2LA6A

Solution nmr structure of rrm domain of rna-binding protein fus from homo sapiens, northeast structural genomics consortium target hr6430a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
b'MGHHHHHHSHSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein FUS
molecule tags Rna binding protein
source organism Homo sapiens
publication title Northeast Structural Genomics Consortium Target HR6430A
rcsb
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2la6A01
4A8XA 2CPJA 1QVFR 3CCLS 1NO8A 3K0JA 2JX2A 3DXBA 5DM7Q 3US5A 4WIIA 3G4SS 1UFWA 1X5SA 3N9UC 2B0GA 3CXCR 4YUDA 2CPFA 1U1OA 1M5KC 2MB0B 2DHAA 2LMIA 2X1AA 1PGZA 2LA6A 3MUTP 1X4AA 2CQ4A 2MSTA 3CCQS 1KD1T 2U2FA 2YH1A 1YTYA 1KC8T 3FEXB 2MYFA 1ZZFA 4F02A 1O0PA 4F26A 1YJ9S 3UD4P 3TO8A 5DM6Q 1OWXA 1YHQS 2XS7A 2LECA 2EVZA 1U1NA 2KRRA 2DGXA 2OTJS 3H2UB 4IOAQ 2FHOB 4WF9Q 3CCVS 1A9NB 4M5DB 3S8SA 2J0SD 1X4HA 2CPIA 1UP1A 3U1LA 1F9FA 2DH9A 1WEZA 3NS6A 1KOOA 2N7CA 2F9JA 3VAIA 1S79A 2HZCA 1VQMS 3VAKA 2D3OR 2MQOA 1WHVA 4LJMA 2DNGA 2VOPA 1DHMA 2CQ3A 5IQQA 2DGUA 3SXLA 1SJ3P 2CPHA 2MQQA 3D2WA 2DGWA 4FXVA 5GADU 2DNLA 3CTRA 3EGNA 2DB1A 2M88A 2LXUA 4YB1P 3MUVP 3CPWR 5DDOC 1VQPS 1VQOS 3BO3A 4QU7A 2A3JA 1D8ZA 1WELA 2HGNA 2KI2A 2FY1A 2BOPA 2DH7A 2KU7A 3NMRA 1YITS 3EX7B 1WF2A 2CPEA 3CMAS 2CQGA 1HL6A 2MKSA 4P6QA 1VC5A 2DGTA 1VQNS 2GO9A 2LEBA 1U1MA 4BS2A 3UCZP 1SJRA 3R27A 2YWKA 5H1SV 2E5IA 3ULHA 1X5PA 2JVRA 3UE2A 4U67Q 4C4WA 2L08A 1JJ4A 3CD6S 3SMZA 3CC2S 2X1FA 4ED5A 2RUGA 2DGVA 2LA4A 1L3KA 5JVHQ 1JJHA 2XSFA 1VC0A 2RQ4A 3MD1A 1DRZA 1ZH5A 1VBXA 3G71S 2U1AA 1VC6A 2DGQA 1U1PA 5LJ3Y 2KXNB 3BEGB 2MQMA 3UCGA 1YWXA 2MSSA 2CQPA 1WWHA 4TLQA 2KT5A 2CQHA 2CPDA 2RS2A 3SDEB 2E5JA 1VQ7S 1WEYA 2KG0A 2CQDA 1FJEB 2AD9A 1WHYA 5CA5A 5D78A 1K8AT 3S01A 4WFAQ 1RKJA 1YIJS 2N82B 2CQ0A 3NNAA 3VF0B 1VQLS 1R8HA 1HD0A 3BO4A 2VODA 2G0CA 1PO6A 3LQVA 2AYBA 3EGZA 2ZJRQ 2F9DA 2MQPA 1U2FA 1X4CA 2OSQA 2OTLS 4Z2XA 5DETA 3Q2SC 2RU3A 2LXIA 2MJNA 3ZZZA 3G6ES 1U1LA 2CQ1A 4QPTA 2DGOA 3R1HA 2K8GA 2JRSA 1OO0B 2PEHA 4WFNQ 1JJ2R 1FJ7A 3IRWP 2RQCA 2RVJA 2MQNA 5ITHA 1SXLA 2DH8A 3MDFA 4FXWA 2E5HA 2AYMA 1U1KA 2ZJPQ 3TP2A 5IFMA 3TYTA 3G9CA 2YH0A 4C7QA 1FT8A 5EN1A 3CUNA 2DK2A 3G8SA 3ZZYA 2MPUA 2DISA 2MHNA 2RRBA 1CVJA 5HO4A 1VQ4S 1FXLA 1DZ5A 2CQCA 2V94A 2OIHA 2DGSA 5HL7Q 1M5VC 2MZ1A 1A7GE 3V4MA 2AYGA 2MKKA 3NNCA 2KRBA 4W90B 4RU2A 3L3CA 1YI2S 3U1MA 2ERRA 4UY8T 5CYJA 1K9MT 3BS9A 1WEXA 3VAMA 4TU9A 2MGZA 2DNYA 2VONA 3CCES 1P1TA 2M9KA 3NS5A 5DDPC 2RNEA 3P5TL 2DO0A 2X1GA 1X5OA 2KHCA 3H2VE 4ZKAA 2DHSA 2M52A 2MKIA 1U6FA 2CPYA 2O3DA 2DITA 5GAEU 3CC4S 5D77A 3VALA 4PRFA 5CXTA 1IQTA 3J7ZT 2M2BA 3B4DA 2JWNA 3HI9A 2LYVA 4V19X 2ZJQQ 2HVZA 1SJQA 1WI8A 2MY7A 1WF0A 2CQ2A 1M1KT 2LKZA 1OIAA 2MZQA 3S6EA 2J8AA 5IM0A 3CCJS 3I56S 1VQ9S 3S7RA 1YJWS 2XNRA 1X4BA 2M8HA 2EK1A 1FO1A 2DNKA 4CH0S 1H2TZ 2K3KA 1WG1A 2UP1A 3RW6A 2RS8A 4TU8A 1DBDA 3MOJB 2KH9A 5JVGQ 1SJ4P 2KYXA 2DIUA 1WG4A 1M5OC 2DNZA 1N52B 5MLCV 2YTCA 3THTA 3CCMS 3HHNB 3SDEA 2KXHA 2KVIA 5FJ4A 2WBRA 2KM8C 1SJFA 1U1QA 4CQ1A 3P49B 4W92B 4YOEA 1WHWA 2DHGA 3VAJA 2X1BA 1R8PA 3CF5Q 3G96A 2HYIB 4LMZA 2E5GA 2DNQA 1M5PC 3MD3A 1Q82T 2XS5A 2VOOA 2DO4A 1N54B 2NLWA 2MXYA 1N88A 2BZ2A 2M0GB 2MKHA 2XS2A 1WHXA 3THPA 3IWNC 1VQ8S 2KN4A 2RRAA 4EGLA 2N3LA 2QEXS 1X0FA 2JVOA 4IO9Q 3I55S 5LJ5Y 2M70A 5GAGU 1X4GA 4J5OA 3G8TA 3VAHA 1QM9A 3PIOQ 1NJIT 2GHPA 3DLLQ 2AYEA 1OPIA 1X4DA 1VBYA 2HGMA 1JMTA 2CJKA 3CC7S 1UAWA 2LEAA 4OZ0A 3UCUP 4CH1A 2J76E 2LQ5A 5BJRA 3MUMP 4LIRA 2KXFA 3PIPQ 1FJCA 1WG5A 3MI7X 1Q86T 1B7FA 3P6YC 3VAFA 3VAGA 3J7YU 2MZRA 5GMKa 2D9PA 1U6BA 1X4FA 3RW7A 2LCWA 2OSRA 2I38A 2MZJA 1UW4A 4WFBQ 3CMES 3UWTA 2E44A 1AUDA 1KOHA 2FC9A 2PE8A 1URNA 2M4MA 2KM8B 1VQKS 1BY9A 1FNXH 1P27B 5IM0B 2MGZB 2QA4S 3R1LA 1FHTA 4WKRA 4QQBA 1W2BR 2DNHA 5LXYA 1Q81T 3B4MA 1HA1A 2L9WA 2MKCA 1H2VZ 4C0OC 4TU7A 3MXHP 1NU4A 2KFYA 4PR6A 1H2UX 2G1DA 1XN9A 2HGLA 3Q2TC 2FC8A 1N8RT 1U1RA 2ADBA 1S72S 2CQIA 4OZ1A 2XB2D 1ZZNA 2RT3A 3LPYA 2G4BA 4IUFA 2I2YA 2N3OA 3CCSS 3BO2A 2XNQA 1VBZA 1D9AA 2D9OA 2SXLA 1VQ6S 1Q7YT 4QU6A 2DNRA 1KQSR 4PKDB 1WI6A 2DNMA 2MZTA 2Q79A 3MURP 5DDRC 2YKAA 2MZSA 3FEYB 1QVGR 2F3JA 2MKJA 1WTBA 1YJNS 2DHXA 3CCRS 1G2EA 5LSOA 5GAHU 2MQLA 2MY8A 1VQ5S 2NZ4A 4ERDA 2DNOA 2CQBA 4UQTA 2DNPA 4F25A 1K73T 2ADCA 1X5TA 5LSLA 1H6KX 4WCEQ 4IOCQ 2MMYA 2CPXA 2MJUA 1X4EA 4Y00A 2L41A 3CCUS 3UD3P 2J0QD 3JB9k 1RK8A 3CULA 2DNNA 2EK6A 3P3DA 4Y0FA 2M7SA 2M8DB 3NNHA 2DIVA 5DDQC 3OW2R 2FPHX 1M90T 2KG1A 4CIOA 2OJ3A 2CPZA 5GVQA 5LXRA 2QFJA 1WF1A 1HD1A
chains in the Genus database with same CATH superfamily
3FC9A 4NL5A 4A8XA 2CPJA 1PYSB 3P96A 3HVTB 1KHWA 4I69A 4KC5A 4PZVA 2MTLA 2UVUA 4WZQA 1TELA 1NO8A 1EZZB 1T9VA 1GMWD 3BKUA 2DT9A 3HMJG 1BWVA 3D6MB 5KG1A 2CNNB 3QZ7A 2CJYB 4MFBB 3US5A 3G4SS 1ELOA 2H5IB 2GFFA 3HJVA 3N9UC 4IQXA 1RT3A 2XO7A 1DQ8A 3ZNJ1 4DBQA 3KJVB 1WC5A 2C2OB 3TQEA 2OFGX 5GAEI 3T5HA 4F3QA 1S1WA 3NGKA 5J1PA 4LVOP 4YUDA 3GG1A 1S76D 1V3RA 4DPWA 4USMA 4G1PA 4LF7F 3KUGA 1M5KC 3V6DB 2QV6A 2MDAA 3KOAA 3LAMA 3DHXA 4IFYB 4B3TJ 2HS4A 2R7SA 3AQOA 4I2QB 4CLUA 3NCPA 2V50A 1FKOB 1N5TA 3MCOA 4KY3A 3VGTA 3MPWA 1SKUB 4OZNA 3PR5B 3WBZA 4C8KA 3NGRA 5A76A 4ZCKA 5F3ZA 2CQ4A 2UXCJ 3CCQS 3H8YA 1KD1T 1YTYA 2B4OA 2KFZA 2V68A 2B51A 4U8YA 3FEXB 2AU0A 3J7AN 1EARA 4DV0F 4ZPAA 4CZCA 1RLDA 4E2FB 3UD4P 2AGOA 3DLKB 3KJNB 4FVCA 5DM6Q 2HHUA 2W2NP 4QCLA 4DV3J 1NK7A 2XS7A 2EVZA 1TL1B 1D09B 2KRRA 2WONA 5E0OA 5CCLA 1U1NA 2C3UA 3H2UB 5EWEA 2A6MA 1UEVA 2RQKA 2HQDA 4DQRA 4C8MA 2UUCJ 4M5DB 4OZLA 1IWAA 3ICLA 4PWUA 1S9EA 1TAQA 2QRRA 1CJKB 2ZBCA 3MHYA 4PCQA 2QA4G 3M30B 3KLVA 4W98A 4WBFA 2VICA 2LDYA 2X51A 2C2MB 2UXBJ 2HWIA 3GYXB 3QO9A 1ZPWX 5ETPA 3AOBA 2MQOA 3VAKA 2HBYB 3F56A 3IAM9 4LJMA 4RNOA 1WJ9A 4WE1B 5IQQA 3SCJE 2QGFB 1SJ3P 1N36F 2YWWA 1JKHA 1VLOA 4Z7YA 1FFSB 2OPQB 1HWUA 3MAAA 3MZIA 3D2WA 3PVXA 5HP1B 3L9ZA 4OYXA 3AB4B 3M30A 3Q0AA 2OD6A 2HS0A 2CJAA 2DNLA 3KUHA 1ZYQA 4YP3A 1W25A 2LXUA 5KFGA 3MUVP 3KNAA 2FVQA 5J2NA 3CPWR 5L39A 1YLXA 3LP1A 1UWBB 3OFHA 4KGVB 3Q89A 5ETOA 2EFOA 4ED2A 1VQOS 1S9FA 5DJBA 1O5JA 5ETVA 4I1TA 2KI2A 5B0GA 4A8OA 3K58A 2XI3A 3EVMA 4DV1J 2VA3A 2VOPA 2FY1A 1JXVA 1P9YA 5H9FJ 4RBTA 4UZCA 3EPGA 4IRKA 3NMRA 4J9VA 2IYGA 2V8DA 4NXMF 2CQGA 1V9OA 2WHOA 3A8EA 3LGNA 4HR2A 2LQBA 5LMUJ 4P6QA 4DLGA 2DGTA 1MMDA 3H59A 1VQNS 1YQHA 4OJ1A 2UXDJ 2G2YA 3I9V9 2EBEA 1TVRB 3C6UB 3GQCA 1HW8A 3UCZP 3T6BA 3BJYA 5A2QU 3R7BB 3K5NA 5F8JA 4ZCIA 3LAKA 3D28A 3R27A 4B17A 4P2FA 3D9BA 1VR6A 5HANA 5LT5A 4CT8A 3RR7A 2UUAF 1HBNA 3DDNA 4K2XA 5AJ3F 4TYAA 1UTAA 1TFWA 1WACA 2DYAA 2GMLA 2L08A 2ZNYA 1YBTA 2MEWA 4HHHA 3I5BA 4I6YA 4ZLLA 4X62F 4ID5B 4F4YA 3PX0A 1JJ4A 1XR7A 2OPSB 1RE1B 4RKUC 4L74A 3SMZA 4QIVA 4DL0C 2JFDA 3AFGA 3PFEA 2YNIB 5AE1A 2VJVA 1MNEA 3CC2S 4DSEA 5HP1A 2W4CA 2X1FA 5E3CA 2VFTA 1S1VA 2YNFA 5G0RB 3NOCA 2UXDF 3CEDA 3M1VB 5HBMB 3B82A 4FNHA 2XMMA 1FD2A 2F1FA 1HQEA 6FDRA 1RDRA 5CHCB 4OI2A 2FIUA 1UKUA 4CYUA 4AQYF 4DS5A 3Q8VA 1UPMB 2GAGC 3W62A 3GCWP 2ZH1A 1VC6A 2XMUA 3KK3A 1U1PA 4G65A 2KXNB 5KFYA 4J9QA 1LOUA 5CH7B 3MAHA 4ED1A 2FQQB 3KKFA 1S0MA 1JLAA 1PYOB 2BM0A 2MSSA 2Y0SD 3DGPB 1WWHA 4TLQA 3C8YA 2I8EA 1DAXA 3RR8A 4OZ3A 4NEYA 1T7PA 5HBMA 3SCKE 5KOXA 1VQ7S 3JTOA 5FLXU 4DXLA 4FKYA 3GFXA 1U2RA 3NAIA 3QMQA 2ZHOA 2YKPA 4DF8A 3KMSA 2EFGA 1FERA 3N6LA 2AZ1A 3UN2A 3MGJA 4WFAQ 4HHUA 1PBAA 3IO1A 3VF0B 2FVPA 2ZOGA 1JLBA 3D6HB 2HURA 2GQCA 5KFHA 1HBNB 5B0FA 4F0MA 5B7WA 2AT1B 1IBKJ 2LP4A 4DL2A 4YDXA 1FTRA 1NHVA 3B6BA 4KKOA 4ZDNA 4CTAB 3ZZOA 4YR0A 1PO6A 2VV5A 4OI0A 3EGZA 3CJ2A 3CT9A 1IM6A 1NZ8A 1RT7A 2MQPA 1X4CA 1YZ6A 9RUBA 2YX7A 4DUZF 2OTLS 1FRHA 1WC0A 4JBCA 2GA7A 2NXJA 4ICLB 3N28A 3PRBA 5A6PA 3C14A 3TVKA 3DYAA 1VJQA 1TKDA 4KFBB 5CCMA 4QPTA 5J2PB 4DL5A 1N56A 4IR1A 2IM3A 2KZZA 5HATA 1OO0B 5T41A 1GEHA 1NK0A 4OHYA 1C2PA 4WFNQ 4JV5F 3QRRA 1F5CA 1HNIA 2CUYA 5I3QA 1JJ2R 3W5YA 5HN0A 1TKXB 1TMJA 4N56A 2LEPA 1V6HA 4UY85 1T9UA 4CO3A 5F0WA 4PYAA 4UOGA 5DS7A 3H5SA 3O6QA 2VC1A 3T1AA 1MMLA 3A3PB 3KDOA 2J7UA 2WB4A 3O44A 2E5HA 4MKVA 1J5EJ 2AZ3A 4OX9F 2LQ8A 3IC1A 5JMNA 5KFMA 4ZN3A 3FSIA 4RX6A 5T14A 5GADI 2FTRA 2A2CA 2OPQA 2ROPA 3F41A 3MAAB 1U1KA 4TKTA 4X65J 2R4FA 4DX6A 3TYTA 1NSAA 4P2XA 3OHAA 1NEEA 3BGOP 3R6GB 1XC9A 1FT8A 4ID5A 3CUNA 4DSFA 2DK2A 1FXDA 4KO0B 3MR5A 2IRYA 2MPUA 3G8SA 3VVTA 1LK7A 1M1HA 2RRBA 4MKBA 5IZHA 3BPDA 5E3PA 3O5TB 1KQFB 4YR2A 4IDKB 5CZVA 1U49A 3DRXA 3QT8A 2XCAA 3RU0A 2AW0A 1XR6A 1BD6A 5HL7Q 1BQNA 3ZTOA 1A7GE 2JOQA 4N77A 2ZHBA 3HXMA 1KONA 2GMJA 2OELA 2K7KA 4G1QA 4W90B 2Z8QA 4MIAA 2ILYA 4MJKA 4JI2F 5IT0A 1WDDA 2ZITA 5IC4B 1WEXA 2V34A 1J27A 5AXMA 5H9FK 2RHQB 3ISND 2VBXA 1Q8IA 1U26A 3BKFA 4DV4J 2BKPA 3ILLA 2HAFA 3FQKA 3W66A 4ZKAA 1D0EA 2DHSA 2DXEA 2MKIA 2DY9A 3RJMB 1R8CA 3OTCA 3NAHA 5IV4A 2W2MP 1Z2LA 2JH3A 3K8WA 4KPCA 5D77A 5HQMA 4WK1A 3F73A 3ET6A 1RT2B 4LFBJ 3NCRA 2COLA 2E7WA 1IQTA 1IKXB 1CULA 4BDPA 3GIIA 4G1QB 4OI6A 1OSCA 2FHJD 4DZDA 1VDHA 3NWRA 2ZJQQ 1P1LA 3IM9A 4C3KA 2HVZA 3MPDA 1Q8LA 2Q66A 2OPRB 3AY0A 3ADAC 3DCAA 3Q8UA 4P74A 1ZH5A 3W5XA 2LKZA 2RH3A 1OIAA 1ZAXA 2Z4PA 3H40A 5IM0A 4KPYA 4JI1F 4WP9A 3PYEA 4KTQA 3S7RA 1CEZA 1H72C 2NUUG 1EJ7L 4IH6A 4MFBA 4NCBA 1S1XB 3RGIA 4DV6F 4DR2F 1U48A 5E7OB 4DQIA 4JUZA 2ZM6F 2HVHA 3H90A 1RAFB 2Z58B 3M9NB 3LGMA 2BE7D 1X9MA 1IKWA 2K3KA 4I68A 4BWMA 1SC1B 4WIQA 4NCGA 2R2TA 2R7OA 3EDRB 3B78A 1KP6A 1TZ0A 2A0FB 4WXOA 4TU8A 2ZEJA 1DBDA 3R5AA 5KG4A 3TAMB 5JUMA 2HPUA 1T8EA 1XWLA 1B4SA 5C42A 4FS1A 3C2PA 3CDWA 1VIXA 2FVCA 3HX9A 4WYLA 4LF1A 2XC9A 4B9NA 4K50A 1WG4A 3SSQA 5JXSA 3HO1A 2W2OP 5KG3A 5A2QY 2RDDA 1K0VA 4ID8A 5LSRA 2HHPA 1N6QB 1HBOB 2HMIA 4HI1A 2IVFB 1I94J 1RTJA 3NY0A 4FPRA 3MMCB 4LR8A 4DS4A 3GV8B 2E5LJ 3SSRA 1YRTA 3V4IB 4KFBA 2KVIA 2X3DA 2B56A 3HHDA 1A0OB 1QDUB 3KLEA 5F8HA 1LQ9A 2N4CA 2WBRA 2F8HA 2KVQE 2ZWPA 3BR8A 3C6TA 3IN5A 1QD1A 1U1QA 4CQ1A 4C9DA 3P49B 4W92B 1KRPA 5F8GA 4YOEA 1T9TA 3P8BB 2VF3A 2B4PA 3L4BC 2C3MA 4GMKA 1EB0A 5DZ6A 5LOQA 4B3RJ 2IM2A 1YJRA 4HEA9 1R8PA 3CF5Q 4A8KA 1HNVB 3D1OA 6AT1B 2E5GA 3WQPA 3KLHB 1BLUA 3I9ZA 1RTJB 3KG4A 5CAAA 2AQ4A 2Z2YB 3FKBA 3MEDB 1N54B 2NLWA 3IP0A 3TJAA 3H4BA 2BZ2A 2YWGA 3PRVA 1AZSB 2XS2A 3IBFB 4J9LA 4HHJA 4WP3A 2KN4A 2LQJA 4DV5F 1DJ0A 1NHKL 4RW6B 1T05A 3IXQA 1UPPA 1NLKL 3IA0A 1X0FA 1QAYA 3I55S 2GV1A 2B6AA 2P5VA 2R3VA 1WKJA 1R8BA 5B09A 1D9FA 4PXEA 1WF1A 4ZVFA 1RU1A 1X4GA 1XJWB 3FCWA 3OJSA 1Y3KA 3VAHA 3CDBA 4FPIA 4G3IA 1RAEB 2VASA 3QGPA 4RW8B 4HDGA 3IGNA 2WCXA 3L09A 3A12A 2BOAA 1RUSA 1X4DA 4N8OA 2C2ZB 2YKMB 3BBBA 7AT1B 1F3VA 4JV1A 3PHTA 1CS4A 2CJKA 2QYGA 3VR1A 5HK4A 2J0XA 1TL7A 5I42A 4WFXA 4YFUA 4CH1A 3HFVA 1UEUA 5I4MA 1T11A 3OJUA 1SQGA 3M8RA 2V4JB 3QT6A 4BCAA 2QLJB 3LP2B 5D0GA 2E1RA 2OI2A 3ISNC 1FX4A 4EMDA 2UVRA 2YNHA 3ONQA 1HQ2A 3D67A 4BWJA 1O8BA 1J5EF 2WK4A 3VAGA 3QIPB 1H98A 1VYAA 1YRXA 2F63A 4PAAA 1RWOB 5D0EA 1HWIA 4ANCA 4PG5A 2VPXB 4ZHRA 1HI0P 2BJDA 4YB7A 4ZPBA 2FLLA 4AL5A 4K4VA 2WVDA 4MH8A 3SZ2A 1ZA1B 3MEDA 4CDIA 2VBWA 1SIWB 4ZP9A 1LV5A 2I38A 5L1JA 1UW4A 2WSFC 3CWJA 4WFBQ 3V6JA 1SKRA 3UWTA 3CMES 3R2DJ 1QSLA 3BQ1A 1JK9B 1RA7A 4DDFA 3KDNA 2DR9A 1VQKS 3R6LB 3HFZB 2FJWA 1FNXH 3EWGA 1N0VC 5KOWA 2QA4S 3G6YA 3MMBB 1PCAA 3OXLA 3R1LA 1TAUA 4RW7B 2FLNA 1WOOA 5F8IA 1W2BR 3PYFA 4NLGA 3MM7B 3EVOA 4ZHRB 1Q81T 3CW2C 3C46A 2KYZA 1HA1A 3VGUA 1FKOA 3W63A 4OYZA 4QYZJ 1PJ5A 2IAJA 3E2EA 1C0UB 3JAMU 2FGOA 1BXNA 3IWXA 2Z56B 3MXHP 4EUVA 2QL9B 4F3OA 4G1IA 2KFYA 3D4JA 1HQUB 3HZEA 1H2UX 2G1DA 3NG8A 3W64A 2I5JB 2QLBB 3QWUA 4FNIA 4IH5A 2UUWA 4B02A 4AXJA 2EC0A 1XN9A 5CYMA 3QSYB 1N8RT 5ADZA 3T1HJ 1YX2A 1NSQA 4CT9A 2Z2MA 3DDIA 2Z2LA 3BPSP 7FDRA 5KFJA 2CJBA 2C2EA 3R5JB 5C42B 2ZH9A 1EQ0A 5FIIA 3LPYA 3R97A 3JSYA 1VIOA 1T3NA 3CCSS 3BO2A 2YWFA 4N5SA 3MM6A 1UEKA 3WHIA 3BV8A 4DMZA 4ZPTR 3TA1A 5D6GA 5KFAA 1S10A 3MM9B 3JSBA 4ILLA 5J2QA 3MCSA 4LF6F 2XMAA 2HQIA 5IQ6A 3ZTPA 1HHSA 4K4XA 2BQRA 3KK2A 3OTBA 1SH2A 2DNMA 4H4OA 4C0HA 1HPZA 5IOLA 3DRPB 1VQYA 3FEYB 2FUG9 2V2QA 3PACA 2Z57B 2P8IA 1YGYA 2XMTA 4OI1A 2F3JA 5JJBA 1QTMA 1JLQA 1SC4B 3IWLA 4QIWD 4UW2A 4L3NA 5GAHU 1FD8A 1LWCB 2QG9B 4QW9A 1U0HB 2CZ9A 2MQLA 4WP8A 1IBLF 1R27B 4EYIB 2XM3A 1CJVA 2DNOA 2CQBA 4LFAF 2DNPA 1F9HA 5C7PA 3BQ0A 4P2MA 1EKSA 2BW2A 1K73T 4FYVB 2RIJA 3GG0A 3KLHA 3I4HX 1DTQB 3TJ8A 3OFGA 3NP5A 1RT5A 2EG2A 4ZVRB 3WC0A 2L41A 3BSOA 3QRPA 2G0IA 3C14B 4ZVGA 3JB9k 1SQFA 3BM7A 4ZP6A 5IC6B 4JI4F 3RAXA 3CULA 4WXWA 1RT2A 1UZDA 2M7SA 3DLEA 2M8DB 4USWA 3VGVA 3FZ2A 4OYOA 5DDQC 4ED0A 1HNWF 3OW2R 1HHTP 1M90T 9ATCB 3W9IA 2BVZA 2FYXA 2NYIA 1H0HB 2NUHA 3NLCA 3SBMA 4NX9A 2GHVC 2JC1A 5GVQA 2VDHA 3Q86A 5LXRA 4WZMA 4M5GA 3KLEB 1REVA 1HFEL 3TX0A 3CSKA 4ECYA 3OVSA 2QZ8A 2XWYA 3O8WA 1NBEB 3MR7A 4TNOA 3HDSA 3UDEA 5IV3A 1QVFR 2C2NA 2JX2A 1DQAA 4ZVEA 1HNWJ 1QSSA 4AYBD 3LALA 4MAKA 4CLYA 3M2UA 1JLCA 1RACB 1NB7A 4K4SA 2XZWA 4F4KA 3ENQA 2HW3A 5BYQA 3HPOA 3H5XA 4MKAA 2B0GA 2VZ9A 3H5YA 2Z30B 2VOOA 4GO7X 2WSEC 2CPFA 1U1OA 3JTPA 3QGHA 1TL7B 5KAKA 4DX7A 2HHHF 2MHEA 2YQ3A 3EXCX 5C25B 5H9EJ 1XBWA 2QL7B 4M5HA 1SBRA 1NZAA 2W9BA 4HI2A 2VU5A 2ROEA 4DV1F 3EICA 4NLXA 4C2MA 3IG1A 2HNYB 2LA6A 2C2RA 3A8KA 3AOCA 2OO4A 1IUJA 1JNRB 2XG8A 4F4ZA 2DRDA 4KQZA 3OL6A 1MLAA 1UMJA 2U2FA 4OI4A 3RBXA 1Q78A 4KV8B 5G0RA 4RPFA 2MYFA 3BN7A 5LM7E 2M3DA 4USJC 3OR1B 1LFWA 2HLTA 2C42A 2XLKA 2R7WA 2R2UA 1UVJA 4YB6A 3TO8A 1EP4B 3IBCB 4O3PA 1NNDA 2A2DA 3BH7B 4DPTA 4CCHA 2LECA 4F8RA 1KDNA 2WVCA 4P75A 1IBLJ 3NL0A 2HIQA 1IKYB 1LNQA 2YXLA 2POKA 4UOHA 1FX2A 3W7BA 1QAIA 3R5DA 2PI4A 5IT9Y 2FHOB 4I7FB 3CCVS 1JLGB 2A6OA 2IMOA 2J0SD 1X4HA 2C3OA 2FY8A 4CI0B 2ZZMA 1YK9A 4DCJB 1UP1A 2CWKA 2CZ4A 4ED8A 1TL1A 4DSJA 4Q8FA 2DH9A 4LREA 4QR1A 1SPBP 3D66A 1U8WA 4ECVA 2GIQA 2K1RA 2YNGA 1IBKF 5KFOA 3VAIA 5CABA 1A6LA 1P9QC 2R2SA 4X84A 2UUCF 4QWAA 3QBCA 3LW5C 4OX7A 3ILOA 3MEGA 3TZZA 4ALZA 2EWHA 4X65F 2W25A 1KVIA 3SXLA 2DGUA 1JNZB 2CPHA 2CDQA 2K1RB 2ZBQA 3D0GE 4O4GB 4OLOA 3CIMA 4LF8J 4RO0A 3GJSB 3W8PA 1FNOA 4DV0J 2GQQA 3ISZA 1AW0A 2OMOA 5IXUA 5GADU 4LVNP 2M88A 1XQIA 3PY8A 4DV2F 1TK8A 4ED4A 3BYPA 2PMHA 2W7AA 1LWCA 4HACB 2IYIA 3U02A 2XLJA 4CNZA 3LWLA 2NXUA 4ECRA 5KT4A 2A3JA 4ZVQB 4IDKA 1Z4UA 3RRGA 3AHPA 2HGNA 2B3TB 2N4DA 4K0KJ 4CLLA 1WOSA 4YDDB 3QJPA 2J6SA 3OR1A 2BOPA 2DH7A 2W9CB 3RB4A 4DN0A 2P6TA 4NLRA 1HNXJ 1FKPB 4OX9J 1NM2A 3M4XA 4OJGA 1EX8A 2CPEA 3O3LA 4USUA 5B0DA 2HNDA 3CMAS 2VKZG 2XY6A 4Y65A 4MK9A 1JLEA 1PAEX 3M2RB 4M5LA 4OX6A 4RR5A 1SJ1A 3TVZA 1KEKA 4QWDA 1VC5A 1NPRA 4PWDA 1KVKA 1I5OB 4M5IA 3MOZA 1MU2A 1IM4A 4M5KA 1BE4A 3SFGA 3ENVA 3LH2S 3FRYA 4BS2A 1AYEA 3WZ0A 4ZJLA 2AJFE 5CYMB 1NPPA 1RWXB 1HQEB 4M5MA 2NPIA 3A3NB 4K8RA 1AA1B 5DG7A 4Y3CA 2MQ8A 1LEOA 3K59A 4H4MB 3AH6A 1X5PA 2JVRA 3OXGA 1S7IA 1T3OA 1LKZA 3ULHA 3LP0A 1XNRJ 3B8HA 4PPDA 2QLXA 3DNCA 3J7A1 2CXEA 4O44A 3CD6S 2VG6A 4A46A 4JI7F 4XIUA 4ED5A 3V2UC 2RUGA 1FVQA 2DGVA 2VJUA 2R7QA 4DZ6A 4DV5J 2ATLA 1VK8A 1UWAA 2UVVA 3J80U 4AD6A 4M5JA 3BF4A 3FSYA 1QTNB 4CNYA 4DR3F 4ZJQA 2F8EX 2JLFA 3FNNA 1JJHA 2F4FA 3K89A 3L7UA 1TKZB 4CM2A 5C5JA 4JV0A 3FMWA 1ZTTA 2C22A 4TQRA 3M8SA 3BBFA 4O0NA 1K0TA 3QSIA 1TK0A 3MM5A 2MQMA 2AV5A 2CJXB 2HQGA 1YWXA 1IJEB 2QA2A 1EHWA 4RNNA 2WB1D 4I7FA 5BR8J 5E5NA 4LFCF 4U7CA 2XHWA 4Q5VA 1U7LA 2RS2A 4TY8A 5DLFA 2HMIB 2L9NA 4JI5F 1KTVA 3W2WA 3BGFA 5KFUA 2CQDA 3FCVA 2IC3A 2IVMA 3VCDA 1WHYA 1RAOA 3DC2A 5CA5A 1BWEA 4B3SF 1PAUB 2KFNA 5I42B 4KV8A 1RKJA 1YIJS 1RBLA 2KHDA 2DXFA 1ZM3A 4NLUA 4DR1J 1F5AA 2BM1A 3HVAA 5FLXY 3ZZTA 4CO1A 3JSMB 3KHHA 2KO1A 3UDLA 2V6AA 3GIMA 3LPEA 3DRRB 3ZTQA 3ILIA 4DV7J 1Y11A 2G13A 2EKNA 2PFDA 5CQGA 1S6UA 1S4EA 2AX1A 4LT6A 4EK2A 3M6VA 4Q2MA 5EWFA 4Q0BB 2DR7A 2IA0A 4KB7A 2PEBA 1NRKA 3GMGA 2B6AB 1VFJA 2DR6A 1F0XA 3PTWA 3C16B 1U2FA 4N76A 2E29A 1R0CB 3MCMA 2ILZA 4Z2XA 3Q2SC 5DETA 2MJNA 2ABYA 3HSDA 4RLEA 3TRGA 5K20B 4H54A 1Y00A 3DOMB 1IKVA 2CQ1A 4Y28C 3UVJA 2ZH7A 2DGOA 2B8PA 5F41A 3R1HA 1NDPA 3BZQA 4OQJA 4LQ9A 3RTVA 2JDJA 3HSGA 5KFKA 1RHQB 1J5OA 2PEHA 3DYAB 4OIXA 2NREA 4ICLA 4DV2J 1JXEA 1FJ7A 3T1YF 2XBPA 1AXQA 2HAIA 4NA1A 3K5OA 3MM7A 4HTIA 3M8QB 5HMWA 3H5UA 2CNOB 2OHDA 3KLIB 5GMEA 5KFSA 4C8OA 4B9LA 2GJ2A 4HACA 2F8MA 4QOTA 2H1YA 1XK8A 4B3MF 2BEFA 2JLEA 2AYMA 3QAUA 3GFHA 4DUTA 1RZMA 5D4PA 1H38A 3PEJA 2EFNA 3IS9B 5IWAJ 1CG2A 1X60A 2BA9A 5IFMA 5HLFA 1C0TA 1HKAA 4OYWA 4GVBB 2VPYB 4K4WA 4C48A 4ECTA 3DLGA 2V5HG 2ASLA 1NK4A 3G9CA 1RAJA 2YH0A 4C7QA 2UV8G 3CVKA 3QGIA 4UQGA 4K7QA 2A18A 3DOKB 3ZZYA 2IIHA 3QIPA 3EGWB 3T9NA 2RILA 3PX6A 1VQ4S 5ETLA 3R5GA 3GV5B 1KSPA 2CQCA 4LF9F 4DR7J 4PEOA 5KFPA 4JI2J 3CNQP 1YZ7A 3DRSB 4X4UA 4F0HA 3QLHA 2MZ1A 1M5VC 3KMQA 4DUZJ 3DRPA 2MKKA 4OHWA 4IG0A 4ZOSA 4J9NA 1RWVB 2KRBA 3MECB 3GLJA 4QWBA 4U95A 3QJLA 3KK3B 4AFFA 4GKKF 4UY8T 4DFKA 1JLFA 1WC4A 3UNGC 4QIGA 1HMVB 1VLYA 3UVJB 4ZIVA 3VAMA 1VHIA 2MGZA 2HHSA 1P1TA 4YS2A 5DDPC 4X4TA 4ZN1A 1AFIA 3CJRA 3KXDA 2DBBA 1OY8A 1RWPB 4FF2A 1NJXA 3CJTA 3H2VE 4MTPA 1AT1B 2VBYA 3I4PA 2V8VA 3AAWB 5GAHI 2F4VF 3UO0A 4QYZK 4OHVA 4LIWA 1U2CA 1R6YA 4IOBA 3R7SB 3VALA 1L3UA 1KWMA 2HNYA 1RISA 2B9EA 2RAQA 4M8LA 3RUBL 1NCLA 1U4BA 1VRUA 1PSDA 2YPZA 3CJ0A 1SV5B 5LMNJ 8ATCB 5HMZA 2F65A 2W2PP 4J90A 5K8PA 2LYVA 2VQEJ 3DM2A 4DUYJ 4V19X 3GILA 2BKNA 4JI4J 2WRMA 3D1QA 2WZ1A 3NRBA 1WF0A 5L1IA 1GQEA 1M1KT 2LXFA 1PBUA 4ES1A 2BJ3A 2J7KA 1KFSA 1HNVA 3H4DA 3CCJS 3I56S 3NGUA 1VQ9S 3DOKA 2IJFA 2XI2A 1CJUB 1V5IB 5D4NA 4TY8B 2H4WB 2YY3A 2VFRA 3KG0A 5HAOA 1X4BA 2IJNA 2M8HA 4LRBA 5K14A 5B08A 3BQ2A 1NSPA 4LF8F 4NYPA 4B3SJ 3QPIA 1WOPA 2C2KB 2CJ9A 4K59A 4CH0S 4K4YA 3MM5B 5T7LB 2XULA 4CTAA 2VFSA 4PYDA 2PFFB 1JLBB 2B4UA 3IRXB 5U47A 3V4IA 1RXOB 4WWSA 2A10A 1S6OA 3NBPB 1TKZA 4NCAA 3PJWA 3UQSA 1VCTA 5BR8F 1CJUA 2BE9B 3ILJA 2QMWA 2FHKA 2DCLA 4QBUA 2W9AA 4P73A 2OMLA 4KYZA 1NK6A 3KJVA 1RT5B 1M5OC 1FRKA 1YDLA 5KFCA 2B9YA 4KO0A 1TV6B 4HT5A 3FBCA 1HIYA 4O44B 3W1YC 4CLZA 1S0NA 3UW1A 3NOGA 2KXHA 4O0IA 1IKVB 3CJ4A 1RJJA 1Q1KA 3MM8B 1S49A 5KFBA 4OYMA 1Y3JA 1SH3A 3MEEA 1LW0A 4ZMMA 5K5MA 3UDCA 3NS7B 3KLGA 1HNZF 3SIPB 3GCXP 1RBOB 2J6UA 3R7NB 2XYGB 4NYZA 2IRUA 1LW0B 4MK7A 3QIDA 2DHGA 4PG7A 4X4QA 3UR3C 2PC6A 3CJKB 2CA9A 4LMZA 2BUNA 1RB0A 2VDIA 3DRRA 4ETZA 4NLPA 4ZK7M 3H7HB 1MMNA 4RZRA 3BR9A 4B3MJ 3LGHA 4P52A 5L8RC 1T02A 3GSIA 2XHCA 1URRA 2YX1A 3BSAA 1TUWA 4DPXA 2HHQA 5KT6A 1N88A 1C1BB 2MKHA 4NWBA 3EYZA 4OI3A 1RCOB 1WHXA 3THPA 4EBEA 4OV6A 4CRJA 1VQ8S 4LF4J 3GJTB 2IDLA 2N3LA 2HWHA 2JVOA 1S7HA 4OV1A 2YKQA 3PRDA 4UT4A 5J2MA 1E6VA 3MFIA 2AP6A 3G87A 2G2OA 1C0UA 4DCPB 4EZ9A 3VVUA 1NJIT 4NPOA 2ZUGA 3PIOQ 4OL8A 2GHPA 1MSWD 2ZHAA 5K8OA 3OLAA 3EPIA 2AYEA 4HTJA 1OPIA 1VGYA 4IFYA 5AXNA 4DQSA 3MMBA 1VHFA 1PILA 3U1NA 1NK9A 5D0HA 3B54A 2V9WA 4Q45A 1TKTB 1Y5NB 4NZ7A 4J9OA 4OZ0A 4LRFA 1G4CA 1TUGB 2XQCA 4HH0A 4JB8B 1RTIA 2YWEA 4AT1B 2XMWA 4ZPVR 1HYSB 1S0VA 1FJCA 1ACMB 1YBAA 1XTZA 3AD7C 1E6VB 1S0OA 3MAQA 1UWBA 2OEKA 1UJ4A 3D6TB 3RBEA 1PC4A 2H51B 3N4WA 1B7FA 4IO1A 1T94A 1Q8KA 2ATCB 2H9ZA 3DGPA 2DR5A 4JI6J 3JQJA 1KS2A 4C11B 4H4OB 4EU0A 3QYYA 1GFWB 2MZRA 2GQ2A 2YWHA 5L9XA 3RAQA 1SV5A 3ZZRA 4X4OA 2CNLB 3D0IE 3SFUA 4LF2A 5B0BA 1QY7A 3FFIA 2GGPA 1RHKB 4ECZA 1S6QA 3E51A 2PDAA 2BRKA 1YRUA 4ZITA 2R7UA 3D0HE 1AUDA 3EZOA 3G2XA 1URNA 2H5EA 2M4MA 3M1VA 4J9UE 3RAMA 4LBIA 1RT6B 4ZLJA 5BYSA 1BY9A 3GONA 4NXMJ 1P27B 3OXFA 3FFIB 5IM0B 2MGZB 2E9RX 5ETRA 5KFRA 4WKRA 4MK8A 5D15A 3PKMA 1WNEA 2AX0A 2D74B 4LF9J 4DR7F 4USKA 4DHVA 5HSPA 2L9WA 1JXLA 1GXTA 2H48B 1QAXA 3N0VA 4TU7A 3LOUA 2W9CA 1FNMA 1NU4A 3WC2A 2QN6B 3R5BA 5AT1B 5KT3A 4PR6A 5ETQA 2UXBF 1FDNA 3P45B 1UZHA 2Y8WA 1GK8A 1C1CA 1GAOA 4XPCA 4LF6J 4YB5A 2ZVSA 1TP7A 1S72S 4ES3A 1APSA 2R9LA 2CQIA 2APOA 2WAQD 1HYSA 1S48A 2GMHA 2O01C 2ZZNA 1WD6A 3SV3A 1R3NA 5KFLA 2WVFA 2RT3A 3I87A 2D7SA 1QUVA 3M05A 3C3LA 2I2YA 3GTYX 3LF0A 1MN9A 2XNQA 1D9AA 1VI7A 2ALYB 2D9OA 3ZTRA 1UVMA 1Q7YT 1GTEA 2C2DA 4QU6A 5BXIA 3CD7A 1SL0A 1KQSR 4RNMA 1KN6A 5ETNA 3RB3A 3DLHA 2V69A 2R8JA 4OMFG 3IFEA 2CAJA 2DTJA 2Q79A 5DDRC 2YKAA 4NLSA 4WK3A 2CVIA 1QVGR 3ETOA 3GJQB 1KKHA 2HHVA 5CYQA 4PABA 1XERA 2RD5C 3DLEB 3TARA 5KG7A 3CCRS 2G2ZA 1WTBA 3KHGA 4K4ZA 4C3LA 4AXIA 2L48A 3M9MB 1W2IA 3BH6B 4EZ6A 4DV6J 1VQ5S 5G4DA 4ERDA 2HBQB 3AOAA 3FVYA 1Z2ZA 2W7PA 1X5TA 2Y0BB 4I0WA 2AGPA 1V5VA 2WSCC 4NMXA 1H6KX 3U7JA 2MJUA 1N5QA 1X4EA 1B0PA 3CCUS 2J0QD 4FKXA 3JSRA 1VJWA 1NDCA 5A6WA 3JQKA 5F8NA 3P3DA 2DEJA 5DLGA 4Q0BA 4B9SA 2FJXA 1X31C 1VMBA 3DHWC 3ELHA 4TYBA 4CIOA 2W8KA 2VH7A 1U45A 2OJ3A 1HBUB 1WORA 2AF6A 5IT4A 1G6BA 3PX4A 1IKWB 2QFJA 1HD1A 1P8GA 4CLSA 1CJKA 2B4VA 3MEEB 3UN5A 2RQMA 1UA0A 3IBWA 3CCLS 3HT3A 3BSNA 4K5SA 1FE0A 3DXBA 5DM7Q 3K0JA 3R2CJ 1UA1A 3GR0A 3DDKA 1X5SA 2HBRB 1HR0F 2WVBA 3RBDA 1KLMB 3DXSX 1QE1B 1SQEA 4C3MA 1NB2A 4ZPDA 1BQMB 2KJVA 3OBIA 2WOMA 5EHHA 4NLDA 2VBZA 5KFZA 2Y3YA 3IM8A 3ZZ0A 4E0DA 2ZOMA 3CD5A 1VBKA 4M1KA 2B5JA 4DR6J 5CYQB 4FBUA 3W2VA 4PUOB 2NPFA 3NBPA 3DI6B 2MLZA 2LFVA 1NKBA 4KH0B 1RADB 1ZM2A 4LSZB 3ET6B 4WJBA 2LMIA 1PGZA 3EM1A 3MUTP 4Y6IA 3GB0A 3M7VA 4GVBA 4PXBA 3OVAA 1DFDA 3UR0A 2NYHA 3MPYA 4XAKA 1QLNA 1KC8T 3ENWA 4IQMA 3E01A 4RBVA 4NA2A 2GVZB 2N7YA 2OPPB 4FYXB 3M9OB 2G9OA 4ILMA 5FD1A 2DRAA 1ZZFA 1RI7A 3GU0A 4F02A 2GHWA 4DCOB 2HZVA 1DTTB 2ROGA 1VQSA 1OWXA 1RT3B 2GS8A 3J80Y 2R8IA 4LSLA 4J9SA 4RW4B 1GX6A 1PIEA 3GE9A 2UZAA 4I4BA 3TAMA 2KL8A 2LQ9A 4WF9Q 4CP5A 1A9NB 3LP0B 4OYPA 3WDOA 1TL3B 3PR4A 1HI1A 5DQHA 3PHEA 1T9WA 1RU2A 1SIZA 1FRMA 1XMBA 2ZH3A 4ECSA 2EEYA 3F44A 5HROA 1KOOA 4CYUB 1N5YB 2N7CA 3FEZA 4X62J 2ASJA 2AJ0A 3CJQA 4KGKA 4D3HA 1D8YA 1ZS6A 2EW9A 4OX8A 4HH1A 4MT1A 4AE5A 2J9DA 4MIWA 5J2QB 2PT0A 3JS9A 4Q44A 5HROB 2O1PA 2P9CA 2ZM6J 2C3YA 3EGVA 1K44A 2GGPB 1GMUA 5L1LA 1S77D 1RWMB 1XEZA 4K0KF 2HQ3A 3FK4A 2PMWA 3EGNA 2W9BB 1L5UA 2DB1A 4HVZA 1HWKA 4YB1P 3ENAA 3L95X 1SC3B 4NA3A 3KHLA 4IG0B 4P9SA 1RGVA 1VQPS 2AJ2A 1E6YA 2PA8D 3BO3A 3LA0A 5ETMA 1CBKA 4P10A 3J81j 1WELA 5LMUF 4OZ5A 4R8UB 4KHMA 4NLYA 4U7UK 3WIVA 1D9DA 2F40A 1AZSA 1IR2A 1OQ3A 2KU7A 4NI2B 1T9YA 4ZVOB 3AJ1A 3P4UB 3PEHA 3AODA 3PYGA 4M63A 4EFAC 1WF2A 1YITS 2BQUA 4C8LA 1TQLA 4RW9B 2MKSA 5A8WB 3FCHA 4R25A 4DN9A 5KFXA 4OHXA 3PKYA 1LWEA 4KHPF 4Z37A 4DL7A 1H7XA 4OLPA 4I2QA 4WU3A 2BJ1A 3HULA 5KT2A 3W9JA 2WVEA 2ZDOA 2FJVA 2UU9F 3W3SA 2QTWA 1YKWA 1C1CB 1MWZA 3FRZA 4GKJJ 4UOFA 4CO2A 2YWKA 4AL7A 2JEFA 2YKOA 4Q43A 4X4NA 3C6TB 5H1SV 2D3UA 2QA1A 4QIEA 4B9UA 3TUPA 2NXEA 4LSNB 3UE2A 1KLMA 1S6PB 4HLBA 3OL7A 4C4WA 2QMUB 4GKJF 1RHRB 1U25A 2AEJA 1IR0A 1FXRA 1FRIA 2EPIA 2WW8A 3AQPA 3I96A 2XMKA 1RKIA 3LP2A 3M6WA 3GFZA 3DFEA 1FWLA 2I0XA 4CLWA 2HWTA 2W1BA 3GPAA 5JVHQ 4XO0A 1PKUA 2XZDB 1RLCL 4KR0B 1FF2A 2XSFA 3K17A 5IWAF 1VC0A 2PN6A 1HARA 4KGXB 3MD1A 3AJ2A 4RL1A 2QE5A 1RYRA 3MPUB 3G71S 2CWXA 2DGQA 3IG1B 5LJ3Y 4WYWA 1N34F 3VHQA 3MM8A 4J9PA 4PXCA 4F67A 2Y1LB 2VD3A 3PW7A 2CQPA 4IG3B 3W5ZA 2GNKA 2KT5A 4I56A 3UD5A 4DG1B 2CPDA 1ZAVA 3FBEA 2VPZB 2XEXA 3CDUA 4RJVA 4OHZA 1Q53A 3SDEB 4C0BA 2E5JA 7FD1A 3UNYA 4DV7F 2KG0A 1BUXA 3AD9C 1FJEB 2AD9A 1SC6A 2AWZA 1B64A 1ITPA 1B99A 5D78A 1K8AT 2NR0A 3Q83A 3S01A 2UUBF 1RHUB 2GVZA 3W2WB 3DLGB 2XWXA 2B7CB 3UN3A 3W8GA 2N82B 1HNXF 1C0TB 3PNIA 3I32A 4NRTA 3TX8A 1QSYA 1EIYB 3NNAA 1F6TA 1QAJA 3JXOA 4IFVB 3DU6A 1R8HA 3HF5A 1N48A 2KB2A 3BO4A 5M2PA 2HEKA 2VODA 3PJ9A 2HFUA 2J7WA 2G0CA 3W2VB 4NRUA 5KFIA 3V6HA 2AYBA 2B5JB 2ZJRQ 1DY3A 3HP6A 3OVBA 4X4PA 3M8QA 4R0EA 1EAYC 1S1UB 3U27A 1F5BA 3NGDA 1R8AA 1AROP 4P7TA 5KFTA 4DR1F 2ZKTA 4A8QA 1MW7A 1R7IA 2DCUB 5D3GA 1KFDA 2LXIA 3ZZZA 3G6ES 4I2PA 4LFAJ 2VIHA 1U1LA 1B7YB 1BHNA 1VOMA 1IR1A 5L38A 3EZUA 2K8GA 3FSXA 1ZM4A 2JRSA 2V8HA 3J81U 1YJTA 5DG8A 4DR3J 2B8QA 3PO5A 3OQ2A 2BKOA 4JOUA 5HJYA 3IRWP 5EDWA 3KJQB 2RVJA 1N32F 2MQNA 3OSNA 2Y8YA 5IT9U 3OSPA 2BANB 1ZA2B 5IS2A 4GC6A 2CYYA 2VG5A 1VRUB 1EETB 1S1TB 1SXLA 2ACYA 2PSZA 2JEJA 4YY3J 4OJ3A 1NKCA 3OL9A 3TA2A 4FXWA 2D69A 3K2YA 4O3QA 2XMJA 4E8UA 2RMLA 1S1VB 2BX6A 2OLWA 4DFJA 3MM9A 2IPOB 4DR6F 3HKWA 1JLFB 4F4XA 5KT7A 2M5YA 4X4SA 3VV2B 1FKPA 3X1LB 2HNDB 4N8NA 1OPZA 4QW8A 1U8SA 2H4YB 5E2QA 5KTQA 1WC3A 2DISA 1B3TA 1D1UA 4ELVA 2AMCB 2MHNA 1RTZA 3H25A 3D3BJ 3X3UA 1ZM9A 2V0NA 2CZVC 3UI3A 2J8SA 1I51B 1OJ4A 2I5JA 2DGSA 2RSQA 3I6PA 1RCXB 2AYGA 3HFKA 1I3OB 5AJ3J 4C8ZA 3IRXA 2Z0GA 3T6JA 1NUEA 1Q95G 4ZLNA 4EO6A 2IJRA 5HMXA 5KG2A 4RU2A 1YI2S 3DMJA 4Q2LA 3U1MA 2ERRA 2VL1A 2ZD1B 4Y2KA 2AGQA 5J2PA 2VONA 3ETMA 1LWEB 2QX0A 2DNYA 3N01A 3I82A 3TZWA 3RYLA 4BHQA 1X0PA 2EI5A 2M9KA 3NS5A 2RNEA 3P5TL 3SSSA 2DO0A 3I31A 3D6FB 1I6JA 1X5OA 3D3CJ 1KVJA 2BE2A 3I5AA 3H98A 4NI2A 4OYBA 6FD1A 2M52A 5LMNF 1U6FA 3TUZC 4FBTA 1TFYA 4USIA 3D5MA 2VFVA 5I3PA 1EKRA 3ZZUA 3M6XA 4XK8C 3JYTB 3S1TA 4F0KA 2QJ3A 2RF2B 3PFOA 4DWIA 5C2CA 2M2BA 3J7ZT 2XYHB 3B4DA 4ECXA 2JWNA 3GYGA 2DPIA 4FF1A 3EE3A 4QR0A 4XTTA 3VWSA 2XGPA 4JI1J 2ZUAA 1LK5A 1N33J 2HRUA 1OYEA 2ZBPA 3HHLB 4TVAB 2H5JB 2O5DA 2OKQA 2OEMA 2QFIA 4RU9A 2ZH2A 1S1WB 3NMAA 2CQ2A 5HI7A 1N33F 4L6V3 1HI8A 3S6EA 3JQMA 3LWMA 2J8AA 3SQGB 4F50A 2CDRB 2VB6A 3CJKA 4H4KC 4DR4F 1FE4A 1WC6A 5KFVA 4ED3A 2V8PA 1YJWS 4FZVA 2V63A 2CFXA 5SZTA 2EK1A 4YR3A 4CO4A 3M8PA 3PW2A 1FO1A 1CS4B 2DNKA 2V2VA 1UFKA 2Q3PA 3FMBA 4YY3F 2FJBB 3ZFVA 3D54A 4K5RA 3M2VB 3RRHA 1K1QA 2Y1IA 3OL8A 3JSMA 1WG1A 3RW6A 4U8VA 2CADA 2IHR1 4KHPJ 2E7VA 1GMVA 2DJWA 4U9RA 3AA9A 3OTOF 3HJFA 3MOJB 2KH9A 2YKNA 3PO4A 2BANA 1SJ4P 4WFYA 2HSEB 1F2HA 4L72B 5SUHA 2E5LF 2KYXA 4ZVUB 3JAMY 4JI6F 2MLYA 3H2LA 3IR5B 1T05B 1UVLA 2XY5A 2DNZA 1IQZA 1R31A 1N52B 4A48A 2FHMA 3AXMA 1VS3A 2EBGA 1M0SA 2OPSA 1ROFA 2OPPA 4UOCA 5MLCV 3T5KA 2BRLA 4IRDA 1TKTA 2KZMA 1NPKA 3K8VA 3CCMS 3MTKA 1PJ7A 2DD8S 5MAOA 3HCXA 3Q8RB 3T1HF 2FZGB 5FJ4A 3N5BA 4UTGA 3T1YJ 2IY5B 5KFFA 1RTDA 2FB0A 1KHVA 1GX5A 2BYCA 5EX3A 4RW7A 1WHWA 3PW5A 5L9NA 1F1BB 4G6VB 4JV2A 1CC8A 4JP8A 2PMZD 4K4UA 2RHSB 4CLPA 2ZC3A 2X1BA 3K57A 3BBCA 1FJGF 1F2GA 1IVZA 1WSRA 4WKYA 4ED6A 2HYIB 3CO0P 3ZXWA 2HZAA 1ULRA 1Q82T 2PD1A 2Q6BA 4GVLA 2XSJA 1M5PC 4PQUA 1HWLA 3PW4A 4AUKA 2IM1A 1J5OB 2XS5A 3EUNA 5DQIA 5HVFA 3HVWA 1U0SA 2QIFA 2KKHA 3DMJB 1TMMA 1DQ9A 3BREA 1GTHA 4MYTA 4M94A 1G3OA 2M0GB 1Y5LB 2GC8A 4DSLA 2Y9HA 3EXYA 1AUSL 5KFDA 4LR7A 1N6QA 1WUUA 3IWNC 2ACMA 4HDHA 5CZXA 1CSJA 3VQSA 3A13A 1YVFA 4H4MA 2QEXS 4LUBA 1FEEA 2GVDB 4ZP7A 2P9EA 2M70A 2GIFA 3QGGA 3R9LA 5GAGU 2AJ1A 2CKWA 1X7VA 4J5OA 2V67A 5F3TA 4DX5A 2Z2ZA 4DFMA 5F9NA 4DR2J 1FWPA 3P5BP 3KK2B 1T95A 2JEGA 3N6MA 8RUCA 4XPEA 1AFJA 1RWWB 3MM6B 5ETKA 3VGSA 4ETXA 1VBYA 1JKHB 3F0NA 2HGMA 3ZC4A 1FKAF 4PG4A 3Q8QB 3CC7S 2E1MC 2ZKUA 2LEAA 4USHA 3MECA 4LBPA 3R8YA 1UVKA 2A1BA 1G7CB 2J76E 2LQ5A 3ZNUA 5BJRA 4X4RA 1Q5VA 1K47A 3EMTA 3MUMP 2AEMA 4LIRA 3TNVA 3W61A 4Y34A 3FUYA 3MI7X 1SKSA 2YNIA 1Q86T 5DQGA 4DL6A 1S5ZA 1FWKA 1X8DA 3PCOB 1MG7A 3GFYA 1HQUA 4L76A 5KFWA 2PIIA 4N7TA 3VAFA 4QZVB 4C8YA 4DR5J 5D0RA 4FVMA 4A8YA 2AEFA 5GMKa 2D9PA 1MROA 3N79A 2UU9J 1U6BA 2LCWA 1RWKB 4MMOA 4JI7J 3POTA 3DLKA 3ITHA 4I2PB 2MZJA 1U24A 4H4KA 4UZBA 4IRCA 2DEIA 2HVEA 3QFHA 2PO4A 4FP9A 5K14B 5J1NA 4B3OA 3C19A 1TVRA 2IRXA 3C6UA 3G6VA 2VHGA 1VISA 1FHTA 3POTB 1M5HA 1RP5A 3V6KA 1U47A 1GXUA 4O23A 2MLXA 4AQYJ 3J7Z5 2DNHA 4ES2A 2D3O1 4RW9A 1UFLA 5C24B 2VC0A 1KBRA 1H2VZ 1S4FA 3E8OA 3TUIC 3HLUA 1LWFB 3EVWA 3QWPA 4CLKA 4LRCA 2BJ7A 4CM0A 2YNHB 3AT1B 1TK5A 4LF5J 1FESA 1JLGA 3A4TA 1HW9A 1T0TV 3DOMA 4DUYF 4X66J 3T5JA 1E6YB 2HGLA 2K06A 1TTHB 2DHHA 2FC8A 3LP1B 4S0MA 4D3GA 3CD0A 2FJEB 5E33A 5AE2A 5F8LA 4WU2A 4ZPCA 4KRWA 1U1RA 2XB2D 1R0BG 1C1BA 3M8YA 3M32A 3QNWB 4ZPWR 2QO3A 2XLIA 1RT1A 1W7WA 2O66A 4OFZA 3TR5A 2R7XA 1XR5A 1O6XA 2J6TA 4IUFA 3GSDA 2N3OA 1RA6A 3JTNA 4RUCA 2SXLA 4P7VA 3NEKA 1F60B 4URQU 3TWZA 2YKMA 4PXDA 1Q7LB 2DNRA 4PKDB 1TL4A 2IFXA 1J2VA 4IR9A 2GCFA 2JJ4D 4NZ0A 5LL6d 1UCNA 1KR4A 3OFFA 2E1PA 3H42A 3MURP 2OEJA 4URSA 1Q0NA 1PC5A 4FS2A 3PYDA 4DPOA 3TZYA 3J81Y 4W4MA 2D41A 2VQEF 3RB6A 1R0AB 4ZS6A 5C25A 1L3VA 2MKJA 3C15A 2DHXA 1YJNS 1G2EA 3OPKA 3TUJC 1XNQJ 5LSOA 2DKOB 2RUSA 2OGUA 4NASA 3W9HA 2BMBA 3FGVA 4LRDA 4KIAA 2MY8A 4Z7CA 2JL9A 1KLNA 5FDLB 5AXLA 4UQTA 3E3XA 4PG6A 1WKKA 3K5MA 2ZBIA 4P72A 1M5SA 5HMYA 3TAPA 3OR2A 3DGVA 3QT5A 4ZP8A 3UFCX 4PQUB 4IOCQ 1WTFA 2BJ8A 4Y00A 3WX4A 2XZTB 3RBZA 1NXIA 3IR7B 4XDCA 3MF5A 5HLFB 1IN0A 5A8RA 4JI5J 1IKXA 1CULB 3AXKA 2DNNA 2EK6A 2WBMA 4Y0FA 2XO6A 5D3GB 3BGLA 3NNHA 2DIVA 2ZDPA 4F04B 4QJVA 3CMQA 1NK8A 2KG1A 2R8KA 5KFQA 3BSCA 4ATNA 4ZLPA 1QUPA 4DPUA 1Y7PA 4A8WA 4LFBF 2C28A 1JJCB 3TANA 4EO8A 1RTDB 1HBMA 1UJ5A 1IBMJ 4PG8A 2JFKA 2VKRA 3DI6A 4L73A 3V81A 2CG8A 1YJUA 4ZCLA 4DPYA 3MCNA 4WIIA 2BW7A 1UFWA 4X2BA 3KNGA 1ZPVA 2FVSA 2NQPA 3HD2A 1U0HA 2HFNA 2QSFA 4O4RA 1CJVB 3CXCR 1NDKA 1QE1A 4F4WA 1NJYA 2JZ5A 2R7RA 4N41A 3DM2B 3C15B 5K9FA 1SI9A 2Y1JA 5F8MA 1R0AA 4A8MP 3HSZA 1M1GA 1FRJA 1Q16B 2ZOFA 2DHAA 4OYIA 5D4OA 3TI0A 2MB0B 3Q8SB 1MU2B 1Q8BA 3GP9A 2QT7A 4IYQA 3DKDA 1SKWA 1RABB 3Q24A 1H7WA 2IVYA 2RKIA 4KT0C 3KK1B 3MR6A 2X1AA 2OUGA 1JLEB 3M2RA 1X4AA 3TEGA 2E1CA 2I6WA 2MSTA 5KG0A 4JI8J 5F0UA 2YH1A 4WPAA 1OY6A 4XDDA 4RUHA 3QAEA 3MR2A 1S1XA 2HK3A 3CCWA 3W60A 4I67A 1NAQA 1RWUA 3OD2A 1O0PA 1S6QB 2L9DA 2QC3A 5HJXA 2CJQA 5THWA 4F26A 3AA8A 1YJ9S 2GAHC 5C2GA 2OPRA 2UUAJ 2R7TA 1HMVA 4GC7A 4Q7AA 1YHQS 3WX8A 1JIHA 3Q8YA 3M2UB 2HFVA 3M6UA 2HK2A 2VG7B 1B0TA 2DGXA 2OTJS 4IOAQ 4BBYA 1I94F 3OTEA 4Y2AA 2W4DA 1SL2A 4DEZA 2CPIA 1OQ6A 1WC1A 3FQLA 4RW4A 3EJMA 3U1LA 1F9FA 3JYTA 4ECWA 1TL5A 4FN5A 1N5VA 5T7LA 2J5AA 4ED7A 4JYAJ 1WEZA 2GIRA 2HHXA 4QIFA 3RZAA 3NS6A 2P6SA 4ZCMA 4B9TA 2PI5A 4Q8EA 4KJIA 1N0UA 2EFQA 2F9JA 1Q5YA 1S79A 2HZCA 2EFVA 1VQMS 3D68A 2D3OR 4ELUA 1WHVA 2DNGA 2FJDB 3BGUA 1DHMA 1RT7B 2CQ3A 3R5CA 4WTOB 1DARA 1L3SA 3H20A 1S57A 5KFNA 2MQQA 5GAGI 1RSCA 4ITSA 2DGWA 1HWJA 3ITHB 4J9MA 4FXVA 5B0CA 2XY7A 4I6AA 1HBOA 2NXNA 3LTOA 3CTRA 2YQ1A 4ANDA 3O1LA 2RDJA 4DV4F 1SUQA 2HNZB 2V9KA 5DZ7A 1IKYA 1U02A 1OY9A 3A8JA 5DDOC 1L3TA 1NJWA 2WTFA 4O3RA 4QU7A 5CD4H 1D8ZA 1RHJB 2K3IA 1YJVA 4CO0A 2BQ3A 1S99A 1BQMA 4U96A 4DF4A 4L75A 2R7VA 1OMSA 2GJFA 2YX4A 3I0SA 5HVGA 3EX7B 3BGRA 1JWWA 2QLWA 1HL6A 2EG1A 4DQQA 3G86A 4DL4A 3MFHA 5J1EB 1CC7A 2JC0A 1C4AA 1R89A 3BGRB 3MWBA 4JI8F 4DQPA 1RT1B 3QJJA 2YPYA 1RT6A 5KG5A 2UXCF 2GO9A 2LEBA 3M32B 3GJRB 1U1MA 2VG5B 3MMJA 2VQFJ 3KWMA 2XTJP 1JB0C 1XNRF 1SJRA 3HM9A 3QO9B 4L3KA 2XMVA 3HHLA 5ETTA 3DLBA 2NXCA 2HHTA 3RB0A 1HNIB 2E5IA 3D7SB 2HVIA 1NK5A 4U67Q 3GIJA 1TKXA 1XNQF 2DY1A 4PWWA 4M5DA 4X64J 1IJFB 3KG1A 4CLTA 4Y2IA 2HVDA 1XMOF 3NKYA 4QYRA 3DU5A 1RWNB 4C97A 1I1GA 1EQMA 4YHHF 1QJHA 4ILRA 1HBMB 4LSNA 4ZIWA 2W4PA 1ZOTA 2QL5B 2LA4A 2XSJB 3KLFB 2CIMA 1S1UA 2NSCA 3IS9A 1XMQF 1L3KA 3E01B 3RG6A 4DJBA 5F9LA 2R2RA 2HRTA 3MEGB 3PJXA 3CCZA 2RQ4A 1XIQA 1CJTB 2ZFHA 1Y10A 2Q1LA 2YNGB 2Q6CA 1LXNA 4FYYB 4LRAA 2U1AA 5K8NA 3K5LA 1VBXA 4X4VA 4CH7A 3HVRA 3NXZA 2R8HA 2IBKA 3BEGB 3AD8C 5B0EA 4F2SA 4HT7A 4LBHA 3UCGA 3CB4A 3A3OB 2F4VJ 1CJTA 1TU0B 3OR2B 4IFVA 4LF4F 1CQMA 1YG0A 1BQNB 2BBEA 2CQHA 5A8WA 4PUOA 3ZO7A 4RBUA 2OAUA 2FGCA 1H73A 1OYDA 1R6VA 2ZNZA 3W65A 4RUAA 4LF5F 2PA3A 1WEYA 2V4JA 4X64F 3KLFA 4NYOA 4R5PB 4ENOA 1U6ZA 2B7BB 2BR0A 4DLEA 1N34J 2VG6B 5GMDA 4J91A 3L7PA 3GIRA 4C8NA 2OH2A 4FYDA 3Q23A 1Q79A 2V2KA 3L7OA 4RUBA 1FDDA 1SH0A 2CQ0A 2CRLA 2FZCB 2VUGA 4PQAA 1P6TA 4KAIA 4YEAA 2F7VA 1UETA 2RDIA 2VPWB 3G6XA 1VQLS 2JEIA 2RJZA 1FVSA 2KDOA 3KK1A 3T5LA 1MWYA 1HD0A 2GX8A 3OTOJ 3HD1A 4RW8A 1K1SA 4Y2CA 5HQLA 4A8SA 2EXUA 2LU1A 3ZTSA 2ZH4A 2B9WA 3I0RB 3NGSA 4EEYA 3LQVA 4USTA 2ZWOA 3N6NA 2AKWB 2NS1B 3T9ZA 2IMWP 1RAIB 2F9DA 3KLGB 4M95A 1HLWA 2YNFB 4RWWA 2O67A 2HLUA 2OSQA 3Q22A 5EX0A 2V8GA 2RU3A 1KTQA 2GO8A 5A0YA 8AT1B 2HHHJ 5D8HB 3CJ5A 3I5CA 2ZH5A 3BYRA 5EUHA 1FFWB 1JLCB 4NOHA 1BQXA 2QYCA 2YQ0A 4N47A 4TLRA 2BDPA 4C11A 4TXSA 2I9SA 4NLTA 1FEHA 2Y1RI 3QLHB 2RQCA 4EYHB 4DU8A 3HK2A 1LWXA 2UUTA 4DSIA 2D1CA 3PV8A 3V5RA 5ITHA 3MMAB 2W2QP 2BXJA 2DH8A 1GMWA 3R3TA 3S8SA 2E9ZA 2HBZB 3MDFA 2JLGA 2J9DE 1V3ZA 4KKOB 3SEOA 4A47A 3K7RA 4AL6A 1HNZJ 4U7UD 2BE2B 4YMEA 4DV3F 5A8RB 5E41A 2ZJPQ 1BC6A 3TP2A 3THVA 1LXJA 4RWXA 2UVWA 3FJ2A 4KBIA 2ZD1A 2BV3A 3CJ3A 2HFZA 4KGZB 3SI8A 5EN1A 4OZ2A 4RNHA 4DI6A 5M2UA 5KFEA 1Y9OA 5BYRA 3PG9A 1FFGB 2ZBRA 1IXKA 5HO4A 2NCKL 3DN9A 3M8ZA 3Q8PB 2W24A 1RAGB 1D3WA 4DSKA 4R8UA 5HQ8A 1DZ5A 1XMOJ 2W01A 1FXLA 2V94A 4BC7A 2OIHA 4LQ3A 2G1HA 2D3ZA 2CG4A 3A8IA 4OZJA 3V4MA 4NMLA 3NNCA 1IBCB 4ZVSB 1T9XA 5J2NB 1RAAB 3MPVA 4LF7J 4KSEB 3TVYA 5H9EK 1BMQB 3L3CA 1DLOA 4J37A 3SV4A 4F7VA 5EGYA 3GR1A 2Q43A 3IMQJ 5CYJA 1K9MT 3BS9A 4X66F 5J1EA 4TU9A 1S97A 1S9GA 1SVDA 4FYWB 3M8PB 3KHRA 4OYAA 4M5NA 2FD2A 2KT3A 2QLFB 4MKYA 3LO3A 2X1GA 3I0SB 1B70B 2KHCA 4DOZA 1GXLA 5DGAA 2YVSA 4DX8H 2ZH6A 3C66A 4GKKJ 2LVWA 2ZE2A 3HHKA 2CPYA 1V3SA 2O3DA 2VA2A 4Y2MA 2DITA 5AXKA 4PPZA 3AB2B 5DG9A 5GAEU 1RYSA 3CC4S 4PRFA 3K5PA 5CXTA 2UV8A 3CCES 1EETA 1S1TA 1N5SA 5A8KA 5I3UB 1T03A 4RW6A 3UDVA 1CLFA 2ZVIA 4JI3F 2HNZA 2HG4A 3HI9A 1S9EB 3T41A 2NSBA 1LWFA 4ZA1A 4E98A 2E9TA 4FXDA 3PZPA 1VRTA 2HIYA 3AJDA 1FK9A 1LW2A 1SJQA 1PJ6A 2LDIA 4NLWA 1WI8A 2MY7A 4HL9A 1TV6A 4TN2A 2RB7A 1DTTA 2HQFA 4J7CA 1DRZA 2IDEA 1N32J 1RTIB 2MKYA 1X9WA 2MZQA 3P6YC 1RTHA 3KFWX 3OV7A 4B9VA 2EC2A 4URGA 2IBOA 2LU2A 1ZBTA 2E66A 3LANA 2J0WA 3NWGA 2EFPA 2VQFF 2XCPA 3V81B 3CJ8A 1N36J 1JX4A 2XNRA 3DLJA 2G0JA 3OUYA 1FCAA 2VFUA 4UUXA 1H2TZ 3QT7A 1ICEB 1NMEB 1X9SA 4B3RF 1F3FA 1G1XA 1MROB 4NE9C 1UW9A 3CO9A 4LR9A 3N5FA 2AHOB 4EBDA 5HVHA 2UP1A 1O51A 1PYTA 1YJ7A 2RS8A 2YBVA 3FDSA 3DOLB 5CD4A 3GYNA 3KLIA 5JVGQ 2IA6A 2K7JA 3QRQA 2XGQA 2WOMB 1EP4A 3CCTA 2DIUA 1NJZA 3BN4A 1FA0A 1KQGB 2YKNB 3CGIA 3MR3A 2ZH8A 3SYZA 1TUVA 4JI0F 4V19J 2FLOA 2FDNA 3UPFA 2HQCA 1GNKA 2AJ4A 2YTCA 3THTA 3SDEA 5DRKA 2OP5A 5E3AA 2DPJA 1Z1ZA 4NCGB 3MTJA 1NDLA 3OTDA 4I6WA 3OLBA 5A0YB 4IH7A 4FDFA 4I64A 4WE1A 4B08A 1JLAB 2JSXA 4UF4A 2RKIB 4BLGA 1JLQB 3HVTA 4P71A 5K8MA 2KM8C 1RHMB 1SJFA 4ELTA 1C4CA 4ZVPB 4JYAF 4YHHJ 5ETSA 4CLFA 3TW0A 1N5YA 5E3QA 1HPZB 1KQKA 3IAS9 3VAJA 2AIRB 2EKYA 4B3TF 1VK3A 2BACA 2GVDA 3DRYA 3TJ9A 4KE5A 4CWBA 4RNFA 5EWGA 1TL3A 3HT0A 3G96A 4EI2A 4J9KA 2KTQA 2DNQA 4J9RA 4GO5X 3MD3A 4PWDB 1WDTA 1DURA 1ZAWA 2E1AA 4FF4A 2BJEA 2ASDA 2KJWA 4KHRA 3A1YG 1FJGJ 3D1HA 2DO4A 2K2PA 3CE8A 2WONB 3G82A 3QATA 4LSLB 4R0JA 5E3RA 2MXYA 3KYLA 1REGX 3PM9A 3TEHB 2AJQA 4O3NA 3IGVA 4KGMA 5M2RA 4NXNJ 4O3OA 1FDAA 4NZ6A 3T3FA 1F9EB 2RE1A 2RF2A 2IC3B 2RRAA 4LFCJ 4EGLA 3GZ7A 4O3SA 3HHLD 1REVB 2IM0A 3KJFB 4F3MA 1FTCA 2DXDA 4NLOA 3WIUA 3TZXA 5LJ5Y 4IO9Q 4DR5F 1YBUA 2X3GA 3HZGA 1N4LA 3DOLA 1U09A 1ZETA 4ZJOA 1SUQB 3SCIE 3G8TA 1H3DA 4ER8A 2C3PA 1QM9A 2IAJB 2B43A 2KT2A 3M8WA 1NKEA 3TAQA 1Q4RA 3DLLQ 1IWGA 1UJ6A 2BABA 3J7YI 2ASYA 2GJIA 2HKEA 4A4JA 3H0PA 4GRSA 4EWTA 4O4GA 3GV7B 1JMTA 1H74A 4OJHA 3SCLE 2V4RA 4FF3A 1SL1A 2ZC4A 1SB6A 1UAWA 4BC9A 1FI4A 3TQ1A 2W7OA 4TY9A 3UCUP 1HR0J 1FRXA 1HHQA 3GIKA 3BDPA 4B3OB 5D4LA 4V1Ak 4QR2A 1YSJA 4JI3J 1LFPA 2KXFA 2OD4A 3CDEA 3PIPQ 1RTHB 1R43A 3MMAA 1WG5A 4ECUA 2HRYA 2HHWA 2L3MA 2RU9A 3T19A 1KNZA 2E7XA 1MWQA 1RQ0A 4K4TA 4DG1A 2H3EB 1VRTB 5DGBA 4IG3A 4KH1B 3KUEA 2P2CB 4F2RA 4DR4J 3OT9A 3J7YU 1ZTWA 1Y4ZB 2V2ZA 2BJ9A 1NSKL 3OFEA 4UUWA 2R42A 3BKTA 1X4FA 1W26A 2OSRA 1HBUA 3G82B 3RW7A 3VZIA 5A8KB 3PW0A 2UUBJ 1RT4A 2OFHX 2X7IA 1RBAA 2QSWA 2FJAB 1OSDA 4U6PA 4MYUA 4WTYA 2E44A 1MN7A 1KOHA 2FC9A 2PE8A 2ZE2B 2RRNA 3C16A 3HKZD 4USVA 3VZHA 2KM8B 1CQNA 4NLQA 3SQGA 1RT4B 2PGCA 3GWCA 2DR8A 4DL3A 4QQBA 1WSVA 1S9GB 2F5GA 3TA0A 2V4QA 5LXYA 1NH7A 4HYKA 3B4MA 2H54B 4YN3B 4CO5A 2MKCA 2HS3A 3TOQA 4DFPA 4C0OC 1DLOB 4K2JA 1S6PA 2ZZTA 3OHBA 3HSJA 2W8LA 2C1EB 4ZVTB 1XMQJ 3CIZA 2J9CA 2FHJA 2JHEA 3G8QA 1SCJB 5DO2A 3BDEA 5C24A 3DRSA 4YQWA 5RUBA 1WKLA 2WW4A 1Y0HA 3O2IA 3PDNA 3FBFA 4P2SA 3Q2TC 1NHUA 1JQGA 2ADBA 4R5PA 2CVEA 4OZ1A 3SQOP 4C98A 1ZZNA 3HHNB 4JV5J 5B0AA 1NH8A 2XYPB 4JI0J 2FZKB 4ECQA 3FZBA 2G4BA 1AB8A 1CVJA 1VBZA 2QMXA 1VQ6S 4EBCA 2NZCA 1TR0A 1UL3A 1WI6A 3QFWA 4ANEA 2FLPA 1UVNA 1OS5A 3LUYA 3BB5A 1CPZA 2GZOA 4IKAA 3KTQA 2MZTA 3EZ5A 1Y5IB 4C6AA 3OUYB 1S59A 2LLZA 2MZSA 4QWEA 4NLVA 3RRKA 4QPXA 2B9XA 3V6DA 3VQTA 3HHLC 4DU7A 1IBMF 4ZVHA 2JNJA 5J2MB 2R8GA 2ALZA 2FVRA 1UVIA 3VTIA 1S12A 1PG5B 1B0VA 3QQCD 2I1RA 2P9GA 4F4AA 2NZ4A 3IR6B 1DTQA 3MMCA 2H65B 3MEKA 1FRLA 3PXGa 2CNKB 3FBBA 4F25A 2VG7A 1FK9B 1LW2B 3QZ8A 2ADCA 4B9MA 3NGTA 1GH8A 3ZZPA 5LSLA 5FDLA 5L1KA 4WCEQ 2MMYA 2CPXA 4NEZA 3UD3P 2DVIA 3CDAA 5KG6A 1GT8A 5L46A 4HKQA 2HFSA 4NXNF 1RK8A 2GW8A 4TQSA 1RAHB 4F36A 2DRBA 5I3UA 3EDQB 4WFZA 1T03B 3NCQA 3HHEA 3I0RA 4A8FA 2FPHX 1FDBA 1VRQC 4MIBA 5KT5A 4QWCA 1BGXT 3CJSA 5AE3A 2CPZA 3M2VA 2HFOA 2J9EA
chains in the Genus database with same CATH topology
4NL5A 4A8XA 2CPJA 3P96A 4KC5A 3HVTB 1KHWA 4I69A 4WZQA 2UVUA 1NO8A 2DT9A 3HMJG 3QZ7A 5KG1A 4MFBB 3US5A 3G4SS 4IQXA 1ELOA 3N9UC 2GFFA 1RT3A 2XO7A 1DQ8A 4DBQA 3KJVB 2OFGX 5GAEI 3T5HA 4F3QA 1S1WA 3NGKA 5J1PA 4LVOP 4YUDA 3GG1A 1S76D 1V3RA 4LF7F 4G1PA 1M5KC 3V6DB 2QV6A 2MDAA 3KOAA 3LAMA 3DHXA 4IFYB 2R7SA 2HS4A 3AQOA 4I2QB 3NCPA 1FKOB 1N5TA 3PR5B 3MPWA 4OZNA 3WBZA 4C8KA 4ZCKA 5F3ZA 2CQ4A 3CCQS 3H8YA 1KD1T 1YTYA 2B4OA 2KFZA 2B51A 3FEXB 2AU0A 4DV0F 4ZPAA 4CZCA 3UD4P 2AGOA 3DLKB 4FVCA 5DM6Q 2HHUA 4QCLA 1NK7A 2XS7A 2EVZA 1TL1B 2WONA 2KRRA 5E0OA 5CCLA 1U1NA 2C3UA 3H2UB 5EWEA 1UEVA 2RQKA 4DQRA 4C8MA 4M5DB 4OZLA 4PWUA 3ICLA 4QPXA 1S9EA 1TAQA 2QRRA 4PCQA 2ZBCA 3MHYA 2QA4G 3M30B 3KLVA 2LDYA 2X51A 2HWIA 3GYXB 3QO9A 1ZPWX 3VAKA 2MQOA 3F56A 3IAM9 4LJMA 4RNOA 4WE1B 5IQQA 3SCJE 1SJ3P 1N36F 1JKHA 3MZIA 2OPQB 1HWUA 3D2WA 5HP1B 3PVXA 3AB4B 3M30A 3Q0AA 2OD6A 2HS0A 2CJAA 2DNLA 1ZYQA 4YP3A 1W25A 2LXUA 5KFGA 3MUVP 3KNAA 2FVQA 5J2NA 3CPWR 5L39A 3LP1A 1UWBB 3OFHA 4ED2A 1VQOS 2EFOA 1S9FA 5DJBA 1O5JA 5B0GA 4I1TA 2KI2A 4A8OA 3K58A 2VA3A 2XI3A 2FY1A 5H9FJ 4RBTA 3EPGA 4IRKA 3NMRA 4JV5F 2IYGA 2V8DA 4NXMF 2CQGA 1V9OA 2WHOA 3A8EA 3LGNA 2LQBA 4DLGA 4P6QA 2DGTA 1MMDA 3H59A 1VQNS 1YQHA 4OJ1A 3I9V9 2EBEA 1TVRB 3C6UB 3GQCA 1HW8A 3UCZP 3T6BA 3BJYA 3K5NA 5F8JA 4ZCIA 3LAKA 3D28A 3R27A 4B17A 5LT5A 4CT8A 3RR7A 2UUAF 1HBNA 3DDNA 4K2XA 5AJ3F 4TYAA 1TFWA 1WACA 2GMLA 2L08A 2ZNYA 3PX0A 4F4YA 3RRGA 3I5BA 4I6YA 4X62F 1JJ4A 4ID5B 1XR7A 2OPSB 4RKUC 3SMZA 4DL0C 4QIVA 5AE1A 2JFDA 4DSEA 3PFEA 2YNIB 5HP1A 2UUBF 1MNEA 3CC2S 2X1FA 2W4CA 5E3CA 2VFTA 1S1VA 2YNFA 5G0RB 2UXDF 3CEDA 3M1VB 5HBMB 3B82A 4FNHA 2XMMA 1FD2A 2F1FA 1HQEA 6FDRA 1RDRA 5CHCB 4OI2A 2FIUA 1UKUA 4AQYF 4DS5A 2ZH1A 1VC6A 2XMUA 3KK3A 1U1PA 2KXNB 5KFYA 4J9QA 1LOUA 5CH7B 3MAHA 4ED1A 3KKFA 1S0MA 1JLAA 1KLNA 2BM0A 2Y0SD 2MSSA 1WWHA 4TLQA 3C8YA 2I8EA 1DAXA 3RR8A 1T7PA 5HBMA 3SCKE 5KOXA 1VQ7S 3JTOA 3GFXA 1U2RA 3NAIA 3QMQA 2ZHOA 2YKPA 4DF8A 3KMSA 2EFGA 1FERA 3N6LA 3MGJA 4WFAQ 3IO1A 3VF0B 2FVPA 2ZOGA 1JLBA 2GQCA 5KFHA 1HBNB 5B0FA 5B7WA 4DL2A 4YDXA 1FTRA 1NHVA 4KKOA 4ZDNA 4CTAB 4YR0A 3ZZOA 1PO6A 2VV5A 4OI0A 3EGZA 3CJ2A 3CT9A 2MQPA 1RT7A 1X4CA 4DUZF 2YX7A 2OTLS 1FRHA 4JBCA 2GA7A 4ICLB 3N28A 3PRBA 5A6PA 3TVKA 3DYAA 1TKDA 2KZZA 4KFBB 5CCMA 4QPTA 5J2PB 4DL5A 1N56A 4IR1A 2IM3A 1OO0B 5T41A 1NK0A 4OHYA 1C2PA 4WFNQ 1F5CA 1HNIA 5I3QA 1JJ2R 5HN0A 1TKXB 4N56A 2LEPA 1V6HA 4UY85 4CO3A 5F0WA 5DS7A 3H5SA 3O6QA 2VC1A 3T1AA 1MMLA 2J7UA 2WB4A 3O44A 2E5HA 4OX9F 3IC1A 5KFMA 3FSIA 4RX6A 5T14A 5GADI 2FTRA 2A2CA 2OPQA 2ROPA 3F41A 1U1KA 4TKTA 2R4FA 3TYTA 3OHAA 1NEEA 1XC9A 1FT8A 4ID5A 3CUNA 4DSFA 2DK2A 1FXDA 4KO0B 3G8SA 2IRYA 2MPUA 5IZHA 1LK7A 2RRBA 4MKBA 1CVJA 4YR2A 5E3PA 3O5TB 1KQFB 4IDKB 5CZVA 1U49A 3DRXA 2XCAA 3RU0A 2AW0A 1XR6A 1BD6A 5HL7Q 1BQNA 1A7GE 2JOQA 4N77A 2ZHBA 3HXMA 1KONA 2GMJA 2K7KA 4G1QA 4W90B 2Z8QA 4MIAA 2ILYA 4MJKA 4JI2F 5IT0A 2ZITA 1WEXA 5AXMA 3ISND 2VBXA 1Q8IA 1U26A 3FQKA 4ZKAA 1D0EA 2DHSA 2MKIA 1R8CA 3OTCA 3NAHA 3F73A 1Z2LA 2JH3A 3K8WA 5D77A 4WK1A 1RT2B 3NCRA 2COLA 2E7WA 1IQTA 1IKXB 4BDPA 3GIIA 4G1QB 4OI6A 1OSCA 2FHJD 2ZJQQ 1P1LA 4C3KA 2HVZA 2Q66A 1Q8LA 2OPRB 3AY0A 3DCAA 1ZH5A 2LKZA 2RH3A 1OIAA 1ZAXA 2Z4PA 3H40A 5IM0A 4KPYA 4JI1F 4KTQA 3S7RA 1CEZA 4MFBA 2NUUG 4IH6A 4NCBA 1S1XB 4DV6F 4DR2F 1U48A 5E7OB 4JUZA 2ZM6F 3M9NB 3LGMA 1X9MA 1IKWA 2K3KA 4I68A 4BWMA 4NCGA 2R2TA 2R7OA 3B78A 1TZ0A 4WXOA 4TU8A 1DBDA 3R5AA 5KG4A 3TAMB 5JUMA 2HPUA 1T8EA 1XWLA 4FS1A 5C42A 3C2PA 3CDWA 1VIXA 2FVCA 3HX9A 4WYLA 2XC9A 4B9NA 4K50A 1WG4A 3SSQA 5JXSA 3HO1A 5KG3A 5A2QY 1K0VA 4ID8A 1N6QB 2HHPA 2HMIA 1HBOB 4HI1A 2IVFB 1RTJA 4FPRA 3MMCB 4DS4A 3GV8B 3SSRA 1YRTA 3V4IB 4KFBA 2KVIA 2B56A 3HHDA 3KLEA 5F8HA 1LQ9A 2N4CA 3BR8A 2F8HA 2WBRA 3C6TA 3IN5A 1U1QA 4CQ1A 4C9DA 3P49B 4W92B 1KRPA 5F8GA 4YOEA 2B4PA 2C3MA 4GMKA 2IM2A 1YJRA 4HEA9 1R8PA 3CF5Q 4A8KA 1HNVB 3D1OA 2E5GA 3KLHB 1BLUA 3I9ZA 1RTJB 3KG4A 2AQ4A 3MEDB 1N54B 2NLWA 3H4BA 2BZ2A 2YWGA 2XS2A 4J9LA 4HHJA 2KN4A 2LQJA 4DV5F 1DJ0A 1T05A 4RW6B 3IXQA 3IA0A 1X0FA 1QAYA 3I55S 2GV1A 2B6AA 2P5VA 1R8BA 5B09A 1D9FA 4PXEA 1WF1A 4ZVFA 1X4GA 3OJSA 1Y3KA 3VAHA 3CDBA 4G3IA 2VASA 3QGPA 4RW8B 4HDGA 3IGNA 2WCXA 3L09A 1X4DA 4N8OA 2YKMB 4JV1A 2CJKA 3VR1A 2J0XA 5I42A 4WFXA 4YFUA 4CH1A 1UEUA 5I4MA 3M8RA 3OJUA 2V4JB 4BCAA 3LP2B 2E1RA 2UVRA 3ISNC 2YNHA 3ONQA 4BWJA 1J5EF 1O8BA 2WK4A 3VAGA 3QIPB 1H98A 1YRXA 1HI0P 1HWIA 4PG5A 2VPXB 4ZHRA 2BJDA 4YB7A 4ZPBA 2FLLA 4AL5A 4K4VA 4MH8A 3SZ2A 3MEDA 2VBWA 1SIWB 4ZP9A 1LV5A 2I38A 5L1JA 1UW4A 2WSFC 3CWJA 4WFBQ 3V6JA 1SKRA 3UWTA 3CMES 1QSLA 3BQ1A 1JK9B 1RA7A 4DDFA 2DR9A 1VQKS 2FJWA 1FNXH 1N0VC 5KOWA 2QA4S 3G6YA 3MMBB 3OXLA 3R1LA 1TAUA 4RW7B 2FLNA 5F8IA 1W2BR 4NLGA 3MM7B 4ZHRB