2LA6A

Solution nmr structure of rrm domain of rna-binding protein fus from homo sapiens, northeast structural genomics consortium target hr6430a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
b'MGHHHHHHSHSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein FUS
publication title Northeast Structural Genomics Consortium Target HR6430A
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2la6A01
2M8HA 5JVHQ 1OWXA 1R8PA 3H2UB 2FHOB 2F3JA 3V4MA 3MUVP 4F02A 3VAKA 2MGZA 3ULHA 4WF9Q 1HD0A 3EGNA 2MHNA 1Q86T 1U6FA 2MZTA 2XNQA 2DGSA 1NO8A 4WIIA 4CH0S 2D9OA 2X1BA 3ZZYA 2RNEA 3ZZZA 4Z2XA 2DNQA 1YJWS 2HZCA 2N82B 2RRAA 2JVRA 2ZJQQ 5DM6Q 2CPIA 5DDQC 4LIRA 2OIHA 2LXUA 2CQGA 3LQVA 2QFJA 1WF1A 2MMYA 5HO4A 3Q2TC 2YH0A 2N7CA 2DGXA 4C4WA 4LMZA 3D2WA 1DRZA 3NS6A 2I2YA 3VAIA 4IOCQ 3CCSS 1S72S 2AYEA 1KOOA 3VAGA 5GVQA 4V19X 2AYMA 3VALA 4W92B 3G96A 2NZ4A 3MDFA 4WFNQ 2DNMA 2ZJPQ 1WHYA 5LXYA 1HL6A 3THTA 2CQDA 2AD9A 1JJHA 2E5HA 3MD3A 2L9WA 2M0GB 2MGZB 3N9UC 2HVZA 2MKKA 1KC8T 5GAGU 2ERRA 1WEYA 2LA4A 2LYVA 3BEGB 5H1SV 4IO9Q 2KXHA 5GMKa 4Y00A 1WEZA 1FXLA 2LMIA 3CTRA 5JVGQ 3THPA 2GO9A 3R1HA 5DM7Q 3G71S 1KOHA 4RU2A 3U1LA 1SJQA 1JJ2R 4IUFA 1QM9A 2DNRA 1BY9A 2DNNA 3S6EA 2CPYA 3TO8A 4QU7A 5FJ4A 2MB0B 2CQ1A 2DNLA 2KI2A 1Q81T 3B4DA 1H6KX 2LXIA 2DHAA 3I55S 2LEBA 3MXHP 4C7QA 1U2FA 3SMZA 1YWXA 2LEAA 2RVJA 4CH1A 1YIJS 2KVIA 2MKHA 2E44A 3VAMA 3IRWP 2M52A 2DO0A 5DETA 3CXCR 2MQQA 3CULA 3R27A 3EX7B 2WBRA 4UQTA 2DH9A 4J5OA 1X4FA 2EVZA 2MQMA 2DHSA 3CC4S 4F26A 2KH9A 1R8HA 2CPXA 3CD6S 2I38A 2MZSA 3CCRS 1W2BR 1U1PA 1FJEB 1B7FA 5D77A 2DHXA 2DIUA 3JB9k 1K73T 5EN1A 3UWTA 5GAEU 1WHXA 2LKZA 2J0SD 1Q7YT 2BZ2A 3G6ES 2CQHA 1WI8A 1QVGR 2MZ1A 1DHMA 2PEHA 2CJKA 1VQNS 2J76E 3PIPQ 2KYXA 1AUDA 1FT8A 2X1GA 2YTCA 2HGLA 3MI7X 2KM8B 3UD3P 2DK2A 1X5TA 1NJIT 4WCEQ 2AYBA 5IM0A 1SJFA 3BO3A 3CC7S 4C0OC 5LSLA 2MKJA 2DHGA 2J0QD 1U1KA 2DNPA 1X4DA 5DDPC 3VAHA 2CPFA 1OO0B 1U1MA 3G4SS 2L41A 3S01A 1WG4A 3EGZA 1YITS 5CA5A 3NNHA 4IOAQ 1HD1A 1M5VC 1SJRA 1JMTA 1F9FA 1YJNS 1WEXA 3MD1A 1X5OA 5GADU 4WKRA 3I56S 1U1QA 3CUNA 5CYJA 2K3KA 1VQPS 1K9MT 2B0GA 2RRBA 2KRRA 5MLCV 5GAHU 1A9NB 5IQQA 2KU7A 4OZ1A 2CQIA 3TYTA 5DDRC 1X4HA 2KRBA 2VONA 2LA6A 2MYFA 1FNXH 1DZ5A 2DNYA 2KG1A 2RQ4A 3CF5Q 1VBYA 1X5PA 2M8DB 1X5SA 3CCLS 2XNRA 3HHNB 4EGLA 2DGTA 1WWHA 5DDOC 2E5GA 2JWNA 3RW7A 3VAJA 2CQBA 2DGVA 3CCQS 1N88A 3J7YU 1URNA 2HGNA 4QQBA 4YB1P 4ZKAA 1QVFR 3SDEB 3VF0B 5IM0B 1VQ4S 2D9PA 1VC6A 1WI6A 2JRSA 2MKCA 2DB1A 2M2BA 1ZZNA 3CCES 1N52B 2G1DA 2DNKA 1H2TZ 4TU8A 2OJ3A 1OPIA 2FC9A 1FJCA 2MXYA 2G0CA 3CMAS 1XN9A 1KD1T 2N3LA 2LCWA 4OZ0A 3R1LA 2HYIB 4P6QA 3MURP 1VQ7S 2DH8A 4TU9A 2DITA 4PRFA 2YKAA 1U1OA 1H2VZ 2DNZA 2M4MA 2DO4A 2DNHA 4QU6A 2F9JA 2LQ5A 2E5IA 5LXRA 2K8GA 2XS7A 2F9DA 2KM8C 2MSSA 1WF0A 1K8AT 2KXNB 2DGQA 4WFAQ 1D9AA 4TLQA 3MUTP 3P49B 1WHWA 3PIOQ 1O0PA 5LJ5Y 2KG0A 5LJ3Y 2JX2A 2MSTA 3CCUS 3CCVS 2MQNA 1WTBA 1X4BA 2DGUA 2A3JA 1H2UX 2MKSA 1M5PC 4CIOA 3S7RA 2DGWA 3NS5A 1VBZA 5IFMA 2BOPA 2VOPA 1X4GA 3L3CA 2RS8A 3BO2A 5D78A 2MJNA 1G2EA 2JVOA 2DH7A 1U6BA 1M5KC 3DLLQ 2RQCA 3SDEA 3K0JA 1UW4A 3DXBA 4QPTA 2MKIA 2MZQA 1ZH5A 2CPDA 2LECA 2DIVA 3US5A 2MPUA 1PO6A 2QA4S 3J7ZT 3UD4P 2KHCA 1PGZA 2ADBA 3VAFA 4ED5A 2RT3A 2ADCA 3FEYB 2CPZA 2ZJRQ 3NNAA 2AYGA 3U1MA 2CQCA 4WFBQ 2CQ2A 1SXLA 1X4EA 1FJ7A 2EK1A 2FPHX 2MQLA 2U1AA 2L08A 2OTJS 2DGOA 2MQPA 4YUDA 2CQ0A 4M5DB 1YTYA 3P5TL 5HL7Q 2U2FA 3G8SA 2M9KA 4W90B 4BS2A 1CVJA 3HI9A 2E5JA 1VC5A 1VQ5S 1WG5A 2CPJA 2M88A 2XB2D 2XS2A 2CQ4A 3MUMP 2XSFA 3CC2S 3G9CA 3S8SA 2GHPA 1Q82T 1U1RA 2X1AA 1ZZFA 3CCMS 1M5OC 3Q2SC 1VQ8S 1D8ZA 2MZRA 1N54B 2OTLS 1U1NA 1RKJA 1VQOS 3UCUP 1P27B 1WHVA 1HA1A 1OIAA 3IWNC 4FXWA 1A7GE 1UAWA 1VQMS 1VQLS 2SXLA 4TU7A 1FO1A 2V94A 1VQKS 2MY8A 2MJUA 1N8RT 1YHQS 2Q79A 2KN4A 1RK8A 3CMES 1X4AA 4PR6A 4A8XA 2QEXS 2CPEA 2EK6A 3P6YC 5CXTA 2KT5A 3RW6A 3SXLA 1WF2A 2X1FA 3G8TA 1M90T 1VBXA 2YWKA 2RUGA 1X4CA 1UFWA 4CQ1A 5BJRA 2OSQA 3CPWR 2HGMA 1M1KT 2O3DA 1WELA 3UCGA 2VODA 2DNOA 4FXVA 2MY7A 2M70A 2N3OA 1U1LA 3MOJB 3LPYA 2FY1A 2VOOA 4Y0FA 3TP2A 4F25A 3BS9A 2YH1A 1YJ9S 3FEXB 2KFYA 2RU3A 3B4MA 2DNGA 2MQOA 3UCZP 2CQ3A 2DISA 2NLWA 2PE8A 2OSRA 1SJ4P 1YI2S 4UY8T 3P3DA 2J8AA 3BO4A 4U67Q 1SJ3P 2FC8A 2XS5A 4PKDB 2CPHA 1NU4A 2G4BA 2D3OR 2M7SA 5ITHA 1VQ9S 3H2VE 3UE2A 2MZJA 2RS2A 3NNCA 4LJMA 1UP1A 2CQPA 1IQTA 1VQ6S 5LSOA 1DBDA 1L3KA 2KXFA 3CCJS 2UP1A 1X0FA 1JJ4A 1FHTA 3NMRA 3OW2R 4ERDA 1KQSR 4YOEA 1VC0A 1P1TA 1WG1A 1S79A
chains in the Genus database with same CATH superfamily
5IT9U 3VVUA 1WC5A 3PACA 2CVEA 3C15B 4NXNF 3EICA 1FTCA 4DL3A 1RACB 2UVRA 1FWLA 2RRAA 1U26A 3UW1A 3PO4A 4OYPA 3OR2B 2IM1A 3QSIA 4NXMF 3GPAA 1DRZA 1S6QA 5EWFA 3DMJA 4NYZA 3TAMB 5GMDA 4BBYA 1CC8A 1UKUA 1HQ2A 3CSKA 4DX6A 3RB3A 3W65A 1WEYA 5KFVA 2R3VA 1S4EA 2XI2A 3L7UA 1SJ1A 1S1TA 4GC6A 4QZVB 2AX1A 5KG1A 1JJ2R 2V0NA 4U8YA 3ZZTA 1D8YA 5ETPA 2Y9HA 4RJVA 3ET6A 2YNIA 1YBUA 1JLCB 1H6KX 3DOMA 3MXHP 4ZPWR 2OPRB 2AGOA 4F4WA 4HT7A 4G3IA 3OLAA 3QT7A 2BMBA 1PIEA 5CYMB 5HMWA 3T19A 4YMEA 2XM3A 5H9FK 1FWKA 3MECB 2BV3A 2RF2A 3ZTPA 4NCGB 3DKDA 3VGUA 2W4CA 4F0KA 4XO0A 2XGQA 2B9XA 1W2IA 3K5OA 3QAUA 4G1IA 5KG4A 2BRKA 2HBYB 4Y65A 5LSLA 2R8IA 3TWZA 2ZBCA 4ZVTB 3LF0A 4JI8F 4LF9J 4CYUB 1WG4A 5K8PA 4LFAF 4JV2A 4M5NA 4DCOB 4OYOA 3TYTA 1EIYB 2DRBA 2LA6A 3HCXA 2DNYA 3CF5Q 4J9QA 1X5PA 3AA8A 2W8LA 3DOKA 1VHFA 2R8JA 2E29A 3MPWA 3R9LA 3SQGA 4DG1B 3MM5A 1N0VC 3TZWA 3L7OA 3IM8A 3VF0B 4LF6J 2D9PA 2JRSA 2ASJA 5JUMA 1XERA 5J2MB 2P9CA 4ZJQA 1RDRA 3Q83A 2IAJA 2DITA 4D3GA 3M8PA 3KK2B 5EWGA 2IBOA 4YS2A 2FHKA 3WC2A 1M1GA 3B78A 2F9DA 3B6BA 1K8AT 3IMQJ 2ZNYA 3CJKB 5HN0A 2DR9A 5KFQA 3TUJC 3GJTB 4LSZB 3K7RA 1FJGF 5BYSA 4CIOA 5HQMA 5L9XA 4IH6A 2W9CB 1TKTB 3BPSP 3PYGA 3LP2B 6FD1A 4YR2A 2J6UA 4GO5X 1R0AA 4B9LA 4ED5A 4OYIA 4M5LA 2EW9A 1IWAA 3GJQB 2HK2A 2JHEA 3MM6A 1IJFB 1MU2B 2L08A 1S9GA 2J5AA 4OI4A 3RZAA 3EJMA 4B9NA 2HKEA 2E5JA 1VC5A 2XB2D 5DJBA 2ZC4A 4LSNA 4TN2A 1WKKA 5F9LA 4EO6A 4IFVB 2HK3A 4AXIA 1A7GE 4FBUA 1FO1A 4IYQA 1FDBA 2MJUA 2XHCA 1NK6A 3C14B 1B0TA 4ZS6A 3V5RA 1SUQA 3OFHA 3CO9A 1SBRA 2WVDA 3DRPB 4TKTA 1RTIB 2PFDA 3MOJB 2UU9F 1KLMB 1C0UA 4DN9A 1KHVA 2QA4G 4N76A 1L3TA 2QGFB 3MPYA 4E98A 3DOLA 3MPDA 2K2PA 2RHQB 1CULA 3BSOA 3MR7A 2XMAA 4PXBA 3MCSA 3E2EA 4USUA 2KXFA 3L4BC 2NXCA 4RNMA 3MCNA 2QRRA 2YQ3A 3Q8QB 2PA3A 2BE9B 3NMRA 1BMQB 2G0IA 4KV8B 1UJ6A 1I6JA 3VR1A 2FZCB 4OYXA 3QIPB 4J37A 3IC1A 2ROPA 1RKIA 2DNQA 4BWMA 2UUTA 2R7OA 2AJ2A 5HLFB 5DDQC 2QYCA 1RT4B 2AF6A 1PC5A 2C3YA 1CS4B 4IOCQ 1F2GA 5IWAJ 4DL4A 2ALZA 4YFUA 1ZAVA 2AYMA 1RXOB 4A47A 2I0XA 2B7BB 5CH7B 1Q0NA 2GO8A 3MD3A 2JLFA 3TEGA 2OELA 2M0GB 4DV6F 4ZPVR 3PVXA 5J2NA 4OZLA 4IO9Q 2IJFA 1H0HB 1TAUA 4BDPA 3QBCA 4RW4A 2GGPB 1BY9A 4J7CA 2V4JA 1Y5LB 2MDAA 4Q2MA 4NWBA 1GH8A 1UEVA 3BV8A 1QTNB 5DETA 4OI3A 2W7PA 1RTHB 1WC6A 2YY3A 2XG8A 3CC4S 1TMJA 2KH9A 2HBQB 3CCRS 1BGXT 2RSQA 4YB6A 1R27B 4NLTA 3AQOA 5FD1A 4PWDB 3AJ2A 3I82A 2X3DA 1Q7YT 5A8RB 2E7XA 2IJRA 3J81j 1JXVA 1DHMA 2KYXA 4KGXB 2IA0A 2MKJA 3ENVA 1I94J 5C25A 3MGJA 1QAJA 1L3VA 1UJ5A 1MROA 1JQGA 1KQGB 1NSAA 4O0IA 1EQMA 1FKPA 4O44B 3DLBA 4P2SA 4JI6J 3JTNA 1HNVB 4LR7A 4OZ1A 1FF2A 1B4SA 3LTOA 4PWWA 2QN6B 1DZ5A 4KBIA 1RWPB 5AXMA 3KNGA 4L76A 3D9BA 5FDLA 3VAJA 3MTJA 1KQFB 1N88A 1TFWA 2KHDA 2A18A 2KB2A 4Y28C 4OJ1A 2IBKA 1N0UA 1XC9A 1WJ9A 4AD6A 1TKZA 2HHWA 2OJ3A 5HMXA 2NZCA 3Q8RB 2VJUA 1DQ9A 3DRRB 3B8HA 4OZ5A 3DLHA 2VG7B 2YKAA 2BJ3A 4EUVA 1LK5A 4DPTA 4LQ9A 1RT7A 2OO4A 4NMLA 4B9MA 1UVJA 4WTYA 2HFVA 2NUUG 2MQNA 2VC1A 4O3NA 3NS5A 3JSMA 2AWZA 2ACYA 3NEKA 5KFBA 1NMEB 4GRSA 1FRHA 5KFJA 3C66A 2MJNA 4ES2A 1HBUA 4HACB 2B51A 4KTQA 3SI8A 1BQNA 4OLPA 4L73A 4KHRA 3UDCA 2CPDA 4YDDB 2DIVA 2MPUA 1PGZA 4B3TF 3K57A 5DGBA 5LMNJ 3VGSA 1FCAA 5I42B 2OTJS 4X4SA 3KNAA 1RT2B 4QW8A 1J5OB 3SQOP 1Y11A 2M9KA 2J7UA 3OXLA 2AGPA 3OVBA 4A8SA 1JNZB 3G9CA 2EEYA 5F8HA 2CZ9A 5EX3A 3Q2SC 1D8ZA 1N54B 2G0JA 3SCJE 1U1NA 4NLPA 3D54A 2R7UA 3DLKB 5IOLA 3PV8A 1XEZA 1RT6A 1VQKS 1IM6A 3QQCD 2HQGA 4ENOA 2OFGX 2A0FB 9ATCB 3P6YC 1WF2A 3G8TA 2F8MA 4WP8A 2OSQA 4X64F 1NKBA 4GO7X 1M1KT 3BN7A 4C8LA 1KP6A 3TUZC 1HQUA 2VL1A 4ZPTR 3W66A 3M6UA 3U7JA 1VLOA 3G82A 2RHSB 1WSRA 4DL2A 1IR0A 4DS5A 3WC0A 3SIPB 5BR8F 3M1VA 2WCXA 2CPHA 4DV3F 4ZVFA 1RWUA 4LJMA 2QLJB 3MMCA 1UZDA 5HATA 5EGYA 2Y1JA 1HBMA 4H4OA 4CNZA 3Q0AA 5C24A 1RHKB 4C3LA 1VC0A 5J1PA 4ID8A 5A76A 4P71A 3MMJA 4I6YA 2F3JA 2FJAB 2HPUA 4F02A 2PI5A 3HP6A 3VAKA 1JLGB 2KFZA 3JQMA 2MHNA 3TQEA 1NO8A 4WBFA 2ZH4A 3KK1A 1LV5A 3KYLA 4ID5A 4Y6IA 4DR5F 2AW0A 3QJJA 1H7XA 4CLSA 4YEAA 5HO4A 3M30A 3HVAA 3PJXA 4C3MA 4LUBA 2AX0A 4OX8A 1E6YA 4B3RF 2L9WA 2HNDB 1NRKA 5ETNA 1NZAA 3MEGA 3W7BA 3A12A 1APSA 3OTDA 2ERRA 5H1SV 4LRBA 3OL9A 1IKWA 1KFDA 2MKYA 4YB5A 2J9EA 3OSPA 4MK9A 4URGA 2LVWA 4QU7A 1DARA 5F0WA 3CEDA 4N77A 1GTHA 2FJEB 2ZKTA 3H40A 4OYWA 1RSCA 3GFXA 1NSPA 1DJ0A 1P9QC 2EPIA 3W5XA 3GV7B 2YWEA 4RO0A 3TAPA 1YJ7A 4RNFA 2I38A 3ETOA 2E9TA 3EZ5A 5HVGA 2LKZA 2ZZNA 2VV5A 1KNZA 1EJ7L 4F4XA 3GIRA 2DT9A 2V69A 4L6V3 4ECVA 4WK3A 2BJ1A 4DZDA 5AJ3J 5D4LA 3R2CJ 2CYYA 3MWBA 4P74A 3IWXA 2L41A 1C0TB 1XMOF 1M5VC 1R43A 3TW0A 3OBIA 1JXLA 4CCHA 3MM7A 2NUHA 4AT1B 4QPXA 3EGWB 5H9EK 4ILMA 2CQIA 2NCKL 4PXCA 2AZ3A 2KFNA 3PFEA 3KMQA 3FBFA 2OPSA 2YKMB 2BKOA 2GNKA 5MAOA 1QVFR 3JS9A 3VVTA 4TYBA 2E9ZA 2M2BA 1RLDA 4F3QA 5E3PA 4E0DA 4ED2A 1VCTA 4ED7A 5G4DA 2FVQA 1VJWA 3FK4A 3MEDA 4I6WA 1T8EA 5KFRA 3UN3A 1ZM9A 3H20A 4DV7F 2M5YA 4TU9A 4RUAA 4F67A 5B0BA 4DF4A 3DLJA 2ZVSA 4RKUC 3BGLA 1ZOTA 2DNHA 2R7XA 2FD2A 2CJYB 3I32A 2PMZD 2IFXA 2A2DA 3CJ0A 3PKYA 4OZ3A 4TY8A 5I3QA 3G2XA 5L1LA 1X4BA 3RAXA 1B70B 1X4GA 1NSQA 4FN5A 2XMVA 3SEOA 2OFHX 3HSJA 2OD4A 4HL9A 4AUKA 2CAJA 1RA7A 3DLGB 1IBMF 2B5JA 5E7OB 3LAKA 3K0JA 2BKNA 1HYSB 3MTKA 1DTTA 4IRDA 5ETKA 4WXWA 3A8JA 2WZ1A 2H48B 2CPZA 3FRZA 2LLZA 2JOQA 1NZ8A 2U1AA 4Q5VA 4RW9A 5LM7E 3OXGA 4Q0BB 1NUEA 3QWPA 2J8SA 3RG6A 4FS2A 3CDWA 4R0EA 2HNYB 2CPJA 3GSDA 1N6QA 3FNNA 4F4YA 1Q82T 1U1RA 1X9MA 3N01A 2OTLS 1FERA 4LF9F 1WHVA 1VQYA 4FKXA 3RAQA 3CIZA 2GHVC 3H4BA 1VQLS 1RAEB 3PYFA 4J9SA 4B9TA 3SZ2A 1B7YB 2D1CA 1NJWA 3PRDA 4L72B 2RUGA 4ZVOB 3X3UA 3GTYX 2RMLA 2FJVA 3FEXB 3W3SA 3DYAB 3RAMA 1KRPA 1BWVA 2CG4A 3V6DB 5DG9A 2IC3A 5T7LB 3TX8A 1ULRA 1EKRA 3H42A 1NU4A 4QR0A 2Y8YA 3KHGA 2PO4A 2G1HA 2RS2A 8RUCA 3IR6B 3Q8YA 1T9YA 4Y2AA 2BQ3A 4UTGA 5KFCA 3QGPA 3POTA 3B82A 3MEEB 2PSZA 1O6XA 4DLEA 5L1JA 1T9UA 3Q8UA 1YBAA 2FHOB 5B0GA 4DR4F 1VGYA 2MGZA 4FF2A 1SV5A 1RYSA 2HZVA 3M2RA 2MZTA 2WVBA 4WIIA 4Z2XA 3BB5A 4NRUA 5HVHA 4ZIVA 3DRSB 1U4BA 3T5JA 3D3CJ 2J9DE 2J7WA 2CQGA 3RBXA 4URQU 2MMYA 2PD1A 2XTJP 3LP0A 4K0KJ 2XCPA 4P2MA 2AYEA 3AD9C 3NGTA 2H54B 4L3NA 3IO1A 1WHYA 1NB2A 4QIWD 1SKSA 3WHIA 4DUYJ 1TK5A 5KFLA 2HHTA 2XEXA 2EXUA 3QPIA 4IG0A 4DPXA 5GMKa 3AA9A 3K8VA 1PJ6A 2CDRB 2YWHA 4NLOA 3W5ZA 3UNYA 2B6AB 3OTBA 3O5TB 2OPQB 4PABA 2DY1A 2JJ4D 4ED4A 3GE9A 2GJIA 4F0MA 1YZ6A 2VICA 2AGQA 1LWCA 2CQ1A 3TOQA 4OHVA 1N48A 4C7QA 4HVZA 3IRWP 3PHTA 2DD8S 2EVZA 1S12A 4WFZA 5A8WA 1D3WA 2QMXA 3WZ0A 3VCDA 1UCNA 4JI1J 4F0HA 3RUBL 1ITPA 4GC7A 1HBOA 1TELA 4LBIA 1IKVA 2IM0A 3DLEB 9RUBA 4KPYA 1T9WA 2CJKA 4RNHA 5CABA 4DUTA 3GV5B 2F65A 2ABYA 2RUSA 1SPBP 3GR0A 4YHHF 4DBQA 5IM0A 3FZBA 1WOOA 3BO3A 3BDEA 4OX7A 5ETVA 4DL0C 2J0QD 3F41A 3V4IA 1VS3A 1U1KA 2ZE2A 3ZFVA 2GJFA 3NGRA 1PYTA 3PYEA 1LOUA 1T03B 2NYHA 3TJ8A 3KHHA 1WEXA 1RHMB 1U0HB 1X5OA 3RTVA 1S6PB 4LT6A 1MLAA 5IQQA 1R31A 3OR1A 2KG1A 3CCLS 3W2WB 4R0JA 3J7YU 2AMCB 2VQFF 2MKCA 1GFWB 4O3RA 1KD1T 2GAGC 1VQ7S 1HPZA 1R89A 3NG8A 1RWNB 1TUVA 2DO4A 5KG6A 2KM8C 2IHR1 2XSJB 5ETOA 2IIHA 3LH2S 2JX2A 2GCFA 3FCHA 1HBNB 2PDAA 1H2UX 2P2CB 4EEYA 1SH3A 1VBZA 2Z30B 1N5YB 2F40A 2YKQA 1NKCA 2FLOA 3KKFA 3D1OA 5D78A 4OMFG 4MYUA 4PG4A 2JEIA 2LQ9A 1B0PA 1ZM4A 4OJ3A 5F3TA 1HNWJ 2DXFA 1C1BB 3EZOA 3J7ZT 2XBPA 3M6XA 2KHCA 2IYGA 1WC1A 2B4OA 2E5LJ 1I3OB 4WJBA 2ZOMA 4Q2LA 2W4PA 5CD4A 4CO4A 3GILA 1YTYA 2V8DA 1ZYQA 3IGNA 2ATLA 4J9LA 4KHPJ 2BYCA 1VQ5S 1Z1ZA 4CTAB 5IQ6A 3N6LA 5B08A 5DLGA 1X7VA 2DBBA 1VQOS 1FRXA 1F5BA 4OZ2A 4N41A 4G65A 2B8PA 3IS9B 2MY8A 5LSRA 2OP5A 1CQNA 1EARA 3FMWA 2DTJA 4RNOA 2EK6A 1JLQB 2HQDA 2HSEB 4JI6F 4LF2A 3RB6A 3WX4A 4PZVA 5FLXU 1YRUA 2O3DA 1G4CA 1REVA 3QNWB 2DRAA 2ZD1B 2N3OA 1IWGA 2VOOA 4FYWB 4Y0FA 1M1HA 2XMMA 4JI3F 3BGRA 4ECYA 2MQOA 4N47A 4DV2F 2BW2A 5GADI 4KT0C 4RW8A 4JBCA 3QT8A 2F5GA 4MIAA 4DEZA 5HP1B 5GAHI 4DV1J 1XBWA 1R8BA 1JLEB 4RW7A 2G4BA 2IPOB 3KWMA 3CE8A 2MZJA 3HK2A 4X4QA 2GVZB 1C2PA 3CCJS 2UP1A 2V67A 4EBEA 1BC6A 3GYXB 4AL7A 1CPZA 3C3LA 3C16B 3KG4A 4DDFA 3HVTA 4JV1A 4RBVA 1Z2ZA 1HNZJ 2FHMA 2JVRA 1E6VA 1IBLJ 4WU3A 3GFHA 3H2LA 3LQVA 4PYDA 4OV1A 4NEZA 3K17A 4DCJB 1HNXJ 4NI2B 3AY0A 1T9VA 2WVEA 3SFUA 1RHJB 2C22A 1S10A 5E41A 1RCXB 2DNMA 4ELTA 4PEOA 5K14A 4LF4F 5E2QA 4DPWA 2Z2YB 1HNIB 4RW6A 1Y3JA 5ETLA 4ECSA 3KK3A 2DR7A 4EBCA 3V6HA 1OMSA 3N0VA 3TARA 4RU2A 4F3MA 1QM9A 2DNRA 1QSSA 4ZPAA 1IKXA 4ETZA 5LMUF 1LXNA 4I64A 1S6QB 5HMZA 4JV5J 2IRUA 4ED6A 4KKOB 2HVEA 4F26A 4C8YA 2BE2A 1IR1A 4X66F 4F4AA 1B7FA 5CQGA 4EZ9A 4KH1B 1T94A 1JLAA 3PW0A 1DTQA 2BEFA 4DUZJ 3C6TA 1S1TB 4QWEA 4RWWA 2UUCF 2V50A 2NSBA 4YB7A 1SJFA 2DHGA 2QC3A 3OL8A 3OT9A 2YNIB 1NLKL 5B7WA 5C5JA 1NPRA 1JKHA 1K9MT 2B0GA 4NLSA 1V3RA 2NS1B 1X4HA 3D68A 2RF2B 1HQEA 4QWDA 1T9TA 1RT1B 1TUGB 3CDUA 4ECXA 2QSFA 4NCBA 2V68A 3PM9A 1R0BG 3FFIA 5L1IA 4QIEA 2UXCF 2OLWA 3SDEB 3HVWA 3IFEA 4ITSA 1NAQA 3OHAA 4ZCMA 1B0VA 1FDAA 2G0CA 2UV8A 3H5SA 4OZ0A 5B0AA 2Z2MA 1ACMB 3FJ2A 1OPZA 2MSSA 3N28A 2DGQA 3EXYA 1X60A 5ETRA 5A8KA 3PIOQ 2QTWA 1RGVA 1YVFA 2B9YA 4C2MA 5DQGA 3SQGB 4D3HA 3MM5B 2E1AA 2VA2A 3KLFB 2DGWA 2RS8A 2UVWA 1DAXA 2L9DA 3CVKA 4F04B 3J81U 4LF5J 3W63A 4QR1A 2JDJA 4NLWA 4QPTA 1UVKA 1Q8IA 1SH0A 4TVAB 3VWSA 3M8PB 1KLNA 3FEYB 4JI2J 3GIJA 3PG9A 4G1QA 4ZPDA 2W2OP 2WVFA 2UUBF 2J6SA 1GEHA 4PUOB 3HI9A 3T3FA 5DQHA 4OI1A 4CO5A 1UFLA 2CNOB 3MUMP 5AJ3F 3NBPA 2B43A 1VI7A 3ADAC 3RBDA 1HWJA 1RCOB 4PYAA 4X65J 4FXWA 3VGTA 4JI7F 2VDHA 4QWCA 5FIIA 3Q8VA 1UZHA 3EPIA 4C11B 1H98A 2KT5A 4ZCIA 1S0NA 3OTOJ 4IDKB 1OJ4A 3LP1A 2NSCA 3MM6B 4CQ1A 3MMBA 1FEHA 2W25A 2J9DA 4UW2A 3PX0A 2RRNA 1KFSA 1V6HA 3DI6A 4ZJLA 4BC9A 3HVRA 5F8JA 3H4DA 2WONA 1TVRA 2XWYA 2I9SA 2C3PA 2RE1A 3R7NB 3KLIA 1ZA2B 3UE2A 1AYEA 2K3IA 4ILLA 2ZDPA 4IOBA 3PZPA 2ZHOA 3PRVA 3OW2R 4IRKA 5IC6B 1KQSR 3HKWA 1SUQB 1LFPA 1RU1A 1ZPWX 2V2QA 3J80U 2VUGA 1KTVA 4WF9Q 1HMVA 1IBKJ 2WSCC 3KLVA 2XNQA 2HAIA 2AJFE 2ZHAA 3EDRB 4UOGA 4ZVSB 4Z37A 2CFXA 5J1EA 1F60B 1SQGA 2LXUA 3KLEA 1WF1A 3ZXWA 3RRKA 1LW2A 2H5EA 1CULB 5IV3A 3M9NB 3P96A 1Q8LA 3VAIA 1S72S 3CJ2A 5GVQA 3VQTA 1UMJA 1CJVA 2QX0A 2AT1B 2HMIA 4N8NA 4DR6F 4NL5A 2YKOA 2W2NP 2HFOA 2VFUA 2R7RA 2KT2A 1KKHA 2IMWP 4KIAA 1KC8T 5GAGU 3CWJA 1BHNA 1URRA 2NXJA 2QMWA 4XIUA 2Z57B 2LMIA 4ZLPA 5F0UA 3C15A 1H73A 1YRXA 3HFVA 2V63A 2QE5A 3S6EA 1FFWB 2BE7D 2CPYA 4C8KA 5FJ4A 4MAKA 4X4PA 1XMQJ 4OHYA 3HFZB 2WW8A 3NP5A 4OJGA 1X0PA 3TZZA 3PW2A 2UXDF 1YIJS 2KVIA 2A1BA 4DSKA 4DR7F 1TV6A 3I4HX 3TAMA 3ZO7A 3AOAA 1WC3A 1MMDA 2VBXA 3M4XA 4CZCA 3G6ES 5J2NB 2GQQA 3GP9A 2BQUA 5F8NA 1L3SA 3G6YA 3JSYA 2V4JB 1RWXB 2XY6A 4CP5A 1I1GA 4B9UA 3SBMA 1XWLA 4MKYA 2IDLA 5A6PA 1TK0A 3UDEA 1YITS 1Q1KA 1SJRA 1JLCA 1UVMA 3I56S 4NA2A 2OPRA 2R2SA 4FNIA 4RU9A 5MLCV 3K5MA 1H38A 5KFXA 2D3UA 3MCMA 5CYMA 1QTMA 4GMKA 3LWLA 2JH3A 1IM4A 2FVCA 3MECA 3GQCA 1WC4A 3MEKA 4P7TA 2UV8G 2VFRA 2VHGA 2D69A 3ZZOA 2W9BA 3QFHA 2ZM6J 3E01A 2CNLB 2XZTB 1H7WA 3O44A 4O4GB 4K0KF 3CCES 3D3BJ 5C25B 4TU8A 3MAQA 2AQ4A 3FUYA 2GQCA 4KC5A 1ZAXA 4HI1A 4PRFA 3NCQA 1N32F 2I8EA 1FKPB 1ROFA 3JQJA 1B3TA 4QU6A 2F9JA 3QYYA 5LXRA 1WF0A 3MAAB 5HSPA 3KHLA 4DUYF 2ZHBA 2OEMA 2W01A 4DR3F 4ZVUB 4LREA 4W98A 2BJ7A 3D6TB 4JI0F 2OUGA 1QAXA 3NCPA 4EO8A 3H59A 1SIZA 4DG1A 2PFFB 3CJRA 2UUAF 3OXFA 4KYZA 2MKIA 3O1LA 1AA1B 3O6QA 1RWMB 4OHWA 4HTJA 2DXEA 4MJKA 5J2MA 3ZZPA 1CC7A 2Q1LA 3DU6A 1WKLA 3K59A 2R7TA 4FS1A 1RT7B 3I0SA 5HQ8A 3RYLA 2I5JA 4DSLA 4YUDA 5HL7Q 4KRWA 1W26A 2XS2A 3THVA 3CC2S 2X1AA 3T1YF 3BN4A 1VQ8S 3WIVA 3UCUP 1OIAA 3AXMA 4NLUA 4USKA 2LDIA 1BQXA 1FXRA 4PQAA 5U47A 2W9CA 1TKTA 3T5KA 4ZK7M 4DV5J 2CPEA 4DXLA 3LP2A 3SXLA 3VZIA 4I68A 4ZP9A 4FXVA 3D6MB 3KDOA 4ZLLA 2ILYA 4LF7J 1YLXA 3HDSA 2YH1A 1F3FA 4KGVB 1T05A 4A8WA 1V5VA 4I2QB 4U67Q 1SJ3P 3PEHA 4PKDB 3CJQA 2RH3A 3W62A 1UVNA 2D3OR 4DX5A 3QAEA 4IFVA 1F5AA 4UUXA 4OI2A 5SUHA 4Y3CA 3OUYA 2BDPA 5B0FA 1FHTA 4ERDA 3PY8A 1FX2A 1S79A 3K5LA 4O3PA 1OYEA 5I3UA 4ECRA 3J7Z5 4PAAA 3L95X 4CH0S 2K06A 4BLGA 3HD2A 1TTHB 3DRPA 3DN9A 5ETQA 4ZVGA 4USHA 4DPOA 5KT2A 1KLMA 4O3OA 1ZTWA 1NK0A 1HNWF 4FP9A 1S1WA 5KG0A 2V2ZA 2GMLA 3CCSS 2ZH5A 1KOOA 2QSWA 2R8KA 1WNEA 2E5LF 1HBMB 4H4OB 1VK8A 3C19A 4CO3A 1QLNA 3I96A 4E8UA 4OFZA 2H1YA 4RWXA 1EB0A 3LALA 1RAOA 1NXIA 5HJYA 1JLBB 3G6XA 1NB7A 2KXHA 4TQSA 1RADB 4ID5B 3BR8A 2DEJA 3QIPA 4HHHA 2FJDB 1CEZA 3HX9A 2WHOA 1H3DA 1RT4A 2XULA 1MWYA 1Z4UA 2FJBB 1AROP 1RB0A 3GB0A 1U2FA 3F56A 2J9CA 3W61A 5ETMA 2ALYB 2MZSA 4OX9J 3GJSB 2H51B 5AXNA 2YKNB 4G1PA 3M9MB 3OFFA 3MEGB 2LEPA 4X2BA 4H4KC 1VQNS 1AUDA 2YTCA 3MI7X 3HT0A 1UVLA 4C9DA 3MFIA 3CC7S 3D1QA 4U7CA 1HW8A 3DGVA 1D0EA 5D3GA 2GGPA 3WIUA 3A13A 4ALZA 3SCKE 1RBLA 3G4SS 3FSYA 2BW7A 3K8WA 4NA3A 3I9V9 1YJNS 2B4VA 4FNHA 1K0TA 1EX8A 3F0NA 2FVSA 2F4VJ 5E3AA 1IJEB 3J81Y 1XIQA 2DXDA 1HHQA 2B7CB 2BACA 1PJ7A 1JIHA 1N5SA 5CYQB 1UWBB 5AT1B 1IBLF 4USJC 1S0MA 1TL7A 2OGUA 3CJ4A 3KFWX 1ELOA 3FBEA 3T1HF 1HNXF 4B3OB 4RBTA 1N52B 1C1CB 2ZH8A 1QE1B 3KG1A 1GMVA 2VKZG 4PG5A 2LXFA 4NX9A 1K44A 3MM7B 4LFCJ 2N4DA 3H7HB 2E5IA 2XS7A 2W2PP 3QZ7A 5AXLA 1D9AA 3IR5B 4O44A 4XTTA 5A2QU 4S0MA 3F44A 2QLBB 3PW4A 1TMMA 3HZGA 1AXQA 3M8QB 2B9WA 3N4WA 3T6BA 1N5VA 2R7SA 3DNCA 3PNIA 2BXJA 4RL1A 4HHJA 2BVZA 5I4MA 1LWEB 2JL9A 5KFSA 1SVDA 5HJXA 4CLTA 3ZTSA 2VQEJ 2L9NA 4NLQA 3GFYA 4ZHRB 4K8RA 5DS7A 4DQIA 2FPHX 4ZDNA 3HKZD 3I87A 5KFWA 3ONQA 4TY8B 4IO1A 4P2XA 2NQPA 1LXJA 4DV0J 1L3UA 2ZWPA 1L5UA 1M5OC 2JNJA 2MZRA 1NK8A 2RB7A 1TQLA 4TY9A 1P27B 3IWNC 2V8VA 5G0RA 3J80Y 2GS8A 1ZAWA 5EX0A 2P5VA 4BHQA 2Q79A 1DTTB 3MOZA 5KT4A 4QWAA 5E3QA 4IKAA 1M90T 3ZTOA 3HHLD 1BWEA 1EZZB 2FLNA 2QMUB 2M70A 1OSCA 4Z7YA 1VIXA 3LPYA 4I6AA 4EI2A 4F25A 3BS9A 1MMLA 1RT2A 2VJVA 1J5OA 2HBRB 3NMAA 5L8RC 2DR8A 4M5MA 4NXNJ 3L09A 1FKAF 4WK1A 2M7SA 3T5LA 3H2VE 5J2PA 1SQFA 3D4JA 1S76D 4OJHA 3N5BA 3AFGA 2I1RA 3DLKA 3TI0A 5D4OA 3W9HA 1X0FA 3LGHA 5KFMA 1SL2A 1RWOB 4NXMJ 1RZMA 5D0EA 1KONA 5JVHQ 3GMGA 1PCAA 1PYOB 2EKYA 3WQPA 1R8AA 3ULHA 1T95A 1NM2A 3DDNA 1OQ6A 3BGUA 2UVVA 4AL6A 3MR2A 1QSYA 3EXCX 2Q66A 3FEZA 1XJWB 4ED0A 2IC3B 5DRKA 4K59A 3MR6A 3AB2B 5D8HB 2VPXB 3NS6A 4OLOA 3M8YA 2ZZMA 4P73A 3POTB 3GJRB 4W92B 1OYDA 1OY9A 1SKUB 1XQIA 3THTA 2CQDA 2GX8A 2E66A 4CM2A 5M2UA 1D9FA 1KVIA 2MGZB 2HVZA 3I5AA 2HWIA 3M2RB 3BGOP 3MM8A 2OPPB 4HDHA 2WAQD 1WORA 3N6MA 1T0TV 1JLGA 4K50A 2GO9A 2J0XA 2VA3A 3R3TA 4F2SA 2DNNA 4YDXA 4P2FA 2V9WA 1KDNA 5KFIA 3V81A 2W8KA 2KI2A 3B4DA 4DR1F 2ZZTA 2FZKB 2LEAA 1Y4ZB 3OTOF 3NAIA 2WBRA 4R8UA 4JI8J 1T7PA 4UZBA 4LFAJ 3QRRA 2E1MC 4CWBA 5GAEU 2DYAA 2GAHC 1WI8A 2J76E 4QW9A 4C8OA 1JWWA 1FFGB 4OZJA 3CD7A 3M05A 1TP7A 4C0OC 2PA8D 1RHQB 3BGFA 1S9EB 5HAOA 1T3NA 2XYHB 5KFGA 1X4DA 3GWCA 2CG8A 1LWCB 2P8IA 3S01A 2YNHA 4AL5A 1J27A 4C8MA 1TKXB 3HF5A 5GADU 2V9KA 1YX2A 3ETMA 4QWBA 3RBEA 2KRRA 5GAHU 2FUG9 3D6FB 3EVOA 1NPPA 2M8DB 4NLYA 4UUWA 5DDOC 2E5GA 4LRCA 4DHVA 5D0HA 1N36J 1Y3KA 3QLHA 5K9FA 1QUVA 3MHYA 5IM0B 2HW3A 1OY8A 3TA2A 1FX4A 1FJGJ 4QYZJ 2ZOFA 4HR2A 1XN9A 2NREA 1LWXA 1M5SA 2LCWA 5THWA 5K8OA 2DHHA 2C1EB 3QRPA 2CRLA 1C0TA 2WTFA 1FNMA 1WUUA 3QMQA 4H4MA 2WSFC 3ELHA 3HULA 3U27A 3LW5C 2AJ1A 1IKYB 4DQQA 3MPUB 3W5YA 1Q53A 4DI6A 1WTBA 3KMSA 4EWTA 1SCJB 3M6VA 2P9GA 1VISA 2E9RX 5DZ7A 2Z8QA 2OEKA 1HR0J 4CI0B 2YKMA 5E33A 1XNRJ 3DLLQ 3Q24A 2Y1IA 3PW7A 2Y8WA 5M2PA 2AEFA 3HLUA 2ZITA 5HI7A 3OD2A 5F3ZA 1QUPA 1PO6A 1HPZB 1UW9A 1PSDA 2AYGA 3U1MA 1TR0A 2RDIA 2BRLA 2EKNA 2EK1A 3I6PA 2BR0A 2DGOA 2EFOA 3P5TL 3NKYA 1T9XA 4W90B 1MMNA 1OY6A 2CXEA 1VQSA 1S1XB 5L46A 4G6VB 2X3GA 2IJNA 5IXUA 4NCAA 2HHHF 2UU9J 3BSCA 3Q89A 1W25A 3D1HA 4A8KA 3O2IA 5T41A 4HT5A 1UAWA 4ELVA 1YJTA 5KT6A 2C2NA 4BWJA 1N34F 2YXLA 3C6UA 4B3SF 1N8RT 3BF4A 3DLGA 3TR5A 1K1QA 4DS4A 2QEXS 3IBFB 4UQGA 5L1KA 1X4CA 2GW8A 2FLLA 5BJRA 3ISZA 1HKAA 4FPRA 4V1Ak 3JYTA 3PCOB 4CLYA 1G3OA 1VK3A 2FY1A 3PFOA 2YPYA 1U7LA 3FQKA 2KFYA 5DO2A 4IFYB 7FD1A 4DFJA 4Q0BA 2HFNA 3HMJG 4ZPBA 1KQKA 1F9HA 1BQMA 2HNYA 1V9OA 1I51B 2ZBPA 3NNCA 1OQ3A 3O3LA 4KGKA 1S97A 1NK4A 1S5ZA 2BANB 4A8YA 1L3KA 2MLYA 1RLCL 3OTEA 4HH0A 3BKTA 4GKKF 1RAAB 2FLPA 4YOEA 5AE1A 3OSNA 4LRDA 1REVB 1HD0A 4OZNA 4X62J 3CCWA 1UFKA 3T6JA 3EYZA 2IMOA 3JAMY 4I67A 2ZJQQ 3MMAB 1EETB 4LIRA 1S99A 3C8YA 5J2QB 3SCIE 4LBHA 1FK9A 5IT0A 2V8GA 4AXJA 3ZNJ1 5A0YA 2GQ2A 2XYPB 1EKSA 2W2MP 1Y7PA 2HVDA 1AZSB 2XHWA 3BBCA 1BUXA 2IA6A 4XPEA 2W1BA 3E3XA 1UVIA 3S1TA 3MEEA 3RU0A 1D09B 2ZUGA 3RRHA 1ZPVA 4J91A 1Q8KA 1VRTA 4GVBA 1XTZA 1WEZA 2R8HA 3GIKA 4KO0B 1E6VB 2NYIA 1X9WA 2HFSA 5KOWA 3AT1B 3DRSA 5HBMB 2DHAA 1KBRA 4DV5F 1XMBA 2RVJA 1N33F 2LQBA 3VAMA 4LSLA 3MZIA 3UVJB 1HI0P 1X4FA 2XZWA 2OAUA 3QIDA 5K14B 1X31C 2C2KB 4OI6A 2UUWA 2R2RA 4IQXA 4ATNA 3GFZA 2HHPA 1VRUA 2XLJA 2BZ2A 3KK3B 2F7VA 4ECTA 2HGLA 4OV6A 4OIXA 2ZBRA 2VDIA 2NPIA 2XQCA 5F9NA 1IKXB 1T11A 2B6AA 3H98A 2CPFA 3WDOA 2XY7A 1JMTA 2GIFA 2IY5B 4WYLA 4J9VA 4ECQA 3EWGA 2CUYA 2NXUA 2LDYA 1SL1A 1JK9B 1CSJA 2CIMA 3DM2B 3HZEA 3BBFA 1JLFA 2KKHA 3IWLA 1JLAB 2BOAA 3FGVA 1DTQB 4I56A 3IGVA 2JWNA 3LAMA 3EDQB 5IT9Y 1YZ7A 3DLEA 2HQFA 4YB1P 5DZ6A 3UQSA 1NDPA 1VQ4S 2ASYA 4FPIA 2VU5A 2FVPA 2A6MA 3BR9A 3CDAA 3EGVA 4K4SA 4LVOP 2IVFB 3RR7A 4OYAA 4WPAA 3RB4A 3IBWA 3L7PA 1ZETA 1AFIA 3H8YA 3AB4B 4NOHA 1JKHB 3E8OA 1U0HA 1UEKA 2KXNB 2JLGA 4X4RA 3H25A 1HQEB 1O0PA 4EBDA 5LJ3Y 1XR7A 2CWKA 3CCUS 3AOBA 4IH5A 1DLOA 2H65B 4LF8F 3ZNUA 3NAHA 1P9YA 3L3CA 2VG6A 3MM9B 5ETSA 2CVIA 2R8GA 1A6LA 3BSAA 4A48A 1U6BA 1M5KC 3IBCB 3UR3C 2MZQA 3OQ2A 1NHVA 2OHDA 1U0SA 1S1VA 3R5CA 4K7QA 4LFBF 1W7WA 5KG7A 3W64A 3FBBA 4ZCLA 2HS4A 8AT1B 4M63A 4USMA 2CJ9A 1UTAA 3MCOA 1VFJA 2VG5A 2XMTA 1LW0B 4X64J 1RTDA 2QL5B 3KHRA 2MTLA 2AJQA 4K5RA 1HBNA 2AEMA 4KAIA 2EFNA 4WIQA 3JQKA 2ZFHA 2DPJA 1N5YA 3A1YG 3UO0A 5KFZA 1FE4A 2HBZB 1PC4A 1NHUA 5BR8J 4X4TA 4Y2KA 4DV3J 4LR9A 4ZOSA 1C1BA 3RJMB 4G1QB 2HGMA 4U96A 1FVQA 4RUHA 3D0HE 5C2GA 4R5PB 1UPPA 4K4XA 1NH7A 1HFEL 2NLWA 3TANA 3NBPB 2OSRA 4MFBA 2YKPA 1K47A 2XS5A 3CD0A 2KZZA 2WBMA 4LRFA 3IRXA 3UFCX 2QLWA 2YWGA 1WOSA 4ZLNA 3FCVA 1Q16B 2QL9B 2WSEC 1PG5B 5KG2A 2Z2LA 3GIMA 3LP1B 1YRTA 4DX7A 2HRTA 3MMBB 2KO1A 2R2TA 1Q86T 6FDRA 2F8EX 3NGUA 3GV8B 4B3RJ 3DI6B 2ZD1A 1MN7A 2OIHA 1SKWA 1FRIA 2QFJA 3D7SB 4K4TA 4JI4F 4LMZA 3KLIB 5HP1A 5CCMA 1KVKA 3BM7A 3N6NA 4FYDA 3KLGA 4V19X 5DQIA 1YGYA 2IM3A 3TZXA 2GVZA 1LK7A 5LXYA 1S1UA 5L9NA 1EP4B 2AD9A 2YX4A 4M1KA 3HHDA 2AZ1A 3N9UC 3RRGA 1HMVB 3BDPA 3AODA 3NCRA 2X51A 5K5MA 4RZRA 4GKJJ 1B64A 3C16A 3THPA 3R1HA 2RAQA 4IUFA 3WX8A 3KLEB 4DZ6A 2EC0A 1LW2B 4K4YA 1Q81T 2C2RA 3SMZA 2VFTA 4CH1A 4P72A 1WC0A 3TAQA 4PQUA 4J9OA 4UQTA 4NI2A 1CJVB 2HMIB 2VPWB 4ELUA 3SSSA 3CJ3A 2HVHA 3DCAA 4WE1B 4B9SA 1XMOJ 3J7YI 1QDUB 4YR3A 2QLFB 1JJCB 2AKWB 2YBVA 4ED1A 3ILJA 2J0SD 3JSBA 4P75A 4FVCA 2AHOB 1F2HA 3NGKA 1HNIA 2DK2A 4W4MA 1SC3B 4CLLA 2AYBA 1NPKA 4CDIA 7AT1B 3JXOA 4M95A 4CLWA 1U1MA 4O23A 3K89A 3MPVA 4RNNA 3GIIA 2J7KA 4XPCA 5BXIA 4IOAQ 2HS3A 3VHQA 4EFAC 4Q7AA 1TV6B 1VQPS 1GAOA 4KQZA 2JZ5A 1K0VA 2YNFA 4ZA1A 4KKOA 5DDRC 4DV7J 3BREA 1FNXH 1X5SA 2XNRA 4EGLA 2G2OA 3R97A 2W7AA 3I9ZA 2HZAA 1M0SA 1EHWA 1NJXA 2HGNA 2GVDB 4X4UA 4P10A 3KLHB 4BCAA 1GTEA 1U09A 3EE3A 1UA1A 4F3OA 5KFUA 3ENWA 1GMWA 2LU2A 2RKIB 3QT6A 4WXOA 1YG0A 1IBMJ 2DNZA 1R0CB 5LT5A 2K1RA 3IG1B 1MWZA 4LF6F 5LJ5Y 4DQPA 2Z56B 2MSTA 4YY3J 4HLBA 2O5DA 2DCLA 2EBEA 1GX6A 3LO3A 2MKSA 1RT1A 5IFMA 4JB8B 2BOPA 4JP8A 2W9BB 1CJUB 3E01B 2CNNB 2HWTA 2W7OA 2V5HG 1SB6A 3UN2A 2RQCA 2WK4A 3SDEA 2V34A 2KL8A 5D0RA 2F1FA 2GA7A 2R7QA 4PPDA 5B0CA 4YN3B 3SSRA 1PAEX 3I4PA 2UVUA 4MT1A 2XO6A 2HG4A 5HROB 4EYHB 1SXLA 1RBAA 4CNYA 4MTPA 2Z58B 3GYNA 2MQPA 2C28A 3GLJA 1U48A 3OPKA 3MAHA 2U2FA 4KR0B 1FKOA 1PYSB 2E1PA 1CVJA 1Y00A 3NS7B 4C0BA 3QGIA 2I6WA 2PIIA 3UI3A 3UD5A 2Y3YA 3ENQA 3NLCA 4CT8A 3OFGA 3KLFA 3F73A 4K5SA 1TK8A 3I0RB 3QT5A 2SXLA 5CAAA 1RT3A 1G6BA 2HHSA 1X4AA 1NK9A 4PR6A 1S48A 4FF1A 3FZ2A 1IN0A 5IZHA 3ITHB 1Q79A 5HQLA 1CJTA 1KR4A 1DQ8A 5C42A 3A8KA 5JJBA 3I0SB 8ATCB 2I5JB 5KFTA 2FJWA 3M8SA 1N36F 2RU3A 3CGIA 3B4MA 2OI2A 4DR4J 2Y0BB 1YI2S 3HPOA 4UY8T 4PUOA 4ZLJA 1TKDA 1VQ9S 1UP1A 2CQPA 1WOPA 4M94A 2CNKB 2GMHA 1NHKL 4P52A 4J9RA 2Q43A 2KZMA 1HIYA 3DDIA 4CLKA 1NCLA 2HHUA 2V2VA 1JJ4A 4Y2IA 3I5BA 3D0GE 2WB4A 3DDKA 2R7VA 2DKOB 4C11A 1F0XA 4IDKA 2PGCA 2XYGB 4J9KA 2LU1A 4ER8A 2YX1A 3KJVB 1RAHB 1ICEB 1T05B 1HR0F 4HH1A 4K4ZA 1FRMA 1XNRF 2YH0A 2CZVC 3DFEA 1UPMB 4CO2A 3AJ1A 4PWUA 5H9FJ 1RAJA 3OUYB 1F1BB 2PT0A 3G96A 2NZ4A 4ICLA 1RAGB 2ZH6A 2MHEA 2WW4A 5KAKA 3BBBA 1AFJA 2E5HA 4CH7A 3BKFA 2VF3A 4C97A 2BABA 4WZQA 3HFKA 5I3UB 4DR2J 3P45B 2D3ZA 3PO5A 2MLXA 3HT3A 5IV4A 3QO9B 5JVGQ 4LR8A 1P1LA 5IWAF 3K5NA 4WU2A 3LUYA 1NKEA 3LGNA 4EMDA 1TL3A 4FKYA 3PTWA 4FYYB 1S1WB 3M2UB 4YHHJ 1RTJA 2E44A 2V6AA 4V19J 2M52A 1YBTA 2W2QP 4LF1A 5KFYA 3RB0A 3LWMA 1V3ZA 2V8HA 3HHLB 1GMWD 1W2BR 1HI1A 4N8OA 3M8RA 3EVMA 2CQHA 1EQ0A 3UR0A 3EM1A 2R4FA 3CJSA 1NEEA 3OL7A 1RT5A 3TVYA 2BM0A 2JC1A 3AD8C 3C2PA 5DDPC 4L74A 1ZBTA 5K8MA 4ZVQB 1HLWA 2VQFJ 2QV6A 1F9FA 3MD1A 1LWFA 4KFBA 4ZJOA 5CD4H 5CCLA 4RBUA 3DRXA 4X62F 2KRBA 5GMEA 2MYFA 1S9FA 2GHWA 1S0VA 1I94F 2A6OA 2DGTA 2ACMA 1U2RA 3Q22A 3TVKA 1PKUA 3D66A 2Q3PA 4U7UD 1SH2A 2HNZB 4A4JA 2EFQA 3K2YA 4JOUA 5T14A 2DB1A 3C46A 5D3GB 3N79A 4KPCA 5EDWA 2GC8A 4L75A 1TL1B 2N3LA 3LPEA 4I7FA 4UOFA 4ZVHA 4EYIB 1NDCA 1S6OA 5DGAA 1S59A 3QJPA 4DSIA 5ETTA 3P49B 2XMKA 1RE1B 3RGIA 2YVSA 1GXTA 1FTRA 3DGPA 4ZPCA 1F5CA 1TL7B 3PX6A 1UEUA 3FSIA 2JVOA 4U95A 3BH7B 5C2CA 1HWIA 2FZGB 3SSQA 2N7YA 1TU0B 4O4GA 2YQ0A 2LQ8A 1RWVB 3UD4P 2ZBIA 4NZ0A 2RT3A 2NR0A 3UDLA 2GIRA 1CLFA 2ZJRQ 2AJ0A 2CQCA 3KOAA 2XGPA 2MQLA 4ZP7A 4M5DB 4FF3A 4DMZA 3BJYA 3MAAA 3LA0A 4UZCA 2NXNA 3SV3A 1Y5IB 4LVNP 2Q6BA 3K5PA 1GMUA 3DC2A 4CO0A 2OD6A 1GXUA 4BC7A 2JC0A 5D4PA 4NA1A 5LMNF 4JI3J 3M32A 4DV2J 2GZOA 4CM0A 2L3MA 2KN4A 2HIYA 3HHLC 7FDRA 1WDTA 3ZTQA 3RW6A 4ZITA 4X4NA 2YWKA 3A8EA 2HRUA 1PBAA 4OL8A 2C42A 3UCGA 2DNOA 3HJVA 2NXEA 5C7PA 5M2RA 2KYZA 2HURA 2DNGA 1NK5A 2A2CA 2DISA 3R5GA 2PE8A 1SJ4P 4WZMA 2FDNA 1RABB 2HFUA 4H4KA 3DMJB 2ZKUA 3MR3A 5G0RB 3P8BB 3GU0A 3BH6B 4DSJA 2FHJA 3QZ8A 4ZIWA 1RA6A 4ES1A 5GAGI 2JEFA 1HHSA 1N4LA 2XCAA 5KFDA 2AV5A 3H2UB 3R2DJ 3DHXA 3V6KA 2QFIA 2VASA 4FXDA 3KJQB 3M2VA 2D9OA 3GCXP 4LF4J 2FVRA 3TUPA 1YJWS 3H5YA 3ET6B 2RIJA 3FC9A 3DOMB 4Y2MA 2EFPA 2ZWOA 2DJWA 2G2YA 1N5QA 2L48A 3D2WA 5J2PB 4I2QA 4WKYA 3Q8PB 3R5JB 2E1RA 1XNQJ 3KUHA 3KUEA 3MDFA 2RQKA 1NK7A 5LMUJ 3J7A1 4A46A 3IR7B 1LNQA 1TFYA 2PN6A 4NMXA 2MKKA 3W2VA 2LA4A 3I31A 2H3EB 3DHWC 3NGDA 4X66J 1FXLA 2KJVA 3VV2B 4OI0A 3VZHA 2H9ZA 4F36A 5F8LA 1I5OB 3U02A 2OMOA 2VPYB 5B09A 1R6YA 2W9AA 3PR5B 4TQRA 4DWIA 1LFWA 3E51A 2LXIA 3PDNA 2Z0GA 2UUCJ 4JI5J 2MKHA 4XAKA 3CB4A 2MQQA 3ICLA 5KFHA 3VGVA 2DH9A 2LQJA 1FNOA 1NBEB 2YNGA 5E5NA 1R8HA 1LKZA 2DVIA 3DOKB 4QIFA 3T41A 2V4RA 1U1PA 5D77A 5ADZA 3FMBA 3ZZUA 1IBCB 4M5JA 2E1CA 4LIWA 4FZVA 3QWUA 3MM8B 1Q5VA 1VJQA 3NGSA 1JLBA 1CJKA 4QOTA 2FIUA 2V8PA 5KT7A 1QY7A 4WCEQ 4FF4A 3UPFA 2ZEJA 3TZYA 1VYAA 3V81B 2DNPA 1KVJA 2IAJB 2XI3A 4WWSA 1NNDA 2UXCJ 5HK4A 2AEJA 3FSXA 4B08A 4R8UB 3CUNA 3ISND 2VBYA 2O01C 2B4UA 2ZH9A 3AHPA 1HI8A 4X4VA 5EWEA 4OHXA 2CADA 2YKNA 4LBPA 1PILA 3MR5A 3CJ8A 2HHVA 4J9MA 4DCPB 1T02A 2POKA 1R0AB 2JEJA 5F41A 4ED8A 3NL0A 2FC9A 1WD6A 1S49A 3CMAS 2WOMA 2YNHB 3PJ9A 3JSRA 4P6QA 4ECZA 4OX6A 3DU5A 4MMOA 4NRTA 4J9UE 3EMTA 1MW7A 4JYAJ 3HJFA 1S9GB 3LGMA 3KJNB 5CZVA 3FRYA 1YJUA 3EZUA 3MUTP 1RWKB 3GYGA 2IM2A 4LSNB 4GKJF 1D9DA 5LL6d 2IRYA 1XR5A 1FESA 4I2PA 3K58A 1M5PC 3JTPA 5AXKA 2QL7B 3S7RA 3QLHB 5CYQA 1UWBA 3BO2A 4KE5A 5K20B 2C2MB 3PR4A 2UUBJ 1G2EA 4NYPA 4IG3A 1YDLA 1TL4A 2UXBJ 1FRLA 4YR0A 4FBTA 4DJBA 4B3OA 5KTQA 2LECA 3D5MA 4KJIA 1C1CA 2CJXB 1S77D 2QA4S 2BJDA 1QE1A 3QFWA 3OVSA 4I0WA 2FHJD 4DQRA 4DU8A 3BQ0A 1ZM2A 1S7HA 4WFBQ 4JI7J 4H4MB 1C0UB 4KH0B 4ECUA 2DPIA 3J7AN 5KG5A 4AE5A 1B99A 3EVWA 3TA1A 3DOLB 1FE0A 3BKUA 1J5EJ 4OYBA 3CCMS 1X8DA 1WACA 4KSEB 4JUZA 1DFDA 1RWWB 2B9EA 2XZDB 1QD1A 3M8QA 4AQYJ 4Q8FA 3CCTA 4FDFA 2BJ8A 4OYZA 5IC4B 1AW0A 1SI9A 4TU7A 2V94A 1UWAA 1YHQS 2H5JB 1KTQA 3CO0P 3TX0A 5CXTA 1LWEA 3QATA 1A0OB 1VRQC 4O4RA 1SC4B 3CNQP 1UFWA 1T3OA 1KHWA 3HD1A 2CWXA 2IYIA 4WP3A 5L38A 4ZHRA 4DL7A 4N56A 2A10A 4C98A 4ZN3A 4ZN1A 4WFXA 2FYXA 4CLFA 1FEEA 2YWWA 4DSFA 3ILLA 1O8BA 4C0HA 1H72C 1QJHA 2CA9A 2CJAA 2MLZA 3OR2A 2FC8A 3NWGA 2IVYA 5ITHA 1WSVA 2D74B 1RUSA 3C6UB 5LSOA 1U49A 1VLYA 3CT9A 1WTFA 1G7CB 4LRAA 4AYBD 4A8OA 1OWXA 1O51A 3OHBA 3SCLE 3V4MA 1MN9A 4YY3F 3JYTB 4RW4B 4DR6J 3R5DA 1KS2A 2N82B 1HW9A 2HQIA 4XDCA 1BQMB 4C48A 3HXMA 3Q2TC 4MH8A 3ENAA 4C4WA 2HVIA 3TA0A 4X4OA 2JFKA 1S4FA 4DL5A 4U6PA 5E0OA 4UOHA 2Y1LB 3VALA 4I1TA 4WFNQ 4EZ6A 2ZJPQ 1VHIA 1JJHA 2UXDJ 3H5UA 3V6JA 1UL3A 3HSGA 4NCGA 3P4UB 4DR7J 1SC6A 1R7IA 4Y00A 3G71S 2KTQA 2FJXA 2C3OA 1MROB 1FK9B 4B3MJ 4CYUA 3I55S 5A0YB 2GIQA 2C3MA 5H9EJ 2DRDA 3A3OB 4E2FB 4UY85 2R9LA 2CKWA 2RDDA 1Y0HA 4J5OA 2CPXA 3EPGA 3PRBA 3KG0A 2ZDOA 3PHEA 1DQAA 2DHXA 5FDLB 4PPZA 2MZ1A 1RYRA 1VRTB 4GVBB 3PIPQ 2XO7A 2RJZA 2KM8B 3UD3P 4F4ZA 4U9RA 5FLXY 1TKZB 2VH7A 4C8ZA 4A8MP 2OPPA 1IQZA 2E7VA 2AU0A 4JI1F 3OL6A 4MK7A 4LSLB 1S6UA 3KK2A 1VMBA 4WP9A 1A9NB 3QRQA 1C4CA 3BYRA 2PC6A 2KU7A 3CJKA 1REGX 1VBYA 1N32J 1VRUB 3M7VA 3JSMB 4QBUA 4WFYA 2ATCB 2VKRA 2VBZA 1FD8A 3RW7A 4ES3A 5DLFA 1HBUB 4M5HA 5JXSA 2F4FA 2C2EA 4ZVPB 2JSXA 2JFDA 1Q7LB 1BQNB 1RTZA 1WI6A 2QLXA 1F9EB 4DR3J 1FDDA 2G1DA 3ZC4A 1H2TZ 1R3NA 1V5IB 4NEYA 4JI0J 5KFAA 1S9EA 2XWXA 1SQEA 2IDEA 4DV4J 3OV7A 1FDNA 2Y1RI 2UUAJ 1VIOA 2MEWA 1TKXA 2AIRB 1MU2A 4M5IA 2K8GA 1BD6A 1ZA1B 4DR2F 3CD5A 1JLFB 1WHWA 3HSZA 2HAFA 2HIQA 2B8QA 5EHHA 2C2OB 2O67A 3W8PA 2M3DA 4NLVA 5A6WA 2R7WA 4PG8A 3KXDA 2PMWA 2HHQA 4U7UK 1RAIB 3IXQA 1RT6B 2P9EA 3VQSA 1UW4A 4QIGA 5CZXA 1G1XA 1KN6A 3T1YJ 4FYVB 2HRYA 4Y34A 3C14A 5D15A 3NNAA 4USVA 1YKWA 3FBCA 4F50A 2CQ2A 1HQUB 1AB8A 2DR5A 3G82B 1RTIA 1FI4A 2N4CA 3SFGA 1DLOB 4BS2A 5IT4A 1Z2LA 3M1VB 1CG2A 1WG5A 1IKYA 2CQ4A 4PXDA 1HHTP 2VG6B 4OQJA 1ZZFA 3MMCB 4TXSA 1RKJA 2BBEA 4USIA 2HQCA 3FDSA 3AH6A 4DOZA 5C24B 5E3CA 1WKJA 1RK8A 2QIFA 3EUNA 3NOCA 3W8GA 2VZ9A 4KHPF 2XMUA 1VBXA 1S1VB 2DEIA 3L9ZA 3A3NB 1N56A 4KV8A 3KK1B 5KT3A 2R2UA 5B0DA 5KFKA 2XLKA 2MY7A 5D0GA 1U1LA 5HMYA 4ZMMA 1YJ9S 4N7TA 1NDKA 2HS0A 2VG5B 3WBZA 4NLXA 1UJ4A 3TEHB 2BM1A 5HLFA 1RTDB 2CQ3A 3M30B 3W9JA 5KFEA 4PG7A 4RUCA 1S1XA 2CZ4A 2Y0SD 4HYKA 4ZCKA 1CS4A 4Q43A 2OH2A 3FVYA 1VQ6S 1E6YB 5KFOA 4P7VA 2DY9A 2B56A 1PAUB 1P1TA 3KUGA 5HANA 2M8HA 4CO1A 2QJ3A 4DFPA 3MUVP 5E3RA 4DQSA 1YK9A 1IKWB 4DV1F 2QO3A 2X1BA 3TJAA 1FD2A 2CPIA 1NJYA 1RHRB 4DSEA 5J1NA 4MFBB 4CRJA 4IFYA 3N5FA 3IRXB 3H5XA 3VAGA 4DL6A 3TJ9A 1SC1B 1VBKA 5GAEI 1RTHA 2BANA 4F2RA 3TQ1A 3R7BB 2C2DA 1HNZF 2OKQA 4PWDA 3AJDA 5A8RA 3PJWA 4M5GA 2VPZB 4TYAA 1RQ0A 2R42A 5DM7Q 1KOHA 3M6WA 1OSDA 3G86A 3TO8A 4O0NA 1MNEA 3MMAA 1EETA 2WVCA 1S0OA 4RR5A 4DU7A 2LEBA 2XY5A 3PYDA 3CW2C 4UT4A 2K7KA 3KLGB 5J2QA 3CXCR 2MQMA 2G13A 2RDJA 2YX7A 3CD6S 3TNVA 1FRJA 1AZSA 1S1UB 4MKAA 1HNVA 3JB9k 2ZC3A 4FVMA 3UWTA 3PX4A 2OPSB 1WHXA 5BYRA 1QVGR 2FQQB 2H4WB 3ILOA 4NLRA 4I4BA 1HWLA 1R6VA 4JV5F 3MEDB 2ZH3A 2DCUB 4PG6A 4KO0A 4NZ6A 1QAYA 2FTRA 4B9VA 2EI5A 4JV0A 3VAHA 3IP0A 5D4NA 2ZOGA 3DRRA 5HBMA 2VG7A 3T1HJ 4PQUB 2LP4A 4WKRA 2HWHA 3QSYB 1TZ0A 3G87A 1SL0A 4DUZF 1FRKA 3UVJA 3W1YC 3G8QA 3BQ2A 2RQ4A 1U8SA 3DRYA 2WRMA 1WWHA 4Z7CA 2CQBA 4C8NA 2B5JB 4M5KA 2BJ9A 2Q6CA 4HACA 4HDGA 3ZZRA 4NASA 2DNKA 2HQ3A 2D41A 1XNQF 1OPIA 4B02A 2W24A 4QIVA 3R1LA 2DH8A 2VBWA 3GG1A 2ILZA 1JXEA 3HO1A 4RW9B 1YQHA 1H2VZ 1XR6A 4CT9A 5LOQA 1U2CA 3A8IA 5I42A 2ROGA 2YNFB 1HWKA 4TLQA 2W4DA 1N6QB 1F3VA 2VB6A 2BJEA 3DM2A 3DXSX 1U24A 3A4TA 2VOPA 2HEKA 3NOGA 4USWA 1PBUA 2BA9A 2OMLA 2DH7A 4JI5F 3R7SB 3CDBA 3M8ZA 4TLRA 4ED3A 3AAWB 4NE9C 2QA2A 4QYZK 3VAFA 1BLUA 2ZH2A 2O1PA 1X4EA 1FJ7A 3P5BP 2K1RB 5L39A 2CQ0A 4NZ7A 4J90A 4LF5F 2XC9A 2V2KA 2ZUAA 3HSDA 2M88A 2VD3A 1GK8A 2KJWA 2XSFA 1U8WA 6AT1B 2ZVIA 5CHCB 1HA1A 4DFKA 4JI2F 1VQMS 3MM9A 4O3QA 4ETXA 3OTCA 2GMJA 1VOMA 5KFPA 1RAFB 4IQMA 4A8XA 4I69A 5IS2A 1SV5B 3AOCA 5JMNA 3HHKA 2VIHA 2APOA 1ZTTA 1FKOB 1KSPA 4X65F 4O3SA 2JLEA 3UCZP 3GR1A 2ZH1A 3LP0B 4DLGA 2YQ1A 4K4WA 3P3DA 3BO4A 2B4PA 1LW0A 1HWUA 3CMQA 1RT3B 3BPDA 1YJVA 1DBDA 2COLA 4L3KA 3UNGC 4A8QA 2EFGA 4JYAF 3SYZA 2ZNZA 1WG1A 5DG7A 5BYQA 4IG0B 3IA0A 2GFFA 1CJTB 2HNDA 5C42B 3ZZ0A 5F8MA 3LOUA 4CLUA 1U6FA 2DGSA 4WTOB 1UA0A 2RNEA 2EWHA 3ZZZA 1GT8A 2KVQE 4GVLA 4KB7A 5DM6Q 4NLGA 2VFVA 1QSLA 2UXBF 2WB1D 4R5PA 5KFFA 3SV4A 2DGXA 2QG9B 4R25A 2H5IB 2I2YA 4UOCA 5A8WB 4RPFA 4KGZB 4DX8H 1IBKF 1HBOB 4Q44A 3OJSA 1IKVB 4DR1J 5F8IA 1K1SA 4Y2CA 3T1AA 1KWMA 2LYVA 3BEGB 1LEOA 1J5EF 1Q4RA 3AQPA 1FVSA 3V4IB 1S57A 3U1LA 4HKQA 2ZE2B 4AQYF 1EAYC 5SZTA 2MB0B 4H54A 1Y10A 5DG8A 4F4KA 2EBGA 2V4QA 1MWQA 1PJ5A 5AE2A 3X1LB 3OR1B 3D6HB 4ICLB 2X7IA 4IH7A 4HI2A 4EK2A 3D28A 5EN1A 1ZS6A 1EP4A 1XK8A 1XMQF 1FT8A 3BQ1A 5KOXA 2VFSA 1X5TA 3OVAA 1NJIT 1ZM3A 1TL3B 3BZQA 3GCWP 1Q5YA 4RUBA 3V2UC 4A8FA 4ANEA 4QCLA 1RP5A 1IXKA 3EGZA 3NNHA 3H0PA 1HD1A 1RTJB 2Z4PA 4C6AA 3PXGa 5EUHA 2HHXA 3A3PB 4HEA9 1U02A 3BSNA 3NWRA 2RRBA 2D3O1 3W9IA 2EG2A 1Y5NB 2VONA 3UDVA 1QAIA 2CJBA 4FYXB 4K4VA 4WE1A 2J0WA 4B17A 2MQ8A 3R8YA 1URNA 3IM9A 2ZBQA 5D6GA 4MIBA 1F6TA 1RT5B 3T9NA 4ECWA 1ZZNA 3IN5A 2KT3A 1O5JA 3VTIA 1JNRB 1FJCA 1HYSA 1U6ZA 2XMWA 4TNOA 1U25A 1LWFB 4KFBB 1U1OA 4KY3A 1GNKA 2M4MA 3UN5A 4U8VA 4UF4A 2LQ5A 1LQ9A 4CLPA 4AFFA 1GQEA 4WFAQ 4ANCA 2ZM6F 1P6TA 2J6TA 2ASLA 2Z2ZA 1RHUB 2EFVA 5HVFA 4B3MF 4IRCA 2GVDA 4QJVA 3IAM9 1BE4A 3BYPA 3DXBA 2QA1A 1ZH5A 2XMJA 3KLHA 3US5A 4DN0A 2G2ZA 4I7FB 2HHHJ 1HARA 3D0IE 1TAQA 4ILRA 2RKIA 1N34J 4F8RA 4B3SJ 3R5BA 3HM9A 3BGRB 3Q23A 4RW8B 4IR1A 1FA0A 4DV6J 3DGPB 3DYAA 3IG1A 1H74A 4WYWA 4RW7B 3V6DA 2PI4A 5K8NA 4LQ3A 2P6SA 4MKBA 3S8SA 5T7LA 4MYTA 2BX6A 4EU0A 3CIMA 2DR6A 1TL5A 2FB0A 4ZVEA 2ZH7A 1CJUA 4F7VA 2PEBA 2IRXA 2EG1A 3GZ7A 3CMES 4ANDA 3D67A 2X1FA 3KTQA 1NSKL 1BXNA 3HVTB 3CPWR 1U45A 4NYOA 5HROA 3HHEA 4GKKJ 1FWPA 1CBKA 1NDLA 1R8CA 2RU9A 4NPOA 1YSJA 3CCZA 4OYMA 2J8AA 3W60A 4MIWA 5B0EA 1X9SA 3U1NA 1VDHA 5KT5A 1TUWA 5RUBA 4QR2A 3M32B 2RILA 4DV4F 2CDQA 3NY0A 3I0RA 1FXDA 1DY3A 4RW6B 4LF7F 1IR2A 3QJLA 4QYRA 1R8PA 1NH8A 4URSA 3EGNA 1GX5A 2CJQA 3ITHA 2FGCA 1KEKA 2G9OA 3ZZYA 2HZCA 3TVZA 4PXEA 2YWFA 2OPQA 4RLEA 1P8GA 5A2QY 1DURA 2N7CA 1VR6A 2AP6A 4DPUA 4ZVRB 1M5HA 2BE2B 2P6TA 4J9PA 3GONA 2EC2A 3OLBA 4YP3A 3ZTRA 1IVZA 2C2ZB 1HL6A 1N33J 3C6TB 2BUNA 1Q8BA 4Q8EA 3M2VB 2BKPA 2O66A 4MK8A 3CTRA 2YPZA 1WDDA 1SJQA 2B3TB 3IAS9 2XLIA 3KJVA 4PCQA 5KFNA 3RBZA 2DNLA 1RI7A 3R6LB 1N5TA 1YWXA 2ASDA 3PKMA 3AXKA 1T03A 2DO0A 4XDDA 3CULA 3KJFB 3R27A 3EX7B 2DHSA 1S6PA 4B3TJ 1FJEB 1GXLA 2DIUA 1K73T 1S7IA 3FFIB 5F8GA 3W2WA 3W2VB 3M8WA 1RISA 1JX4A 2PEHA 2NPFA 2X1GA 3PW5A 3QGHA 4USTA 4IR9A 1MSWD 2RD5C 2HFZA 1FFSB 3Q8SB 3QO9A 2RQMA 1MG7A 4Q45A 3NRBA 1OO0B 4OX9F 3MF5A 5CA5A 3CJTA 3ISNC 5KG3A 3M2UA 2YNGB 4C3KA 1U1QA 5CYJA 2K3KA 5A8KB 2K7JA 2XSJA 3HHLA 3FKBA 3HHNB 1Y9OA 3RR8A 2DGVA 3CCQS 3LANA 1CJKB 2FGOA 4YQWA 4QQBA 2UZAA 4KHMA 3MFHA 4MKVA 4ZKAA 4DPYA 1UETA 1VC6A 3GSIA 3Q86A 1JB0C 2GV1A 4LF8J 1C4AA 2F4VF 1SKRA 1J2VA 3FCWA 2BQRA 2MXYA 3B54A 4J9NA 2HYIB 3MURP 4XK8C 1RBOB 2H4YB 4HHUA 3H90A 2GJ2A 4X84A 3G6VA 4K2XA 3JAMU 2C3UA 3KDNA 2KG0A 3R5AA 2E7WA 3CCVS 1D1UA 2DGUA 4CTAA 2A3JA 3GG0A 4LFBJ 3AD7C 1RU2A 1RJJA 2KDOA 4DR5J 4KGMA 1YJRA 2ROEA 4LFCF 2HNZA 3T5HA 3IS9A 3R6GB 1NJZA 2WOMB 1AUSL 2PMHA 4DF8A 4HTIA 4P9SA 2ADBA 3OFEA 1JLQA 4OHZA 2ADCA 2FY8A 1TL1A 4ZP8A 1Q95G 4M8LA 4DFMA 2QZ8A 3M9OB 2D7SA 3G8SA 2HLTA 2WONB 4ZP6A 1TVRB 4I2PB 2LFVA 3T9ZA 3TUIC 3I5CA 2GHPA 4N5SA 1JLEA 4IG3B 2VQEF 2QT7A 3OJUA 2F8HA 1U47A 5AE3A 4CLZA 3PEJA 2VC0A 2QYGA 4NLDA 2F63A 3NXZA 1SIWB 2IVMA 1CQMA 4DV0F 3QGGA 3ILIA 1WELA 2HLUA 5I3PA 2VODA 1IUJA 5J1EB 3TP2A 4K2JA 3CJ5A 4K4UA 1AT1B 1Q78A 4M5DA 4RX6A 1OS5A 3TRGA 3JTOA 1IQTA 3FQLA 2OEJA 3CDEA 3O8WA 2JEGA 1V3SA 2AJ4A 4JI4J
chains in the Genus database with same CATH topology
4AL7A 1CPZA 4AYBD 4A8OA 3OSNA 1OWXA 1O51A 3OHBA 3SCLE 3V4MA 3C3LA 1REVB 3PACA 3KG4A 1HD0A 4OZNA 4YY3F 3JYTB 2CVEA 4NXNF 3CCWA 4RW4B 3T6JA 4DDFA 3HVTA 4JV1A 3R5DA 1FTCA 3EYZA 4DL3A 2IMOA 4RBVA 2UVRA 1KS2A 1Z2ZA 3JAMY 2N82B 2FHMA 2RRAA 2JVRA 1E6VA 4I67A 1HW9A 2ZJQQ 3MMAB 1EETB 4LIRA 1U26A 4WU3A 2HQIA 3GFHA 4XDCA 1BQMB 3H2LA 3LQVA 3UW1A 1S99A 3C8YA 3PO4A 3HXMA 4OV1A 3OR2B 2IM1A 3Q2TC 1L3UA 5J2QB 4MH8A 3SCIE 1FK9A 4C4WA 2HVIA 4NXMF 5IT0A 2V8GA 1DRZA 3TA0A 1S6QA 4AXJA 4X4OA 3AY0A 5EWFA 5A0YA 2GQ2A 2JFKA 1S4FA 4DL5A 3DMJA 4U6PA 3SFUA 1Y7PA 5E0OA 4NYZA 2C22A 2XHWA 3VALA 4I1TA 3TAMB 1S10A 2IA6A 4WFNQ 5E41A 2DNMA 4ELTA 4EZ6A 2ZJPQ 4XPEA 4BBYA 1CC8A 5K14A 3E3XA 1UVIA 4LF4F 1UKUA 5E2QA 1JJHA 3H5UA 3S1TA 3MEEA 3V6JA 3CSKA 1UL3A 3RU0A 3RB3A 1HNIB 4RW6A 1Y3JA 4NCGA 2ZUGA 4ECSA 3RRHA 1ZPVA 3KK3A 1WEYA 2DR7A 5KFVA 1SC6A 1VRTA 1XTZA 4EBCA 2XI2A 1R7IA 4Y00A 3V6HA 1SJ1A 1S1TA 1WEZA 2R8HA 3GIKA 4GC6A 3N0VA 4QZVB 3G71S 4KO0B 1E6VB 3TARA 2AX1A 5KG1A 2NYIA 1X9WA 1JJ2R 2V0NA 4RU2A 3ZZTA 4F3MA 1QM9A 2DNRA 1QSSA 1D8YA 2KTQA 2FJXA 5KOWA 2C3OA 4ZPAA 3DRSA 1MROB 2YNIA 1IKXA 5HBMB 1FK9B 4ETZA 5LMUF 1JLCB 1LXNA 1H6KX 3DOMA 2DHAA 4I64A 3I55S 1S6QB 3MXHP 5HMZA 5A0YB 4ZPWR 4DV5F 2GIQA 2RVJA 1XMBA 2C3MA 2OPRB 5H9EJ 1N33F 2LQBA 3VAMA 2AGOA 4LSLA 3MZIA 4F4WA 4UY85 2R9LA 4HT7A 4G3IA 2CKWA 3OLAA 2IRUA 1HI0P 4ED6A 4KKOB 1Y0HA 4J5OA 1X4FA 4F26A 2XZWA 2OAUA 4C8YA 2CPXA 2BE2A 3QIDA 3EPGA 5CYMB 5K14B 5HMWA 4X66F 3T19A 4YMEA 4OI6A 3PRBA 2UUWA 2R2RA 4IQXA 3KG0A 1B7FA 2ZDOA 3PHEA 5CQGA 1DQAA 4EZ9A 2DHXA 3MECB 4ATNA 2BV3A 5FDLB 2RF2A 4KJIA 4NCGB 1T94A 3GFZA 2HHPA 1JLAA 1VRUA 2W4CA 3PW0A 2XLJA 2BZ2A 3KK3B 1DTQA 4XO0A 4PPZA 2MZ1A 2B9XA 1W2IA 3K5OA 3QAUA 2XGQA 1RYRA 1VRTB 2F7VA 3PIPQ 2XO7A 3C6TA 1S1TB 4G1IA 2RJZA 2HGLA 2KM8B 4ECTA 4QWEA 4RWWA 4F4ZA 3UD3P 5KG4A 4OIXA 4U9RA 5FLXY 2UUCF 1TKZB 2BRKA 2VH7A 4C8ZA 2NSBA 4YB7A 4Y65A 1SJFA 4A8MP 2OPPA 5LSLA 2DHGA 2R8IA 2NPIA 3OL8A 2ZBCA 1IQZA 5F9NA 2YNIB 1IKXB 3LF0A 4JI8F 2B6AA 3H98A 2CPFA 3WDOA 2XY7A 2AU0A 5B7WA 4JI1F 5C5JA 1WG4A 3OL6A 5K8PA 4LFAF 1JMTA 4MK7A 4LSLB 4WYLA 1S6UA 3KK2A 4JV2A 1VMBA 4ECQA 1JKHA 2NXUA 1K9MT 2B0GA 2LDYA 1SL1A 1A9NB 1C4CA 1JK9B 4NLSA 1V3RA 2PC6A 2KU7A 1CSJA 2CIMA 3DM2B 3HZEA 2NS1B 3CJKA 3TYTA 1X4HA 2DRBA 1JLFA 2KKHA 2LA6A 2RF2B 2DNYA 3CF5Q 3IWLA 4J9QA 1HQEA 1X5PA 3AA8A 4QWDA 2W8LA 1JLAB 1VBYA 3DOKA 1VRUB 1RT1B 1VHFA 3JSMB 2R8JA 3CDUA 2E29A 3FGVA 4QBUA 1DTQB 4I56A 4ECXA 4WFYA 3IGVA 2QSFA 2VKRA 4NCBA 2JWNA 2VBZA 3LAMA 3MPWA 3SQGA 1FD8A 3PM9A 3RW7A 3MM5A 4DG1B 1N0VC 4ES3A 5DLFA 5IT9Y 3FFIA 1HBUB 5L1IA 5JXSA 4QIEA 2UXCF 3L7OA 2C2EA 3DLEA 2OLWA 4YB1P 2JSXA 3UQSA 3SDEB 3VF0B 2JFDA 1Q7LB 3HVWA 2ASYA 1VQ4S 2D9PA 1BQNB 1WI6A 2JRSA 3IFEA 1NAQA 4ITSA 2FVPA 2QLXA 2ASJA 3BR9A 3CDAA 5JUMA 1FDDA 2G1DA 1XERA 3ZC4A 4K4SA 1H2TZ 1R3NA 3OHAA 4ZCMA 5KFAA 5J2MB 2P9CA 4LVOP 1RDRA 1B0VA 2IVFB 1FDAA 3RR7A 2G0CA 1S9EA 2XWXA 3RB4A 2UV8A 3H5SA 1SQEA 4OZ0A 3IBWA 3L7PA 1ZETA 2IAJA 2DITA 4D3GA 1AFIA 3M8PA 3H8YA 3KK2B 5EWGA 3OV7A 1FDNA 2Y1RI 3AB4B 2IBOA 1VIOA 4NOHA 5B0AA 2Z2MA 1JKHB 2FHKA 3E8OA 3FJ2A 1OPZA 1TKXA 1MU2A 3WC2A 2K8GA 3B78A 2F9DA 2MSSA 1BD6A 4DR2F 1K8AT 3N28A 2ZNYA 2DGQA 3CJKB 2KXNB 3EXYA 5HN0A 2JLGA 4X4RA 3CD5A 1JLFB 2DR9A 3H25A 5KFQA 1WHWA 5A8KA 1HQEB 1O0PA 3PIOQ 4EBDA 3TUJC 1RGVA 2HIQA 5LJ3Y 5EHHA 1XR7A 2O67A 3CCUS 4IH5A 1DLOA 1YVFA 2B9YA 2M3DA 3K7RA 4NLVA 5A6WA 4C2MA 2R7WA 4LF8F 4PG8A 5DQGA 3SQGB 3NAHA 1FJGF 4D3HA 3MM5B 5BYSA 2E1AA 4CIOA 2VA2A 3KLFB 2DGWA 2HHQA 3L3CA 2VG6A 4U7UK 3MM9B 2RS8A 2UVWA 3IXQA 1DAXA 2CVIA 2R8GA 2L9DA 1A6LA 1RT6B 3CVKA 5L9XA 4IH6A 3BSAA 4A48A 4QR1A 2W9CB 2JDJA 1U6BA 2P9EA 1TKTB 1M5KC 4NLWA 3VQSA 1UW4A 4QIGA 4QPTA 3UR3C 3LP2B 1UVKA 2MZQA 1Q8IA 3OQ2A 5CZXA 1G1XA 6FD1A 4YR2A 1KN6A 2J6UA 1SH0A 1NHVA 4GO5X 1R0AA 2HRYA 3VWSA 4B9LA 4Y34A 3M8PB 4ED5A 1KLNA 3FEYB 3NNAA 3GIJA 1S1VA 2EW9A 3R5CA 4F50A 2CQ2A 2JHEA 1IJFB 1HQUB 1MU2B 3MM6A 4G1QA 4ZPDA 4LFBF 5KG7A 2DR5A 2L08A 4ZCLA 1RTIA 2HS4A 2UUBF 1S9GA 2N4CA 2J5AA 4M63A 4OI4A 3SFGA 3RZAA 2CJ9A 1DLOB 4BS2A 5IT4A 2J6SA 4B9NA 1Z2LA 3HI9A 2E5JA 3M1VB 1VFJA 3T3FA 1VC5A 4PUOB 2VG5A 1CG2A 4OI1A 1WG5A 4CO5A 1IKYA 1UFLA 5DJBA 5DQHA 2CQ4A 2XMTA 2XB2D 1LW0B 3MUMP 5AJ3F 2ZC4A 1RTDA 4PXDA 4LSNA 4TN2A 3KHRA 1HHTP 3NBPA 2VG6B 2B43A 2AJQA 1VI7A 4OQJA 1ZZFA 4K5RA 5F9LA 3RBDA 1HWJA 1HBNA 3MMCB 4KAIA 4TXSA 4EO6A 2EFNA 4IFVB 1RKJA 2BBEA 4USIA 2ZFHA 4AXIA 4FXWA 1A7GE 3FDSA 1N5YA 2DPJA 3A1YG 3AH6A 5KFZA 1FE4A 4FBUA 4QWCA 4JI7F 4DOZA 1FO1A 4IYQA 5C24B 1PC4A 5FIIA 5E3CA 1FDBA 1NHUA 2MJUA 1RK8A 2QIFA 4X4TA 1NK6A 3EPIA 3EUNA 4Y2KA 4C11B 1B0TA 1H98A 2KT5A 4ZCIA 1S0NA 4ZS6A 2VZ9A 4IDKB 3V5RA 1SUQA 4ZOSA 4KHPF 2XMUA 3LP1A 2NSCA 1VBXA 1S1VB 1C1BA 4QYZJ