3MEGB

Hiv-1 k103n reverse transcriptase in complex with tmc278
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
424
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 103
structure length 404
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3megB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megB03
1C1BA 4LSLA 2HAIA 4EO6A 4QPXA 4EEYA 3I5AA 3IGVA 4F50A 1HPZA 4I2PA 2RF2A 4HYKA 1S6PA 5CYQB 4G1QA 4ZPBA 1GX5A 4ED3A 4K4WA 4J9SA 3HHKA 1S48A 2UVVA 2HMIB 4JV2A 2BE2B 3GV5B 1IKYB 1IKXA 3IS9A 4B3OB 4DL5A 3E01B 3QGIA 2JEIA 3M8PB 2V4QA 5KT4A 3RB3A 1S6QA 3BQ2A 1MU2A 2R2SA 4EBCA 4RW9B 3BSAA 4PUOB 2IMWP 2YKNA 2BRKA 1TQLA 4Y34A 1IKWB 1REVB 2F8EX 2XGPA 3DRRA 2WOMB 1XR5A 2BQ3A 5J2QA 4DEZA 1RT5A 1HNVA 4O4GA 3NBPA 5HBMA 3HKWA 2FLLA 5HROA 1NNDA 4ECWA 4J9QA 4WFXA 4KO0A 3DI6A 5EWFA 4EO8A 4QW8A 5KFJA 2BANA 4IR1A 4R8UB 3CJ3A 2UVWA 1JLAB 1C1CA 4H4OA 3PHEA 5J2MB 2WB4A 3NAHA 3DYAB 4TYAA 1T94A 4IG3A 2D3UA 4TXSA 3KLEA 5KG1A 1TKTB 3QLHA 2FVSA 2YNGB 1RTDB 2IM3A 2R8JA 1BQNB 1RT6A 3TQ1A 3SI8A 4MKAA 2YNIB 1S1VA 5C25B 5KT3A 3JYTB 4NLXA 5DGBA 3FQKA 4TQSA 1TKXA 3UQSA 5KFFA 1ZETA 3FFIA 4K4SA 1S1XB 3KJVB 3DM2A 1DTTA 3GIIA 2BQRA 4K4ZA 1S4FA 1EETB 4NLRA 3V4IA 2I5JA 4K4YA 5KG2A 4O3QA 4NCGA 1T03A 3DLEA 2RDIA 1S1UB 3CDEA 2B6AA 3QO9A 5F8HA 2UVRA 3ITHB 1C0TA 5HP1B 3BSOA 3FRZA 4WXOA 2XC9A 3KLGB 5I3UA 5L1IA 4XO0A 4J9PA 2JEFA 3MFIA 3CDUA 4RW6B 3T1AA 3KK3A 3V6KA 4X2BA 1S1WA 2GC8A 1RT4A 1FK9A 1JLFA 4I2PB 2XWYA 1RTIA 2RF2B 3DRSB 5JUMA 1S6PB 3GIJA 1FKPB 3SFUA 5J1EA 4IFVB 2ZD1A 1KHVA 1T05B 3CDWA 1JLQB 4LSNA 1RA6A 1DTQA 3UPFA 2V4RA 4I2QA 2AGOA 1IKXB 3IS9B 4NLOA 5L1LA 3NMAA 3MR2A 4KSEB 1FKOA 4H54A 4ZVHA 4NLSA 2IC3B 2YKNB 3DLGA 5DLGA 4JUZA 5I42B 4QWDA 1LWFB 4WZMA 3NL0A 5J2QB 2WRMA 4RNOA 4FS2A 2VA2A 5KFTA 1HQEA 4K4VA 2DPJA 1RT5B 2HWHA 4ZVFA 3CIZA 3QZ8A 3KHRA 3DOLA 5DG7A 5HROB 4MK8A 3NGDA 4KO0B 3DI6B 2OH2A 1HARA 1MMLA 3OL9A 3NKYA 3BSCA 5D3GB 2FVQA 5JXSA 4ED6A 3KHLA 1C1CB 1RTJA 1TVRB 2VG6A 3DOKA 4H4OB 3BREA 4J9NA 3V81A 3QIDA 4IG3B 5DGAA 1SH0A 5KFOA 1RTHA 1RT2A 4MIAA 1HNIB 3KLFB 2W9BA 1RT6B 2FVRA 2J6SA 5F8GA 1S1VB 4ECYA 1RT3A 2ILZA 3FFIB 2UVUA 1LWEA 3DM2B 1GX6A 3RAQA 4KV8A 3V4IB 5HLFB 3C6UB 2FVCA 3UDLA 2HNYB 4ZPCA 4O3NA 1BQMA 4ECRA 3HVTB 2WONA 3KLIA 5J2NA 1T03B 2O5DA 1TL3A 3H2LA 4KAIA 2B6AB 3OL8A 1S97A 2J6TA 2UUTA 1C0TB 3PW5A 3MECA 3N6MA 4WFYA 3GILA 2AWZA 4DL3A 4YMEA 2ASJA 2YNFA 1XR6A 4NZ0A 5KFBA 4ECZA 4MIBA 3M8QA 1S1WB 1RT4B 1FK9B 1JLFB 4RUAA 1RTIB 3M9MB 3H5SA 4RW4A 2IJFA 1JLGA 4Y2AA 5J1EB 4EYHB 4Q44A 3PVXA 2FVPA 4IQXA 3BJYA 4LSNB 2OPRA 2JLEA 3BQ0A 4ECUA 1KLMA 5F9NA 2IAJA 2VG5A 1FKOB 4LQ3A 2CKWA 1W25A 4Q43A 4DG1A 4K50A 3TAMB 5KT6A 4MH8A 5K14A 3PW0A 3BQ1A 5J2PA 4RW8B 3KK1A 5L1KA 3MEGA 4KFBB 1SV5A 3KK2A 3RBEA 3G6XA 5FDLB 4MK7A 1R0AA 2ILYA 1HQEB 3MTKA 4ECVA 5DLFA 3MEDB 1JLCA 3C6TB 3H59A 4ZMMA 1UWBA 4YR2A 5DG9A 3PW4A 4YQWA 5KFNA 3KLHA 3VQSA 1RT7A 4IR9A 3DMJA 2D3ZA 4YP3A 1N48A 3I0SA 1HMVB 3DLKA 5KFMA 3LP0A 4J9OA 1RTJB 3DOKB 2VG6B 4RW7A 4HKQA 1HYSA 4MK9A 3V81B 1RAJA 4M94A 1RDRA 1TP7A 3D28A 4FBTA 2W9CA 2I1RA 4KHRA 3H5XA 3PR4A 3KMQA 2CJQA 2FJVA 2W9BB 2HNZA 4WE1B 5F8IA 1VRTB 4ZP7A 2HNDA 5KFAA 1S9EB 1TV6A 3LALA 2JC0A 3FDSA 3T5HA 1JIHA 3PW2A 3H4DA 4TLRA 3QIPA 4DL2A 1LWEB 1TKZA 4NRUA 1YVFA 1NHVA 3LP2A 3V6DA 1EP4A 2IM0A 5KFYA 4G3IA 4KB7A 4ECSA 3T5LA 1DLOA 3DRPA 2B5JB 4U7CA 1HQUA 1BQMB 3Q8SB 4IRDA 1LW2A 2R8GA 2WONB 3KLIB 4IKAA 1S0OA 4ECXA 4RUCA 3OLBA 1C1BB 4LSLB 3H4BA 4ECTA 3GV7B 1QE1A 4I7FA 4IG0A 3QGGA 5KFUA 2YNFB 1T3NA 1HPZB 4NLVA 5L9XA 5KFEA 4G1QB 2IJNA 3EPGA 1S1TA 1JLBA 1JXLA 1WNEA 3LP1A 1JLGB 4PWDA 4ED2A 2OPRB 4ICLA 2W7PA 1S6QB 1CSJA 1MU2B 5KFLA 1KLMB 3KOAA 3Q8RB 4QWBA 2IAJB 2BQUA 2VG5B 3DDKA 3I5CA 3UR0A 3CJ5A 3PW7A 3MR6A 3MEEA 4NLUA 5CYQA 4ID5A 3M9NB 3DRRB 4NLWA 4ZP9A 4ZPAA 4F4XA 1HNVB 4O4GB 2HMIA 5J2PB 2BE2A 5DG8A 3GIKA 1LWCA 3NBPB 3KK1B 5HBMB 4B3OA 4WYLA 3KK2B 1LW0A 1SV5B 1SUQA 3E01A 3G6YA 3CJ4A 3M8PA 2BR0A 1S10A 1XR7A 2FLPA 2VA3A 5KG5A 5L1JA 4TY8A 4PUOA 2BANB 3KLHB 1N4LA 1RA7A 1RT7B 1REVA 4RNMA 4IRCA 4NLGA 2C2RA 3I0SB 3DLKB 4F4YA 3CJ0A 2IBKA 3KLEB 5KG3A 3QLHB 2E9RX 4J9RA 3CWJA 3MF5A 4K4XA 2AX0A 1JX4A 1IKVA 4DL7A 3CO9A 1TL1A 4RZRA 2W9CB 2C2DA 2JC1A 3ICLA 1TKXB 1VRUA 3OHBA 3KMSA 1S0MA 4IOBA 4ZVGA 1TV6B 4QW9A 1DTTB 3PJWA 2ATLA 4J9MA 2GIRA 3M9OB 2I5JB 1S9FA 3QIPB 2YKMA 1TKZB 1TKTA 2E9ZA 4NLTA 3LANA 1BQNA 3H5YA 3LP2B 3V6DB 4NCGB 1EP4B 3DLEB 2ASLA 3QO9B 5C25A 3QGHA 4FS1A 1DLOB 3DRPB 4ZHRA 3RB4A 1HQUB 5C24A 5KFRA 5I3UB 4NLDA 3KHHA 4ED1A 1LW2B 2W9AA 3BGRA 3GIMA 2ASDA 3EZUA 1RYRA 2JEGA 3NAIA 3FQLA 4EBDA 2JEJA 3KK3B 2V9WA 1S1XA 1S9GA 3KNAA 3IG1A 4NLPA 2YNHA 1KHWA 1EETA 1QE1B 4I7FB 4IG0B 5KFCA 5KT5A 2XGQA 3V6JA 4O44A 3JSMA 1D1UA 3OL7A 5KFXA 1D0EA 1QAJA 2OPQA 2ZD1B 4QWAA 2R8HA 2OPPA 2FJXA 4U6PA 1S49A 1DTQB 3SFGA 2R8KA 1S1TB 4I2QB 1JLBB 3HVAA 4ZP6A 3H98A 3ITHA 4O3SA 5HP1A 4FBUA 4GC7A 3KLGA 2B43A 2QE5A 4DL6A 4ICLB 5KFSA 5KFIA 5KFPA 4RNNA 4O3PA 3BR9A 4LQ9A 4RW6A 2OPSA 3LAMA 4ED7A 3RB6A 4O4RA 4IRKA 2FLNA 2UUWA 4URSA 4ED8A 2AGPA 5F9LA 3DLGB 4JV0A 4NRTA 3DRSA 1SH2A 4DL4A 1FKPA 3MEEB 4R5PA 4ID5B 4IFVA 5KFHA 1T05A 1J5OA 3N6NA 4ZVEA 5T14A 1JLQA 4MKBA 4XPEA 2XCAA 2DPIA 4KKOA 4Y2CA 4RU9A 2C28A 3OHAA 5KFWA 3DOLB 4IH7A 1LWCB 3I5BA 4Q45A 4PQUA 2WTFA 4ED0A 1C0UA 1LW0B 1SUQB 4IDKA 2RDJA 4Q8EA 2GIQA 4WXWA 4GC6A 5DQIA 3CVKA 2WCXA 3IRXA 4R0EA 2IC3A 4TY8B 4O3OA 4EYIB 2D7SA 3IGNA 5EUHA 5F8MA 3GQCA 2XI3A 3HVWA 2J6UA 5I42A 5F8JA 1N5YA 2AQ4A 3MR3A 1LWFA 3OSNA 3GV8B 4KE5A 3OSPA 1RTHB 1RT2B 2IM1A 3MFHA 2WHOA 1IKVB 4MFBA 5KFGA 5KG4A 1TL1B 1JKHA 4EBEA 2XI2A 3G6VA 1RT3B 1K1SA 5D3GA 1N6QA 5KFZA 2WK4A 5F8NA 1VRUB 4IFYA 4TQRA 1RT1A 5DQGA 2R2UA 2R2RA 3PJXA 5DQHA 3IN5A 1TVRA 4KV8B 5KG7A 2VG7A 4YR0A 3H40A 2C22A 5CYMA 2YKMB 4Q0BA 4RNFA 1Z4UA 3V6HA 3N6LA 4KHMA 5KG6A 1HNIA 3KLFA 4ZPDA 2EC0A 5J2NB 5KFKA 1TL3B 4KBIA 4J9KA 4ZHRB 4WYWA 5KFVA 5C24B 5KFDA 3MECB 3ISND 1JLEA 3BGRB 2D41A 2QV6A 2XCPA 2R8IA 1ZTTA 1SH3A 1S9GB 2AU0A 3IG1B 2YNHB 2RKIA 3M8QB 2AX1A 5HLFA 3C6UA 2W8LA 4O44B 3JSMB 2HNYA 4RW4B 2OPQB 3HVTA 2OPPB 4K4UA 5C42A 4H4MA 2ZE2A 4NLYA 3TVKA 3I0RA 3QZ7A 1QAIA 2FJWA 4TN2A 4YR3A 2OPSB 3MR5A 4DG1B 4QWCA 5K14B 2IA6A 4XPCA 1K1QA 1IKYA 4R5PB 4URGA 3MEGB 3G86A 1J5OB 5KT7A 4J9LA 1R0AB 4KKOB 3KLVA 1S0NA 1JLCB 4ZP8A 5EWEA 1UWBB 4PQUB 4RW9A 3EPIA 1C0UB 4IDKB 3ISNC 1IM4A 1IKWA 4OL8A 3LAKA 4F4WA 3Q8PB 3DMJB 1ZTWA 5EDWA 4JV1A 1U09A 3IRXB 2WOMA 3PZPA 2BRLA 3TAMA 1OS5A 3LP0B 2C2EA 4RW8A 1HYSB 4RW7B 1N5YB 4F4ZA 4KFBA 4WFZA 5FDLA 4K4TA 3BSNA 4URQU 3Q8QB 3MEDA 3C6TA 2HNZB 3RB0A 3T19A 4MFBB 1I6JA 3CJ2A 5F8LA 3OL6A 2HNDB 4R8UA 1JKHB 3QYYA 2E9TA 1JLAA 4IH6A 4Y3CA 5EWGA 3PR5B 3RAXA 2W7OA 1RYSA 5J2MA 1N6QB 3KHGA 1HMVA 3DYAA 4IFYB 3D5MA 1RT1B 2YNGA 1RTDA 4Q8FA 4RNHA 2VG7B 3H5UA 5C5JA 5CYMB 2YNIA 4Q0BB 1QUVA 3OLAA 4O3RA 3JYTA 2HWIA 3GYNA 4WE1A 4TY9A 1N56A 1VRTA 4M95A 1S9EA 3KJVA 4IH5A 4NLQA 5KT2A 4WZQA 2ALZA 1JLEB 2IM2A 3E51A 4QWEA 2ZKUA 2AGQA 3T5JA 4NYZA 3FSIA 2RKIB 2V0NA 1S1UA 3LP1B 2R2TA 2B5JA 4TYBA 1C2PA 4PWDB 5KG0A 5C42B 3T5KA 4H4MB 2W8KA 2ZE2B 4ECQA 1NHUA 3RBDA 5KFQA 3I0RB
chains in the Genus database with same CATH superfamily
3SCIE 4I2PA 2YX1A 4G1QA 4C2MA 2CJ9A 3CCJS 4ED3A 3GR0A 3HHKA 2EKNA 3HKZD 2A18A 1PYSB 2JEIA 2V4QA 5KT4A 3ZZYA 3BQ2A 2MYFA 4RX6A 3CDBA 1VHFA 5HQ8A 3K58A 1ZA1B 1WORA 2WOMB 2CNLB 2MHEA 1QVFR 1VMBA 5BYRA 4DEZA 2FGCA 2BJEA 2GVZB 3DI6A 1OY8A 3W2VB 3A8IA 4EWTA 1VRQC 2F8HA 4IR1A 3SIPB 4IG3A 4WU3A 2V69A 3R7NB 4USWA 1GQEA 3J7A1 1DTTA 3I96A 3TVZA 3CCES 1V9OA 1Y5NB 1T03A 3DLEA 2HG4A 2UV8A 3FRZA 4WXOA 1KR4A 3PYGA 2NXJA 1JLQB 1I1GA 2BKPA 1FJEB 4XK8C 5I42B 1F5BA 3SV3A 4RU2A 2CQBA 2MMYA 2WRMA 1RT5B 2PSZA 2XNRA 3IM8A 4K0KJ 3EMTA 4P2FA 2KG1A 3VGTA 2V4JB 3PRDA 3KHLA 5KFOA 1RT2A 2FGOA 1QAXA 2FVRA 5F8GA 2XZDB 2NUHA 9RUBA 1B70B 1I51B 1WOSA 4O23A 2CJXB 3V4IB 1NJYA 3C6UB 4F02A 2IMOA 2F4VF 3E8OA 2IRXA 3OL8A 2B6AB 1HR0F 1T9YA 2EEYA 4DUTA 1VYAA 1WF2A 2UUAF 1S1WB 2DNZA 1GXUA 2F63A 1FWKA 1VJQA 4X62J 4DX6A 4IQMA 1RWPB 3KK2A 1SV5A 3PYDA 1HBNA 4WKRA 5A2QU 2DBBA 5EHHA 1UWBA 4DPYA 5HSPA 2KRBA 3TP2A 3IFEA 1ICEB 1J5EF 1U1PA 1QUPA 2DGXA 1RQ0A 1N34J 1XNRF 1SQFA 2VUGA 3MMJA 2V2KA 3C14B 4LFAF 5E3PA 4ZOSA 2DKOB 2E1MC 3V6DA 1CC8A 2WVEA 3BYRA 2B5JB 4CTAA 2WONB 3W3SA 3EVOA 1GH8A 3DRXA 2GV1A 4UOGA 4OYZA 1PKUA 4P52A 3W9IA 1RHKB 3HF5A 3US5A 2FHMA 1CSJA 4J90A 4ZP9A 1Q16B 1AT1B 5DG8A 4DV5F 2FLPA 1RA7A 2C2OB 3RUBL 4FNHA 3JS9A 2EBGA 2OHDA 2ROPA 1N32F 4DL7A 1N54B 3RAMA 4ES3A 2W9CB 4AXJA 5GAHU 2GIFA 4ER8A 3O6QA 4NZ6A 1KQGB 1RAEB 3BZQA 1MN7A 5CXTA 3UD4P 1Q81T 3LGMA 3LP2B 1FERA 5ETOA 3MPVA 4ED1A 1KVKA 1S1XA 2HFZA 1SJFA 2ZHOA 2MZQA 2ZH3A 2C3MA 5IQQA 3CCSS 2DHXA 1RGVA 4QJVA 1DURA 2XCAA 4RU9A 2KL8A 2WTFA 1SUQB 4IDKA 2CPZA 1D8YA 4R0EA 5E0OA 4EYIB 4C98A 3OSPA 2H9ZA 3MEKA 2RNEA 1K1SA 1N6QA 1VRUB 4CYUB 2HZAA 2L08A 3BBBA 2R2UA 3DXSX 2RUSA 2ZZNA 1HNZF 4NI2A 5IV3A 1G1XA 1TUWA 5DJBA 2G1HA 4NYOA 2AU0A 2PN6A 2DR8A 4UT4A 4RW4B 2NZ4A 4WWSA 1X9MA 1EQMA 4CO4A 4LF7J 5AJ3F 3G86A 5DM6Q 2XG8A 4FDFA 3OT9A 2PMZD 4PQUB 2W2NP 4X4VA 4F4AA 4FVMA 2MLXA 3ULHA 3DHXA 3CJ2A 2HNDB 2H5EA 2LMIA 3DYAA 2XO7A 2L41A 2YNGA 4MT1A 2VG7B 2FHKA 2AKWB 1UEUA 4L3NA 5E2QA 2ZKUA 4OLPA 2K3IA 3JSBA 3RG6A 1VC5A 3CF5Q 5GVQA 1YJWS 1NHUA 5KFQA 3D6MB 3HSGA 3R5DA 4LBPA 1HPZA 5CYQB 4WP3A 4A8FA 3M8RA 4RW9B 1WHYA 1RHMB 2C2MB 4EU0A 2LECA 1JB0C 2FLLA 2F9DA 2XB2D 1NK6A 3Q8UA 5J2MB 2HKEA 2KT2A 1Q78A 2FD2A 5KT3A 4NLXA 2PEBA 2NS1B 3C15A 1VBYA 1EETB 3A3PB 3PDNA 1SQGA 5IT9U 4Q7AA 3DOMA 3BSOA 4KGXB 2WVFA 4ES2A 5CH7B 5JUMA 3TA2A 2HVIA 4ZJQA 4RBTA 1U02A 2KT5A 4I2QA 1Q8IA 3QFWA 5L1LA 4F26A 2BW7A 4DX8H 4OIXA 3LPYA 3DLGA 1LWFB 1NMEB 2H5IB 4FS2A 3DU5A 2KZMA 3KNGA 4B3SJ 3AXKA 2VG6A 2IJRA 3QIDA 3TEHB 1ZOTA 4HLBA 3R5GA 3G2XA 1HI8A 3W62A 2DT9A 4JI8J 2XSJB 2GNKA 2H1YA 3UN2A 1IJEB 2W24A 1LWEA 2K06A 2OSQA 1J27A 4YDXA 1APSA 4KAIA 1RHJB 3PW5A 3A12A 4A47A 3D1HA 2RQCA 1BLUA 2GGPA 3MAAA 1FK9B 4YEAA 5B0AA 1RTIB 4IQXA 5IT4A 3ZTSA 3NS5A 2VF3A 1WEZA 3EVMA 4M5NA 4OYPA 3GFHA 5K14A 5J2PA 1C4CA 3HI9A 4KFBB 2I6WA 2HHHF 2VDHA 5DLFA 1WJ9A 2H5JB 3NY0A 4PXCA 3PRVA 2CQCA 1PYTA 5KFMA 2DNKA 2P8IA 3HD2A 4J91A 1EKRA 4DR1J 3R7SB 2FJVA 2O1PA 3NGUA 4CLUA 3SV4A 3T5HA 2N4DA 4IO9Q 1UA0A 4OI3A 2I8EA 2MKKA 4OI6A 3N01A 4OJGA 1FFSB 4WTOB 1WNEA 3LP1A 2CVEA 3IR6B 2A2CA 1KLMB 1R0BG 2CUYA 2YX7A 3THVA 4DR6J 3TZWA 3OFHA 6FDRA 3I87A 3HMJG 1NK0A 3KLEB 4WPAA 1OYDA 4K4XA 4PEOA 1TL1A 3LO3A 2F4FA 2OD4A 4JI5J 1SJ4P 2QL9B 4JV5J 2ATLA 3TJAA 3OR2A 2DNHA 1DHMA 1S9FA 1NPKA 2ZC3A 1IBMJ 4NLTA 1VBKA 5LT5A 4FS1A 1LW2B 1O8BA 1S9GA 1QE1B 2N82B 2NUUG 3FVYA 3H98A 5HP1A 1OIAA 2ZZTA 3BR9A 4O4RA 3AA9A 4URSA 4JV0A 4ID5B 2E1CA 2LLZA 1YIJS 2OTJS 2U2FA 2Y1RI 3MUVP 1FKAF 3V5RA 3Q23A 2D9PA 1F9FA 2XI3A 3HZEA 2J6UA 4YN3B 1RCXB 4KE5A 3QWPA 4JI3F 3PO4A 5KG4A 1JKHA 2RDDA 5KFZA 4HHUA 4UZBA 4B3MJ 3V2UC 1VBZA 1XK8A 4ZPDA 3KLFA 1VQ8S 3UR3C 1U24A 3D54A 2YPZA 1S0VA 3JSMB 5CZXA 1RU2A 4LRCA 3I0RA 4DWIA 4PG7A 4N56A 4P9SA 3H7HB 5HVGA 5LMUJ 1QSYA 2H54B 2P9EA 1V3RA 4HDGA 2XSFA 1M0SA 1NRKA 2BRLA 5DRKA 5LJ3Y 3LP0B 2Q43A 4F4ZA 3QNWB 3WDOA 4WFNQ 1SKUB 1H2VZ 1S79A 4ZPWR 5MLCV 2C3OA 3RAXA 2QSWA 4NXMJ 4DI6A 2Y1LB 4ZLPA 1KTQA 4WZQA 1CULB 1E6YB 2FC9A 4GO5X 1U1KA 1NK8A 2MSSA 2ZH5A 1RBAA 3Q8VA 1C1BA 2KM8C 5F41A 2Y3YA 4ZPBA 2UVVA 1S48A 2BE2B 5IV4A 2ZWOA 4ZN3A 1IBKJ 1MU2A 4X4NA 1Q5VA 2WVCA 4DV0F 1VLYA 3JB9k 4F7VA 2VBWA 2X1GA 1JLAB 4ES1A 4HI2A 1T94A 5KG1A 4ZVSB 3ZZZA 2E7WA 3HHEA 5DGBA 3UQSA 3PIOQ 4DR2J 1NK7A 2X51A 1NUEA 4FN5A 3MFIA 4NXNJ 3D68A 1VC6A 1PGZA 4X2BA 1SCJB 4HTIA 1OY9A 3HDSA 1Q82T 7FD1A 4YHHF 3NNAA 4PWWA 4K4VA 3MD3A 5HROB 5D3GB 2KRRA 2JFDA 4NA3A 2GQQA 3DU6A 1C1CB 4DV2F 3LPEA 2J6SA 2NLWA 5JJBA 2FTRA 1JMTA 2E5IA 1HWIA 4DZDA 3RAQA 2XS5A 3UDLA 4O3NA 4LF8F 1YLXA 3AODA 3HVTB 2O5DA 5A8WA 5A8RA 4A46A 3EDRB 3MECA 2PC6A 2YNFA 3UN3A 1XBWA 4BWMA 2YVSA 3M9MB 2IJFA 2QJ3A 1D9DA 2J0WA 5BYSA 5F9NA 1RAHB 3KG0A 2V2ZA 2FHOB 1W25A 3G4SS 4RW8B 2JLGA 4KGMA 3GB0A 4LF2A 3H59A 2NXCA 4YQWA 4YY3J 4IR9A 2ZH1A 5L8RC 4QR2A 1RWMB 1U8WA 2E1AA 3D28A 4KHRA 3UI3A 4JI0J 4P6QA 1KC8T 3GLJA 1MLAA 4I67A 2PMWA 1TKZA 5KFYA 1DLOA 3DRPA 2EW9A 2OO4A 1HNXJ 5KAKA 4KC5A 3W60A 3VAJA 2HBYB 2RS8A 3CB4A 3EVWA 2QN6B 4P74A 1S6QB 2ZZMA 1SJ3P 3CJ5A 1FWPA 3O5TB 4NLUA 1AROP 3RBZA 1SIWB 3KK1B 4WYLA 2O3DA 4DR4J 3G6YA 3AHPA 1YBTA 3BGUA 2LXFA 2DO0A 3MM9A 2IBKA 3QLHB 1U1QA 2FDNA 2FZKB 4X4SA 3T1HJ 2GVZA 3D1OA 1U4BA 3W2VA 3HJVA 4QW9A 4E8UA 2OD6A 3HO1A 2G2ZA 2JSXA 2CNOB 4PG6A 3GONA 3U7JA 1V3SA 4PXEA 5KFRA 5I3UB 2EK6A 2C3YA 4IG0B 2OPQA 2BKOA 3OFGA 4DPOA 2OPPA 2QZ8A 3SFGA 2EVZA 3HHNB 4TU9A 2OPSA 5D78A 2BOPA 1D8ZA 3W2WA 5B0GA 2YKOA 1JLQA 4Q2LA 2V6AA 1UVLA 5DQIA 2VBYA 2UZAA 2D7SA 5I42A 1FFGB 4EK2A 4Y28C 4DN0A 3CSKA 3KDOA 1XMOF 2XTJP 3BO2A 2C22A 1S7HA 4P71A 5J2NB 1U0SA 4BS2A 3BGRB 4H4KA 4Y6IA 1CJTB 2ADBA 3C6UA 4O44B 1IUJA 1BY9A 4WF9Q 8AT1B 1F1BB 2ZE2A 4NLYA 5BR8F 3HSDA 4KRWA 2ZBIA 3IBWA 2KHDA 4AD6A 4DG1B 1Q0NA 4GO7X 3HFKA 3PV8A 2QRRA 4B02A 1IKWA 4DR3J 4K8RA 1U09A 4DR7J 2YKPA 3G96A 1HYSB 3ZNJ1 4X84A 2KFNA 4CQ1A 2X1BA 2XMMA 5DZ6A 5E3AA 4AQYF 3ZZTA 3SCJE 1YJRA 2Y8YA 5A8KB 4LF5F 3S01A 2RRAA 1WACA 4PCQA 3TZXA 4UUXA 1ZH5A 4EMDA 3HHLA 2IM2A 4OZ3A 3T5JA 4Y2KA 2RKIB 2B5JA 2LA6A 3T5KA 1WI8A 4J9QA 4EO6A 3LA0A 2AJ1A 4M5GA 3WX8A 3CJ8A 3GV5B 3NOCA 3D6TB 4OFZA 3BSAA 2YKNA 4OJ3A 3EE3A 4Y34A 1VHIA 1LV5A 2VFUA 5GADI 2VQFF 3M6UA 2RVJA 2YWWA 1KWMA 1R8BA 4TXSA 1BC6A 4IO1A 2QLFB 2M0GB 1Q7YT 5DETA 3TW0A 2KYXA 3KJVB 3K5NA 3ILIA 2X3DA 2QGFB 4O3QA 5HJXA 5SZTA 1NDPA 4F2SA 1FFWB 1QVGR 1SL2A 2HGLA 2HVZA 4JI7J 1S6PB 3OW2R 1FKPB 3SFUA 1UW9A 2AGOA 4YB1P 3GWCA 3K5OA 2QMWA 4QWDA 3NL0A 2WVBA 3CIZA 2MQOA 3EZOA 1IR1A 4AT1B 3DDIA 1H38A 3WX4A 5LOQA 3D4JA 3WBZA 4LFBJ 1TAUA 3ET6A 2M7SA 2W9BA 3ETMA 1NDKA 2DH7A 1NJIT 4CYUA 3PTWA 2CQ2A 4LF9J 3FJ2A 2B4UA 4C8MA 4JI1F 4PKDB 3MGJA 4YMEA 5D8HB 3H5SA 4RW4A 5J1EB 4CDIA 3BJYA 1R43A 2ACMA 2YTCA 3TX8A 1FKOB 4QR1A 4UOCA 1CJVA 4PWUA 1CS4B 2QLWA 1HQEB 3CUNA 5HVFA 1SL1A 5DG9A 3LOUA 4CNZA 3JTOA 3CMAS 1GMVA 4DZ6A 4HHHA 1T8EA 2FYXA 3DOKB 2WBMA 5L39A 1QLNA 4WE1B 2HNDA 2MGZB 1NJXA 1UW4A 1TL7B 4XAKA 3T5LA 3KLIB 4RUCA 4DQIA 1SPBP 1K47A 4NPOA 3EPGA 3UDVA 1VC0A 1WELA 2MJUA 1JXVA 3DXBA 3KOAA 4J37A 3Q8RB 2DNLA 1UP1A 2L9WA 5CYQA 2ZJPQ 1S10A 2MQPA 2VA3A 3EDQB 4C7QA 2BANB 4QIVA 3RW6A 1GMUA 2PIIA 1TKXB 2ZUGA 4JI3J 1RZMA 3HD1A 1PAUB 2ASLA 1MMDA 3QGHA 1HQUB 3GIMA 3NAIA 3KK3B 2ZOFA 3D6HB 1SL0A 2YNHA 1KHWA 1EETA 1KTVA 3V6JA 5AXMA 3OL7A 3T1YJ 1D0EA 2ZD1B 2R8KA 4U7UK 4J9UE 2QE5A 1TK0A 1Z2LA 1J5OA 2MZRA 2WZ1A 2JZ5A 2DRAA 5D4PA 1DBDA 4I6YA 1G4CA 1N5YA 1LWFA 1SJRA 1S57A 2NQPA 2PA3A 2IM1A 1ZYQA 3MFHA 1T95A 3KG4A 3RU0A 1RISA 1URRA 3QJPA 3NXZA 2XNQA 3IN5A 3PJXA 1HNWJ 4YR0A 2VPZB 2CZ9A 2BJ3A 4OHVA 1R8AA 4M8LA 2KJWA 2W2PP 1SH3A 4WIQA 4HH0A 1FNMA 2VB6A 1BE4A 1QAIA 2WW8A 2QMXA 1RWUA 2LDYA 1BXNA 1KFSA 1HBOB 2KXNB 1JLCB 4ZVRB 3CD6S 1RE1B 5EDWA 1B64A 2LP4A 3C66A 2F7VA 4KFBA 5A6PA 1UMJA 1HHTP 5IT9Y 3QMQA 2DNNA 4C6AA 4R8UA 5EWGA 2WSCC 3QWUA 3OTCA 3GYXB 1NCLA 3MMCA 4Q0BB 4DPXA 3HM9A 4OYWA 2A2DA 3S8SA 2MKSA 4NLQA 2MQMA 2CPJA 2OMOA 3GG0A 3FSIA 1N5QA 2EC2A 5CQGA 3JTNA 3SSSA 5AE3A 2KFZA 1OSCA 2HPUA 4OZJA 1PO6A 2BRKA 1NHKL 1REVB 2VC1A 4C48A 5HMYA 2BJDA 2I2YA 5HI7A 3MMAB 1NNDA 5EN1A 2R7SA 1EB0A 5B0CA 3NAHA 3M32B 4M5JA 3KLEA 2VIHA 3SCLE 3TQ1A 5BJRA 4TQSA 2AJ4A 2NSBA 4DFJA 1N5SA 1KOOA 4QPTA 3GJRB 1S1UB 2UVRA 5K9FA 2YWEA 4RW6B 3T1AA 2CQDA 4I2PB 1KVIA 3HXMA 3SBMA 3E3XA 2XO6A 2YQ0A 2FJDB 3SMZA 3FGVA 2DPJA 3KHRA 1GMWD 3KJFB 2A3JA 3DI6B 3IO1A 3NKYA 1XNQJ 1N88A 5HATA 4KR0B 4IG3B 5DGAA 2RT3A 1X4GA 2KYZA 4KH0B 3K5MA 4KGVB 3LWLA 4KIAA 2ZKTA 1MWZA 4DX5A 3DLBA 3B54A 3BDEA 3K89A 2HS0A 4IYQA 1T03B 3AD8C 3MM7A 4QZVB 1Y7PA 2XHWA 1XR6A 2HBQB 2GHPA 4RUAA 3VAFA 4ZVTB 4ELTA 1HKAA 4UW2A 4WP8A 4OX7A 5K8NA 3PM9A 1VIOA 1HMVB 3LP0A 2VFVA 4GKJJ 2KT3A 3E2EA 1M1GA 1CQMA 1FF2A 1VRTB 2VU5A 5KFAA 1S9EB 4CRJA 4QR0A 5IFMA 4KHPF 4DV4F 4N77A 3TAPA 1EP4A 4DQRA 1AZSB 1UWAA 3TYTA 4I7FA 1CULA 1RKJA 1U47A 2Y0BB 3D6FB 2XMAA 4DF8A 1ZAXA 4A8SA 2BJ7A 2V5HG 2BE2A 3KK2B 1SV5B 3CJ4A 3ENQA 1HBNB 4QBUA 1N4LA 1YJUA 3T41A 1P6TA 2E9RX 4J9RA 2Z4PA 3OPKA 1FJGJ 1UEVA 2GIRA 1XMOJ 3M8ZA 1MNEA 3G6ES 2XY5A 3V6DB 4PG4A 3RB4A 1TZ0A 3CC2S 1H74A 2DD8S 2V9WA 5KT5A 2KKHA 3VAKA 5H9FJ 1DTQB 4HVZA 3GSDA 5KFHA 5T14A 4ZVEA 4KKOA 3OHAA 1YRXA 3P5TL 4Q8EA 1NDLA 4GC6A 4ZCMA 5F8MA 4U95A 2DNMA 1H7XA 5FD1A 3ZZPA 1KQFB 1MMNA 2IPOB 4MFBA 2W1BA 4EBEA 1RWKB 2XWXA 5D3GA 3U1NA 1U6FA 3ZTOA 5DQHA 1KQKA 1FJCA 3QT5A 2RH3A 4I4BA 3HLUA 1E6VB 4ZPVR 2D41A 1K8AT 2D3O1 1WEXA 2KXHA 2F5GA 3HVTA 2DITA 3RW7A 2CG8A 3MR7A 3P8BB 1IKYA 3W66A 4ZN1A 3P96A 4IDKB 3ISNC 4BHQA 3AY0A 3D7SB 4RW8A 4X66J 2DJWA 5IC4B 4ZCIA 4ZIVA 1UL3A 3LWMA 4DQSA 1N6QB 2LQ8A 4Y2IA 3JYTA 4NI2B 3RRKA 4X65J 3KJNB 3L95X 2E5LJ 2V0NA 1C2PA 3I5AA 2HVHA 3CD7A 3ADAC 1N5VA 2F40A 3C46A 2HMIB 3IS9A 3E01B 2KN4A 1S6QA 1QSLA 2W2MP 4F0HA 3VZIA 1JWWA 2F1FA 4DV1J 4KO0A 1T3OA 4K0KF 4EO8A 3MUMP 1DQAA 5ETRA 3DGVA 1RHQB 1HW8A 3DYAB 1VIXA 3QLHA 5HQLA 2YNGB 2FY1A 1BQNB 3SI8A 5FLXY 4PABA 4A8QA 3FQKA 1HIYA 1ZETA 2R7UA 4CO3A 1CBKA 1A7GE 4WFAQ 3BEGB 4NYPA 4OYXA 2RDIA 2HHTA 2CPDA 2EFGA 2CDRB 5I3UA 4JI2J 4YB6A 3CDUA 4ZJOA 4JI1J 2V2QA 2DO4A 2G2YA 1JLFA 1L3KA 2D1CA 3IM9A 1IN0A 1PJ7A 2WW4A 4KSEB 3ZTRA 2IC3B 3UDEA 1JJ4A 2IA0A 1HD0A 2KI2A 1SKSA 4PYAA 2MKCA 3R1HA 2X7IA 1RTJA 3MZIA 1N34F 4YFUA 4L73A 2HHVA 2BM1A 3QSYB 1A9NB 1YJNS 4CO5A 2PT0A 3CT9A 5F0WA 2K8GA 4YOEA 3SDEA 3C15B 3QRQA 2DR6A 1RK8A 2PDAA 5J2NA 2JH3A 3BKUA 2GO8A 5SUHA 2OLWA 1UETA 1ULRA 1JLGA 1AFJA 3W5XA 4ZDNA 2G0CA 2E7XA 1TMJA 3HZGA 4DG1A 4CI0B 1NSPA 2RAQA 5FDLB 2MKJA 3KJQB 4ZMMA 4LBIA 1Y00A 1RT7A 4V19X 5AE2A 2AEMA 5GAGI 3LGNA 1N48A 1X8DA 5HANA 5ETKA 1HYSA 2VG6B 4Z7CA 4TKTA 3UNYA 3QIPA 1LWEB 1YVFA 2BUNA 4DX7A 2OKQA 1TK5A 3KWMA 1Q8LA 1T3NA 4NEZA 3AJDA 2GGPB 3R27A 2MY8A 3ZZ0A 3MAAB 2EPIA 1FXLA 4ICLA 4TU7A 4LUBA 2R7OA 3TJ9A 3T3FA 2DK2A 3UR0A 2WSFC 1REGX 1CG2A 5JMNA 2XMKA 5J2PB 5HBMB 5D15A 2CJKA 2YXLA 1M5HA 1OO0B 1PC5A 1WC3A 5LXYA 1D9FA 3MM8B 2ZH2A 1LFWA 4DSLA 1SJQA 1T11A 3VGSA 4LR8A 3QBCA 1VQMS 2HW3A 1F9EB 2ZC4A 3G82A 3FSXA 2YKMA 2PO4A 1M5VC 2AW0A 5C24A 4B9NA 2F3JA 4QIWD 3UD5A 4DXLA 3KG1A 1XWLA 2E29A 1QAJA 1FTCA 1ZM3A 3IAM9 4NL5A 3TJ8A 5KFPA 2MQNA 3RB6A 4ED8A 4LF7F 2DTJA 1FKPA 3KXDA 3N6NA 3LF0A 1VDHA 4Y2CA 4ILMA 2RDJA 3TAQA 1RLCL 3IGNA 3BKFA 1AA1B 1OSDA 2WHOA 2VICA 2ADCA 1TL1B 1RT3B 1T9WA 2VBZA 4TQRA 1VQNS 2MEWA 2LCWA 3W61A 3M2UA 5CYMA 4W92B 3K5PA 2M5YA 3NNCA 1KEKA 3G87A 3DHWC 1JLEA 3B6BA 2R8IA 4X4QA 1S9GB 3EZ5A 2W8LA 2N4CA 4ENOA 2D3OR 4CLFA 4K4UA 4C0OC 2LVWA 2R7RA 5CYJA 2W25A 4AYBD 4QWCA 3CCLS 1T9XA 1VQ4S 2YY3A 3W5YA 1FDBA 4F4WA 3Q8PB 4XIUA 3QT6A 2AT1B 1TFWA 5G0RA 1XN9A 2Z2MA 1CS4A 3IAS9 4I6WA 1JKHB 2O01C 1RTDA 1YRTA 5C2CA 4DCOB 1QUVA 3M1VA 2XS2A 4WE1A 1U7LA 4I68A 1X5SA 2BZ2A 1WWHA 4X4RA 2Q6BA 3UFCX 1KLNA 3I0RB 3WIUA 1YKWA 1K9MT 1Q95G 2ZH8A 2ZDOA 3UW1A 3GP9A 4B3OB 1RAAB 3M8SA 2MQLA 2BQ3A 2HRTA 4CH0S 1EHWA 1HWJA 4YS2A 5EWFA 2BANA 4JI4J 1NAQA 1LEOA 1B4SA 1NZ8A 2P9GA 3CJRA 2IM3A 3H2VE 2GAGC 3FC9A 2P2CB 1U26A 5C25B 4JI8F 1ZM4A 1TKXA 2B9XA 3CCWA 1LXNA 2XYHB 3IBFB 5KG2A 3RR7A 3CDEA 4DPTA 3R5AA 5L1IA 3KK3A 4P72A 2J5AA 1FCAA 2ZD1A 2GJFA 3CDWA 3D66A 4ZVHA 4MAKA 4A48A 3FKBA 3MMBB 2HWHA 4ZVFA 4G1IA 3NGDA 4KTQA 4PXBA 2K3KA 1RHRB 2ZBPA 3H2UB 3CE8A 1MWYA 4DR1F 4CNYA 3CMES 3MCMA 2Y1IA 2X1FA 3H25A 3J81Y 5AXKA 1D09B 3TZYA 2LKZA 3HULA 2CYYA 1X4DA 3A8EA 1FVSA 2JVRA 2AJ2A 1HW9A 1KN6A 3BS9A 3IXQA 4P2SA 2IVFB 3PVXA 2G0IA 2YKAA 4FP9A 2XMTA 4BC7A 5D0GA 1N5TA 3PFOA 2JRSA 4CT9A 4DR6F 3BQ1A 1FDDA 4FKXA 4OI1A 1HBOA 1NPPA 5LMNJ 3MEDB 1JLCA 3C6TB 4NZ7A 2QO3A 2CWKA 3VQSA 1EAYC 2R42A 3ENWA 1SJ1A 3U1MA 1RDRA 2XMUA 3GSIA 3PR4A 4JI5F 4WCEQ 1PILA 2G2OA 2W4CA 2DGOA 4JV5F 1VFJA 1NKBA 3LALA 1IR2A 2JC0A 3PW2A 4MYUA 1IBMF 2VJUA 3GTYX 4G3IA 4OZ0A 5L9NA 5HVHA 4DCJB 4CLKA 2BJ9A 5A8WB 5A8RB 4HEA9 4P75A 4FXDA 1HD1A 3MTJA 1D9AA 2YNFB 2HS4A 1S1TA 1HI0P 4R25A 2HBZB 2BQUA 4QWBA 1U6BA 4O4GB 3NBPB 2ZJQQ 3T6JA 5FJ4A 4B3RJ 1REVA 1HI1A 4NLGA 1N36J 1FHTA 3KUEA 4GVBA 3BN7A 1IKVA 4M1KA 4KY3A 1SXLA 5LXRA 1VLOA 1SC3B 4B3MF 4J9MA 4RBVA 3M9OB 3M32A 4YUDA 1U2RA 1TKZB 1SC6A 3CDAA 2RHQB 1O51A 4WKYA 1R0CB 1DLOB 3DRPB 3D3CJ 3THPA 2W9AA 1EZZB 2K2PA 1R89A 1NB7A 3GJSB 5HMXA 3GPAA 1RABB 3CNQP 1ZPVA 4RW6A 2QMUB 2YPYA 5E5NA 4K7QA 2DPIA 2JX2A 3R7BB 5LMUF 3MXHP 2PI4A 3LQVA 1C0UA 2HRUA 1A0OB 1UCNA 2GIQA 4NMXA 2D69A 3LH2S 4U8YA 3MM9B 1CPZA 1X7VA 3HSZA 3W64A 3I9ZA 2HGNA 2NPFA 3JQMA 3RZAA 2GO9A 1S6OA 5K8PA 1IR0A 3CCQS 4NXMF 4ZJLA 2DRDA 1Q79A 3N6LA 1TL3B 4CLZA 2UV8G 1ZTTA 3M8QB 2HVDA 2G1DA 2OPQB 2OPPB 2WB1D 1CJUA 3GFYA 4HT7A 2WAQD 2V9KA 3SZ2A 2HQ3A 2OPSB 1RAFB 2AV5A 2KVQE 3W2WB 3WHIA 4OI2A 5EWEA 2KH9A 1IBKF 2GS8A 2HQFA 2XHCA 1IM4A 3DMJB 5LJ5Y 1VK8A 2JVOA 1WF1A 5BXIA 2QL5B 3KFWX 2E9TA 1GAOA 3W5ZA 2A1BA 1HMVA 2B3TB 1X31C 4Q8FA 4F2RA 4O3RA 4DV3F 2HWIA 1VRTA 1WTFA 1S9EA 4DR2F 2UXDJ 1YBUA 3E51A 3UNGC 1DQ8A 2RE1A 2MZSA 2C2KB 2R2TA 2DHSA 4FF2A 2ZE2B 2B4OA 1BWEA 1AZSA 4NXNF 2KXFA 3K2YA 2JFKA 3NNHA 4FF3A 2XBPA 3NS6A 3TR5A 4PUOB 1U0HA 1IKWB 3J81j 5DS7A 2EFNA 3B4MA 1FRIA 3FEZA 3G71S 4DS5A 3OTDA 3IRWP 4WFXA 3OVBA 2CQHA 3WIVA 5IWAJ 2M8HA 2D3UA 3VF0B 3DNCA 3P6YC 4C4WA 2R7QA 1S1VA 4P73A 1I5OB 1QY7A 2POKA 4K4SA 4YDDB 3HHLB 3G8SA 2BQRA 4K4ZA 4C11A 4WU2A 2HHXA 1VQLS 3N79A 5HAOA 2RILA 4PPDA 4X64J 2CFXA 2VKZG 4ZLLA 2BKNA 4CO2A 2UVWA 2FB0A 1NBEB 1DTQA 4EGLA 4F0MA 2VKRA 2NYHA 4BDPA 3NMAA 2A6MA 2M3DA 1F6TA 2YKNB 1B7YB 5JVGQ 1NH7A 4WFBQ 4YY3F 2VQEF 4HACB 3OL9A 2V67A 8ATCB 2IY5B 3UCZP 1TVRB 4OZNA 4CLSA 1H0HB 1HNIB 4JI0F 2QA2A 2CIMA 2DNGA 3VQTA 5HN0A 1G7CB 5B0EA 4LFCJ 4ECRA 1YJ7A 4LRBA 1HNXF 3LW5C 1VQOS 1E6VA 2FHJA 3GILA 1RXOB 4EFAC 5CABA 1IWAA 1LOUA 3BGFA 4DFPA 3D9BA 3TOQA 2HHPA 1MW7A 4BBYA 3RR8A 4ECUA 2CZ4A 1NO8A 2UXBJ 2IAJA 2VG5A 4OX6A 3V4MA 2MPUA 2DGVA 1WC6A 4KQZA 4OQJA 3BO4A 4DR4F 3G6XA 2ILYA 3PW4A 3UVJB 2CAJA 1S99A 4J7CA 3DLKA 2SXLA 4W90B 2XLKA 4AL5A 4N76A 3ET6B 4DV6J 4M94A 3T1HF 1MN9A 2GHVC 3P5BP 2W9BB 4L74A 4ZP7A 3U27A 2DGTA 1HQ2A 4W4MA 3ENVA 3F73A 3QSIA 4NE9C 2Q3PA 4OHZA 1FNXH 2R8GA 3I4HX 3C8YA 4LSLB 3H4BA 5KFUA 3AD9C 1VQKS 5HL7Q 5I4MA 4DR5J 4ED2A 3F44A 5KFLA 4NEYA 3PW7A 1HHSA 2KU7A 2G4BA 3TA1A 2HMIA 1CJVB 2IBOA 1LW0A 3E01A 3NLCA 1H73A 5L1JA 4FNIA 4TY8A 4OYMA 4IRCA 3GR1A 4OYBA 2FJEB 4GVLA 1LKZA 1BQNA 3L4BC 1FVQA 3EICA 4NLDA 2FIUA 2OAUA 4Q2MA 5DZ7A 4NCBA 3RRGA 5KFXA 1TTHB 4O3SA 3O3LA 3DLLQ 5KFSA 5IOLA 3FCWA 2CNNB 2AGPA 5E3RA 3K8WA 4XPEA 3J7YI 3DKDA 4DR3F 4DR7F 2IC3A 1SVDA 5C2GA 5EUHA 1SQEA 2ZH6A 4WK3A 4DUYJ 3NP5A 3OTOJ 2HZVA 3LGHA 5DQGA 1XQIA 1ZS6A 5KG7A 1L3TA 5H1SV 4ZVQB 2M2BA 4KHMA 1GTEA 4HTJA 2XLIA 5KFDA 4LJMA 1EKSA 3TRGA 2QV6A 1B0TA 2YNHB 1MG7A 5C42A 3RTVA 4H4MA 2E1PA 4N5SA 3UCUP 2VH7A 3R9LA 3ZC4A 2BA9A 2HQDA 2J7WA 3RGIA 3SSRA 1J5OB 2ASYA 1S0NA 3EX7B 1KRPA 1PSDA 5ITHA 5LM7E 4OL8A 2D9OA 1UJ6A 1N5YB 1GTHA 5FDLA 2F65A 3PR5B 3IR5B 2E1RA 2RRNA 5L38A 4NA2A 4FYXB 4ZS6A 3L7UA 3UDCA 2ZFHA 1T02A 3TQEA 4CWBA 5ETVA 2KTQA 4JOUA 1RAGB 2VV5A 1AYEA 3GE9A 2RU9A 4HYKA 4JI7F 3IP0A 3JQJA 4U96A 6AT1B 4K4WA 4Y0FA 3OTEA 3AXMA 1P1LA 2J7UA 3ZO7A 4A8MP 3N5FA 4LRFA 1ELOA 2R7VA 1VBXA 2DY9A 5J2QA 3B82A 2UU9J 2OTLS 3OBIA 5HBMA 3F56A 3MOZA 2BOAA 4KGKA 3PO5A 4R8UB 4LFBF 3EXYA 4LRAA 2AEFA 1FT8A 2HYIB 2E66A 3MMCB 3MM8A 4LF9F 3DM2A 2GW8A 3W8PA 1DAXA 4K4YA 3MAQA 1M5OC 4XO0A 5IQ6A 4ELUA 2XWYA 1ZPWX 2ZITA 1WHWA 1X4EA 3IR7B 2N3OA 4H4KC 2CA9A 4OI4A 2UXCF 4FYDA 3R5JB 4RUBA 2HQIA 3JAMY 4ED6A 3R5CA 2YWFA 3MDFA 3T6BA 2C2ZB 1RT3A 1CQNA 2ILZA 4MIWA 1AXQA 2J9EA 3GFZA 3T9NA 4BLGA 4WFYA 4AXIA 2MJNA 2EG2A 3B4DA 1WTBA 2JNJA 2OP5A 2FC8A 1Y10A 3FEYB 4PR6A 2AZ1A 2BYCA 3HHLC 3MPUB 1RUSA 1CJKA 1JNRB 2CPEA 2CKWA 2ZVIA 2Z30B 4CM2A 5KT6A 1IVZA 1NB2A 1Q8KA 1CC7A 4OYOA 1JJ2R 4I64A 1B7FA 4F0KA 1UFKA 2AP6A 2HFNA 3OQ2A 3FUYA 4YP3A 4QYZK 1FEHA 5D4LA 4OZ1A 3CJKB 2RD5C 2UUCJ 1RAJA 5B08A 2BXJA 4FBTA 1B0PA 1L3SA 1HFEL 1JIHA 3VAIA 1RBOB 3O44A 4ANDA 4NRUA 4C8NA 1R8CA 2E5GA 3Q8SB 3G8TA 3BBCA 3MM7B 3N5BA 3IC1A 3T1YF 2CVIA 4LR7A 5T41A 1DARA 5KFEA 1R8PA 2DB1A 3Q22A 2RU3A 2M9KA 2KDOA 3NRBA 4B3OA 2DNQA 5GAEU 3Q83A 3NCPA 1URNA 2MLZA 3FMWA 3PKYA 3QRPA 3NWRA 3TZZA 2C2RA 3WC0A 5KG3A 3CWJA 3GZ7A 1JX4A 1UVMA 2N3LA 1PG5B 3A8KA 3OHBA 1M5KC 1X0PA 1RB0A 1WC5A 1HNWF 4OZ5A 3LANA 3H5YA 2E7VA 4LT6A 1EP4B 5C25A 2FZGB 5BYQA 3FQLA 1IQZA 4I7FB 5KFCA 1D1UA 4RBUA 4M63A 3HFVA 4F8RA 2HZCA 2FJAB 4GC7A 1G2EA 4O3PA 2B9EA 4DL4A 2AZ3A 1OWXA 3TUPA 2ZH7A 4WXWA 3KTQA 3CVKA 4ED4A 4UY8T 3MMBA 3MR3A 1PYOB 1TFYA 4U8VA 1RTHB 4YB7A 1H98A 3PHTA 4IFYA 2M4MA 3QAEA 2FPHX 1AB8A 3TANA 2GZOA 3V6HA 2CADA 2VPWB 1TK8A 4DV3J 3QJLA 2NREA 1R6VA 4F3OA 4USMA 2P5VA 2H48B 1AUDA 2Y1JA 2PFDA 5D4NA 1WHVA 1P9YA 2PEHA 4OZ2A 1TL5A 4K2XA 5HK4A 3EJMA 4URGA 1R0AB 4KKOB 1LK5A 3KLVA 4QIFA 4MKYA 5H9EJ 4N47A 1F2HA 1IJFB 3DDNA 2MQ8A 4K2JA 2Z2LA 3MEDA 3C6TA 4B3TJ 3OXFA 4MFBB 1F60B 4Y00A 3EGVA 4LF4F 3JQKA 3BM7A 4CM0A 2YNIA 1RP5A 3P45B 4Y65A 2QC3A 2WVDA 3GIRA 1VCTA 4M5DB 2DHHA 4NYZA 3L3CA 1ZM2A 2CPYA 4C8KA 4ZPTR 2R7XA 5E3CA 4QPXA 5CZVA 2RF2A 3FMBA 1IKYB 2XYPB 3QGIA 1Y5IB 3VV2B 2ZBCA 2KJVA 1RKIA 2J8AA 3DCAA 4PXDA 4O4GA 5JVHQ 3NBPA 3K57A 2W4PA 3N9UC 1XNQF 2YH1A 5KFJA 2VQEJ 5IT0A 4H4OA 2WB4A 1TKTB 2ZWPA 1FRXA 1S76D 1Y0HA 4PG8A 1UEKA 3JYTB 5M2RA 4FF1A 1PIEA 5H9FK 2KHCA 4KH1B 1UAWA 1C0TA 2YH0A 2LU1A 2YWKA 2Z2YB 3POTB 2CRLA 2N7YA 1TU0B 2AJ0A 2BW2A 2CPHA 4IFVB 4A8WA 3IS9B 3DGPB 4RNOA 4DUZJ 4PQAA 1D3WA 1S6UA 1KNZA 1NU4A 2NXEA 4KO0B 5U47A 4DF4A 3BSCA 3CD0A 4GKJF 3V81A 2GQCA 3M2VB 1SH0A 1J2VA 2JWNA 4ECYA 3BN4A 2V68A 1H6KX 4ZPCA 1EX8A 4F3QA 1BQMA 1R27B 1TL3A 2AWZA 1YSJA 1FO1A 4MIBA 3DN9A 3M8QA 1JLFB 4C0BA 2YBVA 2JLEA 3R1LA 5B0BA 1WEYA 2IHR1 2BJ1A 2Y9HA 3OFEA 1LQ9A 3KLHA 3A1YG 2LXIA 3DMJA 2C1EB 8RUCA 1GT8A 1SC4B 3ILJA 1RTJB 1UJ5A 1LNQA 2I1RA 3MM6A 4N7TA 3AFGA 2HHUA 1FJGF 2ATCB 3NGTA 4V19J 3SDEB 5L46A 2J7KA 4LF6J 2MHNA 4OX8A 4ECXA 4QU7A 4UOFA 3K5LA 3MI7X 2AEJA 2OSRA 3GJTB 3A8JA 1JLBA 1JLGB 3EWGA 3CXCR 1N8RT 3DRRB 2A6OA 4G1PA 3M30A 5F3ZA 3QATA 4KGZB 4PUOA 3B78A 1RT7B 4DCPB 2AYMA 1WOOA 4PYDA 4BWJA 4JI6J 3CO9A 1X4HA 4B9UA 4D3HA 3PJWA 5ETNA 1XC9A 2I5JB 3QIPB 1DFDA 2GMHA 2LEBA 1NXIA 4B17A 3CTRA 4ZHRA 3KHHA 2EK1A 1T0TV 4L72B 3FCHA 1NSQA 1VQ9S 3IG1A 4NLPA 2MKYA 2R8HA 4X4PA 2RQ4A 4PZVA 4DL6A 4ICLB 2BBEA 3HPOA 4ED7A 4NRTA 1R7IA 3DOLB 3TI0A 2RJZA 2LQ5A 1UPPA 1ZAWA 4X66F 3MAHA 4U7UD 3JSYA 4GKKJ 1BQXA 3CO0P 2XZWA 3AQOA 4HACA 4CLLA 2DHAA 1RT1A 3G82B 1HBMB 1TVRA 2M8DB 2YKMB 4RNFA 2EFPA 4ILRA 5KG6A 1HNIA 3M6VA 3W7BA 5C24B 4X65F 2Z58B 1BWVA 2E5LF 3GJQB 4I0WA 5B0FA 2FQQB 3I4PA 4WK1A 4DFKA 3TVKA 3QZ7A 3QRRA 1X5PA 1YDLA 5A2QY 2ZNYA 4DSIA 2BMBA 4DV7J 2QT7A 2ROGA 3BBFA 3LUYA 1YI2S 1XMQJ 1WKJA 4DV1F 4ANEA 4B9SA 5K8OA 5E33A 4Y2MA 3UVJA 4L75A 4UUWA 5DDRC 3PKMA 3D5MA 3M2UB 5CYMB 5D77A 3FRYA 4Z7YA 3HHLD 3R2DJ 4RKUC 5KT2A 1PJ6A 1JLEB 3H20A 2DYAA 2KVIA 2MZJA 1FRMA 2VC0A 5K5MA 4JI2F 2W8KA 4LSLA 4EEYA 4F50A 1FX4A 2LYVA 2YX4A 3TEGA 2YQ3A 1IKXA 2L9DA 3RB3A 1WSVA 2OFHX 1S4EA 1WG1A 2MZ1A 2Q66A 4FYWB 5GMEA 5G0RB 2VFSA 3VGUA 2UXCJ 4PPZA 4JYAJ 4WIIA 3CCRS 1UFWA 5A0YA 1H2TZ 1QJHA 2KM8B 1RTDB 4F4KA 3M1VB 3ILLA 2QEXS 3VWSA 1R8HA 3FFIA 4C8YA 4MYTA 1S4FA 4NLRA 4A4JA 3TVYA 1GK8A 2LA4A 3KLGB 1UJ4A 2N7CA 2JJ4D 4DSEA 4USJC 1BD6A 1SIZA 1NK5A 4AFFA 4USHA 1MROA 2MQQA 3CMQA 1X4FA 1MSWD 4ZITA 4M5HA 2APOA 4C3KA 2Q6CA 2CJAA 4MK8A 2IYGA 2OH2A 1HARA 5E3QA 4JBCA 5JXSA 4K5RA 2DXDA 5ETTA 3MUTP 3CEDA 4OX9J 2HFSA 3R8YA 2UVUA 4I6AA 2UUTA 3VALA 2LDIA 2GJIA 2UUBJ 3CPWR 4USKA 2M88A 2OPRA 2NYIA 3VZHA 4KPCA 3NCRA 2DNYA 4QYRA 1DZ5A 2GCFA 3NMRA 1Q5YA 1FRKA 4MK7A 2BM0A 1OYEA 5A6WA 4DQQA 3BH6B 2DH8A 5IC6B 3UCGA 3I0SA 2GX8A 3AOCA 3RBXA 4UQTA 3P4UB 2DIVA 2VOOA 3PYFA 1TV6A 3FDSA 3BGOP 6FD1A 4WP9A 1RWXB 1JQGA 1FDNA 2LFVA 5GAGU 1Q86T 5CD4H 3DFEA 4U7CA 1FI4A 1S0OA 2OEMA 3NWGA 4ECTA 1BMQB 3QGGA 2B4PA 3NCQA 1JXLA 2OEKA 3BPDA 3FBBA 5EGYA 3CCTA 2J9DA 4RJVA 3N0VA 3MEEA 1HNVB 4XDDA 2XMVA 4B9LA 2HLUA 2IYIA 3SQOP 3CJ0A 4BC9A 4R0JA 1N33J 1RSCA 2EG1A 3ZFVA 4K59A 3K8VA 2GQ2A 1S0MA 3KMSA 3S7RA 3DRYA 1PCAA 4NCGB 1HHQA 5B09A 4FXWA 1RYRA 2JEGA 2D74B 1KOHA 5J1PA 1S1TB 1UA1A 3M2RA 4QOTA 4RNNA 4LQ9A 5IM0A 3QAUA 1YJVA 2IVMA 1P1TA 5F9LA 4Q5VA 3CC7S 5A76A 2GMLA 1PAEX 1WKKA 3I5BA 2OIHA 3MPDA 4G6VB 3PJ9A 2V8PA 4UQGA 3N28A 4K5SA 2B7BB 3AAWB 3CULA 2RIJA 2AQ4A 2O66A 4GVBB 1FD8A 4UY85 5MAOA 1IKVB 2QL7B 2WK4A 2DXFA 4LF4J 4G65A 4DOZA 1Z4UA 3VVTA 5KFKA 2XCPA 1AW0A 3EUNA 1K44A 5ETLA 3M6XA 4AUKA 3SQGA 3UN5A 4USVA 3OR1B 2EI5A 2OGUA 2DEJA 1WI6A 3ENAA 2B51A 3C16B 7FDRA 2XMWA 1C0UB 1IWGA 4JV1A 2ACYA 1OS5A 1QAYA 4FKYA 4HH1A 3W1YC 4RW7B 3NGRA 1B3TA 2ZM6J 3T19A 3CW2C 5F8LA 3QYYA 4JI4F 1HBUB 1QTMA 3VR1A 2ZH4A 3CJKA 1NJZA 1X5OA 3FBCA 3CC4S 4S0MA 1NPRA 2VODA 4QWEA 1U6ZA 1BGXT 1JJHA 4DDFA 2G13A 4PWDB 3LTOA 1W2IA 1CJUB 3PX6A 1GX5A 3J7ZT 3ZNUA 3M8PB 1SBRA 4WJBA 2R2SA 2IMWP 1TQLA 1B99A 2RS2A 4NCAA 3HKWA 2HFUA 1A6LA 1OQ3A 2Y0SD 3RRHA 2QTWA 3CJ3A 4DPWA 1K0TA 4TYAA 1M5PC 2FVSA 2QSFA 1RT6A 2V8VA 4MKAA 5AXNA 2VOPA 1Y3JA 4A8OA 2QA4G 2DR5A 1C4AA 1V5VA 4NMLA 5F8HA 3ITHB 2XC9A 3PACA 4RWXA 4DSFA 1RT4A 4GMKA 2AIRB 4MJKA 2FUG9 1T05B 3OUYA 2F9JA 3FBFA 4LSNA 2V4RA 4DJBA 2J0XA 2DGWA 3MR2A 2CJBA 2LQ9A 3B8HA 1NK9A 4NLSA 1U0HB 3NEKA 4QIEA 5LMNF 1X0FA 2E5HA 3RYLA 4ATNA 2MKHA 1S7IA 2HK2A 1RTHA 4MIAA 1S1VB 1GEHA 1Z1ZA 3HFZB 2A10A 1GX6A 5HLFB 4TLQA 4C11B 2HNYB 3W63A 1FDAA 2CQIA 1RACB 1WKLA 4NZ0A 4HR2A 1NH8A 1FXDA 4Q44A 2LQBA 4JP8A 2GHWA 3BQ0A 4ZIWA 2HSEB 4LMZA 4PG5A 4LQ3A 2O67A 4A8XA 2VASA 2X3GA 1KONA 4MH8A 3TUIC 3AJ1A 1NEEA 3I56S 2DGSA 1R0AA 3MTKA 3AOBA 4RR5A 1CEZA 3PEJA 5KFNA 4B3RF 1ZAVA 1N36F 2XZTB 1U2CA 2LEAA 3H5XA 4OHWA 3UE2A 2GFFA 2FLOA 4CZCA 3D1QA 3HSJA 1NHVA 1KP6A 2CPFA 1JJCB 4ECSA 2F4VJ 2ZOGA 4O0NA 2CG4A 2MKIA 1HR0J 2WSEC 2K7KA 3UO0A 2UUAJ 4M5DA 5L9XA 3R6GB 1W7WA 2AJQA 2IAJB 2VG5B 3AH6A 1SC1B 1OPZA 3N4WA 5GAHI 1LWCA 3HJFA 2G9OA 1O6XA 2BR0A 1LXJA 3HK2A 4F36A 1J5EJ 5ADZA 4XTTA 3DLKB 4F4YA 1XNRJ 1JNZB 1NKCA 2C2DA 4ZLNA 3ICLA 1TUGB 2V2VA 4LFAJ 4F04B 9ATCB 1TKTA 1L3VA 2ASDA 1ZA2B 2VZ9A 3EZUA 2XGQA 4EUVA 5FLXU 3AB4B 1FRJA 5D6GA 1IXKA 3HVAA 4CO0A 1U1NA 2OEJA 3POTA 4LBHA 1XIQA 1OY6A 1ACMB 4R5PA 4IFVA 4CLTA 4MKBA 4I56A 4DV5J 4Q45A 1X9SA 1LW0B 3K17A 4LVNP 4C97A 1ZZNA 2WCXA 3IRXA 2E44A 4TY8B 3GU0A 2QLBB 3DGPA 1IBCB 2W2OP 3D0IE 3PNIA 1VK3A 1N32J 1UZDA 2XI2A 1F3VA 1FD2A 4AL6A 1U1RA 3M2VA 2J9CA 2QIFA 1XJWB 1T9UA 5KFVA 1RAIB 2UXDF 3ZXWA 1Q1KA 2ZH9A 2BACA 2NXUA 4UOHA 4U67Q 4W98A 5D0RA 2ZHBA 2AF6A 2FJWA 2MB0B 5EX0A 2W01A 4CH7A 2IA6A 1YITS 3OVAA 3ETOA 3MCSA 1PBUA 4ERDA 3HCXA 2CXEA 3FNNA 1Y5LB 3LAKA 1U49A 1Y3KA 5E7OB 2WOMA 4L76A 2PGCA 4WFZA 5EX3A 4USTA 4FYYB 3O1LA 4IH6A 5KOWA 5IWAF 4ZK7M 5HQMA 4RNHA 3BF4A 1HNZJ 5GMKa 1YG0A 4TY9A 4M95A 2DR7A 4BCAA 2QX0A 2VL1A 4DLEA 2Z0GA 3THTA 1EQ0A 5C42B 1EARA 4H4MB 4X64F 1SB6A 3T9ZA 1OJ4A 5AJ3J 4J9SA 4TNOA 1KFDA 3A3NB 4HT5A 5ETQA 2XGPA 3DRRA 1XR5A 1RT5A 2A0FB 1OMSA 2B8QA 3H42A 2V4JA 3R6LB 3OTBA 3S1TA 2OFGX 3M05A 3FZ2A 2NR0A 2ZBRA 4KPYA 1B0VA 2XS7A 3V4IA 2I5JA 4LFCF 2R3VA 5CA5A 5DDPC 2B6AA 1UFLA 4YB5A 3TARA 1GXTA 3V6KA 1S1WA 1YK9A 2H4YB 1RLDA 2HIYA 3R97A 3K59A 1YX2A 4NLOA 2UXBF 5B0DA 1KD1T 3MPWA 2RB7A 5J2QB 4U9RA 2VA2A 4C8ZA 4V1Ak 3DOLA 1Y4ZB 3FSYA 2VJVA 2DCUB 3MCOA 4FVCA 2W4DA 4DV6F 4L3KA 5FIIA 3QQCD 3C14A 2DHGA 4AE5A 3W65A 3DM2B 1HBMA 2XYGB 2WONA 2K1RB 1IQTA 4XDCA 1IM6A 1FTRA 3JXOA 4Y2AA 4DR5F 1N52B 2EFQA 3CCMS 1I94F 1VOMA 2MDAA 7AT1B 4DN9A 2J8SA 3VTIA 4Q43A 2ZNZA 4OV6A 5L1KA 3QFHA 3RBEA 1TKDA 3K0JA 3AA8A 3M7VA 4TVAB 3C19A 3L9ZA 2QG9B 3FBEA 2D3ZA 4C9DA 4P7VA 3L7PA 3ELHA 4HKQA 2W9CA 3PYEA 4FPIA 1NDCA 4OZLA 4CLYA 2CZVC 4DL2A 3EGNA 3LP2A 2AMCB 4Z2XA 1ZZFA 2YKQA 3VHQA 1VQ7S 2JOQA 3OLBA 3GV7B 4CH1A 3AJ2A 4NLVA 1F2GA 4FPRA 4ZVUB 1T9TA 2HEKA 1T9VA 2W7PA 4C0HA 5C7PA 1CJKB 4RLEA 4LIRA 1KSPA 1WSRA 4ANCA 1Y9OA 3GIKA 2HHHJ 1SUQA 4EI2A 3EXCX 1RJJA 3KUHA 1WDDA 5DDOC 3NGSA 2J0SD 3MF5A 4A8YA 2AX0A 4QQBA 3EM1A 2GVDB 4DUYF 3OTOF 2JC1A 1VRUA 2L3MA 4FXVA 4IOBA 2K7JA 2E9ZA 2COLA 2VFRA 3QO9B 3SEOA 1H7WA 2BX6A 4EBDA 2JEJA 3CGIA 3M4XA 2HS3A 2FJXA 1S49A 2V8GA 3EYZA 3BO3A 3KLGA 2I38A 2VPYB 2DNPA 4B08A 2CPIA 2IDEA 4IRKA 2UUWA 1IBLF 2V8HA 5HO4A 4IH7A 4PQUA 2H51B 3J80U 3AT1B 4A8KA 4CCHA 1NZAA 5LSRA 3J7YU 3MD1A 4LVOP 2HHSA 4B9VA 1N0UA 4KV8B 1UZHA 2VG7A 2EC0A 4DBQA 3VAGA 4RUHA 3GMGA 3FZBA 1KQSR 5F0UA 1RWVB 2AX1A 1P8GA 3VAMA 5GAEI 3MCNA 3J81U 3H90A 2B8PA 2HIQA 4TN2A 4YR3A 3MR5A 2CJYB 1DY3A 3Q86A 4CP5A 3MEGB 4RW9A 1N0VC 1M1HA 4EZ6A 3PZPA 2UU9F 2HQGA 2B9YA 1JXEA 1H2UX 4URQU 3Q8QB 4UF4A 2HNZB 3RB0A 1DRZA 5J2MA 2XQCA 4IFYB 4RL1A 5D0HA 3OLAA 3Q24A 3GYNA 1VGYA 5IXUA 2AGQA 5IZHA 1KDNA 1Z2ZA 1ITPA 5CHCB 2B56A 2GJ2A 1VQ5S 2OMLA 3D67A 1G6BA 3IGVA 3Q8YA 3TUJC 3EGZA 3BGLA 3M8YA 4JV2A 4F67A 3I82A 2BEFA 4DL5A 3MM5B 1QDUB 1X5TA 2RQKA 3CJSA 4P7TA 3J7Z5 2AHOB 2DIUA 1HNVA 2MY7A 3UWTA 4DU7A 4ECWA 4QW8A 4LREA 1X4BA 1X9WA 2HQCA 2YNIB 3AQPA 2XSJA 2Z8QA 2QLXA 3TA0A 2HGMA 1RAOA 2LXUA 5THWA 5ETSA 4NCGA 4RO0A 3BB5A 3W9JA 4J9PA 2R4FA 3NOGA 3IA0A 1L5UA 1VISA 4ED5A 2GC8A 1FK9A 4ZLJA 1RTIA 2RF2B 3DRSB 1YTYA 1KHVA 1ZM9A 1OQ6A 3MWBA 3FCVA 1MWQA 4Z37A 3P3DA 2IDLA 1KKHA 3PX0A 4RWWA 4WZMA 3QZ8A 2H3EB 1TAQA 4DV0J 1UVJA 2CQ0A 1GMWA 1L3UA 3SXLA 2NXNA 4H4OB 3HHDA 2HRYA 1QM9A 2UUCF 4QYZJ 4TU8A 1Q4RA 1X60A 4HDHA 5ETMA 4N41A 1F0XA 4C3MA 1GNKA 3TO8A 3TNVA 1O0PA 3KDNA 3H2LA 2R7TA 2YQ1A 4NA1A 1C0TB 5T7LB 1Y11A 3N6MA 4DL3A 2ASJA 3BH7B 3PRBA 5KFBA 3PEHA 4NWBA 3L09A 1WD6A 5H9EK 2E5JA 2KG0A 1TELA 1KLMA 3MPYA 2QA1A 3OR1A 4YHHJ 1I3OB 4K50A 3TAMB 3GYGA 3C16A 2CPXA 3IWNC 4IOAQ 3TWZA 2GAHC 2RSQA 1FWLA 1YBAA 3VAHA 4RW7A 3V81B 2BVZA 2B9WA 4DV2J 2CJQA 2CQ1A 5CCMA 5F8IA 3PX4A 3HX9A 2Y8WA 5KOXA 4X4UA 1HBUA 4EZ9A 3SSQA 2XY7A 1RCOB 4LF8J 4IRDA 1BQMB 1LW2A 4IKAA 1QE1A 3SYZA 2I9SA 3Q0AA 4G1QB 2IJNA 2B7CB 4PWDA 2RHSB 3X3UA 3DDKA 3MR6A 4ID5A 1FNOA 1YWXA 1DQ9A 3M8PA 5I3PA 3WZ0A 5AXLA 3KLHB 5LL6d 1WOPA 2P9CA 3BV8A 1KVJA 3MM6B 4ZVGA 1DTTB 2V50A 3FK4A 1HWKA 3O2IA 3UD3P 3DLEB 4C3LA 2VHGA 1F5AA 3A3OB 4WBFA 4IUFA 4D3GA 3JSMA 4ZVOB 1FEEA 4I69A 1JLBB 4M5MA 4ZP6A 3ITHA 3HT0A 2ZJRQ 1S77D 1S12A 3D0GE 2B43A 2MXYA 2AJFE 1QTNB 3A13A 1DJ0A 5RUBA 1F9HA 3HVRA 1UTAA 1RYSA 1T05A 3Q2SC 2VONA 4DSJA 3H8YA 2QYCA 3M30B 4NX9A 4ETXA 3S6EA 3WC2A 3HT3A 1RT2B 1F5CA 4B3TF 3G6VA 3PY8A 1VQYA 2IVYA 1U1OA 3J7AN 3A4TA 4ZHRB 1E6YA 4QIGA 3IG1B 1WG4A 5HLFA 2HNYA 2YWHA 3DLHA 3OJUA 1PBAA 1SI9A 3QT8A 4J9LA 3CIMA 1UWBB 1VQ6S 4UZCA 1UPMB 1VR6A 1SKWA 2C2EA 4DQPA 1TMMA 2L9NA 1I6JA 1JLAA 2W7OA 1RT1B 3GCXP 4J5OA 4ITSA 2FZCB 3H5UA 4CTAB 1S59A 3VCDA 4IH5A 2CQPA 3C2PA 2C2NA 2ZEJA 3OFFA 2DH9A 4TYBA 5KG0A 2KO1A 4MK9A 1HA1A 1AFIA 5BR8J 2AD9A 1VS3A 3ZZOA 4I1TA 4N8OA 3IWXA 3ZZRA 4CLPA 2AYBA 2Z2ZA 3BR8A 1YJ9S 2KB2A 3I31A 2GA7A 1H3DA 1FRHA 2BABA 1W2BR 4DUZF 4MKVA 4LR9A 5HROA 3G9CA 2HURA 3OXLA 5CD4A 3MHYA 2C3UA 1VQPS 2CNKB 1XERA 3IMQJ 4AQYJ 1C1CA 1X4AA 4LF5J 2Z56B 1XMBA 4OV1A 5K8MA 4DHVA 1YRUA 2FJBB 1S1XB 3GIIA 2W7AA 2V34A 5LSLA 2OJ3A 3CD5A 2XM3A 1QSSA 2YWGA 2JEFA 4WTYA 4KYZA 3GIJA 3OXGA 1RA6A 4USUA 1IKXB 2DGQA 4ID8A 4QU6A 1XEZA 1I94J 4H54A 3QPIA 4IOCQ 2UP1A 5DLGA 4JUZA 2R9LA 1PJ5A 2VQFJ 3I55S 3NG8A 1MMLA 3F0NA 1YZ6A 2FVQA 5A0YB 5ETPA 4P2XA 3BREA 4J9NA 3R5BA 1OPIA 1YZ7A 4KT0C 2CQGA 1KS2A 3FFIB 1P9QC 2M52A 1NSKL 1XTZA 1KBRA 2HK3A 4LF6F 1S97A 2FHJD 5I3QA 3G8QA 1HL6A 1LK7A 1RWWB 1NM2A 1UVNA 4ECZA 2GMJA 2DRBA 2LQJA 4LF1A 4EYHB 1HWLA 2EFOA 4USIA 5M2PA 2ZVSA 1SKRA 1MROB 1WC0A 4ELVA 1RI7A 2W2QP 3MURP 1U1MA 4P10A 3KK1A 4OI0A 1VJWA 2I0XA 1M1KT 1TR0A 5GMDA 5HMWA 1WDTA 2OI2A 2DR9A 1GFWB 4JI6F 2J0QD 2MLYA 3KMQA 2RMLA 4CT8A 3R3TA 3CJTA 2B0GA 2Q79A 1CLFA 3H4DA 4TLRA 4ZCLA 4E0DA 2J9DE 3QGPA 4LRDA 4AL7A 4IG0A 1YJTA 1HPZB 2EWHA 2KZZA 1YGYA 2U1AA 2LEPA 4X4OA 4E2FB 2OPRB 1S5ZA 4OLOA 1NJWA 3OD2A 1WC1A 2QFIA 4X62F 3M9NB 2RUGA 4ZPAA 3BKTA 1IBLJ 2JLFA 2QFJA 5KG5A 3JSRA 1K0VA 4RNMA 3D2WA 3I0SB 3F41A 1Q7LB 1FESA 4GKKF 1LFPA 4RZRA 2NSCA 1TV6B 2PE8A 3IBCB 2HAFA 4ILLA 4OJHA 4OMFG 1FE4A 2BDPA 1O5JA 1NSAA 3DOMB 2PA8D 2CQ3A 3BGRA 3QJJA 1UVKA 1CJTA 4O44A 4C8LA 4I2QB 2ZDPA 3PCOB 2QYGA 5KFIA 3TUZC 3WQPA 3LAMA 3DLGB 1RTZA 3MEEB 3ZTQA 4DV7F 2C28A 2ZBQA 5KFWA 4ED0A 2ERRA 4FZVA 1XMQF 2JHEA 5F8JA 1ROFA 2PD1A 4E98A 4ZVPB 3OSNA 4FYVB 3ZZUA 4ZKAA 5KFGA 3D0HE 2JDJA 4NOHA 1Q53A 5A8KA 3H40A 2P6TA 1VI7A 1U45A 3JAMU 5GADU 1WUUA 5F3TA 3X1LB 2RKIA 3PIPQ 4ZA1A 1Q8BA 5HJYA 4C8OA 2K1RA 3I9V9 3M2RB 4CLWA 5IM0B 2ZHAA 2XMJA 1YHQS 2ZUAA 5K14B 4XPCA 1K1QA 3AB2B 2OELA 4ZP8A 4UTGA 1UVIA 4N8NA 3EPIA 2QA4S 2LU2A 3PXGa 1ZTWA 4P2MA 2BV3A 2MTLA 3GG1A 5DDQC 4K4TA 3BSNA 4JYAF 3OL6A 1R3NA 3I32A 2J76E 5B7WA 3KHGA 2XLJA 5C5JA 2HFVA 4HHJA 3EGWB 4DL0C 3K7RA 1N56A 3KJVA 1S72S 3ONQA 4KJIA 1BUXA 4O0IA 1G3OA 3LP1B 2DNRA 3BDPA 2HAIA 3SQGB 1W26A 3VVUA 1M5SA 1S6PA 4FF4A 2DGUA 2PMHA 5D0EA 1V6HA 5G4DA 2VDIA 4EBCA 2R7WA 4OYIA 2DVIA 2F8EX 2VBXA 3AD7C 3H0PA 3I6PA 2C3PA 1HWUA 4ALZA 1WG5A 2HVEA 3PHEA 3OR2B 2R8JA 3ILOA 4OX9F 2GVDA 4DU8A 4M5LA 5KFFA 1U25A 3C3LA 5AT1B 2G0JA 3IWLA 2Q1LA 3VGVA 4B9TA 3QO9A 5HP1B 2XULA 2IRYA 3MOJB 2EXUA 3DLJA 2UUBF 5AE1A 1JK9B 4ZCKA 2AYEA 1FX2A 5J1EA 1NLKL 2DY1A 3UPFA 2NPIA 5DM7Q 1FKOA 3BYPA 4LIWA 1R31A 2HFOA 4OHXA 5KFTA 1HQEA 3KUGA 5DG7A 1FE0A 4ETZA 2VD3A 1BHNA 1V5IB 4DMZA 1VQSA 3DOKA 2HWTA 1CVJA 5CAAA 3KLFB 1RT6B 4B9MA 3CCZA 2MGZA 4HL9A 4KV8A 2EKYA 1TL7A 3PFEA 2FVCA 3KLIA 2J6TA 1RHUB 4NASA 1LWXA 3HP6A 2FY8A 2IFXA 4QCLA 4OHYA 1RT4B 4DFMA 3OUYB 2FVPA 4LSNB 2NCKL 3DC2A 1FA0A 5K20B 1TL4A 2V94A 5J1NA 4CIOA 5HMZA 3PW0A 3M6WA 3MEGA 4B3SF 4ECVA 4YR2A 3GFXA 1FXRA 3JTPA 5DO2A 3CCVS 1F3FA 4RPFA 1YQHA 4J9OA 1FJ7A 2BE9B 3O8WA 1TP7A 1RADB 2DISA 1N33F 2DEIA 4PAAA 2HNZA 3CJQA 3U02A 1ZBTA 3ISZA 2V63A 1RU1A 2IM0A 4KB7A 1H72C 1HQUA 1AUSL 3CCUS 2ALYB 1C1BB 1NKEA 3J80Y 4OJ1A 3OJSA 1U48A 1GXLA 3KKFA 2C42A 1MU2B 3AOAA 3I5CA 3OVSA 2HHWA 5M2UA 4DSKA 2VPXB 4NLWA 4F4XA 4JB8B 3MM5A 2XY6A 1XR7A 5E41A 2HLTA 3M8WA 4DLGA 2BJ8A 4HI1A 3SCKE 2CWXA 4X4TA 3QT7A 2M70A 1U1LA 2V8DA 2EBEA 2X1AA 1NK4A 1U8SA 2AYGA 2DNOA 4KHPJ 4DV4J 1HLWA 2PFFB 5CCLA 2ZOMA 1TUVA 3U1LA 3KNAA 4QWAA 4U6PA 2HHQA 1T7PA 4FBUA 2RQMA 2CDQA 2DCLA 2FLNA 1WC4A 3DRSA 1SH2A 2Z57B 4J9VA 1LWCB 4LSZB 4MMOA 4O3OA 3FEXB 3GQCA 3HVWA 2NZCA 1K73T 1P27B 2F8MA 3GV8B 1M90T 2ZM6F 5D4OA 5KTQA 5F8NA 2R2RA 3D3BJ 3P49B 4Q0BA 1RWNB 4MTPA 3NGKA 1X4CA 4KBIA 2L48A 4J9KA 4OYAA 2CQ4A 2P6SA 2OUGA 4WYWA 3MECB 3ISND 4DS4A 2B4VA 1WHXA 3Q2TC 3RJMB 3GCWP 2EFVA 4PRFA 1EIYB 5T7LA 1RBLA 1V3ZA 3W9HA 4DPUA 1UKUA 4R5PB 5KT7A 2QLJB 1U2FA 3PG9A 3R2CJ 2MZTA 5IS2A 2H65B 3W8GA 2DXEA 3IRXB 2KFYA 2RRBA 1PC4A 3TAMA 4CO1A 3MMAA 2IIHA 2VFTA 1R6YA 2H4WB 3OV7A 3NS7B 4F3MA 4Y3CA 1RWOB 2ABYA 2IRUA 4L6V3 3TX0A 3ZTPA 2HBRB 3KYLA 3BPSP 3Q89A 1QD1A 2MSTA 2WBRA 4F25A 2XEXA 2PI5A 2ALZA 4M5IA 4GRSA 2ROEA 5LSOA 3L7OA 2JL9A 4M5KA 1S1UA 2BE7D 1FRLA 1EJ7L 1WF0A 3RBDA 4ECQA
chains in the Genus database with same CATH topology
1SB6A 3SCIE 4I2PA 2RU9A 2YX1A 4HYKA 3JTNA 4JI7F 3T9ZA 4G1QA 4C2MA 2CJ9A 3CCJS 4ED3A 3GR0A 3SSSA 4K4WA 4J9SA 3HHKA 5AE3A 4TNOA 1KFDA 4Y0FA 3HKZD 2A18A 1OSCA 2HPUA 2JEIA 2KFZA 2V4QA 3OTEA 4HT5A 5KT4A 1P1LA 4OZJA 2J7UA 2MYFA 4RX6A 3CDBA 3ZZYA 3BQ2A 1PO6A 4A8MP 1VHFA 3N5FA 2BRKA 5HQ8A 3K58A 1REVB 2VC1A 5HMYA 1ELOA 2XGPA 3DRRA 2WOMB 1XR5A 2BJDA 5J2QA 2MHEA 3B82A 1VMBA 5BYRA 4DEZA 5HI7A 2I2YA 2FGCA 1RT5A 3MMAB 2OTLS 3OBIA 5HBMA 3F56A 3MOZA 1NNDA 2BJEA 5EN1A 2R7SA 3DI6A 3W2VB 4EWTA 2F8HA 4IR1A 2V4JA 4KGKA 3PO5A 4R8UB 4LFBF 3EXYA 3OTBA 5B0CA 3NAHA 3M32B 3S1TA 4IG3A 3KLEA 4WU3A 2OFGX 1FT8A 3M05A 2HYIB 3FZ2A 2E66A 2NR0A 3SCLE 3MMCB 3TQ1A 3MM8A 5BJRA 4TQSA 4KPYA 1B0VA 2XS7A 1GQEA 2AJ4A 4LF9F 3DM2A 1DTTA 2GW8A 2NSBA 3J7A1 3I96A 3TVZA 3V4IA 3CCES 2I5JA 1V9OA 1DAXA 4DFJA 4LFCF 5CA5A 4K4YA 1N5SA 1Y5NB 1KOOA 3MAQA 4QPTA 1T03A 5DDPC 3DLEA 1S1UB 2HG4A 2B6AA 2UVRA 2UV8A 1UFLA 5K9FA 3FRZA 4WXOA 1M5OC 4XO0A 4YB5A 3TARA 5IQ6A 1KR4A 2YWEA 4ELUA 4RW6B 3T1AA 1GXTA 3V6KA 2CQDA 1S1WA 2XWYA 4I2PB 1ZPWX 1KVIA 2ZITA 3HXMA 1WHWA 1JLQB 1X4EA 3K59A 4NLOA 1I1GA 3E3XA 2UXBF 3IR7B 2N3OA 2FJDB 4H4KC 5B0DA 1FJEB 3SMZA 4OI4A 1KD1T 4XK8C 3MPWA 5I42B 1F5BA 2RB7A 3SV3A 4RU2A 5J2QB 2CQBA 2MMYA 2WRMA 3FGVA 4U9RA 2VA2A 2UXCF 2DPJA 1RT5B 3KHRA 4C8ZA 3DOLA 4FYDA 2PSZA 2XNRA 1Y4ZB 3FSYA 2A3JA 3DI6B 3IO1A 2DCUB 3NKYA 2KG1A 2HQIA 1N88A 2V4JB 3JAMY 4ED6A 3PRDA 3R5CA 3KHLA 4FVCA 2W4DA 4KR0B 4IG3B 4DV6F 5DGAA 5KFOA 2YWFA 1RT2A 2FGOA 2RT3A 1QAXA 5FIIA 2FVRA 1X4GA 2KYZA 3MDFA 5F8GA 2NUHA 2DHGA 3T6BA 3LWLA 4KIAA 3K5MA 2ZKTA 4AE5A 1RT3A 1CQNA 1MWZA 2ILZA 3DLBA 4O23A 3DM2B 4MIWA 1HBMA 3BDEA 3V4IB 1NJYA 3C6UB 4F02A 2IMOA 2F4VF 2J9EA 1AXQA 2HS0A 4IYQA 2WONA 2IRXA 1T03B 3E8OA 3GFZA 3T9NA 3OL8A 2K1RB 2B6AB 3MM7A 1HR0F 1IQTA 4QZVB 1Y7PA 4WFYA 4AXIA 2MJNA 2EG2A 3B4DA 4XDCA 2XHWA 1WF2A 1XR6A 1WTBA 2UUAF 1FTRA