3MEGB

Hiv-1 k103n reverse transcriptase in complex with tmc278
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
424
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
total genus 103
structure length 404
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3megB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB03
5C25B 4J9RA 1QAJA 2W7PA 2VG7B 1C1CA 2V0NA 2IM1A 3MEDB 5KFWA 4EBDA 1S1TB 4TLRA 5K14B 1IKXB 3T5KA 4MFBA 4ED6A 2YNGA 1KLMA 1S6QB 3QYYA 4ZVHA 4ECTA 4LSNB 3KHRA 4IFVB 1NNDA 2XI2A 4RU9A 3C6TA 4NYZA 1XR7A 2R8KA 3LAKA 1TKXB 1FK9A 1LWEA 5HBMA 3KLGB 3KJVB 3NAHA 3VQSA 3RB0A 1JXLA 3KMSA 3GIKA 3BGRA 2IM0A 4NZ0A 1S1VB 1SH0A 4YR3A 3RB3A 3BSAA 2HMIA 1TV6B 2RF2B 2ATLA 2O5DA 2BRLA 3IS9A 3FFIB 4O44A 1XR5A 4KBIA 5KFFA 4QWEA 5CYQB 1LW0B 2OPPA 2WOMA 4IH6A 4F4XA 3I5AA 4O3PA 3IG1B 4DG1A 4NLOA 4GC7A 2JC0A 5J2QA 1TL1A 5EDWA 4DL3A 2AX1A 1LWCA 3FRZA 5HROA 5EUHA 1JKHA 2R8IA 1FKPA 1IM4A 4J9QA 1DLOB 4NLTA 4RNFA 1LWFB 1SV5A 4YR2A 2AQ4A 2B5JB 2GIQA 2RDIA 1JLCA 3I0SB 4ED0A 4WE1A 2WOMB 2UUWA 3BSOA 2UVUA 1QE1A 1RYRA 3M8QB 4YMEA 3PW0A 5J2QB 1N48A 1T03B 3KLFB 5I42A 5EWEA 4K4VA 4MK8A 3LP1A 4JV2A 1C0UA 3GV5B 1S0MA 4ZVEA 3DRPA 5FDLB 5DG7A 3C6TB 1BQNB 3MEEB 2AGOA 2FLLA 3IRXA 4IDKB 1R0AA 4KO0B 4IR9A 5KFTA 4TY9A 3KLEA 3LP0B 2IM2A 4K4TA 2E9RX 1ZTTA 3CDUA 3GILA 3T5LA 4RUAA 1VRTB 5C25A 2WCXA 1D1UA 4G3IA 1S6QA 2D7SA 4KHMA 1JLBB 5J2PA 4PQUA 3BQ2A 3DOLA 1S1TA 3NAIA 1HNVB 4R5PA 4Q45A 2JEGA 1FKOA 5J2MA 1HQEA 2VG7A 2FVRA 3QIPA 4DL6A 4IH5A 4WZMA 4ID5B 5KG5A 5KFAA 3LP0A 1XR6A 2WK4A 1MU2A 3JYTA 4ED3A 3MTKA 3OL8A 1JLBA 5J2PB 2FLPA 4H4OA 1LW2A 3QGGA 1D0EA 2IC3A 4M94A 1JX4A 3SI8A 1S1XB 5F8MA 2UVRA 5F8GA 2OPSA 2ALZA 3V81B 3BREA 1T94A 1S97A 2ASLA 1S9EB 2D41A 2F8EX 1RT7A 4URQU 5KG4A 4RNNA 3H40A 3IRXB 1QE1B 4IDKA 4NLXA 3QZ7A 1RTJA 4RW8A 4O4RA 2YNHB 1DTQB 5J1EA 3BR9A 1MU2B 3TAMB 3JYTB 3SFGA 3G6YA 3RAQA 4IFYA 4ZP6A 2WHOA 4ECZA 1S9EA 3QO9B 4NLYA 1HYSB 1RT2B 1TKZB 1OS5A 3H5UA 3KK2B 4PWDB 5KFRA 3MR3A 1QUVA 2CJQA 5J2MB 1LW2B 3DLGA 3I5BA 4R0EA 3Q8RB 2E9ZA 1EP4A 4KE5A 4J9KA 3V6KA 1RT5B 2HNDA 3MECB 3OLAA 4DG1B 1JLCB 3I0SA 3GV7B 3ISND 3KHLA 4IQXA 4F4ZA 1R0AB 4EEYA 3LALA 4K50A 4YP3A 3MEEA 4RZRA 1S6PA 2W9BA 5KFUA 4GC6A 4KFBA 1IKVA 2XWYA 3I0RB 5F8HA 2VG6A 3H4BA 1JLEA 1S1VA 2YKNB 4F50A 1RT7B 4KKOB 4HKQA 5F9NA 3IG1A 1W25A 2YNIB 3BSNA 1SUQA 5DLFA 2UVVA 4KKOA 4IRKA 1LW0A 4NLRA 4O3OA 1RTDB 3MR2A 4FBUA 3OSPA 4DL5A 2J6TA 4ED8A 4WE1B 2OPQA 3D5MA 5KG2A 4QWAA 2EC0A 3PW4A 2AU0A 1RYSA 4ZPAA 1S48A 2IM3A 2UUTA 3OL9A 5KG0A 1TQLA 5F8IA 4IKAA 3QLHA 1HQEB 5KFSA 5HROB 3M8QA 4ZHRA 2BQ3A 4Q43A 4MFBB 3KLHB 3KHGA 1N5YB 3G86A 2JLEA 1C1BA 4YQWA 4K4UA 1HNIA 4LQ9A 3DLEB 2C2EA 4DL2A 5KFZA 4NLVA 1JLFA 1RTIA 3CJ5A 5KFKA 1RA7A 5DGAA 4IFYB 1T3NA 5J1EB 4M95A 1HMVA 5C42A 1RTJB 4RW8B 3PHEA 2I5JA 3NBPA 4Y2CA 1SH3A 2IJFA 1C0UB 4EO6A 2XGQA 2RDJA 3T5JA 2FJWA 1K1SA 4FBTA 3PVXA 3C6UB 3M9MB 3KLFA 3CJ3A 2IAJB 3IN5A 2V4RA 5CYMA 4ZP9A 4ED2A 1JIHA 4X2BA 4H4OB 2DPIA 1TL3B 4TY8A 5L1KA 3PR5B 5F9LA 2AGPA 3EZUA 4IR1A 4TQSA 4H4MA 3MEDA 2BRKA 1Z4UA 4IG3B 5KT4A 4ECWA 2VA3A 4I7FA 4ZP7A 3MF5A 3CVKA 1S9GB 4Y2AA 4RW9B 2JEJA 4RNMA 2WRMA 5DGBA 2B5JA 2I1RA 4TN2A 4LSLA 3MR5A 4F4YA 4EO8A 1N56A 3DLKB 3N6LA 1DLOA 5KFHA 4I2PB 1JLQB 3OL7A 1RA6A 3DRSB 1JKHB 1GX6A 5KT7A 1S1WA 4JV0A 3RAXA 4G1QA 1ZETA 3DDKA 4O4GA 3TVKA 3MR6A 3NGDA 4NRTA 3DMJA 1TKTA 1S9FA 2W8LA 5DQGA 3GYNA 1IKYB 1C2PA 5KG3A 4OL8A 2OPRB 4DEZA 5F8NA 1S0NA 2FLNA 1EETA 4RW4A 4ECQA 5J2NB 4ZPBA 3QGHA 3BQ1A 3FDSA 3OL6A 1T05B 4QPXA 4WFYA 2XI3A 4R8UB 5J2NA 3PR4A 3G6XA 4IOBA 4KB7A 4H4MB 1HQUB 3SFUA 2YKMA 1IKYA 3JSMA 1KLMB 3KLVA 4ECXA 1JLFB 1RTIB 4RW7B 1HQUA 1QAIA 1DTTB 3N6NA 3D28A 2D3UA 5L1IA 3DLEA 3C6UA 1ZTWA 5DG9A 2HAIA 3KLIB 4PUOB 1JLEB 2YKNA 3ITHB 3KLHA 2QE5A 1HARA 4Y3CA 2R8JA 1TVRA 1JLAA 4NLPA 3DYAB 3IGNA 5JXSA 5L9XA 3MFIA 4ED7A 3H5XA 3ISNC 4QWDA 5C5JA 1RT3A 2ZE2A 4ZMMA 1BQMB 3DLKA 3EPGA 2RKIB 4ID5A 3TQ1A 2WTFA 2WB4A 3MFHA 1IKWA 2ILYA 2JC1A 1HNVA 2IMWP 3HVTA 2JEIA 3DI6B 4WFXA 2V4QA 5L1LA 5C24B 1N6QA 4IG0B 5KFGA 5KG7A 3V6DA 1RTHA 1VRTA 4J9PA 4ECSA 1C0TA 1GX5A 1SUQB 3PW5A 5D3GB 1TV6A 1TKZA 3Q8PB 4MKBA 2C2RA 2IBKA 3LP2A 3V4IA 2XCPA 3BGRB 3KK1B 3QZ8A 1S4FA 4DL4A 4I2QB 1HMVB 5C42B 4WFZA 1S49A 4WZQA 1C0TB 4NLGA 3H98A 4FS2A 2IJNA 5C24A 3CJ4A 3HKWA 3RBEA 4QWBA 3EPIA 3LP2B 3V4IB 4KHRA 5K14A 4Y34A 3HVWA 2XCAA 3DMJB 5I42B 1S1XA 5F8LA 2D3ZA 3V6DB 3OLBA 3NL0A 4MIAA 1RT6B 1VRUA 2ZD1B 5HP1B 1IKVB 5KT6A 2BANB 2BQRA 3NMAA 1UWBA 1NHVA 2AWZA 1REVA 3GV8B 4K4XA 4DL7A 1JLAB 3KK2A 3FQLA 2RKIA 2FVQA 5KT3A 4QW8A 2ASJA 3M8PA 4R5PB 2R2SA 4Q0BA 2YNHA 1N5YA 2VG5A 2V9WA 1VRUB 2ZD1A 5HP1A 1TL1B 2B6AB 3CIZA 1J5OA 2W9CB 1HPZA 2WONA 2IAJA 2HWHA 5KG6A 3MEGB 4NLUA 4JV1A 1DTTA 3KLEB 4ZPCA 4J9LA 2B43A 3JSMB 3IGVA 3E01A 5EWFA 2OPQB 4RW6B 3FQKA 4Q0BB 1DTQA 4RNHA 3UDLA 5JUMA 5KFPA 4ED1A 2HMIB 4F4WA 2OPRA 2J6SA 1YVFA 2ZKUA 4K4YA 5KFOA 5KFLA 3H2LA 1RT4B 3KK3B 4NLQA 4O3RA 3QIPB 3KMQA 3DRRB 3BSCA 1J5OB 1FKOB 2QV6A 4IH7A 2W9CA 5HLFB 4K4ZA 3PW7A 3M9NB 2BR0A 4PQUB 3I0RA 4NCGA 3HVTB 2CKWA 4KV8A 3DM2B 1C1CB 1RT1B 4KSEB 3HHKA 4PWDA 4NLSA 3LANA 3LAMA 3QO9A 2GC8A 3QGIA 1SH2A 3G6VA 3DRSA 1UWBB 1BQNA 4KV8B 2XC9A 4EBCA 4LQ3A 1TVRB 4TYAA 3UPFA 3DRPB 1EP4B 2YNFA 5I3UB 1KHVA 4PUOA 1TL3A 5KFNA 3KK1A 5KFEA 2R8HA 4ECYA 2C2DA 1S9GA 2IA6A 2HNZB 1S10A 4XPCA 3T5HA 4TYBA 4QWCA 4ECUA 3MEGA 3CWJA 2OH2A 4IG3A 2YNIA 4O3QA 2FJVA 5KFIA 2R2RA 1HPZB 2WONB 5KFBA 5CYQA 4WYLA 3Q8QB 3TAMA 2YNFB 2VG6B 3FFIA 3DI6A 4O44B 2HWIA 3NKYA 3UQSA 2GIRA 4ECRA 2FVPA 2BQUA 3GIJA 2RF2A 1IKWB 3E01B 1RDRA 4ZVGA 2ASDA 2E9TA 1CSJA 3LP1B 3H4DA 3ICLA 5KFVA 1LWFA 1SV5B 1TP7A 2OPSB 2VA2A 4YR0A 1JLGB 1RT3B 2ZE2B 1FKPB 4EBEA 3DM2A 5DQIA 3MECA 3BQ0A 4LSNA 3DYAA 1N6QB 1LWCB 3V6HA 3DOLB 4NCGB 3I5CA 3Q8SB 2J6UA 5KFJA 1IKXA 3ITHA 4XO0A 3V6JA 3RB6A 5T14A 4MH8A 5HLFA 3OSNA 1TKTB 1I6JA 1C1BB 3DRRA 1JLGA 3T1AA 1HYSA 4WXOA 4B3OB 2DPJA 4ZHRB 1S1UB 4Q8EA 1U09A 3QLHB 4I2PA 3E51A 4ICLB 4J9MA 4RW6A 4NLDA 4U6PA 4LSLB 2C28A 3CJ2A 1RAJA 5KFDA 4IRCA 3CO9A 4MK7A 3PZPA 3V81A 4JUZA 2AGQA 5D3GA 1T03A 4IFVA 4IRDA 4IG0A 4KO0A 4TXSA 1RTDA 5KG1A 4ECVA 4K4WA 2R8GA 2VG5B 2FVSA 4URSA 5KT5A 4KFBB 2R2TA 5EWGA 4FS1A 4I2QA 2C22A 5FDLA 3M8PB 2JEFA 4O3SA 3UR0A 3GIMA 3FSIA 1WNEA 4MKAA 5KFMA 5DG8A 4Q44A 1EETB 4RW4B 4KAIA 1REVB 1S6PB 2W9BB 1RT1A 2BANA 4TQRA 4NRUA 2HNYA 3BJYA 1S0OA 1RT6A 4ZP8A 2R2UA 4RW9A 3CDWA 4RUCA 3N6MA 3KOAA 3KNAA 3GIIA 1KHWA 2FVCA 4O4GB 4I7FB 2FJXA 4ZVFA 3H5YA 2W7OA 1RT5A 2HNDB 3H59A 1RT4A 3KK3A 1RT2A 4G1QB 3DOKB 4WXWA 4RW7A 2ILZA 2OPPB 2HNYB 4Q8FA 1BQMA 1MMLA 2YKMB 4XPEA 3DLGB 4URGA 2XGPA 3RBDA 5CYMB 1JLQA 3KHHA 4EYHB 5KT2A 2BE2A 4WYWA 3CDEA 3KLIA 2W9AA 4H54A 5DLGA 2BE2B 4NLWA 1TKXA 3KLGA 3QIDA 4EYIB 4RNOA 1N4LA 4J9NA 1RTHB 3PJXA 4O3NA 2B6AA 4QW9A 1K1QA 4TY8B 5L1JA 4J9OA 5KFXA 3T19A 3CJ0A 3GQCA 3DOKA 3OHAA 3IS9B 4K4SA 3OHBA 5KFYA 1HNIB 2W8KA 4ZPDA 4R8UA 3M9OB 2IC3B 4HYKA 2HNZA 2AX0A 1T05A 5DQHA 4J9SA 5I3UA 3RB4A 2I5JB 3NBPB 4U7CA 1S1WB 1FK9B 1LWEB 5HBMB 3KJVA 3H5SA 3PJWA 4ICLA 5KFQA 3PW2A 2UVWA 1S1UA 1NHUA 2YNGB 4MK9A 4B3OA 3HVAA 5F8JA 4MIBA 5KFCA
chains in the Genus database with same CATH superfamily
1VHFA 1WELA 2RVJA 5GMEA 5FLXY 2HK2A 2UU9F 4DSIA 2HHTA 5KFWA 4TLRA 4CRJA 1IKXB 1JB0C 4JI3F 2E29A 2KT2A 3QYYA 4OZ2A 1S6QB 4UOCA 1LK7A 6FD1A 4LSNB 4WFNQ 2ZH1A 1DAXA 3J81Y 1NNDA 3BS9A 4R0JA 3WC0A 4NYZA 1HBNB 3J80U 1VBXA 3LAKA 3RB0A 4B3RF 3M6UA 1AT1B 3GIKA 3P49B 1TUGB 1PKUA 1YZ6A 4YR3A 1SH0A 2HMIA 1TV6B 3MM5A 3TVYA 2LLZA 2HS3A 1RABB 3HSDA 3FFIB 4A46A 4KBIA 2MQOA 1VK8A 5CYQB 1FRKA 2F65A 2FHJD 3IFEA 3SYZA 5D77A 1UVLA 3AOBA 1RWKB 4O3PA 2MQPA 1D8YA 3IG1B 2VUGA 4GC7A 4Q7AA 2PMWA 1X5SA 3BKTA 4DI6A 3PIOQ 1FXRA 5EDWA 4OI4A 3IR6B 1IXKA 1S99A 2AT1B 2AV5A 2AX1A 2PFDA 2Q1LA 2VFVA 2FJAB 4RBVA 1JKHA 1SC6A 1SI9A 1SQFA 2DNKA 4CNYA 8ATCB 1FA0A 1IM4A 3BREA 4ZN1A 4J9QA 4GKJF 3MAHA 3MPDA 3PFEA 1X5OA 2MB0B 2NUHA 3H0PA 4YR2A 2B5JB 2ZITA 1L3SA 4HDGA 4O0NA 3LH2S 1TL4A 5EX0A 2RDIA 2YWKA 4YB5A 3US5A 3U02A 4TVAB 4ED0A 4WE1A 2UZAA 3NS6A 3GJSB 1J5EF 2DO0A 2QFIA 2UUWA 3TP2A 2H3EB 3AOCA 1EARA 3ET6A 1TTHB 4J37A 4DSEA 1T03B 1AA1B 3N5FA 3TX0A 3EE3A 3VZIA 2Y8WA 2NSCA 2ROEA 4PPDA 2IJRA 2HURA 2IVMA 3DCAA 3LW5C 4JV2A 2ZUGA 4DX8H 4ZVEA 3DRPA 1Q0NA 1UKUA 5FDLB 3HD2A 1F60B 5B0EA 1RB0A 3OUYA 5L39A 3BO4A 2YQ0A 3NGSA 4X62J 4HH1A 2FLLA 4IDKB 1PSDA 3C14A 2YBVA 5IC6B 2N7CA 3KG4A 3D2WA 3IBCB 3ZNUA 1ZTTA 1RBOB 3CDUA 2E9RX 4KT0C 1UFWA 1CC8A 3B6BA 1OYEA 3CEDA 3E8OA 1X4DA 3M32A 4RUAA 2J0SD 2HHUA 1SJQA 4KHMA 1WC1A 2PN6A 3LTOA 4DLEA 3BQ2A 1WG5A 2HRYA 4R5PA 1RWNB 1HQEA 2VG7A 4MJKA 3MR7A 4E2FB 4WZMA 4ID5B 3PYDA 2LEBA 3LP0A 2K2PA 2ZOFA 4C8MA 4EUVA 2W24A 4QU6A 2M0GB 4X4TA 2R7WA 2N4DA 3JYTA 1YX2A 3L95X 1WOSA 1HFEL 3W61A 4CTAA 2DNYA 2M8HA 4P73A 3SMZA 1XMOF 1LXNA 4B9NA 1JLBA 2IY5B 3ELHA 2EWHA 2WZ1A 3Q23A 2FTRA 4F8RA 1FXLA 4H4OA 1Z2LA 1VRQC 2OTJS 4CLFA 3VQTA 2FQQB 3QGGA 1D0EA 2IC3A 4M94A 1RAOA 3NNHA 3MD3A 4HT5A 1UL3A 1M1HA 2G1DA 1CQMA 1T94A 1UVKA 2FZGB 2LQJA 2D41A 1RTZA 2F8EX 1RT7A 2X7IA 3PEJA 2NPFA 2ASLA 2KM8C 3QWPA 3W2VA 5I3PA 2A0FB 1R8PA 1VI7A 3TAPA 4CLUA 3IWNC 4O4RA 2H5JB 3R5BA 1ICEB 2BKPA 2ZJQQ 4X4VA 1MU2B 3SFGA 4OYZA 4IFYA 3NCPA 2WHOA 4I6WA 1KTQA 3X3UA 4DPYA 3B82A 5B09A 3K5LA 4L72B 1NUEA 1RT2B 1TKZB 1OS5A 2GW8A 2OFHX 4LBPA 1HNWJ 2N3OA 2W4DA 4MYTA 3WC2A 2H9ZA 3MR3A 3GP9A 2CJQA 4I68A 1LW2B 4ZJOA 1U49A 1TAUA 2GQCA 1Q78A 3I6PA 3TUPA 2B8QA 3HSJA 4KE5A 5HJYA 1NKBA 4UUWA 4W98A 3V6KA 3MECB 2H4WB 2H48B 1J27A 1LFPA 3HFKA 4CO5A 3UDCA 4P10A 2CWKA 3N0VA 1M1KT 3VGVA 4F4ZA 2NXNA 2QLFB 1UZHA 3LALA 3CCUS 4L74A 2JZ5A 2LKZA 4FXVA 4EEYA 4C9DA 4QIWD 4ZCIA 3MEEA 5DZ7A 3D0HE 1S6PA 3MMCB 1X4BA 1BE4A 5KFUA 2W9BA 2QYGA 4GC6A 2XMTA 5F8HA 3OUYB 2PC6A 2EFOA 2XM3A 4JI7F 4K59A 4JI5J 2F7VA 4KKOB 4HKQA 2ABYA 1RBAA 4Y0FA 1IBCB 4A8YA 1LFWA 1VQKS 5AJ3J 3AD9C 3H2VE 3N5BA 3P8BB 3QT5A 1RTDB 1U1LA 1Q1KA 1V3RA 3MCOA 2PGCA 2HHQA 2RT3A 3BGUA 1HQ2A 2EFNA 4PRFA 3D5MA 5KG2A 1MLAA 2AU0A 3PX0A 2NR0A 3D6HB 3PFOA 3LUYA 2JSXA 2XSJB 1S48A 2CDRB 2Q79A 3FSYA 1G3OA 1TQLA 4KHPJ 2HBRB 5EGYA 3QLHA 4ZVOB 1X9WA 4DV1F 2XS5A 3R2CJ 1D3WA 2C3PA 2ACYA 3GR1A 4WKRA 4MFBB 4FKYA 4A8OA 3CCSS 2VV5A 3QJJA 5CCLA 1HR0J 4U67Q 1X7VA 1NK0A 1C1BA 5CCMA 4DFKA 1HNIA 3DLEB 2FGOA 4DL2A 2C2EA 4WU2A 5KFZA 3TRGA 5THWA 1RTIA 4I1TA 5DGAA 4DV3J 3OXGA 1BXNA 1Q79A 2KJVA 2MZQA 3EJMA 1GAOA 1M1GA 2GAGC 4PKDB 2YXLA 4K7QA 1KWMA 3UDEA 4JOUA 4Y2CA 2OD6A 2XGQA 2RDJA 5BYSA 1QM9A 5D78A 1EB0A 2HK3A 5IFMA 3N9UC 3CD0A 1RBLA 2RSQA 4KIAA 4HHHA 4PG4A 1NK8A 1BHNA 2V94A 3GONA 3M9MB 1A0OB 3CJ3A 2IAJB 3QSIA 4FXDA 3ZTQA 4YUDA 4X2BA 4N7TA 1UP1A 3IM8A 3A8IA 2ZFHA 3BYPA 1RAIB 1YJRA 2GCFA 4TY8A 2Y1RI 4DCJB 3EZUA 1G4CA 2H5EA 3KXDA 4DR6F 3S7RA 1YJ9S 4IG3B 2XYHB 4I7FA 4FNIA 2XULA 3MF5A 3P5BP 2QJ3A 1S9GB 4U8VA 2QEXS 3C46A 1MMDA 4RW9B 3NGKA 1XJWB 2WRMA 2IMOA 2RUSA 2LEPA 4RNMA 2JEJA 2CJ9A 5K8MA 3MR5A 5LMUJ 2XLKA 4C4WA 2NQPA 2E66A 2ZZNA 5AXKA 4CLYA 3DRSB 2DIUA 1HBOA 1UPPA 3MM7A 1P9QC 4CLZA 2WB1D 1FWKA 1B7FA 5C2CA 2POKA 2HGNA 2RIJA 4FYYB 3PYGA 3TVKA 3BBCA 3MR6A 2MGZB 2DJWA 4NRTA 3MM8A 2X1GA 4UOHA 5T7LB 4A8MP 1Y5NB 1S9FA 1NK9A 1JJCB 1S4EA 4CP5A 2OSRA 3CDBA 1IKYB 2OPRB 5F8NA 1X5TA 2BJ9A 2X1BA 3F73A 2FLNA 3R6LB 3QGHA 1ZAVA 4KYZA 3FDSA 5M2PA 5AXLA 4QPXA 2CZ4A 2IHR1 1GK8A 4TLQA 4WFYA 1NJWA 2XI3A 4R8UB 5J2NA 1QDUB 2GVZB 2MHNA 1B7YB 2MZTA 2MTLA 2DYAA 4FP9A 4LF2A 5IV3A 1U2FA 3SFUA 5LXRA 3ZZUA 4C0OC 4K2JA 1AYEA 4RW7B 1QAIA 2IYIA 3GFYA 3ZZ0A 4ECXA 3TARA 6FDRA 2D3UA 3KG0A 3JB9k 1ZTWA 4DFJA 1H2UX 3FEXB 3M05A 3G96A 1U24A 3MUMP 5F0UA 5IM0A 3RGIA 2XNQA 3K5PA 1VIXA 4ED7A 1SJ4P 3ISNC 3I55S 3FNNA 2QFJA 1RT3A 2JH3A 2FB0A 4M5NA 4OJHA 4ZMMA 4M5LA 1DARA 2E1CA 2UUCF 1DQAA 4HHJA 5IS2A 4K0KF 4ZOSA 3OPKA 2WB4A 1ZZFA 2QL5B 4HACB 4NZ6A 3CCWA 3TR5A 3HK2A 3MPYA 3RRHA 1HBUB 3HI9A 2JEIA 2OP5A 3V5RA 1KKHA 1OJ4A 2VKZG 5IWAF 2VQEF 3LGNA 2DRDA 3R1LA 3FJ2A 3ONQA 4J9PA 4RWXA 4P71A 1GX5A 3WDOA 4RL1A 5D3GB 2BACA 5A8KB 2YY3A 3GZ7A 1D9FA 1YJTA 1VJWA 1F5BA 1REGX 2EXUA 3LP2A 3V4IA 3EWGA 4AE5A 1QVGR 4NI2A 4B17A 4FPRA 5JJBA 4I2QB 1HMVB 5C42B 3KKFA 5M2RA 4PG6A 2ACMA 2DRBA 3I9V9 2RQKA 2VC0A 3CJ4A 3POTA 2AD9A 3LP2B 3V4IB 4KHRA 2KFYA 2WSFC 1HKAA 4LRBA 2XCAA 1OPZA 3DMJB 2AHOB 5F8LA 4ELTA 2D3ZA 1A6LA 3GMGA 2RJZA 3MGJA 4BWJA 4X4QA 1VQ6S 1RWMB 1WSRA 2B7CB 3NL0A 1NEEA 1RT6B 1EZZB 2C2ZB 2DNHA 4PYAA 1R3NA 1IKVB 3MMAB 3W5ZA 5DETA 2BQRA 4DFPA 3ENWA 1Q8KA 3GV8B 4K4XA 1S76D 2VODA 2DNGA 5HVHA 2FVQA 2CAJA 2F4FA 2KHDA 1M0SA 1YJ7A 2DHGA 3M2VB 4LT6A 3M8PA 2R7OA 3B4DA 3Q24A 3KUGA 1YRXA 4WP8A 3J7AN 3MI7X 1KP6A 2QA4G 1U1NA 1WJ9A 2CNOB 1IBLJ 2IFXA 1J5OA 4ALZA 2GZOA 2IAJA 2LDIA 3CTRA 2HWHA 4NLUA 4JV1A 1DFDA 5FIIA 4TU7A 4ZPCA 3IBFB 2FHKA 3DN9A 3IGVA 3JSMB 4DPTA 2M3DA 4C7QA 4DV6J 2BDPA 4LFCJ 1GT8A 4RNHA 3NOCA 2YVSA 4LREA 4QR1A 7AT1B 2XO7A 3F56A 2OPRA 3D68A 1XNQF 2XS7A 1HD0A 1HL6A 5LM7E 1P6TA 4P6QA 3W9JA 4K4YA 1FF2A 3H2LA 1Z1ZA 2LXIA 3M4XA 3KMQA 4QU7A 2I0XA 4XTTA 3AQOA 1PJ5A 4IH7A 4ZJLA 2VONA 1HA1A 2CNLB 4AXIA 2BR0A 1RCOB 4ZIVA 3A3PB 5HK4A 3D67A 4PG8A 3I0RA 3W9IA 3M9NB 2LMIA 1GTEA 4KV8A 2XMJA 2YX4A 3QNWB 5T7LA 1RT1B 5G0RB 4UOGA 1AUDA 4N47A 4F25A 1FWPA 2RQMA 4E8UA 1KLNA 2DNLA 3LANA 3LAMA 1RAHB 2Z58B 4DXLA 1B99A 1R6VA 1YJVA 2VBZA 3QGIA 4S0MA 5J1PA 1SH2A 2BJDA 2OEMA 2JLGA 4LQ3A 1N5VA 4KV8B 1IR1A 2FPHX 1HI1A 1CJUA 2YNFA 3IR5B 2KH9A 4FF2A 2IA6A 5D4OA 2DH7A 5AJ3F 3G8QA 4XPCA 1RJJA 2YKQA 1JJHA 3CWJA 3K5OA 2R2RA 5L8RC 1HPZB 1OO0B 3GIRA 2A1BA 3ZFVA 4LF4J 1K47A 2YNFB 4ZVUB 3O2IA 5J1NA 3FFIA 2HWIA 2F63A 1UVMA 3FKBA 4DSJA 2RF2A 1IKWB 2QC3A 3JTPA 4ZVGA 1RDRA 1VBZA 2E9TA 1YRUA 2AW0A 2HHPA 3FVYA 3ICLA 3QT6A 1NH8A 1S57A 3ZZZA 3H4DA 3SV3A 2EG1A 4YR0A 2HGMA 2B8PA 1RT3B 4EBEA 3DM2A 3BQ0A 4WIIA 1QVFR 3A8EA 3RB6A 4NA1A 1VQPS 5HLFA 3WIUA 3OSNA 4LF7F 4PAAA 2DNPA 1C1BB 4I64A 4AL6A 2MKJA 2LEAA 4OJ1A 5GAGU 4AL7A 3QSYB 1QUPA 2LXFA 4WXOA 3K8WA 2DPJA 4ZHRB 1H7WA 1S1UB 2MKCA 1U6FA 1TUWA 3QLHB 3U27A 2DGXA 1LNQA 2C28A 3W2WA 1SKRA 3A3OB 4X4PA 3CJ2A 4NI2B 3B8HA 1A9NB 2EBEA 3CO9A 1VJQA 1FDDA 3OTEA 4MK7A 2XSFA 2DB1A 3Q89A 2GMJA 3SSRA 2OI2A 3CCLS 2V69A 1IR2A 3PZPA 1NK5A 3ETMA 5DM7Q 3DNCA 3U1MA 1CS4B 3M1VA 2QA4S 4IG0A 2FJEB 3K17A 4ECVA 2IDEA 4EZ6A 1VISA 2BKNA 2HAFA 4LR8A 3HCXA 1NSQA 5KT5A 4BC9A 4KFBB 2R2TA 1EAYC 2CJYB 3EZOA 3O3LA 4X66F 1R7IA 3J80Y 2J5AA 4M5DB 2VDHA 2Z0GA 5HJXA 5LMUF 3FSIA 2MZ1A 2DD8S 4C8YA 1SBRA 5DG8A 3UN3A 3JTOA 1EETB 4GO5X 4JI0F 2Y0BB 2K8GA 4KAIA 1F3VA 1FD2A 1F6TA 2G1HA 2XYGB 4QIVA 3R8YA 4KHPF 2BANA 2AEJA 3QJLA 3BJYA 3M6VA 1TK8A 4ZPTR 3HX9A 3RR8A 2DY9A 2KVIA 4DSLA 5I3QA 3N6MA 2LQBA 3KJQB 1FXDA 3D6MB 3OQ2A 2C1EB 5E3RA 4I7FB 3H5YA 2MEWA 1RT5A 2HNDB 1B0PA 4USJC 4CCHA 4G1QB 1UEVA 2ILZA 3MUTP 3PO4A 1S77D 1RLCL 1ZPVA 2D1CA 4LRDA 2JFDA 3GFXA 2DKOB 5ETMA 4Y00A 3UW1A 3A8JA 1SKSA 4C48A 1YK9A 3AJDA 4F67A 3ZZRA 5GAHI 4D3GA 2WSCC 1OQ3A 4V19X 1G1XA 1N0UA 1MG7A 4DV5J 2V8GA 4WYWA 1DHMA 3LF0A 4U95A 2CQ2A 2JOQA 3HJFA 1FFWB 4NLWA 3HSZA 3VVTA 1FNMA 3K58A 1N4LA 4J9NA 2GMHA 2LQ9A 4L73A 1CVJA 4C8ZA 2F9DA 3AB4B 5L1JA 5KFXA 2NZCA 3CJ0A 1UA0A 4B3RJ 3GQCA 3EVWA 4ZVQB 1NZ8A 3DOKA 3TUJC 4ANCA 1X4HA 1FJEB 5KFYA 3LA0A 4HYKA 3ILIA 3MDFA 2AX0A 4JP8A 4DPWA 4LFAF 1R8AA 5LJ3Y 1HWJA 1S1WB 1FK9B 3WIVA 4FVMA 5KFQA 2HFSA 3DXSX 5KOXA 3HT3A 4N56A 4DR7J 1FRMA 2Y0SD 4L6V3 1S1UA 1RU2A 4JI6J 2U2FA 3R6GB 1EKRA 2XMUA 5F8JA 2B9WA 1L5UA 4KY3A 2W7PA 4OYPA 4ZPWR 2VG7B 2DEIA 2YWEA 1WC3A 1G2EA 2IM1A 4C3LA 4EBDA 4NXMF 5K14B 3I82A 3L3CA 2CQ3A 4PWWA 2A2DA 2WVEA 2ZZTA 3BGOP 3FCWA 3DU6A 5E3AA 3KHRA 4ECTA 2OIHA 2XI2A 4RU9A 1KVIA 4HTJA 3JSBA 2ASYA 1LWEA 4LF4F 3RZAA 2JRSA 3MPWA 3VQSA 3H2UB 1X9MA 3D0IE 4DU8A 2HFNA 2ZNZA 2DHSA 2RF2B 3UNGC 5IQ6A 2O5DA 3OVBA 2BRLA 3CSKA 4ETXA 2KM8B 2BUNA 4DSKA 1KNZA 3CULA 4JYAF 2HHXA 1KVJA 4QWEA 1DZ5A 3CNQP 2XB2D 1LW0B 2W2PP 1S5ZA 4P2SA 5BR8F 2WOMA 2LP4A 3I5AA 1Q7LB 5GAEI 5CAAA 1T9VA 4DG1A 4NLOA 2AJ4A 1HNWF 1H38A 2O66A 4M63A 2I9SA 5LOQA 4DR3J 1AZSA 3JXOA 4C98A 1LWCA 3FRZA 5HVGA 4DV2F 1U45A 5BYRA 1NK6A 2V4JA 4DX6A 2R8IA 1WWHA 5ETSA 1MW7A 3Q86A 3UCGA 1UFKA 3D6TB 1LWFB 3C3LA 2G2ZA 5EX3A 2CQ0A 2GIQA 1SC1B 3TO8A 4DFMA 5H9EK 3OVAA 3MCMA 4O23A 2R4FA 1IWGA 4CH7A 1YZ7A 1WTBA 1X4CA 3ENVA 4F0HA 3BSOA 2UVUA 3NLCA 1OQ6A 1FERA 1QE1A 2D69A 2I2YA 1WKJA 5J2QB 1HWLA 4CO0A 1N5SA 2X1FA 3T1YF 1ZYQA 1RHUB 4NYPA 4NA3A 4YEAA 3KYLA 2J8SA 4XK8C 3H5XA 2KHCA 3LP1A 2WVDA 5E0OA 1O0PA 3GV5B 1E6YA 1F2HA 4ZDNA 4WU3A 4NXNF 2BOAA 4P72A 1Q86T 1OYDA 2M5YA 4DUTA 2CQDA 1LKZA 2HWTA 4DR3F 3TUIC 4KO0B 1X0PA 5KFTA 4TY9A 1YIJS 1YG0A 4M5IA 3LP0B 2K1RA 3CCES 2KFNA 1RI7A 4GKJJ 4FXWA 2CPEA 3T5LA 1N5TA 1UA1A 2ZOMA 4G3IA 2CADA 1JLBB 1FX4A 4QOTA 1CJKB 4DV7J 2UXCF 3MOJB 3X1LB 2IA0A 1HBOB 3R7SB 4Q45A 1IBMJ 1FKOA 4OHVA 4RLEA 2L9DA 2ZNYA 1NJXA 1HNZF 5C2GA 3W5YA 2KFZA 3ZC4A 2VFSA 1DQ9A 1XR6A 4YB1P 2WK4A 2X3GA 4JI1F 4P52A 3GFZA 3BPSP 4KGKA 4TKTA 2V4JB 4DWIA 4X84A 4QYRA 1XTZA 2COLA 1KOHA 2YX7A 3VTIA 3PO5A 1IUJA 4ZCLA 3KNGA 5A8WB 3PTWA 2XNRA 4RUHA 2E5JA 1H74A 2LFVA 3SI8A 3IR7B 5F8MA 2UVRA 3HHNB 4ZVPB 5K9FA 2ALZA 1JWWA 3V81B 1O51A 4QQBA 4URQU 1S10A 4F02A 1PJ6A 2GGPA 1QE1B 4NLXA 1YITS 3QZ7A 1GXUA 2BJ3A 4LFBF 2YNHB 3M2RB 3OV7A 3J81U 1PIEA 2VDIA 5J1EA 1V9OA 3W8GA 1UJ4A 2V2QA 3TZXA 2HSEB 3MM6B 4CH1A 1VQNS 4ECZA 4FF3A 3QO9B 4C11A 1HYSB 3D1OA 3IA0A 4DV4J 3NGRA 2UP1A 2EK6A 3CCJS 1S12A 4LBHA 4B08A 5J2MB 5A8RA 2NYHA 3DLGA 4R0EA 4Q2LA 3L09A 4ZVRB 4DMZA 3PKYA 3Q8RB 2E9ZA 3PYEA 3F41A 5ETPA 4YHHJ 2VZ9A 2QT7A 2U1AA 1RT5B 2HNDA 3CJTA 4EGLA 3KHLA 3AJ1A 4EMDA 4DUYJ 5IT9U 3EVOA 4IQXA 3C15B 3A1YG 4PWUA 2V34A 3QAEA 2CJXB 4ZLJA 3K5MA 1TL7A 2IRUA 5B0AA 2DO4A 2K3KA 4X4RA 1LWXA 1Q81T 3EGZA 3R9LA 4FYVB 3J81j 3IG1A 2DIVA 2KZMA 2XG8A 4JI7J 3NY0A 2V8PA 3DGPA 1SUQA 3OT9A 4Z2XA 1RZMA 3KTQA 1KD1T 4KKOA 2R7TA 4IRKA 1LW0A 2KO1A 4HHUA 4O3OA 5A8WA 3MR2A 1NJYA 3RBZA 2WBRA 1I1GA 2AKWB 3UD4P 2OPQA 3A12A 5CD4H 1NBEB 2QA1A 2B0GA 2BBEA 3C8YA 1WI8A 3QFWA 3HM9A 1VS3A 4NX9A 2QSWA 2V5HG 4F7VA 1SKWA 4XDDA 3C2PA 2G13A 1K8AT 2EVZA 2UUTA 1RWWB 5KG0A 5F8IA 1WTFA 3CB4A 3MMBB 4LF1A 4MAKA 1HNXF 1RUSA 5KFSA 1R8BA 1SIWB 3TW0A 4C0BA 2PEBA 4OHYA 4J5OA 2LQ5A 1KEKA 4LFAJ 1YJWS 1U8WA 4LQ9A 2HHVA 1JMTA 1UAWA 2OHDA 1O8BA 3W64A 1HHSA 2JDJA 3BN7A 5DO2A 2VFUA 2GFFA 2EBGA 4GMKA 4IYQA 2UUAF 3HO1A 1EQ0A 1B4SA 2ADBA 1CPZA 4OX9J 4DV5F 1VFJA 3PHEA 2UUBF 4DQSA 2LU1A 1PAUB 2B4PA 2GA7A 2IJFA 2PO4A 4B9LA 2MY8A 2R3VA 1R8HA 4FBTA 2AYGA 3C6UB 1RHQB 1Y4ZB 5DZ6A 3VGTA 3KLFA 3WHIA 2VOPA 1VQ8S 5ETKA 3RTVA 3KWMA 4H4OB 5ITHA 3PR5B 2AGPA 1RHRB 1VCTA 4TQSA 4IR1A 4JYAJ 2BRKA 2AJ2A 4U9RA 1Z4UA 1RACB 4ZP7A 1NSKL 2Q6CA 3PXGa 1HBMB 3CVKA 4JI8F 2DCLA 2B5JA 2G0JA 2I1RA 1N56A 2W1BA 2HLTA 3DLKB 2KRRA 1KOOA 2MJUA 2QMUB 3N6LA 1BY9A 2XZTB 2G2OA 1RA6A 4M5JA 2DNNA 1GX6A 3ZTRA 1B70B 1U1PA 2DGWA 3GB0A 3RAXA 1ZETA 3HHLA 4LF6F 2OSQA 2HVEA 4ZPVR 3GR0A 3SCLE 3EXCX 4ZITA 2DR9A 1ZA1B 2C42A 4NXMJ 3NMRA 2MPUA 1IBLF 1WHXA 4PEOA 1Q8IA 4CYUB 3EYZA 4RX6A 1TZ0A 3NWRA 4FKXA 2DR5A 2VHGA 3TZWA 5KG3A 2PE8A 1CULA 4Y28C 1ZM2A 1IQZA 3SEOA 4UOFA 4AXJA 1EETA 3HLUA 4ECQA 2RRBA 4Z7CA 4USKA 3BQ1A 3PX4A 1F1BB 1EJ7L 5KAKA 4F36A 4K2XA 4FPIA 5CHCB 4P7TA 4DQRA 1U8SA 5A8KA 2OD4A 4KB7A 4OX6A 4H4MB 3ENQA 2ZH5A 4JI5F 1HQUB 2RS2A 2YKMA 2YKPA 3JSMA 1JNZB 1Y5LB 2DHAA 3P96A 3TJAA 3D28A 5IXUA 3C6UA 3IP0A 4N8NA 4Y6IA 5DG9A 2ADCA 4OFZA 1N33J 2VH7A 5HQ8A 4NXNJ 1GTHA 2G4BA 1JLEB 1XWLA 2KI2A 2QE5A 5L46A 1VQ9S 2R8JA 1AFJA 1TVRA 1JLAA 4NLPA 5JXSA 3BO2A 5CABA 3CJKA 3QRRA 4K5SA 1WUUA 3T3FA 5C5JA 2F8HA 1QY7A 1YJUA 2Z56B 3EPGA 3OBIA 2RNEA 2XSJA 1APSA 4MIWA 2WTFA 1Q7YT 2CPDA 5G0RA 1IKWA 3BDPA 2VD3A 2UUAJ 1IBKF 2IMWP 1NM2A 3A13A 1EX8A 3A3NB 4IQMA 3PCOB 3LO3A 5LXYA 1N6QA 3NWGA 3H7HB 2GX8A 2X3DA 5KFGA 5D4NA 1RTHA 1VRTA 4ECSA 3PW5A 1SUQB 1IM6A 2D74B 3LGHA 4LVOP 4OYOA 3RR7A 1RU1A 1TV6A 2CPFA 3Q8PB 3VALA 2C2RA 2IBKA 4OIXA 2HQIA 1HBMA 3I56S 4NMLA 2QZ8A 4USUA 3KJFB 3W9HA 4J7CA 4WFZA 2Y9HA 4WP9A 3M8RA 4NLGA 2R42A 3H98A 3UWTA 2JWNA 3AB2B 2IJNA 2O3DA 3M8YA 4LR7A 3HSGA 4WJBA 3UFCX 1H2TZ 3PNIA 5K14A 4UZCA 5K20B 3HVWA 2A6OA 4UW2A 4PXCA 4K4WA 3TA0A 3V6DB 2XY6A 3D1QA 4Y2MA 1PBAA 2BANB 3VAIA 3NMAA 1UWBA 3HPOA 2AWZA 2ZOGA 2J9DE 5EHHA 3ADAC 2XBPA 3FQLA 3B78A 4CO2A 2RKIA 4O0IA 2C2NA 5EN1A 3C19A 3MUVP 2CPIA 2PA8D 1XMQJ 4CLPA 5HQLA 2W2MP 3FBEA 1D8ZA 4R5PB 1P27B 3VGSA 1UMJA 3UD5A 2VG5A 2CJBA 5FD1A 1VRUB 2ZD1A 5HP1A 3PRBA 2MQQA 5GAEU 2ZBCA 2ROGA 3BF4A 2VJVA 3GG0A 2B6AB 3IC1A 4X4NA 2QMXA 2WONA 5MAOA 2E1MC 3BEGB 4P75A 2N4CA 2KKHA 4K5RA 4CLTA 3MEGB 2RHSB 2J7WA 3HZGA 3KLEB 2ZC4A 2L48A 2YWWA 1P9YA 3QWUA 2FY8A 3ILLA 4GVBB 2OPQB 4RW6B 5HN0A 3FQKA 2EPIA 3QGPA 1MNEA 3MTJA 4CLLA 1M5PC 4F4WA 1CULB 2DXDA 2BA9A 4PYDA 4BHQA 5LSOA 1SVDA 1T9WA 3K89A 2LVWA 2BJ1A 1FE0A 4OZJA 1RT4B 3QIPB 4OZNA 3OTDA 1D9AA 1T02A 1Y9OA 1MN7A 3DDIA 3JQKA 1WG4A 2W9CA 4DHVA 3PW7A 1FRHA 3RJMB 1CJUB 1Q16B 4NCGA 4A48A 3ZTOA 3FEYB 5CH7B 1YHQS 1K0TA 4X64F 2PT0A 6AT1B 3JQMA 3DM2B 4KSEB 2IVYA 4JI2F 2OEJA 2APOA 2YWFA 1S6UA 1MROA 4DCOB 2GJIA 1CEZA 3QO9A 1QAYA 1OSDA 2QN6B 4DR5F 1X60A 3H42A 5D4PA 1HHTP 3DRSA 2O67A 1JXEA 4M5DA 5LT5A 2C2KB 1UWBB 1BQNA 3FBFA 2CQCA 2XC9A 5SZTA 4EBCA 1NKEA 1TVRB 2J7KA 2J9EA 3FZBA 4TYAA 3UPFA 3N28A 1FI4A 1KHVA 3UR3C 1S6OA 3G71S 3C66A 2D9PA 3KK1A 3DRYA 5KFEA 2HNZB 2OH2A 3FSXA 3T5HA 3KG1A 4QWCA 1FJ7A 1FJGJ 4IG3A 4O3QA 2FJVA 3IWLA 2HHHJ 5CYQA 2AZ3A 2HZVA 2BXJA 2JVRA 1VC5A 2E44A 2CPHA 2DBBA 1YLXA 1V3ZA 2E7VA 3MCNA 1I5OB 2GIRA 2VPWB 2BQUA 3GIJA 1U26A 4A8WA 2RDDA 4OZ1A 2HQ3A 2DR8A 3CC4S 3ZZYA 2HFVA 4I6AA 2OELA 3ZZOA 4UF4A 5KFVA 1SV5B 4QYZK 2HFOA 4A47A 1XMBA 2VPYB 2GJ2A 1HW9A 3MECA 3B4MA 1WOPA 3EGWB 3DYAA 1BD6A 1LWCB 1HD1A 1KN6A 2LCWA 2RD5C 3Q8SB 2J6UA 2AJ1A 3IO1A 3ITHA 2VQFJ 4B3SJ 2NREA 3Q2TC 4ID8A 3MZIA 4RUBA 1NPKA 1RLDA 4B9UA 1WEXA 3GCWP 3QT7A 1NAQA 2CPXA 3D0GE 3LWMA 1Y7PA 2J76E 1FD8A 3VHQA 3MM7B 2G9OA 4OZ0A 2VB6A 1RAEB 2BYCA 4ICLB 4KGXB 1F9FA 4RW6A 4LSLB 2B7BB 3VCDA 1VQMS 3IAS9 8AT1B 1UTAA 4IRCA 7FDRA 2YKAA 3V81A 3BN4A 4FVCA 4WWSA 3I31A 3L4BC 3QMQA 5BYQA 3RYLA 4B9SA 4KPYA 1U2RA 2E7XA 3MM9A 3LPEA 2Z2ZA 2KJWA 4TXSA 3SXLA 5KG1A 1UWAA 4QZVB 1NRKA 2VG5B 2FVSA 2R8GA 4WFAQ 4N77A 2UXDJ 4O3SA 2C22A 2JEFA 2ZJPQ 5D4LA 2MLXA 3UR0A 5BR8J 1ULRA 1WNEA 4CT9A 1PGZA 1DY3A 2NXUA 3EM1A 4RW4B 4Q44A 1UJ5A 2YX1A 2CQ4A 2DHXA 2DNMA 2E7WA 4OV6A 2NPIA 4NRUA 5DM6Q 1ROFA 1WHVA 5DDRC 4ZVTB 1S0OA 3BKFA 2MMYA 3R3TA 4RW9A 3CDWA 2XLIA 3KOAA 3DDNA 3RU0A 2KXNB 4I0WA 4A8SA 4ZVFA 1WC0A 2ZEJA 1RT4A 2DGUA 1RT2A 3H59A 3MPUB 4B9VA 3OR1A 3J7YI 3FK4A 4IOAQ 4K0KJ 1VIOA 1MMLA 1WC6A 1FDAA 1XQIA 2XTJP 5CYMB 1TK0A 5ETQA 3CJKB 1HI0P 2MLZA 3QPIA 4OLPA 2JJ4D 4EYHB 5KT2A 3T1HJ 3PDNA 5GMDA 3CDEA 2UXDF 3KLIA 3DU5A 1VQ7S 2C3OA 4OHWA 5LMNJ 5DLGA 5B0CA 4AQYF 1UW9A 2YQ3A 1LK5A 2HS0A 4P7VA 2HQFA 4Y2KA 4O3NA 2Z57B 3T6BA 4ATNA 2IYGA 4WKYA 5B0BA 4QW9A 2UV8G 2HBYB 4J9OA 2FY1A 3AA8A 4WPAA 1CS4A 1DQ8A 3M1VB 3OHAA 5CQGA 4FYDA 1CJVB 3OHBA 3UCZP 4V1Ak 4R8UA 3CW2C 2HNZA 2OMLA 4DR6J 5E3PA 1VQ5S 3FRYA 4W4MA 5I3UA 3AQPA 3RB4A 3CC7S 3H5SA 1KSPA 5HO4A 4RKUC 5DS7A 3THVA 3ZZTA 3ENAA 1GH8A 4LBIA 1X5PA 2Z2YB 1WDTA 5KFCA 3AT1B 1QAJA 2DH8A 3SDEA 2VQFF 1C1CA 2V0NA 1MMNA 2O01C 4ZS6A 4JI1J 4W92B 2ZVIA 1KQSR 2CJKA 4NA2A 3DRXA 4ED6A 1KLMA 5IT9Y 4ZVHA 4QR2A 2ZH7A 3ZXWA 2QYCA 1I94J 5GAGI 3C6TA 2K7JA 3VR1A 1XR7A 4P2MA 3CCVS 1U0HB 5HBMA 3KJVB 2GVZA 1BQXA 3D66A 4IO1A 4CO4A 4X4SA 1ZPWX 4F26A 2H1YA 3UD3P 4UT4A 2XS2A 1S1VB 3RB3A 5CZVA 1SB6A 1BLUA 3BSAA 2FYXA 3D6FB 4P74A 1KDNA 1JJ4A 5ETRA 1XIQA 1XR5A 3TZZA 4NE9C 4R25A 5HMYA 4DV4F 1ITPA 4C8NA 2LXUA 1PYOB 3GYGA 2OPPA 3CMAS 2ZDPA 3CMES 2HLUA 4IH6A 1VHIA 2PMZD 4F4XA 2M70A 2Q43A 4ZLLA 3QQCD 1F5AA 3SZ2A 2YH1A 1YJNS 4C0HA 2BJ7A 4UY8T 3KDNA 1SJFA 1K9MT 4NCBA 2CQHA 4JV5J 2PD1A 2XMMA 1FKPA 2QMWA 5HMXA 3PG9A 1OY9A 1R31A 1SPBP 2NXCA 4QJVA 4BCAA 2H4YB 2CWXA 4ZCMA 2J9CA 3G6ES 2AQ4A 1U6ZA 2DHHA 3UN5A 1SQEA 4KTQA 3DKDA 2KL8A 3P4UB 2EFVA 1W7WA 2GAHC 4EU0A 4USHA 1IJEB 1WEZA 2AP6A 2AEFA 3I4HX 3L7UA 4YOEA 1RYRA 2VBWA 3M8QB 4IUFA 4CDIA 1RQ0A 4M5GA 2E1PA 2P9EA 1N48A 4CLKA 2FZKB 5I42A 1PYTA 5EWEA 1YSJA 4C8LA 2K3IA 4K4VA 4NEZA 1KR4A 2GMLA 1HWKA 2X51A 4ILLA 5LJ5Y 4UUXA 1C0UA 1N34J 1S0MA 1WSVA 1Y3KA 3Q83A 3RRKA 2RU9A 1Y0HA 3UDVA 3C6TB 2DK2A 1BQNB 2N7YA 3MEEB 2I8EA 4DPXA 3WX8A 1N34F 3CE8A 2AGOA 4PXDA 1RHJB 4TNOA 1DURA 2AMCB 2AYBA 1HNXJ 2XY7A 4IR9A 1SQGA 1Y3JA 2CVIA 4I69A 3GILA 2BABA 2DCUB 2KT3A 1VRTB 4ITSA 1YBUA 5ETOA 1D1UA 3TVZA 4USMA 1S6QA 2D7SA 3G2XA 3DLLQ 1TFYA 1RWOB 1HNVB 1X4EA 4DL0C 5ADZA 3SCIE 5J2MA 5A8RB 1NK4A 2HFUA 5B0DA 3M8ZA 4DL6A 2W4PA 2KG1A 4IH5A 3NNAA 2L41A 1OY8A 4OX9F 1O6XA 3VZHA 2BX6A 1NDCA 3M8SA 3PV8A 1MU2A 4ED3A 1XMOJ 2DGSA 3MTKA 1IJFB 3HMJG 4B02A 5J2PB 2FLPA 4L3NA 1D09B 1UJ6A 3GJRB 3AD8C 3TZYA 1LW2A 3K59A 2BW2A 1VLYA 4CIOA 2GQ2A 4L75A 1JX4A 1S1XB 2QRRA 1VOMA 1HLWA 4OZLA 5HSPA 2OPSA 5F8GA 5H9FK 1WF2A 4YS2A 4LRAA 5MLCV 4U7UK 1S9EB 1S97A 1M5KC 3H40A 3I87A 4RNNA 3IRXB 2CNNB 3VGUA 4UQGA 3W2WB 4RW8A 1EKSA 4CO1A 1A7GE 1Q8BA 2WW4A 2BV3A 1VMBA 3N79A 2C3YA 1E6YB 2DITA 2V2ZA 3JYTB 3TAMB 3BR9A 2CYYA 4ZP6A 2VICA 4OYWA 1S9EA 1XNQJ 1S0VA 3SSSA 2F5GA 3H5UA 3KK2B 3TUZC 4PWDB 2GJFA 2V8DA 2FJDB 3PYFA 2NZ4A 1QUVA 1DBDA 3AA9A 4LVNP 2IVFB 2Q3PA 3JQJA 1M5SA 2HRTA 2FGCA 1ZH5A 2RILA 3TX8A 4C3KA 3CD6S 2AGQA 1NSPA 4J9KA 2HVHA 2PMHA 4KGZB 3OLAA 3EX7B 1F2GA 4DG1B 1JLCB 3I0SA 1UFLA 3ISND 2LU2A 4LJMA 4OZ5A 3SCKE 5A76A 4ED5A 4TU9A 4WK1A 4A8KA 1FFSB 3EZ5A 3PJ9A 1R0AB 4DBQA 1NH7A 1PCAA 1FEHA 4YP3A 4K50A 2R7UA 1V5IB 2XEXA 4F4KA 1IKVA 2XWYA 3I0RB 3MMAA 3HULA 2VG6A 4BLGA 1JLEA 1S1VA 1QTNB 4F50A 4DCPB 1G6BA 2V63A 4QWAA 3MEKA 1BGXT 4DN0A 1T9TA 5F9NA 1RE1B 2YNIB 3M7VA 4EI2A 1HBNA 5DLFA 3I32A 4NEYA 4PXBA 2XZWA 4Y2IA 3R7NB 3W62A 2ZC3A 2MZJA 3ILOA 3PM9A 4NLRA 4X4OA 4DN9A 1VBKA 3DOMB 4M5MA 3WQPA 4X62F 3OSPA 4DL5A 2EW9A 2J6TA 4HR2A 4NASA 3TAQA 3BKUA 4AL5A 2EC0A 2ZWOA 3EXYA 4DZ6A 3LPYA 2ZH9A 1BWEA 4HTIA 3OFEA 3PW4A 2P6SA 2OJ3A 4ZPAA 4JI0J 1S59A 1QD1A 4KC5A 3VAMA 3BB5A 2IM3A 1H3DA 2IPOB 3CGIA 3DGVA 4MYUA 2WVBA 1Q53A 1RISA 3BGLA 4IKAA 3WZ0A 1SC3B 3OJUA 1UVJA 3CJQA 5HROB 3ZTPA 1XERA 2DGTA 2RU3A 4DR5J 4JI8J 2KZZA 4Q43A 3KHGA 4PZVA 2F4VJ 1N5YB 1AFIA 3VAJA 1B3TA 3IRWP 2XWXA 2M2BA 4F2SA 2ZH3A 2PFFB 2QTWA 2FUG9 4NLVA 4LIRA 3CJ5A 1VK3A 2ZJRQ 4JB8B 2A18A 4HH0A 3W63A 3VF0B 4M95A 1RSCA 4RW8B 4EO6A 2I5JA 1C0UB 4HLBA 4NMXA 2AYEA 2FJWA 2BJ8A 4MTPA 1K1SA 2A10A 4FN5A 5AE1A 7FD1A 1N36F 2CA9A 1SKUB 3IN5A 4ELUA 2V4RA 1U0SA 4ZP9A 3GSIA 4ED2A 2V8HA 2DPIA 1TL3B 2MQMA 4H4MA 3MEDA 1FRLA 2J0XA 5KT4A 4ECWA 2BZ2A 3EVMA 4N41A 4A8XA 2OLWA 3BPDA 4X66J 4Y2AA 2MSSA 2P5VA 1LOUA 2H51B 5A6PA 4F4YA 4LSLA 3HHLC 3HP6A 1XNRJ 1HNZJ 1JLQB 3BYRA 1TU0B 4GO7X 3WBZA 3OL7A 2G0CA 2NLWA 1W26A 1CJTB 3BDEA 3QATA 2E5HA 2J9DA 1Q95G 3M30B 5U47A 4G1QA 3IAM9 4DS5A 3UNYA 3K5NA 3DDKA 2A3JA 3SDEB 1N5QA 3NGDA 2HHWA 1C4CA 3DMJA 1TKTA 4YDXA 1S79A 2CNKB 2GQQA 2P9CA 3HHLB 2W8LA 5DQGA 3H90A 3GYNA 3K7RA 4N8OA 4OJ3A 2UUCJ 1C2PA 1PILA 1C4AA 4DQIA 1MWZA 3AOAA 4DEZA 4DR4F 4GKKJ 3R97A 1RHMB 2YH0A 4RW4A 3TNVA 3OTOJ 2MHEA 4ZPBA 1LQ9A 4C11B 3PACA 1H98A 3OL6A 1T05B 4DV0J 4LF5F 2B4UA 2DXEA 4F0MA 2BMBA 3CCRS 3M6XA 3SCJE 1L3UA 4OX7A 1FHTA 4GVLA 5LL6d 3T1YJ 1VC6A 1KLMB 4LF8J 4NCAA 4GRSA 3KLVA 1JLFB 2IRYA 1WDDA 1HQUA 2CRLA 1DTTB 1OWXA 1ZS6A 3N6NA 3CCQS 3D54A 3DLEA 1X4AA 4WP3A 1KQFB 5BJRA 1ZAWA 2B56A 5JVHQ 4ZCKA 2VKRA 3K0JA 1TR0A 4OJGA 3K2YA 1WKKA 2YKNA 3U7JA 3KLHA 3C16B 3PEHA 2HVDA 5D15A 4Y3CA 3JAMU 4DV1J 2LECA 3DYAB 5F41A 1M5HA 2GVDB 3AJ2A 1UVIA 2F4VF 3FCVA 3G82B 1BQMB 3DLKA 1WKLA 2NSBA 2KDOA 4OQJA 2GS8A 8RUCA 2FC8A 1BUXA 2XMAA 1Q82T 2Y8YA 5FLXU 3OTBA 2NS1B 4KGMA 2MZRA 2MGZA 2MDAA 3MFHA 2MYFA 2RS8A 2AZ1A 2EEYA 2ILYA 4ED4A 1IR0A 4LF9F 3HVTA 3M2UA 4DPOA 2V4QA 2DNZA 5L1LA 1FVSA 4DUZF 1QSLA 1GNKA 3TJ9A 3TA1A 4LUBA 1C0TA 4DSFA 3QRQA 5T41A 2IIHA 2GIFA 3JS9A 4DV3F 1SJ3P 1TKZA 3RUBL 4MKBA 3IXQA 3BGRB 3KK1B 2LDYA 4CQ1A 2A2CA 4PQAA 1S4FA 1S49A 1T9UA 1C0TB 1F9EB 3NCRA 4DOZA 2CQ1A 5C24A 1S7HA 3L7PA 5E33A 4QWBA 3T41A 4FS2A 4AT1B 4Y34A 4KR0B 1NU4A 1VDHA 1HBUA 2KT5A 2KU7A 3DGPB 3G87A 4RR5A 5D0HA 3MM8B 5I42B 2G2YA 1S1XA 2AIRB 5AT1B 1AROP 4ETZA 3OLBA 4M5KA 4MIAA 1JQGA 4PPZA 1VRUA 2ZD1B 5HP1B 3FMBA 2L3MA 1J2VA 3HHLD 5KT6A 4JI4J 5G4DA 1L3VA 2VC1A 2V67A 1FNXH 4LF9J 4LF8F 1GXTA 2EC2A 1JLAB 1RP5A 2MKYA 1ACMB 2VASA 2PI4A 1XMQF 4LF6J 5ETVA 2KXHA 4DZDA 5KT3A 2XYPB 2ROPA 3MXHP 4USIA 4MT1A 4C3MA 2DH9A 3AAWB 3NS7B 2ASJA 2PI5A 3ILJA 4YHHF 1T3OA 2MLYA 3EDRB 2QX0A 4ELVA 4B3MF 1WG1A 4NWBA 3CIZA 4YY3J 1FRIA 2VFTA 1RKJA 4XDCA 3D9BA 4RPFA 3QAUA 3RG6A 3JSYA 5KG6A 1DTTA 2WAQD 2DY1A 4C8KA 3DHXA 4QYZJ 3EMTA 1JNRB 1EIYB 2UXBJ 3E01A 4Z37A 5D6GA 5EWFA 1B0TA 4F0KA 4Q0BB 2KB2A 3UDLA 5KFPA 4ED1A 2F1FA 2D9OA 4GVBA 2DXFA 1SJ1A 3W2VB 1YVFA 3I96A 2ZKUA 4KH1B 4WK3A 1NLKL 5DRKA 5KFOA 5KFLA 1SJRA 4NLQA 1R0CB 2MJNA 2HQGA 1J5OB 1FKOB 1K44A 2QL7B 3CD7A 3OR2A 4K4ZA 3R2DJ 3G8TA 3FBBA 4KPCA 2O1PA 4PQUB 3IM9A 2HZAA 3HVTB 2CKWA 3M2UB 1U7LA 1H7XA 4IO9Q 1YRTA 3HHDA 3R7BB 5E3CA 4NLSA 3W5XA 1NKCA 2OMOA 1NJZA 2DNOA 2QLWA 2GC8A 1JK9B 2V6AA 2RB7A 4HDHA 4PR6A 4BWMA 1FJCA 2N82B 4D3HA 2JLFA 2QIFA 1AZSB 1LXJA 3N01A 3DRPB 1FNOA 3ZTSA 5I3UB 4PUOA 1FTCA 1V5VA 1S9GA 2FHMA 4ZIWA 4ECUA 3P5TL 3J7A1 2YNIA 1TK5A 2W7AA 5H9EJ 1R89A 2WONB 1U4BA 1JXVA 1L3TA 3OVSA 1HIYA 3ET6B 4WYLA 1CQNA 3Q8QB 3ISZA 5IZHA 2UUBJ 2RE1A 1URNA 2CUYA 3NKYA 2ERRA 4E98A 5GADU 4ZLPA 1FESA 1HW8A 3VAHA 2RAQA 1I3OB 3DHWC 2F9JA 1SL0A 1TELA 2E5GA 1R8CA 1JLGB 4RJVA 4ZN3A 4QIGA 2HQDA 2OEKA 1FE4A 3NG8A 4DU7A 3V6HA 1N6QB 2X1AA 4LF7J 3DXBA 4USVA 2BE7D 2M4MA 1IKXA 1UEKA 2HBQB 2A6MA 2C2MB 5T14A 2P8IA 2ZZMA 1ZM3A 5L9NA 1TKTB 1I6JA 1NDPA 2MKKA 1FWLA 3D3CJ 4B3SF 1JLGA 3MPVA 3MMBA 1KBRA 4M8LA 5E5NA 2WVFA 1AUSL 1HYSA 3O8WA 4Y65A 2QA2A 2EFQA 3D7SB 4G6VB 3AFGA 4IOCQ 5SUHA 5K8OA 2VL1A 4Q8EA 1U09A 2HQCA 5HMZA 5GMKa 2HIQA 4ANDA 4J9MA 4U6PA 4F3MA 1TAQA 1NXIA 1J5EJ 2HVIA 5B7WA 1QSYA 3R5JB 4X65F 3DLBA 4OLOA 5D3GA 1UZDA 4IFVA 5F0WA 4OHZA 4KO0A 4IRDA 2FD2A 2XGPA 1SC4B 2V2KA 1IVZA 3PX6A 4U8YA 5EWGA 4URSA 3O44A 4OMFG 4I2QA 3W65A 1FRXA 5LMNF 3GLJA 1P1TA 3AY0A 4WTYA 2W4CA 2GHPA 3M8WA 3GIMA 1U25A 2MZSA 2ZH6A 4B3TJ 2ATCB 3TJ8A 2QO3A 1MN9A 2EKYA 2FDNA 4DUYF 2B4VA 5ETLA 1WHYA 3G82A 4C8OA 5IT0A 2W2QP 4ZA1A 2HNYA 2QLJB 3GG1A 1W2IA 1RT6A 2CVEA 4WFBQ 2Y1LB 4RUCA 3KNAA 2GNKA 3GJTB 4FYWB 3GIIA 2FJXA 3HFZB 2RQCA 9ATCB 2OUGA 3GU0A 4HT7A 3UN2A 4XIUA 2W7OA 1UPMB 3DOKB 4WXWA 5L1KA 2OPPB 4H4KC 4EFAC 2FJBB 1U48A 2HNYB 2H65B 4AYBD 1KQKA 5KTQA 4X65J 4URGA 3W66A 3DLGB 4Q8FA 1KFDA 2HW3A 1F5CA 4LSZB 1JLQA 2VQEJ 2GVDA 4QIFA 1XK8A 4DR2J 2KYXA 1X4GA 4ENOA 3J7ZT 2BE2A 1BMQB 2JX2A 2WVCA 2GGPB 3MAAA 5HQMA 4OI1A 4LFCF 1FJGF 4AQYJ 5C7PA 1FFGB 1RWUA 1WOOA 4PABA 3QFHA 3UVJA 1P1LA 1DRZA 1U0HA 3DC2A 3EDQB 4EYIB 5CA5A 3TQEA 1ZM4A 1RTHB 1NPPA 2DT9A 2CIMA 2B6AA 2ZDOA 4HEA9 3VWSA 2F3JA 3GSDA 3T19A 2HS4A 3HJVA 4YDDB 3MM9B 3CC2S 1N0VC 1YI2S 3FMWA 3UVJB 3TWZA 2UV8A 2IC3B 3OJSA 2ZVSA 5HMWA 2ZBPA 3M9OB 3CCMS 1T05A 2GV1A 2P6TA 4J9SA 4AFFA 4AUKA 2I5JB 4DR1J 4K4UA 1LWEB 2BM0A 1YQHA 5K8PA 1RAAB 4G1IA 3RW6A 2PSZA 1N52B 2CPYA 3AODA 3M6WA 4KJIA 2UXCJ 3CD5A 2EFPA 2YNGB 1FDNA 3R1HA 2DGQA 3ZZPA 2XMVA 4B3OA 1Q5YA 4MK9A 1X0FA 4CYUA 4BDPA 2NCKL 1KONA 5E41A 2RRAA 5IT4A 5C25B 2Z2MA 4J9RA 3TOQA 3EGNA 1PBUA 3GWCA 1V3SA 1W2BR 3OFHA 3MEDB 3R27A 1G7CB 1S1TB 3BM7A 2EI5A 3T5KA 4MFBA 2I6WA 2YNGA 2C2OB 2FZCB 4QR0A 4A8FA 4HVZA 1WC4A 4IFVB 2Z30B 3IWXA 2Y1JA 2R8KA 1TKXB 1FK9A 3KLGB 3NAHA 4GKKF 1JXLA 1T7PA 3KMSA 3CCZA 3BGRA 2IM0A 2QSFA 4NZ0A 5D0EA 2W2OP 1JJ2R 5B0FA 4DQPA 3U1LA 4CO3A 2ATLA 3QRPA 3IS9A 3HZEA 4FNHA 5A2QY 4O44A 2UXBF 3DOMA 1QTMA 4LFBJ 5KFFA 4OYXA 3IBWA 1QAXA 1M5VC 5HL7Q 5H1SV 5E2QA 4C2MA 3HKZD 2JC0A 5J2QA 3CMQA 1TL1A 2JHEA 5F3TA 1M5OC 3HXMA 2CG8A 1CLFA 2J8AA 4UZBA 3HVRA 4DL3A 3TI0A 2YKOA 5EUHA 5HROA 3HF5A 4EWTA 2HFZA 3B54A 1X31C 2QL9B 1H72C 2W01A 4F3OA 1DLOB 3OXLA 4NLTA 4RNFA 1R6YA 2YQ1A 1SV5A 2OAUA 3CJRA 1Q4RA 1U02A 3UI3A 4Q5VA 1Z2ZA 3BBFA 2DGVA 3V4MA 1JLCA 3I0SB 4FDFA 2N3LA 4KQZA 2WOMB 2ZM6F 3KJNB 3O6QA 5HATA 2YPZA 3FCHA 4QBUA 4YMEA 1UCNA 3OXFA 3PW0A 4U7UD 4B9TA 1N8RT 4JBCA 2AJQA 3KLFB 4ZKAA 2VPZB 2OGUA 1NHKL 4DF8A 4U96A 5B0GA 4MK8A 1R0BG 3NCQA 4OI6A 1Q5VA 4UQTA 1VQLS 1SXLA 2DNRA 2UU9J 2H54B 3BGFA 1Y10A 5DG7A 1P8GA 2YWHA 2I38A 5JVGQ 3TYTA 4CM0A 2DEJA 3VAGA 3IRXA 1NDKA 1R0AA 3GE9A 3KLEA 2IM2A 4NPOA 4K4TA 3T9NA 1CG2A 2IRXA 1GMUA 3FEZA 1S7IA 5C25A 2WCXA 2XZDB 4P2XA 2M88A 3A8KA 2CQPA 5J2PA 4PQUA 1KS2A 2WW8A 4JI2J 3DOLA 1S1TA 2LQ8A 3NAIA 3GYXB 1YWXA 4OYIA 5HVFA 1VQOS 2JEGA 4JI4F 5AE3A 5IWAJ 2FVRA 3QIPA 1IBMF 5KG5A 5KFAA 3Q22A 1TMMA 3C15A 4CT8A 1TL5A 1LV5A 3UCUP 1ZBTA 2V9KA 3CCTA 1OIAA 3MM6A 4ZVSB 4TU8A 1U6BA 1QLNA 3F0NA 1Q8LA 3OL8A 1K0VA 2MSTA 1B64A 1FEEA 2EG2A 3N4WA 2M8DB 3D1HA 2VPXB 4WBFA 3HT0A 3MCSA 4CH0S 5AXNA 3HD1A 4YY3F 1SL1A 2AF6A 4OYMA 2E5IA 4ANEA 3PRVA 3DLJA 4DX5A 5KG4A 3CF5Q 5BXIA 3MURP 4FZVA 4IDKA 3C14B 2R7QA 3KFWX 3Q8YA 4ZJQA 1RTJA 1OSCA 3WX4A 5CD4A 2QLXA 1DTQB 1B0VA 1KTVA 3VAKA 3L7OA 4DV6F 2LYVA 2BJEA 3RAQA 3G6YA 1OMSA 2DVIA 4RU2A 1RAGB 2GHVC 4LRCA 4NLYA 4F04B 4G65A 3CJSA 1GXLA 3GJQB 1U1OA 3SBMA 1NCLA 1I51B 5KFRA 2K06A 3OTCA 1FT8A 3I5BA 1N32F 1AXQA 1GMVA 1MWQA 1CJKA 1EP4A 3OR1B 2C3UA 3R5AA 1Y5IB 4LMZA 2L08A 3HDSA 1ZAXA 3P6YC 2NXEA 3GV7B 5CYJA 5IC4B 2XMWA 3Q8UA 4DV2J 3K8VA 1UEUA 2XLJA 1KRPA 2CPJA 1XC9A 1RK8A 4ILRA 2ZM6J 4J91A 4RZRA 1IWAA 4KFBA 4DV0F 1FKAF 4LF5J 1MWYA 5AXMA 3P45B 2SXLA 2YKNB 2V8VA 3H4BA 3OTOF 2ZH8A 1RT7B 2KTQA 5CZXA 5F3ZA 1W25A 1WF1A 1YBTA 2HVZA 4I4BA 1CJVA 3BSNA 1PG5B 2ZHBA 2UVVA 2HEKA 3MWBA 4ES1A 5DDQC 2CQIA 5M2UA 2LA4A 2B3TB 2XHWA 5H9FJ 3W3SA 2GO8A 3OFFA 1U1RA 2OTLS 1D9DA 4ED8A 2AYMA 4WE1B 2ZWPA 5A0YA 4C97A 3NOGA 4F4AA 1RYSA 3O1LA 3MAAB 1GFWB 1VLOA 2EKNA 3OL9A 2Q6BA 1GQEA 4CLWA 4LR9A 1HQEB 1T9YA 2VF3A 3DLHA 3M8QA 3IMQJ 4ZHRA 3LQVA 4OX8A 2BQ3A 2DISA 2HPUA 3KLHB 3C16A 4EK2A 3KDOA 3G86A 3AH6A 5A6WA 4XAKA 2R7SA 2MKHA 4JI6F 2BKOA 2JLEA 1O5JA 2QG9B 4YQWA 1XNRF 3MAQA 4DR7F 1WEYA 4Z7YA 2PEHA 1OY6A 1JLFA 2OO4A 2F8MA 3TA2A 1RA7A 3JAMY 4IFYB 4PG7A 1FVQA 1WHWA 4HL9A 5KFKA 1T3NA 2D3O1 5J1EB 2HG4A 1HMVA 5C42A 2ZHOA 9RUBA 1RTJB 3NBPA 3L9ZA 2BEFA 1SH3A 3BH7B 2BOPA 3T5JA 2HGLA 2B4OA 2DNQA 3ZNJ1 5ETTA 1CC7A 3PVXA 1RADB 1WD6A 2AJFE 1N36J 1VBYA 4OI2A 5CYMA 3R5CA 1JIHA 1HHQA 2CZ9A 3CJ8A 3VV2B 4FBUA 1XBWA 4P9SA 5F9LA 2VA3A 4CTAB 1E6VA 2FHOB 3FZ2A 2ZHAA 4B9MA 3E2EA 2HIYA 1QSSA 1H73A 5DGBA 2XQCA 1WACA 4TN2A 4EO8A 1LEOA 2B9XA 4LRFA 1DLOA 1TL7B 1UETA 4I2PB 2MQ8A 5E3QA 5I4MA 5KFHA 1X4FA 3CUNA 2P2CB 1JKHB 3R5GA 2M7SA 4CNZA 4DPUA 2B51A 2HYIB 5KT7A 1S1WA 2J0QD 1N33F 4JV0A 3TEHB 2V2VA 4I6YA 3OD2A 2BVZA 2XO6A 4O4GA 3EUNA 3MHYA 3SSQA 4JI3J 3HHEA 4UY85 4YN3B 4B3MJ 4ERDA 4NYOA 3NGUA 1YGYA 3GPAA 3UO0A 2CQBA 4ES3A 2Z2LA 2MQNA 2ZH2A 4OL8A 2M52A 2VFRA 5L38A 4FYXB 1ZM9A 2M9KA 1S0NA 4V19J 2E1RA 5J2NB 4DR2F 5FJ4A 1IN0A 2VJUA 5A0YB 2B9EA 4L76A 3PR4A 2DR7A 3G6XA 3T1HF 3W7BA 4PG5A 4IOBA 3NNCA 2HKEA 4ILMA 1RWVB 2OFGX 1IKYA 1VR6A 4C6AA 3JTNA 4DX7A 3G4SS 1VQ4S 1RTIB 4NOHA 4G1PA 3FUYA 5K5MA 4B3TF 3A4TA 5L1IA 4BC7A 1AW0A 2HAIA 3KLIB 3KUEA 3NXZA 1K73T 4MMOA 3W60A 4PUOB 2CZVC 2DRAA 3ITHB 4JV5F 1RHKB 1VYAA 2CQGA 1HARA 2NYIA 1XN9A 2Z8QA 2ZBRA 3CDAA 3SQGA 1T11A 3IGNA 4KRWA 5L9XA 5KOWA 1BWVA 3MFIA 4QWDA 3CPWR 4L3KA 2ZE2A 3BBBA 2AEMA 3M2VA 3RAMA 4X64J 4E0DA 1TMJA 4OZ3A 4BS2A 2RKIB 4ID5A 2B9YA 3T6JA 2CFXA 3TQ1A 1VC0A 2V50A 3D3BJ 1EQMA 5HANA 3RW7A 4DUZJ 1H0HB 2JC1A 1HNVA 1U1MA 1RXOB 2F40A 3DI6B 4WFXA 2E5LF 4HI2A 4MKVA 5C24B 2W2NP 4DLGA 4IG0B 2XHCA 3FC9A 3V6DA 5KG7A 3M32B 1RGVA 4X4UA 4RWWA 1FRJA 2KXFA 2VBXA 3AD7C 5AE2A 2L9NA 2XCPA 1RAFB 4CI0B 1TKDA 3QJPA 3QZ8A 1NMEB 2BW7A 5D8HB 2PA3A 3CT9A 4DL4A 2AJ0A 1HWUA 4ES2A 3O5TB 4WZQA 3TEGA 2MY7A 4K8RA 2Y3YA 4EZ9A 3RBEA 3HKWA 1R43A 2KVQE 3EPIA 1GMWD 4OI3A 4A8QA 3Q0AA 3KUHA 2WBMA 1F3FA 4FF1A 1PJ7A 1YTYA 1ELOA 4M5HA 4N5SA 2PIIA 4H4KA 4KH0B 2DTJA 2CPZA 2VBYA 2ZBQA 4HI1A 2Z4PA 3OR2B 1NHVA 3S1TA 1IBKJ 1REVA 2OKQA 4DL7A 3KK2A 1AB8A 3S01A 2R7RA 3S6EA 1L3KA 4WCEQ 1MROB 1U1QA 4MKYA 4WF9Q 4QW8A 1TUVA 4YFUA 1H6KX 1Y00A 3PKMA 2R2SA 4Q0BA 2YNHA 3M2RA 2K7KA 1N5YA 5DDPC 2V9WA 4FF4A 2RHQB 3NEKA 1TL1B 1PO6A 1NPRA 2W9CB 1HPZA 1NZAA 5B08A 3VVUA 1VQYA 2FHJA 1N88A 4OI0A 3AXKA 3W1YC 3JSRA 4QPTA 1VQSA 5IOLA 3NP5A 3ETOA 4AD6A 4J9LA 4DR4J 1MSWD 1NJIT 2D3OR 2B43A 1FCAA 3DFEA 4ZLNA 1UW4A 4OV1A 3LWLA 1DTQA 5JUMA 3UE2A 4F3QA 2HMIB 3GTYX 4A4JA 1QJHA 3NGTA 4CLSA 4DS4A 5DJBA 2FLOA 3H8YA 2J6SA 4N76A 2PDAA 1EHWA 5DDOC 3KK3B 1OPIA 2KN4A 4CWBA 1FX2A 2FIUA 2VIHA 4O3RA 3DRRB 3BSCA 3E3XA 4I67A 1KQGB 2QV6A 5HLFB 3OFGA 3LGMA 2ZKTA 5ETNA 5RUBA 2C3MA 3SV4A 5GADI 3THTA 1C1CB 4HACA 4DV7F 2R7VA 3HHKA 5E7OB 4PWDA 3CIMA 1ZA2B 1U1KA 3R5DA 1NSAA 2MQLA 3H25A 2VOOA 4BBYA 2IBOA 4PCQA 1RKIA 4DJBA 1PAEX 3G6VA 3PRDA 1T0TV 1HI8A 1V6HA 2ZH4A 1YBAA 2G0IA 3T9ZA 3THPA 3ULHA 3SQGB 1HWIA 4F2RA 1X9SA 3K57A 1M90T 2ALYB 1EP4B 4USWA 5KFNA 2R8HA 1TL3A 4ECYA 2WSEC 3P3DA 2C2DA 5IQQA 4LIWA 4TYBA 5GAHU 3GCXP 3MEGA 2J0WA 5IV4A 4J90A 1URRA 1WC5A 2DGOA 2QGFB 3MD1A 4PXEA 5KFIA 2K1RB 1T8EA 2RH3A 3BH6B 5KFBA 1PC4A 2XY5A 3TAMA 2VG6B 4O44B 3DI6A 3Q8VA 3UQSA 4ECRA 1Y11A 2FVPA 1N54B 3MM5B 1RWXB 3OW2R 3E01B 1PYSB 1F9HA 2Y1IA 2HBZB 2ASDA 4P2FA 1CSJA 3LP1B 1NO8A 1F0XA 2BM1A 3NRBA 3Q2SC 3QBCA 3SQOP 3PIPQ 2XMKA 1LWFA 1R27B 1TP7A 2OPSB 2EFGA 5GVQA 2VA2A 3CXCR 2ZE2B 2KRBA 1FKPB 1WORA 4CZCA 5DQIA 3NS5A 4LSNA 2NUUG 3DOLB 2CDQA 4NCGB 2ZBIA 3I5CA 2ZUAA 2E1AA 2HZCA 4XO0A 4M1KA 4RBUA 1H2VZ 4MH8A 5KFJA 2FC9A 3V6JA 2Q66A 3DRRA 4J9VA 2H5IB 3T1AA 2W25A 4YB6A 4J9UE 3W8PA 2MKIA 1YKWA 3BR8A 4B3OB 4I56A 2YTCA 2MXYA 1FO1A 3POTB 3J7YU 2R7XA 4I2PA 3E51A 3HFVA 2HHHF 3EGVA 4NLDA 4OYBA 3PY8A 2LA6A 1RAJA 5KFDA 4ER8A 2MKSA 1T9XA 2CG4A 5D0GA 4JUZA 2J7UA 1FTRA 2JFKA 3EICA 3I4PA 3PHTA 1T03A 2GHWA 4USTA 2RRNA 3VAFA 1BC6A 4QIEA 1U47A 3G9CA 1RTDA 1SCJB 2RQ4A 4FS1A 1N32J 2HRUA 4DQQA 5FDLA 3M8PB 2BE9B 3BZQA 3G8SA 2NXJA 3TANA 1RCXB 2GO9A 2KYZA 3F44A 5CXTA 5LSLA 2RUGA 2YWGA 4MKAA 1X8DA 1UVNA 5KFMA 2HHSA 3BO3A 5HAOA 1REVB 1S6PB 2CJAA 3MMCA 1RT1A 2DR6A 3D4JA 3U1NA 2CXEA 5A2QU 2W9BB 1T95A 1NB7A 4TQRA 4DF4A 2VU5A 2YPYA 4NZ7A 3AXMA 4ZP8A 2R2UA 4WTOB 1NB2A 3GFHA 2P9GA 3S8SA 1S72S 3MOZA 1KHWA 1DJ0A 4O4GB 1E6VB 2FVCA 3LOUA 4KGVB 4DDFA 1KFSA 4WIQA 3KK3A 1KC8T 4UTGA 4RO0A 4RW7A 1CBKA 1YDLA 1CJTA 3QT8A 1BQMA 2YKMB 2JNJA 4XPEA 4ZK7M 4OYAA 1SIZA 1WI6A 4Q2MA 2EK1A 2RMLA 3SIPB 3RBDA 1SL2A 3FBCA 2E5LJ 4W90B 1TFWA 3KHHA 4CM2A 1XEZA 5IM0B 4NL5A 2W9AA 4YB7A 3RBXA 4H54A 1PC5A 1GEHA 2BE2B 1U2CA 1VGYA 3CO0P 1TKXA 3KLGA 2IDLA 4QCLA 2JVOA 3QIDA 4RNOA 3AHPA 4OHXA 1ZZNA 1I94F 1IQTA 1ZOTA 2QLBB 3FGVA 3PJXA 5JMNA 1K1QA 4TY8B 5HI7A 5LSRA 2KG0A 1GMWA 1NK7A 2L9WA 3ZO7A 3IS9B 5K8NA 2JL9A 2V68A 4K4SA 1NDLA 1HNIB 2W8KA 4ZPDA 4DR1F 3RRGA 1FDBA 3BV8A 5DQHA 1WF0A 3NBPB 2R9LA 4U7CA 3M30A 5HBMB 3KJVA 3PW2A 1KVKA 3I9ZA 3PJWA 4ICLA 2UVWA 1RWPB 3H20A 3V2UC 1NHUA 3MMJA 5D0RA 1HR0F 3HVAA 4RBTA 4MIBA 3J7Z5
chains in the Genus database with same CATH topology
1VHFA 1WELA 2RVJA 5FLXY 4DSIA 2UU9F 2HHTA 5KFWA 4TLRA 1IKXB 1JB0C 4JI3F 2E29A 2KT2A 3QYYA 1S6QB 4UOCA 1LK7A 6FD1A 4LSNB 4WFNQ 2ZH1A 1DAXA 3J81Y 1NNDA 3BS9A 4R0JA 3WC0A 4NYZA 1HBNB 1VBXA 3LAKA 3RB0A 4B3RF 3M6UA 3GIKA 3P49B 4YR3A 1SH0A 2HMIA 1TV6B 3MM5A 3TVYA 2LLZA 2HS3A 3FFIB 4A46A 4KBIA 2MQOA 1VK8A 5CYQB 1FRKA 2FHJD 3IFEA 3SYZA 5D77A 1UVLA 4O3PA 2MQPA 1D8YA 3IG1B 2VUGA 4GC7A 4Q7AA 1X5SA 3PIOQ 1FXRA 5EDWA 4OI4A 3IR6B 1IXKA 1S99A 2AV5A 2AX1A 2Q1LA 4RBVA 2VFVA 4KJIA 2FJAB 1JKHA 1SC6A 1SI9A 2DNKA 4CNYA 1FA0A 1IM4A 4J9QA 4GKJF 3MAHA 2MB0B 3PFEA 1X5OA 2NUHA 4YR2A 2B5JB 2ZITA 1L3SA 4HDGA 3LH2S 1TL4A 5EX0A 2RDIA 2YWKA 4YB5A 3US5A 3U02A 4ED0A 4WE1A 2UZAA 3NS6A 1J5EF 2DO0A 2UUWA 3TP2A 4J37A 4DSEA 1T03B 3N5FA 3VZIA 2NSCA 2ROEA 4PPDA 3DCAA 2IVMA 3LW5C 4JV2A 2ZUGA 4DX8H 4ZVEA 3DRPA 1UKUA 5FDLB 3OUYA 1F60B 5B0EA 3BO4A 5L39A 4HH1A 2FLLA 4IDKB 1PSDA 2N7CA 3KG4A 3D2WA 2E9RX 1ZTTA 3CDUA 4KT0C 1UFWA 1CC8A 3E8OA 3CEDA 4RUAA 1X4DA 3M32A 2J0SD 2HHUA 1SJQA 4KHMA 2PN6A 4DLEA 3BQ2A 1WG5A 2HRYA 4R5PA 1HQEA 2VG7A 4MJKA 4WZMA 4ID5B 2LEBA 3LP0A 2K2PA 2ZOFA 4C8MA 4EUVA 2W24A 4QU6A 2M0GB 4X4TA 2R7WA 2N4DA 3JYTA 3L95X 4CTAA 1HFEL 2DNYA 2M8HA 3SMZA 1XMOF 1LXNA 4B9NA 1JLBA 3Q23A 2EWHA 2FTRA 4F8RA 1FXLA 4H4OA 1Z2LA 2OTJS 3VQTA 3QGGA 1D0EA 2IC3A 4M94A 3NNHA 3MD3A 4HT5A 1UL3A 3BREA 2G1DA 1CQMA 1T94A 1UVKA 2LQJA 3PEJA 2D41A 1VQOS 2F8EX 1RT7A 2ASLA 2NPFA 2KM8C 3QWPA 3W2VA 5I3PA 3IWNC 1R8PA 1VI7A 3TAPA 4O4RA 3R5BA 4X4VA 2ZJQQ 1MU2B 3SFGA 4IFYA 3NCPA 2WHOA 4I6WA 1KTQA 3X3UA 5B09A 3B82A 3K5LA 3VAMA 4L72B 1RT2B 1TKZB 1OS5A 2GW8A 2OFHX 2N3OA 2W4DA 4MYTA 3WC2A 2H9ZA 3MR3A 2CJQA 4I68A 1LW2B 1U49A 1TAUA 2GQCA 1Q78A 3I6PA 4KE5A 1NKBA 4UUWA 3V6KA 3MECB 3HFKA 1LFPA 4CO5A 3UDCA 3N0VA 1M1KT 4F4ZA 4EEYA 3LALA 3CCUS 4C9DA 2JZ5A 2LKZA 4FXVA 4QIWD 4ZCIA 3MEEA 3D0HE 1S6PA 3MMCB 1X4BA 5KFUA 2W9BA 4GC6A 2XMT