2LA6A

Solution nmr structure of rrm domain of rna-binding protein fus from homo sapiens, northeast structural genomics consortium target hr6430a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
MGHHHHHHSHSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA-binding protein FUS
publication title Northeast Structural Genomics Consortium Target HR6430A
rcsb
source organism Homo sapiens
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2la6A01
1U1MA 3H2UB 4F02A 2WBRA 2MPUA 1B7FA 2RQCA 2XB2D 2DHXA 4WF9Q 1VBXA 2CQGA 2DHGA 5CXTA 1IQTA 2MQQA 1YI2S 2GO9A 2LMIA 2CQDA 4YOEA 4LMZA 3CCSS 2N82B 1WF0A 4WIIA 2M88A 2RRBA 4FXWA 2LQ5A 3CF5Q 2EVZA 2QA4S 1WF2A 1FO1A 5HL7Q 2AD9A 3EGZA 1OWXA 2RS2A 3VAFA 3IRWP 3S7RA 2DNNA 2E5IA 1WHWA 2JWNA 1VQLS 2M4MA 3MURP 2KU7A 2OTJS 2XS5A 2CPJA 2CQ1A 1X4EA 2AYEA 4C0OC 2MZ1A 2QEXS 2JX2A 3J7YU 3THTA 1VC5A 3B4DA 2ERRA 1VBZA 1QVFR 1KQSR 2CPEA 2I2YA 2RT3A 1FHTA 3RW7A 3P49B 2M0GB 3VF0B 3UD3P 1KD1T 2U1AA 5D78A 3SDEB 1VQ8S 3U1LA 1M1KT 2OIHA 1ZH5A 1ZZFA 2QFJA 1WG4A 2KT5A 2DNGA 3VAJA 1H6KX 1VQOS 5DM7Q 1OIAA 2KXHA 1VC0A 2B0GA 1X4BA 1DRZA 2DGXA 1DBDA 2MQNA 2K3KA 2DH7A 1M5VC 2RRAA 2ADCA 2HZCA 2MZRA 4OZ0A 2LCWA 2DNYA 2M70A 4J5OA 1M5PC 2MY8A 2DNPA 3P5TL 2D9OA 2M7SA 3R27A 2DHAA 3P3DA 3NNCA 5LJ3Y 5HO4A 3BO2A 2CQ4A 2KFYA 2ZJPQ 2BZ2A 2BOPA 2CPIA 2DGQA 2LXIA 2RQ4A 3VAMA 1FT8A 1YJNS 3VAHA 2GHPA 3NS6A 3ZZYA 3CCRS 5LXRA 2MZSA 1VQ5S 2DIUA 2F3JA 4YB1P 2OTLS 4TU8A 3VAIA 1F9FA 3NMRA 4U67Q 5CA5A 1N88A 1UP1A 1H2UX 2L41A 5GAEU 2G0CA 1VBYA 3SMZA 5FJ4A 2MSTA 5JVGQ 2E5GA 4ERDA 2CPZA 2MXYA 1WWHA 2MYFA 3MXHP 2MSSA 2MMYA 3SXLA 2DNZA 3Q2TC 1SJ3P 4TLQA 5GVQA 3JB9k 1M5KC 3CULA 4W90B 1S72S 1WHVA 2LEBA 2DGWA 2FC8A 2F9JA 4CH1A 1U6BA 1Q81T 2DITA 2CPHA 2FHOB 1YHQS 3CD6S 1WHYA 2JVRA 3FEXB 4QU7A 3UWTA 5JVHQ 3G9CA 1U1LA 4RU2A 2HGLA 4V19X 2KVIA 1K73T 1JJHA 4WCEQ 2LKZA 1SJFA 4OZ1A 3TYTA 2VOPA 2KH9A 3CC4S 3EGNA 2M9KA 3TP2A 4CH0S 3CPWR 1QVGR 3R1HA 5LSOA 3DXBA 2CPXA 1D9AA 5DDRC 3LPYA 1QM9A 3G96A 1S79A 2MKSA 1U1PA 2E5JA 1X4HA 1Q7YT 2J0QD 2XS7A 1G2EA 1XN9A 1WHXA 2HVZA 2CQ2A 3PIPQ 1NU4A 2ZJRQ 2CPYA 3NS5A 2DNMA 3MD3A 2N7CA 3BEGB 2AYBA 2KHCA 1YITS 2PE8A 1SJRA 4M5DB 2KG0A 2J8AA 2MKJA 1YIJS 2X1GA 3VAKA 4QPTA 2MJNA 4ZKAA 1JJ2R 4PR6A 1OO0B 1YTYA 3CCUS 2Q79A 3G8TA 3S8SA 1FJEB 2DNHA 1P27B 1HL6A 2M2BA 1NJIT 3VALA 5CYJA 3V4MA 2MQMA 3R1LA 2M8DB 4W92B 2LA4A 2KG1A 2CQHA 3US5A 2MQPA 4Y0FA 2XS2A 1Q82T 1RK8A 3CC7S 1FJ7A 1H2VZ 1O0PA 2CQ3A 2JVOA 2MKHA 4CQ1A 1WI6A 2U2FA 2MZTA 3K0JA 2MY7A 3CCMS 2MKKA 2XNQA 2CQIA 4BS2A 2J0SD 1DHMA 2RVJA 3G71S 2XSFA 2DB1A 2F9DA 3OW2R 2MGZB 2I38A 2MKIA 3CXCR 4WKRA 1H2TZ 1PO6A 1X4AA 2PEHA 2A3JA 5IM0B 2J76E 3CTRA 1YWXA 1M5OC 4IOCQ 2LA6A 1HA1A 2YH1A 2VONA 2KM8B 4UY8T 1FNXH 1WTBA 1PGZA 3TO8A 1N54B 2O3DA 5DDPC 3Q2SC 1CVJA 1WI8A 2DK2A 2HYIB 3CMES 4P6QA 4PRFA 1HD0A 3SDEA 3S6EA 3CC2S 1VC6A 4YUDA 1HD1A 2OSRA 2DNRA 2OSQA 2RUGA 2DGVA 2VOOA 4QU6A 1X0FA 3L3CA 2L9WA 3FEYB 3UCUP 2RU3A 3BO4A 5LJ5Y 1WEZA 2DH9A 1R8HA 2CQ0A 1VQPS 1X4CA 1KOHA 1VQMS 1P1TA 2D3OR 2X1BA 1SJ4P 1UW4A 1RKJA 1K9MT 1KOOA 5GADU 2K8GA 1WELA 5D77A 1AUDA 2FC9A 1U6FA 3UE2A 2XNRA 4A8XA 1BY9A 3MDFA 1NO8A 3LQVA 5GMKa 1K8AT 2CQBA 4F25A 5ITHA 1OPIA 2DISA 2V94A 2AYGA 3MUMP 2DHSA 4ED5A 1N8RT 2CPDA 1VQKS 2KXFA 2SXLA 2DO0A 1X5PA 1W2BR 3S01A 2DGSA 1JMTA 4LIRA 1VQNS 4F26A 2N3LA 1WF1A 4WFAQ 2G4BA 5BJRA 5DETA 1X4DA 3NNHA 3ZZZA 5IFMA 4TU9A 3ULHA 3NNAA 1R8PA 1U1OA 5IQQA 1A7GE 3HI9A 4LJMA 5LSLA 1SXLA 2VODA 3G6ES 3N9UC 2MJUA 2HGMA 2CPFA 2YWKA 2DO4A 1FXLA 1KC8T 3I55S 4Y00A 1WG5A 3J7ZT 3D2WA 3CCQS 3CCLS 3MI7X 1N52B 2LEAA 2ADBA 2EK6A 1YJ9S 2M8HA 5DDOC 1UAWA 3CCES 4Z2XA 2NZ4A 2MB0B 3U1MA 1JJ4A 2E44A 1WG1A 2KXNB 2FPHX 2DNLA 5DM6Q 4FXVA 1L3KA 1X4FA 2KI2A 1Q86T 3CUNA 2E5HA 4WFNQ 2KM8C 3I56S 2DH8A 3BO3A 2FY1A 2UP1A 3G4SS 3MD1A 3HHNB 1ZZNA 2KN4A 3MUVP 2KYXA 4TU7A 2CJKA 1YJWS 1A9NB 3RW6A 3BS9A 1WEXA 2HGNA 4QQBA 1U2FA 2LECA 2DIVA 2D9PA 2MHNA 3IWNC 3UD4P 2M52A 4CIOA 1U1KA 3CCVS 4EGLA 3UCGA 1U1QA 2ZJQQ 2DNKA 4IO9Q 2MKCA 1DZ5A 1VQ4S 3DLLQ 2EK1A 2G1DA 5DDQC 2AYMA 2KRRA 4PKDB 1SJQA 4C7QA 3B4MA 4IOAQ 1X5OA 2RS8A 2MZQA 3MUTP 3EX7B 1X5SA 4WFBQ 1U1NA 2LYVA 2JRSA 3PIOQ 1X5TA 1X4GA 2DNOA 2LXUA 5LXYA 5H1SV 2DNQA 3H2VE 3VAGA 4IUFA 2L08A 2DGTA 5EN1A 2CQPA 2RNEA 2MQLA 2DGOA 3THPA 3MOJB 2MZJA 2MGZA 3UCZP 1VQ6S 4C4WA 3CMAS 5GAHU 2OJ3A 2KRBA 5IM0A 2N3OA 1VQ7S 3P6YC 1FJCA 2YH0A 2NLWA 2YKAA 2DGUA 2MQOA 3CCJS 5GAGU 3G8SA 1WEYA 4UQTA 1UFWA 2X1FA 1U1RA 1D8ZA 2YTCA 2CQCA 1VQ9S 1URNA 5MLCV 1M90T 2X1AA
chains in the Genus database with same CATH superfamily
5C24A 2DHXA 2CDRB 3T1YF 5G4DA 2GO9A 4DSIA 3CNQP 1WF0A 4WIIA 2M88A 3QGHA 1JB0C 2YY3A 1BC6A 3K8WA 1NHKL 1WF2A 3G6YA 4M5LA 3AJ1A 3FFIA 3LGNA 4LVNP 3CDWA 2RE1A 3IRWP 3DRYA 5GMEA 4X84A 4WZQA 4ZVHA 2CPJA 5KT6A 2AYEA 4C0OC 2QE5A 1VBZA 3I0SA 3LW5C 2F4VJ 2A6MA 3W65A 1N48A 2KT5A 3I5AA 3BKTA 5DM7Q 2C28A 2ZH4A 3KK1A 4CT8A 1N6QB 3K57A 4DS5A 2MZRA 1TZ0A 4J5OA 2D9OA 2RIJA 1CJUA 4DR5F 5HO4A 3BO2A 3BSNA 3QWUA 2KFYA 1J2VA 5E41A 2MZSA 3HP6A 1LQ9A 4IFYB 1Y3JA 1WC0A 2MSSA 1DY3A 5KT5A 2VHGA 4DR6F 3PYEA 3K7RA 3BGLA 1UMJA 3QNWB 4DX8H 2QMUB 3AOBA 4CT9A 3KNAA 4ED3A 3OVBA 1FVSA 2VOPA 2WW4A 4JI5J 5B0GA 4TYBA 4WU2A 2ALYB 2IJFA 3DRRA 3T5JA 4DV5F 2HVZA 3FCVA 1NU4A 1U0SA 3QJLA 4B9SA 2KTQA 5HQ8A 2XZDB 1AFJA 4WYWA 2HG4A 3DLJA 3LF0A 4KSEB 1N36F 1H3DA 2CADA 3BGUA 3T1AA 4FP9A 2LXFA 2WVFA 5J2NB 2QG9B 2ZKTA 3KUHA 4WP3A 1FCAA 2UVWA 2J9EA 4H4KA 1MWZA 4P10A 2FHMA 3LUYA 1Y10A 2MZTA 2JOQA 5KFDA 3M2VA 3KDNA 1IBKF 3AT1B 2FHJA 2KFZA 1QSYA 3R7SB 2DVIA 3FKBA 2YH1A 2ZUAA 1MWQA 2Z58B 2K7KA 4W4MA 1XJWB 2HYIB 5C24B 4NA1A 4CCHA 2XSJA 1HD0A 2BUNA 3MR7A 7FD1A 1NDKA 2YPYA 4DUTA 5F41A 1ZAWA 2E9RX 3EVWA 2RD5C 1IQZA 2JLFA 3FFIB 4N77A 3M8YA 1Q8BA 1SJ4P 3TWZA 1HNWJ 2HFNA 4USTA 3UE2A 3I0SB 2HHWA 4LF5F 4A8WA 2CYYA 3LP0A 2GIRA 4O4GA 3KK1B 2OMOA 1G7CB 3I96A 1WUUA 2V67A 5IWAJ 1MW7A 1OJ4A 2EFVA 1RT5A 1CJUB 3T19A 3OVSA 3HI9A 5LSLA 3TQ1A 4MIAA 2I8EA 3H40A 3G6ES 3DXSX 4Y00A 2WHOA 4IG0A 4RU9A 3PY8A 1Q8IA 2FJEB 4QR0A 1HWUA 4N56A 4CO4A 2F4VF 2ZDOA 1IBMJ 3OBIA 4WP8A 1PAUB 3H5YA 4DN9A 4PQUA 1RSCA 4DBQA 2QN6B 4FNHA 4QQBA 4P71A 4NLGA 2GHWA 2M52A 3KG1A 3M8PA 4PABA 2B51A 2CG8A 1IWGA 3DLLQ 2KL8A 1UFLA 2P6TA 3B4MA 3PM9A 2UZAA 4CI0B 2DT9A 1PCAA 1Q7LB 3G6XA 4QWCA 3RBXA 2RNEA 2DGOA 2R4FA 1FD2A 3W9HA 5B0DA 3SI8A 2ZOMA 2AMCB 2GZOA 2RB7A 2V34A 5CD4A 5HMYA 1TMJA 3FSYA 2HWHA 3GFZA 2XMAA 4DL6A 1EAYC 3HO1A 3HPOA 4MKAA 3QGPA 4JI5F 2ACMA 3ICLA 3W8PA 5T7LA 3CO9A 3FBEA 2GJ2A 1TUVA 3M2VB 2EVZA 5F0UA 3J81Y 1IKVA 4QW8A 1EB0A 4OX6A 4BDPA 3JYTA 1RI7A 4JP8A 3S7RA 4LF4J 4KGKA 1X4EA 4PPDA 2XC9A 4OZLA 3BH6B 1GQEA 2J7KA 1FXDA 3ZTRA 2XSJB 2C2EA 1HYSA 1SH3A 1PBUA 1MSWD 2QFJA 4W98A 4OYBA 2ZH9A 4WZMA 3LGMA 4MKBA 3PRBA 3MPYA 1R31A 2HQGA 4RBVA 2BXJA 4E2FB 3RB6A 2DGQA 2RQ4A 2V68A 3WC0A 3SZ2A 3G87A 4R0JA 3HKWA 4DUZJ 3LP0B 1LWCA 2QLFB 3GG1A 4O4GB 2NXJA 2MSTA 1IR1A 3SBMA 3Q8VA 2VG5A 3MXHP 3D7SB 2HFUA 2DNZA 3JSBA 1SJ3P 4DPYA 4W90B 1DTQB 2DGWA 1RT5B 2F8MA 3MECA 1RAJA 5E33A 1WHYA 2GW8A 2AX0A 2HGLA 4V19X 1FNMA 5ETLA 1V9OA 2A6OA 1HNWF 4IG0B 2HFOA 4ILMA 3CGIA 2GVZB 2VDHA 4FKYA 1ZAXA 2UUTA 3J7AN 1NJYA 4KHPJ 2AZ3A 3QSYB 4PQUB 5J1PA 2R7XA 5H9FK 4RLEA 4CDIA 3FSXA 3PEJA 4TY9A 2J9DE 5IWAF 4X64J 4O3QA 2V4JB 3M8PB 2VBXA 5GMDA 4MFBA 1P27B 1D9FA 2N7YA 3MFHA 4JOUA 4Y0FA 4HT5A 1B3TA 3ILJA 4OI3A 1GMVA 1RK8A 2MKHA 4CQ1A 2U2FA 2HVDA 1YGYA 1ULRA 1IBMF 3R5JB 2F63A 3BSOA 1HMVA 3FC9A 4A8KA 4FKXA 3S1TA 4K4VA 2QSFA 1UPMB 1BWEA 3HVTA 1IJEB 2XZTB 2O3DA 3M2RA 3BR8A 3Q2SC 4M5NA 3DLEA 3V2UC 4K5SA 4HR2A 1A6LA 2LVWA 1HBNA 4RL1A 5KOXA 5T7LB 1IKVB 2GMLA 3JYTB 1U4BA 2PMWA 1KTQA 1RXOB 2Y9HA 1X8DA 2FGCA 2Q43A 4X4PA 2CIMA 3MZIA 4P2XA 1Y5NB 1EQMA 2IVFB 4NEZA 4RNFA 1DAXA 5GMKa 1MROA 2V94A 1HYSB 5KG1A 3H5SA 4DFJA 3B6BA 4Q43A 1SIZA 4F8RA 1GT8A 2IMOA 2D41A 4CO1A 1PKUA 1GXLA 3MR2A 2Z2MA 1UKUA 2PMZD 3H4BA 5KFNA 1AZSA 5F0WA 4QWBA 3DLKA 1TL1A 1H7WA 1KC8T 4CLKA 3CCLS 4DWIA 2OKQA 1QUVA 3MI7X 1LWCB 4LF4F 1Q16B 3BSCA 2WVDA 3BYRA 2MB0B 1CLFA 1S6UA 4NLUA 2VG5B 1SKWA 4ECYA 1V5VA 2YKQA 3CUNA 3PKMA 3N28A 1GTEA 3LOUA 1RU1A 3MECB 3MUVP 2XTJP 1Q4RA 2ZBPA 2KYXA 1PIEA 3EVMA 4TU7A 1S0MA 4M5IA 2HS3A 2MHNA 4PWWA 3IR6B 5B0EA 2V2QA 1RT3A 4FBTA 1E6VB 3T9NA 2KRRA 2J9CA 4PKDB 4DUZF 1NDLA 2C2NA 2YXLA 2IFXA 1X5TA 2IYIA 2H48B 1PJ5A 1ZPWX 3GFYA 2AHOB 1NSAA 4AT1B 1HFEL 4C8OA 1JLFA 4O23A 2Y0SD 4EYHB 2OO4A 1VQ6S 4C4WA 1UVKA 2CJ9A 2P9GA 3MM5A 2BKNA 1VQ7S 2NCKL 1KSPA 2YKAA 4OJ3A 1WEYA 2O01C 2IBKA 2KT2A 4Z7CA 4F50A 1SC1B 1FF2A 3W60A 1RABB 1I3OB 3UN5A 1XIQA 4OX7A 3M8ZA 3WX4A 2MLXA 1HMVB 5IOLA 4KHPF 1KRPA 2OD6A 2G0IA 3M6UA 3KLEA 2V8GA 3Q89A 2QEXS 3THTA 3HVTB 3M2RB 3DLEB 3ENVA 4X64F 3O2IA 1FHTA 3JTNA 1K0TA 3VF0B 2E7WA 3AB2B 4G3IA 5HMXA 4P72A 4U9RA 3VAJA 2DNGA 1OIAA 1VQYA 7AT1B 3M4XA 1VBKA 2DH7A 4B9UA 4ZPAA 2V5HG 4AE5A 2UXDF 2LCWA 1B0TA 2M7SA 1FKOA 3KHGA 3NCRA 2AT1B 3TVZA 1MROB 3GV5B 4B3SJ 1D3WA 1RAAB 4PZVA 1U02A 4B3MJ 3GFXA 1ZA2B 5FJ4A 2LLZA 4AQYJ 2HMIB 2W2OP 3JB9k 3AFGA 1QE1A 3F41A 1AZSB 1YBTA 1U6BA 3DLKB 4BBYA 1TL1B 2CPHA 3AXKA 4TQSA 4UOCA 3HFKA 1X9SA 1XTZA 2G2ZA 5HK4A 3ZNJ1 3PW4A 3R2CJ 4BC7A 2F8EX 4B02A 1SQEA 2V2KA 2PFDA 1QM9A 1EKRA 4OI2A 2NXNA 3OHBA 3FGVA 1WKLA 1OY6A 1YITS 2NPIA 1KNZA 2X1GA 4K5RA 4KH1B 2MJNA 2RH3A 2ALZA 4PR6A 1YTYA 1KHVA 1RT3B 2L9NA 4ZMMA 2DNHA 1NK4A 2M2BA 1SKRA 2FVRA 4NLWA 5ETNA 1Q53A 2V6AA 1N5VA 4M5GA 2XM3A 4WBFA 3K5PA 3OL8A 3HVAA 5ETSA 2MKKA 2BR0A 1JLFB 1GTHA 2KJVA 3R2DJ 2HEKA 3MM5B 2W2QP 4C3KA 3IFEA 1M5OC 1XNRJ 4OYIA 1NB7A 1PGZA 3TUIC 4DL0C 1JNRB 4PRFA 2G9OA 4X4SA 3SDEA 1D0EA 1Q5YA 2OSRA 4YP3A 3FCHA 3GILA 4BHQA 5L38A 5F9LA 3FEYB 3TANA 1CS4A 5SZTA 4CLYA 5LJ5Y 4N41A 3TJ8A 3KLEB 1YJTA 5D77A 2VQEJ 2F4FA 3IN5A 2LQ8A 4QYRA 3HX9A 3JSMA 4B08A 1ZS6A 2YWWA 3T6JA 1BQNA 4G6VB 2NREA 1FRXA 1FRIA 4B9LA 2IJRA 3S01A 1RT6A 4ID5A 2CJAA 1U26A 3UDCA 1Z4UA 4J9KA 1RHJB 2G1HA 5KFWA 2XQCA 4LSNA 4E98A 1FKOB 2LDYA 4NOHA 4ANEA 5KG6A 2R7OA 2ASJA 6FD1A 2IRYA 3A8IA 1T95A 1B0VA 1AROP 1RWOB 2NSBA 5K8NA 1ZOTA 1WG1A 3D1QA 1QE1B 3CD7A 2FY1A 1SBRA 5A6WA 1NSKL 1S4EA 3KNGA 3HFVA 1KDNA 1GX6A 2IYGA 1HWLA 3IWNC 3V81B 3QJPA 4IH5A 3GYGA 1J5EF 1P8GA 3QT8A 2BABA 3LAMA 1T03A 3FUYA 2QX0A 4B3SF 1X5OA 4Z37A 2CNLB 1X5SA 4QBUA 4JYAJ 4B3MF 2JRSA 5KFVA 3PIOQ 2W2MP 4AQYF 3TQEA 4IUFA 2YWFA 3HHEA 3FQLA 4DSJA 2YWEA 4CRJA 5KFCA 4U6PA 4FBUA 1W7WA 5D4LA 2N3OA 3P6YC 1YRUA 4DV6J 4JV1A 4ZPCA 2YTCA 2RHSB 2HLUA 2VBYA 1QAIA 1URNA 2DY9A 2H1YA 2X1AA 4WF9Q 3ISZA 3K5LA 3G6VA 5HJXA 1IQTA 2EI5A 1MWYA 4DSEA 3OVAA 1SC4B 2JFDA 2CAJA 2GMJA 3CJ2A 2DNNA 1V3RA 3MURP 1TK0A 3PX4A 2JX2A 3MGJA 2HHTA 3DHWC 4JV5J 3SDEB 1C2PA 1XEZA 2W9BA 1MU2A 1TU0B 1FFSB 3PTWA 4TY8A 4OYZA 1R8AA 2B0GA 4K4SA 3HKZD 3FSIA 1CS4B 4ETXA 2UUAJ 2MLZA 1EX8A 4OZ0A 4JV0A 5SUHA 3F44A 1HI8A 3M8QA 3JSRA 4PAAA 1PYTA 3QAUA 2CPIA 1U0HA 4OZ2A 3JSMB 2BE7D 1FDBA 3NMRA 4KHRA 1XNRF 1BQNB 4DPXA 2FLLA 4E0DA 1XWLA 1SH2A 1RT6B 4IQXA 2AJ2A 4DXLA 4PG8A 2MKYA 2AGPA 1S5ZA 1BE4A 1X60A 4QU7A 1K73T 3ADAC 2KH9A 2NXCA 5HANA 2VQEF 1RAIB 3ZZTA 4R0EA 4OYMA 3HVWA 3RU0A 1S79A 3SSSA 1T9YA 3VGUA 1OQ3A 4ZLJA 4DPUA 3DHXA 2PE8A 4A4JA 4OFZA 1YIJS 1TKDA 5KT7A 1JNZB 1TKTA 4OV6A 3CCUS 3S8SA 1UA0A 2CNNB 4MK9A 5DQHA 3PV8A 4TLRA 2CQHA 1F60B 2PI5A 3CIZA 4F4ZA 1H2VZ 1N33J 4ECZA 4L74A 3GIIA 4EBDA 2XSFA 4G1IA 3WHIA 1HBMB 1PO6A 3SV3A 4FVMA 2BM0A 1YWXA 3VQTA 3ENQA 1FNXH 1WTBA 1ZAVA 4LR7A 1I1GA 1YSJA 3O1LA 2DK2A 4M1KA 3CC2S 2NQPA 3LP2A 3EUNA 1R8HA 2CQ0A 4JYAF 4JI7J 5EUHA 3H20A 4WPAA 1RAFB 1RKJA 3QGIA 2BEFA 2MTLA 2XO7A 4QZVB 4HT7A 4NRTA 2DCLA 2YPZA 1K8AT 3O3LA 5F8GA 2P8IA 1YRXA 4DV6F 2MQ8A 3DFEA 2W9BB 1MU2B 4P2SA 2LDIA 4TY8B 1KLMA 3M05A 1RBAA 1D8YA 1X5PA 2VV5A 5A0YA 3QWPA 4FPIA 2ZEJA 1U8WA 2A2DA 5EDWA 3BQ1A 4KO0A 1SQGA 1JLCA 3M9NB 1TL5A 3ZZPA 3J80Y 1QJHA 2LQBA 5AE1A 5IFMA 3W1YC 3H5UA 3UFCX 4AFFA 5D0RA 3D0GE 1U0HB 5CQGA 2BE9B 4C3MA 2YWKA 2ZVIA 2VFVA 4OHXA 1WG5A 2GIFA 2ADBA 1CQNA 4ECSA 1S99A 3CCES 1NB2A 1F3FA 1K1QA 4UY85 2FD2A 1WC4A 4A46A 4JV5F 2RDDA 2CJBA 3OUYA 2DXFA 1Q78A 4ED8A 3HF5A 3IGNA 1RT4A 3R8YA 1A9NB 2UUAF 2NUUG 1U2FA 4F0HA 4CIOA 3CCVS 4H4MA 2WSFC 2UXCJ 2PEBA 4RUHA 4X4UA 4WK3A 1VRUA 4M63A 5M2PA 4EZ6A 1SV5A 4Y34A 4Y2CA 1NXIA 2BMBA 4OHYA 4L6V3 1H72C 5LSRA 3W63A 3ETMA 1UEUA 5GAGU 2B4OA 3I0RA 3EXCX 4RZRA 3NBPA 1QDUB 3PX6A 1RYRA 2MPUA 5GAHI 1GK8A 2DD8S 5IQ6A 1RTZA 2VL1A 3GJQB 2V8PA 4PYAA 2F8HA 4NCGA 4B17A 3HHDA 3PFEA 4CO5A 3UPFA 2EC2A 2BKPA 3JSYA 4Z7YA 4DQPA 5D0GA 3I31A 3D0HE 2HRYA 2R9LA 4DPOA 1T02A 2AJQA 3QIPA 2RT3A 3W66A 1S49A 3MCMA 3H90A 3A12A 2RDIA 3FQKA 2XEXA 1VC0A 4NLOA 4NI2A 1YDLA 3SCKE 1V6HA 4YR3A 1TAUA 1N33F 1WSVA 2JEFA 3VAMA 4PQAA 3VAHA 3V5RA 1EIYB 4USVA 2ZKUA 1M1HA 3PKYA 1R6VA 3C19A 3LO3A 1S12A 4TKTA 4JI1J 5J1EA 4NYOA 3ZTPA 5A0YB 5JVGQ 3GV8B 4BC9A 4PXEA 4KO0B 2MYFA 5G0RA 2PI4A 1JLCB 2E1MC 1Y0HA 2ATLA 2J5AA 2OPPA 2W9CA 1HWJA 1YHQS 1H7XA 4WFZA 2K06A 2ASLA 1U1LA 4JI7F 1UEKA 4M5JA 3W64A 1QTMA 1IR2A 3CC4S 4NMXA 3DDNA 1NK9A 3HD1A 2RKIA 3R6LB 4Q7AA 3TAQA 1FX4A 3LPYA 4G1PA 1KFSA 1X4HA 2D1CA 4GVBA 2Z8QA 3OUYB 4IRDA 3NS5A 3EMTA 1KFDA 1RT4B 2UV8A 3DDIA 3GLJA 1V3SA 2I1RA 4K4WA 2MKJA 2CZ9A 3Q8SB 4KQZA 2Z30B 4H4MB 1HQUA 3IC1A 1HL6A 1VRUB 2M8DB 1SV5B 1R43A 2LA4A 3US5A 2Q6CA 3AHPA 2C3OA 4C9DA 3QQCD 1DHMA 2QO3A 2VG7A 3CD0A 3CXCR 4UTGA 1XC9A 5DRKA 1BGXT 3OFGA 4IOCQ 2QYCA 3I0RB 5K20B 3NBPB 1FNOA 5DZ7A 1N54B 5I42A 2HFVA 2KT3A 2IM0A 5FD1A 2QLBB 2DGVA 1CULA 5LM7E 4DEZA 4URGA 2HS4A 4NCGB 1S6PA 2DH9A 1X4CA 1KOHA 1VQMS 2X1BA 3KK3A 2BW2A 2CJQA 3AB4B 3R97A 1M0SA 1NO8A 3QIPB 1Q0NA 2DISA 2RDJA 3UR3C 5EWEA 1ITPA 5KFGA 1SH0A 2B8QA 4FF3A 4NI2B 1PC4A 4LVOP 4F26A 2HFZA 3GQCA 2EFPA 2NXUA 3TARA 5CH7B 2O1PA 4UOFA 2PT0A 2GQ2A 3KTQA 3DLGA 1XNQJ 1F2HA 1N5SA 4F3QA 2Z0GA 2AU0A 1X9WA 4UQGA 2D7SA 3TZWA 2CZ4A 3UDLA 4J9PA 5IC6B 1AW0A 1T3OA 4IR9A 4OI1A 1R0CB 5G0RB 2XLIA 2DNLA 4FXVA 2POKA 2OPPB 2W9CB 2RUSA 4ZCKA 1J27A 2GS8A 3A3NB 2W8LA 2JNJA 2I6WA 2BVZA 4YEAA 2XLJA 4KJIA 2R7QA 3MM6A 4ZN3A 3BYPA 1BLUA 4HVZA 2XCPA 3KYLA 2AZ1A 2GGPB 2G1DA 2RKIB 3T1HJ 3MEEA 4EFAC 3EX7B 4GVBB 4JI1F 4OZ5A 3NGDA 4PG6A 3UNGC 2DNQA 3H2VE 3L4BC 3VGTA 5I4MA 3QFHA 3OQ2A 4KBIA 3UVJA 4NLQA 1HQUB 4AD6A 3G8SA 1KQGB 1LXJA 4F7VA 3KJVA 3UQSA 3OT9A 1FEHA 3IXQA 1XBWA 4K2XA 1N0UA 3BGFA 2IJNA 4FZVA 2X7IA 1CJTA 2VG7B 3D0IE 1AT1B 3CJ3A 3PJXA 4X62J 3A3OB 2UXBF 3J7YU 2W2PP 1EZZB 2OLWA 5I42B 1H38A 3DDKA 1VIXA 4EK2A 2CFXA 2FJAB 4MT1A 5HJYA 3MHYA 1WC5A 4K4UA 3PHEA 3PO5A 1FX2A 2WB4A 4XPEA 4DUYJ 1TK5A 5L1JA 1XR5A 1FJGJ 1DRZA 2Z56B 4X4RA 3EJMA 1NSPA 1S6PB 4HDHA 3THVA 5KFMA 3KK3B 1M90T 1M5PC 4D3HA 4NZ6A 2BOPA 1FRLA 2XMUA 5A6PA 1F3VA 3LA0A 1F5AA 5KFBA 3DOMA 4C3LA 4WTYA 5J1NA 1H2UX 1U45A 1VBYA 3TOQA 4ZP7A 2WSEC 4I56A 4YMEA 1YX2A 5E3RA 4QJVA 4DV7J 1K44A 1NHVA 3ZNUA 2VKZG 2FHOB 3LANA 3DLGB 2V8HA 4H4KC 4ZPBA 4X4TA 4IDKA 1AYEA 4KRWA 3H98A 4IFVA 4ZPVR 1U7LA 3BSAA 2YVSA 4X4NA 4BLGA 4JUZA 2CXEA 3BV8A 2KO1A 1UVJA 5I3UA 2B6AA 3E2EA 3D9BA 3KLIA 4ZLLA 3N6MA 1NH7A 3GU0A 3GYXB 3ZTOA 3MM6B 3W5YA 4H4OB 2H4YB 2C2DA 1XNQF 5DJBA 2AWZA 4CLPA 3MEEB 2MQMA 2V0NA 1O51A 1VGYA 2IMWP 1NLKL 4NWBA 3WX8A 2QC3A 3GMGA 4KC5A 1FJ7A 1I6JA 4MMOA 1OMSA 2J0XA 4O44A 1RBLA 2AGQA 4BS2A 2J0SD 3KMQA 2ZHOA 4JI2J 1IR0A 3UVJB 3PCOB 1R8BA 3C6UA 3GSDA 4K4YA 1S77D 5LMUJ 3CTRA 2XULA 3JAMY 2V8VA 4OYPA 2VONA 4X65J 3B78A 4U7UD 2D3ZA 3TO8A 2VFSA 4E8UA 1CVJA 5ETQA 3TX0A 2HNYA 2CWKA 3KJVB 3RBDA 4B3OA 5C7PA 1HIYA 2DPIA 5LL6d 1MN9A 2RUGA 5KAKA 5HN0A 4RWXA 3T1HF 1KQFB 1X9MA 3UCUP 1SVDA 1CJTB 2IBOA 1ZA1B 2FC9A 5KG4A 2HQFA 1UVIA 4LF2A 5L1IA 3HD2A 2J6UA 2AYGA 4U95A 3EE3A 1KVIA 1LW0A 3V6DA 3M6VA 4PG5A 1WTFA 1RP5A 2RMLA 2N3LA 3R3TA 5BJRA 2Y1LB 3M2UA 4OX9J 3KHRA 3CD5A 4CWBA 4OX8A 2VODA 1IUJA 3DOMB 1L3TA 3HSDA 3J7ZT 5L8RC 2ZE2A 3HDSA 4L75A 4X62F 3H0PA 3F0NA 5DDOC 2P6SA 3HZGA 2OHDA 2RF2A 2KXNB 1QLNA 4KGVB 2FPHX 1NZAA 5HVGA 4LIWA 4DUYF 3JXOA 3I56S 1FJGF 5IV3A 4HI2A 3HHNB 2CKWA 3IAM9 3VCDA 1WC1A 1ROFA 1SI9A 1HNZJ 1WEXA 3D3BJ 1FDNA 3KG0A 2HW3A 5LMNJ 4IO9Q 3D68A 1GXUA 1C4AA 3HHKA 1AB8A 3MMAA 3SQGA 2DRAA 3CCZA 4GC6A 2LXUA 2B6AB 3R5AA 3D6HB 3KLIB 3FBFA 4WU3A 4FF2A 3D6MB 4USIA 5KFEA 2MQLA 4CTAA 2BQ3A 3TRGA 1KVJA 2IHR1 1GMWD 1VS3A 3CMAS 1XMOJ 4DV7F 3Q86A 1VK3A 4DHVA 1WNEA 4GVLA 1FTRA 1K47A 3RAQA 2E9TA 3R5DA 1S1XB 1VQ9S 2DKOB 4C8NA 4GRSA 2W9AA 2QFIA 1N0VC 3OJSA 2MQQA 2KYZA 3EYZA 1N34J 1REVB 4OLPA 4LMZA 2RRBA 2PC6A 2VICA 4O44B 1RU2A 1LWFB 1FO1A 1VRQC 5E0OA 4M8LA 4L3KA 1RZMA 3ZXWA 3C6UB 1OSCA 2OTJS 3I9V9 4KHMA 4AXJA 1GMUA 3MMBA 3K17A 2VC0A 3OLBA 9RUBA 4WWSA 4PUOA 2HNYB 4B3OB 3RW7A 1VQ8S 4ZCIA 4RPFA 2BRLA 3CEDA 3T5KA 1SCJB 4DU8A 1S48A 3PW7A 5HSPA 4IH7A 1U6ZA 4ZVEA 2K3KA 2H54B 1RHQB 2ZBIA 3TW0A 5KG7A 4K4XA 3D1OA 2UV8G 3QZ8A 3CCRS 4JI2F 4C8ZA 2DIUA 3BZQA 4PPZA 5LMUF 4TU8A 1UTAA 3VAIA 5K14A 3IMQJ 3L09A 3V6DB 4X65F 2IM3A 4ANDA 2WVEA 1NPPA 3DN9A 1C4CA 3DRSA 1UWAA 3GIKA 4DR7J 2HLTA 1LFPA 3PEHA 4CH1A 4DQQA 1ZTTA 1TAQA 2DITA 4NLXA 2EPIA 2JVRA 3KFWX 2OFHX 4ES3A 2V4QA 2ZE2B 4B9MA 4KKOA 2GJIA 3DGVA 2RF2B 2W8KA 2MEWA 2XWXA 1G1XA 2QA4G 4IFYA 1XN9A 5HMZA 5CYMA 2XMVA 1IN0A 4KYZA 3NKYA 3IWLA 5BYSA 4OX9F 5DG8A 4ED1A 4IQMA 4CM2A 1JJ2R 2Q79A 4DPTA 1UA1A 4AXIA 2KKHA 3M8WA 4I0WA 2QV6A 1FWKA 3MMAB 3SQGB 5F8NA 1SJ1A 1P1LA 3J7A1 2QLWA 1RTDA 3ONQA 1WI6A 4EBCA 2LFVA 4RW7A 3HM9A 5IT9Y 4FF4A 3E3XA 4DOZA 2RRNA 2CRLA 4LBIA 2YKOA 1FK9B 1Y7PA 2YQ0A 4Y2MA 4GKJF 3KJQB 1HA1A 3M1VA 2IC3B 1HNZF 2FHKA 1S0OA 4LRCA 1JX4A 4UOGA 3PW5A 1SQFA 1TP7A 4ZP8A 5LMNF 4J9MA 3H7HB 1R89A 2E1RA 1UEVA 4ID8A 4X4OA 4WXOA 4LF9J 3KHHA 1UPPA 1P1TA 1GAOA 1F1BB 2YX1A 1K9MT 4IR1A 1EETB 4NL5A 3CSKA 1AUDA 3MMBB 4XDDA 4LBHA 4A8XA 4PUOB 1RAEB 1XMOF 3VZHA 4OV1A 4DFMA 4U96A 4QIVA 3PHTA 2DO0A 4WYLA 4P74A 2BJ9A 4K7QA 2NUHA 1NK0A 1JLGA 1FD8A 1C0UA 4N7TA 1N34F 4ECUA 2M3DA 5IQQA 1D9DA 4ER8A 1JXEA 2O5DA 2H5EA 5T41A 1FXLA 3RAXA 2V50A 4IO1A 3N6NA 2B9XA 5L39A 5K14B 2HQIA 3H42A 1RHMB 2B7CB 3DRSB 1V5IB 4KGXB 4NCBA 2XGPA 4NCAA 1FWLA 3NXZA 3NOCA 3OL9A 7FDRA 2VA3A 4WFNQ 2B8PA 2VC1A 2DH8A 5HQMA 4ZN1A 1QUPA 1P9YA 4O3NA 1YJWS 4FYXB 1RB0A 3ILLA 1QTNB 4ZPDA 4ED6A 2BJEA 3D1HA 5F3TA 4KKOB 2DRBA 2MKCA 2YNIB 4ZVFA 3TJ9A 3FVYA 2Y1RI 1S6OA 3PYDA 5KG3A 3NCQA 3IP0A 4C7QA 3IO1A 3W9JA 3MUTP 4IRCA 4WFBQ 1U1NA 1JQGA 2BYCA 3CJSA 3KJNB 3HXMA 2AQ4A 3OPKA 1FXRA 5CYMB 1DFDA 1X0PA 4AL7A 4DPWA 4WFXA 4CZCA 4DR7F 2VH7A 2C42A 1UZDA 5LT5A 1UFWA 4FYDA 4LFCJ 2YNHB 4P9SA 5CD4H 2CQGA 1ZTWA 1RTDB 3OL6A 4ED4A 1N56A 4I6WA 4DCOB 4RW7B 3LWMA 3CDAA 4URSA 1RWVB 2LQ5A 3RJMB 4ENOA 3MAAA 2JC1A 3AJDA 4F4YA 3ISNC 1VDHA 1KHWA 4ECQA 3AXMA 3FRYA 3M1VB 1VC5A 4F4XA 1KLNA 2ZZNA 2CPEA 1NUEA 1DQ9A 5ETKA 1SKSA 2HVHA 1KD1T 2BJ7A 3NG8A 4EBEA 3H2LA 4OI4A 4A8FA 1UCNA 3W3SA 1S9FA 1M5VC 2XMTA 2ZH2A 3NLCA 4ZVSB 4Y6IA 3P3DA 4ELTA 2ZJPQ 5DGAA 3MEGA 3DRPA 1ZYQA 3NS6A 1P6TA 4N8NA 2C3UA 4ED0A 1S0NA 5CYQB 1UP1A 1U48A 1IBCB 3NMAA 2E5GA 1HBUA 3DOLA 4Y28C 2VKRA 5DLFA 1N32J 2MMYA 3JQJA 3CB4A 1JLGB 1C0UB 4P75A 1WHVA 3IR5B 2PSZA 4LF9F 1BHNA 1Q81T 3PACA 4QCLA 8ATCB 5KFRA 2AV5A 3RZAA 4V1Ak 1TFYA 1VRTA 1MLAA 2PFFB 3NGSA 1NSQA 4ZJLA 4GC7A 5IT4A 2FQQB 2APOA 5DDRC 2E5JA 2XS7A 3MPDA 1SB6A 5B0FA 1B4SA 2B9WA 5RUBA 2D3O1 4CYUA 2CPYA 4DSFA 3NEKA 3D6FB 3A8KA 1SJRA 2KG0A 2XWYA 1DTQA 1CJKA 4M5KA 3GTYX 3T6BA 5EHHA 3IA0A 4W92B 2KG1A 4KGMA 2MQPA 2GVZA 4J9OA 2XI3A 3A8JA 1RAGB 1IKWA 3K0JA 3NL0A 1S1UA 3RBZA 1Y3KA 1KEKA 2DTJA 2OD4A 1JIHA 1LK7A 1LFWA 1RBOB 2J7UA 1FRJA 4OQJA 4J9SA 5DDPC 1OYEA 2V4JA 4FVCA 4KY3A 4P6QA 1U47A 4LREA 2E1CA 1NRKA 2DNRA 2OAUA 1F0XA 3GCWP 3FMWA 5ETVA 1TUGB 3MAAB 3EZUA 1HQ2A 4RKUC 2J8SA 3TEHB 1IXKA 1UJ4A 4YS2A 3MPUB 4NX9A 2ZUGA 4WK1A 3W8GA 4F25A 3QYYA 5ITHA 1RHRB 4ED5A 1WKJA 1N8RT 1CC8A 1LWXA 2D74B 4LFCF 1VQNS 1PBAA 4I69A 1FRHA 1FVQA 4EWTA 4ECVA 5FLXY 3KWMA 2ZHBA 1FRKA 3GJTB 4X4QA 4KAIA 3MEGB 3DRPB 2CPFA 1YJRA 4F4WA 1B7YB 2L48A 3HSZA 2BACA 3CCTA 2M8HA 1KVKA 1HBUB 2Y8WA 3DOLB 2E1PA 3W9IA 3W2VA 3VWSA 2BQUA 4ZS6A 2IAJA 2UP1A 4YHHJ 1ZM2A 3BKFA 2WSCC 5KG5A 4J37A 4HTIA 1EKSA 4KT0C 1TVRA 1N5QA 4HEA9 2D9PA 1KBRA 3LGHA 4DV3J 3RR8A 1VRTB 1U1KA 2AKWB 1RCXB 1TL3B 1RTIA 1GH8A 2J0WA 4NXNJ 2W1BA 4A8MP 2IM1A 2DBBA 4IOAQ 5L1LA 2V2ZA 1HHSA 3EDRB 4CYUB 2G0JA 5H1SV 5IC4B 3OTEA 5C2GA 4HYKA 1N32F 1DLOA 2KFNA 3THPA 3CDUA 1FDDA 5AXKA 2MZJA 2MGZA 4DR2J 1U24A 1CJKB 2HHHJ 3MEDA 1KN6A 3JTPA 1IJFB 4O0IA 3GR0A 2BDPA 3TZXA 2FZGB 4KIAA 3GYNA 5F9NA 3MMJA 4DLGA 5KG0A 3HT3A 1VBXA 3KLGA 2DHGA 3GWCA 1E6VA 1YI2S 2W01A 2LMIA 1IKWB 1FERA 4LUBA 1S1UB 2R8JA 1E6YA 3U02A 2JH3A 3TR5A 1ACMB 3FCWA 4NA2A 1G6BA 2W25A 2MLYA 4DR4F 2HNZA 2ZWPA 3J81U 2VBWA 2Y1JA 3AOAA 3GSIA 2WCXA 3RRHA 5E5NA 1ZBTA 1NNDA 1X4BA 3P4UB 5DZ6A 2HPUA 2UXDJ 1H0HB 2ZBQA 3DGPA 5M2UA 2R2RA 3B54A 5H9FJ 5FDLA 2Z2LA 4XK8C 1Q95G 2CQ4A 3TUPA 2A10A 1PAEX 3GJRB 1FT8A 1T9WA 1YJNS 3QFWA 3G86A 2ZNZA 3IRXB 1VQSA 3AAWB 1KP6A 2L41A 2CNKB 1RTHB 4RUAA 4QOTA 5U47A 1W25A 4NYZA 4Q44A 3H5XA 4CH7A 5C42A 3C46A 4C8LA 2YX4A 2ZD1B 3BBCA 1WDTA 5GAEI 2QRRA 3CE8A 4I2PA 2R7UA 2QSWA 3FEXB 1QAYA 4UZCA 5JVHQ 3BDEA 3PJ9A 2VQFJ 4U7UK 1G3OA 2KVIA 3IWXA 2LKZA 5J2MA 3TYTA 2AJFE 3KDOA 1WSRA 5IV4A 3D4JA 2MKSA 1SC6A 2HHVA 1RA7A 5KT4A 1I94J 3QLHA 3W2VB 2JZ5A 1TKXA 3GR1A 5F8MA 3M7VA 2IAJB 2HMIA 1CEZA 1SPBP 2WAQD 1DJ0A 4FS2A 3A4TA 2ILZA 1TVRB 2J8AA 5DO2A 2ASYA 3CMQA 4QPTA 4R25A 5KFOA 1KONA 4Q2LA 3M32A 1RTIB 1DARA 4NXMJ 3SCIE 4KFBB 4K4ZA 1NK7A 2QLXA 4TN2A 4C97A 1BQMA 2ASDA 3KKFA 1Q79A 4KE5A 2JVOA 3AA9A 2HVEA 2XNQA 1JLAA 1S57A 1DLOB 3PZPA 2QT7A 2MGZB 2JJ4D 3MEDB 4ZPWR 5KFLA 2W4PA 1X4AA 4YHHF 5B0CA 1VLYA 3IR7B 3LPEA 4DV3F 4O3OA 2JEJA 3KLGB 4FXDA 1UETA 4NXNF 4AL6A 2BW7A 4Y2AA 2VPXB 1R27B 1E6YB 4LQ9A 4DL2A 1BUXA 2ACYA 1UW4A 4X66J 1KOOA 1CSJA 3OTCA 4J7CA 3LALA 3WQPA 4P7TA 2FUG9 4YN3B 3Q22A 4DR2F 2MDAA 2HHHF 4B3RJ 2HNZB 2XY7A 2DHSA 3Q24A 3K59A 3MEKA 1HHTP 3CJTA 3O8WA 2XHWA 2VIHA 1N5TA 3DGPB 5DETA 1X4DA 2UUWA 1SKUB 2PIIA 4WTOB 4TYAA 3D66A 5FDLB 4LSZB 1HR0J 4ATNA 1A7GE 4ZCMA 2UVVA 2OGUA 1SXLA 5C5JA 1OPZA 4UOHA 2LQJA 4UUWA 3FMBA 3CCQS 3I6PA 2VD3A 2LU2A 2KZMA 5I3QA 4G1QA 1XR6A 5C42B 8RUCA 2R7WA 2HK3A 3M6WA 1X4FA 4DQIA 2E5HA 3KLHA 3HHLD 3D5MA 4DCPB 4I2PB 2IRXA 1VMBA 2VPWB 5K8PA 2VASA 3ET6A 4ZVPB 3L7UA 1SC3B 2H51B 2LECA 2W4DA 5J2MB 1T11A 2ZM6J 3BDPA 2GAHC 2H3EB 3FDSA 1J5EJ 4F0KA 2ZJQQ 1FESA 2HHPA 4J91A 5HBMA 2FGOA 1R0BG 3N6LA 2KHDA 1RWWB 2WONA 4OJ1A 3SSQA 5KFKA 4FS1A 2HVIA 1Y5IB 3QLHB 1TKXB 3POTA 2CG4A 4NE9C 2C3MA 2LYVA 1EJ7L 3D6TB 2XYHB 3C3LA 1REGX 2DGTA 5EN1A 2K1RA 3NGTA 2B7BB 1RJJA 1LEOA 5EX3A 1Y5LB 2VF3A 1EP4A 4LF6J 4FN5A 4YR2A 2MQOA 3M32B 1IVZA 1LXNA 2VQFF 1YBUA 3RGIA 1SIWB 3H25A 4Y3CA 2FLNA 2B9EA 4B9NA 5MLCV 3V81A 3SFGA 2WBRA 1BQMB 3EVOA 2XB2D 2P2CB 4UW2A 5L9XA 2JSXA 4KR0B 2H5IB 2QA2A 1IWAA 4YOEA 3CCSS 3EICA 1JLAB 2A18A 1I94F 2W2NP 2B4VA 2ROPA 3QT6A 2KU7A 2XS5A 2CQ1A 1TELA 3DI6A 5D0EA 1HNIA 4NLTA 4DSLA 8AT1B 1JJCB 2OIHA 4NXMF 1WG4A 3WIVA 2DGXA 4ZLPA 2YKNA 2BX6A 3R7NB 2CVIA 4RNHA 5B0BA 5B0AA 2J6SA 4RW6A 4HH0A 2H9ZA 4PXDA 4P52A 5CZVA 5K5MA 4YB1P 2AEJA 2FLOA 1RWUA 2GJFA 3ZZ0A 4O3PA 3PFOA 4DR3J 2Q3PA 1JXLA 2FJBB 4ZCLA 3HFZB 5A8RA 2KZZA 5A8WA 3Q8YA 5GVQA 2B5JA 5MAOA 2F9JA 1RWNB 2OEMA 2EKNA 4F3MA 1SJFA 4X66F 1PSDA 1WACA 3E8OA 4OZ1A 5KT2A 2HBZB 1C1BA 2Q66A 4G1QB 4I4BA 4WE1B 4ZVRB 4B3RF 1HW9A 1D9AA 4HACA 1U1PA 4MIBA 1PYSB 1WHXA 3KLHB 2C3YA 3PIPQ 2HHQA 2DR6A 3ET6B 2KHCA 4ZHRA 4XO0A 1NKCA 3VAKA 1HR0F 1B99A 4JI3J 3KG4A 2X3DA 5HBMB 2WONB 2DJWA 5KFXA 5CYJA 4OJGA 3GIMA 1FDAA 2JC0A 4NEYA 1IBLJ 1JLQB 3POTB 2RQKA 1CBKA 3CC7S 2ZH5A 2V9KA 2IA6A 2K1RB 1JLBA 3CCMS 5A8KA 3RYLA 4KTQA 3QPIA 2DB1A 4Y65A 2VJVA 2I38A 2EBEA 1EP4B 2COLA 2OFGX 4OYWA 2E7VA 3SQOP 3WZ0A 1YBAA 3R9LA 3LP1A 4C98A 1HWIA 1WI8A 2ZM6F 4LFAJ 3BREA 3W2WB 4J90A 3IM8A 2OSQA 4ILLA 2HAIA 2NPFA 3D28A 4N5SA 2N4DA 3NS7B 3RRGA 2IY5B 3R7BB 2RU3A 4PWDA 3Q23A 3JTOA 2QGFB 4OI6A 5E3AA 1V3ZA 4MKVA 2E29A 3BKUA 2K8GA 4DI6A 5D4NA 2IVYA 1B64A 3MWBA 1U6FA 2OI2A 1HBMA 2OPQA 3DI6B 1HNIB 4LF6F 4LRAA 4QW9A 4YB7A 3LWLA 3NWRA 2CPDA 3MMCA 4HHHA 2KXFA 2B4PA 3K5OA 1YJUA 2I0XA 2YKNB 3BM7A 3GCXP 1URRA 3I5BA 2ZC3A 3CJ4A 1T8EA 4TU9A 4LSLA 4CO2A 4UUXA 4MKYA 4RW6B 4JV2A 2HGMA 2EFGA 5CZXA 2Q6BA 4DCJB 2C2KB 2ZVSA 2C3PA 1FA0A 4Z2XA 5D4OA 5T14A 1RYSA 1P9QC 3OSPA 1PG5B 5A8RB 1FFGB 5A8WB 4RUCA 5K8OA 1ZM4A 4U8YA 4QIGA 2B5JB 1RT7A 2J9DA 4XIUA 3EGWB 2GMHA 4KH0B 3MD1A 3RTVA 1S0VA 1QSLA 4Q8FA 3BS9A 4PG4A 2DCUB 2DIVA 4J9LA 3NRBA 1C1BB 1VYAA 4ZVQB 3TUZC 4U7CA 1DZ5A 1VQ4S 3C15A 2AYMA 2N4CA 4HACB 5HMWA 2VB6A 2EG1A 3OTDA 4DR3F 2DNOA 1J5OA 4NZ0A 2CQPA 2QL5B 4ZHRB 1U25A 5DG9A 4USMA 2A1BA 2BJ8A 2HFSA 2IVMA 5DQIA 1BQXA 4JB8B 5IM0A 2DGUA 3CCJS 1R6YA 2WVCA 3KLVA 1T05A 1G4CA 4ZOSA 1GEHA 3AY0A 2CUYA 2CQDA 2N82B 2R3VA 1JLBB 1SL2A 1DQAA 5A8KB 5F8JA 3K8VA 1OWXA 3D67A 5HATA 3VAFA 3QT5A 4ZA1A 1VHIA 2E5IA 4OZ3A 1SL1A 1RWMB 4FNIA 5HVHA 4ECWA 2R2SA 4DV2J 2MHEA 2FHJD 3LP1B 3FBBA 2ERRA 3EPIA 3IGVA 1KQSR 4RBUA 5D78A 3AD9C 3U1LA 3CJ8A 4JI3F 5KFTA 3CDBA 1NEEA 4CLLA 2B4UA 2W7AA 3BGOP 4PWDB 2EKYA 5KTQA 1IBLF 3MAQA 3TAMA 2ADCA 2FJVA 3SCLE 2GA7A 2JLEA 4HLBA 5CCLA 2DHAA 3UI3A 1RHUB 4UT4A 3EM1A 3C8YA 5EWFA 2OPQB 2GHPA 3WIUA 4ZP6A 3GONA 2F3JA 4LF1A 1OSDA 2OTLS 3DRRB 3FEZA 3MMCB 2G0CA 3RBEA 3RB4A 4IYQA 2MXYA 4ZIVA 4LFAF 2OPRA 3I9ZA 1UVLA 2I9SA 4ES2A 2B9YA 1M5KC 3WC2A 4ECXA 2M5YA 3GJSB 2DR5A 4LSLB 4QIWD 2ZH3A 2GVDA 4MJKA 4RUBA 3UWTA 4DV4J 5KFAA 3CWJA 4FYWB 5EGYA 2HKEA 4YQWA 4FYVB 3TP2A 1AFIA 2BM1A 1RWPB 4C2MA 4WKYA 4ZK7M 4QPXA 2HNDA 6FDRA 1G2EA 2J0QD 4F67A 1NH8A 3TUJC 1ZM9A 1RT7B 4AYBD 3GPAA 2XYPB 3N79A 4EZ9A 4MH8A 3MD3A 3BEGB 1TL4A 3IS9A 3P96A 3GIRA 4C8YA 3MCOA 1H74A 2YKPA 1APSA 3C15B 2AX1A 2B56A 4HKQA 5K9FA 5KG2A 4BWJA 3ZTQA 2XS2A 4CO3A 1WORA 1J5OB 3AJ2A 4NLVA 3DOKA 2FJWA 4RO0A 1IM6A 5ADZA 5IM0B 2D69A 5D4PA 3ILIA 1F5BA 1AUSL 5E3QA 4R5PA 4M95A 2K2PA 1T05B 4QIFA 1RADB 4ZVUB 1FEEA 3R6GB 4NA3A 4NLSA 2EFQA 1VFJA 2QL7B 1Q5VA 4LT6A 3AD8C 1KS2A 1WELA 4QR2A 5IT0A 2DXEA 2R2UA 3HK2A 1OPIA 3HJFA 3T41A 3DRXA 3NY0A 4FF1A 5AXMA 3OXLA 3ZC4A 3WBZA 2QIFA 3TAMB 2YWGA 4DS4A 3A1YG 5B7WA 3N5BA 3NGRA 3ZZZA 3NNAA 3T5HA 3G2XA 3SIPB 2DO4A 1L3SA 2IPOB 3I55S 1RAHB 4N8OA 3FK4A 3J81j 2EFNA 3J80U 2EK6A 5K8MA 3D54A 4DV2F 1UAWA 2C22A 4TQRA 4NLRA 4ANCA 5B08A 3U1MA 1JJ4A 3D3CJ 2E44A 2OPRB 5KFSA 5DM6Q 4XPCA 1HARA 3OL7A 3BO3A 2GVDB 1ZZNA 2J7WA 4DQRA 5F8LA 2Z57B 3DYAA 2HGNA 2F65A 4M5DA 3FBCA 4KGZB 3MR6A 4OZJA 3W61A 1EHWA 3HVRA 4CLZA 3PX0A 1U1QA 1NDPA 3C2PA 2EK1A 3CIMA 2HNDB 2RS8A 2MZQA 3PYGA 3K89A 3QIDA 3ZZOA 1HPZA 1TUWA 4J9NA 5J2QA 3MOJB 3IS9B 2FZKB 5GAHU 4ZVOB 1FJCA 1QSSA 2V63A 4UQTA 2ZBCA 4DV4F 3ZTSA 2HS0A 2V2VA 4RNNA 2FVPA 3J7Z5 2GGPA 1NK6A 5CXTA 1CQMA 4ED7A 3DOKB 4N47A 5HQLA 2F1FA 4PEOA 2R2TA 2H4WB 2UXBJ 2HIYA 4R5PB 2A0FB 1PC5A 1RHKB 3B8HA 3UD3P 4I7FA 5H9EK 4NLYA 2UUCJ 4B9TA 2QZ8A 1H6KX 5DG7A 2G2OA 3G82A 1QD1A 2L9DA 3DKDA 4NLDA 2AJ1A 5HVFA 4Q45A 1AXQA 2DNYA 5KFJA 1N4LA 1T0TV 4YY3J 1NBEB 1F9EB 2GCFA 3H4DA 2CJXB 3GG0A 4Q8EA 1N88A 5H9EJ 1LW2A 2PMHA 4QWAA 2UVUA 3MCNA 3KK2A 3P5BP 2RU9A 3TVYA 1S72S 1JK9B 5DQGA 5ETRA 4GMKA 2KDOA 4F36A 2FZCB 1Y4ZB 2BJ3A 4ETZA 4MFBB 4WCEQ 2WTFA 3AQPA 2UU9J 1FI4A 2CPXA 3L7OA 5THWA 1VCTA 4V19J 4I68A 5BYQA 5E3PA 1PJ6A 1YJ7A 3KUEA 4JI0J 2CQ2A 3CJKA 4OI0A 2DNMA 3GE9A 2N7CA 4OHZA 1S59A 2IDLA 3NGKA 4DX6A 3M8RA 4HHUA 1QAXA 1I51B 4A48A 3DYAB 2KJWA 4M5DB 2RAQA 4K0KJ 2DHHA 3T3FA 2GHVC 3GP9A 1HBNB 2AEMA 1NJIT 2BJDA 2XLKA 1VISA 3Q0AA 3ENAA 1HPZB 3MPVA 2EW9A 1U8SA 4EUVA 4FYYB 2NYIA 5J2QB 2MKIA 4WKRA 3CT9A 4DG1A 4TXSA 3HCXA 3I32A 1MMDA 4ZIWA 2KM8B 2JDJA 4H4OA 2HQ3A 3DLHA 5LOQA 3NCPA 2WOMA 4TNOA 2XMKA 2L9WA 3MF5A 6AT1B 3GB0A 4O3SA 1TK8A 4HTJA 2HBYB 1M5HA 2C2RA 2D3OR 2AJ4A 4ED2A 2AEFA 4LBPA 5GADU 3SYZA 3Q83A 3VGVA 2EWHA 4X2BA 1WJ9A 2B43A 1BY9A 1MMNA 1NDCA 1RKIA 4H54A 3MFIA 5D6GA 4OZNA 4NMLA 2XCAA 4I7FB 3VTIA 1VQKS 4C6AA 2VG6A 1W2BR 4WJBA 3G82B 2DGSA 3QO9A 5F8HA 4P7VA 3UDEA 3PR5B 4ICLA 2P5VA 3TX8A 1GNKA 5D0HA 2UUBJ 1LK5A 2YQ1A 3K2YA 3U1NA 5C2CA 4HH1A 2NR0A 2Q1LA 3OJUA 1C0TA 3OFFA 1LW2B 1UL3A 3MPWA 2OP5A 4C8KA 3KK2B 3TVKA 1YZ7A 1HBOA 2CWXA 2KI2A 3ISND 4NLPA 3OTOJ 2UUCF 4RNMA 2FLPA 1S97A 4F3OA 5KFIA 2WBMA 2YQ3A 4YB6A 1D09B 2CJKA 3AQOA 2KB2A 2OELA 2HHUA 4J9VA 1IKYA 3EXYA 1WC3A 4YY3F 2DNKA 2VUGA 1R3NA 3JS9A 4ZVTB 2R7TA 1JLEA 3TA2A 2LU1A 2EFOA 2IDEA 1NZ8A 3VHQA 4QYZK 1X4GA 3CJKB 5LXYA 2AIRB 5B09A 4KV8A 1TV6A 4KPYA 3NAHA 3MOZA 3JQMA 2OJ3A 2OMLA 2ZWOA 2AF6A 2HRTA 4AL5A 5HROA 1B0PA 2CQCA 2FVSA 5HAOA 1U1MA 4MYTA 3H2UB 4F02A 5EWGA 1U2RA 2UU9F 5EX0A 4LFBJ 4QYZJ 4IRKA 2RJZA 4DJBA 5M2RA 1JWWA 3FZBA 2XG8A 3AH6A 2FIUA 2RS2A 1S6QA 1Y11A 4JI0F 3TZYA 4DG1B 5AE3A 2ZITA 3QZ7A 1VQLS 3VV2B 5I3PA 5KFHA 1XQIA 4M5MA 3EDQB 4K0KF 1X31C 5FIIA 2M0GB 2DR7A 2XO6A 4KB7A 1M1KT 2WOMB 1FTCA 3K58A 3HMJG 1S1XA 2CZVC 4DZ6A 4RW9A 2WVBA 1LWEA 2BBEA 2MQNA 2BV3A 4MK7A 2RRAA 3AD7C 2XY5A 3OFHA 1REVA 5E7OB 2HZCA 3R27A 4IH6A 2HRUA 1LWFA 2GC8A 4LF7J 4OHVA 1Z1ZA 2BOAA 2BZ2A 3O44A 1X7VA 4G65A 4USJC 1VLOA 4BWMA 1S9EA 2VG6B 1NCLA 4IG3A 3QO9B 3H8YA 3MM7A 2F7VA 1YK9A 4TLQA 1LOUA 4DFPA 3C16A 3OR1A 2FVCA 2LEBA 2FC8A 3UNYA 2BKOA 4ICLB 3QSIA 1O5JA 3OXGA 1JXVA 3G9CA 3HULA 5AT1B 1Q8KA 4XDCA 1WOSA 2QL9B 2HBQB 5KFPA 1HQEA 5DLGA 4MIWA 3EGNA 4LQ3A 1C0TB 1QVGR 3W5XA 3P8BB 1YG0A 2AGOA 2XYGB 1HBOB 2F40A 1GMWA 3E01A 1Z2ZA 1U09A 4JI4J 4F2SA 3DC2A 2W4CA 1RT1A 3V4IA 4TVAB 1IKYB 1OO0B 1F9HA 3UO0A 3NWGA 1FJEB 3OFEA 3AODA 2GO8A 3VALA 5AJ3J 4PYDA 2UUBF 1JLEB 1RT2A 3RB0A 1KKHA 2VU5A 3FZ2A 4CLFA 4P2FA 2A2CA 2Z4PA 3R5GA 4KV8B 2HWIA 1N5YA 1WOPA 3QJJA 2DYAA 1TV6B 2VFRA 4A47A 3N01A 3KHLA 1VIOA 2NSCA 3OTOF 1F5CA 1YZ6A 4GKJJ 5HROB 2VDIA 3A8EA 4ID5B 1S4FA 3CMES 5D8HB 3KUGA 1VC6A 2VOOA 3L3CA 3JAMU 4LSNB 3TAPA 4DV0J 1VQPS 1S6QB 3UDVA 4DL3A 3TNVA 3GZ7A 1DTTA 3N4WA 2DPJA 3CW2C 3P45B 4JI6J 1S76D 3ITHA 2VFUA 2QTWA 1FK9A 1GXTA 2IC3A 3IAS9 2R7VA 4NPOA 1RE1B 4RW9B 1LWEB 3CVKA 3MR5A 1JMTA 4ELUA 1BMQB 4HHJA 1WF1A 3U7JA 4LFBF 3NAIA 1LV5A 3F73A 1RISA 1RTJA 3ZZRA 1S1WA 3BPSP 5HI7A 4KPCA 3D2WA 1EETA 1T03B 3NP5A 2PDAA 4PXCA 4OLOA 4M5HA 1YJ9S 1S9EB 4CP5A 4IG3B 1B70B 2WW8A 1YRTA 3MM7B 4RBTA 3OD2A 1CJVA 3C16B 3OR1B 1NMEB 1KWMA 2XGQA 2HZVA 5KFZA 2FTRA 3DNCA 4CO0A 1HHQA 2GAGC 3UD4P 1Y9OA 1HQEB 4O4RA 4EGLA 3UCGA 4LF7F 1WOOA 3PG9A 3DLBA 2HSEB 4FPRA 2VPZB 2NYHA 4GO5X 4XTTA 3E01B 3GFHA 3VAGA 3M8SA 5ETPA 1RT1B 4S0MA 1NJWA 4WFYA 5IS2A 2XMJA 2PA8D 4DMZA 4LR9A 4J9QA 3QAEA 3V4IB 3OXFA 2PN6A 4X4VA 1WKKA 1YJVA 2JFKA 2C2OB 2X1FA 4F04B 1A0OB 3BJYA 2O66A 4RW8A 2NXEA 1RT2B 4F0MA 4PG7A 1O8BA 5CAAA 4DV1J 2RQCA 1QY7A 2YNIA 3MM8A 2C1EB 5GAGI 3QRPA 1K0VA 1VI7A 2GNKA 3SEOA 4FXWA 1N5YB 3CF5Q 3M8QB 1RAOA 3Q8QB 3GIJA 4JI4F 4WP9A 2JWNA 3EZ5A 2GQQA 2MZ1A 1NHUA 2AP6A 3BN4A 2I5JA 1RCOB 4LRBA 3BPDA 2RQMA 3PO4A 1YVFA 3TA1A 1ZETA 2KXHA 5AJ3F 2YNHA 2DEIA 1EARA 4ZJQA 5KFFA 4HI1A 4RW4A 3OHAA 5BR8J 1DTTB 2M70A 3TI0A 3P5TL 4FDFA 2ZOGA 1VK8A 3ITHB 2JEIA 4OIXA 1FE0A 1VQ5S 3RRKA 4U67Q 5CA5A 3C14A 1TQLA 5F3ZA 1Q8LA 3SCJE 3T9ZA 2HURA 2JLGA 1HNVA 2ZOFA 3CULA 2R7SA 2IM2A 1FRMA 2Y0BB 1RTJB 4B9VA 3VQSA 3F56A 4QWEA 4DV0F 3CD6S 1S1WB 1TKTB 2AJ0A 4RU2A 1YKWA 2QYGA 1S10A 4A8SA 4L73A 4URQU 3CPWR 4JI6F 5AXLA 3R1HA 5LSOA 3DXBA 1T94A 1HW8A 1O6XA 4DF8A 4HL9A 2HQCA 4USHA 1Q7YT 5CYQA 1CJVB 1BD6A 3CJ5A 4O0NA 3MM9A 4OYOA 3HHLC 2AYBA 4BCAA 4DU7A 1HNXJ 3RAMA 1ELOA 4NYPA 1XR7A 3BH7B 2P9EA 4PXBA 1PYOB 4HDGA 4MTPA 1ZM3A 5C25A 5KOWA 4M94A 2EC0A 3LP2B 2VBZA 3RUBL 1RACB 1O0PA 5JXSA 2OEKA 1NJZA 1S9GA 3OW2R 2F9DA 2VA2A 1H2TZ 1Z2LA 1SUQA 2PEHA 2A3JA 2J76E 4YDXA 2V9WA 2GIQA 3E51A 1KLMB 4RW8B 2FY8A 2NZCA 5IT9U 3N0VA 4DL7A 1M1GA 1HKAA 2F5GA 3MM8B 4YUDA 1HD1A 4QIEA 4C0BA 1X0FA 2HZAA 4L3NA 2DXDA 2ZH7A 1DQ8A 4GKKJ 2X3GA 3ELHA 1RUSA 2CA9A 2HHXA 1F2GA 4F2RA 3B82A 2I5JB 1XERA 3UN2A 2XNRA 2HK2A 3CJ0A 3MDFA 1NKBA 1OY8A 2LQ9A 1GX5A 3L9ZA 4DQSA 4B3TJ 5KFYA 1L3VA 1TMMA 2HQDA 4DL5A 2GV1A 4Y2KA 2BQRA 4DV1F 3NGUA 4WFAQ 4J9UE 5BXIA 4RW4B 3KOAA 2W7OA 3PW2A 2C2MB 2BA9A 1TL7A 1DURA 3IG1A 3DCAA 4ITSA 4RJVA 4RX6A 1VJWA 3N5FA 3ZFVA 3MTJA 3W7BA 3C14B 1BWVA 2NZ4A 2ZBRA 2H5JB 4MAKA 2ZZTA 2QMWA 4PWUA 3VR1A 3QBCA 1Q86T 1HNVB 3G4SS 2WRMA 4YFUA 3KJFB 4Q0BA 4LF8J 5BR8F 2ZH6A 2K3IA 2UXCF 2ZH1A 3VGSA 5DDQC 3C6TA 4EU0A 2YX7A 3UD5A 2R8KA 2GQCA 4DX7A 1RLDA 3MM9B 2R8IA 4CM0A 3ILOA 2QJ3A 1R0AA 4OL8A 2OPSA 4I6AA 4DLEA 2JHEA 4C48A 2NLWA 3PXGa 3R5BA 1FKPA 5GADI 3UN3A 2V8DA 2E5LJ 3PJWA 3DMJA 5C25B 1B7FA 4P2MA 2YBVA 1TL3A 3IBFB 3K5MA 4CLUA 1RA6A 4DX5A 3BB5A 1S9GB 2AD9A 2X51A 3OR2A 5HL7Q 3V6HA 2YWHA 5BYRA 1SUQB 2EEYA 1WHWA 3BQ2A 2M4MA 4OYAA 1RWXB 4ZJOA 3IBWA 1BXNA 3DU5A 1HNXF 4DR4J 1MN7A 3G8QA 2G2YA 5J1EB 1TR0A 3M30A 1FFWB 3TZZA 3TA0A 1QVFR 1IM4A 2I2YA 1S1VA 1VOMA 4OYXA 1S1TA 1ZH5A 2PO4A 1ZZFA 3J7YI 1VQOS 2OH2A 2DRDA 4K2JA 1QAJA 5L9NA 3M9OB 3MCSA 1DBDA 1UFKA 1PJ7A 2IRUA 3BBFA 3SSRA 1FE4A 3KMSA 2BJ1A 1XMBA 1OYDA 4USUA 2DNPA 2J6TA 3NNCA 1NK5A 3AA8A 2LXIA 3BF4A 4ZPTR 4OJHA 2BANA 4ILRA 1VJQA 2DR9A 5LXRA 1S7IA 3MAHA 2ZZMA 1F9FA 2YKMA 3H59A 3L95X 3Q8PB 3V6KA 3PYFA 4ERDA 3LTOA 2C2ZB 2EG2A 3Q2TC 3IBCB 2Y1IA 1NAQA 2WB1D 3QGGA 1TL7B 4K59A 2ZDPA 3IG1B 4GKKF 4RR5A 3ETOA 1RDRA 2BE2A 4CNZA 4DFKA 3QMQA 2M9KA 3JQKA 1XMQJ 4RNOA 2KVQE 1YLXA 3A3PB 3IRXA 4A8OA 1KTVA 1L5UA 2ZHAA 2OUGA 4DZDA 1T9XA 1RTHA 2D3UA 3PVXA 4UF4A 4GO7X 2BRKA 4B3TF 2CVEA 3KLFA 2QA1A 2ZJRQ 1UJ5A 4EMDA 4WXWA 4Q0BB 1RQ0A 2HBRB 2ZD1A 3Q8RB 1XK8A 2B3TB 1TFWA 3L7PA 4C11A 4ZKAA 1T9TA 2E66A 3VVUA 3VVTA 4AUKA 3ZO7A 1CULB 1NM2A 3C6TB 3R1LA 3PRDA 1IKXA 4YDDB 3TEGA 4ECTA 3BR9A 5HP1A 2YNGA 2MY7A 1R0AB 4RWWA 2CQIA 2XZWA 4YR0A 2XMWA 2OPSB 9ATCB 3O6QA 4J9RA 4WIQA 4CNYA 4ZDNA 3A13A 4DSKA 5E2QA 2ZNYA 1Y00A 5HLFA 2ILYA 1HI1A 3VZIA 5JJBA 1FKPB 3HT0A 4LF8F 4UY8T 4R8UA 2XY6A 4OMFG 3DMJB 1ZPVA 1Q1KA 5F8IA 3S6EA 3R5CA 2IA0A 3BQ0A 4QU6A 4KFBA 2PD1A 1FKAF 3OR2B 3BO4A 3HSJA 1WEZA 3AOCA 3PDNA 2AW0A 4K50A 3M30B 2R8HA 2OEJA 2QMXA 3LQVA 4LR8A 4YB5A 1S1VB 3CDEA 3OSNA 2CQBA 5AE2A 3MUMP 5ETTA 1S1TB 2SXLA 4QR1A 2E5LF 4ZP9A 3HSGA 1WD6A 3BGRA 3OLAA 3NNHA 4DN0A 3ULHA 4I67A 5D15A 1U1OA 4EEYA 2ZH8A 3I4HX 5CCMA 5IZHA 1MNEA 1W2IA 2MJUA 3PRVA 2BANB 4DL4A 3WDOA 1YQHA 2YKMB 3OV7A 5KFUA 3UR0A 5FLXU 3X3UA 2HWTA 1JKHA 3FJ2A 1L3KA 3FRZA 3I82A 2WK4A 1HLWA 3RW6A 2BE2B 3CCWA 2K7JA 2LEPA 1UVNA 5D3GA 1VR6A 3SFUA 4USWA 3V6JA 5ETMA 2FDNA 1SL0A 2PA3A 1KR4A 3K5NA 1RGVA 3KLFB 1NPKA 2FVQA 2RILA 4F4AA 2GFFA 1UWBA 4Q2MA 1TKZA 1WDDA 3UCZP 4C0HA 1CC7A 2KRBA 5CABA 4NASA 4C11B 4F4KA 4D3GA 3EWGA 4U8VA 5KT3A 1D8ZA 4DR1J 1K1SA 2ATCB 3T5LA 5KFQA 4ES1A 2HAFA 1IKXB 3ENWA 1Q82T 2XI2A 1XMQF 3RB3A 4LRFA 5HP1B 2HIQA 2YNGB 3BBBA 2QA4S 2Z2YB 3EGZA 4L76A 5JUMA 4Q5VA 5HLFB 2R7RA 4R8UB 3B4DA 2V4RA 4CLTA 5J2PA 2DEJA 3P49B 4ZVGA 2U1AA 5IXUA 1UVMA 2E1AA 4CLSA 2CJYB 2L3MA 2Y3YA 3U27A 2MY8A 4IDKB 3DM2A 5LJ3Y 2JL9A 4EO8A 4IFVB 3ZZYA 2EXUA 4I2QA 2XMMA 2ROEA 3C66A 3PW0A 1PILA 5GAEU 3SMZA 3MR3A 3HHLA 2HHSA 5I3UB 2W24A 2CPZA 1WWHA 3SXLA 1FWPA 3BGRB 4DF4A 5AXNA 3NOGA 4JI8J 5L46A 2RHQB 1UZHA 3TJAA 2JEGA 1JJHA 3OTBA 1NK8A 4MK8A 2FJDB 4DDFA 3T1YJ 4CH0S 3I87A 5A76A 1RLCL 4IKAA 4N76A 3G96A 2Y8YA 1JKHB 4USKA 2ROGA 2FB0A 2O67A 2E9ZA 1MMLA 3W5ZA 1HWKA 5A2QY 4MYUA 4JBCA 4K8RA 1C1CA 1OY9A 2VFTA 2CDQA 1ICEB 4NRUA 4ZITA 5D3GB 2G13A 3G8TA 1VHFA 2LP4A 3EZOA 2NS1B 3V4MA 1GFWB 2YNFA 1U2CA 1U49A 2ZC4A 3W62A 5JMNA 3RG6A 2VPYB 4WE1A 2CQ3A 4I1TA 3RR7A 4DR5J 3CO0P 1I5OB 2PGCA 1UWBB 3IM9A 2RVJA 3G71S 1TKZB 4CLWA 2LA6A 1OQ6A 1R8CA 1UJ6A 1H98A 4LRDA 3QRRA 1LW0B 3HJVA 1HI0P 3PR4A 3CJRA 2Z2ZA 1TTHB 2IIHA 3SV4A 4DR6J 3ZZUA 1WC6A 3M2UB 2CNOB 4A8YA 1M5SA 1JLQA 1N6QA 2DR8A 2VJUA 3LAKA 4XAKA 3QT7A 2UVRA 1UW9A 2QLJB 2P9CA 5L1KA 3PNIA 2VZ9A 5J2PB 2ABYA 4PCQA 1W26A 5E3CA 2W7PA 4DV5J 5CHCB 3QRQA 4QWDA 4DR1F 4LIRA 1CG2A 4ZLNA 2R42A 1MG7A 1OS5A 3W2WA 1CPZA 1H73A 2G4BA 1LKZA 1N36J 4P73A 3DM2B 1R8PA 4A8QA 2H65B 4LJMA 1F6TA 1NKEA 2E7XA 1T9UA 3N9UC 4I2QB 2FYXA 3EPGA 5A2QU 4O3RA 1NJXA 1N52B 5ETOA 2LEAA 4K4TA 4C8MA 4Y2IA 3EGVA 1AA1B 3HHLB 5DS7A 3GV7B 4OHWA 1IBKJ 4I64A 4CTAB 2GX8A 3BN7A 2V69A 2KM8C 1S7HA 2RSQA 3MTKA 2R8GA 2KN4A 4NZ7A 1D1UA 1EQ0A 2EBGA 4I6YA 3Q8UA 4L72B 3HLUA 4EI2A 4ELVA 2XHCA 1LNQA 1NPRA 5DGBA 3X1LB 5J2NA 1SJQA 1RWKB 2DY1A 2FJXA 1L3UA 3O5TB 3HZEA 1R7IA 2WZ1A 3CJQA 3M9MB 3DU6A 3FNNA 2L08A 4ECRA 3UW1A 3KXDA 3LH2S 2ZFHA 1C1CB 2XBPA 3I4PA 3QATA 4EYIB 1T3NA 3I5CA 4JI8F 4LF5J 4EO6A 4UZBA 4IOBA 2YH0A 1KQKA 3M6XA 1U1RA 1T9VA 2YNFB 1T7PA 4ALZA
chains in the Genus database with same CATH topology
3MMJA 1U1MA 4MYTA 3H2UB 4F02A 5EWGA 2MPUA 5C24A 5GAHI 2DHXA 4DLGA 5KG0A 3HT3A 1VBXA 1U2RA 3KLGA 2DHGA 3T1YF 5G4DA 3GWCA 2UU9F 2DD8S 1E6VA 5EX0A 1YI2S 5IQ6A 4QYZJ 2GO9A 4DSIA 2LMIA 4IRKA 1IKWB 1FERA 2RJZA 1WF0A 4WIIA 2M88A 3QGHA 1JB0C 1S1UB 2VL1A 2YY3A 3FZBA 4LUBA 2XG8A 5M2RA 4DJBA 2R8JA 1BC6A 1JWWA 1E6YA 2F8HA 3U02A 3AH6A 3K8WA 1WF2A 2FIUA 4NCGA 4B17A 3G6YA 3AJ1A 3FFIA 3HHDA 3LGNA 3PFEA 2JH3A 4LVNP 1S6QA 3CDWA 3TR5A 4JI0F 4CO5A 3UPFA 2RS2A 2RE1A 3IRWP 3DRYA 4DG1B 5AE3A 4X84A 2ZITA 3QZ7A 4WZQA 4NA2A 4ZVHA 1VQLS 5I3PA 3JSYA 2CPJA 1G6BA 2W25A 5KT6A 4DQPA 2AYEA 4C0OC 2QE5A 3I31A 3D0HE 5KFHA 2HRYA 2R9LA 4DR4F 4DPOA 1T02A 2AJQA 1VBZA 3I0SA 3LW5C 2HNZA 2RT3A 3QIPA 4K0KF 2VBWA 5FIIA 2Y1JA 2M0GB 2DR7A 1S49A 2WCXA 3RRHA 4KB7A 1M1KT 2WOMB 1FTCA 2RDIA 3K58A 3HMJG 1N48A 2KT5A 3I5AA 1S1XA 2CZVC 3FQKA 5E5NA 1ZBTA 2XEXA 4RW9A 5DM7Q 2C28A 1VC0A 1LWEA 2ZH4A 1NNDA 1X4BA 3KK1A 4NLOA 2BBEA 2MQNA 2BV3A 3SCKE 4MK7A 2HPUA 2RRAA 1V6HA 4CT8A 1N6QB 3K57A 4YR3A 1H0HB 2XY5A 3OFHA 3DGPA 1REVA 5E7OB 2HZCA 5M2UA 2MZRA 4DS5A 1TAUA 2R2RA 5H9FJ 1N33F 1TZ0A 5FDLA 4J5OA 3R27A 2D9OA 2Z2LA 2RIJA 4IH6A 2HRUA 4DR5F 1LWFA 2GC8A 5HO4A 4XK8C 2CQ4A 3BO2A 3QWUA 4OHVA 2KFYA 1Z1ZA 3BSNA 2BZ2A 2JEFA 2A10A 3VAMA 3O44A 1X7VA 1FT8A 4PQAA 1YJNS 3VAHA 3V5RA 1J2VA 3G86A 2ZNZA 5E41A 2ZKUA 2MZSA 3IRXB 4USJC 1VQSA 3AAWB 3PKYA 4BWMA 3HP6A 3LO3A 1LQ9A 4TKTA 4IFYB 5J1EA 1S9EA 2L41A 2VG6B 1RTHB 1Y3JA 4RUAA 4QOTA 4NYOA 5A0YB 4IG3A 5JVGQ 3GV8B 5U47A 1W25A 4BC9A 4PXEA 3QO9B 4NYZA 4Q44A 4KO0B 3H5XA 4CH7A 2MYFA 3H8YA 5G0RA 2MSSA 5C42A 2PI4A 1JLCB 2E1MC 3MM7A 3C46A 5KT5A 4C8LA 2YX4A 1Y0HA 2F7VA 4TLQA 4DR6F 2ZD1B 1LOUA 2ATLA 4DFPA 2J5AA 2OPPA 3OR1A 2FVCA 5GAEI 2QRRA 3CE8A 3K7RA 2FC8A 3BGLA 1UMJA 2W9CA 2LEBA 4I2PA 2R7UA 1HWJA 4DX8H 2QSWA 4ICLB 1YHQS 3FEXB 1QAYA 1O5JA 3OXGA 1H7XA 4CT9A 5JVHQ 3G9CA 3KNAA 3BDEA 4WFZA 2ASLA 4U7UK 1U1LA 4XDCA 4JI7F 1G3OA 2KVIA 3IWXA 4ED3A 2LKZA 3OVBA 5KFPA 5J2MA 3TYTA 2AJFE 1FVSA 1QTMA 2VOPA 1HQEA 5DLGA 4MIWA 3CC4S 3EGNA 3DDNA 5B0GA 4LQ3A 1C0TB 4TYBA 1QVGR 1NK9A 4WU2A 2IJFA 2RKIA 1YG0A 4Q7AA 3TAQA 3LPYA 4G1PA 3DRRA 2MKSA 1KFSA 1X4HA 1SC6A 2HHVA 3T5JA 2AGOA 1RA7A 2D1CA 5KT4A 1HBOB 3QLHA 2F40A 3W2VB 4DV5F 2JZ5A 1TKXA 3GR1A 3E01A 2HVZA 2Z8QA 5F8MA 3OUYB 1Z2ZA 4IRDA 1NU4A 2IAJB 1U09A 4F2SA 3QJLA 3DC2A 2W4CA 3NS5A 1RT1A 2HMIA 1CEZA 1KFDA 2WAQD 1DJ0A 1RT4B 2UV8A 4FS2A 4B9SA 2KTQA 5HQ8A 1V3SA 1AFJA 2I1RA 4WYWA 2ILZA 1TVRB 4K4WA 2HG4A 3DLJA 3LF0A 2J8AA 3V4IA 2MKJA 5DO2A 4KSEB 2ASYA 1N36F 1H3DA 1IKYB 3Q8SB 4KQZA 4QPTA 4R25A 5KFOA 4H4MB 1HQUA 1KONA 1OO0B 3BGUA 3IC1A 4Q2LA 3M32A 3T1AA 1RTIB 1DARA 3NWGA 1FJEB 3OFEA 4FP9A 1HL6A 2LXFA 3SCIE 2GO8A 5J2NB 1VRUB 2ZKTA 3VALA 2UUBF 4KFBB 1JLEB 2M8DB 1NK7A 4K4ZA 1RT2A 2QLXA 1FCAA 3RB0A 2UVWA 2J9EA 1SV5B 4TN2A 1R43A 2LA4A 4C97A 4H4KA 1BQMA 2Q6CA 3US5A 1MWZA 2ASDA 3FZ2A 3KKFA 3AHPA 2A2CA 2Z4PA 2C3OA 1Q79A 4KE5A 2FHMA 2JVOA 3LUYA 3AA9A 2MZTA 2JOQA 5KFDA 4KV8B 2HWIA 3M2VA 2XNQA 1N5YA 1IBKF 1JLAA 3QJJA 1DLOB 1TV6B 4C9DA 2VFRA 4A47A 1DHMA 3N01A 3PZPA 3KHLA 1VIOA 2NSCA 2QT7A 2MGZB 2JJ4D 3OTOF 2QO3A 2VG7A 3CD0A 1F5CA 2FHJA 3CXCR 3MEDB 1XC9A 5DRKA 4ZPWR 5KFLA 2W4PA 2KFZA 1X4AA 1QSYA 1BGXT 4YHHF 3OFGA 5B0CA 2DVIA 1VLYA 4IOCQ 2QYCA 3I0RB 5HROB 2YH1A 3IR7B 3NBPB 1FNOA 1N54B 5I42A 3A8EA 4DV3F 2K7KA 2KT3A 4ID5B 1S4FA 4O3OA 2HYIB 5C24B 2JEJA 3CMES 4NA1A 4CCHA 2XSJA 1HD0A 5D8HB 2IM0A 3KLGB 4FXDA 2BUNA 1VC6A 5FD1A 1UETA 7FD1A 2DGVA 2VOOA 4NXNF 4AL6A 3L3CA 4Y2AA 2VPXB 5F41A 4DEZA 1ZAWA 4URGA 1R27B 2E9RX 1E6YB 4LSNB 3TAPA 2RD5C 4LQ9A 4DL2A 2HS4A 4NCGB 1IQZA 1S6PA 2JLFA 3FFIB 2DH9A 1VQPS 1S6QB 1X4CA 1KOHA 4N77A 4DL3A 1VQMS 3TNVA 3GZ7A 2X1BA 1Q8BA 1SJ4P 2ACYA 1DTTA 1UW4A 3KK3A 1KOOA 1CSJA 3N4WA 2BW2A 3OTCA 2DPJA 3LALA 2CJQA 3AB4B 4P7TA 2FUG9 2HFNA 1S76D 3ITHA 2VFUA 3UE2A 3Q22A 4DR2F 2MDAA 1M0SA 3I0SB 2HHHF 1FK9A 1NO8A 2HHWA 2HNZB 1GXTA 3QIPB 4LF5F 2XY7A 4A8WA 2DISA 2RDJA 2CYYA 3LP0A 2DHSA 2GIRA 2IC3A 3UR3C 3Q24A 3IAS9 5EWEA 2R7VA 4NPOA 3K59A 4RW9B 3MEKA 4O4GA 1HHTP 1LWEB 5KFGA 1SH0A 3KK1B 4FF3A 3CVKA 3MR5A 1JMTA 1PC4A 4ELUA 3O8WA 4LVOP 2OMOA 4F26A 2HFZA 3GQCA 4HHJA 1WF1A 3U7JA 2EFPA 2XHWA 2NXUA 1N5TA 3TARA 5CH7B 1G7CB 3I96A 5DETA 1X4DA 2UUWA 2O1PA 2PIIA 2PT0A 2GQ2A 4TYAA 4LFBF 3NAIA 5FDLB 1MW7A 1LV5A 2EFVA 1RT5A 3F73A 1RISA 3KTQA 3T19A 4ATNA 3OVSA 1RTJA 1A7GE 3ZZRA 4ZCMA 2UVVA 3HI9A 3DLGA 1S1WA 5LSLA 1SXLA 3TQ1A 4MIAA 5C5JA 2I8EA 3H40A 3G6ES 1OPZA 5HI7A 2LQJA 4UUWA 1N5SA 3FMBA 4F3QA 2Z0GA 2AU0A 3DXSX 4Y00A 1X9WA 3CCQS 3D2WA 4UQGA 1EETA 2WHOA 1T03B 3NP5A 2D7SA 4IG0A 2PDAA 3I6PA 4PXCA 4OLOA 4RU9A 2VD3A 1S9EB 2CZ4A 2LU2A 1YJ9S 3UDLA 2KZMA 4J9PA 1Q8IA 2FJEB 5I3QA 4QR0A 3PY8A 4IG3B 1AW0A 1T3OA 4G1QA 1HWUA 2WW8A 4N56A 4CO4A