2ZUGA

Crystal structure of wssv icp11
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
ATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEELRLLTGDSTLEIQPMIVPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF115 (WSSV285) (Wsv230)
publication title White spot syndrome virus protein ICP11: A histone-binding DNA mimic that disrupts nucleosome assembly
pubmed doi rcsb
source organism Shrimp white spot syndrome virus
molecule tags Viral protein
total genus 13
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09625 VP9 VP9 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2070 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zugA00
2ZUGA 2GJIA 2GJ2A
chains in the Genus database with same CATH superfamily
2G2YA 3AA8A 2GAHC 2QZ8A 2LP4A 3Q83A 1HNVA 3QYYA 4YY3F 2HNZB 3LP0A 4L3NA 1FFGB 1HNIA 3M8YA 3DLKA 1LV5A 2IY5B 4C8LA 2KT3A 3GIRA 2ZVIA 4ZVEA 1DJ0A 1MWYA 2CPDA 2HS3A 5KG3A 2Z4PA 4WFYA 3FBFA 3O6QA 3NGRA 3CCLS 1ZA1B 2J7KA 3TUZC 3NGKA 1IBKJ 4WP8A 4DEZA 2ZJPQ 2QLWA 5C2CA 4JI2J 4GVLA 2VFSA 5GMKa 2X1AA 4F2SA 2R42A 1VS3A 4Q2LA 1D9FA 3MPDA 2Y0SD 4MMOA 5HJYA 2QLXA 2FHMA 1M90T 4OHZA 2GW8A 2ADBA 3PIOQ 5IFMA 2GQ2A 1BD6A 3EGNA 5HMYA 3LPEA 2FY8A 2ZKUA 2V9KA 3I87A 4QPXA 3BN4A 5B0FA 3HJFA 1T0TV 1EJ7L 3QGGA 2BXJA 2HVZA 3SFGA 4FXDA 4EFAC 4LF1A 3KUEA 3HPOA 3R5BA 2HFZA 5SZTA 2VOOA 2CPJA 3Q2SC 1FFSB 3HHLB 2DNYA 3O3LA 2W1BA 4IH5A 3DGPA 1VI7A 5GAEI 3NS5A 1T94A 1NDCA 4XIUA 1RT1A 3FSXA 1T9YA 3AJ1A 4J37A 4ED1A 3T9ZA 3D2WA 2EK1A 1RTJA 1U1RA 1FT8A 3D7SB 2BOPA 3G82B 5D3GB 2KB2A 4O3QA 2CQ2A 4RWWA 3CEDA 4Q2MA 1TKDA 4JV1A 3MECA 5AE3A 3BBBA 5D4LA 2CADA 3ZZYA 2Z2LA 4O3PA 2A3JA 2DKOB 2NPFA 1MW7A 2VKZG 1JNRB 3OSNA 3EICA 1ICEB 1BY9A 2XTJP 5AXMA 3S7RA 1W2BR 2F4VF 5L8RC 3U02A 3GTYX 2KXHA 5KFGA 2KVIA 1EETA 1C0TA 3OQ2A 4KV8B 4Q45A 1FXDA 1F3FA 2Z56B 4ITSA 4DQPA 1L3VA 1Q1KA 4C97A 5JVHQ 4K7QA 4LSNA 1FEEA 2IRUA 4LF4F 4RW6A 5K5MA 2AP6A 3OVBA 2DJWA 2CVEA 2VBXA 1TQLA 1IKWA 5T7LB 2RUGA 5LSOA 1S1UA 1LWFA 2N3LA 3EPGA 2MZQA 4CCHA 1RAAB 2BQRA 2PD1A 1PBUA 2QTWA 2H5JB 4ZLPA 1HNXJ 2DB1A 4DR6F 3CCES 1LEOA 2C2OB 4KGVB 1NJIT 4NCBA 1VYAA 3BGOP 4ZVTB 4RBVA 2ZD1B 2ZE2B 2QMWA 2DNPA 2R8IA 3M2UB 5L9NA 1IM4A 1NHKL 2LXUA 4X84A 4C4WA 3W5XA 1NLKL 2B9EA 3E8OA 1ZAVA 2LDIA 2IRYA 4I2PA 2MQPA 1YWXA 3BGRA 2ZZTA 1HYSB 3JTPA 3WC0A 3QJPA 4PPDA 1HNWF 4ZLJA 1S1XB 3DRSB 4OI6A 2ZBQA 3LO3A 5ETLA 5D77A 2XS5A 4DV7F 2PO4A 2Y8WA 2LLZA 2IMWP 1J5OA 4M5KA 3M6XA 3QBCA 4I2QB 1KNZA 1R0CB 3PYGA 4M5GA 3TVYA 4I67A 2VONA 2VBWA 3PJXA 2DNGA 3M8QB 1XNQF 3LWLA 2DPJA 3J80Y 2L08A 2V67A 3EX7B 2VJUA 2ROPA 1F1BB 5HJXA 1Q8LA 3DDNA 4NCGB 2MGZA 5L39A 4IR9A 4FPIA 3QIPA 5LMUJ 1K1SA 2CFXA 3MGJA 1WEZA 3OD2A 5L1LA 1AW0A 1UVLA 1ZZFA 1VRTA 2EFPA 4NLTA 2IAJA 4ZKAA 3KK3A 4GVBA 3VAMA 1UJ5A 4JI3F 3K89A 1I3OB 4UOCA 1EX8A 4QBUA 2UUAF 3CSKA 1CC8A 4NXMF 4B3MF 4IOCQ 2ACYA 3QT7A 4ED7A 1K8AT 4ED6A 4F4ZA 4ED0A 8AT1B 1VQ4S 2EC2A 4OZJA 1XMQJ 4GC7A 2BKNA 4F0MA 2ZVSA 3OW2R 2PE8A 1O51A 3I96A 1D9AA 4OZNA 1NCLA 3BZQA 4CI0B 2XLIA 2GMLA 1WNEA 5EUHA 1M1HA 1Q8IA 3CD7A 3N9UC 4PXEA 4B9LA 3HHEA 4NYPA 1SJFA 2NLWA 5ETOA 3KNGA 2RRAA 2ZITA 1QAIA 5LXRA 4KTQA 2M0GB 1SUQA 1UP1A 2XCAA 4NA2A 2EI5A 4KGKA 1RT5A 4B9MA 2B4OA 4J90A 1IVZA 2W24A 4DR3J 1VRUB 3M30B 1ZYQA 2OP5A 3WQPA 2VOPA 2GQCA 2X1GA 4R8UA 4X66J 3ISNC 2PMHA 2I1RA 1M5VC 3CJRA 1FJGF 1HQ2A 2MKHA 5CH7B 3ZFVA 4DLEA 2XMUA 1IKYA 1KFDA 3RAMA 5BYQA 2RMLA 5C24A 4QU7A 2QA1A 3M32A 2HW3A 4YOEA 1WTBA 4AXJA 3NBPA 1Y5NB 2EC0A 2YKNA 2MSSA 1SV5A 3V4MA 1YRUA 4YUDA 1NEEA 4XDCA 3FEZA 5BXIA 4ZPWR 5CZVA 2MJNA 2DEJA 2PSZA 4WCEQ 1YJUA 1C1BA 1TKZA 2QFJA 2G2OA 2UUBF 4U95A 4NLVA 4E2FB 2YNHA 3CCUS 3CC2S 2E44A 2FQQB 5CQGA 5T14A 3DRXA 4PAAA 4HI2A 4G1PA 4W92B 2UUTA 5J2PB 4WPAA 4USIA 1S9GB 3VZIA 1ZPWX 1SKWA 4PUOA 2KZMA 2AX1A 1XMOF 1TELA 2RDJA 5LOQA 2LFVA 2MHNA 2B6AA 2XMJA 2CJ9A 2ZBPA 5FJ4A 1TK8A 3RBXA 2YXLA 3N5FA 5K9FA 5A8KB 3PRBA 1GX5A 1OWXA 4AE5A 2ZH1A 3W1YC 2VF3A 2VBYA 4KSEB 2HVEA 2G0IA 4NLYA 1X4FA 3FQKA 2LQ9A 2VG7A 3MR6A 1D0EA 1CULA 4CP5A 1T11A 1UWBA 2WBMA 2FC8A 2AJ4A 2HK2A 2FLNA 5HI7A 1FKOA 2VPYB 3GWCA 3JB9k 3TW0A 3U1LA 4YDXA 5KT7A 2MQNA 2C2EA 1LW2B 1FESA 4A8QA 2RH3A 4DUZJ 1RWWB 1S0NA 1UFKA 2QGFB 4G3IA 4OYBA 4UOGA 2HS0A 3NMAA 4ES1A 4FYWB 5EDWA 1CQMA 1SJ4P 2F7VA 1DHMA 3KLEB 3H5XA 2MKKA 1IWGA 2CZ4A 3NCQA 4CH7A 5G0RA 3O2IA 1VRQC 4CT9A 1S6QA 3NEKA 3NS6A 1JLQA 1HR0J 2RU9A 3JQMA 2AYBA 1YITS 1Q81T 4N8NA 3KLFB 3HKWA 4GMKA 3HF5A 1JQGA 1VQNS 3Q8RB 2OPPB 3SI8A 1EQMA 3D1HA 3CB4A 4RBUA 2F9JA 4OV1A 3B8HA 3KHGA 2J5AA 2ZBCA 1C2PA 4DCPB 3KHLA 3THPA 2RE1A 3FEXB 2MKIA 5GVQA 2GHVC 2MJUA 3W2VA 1VQ5S 5B0AA 3MF5A 3CJKB 4ZITA 4QIWD 4NWBA 4OYAA 5ETQA 2RKIB 4JV5J 4GKKJ 4IFVB 3R2CJ 2KRRA 1RT4B 4R0JA 4WK3A 5E3CA 1NU4A 1Y11A 1RWMB 1QVFR 3G2XA 4TU7A 3Q8QB 4NOHA 4U7UD 2HWHA 1ROFA 2MZSA 2JHEA 4X4OA 1TVRB 5H1SV 2CNNB 3P45B 4KO0B 3M8PA 2LVWA 1NUEA 1DURA 1NHUA 2NQPA 1FNOA 2QRRA 2DYAA 3PEHA 4CLKA 1IBKF 1JMTA 1RHJB 5B09A 1RI7A 4DR4J 1WHVA 3FFIA 4EO6A 4O44A 1WG5A 2D3O1 4EZ9A 1FERA 2FJDB 3MDFA 3W60A 1HWLA 3KWMA 4KE5A 2H51B 3AOCA 3R97A 3I56S 4K5RA 5I42B 3R6GB 1UETA 1VQ9S 3LAKA 3P49B 1GTEA 2VH7A 2GHWA 4WJBA 3CVKA 4P52A 2VBZA 1N5QA 2JEGA 3AD8C 2EFGA 1VQSA 4P9SA 1NB7A 1X4EA 2N7CA 1HQUB 3I9ZA 1IKXA 5BJRA 3KG4A 4TQSA 4IFYB 4CLUA 4U9RA 5JJBA 3CC7S 1GFWB 2DCUB 2PEBA 7FD1A 3NAHA 2HEKA 2QV6A 4LQ3A 3LAMA 2IM3A 4FZVA 1C0UB 1X31C 1LQ9A 1MWQA 4OIXA 1NKEA 1I6JA 1IR0A 2FUG9 5KFJA 2KG0A 5GMDA 3CJ2A 1SH0A 1RT2A 3MEDA 5E5NA 4Q44A 1FEHA 4NLXA 3KJVB 1RAIB 1WC6A 4FS1A 4LUBA 3MAAA 4PWWA 4K4YA 4IQMA 3HULA 4OX9J 1NBEB 1UA1A 5CZXA 2N7YA 1TMMA 2V68A 3F56A 3HJVA 3NXZA 1HBOA 2F8EX 5J1NA 4JI7J 5HAOA 1R89A 4F8RA 3C14B 4UUWA 3DU5A 1REGX 1CBKA 3HT3A 2XMMA 2JVOA 2BACA 4RW8B 3FMWA 3IO1A 2IFXA 4RW7B 4MFBA 1H6KX 3CJ4A 3CMQA 2KT2A 4DJBA 2X3DA 1JJ4A 4K59A 1JLFB 2CWKA 3KHHA 2C3YA 3FBCA 2CQGA 3DRPB 3BO3A 3OXLA 5SUHA 4RPFA 1KTVA 2MPUA 2V2VA 4NI2A 2LEPA 4I6YA 4QJVA 3LA0A 4ECWA 2WW8A 1MROB 4DWIA 2NZCA 3MFIA 1C4CA 2XZWA 1HNXF 3MCNA 4HTJA 3OHAA 4B9NA 3UDVA 2GJ2A 2ZZNA 4FF4A 2KYXA 2D74B 3F41A 3ZZRA 5F8GA 3PJ9A 1BQMB 4DV5F 4DF8A 1VQ7S 1RYRA 2V2QA 1U09A 2ZJQQ 4CDIA 1I94J 4JYAJ 2CQDA 1S97A 1B99A 5CCLA 2DGUA 3I0RA 4RW9A 2EBEA 4DHVA 3JSMA 5HP1B 2W8KA 2EXUA 1YX2A 2KU7A 3AB4B 3D1OA 3KDNA 3FZ2A 1DQ9A 4ER8A 4ECVA 4OL8A 4DFJA 4ZCLA 1W25A 1HWUA 2WVFA 4KB7A 2FVSA 2M9KA 5GAGU 2ZHAA 2VASA 4ZVPB 1SJ3P 1R0AB 3FMBA 2ILZA 2HG4A 4EBCA 4QIVA 2AD9A 1SJRA 1UZDA 3BKFA 2XC9A 3OXGA 4MK9A 3DI6B 5ETKA 3GSDA 2HK3A 3M9MB 1VQMS 1RTIA 3T6BA 1EKRA 4GKJJ 2J0QD 4RU2A 3T41A 1U1MA 5A8WA 2HZAA 4IR1A 2IDLA 1KVIA 1X8DA 1UKUA 4F26A 1Y00A 4MIWA 2NR0A 5FDLA 4C2MA 3KLGA 1JJCB 4OZ1A 4JI8J 2PA8D 4EYHB 2XNQA 3CDEA 1XMQF 5E3AA 4U6PA 3WDOA 3V6HA 2J0SD 5ETSA 3EWGA 4YQWA 1MU2A 2AKWB 4RW4B 4EGLA 4B3RJ 3UQSA 5GMEA 4OJ1A 3RW6A 2PC6A 3W3SA 2GMJA 8RUCA 3G6XA 4KKOA 3GIMA 2OPQA 3N01A 4ETZA 1NDLA 1PIEA 5J2MA 1GAOA 3ILLA 3CCMS 1XIQA 4DV4J 2ZHOA 2E1CA 3C15B 2W4DA 1PYOB 3DRYA 4ZP8A 3EDRB 1UVNA 4F0HA 3K5MA 4U7CA 4X2BA 1H0HB 4DCOB 4M5HA 5KG6A 1Q7YT 1ZTWA 1TL3A 4X66F 2CQ1A 3AXMA 4J91A 2XMWA 1AFJA 2XY5A 1TUGB 4FNIA 4LF9J 1HYSA 1A6LA 2AGOA 4IOAQ 4L75A 3C16B 3L95X 1M1GA 1JJHA 2MEWA 1H74A 2JVRA 2OMOA 5LJ3Y 4WP3A 3N6NA 1V5VA 5CYJA 2UVVA 3UNGC 3Q89A 4OX8A 2KFYA 3DKDA 4XAKA 3M9OB 3GSIA 1IM6A 2HNYB 1IR1A 2RNEA 3RAXA 1FF2A 3TEGA 2VFUA 3SIPB 2Y1JA 4NYZA 1XWLA 2CUYA 3GJRB 2V8PA 1BMQB 1N88A 5EGYA 2V4RA 2G9OA 3C6TA 1X0PA 1JK9B 2R4FA 3ZZTA 2FZCB 1KKHA 5B0BA 1NJZA 3KLIB 4X4QA 1RQ0A 2XLKA 5AXLA 1FK9A 2DITA 1LWEA 2C3PA 1N5YA 2MHEA 3IS9B 3N6LA 1N48A 1YLXA 3PW2A 1QSYA 5HVFA 2FLPA 1WF2A 4TXSA 3CPWR 1H2TZ 2BANB 2Q1LA 5K20B 2ZBIA 2XMTA 1MMNA 2XI3A 2W9CB 3HHKA 2BJ7A 4DX5A 1TK5A 3GZ7A 2C2MB 2VQEJ 2FJXA 1P1TA 3LPYA 2E5IA 3QMQA 3OL8A 1Z1ZA 3CD6S 4FVCA 3CULA 3PO4A 2WK4A 3S01A 3MEGA 1IKVB 5C42B 3MPYA 1EAYC 1LNQA 2VG5B 3NWRA 4DG1B 4OLOA 4C11A 1CS4B 3QPIA 1IN0A 5F8HA 2VA3A 2B9WA 2FJEB 4PQUA 2RF2B 5KOWA 2E29A 1X4HA 4KJIA 2ZKTA 3QQCD 2C22A 1RTDA 2A2CA 2MKSA 1HR0F 3M2RA 3L09A 3SV4A 2CWXA 3EVMA 3UD3P 1WUUA 2HQIA 2KKHA 1ZM3A 1UPPA 1XMBA 3NP5A 5KT3A 1U6BA 2CIMA 1RT3B 1R6VA 3H7HB 1KTQA 1K44A 1GEHA 4ECUA 4DU7A 4UY85 3PM9A 2Q79A 4DX7A 3T1HJ 3NGTA 1SQGA 2O5DA 1CG2A 4CM2A 2LEBA 5CYMB 2CPFA 1EP4A 1OY6A 2XCPA 2MMYA 4DR1F 3HP6A 2QYCA 4ETXA 3W61A 5GAGI 2Q66A 4JV5F 1APSA 3WBZA 4GKKF 4LJMA 1CJUA 4OYZA 4UTGA 4LFAJ 4UW2A 3OR1A 2OLWA 2DGQA 3OLAA 3NWGA 4KR0B 1S4FA 1IBCB 2V8VA 1GH8A 4F02A 3V4IB 2FVPA 4MKYA 3L9ZA 4DX8H 4O4RA 3KK1B 4DR4F 3PXGa 2X1FA 4V19J 4NLUA 1B0PA 2GJIA 4PPZA 2B4UA 3A8IA 3TJ8A 2AJ1A 5E33A 2CYYA 2XSJB 4WZMA 1IBMF 1FHTA 2W4PA 4N76A 2W2PP 1S72S 2RRNA 4X4RA 4QQBA 2A6OA 2UXDJ 3AXKA 1NRKA 3OJSA 1XNRJ 4ZCIA 2ZH9A 1T03A 1FRIA 5IOLA 1VLOA 3EYZA 1VQYA 4IO1A 3ADAC 2DTJA 3DNCA 4IKAA 1TUWA 4NASA 2VG6A 1CJKA 3CXCR 2DHGA 5C7PA 3GYGA 5IT9Y 4JI4F 4ZVSB 5HQ8A 2DIUA 1WDDA 3TEHB 3M1VA 4X65J 1P6TA 1H38A 5IV3A 2J9DE 3HVTB 1S76D 2CQIA 3M6UA 3R1LA 4DV6J 2YWEA 3CCWA 2HIYA 1X4AA 4EEYA 4ZPBA 2M70A 3ISZA 2YWHA 5IC6B 3QZ7A 1WSVA 3L7UA 3GU0A 3NOGA 4OX9F 1U7LA 1N6QB 3ZTPA 3IRXB 4DQRA 1SKSA 5B0CA 2H5IB 4DPWA 4ZK7M 1YZ7A 3GYXB 1SCJB 2KRBA 4LSLA 3DMJB 4JI7F 2FLOA 3AJDA 3QFHA 4DFKA 2UP1A 2HAIA 3P4UB 5I4MA 4ID8A 4CLSA 2XO6A 4NEZA 2ZH6A 3B54A 4DL2A 2J0WA 2J76E 4DPTA 4OI2A 4IFVA 4DDFA 3G6VA 5IWAF 3TO8A 5J1EA 2XBPA 5AE1A 4HLBA 4O4GB 2NZ4A 3I0SA 4DV3J 2LEAA 2B8QA 2Y8YA 2OKQA 1KONA 4KYZA 2WHOA 1Z4UA 1LW0B 3FNNA 5GAHU 1RHQB 1MLAA 1OQ3A 3EGWB 2R8GA 1Y10A 1YQHA 5KFBA 2DNLA 3FK4A 2OELA 5DZ6A 4G1IA 1AFIA 1BQNB 1EARA 4AYBD 1DLOB 2OIHA 1RT6A 2ZH3A 3AODA 2DVIA 2RS8A 1NK4A 3JQKA 2DH7A 2Q6BA 1YBUA 2ZOGA 1S5ZA 1R3NA 3FC9A 1I94F 1L3TA 3C19A 4JYAF 2CQHA 3NOCA 4WZQA 3U1MA 4ZP9A 2Q3PA 1U0HB 2C28A 3MMCA 3GIIA 1LWXA 2A10A 2XEXA 4L6V3 4FKYA 4F4WA 4ECRA 4ID5B 2KT5A 1R8HA 2AJ2A 2E5GA 1Y3JA 4ZVQB 1IBLJ 3MCOA 2B3TB 1RJJA 1FTRA 5T41A 2L9WA 4RLEA 1FKPA 5DM7Q 2XYGB 2K1RA 3W9HA 2V63A 4QU6A 3AAWB 4NLQA 3IA0A 4ZPCA 4KHMA 4FPRA 3EZ5A 2GA7A 4AT1B 3MM7A 1AUSL 3NMRA 3DOMA 3OUYB 1SC1B 3DLHA 2JFKA 3E01A 3HHLC 1YBTA 4ZVUB 2N3OA 4GKJF 3QGPA 4V19X 2WB1D 2HBRB 4PG7A 5HROB 2W2OP 3R5AA 1RAEB 4F4XA 3BQ1A 4DSEA 4TKTA 3H40A 2J9CA 5KFRA 1L3SA 5HATA 2BE2B 3DN9A 1NK5A 3H20A 1JLBA 4DUYJ 3BYPA 3W7BA 3PZPA 1VR6A 3X1LB 3FCWA 4JI8F 2OI2A 3POTB 3SQGA 2ROGA 5DDRC 5A2QY 2K7JA 1AZSA 3R7NB 1VDHA 4PXDA 1UW4A 3QT8A 4P7TA 2GHPA 4B3OB 4ZN3A 1WF1A 1SC6A 3ICLA 4B3RF 3HHNB 3SZ2A 3UFCX 1NSAA 4AUKA 1YJ7A 4MK8A 4ZVGA 1Q5VA 4C3KA 1FI4A 3QLHA 2BJEA 1D09B 3MM5A 3SFUA 3AOBA 2CQ4A 2Y1LB 3ILOA 4DN0A 5AE2A 4OYMA 2DNMA 1SPBP 4PWDA 4M1KA 2E66A 3TZYA 4DV4F 3NRBA 1VHIA 1LWCB 2KVQE 2BKOA 1FRMA 2DR9A 1VIXA 2A1BA 1GNKA 4EWTA 4F04B 1H7WA 5DLGA 5DGAA 4BHQA 1U1LA 2E7XA 3MMBB 2MY8A 4FYYB 4DPXA 4V1Ak 4TLQA 3TVZA 4Y2KA 2QE5A 4ED5A 1VK8A 3DM2B 3V6DB 4LF9F 1JXEA 1RCXB 3SDEB 4LF5J 1J5EJ 4OV6A 2DXEA 1T7PA 2YKAA 4KIAA 4RX6A 2IA0A 1JLCB 3A4TA 4J9UE 1UTAA 4M5DA 2RAQA 1ZPVA 4M5LA 4W90B 2R7WA 2V8HA 4RUHA 2BUNA 2OFGX 4YFUA 2XMVA 2E7VA 1TFWA 1WACA 4ZPTR 3W63A 2B4VA 1KRPA 5LL6d 5E2QA 2IHR1 1RU2A 3MCMA 1UJ4A 4U8VA 4M94A 2QMUB 1DRZA 4J9PA 2FD2A 1DAXA 2OPSA 2LQJA 1SC4B 4OJ3A 4WFNQ 4ZLNA 2V4JB 1HMVB 2AMCB 2HGLA 3KK2A 1VIOA 3SEOA 2VA2A 4DF4A 3PEJA 3T1YJ 3OFEA 4J9SA 2HLTA 3MM6B 1GMWD 2DRBA 3VAIA 1FCAA 2HVDA 4P75A 3OSPA 2F4VJ 3C46A 4HT5A 4HACB 2QX0A 2OHDA 2BQ3A 3T19A 2EEYA 3LP2B 2HS4A 3DLLQ 5C2GA 5HVHA 2B7CB 1U49A 4KQZA 1MMLA 2FIUA 1SQFA 1XBWA 2W9BA 2MTLA 1EQ0A 1Q53A 4Q5VA 1XERA 4ICLA 2VQEF 4KFBB 3ILJA 2KL8A 1IWAA 1YJWS 1E6YB 2BABA 2OAUA 2D3UA 3I32A 3PYDA 1BXNA 1F2GA 2OO4A 1G3OA 3PJWA 4M5MA 5FLXY 3G6YA 1KOOA 2QL9B 2CVIA 1WI8A 4PCQA 4Q0BB 3IBFB 2PT0A 2VJVA 2ZWOA 1SL2A 5KG2A 3TJAA 2DHXA 2W2MP 3VZHA 1D8ZA 5IM0A 4K4TA 1T05A 4LREA 2ASDA 4ECSA 1QD1A 2CPZA 4DPUA 1NPKA 2MKCA 1Y5LB 5D0RA 4GRSA 5D8HB 1S6UA 1FO1A 2HNDB 2WW4A 1SH2A 4HTIA 3CCRS 2XY7A 2DR7A 3DYAA 1S9FA 3NS7B 2V6AA 3QIDA 5F3TA 1S6OA 4B9UA 4DR2J 1JNZB 2P2CB 5KFOA 1D1UA 3T1HF 2ZC4A 3MUVP 5KFNA 2BKPA 5H9EJ 2WOMB 5J2NA 1DTTA 3WZ0A 4X4VA 3VGSA 5AT1B 4FYVB 1F5AA 1RAHB 2XI2A 2HGNA 4O0NA 2Y1IA 3HZEA 3FSIA 1VISA 4LFAF 1LK5A 2CA9A 5KFPA 1KC8T 4DOZA 5H9FJ 5JMNA 1B7YB 4JI3J 2KJWA 2DH8A 3EMTA 3DRRB 2OUGA 2UUAJ 1BE4A 2BRKA 3P6YC 3ENQA 2DGOA 5D78A 1CC7A 4ED2A 4N56A 4P6QA 1WHXA 1VJWA 1LK7A 3BH7B 2RJZA 4ZJOA 1HPZB 2QEXS 2C2ZB 1TUVA 4DL5A 3G8QA 1IUJA 3UW1A 3FEYB 4I68A 2HURA 5KFQA 2BMBA 3HFZB 2JEIA 2K3IA 1U0SA 1QDUB 1TV6A 4NZ0A 1RGVA 2ZH7A 1YJRA 2V2KA 5HK4A 1TKXA 2JNJA 1NK8A 4ILMA 1ZTTA 1K73T 3HFVA 1BLUA 4BWJA 2A18A 5C42A 2UXDF 2KFNA 3HK2A 1B3TA 4MKVA 5F8LA 2YH0A 1AB8A 1HBNB 3GIJA 4K4UA 2BM0A 3TOQA 2UXBJ 4X4TA 2AV5A 3T3FA 2CKWA 2POKA 1XJWB 2HFUA 4X4UA 3VGVA 4A46A 2DISA 3PTWA 3R9LA 2RHQB 1Y0HA 2ASLA 2Z58B 3DCAA 2IJRA 3MD1A 1FX4A 3M9NB 4ANDA 4X65F 3MTKA 2WONA 5U47A 5K14A 2ASJA 4QW8A 2QIFA 2HFOA 3M8ZA 4DV6F 1RWXB 4TY8A 2XYPB 2PMWA 4R5PB 1IJEB 3CJ3A 2MQ8A 2WVBA 3IN5A 4UF4A 4YMEA 2DY9A 4CLFA 2NYHA 3NAIA 4UT4A 3H5SA 3R5CA 1RADB 1NJWA 1X5TA 1QSSA 3GQCA 3IR6B 2VDIA 3J80U 3VAHA 2B5JB 3MI7X 2UUBJ 5CYMA 2C2DA 4JBCA 4PG4A 4ED4A 3VR1A 5DG9A 1A9NB 3IWXA 4DSLA 2W7PA 4FDFA 3PO5A 1U26A 4GO5X 1HBUA 4MYUA 4AL7A 4OZLA 4RNMA 3IAM9 1Y5IB 3DHXA 1UFWA 3R1HA 1F9EB 2ASYA 1NDPA 2VL1A 2AJQA 2KXFA 4I6WA 1EZZB 1OQ6A 5C25B 3PW5A 3DLGA 3GV8B 2FGCA 2J6TA 2W9AA 4DCJB 2XGQA 3QGHA 2R2SA 4QWEA 4Y2CA 1KN6A 1S7IA 4DL0C 4LR9A 1RAGB 4NRTA 2JJ4D 3I4PA 3L7PA 3MTJA 1RWOB 3ZZOA 1SJQA 5DG7A 5K8MA 3ILIA 2DD8S 3HSJA 4C8MA 3VCDA 3OR2B 1G1XA 2HQDA 3QSIA 3WIUA 4OYPA 1RACB 1RAOA 5ITHA 3DLEB 3BF4A 1KLMB 2V69A 4H4KA 5ETPA 4H4OA 4DL7A 3LOUA 3DOLB 3IWNC 4WFAQ 4FBUA 2GNKA 3KLVA 3PKYA 3K8WA 3QWUA 4IDKA 3GG0A 4N5SA 4DQQA 2YNGA 2JRSA 2DO0A 1IBLF 1HI1A 4WXOA 3OJUA 2R7UA 1PG5B 3W9IA 3U7JA 4ZCKA 2BJ9A 3N5BA 4CYUB 2C3MA 3I82A 3OFGA 5J2QA 3B78A 2R2TA 2R2UA 2GVZB 1CJVB 1FE0A 4IG0B 2FC9A 1ZETA 3HMJG 2CQCA 2Q6CA 1FNXH 1HNZJ 3R7SB 2DR5A 3KHRA 3HI9A 1N6QA 2HVIA 2XB2D 1ZM4A 3A12A 3UPFA 1U4BA 1RWUA 5A8RA 3PX4A 2RDIA 3CF5Q 1RBLA 1JKHA 1O5JA 1TL7B 3D1QA 4CNZA 5KFYA 3TP2A 4OZ3A 2F40A 2HMIB 2Z0GA 4RNNA 2L9NA 3R27A 3ZC4A 3MMAB 1S6PB 3Q86A 2XLJA 3NY0A 4AFFA 2MQMA 4M63A 1OYDA 3M7VA 1Z2ZA 4PG5A 1Q8KA 3DOKA 2BR0A 1BUXA 4KGZB 2ATCB 2DNNA 1DTQB 4ZVOB 1HQEB 3V5RA 3I5BA 5KFHA 4F50A 4OX7A 1NK9A 3TZZA 3TVKA 1GMVA 3H8YA 4WXWA 1PYTA 1JB0C 9RUBA 4Y0FA 3JSYA 4DZ6A 3SCKE 4ZJQA 1QY7A 1V3RA 3JQJA 1RWNB 4TNOA 1RLCL 2FTRA 4RNOA 5F9NA 2M3DA 1X9SA 1HNVB 4LF5F 1J5EF 2G1DA 3LP0B 4ID5A 1R7IA 2FLLA 2Y9HA 1HNIB 3I4HX 5I3PA 3DLKB 4XDDA 3V2UC 1S1VA 4ZJLA 2YX4A 3J81U 3TUIC 4ILLA 1HWJA 4FP9A 1WC5A 2IVMA 5EWEA 2AZ3A 3GB0A 2F1FA 4C3LA 2XM3A 3MURP 1OJ4A 1HHSA 1E6VA 3LUYA 2EG1A 1M5OC 3M6WA 3I5AA 4MIBA 1B0TA 2BQUA 2GJFA 1U24A 3MM9A 4PKDB 4U7UK 2WB4A 1RTZA 4OYWA 3PVXA 2CG4A 3R6LB 1MSWD 4F36A 2QG9B 1F5BA 3MCSA 1NK0A 4KY3A 1P9QC 3CDUA 3AD9C 3T1YF 1TKTA 1W26A 3ITHA 2I5JA 4BLGA 5D6GA 1TL1A 2UVUA 4ECXA 3GV5B 2ROEA 4NMLA 1FWKA 3AJ2A 4DBQA 2CRLA 4FNHA 3A3OB 2OH2A 2FY1A 4JV2A 3BSOA 2XNRA 5M2RA 4I7FA 4WP9A 3DGPB 1U2CA 4OHXA 3MR7A 1K0TA 4CRJA 3ELHA 2HKEA 2QSWA 2UZAA 3AD7C 1RT1B 2CNKB 4CT8A 3EVOA 1WF0A 5K8OA 1RK8A 2EPIA 5LT5A 1RTJB 3IAS9 3P5BP 3AFGA 4ZPVR 1OS5A 3G6ES 1KQKA 2XULA 2F8MA 1FWPA 5HMXA 4CLLA 1K1QA 1XQIA 2XSFA 2KTQA 1VK3A 3MECB 3TYTA 2CJYB 2D3OR 1M5SA 4ZCMA 4DV5J 2B56A 2CPIA 2VDHA 2UVWA 3D54A 5LXYA 1RDRA 3NNAA 2P8IA 4QR2A 5LSRA 7FDRA 2J6SA 3DGVA 3CCTA 4HR2A 1HBMA 3J7A1 5RUBA 1EETB 2OJ3A 1C0TB 1N34F 2U1AA 5DZ7A 2EW9A 1JXVA 2BBEA 4F2RA 3HVAA 3ENAA 3RRGA 1N0UA 1UMJA 2GIQA 1TU0B 4LSNB 1K9MT 2YKMA 3RW7A 2UV8G 4RW6B 3CT9A 1FX2A 5CYQA 3MUTP 3T5HA 4DR2F 2FVRA 2LYVA 2O67A 1GMUA 3UWTA 1IKWB 4C8KA 3Q8YA 3U1NA 1S1UB 1LWFB 4MJKA 2HFVA 1C4AA 2OD6A 2V8GA 2Y1RI 3KMSA 3TAMA 3VQSA 4J9QA 4LF7J 5KT6A 3A1YG 4WE1A 4NZ7A 2V4JA 2NREA 1REVA 3H5UA 1X4GA 3LP1A 4K0KJ 1I51B 3K8VA 2MLYA 4AQYJ 4NRUA 4CLPA 3G86A 2FDNA 5CAAA 2GX8A 5G4DA 4I2PB 3K17A 2FJVA 3R2DJ 3BGRB 1VBZA 2OFHX 4HI1A 4K2XA 1NDKA 2FYXA 5HANA 5GADU 1Q95G 2CAJA 1SJ1A 4OI4A 3RU0A 4WYWA 3Q24A 4Y28C 3BSCA 1J5OB 4CO2A 4YR3A 2FVQA 3ZXWA 1URNA 4P7VA 4CZCA 3M2VA 3J81j 1S0VA 1HARA 4C48A 4OZ0A 4L74A 2MZTA 2VFTA 2ZJRQ 2OGUA 5EN1A 4PXBA 3UD4P 3D0IE 1VQ6S 1U1KA 2MGZB 5B0EA 1WG4A 3QIPB 3N6MA 4F4AA 1Q86T 3HD2A 2WVCA 5D0HA 3HSGA 4XPCA 1UEKA 1NK7A 1VRTB 2UXBF 2IAJB 3IBWA 3KK3B 4GVBB 2VKRA 2WRMA 3RBZA 4Q0BA 2ATLA 2N82B 3J7YU 5KFUA 2WSEC 4NLDA 5E3RA 1RT7A 2P6TA 2NUHA 1LXNA 3KKFA 1NZAA 2RRBA 1KR4A 5ETVA 1WWHA 2AT1B 3G87A 2HZCA 2LA6A 2DNQA 1QVGR 1M5KC 2XY6A 5HBMA 1RTHA 2EG2A 5HLFA 5KFMA 3ENVA 4UQTA 2JZ5A 3MOJB 1G6BA 2JX2A 3T6JA 2P9GA 2KH9A 3T5JA 3BREA 1RBOB 1T9TA 4FKXA 2HRUA 1YRTA 3RRKA 4D3GA 1FFWB 1KFSA 2DT9A 3MOZA 1Y4ZB 3FRZA 2DXDA 2R7XA 1WOPA 2BEFA 2DR8A 3ZNUA 1Q0NA 4W98A 3W65A 5KG7A 1SUQB 4OZ5A 3ETOA 4LQ9A 1RT5B 2G2ZA 4L76A 1KS2A 1S1TA 2OEMA 1B0VA 1F0XA 3GJTB 5DS7A 3QRQA 2HBYB 2B8PA 2ZFHA 4R8UB 3QRPA 4OYIA 2QA2A 2RSQA 2CQ3A 3QJLA 2BYCA 1OIAA 4UUXA 4C8NA 3SYZA 1IKYB 3N0VA 2XS2A 4F4YA 1CJTA 2O01C 2E5HA 4IUFA 1WC1A 2GZOA 3M32B 1RHUB 3NNCA 3GFZA 5CHCB 3OPKA 2RT3A 2BRLA 3L7OA 3NBPB 1I5OB 2XWXA 3IGNA 4XK8C 4EO8A 2YKNB 2HZVA 2UUCJ 3EZOA 2YNFA 3UDCA 1ZH5A 2IVYA 4DV1J 3NG8A 2CZVC 2MQLA 2F4FA 1C1BB 2ZH2A 4ZHRA 2W25A 2JEFA 3MAHA 2AEMA 2YNHB 5CCMA 3CO9A 5E3QA 5I3UA 3QSYB 3X3UA 1FXRA 4FYXB 4PG8A 1N33J 4WWSA 2PI4A 3CTRA 2V0NA 1U48A 4PUOB 3MEEA 1H3DA 4WFZA 2H5EA 3UR3C 2LCWA 1UEUA 1HWIA 2Y0BB 3G96A 2B6AB 2IA6A 3TI0A 4ZVRB 3OTCA 3T5KA 4B9VA 4H4KC 2HHWA 4DUTA 1ZAWA 1JLAA 2NXUA 2W2QP 3FGVA 2BA9A 3RB3A 2AYGA 3EM1A 2RU3A 2QA4S 1WOSA 3D6FB 4IO9Q 2VHGA 1NPRA 2IBOA 1JLGA 5JUMA 1YIJS 1HNZF 1NSPA 4TU8A 2VG7B 3D28A 4JP8A 1RAFB 3RUBL 1CULB 1UWBB 3VAKA 3WHIA 2XZDB 1W2IA 1FKOB 3OVAA 4EZ6A 3A3PB 2DNRA 5KFXA 4JB8B 4DR1J 3UNYA 1YTYA 2UU9J 3W2WA 4DR5J 4Q43A 4OJHA 3OXFA 2MDAA 3V81A 4N8OA 4N7TA 3FSYA 2HFSA 3EDQB 1BC6A 4CTAA 4IG3A 5G0RB 1Y3KA 1OYEA 1S6QB 3S6EA 2VFVA 4HH1A 2FJBB 4CM0A 4QYRA 1JLQB 3D6MB 3RZAA 1FJEB 2OEJA 4USTA 3Q23A 5A6PA 1S9EA 2ZC3A 3CIZA 3C6UA 1QAJA 2IM2A 3UVJA 1N4LA 2MY7A 5D15A 1I1GA 2LQBA 2Q43A 4M5NA 1N52B 2ZBRA 1N36J 2HBZB 4LSZB 5H9FK 1NKBA 4IRCA 3JYTA 5AXNA 4DPYA 2UV8A 3ZO7A 2YNIA 4K2JA 2HWTA 1R8CA 1ZA2B 3CCZA 2RILA 1JX4A 3TUPA 2L9DA 3KLHA 4RBTA 4TYAA 1YDLA 2CPHA 4RUAA 1IBMJ 3J7ZT 3PACA 4DL6A 3ET6A 1LFWA 3W2VB 5MAOA 1WEYA 1WEXA 3ENWA 1ACMB 1EHWA 2Z8QA 3GYNA 4USKA 3SCIE 4U96A 4NX9A 3ISND 3JAMY 3IG1A 4DQIA 3B82A 5E7OB 3MM8A 5DGBA 4ATNA 1JIHA 4JI4J 2M4MA 4USJC 3M8PB 2LECA 1VQPS 2GGPB 3RR8A 3H0PA 5KFTA 2X51A 4MT1A 2MQOA 3L3CA 2IYIA 2JOQA 3ZTOA 1FRHA 4I64A 2MZRA 3PX0A 2GVDB 2K3KA 4A8OA 2IVFB 5DQIA 2GVZA 3FFIB 4O44B 4DV2J 1VBYA 1DY3A 3HKZD 3CNQP 3FQLA 3RBDA 1NSQA 1RHKB 2HHTA 2IC3A 1FVSA 3MR5A 1GT8A 1U8WA 3QO9A 4PYDA 1O0PA 1FDNA 2RS2A 1FD8A 5EX3A 3OL9A 3TRGA 3J7AN 1DQ8A 3MPUB 1RB0A 3UCUP 2PI5A 2C3OA 3UI3A 4HKQA 4BC7A 1GK8A 3MHYA 3RYLA 2FHKA 4URSA 1HFEL 2GQQA 3D5MA 2RDDA 4LBHA 4K4SA 4Q7AA 5IT4A 4A8WA 3GR0A 1IKXB 2G1HA 4E98A 2H54B 3ONQA 4FYDA 2HNZA 5IWAJ 3G4SS 5BYRA 3N28A 1PO6A 1K47A 4P10A 5L9XA 1RABB 4IRKA 5E3PA 4J9MA 1G7CB 3UD5A 4I56A 4X4SA 2ZWPA 1S59A 3KUHA 3TX8A 4LRAA 3SSQA 2CJBA 4A8YA 4IRDA 1NJXA 4CLYA 2JWNA 1VQ8S 1RT2B 4HT7A 2EVZA 2GS8A 3M6VA 2APOA 1KBRA 1Q16B 3MAAB 2GMHA 5DQGA 2N4CA 2DNOA 1VC5A 4UOHA 4USVA 1XTZA 1HBOB 3BYRA 2VPWB 4B9TA 3CDBA 1S0OA 4YS2A 4YR0A 2ALZA 4MFBB 2PIIA 4KGXB 2HYIB 4ED3A 1WJ9A 1XR7A 3OTBA 5L46A 4NL5A 3RAQA 2W01A 2HQ3A 5A76A 4KHPJ 5IT9U 3R5DA 5B0GA 3HHLA 1TFYA 2KM8B 2Z2ZA 2DGVA 4P72A 4OI1A 1FTCA 3BH6B 3I5CA 5F9LA 2FGOA 3SQOP 4DSKA 4NI2B 1Q7LB 2YKOA 3JSRA 4ZVHA 4B17A 4LF7F 2BZ2A 4NEYA 2QA4G 3BEGB 1U8SA 2DGTA 4DSIA 3LGMA 1DFDA 3G82A 5D3GA 4DMZA 1ITPA 4B9SA 5E0OA 4RNFA 1FXLA 2NXCA 4K0KF 3JXOA 1YZ6A 3BKTA 1HHQA 1RUSA 3CJSA 4H4MB 3PV8A 2XWYA 4AQYF 3GPAA 2F63A 3BBCA 2KHCA 1OSCA 1VGYA 3I0RB 4RW9B 2I38A 2VV5A 2LQ8A 1HI8A 3JSMB 4M8LA 3BPSP 4URQU 5DDPC 1AYEA 1CPZA 2MZ1A 4KV8A 2HHXA 2XYHB 4YHHJ 1FKAF 1PJ5A 2DCLA 3WIVA 5F8MA 4ZN1A 2JLEA 4WIQA 3UN3A 3WC2A 2WSCC 1TAUA 4WU2A 3PW4A 3VQTA 3DU6A 4YB1P 4PYAA 3K5OA 3UDLA 2HHUA 2AWZA 1LFPA 5T7LA 2FVCA 3NGUA 1H2VZ 1NO8A 2CDQA 4LFCJ 2WZ1A 2NSCA 4LVNP 3VAFA 2Y3YA 1JXLA 2QSFA 1RTIB 3O5TB 4ANCA 2W2NP 4B08A 5A8WB 4LBIA 1ZS6A 2ZD1A 2ZE2A 3OT9A 1Q79A 3M2UA 2M7SA 1RYSA 1URRA 5FDLB 3KLGB 4X64J 4DL4A 3QNWB 5B7WA 4OJGA 2R3VA 2KXNB 5F8IA 3OFFA 4PRFA 1IXKA 4ZVFA 4J9VA 3RG6A 2YWFA 1UJ6A 1S1XA 2ZHBA 3DRSA 3OLBA 5L1IA 3V6KA 3SXLA 2CXEA 2YH1A 1MU2B 2NXJA 2R8JA 4RL1A 2PFDA 3B4MA 2X1BA 1FJCA 4I2QA 1ELOA 5KG5A 1Q82T 3BSAA 4HYKA 1GQEA 2DK2A 5IS2A 1MMDA 1KHWA 2C1EB 1U2FA 4KH0B 4KKOB 1U45A 2YQ1A 3HVRA 3M8QA 2OPQB 2DBBA 3VHQA 1YJNS 4HDGA 2A0FB 5J2MB 2F3JA 3DXSX 1NXIA 4NCGA 1NH7A 3HFKA 4CH0S 2SXLA 2E1MC 4CO1A 3MR2A 1PAUB 4ZMMA 3QFWA 2WCXA 4K4VA 4XPEA 3RBEA 3CJ5A 1TL3B 2BM1A 4NMXA 2DY1A 1N5SA 1CLFA 2ZNZA 3TANA 2D9PA 2DXFA 3CJ0A 3M8WA 1SL0A 4KH1B 1UW9A 5A2QU 3SCJE 3A13A 5LM7E 3CD5A 4DL3A 2ZH4A 5F0WA 1N32J 4OYOA 3EJMA 1WHWA 4QW9A 2UUCF 4A8KA 5HL7Q 2VQFJ 2QYGA 4DV1F 1N5VA 4LRFA 4ZDNA 4LF2A 3GLJA 1HD1A 3HHDA 2B9YA 1FJ7A 5M2PA 3VAJA 1QUPA 4XTTA 1YG0A 2IJNA 2EKNA 2KYZA 4QWAA 4OHWA 2E1RA 3D0HE 4TYBA 4M5JA 1S99A 1CQNA 4DS5A 1YSJA 2QLFB 1N33F 3C6TB 2J9DA 1W7WA 4URGA 1PSDA 1Q4RA 4MIAA 2R8HA 5CD4A 1VRUA 3M30A 4ILRA 3MPVA 1FK9B 1LWEB 4R25A 3R3TA 5KT2A 4BC9A 4KRWA 1N5YB 2FJWA 2MLZA 4RJVA 1B64A 4QR1A 2O3DA 4MAKA 1S12A 4I1TA 4ZP6A 1TR0A 1T3NA 4KPYA 2CJQA 2HIQA 3QATA 5M2UA 3UCGA 4H54A 1GXTA 2H48B 3LALA 4IYQA 4UZCA 4YN3B 1KQSR 1BQXA 1JWWA 5C5JA 4ECYA 1S77D 3QZ8A 3VALA 1X9MA 3MEGB 5A0YB 2UU9F 4C11B 5KT5A 4DR5F 3WX4A 3OTOF 1T9UA 2PGCA 5J2PA 2AQ4A 4PQUB 1S9GA 4Q8FA 2I2YA 1S7HA 2NUUG 1RTDB 5HO4A 3BB5A 2JLFA 3M2RB 3KOAA 4LBPA 1RKIA 2EKYA 1KQFB 1UFLA 2K06A 4QZVB 5A8KA 2AYEA 1P8GA 4ECZA 1N36F 4TLRA 4OHVA 4X4PA 2W8LA 2MQQA 4ANEA 4F0KA 1NHVA 3AQPA 1TK0A 2AHOB 3S1TA 2R7VA 2QL7B 1KP6A 3I9V9 2FB0A 3ZTRA 3H5YA 3MFHA 2P9CA 1OY8A 1IQTA 3MAQA 2PN6A 1EP4B 3UN5A 2HBQB 4RUBA 1NKCA 3AH6A 1F2HA 1LW2A 3PYEA 5D0EA 2YBVA 4LF8J 4USUA 3H90A 5FLXU 2BJ3A 4L73A 2AEJA 1CJUB 4L3KA 3K58A 5KOXA 4C8YA 3OR1B 1H72C 2LU1A 3K59A 4ZPDA 3KLEA 3PKMA 5CA5A 4HDHA 4C3MA 2N4DA 5DLFA 1F9HA 3RB6A 3R5GA 1J2VA 4EBEA 4L72B 5KFEA 2IBKA 4PABA 5D0GA 4S0MA 3JTOA 3PW0A 4RZRA 3MXHP 3KLFA 2H9ZA 1X0FA 2DHHA 1T9VA 4CO0A 1T95A 4DV2F 4J9OA 2OPPA 2DR6A 1PC5A 3PY8A 1U6ZA 1F3VA 3DXBA 1RP5A 1RXOB 4JI5J 3QWPA 4MYTA 2D69A 3IM9A 1NB2A 1N0VC 3VGUA 2VC0A 4WBFA 1P27B 2PFFB 3JTNA 1R31A 2CG8A 4B3TJ 4X4NA 1O8BA 3CJKA 1LXJA 2Z30B 2D7SA 2RKIA 1T03B 2HRTA 1J27A 1RT4A 2B4PA 3CW2C 2VG6B 1CJKB 3FDSA 2Z2YB 1YI2S 2H4YB 3M8SA 2KJVA 1BWVA 1WELA 3EGZA 2H3EB 3J81Y 1IR2A 2V9WA 2K7KA 3M1VB 3P3DA 4JV0A 4ELTA 1TVRA 4KT0C 2WSFC 4KO0A 4KGMA 5FD1A 3BDEA 4FS2A 3CC4S 2DHSA 1OMSA 3K5LA 3H59A 4USHA 3TX0A 5KFAA 2COLA 2ZM6J 4O3SA 3PR4A 2AIRB 2W7OA 2PMZD 1QAXA 3HX9A 2ABYA 4LFBJ 4A47A 1R8PA 2FZGB 4LSLB 5I42A 2RVJA 1AT1B 1VC6A 3TQEA 4G1QB 3IGVA 1HQUA 3LH2S 3CCJS 2P5VA 2C3UA 5J1EB 2OMLA 2CQ0A 4IFYA 3HLUA 3I0SB 2RIJA 4X62J 2EFQA 4KHPF 1UZHA 4YP3A 5DM6Q 4PR6A 1RCOB 4P71A 4DI6A 4USWA 1ZZNA 3ZTQA 4QR0A 2GGPA 1QM9A 4F67A 2E1AA 1C0UA 3VV2B 1YJVA 2GVDA 2YKPA 1C1CB 1OPZA 4JI2F 2V34A 3FCHA 1NPPA 1HA1A 1RT6B 1WG1A 3KJVA 2J7UA 1CVJA 4LMZA 1F60B 2CPXA 4C6AA 1NM2A 3RTVA 5DRKA 3US5A 2NCKL 4BCAA 2RQKA 2C2KB 4CLTA 1HW9A 3Q0AA 3D9BA 4DX6A 2AJFE 4Z2XA 1WOOA 5KG4A 3MMCB 3C14A 3EXCX 4EYIB 4LRBA 3CJTA 3RGIA 4C9DA 4FVMA 4RW8A 2CQBA 1LKZA 2QN6B 4RW7A 4YHHF 2E9RX 2GFFA 4CQ1A 2YWWA 1FDBA 2WVDA 4CIOA 4HVZA 1JLFA 1KEKA 1FKPB 5DDOC 1A7GE 2K1RB 3NKYA 3DRPA 1NZ8A 3GG1A 1FDDA 3AHPA 4FF1A 2HRYA 2VUGA 1R6YA 2YX1A 4NLPA 4LFCF 4YR2A 4BS2A 2A6MA 3KG0A 4P2FA 3MM7B 4Y65A 1MROA 3DOMB 1PILA 3GFYA 5HN0A 2M8DB 3VVTA 1GMWA 4NYOA 3E01B 3KUGA 3LWMA 3QRRA 4I69A 1CEZA 3BSNA 5BYSA 2HGMA 4B3SJ 1SIWB 2BE9B 3G8TA 1BQMA 1EIYB 1IJFB 1XR6A 1RE1B 1RWVB 2EFOA 2O66A 2HQCA 3MUMP 1JLBB 1X5SA 4QYZJ 1AA1B 2HSEB 4X64F 5CXTA 1R8BA 3TR5A 2GO9A 6AT1B 3SQGB 1KOHA 3IXQA 3PCOB 3MR3A 5HP1A 5F8NA 1AZSB 3DLJA 4Y2IA 3A8EA 2PEHA 2V8DA 3Q8SB 3H98A 1TMJA 2WBRA 3CO0P 2AGPA 3FVYA 4HHHA 2MKYA 4PG6A 3AB2B 4DR7J 4OFZA 3GP9A 3JS9A 2D9OA 1TP7A 4GC6A 2YKQA 2RHSB 5LJ5Y 2HQGA 2GC8A 4FBTA 2IMOA 2CDRB 3BQ0A 2IDEA 1R0AA 1FA0A 3QLHB 3MM5B 4R0EA 2G0JA 1FE4A 2WTFA 4NLRA 3D3CJ 4WF9Q 1WHYA 1U1OA 4PWDB 3VGTA 2VPXB 2OPRB 1TZ0A 3CJ8A 1SH3A 2D1CA 3LQVA 3DI6A 2A2DA 3BQ2A 2QFIA 2CZ9A 3BV8A 4LR8A 4U8YA 2YWKA 3E51A 4OQJA 4H4MA 1N5TA 2UXCJ 1TTHB 3A8KA 2E7WA 4CLWA 2HHVA 4G65A 3DHWC 3T1AA 3QT6A 4ED8A 3BM7A 1FNMA 3PR5B 9ATCB 1L5UA 2YTCA 4M5DB 5EHHA 4QWBA 4NXNJ 1X5PA 2J8SA 5LSLA 3W9JA 1N32F 4Z7CA 1KHVA 4NZ6A 4RW4A 1NK6A 3AQOA 4FXVA 2VQFF 1YJ9S 2ZDOA 3FRYA 3MZIA 4JI0J 2XGPA 4OZ2A 3R8YA 4NCAA 1FRJA 1FRXA 4HL9A 4O23A 2M52A 4WFBQ 1RA7A 5DDQC 3F44A 1T9WA 7AT1B 3ZZZA 1FRLA 2EFNA 2OPSB 5LMUF 4MTPA 2VICA 2AF6A 3MMJA 3D66A 4N41A 4F3OA 5IV4A 3KK2B 2CNLB 3C15A 1SVDA 3PRDA 5GAHI 1V6HA 2MKJA 1U1PA 2CJAA 2XMKA 2GO8A 1VMBA 2GIRA 2W7AA 3CJQA 2W4CA 3ZTSA 3PX6A 4YB6A 5KFIA 1PAEX 1UEVA 6FD1A 1MN7A 2DRDA 3C8YA 2H1YA 5LMNJ 1R43A 1XN9A 4Y3CA 1BGXT 1N34J 1PC4A 3C16A 3IC1A 2EK6A 2G4BA 2X7IA 5JXSA 2QT7A 3LANA 2W9BB 2YQ3A 1QTMA 2CPYA 1KWMA 1S0MA 1S1WB 1ZBTA 2HHHJ 1KLNA 3CGIA 5AJ3J 3CMAS 3HD1A 1PKUA 4ICLB 4E0DA 3W62A 2X3GA 1VJQA 2HNYA 1UVIA 2Z2MA 3H2LA 3HHLD 3O1LA 2E9ZA 1RWKB 4J5OA 4OMFG 4J9RA 1RKJA 2RQMA 4DPOA 1S57A 5EX0A 2EFVA 1MN9A 3KXDA 4DR3F 3Q8UA 2E5LJ 3M8RA 1ULRA 2YX7A 3PRVA 3KLIA 1TAQA 5IM0B 2LXIA 2F9DA 1V5IB 1T05B 2AX0A 3BR8A 4RKUC 2JEJA 4ZP7A 1B70B 3HCXA 2ILYA 3D4JA 2NS1B 2ZZMA 3IS9A 2BJDA 3T5LA 1SIZA 3O8WA 3BJYA 3FUYA 2P6SA 3CIMA 1Q78A 1VQKS 1U1QA 1ZOTA 3SSRA 3PFEA 1BHNA 1RZMA 4HHJA 1SKRA 2BANA 3UCZP 3DYAB 4TU9A 1FWLA 3CDWA 2JFDA 3L4BC 3O44A 2F8HA 4LRDA 2W9CA 1A0OB 1VBXA 3OHBA 2XHWA 4M95A 1YKWA 3UO0A 1JLEB 4KC5A 5J2NB 4A48A 1DBDA 1DTTB 2XG8A 3HSDA 2BOAA 3AA9A 3OBIA 3ZZUA 3S8SA 4ZOSA 3BN7A 1IKVA 1F6TA 4LF8F 3NCRA 2VG5A 4DG1A 3HSZA 5DJBA 1WD6A 1CS4A 2VZ9A 1G4CA 2JLGA 3K5NA 3HT0A 2OD4A 1P1LA 1Q5YA 1Z2LA 4JI1J 2RF2A 4Y34A 2DGXA 4LR7A 4DFPA 5CABA 1EB0A 3SMZA 3GONA 1Q8BA 5F0UA 3D6HB 3VTIA 2ERRA 1GX6A 3RR7A 2H4WB 3LTOA 2BV3A 2AEFA 1RHMB 3KFWX 3OTDA 2OTLS 1O6XA 3TAPA 3PYFA 3BS9A 2MXYA 1RT3A 3W5ZA 1TV6B 5IQ6A 3V6JA 4JI5F 2FHJA 2GCFA 2C2RA 4JOUA 2BW2A 2I0XA 3U27A 1TKXB 2C42A 3SBMA 2XO7A 3FZBA 1OPIA 1CSJA 1ZAXA 5CD4H 1VBKA 1PJ7A 4DUZF 1RISA 5A0YA 4B3TF 3IR5B 5KFKA 1X60A 3MWBA 4ECTA 4RNHA 4AXIA 1SKUB 3OFHA 4Y6IA 5D4OA 4FXWA 4DQSA 3B6BA 2Z57B 5HQLA 5IQQA 4AD6A 4PQAA 3RJMB 1M5HA 3TZWA 1H7XA 4HEA9 2E1PA 2WONB 5F8JA 1U6FA 5K14B 5E41A 2OEKA 2IRXA 1LOUA 3OL7A 3AOAA 3V4IA 1X4CA 3TUJC 4TY8B 3CCSS 3KK1A 2DNKA 4C8OA 1B4SA 2RD5C 2KO1A 4KAIA 2ZM6F 4OI3A 1WC3A 1WC4A 2BJ1A 3RB4A 1R27B 2V2ZA 1KVJA 4EUVA 2R7OA 5BR8J 4LFBF 1PJ6A 2DRAA 1UPMB 2XSJA 3TAQA 1QE1B 3PNIA 4RUCA 2FZKB 1M5PC 2DEIA 4C98A 4O3RA 3N4WA 2R7SA 3CDAA 4NA1A 2XQCA 1AROP 2VIHA 1HBUB 3CD0A 4NLWA 3E3XA 5ETMA 3NLCA 2LXFA 1D8YA 3M05A 1VOMA 4U67Q 2R7QA 3K57A 4X62F 2YVSA 4UZBA 3BBFA 4QIEA 4PWUA 4WU3A 5IT0A 4OYXA 4PEOA 3DLGB 1RBAA 3TWZA 3HVTA 4CO5A 1AXQA 4DXLA 2NYIA 4EBDA 3N79A 8ATCB 4FF2A 4F7VA 1VCTA 2IIHA 4NLOA 3EZUA 1V3ZA 3FBEA 4EU0A 2ZH5A 3W8PA 2DHAA 3GE9A 2XS7A 4D3HA 4DN9A 3GFHA 4OHYA 3CCVS 4WFXA 1OSDA 1HWKA 3VAGA 1BWEA 3CMES 2R7TA 3IRXA 1UAWA 3I31A 4YB5A 2J0XA 3H42A 1VQLS 1NH8A 4H4OB 4YDDB 2EWHA 3DMJA 2M5YA 1YHQS 4IOBA 5KTQA 4MK7A 4A8FA 4Y2AA 3KJNB 2K8GA 5JVGQ 2XZTB 4IDKB 1WKKA 2YNGB 5ETTA 3OTEA 4DS4A 2DO4A 4O4GA 3VVUA 3C66A 5D4NA 2M2BA 4OX6A 1D9DA 4UOFA 3KG1A 1LW0A 1L3KA 3TARA 5J2QB 1GTHA 3EVWA 4DSFA 1NAQA 2AW0A 3KJQB 1WI6A 1BQNA 3MD3A 2YQ0A 4MKAA 1DLOA 3NCPA 4ZIVA 1FDAA 4I0WA 2YWGA 4B3SF 2FHOB 1YJTA 4E8UA 4DLGA 4K4XA 4QPTA 5F41A 2J9EA 3PHEA 2HVHA 5A8RB 2KHDA 2ACMA 1QUVA 2YPZA 1U47A 4G1QA 4WKRA 1JKHB 1U0HA 1GXUA 3TNVA 3THVA 2ZUAA 3KMQA 4DV0J 2V50A 2QLBB 4P74A 3BO2A 4TY9A 4N77A 3BGUA 3GJQB 1PBAA 2AJ0A 4DR7F 3KJFB 2IPOB 2RQCA 4B02A 3AT1B 1G2EA 4KPCA 2AGQA 3DOKB 4ZPAA 4LF6J 4IH6A 2ZOMA 5HQMA 3TA0A 4M5IA 4ERDA 3D0GE 2KFZA 4NE9C 3H4BA 2I9SA 1VHFA 2OTJS 1ZM2A 1GXLA 3F0NA 4JI6J 1Y9OA 3JSBA 1C1CA 3OUYA 4K8RA 1R8AA 4CO4A 4F3MA 2KM8C 3KYLA 1KVKA 2XMAA 3ULHA 5HROA 3PW7A 4Q8EA 3IWLA 5KFSA 4A8SA 2BE2A 3IMQJ 3W5YA 3NGDA 1HW8A 2CJXB 2UXCF 3CUNA 3DDKA 4WK1A 1TL5A 2NPIA 3POTA 3IRWP 5K8PA 3PHTA 4RU9A 3BGFA 4WIIA 3J7Z5 1YGYA 3P96A 4ELVA 1NJYA 1S1VB 3D68A 4B3OA 4NXNF 1HI0P 3RB0A 2R8KA 1FD2A 2V4QA 2GAGC 4JI0F 5HVGA 4OLPA 1E6VB 4ZS6A 2HAFA 2VFRA 2WAQD 3H2UB 3KTQA 2VPZB 4WTYA 3MM9B 2B7BB 4ELUA 2WVEA 2F5GA 5D4PA 1P9YA 3SSSA 2B43A 3NGSA 5KG0A 1LWCA 4NPOA 2MLXA 4GO7X 3PG9A 4K4ZA 2BX6A 2JDJA 3MMBA 1TKTB 3ITHB 2I5JB 1TL1B 1HL6A 4P2XA 3DM2A 3EXYA 1H73A 3OL6A 3V6DA 5LMNF 1L3UA 2NXNA 5DQHA 3SDEA 2E9TA 3JAMU 2VU5A 4YY3J 2LMIA 1XK8A 1JLCA 1YRXA 2U2FA 4I7FB 1KD1T 4A8MP 3KDOA 5ADZA 2HHHF 1M1KT 3QAUA 5AJ3F 5DO2A 3LGNA 3GJSB 3NL0A 4OI0A 3SCLE 3GIKA 2K2PA 3T9NA 4CH1A 1V9OA 4HHUA 4C8ZA 1AUDA 1JJ2R 2O1PA 4BDPA 4AL5A 4USMA 1SBRA 1NMEB 2QL5B 3TJ9A 1RLDA 2OPRA 3QAEA 1OY9A 3TA2A 3PDNA 5K8NA 1HMVA 2HHQA 3Q8VA 4DU8A 4NLGA 4LRCA 2E5LF 1RHRB 3HM9A 3IR7B 2HQFA 3IM8A 3GFXA 3G71S 4P73A 4ZLLA 2BE7D 1QTNB 3SV3A 3B4DA 2HHPA 3UE2A 3MM6A 3F73A 2AYMA 1HBMB 4NA3A 2R9LA 1XEZA 2DPIA 2VD3A 1PCAA 2XHCA 2HHSA 5KFZA 4HACA 2BW7A 3VF0B 5L38A 2LQ5A 4LIRA 3LP2A 2RB7A 3QGIA 1X9WA 1KDNA 4ENOA 4O0IA 4NLSA 4ES2A 2YKMB 3HVWA 2MYFA 1WDTA 2JC0A 5CYQB 2M88A 2DGWA 3UN2A 2RUSA 4LT6A 4CNYA 4KFBA 1IQZA 3D3BJ 3EPIA 3LW5C 1E6YA 2AZ1A 3TAMB 1UVKA 4UQGA 1X5OA 2ZDPA 1VQOS 2CQPA 4WE1B 4K50A 3RRHA 2EBGA 4TVAB 3R7BB 1REVB 3LP1B 5KG1A 5KAKA 1HLWA 2D41A 4RWXA 4JI1F 3K5PA 1WKLA 2B9XA 3KNAA 1NNDA 3UR0A 4K5SA 2YPYA 1H2UX 4DSJA 2I6WA 1EKSA 2C2NA 1RAJA 3GCXP 2UUWA 4MH8A 4YB7A 4UY8T 2HNDA 3OV7A 2HFNA 4KBIA 4QYZK 4DZDA 3M2VB 3ZZPA 1UVMA 1S1WA 1PYSB 4LF4J 4C0BA 1UVJA 4I4BA 3C2PA 2LDYA 3D67A 3M4XA 4QWDA 1H98A 2QJ3A 4J9NA 2WOMA 5I3QA 2R7RA 4ECQA 1T8EA 4F3QA 3TA1A 2G0CA 5A6WA 5MLCV 5AXKA 4YEAA 4DR6J 2ZOFA 1X4DA 3C3LA 3E2EA 1X4BA 3AY0A 3H4DA 2VODA 3H25A 3BPDA 1U1NA 2LKZA 1DQAA 2L48A 5KFDA 1DARA 3DRRA 4J9KA 1RT7B 1SC3B 5KFCA 1HIYA 2PDAA 4AL6A 3K2YA 1M0SA 1R0BG 1XC9A 2G13A 1HNWJ 3IP0A 5KFLA 3HXMA 3LF0A 4O3NA 5HBMB 1RTHB 5HLFB 5C24B 2I8EA 4WYLA 4DV7J 1MG7A 1UA0A 2ZUGA 1HPZA 1F5CA 2JC1A 3G8SA 3CCQS 1VC0A 1SV5B 4RO0A 2KN4A 5B08A 5BR8F 4A8XA 1HKAA 1JLEA 1XNQJ 1TKZB 5HMZA 5IC4B 2CPEA 2LU2A 4P2SA 3GCWP 2D3ZA 1MWZA 3TQ1A 1DZ5A 4C0OC 3W66A 3Q2TC 1S1TB 1UWAA 2OSRA 1VFJA 3THTA 1HBNA 2B51A 3FCVA 3H2VE 3FKBA 5L1KA 3GR1A 5ETRA 3CE8A 1QJHA 4F25A 5KFVA 1TL4A 5KFWA 4NXMJ 4B3MJ 4WKYA 1XR5A 1QLNA 2KG1A 2CJKA 5DG8A 3LGHA 3K7RA 1CJTB 1U02A 1YK9A 3HO1A 5FIIA 3Q8PB 2RQ4A 3TZXA 3BKUA 1WC0A 1UCNA 5HSPA 1VLYA 1WKJA 2P9EA 3PIPQ 1RWPB 4R5PA 2JH3A 1D3WA 3W64A 3I55S 2V5HG 2YNFB 2AU0A 2KZZA 4ALZA 3DFEA 4C7QA 3PFOA 2IM0A 4ZHRB 4DFMA 1S10A 2CNOB 2B5JA 2BDPA 5I3UB 3MPWA 4C0HA 3MEKA 2QO3A 5GAEU 2R2RA 3G9CA 1XNRF 5THWA 2HWIA 3BO4A 4QIFA 1T02A 5KFFA 3QT5A 4ZIWA 3OTOJ 2ZEJA 3MEEB 2UVRA 2NXEA 2J7WA 5H9EK 5IXUA 2ADCA 1QAYA 2E5JA 1KSPA 2BVZA 1N54B 1PGZA 2DIVA 4TN2A 1YBAA 1FJGJ 2ZH8A 1UL3A 3DC2A 4I6AA 5C25A 1JLAB 1B7FA 4K4WA 1RA6A 3FJ2A 3OVSA 3DLBA 1S49A 5ETNA 5EWGA 2HLUA 1T3OA 2DGSA 3A8JA 4Y00A 1JLGB 1WORA 2KDOA 4J7CA 2MB0B 4IQXA 1V3SA 2J6UA 5IZHA 3OR2A 3DDIA 2DNZA 5KT4A 3D6TB 5GADI 2B0GA 1F9FA 3K0JA 1QE1A 4MKBA 3DLEA 1S48A 1KQGB 1KLMA 4P2MA 6FDRA 4EI2A 1N56A 2DH9A 4N47A 1WTFA 2F65A 2FPHX 5L1JA 3W2WB 4Z37A 3DOLA 3I6PA 1YVFA 3V81B 4DV0F 2QMXA 1SB6A 3IFEA 3WX8A 2GIFA 4CTAB 4LIWA 4IG3B 4LVOP 3UDEA 1FRKA 4WTOB 4JUZA 4IH7A 2M8HA 1XMOJ 4DV3F 5DETA 2ALYB 4LF6F 1S9EB 4TQRA 3C6UB 1S79A 2IJFA 3UVJB 3ETMA 1HD0A 4CYUA 5J1PA 1T9XA 2NSBA 3EE3A 1NSKL 2IM1A 3ZZ0A 4JI6F 3J7YI 3JYTB 1CJVA 3CWJA 2YNIB 4A4JA 4IG0A 1ZM9A 3HDSA 4FF3A 4HH0A 3ZNJ1 2BJ8A 3KLHB 2MZJA 3GILA 1U25A 4CWBA 4QOTA 2V94A 1RSCA 1OO0B 2DNHA 4FN5A 3NNHA 1Y7PA 2QC3A 4G6VB 3P5TL 1SI9A 3FBBA 1RU1A 3ET6B 3P8BB 2J8AA 4O3OA 5B0DA 4CLZA 4EK2A 1N8RT 2MSTA 2VB6A 2FHJD 1TL7A 1MNEA 2JL9A 2GV1A 5F3ZA 4PZVA 4BWMA 3W8GA 1HHTP 3IG1B 2HMIA 4KHRA 4CO3A 1K0VA 3BR9A 3Q22A 3MM8B 4EMDA 3MMAA 1S6PA 1X7VA 4ES3A 3EGVA 1U2RA 1FVQA 4J9LA 2LA4A 2HPUA 1S4EA 1SQEA 2JSXA 3HZGA 4XO0A 2KI2A 2YY3A 3VWSA 4RR5A 2ZNYA 5EWFA 4PXCA 3GV7B 1WSRA 4QCLA 1QSLA 1DTQA 3GMGA 1SXLA 2FJAB 4W4MA 3BDPA 2OSQA 1HQEA 2IYGA 4ZA1A 3MEDB 2VC1A 3IBCB 1SL1A 2IC3B 4Z7YA 5HMWA 2QLJB 3QO9B 4QWCA 4QIGA 3QJJA 4Y2MA 2L41A 2L3MA 2H65B 4DUYF 3EUNA 4BBYA 2PA3A 3BGLA 3A3NB 3R5JB 4F4KA
chains in the Genus database with same CATH topology
2W4PA 2HRUA 4N76A 5EHHA 3AA8A 1S72S 1YRTA 2QZ8A 3RRKA 4D3GA 1KFSA 4QWBA 1HNVA 2RRNA 1X5PA 2DT9A 3QYYA 5LSLA 3MOZA 1N32F 1Y4ZB 1KHVA 4NZ6A 4RW4A 4YY3F 4X4RA 2HNZB 4QQBA 3FRZA 3LP0A 1NK6A 3AQOA 4FXVA 4L3NA 1HNIA 1NRKA 2VQFF 1YJ9S 2ZDOA 2R7XA 3FRYA 3DLKA 3MZIA 3OJSA 1LV5A 2XGPA 4ZCIA 4C8LA 2ZH9A 2DR8A 1T03A 2KT3A 1FRIA 4NCAA 3EYZA 1VQYA 4IO1A 1FRJA 2DTJA 3DNCA 4ZVEA 5KG7A 1FRXA 1SUQB 4IKAA 4OZ5A 1DJ0A 4HL9A 3ETOA 4O23A 4LQ9A 1MWYA 2VG6A 2M52A 4WFBQ 1RA7A 2CPDA 5DDQC 1RT5B 2HS3A 1KS2A 3F44A 5KG3A 1S1TA 3CXCR 2Z4PA 1B0VA 4WFYA 2DHGA 3ZZZA 1FRLA 5IT9Y 1F0XA 2EFNA 2OPSB 4JI4F 5DS7A 3O6QA 5LMUF 3CCLS 4MTPA 2J7KA 2AF6A 3MMJA 5HQ8A 2DIUA 3TUZC 4N41A 4F3OA 3KK2B 3NGKA 3M1VA 2ZFHA 1P6TA 4R8UB 1H38A 4DEZA 2ZJPQ 3PRDA 5GAHI 2QLWA 1V6HA 2QA2A 2RSQA 2VFSA 5GMKa 2X1AA 2MKJA 1U1PA 2J9DE 2CJAA 2CQ3A 2XMKA 3HVTB 2GO8A 4F2SA 2CQIA 1S76D 3QJLA 3M6UA 1VMBA 2GIRA 1VS3A 2BYCA 1OIAA 4Q2LA 4UUXA 1D9FA 2Y0SD 4MMOA 2W7AA 3R1LA 4C8NA 3SYZA 1IKYB 3N0VA 2W4CA 2YWEA 3CCWA 3PX6A 2XS2A 4F4YA 2QLXA 4YB6A 2FHMA 5KFIA 1M90T 2O01C 1X4AA 4EEYA 2E5HA 4ZPBA 4IUFA 1UEVA 6FD1A 2M70A 3M32B 4OHZA 3ISZA 2GW8A 3NNCA 2YWHA 3GFZA 2ADBA 5CHCB 3OPKA 3QZ7A 2RT3A 3C8YA 3PIOQ 2BRLA 3L7OA 3NBPB 5IFMA 2GQ2A 1R43A 1XN9A 2XWXA 3IGNA 4Y3CA 1BGXT 1BD6A 3EGNA 4XK8C 4EO8A 2YKNB 4OX9F 1U7LA 5HMYA 1PC4A 1N6QB 2ZKUA 3IRXB 4DQRA 3IC1A 1SKSA 2EK6A 5B0CA 2V9KA 2G4BA 4ZK7M 3I87A 5JXSA 4QPXA 2QT7A 3BN4A 5B0FA 3HJFA 2YNFA 3UDCA 1ZH5A 2IVYA 3LANA 3GYXB 2KRBA 4LSLA 3NG8A 3QGGA 2YQ3A 2W9BB 3TAQA 2CZVC 3DMJB 2CPYA 1QTMA 4JI7F 2BXJA 1S0MA 2HVZA 2MQLA 3SFGA 1S1WB 4FXDA 1ZBTA 4EFAC 2FLOA 4DFKA 1C1BB 2ZH2A 2UP1A 2HAIA 5I4MA 4ZHRA 2W25A 3CGIA 4ID8A 3HPOA 1KLNA 2JEFA 3MAHA 2HFZA 3R5BA 3CMAS 2YNHB 5SZTA 2VOOA 2CPJA 4ICLB 5CCMA 3CO9A 5E3QA 4E0DA 2ZH6A 3Q2SC 4DL2A 2J0WA 2J76E 5I3UA 4OI2A 4IFVA 4DDFA 2X3GA 3HHLB 2DNYA 3O3LA 3G6VA 4IH5A 3X3UA 1FXRA 3DGPA 1VI7A 4PG8A 2HNYA 5GAEI 1UVIA 5IWAF 3TO8A 5J1EA 2Z2MA 2XBPA 3H2LA 5AE1A 4HLBA 3HHLD 4O4GB 3NS5A 1T94A 3O1LA 2NZ4A 3I0SA 2PI4A 3CTRA 2E9ZA 4XIUA 2V0NA 1U48A 1RT1A 3FSXA 2LEAA 3AJ1A 3MEEA 4PUOB 4J5OA 1H3DA 2OKQA 4OMFG 1KONA 4WFZA 4J9RA 1RKJA 2RQMA 2H5EA 4J37A 4DPOA 3UR3C 4ED1A 2WHOA 3T9ZA 1Z4UA 2LCWA 3D2WA 2EK1A 1RTJA 1UEUA 1HWIA 1LW0B 3FNNA 5EX0A 1U1RA 5GAHU 2EFVA 3G96A 2B6AB 2IA6A 4DR3F 1FT8A 3EGWB 1OQ3A 3TI0A 2R8GA 3OTCA 3T5KA 1YQHA 5KFBA 4H4KC 4B9VA 2BOPA 3M8RA 5D3GB 2HHWA 1ULRA 2DNLA 2KB2A 2YX7A 4O3QA 2CQ2A 4RWWA 3CEDA 1TAQA 3KLIA 1ZAWA 4Q2MA 1TKDA 5IM0B 4JV1A 2LXIA 2F9DA 1JLAA 2NXUA 1T05B 3MECA 2AX0A 3BR8A 4G1IA 1AFIA 1BQNB 4RKUC 5AE3A 3FGVA 2JEJA 5D4LA 3ZZYA 4ZP7A 4AYBD 2BA9A 2Z2LA 3RB3A 1DLOB 2AYGA 4O3PA 2ILYA 2A3JA 2RU3A 2OIHA 1RT6A 2NS1B 2ZH3A 2QA4S 2NPFA 2ZZMA 1MW7A 3IS9A 2VKZG 1JNRB 4IO9Q 3OSNA 2BJDA 3T5LA 1SIZA 2DVIA 3O8WA 1BY9A 2RS8A 3BJYA 5AXMA 2IBOA 3S7RA 1W2BR 1NK4A 2DH7A 1JLGA 2P6SA 5JUMA 3CIMA 2Q6BA 1YIJS 2ZOGA 1Q78A 2F4VF 1HNZF 1R3NA 4TU8A 2VG7B 1VQKS 1U1QA 5L8RC 1ZOTA 3U02A 3SSRA 3D28A 3PFEA 2KXHA 5KFGA 2KVIA 1I94F 1EETA 1C0TA 3OQ2A 1L3TA 1UWBB 4KV8B 4HHJA 3VAKA 4JYAF 4Q45A 1SKRA 2BANA 2CQHA 3UCZP 4WZQA 1FXDA 3U1MA 4ZP9A 1W2IA 1FKOB 3DYAB 4ITSA 4TU9A 2Q3PA 4DQPA 3CDWA 2JFDA 2C28A 3MMCA 2F8HA 3O44A 3OVAA 3GIIA 2A10A 1L3VA 1Q1KA 2W9CA 4C97A 2XEXA 4EZ6A 1VBXA 3OHBA 5JVHQ 2XHWA 4M95A 4L6V3 4LSNA 1FEEA 2DNRA 2IRUA 5KFXA 4F4WA 1JLEB 4ECRA 4ID5B 4KC5A 4LF4F 4RW6A 2KT5A 5J2NB 4A48A 1R8HA 5K5MA 1DBDA 2AP6A 3OVBA 1DTTB 2XG8A 1YTYA 2DJWA 3W2WA 3AA9A 2E5GA 1Y3JA 3OBIA 2CVEA 3ZZUA 4Q43A 3S8SA 2B3TB 4OJHA 3OXFA 2MDAA 1RJJA 1FTRA 2VBXA 1TQLA 3BN7A 1IKWA 4N8OA 2RUGA 5T41A 1IKVA 5T7LB 5LSOA 1S1UA 1LWFA 3FSYA 4LF8F 2N3LA 3NCRA 3EPGA 2MZQA 2L9WA 2VG5A 4RLEA 1FKPA 1BC6A 5DM7Q 2K1RA 4DG1A 4CTAA 5DJBA 4IG3A 4CCHA 5G0RB 1Y3KA 1WD6A 2VZ9A 2BQRA 2PD1A 1S6QB 3RYLA 4QU6A 3AAWB 4NLQA 3IA0A 4ZPCA 3S6EA 2VFVA 4HH1A 2FJBB 4KHMA 4FPRA 2JLGA 4ZLPA 3K5NA 4QYRA 1JLQB 2DB1A 3RZAA 3EZ5A 3CCES 2OD4A 1FJEB 4DR6F 1P1LA 2GA7A 3Q23A 1Z2LA 5A6PA 1NJIT 1S9EA 4NCBA 2RF2A 2ZC3A 3CIZA 3C6UA 3MM7A 4Y34A 1QAJA 2DGXA 2IM2A 3NMRA 1N4LA 3DOMA 4RBVA 2MY7A 3OUYB 2ZD1B 4DFPA 1I1GA 2LQBA 2Q43A 2ZE2B 3DLHA 2JFKA 3E01A 2QMWA 3SMZA 3HHLC 2DNPA 1N52B 1Q8BA 2R8IA 3M2UB 5F0UA 5L9NA 3VTIA 1IM4A 2N3OA 4GKJF 2ERRA 2LXUA 3QGPA 4X84A 4V19X 1GX6A 2WB1D 1NKBA 4IRCA 4C4WA 3RR7A 3JYTA 5AXNA 4PG7A 5HROB 2UV8A 3E8OA 1ZAVA 3R5AA 2LDIA 4F4XA 2IRYA 4I2PA 2MQPA 2YNIA 3BQ1A 2HWTA 1R8CA 3CCZA 1YWXA 2RILA 1JX4A 2BV3A 4DSEA 3BGRA 4TKTA 2L9DA 3H40A 2J9CA 5KFRA 1L3SA 1HYSB 2BE2B 3JTPA 3KLHA 3KFWX 3OTDA 3WC0A 3DN9A 2OTLS 4PPDA 4RBTA 4TYAA 1HNWF 1NK5A 3QJPA 3H20A 1JLBA 1S1XB 3DRSB 4OI6A 3LO3A 3W7BA 3PZPA 5D77A 2XS5A 3TAPA 3X1LB 4DV7F 2CPHA 2PO4A 3BS9A 4RUAA 2LLZA 2MXYA 1RT3A 3J7ZT 4JI8F 3POTB 2IMWP 1J5OA 3PACA 1TV6B 5IQ6A 3V6JA 3SQGA 4DL6A 2ROGA 3M6XA 4JI5F 5DDRC 2FHJA 1LFWA 3W2VB 2GCFA 5A2QY 2C2RA 4JOUA 2K7JA 5MAOA 4I2QB 1WEYA 2BW2A 1WEXA 1KNZA 2I0XA 3ENWA 4PXDA 3U27A 1TKXB 1UW4A 2Z8QA 2C42A 4P7TA 2GHPA 4B3OB 3TVYA 3GYNA 2XO7A 3FZBA 3SCIE 1OPIA 1CSJA 4I67A 1WF1A 2VONA 2VBWA 1SC6A 1ZAXA 3PJXA 5CD4H 3ICLA 4B3RF 2DNGA 4NX9A 3M8QB 4DUZF 1XNQF 3HHNB 3ISND 3SZ2A 1RISA 5A0YA 3JAMY 3UFCX 3IG1A 3LWLA 2DPJA 4B3TF 3J80Y 2L08A 3IR5B 3EX7B 4DQIA 4AUKA 3B82A 4MK8A 5KFKA 5E7OB 3MM8A 2ROPA 4ZVGA 5DGBA 3MWBA 4ATNA 4ECTA 1Q8LA 3DDNA 4NCGB 2MGZA 4RNHA 4C3KA 1JIHA 4AXIA 3QLHA 2BJEA 3MM5A 5L39A 4IR9A 3SFUA 3OFHA 2M4MA 3QIPA 4Y6IA 4USJC 5D4OA 1K1SA 2CFXA 3MGJA 3M8PB 1WEZA 4FXWA 4DQSA 2LECA 1VQPS 2CQ4A 2GGPB 3RR8A 4DN0A 5AE2A 5L1LA 5IQQA 1UVLA 1AW0A 2DNMA 5KFTA 2X51A 4PWDA 1ZZFA 4M1KA 4PQAA 2MQOA 1VRTA 2E66A 2EFPA 3L3CA 4NLTA 4DV4F 2IAJA 4ZKAA 2IYIA 3KK3A 1M5HA 3NRBA 2JOQA 3VAMA 1H7XA 4HEA9 1FRHA 1UJ5A 4I64A 2MZRA 3PX0A 1LWCB 4JI3F 2K3KA 2WONB 5F8JA 4A8OA 1U6FA 5K14B 4UOCA 5E41A 2IRXA 4QBUA 2IVFB 1FRMA 2DR9A 2UUAF 3CSKA 5DQIA 3FFIB 1VIXA 2A1BA 4O44B 1GNKA 1LOUA 1CC8A 4EWTA 3OL7A 1VBYA 4NXMF 3HKZD 4B3MF 3FQLA 3RBDA 3V4IA 1H7WA 5DLGA 5DGAA 4BHQA 4IOCQ 1X4CA 1U1LA 2E7XA 2ACYA 3MMBB 2HHTA 2IC3A 4ED7A 2MY8A 3TUJC 1FVSA 1K8AT 3MR5A 1GT8A 4ED6A 4TY8B 3CCSS 3KK1A 4F4ZA 3QO9A 1O0PA 4ED0A 2DNKA 4C8OA 1FDNA 1VQ4S 4TLQA 2RS2A 2RD5C 4OZJA 2KO1A 3TVZA 4Y2KA 4KAIA 4GC7A 2QE5A 1FD8A 2ZM6F 5EX3A 4ED5A 3OL9A 1VK8A 3DM2B 4OI3A 3TRGA 1DQ8A 3RB4A 3V6DB 2ZVSA 1JXEA 4LF9F 1R27B 1KVJA 4EUVA 2R7OA 3SDEB 3OW2R 3UCUP 2PE8A 2C3OA 2PI5A 3UI3A 1T7PA 4LFBF 4HKQA 4BC7A 2DRAA 2YKAA 1O51A 2XSJA 3MHYA 4KIAA 2FHKA 4RX6A 2IA0A 1JLCB 1QE1B 3I96A 1D9AA 4OZNA 4M5DA 4URSA 1HFEL 2GQQA 3D5MA 3BZQA 4CI0B 1ZPVA 3PNIA 4RUCA 4W90B 1M5PC 2XLIA 2GMLA 1WNEA 5EUHA 4K4SA 4Q7AA 5IT4A 4C98A 2R7WA 4A8WA 3GR0A 1IKXB 2V8HA 1Q8IA 3CD7A 3N9UC 4PXEA 4O3RA 4RUHA 2BUNA 4B9LA 4E98A 3N4WA 3ONQA 4FYDA 2OFGX 3HHEA 2HNZA 4NYPA 2R7SA 3CDAA 4YFUA 4NA1A 2NLWA 3G4SS 5BYRA 2XMVA 1SJFA 3KNGA 1AROP 1TFWA 2RRAA 3N28A 1HBUB 1WACA 3CD0A 4NLWA 4ZPTR 3E3XA 1PO6A 2ZITA 2B4VA 5L9XA 1QAIA 3NLCA 1KRPA 5LL6d 2LXFA 5E2QA 4IRKA 5LXRA 5E3PA 4J9MA 1D8YA 3M05A 1G7CB 4KTQA 2IHR1 1VOMA 2M0GB 4I56A 1SUQA 1UP1A 4X4SA 4U67Q 2XCAA 2R7QA 4NA2A 3K57A 2EI5A 4KGKA 1UJ4A 1RT5A 4X62F 4B9MA 3TX8A 4M94A 2B4OA 2YVSA 3SSQA 1DRZA 2CJBA 4J9PA 4A8YA 2FD2A 1DAXA 2W24A 3CULA 1VRUB 2OPSA 2LQJA 3M30B 4QIEA 4PWUA 1ZYQA 4OJ3A 4WU3A 4WFNQ 4IRDA 5IT0A 1NJXA 2OP5A 2V4JB 1HMVB 2HGLA 2VOPA 3DLGB 3KK2A 2GQCA 1VIOA 2X1GA 2JWNA 1VQ8S 1RT2B 4R8UA 3SEOA 2VA2A 4HT7A 4DF4A 3ISNC 2PMHA 2EVZA 3PEJA 3M6VA 2APOA 1Q16B 2I1RA 3OFEA 1M5VC 4J9SA 1FJGF 3HVTA 2GMHA 2MKHA 4CO5A 5DQGA 5CH7B 1AXQA 3ZFVA 4DLEA 2HLTA 3MM6B 2XMUA 2N4CA 2DNOA 2NYIA 4EBDA 1VC5A 1IKYA 3N79A 1KFDA 3RAMA 5BYQA 4FF2A 2DRBA 3VAIA 1FCAA 2RMLA 5C24A 4QU7A 3OSPA 3C46A 4HT5A 2QA1A 3M32A 2HW3A 4YOEA 4NLOA 3EZUA 1V3ZA 4EU0A 1XTZA 2ZH5A 1HBOB 1WTBA 2DHAA 3GE9A 4AXJA 2XS7A 2BQ3A 3NBPA 3T19A 1Y5NB 3LP2B 4D3HA 4DN9A 2EC0A 3GFHA 4OHYA 3CCVS 2YKNA 4WFXA 2HS4A 3DLLQ 1OSDA 2VPWB 1HWKA 3VAGA 1BWEA 3CMES 2R7TA 3V81A 2MSSA 1SV5A 3IRXA 3V4MA 1UAWA 4B9TA 1YRUA 3I31A 4YB5A 2B7CB 2J0XA 4YUDA 1NEEA 3CDBA 1VQLS 1NH8A 1U49A 4KQZA 1MMLA 4H4OB 4XDCA 3FEZA 4YDDB 2FIUA 1S0OA 1XBWA 4YR0A 2EWHA 2ALZA 2W9BA 4MFBB 2PIIA 2M5YA 3DMJA 4ZPWR 1YHQS 5CZVA 4IOBA 2HYIB 2MJNA 5KTQA 2PSZA 4MK7A 1YJUA 4WCEQ 4ED3A 1C1BA 1TKZA 2QFJA 2UUBF 4NLVA 1XR7A 3OTBA 4A8FA 1Q53A 4Q5VA 2YNHA 4Y2AA 1XERA 2K8GA 4ICLA 4NL5A 3CCUS 3CC2S 2VQEF 5JVGQ 3RAQA 4KFBB 2E44A 2HQ3A 3R5DA 5CQGA 3HHLA 4IDKB 5B0GA 1TFYA 2KM8B 2DGVA 1YJWS 5T14A 3DRXA 1E6YB 2YNGB 4OI1A 2BABA 1FTCA 2OAUA 4HI2A 2D3UA 3OTEA 3I32A 4DS4A 2DO4A 3I5CA 4G1PA 5F9LA 4W92B 4O4GA 2UUTA 3C66A 5D4NA 2FGOA 5J2PB 1F2GA 2OO4A 1G3OA 2M2BA 4USIA 4DSKA 1Q7LB 1S9GB 3VZIA 1ZPWX 1SKWA 4PUOA 2YKOA 3PJWA 3JSRA 4ZVHA 4OX6A 4B17A 2KZMA 1D9DA 2AX1A 3KG1A 1XMOF 2RDJA 5FLXY