3MEGB

Hiv-1 k103n reverse transcriptase in complex with tmc278
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
424
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
total genus 103
structure length 404
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3megB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB03
3BQ1A 1JXLA 2WONB 2FJXA 5L1KA 5DLFA 3KLIB 3DLKB 4I7FB 1R0AA 3UQSA 4IRDA 2IJNA 4MK8A 2FVQA 2RDJA 4KO0A 4EBCA 2BQRA 3M9OB 1QE1A 1EP4A 2YNGA 4Y3CA 1KHVA 2C2EA 2IC3B 2FVCA 5K14B 2ILZA 4HYKA 2C22A 3KLGA 3T5HA 3MEGB 3M9NB 1ZTTA 4DEZA 1BQMB 3QLHB 5C25A 4ZPCA 2B6AB 4F4YA 2RKIA 3BGRB 2WK4A 5L1JA 1RTHA 2YNGB 4ICLB 1S48A 1XR6A 5KG1A 1UWBA 3KLHB 2R8GA 5HBMB 5KFDA 5KFWA 1DTTA 4XPCA 1J5OA 2YNIA 2FJVA 2IM3A 3DDKA 3PVXA 1C1CA 4O44A 1HQUA 1VRTB 2V4QA 3JSMB 3PW7A 2CKWA 1EETB 3NL0A 4TXSA 3PW2A 3DI6B 1RTJB 3TVKA 3EZUA 4QWBA 1JLAA 2ZE2A 1LWFA 3SFGA 5C42A 1SH3A 5J1EA 4QWDA 3H5UA 1RDRA 5KG0A 3KLVA 1WNEA 3KJVB 1IKYA 2ZD1B 3KLFB 4O4GB 3KHRA 2BE2B 4GC7A 1S1VB 5KFSA 2AGOA 2YKNB 1N5YA 2HNDA 2D3UA 4EYHB 2I1RA 1S0OA 4ED6A 3DI6A 5KFKA 3GIKA 1XR7A 2YNFB 3D5MA 1LWFB 4IFVA 5C42B 3QGIA 3KLIA 3IS9B 3T5JA 4I7FA 1DLOA 2OPSB 3PW4A 4ED3A 2B5JA 3EPIA 2UVRA 4MIBA 5EWGA 3M8PB 4J9MA 3N6MA 2J6TA 4NYZA 3EPGA 5KFVA 4K4UA 5KFHA 1RT3B 1S1WB 3IRXA 3HVAA 5KFEA 3DRSA 3KHGA 4IFVB 5FDLB 3UPFA 2FLNA 4WFYA 2W9AA 4IDKA 4QW9A 3MR2A 2B5JB 2XGPA 1QAJA 3DYAB 4RW7B 4RNFA 1Z4UA 1TL3B 5DGBA 4I2QA 2ALZA 3NMAA 4ZP7A 1N6QB 5J2NA 1T05A 1KLMA 5J2MA 2VG6B 4TY8A 1IKWA 3IG1A 2J6UA 3V6DA 2ASDA 4GC6A 3DOLB 2JEGA 3H5XA 2XCAA 3GILA 5L9XA 2D7SA 5FDLA 5KFJA 1RT4B 2WOMB 4O3SA 4URQU 4K50A 5JXSA 4ZPAA 4URSA 2OH2A 3QIDA 5KFPA 5F8HA 3DLEB 3GV5B 3H4BA 4TYBA 2OPQB 4YP3A 2XGQA 1RT6A 1S10A 4JUZA 5HROA 5KT4A 4NLYA 3CWJA 3IN5A 1JKHA 3QZ8A 5F8LA 4DL3A 1C1CB 3KLGB 4KHMA 2F8EX 4JV0A 4ECWA 3T19A 5D3GB 1REVA 3LANA 2C2DA 1JLBA 2B6AA 3GYNA 2HMIB 5KFTA 3C6TB 2RKIB 1TP7A 3BGRA 4ED7A 4EBEA 5KFAA 3IS9A 3KK3B 5CYMA 2BRKA 1IKXA 5HROB 4NCGB 1IKYB 2ZD1A 5KT3A 1SV5B 4U7CA 5KFQA 3Q8RB 4MKBA 4IOBA 3M8QB 2W8KA 5I42A 1N4LA 3RAQA 4PWDB 1MMLA 1N5YB 2I5JB 4TQSA 5KT6A 4NLQA 3FSIA 3H4DA 3SFUA 4Q8FA 1EETA 3MECA 1TKTA 4NLVA 2DPIA 1C0TA 2FVRA 3CDWA 2AU0A 4F50A 3DM2B 3FQLA 1TL1A 2IM2A 4G1QB 4H4OA 3KJVA 2IAJB 4TYAA 4YR3A 3M8PA 1S1XA 4B3OA 4ECZA 4PQUB 4Y34A 2ATLA 1S9GB 2I5JA 3Q8SB 2XI2A 2W7OA 2RF2B 3IRXB 3BSAA 3C6UB 3LP2B 2VA3A 3DRSB 4K4VA 5J2PB 2IA6A 4KKOA 5I3UA 5DG8A 2FLPA 3HVWA 5HLFB 3DM2A 3FFIA 3QO9B 3UDLA 4QPXA 5L1IA 4IRKA 3ICLA 4I2PB 3RB0A 4QWEA 2IC3A 1HYSB 2HWHA 4RNMA 4HKQA 3QIPA 2WRMA 3V6DB 5HP1A 4U6PA 4WXOA 4G3IA 4K4SA 2FVPA 1D1UA 4KAIA 5J2PA 1BQMA 5DG7A 4MK9A 3FQKA 4ZPBA 2FLLA 3OL7A 5HLFA 4IG0A 2GIRA 4J9NA 4IR1A 1ZTWA 2C28A 1JLEB 4ZVEA 5F8IA 3FDSA 1TL3A 3IGVA 1HMVA 2FVSA 3BREA 4NZ0A 4R5PA 3G6XA 3QGGA 5KG4A 5DQIA 2R8JA 1J5OB 4WE1B 1RA7A 3H98A 3MEGA 1MU2A 3KLEA 4NRTA 4K4YA 4FBTA 3KK1B 5C25B 3OSNA 3V81A 3RAXA 2IM1A 5EUHA 3BJYA 4WXWA 5DQHA 4JV2A 4WFXA 4O3NA 4ECQA 4NCGA 2UUWA 2AX1A 4RW8B 3NGDA 1YVFA 2HNZB 2OPRA 5KFIA 3GV8B 3KK1A 1K1QA 3JSMA 3GV7B 4KFBB 1T03A 3V81B 3QYYA 2JEFA 4KSEB 1JLBB 4RNOA 4TQRA 3T1AA 1C2PA 4KKOB 5I3UB 1T94A 4WZMA 1DLOB 2OPSA 4ZP9A 2D41A 3QO9A 1XR5A 2DPJA 1RA6A 3DLGA 4LSLB 3I0RB 4PQUA 1HQEA 2BANA 4WYWA 3CJ2A 1TV6A 2YKNA 1RT5A 3DRPA 4XPEA 4ECSA 2RF2A 2YKMB 3UR0A 5C5JA 4YR0A 4WYLA 1RAJA 4IH7A 1HNIA 4FS1A 5DQGA 3T5LA 2V9WA 5EWEA 4XO0A 4Q44A 4MFBB 4IG0B 3GIJA 1JLQB 2W9CA 3KHLA 4WFZA 2R2RA 2R2UA 2FJWA 4ECUA 1JLEA 2JLEA 3LAMA 1DTQA 3G86A 2IAJA 3CIZA 4WZQA 1KHWA 1QE1B 5J2NB 1T05B 1KLMB 2R2SA 4TY8B 1CSJA 1K1SA 4QWAA 5J2QA 5KFUA 2CJQA 4J9LA 4DL2A 1JLFB 4ECYA 4LSNA 4QWCA 1HARA 3RB6A 2WCXA 2BRLA 1TKZA 5KG3A 4Q45A 3V6KA 3DYAA 4RW7A 5KG2A 4LQ3A 1HNVA 4RUAA 2HNYA 2VG5B 4PUOA 5KG5A 1HMVB 4KE5A 3E01B 1N48A 2JEJA 2E9ZA 3ITHA 4K4XA 1JKHB 1RT3A 3RBEA 5HP1B 1JLCB 2HWIA 3QZ7A 4H4MB 3KLEB 1C1BA 3VQSA 4J9SA 1SUQB 3TAMA 4RW6A 4ZVGA 1N56A 3PW0A 1S0NA 4ED2A 4ID5B 1EP4B 3LALA 1QUVA 4MKAA 5K14A 2E9TA 1S4FA 3IG1B 4O4GA 4PWDA 1RT1A 1RYSA 4IFYB 1D0EA 1SUQA 1S1VA 3V4IB 3N6NA 3LP0B 4F4ZA 3PR5B 4KB7A 3CDUA 3MR6A 4ECTA 4DG1B 1LW0A 2W9BB 2OPQA 3KK3A 5JUMA 5HBMA 3NKYA 3MEEA 4NLUA 3DLGB 4TN2A 4LSLA 3V6HA 2YNHB 3OL6A 3NBPA 4TLRA 1LWCA 4RNNA 1HQUB 4ZVFA 3OL8A 4EYIB 2WTFA 5C24B 2BQ3A 1S1UB 3C6UA 4ZHRA 2UVWA 3MEDB 5KFLA 3RB4A 2AGPA 3OL9A 5KFXA 3HVTB 1JLFA 1C0TB 1C0UA 2JC0A 2XWYA 1I6JA 3I5CA 4NLWA 5KFGA 5KT5A 3OLBA 5F8GA 3DMJB 3M9MB 1TL1B 5KFMA 1GX6A 2ASJA 4ZPDA 4IG3A 4IKAA 4M94A 3HHKA 1HYSA 3GIIA 2AQ4A 4KBIA 4FS2A 2VA2A 5F8JA 2R2TA 1N6QA 5J2MB 2AWZA 3GIMA 5J2QB 3BSNA 1S97A 4IRCA 3DOLA 4H4MA 1FK9B 2O5DA 4R0EA 1HNIB 1RTIA 1S9EB 4KV8B 3TAMB 4R8UA 4O3PA 3DLKA 3BR9A 4ECVA 3CVKA 3DMJA 3KHHA 3H59A 1JLGA 5DLGA 4RW4B 1TKXB 1S1XB 3DOKB 4RUCA 3DLEA 4R5PB 3I0SA 1W25A 2IM0A 1S6PA 3ITHB 3I5BA 2QE5A 3KNAA 1QAIA 2J6SA 1S9FA 3MTKA 2GC8A 1RT2B 3PW5A 2W8LA 2WHOA 5KFYA 1RT1B 2QV6A 4O44B 3I5AA 2RDIA 1RTIB 4R8UB 3PZPA 5F9NA 2ASLA 4EEYA 1LWEB 1RTDB 2IJFA 5KFZA 1LW2B 4K4WA 4NLSA 1TKZB 4ID5A 4DG1A 3TQ1A 3C6TA 4PUOB 3ISND 5KFCA 5J1EB 4I2PA 2XI3A 1UWBB 3KLHA 4RW8A 1IKXB 2VG6A 1RT7B 4JV1A 3MF5A 3PJWA 3ISNC 2HAIA 4MH8A 3MR5A 5I42B 1NNDA 1MU2B 1TQLA 2HNDB 4YR2A 4NLXA 3BQ2A 1LWEA 1T3NA 2VG7A 3QLHA 3DRRA 3KK2A 4NLTA 5EDWA 4LQ9A 5KFNA 3OHAA 3HVTA 1IM4A 5KT2A 3H5YA 3GQCA 4YMEA 4F4XA 4QW8A 4ZMMA 1S1TA 1RT7A 2AGQA 3Q8QB 2WB4A 4H4OB 1LWCB 2D3ZA 3Q8PB 2YNIB 4J9RA 2JEIA 1TV6B 3DRPB 4IH6A 2B43A 4NLRA 1VRTA 5KG6A 3MFHA 3OLAA 3MFIA 1BQNB 1S1WA 3MEDA 3PHEA 5KFRA 1FKOB 2UVUA 1SH0A 2V4RA 2YNFA 1NHVA 1HPZB 4DL7A 4X2BA 1S1TB 1JLGB 3PJXA 5DG9A 3MR3A 3MEEB 4IG3B 2HNZA 2OPRB 3DOKA 3CDEA 2UVVA 3NAIA 5KT7A 4OL8A 1RT5B 1SH2A 1IKWB 4KFBA 1T03B 3CO9A 5KG7A 2BQUA 2OPPB 4Q8EA 3MECB 4Q0BA 3JYTB 1FK9A 2WONA 1HPZA 4EO6A 1VRUB 2BR0A 1S49A 4J9QA 4IH5A 4NLOA 4RU9A 3T5KA 4MFBA 1S6QA 1LW2A 2W9CB 4G1QA 5F9LA 4YQWA 1TKXA 5KFFA 5F8NA 3BQ0A 4O3QA 4DL4A 5L1LA 1FKPA 3I0SB 4NLPA 1HQEB 2EC0A 1S6PB 3QGHA 4Y2CA 3OHBA 3LP1A 2XCPA 4J9OA 1JLCA 4WE1A 3LP2A 4K4TA 4H54A 3LAKA 2R8HA 1RT4A 2WOMA 5D3GA 3D28A 3CJ4A 4ECRA 1S9EA 4KV8A 3DRRB 4URGA 3KK2B 4J9PA 1IKVA 4RW9A 2XC9A 4FBUA 4RW4A 1RTHB 1TVRB 4ICLA 4NLDA 5DGAA 4ZP8A 3KMQA 4DL6A 4I2QB 4ED8A 4MK7A 3NAHA 3M8QA 1U09A 3KOAA 3V4IA 4LSNB 4ZP6A 1GX5A 1RYRA 1REVB 4RW6B 1BQNA 1R0AB 3HKWA 4RZRA 4ED1A 4NLGA 1RTJA 1RTDA 2HMIA 4KO0B 2JC1A 4KHRA 3PR4A 1JLAB 2ZE2B 1TVRA 5EWFA 2GIQA 3BSCA 3H5SA 4O3RA 5CYMB 2IBKA 2UUTA 2C2RA 1RT6B 2YNHA 3NBPB 3N6LA 1JX4A 1DTTB 4B3OB 3I0RA 4ZVHA 2W7PA 1C1BB 1S9GA 2BANB 1S1UA 4ZHRB 3LP0A 1JIHA 2IMWP 2VG7B 2YKMA 1TKTB 4Q0BB 3FRZA 3BSOA 1VRUA 1LW0B 4J9KA 3RB3A 3FFIB 1S6QB 1OS5A 2ILYA 1JLQA 2ZKUA 4ED0A 3G6VA 3KLFA 3KMSA 1SV5A 3H2LA 1DTQB 2V0NA 3CJ0A 3CJ3A 4TY9A 2BE2A 3SI8A 4IQXA 4IFYA 5T14A 3IGNA 4NRUA 4Y2AA 3G6YA 3OSPA 3QIPB 5CYQB 3CJ5A 3JYTA 1FKOA 4K4ZA 2E9RX 4IR9A 5F8MA 3H40A 1C0UB 4IDKB 1S0MA 2W9BA 2R8IA 5KFOA 5KFBA 4DL5A 4RW9B 1IKVB 4Q43A 1HNVB 3E51A 2HNYB 2VG5A 4RNHA 4EO8A 1FKPB 4F4WA 1NHUA 4ECXA 1ZETA 2R8KA 3E01A 4EBDA 3LP1B 5C24A 5CYQA 1RT2A 4M95A 2AX0A 4O4RA 4O3OA 3V6JA 3RBDA 2OPPA 4MIAA
chains in the Genus database with same CATH superfamily
2VH7A 3BKTA 4K7QA 1HNWJ 2CQ2A 2WONB 2BJEA 2JSXA 5L1KA 1CQMA 1N8RT 3J81Y 1R0AA 4B3RJ 1RWNB 2RJZA 1F2HA 2IJNA 2X7IA 3KUGA 2V2ZA 3EDRB 4DHVA 5B08A 5F3ZA 2BQRA 1D3WA 3MMBB 5E7OB 3T41A 4K5SA 1YJ9S 1QE1A 2YNGA 4Y3CA 1SB6A 1IVZA 1QAXA 1RAHB 3J7A1 1VDHA 5K14B 4CO3A 2C22A 1N5TA 2H5IB 2CPJA 1FO1A 1MWYA 3EVWA 3KDOA 4GO7X 1Y3JA 2G2YA 4DEZA 1KFSA 2I38A 2VFVA 4GKJF 3BDEA 5C25A 2Z2MA 3OJUA 3HM9A 2B6AB 3SXLA 2KT5A 4F4YA 1ZOTA 3BF4A 3DN9A 5D4PA 1QLNA 1WI8A 2E5LF 2OTLS 2DXFA 1NSKL 1RTHA 2P9EA 1S48A 4AE5A 1B7FA 3KLHB 2EWHA 3CCSS 2R8GA 5HBMB 1QY7A 5KFWA 3JS9A 2FJVA 3AXKA 4FZVA 4ZITA 2CNOB 3P5TL 2IM3A 3VV2B 3DDKA 3K5LA 2YY3A 5J1NA 2BE7D 1UETA 1SJ3P 2IIHA 1U25A 2CKWA 1EETB 2JVRA 3VAFA 2Z56B 2CWKA 2R7UA 4AXJA 3US5A 1RAEB 3BQ0A 2K06A 5C42A 3SFGA 5J1EA 4QWDA 4DV3J 1RDRA 1T7PA 2F4VJ 2ROGA 2KT2A 1IKYA 2X3DA 2YWHA 2Z8QA 1ELOA 1ZAWA 2VQFF 3GFZA 2Z2ZA 3C15A 3M6XA 4GC7A 1S1VB 4U67Q 4DS5A 3TARA 2AGOA 4P52A 2XBPA 3VWSA 2D3UA 2LQ5A 4WP8A 2PI4A 5KOXA 3L7OA 4Y2KA 1N34F 2BMBA 4PG7A 2VIHA 2YX4A 3N01A 4ED6A 2DISA 2EG1A 2YNFB 3D5MA 1YIJS 2XS2A 1LWFB 2J9EA 3KLIA 3AD7C 4Q7AA 4I7FA 4ED3A 3MPWA 5AE1A 1VQ4S 4CP5A 1RBLA 3MPYA 1TELA 3SCKE 2BJ7A 4WFNQ 2R7RA 4NYZA 3HF5A 2V63A 3M2VB 1ZPVA 3R5GA 2GAGC 3HVAA 5LXRA 1JJCB 1TK0A 3FKBA 5KFEA 4XTTA 2RHQB 3LW5C 5CHCB 3UPFA 2CNNB 1FHTA 1KSPA 3CJSA 2O67A 1TZ0A 4C48A 3J80Y 3PR4A 5ETSA 1QM9A 4I1TA 4DUZF 4KHPF 5D4OA 1TL3B 3BBBA 4JI2F 3O44A 4X64J 4OHWA 3AQOA 4FYYB 4I2QA 2JLFA 2DGXA 2XMTA 2JLGA 3FNNA 4GMKA 1L5UA 4CCHA 3CC7S 3J80U 3B4MA 2CJXB 5FIIA 4NXMJ 2HVHA 2HQFA 2LQBA 3H5XA 2VF3A 3AAWB 2RD5C 1FFGB 1X8DA 1RT4B 4LFBJ 3EGNA 2ADCA 4K2XA 3OTDA 4C8YA 2QYCA 3A8IA 1PBAA 1NK8A 2CQDA 4PPDA 2JNJA 3MWBA 2MXYA 3ZC4A 2UUBJ 1RT6A 2Y0SD 4JUZA 2QL5B 3GJTB 5F41A 3MGJA 4DL3A 4F26A 1RAAB 4KHMA 1FTCA 4OZNA 5GAHU 1H98A 4IYQA 3DHXA 3R5AA 3FVYA 3G82A 3GYNA 3MEKA 3OJSA 4NXMF 4X4QA 3BS9A 2RKIB 2HQGA 1FFWB 2KRRA 4FPIA 4EBEA 2BRKA 3A12A 1XMQJ 4HTJA 4OYXA 4KGZB 2XG8A 2MQ8A 3J7AN 5I42A 1FD8A 2EXUA 5EGYA 1FDBA 3SCIE 3R1LA 2I5JB 2H4WB 5KT6A 3FSIA 3C16A 4FN5A 2I9SA 4HEA9 3MECA 2FIUA 1SC6A 4QOTA 3OTOJ 1C0TA 1L3KA 2WBRA 2UXCJ 2AU0A 4F50A 4QZVB 3FQLA 2VICA 1EZZB 2VC0A 4H4OA 3KJVA 4TYAA 2LKZA 4OZ3A 1YRXA 3GG0A 5ADZA 1U1NA 1U1OA 2MB0B 5D0HA 2HQCA 3QAUA 4PYAA 4E2FB 5BXIA 2ADBA 2ATLA 4B9VA 3Q8SB 2XI2A 4ZLLA 2R9LA 3PXGa 2JL9A 3C6UB 3BSAA 2ERRA 3BGLA 3TZWA 5M2RA 4K4VA 4V19J 4ZLJA 2IA6A 4KKOA 4E98A 1NSAA 1ZS6A 2YKQA 3HVWA 1WDDA 1Y5IB 3UDLA 2X1AA 4KGKA 4NL5A 3HVRA 4IRKA 1APSA 1FJEB 1QVGR 3C14B 3RB0A 1HBNB 2D9OA 1M5OC 4Y65A 2ZH9A 2EI5A 2B4OA 2UXCF 4ZDNA 1TL7A 1FRLA 1GT8A 3JQJA 2C3PA 3R6GB 1YJVA 2LYVA 4CO4A 4KAIA 3TO8A 3D54A 1G4CA 1UJ4A 2HBYB 5A0YB 2M2BA 4ZPBA 4C6AA 3SQOP 2CQ1A 1RHMB 1EAYC 1WEZA 1X4HA 1CS4A 2VFRA 5GAEI 1U6FA 4HHJA 1JLEB 5CCMA 3THVA 4RU2A 4MT1A 5CXTA 3A8KA 5FJ4A 2YBVA 2FVSA 2ASYA 3G6XA 1Q7YT 2EEYA 4ELTA 3QGGA 5AXLA 5KG4A 4NYPA 1XC9A 4WK3A 2CQ3A 1F5AA 1B0VA 1CJTA 2DGWA 1RA7A 2LQJA 2FHMA 2Z57B 1J2VA 3MEGA 2OFHX 1F9HA 3MPVA 3KK1B 5CH7B 5C25B 3H25A 2PGCA 1C4CA 3ENQA 3R7SB 2IJRA 3OSNA 1FXLA 2FHOB 4NA1A 2K8GA 3W1YC 4B02A 2J8SA 3CE8A 3JTPA 1A7GE 4WXWA 5DQHA 2RQCA 4PZVA 3ZTSA 3M8SA 2AX1A 4RW8B 3EMTA 5ETOA 4OZJA 2WVFA 3AT1B 4ID8A 5KFIA 4ED4A 1N36J 4DR6F 2AZ1A 2HZCA 3WC0A 1R8HA 3KK1A 3MCSA 1GNKA 3NGTA 1K1QA 3JSMA 4I68A 4KFBB 4QIEA 4CM2A 5AE2A 3QYYA 2JEFA 1WC0A 1U2RA 1HHTP 1D9FA 2VODA 1JLBB 2A18A 2PC6A 1OY6A 3R9LA 1V3SA 5I3UB 5B0CA 1OYEA 3EVOA 5HL7Q 4ZJLA 1T9YA 2KL8A 3PYEA 1IR2A 4DV6J 4OHVA 2DNKA 2CG4A 3HSGA 1RA6A 2VUGA 3CDAA 4JI4J 3I0RB 3L09A 1XEZA 2G0CA 3R6LB 4CRJA 1KNZA 3JSBA 1HR0F 2GJ2A 3IM9A 5E3RA 5IM0A 3KFWX 2C3OA 1IR1A 3BR8A 1DQAA 4Y2MA 3JAMU 5A2QU 1NJWA 1NKEA 2XHCA 2XMUA 4FS1A 4IH7A 1SJRA 1WUUA 1GTEA 2CDRB 2LEAA 3AD8C 2KTQA 4J9UE 4RUBA 4XAKA 2GVZB 2J7UA 4MFBB 1CQNA 3HHLD 1R8BA 5CD4H 2W9CA 1PILA 2BDPA 2CPIA 2HBRB 3DGPA 3IC1A 2WVCA 2G13A 1H7XA 2XZDB 2IAJA 1D09B 3H7HB 1T05B 4TY8B 2R2SA 5DJBA 4I56A 3ZO7A 2BJ3A 4FNHA 4QWAA 2AP6A 2M70A 1LQ9A 2GHWA 2VL1A 4OV6A 2VC1A 3P3DA 3TAPA 4LRCA 4K5RA 4AXIA 3OBIA 1VHIA 1XTZA 3V6KA 1HNVA 3DGVA 2VG5B 5KG5A 4PUOA 4QU7A 1HA1A 1SC1B 3OVSA 2KYXA 1FNXH 3E01B 3H0PA 5CZXA 2F4VF 1FJGF 5HP1B 3GFYA 3QZ7A 4HVZA 5D4NA 2DNZA 3HSJA 4P72A 4CT8A 4XIUA 1HBUA 1A0OB 3IXQA 4H4KA 3NP5A 3CSKA 3R2CJ 2VBWA 4ED2A 2RQMA 4Z2XA 4V19X 1UJ6A 3LALA 1S6OA 2CZVC 5D15A 1QUVA 4AL5A 4R0JA 4DZ6A 4O4GA 2DH8A 1RYSA 2ZDPA 4DPTA 2ATCB 2VFUA 2BBEA 2J9DE 2P9CA 3LP0B 1E6YA 1VFJA 2AHOB 2AT1B 3CD7A 5A2QY 1UA0A 3CDUA 1RBOB 4UZBA 2PT0A 3CCLS 2ZH8A 2UUAJ 2W7AA 3WBZA 5U47A 2ZJRQ 1VQOS 2MHNA 3KK3A 4QIGA 3L7UA 5JUMA 5HBMA 3NKYA 2ZNZA 2QZ8A 4M5JA 4NLUA 4PCQA 2R7SA 4PEOA 1LKZA 2HVIA 3TX0A 3HCXA 3N4WA 2FHKA 2GHPA 4EYIB 2AJ0A 2XMMA 2WTFA 4ZHRA 4P10A 1EJ7L 4BDPA 1FXDA 1K73T 4EWTA 2AGPA 5KFXA 1P8GA 1SJFA 1UVLA 1RAFB 1C0TB 3OL9A 2LEPA 2XWYA 3PY8A 4NMXA 4C4WA 5KT5A 1KVIA 1RAIB 1NK5A 2ZZNA 1GX6A 2ASJA 2EKNA 3CB4A 2KZZA 4IKAA 4M94A 3HHKA 4PG6A 2DRAA 2JHEA 2CVEA 2GHVC 3GR0A 3GIMA 2A2DA 2AWZA 2GAHC 2PN6A 1IWAA 3BKUA 2EFQA 2KHCA 2L9DA 3OR1B 3DOLA 4H4MA 2DHHA 2O5DA 2M8DB 2ZZMA 4R8UA 1S9EB 4ECVA 3BR9A 2QGFB 2YH0A 3D1QA 2E66A 5HK4A 4KH0B 5DLGA 4RW4B 3JXOA 3ZFVA 3DLEA 4R5PB 1M5KC 1R8PA 1W25A 1O51A 3G87A 4CI0B 1S6PA 3ITHB 2A2CA 3CDBA 1EARA 1AZSB 3OW2R 5KFYA 2GJIA 1BD6A 1VJWA 2Y1IA 2CJ9A 1U6BA 3D4JA 3I5AA 3RJMB 3AFGA 2ASLA 1HLWA 4UW2A 4EEYA 3MCMA 2NQPA 1NK7A 1AUSL 3PIOQ 4NLSA 2MZQA 1T9WA 4LJMA 3B82A 1RKIA 3T1YJ 3TQ1A 1YQHA 3C6TA 1RP5A 1RISA 5IOLA 3RTVA 1X4DA 5J1EB 3ELHA 5E5NA 4DSFA 4OZ5A 1Z1ZA 1IKXB 3RG6A 3VF0B 3FK4A 1YBAA 2J8AA 4UTGA 1MNEA 3T6JA 4JV1A 3M7VA 3ISNC 4DPWA 4MH8A 3LO3A 3THPA 3ZTPA 3FCVA 1RUSA 2ZOFA 4ILMA 1M5VC 3QLHA 2OEMA 1LFWA 4NLTA 3ZZTA 3BM7A 3S8SA 1FX4A 5KT2A 4AUKA 1WEXA 3OVAA 3H5YA 3L95X 3ISZA 5B0BA 2BEFA 4KQZA 3GQCA 1HNXF 4DUZJ 3FZ2A 4ZMMA 1SC3B 1REGX 3P5BP 3VTIA 2AGQA 2D69A 2HIYA 4IO1A 4NWBA 1LWCB 2D3ZA 4JB8B 2X1BA 4AYBD 2W01A 3MFIA 1VRTA 3OLAA 2VD3A 5D4LA 3AHPA 1S1WA 3MEDA 1WC4A 4UF4A 3PX4A 1NKCA 2UVUA 3N5BA 1D9AA 4USMA 1NHVA 1IBKF 1WC1A 3OTEA 2AIRB 5E3QA 4P74A 2WW4A 3TUJC 2B7CB 3PJXA 3MEEB 2OPRB 3DOKA 4X66J 3MOJB 2A6MA 1T9XA 5KT7A 4QQBA 1Q7LB 2IBOA 2HHHF 4OL8A 2Q79A 3QMQA 3PRVA 1T03B 2BQUA 3D1HA 1XMBA 3MECB 4L6V3 5LMUF 3OR2B 1OMSA 2JRSA 4KTQA 2WONA 3SCLE 5DDOC 2FJAB 2JFDA 3HHNB 1S49A 4J9QA 4RU9A 3T5KA 1NEEA 4YQWA 2DR7A 1TKXA 3CJ8A 3K2YA 1S6PB 4ZCIA 3QGHA 4LBIA 1M90T 3IR5B 2QX0A 1JLCA 1K9MT 4DQIA 3LGMA 3OFEA 3TJ8A 1DBDA 2PD1A 2XMKA 2R8HA 4QR0A 4HI2A 1YRUA 4URGA 1VQYA 4CO5A 5IT9Y 4LF6F 1VOMA 3JTNA 1IKVA 2J7KA 4BC7A 2W2NP 3TVYA 2HAFA 4DX8H 4NLDA 5DGAA 4BLGA 1NB7A 1UVIA 1N33F 2LU1A 4I2QB 4DR5J 1S79A 4QJVA 1FE4A 2R7QA 3B54A 4TKTA 1GMVA 2HVDA 4FF3A 2DEIA 3NAHA 4ZLPA 2NZ4A 3LTOA 3KOAA 1TMJA 3V4IA 2AJFE 2X1GA 4ZP6A 2DR6A 3AB2B 1OIAA 1W2BR 2ZH3A 1BQNA 1R0AB 2J0XA 3HKWA 4L76A 4RZRA 2HMIA 1VLYA 3BQ2A 1VQKS 1WC3A 4HACB 1TVRA 3D3BJ 1V5VA 1XIQA 2GQQA 2GIQA 3PRBA 5CYMB 4C8MA 3IWLA 3ZTOA 1T8EA 2IBKA 4O3RA 1ACMB 3R2DJ 3ZTQA 3NBPB 2LP4A 1F5CA 4P2SA 3W5XA 4B3OB 2NXJA 2MGZB 2Y9HA 4K0KF 3GYGA 5IT4A 3HFVA 1HWUA 3J7YI 2BANB 1N36F 3PDNA 1JIHA 2HS0A 3C19A 3QT8A 1Y4ZB 2VG7B 2J9DA 2YKMA 4PXDA 1TKTB 1VS3A 1N32F 2R7VA 3EGVA 3TA0A 3R5BA 1VRUA 5GAHI 1LW0B 2VBYA 1TK5A 3RB3A 1PCAA 2UUCJ 3FFIB 3MR7A 1OY8A 3G6VA 3ZNUA 4A46A 3KMSA 4PAAA 4NLGA 3CJ0A 3CF5Q 2FHJD 1SJ4P 2CPYA 3MUVP 4FXDA 3BGOP 1BQXA 1BUXA 4MMOA 1UVNA 2XWXA 2P6TA 1PJ5A 3OTOF 4UY8T 3PKMA 2VOOA 4LF9F 3JYTA 1FKOA 4ZVRB 1Y0HA 2I6WA 4K4ZA 4ERDA 5F8MA 2XMJA 4EU0A 2K3IA 3MMCA 4DX6A 2W9BA 2R8IA 3HHEA 2VBXA 4F02A 3FUYA 3FEXB 4WTOB 1YJNS 1R6YA 1X5OA 4CYUB 2N82B 2DGSA 2Z2LA 4E8UA 3LP1B 1ZYQA 2AW0A 2C2NA 1RT2A 2AX0A 4O4RA 1UKUA 1VQ8S 4DN9A 3BQ1A 1NJYA 1JQGA 1FA0A 3MMCB 3DLKB 4I7FB 3UQSA 2ZZTA 1SL1A 2HVEA 4KO0A 4Y0FA 2DIUA 3G6YA 1WDTA 3NS5A 2UUBF 2CDQA 1M5HA 1IBKJ 4X4UA 4DF8A 1KHVA 2CJYB 2H51B 2MDAA 3AXMA 2C2EA 4JYAJ 2C2MB 4B9TA 1FESA 8AT1B 4A47A 2IVYA 1J5EJ 1YJ7A 3KLGA 1TL7B 4C98A 3W62A 1S59A 3F73A 3I96A 1OPIA 4LF8F 4ZPCA 3O6QA 4O0NA 4DOZA 4AFFA 1LXNA 3GZ7A 1U8SA 2RKIA 2WK4A 3M4XA 4OI6A 3OFGA 5L39A 1LV5A 2CJKA 2NCKL 2R4FA 1BLUA 4F0KA 1MMNA 1ROFA 3UD4P 3GU0A 2YKPA 3U1MA 4HDHA 4XPCA 5KFDA 1PO6A 2YNIA 2HHXA 4N56A 3OUYA 1KD1T 3O8WA 1C1CA 2E7WA 7FD1A 3PO4A 4X4NA 4WFBQ 3VALA 3H2VE 4B3TJ 3VAMA 1NO8A 3TRGA 3QT7A 1HI1A 1Z2LA 4RWWA 5KFAA 2FY1A 2C3UA 2F1FA 4P7VA 4FYVB 1RTJB 5CAAA 3NL0A 1BC6A 4LF6J 4WIQA 1J5EF 4P71A 3EZUA 1UP1A 1JLAA 2ZE2A 1WTFA 5HSPA 2MQQA 1VJQA 3OL8A 3KLVA 1WNEA 1I51B 1EB0A 4YFUA 4BWJA 3DGPB 1R43A 5LOQA 4O4GB 4ZIVA 3KHRA 4ES1A 2BE2B 5LSOA 1ZH5A 3W2VB 3R5JB 1N5YA 2HNDA 2E1PA 4F0HA 2I1RA 5B0AA 1U47A 5G4DA 2VU5A 4CO0A 4HH0A 1S99A 2QO3A 4ZVQB 5K8PA 5KFKA 2RQ4A 4OX6A 3HI9A 1QTMA 4IFVA 3D66A 3OXGA 3QGIA 2QN6B 3AODA 4PABA 1P6TA 2B5JA 2Z58B 2XYPB 2DNRA 3P8BB 3H42A 1XMOJ 3MAAB 3C14A 3M8PB 5E0OA 2BACA 4CYUA 1B4SA 1TUVA 3T1HJ 1VQ6S 2LXFA 1V3RA 3ZZYA 2DNMA 5IM0B 4DZDA 3C16B 3WQPA 3BO4A 3IRXA 1HHSA 2F7VA 4ELUA 2DK2A 2ZHAA 4HH1A 1KOHA 4KYZA 2FGOA 3MAHA 2W1BA 1S9FA 1T0TV 5FDLB 2W2MP 3CW2C 2FLNA 2COLA 2ZBQA 1KQFB 4IDKA 4QW9A 4X62J 3MR2A 2J76E 1QAJA 1Y5LB 3HJVA 5DGBA 2GQCA 4RX6A 3MI7X 3N28A 2ALZA 3D1OA 2FJEB 4ZP7A 2MLXA 1N6QB 1T05A 4TY8A 1KLMA 5M2PA 2B56A 2J6UA 1IKWA 4ZVTB 5DETA 3V6DA 6AT1B 2ASDA 3DOLB 2Y1LB 2NZCA 4PXBA 2Z4PA 3GILA 1J27A 5FDLA 5KFJA 4I6YA 5IS2A 3HD1A 3G6ES 4O3SA 4URQU 3CC2S 4K50A 4JI5J 1AW0A 4ZPAA 4YOEA 2B0GA 4LF1A 4ZK7M 2JZ5A 3RRGA 1YJTA 4YDXA 1IN0A 3DXSX 3MMBA 1I5OB 1TUWA 3D3CJ 2GVDA 4U7UD 2HHPA 1VC6A 3Q8UA 1S10A 1CC7A 4LF7J 1XQIA 4C11B 1DZ5A 3CXCR 1RWVB 3UDEA 3RB6A 2YKOA 1HHQA 1PG5B 4JV0A 4PG8A 5L8RC 4UQGA 4HR2A 1S4EA 2ZWPA 1ICEB 4I64A 3VAIA 1JLBA 2B6AA 2EFPA 2HMIB 1CJKA 1EKRA 3GYXB 2P6SA 3C6TB 5KFTA 4DV5F 3BGRA 2KM8C 1U1QA 3D67A 4U7CA 1NHKL 3Q8VA 3R3TA 4OZLA 4Y6IA 3Q8RB 2RU9A 3KJQB 2F65A 1IBMF 5IT0A 5HI7A 3M8QB 3NCRA 3VGTA 2E1MC 3AOCA 5GADI 4TU7A 3M8RA 3RAQA 1N5YB 2NUHA 2WAQD 4EZ9A 2XLJA 3H4DA 4P2XA 2DEJA 3SFUA 3GTYX 1HL6A 3T1HF 4DXLA 4NLVA 5A8RA 1FRIA 2XNQA 2FVRA 1VGYA 2QYGA 1RLDA 2K7KA 4WWSA 4ZVUB 1BMQB 3HFZB 5DZ7A 4DR7J 2IYGA 2FLOA 1HBMB 4J37A 4G1QB 1UAWA 2H3EB 5ETTA 1UEKA 4ANDA 4D3HA 4Z7CA 4ZCMA 2BKNA 5D6GA 4PQUB 4Y34A 3GCWP 1S9GB 4ECZA 2GJFA 2GMJA 2W7OA 4JI7F 4DCOB 3IRXB 1VQ7S 1NBEB 4USTA 5HO4A 1EQ0A 3DRSB 1X4CA 1SJQA 2E1CA 2FLPA 1DQ8A 5HLFB 4USKA 1RADB 1R6VA 5AE3A 2X51A 3QO9B 3D6HB 3HHDA 3EWGA 1VQNS 2UV8A 4QPXA 2FYXA 1K44A 3FGVA 7AT1B 2FZCB 2EK1A 3M2RA 4LFBF 1U8WA 4OV1A 2RQKA 2IC3A 3LWMA 1TKDA 2KFZA 4U6PA 1UMJA 2CPDA 2FVPA 4GRSA 5G0RB 1B0PA 4F04B 1TUGB 4FYWB 2ABYA 1BQMA 5DG7A 3EUNA 3FQKA 2OJ3A 3I31A 3K7RA 1PYTA 2E29A 2GIRA 1S7IA 1UVMA 4J9NA 2C28A 1KRPA 2EK6A 3SZ2A 3DOMA 3P6YC 4NZ0A 4R5PA 2R7TA 2KKHA 2R8JA 4YB7A 3JB9k 1FT8A 1H7WA 5AJ3J 2HW3A 2NUUG 3W3SA 2CVIA 4JI8F 2B9EA 4LUBA 4FBTA 4GKKJ 2K1RB 3NGRA 2FDNA 3TZYA 3BEGB 4CLPA 4ILLA 1N88A 3O5TB 2IM1A 4UUWA 2NR0A 2UXBF 5EUHA 3TX8A 1WJ9A 4AL7A 2PA3A 1VC5A 3D0IE 4WFXA 4LF5F 4ECQA 3RAMA 2FY8A 1PYSB 3W5ZA 3HKZD 2KVIA 3NGKA 2OPRA 3QT5A 4C3LA 4F36A 2OSQA 3RBZA 4DPUA 3J81j 1X0FA 2KZMA 2OELA 3I4PA 1UJ5A 3Q89A 3GV7B 4LREA 1T03A 1HQ2A 3V81B 3KJFB 2MPUA 3U1LA 1JJ4A 1U7LA 2NSCA 2ZKTA 3T1AA 1C2PA 1MROA 1T94A 2RT3A 2XYHB 1CULA 3IAS9 4TQRA 3DRYA 2CYYA 2DGUA 4ZP9A 2D41A 2F9DA 5LJ5Y 4ER8A 2NS1B 4F3MA 4KH1B 4O0IA 1WTBA 2FB0A 4TLQA 3K5NA 3VGUA 4Z37A 1XWLA 2Q3PA 2IRXA 1N33J 4PQUA 1HQEA 2POKA 4K2JA 3WDOA 2BANA 4ZVPB 4ZKAA 1F60B 1RT5A 4L72B 2RF2A 1RJJA 3LF0A 3HD2A 5KOWA 5C5JA 3T5LA 4WYLA 4J91A 2V9WA 3KG1A 5A0YA 4JI0F 2XZWA 4PYDA 3QAEA 4ZCKA 1GMUA 1RABB 3GIJA 4Q44A 4RNOA 4OYPA 1VBKA 5HQLA 4ECUA 2FJWA 5A8WB 4M1KA 1JLEA 1S77D 1Q82T 3C66A 2V68A 3G86A 3GJRB 4FYXB 2BOPA 4LRDA 4WU3A 2CNKB 1NCLA 2R7XA 2HEKA 4WFAQ 2DNPA 3SDEA 2RNEA 4DL2A 2Y0BB 1BE4A 2WSEC 3GG1A 3PRDA 1WSRA 6FDRA 1BHNA 4J9LA 4JI4F 1R0BG 4C8ZA 1FD2A 2ZITA 3AH6A 3BV8A 1N0UA 3TUZC 4OZ1A 4USUA 5KG3A 4Q45A 4LF2A 4RW7A 5EX3A 1N52B 3PKYA 4RUAA 2N4DA 2L9WA 4LQ3A 3ETOA 4Y2IA 1VRQC 2QG9B 1FVQA 4LVOP 1G2EA 2WZ1A 3GFXA 2EFOA 3TWZA 4K4XA 5ETKA 1RT3A 5GAGU 1WF1A 2BV3A 2E1AA 1JLCB 2NXUA 4H4KC 4H4MB 2CA9A 2OGUA 2RAQA 2CQPA 4KGVB 3VQSA 2CNLB 1SUQB 4CLTA 1SKWA 3ZZUA 1XNQF 1ULRA 1X9WA 3BO3A 3PW0A 4DV1F 1F0XA 5AJ3F 2XO6A 4ZN1A 1S0NA 1GEHA 3TEHB 1QD1A 5K20B 1EP4B 3S1TA 3GSIA 5K8NA 2XZTB 1G3OA 2DKOB 3DXBA 1S4FA 1TR0A 3GP9A 1MW7A 2APOA 3LA0A 3POTA 1FRJA 5IQQA 3UD5A 3X3UA 1RT1A 4IFYB 1D0EA 1SUQA 3V4IB 1AT1B 3ET6B 2RS8A 3QWUA 4ZN3A 4DSIA 2DR9A 1MWQA 4F0MA 3MR6A 4ECTA 4YN3B 4DG1B 4OX9F 3G9CA 2OEKA 4ZOSA 1L3TA 2W9BB 2GW8A 1UFWA 3MOZA 1WACA 4CO2A 1KKHA 3DLGB 1X0PA 4LSLA 5DRKA 2CXEA 4IOAQ 4QU6A 2E5HA 1T3OA 4TLRA 3HULA 4TU8A 4DSKA 2XMVA 4ILRA 4OZ2A 1S72S 3CCUS 3W65A 1KQSR 2G2ZA 4B9SA 3NS7B 4RBVA 1D8ZA 2Z30B 3C46A 2UVWA 3RR7A 3RB4A 2DRDA 2VPYB 4PG5A 3FC9A 4YB1P 3VZIA 3OLBA 4NLWA 4L3NA 2DNOA 2MKCA 3CCJS 4DPYA 3DMJB 3M9MB 4DJBA 2VFTA 5A8WA 3TW0A 2HGMA 2YWWA 1EIYB 2DHAA 3VHQA 4DV0F 1SC4B 5HQ8A 1Q16B 2VA2A 5F8JA 3S6EA 1VISA 4WP3A 1L3SA 3RU0A 4IRCA 3QJJA 3VVUA 1XNRJ 2OFGX 2ZOGA 1RTIA 4KV8B 3TAMB 4PWWA 2W25A 3ADAC 2SXLA 2GQ2A 3DMJA 3CVKA 2C2KB 3H59A 3TNVA 2W2QP 1RACB 4USWA 2DYAA 3HZGA 4NEYA 1S1XB 4OLPA 4DMZA 4DV1J 3MM7B 3I0SA 3FSYA 1MMDA 1Y7PA 3I5BA 1NK6A 4F2SA 3KNAA 3SSRA 3TP2A 1NJZA 3SBMA 1N34J 2V94A 3MTKA 2ZNYA 4C7QA 3U7JA 2QV6A 4B3RF 1KTVA 2RDIA 1RTIB 1NSPA 1X4EA 1Y9OA 5F9NA 2XY7A 2NXCA 2V5HG 2OEJA 1LWEB 1KOOA 3T3FA 2IJFA 5KFZA 3U1NA 4K4WA 4HACA 3O3LA 2ALYB 4JYAF 4DV3F 4PUOB 1HWLA 2HS4A 3HDSA 2G1HA 2XI3A 4I2PA 1UWBB 2FPHX 4LT6A 4RW8A 2GFFA 3EXYA 2PEHA 4OIXA 2CFXA 1KVJA 3MR5A 2MKKA 3FBEA 3RZAA 2DRBA 5JJBA 2NREA 3NNCA 2M88A 5I42B 4DFPA 4L73A 2HNDB 2BKPA 2JDJA 1BGXT 3CTRA 2K1RA 2LDIA 1QUPA 2BVZA 2MZRA 3Q2SC 4NI2A 4DR5F 5KFNA 4IOCQ 2M9KA 5L46A 2EC2A 5JVGQ 3IM8A 3RGIA 4YMEA 5K8MA 1R0CB 3HO1A 2KVQE 2J5AA 2J0WA 3ZZPA 1RT7A 3ZZZA 4ENOA 2IFXA 3FMWA 2QSWA 4YHHJ 1CC8A 2WB4A 4A8OA 1HIYA 1Y11A 1Z2ZA 4J9RA 2DCUB 2F9JA 5A6PA 4M5GA 3OUYB 2PMZD 3MFHA 1KONA 2BJ8A 1KFDA 1RWXB 2EKYA 3NS6A 5BR8J 4CIOA 3SYZA 2DGTA 1CJVA 1FKOB 1SH0A 2L08A 4UOCA 2V4RA 2J9CA 1P1LA 2KYZA 4DL7A 1SCJB 3MD3A 1FRKA 4KHPJ 4X2BA 2D3O1 2FTRA 2F3JA 4K0KJ 3AJ1A 5DG9A 4DR1F 1LOUA 2KXFA 1UTAA 4O23A 3CDEA 3M6VA 2QA4G 1HBNA 3W61A 3FJ2A 5RUBA 3HP6A 1RT5B 1DFDA 1IKWB 4KFBA 4DU8A 1YHQS 1RGVA 1SQEA 1VBZA 1FK9A 1GQEA 4WK1A 1HPZA 3V2UC 1VRUB 4NLOA 2LECA 1S6QA 1LW2A 1V3ZA 4G1QA 3CULA 3GMGA 5KFFA 5F8NA 5CD4A 1JXVA 1OYDA 1VQSA 3OTCA 1VR6A 5L1LA 3I0SB 4NLPA 3TUIC 2MQOA 2B4UA 1Q53A 2V69A 4Y2CA 1H2VZ 3WIUA 3HK2A 6FD1A 2XCPA 4X65J 4F3OA 3KNGA 4RLEA 3BYRA 4H54A 2WVDA 3ILLA 3N5FA 2WOMA 5D3GA 2B9XA 3D28A 3CJ4A 4BS2A 2MTLA 3P45B 3G8SA 1OO0B 2XY6A 3C3LA 2C42A 2A1BA 1Q8LA 3EJMA 1UFLA 2XC9A 1VQMS 4FBUA 1ZA2B 3RBXA 2PMHA 2FGCA 3K8VA 4ANCA 5HVHA 4DQSA 3KMQA 2FD2A 4ZCLA 3MXHP 4RR5A 3R5CA 3CD6S 1Q0NA 1YK9A 4MK7A 2QFJA 1F1BB 2YWKA 3NWGA 2EPIA 4L3KA 3W7BA 1V6HA 4Y00A 1CJUB 4LSNB 1FVSA 2CQ4A 4YHHF 1MSWD 3AY0A 1WF0A 1REVB 1M5SA 1WC6A 1K0TA 8RUCA 1XMOF 1RTJA 4HHHA 3PYGA 2QMUB 1JLAB 2ZE2B 2FJDB 2G0JA 2MQNA 3A4TA 3D7SB 3H5SA 5ETQA 2DGVA 2D3OR 4P2FA 4C3MA 2W4DA 1GFWB 2DCLA 2C2RA 4GKJJ 4J9VA 2MQPA 2FZGB 2DNYA 3I0RA 2E7VA 1NKBA 2JOQA 3IBCB 2N3LA 1S1UA 1H3DA 1PJ7A 1R89A 1N5SA 3ET6A 1HW9A 3ETMA 3UFCX 5IQ6A 4DF4A 3OR2A 1NLKL 1NDPA 3CC4S 1Q1KA 1R8CA 1RI7A 2XS5A 1VCTA 1SL2A 3RW6A 4PRFA 2ZKUA 2IVMA 1RZMA 3SIPB 3VGSA 4KJIA 3B78A 3KLFA 4CLYA 4X64F 1SV5A 4TY9A 1DTQB 2V0NA 1Q8IA 3CJ3A 3B8HA 3NLCA 4FPRA 4P9SA 3UCGA 5T14A 3IGNA 4GO5X 4P6QA 3CO0P 1L3VA 5CYQB 1A6LA 3M32A 9RUBA 3JSYA 2XMWA 1HR0J 2VPZB 1HWJA 2X1FA 2E9RX 1MN7A 3H40A 1YZ6A 3DCAA 4IDKB 2VJUA 5H9EJ 3B4DA 4RJVA 4DFJA 4DSLA 2F4FA 1AXQA 2DTJA 3MM9B 4HL9A 4DL5A 1IKVB 5LJ3Y 4F67A 4N8NA 3E51A 2VG5A 2BJ1A 4EO8A 5M2UA 1FKPB 4F4WA 4ECXA 4B3MJ 1TMMA 2HBQB 2HWTA 3GE9A 4DR4F 4DFMA 4LF5J 4JV5J 4DV7F 2L48A 2RILA 3Q22A 2DITA 3UI3A 4L75A 2OPPA 2XB2D 1RHKB 1JXLA 2FJXA 2ZHOA 5DLFA 1S7HA 2RHSB 4IRDA 2HQIA 2YQ3A 4MK8A 2FVQA 3CMAS 3D6FB 3QRQA 4OYOA 2V8VA 1WG1A 3QBCA 4JBCA 2ZM6J 3LPEA 3MURP 4NXNF 4P2MA 3T1YF 3UN5A 2IC3B 2B8QA 3CJTA 2Q1LA 3IRWP 3G8TA 1X5TA 4JI3F 2BW7A 5D0RA 3MEGB 1CJUA 1ZTTA 1BQMB 3QLHB 2H4YB 2HFUA 3BH6B 4ZJQA 3NEKA 2O3DA 4C97A 4B9MA 2EFGA 3ZZRA 3BGRB 1SQGA 1DY3A 2YNGB 5KG1A 1YITS 2YX7A 5E33A 1UWBA 1ZM3A 1X7VA 2K2PA 2Q66A 1DTTA 1J5OA 3DKDA 5DO2A 1PKUA 3D0GE 1I94J 4O44A 3I87A 3MM6A 4NA3A 1HQUA 1VRTB 2V4QA 3JSMB 5AXNA 3PW7A 5LSLA 5H1SV 3PW2A 3DI6B 3BN4A 3EVMA 2HFNA 4LRFA 3H20A 4QWBA 2ZBPA 4K59A 1LWFA 3WIVA 5DDQC 2M4MA 3H5UA 1HD0A 2ZVIA 2QRRA 4DS4A 4LBPA 3KLFB 3IWXA 2X3GA 2YX1A 4OYAA 1FRXA 2YQ1A 1SI9A 4EYHB 2QL7B 2HZVA 1D8YA 2DNLA 3DI6A 3EICA 2LXIA 4FVCA 2MMYA 1PJ6A 4M5DA 5C42B 1U2CA 1C4AA 3IS9B 2CADA 3T5JA 1ZBTA 2KO1A 5ETLA 3EPIA 4F2RA 3Q24A 4MIBA 2OIHA 2MLZA 5JMNA 3IR7B 1U1PA 1O8BA 2Q43A 3N6MA 2J6TA 4CZCA 4C8NA 1PAEX 3QT6A 1H2TZ 5KFHA 1RT3B 1S1WB 3E8OA 1GMWD 1Q8BA 1RQ0A 4J90A 3KHGA 1CEZA 4WFYA 3CCTA 2MZ1A 1WKKA 2XGPA 3DYAB 1YTYA 1S12A 2VZ9A 4B08A 2HG4A 5IC6B 1RHRB 2GX8A 4ITSA 4NMLA 4LF4F 3JTOA 5J2NA 5J2MA 2VG6B 2CAJA 2IVFB 3J81U 4UOHA 3CMES 2JEGA 2VOPA 3P96A 2QC3A 2D7SA 1WHXA 2OMOA 4ALZA 5FLXY 4AQYF 1HBUB 2WOMB 1NPPA 1RHUB 3N79A 4AL6A 4A8WA 1Q81T 1WHYA 4ZIWA 4C8OA 1KP6A 4URSA 4G65A 2OH2A 3QIDA 4I67A 1N5VA 4M5LA 1SXLA 4ES2A 3H4BA 3PO5A 3CJQA 2ROPA 4YP3A 2XGQA 4BCAA 5HROA 4NLYA 2LCWA 2HFZA 3IN5A 1OWXA 1RWPB 2LDYA 3DU6A 5THWA 4N8OA 5F8LA 3KLGB 1FEEA 2F8EX 4ECWA 3T19A 2KU7A 1O5JA 1OSDA 3M30A 4MIWA 2V34A 1REVA 5ETVA 2U1AA 5E3CA 3DFEA 5T41A 2C2DA 1UPPA 4B9NA 2B51A 1U1LA 4OHZA 3T6BA 4ED7A 1EX8A 3DDIA 1LK5A 4LVNP 5D8HB 4RBUA 3KK3B 3CPWR 5HROB 3EXCX 4C0HA 4AQYJ 4NCGB 1IKYB 3FRYA 3M8ZA 1P1TA 1YJWS 5KFQA 2V2KA 3CT9A 5AXMA 2VHGA 4JI8J 2NXNA 2RUGA 1S6UA 1FWPA 1N4LA 4EMDA 4BC9A 1WOPA 2LA4A 4NLQA 3N9UC 2F5GA 5GVQA 4A8SA 3V4MA 4Q8FA 2CIMA 1JK9B 2DPIA 3KG4A 2EG2A 1W7WA 2GGPA 3FBCA 4DV2J 3CDWA 4DR2F 3WZ0A 1XERA 2AJ2A 1EHWA 5K9FA 2QSFA 4YR3A 1FE0A 5C2CA 1S1XA 4B3OA 4ETXA 2MGZA 2RS2A 2B9YA 2I5JA 3IWNC 1UZHA 1WOOA 3I6PA 4CLKA 3I9ZA 1RSCA 1WOSA 4DV7J 2VA3A 2PEBA 2VQFJ 5J2PB 3K5OA 1MROB 2I2YA 4DFKA 4YUDA 2DNNA 3FFIA 1KEKA 4B3TF 4FF4A 2B8PA 3UCUP 1VQPS 5L1IA 3RW7A 3DU5A 1SIWB 2MQMA 1X4BA 4A8MP 4I2PB 2WSCC 4QWEA 2EBGA 2HWHA 1KQKA 3SSSA 4Q43A 4RNMA 3W9JA 4EUVA 4DR2J 4G3IA 4JI6J 2AEJA 1FNOA 2V4JA 2OD4A 2XULA 3M05A 4WXOA 4BBYA 2UUAF 4K4SA 1HD1A 5J2PA 4MK9A 4FNIA 1IJEB 3OL7A 2O1PA 2N7YA 1MG7A 2V9KA 4M5KA 4ZPWR 3QFWA 3ZNJ1 4IG0A 1VK3A 2OUGA 1ZTWA 5LM7E 4F4AA 5F8IA 2R7WA 4NPOA 2V8PA 3IGVA 4OJ3A 3BREA 3ENWA 3D0HE 1DAXA 2M8HA 5DQIA 4RUHA 2UZAA 2F8HA 3BBCA 3SDEB 3CCVS 4QR1A 3QSYB 2FJBB 2DHXA 4NRTA 1VQ9S 4K4YA 5EN1A 2JVOA 1XBWA 2BOAA 1DRZA 2XS7A 4Q5VA 3PIPQ 3RAXA 3M8YA 3GIRA 5A8RB 4XK8C 1ZM9A 4LSZB 1T02A 4HI1A 4P7TA 1VBYA 2MEWA 1S57A 1H72C 4M5IA 4RL1A 5E3PA 2DNGA 4LRAA 5ETMA 3QQCD 2G4BA 4CLFA 2W4PA 4NCGA 3DDNA 4LBHA 3NGDA 2B3TB 2Y3YA 3CJRA 4DUYJ 2HNZB 2DD8S 2DNQA 4PPZA 1GMWA 5EWFA 1QSYA 4U9RA 3A8EA 3CCQS 1L3UA 3TUPA 3TR5A 1NJIT 2XSJB 1F3VA 4KSEB 2ZBRA 4KY3A 3R5DA 1U26A 4WU2A 1T95A 1HBOB 5AXKA 2CJBA 1H73A 1DLOB 2OPSA 3NWRA 4CH7A 4B9LA 2GIFA 3QO9A 1T9VA 2DPJA 3W64A 4DI6A 4N76A 4MKYA 3FCWA 3OXFA 2VJVA 2V8GA 3CMQA 2HRTA 1RU1A 2EW9A 2HPUA 2RH3A 2PO4A 4OYMA 4ECSA 1TV6A 3DRPA 4XPEA 2F63A 3QWPA 4A8YA 2G9OA 5BYSA 1TU0B 2KJVA 4I69A 3UR0A 1X4AA 1U4BA 2UU9F 1RAJA 3IBWA 1HNIA 3KJNB 3IA0A 2A0FB 2LMIA 2MY7A 3GCXP 2N7CA 2BYCA 4PR6A 1NK9A 2QTWA 4ZS6A 2PDAA 2OI2A 2ROEA 2R2RA 2R2UA 4WFZA 4DDFA 4DPOA 2JLEA 3W9HA 3CUNA 1DTQA 1K0VA 3CIZA 1P9YA 1IQZA 1KHWA 3UN2A 4WZQA 1KLMB 1DQ9A 2V8HA 5LMNJ 1VC0A 3CCZA 1Y00A 2WVBA 4WBFA 3MMAA 2W24A 2XSFA 4NEZA 5D0GA 5KFUA 1JLFB 1JXEA 3J7Z5 4LSNA 4QWCA 4ECYA 1SJ1A 3A3PB 5MLCV 1ZAXA 1Q5VA 3OT9A 4FXVA 4A8QA 1WI6A 2ZHBA 1HW8A 2BRLA 3RR8A 1TKZA 3BN7A 3DYAA 3GWCA 4L74A 1PC5A 5KG2A 2ZDOA 2HNYA 2DGOA 5DM7Q 4GVBA 1T9UA 3GB0A 4USHA 5H9FJ 3F56A 1FEHA 4KE5A 1N48A 2JEJA 2E44A 3ITHA 2CG8A 4D3GA 1JKHB 1H2UX 4JI7J 2MSSA 4ZVOB 3RYLA 3R7NB 3PX6A 3LH2S 3PYFA 4NZ7A 3VR1A 1NPRA 4J9SA 1C1BA 4F8RA 1G6BA 1JNZB 1W26A 3TAMA 3MCNA 4RW6A 4OI3A 4ZVGA 2ACMA 2MQLA 4EI2A 5BJRA 5HMWA 2ZH4A 1HFEL 1PIEA 5AT1B 2XM3A 2AJ1A 2ZJQQ 1DJ0A 1TK8A 1MN9A 4DR3J 5SZTA 4X4SA 2VBZA 3QSIA 3DNCA 5K14A 5E2QA 3IG1B 1RWWB 2LQ9A 3MPUB 5HN0A 2W9CB 2QA4S 2MY8A 4PWDA 3VQTA 1FJ7A 1JWWA 1FX2A 4EK2A 3W2VA 2MKHA 4F4ZA 4KB7A 1Q8KA 2DY1A 1Y10A 1XN9A 2OD6A 3CIMA 3LPYA 4I0WA 1LW0A 1VYAA 4W90B 1KTQA 4MJKA 4QIVA 2QMXA 2OPQA 5JVHQ 1JNRB 1HBMA 1XK8A 4G1IA 3RRKA 4CH0S 4B9UA 4OLOA 2AMCB 3RRHA 2VKZG 4LF7F 3IAM9 3BGFA 1FJCA 1LWCA 4RNNA 5ETRA 1HQUB 4RPFA 1TFYA 1N32J 5C24B 1S1UB 2MZTA 4JI5F 3MEDB 1H6KX 4A8FA 3HVTB 4OHXA 4PQAA 1TL4A 1C0UA 2CPEA 2JC0A 3CCES 5KFGA 4DLEA 1KC8T 4C8LA 1YJRA 2M5YA 1JMTA 3CJKA 5F8GA 4JV5F 2W2PP 2ZUAA 5KFMA 4DUYF 2MKSA 2P2CB 3HT3A 4IG3A 2YTCA 1WKLA 1YWXA 1HYSA 1WELA 1Y3KA 1ZPWX 3NXZA 4I4BA 4KT0C 5GAGI 3I55S 2R2TA 2CQBA 1N6QA 3FEYB 4HDGA 4FS2A 2YPYA 2VQEJ 1M5PC 1E6VA 4X4RA 1NK0A 3BSNA 1QSLA 2A6OA 2DVIA 4UY85 2A10A 4WP9A 4YDDB 4O3PA 3DLKA 2H5EA 4LFAF 3K59A 2CQIA 1B0TA 4C0OC 1SKRA 1TKXB 3SSQA 4RUCA 3I82A 1F2GA 2QE5A 3NRBA 2J6SA 2DO0A 3TVZA 2GC8A 3PW5A 1WSVA 2XLIA 3JAMY 1RT1B 2FUG9 3UN3A 1U45A 4O44B 1NUEA 3PNIA 4OQJA 3ULHA 4FP9A 5A76A 4R8UB 3PZPA 3UD3P 1LK7A 3Q83A 1RTDB 2MYFA 1LW2B 4JI1F 1OPZA 1IBCB 4DG1A 2DO4A 2GA7A 3PEJA 2UXDF 1WORA 2HURA 2V50A 3PYDA 1RE1B 4CO1A 1RWUA 2DJWA 4KRWA 2VG6A 3QNWB 3OXLA 4J5OA 4OI4A 2VV5A 1IQTA 4RKUC 1K47A 3PJWA 4DV4J 2DH7A 2MJNA 4X4TA 1NNDA 4HHUA 3R7BB 1T3NA 4NLXA 3K0JA 3GR1A 4JI1J 3HHLA 2BKOA 3DRRA 3KK2A 2V6AA 4UOFA 5EDWA 1T9TA 4LQ9A 2HS3A 1S76D 4ZA1A 2MZSA 2QEXS 4QW8A 2NYIA 2RRNA 2BABA 1GXLA 1NMEB 2V2VA 3NOGA 3Q8QB 3TANA 3PX0A 1UCNA 1VI7A 2Z0GA 2CPXA 2HFOA 4RO0A 3TJ9A 3Q8PB 1HNZJ 4DR7F 1QJHA 2OAUA 1V9OA 4OYBA 4IH6A 3MHYA 2RDDA 2IYIA 1AB8A 3K8WA 2EVZA 3KUHA 3PHEA 4CDIA 2CJAA 4DCJB 1H74A 2VASA 2XSJA 3VVTA 1RLCL 2M0GB 3MTJA 5B7WA 5CCLA 2XLKA 1K8AT 3TZXA 1IR0A 4J7CA 4MYTA 5D77A 2H54B 3ILJA 1WHWA 2OLWA 3MM9A 1O6XA 2IMOA 1JLGB 4M8LA 3SCJE 3MR3A 3K57A 2ZH6A 2NPIA 4IG3B 3QFHA 1U48A 1R7IA 2AYGA 2RSQA 2QFIA 3LQVA 3NAIA 2UVVA 2F8MA 4DX5A 3OQ2A 5FLXU 3HX9A 4DQQA 1SL0A 1BWEA 1SH2A 3RUBL 1YG0A 1E6VB 1KBRA 1URRA 2OPPB 2QJ3A 3V5RA 1PGZA 5IFMA 4Q0BA 3D9BA 3JYTB 5D0EA 4F3QA 1VIOA 3LGNA 3HXMA 2OO4A 1ZA1B 2K3KA 2BR0A 4M5MA 3DLLQ 4OYZA 2CPZA 4MFBA 1NDLA 2OKQA 3BYPA 3PM9A 3AA9A 4JOUA 4WTYA 3T9NA 4B17A 5F9LA 2RU3A 3K58A 4DL4A 2E7XA 4PXEA 4WPAA 4O3QA 4A8XA 4DR1J 1HQEB 2EC0A 1RU2A 1YGYA 4KPCA 3LP1A 3OHBA 2HHSA 2JX2A 4J9OA 5ETPA 4GKKF 4WE1A 4K4TA 5MAOA 3LAKA 3JQMA 2XEXA 3M30B 2OSRA 4KV8A 2BZ2A 2GNKA 4KR0B 2B7BB 1AROP 1AYEA 2HIQA 4RW9A 1FNMA 5DS7A 1RTHB 1TVRB 3I4HX 3NCQA 2ZBIA 3KXDA 4DL6A 2DR8A 2AZ3A 1H38A 3POTB 5K8OA 1YDLA 1FKAF 2CZ4A 3ILOA 4CNYA 2MKIA 1U09A 3MM6B 4KIAA 4RBTA 2D9PA 2IHR1 1GX5A 4RW6B 3G4SS 2R3VA 4NXNJ 1XNQJ 2IDLA 2VDIA 2JC1A 1U1RA 4LR9A 2LFVA 3MM8A 3NMRA 4IQMA 1Q86T 3VAJA 3ENAA 2UXBJ 3M6WA 1RT6B 2YNHA 2ACYA 5SUHA 1SKUB 3N6LA 1JX4A 3EDQB 4CTAA 1PSDA 2E5JA 1LFPA 2D74B 1KS2A 4ZVHA 2W7PA 4NCAA 4ZJOA 3R97A 3LP0A 1E6YB 1FCAA 3UR3C 4LR7A 2IMWP 2KHDA 2QT7A 4DR4J 3FRZA 3TA2A 4NI2B 3MM8B 1Y5NB 4DSEA 1U02A 1ZAVA 3W2WB 4ATNA 4J9KA 2ZC4A 2C3YA 2GO8A 3IMQJ 2J0QD 1S6QB 2ILYA 1JLQA 1X60A 3K17A 4ED0A 3CCWA 3WC2A 1FDAA 3W63A 3Q2TC 3TEGA 3H2LA 3SQGA 4WIIA 3SI8A 2BE2A 1LEOA 1M1GA 4IFYA 4IQXA 4LIWA 3D6MB 1GXTA 1F9FA 3L9ZA 4YY3F 1NB2A 3OSPA 2VPXB 4A4JA 4YEAA 1R3NA 4B3SJ 3CJ5A 2H48B 3M1VB 4DPXA 4CQ1A 3WX8A 4UT4A 1C0UB 1S0MA 1FF2A 5BYQA 5KFOA 3H2UB 2YWEA 1I3OB 3UDCA 1NH8A 3X1LB 1HI0P 3MM7A 4RNHA 1QSSA 4ZPTR 4G1PA 1VHFA 2QMWA 5BYRA 4ED5A 3PV8A 3FBBA 2VPWB 4QR2A 5C7PA 3RBDA 4MIAA 2BJ9A 2I8EA 2XMAA 3KWMA 1AFJA 3OFFA 3KLIB 1RCXB 4JI3J 4U8YA 3G96A 3AJDA 3OPKA 5B09A 2RDJA 1DURA 4EBCA 3THTA 3EGZA 3M9OB 2PFFB 2CPFA 3BH7B 3PHTA 3E2EA 4UZCA 4DLGA 1EP4A 1M1HA 1IJFB 2CQCA 4P73A 1HNWF 1V5IB 2FVCA 3A8JA 4HYKA 2ILZA 2IY5B 4F25A 3HT0A 4CM0A 2V4JB 3T5HA 4JP8A 3M9NB 1RBAA 2MKJA 2KXNB 2HHWA 1U0SA 2PA8D 2ZH2A 2AF6A 3AA8A 1Q95G 4PWUA 1VBXA 3LOUA 1CVJA 3OVBA 3ILIA 4CLLA 5DG8A 5L1JA 5LSRA 2ZJPQ 3UNGC 4A8KA 4ICLB 3FSXA 2HHUA 1XR6A 4ELVA 1H0HB 2HK3A 1FTRA 3MMJA 3F44A 3HZEA 3ONQA 1NM2A 4USJC 3EE3A 4C11A 4CTAB 4DSJA 4LF8J 3GSDA 1UPMB 2A3JA 2PMWA 4HLBA 5F0WA 3PVXA 4KGMA 3BZQA 2KB2A 3UNYA 2GMHA 2DGQA 1RB0A 1WG5A 4U8VA 4DV4F 2AYBA 1CG2A 1WHVA 1TFWA 1NJXA 3HHLB 3LUYA 5H9FK 4TXSA 4E0DA 3TVKA 3R1HA 4XDCA 1CULB 2UXDJ 1SH3A 3O1LA 1NU4A 1OQ3A 2YKAA 1JJ2R 4U7UK 5KG0A 3KJVB 5LXYA 2ZD1B 2KJWA 2DBBA 3D6TB 1GAOA 2WVEA 3G2XA 1PYOB 5T7LB 4UOGA 2OHDA 5KFSA 2N4CA 1VQ5S 2YKNB 3OD2A 1KR4A 1FJGJ 1S0OA 1B7YB 2WBMA 4TVAB 3M1VA 4WKRA 1EKSA 3CGIA 3GIKA 4MKVA 1XR7A 2U2FA 4P75A 1DARA 1Q79A 2CZ9A 5IWAJ 5L38A 1HWIA 3KKFA 4USVA 3PW4A 4F4KA 1DLOA 2OPSB 2UVRA 2V67A 4S0MA 4AT1B 5EWGA 2GO9A 2KM8B 4LR8A 4EFAC 4YB5A 4J9MA 4CH1A 1D9DA 4DR3F 4C2MA 2KG0A 2M7SA 5KFVA 3EPGA 4K4UA 3H90A 3BPSP 3F0NA 3OTBA 4OJGA 2HRUA 4X84A 4CT9A 5L9NA 4LF4J 3DRSA 2KRBA 4IFVB 1PBUA 1UW4A 4OJ1A 5DZ6A 2W9AA 4M5NA 2FC8A 3ENVA 5EHHA 2B5JB 5D78A 2GCFA 1X9MA 4RW7B 4RNFA 2CRLA 1U2FA 1Z4UA 2P9GA 3TAQA 4MYUA 3PFOA 4W92B 1BWVA 1SPBP 3HSZA 3NMAA 1T11A 4NOHA 1HKAA 2BUNA 4YY3J 3IG1A 4DV5J 4GC6A 2GS8A 4R25A 5G0RA 2XCAA 2NSBA 5L9XA 3W8PA 1RXOB 2AYEA 2VKRA 3VCDA 1FDNA 3Q23A 1X4FA 5JXSA 3MD1A 5IXUA 5KTQA 3KTQA 5E3AA 1NDKA 5KFPA 3Q8YA 5F8HA 3DLEB 3GV5B 3QRPA 2QA1A 4TYBA 2IDEA 2OPQB 2Q6BA 2LXUA 3AOAA 2C2ZB 4QYZJ 5KT4A 4QBUA 3CWJA 2ZH1A 1F5BA 1JKHA 2G0IA 3QZ8A 5I4MA 1TAUA 4EZ6A 1Q4RA 1C1CB 3FBFA 2UV8G 4N47A 3TJAA 2QLJB 4X4OA 2E5GA 2GV1A 5D3GB 3SMZA 1X31C 5A6WA 2AV5A 3LANA 1R8AA 4DUTA 3BB5A 2VFSA 1ZZNA 1TP7A 2LQ8A 3IS9A 2HRYA 5CYMA 1OY9A 2MSTA 2QIFA 1IKXA 4Q2LA 1O0PA 3W66A 1DHMA 3MAQA 5KT3A 2ZD1A 1UVKA 2NYHA 1SV5B 1Q5YA 1B3TA 2G2OA 4MKBA 2YQ0A 4IOBA 2WW8A 4U95A 2W8KA 1XNRF 3QRRA 4PWDB 3K89A 1MMLA 4FYDA 4TQSA 3M32B 1UFKA 1YKWA 2VONA 3B6BA 1RAOA 1EETA 7FDRA 2B4VA 1TKTA 1BXNA 2PFDA 4I6WA 2IRUA 5BR8F 2HK2A 2IA0A 3A13A 5ETNA 2UP1A 3DLHA 3L3CA 1KLNA 2DY9A 2GMLA 3NY0A 3DM2B 4ZVSB 1TL1A 2IM2A 2ZBCA 4M63A 5IWAF 2IAJB 1PAUB 3EZOA 3M8PA 4ES3A 4IO9Q 1IBLF 1UVJA 4OHYA 2IPOB 4X4VA 2VQEF 2CWXA 3HHLC 1QDUB 4C3KA 5LMUJ 1GH8A 5HVFA 4ETZA 2RF2B 3LP2B 1AA1B 4LFCJ 1LXJA 3LWLA 1UWAA 5CQGA 5H9EK 5I3UA 1IBLJ 1IWGA 2DIVA 1FDDA 1P27B 2QLXA 1FFSB 4KGXB 3DM2A 3AB4B 4M5DB 2YXLA 3FMBA 3MCOA 3W60A 1SBRA 4GVBB 4N41A 5I3QA 3ICLA 3MPDA 1HYSB 1QAYA 2AKWB 4HKQA 3QIPA 2E1RA 3V6DB 5HP1A 1GK8A 2WRMA 1D1UA 1ZM2A 5IV3A 2AJ4A 2FLLA 2DNHA 5HAOA 5HLFA 3NOCA 2RIJA 5B0GA 2GVZA 1VIXA 3VAGA 2Y1RI 4DN0A 3BPDA 4IR1A 3DLBA 4JI6F 4ZVEA 1B70B 2QA2A 3AD9C 1TL3A 3FDSA 3H8YA 1HMVA 4KC5A 4MTPA 2LLZA 4JI2J 4WJBA 1NPKA 1ITPA 3PFEA 2PI5A 3KG0A 4DQPA 1J5OB 2W2OP 4WE1B 2FQQB 2Z2YB 4QYZK 2JFKA 1U1KA 4DV6F 1FI4A 1HNZF 4CWBA 3H98A 2VB6A 4UUXA 1MU2A 3KLEA 4LIRA 2DXDA 1NH7A 2J7WA 2ZH7A 2CQGA 2QLWA 3V81A 2HKEA 1GXUA 2M52A 2Q6CA 1NAQA 5EX0A 1SVDA 3A1YG 3JQKA 1M1KT 3DOMB 3FEZA 3BJYA 3BO2A 2LEBA 1RHJB 4JV2A 1UEUA 2DT9A 2M3DA 4O3NA 4DWIA 2UUWA 1KN6A 1FXRA 1YVFA 2O66A 4HT7A 2KH9A 2JWNA 1KWMA 5E41A 3R8YA 3GV8B 3CCMS 3QJLA 1WEYA 2MJUA 3TOQA 1OQ6A 2H65B 3GONA 3T9ZA 2G1DA 2MHEA 1TAQA 3EGWB 4YB6A 2KT3A 3UDVA 3HMJG 3G82B 4KKOB 4WZMA 3ZXWA 3ZZOA 1RWKB 3QATA 4YS2A 2DHGA 1XR5A 2BM0A 5GMDA 2BA9A 4CLWA 4ZLNA 3DLGA 2WB1D 4LSLB 1G7CB 4JI0J 3Q86A 1URNA 2KG1A 1HI8A 5DDRC 4WYWA 3CJ2A 4LFAJ 2YKNA 2MKYA 3EM1A 1MLAA 2YKMB 2HLTA 3CCRS 4YR0A 1FWKA 2L41A 2ZC3A 5DQGA 1IM6A 4LF9J 3U02A 2KN4A 2FC9A 4OI1A 4C0BA 2GGPB 5GMEA 5EWEA 3HLUA 4XO0A 1WWHA 1U0HA 4IG0B 1CBKA 1JLQB 4QPTA 4NX9A 5A8KB 3KHLA 2C3MA 2HSEB 5IC4B 3LAMA 2UU9J 3NNAA 4ZPVR 3C15B 1X9SA 1QE1B 5J2NB 2RVJA 2HGLA 2ZH5A 5DM6Q 1CSJA 4FF2A 5IT9U 1K1SA 4BWMA 4FXWA 3G8QA 3E3XA 5J2QA 5CZVA 2CJQA 5CABA 2DR5A 1YBTA 1B99A 1UZDA 1HARA 2WCXA 2UUCF 2HFSA 2AEMA 5A8KA 3TI0A 3IP0A 2NPFA 2BXJA 2EFVA 1KQGB 3G71S 1HMVB 2C1EB 1CPZA 2XO7A 2E9ZA 1YI2S 1BY9A 2R42A 3GLJA 3M2VA 2J0SD 2H9ZA 5LT5A 5GADU 1UEVA 2HZAA 4K8RA 3HSDA 2YWGA 4FDFA 3UVJA 2HWIA 9ATCB 3RBEA 4OX8A 3PEHA 3KLEB 1PC4A 2W4CA 3NNHA 3QGPA 1N56A 1UW9A 4FKXA 4M5HA 5KAKA 3U27A 2HVZA 1CS4B 2DHSA 4ID5B 1HNXJ 1HBOA 2BW2A 2L3MA 2DH9A 3FCHA 1FERA 1FWLA 2PIIA 2OTJS 5C2GA 4MKAA 3QJPA 2BE9B 2AYMA 2H1YA 5IZHA 2E9TA 1XMQF 1YRTA 1NXIA 4PKDB 4N77A 2HHVA 1N5QA 1S1VA 2V8DA 2QLBB 3N6NA 3NGUA 3NG8A 2K7JA 3PR5B 1UA1A 5F0UA 2N3OA 1NZ8A 2CQHA 2HYIB 3OV7A 1FRHA 4C8KA 4KPYA 1QVFR 2RMLA 3P49B 1CJKB 1YX2A 2ZWOA 3N0VA 4XDDA 2JH3A 3FZBA 1OJ4A 2FHJA 3LGHA 3MEEA 4TN2A 3V6HA 1VMBA 2YNHB 3OL6A 3NBPA 3JSRA 4Z7YA 1NSQA 4QCLA 4GVLA 4CLSA 2CQ0A 2XYGB 3BKFA 4ZVFA 3W8GA 2YH1A 2XHWA 2BQ3A 3C6UA 4DL0C 3Q0AA 2D1CA 5KFLA 1X5SA 2KXHA 3PG9A 1R27B 3S7RA 4WKYA 5HMZA 1JLFA 4EGLA 2RRAA 2CUYA 3M6UA 2Y8YA 1I6JA 3I5CA 4OFZA 1P9QC 4QYRA 2QLFB 3W2WA 3CD5A 3J7YU 2H5JB 2RE1A 1TL1B 4TU9A 4ZPDA 2DXEA 1IBMJ 2NXEA 3O2IA 3SQGB 2LU2A 5CYJA 3GIIA 2AQ4A 4KBIA 4V1Ak 1RWOB 4CNZA 1RWMB 1UL3A 5J2MB 1SQFA 3CEDA 2C2OB 3GPAA 4LMZA 5J2QB 1M0SA 1S97A 2I0XA 1FRMA 1FK9B 1X4GA 3PCOB 1HNIB 4R0EA 5FD1A 4N7TA 1ZZFA 3W9IA 3VAKA 1A9NB 5LL6d 2O01C 3KHHA 1TTHB 1JLGA 2L9NA 2MZJA 3MAAA 3M2UB 2PE8A 3R27A 5B0FA 3DOKB 1B64A 1YZ7A 2B9WA 5HJXA 5IV4A 1MWZA 4FKYA 2IM0A 3K5PA 3KUEA 4B3SF 3MZIA 3TQEA 3EX7B 1QAIA 1VK8A 3KYLA 3MDFA 1R31A 4NASA 3UVJB 3DLJA 3MUTP 1RT2B 4WCEQ 2W8LA 2WHOA 3BGUA 2EFNA 1WC5A 2OP5A 3CD0A 1YBUA 3D68A 4DV0J 2E5LJ 4Q2MA 3UE2A 4LRBA 1YSJA 4OZ0A 5K5MA 1TKZB 3SV3A 2AJQA 1CLFA 4ID5A 1QTNB 1YJUA 2HQ3A 2XTJP 4NYOA 3TYTA 3ISND 3NCPA 1N54B 2MLYA 5KFCA 3KLHA 1F9EB 2ZOMA 1RT7B 4N5SA 3AJ2A 3MF5A 1ZM4A 1VLOA 2HAIA 2HQDA 3UW1A 2RUSA 4BHQA 5T7LA 3ZTRA 3SV4A 1MU2B 1TQLA 2BX6A 4YR2A 2ZUGA 1LWXA 1LWEA 2BJDA 2VG7A 1WG4A 2YPZA 2ZFHA 3C8YA 2JJ4D 3WX4A 2P8IA 4DQRA 2FZKB 4RWXA 3OHAA 3HVTA 1IM4A 2V2QA 4C9DA 3VGVA 5HMYA 1NZAA 1RCOB 4F4XA 4X62F 4DR6J 1S1TA 4ANEA 3S01A 1IXKA 4G6VB 4H4OB 5HQMA 4X4PA 1CJTB 3BBFA 2YNIB 3GJQB 2JEIA 1TV6B 3DRPB 5B0DA 1NK4A 5KG6A 2B43A 4NLRA 4UQTA 3IFEA 2EBEA 1BQNB 5KFRA 3I56S 2YNFA 3A3OB 2ZM6F 1HPZB 4I6AA 2KFYA 3AQPA 3L7PA 2HHQA 1S1TB 2F40A 3L4BC 3TZZA 1U6ZA 5B0EA 3DRXA 2AD9A 1W2IA 3PJ9A 3KDNA 5HJYA 2HNZA 2VDHA 3DHWC 2B4PA 5ITHA 4PG4A 4F7VA 5HMXA 3HPOA 3J7ZT 3CO9A 2Y1JA 2IRYA 5KG7A 1CJVB 1RKJA 4Q8EA 3EZ5A 3HJFA 3F41A 4FVMA 1LNQA 5HVGA 2E5IA 4DX7A 4IUFA 4EO6A 1TL5A 4IH5A 3AOBA 5GAEU 1F6TA 1U0HB 3M8WA 2HHHJ 3CJKB 3M2UA 3PACA 3VZHA 1U1MA 2XQCA 4NCBA 1FKPA 3IBFB 4NZ6A 4DU7A 1F3FA 2GVDB 3UCZP 1AFIA 4NA2A 2ZVSA 3IR6B 2KFNA 3LP2A 3EYZA 3OR1A 2XNRA 1RT4A 4OYIA 4ECRA 5HANA 4OX7A 1S9EA 1RTZA 2HBZB 3DRRB 3I32A 3KK2B 1IUJA 2RB7A 4J9PA 4A48A 4FF1A 4X65F 3M2RB 3PTWA 4DV2F 4RW4A 4ICLA 2LVWA 3I9V9 4ZP8A 4OMFG 3NGSA 3MUMP 2HFVA 1X5PA 2OMLA 1GTHA 3DC2A 8ATCB 4OI0A 4ED8A 1I94F 4MAKA 2NLWA 3MMAB 3BDPA 3M8QA 1G1XA 4WF9Q 3A3NB 2XY5A 1I1GA 3D2WA 3CNQP 3VAHA 1RYRA 4OJHA 2P5VA 2YVSA 4PXCA 4ED1A 3P4UB 2ZEJA 1RTDA 4LFCF 4KO0B 2KDOA 3GFHA 3GJSB 2YWFA 4KHRA 1RAGB 4QIFA 4USIA 3BSCA 2HHTA 4HTIA 2UUTA 1OSCA 1U49A 1YLXA 1DTTB 1NDCA 1WF2A 2QL9B 4DBQA 4W98A 1AUDA 1C1BB 1S9GA 1NRKA 4NE9C 4Y28C 4ZHRB 1RHQB 1S0VA 5LMNF 4AD6A 2Y8WA 1U24A 3MM5B 4X66F 1RK8A 4Q0BB 4OI2A 1Q78A 3K5MA 1SKSA 4DCPB 3BSOA 3WHIA 4OX9J 3HFKA 1OS5A 2GZOA 2CPHA 4W4MA 4TNOA 2AEFA 5GMKa 4NRUA 2LA6A 4Y2AA 1XJWB 3OFHA 1HWKA 1KVKA 5J1PA 3QIPB 2KI2A 3MM5A 3UWTA 2RRBA 1WKJA 3IO1A 4HT5A 4U96A 5HATA 4B3MF 2WSFC 2HLUA 1WD6A 4IR9A 2DB1A 5F3TA 1VQLS 2PSZA 4QIWD 1EQMA 2R7OA 3W5YA 3QPIA 4RW9B 3UO0A 5KFBA 1HNVB 4CLZA 2HNYB 1ZETA 3ZZ0A 2HGNA 1NHUA 2R8KA 1JJHA 1KDNA 3E01A 4OYWA 5I3PA 4EBDA 5C24A 3SEOA 3C2PA 5CYQA 1S5ZA 4M95A 1AZSA 4O3OA 5DDPC 5CA5A 4CLUA 2BM1A 3V6JA 1N0VC 1SIZA 3TA1A 1JB0C
chains in the Genus database with same CATH topology
2VH7A 2CQ2A 2WONB 2BJEA 2JSXA 5L1KA 1CQMA 1N8RT 3J81Y 1R0AA 2RJZA 2IJNA 4DHVA 5B08A 5F3ZA 2BQRA 1D3WA 3MMBB 5E7OB 1YJ9S 4K5SA 1QE1A 2YNGA 4Y3CA 1SB6A 1QAXA 3J7A1 5K14B 4CO3A 2C22A 1N5TA 2CPJA 1FO1A 1MWYA 4GO7X 1KFSA 1Y3JA 4GKJF 4DEZA 2I38A 2VFVA 3BDEA 5C25A 2Z2MA 3OJUA 3HM9A 2B6AB 3SXLA 2KT5A 4F4YA 1ZOTA 3BF4A 3DN9A 5D4PA 1QLNA 1WI8A 2E5LF 2OTLS 1RTHA 2P9EA 1S48A 4AE5A 1B7FA 3KLHB 2EWHA 3CCSS 2R8GA 5HBMB 1QY7A 5KFWA 2FJVA 4FZVA 3P5TL 3K5LA 2IM3A 3DDKA 2YY3A 5J1NA 1UETA 1SJ3P 1U25A 2CKWA 1EETB 2JVRA 3VAFA 2R7UA 4AXJA 3US5A 3BQ0A 3SFGA 5C42A 4QWDA 5J1EA 1RDRA 2ROGA 2KT2A 1IKYA 2YWHA 2Z8QA 1ELOA 1ZAWA 2VQFF 3GFZA 3M6XA 4GC7A 1S1VB 4U67Q 4DS5A 3TARA 2AGOA 2XBPA 3VWSA 2D3UA 2LQ5A 2PI4A 5KOXA 3L7OA 4Y2KA 1N34F 4PG7A 4ED6A 2YX4A 3N01A 2DISA 2EG1A 2YNFB 3D5MA 1YIJS 2XS2A 1LWFB 2J9EA 3KLIA 4Q7AA 4I7FA 4ED3A 3MPWA 5AE1A 1VQ4S 3MPYA 3SCKE 4WFNQ 2R7RA 4NYZA 3HF5A 3M2VB 1ZPVA 3HVAA 5LXRA 1TK0A 5KFEA 3LW5C 5CHCB 3UPFA 1FHTA 1KSPA 3J80Y 2O67A 1TZ0A 4DUZF 4KHPF 1QM9A 4I1TA 5D4OA 1TL3B 4JI2F 3O44A 4OHWA 3AQOA 4I2QA 2JLFA 2DGXA 2XMTA 2JLGA 3FNNA 4GMKA 1L5UA 4CCHA 3CC7S 3B4MA 5FIIA 2HVHA 2LQBA 3H5XA 3AAWB 2RD5C 1X8DA 1RT4B 3EGNA 2ADCA 4K2XA 3OTDA 4C8YA 2QYCA 1NK8A 2CQDA 4PPDA 3MWBA 2MXYA 3ZC4A 1RT6A 2Y0SD 4JUZA 5F41A 3MGJA 4DL3A 4F26A 4KHMA 1FTCA 4OZNA 5GAHU 1H98A 4IYQA 3DHXA 3R5AA 3FVYA 3GYNA 3MEKA 3OJSA 4NXMF 4X4QA 3BS9A 2RKIB 2KRRA 4EBEA 2BRKA 4HTJA 2XG8A 5I42A 1FD8A 5EGYA 1FDBA 3SCIE 3R1LA 2I5JB 5KT6A 3FSIA 4FN5A 2I9SA 4HEA9 3MECA 2FIUA 1SC6A 4QOTA 1C0TA 1L3KA 2WBRA 2AU0A 4F50A 4QZVB 3FQLA 2VC0A 4H4OA 3KJVA 4TYAA 2LKZA 1YRXA 3GG0A 5ADZA 1U1NA 1U1OA 2MB0B 2ADBA 4B9VA 3QAUA 2ATLA 3Q8SB 2XI2A 2R9LA 3PXGa 2JL9A 3C6UB 3BSAA 2ERRA 3BGLA 5M2RA 4K4VA 2IA6A 4KKOA 4E98A 3HVWA 2YKQA 1Y5IB 3UDLA 2X1AA 4KGKA 4NL5A 3HVRA 4IRKA 1APSA 1FJEB 1QVGR 3RB0A 1HBNB 2D9OA 1M5OC 4Y65A 2ZH9