3MEGB

Hiv-1 k103n reverse transcriptase in complex with tmc278
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
424
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 103
structure length 404
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3megB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB03
2XC9A 2YKMB 3DLKB 2CJQA 5KT6A 1S9EA 4MK8A 1U09A 1SH2A 1S0NA 4MH8A 2R8KA 1S6QB 5J2PB 2FLNA 5DQIA 4KBIA 1NHUA 5KFZA 1N6QA 1S1UB 1HNVB 4TN2A 1RT3A 2GIQA 3FQKA 1C1CA 4KE5A 4M94A 4ICLA 4B3OA 4K4TA 1VRTB 2VG7B 1ZTTA 4ZVEA 1T03B 2W7OA 1T05B 2QV6A 5J1EA 2IM1A 3IGVA 3IG1A 3KLHA 2UUWA 2I1RA 3LP0B 2BANB 3MEGB 5HLFB 3KHGA 2B6AB 2ZKUA 3CJ0A 4ZPAA 3DM2A 3JYTB 1C0TA 1JLEB 4LSLA 1JLAB 3DRRA 1TKXB 3CWJA 1IKVA 4EBEA 2R8JA 2RF2B 1DTQA 4XPCA 1GX6A 4XO0A 5JUMA 1S6PA 1BQNA 2VG6B 5KG2A 5C24A 2B43A 1RTJA 1HQUB 2BE2B 3QLHA 4I7FA 4H4MA 4NLVA 1JIHA 1S1XA 3E01B 1QAIA 3PR5B 1S97A 4Y2CA 2EC0A 1TVRB 4QWBA 5F8MA 4ECYA 3TQ1A 1TL1A 3V6DA 2R8HA 2ILZA 4NLGA 1RT2A 2ZD1A 2BQRA 4IQXA 5KFQA 4IKAA 1LW0B 4QW8A 5KFTA 3Q8SB 2HMIA 3PZPA 4RW4B 2BQUA 1S0OA 2FJWA 4WFYA 1REVB 2R2UA 4YP3A 3LP2B 5EDWA 5HP1B 4Y34A 2BR0A 3LAKA 3M8QA 4IRCA 2OPPA 4Q0BA 3N6MA 3G6VA 4I2PA 1HMVA 3HKWA 5KFNA 5KFPA 3KMSA 1QE1A 4JV2A 1JLGB 3BQ0A 3CJ5A 5KFBA 5DG8A 2ASDA 3NBPA 5KFJA 4RZRA 1JLCA 4F4WA 4ED6A 3DOLB 3PJXA 5L1KA 5C5JA 2BRKA 3DLEA 4QPXA 4QWAA 1RT1A 4IG3A 1NHVA 3FRZA 3M9NB 1S9EB 4X2BA 3H2LA 1TKTA 1OS5A 4O3OA 3OSPA 2ASJA 3PVXA 5D3GB 2C28A 3FSIA 4YMEA 1I6JA 3MTKA 1IKXA 4Q8EA 3IN5A 2AGPA 2UVRA 2HWHA 5DQGA 1C0UA 1C1CB 1EETA 4M95A 4ICLB 4B3OB 2GIRA 4TYBA 1DLOB 3OHAA 4EO8A 5KFFA 3DRPA 4ECSA 5J1EB 4KHMA 5DGAA 5FDLA 5F8GA 3IG1B 3KLHB 3EPGA 2RDJA 4RNFA 1MMLA 4RNMA 3DM2B 5KFRA 1C0TB 4LSLB 3CJ3A 3DRRB 3KK1A 3KLIA 3QIDA 1IKVB 1T05A 4TXSA 4O3NA 2W8KA 4WFXA 3LP0A 5F8NA 1HNIA 5C24B 5DG9A 2WK4A 2JLEA 1RTJB 4EYIB 4ED8A 5KFUA 4FBUA 1IKYA 2RKIB 3QLHB 4H4MB 4I7FB 1RA6A 3QGIA 1S1TA 3GV7B 4G3IA 1S1XB 3I5CA 3G86A 3QO9B 4QWEA 3RBDA 5CYQA 2VG6A 4MKAA 3I5BA 5KFVA 1S9FA 2R8GA 3KJVA 4ZVHA 1S9GA 4R5PA 1XR6A 5DLFA 1TP7A 1HQUA 1TL1B 3V6DB 5KG0A 4IR1A 2E9TA 1RT2B 5KFLA 2ZD1B 4Q44A 4O3RA 3E01A 4NLDA 2HMIB 3QYYA 3GIKA 2ASLA 2F8EX 4TYAA 2W9AA 5KT5A 4MFBA 3H5UA 3M9OB 3M8QB 4JV0A 4ZP8A 1FKOA 4RW4A 1HMVB 3GV5B 3RBEA 1QE1B 1LWCA 5I3UB 3NBPB 1QUVA 1JLCB 1HQEA 4O4GA 4MKBA 5J2QA 2AU0A 5HP1A 2AGOA 4KFBA 3DLEB 4EBCA 3IGNA 1RT1B 1NNDA 4IG3B 4ZPBA 4URSA 4NRTA 2UVUA 3MEDA 3RB3A 1TKTB 2FJVA 5T14A 1RYSA 4IR9A 3KHRA 5KFYA 4O44A 4H4OA 2FVSA 3H5XA 4R0EA 4ZMMA 4RW7B 2AWZA 2ILYA 4NLWA 1IKXB 4KKOA 5F9NA 1N56A 3DYAA 3CIZA 4YR3A 1C0UB 1EETB 4K4YA 5D3GA 4KAIA 3OL7A 3PW2A 3DRPB 2WCXA 1LWFA 5FDLB 4URGA 2QE5A 4Q43A 4YQWA 2J6TA 4Y3CA 4QWDA 1JLFA 4NLUA 1TKZA 1DLOA 3KK1B 3KLIB 3DDKA 3TAMA 1S4FA 5I42A 4KHRA 1S49A 5HBMA 4QWCA 3KHLA 1TL3B 4ECXA 1VRUA 4DL7A 4TQRA 1S1WA 3CDWA 3HVWA 2JEIA 1HNIB 5KG3A 1T3NA 4J9KA 3LANA 2R8IA 1RA7A 1IKYB 4NLPA 1S1TB 1BQMA 2FJXA 5CYQB 3KJVB 1S9GB 4R5PB 4O4RA 3OLBA 4GC6A 3KLVA 1LW2A 4ED2A 2RKIA 4MIAA 4K4XA 2FLPA 3CDEA 1W25A 3QO9A 4J9LA 3KLEA 3H4DA 3V81B 4F4ZA 4Q45A 5KT2A 2IMWP 3MECA 2CKWA 5J2NA 4MFBB 3RAXA 2YKNB 1JXLA 1RTDA 2D7SA 1FKOB 3OSNA 1LWCB 4JUZA 3H40A 3ITHA 4O3QA 4FS1A 1HQEB 4O4GB 1KHWA 2V4QA 5J2QB 2UVWA 4FBTA 4NLYA 4J9RA 4KFBB 2ATLA 3V6JA 2JEJA 3NAIA 3NKYA 2J6UA 3DOKA 3MEDB 2XCPA 5I3UA 4F50A 3BGRA 2OPSB 2O5DA 4O44B 4H4OB 3QGHA 1RT6A 2DPJA 4R8UA 3CJ4A 3NAHA 4KKOB 2OH2A 3BR9A 3DYAB 1T94A 1DTTA 3DLGB 4LSNA 3CVKA 3C6TB 2W9CA 1C2PA 3KHHA 3RB6A 4ED0A 1UWBA 5KT7A 3OL9A 2IBKA 4RW7A 4J9SA 1N5YB 1LWFB 3TVKA 3JSMA 5EWGA 4RW9B 1JLFB 3VQSA 1TKZB 2V0NA 1SH0A 2C22A 3TAMB 5I42B 3KK3A 5HBMB 4NRUA 1VRUB 2W9BB 4IRKA 1S1WB 3HVAA 3H5SA 4RNNA 4F4YA 5J2MA 1WNEA 1RTIB 2R2SA 3E51A 4WZMA 3KLFA 2VA3A 2WRMA 3T5KA 1S0MA 4KV8A 1BQMB 1TL3A 2FVRA 4WXOA 5EWEA 2R2RA 2IAJA 3V6HA 2GC8A 2IJFA 4IH7A 3Q8PB 3Q8QB 2UVVA 1LW2B 4K4WA 1KHVA 4I2QA 2VA2A 1RTHA 2HNZA 1SV5A 2OPRA 4EYHB 3KLEB 5KG7A 3LP1A 1CSJA 3MR2A 3MFIA 4K4UA 3MECB 5C25A 1K1QA 2UUTA 1HARA 5J2NB 4HKQA 3CO9A 1RTDB 3G6YA 2FLLA 4H54A 2IC3B 1R0AA 3BSNA 3T5HA 3V81A 4ECZA 3I0SA 3PW7A 3ICLA 4ZPCA 2YNIB 3ITHB 1RT5A 1EP4A 4WXWA 2HNYB 2YKNA 3OL8A 3SFGA 1LWEA 4J9MA 1C1BA 5C42A 3DOKB 5CYMA 5HROB 2FVCA 4PQUA 3BSCA 2RDIA 3KOAA 2HNDB 4U7CA 5DLGA 4TY9A 4IG0A 3BGRB 4LQ9A 4ZP6A 3NGDA 2R2TA 2XGQA 3FDSA 1RT6B 5EUHA 2V9WA 1YVFA 3QGGA 4R8UB 1TQLA 3RAQA 4JV1A 3MEEB 4RW8A 1DTTB 4ECRA 5L1JA 3QZ8A 1SH3A 4LSNB 2I5JA 3M9MB 3OL6A 2W9CB 4EBDA 2DPIA 2OPSA 1UWBB 3MF5A 3GQCA 1GX5A 2ZE2A 3M8PA 1D1UA 3EZUA 3HVTA 3D5MA 4TQSA 5KG5A 3JSMB 3PR4A 2AGQA 3DLGA 3KK2A 3C6TA 3DI6A 3GIMA 3ISNC 4ECVA 1J5OA 3BQ2A 3UPFA 2HWIA 1N5YA 5F9LA 3KK3B 1RT7A 1K1SA 1S48A 5KG6A 4RW9A 3PHEA 1MU2B 3SFUA 4YR2A 1Z4UA 5J2MB 4DL5A 3PW4A 4IFVA 4IOBA 3QZ7A 4IDKB 3KLFB 2C2RA 3IRXA 3I0RA 3KLGA 3DRSA 4KV8B 4ZPDA 4KB7A 3BJYA 2AX1A 3N6NA 4ECWA 5EWFA 2W9BA 2IAJB 1RT4A 1RTIA 1RDRA 1JKHA 5F8HA 3LAMA 4I2QB 5KFAA 1RTHB 2HNZB 4XPEA 1SV5B 1SUQA 2OPRB 2IA6A 4NCGA 5KG1A 3BQ1A 4J9NA 3LP1B 2HAIA 2IM2A 5F8IA 5F8JA 4ID5A 5C25B 2FVQA 3I5AA 3PJWA 5KG4A 4TY8A 5KT4A 4URQU 1R0AB 3GIIA 5L1IA 4NLRA 3EPIA 3I0SB 1S10A 2E9RX 3N6LA 3G6XA 2IM3A 2WB4A 1IM4A 1RT5B 1EP4B 1ZTWA 2YNGA 1FK9A 3LALA 1LWEB 1TV6B 4DG1B 2IC3A 1C1BB 5K14A 3KNAA 5C42B 5CYMB 1QAJA 5KFCA 4PQUB 4IRDA 2YNIA 5L1LA 2IM0A 3H59A 4IG0B 4PUOB 2HNYA 4MIBA 4NLSA 4TLRA 4PWDA 4RUCA 4KO0A 3MR3A 3BREA 1KLMA 3FQLA 5HROA 4RW8B 2OPQA 2VG5A 1JX4A 2WONB 2I5JB 4IH5A 1JLQA 2HNDA 3BSOA 1HYSA 2IJNA 2YNFA 3QIPA 4WYLA 2ZE2B 4DL2A 3M8PB 4DL4A 3BSAA 1FKPA 3KMQA 3MEEA 3PW5A 3HVTB 2XI2A 4RW6A 3UQSA 3FFIA 1HPZA 3KK2B 1S1VA 3DI6B 3C6UA 3V4IA 3MR5A 5DQHA 3PW0A 3T1AA 1J5OB 4GC7A 2E9ZA 2XI3A 3DMJA 3RB4A 1RT7B 5KFIA 1JLBA 4MK9A 4K4VA 5KFWA 4WE1B 4IFVB 3CDUA 4IFYA 4ZHRA 5KFEA 3IRXB 3I0RB 3NL0A 3KLGB 4K50A 4K4SA 3DRSB 2JC0A 5F8LA 1IKWA 3IS9A 2YNHA 1D0EA 2B5JA 1MU2A 4EEYA 1RT4B 4O3SA 2WOMA 4Y2AA 2BRLA 4IDKA 1JKHB 5L9XA 5KFKA 4FS2A 1SUQB 4ED7A 4NLXA 4NCGB 4G1QA 4ZVGA 3H5YA 5KT3A 1ZETA 2YKMA 3DLKA 1N6QB 2WHOA 5KFSA 4LQ3A 4DL3A 4ID5B 1RT3B 3MR6A 2V4RA 3GILA 1S6QA 1N48A 2JEGA 5J2PA 4TY8B 4ECQA 2FVPA 4ZP9A 4O3PA 4U6PA 5KFXA 3D28A 3H98A 3MFHA 3T5JA 5DG7A 3Q8RB 3V6KA 1S1UA 1HNVA 4KSEB 4ECUA 2YNGB 1RYRA 5KFMA 2C2EA 1FK9B 1VRTA 2VG7A 5K14B 3CJ2A 3NMAA 1T03A 4Q8FA 1DTQB 4J9PA 4ED1A 4ZP7A 3HHKA 1S6PB 1BQNB 2D41A 4NLTA 2BANA 3MEGA 4KO0B 5HLFA 2B6AA 1TV6A 4DG1A 4PWDB 3JYTA 4IH6A 3OHBA 1JLEA 1KLMB 1JLAA 2D3UA 1TKXA 4RNOA 1XR5A 2OPQB 2VG5B 4ED3A 3T5LA 2RF2A 4DEZA 1JLQB 2W7PA 4NYZA 4PUOA 1HYSB 3UDLA 2YNFB 3OLAA 4RNHA 3QIPB 3GYNA 3GV8B 5KFDA 2AX0A 1FKPB 1RAJA 5KFOA 2ALZA 2XWYA 2BE2A 2AQ4A 4F4XA 3ISND 4RW6B 4WFZA 3FFIB 5JXSA 1HPZB 2WONA 4ECTA 4DL6A 1S1VB 4YR0A 4RU9A 3SI8A 2JEFA 2W8LA 3C6UB 4RUAA 3V4IB 4J9OA 4QW9A 1TVRA 2XCAA 4NLOA 3DMJB 2BQ3A 1JLBB 4ZVFA 5DGBA 2WTFA 3UR0A 2OPPB 1LW0A 4Q0BB 4WYWA 4OL8A 3T19A 5KFGA 4I2PB 3H4BA 4IFYB 4ZHRB 1REVA 1IKWB 3IS9B 1XR7A 2J6SA 2YNHB 3LP2A 4J9QA 4WZQA 2B5JB 5KFHA 4HYKA 1N4LA 4WE1A 2WOMB 2XGPA 1JLGA 4MK7A 3RB0A 2C2DA 2D3ZA 2JC1A 3DOLA 4K4ZA 4EO6A 4G1QB 4NLQA 4NZ0A 3GIJA
chains in the Genus database with same CATH superfamily
3DLKB 2HLTA 1SH2A 1M1HA 4KR0B 3I32A 2HFZA 1I94F 3FQKA 4ILRA 4PG6A 1T03B 5AJ3J 2V4JB 3MM8A 3OFHA 3DM2A 1VS3A 3P5TL 2MYFA 3ZC4A 2P9CA 2WVBA 2AV5A 2VG6B 1BQNA 4C48A 4NPOA 4I7FA 3A8IA 3W3SA 1QDUB 4QWBA 3Q23A 2E5IA 2UU9F 3JQMA 4OYOA 2R2UA 1FHTA 4NYPA 4QPXA 1YJ7A 2VPWB 3WC0A 3M32A 4YDXA 3KNGA 2DRDA 5LMNF 3GSIA 3IN5A 2D3O1 3A8KA 3OHAA 1UCNA 2OD6A 2QFIA 2CQPA 4MT1A 3UVJB 3LP0A 2DIVA 1VJWA 4ELTA 3I5CA 2KM8B 5H9FK 2HHQA 5KG0A 2B9XA 2XZDB 1WC4A 3TR5A 2F8EX 3CD5A 2MHNA 4FYVB 4DPYA 2HK3A 1MWZA 2G0JA 4DR3F 2AU0A 2ATCB 2GAHC 4KFBA 2GMHA 1QVGR 3KG1A 3H5XA 4RW7B 1HI0P 1OQ3A 2WSFC 7FDRA 1YSJA 4QCLA 1XQIA 3CCMS 2KVIA 1OIAA 1S4FA 3BGFA 5HBMA 3CJKA 2LP4A 1WKJA 3SBMA 3M1VB 1IKYB 2APOA 2Y1JA 2N7YA 3MPWA 2ZITA 4MMOA 1N5TA 2HQGA 4DDFA 3BBFA 1M0SA 3OTBA 4O3QA 2BX6A 2JEJA 4DZ6A 3K8WA 2Z2MA 1Q8BA 2O5DA 2DY1A 4WJBA 4LBPA 2VOOA 3P3DA 1T94A 3R8YA 2PI4A 3BH7B 3WQPA 1FWKA 1UA1A 4ZJLA 3OL9A 2EVZA 3PDNA 3QAUA 1IN0A 2CADA 2LLZA 5IT9U 2DR7A 3HVAA 3E51A 2EG2A 2WZ1A 4DLEA 2R2RA 3V6HA 3Q8PB 2UVVA 3RBZA 4I2QA 1FRXA 2BJ9A 2K1RA 2ZH4A 4MYTA 1YWXA 3HJVA 3V81A 1TAQA 3OTCA 1ZAXA 4ZPCA 4WXWA 3ISZA 3TAPA 4P71A 5C42A 4O23A 3W2WB 4HR2A 1IBKJ 4F0KA 3TJ8A 3NXZA 3RAQA 1F1BB 4LSNB 2QJ3A 5BYRA 1D1UA 3JSMB 5IOLA 5AXKA 3J7YI 4DV0F 4ECVA 3OR2B 3SFUA 1YBTA 3EE3A 3IRXA 3I0RA 4LRCA 2J9DE 3CSKA 2CQIA 4HTIA 1XK8A 4ECWA 5H1SV 1UFKA 4L3KA 4CLLA 1RTIA 3EXCX 3D6HB 3HVRA 4NA3A 3LAMA 1TAUA 5KG1A 4N56A 1AFJA 2IM2A 1N54B 5C25B 3TO8A 1U25A 2HGMA 5DJBA 5DDOC 4V1Ak 1LQ9A 2XB2D 1LWEB 1TV6B 1I51B 3M2UA 4PUOB 1SXLA 4RUCA 3RYLA 3M6XA 4JI4J 1U1LA 1VISA 2LQBA 2CVIA 2W7AA 2HNDA 4OX6A 3AQPA 1G7CB 3BBBA 4DN0A 2DR9A 3W9HA 1X5SA 5KFIA 3W1YC 4LF9F 2XEXA 2IYGA 2JC0A 1Q4RA 2N82B 1CS4A 5ETLA 5L9XA 1SUQB 3TYTA 2N3LA 5KT3A 1PC4A 2QEXS 5C2CA 2JEGA 1XNRJ 2XWXA 3C15B 2Z30B 4JOUA 3ELHA 3W2VA 4HEA9 2B9YA 3QWUA 1VJQA 4Q8FA 3W60A 4NLTA 4UOHA 3MHYA 1NO8A 2D69A 2W7PA 3OLAA 2Y3YA 5KFDA 2N4DA 1FKPB 3DHWC 2XWYA 1IBLJ 3JQKA 4RU9A 3HT3A 1OMSA 4XDDA 4JI2F 2IYIA 2CPEA 4OL8A 3SQGA 4PWWA 2YNHB 2DHAA 4LVOP 4ZCKA 3MAHA 3U27A 4X4OA 1X4CA 4MH8A 5LOQA 4WK1A 1CJKA 2YXLA 3B78A 4M94A 4TLQA 1SC4B 2Z2ZA 4I1TA 2PC6A 1SJQA 3EZOA 1S5ZA 4UUWA 2UUWA 4CNZA 2BANB 3LA0A 3CB4A 4RLEA 1QM9A 5JUMA 3AJ2A 1FX2A 1ROFA 1WHVA 1KQFB 5KAKA 5IT0A 4NLGA 3D1HA 1W2IA 4OI2A 1N33J 1WSRA 1EARA 1QAXA 5HATA 4N47A 4OHXA 3H2LA 3DRXA 4A8OA 3ZZTA 4YMEA 4ZIWA 4OJ1A 3QSYB 3TA1A 3IAS9 3LGHA 5CD4A 4NXNF 1MMLA 3DM2B 2KT2A 1HNIA 5DG9A 3K58A 4I7FB 2PFDA 4JI6F 2G9OA 4EWTA 4UQGA 2AD9A 3CCRS 4CQ1A 1AUSL 4OYWA 1MWQA 1FVSA 4C9DA 4LFAF 3PX0A 3PKYA 5J2QA 5K8NA 2AGOA 3UNGC 3N5FA 4U96A 2QN6B 1SKSA 2BW7A 4I6AA 2RUGA 3GLJA 3M32B 2FVSA 1LFPA 4ZMMA 1ZBTA 1IUJA 3NOGA 2OJ3A 1F2GA 4L6V3 2QMXA 4BBYA 4PCQA 2EI5A 2CZ9A 2QL9B 4Y3CA 2V8DA 2RSQA 4TNOA 1HKAA 1YLXA 1KVKA 5AE3A 1BQMA 2BJDA 4DPWA 4ES2A 5IFMA 1NDPA 1SQGA 1VQOS 4NCAA 4U8YA 2QL7B 3BBCA 1TELA 2CKWA 2VBZA 3RAXA 3MAAA 3P45B 5JMNA 1NJWA 1X0FA 1F2HA 1GXTA 4FS1A 2OGUA 4KFBB 1XC9A 1U6ZA 1VQYA 4NEYA 1OSCA 4YHHF 3C16A 1R89A 5CZVA 4UY85 5B7WA 4UOGA 5B0DA 2Y0SD 3TZZA 4DR5J 3CJKB 5HBMB 2HZCA 4B9TA 1WNEA 5J2MA 2WRMA 2H5IB 3L7OA 2Y9HA 3Q8QB 2YQ0A 5L38A 1NZAA 1VHIA 4WU2A 3GCXP 4OJGA 1I94J 4ECZA 4LRDA 4W90B 2NZCA 1XTZA 2P6SA 3P49B 4NZ7A 1LFWA 1UPMB 3QGGA 1FA0A 4ZIVA 4ECRA 2U2FA 4ZCIA 2G1HA 2FDNA 4RUHA 2VPZB 1RT7A 4L73A 1MU2B 2BMBA 3BJYA 4USHA 4DQRA 4ILMA 4DF8A 4I2QB 4XPEA 4J9NA 1JJ2R 1NKBA 4G1IA 5LMNJ 3I5AA 1FNOA 2K1RB 1FDDA 1IR1A 3M4XA 3EPIA 1VFJA 3EDQB 2MSTA 2ZC3A 5C42B 4CI0B 4UTGA 5E3CA 2JHEA 2ZJRQ 1BY9A 5LJ3Y 3D4JA 3MUTP 5DZ6A 5AXLA 4IH5A 4DR6F 4OZ0A 2F4FA 1PJ5A 2XI2A 1S7IA 1DRZA 2D9OA 2PO4A 2MXYA 4JP8A 3CCTA 2ABYA 2DNYA 4K4VA 4M5KA 2CPZA 4ZHRA 3IRXB 3I0RB 3NOCA 1W2BR 3PX6A 1NK7A 3JB9k 2ZKTA 4N77A 3RR8A 2WOMA 4PXBA 4AQYJ 5KFKA 1UEKA 5HO4A 4ZKAA 2ZVIA 4B9UA 3HD1A 3QFHA 3LH2S 1HNVA 2MZ1A 3TUJC 4ED1A 3NNHA 2NQPA 3PIOQ 1R8CA 1PSDA 2GQQA 4ED3A 1PKUA 5L39A 2ALZA 5JXSA 2DJWA 3H0PA 2FTRA 1NHKL 2HYIB 4I6YA 2KG0A 4KRWA 2BYCA 1LXNA 3R6GB 2QYCA 2Z58B 1CS4B 1HLWA 1RAFB 2MPUA 1VQ6S 2OD4A 3D0HE 2XMVA 3W2VB 1KLNA 2KHDA 2OELA 3RAMA 3DDIA 4JI0J 1V9OA 2BKOA 3DRRA 2R8JA 5HMXA 2CYYA 1CBKA 4F2SA 4YB5A 5D4PA 2HHHJ 1PYTA 5F0UA 4DS4A 4JI5F 2HIYA 2AJ1A 4QW8A 1N0UA 3SQGB 3I55S 2BM1A 1FKAF 1HI8A 3RRHA 5DDQC 2V69A 5KFNA 1JLCA 3CUNA 4ED6A 2KTQA 4X4TA 3DLEA 3R9LA 4DV1F 2YWEA 5D3GB 1CJKB 2HWHA 5LSOA 5B0AA 4DV0J 2H1YA 5I4MA 1NJIT 4AT1B 2JVOA 2YX7A 3TOQA 1Y11A 1VR6A 4CH0S 4QWEA 1PILA 1BWEA 1H2TZ 3V2UC 2YX1A 2VH7A 3GFXA 1HQEA 4MKBA 1KQSR 1RWUA 2E7XA 3VAMA 4KKOA 4DOZA 2NPFA 2BXJA 1Q8KA 1JJCB 4DSJA 3TEHB 1FTCA 3ENWA 4BS2A 2LXUA 1X5PA 4FP9A 2ZH1A 1DQ9A 5JVHQ 4TQRA 1HNIB 4F25A 1KOOA 2DGOA 1VQ8S 4ZJOA 2FLPA 1GQEA 1YJNS 2GO8A 2QA4G 3GP9A 1KQKA 5D8HB 3KUGA 1JXLA 4KGXB 5A0YA 3GPAA 5G0RA 4FN5A 2VDHA 4C3MA 1X0PA 4HHUA 2V4QA 5J2QB 4HLBA 4I0WA 2BVZA 5GAGI 1M5SA 2OMOA 4ED0A 3PFEA 4F2RA 3PX4A 1OO0B 3PRVA 3NCQA 4WTOB 2V0NA 2KH9A 3GJQB 3W64A 3UCUP 3ZZZA 4F4YA 1BQMB 1KP6A 2HQFA 5KG7A 3MFIA 4DR2J 4K2JA 4CLWA 3CO9A 3MAAB 1TUGB 1RT5A 4G6VB 2WVCA 1NSQA 4E2FB 4ZVUB 1Y10A 4F3QA 5DLGA 2XGQA 2Q43A 3NEKA 3M9MB 2BACA 2KJWA 2QRRA 1J5EJ 3GQCA 4WFBQ 3C6TA 2KDOA 1K1SA 4ID8A 5J2MB 2Q6BA 2XTJP 3HSJA 2VF3A 2YQ1A 3U7JA 3HJFA 1ACMB 1MLAA 1HW8A 3EVWA 4U8VA 4AD6A 5AT1B 4UW2A 3T41A 1D3WA 3N6LA 1IM4A 1RISA 1U1RA 3IWNC 1B7YB 1BLUA 2CVEA 2DHXA 2XS7A 4OI1A 1KLMA 2VG5A 1HNXF 1HYSA 1Y9OA 3BSAA 2HBQB 3V4IA 1HWLA 1RT7B 4MK9A 1A0OB 3G87A 3TWZA 1IQTA 2ASYA 2BRLA 5A8WA 4FS2A 4NLXA 3A3PB 3G8QA 4PZVA 2HFOA 3D6MB 3SSRA 5KFXA 3D28A 3MMBA 4CIOA 1NB7A 4MYUA 4LIWA 3I6PA 3D2WA 4ANEA 1P9QC 1VC6A 3GV8B 2G13A 1PJ6A 4QR2A 3IFEA 3BGLA 4DX6A 4AE5A 4LRFA 4WYWA 1U49A 4ZHRB 1FJEB 3FC9A 3EX7B 2WOMB 1KC8T 1V3RA 3R5JB 4K4ZA 1K0TA 3EVMA 2CJQA 5KT6A 3IR6B 1RLDA 4BWMA 4ZLPA 1CEZA 1Q82T 1ZA1B 4DV3J 3D6FB 3D67A 1HNVB 2J7KA 1UEVA 1HD0A 3D54A 4A8QA 3IG1A 1NCLA 2ZKUA 1BC6A 1PC5A 4A8XA 1GX6A 2VASA 1N5QA 1ZOTA 5E2QA 4Y28C 2HS3A 2XMMA 2HK2A 3V6DA 2H51B 3SMZA 1P1LA 3PZPA 1LK5A 1UVKA 5KTQA 1QTMA 4IRCA 1UFWA 1Y0HA 1YITS 1QY7A 2B9WA 4I6WA 2C3PA 4OLOA 1S6UA 2XO7A 2ZJPQ 4OV1A 2WBMA 3J7ZT 1K0VA 4ECSA 5FDLA 2KN4A 1FO1A 2EFVA 1MSWD 3DRRB 3QIDA 1XNQF 1RAIB 3HHDA 2RKIB 1S1TA 3PACA 3CJTA 2LKZA 1PG5B 1RQ0A 2I0XA 5KFVA 2R8GA 3KJVA 3MPUB 2IY5B 4CT8A 3DLBA 3CC2S 3ILJA 3K5MA 4TYAA 5ETQA 3AOCA 4JV0A 4CO1A 1JLCB 4O4GA 3JQJA 3W61A 5HP1A 2CJ9A 4MTPA 3DLEB 4USJC 3MCMA 4URSA 3MEDA 3H25A 2FJVA 4IR9A 3HT0A 4DL0C 4OV6A 3MR7A 3CIZA 3OTOJ 3QMQA 1VIXA 3G82A 3SCJE 3JTOA 3N5BA 2JLGA 2ZJQQ 4ECXA 1WHYA 5FJ4A 3HVWA 2R8IA 2CG4A 2Z2LA 1FCAA 1L5UA 3K5NA 2RMLA 3SIPB 5KT2A 4DMZA 3I31A 3B82A 2GJ2A 1HQEB 3H7HB 3G6ES 4J9RA 2GS8A 2ATLA 2GW8A 3AB4B 3BGRA 2ZDPA 2RD5C 4PYDA 4DHVA 4KKOB 4C97A 1KS2A 1OPZA 3UDVA 4DPOA 3NWRA 2QL5B 4UT4A 2JZ5A 3CMES 2MQPA 4AL5A 4KV8A 3K5LA 3TA0A 1OJ4A 3TW0A 8ATCB 1GNKA 1E6VA 1R7IA 4ATNA 1N32J 3J81Y 1S72S 2MTLA 1KTQA 2O1PA 2A3JA 2C42A 2PSZA 5A0YB 2FLLA 5G0RB 3F73A 1EP4A 2R7WA 1QTNB 4J9MA 3IAM9 4MJKA 2DEJA 3QWPA 2V9WA 4YOEA 4ZPWR 4LBHA 5D4OA 4JI5J 4RO0A 4LRBA 3BPSP 2MZJA 1FFWB 5KG5A 2CQDA 2F5GA 4TU8A 2D9PA 4HI2A 5F9LA 4LF7J 1L3TA 3R1HA 2AX1A 4FPIA 2EKYA 1CJVA 2CA9A 5F8HA 3DGVA 2EK1A 1RU2A 2ZOFA 5KG4A 2BABA 3MAQA 2G2ZA 1RT5B 2IMOA 4B02A 5THWA 4NLSA 4GRSA 3AAWB 3BSOA 3P6YC 5D77A 4I64A 2AF6A 3CDUA 1VBKA 3L95X 1Q16B 1IKWA 3BO2A 4EEYA 5CYJA 1KR4A 1U45A 4PAAA 1IWGA 3CJ8A 1ICEB 4Q5VA 4FVMA 4DV6J 3BZQA 2RQ4A 3NRBA 4J90A 2HHSA 2D3OR 2CJKA 2VG7A 2H3EB 3ZZUA 5LMUF 2ZM6J 2ADCA 4LRAA 9ATCB 1RJJA 1KLMB 2VG5B 2E1CA 3FCVA 1HYSB 3SV3A 3BS9A 2V2VA 2DH9A 2W8LA 3V4IB 1S79A 2L41A 3F44A 1S6OA 5HQ8A 4J9UE 4JV5J 2C3OA 4X4QA 3Q86A 4LF5J 2DH7A 3GSDA 1FTRA 2A2CA 2XY6A 5A8WB 3RB0A 2D3ZA 2JC1A 3ZZRA 1WSVA 1UEUA 3OXGA 4CM2A 3UN3A 3JTPA 3MMBB 1RT3A 4ICLA 3HFZB 5HQMA 2C1EB 5J1EA 2IM1A 2VQEF 3IGVA 1RI7A 4DSFA 4OZ5A 1RTZA 1ITPA 3D9BA 5FLXY 1TK0A 3UDCA 1RTJA 2KT5A 3HSDA 4DR7F 4Y2CA 2ILZA 2ZD1A 2BQRA 4UZBA 4K59A 4RW4B 2RQCA 3K89A 3W62A 1GEHA 3MURP 2XYHB 1TKTA 1X4BA 3PVXA 4Q2MA 2UVRA 1NXIA 2NR0A 1DLOB 5DGAA 1FWLA 3JSBA 3IG1B 3FZ2A 2XLKA 4LFBJ 3K8VA 1H7WA 4ED8A 3M6VA 2VBXA 5T41A 5ETNA 4R5PA 1TP7A 3V6DB 3NMRA 4CLTA 1G6BA 3CT9A 4WIQA 2HLUA 4ITSA 1YDLA 4HHHA 1RWVB 2G2YA 3CCUS 3CW2C 3PEJA 1FNXH 4KPCA 1KSPA 2W1BA 5FDLB 2PDAA 5LSLA 2DRBA 4K2XA 4NLUA 1TKZA 3DDKA 3HULA 5I42A 1CJUA 3NS7B 4CP5A 5AXNA 3PHTA 1S1TB 4P52A 3KJVB 1UVJA 4MIAA 4B3MF 4LUBA 2ROGA 4J9LA 2A6MA 4YS2A 1RTDA 1RCXB 3U1NA 4OYBA 5DO2A 1T9UA 4O4GB 4KY3A 3MEDB 4FPRA 5A2QU 1Y3KA 2CZVC 3O3LA 3RB6A 4RPFA 3UO0A 4NOHA 4J9SA 3TVKA 3QRQA 3G82B 4X84A 2C22A 4XAKA 3BKFA 1F0XA 2W9BB 3DDNA 1Y4ZB 1H98A 5IS2A 5EWEA 3VGSA 2LCWA 4ZVRB 2VB6A 4B3TJ 1RTHA 1O0PA 1AYEA 3MR2A 1D8YA 1RWXB 3WC2A 2ZHAA 2XMAA 1NSPA 2HQDA 3DU6A 3BSCA 2NXCA 4OZ2A 1BQXA 2BOPA 1QLNA 2HG4A 4U7CA 3BGRB 1KONA 2R2TA 2J7WA 3CDBA 2HHWA 2FJDB 2V68A 2M8DB 1SH3A 4EBDA 2IRXA 3AOBA 1CC8A 4FF4A 1U6BA 3DI6A 2EWHA 3W63A 3NP5A 3OTDA 1FEEA 3M6UA 3ILOA 3KLGA 4KV8B 4DUTA 2IRUA 1IQZA 2YKAA 1E6VB 1AXQA 4FVCA 5E3AA 3PNIA 2HAIA 2GGPA 2IM3A 4F02A 3BDPA 1EP4B 1ZTWA 2VOPA 1UTAA 1IBMJ 3AHPA 2IVYA 1QAJA 4A48A 4NE9C 1RE1B 5L1LA 1UW9A 3VGVA 5CA5A 3BREA 5A8RA 1JLQA 3HM9A 4CYUA 3NGSA 3W5ZA 2J7UA 4WE1B 4WP8A 2RS8A 1MMNA 1SB6A 1N36J 5ETPA 3M2VA 1FXRA 4O3SA 1CJVB 2VKRA 4C0OC 4CRJA 4HI1A 5KFSA 4Z7YA 2FHOB 5D0GA 4ECQA 4LJMA 2FVPA 3UFCX 3MCNA 3K17A 1WOPA 3V6KA 3P8BB 2DR5A 3HZGA 2ZH5A 1QAYA 2D41A 1XMOJ 5HMZA 1U8WA 3HDSA 2KHCA 4RNOA 2V34A 1X7VA 2GIFA 1EQ0A 3DOMA 5DDRC 4LFCJ 2WAQD 1FT8A 5GMDA 4DXLA 3T19A 1IKWB 2GCFA 4KGMA 1WF2A 3IRWP 4LBIA 2DRAA 3GIJA 1S9EA 1U09A 3V4MA 4NEZA 1RBOB 3EM1A 4DV5F 2XQCA 2VG7B 4MIWA 3MM7B 3CCQS 1A6LA 4FDFA 1Q8IA 4EBEA 3UN5A 1UETA 4OI6A 3FUYA 3RU0A 4P75A 2C2ZB 4CLKA 2KKHA 4Y00A 2CJYB 2OEJA 3ONQA 5D6GA 3K5OA 3TUIC 1HBOA 2BR0A 4F0MA 2V8HA 1NEEA 1WDDA 3NBPA 5KFJA 4LF6J 2LEPA 1RT1A 3TQEA 3CNQP 1APSA 5CAAA 5GVQA 4GKKJ 4N76A 4ICLB 4CLZA 5AJ3F 4X64J 2ZBIA 4DN9A 5KFFA 5J1EB 2DKOB 4C8LA 3TX8A 6AT1B 3CJ3A 1T05A 1U6FA 2QA1A 2B0GA 2WB1D 1RTJB 4HTJA 2CPYA 2PEBA 2AW0A 4NXMJ 5DETA 4ZVHA 1XR6A 4C3KA 4DV7J 4A8YA 2ZD1B 2KZMA 4O3RA 3AFGA 1T11A 3F56A 3H5UA 3M7VA 3EJMA 3AJDA 3CCZA 2BOAA 2UVUA 1TKTB 3KXDA 3KHRA 2NZ4A 3GU0A 4QYRA 3LO3A 1JJHA 2QE5A 1M5PC 1HNZJ 1Q78A 4KHRA 4QWCA 1S49A 3D3BJ 3LPYA 3TJ9A 2QC3A 2PE8A 2XMUA 4R5PB 2FLOA 4GC6A 2WW8A 3VAKA 2MY8A 4NX9A 2YY3A 3QO9A 3ET6A 3TVZA 4V19X 2IBOA 3LW5C 4CT9A 3IR5B 2QLJB 3D0IE 1HA1A 1ZA2B 3OXFA 4NLYA 2LU2A 5LMUJ 4FKXA 2EW9A 4F50A 4C0HA 4ZLNA 1NM2A 1SL2A 1LV5A 4PXEA 3DNCA 2W9CA 2DO4A 3TANA 2W4DA 1N5YB 4RW9B 1RBLA 1TKZB 5I42B 1IJEB 1NDLA 4QIEA 4A8SA 1CJUB 1D09B 5J1NA 3MMCA 2AYMA 3PFOA 4UOCA 3DKDA 2I38A 1GXUA 2YKOA 3H2VE 3D66A 1PBUA 1SV5A 1XERA 5BYQA 1ZM3A 5LT5A 3O8WA 1UVLA 3OUYA 1RTDB 4H4KC 3I0SA 3MTJA 4BWJA 3W9IA 1C1BA 2FVCA 4WWSA 3BR8A 1U1QA 3EDRB 4TY9A 1DFDA 4LF8J 4XK8C 3FEZA 2DPIA 3OL6A 1WD6A 3MF5A 4DR7J 3KDOA 4TQSA 3ISNC 1T02A 4ANDA 3BQ2A 1P1TA 1J27A 3GYGA 4DQPA 5KG6A 2ZWPA 4IDKB 3CPWR 2XMKA 1S76D 5EWFA 1DARA 2R4FA 2HZAA 1Q1KA 3G8SA 1RTHB 4D3HA 4CZCA 5F8JA 2MY7A 2CDRB 4URQU 4NLRA 2E9RX 3T6JA 3G6XA 4DFJA 3H90A 4DG1B 3KNAA 3GR0A 1UAWA 2EBGA 2VL1A 1IBKF 1SKRA 4KO0A 4WCEQ 2GV1A 1KTVA 2WONB 1J2VA 4PPZA 3DN9A 3RTVA 1RAOA 4KGVB 3NGTA 3UQSA 3DI6B 2H5JB 4GKJJ 4DI6A 3PW0A 3T1AA 4OYIA 1FEHA 5LXYA 2Q66A 3KLGB 4ZDNA 3OTEA 1AW0A 2EC2A 4P2SA 4ZN1A 3TUZC 2NXNA 1XJWB 1KEKA 2HBZB 2H54B 1L3KA 1W26A 2GGPB 4LREA 4CDIA 4ZA1A 2EFPA 4LIRA 1S1UA 2DD8S 4B9SA 2QZ8A 4ZS6A 2X51A 2ZHOA 1IBCB 2V8GA 4JI4F 5HLFA 1JLAA 5A8RB 1XR5A 3DLHA 4NASA 1JLQB 3Q24A 4U7UK 4CYUB 5DZ7A 4F36A 1VQ9S 1SBRA 3O44A 4ZVFA 4Q0BB 2VBWA 2FGOA 3CJQA 3RRGA 3M2VB 3BF4A 5CD4H 4USKA 3WBZA 2NUHA 4MK7A 3HX9A 4DU8A 2RT3A 4CO4A 3W5YA 1XNRF 3IC1A 4F26A 4EZ6A 1U1PA 4G65A 5KFZA 3BN7A 2QSWA 2EPIA 5HQLA 1U24A 2NPIA 4RBUA 3PEHA 3OJSA 4B3RJ 3AXKA 5SZTA 2CNNB 1IBLF 4ZVOB 3DOMB 2FD2A 2PI5A 2HGLA 3R7BB 5F3ZA 4OI3A 4PYAA 1QAIA 1S97A 3THVA 2EC0A 1K47A 1YRXA 3PIPQ 5K20B 4DFMA 4IKAA 3OFFA 1RHJB 2ZH9A 2RJZA 2ZBRA 5EDWA 1H7XA 1Q86T 4CO5A 3N6MA 3CCVS 1IXKA 5KFPA 3CJ5A 5DG8A 3VF0B 2UV8G 5L1KA 1U1NA 2B8QA 1X9MA 4QWAA 1S9EB 2XSJA 5D4NA 2W24A 3FSIA 4K5RA 1IKXA 3OR1A 3EZ5A 2C3UA 1T9XA 4NMXA 2GIRA 2VIHA 4FF3A 1OSDA 3R5BA 2JLEA 4M1KA 3J7AN 2VJUA 3TA2A 3I5BA 1K8AT 3IM8A 4FYYB 3E01A 4NLDA 3D1OA 3O2IA 4QIWD 1HBOB 3VCDA 1FDAA 3NBPB 2DHSA 3J80Y 1RT1B 1NNDA 2AJQA 5T14A 4BC7A 4EUVA 1SCJB 5F9NA 1HL6A 4RL1A 2L3MA 3BKTA 2IA0A 4YR3A 1REGX 2BDPA 1YG0A 4QYZK 3PW2A 3E3XA 4Q43A 4PXDA 4CWBA 2EFOA 4M5HA 3CDWA 1R43A 3T1YJ 2XYPB 3NWGA 3ZZOA 4F4AA 2EFQA 1W25A 2QMUB 3KLEA 4F4ZA 2PT0A 3M6WA 4CLYA 1B3TA 4JUZA 1UJ5A 3ITHA 2Y1RI 3PYDA 4R25A 4P6QA 3NAIA 3S01A 1XMBA 2JOQA 2L9NA 5I3UA 1RK8A 3H8YA 4R8UA 3CJ4A 3KHHA 1XEZA 4JI7J 1YKWA 1UWBA 1H72C 1WEXA 3IBWA 3MD1A 1VQ5S 1N8RT 4NRUA 2VICA 5E33A 2RRAA 3FSXA 1BXNA 2HSEB 2AZ1A 2BEFA 5D15A 4CLUA 3LP1A 2DK2A 2HVEA 2M3DA 4UUXA 5A76A 4K4UA 2QLWA 2KXFA 2M52A 3D6TB 4LVNP 1MN7A 2HBYB 1TUVA 2IC3B 3T5HA 1LK7A 1U2CA 1MROB 5IWAJ 5HROB 1RHUB 2H48B 3QPIA 3LQVA 1YVFA 3L7UA 4EZ9A 3MEEB 1S99A 1Y00A 2W9CB 2I5JA 3L4BC 2OPSA 4LT6A 4DR5F 2RILA 3EYZA 5DRKA 3GIRA 3J7Z5 1S48A 4CH7A 2RRNA 3OVBA 3CULA 2M2BA 1MMDA 3MMCB 2R9LA 1KQGB 1SV5B 5GMEA 3GFHA 3KUHA 5L9NA 3OUYB 3BB5A 3I0SB 4FXVA 1NU4A 3LGMA 2YNGA 1WOSA 2HVDA 1C1BB 4Z2XA 3CXCR 3LUYA 4A8FA 2GJIA 1N88A 4M63A 1XBWA 1JX4A 1BE4A 1VYAA 2RRBA 2ZH6A 2CQ3A 2M8HA 2D1CA 1WI8A 1B0TA 3RB4A 1TFWA 2VFVA 1NK5A 4N41A 4IFYA 2F8MA 2HHPA 4ZVGA 3H5YA 2ALYB 4LR8A 3RRKA 1N6QB 4EMDA 2QG9B 2DR8A 3UR3C 4H4KA 3Q8RB 4UOFA 1NDCA 2C2EA 3NMAA 1S6PB 4KO0B 4IH6A 1JLEA 1SI9A 5EN1A 1PYSB 2DO0A 2EXUA 1T3NA 2HKEA 4ECTA 4PG7A 1WDTA 2NCKL 2OPPB 3UR0A 3H4BA 2KFZA 1REVA 4AQYF 3MMAA 3GFYA 4M5JA 1X5TA 1UVIA 4MK8A 1O5JA 1FF2A 3M8ZA 3VTIA 2KO1A 2OIHA 1S1UB 4TN2A 2KXHA 2GA7A 4RJVA 2BJ3A 2PN6A 1H74A 3QRPA 4DUZJ 3KLHA 4QU7A 5HAOA 5HLFB 5GAHU 2DNHA 1JLAB 1U0SA 3C14A 2OEMA 1QVFR 3CO0P 5KG2A 4M5GA 1S1XA 4ZOSA 2XNRA 4FF1A 1TL1A 2KRRA 2HMIA 3MM6A 2FJWA 2DB1A 2RAQA 4BCAA 4I2PA 3LF0A 3KMSA 4FXDA 1QE1A 2ASDA 2GHPA 4RZRA 3RUBL 3FK4A 2BRKA 3UI3A 1VMBA 5ETVA 2ROEA 4OJ3A 1OS5A 5HN0A 3MI7X 4FXWA 4M8LA 2CG8A 1NDKA 5ITHA 3DLJA 3DRPA 4JI0F 4DBQA 4HL9A 2ZBCA 4WPAA 2M70A 1R3NA 3TNVA 2W2QP 2HHHF 1UKUA 2W8KA 2KYZA 1Z2ZA 4Y6IA 2RS2A 3RBDA 5IC6B 2KU7A 1HQUA 2K3KA 4IR1A 2MKJA 1B99A 1OY8A 3R2DJ 2KL8A 5KT5A 2GVDA 1FKOA 4RWWA 1WEYA 3GV5B 4X62J 2NSCA 3IMQJ 2VFUA 3BO4A 1U4BA 1URRA 1NPKA 2XSJB 2XY7A 5E3QA 1RYSA 1L3VA 1IKXB 4IOCQ 4UY8T 3OR1B 4K4YA 4KAIA 2Y8WA 1HQ2A 2DY9A 3J7YU 1GAOA 3K5PA 4L72B 1UW4A 2EK6A 2C3MA 3KJQB 2ZH8A 2ZZMA 2VDIA 3VALA 2NSBA 5CABA 1G1XA 3AODA 3ILIA 2O01C 1H3DA 1RAGB 3UE2A 2UVWA 1N34J 3AD9C 3IBFB 3SZ2A 3N4WA 3QGHA 2HQ3A 4ZCLA 2MZRA 5GAEU 2FY8A 1KRPA 2XHWA 2IBKA 3ADAC 3U1LA 1VQ4S 1FJCA 1SH0A 2K2PA 1DZ5A 1Q7LB 3T5KA 1TL3A 1GH8A 3DXBA 4RUBA 3FJ2A 3SCIE 4K4WA 2F7VA 1HNWF 3KLEB 1OY9A 1WC1A 1CSJA 4USVA 2AYGA 2MKSA 3M05A 4EI2A 2YNIB 1SC1B 3ITHB 4P9SA 2HNYB 2YKNA 1XMQJ 3C8YA 2FUG9 3NGDA 4R8UB 1UVMA 3UNYA 1AA1B 1UWBB 4J5OA 1K44A 4YFUA 3EZUA 2MQ8A 3PR4A 3DLGA 3NNAA 2M4MA 2ZZNA 1P27B 3PG9A 1GXLA 4XIUA 3DRSA 3CCES 3TJAA 1RP5A 2YPZA 2UXBJ 3QQCD 4DR2F 3LP1B 2BE9B 1VQSA 1NPPA 2DHGA 2UUBJ 2KVQE 2BBEA 1NB2A 2E7WA 2IM0A 4DX5A 2N4CA 1JNZB 3CGIA 3Q89A 2I5JB 2BZ2A 3LTOA 1J5EF 1IWAA 3P5BP 4OFZA 1HFEL 2RB7A 2DT9A 5BR8J 3M8RA 4ILLA 3TARA 5KFEA 2QSFA 3NGKA 2GNKA 2JFKA 1F9HA 3MEKA 5B09A 2W2MP 3I9V9 3RR7A 3RBXA 3HXMA 3W7BA 1X9WA 4ZP9A 2GMJA 4IOAQ 3MM8B 2BKNA 3Q83A 2YNGB 5HANA 4NA2A 1GMVA 4OX7A 2PA8D 2NYIA 1BQNB 4HH0A 2CQ0A 1T9WA 1ELOA 1TMJA 2N7CA 4X4RA 2F3JA 4LR7A 2B4OA 1NBEB 4YDDB 2J8AA 3POTA 1UP1A 1TVRA 4NLOA 3RW6A 3O6QA 4I56A 2DXDA 1N0VC 4DV4J 4IFYB 4WZQA 4OYAA 2RIJA 2VPYB 2XGPA 4GVBA 1FNMA 1DQ8A 4QBUA 1SKUB 2ERRA 4KT0C 4ZVEA 3THTA 1PGZA 1DBDA 3LP0B 4C8MA 1JLEB 2ZBPA 1DTQA 4JI3J 3C2PA 5C24A 1FVQA 2MEWA 2AJ2A 1T3OA 4OHVA 3ZTOA 4DR1F 3I4HX 2DYAA 2XG8A 1REVB 3HP6A 2HBRB 3FKBA 3C46A 4I4BA 3MMAB 5KFBA 2B9EA 2EFNA 2FC8A 3M9NB 2V8PA 3CD7A 2R7SA 4DV3F 4NI2A 2C28A 2VD3A 3FGVA 1B0PA 3NGUA 2MDAA 3KLHB 2M9KA 2I8EA 4LR9A 1HHSA 5H9EJ 2V8VA 4DR4J 1U0HA 4G3IA 1S1XB 1NJYA 2VG6A 1TL1B 2E9TA 2VPXB 2HMIB 3MM6B 3SSQA 4DFKA 2DR6A 4L74A 1OYDA 1QE1B 2RH3A 2HRTA 2Q6CA 1N56A 1SQFA 2CNOB 3DRPB 3GTYX 2WCXA 2KZZA 2AZ3A 4F4KA 2PEHA 2HS0A 4U95A 2XMJA 3JAMU 3W66A 4O0NA 2GQCA 4NLPA 1T7PA 4P7VA 1YRTA 4ED2A 1TKDA 3H4DA 3V81B 2GVDB 2HURA 1FKOB 4DX8H 3GZ7A 2H9ZA 4C2MA 2POKA 5E0OA 2IDLA 3TX0A 2DPJA 2RHSB 3OTOF 2I9SA 2ZUAA 2KB2A 5ETRA 4RW7A 2MKCA 4B9NA 2L48A 1X4EA 4BC9A 2ZNYA 2CUYA 4NWBA 2P6TA 2LXFA 3KK3A 4CTAA 1H2VZ 1RTIB 2AYBA 4HT7A 4TVAB 3M1VA 3G71S 1YHQS 1NZ8A 2V9KA 1K1QA 1D9FA 3SCKE 1TUWA 4LF2A 2MKYA 3M2UB 2MJUA 3Q8VA 1VBXA 1V6HA 1KWMA 3QFWA 2RDIA 2HNDB 1EJ7L 3QZ8A 3FBCA 1PCAA 2AGQA 4P72A 2NLWA 1F9FA 4CLSA 2V94A 1T9VA 2VQFF 1X8DA 2DNOA 2CQGA 4IOBA 3R5GA 1KBRA 2CPDA 1P6TA 4NZ6A 1R8HA 4OZ3A 5GMKa 1N32F 7FD1A 2MLXA 4JI8J 4LF4F 4K8RA 2YTCA 4DS5A 1S10A 3GG1A 1S0VA 1S57A 1BGXT 2MKHA 4TLRA 1D9AA 2XSFA 4JYAJ 2CNLB 3W2WA 2OPQA 2DVIA 2PFFB 4WYLA 3PW5A 5IT4A 5AXMA 3C6UA 3T9NA 1NH7A 4YY3F 4LF7F 2YVSA 2VONA 5KFWA 3DRSB 3OR2A 1FWPA 1T9YA 2MQNA 4MAKA 2VC1A 1Q8LA 1YGYA 2LQ9A 1U47A 2YKMA 2WHOA 4PRFA 3Q2TC 4ETZA 1S6QA 2DIUA 4C4WA 5B0GA 3HLUA 3G2XA 5DG7A 3QAEA 1DY3A 4PPDA 5GADU 1RAEB 1TV6A 3JYTA 4Q7AA 1NKCA 3PTWA 4PUOA 4RNHA 1O6XA 1TL7A 1RAJA 1VQPS 3R6LB 3GJSB 3FEXB 3NGRA 5K8MA 1U26A 2XY5A 1T95A 1FRIA 1LW0A 2LMIA 4DUYJ 4J9QA 2GX8A 4Y2KA 1GMWA 4DV6F 2ZBQA 2KG1A 4QJVA 5B0FA 3C15A 2ZM6F 2I1RA 1PIEA 3QT5A 3T1HJ 4KHPJ 1JIHA 4ZVQB 1HNWJ 3POTB 4JV5F 1TVRB 3KUEA 2UXCF 3N28A 2QA4S 5KFQA 4LF5F 1M5OC 5DS7A 2LU1A 3A3OB 5IXUA 1HMVA 1Q5YA 4GVBB 3I87A 3SQOP 2IVMA 2AIRB 3FRZA 5GAGU 3UWTA 2OTLS 3MPVA 4X65J 3R5AA 3WIUA 2HQIA 1RUSA 5I3QA 4ALZA 3I82A 1F3VA 2RDJA 1WC6A 1YJ9S 2V2QA 4RNMA 2CPXA 3MUVP 3SYZA 3R5DA 5C24B 3AY0A 1YIJS 4M5IA 5CYQA 4NL5A 1S9FA 1X60A 2DGWA 4L3NA 5AE1A 2HPUA 3GIKA 1GMUA 1MG7A 2W9AA 4MFBA 4RBVA 1EZZB 3PJ9A 1QUVA 5B0BA 3MWBA 1X4HA 3C16B 1HR0F 3RB3A 2UUCJ 4NI2B 3CC4S 4H4OA 2J0WA 2O66A 5A6WA 4KIAA 4IYQA 4KGKA 2XLJA 1I5OB 4LFBF 1WG1A 2CNKB 5IZHA 3TAMA 1C4CA 1NAQA 1S1WA 3J81j 2CPHA 2LECA 1U0HB 2PMZD 5MAOA 2FQQB 2B3TB 3TAQA 2OTJS 4K7QA 3CDEA 3EGVA 2P2CB 2ZDOA 2OHDA 1I3OB 1QD1A 4LF1A 1TL5A 3MOJB 3R2CJ 4DV2J 2J6UA 3MZIA 3TZWA 3VVTA 3CCSS 2BJ1A 2AEJA 4KQZA 3ZZ0A 3CD0A 1FERA 1PAEX 4EGLA 3PXGa 3TVYA 2DISA 2LDIA 4E0DA 3CCLS 1DJ0A 4JBCA 2MZQA 3ENVA 2VFRA 4OZJA 2VA3A 1BD6A 3QNWB 3HHNB 2FVRA 3EGZA 4IH7A 1Z2LA 1YJRA 2Z57B 1MWYA 1MNEA 2XULA 2FJEB 3KYLA 4X4VA 4H54A 1F6TA 3ICLA 1DQAA 4QOTA 2E1PA 1I1GA 1KFSA 1CQNA 3K59A 5EUHA 4DQIA 2HWTA 1U7LA 4X4SA 3N0VA 5AE2A 1GX5A 3AOAA 4A8MP 4DR1J 3D5MA 4JI1F 1FFSB 1M5KC 3QT8A 3KK3B 4CTAB 1SVDA 8AT1B 5GAHI 2MJNA 1VRQC 2V50A 1RDRA 4B3TF 1UMJA 3H42A 2IA6A 2VBYA 3PJWA 2KYXA 2I2YA 5B08A 5L1IA 6FDRA 2W01A 2OFHX 2DGXA 1L3SA 5KFCA 2R7XA 3VAHA 2R3VA 4TKTA 1BMQB 4MIBA 2IJNA 1RHQB 1VC5A 3KMQA 2AKWB 1HPZA 1D8ZA 4GC7A 3A8JA 2G0CA 1SKWA 1CPZA 4B3SF 2F4VF 3M8SA 3SSSA 1X4GA 3HD2A 2VU5A 2C2MB 4OIXA 1MU2A 2E66A 1KFDA 4P73A 1RKIA 1VCTA 3TZYA 2HVZA 3V5RA 5T7LA 3H20A 3OPKA 3ENAA 3PO4A 1YBUA 5EGYA 4ERDA 4KJIA 1IBMF 3ZFVA 1VRTA 5D0EA 2VODA 4J9PA 2JJ4D 2DEIA 5ADZA 1VGYA 3JS9A 1TKXA 2OPQB 3B4MA 4MKVA 1NK8A 3SI8A 3C6UB 4J9OA 4WKRA 3GJTB 2MKIA 5DGBA 2FHJA 1NJZA 1RWWB 5KFGA 1N36F 2L08A 2NS1B 4USIA 4C8ZA 3BM7A 1RLCL 3DLLQ 5HMYA 5KFHA 2BE7D 1SC3B 5JJBA 2PMWA 4CLPA 5E5NA 4NLQA 2BJEA 3CC7S 2XC9A 2YKMB 1S6QB 4X66F 3AQOA 2OFGX 4HT5A 4J9VA 4B3OA 3M8WA 1NPRA 2Y0BB 3VAFA 1XMOF 1RAAB 5EX3A 4GMKA 1CJTA 2J9CA 3JYTB 1IKVA 3UW1A 4XPCA 3L7PA 5ETSA 1TZ0A 1TL7B 2HIQA 2V6AA 4LFCF 4H4MA 2FB0A 2FYXA 5GAEI 1LW0B 3WDOA 3TRGA 4QZVB 2FJBB 4A8KA 2UUAF 4YN3B 3W65A 3H2UB 2E5GA 5IV3A 1FDNA 2LEBA 1I6JA 4QYZJ 2XHCA 1WORA 3Q8YA 4KHMA 4Y0FA 2VQFJ 5JVGQ 3EPGA 3LWMA 3CF5Q 1KD1T 4FYXB 5KFRA 3SCLE 3QGIA 2RU3A 4DQQA 4PKDB 2AJFE 1S9GA 3RJMB 1VHFA 5KFLA 3TI0A 4LF4J 5EX0A 2HFNA 2V67A 2H4WB 1JK9B 1EB0A 3DCAA 4P7TA 1SJ3P 1HMVB 1M5HA 3RGIA 5F3TA 3MGJA 4U9RA 4LF6F 2MQOA 1X4DA 4PR6A 1SPBP 3SEOA 4KH1B 4GKKF 2AJ0A 3DYAA 4X64F 5D3GA 3OL7A 2CQCA 3PCOB 4YY3J 4URGA 1OYEA 3QJJA 1NKEA 2DGTA 3ZXWA 1EIYB 1TK5A 3KHLA 1VRUA 4DL7A 2JEIA 2LA6A 1RA7A 1L3UA 1UJ6A 4NXMF 2FJXA 4QR1A 5CYQB 1NUEA 4DV7F 4O4RA 4K4XA 4OYXA 2DCUB 2XMWA 2ZUGA 4Q45A 3MECA 2JNJA 4M5MA 5J2NA 4MFBB 2VKZG 4A46A 4DX7A 2JRSA 2CJXB 4FF2A 1YI2S 2NXEA 3V6JA 4OYPA 4B9LA 4H4OB 2P5VA 2H4YB 3PKMA 4P2FA 1DTTA 2Z2YB 3B54A 3C6TB 1T0TV 3VWSA 1HNZF 2K3IA 2UZAA 2QO3A 1B70B 1K73T 1SQEA 4XTTA 3TAMB 3HMJG 3K7RA 1FE4A 5DDPC 1S1WB 1V3SA 4FZVA 4F8RA 3ZTPA 3KLFA 3Q0AA 1ZM4A 2GC8A 4FYWB 2B56A 1HBNA 2HNZA 1VQMS 1AFIA 3R7NB 5IQ6A 2UUTA 4ZVTB 1YBAA 2F9JA 4F0HA 3VAGA 3SFGA 1VLOA 1AUDA 5D78A 4ZP6A 4IG0A 4P2XA 4WTYA 2R7TA 4WFNQ 4WF9Q 2E5LJ 4ZPVR 2UXCJ 4HACA 3UPFA 4C6AA 1UL3A 2CQ2A 3CJSA 3PHEA 3MOZA 1HWUA 4ED4A 1S77D 1FRJA 3ZTSA 3HF5A 3FZBA 1ZZNA 2QGFB 1NK6A 5F8IA 2FZGB 3GIIA 5E41A 2J9DA 4QIGA 2VC0A 5D4LA 1TR0A 4ZK7M 2BW2A 1UJ4A 5LL6d 4U67Q 4LF8F 5H9FJ 3CEDA 3U02A 3OBIA 3HSZA 1QJHA 2Y1LB 1TK8A 1CG2A 2X1GA 2HGNA 5A6PA 2E9ZA 2R42A 5A2QY 2FJAB 5B0CA 2LYVA 2N3OA 3VV2B 2DGVA 1LNQA 1HR0J 2UXDJ 2DBBA 2V4RA 3GILA 3H98A 3T5JA 3W8GA 4CH1A 3BO3A 1BHNA 3P4UB 5KFMA 4DZDA 3X1LB 3MEGA 3OHBA 2D3UA 2A1BA 2RF2A 4DEZA 4F3OA 4QQBA 4IUFA 3ISND 1SJ4P 4GKJF 1CVJA 1HPZB 4WZMA 4YR0A 3GR1A 3MXHP 1RWMB 2IHR1 1FFGB 2UU9J 1JXVA 3BKUA 1JLGA 5T7LB 1WACA 2LEAA 3BGUA 2GFFA 1VK3A 4P10A 4BDPA 2YWHA 2FLNA 1NHUA 3LPEA 2R7QA 1C1CA 3UDEA 2AEMA 1VRTB 2DTJA 2BJ8A 3IM9A 3KJFB 1Q53A 3KHGA 3CJ0A 3NS5A 4ZPAA 1TKXB 1RWPB 3O1LA 4XO0A 4WU3A 1X9SA 3QLHA 2E1RA 1DURA 3TQ1A 2DXFA 2AJ4A 2QX0A 1RT2A 4K0KF 5BYSA 3J7A1 5FIIA 4C8KA 2HHXA 3KJNB 5E3RA 3THPA 1GTEA 1SIWB 5A8KA 2MLZA 3HI9A 5HP1B 2QIFA 4Y34A 5CCLA 3G6VA 4OI4A 3HKZD 3HKWA 1H6KX 4DR3J 3S6EA 1ZAVA 1WF0A 3A13A 3AA9A 5C5JA 4IG3A 2WVEA 1B7FA 2GAGC 2GHWA 3OSPA 2ASJA 2R7UA 2X7IA 1R6YA 1SL1A 3ETOA 2F8HA 5DQGA 4JI1J 5G4DA 4B3OB 1ZM9A 4EO8A 4USWA 1WC0A 4RNFA 4GO5X 1CJTB 1F5CA 4B3RF 3KLIA 1IKVB 4O3NA 2IVFB 2WK4A 3GMGA 4H4MB 2AYEA 3GV7B 5U47A 5M2PA 2V2KA 3OV7A 3A12A 4ENOA 1WI6A 3QYYA 2ASLA 2K06A 2W4CA 2ZH7A 2RUSA 1LWCA 5LXRA 2FY1A 3CIMA 5IM0A 3S1TA 1WJ9A 2B4UA 2V5HG 2MLYA 3NG8A 4PXCA 2LA4A 2OSRA 1RABB 2AWZA 4W98A 2XBPA 1RAHB 3PYGA 5C7PA 3ETMA 2YWKA 1R0CB 1JLFA 3RW7A 4B3SJ 2F4VJ 3HHLD 3M2RA 3OQ2A 5HVHA 1KNZA 2KFYA 3LANA 1NSKL 3I56S 4M5NA 1ZAWA 1S9GB 3Q8UA 1LW2A 2RKIA 1KDNA 2B8PA 1V5IB 2D7SA 2YBVA 2Q3PA 1R8BA 2A18A 1IVZA 2QA2A 5E3PA 1KHWA 3L09A 3NKYA 2DNNA 2R7OA 1RT6A 4OYMA 3BR9A 3DYAB 3GONA 3KG0A 1HWIA 1NLKL 2DXEA 1JNRB 3D0GE 1U2RA 1VRUB 4IRKA 1R0BG 2CQHA 5GADI 3T1YF 1S7HA 5HVGA 2DCLA 4LMZA 1KHVA 2R7VA 2LXIA 2OPRA 2YWFA 3R5CA 4DPXA 1RU1A 4X66J 2QYGA 1FRKA 3MECB 5J2NB 3A1YG 2MQQA 1Y3JA 3OL8A 3G9CA 3NCPA 3BEGB 2KXNB 3HSGA 4ES1A 3OXLA 4RW8A 3PO5A 1DTTB 3UD4P 4JI7F 4C3LA 1HD1A 1LWXA 2BKPA 1O51A 2VHGA 3MPDA 3HVTA 3FBBA 4N7TA 2J8SA 2HWIA 1HI1A 1WKKA 2ZH2A 4LF9J 2EKNA 3QZ7A 3PW4A 2NYHA 3KLFB 5EHHA 2UUAJ 1HBNB 2HNZB 2JH3A 4FKYA 4ID5A 2FVQA 1WWHA 4TY8A 2NXJA 1A9NB 5IWAF 3WX4A 5HMWA 1NH8A 1EKSA 4IG0B 3MMJA 1AT1B 1Q95G 2J0XA 1Y5IB 4Q2LA 1B4SA 4CCHA 2XO6A 3QIPA 4WP9A 3FFIA 1F9EB 1S1VA 4HACB 5BXIA 4JI2J 3Q2SC 2QFJA 4K4SA 2B5JA 2D74B 1Y5LB 1RT3B 3MR6A 4KGZB 1VQKS 3FVYA 4B9MA 2XMTA 4FNHA 4DCJB 3M30A 3GYXB 1RYRA 1H2UX 3AD8C 4EFAC 4NYZA 3R3TA 3GYNA 4OLPA 3JSYA 3IWXA 1EKRA 2QMWA 4RUAA 1VQ7S 1UZDA 3QRRA 3HZEA 2B4PA 2XS5A 2JWNA 3OVSA 4CM0A 1XR7A 2RE1A 3GJRB 4DSIA 3EWGA 4AUKA 1RSCA 2VV5A 1KVIA 3FMWA 2KFNA 4KBIA 2YPYA 1Y7PA 3F0NA 2W7OA 2RQKA 3GE9A 2QV6A 4DWIA 3VAJA 4C8YA 2MHEA 3MEGB 2MQLA 2NXUA 4NXNJ 4LSLA 3UCGA 1B0VA 1RWOB 3K2YA 2RF2B 2AMCB 3QT7A 4TU9A 4L76A 5HK4A 1HW9A 3I9ZA 4ELUA 4JI6J 5FD1A 4DPUA 4ECYA 5F8MA 2LVWA 2R8HA 2LQ5A 4WFYA 5C2GA 4YP3A 2UP1A 1UWAA 4JV2A 1JLGB 4LFAJ 2JFDA 3PJXA 3PRBA 1G2EA 1WC5A 3D7SB 1NHVA 2JX2A 4O3OA 4AXJA 3G8TA 3DXSX 3MM5A 1C1CB 4M95A 1VQLS 4TYBA 2DNPA 4DUZF 1ZPWX 1VQNS 3QATA 4TXSA 3KK1A 2ZOMA 3SV4A 2J0SD 5F8NA 3QLHB 1ZS6A 2CIMA 1FI4A 5DLFA 4GO7X 1RT2B 1KKHA 2M7SA 3WHIA 5ETTA 4DCPB 5A8KB 3T6BA 1H0HB 4RW4A 4OHWA 4DCOB 1FJ7A 1NJXA 4IG3B 2Q79A 1RCOB 3A3NB 4YHHJ 4R0EA 1UVNA 2IRYA 3W8PA 1PBAA 2X1AA 4YQWA 1LWFA 2J6TA 3IR7B 4W92B 5LSRA 1DLOA 1YRUA 3KLIB 1FX4A 3FMBA 4DSLA 5KG3A 1FJGF 3HPOA 1BWVA 3UCZP 3OLBA 1FRHA 2EBEA 3DRYA 4R0JA 4KC5A 3E2EA 2ZEJA 4X62F 3AD7C 1LWCB 2ZH3A 1ZH5A 5IM0B 3DOKA 3ZO7A 3QSIA 2DNZA 3NAHA 1P8GA 3UD3P 2DNRA 5KT7A 1FE0A 1WOOA 1JLFB 3MM9A 3M2RB 1LEOA 4Y2IA 3H5SA 1SJRA 2FZKB 3U1MA 2ZFHA 1BUXA 2IJFA 1LW2B 4C7QA 3KTQA 3OVAA 4HKQA 1NK9A 5J1PA 2XLIA 3BSNA 3FCHA 2DNKA 4RBTA 3PW7A 1URNA 1N34F 2G0IA 3OT9A 3NCRA 1R27B 1V3ZA 2ZOGA 4W4MA 2HVIA 3S7RA 1RT6B 4BHQA 1TQLA 4FYDA 3VHQA 1WTFA 3KWMA 4DR6J 2ZE2A 3M8PA 4G1PA 1Q0NA 4HHJA 3AB2B 1MW7A 4M5DA 4K0KJ 1ZYQA 3QJLA 3CE8A 5BJRA 2WSCC 2RHQB 1ULRA 2CQ1A 4ZVPB 4UZCA 4OQJA 3N6NA 2W9BA 4AL6A 1RT4A 2OLWA 2HHTA 5K5MA 5KFAA 2GQ2A 2OPRB 4NCGA 4Z7CA 1YZ7A 4FNIA 3I96A 2AHOB 2ZWOA 1U8SA 4J91A 1XMQF 3LALA 4RWXA 2WVFA 3H59A 3HHLC 4JB8B 4PWDA 3PM9A 1U1KA 4RW8B 2EFGA 2M5YA 2YNFA 4I68A 2C3YA 3HVTB 1EX8A 3MR5A 3IA0A 2V63A 2O3DA 4E98A 3PYFA 3O5TB 2YKPA 2U1AA 4K50A 3OFEA 3IS9A 2HFSA 1D0EA 3MPYA 3PYEA 4Y2AA 5L8RC 1NK0A 3JTNA 2UXBF 2RQMA 4G1QA 3R27A 3VGTA 4ED5A 4CO3A 2VJVA 4ID5B 1IJFB 3IWLA 4TY8B 4O3PA 3SDEA 4U6PA 2UUBF 3MFHA 4KSEB 4N5SA 5HI7A 4DQSA 2JSXA 3CJ2A 1YJWS 2DNGA 3A8EA 3EUNA 3T5LA 3T3FA 3NNCA 3QIPB 2FHKA 2BE2A 4F4XA 3FFIB 1S1VB 5I3PA 2CDQA 3IP0A 3PV8A 1R8PA 5BR8F 4C8NA 4NYOA 2X3DA 1HWKA 1R31A 2C2OB 2B5JB 4HYKA 4PG8A 2JL9A 1GMWD 4WE1A 2YWGA 1OPIA 4EO6A 4USTA 1HBUA 1S0NA 4DV1J 5DQIA 4K4TA 4KPYA 1RKJA 1T05B 1JWWA 4DSEA 2CPJA 3M30B 2CXEA 3KG4A 2FC9A 1C0TA 2C2NA 2YWWA 2NREA 1F3FA 2G2OA 4NA1A 1AZSA 4NLVA 2VFSA 1AB8A 2SXLA 2HHVA 4IQXA 4DV4F 2K8GA 2BQUA 2XZWA 2B51A 2CWXA 2BM0A 4DLGA 2XNQA 1D9DA 3LAKA 3M8QA 3W9JA 2A6OA 2MZTA 4Y2MA 2RDDA 2WW4A 1Y5NB 3I4PA 2O67A 5DM7Q 4Q8EA 2CWKA 3SXLA 4AFFA 2FPHX 1C0UA 1ZM2A 2G4BA 2J0QD 5K8OA 5F8GA 3J81U 4LSLB 3MM7A 4JI3F 4WKYA 2WVDA 4ANCA 1XN9A 4WFXA 2HFVA 2VFTA 3D1QA 5KFUA 4P2MA 5M2UA 3QO9B 3ET6B 5HJXA 2E29A 4B9VA 3US5A 3AT1B 4DSKA 2HEKA 5HL7Q 4Q44A 4F7VA 4RU2A 1TFYA 3CJRA 3QT6A 3VQTA 4HDHA 4RKUC 1EQMA 2OUGA 3MCOA 2F63A 2JLFA 1RHMB 4EBCA 2MMYA 4ZPBA 1RADB 4NRTA 1N5SA 2W2NP 1N5VA 4NLWA 2P9EA 3HO1A 1NMEB 3BDEA 3MM5B 5M2RA 2H65B 3FEYB 1Q5VA 2DNLA 1JQGA 3LGNA 4DJBA 3KK1B 1HWJA 4DR4F 4J9KA 3N01A 2MGZA 3EXYA 1WHWA 2LQ8A 3EVOA 2CRLA 5HJYA 3H40A 2IJRA 4B08A 1S4EA 1VI7A 3HFKA 3CCJS 3BV8A 2RNEA 1C2PA 3C3LA 3B6BA 1LWFB 2QT7A 1JJ4A 1VBZA 4ZLLA 3WIVA 4HDGA 2CZ4A 1SJ1A 4DU7A 2IAJA 5IT9Y 1YQHA 4WFAQ 4WIIA 2J76E 1WC3A 2VA2A 4EYHB 2HQCA 5ETKA 1VDHA 1F60B 3G6YA 3C66A 1R0AA 2E1MC 1V5VA 3T9ZA 3DOKB 1XIQA 3OFGA 2MSSA 4CO0A 1UPPA 2ADBA 3OJUA 5DM6Q 2BA9A 3FDSA 4YB7A 3GFZA 2M88A 2B7CB 4PQAA 4WK3A 1AROP 1HNXJ 1OWXA 5CHCB 2FHMA 3KK2A 5MLCV 1J5OA 4ELVA 3MM9B 1N5YA 3TUPA 4RW9A 4YR2A 4DL5A 4IFVA 2J5AA 3IBCB 3TP2A 1WUUA 1TU0B 4KB7A 1M1KT 3ZNUA 3MD3A 2NUUG 4PWUA 5H9EK 3BYRA 3ZTQA 3EMTA 3BQ1A 1R8AA 2XM3A 3WZ0A 3GG0A 4ETXA 3EGNA 3IXQA 5FLXU 2P8IA 1Z1ZA 3E8OA 1FESA 3OD2A 4K5SA 3G96A 5B0EA 3MR3A 1U02A 4N8OA 1EHWA 2X1FA 3BN4A 2ZE2B 3M8PB 2PA3A 4RW6A 2E7VA 4M5DB 2KM8C 4B17A 3DMJA 2ACYA 2YH1A 2YH0A 4CLFA 3B4DA 4U7UD 4QU6A 2DGSA 1RT4B 4IDKA 4ZVSB 1KN6A 1RWKB 9RUBA 1NK4A 2COLA 4NCGB 3MUMP 5CZXA 2Z0GA 1ZETA 4JI8F 5HSPA 1WG4A 4LQ3A 5J2PA 1RHRB 4YUDA 4HVZA 2GHVC 5K8PA 1VK8A 2YQ3A 1IR0A 3LOUA 2HFUA 2K7KA 4PWDB 4JYAF 2B6AA 4DG1A 1XWLA 4OX9F 1U1MA 1FJGJ 1E6YA 3UDLA 2YNFB 2AQ4A 2BUNA 4WFZA 4DL6A 2WONA 4C11A 1X31C 4CO2A 1FD2A 5D0HA 3ZZPA 2FHJD 2WTFA 3EICA 3IS9B 3HCXA 3LP2A 5F0WA 1YJUA 2Y1IA 3GB0A 4L75A 5ETOA 1EAYC 3DOLA 3DGPA 4G1QB 2R8KA 3CDAA 5LM7E 3SDEB 3ULHA 5IQQA 1ZTTA 3HHLA 3PRDA 4F3MA 1M5VC 1PAUB 4YEAA 1XNQJ 3BH6B 2B43A 2BE2B 1U2FA 2C2KB 3E01B 1HHTP 2BV3A 2F40A 2E5HA 4OHZA 3Q8SB 4Y65A 4DUYF 1K9MT 4RX6A 4Q0BA 1H73A 1U1OA 3A4TA 1WELA 3FSYA 3F41A 1HBUB 4X2BA 3MTKA 1C4AA 1EETA 4TU7A 3R97A 2P9GA 4EU0A 1SC6A 3FBFA 3G4SS 1C0TB 1RGVA 3T1HF 1G3OA 1WG5A 4KHPF 2JVRA 3DU5A 4FBUA 1RA6A 1AZSB 3G86A 3KFWX 4MKAA 1Q7YT 4RR5A 5F41A 3NY0A 1SIZA 3UN2A 4OJHA 1X5OA 3M8QB 1PJ7A 4UF4A 5CQGA 5I3UB 4YB6A 3IGNA 4IO9Q 4AL7A 4X65F 5KFYA 4O44A 1LKZA 2ILYA 3N9UC 3VVUA 1C0UB 2IFXA 1TMMA 2JDJA 2YKQA 3DFEA 2M0GB 1RBAA 3VZIA 4BLGA 1YX2A 1RACB 4OYZA 1SJFA 1FRLA 2RU9A 4DFPA 2IMWP 1W7WA 1Q79A 2QLFB 2OAUA 4ZLJA 2UUCF 2XCPA 2OPSB 1OQ6A 2GVZA 1VC0A 3UD5A 4ZITA 5EWGA 1CULA 3VQSA 1YJVA 1UA0A 4RNNA 2R2SA 3CTRA 1NSAA 3ZTRA 1S0MA 2MGZB 1HBMA 2GMLA 2E1AA 4WXOA 2XS2A 2HAFA 2V2ZA 2VZ9A 3ZZYA 4KH0B 1WTBA 1O8BA 2Z8QA 4DV2F 2HRYA 5CYMA 4PQUA 1YJTA 5CXTA 3KOAA 1ZPVA 4JV1A 5L1JA 2LFVA 3Q22A 5D0RA 2XZTB 3KDNA 4USUA 3L3CA 1M1GA 3GIMA 3HFVA 4ZPDA 3ZNJ1 2IAJB 4CNYA 1JKHA 3KKFA 4ZCMA 3JAMY 1R0AB 1VIOA 2WB4A 1FK9A 1RWNB 2IC3A 5K14A 2GO9A 4IRDA 4I67A 1MROA 4ZN3A 2G1DA 5HROA 3JSRA 1KOHA 2AT1B 1T8EA 1DHMA 3MEEA 3ILLA 3KK2B 4A8WA 3BPDA 4XDCA 5DQHA 4C98A 4WP3A 1J5OB 2XI3A 4C0BA 1JLBA 3PY8A 2KI2A 1MN9A 4IFVB 3NL0A 1RZMA 2MQMA 5F8LA 1F5BA 5KOWA 3AH6A 4AXIA 2KJVA 3K0JA 4PEOA 4ZJQA 5LJ5Y 4ED7A 5L46A 3QGPA 1R6VA 4J37A 3DLKA 4DL3A 1GFWB 1N48A 4USMA 3D68A 1NRKA 4ECUA 1JB0C 2F65A 2J9EA 1S12A 4S0MA 4I69A 3NLCA 1T03A 4UQTA 2V4JA 3C14B 4KYZA 1FD8A 2VQEJ 1WKLA 3X3UA 1S59A 1QSSA 4OZNA 4GVLA 2AX0A 5KFOA 4RW6B 1A7GE 1B64A 2ZZTA 4WBFA 2XCAA 3DMJB 2AP6A 2BQ3A 2GZOA 5IV4A 2X1BA 5K9FA 3CMAS 4I2PB 1JMTA 2J6SA 3FNNA 1N4LA 4ES3A 2CPFA 1YK9A 1HIYA 3MDFA 5J2PB 4MKYA 4OHYA 1N6QA 4QR0A 2GIQA 4KE5A 2IDEA 2W4PA 2B6AB 3CWJA 5CH7B 3DC2A 3UVJA 1E6YB 1S6PA 3GCWP 2FIUA 1HQUB 2QLXA 1TTHB 4C11B 3PR5B 1H38A 2I6WA 2EG1A 4O0IA 4J7CA 5KFTA 1VLYA 1S0OA 2HS4A 5CCMA 2CJAA 3LP2B 2OPPA 3BQ0A 4F4WA 3DOLB 2YX4A 3DGPB 3ENQA 4F67A 2OSQA 2QLBB 2CQBA 1YZ6A 2A2DA 3HHEA 2AGPA 8RUCA 4E8UA 2KRBA 3HHLB 2FGCA 4EYIB 1YTYA 2L9DA 1UFLA 1IKYA 1CC7A 5SUHA 2MKKA 2PD1A 2F9DA 3FRYA 1IR2A 4B3MJ 2OEKA 3RG6A 3M9OB 4ZP8A 5E7OB 3RBEA 4DF4A 2ROPA 4QPTA 2CJBA 4OZLA 1F5AA 2H5EA 2R7RA 3VAIA 3CD6S 2ZHBA 4OZ1A 2ZC4A 1EETB 1RXOB 4LSZB 2PGCA 4QWDA 1TL3B 2IPOB 1JXEA 2UV8A 4X4PA 4Z37A 2HVHA 1WF1A 2DITA 1Q81T 1FXLA 2VUGA 1RHKB 4P74A 2KT3A 3KLVA 2B7BB 1LXJA 3TEGA 3S8SA 2MB0B 1WHXA 2HW3A 2IIHA 3AJ1A 2ZNZA 3IO1A 2YKNB 1P9YA 2HRUA 3OSNA 3MCSA 2DHHA 4PABA 4FBTA 2WSEC 1FDBA 4OX9J 3L9ZA 3BGOP 4O44B 5IC4B 3FBEA 3D3CJ 2OH2A 3DLGB 4LSNA 3CVKA 2Z56B 1HHQA 3N79A 2GJFA 1X4AA 2AEFA 4NCBA 3JSMA 2EEYA 4OX8A 1G4CA 4X4NA 4N8NA 4HH1A 1GT8A 3C19A 4NMLA 1OY6A 1N52B 4KTQA 4X4UA 1RB0A 5C25A 1HARA 2XYGB 1GTHA 2X3GA 2A0FB 1VOMA 3FCWA 1N33F 2ZVSA 2PIIA 6FD1A 1LWEA 2CFXA 1CLFA 2QTWA 4LQ9A 3DHXA 1DAXA 2GVZB 3B8HA 3JXOA 3VR1A 4EK2A 2FZCB 2DGUA 1QSYA 2WBRA 3NS6A 1CULB 3K57A 2Y8YA 1Z4UA 1PYOB 4F04B 1FRMA 2C2RA 1QUPA 4DPTA 2OKQA 1HBMB 4M5LA 3RZAA 1GK8A 3EGWB 4A4JA 3TZXA 3LWLA 1SUQA 4IO1A 4PG4A 2ACMA 2BJ7A 5KT4A 2F1FA 3HK2A 1KVJA 3AXMA 2E5JA 1PO6A 2W2OP 5CYMB 2OO4A 3M8YA 4PQUB 2L9WA 2W25A 2YNIA 1TL4A 2K7JA 1QSLA 2HNYA 4A47A 1VBYA 3FQLA 4QIFA 2PMHA 3R1LA 2DGQA 4DL2A 1FXDA 4DL4A 2E5LF 1FKPA 1WEZA 3CCWA 1X4FA 3VZHA 3AA8A 1LOUA 2Z4PA 2CPIA 4V19J 3CMQA 2E44A 1T9TA 2DNQA 4C8OA 2YNHA 3P96A 1JKHB 3GWCA 4ER8A 2OP5A 4OMFG 3BYPA 2Q1LA 3QBCA 1ZZFA 3WX8A 4D3GA 4OI0A 1FK9B 4YB1P 5K14B 4DV5J 3OW2R 2B4VA 2OMLA 1DTQB 4ZP7A 3HHKA 5RUBA 7AT1B 2BANA 2DNMA 2CQ4A 2RVJA 1CQMA 4ZPTR 5ETMA 4AYBD 3W5XA 2W2PP 5HVFA 5KOXA 2HHUA 1SL0A 2OI2A 2JEFA 2HZVA 2CAJA 4QW9A 2DH8A 4IQMA 4PG5A 2LDYA 2LQJA 3VGUA 1JLBB 3J80U 1UZHA 3QJPA 3R7SB 1U48A 2A10A 2MZSA 4QIVA 1IM6A 1M90T 2C2DA 2UXDF 4NZ0A
chains in the Genus database with same CATH topology
3DLKB 2HLTA 2VV5A 4QBUA 1SH2A 1KVIA 3FMWA 1UEUA 4KR0B 2KFNA 3OXGA 3I32A 2ERRA 3JTPA 4KT0C 4KBIA 2HFZA 3MMBB 1I94F 1RT3A 3FQKA 1Y7PA 4ICLA 4ILRA 4PG6A 4ZVEA 3THTA 1T03B 2RQKA 2W7OA 3GE9A 2QV6A 2V4JB 5J1EA 2IM1A 3VAJA 1PGZA 2VQEF 3IGVA 1RI7A 3MM8A 1DBDA 4C8YA 3LP0B 2MHEA 3MEGB 2MQLA 2NXUA 3OFHA 4C8MA 3DM2A 4LSLA 1JLEB 1VS3A 3UCGA 1B0VA 4DSFA 3K2YA 4OZ5A 3P5TL 2MYFA 2RF2B 2P9CA 3ZC4A 1DTQA 2AV5A 5FLXY 1TK0A 2VG6B 1BQNA 3C2PA 5C24A 4NPOA 1FVQA 3UDCA 1RTJA 4TU9A 4I7FA 1T3OA 3W3SA 1HW9A 2KT5A 4OHVA 3I9ZA 4ELUA 4DR7F 4Y2CA 5FD1A 4DR1F 3I4HX 4QWBA 5F8MA 4ECYA 3Q23A 2LVWA 2R8HA 2E5IA 2ILZA 2LQ5A 2ZD1A 2BQRA 2UU9F 4K59A 4RW4B 2XG8A 4WFYA 1REVB 2R2UA 3HP6A 4YP3A 2UP1A 3C46A 2RQCA 1FHTA 4I4BA 3MMAB 1JLGB 4JV2A 5KFBA 2JFDA 3PJXA 3PRBA 1G2EA 4NYPA 2EFNA 4QPXA 3MURP 1NHVA 2JX2A 2FC8A 3M9NB 2VPWB 3CD7A 2R7SA 1TKTA 1X4BA 3WC0A 3M32A 4O3OA 4AXJA 4DV3F 4YDXA 3PVXA 2C28A 3G8TA 3DXSX 3KNGA 5LMNF 3IN5A 4Q2MA 2UVRA 2VD3A 3FGVA 2NR0A 3MM5A 1C1CB 4M95A 1VQLS 1B0PA 4TYBA 2DNPA 1DLOB 3OHAA 4DUZF 2OD6A 2MDAA 5DGAA 1ZPWX 3JSBA 1VQNS 3IG1B 3KLHB 3FZ2A 2M9KA 2CQPA 2XLKA 4TXSA 3KK1A 2I8EA 2ZOMA 1HHSA 3SV4A 2J0SD 3K8VA 5F8NA 3LP0A 5H9EJ 2V8VA 1H7WA 4ED8A 2DIVA 3M6VA 3QLHB 2VBXA 1VJWA 4G3IA 4ELTA 5T41A 1S1XB 3I5CA 1NJYA 2CIMA 2VG6A 2KM8B 5DLFA 4R5PA 2HHQA 1TP7A 4GO7X 1TL1B 3V6DB 5KG0A 2E9TA 2B9XA 1RT2B 2M7SA 2VPXB 2HMIB 3MM6B 3SSQA 3TR5A 4DFKA 5A8KB 3NMRA 2F8EX 3T6BA 3CD5A 1H0HB 2MHNA 1G6BA 3CT9A 4RW4A 1MWZA 4DR3F 1QE1B 2HLUA 4ITSA 2RH3A 4OHWA 2AU0A 1FJ7A 4KFBA 1NJXA 4IG3B 2GMHA 2Q79A 3CCUS 1QVGR 3KG1A 3H5XA 3PEJA 2Q6CA 4R0EA 4RW7B 1N56A 1HI0P 1FNXH 1OQ3A 2WSFC 7FDRA 1UVNA 2IRYA 1YSJA 1KSPA 4QCLA 3DRPB 2X1AA 2WCXA 1LWFA 5FDLB 4YQWA 2J6TA 2KZZA 3IR7B 3CCMS 4W92B 2KVIA 2PDAA 5LSLA 5LSRA 2DRBA 4K2XA 4F4KA 2PEHA 2HS0A 4NLUA 1TKZA 1DLOA 1YRUA 3KLIB 3DDKA 1OIAA 1S4FA 5I42A 2XMJA 3BGFA