2LA6A

Solution nmr structure of rrm domain of rna-binding protein fus from homo sapiens, northeast structural genomics consortium target hr6430a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
MGHHHHHHSHSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein FUS
publication title Northeast Structural Genomics Consortium Target HR6430A
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2la6A01
1UW4A 2E5GA 5IQQA 2MQOA 2MY7A 3MUMP 3JB9k 2M4MA 1X4GA 1HA1A 2MHNA 1VC0A 1WELA 3MURP 1VQ5S 2DH9A 1M5VC 2LCWA 5BJRA 2RRAA 1FJ7A 2MZJA 1BY9A 2LMIA 1M5PC 3VAHA 3S01A 2ADBA 1KC8T 2OTLS 1H2VZ 5DDPC 2CJKA 4F02A 2LXUA 1N52B 5MLCV 1U6FA 2LXIA 2A3JA 3CD6S 1M5OC 2MXYA 1WHVA 3H2VE 2DGOA 1WHXA 2ZJQQ 2MKSA 5JVGQ 3UD3P 3BEGB 1U1LA 2M8HA 3G9CA 3ZZZA 2M7SA 2DNLA 3K0JA 4LIRA 3R1HA 1IQTA 2M0GB 2DNHA 1URNA 2LYVA 5EN1A 3P3DA 1YWXA 4UQTA 2J8AA 2M88A 1KOHA 1WTBA 2DNOA 2XNRA 4A8XA 2CQDA 3PIOQ 1FJCA 3VAJA 1Q82T 4LMZA 2X1BA 1ZZFA 2G0CA 3EGNA 3S7RA 2SXLA 2CQ1A 5GAEU 1HD0A 2QEXS 1KQSR 2I2YA 2MQPA 2ERRA 2DO0A 2LA6A 3CCRS 1JJ4A 3NNAA 2L08A 2KG0A 2FY1A 5FJ4A 2RQ4A 3UWTA 2XS7A 1M1KT 2UP1A 5LJ3Y 1WF0A 5LXYA 2HGLA 2MKKA 2MMYA 2D9PA 2KYXA 2CQ4A 1X4EA 2LKZA 3S8SA 2CPYA 2QA4S 2FPHX 3TO8A 4CIOA 3HI9A 4FXWA 2I38A 1U2FA 2MYFA 2AYBA 1VQKS 2AYMA 4C7QA 3CMES 3BS9A 2VOOA 3TYTA 2DNKA 2DITA 5GADU 3TP2A 2ADCA 5DDOC 2HZCA 1O0PA 3DLLQ 2LQ5A 3DXBA 3VAGA 1SJFA 3RW6A 2DK2A 1X4FA 1X5OA 2Q79A 3R27A 1SJRA 1U1MA 1PO6A 2MQQA 2MZRA 2DHSA 2CQBA 4YB1P 4CQ1A 1YI2S 3UCGA 4U67Q 4W90B 1VQOS 3U1MA 2E44A 1UP1A 1U1QA 5H1SV 2DHXA 2J76E 2B0GA 3NMRA 2KFYA 3NNCA 2DB1A 2MZQA 3MD3A 4ED5A 1JJHA 2M52A 4YOEA 1KD1T 2OIHA 1WI6A 2DHAA 1VQ9S 1M90T 1G2EA 2XSFA 1VBXA 1RKJA 2DH8A 1YTYA 1YJWS 2JWNA 4IOAQ 2HYIB 3P6YC 2CQ3A 5DM6Q 1U1OA 1H6KX 3G4SS 2DNZA 3OW2R 3LQVA 1QM9A 5GAGU 3VALA 2DH7A 4IOCQ 2JVRA 4Z2XA 3BO2A 2LEAA 2AD9A 2N82B 2CPXA 1DHMA 2M9KA 2VODA 5DDQC 1D9AA 2E5HA 2MSTA 5CYJA 3MDFA 1Q81T 3CCSS 2RS2A 1R8HA 1X4CA 1FHTA 5DDRC 2F3JA 5LSOA 1VQLS 1U1NA 2VOPA 5HL7Q 1FXLA 4UY8T 2DNYA 1A9NB 4PKDB 5IFMA 2FHOB 4QU6A 5IM0A 5DETA 4IO9Q 1S72S 2CPEA 2N3LA 1VQ8S 2GO9A 3CCVS 2KHCA 2MQNA 4EGLA 1FJEB 1WEZA 2DGQA 2O3DA 1S79A 4PR6A 2FC8A 4WKRA 3ULHA 1P27B 2DIVA 1WG1A 2PE8A 2RNEA 4WFNQ 5JVHQ 5GAHU 4BS2A 1JMTA 4LJMA 3SMZA 3CXCR 2OTJS 2YKAA 2N7CA 2DHGA 2V94A 3CCQS 2CQ2A 3HHNB 2N3OA 3S6EA 4QQBA 1OWXA 2U1AA 1R8PA 2X1FA 2VONA 2FC9A 2M70A 3CF5Q 3L3CA 3NNHA 2CPHA 1B7FA 1FNXH 1X4BA 2HGMA 4C0OC 2CQIA 4RU2A 1DBDA 3R1LA 1W2BR 1VBYA 2MJUA 4P6QA 2CQ0A 1VC5A 2KXNB 2ZJPQ 1VC6A 3CC4S 1PGZA 3N9UC 4OZ0A 4WFAQ 2MKJA 1K9MT 4ERDA 4Y0FA 2NZ4A 2MJNA 3EGZA 2KG1A 3IWNC 2DGTA 1WHWA 3I56S 1VQPS 1HD1A 4F26A 1H2TZ 2CPZA 2U2FA 2YH0A 1SJ4P 1X0FA 2D9OA 5ITHA 3J7ZT 1YJ9S 1YITS 2XS5A 4IUFA 1NU4A 2M8DB 1F9FA 1SJQA 2RVJA 4F25A 1WEYA 2LA4A 2YH1A 1VBZA 1VQ7S 5LXRA 1QVFR 5IM0B 3G96A 2HVZA 4TU8A 4TU9A 1YJNS 1A7GE 4WF9Q 3MUVP 2WBRA 3G8TA 1X4DA 3J7YU 2J0SD 1UFWA 3SDEA 3LPYA 2AYGA 2KRBA 1KOOA 2JX2A 2KI2A 3BO4A 2LECA 3PIPQ 3RW7A 2OSRA 1N54B 2L9WA 4J5OA 3VAKA 5D77A 2DGSA 2KN4A 4Y00A 3CCLS 1WHYA 3SXLA 3Q2TC 4YUDA 3FEYB 2E5IA 3B4MA 1VQ6S 1FO1A 2G4BA 3CC7S 2X1GA 2MB0B 1VQNS 2MQLA 3UCUP 1WI8A 4CH1A 3CCJS 1ZZNA 2MQMA 2G1DA 2PEHA 2DNGA 2M2BA 2KH9A 3V4MA 2XNQA 2QFJA 4CH0S 3NS6A 1UAWA 1D8ZA 5CA5A 2YWKA 3CPWR 3ZZYA 3P49B 3MD1A 3MUTP 4ZKAA 3VAMA 3UD4P 2JVOA 1YHQS 1SJ3P 2CPIA 4FXVA 2XB2D 2RS8A 2DGUA 4PRFA 2DNRA 5GMKa 3U1LA 2KM8C 5D78A 3CCMS 2DIUA 1OO0B 2DNPA 2MGZA 1N88A 3CCUS 1WF2A 2MKIA 1U1RA 2KVIA 2KXFA 3MI7X 3CULA 2DGVA 1L3KA 2AYEA 3THPA 2MKHA 5LJ5Y 1OIAA 3CCES 5CXTA 3FEXB 2CQHA 3IRWP 2KU7A 1XN9A 3CMAS 5HO4A 3B4DA 2DNQA 5GVQA 4WCEQ 3BO3A 1NJIT 1WWHA 2F9JA 4QPTA 2JRSA 3SDEB 1CVJA 2MY8A 2MZ1A 1QVGR 2MKCA 1X5PA 2RQCA 1HL6A 2RUGA 1ZH5A 2L41A 4OZ1A 1WG5A 2GHPA 3UCZP 3Q2SC 1Q7YT 2K8GA 4WIIA 2DISA 2BZ2A 1OPIA 2LEBA 3H2UB 1K73T 1FT8A 1M5KC 2XS2A 1P1TA 2KM8B 1DZ5A 3THTA 4W92B 3MXHP 2DNMA 2J0QD 2OSQA 3VF0B 3G6ES 1Q86T 2DO4A 2BOPA 1U6BA 2CQCA 3I55S 3CC2S 3CUNA 2CPFA 3G8SA 2RT3A 4M5DB 2KRRA 3MOJB 1K8AT 1VQMS 4V19X 2EK6A 2ZJRQ 1NO8A 3G71S 1U1PA 4WFBQ 1X5TA 4QU7A 1VQ4S 2X1AA 5LSLA 1X4HA 2MZTA 2MPUA 2DNNA 2K3KA 1YIJS 2MSSA 2NLWA 1N8RT 2MGZB 4C4WA 3CTRA 3EX7B 2F9DA 2DGWA 3D2WA 4TU7A 2CPDA 1X4AA 2RRBA 5DM7Q 2D3OR 2KT5A 2CPJA 2HGNA 2CQGA 3US5A 2KXHA 2RU3A 1DRZA 1AUDA 2YTCA 1H2UX 1X5SA 1U1KA 2DGXA 2CQPA 1WF1A 1JJ2R 1WG4A 3P5TL 3VAFA 2OJ3A 2EK1A 1SXLA 4TLQA 3UE2A 2MZSA 3NS5A 2EVZA 3VAIA 1WEXA 1RK8A 2E5JA
chains in the Genus database with same CATH superfamily
1D0EA 4KE5A 1WSVA 3FC9A 3BKTA 1YRUA 2R4FA 4GVBA 1HBNA 4IRKA 3B82A 5ETKA 3PRBA 4C3LA 3AHPA 5C2CA 3IGNA 3H42A 1M1GA 2ADBA 2OTLS 4NXNF 2RH3A 4DUTA 2DCLA 1U25A 2VPZB 4AXJA 4JI8J 4A8MP 1M5OC 4G1IA 3OL6A 2DR7A 5JVGQ 3FRYA 2IJRA 1TKTB 2VC1A 1NK8A 3QYYA 1CJUB 3BSAA 5KT5A 4UQTA 2W2OP 3OJSA 4JI2J 4CDIA 3BGUA 1N5YA 2ZC3A 4EWTA 1NEEA 2HQCA 3EGNA 2IM2A 2QEXS 3ONQA 5GMEA 2HBQB 4FXDA 3DOMA 4IH6A 2HGLA 1Q8LA 3DOKB 3RB6A 3W9IA 1HNXF 5F0WA 1IKXA 4FXWA 4ZVTB 4K7QA 1EETA 1O0PA 2IAJA 3H4BA 4RBVA 3FQKA 2PC6A 2MQQA 2HK3A 4GRSA 5KFXA 3C6UB 4U67Q 2R7XA 4MK9A 2IC3B 2IJNA 3HVTA 2WVCA 2DHXA 1FKOB 4JI0F 1YLXA 2ACMA 3K59A 3GYXB 3O1LA 4L76A 3GCWP 2I0XA 3SQGA 1VRTB 3A4TA 3CIMA 5HROA 4FYDA 2DNZA 3LP1B 4U9RA 3OW2R 4OL8A 3TARA 2KKHA 5AXLA 2BJ1A 2IJFA 3M1VA 5L1IA 2AD9A 2VA2A 1VI7A 1UFLA 2WVEA 3QO9A 3JQKA 4MKBA 3J7Z5 2HNYB 1LWXA 4C0BA 2YPYA 4FF3A 1PAEX 2NPFA 1W25A 1FXLA 2EWHA 5IT0A 3AT1B 4DUYF 4IO9Q 2C3YA 1GFWB 3GFHA 4MTPA 5LSRA 4N76A 3K17A 3OPKA 3D9BA 3R7NB 2B6AB 4X4QA 1N5QA 4LFBF 3OR1B 2XWXA 4CLZA 5BR8F 3NCQA 4K5SA 4M5IA 2UZAA 2NXEA 5D3GB 3A8KA 2DXDA 2J7KA 5DG7A 4P6QA 4S0MA 3OHAA 1H7XA 3WQPA 3T1HJ 2BJ9A 4B3MF 2QC3A 2KG1A 2DGTA 1H2TZ 4ITSA 4I69A 1X0FA 1IBKF 1XMQJ 4H4MA 3DLHA 2W25A 4PWDB 3D1HA 1U49A 1S1TB 3NEKA 2B9EA 4X4RA 2OFGX 4NLTA 1JXVA 2IDLA 3PIPQ 2RB7A 3W2VA 3LP2A 4MJKA 2HBYB 1RHJB 4A8FA 3C66A 1HNIB 1FWLA 3HHEA 4PPZA 4NASA 2MB0B 5KG1A 1UWBA 1S0OA 4JB8B 1RT1A 3JYTB 2MQMA 4J90A 4WIQA 2VDHA 2HVDA 2HWHA 1NUEA 2RAQA 2B9XA 1YHQS 2Y3YA 4I56A 4DDFA 5A76A 3CIZA 4ID5B 1R0AB 4DQRA 1LWFB 2GMHA 3QRRA 3R5BA 3NOCA 3ZTQA 1V5VA 2W7PA 3IS9B 2VU5A 1KNZA 1NPRA 3QMQA 3KK1B 1HL6A 1NCLA 1S1XB 2RHQB 3KFWX 2ZM6F 3CDWA 2HHHF 3VF0B 1Y00A 3G6ES 5F8JA 1KS2A 4DHVA 2DPIA 1RT4A 2XMMA 1VYAA 1RAJA 3KG1A 3VWSA 2ZDPA 4OIXA 4M63A 3KHRA 3OTCA 1VGYA 3R6GB 5LT5A 1CJUA 2XY7A 1C1BB 2CJ9A 1ZAVA 3MFHA 2K3KA 2UU9J 4ECQA 4ZVHA 1KLNA 1X4AA 5DM7Q 2HHUA 1QD1A 2VZ9A 1U2RA 3M8QB 2VG5A 1S57A 3N01A 3VAFA 4Y34A 3NS5A 3QLHB 1IKYB 2OAUA 3DOKA 2CVIA 2XMVA 5E41A 5HK4A 4LRFA 2C3OA 3HM9A 3TA1A 3CO0P 4X62F 4EBCA 4KHPF 1FJ7A 2MZJA 3FBBA 2NCKL 3D0GE 2YX7A 3GSIA 2AGPA 4IOBA 5KFKA 2MXYA 1WHVA 1UW9A 3C6UA 4UZBA 2B56A 2IC3A 4TQRA 3W7BA 4I2QB 4WXWA 1FKOA 4CCHA 2X51A 3DLKA 1VLYA 1PG5B 5D4OA 5L9NA 1JLFA 1VRTA 2X1BA 1EZZB 1HD0A 1RWKB 1MWQA 2ERRA 4AL5A 2A1BA 3LP1A 2O66A 2BACA 2VQEF 1WKLA 1JLBB 4X2BA 1QE1B 2NXCA 5IXUA 4I2PB 2HNYA 4AE5A 3T1AA 3HI9A 1AZSB 2BW2A 2DRAA 4DV4F 3CJRA 4UY85 1JB0C 4Z37A 3DYAB 1LXJA 3TANA 1FVSA 1HWKA 5J2NB 1Q8BA 2WSCC 3AB2B 4JI1J 3ZNJ1 3X1LB 3DXSX 4OJGA 1ULRA 2RF2B 4PABA 2B6AA 2J76E 2DB1A 2VA3A 4DL4A 3OR1A 2B5JA 3OTDA 4I6YA 5LMNJ 3HULA 4B3TF 3UN5A 4FNIA 1RKJA 3ZZOA 1SH2A 3PZPA 3P6YC 2FUG9 5D3GA 4GKKF 1IM6A 1GMUA 1JNRB 2OELA 4M5HA 2R8HA 2ZOFA 4EO8A 3FK4A 1P8GA 2DYAA 5K8NA 4HACA 2XMWA 4IOCQ 3BM7A 4LQ3A 1UZDA 5CYJA 1YJVA 3R9LA 1NJWA 4BC9A 5SZTA 3DRYA 4LREA 3Q24A 1S1TA 1RWOB 3UN2A 1RT2B 1S79A 4PR6A 2UUAJ 5GAHU 1NK9A 4N5SA 3BGLA 3ENQA 5KOXA 3CXCR 3ETMA 3ZTRA 1HNIA 4YP3A 2U1AA 3VV2B 2WOMB 2QLXA 3JYTA 2ZH7A 3LPEA 4EK2A 1W2BR 2XMJA 4LF8J 4GO5X 2MJUA 3NWRA 4ZPCA 1RWMB 4WFAQ 3HP6A 1W7WA 4A8QA 1PBUA 4Y0FA 4ZCIA 3LTOA 1NU4A 2FHKA 4ID5A 3EVOA 2GFFA 4IDKA 3LGNA 3G8TA 4M5NA 4LF5J 1HNWJ 2V8VA 4A8WA 3QRQA 3RRHA 3KK1A 3MPWA 4ICLB 2UXDF 3K5PA 1S12A 2W8LA 1PJ6A 2NQPA 4DWIA 3MZIA 3HK2A 1RAGB 2HQFA 1S1XA 4K2JA 4YQWA 1PSDA 5JMNA 2VF3A 1ZETA 1IR2A 1FESA 4ZMMA 4DQIA 2QFJA 1UAWA 4Y2KA 5A8WB 2V4JA 3MEKA 1S6OA 1MW7A 2AGOA 4PQUA 4O44A 1IBMJ 3G2XA 4DV0F 2FB0A 3GR1A 2V2ZA 2UV8A 2I6WA 3R3TA 1TAQA 3M8QA 4OV6A 2R7QA 5EWGA 1WWHA 1CVJA 1NNDA 4ED4A 1IKYA 1CC8A 4QCLA 3MR5A 1KR4A 3BQ1A 1RADB 2K8GA 3SZ2A 5KFVA 3B54A 4CT8A 2BZ2A 4Y2MA 3RYLA 2LEBA 1M5KC 2KM8B 4ECZA 4DFJA 3KMSA 4FYYB 5LMUF 1DJ0A 1NHUA 3TJAA 3MEGB 2NXJA 3BDEA 4C3KA 4USVA 4X65J 3CJSA 2YWHA 8ATCB 1EIYB 2H5IB 2Q3PA 3PR4A 1NO8A 4YB6A 1X5TA 2KO1A 4XAKA 1F5CA 2VH7A 3LP0B 5CCLA 2M5YA 3FGVA 5E33A 2F9DA 2R3VA 4DI6A 4ZP6A 1HMVB 2KXHA 1QLNA 2Q1LA 4C48A 2YTCA 1H2UX 4R5PA 2WVBA 5HN0A 4DJBA 1JLBA 5KFUA 1AA1B 5J1PA 2F4VJ 1QE1A 1EP4B 2G0IA 2E5JA 3KLGA 4KPCA 4PWUA 5HVFA 4YY3F 4ZVFA 3ADAC 2BJDA 2MHNA 3OXFA 1AZSA 3GV5B 2KB2A 1FDNA 3T5JA 2ZD1A 2E29A 2P2CB 1BY9A 1M5PC 3GV7B 5J2NA 2A3JA 1I94J 5M2RA 2WBMA 2RF2A 3FDSA 2MKSA 2UVWA 5E7OB 1H0HB 1S48A 3BF4A 1BQNB 2MQ8A 3UQSA 1RSCA 2PFFB 4D3GA 4KQZA 1V9OA 4TLRA 3TAQA 3A8EA 5CYMA 1TAUA 2ZHAA 1YBAA 3IO1A 1T7PA 4OZ5A 4ZJOA 3CCRS 2XS7A 3D1QA 4DR3F 1CEZA 2J9EA 2UV8G 4OYMA 1XR7A 4AYBD 4X4PA 2DNKA 3EXYA 5AXMA 1MWYA 2AV5A 2ADCA 4UUWA 3CJKB 1FXDA 1BQXA 3A8IA 1SJFA 3CD0A 2HNDB 2Q79A 1SJRA 3GE9A 1T05B 2IM3A 2ZOGA 1N33F 5KFTA 1GH8A 5HATA 2VC0A 3BN7A 3CDBA 4USMA 1UPPA 5ETVA 1GQEA 2WOMA 1FX2A 2PIIA 4EMDA 2UXBF 3AY0A 1RAHB 4RNFA 2D3ZA 4MKVA 1HI1A 1IKWB 3MCSA 4ZP8A 2W2QP 3R7SB 3UN3A 1NJYA 1RISA 1DHMA 2B4OA 4FPRA 4DPTA 2E5HA 1Q81T 3MDFA 2IRXA 2D3UA 4URSA 2FLLA 2C3MA 4WZMA 2CZ4A 3AOAA 2HS0A 2FZKB 3D3BJ 2MQNA 1RCOB 3SV3A 2GVZB 4ICLA 1R89A 4L72B 2J0WA 2OTJS 3R2DJ 2HSEB 2XHWA 1L3TA 2V94A 3EPGA 2HHVA 1OWXA 2RRNA 2M70A 4ZVUB 2H4WB 2FJXA 1B7FA 4M5LA 1X4BA 2BM0A 1NK4A 1VBYA 1CS4B 1SVDA 2CQ0A 5THWA 3WC0A 3IBCB 4KB7A 4OZ0A 2NZ4A 2MJNA 1B0TA 1VQPS 5KFOA 3JQJA 3K5LA 1FE0A 2CPZA 4RLEA 5L1JA 2FJAB 1R0CB 2FJWA 4JI8F 1OJ4A 3TQ1A 2Y9HA 5DZ7A 5J1EB 2PMHA 3SCJE 4ED3A 4I6AA 1CJTB 3W2WA 2ZFHA 3OHBA 2HLUA 3PW0A 4P10A 4CO5A 3JXOA 4JBCA 2WAQD 4NLQA 1RHKB 2W8KA 2DGSA 4RW4B 3ZFVA 4Q8FA 1Y11A 1BD6A 1CULB 3R5GA 3FEYB 2C2DA 1SBRA 4N8OA 4RW8B 3POTA 4KBIA 4DFPA 3KJFB 3L7PA 1BWVA 4A8KA 1PILA 2HLTA 1D8ZA 4WP8A 1XR5A 1UVNA 1RLCL 2EEYA 5HQ8A 2XULA 2AX1A 3OXLA 2DGUA 2D3O1 1IQZA 3LP0A 2KYZA 4F4WA 3ZZPA 2DNPA 4OYPA 2Z2YB 2KXFA 4EZ6A 4PZVA 3THPA 4UUXA 2JEGA 4RW6B 3NL0A 3NS7B 3U27A 5IOLA 4DV6J 5B0GA 2RQKA 1MG7A 4X4NA 2FYXA 3DLJA 3UD5A 2IBKA 1IR0A 4RW7A 2RQCA 3TZXA 4B9TA 3Q8VA 2ZUGA 4QIWD 1RDRA 2FHJA 2XZWA 3AJ2A 2GIQA 1REGX 2Q6CA 3GLJA 2NUHA 3WIVA 5J2QB 3HHKA 1FD8A 1SC6A 1D8YA 1X9MA 1BQNA 4PYAA 2VHGA 3HZEA 4DR6J 1KDNA 2X1AA 2PSZA 1S4FA 2DNNA 2MSSA 4M5GA 2ZKTA 3KG4A 2BM1A 2OPRB 4NOHA 3FCVA 4BWMA 3OLBA 1X5SA 2CQPA 2YBVA 3D6TB 1VJWA 1S1WB 1HBOB 4KRWA 2BUNA 2MY7A 2DPJA 2XWYA 5JJBA 5KFRA 2LCWA 3VVTA 1JLEB 5ETLA 4EI2A 3A12A 4C8NA 2HNDA 1H2VZ 3N5FA 1T05A 1FRIA 4DR4J 3T1HF 1Q0NA 1U1LA 4DPXA 4UTGA 1KN6A 2M0GB 2CRLA 2I5JB 3AJDA 5C24B 2J8AA 3M2VB 4HT7A 3UPFA 3RUBL 5I42B 4J9VA 2EFGA 4QWAA 1KEKA 3LWLA 1KQGB 2WVFA 1IKWA 3A3NB 1RYRA 4LBPA 2UP1A 2E7XA 2D9PA 2KYXA 1ZTTA 3DHXA 3MCOA 4OZJA 3JAMY 1J5OB 2AYBA 2GS8A 2ASYA 3BS9A 5E3QA 4LRAA 4LFCJ 3Q23A 4ANDA 2A18A 1VISA 3MM6B 1U1MA 4KIAA 5C5JA 5KFQA 1OQ6A 4FS2A 2HVIA 1IJFB 5H1SV 4IRDA 3NNCA 3FQLA 4ZPVR 3DDKA 1KD1T 1WI6A 1Y5NB 3SQOP 1YJWS 1R31A 4C8MA 2NSBA 1HNZF 3ILJA 1KONA 1CS4A 4QYZK 1W2IA 4OQJA 3KK2B 4F0MA 2QN6B 2W4CA 3BYRA 3CGIA 5DDQC 1D9AA 4JI5J 5KFLA 4PG5A 5J1EA 4OI2A 1S72S 2W2NP 2N3LA 2GO9A 1CJTA 4C11B 2QA2A 2DIVA 1Q95G 2KL8A 4LJMA 2UU9F 2IVFB 3C15B 1WKKA 3MR3A 4NE9C 2X1FA 4ETXA 2R9LA 2J9CA 3MMJA 4RW8A 4AQYJ 4E0DA 4ZLLA 1NH8A 2DXFA 3AD8C 1TK5A 1J5EJ 4USHA 3W60A 2DRDA 1K1QA 2FVCA 4J9UE 3I0SB 2Y8WA 3WZ0A 4YDDB 2QFIA 3DOLB 1MU2A 3BGRA 3TJ8A 5BXIA 3HHLB 5J2MA 1FNMA 4F25A 2LA4A 4FKYA 2FZCB 3G82B 2HG4A 4RW6A 1QVFR 1FTRA 3G96A 4TU8A 4OI1A 4FYWB 1X7VA 2V63A 5K14B 1HW8A 2ZBIA 4MFBB 4I64A 2ZBRA 4F67A 4DV3F 2EFPA 3PKMA 1H72C 4NLVA 2LQ9A 1RZMA 4RNHA 3TVZA 2MQLA 3UCUP 4Q7AA 3CCJS 2KH9A 1VRUA 1HWJA 4CLSA 4LRCA 2H4YB 3T1YJ 3DU5A 1ZTWA 1F0XA 2RS8A 3HVWA 3WHIA 3KLIB 3BGFA 1U2CA 3GFYA 4JI1F 3GMGA 1SQFA 5L39A 1U24A 2HFSA 4HEA9 5DZ6A 5GVQA 3BO3A 4WCEQ 1RWXB 2VV5A 1WC6A 2AMCB 1FJGF 2P9CA 4IFVA 5ETNA 1ZH5A 4OZ3A 2IBOA 3UCZP 2CNOB 3CDUA 4C97A 2YQ3A 4OI0A 2UUBF 3V5RA 1S9GB 1HI0P 4C9DA 2C2KB 4KYZA 1NKEA 3LANA 5KFAA 2JLFA 3L4BC 3M6UA 4L75A 1LW2A 1RA6A 2VKRA 1IKVA 5AXKA 3DRPB 2I5JA 4HH1A 5KFFA 4Y3CA 3M2VA 3CDEA 4I68A 1X0PA 3UDCA 3WX4A 5F9LA 5I42A 3TOQA 2QMWA 2CWKA 2OJ3A 3IM8A 4OI4A 3IA0A 1J5OA 1UJ6A 2WTFA 3NMAA 3IAM9 1WNEA 2BE9B 1WOPA 1HPZB 1IQTA 4ZJLA 2XY6A 2XNRA 4RBUA 4RJVA 1R0BG 2XYPB 2XMUA 4LF5F 2G0CA 2GJ2A 3ENAA 4TNOA 5GAEU 3CT9A 4F50A 1HNWF 4C0HA 4JV0A 3RB3A 3M9MB 1Z2LA 3KK2A 3H20A 2UVUA 1SCJB 3QSIA 1QTMA 1GTHA 2CQ4A 2CPYA 2FTRA 3JTOA 2W2MP 2FDNA 2R2SA 1YJRA 2ZC4A 3NG8A 1VK8A 1D9FA 1RLDA 2LQ5A 3VAGA 1TR0A 2X7IA 3HZGA 1WC5A 4FKXA 3I31A 2AGQA 4IR1A 3NAIA 4U7UD 4YB1P 1C1CB 5JUMA 3UCGA 3QNWB 3PVXA 5FLXU 3HO1A 3ZO7A 2MZQA 4ZVQB 1EJ7L 3C15A 1XR6A 2MLZA 2E1PA 2DVIA 4IOAQ 2H65B 1TVRB 3F73A 4B02A 3ENVA 2VFVA 2I1RA 3I0SA 3QT8A 2F8HA 4LIWA 3DOLA 3HHLA 1VQLS 4QIEA 5DJBA 2VOPA 3F56A 1VRQC 5KFNA 3A1YG 2CPEA 1TKXB 4QBUA 4MFBA 4EO6A 2HHSA 2ALZA 4DR1J 2UXCJ 5KG4A 4DV5F 2HHQA 1OSDA 2YKAA 4YR0A 1FRKA 1AUSL 2N7CA 4JV1A 3D66A 2N3OA 3S6EA 2Q43A 5B0AA 1VS3A 2VONA 2HQDA 4CTAB 3NNHA 2VPYB 2XSJA 3MAHA 2E9ZA 5I3UB 5F8HA 3GJQB 3T5HA 2L48A 2KFNA 4M1KA 2PMWA 5IWAJ 5D4LA 4KKOB 3IWXA 5HVHA 3QIPB 2Y1JA 3OLAA 2OH2A 4ZN1A 4LSLB 5IC4B 5C25B 3OUYB 2D9OA 2VBYA 3KLIA 4IUFA 1F9FA 2RQMA 3PFEA 5AE1A 1WEYA 2IHR1 1HWIA 1F9EB 4F8RA 1U8WA 2O67A 3UR0A 3P8BB 2E5LF 1YK9A 4OJHA 1OYDA 1M5SA 2VG6B 3OVSA 1HBMA 4P71A 3BBCA 3OV7A 2KN4A 2W9BB 3FMWA 3QAEA 2G0JA 4HTIA 4R8UB 4IYQA 3B4MA 1VQ6S 1S9GA 3WC2A 1ZOTA 3MGJA 4ANCA 5KFMA 3C8YA 3AJ1A 4B3SF 5C42B 2D1CA 3IRXB 2CPIA 4FXVA 2HQIA 4HDHA 4DX7A 4DCOB 4ZITA 4QWEA 3MEEB 2KM8C 4ED0A 2ATLA 3JTNA 2HZAA 1N88A 3W5XA 4KGKA 3WIUA 5CXTA 3FEXB 1UPMB 2FHMA 2EG1A 4UOCA 4QPTA 4NA2A 2FVPA 2W1BA 5KFPA 2VD3A 3CB4A 3MECA 2GVDB 3GFZA 1QSYA 3AD7C 2YNFA 2HPUA 2DISA 1S1VB 1FEEA 1OPIA 2WB4A 1SL1A 3R5JB 3LF0A 1RHQB 5U47A 3TA0A 2YKMB 3H5UA 3TUPA 3I55S 1KSPA 3CUNA 3V81B 1LNQA 1F60B 5KG0A 1KHWA 1HPZA 4Q45A 2ZJRQ 2F8MA 1XJWB 1HHSA 3EZOA 2AHOB 4M95A 3KLHB 1UETA 2XHCA 2ZH4A 4IQXA 4M5MA 4N8NA 3W62A 1WG4A 3DFEA 1CG2A 1KHVA 2MEWA 1EB0A 5RUBA 4P2SA 1S97A 2QG9B 1YJTA 3JSMA 1IBLJ 2ZZTA 2K3IA 2BABA 4G1QA 4RUCA 4WJBA 3K5MA 5GAHI 4DXLA 3MM8B 1N36J 2AW0A 3MMBB 1TL7A 5DDPC 4F02A 8AT1B 3QSYB 2RU9A 4Y2AA 3PEJA 3D6HB 1URNA 5L9XA 2ZH5A 3Q86A 1DLOA 1FKPA 4ETZA 1TKZA 3RB0A 3DLBA 1GNKA 2EC0A 2IRYA 4LVNP 3E51A 1YGYA 1SQEA 5LXYA 3QPIA 3FVYA 1QUVA 3K5OA 4OX9J 2I38A 2CDRB 3VGUA 3HHDA 4JI6F 5AJ3J 2EFNA 5CYQA 2DK2A 4WFYA 2G2ZA 2MZRA 3PDNA 4DUZF 1GK8A 1AXQA 1YDLA 1UL3A 4ZP7A 3NLCA 4PYDA 4CWBA 1BLUA 2E66A 4M8LA 3OVAA 1VQ9S 5AXNA 2W24A 3IXQA 3IFEA 3VVUA 5I3UA 1SJ1A 1RACB 3CDAA 2QA1A 3LQVA 1QM9A 4KKOA 3MM5A 2QLFB 4BC7A 2DT9A 3D5MA 3G86A 3OBIA 4PG8A 3TUIC 2HRYA 4DX8H 4LSLA 1E6YB 4ILRA 3JSBA 3MCNA 1R8HA 5DDRC 1UEUA 5CZVA 3LAKA 3J80U 3M8PB 4PKDB 2BRLA 5IFMA 2FHOB 2QZ8A 4LFAJ 4QU6A 2R2RA 4WZQA 2O3DA 4L73A 1N34J 1E6VB 1UVLA 1HLWA 4DQQA 5JVHQ 5E3CA 4HYKA 4N41A 4Q8EA 1I3OB 1MMNA 1MMLA 2W9BA 1HWUA 3HPOA 2FC9A 4RX6A 3Q8RB 3MPYA 3IG1B 4DSEA 1DARA 1I5OB 1FK9B 1VC6A 4L3NA 3OD2A 3OR2A 4OFZA 1L5UA 2IMOA 1MSWD 4EU0A 2YXLA 4F3QA 3MEEA 2WHOA 2VASA 3TR5A 3FBFA 5DG9A 2RVJA 2YH1A 4P52A 3PV8A 4WPAA 5IM0B 1YJNS 2CJYB 4F3MA 3TUZC 4WF9Q 3MUVP 2GZOA 3KHGA 2XC9A 3ILLA 4CO3A 1U4BA 4FF1A 3QAUA 4KGXB 5M2UA 2GVDA 2GC8A 4JV5F 1X31C 2ZH3A 4X84A 4Y00A 1S1VA 2NXUA 2Z2MA 4LSZB 3PYDA 2N4CA 5IV3A 1IXKA 4PWWA 4CLYA 2JFKA 4CH1A 3QT7A 2DNGA 2OMLA 1Q4RA 2CADA 3MUTP 4ZKAA 1JLGB 3M8RA 3TX0A 2ZHBA 4TKTA 5DRKA 3PFOA 3H40A 4LFCF 2N4DA 2J0XA 5A8KB 3GB0A 2HWIA 3W9HA 2DJWA 4ILLA 4BDPA 4L3KA 4AL7A 2VFSA 1JLAA 5HO4A 3R2CJ 1MNEA 2K7KA 2F9JA 4WU3A 4PQAA 3M6XA 5H9FJ 4YR2A 1WG5A 4PPDA 2YWGA 4LF6J 4DR2J 3M30B 3OFGA 3MM8A 4DZDA 2ASLA 1UA1A 3MTKA 4NZ7A 2BOPA 1GMVA 4J9QA 3DCAA 1FXRA 1TK0A 4X64F 3ITHB 3NXZA 5K9FA 1XMOF 4OYBA 2DY1A 5IT9U 1VR6A 3HD2A 4QZVB 2ZH6A 4K4WA 1X4HA 2MZTA 2V69A 2V2VA 3IR7B 1DAXA 3SYZA 1UMJA 4KFBA 1Y5LB 3H25A 1KLMA 4CLKA 1AUDA 3UNYA 2B51A 2NS1B 1SXLA 2EC2A 2E5GA 4DFMA 2QIFA 4DG1B 1S1UB 2ZBCA 1RT3B 1CBKA 1X4GA 3IN5A 4IH5A 4CLFA 2LVWA 3GIMA 1BGXT 3KJQB 5BJRA 5AT1B 1RBOB 6FD1A 4U95A 5KT2A 3D6FB 4WTOB 2IDEA 2BYCA 2W9CA 3G9CA 4YR3A 2CIMA 5IC6B 1FWPA 2DNHA 3IBWA 1QAJA 5EN1A 4K59A 4WXOA 2BQRA 2CQDA 4ELVA 4DSKA 2ILZA 2GA7A 4LRDA 4O0IA 4RNOA 3P4UB 3IM9A 3N6NA 1UFKA 1M5HA 4DR5F 2FY1A 1N5VA 2ZH8A 1EX8A 1PC4A 3UWTA 1RTIA 2OPPB 2CJBA 2YKNB 4FZVA 1VK3A 1NDCA 2W01A 2LKZA 2QA4S 2FPHX 3MMCB 2XYGB 3TJ9A 4CLUA 4DEZA 1G4CA 2AT1B 4NMLA 1GXLA 3M8PA 1SIZA 2HZCA 1X5OA 1QUPA 3K2YA 3SFUA 3RZAA 2CJAA 1LWEA 3I5BA 1SQGA 2V9WA 4QWDA 4K0KJ 1CJVB 3OTOJ 1G2EA 4AL6A 4DPUA 5HLFA 3IG1A 1ICEB 1Y3JA 1GXTA 2WZ1A 4LF9F 2Y0SD 2OMOA 2VG7A 2CKWA 1GMWD 5G4DA 1SI9A 4NYOA 2FY8A 2C3UA 4ZIVA 4KHRA 2EW9A 4DLGA 5HL7Q 2EI5A 3FRZA 3QATA 3OSNA 5IM0A 3F41A 2NR0A 4LT6A 2XO6A 3V6JA 3C19A 1ZAWA 1T8EA 3KXDA 5B0FA 3V6KA 3R5CA 5DLGA 2LQJA 4DSJA 2O5DA 3KHLA 3FCWA 2M3DA 2UUWA 5KOWA 4WWSA 5T7LA 2J5AA 2C2RA 1LXNA 3BBBA 1JLGA 2P9GA 3GV8B 2R42A 2YWEA 1N48A 3ZNUA 1T3NA 4DSIA 5L1LA 4KR0B 4PXBA 5A8KA 3D67A 3DLEB 3FZ2A 2J7WA 2AEFA 3CJ4A 2GAGC 3EICA 3HDSA 3W5ZA 1RBLA 2LDYA 2Y0BB 1RTDA 3CD7A 1S59A 2JSXA 3KLFB 2KI2A 3RW7A 2Z58B 2YY3A 5HJYA 2HFNA 1IM4A 1AT1B 5D15A 1MN9A 2H3EB 3M30A 4HI2A 3AOCA 4GVLA 3MHYA 3CVKA 3FEZA 2MTLA 4RO0A 3IC1A 3V4MA 3QQCD 1FNOA 4CH0S 1D09B 5CA5A 2V50A 3GQCA 4OLOA 4DZ6A 3GIKA 3KUGA 4NLXA 2ZWPA 3CCMS 5HQLA 3Q8UA 2Z0GA 4H4OB 3CCUS 2KTQA 3DRSB 3RGIA 1TK8A 1ZS6A 4DV1J 4URQU 3LGMA 1SKUB 3RU0A 4GC6A 1O51A 3KMQA 1RTJB 2J6SA 1QVGR 5DQHA 4DG1A 1S1UA 5HANA 1RT3A 2BANB 2GAHC 4XDDA 3QRPA 4AXIA 2XS2A 3BKFA 4NXNJ 1NZAA 3QWUA 2GMLA 2DR5A 4K8RA 2GO8A 1NSQA 1RBAA 1D9DA 3I4PA 1TL1B 4P7VA 3W1YC 3VHQA 2RT3A 3OSPA 2OFHX 4M5DB 2LEPA 4YB7A 2HQGA 1OQ3A 3MM7A 4CT9A 1UVJA 5D8HB 4UW2A 3GYNA 3TUJC 1RAEB 4QR2A 4J9LA 2DGWA 3HVRA 3H5YA 3WX8A 3OQ2A 3KDOA 2HGNA 2YNGB 2P8IA 2XYHB 2HURA 3HSGA 2XLJA 3I96A 3GP9A 4YMEA 2BW7A 2OPPA 4LF4F 3PEHA 2YKNA 4MK8A 4KV8B 3MMCA 3FSYA 1QY7A 3H5SA 3P45B 1U0HB 1M5VC 2XBPA 2CYYA 1NPPA 2LQBA 1S6PA 1S4EA 5IWAF 2H1YA 3KNGA 1KC8T 1S49A 2QSFA 4QIGA 2FLOA 4PUOA 2K2PA 1WHXA 1RTHB 5F8LA 1OPZA 4JI0J 2W4PA 3KNAA 5D0GA 2GIRA 3EZUA 3K0JA 3IGVA 5GADI 1SL0A 3PIOQ 1RAOA 2OD4A 4NLOA 4ID8A 3H4DA 2CNNB 3ET6B 2JLGA 2XGQA 2J6TA 1Q5YA 1SB6A 4USTA 1L3SA 5KFEA 3S8SA 2CZVC 2V0NA 4TY8B 1IBCB 1U2FA 2VFRA 1VQKS 3CMES 3H7HB 1P1LA 4C3MA 2DITA 4J91A 1NB2A 4F2RA 3HT0A 2HHTA 4LFBJ 3M6WA 4DN9A 3CEDA 3HFZB 3MD3A 3PW2A 4L6V3 1M0SA 4QWBA 1ZYQA 1KVKA 2DH8A 4HI1A 1YTYA 2JWNA 2HYIB 2IM1A 3KLVA 4WP3A 4ED6A 4V19J 4B3MJ 4JI4J 3QT5A 3I87A 3PYEA 1BMQB 3A3OB 1WTFA 3BO2A 2V8DA 1TQLA 1IBKJ 2M9KA 3MPUB 3VZHA 4CM2A 3ZZUA 1V5IB 3DLEA 3Q83A 2F3JA 5KT6A 5E3PA 3KLEA 1IR1A 2DNYA 2AEJA 1F1BB 4UF4A 2DGQA 1WC1A 1V3ZA 1TL5A 4K4ZA 1Y4ZB 1V3SA 5M2PA 1S6QB 4MK7A 1TL3B 3CJ0A 3HHNB 4QQBA 4B9UA 1X60A 2XZDB 4BLGA 5E3AA 1AROP 1FNXH 4O3QA 4XPEA 4CI0B 1NXIA 2BDPA 1VC5A 1R8AA 4W4MA 4A8OA 1PGZA 2PA8D 2BEFA 1FRMA 1DQ9A 2AX0A 2JH3A 5ITHA 1S77D 2XS5A 3GJSB 4H4OA 3DRRB 4WFXA 1TKTA 1SJQA 4AT1B 4DV7F 1VIOA 4MIAA 2WBRA 1BE4A 1RTJA 1RE1B 3OL7A 2GIFA 2ZM6J 4YHHF 1WHYA 2BANA 2HHHJ 2A0FB 5F3TA 4NLDA 1XNQJ 2HHPA 4LSNB 2XMTA 3UNGC 1HHQA 4GO7X 2OLWA 1RT5B 3CPWR 2YWKA 3PW7A 1HNVB 2ACYA 5T14A 3VAMA 2DRBA 1B4SA 4DR7F 1F2HA 4JV2A 5GAEI 3MCMA 3U1LA 4PG4A 3NRBA 3T41A 2QA4G 4OHVA 3F0NA 4P9SA 1L3KA 3PHEA 2CQHA 3KTQA 1NLKL 1HIYA 1QSLA 5HMWA 2DNQA 3NGTA 3OL8A 2DKOB 1I51B 2NYIA 3M05A 3BPSP 3G6XA 4KHPJ 4X62J 5F8MA 3HSZA 1Q7YT 4K4UA 2HFVA 4G65A 1P1TA 1DZ5A 4ES3A 1REVB 1GT8A 1NB7A 5KG3A 3AH6A 4RNMA 3HT3A 1UJ5A 4ECVA 1RTHA 2D41A 2WSFC 5F0UA 3D68A 4P2FA 1LW0B 2PFDA 2KRRA 3MOJB 2YPZA 3GONA 3MWBA 2LLZA 2EK6A 4BCAA 1FRLA 3UDEA 5HP1B 4LFAF 4F4AA 3D2WA 2VQEJ 2FQQB 2V9KA 1EQ0A 1EARA 2RDJA 1U1KA 1UVMA 3PACA 5IS2A 4N77A 4XK8C 4AFFA 2EVZA 1UZHA 4DV4J 4HHJA 4FNHA 1QAYA 4USJC 2YNIB 2ZZNA 3IR6B 4TN2A 3CO9A 2ASDA 5KFWA 1U02A 7FD1A 2O01C 5D4PA 5KG7A 2OGUA 1APSA 2BA9A 3WBZA 1FF2A 2G2YA 4JYAJ 3W66A 5MLCV 1TFYA 3VR1A 3H2VE 2K1RB 3BEGB 5A6PA 3N5BA 3W64A 2M7SA 4PWDA 2DNLA 4LIRA 4B3TJ 1WTBA 1Y9OA 2HS4A 2SXLA 3JS9A 3EUNA 4Q2MA 1GTEA 2F40A 5FJ4A 2VQFF 2F1FA 4B08A 2VPWB 3AAWB 3TO8A 4CIOA 1J2VA 2ZKUA 4B3RF 4FVCA 3K5NA 3NAHA 3B6BA 1AW0A 2OO4A 1N6QB 3BR8A 3T5KA 3NKYA 3EGVA 3UR3C 1R0AA 1LWFA 3AFGA 4K4SA 2E44A 3I0RB 1S6QA 2R2TA 1TL3A 3OJUA 3B78A 3IS9A 1U47A 4YOEA 2AIRB 3EXCX 1H6KX 4JI7F 5EX0A 2GQCA 4NA1A 4DR2F 1RT7B 3LWMA 4UZCA 2P6SA 4LR7A 3FBEA 2IRUA 4H4KC 1B3TA 3DRRA 1FHTA 3VQSA 2H5JB 3NGUA 2MLYA 1U1NA 4WK1A 5DO2A 3GPAA 2WW4A 2L9DA 2IYIA 2IIHA 1C1BA 2UXDJ 1VQ8S 3CCVS 3K7RA 4DMZA 3M9NB 1G7CB 4WK3A 1TUGB 2AWZA 2BJEA 4DS5A 3BSOA 3Q8YA 3BDPA 1PYTA 5FLXY 3QLHA 2QLWA 2RD5C 2CQIA 2AQ4A 2ROPA 3CC4S 2ZJPQ 1K0TA 3HF5A 2B9WA 4DV0J 3DGPB 3W8GA 5EDWA 2BE7D 2WW8A 2HFZA 5FIIA 4I2QA 4U7CA 4PXCA 4KJIA 3J7YU 1I1GA 3H0PA 1NKBA 2KRBA 4J5OA 3RBZA 5D77A 5I3PA 4ER8A 5A2QU 2FLNA 3D0HE 1VOMA 2G4BA 2XM3A 4I2PA 1IKXB 2VDIA 4E2FB 2VICA 3N0VA 4NYZA 4YFUA 1X9SA 2BKOA 1EETB 2IAJB 1CPZA 2XB2D 3DYAA 5KTQA 2DNRA 2FD2A 5HP1A 1R3NA 2V34A 4NX9A 1OO0B 5KG2A 4K4XA 2MKIA 3MR7A 4W98A 4NPOA 3MI7X 3MAAB 4O0NA 2DGVA 3CULA 4G3IA 3KYLA 3CCES 4OI3A 1F9HA 2DEJA 5EHHA 1NKCA 2KU7A 2FVSA 4YY3J 1RHMB 2JRSA 4KH1B 4EBEA 3SQGB 2RUSA 4OZ1A 2HHWA 5C7PA 1VFJA 5IQ6A 1FT8A 3O5TB 2GHWA 1FI4A 2CA9A 1DTTB 4Z7YA 5B0BA 2OSQA 1LK7A 2HFOA 4F4ZA 4LF7F 1U6BA 1TZ0A 2IM0A 2BV3A 2K1RA 3PW5A 4WYLA 3H8YA 2HMIB 3FSIA 5LSLA 3HJFA 4ALZA 5H9EJ 2HRUA 1WSRA 4PEOA 3H98A 1RT2A 3O6QA 2OEMA 1HARA 4DR3J 2B3TB 1DRZA 4O4RA 4NRUA 2QLBB 4JP8A 2ZHOA 3P5TL 1N4LA 2MZSA 3AQPA 4USWA 4MAKA 4NXMF 5F9NA 1XNRF 4ZPAA 2QLJB 4J9OA 2G13A 3MURP 3J7AN 1KWMA 5LOQA 1FDAA 4C98A 2PO4A 2RE1A 1LWCB 1N33J 3D7SB 2Q6BA 1N6QA 3M2UB 1B64A 1TUWA 1YZ7A 5T41A 2ZJQQ 3PR5B 3UD3P 1PYSB 1KRPA 2BXJA 5DQGA 1YX2A 2P5VA 3DC2A 5EWEA 4Y28C 1FA0A 4YN3B 3W9JA 4BWJA 4F36A 2UXBJ 3TNVA 4NLUA 2M88A 3UFCX 2YQ0A 2RHSB 5IV4A 4DX6A 3I5CA 1Q82T 3MOZA 1RT6B 3S7RA 2CQ1A 2EPIA 2F5GA 4ECXA 3EGWB 3NP5A 1LFPA 3RBEA 4KT0C 3ZZTA 4G6VB 3PYFA 3ICLA 4PAAA 1RT7A 1UWBB 5KFJA 1X4EA 3FFIB 2Z57B 3GSDA 3VQTA 1T9TA 2LDIA 5A8WA 1T9UA 4B3OB 2ZWOA 4DPOA 2GQ2A 4U7UK 5HAOA 1NK0A 3TZWA 4CQ1A 1TU0B 3NY0A 1YI2S 4ZHRB 4I67A 4F04B 1U8SA 2QV6A 3ILIA 1UP1A 3NCPA 3PRVA 1XIQA 4DV1F 2RIJA 2CXEA 2DXEA 1M90T 2ZBQA 5HVGA 1RAIB 4WYWA 2IPOB 2EFQA 4JI2F 5J1NA 2XO7A 2VBWA 5EGYA 4ZCKA 1RB0A 2JVRA 4Z2XA 3DGPA 3MEGA 4LR9A 1FDDA 2VODA 1RT4B 3CCSS 2RS2A 4RNNA 1TELA 3BREA 3CCTA 4IRCA 3QIDA 2EKNA 1NPKA 1T94A 1WEZA 2V8GA 1H74A 4I1TA 5CABA 3ULHA 3J81U 3W3SA 4WP9A 1NDLA 2VG5B 1HMVA 3NGRA 1Q7LB 1ZAXA 1CSJA 4IG0B 1EP4A 3L3CA 3AXKA 2HGMA 3TQEA 4FF4A 2PGCA 2JC1A 1B0VA 1UCNA 1HHTP 1F3VA 5KFSA 4OX6A 4QR0A 3O3LA 3I56S 2C2EA 2RDDA 2MDAA 5L8RC 2CNKB 3MAAA 1QDUB 2QSWA 2J6UA 1VBZA 3F44A 3VCDA 1VQ7S 2RKIB 4TU9A 3DLGB 3DLKB 3J80Y 1JLFB 4MKYA 1FX4A 2R7RA 1C4AA 1EKRA 3VAKA 1GX5A 3DDIA 4RPFA 4GMKA 4R0JA 4WU2A 3GWCA 3LALA 4YUDA 5AE2A 1DTTA 1KQKA 1VQNS 4J9RA 1WOSA 2G1DA 2M2BA 5K8OA 1S99A 5D0EA 1QAIA 3EVMA 1S9FA 2JVOA 4OYOA 3C46A 4UOGA 3CJKA 2HMIA 3PX6A 5I3QA 2A2DA 3LAMA 2WB1D 2X3GA 5D78A 2HHXA 3T9NA 3MR2A 3K8WA 4QWCA 2GCFA 3DU6A 4XIUA 2AYEA 2DR6A 3FNNA 1XMQF 2B5JB 5C2GA 2MKCA 1G1XA 1VQYA 4CYUB 5ETRA 3I6PA 1VHFA 3FBCA 4DOZA 1M1HA 1T9VA 6AT1B 4RL1A 1K73T 3H2UB 4HACB 1UEKA 2Z4PA 2ASJA 1LWCA 1PCAA 3EDRB 3Q8PB 4JI4F 3M2UA 2DO4A 5EUHA 4RBTA 3P96A 2QL9B 2PDAA 2HVEA 2RILA 1NDPA 4IH7A 1VQMS 4V19X 2QX0A 4OYWA 4DU8A 3BSNA 4QU7A 2MPUA 1VIXA 2C42A 4ED7A 2NLWA 2L3MA 4M5JA 3CTRA 4O23A 2GVZA 1LEOA 2ZNZA 1N0VC 1RT6A 4E8UA 3QGPA 3LW5C 4PXDA 2KZZA 3SFGA 1JJ2R 5E5NA 3M6VA 1S76D 1BQMB 3N28A 3MUMP 3FFIA 4UOFA 1UEVA 3TX8A 2XQCA 5L1KA 2OI2A 2R7SA 4B3OA 5LL6d 2C1EB 3AQOA 3BYPA 4N47A 3AB4B 2LMIA 3R6LB 4UOHA 4HLBA 3S01A 3D6MB 2LXIA 3EWGA 3TA2A 4QYRA 4ZHRA 2HNZB 4R25A 4NCGB 3K8VA 1WC0A 1N32J 4IDKB 3ILOA 2IMWP 5ETTA 2R7VA 1IJEB 1TTHB 1IWAA 1HNZJ 5IT9Y 2QO3A 1T9WA 4HHUA 3T3FA 4DSFA 4NEZA 3Q8QB 1WD6A 4RW4A 4DX5A 3O2IA 4KAIA 2DO0A 1CULA 1JJ4A 1LK5A 1M1KT 2MKKA 3LO3A 1XNQF 1HQUB 1HW9A 1ZM2A 1DQAA 3C3LA 5ETOA 2FIUA 2V4JB 3SCLE 5GADU 1S7HA 1RHUB 1NK7A 2AKWB 1GXUA 1X4FA 1TKDA 1AFIA 2BX6A 4PQUB 4O44B 4DCPB 4ECTA 3BB5A 4ELTA 2DHSA 3BQ2A 1NJXA 4OLPA 3ZZRA 4CRJA 1QTNB 5E0OA 1N0UA 3V4IB 5CCMA 2DR9A 1S10A 1YG0A 4IG0A 1VBXA 2C22A 1T95A 4DL0C 2CQ3A 3ZTSA 1YBTA 1H3DA 5DM6Q 2EBGA 3GIJA 2FJEB 4P75A 3NBPB 5B0DA 2V4RA 2N82B 1R43A 3G8QA 4C2MA 1NZ8A 2MSTA 5J2QA 1GEHA 2F65A 1T0TV 1X4CA 2XI3A 4FBTA 3KJVB 2W7OA 3H90A 2RKIA 4LVOP 5HMYA 3PNIA 4XO0A 3ELHA 3DLGA 4EGLA 2AZ1A 3NGSA 3KWMA 4FYXB 4WFNQ 4DV3J 2KT3A 1JMTA 1ZM4A 3ENWA 3RRGA 2OPRA 4ED8A 3C6TB 1T11A 2G2OA 4R5PB 1ZM3A 2ABYA 1FD2A 1S1WA 1HBOA 3KLGB 2VKZG 4RU2A 1DBDA 5LMNF 1XC9A 4RUHA 1OYEA 3IMQJ 2ZD1B 1JLEA 4UQGA 3O8WA 4OHYA 2KJWA 1DQ8A 5F3ZA 1SJ4P 3PCOB 1YITS 2K06A 4IR9A 2YNHB 2IVMA 3UO0A 1OS5A 4JYAF 4OYXA 3CJQA 4KGVB 3HX9A 1FJGJ 2QMUB 3EE3A 5C24A 2W9AA 1RQ0A 5CYMB 2PEBA 3LPYA 4FDFA 4A8YA 4CP5A 3BO4A 2E7WA 2UUBJ 4CYUA 2DEIA 1G6BA 3CCLS 4DS4A 4M94A 2UUAF 3QGIA 2ZDOA 2A2CA 1Q53A 5KFDA 4CO0A 2ALYB 1WI8A 2DD8S 1R27B 2PEHA 4DPYA 2VBZA 3MFIA 4U8VA 1OMSA 3SEOA 4LF2A 3NS6A 4FBUA 4LF8F 4TY9A 4ZVGA 4CO2A 2RSQA 1JK9B 1VBKA 4O4GB 3MM6A 1HQEB 4B9VA 1WF2A 2KVIA 3MF5A 4ZVOB 1TFWA 3HVAA 1SC3B 3B4DA 2B7CB 1UVKA 2H9ZA 2HIYA 3SDEB 3T9ZA 4CLPA 1EAYC 1BQMA 2WCXA 1KFDA 4WIIA 2XTJP 3THTA 3W5YA 3W65A 5B08A 2J0QD 1VDHA 1KQFB 2CQCA 3CC2S 4X66J 3A3PB 3G8SA 1UJ4A 2HK2A 2HNZA 5F8IA 3I9V9 5ETMA 2BBEA 4NCGA 1N5SA 3QGGA 1ZM9A 1VQSA 4C11A 1YIJS 5KG6A 4ECUA 4KO0B 4ZCLA 2Z30B 3EX7B 4TU7A 1IBMF 4WE1B 2ILYA 2VB6A 2RU3A 1RTZA 3KHHA 2HBRB 1ZA1B 4TLQA 4NLSA 1JWWA 2PA3A 4IO1A 4K2XA 4RZRA 2P6TA 3M8WA 2XG8A 1OY8A 4DF4A 2M4MA 4B9LA 1HQUA 3CD5A 1LQ9A 2R2UA 1NAQA 4KY3A 4ATNA 2YKQA 3PRDA 5LM7E 3PM9A 4G1PA 3TAMB 4ZVSB 1Z4UA 1N52B 2ROGA 2PI5A 2VIHA 1NM2A 3ZZZA 4I7FB 3G82A 3A8JA 3FKBA 4X65F 2V4QA 3V4IA 1S0NA 1Q1KA 3W2WB 5BYRA 2HRTA 5K14A 1P9QC 5ADZA 2HAFA 5SUHA 5CD4A 4LMZA 2IVYA 4B17A 4RWXA 4MKAA 4DL3A 3NBPA 3MPVA 4XTTA 2I9SA 1WF0A 4J37A 3ZC4A 4Q0BB 2EFOA 1F2GA 2E1MC 4TVAB 3POTB 2F4VF 2ZH9A 2IY5B 2MYFA 4D3HA 2CAJA 4ZCMA 2D69A 3U7JA 3KJVA 1PYOB 1Q78A 4OI6A 3DXBA 4HTJA 2RMLA 4ZS6A 5KFYA 9RUBA 3GFXA 4DV5J 2JEJA 2BQ3A 4OZNA 1I94F 3OXGA 4QR1A 3C6TA 1R8CA 2LFVA 2XLKA 2DHAA 1SUQB 3N79A 3FMBA 3LA0A 4RW7B 2HBZB 1U1OA 4EZ9A 3IAS9 4C6AA 3VALA 2AJ4A 3LUYA 2LEAA 4C8LA 1SKSA 4ZOSA 1OSCA 5CD4H 4P2XA 4O3PA 2YNHA 2YVSA 2E5LJ 2BJ7A 2ZH2A 5DETA 3DRPA 4I0WA 2KHCA 4KSEB 1HI8A 5JXSA 4WKRA 1PJ5A 1IVZA 2NUUG 4Y65A 2WONB 5F8GA 4B3SJ 1HFEL 4PXEA 3CF5Q 2FHJD 3QJJA 2FJDB 2ZOMA 2XZTB 3KKFA 1UTAA 1YRXA 1F3FA 2R7UA 1RI7A 2E7VA 4RUBA 1HBUB 3N9UC 4I4BA 2MKJA 2AJ0A 4X4SA 1SL2A 1TV6B 3D3CJ 4DV2J 2XCPA 4O4GA 5DGBA 2YH0A 1HQEA 3HXMA 3MEDB 4A8SA 3J7ZT 1ACMB 2M8DB 5DS7A 2OP5A 1AB8A 4ZPDA 4PCQA 1RGVA 5KT7A 1A7GE 4Q2LA 1K44A 4OHWA 3CCZA 3TI0A 2J0SD 1UFWA 3SDEA 3G87A 3UDVA 1YRTA 2LECA 5KT3A 4MYUA 1N54B 3EDQB 2J7UA 2L9WA 2CG4A 1OY9A 2H5EA 3PO4A 3Q2TC 4IQMA 2G1HA 1FO1A 2X1GA 4IFYB 1RKIA 5D6GA 4FS1A 4RUAA 4TXSA 3R5AA 2C2MB 3AOBA 2V67A 2BJ8A 3RAQA 1SJ3P 1JLQB 4PRFA 1C1CA 4MIBA 4KO0A 3N6MA 3M4XA 4ECSA 4WE1A 1OIAA 3A13A 1T9YA 4NYPA 3BN4A 2JLEA 4ZJQA 2MZ1A 1RWWB 3CJ5A 1JX4A 1WDTA 3GTYX 2R8GA 5KAKA 2Q66A 1TVRA 1RWPB 3HD1A 3HSJA 3RJMB 3I9ZA 1NK6A 2Y1RI 5H9FK 4JOUA 4ZLPA 2KFZA 4NRTA 1BXNA 3TAMA 1U45A 4LBIA 4ECRA 2CPFA 2R7TA 4DPWA 3MMAB 4I7FA 3GG0A 3TZZA 4QIFA 3K89A 2ZH1A 1TKXA 1Y7PA 1VHIA 2JHEA 3HMJG 3PG9A 1HYSB 4ZPBA 5KFCA 1RWNB 2LQ8A 1TMJA 4ZLNA 3L7OA 1C0TB 4DQSA 4EBDA 3UE2A 2X3DA 5CHCB 4CTAA 4J9MA 4Q0BA 5B09A 1WEXA 1UW4A 2V8PA 2WSEC 4ZVEA 4JI6J 1HQ2A 4DCJB 3DI6B 4DV6F 2F63A 1U0SA 2AJ1A 4J9SA 4OX8A 3QIPA 3TVYA 4DUZJ 1JLCB 5C25A 4HHHA 3OUYA 1JIHA 1A6LA 1MU2B 3BGRB 3W8PA 5J2MB 3TEGA 5CAAA 4DL5A 4KPYA 3CNQP 1NSKL 1RA7A 3ETOA 4YB5A 3D4JA 5HSPA 2LYVA 4NEYA 5G0RB 1KVIA 1SUQA 4EFAC 4DR6F 4ECYA 3TAPA 1U26A 1Q8KA 4CLTA 2UUCJ 2VG6A 2KDOA 1ZZFA 4K5RA 1P6TA 3FJ2A 2RQ4A 4R8UA 1EQMA 1NBEB 1JXEA 4NLWA 2MMYA 4ZIWA 1BHNA 2UVVA 2PD1A 3KG0A 4NWBA 3OT9A 4J9PA 1VRUB 3U02A 5C42A 3J7YI 3M9OB 4C7QA 1Q5VA 2B8QA 3BPDA 3IRXA 2AJQA 3TP2A 5DDOC 1NDKA 1GAOA 1PO6A 1QJHA 2YKPA 4IKAA 3GJRB 3GYGA 3VGTA 2WK4A 1VQOS 4DL7A 1U1QA 4DR4F 2GV1A 4EUVA 2WONA 1WC3A 3C16B 2XEXA 4IFVB 4O3NA 1KVJA 4X4TA 1FKAF 5I4MA 4P72A 1YSJA 1N5TA 5GAGU 4JI3J 1HBUA 3TWZA 1TV6A 2HKEA 2YKMA 1JQGA 1DTQB 3MEDA 1R8BA 3V81A 2FZGB 1LW2B 3G6VA 5LSOA 1C4CA 2R8IA 1U6ZA 2F7VA 2BR0A 1IKVB 4UY8T 1A9NB 1QAXA 3OVBA 4JV5J 3VTIA 4NI2B 1FJEB 4B9SA 4C8ZA 3DKDA 1WG1A 3BQ0A 3KLHA 3SI8A 2CQ2A 3T19A 2QGFB 3H59A 1R8PA 2V5HG 5CH7B 1J27A 1RWUA 4GKJJ 4IFYA 1K47A 1KBRA 1ROFA 3E01B 4CLWA 1XK8A 2KXNB 1Q8IA 3RBDA 3PJ9A 2Z56B 4TQSA 1JLQA 3MMBA 2CWXA 1WHWA 4RU9A 4P74A 4KHMA 2XMAA 1ZPWX 3QJLA 5HMXA 3V6HA 4A48A 2BMBA 4JI5F 1L3VA 2R8JA 4NCAA 1NSAA 4J9NA 4Y2CA 2VJVA 1N32F 4O3OA 2FGOA 3J7A1 3M8YA 2JX2A 3CW2C 2AJ2A 1CJKB 2V8HA 2PMZD 3E8OA 5IT4A 4NL5A 3SXLA 4R0EA 1D1UA 4XPCA 1TMMA 4F4YA 1WUUA 2APOA 4NCBA 2N7YA 1FRJA 4X64J 2GGPB 2C3PA 1XMOJ 1FFWB 2QYGA 4AQYF 1KFSA 3MMAA 1U09A 5KFIA 4DQPA 1J5EF 2HQ3A 2R8KA 5GMKa 1B7YB 3BSCA 4DFKA 1YQHA 1HYSA 4DN0A 3IRWP 3AODA 1C0TA 1XN9A 3HSDA 3CMAS 4LBHA 2HEKA 1WDDA 1FFGB 3OTBA 1F5AA 3G6YA 2E9TA 2OEKA 1NJIT 2MY8A 1FERA 1JXLA 1X5PA 1LKZA 2JEIA 4J7CA 3DRXA 3DI6A 1GX6A 2Y1IA 2J9DE 4USUA 2W4DA 2DNMA 2BKPA 1JLCA 5A2QY 3CJ8A 1E6YA 2F4FA 2JNJA 2LXFA 4KTQA 3T1YF 1T9XA 3SBMA 1YZ6A 2GW8A 2BE2B 3ZXWA 4RR5A 5G0RA 1MROB 1MWZA 1N8RT 5ETQA 1E6VA 1WORA 2R7WA 4DR5J 1O5JA 3PYGA 2CPDA 2RRBA 4HR2A 3ZTPA 4UT4A 1XQIA 4M5KA 4FN5A 2DGXA 2VJUA 1WF1A 3BR9A 2EK1A 4H4KA 4CO1A 4RKUC 4K4YA 4K4TA 3CJ3A 2XSJB 2MQOA 1BC6A 1FVQA 3EMTA 3I5AA 3DGVA 2EXUA 1C2PA 1FK9A 2Z2ZA 2RRAA 4EEYA 2B4UA 3M2RB 3HHLD 3ISND 1U6FA 3PXGa 1SC4B 2DGOA 3BGOP 1C0UB 3X3UA 3I32A 2EKYA 1S5ZA 1SKRA 1ZPVA 3PX4A 2OEJA 3C16A 2MKYA 2BJ3A 2CJQA 2DNOA 3VGSA 4LF9J 1HBMB 1RXOB 2HZVA 5AE3A 3Q8SB 3HCXA 2MQPA 3JSYA 4NLPA 2L08A 1H73A 2QMXA 3KK3B 5LJ3Y 1S0VA 3I4HX 1X9WA 4ZP9A 3PO5A 3R7BB 2BKNA 3AA8A 1DTQA 2YQ1A 5B0CA 3QFWA 3H5XA 3C2PA 3RRKA 1CQNA 2VBXA 2Y8YA 2GX8A 4ED2A 5DGAA 4NI2A 4LQ9A 4OJ1A 2CQBA 1JJCB 1VLOA 2BQUA 5A8RB 4PG6A 3NMRA 3KJNB 4FP9A 3J81j 1JJHA 4CNZA 2XGPA 2JDJA 2AJFE 2ZITA 1Q79A 3OTEA 4Q44A 4QYZJ 4L74A 3MECB 3BH6B 3M8ZA 2YNFB 1F5BA 3DNCA 1HR0J 3G4SS 3E01A 4J9KA 1H38A 3GIIA 2QE5A 3ISZA 5J2PB 3EPIA 5K8MA 2NREA 3QFHA 3LGHA 1ITPA 2OPSB 4MT1A 2YKOA 4LF1A 4OMFG 1WOOA 5EWFA 1JKHB 3ITHA 5HBMB 4X66F 2GJFA 4V1Ak 2HVHA 4DLEA 3RAXA 1P9YA 2ZEJA 1ZA2B 4FF2A 1SH3A 2FVRA 2FC8A 4PG7A 1P27B 2RNEA 4ZPTR 1RU2A 1YBUA 1CJKA 3D54A 3N6LA 1PBAA 1WJ9A 3FUYA 3TEHB 2WRMA 1XTZA 4CO4A 4OV1A 3NGDA 2DBBA 4OYIA 4A46A 2EFVA 2RDIA 2GGPA 5E2QA 3R1LA 1OY6A 3JSMB 2ZVSA 2FJVA 3E3XA 4Z7CA 3OFFA 2YX1A 2B7BB 5IZHA 4G1QB 2E1AA 1K9MT 4ERDA 2YX4A 3RG6A 3BV8A 1TL7B 4F26A 3K58A 1IN0A 1MMDA 3T6JA 3QBCA 1SPBP 1MN7A 5KT4A 4OZLA 2CJXB 2JOQA 1RABB 4KC5A 4MMOA 3RR8A 5LXRA 4ZK7M 2OKQA 3OFHA 2KZMA 1DLOB 2BRKA 2KJVA 3NCRA 1FKPB 2JZ5A 2HAIA 5DLFA 1TKZB 2C2ZB 2GHVC 6FDRA 3GCXP 3MR6A 1L3UA 4ELUA 3J81Y 1SV5B 4DR1F 1HNXJ 2UXCF 1XERA 2NPIA 2XY5A 2C2NA 5BYSA 3OL9A 1H7WA 5E3RA 4QW9A 1ZZNA 3IBFB 1GMWA 3D1OA 3MD1A 4OYAA 3V6DB 3UD4P 4A4JA 4P2MA 2QT7A 1T03B 2XMKA 4EYIB 1TUVA 1U48A 5CYQB 1CC7A 2ZE2B 3H2LA 2BE2A 4AUKA 4X4UA 1MROA 4C8YA 3IWLA 1ELOA 4ECWA 3GZ7A 2MKHA 1CQMA 3JTPA 3HKWA 4CH7A 4LF4J 3BZQA 1CJVA 1Z1ZA 2Z2LA 4LR8A 2XLIA 1PJ7A 1QSSA 1HWLA 3TVKA 3AXMA 2L41A 2GHPA 4K50A 5ETPA 2AF6A 4B9MA 1YJUA 4W92B 2FJBB 3DM2B 4HDGA 3EZ5A 2QRRA 3MM5B 4NLYA 3HFKA 5FDLB 3M2RA 1Q86T 2ROEA 1IUJA 3HFVA 4DUYJ 3SSSA 4O3RA 3V2UC 1C0UA 1K8AT 2ZBPA 1XBWA 1Q16B 4OYZA 1FWKA 1KTVA 3PTWA 1Y3KA 3T6BA 2AZ3A 2PN6A 1VQ4S 2J9DA 1A0OB 4F4XA 4ES1A 3MTJA 5BR8J 4ZPWR 2KT5A 4ENOA 2DY9A 4WFZA 4ZVPB 1FRHA 1DURA 3CSKA 3OFEA 3KK3A 4U8YA 5ETSA 3AA9A 3VAIA 2ZNYA 4CNYA 5IQQA 2GNKA 3JB9k 1SIWB 2FLPA 3N4WA 2KT2A 1HA1A 1VC0A 1WELA 1VQ5S 5GMDA 2DH9A 3KOAA 3UW1A 2EG2A 3OR2B 5HQMA 5KG5A 1NHKL 2V6AA 1EHWA 4ZA1A 4N56A 3VAHA 4O3SA 2D7SA 3MAQA 1SC1B 3CD6S 3GU0A 4DV2F 3CCWA 3UI3A 4IG3B 4QJVA 4FYVB 4B9NA 5A8RA 3R1HA 1RYSA 3CWJA 3P3DA 7FDRA 2GMJA 3QGHA 1KOHA 4USIA 1R6YA 3PJWA 3KLFA 3QT6A 1FJCA 2J8SA 1VJQA 3GIRA 1NJZA 2IA6A 3HLUA 4ZLJA 2ZVIA 5J2PA 3TRGA 2QYCA 3JQMA 2HFUA 1UKUA 2W2PP 2OPSA 4FPIA 4KGZB 4DL6A 2AYMA 2VOOA 3TYTA 1JKHA 5HBMA 1IBLF 2POKA 3RW6A 3DDNA 3L09A 3R27A 2IA0A 1N36F 4RWWA 2D74B 3DRSA 3U1MA 4F3OA 3QWPA 3BKUA 4TYAA 1CLFA 2B0GA 2KFYA 4ED5A 3L7UA 2CDQA 1JLAB 5MAOA 2OIHA 1G3OA 2XSFA 4E98A 5K5MA 2NXNA 2RJZA 5KFHA 3RB4A 1Y0HA 1S0MA 2DH7A 4N7TA 4URGA 2NYHA 3DMJB 4MH8A 1TL1A 4DV7J 3GG1A 1R7IA 2LU1A 2CFXA 4M5DA 2QJ3A 2COLA 2W7AA 4OX9F 3PY8A 5AJ3F 1KKHA 2IFXA 1B70B 2YWWA 4YHHJ 2AU0A 3SCKE 4WBFA 2PE8A 2PI4A 2B4PA 3SMZA 3B8HA 4KFBB 2YNGA 1IWGA 4CM0A 1KLMB 4CZCA 2DHGA 3CCQS 1JNZB 3RTVA 1SV5A 5HJXA 1BUXA 2CPHA 3ZTOA 4YDXA 4KV8A 1LV5A 1RUSA 4DR7J 4C8OA 1U0HA 2VUGA 1T02A 3QZ7A 3V6DA 1T03A 2LP4A 1RP5A 2L9NA 1YKWA 2ZE2A 3GR0A 3EGZA 1HD1A 4NLGA 2H54B 2U2FA 2W9CB 4GC7A 3D0IE 3TZYA 4FVMA 2E9RX 7AT1B 2C28A 4QOTA 2HVZA 4LUBA 1FEHA 5D0RA 1WKJA 3RBXA 2AYGA 3CJ2A 1KOOA 2VFUA 4NLRA 3U1NA 1N34F 2UUCF 3ET6A 2DCUB 1AFJA 2H48B 1RTIB 2E5IA 3CE8A 3DM2A 1BWEA 3DHWC 5FDLA 2CNLB 2UVRA 1I6JA 4KGMA 3PJXA 4TY8A 2QL7B 2XNQA 2VPXB 3LH2S 1O8BA 4KH0B 3ZZYA 3RAMA 2HS3A 4F0KA 3DN9A 4TYBA 5K20B 2QTWA 3UVJB 1LWEB 1NMEB 3S1TA 4QIVA 1S9EB 4USKA 5LJ5Y 2IYGA 3BBFA 4GKKJ 3MPDA 2MLXA 5HLFB 3M32B 1RHRB 5EX3A 3P5BP 2RUGA 3Q2SC 4WKYA 1S7IA 2VG7B 4ED1A 3MXHP 5KFBA 4RW9B 2KHDA 4CLLA 4JI3F 1FE4A 3KDNA 1V3RA 5L38A 3VGVA 4X4OA 4IG3A 3K57A 1FRXA 4Q43A 2JJ4D 3MM9B 1RJJA 3W61A 2K7JA 5K8PA 2FGCA 4F2SA 3PX0A 3R8YA 2MGZB 5CQGA 5FD1A 2D3OR 2CPJA 2VQFJ 5H9EK 2PT0A 2CQGA 3US5A 2JFDA 2OHDA 4A47A 3LOUA 3JAMU 1XWLA 4C8KA 2A6OA 4ILMA 4B3RJ 2JEFA 3NWGA 5T7LB 4QPXA 1SKWA 9ATCB 4GKJF 2OPQB 2HWTA 3QZ8A 4YS2A 1WC4A 2ZZMA 4LF6F 1RWVB 2C2OB 4ES2A 2HIQA 2CJKA 2LXUA 3C14B 2YWFA 4BBYA 2DHHA 1MLAA 3FSXA 3GJTB 2CZ9A 2M8HA 4NA3A 5BYQA 4U6PA 1O6XA 1YWXA 4HT5A 4DL2A 4QW8A 1RTDB 1RU1A 5A6WA 3SCIE 2ATCB 4A8XA 4JI7J 3VAJA 5DQIA 2FVQA 2B4VA 1FFSB 2I2YA 1NH7A 2QL5B 1KQSR 5A0YB 4EYHB 2LA6A 3NNAA 2KG0A 4K4VA 1RCXB 8RUCA 3SV4A 4MYTA 4LSNA 4OZ2A 1V6HA 4F0HA 3DMJA 3THVA 1S6UA 4GVBB 1HBNB 1RT5A 2V2KA 1HNVA 3IR5B 2CUYA 1Y10A 2JL9A 3Q89A 2B9YA 3QJPA 3DLLQ 1AYEA 1HKAA 4OHZA 3NGKA 1NHVA 4BHQA 4OHXA 3W63A 3UDLA 4WTYA 4W90B 5D4NA 2OD6A 1N56A 3SSQA 3EYZA 2M52A 1B99A 2KVQE 3I82A 3FCHA 4LRBA 2DR8A 4Y6IA 1N5YB 4MIWA 5B0EA 1D3WA 2I8EA 2Z8QA 5LMUJ 3CJTA 3M8SA 3DOMB 1WACA 5CZXA 1REVA 4JUZA 2CPXA 2E1RA 3R5DA 1RAAB 2BVZA 2GJIA 4I6WA 1LW0A 3M7VA 1FTCA 1PIEA 3L9ZA 1FDBA 2HW3A 3GILA 3MM7B 2O1PA 1K1SA 1ZBTA 2CVEA 4DF8A 4ZVRB 1T3OA 3FZBA 1UA0A 4BS2A 4ZDNA 3HVTB 2XCAA 2GQQA 1TP7A 4HH0A 3PW4A 1TL4A 5L46A 1XEZA 4K0KF 1U7LA 4C0OC 3OTOF 2NSCA 1NRKA 2JC0A 5DG8A 5HROB 1X8DA 2V2QA 2YNIA 2OUGA 1F6TA 4Y2IA 4X4VA 1LOUA 4NZ6A 1FCAA 3R97A 3Q0AA 4ZN3A 3M1VB 2LU2A 1S6PB 3IWNC 2EBEA 3QO9B 4HVZA 3UVJA 1YJ9S 1H98A 4PUOB 4P7TA 1PKUA 2BOAA 1S9EA 5B7WA 1RAFB 4DU7A 1URRA 4AD6A 1X4DA 3VZIA 4DBQA 3M32A 2OSRA 1VCTA 4U96A 2MHEA 2P9EA 3HJVA 5KFGA 1NK5A 2A10A 4NMXA 5F41A 2E1CA 4LF7J 4XDCA 3WDOA 4RW9A 3IP0A 3CC7S 3BH7B 1K0VA 3L95X 3D28A 3P49B 3BJYA 3E2EA 3MM9A 2V68A 1R6VA 2B8PA 3Q22A 3HKZD 2DIUA 3JSRA 2MGZA 2VL1A 4H4MB 1U1RA 5HI7A 4DSLA 1DY3A 1KTQA 5HMZA 1DFDA 1B0PA 3AD9C 3I0RA 5KFZA 2B43A 2DTJA 4Q5VA 2Y1LB 3HHLC 4NXMJ 2F8EX 3ISNC 3PKYA 2AP6A 2NZCA 1XNRJ 3KUHA 1UVIA 3W2VB 4P73A 2AEMA 4YEAA 3LP2B 1XMBA 1Z2ZA 2OPQA 1UWAA 3EVWA 4OJ3A 1HR0F 4OX7A 3EM1A 1VMBA 1RT1B 1YJ7A 3TW0A 3CMQA 3C14A 1YVFA 1PAUB 2UUTA 1W26A 3KLEB 3PHTA 4HL9A 4H54A 2R7OA 2VFTA 3G71S 1U1PA 4WFBQ 2H51B 3NOGA 4NZ0A 2CG8A 3EJMA 3T5LA 1PC5A 5GAGI 4C4WA 1NSPA 3SSRA 2ZUAA 1Y5IB 1LFWA 3KUEA 2G9OA 3ZZ0A 1EKSA 5F8NA 5A0YA 3O44A 3RR7A 1SH0A 4ANEA 2A6MA 4HKQA 1KP6A 5D0HA 4F4KA 4F7VA 2WVDA 2XI2A 3SIPB 1RK8A
chains in the Genus database with same CATH topology
1UW4A 1D0EA 2WSEC 4ZVEA 4KE5A 4HHJA 4FNHA 1QAYA 3DI6B 4USJC 4DV6F 1YRUA 3IA0A 2R4FA 2YNIB 2ZZNA 1HBNA 3IR6B 1J5OA 2AJ1A 4TN2A 4J9SA 4OX8A 4IRKA 3B82A 3PRBA 4C3LA 3CO9A 2ASDA 5KFWA 1UJ6A 3QIPA 2WTFA 3AHPA 3TVYA 3NMAA 3IAM9 7FD1A 2O01C 3IGNA 5D4PA 5KG7A 2ADBA 1WNEA 1JLCB 2OTLS 1APSA 2BA9A 3WBZA 4NXNF 1FF2A 2RH3A 2DCLA 1U25A 2VPZB 4AXJA 5C25A 5MLCV 1JIHA 3OUYA 1TFYA 4A8MP 1A6LA 1M5OC 3VR1A 3H2VE 4G1IA 1MU2B 2K1RB 3BGRB 3OL6A 5JVGQ 2DR7A 3FRYA 3BEGB 5A6PA 1TKTB 3N5BA 2VC1A 5J2MB 1NK8A 2M7SA 4PWDA 4DL5A 3QYYA 2DNLA 1HPZB 4LIRA 4KPYA 1IQTA 1RA7A 3ETOA 4YB5A 2LYVA 2XY6A 3BSAA 5G0RB 5KT5A 4UQTA 1KVIA 1SUQA 4EFAC 4DR6F 4ECYA 3OJSA 1U26A 3TAPA 1WTBA 2XNRA 2VG6A 4RBUA 1Y9OA 3BGUA 1N5YA 2ZC3A 2KDOA 4EWTA 1NEEA 2HS4A 2XMUA 4LF5F 1ZZFA 2G0CA 2GJ2A 2IM2A 3EGNA 4TNOA 2SXLA 5GAEU 3CT9A 4F50A 1HNWF 4C0HA 2QEXS 4K5RA 4JV0A 3ONQA 3EUNA 4Q2MA 3RB3A 4FXDA 1GTEA 3M9MB 1P6TA 2F40A 3FJ2A 1Z2LA 5FJ4A 2RQ4A 3DOMA 4R8UA 3KK2A 2VQFF 3H20A 2UVUA 1JXEA 1QTMA 4IH6A 2HGLA 1Q8LA 4NLWA 1GTHA 2MMYA 3DOKB 2F1FA 2CQ4A 4B08A 3RB6A 2UVVA 2PD1A 2VPWB 2CPYA 1HNXF 5F0WA 1IKXA 3KG0A 4NWBA 3AAWB 3TO8A 4J9PA 4CIOA 1VRUB 3U02A 4FXWA 1J2VA 2ZKUA 5C42A 3J7YI 2FTRA 3M9OB 3JTOA 4C7QA 2FDNA 4FVCA 2R2SA 4B3RF 3K5NA 3IRXA 1YJRA 2AJQA 3NAHA 2ZC4A 3NG8A 1VK8A 3TP2A 1EETA 1D9FA 1AW0A 5DDOC 1O0PA 2IAJA 3H4BA 2OO4A 2LQ5A 3VAGA 1TR0A 3HZGA 1N6QB 3BR8A 1GAOA 4RBVA 3FQKA 2PC6A 3T5KA 1PO6A 3I31A 2MQQA 1QJHA 3NAIA 2AGQA 4IR1A 2YKPA 3NKYA 4IKAA 4YB1P 1C1CB 5JUMA 5KFXA 3C6UB 3UCGA 4U67Q 3UR3C 1R0AA 2WK4A 2R7XA 1LWFA 1VQOS 4DL7A 4K4SA 4MK9A 3PVXA 2IC3B 2E44A 2IJNA 3HVTA 3I0RB 1S6QA 1U1QA 4DR4F 3HO1A 2DHXA 2R2TA 2MZQA 1TL3A 3OJUA 3B78A 3IS9A 1U47A 1FKOB 2GV1A 4YOEA 4EUVA 4JI0F 2WONA 3K59A 1XR6A 2XEXA 3GYXB 3O1LA 2I0XA 4IFVB 3EXCX 2DVIA 4IOAQ 4O3NA 3SQGA 1KVJA 1VRTB 4X4TA 1TVRB 1H6KX 3CIMA 5HROA 1FKAF 5I4MA 3F73A 4B02A 1YSJA 4JI7F 1N5TA 3ENVA 2VFVA 4FYDA 2DNZA 3LP1B 4U9RA 3OW2R 5EX0A 2GQCA 4OL8A 5GAGU 3TARA 1HBUA 2KKHA 5AXLA 4NA1A 2I1RA 3I0SA 2IJFA 3M1VA 5L1IA 4DR2F 1RT7B 1TV6A 2F8HA 2AD9A 2VA2A 1VI7A 2YKMA 1UFLA 3LWMA 3QO9A 4MKBA 3J7Z5 4LIWA 2HNYB 2P6SA 1DTQB 2IRUA 3MEDA 1R8BA 4H4KC 3DOLA 4C0BA 3V81A 3DRRA 1FHTA 3VQSA 1LW2B 3G6VA 3HHLA 5LSOA 1VQLS 4QIEA 1U1NA 1C4CA 5DJBA 4WK1A 2VOPA 5DO2A 4FF3A 2R8IA 1U6ZA 2NPFA 2F7VA 1W25A 1IKVB 3F56A 2BR0A 4UY8T 1FXLA 2EWHA 5KFNA 5IT0A 1A9NB 2L9DA 2IYIA 3A1YG 4DUYF 1QAXA 4IO9Q 1C1BA 2CPEA 1VQ8S 3OVBA 1TKXB 3CCVS 4QBUA 3VTIA 3K7RA 1FJEB 2C3YA 4B9SA 4C8ZA 4DMZA 3M9NB 3GFHA 1G7CB 4MFBA 4MTPA 1WG1A 4EO6A 5LSRA 2HHSA 3BQ0A 4WK3A 4N76A 2ALZA 3OPKA 3KLHA 5KG4A 2B6AB 4DV5F 4X4QA 1N5QA 1OSDA 2HHQA 4LFBF 2YKAA 4YR0A 1FRKA 2N7CA 3OR1B 4JV1A 3SI8A 2CQ2A 2N3OA 3S6EA 2Q43A 2XWXA 3T19A 5BR8F 3H59A 2AWZA 5B0AA 1VS3A 2BJEA 4DS5A 3BSOA 1R8PA 2V5HG 3NCQA 2VONA 3BDPA 4K5SA 5FLXY 4CTAB 5CH7B 3QLHA 3NNHA 2QLWA 2VPYB 2RD5C 2UZAA 1RWUA 2XSJA 3MAHA 5D3GB 2CQIA 4IFYA 2E9ZA 5I3UB 2J7KA 5F8HA 5DG7A 3T5HA 2L48A 2AQ4A 2KFNA 4M1KA 1ROFA 3E01B 2ROPA 1XK8A 4P6QA 5D4LA 3CC4S 2KXNB 2ZJPQ 1K0TA 3HF5A 4KKOB 3IWXA 2B9WA 3QIPB 1Q8IA 1H7XA 3OHAA 2Y1JA 3RBDA 3OLAA 2OH2A 4TQSA 5EDWA 1JLQA 4B3MF 2KG1A 3MMBA 2DGTA 1WHWA 4RU9A 1H2TZ 4ITSA 4KHMA 4LSLB 5C25B 3OUYB 1ZPWX 3QJLA 4I69A 1X0FA 2D9OA 2VBYA 3KLIA 4IUFA 1IBKF 2WW8A 4H4MA 1F9FA 5HMXA 3DLHA 2RQMA 3PFEA 5AE1A 1WEYA 2HFZA 2W25A 3V6HA 4PWDB 2IHR1 4A48A 5FIIA 1HWIA 4JI5F 3D1HA 4F8RA 4I2QA 1U49A 4U7CA 1S1TB 2O67A 3UR0A 4X4RA 1L3VA 4PXCA 2R8JA 4NCAA 2E5LF 4J9NA 4KJIA 4OJHA 4Y2CA 3J7YU 1I1GA 2OFGX 1M5SA 4O3OA 4NLTA 2FGOA 2VG6B 3OVSA 1NKBA 3J7A1 2KRBA 1HBMA 1N32F 2JX2A 3PIPQ 2RB7A 3W2VA 2V8HA 2PMZD 3LP2A 4MJKA 3OV7A 3E8OA 4J5OA 5D77A 2KN4A 2W9BB 5IT4A 4A8FA 3FMWA 5I3PA 3C66A 3QAEA 4NL5A 4R0EA 3SXLA 1D1UA 1HNIB 3HHEA 4HTIA 4PPZA 2FLNA 4R8UB 3D0HE 3B4MA 1VOMA 1S9GA 4IYQA 4XPCA 1VQ6S 2G4BA 3WC2A 4F4YA 1ZOTA 3MGJA 2APOA 2MB0B 4NCBA 2N7YA 1UWBA 5KG1A 1S0OA 1FRJA 5KFMA 4I2PA 1RT1A 3JYTB 2MQMA 3C8YA 2GGPB 1IKXB 2C3PA 3AJ1A 4B3SF 3N0VA 5C42B 4NYZA 2HWHA 4YFUA 2D1CA 1X9SA 3IRXB 4AQYF 1KFSA 3MMAA 1U09A 2B9XA 5KFIA 1YHQS 1EETB 2CPIA 4DQPA 4I56A 4FXVA 2IAJB 1J5EF 1CPZA 2HQ3A 2HQIA 3DYAA 5KTQA 2R8KA 2XB2D 2DNRA 2FD2A 4HDHA 5GMKa 4QWEA 5HP1A 3MEEB 2KM8C 4ED0A 4DDFA 2ATLA 1R3NA 4NX9A 1OO0B 3BSCA 1YQHA 5KG2A 3JTNA 3CIZA 4DFKA 1N88A 1HYSA 4K4XA 2MKIA 4ID5B 1R0AB 4DQRA 1LWFB 2GMHA 3R5BA 4KGKA 4NPOA 3MI7X 3CULA 2DGVA 4G3IA 3KYLA 3CCES 4OI3A 3FEXB 5CXTA 4DN0A 5EHHA 3IRWP 2W7PA 1NKCA 2FHMA 1C0TA 2KU7A 1XN9A 3IS9B 2FVSA 3CMAS 2EG1A 1F5AA 3OTBA 3G6YA 2E9TA 1NJIT 4UOCA 4QPTA 2JRSA 4NA2A 2FVPA 2MY8A 5KFPA 2VD3A 3CB4A 4EBEA 1KNZA 3QMQA 1FERA 3MECA 3KK1B 1JXLA 3GFZA 1X5PA 3SQGB 1QSYA 1LKZA 1HL6A 2JEIA 2YNFA 4OZ1A 3DRXA 3DI6A 2HHWA 2HPUA 1GX6A <