2Y0BB

Caspase-3 in complex with an inhibitory darpin-3.4_s76r
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
CHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 SUBUNIT P17
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 18
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2y0bB00
4ZVUB 2XYGB 3KJQB 2CDRB 3R6LB 2Y1LB 2QLBB 3R7BB 1RWXB 1PYOB 2Y0BB 2H54B 3KJNB 1SC4B 2C1EB 2XYPB 3R5JB 4ZVTB 4LSZB 2H51B 2DKOB 4ZVQB 3GJQB 2H65B 1RE1B 1RWPB 2HBYB 1SC1B 1RHQB 2CNLB 2QL5B 1IBCB 2H5JB 3D6MB 2CJXB 3IBFB 2C2ZB 1RWMB 2H48B 2C2OB 1RWVB 2CNOB 1I51B 3GJTB 2CJYB 4DCPB 2CNNB 2H4YB 2QL9B 1RHUB 2H4WB 4JB8B 5IC6B 5IC4B 3NS7B 3GJSB 2XZDB 2HBQB 3EDQB 1RWWB 3D6HB 1ICEB 2FQQB 4ZVOB 1RHMB 3R7SB 2QL7B 1SC3B 1RHKB 3R6GB 2XYHB 3IBCB 1RWNB 1BMQB 1PAUB 2HBRB 3EDRB 3GJRB 3KJFB 1NMEB 1I3OB 1QDUB 2QLFB 4DCJB 3D6FB 4ZVPB 2CNKB 1RHRB 2P2CB 3QNWB 1RWOB 1RWKB 1QTNB 2H5IB 1RHJB 2HBZB 3P45B 3P4UB 4DCOB 1GFWB 3SIPB 3R7NB 4ZVSB 2C2MB 1F9EB 5K20B 2XZTB 2QLJB 3RJMB 2C2KB 4ZVRB
chains in the Genus database with same CATH superfamily
3CJ3A 3J81j 3MGJA 5KG2A 2B0GA 2GA7A 2NXUA 4KHPJ 4DFJA 2W24A 4TYAA 3S01A 4C3KA 1TL1A 2I5JB 4UQGA 4FPIA 4FBUA 1NZAA 2Y0SD 2Y1JA 5GVQA 5KFKA 1EJ7L 3R97A 2RB7A 2JSXA 1IXKA 1RISA 2R7OA 1WKJA 4WWSA 1AFJA 4K4SA 5DG9A 1X4EA 3FRZA 2X3DA 3R1LA 4CLUA 5KFXA 2ATCB 2GVDB 3LQVA 5DQGA 2QLXA 2V5HG 2QFIA 3AQPA 1Y4ZB 3VZHA 1LWXA 2I38A 1Q7LB 3LOUA 1Q81T 4QBUA 4ILRA 4LFCJ 4PXCA 3X3UA 4N77A 4A8XA 3UCZP 3M6WA 3AT1B 1RB0A 5IWAJ 4DF4A 7FDRA 3G71S 1R0BG 4WFBQ 2B6AA 5E41A 1F5CA 3QZ8A 2ZD1B 1BY9A 1I1GA 1RTJA 3G6VA 3SXLA 1CVJA 2VODA 2CQCA 2VG5B 1YJ7A 1Q8BA 2X3GA 1WF2A 2XSJB 3KWMA 3ZXWA 1UW9A 3G86A 2HIYA 4LF9J 1RT7B 2XTJP 3PR4A 4PWDA 3LPYA 1W25A 4ZVEA 2F8HA 2XMKA 4DMZA 2HFZA 4EZ9A 4LRAA 1N5QA 4OHXA 2XY5A 1MWYA 3A8JA 3E51A 1U1KA 1D9FA 5JVHQ 4HT5A 3V4IB 3CUNA 4B3MF 1QAYA 4X65J 1X4CA 1NJZA 4OI6A 3ENAA 1UVKA 3CCQS 4BHQA 5A2QY 3T1YJ 3GV5B 1XNQJ 2MZRA 1UVNA 4RW4B 4H4MA 2ZH1A 2C3UA 3UE2A 4DPXA 2E44A 2N7YA 4RUCA 3SCKE 3MR3A 3UN2A 3KMSA 5ETQA 2DHXA 3BGRB 4ICLA 2XYGB 3HVRA 3M05A 2AEMA 2FJVA 4WP9A 4PZVA 3TI0A 1GT8A 3MM6A 4Y28C 2UVRA 1H7XA 3BBBA 2BJ1A 4K4TA 4R0JA 1EQMA 3MEEB 2DR6A 3T3FA 2AX0A 1WDDA 3VAGA 4DV6J 3TZZA 1WOPA 2IJNA 2ZC4A 1K0VA 3CD6S 2YKQA 2OEKA 4H4KA 3QT5A 4CI0B 5BYQA 5F9NA 1ZTTA 1HBOA 4DR3J 3P3DA 4K2XA 4K0KJ 2F65A 3MAQA 1C1CA 2RQMA 1DTTB 4ZLJA 1RUSA 2AYMA 3NMRA 4IDKA 1ZAWA 2R7SA 2CPDA 4QIVA 2V4QA 1F60B 4J9QA 2YQ3A 5A8RA 1GFWB 2PO4A 2J9EA 3E3XA 2VJVA 3M8PA 4LF7F 1U6ZA 3NAHA 4ZVGA 4F4AA 1DURA 4NYZA 5CYJA 4N47A 2IMWP 4U7UK 5FLXY 2CXEA 2KZMA 2BJ3A 3HCXA 4FF1A 4L75A 3OJSA 4ED0A 4JYAJ 4MIWA 2NZ4A 5CD4A 1T0TV 4UF4A 1C4CA 2E9RX 3BDPA 3MMBA 2BQRA 3KLFA 1RTIB 3QBCA 4KH1B 1LQ9A 1ZA1B 4I2PB 3M8SA 3KUEA 2VONA 1JQGA 1RLDA 1D9AA 3MTKA 4KBIA 2MQPA 4JV2A 4LIRA 2D3UA 3IRXA 1PG5B 2DGSA 4G65A 3EWGA 2IDLA 4ED1A 3TAPA 3PHEA 5E2QA 5C7PA 1SL2A 4BC7A 4CP5A 3L9ZA 2NXEA 2WVEA 2IM3A 1WOOA 1HNWJ 5L38A 2H5IB 3W9JA 2MZQA 1NK9A 1VIXA 2MHNA 5J2NA 2K3IA 2JEJA 1S0MA 7FD1A 2OFGX 3KK2B 4DV3F 3U1MA 2KFNA 2W9CA 1IQTA 5LXRA 2VBXA 1C0UA 3QJJA 2M0GB 3VR1A 1TELA 3HK2A 1KLMA 2QEXS 2LKZA 1HQEB 2H5JB 2WOMB 4MIBA 2CDQA 2DNRA 3BH6B 2HGNA 4GVBA 4B3TJ 1SQFA 2DNOA 3LP0B 2IVFB 3ZZUA 5ADZA 3EPGA 2A18A 4ZHRB 1T95A 3MUVP 2R8KA 2MLYA 2BW7A 1DRZA 3BPSP 4I6AA 4Y2IA 4DDFA 3TO8A 1TL3B 1XIQA 3UN5A 2VBYA 4IOAQ 2GCFA 3A4TA 3TJAA 1JB0C 2Z57B 4QU6A 1M5SA 1APSA 4KO0A 3AXMA 1TKTB 2AJ0A 4OI2A 1NNDA 2DGUA 3IG1A 3W62A 4IO9Q 3VQTA 2KU7A 2FVSA 4YUDA 3M4XA 2FLLA 3KNAA 1IR2A 2HVZA 3PO4A 5LMNF 2F63A 4ZJOA 4JI7J 4H54A 3I5BA 4C6AA 2RUSA 3BGUA 4LR8A 2LYVA 2NXCA 1BQNA 4DL6A 4F0KA 1Q79A 2OELA 4X4VA 3SBMA 3FCHA 3TUZC 2ZBIA 4JI3F 2GO9A 2PA8D 4G1QB 2R8GA 2FC8A 3MMJA 3D0GE 3Q8VA 1T03B 2XSFA 1X5SA 5D0GA 5EHHA 3JSMB 1LFWA 2V8VA 1X9SA 1YBTA 4DSFA 5F8IA 4DR4J 3MUMP 4IYQA 1XEZA 1GXLA 1N33J 1X9MA 5KT6A 1FESA 2DPIA 4IOBA 3A3OB 3MHYA 3I0SB 1R8CA 4OX9J 3PCOB 2YNHB 3EVWA 4NZ0A 5B0BA 3NL0A 2HSEB 1S4EA 2OPRB 3PIPQ 2F5GA 4BDPA 3B6BA 4KPYA 1IKVB 2YKOA 3JQJA 2H48B 4ILLA 4C8LA 2QA2A 2RRBA 2C3YA 2JL9A 1KVIA 1RT7A 3R1HA 8ATCB 5E3CA 2D9PA 3HM9A 4J90A 5L46A 4Y6IA 2J9DE 4WZMA 2V63A 4PWWA 4PQUB 5A8WA 1DLOA 4R5PA 4I1TA 3US5A 1BWEA 1KHWA 2E1RA 4KIAA 5HN0A 3DLKA 3DOKA 1FFWB 2CKWA 4CLWA 4RW6B 3V81A 3Q8YA 5EWEA 2PI4A 1X9WA 1VQYA 3GG0A 2NYHA 1HNVA 2DR8A 2LEAA 2ZKUA 4RW4A 1HW8A 3DGPB 2AX1A 2W4CA 1TL7A 2HFSA 3KKFA 1JLFB 2BJ9A 4F3OA 1U26A 2JLEA 1NH8A 2G2OA 1S9GB 4F0HA 2WAQD 1TKDA 2ERRA 2PEHA 3SCIE 1YIJS 4LF5F 4LSNB 1CJTA 4NXNF 1B64A 5IT9Y 5AJ3J 3PNIA 2V6AA 2FLNA 4AYBD 3CCMS 3MPYA 3MUTP 4ZP7A 4P7TA 3DMJB 2MZJA 3T19A 4DPUA 3T5JA 3A8EA 4QPXA 3GCWP 1S0NA 2FB0A 1IBLJ 3J80Y 3AJ2A 1U1RA 2DPJA 4DV2J 1M1GA 4CO2A 1GMVA 4Y34A 1S99A 9ATCB 4DHVA 1BMQB 2BW2A 3MM5B 4EUVA 3BQ1A 1WC6A 4C8OA 1HBUB 1ZM4A 1S48A 4NWBA 2YWEA 4OJ1A 2KZZA 2HNYB 2AWZA 2JVOA 1HKAA 3CW2C 2AYGA 4LQ9A 3G96A 5EN1A 3UVJB 3DRSB 3LW5C 4EEYA 1HNZJ 3QFWA 1SH0A 4DOZA 3OVAA 3GR1A 4P9SA 3KG0A 4MJKA 2WK4A 2RHSB 1WEXA 2O01C 2HNZB 1KN6A 1Q16B 1Q5YA 3H8YA 2BANB 3FKBA 4USJC 3SCLE 4FNIA 4M63A 2HEKA 4HACB 1RJJA 3PEHA 5A6WA 2HVEA 4OI4A 2K1RB 3G6YA 1UCNA 2A6OA 2XMAA 3CJKA 4KKOB 5H9FJ 2CZ9A 2HWIA 1GH8A 2QTWA 1ZTWA 5DQHA 4NXMJ 1SIWB 4WFXA 1FRLA 4TY8B 1FJGJ 2ZZNA 4I4BA 1FKAF 5K8OA 1R0AA 4NA3A 2BEFA 2O67A 1FNOA 4UY85 1KEKA 5HP1B 2XZTB 3J7Z5 2JC0A 2FJDB 3KK1A 2XCAA 2L41A 1W7WA 4KHPF 5C42A 1OS5A 3RR8A 1KSPA 2OGUA 1VRTA 1SC1B 2C2RA 3IWXA 2K7KA 5C5JA 5CYQB 4FYYB 4DZ6A 4Y00A 3BM7A 3KK2A 3LP2A 4GVLA 1LW0A 4DZDA 1TV6A 2OEJA 4P6QA 4X4NA 3NEKA 3E2EA 5IC6B 1QAIA 2AJ4A 1N6QB 4MTPA 1OO0B 2ADBA 2R7XA 3N4WA 1N36J 3R3TA 1HI1A 5GADI 1J5EJ 2BM1A 3BKUA 1GTEA 3R5GA 4DPYA 3GR0A 3LGMA 3AD7C 4K8RA 2RQCA 4DX5A 4EMDA 2PEBA 1ZAXA 4L76A 2W2PP 4I6WA 5IWAF 3OTCA 1OQ6A 3FRYA 4DR6F 3A13A 1FO1A 3OV7A 3TP2A 3MR7A 1S1VB 4WKRA 1XMQJ 2V0NA 3NXZA 4O3PA 1NZ8A 2O66A 2AYEA 4I56A 3UWTA 2H9ZA 1VRUB 4ZS6A 3AAWB 5HVFA 2HFUA 2V50A 2KXFA 3OL7A 2AGQA 2ZNZA 4LF9F 1FDBA 3UO0A 2MQOA 2YH1A 3EGNA 3GV7B 2YWHA 1DQ9A 4KRWA 2PDAA 3GWCA 4X4RA 2CPZA 3AA9A 4DX8H 1SKRA 2CA9A 3SSSA 3SDEA 3KG1A 2LDYA 3GYGA 1JJ4A 4YQWA 1UVJA 1JLGB 4CO5A 3OW2R 4H4KC 2V67A 4R8UA 1Q8LA 4O23A 5MLCV 4X65F 4CO1A 1S1TA 2IJFA 4ED3A 1NB2A 3OFFA 3BSOA 2GZOA 2DR5A 4LF1A 2FTRA 3EDRB 3BR9A 5T7LA 3R5DA 1U6FA 3ET6B 1FT8A 1HR0J 3BYRA 1U45A 2Y1IA 1SCJB 4DN9A 3TQ1A 4KFBB 2QJ3A 1H6KX 1ZA2B 2WSCC 1U02A 1Y5LB 2EKYA 4FKXA 1XERA 2AJ1A 3M8YA 1RTHB 4DS4A 5KFTA 3DCAA 1W26A 1CPZA 4IH7A 3TEGA 2IAJB 2DHSA 4QWBA 2BE9B 2C1EB 3DXBA 3V6DB 3TAQA 4ECWA 1N0VC 1FHTA 3DXSX 1NK8A 1X60A 1SKWA 1LXNA 4F50A 1NK6A 1XR5A 2NLWA 5LOQA 1D09B 1VGYA 2CFXA 5CZVA 2KG1A 2B5JA 2OPRA 3HHNB 4PR6A 2CNNB 4U8YA 2W4PA 1WG4A 3RG6A 5E3AA 3ZZOA 3BQ2A 2UUCJ 5F8LA 3KJVA 2E29A 2DGOA 3PYFA 2VPZB 3M2RB 4DR3F 4JV5J 3K8WA 4K0KF 3CCUS 1AXQA 1UWAA 3CD5A 2EFNA 3JTNA 4F4XA 3CO9A 2R8IA 2PT0A 1FX2A 5G0RA 2XO6A 2CUYA 4FN5A 1PJ7A 2EK1A 3VF0B 4FYVB 1NKEA 1NK4A 2K2PA 3MCMA 4ZIWA 3W2VB 4H4OA 1VBZA 2KDOA 4U6PA 1K44A 4EI2A 4DUYF 3R7BB 1RTDA 1H98A 1YVFA 2WRMA 5J1EA 2HHTA 3M6XA 1KWMA 5B7WA 3MOZA 1RAEB 3PZPA 3HSGA 2Q1LA 3H0PA 4HI2A 5D3GB 2WBMA 4FS1A 1QVFR 4P2FA 1ZZNA 3TA1A 2R8HA 2DO0A 1SKUB 3SQGB 1FXLA 3MCOA 2VFTA 4A47A 5IXUA 3O5TB 1U2FA 3KLEB 2YPZA 4RNNA 2FVQA 1N5VA 3FZ2A 3KLVA 2AP6A 1FDNA 3OSPA 3D6HB 2G2ZA 3LPEA 3ICLA 4ES2A 3TR5A 1RAFB 2KL8A 3NBPB 3DMJA 2HQCA 2ZBPA 3QAEA 2YVSA 1NH7A 2DIVA 1GX5A 1S1XA 5CCMA 2FLPA 1KTQA 2HS0A 1HNWF 3PKMA 4TLRA 1FFGB 2RIJA 1H7WA 3EZOA 4NOHA 2WVFA 5KFZA 1JMTA 2HMIB 4ECYA 1O51A 4NLQA 2HHQA 4KJIA 1FFSB 3GFHA 2HQ3A 1SV5A 1K1SA 4JI5J 5SZTA 1VC5A 3UDEA 2OO4A 2XYPB 2DGVA 3IA0A 2HNDA 3W5XA 4RWXA 2ZH7A 2E9ZA 2IPOB 4BWJA 3B78A 1W2IA 2PSZA 1FRMA 3UVJA 4NYPA 5EWGA 2NSBA 3CD7A 5B0EA 1HYSA 4C11B 2DB1A 2BRLA 1UZHA 1WD6A 1FEHA 2A2DA 9RUBA 4B3TF 5EGYA 3CJTA 1R89A 3W8PA 3MR5A 5EX0A 3N5FA 1Q0NA 2ASJA 2HHSA 3TJ8A 3VAIA 2Z56B 4HACA 4O0NA 3W60A 4DSKA 4B9LA 1BQXA 4B9TA 4DU8A 5CA5A 5J2QA 4YS2A 1VJWA 3CDBA 3Q22A 4C0OC 4B08A 4B3RJ 3R7NB 2BE2A 2RRNA 1N5YA 2X1GA 3QWPA 2MKYA 1B70B 3PW2A 4DJBA 2QLBB 4TY8A 1F2HA 2LQ5A 2Y9HA 4QPTA 7AT1B 3CVKA 2GQQA 1NK0A 1XR6A 1XC9A 2AGPA 3MMCA 3EZ5A 2ZWPA 3QLHB 3QGGA 1S6QB 5A0YB 4AD6A 5K5MA 1N8RT 4QZVB 4EK2A 3FK4A 4X84A 2D3ZA 4JI7F 1T9XA 4QU7A 2XHWA 3V6HA 1WUUA 2RJZA 5DS7A 4CLLA 4O44A 2ZVSA 4ETXA 2MJNA 4OYXA 1H3DA 4OJHA 3MXHP 4JI8J 2BQ3A 3I0RA 2CG4A 2VFRA 2YNGA 3TVZA 3D66A 2KT3A 3PJXA 2J8SA 3NS5A 1S97A 1N6QA 3UDVA 3I32A 2ZE2B 3FNNA 4DR4F 1RT5B 2VG6A 1N33F 3GIKA 2EFQA 3H5XA 3SIPB 2V4RA 1U4BA 3PXGa 1Y5NB 1C2PA 2J6SA 2H3EB 5L9XA 4X66J 2GGPB 5D15A 4C8MA 1IVZA 4IOCQ 4F36A 3RYLA 3POTB 3BR8A 2WW8A 2OPSA 4ZVQB 1PIEA 1WC4A 3PEJA 1NUEA 1S1VA 3CC7S 1H2UX 1HMVB 4MKYA 4U96A 1U47A 3GTYX 1VRUA 3HVWA 3SV3A 3C6UA 4ID5B 4AL5A 4OMFG 4A48A 2VBZA 2DXDA 4NLVA 4HT7A 2HG4A 4B3SJ 2Z0GA 4LVNP 1KVKA 4KGMA 4C8KA 3RTVA 3D4JA 1B0VA 2ACYA 4NI2B 1U8WA 1SJQA 3ONQA 3TEHB 4DR2J 2M9KA 2MYFA 4RW9A 4F04B 1JLGA 1NXIA 1F5AA 3GJRB 2A0FB 3AJ1A 2DK2A 2CYYA 2JEIA 3I9V9 5CZXA 1RWKB 1IKXB 3DHXA 3HP6A 1UA0A 4ED7A 3LF0A 3CNQP 1U0SA 5GADU 3RJMB 3CJ5A 1U09A 3ZTOA 2ASDA 5BR8J 4EO6A 2QA1A 4AXJA 3BJYA 4EYIB 1SUQA 2E1AA 4QCLA 3EUNA 3O3LA 3CE8A 4DSIA 3DM2B 2AMCB 2M88A 2CNLB 2RKIB 1RTHA 4OJGA 3ETMA 2COLA 1NHUA 2BVZA 1IR0A 4C4WA 1QE1A 4HVZA 4LT6A 3QGIA 4N56A 3FBFA 1MMLA 4USIA 3IR7B 2ZUAA 5CXTA 1T9VA 5IC4B 4C97A 5A2QU 1RT1B 2M8DB 1JLQA 3OXLA 2YKPA 4PYAA 4JV1A 2KVIA 3HMJG 1KR4A 1U48A 4I2QB 5CHCB 4DV2F 2CG8A 1PKUA 4PKDB 4F02A 1FVSA 1RHKB 3RR7A 3OTBA 1OQ3A 2HHUA 2U1AA 3C16B 1JLAA 4CM0A 1MROA 4Y2MA 1CEZA 2HW3A 4RBVA 5HAOA 2HK2A 4KR0B 4K4YA 5KFJA 1UAWA 2XMMA 2K8GA 4UUWA 1VQ7S 2JC1A 4DUTA 1FKOB 2XMJA 8RUCA 3IR6B 3H7HB 2Y1LB 4UZBA 2HQDA 2JJ4D 2BJ7A 4M5DB 2EBEA 1HNIA 3N6LA 1ZAVA 2F3JA 4ED6A 1R27B 2MY7A 5KFSA 4OZ0A 4Q43A 3Q8QB 2E5LF 4CCHA 4FZVA 1UFKA 2KM8C 1MN9A 4G1PA 2I6WA 3HVTB 1UP1A 1H74A 5KFRA 2AJFE 4JP8A 2RUGA 4WTOB 5IM0A 1NRKA 4X62J 3D1QA 4FNHA 2YBVA 4YR2A 1NKCA 4USTA 5D0HA 1RKIA 3S1TA 1SBRA 3JSRA 3NCQA 3KLEA 2OMOA 3VGTA 1R8PA 2J0QD 1OPZA 1U1QA 3AY0A 5L8RC 3GB0A 1FX4A 1FVQA 4NLOA 2OUGA 1VQPS 4ZCMA 4OZ1A 1RAHB 2MLXA 2YKMA 1YZ6A 4DPOA 3M2VB 5FLXU 1S7HA 3MM8B 4ZPAA 3FBCA 1NSKL 1JLEA 1YZ7A 1BUXA 4WE1B 2DR9A 1IKYA 3EZUA 3HHLA 3DRRB 4LR9A 5KFHA 2XLJA 4ZVHA 3GJQB 1R8HA 4E2FB 2YXLA 1EP4A 2C2NA 2WONB 4YB5A 4KQZA 3PRDA 2V4JB 2OP5A 4M5NA 5HROB 1WC3A 4DSLA 3Q86A 2EK6A 4B9MA 4CLTA 3RRGA 3IS9B 2XGPA 2LMIA 1D3WA 4DL5A 3OR2A 1N36F 3E01B 4DLEA 4DG1A 2VD3A 2F4FA 2Z2MA 1J5EF 5DZ7A 2D7SA 4OHYA 1VBXA 2KRBA 2ASLA 2DGXA 2KRRA 2AQ4A 2ZH8A 2L3MA 5I3PA 5K14B 2XB2D 4DR5J 2LECA 4RZRA 3JYTB 4DUZJ 1NSQA 5KFWA 3AH6A 4RW7B 4WP8A 2GHPA 1VQSA 4NCBA 2VQFJ 2HK3A 1VQ5S 1LWCB 4F3MA 1XMQF 2ZVIA 1VQMS 1M5PC 1SC4B 3RAQA 4F3QA 4ZK7M 2LVWA 4IG3A 3Q89A 3RZAA 2QL5B 5FJ4A 5HJYA 2KT2A 5K8MA 1R43A 5FD1A 3QAUA 1WG1A 1Q1KA 3DLEB 4OZ2A 2ILZA 4J9LA 3UN3A 1UEUA 4NCGA 3ZFVA 4IR1A 4PEOA 1OMSA 2FJXA 3H40A 2ZH9A 2BJEA 2R7UA 3NNAA 3C6TB 1HBMA 1B7YB 5CQGA 5KG1A 2CQ0A 2XGQA 2YNFB 2IC3A 4K50A 2VICA 3C66A 2EC2A 1WJ9A 4MK7A 2ZJPQ 2G1HA 1I3OB 2PC6A 2CAJA 1HR0F 2GHWA 1RDRA 4EGLA 4RUHA 4A8OA 3QNWB 3BDEA 3GPAA 3RB6A 1FRJA 2OFHX 3PR5B 3TYTA 4U67Q 1CJVB 2DHHA 4PPDA 2G4BA 2BRKA 3TA2A 2QSFA 2Y3YA 4K7QA 3CJSA 2XHCA 2VOOA 2BJ8A 3MF5A 1IWAA 4CYUA 2E5IA 5J2PA 3L7OA 1LWEB 3MPUB 4OYPA 3ILIA 1EQ0A 1R8BA 2XULA 5KG6A 5HLFA 5B0AA 4I67A 2OI2A 1YBAA 2GMJA 2F8MA 4Y2KA 4N7TA 3POTA 5DLFA 2ZM6J 3CCJS 4DL2A 1V9OA 1IKWA 2H4WB 4PXBA 2W2OP 1REVB 3EDQB 4A8WA 2UUCF 1AFIA 2NXNA 2XBPA 4M5KA 4ID5A 4JV5F 4NPOA 1A6LA 3G4SS 3BYPA 1YGYA 4M5HA 5FDLB 1VRQC 1I6JA 1RI7A 3FFIA 5GMEA 4ZN3A 3H5SA 3W2WA 4NI2A 4PYDA 1D8YA 3P5BP 3R2CJ 2OIHA 3PFOA 4WFYA 3CCLS 1T9UA 2FY1A 3BV8A 4ZPDA 2AIRB 3Q24A 3PYGA 2DNHA 4OFZA 4F4KA 3KNGA 1TAQA 4F2RA 1TQLA 2YNIA 1FE0A 1TK8A 1IKXA 2W2NP 3MPVA 4L73A 1CC7A 4LRDA 1B7FA 4IFVA 1HWIA 4LFAJ 1RWPB 5KFBA 1CJUB 4DV4J 2RDJA 2LQ9A 3T5HA 4X4PA 3ZZTA 4OJ3A 2QMUB 5D0RA 1FRHA 1VQ8S 1DARA 1P27B 2GV1A 3QJPA 3NGTA 1WEYA 2VC1A 1LEOA 2A10A 2GVZB 2VPXB 5MAOA 1NSAA 4CLSA 2GQ2A 2FHJA 6AT1B 5DDRC 3WX4A 1M1HA 3CIMA 3W5ZA 2B4VA 1SB6A 1RYRA 4NLTA 2CQGA 2HBRB 2BE7D 3H25A 5K9FA 4DCJB 4I2QA 1YKWA 3BF4A 5E3QA 1GQEA 5DM7Q 1RT4A 1Q86T 5KG5A 3L95X 3U1LA 5ETNA 1X4HA 3HSJA 4A8KA 2LQBA 3EXYA 2FHKA 1N56A 1S49A 1S9EA 2DO4A 4AUKA 2G0JA 4A8SA 3JQKA 2HBYB 4IO1A 2AF6A 2M7SA 4NLRA 2HZVA 3BN4A 2PIIA 3GYNA 2CJXB 3SEOA 4DQIA 4M5DA 3QO9B 1I51B 1CULB 4OZ3A 3J80U 2XMTA 5ETPA 4EBCA 2B6AB 3D0IE 1KFSA 1UFLA 2IHR1 3R27A 3VQSA 1TAUA 1F3VA 3BBCA 3HVTA 2DNLA 4OZJA 3KFWX 2HS3A 3GYXB 3FQLA 4Q7AA 4NLXA 4PWDB 3DNCA 3AHPA 2VFUA 2W25A 3DDNA 4P2SA 3LWMA 3V6JA 1VBKA 3B82A 2W4DA 3UD4P 1RU2A 5LL6d 2VQEJ 3SSRA 1N48A 3TRGA 1F6TA 3WZ0A 3DYAA 1OYEA 3NOCA 1HI8A 5T41A 1RCOB 3D28A 2WVCA 1X4BA 1H0HB 2NREA 4ED4A 4LBPA 2MKSA 3OLAA 3VWSA 4H4MB 2CQPA 4ZDNA 4TU9A 2UVUA 1H72C 2V8GA 1LFPA 2OHDA 5ETOA 2EC0A 1U1MA 2UUAJ 4JV0A 1L3SA 4ICLB 3K17A 2V2KA 4JI8F 2ZWOA 3IGVA 1R6YA 2V4JA 5RUBA 2P6TA 3SYZA 4Y3CA 3MM6B 3MI7X 4OX8A 1PC5A 5HANA 1NDCA 4HHJA 3V6KA 1NMEB 2XI2A 1RLCL 2GIRA 2APOA 1OY6A 2DEIA 4ZIVA 1F5BA 4WXWA 1TVRA 3Q8UA 2FPHX 1ZOTA 2ASYA 1QY7A 2J9CA 5AXMA 2Z58B 3UPFA 2CJBA 5K14A 4X66F 4TKTA 3JYTA 3OD2A 3W66A 4ES1A 3I96A 5J2MA 5HMZA 1NJWA 1D8ZA 3OSNA 4YN3B 1SL0A 4RW7A 1C1CB 1TL5A 4YB6A 3TZXA 4A8QA 4CRJA 4MK8A 1U24A 5E7OB 3P96A 5KTQA 4ZCKA 2D1CA 3LTOA 1X8DA 4WU3A 4DCPB 4HHHA 5DQIA 5A8RB 5KOXA 2MQQA 3A8IA 3M8PB 2IBKA 3M6VA 4DX7A 1K47A 3MM9A 2GHVC 4X64J 2P9CA 1SC3B 2KN4A 4DR2F 3T9NA 3CGIA 2R42A 1RTZA 1CJKA 2LU2A 4CH1A 4YHHF 1CLFA 5J1NA 3MMBB 2UV8A 1BHNA 3KLFB 1LW2A 5GAGI 4ZVSB 3HZEA 1SQEA 2CDRB 3OVSA 3OTEA 1UA1A 5BR8F 1VYAA 2R7VA 4OLOA 5AXNA 2JLGA 3RAXA 1MU2A 4USUA 5DO2A 1OY8A 5HBMA 1IJFB 1TKZA 2YKNA 4GKJF 3FEYB 1ZH5A 2ZJQQ 1PCAA 2HZCA 2CJKA 3F44A 1LWEA 5GMDA 1IQZA 1S9FA 3X1LB 5F3ZA 2P6SA 1H73A 3KLHB 1RCXB 1M1KT 2QO3A 1L3VA 1MWZA 1DY3A 4L3NA 4AE5A 5J2NB 4F0MA 4NLGA 3MR2A 5D6GA 3TAMA 4FKYA 5KFFA 2W9CB 2DR7A 1C0UB 1REVA 3PRBA 3QT7A 1KLMB 2J6TA 5L1IA 2CNKB 5ETMA 5GMKa 3B4DA 1VI7A 2FYXA 5D4NA 2HS4A 4QR2A 3TVKA 4WXOA 1VQLS 3FMBA 4B9NA 1VOMA 2G0CA 2CQDA 4GVBB 4UW2A 4ILMA 5A6PA 3MAHA 4HH1A 4KE5A 1UPMB 5LMUF 5C2CA 1TTHB 3HX9A 3HHLC 1RACB 4S0MA 4WFAQ 2ALZA 4OI3A 4WBFA 5CH7B 2ZUGA 4RUAA 4NASA 3CCTA 5LSRA 4FYDA 2NSCA 3D9BA 4KTQA 2OD4A 1R31A 4KO0B 1KONA 3DKDA 1XNRJ 1WNEA 3HPOA 4GC6A 3JTPA 3MWBA 2OPQA 1XK8A 1WSVA 4MIAA 1S1UA 2GVZA 1AT1B 1URRA 2NS1B 3GFYA 1BQNB 3F73A 1PJ6A 3CD0A 1RBAA 1FDDA 1X4FA 4L3KA 2BABA 1P6TA 4CZCA 1HQUA 2ACMA 4W98A 1NKBA 3AFGA 3HLUA 1S57A 3PY8A 1UPPA 3PFEA 3THPA 1Z2ZA 3IAS9 2HVDA 2PN6A 2RDIA 5H9EJ 2HPUA 3ITHA 4PUOA 2ADCA 2E7WA 2YWGA 3BO4A 5KFOA 1HD0A 1IBKJ 3LH2S 2MZTA 3NS6A 1YRUA 3MZIA 3H2VE 3P6YC 3UD5A 5E3PA 3T9ZA 1P1TA 3NAIA 4LRBA 1XMOF 3UI3A 3I82A 2EWHA 1FNMA 5ETTA 3WIUA 3QO9A 3OTOJ 1CULA 2ZOFA 3JSBA 1HNXJ 4KAIA 4Y0FA 1N34J 1X31C 2ZHAA 2AD9A 3UCGA 4EBDA 4F67A 2FZKB 3KK3A 3ILLA 3GQCA 4DR5F 1VR6A 1QTNB 3H2UB 4DUZF 4JI2J 4J9UE 3I5CA 5DDPC 5DDOC 4MAKA 2PI5A 4KGVB 5K20B 3W5YA 1XN9A 3LGNA 3MTJA 2V2ZA 4LBHA 1WF0A 4PWUA 2B43A 2VQFF 3H2LA 4W4MA 4BWMA 1PYOB 4URSA 4OYOA 4E98A 4ECQA 2ZDPA 4ZJQA 3RBEA 2OH2A 1WC0A 3HO1A 1RT3A 5A8WB 1DLOB 1SPBP 4R5PB 3G2XA 3ELHA 3TUPA 3D6MB 5KG0A 3QATA 3DLKB 3DOKB 3NMAA 1RP5A 4DL3A 3V81B 2RF2A 2LCWA 5F8HA 2UVWA 1HNVB 3EXCX 1AROP 2J0XA 3QSYB 1WTFA 1AA1B 2BZ2A 5HO4A 1TL7B 5D4LA 1AUSL 1X0FA 5J1PA 3OXGA 5L1KA 1BQMA 5HL7Q 4GMKA 3WBZA 4RU9A 3D3BJ 5DLGA 1T05A 4JBCA 3K5NA 1CJTB 3BN7A 2V2VA 1IM6A 1YBUA 4V19X 2Q43A 2JOQA 2KT5A 3UW1A 5GAEI 1GMUA 4B9SA 3EJMA 4LJMA 1RA6A 3LGHA 1FK9A 4CLYA 1QSYA 2XWYA 5D4OA 4WP3A 4B9UA 2RVJA 1V5VA 4C2MA 2KXHA 2CNOB 4ZOSA 2J7UA 2R4FA 4P75A 2HRTA 3BB5A 4K4ZA 4ECZA 1L3TA 1EETA 3R5AA 4I7FA 2ZM6F 4N8OA 4M5MA 1MW7A 4UT4A 1S4FA 3GSDA 2DNGA 3NLCA 1ZM9A 3OT9A 3ZTRA 1UEKA 1T3NA 5KFCA 4QW9A 2QT7A 2YH0A 2XYHB 4G1IA 3C2PA 4DU7A 3MCNA 3DLLQ 3A1YG 4YY3J 1DHMA 3QWUA 1F9EB 1X7VA 5IOLA 2FC9A 1H2VZ 1CBKA 1C0TB 4CNZA 5M2PA 2NCKL 2B9WA 1N88A 2B8QA 1R8AA 2IA6A 3S7RA 2MKKA 2XEXA 3M2UA 3OL8A 3G8TA 2DISA 3GG1A 2X1AA 4K4XA 1V6HA 1VS3A 4PABA 3CJKB 4LFAF 3V4MA 1JX4A 2G0IA 1U8SA 1U0HA 2QFJA 5ITHA 2YWWA 2BKOA 1WC5A 4A8MP 2VFVA 4BBYA 2DITA 3QQCD 3CEDA 4NMLA 2QL9B 1R0AB 2FHOB 1FD8A 3NS7B 1JLCA 2RRAA 3EMTA 3KK1B 1UVMA 2AKWB 2LA4A 2VPYB 1DTQA 3RB3A 2QRRA 3KUGA 5C42B 1MNEA 2V8HA 4USWA 4WFZA 1VRTB 4PG4A 4PAAA 1URNA 2KM8B 3KLHA 1QLNA 2C3PA 1VIOA 3SMZA 1DQAA 2P2CB 1SJ3P 2UXDJ 2DRBA 1MMDA 3LP2B 1LW0B 5A76A 1RADB 1HL6A 1TV6B 4WPAA 1JXEA 3AOBA 4M8LA 3IXQA 2MXYA 1RGVA 3IMQJ 1V3RA 2DGQA 1P1LA 1U2RA 1R3NA 3VAFA 2MMYA 5GAGU 4LF7J 2AT1B 4ERDA 3Q8RB 3P49B 1WHVA 1WOSA 3MFIA 2W8LA 1RWMB 3A3NB 2GMLA 2RMLA 1FA0A 4QWAA 3NGSA 1SJ1A 4U7CA 2IDEA 5IV4A 3OBIA 2YY3A 3FQKA 3T1HJ 3OUYA 1X4GA 4Q2MA 2KH9A 3EM1A 2BOPA 4V1Ak 2OSQA 2IVMA 1YTYA 3C19A 1LNQA 4ZVOB 1QAXA 3WC0A 3GCXP 3H59A 4QWEA 5JVGQ 2PFDA 1BWVA 1ROFA 3D5MA 2PMZD 3ZTSA 4Y2AA 3SDEB 3BEGB 4RU2A 2U2FA 1VQ6S 2NZCA 4FPRA 5G4DA 1Q53A 2AHOB 3U1NA 4ZCLA 4R8UB 3FZBA 4ES3A 2VQEF 1S1TB 3DOMA 1ITPA 5T7LB 1FF2A 4LUBA 2F8EX 4C8NA 4ENOA 2RE1A 4HTIA 1DZ5A 3CMAS 4DV3J 2IJRA 5GAHU 3G8QA 5M2RA 2C3OA 1HHTP 4EO8A 2CWKA 2UUAF 4PG7A 2UUTA 4D3GA 3DI6B 2QMXA 1YRTA 1MLAA 1Q8KA 4AT1B 2ATLA 4A46A 2FVRA 2V68A 3Q8PB 3AQOA 4KH0B 4FF4A 2B3TB 5DM6Q 1PYTA 4O3SA 1NHKL 1O6XA 4P71A 4P74A 2FD2A 2B5JB 4U8VA 2DD8S 3CCES 1EB0A 1VHFA 3G87A 4WIQA 2HHVA 5B0FA 1UMJA 1X4DA 4DV0J 2Q79A 1RWXB 2H1YA 3KJVB 3CJ4A 4QWCA 2WSEC 3FC9A 4ZVTB 4OI1A 3OR1B 5I42B 3H4DA 4QR1A 2AW0A 5G0RB 4PXEA 2VL1A 2Z30B 2N7CA 1O8BA 3IWNC 5KFUA 2RU9A 2VU5A 1SJ4P 3TUIC 1GMWA 3K8VA 4H4OB 1S6PA 3CC2S 1KTVA 1CG2A 3I55S 1NM2A 3DHWC 5KFGA 3IC1A 1X5PA 2ZH6A 1RTDB 2HYIB 2DH9A 5J1EB 1VMBA 3RBZA 1HPZB 2QG9B 5AXLA 1SQGA 1U49A 4HDHA 2OTLS 2E1MC 1RT6A 1CS4A 3L4BC 3V5RA 4NRUA 4WIIA 1IBMJ 2CPIA 2MJUA 2XO7A 3PDNA 4OYZA 1SC6A 3KTQA 3WX8A 3CF5Q 4PRFA 3RB4A 3CO0P 3OTDA 4C3MA 3ZZ0A 4DN0A 2R7QA 1WI6A 3KHGA 2E7XA 4OLPA 2E1CA 2Y1RI 3K58A 3THVA 3FVYA 3HKZD 3MEDB 3H98A 1NDLA 4ECRA 2HRUA 2ZOGA 5HI7A 3ETOA 4C98A 1S1XB 2HVIA 4MFBA 3PJ9A 4RUBA 2MY8A 1EKRA 2AJQA 4CDIA 3BKFA 1KRPA 3H5YA 3FSXA 4UY8T 4TN2A 1UZDA 1NPPA 1B0PA 3GZ7A 4ALZA 4AXIA 4AFFA 4P2XA 4F8RA 1SV5B 4B17A 1NJYA 1C1BA 3WDOA 2HNDB 2KO1A 2W1BA 1L3KA 4IUFA 3MMAA 2CPEA 4FF2A 4DFPA 4YMEA 1YJTA 1YSJA 3CSKA 4TU8A 1HYSB 2IYIA 2OPPA 3M9MB 1RXOB 3CCSS 1WORA 5D8HB 3UCUP 3BSNA 2EFOA 4K5SA 1TUVA 2XMUA 3O44A 4USMA 3UQSA 1WSRA 1C0TA 2DGTA 2KYXA 4ZPVR 2IM1A 3BH7B 3IAM9 4RWWA 1T02A 4IFYA 1GXUA 5J2QB 1I94J 1NB7A 2C3MA 4M95A 4Q2LA 3CIZA 2UVVA 2BE2B 2XMWA 2FY8A 5KFLA 1V5IB 1N5YB 1XNRF 4KY3A 4DSJA 1KHVA 3GONA 3PG9A 4OZ5A 1RAGB 3A3PB 4O3RA 3QGPA 2XLKA 2MQMA 3MMCB 3UDCA 1NLKL 4OYWA 2D9OA 2B4PA 3C15B 1FE4A 2E5HA 3M30A 1Y5IB 3K59A 5IZHA 4O44B 3GIMA 3QRRA 3ZZPA 1KQFB 3J7AN 3N28A 3HDSA 1IUJA 3VVUA 2ZEJA 4KGKA 5DRKA 3I0RB 1RAOA 4F26A 4DQQA 2YNGB 4IKAA 4FYWB 4Y65A 2Q6CA 1B0TA 3AOAA 1RHQB 1JJHA 2XS7A 3U7JA 5LSOA 3HSZA 2MHEA 5ETRA 3LWLA 2WZ1A 1FEEA 1IBKF 2J6UA 3EVOA 2VG6B 2UUBJ 1S77D 3PTWA 1VCTA 4JI1J 4K4UA 3N01A 4DQPA 4OV1A 3MD3A 2GIQA 1JLBA 1NK7A 1N5SA 3KG4A 1N4LA 4LFCF 2I1RA 3OTOF 1G3OA 2CQ2A 1HNXF 1Y11A 2G1DA 4USHA 2FHMA 5L1LA 1N34F 4FF3A 2OPSB 3QMQA 3VHQA 1Q8IA 3P8BB 2F9DA 4CNYA 4ELUA 4YEAA 4RPFA 3TUJC 3CCWA 3BBFA 3BSAA 2IA0A 3S6EA 2R7TA 2OLWA 4KB7A 1GX6A 2XS2A 4JI2F 3R5CA 3C6UB 2E5GA 5DDQC 3NKYA 2EG2A 3SFUA 1F1BB 3MEGA 5KAKA 1MN7A 3IFEA 2M70A 3FSIA 1ZM3A 4RJVA 2IY5B 2CVEA 5HATA 2Y8YA 3QT8A 4LR7A 4B9VA 2P8IA 1EZZB 2H51B 5KG7A 2A6MA 2DT9A 2AYBA 4JI0J 4RW9B 3FDSA 2IM0A 2E66A 2LP4A 2XS5A 2GAHC 3DN9A 4ZITA 4ZLNA 4RBUA 2ZFHA 1BD6A 2F7VA 3FJ2A 2CJYB 4J9NA 4QW8A 4PCQA 4N41A 2MZ1A 5I3UA 3T1YF 1OJ4A 4PXDA 4QJVA 8AT1B 1XNQF 3EX7B 1U6BA 4HR2A 2ZZTA 4KHMA 3PW7A 3CPWR 4ATNA 2HFNA 3W65A 1SUQB 4YDXA 4XAKA 4OIXA 1RHMB 3T5LA 1ZS6A 4J37A 3M8ZA 1YQHA 4LRCA 2WBRA 3DI6A 1T94A 4P7VA 1SJFA 1QE1B 3P45B 3ZTPA 3KMQA 5T14A 1L3UA 1D1UA 2WHOA 3RRKA 1ZETA 1ULRA 3IGNA 3VAJA 2AGOA 4OZLA 4ZVRB 2VB6A 4YB7A 4NA2A 4C8ZA 1Q5VA 3HD1A 5DG8A 1JLQB 3PIOQ 4DV6F 2B8PA 2ROEA 4YFUA 4LSZB 3J7YI 3HSDA 4FS2A 2H65B 3EICA 1SL1A 3Q8SB 1FKPA 3ILOA 3T1AA 4DR6J 2VC0A 2VA3A 1JLAB 2DIUA 1MROB 5K8NA 3M1VA 2ZHBA 4NL5A 4JOUA 3OR1A 5I42A 5C25B 2BKNA 5JXSA 2DRDA 3NY0A 1F2GA 1YI2S 4XIUA 2E5JA 4DV1J 3RBXA 4CQ1A 2HBQB 3W8GA 3ULHA 3PX0A 3WQPA 3PKYA 1HIYA 3MAAB 1HNIB 3D2WA 1QTMA 1NO8A 2BBEA 3R7SB 2X1BA 4NRTA 3HT0A 3O6QA 3GIIA 1UVLA 1EARA 2RS8A 2JLFA 4ZVPB 3QT6A 2LEPA 5IQ6A 1HPZA 2IRYA 1FDAA 1JJCB 4YY3F 2IIHA 5IM0B 4JYAF 2IFXA 2YQ1A 2UUWA 4X4QA 2DY9A 3HHLD 2JNJA 2H54B 2B4OA 3IR5B 2LXFA 3K5MA 5B09A 3IBWA 2PMWA 3D7SB 2RQKA 4DPWA 2CQ3A 3I5AA 2J0WA 4WU2A 2AJ2A 4CH7A 2F4VJ 3WC2A 2YKMB 3M7VA 4P2MA 5E5NA 1VISA 3PW0A 3M8WA 3MEDA 2BM0A 5KT5A 4C48A 3K7RA 4ED8A 1RKJA 1JLEB 2QA4G 4LF2A 1S0OA 5AXKA 3Q0AA 2V8PA 3Q23A 3I9ZA 1IKYB 1TK5A 3KLIA 3T6JA 1LK5A 3HHLB 2RHQB 2QSWA 1BLUA 2GJ2A 3QRPA 1RQ0A 2D3OR 1VHIA 4LSLA 1E6VA 4CTAB 1EP4B 4XPCA 4J5OA 2IRXA 3FUYA 3BGLA 3VGSA 4DL4A 2HHPA 3PW5A 2UXDF 1PO6A 2CQHA 1PBUA 4NLPA 4TXSA 1NEEA 4C3LA 3FCVA 3WIVA 3N5BA 2W2QP 2UZAA 3DRXA 3DOLA 1N32J 2DNYA 2CPFA 2BUNA 2GQCA 3M9OB 2HWTA 3IRWP 1KC8T 4L72B 3OR2B 2V34A 2M4MA 4DG1B 4OYMA 4DUYJ 1J2VA 1TMJA 2R7WA 3FCWA 2AU0A 2R3VA 4ID8A 2KYZA 3OFEA 4TNOA 4O4GA 2R2TA 2HFOA 2NXJA 1I5OB 2E9TA 3OL9A 3B4MA 3T1HF 2IMOA 4UOCA 4WJBA 2V9WA 2OMLA 3AB2B 2Z8QA 3GIRA 1MMNA 3QIPB 3JAMU 4IG3B 1JJ2R 4L6V3 3UNGC 2F9JA 2P9GA 5KFAA 1HQ2A 4QYRA 5L1JA 2JEFA 4UOHA 1J5OA 1N52B 1NAQA 3KXDA 1FNXH 2HBZB 3R8YA 2LA6A 3RBDA 4FYXB 1KQSR 4NCGB 2C2MB 2M5YA 4AQYJ 3C15A 4P10A 1FWLA 2VFSA 3TNVA 4ZVUB 3C14B 3HF5A 1U1OA 1S6UA 3QYYA 1HBMB 1YHQS 1PGZA 2JFDA 2Z2LA 1PAEX 4NMXA 3T41A 4ZMMA 4TQSA 1OYDA 3W3SA 3VVTA 2IC3B 1WHWA 2GIFA 3WHIA 2ZJRQ 4JI4J 1V3SA 3KLGA 1NCLA 1QUVA 4NLYA 2Y8WA 2DY1A 2CADA 2GJIA 1B99A 1VJQA 2I2YA 1Y7PA 2WSFC 4Q0BA 3L09A 4LRFA 4C0BA 5BYRA 5CYMA 2YX4A 3D3CJ 2W7OA 4XDDA 1JXVA 4CYUB 5J2PB 5EX3A 4RW8A 2V94A 2HIQA 4KGXB 5HLFB 5F0WA 4OX9F 1WWHA 2ZC3A 3MM7A 2MB0B 2KFZA 4X2BA 1JK9B 1IKWB 4J9MA 3F56A 4PG8A 4W90B 3ZC4A 5KFIA 3IM9A 4DV0F 2JEGA 2C42A 1EX8A 2EBGA 1RT2A 1RE1B 1GAOA 2QV6A 1R6VA 4YP3A 4ZP9A 1S1WB 3FFIB 3LP1A 3W2WB 4NLDA 4URQU 3M8QA 2G9OA 1FTCA 2F40A 1SH2A 2OEMA 1YJWS 5F0UA 3J7A1 4QYZK 1K0TA 4OX6A 2FHJD 2YNIB 1LXJA 3BGOP 2LXUA 4OYIA 2VASA 2MQNA 3PO5A 1JWWA 1RAAB 2EFPA 2I5JA 2PMHA 1WDTA 2HQIA 3R6GB 4IFVB 3W64A 2HAFA 2C22A 3W9IA 3EGVA 1QDUB 4EFAC 4E0DA 2V9KA 1S0VA 3HI9A 1IBMF 3CDAA 1YJ9S 3VZIA 4V19J 2XWXA 4DL0C 2LDIA 1E6YB 1RSCA 2QLJB 3TARA 1XR7A 2C2KB 3EPIA 3ISND 2UU9J 2FLOA 2GVDA 2N82B 1FI4A 4URGA 3CTRA 1YLXA 5A8KB 4LIWA 5AJ3F 1WKLA 2BACA 1QJHA 5IT4A 3JQMA 1QSLA 4GKKJ 2XM3A 1IBLF 1RWVB 1X5OA 1O5JA 3Q2SC 5KFPA 1RZMA 3HFKA 1WEZA 3GJTB 4DQSA 4YOEA 2DYAA 2DHGA 4RX6A 4JUZA 4HHUA 2QC3A 1RT4B 2ZD1A 3CT9A 4USVA 2B56A 2PGCA 2VG5A 3E8OA 2LFVA 5BJRA 3G9CA 2XSJA 3MECB 3HFVA 5C25A 1GXTA 3MD1A 2LXIA 3GV8B 2BX6A 3A8KA 1S9EB 1YWXA 3TJ9A 1PAUB 4RNMA 2DVIA 2CWXA 2VHGA 1VLYA 4Z2XA 4JI6J 2HVHA 2EG1A 3MAAA 4DFKA 4KC5A 4Z7CA 5KT4A 4RLEA 4MT1A 2D41A 5BYSA 1HNZF 4ZPCA 1TZ0A 1B3TA 2VKRA 1UKUA 2UXBJ 3V4IA 2FGCA 4C9DA 3G82B 2Q3PA 3CCRS 4DR7J 3RAMA 5B0GA 2BMBA 3W9HA 5KT7A 4XO0A 4O3NA 2ZZMA 3TWZA 2MGZB 2JVRA 1RA7A 1YX2A 3PRVA 2OAUA 5EUHA 4X4SA 3TW0A 1I94F 3VV2B 3NCRA 2C28A 3K89A 4CLPA 1WELA 2DH7A 3J7YU 3BGRA 3G8SA 1Y9OA 2XNQA 4ANDA 1ICEB 4NXMF 3HJVA 3KUHA 5JJBA 1FJGF 3CCVS 5DGAA 4OI0A 1WKKA 3DYAB 2GAGC 1S6OA 4DXLA 2QA4S 2ABYA 5KFNA 2VKZG 3CWJA 1QM9A 2BA9A 5HJXA 4TQRA 3MEEA 1IN0A 4GO5X 4K5RA 2B7CB 1M5OC 2K7JA 2XG8A 2W9AA 3R9LA 1YJNS 1RYSA 5KG4A 1A9NB 2V8DA 1ZBTA 3FBEA 4CTAA 4ANCA 4UUXA 3DRPB 2NUUG 3J81U 1PYSB 4ER8A 1K73T 4J9RA 1DTTA 4ZVFA 3IO1A 3D54A 5KFVA 3GFZA 2JDJA 4MKVA 3W63A 1DFDA 2KHCA 2RNEA 2EW9A 4ELTA 1TVRB 1YJRA 2MTLA 2J76E 2UUBF 2UV8G 1X5TA 2MSSA 4JI1F 2GO8A 3FMWA 2E5LJ 3VAKA 1YG0A 2DEJA 1KBRA 1EAYC 2YWKA 5J2MB 2ILYA 5F8JA 2HURA 2HFVA 3B54A 4LFBJ 2QLFB 5AE1A 4IG0B 2RD5C 1RHRB 4ZLPA 3N79A 1RTIA 3ZO7A 1GK8A 2X7IA 4I2PA 3QIPA 2G13A 5LT5A 2L08A 3QJLA 1SH3A 4DS5A 4ITSA 1NDPA 3CMQA 1VQKS 3RB0A 3D1HA 4NX9A 4K4WA 5HQLA 4LMZA 3MM9B 4ANEA 1ZPWX 3CJ0A 4L74A 4EBEA 4CT8A 2SXLA 3C14A 5BXIA 4JI0F 2QN6B 2RAQA 1NBEB 1CJKB 1BGXT 1S12A 2Z2YB 1H38A 2ZKTA 4CT9A 3TQEA 4QOTA 1LWFB 1EHWA 1LW2B 4F7VA 4CO3A 3EGWB 3ZZZA 2XNRA 1L5UA 2NPFA 4G3IA 5C24B 1Y3JA 2W2MP 1MU2B 3RW6A 4XDCA 5HBMB 1TMMA 2CIMA 1HQEA 2WOMA 4N5SA 1TKZB 2YKNB 2CPYA 1VDHA 2RSQA 3UFCX 1Q78A 1AZSB 5HQ8A 2GX8A 1QUPA 1HARA 3NGKA 3OVBA 2GMHA 3N6NA 4WTYA 4FXVA 2YX1A 4ZP6A 1FXRA 2L9WA 1T9YA 3LP0A 1Z4UA 5HVHA 4OV6A 3KOAA 3ZZYA 4ZHRA 3TAMB 3SSQA 3TOQA 3Q2TC 5F3TA 4KT0C 3AXKA 3PYDA 6FDRA 4Y2CA 3BO3A 1TL3A 2I8EA 2B9YA 5ETKA 2C2ZB 3CXCR 1RU1A 2ZH3A 2CJ9A 3NNCA 1J27A 3F41A 1TKTA 5IS2A 4TVAB 3QZ7A 4GC7A 1KFDA 2OTJS 1OWXA 1OPIA 1S1WA 3MFHA 4HEA9 5JUMA 2XZDB 4DV1F 1FD2A 2D69A 2J9DA 2FJBB 2FQQB 4DSEA 4NZ6A 2NR0A 2N4CA 3H42A 4ECUA 1Q7YT 2MEWA 3OFGA 4UTGA 3AD8C 2Z4PA 2DHAA 1DBDA 4ETZA 2KKHA 2RS2A 1Y3KA 2HZAA 2KFYA 2KB2A 1ZYQA 4DV7J 2FJEB 3DRYA 2ZBCA 2DNPA 2MDAA 4Q5VA 4G1QA 4CM2A 4FXWA 1MG7A 2K06A 1T03A 2DCUB 1G1XA 1UVIA 5KFYA 3TVYA 2OPQB 4HL9A 3JSMA 2DKOB 1E6YA 1SKSA 2YKAA 1FTRA 2YTCA 1S1UB 3QFHA 2D74B 5A8KA 5HMYA 5K8PA 1SXLA 5IQQA 3NOGA 2F4VF 1HHQA 3AJDA 4P52A 2DXEA 5U47A 1HQUB 4QQBA 2L48A 4CLFA 5CABA 3I0SA 2YNHA 6FD1A 4UOFA 3H20A 2M52A 4M1KA 2WW4A 2VJUA 4EYHB 1VQNS 3ITHB 4PUOB 1IKVA 2DBBA 3FGVA 3MECA 1ZPVA 3BPDA 1U7LA 2CQIA 4U9RA 5L39A 2AEJA 2NQPA 4JI5F 1GTHA 1HBNB 4O0IA 4KHRA 2R2UA 2LQJA 1Y0HA 3N6MA 4CO0A 2BKPA 3BGFA 4PPZA 4TU7A 3DLJA 4HH0A 4FXDA 5KT3A 2VIHA 1N32F 1KOHA 5KFDA 4WCEQ 1K1QA 3Q83A 1TK0A 4PQUA 2R9LA 2J8AA 2DNMA 3MDFA 3O1LA 4I69A 1AW0A 1P8GA 3AOCA 1TUWA 2YPYA 3ZNUA 2QYCA 3G82A 3NP5A 3KK3B 2CJQA 4RW6A 1AUDA 2E7VA 1FJ7A 1Q95G 4DV5J 2H4YB 2GC8A 1OSCA 3DGPA 2J5AA 4WFNQ 2MGZA 3IN5A 1NPKA 3MOJB 2VUGA 1JLFA 5EWFA 1YK9A 1PC4A 2ALYB 1S9GA 4WYLA 4QIWD 3OPKA 1UEVA 1RT3B 4B3RF 4J9KA 4A8YA 4I68A 5HQMA 4LSNA 5LXYA 3K5PA 2EKNA 3CDWA 5ETVA 1S10A 4MYUA 2R7RA 1T8EA 2RF2B 3MCSA 1NJXA 1XWLA 4XPEA 3SZ2A 2MQ8A 4AQYF 1T11A 2XMVA 3BREA 1ACMB 2C2DA 2JRSA 1GNKA 3BQ0A 2ZDOA 3VCDA 2M3DA 3KDNA 2Z2ZA 3CULA 2WVDA 3EVMA 2FZCB 4D3HA 4JI4F 3DRPA 1QSSA 2HHWA 3SI8A 2HHHJ 3MM5A 1BQMB 4ZA1A 3I4PA 2KI2A 2VPWB 4XTTA 3HZGA 1T05B 4ECSA 1Y10A 1HBUA 3I87A 1RAJA 2FVCA 3VAMA 2HNYA 2CZVC 1V3ZA 2IM2A 3K5LA 3GE9A 5LM7E 2KJWA 3NGRA 4NZ7A 5KT2A 1RBOB 3DRSA 1FK9B 4RO0A 1TFWA 4ECXA 3IBCB 1RWNB 4DR1J 3NWRA 1G4CA 4ZPWR 3PACA 4NEZA 2VDIA 2HNZA 4F4YA 1QAJA 5IV3A 4O3QA 4DCOB 1C4AA 2BANA 3KYLA 1S59A 1YJVA 1EETB 1WTBA 4I7FB 4LF6J 1VBYA 3KJQB 4IG0A 3NRBA 2K1RA 1FWPA 1TFYA 3DLGB 4KKOA 1DAXA 4K59A 4ZN1A 2CQ4A 4ZCIA 3IBFB 4B3SF 2VZ9A 3HKWA 5H9EK 3PM9A 5HP1A 2MQLA 3QPIA 3VGUA 4USKA 4CIOA 4IH6A 1RWWB 1IWGA 3JSYA 3VALA 2QIFA 1NPRA 3ISZA 3M2UB 4OYAA 1LWFA 3EGZA 1TU0B 3PVXA 1KP6A 4KYZA 5DZ6A 5CYQA 3R2DJ 1Q82T 4X4UA 1U0HB 2GFFA 5C24A 1D0EA 4W92B 2QE5A 2XI3A 1RHJB 2OKQA 3TZWA 4UQTA 3HT3A 3P4UB 2CQ1A 3SV4A 2HKEA 5D0EA 2B7BB 4LF8J 1AZSA 2UU9F 1JLCB 1R7IA 5IT0A 5THWA 1M5VC 1DTQB 2I9SA 2NUHA 2CVIA 1ZZFA 5F8GA 3TANA 1OSDA 3JXOA 3VGVA 4DPTA 4OHVA 2MKHA 5IFMA 4GKKF 2MPUA 4RKUC 1OIAA 1FRIA 4IH5A 1FRKA 2VH7A 2W7PA 2M8HA 2ZH5A 1OY9A 4ED2A 3AODA 1M90T 4WZQA 3DLBA 3L7PA 1N5TA 5D78A 2DCLA 2E1PA 1HD1A 3JAMY 3C8YA 5D4PA 2QL7B 2FIUA 4ELVA 1LOUA 4DI6A 1NSPA 1S7IA 4JI6F 2OJ3A 4M5GA 3NWGA 3GSIA 3PV8A 5L9NA 2BDPA 5CCLA 3OUYB 1LKZA 2UXBF 4YHHJ 4IQMA 2PFFB 2W01A 4DR7F 1T3OA 2HWHA 2FZGB 3ET6A 1JKHB 1EKSA 4X62F 1EIYB 2FJAB 2EVZA 2GW8A 3RUBL 2ZNYA 5F9LA 3L3CA 1HA1A 5AE2A 2N4DA 2DJWA 4KFBA 3CJQA 4HYKA 2DGWA 1BXNA 3P5TL 1LV5A 4GKJJ 1REGX 2HAIA 2L9NA 3LAMA 2IAJA 1SJRA 2HGLA 2O1PA 1CC8A 3V6DA 2W8KA 1PSDA 3DU5A 4DEZA 1JNZB 2VF3A 3OHBA 4CO4A 1S72S 3I4HX 1CQMA 3DOMB 2QX0A 2VG7B 5DETA 4IRDA 1RWUA 3LO3A 3EE3A 4LF4J 2CZ4A 2FGOA 2QZ8A 3DGVA 4AL6A 1U1LA 1M0SA 3HHEA 5B08A 3IP0A 4NA1A 2KXNB 4WYWA 2LU1A 3M2RA 1KKHA 1VFJA 4QIGA 1HBNA 2BJDA 1FCAA 1Q4RA 1UJ4A 2VA2A 1M5HA 4HDGA 2O3DA 1H2TZ 1LK7A 4M5LA 4PQAA 2XZWA 2CPHA 2AV5A 4MYTA 4OX7A 5F41A 1RK8A 2UXCJ 2HLUA 2VV5A 1IR1A 2RILA 1VC0A 4MKAA 1FJEB 3SCJE 2N3OA 1TR0A 5LMUJ 3D67A 1GMWD 4J91A 4YR0A 3W2VA 4B02A 1UETA 3NNHA 1U1PA 1KVJA 3D1OA 3QGHA 2HHXA 2N3LA 3TZYA 3HULA 5CD4H 5F8NA 1T9TA 3O2IA 2V2QA 3GJSB 4HKQA 3A12A 3ILJA 1SIZA 4F25A 2IVYA 4G6VB 1WACA 2BXJA 3CDEA 2C2EA 2RU3A 5D3GA 2YX7A 4R0EA 1UWBB 4OZNA 1W2BR 4LFBF 4OYBA 3SQGA 4ECVA 2ZHOA 3G6XA 4WKYA 4J9SA 3KHHA 3K57A 4EZ6A 4CLZA 2PD1A 1S6PB 2BR0A 1RAIB 2MZSA 1KNZA 2JHEA 2R2RA 1F9FA 3NBPA 2FVPA 2K3KA 2R2SA 5F8MA 1RT6B 3CJRA 1CS4B 3HJFA 2RH3A 2CPXA 3L7UA 3D68A 2OD6A 5LSLA 1UFWA 4TY9A 4DBQA 3GIJA 2HMIA 4GO7X 3KHLA 3D0HE 3AD9C 2EXUA 3IWLA 4QYZJ 1K8AT 2MSTA 4U7UD 3QRQA 4NLWA 1CQNA 1JNRB 3PYEA 4NLSA 2LLZA 4XK8C 1XMOJ 1FXDA 5KFQA 3HHDA 2MKJA 1P9YA 5KG3A 3AA8A 1DJ0A 4J7CA 3PX6A 5HMXA 2XQCA 4K4VA 4MFBB 1SI9A 1X4AA 2W9BB 2XY6A 4X4TA 4FP9A 3R5BA 4C11A 1PILA 2ZBQA 2XLIA 4M5IA 4B3OB 2B4UA 3CB4A 3DFEA 3M32B 2WVBA 3FEZA 2AZ3A 5FIIA 4EU0A 1CSJA 2DH8A 5M2UA 1C1BB 3GILA 2CQBA 1FWKA 3OLBA 4O3OA 3GP9A 3FEXB 2DTJA 4PG5A 3MMAB 2PA3A 1HLWA 3DLGA 3FBBA 2Q66A 2BV3A 1S76D 4RNFA 2OPPB 3ENWA 3DDIA 2QLWA 4B3MJ 3SQOP 4UOGA 2LQ8A 2HRYA 4KV8B 1XQIA 1U1NA 4F4ZA 3T5KA 2KJVA 3QLHA 1S6QA 5A0YA 4U95A 3ADAC 1MSWD 1TKXB 2VDHA 4NLUA 1YRXA 1HWUA 2VOPA 2RDDA 4C8YA 3BS9A 4OHZA 1VC6A 4CWBA 4IFYB 1YJUA 1RWOB 4CLKA 2XY7A 1IJEB 2OSRA 1R0CB 3ISNC 4DV7F 3CDUA 2HGMA 3J81Y 1AB8A 4FVCA 3OQ2A 3NG8A 1UJ6A 3R6LB 4DV4F 2WB4A 3LUYA 3TX8A 1N54B 3RGIA 4YB1P 4EWTA 3GLJA 1U25A 1VQOS 3BO2A 1U2CA 3O8WA 3DLHA 3GMGA 3DDKA 2ZE2A 4F2SA 1RT5A 3LA0A 5E33A 3FSYA 1KLNA 3M30B 4DLGA 4HLBA 1NJIT 1O0PA 2XCPA 3MURP 1XMBA 1FJCA 2GGPA 2J7KA 2MKCA 5AT1B 5ETLA 1G2EA 4KPCA 4MH8A 3W7BA 3HFZB 1UW4A 2DRAA 1ELOA 1XTZA 1B4SA 1HMVA 2EEYA 4F4WA 3CCZA 4HI1A 3LAKA 3ZNJ1 1HI0P 2BOAA 4IR9A 2IBOA 4NEYA 3N0VA 2DNZA 4O4RA 3NGUA 4Z7YA 2DXFA 4PG6A 2IRUA 3KDOA 1JLBB 3CMES 3VTIA 4X4OA 2FUG9 4DX6A 3R5JB 1UJ5A 5CAAA 5C2GA 1HFEL 5B0DA 4BC9A 2A3JA 1UL3A 5DJBA 4RBTA 2MKIA 1VK3A 4KGZB 4DV5F 2KG0A 1JKHA 1TUGB 2P5VA 4UZCA 2XC9A 1BE4A 2F1FA 3H5UA 1ZM2A 3MEGB 3QIDA 1TP7A 1S79A 2M2BA 3LALA 4WK3A 4I6YA 3DM2A 4C0HA 2RKIA 3I6PA 3RU0A 5LJ3Y 3K2YA 3PHTA 5HVGA 2HLTA 3D6TB 3MR6A 3UR0A 3OJUA 4RNOA 1TL1B 5D77A 3B8HA 4K2JA 3TX0A 2JX2A 5I3UB 1RT1A 1VLOA 2VG7A 1Y00A 5DGBA 1JIHA 2ROPA 4R25A 1VK8A 3JTOA 2EFVA 2B51A 2CPJA 3C16A 3CJ2A 2ZITA 4WK1A 4Q44A 2HHHF 5HSPA 2CRLA 4ED5A 5I4MA 2ZBRA 1RBLA 3OXFA 4WF9Q 5E0OA 2HQFA 1FKOA 5IT9U 4OL8A 1TL4A 3VAHA 1RHUB 5EDWA 1K9MT 5KFMA 3KHRA 3OHAA 2GNKA 3PW4A 2EFGA 2W7AA 4N8NA 4QWDA 5H9FK 1S5ZA 3CC4S 1WHYA 1Z1ZA 2VBWA 4GRSA 1FKPB 4DR1F 3M8RA 1RTJB 1N0UA 5HMWA 2DNQA 3OL6A 1MWQA 3M1VB 4OQJA 1T7PA 3HD2A 4Q8EA 2QYGA 4MK9A 1BC6A 1UWBA 2B9EA 1XBWA 4FVMA 4LF6F 3MPDA 1DQ8A 3K5OA 2I0XA 5LMNJ 2WB1D 1WF1A 4AL7A 5AE3A 2RQ4A 3N9UC 3M2VA 2ZH2A 2L9DA 4YR3A 4JI3J 4X64F 3U02A 3MM8A 4KSEB 4ZPBA 4WE1A 3UNYA 5KFEA 2JWNA 3DRRA 1KD1T 1VQ4S 2G2YA 2KHDA 2R8JA 3LANA 1G7CB 2FDNA 2DNNA 3KJFB 2WONA 4ZP8A 4TYBA 2POKA 4I64A 3RW7A 1KQGB 1X0PA 3D6FB 2ROGA 2FJWA 1T9WA 2A2CA 4DQRA 1PJ5A 2JFKA 1QVGR 1FRXA 3IM8A 5HROA 4LBIA 2B9XA 3IS9A 4LF8F 2GS8A 4ZLLA 3MEKA 4CH0S 3HVAA 2W9BA 2NPIA 1YDLA 3C46A 3E01A 2QMWA 3DU6A 3M9NB 3KLIB 4Q45A 4B3OA 4QIEA 3M32A 3J7ZT 4LSLB 1E6VB 2PE8A 4YDDB 1F3FA 2EI5A 2C2OB 4A4JA 1HBOB 3G6ES 3C3LA 1HWLA 1WI8A 4MMOA 1HWJA 4ZJLA 4RR5A 1G6BA 2DNKA 3T6BA 4RNHA 1YITS 3HHKA 1LWCA 3DOLB 2BQUA 4IDKB 2J7WA 5I3QA 3RRHA 2D3O1 1AYEA 1F9HA 2KVQE 1HHSA 4J9PA 3I56S 2JH3A 1KOOA 4FBTA 4IQXA 5JMNA 3TA0A 3H90A 4P73A 4KV8A 3DLEA 2RT3A 4E8UA 2JZ5A 5B0CA 4J9OA 1TKXA 5E3RA 3U27A 5H1SV 3F0NA 3C6TA 4O4GB 5GAEU 5KOWA 4QIFA 5HK4A 4LREA 3W61A 3AB4B 1IM4A 2Y0BB 3PX4A 2YNFA 1PBAA 2QGFB 2X51A 1D9DA 1A7GE 4QR0A 3THTA 2AZ1A 4DF8A 1GEHA 1NDKA 4LF5J 1IBCB 3K0JA 2P9EA 2WCXA 4NYOA 3BZQA 1JXLA 4NXNJ 2A1BA 1J5OB 1M5KC 3IRXB 1CJVA 3CJ8A 1WHXA 3NGDA 1Z2LA 4N76A 1NU4A 1KS2A 1RABB 1XJWB 1F0XA 1KDNA 3UDLA 4M5JA 4P72A 4C7QA 5DG7A 2ZOMA 1NK5A 3KLGB 2KTQA 4ZKAA 3OFHA 2BYCA 4LVOP 4IRKA 4DL7A 1NHVA 2H5EA 2X1FA 3PJWA 3GFXA 1UTAA 4Q0BB 3V2UC 4LF4F 4OHWA 1WG5A 3HXMA 3M6UA 5SUHA 3JS9A 1VQ9S 4IRCA 5CYMB 3KJNB 4TLQA 3UD3P 3SFGA 2LEBA 1HW9A 4Z37A 5FDLA 4NCAA 3H4BA 5LJ5Y 4RW8B 4DWIA 4I0WA 1SVDA 2AEFA 2IYGA 4MKBA 2UXCF 5ETSA 4ZPTR 1A0OB 3W1YC 2Q6BA 3MPWA 5GAHI 3S8SA 1QD1A 4A8FA 3JB9k 2NYIA 2HQGA 3QSIA 3MM7B 4RL1A 4JB8B 2CJAA 3BSCA 2MLZA 3I31A 4HTJA 1FERA 2V69A 4NE9C 4LQ3A 2J0SD 4ECTA 3ENVA 4M94A 3ZZRA 4DFMA 1RT2B 2O5DA 3DC2A 3ZTQA 1CJUA 4BCAA 3IG1B 2WTFA 4BS2A 1P9QC 1WC1A 4Q8FA 3LP1B 3GU0A 2YQ0A 3BKTA 2ZH4A 2EPIA 2UP1A 1HWKA 3NCPA 3M8QB 2GJFA 4J9VA 4FDFA 4BLGA 1KQKA 2YWFA 3EYZA 3ENQA 3UR3C
chains in the Genus database with same CATH topology
4ZVUB 2XYGB 3KJQB 2CDRB 3R6LB 2Y1LB 2QLBB 3R7BB 1RWXB 1PYOB 2Y0BB 2H54B 3KJNB 1SC4B 2C1EB 2XYPB 3R5JB 4ZVTB 4LSZB 2H51B 2DKOB 4ZVQB 3GJQB 2H65B 1RE1B 1RWPB 2HBYB 1SC1B 1RHQB 2CNLB 2QL5B 1IBCB 2H5JB 3D6MB 2CJXB 3IBFB 2C2ZB 1RWMB 2H48B 2C2OB 1RWVB 2CNOB 1I51B 3GJTB 2CJYB 4DCPB 2CNNB 2H4YB 2QL9B 1RHUB 2H4WB 4JB8B 5IC6B 5IC4B 3NS7B 3GJSB 2XZDB 2HBQB 3EDQB 1RWWB 3D6HB 1ICEB 2FQQB 4ZVOB 1RHMB 3R7SB 2QL7B 1SC3B 1RHKB 3R6GB 2XYHB 3IBCB 1RWNB 1BMQB 1PAUB 2HBRB 3EDRB 3GJRB 3KJFB 1NMEB 1I3OB 1QDUB 2QLFB 4DCJB 3D6FB 4ZVPB 2CNKB 1RHRB 2P2CB 3QNWB 1RWOB 1RWKB 1QTNB 2H5IB 1RHJB 2HBZB 3P45B 3P4UB 4DCOB 1GFWB 3SIPB 3R7NB 4ZVSB 2C2MB 1F9EB 5K20B 2XZTB 2QLJB 3RJMB 2C2KB 4ZVRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVU B;  2XYG B;  3KJQ B;  2CDR B;  3R6L B;  2Y1L B;  2QLB B;  3R7B B;  1RWX B;  1PYO B;  2Y0B B;  2H54 B;  3KJN B;  1SC4 B;  2C1E B;  2XYP B;  3R5J B;  4ZVT B;  4LSZ B;  2H51 B;  2DKO B;  4ZVQ B;  3GJQ B;  2H65 B;  1RE1 B;  1RWP B;  2HBY B;  1SC1 B;  1RHQ B;  2CNL B;  2QL5 B;  1IBC B;  2H5J B;  3D6M B;  2CJX B;  3IBF B;  2C2Z B;  1RWM B;  2H48 B;  2C2O B;  1RWV B;  2CNO B;  1I51 B;  3GJT B;  2CJY B;  4DCP B;  2CNN B;  2H4Y B;  2QL9 B;  1RHU B;  2H4W B;  4JB8 B;  5IC6 B;  5IC4 B;  3NS7 B;  3GJS B;  2XZD B;  2HBQ B;  3EDQ B;  1RWW B;  3D6H B;  1ICE B;  2FQQ B;  4ZVO B;  1RHM B;  3R7S B;  2QL7 B;  1SC3 B;  1RHK B;  3R6G B;  2XYH B;  3IBC B;  1RWN B;  1BMQ B;  1PAU B;  2HBR B;  3EDR B;  3GJR B;  3KJF B;  1NME B;  1I3O B;  1QDU B;  2QLF B;  4DCJ B;  3D6F B;  4ZVP B;  2CNK B;  1RHR B;  2P2C B;  3QNW B;  1RWO B;  1RWK B;  1QTN B;  2H5I B;  1RHJ B;  2HBZ B;  3P45 B;  3P4U B;  4DCO B;  1GFW B;  3SIP B;  3R7N B;  4ZVS B;  2C2M B;  1F9E B;  5K20 B;  2XZT B;  2QLJ B;  3RJM B;  2C2K B;  4ZVR B; 
#chains in the Genus database with same CATH topology
 3CJ3 A;  3J81 j;  3MGJ A;  5KG2 A;  2B0G A;  2GA7 A;  2NXU A;  4KHP J;  4DFJ A;  2W24 A;  4TYA A;  3S01 A;  4C3K A;  1TL1 A;  2I5J B;  4UQG A;  4FPI A;  4FBU A;  1NZA A;  2Y0S D;  2Y1J A;  5GVQ A;  5KFK A;  1EJ7 L;  3R97 A;  2RB7 A;  2JSX A;  1IXK A;  1RIS A;  2R7O A;  1WKJ A;  4WWS A;  1AFJ A;  4K4S A;  5DG9 A;  1X4E A;  3FRZ A;  2X3D A;  3R1L A;  4CLU A;  5KFX A;  2ATC B;  2GVD B;  3LQV A;  5DQG A;  2QLX A;  2V5H G;  2QFI A;  3AQP A;  1Y4Z B;  3VZH A;  1LWX A;  2I38 A;  1Q7L B;  3LOU A;  1Q81 T;  4QBU A;  4ILR A;  4LFC J;  4PXC A;  3X3U A;  4N77 A;  4A8X A;  3UCZ P;  3M6W A;  3AT1 B;  1RB0 A;  5IWA J;  4DF4 A;  7FDR A;  3G71 S;  1R0B G;  4WFB Q;  2B6A A;  5E41 A;  1F5C A;  3QZ8 A;  2ZD1 B;  1BY9 A;  1I1G A;  1RTJ A;  3G6V A;  3SXL A;  1CVJ A;  2VOD A;  2CQC A;  2VG5 B;  1YJ7 A;  1Q8B A;  2X3G A;  1WF2 A;  2XSJ B;  3KWM A;  3ZXW A;  1UW9 A;  3G86 A;  2HIY A;  4LF9 J;  1RT7 B;  2XTJ P;  3PR4 A;  4PWD A;  3LPY A;  1W25 A;  4ZVE A;  2F8H A;  2XMK A;  4DMZ A;  2HFZ A;  4EZ9 A;  4LRA A;  1N5Q A;  4OHX A;  2XY5 A;  1MWY A;  3A8J A;  3E51 A;  1U1K A;  1D9F A;  5JVH Q;  4HT5 A;  3V4I B;  3CUN A;  4B3M F;  1QAY A;  4X65 J;  1X4C A;  1NJZ A;  4OI6 A;  3ENA A;  1UVK A;  3CCQ S;  4BHQ A;  5A2Q Y;  3T1Y J;  3GV5 B;  1XNQ J;  2MZR A;  1UVN A;  4RW4 B;  4H4M A;  2ZH1 A;  2C3U A;  3UE2 A;  4DPX A;  2E44 A;  2N7Y A;  4RUC A;  3SCK E;  3MR3 A;  3UN2 A;  3KMS A;  5ETQ A;  2DHX A;  3BGR B;  4ICL A;  2XYG B;  3HVR A;  3M05 A;  2AEM A;  2FJV A;  4WP9 A;  4PZV A;  3TI0 A;  1GT8 A;  3MM6 A;  4Y28 C;  2UVR A;  1H7X A;  3BBB A;  2BJ1 A;  4K4T A;  4R0J A;  1EQM A;  3MEE B;  2DR6 A;  3T3F A;  2AX0 A;  1WDD A;  3VAG A;  4DV6 J;  3TZZ A;  1WOP A;  2IJN A;  2ZC4 A;  1K0V A;  3CD6 S;  2YKQ A;  2OEK A;  4H4K A;  3QT5 A;  4CI0 B;  5BYQ A;  5F9N A;  1ZTT A;  1HBO A;  4DR3 J;  3P3D A;  4K2X A;  4K0K J;  2F65 A;  3MAQ A;  1C1C A;  2RQM A;  1DTT B;  4ZLJ A;  1RUS A;  2AYM A;  3NMR A;  4IDK A;  1ZAW A;  2R7S A;  2CPD A;  4QIV A;  2V4Q A;  1F60 B;  4J9Q A;  2YQ3 A;  5A8R A;  1GFW B;  2PO4 A;  2J9E A;  3E3X A;  2VJV A;  3M8P A;  4LF7 F;  1U6Z A;  3NAH A;  4ZVG A;  4F4A A;  1DUR A;  4NYZ A;  5CYJ A;  4N47 A;  2IMW P;  4U7U K;  5FLX Y;  2CXE A;  2KZM A;  2BJ3 A;  3HCX A;  4FF1 A;  4L75 A;  3OJS A;  4ED0 A;  4JYA J;  4MIW A;  2NZ4 A;  5CD4 A;  1T0T V;  4UF4 A;  1C4C A;  2E9R X;  3BDP A;  3MMB A;  2BQR A;  3KLF A;  1RTI B;  3QBC A;  4KH1 B;  1LQ9 A;  1ZA1 B;  4I2P B;  3M8S A;  3KUE A;  2VON A;  1JQG A;  1RLD A;  1D9A A;  3MTK A;  4KBI A;  2MQP A;  4JV2 A;  4LIR A;  2D3U A;  3IRX A;  1PG5 B;  2DGS A;  4G65 A;  3EWG A;  2IDL A;  4ED1 A;  3TAP A;  3PHE A;  5E2Q A;  5C7P A;  1SL2 A;  4BC7 A;  4CP5 A;  3L9Z A;  2NXE A;  2WVE A;  2IM3 A;  1WOO A;  1HNW J;  5L38 A;  2H5I B;  3W9J A;  2MZQ A;  1NK9 A;  1VIX A;  2MHN A;  5J2N A;  2K3I A;  2JEJ A;  1S0M A;  7FD1 A;  2OFG X;  3KK2 B;  4DV3 F;  3U1M A;  2KFN A;  2W9C A;  1IQT A;  5LXR A;  2VBX A;  1C0U A;  3QJJ A;  2M0G B;  3VR1 A;  1TEL A;  3HK2 A;  1KLM A;  2QEX S;  2LKZ A;  1HQE B;  2H5J B;  2WOM B;  4MIB A;  2CDQ A;  2DNR A;  3BH6 B;  2HGN A;  4GVB A;  4B3T J;  1SQF A;  2DNO A;  3LP0 B;  2IVF B;  3ZZU A;  5ADZ A;  3EPG A;  2A18 A;  4ZHR B;  1T95 A;  3MUV P;  2R8K A;  2MLY A;  2BW7 A;  1DRZ A;  3BPS P;  4I6A A;  4Y2I A;  4DDF A;  3TO8 A;  1TL3 B;  1XIQ A;  3UN5 A;  2VBY A;  4IOA Q;  2GCF A;  3A4T A;  3TJA A;  1JB0 C;  2Z57 B;  4QU6 A;  1M5S A;  1APS A;  4KO0 A;  3AXM A;  1TKT B;  2AJ0 A;  4OI2 A;  1NND A;  2DGU A;  3IG1 A;  3W62 A;  4IO9 Q;  3VQT A;  2KU7 A;  2FVS A;  4YUD A;  3M4X A;  2FLL A;  3KNA A;  1IR2 A;  2HVZ A;  3PO4 A;  5LMN F;  2F63 A;  4ZJO A;  4JI7 J;  4H54 A;  3I5B A;  4C6A A;  2RUS A;  3BGU A;  4LR8 A;  2LYV A;  2NXC A;  1BQN A;  4DL6 A;  4F0K A;  1Q79 A;  2OEL A;  4X4V A;  3SBM A;  3FCH A;  3TUZ C;  2ZBI A;  4JI3 F;  2GO9 A;  2PA8 D;  4G1Q B;  2R8G A;  2FC8 A;  3MMJ A;  3D0G E;  3Q8V A;  1T03 B;  2XSF A;  1X5S A;  5D0G A;  5EHH A;  3JSM B;  1LFW A;  2V8V A;  1X9S A;  1YBT A;  4DSF A;  5F8I A;  4DR4 J;  3MUM P;  4IYQ A;  1XEZ A;  1GXL A;  1N33 J;  1X9M A;  5KT6 A;  1FES A;  2DPI A;  4IOB A;  3A3O B;  3MHY A;  3I0S B;  1R8C A;  4OX9 J;  3PCO B;  2YNH B;  3EVW A;  4NZ0 A;  5B0B A;  3NL0 A;  2HSE B;  1S4E A;  2OPR B;  3PIP Q;  2F5G A;  4BDP A;  3B6B A;  4KPY A;  1IKV B;  2YKO A;  3JQJ A;  2H48 B;  4ILL A;  4C8L A;  2QA2 A;  2RRB A;  2C3Y A;  2JL9 A;  1KVI A;  1RT7 A;  3R1H A;  8ATC B;  5E3C A;  2D9P A;  3HM9 A;  4J90 A;  5L46 A;  4Y6I A;  2J9D E;  4WZM A;  2V63 A;  4PWW A;  4PQU B;  5A8W A;  1DLO A;  4R5P A;  4I1T A;  3US5 A;  1BWE A;  1KHW A;  2E1R A;  4KIA A;  5HN0 A;  3DLK A;  3DOK A;  1FFW B;  2CKW A;  4CLW A;  4RW6 B;  3V81 A;  3Q8Y A;  5EWE A;  2PI4 A;  1X9W A;  1VQY A;  3GG0 A;  2NYH A;  1HNV A;  2DR8 A;  2LEA A;  2ZKU A;  4RW4 A;  1HW8 A;  3DGP B;  2AX1 A;  2W4C A;  1TL7 A;  2HFS A;  3KKF A;  1JLF B;  2BJ9 A;  4F3O A;  1U26 A;  2JLE A;  1NH8 A;  2G2O A;  1S9G B;  4F0H A;  2WAQ D;  1TKD A;  2ERR A;  2PEH A;  3SCI E;  1YIJ S;  4LF5 F;  4LSN B;  1CJT A;  4NXN F;  1B64 A;  5IT9 Y;  5AJ3 J;  3PNI A;  2V6A A;  2FLN A;  4AYB D;  3CCM S;  3MPY A;  3MUT P;  4ZP7 A;  4P7T A;  3DMJ B;  2MZJ A;  3T19 A;  4DPU A;  3T5J A;  3A8E A;  4QPX A;  3GCW P;  1S0N A;  2FB0 A;  1IBL J;  3J80 Y;  3AJ2 A;  1U1R A;  2DPJ A;  4DV2 J;  1M1G A;  4CO2 A;  1GMV A;  4Y34 A;  1S99 A;  9ATC B;  4DHV A;  1BMQ B;  2BW2 A;  3MM5 B;  4EUV A;  3BQ1 A;  1WC6 A;  4C8O A;  1HBU B;  1ZM4 A;  1S48 A;  4NWB A;  2YWE A;  4OJ1 A;  2KZZ A;  2HNY B;  2AWZ A;  2JVO A;  1HKA A;  3CW2 C;  2AYG A;  4LQ9 A;  3G96 A;  5EN1 A;  3UVJ B;  3DRS B;  3LW5 C;  4EEY A;  1HNZ J;  3QFW A;  1SH0 A;  4DOZ A;  3OVA A;  3GR1 A;  4P9S A;  3KG0 A;  4MJK A;  2WK4 A;  2RHS B;  1WEX A;  2O01 C;  2HNZ B;  1KN6 A;  1Q16 B;  1Q5Y A;  3H8Y A;  2BAN B;  3FKB A;  4USJ C;  3SCL E;  4FNI A;  4M63 A;  2HEK A;  4HAC B;  1RJJ A;  3PEH A;  5A6W A;  2HVE A;  4OI4 A;  2K1R B;  3G6Y A;  1UCN A;  2A6O A;  2XMA A;  3CJK A;  4KKO B;  5H9F J;  2CZ9 A;  2HWI A;  1GH8 A;  2QTW A;  1ZTW A;  5DQH A;  4NXM J;  1SIW B;  4WFX A;  1FRL A;  4TY8 B;  1FJG J;  2ZZN A;  4I4B A;  1FKA F;  5K8O A;  1R0A A;  4NA3 A;  2BEF A;  2O67 A;  1FNO A;  4UY8 5;  1KEK A;  5HP1 B;  2XZT B;  3J7Z 5;  2JC0 A;  2FJD B;  3KK1 A;  2XCA A;  2L41 A;  1W7W A;  4KHP F;  5C42 A;  1OS5 A;  3RR8 A;  1KSP A;  2OGU A;  1VRT A;  1SC1 B;  2C2R A;  3IWX A;  2K7K A;  5C5J A;  5CYQ B;  4FYY B;  4DZ6 A;  4Y00 A;  3BM7 A;  3KK2 A;  3LP2 A;  4GVL A;  1LW0 A;  4DZD A;  1TV6 A;  2OEJ A;  4P6Q A;  4X4N A;  3NEK A;  3E2E A;  5IC6 B;  1QAI A;  2AJ4 A;  1N6Q B;  4MTP A;  1OO0 B;  2ADB A;  2R7X A;  3N4W A;  1N36 J;  3R3T A;  1HI1 A;  5GAD I;  1J5E J;  2BM1 A;  3BKU A;  1GTE A;  3R5G A;  4DPY A;  3GR0 A;  3LGM A;  3AD7 C;  4K8R A;  2RQC A;  4DX5 A;  4EMD A;  2PEB A;  1ZAX A;  4L76 A;  2W2P P;  4I6W A;  5IWA F;  3OTC A;  1OQ6 A;  3FRY A;  4DR6 F;  3A13 A;  1FO1 A;  3OV7 A;  3TP2 A;  3MR7 A;  1S1V B;  4WKR A;  1XMQ J;  2V0N A;  3NXZ A;  4O3P A;  1NZ8 A;  2O66 A;  2AYE A;  4I56 A;  3UWT A;  2H9Z A;  1VRU B;  4ZS6 A;  3AAW B;  5HVF A;  2HFU A;  2V50 A;  2KXF A;  3OL7 A;  2AGQ A;  2ZNZ A;  4LF9 F;  1FDB A;  3UO0 A;  2MQO A;  2YH1 A;  3EGN A;  3GV7 B;  2YWH A;  1DQ9 A;  4KRW A;  2PDA A;  3GWC A;  4X4R A;  2CPZ A;  3AA9 A;  4DX8 H;  1SKR A;  2CA9 A;  3SSS A;  3SDE A;  3KG1 A;  2LDY A;  3GYG A;  1JJ4 A;  4YQW A;  1UVJ A;  1JLG B;  4CO5 A;  3OW2 R;  4H4K C;  2V67 A;  4R8U A;  1Q8L A;  4O23 A;  5MLC V;  4X65 F;  4CO1 A;  1S1T A;  2IJF A;  4ED3 A;  1NB2 A;  3OFF A;  3BSO A;  2GZO A;  2DR5 A;  4LF1 A;  2FTR A;  3EDR B;  3BR9 A;  5T7L A;  3R5D A;  1U6F A;  3ET6 B;  1FT8 A;  1HR0 J;  3BYR A;  1U45 A;  2Y1I A;  1SCJ B;  4DN9 A;  3TQ1 A;  4KFB B;  2QJ3 A;  1H6K X;  1ZA2 B;  2WSC C;  1U02 A;  1Y5L B;  2EKY A;  4FKX A;  1XER A;  2AJ1 A;  3M8Y A;  1RTH B;  4DS4 A;  5KFT A;  3DCA A;  1W26 A;  1CPZ A;  4IH7 A;  3TEG A;  2IAJ B;  2DHS A;  4QWB A;  2BE9 B;  2C1E B;  3DXB A;  3V6D B;  3TAQ A;  4ECW A;  1N0V C;  1FHT A;  3DXS X;  1NK8 A;  1X60 A;  1SKW A;  1LXN A;  4F50 A;  1NK6 A;  1XR5 A;  2NLW A;  5LOQ A;  1D09 B;  1VGY A;  2CFX A;  5CZV A;  2KG1 A;  2B5J A;  2OPR A;  3HHN B;  4PR6 A;  2CNN B;  4U8Y A;  2W4P A;  1WG4 A;  3RG6 A;  5E3A A;  3ZZO A;  3BQ2 A;  2UUC J;  5F8L A;  3KJV A;  2E29 A;  2DGO A;  3PYF A;  2VPZ B;  3M2R B;  4DR3 F;  4JV5 J;  3K8W A;  4K0K F;  3CCU S;  1AXQ A;  1UWA A;  3CD5 A;  2EFN A;  3JTN A;  4F4X A;  3CO9 A;  2R8I A;  2PT0 A;  1FX2 A;  5G0R A;  2XO6 A;  2CUY A;  4FN5 A;  1PJ7 A;  2EK1 A;  3VF0 B;  4FYV B;  1NKE A;  1NK4 A;  2K2P A;  3MCM A;  4ZIW A;  3W2V B;  4H4O A;  1VBZ A;  2KDO A;  4U6P A;  1K44 A;  4EI2 A;  4DUY F;  3R7B B;  1RTD A;  1H98 A;  1YVF A;  2WRM A;  5J1E A;  2HHT A;  3M6X A;  1KWM A;  5B7W A;  3MOZ A;  1RAE B;  3PZP A;  3HSG A;  2Q1L A;  3H0P A;  4HI2 A;  5D3G B;  2WBM A;  4FS1 A;  1QVF R;  4P2F A;  1ZZN A;  3TA1 A;  2R8H A;  2DO0 A;  1SKU B;  3SQG B;  1FXL A;  3MCO A;  2VFT A;  4A47 A;  5IXU A;  3O5T B;  1U2F A;  3KLE B;  2YPZ A;  4RNN A;  2FVQ A;  1N5V A;  3FZ2 A;  3KLV A;  2AP6 A;  1FDN A;  3OSP A;  3D6H B;  2G2Z A;  3LPE A;  3ICL A;  4ES2 A;  3TR5 A;  1RAF B;  2KL8 A;  3NBP B;  3DMJ A;  2HQC A;  2ZBP A;  3QAE A;  2YVS A;  1NH7 A;  2DIV A;  1GX5 A;  1S1X A;  5CCM A;  2FLP A;  1KTQ A;  2HS0 A;  1HNW F;  3PKM A;  4TLR A;  1FFG B;  2RIJ A;  1H7W A;  3EZO A;  4NOH A;  2WVF A;  5KFZ A;  1JMT A;  2HMI B;  4ECY A;  1O51 A;  4NLQ A;  2HHQ A;  4KJI A;  1FFS B;  3GFH A;  2HQ3 A;  1SV5 A;  1K1S A;  4JI5 J;  5SZT A;  1VC5 A;  3UDE A;  2OO4 A;  2XYP B;  2DGV A;  3IA0 A;  2HND A;  3W5X A;  4RWX A;  2ZH7 A;  2E9Z A;  2IPO B;  4BWJ A;  3B78 A;  1W2I A;  2PSZ A;  1FRM A;  3UVJ A;  4NYP A;  5EWG A;  2NSB A;  3CD7 A;  5B0E A;  1HYS A;  4C11 B;  2DB1 A;  2BRL A;  1UZH A;  1WD6 A;  1FEH A;  2A2D A;  9RUB A;  4B3T F;  5EGY A;  3CJT A;  1R89 A;  3W8P A;  3MR5 A;  5EX0 A;  3N5F A;  1Q0N A;  2ASJ A;  2HHS A;  3TJ8 A;  3VAI A;  2Z56 B;  4HAC A;  4O0N A;  3W60 A;  4DSK A;  4B9L A;  1BQX A;  4B9T A;  4DU8 A;  5CA5 A;  5J2Q A;  4YS2 A;  1VJW A;  3CDB A;  3Q22 A;  4C0O C;  4B08 A;  4B3R J;  3R7N B;  2BE2 A;  2RRN A;  1N5Y A;  2X1G A;  3QWP A;  2MKY A;  1B70 B;  3PW2 A;  4DJB A;  2QLB B;  4TY8 A;  1F2H A;  2LQ5 A;  2Y9H A;  4QPT A;  7AT1 B;  3CVK A;  2GQQ A;  1NK0 A;  1XR6 A;  1XC9 A;  2AGP A;  3MMC A;  3EZ5 A;  2ZWP A;  3QLH B;  3QGG A;  1S6Q B;  5A0Y B;  4AD6 A;  5K5M A;  1N8R T;  4QZV B;  4EK2 A;  3FK4 A;  4X84 A;  2D3Z A;  4JI7 F;  1T9X A;  4QU7 A;  2XHW A;  3V6H A;  1WUU A;  2RJZ A;  5DS7 A;  4CLL A;  4O44 A;  2ZVS A;  4ETX A;  2MJN A;  4OYX A;  1H3D A;  4OJH A;  3MXH P;  4JI8 J;  2BQ3 A;  3I0R A;  2CG4 A;  2VFR A;  2YNG A;  3TVZ A;  3D66 A;  2KT3 A;  3PJX A;  2J8S A;  3NS5 A;  1S97 A;  1N6Q A;  3UDV A;  3I32 A;  2ZE2 B;  3FNN A;  4DR4 F;  1RT5 B;  2VG6 A;  1N33 F;  3GIK A;  2EFQ A;  3H5X A;  3SIP B;  2V4R A;  1U4B A;  3PXG a;  1Y5N B;  1C2P A;  2J6S A;  2H3E B;  5L9X A;  4X66 J;  2GGP B;  5D15 A;  4C8M A;  1IVZ A;  4IOC Q;  4F36 A;  3RYL A;  3POT B;  3BR8 A;  2WW8 A;  2OPS A;  4ZVQ B;  1PIE A;  1WC4 A;  3PEJ A;  1NUE A;  1S1V A;  3CC7 S;  1H2U X;  1HMV B;  4MKY A;  4U96 A;  1U47 A;  3GTY X;  1VRU A;  3HVW A;  3SV3 A;  3C6U A;  4ID5 B;  4AL5 A;  4OMF G;  4A48 A;  2VBZ A;  2DXD A;  4NLV A;  4HT7 A;  2HG4 A;  4B3S J;  2Z0G A;  4LVN P;  1KVK A;  4KGM A;  4C8K A;  3RTV A;  3D4J A;  1B0V A;  2ACY A;  4NI2 B;  1U8W A;  1SJQ A;  3ONQ A;  3TEH B;  4DR2 J;  2M9K A;  2MYF A;  4RW9 A;  4F04 B;  1JLG A;  1NXI A;  1F5A A;  3GJR B;  2A0F B;  3AJ1 A;  2DK2 A;  2CYY A;  2JEI A;  3I9V 9;  5CZX A;  1RWK B;  1IKX B;  3DHX A;  3HP6 A;  1UA0 A;  4ED7 A;  3LF0 A;  3CNQ P;  1U0S A;  5GAD U;  3RJM B;  3CJ5 A;  1U09 A;  3ZTO A;  2ASD A;  5BR8 J;  4EO6 A;  2QA1 A;  4AXJ A;  3BJY A;  4EYI B;  1SUQ A;  2E1A A;  4QCL A;  3EUN A;  3O3L A;  3CE8 A;  4DSI A;  3DM2 B;  2AMC B;  2M88 A;  2CNL B;  2RKI B;  1RTH A;  4OJG A;  3ETM A;  2COL A;  1NHU A;  2BVZ A;  1IR0 A;  4C4W A;  1QE1 A;  4HVZ A;  4LT6 A;  3QGI A;  4N56 A;  3FBF A;  1MML A;  4USI A;  3IR7 B;  2ZUA A;  5CXT A;  1T9V A;  5IC4 B;  4C97 A;  5A2Q U;  1RT1 B;  2M8D B;  1JLQ A;  3OXL A;  2YKP A;  4PYA A;  4JV1 A;  2KVI A;  3HMJ G;  1KR4 A;  1U48 A;  4I2Q B;  5CHC B;  4DV2 F;  2CG8 A;  1PKU A;  4PKD B;  4F02 A;  1FVS A;  1RHK B;  3RR7 A;  3OTB A;  1OQ3 A;  2HHU A;  2U1A A;  3C16 B;  1JLA A;  4CM0 A;  1MRO A;  4Y2M A;  1CEZ A;  2HW3 A;  4RBV A;  5HAO A;  2HK2 A;  4KR0 B;  4K4Y A;  5KFJ A;  1UAW A;  2XMM A;  2K8G A;  4UUW A;  1VQ7 S;  2JC1 A;  4DUT A;  1FKO B;  2XMJ A;  8RUC A;  3IR6 B;  3H7H B;  2Y1L B;  4UZB A;  2HQD A;  2JJ4 D;  2BJ7 A;  4M5D B;  2EBE A;  1HNI A;  3N6L A;  1ZAV A;  2F3J A;  4ED6 A;  1R27 B;  2MY7 A;  5KFS A;  4OZ0 A;  4Q43 A;  3Q8Q B;  2E5L F;  4CCH A;  4FZV A;  1UFK A;  2KM8 C;  1MN9 A;  4G1P A;  2I6W A;  3HVT B;  1UP1 A;  1H74 A;  5KFR A;  2AJF E;  4JP8 A;  2RUG A;  4WTO B;  5IM0 A;  1NRK A;  4X62 J;  3D1Q A;  4FNH A;  2YBV A;  4YR2 A;  1NKC A;  4UST A;  5D0H A;  1RKI A;  3S1T A;  1SBR A;  3JSR A;  3NCQ A;  3KLE A;  2OMO A;  3VGT A;  1R8P A;  2J0Q D;  1OPZ A;  1U1Q A;  3AY0 A;  5L8R C;  3GB0 A;  1FX4 A;  1FVQ A;  4NLO A;  2OUG A;  1VQP S;  4ZCM A;  4OZ1 A;  1RAH B;  2MLX A;  2YKM A;  1YZ6 A;  4DPO A;  3M2V B;  5FLX U;  1S7H A;  3MM8 B;  4ZPA A;  3FBC A;  1NSK L;  1JLE A;  1YZ7 A;  1BUX A;  4WE1 B;  2DR9 A;  1IKY A;  3EZU A;  3HHL A;  3DRR B;  4LR9 A;  5KFH A;  2XLJ A;  4ZVH A;  3GJQ B;  1R8H A;  4E2F B;  2YXL A;  1EP4 A;  2C2N A;  2WON B;  4YB5 A;  4KQZ A;  3PRD A;  2V4J B;  2OP5 A;  4M5N A;  5HRO B;  1WC3 A;  4DSL A;  3Q86 A;  2EK6 A;  4B9M A;  4CLT A;  3RRG A;  3IS9 B;  2XGP A;  2LMI A;  1D3W A;  4DL5 A;  3OR2 A;  1N36 F;  3E01 B;  4DLE A;  4DG1 A;  2VD3 A;  2F4F A;  2Z2M A;  1J5E F;  5DZ7 A;  2D7S A;  4OHY A;  1VBX A;  2KRB A;  2ASL A;  2DGX A;  2KRR A;  2AQ4 A;  2ZH8 A;  2L3M A;  5I3P A;  5K14 B;  2XB2 D;  4DR5 J;  2LEC A;  4RZR A;  3JYT B;  4DUZ J;  1NSQ A;  5KFW A;  3AH6 A;  4RW7 B;  4WP8 A;  2GHP A;  1VQS A;  4NCB A;  2VQF J;  2HK3 A;  1VQ5 S;  1LWC B;  4F3M A;  1XMQ F;  2ZVI A;  1VQM S;  1M5P C;  1SC4 B;  3RAQ A;  4F3Q A;  4ZK7 M;  2LVW A;  4IG3 A;  3Q89 A;  3RZA A;  2QL5 B;  5FJ4 A;  5HJY A;  2KT2 A;  5K8M A;  1R43 A;  5FD1 A;  3QAU A;  1WG1 A;  1Q1K A;  3DLE B;  4OZ2 A;  2ILZ A;  4J9L A;  3UN3 A;  1UEU A;  4NCG A;  3ZFV A;  4IR1 A;  4PEO A;  1OMS A;  2FJX A;  3H40 A;  2ZH9 A;  2BJE A;  2R7U A;  3NNA A;  3C6T B;  1HBM A;  1B7Y B;  5CQG A;  5KG1 A;  2CQ0 A;  2XGQ A;  2YNF B;  2IC3 A;  4K50 A;  2VIC A;  3C66 A;  2EC2 A;  1WJ9 A;  4MK7 A;  2ZJP Q;  2G1H A;  1I3O B;  2PC6 A;  2CAJ A;  1HR0 F;  2GHW A;  1RDR A;  4EGL A;  4RUH A;  4A8O A;  3QNW B;  3BDE A;  3GPA A;  3RB6 A;  1FRJ A;  2OFH X;  3PR5 B;  3TYT A;  4U67 Q;  1CJV B;  2DHH A;  4PPD A;  2G4B A;  2BRK A;  3TA2 A;  2QSF A;  2Y3Y A;  4K7Q A;  3CJS A;  2XHC A;  2VOO A;  2BJ8 A;  3MF5 A;  1IWA A;  4CYU A;  2E5I A;  5J2P A;  3L7O A;  1LWE B;  3MPU B;  4OYP A;  3ILI A;  1EQ0 A;  1R8B A;  2XUL A;  5KG6 A;  5HLF A;  5B0A A;  4I67 A;  2OI2 A;  1YBA A;  2GMJ A;  2F8M A;  4Y2K A;  4N7T A;  3POT A;  5DLF A;  2ZM6 J;  3CCJ S;  4DL2 A;  1V9O A;  1IKW A;  2H4W B;  4PXB A;  2W2O P;  1REV B;  3EDQ B;  4A8W A;  2UUC F;  1AFI A;  2NXN A;  2XBP A;  4M5K A;  4ID5 A;  4JV5 F;  4NPO A;  1A6L A;  3G4S S;  3BYP A;  1YGY A;  4M5H A;  5FDL B;  1VRQ C;  1I6J A;  1RI7 A;  3FFI A;  5GME A;  4ZN3 A;  3H5S A;  3W2W A;  4NI2 A;  4PYD A;  1D8Y A;  3P5B P;  3R2C J;  2OIH A;  3PFO A;  4WFY A;  3CCL S;  1T9U A;  2FY1 A;  3BV8 A;  4ZPD A;  2AIR B;  3Q24 A;  3PYG A;  2DNH A;  4OFZ A;  4F4K A;  3KNG A;  1TAQ A;  4F2R A;  1TQL A;  2YNI A;  1FE0 A;  1TK8 A;  1IKX A;  2W2N P;  3MPV A;  4L73 A;  1CC7 A;  4LRD A;  1B7F A;  4IFV A;  1HWI A;  4LFA J;  1RWP B;  5KFB A;  1CJU B;  4DV4 J;  2RDJ A;  2LQ9 A;  3T5H A;  4X4P A;  3ZZT A;  4OJ3 A;  2QMU B;  5D0R A;  1FRH A;  1VQ8 S;  1DAR A;  1P27 B;  2GV1 A;  3QJP A;  3NGT A;  1WEY A;  2VC1 A;  1LEO A;  2A10 A;  2GVZ B;  2VPX B;  5MAO A;  1NSA A;  4CLS A;  2GQ2 A;  2FHJ A;  6AT1 B;  5DDR C;  3WX4 A;  1M1H A;  3CIM A;  3W5Z A;  2B4V A;  1SB6 A;  1RYR A;  4NLT A;  2CQG A;  2HBR B;  2BE7 D;  3H25 A;  5K9F A;  4DCJ B;  4I2Q A;  1YKW A;  3BF4 A;  5E3Q A;  1GQE A;  5DM7 Q;  1RT4 A;  1Q86 T;  5KG5 A;  3L95 X;  3U1L A;  5ETN A;  1X4H A;  3HSJ A;  4A8K A;  2LQB A;  3EXY A;  2FHK A;  1N56 A;  1S49 A;  1S9E A;  2DO4 A;  4AUK A;  2G0J A;  4A8S A;  3JQK A;  2HBY B;  4IO1 A;  2AF6 A;  2M7S A;  4NLR A;  2HZV A;  3BN4 A;  2PII A;  3GYN A;  2CJX B;  3SEO A;  4DQI A;  4M5D A;  3QO9 B;  1I51 B;  1CUL B;  4OZ3 A;  3J80 U;  2XMT A;  5ETP A;  4EBC A;  2B6A B;  3D0I E;  1KFS A;  1UFL A;  2IHR 1;  3R27 A;  3VQS A;  1TAU A;  1F3V A;  3BBC A;  3HVT A;  2DNL A;  4OZJ A;  3KFW X;  2HS3 A;  3GYX B;  3FQL A;  4Q7A A;  4NLX A;  4PWD B;  3DNC A;  3AHP A;  2VFU A;  2W25 A;  3DDN A;  4P2S A;  3LWM A;  3V6J A;  1VBK A;  3B82 A;  2W4D A;  3UD4 P;  1RU2 A;  5LL6 d;  2VQE J;  3SSR A;  1N48 A;  3TRG A;  1F6T A;  3WZ0 A;  3DYA A;  1OYE A;  3NOC A;  1HI8 A;  5T41 A;  1RCO B;  3D28 A;  2WVC A;  1X4B A;  1H0H B;  2NRE A;  4ED4 A;  4LBP A;  2MKS A;  3OLA A;  3VWS A;  4H4M B;  2CQP A;  4ZDN A;  4TU9 A;  2UVU A;  1H72 C;  2V8G A;  1LFP A;  2OHD A;  5ETO A;  2EC0 A;  1U1M A;  2UUA J;  4JV0 A;  1L3S A;  4ICL B;  3K17 A;  2V2K A;  4JI8 F;  2ZWO A;  3IGV A;  1R6Y A;  2V4J A;  5RUB A;  2P6T A;  3SYZ A;  4Y3C A;  3MM6 B;  3MI7 X;  4OX8 A;  1PC5 A;  5HAN A;  1NDC A;  4HHJ A;  3V6K A;  1NME B;  2XI2 A;  1RLC L;  2GIR A;  2APO A;  1OY6 A;  2DEI A;  4ZIV A;  1F5B A;  4WXW A;  1TVR A;  3Q8U A;  2FPH X;  1ZOT A;  2ASY A;  1QY7 A;  2J9C A;  5AXM A;  2Z58 B;  3UPF A;  2CJB A;  5K14 A;  4X66 F;  4TKT A;  3JYT A;  3OD2 A;  3W66 A;  4ES1 A;  3I96 A;  5J2M A;  5HMZ A;  1NJW A;  1D8Z A;  3OSN A;  4YN3 B;  1SL0 A;  4RW7 A;  1C1C B;  1TL5 A;  4YB6 A;  3TZX A;  4A8Q A;  4CRJ A;  4MK8 A;  1U24 A;  5E7O B;  3P96 A;  5KTQ A;  4ZCK A;  2D1C A;  3LTO A;  1X8D A;  4WU3 A;  4DCP B;  4HHH A;  5DQI A;  5A8R B;  5KOX A;  2MQQ A;  3A8I A;  3M8P B;  2IBK A;  3M6V A;  4DX7 A;  1K47 A;  3MM9 A;  2GHV C;  4X64 J;  2P9C A;  1SC3 B;  2KN4 A;  4DR2 F;  3T9N A;  3CGI A;  2R42 A;  1RTZ A;  1CJK A;  2LU2 A;  4CH1 A;  4YHH F;  1CLF A;  5J1N A;  3MMB B;  2UV8 A;  1BHN A;  3KLF B;  1LW2 A;  5GAG I;  4ZVS B;  3HZE A;  1SQE A;  2CDR B;  3OVS A;  3OTE A;  1UA1 A;  5BR8 F;  1VYA A;  2R7V A;  4OLO A;  5AXN A;  2JLG A;  3RAX A;  1MU2 A;  4USU A;  5DO2 A;  1OY8 A;  5HBM A;  1IJF B;  1TKZ A;  2YKN A;  4GKJ F;  3FEY B;  1ZH5 A;  2ZJQ Q;  1PCA A;  2HZC A;  2CJK A;  3F44 A;  1LWE A;  5GMD A;  1IQZ A;  1S9F A;  3X1L B;  5F3Z A;  2P6S A;  1H73 A;  3KLH B;  1RCX B;  1M1K T;  2QO3 A;  1L3V A;  1MWZ A;  1DY3 A;  4L3N A;  4AE5 A;  5J2N B;  4F0M A;  4NLG A;  3MR2 A;  5D6G A;  3TAM A;  4FKY A;  5KFF A;  2W9C B;  2DR7 A;  1C0U B;  1REV A;  3PRB A;  3QT7 A;  1KLM B;  2J6T A;  5L1I A;  2CNK B;  5ETM A;  5GMK a;  3B4D A;  1VI7 A;  2FYX A;  5D4N A;  2HS4 A;  4QR2 A;  3TVK A;  4WXO A;  1VQL S;  3FMB A;  4B9N A;  1VOM A;  2G0C A;  2CQD A;  4GVB B;  4UW2 A;  4ILM A;  5A6P A;  3MAH A;  4HH1 A;  4KE5 A;  1UPM B;  5LMU F;  5C2C A;  1TTH B;  3HX9 A;  3HHL C;  1RAC B;  4S0M A;  4WFA Q;  2ALZ A;  4OI3 A;  4WBF A;  5CH7 B;  2ZUG A;  4RUA A;  4NAS A;  3CCT A;  5LSR A;  4FYD A;  2NSC A;  3D9B A;  4KTQ A;  2OD4 A;  1R31 A;  4KO0 B;  1KON A;  3DKD A;  1XNR J;  1WNE A;  3HPO A;  4GC6 A;  3JTP A;  3MWB A;  2OPQ A;  1XK8 A;  1WSV A;  4MIA A;  1S1U A;  2GVZ A;  1AT1 B;  1URR A;  2NS1 B;  3GFY A;  1BQN B;  3F73 A;  1PJ6 A;  3CD0 A;  1RBA A;  1FDD A;  1X4F A;  4L3K A;  2BAB A;  1P6T A;  4CZC A;  1HQU A;  2ACM A;  4W98 A;  1NKB A;  3AFG A;  3HLU A;  1S57 A;  3PY8 A;  1UPP A;  3PFE A;  3THP A;  1Z2Z A;  3IAS 9;  2HVD A;  2PN6 A;  2RDI A;  5H9E J;  2HPU A;  3ITH A;  4PUO A;  2ADC A;  2E7W A;  2YWG A;  3BO4 A;  5KFO A;  1HD0 A;  1IBK J;  3LH2 S;  2MZT A;  3NS6 A;  1YRU A;  3MZI A;  3H2V E;  3P6Y C;  3UD5 A;  5E3P A;  3T9Z A;  1P1T A;  3NAI A;  4LRB A;  1XMO F;  3UI3 A;  3I82 A;  2EWH A;  1FNM A;  5ETT A;  3WIU A;  3QO9 A;  3OTO J;  1CUL A;  2ZOF A;  3JSB A;  1HNX J;  4KAI A;  4Y0F A;  1N34 J;  1X31 C;  2ZHA A;  2AD9 A;  3UCG A;  4EBD A;  4F67 A;  2FZK B;  3KK3 A;  3ILL A;  3GQC A;  4DR5 F;  1VR6 A;  1QTN B;  3H2U B;  4DUZ F;  4JI2 J;  4J9U E;  3I5C A;  5DDP C;  5DDO C;  4MAK A;  2PI5 A;  4KGV B;  5K20 B;  3W5Y A;  1XN9 A;  3LGN A;  3MTJ A;  2V2Z A;  4LBH A;  1WF0 A;  4PWU A;  2B43 A;  2VQF F;  3H2L A;  4W4M A;  4BWM A;  1PYO B;  4URS A;  4OYO A;  4E98 A;  4ECQ A;  2ZDP A;  4ZJQ A;  3RBE A;  2OH2 A;  1WC0 A;  3HO1 A;  1RT3 A;  5A8W B;  1DLO B;  1SPB P;  4R5P B;  3G2X A;  3ELH A;  3TUP A;  3D6M B;  5KG0 A;  3QAT A;  3DLK B;  3DOK B;  3NMA A;  1RP5 A;  4DL3 A;  3V81 B;  2RF2 A;  2LCW A;  5F8H A;  2UVW A;  1HNV B;  3EXC X;  1ARO P;  2J0X A;  3QSY B;  1WTF A;  1AA1 B;  2BZ2 A;  5HO4 A;  1TL7 B;  5D4L A;  1AUS L;  1X0F A;  5J1P A;  3OXG A;  5L1K A;  1BQM A;  5HL7 Q;  4GMK A;  3WBZ A;  4RU9 A;  3D3B J;  5DLG A;  1T05 A;  4JBC A;  3K5N A;  1CJT B;  3BN7 A;  2V2V A;  1IM6 A;  1YBU A;  4V19 X;  2Q43 A;  2JOQ A;  2KT5 A;  3UW1 A;  5GAE I;  1GMU A;  4B9S A;  3EJM A;  4LJM A;  1RA6 A;  3LGH A;  1FK9 A;  4CLY A;  1QSY A;  2XWY A;  5D4O A;  4WP3 A;  4B9U A;  2RVJ A;  1V5V A;  4C2M A;  2KXH A;  2CNO B;  4ZOS A;  2J7U A;  2R4F A;  4P75 A;  2HRT A;  3BB5 A;  4K4Z A;  4ECZ A;  1L3T A;  1EET A;  3R5A A;  4I7F A;  2ZM6 F;  4N8O A;  4M5M A;  1MW7 A;  4UT4 A;  1S4F A;  3GSD A;  2DNG A;  3NLC A;  1ZM9 A;  3OT9 A;  3ZTR A;  1UEK A;  1T3N A;  5KFC A;  4QW9 A;  2QT7 A;  2YH0 A;  2XYH B;  4G1I A;  3C2P A;  4DU7 A;  3MCN A;  3DLL Q;  3A1Y G;  4YY3 J;  1DHM A;  3QWU A;  1F9E B;  1X7V A;  5IOL A;  2FC9 A;  1H2V Z;  1CBK A;  1C0T B;  4CNZ A;  5M2P A;  2NCK L;  2B9W A;  1N88 A;  2B8Q A;  1R8A A;  2IA6 A;  3S7R A;  2MKK A;  2XEX A;  3M2U A;  3OL8 A;  3G8T A;  2DIS A;  3GG1 A;  2X1A A;  4K4X A;  1V6H A;  1VS3 A;  4PAB A;  3CJK B;  4LFA F;  3V4M A;  1JX4 A;  2G0I A;  1U8S A;  1U0H A;  2QFJ A;  5ITH A;  2YWW A;  2BKO A;  1WC5 A;  4A8M P;  2VFV A;  4BBY A;  2DIT A;  3QQC D;  3CED A;  4NML A;  2QL9 B;  1R0A B;  2FHO B;  1FD8 A;  3NS7 B;  1JLC A;  2RRA A;  3EMT A;  3KK1 B;  1UVM A;  2AKW B;  2LA4 A;  2VPY B;  1DTQ A;  3RB3 A;  2QRR A;  3KUG A;  5C42 B;  1MNE A;  2V8H A;  4USW A;  4WFZ A;  1VRT B;  4PG4 A;  4PAA A;  1URN A;  2KM8 B;  3KLH A;  1QLN A;  2C3P A;  1VIO A;  3SMZ A;  1DQA A;  2P2C B;  1SJ3 P;  2UXD J;  2DRB A;  1MMD A;  3LP2 B;  1LW0 B;  5A76 A;  1RAD B;  1HL6 A;  1TV6 B;  4WPA A;  1JXE A;  3AOB A;  4M8L A;  3IXQ A;  2MXY A;  1RGV A;  3IMQ J;  1V3R A;  2DGQ A;  1P1L A;  1U2R A;  1R3N A;  3VAF A;  2MMY A;  5GAG U;  4LF7 J;  2AT1 B;  4ERD A;  3Q8R B;  3P49 B;  1WHV A;  1WOS A;  3MFI A;  2W8L A;  1RWM B;  3A3N B;  2GML A;  2RML A;  1FA0 A;  4QWA A;  3NGS A;  1SJ1 A;  4U7C A;  2IDE A;  5IV4 A;  3OBI A;  2YY3 A;  3FQK A;  3T1H J;  3OUY A;  1X4G A;  4Q2M A;  2KH9 A;  3EM1 A;  2BOP A;  4V1A k;  2OSQ A;  2IVM A;  1YTY A;  3C19 A;  1LNQ A;  4ZVO B;  1QAX A;  3WC0 A;  3GCX P;  3H59 A;  4QWE A;  5JVG Q;  2PFD A;  1BWV A;  1ROF A;  3D5M A;  2PMZ D;  3ZTS A;  4Y2A A;  3SDE B;  3BEG B;  4RU2 A;  2U2F A;  1VQ6 S;  2NZC A;  4FPR A;  5G4D A;  1Q53 A;  2AHO B;  3U1N A;  4ZCL A;  4R8U B;  3FZB A;  4ES3 A;  2VQE F;  1S1T B;  3DOM A;  1ITP A;  5T7L B;  1FF2 A;  4LUB A;  2F8E X;  4C8N A;  4ENO A;  2RE1 A;  4HTI A;  1DZ5 A;  3CMA S;  4DV3 J;  2IJR A;  5GAH U;  3G8Q A;  5M2R A;  2C3O A;  1HHT P;  4EO8 A;  2CWK A;  2UUA F;  4PG7 A;  2UUT A;  4D3G A;  3DI6 B;  2QMX A;  1YRT A;  1MLA A;  1Q8K A;  4AT1 B;  2ATL A;  4A46 A;  2FVR A;  2V68 A;  3Q8P B;  3AQO A;  4KH0 B;  4FF4 A;  2B3T B;  5DM6 Q;  1PYT A;  4O3S A;  1NHK L;  1O6X A;  4P71 A;  4P74 A;  2FD2 A;  2B5J B;  4U8V A;  2DD8 S;  3CCE S;  1EB0 A;  1VHF A;  3G87 A;  4WIQ A;  2HHV A;  5B0F A;  1UMJ A;  1X4D A;  4DV0 J;  2Q79 A;  1RWX B;  2H1Y A;  3KJV B;  3CJ4 A;  4QWC A;  2WSE C;  3FC9 A;  4ZVT B;  4OI1 A;  3OR1 B;  5I42 B;  3H4D A;  4QR1 A;  2AW0 A;  5G0R B;  4PXE A;  2VL1 A;  2Z30 B;  2N7C A;  1O8B A;  3IWN C;  5KFU A;  2RU9 A;  2VU5 A;  1SJ4 P;  3TUI C;  1GMW A;  3K8V A;  4H4O B;  1S6P A;  3CC2 S;  1KTV A;  1CG2 A;  3I55 S;  1NM2 A;  3DHW C;  5KFG A;  3IC1 A;  1X5P A;  2ZH6 A;  1RTD B;  2HYI B;  2DH9 A;  5J1E B;  1VMB A;  3RBZ A;  1HPZ B;  2QG9 B;  5AXL A;  1SQG A;  1U49 A;  4HDH A;  2OTL S;  2E1M C;  1RT6 A;  1CS4 A;  3L4B C;  3V5R A;  4NRU A;  4WII A;  1IBM J;  2CPI A;  2MJU A;  2XO7 A;  3PDN A;  4OYZ A;  1SC6 A;  3KTQ A;  3WX8 A;  3CF5 Q;  4PRF A;  3RB4 A;  3CO0 P;  3OTD A;  4C3M A;  3ZZ0 A;  4DN0 A;  2R7Q A;  1WI6 A;  3KHG A;  2E7X A;  4OLP A;  2E1C A;  2Y1R I;  3K58 A;  3THV A;  3FVY A;  3HKZ D;  3MED B;  3H98 A;  1NDL A;  4ECR A;  2HRU A;  2ZOG A;  5HI7 A;  3ETO A;  4C98 A;  1S1X B;  2HVI A;  4MFB A;  3PJ9 A;  4RUB A;  2MY8 A;  1EKR A;  2AJQ A;  4CDI A;  3BKF A;  1KRP A;  3H5Y A;  3FSX A;  4UY8 T;  4TN2 A;  1UZD A;  1NPP A;  1B0P A;  3GZ7 A;  4ALZ A;  4AXI A;  4AFF A;  4P2X A;  4F8R A;  1SV5 B;  4B17 A;  1NJY A;  1C1B A;  3WDO A;  2HND B;  2KO1 A;  2W1B A;  1L3K A;  4IUF A;  3MMA A;  2CPE A;  4FF2 A;  4DFP A;  4YME A;  1YJT A;  1YSJ A;  3CSK A;  4TU8 A;  1HYS B;  2IYI A;  2OPP A;  3M9M B;  1RXO B;  3CCS S;  1WOR A;  5D8H B;  3UCU P;  3BSN A;  2EFO A;  4K5S A;  1TUV A;  2XMU A;  3O44 A;  4USM A;  3UQS A;  1WSR A;  1C0T A;  2DGT A;  2KYX A;  4ZPV R;  2IM1 A;  3BH7 B;  3IAM 9;  4RWW A;  1T02 A;  4IFY A;  1GXU A;  5J2Q B;  1I94 J;  1NB7 A;  2C3M A;  4M95 A;  4Q2L A;  3CIZ A;  2UVV A;  2BE2 B;  2XMW A;  2FY8 A;  5KFL A;  1V5I B;  1N5Y B;  1XNR F;  4KY3 A;  4DSJ A;  1KHV A;  3GON A;  3PG9 A;  4OZ5 A;  1RAG B;  3A3P B;  4O3R A;  3QGP A;  2XLK A;  2MQM A;  3MMC B;  3UDC A;  1NLK L;  4OYW A;  2D9O A;  2B4P A;  3C15 B;  1FE4 A;  2E5H A;  3M30 A;  1Y5I B;  3K59 A;  5IZH A;  4O44 B;  3GIM A;  3QRR A;  3ZZP A;  1KQF B;  3J7A N;  3N28 A;  3HDS A;  1IUJ A;  3VVU A;  2ZEJ A;  4KGK A;  5DRK A;  3I0R B;  1RAO A;  4F26 A;  4DQQ A;  2YNG B;  4IKA A;  4FYW B;  4Y65 A;  2Q6C A;  1B0T A;  3AOA A;  1RHQ B;  1JJH A;  2XS7 A;  3U7J A;  5LSO A;  3HSZ A;  2MHE A;  5ETR A;  3LWL A;  2WZ1 A;  1FEE A;  1IBK F;  2J6U A;  3EVO A;  2VG6 B;  2UUB J;  1S77 D;  3PTW A;  1VCT A;  4JI1 J;  4K4U A;  3N01 A;  4DQP A;  4OV1 A;  3MD3 A;  2GIQ A;  1JLB A;  1NK7 A;  1N5S A;  3KG4 A;  1N4L A;  4LFC F;  2I1R A;  3OTO F;  1G3O A;  2CQ2 A;  1HNX F;  1Y11 A;  2G1D A;  4USH A;  2FHM A;  5L1L A;  1N34 F;  4FF3 A;  2OPS B;  3QMQ A;  3VHQ A;  1Q8I A;  3P8B B;  2F9D A;  4CNY A;  4ELU A;  4YEA A;  4RPF A;  3TUJ C;  3CCW A;  3BBF A;  3BSA A;  2IA0 A;  3S6E A;  2R7T A;  2OLW A;  4KB7 A;  1GX6 A;  2XS2 A;  4JI2 F;  3R5C A;  3C6U B;  2E5G A;  5DDQ C;  3NKY A;  2EG2 A;  3SFU A;  1F1B B;  3MEG A;  5KAK A;  1MN7 A;  3IFE A;  2M70 A;  3FSI A;  1ZM3 A;  4RJV A;  2IY5 B;  2CVE A;  5HAT A;  2Y8Y A;  3QT8 A;  4LR7 A;  4B9V A;  2P8I A;  1EZZ B;  2H51 B;  5KG7 A;  2A6M A;  2DT9 A;  2AYB A;  4JI0 J;  4RW9 B;  3FDS A;  2IM0 A;  2E66 A;  2LP4 A;  2XS5 A;  2GAH C;  3DN9 A;  4ZIT A;  4ZLN A;  4RBU A;  2ZFH A;  1BD6 A;  2F7V A;  3FJ2 A;  2CJY B;  4J9N A;  4QW8 A;  4PCQ A;  4N41 A;  2MZ1 A;  5I3U A;  3T1Y F;  1OJ4 A;  4PXD A;  4QJV A;  8AT1 B;  1XNQ F;  3EX7 B;  1U6B A;  4HR2 A;  2ZZT A;  4KHM A;  3PW7 A;  3CPW R;  4ATN A;  2HFN A;  3W65 A;  1SUQ B;  4YDX A;  4XAK A;  4OIX A;  1RHM B;  3T5L A;  1ZS6 A;  4J37 A;  3M8Z A;  1YQH A;  4LRC A;  2WBR A;  3DI6 A;  1T94 A;  4P7V A;  1SJF A;  1QE1 B;  3P45 B;  3ZTP A;  3KMQ A;  5T14 A;  1L3U A;  1D1U A;  2WHO A;  3RRK A;  1ZET A;  1ULR A;  3IGN A;  3VAJ A;  2AGO A;  4OZL A;  4ZVR B;  2VB6 A;  4YB7 A;  4NA2 A;  4C8Z A;  1Q5V A;  3HD1 A;  5DG8 A;  1JLQ B;  3PIO Q;  4DV6 F;  2B8P A;  2ROE A;  4YFU A;  4LSZ B;  3J7Y I;  3HSD A;  4FS2 A;  2H65 B;  3EIC A;  1SL1 A;  3Q8S B;  1FKP A;  3ILO A;  3T1A A;  4DR6 J;  2VC0 A;  2VA3 A;  1JLA B;  2DIU A;  1MRO B;  5K8N A;  3M1V A;  2ZHB A;  4NL5 A;  4JOU A;  3OR1 A;  5I42 A;  5C25 B;  2BKN A;  5JXS A;  2DRD A;  3NY0 A;  1F2G A;  1YI2 S;  4XIU A;  2E5J A;  4DV1 J;  3RBX A;  4CQ1 A;  2HBQ B;  3W8G A;  3ULH A;  3PX0 A;  3WQP A;  3PKY A;  1HIY A;  3MAA B;  1HNI B;  3D2W A;  1QTM A;  1NO8 A;  2BBE A;  3R7S B;  2X1B A;  4NRT A;  3HT0 A;  3O6Q A;  3GII A;  1UVL A;  1EAR A;  2RS8 A;  2JLF A;  4ZVP B;  3QT6 A;  2LEP A;  5IQ6 A;  1HPZ A;  2IRY A;  1FDA A;  1JJC B;  4YY3 F;  2IIH A;  5IM0 B;  4JYA F;  2IFX A;  2YQ1 A;  2UUW A;  4X4Q A;  2DY9 A;  3HHL D;  2JNJ A;  2H54 B;  2B4O A;  3IR5 B;  2LXF A;  3K5M A;  5B09 A;  3IBW A;  2PMW A;  3D7S B;  2RQK A;  4DPW A;  2CQ3 A;  3I5A A;  2J0W A;  4WU2 A;  2AJ2 A;  4CH7 A;  2F4V J;  3WC2 A;  2YKM B;  3M7V A;  4P2M A;  5E5N A;  1VIS A;  3PW0 A;  3M8W A;  3MED A;  2BM0 A;  5KT5 A;  4C48 A;  3K7R A;  4ED8 A;  1RKJ A;  1JLE B;  2QA4 G;  4LF2 A;  1S0O A;  5AXK A;  3Q0A A;  2V8P A;  3Q23 A;  3I9Z A;  1IKY B;  1TK5 A;  3KLI A;  3T6J A;  1LK5 A;  3HHL B;  2RHQ B;  2QSW A;  1BLU A;  2GJ2 A;  3QRP A;  1RQ0 A;  2D3O R;  1VHI A;  4LSL A;  1E6V A;  4CTA B;  1EP4 B;  4XPC A;  4J5O A;  2IRX A;  3FUY A;  3BGL A;  3VGS A;  4DL4 A;  2HHP A;  3PW5 A;  2UXD F;  1PO6 A;  2CQH A;  1PBU A;  4NLP A;  4TXS A;  1NEE A;  4C3L A;  3FCV A;  3WIV A;  3N5B A;  2W2Q P;  2UZA A;  3DRX A;  3DOL A;  1N32 J;  2DNY A;  2CPF A;  2BUN A;  2GQC A;  3M9O B;  2HWT A;  3IRW P;  1KC8 T;  4L72 B;  3OR2 B;  2V34 A;  2M4M A;  4DG1 B;  4OYM A;  4DUY J;  1J2V A;  1TMJ A;  2R7W A;  3FCW A;  2AU0 A;  2R3V A;  4ID8 A;  2KYZ A;  3OFE A;  4TNO A;  4O4G A;  2R2T A;  2HFO A;  2NXJ A;  1I5O B;  2E9T A;  3OL9 A;  3B4M A;  3T1H F;  2IMO A;  4UOC A;  4WJB A;  2V9W A;  2OML A;  3AB2 B;  2Z8Q A;  3GIR A;  1MMN A;  3QIP B;  3JAM U;  4IG3 B;  1JJ2 R;  4L6V 3;  3UNG C;  2F9J A;  2P9G A;  5KFA A;  1HQ2 A;  4QYR A;  5L1J A;  2JEF A;  4UOH A;  1J5O A;  1N52 B;  1NAQ A;  3KXD A;  1FNX H;  2HBZ B;  3R8Y A;  2LA6 A;  3RBD A;  4FYX B;  1KQS R;  4NCG B;  2C2M B;  2M5Y A;  4AQY J;  3C15 A;  4P10 A;  1FWL A;  2VFS A;  3TNV A;  4ZVU B;  3C14 B;  3HF5 A;  1U1O A;  1S6U A;  3QYY A;  1HBM B;  1YHQ S;  1PGZ A;  2JFD A;  2Z2L A;  1PAE X;  4NMX A;  3T41 A;  4ZMM A;  4TQS A;  1OYD A;  3W3S A;  3VVT A;  2IC3 B;  1WHW A;  2GIF A;  3WHI A;  2ZJR Q;  4JI4 J;  1V3S A;  3KLG A;  1NCL A;  1QUV A;  4NLY A;  2Y8W A;  2DY1 A;  2CAD A;  2GJI A;  1B99 A;  1VJQ A;  2I2Y A;  1Y7P A;  2WSF C;  4Q0B A;  3L09 A;  4LRF A;  4C0B A;  5BYR A;  5CYM A;  2YX4 A;  3D3C J;  2W7O A;  4XDD A;  1JXV A;  4CYU B;  5J2P B;  5EX3 A;  4RW8 A;  2V94 A;  2HIQ A;  4KGX B;  5HLF B;  5F0W A;  4OX9 F;  1WWH A;  2ZC3 A;  3MM7 A;  2MB0 B;  2KFZ A;  4X2B A;  1JK9 B;  1IKW B;  4J9M A;  3F56 A;  4PG8 A;  4W90 B;  3ZC4 A;  5KFI A;  3IM9 A;  4DV0 F;  2JEG A;  2C42 A;  1EX8 A;  2EBG A;  1RT2 A;  1RE1 B;  1GAO A;  2QV6 A;  1R6V A;  4YP3 A;  4ZP9 A;  1S1W B;  3FFI B;  3LP1 A;  3W2W B;  4NLD A;  4URQ U;  3M8Q A;  2G9O A;  1FTC A;  2F40 A;  1SH2 A;  2OEM A;  1YJW S;  5F0U A;  3J7A 1;  4QYZ K;  1K0T A;  4OX6 A;  2FHJ D;  2YNI B;  1LXJ A;  3BGO P;  2LXU A;  4OYI A;  2VAS A;  2MQN A;  3PO5 A;  1JWW A;  1RAA B;  2EFP A;  2I5J A;  2PMH A;  1WDT A;  2HQI A;  3R6G B;  4IFV B;  3W64 A;  2HAF A;  2C22 A;  3W9I A;  3EGV A;  1QDU B;  4EFA C;  4E0D A;  2V9K A;  1S0V A;  3HI9 A;  1IBM F;  3CDA A;  1YJ9 S;  3VZI A;  4V19 J;  2XWX A;  4DL0 C;  2LDI A;  1E6Y B;  1RSC A;  2QLJ B;  3TAR A;  1XR7 A;  2C2K B;  3EPI A;  3ISN D;  2UU9 J;  2FLO A;  2GVD A;  2N82 B;  1FI4 A;  4URG A;  3CTR A;  1YLX A;  5A8K B;  4LIW A;  5AJ3 F;  1WKL A;  2BAC A;  1QJH A;  5IT4 A;  3JQM A;  1QSL A;  4GKK J;  2XM3 A;  1IBL F;  1RWV B;  1X5O A;  1O5J A;  3Q2S C;  5KFP A;  1RZM A;  3HFK A;  1WEZ A;  3GJT B;  4DQS A;  4YOE A;  2DYA A;  2DHG A;  4RX6 A;  4JUZ A;  4HHU A;  2QC3 A;  1RT4 B;  2ZD1 A;  3CT9 A;  4USV A;  2B56 A;  2PGC A;  2VG5 A;  3E8O A;  2LFV A;  5BJR A;  3G9C A;  2XSJ A;  3MEC B;  3HFV A;  5C25 A;  1GXT A;  3MD1 A;  2LXI A;  3GV8 B;  2BX6 A;  3A8K A;  1S9E B;  1YWX A;  3TJ9 A;  1PAU B;  4RNM A;  2DVI A;  2CWX A;  2VHG A;  1VLY A;  4Z2X A;  4JI6 J;  2HVH A;  2EG1 A;  3MAA A;  4DFK A;  4KC5 A;  4Z7C A;  5KT4 A;  4RLE A;  4MT1 A;  2D41 A;  5BYS A;  1HNZ F;  4ZPC A;  1TZ0 A;  1B3T A;  2VKR A;  1UKU A;  2UXB J;  3V4I A;  2FGC A;  4C9D A;  3G82 B;  2Q3P A;  3CCR S;  4DR7 J;  3RAM A;  5B0G A;  2BMB A;  3W9H A;  5KT7 A;  4XO0 A;  4O3N A;  2ZZM A;  3TWZ A;  2MGZ B;  2JVR A;  1RA7 A;  1YX2 A;  3PRV A;  2OAU A;  5EUH A;  4X4S A;  3TW0 A;  1I94 F;  3VV2 B;  3NCR A;  2C28 A;  3K89 A;  4CLP A;  1WEL A;  2DH7 A;  3J7Y U;  3BGR A;  3G8S A;  1Y9O A;  2XNQ A;  4AND A;  1ICE B;  4NXM F;  3HJV A;  3KUH A;  5JJB A;  1FJG F;  3CCV S;  5DGA A;  4OI0 A;  1WKK A;  3DYA B;  2GAG C;  1S6O A;  4DXL A;  2QA4 S;  2ABY A;  5KFN A;  2VKZ G;  3CWJ A;  1QM9 A;  2BA9 A;  5HJX A;  4TQR A;  3MEE A;  1IN0 A;  4GO5 X;  4K5R A;  2B7C B;  1M5O C;  2K7J A;  2XG8 A;  2W9A A;  3R9L A;  1YJN S;  1RYS A;  5KG4 A;  1A9N B;  2V8D A;  1ZBT A;  3FBE A;  4CTA A;  4ANC A;  4UUX A;  3DRP B;  2NUU G;  3J81 U;  1PYS B;  4ER8 A;  1K73 T;  4J9R A;  1DTT A;  4ZVF A;  3IO1 A;  3D54 A;  5KFV A;  3GFZ A;  2JDJ A;  4MKV A;  3W63 A;  1DFD A;  2KHC A;  2RNE A;  2EW9 A;  4ELT A;  1TVR B;  1YJR A;  2MTL A;  2J76 E;  2UUB F;  2UV8 G;  1X5T A;  2MSS A;  4JI1 F;  2GO8 A;  3FMW A;  2E5L J;  3VAK A;  1YG0 A;  2DEJ A;  1KBR A;  1EAY C;  2YWK A;  5J2M B;  2ILY A;  5F8J A;  2HUR A;  2HFV A;  3B54 A;  4LFB J;  2QLF B;  5AE1 A;  4IG0 B;  2RD5 C;  1RHR B;  4ZLP A;  3N79 A;  1RTI A;  3ZO7 A;  1GK8 A;  2X7I A;  4I2P A;  3QIP A;  2G13 A;  5LT5 A;  2L08 A;  3QJL A;  1SH3 A;  4DS5 A;  4ITS A;  1NDP A;  3CMQ A;  1VQK S;  3RB0 A;  3D1H A;  4NX9 A;  4K4W A;  5HQL A;  4LMZ A;  3MM9 B;  4ANE A;  1ZPW X;  3CJ0 A;  4L74 A;  4EBE A;  4CT8 A;  2SXL A;  3C14 A;  5BXI A;  4JI0 F;  2QN6 B;  2RAQ A;  1NBE B;  1CJK B;  1BGX T;  1S12 A;  2Z2Y B;  1H38 A;  2ZKT A;  4CT9 A;  3TQE A;  4QOT A;  1LWF B;  1EHW A;  1LW2 B;  4F7V A;  4CO3 A;  3EGW B;  3ZZZ A;  2XNR A;  1L5U A;  2NPF A;  4G3I A;  5C24 B;  1Y3J A;  2W2M P;  1MU2 B;  3RW6 A;  4XDC A;  5HBM B;  1TMM A;  2CIM A;  1HQE A;  2WOM A;  4N5S A;  1TKZ B;  2YKN B;  2CPY A;  1VDH A;  2RSQ A;  3UFC X;  1Q78 A;  1AZS B;  5HQ8 A;  2GX8 A;  1QUP A;  1HAR A;  3NGK A;  3OVB A;  2GMH A;  3N6N A;  4WTY A;  4FXV A;  2YX1 A;  4ZP6 A;  1FXR A;  2L9W A;  1T9Y A;  3LP0 A;  1Z4U A;  5HVH A;  4OV6 A;  3KOA A;  3ZZY A;  4ZHR A;  3TAM B;  3SSQ A;  3TOQ A;  3Q2T C;  5F3T A;  4KT0 C;  3AXK A;  3PYD A;  6FDR A;  4Y2C A;  3BO3 A;  1TL3 A;  2I8E A;  2B9Y A;  5ETK A;  2C2Z B;  3CXC R;  1RU1 A;  2ZH3 A;  2CJ9 A;  3NNC A;  1J27 A;  3F41 A;  1TKT A;  5IS2 A;  4TVA B;  3QZ7 A;  4GC7 A;  1KFD A;  2OTJ S;  1OWX A;  1OPI A;  1S1W A;  3MFH A;  4HEA 9;  5JUM A;  2XZD B;  4DV1 F;  1FD2 A;  2D69 A;  2J9D A;  2FJB B;  2FQQ B;  4DSE A;  4NZ6 A;  2NR0 A;  2N4C A;  3H42 A;  4ECU A;  1Q7Y T;  2MEW A;  3OFG A;  4UTG A;  3AD8 C;  2Z4P A;  2DHA A;  1DBD A;  4ETZ A;  2KKH A;  2RS2 A;  1Y3K A;  2HZA A;  2KFY A;  2KB2 A;  1ZYQ A;  4DV7 J;  2FJE B;  3DRY A;  2ZBC A;  2DNP A;  2MDA A;  4Q5V A;  4G1Q A;  4CM2 A;  4FXW A;  1MG7 A;  2K06 A;  1T03 A;  2DCU B;  1G1X A;  1UVI A;  5KFY A;  3TVY A;  2OPQ B;  4HL9 A;  3JSM A;  2DKO B;  1E6Y A;  1SKS A;  2YKA A;  1FTR A;  2YTC A;  1S1U B;  3QFH A;  2D74 B;  5A8K A;  5HMY A;  5K8P A;  1SXL A;  5IQQ A;  3NOG A;  2F4V F;  1HHQ A;  3AJD A;  4P52 A;  2DXE A;  5U47 A;  1HQU B;  4QQB A;  2L48 A;  4CLF A;  5CAB A;  3I0S A;  2YNH A;  6FD1 A;  4UOF A;  3H20 A;  2M52 A;  4M1K A;  2WW4 A;  2VJU A;  4EYH B;  1VQN S;  3ITH B;  4PUO B;  1IKV A;  2DBB A;  3FGV A;  3MEC A;  1ZPV A;  3BPD A;  1U7L A;  2CQI A;  4U9R A;  5L39 A;  2AEJ A;  2NQP A;  4JI5 F;  1GTH A;  1HBN B;  4O0I A;  4KHR A;  2R2U A;  2LQJ A;  1Y0H A;  3N6M A;  4CO0 A;  2BKP A;  3BGF A;  4PPZ A;  4TU7 A;  3DLJ A;  4HH0 A;  4FXD A;  5KT3 A;  2VIH A;  1N32 F;  1KOH A;  5KFD A;  4WCE Q;  1K1Q A;  3Q83 A;  1TK0 A;  4PQU A;  2R9L A;  2J8A A;  2DNM A;  3MDF A;  3O1L A;  4I69 A;  1AW0 A;  1P8G A;  3AOC A;  1TUW A;  2YPY A;  3ZNU A;  2QYC A;  3G82 A;  3NP5 A;  3KK3 B;  2CJQ A;  4RW6 A;  1AUD A;  2E7V A;  1FJ7 A;  1Q95 G;  4DV5 J;  2H4Y B;  2GC8 A;  1OSC A;  3DGP A;  2J5A A;  4WFN Q;  2MGZ A;  3IN5 A;  1NPK A;  3MOJ B;  2VUG A;  1JLF A;  5EWF A;  1YK9 A;  1PC4 A;  2ALY B;  1S9G A;  4WYL A;  4QIW D;  3OPK A;  1UEV A;  1RT3 B;  4B3R F;  4J9K A;  4A8Y A;  4I68 A;  5HQM A;  4LSN A;  5LXY A;  3K5P A;  2EKN A;  3CDW A;  5ETV A;  1S10 A;  4MYU A;  2R7R A;  1T8E A;  2RF2 B;  3MCS A;  1NJX A;  1XWL A;  4XPE A;  3SZ2 A;  2MQ8 A;  4AQY F;  1T11 A;  2XMV A;  3BRE A;  1ACM B;  2C2D A;  2JRS A;  1GNK A;  3BQ0 A;  2ZDO A;  3VCD A;  2M3D A;  3KDN A;  2Z2Z A;  3CUL A;  2WVD A;  3EVM A;  2FZC B;  4D3H A;  4JI4 F;  3DRP A;  1QSS A;  2HHW A;  3SI8 A;  2HHH J;  3MM5 A;  1BQM B;  4ZA1 A;  3I4P A;  2KI2 A;  2VPW B;  4XTT A;  3HZG A;  1T05 B;  4ECS A;  1Y10 A;  1HBU A;  3I87 A;  1RAJ A;  2FVC A;  3VAM A;  2HNY A;  2CZV C;  1V3Z A;  2IM2 A;  3K5L A;  3GE9 A;  5LM7 E;  2KJW A;  3NGR A;  4NZ7 A;  5KT2 A;  1RBO B;  3DRS A;  1FK9 B;  4RO0 A;  1TFW A;  4ECX A;  3IBC B;  1RWN B;  4DR1 J;  3NWR A;  1G4C A;  4ZPW R;  3PAC A;  4NEZ A;  2VDI A;  2HNZ A;  4F4Y A;  1QAJ A;  5IV3 A;  4O3Q A;  4DCO B;  1C4A A;  2BAN A;  3KYL A;  1S59 A;  1YJV A;  1EET B;  1WTB A;  4I7F B;  4LF6 J;  1VBY A;  3KJQ B;  4IG0 A;  3NRB A;  2K1R A;  1FWP A;  1TFY A;  3DLG B;  4KKO A;  1DAX A;  4K59 A;  4ZN1 A;  2CQ4 A;  4ZCI A;  3IBF B;  4B3S F;  2VZ9 A;  3HKW A;  5H9E K;  3PM9 A;  5HP1 A;  2MQL A;  3QPI A;  3VGU A;  4USK A;  4CIO A;  4IH6 A;  1RWW B;  1IWG A;  3JSY A;  3VAL A;  2QIF A;  1NPR A;  3ISZ A;  3M2U B;  4OYA A;  1LWF A;  3EGZ A;  1TU0 B;  3PVX A;  1KP6 A;  4KYZ A;  5DZ6 A;  5CYQ A;  3R2D J;  1Q82 T;  4X4U A;  1U0H B;  2GFF A;  5C24 A;  1D0E A;  4W92 B;  2QE5 A;  2XI3 A;  1RHJ B;  2OKQ A;  3TZW A;  4UQT A;  3HT3 A;  3P4U B;  2CQ1 A;  3SV4 A;  2HKE A;  5D0E A;  2B7B B;  4LF8 J;  1AZS A;  2UU9 F;  1JLC B;  1R7I A;  5IT0 A;  5THW A;  1M5V C;  1DTQ B;  2I9S A;  2NUH A;  2CVI A;  1ZZF A;  5F8G A;  3TAN A;  1OSD A;  3JXO A;  3VGV A;  4DPT A;  4OHV A;  2MKH A;  5IFM A;  4GKK F;  2MPU A;  4RKU C;  1OIA A;  1FRI A;  4IH5 A;  1FRK A;  2VH7 A;  2W7P A;  2M8H A;  2ZH5 A;  1OY9 A;  4ED2 A;  3AOD A;  1M90 T;  4WZQ A;  3DLB A;  3L7P A;  1N5T A;  5D78 A;  2DCL A;  2E1P A;  1HD1 A;  3JAM Y;  3C8Y A;  5D4P A;  2QL7 B;  2FIU A;  4ELV A;  1LOU A;  4DI6 A;  1NSP A;  1S7I A;  4JI6 F;  2OJ3 A;  4M5G A;  3NWG A;  3GSI A;  3PV8 A;  5L9N A;  2BDP A;  5CCL A;  3OUY B;  1LKZ A;  2UXB F;  4YHH J;  4IQM A;  2PFF B;  2W01 A;  4DR7 F;  1T3O A;  2HWH A;  2FZG B;  3ET6 A;  1JKH B;  1EKS A;  4X62 F;  1EIY B;  2FJA B;  2EVZ A;  2GW8 A;  3RUB L;  2ZNY A;  5F9L A;  3L3C A;  1HA1 A;  5AE2 A;  2N4D A;  2DJW A;  4KFB A;  3CJQ A;  4HYK A;  2DGW A;  1BXN A;  3P5T L;  1LV5 A;  4GKJ J;  1REG X;  2HAI A;  2L9N A;  3LAM A;  2IAJ A;  1SJR A;  2HGL A;  2O1P A;  1CC8 A;  3V6D A;  2W8K A;  1PSD A;  3DU5 A;  4DEZ A;  1JNZ B;  2VF3 A;  3OHB A;  4CO4 A;  1S72 S;  3I4H X;  1CQM A;  3DOM B;  2QX0 A;  2VG7 B;  5DET A;  4IRD A;  1RWU A;  3LO3 A;  3EE3 A;  4LF4 J;  2CZ4 A;  2FGO A;  2QZ8 A;  3DGV A;  4AL6 A;  1U1L A;  1M0S A;  3HHE A;  5B08 A;  3IP0 A;  4NA1 A;  2KXN B;  4WYW A;  2LU1 A;  3M2R A;  1KKH A;  1VFJ A;  4QIG A;  1HBN A;  2BJD A;  1FCA A;  1Q4R A;  1UJ4 A;  2VA2 A;  1M5H A;  4HDG A;  2O3D A;  1H2T Z;  1LK7 A;  4M5L A;  4PQA A;  2XZW A;  2CPH A;  2AV5 A;  4MYT A;  4OX7 A;  5F41 A;  1RK8 A;  2UXC J;  2HLU A;  2VV5 A;  1IR1 A;  2RIL A;  1VC0 A;  4MKA A;  1FJE B;  3SCJ E;  2N3O A;  1TR0 A;  5LMU J;  3D67 A;  1GMW D;  4J91 A;  4YR0 A;  3W2V A;  4B02 A;  1UET A;  3NNH A;  1U1P A;  1KVJ A;  3D1O A;  3QGH A;  2HHX A;  2N3L A;  3TZY A;  3HUL A;  5CD4 H;  5F8N A;  1T9T A;  3O2I A;  2V2Q A;  3GJS B;  4HKQ A;  3A12 A;  3ILJ A;  1SIZ A;  4F25 A;  2IVY A;  4G6V B;  1WAC A;  2BXJ A;  3CDE A;  2C2E A;  2RU3 A;  5D3G A;  2YX7 A;  4R0E A;  1UWB B;  4OZN A;  1W2B R;  4LFB F;  4OYB A;  3SQG A;  4ECV A;  2ZHO A;  3G6X A;  4WKY A;  4J9S A;  3KHH A;  3K57 A;  4EZ6 A;  4CLZ A;  2PD1 A;  1S6P B;  2BR0 A;  1RAI B;  2MZS A;  1KNZ A;  2JHE A;  2R2R A;  1F9F A;  3NBP A;  2FVP A;  2K3K A;  2R2S A;  5F8M A;  1RT6 B;  3CJR A;  1CS4 B;  3HJF A;  2RH3 A;  2CPX A;  3L7U A;  3D68 A;  2OD6 A;  5LSL A;  1UFW A;  4TY9 A;  4DBQ A;  3GIJ A;  2HMI A;  4GO7 X;  3KHL A;  3D0H E;  3AD9 C;  2EXU A;  3IWL A;  4QYZ J;  1K8A T;  2MST A;  4U7U D;  3QRQ A;  4NLW A;  1CQN A;  1JNR B;  3PYE A;  4NLS A;  2LLZ A;  4XK8 C;  1XMO J;  1FXD A;  5KFQ A;  3HHD A;  2MKJ A;  1P9Y A;  5KG3 A;  3AA8 A;  1DJ0 A;  4J7C A;  3PX6 A;  5HMX A;  2XQC A;  4K4V A;  4MFB B;  1SI9 A;  1X4A A;  2W9B B;  2XY6 A;  4X4T A;  4FP9 A;  3R5B A;  4C11 A;  1PIL A;  2ZBQ A;  2XLI A;  4M5I A;  4B3O B;  2B4U A;  3CB4 A;  3DFE A;  3M32 B;  2WVB A;  3FEZ A;  2AZ3 A;  5FII A;  4EU0 A;  1CSJ A;  2DH8 A;  5M2U A;  1C1B B;  3GIL A;  2CQB A;  1FWK A;  3OLB A;  4O3O A;  3GP9 A;  3FEX B;  2DTJ A;  4PG5 A;  3MMA B;  2PA3 A;  1HLW A;  3DLG A;  3FBB A;  2Q66 A;  2BV3 A;  1S76 D;  4RNF A;  2OPP B;  3ENW A;  3DDI A;  2QLW A;  4B3M J;  3SQO P;  4UOG A;  2LQ8 A;  2HRY A;  4KV8 B;  1XQI A;  1U1N A;  4F4Z A;  3T5K A;  2KJV A;  3QLH A;  1S6Q A;  5A0Y A;  4U95 A;  3ADA C;  1MSW D;  1TKX B;  2VDH A;  4NLU A;  1YRX A;  1HWU A;  2VOP A;  2RDD A;  4C8Y A;  3BS9 A;  4OHZ A;  1VC6 A;  4CWB A;  4IFY B;  1YJU A;  1RWO B;  4CLK A;  2XY7 A;  1IJE B;  2OSR A;  1R0C B;  3ISN C;  4DV7 F;  3CDU A;  2HGM A;  3J81 Y;  1AB8 A;  4FVC A;  3OQ2 A;  3NG8 A;  1UJ6 A;  3R6L B;  4DV4 F;  2WB4 A;  3LUY A;  3TX8 A;  1N54 B;  3RGI A;  4YB1 P;  4EWT A;  3GLJ A;  1U25 A;  1VQO S;  3BO2 A;  1U2C A;  3O8W A;  3DLH A;  3GMG A;  3DDK A;  2ZE2 A;  4F2S A;  1RT5 A;  3LA0 A;  5E33 A;  3FSY A;  1KLN A;  3M30 B;  4DLG A;  4HLB A;  1NJI T;  1O0P A;  2XCP A;  3MUR P;  1XMB A;  1FJC A;  2GGP A;  2J7K A;  2MKC A;  5AT1 B;  5ETL A;  1G2E A;  4KPC A;  4MH8 A;  3W7B A;  3HFZ B;  1UW4 A;  2DRA A;  1ELO A;  1XTZ A;  1B4S A;  1HMV A;  2EEY A;  4F4W A;  3CCZ A;  4HI1 A;  3LAK A;  3ZNJ 1;  1HI0 P;  2BOA A;  4IR9 A;  2IBO A;  4NEY A;  3N0V A;  2DNZ A;  4O4R A;  3NGU A;  4Z7Y A;  2DXF A;  4PG6 A;  2IRU A;  3KDO A;  1JLB B;  3CME S;  3VTI A;  4X4O A;  2FUG 9;  4DX6 A;  3R5J B;  1UJ5 A;  5CAA A;  5C2G A;  1HFE L;  5B0D A;  4BC9 A;  2A3J A;  1UL3 A;  5DJB A;  4RBT A;  2MKI A;  1VK3 A;  4KGZ B;  4DV5 F;  2KG0 A;  1JKH A;  1TUG B;  2P5V A;  4UZC A;  2XC9 A;  1BE4 A;  2F1F A;  3H5U A;  1ZM2 A;  3MEG B;  3QID A;  1TP7 A;  1S79 A;  2M2B A;  3LAL A;  4WK3 A;  4I6Y A;  3DM2 A;  4C0H A;  2RKI A;  3I6P A;  3RU0 A;  5LJ3 Y;  3K2Y A;  3PHT A;  5HVG A;  2HLT A;  3D6T B;  3MR6 A;  3UR0 A;  3OJU A;  4RNO A;  1TL1 B;  5D77 A;  3B8H A;  4K2J A;  3TX0 A;  2JX2 A;  5I3U B;  1RT1 A;  1VLO A;  2VG7 A;  1Y00 A;  5DGB A;  1JIH A;  2ROP A;  4R25 A;  1VK8 A;  3JTO A;  2EFV A;  2B51 A;  2CPJ A;  3C16 A;  3CJ2 A;  2ZIT A;  4WK1 A;  4Q44 A;  2HHH F;  5HSP A;  2CRL A;  4ED5 A;  5I4M A;  2ZBR A;  1RBL A;  3OXF A;  4WF9 Q;  5E0O A;  2HQF A;  1FKO A;  5IT9 U;  4OL8 A;  1TL4 A;  3VAH A;  1RHU B;  5EDW A;  1K9M T;  5KFM A;  3KHR A;  3OHA A;  2GNK A;  3PW4 A;  2EFG A;  2W7A A;  4N8N A;  4QWD A;  5H9F K;  1S5Z A;  3CC4 S;  1WHY A;  1Z1Z A;  2VBW A;  4GRS A;  1FKP B;  4DR1 F;  3M8R A;  1RTJ B;  1N0U A;  5HMW A;  2DNQ A;  3OL6 A;  1MWQ A;  3M1V B;  4OQJ A;  1T7P A;  3HD2 A;  4Q8E A;  2QYG A;  4MK9 A;  1BC6 A;  1UWB A;  2B9E A;  1XBW A;  4FVM A;  4LF6 F;  3MPD A;  1DQ8 A;  3K5O A;  2I0X A;  5LMN J;  2WB1 D;  1WF1 A;  4AL7 A;  5AE3 A;  2RQ4 A;  3N9U C;  3M2V A;  2ZH2 A;  2L9D A;  4YR3 A;  4JI3 J;  4X64 F;  3U02 A;  3MM8 A;  4KSE B;  4ZPB A;  4WE1 A;  3UNY A;  5KFE A;  2JWN A;  3DRR A;  1KD1 T;  1VQ4 S;  2G2Y A;  2KHD A;  2R8J A;  3LAN A;  1G7C B;  2FDN A;  2DNN A;  3KJF B;  2WON A;  4ZP8 A;  4TYB A;  2POK A;  4I64 A;  3RW7 A;  1KQG B;  1X0P A;  3D6F B;  2ROG A;  2FJW A;  1T9W A;  2A2C A;  4DQR A;  1PJ5 A;  2JFK A;  1QVG R;  1FRX A;  3IM8 A;  5HRO A;  4LBI A;  2B9X A;  3IS9 A;  4LF8 F;  2GS8 A;  4ZLL A;  3MEK A;  4CH0 S;  3HVA A;  2W9B A;  2NPI A;  1YDL A;  3C46 A;  3E01 A;  2QMW A;  3DU6 A;  3M9N B;  3KLI B;  4Q45 A;  4B3O A;  4QIE A;  3M32 A;  3J7Z T;  4LSL B;  1E6V B;  2PE8 A;  4YDD B;  1F3F A;  2EI5 A;  2C2O B;  4A4J A;  1HBO B;  3G6E S;  3C3L A;  1HWL A;  1WI8 A;  4MMO A;  1HWJ A;  4ZJL A;  4RR5 A;  1G6B A;  2DNK A;  3T6B A;  4RNH A;  1YIT S;  3HHK A;  1LWC A;  3DOL B;  2BQU A;  4IDK B;  2J7W A;  5I3Q A;  3RRH A;  2D3O 1;  1AYE A;  1F9H A;  2KVQ E;  1HHS A;  4J9P A;  3I56 S;  2JH3 A;  1KOO A;  4FBT A;  4IQX A;  5JMN A;  3TA0 A;  3H90 A;  4P73 A;  4KV8 A;  3DLE A;  2RT3 A;  4E8U A;  2JZ5 A;  5B0C A;  4J9O A;  1TKX A;  5E3R A;  3U27 A;  5H1S V;  3F0N A;  3C6T A;  4O4G B;  5GAE U;  5KOW A;  4QIF A;  5HK4 A;  4LRE A;  3W61 A;  3AB4 B;  1IM4 A;  2Y0B B;  3PX4 A;  2YNF A;  1PBA A;  2QGF B;  2X51 A;  1D9D A;  1A7G E;  4QR0 A;  3THT A;  2AZ1 A;  4DF8 A;  1GEH A;  1NDK A;  4LF5 J;  1IBC B;  3K0J A;  2P9E A;  2WCX A;  4NYO A;  3BZQ A;  1JXL A;  4NXN J;  2A1B A;  1J5O B;  1M5K C;  3IRX B;  1CJV A;  3CJ8 A;  1WHX A;  3NGD A;  1Z2L A;  4N76 A;  1NU4 A;  1KS2 A;  1RAB B;  1XJW B;  1F0X A;  1KDN A;  3UDL A;  4M5J A;  4P72 A;  4C7Q A;  5DG7 A;  2ZOM A;  1NK5 A;  3KLG B;  2KTQ A;  4ZKA A;  3OFH A;  2BYC A;  4LVO P;  4IRK A;  4DL7 A;  1NHV A;  2H5E A;  2X1F A;  3PJW A;  3GFX A;  1UTA A;  4Q0B B;  3V2U C;  4LF4 F;  4OHW A;  1WG5 A;  3HXM A;  3M6U A;  5SUH A;  3JS9 A;  1VQ9 S;  4IRC A;  5CYM B;  3KJN B;  4TLQ A;  3UD3 P;  3SFG A;  2LEB A;  1HW9 A;  4Z37 A;  5FDL A;  4NCA A;  3H4B A;  5LJ5 Y;  4RW8 B;  4DWI A;  4I0W A;  1SVD A;  2AEF A;  2IYG A;  4MKB A;  2UXC F;  5ETS A;  4ZPT R;  1A0O B;  3W1Y C;  2Q6B A;  3MPW A;  5GAH I;  3S8S A;  1QD1 A;  4A8F A;  3JB9 k;  2NYI A;  2HQG A;  3QSI A;  3MM7 B;  4RL1 A;  4JB8 B;  2CJA A;  3BSC A;  2MLZ A;  3I31 A;  4HTJ A;  1FER A;  2V69 A;  4NE9 C;  4LQ3 A;  2J0S D;  4ECT A;  3ENV A;  4M94 A;  3ZZR A;  4DFM A;  1RT2 B;  2O5D A;  3DC2 A;  3ZTQ A;  1CJU A;  4BCA A;  3IG1 B;  2WTF A;  4BS2 A;  1P9Q C;  1WC1 A;  4Q8F A;  3LP1 B;  3GU0 A;  2YQ0 A;  3BKT A;  2ZH4 A;  2EPI A;  2UP1 A;  1HWK A;  3NCP A;  3M8Q B;  2GJF A;  4J9V A;  4FDF A;  4BLG A;  1KQK A;  2YWF A;  3EYZ A;  3ENQ A;  3UR3 C; 
#chains in the Genus database with same CATH homology
 4ZVU B;  2XYG B;  3KJQ B;  2CDR B;  3R6L B;  2Y1L B;  2QLB B;  3R7B B;  1RWX B;  1PYO B;  2Y0B B;  2H54 B;  3KJN B;  1SC4 B;  2C1E B;  2XYP B;  3R5J B;  4ZVT B;  4LSZ B;  2H51 B;  2DKO B;  4ZVQ B;  3GJQ B;  2H65 B;  1RE1 B;  1RWP B;  2HBY B;  1SC1 B;  1RHQ B;  2CNL B;  2QL5 B;  1IBC B;  2H5J B;  3D6M B;  2CJX B;  3IBF B;  2C2Z B;  1RWM B;  2H48 B;  2C2O B;  1RWV B;  2CNO B;  1I51 B;  3GJT B;  2CJY B;  4DCP B;  2CNN B;  2H4Y B;  2QL9 B;  1RHU B;  2H4W B;  4JB8 B;  5IC6 B;  5IC4 B;  3NS7 B;  3GJS B;  2XZD B;  2HBQ B;  3EDQ B;  1RWW B;  3D6H B;  1ICE B;  2FQQ B;  4ZVO B;  1RHM B;  3R7S B;  2QL7 B;  1SC3 B;  1RHK B;  3R6G B;  2XYH B;  3IBC B;  1RWN B;  1BMQ B;  1PAU B;  2HBR B;  3EDR B;  3GJR B;  3KJF B;  1NME B;  1I3O B;  1QDU B;  2QLF B;  4DCJ B;  3D6F B;  4ZVP B;  2CNK B;  1RHR B;  2P2C B;  3QNW B;  1RWO B;  1RWK B;  1QTN B;  2H5I B;  1RHJ B;  2HBZ B;  3P45 B;  3P4U B;  4DCO B;  1GFW B;  3SIP B;  3R7N B;  4ZVS B;  2C2M B;  1F9E B;  5K20 B;  2XZT B;  2QLJ B;  3RJM B;  2C2K B;  4ZVR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...