2ZUGA

Crystal structure of wssv icp11
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
ATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEELRLLTGDSTLEIQPMIVPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords ORF115 (WSSV285) (Wsv230)
publication title White spot syndrome virus protein ICP11: A histone-binding DNA mimic that disrupts nucleosome assembly
pubmed doi rcsb
source organism Shrimp white spot syndrome virus
total genus 13
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09625 VP9 VP9 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2070 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zugA00
2GJIA 2ZUGA 2GJ2A
chains in the Genus database with same CATH superfamily
4EUVA 1LOUA 3TUJC 1O51A 2G13A 2X3GA 3MURP 1QTMA 2HHHJ 3PTWA 4NEYA 4KAIA 4DR7F 2MLYA 5B0BA 1GTEA 1NAQA 4PG7A 2GAGC 1RTJA 4TU8A 2AEFA 4KGZB 4EYIB 2EG2A 4KV8B 1X4AA 3CDAA 3BYRA 4HHHA 1F9FA 2E7WA 3SFGA 3NAHA 1RAIB 5L9NA 4CI0B 2K1RB 2VG5A 3J7YU 3CDUA 4QWBA 1ITPA 3NOGA 1FX2A 4KHMA 2RD5C 2IRYA 3HVRA 3EE3A 3ZZZA 5IC6B 1U1KA 3KK3A 2DGXA 2NZCA 4J37A 4F50A 3GJSB 3LO3A 3BPDA 5AJ3F 2DXDA 4Z37A 2HSEB 3W62A 3MR5A 3M05A 4Q8EA 2HNYA 1S57A 3P5BP 3CDEA 3R5DA 1NJZA 1AUSL 4X64J 2Y1JA 3CCJS 3IRXB 2XGQA 1CLFA 3OFGA 2A18A 3HMJG 1TTHB 4WCEQ 3R27A 3HHLC 2FZGB 4JUZA 3ZZUA 4USMA 3DLBA 4TY9A 2H65B 5ETRA 1U48A 4LF6J 1IN0A 1RWMB 1JXEA 2V0NA 2XMWA 3GILA 3AH6A 1RCOB 2JC0A 3R6GB 5HJXA 4KKOB 3QRQA 2FJBB 3SDEA 3C19A 4RNFA 3T1YJ 2WSEC 2FY8A 3ELHA 3V4IA 2FJXA 3E8OA 4BBYA 4JI3F 5K9FA 3KLHB 3KOAA 3TJ9A 3MR6A 3NGKA 1QDUB 4YDXA 2OH2A 2ZOMA 2HHVA 4B3MF 1TKZA 4A8WA 3L4BC 1Q82T 2NYHA 2NPFA 4ICLB 4DSFA 4LUBA 2ZE2A 5G4DA 5CYQA 4LFBF 2MQPA 1NJWA 1S49A 3POTA 2MHNA 3DOLA 2I9SA 1WHWA 1FO1A 4CRJA 2ZHAA 5DQHA 1VC6A 2UVRA 3FVYA 2DXEA 3MECB 3RAQA 2OKQA 4F04B 4X4OA 3DLGA 3HZEA 1SV5A 1SKUB 4WFXA 4MK9A 4ZLNA 2WW4A 2FHKA 2GVDB 3DOKB 3I4PA 1ZZNA 3EXYA 2MKIA 2PI4A 2C22A 4O44B 3PX0A 1HNVA 1TZ0A 4KE5A 2XI3A 2ZM6J 1YVFA 2JDJA 2VKZG 4DV4J 1YQHA 2POKA 3RGIA 5LMUJ 1P1LA 2WOMB 3EGNA 2FUG9 4F02A 2H5JB 5KFWA 4DL4A 5L1LA 1T7PA 2ZH9A 3T41A 4ZMMA 4ZVSB 4USVA 4LIWA 2F5GA 3MM5A 1HA1A 1ZYQA 3WC0A 2EBEA 2E7XA 4ZITA 1NDPA 2HQCA 1URRA 3CF5Q 4NLTA 3W1YC 2DCUB 3A8EA 4QWCA 4NOHA 2CKWA 4RNMA 3FDSA 4EO6A 4F3OA 1HWKA 3JSYA 2M8DB 2IVFB 3O3LA 3MMCA 5KG1A 2CNKB 1H74A 2YPZA 4HDGA 1I1GA 2QSFA 4ZIVA 1M5PC 4GMKA 2XB2D 4DQIA 1KSPA 1OY9A 1EETA 2IVYA 3IBWA 4OJGA 1IUJA 2DGTA 1LEOA 1KOHA 3D6HB 4JI0F 3C66A 1JLFA 2YVSA 4XDCA 3GWCA 4RW9A 2R8JA 4P7TA 3R5CA 1RHMB 3N9UC 5LSOA 3GJTB 3AT1B 3RR7A 2EK6A 1HW8A 1CJKA 5A8RB 2P9GA 2DBBA 2HG4A 2E1CA 1VCTA 4OJ1A 1GNKA 4C8MA 3RW7A 1LW2A 3W9JA 4C2MA 1MSWD 3R6LB 3TARA 4IDKB 2B3TB 3OTOJ 2DNKA 5EWGA 3HKZD 3VAIA 2P6TA 4IFVB 4I6YA 4NLGA 4USIA 2BKOA 4DOZA 2DHSA 2KHDA 2JJ4D 1CG2A 4TKTA 4F0HA 2JOQA 4J9RA 4M94A 1OS5A 2DHAA 2FC9A 5HATA 1IQZA 2QFIA 1FVQA 3H5SA 4WXOA 4TY8B 1TKDA 3A8JA 5IV4A 2IRUA 4OLOA 5IM0A 4CM0A 2VFSA 4J9KA 3MEEB 3LA0A 1RP5A 4U95A 2V2ZA 3MEKA 1T05B 2XEXA 4JI8F 2YY3A 4KY3A 2LXFA 2H4WB 4FNIA 1N33J 1KWMA 2VDHA 3P4UB 1UL3A 4JV1A 2HVIA 4C4WA 3WX8A 4DX8H 3O2IA 2PMWA 1RT7B 3THVA 3KLVA 2JLFA 2P6SA 4RW4A 3UNGC 4OX9J 5BYRA 1U0HB 3M30B 5IZHA 1UVJA 1MN9A 3TX8A 1AFJA 4FF4A 5KFKA 3GB0A 2HWIA 3CC7S 1WSVA 1K0VA 1RK8A 2BE9B 1YJ9S 4A8YA 4XK8C 3PM9A 2GZOA 4C3LA 3I96A 4AL7A 1JQGA 3UDVA 5HSPA 4DR5F 2NSCA 4I6AA 2ZOFA 4A8QA 1PBUA 4DI6A 2VBXA 3R1HA 3DHXA 2DNYA 1TP7A 4DFKA 3I31A 1WG4A 2BR0A 2XZTB 1MU2B 2FD2A 1XQIA 1JLEB 2JLEA 4ILRA 2R7VA 1TKTA 2CQ0A 1VQSA 2CUYA 1H72C 1DQ8A 1IXKA 1FRXA 1WF0A 4R25A 1KTVA 1L3UA 1NHUA 3KUGA 1CVJA 4OHWA 3HVTB 1QVGR 2FC8A 1R3NA 4OX6A 4OZ5A 4C97A 1XR6A 4FP9A 4OI0A 3IR6B 3HFZB 4RUCA 5A6PA 2UXBF 3VV2B 1RT4B 3M8SA 4GKKF 1FXDA 1VBZA 1N88A 2DH9A 1JWWA 1UW9A 1Y9OA 4OI4A 4ZN3A 4ED1A 4EK2A 4DR7J 1RADB 2X3DA 3FSYA 2JVOA 4DG1A 1P8GA 2DNRA 4URQU 4HT7A 5E7OB 5KFXA 2IA6A 2R7XA 5DO2A 1U1OA 2OTLS 2DJWA 3J81U 3N6MA 3IC1A 3HHNB 2RF2B 1TVRA 2ZH6A 1TL1B 4JI6F 3KJFB 4XPCA 2AJFE 3CJ8A 4RUBA 3QIDA 1KTQA 1FFSB 3ENAA 5KT6A 3TZZA 1JXVA 3QJJA 1U24A 1YJTA 4F0MA 1RBLA 1S9EA 4PXBA 4Q2MA 3QT5A 5LSRA 2D69A 4RWXA 4CTAB 1BQXA 5A6WA 4ERDA 4ZPDA 4WYWA 2CZVC 2QTWA 1N36F 1SXLA 3RRGA 1RJJA 4B9VA 3MCOA 2F3JA 5KG2A 4ZVFA 3M2UA 3M9OB 3SQOP 4C0OC 4CO3A 3PNIA 2ZNZA 1VBYA 4OI6A 4XDDA 2ZJRQ 5F3ZA 1UP1A 4NEZA 4DQSA 2DNOA 2ZVIA 1N6QA 1H73A 2ZBQA 4K4SA 6FD1A 2CIMA 2E7VA 3TZWA 4H4MA 4MIBA 4NXMJ 2C3PA 2FJVA 1TL7A 2AP6A 4B9MA 3C6UB 2RQMA 4P71A 5AXMA 3EGVA 2XZDB 3HLUA 3M2VA 1RISA 3R5JB 2ZVSA 2XY5A 4ECZA 3RR8A 3DYAB 4TU9A 3ILOA 5KFMA 1WF2A 1J5OB 1P1TA 4OYPA 2J7UA 1JLAB 1VS3A 3MM8B 1VJWA 1APSA 3IP0A 3BSOA 2GVZA 1ZM3A 8ATCB 2V4QA 2RE1A 2MSTA 5C2GA 2WONB 1PYSB 2C3YA 3JTNA 1CQMA 4NX9A 2QGFB 1IWGA 2YKMB 2CA9A 4L76A 3EWGA 3TZXA 4LRBA 4Y65A 4TQRA 5LMNJ 2BVZA 2Z4PA 4ECYA 3C8YA 2M4MA 5A8KB 2E1MC 2OSRA 4ZN1A 5E3AA 4M5JA 3KYLA 4USHA 2O67A 2QT7A 3CMAS 3KLIB 4NMLA 3AA8A 2V5HG 2EFQA 4WP3A 2KHCA 3PYGA 2O1PA 2V8DA 4WFNQ 1OSDA 3VQTA 1YJWS 4EFAC 4U67Q 2QO3A 2UV8G 3PW2A 1KVJA 4H4OA 1S6PA 3QAUA 4CYUA 1H38A 4DU7A 3LP2A 2RU9A 2DGVA 4MKVA 3ZTOA 3OTEA 3G8TA 1RTHA 5JVGQ 3KHGA 3CO0P 4QIGA 4KGXB 2LDIA 2DCLA 3AJDA 3GZ7A 5A8WB 3UD5A 4DUZJ 2WVCA 1VRUA 4ZPAA 4PPZA 4X4UA 1NPKA 4USKA 4UUXA 1KOOA 3HDSA 3M1VA 4DL3A 5CYMA 3MPVA 4K2XA 2BQRA 1R0AB 4DCOB 2NXCA 2QIFA 1WDTA 1D9AA 2VUGA 4C11B 1YBTA 4B3OB 2CQDA 1X7VA 1FI4A 5ETVA 1WG1A 3TYTA 2E1PA 4CLLA 1KVKA 2D74B 3Q2SC 1ZZFA 4CH1A 2GO9A 1NLKL 5HP1B 1N0VC 5GAGU 4BC9A 2XMVA 1JLCA 2P5VA 1ZM2A 4LF5F 1Q95G 5JJBA 1VLYA 3FRZA 1RT3B 2R8GA 1AYEA 4C8YA 1WC6A 3KHRA 3C6TB 2HNZB 1GMWD 3QFWA 1IKYB 2W2QP 5F0WA 3BEGB 4K2JA 3LWMA 4Q44A 1NBEB 3DLLQ 3UFCX 1FDNA 2LMIA 2QMXA 4FYVB 1RTDA 8AT1B 2FJWA 4ATNA 5E3CA 4I7FA 4BWJA 1RU2A 3JAMY 2PFDA 4LSLB 3MFIA 2DRBA 4ZVUB 4YR3A 4NA3A 2PI5A 4ZP6A 3RUBL 3VGUA 2A6OA 1UZHA 1EP4B 4TLQA 3DLKA 5ADZA 4N8NA 2HBRB 2IDEA 2HMIA 4GO7X 3J80U 4DV1F 2IJFA 4L73A 4ANDA 1XJWB 5DQGA 1NK8A 5ETSA 2IRXA 3PHTA 2AMCB 4NLVA 3WQPA 1UPMB 3TVYA 3R1LA 2VG7B 4EBDA 4PCQA 4HACB 1YIJS 3E01B 2NS1B 3RAMA 1BC6A 1BE4A 5F8LA 5J2QB 3CUNA 2QV6A 4IFYA 4PABA 4OZJA 2G1HA 3TUZC 7FD1A 2MQNA 4Y28C 1X5PA 1ZS6A 5HVHA 2DNNA 1PYOB 2HRUA 2R7WA 1RLDA 3HSDA 1YJVA 3Q8PB 1DTQB 3MPYA 3VVTA 4PPDA 2XNQA 4AL5A 1GK8A 3UVJB 1MMDA 2IYGA 4M5KA 4CLWA 3WZ0A 2R9LA 3GE9A 2CPZA 2MLXA 4IO1A 3W8GA 2ZJQQ 1F3FA 2HVZA 3I5BA 3ZC4A 4UZCA 3T9NA 5I3UA 1M1KT 1GT8A 1T9TA 2C3MA 2XCPA 1AT1B 1TKXB 1U0SA 3UN3A 2XMUA 4DV5J 1IM4A 3DOMA 4K4TA 3W7BA 8RUCA 3HJFA 3MOJB 3QO9B 4D3HA 3J7YI 1BWVA 2W9BA 4YY3F 4PRFA 4ZKAA 1QAIA 1HBOA 4K5SA 3DU5A 2V68A 2XHCA 4BHQA 3M2RB 5DJBA 3QPIA 5KG7A 3SV4A 3PR5B 4DV7F 1QSYA 2IY5B 1NJXA 3HI9A 1RUSA 4PWUA 4RW6B 3KJVB 3L7OA 1TAQA 2JFDA 1BD6A 4DPOA 2Z2YB 3WX4A 1YITS 5K8PA 1TUWA 5ETTA 1UEUA 5J2MB 5C2CA 3KLFB 1S77D 2PIIA 4P6QA 3MMAB 3CJRA 2RS2A 3PKYA 4FZVA 4DBQA 2HRYA 4JI2F 3R7BB 2G0JA 2MKYA 3KJNB 1WEZA 2M2BA 1FVSA 4J9LA 1XNRJ 3HKWA 5ETMA 2CQ4A 3CJ2A 3TZYA 1YJNS 3D68A 1CS4A 3MCNA 4EGLA 2WSCC 1KVIA 2Y0BB 1NU4A 3S6EA 4M5IA 5M2RA 3QBCA 4I2QA 1YBAA 2W8KA 1PCAA 4KB7A 1HKAA 1PGZA 3CJKB 2BX6A 4P2FA 2G2YA 1WWHA 2AQ4A 3I9V9 3DKDA 5DM6Q 1KFDA 4U6PA 5KT2A 2LU2A 1JNZB 1J5EJ 4EI2A 4DF4A 5HROA 4ZCIA 3TR5A 4R8UA 1IBKJ 3CVKA 3BGFA 2VB6A 3U27A 1NB7A 5L38A 2XMJA 2FPHX 3P8BB 2LDYA 1CSJA 1JB0C 1WC3A 1N34J 2K1RA 2AW0A 2MPUA 1X9SA 2F8HA 2KVQE 1WF1A 3DU6A 4V1Ak 3AD7C 3PRBA 1B0VA 1S1TA 1FRJA 5LJ5Y 4I67A 3S01A 5L1IA 2KKHA 1KQFB 3CXCR 2KB2A 1VQPS 1JLGA 2W7OA 3V5RA 3IM8A 3W9IA 3BBBA 3EXCX 1KBRA 3D1OA 2IDLA 4RJVA 1VBXA 4OIXA 3PJ9A 2KYXA 3IRXA 4RWWA 1HQ2A 2GIRA 2R2RA 3R7SB 3RBZA 3TVZA 1S6QB 4F3MA 3MPWA 2MJNA 2HFUA 4UQTA 2V9KA 1XMBA 1WKLA 3VGSA 1TQLA 1XK8A 1ZAVA 5EGYA 4F4XA 2L41A 2XLJA 1RWKB 2Z56B 3T5HA 4KKOA 5B0FA 2FYXA 3QYYA 1DARA 4WIQA 1NSAA 1TV6B 3NNAA 1D3WA 4O3NA 3QAEA 3MMBB 4B9SA 2YNIA 1K9MT 3PR4A 4F4AA 2CPEA 1K1SA 3G9CA 2AT1B 4IG3B 2RRBA 1LXNA 2J0SD 3JTPA 3KLHA 1FRHA 1NPRA 1F9HA 4ZHRA 5AE1A 4HI1A 4KO0B 3HFKA 1SQFA 2OLWA 3H4DA 2UUCF 2PT0A 1RAFB 2J5AA 4ICLA 4AXJA 4B9TA 3B78A 2ASLA 1KQSR 4XIUA 3BYPA 2I5JA 3QNWB 2YWEA 3DRRA 1NCLA 5D4LA 4X62J 2I0XA 2RT3A 3QT7A 3MECA 3MD1A 4Y00A 3T1HJ 1S7HA 3R2CJ 4IOBA 3DXBA 3UD4P 1UZDA 1S72S 3PFEA 3KUHA 4RBTA 3DOKA 4TYBA 4LBPA 4I69A 1FT8A 3NS5A 1UTAA 2QA4G 9RUBA 1CJVB 4M63A 4FDFA 2RHSB 4O44A 2CXEA 1V6HA 3CE8A 3TQ1A 5C25B 1HD0A 5B0AA 1U1RA 2OPRB 1Z1ZA 3H42A 3H2LA 2WOMA 4H4KA 2L08A 3OR1B 1S1UA 5BYQA 1HD1A 3BJYA 1Z2ZA 2ZH5A 2AJ2A 5HMYA 3NWRA 1GQEA 3RW6A 3KHLA 3D1QA 4C9DA 1REVA 4X4VA 2M5YA 1IBMF 2BOAA 4YR0A 3OL6A 2W9CB 1OYEA 4DR1J 3P6YC 2YX4A 4ECTA 1WG5A 4TLRA 4K59A 3THPA 3AXKA 3GIIA 3AB4B 2HVHA 2X1BA 5HQ8A 3BKFA 2Q66A 3MMJA 4DV2J 2R8HA 4RX6A 4Q0BB 3B8HA 2F40A 2RQKA 3AOAA 3FSXA 1W2BR 2JSXA 2A10A 1JLQB 5F3TA 2QG9B 2F4FA 3FFIA 3N01A 5KFDA 2EFNA 3CIMA 2J6TA 1SQGA 3I87A 4DSJA 1WD6A 4Z7CA 1S59A 3HK2A 5A8RA 5KTQA 4RW7A 3UCUP 5F41A 4ENOA 3D3BJ 1HNXF 2WVEA 1QTNB 2RUSA 2ASDA 2VBYA 1BXNA 4ZPVR 1MWYA 3L95X 5F9NA 3TAPA 3QGHA 3RTVA 3US5A 1FFGB 1HHTP 4IDKA 3KK1B 2XHWA 3MFHA 5LSLA 1HI0P 2IVMA 4IFVA 2FLNA 1VHIA 2B9WA 3JXOA 1VYAA 1OJ4A 1F9EB 1DBDA 1GMUA 4OI2A 5LT5A 3GV7B 4O0IA 4OX7A 4O0NA 1H2VZ 2WTFA 4TY8A 3CJQA 1VMBA 4WJBA 1PYTA 2Q6CA 5F9LA 1OO0B 5GADI 1UVMA 5HL7Q 4RNNA 1C1BA 2YQ3A 1C0TA 3MEEA 1K8AT 2RB7A 3UWTA 5FLXY 1B3TA 2BA9A 5KFFA 2J6SA 2VHGA 2ZNYA 5D15A 3ZFVA 4GKJF 1R8PA 2BJEA 4E8UA 1FFWB 7AT1B 2DNGA 2ZH4A 1TK5A 1RLCL 1XMQJ 3D2WA 5B09A 4KGMA 3IA0A 3C15B 4OV6A 4RUAA 1RT7A 2WVBA 3DDNA 1X9WA 1MWQA 2ZH2A 1U0HA 3M30A 4I4BA 1UEKA 1RYRA 3UN2A 4N76A 1VRTA 3DCAA 1XBWA 2VD3A 3NS6A 2GJ2A 3CCUS 2ADCA 1CJUB 2R7UA 3DNCA 4P2SA 1RBOB 2W4DA 4ZCMA 3IR5B 2MYFA 3H5YA 3RYLA 3MCMA 3SIPB 2VL1A 1N32J 2CJAA 2NXEA 2V4JB 1WTFA 1X4DA 4WP8A 4WTOB 2OJ3A 4ES3A 2J8AA 5E3PA 1MU2A 1JLEA 4YHHJ 2ZBCA 3BGOP 3LW5C 4UQGA 4DX7A 2IAJB 3SSSA 4LMZA 4ZPBA 3U02A 3TW0A 3NP5A 2HFOA 2A3JA 2W24A 3HVTA 1L3KA 1NK9A 2LQ8A 1TL5A 3HM9A 1RGVA 4PR6A 1FKPB 4C0BA 2ZWPA 1SKSA 5ETPA 2RQ4A 3EPIA 3O5TB 2MTLA 1X4FA 2OMLA 1FHTA 4DPXA 2Q43A 2IJRA 4ER8A 2QLJB 2IM2A 4WIIA 2I1RA 4M5DA 5F8JA 2WVFA 1H6KX 3NG8A 1X4BA 2N4DA 2VQFF 2J9EA 4DSKA 2VU5A 3CSKA 1VQYA 2H1YA 4LSZB 4DQPA 1MN7A 5DG9A 1H2UX 3KG1A 3JSMB 1X4CA 2PE8A 5IFMA 2VPWB 2OPPA 4TNOA 2F4VJ 2VA3A 3TOQA 5K8MA 2KJVA 4A8SA 4USJC 3W2WB 1FA0A 3U7JA 3OUYA 2ERRA 4C8ZA 4X4QA 1R43A 3KKFA 1U1QA 2LU1A 1S6OA 2E5LJ 4Y2AA 4EBCA 2UVWA 3QRPA 3TRGA 2G2OA 4ZPWR 3R5AA 1X9MA 3G6VA 2Q1LA 5F8MA 1SH3A 3BBFA 1TL3B 4IH7A 3MM6B 2VF3A 2AGQA 4RW8B 2DGSA 3UO0A 1LWEB 2EFPA 5EHHA 1NH8A 1TFYA 2V8HA 2CG4A 3N79A 3W5ZA 5J2PB 2PEHA 3M8PB 4G65A 3GCWP 1UA1A 3K2YA 3TO8A 3GIMA 1N56A 2A1BA 1IJFB 2N7CA 3TVKA 3BSNA 1M5SA 3H5XA 2V50A 2R4FA 1H2TZ 4N5SA 4LR9A 3Q8UA 4DPUA 5IQQA 4DV3F 1D9DA 2XG8A 1O5JA 3OJUA 2FY1A 2F63A 1HI1A 1LW0B 2IA0A 5HI7A 2QA2A 3DYAA 1J5OA 4C8KA 2OUGA 1RT2A 1JLAA 1UJ6A 2HGMA 2J0WA 2BUNA 3MM8A 3NAIA 3MEDB 3BR8A 2FZCB 3IBFB 2QX0A 2WONA 1OIAA 4NCGB 2C2ZB 3K5MA 3NBPA 2HHHF 5EN1A 2XMKA 4ZK7M 3DMJB 3ZZRA 2J9DE 3CCQS 1OY8A 5KFGA 2JRSA 1Q5VA 1QSLA 5A8KA 3VALA 5IXUA 3QSIA 1EIYB 5LXYA 2HS3A 2XI2A 2C1EB 3Q89A 4NI2B 5C24A 4F7VA 5DETA 3Q8VA 2QN6B 3W66A 3GFXA 1VIXA 4LIRA 1LK7A 1EZZB 3OXLA 1S4EA 3DRSB 5DM7Q 1ZTWA 3BGRB 4WFZA 3DLEA 5HVGA 2HHTA 1E6YA 2YNFB 4NASA 1MNEA 1TU0B 3C14B 1T0TV 2EWHA 3G8QA 5A8WA 3E3XA 2KO1A 4NRTA 1RA7A 3ET6B 4P2XA 5K8OA 3L09A 4X64F 5KFCA 2FVRA 4CO1A 3VAGA 1F5BA 4CP5A 1SL2A 4Y6IA 5KG0A 3CJ4A 4F26A 3HHKA 1F0XA 4ZP7A 4ED4A 1SUQA 3BSCA 4X4NA 5DGBA 4USUA 2B56A 2LA4A 4LF6F 2BV3A 2ZEJA 1WKJA 4DUTA 2VPZB 4M5GA 3CGIA 1NKEA 3OVSA 5HP1A 3T1YF 2RDDA 2PO4A 2OEJA 1VQNS 4DHVA 1VOMA 1RT3A 3GV5B 2EVZA 1XIQA 2HQ3A 2ACYA 4CIOA 1NPPA 2B6AB 3N5FA 5D0RA 3K17A 3I0SB 3JYTB 3LGNA 3C6TA 2UXCJ 4ELUA 5HVFA 3Q24A 4DLEA 3NMAA 4QWAA 1M0SA 2DPJA 1CC8A 5DS7A 2PN6A 3DGVA 1M5HA 1N0UA 3KJQB 3R97A 2UVVA 3PVXA 4W92B 1XR5A 3GIKA 1YX2A 2W2NP 1EP4A 1UCNA 2K2PA 4OYIA 4RNOA 1U1LA 2RDJA 4NLSA 1S0OA 3I0RA 3MTJA 4O4GB 1YTYA 4HR2A 2BXJA 5K14B 2E1AA 4USWA 3W2VA 3UQSA 5D8HB 1DQ9A 2GQCA 4XAKA 4YFUA 3NXZA 1FEHA 2VFVA 4F0KA 2V63A 2VG7A 4Z2XA 1Y3KA 3ENWA 4JYAJ 4HACA 1YG0A 3OL7A 1HPZB 1ULRA 2UUWA 2CRLA 3E01A 4EZ6A 2ZM6F 4V19X 3RB4A 4K8RA 3W8PA 3M6VA 2OPSA 4DV4F 1FDDA 3TAMA 5LMUF 4H54A 4LVNP 5B0GA 1UVLA 3CPWR 1PAEX 2XULA 2F8MA 4PUOB 3KK2B 1VQ5S 2YKNB 2V8PA 3I56S 4MFBB 4X66J 1AZSA 1Q4RA 1GFWB 3DRPA 1S1VB 5E3RA 2HS0A 3VTIA 1SL1A 4E2FB 1V3ZA 3DDKA 1DTQA 1T02A 2PA3A 4R0JA 4PXDA 3ZXWA 4UOGA 3W61A 3D28A 4QIFA 2IM1A 1XC9A 2EFGA 4DDFA 4J91A 1ZAXA 1OWXA 2ZD1A 4F4WA 1Q7LB 2UU9J 2G0IA 3HZGA 3CD0A 3GTYX 2NCKL 3HSJA 4A48A 1TKXA 2QLBB 2AWZA 2XSJB 1WC1A 4ECVA 1KLMB 1S10A 2GW8A 2YBVA 4ETXA 4XTTA 3Q86A 4QPTA 2ROGA 1VC5A 2KG0A 4JI5J 1U4BA 1V3SA 2VOPA 2XQCA 4P10A 1EJ7L 3M2RA 4IG0B 4LJMA 1N52B 1X4HA 3LQVA 1VQOS 1RB0A 1NDKA 2L3MA 4M5NA 1U1NA 1RT6A 4RBVA 4AQYF 2DKOB 3A8IA 2LYVA 5EWEA 4RW6A 2R2TA 2GQ2A 3NEKA 5I3PA 2OPQB 2KFNA 1BLUA 3UCZP 3CCSS 3OTOF 4ZVEA 4DV0J 4WZQA 5J2MA 5KG3A 4P75A 3KLFA 4JI1J 3MMAA 2HQGA 3V6DA 3L3CA 1P27B 3T1AA 1NDCA 4IH6A 1EHWA 2PDAA 3D9BA 1TK0A 1RTJB 1DFDA 4URSA 1C0UB 3EDRB 5HLFA 2DO4A 2HHXA 3CW2C 2DGUA 2R7TA 3LUYA 3R7NB 4B3SJ 4JI4J 2Q6BA 2LXUA 2VASA 4K0KJ 2UUAJ 1P6TA 4FF2A 3CC2S 1VBKA 2RUGA 4H4KC 4PYAA 5H9EK 3CJKA 1MROB 3NLCA 3KK3B 1NK4A 3M32B 4A4JA 3O44A 4HI2A 1R8CA 4NYPA 4Q5VA 4K4VA 4FBTA 5D4OA 2QL7B 1WKKA 1N33F 2QLXA 3GONA 3ZTSA 2IYIA 3GMGA 4NE9C 2LKZA 3UR3C 4UF4A 5KT4A 4CLSA 3T9ZA 3AA9A 3EX7B 4CO0A 2LEPA 1FTRA 4OX9F 1CULB 1FWPA 5CHCB 1RAOA 3CD7A 5B08A 2EEYA 3PYFA 2GHPA 2QA1A 5DDQC 3IGVA 3H0PA 2YWHA 3N6LA 5GMEA 3SCJE 1Y0HA 3EZ5A 3G96A 1I5OB 3SDEB 5CA5A 1YJ7A 3TP2A 1RAHB 2C3OA 1QVFR 2JNJA 1QSSA 3KWMA 3BQ0A 3V4IB 4RLEA 1GEHA 5HQLA 2EKNA 4ED2A 4NXNJ 2H4YB 2ATLA 2FLLA 3BPSP 1NUEA 1D8YA 4Q2LA 5BJRA 2RKIA 2HWTA 5L1JA 1MG7A 1TKZB 3AY0A 1S1XB 2ZDPA 2RRNA 3EVOA 3BGLA 2K7KA 2ALZA 5CYQB 5D0GA 4ZOSA 3MF5A 2BANB 3DOLB 1IKXB 2A2DA 1JLBA 4I6WA 1NZAA 2Y1LB 1UETA 1KS2A 1U8WA 5DLFA 1IBLJ 5E2QA 1S76D 4QYZJ 1TV6A 2V69A 4Y3CA 2RQCA 2BW7A 2F7VA 1SC3B 3MMBA 1HHSA 2VBWA 3MCSA 5C42B 4HEA9 1ROFA 4PQAA 4RL1A 1BQNB 4PXEA 5J2NA 3PO5A 5HAOA 3RB0A 2BQ3A 2MQOA 4P74A 2DNLA 4DL7A 3ZZ0A 5EWFA 2WK4A 1R8AA 2LVWA 3ENVA 3OXFA 3PV8A 1C1CA 2YTCA 3NOCA 1SL0A 5F0UA 2QL9B 4M5MA 1YI2S 1Y4ZB 2M70A 3KTQA 2NQPA 3NNCA 1I94J 3NGTA 3CJTA 3H5UA 2HAIA 4J9SA 3RBXA 1RWXB 2KM8B 1RHQB 1VJQA 5IT0A 4C6AA 2NXUA 2QYCA 2XY7A 1HQUA 2AX1A 4NA2A 1YZ7A 5HO4A 4DR6J 2MY8A 3MDFA 2DR8A 1G3OA 2JC1A 3EVWA 2DNPA 2ZC4A 5H9FK 3W63A 2BJ1A 1CJVA 3LP1B 4L75A 4MIWA 1KHVA 3UN5A 1OPIA 1HI8A 1RTZA 1LFWA 2BBEA 1BQMB 2CDQA 3FEXB 5C25A 2DD8S 5ETLA 1OSCA 4Y2MA 2PSZA 4DZ6A 3KDOA 4RW9B 3IBCB 4NLWA 3VVUA 4ILMA 1Q0NA 3GG1A 1HBUB 4NXMF 2ZBPA 1SKWA 4KGVB 2LEBA 1U47A 3MPDA 4L74A 2PGCA 3RG6A 3IM9A 3VGVA 2WZ1A 4KHPJ 1T9YA 4YB1P 2MZRA 4J9PA 4I2PB 1HWUA 3TA0A 2W9CA 1LK5A 1U2CA 1LW2B 1NSPA 3MAAB 3RRHA 2JL9A 1P9QC 1XMOJ 1LNQA 2AF6A 2ZKTA 3VCDA 2F65A 3BQ1A 2CWKA 2HWHA 2ZZTA 2C2NA 2BJ7A 2J7KA 3NGSA 2DGWA 3DLJA 4PG4A 2CPHA 2WAQD 4NZ7A 1QY7A 3K5PA 4YS2A 3B4MA 3M9MB 2ABYA 2IMWP 4MIAA 3M8YA 1B7FA 1JLQA 5L9XA 2VA2A 3MEGA 3BS9A 4PG5A 2JZ5A 3WHIA 3LWLA 5LMNF 2G1DA 4UOFA 3H98A 2YNGB 1G1XA 2J9CA 3GYGA 1RAEB 4N47A 2CJBA 1UA0A 3HHLD 2QYGA 2L9WA 5KFSA 1NO8A 5DG7A 1ZTTA 4LF9J 2BYCA 1RT1B 5FDLA 2MXYA 1F1BB 3MM9A 4TQSA 3QFHA 1IKWB 4AFFA 5D4NA 4A8MP 1UEVA 3J7ZT 5HJYA 3SCIE 3S7RA 1M5VC 4HVZA 2Y0SD 3QZ8A 3G8SA 2KVIA 2MKCA 1R0BG 2SXLA 2HLUA 4USTA 1JJ4A 4DUZF 4RKUC 1U1PA 1V5VA 4WE1A 1GXLA 2X1AA 1VISA 4LSNA 3HVWA 2XO6A 4YEAA 1ZBTA 5CCMA 2C2OB 5CCLA 4JBCA 2CPFA 3GYXB 3SQGB 3HPOA 4FXDA 1QAXA 3CMES 2FZKB 2BKPA 2JHEA 4FKYA 4CH7A 4HYKA 1CQNA 1ELOA 4YDDB 3PW5A 4F4ZA 1WOSA 2ZH3A 2UUBJ 2MLZA 2DR9A 3RU0A 5M2PA 4ECSA 3OD2A 2O5DA 1UVIA 3VAHA 1I6JA 3C15A 2QL5B 2XZWA 4QIWD 3O6QA 2IM0A 4AYBD 2F1FA 3N0VA 4WFYA 2BRLA 2QMWA 2CPDA 1YRTA 1S0MA 3TX0A 3QWPA 3H20A 5G0RA 3OV7A 1XR7A 1CJUA 4AQYJ 2YWGA 4N56A 4KTQA 1W25A 3TEHB 2PFFB 3GSIA 4FYWB 3HD2A 1QUPA 2V4JA 4DCJB 3G6ES 4ECUA 2EI5A 4R5PB 1WOOA 5KFNA 4GO5X 3VAMA 4X4SA 2BABA 3O1LA 4U96A 4U7UD 4EEYA 2IAJA 4W90B 4JV2A 4XO0A 1TVRB 3H90A 4FVCA 2FVCA 4FXWA 4WU3A 5KFQA 3MR3A 3K57A 3M8QA 4OZ3A 5KFIA 4UW2A 2DRAA 4CO5A 1S9EB 3M4XA 2A6MA 4F25A 2RJZA 5KFOA 4DX5A 1FWLA 2BE7D 2Y9HA 3GQCA 5JUMA 2CVEA 3PFOA 5RUBA 2KH9A 2ZUGA 4ED3A 1TUVA 2BQUA 2CQHA 1KDNA 2HBQB 4DV6J 4DSIA 4F67A 2NXJA 4ID8A 3E51A 4X65J 5HANA 4IR1A 2L48A 3P96A 4HL9A 4PG8A 1XERA 2HFNA 3SFUA 4GVBA 3U1MA 4I1TA 4DF8A 3JSMA 4EO8A 2ZH1A 1JJHA 2FHJD 2CPJA 2GFFA 2YWKA 3GU0A 3CCWA 1LWXA 4WK3A 3QATA 4ZJOA 3BBCA 1T94A 4LFCJ 1UWAA 2GS8A 1X0PA 5KOWA 1U8SA 1BMQB 2YX1A 4DV5F 3AAWB 1X0FA 3W2WA 2BJDA 2CPXA 1ZH5A 5IT9U 3T3FA 2BZ2A 2FIUA 4NLRA 4B3TJ 4ECQA 1LWCA 1D09B 5AXLA 2Y1RI 2FGCA 2VBZA 2YKOA 1C2PA 3G6YA 4G3IA 3PX6A 2ZH7A 2V34A 4DS4A 2QFJA 1DHMA 2HVEA 1Q53A 1RI7A 2C2EA 4C3KA 4Y0FA 2KL8A 2YKQA 1DZ5A 3BO4A 1LWEA 5AE2A 4QZVB 5T14A 1FRLA 2P8IA 2W01A 3LGHA 4UTGA 3NKYA 3M8PA 4G1QA 4CLZA 3I32A 4YMEA 3ZZYA 5KFJA 1GXUA 2OP5A 3RB3A 1M1GA 1SPBP 2BJ8A 4ZA1A 3D1HA 5GADU 4ZVQB 4B08A 2YQ0A 2FVPA 1VQ6S 1XNRF 1DLOA 3OSPA 1GH8A 4YUDA 2XMAA 2CAJA 3V2UC 4C3MA 1TK8A 2Z0GA 2NR0A 4KC5A 5ETKA 1HFEL 2XWYA 1ZA2B 4DX6A 1LW0A 1T3OA 3V6JA 4LREA 7FDRA 4HTJA 1DJ0A 2AJ1A 1JK9B 2ZBIA 3IRWP 1U2RA 3Q2TC 4ZP9A 4X4TA 5KFUA 3MEDA 3PJXA 5M2UA 2HQDA 1S6PB 4MK7A 2BE2B 2HGLA 3NY0A 3EJMA 2B7BB 2R8KA 4ZPCA 4DN9A 5I42B 4B9LA 3MUMP 1X5TA 2B5JA 1VRUB 1VFJA 1NXIA 1FRKA 2W9AA 2HIQA 1RHUB 2QLFB 2CPIA 3DMJA 4J5OA 3CD5A 2CJKA 2YNHB 1J5EF 5CQGA 1RYSA 3M1VB 1T9UA 2KFZA 3CJ3A 3QLHB 4TXSA 1IBKF 3AFGA 5E33A 3B54A 1EAYC 4FPRA 2RHQB 2I8EA 4NI2A 3D67A 4YB7A 4PKDB 4DSEA 4RZRA 3OHAA 4DJBA 1N34F 2XC9A 2GCFA 3FCWA 1FJGJ 3DRSA 4MT1A 4EYHB 4PQUB 4ED6A 1JLCB 2H54B 2MZTA 3BGRA 2UXDJ 2B8PA 1W7WA 3GFZA 3DM2A 3W3SA 2YNFA 4IRDA 3WIVA 3C14A 3G87A 2CJXB 4K50A 3FSIA 1B99A 3G82B 4Y34A 4WBFA 3I82A 2XBPA 1GMVA 2NSBA 4QWDA 2OMOA 4I0WA 2R8IA 2J8SA 2AEJA 2QJ3A 3LOUA 2Z8QA 2IHR1 4J7CA 1PBAA 4X84A 3NRBA 3A12A 3D0IE 3W60A 2VJUA 2G9OA 5D4PA 3OFFA 3DLKB 4GVLA 1NDLA 2VC0A 2HS4A 1U2FA 2HMIB 3R2DJ 3BKUA 3EGZA 4IYQA 5AE3A 1JIHA 3QGIA 1S9GA 1RDRA 1RTIA 2V9WA 3FRYA 1V9OA 3QZ7A 4U9RA 4JV5J 3MM7A 3OBIA 4HHJA 4QJVA 2IC3A 2U2FA 3I0SA 5EX0A 4ZVRB 1LQ9A 3SSQA 2AEMA 1TELA 3HHEA 4ZVOB 4DUYJ 1R6YA 2R7OA 2YPYA 2W2PP 1ICEB 4NYOA 1WJ9A 2VONA 5E5NA 2B4UA 3K8VA 2HFVA 2CWXA 1BUXA 4AD6A 4LFAJ 2G0CA 1N5YB 4JI7F 4QQBA 4X62F 1WOPA 4ALZA 1PO6A 2CYYA 4NLPA 4ED0A 4J9MA 3CWJA 1LFPA 1GXTA 4WFAQ 3T1HF 2CNLB 4NLXA 4IH5A 3G2XA 5K14A 2DHXA 4Y2KA 4DSLA 3LAKA 3OL8A 3QJPA 3Q0AA 3HX9A 3N6NA 3M8ZA 3SCKE 4IQMA 3BN7A 4PEOA 2CQBA 2HVDA 1GAOA 2GHVC 3TJAA 5I3UB 2YH0A 1HPZA 3OPKA 5IT9Y 4IRKA 3FBFA 1GMWA 2CG8A 3DGPB 4E0DA 5J1PA 3DOMB 4CLPA 2OI2A 2GV1A 1F60B 2EFVA 2RU3A 2APOA 1EQMA 1LXJA 2FHOB 4JV0A 4PUOA 3KK2A 2K8GA 1F2HA 5K5MA 4MFBA 2GQQA 1SH2A 1HBOB 3S8SA 4ELTA 1PC4A 1M1HA 1RCXB 3BH6B 1DURA 3IAS9 2WB4A 3CT9A 4DR1F 1MWZA 1IWAA 1VRQC 2ILZA 3CJ5A 4N41A 5KFEA 1H98A 4WKRA 2X7IA 2OD6A 2WRMA 1WSRA 4OYMA 1SJQA 1SC6A 3DRYA 5EUHA 2AX0A 3GCXP 3B4DA 4DV2F 4ZCLA 2DNHA 4FYXB 4UT4A 4E98A 4PG6A 3GIJA 3D66A 4EU0A 1SVDA 4NPOA 5IQ6A 1RAAB 2HGNA 2VV5A 1H0HB 1HR0J 1KD1T 5JXSA 4LRCA 4CO2A 1U26A 3HHDA 4AUKA 4PZVA 3J81Y 1KLMA 2VFTA 2Z2ZA 4HH1A 1UWBB 1CS4B 3DHWC 2R7SA 2LEAA 1SBRA 3FEYB 4I2QB 1NKCA 1UFKA 4EWTA 2E29A 4IG0A 4LT6A 2XLIA 1NSKL 3NWGA 3KG4A 2M8HA 4M95A 4OHZA 4DFJA 1WEXA 3G6XA 4YB5A 1H7WA 4OHVA 1ACMB 2YKAA 4G6VB 4MH8A 1N4LA 5HROB 5HMZA 2JFKA 4DZDA 2AGPA 4R8UB 3PEJA 3I5AA 3BV8A 5ETOA 3M9NB 1WHVA 1C0UA 3GJRB 2BOPA 2KXHA 1QAYA 3OLBA 2XMTA 2KN4A 1Q5YA 2HFZA 3PZPA 1OQ6A 3PG9A 1Q78A 4FF3A 2ZHOA 1S1TB 4YQWA 1MROA 2VPXB 1N5SA 2JEIA 1IR0A 3CDWA 3M32A 4LRFA 2CPYA 1JLGB 2DNZA 2BKNA 3IG1A 5KT3A 1OQ3A 3FKBA 3QQCD 1XMQF 3ENQA 2KRBA 3GG0A 4B3RJ 4DR3J 3F44A 1CULA 2PMZD 2BMBA 4DL6A 1HNWF 3DI6B 5D3GB 4O3RA 4DR4J 3CDBA 4ZPTR 2VIHA 2GMLA 2OEMA 1HNIB 4LQ3A 5U47A 2N3LA 3FBCA 2M3DA 2BRKA 3W5YA 1N32F 2EPIA 3CEDA 4K4UA 3V6HA 3KDNA 2KDOA 4C0HA 3AD9C 1KLNA 1IBCB 2YNIB 4NLUA 4CNZA 1HNZJ 4NWBA 5A2QU 1I51B 3FZBA 1WC0A 3PCOB 3JSBA 5IWAJ 2VQEJ 4YHHF 1T11A 1FESA 4C8LA 4ZHRB 2ILYA 1NK6A 1U25A 2AYMA 4I56A 1S1XA 3H40A 1W26A 4K4WA 3O8WA 4CT9A 5F8GA 2BACA 5KFHA 4LF2A 4UY85 3L9ZA 1HQEB 3OR2A 2BANA 2I5JB 1Y00A 3X1LB 3DRRB 1IKXA 2PC6A 3R9LA 1WELA 2HBYB 3D6FB 1D0EA 1QD1A 3M7VA 3VAFA 3PW4A 1HBMB 2A0FB 2OD4A 3BSAA 5C42A 2Z2MA 2DEJA 1BQNA 2FB0A 2MJUA 3TI0A 1Q81T 3SXLA 4DR2J 3IFEA 1FDBA 5L46A 1V5IB 3PYEA 4KV8A 4G1PA 2A2CA 3BZQA 5THWA 1F2GA 4LF8J 1NZ8A 4F2RA 1BGXT 4IR9A 1S1UB 4O3PA 2XMMA 3AJ1A 2F4VF 4FS1A 2W4PA 3GP9A 5BR8J 1REVB 2D1CA 1XNQJ 1S99A 3SEOA 1VQKS 3GFHA 1ZPWX 2GO8A 5K20B 2AD9A 2MZQA 2E5LF 4O23A 3FQLA 3GPAA 3IS9B 4CT8A 3P5TL 1JX4A 1SIWB 3GR0A 1QJHA 3H59A 3UPFA 2EBGA 2MSSA 3LP1A 4M8LA 3K89A 1BQMA 4O3QA 4OX8A 3J80Y 1Y5LB 1FERA 3EICA 2CJ9A 3Q83A 1YBUA 2BM0A 4K7QA 3LGMA 4OQJA 4OYXA 2CVIA 3FFIB 2UVUA 3C3LA 5HBMB 1YKWA 1L5UA 1UFLA 2Q3PA 1S1WB 2C2KB 1HBUA 1EKSA 2MGZB 3QGGA 4BCAA 1CJTB 2KFYA 1AA1B 5KFBA 1HYSB 2PA8D 4RW7B 2E5JA 3IXQA 3K5NA 4WU2A 4I2PA 1SH0A 3THTA 3OTBA 3MAAA 2IJNA 1WACA 3EPGA 3PDNA 3D0HE 5CD4H 4ES2A 1XEZA 1ZM9A 2XTJP 3JSRA 1TFWA 2W2MP 1REGX 1Q79A 2P9CA 4ZS6A 4NA1A 1T9VA 3A3NB 4A8FA 4JI7J 3R5GA 1U02A 3ULHA 2KXNB 4LR7A 3M6UA 2RDIA 5SUHA 4LR8A 3DN9A 4F3QA 5T7LB 2F8EX 2O3DA 4L3NA 2EFOA 2N82B 2YNGA 1A0OB 2B4OA 1T03B 3AD8C 2GVDA 2DY9A 2RNEA 3SV3A 3J81j 1C1BB 3E2EA 1C0TB 1C4AA 2DR6A 3HF5A 2VODA 2OFGX 1SC4B 3PHEA 1C4CA 1RSCA 2DNMA 2DRDA 2KT2A 2NXNA 1RT1A 4OLPA 2Y3YA 2QA4S 5KT7A 2YKPA 2PD1A 4Q8FA 3HO1A 1IKWA 3T6JA 4X4PA 2BJ3A 4CH0S 4TYAA 2UV8A 4LF7J 3UNYA 1VRTB 2W7AA 3C16B 1KC8T 2AIRB 1RZMA 2MDAA 4PYDA 2XCAA 3CCES 3WDOA 3D54A 2DVIA 2R3VA 3SBMA 3SMZA 5H1SV 4K5RA 1TMJA 4WPAA 5D0HA 2LCWA 5CAAA 1K73T 1YWXA 3ISND 5A2QY 1ZPVA 1HL6A 3SQGA 5E41A 2DISA 1OY6A 5J1NA 4NCBA 3HHLB 1FXLA 1A9NB 2LECA 4ZJQA 1QUVA 4ZVGA 3HT3A 1NJYA 3LALA 3PXGa 2E66A 4NYZA 3CJ0A 2MB0B 4MKAA 3KLGB 2Z30B 3B82A 1H7XA 3ZNUA 3D5MA 1QAJA 4NLOA 3TUIC 3FMWA 2UXCF 1FX4A 3MOZA 2X1GA 4LRAA 3WIUA 1X8DA 2WCXA 1NHKL 2E9TA 1J27A 4RPFA 1KQGB 3PW7A 4IQXA 2ZKUA 5K8NA 4U8VA 4M5DB 4MAKA 1S9FA 5ETQA 2MQMA 3PRDA 3VZIA 3QSYB 1ZA1B 3BREA 3W65A 4R5PA 1F3VA 3FBEA 1NKBA 4P7VA 3JAMU 2FJAB 1M5OC 2D41A 3KLEB 2FHMA 3SCLE 3BQ2A 1FJEB 4Q45A 4HDHA 3T5LA 5F8IA 1IVZA 4HHUA 4JYAF 1FNMA 1RHJB 4FYYB 2OPPB 4LQ9A 5EX3A 1NHVA 1N5QA 1JXLA 3AQOA 1NK0A 2CDRB 1NB2A 3OUYB 2V2KA 3K59A 1T05A 2CQIA 2CNNB 5AJ3J 4ID5B 2QRRA 4F8RA 4X66F 1S4FA 5GAEI 4FVMA 3WC2A 1SI9A 3CCRS 2EXUA 2XYGB 3NCQA 3IAM9 3CCZA 4YB6A 1HNWJ 4GC7A 1SQEA 2C28A 2H5IB 4A47A 3RZAA 2GGPB 1EKRA 2EG1A 3AOCA 2M0GB 4C48A 2UU9F 4LBHA 3I55S 3OVBA 1CC7A 2YQ1A 1EQ0A 1BY9A 4MMOA 4L6V3 1BWEA 4G1IA 3C46A 4ECXA 4JI3J 3UDLA 3ADAC 1WC5A 2MQLA 3BO3A 2EK1A 2HQIA 4WTYA 3B6BA 5GAHI 4JI5F 4DL5A 1RT2B 4CLKA 3HVAA 4B3MJ 2D3OR 4BS2A 2XSFA 2NUUG 1HMVB 2HEKA 2GMJA 4LFBJ 3SI8A 4MYTA 4WWSA 2VKRA 3TQEA 2KXFA 2XO7A 4KJIA 1LWFB 1RT4A 3QT6A 3HP6A 4DV0F 3JQMA 2FLOA 3NBPB 4ITSA 4JI1F 2VICA 1FDAA 3G71S 2AU0A 1M5KC 1WDDA 2KRRA 1A6LA 4Y2IA 3RBDA 5HMWA 2W25A 5C24B 3GIRA 2HZCA 4WF9Q 4TVAB 4KGKA 1WORA 2VFUA 3I6PA 3GLJA 1PSDA 4B3SF 4JI4F 2D3O1 1S0NA 3QRRA 4K0KF 4KFBB 2UUAF 3D6TB 5DRKA 2FVSA 2RF2A 4KYZA 4KPCA 1DAXA 1TL1A 2ZZMA 1RWVB 1MLAA 5HMXA 2HZAA 3DLEB 4DPTA 2BE2A 1E6YB 2AJQA 4U8YA 3OSNA 3CCVS 5I42A 1KNZA 4J9OA 2DH8A 2OEKA 5L8RC 1K44A 2DH7A 3Q23A 2E5IA 4OZ1A 3BDPA 2ROEA 4CTAA 2YNHA 3CIZA 2E5HA 2HNDB 3MXHP 4AE5A 3FBBA 1KHWA 3QLHA 1YDLA 4MKBA 3MR2A 2BDPA 2UP1A 1SUQB 2ZHBA 4ED5A 1RT5B 3W5XA 1G2EA 4KRWA 1ZOTA 2EC0A 3AHPA 4B17A 2J6UA 1UW4A 2HHWA 3CNQP 4PQUA 4JI0J 4O3OA 4KIAA 2MKKA 3Q8RB 2AYGA 5IV3A 4NXNF 4OFZA 5CZXA 4I68A 2XS5A 3C6UA 4DFMA 1NSQA 3G82A 5GVQA 3FNNA 5T41A 2GA7A 3I4HX 4GRSA 3AJ2A 3HFVA 2HIYA 1JKHB 2GIFA 4A46A 1JJ2R 4DQQA 5J1EB 1M90T 2ZDOA 2IFXA 4BDPA 5GMDA 1PJ7A 1VK3A 4LF1A 1Q86T 5KG5A 1IM6A 1YHQS 4FKXA 3I0RB 1UJ4A 2BM1A 1KR4A 4AT1B 5CABA 3HJVA 1IBLF 3W2VB 2YKMA 2XWXA 3BF4A 1Q8BA 3RAXA 2DO0A 1Q7YT 1Y10A 1R7IA 2VH7A 3A1YG 3CJSA 2NREA 4IRCA 3RRKA 2N4CA 2B7CB 4K4YA 2Y8WA 5KG6A 5AXNA 4NRUA 3G4SS 3HT0A 3KLIA 3A13A 1FXRA 4ILLA 4QIEA 1JMTA 2OPSB 1FK9B 3TAMB 4JI8J 2GAHC 2XYPB 2Q79A 4LBIA 4URGA 2IMOA 4RBUA 3BB5A 1AZSB 1I94F 3PACA 3DRPB 1JNRB 2B0GA 3R5BA 1N5YA 2KT3A 3MGJA 2IBKA 3LTOA 4ZCKA 2MY7A 1U1MA 4J9VA 2GJIA 1VLOA 3LH2S 2NLWA 3IWXA 3LP0B 1R8BA 1HBNB 1UPPA 2OAUA 3J7AN 2B51A 4DR6F 2IPOB 2VG6B 3IR7B 2D7SA 1VC0A 2ZD1B 2JLGA 4OZ2A 4QR0A 4BWMA 1S12A 1R0AA 1T9XA 5DQIA 2B9XA 4DR5J 3LF0A 4ZVHA 4F4YA 4A8KA 4IOCQ 3DGPA 4K4ZA 3EM1A 1F5AA 4C11A 4B3OA 4KPYA 9ATCB 3IN5A 2DPIA 2L9DA 1SJ4P 3CMQA 4NMXA 3V4MA 1S6UA 5F8HA 2D9OA 3P49B 3PO4A 3L7PA 4U7CA 4F4KA 3U1NA 2AJ0A 2K3KA 5D78A 2CQ1A 2DT9A 3AB2B 1YSJA 1RT6B 4KHPF 5A0YB 1IKVB 1PIEA 2HNZA 5DDOC 2XS7A 4OHXA 1IKYA 2GNKA 4FYDA 3TNVA 1B4SA 2UXBJ 1XMOF 1ZETA 2O66A 4DCPB 4PWDB 4GKKJ 4DQRA 3A3PB 4UY8T 3V6DB 3D3CJ 4GC6A 2K3IA 4B02A 4LSLA 2LQ9A 2WSFC 1FEEA 2AZ1A 3A3OB 4QR1A 5HLFB 5A76A 1UWBA 4HH0A 1PC5A 3TA1A 2W7PA 5EDWA 3H2VE 2CZ4A 5LM7E 3BN4A 2FDNA 1A7GE 2FLPA 4J9UE 4CNYA 4JI6J 3VQSA 3MAQA 1RU1A 3BGUA 2DEIA 1N5VA 3CCMS 4DFPA 3MAHA 2DIUA 1RBAA 2DHGA 4LF9F 4QW9A 1RACB 2KM8C 2M9KA 5J2QA 2WVDA 1UJ5A 1URNA 1DTTB 4NLYA 4FXVA 1FKAF 1NRKA 1SB6A 2KYZA 1RWOB 3D0GE 4P52A 3HD1A 1SC1B 3PEHA 1N36J 1N5TA 5I3QA 2YX7A 2QE5A 3OFHA 3ZTQA 3GJQB 2R7QA 5DDRC 4L72B 3F73A 3UVJA 2H48B 2RIJA 3UR0A 5IT4A 1KN6A 1VQ7S 1ZAWA 4D3GA 1Q16B 3SZ2A 2NYIA 3R3TA 1FKOB 4PXCA 4ZDNA 3ITHB 4QWEA 2YXLA 3AODA 4ED8A 3V81B 1KP6A 3ZTPA 3EVMA 5FLXU 1D8ZA 3K0JA 2UUBF 3KMSA 2RKIB 2GX8A 2CJYB 3OW2R 3ZZOA 4QCLA 3VWSA 3QO9A 5KFZA 3P3DA 1FE4A 2LLZA 5I4MA 2HW3A 4AL6A 2NUHA 3TANA 2PMHA 5BXIA 3ONQA 3DI6A 1QE1B 1I3OB 4RUHA 5D3GA 2DY1A 3PIPQ 3PW0A 1MW7A 1E6VB 1JLBB 2XNRA 3QIPB 4N8OA 1EARA 1HNIA 4P9SA 2E44A 4QOTA 3KJVA 2IM3A 2MQ8A 1MMNA 1FWKA 4OI3A 3FK4A 4MKYA 2R7RA 2J7WA 1AFIA 2OFHX 5E0OA 5LJ3Y 1DQAA 2KTQA 2LFVA 1LKZA 3RBEA 4BLGA 1RWPB 1BHNA 5J2NB 1KONA 1IR1A 2MZSA 3OLAA 2QMUB 2I2YA 1HW9A 3H2UB 3JS9A 5CD4A 1U09A 3FMBA 1RWWB 3GYNA 1C1CB 4O4RA 2VG5B 2XY6A 1HQEA 1PG5B 3ISNC 4F36A 2AZ3A 5CZVA 3IWLA 3VGTA 1CBKA 2O01C 3M8RA 1W2IA 2GHWA 1VQ9S 4ZP8A 1G4CA 1HHQA 1HARA 4FN5A 1HQUB 4RU9A 2JH3A 1NH7A 5CYJA 2B4PA 4AXIA 2E9ZA 1NJIT 1HBMA 4NCAA 2HNYB 4DV6F 1Z4UA 2W1BA 4DPWA 1VQ4S 2LQJA 2AYBA 1Y11A 4X65F 3BKTA 4Q43A 2QSWA 4FNHA 2JX2A 3MD3A 3RJMB 5C5JA 2QLWA 2R42A 2RRAA 1PILA 2V8GA 3F41A 2VC1A 3VAKA 4OYBA 3NCPA 4CLYA 3BDEA 1AROP 1R0CB 5B0EA 3NGUA 3S1TA 3KNAA 4V19J 3OHBA 2BJ9A 3U1LA 4LF4F 2YWWA 4M1KA 3N4WA 2HURA 4WZMA 4LFCF 4LF5J 2HHUA 4IKAA 5E3QA 2D3UA 4B9NA 3QMQA 1VQ8S 4KT0C 1L3SA 2CFXA 3N28A 2OELA 2C2RA 2Z2LA 2COLA 2M52A 4B3TF 1RAGB 2GIQA 4ANEA 1P9YA 3G86A 5KFLA 4XPEA 3IS9A 2KZZA 4OZNA 2OO4A 4ZLJA 2QEXS 1SKRA 2DTJA 3NL0A 4O3SA 5KOXA 3BM7A 2ZE2B 1YZ6A 1O6XA 4KHRA 3POTB 1S6QA 3KG0A 1T3NA 2VOOA 5KFAA 1H3DA 3JTOA 3F56A 3DC2A 1B70B 2JWNA 2RVJA 4EMDA 1YRXA 3MEGB 2JVRA 5IOLA 2V2VA 2V6AA 3DLGB 1SV5B 4U7UK 5HBMA 2CNOB 3GR1A 4DV1J 1VI7A 3Q8QB 2ASYA 1S1WA 4KH0B 3FUYA 2MGZA 5MLCV 2L9NA 1U45A 1CJTA 4EBEA 5D6GA 5AXKA 1Z2LA 1IQTA 1HYSA 2GJFA 1YLXA 2VZ9A 1YK9A 2C2DA 4WXWA 4IG3A 1X4EA 2ALYB 2CJQA 1HNVB 3D4JA 5FDLB 3FEZA 3MM9B 1O8BA 3T5KA 3T19A 1RABB 3D6MB 4QYRA 2QC3A 4KO0A 1UVNA 3PX4A 3EGWB 2KI2A 3CB4A 1HLWA 2QZ8A 2DNQA 4PAAA 4KR0B 5HQMA 2HPUA 5FJ4A 2DHHA 2J0QD 1PJ5A 3HSGA 3OXGA 3QJLA 3MM5B 4WE1B 1X5SA 2H5EA 5T7LA 2DB1A 4LSNB 4EZ9A 4I64A 2ROPA 1U6BA 4RNHA 2DIVA 3L7UA 3MUVP 1T03A 1QLNA 2N3OA 4UUWA 4Z7YA 4DLGA 3MMCB 2RMLA 3J7A1 4CLTA 2CQGA 1EETB 3EZUA 2OSQA 1SJFA 5AT1B 3VHQA 3MUTP 2LXIA 3UI3A 5B7WA 4RU2A 5FD1A 4OI1A 1FJGF 4C8OA 3MI7X 1RXOB 1FJ7A 3PIOQ 2OPRA 3FJ2A 4WYLA 5BYSA 3GV8B 1JLFB 1S0VA 2UXDF 4UZBA 4OJHA 3I5CA 3A8KA 3OR1A 4IO9Q 4YY3J 4ELVA 2W8LA 3OL9A 4FBUA 1B7YB 2RILA 1FF2A 3BH7B 3C16A 1WC4A 1CJKB 4YN3B 5G0RB 4S0MA 2V2QA 3CTRA 4DV7J 4L3KA 3ZZTA 3OQ2A 4M5LA 5B0DA 3DDIA 2FGOA 1HWIA 1GTHA 4B9UA 3EMTA 3CCLS 4A8OA 2BEFA 3HHLA 4Q0BA 3JQJA 2WW8A 4JI2J 1K47A 4QPXA 2D3ZA 3H8YA 5D77A 1F6TA 1FNOA 3AQPA 2P2CB 4QU6A 5DZ7A 1VQLS 1YJRA 5L39A 4P2MA 3KLGA 4FPIA 4JV5F 5DG8A 1PAUB 4NLDA 5IM0B 2NZ4A 3EUNA 4CLFA 2Y8YA 3M8QB 1FD8A 2GC8A 1KQKA 4OZLA 4J90A 3NS7B 4DUYF 2DITA 3CC4S 3OJSA 4OJ3A 4UOHA 5C7PA 2HK2A 5KFTA 2C42A 2ZC3A 1WUUA 4KQZA 4J9NA 3KK1A 5IC4B 1X31C 1HWJA 3QWUA 2WHOA 4RR5A 2HYIB 4LFAF 1Q8IA 3MWBA 1FCAA 2MMYA 3DLHA 2X1FA 2WBRA 2V4RA 4RW4B 4CM2A 2MKJA 1YGYA 3WBZA 3ETMA 3LANA 2HLTA 4X2BA 1YRUA 3SSRA 4QYZK 2FJEB 4GVBB 3KLEA 3V6KA 3LPYA 1IJEB 1N8RT 3MHYA 5KG4A 2P9EA 2W4CA 6AT1B 4ECWA 3J7Z5 2H51B 3CO9A 2FJDB 2ZH8A 3UE2A 1HWLA 3DRXA 3T5JA 5JVHQ 4NLQA 1FD2A 4A8XA 2FTRA 2PEBA 5KT5A 2OGUA 4MYUA 2IIHA 1U6FA 3IGNA 2OIHA 3ILLA 5HK4A 1LWCB 3TAQA 2C3UA 4ID5A 3TWZA 1TKTB 1V3RA 3PKMA 2V67A 1WEYA 2XLKA 1JJCB 4CQ1A 3ZNJ1 5JMNA 1T9WA 3UW1A 3HSZA 2J76E 1OYDA 2MEWA 2CQCA 4MJKA 2K06A 4K4XA 2D9PA 3TJ8A 3UDCA 1FRIA 5LL6d 2GGPA 2F9JA 1RKIA 4G1QB 4DU8A 4ZLPA 3PJWA 1VQMS 2BW2A 2DYAA 3AOBA 2ADBA 3K58A 4KBIA 2JEFA 2FVQA 1RAJA 1U49A 1HR0F 1DLOB 4P72A 2Z58B 4W98A 4DG1B 3FZ2A 3H25A 4WFBQ 2R2UA 4DL0C 1UFWA 1VR6A 1VDHA 1OPZA 5GAGI 4QU7A 3K8WA 3ICLA 2HHSA 2MZJA 4UOCA 2FQQB 2UUCJ 3K5OA 1HMVA 2AKWB 2ZZNA 1AB8A 3MZIA 2HZVA 4OL8A 3OTDA 5LOQA 3TUPA 1FKPA 3W9HA 1SJRA 1NK5A 3DXSX 2B5JB 1MMLA 1OMSA 1LWFA 2R2SA 2Z57B 4QW8A 4CDIA 4C98A 4FF1A 3KXDA 2LA6A 1Y5IB 2FHJA 3Q8YA 4OYWA 3OFEA 1UAWA 3DFEA 3NCRA 1RKJA 4ZIWA 4FS2A 3K7RA 4PWWA 2HAFA 2ZJPQ 1RHRB 1RHKB 3ILIA 2MZ1A 4HKQA 3H7HB 2HFSA 3M2UB 2H9ZA 1LV5A 2DR5A 1QM9A 4IUFA 2ZBRA 4KFBA 4DWIA 4OMFG 1N6QB 4MK8A 2ZUAA 1VIOA 4WK1A 1AUDA 2KZMA 4TU7A 1G6BA 3AXMA 1X4GA 3N5BA 4LF4J 2J9DA 2H3EB 2RS8A 4H4MB 3DM2B 3CD6S 1TL7B 1S79A 1T8EA 2CQ2A 3M2VB 2M88A 2AHOB 1IBMJ 2EW9A 3NGDA 4B3RF 5KFVA 1PJ6A 4DR3F 2NPIA 1FJCA 2HNDA 2KT5A 3SYZA 2OTJS 4W4MA 3OVAA 2VFRA 3FC9A 4DR4F 1TL3A 2GVZB 1UMJA 3PY8A 3MM6A 4CWBA 2YH1A 3LPEA 1YJUA 4RW8A 4Y2CA 1RT5A 1FNXH 1X5OA 2KJWA 1WHXA 3ISZA 4DMZA 4X4RA 3NGRA 3BO2A 2F9DA 1SCJB 5J2PA 1S9GB 2CZ9A 1RTIB 1HIYA 1B64A 4QIVA 3FCHA 2XS2A 1HNZF 3MM7B 2UUTA 1B0PA 4DS5A 1U6ZA 2IC3B 1F5CA 4OV1A 3UDEA 2VQEF 5IWAF 5IS2A 5GMKa 1IR2A 2X51A 2AGOA 5DLGA 1DY3A 2UZAA 1R6VA 3JB9k 1WNEA 5H9EJ 3FGVA 1D9FA 1D1UA 3D7SB 2RAQA 1HNXJ 2V8VA 2VPYB 1JKHA 4OZ0A 3HCXA 4ZVTB 1Q8KA 5MAOA 4YOEA 4F2SA 3ZO7A 4YP3A 1AXQA 1R31A 3NNHA 5J1EA 4TN2A 5GAEU 3ZZPA 3GSDA 4ZLLA 3PYDA 4HLBA 1NEEA 3ILJA 4H4OB 3LAMA 1G7CB 3X3UA 4CYUB 3VAJA 3LP2B 3FCVA 1RTHB 4R0EA 1L3VA 3QT8A 1NM2A 4DL2A 1B0TA 1ZM4A 3VF0B 6FDRA 4NCGA 2HKEA 1O0PA 4HT5A 1Y3JA 4JB8B 2VJVA 2AYEA 2OHDA 5CYMB 3EYZA 4ED7A 1TR0A 3KUEA 4DR2F 3OT9A 1R8HA 2J0XA 2XM3A 3MTKA 1Y7PA 4IOAQ 1VGYA 1FK9A 2ATCB 1R27B 4C8NA 2V94A 3CULA 3Q8SB 4GKJJ 4RO0A 3A4TA 4LF8F 3OTCA 1S48A 1CPZA 1WI8A 2HQFA 2JEJA 1XN9A 5GAHU 1K1QA 3F0NA 3IMQJ 2C2MB 3PRVA 2N7YA 5BR8F 5L1KA 1R89A 4DPYA 3H4BA 1XNQF 2HBZB 1X60A 1PKUA 2KU7A 4ZVPB 2B43A 3UCGA 1EB0A 4YR2A 4KSEB 1CEZA 1UVKA 3Q22A 2Y1IA 5FIIA 4ZJLA 3LP0A 1HBNA 3HXMA 1KRPA 2VG6A 3ET6A 1RTDB 2MHEA 1N48A 5KFYA 4I7FB 3VZHA 5DGAA 2ASJA 1SJ3P 2HK3A 3C2PA 5KFPA 4ES1A 4OHYA 3M6XA 2AJ4A 3ETOA 4J9QA 1XWLA 1J2VA 1RQ0A 3BR9A 5CH7B 3MPUB 1RWNB 4ETZA 2RH3A 2XGPA 1VHFA 2LQ5A 4QBUA 1DRZA 2I6WA 2CQPA 1FE0A 1Y5NB 1VK8A 2CQ3A 2EKYA 1WI6A 1TUGB 3M6WA 3MR7A 1Q1KA 3VR1A 4BC7A 5A0YA 1IKVA 2HHPA 2B6AA 2ZOGA 2I38A 3JYTA 4OYAA 4C7QA 3JQKA 4CCHA 1KKHA 4OYOA 2VDIA 2G4BA 4MTPA 4OYZA 4IFYB 2M7SA 1XTZA 2U1AA 2YWFA 1KEKA 3P45B 4PWDA 4CZCA 2RSQA 4DXLA 2KG1A 4M5HA 2MKSA 3KHHA 1S7IA 1S5ZA 5D0EA 1L3TA 5B0CA 5DDPC 2ZWOA 3T6BA 4ANCA 2VQFJ 5H9FJ 4NZ6A 4O4GA 4ECRA 1NK7A 1SIZA 2DR7A 4LVOP 2AV5A 2EC2A 2WB1D 1SJ1A 1S97A 2E9RX 2DGQA 1TMMA 1FRMA 4QR2A 1RE1B 2B8QA 2ZITA 1GX5A 3EDQB 2WBMA 3KNGA 2ACMA 2HRTA 1U7LA 2JEGA 1KFSA 4DEZA 2LQBA 2MQQA 3IG1B 2K7JA 3TEGA 1DTTA 1EX8A 2W2OP 3GFYA 3CCTA 1UKUA 3EZOA 2W9BB 5F8NA 2MKHA 2YKNA 4LF7F 4JP8A 2E1RA 3IWNC 4Q7AA 4NL5A 1S1VA 1T95A 5SZTA 1GX6A 3I9ZA 3QGPA 2E5GA 3HULA 3KMQA 1RA6A 2CADA 3R8YA 2B4VA 4N7TA 2HHQA 3NMRA 4KH1B 2DXFA 3ZTRA 1FKOA 3W64A 4CO4A 4CLUA 3ITHA 2B9YA 4JOUA 5HN0A 3RB6A 2IBOA 3V81A 1WHYA 1AW0A 3K5LA 4DV3J 5KFRA 4NZ0A 2XSJA 2B9EA 1NMEB 1K0TA 2ZFHA 2XYHB 5DZ6A 3M8WA 1Q8LA 4HTIA 4WP9A 1RWUA 1TL4A 2DK2A 3UD3P 4WKYA 3OR2B 1QE1A 4LRDA 5ETNA 1FTCA 1E6VA 2LP4A 5KAKA 4N77A 3QIPA 2G2ZA 1WTBA 2GMHA 3KFWX 3TA2A 1NNDA 1TAUA 4DN0A 3IO1A 3FQKA 2DGOA 2OPQA 5ITHA 5CXTA 5LXRA 1N54B 4P73A
chains in the Genus database with same CATH topology
4EUVA 1I94F 3PACA 1X0PA 1W2BR 1LOUA 2JSXA 3DRPB 1JNRB 1O51A 2B0GA 1U8SA 1JLQB 2A10A 3TUJC 5KOWA 3R5BA 2G13A 2X3GA 2YX1A 4DV5F 3AAWB 1X0FA 1N5YA 2KT3A 3MURP 3MGJA 3W2WA 5F3TA 1QTMA 2IBKA 4KAIA 4DR7F 2BJDA 3FFIA 2CPXA 3N01A 1ZH5A 5B0BA 1GTEA 3T3FA 4ZCKA 2BZ2A 2FIUA 5KFDA 4NLRA 1NAQA 4ECQA 1LWCA 2MY7A 1U1MA 5AXLA 4PG7A 2EFNA 2GJIA 2Y1RI 2FGCA 2NLWA 3CIMA 3LH2S 2J6TA 3IWXA 2VBZA 2YKOA 3LP0B 1R8BA 1HBNB 1RTJA 1C2PA 4TU8A 3I87A 2OAUA 4DSJA 1WD6A 2B51A 4DR6F 3G6YA 4EYIB 2VG6B 4G3IA 2EG2A 3PX6A 2E9ZA 3IR7B 4KV8B 1X4AA 2ZH7A 4DS4A 3HK2A 3CDAA 2D7SA 5A8RA 5KTQA 2QFJA 1VC0A 2ZD1B 2JLGA 1DHMA 4RW7A 3UCUP 1Q53A 1RI7A 5F41A 1HNXF 1F9FA 2E7WA 2C2EA 3SFGA 3NAHA 4QR0A 4C3KA 4Y0FA 4BWMA 2ASDA 2VBYA 4ZPVR 2YKQA 1MWYA 1DZ5A 5L9NA 3L95X 4CI0B 5F9NA 3TAPA 3QGHA 1R0AA 3BO4A 3RTVA 2K1RB 2VG5A 3US5A 1LWEA 5AE2A 3J7YU 5DQIA 2B9XA 4QZVB 3CDUA 4QWBA 5T14A 1FRLA 1HHTP 3LF0A 4IDKA 3NKYA 4KHMA 2RD5C 2IRYA 3KK1B 3HVRA 4ZVHA 4F4YA 4A8KA 2XHWA 4IOCQ 3DGPA 3M8PA 3MFHA 4K4ZA 5LSLA 1F5AA 4C11A 4B3OA 1HI0P 4KPYA 4G1QA 3ZZZA 3I32A 2IVMA 4YMEA 4IFVA 1U1KA 3KK3A 2FLNA 3ZZYA 3IN5A 5KFJA 2DGXA 1GXUA 4J37A 4F50A 2OP5A 3RB3A 2B9WA 2DPIA 2L9DA 1SJ4P 3LO3A 4ZA1A 3D1HA 5GADU 5AJ3F 3V4MA 1S6UA 4B08A 5F8HA 2D9OA 4Z37A 3P49B 3MR5A 3PO4A 1DBDA 3L7PA 4U7CA 2FVPA 1VQ6S 4OI2A 3U1NA 5LT5A 3GV7B 2AJ0A 2K3KA 3M05A 4OX7A 4O0IA 4F4KA 4Q8EA 5D78A 1DLOA 2HNYA 1XNRF 2CQ1A 3CDEA 3OSPA 1GH8A 4YUDA 1TK8A 2DT9A 3V2UC 4C3MA 3R5DA 3AB2B 1H2VZ 2Z0GA 1NJZA 2WTFA 1YSJA 4TY8A 2NR0A 1VMBA 4KC5A 4WJBA 5F9LA 1HFEL 2Q6CA 1RT6B 2Y1JA 2XWYA 1OO0B 4KHPF 5A0YB 3CCJS 1IKVB 5GADI 3IRXB 2XGQA 1LW0A 1T3OA 1CLFA 3V6JA 7FDRA 1UVMA 2HNZA 5HL7Q 3OFGA 2A18A 4HTJA 3HMJG 1DJ0A 5DDOC 2XS7A 2AJ1A 4OHXA 1IKYA 4WCEQ 4RNNA 1JK9B 2GNKA 2ZBIA 4FYDA 3TNVA 3R27A 1C1BA 2YQ3A 1C0TA 3HHLC 3MEEA 4JUZA 3IRWP 1U2RA 3ZZUA 1K8AT 3Q2TC 1XMOF 1ZETA 2O66A 2RB7A 3UWTA 4ZP9A 4X4TA 5FLXY 5KFUA 3MEDA 3PJXA 3DLBA 4TY9A 2BA9A 5KFFA 4PWDB 5M2UA 2J6SA 1U48A 1S6PB 4DQRA 1IN0A 4UY8T 4MK7A 2BE2B 3V6DB 2ZNYA 2HGLA 1JXEA 2V0NA 4GC6A 2XMWA 3ZFVA 3GILA 2B7BB 2K3IA 3AH6A 2R8KA 2JC0A 4ZPCA 4DN9A 1R8PA 2BJEA 4GKJF 4KKOB 4B02A 4E8UA 2FJBB 3SDEA 4LSLA 5I42B 4RNFA 4B9LA 2DNGA 2ZH4A 2WSEC 3MUMP 2LQ9A 1X5TA 1TK5A 2B5JA 2WSFC 1FEEA 1VRUB 1VFJA 3D2WA 5B09A 4KGMA 4QR1A 3V4IA 5HLFB 1FRKA 3IA0A 4RUAA 2W9AA 2HIQA 2FJXA 1RT7A 1UWBA 3E8OA 3DDNA 4HH0A 2CPIA 3DMJA 4J5OA 4BBYA 3CD5A 1X9WA 2CJKA 4JI3F 1PC5A 2YNHB 5K9FA 3TA1A 3M30A 2ZH2A 4I4BA 2W7PA 1J5EF 5CQGA 1RYSA 3M1VB 1RYRA 5EDWA 4N76A 2KFZA 1VRTA 3DCAA 3H2VE 3KLHB 1XBWA 2CZ4A 3CJ3A 3KOAA 3BN4A 3QLHB 3MR6A 2FDNA 4TXSA 1IBKF 1A7GE 2VD3A 3NGKA 5E33A 3NS6A 2GJ2A 2FLPA 4FPRA 3CCUS 4YDXA 4CNYA 2OH2A 3VQSA 2ADCA 2ZOMA 2HHVA 2I8EA 4B3MF 3MAQA 2R7UA 3DNCA 1TKZA 4P2SA 2W4DA 3BGUA 4ZCMA 4YB7A 4A8WA 1N5VA 3IR5B 3CCMS 1Q82T 4PKDB 4DSEA 4DFPA 2MYFA 3MAHA 2NPFA 4RZRA 3OHAA 4DJBA 4ICLB 4DSFA 4LUBA 2DIUA 3H5YA 2ZE2A 5G4DA 3RYLA 2DHGA 5CYQA 2VL1A 4LFBF 1N34F 2MQPA 2XC9A 1S49A 2CJAA 2GCFA 4QW9A 1NJWA 4LF9F 3POTA 2V4JB 2MHNA 1WTFA 2KM8C 2M9KA 3DOLA 1X4DA 2I9SA 1WHWA 1FO1A 3DRSA 4EYHB 2ZHAA 4PQUB 5J2QA 5DQHA 2OJ3A 1VC6A 1UJ5A 2UVRA 4ED6A 1JLCB 1URNA 4ES3A 3FVYA 2J8AA 1DTTB 5E3PA 4NLYA 4FXVA 2MZTA 3MECB 3BGRA 1FKAF 3RAQA 1NRKA 2OKQA 1SB6A 4X4OA 3DLGA 1MU2A 2KYZA 1SV5A 3DM2A 2YNFA 3GFZA 3HZEA 3D0GE 4WFXA 4IRDA 4MK9A 1JLEA 2ZBCA 4K50A 3FSIA 3LW5C 4UQGA 3PEHA 4Y34A 2IAJB 3SSSA 2FHKA 4LMZA 1N5TA 4ZPBA 3DOKB 3I4PA 1ZZNA 5I3QA 3I82A 2YX7A 2QE5A 3EXYA 3OFHA 2XBPA 3U02A 2MKIA 2NSBA 3TW0A 4QWDA 2OMOA 2R7QA 2PI4A 3NP5A 2C22A 5DDRC 4I0WA 4L72B 2R8IA 2HFOA 2A3JA 3F73A 2W24A 4O44B 3HVTA 1L3KA 3PX0A 1NK9A 1HNVA 1TL5A 3HM9A 1RGVA 2RIJA 3LOUA 3UR0A 2Z8QA 2IHR1 5IT4A 4PR6A 1KN6A 1FKPB 4X84A 4C0BA 3NRBA 1SKSA 1TZ0A 1VQ7S 1ZAWA 4KE5A 2RQ4A 2XI3A 4D3GA 3EPIA 3O5TB 1Q16B 1YVFA 3D0IE 3SZ2A 2JDJA 1X4FA 2NYIA 3R3TA 2G9OA 5D4PA 2OMLA 1FHTA 1FKOB 2VKZG 3OFFA 1YQHA 4PXCA 3DLKB 2POKA 4ZDNA 2VC0A 2Q43A 1P1LA 3ITHB 2HS4A 2WOMB 4QWEA 3EGNA 1U2FA 2FUG9 4F02A 2HMIB 2IM2A 5KFWA 4WIIA 4DL4A 2I1RA 3EGZA 5L1LA 4ED8A 3V81B 4IYQA 4M5DA 1T7PA 5AE3A 1JIHA 1D8ZA 2ZH9A 5F8JA 3QGIA 1S9GA 3K0JA 2UUBF 3KMSA 1RDRA 4ZMMA 2RKIB 1RTIA 2GX8A 3OW2R 1H6KX 3ZZOA 4LIWA 4QCLA 2V9WA 3VWSA 3FRYA 3NG8A 3MM5A 1V9OA 1HA1A 3QO9A 1X4BA 3QZ7A 5KFZA 1ZYQA 2N4DA 3P3DA 3WC0A 4U9RA 3MM7A 3OBIA 2EBEA 2J9EA 2VQFF 2E7XA 1FE4A 2LLZA 5I4MA 4DSKA 2HW3A 4HHJA 4QJVA 1URRA 3CSKA 4AL6A 1VQYA 3CF5Q 2NUHA 2IC3A 4NLTA 2U2FA 3I0SA 5EX0A 2DCUB 3TANA 3A8EA 4QWCA 4NOHA 4DQPA 2CKWA 2PMHA 1LQ9A 3ONQA 3SSQA 5DG9A 3DI6A 1QE1B 4RNMA 3FDSA 4EO6A 3HHEA 4F3OA 4RUHA 5D3GA 3PIPQ 1H2UX 3PW0A 1MW7A 1HWKA 3KG1A 3JSYA 3JSMB 1E6VB 1JLBB 2M8DB 2IVFB 2XNRA 1R6YA 2R7OA 3MMCA 3O3LA 1X4CA 5KG1A 3QIPB 2PE8A 4N8OA 4HDGA 1HNIA 1I1GA 4NYOA 2QSFA 1M5PC 4GMKA 2XB2D 2E44A 5IFMA 4DQIA 2VONA 4QOTA 3KJVA 1KSPA 2VPWB 1EETA 2IVYA 5E5NA 2IM3A 2B4UA 2OPPA 3IBWA 1MMNA 4OJGA 3K8VA 4TNOA 2VA3A 4OI3A 1IUJA 2DGTA 1KOHA 3TOQA 4MKYA 5K8MA 2KJVA 2R7RA 2G0CA 1N5YB 4A8SA 2J7WA 4USJC 3W2WB 4JI7F 1FA0A 4JI0F 4QQBA 3U7JA 4X62F 1AFIA 4ALZA 2OFHX 3C66A 3OUYA 5E0OA 1PO6A 2ERRA 1JLFA 5LJ3Y 1DQAA 2CYYA 2KTQA 4NLPA 4ED0A 4C8ZA 1LKZA 4J9MA 3RBEA 2YVSA 4XDCA 1R43A 4X4QA 3GWCA 3CWJA 3KKFA 1U1QA 1LFPA 4RW9A 2LU1A 1GXTA 4P7TA 1S6OA 4WFAQ 3T1HF 2R8JA 5J2NB 4Y2AA 4NLXA 1KONA 4EBCA 2MZSA 3R5CA 4IH5A 3N9UC 2UVWA 5LSOA 3RR7A 5K14A 2EK6A 2DHXA 3TRGA 4ZPWR 1HW8A 3R5AA 3OLAA 4Y2KA 1X9MA 2I2YA 3G6VA 4DSLA 3LAKA 3OL8A 1HW9A 2Q1LA 3H2UB 5A8RB 5F8MA 3QJPA 2P9GA 1SH3A 2DBBA 2HG4A 3Q0AA 3HX9A 3N6NA 1TL3B 2E1CA 1U09A 4IH7A 3MM6B 3FMBA 2AGQA 3SCKE 4IQMA 3BN7A 4RW8B 3GYNA 4OJ1A 2CQBA 2DGSA 1C1CB 1GNKA 4O4RA 1GAOA 2GHVC 4C8MA 3RW7A 2VG5B 1LW2A 1LWEB 5I3UB 2EFPA 2YH0A 5EHHA 2XY6A 4C2MA 1HPZA 1NH8A 1TFYA 1HQEA 2V8HA 1MSWD 3ISNC 3OPKA 3TARA 2CG4A 4IDKB 5IT9Y 2B3TB 4IRKA 3N79A 2DNKA 5J2PB 2PEHA 3M8PB 5CZVA 4E0DA 5J1PA 3IWLA 3HKZD 5EWGA 3VAIA 2P6TA 1UA1A 2O01C 2GV1A 3K2YA 4IFVB 4I6YA 1F60B 3M8RA 1W2IA 2GHWA 2EFVA 4USIA 3TO8A 2RU3A 3GIMA 1VQ9S 4NLGA 4ZP8A 4DOZA 2DHSA 2APOA 1N56A 2KHDA 2A1BA 2JJ4D 1LXJA 1CG2A 2FHOB 4TKTA 1IJFB 2N7CA 3TVKA 1HARA 4FN5A 4JV0A 3BSNA 1M5SA 3H5XA 4PUOA 2JOQA 3KK2A 1HQUB 2K8GA 4J9RA 4M94A 1OS5A 2R4FA 1H2TZ 5K5MA 2JH3A 1NH7A 5CYJA 4MFBA 4RU9A 4N5SA 2DHAA 2GQQA 2FC9A 2B4PA 4AXIA 1SH2A 1HBOB 3S8SA 1IQZA 1NJIT 1HBMA 5IQQA 1PC4A 4ELTA 2HNYB 4DV6F 4NCAA 1Z4UA 4DV3F 1VQ4S 1FVQA 2LQJA 2AYBA 3H5SA 1D9DA 2XG8A 4WXOA 1O5JA 4TY8B 4X65F 1TKDA 4Q43A 3OJUA 2QSWA 4FNHA 2JX2A 2FY1A 1DURA 3MD3A 3IAS9 2QLWA 5C5JA 2WB4A 2RRAA 1HI1A 1LW0B 1PILA 2IA0A 2IRUA 3CT9A 2QA2A 2V8GA 5HI7A 3DYAA 3F41A 2VC1A 4OLOA 4DR1F 1MWZA 5IM0A 2ILZA 3VAKA 3CJ5A 4N41A 5KFEA 1H98A 2VFSA 1J5OA 4C8KA 4WKRA 4J9KA 1RT2A 3MEEB 2OD6A 2WRMA 3NCPA 1JLAA 1RP5A 1UJ6A 2HGMA 2J0WA 2BUNA 3BDEA 3MM8A 1SJQA 1AROP 1SC6A 3DRYA 3MEDB 3NAIA 5EUHA 2AX0A 5B0EA 3BR8A 3S1TA 3B4DA 4DV2F 3KNAA 4ZCLA 3MEKA 2DNHA 4V19J 3OHBA 1T05B 4E98A 4PG6A 2XEXA 4JI8F 3GIJA 3U1LA 4LF4F 2YY3A 2WONA 4EU0A 2LXFA 4FNIA 4M1KA 1OIAA 4NPOA 5IQ6A 3N4WA 2HGNA 4WZMA 2VV5A 4NCGB 1H0HB 4LFCF 1KD1T 1UL3A 5JXSA 4JV1A 4CO2A 1U26A 3HHDA 3K5MA 4C4WA 4AUKA 2HVIA 2HHUA 4DX8H 4IKAA 3O2IA 2D3UA 5E3QA 4B9NA 3J81Y 1RT7B 1KLMA 2VFTA 3QMQA 3THVA 1VQ8S 3KLVA 3NBPA 4HH1A 2HHHF 5EN1A 1UWBB 2JLFA 2P6SA 2XMKA 4KT0C 4RW4A 3DMJB 3ZZRA 4ZK7M 1L3SA 2CFXA 3N28A 3UNGC 2J9DE 3CCQS 5BYRA 5IZHA 3M30B 1UVJA 5KFGA 2C2RA 2Z2LA 2COLA 2JRSA 1QSLA 5A8KA 3TX8A 3DHWC 2M52A 4B3TF 1AFJA 2R7SA 2GIQA 2LEAA 3VALA 4FF4A 5KFKA 1SBRA 3G86A 3FEYB 5KFLA 4XPEA 4I2QB 5IXUA 3GB0A 3IS9A 2HWIA 2KZZA 4OZNA 5LXYA 2OO4A 1NKCA 3CC7S 4EWTA 1K0VA 2E29A 1RK8A 2HS3A 1YJ9S 2XI2A 4IG0A 4A8YA 5C24A 5DETA 2QEXS 1SKRA 4XK8C 3PM9A 2DTJA 3NL0A 3GFXA 4LT6A 1VIXA 2XLIA 5KOXA 4O3SA 3BM7A 4LIRA 1LK7A 2ZE2B 3NWGA 4C3LA 3OXLA 3I96A 4AL7A 4KHRA 3KG4A 3POTB 1S6QA 3KG0A 2M8HA 1T3NA 4M95A 2VOOA 4OHZA 5KFAA 4DR5F 3DRSB 4DFJA 1WEXA 1H3DA 2NSCA 3JTOA 3F56A 4I6AA 3G6XA 2ZOFA 3DC2A 5DM7Q 1ZTWA 4A8QA 4YB5A 1H7WA 2JWNA 2RVJA 4OHVA 1YRXA 3MEGB 3BGRB 4WFZA 2JVRA 2VBXA 3R1HA 3DHXA 2DNYA 1TP7A 2YKAA 4DFKA 3I31A 1WG4A 4G6VB 3DLEA 2BR0A 4MH8A 3DLGB 1MU2B 2HHTA 1E6YA 1SV5B 2YNFB 4U7UK 1N4LA 1MNEA 2FD2A 5HROB 5HBMA 3GR1A 5HMZA 1JLEB 1VI7A 2JLEA 4ILRA 3Q8QB 2EWHA 2JFKA 3G8QA 2R7VA 1TKTA 2CQ0A 2ASYA 1S1WA 2AGPA 4R8UB 3PEJA 5MLCV 3I5AA 2L9NA 2MGZA 5A8WA 1VQSA 1U45A 3E3XA 2KO1A 3M9NB 4EBEA 1DQ8A 1IXKA 5D6GA 1FRXA 1WHVA 1WF0A 4NRTA 5AXKA 1C0UA 1Z2LA 4R25A 1RA7A 1KTVA 1IQTA 1L3UA 1NHUA 5K8OA 1HYSA 3L09A 1CVJA 2BOPA 2VZ9A 2KXHA 4X64F 4OHWA 2C2DA 4WXWA 4IG3A 3HVTB 1QAYA 1X4EA 3OLBA 2FC8A 2XMTA 1QVGR 5KFCA 2KN4A 2FVRA 2CJQA 1R3NA 1HNVB 4OX6A 4CO1A 4OZ5A 3VAGA 5FDLB 4C97A 1F5BA 1XR6A 4FP9A 1SL2A 4OI0A 3FEZA 3MM9B