3DDIA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with tdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 41
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3ddiA00
3VGUA 3DDIA 1EHWA 3DKDA 3VGVA 1MN9A 3NGTA 1NDLA 3Q86A 4W98A 4F4AA 1NSPA 4DUTA 1F6TA 1NCLA 1PAEX 3G2XA 1F3FA 4ANEA 1WKLA 3BBFA 3FKBA 3B6BA 4C6AA 4O0NA 4S0MA 3BBCA 3FBEA 4F36A 1ZS6A 1NDKA 3GP9A 3B54A 4UOGA 3ZTRA 5BXIA 2DXDA 3NGRA 1VYAA 1HLWA 3ENAA 2AZ1A 3FCWA 3VVTA 1LEOA 3FBCA 3EVMA 4HR2A 3VVUA 3Q89A 4EK2A 1S59A 3FC9A 3PRVA 3Q8UA 3ETMA 3EM1A 1BHNA 3NGSA 2ZUAA 2NCKL 1S57A 1WKKA 2DY9A 3R9LA 1PKUA 3FBFA 4WBFA 1UCNA 1B99A 5CAAA 3EMTA 3EICA 2B8QA 2BEFA 4CP5A 4UOHA 3VGTA 4FKXA 4KPCA 1NSKL 4ENOA 3GPAA 2BX6A 1XIQA 1HHQA 3ELHA 2AZ3A 1NPKA 1NB2A 1NDCA 3JS9A 1NDPA 4ANDA 3MPDA 2DYAA 1U8WA 3Q83A 5C7PA 3EVOA 1XQIA 1JXVA 3FBBA 1BUXA 1B4SA 1NHKL 2B8PA 1KDNA 1W7WA 3EE3A 3ZTOA 2CWKA 4DI6A 2VU5A 3BH6B 2HVEA 1LWXA 4UOFA 3PJ9A 1NUEA 3Q8VA 3FCVA 3Q8YA 3ZTQA 4ANCA 3EVWA 4DZ6A 1HIYA 3EJMA 1S5ZA 1NSQA 3BBBA 2HURA 3ZTSA 3ZTPA 3WX8A 2DXFA 1BE4A 5IOLA 1WKJA 4FKYA 3NGUA 3VGSA 3BH7B 1MN7A 2DXEA 1NLKL 1K44A 5CABA 2HVDA 3L7UA
chains in the Genus database with same CATH superfamily
1WOOA 4C7QA 2H5IB 2RRAA 1EHWA 2B51A 2J5AA 3CJ8A 4DFPA 1FJCA 3DCAA 3DNCA 3GMGA 4B08A 4KJIA 1ZZNA 5CYMB 4X4QA 5F9NA 5AXMA 4MK7A 3OLAA 4ECZA 4GKJF 1RHJB 3W8PA 1V3SA 3G2XA 3P3DA 4CT8A 2I6WA 3BV8A 3FQKA 5LOQA 3VAGA 1FFGB 1XNQJ 2A0FB 2KDOA 3M6VA 3RAMA 2AW0A 4AQYF 1IM6A 1FWKA 2EFGA 1DBDA 3BN4A 2ILYA 3QIDA 4PABA 1EQMA 5IC4B 3TA2A 3TZXA 2C22A 4E0DA 3C3LA 1WNEA 1FFSB 1P9QC 1UPPA 1GTEA 1NXIA 1RE1B 2AZ1A 2XMMA 4NEYA 1WC4A 3H5YA 2BZ2A 3MI7X 2VKZG 1FNOA 2EI5A 2XMVA 3IA0A 4DG1A 5FLXU 5HVHA 2KFZA 4B3TJ 1RACB 4U95A 1F5CA 1NK7A 3D1HA 3ZC4A 5A8KB 1Q8LA 2CQ2A 1RLCL 4K2XA 3D54A 1S1WA 3NCQA 1YVFA 5T14A 2HQDA 3R5BA 3RG6A 4K4SA 3HHLC 3W63A 2DNMA 4OYXA 4B9TA 4Q0BA 3DM2B 2GCFA 4LFBJ 2R9LA 5KAKA 1F2GA 2Z2MA 2WBMA 2PEHA 1CJUA 2OEKA 1OY6A 4C48A 5K8OA 3K5OA 4DQQA 1JJCB 5DDPC 1VQ6S 3R9LA 3QNWB 2FZKB 3OT9A 3EXYA 4ECQA 1KQSR 1CEZA 5C5JA 2OPQB 2C2RA 2AMCB 5F0UA 5CXTA 3MOZA 2JLFA 1M1GA 5HQ8A 1TL1B 3UWTA 5F8GA 1ZPVA 2MJNA 2CJ9A 1VQ9S 4OYIA 1TK5A 4AQYJ 1SUQB 2P8IA 3MR6A 3EDQB 2EK6A 3SSQA 2LEAA 3FK4A 4OYMA 2E5IA 2FJVA 2Y8WA 2GA7A 4ALZA 1WACA 3IGNA 1L3KA 2CJAA 2GMLA 4B3OA 2XEXA 3HI9A 2DT9A 2BABA 2KRBA 3E01A 2XMKA 4Q2MA 1XR5A 4A46A 9ATCB 4QYZK 3QWPA 4WFYA 5KFDA 1TK0A 4L6V3 3MDFA 1ZTWA 3CSKA 4K4YA 1XIQA 1RQ0A 4TYAA 2AX0A 3HULA 4QWBA 3I5AA 1JLEA 2WONA 3RUBL 2DR6A 3H5XA 4MKBA 5GAHI 3F73A 4LFCJ 2W1BA 3MPDA 2LEBA 2UUBF 4JI5J 4B3TF 3FUYA 1KHVA 3GIMA 3CCES 4MYUA 2MKYA 4CH1A 3PHEA 5D0HA 4A8MP 2OPPB 2HZVA 2PA3A 4MTPA 2MKHA 5JXSA 3US5A 3C15A 1U8SA 4NZ6A 4P74A 1RAEB 1FJ7A 2R2UA 2HNZB 1R0CB 1Y5LB 1X9SA 1T9WA 2KT2A 3DRPB 2E7XA 2VU5A 2V67A 2K7JA 3M05A 4ZPCA 4NA3A 4KGMA 1UAWA 2PT0A 1Z1ZA 4CZCA 2AEFA 2CG8A 2W2QP 3AY0A 3ZTQA 1NK8A 3LOUA 1ZAVA 4PPDA 5IQ6A 3Q24A 1PILA 3G82B 4HEA9 4K4UA 2DHSA 4J9NA 3UN5A 2DH8A 5KT4A 3RRKA 3B82A 1RT3A 3M8WA 4TKTA 1FD2A 3V4MA 3TX0A 4ZLPA 2ADCA 2MY7A 1QVGR 3ICLA 1QAIA 4I6AA 1PO6A 8ATCB 4ZCLA 4ED8A 5CYQB 1JMTA 3CGIA 1TV6A 2WHOA 1JKHB 5DRKA 4HVZA 5KFGA 4C11A 2NUUG 2R7SA 4FKYA 4M5GA 4K8RA 4TVAB 2UUAF 4F3OA 2VC1A 4DSLA 3OFGA 4DV0J 2EFPA 1TVRB 2VH7A 2XMJA 4YB7A 1VC6A 3N0VA 1IKXA 2OEJA 1UFLA 2FLOA 4I0WA 4WP8A 4MKYA 3OTEA 3ZZTA 4H4MA 4CH7A 1EZZB 3SMZA 1B0PA 1YJ9S 3JAMU 4CNYA 1TTHB 1PYSB 2R8HA 3M9OB 3OUYA 4F4AA 3UDEA 3FMBA 2J7UA 1EX8A 2ZFHA 4AXIA 1DTQA 1SH3A 2W9BB 1H38A 4HLBA 2OPRB 2FLPA 1FDAA 1FWLA 4KR0B 4ECRA 4LBHA 3W5YA 4DBQA 5D3GB 2XYHB 4JI3J 3THTA 3OR1B 4V1Ak 4WP9A 2V9KA 1GEHA 5BXIA 1WDDA 1VYAA 4JOUA 1VQ8S 2LXFA 1Q8KA 3OL9A 1Q1KA 2B4UA 2VC0A 3RGIA 4Y28C 2GAGC 2JSXA 3KKFA 3VAHA 2LQBA 4ECTA 4WYWA 3T19A 1GXUA 2V4RA 1UA0A 3V6HA 2YKPA 1F5AA 5LSRA 3FZ2A 2VIHA 2XY6A 3TANA 1TQLA 3DRPA 1TUWA 1IKYB 2AJFE 4CLKA 2E5GA 3DU6A 4MFBA 4OZ0A 3GFXA 1RWXB 3SCIE 2E9RX 5C24A 3BDPA 5L9NA 2M8DB 4Q0BB 3CD6S 1R0BG 2AIRB 3D9BA 4W92B 3I0SB 4GKKJ 3HZGA 5JVHQ 4RW4A 4PR6A 1HQEA 1WHXA 2K7KA 2QV6A 4TY9A 4F7VA 1CULB 2V69A 4FXWA 1P6TA 3O44A 3FMWA 2R3VA 3CJ5A 1D3WA 3CCZA 3PR4A 4IOCQ 3AB4B 1T03B 3I96A 3HKZD 2HHHF 5DGBA 4QOTA 4ETZA 1S6OA 2E29A 4C8KA 3VAIA 4K0KF 2AQ4A 3J81j 4FBUA 2VG7B 4NCGB 1BMQB 1LK5A 1APSA 4UOHA 3NXZA 1Y5NB 3OJUA 4RO0A 4GO7X 2UVUA 1GAOA 2F40A 4F4XA 2DRDA 3MM5A 4MIWA 4OQJA 3EYZA 1Y0HA 3GFZA 4FVCA 1T05A 2QMWA 4KB7A 1SJQA 2V9WA 5D8HB 3OVBA 1N4LA 1RT5A 1U2CA 4TLQA 5D77A 1NDPA 2M2BA 1U25A 3AD9C 2POKA 1TP7A 4I2QA 3SCJE 1RTHA 4ZIVA 5ETVA 4EZ6A 2MLYA 2VPXB 2D3ZA 2AJ4A 3DOMB 4ECXA 4ZHRB 1HBMA 4DL7A 1XBWA 2WSFC 2CUYA 2RQMA 3O8WA 4K2JA 1RTDB 1HD0A 2AX1A 4OZ5A 4BCAA 2HHUA 2LDYA 3QYYA 3EWGA 3G8SA 3HMJG 2D41A 1JLBB 2XO7A 1N32F 2PFDA 1WF1A 3PJWA 3WC2A 4USMA 3MM6A 5KT6A 4WXOA 1MW7A 1CQNA 1WD6A 2KU7A 2HHVA 2LQ8A 3T5HA 1RT2B 1WI8A 4L3NA 1ZBTA 3H4BA 5LMNJ 4LF6F 3ZZYA 4PG8A 3NOGA 1IUJA 1P1LA 4OZLA 2DXFA 4TNOA 2QGFB 4DEZA 2DVIA 1CJVA 4ZIWA 2DNQA 4IOBA 1KP6A 1PYTA 2Q66A 2C2MB 3NMRA 3TA1A 2OEMA 3BYPA 1L3VA 4CLFA 2IBKA 2BW2A 4LF4J 1KR4A 2AHOB 2NSBA 2C3PA 5M2UA 1AXQA 1FKAF 1U24A 3MHYA 3UFCX 4RNOA 4DR3F 3NWRA 1FTRA 2IBOA 3ULHA 2ZVIA 5KFRA 3U1NA 4DDFA 5IM0A 1RSCA 2OELA 2UUAJ 1TKTB 2C28A 1O8BA 1IKWA 3MCNA 1AZSA 1TL3A 2N7YA 5CQGA 3LP1B 2X51A 4E2FB 4K4VA 1URNA 2R7TA 1NDLA 2VPWB 4F25A 2VFTA 4FF3A 4IDKA 2KKHA 5IXUA 4NXMF 2VV5A 4IQMA 2E66A 2HK2A 2VG6B 4MMOA 4O0IA 2R2RA 4NA1A 5K14A 2VQFJ 2LCWA 2GNKA 5EX0A 3HPOA 1WEYA 1R27B 4ECUA 4I56A 2HYIB 1W2BR 3GE9A 2AGPA 2Z0GA 2UXCJ 1NB7A 4B3SF 2MEWA 2DGOA 3GP9A 4CH0S 3RB4A 3P6YC 5KFSA 1DQ8A 1C0TB 4DV2J 3D66A 4WFXA 3IR5B 3TAPA 3M2UA 2YTCA 3ZZOA 3HVAA 2VICA 2DNNA 2WK4A 4X65J 4ZPVR 2XS5A 5L8RC 3SI8A 2BQUA 3VVUA 1DJ0A 2BM1A 3CULA 1I94J 2QJ3A 1FESA 1RT2A 1HMVB 3MAAA 4AL6A 1PC4A 1HW9A 3ETMA 5K8NA 2YXLA 3OFFA 1S76D 3FFIB 1YITS 3K5PA 1T11A 1P9YA 3MR5A 3EDRB 4NLYA 5F3ZA 2XY7A 4NXNJ 4Y2AA 1S0VA 1T7PA 1ULRA 2G2YA 3C16A 5K14B 4PXDA 4WBFA 5A0YA 1B99A 3I31A 3IP0A 4IR9A 4N77A 4WIIA 4DU8A 2D9PA 1TR0A 2WOMB 3HVTA 1JJHA 5B0DA 3EICA 5I3UB 4QYRA 3K57A 2CPJA 2M0GB 2VL1A 3MEDA 4USKA 1OQ3A 1RISA 4PG7A 4N8OA 3G82A 1O5JA 3DN9A 4DV2F 4DR4J 4LJMA 3DLJA 3RBZA 3M9NB 2YH0A 4JI1J 1D09B 2UXDF 1V9OA 2RRNA 3J80U 3VTIA 4WK1A 2P9EA 1GTHA 1LW0A 2HNYA 5D0EA 1SJ4P 3MM5B 5F9LA 4FZVA 4LRBA 2IVFB 3SCLE 4HDHA 3ELHA 1JKHA 1YBUA 1N5VA 1NDCA 5D0RA 4I1TA 1IWGA 1T9XA 1UPMB 2R7QA 2Y0SD 2PGCA 3D6HB 2IPOB 4P2XA 4ZHRA 2KM8C 2FB0A 2M5YA 4DV1F 4DQPA 4ED1A 1FTCA 3EGWB 2LA4A 2Q79A 3Q83A 1CJTB 2VFVA 4UQTA 4I2PB 5KFAA 1SIWB 4V19X 1TELA 1ZAWA 3PX0A 2HQCA 1S0NA 4RW9A 3L95X 1B4SA 4KFBA 4PCQA 4LFCF 3R2CJ 3J81Y 4DFJA 1LNQA 2Z30B 2ZE2A 1HWUA 3P5TL 3H8YA 5B0AA 1VRQC 2UZAA 5U47A 3KMSA 4TY8B 1LV5A 2QTWA 4ELUA 5ETKA 4LSZB 4AYBD 2FTRA 2G1HA 2HNDB 3DRSA 1NH7A 3G87A 3HSGA 3L09A 3PJ9A 1HI8A 4HDGA 1TU0B 4OMFG 3UCZP 2MDAA 3PVXA 4B9SA 2XWYA 5F8LA 3CJ3A 2YX1A 1WSRA 3LGNA 4RWXA 2I0XA 4RX6A 3TJAA 2DNYA 3BM7A 3HSJA 4CTAB 3BBBA 3QPIA 4I6YA 4QR2A 5E3AA 1QSSA 1CS4B 1BGXT 1PC5A 2HURA 3DLKA 2LXUA 3C2PA 3WX8A 4KC5A 1BE4A 4YR3A 1NAQA 1RKJA 3W2VB 4ECSA 1IKVB 2NREA 2O66A 4DLGA 2DKOB 3EGVA 3HDSA 3OXGA 5SUHA 4ILLA 1PBAA 4J9RA 4HACB 1AUSL 4LFAJ 1K44A 2LLZA 3VHQA 1EKRA 2V4QA 2ZHBA 2V63A 1Q81T 5HAOA 3KOAA 5I4MA 2AP6A 2MQMA 2V94A 1LXNA 2VFUA 5IV4A 3BQ2A 2UXBJ 1QE1B 2A3JA 3I56S 4WXWA 4TXSA 2YKMB 3VGVA 3KK2B 1S6PA 3M8SA 5DG7A 2VD3A 2D9OA 3DI6B 1R8HA 5J2NB 2WVEA 3NWGA 3IS9A 4KT0C 2ZH3A 2LA6A 3OPKA 3PYEA 3W64A 3QBCA 4LF8F 2FLNA 2BA9A 1RWKB 1LW0B 2BANB 4DR6J 4I6WA 4EFAC 4J9OA 3IWLA 1F3VA 4S0MA 2F4VJ 4X4NA 4OV6A 3H2UB 4EO6A 4QWEA 2Q43A 1FRIA 2L9DA 3FBEA 2HSEB 2XBPA 4F0MA 1TFWA 1HYSB 1KLMA 1ZS6A 1RT4B 3NY0A 3KLVA 2ZH7A 1V5VA 5L1KA 3DLEA 3TARA 2GMJA 1Q5YA 4EGLA 4K4XA 2OFGX 4CLSA 3DHXA 1JLCA 1XR7A 2ZOMA 3MWBA 1RT5B 2CQ1A 3PW0A 3NCRA 2D3UA 2M4MA 5F8HA 4OYZA 1DHMA 5A2QY 3Q2SC 2B4VA 2CJBA 4NZ0A 4WU2A 4J90A 1Z2LA 3MM8B 4FYXB 1Q95G 4PXEA 2R7RA 4ZVQB 1NMEB 2OLWA 4KHPJ 4O3SA 1ITPA 4CLUA 2XGPA 1FDNA 2EVZA 5LJ3Y 2GGPA 3I4PA 2LQ5A 2YNHA 4C8MA 5IS2A 5AXLA 1OIAA 3M30B 1DLOB 1MU2A 2CQBA 3TAMB 2ZJPQ 1NZAA 2AF6A 2XZWA 1OWXA 3VAKA 2QMUB 1HWKA 4C8ZA 3A8KA 5KFJA 1YJNS 1CJKA 2CQIA 4WF9Q 2BDPA 3DOKB 3R7NB 3N6NA 2MQQA 2JNJA 4RNNA 3GR1A 4CT9A 1AFIA 4E8UA 2KVIA 4OYPA 1LWFA 3MCOA 3UVJB 2KXHA 1JLQB 3M2RA 2KZMA 4I67A 1KTVA 1JJ4A 5DLGA 3OR2B 3CDAA 5KFFA 1OPZA 5IZHA 3TVYA 5H9EK 3MM7A 3QGHA 1WEZA 5M2RA 2JEGA 3UW1A 2G0JA 3DMJA 4HTJA 4MJKA 3ZFVA 4OI4A 2M3DA 3ET6B 2YPZA 2F65A 1RAFB 4U7CA 1Y00A 1KQFB 1VQ7S 2GGPB 4Z7YA 3B78A 2N4CA 5CZXA 5ITHA 4XTTA 3R7SB 1S9GA 2QLBB 2Q1LA 4NYOA 1EIYB 4WTYA 2WBRA 2BOAA 3W1YC 1JLQA 1KDNA 1VRUA 2ROGA 4Y2KA 1NKBA 4J5OA 5A2QU 1UW4A 2X1GA 3D3BJ 4DUZJ 1X5TA 1NO8A 2OKQA 1X0FA 1HNZJ 4BBYA 1X4DA 3SV4A 2ZUGA 1RTIB 2EFNA 1RXOB 3I9V9 4LMZA 4G1PA 3P45B 2H9ZA 1I5OB 1WC0A 1LWFB 1KFDA 3GJTB 3AJ2A 3NBPB 3NGKA 3Q0AA 1U0HA 2BW7A 1ICEB 1X4GA 1FD8A 3PHTA 3LP1A 1HPZB 1TUGB 2W25A 4H4MB 3GONA 4NLXA 2N82B 4AXJA 1UWBA 1U45A 1RAOA 1WHYA 4NZ7A 1N6QA 4ZPDA 2E1MC 3QJLA 3GG0A 1RAGB 3AH6A 3VAJA 1WKJA 1UVLA 2WAQD 1R8BA 1IN0A 3BH7B 3KFWX 3J81U 1HI0P 4B02A 2HGMA 5J1PA 4F8RA 2M8HA 1H98A 1RWNB 3ZNUA 3CO9A 4QWCA 2C1EB 4NLDA 1QD1A 2W01A 1Q82T 5GAEU 1XR6A 1MG7A 3FEXB 5M2PA 1DRZA 1F9EB 1NHUA 2ZC4A 3VWSA 4O3NA 1S1VA 4WK3A 3GLJA 1QE1A 3MD3A 4N47A 3ZNJ1 5AJ3J 2XGQA 2IDEA 2DNOA 4WE1A 3WZ0A 2W9CB 3G6VA 3OTOF 4DV5F 2GC8A 1KQGB 3KLIA 1TL7B 5DGAA 1J27A 1FXRA 3SFGA 3OHBA 4NI2A 4X4UA 1WWHA 1BQNB 4I7FB 3M7VA 2OO4A 2VDHA 4YB1P 1RYRA 4X64J 1JQGA 2CPIA 2FVPA 4BLGA 2HS4A 5B08A 4DR5F 4F36A 4I69A 3O1LA 1VGYA 2X1AA 2DGUA 2FHOB 2YX4A 1FKOA 5ETRA 2FUG9 1G3OA 2HS0A 1FA0A 2K1RB 4QIFA 1FRMA 1K1QA 4F26A 1SKSA 2UVRA 2W9CA 3EZOA 1RWWB 2ASLA 3QGIA 5IQQA 3W61A 3A4TA 4HTIA 4AFFA 5G0RB 2JH3A 1QLNA 3BO4A 1B7YB 3OLBA 5LJ5Y 3SXLA 3G96A 1RTIA 3V81A 2XULA 5HQMA 4DR7F 5B0GA 4R8UA 2Y1IA 1J5EJ 2Y1JA 1SQEA 5GVQA 5J2MA 3KLGB 4RW6A 2XO6A 5D15A 1U1NA 1Z2ZA 3AD8C 2CVIA 4PUOA 4IG0B 2E9ZA 5K8PA 3R2DJ 4H4KC 4CO3A 3AJDA 2YWKA 3CJRA 3ZZ0A 4RNHA 4M94A 2C2DA 1U4BA 1YJVA 5H9FJ 3DRSB 2DPIA 4EZ9A 4OHYA 3DGVA 3G4SS 2ZZTA 1UL3A 3QLHA 3EZ5A 2V2VA 3C6TB 2J9DA 1XMOF 2MSSA 1EJ7L 2EWHA 2ZWOA 3OV7A 2HHTA 2W2MP 1S1UB 1FO1A 3DLKB 4J37A 4DOZA 2X1FA 5D4NA 5H9FK 3H5SA 2UUCF 1Q0NA 1D8YA 2XCPA 1HQUB 2I38A 5HK4A 2KG0A 1VQPS 1MROA 5F0WA 5ADZA 5C7PA 3M6UA 3TO8A 2MKSA 2QT7A 1B70B 1F9HA 1X4HA 3HFZB 4HT5A 4RWWA 1XNRF 2DD8S 2ZH1A 4K4ZA 2B9XA 4ES1A 3CWJA 3KJVA 1U1MA 2ROPA 5A6WA 1DLOA 1MU2B 2PMZD 1J5OA 1IBLF 4OX9F 1C1BB 3LWLA 1D8ZA 3MMJA 5T41A 4OHXA 2QEXS 4UZBA 3K8VA 1EARA 2O01C 5J2NA 3IAS9 2VG5B 3K8WA 2AD9A 2BKNA 2ZKUA 3DHWC 3PNIA 3KHGA 3FVYA 1HQUA 1KTQA 4J9LA 4I68A 3QT7A 2U1AA 2G13A 1C4AA 3W65A 4C4WA 3R7BB 3BSAA 1TL4A 3B8HA 5DJBA 1EB0A 1Q7YT 1VRTA 4B9NA 1S1XA 3ITHB 3M6XA 3H40A 4B3SJ 2YH1A 3RB3A 2CYYA 3PG9A 2BANA 3D1QA 2E5LF 1RHRB 1X4EA 3C16B 5AT1B 3VGSA 1A7GE 3IAM9 1C1CA 4HHJA 3AQOA 4MK9A 4RW6B 2KHCA 1M5HA 1NPPA 3C6TA 4PQAA 1K1SA 3POTA 5HROB 2I5JA 1N5TA 1KQKA 2W8KA 4DCJB 2HHWA 2CQCA 5E3QA 4ER8A 3PKMA 2EXUA 2JFDA 3KK3B 4YDDB 1VJWA 2IIHA 3IG1A 5HVFA 2DGSA 2EC2A 3KWMA 4C3LA 3HSZA 3SCKE 5LSOA 2J9DE 4DUTA 2ZEJA 4IR1A 4B3RJ 4FPIA 4DR5J 2PDAA 4ED2A 2CJYB 4C0HA 2WVBA 1HBNB 2O5DA 3O5TB 1LQ9A 1OY8A 1JIHA 4URGA 4L73A 5AXNA 2UV8G 3BBCA 3J80Y 2E44A 3I87A 3N79A 5T7LB 3THVA 5IC6B 2F8MA 4L3KA 3HHLB 2IY5B 4UOGA 1RTHB 1KC8T 1S12A 4ECVA 1MMLA 1YBAA 2A2DA 3OW2R 3HHKA 4KFBB 2BRLA 4LT6A 4L76A 2WCXA 4YN3B 4QW8A 1HKAA 5KFNA 1HFEL 2XHWA 2K1RA 5KFZA 3W8GA 1M1KT 1BQXA 1M90T 1RJJA 5E3CA 5ETTA 4XIUA 1PIEA 4L75A 1SV5A 3BB5A 4YR2A 1BHNA 5G4DA 4DR2F 4ERDA 3PR5B 4USJC 4Q8FA 2I1RA 2RAQA 1RAHB 2ADBA 1VI7A 3PW2A 1NKCA 4CLPA 4DV4J 2ABYA 4Q7AA 3VV2B 1U47A 3NS7B 1VLOA 2E1CA 4K0KJ 2ROEA 1T03A 1L3TA 3BGRB 5KG2A 3CDUA 2CQHA 1VRTB 2L9WA 3KHRA 3CF5Q 1JXEA 5E7OB 3M32A 3H42A 2CQ3A 1RT1B 1XWLA 3DLBA 2DPJA 1CSJA 2CVEA 4LF5J 1XEZA 2KL8A 5DG8A 4QPXA 1TKZA 2PMWA 1F9FA 3BSCA 4R25A 1NJYA 1KNZA 3KUEA 2L08A 3TYTA 3UCUP 1Q78A 2HAFA 4RUAA 2V5HG 4EI2A 4F3QA 4LR7A 4A48A 4RU2A 2BM0A 1NJIT 4TY8A 1DY3A 5LM7E 4MH8A 1HBUB 3V4IA 1H3DA 4QR1A 1WC1A 1RBLA 1HHQA 4P2SA 5L39A 3IR7B 2FJWA 1YJUA 2ZH4A 1K0VA 5BJRA 4X62J 2RIJA 4LR9A 4ZN3A 1N33F 1D9AA 2J7WA 5A0YB 2CAJA 2RU3A 4JV2A 1U8WA 4ZA1A 1YRUA 2FPHX 3M4XA 3D0IE 4C3KA 2JZ5A 1J5OB 1VQ4S 2Y9HA 3HHLA 4EEYA 5I3UA 4FPRA 4NA2A 1DAXA 3CJQA 3LQVA 3X3UA 1NRKA 4E98A 3MOJB 1RADB 1FXDA 3L7PA 1C2PA 3T5JA 1FI4A 1KKHA 1W7WA 2D1CA 3UN2A 2HWIA 2M88A 1S9GB 1SC6A 1IKYA 3BH6B 3ZTOA 2MKKA 4PQUA 1C1BA 1U1RA 3D4JA 1T9YA 3C6UA 2QZ8A 1NJWA 1S9EB 4UQGA 3FCVA 4B17A 1Q5VA 3K2YA 4A8OA 4X84A 2OFHX 3E3XA 5KFKA 1IBKJ 1FCAA 4A8QA 3EVWA 1MLAA 2FYXA 4ZVSB 4DUZF 2QRRA 3M6WA 1HNZF 2AYBA 4QIVA 4Y0FA 1HQEB 4RKUC 4A8SA 4IFYB 2YNGB 3J7ZT 3DRRA 4R0EA 4M5MA 2J0XA 5ETPA 3KUHA 4ZP9A 3PW5A 1CC7A 1HW8A 4DL6A 2E7VA 4JI2J 4AE5A 3Q23A 1HNXJ 1UVNA 5J2PB 1YWXA 2VG7A 4NCGA 2BRKA 3GU0A 2KXNB 3H4DA 2FZGB 1U7LA 2DNHA 1X4FA 2F4FA 1YJWS 2FGCA 1HR0J 2YX7A 2RKIA 3SQOP 1P27B 1AZSB 2KB2A 1RT1A 3DKDA 3MEGB 5HJXA 2VQFF 1SL1A 4B9UA 4DX6A 4XO0A 4NOHA 2L3MA 5GADU 2CG4A 2HIYA 2C2ZB 2KXFA 4O3RA 1S6UA 4MYTA 3U1LA 1XTZA 4IG0A 1VCTA 3HX9A 3O2IA 1WOPA 3W66A 2HG4A 4KGVB 3GB0A 4NASA 3MM8A 4Y2MA 1HNIA 2VPYB 2F1FA 5FDLA 5HBMB 5AJ3F 5KG1A 4R8UB 5HP1A 1RWVB 3NEKA 2DY1A 2G9OA 2MKJA 4M5KA 4ZJLA 3MMBB 3LWMA 3F56A 2D3OR 1FRHA 1LW2B 2JHEA 3D68A 3FJ2A 1N0UA 1REGX 3N6MA 3R6GB 4RJVA 5J2QA 2BR0A 3CVKA 3MMAA 4Z37A 3DOLB 2DGVA 2MQNA 2EPIA 3MM6B 3EVMA 3TUIC 2HS3A 4H4KA 2R2SA 2UXCF 3OUYB 3T1HJ 1OSCA 2BE7D 2HFSA 4F4KA 3M8YA 3WX4A 3FCHA 2ZVSA 5DG9A 2ERRA 2XM3A 4USVA 2BJ3A 3OTDA 3GYGA 3LP2A 1BWVA 2BE9B 1ZYQA 3I5BA 1FK9A 4DLEA 4KKOB 5E41A 4GRSA 2JVOA 3MPUB 4AT1B 2CDQA 3GV8B 2HBRB 2MZRA 2NCKL 3CD0A 1WKKA 5CHCB 2ZWPA 1YRXA 4L72B 1RU1A 1Y4ZB 2P2CB 1JWWA 2E1PA 2PN6A 2EBGA 1PJ6A 2CFXA 2PEBA 3CT9A 4C8NA 5C25B 3SIPB 4FVMA 3TNVA 5CCLA 3EMTA 4KBIA 2DO0A 3KYLA 4J9MA 4CLYA 3MCSA 2KJVA 4RBUA 4DV4F 3BGRA 3AFGA 3LGMA 2CJXB 4U8VA 2DEJA 3WQPA 2XQCA 2DNPA 4PEOA 3IC1A 4NMXA 1Q8IA 2MGZB 4X2BA 2VJVA 1A9NB 3IBWA 5E3RA 1X8DA 5MAOA 2IJFA 2KO1A 5GMKa 4P75A 4GC6A 5KOWA 2DR7A 4LF5F 5DM6Q 4GVLA 2XSFA 3T41A 3H25A 1HHTP 4U9RA 2WTFA 4JV0A 2JLGA 1CBKA 4PRFA 1GX5A 2U2FA 1W2IA 4R5PA 4EUVA 3JS9A 4CYUA 2KT5A 2RS8A 4NWBA 3IM9A 1X60A 1RAJA 1PG5B 3M2VB 1E6YA 5EX3A 5I42B 3JSMB 1D0EA 1WUUA 2I2YA 2GQCA 3NNHA 1UVKA 3U27A 5AE1A 2PE8A 1XQIA 1MMNA 2DNGA 4J9UE 5HROA 1FKPA 2COLA 4HHHA 2EFQA 4DMZA 1BUXA 5L46A 2DEIA 3HF5A 1KD1T 3H5UA 2GQQA 3M8PB 4U6PA 4DV1J 2YKQA 4F67A 2F8HA 1YG0A 5JJBA 1JNRB 3C14B 4RW9B 1OYDA 2HNDA 1U1LA 2OTJS 1T05B 5KFHA 4B3MF 2ZE2B 4HI2A 2FJXA 2ZM6J 5A6PA 4OIXA 1H74A 3I55S 2IVYA 2XMAA 3BR9A 3MZIA 2NXJA 2W7OA 3ENVA 4LF9J 2KVQE 1SKWA 5KG3A 3TZYA 4IRCA 3KK3A 2JC0A 2NXUA 3IG1B 1S1VB 3HM9A 1PGZA 2DB1A 2JOQA 4ID8A 3KNAA 1KLNA 2PI4A 2JJ4D 3JTNA 2N4DA 3ZTSA 4XK8C 4FF4A 2MZTA 1MNEA 2P9GA 5DQGA 1S7IA 2W24A 5FD1A 2DHAA 1FDBA 2V68A 3OBIA 2OD6A 1A6LA 4NLPA 2GVZA 1SVDA 3OXLA 1KONA 3P49B 4NI2B 3QMQA 1UTAA 2XI3A 2L48A 4F50A 2LU2A 1MN7A 2Z57B 1NLKL 1WSVA 3AHPA 2PIIA 3CCWA 2G2ZA 5DDRC 3PKYA 3Q2TC 4ZMMA 3IGVA 3CCUS 2HVDA 1IM4A 1C1CB 3L7UA 1RCXB 1REVA 2JFKA 3P5BP 1RWPB 3R5CA 4GVBB 1RYSA 1HWIA 1HNXF 2FJAB 1SKUB 5HANA 3AOAA 3FGVA 4U7UK 4DCOB 5KFOA 2BJ8A 2I5JB 5B0FA 3GCWP 1LWEB 4Y2IA 2LFVA 4UT4A 2XY5A 1JJ2R 3CCRS 2RHQB 4CRJA 4DJBA 4RLEA 3CC4S 3V2UC 1X9WA 2YNIA 2MTLA 4O4RA 4OJGA 3G86A 4X4OA 4WFNQ 3JYTB 1BLUA 2HAIA 2NYHA 3G8TA 3BQ0A 1OY9A 2HMIA 4LSLA 4CM0A 5LMUF 2DHXA 2XS7A 2KTQA 1JXLA 3V6KA 2NXEA 4QW9A 1N5SA 5JMNA 1BQMA 2IA0A 2JRSA 2FVSA 3VAMA 4WP3A 4FYDA 2B7CB 2YWGA 1VBYA 5BR8F 2E1RA 1SJ1A 2WOMA 2OHDA 2XNQA 1DTTB 1LWEA 3DC2A 5KFXA 3BO3A 3K0JA 3JSBA 4UF4A 1S97A 3ONQA 3JTPA 2HVIA 2JEJA 4HH0A 4J91A 4YHHJ 3PRVA 3Q8UA 3W9JA 1IKXB 2GIRA 2QA4G 2DH7A 2AV5A 1JLFA 4WKRA 1YGYA 3B4DA 1BQNA 4I7FA 5LL6d 4G6VB 3PIOQ 3D2WA 4J9PA 1VHIA 2RDIA 3RW7A 2OPPA 2VUGA 5J1NA 2HGLA 2R8IA 4OHZA 3ZXWA 3Q22A 4YB5A 1CJKB 2HBYB 4QIGA 4DQRA 3CC7S 1CC8A 1YDLA 2MQPA 2PFFB 3GG1A 2IJNA 3D5MA 3QAEA 4WFZA 2YKMA 3SDEA 1TKTA 3O3LA 4DPXA 5DDOC 4J9QA 3TQ1A 4PAAA 1FXLA 4U96A 1E6VA 1P1TA 4CI0B 3CCSS 3E01B 3CCTA 4IG3A 3A8IA 5GADI 2FJEB 3BO2A 1HR0F 2H51B 1Y11A 4M63A 3K17A 5LMNF 4LUBA 4P6QA 3CNQP 2CDRB 2A1BA 1U0SA 2B9WA 2VF3A 3D6TB 2AJ0A 3H59A 5L1LA 3AOCA 4IH5A 1NB2A 2DR5A 4X66J 1FKPB 2CNOB 1VDHA 4O4GB 4RZRA 3PO5A 4AL5A 4UUWA 2DNKA 3HVWA 3N01A 4IFYA 3WIUA 4JI7J 2VFSA 4RU9A 3IMQJ 4K7QA 3KLGA 2PSZA 3SYZA 5ETOA 3M2VA 3PZPA 2DNLA 5I42A 2QX0A 2UU9J 2CNNB 4NEZA 1FRXA 4ATNA 1VQSA 3EE3A 2CQGA 1RA6A 2VZ9A 4OL8A 1XERA 2IDLA 3CDEA 1EETB 2IC3A 2CADA 3W9HA 3C14A 3J7YU 1GH8A 1W25A 5HQLA 1H7XA 2QFIA 2Z2ZA 1UFKA 4UZCA 3PYDA 1YQHA 1Q8BA 2BQ3A 1WC5A 4PXBA 1UWBB 5IWAJ 1J2VA 4DS4A 4R0JA 2R7UA 1HIYA 2B9YA 2EG2A 2V4JA 5GAGI 1U0HB 1DURA 4NX9A 3T1YJ 5E2QA 2CPHA 4ECWA 3TI0A 4OI0A 4DS5A 2KN4A 2CNLB 5F3TA 5BYQA 2W8LA 1S77D 4NE9C 2EBEA 5FDLB 4X62F 3GV7B 3WBZA 1HARA 3Q8PB 4Y00A 3N9UC 3D6MB 3W3SA 1UVJA 2VFRA 3HKWA 3H90A 4QU7A 3NNAA 3CJSA 1SXLA 1RT7B 2ZHAA 1H72C 1XNRJ 3I0RA 3E51A 1TK8A 1PYOB 3MR2A 2CXEA 2B3TB 2UU9F 1HBMB 1N56A 4KQZA 3UD3P 3QT8A 4DL5A 4DX7A 1SC3B 2ZC3A 1VBZA 4LSNB 2V4JB 1RHMB 1R89A 4C8OA 1TL5A 3DMJB 1U2FA 2QG9B 4NPOA 1N5YA 2LMIA 3VZIA 2JWNA 1OSDA 3TUPA 4ZCKA 3DRYA 4J7CA 3KG0A 2GX8A 1SV5B 3TQEA 3B6BA 1NJZA 1DZ5A 3QIPA 4JV5J 1FVSA 3JXOA 2FVQA 1N54B 3DGPA 4Y3CA 2HWTA 2FJBB 1SC1B 1S1XB 3ITHA 1SC4B 4YS2A 1VQNS 3HSDA 1HNIB 2RH3A 2OPSA 4NLWA 4F0KA 1AW0A 2J0SD 3I5CA 4JI2F 2HIQA 5LMUJ 1YJRA 1YKWA 4JI1F 1KBRA 1Y3JA 2HBZB 4J9VA 2QA4S 3H20A 3CMAS 5F8NA 2HLUA 5FLXY 4A8KA 2LVWA 4HR2A 5KFVA 4EK2A 3Q89A 3HO1A 5K8MA 1J5EF 4NCAA 1VQYA 4LREA 4QZVB 3EUNA 3ZZPA 4GKKF 4DR7J 1FRLA 2F3JA 3C46A 3QRRA 3Q8QB 2D3O1 2AYMA 2NPIA 1VK8A 2ZBCA 5LT5A 5KFEA 3K5MA 9RUBA 3T5KA 2HVHA 2DY9A 2DITA 2O3DA 3JSRA 4JP8A 1SIZA 1VS3A 2DGXA 4ZVTB 2VG6A 2YNIB 4FP9A 2RJZA 4RPFA 3KJFB 5CAAA 4NRTA 1NU4A 3Q8SB 1N36J 1CULA 2B8QA 4YEAA 1V6HA 3LGHA 3LH2S 4I64A 4D3HA 4TU8A 4KTQA 2AJ1A 1YSJA 1KEKA 1IJEB 3BPDA 3BN7A 2C42A 3LF0A 4XPEA 3VCDA 1WG4A 4WTOB 3D1OA 1LOUA 1N34F 5I3PA 1B0VA 2FC9A 3GPAA 4W4MA 4NYPA 4W90B 4CO4A 4P73A 1U6ZA 2ZJQQ 3HZEA 4JYAJ 1NK4A 3G6YA 2KJWA 3D6FB 2MKCA 2UV8A 4ZJQA 3K5NA 4DQIA 2RDJA 5KG7A 4KHPF 2L9NA 1Q86T 3T5LA 1RWOB 1KOHA 4RUCA 3F44A 3QQCD 3HHLD 3BGUA 3M32B 3DLEB 4H4OB 1MROB 3S01A 1FNMA 2MY8A 3MR7A 4GVBA 1NHVA 2VBZA 2ILZA 4I4BA 1NHKL 4WFAQ 4IO9Q 4CLWA 2VBXA 1HL6A 1N32J 1FERA 5ETMA 3TVZA 4Y65A 1VK3A 1RTZA 3M1VB 1WF0A 3KJVB 1QTMA 2P6TA 5T7LA 2QL5B 2V2KA 3QJPA 5DZ7A 4XPCA 1LWXA 4UOFA 6AT1B 3RR7A 1PAUB 3TA0A 2H48B 1QUPA 3H2VE 3T1YF 4LRFA 3M9MB 1QAJA 1CS4A 3KDOA 4WZQA 5CD4H 2DHGA 2IRYA 3CJKA 4B9LA 1AROP 3AJ1A 4DR6F 2QL9B 2YWHA 1C4CA 2AYGA 3GFHA 3A1YG 1D1UA 3S6EA 4EBEA 2A18A 4WZMA 2OJ3A 4KO0A 4FXDA 3EGZA 2Q6CA 4OZ2A 4WKYA 1IR1A 1Y7PA 2AGQA 5EWFA 5IT4A 3LTOA 2R4FA 4Q44A 4F02A 2H4WB 1T94A 2MPUA 1TZ0A 1S4FA 1WC3A 2GZOA 1R43A 2YWEA 3BPSP 1RT6B 4NMLA 4OX7A 5E33A 1TL1A 2ZD1B 3QAUA 4TN2A 1LWCA 2FHJD 3QGPA 4ZOSA 4DHVA 3DDIA 5KOXA 5LXYA 3GIJA 2WB4A 2MGZA 1YZ6A 4IKAA 3MAQA 5L9XA 3PX6A 4LRAA 3PFEA 3MPVA 3PIPQ 4ED5A 4JI0J 4ZVOB 3CCVS 3VZHA 3J7AN 2MHEA 4ZLNA 2AEJA 3OSNA 1UA1A 1F3FA 1DQAA 2LQ9A 3E8OA 3BBFA 3T1AA 2ZNYA 5B0BA 2QA2A 1YTYA 4Y6IA 4DFMA 2ZOFA 2BOPA 2HHHJ 2EEYA 4O0NA 2M7SA 1FWPA 5B7WA 1X0PA 4KO0B 1OMSA 2AT1B 3QT6A 4UY85 1KOOA 1ZA2B 3H0PA 3GSIA 4JBCA 3PEHA 4OI3A 3TUZC 5L1JA 1TMMA 1GMUA 3RU0A 4JV5F 1CLFA 4BC9A 3KK1B 5C25A 2DGTA 4YMEA 7AT1B 4KSEB 2F7VA 1SJRA 4WE1B 5KG6A 3UNYA 1TUVA 3RJMB 1RT7A 2DISA 2FVCA 4PG5A 3K58A 1B7FA 2VB6A 2GQ2A 1XC9A 2CPDA 2FIUA 4ZP8A 2OSQA 2J6SA 1KVIA 2BKPA 1D9DA 1I1GA 3D7SB 3PFOA 4K50A 3DM2A 4JI0F 3N4WA 2GHPA 3KLFB 2HFNA 2GJFA 3DOMA 4MT1A 3JB9k 2K3IA 3OD2A 3HHEA 3NL0A 1RB0A 4QYZJ 1WDTA 1X31C 1IBLJ 2WW4A 3QFWA 4LRCA 3SBMA 3DOLA 4CO1A 4G1IA 2N3LA 1M5VC 2CZVC 2FHMA 4URSA 1JX4A 4CP5A 2QIFA 1I51B 2QA1A 3G9CA 5DLFA 3OR2A 4FKXA 5EDWA 2HFOA 2YBVA 3MGJA 2Y1RI 3PX4A 5C24B 2RRBA 3TR5A 4JI8F 4DV7F 3CCJS 2UXBF 2RF2B 3MEDB 1KS2A 2I8EA 1FX4A 4DL4A 4P2FA 1T3OA 4OJ3A 4DXLA 1K47A 3EX7B 2DTJA 3GYXB 1VQKS 2AZ3A 2IJRA 2NZCA 2PC6A 2C3OA 3PJXA 1ZH5A 1N8RT 4CQ1A 1DQ9A 3LA0A 4WU3A 5KFUA 1GMWA 4ES2A 1AB8A 1YJ7A 2WSCC 4ZVEA 2NQPA 3R1HA 1UW9A 2QE5A 4JYAF 2R7XA 3I6PA 2IRXA 2ACMA 4KIAA 2CJKA 3KNGA 4RUBA 4LQ9A 5KG5A 1CVJA 2HWHA 5D4OA 4Z7CA 4F2RA 2LEPA 3L7OA 3CPWR 4JI7F 1MSWD 3C6UB 4KH1B 2IA6A 3GWCA 4EYIB 1S1UA 2JL9A 4YQWA 3BF4A 4UTGA 4EMDA 1KN6A 2HHPA 2GIQA 3DOKA 5KFIA 4DSKA 4NXMJ 1K0TA 4O44B 2NLWA 2Z8QA 3DFEA 1S79A 2ZITA 3MM9A 3SQGB 2I9SA 2PO4A 4DUYJ 1JLAA 4LSNA 3LO3A 3UDCA 1VQMS 1UJ4A 4J9SA 3TEGA 3G8QA 4XDCA 2W9AA 2Y1LB 3A8JA 3PM9A 2ZBRA 3R5AA 4IFVA 3RRHA 1E6YB 2XZTB 2E1AA 2SXLA 2VBYA 1FE4A 3MUVP 2D7SA 2FJDB 1ZETA 4ZS6A 1SI9A 3I9ZA 5IOLA 4LBIA 1JLEB 2VHGA 2NR0A 1NEEA 4PPZA 3NNCA 3W2WA 2NS1B 2MZSA 2YVSA 4LBPA 1NK5A 1RTDA 3IO1A 1BD6A 3OFHA 3EPIA 2HHXA 5DETA 2C3UA 2CZ4A 3F41A 1Q53A 2ASYA 4G65A 5ETNA 1H2UX 2EKYA 5SZTA 1FHTA 5A8WB 1N0VC 3LAKA 3MMCA 2X3GA 4PKDB 2MZJA 4CDIA 4N56A 1QSLA 1H0HB 4OZNA 3VALA 4JV1A 3KK2A 3RZAA 1O51A 2HVZA 2ALZA 3KLEA 2ZOGA 3BEGB 4P72A 2HHQA 1MN9A 4DV6F 1ZTTA 2UP1A 1HWJA 3QSIA 1FEHA 1ZM3A 4ZVUB 1WORA 1S9FA 2F4VF 5D4LA 1M5SA 4ZK7M 1NCLA 2A6OA 2ZBPA 2VOPA 1R0AA 1Y9OA 2QO3A 4HI1A 2GVZB 2LP4A 3NP5A 3OL8A 1UKUA 2RQ4A 4O3PA 3IS9B 4BWMA 1S6QB 3MFIA 1UFWA 1U2RA 4ED0A 2H5JB 3CD7A 3GIRA 5EHHA 2IM3A 1X4AA 1U26A 1WJ9A 2XHCA 3DDNA 4P52A 2PA8D 3B54A 5E5NA 4MIBA 5EUHA 3W2WB 3NGRA 1Y10A 5HO4A 4YP3A 4NLVA 4CM2A 3QZ7A 1S7HA 3ENAA 4QWDA 1RBOB 5DS7A 1HD1A 1G4CA 3FBCA 1HYSA 5EN1A 3HHDA 2GVDB 5EWGA 3FZBA 2B5JB 1XK8A 1TMJA 1F2HA 1UZHA 1S59A 1EETA 2LQJA 4QQBA 4DR1J 2ASDA 2XS2A 2RUSA 1JLGB 3MUMP 4PG6A 1QAYA 1KHWA 3AA8A 5K9FA 1QY7A 3HK2A 5F8JA 4BS2A 1YRTA 1HHSA 3T1HF 1NZ8A 3V5RA 4MFBB 3IBFB 3KLFA 2BJ9A 3U7JA 1EP4B 2NYIA 2XMTA 4EBDA 1T0TV 1VBKA 1R0AB 3ZZRA 1PJ7A 4KV8A 2DNZA 1VIXA 2DGQA 4NLOA 3MPWA 1ZPWX 3BYRA 3V6DA 2HRUA 3D3CJ 3ILOA 4P2MA 4ZITA 2ZJRQ 1NK9A 1BC6A 2LECA 1T9TA 4DV7J 3ADAC 4JI8J 5HSPA 4ZLLA 4HACA 1VFJA 2LXIA 4MK8A 2A2CA 3R3TA 2BYCA 1QUVA 1QDUB 3PXGa 3CJKB 2X7IA 1H2TZ 1HNVB 3M1VA 3VGTA 4JI6F 1U48A 1X9MA 3CCLS 2HQIA 2DIUA 3IR6B 2V8GA 3JTOA 5HL7Q 2G4BA 3PYFA 2HW3A 1QJHA 2E5JA 2ZZMA 4FYWB 3PACA 3CJ2A 4FNIA 3GJRB 4ZPTR 2DNRA 4DU7A 5IFMA 3OL7A 1HBNA 2CRLA 3CMQA 3GFYA 1X5OA 3D28A 3GTYX 5D6GA 3T9NA 1H73A 4DR1F 2HQFA 5IV3A 1AUDA 2XLKA 1JLFB 3HCXA 3NKYA 1N88A 3NS5A 4M5LA 2HGNA 2GIFA 5GMDA 1SCJB 4QWAA 2E5LJ 3HHNB 1UETA 2JEIA 3ILLA 2HK3A 3ILIA 4M1KA 4CCHA 3L4BC 4OX9J 2R8GA 1FE0A 3EVOA 1M5OC 1M5KC 5IT9Y 1Q7LB 1JXVA 5KT2A 1F1BB 1JLCB 2VA2A 1LWCB 2R42A 3X1LB 1G7CB 4NXNF 1S6QA 3KMQA 4L74A 1R7IA 2YQ1A 3OTCA 3VF0B 5L38A 1OJ4A 1X5SA 4DX8H 1HMVA 3MAAB 3W60A 4QCLA 3ISZA 4F4ZA 1VRUB 2YWFA 3BGFA 2QSFA 4LF6J 4X4TA 1QM9A 4DG1B 3GJQB 1GNKA 1A0OB 2OPRA 3PW7A 2NSCA 1OYEA 4DR4F 4ZPAA 1NKEA 1IQTA 1U1KA 2CQ0A 4A8YA 3DI6A 2DCLA 4OZJA 4PWUA 3BKUA 5HMWA 5KFBA 2W4DA 4DSJA 3N5BA 2ASJA 3FFIA 5KG4A 4FF2A 2MQOA 3SZ2A 2XMWA 2APOA 3AA9A 4UOCA 5HBMA 3KLHB 5EWEA 3NAHA 4DX5A 2OD4A 2F9JA 4JI3F 2Z58B 3NOCA 3F0NA 3IWXA 5CYQA 2MSTA 1VIOA 4TLRA 1ACMB 2HLTA 4M5DB 1RLDA 2QFJA 1VQ5S 2FC8A 4ZVFA 2QLWA 4WCEQ 1RZMA 4QBUA 1SUQA 3D67A 3LP0B 4ZLJA 5KFWA 4ZPWR 1VQOS 1ZAXA 1NPRA 1REVB 1B64A 3QWUA 4NYZA 1GT8A 3GILA 4K4WA 3MECA 4ZVGA 2M9KA 3BKTA 1YJTA 2VG5A 4IRKA 2YNHB 2EKNA 2IVMA 4RW8A 2DR9A 2V8PA 5J2PA 2YQ0A 3AOBA 1GK8A 1U6BA 1IBCB 2Y3YA 2W7AA 2AEMA 2MJUA 4URQU 4KGKA 3HT3A 1RGVA 3M8PA 3RRGA 2BXJA 4DPWA 2C2OB 4DSIA 2D74B 4USHA 2UUWA 2J0WA 2VASA 4OJHA 2J9CA 2HFVA 4M95A 2HRYA 4OHWA 2DXDA 2BE2A 2QC3A 2YNFA 3JQKA 3MEGA 4ED3A 1I6JA 1KVJA 3MF5A 2V8VA 2XI2A 5KFLA 3TJ8A 3VVTA 2NXNA 3LALA 2J0QD 1C0UA 3HFKA 3CEDA 2CPZA 1FF2A 2FVRA 1TFYA 3FSIA 2XG8A 3S7RA 3FSYA 3W5ZA 3IRWP 1SJFA 4CLZA 3FC9A 1EP4A 4N7TA 3S1TA 1JNZB 4DSEA 3NGSA 4P9SA 4B3OB 3MEEB 1FT8A 3CO0P 3O6QA 3U1MA 4YY3F 3GJSB 1RTJB 5B0EA 3AB2B 4CNZA 2ZZNA 4K59A 1O6XA 1I3OB 3A3OB 4Z2XA 3BGOP 3CJ4A 3RBEA 3TZWA 4DL2A 4ELTA 2V2ZA 2AGOA 3THPA 1WHVA 3QZ8A 1UCNA 1WELA 2VA3A 5D4PA 4WPAA 1HNWF 4KGZB 4RW7A 1RDRA 4DQSA 1AT1B 3OXFA 1JLBA 2FDNA 3NG8A 4IUFA 2EK1A 3EZUA 4QPTA 4CWBA 3NMAA 3R5GA 3LANA 3KDNA 2MB0B 4U7UD 2IMWP 1GXTA 1UJ6A 3TP2A 2W7PA 4FF1A 2XTJP 3UR0A 1JB0C 2NXCA 3I0RB 4N8NA 2H3EB 3GQCA 2AJQA 1T95A 3EPGA 1SQFA 1CJUB 1R8CA 1X7VA 3BDEA 4YR0A 2AU0A 4OX6A 3QSYB 1SL0A 4PYAA 5CYMA 4K4TA 4JI4J 2QYGA 1YX2A 2OPQA 1XN9A 4N5SA 4ECYA 1HPZA 4CLTA 1WF2A 3GV5B 4XAKA 4DV0F 2EFVA 4RBVA 5KFYA 3RAQA 3KHHA 4I2QB 4DCPB 2IHR1 1NNDA 2DRBA 2C2KB 3ZZZA 1IR0A 2DK2A 3UCGA 8RUCA 3MD1A 3BZQA 4LQ3A 5A8RB 3PYGA 4ZP6A 1HNWJ 1RHUB 3R6LB 4XDDA 2GV1A 1VR6A 3FRYA 5DO2A 2YY3A 2JDJA 3QT5A 3OTOJ 5JVGQ 5HLFA 2MQLA 3FQLA 3JAMY 2YNGA 2VDIA 3ZO7A 2B43A 2QSWA 5C42A 1RWMB 3MAHA 1WEXA 4IYQA 3KLEB 1DFDA 1P8GA 3EJMA 2BACA 1MWQA 1NSQA 2XLIA 2P9CA 4NLQA 3VQSA 2HEKA 3MM9B 3ZTPA 4CO5A 1TAUA 2YKNB 1JLAB 2IAJA 3KJNB 5KFQA 1BXNA 2IMOA 1C0TA 4U8YA 5KG0A 2V0NA 3RR8A 4RW4B 2GFFA 1KVKA 4KAIA 1E6VB 2RKIB 3OVAA 2OTLS 2ZHOA 2F8EX 5KT7A 1U1PA 2RT3A 4RNMA 1RWUA 3IWNC 3CD5A 4Y2CA 3UVJA 1CQMA 2NPFA 4USIA 4PZVA 1F0XA 3VGUA 4J9KA 2X3DA 1N6QB 1IXKA 4LF1A 4F4YA 4WWSA 1YK9A 5IM0B 4DR3J 2CZ9A 3IBCB 4W98A 4O4GA 2B7BB 4IQXA 2KH9A 3CMES 3NBPA 1F60B 1KWMA 1PAEX 3BSOA 2JC1A 1U1OA 3HJFA 4PUOB 4ANEA 4ZKAA 4USWA 2CQDA 4DV6J 5ETLA 5J1EB 1RHQB 2AYEA 4PWDB 4A47A 4F4WA 2RDDA 1HBOA 1FDDA 3FSXA 3QRQA 4FYVB 3CCMS 1SKRA 1OQ6A 2IAJB 1Y3KA 3DRRB 1R8AA 1TKZB 4GMKA 2QLFB 4HL9A 4P10A 3UI3A 1X5PA 5EGYA 3AXKA 2EW9A 5A8RA 2H65B 5HI7A 1KRPA 3A8EA 3MUTP 5CYJA 4ELVA 2ACYA 3M8QA 4ID5A 1LEOA 4M5IA 2B6AB 1UEUA 1R6YA 3DLGB 4Q43A 4M5DA 3RBDA 1K8AT 5FJ4A 1FJGJ 4G1QA 1R8PA 2QN6B 4TU9A 4DPOA 5C2CA 1DTQB 1MWYA 5FIIA 3RAXA 5HLFB 1S4EA 1Q79A 2MHNA 2HZCA 3CJTA 2HQGA 3MECB 3IN5A 4F0HA 5D0GA 4P7TA 4FYYB 1FEEA 1TL7A 2DGWA 2KHDA 1RU2A 3FEYB 1RT3B 5CH7B 2W9BA 4C8LA 1S49A 2C2EA 2XCAA 4QU6A 2YKNA 3H2LA 3NS6A 4ZN1A 3K5LA 4B3MJ 2C2NA 3QRPA 1SL2A 2BEFA 5ETSA 1QVFR 1OS5A 4PWWA 3MTKA 4LF7J 1S99A 3QO9B 1N48A 2E9TA 2H1YA 3T9ZA 4KHRA 2K2PA 3RYLA 4ENOA 3KHLA 3V4IB 3BR8A 1N33J 1KFSA 4C9DA 2GMHA 1EAYC 1TAQA 3E2EA 4OYOA 1RABB 2KT3A 1CG2A 1YLXA 3IRXA 1U49A 3P96A 2IRUA 1H7WA 2G0IA 2JX2A 1ROFA 2J7KA 3FEZA 2GS8A 3MPYA 2GJIA 4NLTA 4QIEA 3W2VA 4YFUA 1N52B 4BHQA 3M8RA 3DXSX 4Y34A 2MZ1A 3NCPA 4KY3A 2BJ7A 4JUZA 4CTAA 2ZH6A 2WONB 4ED6A 3IFEA 1IBMF 3N28A 4ES3A 1TKXB 3I0SA 3H98A 6FDRA 3TOQA 3T6BA 2H5EA 3SV3A 2Z2LA 2J6TA 4OLPA 1UP1A 3PCOB 2YQ3A 3POTB 2EG1A 2J8SA 1XMQF 2R2TA 4LF2A 5CA5A 5HVGA 3RB0A 2B8PA 2CNKB 2DIVA 2OGUA 2RU9A 2KFYA 4JI5F 2V2QA 4F2SA 2DO4A 3OFEA 2XMUA 3OR1A 4YOEA 1T02A 4KE5A 4V19J 4OJ1A 2RILA 5G0RA 3SEOA 1RK8A 2Y0BB 5KTQA 2ALYB 3ETOA 4WJBA 1UJ5A 5L1IA 1MWZA 5E0OA 2B5JA 2WW8A 3W62A 2FHJA 1NJXA 4IRDA 4JI6J 4OFZA 4CYUB 3TW0A 2EC0A 3GIKA 1S6PB 2QMXA 3HP6A 2ZH5A 2XNRA 2UXDJ 1S5ZA 1TKXA 2AJ2A 2OSRA 3IRXB 5HJYA 3PEJA 3N6LA 3JSMA 3PY8A 2CPFA 2BUNA 3BJYA 1LK7A 3V81B 2BE2B 4BC7A 1GFWB 4PG4A 2F9DA 4YB6A 4YUDA 4GC7A 4ILRA 3PV8A 4Q8EA 2DRAA 1WC6A 1Y5IB 3P4UB 2QYCA 4LIWA 5KFPA 3HJVA 1UZDA 1NSAA 1TVRA 2C3YA 3T3FA 3DXBA 1IKVA 4BWJA 4IG3B 4DN0A 4FN5A 2LKZA 3D0GE 1ZZFA 3HD1A 3TAQA 1UEKA 2Z4PA 2RQCA 3CC2S 4LVOP 2KI2A 3W5XA 1S1WB 4AL7A 2ZBQA 4LFBF 4X4SA 3ILJA 2BJDA 1C0UB 3JSYA 3NGTA 2WSEC 5DQHA 1GX6A 3Q86A 2O1PA 2XSJA 1NSPA 3OHAA 1N5QA 4WFBQ 1YHQS 2F5GA 1NK0A 1JK9B 2V8HA 2AKWB 2LYVA 3UR3C 3LPYA 3WIVA 3CUNA 1M5PC 1VJQA 1IJFB 3KUGA 4C6AA 3NAIA 5D3GA 3KLIB 3DDKA 3LUYA 2P6SA 1S0MA 2Y8YA 2ZBIA 1GXLA 4C3MA 4ZCMA 3K59A 3RW6A 1AFJA 1FX2A 2B6AA 3UDLA 3G6XA 1NDKA 5KFCA 4MIAA 3ZTRA 3AT1B 4I2PA 1FJGF 5DQIA 1OPIA 4X64F 1EQ0A 3SFUA 3FCWA 2BBEA 3MMBA 2HFZA 5I3QA 4DWIA 1VC5A 3OTBA 2CQ4A 5A8WA 4ZDNA 1FNXH 3M8QB 4ID5B 4OX8A 4C2MA 3MM7B 3TX8A 4UY8T 4DSFA 4ZP7A 3PRBA 4NL5A 2KG1A 2YPYA 4DPYA 3EM1A 3GZ7A 2MQ8A 4M8LA 2H4YB 4LRDA 3PO4A 1U09A 3QIPB 2N7CA 2R7VA 2CPXA 2VODA 3AAWB 5DZ6A 3DYAA 4LSLB 3BS9A 3VQTA 4CO2A 4DZDA 2GJ2A 4OYBA 3S8SA 1S57A 1IWAA 1VHFA 1WG1A 1SH2A 2GHVC 3BKFA 3IXQA 4HH1A 3QGGA 4IFVB 4NLSA 3SDEB 1YBTA 2B56A 5HMZA 2ZH9A 3C15B 3ET6A 5D78A 1NBEB 2KRRA 1X4BA 4MAKA 2UUTA 3AXMA 2DBBA 4ICLA 2GO8A 1IVZA 3M30A 3TAMA 4X4VA 1FVQA 2GW8A 2XYGB 4OHVA 4AUKA 1S48A 2IM0A 2CQPA 5BYRA 5B0CA 3R8YA 3BREA 5C42B 1XMBA 2RF2A 2EFOA 4C8YA 1T9VA 4UUXA 2RHSB 5DM7Q 3CW2C 3QLHB 1VLYA 5B09A 5HN0A 4X65F 2LDIA 4USTA 3TVKA 2BX6A 3N5FA 3MURP 3PDNA 3CB4A 1I94F 4G3IA 4G1QB 4A8WA 1KSPA 2W4CA 1NPKA 3K7RA 1XMQJ 4FDFA 4HYKA 3RTVA 3ISNC 4DR2J 1RI7A 5DDQC 4JB8B 2PMHA 3V6DB 1WG5A 2BMBA 1AYEA 5E3PA 4RR5A 3UN3A 2XZDB 3ENQA 2ATCB 1PSDA 2OPSB 4EBCA 1U1QA 2UUCJ 5HMYA 1GQEA 3TWZA 3FBBA 3UNGC 4DPTA 2HPUA 1GMVA 4Q5VA 5K20B 1DARA 2VQEJ 4DV3J 2P5VA 4Q45A 3BQ1A 4M5JA 1UVMA 2MKIA 4ZVHA 5A8KA 1B3TA 2B4OA 4IO1A 2G1DA 3W9IA 3CXCR 3BGLA 2ZH8A 2J8AA 1HNVA 3MFHA 2ZDOA 3QO9A 4MKVA 4A8XA 2RB7A 3L3CA 2OH2A 5H9EJ 4KHMA 2ATLA 3WHIA 4DPUA 1HBUA 4LF4F 5H1SV 4RBTA 2XWXA 2HBQB 4O3OA 2DCUB 3CE8A 4LF9F 4C97A 3EGNA 4ZPBA 2R8JA 2UVWA 1QSYA 2RQKA 2HRTA 3VR1A 4JI4F 4KRWA 1QTNB 3NGUA 1CPZA 2B4PA 4DF4A 3C8YA 1RAAB 4MKAA 2V50A 2UUBJ 4PQUB 5IT9U 2BV3A 2BVZA 2RUGA 5HP1B 3OSPA 1M0SA 1WTBA 1RP5A 4OV1A 2GHWA 2CPEA 4RW7B 3SSRA 4F3MA 5CABA 2QLJB 1SH0A 2W2PP 3FNNA 2VQEF 4DV3F 4B3RF 4PYDA 1L3SA 3GR0A 3WC0A 6FD1A 3DLGA 2V8DA 3CIZA 3RBXA 4YY3J 4TQRA 3R1LA 3TEHB 1XNQF 1UMJA 3UD5A 2RE1A 1S10A 3RB6A 2WRMA 3K89A 4N76A 3C66A 3G71S 5HATA 3FKBA 3HVRA 3J7Z5 1PCAA 1VC0A 3MEEA 4KKOA 1RTJA 3GIIA 4DV5J 2M70A 4NLGA 2A10A 5F8MA 3KG4A 4F04B 2QL7B 4QJVA 4UW2A 5KT3A 2KZZA 1FRKA 1VOMA 3UQSA 1SPBP 2RVJA 2MLZA 2MXYA 2BJEA 3M2UB 4C0BA 2IYGA 1B0TA 2R8KA 3T6JA 1NM2A 2YWWA 3TUJC 1O0PA 1YIJS 2J6UA 2MZQA 3LP0A 4YDXA 4EO8A 5BR8J 2WZ1A 2K8GA 3M2RB 5AXKA 1S9EA 1RAIB 2ZUAA 4NLUA 2JVRA 1SJ3P 5LSLA 3GSDA 1LXJA 3C19A 3HT0A 4ICLB 4RW8B 2ZH2A 1PKUA 3FBFA 3HVTB 3SSSA 4AD6A 4FS2A 4DL3A 3H7HB 4OI1A 4OLOA 1RT6A 4ZJOA 5LXRA 1LFWA 2IM2A 2H54B 3LPEA 3R5JB 4EYHB 1RT4A 2J76E 4USUA 5GAEI 5RUBA 3CCQS 1HWLA 3NGDA 4RL1A 3KLHA 4X4PA 2GAHC 1MMDA 1U6FA 2MYFA 2QLXA 2OMOA 1NSKL 2YKAA 4O44A 3SQGA 3J7YI 1X4CA 1FK9B 3AD7C 2A6MA 2CPYA 1W26A 3Q8RB 4X66F 1S72S 4KPYA 4KGXB 1PBUA 1UEVA 4PXCA 2FY8A 3MTJA 2B0GA 2HMIB 3GYNA 4ILMA 5KT5A 1T3NA 1V3ZA 2HHSA 1Q4RA 3PTWA 1XMOJ 2V6AA 3KG1A 2VOOA 2RD5C 4HKQA 1BWEA 1H6KX 4ANDA 4D3GA 3PRDA 3A12A 2J9EA 2OI2A 1SB6A 3B4MA 4EU0A 1RHKB 3R27A 5AE2A 2R7OA 1G6BA 4IOAQ 2IYIA 3QFHA 3BSNA 3U02A 4B9MA 3KK1A 3G6ES 2ZKTA 3MR3A 2DJWA 1RUSA 3IM8A 2AWZA 2CWKA 2ZDPA 3PW4A 1KLMB 2HZAA 1PJ5A 1OO0B 2B9EA 1T8EA 2OUGA 4RUHA 1V5IB 2JEFA 2PD1A 1R3NA 4KH0B 4P7VA 4IDKB 3Q8YA 1LFPA 3I32A 4ANCA 2BQRA 2MMYA 2LU1A 2UVVA 4NCBA 2FZCB 2JLEA 1TL3B 2XLJA 1HQ2A 2MLXA 1TKDA 3FDSA 4ZCIA 1SQGA 3KJQB 1D9FA 3TRGA 2WVCA 2W2OP 2E7WA 2XSJB 3TJ9A 1Q16B 4CLLA 4LFAF 2CIMA 4R5PB 5GAHU 1FFWB 3MCMA 2KYZA 5GMEA 5IT0A 7FDRA 1R31A 2WVDA 2DR8A 5J1EA 2ZD1A 2RSQA 3D0HE 3LW5C 4P71A 3CIMA 4A4JA 2FGOA 2KFNA 2DXEA 2XYPB 1K73T 3W7BA 2VONA 1WTFA 1WHWA 3P8BB 5K5MA 4NRUA 2VBWA 3CDBA 4CIOA 1JLGA 1G1XA 1FKOB 5ETQA 4ED4A 4O3QA 1FRJA 3TZZA 3DLHA 1XJWB 4LF8J 1M1HA 4DN9A 2ZM6F 1F6TA 3EXCX 3R5DA 2XB2D 4M5NA 1YZ7A 4KV8B 2RMLA 1WKLA 2R7WA 4BDPA 3AQPA 5A76A 4K5RA 1UVIA 1EKSA 2BKOA 2FHKA 2M52A 1RKIA 4KYZA 3UPFA 2CWXA 4O23A 4WIQA 4DFKA 1S0OA 7FD1A 3OQ2A 3KTQA 1BY9A 2K3KA 4A8FA 2HKEA 2RNEA 5F8IA 2ZNZA 4YHHF 4OZ1A 4LF7F 3R97A 2HFUA 4M5HA 1WOSA 2GO9A 3A13A 1IKWB 1RA7A 1NH8A 1V3RA 2OMLA 1HLWA 4ITSA 5GAGU 4TU7A 3MEKA 4ZVRB 2Z2YB 2DH9A 2NZ4A 1RCOB 2D69A 3MMAB 2CA9A 3NRBA 5CCMA 4OYAA 5JUMA 4TQSA 1Z4UA 5KFMA 2HNYB 4ETXA 1YI2S 2G0CA 2X1BA 1VMBA 1LKZA 4K5SA 1IBMJ 3HFVA 1AA1B 4ZVPB 4PWDA 3LP2B 1CJVB 1U02A 4QIWD 3ZZUA 4H4OA 4OI2A 4ED7A 3UD4P 2C3MA 4IH7A 4LIRA 2W2NP 3HXMA 2RS2A 2F63A 1L3UA 3MXHP 5C2GA 1RBAA 3VAFA 2FD2A 2GVDA 4CO0A 3MMCB 5CD4A 3JQJA 1CJTA 2Q3PA 3DU5A 3OL6A 3V6JA 1HI1A 3CDWA 3UO0A 1ZM2A 3OJSA 2E5HA 1T9UA 1N34J 2FLLA 1VQLS 2WB1D 3JQMA 1IR2A 1LW2A 4QR0A 5AE3A 3QJJA 4RNFA 3UE2A 4KPCA 5IWAF 1K9MT 2Q6BA 2CKWA 3UDVA 3CJ0A 1N36F 4FNHA 5KFTA 4EWTA 2XC9A 5CZVA 4B9VA 4DL0C 2IC3B 5BYSA 2HQ3A 4X4RA 4C98A 1ZA1B 3I4HX 1IQZA 4C11B 3DRXA 1VISA 2Z56B 1S1TB 4NLRA 1G2EA 2CJQA 4LVNP 2DYAA 3GCXP 1URRA 2YNFB 2NUHA 1BQMB 1ZM4A 2IFXA 3ISND 2OP5A 4H54A 2BJ1A 5F41A 2FY1A 3CTRA 3DGPB 5THWA 4OYWA 1HBOB 1HA1A 5HMXA 3OVSA 4IH6A 1ZM9A 1VBXA 4DUYF 4TYBA 4DI6A 3ENWA 4OI6A 2YKOA 1FJEB 2HVEA 3HLUA 3J7A1 1NUEA 2HNZA 3Q8VA 4OZ3A 3JYTA 4DF8A 1N5YB 2VPZB 4GKJJ 3A3NB 3KXDA 2FQQB 4Q2LA 1DTTA 1GMWD 1QAXA 4LR8A 3L9ZA 4DZ6A 3HD2A 3WDOA 1ELOA 1NK6A 4FS1A 2KM8B 2VJUA 4WYLA 2OAUA 3I82A 3DLLQ 4FBTA 2N3OA 3M8ZA 3QATA 2V34A 1IBKF 2IM1A 2VKRA 1UWAA 2W4PA 1S1TA 3DYAB 1L5UA 2WVFA 1R6VA 2OIHA 1WI6A 5MLCV 2PI5A 1SBRA 2G2OA 3FRZA 4HT7A 3NLCA 3LAMA 5J2MB 4HHUA 1H2VZ 8AT1B 4FXVA 1TV6B 1ZOTA 2K06A 1F5BA 2O67A 4C0OC 2L41A 5J2QB 4N41A 2KYXA 2DHHA 3AODA 4U67Q 4GO5X 3A3PB
chains in the Genus database with same CATH topology
3VGUA 3DDIA 1EHWA 3DKDA 3VGVA 1MN9A 3NGTA 1NDLA 3Q86A 4W98A 4F4AA 1NSPA 4DUTA 1F6TA 1NCLA 1PAEX 3G2XA 1F3FA 4ANEA 1WKLA 3BBFA 3FKBA 3B6BA 4C6AA 4O0NA 4S0MA 3BBCA 3FBEA 4F36A 1ZS6A 1NDKA 3GP9A 3B54A 4UOGA 3ZTRA 5BXIA 2DXDA 3NGRA 1VYAA 1HLWA 3ENAA 2AZ1A 3FCWA 3VVTA 1LEOA 3FBCA 3EVMA 4HR2A 3VVUA 3Q89A 4EK2A 1S59A 3FC9A 3PRVA 3Q8UA 3ETMA 3EM1A 1BHNA 3NGSA 2ZUAA 2NCKL 1S57A 1WKKA 2DY9A 3R9LA 1PKUA 3FBFA 4WBFA 1UCNA 1B99A 5CAAA 3EMTA 3EICA 2B8QA 2BEFA 4CP5A 4UOHA 3VGTA 4FKXA 4KPCA 1NSKL 4ENOA 3GPAA 2BX6A 1XIQA 1HHQA 3ELHA 2AZ3A 1NPKA 1NB2A 1NDCA 3JS9A 1NDPA 4ANDA 3MPDA 2DYAA 1U8WA 3Q83A 5C7PA 3EVOA 1XQIA 1JXVA 3FBBA 1BUXA 1B4SA 1NHKL 2B8PA 1KDNA 1W7WA 3EE3A 3ZTOA 2CWKA 4DI6A 2VU5A 3BH6B 2HVEA 1LWXA 4UOFA 3PJ9A 1NUEA 3Q8VA 3FCVA 3Q8YA 3ZTQA 4ANCA 3EVWA 4DZ6A 1HIYA 3EJMA 1S5ZA 1NSQA 3BBBA 2HURA 3ZTSA 3ZTPA 3WX8A 2DXFA 1BE4A 5IOLA 1WKJA 4FKYA 3NGUA 3VGSA 3BH7B 1MN7A 2DXEA 1NLKL 1K44A 5CABA 2HVDA 3L7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGU A;  3DDI A;  1EHW A;  3DKD A;  3VGV A;  1MN9 A;  3NGT A;  1NDL A;  3Q86 A;  4W98 A;  4F4A A;  1NSP A;  4DUT A;  1F6T A;  1NCL A;  1PAE X;  3G2X A;  1F3F A;  4ANE A;  1WKL A;  3BBF A;  3FKB A;  3B6B A;  4C6A A;  4O0N A;  4S0M A;  3BBC A;  3FBE A;  4F36 A;  1ZS6 A;  1NDK A;  3GP9 A;  3B54 A;  4UOG A;  3ZTR A;  5BXI A;  2DXD A;  3NGR A;  1VYA A;  1HLW A;  3ENA A;  2AZ1 A;  3FCW A;  3VVT A;  1LEO A;  3FBC A;  3EVM A;  4HR2 A;  3VVU A;  3Q89 A;  4EK2 A;  1S59 A;  3FC9 A;  3PRV A;  3Q8U A;  3ETM A;  3EM1 A;  1BHN A;  3NGS A;  2ZUA A;  2NCK L;  1S57 A;  1WKK A;  2DY9 A;  3R9L A;  1PKU A;  3FBF A;  4WBF A;  1UCN A;  1B99 A;  5CAA A;  3EMT A;  3EIC A;  2B8Q A;  2BEF A;  4CP5 A;  4UOH A;  3VGT A;  4FKX A;  4KPC A;  1NSK L;  4ENO A;  3GPA A;  2BX6 A;  1XIQ A;  1HHQ A;  3ELH A;  2AZ3 A;  1NPK A;  1NB2 A;  1NDC A;  3JS9 A;  1NDP A;  4AND A;  3MPD A;  2DYA A;  1U8W A;  3Q83 A;  5C7P A;  3EVO A;  1XQI A;  1JXV A;  3FBB A;  1BUX A;  1B4S A;  1NHK L;  2B8P A;  1KDN A;  1W7W A;  3EE3 A;  3ZTO A;  2CWK A;  4DI6 A;  2VU5 A;  3BH6 B;  2HVE A;  1LWX A;  4UOF A;  3PJ9 A;  1NUE A;  3Q8V A;  3FCV A;  3Q8Y A;  3ZTQ A;  4ANC A;  3EVW A;  4DZ6 A;  1HIY A;  3EJM A;  1S5Z A;  1NSQ A;  3BBB A;  2HUR A;  3ZTS A;  3ZTP A;  3WX8 A;  2DXF A;  1BE4 A;  5IOL A;  1WKJ A;  4FKY A;  3NGU A;  3VGS A;  3BH7 B;  1MN7 A;  2DXE A;  1NLK L;  1K44 A;  5CAB A;  2HVD A;  3L7U A; 
#chains in the Genus database with same CATH topology
 1WOO A;  4C7Q A;  2H5I B;  2RRA A;  1EHW A;  2B51 A;  2J5A A;  3CJ8 A;  4DFP A;  1FJC A;  3DCA A;  3DNC A;  3GMG A;  4B08 A;  4KJI A;  1ZZN A;  5CYM B;  4X4Q A;  5F9N A;  5AXM A;  4MK7 A;  3OLA A;  4ECZ A;  4GKJ F;  1RHJ B;  3W8P A;  1V3S A;  3G2X A;  3P3D A;  4CT8 A;  2I6W A;  3BV8 A;  3FQK A;  5LOQ A;  3VAG A;  1FFG B;  1XNQ J;  2A0F B;  2KDO A;  3M6V A;  3RAM A;  2AW0 A;  4AQY F;  1IM6 A;  1FWK A;  2EFG A;  1DBD A;  3BN4 A;  2ILY A;  3QID A;  4PAB A;  1EQM A;  5IC4 B;  3TA2 A;  3TZX A;  2C22 A;  4E0D A;  3C3L A;  1WNE A;  1FFS B;  1P9Q C;  1UPP A;  1GTE A;  1NXI A;  1RE1 B;  2AZ1 A;  2XMM A;  4NEY A;  1WC4 A;  3H5Y A;  2BZ2 A;  3MI7 X;  2VKZ G;  1FNO A;  2EI5 A;  2XMV A;  3IA0 A;  4DG1 A;  5FLX U;  5HVH A;  2KFZ A;  4B3T J;  1RAC B;  4U95 A;  1F5C A;  1NK7 A;  3D1H A;  3ZC4 A;  5A8K B;  1Q8L A;  2CQ2 A;  1RLC L;  4K2X A;  3D54 A;  1S1W A;  3NCQ A;  1YVF A;  5T14 A;  2HQD A;  3R5B A;  3RG6 A;  4K4S A;  3HHL C;  3W63 A;  2DNM A;  4OYX A;  4B9T A;  4Q0B A;  3DM2 B;  2GCF A;  4LFB J;  2R9L A;  5KAK A;  1F2G A;  2Z2M A;  2WBM A;  2PEH A;  1CJU A;  2OEK A;  1OY6 A;  4C48 A;  5K8O A;  3K5O A;  4DQQ A;  1JJC B;  5DDP C;  1VQ6 S;  3R9L A;  3QNW B;  2FZK B;  3OT9 A;  3EXY A;  4ECQ A;  1KQS R;  1CEZ A;  5C5J A;  2OPQ B;  2C2R A;  2AMC B;  5F0U A;  5CXT A;  3MOZ A;  2JLF A;  1M1G A;  5HQ8 A;  1TL1 B;  3UWT A;  5F8G A;  1ZPV A;  2MJN A;  2CJ9 A;  1VQ9 S;  4OYI A;  1TK5 A;  4AQY J;  1SUQ B;  2P8I A;  3MR6 A;  3EDQ B;  2EK6 A;  3SSQ A;  2LEA A;  3FK4 A;  4OYM A;  2E5I A;  2FJV A;  2Y8W A;  2GA7 A;  4ALZ A;  1WAC A;  3IGN A;  1L3K A;  2CJA A;  2GML A;  4B3O A;  2XEX A;  3HI9 A;  2DT9 A;  2BAB A;  2KRB A;  3E01 A;  2XMK A;  4Q2M A;  1XR5 A;  4A46 A;  9ATC B;  4QYZ K;  3QWP A;  4WFY A;  5KFD A;  1TK0 A;  4L6V 3;  3MDF A;  1ZTW A;  3CSK A;  4K4Y A;  1XIQ A;  1RQ0 A;  4TYA A;  2AX0 A;  3HUL A;  4QWB A;  3I5A A;  1JLE A;  2WON A;  3RUB L;  2DR6 A;  3H5X A;  4MKB A;  5GAH I;  3F73 A;  4LFC J;  2W1B A;  3MPD A;  2LEB A;  2UUB F;  4JI5 J;  4B3T F;  3FUY A;  1KHV A;  3GIM A;  3CCE S;  4MYU A;  2MKY A;  4CH1 A;  3PHE A;  5D0H A;  4A8M P;  2OPP B;  2HZV A;  2PA3 A;  4MTP A;  2MKH A;  5JXS A;  3US5 A;  3C15 A;  1U8S A;  4NZ6 A;  4P74 A;  1RAE B;  1FJ7 A;  2R2U A;  2HNZ B;  1R0C B;  1Y5L B;  1X9S A;  1T9W A;  2KT2 A;  3DRP B;  2E7X A;  2VU5 A;  2V67 A;  2K7J A;  3M05 A;  4ZPC A;  4NA3 A;  4KGM A;  1UAW A;  2PT0 A;  1Z1Z A;  4CZC A;  2AEF A;  2CG8 A;  2W2Q P;  3AY0 A;  3ZTQ A;  1NK8 A;  3LOU A;  1ZAV A;  4PPD A;  5IQ6 A;  3Q24 A;  1PIL A;  3G82 B;  4HEA 9;  4K4U A;  2DHS A;  4J9N A;  3UN5 A;  2DH8 A;  5KT4 A;  3RRK A;  3B82 A;  1RT3 A;  3M8W A;  4TKT A;  1FD2 A;  3V4M A;  3TX0 A;  4ZLP A;  2ADC A;  2MY7 A;  1QVG R;  3ICL A;  1QAI A;  4I6A A;  1PO6 A;  8ATC B;  4ZCL A;  4ED8 A;  5CYQ B;  1JMT A;  3CGI A;  1TV6 A;  2WHO A;  1JKH B;  5DRK A;  4HVZ A;  5KFG A;  4C11 A;  2NUU G;  2R7S A;  4FKY A;  4M5G A;  4K8R A;  4TVA B;  2UUA F;  4F3O A;  2VC1 A;  4DSL A;  3OFG A;  4DV0 J;  2EFP A;  1TVR B;  2VH7 A;  2XMJ A;  4YB7 A;  1VC6 A;  3N0V A;  1IKX A;  2OEJ A;  1UFL A;  2FLO A;  4I0W A;  4WP8 A;  4MKY A;  3OTE A;  3ZZT A;  4H4M A;  4CH7 A;  1EZZ B;  3SMZ A;  1B0P A;  1YJ9 S;  3JAM U;  4CNY A;  1TTH B;  1PYS B;  2R8H A;  3M9O B;  3OUY A;  4F4A A;  3UDE A;  3FMB A;  2J7U A;  1EX8 A;  2ZFH A;  4AXI A;  1DTQ A;  1SH3 A;  2W9B B;  1H38 A;  4HLB A;  2OPR B;  2FLP A;  1FDA A;  1FWL A;  4KR0 B;  4ECR A;  4LBH A;  3W5Y A;  4DBQ A;  5D3G B;  2XYH B;  4JI3 J;  3THT A;  3OR1 B;  4V1A k;  4WP9 A;  2V9K A;  1GEH A;  5BXI A;  1WDD A;  1VYA A;  4JOU A;  1VQ8 S;  2LXF A;  1Q8K A;  3OL9 A;  1Q1K A;  2B4U A;  2VC0 A;  3RGI A;  4Y28 C;  2GAG C;  2JSX A;  3KKF A;  3VAH A;  2LQB A;  4ECT A;  4WYW A;  3T19 A;  1GXU A;  2V4R A;  1UA0 A;  3V6H A;  2YKP A;  1F5A A;  5LSR A;  3FZ2 A;  2VIH A;  2XY6 A;  3TAN A;  1TQL A;  3DRP A;  1TUW A;  1IKY B;  2AJF E;  4CLK A;  2E5G A;  3DU6 A;  4MFB A;  4OZ0 A;  3GFX A;  1RWX B;  3SCI E;  2E9R X;  5C24 A;  3BDP A;  5L9N A;  2M8D B;  4Q0B B;  3CD6 S;  1R0B G;  2AIR B;  3D9B A;  4W92 B;  3I0S B;  4GKK J;  3HZG A;  5JVH Q;  4RW4 A;  4PR6 A;  1HQE A;  1WHX A;  2K7K A;  2QV6 A;  4TY9 A;  4F7V A;  1CUL B;  2V69 A;  4FXW A;  1P6T A;  3O44 A;  3FMW A;  2R3V A;  3CJ5 A;  1D3W A;  3CCZ A;  3PR4 A;  4IOC Q;  3AB4 B;  1T03 B;  3I96 A;  3HKZ D;  2HHH F;  5DGB A;  4QOT A;  4ETZ A;  1S6O A;  2E29 A;  4C8K A;  3VAI A;  4K0K F;  2AQ4 A;  3J81 j;  4FBU A;  2VG7 B;  4NCG B;  1BMQ B;  1LK5 A;  1APS A;  4UOH A;  3NXZ A;  1Y5N B;  3OJU A;  4RO0 A;  4GO7 X;  2UVU A;  1GAO A;  2F40 A;  4F4X A;  2DRD A;  3MM5 A;  4MIW A;  4OQJ A;  3EYZ A;  1Y0H A;  3GFZ A;  4FVC A;  1T05 A;  2QMW A;  4KB7 A;  1SJQ A;  2V9W A;  5D8H B;  3OVB A;  1N4L A;  1RT5 A;  1U2C A;  4TLQ A;  5D77 A;  1NDP A;  2M2B A;  1U25 A;  3AD9 C;  2POK A;  1TP7 A;  4I2Q A;  3SCJ E;  1RTH A;  4ZIV A;  5ETV A;  4EZ6 A;  2MLY A;  2VPX B;  2D3Z A;  2AJ4 A;  3DOM B;  4ECX A;  4ZHR B;  1HBM A;  4DL7 A;  1XBW A;  2WSF C;  2CUY A;  2RQM A;  3O8W A;  4K2J A;  1RTD B;  1HD0 A;  2AX1 A;  4OZ5 A;  4BCA A;  2HHU A;  2LDY A;  3QYY A;  3EWG A;  3G8S A;  3HMJ G;  2D41 A;  1JLB B;  2XO7 A;  1N32 F;  2PFD A;  1WF1 A;  3PJW A;  3WC2 A;  4USM A;  3MM6 A;  5KT6 A;  4WXO A;  1MW7 A;  1CQN A;  1WD6 A;  2KU7 A;  2HHV A;  2LQ8 A;  3T5H A;  1RT2 B;  1WI8 A;  4L3N A;  1ZBT A;  3H4B A;  5LMN J;  4LF6 F;  3ZZY A;  4PG8 A;  3NOG A;  1IUJ A;  1P1L A;  4OZL A;  2DXF A;  4TNO A;  2QGF B;  4DEZ A;  2DVI A;  1CJV A;  4ZIW A;  2DNQ A;  4IOB A;  1KP6 A;  1PYT A;  2Q66 A;  2C2M B;  3NMR A;  3TA1 A;  2OEM A;  3BYP A;  1L3V A;  4CLF A;  2IBK A;  2BW2 A;  4LF4 J;  1KR4 A;  2AHO B;  2NSB A;  2C3P A;  5M2U A;  1AXQ A;  1FKA F;  1U24 A;  3MHY A;  3UFC X;  4RNO A;  4DR3 F;  3NWR A;  1FTR A;  2IBO A;  3ULH A;  2ZVI A;  5KFR A;  3U1N A;  4DDF A;  5IM0 A;  1RSC A;  2OEL A;  2UUA J;  1TKT B;  2C28 A;  1O8B A;  1IKW A;  3MCN A;  1AZS A;  1TL3 A;  2N7Y A;  5CQG A;  3LP1 B;  2X51 A;  4E2F B;  4K4V A;  1URN A;  2R7T A;  1NDL A;  2VPW B;  4F25 A;  2VFT A;  4FF3 A;  4IDK A;  2KKH A;  5IXU A;  4NXM F;  2VV5 A;  4IQM A;  2E66 A;  2HK2 A;  2VG6 B;  4MMO A;  4O0I A;  2R2R A;  4NA1 A;  5K14 A;  2VQF J;  2LCW A;  2GNK A;  5EX0 A;  3HPO A;  1WEY A;  1R27 B;  4ECU A;  4I56 A;  2HYI B;  1W2B R;  3GE9 A;  2AGP A;  2Z0G A;  2UXC J;  1NB7 A;  4B3S F;  2MEW A;  2DGO A;  3GP9 A;  4CH0 S;  3RB4 A;  3P6Y C;  5KFS A;  1DQ8 A;  1C0T B;  4DV2 J;  3D66 A;  4WFX A;  3IR5 B;  3TAP A;  3M2U A;  2YTC A;  3ZZO A;  3HVA A;  2VIC A;  2DNN A;  2WK4 A;  4X65 J;  4ZPV R;  2XS5 A;  5L8R C;  3SI8 A;  2BQU A;  3VVU A;  1DJ0 A;  2BM1 A;  3CUL A;  1I94 J;  2QJ3 A;  1FES A;  1RT2 A;  1HMV B;  3MAA A;  4AL6 A;  1PC4 A;  1HW9 A;  3ETM A;  5K8N A;  2YXL A;  3OFF A;  1S76 D;  3FFI B;  1YIT S;  3K5P A;  1T11 A;  1P9Y A;  3MR5 A;  3EDR B;  4NLY A;  5F3Z A;  2XY7 A;  4NXN J;  4Y2A A;  1S0V A;  1T7P A;  1ULR A;  2G2Y A;  3C16 A;  5K14 B;  4PXD A;  4WBF A;  5A0Y A;  1B99 A;  3I31 A;  3IP0 A;  4IR9 A;  4N77 A;  4WII A;  4DU8 A;  2D9P A;  1TR0 A;  2WOM B;  3HVT A;  1JJH A;  5B0D A;  3EIC A;  5I3U B;  4QYR A;  3K57 A;  2CPJ A;  2M0G B;  2VL1 A;  3MED A;  4USK A;  1OQ3 A;  1RIS A;  4PG7 A;  4N8O A;  3G82 A;  1O5J A;  3DN9 A;  4DV2 F;  4DR4 J;  4LJM A;  3DLJ A;  3RBZ A;  3M9N B;  2YH0 A;  4JI1 J;  1D09 B;  2UXD F;  1V9O A;  2RRN A;  3J80 U;  3VTI A;  4WK1 A;  2P9E A;  1GTH A;  1LW0 A;  2HNY A;  5D0E A;  1SJ4 P;  3MM5 B;  5F9L A;  4FZV A;  4LRB A;  2IVF B;  3SCL E;  4HDH A;  3ELH A;  1JKH A;  1YBU A;  1N5V A;  1NDC A;  5D0R A;  4I1T A;  1IWG A;  1T9X A;  1UPM B;  2R7Q A;  2Y0S D;  2PGC A;  3D6H B;  2IPO B;  4P2X A;  4ZHR A;  2KM8 C;  2FB0 A;  2M5Y A;  4DV1 F;  4DQP A;  4ED1 A;  1FTC A;  3EGW B;  2LA4 A;  2Q79 A;  3Q83 A;  1CJT B;  2VFV A;  4UQT A;  4I2P B;  5KFA A;  1SIW B;  4V19 X;  1TEL A;  1ZAW A;  3PX0 A;  2HQC A;  1S0N A;  4RW9 A;  3L95 X;  1B4S A;  4KFB A;  4PCQ A;  4LFC F;  3R2C J;  3J81 Y;  4DFJ A;  1LNQ A;  2Z30 B;  2ZE2 A;  1HWU A;  3P5T L;  3H8Y A;  5B0A A;  1VRQ C;  2UZA A;  5U47 A;  3KMS A;  4TY8 B;  1LV5 A;  2QTW A;  4ELU A;  5ETK A;  4LSZ B;  4AYB D;  2FTR A;  2G1H A;  2HND B;  3DRS A;  1NH7 A;  3G87 A;  3HSG A;  3L09 A;  3PJ9 A;  1HI8 A;  4HDG A;  1TU0 B;  4OMF G;  3UCZ P;  2MDA A;  3PVX A;  4B9S A;  2XWY A;  5F8L A;  3CJ3 A;  2YX1 A;  1WSR A;  3LGN A;  4RWX A;  2I0X A;  4RX6 A;  3TJA A;  2DNY A;  3BM7 A;  3HSJ A;  4CTA B;  3BBB A;  3QPI A;  4I6Y A;  4QR2 A;  5E3A A;  1QSS A;  1CS4 B;  1BGX T;  1PC5 A;  2HUR A;  3DLK A;  2LXU A;  3C2P A;  3WX8 A;  4KC5 A;  1BE4 A;  4YR3 A;  1NAQ A;  1RKJ A;  3W2V B;  4ECS A;  1IKV B;  2NRE A;  2O66 A;  4DLG A;  2DKO B;  3EGV A;  3HDS A;  3OXG A;  5SUH A;  4ILL A;  1PBA A;  4J9R A;  4HAC B;  1AUS L;  4LFA J;  1K44 A;  2LLZ A;  3VHQ A;  1EKR A;  2V4Q A;  2ZHB A;  2V63 A;  1Q81 T;  5HAO A;  3KOA A;  5I4M A;  2AP6 A;  2MQM A;  2V94 A;  1LXN A;  2VFU A;  5IV4 A;  3BQ2 A;  2UXB J;  1QE1 B;  2A3J A;  3I56 S;  4WXW A;  4TXS A;  2YKM B;  3VGV A;  3KK2 B;  1S6P A;  3M8S A;  5DG7 A;  2VD3 A;  2D9O A;  3DI6 B;  1R8H A;  5J2N B;  2WVE A;  3NWG A;  3IS9 A;  4KT0 C;  2ZH3 A;  2LA6 A;  3OPK A;  3PYE A;  3W64 A;  3QBC A;  4LF8 F;  2FLN A;  2BA9 A;  1RWK B;  1LW0 B;  2BAN B;  4DR6 J;  4I6W A;  4EFA C;  4J9O A;  3IWL A;  1F3V A;  4S0M A;  2F4V J;  4X4N A;  4OV6 A;  3H2U B;  4EO6 A;  4QWE A;  2Q43 A;  1FRI A;  2L9D A;  3FBE A;  2HSE B;  2XBP A;  4F0M A;  1TFW A;  1HYS B;  1KLM A;  1ZS6 A;  1RT4 B;  3NY0 A;  3KLV A;  2ZH7 A;  1V5V A;  5L1K A;  3DLE A;  3TAR A;  2GMJ A;  1Q5Y A;  4EGL A;  4K4X A;  2OFG X;  4CLS A;  3DHX A;  1JLC A;  1XR7 A;  2ZOM A;  3MWB A;  1RT5 B;  2CQ1 A;  3PW0 A;  3NCR A;  2D3U A;  2M4M A;  5F8H A;  4OYZ A;  1DHM A;  5A2Q Y;  3Q2S C;  2B4V A;  2CJB A;  4NZ0 A;  4WU2 A;  4J90 A;  1Z2L A;  3MM8 B;  4FYX B;  1Q95 G;  4PXE A;  2R7R A;  4ZVQ B;  1NME B;  2OLW A;  4KHP J;  4O3S A;  1ITP A;  4CLU A;  2XGP A;  1FDN A;  2EVZ A;  5LJ3 Y;  2GGP A;  3I4P A;  2LQ5 A;  2YNH A;  4C8M A;  5IS2 A;  5AXL A;  1OIA A;  3M30 B;  1DLO B;  1MU2 A;  2CQB A;  3TAM B;  2ZJP Q;  1NZA A;  2AF6 A;  2XZW A;  1OWX A;  3VAK A;  2QMU B;  1HWK A;  4C8Z A;  3A8K A;  5KFJ A;  1YJN S;  1CJK A;  2CQI A;  4WF9 Q;  2BDP A;  3DOK B;  3R7N B;  3N6N A;  2MQQ A;  2JNJ A;  4RNN A;  3GR1 A;  4CT9 A;  1AFI A;  4E8U A;  2KVI A;  4OYP A;  1LWF A;  3MCO A;  3UVJ B;  2KXH A;  1JLQ B;  3M2R A;  2KZM A;  4I67 A;  1KTV A;  1JJ4 A;  5DLG A;  3OR2 B;  3CDA A;  5KFF A;  1OPZ A;  5IZH A;  3TVY A;  5H9E K;  3MM7 A;  3QGH A;  1WEZ A;  5M2R A;  2JEG A;  3UW1 A;  2G0J A;  3DMJ A;  4HTJ A;  4MJK A;  3ZFV A;  4OI4 A;  2M3D A;  3ET6 B;  2YPZ A;  2F65 A;  1RAF B;  4U7C A;  1Y00 A;  1KQF B;  1VQ7 S;  2GGP B;  4Z7Y A;  3B78 A;  2N4C A;  5CZX A;  5ITH A;  4XTT A;  3R7S B;  1S9G A;  2QLB B;  2Q1L A;  4NYO A;  1EIY B;  4WTY A;  2WBR A;  2BOA A;  3W1Y C;  1JLQ A;  1KDN A;  1VRU A;  2ROG A;  4Y2K A;  1NKB A;  4J5O A;  5A2Q U;  1UW4 A;  2X1G A;  3D3B J;  4DUZ J;  1X5T A;  1NO8 A;  2OKQ A;  1X0F A;  1HNZ J;  4BBY A;  1X4D A;  3SV4 A;  2ZUG A;  1RTI B;  2EFN A;  1RXO B;  3I9V 9;  4LMZ A;  4G1P A;  3P45 B;  2H9Z A;  1I5O B;  1WC0 A;  1LWF B;  1KFD A;  3GJT B;  3AJ2 A;  3NBP B;  3NGK A;  3Q0A A;  1U0H A;  2BW7 A;  1ICE B;  1X4G A;  1FD8 A;  3PHT A;  3LP1 A;  1HPZ B;  1TUG B;  2W25 A;  4H4M B;  3GON A;  4NLX A;  2N82 B;  4AXJ A;  1UWB A;  1U45 A;  1RAO A;  1WHY A;  4NZ7 A;  1N6Q A;  4ZPD A;  2E1M C;  3QJL A;  3GG0 A;  1RAG B;  3AH6 A;  3VAJ A;  1WKJ A;  1UVL A;  2WAQ D;  1R8B A;  1IN0 A;  3BH7 B;  3KFW X;  3J81 U;  1HI0 P;  4B02 A;  2HGM A;  5J1P A;  4F8R A;  2M8H A;  1H98 A;  1RWN B;  3ZNU A;  3CO9 A;  4QWC A;  2C1E B;  4NLD A;  1QD1 A;  2W01 A;  1Q82 T;  5GAE U;  1XR6 A;  1MG7 A;  3FEX B;  5M2P A;  1DRZ A;  1F9E B;  1NHU A;  2ZC4 A;  3VWS A;  4O3N A;  1S1V A;  4WK3 A;  3GLJ A;  1QE1 A;  3MD3 A;  4N47 A;  3ZNJ 1;  5AJ3 J;  2XGQ A;  2IDE A;  2DNO A;  4WE1 A;  3WZ0 A;  2W9C B;  3G6V A;  3OTO F;  4DV5 F;  2GC8 A;  1KQG B;  3KLI A;  1TL7 B;  5DGA A;  1J27 A;  1FXR A;  3SFG A;  3OHB A;  4NI2 A;  4X4U A;  1WWH A;  1BQN B;  4I7F B;  3M7V A;  2OO4 A;  2VDH A;  4YB1 P;  1RYR A;  4X64 J;  1JQG A;  2CPI A;  2FVP A;  4BLG A;  2HS4 A;  5B08 A;  4DR5 F;  4F36 A;  4I69 A;  3O1L A;  1VGY A;  2X1A A;  2DGU A;  2FHO B;  2YX4 A;  1FKO A;  5ETR A;  2FUG 9;  1G3O A;  2HS0 A;  1FA0 A;  2K1R B;  4QIF A;  1FRM A;  1K1Q A;  4F26 A;  1SKS A;  2UVR A;  2W9C A;  3EZO A;  1RWW B;  2ASL A;  3QGI A;  5IQQ A;  3W61 A;  3A4T A;  4HTI A;  4AFF A;  5G0R B;  2JH3 A;  1QLN A;  3BO4 A;  1B7Y B;  3OLB A;  5LJ5 Y;  3SXL A;  3G96 A;  1RTI A;  3V81 A;  2XUL A;  5HQM A;  4DR7 F;  5B0G A;  4R8U A;  2Y1I A;  1J5E J;  2Y1J A;  1SQE A;  5GVQ A;  5J2M A;  3KLG B;  4RW6 A;  2XO6 A;  5D15 A;  1U1N A;  1Z2Z A;  3AD8 C;  2CVI A;  4PUO A;  4IG0 B;  2E9Z A;  5K8P A;  3R2D J;  4H4K C;  4CO3 A;  3AJD A;  2YWK A;  3CJR A;  3ZZ0 A;  4RNH A;  4M94 A;  2C2D A;  1U4B A;  1YJV A;  5H9F J;  3DRS B;  2DPI A;  4EZ9 A;  4OHY A;  3DGV A;  3G4S S;  2ZZT A;  1UL3 A;  3QLH A;  3EZ5 A;  2V2V A;  3C6T B;  2J9D A;  1XMO F;  2MSS A;  1EJ7 L;  2EWH A;  2ZWO A;  3OV7 A;  2HHT A;  2W2M P;  1S1U B;  1FO1 A;  3DLK B;  4J37 A;  4DOZ A;  2X1F A;  5D4N A;  5H9F K;  3H5S A;  2UUC F;  1Q0N A;  1D8Y A;  2XCP A;  1HQU B;  2I38 A;  5HK4 A;  2KG0 A;  1VQP S;  1MRO A;  5F0W A;  5ADZ A;  5C7P A;  3M6U A;  3TO8 A;  2MKS A;  2QT7 A;  1B70 B;  1F9H A;  1X4H A;  3HFZ B;  4HT5 A;  4RWW A;  1XNR F;  2DD8 S;  2ZH1 A;  4K4Z A;  2B9X A;  4ES1 A;  3CWJ A;  3KJV A;  1U1M A;  2ROP A;  5A6W A;  1DLO A;  1MU2 B;  2PMZ D;  1J5O A;  1IBL F;  4OX9 F;  1C1B B;  3LWL A;  1D8Z A;  3MMJ A;  5T41 A;  4OHX A;  2QEX S;  4UZB A;  3K8V A;  1EAR A;  2O01 C;  5J2N A;  3IAS 9;  2VG5 B;  3K8W A;  2AD9 A;  2BKN A;  2ZKU A;  3DHW C;  3PNI A;  3KHG A;  3FVY A;  1HQU A;  1KTQ A;  4J9L A;  4I68 A;  3QT7 A;  2U1A A;  2G13 A;  1C4A A;  3W65 A;  4C4W A;  3R7B B;  3BSA A;  1TL4 A;  3B8H A;  5DJB A;  1EB0 A;  1Q7Y T;  1VRT A;  4B9N A;  1S1X A;  3ITH B;  3M6X A;  3H40 A;  4B3S J;  2YH1 A;  3RB3 A;  2CYY A;  3PG9 A;  2BAN A;  3D1Q A;  2E5L F;  1RHR B;  1X4E A;  3C16 B;  5AT1 B;  3VGS A;  1A7G E;  3IAM 9;  1C1C A;  4HHJ A;  3AQO A;  4MK9 A;  4RW6 B;  2KHC A;  1M5H A;  1NPP A;  3C6T A;  4PQA A;  1K1S A;  3POT A;  5HRO B;  2I5J A;  1N5T A;  1KQK A;  2W8K A;  4DCJ B;  2HHW A;  2CQC A;  5E3Q A;  4ER8 A;  3PKM A;  2EXU A;  2JFD A;  3KK3 B;  4YDD B;  1VJW A;  2IIH A;  3IG1 A;  5HVF A;  2DGS A;  2EC2 A;  3KWM A;  4C3L A;  3HSZ A;  3SCK E;  5LSO A;  2J9D E;  4DUT A;  2ZEJ A;  4IR1 A;  4B3R J;  4FPI A;  4DR5 J;  2PDA A;  4ED2 A;  2CJY B;  4C0H A;  2WVB A;  1HBN B;  2O5D A;  3O5T B;  1LQ9 A;  1OY8 A;  1JIH A;  4URG A;  4L73 A;  5AXN A;  2UV8 G;  3BBC A;  3J80 Y;  2E44 A;  3I87 A;  3N79 A;  5T7L B;  3THV A;  5IC6 B;  2F8M A;  4L3K A;  3HHL B;  2IY5 B;  4UOG A;  1RTH B;  1KC8 T;  1S12 A;  4ECV A;  1MML A;  1YBA A;  2A2D A;  3OW2 R;  3HHK A;  4KFB B;  2BRL A;  4LT6 A;  4L76 A;  2WCX A;  4YN3 B;  4QW8 A;  1HKA A;  5KFN A;  1HFE L;  2XHW A;  2K1R A;  5KFZ A;  3W8G A;  1M1K T;  1BQX A;  1M90 T;  1RJJ A;  5E3C A;  5ETT A;  4XIU A;  1PIE A;  4L75 A;  1SV5 A;  3BB5 A;  4YR2 A;  1BHN A;  5G4D A;  4DR2 F;  4ERD A;  3PR5 B;  4USJ C;  4Q8F A;  2I1R A;  2RAQ A;  1RAH B;  2ADB A;  1VI7 A;  3PW2 A;  1NKC A;  4CLP A;  4DV4 J;  2ABY A;  4Q7A A;  3VV2 B;  1U47 A;  3NS7 B;  1VLO A;  2E1C A;  4K0K J;  2ROE A;  1T03 A;  1L3T A;  3BGR B;  5KG2 A;  3CDU A;  2CQH A;  1VRT B;  2L9W A;  3KHR A;  3CF5 Q;  1JXE A;  5E7O B;  3M32 A;  3H42 A;  2CQ3 A;  1RT1 B;  1XWL A;  3DLB A;  2DPJ A;  1CSJ A;  2CVE A;  4LF5 J;  1XEZ A;  2KL8 A;  5DG8 A;  4QPX A;  1TKZ A;  2PMW A;  1F9F A;  3BSC A;  4R25 A;  1NJY A;  1KNZ A;  3KUE A;  2L08 A;  3TYT A;  3UCU P;  1Q78 A;  2HAF A;  4RUA A;  2V5H G;  4EI2 A;  4F3Q A;  4LR7 A;  4A48 A;  4RU2 A;  2BM0 A;  1NJI T;  4TY8 A;  1DY3 A;  5LM7 E;  4MH8 A;  1HBU B;  3V4I A;  1H3D A;  4QR1 A;  1WC1 A;  1RBL A;  1HHQ A;  4P2S A;  5L39 A;  3IR7 B;  2FJW A;  1YJU A;  2ZH4 A;  1K0V A;  5BJR A;  4X62 J;  2RIJ A;  4LR9 A;  4ZN3 A;  1N33 F;  1D9A A;  2J7W A;  5A0Y B;  2CAJ A;  2RU3 A;  4JV2 A;  1U8W A;  4ZA1 A;  1YRU A;  2FPH X;  3M4X A;  3D0I E;  4C3K A;  2JZ5 A;  1J5O B;  1VQ4 S;  2Y9H A;  3HHL A;  4EEY A;  5I3U A;  4FPR A;  4NA2 A;  1DAX A;  3CJQ A;  3LQV A;  3X3U A;  1NRK A;  4E98 A;  3MOJ B;  1RAD B;  1FXD A;  3L7P A;  1C2P A;  3T5J A;  1FI4 A;  1KKH A;  1W7W A;  2D1C A;  3UN2 A;  2HWI A;  2M88 A;  1S9G B;  1SC6 A;  1IKY A;  3BH6 B;  3ZTO A;  2MKK A;  4PQU A;  1C1B A;  1U1R A;  3D4J A;  1T9Y A;  3C6U A;  2QZ8 A;  1NJW A;  1S9E B;  4UQG A;  3FCV A;  4B17 A;  1Q5V A;  3K2Y A;  4A8O A;  4X84 A;  2OFH X;  3E3X A;  5KFK A;  1IBK J;  1FCA A;  4A8Q A;  3EVW A;  1MLA A;  2FYX A;  4ZVS B;  4DUZ F;  2QRR A;  3M6W A;  1HNZ F;  2AYB A;  4QIV A;  4Y0F A;  1HQE B;  4RKU C;  4A8S A;  4IFY B;  2YNG B;  3J7Z T;  3DRR A;  4R0E A;  4M5M A;  2J0X A;  5ETP A;  3KUH A;  4ZP9 A;  3PW5 A;  1CC7 A;  1HW8 A;  4DL6 A;  2E7V A;  4JI2 J;  4AE5 A;  3Q23 A;  1HNX J;  1UVN A;  5J2P B;  1YWX A;  2VG7 A;  4NCG A;  2BRK A;  3GU0 A;  2KXN B;  3H4D A;  2FZG B;  1U7L A;  2DNH A;  1X4F A;  2F4F A;  1YJW S;  2FGC A;  1HR0 J;  2YX7 A;  2RKI A;  3SQO P;  1P27 B;  1AZS B;  2KB2 A;  1RT1 A;  3DKD A;  3MEG B;  5HJX A;  2VQF F;  1SL1 A;  4B9U A;  4DX6 A;  4XO0 A;  4NOH A;  2L3M A;  5GAD U;  2CG4 A;  2HIY A;  2C2Z B;  2KXF A;  4O3R A;  1S6U A;  4MYT A;  3U1L A;  1XTZ A;  4IG0 A;  1VCT A;  3HX9 A;  3O2I A;  1WOP A;  3W66 A;  2HG4 A;  4KGV B;  3GB0 A;  4NAS A;  3MM8 A;  4Y2M A;  1HNI A;  2VPY B;  2F1F A;  5FDL A;  5HBM B;  5AJ3 F;  5KG1 A;  4R8U B;  5HP1 A;  1RWV B;  3NEK A;  2DY1 A;  2G9O A;  2MKJ A;  4M5K A;  4ZJL A;  3MMB B;  3LWM A;  3F56 A;  2D3O R;  1FRH A;  1LW2 B;  2JHE A;  3D68 A;  3FJ2 A;  1N0U A;  1REG X;  3N6M A;  3R6G B;  4RJV A;  5J2Q A;  2BR0 A;  3CVK A;  3MMA A;  4Z37 A;  3DOL B;  2DGV A;  2MQN A;  2EPI A;  3MM6 B;  3EVM A;  3TUI C;  2HS3 A;  4H4K A;  2R2S A;  2UXC F;  3OUY B;  3T1H J;  1OSC A;  2BE7 D;  2HFS A;  4F4K A;  3M8Y A;  3WX4 A;  3FCH A;  2ZVS A;  5DG9 A;  2ERR A;  2XM3 A;  4USV A;  2BJ3 A;  3OTD A;  3GYG A;  3LP2 A;  1BWV A;  2BE9 B;  1ZYQ A;  3I5B A;  1FK9 A;  4DLE A;  4KKO B;  5E41 A;  4GRS A;  2JVO A;  3MPU B;  4AT1 B;  2CDQ A;  3GV8 B;  2HBR B;  2MZR A;  2NCK L;  3CD0 A;  1WKK A;  5CHC B;  2ZWP A;  1YRX A;  4L72 B;  1RU1 A;  1Y4Z B;  2P2C B;  1JWW A;  2E1P A;  2PN6 A;  2EBG A;  1PJ6 A;  2CFX A;  2PEB A;  3CT9 A;  4C8N A;  5C25 B;  3SIP B;  4FVM A;  3TNV A;  5CCL A;  3EMT A;  4KBI A;  2DO0 A;  3KYL A;  4J9M A;  4CLY A;  3MCS A;  2KJV A;  4RBU A;  4DV4 F;  3BGR A;  3AFG A;  3LGM A;  2CJX B;  4U8V A;  2DEJ A;  3WQP A;  2XQC A;  2DNP A;  4PEO A;  3IC1 A;  4NMX A;  1Q8I A;  2MGZ B;  4X2B A;  2VJV A;  1A9N B;  3IBW A;  5E3R A;  1X8D A;  5MAO A;  2IJF A;  2KO1 A;  5GMK a;  4P75 A;  4GC6 A;  5KOW A;  2DR7 A;  4LF5 F;  5DM6 Q;  4GVL A;  2XSF A;  3T41 A;  3H25 A;  1HHT P;  4U9R A;  2WTF A;  4JV0 A;  2JLG A;  1CBK A;  4PRF A;  1GX5 A;  2U2F A;  1W2I A;  4R5P A;  4EUV A;  3JS9 A;  4CYU A;  2KT5 A;  2RS8 A;  4NWB A;  3IM9 A;  1X60 A;  1RAJ A;  1PG5 B;  3M2V B;  1E6Y A;  5EX3 A;  5I42 B;  3JSM B;  1D0E A;  1WUU A;  2I2Y A;  2GQC A;  3NNH A;  1UVK A;  3U27 A;  5AE1 A;  2PE8 A;  1XQI A;  1MMN A;  2DNG A;  4J9U E;  5HRO A;  1FKP A;  2COL A;  4HHH A;  2EFQ A;  4DMZ A;  1BUX A;  5L46 A;  2DEI A;  3HF5 A;  1KD1 T;  3H5U A;  2GQQ A;  3M8P B;  4U6P A;  4DV1 J;  2YKQ A;  4F67 A;  2F8H A;  1YG0 A;  5JJB A;  1JNR B;  3C14 B;  4RW9 B;  1OYD A;  2HND A;  1U1L A;  2OTJ S;  1T05 B;  5KFH A;  4B3M F;  2ZE2 B;  4HI2 A;  2FJX A;  2ZM6 J;  5A6P A;  4OIX A;  1H74 A;  3I55 S;  2IVY A;  2XMA A;  3BR9 A;  3MZI A;  2NXJ A;  2W7O A;  3ENV A;  4LF9 J;  2KVQ E;  1SKW A;  5KG3 A;  3TZY A;  4IRC A;  3KK3 A;  2JC0 A;  2NXU A;  3IG1 B;  1S1V B;  3HM9 A;  1PGZ A;  2DB1 A;  2JOQ A;  4ID8 A;  3KNA A;  1KLN A;  2PI4 A;  2JJ4 D;  3JTN A;  2N4D A;  3ZTS A;  4XK8 C;  4FF4 A;  2MZT A;  1MNE A;  2P9G A;  5DQG A;  1S7I A;  2W24 A;  5FD1 A;  2DHA A;  1FDB A;  2V68 A;  3OBI A;  2OD6 A;  1A6L A;  4NLP A;  2GVZ A;  1SVD A;  3OXL A;  1KON A;  3P49 B;  4NI2 B;  3QMQ A;  1UTA A;  2XI3 A;  2L48 A;  4F50 A;  2LU2 A;  1MN7 A;  2Z57 B;  1NLK L;  1WSV A;  3AHP A;  2PII A;  3CCW A;  2G2Z A;  5DDR C;  3PKY A;  3Q2T C;  4ZMM A;  3IGV A;  3CCU S;  2HVD A;  1IM4 A;  1C1C B;  3L7U A;  1RCX B;  1REV A;  2JFK A;  3P5B P;  1RWP B;  3R5C A;  4GVB B;  1RYS A;  1HWI A;  1HNX F;  2FJA B;  1SKU B;  5HAN A;  3AOA A;  3FGV A;  4U7U K;  4DCO B;  5KFO A;  2BJ8 A;  2I5J B;  5B0F A;  3GCW P;  1LWE B;  4Y2I A;  2LFV A;  4UT4 A;  2XY5 A;  1JJ2 R;  3CCR S;  2RHQ B;  4CRJ A;  4DJB A;  4RLE A;  3CC4 S;  3V2U C;  1X9W A;  2YNI A;  2MTL A;  4O4R A;  4OJG A;  3G86 A;  4X4O A;  4WFN Q;  3JYT B;  1BLU A;  2HAI A;  2NYH A;  3G8T A;  3BQ0 A;  1OY9 A;  2HMI A;  4LSL A;  4CM0 A;  5LMU F;  2DHX A;  2XS7 A;  2KTQ A;  1JXL A;  3V6K A;  2NXE A;  4QW9 A;  1N5S A;  5JMN A;  1BQM A;  2IA0 A;  2JRS A;  2FVS A;  3VAM A;  4WP3 A;  4FYD A;  2B7C B;  2YWG A;  1VBY A;  5BR8 F;  2E1R A;  1SJ1 A;  2WOM A;  2OHD A;  2XNQ A;  1DTT B;  1LWE A;  3DC2 A;  5KFX A;  3BO3 A;  3K0J A;  3JSB A;  4UF4 A;  1S97 A;  3ONQ A;  3JTP A;  2HVI A;  2JEJ A;  4HH0 A;  4J91 A;  4YHH J;  3PRV A;  3Q8U A;  3W9J A;  1IKX B;  2GIR A;  2QA4 G;  2DH7 A;  2AV5 A;  1JLF A;  4WKR A;  1YGY A;  3B4D A;  1BQN A;  4I7F A;  5LL6 d;  4G6V B;  3PIO Q;  3D2W A;  4J9P A;  1VHI A;  2RDI A;  3RW7 A;  2OPP A;  2VUG A;  5J1N A;  2HGL A;  2R8I A;  4OHZ A;  3ZXW A;  3Q22 A;  4YB5 A;  1CJK B;  2HBY B;  4QIG A;  4DQR A;  3CC7 S;  1CC8 A;  1YDL A;  2MQP A;  2PFF B;  3GG1 A;  2IJN A;  3D5M A;  3QAE A;  4WFZ A;  2YKM A;  3SDE A;  1TKT A;  3O3L A;  4DPX A;  5DDO C;  4J9Q A;  3TQ1 A;  4PAA A;  1FXL A;  4U96 A;  1E6V A;  1P1T A;  4CI0 B;  3CCS S;  3E01 B;  3CCT A;  4IG3 A;  3A8I A;  5GAD I;  2FJE B;  3BO2 A;  1HR0 F;  2H51 B;  1Y11 A;  4M63 A;  3K17 A;  5LMN F;  4LUB A;  4P6Q A;  3CNQ P;  2CDR B;  2A1B A;  1U0S A;  2B9W A;  2VF3 A;  3D6T B;  2AJ0 A;  3H59 A;  5L1L A;  3AOC A;  4IH5 A;  1NB2 A;  2DR5 A;  4X66 J;  1FKP B;  2CNO B;  1VDH A;  4O4G B;  4RZR A;  3PO5 A;  4AL5 A;  4UUW A;  2DNK A;  3HVW A;  3N01 A;  4IFY A;  3WIU A;  4JI7 J;  2VFS A;  4RU9 A;  3IMQ J;  4K7Q A;  3KLG A;  2PSZ A;  3SYZ A;  5ETO A;  3M2V A;  3PZP A;  2DNL A;  5I42 A;  2QX0 A;  2UU9 J;  2CNN B;  4NEZ A;  1FRX A;  4ATN A;  1VQS A;  3EE3 A;  2CQG A;  1RA6 A;  2VZ9 A;  4OL8 A;  1XER A;  2IDL A;  3CDE A;  1EET B;  2IC3 A;  2CAD A;  3W9H A;  3C14 A;  3J7Y U;  1GH8 A;  1W25 A;  5HQL A;  1H7X A;  2QFI A;  2Z2Z A;  1UFK A;  4UZC A;  3PYD A;  1YQH A;  1Q8B A;  2BQ3 A;  1WC5 A;  4PXB A;  1UWB B;  5IWA J;  1J2V A;  4DS4 A;  4R0J A;  2R7U A;  1HIY A;  2B9Y A;  2EG2 A;  2V4J A;  5GAG I;  1U0H B;  1DUR A;  4NX9 A;  3T1Y J;  5E2Q A;  2CPH A;  4ECW A;  3TI0 A;  4OI0 A;  4DS5 A;  2KN4 A;  2CNL B;  5F3T A;  5BYQ A;  2W8L A;  1S77 D;  4NE9 C;  2EBE A;  5FDL B;  4X62 F;  3GV7 B;  3WBZ A;  1HAR A;  3Q8P B;  4Y00 A;  3N9U C;  3D6M B;  3W3S A;  1UVJ A;  2VFR A;  3HKW A;  3H90 A;  4QU7 A;  3NNA A;  3CJS A;  1SXL A;  1RT7 B;  2ZHA A;  1H72 C;  1XNR J;  3I0R A;  3E51 A;  1TK8 A;  1PYO B;  3MR2 A;  2CXE A;  2B3T B;  2UU9 F;  1HBM B;  1N56 A;  4KQZ A;  3UD3 P;  3QT8 A;  4DL5 A;  4DX7 A;  1SC3 B;  2ZC3 A;  1VBZ A;  4LSN B;  2V4J B;  1RHM B;  1R89 A;  4C8O A;  1TL5 A;  3DMJ B;  1U2F A;  2QG9 B;  4NPO A;  1N5Y A;  2LMI A;  3VZI A;  2JWN A;  1OSD A;  3TUP A;  4ZCK A;  3DRY A;  4J7C A;  3KG0 A;  2GX8 A;  1SV5 B;  3TQE A;  3B6B A;  1NJZ A;  1DZ5 A;  3QIP A;  4JV5 J;  1FVS A;  3JXO A;  2FVQ A;  1N54 B;  3DGP A;  4Y3C A;  2HWT A;  2FJB B;  1SC1 B;  1S1X B;  3ITH A;  1SC4 B;  4YS2 A;  1VQN S;  3HSD A;  1HNI B;  2RH3 A;  2OPS A;  4NLW A;  4F0K A;  1AW0 A;  2J0S D;  3I5C A;  4JI2 F;  2HIQ A;  5LMU J;  1YJR A;  1YKW A;  4JI1 F;  1KBR A;  1Y3J A;  2HBZ B;  4J9V A;  2QA4 S;  3H20 A;  3CMA S;  5F8N A;  2HLU A;  5FLX Y;  4A8K A;  2LVW A;  4HR2 A;  5KFV A;  4EK2 A;  3Q89 A;  3HO1 A;  5K8M A;  1J5E F;  4NCA A;  1VQY A;  4LRE A;  4QZV B;  3EUN A;  3ZZP A;  4GKK F;  4DR7 J;  1FRL A;  2F3J A;  3C46 A;  3QRR A;  3Q8Q B;  2D3O 1;  2AYM A;  2NPI A;  1VK8 A;  2ZBC A;  5LT5 A;  5KFE A;  3K5M A;  9RUB A;  3T5K A;  2HVH A;  2DY9 A;  2DIT A;  2O3D A;  3JSR A;  4JP8 A;  1SIZ A;  1VS3 A;  2DGX A;  4ZVT B;  2VG6 A;  2YNI B;  4FP9 A;  2RJZ A;  4RPF A;  3KJF B;  5CAA A;  4NRT A;  1NU4 A;  3Q8S B;  1N36 J;  1CUL A;  2B8Q A;  4YEA A;  1V6H A;  3LGH A;  3LH2 S;  4I64 A;  4D3H A;  4TU8 A;  4KTQ A;  2AJ1 A;  1YSJ A;  1KEK A;  1IJE B;  3BPD A;  3BN7 A;  2C42 A;  3LF0 A;  4XPE A;  3VCD A;  1WG4 A;  4WTO B;  3D1O A;  1LOU A;  1N34 F;  5I3P A;  1B0V A;  2FC9 A;  3GPA A;  4W4M A;  4NYP A;  4W90 B;  4CO4 A;  4P73 A;  1U6Z A;  2ZJQ Q;  3HZE A;  4JYA J;  1NK4 A;  3G6Y A;  2KJW A;  3D6F B;  2MKC A;  2UV8 A;  4ZJQ A;  3K5N A;  4DQI A;  2RDJ A;  5KG7 A;  4KHP F;  2L9N A;  1Q86 T;  3T5L A;  1RWO B;  1KOH A;  4RUC A;  3F44 A;  3QQC D;  3HHL D;  3BGU A;  3M32 B;  3DLE B;  4H4O B;  1MRO B;  3S01 A;  1FNM A;  2MY8 A;  3MR7 A;  4GVB A;  1NHV A;  2VBZ A;  2ILZ A;  4I4B A;  1NHK L;  4WFA Q;  4IO9 Q;  4CLW A;  2VBX A;  1HL6 A;  1N32 J;  1FER A;  5ETM A;  3TVZ A;  4Y65 A;  1VK3 A;  1RTZ A;  3M1V B;  1WF0 A;  3KJV B;  1QTM A;  2P6T A;  5T7L A;  2QL5 B;  2V2K A;  3QJP A;  5DZ7 A;  4XPC A;  1LWX A;  4UOF A;  6AT1 B;  3RR7 A;  1PAU B;  3TA0 A;  2H48 B;  1QUP A;  3H2V E;  3T1Y F;  4LRF A;  3M9M B;  1QAJ A;  1CS4 A;  3KDO A;  4WZQ A;  5CD4 H;  2DHG A;  2IRY A;  3CJK A;  4B9L A;  1ARO P;  3AJ1 A;  4DR6 F;  2QL9 B;  2YWH A;  1C4C A;  2AYG A;  3GFH A;  3A1Y G;  1D1U A;  3S6E A;  4EBE A;  2A18 A;  4WZM A;  2OJ3 A;  4KO0 A;  4FXD A;  3EGZ A;  2Q6C A;  4OZ2 A;  4WKY A;  1IR1 A;  1Y7P A;  2AGQ A;  5EWF A;  5IT4 A;  3LTO A;  2R4F A;  4Q44 A;  4F02 A;  2H4W B;  1T94 A;  2MPU A;  1TZ0 A;  1S4F A;  1WC3 A;  2GZO A;  1R43 A;  2YWE A;  3BPS P;  1RT6 B;  4NML A;  4OX7 A;  5E33 A;  1TL1 A;  2ZD1 B;  3QAU A;  4TN2 A;  1LWC A;  2FHJ D;  3QGP A;  4ZOS A;  4DHV A;  3DDI A;  5KOX A;  5LXY A;  3GIJ A;  2WB4 A;  2MGZ A;  1YZ6 A;  4IKA A;  3MAQ A;  5L9X A;  3PX6 A;  4LRA A;  3PFE A;  3MPV A;  3PIP Q;  4ED5 A;  4JI0 J;  4ZVO B;  3CCV S;  3VZH A;  3J7A N;  2MHE A;  4ZLN A;  2AEJ A;  3OSN A;  1UA1 A;  1F3F A;  1DQA A;  2LQ9 A;  3E8O A;  3BBF A;  3T1A A;  2ZNY A;  5B0B A;  2QA2 A;  1YTY A;  4Y6I A;  4DFM A;  2ZOF A;  2BOP A;  2HHH J;  2EEY A;  4O0N A;  2M7S A;  1FWP A;  5B7W A;  1X0P A;  4KO0 B;  1OMS A;  2AT1 B;  3QT6 A;  4UY8 5;  1KOO A;  1ZA2 B;  3H0P A;  3GSI A;  4JBC A;  3PEH A;  4OI3 A;  3TUZ C;  5L1J A;  1TMM A;  1GMU A;  3RU0 A;  4JV5 F;  1CLF A;  4BC9 A;  3KK1 B;  5C25 A;  2DGT A;  4YME A;  7AT1 B;  4KSE B;  2F7V A;  1SJR A;  4WE1 B;  5KG6 A;  3UNY A;  1TUV A;  3RJM B;  1RT7 A;  2DIS A;  2FVC A;  4PG5 A;  3K58 A;  1B7F A;  2VB6 A;  2GQ2 A;  1XC9 A;  2CPD A;  2FIU A;  4ZP8 A;  2OSQ A;  2J6S A;  1KVI A;  2BKP A;  1D9D A;  1I1G A;  3D7S B;  3PFO A;  4K50 A;  3DM2 A;  4JI0 F;  3N4W A;  2GHP A;  3KLF B;  2HFN A;  2GJF A;  3DOM A;  4MT1 A;  3JB9 k;  2K3I A;  3OD2 A;  3HHE A;  3NL0 A;  1RB0 A;  4QYZ J;  1WDT A;  1X31 C;  1IBL J;  2WW4 A;  3QFW A;  4LRC A;  3SBM A;  3DOL A;  4CO1 A;  4G1I A;  2N3L A;  1M5V C;  2CZV C;  2FHM A;  4URS A;  1JX4 A;  4CP5 A;  2QIF A;  1I51 B;  2QA1 A;  3G9C A;  5DLF A;  3OR2 A;  4FKX A;  5EDW A;  2HFO A;  2YBV A;  3MGJ A;  2Y1R I;  3PX4 A;  5C24 B;  2RRB A;  3TR5 A;  4JI8 F;  4DV7 F;  3CCJ S;  2UXB F;  2RF2 B;  3MED B;  1KS2 A;  2I8E A;  1FX4 A;  4DL4 A;  4P2F A;  1T3O A;  4OJ3 A;  4DXL A;  1K47 A;  3EX7 B;  2DTJ A;  3GYX B;  1VQK S;  2AZ3 A;  2IJR A;  2NZC A;  2PC6 A;  2C3O A;  3PJX A;  1ZH5 A;  1N8R T;  4CQ1 A;  1DQ9 A;  3LA0 A;  4WU3 A;  5KFU A;  1GMW A;  4ES2 A;  1AB8 A;  1YJ7 A;  2WSC C;  4ZVE A;  2NQP A;  3R1H A;  1UW9 A;  2QE5 A;  4JYA F;  2R7X A;  3I6P A;  2IRX A;  2ACM A;  4KIA A;  2CJK A;  3KNG A;  4RUB A;  4LQ9 A;  5KG5 A;  1CVJ A;  2HWH A;  5D4O A;  4Z7C A;  4F2R A;  2LEP A;  3L7O A;  3CPW R;  4JI7 F;  1MSW D;  3C6U B;  4KH1 B;  2IA6 A;  3GWC A;  4EYI B;  1S1U A;  2JL9 A;  4YQW A;  3BF4 A;  4UTG A;  4EMD A;  1KN6 A;  2HHP A;  2GIQ A;  3DOK A;  5KFI A;  4DSK A;  4NXM J;  1K0T A;  4O44 B;  2NLW A;  2Z8Q A;  3DFE A;  1S79 A;  2ZIT A;  3MM9 A;  3SQG B;  2I9S A;  2PO4 A;  4DUY J;  1JLA A;  4LSN A;  3LO3 A;  3UDC A;  1VQM S;  1UJ4 A;  4J9S A;  3TEG A;  3G8Q A;  4XDC A;  2W9A A;  2Y1L B;  3A8J A;  3PM9 A;  2ZBR A;  3R5A A;  4IFV A;  3RRH A;  1E6Y B;  2XZT B;  2E1A A;  2SXL A;  2VBY A;  1FE4 A;  3MUV P;  2D7S A;  2FJD B;  1ZET A;  4ZS6 A;  1SI9 A;  3I9Z A;  5IOL A;  4LBI A;  1JLE B;  2VHG A;  2NR0 A;  1NEE A;  4PPZ A;  3NNC A;  3W2W A;  2NS1 B;  2MZS A;  2YVS A;  4LBP A;  1NK5 A;  1RTD A;  3IO1 A;  1BD6 A;  3OFH A;  3EPI A;  2HHX A;  5DET A;  2C3U A;  2CZ4 A;  3F41 A;  1Q53 A;  2ASY A;  4G65 A;  5ETN A;  1H2U X;  2EKY A;  5SZT A;  1FHT A;  5A8W B;  1N0V C;  3LAK A;  3MMC A;  2X3G A;  4PKD B;  2MZJ A;  4CDI A;  4N56 A;  1QSL A;  1H0H B;  4OZN A;  3VAL A;  4JV1 A;  3KK2 A;  3RZA A;  1O51 A;  2HVZ A;  2ALZ A;  3KLE A;  2ZOG A;  3BEG B;  4P72 A;  2HHQ A;  1MN9 A;  4DV6 F;  1ZTT A;  2UP1 A;  1HWJ A;  3QSI A;  1FEH A;  1ZM3 A;  4ZVU B;  1WOR A;  1S9F A;  2F4V F;  5D4L A;  1M5S A;  4ZK7 M;  1NCL A;  2A6O A;  2ZBP A;  2VOP A;  1R0A A;  1Y9O A;  2QO3 A;  4HI1 A;  2GVZ B;  2LP4 A;  3NP5 A;  3OL8 A;  1UKU A;  2RQ4 A;  4O3P A;  3IS9 B;  4BWM A;  1S6Q B;  3MFI A;  1UFW A;  1U2R A;  4ED0 A;  2H5J B;  3CD7 A;  3GIR A;  5EHH A;  2IM3 A;  1X4A A;  1U26 A;  1WJ9 A;  2XHC A;  3DDN A;  4P52 A;  2PA8 D;  3B54 A;  5E5N A;  4MIB A;  5EUH A;  3W2W B;  3NGR A;  1Y10 A;  5HO4 A;  4YP3 A;  4NLV A;  4CM2 A;  3QZ7 A;  1S7H A;  3ENA A;  4QWD A;  1RBO B;  5DS7 A;  1HD1 A;  1G4C A;  3FBC A;  1HYS A;  5EN1 A;  3HHD A;  2GVD B;  5EWG A;  3FZB A;  2B5J B;  1XK8 A;  1TMJ A;  1F2H A;  1UZH A;  1S59 A;  1EET A;  2LQJ A;  4QQB A;  4DR1 J;  2ASD A;  2XS2 A;  2RUS A;  1JLG B;  3MUM P;  4PG6 A;  1QAY A;  1KHW A;  3AA8 A;  5K9F A;  1QY7 A;  3HK2 A;  5F8J A;  4BS2 A;  1YRT A;  1HHS A;  3T1H F;  1NZ8 A;  3V5R A;  4MFB B;  3IBF B;  3KLF A;  2BJ9 A;  3U7J A;  1EP4 B;  2NYI A;  2XMT A;  4EBD A;  1T0T V;  1VBK A;  1R0A B;  3ZZR A;  1PJ7 A;  4KV8 A;  2DNZ A;  1VIX A;  2DGQ A;  4NLO A;  3MPW A;  1ZPW X;  3BYR A;  3V6D A;  2HRU A;  3D3C J;  3ILO A;  4P2M A;  4ZIT A;  2ZJR Q;  1NK9 A;  1BC6 A;  2LEC A;  1T9T A;  4DV7 J;  3ADA C;  4JI8 J;  5HSP A;  4ZLL A;  4HAC A;  1VFJ A;  2LXI A;  4MK8 A;  2A2C A;  3R3T A;  2BYC A;  1QUV A;  1QDU B;  3PXG a;  3CJK B;  2X7I A;  1H2T Z;  1HNV B;  3M1V A;  3VGT A;  4JI6 F;  1U48 A;  1X9M A;  3CCL S;  2HQI A;  2DIU A;  3IR6 B;  2V8G A;  3JTO A;  5HL7 Q;  2G4B A;  3PYF A;  2HW3 A;  1QJH A;  2E5J A;  2ZZM A;  4FYW B;  3PAC A;  3CJ2 A;  4FNI A;  3GJR B;  4ZPT R;  2DNR A;  4DU7 A;  5IFM A;  3OL7 A;  1HBN A;  2CRL A;  3CMQ A;  3GFY A;  1X5O A;  3D28 A;  3GTY X;  5D6G A;  3T9N A;  1H73 A;  4DR1 F;  2HQF A;  5IV3 A;  1AUD A;  2XLK A;  1JLF B;  3HCX A;  3NKY A;  1N88 A;  3NS5 A;  4M5L A;  2HGN A;  2GIF A;  5GMD A;  1SCJ B;  4QWA A;  2E5L J;  3HHN B;  1UET A;  2JEI A;  3ILL A;  2HK3 A;  3ILI A;  4M1K A;  4CCH A;  3L4B C;  4OX9 J;  2R8G A;  1FE0 A;  3EVO A;  1M5O C;  1M5K C;  5IT9 Y;  1Q7L B;  1JXV A;  5KT2 A;  1F1B B;  1JLC B;  2VA2 A;  1LWC B;  2R42 A;  3X1L B;  1G7C B;  4NXN F;  1S6Q A;  3KMQ A;  4L74 A;  1R7I A;  2YQ1 A;  3OTC A;  3VF0 B;  5L38 A;  1OJ4 A;  1X5S A;  4DX8 H;  1HMV A;  3MAA B;  3W60 A;  4QCL A;  3ISZ A;  4F4Z A;  1VRU B;  2YWF A;  3BGF A;  2QSF A;  4LF6 J;  4X4T A;  1QM9 A;  4DG1 B;  3GJQ B;  1GNK A;  1A0O B;  2OPR A;  3PW7 A;  2NSC A;  1OYE A;  4DR4 F;  4ZPA A;  1NKE A;  1IQT A;  1U1K A;  2CQ0 A;  4A8Y A;  3DI6 A;  2DCL A;  4OZJ A;  4PWU A;  3BKU A;  5HMW A;  5KFB A;  2W4D A;  4DSJ A;  3N5B A;  2ASJ A;  3FFI A;  5KG4 A;  4FF2 A;  2MQO A;  3SZ2 A;  2XMW A;  2APO A;  3AA9 A;  4UOC A;  5HBM A;  3KLH B;  5EWE A;  3NAH A;  4DX5 A;  2OD4 A;  2F9J A;  4JI3 F;  2Z58 B;  3NOC A;  3F0N A;  3IWX A;  5CYQ A;  2MST A;  1VIO A;  4TLR A;  1ACM B;  2HLT A;  4M5D B;  1RLD A;  2QFJ A;  1VQ5 S;  2FC8 A;  4ZVF A;  2QLW A;  4WCE Q;  1RZM A;  4QBU A;  1SUQ A;  3D67 A;  3LP0 B;  4ZLJ A;  5KFW A;  4ZPW R;  1VQO S;  1ZAX A;  1NPR A;  1REV B;  1B64 A;  3QWU A;  4NYZ A;  1GT8 A;  3GIL A;  4K4W A;  3MEC A;  4ZVG A;  2M9K A;  3BKT A;  1YJT A;  2VG5 A;  4IRK A;  2YNH B;  2EKN A;  2IVM A;  4RW8 A;  2DR9 A;  2V8P A;  5J2P A;  2YQ0 A;  3AOB A;  1GK8 A;  1U6B A;  1IBC B;  2Y3Y A;  2W7A A;  2AEM A;  2MJU A;  4URQ U;  4KGK A;  3HT3 A;  1RGV A;  3M8P A;  3RRG A;  2BXJ A;  4DPW A;  2C2O B;  4DSI A;  2D74 B;  4USH A;  2UUW A;  2J0W A;  2VAS A;  4OJH A;  2J9C A;  2HFV A;  4M95 A;  2HRY A;  4OHW A;  2DXD A;  2BE2 A;  2QC3 A;  2YNF A;  3JQK A;  3MEG A;  4ED3 A;  1I6J A;  1KVJ A;  3MF5 A;  2V8V A;  2XI2 A;  5KFL A;  3TJ8 A;  3VVT A;  2NXN A;  3LAL A;  2J0Q D;  1C0U A;  3HFK A;  3CED A;  2CPZ A;  1FF2 A;  2FVR A;  1TFY A;  3FSI A;  2XG8 A;  3S7R A;  3FSY A;  3W5Z A;  3IRW P;  1SJF A;  4CLZ A;  3FC9 A;  1EP4 A;  4N7T A;  3S1T A;  1JNZ B;  4DSE A;  3NGS A;  4P9S A;  4B3O B;  3MEE B;  1FT8 A;  3CO0 P;  3O6Q A;  3U1M A;  4YY3 F;  3GJS B;  1RTJ B;  5B0E A;  3AB2 B;  4CNZ A;  2ZZN A;  4K59 A;  1O6X A;  1I3O B;  3A3O B;  4Z2X A;  3BGO P;  3CJ4 A;  3RBE A;  3TZW A;  4DL2 A;  4ELT A;  2V2Z A;  2AGO A;  3THP A;  1WHV A;  3QZ8 A;  1UCN A;  1WEL A;  2VA3 A;  5D4P A;  4WPA A;  1HNW F;  4KGZ B;  4RW7 A;  1RDR A;  4DQS A;  1AT1 B;  3OXF A;  1JLB A;  2FDN A;  3NG8 A;  4IUF A;  2EK1 A;  3EZU A;  4QPT A;  4CWB A;  3NMA A;  3R5G A;  3LAN A;  3KDN A;  2MB0 B;  4U7U D;  2IMW P;  1GXT A;  1UJ6 A;  3TP2 A;  2W7P A;  4FF1 A;  2XTJ P;  3UR0 A;  1JB0 C;  2NXC A;  3I0R B;  4N8N A;  2H3E B;  3GQC A;  2AJQ A;  1T95 A;  3EPG A;  1SQF A;  1CJU B;  1R8C A;  1X7V A;  3BDE A;  4YR0 A;  2AU0 A;  4OX6 A;  3QSY B;  1SL0 A;  4PYA A;  5CYM A;  4K4T A;  4JI4 J;  2QYG A;  1YX2 A;  2OPQ A;  1XN9 A;  4N5S A;  4ECY A;  1HPZ A;  4CLT A;  1WF2 A;  3GV5 B;  4XAK A;  4DV0 F;  2EFV A;  4RBV A;  5KFY A;  3RAQ A;  3KHH A;  4I2Q B;  4DCP B;  2IHR 1;  1NND A;  2DRB A;  2C2K B;  3ZZZ A;  1IR0 A;  2DK2 A;  3UCG A;  8RUC A;  3MD1 A;  3BZQ A;  4LQ3 A;  5A8R B;  3PYG A;  4ZP6 A;  1HNW J;  1RHU B;  3R6L B;  4XDD A;  2GV1 A;  1VR6 A;  3FRY A;  5DO2 A;  2YY3 A;  2JDJ A;  3QT5 A;  3OTO J;  5JVG Q;  5HLF A;  2MQL A;  3FQL A;  3JAM Y;  2YNG A;  2VDI A;  3ZO7 A;  2B43 A;  2QSW A;  5C42 A;  1RWM B;  3MAH A;  1WEX A;  4IYQ A;  3KLE B;  1DFD A;  1P8G A;  3EJM A;  2BAC A;  1MWQ A;  1NSQ A;  2XLI A;  2P9C A;  4NLQ A;  3VQS A;  2HEK A;  3MM9 B;  3ZTP A;  4CO5 A;  1TAU A;  2YKN B;  1JLA B;  2IAJ A;  3KJN B;  5KFQ A;  1BXN A;  2IMO A;  1C0T A;  4U8Y A;  5KG0 A;  2V0N A;  3RR8 A;  4RW4 B;  2GFF A;  1KVK A;  4KAI A;  1E6V B;  2RKI B;  3OVA A;  2OTL S;  2ZHO A;  2F8E X;  5KT7 A;  1U1P A;  2RT3 A;  4RNM A;  1RWU A;  3IWN C;  3CD5 A;  4Y2C A;  3UVJ A;  1CQM A;  2NPF A;  4USI A;  4PZV A;  1F0X A;  3VGU A;  4J9K A;  2X3D A;  1N6Q B;  1IXK A;  4LF1 A;  4F4Y A;  4WWS A;  1YK9 A;  5IM0 B;  4DR3 J;  2CZ9 A;  3IBC B;  4W98 A;  4O4G A;  2B7B B;  4IQX A;  2KH9 A;  3CME S;  3NBP A;  1F60 B;  1KWM A;  1PAE X;  3BSO A;  2JC1 A;  1U1O A;  3HJF A;  4PUO B;  4ANE A;  4ZKA A;  4USW A;  2CQD A;  4DV6 J;  5ETL A;  5J1E B;  1RHQ B;  2AYE A;  4PWD B;  4A47 A;  4F4W A;  2RDD A;  1HBO A;  1FDD A;  3FSX A;  3QRQ A;  4FYV B;  3CCM S;  1SKR A;  1OQ6 A;  2IAJ B;  1Y3K A;  3DRR B;  1R8A A;  1TKZ B;  4GMK A;  2QLF B;  4HL9 A;  4P10 A;  3UI3 A;  1X5P A;  5EGY A;  3AXK A;  2EW9 A;  5A8R A;  2H65 B;  5HI7 A;  1KRP A;  3A8E A;  3MUT P;  5CYJ A;  4ELV A;  2ACY A;  3M8Q A;  4ID5 A;  1LEO A;  4M5I A;  2B6A B;  1UEU A;  1R6Y A;  3DLG B;  4Q43 A;  4M5D A;  3RBD A;  1K8A T;  5FJ4 A;  1FJG J;  4G1Q A;  1R8P A;  2QN6 B;  4TU9 A;  4DPO A;  5C2C A;  1DTQ B;  1MWY A;  5FII A;  3RAX A;  5HLF B;  1S4E A;  1Q79 A;  2MHN A;  2HZC A;  3CJT A;  2HQG A;  3MEC B;  3IN5 A;  4F0H A;  5D0G A;  4P7T A;  4FYY B;  1FEE A;  1TL7 A;  2DGW A;  2KHD A;  1RU2 A;  3FEY B;  1RT3 B;  5CH7 B;  2W9B A;  4C8L A;  1S49 A;  2C2E A;  2XCA A;  4QU6 A;  2YKN A;  3H2L A;  3NS6 A;  4ZN1 A;  3K5L A;  4B3M J;  2C2N A;  3QRP A;  1SL2 A;  2BEF A;  5ETS A;  1QVF R;  1OS5 A;  4PWW A;  3MTK A;  4LF7 J;  1S99 A;  3QO9 B;  1N48 A;  2E9T A;  2H1Y A;  3T9Z A;  4KHR A;  2K2P A;  3RYL A;  4ENO A;  3KHL A;  3V4I B;  3BR8 A;  1N33 J;  1KFS A;  4C9D A;  2GMH A;  1EAY C;  1TAQ A;  3E2E A;  4OYO A;  1RAB B;  2KT3 A;  1CG2 A;  1YLX A;  3IRX A;  1U49 A;  3P96 A;  2IRU A;  1H7W A;  2G0I A;  2JX2 A;  1ROF A;  2J7K A;  3FEZ A;  2GS8 A;  3MPY A;  2GJI A;  4NLT A;  4QIE A;  3W2V A;  4YFU A;  1N52 B;  4BHQ A;  3M8R A;  3DXS X;  4Y34 A;  2MZ1 A;  3NCP A;  4KY3 A;  2BJ7 A;  4JUZ A;  4CTA A;  2ZH6 A;  2WON B;  4ED6 A;  3IFE A;  1IBM F;  3N28 A;  4ES3 A;  1TKX B;  3I0S A;  3H98 A;  6FDR A;  3TOQ A;  3T6B A;  2H5E A;  3SV3 A;  2Z2L A;  2J6T A;  4OLP A;  1UP1 A;  3PCO B;  2YQ3 A;  3POT B;  2EG1 A;  2J8S A;  1XMQ F;  2R2T A;  4LF2 A;  5CA5 A;  5HVG A;  3RB0 A;  2B8P A;  2CNK B;  2DIV A;  2OGU A;  2RU9 A;  2KFY A;  4JI5 F;  2V2Q A;  4F2S A;  2DO4 A;  3OFE A;  2XMU A;  3OR1 A;  4YOE A;  1T02 A;  4KE5 A;  4V19 J;  4OJ1 A;  2RIL A;  5G0R A;  3SEO A;  1RK8 A;  2Y0B B;  5KTQ A;  2ALY B;  3ETO A;  4WJB A;  1UJ5 A;  5L1I A;  1MWZ A;  5E0O A;  2B5J A;  2WW8 A;  3W62 A;  2FHJ A;  1NJX A;  4IRD A;  4JI6 J;  4OFZ A;  4CYU B;  3TW0 A;  2EC0 A;  3GIK A;  1S6P B;  2QMX A;  3HP6 A;  2ZH5 A;  2XNR A;  2UXD J;  1S5Z A;  1TKX A;  2AJ2 A;  2OSR A;  3IRX B;  5HJY A;  3PEJ A;  3N6L A;  3JSM A;  3PY8 A;  2CPF A;  2BUN A;  3BJY A;  1LK7 A;  3V81 B;  2BE2 B;  4BC7 A;  1GFW B;  4PG4 A;  2F9D A;  4YB6 A;  4YUD A;  4GC7 A;  4ILR A;  3PV8 A;  4Q8E A;  2DRA A;  1WC6 A;  1Y5I B;  3P4U B;  2QYC A;  4LIW A;  5KFP A;  3HJV A;  1UZD A;  1NSA A;  1TVR A;  2C3Y A;  3T3F A;  3DXB A;  1IKV A;  4BWJ A;  4IG3 B;  4DN0 A;  4FN5 A;  2LKZ A;  3D0G E;  1ZZF A;  3HD1 A;  3TAQ A;  1UEK A;  2Z4P A;  2RQC A;  3CC2 S;  4LVO P;  2KI2 A;  3W5X A;  1S1W B;  4AL7 A;  2ZBQ A;  4LFB F;  4X4S A;  3ILJ A;  2BJD A;  1C0U B;  3JSY A;  3NGT A;  2WSE C;  5DQH A;  1GX6 A;  3Q86 A;  2O1P A;  2XSJ A;  1NSP A;  3OHA A;  1N5Q A;  4WFB Q;  1YHQ S;  2F5G A;  1NK0 A;  1JK9 B;  2V8H A;  2AKW B;  2LYV A;  3UR3 C;  3LPY A;  3WIV A;  3CUN A;  1M5P C;  1VJQ A;  1IJF B;  3KUG A;  4C6A A;  3NAI A;  5D3G A;  3KLI B;  3DDK A;  3LUY A;  2P6S A;  1S0M A;  2Y8Y A;  2ZBI A;  1GXL A;  4C3M A;  4ZCM A;  3K59 A;  3RW6 A;  1AFJ A;  1FX2 A;  2B6A A;  3UDL A;  3G6X A;  1NDK A;  5KFC A;  4MIA A;  3ZTR A;  3AT1 B;  4I2P A;  1FJG F;  5DQI A;  1OPI A;  4X64 F;  1EQ0 A;  3SFU A;  3FCW A;  2BBE A;  3MMB A;  2HFZ A;  5I3Q A;  4DWI A;  1VC5 A;  3OTB A;  2CQ4 A;  5A8W A;  4ZDN A;  1FNX H;  3M8Q B;  4ID5 B;  4OX8 A;  4C2M A;  3MM7 B;  3TX8 A;  4UY8 T;  4DSF A;  4ZP7 A;  3PRB A;  4NL5 A;  2KG1 A;  2YPY A;  4DPY A;  3EM1 A;  3GZ7 A;  2MQ8 A;  4M8L A;  2H4Y B;  4LRD A;  3PO4 A;  1U09 A;  3QIP B;  2N7C A;  2R7V A;  2CPX A;  2VOD A;  3AAW B;  5DZ6 A;  3DYA A;  4LSL B;  3BS9 A;  3VQT A;  4CO2 A;  4DZD A;  2GJ2 A;  4OYB A;  3S8S A;  1S57 A;  1IWA A;  1VHF A;  1WG1 A;  1SH2 A;  2GHV C;  3BKF A;  3IXQ A;  4HH1 A;  3QGG A;  4IFV B;  4NLS A;  3SDE B;  1YBT A;  2B56 A;  5HMZ A;  2ZH9 A;  3C15 B;  3ET6 A;  5D78 A;  1NBE B;  2KRR A;  1X4B A;  4MAK A;  2UUT A;  3AXM A;  2DBB A;  4ICL A;  2GO8 A;  1IVZ A;  3M30 A;  3TAM A;  4X4V A;  1FVQ A;  2GW8 A;  2XYG B;  4OHV A;  4AUK A;  1S48 A;  2IM0 A;  2CQP A;  5BYR A;  5B0C A;  3R8Y A;  3BRE A;  5C42 B;  1XMB A;  2RF2 A;  2EFO A;  4C8Y A;  1T9V A;  4UUX A;  2RHS B;  5DM7 Q;  3CW2 C;  3QLH B;  1VLY A;  5B09 A;  5HN0 A;  4X65 F;  2LDI A;  4UST A;  3TVK A;  2BX6 A;  3N5F A;  3MUR P;  3PDN A;  3CB4 A;  1I94 F;  4G3I A;  4G1Q B;  4A8W A;  1KSP A;  2W4C A;  1NPK A;  3K7R A;  1XMQ J;  4FDF A;  4HYK A;  3RTV A;  3ISN C;  4DR2 J;  1RI7 A;  5DDQ C;  4JB8 B;  2PMH A;  3V6D B;  1WG5 A;  2BMB A;  1AYE A;  5E3P A;  4RR5 A;  3UN3 A;  2XZD B;  3ENQ A;  2ATC B;  1PSD A;  2OPS B;  4EBC A;  1U1Q A;  2UUC J;  5HMY A;  1GQE A;  3TWZ A;  3FBB A;  3UNG C;  4DPT A;  2HPU A;  1GMV A;  4Q5V A;  5K20 B;  1DAR A;  2VQE J;  4DV3 J;  2P5V A;  4Q45 A;  3BQ1 A;  4M5J A;  1UVM A;  2MKI A;  4ZVH A;  5A8K A;  1B3T A;  2B4O A;  4IO1 A;  2G1D A;  3W9I A;  3CXC R;  3BGL A;  2ZH8 A;  2J8A A;  1HNV A;  3MFH A;  2ZDO A;  3QO9 A;  4MKV A;  4A8X A;  2RB7 A;  3L3C A;  2OH2 A;  5H9E J;  4KHM A;  2ATL A;  3WHI A;  4DPU A;  1HBU A;  4LF4 F;  5H1S V;  4RBT A;  2XWX A;  2HBQ B;  4O3O A;  2DCU B;  3CE8 A;  4LF9 F;  4C97 A;  3EGN A;  4ZPB A;  2R8J A;  2UVW A;  1QSY A;  2RQK A;  2HRT A;  3VR1 A;  4JI4 F;  4KRW A;  1QTN B;  3NGU A;  1CPZ A;  2B4P A;  4DF4 A;  3C8Y A;  1RAA B;  4MKA A;  2V50 A;  2UUB J;  4PQU B;  5IT9 U;  2BV3 A;  2BVZ A;  2RUG A;  5HP1 B;  3OSP A;  1M0S A;  1WTB A;  1RP5 A;  4OV1 A;  2GHW A;  2CPE A;  4RW7 B;  3SSR A;  4F3M A;  5CAB A;  2QLJ B;  1SH0 A;  2W2P P;  3FNN A;  2VQE F;  4DV3 F;  4B3R F;  4PYD A;  1L3S A;  3GR0 A;  3WC0 A;  6FD1 A;  3DLG A;  2V8D A;  3CIZ A;  3RBX A;  4YY3 J;  4TQR A;  3R1L A;  3TEH B;  1XNQ F;  1UMJ A;  3UD5 A;  2RE1 A;  1S10 A;  3RB6 A;  2WRM A;  3K89 A;  4N76 A;  3C66 A;  3G71 S;  5HAT A;  3FKB A;  3HVR A;  3J7Z 5;  1PCA A;  1VC0 A;  3MEE A;  4KKO A;  1RTJ A;  3GII A;  4DV5 J;  2M70 A;  4NLG A;  2A10 A;  5F8M A;  3KG4 A;  4F04 B;  2QL7 B;  4QJV A;  4UW2 A;  5KT3 A;  2KZZ A;  1FRK A;  1VOM A;  3UQS A;  1SPB P;  2RVJ A;  2MLZ A;  2MXY A;  2BJE A;  3M2U B;  4C0B A;  2IYG A;  1B0T A;  2R8K A;  3T6J A;  1NM2 A;  2YWW A;  3TUJ C;  1O0P A;  1YIJ S;  2J6U A;  2MZQ A;  3LP0 A;  4YDX A;  4EO8 A;  5BR8 J;  2WZ1 A;  2K8G A;  3M2R B;  5AXK A;  1S9E A;  1RAI B;  2ZUA A;  4NLU A;  2JVR A;  1SJ3 P;  5LSL A;  3GSD A;  1LXJ A;  3C19 A;  3HT0 A;  4ICL B;  4RW8 B;  2ZH2 A;  1PKU A;  3FBF A;  3HVT B;  3SSS A;  4AD6 A;  4FS2 A;  4DL3 A;  3H7H B;  4OI1 A;  4OLO A;  1RT6 A;  4ZJO A;  5LXR A;  1LFW A;  2IM2 A;  2H54 B;  3LPE A;  3R5J B;  4EYH B;  1RT4 A;  2J76 E;  4USU A;  5GAE I;  5RUB A;  3CCQ S;  1HWL A;  3NGD A;  4RL1 A;  3KLH A;  4X4P A;  2GAH C;  1MMD A;  1U6F A;  2MYF A;  2QLX A;  2OMO A;  1NSK L;  2YKA A;  4O44 A;  3SQG A;  3J7Y I;  1X4C A;  1FK9 B;  3AD7 C;  2A6M A;  2CPY A;  1W26 A;  3Q8R B;  4X66 F;  1S72 S;  4KPY A;  4KGX B;  1PBU A;  1UEV A;  4PXC A;  2FY8 A;  3MTJ A;  2B0G A;  2HMI B;  3GYN A;  4ILM A;  5KT5 A;  1T3N A;  1V3Z A;  2HHS A;  1Q4R A;  3PTW A;  1XMO J;  2V6A A;  3KG1 A;  2VOO A;  2RD5 C;  4HKQ A;  1BWE A;  1H6K X;  4AND A;  4D3G A;  3PRD A;  3A12 A;  2J9E A;  2OI2 A;  1SB6 A;  3B4M A;  4EU0 A;  1RHK B;  3R27 A;  5AE2 A;  2R7O A;  1G6B A;  4IOA Q;  2IYI A;  3QFH A;  3BSN A;  3U02 A;  4B9M A;  3KK1 A;  3G6E S;  2ZKT A;  3MR3 A;  2DJW A;  1RUS A;  3IM8 A;  2AWZ A;  2CWK A;  2ZDP A;  3PW4 A;  1KLM B;  2HZA A;  1PJ5 A;  1OO0 B;  2B9E A;  1T8E A;  2OUG A;  4RUH A;  1V5I B;  2JEF A;  2PD1 A;  1R3N A;  4KH0 B;  4P7V A;  4IDK B;  3Q8Y A;  1LFP A;  3I32 A;  4ANC A;  2BQR A;  2MMY A;  2LU1 A;  2UVV A;  4NCB A;  2FZC B;  2JLE A;  1TL3 B;  2XLJ A;  1HQ2 A;  2MLX A;  1TKD A;  3FDS A;  4ZCI A;  1SQG A;  3KJQ B;  1D9F A;  3TRG A;  2WVC A;  2W2O P;  2E7W A;  2XSJ B;  3TJ9 A;  1Q16 B;  4CLL A;  4LFA F;  2CIM A;  4R5P B;  5GAH U;  1FFW B;  3MCM A;  2KYZ A;  5GME A;  5IT0 A;  7FDR A;  1R31 A;  2WVD A;  2DR8 A;  5J1E A;  2ZD1 A;  2RSQ A;  3D0H E;  3LW5 C;  4P71 A;  3CIM A;  4A4J A;  2FGO A;  2KFN A;  2DXE A;  2XYP B;  1K73 T;  3W7B A;  2VON A;  1WTF A;  1WHW A;  3P8B B;  5K5M A;  4NRU A;  2VBW A;  3CDB A;  4CIO A;  1JLG A;  1G1X A;  1FKO B;  5ETQ A;  4ED4 A;  4O3Q A;  1FRJ A;  3TZZ A;  3DLH A;  1XJW B;  4LF8 J;  1M1H A;  4DN9 A;  2ZM6 F;  1F6T A;  3EXC X;  3R5D A;  2XB2 D;  4M5N A;  1YZ7 A;  4KV8 B;  2RML A;  1WKL A;  2R7W A;  4BDP A;  3AQP A;  5A76 A;  4K5R A;  1UVI A;  1EKS A;  2BKO A;  2FHK A;  2M52 A;  1RKI A;  4KYZ A;  3UPF A;  2CWX A;  4O23 A;  4WIQ A;  4DFK A;  1S0O A;  7FD1 A;  3OQ2 A;  3KTQ A;  1BY9 A;  2K3K A;  4A8F A;  2HKE A;  2RNE A;  5F8I A;  2ZNZ A;  4YHH F;  4OZ1 A;  4LF7 F;  3R97 A;  2HFU A;  4M5H A;  1WOS A;  2GO9 A;  3A13 A;  1IKW B;  1RA7 A;  1NH8 A;  1V3R A;  2OML A;  1HLW A;  4ITS A;  5GAG U;  4TU7 A;  3MEK A;  4ZVR B;  2Z2Y B;  2DH9 A;  2NZ4 A;  1RCO B;  2D69 A;  3MMA B;  2CA9 A;  3NRB A;  5CCM A;  4OYA A;  5JUM A;  4TQS A;  1Z4U A;  5KFM A;  2HNY B;  4ETX A;  1YI2 S;  2G0C A;  2X1B A;  1VMB A;  1LKZ A;  4K5S A;  1IBM J;  3HFV A;  1AA1 B;  4ZVP B;  4PWD A;  3LP2 B;  1CJV B;  1U02 A;  4QIW D;  3ZZU A;  4H4O A;  4OI2 A;  4ED7 A;  3UD4 P;  2C3M A;  4IH7 A;  4LIR A;  2W2N P;  3HXM A;  2RS2 A;  2F63 A;  1L3U A;  3MXH P;  5C2G A;  1RBA A;  3VAF A;  2FD2 A;  2GVD A;  4CO0 A;  3MMC B;  5CD4 A;  3JQJ A;  1CJT A;  2Q3P A;  3DU5 A;  3OL6 A;  3V6J A;  1HI1 A;  3CDW A;  3UO0 A;  1ZM2 A;  3OJS A;  2E5H A;  1T9U A;  1N34 J;  2FLL A;  1VQL S;  2WB1 D;  3JQM A;  1IR2 A;  1LW2 A;  4QR0 A;  5AE3 A;  3QJJ A;  4RNF A;  3UE2 A;  4KPC A;  5IWA F;  1K9M T;  2Q6B A;  2CKW A;  3UDV A;  3CJ0 A;  1N36 F;  4FNH A;  5KFT A;  4EWT A;  2XC9 A;  5CZV A;  4B9V A;  4DL0 C;  2IC3 B;  5BYS A;  2HQ3 A;  4X4R A;  4C98 A;  1ZA1 B;  3I4H X;  1IQZ A;  4C11 B;  3DRX A;  1VIS A;  2Z56 B;  1S1T B;  4NLR A;  1G2E A;  2CJQ A;  4LVN P;  2DYA A;  3GCX P;  1URR A;  2YNF B;  2NUH A;  1BQM B;  1ZM4 A;  2IFX A;  3ISN D;  2OP5 A;  4H54 A;  2BJ1 A;  5F41 A;  2FY1 A;  3CTR A;  3DGP B;  5THW A;  4OYW A;  1HBO B;  1HA1 A;  5HMX A;  3OVS A;  4IH6 A;  1ZM9 A;  1VBX A;  4DUY F;  4TYB A;  4DI6 A;  3ENW A;  4OI6 A;  2YKO A;  1FJE B;  2HVE A;  3HLU A;  3J7A 1;  1NUE A;  2HNZ A;  3Q8V A;  4OZ3 A;  3JYT A;  4DF8 A;  1N5Y B;  2VPZ B;  4GKJ J;  3A3N B;  3KXD A;  2FQQ B;  4Q2L A;  1DTT A;  1GMW D;  1QAX A;  4LR8 A;  3L9Z A;  4DZ6 A;  3HD2 A;  3WDO A;  1ELO A;  1NK6 A;  4FS1 A;  2KM8 B;  2VJU A;  4WYL A;  2OAU A;  3I82 A;  3DLL Q;  4FBT A;  2N3O A;  3M8Z A;  3QAT A;  2V34 A;  1IBK F;  2IM1 A;  2VKR A;  1UWA A;  2W4P A;  1S1T A;  3DYA B;  1L5U A;  2WVF A;  1R6V A;  2OIH A;  1WI6 A;  5MLC V;  2PI5 A;  1SBR A;  2G2O A;  3FRZ A;  4HT7 A;  3NLC A;  3LAM A;  5J2M B;  4HHU A;  1H2V Z;  8AT1 B;  4FXV A;  1TV6 B;  1ZOT A;  2K06 A;  1F5B A;  2O67 A;  4C0O C;  2L41 A;  5J2Q B;  4N41 A;  2KYX A;  2DHH A;  3AOD A;  4U67 Q;  4GO5 X;  3A3P B; 
#chains in the Genus database with same CATH homology
 3VGU A;  3DDI A;  1EHW A;  3DKD A;  3VGV A;  1MN9 A;  3NGT A;  1NDL A;  3Q86 A;  4W98 A;  4F4A A;  1NSP A;  4DUT A;  1F6T A;  1NCL A;  1PAE X;  3G2X A;  1F3F A;  4ANE A;  1WKL A;  3BBF A;  3FKB A;  3B6B A;  4C6A A;  4O0N A;  4S0M A;  3BBC A;  3FBE A;  4F36 A;  1ZS6 A;  1NDK A;  3GP9 A;  3B54 A;  4UOG A;  3ZTR A;  5BXI A;  2DXD A;  3NGR A;  1VYA A;  1HLW A;  3ENA A;  2AZ1 A;  3FCW A;  3VVT A;  1LEO A;  3FBC A;  3EVM A;  4HR2 A;  3VVU A;  3Q89 A;  4EK2 A;  1S59 A;  3FC9 A;  3PRV A;  3Q8U A;  3ETM A;  3EM1 A;  1BHN A;  3NGS A;  2ZUA A;  2NCK L;  1S57 A;  1WKK A;  2DY9 A;  3R9L A;  1PKU A;  3FBF A;  4WBF A;  1UCN A;  1B99 A;  5CAA A;  3EMT A;  3EIC A;  2B8Q A;  2BEF A;  4CP5 A;  4UOH A;  3VGT A;  4FKX A;  4KPC A;  1NSK L;  4ENO A;  3GPA A;  2BX6 A;  1XIQ A;  1HHQ A;  3ELH A;  2AZ3 A;  1NPK A;  1NB2 A;  1NDC A;  3JS9 A;  1NDP A;  4AND A;  3MPD A;  2DYA A;  1U8W A;  3Q83 A;  5C7P A;  3EVO A;  1XQI A;  1JXV A;  3FBB A;  1BUX A;  1B4S A;  1NHK L;  2B8P A;  1KDN A;  1W7W A;  3EE3 A;  3ZTO A;  2CWK A;  4DI6 A;  2VU5 A;  3BH6 B;  2HVE A;  1LWX A;  4UOF A;  3PJ9 A;  1NUE A;  3Q8V A;  3FCV A;  3Q8Y A;  3ZTQ A;  4ANC A;  3EVW A;  4DZ6 A;  1HIY A;  3EJM A;  1S5Z A;  1NSQ A;  3BBB A;  2HUR A;  3ZTS A;  3ZTP A;  3WX8 A;  2DXF A;  1BE4 A;  5IOL A;  1WKJ A;  4FKY A;  3NGU A;  3VGS A;  3BH7 B;  1MN7 A;  2DXE A;  1NLK L;  1K44 A;  5CAB A;  2HVD A;  3L7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...