3DDIA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with tdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 41
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3ddiA00
4UOFA 3FCVA 2B8QA 4EK2A 3FBEA 1WKKA 2HURA 2VU5A 3B54A 4W98A 3NGTA 5CABA 3BBBA 4WBFA 2AZ1A 4C6AA 3EICA 1ZS6A 3VGVA 3Q86A 3PJ9A 3VGUA 1S57A 1F3FA 1NSQA 3FCWA 4ANCA 3MPDA 4DZ6A 3PRVA 1B99A 1WKLA 4FKXA 5CAAA 3VVTA 3FBCA 3Q8YA 1XQIA 1K44A 1PAEX 2NCKL 3EVOA 1B4SA 2DXEA 1UCNA 3GP9A 3DKDA 3ELHA 1NCLA 3VGTA 3ZTOA 3FBFA 3ZTSA 4KPCA 1JXVA 3Q8VA 3Q8UA 2BX6A 4CP5A 4F4AA 3ZTRA 2DY9A 3Q89A 1F6TA 1S59A 3VVUA 1LEOA 2B8PA 3FC9A 3G2XA 3R9LA 4ANEA 2DXDA 1MN9A 1NHKL 3ETMA 3BBCA 1HIYA 3NGRA 1S5ZA 3EJMA 3EMTA 1PKUA 3EVMA 1U8WA 2HVEA 3JS9A 1NDLA 4UOHA 1NDCA 1NSKL 4S0MA 3NGUA 3GPAA 3ZTQA 3BH7B 2ZUAA 2BEFA 1NLKL 1BE4A 5IOLA 1VYAA 2CWKA 4DI6A 4UOGA 3NGSA 5BXIA 4O0NA 1EHWA 1NUEA 1HLWA 2AZ3A 3EM1A 2HVDA 4DUTA 1HHQA 5C7PA 3ZTPA 4F36A 1NB2A 4ANDA 2DXFA 3ENAA 3B6BA 3WX8A 1MN7A 1BUXA 1NDPA 3L7UA 3FKBA 4ENOA 3EVWA 3DDIA 4FKYA 3EE3A 1KDNA 3BH6B 1W7WA 1WKJA 1LWXA 3BBFA 1BHNA 3VGSA 1XIQA 1NPKA 3FBBA 4HR2A 1NDKA 1NSPA 3Q83A 2DYAA
chains in the Genus database with same CATH superfamily
2GAHC 4GVBA 3KWMA 2F3JA 4PG4A 3UCZP 3G86A 5KFZA 3QT8A 1RBOB 3JAMY 4ICLB 2Z2MA 2OHDA 3CO9A 2ASJA 3T1YF 2R42A 3T5KA 4X4RA 1AA1B 2JEGA 2QA1A 1VK3A 3SFUA 3GFYA 4OI1A 1HNIA 5L1JA 3MI7X 2ZHBA 2XCPA 5L46A 4IH6A 1WEXA 2GIFA 4NOHA 2VBYA 1PJ5A 5IFMA 5I3UA 4RO0A 3RB0A 3GQCA 4KGMA 2DCLA 1H73A 1LW2A 2JOQA 5J1NA 2N3LA 5I3QA 1KTQA 2H4YB 2CWKA 1RT7A 2R7XA 1FJCA 4QWEA 2XMJA 2K1RB 1HL6A 3DLEB 4LF7F 4ZCMA 3QRPA 3AD8C 5B0GA 2EBGA 1PO6A 4X2BA 5AXNA 5D0EA 2VJVA 1B70B 1WACA 3C15B 2AEJA 3FEXB 4QIWD 4F3QA 1KVKA 1QTMA 4UOFA 4AD6A 3M8PB 2ZHAA 4UF4A 3F44A 5L39A 3FRZA 1S1WA 1RDRA 3W2WA 4KIAA 4M5IA 1RBAA 2HRUA 3ZZUA 3J81Y 4M5NA 3KLGA 5K8MA 2GS8A 1VBXA 3M6VA 5LOQA 1TMJA 1B7FA 4M94A 1XNQF 1SIWB 3BGFA 2OSQA 1HNZJ 2KZMA 4G1IA 1RAAB 3L95X 5ETQA 2BR0A 2LXFA 5LSRA 1NH7A 5M2UA 4K8RA 1IBKF 3ULHA 5DO2A 2FUG9 3T1HF 1HI0P 3ILIA 1N32F 4LF2A 2YH0A 5A8RA 1HWIA 4PXDA 1Q95G 4DV0J 2EFGA 2CQ1A 3NP5A 4ZP9A 2LA4A 2NXEA 3M8QB 5F0WA 5HAOA 1VK8A 3M2VB 3D6MB 4QIFA 5A8WB 5A6PA 2ZC4A 2RS8A 1R0AA 2FJAB 1YX2A 4DCPB 1X5TA 3THTA 4HL9A 1XMQJ 2CJQA 3CJTA 1RT1B 1Z2LA 2X1FA 3VALA 2WVEA 4LFAJ 1AB8A 1NO8A 2M52A 4DX7A 2J6TA 3ZTOA 2VONA 4NEYA 3Q8UA 2RDDA 4Y2MA 3TUPA 2A1BA 2DGSA 2C3OA 2V9KA 5EHHA 5KFFA 2DPJA 2JC1A 3PR4A 4F2SA 2BMBA 1I5OB 1OIAA 1GXUA 2OD4A 1JXEA 3L7UA 4USIA 4ECQA 2RF2B 1IQZA 1JLFB 1CBKA 2VFUA 2YXLA 1XNRJ 1U0HA 4OJ3A 5DDRC 3AFGA 1LWEB 4J9NA 2I5JB 2W4CA 2ZOMA 4OJ1A 1HWJA 4E8UA 2HK2A 4DBQA 1VRUB 4DFJA 5KFTA 3TEHB 3W62A 4DX8H 3ZXWA 1U6ZA 2YKQA 2XO6A 2LVWA 2KG0A 1TFWA 5K14A 1QVGR 5HLFB 4BWJA 4EZ6A 2QL5B 3T9NA 2BRKA 5J2NA 1SJFA 4B3TF 1YJ7A 2EBEA 1YBUA 1S12A 1WJ9A 2CQPA 4HT5A 4FNHA 3HJFA 2E5HA 4IUFA 2B4OA 3FCHA 4YP3A 2LQJA 1LK7A 2XBPA 4JI6F 3K57A 5HROB 3RTVA 3KLIB 1RU2A 2E9ZA 2JL9A 3DC2A 3DU6A 3MD1A 4Q44A 5KFVA 2MSTA 1UFKA 1JLCB 1T95A 1SKUB 1KVIA 5J2QA 2QL7B 4NLYA 4ID5A 1U02A 3BSNA 1ZM2A 2V4RA 2HW3A 4JI0J 1CJVB 2DRAA 1UJ4A 3J81j 2HURA 2CG4A 2ZC3A 1TKXB 2NPIA 2RRAA 4U7UD 2M7SA 3HX9A 2P9CA 1IBMF 5HMYA 2K1RA 3IFEA 2BKPA 2OH2A 3A8IA 2F9DA 2DNGA 4JP8A 5E0OA 2DGXA 2MMYA 3W61A 4XPEA 5SZTA 2YNGA 4NA1A 3X3UA 1FRHA 4H4OA 3BSCA 3HK2A 2Y9HA 3N6NA 5AE1A 2DH8A 4PWUA 4IDKB 4USTA 4XIUA 3FUYA 2MKSA 2FJBB 4O3PA 5AXKA 3TX8A 2WB1D 1RQ0A 3L7PA 3IXQA 3W8PA 2OPSA 2GFFA 1FT8A 3IS9A 2VG5B 1XMOJ 5GVQA 1HQEA 1F9EB 2GVZB 5I3PA 5K8NA 2YVSA 1NXIA 3GYNA 2CQBA 1RHQB 5ADZA 3W7BA 2XI3A 2NPFA 2W01A 3WZ0A 1U2CA 1LWXA 1YTYA 5KFOA 1JJ4A 2RDIA 1CJUA 1FWPA 4MIBA 2E5GA 2XTJP 2FJXA 4MIWA 2MJNA 1U0SA 2WBMA 2WCXA 1FJGF 2H3EB 3KMQA 3O1LA 4WK1A 4TKTA 5E3AA 3BGLA 2GQCA 4OYWA 1FEHA 2KO1A 1WF2A 1OWXA 1SH3A 4URSA 3T1YJ 1FKPB 4LSNB 4L6V3 4WFZA 2MQNA 2RRBA 3BV8A 4DHVA 1F6TA 5C42B 3DI6A 4C98A 3RZAA 3EMTA 8AT1B 3MFHA 3JQKA 2ZD1A 1VQ6S 1KSPA 4UW2A 3U27A 3J7YI 2XEXA 2R9LA 1M5SA 1TK0A 2M8DB 5F41A 4KGVB 2E1RA 3O8WA 3MAQA 2HVIA 3CT9A 4X64J 1VIOA 4KB7A 4YR0A 3SQGA 1HBMB 5KG4A 3M8SA 2AYBA 2O67A 1RT2A 2CQIA 3OR2A 5EX3A 3D2WA 2DPIA 4B3OA 3NGTA 3M6UA 1ZS6A 1TFYA 4OYZA 1BWEA 4B3SJ 2EG1A 4DZ6A 2IJFA 2MZRA 4LF1A 1YBAA 2KT5A 4E98A 4PCQA 4JI8F 3TR5A 1TUGB 1RE1B 3UNYA 1FK9B 5LMNF 4DCJB 4DOZA 3CC7S 1SB6A 1PC5A 4F4AA 4F0MA 2F8MA 4PWDB 5GADU 2ZWPA 5GMEA 1SUQB 4PYAA 3VAKA 1TZ0A 4C8LA 1YJNS 3KLHB 4QU7A 3BGOP 1GMUA 3QPIA 1ZAVA 4ECYA 4A47A 1T9WA 3A8KA 1N32J 4TNOA 4I7FB 4NCGA 3WX8A 1PBAA 4RW8B 4I1TA 2HFNA 4WYLA 3MURP 5EN1A 2HFSA 4EMDA 3NXZA 2YX7A 1LFWA 5KFGA 2BXJA 1JLGA 2QSFA 2ZKTA 1NPKA 4Z7YA 2AF6A 2KXHA 2QC3A 3BDPA 3P3DA 2MQMA 2NR0A 2HLTA 1MU2B 1SV5B 3W65A 4W4MA 3EXYA 5HROA 1RWNB 1RCOB 4JI5F 1R3NA 4FVMA 2B3TB 3H2VE 2LECA 2DVIA 1T0TV 4KQZA 1EX8A 3GIMA 1ZM4A 3I5CA 3MGJA 2HQDA 2WONA 2B7BB 3QSIA 1E6VB 4WU2A 3TP2A 3EDRB 3UDEA 1ZZFA 5T7LB 1X9SA 4ZOSA 3NNHA 1YJVA 2HQ3A 2CQHA 1NDLA 4OL8A 3OJSA 1NJIT 2QO3A 2W4DA 3HXMA 1GNKA 2HVDA 4NXMF 3OXFA 4DV5F 2ATCB 3MM6B 3T6BA 1LWCB 4OX8A 1N52B 1T05A 3DM2A 1W7WA 3BBFA 2GV1A 4Z7CA 2PC6A 4IKAA 3C16B 4YB5A 3PXGa 2AU0A 3M1VA 3PRDA 4QWDA 2PE8A 3UW1A 3JSMA 3UVJA 2FLNA 1RLDA 1IKWB 2Y8YA 1QM9A 4PEOA 2ZBIA 2VG5A 1XK8A 1TKZB 1X5SA 2HQCA 4ECWA 2OEMA 4KPCA 1RB0A 4C0HA 3OTDA 1X4CA 1UKUA 3DHXA 2FC8A 2BOPA 2ZH5A 4B3TJ 3FC9A 3BS9A 1G4CA 1VQ8S 1JLEA 2R7QA 4G1PA 2IMOA 3TWZA 4BC7A 4RNHA 4UOGA 4O3SA 2VPZB 3NCQA 4JV2A 4X66F 1HHQA 3SYZA 5DDPC 4FF1A 4EGLA 1MMNA 1QUPA 3GJTB 2V8HA 2V9WA 3PX4A 1GXTA 3DGPB 1EB0A 2ZNZA 3TVYA 4BS2A 4BCAA 3IBCB 5CHCB 2W2PP 2Y1JA 1IR1A 4NLUA 2D1CA 4YDXA 3B54A 4F8RA 2AWZA 4WE1B 2MZ1A 1KLMA 1RT5A 5JJBA 4UOCA 1N5SA 3A4TA 3KLVA 2BZ2A 2KT2A 4YB7A 1S99A 4A8XA 3LP1A 1ELOA 3US5A 2XM3A 1UETA 4K59A 2J7WA 2YWFA 4K2XA 3QFHA 3AQPA 5D0RA 3T3FA 2VODA 4USMA 5LSLA 3P8BB 4ZITA 3AOCA 4ETXA 2R4FA 2WHOA 3PYGA 3M30A 4NLGA 3AB2B 1DLOA 1TL5A 1F5BA 4LR7A 4OX6A 1BQNA 3UDVA 5CH7B 5HQMA 4Y2AA 1JLBB 1N6QA 1CS4A 1RTIB 1RSCA 2HK3A 3RU0A 4K0KF 4N47A 3FKBA 3SCKE 2QLBB 2AX1A 2DISA 2PSZA 4EU0A 1G2EA 1S1TA 5E3PA 4JUZA 4WYWA 3I4HX 2F8HA 5GAGI 4KKOA 5FDLB 4UUWA 3ZZZA 4OHZA 1SUQA 2G2ZA 4LFBF 1IKXA 3ZNJ1 2ZZNA 4WKYA 5DQIA 3J80U 2MTLA 1FJGJ 1S0VA 3I31A 2R7VA 4KSEB 1B4SA 2EI5A 3MECB 1DHMA 1NBEB 1CG2A 1SXLA 4GKJF 1HR0J 2R8GA 3M8RA 1ZH5A 2JSXA 4C8MA 2U1AA 4F7VA 1SL1A 2OD6A 1S0MA 1P1TA 4A48A 3QT7A 4PUOA 1FFSB 3LP2A 4C8KA 2QA2A 3V4IA 3NG8A 3CCSS 3LAKA 1DARA 2KT3A 2B6AA 1Q79A 1CEZA 2BE9B 1GMVA 2DK2A 2VKZG 5G0RB 3OXLA 1WC3A 1HMVB 2QSWA 4K50A 4Y6IA 3ONQA 5T7LA 3Q8QB 2FB0A 2AJ1A 1VJWA 3BBBA 2H1YA 1RKIA 4N5SA 5DG8A 2F1FA 3IP0A 2KYXA 4NWBA 3H4DA 4MFBA 4DMZA 1XR6A 3OFHA 4LQ9A 1X0FA 3ELHA 4KRWA 3IR7B 4FBTA 4ZHRA 5HSPA 1X5OA 9ATCB 1VQSA 5DJBA 5J2PA 4KHPJ 1S59A 2DEJA 2ABYA 5LT5A 2DIVA 3G2XA 1VLOA 1NHKL 2BKNA 1IR0A 2JJ4D 1Q82T 2FZKB 2EKYA 3C16A 3JAMU 2LXUA 1S79A 1Y5LB 2HFUA 2MKCA 4QYZK 1RT6A 2ADBA 2KXNB 3MM7A 2XS7A 1TV6A 3N0VA 4HDGA 3L3CA 2OI2A 3EGZA 3QGHA 1X60A 1EARA 3NMRA 2KI2A 3OLBA 1SC3B 1HYSB 3GV7B 2KFZA 4CLUA 2R7RA 4A8KA 1WWHA 2RVJA 4O4GA 2IFXA 1RI7A 2XWXA 2BJ8A 2KVQE 3L7OA 2UXBF 3PHTA 3VGUA 3QJJA 1S57A 2X3DA 2G0IA 2WVFA 3DXSX 3QYYA 3PDNA 2FPHX 1RWPB 5L38A 1UCNA 2QMXA 1PG5B 2VKRA 3R5CA 3G4SS 1S0OA 3ZTSA 4OZ0A 1TKTB 1NHUA 5SUHA 1DQ8A 3A3OB 3FMWA 1LK5A 2VQEF 4PKDB 3PYDA 1VC5A 3GSIA 2LEAA 1TL3B 4NYZA 3GSDA 3VQSA 2QE5A 1OSCA 3DLBA 5IOLA 3UN5A 2FGCA 2JC0A 1D0EA 4FN5A 3A13A 3J81U 5C7PA 2PN6A 1NK8A 1U1OA 4DL2A 3MM9A 1ZTTA 2NXJA 4WXWA 5C5JA 2GAGC 3JTOA 3VF0B 1APSA 3EE3A 4ETZA 4DU7A 2Y1RI 3GG1A 1AYEA 2EFVA 2OMOA 4V1Ak 4G6VB 1Z2ZA 2YNFB 2RD5C 1J5OA 2AGOA 2CZ4A 2OGUA 1S9GA 3NS6A 4GMKA 1Y5IB 3T5JA 1F9FA 2RKIB 1DBDA 3KG1A 2YY3A 2WVDA 5ETVA 2W2OP 4NX9A 4WIQA 5GAEU 5FLXY 4RNFA 5K8OA 1LV5A 1K1QA 1Q7YT 2V4QA 3CCWA 2FD2A 3PG9A 4AQYJ 1K73T 3K17A 3DGVA 1KN6A 3Q24A 5KFMA 3TJ9A 4QW9A 4P75A 2VICA 4RKUC 1DFDA 1GTEA 1FDAA 1ZA2B 2CIMA 5B0BA 3NOCA 2V69A 3KUGA 2KL8A 1FRXA 3I9ZA 4K4XA 5A8KA 4WIIA 1MLAA 5M2PA 5KG0A 3ISZA 3MDFA 3CC2S 3W60A 4YFUA 3DRPB 1R8HA 2ERRA 1WI8A 3KLEA 1HNXF 4CM2A 2YBVA 4ELVA 4EK2A 3LTOA 4NLQA 2XC9A 1H6KX 2V4JA 4U8VA 2J0XA 4P71A 1NNDA 4ANCA 2LYVA 1B99A 1N33F 3RBXA 1N36F 3DOLA 2J5AA 4DR5F 4FPIA 4I6YA 1UVMA 3Q8VA 1SJQA 5B0CA 2AGQA 2OPRA 1DURA 4HT7A 3NGRA 3A1YG 2R2RA 3H20A 4F4XA 1NSKL 2JRSA 3OD2A 3SV4A 1C1CA 1FNMA 2Q6BA 5E5NA 5BXIA 4Q8FA 2RAQA 1HFEL 4K4YA 5A2QU 2IHR1 4IFYB 2YKNB 5HANA 2M70A 1S0NA 2AT1B 2NYIA 2RILA 1HNVB 4K0KJ 4P2XA 3VAGA 2VDHA 3CCUS 5M2RA 4QZVB 1P1LA 2W9BB 2PMWA 4DSIA 4RL1A 5IT0A 3POTA 4J91A 4C97A 4B9TA 3FSYA 2WRMA 2ZBCA 3KNAA 3Q8RB 3FQKA 4OLOA 4F3MA 1NSQA 1JXLA 2VG7A 5LM7E 5H9EJ 2DH9A 1K0VA 5J1EB 2I8EA 4RW4A 2LEBA 1NCLA 3IM9A 4FYWB 1HYSA 2HWTA 1HBOA 1VHFA 1RYSA 1EETB 3U02A 5L9XA 1SJ1A 4RUAA 4DLGA 1FRLA 1UA0A 4GKJJ 3TANA 5IT9Y 4DR2J 2RB7A 3FDSA 2RHSB 2KZZA 2BEFA 3TEGA 4ID8A 2XMWA 1JJ2R 2G2OA 4LFCJ 3K5NA 2J9DA 1HARA 1GTHA 2G1DA 5KFIA 2CJAA 3H90A 2LLZA 1JWWA 2YKMB 1R31A 1S6PA 1FEEA 3CSKA 4LF8J 1T11A 3FEZA 4M95A 5CA5A 5H9EK 4MJKA 2HFOA 3CJSA 3N5FA 1CQNA 2PGCA 1TAQA 4OZ3A 1FX2A 3FQLA 1HBNB 1VGYA 4QIVA 4KGXB 1TL3A 2KM8B 1S97A 1FXLA 4P10A 5CYQA 2C2RA 3MTJA 4H4KC 4IO1A 5KTQA 2XLIA 3PRVA 2L9NA 2DO0A 4DDFA 2B56A 4RW6B 1IN0A 1IJEB 3NNAA 3SI8A 2WSCC 4C8NA 3GV5B 1WDDA 3HULA 3F73A 2XI2A 4DSEA 5ETOA 2CAJA 1F3VA 5KFLA 4DV6J 5JMNA 1X31C 4KFBA 2C22A 2F4VF 2DGWA 2R3VA 4ECTA 2PA8D 1LXJA 2ZDOA 3QBCA 3CCZA 3CD6S 3V81B 2UUCJ 4EYIB 3PCOB 3KK3A 4RUBA 4RWXA 4F0HA 2FY8A 3GTYX 4ES3A 3O44A 4ZPCA 3WX4A 4DV2J 2RSQA 2N4CA 3M05A 1VC6A 4ZS6A 4DU8A 2BJ9A 5KT6A 1IJFB 2NS1B 2W2MP 3OFEA 4OHXA 2LP4A 5HP1A 1RAIB 1DZ5A 3G8QA 4QQBA 4HLBA 3QAEA 4RLEA 2FQQB 3CJ4A 4ZVTB 1SL2A 3O6QA 4DG1B 1T03A 4IRCA 1MG7A 2W24A 1U1RA 2YWHA 5F8HA 4CRJA 2H48B 5JVHQ 2CPDA 2UXBJ 3D0GE 1WD6A 4IFVB 1K44A 1HQ2A 2HHQA 2DNHA 4DF8A 1FD8A 1T94A 3MPVA 2WB4A 3EZOA 4J9KA 2AD9A 1HD0A 4NLVA 1L3KA 2E7XA 5CQGA 2HS3A 2BX6A 2MZQA 4O23A 4DL3A 5D6GA 1NPPA 4H4KA 3NWGA 3M6XA 4ED4A 1I51B 4LF6J 3DU5A 3PKMA 2VQEJ 3NBPB 1VQOS 5DDOC 2BOAA 3PYFA 3D28A 1S4FA 1K9MT 2W4PA 3T5LA 1RAGB 2CADA 2MZJA 1LW0A 3CDBA 3G8SA 4JI4J 2PFDA 3LWMA 1V5IB 4MKAA 3PX6A 2E1AA 3WIVA 1BHNA 1F5CA 3SDEB 5KFBA 2HNDB 4HR2A 3IRWP 1FRIA 4HACA 3X1LB 2YKOA 4R8UA 2G13A 3UCGA 2Y0BB 4TLRA 3CC4S 3MPDA 2B9XA 5HL7Q 1U48A 2AKWB 4YHHF 3GIIA 1VBKA 3K5MA 3CJKB 3D6FB 2DCUB 1D3WA 1RWVB 5LL6d 3TJAA 1LFPA 5B7WA 2OPPA 2KM8C 3K5OA 4ZVSB 2YKNA 4F50A 3KHGA 4ECZA 1SCJB 3M32B 2Z2LA 5FIIA 2IC3B 5F8IA 2VIHA 4ECRA 3BR8A 1CPZA 1TAUA 3MD3A 3KK1B 3PZPA 5EWGA 3MMJA 2ILZA 3L9ZA 3MMCB 1N0UA 1YK9A 3E01B 4AE5A 3P49B 1Y3JA 2COLA 5KFKA 4DSFA 3DLJA 3BJYA 1L3UA 3IO1A 3OL8A 4LRBA 2V67A 3FCVA 1FWLA 1WKKA 2N3OA 2H9ZA 3PHEA 3Q2TC 1SQEA 3HMJG 2MZSA 4KHRA 4HH0A 4KO0A 1UPPA 3SQOP 1X7VA 3FSIA 3C6TA 2NUHA 4X4TA 3SCLE 4QIGA 4C3LA 4U7UK 1IKVB 1N5YA 1RA6A 3JSYA 4LBPA 4DR5J 4CO2A 1PBUA 4DV1F 5ETLA 1UWBB 1HHSA 3OJUA 5BJRA 2MB0B 2HBZB 1HBNA 3OHAA 3HHLB 1NLKL 1HWUA 2QN6B 3AD7C 2D69A 3QGPA 1NUEA 2BJEA 2E7WA 4C0BA 5K20B 2CPFA 1LQ9A 4P2FA 4GKKF 5J2MA 4KH0B 2DITA 1VDHA 1C0UA 1UVIA 5DETA 2OAUA 1TL7A 2IM3A 4IG0A 3IAS9 1DTQA 2MHEA 1OPZA 1T3NA 1SH2A 3MCMA 3G6VA 4DR7F 2F7VA 2KHDA 4ELUA 3VAFA 4Y3CA 2D3O1 4RW7B 3HZEA 2ZUGA 2NREA 5AJ3F 2BQ3A 4JV5J 2FYXA 3DCAA 3V6KA 1PYOB 3W9IA 2CDRB 2HS4A 1T3OA 4I64A 5IM0A 2QEXS 4R5PB 2DH7A 3CD7A 4MTPA 4QIEA 1N0VC 2CNKB 2D3ZA 1SKSA 1QVFR 4DR4F 1TP7A 2XS2A 3W2VB 2DR9A 5IV4A 1VQYA 1DAXA 3UI3A 1W2BR 2XS5A 2QT7A 3CIZA 3M9NB 3NKYA 2UVUA 2XMMA 2JFDA 2H65B 1OYDA 2ZUAA 4I6WA 2D3UA 3BM7A 1NK7A 2RE1A 1LNQA 2UU9F 2PI4A 1HLWA 2IA6A 4ZVRB 4PQAA 2A3JA 4JI2F 4ZVQB 5HBMA 3Q22A 5JVGQ 4F3OA 3HHKA 4IFVA 5KFPA 4OHVA 1B0VA 3K89A 1JLQB 3N01A 1U1MA 1RWUA 3MEDB 3C6UB 1CC8A 5KOXA 2GX8A 4NLRA 3JYTB 4LF9F 5ETTA 3D3CJ 2OPQB 1GMWA 1RWOB 1QSSA 3PKYA 3G82B 2B8QA 2B9YA 2VUGA 3D7SB 4CLWA 2GO9A 4QW8A 4G1QA 1ZBTA 4ZN3A 1CQMA 4I2PB 3VGVA 2HZAA 1TUVA 4L76A 1HQUA 5D4OA 1GAOA 2CZVC 4EBCA 3V6HA 1T9VA 1FKOB 2VG6B 3VAHA 1FHTA 1WG5A 4PR6A 3RGIA 2MXYA 3D1HA 3UR3C 4UUXA 2EEYA 4XDDA 3IAM9 2NSCA 2JVRA 2F4FA 5RUBA 1IKYB 1TVRA 3SDEA 1LWFA 2HNDA 3MAAA 4TY8A 3D6TB 4OLPA 1AROP 1P8GA 4NLDA 4ZVHA 2FHJD 2EFOA 4DV7F 1AZSA 3RUBL 1X4GA 3NY0A 4NRUA 4WP9A 1V3RA 2ZE2A 1XTZA 1UZHA 3QATA 4B9MA 3HHLC 4ZVFA 1UVKA 2CG8A 5C2CA 5KT3A 5GMDA 1F60B 4BWMA 3RBZA 2AP6A 1WHXA 3R1HA 2VFVA 1ZPVA 2Y0SD 1F2HA 3BB5A 4LBIA 1RT4B 1ULRA 3HSGA 3GFXA 4F26A 4W98A 1H7WA 3CE8A 1RHRB 4CI0B 3CJRA 3UN3A 3ET6A 4WFYA 2HGLA 1A0OB 3D5MA 1S1XA 4Q45A 4Y28C 1RTHA 3HKWA 4DV4F 4M5HA 2RH3A 1EKSA 2R8IA 1RWWB 2J9CA 3VVUA 4JYAF 2VC1A 1QD1A 4AFFA 2GGPB 1T9YA 2HG4A 4PXEA 2WSEC 4OI4A 2XSJA 3DHWC 4RBVA 1VQLS 3SCJE 5KG2A 2K8GA 2J9EA 3HHDA 1MROB 2VD3A 1JLAB 1WI6A 1DTTB 4C4WA 3GONA 3EM1A 3U7JA 2K2PA 5I4MA 4YB6A 3OPKA 4OZ5A 3NNCA 2ZEJA 1GT8A 5A0YA 4X4QA 2YTCA 1BUXA 1NK6A 4X84A 3QLHB 5HN0A 4WZQA 3TVZA 2ACYA 2UXCF 2CQGA 3OT9A 1DRZA 4ATNA 2L41A 3I0RA 1YSJA 4RW9A 1ROFA 2QMWA 5F8NA 1RTDA 3ITHB 1LOUA 4YN3B 2HNYB 4X62F 4QWCA 2PIIA 2MQLA 5ETMA 3D67A 3HHLA 2D74B 3TAMB 3AA8A 2YNHA 3RB3A 1X9MA 4GVBB 3IGNA 1NK4A 4D3GA 1EIYB 3VVTA 2R7UA 1HBUA 2EG2A 2OKQA 4OQJA 2E5LF 3NWRA 4YHHJ 3VGTA 2HIQA 1FDNA 3AA9A 2HHPA 1XERA 2BUNA 4J9RA 1EJ7L 3S1TA 5HVGA 2B5JA 4HHJA 2VPXB 2QLJB 4MT1A 3ETMA 4K4UA 1GH8A 2HQFA 1KHWA 3ZZOA 1HNIB 4FYVB 4ECXA 1O8BA 2R7SA 2HBQB 2DHXA 3HHEA 4DR6J 3NLCA 1RAFB 2DNMA 3IRXA 1JK9B 5I3UB 2UZAA 4JI7F 1NHVA 2R2UA 2F9JA 3TNVA 2YPZA 2V2KA 2IBKA 1U1NA 4FKYA 3QGIA 4WU3A 2FJVA 1ZM3A 1RT7B 2CPEA 2HBRB 2GIQA 4ZLJA 2EK1A 2NSBA 1Y0HA 2ZJRQ 2XGPA 1GK8A 1KFSA 4CLLA 4Z37A 4J7CA 4A8OA 5C25A 3OLAA 2HHWA 4LVNP 2V34A 2FC9A 4ZVUB 5KG5A 2XMUA 1VCTA 2BQRA 1FCAA 3D3BJ 4ZVPB 4WJBA 4CLPA 4OYXA 4K4TA 1HD1A 1YJUA 3QWUA 1S1WB 2BJ3A 3H98A 2H5JB 2K7JA 3LOUA 4NLOA 2ZBPA 5CD4H 3MMAB 4R0JA 2XHCA 3MEDA 3WQPA 3KLGB 2W9AA 2AW0A 3JYTA 2Y3YA 2V0NA 3G82A 3HLUA 4WP3A 3VWSA 3M8YA 2QFIA 4DR1F 4DV1J 2Y8WA 1X4FA 1S6QA 3AQOA 2OFGX 2KRRA 3LGHA 3CF5Q 4I69A 3CXCR 5IV3A 5FLXU 2IAJA 1BXNA 3BEGB 1PIEA 2VG6A 2V2VA 4NE9C 1RTJA 1VIXA 2YQ1A 3RB6A 4GKKJ 4LQ3A 2AV5A 5E3RA 4USVA 3MWBA 5A8RB 4FVCA 5EUHA 2Z30B 2N4DA 5GADI 1NKBA 3W1YC 3FGVA 3LA0A 1R0BG 2B7CB 1K8AT 4WBFA 4U95A 1U1LA 1WOOA 3I56S 3V5RA 5F3TA 1SI9A 2W7AA 4DR7J 4J9LA 3MOZA 4C3MA 2M2BA 3EVOA 1R0AB 2MLYA 2O01C 2C42A 2MDAA 3UD4P 4N8OA 7FDRA 1M5PC 4RUHA 2MKJA 1S9EB 4DR4J 2QL9B 3KMSA 1VI7A 2D9OA 3IBFB 3SIPB 1FFGB 3W5XA 3CW2C 2D9PA 5ETSA 2ATLA 2UUBF 2HNZA 1R7IA 5DQGA 2UUTA 3E2EA 3AHPA 3OR1A 2UU9J 1M1GA 4JI2J 1XBWA 1RT3A 1UVJA 2GVDA 1AUDA 2QIFA 3AT1B 1KDNA 2Q3PA 4LF5F 4KY3A 4WP8A 1ZETA 3ILOA 4O4RA 4NCBA 3B4DA 2VQFJ 1J5EJ 1JNZB 2ILYA 3BKTA 4OZ1A 4K2JA 3N6MA 1U0HB 3C3LA 4WFXA 2CA9A 4CLTA 2LQ5A 4DPWA 1REVA 3H2LA 1QAXA 3SCIE 4IOCQ 3BSOA 3F41A 1PYSB 1YZ7A 2CFXA 1EP4A 3MMBB 1D1UA 1H2TZ 5DG7A 2UXDF 1FVQA 1T8EA 4IOAQ 5K14B 1P9YA 4F04B 2C2MB 3PW7A 2MQ8A 4CTAA 3NGUA 1T7PA 4OYOA 2ZZMA 2HGMA 4X65J 2AJ2A 3IBWA 1B7YB 4ZPTR 4IRKA 1IUJA 3OL6A 1OQ3A 1CJKA 3K7RA 4WWSA 5IT4A 4USJC 1JJHA 2LQBA 1C0TA 4DV7J 2ZHOA 5AE2A 1HNWF 1WORA 5LMUF 2AQ4A 2AJFE 1NDPA 2WBRA 3LH2S 3PM9A 3GILA 3CCMS 2CPXA 4ED0A 1KRPA 4KPYA 5IT9U 2R8JA 5J2QB 2CJKA 6AT1B 3H59A 4ID5B 3K2YA 2RU3A 3KJNB 4URQU 1VS3A 5FD1A 1RAOA 1WKLA 1WHVA 2GA7A 1HI1A 4CH0S 3CO0P 4JI3F 1S6UA 1GX5A 1FD2A 3DKDA 4ED8A 3CDAA 4B3RJ 5D77A 2OP5A 3CJ8A 2DY9A 1FWKA 4IH7A 4I68A 4ILMA 1HW9A 5KFUA 3L09A 3DLGB 1CJTA 5H9FJ 1MWZA 2YNGB 3CCVS 2XSFA 4LRAA 4H4OB 4OV1A 2F5GA 5KT7A 1C1BA 1PILA 2L3MA 4KC5A 4OZNA 3E8OA 3U1MA 4HH1A 3WDOA 8ATCB 3HM9A 2MKYA 4DUYJ 2KU7A 2ZWOA 1SKRA 3KHLA 2OPSB 3MUTP 3IS9B 3CIMA 2P9GA 1Q4RA 1NJXA 2UXCJ 2G0CA 1HQEB 2BABA 3MMAA 1SC1B 5DLFA 3TRGA 1Y3KA 4W90B 2HRTA 4HTJA 2XYHB 2FGOA 1CJUB 1S7IA 2MY7A 1Q16B 4WTOB 3ZZRA 4DF4A 2X51A 4X62J 3TW0A 1HW8A 4M5GA 4Y0FA 2W25A 3RJMB 3R2CJ 4CH1A 2E5LJ 1Z1ZA 1FESA 5E41A 3HHLD 4IG3A 1O6XA 2ZVIA 1W25A 3RRGA 4P7VA 4WTYA 2E66A 1Q8LA 2D7SA 1IQTA 2VPYB 3HSDA 3HDSA 3IM8A 4J9UE 1TKDA 3CCES 4EO8A 2Q43A 3KOAA 2JFKA 4OX9F 2WAQD 3DI6B 4G65A 4ZP6A 1N54B 3VTIA 2UUAJ 2ZD1B 1U6BA 2LDYA 1ZAWA 4TLQA 5LJ3Y 3HCXA 1TR0A 4JI7J 1QUVA 2RUGA 3GZ7A 3FBBA 2Z58B 1UEVA 3SQGB 3DOMA 2K06A 1BQXA 1YLXA 1S9EA 3FVYA 2BKOA 5T41A 1V9OA 3G9CA 1P27B 4PG6A 3N6LA 1RT2B 2LU2A 3OR2B 2BW7A 3E3XA 2H51B 3MF5A 3P96A 2FLLA 4FS1A 2HMIA 4DZDA 4QU6A 4B3OB 3JSBA 4FP9A 1M0SA 3OVSA 5CZVA 1HPZA 1SIZA 3QFWA 1IBLJ 5KFWA 4F4KA 3PJXA 4ALZA 2QJ3A 4DL0C 2KYZA 3H5YA 4TY9A 1V3SA 1TL1A 1QSYA 2IVYA 1Q86T 3AY0A 2XMKA 5F8GA 3THVA 3CDEA 1XC9A 3VZIA 4DR1J 2ZH3A 2HBYB 3Q2SC 3ISNC 1U45A 3P4UB 2HAIA 3PW5A 4HTIA 1WC4A 2HWIA 2CQDA 3MMBA 3OTEA 3NS7B 1WKJA 4XPCA 2XQCA 3T6JA 3M2UA 4NCGB 3C8YA 3DLKA 2MEWA 3CMQA 1JLGB 3GYGA 3AJDA 3FBCA 4B02A 4DUZJ 2B43A 2WK4A 3IG1A 2J8SA 3TARA 3HPOA 3PIPQ 3T5HA 1UA1A 1I1GA 4ECSA 2VV5A 3GCWP 1EZZB 5AT1B 5HMXA 3MEGA 5F0UA 3FJ2A 1I94J 3MR3A 1RTZA 2JNJA 2WONB 3KK2A 1WTFA 2ZH7A 3V6DB 4RR5A 2W7OA 4DQIA 2EC2A 2MY8A 1RCXB 1S7HA 7AT1B 4Q2LA 3R5BA 1KQKA 2XCAA 4X4NA 3TUIC 2WW8A 3OUYA 3LF0A 1U1PA 4MKVA 4K4VA 1FDBA 4NLPA 4ED7A 4DL7A 4OZLA 2PA3A 4AL6A 3VAMA 1NSPA 4LIRA 2MKKA 3GWCA 1X4DA 4LF5J 4ZPVR 1SC4B 3DLGA 2G4BA 1TUWA 4C6AA 3J7A1 1T05B 3DM2B 3OVAA 1T9UA 2DGOA 1N34F 2Q1LA 4OMFG 4MYTA 4ZJLA 1YHQS 3M1VB 3JSMB 4CH7A 3UVJB 2M5YA 4LMZA 2KHCA 3NCRA 4LIWA 3R5AA 2GCFA 4KAIA 4Q5VA 3QQCD 4GVLA 1QAJA 2UXDJ 5IWAF 3NCPA 2JWNA 4FZVA 4Q43A 2CQ2A 5B0DA 2HHSA 3I82A 3UD3P 3QRQA 3CJ2A 3PFEA 3MM5A 2ZNYA 2B4UA 1JLEB 1L5UA 3ENAA 5HO4A 5KFAA 4BC9A 5GAEI 3DOKA 3IWNC 3EGVA 3HFKA 1WDTA 4CWBA 1VC0A 4EO6A 3BPSP 5DZ6A 4B9VA 4RU9A 2PD1A 2HAFA 3GMGA 2W8KA 3ZZPA 3JXOA 4J9PA 4KBIA 1D09B 1WC1A 2PMHA 4RWWA 2NXNA 3BPDA 3BREA 4ZPBA 4B08A 4TVAB 4EEYA 2F40A 1Q7LB 3KTQA 1FF2A 4FXWA 1KLMB 1RT5B 4CO3A 4H54A 3U1NA 2J6SA 4ZIWA 2DNPA 2BA9A 3H40A 1QE1A 1HHTP 5DLGA 1B64A 2HPUA 4AXJA 3LP1B 3QJPA 2LCWA 4DPYA 4E2FB 4RUCA 3TAQA 4LF7J 3ZTQA 1XJWB 1YRTA 1U47A 3HT0A 4DLEA 2DT9A 3GYXB 3EZUA 4ED3A 3M30B 4OYMA 3B6BA 1DLOB 5GMKa 1BQNB 2NLWA 1N6QB 1N4LA 1NMEB 1CS4B 2ZKUA 4J90A 2I6WA 3P6YC 5D0HA 3KDOA 3SSRA 5GAHU 3DRRA 2QX0A 4I2QA 4NI2A 1FDDA 2ZH2A 4A8SA 1S1TB 1AT1B 2AYEA 3UFCX 1M90T 1KWMA 2MLXA 4IQMA 3HVTA 4Q2MA 4PZVA 4FKXA 4KKOB 1XNQJ 4PPZA 2L48A 1IKXB 4PABA 4I4BA 5KFRA 4UT4A 3AJ1A 1IBKJ 5KT2A 1GQEA 4ZN1A 2ZVSA 3T1HJ 2J0SD 2I0XA 1T9TA 4MKBA 2L9WA 1HNZF 4DL6A 3TA2A 3UN2A 3GFZA 1LXNA 3M6WA 2YX4A 2HHHF 5D3GA 3ENVA 3PY8A 2R2TA 4OX9J 3M2RA 3EDQB 2OLWA 2VL1A 3D1OA 4PUOB 3FFIA 3BH6B 3FZBA 2GIRA 3LP2B 3K58A 4DV0F 1IXKA 3V4IB 3BN4A 3H8YA 5CCMA 4Z2XA 5IZHA 2B6AB 3DRSA 2L08A 2YWWA 1RAHB 2QA4S 4QPXA 3EICA 4KGKA 4NZ7A 4F25A 4K5RA 3V6DA 2CQ4A 2DNOA 4RU2A 4ZVEA 5E33A 3R5GA 5B0EA 4F4WA 2OUGA 4CT9A 2BM0A 4ZK7M 2V8VA 4O3RA 5L8RC 1XMQF 3HSJA 2C2NA 4DSJA 3DRXA 2XY6A 2DO4A 4C11A 3MM8A 3O3LA 4MFBB 2XULA 3LW5C 4ZHRB 1U7LA 2K3IA 5J2PB 2DD8S 4XTTA 4WK3A 4YS2A 4OX7A 5F8MA 1S77D 1M1HA 4P72A 1SJ3P 1VFJA 4DSKA 1RT6B 2VC0A 2CNOB 3MM7B 1YI2S 1TV6B 3NS5A 3I96A 4J9MA 2HYIB 4OZJA 2IBOA 3AOBA 1XNRF 2ZH8A 5EDWA 2R2SA 1WF0A 4RX6A 2K7KA 2LXIA 2VFTA 1VMBA 4O4GB 4WXOA 5AE3A 3CD0A 4NXNF 3V6JA 1S1UB 3B82A 4N77A 2DHAA 1UVLA 2RT3A 2WOMA 2LA6A 4RPFA 3I0SA 4JI6J 3C66A 1MWQA 5MAOA 3ETOA 3VAIA 4C3KA 1U24A 3EVMA 1QLNA 3IWLA 1KKHA 3CJ3A 3OTOF 3W64A 2E29A 1FVSA 4RNOA 1MW7A 4P2SA 3KHHA 5IQQA 1NJWA 3N79A 4K5SA 4KV8B 1CULA 4CT8A 2DIUA 4M5DA 1RUSA 4URGA 3KJVA 3ILLA 1G7CB 2XWYA 4M5MA 4DFMA 4DWIA 1WG4A 4C7QA 1D8YA 3BQ2A 4M5LA 4ERDA 2IIHA 3TAPA 3R27A 2ASLA 3MM9B 4O3NA 1WG1A 1KTVA 2E1PA 1IBMJ 3CGIA 3BN7A 4JI0F 2CUYA 1FKAF 3SMZA 4OI3A 5CAAA 4QR0A 3AXKA 1J5OB 3W9JA 4USKA 1S9GB 3B8HA 5IC6B 1Q8KA 2GHWA 1W26A 3IR5B 3TUZC 1VBZA 2DHGA 3AXMA 4IR1A 3KG0A 1M5KC 3KJQB 3HI9A 4E0DA 5A6WA 2ALZA 5IWAJ 1VLYA 2YWKA 3MXHP 2CWXA 3HO1A 2HHTA 3MCNA 2FJEB 4FS2A 3A8EA 3HJVA 1VQ4S 2HZCA 5CYMB 4ZJOA 1S76D 3CMES 2VFSA 3SZ2A 2WTFA 1XMOF 3D66A 2DNLA 2QYGA 1L3VA 5A8KB 3W5ZA 3DYAA 1M5OC 4CO5A 3QNWB 1TU0B 2LU1A 2P5VA 2IJRA 5LJ5Y 5A76A 3GJQB 2BE7D 3KLEB 4EBDA 1S1VA 1H2VZ 2CQ3A 4LSLA 3TYTA 4B9UA 9RUBA 2QYCA 3SFGA 1RK8A 1K0TA 4CDIA 1BY9A 2XMAA 2V4JB 3PW2A 1BLUA 1XMBA 5KFHA 3PW0A 4I67A 2AHOB 2IPOB 1FRMA 1A6LA 1M1KT 3NEKA 5KFDA 3DOLB 1X4EA 2DRDA 1QJHA 3JSRA 4JBCA 3PO4A 4UQGA 2JEJA 3G6ES 3HZGA 4N56A 4DX5A 2HEKA 2OPRB 4O0NA 2F63A 4N76A 2NYHA 1K47A 1SC6A 2DY1A 4V19J 1S6OA 2PEHA 2CNNB 3QRRA 1SH0A 1C1CB 1RISA 4ZJQA 2GJIA 1RADB 2BJ7A 3CD5A 5L1IA 3DMJA 4YEAA 2MKIA 4X64F 3QT5A 2I1RA 1Q5VA 1XIQA 3F56A 1R89A 3MPYA 1RXOB 3GJRB 3PTWA 2KJWA 1MMLA 4QPTA 2VFRA 3G87A 4GO7X 2LEPA 3I5AA 4JI8J 3BKUA 3ICLA 2IVMA 4PRFA 5LMNJ 3TOQA 2RJZA 2IM2A 3UR0A 2A2DA 2AX0A 3POTB 4CLZA 1D9AA 3BSAA 4B3SF 3B4MA 2YWEA 2VG7B 2YKAA 3T9ZA 5LXYA 2RQCA 1E6YA 2RRNA 4L3NA 2MGZA 5BYSA 4RBTA 2IDEA 4RW4B 1YITS 4WFBQ 1T9XA 1RBLA 2FHKA 3QGGA 1HBOB 1N5TA 3GCXP 3BYPA 2J0WA 1LKZA 1UL3A 3BO2A 2AJ0A 3PW4A 4QCLA 2HHHJ 3R8YA 3WHIA 1S1UA 5D4NA 4JV0A 3RAMA 2MZTA 4USUA 3UWTA 3P5BP 4ILRA 3CJ0A 3GLJA 3G6YA 4C8ZA 2HVHA 1VRTA 1IR2A 2JVOA 4ZDNA 1ZYQA 5U47A 2DR7A 4PQUA 3C19A 5D4LA 4O44B 5C24A 3IR6B 1S6PB 2RDJA 4JI5J 1B3TA 2YPYA 1JJCB 1RHMB 4QJVA 2MKHA 5I42A 2KH9A 4QOTA 3D0HE 4KV8A 3Q8YA 4PYDA 3QIPA 2IDLA 5CYQB 2AYGA 1SQGA 4FXDA 2HVZA 2GMHA 1MWYA 4TU8A 3PACA 3LPEA 3UE2A 2XYGB 4HI1A 4LREA 2ZH4A 2V2ZA 3Q0AA 2J9DE 2IY5B 2VOOA 4FNIA 3JS9A 4MMOA 4QWBA 4NXMJ 3EZ5A 1L3SA 4DV5J 2MPUA 2UVVA 2ZJQQ 1YRXA 4YMEA 4KFBB 2CRLA 1U1KA 5KFNA 4CLYA 2V8DA 3EPIA 1NB2A 4A46A 1FFWB 3KK3B 3N5BA 4KGZB 1KVJA 1RJJA 2QG9B 3IA0A 1KC8T 3MCOA 4A4JA 1JKHB 2X1BA 2ASDA 1VQ9S 1U1QA 2ROEA 1O5JA 3DNCA 1OY6A 3CJQA 3Q83A 4CIOA 4DR3F 3JB9k 5LSOA 5HP1B 3R1LA 3CUNA 2HHXA 1BC6A 2DNYA 4LF4F 3IWXA 1B0PA 2WZ1A 2IJNA 1RWKB 4ZP7A 2GMJA 2D41A 3RRKA 2FZCB 4YR3A 1T03B 1PC4A 3HP6A 2GHPA 4NXNJ 4DS4A 5CYMA 5E3CA 4ZP8A 2K3KA 2W9CB 1RHJB 2IM1A 3MR6A 4N41A 4C0OC 3DXBA 2Z56B 1FERA 2GHVC 1PKUA 2E9TA 4OHYA 4QYRA 3HFZB 4X66J 3J7AN 2IYIA 5A2QY 2N82B 4H4MB 4Q0BA 3OTOJ 2BE2A 5D8HB 1RP5A 4C9DA 2M9KA 5ETRA 4RNMA 4M5JA 5J1PA 1OY8A 2XY7A 2IRUA 2UVWA 3DDIA 2AGPA 1YJWS 2L9DA 3EXCX 1WOPA 1QAYA 4G3IA 1FNOA 2XZWA 5KG1A 4ICLA 1LW0B 2IMWP 2HHUA 3G71S 1RWXB 2VA2A 1YRUA 3O5TB 3QAUA 2VJUA 1M5VC 1KQGB 5KFCA 2V68A 1X4AA 4JB8B 1YGYA 2Z2YB 3PR5B 2GO8A 4HACB 5HATA 3V2UC 4R8UB 2I38A 3SXLA 1KOHA 2XG8A 3G6XA 4ZLLA 3GIKA 4B9SA 1PAUB 1JXVA 2ZITA 1AFJA 4KJIA 2BBEA 3TUJC 2J6UA 1R8PA 1U8SA 1JNRB 2OIHA 3R9LA 4HI2A 1VHIA 2OPPB 4C48A 3DLEA 4ZVOB 1O51A 4PG8A 3GPAA 1GFWB 1X4BA 1BE4A 3QWPA 1GEHA 4HDHA 4ZCLA 4ED5A 1NK9A 3CB4A 3C15A 4TYAA 2RMLA 3FK4A 4LRFA 3M8PA 4ENOA 1L3TA 1V5VA 3OXGA 4QR1A 4YB1P 4LFBJ 3D68A 2BRLA 2OO4A 3LAMA 2I9SA 1HI8A 4BLGA 3UCUP 3TX0A 1F0XA 3N4WA 2V94A 2KN4A 4CO1A 1SPBP 3Q23A 2B4PA 3TI0A 4DXLA 4K4WA 4LR8A 3H4BA 3M7VA 1URNA 2A18A 4KO0B 3HT3A 1TK8A 4J5OA 3C6TB 4ILLA 3A12A 2Q6CA 3B78A 3BBCA 1HIYA 4O44A 4YOEA 1N5YB 4ES2A 4QBUA 2W1BA 1HR0F 1V3ZA 3M8QA 4PG5A 1VR6A 2ZBQA 4Q7AA 1X0PA 1EKRA 2IA0A 3M2VA 5D15A 3D54A 5A8WA 1WHWA 3ZNUA 2IYGA 4DQSA 2P9EA 1P9QC 2V6AA 4RNNA 4TU9A 6FD1A 1RABB 5J2MB 3UDLA 3N9UC 2P2CB 1KBRA 1J27A 5DM7Q 3PVXA 1RT1A 3PJWA 1C0UB 2HGNA 1TL7B 3K5PA 2M3DA 4IG0B 2YH1A 1DTQB 2QA4G 2O66A 1H3DA 4A8YA 2VB6A 1PJ7A 2O1PA 4MK7A 1YZ6A 4YDDB 1ZZNA 2BDPA 4UZBA 3ZTRA 5T14A 4DV3F 3OW2R 1JKHA 5IM0B 1WSRA 3C2PA 5B08A 1F1BB 3JQMA 2EK6A 4FF2A 2RU9A 2FJWA 4KHPF 2RF2A 1ZOTA 4B9LA 1JLFA 4I0WA 2P6TA 1KONA 2EC0A 1LWEA 1PYTA 3OFFA 4OI2A 3MUVP 3I4PA 4F4ZA 4WF9Q 2I5JA 3BYRA 1BMQB 1VRUA 3GFHA 3H42A 5HBMB 1RKJA 1YJRA 5EGYA 2W9CA 2FVQA 2CZ9A 2YQ3A 2RQKA 4NYOA 2JHEA 2EVZA 4P9SA 5HLFA 2C3MA 4K7QA 1A9NB 1IVZA 3AH6A 3I6PA 4H4MA 1XQIA 1PGZA 4G1QB 3EUNA 2E1MC 2XY5A 1RACB 3PEHA 1HQUB 2C2DA 3PEJA 2EXUA 4QWAA 2DGVA 3KLIA 1WC0A 2MJUA 2BV3A 3BKFA 5EX0A 2KVIA 2GJFA 3D4JA 3DFEA 4MAKA 4CQ1A 1T02A 3RBDA 4CLFA 2LFVA 3SBMA 1JLCA 2DNRA 2UP1A 1H38A 1TVRB 3FRYA 1JQGA 3D1QA 3S8SA 1LWFB 3KHRA 4WZMA 4IH5A 3MAAB 4TY8B 4DPOA 5CZXA 1VQNS 2WSFC 2HKEA 1CJVA 3FSXA 1EQMA 4Y65A 3H2UB 1VRQC 1AZSB 1TKXA 3A3NB 3SV3A 4Y2CA 2VA3A 4DQPA 2CDQA 1NDKA 2ZE2B 2N7YA 2Z4PA 2X1GA 1Q81T 2AZ1A 1CC7A 4OFZA 1R8BA 3WIUA 4DR3J 2CQ0A 2WVBA 3JTPA 6FDRA 4IQXA 2RHQB 3I5BA 4CO4A 4ED2A 3GB0A 4ZMMA 4LF4J 1PCAA 1ZPWX 3DLHA 4IDKA 3HHNB 5KG7A 3ET6B 2CJYB 3SEOA 3LGNA 3NMAA 2NZCA 1SL0A 1S1XB 4ANEA 3CDWA 1RTHB 2QMUB 2G0JA 1KFDA 4S0MA 2GVZA 1X4HA 4AQYF 3KLFB 3PO5A 3CCTA 1I3OB 2XSJB 1NZAA 1TTHB 3ZFVA 2V50A 1S4EA 4USHA 1HNXJ 4TN2A 5HK4A 2EFPA 3DDKA 3S7RA 1N48A 4F67A 3PNIA 1JMTA 5A0YB 2NXUA 1UFWA 1N33J 3UO0A 1JIHA 2LQ8A 2R7TA 1FKPA 3I0RB 1N36J 4LSNA 4HVZA 4RW9B 4ZKAA 1R6VA 4YY3F 2A6MA 2FIUA 4TU7A 4F4YA 2EFQA 1RTDB 5C42A 1AUSL 3TQ1A 2ZZTA 1HA1A 1IBCB 2A2CA 2DJWA 4BDPA 2U2FA 3M4XA 4DN0A 2HSEB 2YNHB 4PG7A 3K59A 1FE0A 2PI5A 2CJ9A 4ECUA 1LEOA 2XNQA 1HBUB 3R7NB 3GV8B 3RAQA 1BD6A 4HYKA 4DJBA 5KG3A 2M0GB 3LQVA 3LGMA 2Q79A 3HKZD 2B5JB 2IRYA 1GXLA 4DL4A 1HBMA 3N28A 1XR7A 4RJVA 5DRKA 1UP1A 4ANDA 2CJBA 2C2KB 1H72C 3CVKA 2BANB 5HVHA 3THPA 4NZ6A 2BYCA 4XAKA 1NSAA 3IRXB 3MAHA 1Y11A 3PRBA 4ZA1A 4LBHA 3FBEA 2Y1IA 3LANA 1Q53A 4L75A 5G4DA 1FK9A 2XLKA 4FF4A 2XNRA 4CYUB 1YJTA 4XK8C 2P8IA 1KOOA 1S72S 4PWDA 4NA3A 5C25B 3OL7A 3WC0A 2LMIA 2FDNA 2FHMA 3KLHA 2ZOGA 2V2QA 2J0QD 2NXCA 2KG1A 5KT4A 3R5DA 5F8LA 4I7FA 1N56A 3TZYA 4NLWA 1FTCA 4RW8A 2E5JA 3BQ1A 4TYBA 4NLSA 4AT1B 2HQGA 4DR2F 2XHWA 4LR9A 4PPDA 2JLEA 1S6QB 3BGUA 4DEZA 2UVRA 4LFCF 1MU2A 2GW8A 1SV5A 3RR7A 3S01A 1S49A 2IAJB 4KT0C 4ZPDA 4PXCA 3KYLA 5CCLA 3HF5A 4LF8F 1RTJB 3CULA 3SSQA 5HI7A 3QSYB 2NZ4A 4QYZJ 3NGDA 2JEIA 3FCWA 1E6VA 3CEDA 3OHBA 3QT6A 2CXEA 1HWLA 1SKWA 3D9BA 4RZRA 3JTNA 2F4VJ 3P5TL 2QFJA 4WFAQ 2DR6A 2XB2D 4C8YA 1ITPA 2B8PA 5H1SV 4A8QA 4B17A 3AOAA 2EW9A 2C1EB 4U6PA 4DV3J 4UY8T 2POKA 3FEYB 4OYBA 4U9RA 2OEKA 4DV6F 1RU1A 3MM6A 3CCLS 1LWCA 1VYAA 4CZCA 2RQ4A 2PT0A 4NA2A 4ZIVA 2JDJA 3KFWX 1G3OA 2UUCF 2QLXA 2CPHA 4LJMA 4DV2F 2PDAA 2X3GA 4CNYA 2HNZB 4NMXA 3VGSA 3H0PA 3M8WA 4KE5A 3OR1B 2G9OA 1UJ5A 1RT3B 3ADAC 1IKWA 2GVDB 5BYRA 2NQPA 1TKZA 3U1LA 4TQRA 4Y2KA 3FZ2A 3KLFA 4CLKA 4B9NA 2GMLA 4W92B 2KTQA 2ACMA 1WOSA 2VDIA 1CSJA 2VBZA 3Q8PB 4NMLA 1REVB 4IYQA 1F2GA 1RWMB 1EP4B 1VQ7S 3ZO7A 1WSVA 5ETKA 3G96A 2D3OR 3K0JA 2BW2A 5KFJA 4NLXA 1HKAA 1R6YA 3DGPA 2CYYA 3KG4A 4LF6F 3ZTPA 4CTAB 4J9SA 1PJ6A 4OYPA 1UZDA 2R7OA 1KHVA 1OMSA 1Y4ZB 4WE1A 1CJKB 2HLUA 1G1XA 5HJYA 3GR1A 1C0TB 3NRBA 4JI4F 3SSSA 1SVDA 1IWGA 1OO0B 2ZM6F 3NGKA 3CTRA 3Q86A 4OI6A 4UY85 4DS5A 1Z4UA 5KFQA 4C8OA 3K8VA 3HVAA 3OQ2A 4YR2A 5B0FA 1WC5A 2BANA 5THWA 2QV6A 1UW4A 4DN9A 3R3TA 1JLBA 1NB7A 2W2NP 1U8WA 1RTIA 4P74A 1R27B 1NKEA 1QAIA 2XYPB 1S10A 2DNQA 4EZ9A 2V5HG 4TXSA 2MLZA 4A8MP 2W2QP 2A6OA 5DQHA 1WTBA 5HVFA 3DN9A 1CJTB 4Y34A 4CYUA 3DLLQ 4AXIA 2M88A 5AXLA 1OQ6A 5FDLA 2OTLS 1C1BB 1WHYA 1NJZA 1NU4A 4FYXB 4X4SA 3J7YU 4M5KA 4Y2IA 4DPUA 1DQ9A 3MECA 5K8PA 3IMQJ 2VOPA 3R2DJ 3W9HA 4ECVA 3GIJA 2J7UA 5B09A 1N8RT 2GJ2A 4YY3J 3QZ8A 3K5LA 1VQMS 2XMVA 1X9WA 5KFEA 4MK8A 2JH3A 3TA1A 2B51A 1NPRA 1Q8IA 2VHGA 2DGTA 5GAHI 1YDLA 2F8EX 4N8NA 5ITHA 4IG3B 2JLGA 1XN9A 5G0RA 4F02A 4EYHB 1CVJA 4L74A 2XZTB 5KT5A 1HMVA 1K1SA 2FVPA 1KEKA 1WNEA 1DJ0A 3RYLA 1MN7A 4DFPA 4OJHA 3T1AA 1ZAXA 3UNGC 1VQPS 3R6LB 4NEZA 4EI2A 1Q0NA 2AYMA 3TA0A 4Y00A 4UZCA 4ZPAA 3BZQA 3UQSA 3RBEA 5AJ3J 4AUKA 1KNZA 4KHMA 1J2VA 1RA7A 5L1LA 4FXVA 1RGVA 4UQTA 2LQ9A 1UPMB 3DOMB 4IO9Q 4M8LA 2Z0GA 4X4PA 1UMJA 1Q8BA 3A8JA 2APOA 4JV5F 2HMIB 2ZH1A 2C2EA 2QGFB 4FF3A 1HPZB 1YWXA 3I55S 1NKCA 3RG6A 1XWLA 3OBIA 1Y10A 1TL1B 2ROPA 5DS7A 3HVRA 4O3OA 2FJDB 2B9WA 5F3ZA 3IGVA 2CPIA 3C14B 4LF9J 1UTAA 4ED6A 2PMZD 1FTRA 4OJGA 1EAYC 3V4MA 3CDUA 3A3PB 1N88A 4IRDA 4J9OA 4U96A 3MTKA 2QLWA 2XO7A 1GMWD 4LUBA 1ZTWA 3ENWA 1PSDA 2UUWA 2ZDPA 3LWLA 1VOMA 1YKWA 4Q8EA 2V63A 3M2UB 1RHKB 1TKTA 3M9OB 3DLKB 5BR8F 1TELA 2DNZA 5EWEA 4P52A 2BM1A 3DRYA 3IG1B 4FYDA 1S5ZA 2OJ3A 3R7BB 4FPRA 1EQ0A 5LXRA 3H25A 2FHJA 1GX6A 1D8ZA 1DQAA 4YUDA 5KFYA 3VR1A 2ASYA 4GRSA 3HD1A 3H5UA 3MEGB 4AL5A 2NUUG 3KUEA 1BWVA 2YNFA 3KK2B 2PFFB 2RNEA 3I9V9 5CYJA 4CCHA 1TMMA 2RKIA 3OUYB 3QJLA 3IC1A 3BR9A 1VBYA 2YNIB 3ZZ0A 5IXUA 2Z8QA 1Q5YA 4DV4J 3MFIA 2I2YA 3KJFB 2IVFB 2DHSA 1FRJA 4O0IA 3OTBA 4JYAJ 3CCJS 4GC6A 1REGX 2ADCA 2LDIA 4CP5A 4HKQA 1NM2A 3LPYA 5BYQA 1FNXH 2RUSA 2EKNA 4CNZA 3O2IA 3LALA 5F9NA 4C2MA 2DTJA 2DKOB 3BGRB 1U49A 4HEA9 1R43A 3DRPA 4FBUA 1OJ4A 1SJ4P 4F2RA 2W7PA 3MEEB 4ZPWR 2ZOFA 3MM5B 3KKFA 2B4VA 1Q1KA 3I32A 5KFXA 3EYZA 3OV7A 1H74A 4K4SA 4L3KA 3D6HB 3DOKB 4U67Q 3UD5A 5K5MA 5H9FK 3PX0A 1N5VA 1MMDA 2CPYA 3MZIA 1C4AA 1JB0C 2BJDA 2GZOA 3TZXA 4PAAA 2ZM6J 4WCEQ 2ZH9A 1RYRA 1SQFA 1YG0A 3CWJA 1TL4A 2C3PA 4RBUA 1Y7PA 3JQJA 2ROGA 4P7TA 4JI1F 2YKPA 1FI4A 3R5JB 3BQ0A 3TQEA 3S6EA 5L1KA 1NK0A 5GAGU 1S9FA 3W3SA 4L72B 4J9QA 2FVRA 2C2ZB 1UEKA 3BF4A 4UOHA 2MQPA 1IWAA 3F0NA 1KLNA 4MYUA 2KJVA 3W66A 4IFYA 1QE1B 1FA0A 2PEBA 1F5AA 3W63A 1HNVA 4NZ0A 4J9VA 2HFVA 4DUTA 5FJ4A 4OIXA 4M1KA 1WF1A 2DXFA 4YQWA 2W9BA 1YJ9S 4V19X 4DR6F 4NCAA 5AXMA 1KQFB 4ELTA 3ILJA 4DX6A 2H5IB 3I87A 4B3MF 3OSNA 4ZCIA 2ZFHA 5J1EA 4P73A 1OS5A 3QO9B 4NLTA 1FJ7A 1H7XA 5DG9A 3DRRB 2DR5A 1VQKS 1EETA 2AJ4A 4I2QB 4DFKA 2IM0A 4NI2B 1NZ8A 3C14A 3J7ZT 2R8HA 2EWHA 3HVTB 1KR4A 3AJ2A 3Q89A 2OTJS 3P45B 1ICEB 4GO5X 5MLCV 1NEEA 3EJMA 2WW4A 1FX4A 1RAEB 3HVWA 2BQUA 2E9RX 1FO1A 1YQHA 5HJXA 1VQ5S 1XEZA 2YKMA 5ETNA 2KB2A 1UEUA 2DGUA 3MR7A 2EFNA 2FLOA 2J8AA 3NL0A 4A8FA 1QY7A 4OV6A 2HIYA 4K4ZA 3AAWB 4ZVGA 3EVWA 3TO8A 5D3GB 4DPTA 3HD2A 5CXTA 4ES1A 3M2RB 1ZM9A 1UW9A 1Y00A 2GC8A 2DYAA 3PFOA 4RW6A 3OL9A 3FFIB 2OEJA 5DDQC 1Q78A 3PV8A 3DRSB 2MQOA 2NCKL 4LSZB 1YVFA 3GR0A 4I56A 3OSPA 2R8KA 3V81A 2H5EA 1VISA 1O0PA 4AYBD 4DL5A 4TQSA 2E44A 2RIJA 1MN9A 4KTQA 2YQ0A 2UUBJ 4PWWA 1A7GE 4C11B 3MM8B 7FD1A 2KKHA 2YNIA 2Z57B 3GJSB 4DI6A 4U7CA 3NGSA 1QDUB 2Q66A 5HMZA 4A8WA 3QZ7A 2A0FB 2FVSA 3RW7A 4IR9A 3CNQP 3PIOQ 3QIDA 4DG1A 3CJ5A 3VCDA 2B0GA 2HHVA 4QR2A 2RS2A 5CD4A 2QZ8A 3H5SA 4U8YA 3J7Z5 1CLFA 4MIAA 2B9EA 5DGAA 3OTCA 3UPFA 2FLPA 1U2RA 1ZA1B 3LO3A 4WPAA 3EGWB 1HWKA 3NAIA 3K8WA 1WUUA 1RZMA 4AL7A 5DGBA 2VQFF 2AIRB 1J5EF 3BGRA 3M9MB 1U09A 1BQMB 2YWGA 2DGQA 2G2YA 1XR5A 1KQSR 1R0CB 2CJXB 4LT6A 2CNLB 1Y5NB 1DY3A 1JX4A 1VJQA 3MEEA 1FXRA 5BR8J 3NBPA 4EFAC 2CKWA 3MR5A 3R97A 3IN5A 2DXDA 1RLCL 2WOMB 1AXQA 2FTRA 5HMWA 3RRHA 2ALYB 2O3DA 1HNWJ 5LMUJ 3I0SB 1KP6A 2ZBRA 1EHWA 1UVNA 2AZ3A 3TZZA 4LVOP 4MKYA 4R0EA 1H98A 4CLSA 1OYEA 2JLFA 4R25A 1OPIA 4X65F 5D78A 2E1CA 3LP0B 1CULB 4IOBA 4M5DB 2JX2A 3KJVB 1FRKA 2BVZA 4DQQA 3CJKA 3H5XA 1R8AA 3L4BC 2XGQA 4JI3J 3NAHA 4DPXA 3BO3A 2KRBA 3OVBA 1OSDA 3PYEA 3TJ8A 1TQLA 5IS2A 2HFZA 3H7HB 1PAEX 1WEZA 2VBXA 1AFIA 2RQMA 3M32A 3KXDA 5F8JA 5JXSA 2IC3A 2BJ1A 8RUCA 3FBFA 2HS0A 2C3YA 4OZ2A 4X4UA 3EPGA 2FHOB 3VZHA 4B3RF 4ED1A 1UFLA 2DNKA 5DZ7A 3TVKA 3KK1A 2PO4A 1RHUB 1R8CA 3MMCA 3QO9A 1YBTA 4ER8A 2MQQA 4JV1A 3E01A 2C2OB 2DBBA 3ZZTA 1FE4A 4OYIA 3EWGA 2KFNA 2DEIA 3KNGA 1YIJS 1U26A 2VZ9A 3OFGA 3VHQA 4JOUA 1NAQA 2G1HA 2EPIA 2GQ2A 2MYFA 2DNNA 5KFSA 3G8TA 4DCOB 1BGXT 1WELA 5K9FA 1U25A 4OYAA 4DUYF 2HQIA 2WVCA 2XMTA 5L9NA 3GIRA 3CPWR 1IKVA 1QTNB 4ITSA 3DYAB 4I6AA 2ZJPQ 2KXFA 3GG0A 1S48A 1G6BA 1UWBA 5KOWA 3MOJB 1AW0A 1S1VB 2CVEA 3GE9A 2SXLA 4LSLB 3R7SB 5HQLA 2DRBA 4WKRA 3T19A 4ZLNA 4JI1J 3MPUB 1ACMB 2X7IA 5F9LA 4LRCA 3WBZA 2VH7A 3MPWA 4OHWA 2HVEA 3MR2A 2UV8A 2DR8A 1NDCA 2OELA 3RW6A 4O3QA 1WEYA 5B0AA 3DDNA 4KH1B 2VASA 1NH8A 1F9HA 4MK9A 3CCRS 3WC2A 2VPWB 4PXBA 2UUAF 1NJYA 2P6SA 3BO4A 2CQCA 2M8HA 3CCQS 1V6HA 3ZZYA 4RW7A 4XO0A 4LRDA 3MEKA 2E7VA 4F0KA 2LKZA 1LW2B 3RR8A 4NYPA 1U2FA 2AMCB 4R5PA 1Y9OA 4B3MJ 3DMJB 2MSSA 3PJ9A 2UV8G 4M63A 2QLFB 5IC4B 4D3HA 5ETPA 4LFAF 2XZDB 4UTGA 3W2VA 2DXEA 2FY1A 2DB1A 5D4PA 1I6JA 3KUHA 3MUMP 3FMBA 4CM0A 3QMQA 1WC6A 1X8DA 1IBLF 5KG6A 3HSZA 3EGNA 4DSLA 2OMLA 1H2UX 2CPZA 1E6YB 2W8LA 2MGZB 3W2WB 4FDFA 1JLQA 1IM6A 1SBRA 1SJRA 2V8PA 5E7OB 3HFVA 2HZVA 3CMAS 1BQMA 3C6UA 4EBEA 4GC7A 2AEFA 4L73A 2OPQA 1C2PA 1C4CA 1QSLA 2Y1LB 1MNEA 2AEMA 2FZGB 1UJ6A 2R7WA 4I2PA 4FYYB 2CVIA 4USWA 3MCSA 2YX1A 3W8GA 3BDEA 2IRXA 1UAWA 4WFNQ 1X5PA 2E5IA 2KDOA 2HRYA 1FKOA 4BBYA 1VRTB 4X4VA 3EX7B 4OI0A 4PQUB 5HQ8A 2XLJA 3UDCA 4N7TA 5C24B 2QRRA 4ZCKA 1D9FA 2M4MA 1IKYA 1W2IA 3FNNA 2H4WB 2ZH6A 3VQTA 4EWTA 3GP9A 3R6GB 2OFHX 5E3QA 4NPOA 5I42B 4DUZF 3RAXA 2GNKA 3LP0A 3AODA 1NK5A 3QIPB 4HHUA 4KR0B 2JZ5A 2X1AA 3T41A 2KFYA 5JUMA 5E2QA 4CO0A 2C3UA 1B0TA 3TZWA 2O5DA 1I94F 4NL5A 1OY9A 3J80Y 4EUVA 1IM4A 2J7KA 1U4BA 2BACA 3GU0A 3ENQA 3C46A 3E51A 1RT4A 2HWHA 2JEFA 1U6FA 3VAJA 1MSWD 1UWAA 1NRKA 4P2MA 2OSRA 1N34J 1TK5A 2VU5A 3ISND 3Q8SB 5DM6Q 4DQRA 5CABA 1FJEB 2H54B 1N5QA 2VF3A 2GQQA 1F3FA 2MHNA 2AJQA 2N7CA 2CPJA 2V8GA 2GGPA 3ZC4A 2QTWA 3AB4B 4MH8A 4P6QA 1URRA 4J37A 1P6TA 3RB4A 4HHHA 1MROA 1JLAA 1DTTA 2FVCA 5EWFA 2F65A 5KAKA 2C28A 2A10A 3LUYA 3MHYA 1KS2A 5C2GA 3AD9C 4ZLPA 3QLHA 3BH7B 3VV2B 3KDNA 4XDCA 1FXDA 3D0IE 4X4OA 2VBWA 4BHQA 1D9DA 2DHHA 5J2NB 4F36A 1M5HA 4KYZA 5D0GA 4Q0BB 3NOGA 3W5YA 5IQ6A 3ITHA 2Z2ZA 1KD1T 2BE2B 4NASA 2HNYA 3M8ZA 1H0HB 1RAJA 2J76E 3TAMA 4NRTA
chains in the Genus database with same CATH topology
4UOFA 3FCVA 2B8QA 4EK2A 3FBEA 1WKKA 2HURA 2VU5A 3B54A 4W98A 3NGTA 5CABA 3BBBA 4WBFA 2AZ1A 4C6AA 3EICA 1ZS6A 3VGVA 3Q86A 3PJ9A 3VGUA 1S57A 1F3FA 1NSQA 3FCWA 4ANCA 3MPDA 4DZ6A 3PRVA 1B99A 1WKLA 4FKXA 5CAAA 3VVTA 3FBCA 3Q8YA 1XQIA 1K44A 1PAEX 2NCKL 3EVOA 1B4SA 2DXEA 1UCNA 3GP9A 3DKDA 3ELHA 1NCLA 3VGTA 3ZTOA 3FBFA 3ZTSA 4KPCA 1JXVA 3Q8VA 3Q8UA 2BX6A 4CP5A 4F4AA 3ZTRA 2DY9A 3Q89A 1F6TA 1S59A 3VVUA 1LEOA 2B8PA 3FC9A 3G2XA 3R9LA 4ANEA 2DXDA 1MN9A 1NHKL 3ETMA 3BBCA 1HIYA 3NGRA 1S5ZA 3EJMA 3EMTA 1PKUA 3EVMA 1U8WA 2HVEA 3JS9A 1NDLA 4UOHA 1NDCA 1NSKL 4S0MA 3NGUA 3GPAA 3ZTQA 3BH7B 2ZUAA 2BEFA 1NLKL 1BE4A 5IOLA 1VYAA 2CWKA 4DI6A 4UOGA 3NGSA 5BXIA 4O0NA 1EHWA 1NUEA 1HLWA 2AZ3A 3EM1A 2HVDA 4DUTA 1HHQA 5C7PA 3ZTPA 4F36A 1NB2A 4ANDA 2DXFA 3ENAA 3B6BA 3WX8A 1MN7A 1BUXA 1NDPA 3L7UA 3FKBA 4ENOA 3EVWA 3DDIA 4FKYA 3EE3A 1KDNA 3BH6B 1W7WA 1WKJA 1LWXA 3BBFA 1BHNA 3VGSA 1XIQA 1NPKA 3FBBA 4HR2A 1NDKA 1NSPA 3Q83A 2DYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UOF A;  3FCV A;  2B8Q A;  4EK2 A;  3FBE A;  1WKK A;  2HUR A;  2VU5 A;  3B54 A;  4W98 A;  3NGT A;  5CAB A;  3BBB A;  4WBF A;  2AZ1 A;  4C6A A;  3EIC A;  1ZS6 A;  3VGV A;  3Q86 A;  3PJ9 A;  3VGU A;  1S57 A;  1F3F A;  1NSQ A;  3FCW A;  4ANC A;  3MPD A;  4DZ6 A;  3PRV A;  1B99 A;  1WKL A;  4FKX A;  5CAA A;  3VVT A;  3FBC A;  3Q8Y A;  1XQI A;  1K44 A;  1PAE X;  2NCK L;  3EVO A;  1B4S A;  2DXE A;  1UCN A;  3GP9 A;  3DKD A;  3ELH A;  1NCL A;  3VGT A;  3ZTO A;  3FBF A;  3ZTS A;  4KPC A;  1JXV A;  3Q8V A;  3Q8U A;  2BX6 A;  4CP5 A;  4F4A A;  3ZTR A;  2DY9 A;  3Q89 A;  1F6T A;  1S59 A;  3VVU A;  1LEO A;  2B8P A;  3FC9 A;  3G2X A;  3R9L A;  4ANE A;  2DXD A;  1MN9 A;  1NHK L;  3ETM A;  3BBC A;  1HIY A;  3NGR A;  1S5Z A;  3EJM A;  3EMT A;  1PKU A;  3EVM A;  1U8W A;  2HVE A;  3JS9 A;  1NDL A;  4UOH A;  1NDC A;  1NSK L;  4S0M A;  3NGU A;  3GPA A;  3ZTQ A;  3BH7 B;  2ZUA A;  2BEF A;  1NLK L;  1BE4 A;  5IOL A;  1VYA A;  2CWK A;  4DI6 A;  4UOG A;  3NGS A;  5BXI A;  4O0N A;  1EHW A;  1NUE A;  1HLW A;  2AZ3 A;  3EM1 A;  2HVD A;  4DUT A;  1HHQ A;  5C7P A;  3ZTP A;  4F36 A;  1NB2 A;  4AND A;  2DXF A;  3ENA A;  3B6B A;  3WX8 A;  1MN7 A;  1BUX A;  1NDP A;  3L7U A;  3FKB A;  4ENO A;  3EVW A;  3DDI A;  4FKY A;  3EE3 A;  1KDN A;  3BH6 B;  1W7W A;  1WKJ A;  1LWX A;  3BBF A;  1BHN A;  3VGS A;  1XIQ A;  1NPK A;  3FBB A;  4HR2 A;  1NDK A;  1NSP A;  3Q83 A;  2DYA A; 
#chains in the Genus database with same CATH topology
 2GAH C;  4GVB A;  3KWM A;  2F3J A;  4PG4 A;  3UCZ P;  3G86 A;  5KFZ A;  3QT8 A;  1RBO B;  3JAM Y;  4ICL B;  2Z2M A;  2OHD A;  3CO9 A;  2ASJ A;  3T1Y F;  2R42 A;  3T5K A;  4X4R A;  1AA1 B;  2JEG A;  2QA1 A;  1VK3 A;  3SFU A;  3GFY A;  4OI1 A;  1HNI A;  5L1J A;  3MI7 X;  2ZHB A;  2XCP A;  5L46 A;  4IH6 A;  1WEX A;  2GIF A;  4NOH A;  2VBY A;  1PJ5 A;  5IFM A;  5I3U A;  4RO0 A;  3RB0 A;  3GQC A;  4KGM A;  2DCL A;  1H73 A;  1LW2 A;  2JOQ A;  5J1N A;  2N3L A;  5I3Q A;  1KTQ A;  2H4Y B;  2CWK A;  1RT7 A;  2R7X A;  1FJC A;  4QWE A;  2XMJ A;  2K1R B;  1HL6 A;  3DLE B;  4LF7 F;  4ZCM A;  3QRP A;  3AD8 C;  5B0G A;  2EBG A;  1PO6 A;  4X2B A;  5AXN A;  5D0E A;  2VJV A;  1B70 B;  1WAC A;  3C15 B;  2AEJ A;  3FEX B;  4QIW D;  4F3Q A;  1KVK A;  1QTM A;  4UOF A;  4AD6 A;  3M8P B;  2ZHA A;  4UF4 A;  3F44 A;  5L39 A;  3FRZ A;  1S1W A;  1RDR A;  3W2W A;  4KIA A;  4M5I A;  1RBA A;  2HRU A;  3ZZU A;  3J81 Y;  4M5N A;  3KLG A;  5K8M A;  2GS8 A;  1VBX A;  3M6V A;  5LOQ A;  1TMJ A;  1B7F A;  4M94 A;  1XNQ F;  1SIW B;  3BGF A;  2OSQ A;  1HNZ J;  2KZM A;  4G1I A;  1RAA B;  3L95 X;  5ETQ A;  2BR0 A;  2LXF A;  5LSR A;  1NH7 A;  5M2U A;  4K8R A;  1IBK F;  3ULH A;  5DO2 A;  2FUG 9;  3T1H F;  1HI0 P;  3ILI A;  1N32 F;  4LF2 A;  2YH0 A;  5A8R A;  1HWI A;  4PXD A;  1Q95 G;  4DV0 J;  2EFG A;  2CQ1 A;  3NP5 A;  4ZP9 A;  2LA4 A;  2NXE A;  3M8Q B;  5F0W A;  5HAO A;  1VK8 A;  3M2V B;  3D6M B;  4QIF A;  5A8W B;  5A6P A;  2ZC4 A;  2RS8 A;  1R0A A;  2FJA B;  1YX2 A;  4DCP B;  1X5T A;  3THT A;  4HL9 A;  1XMQ J;  2CJQ A;  3CJT A;  1RT1 B;  1Z2L A;  2X1F A;  3VAL A;  2WVE A;  4LFA J;  1AB8 A;  1NO8 A;  2M52 A;  4DX7 A;  2J6T A;  3ZTO A;  2VON A;  4NEY A;  3Q8U A;  2RDD A;  4Y2M A;  3TUP A;  2A1B A;  2DGS A;  2C3O A;  2V9K A;  5EHH A;  5KFF A;  2DPJ A;  2JC1 A;  3PR4 A;  4F2S A;  2BMB A;  1I5O B;  1OIA A;  1GXU A;  2OD4 A;  1JXE A;  3L7U A;  4USI A;  4ECQ A;  2RF2 B;  1IQZ A;  1JLF B;  1CBK A;  2VFU A;  2YXL A;  1XNR J;  1U0H A;  4OJ3 A;  5DDR C;  3AFG A;  1LWE B;  4J9N A;  2I5J B;  2W4C A;  2ZOM A;  4OJ1 A;  1HWJ A;  4E8U A;  2HK2 A;  4DBQ A;  1VRU B;  4DFJ A;  5KFT A;  3TEH B;  3W62 A;  4DX8 H;  3ZXW A;  1U6Z A;  2YKQ A;  2XO6 A;  2LVW A;  2KG0 A;  1TFW A;  5K14 A;  1QVG R;  5HLF B;  4BWJ A;  4EZ6 A;  2QL5 B;  3T9N A;  2BRK A;  5J2N A;  1SJF A;  4B3T F;  1YJ7 A;  2EBE A;  1YBU A;  1S12 A;  1WJ9 A;  2CQP A;  4HT5 A;  4FNH A;  3HJF A;  2E5H A;  4IUF A;  2B4O A;  3FCH A;  4YP3 A;  2LQJ A;  1LK7 A;  2XBP A;  4JI6 F;  3K57 A;  5HRO B;  3RTV A;  3KLI B;  1RU2 A;  2E9Z A;  2JL9 A;  3DC2 A;  3DU6 A;  3MD1 A;  4Q44 A;  5KFV A;  2MST A;  1UFK A;  1JLC B;  1T95 A;  1SKU B;  1KVI A;  5J2Q A;  2QL7 B;  4NLY A;  4ID5 A;  1U02 A;  3BSN A;  1ZM2 A;  2V4R A;  2HW3 A;  4JI0 J;  1CJV B;  2DRA A;  1UJ4 A;  3J81 j;  2HUR A;  2CG4 A;  2ZC3 A;  1TKX B;  2NPI A;  2RRA A;  4U7U D;  2M7S A;  3HX9 A;  2P9C A;  1IBM F;  5HMY A;  2K1R A;  3IFE A;  2BKP A;  2OH2 A;  3A8I A;  2F9D A;  2DNG A;  4JP8 A;  5E0O A;  2DGX A;  2MMY A;  3W61 A;  4XPE A;  5SZT A;  2YNG A;  4NA1 A;  3X3U A;  1FRH A;  4H4O A;  3BSC A;  3HK2 A;  2Y9H A;  3N6N A;  5AE1 A;  2DH8 A;  4PWU A;  4IDK B;  4UST A;  4XIU A;  3FUY A;  2MKS A;  2FJB B;  4O3P A;  5AXK A;  3TX8 A;  2WB1 D;  1RQ0 A;  3L7P A;  3IXQ A;  3W8P A;  2OPS A;  2GFF A;  1FT8 A;  3IS9 A;  2VG5 B;  1XMO J;  5GVQ A;  1HQE A;  1F9E B;  2GVZ B;  5I3P A;  5K8N A;  2YVS A;  1NXI A;  3GYN A;  2CQB A;  1RHQ B;  5ADZ A;  3W7B A;  2XI3 A;  2NPF A;  2W01 A;  3WZ0 A;  1U2C A;  1LWX A;  1YTY A;  5KFO A;  1JJ4 A;  2RDI A;  1CJU A;  1FWP A;  4MIB A;  2E5G A;  2XTJ P;  2FJX A;  4MIW A;  2MJN A;  1U0S A;  2WBM A;  2WCX A;  1FJG F;  2H3E B;  3KMQ A;  3O1L A;  4WK1 A;  4TKT A;  5E3A A;  3BGL A;  2GQC A;  4OYW A;  1FEH A;  2KO1 A;  1WF2 A;  1OWX A;  1SH3 A;  4URS A;  3T1Y J;  1FKP B;  4LSN B;  4L6V 3;  4WFZ A;  2MQN A;  2RRB A;  3BV8 A;  4DHV A;  1F6T A;  5C42 B;  3DI6 A;  4C98 A;  3RZA A;  3EMT A;  8AT1 B;  3MFH A;  3JQK A;  2ZD1 A;  1VQ6 S;  1KSP A;  4UW2 A;  3U27 A;  3J7Y I;  2XEX A;  2R9L A;  1M5S A;  1TK0 A;  2M8D B;  5F41 A;  4KGV B;  2E1R A;  3O8W A;  3MAQ A;  2HVI A;  3CT9 A;  4X64 J;  1VIO A;  4KB7 A;  4YR0 A;  3SQG A;  1HBM B;  5KG4 A;  3M8S A;  2AYB A;  2O67 A;  1RT2 A;  2CQI A;  3OR2 A;  5EX3 A;  3D2W A;  2DPI A;  4B3O A;  3NGT A;  3M6U A;  1ZS6 A;  1TFY A;  4OYZ A;  1BWE A;  4B3S J;  2EG1 A;  4DZ6 A;  2IJF A;  2MZR A;  4LF1 A;  1YBA A;  2KT5 A;  4E98 A;  4PCQ A;  4JI8 F;  3TR5 A;  1TUG B;  1RE1 B;  3UNY A;  1FK9 B;  5LMN F;  4DCJ B;  4DOZ A;  3CC7 S;  1SB6 A;  1PC5 A;  4F4A A;  4F0M A;  2F8M A;  4PWD B;  5GAD U;  2ZWP A;  5GME A;  1SUQ B;  4PYA A;  3VAK A;  1TZ0 A;  4C8L A;  1YJN S;  3KLH B;  4QU7 A;  3BGO P;  1GMU A;  3QPI A;  1ZAV A;  4ECY A;  4A47 A;  1T9W A;  3A8K A;  1N32 J;  4TNO A;  4I7F B;  4NCG A;  3WX8 A;  1PBA A;  4RW8 B;  4I1T A;  2HFN A;  4WYL A;  3MUR P;  5EN1 A;  2HFS A;  4EMD A;  3NXZ A;  2YX7 A;  1LFW A;  5KFG A;  2BXJ A;  1JLG A;  2QSF A;  2ZKT A;  1NPK A;  4Z7Y A;  2AF6 A;  2KXH A;  2QC3 A;  3BDP A;  3P3D A;  2MQM A;  2NR0 A;  2HLT A;  1MU2 B;  1SV5 B;  3W65 A;  4W4M A;  3EXY A;  5HRO A;  1RWN B;  1RCO B;  4JI5 F;  1R3N A;  4FVM A;  2B3T B;  3H2V E;  2LEC A;  2DVI A;  1T0T V;  4KQZ A;  1EX8 A;  3GIM A;  1ZM4 A;  3I5C A;  3MGJ A;  2HQD A;  2WON A;  2B7B B;  3QSI A;  1E6V B;  4WU2 A;  3TP2 A;  3EDR B;  3UDE A;  1ZZF A;  5T7L B;  1X9S A;  4ZOS A;  3NNH A;  1YJV A;  2HQ3 A;  2CQH A;  1NDL A;  4OL8 A;  3OJS A;  1NJI T;  2QO3 A;  2W4D A;  3HXM A;  1GNK A;  2HVD A;  4NXM F;  3OXF A;  4DV5 F;  2ATC B;  3MM6 B;  3T6B A;  1LWC B;  4OX8 A;  1N52 B;  1T05 A;  3DM2 A;  1W7W A;  3BBF A;  2GV1 A;  4Z7C A;  2PC6 A;  4IKA A;  3C16 B;  4YB5 A;  3PXG a;  2AU0 A;  3M1V A;  3PRD A;  4QWD A;  2PE8 A;  3UW1 A;  3JSM A;  3UVJ A;  2FLN A;  1RLD A;  1IKW B;  2Y8Y A;  1QM9 A;  4PEO A;  2ZBI A;  2VG5 A;  1XK8 A;  1TKZ B;  1X5S A;  2HQC A;  4ECW A;  2OEM A;  4KPC A;  1RB0 A;  4C0H A;  3OTD A;  1X4C A;  1UKU A;  3DHX A;  2FC8 A;  2BOP A;  2ZH5 A;  4B3T J;  3FC9 A;  3BS9 A;  1G4C A;  1VQ8 S;  1JLE A;  2R7Q A;  4G1P A;  2IMO A;  3TWZ A;  4BC7 A;  4RNH A;  4UOG A;  4O3S A;  2VPZ B;  3NCQ A;  4JV2 A;  4X66 F;  1HHQ A;  3SYZ A;  5DDP C;  4FF1 A;  4EGL A;  1MMN A;  1QUP A;  3GJT B;  2V8H A;  2V9W A;  3PX4 A;  1GXT A;  3DGP B;  1EB0 A;  2ZNZ A;  3TVY A;  4BS2 A;  4BCA A;  3IBC B;  5CHC B;  2W2P P;  2Y1J A;  1IR1 A;  4NLU A;  2D1C A;  4YDX A;  3B54 A;  4F8R A;  2AWZ A;  4WE1 B;  2MZ1 A;  1KLM A;  1RT5 A;  5JJB A;  4UOC A;  1N5S A;  3A4T A;  3KLV A;  2BZ2 A;  2KT2 A;  4YB7 A;  1S99 A;  4A8X A;  3LP1 A;  1ELO A;  3US5 A;  2XM3 A;  1UET A;  4K59 A;  2J7W A;  2YWF A;  4K2X A;  3QFH A;  3AQP A;  5D0R A;  3T3F A;  2VOD A;  4USM A;  5LSL A;  3P8B B;  4ZIT A;  3AOC A;  4ETX A;  2R4F A;  2WHO A;  3PYG A;  3M30 A;  4NLG A;  3AB2 B;  1DLO A;  1TL5 A;  1F5B A;  4LR7 A;  4OX6 A;  1BQN A;  3UDV A;  5CH7 B;  5HQM A;  4Y2A A;  1JLB B;  1N6Q A;  1CS4 A;  1RTI B;  1RSC A;  2HK3 A;  3RU0 A;  4K0K F;  4N47 A;  3FKB A;  3SCK E;  2QLB B;  2AX1 A;  2DIS A;  2PSZ A;  4EU0 A;  1G2E A;  1S1T A;  5E3P A;  4JUZ A;  4WYW A;  3I4H X;  2F8H A;  5GAG I;  4KKO A;  5FDL B;  4UUW A;  3ZZZ A;  4OHZ A;  1SUQ A;  2G2Z A;  4LFB F;  1IKX A;  3ZNJ 1;  2ZZN A;  4WKY A;  5DQI A;  3J80 U;  2MTL A;  1FJG J;  1S0V A;  3I31 A;  2R7V A;  4KSE B;  1B4S A;  2EI5 A;  3MEC B;  1DHM A;  1NBE B;  1CG2 A;  1SXL A;  4GKJ F;  1HR0 J;  2R8G A;  3M8R A;  1ZH5 A;  2JSX A;  4C8M A;  2U1A A;  4F7V A;  1SL1 A;  2OD6 A;  1S0M A;  1P1T A;  4A48 A;  3QT7 A;  4PUO A;  1FFS B;  3LP2 A;  4C8K A;  2QA2 A;  3V4I A;  3NG8 A;  3CCS S;  3LAK A;  1DAR A;  2KT3 A;  2B6A A;  1Q79 A;  1CEZ A;  2BE9 B;  1GMV A;  2DK2 A;  2VKZ G;  5G0R B;  3OXL A;  1WC3 A;  1HMV B;  2QSW A;  4K50 A;  4Y6I A;  3ONQ A;  5T7L A;  3Q8Q B;  2FB0 A;  2AJ1 A;  1VJW A;  3BBB A;  2H1Y A;  1RKI A;  4N5S A;  5DG8 A;  2F1F A;  3IP0 A;  2KYX A;  4NWB A;  3H4D A;  4MFB A;  4DMZ A;  1XR6 A;  3OFH A;  4LQ9 A;  1X0F A;  3ELH A;  4KRW A;  3IR7 B;  4FBT A;  4ZHR A;  5HSP A;  1X5O A;  9ATC B;  1VQS A;  5DJB A;  5J2P A;  4KHP J;  1S59 A;  2DEJ A;  2ABY A;  5LT5 A;  2DIV A;  3G2X A;  1VLO A;  1NHK L;  2BKN A;  1IR0 A;  2JJ4 D;  1Q82 T;  2FZK B;  2EKY A;  3C16 A;  3JAM U;  2LXU A;  1S79 A;  1Y5L B;  2HFU A;  2MKC A;  4QYZ K;  1RT6 A;  2ADB A;  2KXN B;  3MM7 A;  2XS7 A;  1TV6 A;  3N0V A;  4HDG A;  3L3C A;  2OI2 A;  3EGZ A;  3QGH A;  1X60 A;  1EAR A;  3NMR A;  2KI2 A;  3OLB A;  1SC3 B;  1HYS B;  3GV7 B;  2KFZ A;  4CLU A;  2R7R A;  4A8K A;  1WWH A;  2RVJ A;  4O4G A;  2IFX A;  1RI7 A;  2XWX A;  2BJ8 A;  2KVQ E;  3L7O A;  2UXB F;  3PHT A;  3VGU A;  3QJJ A;  1S57 A;  2X3D A;  2G0I A;  2WVF A;  3DXS X;  3QYY A;  3PDN A;  2FPH X;  1RWP B;  5L38 A;  1UCN A;  2QMX A;  1PG5 B;  2VKR A;  3R5C A;  3G4S S;  1S0O A;  3ZTS A;  4OZ0 A;  1TKT B;  1NHU A;  5SUH A;  1DQ8 A;  3A3O B;  3FMW A;  1LK5 A;  2VQE F;  4PKD B;  3PYD A;  1VC5 A;  3GSI A;  2LEA A;  1TL3 B;  4NYZ A;  3GSD A;  3VQS A;  2QE5 A;  1OSC A;  3DLB A;  5IOL A;  3UN5 A;  2FGC A;  2JC0 A;  1D0E A;  4FN5 A;  3A13 A;  3J81 U;  5C7P A;  2PN6 A;  1NK8 A;  1U1O A;  4DL2 A;  3MM9 A;  1ZTT A;  2NXJ A;  4WXW A;  5C5J A;  2GAG C;  3JTO A;  3VF0 B;  1APS A;  3EE3 A;  4ETZ A;  4DU7 A;  2Y1R I;  3GG1 A;  1AYE A;  2EFV A;  2OMO A;  4V1A k;  4G6V B;  1Z2Z A;  2YNF B;  2RD5 C;  1J5O A;  2AGO A;  2CZ4 A;  2OGU A;  1S9G A;  3NS6 A;  4GMK A;  1Y5I B;  3T5J A;  1F9F A;  2RKI B;  1DBD A;  3KG1 A;  2YY3 A;  2WVD A;  5ETV A;  2W2O P;  4NX9 A;  4WIQ A;  5GAE U;  5FLX Y;  4RNF A;  5K8O A;  1LV5 A;  1K1Q A;  1Q7Y T;  2V4Q A;  3CCW A;  2FD2 A;  3PG9 A;  4AQY J;  1K73 T;  3K17 A;  3DGV A;  1KN6 A;  3Q24 A;  5KFM A;  3TJ9 A;  4QW9 A;  4P75 A;  2VIC A;  4RKU C;  1DFD A;  1GTE A;  1FDA A;  1ZA2 B;  2CIM A;  5B0B A;  3NOC A;  2V69 A;  3KUG A;  2KL8 A;  1FRX A;  3I9Z A;  4K4X A;  5A8K A;  4WII A;  1MLA A;  5M2P A;  5KG0 A;  3ISZ A;  3MDF A;  3CC2 S;  3W60 A;  4YFU A;  3DRP B;  1R8H A;  2ERR A;  1WI8 A;  3KLE A;  1HNX F;  4CM2 A;  2YBV A;  4ELV A;  4EK2 A;  3LTO A;  4NLQ A;  2XC9 A;  1H6K X;  2V4J A;  4U8V A;  2J0X A;  4P71 A;  1NND A;  4ANC A;  2LYV A;  1B99 A;  1N33 F;  3RBX A;  1N36 F;  3DOL A;  2J5A A;  4DR5 F;  4FPI A;  4I6Y A;  1UVM A;  3Q8V A;  1SJQ A;  5B0C A;  2AGQ A;  2OPR A;  1DUR A;  4HT7 A;  3NGR A;  3A1Y G;  2R2R A;  3H20 A;  4F4X A;  1NSK L;  2JRS A;  3OD2 A;  3SV4 A;  1C1C A;  1FNM A;  2Q6B A;  5E5N A;  5BXI A;  4Q8F A;  2RAQ A;  1HFE L;  4K4Y A;  5A2Q U;  2IHR 1;  4IFY B;  2YKN B;  5HAN A;  2M70 A;  1S0N A;  2AT1 B;  2NYI A;  2RIL A;  1HNV B;  4K0K J;  4P2X A;  3VAG A;  2VDH A;  3CCU S;  5M2R A;  4QZV B;  1P1L A;  2W9B B;  2PMW A;  4DSI A;  4RL1 A;  5IT0 A;  3POT A;  4J91 A;  4C97 A;  4B9T A;  3FSY A;  2WRM A;  2ZBC A;  3KNA A;  3Q8R B;  3FQK A;  4OLO A;  4F3M A;  1NSQ A;  1JXL A;  2VG7 A;  5LM7 E;  5H9E J;  2DH9 A;  1K0V A;  5J1E B;  2I8E A;  4RW4 A;  2LEB A;  1NCL A;  3IM9 A;  4FYW B;  1HYS A;  2HWT A;  1HBO A;  1VHF A;  1RYS A;  1EET B;  3U02 A;  5L9X A;  1SJ1 A;  4RUA A;  4DLG A;  1FRL A;  1UA0 A;  4GKJ J;  3TAN A;  5IT9 Y;  4DR2 J;  2RB7 A;  3FDS A;  2RHS B;  2KZZ A;  2BEF A;  3TEG A;  4ID8 A;  2XMW A;  1JJ2 R;  2G2O A;  4LFC J;  3K5N A;  2J9D A;  1HAR A;  1GTH A;  2G1D A;  5KFI A;  2CJA A;  3H90 A;  2LLZ A;  1JWW A;  2YKM B;  1R31 A;  1S6P A;  1FEE A;  3CSK A;  4LF8 J;  1T11 A;  3FEZ A;  4M95 A;  5CA5 A;  5H9E K;  4MJK A;  2HFO A;  3CJS A;  3N5F A;  1CQN A;  2PGC A;  1TAQ A;  4OZ3 A;  1FX2 A;  3FQL A;  1HBN B;  1VGY A;  4QIV A;  4KGX B;  1TL3 A;  2KM8 B;  1S97 A;  1FXL A;  4P10 A;  5CYQ A;  2C2R A;  3MTJ A;  4H4K C;  4IO1 A;  5KTQ A;  2XLI A;  3PRV A;  2L9N A;  2DO0 A;  4DDF A;  2B56 A;  4RW6 B;  1IN0 A;  1IJE B;  3NNA A;  3SI8 A;  2WSC C;  4C8N A;  3GV5 B;  1WDD A;  3HUL A;  3F73 A;  2XI2 A;  4DSE A;  5ETO A;  2CAJ A;  1F3V A;  5KFL A;  4DV6 J;  5JMN A;  1X31 C;  4KFB A;  2C22 A;  2F4V F;  2DGW A;  2R3V A;  4ECT A;  2PA8 D;  1LXJ A;  2ZDO A;  3QBC A;  3CCZ A;  3CD6 S;  3V81 B;  2UUC J;  4EYI B;  3PCO B;  3KK3 A;  4RUB A;  4RWX A;  4F0H A;  2FY8 A;  3GTY X;  4ES3 A;  3O44 A;  4ZPC A;  3WX4 A;  4DV2 J;  2RSQ A;  2N4C A;  3M05 A;  1VC6 A;  4ZS6 A;  4DU8 A;  2BJ9 A;  5KT6 A;  1IJF B;  2NS1 B;  2W2M P;  3OFE A;  4OHX A;  2LP4 A;  5HP1 A;  1RAI B;  1DZ5 A;  3G8Q A;  4QQB A;  4HLB A;  3QAE A;  4RLE A;  2FQQ B;  3CJ4 A;  4ZVT B;  1SL2 A;  3O6Q A;  4DG1 B;  1T03 A;  4IRC A;  1MG7 A;  2W24 A;  1U1R A;  2YWH A;  5F8H A;  4CRJ A;  2H48 B;  5JVH Q;  2CPD A;  2UXB J;  3D0G E;  1WD6 A;  4IFV B;  1K44 A;  1HQ2 A;  2HHQ A;  2DNH A;  4DF8 A;  1FD8 A;  1T94 A;  3MPV A;  2WB4 A;  3EZO A;  4J9K A;  2AD9 A;  1HD0 A;  4NLV A;  1L3K A;  2E7X A;  5CQG A;  2HS3 A;  2BX6 A;  2MZQ A;  4O23 A;  4DL3 A;  5D6G A;  1NPP A;  4H4K A;  3NWG A;  3M6X A;  4ED4 A;  1I51 B;  4LF6 J;  3DU5 A;  3PKM A;  2VQE J;  3NBP B;  1VQO S;  5DDO C;  2BOA A;  3PYF A;  3D28 A;  1S4F A;  1K9M T;  2W4P A;  3T5L A;  1RAG B;  2CAD A;  2MZJ A;  1LW0 A;  3CDB A;  3G8S A;  4JI4 J;  2PFD A;  3LWM A;  1V5I B;  4MKA A;  3PX6 A;  2E1A A;  3WIV A;  1BHN A;  1F5C A;  3SDE B;  5KFB A;  2HND B;  4HR2 A;  3IRW P;  1FRI A;  4HAC A;  3X1L B;  2YKO A;  4R8U A;  2G13 A;  3UCG A;  2Y0B B;  4TLR A;  3CC4 S;  3MPD A;  2B9X A;  5HL7 Q;  1U48 A;  2AKW B;  4YHH F;  3GII A;  1VBK A;  3K5M A;  3CJK B;  3D6F B;  2DCU B;  1D3W A;  1RWV B;  5LL6 d;  3TJA A;  1LFP A;  5B7W A;  2OPP A;  2KM8 C;  3K5O A;  4ZVS B;  2YKN A;  4F50 A;  3KHG A;  4ECZ A;  1SCJ B;  3M32 B;  2Z2L A;  5FII A;  2IC3 B;  5F8I A;  2VIH A;  4ECR A;  3BR8 A;  1CPZ A;  1TAU A;  3MD3 A;  3KK1 B;  3PZP A;  5EWG A;  3MMJ A;  2ILZ A;  3L9Z A;  3MMC B;  1N0U A;  1YK9 A;  3E01 B;  4AE5 A;  3P49 B;  1Y3J A;  2COL A;  5KFK A;  4DSF A;  3DLJ A;  3BJY A;  1L3U A;  3IO1 A;  3OL8 A;  4LRB A;  2V67 A;  3FCV A;  1FWL A;  1WKK A;  2N3O A;  2H9Z A;  3PHE A;  3Q2T C;  1SQE A;  3HMJ G;  2MZS A;  4KHR A;  4HH0 A;  4KO0 A;  1UPP A;  3SQO P;  1X7V A;  3FSI A;  3C6T A;  2NUH A;  4X4T A;  3SCL E;  4QIG A;  4C3L A;  4U7U K;  1IKV B;  1N5Y A;  1RA6 A;  3JSY A;  4LBP A;  4DR5 J;  4CO2 A;  1PBU A;  4DV1 F;  5ETL A;  1UWB B;  1HHS A;  3OJU A;  5BJR A;  2MB0 B;  2HBZ B;  1HBN A;  3OHA A;  3HHL B;  1NLK L;  1HWU A;  2QN6 B;  3AD7 C;  2D69 A;  3QGP A;  1NUE A;  2BJE A;  2E7W A;  4C0B A;  5K20 B;  2CPF A;  1LQ9 A;  4P2F A;  4GKK F;  5J2M A;  4KH0 B;  2DIT A;  1VDH A;  1C0U A;  1UVI A;  5DET A;  2OAU A;  1TL7 A;  2IM3 A;  4IG0 A;  3IAS 9;  1DTQ A;  2MHE A;  1OPZ A;  1T3N A;  1SH2 A;  3MCM A;  3G6V A;  4DR7 F;  2F7V A;  2KHD A;  4ELU A;  3VAF A;  4Y3C A;  2D3O 1;  4RW7 B;  3HZE A;  2ZUG A;  2NRE A;  5AJ3 F;  2BQ3 A;  4JV5 J;  2FYX A;  3DCA A;  3V6K A;  1PYO B;  3W9I A;  2CDR B;  2HS4 A;  1T3O A;  4I64 A;  5IM0 A;  2QEX S;  4R5P B;  2DH7 A;  3CD7 A;  4MTP A;  4QIE A;  1N0V C;  2CNK B;  2D3Z A;  1SKS A;  1QVF R;  4DR4 F;  1TP7 A;  2XS2 A;  3W2V B;  2DR9 A;  5IV4 A;  1VQY A;  1DAX A;  3UI3 A;  1W2B R;  2XS5 A;  2QT7 A;  3CIZ A;  3M9N B;  3NKY A;  2UVU A;  2XMM A;  2JFD A;  2H65 B;  1OYD A;  2ZUA A;  4I6W A;  2D3U A;  3BM7 A;  1NK7 A;  2RE1 A;  1LNQ A;  2UU9 F;  2PI4 A;  1HLW A;  2IA6 A;  4ZVR B;  4PQA A;  2A3J A;  4JI2 F;  4ZVQ B;  5HBM A;  3Q22 A;  5JVG Q;  4F3O A;  3HHK A;  4IFV A;  5KFP A;  4OHV A;  1B0V A;  3K89 A;  1JLQ B;  3N01 A;  1U1M A;  1RWU A;  3MED B;  3C6U B;  1CC8 A;  5KOX A;  2GX8 A;  4NLR A;  3JYT B;  4LF9 F;  5ETT A;  3D3C J;  2OPQ B;  1GMW A;  1RWO B;  1QSS A;  3PKY A;  3G82 B;  2B8Q A;  2B9Y A;  2VUG A;  3D7S B;  4CLW A;  2GO9 A;  4QW8 A;  4G1Q A;  1ZBT A;  4ZN3 A;  1CQM A;  4I2P B;  3VGV A;  2HZA A;  1TUV A;  4L76 A;  1HQU A;  5D4O A;  1GAO A;  2CZV C;  4EBC A;  3V6H A;  1T9V A;  1FKO B;  2VG6 B;  3VAH A;  1FHT A;  1WG5 A;  4PR6 A;  3RGI A;  2MXY A;  3D1H A;  3UR3 C;  4UUX A;  2EEY A;  4XDD A;  3IAM 9;  2NSC A;  2JVR A;  2F4F A;  5RUB A;  1IKY B;  1TVR A;  3SDE A;  1LWF A;  2HND A;  3MAA A;  4TY8 A;  3D6T B;  4OLP A;  1ARO P;  1P8G A;  4NLD A;  4ZVH A;  2FHJ D;  2EFO A;  4DV7 F;  1AZS A;  3RUB L;  1X4G A;  3NY0 A;  4NRU A;  4WP9 A;  1V3R A;  2ZE2 A;  1XTZ A;  1UZH A;  3QAT A;  4B9M A;  3HHL C;  4ZVF A;  1UVK A;  2CG8 A;  5C2C A;  5KT3 A;  5GMD A;  1F60 B;  4BWM A;  3RBZ A;  2AP6 A;  1WHX A;  3R1H A;  2VFV A;  1ZPV A;  2Y0S D;  1F2H A;  3BB5 A;  4LBI A;  1RT4 B;  1ULR A;  3HSG A;  3GFX A;  4F26 A;  4W98 A;  1H7W A;  3CE8 A;  1RHR B;  4CI0 B;  3CJR A;  3UN3 A;  3ET6 A;  4WFY A;  2HGL A;  1A0O B;  3D5M A;  1S1X A;  4Q45 A;  4Y28 C;  1RTH A;  3HKW A;  4DV4 F;  4M5H A;  2RH3 A;  1EKS A;  2R8I A;  1RWW B;  2J9C A;  3VVU A;  4JYA F;  2VC1 A;  1QD1 A;  4AFF A;  2GGP B;  1T9Y A;  2HG4 A;  4PXE A;  2WSE C;  4OI4 A;  2XSJ A;  3DHW C;  4RBV A;  1VQL S;  3SCJ E;  5KG2 A;  2K8G A;  2J9E A;  3HHD A;  1MRO B;  2VD3 A;  1JLA B;  1WI6 A;  1DTT B;  4C4W A;  3GON A;  3EM1 A;  3U7J A;  2K2P A;  5I4M A;  4YB6 A;  3OPK A;  4OZ5 A;  3NNC A;  2ZEJ A;  1GT8 A;  5A0Y A;  4X4Q A;  2YTC A;  1BUX A;  1NK6 A;  4X84 A;  3QLH B;  5HN0 A;  4WZQ A;  3TVZ A;  2ACY A;  2UXC F;  2CQG A;  3OT9 A;  1DRZ A;  4ATN A;  2L41 A;  3I0R A;  1YSJ A;  4RW9 A;  1ROF A;  2QMW A;  5F8N A;  1RTD A;  3ITH B;  1LOU A;  4YN3 B;  2HNY B;  4X62 F;  4QWC A;  2PII A;  2MQL A;  5ETM A;  3D67 A;  3HHL A;  2D74 B;  3TAM B;  3AA8 A;  2YNH A;  3RB3 A;  1X9M A;  4GVB B;  3IGN A;  1NK4 A;  4D3G A;  1EIY B;  3VVT A;  2R7U A;  1HBU A;  2EG2 A;  2OKQ A;  4OQJ A;  2E5L F;  3NWR A;  4YHH J;  3VGT A;  2HIQ A;  1FDN A;  3AA9 A;  2HHP A;  1XER A;  2BUN A;  4J9R A;  1EJ7 L;  3S1T A;  5HVG A;  2B5J A;  4HHJ A;  2VPX B;  2QLJ B;  4MT1 A;  3ETM A;  4K4U A;  1GH8 A;  2HQF A;  1KHW A;  3ZZO A;  1HNI B;  4FYV B;  4ECX A;  1O8B A;  2R7S A;  2HBQ B;  2DHX A;  3HHE A;  4DR6 J;  3NLC A;  1RAF B;  2DNM A;  3IRX A;  1JK9 B;  5I3U B;  2UZA A;  4JI7 F;  1NHV A;  2R2U A;  2F9J A;  3TNV A;  2YPZ A;  2V2K A;  2IBK A;  1U1N A;  4FKY A;  3QGI A;  4WU3 A;  2FJV A;  1ZM3 A;  1RT7 B;  2CPE A;  2HBR B;  2GIQ A;  4ZLJ A;  2EK1 A;  2NSB A;  1Y0H A;  2ZJR Q;  2XGP A;  1GK8 A;  1KFS A;  4CLL A;  4Z37 A;  4J7C A;  4A8O A;  5C25 A;  3OLA A;  2HHW A;  4LVN P;  2V34 A;  2FC9 A;  4ZVU B;  5KG5 A;  2XMU A;  1VCT A;  2BQR A;  1FCA A;  3D3B J;  4ZVP B;  4WJB A;  4CLP A;  4OYX A;  4K4T A;  1HD1 A;  1YJU A;  3QWU A;  1S1W B;  2BJ3 A;  3H98 A;  2H5J B;  2K7J A;  3LOU A;  4NLO A;  2ZBP A;  5CD4 H;  3MMA B;  4R0J A;  2XHC A;  3MED A;  3WQP A;  3KLG B;  2W9A A;  2AW0 A;  3JYT A;  2Y3Y A;  2V0N A;  3G82 A;  3HLU A;  4WP3 A;  3VWS A;  3M8Y A;  2QFI A;  4DR1 F;  4DV1 J;  2Y8W A;  1X4F A;  1S6Q A;  3AQO A;  2OFG X;  2KRR A;  3LGH A;  3CF5 Q;  4I69 A;  3CXC R;  5IV3 A;  5FLX U;  2IAJ A;  1BXN A;  3BEG B;  1PIE A;  2VG6 A;  2V2V A;  4NE9 C;  1RTJ A;  1VIX A;  2YQ1 A;  3RB6 A;  4GKK J;  4LQ3 A;  2AV5 A;  5E3R A;  4USV A;  3MWB A;  5A8R B;  4FVC A;  5EUH A;  2Z30 B;  2N4D A;  5GAD I;  1NKB A;  3W1Y C;  3FGV A;  3LA0 A;  1R0B G;  2B7C B;  1K8A T;  4WBF A;  4U95 A;  1U1L A;  1WOO A;  3I56 S;  3V5R A;  5F3T A;  1SI9 A;  2W7A A;  4DR7 J;  4J9L A;  3MOZ A;  4C3M A;  2M2B A;  3EVO A;  1R0A B;  2MLY A;  2O01 C;  2C42 A;  2MDA A;  3UD4 P;  4N8O A;  7FDR A;  1M5P C;  4RUH A;  2MKJ A;  1S9E B;  4DR4 J;  2QL9 B;  3KMS A;  1VI7 A;  2D9O A;  3IBF B;  3SIP B;  1FFG B;  3W5X A;  3CW2 C;  2D9P A;  5ETS A;  2ATL A;  2UUB F;  2HNZ A;  1R7I A;  5DQG A;  2UUT A;  3E2E A;  3AHP A;  3OR1 A;  2UU9 J;  1M1G A;  4JI2 J;  1XBW A;  1RT3 A;  1UVJ A;  2GVD A;  1AUD A;  2QIF A;  3AT1 B;  1KDN A;  2Q3P A;  4LF5 F;  4KY3 A;  4WP8 A;  1ZET A;  3ILO A;  4O4R A;  4NCB A;  3B4D A;  2VQF J;  1J5E J;  1JNZ B;  2ILY A;  3BKT A;  4OZ1 A;  4K2J A;  3N6M A;  1U0H B;  3C3L A;  4WFX A;  2CA9 A;  4CLT A;  2LQ5 A;  4DPW A;  1REV A;  3H2L A;  1QAX A;  3SCI E;  4IOC Q;  3BSO A;  3F41 A;  1PYS B;  1YZ7 A;  2CFX A;  1EP4 A;  3MMB B;  1D1U A;  1H2T Z;  5DG7 A;  2UXD F;  1FVQ A;  1T8E A;  4IOA Q;  5K14 B;  1P9Y A;  4F04 B;  2C2M B;  3PW7 A;  2MQ8 A;  4CTA A;  3NGU A;  1T7P A;  4OYO A;  2ZZM A;  2HGM A;  4X65 J;  2AJ2 A;  3IBW A;  1B7Y B;  4ZPT R;  4IRK A;  1IUJ A;  3OL6 A;  1OQ3 A;  1CJK A;  3K7R A;  4WWS A;  5IT4 A;  4USJ C;  1JJH A;  2LQB A;  1C0T A;  4DV7 J;  2ZHO A;  5AE2 A;  1HNW F;  1WOR A;  5LMU F;  2AQ4 A;  2AJF E;  1NDP A;  2WBR A;  3LH2 S;  3PM9 A;  3GIL A;  3CCM S;  2CPX A;  4ED0 A;  1KRP A;  4KPY A;  5IT9 U;  2R8J A;  5J2Q B;  2CJK A;  6AT1 B;  3H59 A;  4ID5 B;  3K2Y A;  2RU3 A;  3KJN B;  4URQ U;  1VS3 A;  5FD1 A;  1RAO A;  1WKL A;  1WHV A;  2GA7 A;  1HI1 A;  4CH0 S;  3CO0 P;  4JI3 F;  1S6U A;  1GX5 A;  1FD2 A;  3DKD A;  4ED8 A;  3CDA A;  4B3R J;  5D77 A;  2OP5 A;  3CJ8 A;  2DY9 A;  1FWK A;  4IH7 A;  4I68 A;  4ILM A;  1HW9 A;  5KFU A;  3L09 A;  3DLG B;  1CJT A;  5H9F J;  1MWZ A;  2YNG B;  3CCV S;  2XSF A;  4LRA A;  4H4O B;  4OV1 A;  2F5G A;  5KT7 A;  1C1B A;  1PIL A;  2L3M A;  4KC5 A;  4OZN A;  3E8O A;  3U1M A;  4HH1 A;  3WDO A;  8ATC B;  3HM9 A;  2MKY A;  4DUY J;  2KU7 A;  2ZWO A;  1SKR A;  3KHL A;  2OPS B;  3MUT P;  3IS9 B;  3CIM A;  2P9G A;  1Q4R A;  1NJX A;  2UXC J;  2G0C A;  1HQE B;  2BAB A;  3MMA A;  1SC1 B;  5DLF A;  3TRG A;  1Y3K A;  4W90 B;  2HRT A;  4HTJ A;  2XYH B;  2FGO A;  1CJU B;  1S7I A;  2MY7 A;  1Q16 B;  4WTO B;  3ZZR A;  4DF4 A;  2X51 A;  4X62 J;  3TW0 A;  1HW8 A;  4M5G A;  4Y0F A;  2W25 A;  3RJM B;  3R2C J;  4CH1 A;  2E5L J;  1Z1Z A;  1FES A;  5E41 A;  3HHL D;  4IG3 A;  1O6X A;  2ZVI A;  1W25 A;  3RRG A;  4P7V A;  4WTY A;  2E66 A;  1Q8L A;  2D7S A;  1IQT A;  2VPY B;  3HSD A;  3HDS A;  3IM8 A;  4J9U E;  1TKD A;  3CCE S;  4EO8 A;  2Q43 A;  3KOA A;  2JFK A;  4OX9 F;  2WAQ D;  3DI6 B;  4G65 A;  4ZP6 A;  1N54 B;  3VTI A;  2UUA J;  2ZD1 B;  1U6B A;  2LDY A;  1ZAW A;  4TLQ A;  5LJ3 Y;  3HCX A;  1TR0 A;  4JI7 J;  1QUV A;  2RUG A;  3GZ7 A;  3FBB A;  2Z58 B;  1UEV A;  3SQG B;  3DOM A;  2K06 A;  1BQX A;  1YLX A;  1S9E A;  3FVY A;  2BKO A;  5T41 A;  1V9O A;  3G9C A;  1P27 B;  4PG6 A;  3N6L A;  1RT2 B;  2LU2 A;  3OR2 B;  2BW7 A;  3E3X A;  2H51 B;  3MF5 A;  3P96 A;  2FLL A;  4FS1 A;  2HMI A;  4DZD A;  4QU6 A;  4B3O B;  3JSB A;  4FP9 A;  1M0S A;  3OVS A;  5CZV A;  1HPZ A;  1SIZ A;  3QFW A;  1IBL J;  5KFW A;  4F4K A;  3PJX A;  4ALZ A;  2QJ3 A;  4DL0 C;  2KYZ A;  3H5Y A;  4TY9 A;  1V3S A;  1TL1 A;  1QSY A;  2IVY A;  1Q86 T;  3AY0 A;  2XMK A;  5F8G A;  3THV A;  3CDE A;  1XC9 A;  3VZI A;  4DR1 J;  2ZH3 A;  2HBY B;  3Q2S C;  3ISN C;  1U45 A;  3P4U B;  2HAI A;  3PW5 A;  4HTI A;  1WC4 A;  2HWI A;  2CQD A;  3MMB A;  3OTE A;  3NS7 B;  1WKJ A;  4XPC A;  2XQC A;  3T6J A;  3M2U A;  4NCG B;  3C8Y A;  3DLK A;  2MEW A;  3CMQ A;  1JLG B;  3GYG A;  3AJD A;  3FBC A;  4B02 A;  4DUZ J;  2B43 A;  2WK4 A;  3IG1 A;  2J8S A;  3TAR A;  3HPO A;  3PIP Q;  3T5H A;  1UA1 A;  1I1G A;  4ECS A;  2VV5 A;  3GCW P;  1EZZ B;  5AT1 B;  5HMX A;  3MEG A;  5F0U A;  3FJ2 A;  1I94 J;  3MR3 A;  1RTZ A;  2JNJ A;  2WON B;  3KK2 A;  1WTF A;  2ZH7 A;  3V6D B;  4RR5 A;  2W7O A;  4DQI A;  2EC2 A;  2MY8 A;  1RCX B;  1S7H A;  7AT1 B;  4Q2L A;  3R5B A;  1KQK A;  2XCA A;  4X4N A;  3TUI C;  2WW8 A;  3OUY A;  3LF0 A;  1U1P A;  4MKV A;  4K4V A;  1FDB A;  4NLP A;  4ED7 A;  4DL7 A;  4OZL A;  2PA3 A;  4AL6 A;  3VAM A;  1NSP A;  4LIR A;  2MKK A;  3GWC A;  1X4D A;  4LF5 J;  4ZPV R;  1SC4 B;  3DLG A;  2G4B A;  1TUW A;  4C6A A;  3J7A 1;  1T05 B;  3DM2 B;  3OVA A;  1T9U A;  2DGO A;  1N34 F;  2Q1L A;  4OMF G;  4MYT A;  4ZJL A;  1YHQ S;  3M1V B;  3JSM B;  4CH7 A;  3UVJ B;  2M5Y A;  4LMZ A;  2KHC A;  3NCR A;  4LIW A;  3R5A A;  2GCF A;  4KAI A;  4Q5V A;  3QQC D;  4GVL A;  1QAJ A;  2UXD J;  5IWA F;  3NCP A;  2JWN A;  4FZV A;  4Q43 A;  2CQ2 A;  5B0D A;  2HHS A;  3I82 A;  3UD3 P;  3QRQ A;  3CJ2 A;  3PFE A;  3MM5 A;  2ZNY A;  2B4U A;  1JLE B;  1L5U A;  3ENA A;  5HO4 A;  5KFA A;  4BC9 A;  5GAE I;  3DOK A;  3IWN C;  3EGV A;  3HFK A;  1WDT A;  4CWB A;  1VC0 A;  4EO6 A;  3BPS P;  5DZ6 A;  4B9V A;  4RU9 A;  2PD1 A;  2HAF A;  3GMG A;  2W8K A;  3ZZP A;  3JXO A;  4J9P A;  4KBI A;  1D09 B;  1WC1 A;  2PMH A;  4RWW A;  2NXN A;  3BPD A;  3BRE A;  4ZPB A;  4B08 A;  4TVA B;  4EEY A;  2F40 A;  1Q7L B;  3KTQ A;  1FF2 A;  4FXW A;  1KLM B;  1RT5 B;  4CO3 A;  4H54 A;  3U1N A;  2J6S A;  4ZIW A;  2DNP A;  2BA9 A;  3H40 A;  1QE1 A;  1HHT P;  5DLG A;  1B64 A;  2HPU A;  4AXJ A;  3LP1 B;  3QJP A;  2LCW A;  4DPY A;  4E2F B;  4RUC A;  3TAQ A;  4LF7 J;  3ZTQ A;  1XJW B;  1YRT A;  1U47 A;  3HT0 A;  4DLE A;  2DT9 A;  3GYX B;  3EZU A;  4ED3 A;  3M30 B;  4OYM A;  3B6B A;  1DLO B;  5GMK a;  1BQN B;  2NLW A;  1N6Q B;  1N4L A;  1NME B;  1CS4 B;  2ZKU A;  4J90 A;  2I6W A;  3P6Y C;  5D0H A;  3KDO A;  3SSR A;  5GAH U;  3DRR A;  2QX0 A;  4I2Q A;  4NI2 A;  1FDD A;  2ZH2 A;  4A8S A;  1S1T B;  1AT1 B;  2AYE A;  3UFC X;  1M90 T;  1KWM A;  2MLX A;  4IQM A;  3HVT A;  4Q2M A;  4PZV A;  4FKX A;  4KKO B;  1XNQ J;  4PPZ A;  2L48 A;  1IKX B;  4PAB A;  4I4B A;  5KFR A;  4UT4 A;  3AJ1 A;  1IBK J;  5KT2 A;  1GQE A;  4ZN1 A;  2ZVS A;  3T1H J;  2J0S D;  2I0X A;  1T9T A;  4MKB A;  2L9W A;  1HNZ F;  4DL6 A;  3TA2 A;  3UN2 A;  3GFZ A;  1LXN A;  3M6W A;  2YX4 A;  2HHH F;  5D3G A;  3ENV A;  3PY8 A;  2R2T A;  4OX9 J;  3M2R A;  3EDQ B;  2OLW A;  2VL1 A;  3D1O A;  4PUO B;  3FFI A;  3BH6 B;  3FZB A;  2GIR A;  3LP2 B;  3K58 A;  4DV0 F;  1IXK A;  3V4I B;  3BN4 A;  3H8Y A;  5CCM A;  4Z2X A;  5IZH A;  2B6A B;  3DRS A;  2L08 A;  2YWW A;  1RAH B;  2QA4 S;  4QPX A;  3EIC A;  4KGK A;  4NZ7 A;  4F25 A;  4K5R A;  3V6D A;  2CQ4 A;  2DNO A;  4RU2 A;  4ZVE A;  5E33 A;  3R5G A;  5B0E A;  4F4W A;  2OUG A;  4CT9 A;  2BM0 A;  4ZK7 M;  2V8V A;  4O3R A;  5L8R C;  1XMQ F;  3HSJ A;  2C2N A;  4DSJ A;  3DRX A;  2XY6 A;  2DO4 A;  4C11 A;  3MM8 A;  3O3L A;  4MFB B;  2XUL A;  3LW5 C;  4ZHR B;  1U7L A;  2K3I A;  5J2P B;  2DD8 S;  4XTT A;  4WK3 A;  4YS2 A;  4OX7 A;  5F8M A;  1S77 D;  1M1H A;  4P72 A;  1SJ3 P;  1VFJ A;  4DSK A;  1RT6 B;  2VC0 A;  2CNO B;  3MM7 B;  1YI2 S;  1TV6 B;  3NS5 A;  3I96 A;  4J9M A;  2HYI B;  4OZJ A;  2IBO A;  3AOB A;  1XNR F;  2ZH8 A;  5EDW A;  2R2S A;  1WF0 A;  4RX6 A;  2K7K A;  2LXI A;  2VFT A;  1VMB A;  4O4G B;  4WXO A;  5AE3 A;  3CD0 A;  4NXN F;  3V6J A;  1S1U B;  3B82 A;  4N77 A;  2DHA A;  1UVL A;  2RT3 A;  2WOM A;  2LA6 A;  4RPF A;  3I0S A;  4JI6 J;  3C66 A;  1MWQ A;  5MAO A;  3ETO A;  3VAI A;  4C3K A;  1U24 A;  3EVM A;  1QLN A;  3IWL A;  1KKH A;  3CJ3 A;  3OTO F;  3W64 A;  2E29 A;  1FVS A;  4RNO A;  1MW7 A;  4P2S A;  3KHH A;  5IQQ A;  1NJW A;  3N79 A;  4K5S A;  4KV8 B;  1CUL A;  4CT8 A;  2DIU A;  4M5D A;  1RUS A;  4URG A;  3KJV A;  3ILL A;  1G7C B;  2XWY A;  4M5M A;  4DFM A;  4DWI A;  1WG4 A;  4C7Q A;  1D8Y A;  3BQ2 A;  4M5L A;  4ERD A;  2IIH A;  3TAP A;  3R27 A;  2ASL A;  3MM9 B;  4O3N A;  1WG1 A;  1KTV A;  2E1P A;  1IBM J;  3CGI A;  3BN7 A;  4JI0 F;  2CUY A;  1FKA F;  3SMZ A;  4OI3 A;  5CAA A;  4QR0 A;  3AXK A;  1J5O B;  3W9J A;  4USK A;  1S9G B;  3B8H A;  5IC6 B;  1Q8K A;  2GHW A;  1W26 A;  3IR5 B;  3TUZ C;  1VBZ A;  2DHG A;  3AXM A;  4IR1 A;  3KG0 A;  1M5K C;  3KJQ B;  3HI9 A;  4E0D A;  5A6W A;  2ALZ A;  5IWA J;  1VLY A;  2YWK A;  3MXH P;  2CWX A;  3HO1 A;  2HHT A;  3MCN A;  2FJE B;  4FS2 A;  3A8E A;  3HJV A;  1VQ4 S;  2HZC A;  5CYM B;  4ZJO A;  1S76 D;  3CME S;  2VFS A;  3SZ2 A;  2WTF A;  1XMO F;  3D66 A;  2DNL A;  2QYG A;  1L3V A;  5A8K B;  3W5Z A;  3DYA A;  1M5O C;  4CO5 A;  3QNW B;  1TU0 B;  2LU1 A;  2P5V A;  2IJR A;  5LJ5 Y;  5A76 A;  3GJQ B;  2BE7 D;  3KLE B;  4EBD A;  1S1V A;  1H2V Z;  2CQ3 A;  4LSL A;  3TYT A;  4B9U A;  9RUB A;  2QYC A;  3SFG A;  1RK8 A;  1K0T A;  4CDI A;  1BY9 A;  2XMA A;  2V4J B;  3PW2 A;  1BLU A;  1XMB A;  5KFH A;  3PW0 A;  4I67 A;  2AHO B;  2IPO B;  1FRM A;  1A6L A;  1M1K T;  3NEK A;  5KFD A;  3DOL B;  1X4E A;  2DRD A;  1QJH A;  3JSR A;  4JBC A;  3PO4 A;  4UQG A;  2JEJ A;  3G6E S;  3HZG A;  4N56 A;  4DX5 A;  2HEK A;  2OPR B;  4O0N A;  2F63 A;  4N76 A;  2NYH A;  1K47 A;  1SC6 A;  2DY1 A;  4V19 J;  1S6O A;  2PEH A;  2CNN B;  3QRR A;  1SH0 A;  1C1C B;  1RIS A;  4ZJQ A;  2GJI A;  1RAD B;  2BJ7 A;  3CD5 A;  5L1I A;  3DMJ A;  4YEA A;  2MKI A;  4X64 F;  3QT5 A;  2I1R A;  1Q5V A;  1XIQ A;  3F56 A;  1R89 A;  3MPY A;  1RXO B;  3GJR B;  3PTW A;  2KJW A;  1MML A;  4QPT A;  2VFR A;  3G87 A;  4GO7 X;  2LEP A;  3I5A A;  4JI8 J;  3BKU A;  3ICL A;  2IVM A;  4PRF A;  5LMN J;  3TOQ A;  2RJZ A;  2IM2 A;  3UR0 A;  2A2D A;  2AX0 A;  3POT B;  4CLZ A;  1D9A A;  3BSA A;  4B3S F;  3B4M A;  2YWE A;  2VG7 B;  2YKA A;  3T9Z A;  5LXY A;  2RQC A;  1E6Y A;  2RRN A;  4L3N A;  2MGZ A;  5BYS A;  4RBT A;  2IDE A;  4RW4 B;  1YIT S;  4WFB Q;  1T9X A;  1RBL A;  2FHK A;  3QGG A;  1HBO B;  1N5T A;  3GCX P;  3BYP A;  2J0W A;  1LKZ A;  1UL3 A;  3BO2 A;  2AJ0 A;  3PW4 A;  4QCL A;  2HHH J;  3R8Y A;  3WHI A;  1S1U A;  5D4N A;  4JV0 A;  3RAM A;  2MZT A;  4USU A;  3UWT A;  3P5B P;  4ILR A;  3CJ0 A;  3GLJ A;  3G6Y A;  4C8Z A;  2HVH A;  1VRT A;  1IR2 A;  2JVO A;  4ZDN A;  1ZYQ A;  5U47 A;  2DR7 A;  4PQU A;  3C19 A;  5D4L A;  4O44 B;  5C24 A;  3IR6 B;  1S6P B;  2RDJ A;  4JI5 J;  1B3T A;  2YPY A;  1JJC B;  1RHM B;  4QJV A;  2MKH A;  5I42 A;  2KH9 A;  4QOT A;  3D0H E;  4KV8 A;  3Q8Y A;  4PYD A;  3QIP A;  2IDL A;  5CYQ B;  2AYG A;  1SQG A;  4FXD A;  2HVZ A;  2GMH A;  1MWY A;  4TU8 A;  3PAC A;  3LPE A;  3UE2 A;  2XYG B;  4HI1 A;  4LRE A;  2ZH4 A;  2V2Z A;  3Q0A A;  2J9D E;  2IY5 B;  2VOO A;  4FNI A;  3JS9 A;  4MMO A;  4QWB A;  4NXM J;  3EZ5 A;  1L3S A;  4DV5 J;  2MPU A;  2UVV A;  2ZJQ Q;  1YRX A;  4YME A;  4KFB B;  2CRL A;  1U1K A;  5KFN A;  4CLY A;  2V8D A;  3EPI A;  1NB2 A;  4A46 A;  1FFW B;  3KK3 B;  3N5B A;  4KGZ B;  1KVJ A;  1RJJ A;  2QG9 B;  3IA0 A;  1KC8 T;  3MCO A;  4A4J A;  1JKH B;  2X1B A;  2ASD A;  1VQ9 S;  1U1Q A;  2ROE A;  1O5J A;  3DNC A;  1OY6 A;  3CJQ A;  3Q83 A;  4CIO A;  4DR3 F;  3JB9 k;  5LSO A;  5HP1 B;  3R1L A;  3CUN A;  2HHX A;  1BC6 A;  2DNY A;  4LF4 F;  3IWX A;  1B0P A;  2WZ1 A;  2IJN A;  1RWK B;  4ZP7 A;  2GMJ A;  2D41 A;  3RRK A;  2FZC B;  4YR3 A;  1T03 B;  1PC4 A;  3HP6 A;  2GHP A;  4NXN J;  4DS4 A;  5CYM A;  5E3C A;  4ZP8 A;  2K3K A;  2W9C B;  1RHJ B;  2IM1 A;  3MR6 A;  4N41 A;  4C0O C;  3DXB A;  2Z56 B;  1FER A;  2GHV C;  1PKU A;  2E9T A;  4OHY A;  4QYR A;  3HFZ B;  4X66 J;  3J7A N;  2IYI A;  5A2Q Y;  2N82 B;  4H4M B;  4Q0B A;  3OTO J;  2BE2 A;  5D8H B;  1RP5 A;  4C9D A;  2M9K A;  5ETR A;  4RNM A;  4M5J A;  5J1P A;  1OY8 A;  2XY7 A;  2IRU A;  2UVW A;  3DDI A;  2AGP A;  1YJW S;  2L9D A;  3EXC X;  1WOP A;  1QAY A;  4G3I A;  1FNO A;  2XZW A;  5KG1 A;  4ICL A;  1LW0 B;  2IMW P;  2HHU A;  3G71 S;  1RWX B;  2VA2 A;  1YRU A;  3O5T B;  3QAU A;  2VJU A;  1M5V C;  1KQG B;  5KFC A;  2V68 A;  1X4A A;  4JB8 B;  1YGY A;  2Z2Y B;  3PR5 B;  2GO8 A;  4HAC B;  5HAT A;  3V2U C;  4R8U B;  2I38 A;  3SXL A;  1KOH A;  2XG8 A;  3G6X A;  4ZLL A;  3GIK A;  4B9S A;  1PAU B;  1JXV A;  2ZIT A;  1AFJ A;  4KJI A;  2BBE A;  3TUJ C;  2J6U A;  1R8P A;  1U8S A;  1JNR B;  2OIH A;  3R9L A;  4HI2 A;  1VHI A;  2OPP B;  4C48 A;  3DLE A;  4ZVO B;  1O51 A;  4PG8 A;  3GPA A;  1GFW B;  1X4B A;  1BE4 A;  3QWP A;  1GEH A;  4HDH A;  4ZCL A;  4ED5 A;  1NK9 A;  3CB4 A;  3C15 A;  4TYA A;  2RML A;  3FK4 A;  4LRF A;  3M8P A;  4ENO A;  1L3T A;  1V5V A;  3OXG A;  4QR1 A;  4YB1 P;  4LFB J;  3D68 A;  2BRL A;  2OO4 A;  3LAM A;  2I9S A;  1HI8 A;  4BLG A;  3UCU P;  3TX0 A;  1F0X A;  3N4W A;  2V94 A;  2KN4 A;  4CO1 A;  1SPB P;  3Q23 A;  2B4P A;  3TI0 A;  4DXL A;  4K4W A;  4LR8 A;  3H4B A;  3M7V A;  1URN A;  2A18 A;  4KO0 B;  3HT3 A;  1TK8 A;  4J5O A;  3C6T B;  4ILL A;  3A12 A;  2Q6C A;  3B78 A;  3BBC A;  1HIY A;  4O44 A;  4YOE A;  1N5Y B;  4ES2 A;  4QBU A;  2W1B A;  1HR0 F;  1V3Z A;  3M8Q A;  4PG5 A;  1VR6 A;  2ZBQ A;  4Q7A A;  1X0P A;  1EKR A;  2IA0 A;  3M2V A;  5D15 A;  3D54 A;  5A8W A;  1WHW A;  3ZNU A;  2IYG A;  4DQS A;  2P9E A;  1P9Q C;  2V6A A;  4RNN A;  4TU9 A;  6FD1 A;  1RAB B;  5J2M B;  3UDL A;  3N9U C;  2P2C B;  1KBR A;  1J27 A;  5DM7 Q;  3PVX A;  1RT1 A;  3PJW A;  1C0U B;  2HGN A;  1TL7 B;  3K5P A;  2M3D A;  4IG0 B;  2YH1 A;  1DTQ B;  2QA4 G;  2O66 A;  1H3D A;  4A8Y A;  2VB6 A;  1PJ7 A;  2O1P A;  4MK7 A;  1YZ6 A;  4YDD B;  1ZZN A;  2BDP A;  4UZB A;  3ZTR A;  5T14 A;  4DV3 F;  3OW2 R;  1JKH A;  5IM0 B;  1WSR A;  3C2P A;  5B08 A;  1F1B B;  3JQM A;  2EK6 A;  4FF2 A;  2RU9 A;  2FJW A;  4KHP F;  2RF2 A;  1ZOT A;  4B9L A;  1JLF A;  4I0W A;  2P6T A;  1KON A;  2EC0 A;  1LWE A;  1PYT A;  3OFF A;  4OI2 A;  3MUV P;  3I4P A;  4F4Z A;  4WF9 Q;  2I5J A;  3BYR A;  1BMQ B;  1VRU A;  3GFH A;  3H42 A;  5HBM B;  1RKJ A;  1YJR A;  5EGY A;  2W9C A;  2FVQ A;  2CZ9 A;  2YQ3 A;  2RQK A;  4NYO A;  2JHE A;  2EVZ A;  4P9S A;  5HLF A;  2C3M A;  4K7Q A;  1A9N B;  1IVZ A;  3AH6 A;  3I6P A;  4H4M A;  1XQI A;  1PGZ A;  4G1Q B;  3EUN A;  2E1M C;  2XY5 A;  1RAC B;  3PEH A;  1HQU B;  2C2D A;  3PEJ A;  2EXU A;  4QWA A;  2DGV A;  3KLI A;  1WC0 A;  2MJU A;  2BV3 A;  3BKF A;  5EX0 A;  2KVI A;  2GJF A;  3D4J A;  3DFE A;  4MAK A;  4CQ1 A;  1T02 A;  3RBD A;  4CLF A;  2LFV A;  3SBM A;  1JLC A;  2DNR A;  2UP1 A;  1H38 A;  1TVR B;  3FRY A;  1JQG A;  3D1Q A;  3S8S A;  1LWF B;  3KHR A;  4WZM A;  4IH5 A;  3MAA B;  4TY8 B;  4DPO A;  5CZX A;  1VQN S;  2WSF C;  2HKE A;  1CJV A;  3FSX A;  1EQM A;  4Y65 A;  3H2U B;  1VRQ C;  1AZS B;  1TKX A;  3A3N B;  3SV3 A;  4Y2C A;  2VA3 A;  4DQP A;  2CDQ A;  1NDK A;  2ZE2 B;  2N7Y A;  2Z4P A;  2X1G A;  1Q81 T;  2AZ1 A;  1CC7 A;  4OFZ A;  1R8B A;  3WIU A;  4DR3 J;  2CQ0 A;  2WVB A;  3JTP A;  6FDR A;  4IQX A;  2RHQ B;  3I5B A;  4CO4 A;  4ED2 A;  3GB0 A;  4ZMM A;  4LF4 J;  1PCA A;  1ZPW X;  3DLH A;  4IDK A;  3HHN B;  5KG7 A;  3ET6 B;  2CJY B;  3SEO A;  3LGN A;  3NMA A;  2NZC A;  1SL0 A;  1S1X B;  4ANE A;  3CDW A;  1RTH B;  2QMU B;  2G0J A;  1KFD A;  4S0M A;  2GVZ A;  1X4H A;  4AQY F;  3KLF B;  3PO5 A;  3CCT A;  1I3O B;  2XSJ B;  1NZA A;  1TTH B;  3ZFV A;  2V50 A;  1S4E A;  4USH A;  1HNX J;  4TN2 A;  5HK4 A;  2EFP A;  3DDK A;  3S7R A;  1N48 A;  4F67 A;  3PNI A;  1JMT A;  5A0Y B;  2NXU A;  1UFW A;  1N33 J;  3UO0 A;  1JIH A;  2LQ8 A;  2R7T A;  1FKP A;  3I0R B;  1N36 J;  4LSN A;  4HVZ A;  4RW9 B;  4ZKA A;  1R6V A;  4YY3 F;  2A6M A;  2FIU A;  4TU7 A;  4F4Y A;  2EFQ A;  1RTD B;  5C42 A;  1AUS L;  3TQ1 A;  2ZZT A;  1HA1 A;  1IBC B;  2A2C A;  2DJW A;  4BDP A;  2U2F A;  3M4X A;  4DN0 A;  2HSE B;  2YNH B;  4PG7 A;  3K59 A;  1FE0 A;  2PI5 A;  2CJ9 A;  4ECU A;  1LEO A;  2XNQ A;  1HBU B;  3R7N B;  3GV8 B;  3RAQ A;  1BD6 A;  4HYK A;  4DJB A;  5KG3 A;  2M0G B;  3LQV A;  3LGM A;  2Q79 A;  3HKZ D;  2B5J B;  2IRY A;  1GXL A;  4DL4 A;  1HBM A;  3N28 A;  1XR7 A;  4RJV A;  5DRK A;  1UP1 A;  4AND A;  2CJB A;  2C2K B;  1H72 C;  3CVK A;  2BAN B;  5HVH A;  3THP A;  4NZ6 A;  2BYC A;  4XAK A;  1NSA A;  3IRX B;  3MAH A;  1Y11 A;  3PRB A;  4ZA1 A;  4LBH A;  3FBE A;  2Y1I A;  3LAN A;  1Q53 A;  4L75 A;  5G4D A;  1FK9 A;  2XLK A;  4FF4 A;  2XNR A;  4CYU B;  1YJT A;  4XK8 C;  2P8I A;  1KOO A;  1S72 S;  4PWD A;  4NA3 A;  5C25 B;  3OL7 A;  3WC0 A;  2LMI A;  2FDN A;  2FHM A;  3KLH A;  2ZOG A;  2V2Q A;  2J0Q D;  2NXC A;  2KG1 A;  5KT4 A;  3R5D A;  5F8L A;  4I7F A;  1N56 A;  3TZY A;  4NLW A;  1FTC A;  4RW8 A;  2E5J A;  3BQ1 A;  4TYB A;  4NLS A;  4AT1 B;  2HQG A;  4DR2 F;  2XHW A;  4LR9 A;  4PPD A;  2JLE A;  1S6Q B;  3BGU A;  4DEZ A;  2UVR A;  4LFC F;  1MU2 A;  2GW8 A;  1SV5 A;  3RR7 A;  3S01 A;  1S49 A;  2IAJ B;  4KT0 C;  4ZPD A;  4PXC A;  3KYL A;  5CCL A;  3HF5 A;  4LF8 F;  1RTJ B;  3CUL A;  3SSQ A;  5HI7 A;  3QSY B;  2NZ4 A;  4QYZ J;  3NGD A;  2JEI A;  3FCW A;  1E6V A;  3CED A;  3OHB A;  3QT6 A;  2CXE A;  1HWL A;  1SKW A;  3D9B A;  4RZR A;  3JTN A;  2F4V J;  3P5T L;  2QFJ A;  4WFA Q;  2DR6 A;  2XB2 D;  4C8Y A;  1ITP A;  2B8P A;  5H1S V;  4A8Q A;  4B17 A;  3AOA A;  2EW9 A;  2C1E B;  4U6P A;  4DV3 J;  4UY8 T;  2POK A;  3FEY B;  4OYB A;  4U9R A;  2OEK A;  4DV6 F;  1RU1 A;  3MM6 A;  3CCL S;  1LWC A;  1VYA A;  4CZC A;  2RQ4 A;  2PT0 A;  4NA2 A;  4ZIV A;  2JDJ A;  3KFW X;  1G3O A;  2UUC F;  2QLX A;  2CPH A;  4LJM A;  4DV2 F;  2PDA A;  2X3G A;  4CNY A;  2HNZ B;  4NMX A;  3VGS A;  3H0P A;  3M8W A;  4KE5 A;  3OR1 B;  2G9O A;  1UJ5 A;  1RT3 B;  3ADA C;  1IKW A;  2GVD B;  5BYR A;  2NQP A;  1TKZ A;  3U1L A;  4TQR A;  4Y2K A;  3FZ2 A;  3KLF A;  4CLK A;  4B9N A;  2GML A;  4W92 B;  2KTQ A;  2ACM A;  1WOS A;  2VDI A;  1CSJ A;  2VBZ A;  3Q8P B;  4NML A;  1REV B;  4IYQ A;  1F2G A;  1RWM B;  1EP4 B;  1VQ7 S;  3ZO7 A;  1WSV A;  5ETK A;  3G96 A;  2D3O R;  3K0J A;  2BW2 A;  5KFJ A;  4NLX A;  1HKA A;  1R6Y A;  3DGP A;  2CYY A;  3KG4 A;  4LF6 F;  3ZTP A;  4CTA B;  4J9S A;  1PJ6 A;  4OYP A;  1UZD A;  2R7O A;  1KHV A;  1OMS A;  1Y4Z B;  4WE1 A;  1CJK B;  2HLU A;  1G1X A;  5HJY A;  3GR1 A;  1C0T B;  3NRB A;  4JI4 F;  3SSS A;  1SVD A;  1IWG A;  1OO0 B;  2ZM6 F;  3NGK A;  3CTR A;  3Q86 A;  4OI6 A;  4UY8 5;  4DS5 A;  1Z4U A;  5KFQ A;  4C8O A;  3K8V A;  3HVA A;  3OQ2 A;  4YR2 A;  5B0F A;  1WC5 A;  2BAN A;  5THW A;  2QV6 A;  1UW4 A;  4DN9 A;  3R3T A;  1JLB A;  1NB7 A;  2W2N P;  1U8W A;  1RTI A;  4P74 A;  1R27 B;  1NKE A;  1QAI A;  2XYP B;  1S10 A;  2DNQ A;  4EZ9 A;  2V5H G;  4TXS A;  2MLZ A;  4A8M P;  2W2Q P;  2A6O A;  5DQH A;  1WTB A;  5HVF A;  3DN9 A;  1CJT B;  4Y34 A;  4CYU A;  3DLL Q;  4AXI A;  2M88 A;  5AXL A;  1OQ6 A;  5FDL A;  2OTL S;  1C1B B;  1WHY A;  1NJZ A;  1NU4 A;  4FYX B;  4X4S A;  3J7Y U;  4M5K A;  4Y2I A;  4DPU A;  1DQ9 A;  3MEC A;  5K8P A;  3IMQ J;  2VOP A;  3R2D J;  3W9H A;  4ECV A;  3GIJ A;  2J7U A;  5B09 A;  1N8R T;  2GJ2 A;  4YY3 J;  3QZ8 A;  3K5L A;  1VQM S;  2XMV A;  1X9W A;  5KFE A;  4MK8 A;  2JH3 A;  3TA1 A;  2B51 A;  1NPR A;  1Q8I A;  2VHG A;  2DGT A;  5GAH I;  1YDL A;  2F8E X;  4N8N A;  5ITH A;  4IG3 B;  2JLG A;  1XN9 A;  5G0R A;  4F02 A;  4EYH B;  1CVJ A;  4L74 A;  2XZT B;  5KT5 A;  1HMV A;  1K1S A;  2FVP A;  1KEK A;  1WNE A;  1DJ0 A;  3RYL A;  1MN7 A;  4DFP A;  4OJH A;  3T1A A;  1ZAX A;  3UNG C;  1VQP S;  3R6L B;  4NEZ A;  4EI2 A;  1Q0N A;  2AYM A;  3TA0 A;  4Y00 A;  4UZC A;  4ZPA A;  3BZQ A;  3UQS A;  3RBE A;  5AJ3 J;  4AUK A;  1KNZ A;  4KHM A;  1J2V A;  1RA7 A;  5L1L A;  4FXV A;  1RGV A;  4UQT A;  2LQ9 A;  1UPM B;  3DOM B;  4IO9 Q;  4M8L A;  2Z0G A;  4X4P A;  1UMJ A;  1Q8B A;  3A8J A;  2APO A;  4JV5 F;  2HMI B;  2ZH1 A;  2C2E A;  2QGF B;  4FF3 A;  1HPZ B;  1YWX A;  3I55 S;  1NKC A;  3RG6 A;  1XWL A;  3OBI A;  1Y10 A;  1TL1 B;  2ROP A;  5DS7 A;  3HVR A;  4O3O A;  2FJD B;  2B9W A;  5F3Z A;  3IGV A;  2CPI A;  3C14 B;  4LF9 J;  1UTA A;  4ED6 A;  2PMZ D;  1FTR A;  4OJG A;  1EAY C;  3V4M A;  3CDU A;  3A3P B;  1N88 A;  4IRD A;  4J9O A;  4U96 A;  3MTK A;  2QLW A;  2XO7 A;  1GMW D;  4LUB A;  1ZTW A;  3ENW A;  1PSD A;  2UUW A;  2ZDP A;  3LWL A;  1VOM A;  1YKW A;  4Q8E A;  2V63 A;  3M2U B;  1RHK B;  1TKT A;  3M9O B;  3DLK B;  5BR8 F;  1TEL A;  2DNZ A;  5EWE A;  4P52 A;  2BM1 A;  3DRY A;  3IG1 B;  4FYD A;  1S5Z A;  2OJ3 A;  3R7B B;  4FPR A;  1EQ0 A;  5LXR A;  3H25 A;  2FHJ A;  1GX6 A;  1D8Z A;  1DQA A;  4YUD A;  5KFY A;  3VR1 A;  2ASY A;  4GRS A;  3HD1 A;  3H5U A;  3MEG B;  4AL5 A;  2NUU G;  3KUE A;  1BWV A;  2YNF A;  3KK2 B;  2PFF B;  2RNE A;  3I9V 9;  5CYJ A;  4CCH A;  1TMM A;  2RKI A;  3OUY B;  3QJL A;  3IC1 A;  3BR9 A;  1VBY A;  2YNI B;  3ZZ0 A;  5IXU A;  2Z8Q A;  1Q5Y A;  4DV4 J;  3MFI A;  2I2Y A;  3KJF B;  2IVF B;  2DHS A;  1FRJ A;  4O0I A;  3OTB A;  4JYA J;  3CCJ S;  4GC6 A;  1REG X;  2ADC A;  2LDI A;  4CP5 A;  4HKQ A;  1NM2 A;  3LPY A;  5BYQ A;  1FNX H;  2RUS A;  2EKN A;  4CNZ A;  3O2I A;  3LAL A;  5F9N A;  4C2M A;  2DTJ A;  2DKO B;  3BGR B;  1U49 A;  4HEA 9;  1R43 A;  3DRP A;  4FBU A;  1OJ4 A;  1SJ4 P;  4F2R A;  2W7P A;  3MEE B;  4ZPW R;  2ZOF A;  3MM5 B;  3KKF A;  2B4V A;  1Q1K A;  3I32 A;  5KFX A;  3EYZ A;  3OV7 A;  1H74 A;  4K4S A;  4L3K A;  3D6H B;  3DOK B;  4U67 Q;  3UD5 A;  5K5M A;  5H9F K;  3PX0 A;  1N5V A;  1MMD A;  2CPY A;  3MZI A;  1C4A A;  1JB0 C;  2BJD A;  2GZO A;  3TZX A;  4PAA A;  2ZM6 J;  4WCE Q;  2ZH9 A;  1RYR A;  1SQF A;  1YG0 A;  3CWJ A;  1TL4 A;  2C3P A;  4RBU A;  1Y7P A;  3JQJ A;  2ROG A;  4P7T A;  4JI1 F;  2YKP A;  1FI4 A;  3R5J B;  3BQ0 A;  3TQE A;  3S6E A;  5L1K A;  1NK0 A;  5GAG U;  1S9F A;  3W3S A;  4L72 B;  4J9Q A;  2FVR A;  2C2Z B;  1UEK A;  3BF4 A;  4UOH A;  2MQP A;  1IWA A;  3F0N A;  1KLN A;  4MYU A;  2KJV A;  3W66 A;  4IFY A;  1QE1 B;  1FA0 A;  2PEB A;  1F5A A;  3W63 A;  1HNV A;  4NZ0 A;  4J9V A;  2HFV A;  4DUT A;  5FJ4 A;  4OIX A;  4M1K A;  1WF1 A;  2DXF A;  4YQW A;  2W9B A;  1YJ9 S;  4V19 X;  4DR6 F;  4NCA A;  5AXM A;  1KQF B;  4ELT A;  3ILJ A;  4DX6 A;  2H5I B;  3I87 A;  4B3M F;  3OSN A;  4ZCI A;  2ZFH A;  5J1E A;  4P73 A;  1OS5 A;  3QO9 B;  4NLT A;  1FJ7 A;  1H7X A;  5DG9 A;  3DRR B;  2DR5 A;  1VQK S;  1EET A;  2AJ4 A;  4I2Q B;  4DFK A;  2IM0 A;  4NI2 B;  1NZ8 A;  3C14 A;  3J7Z T;  2R8H A;  2EWH A;  3HVT B;  1KR4 A;  3AJ2 A;  3Q89 A;  2OTJ S;  3P45 B;  1ICE B;  4GO5 X;  5MLC V;  1NEE A;  3EJM A;  2WW4 A;  1FX4 A;  1RAE B;  3HVW A;  2BQU A;  2E9R X;  1FO1 A;  1YQH A;  5HJX A;  1VQ5 S;  1XEZ A;  2YKM A;  5ETN A;  2KB2 A;  1UEU A;  2DGU A;  3MR7 A;  2EFN A;  2FLO A;  2J8A A;  3NL0 A;  4A8F A;  1QY7 A;  4OV6 A;  2HIY A;  4K4Z A;  3AAW B;  4ZVG A;  3EVW A;  3TO8 A;  5D3G B;  4DPT A;  3HD2 A;  5CXT A;  4ES1 A;  3M2R B;  1ZM9 A;  1UW9 A;  1Y00 A;  2GC8 A;  2DYA A;  3PFO A;  4RW6 A;  3OL9 A;  3FFI B;  2OEJ A;  5DDQ C;  1Q78 A;  3PV8 A;  3DRS B;  2MQO A;  2NCK L;  4LSZ B;  1YVF A;  3GR0 A;  4I56 A;  3OSP A;  2R8K A;  3V81 A;  2H5E A;  1VIS A;  1O0P A;  4AYB D;  4DL5 A;  4TQS A;  2E44 A;  2RIJ A;  1MN9 A;  4KTQ A;  2YQ0 A;  2UUB J;  4PWW A;  1A7G E;  4C11 B;  3MM8 B;  7FD1 A;  2KKH A;  2YNI A;  2Z57 B;  3GJS B;  4DI6 A;  4U7C A;  3NGS A;  1QDU B;  2Q66 A;  5HMZ A;  4A8W A;  3QZ7 A;  2A0F B;  2FVS A;  3RW7 A;  4IR9 A;  3CNQ P;  3PIO Q;  3QID A;  4DG1 A;  3CJ5 A;  3VCD A;  2B0G A;  2HHV A;  4QR2 A;  2RS2 A;  5CD4 A;  2QZ8 A;  3H5S A;  4U8Y A;  3J7Z 5;  1CLF A;  4MIA A;  2B9E A;  5DGA A;  3OTC A;  3UPF A;  2FLP A;  1U2R A;  1ZA1 B;  3LO3 A;  4WPA A;  3EGW B;  1HWK A;  3NAI A;  3K8W A;  1WUU A;  1RZM A;  4AL7 A;  5DGB A;  2VQF F;  2AIR B;  1J5E F;  3BGR A;  3M9M B;  1U09 A;  1BQM B;  2YWG A;  2DGQ A;  2G2Y A;  1XR5 A;  1KQS R;  1R0C B;  2CJX B;  4LT6 A;  2CNL B;  1Y5N B;  1DY3 A;  1JX4 A;  1VJQ A;  3MEE A;  1FXR A;  5BR8 J;  3NBP A;  4EFA C;  2CKW A;  3MR5 A;  3R97 A;  3IN5 A;  2DXD A;  1RLC L;  2WOM B;  1AXQ A;  2FTR A;  5HMW A;  3RRH A;  2ALY B;  2O3D A;  1HNW J;  5LMU J;  3I0S B;  1KP6 A;  2ZBR A;  1EHW A;  1UVN A;  2AZ3 A;  3TZZ A;  4LVO P;  4MKY A;  4R0E A;  1H98 A;  4CLS A;  1OYE A;  2JLF A;  4R25 A;  1OPI A;  4X65 F;  5D78 A;  2E1C A;  3LP0 B;  1CUL B;  4IOB A;  4M5D B;  2JX2 A;  3KJV B;  1FRK A;  2BVZ A;  4DQQ A;  3CJK A;  3H5X A;  1R8A A;  3L4B C;  2XGQ A;  4JI3 J;  3NAH A;  4DPX A;  3BO3 A;  2KRB A;  3OVB A;  1OSD A;  3PYE A;  3TJ8 A;  1TQL A;  5IS2 A;  2HFZ A;  3H7H B;  1PAE X;  1WEZ A;  2VBX A;  1AFI A;  2RQM A;  3M32 A;  3KXD A;  5F8J A;  5JXS A;  2IC3 A;  2BJ1 A;  8RUC A;  3FBF A;  2HS0 A;  2C3Y A;  4OZ2 A;  4X4U A;  3EPG A;  2FHO B;  3VZH A;  4B3R F;  4ED1 A;  1UFL A;  2DNK A;  5DZ7 A;  3TVK A;  3KK1 A;  2PO4 A;  1RHU B;  1R8C A;  3MMC A;  3QO9 A;  1YBT A;  4ER8 A;  2MQQ A;  4JV1 A;  3E01 A;  2C2O B;  2DBB A;  3ZZT A;  1FE4 A;  4OYI A;  3EWG A;  2KFN A;  2DEI A;  3KNG A;  1YIJ S;  1U26 A;  2VZ9 A;  3OFG A;  3VHQ A;  4JOU A;  1NAQ A;  2G1H A;  2EPI A;  2GQ2 A;  2MYF A;  2DNN A;  5KFS A;  3G8T A;  4DCO B;  1BGX T;  1WEL A;  5K9F A;  1U25 A;  4OYA A;  4DUY F;  2HQI A;  2WVC A;  2XMT A;  5L9N A;  3GIR A;  3CPW R;  1IKV A;  1QTN B;  4ITS A;  3DYA B;  4I6A A;  2ZJP Q;  2KXF A;  3GG0 A;  1S48 A;  1G6B A;  1UWB A;  5KOW A;  3MOJ B;  1AW0 A;  1S1V B;  2CVE A;  3GE9 A;  2SXL A;  4LSL B;  3R7S B;  5HQL A;  2DRB A;  4WKR A;  3T19 A;  4ZLN A;  4JI1 J;  3MPU B;  1ACM B;  2X7I A;  5F9L A;  4LRC A;  3WBZ A;  2VH7 A;  3MPW A;  4OHW A;  2HVE A;  3MR2 A;  2UV8 A;  2DR8 A;  1NDC A;  2OEL A;  3RW6 A;  4O3Q A;  1WEY A;  5B0A A;  3DDN A;  4KH1 B;  2VAS A;  1NH8 A;  1F9H A;  4MK9 A;  3CCR S;  3WC2 A;  2VPW B;  4PXB A;  2UUA F;  1NJY A;  2P6S A;  3BO4 A;  2CQC A;  2M8H A;  3CCQ S;  1V6H A;  3ZZY A;  4RW7 A;  4XO0 A;  4LRD A;  3MEK A;  2E7V A;  4F0K A;  2LKZ A;  1LW2 B;  3RR8 A;  4NYP A;  1U2F A;  2AMC B;  4R5P A;  1Y9O A;  4B3M J;  3DMJ B;  2MSS A;  3PJ9 A;  2UV8 G;  4M63 A;  2QLF B;  5IC4 B;  4D3H A;  5ETP A;  4LFA F;  2XZD B;  4UTG A;  3W2V A;  2DXE A;  2FY1 A;  2DB1 A;  5D4P A;  1I6J A;  3KUH A;  3MUM P;  3FMB A;  4CM0 A;  3QMQ A;  1WC6 A;  1X8D A;  1IBL F;  5KG6 A;  3HSZ A;  3EGN A;  4DSL A;  2OML A;  1H2U X;  2CPZ A;  1E6Y B;  2W8L A;  2MGZ B;  3W2W B;  4FDF A;  1JLQ A;  1IM6 A;  1SBR A;  1SJR A;  2V8P A;  5E7O B;  3HFV A;  2HZV A;  3CMA S;  1BQM A;  3C6U A;  4EBE A;  4GC7 A;  2AEF A;  4L73 A;  2OPQ A;  1C2P A;  1C4C A;  1QSL A;  2Y1L B;  1MNE A;  2AEM A;  2FZG B;  1UJ6 A;  2R7W A;  4I2P A;  4FYY B;  2CVI A;  4USW A;  3MCS A;  2YX1 A;  3W8G A;  3BDE A;  2IRX A;  1UAW A;  4WFN Q;  1X5P A;  2E5I A;  2KDO A;  2HRY A;  1FKO A;  4BBY A;  1VRT B;  4X4V A;  3EX7 B;  4OI0 A;  4PQU B;  5HQ8 A;  2XLJ A;  3UDC A;  4N7T A;  5C24 B;  2QRR A;  4ZCK A;  1D9F A;  2M4M A;  1IKY A;  1W2I A;  3FNN A;  2H4W B;  2ZH6 A;  3VQT A;  4EWT A;  3GP9 A;  3R6G B;  2OFH X;  5E3Q A;  4NPO A;  5I42 B;  4DUZ F;  3RAX A;  2GNK A;  3LP0 A;  3AOD A;  1NK5 A;  3QIP B;  4HHU A;  4KR0 B;  2JZ5 A;  2X1A A;  3T41 A;  2KFY A;  5JUM A;  5E2Q A;  4CO0 A;  2C3U A;  1B0T A;  3TZW A;  2O5D A;  1I94 F;  4NL5 A;  1OY9 A;  3J80 Y;  4EUV A;  1IM4 A;  2J7K A;  1U4B A;  2BAC A;  3GU0 A;  3ENQ A;  3C46 A;  3E51 A;  1RT4 A;  2HWH A;  2JEF A;  1U6F A;  3VAJ A;  1MSW D;  1UWA A;  1NRK A;  4P2M A;  2OSR A;  1N34 J;  1TK5 A;  2VU5 A;  3ISN D;  3Q8S B;  5DM6 Q;  4DQR A;  5CAB A;  1FJE B;  2H54 B;  1N5Q A;  2VF3 A;  2GQQ A;  1F3F A;  2MHN A;  2AJQ A;  2N7C A;  2CPJ A;  2V8G A;  2GGP A;  3ZC4 A;  2QTW A;  3AB4 B;  4MH8 A;  4P6Q A;  1URR A;  4J37 A;  1P6T A;  3RB4 A;  4HHH A;  1MRO A;  1JLA A;  1DTT A;  2FVC A;  5EWF A;  2F65 A;  5KAK A;  2C28 A;  2A10 A;  3LUY A;  3MHY A;  1KS2 A;  5C2G A;  3AD9 C;  4ZLP A;  3QLH A;  3BH7 B;  3VV2 B;  3KDN A;  4XDC A;  1FXD A;  3D0I E;  4X4O A;  2VBW A;  4BHQ A;  1D9D A;  2DHH A;  5J2N B;  4F36 A;  1M5H A;  4KYZ A;  5D0G A;  4Q0B B;  3NOG A;  3W5Y A;  5IQ6 A;  3ITH A;  2Z2Z A;  1KD1 T;  2BE2 B;  4NAS A;  2HNY A;  3M8Z A;  1H0H B;  1RAJ A;  2J76 E;  3TAM A;  4NRT A; 
#chains in the Genus database with same CATH homology
 4UOF A;  3FCV A;  2B8Q A;  4EK2 A;  3FBE A;  1WKK A;  2HUR A;  2VU5 A;  3B54 A;  4W98 A;  3NGT A;  5CAB A;  3BBB A;  4WBF A;  2AZ1 A;  4C6A A;  3EIC A;  1ZS6 A;  3VGV A;  3Q86 A;  3PJ9 A;  3VGU A;  1S57 A;  1F3F A;  1NSQ A;  3FCW A;  4ANC A;  3MPD A;  4DZ6 A;  3PRV A;  1B99 A;  1WKL A;  4FKX A;  5CAA A;  3VVT A;  3FBC A;  3Q8Y A;  1XQI A;  1K44 A;  1PAE X;  2NCK L;  3EVO A;  1B4S A;  2DXE A;  1UCN A;  3GP9 A;  3DKD A;  3ELH A;  1NCL A;  3VGT A;  3ZTO A;  3FBF A;  3ZTS A;  4KPC A;  1JXV A;  3Q8V A;  3Q8U A;  2BX6 A;  4CP5 A;  4F4A A;  3ZTR A;  2DY9 A;  3Q89 A;  1F6T A;  1S59 A;  3VVU A;  1LEO A;  2B8P A;  3FC9 A;  3G2X A;  3R9L A;  4ANE A;  2DXD A;  1MN9 A;  1NHK L;  3ETM A;  3BBC A;  1HIY A;  3NGR A;  1S5Z A;  3EJM A;  3EMT A;  1PKU A;  3EVM A;  1U8W A;  2HVE A;  3JS9 A;  1NDL A;  4UOH A;  1NDC A;  1NSK L;  4S0M A;  3NGU A;  3GPA A;  3ZTQ A;  3BH7 B;  2ZUA A;  2BEF A;  1NLK L;  1BE4 A;  5IOL A;  1VYA A;  2CWK A;  4DI6 A;  4UOG A;  3NGS A;  5BXI A;  4O0N A;  1EHW A;  1NUE A;  1HLW A;  2AZ3 A;  3EM1 A;  2HVD A;  4DUT A;  1HHQ A;  5C7P A;  3ZTP A;  4F36 A;  1NB2 A;  4AND A;  2DXF A;  3ENA A;  3B6B A;  3WX8 A;  1MN7 A;  1BUX A;  1NDP A;  3L7U A;  3FKB A;  4ENO A;  3EVW A;  3DDI A;  4FKY A;  3EE3 A;  1KDN A;  3BH6 B;  1W7W A;  1WKJ A;  1LWX A;  3BBF A;  1BHN A;  3VGS A;  1XIQ A;  1NPK A;  3FBB A;  4HR2 A;  1NDK A;  1NSP A;  3Q83 A;  2DYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...