3C14B

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and ca
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
189
Chain Sequence
HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase/lyase inhibitor
molecule keywords Adenylate cyclase type 5
publication title Structural basis for inhibition of mammalian adenylyl cyclase by calcium.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 53
structure length 189
sequence length 199
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3c14B00
1CJKA 3G82B 4USUA 4OYIA 5IV3A 5D0HA 3UVJB 1TL7A 2GVDA 1CJUA 3G82A 4WP8A 4OYZA 4NI2B 3MR7A 2GVZB 3UVJA 4CLYA 3C14A 1YBTA 1YK9A 4OYAA 4USWA 2GVZA 4CLFA 4CLWA 4CLUA 2WZ1A 1CJUB 4WP9A 4USVA 1CULB 4CLKA 3R5GA 4CM2A 5D0EA 3C14B 1CS4B 1CULA 3ET6B 4CLTA 4USTA 4OYBA 4P2XA 1CS4A 3ET6A 5D15A 3C16B 4OYXA 1CJVA 2W01A 4CLLA 4WP3A 3C16A 1WC0A 4WPAA 1YBUA 1Y11A 3C15B 4OZ3A 1CJTB 4CM0A 2QV6A 1TL7B 1U0HB 1AZSA 1FX4A 3C15A 4OZ2A 5D0GA 1CJVB 1CJTA 4P2FA 1WC5A 4P2MA 1U0HA 4NI2A 5D0RA 4CLPA 1FX2A 2BW7A 4OYMA 1AB8A 4OYPA 1AZSB 1Y10A 4CLZA 1WC4A 3MAAB 4CLSA 1CJKB 4OYOA 4OYWA 1WC3A 5IV4A 3MAAA 1WC6A 1WC1A 2GVDB
chains in the Genus database with same CATH superfamily
4NZ6A 2HPUA 1H0HB 4DV3F 3TI0A 2UXBF 5BR8J 4KRWA 1IXKA 5HROA 4FZVA 1S5ZA 1TVRB 1H7XA 3DU6A 2OSQA 3FK4A 2PEHA 3NBPA 2ATCB 1ZM4A 4JI5J 3EPGA 1VQPS 2WAQD 4JOUA 2CG4A 4EEYA 4F2SA 3G2XA 4P2SA 2VUGA 5G0RB 4Z7CA 2LMIA 4LF1A 2QIFA 4GO5X 2DK2A 3DOMB 1N52B 1QVGR 1M1GA 4LFBJ 4KO0A 2YNFB 4GVLA 1EP4B 1TKTA 2QMWA 2LQ8A 2ZHBA 3QT8A 1F5BA 1FD8A 5FIIA 4ENOA 1SJFA 5HQ8A 3DKDA 4L73A 2V34A 3S6EA 2A10A 2AJ2A 1NK0A 5L1LA 3GIKA 5K5MA 1VC5A 5B08A 3H4BA 1C4CA 4FS1A 2XMUA 3ZTPA 3HK2A 4FKXA 1TMJA 2OFGX 1H6KX 4ED3A 2FD2A 4E2FB 1SKUB 3T5KA 2KI2A 1S9FA 2FZKB 2DO4A 2C2DA 1G4CA 4DPYA 2K3IA 1EJ7L 3T1YF 1VQKS 1RAFB 1TP7A 1WC0A 3LH2S 2OD4A 2JZ5A 3FBBA 1WOPA 3M4XA 4PYDA 3WC2A 4U96A 1GFWB 5B0BA 2BA9A 2A6OA 2C2MB 1FI4A 4ZS6A 1MWYA 3B82A 1FJCA 3NXZA 5LMUJ 2PMHA 1NK5A 3EZ5A 4DF8A 1EQ0A 1RT5B 1TV6B 4MIWA 2CJKA 2Y0BB 3OUYB 2JEFA 2BX6A 3F56A 5DM7Q 2CQBA 3CGIA 4N5SA 2DVIA 4LSLA 2AGPA 1JJCB 3MM6A 1YG0A 1LXJA 4OZ1A 2BJ7A 1W7WA 5T7LB 2D3O1 4LUBA 1JJ4A 3DRRB 3AD7C 4WP9A 1AUSL 2GX8A 3TARA 3BZQA 5J2QB 1HBOA 2G13A 3MR2A 2PFDA 1NHUA 4B3SF 1BQXA 2E7XA 5D3GA 2PGCA 3CJKA 2RHQB 4PZVA 3C2PA 1VLOA 4DL2A 2LP4A 5GMKa 5GMEA 3WIUA 4DPXA 2C2NA 2Q66A 2IVFB 1RT7B 4Q8EA 3L4BC 3MR3A 1L3SA 2WK4A 3KWMA 3C8YA 2H54B 4J9OA 4K4UA 1IBKJ 4ECYA 2J0SD 1O8BA 2QTWA 4DV2J 1O0PA 3LGNA 1D1UA 4KHPF 4Y2MA 4OJGA 2CUYA 2JC0A 4CYUB 4LF7J 3BN7A 2BJ3A 1S72S 3LALA 5IV3A 3RGIA 1PGZA 2FJEB 3H0PA 4DR5J 3HFZB 3FEYB 4OHWA 2FLPA 2ROPA 5E2QA 3N28A 3OTCA 2MKIA 4LR9A 1NB7A 4O3PA 4DFKA 2R9LA 3A8IA 3DLKA 2DH9A 1U8SA 4KHMA 3ET6A 5M2PA 4CNYA 2QFJA 5DLFA 3V81B 2VJUA 3KLEB 4EYIB 3MEEA 3DM2A 3IXQA 3Q8QB 1IBLJ 2AD9A 1U0HB 4AL7A 4QPXA 3LPYA 3AD8C 4BCAA 4ECZA 2AJFE 3M8YA 4LIWA 4QWDA 2VONA 5IM0B 5ETSA 4TU9A 2E9RX 2RHSB 3EM1A 3RUBL 1JLAB 4K4SA 1HI8A 5K8MA 4FF1A 2W8LA 1H2UX 2GO9A 2JVOA 4DFPA 3NNAA 2E7WA 4EWTA 5KFPA 4KKOB 4ILLA 1YI2S 3HHDA 3V6DA 5DDPC 4OHVA 1G1XA 2O66A 5HVFA 1KWMA 3WDOA 1JKHA 3UN3A 1CULB 2OMLA 3TQEA 3O2IA 2NXUA 4ECTA 2HFUA 3PIOQ 4PPDA 2B3TB 3TW0A 4XO0A 2LLZA 2QGFB 3JYTA 4LBPA 2AGOA 1JLEB 3DOLA 4RX6A 1REVB 2VPWB 3BF4A 2JOQA 3NGSA 1NNDA 2R8JA 3T19A 2LCWA 2DNGA 4USIA 4X4RA 1UAWA 2HGLA 4KYZA 2WOMA 4GO7X 2AP6A 4P75A 1NK7A 3K8VA 2XMTA 1K0TA 4DR1F 4I69A 5MLCV 2QA1A 3W5ZA 3BQ1A 4I6WA 1RT2A 4IR1A 1Q5VA 1N54B 3PACA 4M5MA 1NJWA 3AXKA 5IFMA 2UUBJ 4IO1A 5FDLA 2RRNA 5C24A 1RBAA 4XDDA 4OX9F 4DV6J 2RDJA 3RZAA 1KDNA 3BSOA 3ISZA 5IQQA 3HT3A 2YNIA 4ZN1A 3FJ2A 1M5VC 3W61A 1G7CB 2DXDA 5ETNA 4E98A 5A0YA 3W64A 5HMZA 2V8VA 4BWJA 4I2QB 4P6QA 2I5JA 4RUCA 3DMJA 5BYRA 4ZITA 3UDLA 3VCDA 3I31A 3C3LA 2NSCA 2X3DA 2HQFA 1JLFB 4ZPTR 1TUWA 1FXDA 1FKPB 3SCKE 3CPWR 2MHEA 1X8DA 1U8WA 4TY8A 4F25A 2WBRA 2BQ3A 1U2CA 1TFWA 1YJ7A 1RAHB 2MLYA 1WORA 2Q6CA 3MCOA 4Y28C 5IWAJ 4NYPA 3R2DJ 3QIDA 2HWIA 2ACYA 4UY85 4LFCF 1UEVA 3I0SA 3T9ZA 3R97A 1MG7A 3CJ8A 1U48A 4R8UA 2GVZB 4YHHJ 3FVYA 2XHWA 3AQPA 4OYAA 1S9EB 4O23A 3HHLB 2DRAA 4MT1A 4USVA 3K58A 4JI1F 1B7YB 4ZPBA 1YRXA 1S1XB 5CH7B 2GHWA 2MJNA 2IMWP 4ANCA 1XMOF 3P6YC 1HQ2A 4DHVA 3P8BB 4Q43A 2VDHA 2KYXA 2G0CA 1S7IA 5C42A 1FJGJ 5DJBA 2J7KA 3H25A 5KFNA 4B9UA 4W98A 2B8QA 4GMKA 4MIAA 4I4BA 5JMNA 2DRBA 3PKMA 3LAKA 4RBTA 1XEZA 1F6TA 3GWCA 1TAQA 3EZUA 4KFBA 4DDFA 2XYGB 4Q7AA 2LEBA 3S1TA 1NKEA 1PKUA 2B56A 4ED7A 1VDHA 3DLGB 4TXSA 4ED8A 1VJQA 4TU8A 4HDGA 2IIHA 5ETMA 1CC7A 5KFKA 4KJIA 3B8HA 5HLFA 3RB4A 2GA7A 3CIMA 3CSKA 3AOAA 1IUJA 3W9JA 2DYAA 2GIRA 2RNEA 4U9RA 2CWKA 4C48A 2GHPA 1S10A 1YJUA 4JI3F 2DJWA 2BJ9A 2XY5A 1VRTB 3DXSX 2L3MA 3HKWA 4WFYA 2ZM6J 4O3NA 3IG1B 1F1BB 2NPIA 2DGOA 4LF9F 2UVWA 1PG5B 1RGVA 5GADU 1NPKA 4J7CA 1WKKA 1OJ4A 5GAEI 4FVCA 1NJZA 5AXNA 2RH3A 4ELTA 4K50A 1N36F 2IA0A 3CMAS 1DTTB 4CO4A 5K20B 3KMSA 1YGYA 4OIXA 2KO1A 3UD3P 4FF2A 3CUNA 4C8KA 2R4FA 4LIRA 5EWFA 1K0VA 1UPMB 5CCLA 3KJVA 3MFHA 2W9CA 3RRGA 3ICLA 1UTAA 1QE1B 2AMCB 2WZ1A 4JI4F 1ULRA 5F3ZA 4OHZA 2BABA 2ZBPA 4ECXA 1YBAA 4K4ZA 1X4DA 1P8GA 2J0QD 4DL6A 2FLNA 1HWLA 4X4VA 2W7AA 3CCVS 2Y0SD 4LF8J 1T95A 3SIPB 2IDEA 2B8PA 3M8WA 1U6FA 4DLEA 4U6PA 3M30A 1HBNA 2DO0A 3HSZA 1YJVA 1Q0NA 4ED2A 3DRPA 1WEXA 2CQ2A 2KU7A 2RSQA 2QMUB 1FDAA 3LO3A 1RWKB 4PXEA 1C0TB 1KQGB 1S79A 3KHLA 3AJ1A 3MI7X 2YKNB 4C0BA 5DM6Q 5FLXU 1LOUA 2DISA 1C1BA 4IQXA 1NZ8A 3OXFA 3CJ5A 1IR1A 4ZLNA 2HBYB 2V8GA 1YJWS 3DI6A 2OEKA 4F7VA 4USWA 2IJNA 3QT6A 1AT1B 2DR6A 1TL5A 4V19X 1U4BA 1RAIB 3M2RB 1SV5A 4J5OA 5J2MB 5KG1A 3I5BA 4OV1A 4B9MA 5LMNF 5CABA 4ECUA 4DOZA 2BKOA 1Q53A 3BPDA 3LP2A 1KKHA 4A8FA 4AL5A 3A12A 2D3UA 5K8PA 3GIJA 2V4QA 4YN3B 3MPYA 5KFLA 2A6MA 2H9ZA 1TL3A 3RB6A 4P7VA 1JLBB 2AT1B 2MEWA 3VWSA 2AYGA 4EFAC 3AJDA 1Z1ZA 3AB2B 3FZBA 4L6V3 1LWCB 2C2EA 2CXEA 2Y1JA 3GONA 3NS5A 1NDKA 1RT1B 3GJSB 1KQSR 2PDAA 4WBFA 3TJAA 3OTDA 2ZNZA 3BO4A 2FVSA 1WC1A 1M1KT 2HRYA 2N3LA 1FRLA 2RQMA 1EAYC 2Z2ZA 3QZ7A 3H5YA 3SDEA 1X31C 3M8ZA 4URSA 3CD7A 3CDBA 4CLFA 1RT4B 5D4OA 3UI3A 4USMA 5C25B 4M63A 4KGXB 4C9DA 1SJ1A 2LQ5A 4ZVUB 2OPSB 3BGFA 2Q79A 2JWNA 2JVRA 3B4DA 2YNHB 3ZTQA 2RF2B 4ICLB 1CJVA 2DY1A 3WQPA 2YVSA 2IDLA 1FFSB 1W26A 4B9VA 2QL5B 3TZZA 1S1UB 2F4VJ 2FQQB 2DXEA 1OWXA 4OZ2A 5HQMA 2DNLA 3DRSB 1D0EA 3W5YA 2X1FA 5KFIA 4YB7A 2VU5A 3F41A 2I8EA 2Y1RI 3ONQA 3KG1A 1SUQB 1MWQA 4AQYJ 4J9KA 4I7FA 4JI2F 4I2PB 4NCGA 5JXSA 2CA9A 1NB2A 1S6OA 3UNGC 4B3OA 2OO4A 1EETB 4DV0F 3H8YA 4C0OC 4ES2A 3ZNJ1 4F4ZA 4FBTA 5KFZA 3PFOA 4PUOA 1S76D 4IG3A 1FXRA 1PJ5A 2ZH4A 1EKSA 1V9OA 4CM2A 1Y4ZB 5HO4A 1NXIA 3FQKA 3CEDA 4H4KC 3DLHA 2XTJP 4ZLPA 4CZCA 2YWGA 2FY8A 5KFXA 3MFIA 4WFZA 3ZTSA 5E3CA 4XDCA 2OELA 1FFGB 2A2CA 2RDIA 3RBXA 2QLJB 2EKNA 2KFZA 2XEXA 2C2RA 5B0CA 1M0SA 2RU3A 2WVFA 3DGPB 1RLCL 2E9TA 4IO9Q 1Y10A 2NYHA 4LVNP 3LANA 2R7RA 4X66J 5HVHA 3RR7A 4DR2J 4OYOA 2WSCC 4DUYF 1EB0A 3EDRB 2RKIA 9RUBA 2QA4S 2DH7A 3A8KA 5E3RA 3D54A 1MU2A 4WU2A 3IAM9 1N32J 4DV4J 3RAQA 1RWNB 4ZP7A 3F73A 5KFDA 3DRYA 2V8DA 4ZJLA 2XMVA 3EE3A 4K4XA 2ABYA 5F41A 3VVTA 2VFTA 1F5AA 3LGMA 1FK9B 1KTVA 3K7RA 4M5DA 1J2VA 1FDNA 3PKYA 2AX1A 3OTEA 5L38A 1OYDA 1FX4A 4C4WA 5E0OA 3J81j 2NQPA 5BR8F 3OW2R 2RT3A 3T3FA 4TYBA 2XMKA 1NPRA 3BB5A 1WEZA 1HIYA 2UUCJ 4C2MA 4LF6F 4HTIA 2ZH8A 4JI5F 2C2ZB 3CCTA 2HSEB 2H5EA 1T9VA 3G71S 1OO0B 4OQJA 1O6XA 1T11A 4OI2A 1N5QA 1HI1A 2JDJA 2ALZA 4ZHRA 3C14A 2K1RA 3R6GB 5H9EJ 5HANA 2PC6A 2HIYA 3DRXA 4WFNQ 5BJRA 1MROB 2GMJA 4RW4A 3CTRA 4RW6A 1XMBA 1FESA 4AD6A 2E5LJ 1U1MA 1IQTA 3BQ2A 2B43A 2GQCA 1VQ6S 3C16A 1VC6A 5J2NA 1XK8A 4NX9A 2OLWA 3EWGA 4MFBA 2OPQB 2C28A 2IAJA 3K17A 4LBHA 4I0WA 1JNZB 4IOAQ 4NE9C 1HQEB 1ROFA 2V67A 1TU0B 4G3IA 1E6VA 4MTPA 1REGX 4OHXA 4ANEA 1GXLA 1U1KA 2G2OA 2UV8A 4OYWA 3TUZC 2HMIA 3CJTA 2OPPA 1JLGB 1H74A 1WEYA 2D69A 1NHVA 2LFVA 4NA3A 1G3OA 1N6QA 4LQ9A 1T9UA 3WC0A 1P27B 4WXWA 5F9NA 3PFEA 3RAMA 4CLKA 1NEEA 1T3NA 2B6AB 4D3GA 4DV3J 4X4NA 2F9JA 5H9FJ 1DBDA 1S0VA 3JSBA 5KOWA 4F3MA 5GAHU 4IQMA 4OYXA 1VJWA 3IM9A 5K8NA 1FKOA 2XLJA 1IKVA 4NLXA 5DLGA 3BH7B 1X9WA 2FUG9 2K06A 1T8EA 1SH2A 1IKYA 4OJHA 2MZTA 2CNKB 5EWGA 2XSJA 5DS7A 3MMBB 3OT9A 4C8MA 3R3TA 3RB3A 3WX4A 3CO9A 2Z58B 1NJXA 2MJUA 3A3NB 3PW0A 5AXLA 3R1LA 3D6HB 3X3UA 5D4LA 3IS9A 3D1HA 1ZM3A 1XJWB 4HI2A 1C1CB 3FFIB 3W5XA 2R2RA 4L74A 4RKUC 1HBUA 3TZYA 4LF2A 4N47A 3I0RB 2OEJA 1VRUA 2HHVA 2Q6BA 3AH6A 3R5GA 3BN4A 2R7TA 4Y00A 1Y3JA 3Q86A 1FTRA 5KFFA 2VA2A 4LF7F 3MCMA 1EHWA 4CLLA 3SEOA 4WE1B 2GHVC 2CQ1A 1IKXB 2VD3A 3MTKA 1F3VA 3D28A 3DDIA 2VBWA 5ITHA 3DOKA 2CQIA 3QAEA 3HD1A 2XB2D 5CA5A 1A7GE 3PW2A 3I32A 2D3ZA 3Q0AA 1RWPB 3HKZD 1UW4A 4TU7A 3P5BP 2GVDB 2YX4A 1FWLA 2NYIA 4R5PB 3BREA 5KFTA 2QLXA 3T5JA 3F0NA 1IBLF 4MKYA 1QLNA 5EWEA 3PO4A 5A6PA 1HQUA 3M2UB 1AW0A 4KIAA 3MTJA 1PSDA 4WFBQ 4RW9A 3EJMA 2IC3A 5AJ3J 1ZS6A 2V9KA 1NCLA 1T9XA 2PA8D 1OSDA 1S6UA 3IWXA 2RS8A 4ER8A 1LWFB 1S6QA 1N56A 4HEA9 2ROGA 2MY7A 1DQ9A 2F5GA 4ZVGA 3J80Y 2FLLA 3FMWA 3OR2B 4NLPA 3PCOB 5IS2A 1JK9B 2VFSA 4U8VA 5DG8A 2RIJA 3K8WA 4P71A 1X4FA 4ECRA 1BUXA 5HATA 2WHOA 1HMVB 4ZPVR 2DEIA 3VVUA 2CWXA 2OD6A 3FNNA 4ZPWR 3TAPA 3LP0A 2YKOA 2XZDB 3W7BA 1KHVA 4USKA 2YX7A 4ZDNA 3MMAB 5C7PA 1YHQS 3JQJA 3NMAA 2AHOB 4O4GA 3M6WA 2CPDA 1WNEA 1YBTA 2CPHA 4GVBB 5IOLA 2MLZA 3UN2A 4JUZA 3MAHA 5KG6A 2D7SA 4LSLB 2VC1A 3MM6B 3AY0A 3P3DA 3J7A1 1PBAA 4DL5A 1WELA 2IVYA 1ZAXA 1CS4A 1IJEB 2J5AA 3GE9A 1X4EA 1SB6A 2V2VA 3OFFA 2JRSA 3QQCD 1H7WA 3DCAA 2UUBF 3C15B 3TEGA 3ILLA 1NK4A 1YWXA 2KN4A 3OTBA 5H1SV 4DV6F 4YDXA 1OSCA 3K5OA 3DN9A 3Q23A 3QJJA 2XLIA 3VR1A 4JYAJ 3QGPA 4C8OA 4MYUA 1RCOB 4KR0B 4ZPCA 4Q0BA 4HKQA 3FGVA 2KT2A 2NXCA 2GGPB 4PWWA 4Q2MA 3UD5A 1HYSA 1BQNA 1WACA 1GMVA 1EX8A 2W4CA 1X5SA 1VQLS 4KGKA 1AFJA 3KUGA 3R5BA 3CE8A 3Q24A 4FPRA 4XK8C 3THTA 5LXYA 1R0AA 4IDKB 3V6KA 3PG9A 4KT0C 3VGSA 1UVMA 2HWTA 1KHWA 3N6MA 1RYSA 4F4KA 3K5LA 4PWDA 4AUKA 1GH8A 2QEXS 2BMBA 1M5HA 1F0XA 1GXTA 1TL1B 1UMJA 1UA1A 2VG6A 3CCLS 1XC9A 1RTDA 4FN5A 4YHHF 1RTJA 2Z2LA 2HZCA 3K89A 1H38A 4PABA 3DM2B 4LBIA 2CG8A 4TLRA 2M4MA 1BQMA 5K8OA 1DY3A 3U7JA 2R3VA 5I42A 1XN9A 1NRKA 2AF6A 3MM7B 2MQPA 4NXMJ 4PR6A 3C66A 3I4PA 3H59A 4DPUA 2D9OA 4CTAA 2QSFA 3D0IE 5KFEA 4QZVB 2B4OA 4Z2XA 2OSRA 4R0JA 3VAJA 3S01A 3ILOA 1JMTA 1AXQA 4OL8A 2PIIA 1FJGF 5A8KA 3C6UA 2UVVA 3KG0A 3UPFA 1UA0A 3MM9B 2ZD1B 4OX9J 1RISA 1PAUB 3FCWA 1C4AA 3NNCA 2OMOA 1G2EA 2R7SA 4UW2A 4K5SA 2HFVA 5CZXA 3PR5B 3PR4A 3KXDA 3Q8RB 1XMQJ 3K2YA 4FF4A 3JYTB 3HFVA 3GG0A 2ZVSA 1S1TB 2M3DA 3DOLB 3QYYA 2KM8B 1T05B 2BRLA 3FEXB 3CNQP 5E5NA 2XMWA 3J80U 2KXNB 3MEGB 4LSZB 5IT0A 2OEMA 3CD5A 3QRPA 4KPCA 1SI9A 3DLLQ 3GFZA 2X1GA 1RP5A 4EUVA 3W9IA 1TKZA 2IBOA 3D9BA 5KFUA 1KVIA 2JEIA 1AFIA 4ID5B 1SH0A 1D9AA 4QR2A 1L5UA 1TUGB 1R6YA 4OLPA 5KG0A 4ZKAA 4IFVB 3MF5A 4P52A 3QO9A 1FCAA 3W63A 1H72C 3FSIA 3RRHA 1LW2B 3PRDA 4LFCJ 4HHHA 5ETRA 3MR5A 2YQ3A 1I94J 1WHWA 1U1OA 3L7OA 1Q86T 3QSYB 3IRXA 3D3BJ 1YJNS 2B51A 3D2WA 2HNZB 2YNIB 2EFGA 3MDFA 4RW8A 4CT9A 1RA6A 3OVSA 1UFWA 2HAIA 5A0YB 1V6HA 1VQMS 4JI1J 4LRFA 4AYBD 1QVFR 2I5JB 1Y11A 3GSIA 3DMJB 3PX0A 3TJ8A 3MM8B 3KUEA 1Z4UA 5GAGI 1XMOJ 1GQEA 1LW0A 1T3OA 5B7WA 1BY9A 2W8KA 4QWAA 5LL6d 4DG1B 5IV4A 4B3TF 1TR0A 3ZZTA 4UZBA 1T03A 4WFXA 2VQFJ 4ZVQB 3R7NB 4NEYA 5DZ7A 2D3OR 2DNRA 3JAMU 4DWIA 2GV1A 3W60A 5CYMA 2FJXA 4J9VA 1NSPA 3J7Z5 2LKZA 2BJDA 1GX6A 1WWHA 4ZK7M 4XPEA 2IMOA 5KT4A 4OYBA 4CNZA 2V50A 3JSMB 3HMJG 4F02A 3TWZA 4JP8A 1S1VB 4G1PA 2ADBA 3VAKA 1B64A 1RLDA 4Y2KA 4QR1A 1W2BR 1UVKA 1TKDA 2FGOA 3QRRA 1WG4A 4RL1A 2WVCA 1JJ2R 4FVMA 2ZZTA 4IRKA 1FF2A 3PYEA 3HVTA 4ED5A 2XC9A 4B3MJ 2B5JA 5L1JA 1UVIA 3G4SS 3J7YI 4A48A 2IA6A 3VF0B 3CB4A 4U7CA 4OZ5A 4QIGA 2W2NP 4IRDA 3MGJA 3T6JA 5ETOA 3SFUA 5EN1A 2OIHA 3MMCB 1OIAA 4EYHB 2HHWA 4MK8A 4W90B 4ECWA 4R25A 1KS2A 1FRKA 2NLWA 1HR0F 2XM3A 4DQSA 1KFDA 5DDRC 3OBIA 1TVRA 2GCFA 2QN6B 2XS2A 2L08A 3W2VB 3VZIA 4F4YA 4ECQA 2KG0A 3CT9A 3H7HB 3MM5A 1RT6B 5B0GA 2QC3A 4ZMMA 1CJTB 4CM0A 4MKVA 3UR3C 1WDTA 4EBCA 1O5JA 1K9MT 1VBYA 4DV5F 3DOMA 4NI2A 4RW7B 2C2KB 2KL8A 3H4DA 1TK0A 2YNFA 2KVQE 3JTOA 1EP4A 4O4RA 3Q83A 2IRUA 1MW7A 2JH3A 1HWUA 3ZNUA 4LQ3A 1QUVA 2MLXA 2Z2YB 3M7VA 2CQ3A 2WCXA 2CPJA 2YH1A 4RLEA 2F3JA 2VL1A 1W25A 1HLWA 4FYXB 3M9MB 2QMXA 1U6ZA 4X62J 2APOA 1JNRB 4IRCA 2HRUA 2KDOA 2F4VF 3H2UB 5HAOA 2MZJA 2MY8A 1YJRA 5AE3A 3KJVB 2ZJPQ 2ZKTA 1LFWA 3P45B 1ZTTA 5D77A 1WOSA 4PG4A 1L3UA 2DY9A 2OP5A 2BE7D 5LM7E 4LREA 5I3QA 3R2CJ 2FVQA 1NSKL 5A8WB 1OY6A 4NRUA 3IR7B 1NPPA 4B3RJ 1RTIB 4DBQA 3HHKA 2YTCA 2CDQA 3T5LA 3KYLA 4OI0A 3SCIE 2E5IA 5DZ6A 5AXKA 2HHUA 1XQIA 2BKNA 3UD4P 1HBNB 2XCAA 3DRPB 4IH7A 4XAKA 1KOOA 4ETZA 2IM3A 2DT9A 1KBRA 1CLFA 4YQWA 2DBBA 2J7WA 1TL7B 3KLIB 3G82B 3ZZUA 4ATNA 2EXUA 2OPRA 3GP9A 3PW5A 4AXIA 5B0AA 2YQ0A 4ITSA 2U1AA 4HTJA 3JTNA 1FWKA 2LXIA 4S0MA 2VB6A 3W8PA 2MXYA 4L72B 5T7LA 4ZVHA 3DRRA 3DI6B 3M8RA 5J2QA 2MQNA 3FSXA 3RU0A 3OTOJ 4X66F 2JFDA 3LOUA 1VHFA 3BYRA 2RD5C 1HARA 2VG5B 1DTQA 3E8OA 5AT1B 1J27A 3HHEA 1FNOA 3LP2B 1PCAA 3EVWA 4GC6A 5KFSA 4DL3A 4U95A 1V5IB 1N32F 3O3LA 1N5VA 1B7FA 2HKEA 4DL0C 3TZXA 2IM2A 3OVBA 4JV1A 2PMWA 3L7UA 1PYTA 2CQ4A 2R7XA 3RRKA 3KK3B 1Y3KA 3UCGA 3SQOP 4QWCA 1MN7A 2DGSA 1UETA 4Y34A 2DNPA 1AA1B 2BKPA 5I3UA 2LDIA 4CYUA 3VAMA 3SQGB 2EK6A 7FDRA 3LTOA 3MR7A 1FNMA 1HPZA 2V63A 4TNOA 3M9NB 2KZMA 2ZBIA 4K4YA 2Z0GA 3H40A 1RKIA 2MKHA 3H2VE 4HHJA 4YEAA 3HJVA 4TQSA 3D4JA 1FRXA 2UUCF 2EBEA 2ZKUA 2ZBQA 2CFXA 2QFIA 3P4UB 3Q2SC 2AZ1A 2HHXA 1IR0A 4WP3A 3KLEA 5KG5A 3KUHA 4V19J 4QBUA 5CQGA 4ZPDA 1IBMF 1CJVB 5CD4A 3V6JA 3K5MA 1U0HA 4DX6A 3CJ2A 2PFFB 1WKLA 3EX7B 2DGTA 3D66A 4BDPA 3DU5A 2E5LF 1RU2A 2MQLA 4ERDA 2BUNA 1JLAA 5DG7A 4NLQA 4PQUA 5M2RA 4KGZB 4I7FB 2N4DA 2YKMB 4WK3A 3J81Y 3OFEA 5B09A 4ES1A 2O5DA 4ZN3A 3NGUA 1HNZJ 3MHYA 4KKOA 2MKKA 1JLCB 2BJ1A 3A8EA 2L9DA 1SKWA 3OVAA 3IMQJ 2XNRA 2Y1IA 3AQOA 1TKXB 1S9GB 3QBCA 1CULA 2X7IA 3E01A 1UKUA 1UEUA 4KGMA 1TUVA 1NMEB 1EQMA 2W1BA 3DFEA 2J0XA 1M1HA 2BQRA 4RU2A 1JLEA 3H98A 4TKTA 1REVA 4A4JA 3ITHB 1CQMA 5LSOA 3TYTA 4C6AA 4HH0A 2FZGB 3CVKA 2W9AA 4Y65A 2GJFA 5RUBA 1ICEB 1UVNA 1KN6A 4G1QA 3QMQA 4TYAA 4Y3CA 4LF6J 3O5TB 4M5IA 4DQIA 2RKIB 3BKFA 4MAKA 2KVIA 4DZDA 2FJAB 2KFNA 2JL9A 2G1DA 2Z57B 1CQNA 3IWLA 7FD1A 1JLQA 1RU1A 4PXCA 4I2QA 3G87A 5H9EK 5GAEU 2C22A 3OXGA 2ZUGA 4WJBA 4DSKA 2MKJA 1HW8A 1PIEA 3LWLA 2ASDA 4ZIWA 1DQAA 4EMDA 1JLFA 3R8YA 5M2UA 4MMOA 3IFEA 1VQ4S 2MB0B 2NPFA 4M5DB 1M90T 1QTMA 1FKPA 3ZXWA 4OZ0A 2UVUA 4M5GA 2QJ3A 3TQ1A 3FMBA 1WSVA 1CJKB 4LVOP 3CW2C 3MZIA 2KYZA 2N82B 1VIXA 3QT5A 5IC4B 4DR4J 4CIOA 3PJWA 2HBQB 1FE4A 3QFHA 3CJSA 1FJ7A 3BSAA 4PEOA 4AFFA 3QGIA 3DHXA 3WZ0A 1XERA 4NLTA 2LECA 2GVZA 4MJKA 2DIVA 4YY3F 2I2YA 2J6UA 2CPEA 1S9EA 1QAJA 3QPIA 1IQZA 3ZO7A 4B9SA 2ACMA 3HHLA 3C14B 2LU1A 3P96A 1R31A 5DDOC 2HGNA 2AWZA 1NAQA 5A8RB 3OHAA 1U1RA 1S1XA 2W01A 4NLRA 1LWXA 1FT8A 4PYAA 4BHQA 3LAMA 3NNHA 1S97A 5ETQA 5H9FK 1AZSA 3RBZA 3A8JA 2DB1A 3CJ4A 3OV7A 4TN2A 2WSFC 1N88A 2ZDPA 2XYHB 3D68A 4CP5A 3RR8A 5AJ3F 4F4XA 1EKRA 5CYQB 4L3KA 1UWBB 1SKSA 1Q5YA 5E33A 2KJVA 2W9BB 5DGAA 4KBIA 4NXNJ 3VAGA 3JSRA 1C2PA 4C3MA 5JVGQ 2C3UA 2VFRA 4WKYA 2J0WA 2E1MC 3JQKA 4NRTA 2LQ9A 1ZPWX 2CJBA 2OKQA 4RUHA 2EG2A 3DLGA 4P72A 1QJHA 1IVZA 4USJC 2HMIB 5CHCB 4LF5J 3OR1B 4FYVB 3T1HF 3LGHA 5L1KA 4NMXA 1IM4A 4CWBA 2RJZA 2W7PA 3J81U 1NZAA 2NREA 3HF5A 2DRDA 2BANA 2POKA 4IFYB 1VRTA 2N4CA 1X4AA 1RTHA 2F7VA 5T41A 3IG1A 2DITA 4H54A 1H2VZ 2XWYA 1L3TA 1FDDA 1D8YA 2N7YA 2IJRA 3MPUB 2GO8A 3ZTOA 5THWA 4M5NA 2AJ4A 2GJ2A 4WKRA 1FKOB 1Q7LB 1IKVB 2PEBA 1RHQB 5EDWA 3CCUS 4C11B 1DTTA 4NA2A 3X1LB 5KFAA 6AT1B 2B4PA 3JQMA 2KZZA 2RVJA 3KHHA 1OS5A 2UXCF 1J5EJ 4CI0B 1L3KA 3TJ9A 1HNWF 4L3NA 5LJ3Y 4DN0A 1KSPA 2P8IA 1PJ7A 5LSRA 1GAOA 4LR7A 1SJ3P 1VQ8S 1O51A 1QE1A 3NG8A 3ENVA 4JYAF 3BO2A 1DZ5A 2DGXA 2PD1A 1UZHA 2MMYA 2KXFA 1HBUB 3N5BA 1FTCA 4IG0B 3HSDA 3IAS9 4DR7F 2H3EB 4YDDB 2R7VA 1ELOA 4HACB 5E3AA 1FHTA 3V4IB 1WHVA 2NXEA 3OFGA 2DNYA 1DARA 3NAIA 3KK1A 2W7OA 3GJRB 1VIOA 2LA4A 4F26A 5HN0A 6FDRA 2BYCA 4J9QA 4F4WA 2EFOA 1C0TA 4Z37A 1GX5A 1N8RT 1S77D 4DU8A 4RWXA 2R2SA 2YKNA 3TNVA 4OJ3A 3LW5C 1J5OA 1JB0C 2HBRB 5JUMA 2H48B 4M5HA 5GVQA 5J2PB 3PZPA 4C8LA 1TQLA 4LRDA 5JJBA 1HQUB 4LMZA 2ZOGA 3W8GA 3M2RA 3DLBA 4ELUA 3R5JB 3GJQB 1D3WA 3KTQA 3D0GE 4NXMF 2Y8YA 1S4FA 3GYXB 3MECA 2KH9A 1Q8BA 4PG8A 1ZOTA 3CCJS 3GILA 2E1RA 2D9PA 3MAQA 4Q2LA 4JV0A 1A6LA 4IOCQ 2Y9HA 1X5OA 3V6HA 3G8TA 2RAQA 2OFHX 5KG2A 1IWGA 2JSXA 3DDKA 1X4GA 2EK1A 2YH0A 1NK8A 4TQRA 1S49A 3A13A 4CLSA 1RT1A 2WTFA 1F2HA 3CC4S 2HWHA 1R8AA 4UUWA 4LRBA 1K73T 3SSRA 3FCHA 4DI6A 2AJ1A 2IBKA 2M7SA 1R0CB 1FD2A 1T0TV 2YPZA 1DHMA 3C6TA 2MDAA 3LWMA 2R8IA 3IGVA 1XMQF 4Y2CA 4ZP9A 1S7HA 3BKTA 2CKWA 1K44A 1SC6A 4NCAA 3GR0A 1Y5IB 3M2VB 3CC7S 2DCUB 5ETPA 1RT4A 4OI1A 1JWWA 1VGYA 2YNGA 5F8HA 2KRBA 3GCXP 5C25A 2NXNA 2LU2A 4EGLA 2FJDB 1U45A 2L9WA 2ZFHA 3L09A 3WIVA 3KJQB 2YNHA 5F0UA 5SZTA 1HKAA 2V69A 3KLHB 1RAGB 3IR6B 4NMLA 2M8DB 3H5UA 4ICLA 1BLUA 4OI3A 4NYOA 1FRJA 3DXBA 3AXMA 3MD1A 3O1LA 3D7SB 2YPYA 1K8AT 1S1UA 3SBMA 3W3SA 2D74B 1C0UB 1S57A 3AHPA 3D5MA 2DGUA 5A2QY 3POTB 1I94F 3J7ZT 3DRSA 4BLGA 3MMJA 3HHNB 4L76A 2DGVA 4BC9A 1RZMA 4KH1B 3D67A 2CPZA 4UQTA 4QW8A 3K57A 2A2DA 2HHHF 1LV5A 4Q0BB 4HDHA 3NMRA 4PRFA 4CQ1A 5K14B 4FXDA 3PX6A 3HSGA 4UOGA 1XNRJ 1SXLA 1XNQJ 4IH6A 4I56A 3EGNA 1R0AB 5DG9A 3MUTP 4YP3A 1MSWD 2NR0A 3OL7A 2QT7A 1WTFA 1U7LA 2JEJA 2XWXA 3M32B 3IBWA 2M88A 4O0IA 3GQCA 1W2IA 3EICA 3ILIA 2VQFF 1HWKA 5DRKA 1HNIB 2ZHAA 2MQQA 3CC2S 2FJWA 2VHGA 2BBEA 1RTDB 3FSYA 5AE2A 1RTJB 1SPBP 3FRZA 3DGPA 1TL4A 3BSNA 1P9QC 2VFUA 2ZE2B 2XO7A 4DS4A 3PXGa 2JLGA 1Z2LA 1QSYA 4PG7A 3VHQA 2FYXA 4DLGA 3FRYA 3W66A 2UUWA 2HG4A 5HP1B 4CH0S 2EWHA 4QQBA 1WI6A 4U8YA 2ZWPA 1DLOA 4YR0A 2NUHA 4WZQA 4B3MF 2I9SA 4C8YA 2V4JB 4URGA 3C6UB 5A6WA 1S1WB 1N33F 5DQIA 4ZLLA 1AUDA 3H2LA 5AXMA 2GAHC 2H1YA 4RPFA 4KGVB 1SL0A 1KLMB 4QIFA 5LSLA 1BC6A 3I9ZA 1FK9A 4H4OB 1PC4A 1S6PA 1RHMB 4DL7A 4C8ZA 3VGUA 1VHIA 2XNQA 4DR6J 2UU9J 2HQ3A 2VODA 2ZH7A 2CADA 4RO0A 1Y5LB 1MMNA 3AOBA 1U25A 5FD1A 1X5PA 5CZVA 4B17A 3CD6S 1MMLA 4GKKJ 1F9FA 4K59A 3THVA 3Q89A 3KLFB 3DDNA 3HVAA 2QLBB 3BPSP 3OLAA 1YLXA 4N41A 3QIPB 2G4BA 3QATA 4K2JA 1VK8A 4DEZA 1ZPVA 3FQLA 1SVDA 1TKZB 4Y6IA 1F9HA 4B3TJ 2GMLA 2HQCA 3K5NA 2BOPA 1KQFB 4ZPAA 5F8NA 1MROA 1HI0P 1FVQA 2MQMA 3MCSA 5C5JA 4A8WA 3SMZA 4U67Q 3QAUA 2N7CA 4GC7A 3CCSS 1JX4A 4JI7F 1F2GA 3IRXB 4NZ0A 4OZJA 4F0MA 4X62F 4IUFA 4I6AA 4RW8B 3P49B 3RAXA 5D8HB 2HAFA 2VOOA 4OI6A 3R7SB 2BOAA 3AODA 1Q79A 1HQEA 1GMWA 2HNDB 1NDPA 2YWHA 3KLGB 3R6LB 3BYPA 4ZCMA 3G6VA 2KG1A 1WD6A 4O44B 1Q78A 2J9DA 1JLGA 4B3RF 3PV8A 4C3LA 3CJQA 5E3QA 3GJTB 1X4HA 3QJLA 4USHA 2K2PA 4Q45A 2AYEA 5D0EA 4LFAJ 1VQYA 4A8YA 2F1FA 2B6AA 1Q7YT 3PY8A 1KP6A 2AIRB 2M9KA 1RE1B 3IP0A 4YMEA 3CCES 1HR0J 3VZHA 1JXEA 3HI9A 2XBPA 3EPIA 1A0OB 2DR5A 1BWVA 2AKWB 2DR8A 2R8KA 4I64A 1U02A 3CMES 2CJAA 2X1BA 4FS2A 3U1NA 4K0KJ 2PO4A 4CH1A 1R3NA 2FIUA 8AT1B 4ED4A 2HFOA 1X4CA 2HVZA 3OTOF 4QIEA 2ZH9A 2OTLS 3QLHB 4NLVA 4NASA 2R42A 3M8QA 4DV5J 4LF4F 5CYJA 1H98A 2PN6A 3GFHA 1VRQC 1R0BG 1GTEA 1DJ0A 1E6YA 2WW8A 2V5HG 3LUYA 3G9CA 2V4RA 1SC4B 1RB0A 4X4QA 3FFIA 1IBCB 4FNHA 1RWMB 2HQIA 3W2WB 5ETTA 2YWWA 4DMZA 1VOMA 4WIQA 3I0RA 5F0WA 1RXOB 3UW1A 3I5CA 2HK3A 3RW7A 2JX2A 1QSLA 2FLOA 4H4MA 4FXWA 1HW9A 2UV8G 2C3PA 2P2CB 4X84A 1Q1KA 3EXCX 2XS7A 2GC8A 4WE1A 5LT5A 2EEYA 1IKXA 2V9WA 4GKJJ 2EC0A 1Y5NB 2HS3A 2BDPA 3MM5B 3N01A 2IFXA 2R7OA 5D0RA 2KRRA 2BM0A 1SQGA 1KLNA 1UJ4A 3H42A 2LXUA 4F0HA 1OPIA 2XHCA 1U47A 2MTLA 4NI2B 4NA1A 3M8PB 2RQKA 4A8OA 2N3OA 3KLVA 2DH8A 3UVJB 3KDOA 2GVDA 3L3CA 2DHGA 3VAFA 2I0XA 4R5PA 1S4EA 2FHJA 3NGRA 2ZOFA 3Q22A 1LWEB 1LK5A 1RA7A 1U0SA 1RHKB 4G1IA 3M2UA 2LA6A 1OQ6A 5KFGA 2VBYA 3NWRA 2V68A 3MPVA 2IYGA 1N34J 2ZITA 3B78A 2RE1A 1HWIA 2BJEA 1HD1A 3PIPQ 3R5DA 3HD2A 2YKPA 4QCLA 4LSNB 1LWFA 4B9LA 3TAMB 2L48A 2W2MP 2CQPA 2X3GA 3HVWA 2ZH3A 4F3OA 3GR1A 3GIMA 1S0OA 3RB0A 3OR2A 4DUZJ 1N5YB 3GU0A 4MK7A 3CMQA 1RWXB 1X0FA 1HNZF 1EIYB 2CNOB 3M6VA 1FX2A 1RADB 3VALA 2IM0A 4NEZA 2WW4A 1RK8A 2NCKL 2DIUA 1GMUA 1HMVA 2GIFA 2PA3A 5HSPA 4PCQA 2DPJA 3F44A 2RUGA 4E8UA 2ZH6A 3B54A 3VQSA 2R7WA 3TX0A 3MMAA 1HNVB 3SZ2A 4M1KA 2W24A 4CDIA 1IR2A 4QPTA 2OPRB 4GVBA 3SCJE 2VG7B 1B0TA 5F9LA 3ZZ0A 2D1CA 4DZ6A 3HO1A 1TZ0A 3H90A 5F8GA 1BHNA 3L7PA 3DLEB 2VF3A 1EZZB 5DDQC 4HI1A 2IJFA 2J9CA 5KFMA 4RNOA 1UCNA 4AXJA 2JHEA 3R9LA 2J8SA 2E5JA 4IYQA 1RAEB 2GQQA 4B02A 3C15A 4ETXA 3JXOA 3WX8A 1DTQB 4B9TA 1T02A 2Y3YA 3KK2B 3BKUA 1UJ5A 3ETMA 1XR6A 3MAAB 4FNIA 2BVZA 1IBMJ 2G0IA 3R7BB 3JSYA 2BE2B 3B4MA 3NKYA 4UZCA 2GGPA 3RTVA 3SCLE 3AJ2A 1SIZA 4KV8B 3L9ZA 1RBOB 4OYZA 1TK5A 3BV8A 1HBMA 3GV7B 4J9UE 1ZZFA 2HNYB 1CBKA 1JQGA 2H5JB 2Z56B 2VV5A 2BACA 5I3UB 4IDKA 4P10A 1RQ0A 3MEDB 3OL8A 2QRRA 3NOGA 1HPZB 5DETA 3EUNA 2CNNB 2G9OA 2NXJA 2ZNYA 4OJ1A 2MQOA 3KDNA 1CEZA 5LXRA 4YOEA 4KC5A 3IBCB 1OMSA 3DYAA 4DR4F 1N0UA 3VGVA 5GAGU 3CCQS 3U1LA 1VR6A 3THPA 3OL9A 1TL1A 2JC1A 2C2OB 3NGTA 4J9NA 3SFGA 2ZC4A 2CVEA 1S0NA 3S7RA 3GZ7A 4X64F 2BW7A 3GCWP 4PAAA 2R8HA 3MM7A 1RUSA 4OHYA 3N0VA 4M5LA 4WXOA 3BDPA 3ZC4A 3N79A 1MWZA 3BGRB 2E9ZA 2HZAA 4FDFA 4PQUB 2BRKA 2WONA 4KSEB 2MYFA 4QYZK 3MD3A 1HD0A 1U1LA 3LF0A 3BR9A 5KFRA 3MM9A 2F8HA 2ZD1A 4BBYA 4F67A 2XCPA 3QZ8A 4DX5A 4NXNF 4JI0F 2ZZMA 1GEHA 1U1NA 4UUXA 5MAOA 3I5AA 3O6QA 3E01B 1FERA 2V94A 4PG5A 3CCZA 2FTRA 2UP1A 2FJBB 5I4MA 2I38A 3E51A 3J7YU 1V3RA 4FXVA 1D8ZA 4LF5F 1S1TA 4CLPA 1T05A 4NCBA 2CPIA 2EKYA 1TELA 1PO6A 2EVZA 1TTHB 3MEGA 4CT8A 3SSQA 1CPZA 4QIVA 3QRQA 1RSCA 2DXFA 3RJMB 4PPZA 1Q8IA 2L41A 4WTOB 2XY6A 1HHSA 4ID5A 5HROB 4FF3A 4G1QB 4F4AA 4IFVA 1SL2A 3NBPB 2RILA 1LW2A 3AD9C 2CQCA 2J9DE 3PEHA 5DGBA 1F60B 2E5GA 1WSRA 2FVPA 2FHKA 2IHR1 2E1AA 2YBVA 5ETKA 5IZHA 4YY3J 2HNZA 2IYIA 3W62A 2MZRA 1Y9OA 2Q1LA 2XMMA 5IT9Y 1J5EF 1JLQB 2B7CB 5KFBA 3ADAC 4WPAA 4J91A 2DR9A 3ISNC 4AE5A 2DHAA 2JLEA 1BWEA 4KO0B 1TKTB 2ZDOA 3MM8A 4P2MA 4WK1A 2VPZB 2MGZA 5CAAA 1FO1A 3CJRA 5E41A 5ADZA 4OYMA 2R7UA 2IM1A 5AE1A 1NO8A 3T5HA 4OLOA 4U7UD 3ZZYA 4OYIA 3CJ0A 1N48A 5ETVA 4DG1A 3NS6A 5FLXY 4KPYA 2NUUG 2A0FB 1M5PC 2ZEJA 2Q3PA 4RWWA 2LQJA 1IWAA 3PTWA 3U02A 4PWUA 1SKRA 1R43A 2XGQA 3MOJB 5KT2A 4HLBA 2PT0A 5D4NA 5KFCA 5HMYA 2XZTB 2IPOB 2QX0A 4ANDA 2ROEA 2B4VA 4UOHA 1HNXJ 1HL6A 4WWSA 3BEGB 3T1HJ 4PXDA 3JSMA 4RUBA 2OTJS 5D4PA 1S1VA 3NCPA 2M0GB 4WU3A 2AX0A 4A8QA 4DCPB 5DQGA 2ZVIA 1U6BA 4BC7A 2PSZA 2Y8WA 2FY1A 4ECVA 4RBUA 1PC5A 2QZ8A 3QJPA 2PI4A 2EI5A 1AZSB 4DS5A 3KKFA 2CQGA 3ISND 5FJ4A 3CDAA 2AGQA 4WZMA 4ZP6A 4FYWB 2DHHA 1IKWA 5KFQA 5HBMA 3OD2A 4IOBA 4X4UA 4QOTA 9ATCB 2V2QA 3MMCA 5HVGA 4CLYA 4RBVA 4UTGA 2HVHA 1HBOB 2UXCJ 2CRLA 1P1TA 2XS5A 1FFWB 4ZVPB 3N4WA 1HNWJ 5HK4A 4DV7J 2VA3A 1M5KC 1PBUA 1VISA 1URRA 4QW9A 1VI7A 2C1EB 3LPEA 2OUGA 3HT0A 2E29A 2HVEA 5D3GB 3CJKB 2R2TA 5D15A 1X9MA 1Y00A 2YX1A 4DCOB 1Q8LA 2EC2A 2J76E 4A8XA 4WYWA 3T9NA 3W2VA 1AROP 2EG1A 1SCJB 3UCUP 2V2ZA 2BANB 3EYZA 1QM9A 1RT6A 4ZCLA 2G0JA 3OPKA 1UVJA 5E3PA 1CJTA 4DR7J 2ASLA 1RTHB 1ZTWA 3Q8SB 2H4YB 1I6JA 2BXJA 4KHRA 2DNQA 3UCZP 4P7TA 1VQNS 4RW7A 1KVJA 1VQ7S 2ILZA 1LQ9A 1WC6A 2KB2A 3GYGA 4YB1P 2V0NA 1A9NB 1MN9A 4ZVSB 1Q16B 3M1VA 1FRHA 1F9EB 2EPIA 1B0VA 3DLKB 3CULA 3BO3A 1DRZA 5CCMA 2DD8S 2G2ZA 3ET6B 2ZJRQ 3G8QA 4OX6A 4WIIA 4O3QA 2FC9A 4DV1F 1NK9A 5L9NA 2OHDA 2XY7A 3MEEB 2NS1B 2RRBA 1UJ6A 4I1TA 5J1EA 2HGMA 1VYAA 1OPZA 2VASA 2BE9B 3GG1A 2PI5A 5A8WA 1LEOA 3NP5A 5B0EA 3TRGA 2CZ4A 2FGCA 4WFAQ 1XNRF 1U1QA 1RTIA 1XNQF 1ZM9A 2H5IB 5HL7Q 2XMJA 3N9UC 1CC8A 4N56A 5A76A 3NOCA 2ZH5A 5IT9U 3BM7A 3UDEA 8ATCB 4ILRA 1KD1T 4FPIA 1NSQA 3KK1B 3ELHA 1RWOB 1KVKA 4TVAB 1L3VA 2Z30B 4PG6A 3C46A 1TL7A 5F8LA 1CJUA 2R2UA 2K7KA 3KLIA 1KQKA 3G82A 4WP8A 2GS8A 3KG4A 4M5JA 3V6DB 5KFYA 1IN0A 1FJEB 1RACB 1RT3A 5J1NA 3GSDA 3G96A 2EFPA 3NRBA 3PW7A 1JKHB 1QY7A 3LP1A 1RJJA 1RTZA 4A8MP 5LJ5Y 2E5HA 4NZ7A 2HFNA 3MUMP 1OYEA 1J5OB 2W4DA 4UF4A 1R8PA 1S48A 3FCVA 4YB5A 3TO8A 1RWWB 3GFYA 5DQHA 1Q8KA 4OZLA 1FRIA 4DFMA 1V3SA 2VC0A 4HT7A 2H51B 4JB8B 1YBUA 1BGXT 2VG5A 4F0KA 3WBZA 3MECB 4DQQA 2MQ8A 2WOMB 1RAOA 1WKJA 3ENQA 5K9FA 4NLWA 4DR3J 2BJ8A 4QYRA 2B4UA 2QSWA 2MSSA 2ILYA 2DR7A 3EVOA 1KOHA 1RT2B 3DLJA 5EHHA 4J9PA 7AT1B 2VQEF 1VBXA 3PRBA 3QGGA 3KK3A 2HURA 3MPWA 1G6BA 5FDLB 2NZCA 5C24B 2QYGA 2HYIB 2BR0A 1PJ6A 3OHBA 4EZ6A 3FUYA 2YQ1A 2UVRA 1ZAVA 2KT5A 3NLCA 3CCRS 3SQGA 4CLUA 4DR6F 3CDUA 2UU9F 4JI8J 2HHHJ 3VV2B 1S0MA 2O67A 4A47A 3Q8VA 3TP2A 1FWPA 3GIIA 3C6TB 3BBBA 2DHSA 4DX7A 2ZH2A 2HHPA 1SH3A 4ZVTB 1IJFB 4JV5J 1R8HA 2HBZB 4M5KA 4GKKF 2JEGA 4A46A 1RI7A 3GV5B 5HMWA 1QAYA 4F50A 3CWJA 4DQPA 4MKAA 2C42A 2YNGB 3R5CA 4K4TA 2V8PA 4KB7A 2R8GA 1I5OB 1NJYA 3FEZA 4XTTA 4YS2A 4OFZA 2KHCA 2ZC3A 4TY8B 1EARA 4ED1A 1VQ9S 4DPWA 4OMFG 2JFKA 1V3ZA 1NUEA 3LA0A 2GNKA 3QGHA 1ZETA 1U24A 5D78A 5U47A 3PJ9A 3TOQA 3Q8YA 3I0SB 4M95A 2ZH1A 2HQGA 3PNIA 3ZZPA 3PYGA 4ALZA 4EO8A 4R8UB 2CJQA 1SQEA 4LT6A 3MCNA 2GZOA 3B6BA 2BQUA 3UQSA 1R6VA 2YKQA 3HPOA 2YKMA 4X65F 4URQU 4FKYA 5EX0A 2CAJA 2MHNA 3OJSA 4CCHA 3AAWB 2VPYB 3OJUA 1ZA2B 2Z2MA 1JLCA 5KG3A 2XI2A 3MWBA 3TA2A 4A8SA 1TKXA 1WTBA 3IRWP 1S9GA 4RZRA 1U2RA 3U1MA 3FDSA 4NLGA 1HHTP 3HHLC 3I87A 1YSJA 5C42B 1NK6A 2ATLA 1VCTA 1UEKA 2M70A 1N5SA 1N33J 4C7QA 1H73A 1SIWB 2CVIA 3V2UC 3ITHA 3NY0A 2F40A 3IC1A 2DEJA 5KG7A 5ETLA 4G65A 4KFBB 1RDRA 4LFAF 4EK2A 1RBLA 2FB0A 1QTNB 1QAIA 3FBEA 3D0HE 3M6XA 1V5VA 2MSTA 3UWTA 2GFFA 5L39A 1Q4RA 1T9WA 4ZLJA 2XLKA 5HLFB 2KT3A 5F8IA 3W65A 5IC6B 3RBDA 1YTYA 4ECSA 3MEKA 1PAEX 1NKCA 2EFNA 3E3XA 2AV5A 5E7OB 1GT8A 3W1YC 1NM2A 4K0KF 3N6NA 3NAHA 2E7VA 4ZP8A 1YJ9S 3HDSA 2IRXA 5G0RA 1DLOB 1BXNA 3T41A 4JI6J 5HMXA 2ADCA 3VAHA 2F9DA 2EFQA 3PW4A 3PO5A 4MK9A 4YR3A 4DU7A 4ES3A 2WVBA 1N0VC 1Z2ZA 2B9EA 4UQGA 1RCXB 1ZBTA 4W92B 2UXDJ 4JI7J 3SYZA 4KH0B 3HHLD 4D3HA 5HJXA 2X1AA 1S6PB 4O3SA 3CCMS 1QSSA 5HQLA 2HQDA 3U27A 1CJKA 2W9CB 3BS9A 2OH2A 4DSJA 2E44A 2AU0A 2YXLA 2B0GA 2K8GA 3A4TA 2XZWA 3RG6A 1FRMA 2XYPB 2HZVA 4BWMA 2AEMA 4AT1B 3KHRA 4GKJF 4CLWA 4YUDA 4C3KA 3ULHA 4RJVA 1R8BA 4N77A 4LR8A 2CQHA 2P6SA 5SUHA 2HHSA 1SL1A 2UZAA 1UP1A 4PQAA 2ALYB 2CJXB 2ASYA 2FHMA 1KRPA 4Y2AA 3D3CJ 2DKOB 4CRJA 5A8RA 3DHWC 3M30B 4LFBF 1UVLA 1KR4A 2LXFA 1K1QA 2O1PA 1NKBA 2DNOA 5HJYA 1FXLA 1RT5A 2FDNA 1I1GA 1TV6A 3RBEA 2G2YA 4FYYB 5DO2A 3OUYA 4NWBA 3G86A 1N34F 2UUAJ 2VZ9A 2IVMA 3MR6A 2HW3A 2CJ9A 1QDUB 5CYQA 4K8RA 3DGVA 4NPOA 1UWBA 4EU0A 1X4BA 2W9BA 1C1BB 1FA0A 1ZM2A 2GJIA 2J7UA 4DN9A 8RUCA 1YZ7A 3VQTA 1JXVA 2KXHA 2K3KA 1SV5B 2P6TA 4DUZF 4LF4J 4DQRA 2XQCA 3HSJA 5B0FA 2RDDA 3HFKA 1SJRA 1MNEA 3W9HA 2ZOMA 3OR1A 3EZOA 4O3OA 1SBRA 1RAJA 3OXLA 4P2XA 2ZWOA 5F8JA 3IWNC 4N7TA 4YFUA 1D9FA 2WBMA 3PHTA 3HLUA 2F8MA 3GV8B 1RT7A 1TL3B 1Q82T 1T9TA 3KNGA 4NLYA 4DF4A 2DNZA 4IFYA 2VOPA 5LMUF 3PVXA 3J7AN 3NGKA 3IN5A 4FBUA 2UXBJ 1U2FA 2IRYA 4EZ9A 2Q43A 4FP9A 5KT7A 3KFWX 3TUIC 2AYMA 5G4DA 3A3OB 3MXHP 5GADI 2OAUA 5HI7A 1S99A 2CQ0A 2WSEC 2PE8A 4C11A 3PX4A 4K2XA 1UFKA 4WYLA 4X2BA 4USUA 4ELVA 3SDEB 1ZYQA 4K7QA 2BM1A 2B9WA 2CYYA 3M8QB 1CVJA 1YK9A 2Y1LB 5EUHA 2V8HA 3V81A 4QR0A 1E6YB 2M8HA 4NLOA 4M94A 2W2PP 3CXCR 2SXLA 3TZWA 4I68A 3TVKA 3PYDA 3MOZA 4X4OA 3IA0A 1K47A 3OQ2A 3NGDA 4IG0A 2CZ9A 5L9XA 2C3YA 3FC9A 2WB1D 1MMDA 4H4MB 3HJFA 1IBKF 4HACA 4A8KA 2QV6A 1Q81T 1XIQA 3V4IA 4DV2F 5IM0A 2AZ3A 2HLTA 1TMMA 4YR2A 3K5PA 4MH8A 4N8OA 3HX9A 3BH6B 5I3PA 5KFWA 4V1Ak 4NCGB 1B99A 2JLFA 4HH1A 4DR5F 1TK8A 3E2EA 2CDRB 1MLAA 1DFDA 1FNXH 4B3OB 3T1YJ 5KT5A 1PILA 3HCXA 4PUOB 1H2TZ 3TAQA 4IG3B 4HT5A 3KJFB 3HULA 5L46A 1NLKL 1SJQA 3NL0A 2YWEA 1RWVB 2LEAA 5J2PA 2LDYA 4RNFA 2AEJA 3PRVA 5IT4A 3EGWB 1DURA 1P6TA 2KFYA 3TEHB 4C98A 3A3PB 3M05A 1OY9A 4RNNA 2QE5A 3OLBA 2VPXB 4WTYA 1GXUA 3Q8UA 2FJVA 4KAIA 3G6ES 4RNHA 3JTPA 4NLSA 3ZZZA 2E1CA 4RU9A 1YVFA 1WDDA 2E1PA 3UR0A 3MURP 2VBZA 2U2FA 5L8RC 4QYZJ 2GW8A 2HEKA 2E66A 3PYFA 4BS2A 1YJTA 4B3SJ 1R89A 1WC3A 4C8NA 2RU9A 4I67A 4ZCKA 4NLUA 4JBCA 3EDQB 1MU2B 4K4VA 4J9RA 4QU6A 2B9YA 3AA8A 5GMDA 5KFOA 3PJXA 4C97A 1PYOB 1ACMB 1D09B 4WF9Q 4HL9A 4DPOA 2Z8QA 3BJYA 3VTIA 2LVWA 2CIMA 3M2VA 1UFLA 3N6LA 3FZ2A 2AW0A 2W2QP 4CLTA 1KC8T 4KHPJ 1NH7A 2AJ0A 2RQ4A 1YZ6A 4NYZA 1H3DA 2LEPA 3PHEA 3KLHA 2KHDA 3TANA 3I56S 1ITPA 2G1HA 2DNNA 2VFVA 3UN5A 2H4WB 2ZBCA 3KNAA 4CO3A 2X51A 4J37A 3O44A 1C0UA 4UY8T 2ZBRA 4MYTA 3POTA 1F3FA 3M6UA 3D6MB 1FKAF 3ZZOA 4HR2A 2DHXA 2MKCA 2AYBA 4X64J 4P73A 4ZHRB 2VKRA 2K1RB 2MZ1A 3A1YG 3AOCA 2BZ2A 2XI3A 2RUSA 3T1AA 3JAMY 4H4KA 5K14A 4RW4B 2Z4PA 5LOQA 3QWPA 4RW6B 4B08A 2VH7A 2AQ4A 4ZA1A 3K59A 1HBMB 4XPCA 1LFPA 3ZFVA 5KFJA 2CQDA 1XBWA 2HLUA 2VKZG 3C16B 3FBCA 2KJWA 3BSCA 2CNLB 5J2NB 4JV2A 4QU7A 2QG9B 3M32A 4MFBB 2IAJB 2LYVA 4MIBA 1U26A 1CG2A 1PYSB 4JI0J 1R27B 3DYAB 3D1QA 3VGTA 1VQSA 1YIJS 2QLFB 2ERRA 1HNIA 2P9GA 5IWAF 3BBCA 1RWUA 4ZJOA 2FVRA 1WUUA 4K5RA 3BBFA 3PM9A 1YDLA 1E6VB 1WOOA 4F8RA 3BR8A 4OX7A 1I3OB 1N5TA 3K0JA 2AJQA 5T14A 4GRSA 3AT1B 4KTQA 2OPPB 3I55S 5BYSA 1I51B 1HNXF 2W4PA 2CPXA 2ZHOA 2ZE2A 4KE5A 3TR5A 1N6QB 3US5A 3AFGA 4Y2IA 4LJMA 1Y7PA 3D6TB 3UO0A 2XMAA 5HP1A 4CO0A 2FZCB 2DNMA 3P5TL 4FYDA 1VMBA 3HP6A 1WG1A 4N76A 3G8SA 2ZUAA 3GFXA 4DR1J 1NH8A 4USTA 3HXMA 2COLA 2V4JA 1VC0A 2WONB 1Q95G 1S1WA 4EBDA 4G6VB 2IY5B 4J90A 2XGPA 1VLYA 3QWUA 2FC8A 3WHIA 1KFSA 1KLMA 2XSFA 3OSNA 1KNZA 1RHJB 2I1RA 1IKYB 1XR7A 2QLWA 1U49A 4H4OA 2LQBA 4IKAA 2XSJB 6FD1A 3UDVA 5EX3A 2OJ3A 3SSSA 4C0HA 2A1BA 2DGWA 4UOCA 4DV7F 3V5RA 4EI2A 2J6SA 2VJVA 3IS9B 3RYLA 4HVZA 2F8EX 2RQCA 4ILMA 2HIQA 3KLFA 1IM6A 2DGQA 1X5TA 3LQVA 1SQFA 3FKBA 3QIPA 4J9MA 1UPPA 1B70B 3QT7A 1VRUB 3HZEA 2VICA 2V2KA 4DUTA 2EFVA 4DFJA 2ZM6F 1GK8A 2QA4G 1ZAWA 2FHOB 1OY8A 1GMWD 4F36A 4NL5A 2W25A 3ZTRA 2MKYA 1T7PA 1VBZA 3I9V9 2AEFA 3OL6A 1P9YA 3I96A 1N4LA 1LK7A 2I6WA 2GQ2A 1HFEL 1TAUA 2QL9B 3NEKA 1GTHA 3DOKB 5L1IA 4Y0FA 3UNYA 2O01C 4UOFA 3FBFA 3TA1A 2GMHA 2MZQA 3CDWA 4P9SA 1SJ4P 3MUVP 4CO2A 1ZA1B 1S59A 1HWJA 4OYPA 2YWFA 4AL6A 3ZZRA 1KTQA 4DX8H 3H5XA 4K4WA 2MGZB 3PDNA 1FEEA 3M8SA 2EW9A 2HNDA 4ZJQA 3KLGA 5C2GA 5J2MA 4O44A 3NWGA 3NCQA 4RW9B 1K1SA 2IC3B 3TVZA 3KHGA 4QIWD 5KOXA 1DAXA 2NZ4A 3N5FA 4LF8F 2C3MA 1S6QB 3V4MA 3TUPA 1X0PA 2VIHA 1JLBA 1WJ9A 1VBKA 4XIUA 3SI8A 4DSLA 1VFJA 2UUTA 1JXLA 1LWCA 2HVIA 3MPDA 4QJVA 3DC2A 4Z7YA 2GIQA 5GAHI 2RRAA 5CXTA 4ZVFA 1FDBA 2KTQA 4HYKA 1RHRB 2BV3A 1TFYA 1B0PA 5KG4A 2PMZD 2JJ4D 1FVSA 4DJBA 3R27A 4RR5A 4R0EA 4DL4A 3R5AA 3GMGA 1NU4A 2C3OA 3LP0B 4JI3J 1UZDA 4HHUA 3PEJA 4I6YA 1B4SA 3CF5Q 3SV4A 4KY3A 3QLHA 2EBGA 4O4GB 4LF9J 3R1HA 3UE2A 4UT4A 1F5CA 4Q8FA 2HHTA 1U09A 4CO1A 3L95X 1M5OC 1X9SA 1URNA 1RABB 1T9YA 1WHXA 2OPSA 4TY9A 1IKWB 2ZZNA 3BGUA 1NJIT 1N36J 1YX2A 1RYRA 5HBMB 4CO5A 1FE0A 2RF2A 2H65B 4DR3F 2F4FA 3ENWA 3W2WA 4EBEA 1CS4B 1DQ8A 4Q5VA 1VS3A 1NBEB 5KT6A 2FVCA 1B3TA 4X4TA 2FHJD 4F3QA 3O8WA 4OI4A 3CD0A 3D1OA 4O0NA 3QFWA 1ZH5A 3CJ3A 4DV1J 4PXBA 5BYQA 2XULA 1X7VA 3TX8A 1SUQA 3UFCX 1SC3B 1WC5A 5JVHQ 1ZZNA 4JI4J 4I2PA 4JI8F 3JB9k 2ASJA 4CLZA 1HYSB 1EETA 2WVEA 3GB0A 1BQNB 1WC4A 3JS9A 2DTJA 4ZOSA 2QL7B 4X4SA 4JV5F 2M5YA 2VDIA 2O3DA 3QSIA 2XO6A 3EXYA 1RKJA 2ZJQQ 4F04B 4X4PA 3H20A 1FEHA 2R7QA 3EGZA 3M8PA 5KFHA 1GNKA 2P9CA 3UVJA 3HVRA 3DNCA 2M52A 4PWDB 1LWEA 3M1VB 3Q8PB 3IR5B 1JIHA 5F3TA 1YRUA 2J6TA 3GPAA 3GIRA 2YKAA 4ZVRB 3C19A 2VG6B 2MKSA 4O3RA 3CDEA 5EGYA 1KONA 2DNHA 2D41A 2WRMA 1UW9A 4LSNA 5KFVA 3TAMA 4ED0A 1QD1A 2HS0A 3I6PA 1AYEA 1M5SA 2J8AA 5D6GA 1YKWA 5IXUA 4AQYF 5J1EB 1BQMB 3G6XA 1WF0A 5IQ6A 5I42B 1N5YA 3NCRA 1AB8A 3ETOA 5LMNJ 4CTAB 3SXLA 4ID8A 2NSBA 3TVYA 3TA0A 3BQ0A 2B7BB 2P9EA 5J1PA 4QWEA 2WB4A 1LKZA 3G6YA 3HZGA 5D0HA 4NOHA 5A8KB 3IGNA 1XTZA 4YB6A 1X60A 3T6BA 3M9OB 2FPHX 2DNKA 2VQEJ 3OFHA 2JNJA 4Q44A 1NDLA 3H5SA 1HNVA 1LNQA 2YWKA 1CJUB 2HS4A 4LRAA 3GLJA 4DPTA 3GYNA 4DSFA 5F8MA 2OI2A 1RT3B 1YITS 2VG7A 5C2CA 1OQ3A 1XWLA 3ENAA 3LP1B 1WF2A 1P1LA 2HFZA 2HFSA 5B0DA 4J9SA 3DLEA 4DXLA 4M8LA 2MPUA 3ILJA 2A3JA 3KOAA 2MZSA 4OZ3A 5KAKA 4ZIVA 2BW2A 2P5VA 1NDCA 2F65A 3VAIA 4OV6A 4IH5A 4ZCIA 4DR2F 4DCJB 4IR9A 2WVDA 2QA2A 3IBFB 4CH7A 1JJHA 1R7IA 1QAXA 4E0DA 3AA9A 4DSEA 2BEFA 2J9EA 2CZVC 3KK2A 5BXIA 4ZVEA 5KTQA 2B9XA 3NS7B 4JI6F 4DV4F 3MAAA 3BDEA 2A18A 3TUJC 2KM8C 2BE2A 1BE4A 2W2OP 3GTYX 1VK3A 2QO3A 2HHQA 3QO9B 2HVDA 4KV8A 1YRTA 5KT3A 2UXDF 1VQ5S 2HNYA 4U7UK 1WHYA 3CIZA 1RAAB 2HRTA 1QUPA 4WCEQ 2V6AA 3MEDA 1Y0HA 3D6FB 3KJNB 4LRCA 3S8SA 1APSA 3EVMA 4X65J 4JI2J 4N8NA 3RW6A 3I82A 4RNMA 4RUAA 2OPQA 1UL3A 3QNWB 1WG5A 4DV0J 4OZNA 3AB4B 3SV3A 5CD4H 1LW0B 5D0GA 2RMLA 4OX8A 3CCWA 4P2FA 4TLQA 4EO6A 2K7JA 5A2QU 3BGLA 1WF1A 1WI8A 3I4HX 1XR5A 4QWBA 2RS2A 4MKBA 3EMTA 1T94A 2XG8A 1R8CA 4PKDB 2RB7A 2QYCA 1T03B 1D9DA 1NSAA 3KMQA 2L9NA 3IO1A 1LXNA 3HM9A 2VBXA 1RHUB 5CYMB 3BGRA 2YY3A 3BGOP 3Q2TC 3OSPA 1BMQB 2GAGC 1HHQA 2UUAF 1U1PA 4L75A 4F2RA 2M2BA 4DUYJ 2DPIA 1CSJA 1KEKA 1VQOS 4DSIA 2KKHA 3CO0P 1BD6A 1HA1A 4NLDA 2OGUA 1S12A 3MMBA 3HVTB 2HK2A 4J9LA 4KQZA 2B5JB 1YQHA 4ZVOB 1NHKL 4P74A 3UDCA 4W4MA 2F63A 3EGVA 2CPYA 3IM8A 4ED6A 2DCLA 1C1CA 2CPFA 1SC1B 2CJYB 4B9NA 1UWAA
chains in the Genus database with same CATH topology
1CJKA 3G82B 4USUA 4OYIA 5IV3A 5D0HA 3UVJB 1TL7A 2GVDA 1CJUA 3G82A 4WP8A 4OYZA 4NI2B 3MR7A 2GVZB 3UVJA 4CLYA 3C14A 1YBTA 1YK9A 4OYAA 4USWA 2GVZA 4CLFA 4CLWA 4CLUA 2WZ1A 1CJUB 4WP9A 4USVA 1CULB 4CLKA 3R5GA 4CM2A 5D0EA 3C14B 1CS4B 1CULA 3ET6B 4CLTA 4USTA 4OYBA 4P2XA 1CS4A 3ET6A 5D15A 3C16B 4OYXA 1CJVA 2W01A 4CLLA 4WP3A 3C16A 1WC0A 4WPAA 1YBUA 1Y11A 3C15B 4OZ3A 1CJTB 4CM0A 2QV6A 1TL7B 1U0HB 1AZSA 1FX4A 3C15A 4OZ2A 5D0GA 1CJVB 1CJTA 4P2FA 1WC5A 4P2MA 1U0HA 4NI2A 5D0RA 4CLPA 1FX2A 2BW7A 4OYMA 1AB8A 4OYPA 1AZSB 1Y10A 4CLZA 1WC4A 3MAAB 4CLSA 1CJKB 4OYOA 4OYWA 1WC3A 5IV4A 3MAAA 1WC6A 1WC1A 2GVDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJK A;  3G82 B;  4USU A;  4OYI A;  5IV3 A;  5D0H A;  3UVJ B;  1TL7 A;  2GVD A;  1CJU A;  3G82 A;  4WP8 A;  4OYZ A;  4NI2 B;  3MR7 A;  2GVZ B;  3UVJ A;  4CLY A;  3C14 A;  1YBT A;  1YK9 A;  4OYA A;  4USW A;  2GVZ A;  4CLF A;  4CLW A;  4CLU A;  2WZ1 A;  1CJU B;  4WP9 A;  4USV A;  1CUL B;  4CLK A;  3R5G A;  4CM2 A;  5D0E A;  3C14 B;  1CS4 B;  1CUL A;  3ET6 B;  4CLT A;  4UST A;  4OYB A;  4P2X A;  1CS4 A;  3ET6 A;  5D15 A;  3C16 B;  4OYX A;  1CJV A;  2W01 A;  4CLL A;  4WP3 A;  3C16 A;  1WC0 A;  4WPA A;  1YBU A;  1Y11 A;  3C15 B;  4OZ3 A;  1CJT B;  4CM0 A;  2QV6 A;  1TL7 B;  1U0H B;  1AZS A;  1FX4 A;  3C15 A;  4OZ2 A;  5D0G A;  1CJV B;  1CJT A;  4P2F A;  1WC5 A;  4P2M A;  1U0H A;  4NI2 A;  5D0R A;  4CLP A;  1FX2 A;  2BW7 A;  4OYM A;  1AB8 A;  4OYP A;  1AZS B;  1Y10 A;  4CLZ A;  1WC4 A;  3MAA B;  4CLS A;  1CJK B;  4OYO A;  4OYW A;  1WC3 A;  5IV4 A;  3MAA A;  1WC6 A;  1WC1 A;  2GVD B; 
#chains in the Genus database with same CATH topology
 4NZ6 A;  2HPU A;  1H0H B;  4DV3 F;  3TI0 A;  2UXB F;  5BR8 J;  4KRW A;  1IXK A;  5HRO A;  4FZV A;  1S5Z A;  1TVR B;  1H7X A;  3DU6 A;  2OSQ A;  3FK4 A;  2PEH A;  3NBP A;  2ATC B;  1ZM4 A;  4JI5 J;  3EPG A;  1VQP S;  2WAQ D;  4JOU A;  2CG4 A;  4EEY A;  4F2S A;  3G2X A;  4P2S A;  2VUG A;  5G0R B;  4Z7C A;  2LMI A;  4LF1 A;  2QIF A;  4GO5 X;  2DK2 A;  3DOM B;  1N52 B;  1QVG R;  1M1G A;  4LFB J;  4KO0 A;  2YNF B;  4GVL A;  1EP4 B;  1TKT A;  2QMW A;  2LQ8 A;  2ZHB A;  3QT8 A;  1F5B A;  1FD8 A;  5FII A;  4ENO A;  1SJF A;  5HQ8 A;  3DKD A;  4L73 A;  2V34 A;  3S6E A;  2A10 A;  2AJ2 A;  1NK0 A;  5L1L A;  3GIK A;  5K5M A;  1VC5 A;  5B08 A;  3H4B A;  1C4C A;  4FS1 A;  2XMU A;  3ZTP A;  3HK2 A;  4FKX A;  1TMJ A;  2OFG X;  1H6K X;  4ED3 A;  2FD2 A;  4E2F B;  1SKU B;  3T5K A;  2KI2 A;  1S9F A;  2FZK B;  2DO4 A;  2C2D A;  1G4C A;  4DPY A;  2K3I A;  1EJ7 L;  3T1Y F;  1VQK S;  1RAF B;  1TP7 A;  1WC0 A;  3LH2 S;  2OD4 A;  2JZ5 A;  3FBB A;  1WOP A;  3M4X A;  4PYD A;  3WC2 A;  4U96 A;  1GFW B;  5B0B A;  2BA9 A;  2A6O A;  2C2M B;  1FI4 A;  4ZS6 A;  1MWY A;  3B82 A;  1FJC A;  3NXZ A;  5LMU J;  2PMH A;  1NK5 A;  3EZ5 A;  4DF8 A;  1EQ0 A;  1RT5 B;  1TV6 B;  4MIW A;  2CJK A;  2Y0B B;  3OUY B;  2JEF A;  2BX6 A;  3F56 A;  5DM7 Q;  2CQB A;  3CGI A;  4N5S A;  2DVI A;  4LSL A;  2AGP A;  1JJC B;  3MM6 A;  1YG0 A;  1LXJ A;  4OZ1 A;  2BJ7 A;  1W7W A;  5T7L B;  2D3O 1;  4LUB A;  1JJ4 A;  3DRR B;  3AD7 C;  4WP9 A;  1AUS L;  2GX8 A;  3TAR A;  3BZQ A;  5J2Q B;  1HBO A;  2G13 A;  3MR2 A;  2PFD A;  1NHU A;  4B3S F;  1BQX A;  2E7X A;  5D3G A;  2PGC A;  3CJK A;  2RHQ B;  4PZV A;  3C2P A;  1VLO A;  4DL2 A;  2LP4 A;  5GMK a;  5GME A;  3WIU A;  4DPX A;  2C2N A;  2Q66 A;  2IVF B;  1RT7 B;  4Q8E A;  3L4B C;  3MR3 A;  1L3S A;  2WK4 A;  3KWM A;  3C8Y A;  2H54 B;  4J9O A;  4K4U A;  1IBK J;  4ECY A;  2J0S D;  1O8B A;  2QTW A;  4DV2 J;  1O0P A;  3LGN A;  1D1U A;  4KHP F;  4Y2M A;  4OJG A;  2CUY A;  2JC0 A;  4CYU B;  4LF7 J;  3BN7 A;  2BJ3 A;  1S72 S;  3LAL A;  5IV3 A;  3RGI A;  1PGZ A;  2FJE B;  3H0P A;  4DR5 J;  3HFZ B;  3FEY B;  4OHW A;  2FLP A;  2ROP A;  5E2Q A;  3N28 A;  3OTC A;  2MKI A;  4LR9 A;  1NB7 A;  4O3P A;  4DFK A;  2R9L A;  3A8I A;  3DLK A;  2DH9 A;  1U8S A;  4KHM A;  3ET6 A;  5M2P A;  4CNY A;  2QFJ A;  5DLF A;  3V81 B;  2VJU A;  3KLE B;  4EYI B;  3MEE A;  3DM2 A;  3IXQ A;  3Q8Q B;  1IBL J;  2AD9 A;  1U0H B;  4AL7 A;  4QPX A;  3LPY A;  3AD8 C;  4BCA A;  4ECZ A;  2AJF E;  3M8Y A;  4LIW A;  4QWD A;  2VON A;  5IM0 B;  5ETS A;  4TU9 A;  2E9R X;  2RHS B;  3EM1 A;  3RUB L;  1JLA B;  4K4S A;  1HI8 A;  5K8M A;  4FF1 A;  2W8L A;  1H2U X;  2GO9 A;  2JVO A;  4DFP A;  3NNA A;  2E7W A;  4EWT A;  5KFP A;  4KKO B;  4ILL A;  1YI2 S;  3HHD A;  3V6D A;  5DDP C;  4OHV A;  1G1X A;  2O66 A;  5HVF A;  1KWM A;  3WDO A;  1JKH A;  3UN3 A;  1CUL B;  2OML A;  3TQE A;  3O2I A;  2NXU A;  4ECT A;  2HFU A;  3PIO Q;  4PPD A;  2B3T B;  3TW0 A;  4XO0 A;  2LLZ A;  2QGF B;  3JYT A;  4LBP A;  2AGO A;  1JLE B;  3DOL A;  4RX6 A;  1REV B;  2VPW B;  3BF4 A;  2JOQ A;  3NGS A;  1NND A;  2R8J A;  3T19 A;  2LCW A;  2DNG A;  4USI A;  4X4R A;  1UAW A;  2HGL A;  4KYZ A;  2WOM A;  4GO7 X;  2AP6 A;  4P75 A;  1NK7 A;  3K8V A;  2XMT A;  1K0T A;  4DR1 F;  4I69 A;  5MLC V;  2QA1 A;  3W5Z A;  3BQ1 A;  4I6W A;  1RT2 A;  4IR1 A;  1Q5V A;  1N54 B;  3PAC A;  4M5M A;  1NJW A;  3AXK A;  5IFM A;  2UUB J;  4IO1 A;  5FDL A;  2RRN A;  5C24 A;  1RBA A;  4XDD A;  4OX9 F;  4DV6 J;  2RDJ A;  3RZA A;  1KDN A;  3BSO A;  3ISZ A;  5IQQ A;  3HT3 A;  2YNI A;  4ZN1 A;  3FJ2 A;  1M5V C;  3W61 A;  1G7C B;  2DXD A;  5ETN A;  4E98 A;  5A0Y A;  3W64 A;  5HMZ A;  2V8V A;  4BWJ A;  4I2Q B;  4P6Q A;  2I5J A;  4RUC A;  3DMJ A;  5BYR A;  4ZIT A;  3UDL A;  3VCD A;  3I31 A;  3C3L A;  2NSC A;  2X3D A;  2HQF A;  1JLF B;  4ZPT R;  1TUW A;  1FXD A;  1FKP B;  3SCK E;  3CPW R;  2MHE A;  1X8D A;  1U8W A;  4TY8 A;  4F25 A;  2WBR A;  2BQ3 A;  1U2C A;  1TFW A;  1YJ7 A;  1RAH B;  2MLY A;  1WOR A;  2Q6C A;  3MCO A;  4Y28 C;  5IWA J;  4NYP A;  3R2D J;  3QID A;  2HWI A;  2ACY A;  4UY8 5;  4LFC F;  1UEV A;  3I0S A;  3T9Z A;  3R97 A;  1MG7 A;  3CJ8 A;  1U48 A;  4R8U A;  2GVZ B;  4YHH J;  3FVY A;  2XHW A;  3AQP A;  4OYA A;  1S9E B;  4O23 A;  3HHL B;  2DRA A;  4MT1 A;  4USV A;  3K58 A;  4JI1 F;  1B7Y B;  4ZPB A;  1YRX A;  1S1X B;  5CH7 B;  2GHW A;  2MJN A;  2IMW P;  4ANC A;  1XMO F;  3P6Y C;  1HQ2 A;  4DHV A;  3P8B B;  4Q43 A;  2VDH A;  2KYX A;  2G0C A;  1S7I A;  5C42 A;  1FJG J;  5DJB A;  2J7K A;  3H25 A;  5KFN A;  4B9U A;  4W98 A;  2B8Q A;  4GMK A;  4MIA A;  4I4B A;  5JMN A;  2DRB A;  3PKM A;  3LAK A;  4RBT A;  1XEZ A;  1F6T A;  3GWC A;  1TAQ A;  3EZU A;  4KFB A;  4DDF A;  2XYG B;  4Q7A A;  2LEB A;  3S1T A;  1NKE A;  1PKU A;  2B56 A;  4ED7 A;  1VDH A;  3DLG B;  4TXS A;  4ED8 A;  1VJQ A;  4TU8 A;  4HDG A;  2IIH A;  5ETM A;  1CC7 A;  5KFK A;  4KJI A;  3B8H A;  5HLF A;  3RB4 A;  2GA7 A;  3CIM A;  3CSK A;  3AOA A;  1IUJ A;  3W9J A;  2DYA A;  2GIR A;  2RNE A;  4U9R A;  2CWK A;  4C48 A;  2GHP A;  1S10 A;  1YJU A;  4JI3 F;  2DJW A;  2BJ9 A;  2XY5 A;  1VRT B;  3DXS X;  2L3M A;  3HKW A;  4WFY A;  2ZM6 J;  4O3N A;  3IG1 B;  1F1B B;  2NPI A;  2DGO A;  4LF9 F;  2UVW A;  1PG5 B;  1RGV A;  5GAD U;  1NPK A;  4J7C A;  1WKK A;  1OJ4 A;  5GAE I;  4FVC A;  1NJZ A;  5AXN A;  2RH3 A;  4ELT A;  4K50 A;  1N36 F;  2IA0 A;  3CMA S;  1DTT B;  4CO4 A;  5K20 B;  3KMS A;  1YGY A;  4OIX A;  2KO1 A;  3UD3 P;  4FF2 A;  3CUN A;  4C8K A;  2R4F A;  4LIR A;  5EWF A;  1K0V A;  1UPM B;  5CCL A;  3KJV A;  3MFH A;  2W9C A;  3RRG A;  3ICL A;  1UTA A;  1QE1 B;  2AMC B;  2WZ1 A;  4JI4 F;  1ULR A;  5F3Z A;  4OHZ A;  2BAB A;  2ZBP A;  4ECX A;  1YBA A;  4K4Z A;  1X4D A;  1P8G A;  2J0Q D;  4DL6 A;  2FLN A;  1HWL A;  4X4V A;  2W7A A;  3CCV S;  2Y0S D;  4LF8 J;  1T95 A;  3SIP B;  2IDE A;  2B8P A;  3M8W A;  1U6F A;  4DLE A;  4U6P A;  3M30 A;  1HBN A;  2DO0 A;  3HSZ A;  1YJV A;  1Q0N A;  4ED2 A;  3DRP A;  1WEX A;  2CQ2 A;  2KU7 A;  2RSQ A;  2QMU B;  1FDA A;  3LO3 A;  1RWK B;  4PXE A;  1C0T B;  1KQG B;  1S79 A;  3KHL A;  3AJ1 A;  3MI7 X;  2YKN B;  4C0B A;  5DM6 Q;  5FLX U;  1LOU A;  2DIS A;  1C1B A;  4IQX A;  1NZ8 A;  3OXF A;  3CJ5 A;  1IR1 A;  4ZLN A;  2HBY B;  2V8G A;  1YJW S;  3DI6 A;  2OEK A;  4F7V A;  4USW A;  2IJN A;  3QT6 A;  1AT1 B;  2DR6 A;  1TL5 A;  4V19 X;  1U4B A;  1RAI B;  3M2R B;  1SV5 A;  4J5O A;  5J2M B;  5KG1 A;  3I5B A;  4OV1 A;  4B9M A;  5LMN F;  5CAB A;  4ECU A;  4DOZ A;  2BKO A;  1Q53 A;  3BPD A;  3LP2 A;  1KKH A;  4A8F A;  4AL5 A;  3A12 A;  2D3U A;  5K8P A;  3GIJ A;  2V4Q A;  4YN3 B;  3MPY A;  5KFL A;  2A6M A;  2H9Z A;  1TL3 A;  3RB6 A;  4P7V A;  1JLB B;  2AT1 B;  2MEW A;  3VWS A;  2AYG A;  4EFA C;  3AJD A;  1Z1Z A;  3AB2 B;  3FZB A;  4L6V 3;  1LWC B;  2C2E A;  2CXE A;  2Y1J A;  3GON A;  3NS5 A;  1NDK A;  1RT1 B;  3GJS B;  1KQS R;  2PDA A;  4WBF A;  3TJA A;  3OTD A;  2ZNZ A;  3BO4 A;  2FVS A;  1WC1 A;  1M1K T;  2HRY A;  2N3L A;  1FRL A;  2RQM A;  1EAY C;  2Z2Z A;  3QZ7 A;  3H5Y A;  3SDE A;  1X31 C;  3M8Z A;  4URS A;  3CD7 A;  3CDB A;  4CLF A;  1RT4 B;  5D4O A;  3UI3 A;  4USM A;  5C25 B;  4M63 A;  4KGX B;  4C9D A;  1SJ1 A;  2LQ5 A;  4ZVU B;  2OPS B;  3BGF A;  2Q79 A;  2JWN A;  2JVR A;  3B4D A;  2YNH B;  3ZTQ A;  2RF2 B;  4ICL B;  1CJV A;  2DY1 A;  3WQP A;  2YVS A;  2IDL A;  1FFS B;  1W26 A;  4B9V A;  2QL5 B;  3TZZ A;  1S1U B;  2F4V J;  2FQQ B;  2DXE A;  1OWX A;  4OZ2 A;  5HQM A;  2DNL A;  3DRS B;  1D0E A;  3W5Y A;  2X1F A;  5KFI A;  4YB7 A;  2VU5 A;  3F41 A;  2I8E A;  2Y1R I;  3ONQ A;  3KG1 A;  1SUQ B;  1MWQ A;  4AQY J;  4J9K A;  4I7F A;  4JI2 F;  4I2P B;  4NCG A;  5JXS A;  2CA9 A;  1NB2 A;  1S6O A;  3UNG C;  4B3O A;  2OO4 A;  1EET B;  4DV0 F;  3H8Y A;  4C0O C;  4ES2 A;  3ZNJ 1;  4F4Z A;  4FBT A;  5KFZ A;  3PFO A;  4PUO A;  1S76 D;  4IG3 A;  1FXR A;  1PJ5 A;  2ZH4 A;  1EKS A;  1V9O A;  4CM2 A;  1Y4Z B;  5HO4 A;  1NXI A;  3FQK A;  3CED A;  4H4K C;  3DLH A;  2XTJ P;  4ZLP A;  4CZC A;  2YWG A;  2FY8 A;  5KFX A;  3MFI A;  4WFZ A;  3ZTS A;  5E3C A;  4XDC A;  2OEL A;  1FFG B;  2A2C A;  2RDI A;  3RBX A;  2QLJ B;  2EKN A;  2KFZ A;  2XEX A;  2C2R A;  5B0C A;  1M0S A;  2RU3 A;  2WVF A;  3DGP B;  1RLC L;  2E9T A;  4IO9 Q;  1Y10 A;  2NYH A;  4LVN P;  3LAN A;  2R7R A;  4X66 J;  5HVH A;  3RR7 A;  4DR2 J;  4OYO A;  2WSC C;  4DUY F;  1EB0 A;  3EDR B;  2RKI A;  9RUB A;  2QA4 S;  2DH7 A;  3A8K A;  5E3R A;  3D54 A;  1MU2 A;  4WU2 A;  3IAM 9;  1N32 J;  4DV4 J;  3RAQ A;  1RWN B;  4ZP7 A;  3F73 A;  5KFD A;  3DRY A;  2V8D A;  4ZJL A;  2XMV A;  3EE3 A;  4K4X A;  2ABY A;  5F41 A;  3VVT A;  2VFT A;  1F5A A;  3LGM A;  1FK9 B;  1KTV A;  3K7R A;  4M5D A;  1J2V A;  1FDN A;  3PKY A;  2AX1 A;  3OTE A;  5L38 A;  1OYD A;  1FX4 A;  4C4W A;  5E0O A;  3J81 j;  2NQP A;  5BR8 F;  3OW2 R;  2RT3 A;  3T3F A;  4TYB A;  2XMK A;  1NPR A;  3BB5 A;  1WEZ A;  1HIY A;  2UUC J;  4C2M A;  4LF6 F;  4HTI A;  2ZH8 A;  4JI5 F;  2C2Z B;  3CCT A;  2HSE B;  2H5E A;  1T9V A;  3G71 S;  1OO0 B;  4OQJ A;  1O6X A;  1T11 A;  4OI2 A;  1N5Q A;  1HI1 A;  2JDJ A;  2ALZ A;  4ZHR A;  3C14 A;  2K1R A;  3R6G B;  5H9E J;  5HAN A;  2PC6 A;  2HIY A;  3DRX A;  4WFN Q;  5BJR A;  1MRO B;  2GMJ A;  4RW4 A;  3CTR A;  4RW6 A;  1XMB A;  1FES A;  4AD6 A;  2E5L J;  1U1M A;  1IQT A;  3BQ2 A;  2B43 A;  2GQC A;  1VQ6 S;  3C16 A;  1VC6 A;  5J2N A;  1XK8 A;  4NX9 A;  2OLW A;  3EWG A;  4MFB A;  2OPQ B;  2C28 A;  2IAJ A;  3K17 A;  4LBH A;  4I0W A;  1JNZ B;  4IOA Q;  4NE9 C;  1HQE B;  1ROF A;  2V67 A;  1TU0 B;  4G3I A;  1E6V A;  4MTP A;  1REG X;  4OHX A;  4ANE A;  1GXL A;  1U1K A;  2G2O A;  2UV8 A;  4OYW A;  3TUZ C;  2HMI A;  3CJT A;  2OPP A;  1JLG B;  1H74 A;  1WEY A;  2D69 A;  1NHV A;  2LFV A;  4NA3 A;  1G3O A;  1N6Q A;  4LQ9 A;  1T9U A;  3WC0 A;  1P27 B;  4WXW A;  5F9N A;  3PFE A;  3RAM A;  4CLK A;  1NEE A;  1T3N A;  2B6A B;  4D3G A;  4DV3 J;  4X4N A;  2F9J A;  5H9F J;  1DBD A;  1S0V A;  3JSB A;  5KOW A;  4F3M A;  5GAH U;  4IQM A;  4OYX A;  1VJW A;  3IM9 A;  5K8N A;  1FKO A;  2XLJ A;  1IKV A;  4NLX A;  5DLG A;  3BH7 B;  1X9W A;  2FUG 9;  2K06 A;  1T8E A;  1SH2 A;  1IKY A;  4OJH A;  2MZT A;  2CNK B;  5EWG A;  2XSJ A;  5DS7 A;  3MMB B;  3OT9 A;  4C8M A;  3R3T A;  3RB3 A;  3WX4 A;  3CO9 A;  2Z58 B;  1NJX A;  2MJU A;  3A3N B;  3PW0 A;  5AXL A;  3R1L A;  3D6H B;  3X3U A;  5D4L A;  3IS9 A;  3D1H A;  1ZM3 A;  1XJW B;  4HI2 A;  1C1C B;  3FFI B;  3W5X A;  2R2R A;  4L74 A;  4RKU C;  1HBU A;  3TZY A;  4LF2 A;  4N47 A;  3I0R B;  2OEJ A;  1VRU A;  2HHV A;  2Q6B A;  3AH6 A;  3R5G A;  3BN4 A;  2R7T A;  4Y00 A;  1Y3J A;  3Q86 A;  1FTR A;  5KFF A;  2VA2 A;  4LF7 F;  3MCM A;  1EHW A;  4CLL A;  3SEO A;  4WE1 B;  2GHV C;  2CQ1 A;  1IKX B;  2VD3 A;  3MTK A;  1F3V A;  3D28 A;  3DDI A;  2VBW A;  5ITH A;  3DOK A;  2CQI A;  3QAE A;  3HD1 A;  2XB2 D;  5CA5 A;  1A7G E;  3PW2 A;  3I32 A;  2D3Z A;  3Q0A A;  1RWP B;  3HKZ D;  1UW4 A;  4TU7 A;  3P5B P;  2GVD B;  2YX4 A;  1FWL A;  2NYI A;  4R5P B;  3BRE A;  5KFT A;  2QLX A;  3T5J A;  3F0N A;  1IBL F;  4MKY A;  1QLN A;  5EWE A;  3PO4 A;  5A6P A;  1HQU A;  3M2U B;  1AW0 A;  4KIA A;  3MTJ A;  1PSD A;  4WFB Q;  4RW9 A;  3EJM A;  2IC3 A;  5AJ3 J;  1ZS6 A;  2V9K A;  1NCL A;  1T9X A;  2PA8 D;  1OSD A;  1S6U A;  3IWX A;  2RS8 A;  4ER8 A;  1LWF B;  1S6Q A;  1N56 A;  4HEA 9;  2ROG A;  2MY7 A;  1DQ9 A;  2F5G A;  4ZVG A;  3J80 Y;  2FLL A;  3FMW A;  3OR2 B;  4NLP A;  3PCO B;  5IS2 A;  1JK9 B;  2VFS A;  4U8V A;  5DG8 A;  2RIJ A;  3K8W A;  4P71 A;  1X4F A;  4ECR A;  1BUX A;  5HAT A;  2WHO A;  1HMV B;  4ZPV R;  2DEI A;  3VVU A;  2CWX A;  2OD6 A;  3FNN A;  4ZPW R;  3TAP A;  3LP0 A;  2YKO A;  2XZD B;  3W7B A;  1KHV A;  4USK A;  2YX7 A;  4ZDN A;  3MMA B;  5C7P A;  1YHQ S;  3JQJ A;  3NMA A;  2AHO B;  4O4G A;  3M6W A;  2CPD A;  1WNE A;  1YBT A;  2CPH A;  4GVB B;  5IOL A;  2MLZ A;  3UN2 A;  4JUZ A;  3MAH A;  5KG6 A;  2D7S A;  4LSL B;  2VC1 A;  3MM6 B;  3AY0 A;  3P3D A;  3J7A 1;  1PBA A;  4DL5 A;  1WEL A;  2IVY A;  1ZAX A;  1CS4 A;  1IJE B;  2J5A A;  3GE9 A;  1X4E A;  1SB6 A;  2V2V A;  3OFF A;  2JRS A;  3QQC D;  1H7W A;  3DCA A;  2UUB F;  3C15 B;  3TEG A;  3ILL A;  1NK4 A;  1YWX A;  2KN4 A;  3OTB A;  5H1S V;  4DV6 F;  4YDX A;  1OSC A;  3K5O A;  3DN9 A;  3Q23 A;  3QJJ A;  2XLI A;  3VR1 A;  4JYA J;  3QGP A;  4C8O A;  4MYU A;  1RCO B;  4KR0 B;  4ZPC A;  4Q0B A;  4HKQ A;  3FGV A;  2KT2 A;  2NXC A;  2GGP B;  4PWW A;  4Q2M A;  3UD5 A;  1HYS A;  1BQN A;  1WAC A;  1GMV A;  1EX8 A;  2W4C A;  1X5S A;  1VQL S;  4KGK A;  1AFJ A;  3KUG A;  3R5B A;  3CE8 A;  3Q24 A;  4FPR A;  4XK8 C;  3THT A;  5LXY A;  1R0A A;  4IDK B;  3V6K A;  3PG9 A;  4KT0 C;  3VGS A;  1UVM A;  2HWT A;  1KHW A;  3N6M A;  1RYS A;  4F4K A;  3K5L A;  4PWD A;  4AUK A;  1GH8 A;  2QEX S;  2BMB A;  1M5H A;  1F0X A;  1GXT A;  1TL1 B;  1UMJ A;  1UA1 A;  2VG6 A;  3CCL S;  1XC9 A;  1RTD A;  4FN5 A;  4YHH F;  1RTJ A;  2Z2L A;  2HZC A;  3K89 A;  1H38 A;  4PAB A;  3DM2 B;  4LBI A;  2CG8 A;  4TLR A;  2M4M A;  1BQM A;  5K8O A;  1DY3 A;  3U7J A;  2R3V A;  5I42 A;  1XN9 A;  1NRK A;  2AF6 A;  3MM7 B;  2MQP A;  4NXM J;  4PR6 A;  3C66 A;  3I4P A;  3H59 A;  4DPU A;  2D9O A;  4CTA A;  2QSF A;  3D0I E;  5KFE A;  4QZV B;  2B4O A;  4Z2X A;  2OSR A;  4R0J A;  3VAJ A;  3S01 A;  3ILO A;  1JMT A;  1AXQ A;  4OL8 A;  2PII A;  1FJG F;  5A8K A;  3C6U A;  2UVV A;  3KG0 A;  3UPF A;  1UA0 A;  3MM9 B;  2ZD1 B;  4OX9 J;  1RIS A;  1PAU B;  3FCW A;  1C4A A;  3NNC A;  2OMO A;  1G2E A;  2R7S A;  4UW2 A;  4K5S A;  2HFV A;  5CZX A;  3PR5 B;  3PR4 A;  3KXD A;  3Q8R B;  1XMQ J;  3K2Y A;  4FF4 A;  3JYT B;  3HFV A;  3GG0 A;  2ZVS A;  1S1T B;  2M3D A;  3DOL B;  3QYY A;  2KM8 B;  1T05 B;  2BRL A;  3FEX B;  3CNQ P;  5E5N A;  2XMW A;  3J80 U;  2KXN B;  3MEG B;  4LSZ B;  5IT0 A;  2OEM A;  3CD5 A;  3QRP A;  4KPC A;  1SI9 A;  3DLL Q;  3GFZ A;  2X1G A;  1RP5 A;  4EUV A;  3W9I A;  1TKZ A;  2IBO A;  3D9B A;  5KFU A;  1KVI A;  2JEI A;  1AFI A;  4ID5 B;  1SH0 A;  1D9A A;  4QR2 A;  1L5U A;  1TUG B;  1R6Y A;  4OLP A;  5KG0 A;  4ZKA A;  4IFV B;  3MF5 A;  4P52 A;  3QO9 A;  1FCA A;  3W63 A;  1H72 C;  3FSI A;  3RRH A;  1LW2 B;  3PRD A;  4LFC J;  4HHH A;  5ETR A;  3MR5 A;  2YQ3 A;  1I94 J;  1WHW A;  1U1O A;  3L7O A;  1Q86 T;  3QSY B;  3IRX A;  3D3B J;  1YJN S;  2B51 A;  3D2W A;  2HNZ B;  2YNI B;  2EFG A;  3MDF A;  4RW8 A;  4CT9 A;  1RA6 A;  3OVS A;  1UFW A;  2HAI A;  5A0Y B;  1V6H A;  1VQM S;  4JI1 J;  4LRF A;  4AYB D;  1QVF R;  2I5J B;  1Y11 A;  3GSI A;  3DMJ B;  3PX0 A;  3TJ8 A;  3MM8 B;  3KUE A;  1Z4U A;  5GAG I;  1XMO J;  1GQE A;  1LW0 A;  1T3O A;  5B7W A;  1BY9 A;  2W8K A;  4QWA A;  5LL6 d;  4DG1 B;  5IV4 A;  4B3T F;  1TR0 A;  3ZZT A;  4UZB A;  1T03 A;  4WFX A;  2VQF J;  4ZVQ B;  3R7N B;  4NEY A;  5DZ7 A;  2D3O R;  2DNR A;  3JAM U;  4DWI A;  2GV1 A;  3W60 A;  5CYM A;  2FJX A;  4J9V A;  1NSP A;  3J7Z 5;  2LKZ A;  2BJD A;  1GX6 A;  1WWH A;  4ZK7 M;  4XPE A;  2IMO A;  5KT4 A;  4OYB A;  4CNZ A;  2V50 A;  3JSM B;  3HMJ G;  4F02 A;  3TWZ A;  4JP8 A;  1S1V B;  4G1P A;  2ADB A;  3VAK A;  1B64 A;  1RLD A;  4Y2K A;  4QR1 A;  1W2B R;  1UVK A;  1TKD A;  2FGO A;  3QRR A;  1WG4 A;  4RL1 A;  2WVC A;  1JJ2 R;  4FVM A;  2ZZT A;  4IRK A;  1FF2 A;  3PYE A;  3HVT A;  4ED5 A;  2XC9 A;  4B3M J;  2B5J A;  5L1J A;  1UVI A;  3G4S S;  3J7Y I;  4A48 A;  2IA6 A;  3VF0 B;  3CB4 A;  4U7C A;  4OZ5 A;  4QIG A;  2W2N P;  4IRD A;  3MGJ A;  3T6J A;  5ETO A;  3SFU A;  5EN1 A;  2OIH A;  3MMC B;  1OIA A;  4EYH B;  2HHW A;  4MK8 A;  4W90 B;  4ECW A;  4R25 A;  1KS2 A;  1FRK A;  2NLW A;  1HR0 F;  2XM3 A;  4DQS A;  1KFD A;  5DDR C;  3OBI A;  1TVR A;  2GCF A;  2QN6 B;  2XS2 A;  2L08 A;  3W2V B;  3VZI A;  4F4Y A;  4ECQ A;  2KG0 A;  3CT9 A;  3H7H B;  3MM5 A;  1RT6 B;  5B0G A;  2QC3 A;  4ZMM A;  1CJT B;  4CM0 A;  4MKV A;  3UR3 C;  1WDT A;  4EBC A;  1O5J A;  1K9M T;  1VBY A;  4DV5 F;  3DOM A;  4NI2 A;  4RW7 B;  2C2K B;  2KL8 A;  3H4D A;  1TK0 A;  2YNF A;  2KVQ E;  3JTO A;  1EP4 A;  4O4R A;  3Q83 A;  2IRU A;  1MW7 A;  2JH3 A;  1HWU A;  3ZNU A;  4LQ3 A;  1QUV A;  2MLX A;  2Z2Y B;  3M7V A;  2CQ3 A;  2WCX A;  2CPJ A;  2YH1 A;  4RLE A;  2F3J A;  2VL1 A;  1W25 A;  1HLW A;  4FYX B;  3M9M B;  2QMX A;  1U6Z A;  4X62 J;  2APO A;  1JNR B;  4IRC A;  2HRU A;  2KDO A;  2F4V F;  3H2U B;  5HAO A;  2MZJ A;  2MY8 A;  1YJR A;  5AE3 A;  3KJV B;  2ZJP Q;  2ZKT A;  1LFW A;  3P45 B;  1ZTT A;  5D77 A;  1WOS A;  4PG4 A;  1L3U A;  2DY9 A;  2OP5 A;  2BE7 D;  5LM7 E;  4LRE A;  5I3Q A;  3R2C J;  2FVQ A;  1NSK L;  5A8W B;  1OY6 A;  4NRU A;  3IR7 B;  1NPP A;  4B3R J;  1RTI B;  4DBQ A;  3HHK A;  2YTC A;  2CDQ A;  3T5L A;  3KYL A;  4OI0 A;  3SCI E;  2E5I A;  5DZ6 A;  5AXK A;  2HHU A;  1XQI A;  2BKN A;  3UD4 P;  1HBN B;  2XCA A;  3DRP B;  4IH7 A;  4XAK A;  1KOO A;  4ETZ A;  2IM3 A;  2DT9 A;  1KBR A;  1CLF A;  4YQW A;  2DBB A;  2J7W A;  1TL7 B;  3KLI B;  3G82 B;  3ZZU A;  4ATN A;  2EXU A;  2OPR A;  3GP9 A;  3PW5 A;  4AXI A;  5B0A A;  2YQ0 A;  4ITS A;  2U1A A;  4HTJ A;  3JTN A;  1FWK A;  2LXI A;  4S0M A;  2VB6 A;  3W8P A;  2MXY A;  4L72 B;  5T7L A;  4ZVH A;  3DRR A;  3DI6 B;  3M8R A;  5J2Q A;  2MQN A;  3FSX A;  3RU0 A;  3OTO J;  4X66 F;  2JFD A;  3LOU A;  1VHF A;  3BYR A;  2RD5 C;  1HAR A;  2VG5 B;  1DTQ A;  3E8O A;  5AT1 B;  1J27 A;  3HHE A;  1FNO A;  3LP2 B;  1PCA A;  3EVW A;  4GC6 A;  5KFS A;  4DL3 A;  4U95 A;  1V5I B;  1N32 F;  3O3L A;  1N5V A;  1B7F A;  2HKE A;  4DL0 C;  3TZX A;  2IM2 A;  3OVB A;  4JV1 A;  2PMW A;  3L7U A;  1PYT A;  2CQ4 A;  2R7X A;  3RRK A;  3KK3 B;  1Y3K A;  3UCG A;  3SQO P;  4QWC A;  1MN7 A;  2DGS A;  1UET A;  4Y34 A;  2DNP A;  1AA1 B;  2BKP A;  5I3U A;  2LDI A;  4CYU A;  3VAM A;  3SQG B;  2EK6 A;  7FDR A;  3LTO A;  3MR7 A;  1FNM A;  1HPZ A;  2V63 A;  4TNO A;  3M9N B;  2KZM A;  2ZBI A;  4K4Y A;  2Z0G A;  3H40 A;  1RKI A;  2MKH A;  3H2V E;  4HHJ A;  4YEA A;  3HJV A;  4TQS A;  3D4J A;  1FRX A;  2UUC F;  2EBE A;  2ZKU A;  2ZBQ A;  2CFX A;  2QFI A;  3P4U B;  3Q2S C;  2AZ1 A;  2HHX A;  1IR0 A;  4WP3 A;  3KLE A;  5KG5 A;  3KUH A;  4V19 J;  4QBU A;  5CQG A;  4ZPD A;  1IBM F;  1CJV B;  5CD4 A;  3V6J A;  3K5M A;  1U0H A;  4DX6 A;  3CJ2 A;  2PFF B;  1WKL A;  3EX7 B;  2DGT A;  3D66 A;  4BDP A;  3DU5 A;  2E5L F;  1RU2 A;  2MQL A;  4ERD A;  2BUN A;  1JLA A;  5DG7 A;  4NLQ A;  4PQU A;  5M2R A;  4KGZ B;  4I7F B;  2N4D A;  2YKM B;  4WK3 A;  3J81 Y;  3OFE A;  5B09 A;  4ES1 A;  2O5D A;  4ZN3 A;  3NGU A;  1HNZ J;  3MHY A;  4KKO A;  2MKK A;  1JLC B;  2BJ1 A;  3A8E A;  2L9D A;  1SKW A;  3OVA A;  3IMQ J;  2XNR A;  2Y1I A;  3AQO A;  1TKX B;  1S9G B;  3QBC A;  1CUL A;  2X7I A;  3E01 A;  1UKU A;  1UEU A;  4KGM A;  1TUV A;  1NME B;  1EQM A;  2W1B A;  3DFE A;  2J0X A;  1M1H A;  2BQR A;  4RU2 A;  1JLE A;  3H98 A;  4TKT A;  1REV A;  4A4J A;  3ITH B;  1CQM A;  5LSO A;  3TYT A;  4C6A A;  4HH0 A;  2FZG B;  3CVK A;  2W9A A;  4Y65 A;  2GJF A;  5RUB A;  1ICE B;  1UVN A;  1KN6 A;  4G1Q A;  3QMQ A;  4TYA A;  4Y3C A;  4LF6 J;  3O5T B;  4M5I A;  4DQI A;  2RKI B;  3BKF A;  4MAK A;  2KVI A;  4DZD A;  2FJA B;  2KFN A;  2JL9 A;  2G1D A;  2Z57 B;  1CQN A;  3IWL A;  7FD1 A;  1JLQ A;  1RU1 A;  4PXC A;  4I2Q A;  3G87 A;  5H9E K;  5GAE U;  2C22 A;  3OXG A;  2ZUG A;  4WJB A;  4DSK A;  2MKJ A;  1HW8 A;  1PIE A;  3LWL A;  2ASD A;  4ZIW A;  1DQA A;  4EMD A;  1JLF A;  3R8Y A;  5M2U A;  4MMO A;  3IFE A;  1VQ4 S;  2MB0 B;  2NPF A;  4M5D B;  1M90 T;  1QTM A;  1FKP A;  3ZXW A;  4OZ0 A;  2UVU A;  4M5G A;  2QJ3 A;  3TQ1 A;  3FMB A;  1WSV A;  1CJK B;  4LVO P;  3CW2 C;  3MZI A;  2KYZ A;  2N82 B;  1VIX A;  3QT5 A;  5IC4 B;  4DR4 J;  4CIO A;  3PJW A;  2HBQ B;  1FE4 A;  3QFH A;  3CJS A;  1FJ7 A;  3BSA A;  4PEO A;  4AFF A;  3QGI A;  3DHX A;  3WZ0 A;  1XER A;  4NLT A;  2LEC A;  2GVZ A;  4MJK A;  2DIV A;  4YY3 F;  2I2Y A;  2J6U A;  2CPE A;  1S9E A;  1QAJ A;  3QPI A;  1IQZ A;  3ZO7 A;  4B9S A;  2ACM A;  3HHL A;  3C14 B;  2LU1 A;  3P96 A;  1R31 A;  5DDO C;  2HGN A;  2AWZ A;  1NAQ A;  5A8R B;  3OHA A;  1U1R A;  1S1X A;  2W01 A;  4NLR A;  1LWX A;  1FT8 A;  4PYA A;  4BHQ A;  3LAM A;  3NNH A;  1S97 A;  5ETQ A;  5H9F K;  1AZS A;  3RBZ A;  3A8J A;  2DB1 A;  3CJ4 A;  3OV7 A;  4TN2 A;  2WSF C;  1N88 A;  2ZDP A;  2XYH B;  3D68 A;  4CP5 A;  3RR8 A;  5AJ3 F;  4F4X A;  1EKR A;  5CYQ B;  4L3K A;  1UWB B;  1SKS A;  1Q5Y A;  5E33 A;  2KJV A;  2W9B B;  5DGA A;  4KBI A;  4NXN J;  3VAG A;  3JSR A;  1C2P A;  4C3M A;  5JVG Q;  2C3U A;  2VFR A;  4WKY A;  2J0W A;  2E1M C;  3JQK A;  4NRT A;  2LQ9 A;  1ZPW X;  2CJB A;  2OKQ A;  4RUH A;  2EG2 A;  3DLG A;  4P72 A;  1QJH A;  1IVZ A;  4USJ C;  2HMI B;  5CHC B;  4LF5 J;  3OR1 B;  4FYV B;  3T1H F;  3LGH A;  5L1K A;  4NMX A;  1IM4 A;  4CWB A;  2RJZ A;  2W7P A;  3J81 U;  1NZA A;  2NRE A;  3HF5 A;  2DRD A;  2BAN A;  2POK A;  4IFY B;  1VRT A;  2N4C A;  1X4A A;  1RTH A;  2F7V A;  5T41 A;  3IG1 A;  2DIT A;  4H54 A;  1H2V Z;  2XWY A;  1L3T A;  1FDD A;  1D8Y A;  2N7Y A;  2IJR A;  3MPU B;  2GO8 A;  3ZTO A;  5THW A;  4M5N A;  2AJ4 A;  2GJ2 A;  4WKR A;  1FKO B;  1Q7L B;  1IKV B;  2PEB A;  1RHQ B;  5EDW A;  3CCU S;  4C11 B;  1DTT A;  4NA2 A;  3X1L B;  5KFA A;  6AT1 B;  2B4P A;  3JQM A;  2KZZ A;  2RVJ A;  3KHH A;  1OS5 A;  2UXC F;  1J5E J;  4CI0 B;  1L3K A;  3TJ9 A;  1HNW F;  4L3N A;  5LJ3 Y;  4DN0 A;  1KSP A;  2P8I A;  1PJ7 A;  5LSR A;  1GAO A;  4LR7 A;  1SJ3 P;  1VQ8 S;  1O51 A;  1QE1 A;  3NG8 A;  3ENV A;  4JYA F;  3BO2 A;  1DZ5 A;  2DGX A;  2PD1 A;  1UZH A;  2MMY A;  2KXF A;  1HBU B;  3N5B A;  1FTC A;  4IG0 B;  3HSD A;  3IAS 9;  4DR7 F;  2H3E B;  4YDD B;  2R7V A;  1ELO A;  4HAC B;  5E3A A;  1FHT A;  3V4I B;  1WHV A;  2NXE A;  3OFG A;  2DNY A;  1DAR A;  3NAI A;  3KK1 A;  2W7O A;  3GJR B;  1VIO A;  2LA4 A;  4F26 A;  5HN0 A;  6FDR A;  2BYC A;  4J9Q A;  4F4W A;  2EFO A;  1C0T A;  4Z37 A;  1GX5 A;  1N8R T;  1S77 D;  4DU8 A;  4RWX A;  2R2S A;  2YKN A;  3TNV A;  4OJ3 A;  3LW5 C;  1J5O A;  1JB0 C;  2HBR B;  5JUM A;  2H48 B;  4M5H A;  5GVQ A;  5J2P B;  3PZP A;  4C8L A;  1TQL A;  4LRD A;  5JJB A;  1HQU B;  4LMZ A;  2ZOG A;  3W8G A;  3M2R A;  3DLB A;  4ELU A;  3R5J B;  3GJQ B;  1D3W A;  3KTQ A;  3D0G E;  4NXM F;  2Y8Y A;  1S4F A;  3GYX B;  3MEC A;  2KH9 A;  1Q8B A;  4PG8 A;  1ZOT A;  3CCJ S;  3GIL A;  2E1R A;  2D9P A;  3MAQ A;  4Q2L A;  4JV0 A;  1A6L A;  4IOC Q;  2Y9H A;  1X5O A;  3V6H A;  3G8T A;  2RAQ A;  2OFH X;  5KG2 A;  1IWG A;  2JSX A;  3DDK A;  1X4G A;  2EK1 A;  2YH0 A;  1NK8 A;  4TQR A;  1S49 A;  3A13 A;  4CLS A;  1RT1 A;  2WTF A;  1F2H A;  3CC4 S;  2HWH A;  1R8A A;  4UUW A;  4LRB A;  1K73 T;  3SSR A;  3FCH A;  4DI6 A;  2AJ1 A;  2IBK A;  2M7S A;  1R0C B;  1FD2 A;  1T0T V;  2YPZ A;  1DHM A;  3C6T A;  2MDA A;  3LWM A;  2R8I A;  3IGV A;  1XMQ F;  4Y2C A;  4ZP9 A;  1S7H A;  3BKT A;  2CKW A;  1K44 A;  1SC6 A;  4NCA A;  3GR0 A;  1Y5I B;  3M2V B;  3CC7 S;  2DCU B;  5ETP A;  1RT4 A;  4OI1 A;  1JWW A;  1VGY A;  2YNG A;  5F8H A;  2KRB A;  3GCX P;  5C25 A;  2NXN A;  2LU2 A;  4EGL A;  2FJD B;  1U45 A;  2L9W A;  2ZFH A;  3L09 A;  3WIV A;  3KJQ B;  2YNH A;  5F0U A;  5SZT A;  1HKA A;  2V69 A;  3KLH B;  1RAG B;  3IR6 B;  4NML A;  2M8D B;  3H5U A;  4ICL A;  1BLU A;  4OI3 A;  4NYO A;  1FRJ A;  3DXB A;  3AXM A;  3MD1 A;  3O1L A;  3D7S B;  2YPY A;  1K8A T;  1S1U A;  3SBM A;  3W3S A;  2D74 B;  1C0U B;  1S57 A;  3AHP A;  3D5M A;  2DGU A;  5A2Q Y;  3POT B;  1I94 F;  3J7Z T;  3DRS A;  4BLG A;  3MMJ A;  3HHN B;  4L76 A;  2DGV A;  4BC9 A;  1RZM A;  4KH1 B;  3D67 A;  2CPZ A;  4UQT A;  4QW8 A;  3K57 A;  2A2D A;  2HHH F;  1LV5 A;  4Q0B B;  4HDH A;  3NMR A;  4PRF A;  4CQ1 A;  5K14 B;  4FXD A;  3PX6 A;  3HSG A;  4UOG A;  1XNR J;  1SXL A;  1XNQ J;  4IH6 A;  4I56 A;  3EGN A;  1R0A B;  5DG9 A;  3MUT P;  4YP3 A;  1MSW D;  2NR0 A;  3OL7 A;  2QT7 A;  1WTF A;  1U7L A;  2JEJ A;  2XWX A;  3M32 B;  3IBW A;  2M88 A;  4O0I A;  3GQC A;  1W2I A;  3EIC A;  3ILI A;  2VQF F;  1HWK A;  5DRK A;  1HNI B;  2ZHA A;  2MQQ A;  3CC2 S;  2FJW A;  2VHG A;  2BBE A;  1RTD B;  3FSY A;  5AE2 A;  1RTJ B;  1SPB P;  3FRZ A;  3DGP A;  1TL4 A;  3BSN A;  1P9Q C;  2VFU A;  2ZE2 B;  2XO7 A;  4DS4 A;  3PXG a;  2JLG A;  1Z2L A;  1QSY A;  4PG7 A;  3VHQ A;  2FYX A;  4DLG A;  3FRY A;  3W66 A;  2UUW A;  2HG4 A;  5HP1 B;  4CH0 S;  2EWH A;  4QQB A;  1WI6 A;  4U8Y A;  2ZWP A;  1DLO A;  4YR0 A;  2NUH A;  4WZQ A;  4B3M F;  2I9S A;  4C8Y A;  2V4J B;  4URG A;  3C6U B;  5A6W A;  1S1W B;  1N33 F;  5DQI A;  4ZLL A;  1AUD A;  3H2L A;  5AXM A;  2GAH C;  2H1Y A;  4RPF A;  4KGV B;  1SL0 A;  1KLM B;  4QIF A;  5LSL A;  1BC6 A;  3I9Z A;  1FK9 A;  4H4O B;  1PC4 A;  1S6P A;  1RHM B;  4DL7 A;  4C8Z A;  3VGU A;  1VHI A;  2XNQ A;  4DR6 J;  2UU9 J;  2HQ3 A;  2VOD A;  2ZH7 A;  2CAD A;  4RO0 A;  1Y5L B;  1MMN A;  3AOB A;  1U25 A;  5FD1 A;  1X5P A;  5CZV A;  4B17 A;  3CD6 S;  1MML A;  4GKK J;  1F9F A;  4K59 A;  3THV A;  3Q89 A;  3KLF B;  3DDN A;  3HVA A;  2QLB B;  3BPS P;  3OLA A;  1YLX A;  4N41 A;  3QIP B;  2G4B A;  3QAT A;  4K2J A;  1VK8 A;  4DEZ A;  1ZPV A;  3FQL A;  1SVD A;  1TKZ B;  4Y6I A;  1F9H A;  4B3T J;  2GML A;  2HQC A;  3K5N A;  2BOP A;  1KQF B;  4ZPA A;  5F8N A;  1MRO A;  1HI0 P;  1FVQ A;  2MQM A;  3MCS A;  5C5J A;  4A8W A;  3SMZ A;  4U67 Q;  3QAU A;  2N7C A;  4GC7 A;  3CCS S;  1JX4 A;  4JI7 F;  1F2G A;  3IRX B;  4NZ0 A;  4OZJ A;  4F0M A;  4X62 F;  4IUF A;  4I6A A;  4RW8 B;  3P49 B;  3RAX A;  5D8H B;  2HAF A;  2VOO A;  4OI6 A;  3R7S B;  2BOA A;  3AOD A;  1Q79 A;  1HQE A;  1GMW A;  2HND B;  1NDP A;  2YWH A;  3KLG B;  3R6L B;  3BYP A;  4ZCM A;  3G6V A;  2KG1 A;  1WD6 A;  4O44 B;  1Q78 A;  2J9D A;  1JLG A;  4B3R F;  3PV8 A;  4C3L A;  3CJQ A;  5E3Q A;  3GJT B;  1X4H A;  3QJL A;  4USH A;  2K2P A;  4Q45 A;  2AYE A;  5D0E A;  4LFA J;  1VQY A;  4A8Y A;  2F1F A;  2B6A A;  1Q7Y T;  3PY8 A;  1KP6 A;  2AIR B;  2M9K A;  1RE1 B;  3IP0 A;  4YME A;  3CCE S;  1HR0 J;  3VZH A;  1JXE A;  3HI9 A;  2XBP A;  3EPI A;  1A0O B;  2DR5 A;  1BWV A;  2AKW B;  2DR8 A;  2R8K A;  4I64 A;  1U02 A;  3CME S;  2CJA A;  2X1B A;  4FS2 A;  3U1N A;  4K0K J;  2PO4 A;  4CH1 A;  1R3N A;  2FIU A;  8AT1 B;  4ED4 A;  2HFO A;  1X4C A;  2HVZ A;  3OTO F;  4QIE A;  2ZH9 A;  2OTL S;  3QLH B;  4NLV A;  4NAS A;  2R42 A;  3M8Q A;  4DV5 J;  4LF4 F;  5CYJ A;  1H98 A;  2PN6 A;  3GFH A;  1VRQ C;  1R0B G;  1GTE A;  1DJ0 A;  1E6Y A;  2WW8 A;  2V5H G;  3LUY A;  3G9C A;  2V4R A;  1SC4 B;  1RB0 A;  4X4Q A;  3FFI A;  1IBC B;  4FNH A;  1RWM B;  2HQI A;  3W2W B;  5ETT A;  2YWW A;  4DMZ A;  1VOM A;  4WIQ A;  3I0R A;  5F0W A;  1RXO B;  3UW1 A;  3I5C A;  2HK3 A;  3RW7 A;  2JX2 A;  1QSL A;  2FLO A;  4H4M A;  4FXW A;  1HW9 A;  2UV8 G;  2C3P A;  2P2C B;  4X84 A;  1Q1K A;  3EXC X;  2XS7 A;  2GC8 A;  4WE1 A;  5LT5 A;  2EEY A;  1IKX A;  2V9W A;  4GKJ J;  2EC0 A;  1Y5N B;  2HS3 A;  2BDP A;  3MM5 B;  3N01 A;  2IFX A;  2R7O A;  5D0R A;  2KRR A;  2BM0 A;  1SQG A;  1KLN A;  1UJ4 A;  3H42 A;  2LXU A;  4F0H A;  1OPI A;  2XHC A;  1U47 A;  2MTL A;  4NI2 B;  4NA1 A;  3M8P B;  2RQK A;  4A8O A;  2N3O A;  3KLV A;  2DH8 A;  3UVJ B;  3KDO A;  2GVD A;  3L3C A;  2DHG A;  3VAF A;  2I0X A;  4R5P A;  1S4E A;  2FHJ A;  3NGR A;  2ZOF A;  3Q22 A;  1LWE B;  1LK5 A;  1RA7 A;  1U0S A;  1RHK B;  4G1I A;  3M2U A;  2LA6 A;  1OQ6 A;  5KFG A;  2VBY A;  3NWR A;  2V68 A;  3MPV A;  2IYG A;  1N34 J;  2ZIT A;  3B78 A;  2RE1 A;  1HWI A;  2BJE A;  1HD1 A;  3PIP Q;  3R5D A;  3HD2 A;  2YKP A;  4QCL A;  4LSN B;  1LWF A;  4B9L A;  3TAM B;  2L48 A;  2W2M P;  2CQP A;  2X3G A;  3HVW A;  2ZH3 A;  4F3O A;  3GR1 A;  3GIM A;  1S0O A;  3RB0 A;  3OR2 A;  4DUZ J;  1N5Y B;  3GU0 A;  4MK7 A;  3CMQ A;  1RWX B;  1X0F A;  1HNZ F;  1EIY B;  2CNO B;  3M6V A;  1FX2 A;  1RAD B;  3VAL A;  2IM0 A;  4NEZ A;  2WW4 A;  1RK8 A;  2NCK L;  2DIU A;  1GMU A;  1HMV A;  2GIF A;  2PA3 A;  5HSP A;  4PCQ A;  2DPJ A;  3F44 A;  2RUG A;  4E8U A;  2ZH6 A;  3B54 A;  3VQS A;  2R7W A;  3TX0 A;  3MMA A;  1HNV B;  3SZ2 A;  4M1K A;  2W24 A;  4CDI A;  1IR2 A;  4QPT A;  2OPR B;  4GVB A;  3SCJ E;  2VG7 B;  1B0T A;  5F9L A;  3ZZ0 A;  2D1C A;  4DZ6 A;  3HO1 A;  1TZ0 A;  3H90 A;  5F8G A;  1BHN A;  3L7P A;  3DLE B;  2VF3 A;  1EZZ B;  5DDQ C;  4HI1 A;  2IJF A;  2J9C A;  5KFM A;  4RNO A;  1UCN A;  4AXJ A;  2JHE A;  3R9L A;  2J8S A;  2E5J A;  4IYQ A;  1RAE B;  2GQQ A;  4B02 A;  3C15 A;  4ETX A;  3JXO A;  3WX8 A;  1DTQ B;  4B9T A;  1T02 A;  2Y3Y A;  3KK2 B;  3BKU A;  1UJ5 A;  3ETM A;  1XR6 A;  3MAA B;  4FNI A;  2BVZ A;  1IBM J;  2G0I A;  3R7B B;  3JSY A;  2BE2 B;  3B4M A;  3NKY A;  4UZC A;  2GGP A;  3RTV A;  3SCL E;  3AJ2 A;  1SIZ A;  4KV8 B;  3L9Z A;  1RBO B;  4OYZ A;  1TK5 A;  3BV8 A;  1HBM A;  3GV7 B;  4J9U E;  1ZZF A;  2HNY B;  1CBK A;  1JQG A;  2H5J B;  2Z56 B;  2VV5 A;  2BAC A;  5I3U B;  4IDK A;  4P10 A;  1RQ0 A;  3MED B;  3OL8 A;  2QRR A;  3NOG A;  1HPZ B;  5DET A;  3EUN A;  2CNN B;  2G9O A;  2NXJ A;  2ZNY A;  4OJ1 A;  2MQO A;  3KDN A;  1CEZ A;  5LXR A;  4YOE A;  4KC5 A;  3IBC B;  1OMS A;  3DYA A;  4DR4 F;  1N0U A;  3VGV A;  5GAG U;  3CCQ S;  3U1L A;  1VR6 A;  3THP A;  3OL9 A;  1TL1 A;  2JC1 A;  2C2O B;  3NGT A;  4J9N A;  3SFG A;  2ZC4 A;  2CVE A;  1S0N A;  3S7R A;  3GZ7 A;  4X64 F;  2BW7 A;  3GCW P;  4PAA A;  2R8H A;  3MM7 A;  1RUS A;  4OHY A;  3N0V A;  4M5L A;  4WXO A;  3BDP A;  3ZC4 A;  3N79 A;  1MWZ A;  3BGR B;  2E9Z A;  2HZA A;  4FDF A;  4PQU B;  2BRK A;  2WON A;  4KSE B;  2MYF A;  4QYZ K;  3MD3 A;  1HD0 A;  1U1L A;  3LF0 A;  3BR9 A;  5KFR A;  3MM9 A;  2F8H A;  2ZD1 A;  4BBY A;  4F67 A;  2XCP A;  3QZ8 A;  4DX5 A;  4NXN F;  4JI0 F;  2ZZM A;  1GEH A;  1U1N A;  4UUX A;  5MAO A;  3I5A A;  3O6Q A;  3E01 B;  1FER A;  2V94 A;  4PG5 A;  3CCZ A;  2FTR A;  2UP1 A;  2FJB B;  5I4M A;  2I38 A;  3E51 A;  3J7Y U;  1V3R A;  4FXV A;  1D8Z A;  4LF5 F;  1S1T A;  4CLP A;  1T05 A;  4NCB A;  2CPI A;  2EKY A;  1TEL A;  1PO6 A;  2EVZ A;  1TTH B;  3MEG A;  4CT8 A;  3SSQ A;  1CPZ A;  4QIV A;  3QRQ A;  1RSC A;  2DXF A;  3RJM B;  4PPZ A;  1Q8I A;  2L41 A;  4WTO B;  2XY6 A;  1HHS A;  4ID5 A;  5HRO B;  4FF3 A;  4G1Q B;  4F4A A;  4IFV A;  1SL2 A;  3NBP B;  2RIL A;  1LW2 A;  3AD9 C;  2CQC A;  2J9D E;  3PEH A;  5DGB A;  1F60 B;  2E5G A;  1WSR A;  2FVP A;  2FHK A;  2IHR 1;  2E1A A;  2YBV A;  5ETK A;  5IZH A;  4YY3 J;  2HNZ A;  2IYI A;  3W62 A;  2MZR A;  1Y9O A;  2Q1L A;  2XMM A;  5IT9 Y;  1J5E F;  1JLQ B;  2B7C B;  5KFB A;  3ADA C;  4WPA A;  4J91 A;  2DR9 A;  3ISN C;  4AE5 A;  2DHA A;  2JLE A;  1BWE A;  4KO0 B;  1TKT B;  2ZDO A;  3MM8 A;  4P2M A;  4WK1 A;  2VPZ B;  2MGZ A;  5CAA A;  1FO1 A;  3CJR A;  5E41 A;  5ADZ A;  4OYM A;  2R7U A;  2IM1 A;  5AE1 A;  1NO8 A;  3T5H A;  4OLO A;  4U7U D;  3ZZY A;  4OYI A;  3CJ0 A;  1N48 A;  5ETV A;  4DG1 A;  3NS6 A;  5FLX Y;  4KPY A;  2NUU G;  2A0F B;  1M5P C;  2ZEJ A;  2Q3P A;  4RWW A;  2LQJ A;  1IWA A;  3PTW A;  3U02 A;  4PWU A;  1SKR A;  1R43 A;  2XGQ A;  3MOJ B;  5KT2 A;  4HLB A;  2PT0 A;  5D4N A;  5KFC A;  5HMY A;  2XZT B;  2IPO B;  2QX0 A;  4AND A;  2ROE A;  2B4V A;  4UOH A;  1HNX J;  1HL6 A;  4WWS A;  3BEG B;  3T1H J;  4PXD A;  3JSM A;  4RUB A;  2OTJ S;  5D4P A;  1S1V A;  3NCP A;  2M0G B;  4WU3 A;  2AX0 A;  4A8Q A;  4DCP B;  5DQG A;  2ZVI A;  1U6B A;  4BC7 A;  2PSZ A;  2Y8W A;  2FY1 A;  4ECV A;  4RBU A;  1PC5 A;  2QZ8 A;  3QJP A;  2PI4 A;  2EI5 A;  1AZS B;  4DS5 A;  3KKF A;  2CQG A;  3ISN D;  5FJ4 A;  3CDA A;  2AGQ A;  4WZM A;  4ZP6 A;  4FYW B;  2DHH A;  1IKW A;  5KFQ A;  5HBM A;  3OD2 A;  4IOB A;  4X4U A;  4QOT A;  9ATC B;  2V2Q A;  3MMC A;  5HVG A;  4CLY A;  4RBV A;  4UTG A;  2HVH A;  1HBO B;  2UXC J;  2CRL A;  1P1T A;  2XS5 A;  1FFW B;  4ZVP B;  3N4W A;  1HNW J;  5HK4 A;  4DV7 J;  2VA3 A;  1M5K C;  1PBU A;  1VIS A;  1URR A;  4QW9 A;  1VI7 A;  2C1E B;  3LPE A;  2OUG A;  3HT0 A;  2E29 A;  2HVE A;  5D3G B;  3CJK B;  2R2T A;  5D15 A;  1X9M A;  1Y00 A;  2YX1 A;  4DCO B;  1Q8L A;  2EC2 A;  2J76 E;  4A8X A;  4WYW A;  3T9N A;  3W2V A;  1ARO P;  2EG1 A;  1SCJ B;  3UCU P;  2V2Z A;  2BAN B;  3EYZ A;  1QM9 A;  1RT6 A;  4ZCL A;  2G0J A;  3OPK A;  1UVJ A;  5E3P A;  1CJT A;  4DR7 J;  2ASL A;  1RTH B;  1ZTW A;  3Q8S B;  2H4Y B;  1I6J A;  2BXJ A;  4KHR A;  2DNQ A;  3UCZ P;  4P7T A;  1VQN S;  4RW7 A;  1KVJ A;  1VQ7 S;  2ILZ A;  1LQ9 A;  1WC6 A;  2KB2 A;  3GYG A;  4YB1 P;  2V0N A;  1A9N B;  1MN9 A;  4ZVS B;  1Q16 B;  3M1V A;  1FRH A;  1F9E B;  2EPI A;  1B0V A;  3DLK B;  3CUL A;  3BO3 A;  1DRZ A;  5CCM A;  2DD8 S;  2G2Z A;  3ET6 B;  2ZJR Q;  3G8Q A;  4OX6 A;  4WII A;  4O3Q A;  2FC9 A;  4DV1 F;  1NK9 A;  5L9N A;  2OHD A;  2XY7 A;  3MEE B;  2NS1 B;  2RRB A;  1UJ6 A;  4I1T A;  5J1E A;  2HGM A;  1VYA A;  1OPZ A;  2VAS A;  2BE9 B;  3GG1 A;  2PI5 A;  5A8W A;  1LEO A;  3NP5 A;  5B0E A;  3TRG A;  2CZ4 A;  2FGC A;  4WFA Q;  1XNR F;  1U1Q A;  1RTI A;  1XNQ F;  1ZM9 A;  2H5I B;  5HL7 Q;  2XMJ A;  3N9U C;  1CC8 A;  4N56 A;  5A76 A;  3NOC A;  2ZH5 A;  5IT9 U;  3BM7 A;  3UDE A;  8ATC B;  4ILR A;  1KD1 T;  4FPI A;  1NSQ A;  3KK1 B;  3ELH A;  1RWO B;  1KVK A;  4TVA B;  1L3V A;  2Z30 B;  4PG6 A;  3C46 A;  1TL7 A;  5F8L A;  1CJU A;  2R2U A;  2K7K A;  3KLI A;  1KQK A;  3G82 A;  4WP8 A;  2GS8 A;  3KG4 A;  4M5J A;  3V6D B;  5KFY A;  1IN0 A;  1FJE B;  1RAC B;  1RT3 A;  5J1N A;  3GSD A;  3G96 A;  2EFP A;  3NRB A;  3PW7 A;  1JKH B;  1QY7 A;  3LP1 A;  1RJJ A;  1RTZ A;  4A8M P;  5LJ5 Y;  2E5H A;  4NZ7 A;  2HFN A;  3MUM P;  1OYE A;  1J5O B;  2W4D A;  4UF4 A;  1R8P A;  1S48 A;  3FCV A;  4YB5 A;  3TO8 A;  1RWW B;  3GFY A;  5DQH A;  1Q8K A;  4OZL A;  1FRI A;  4DFM A;  1V3S A;  2VC0 A;  4HT7 A;  2H51 B;  4JB8 B;  1YBU A;  1BGX T;  2VG5 A;  4F0K A;  3WBZ A;  3MEC B;  4DQQ A;  2MQ8 A;  2WOM B;  1RAO A;  1WKJ A;  3ENQ A;  5K9F A;  4NLW A;  4DR3 J;  2BJ8 A;  4QYR A;  2B4U A;  2QSW A;  2MSS A;  2ILY A;  2DR7 A;  3EVO A;  1KOH A;  1RT2 B;  3DLJ A;  5EHH A;  4J9P A;  7AT1 B;  2VQE F;  1VBX A;  3PRB A;  3QGG A;  3KK3 A;  2HUR A;  3MPW A;  1G6B A;  5FDL B;  2NZC A;  5C24 B;  2QYG A;  2HYI B;  2BR0 A;  1PJ6 A;  3OHB A;  4EZ6 A;  3FUY A;  2YQ1 A;  2UVR A;  1ZAV A;  2KT5 A;  3NLC A;  3CCR S;  3SQG A;  4CLU A;  4DR6 F;  3CDU A;  2UU9 F;  4JI8 J;  2HHH J;  3VV2 B;  1S0M A;  2O67 A;  4A47 A;  3Q8V A;  3TP2 A;  1FWP A;  3GII A;  3C6T B;  3BBB A;  2DHS A;  4DX7 A;  2ZH2 A;  2HHP A;  1SH3 A;  4ZVT B;  1IJF B;  4JV5 J;  1R8H A;  2HBZ B;  4M5K A;  4GKK F;  2JEG A;  4A46 A;  1RI7 A;  3GV5 B;  5HMW A;  1QAY A;  4F50 A;  3CWJ A;  4DQP A;  4MKA A;  2C42 A;  2YNG B;  3R5C A;  4K4T A;  2V8P A;  4KB7 A;  2R8G A;  1I5O B;  1NJY A;  3FEZ A;  4XTT A;  4YS2 A;  4OFZ A;  2KHC A;  2ZC3 A;  4TY8 B;  1EAR A;  4ED1 A;  1VQ9 S;  4DPW A;  4OMF G;  2JFK A;  1V3Z A;  1NUE A;  3LA0 A;  2GNK A;  3QGH A;  1ZET A;  1U24 A;  5D78 A;  5U47 A;  3PJ9 A;  3TOQ A;  3Q8Y A;  3I0S B;  4M95 A;  2ZH1 A;  2HQG A;  3PNI A;  3ZZP A;  3PYG A;  4ALZ A;  4EO8 A;  4R8U B;  2CJQ A;  1SQE A;  4LT6 A;  3MCN A;  2GZO A;  3B6B A;  2BQU A;  3UQS A;  1R6V A;  2YKQ A;  3HPO A;  2YKM A;  4X65 F;  4URQ U;  4FKY A;  5EX0 A;  2CAJ A;  2MHN A;  3OJS A;  4CCH A;  3AAW B;  2VPY B;  3OJU A;  1ZA2 B;  2Z2M A;  1JLC A;  5KG3 A;  2XI2 A;  3MWB A;  3TA2 A;  4A8S A;  1TKX A;  1WTB A;  3IRW P;  1S9G A;  4RZR A;  1U2R A;  3U1M A;  3FDS A;  4NLG A;  1HHT P;  3HHL C;  3I87 A;  1YSJ A;  5C42 B;  1NK6 A;  2ATL A;  1VCT A;  1UEK A;  2M70 A;  1N5S A;  1N33 J;  4C7Q A;  1H73 A;  1SIW B;  2CVI A;  3V2U C;  3ITH A;  3NY0 A;  2F40 A;  3IC1 A;  2DEJ A;  5KG7 A;  5ETL A;  4G65 A;  4KFB B;  1RDR A;  4LFA F;  4EK2 A;  1RBL A;  2FB0 A;  1QTN B;  1QAI A;  3FBE A;  3D0H E;  3M6X A;  1V5V A;  2MST A;  3UWT A;  2GFF A;  5L39 A;  1Q4R A;  1T9W A;  4ZLJ A;  2XLK A;  5HLF B;  2KT3 A;  5F8I A;  3W65 A;  5IC6 B;  3RBD A;  1YTY A;  4ECS A;  3MEK A;  1PAE X;  1NKC A;  2EFN A;  3E3X A;  2AV5 A;  5E7O B;  1GT8 A;  3W1Y C;  1NM2 A;  4K0K F;  3N6N A;  3NAH A;  2E7V A;  4ZP8 A;  1YJ9 S;  3HDS A;  2IRX A;  5G0R A;  1DLO B;  1BXN A;  3T41 A;  4JI6 J;  5HMX A;  2ADC A;  3VAH A;  2F9D A;  2EFQ A;  3PW4 A;  3PO5 A;  4MK9 A;  4YR3 A;  4DU7 A;  4ES3 A;  2WVB A;  1N0V C;  1Z2Z A;  2B9E A;  4UQG A;  1RCX B;  1ZBT A;  4W92 B;  2UXD J;  4JI7 J;  3SYZ A;  4KH0 B;  3HHL D;  4D3H A;  5HJX A;  2X1A A;  1S6P B;  4O3S A;  3CCM S;  1QSS A;  5HQL A;  2HQD A;  3U27 A;  1CJK A;  2W9C B;  3BS9 A;  2OH2 A;  4DSJ A;  2E44 A;  2AU0 A;  2YXL A;  2B0G A;  2K8G A;  3A4T A;  2XZW A;  3RG6 A;  1FRM A;  2XYP B;  2HZV A;  4BWM A;  2AEM A;  4AT1 B;  3KHR A;  4GKJ F;  4CLW A;  4YUD A;  4C3K A;  3ULH A;  4RJV A;  1R8B A;  4N77 A;  4LR8 A;  2CQH A;  2P6S A;  5SUH A;  2HHS A;  1SL1 A;  2UZA A;  1UP1 A;  4PQA A;  2ALY B;  2CJX B;  2ASY A;  2FHM A;  1KRP A;  4Y2A A;  3D3C J;  2DKO B;  4CRJ A;  5A8R A;  3DHW C;  3M30 B;  4LFB F;  1UVL A;  1KR4 A;  2LXF A;  1K1Q A;  2O1P A;  1NKB A;  2DNO A;  5HJY A;  1FXL A;  1RT5 A;  2FDN A;  1I1G A;  1TV6 A;  3RBE A;  2G2Y A;  4FYY B;  5DO2 A;  3OUY A;  4NWB A;  3G86 A;  1N34 F;  2UUA J;  2VZ9 A;  2IVM A;  3MR6 A;  2HW3 A;  2CJ9 A;  1QDU B;  5CYQ A;  4K8R A;  3DGV A;  4NPO A;  1UWB A;  4EU0 A;  1X4B A;  2W9B A;  1C1B B;  1FA0 A;  1ZM2 A;  2GJI A;  2J7U A;  4DN9 A;  8RUC A;  1YZ7 A;  3VQT A;  1JXV A;  2KXH A;  2K3K A;  1SV5 B;  2P6T A;  4DUZ F;  4LF4 J;  4DQR A;  2XQC A;  3HSJ A;  5B0F A;  2RDD A;  3HFK A;  1SJR A;  1MNE A;  3W9H A;  2ZOM A;  3OR1 A;  3EZO A;  4O3O A;  1SBR A;  1RAJ A;  3OXL A;  4P2X A;  2ZWO A;  5F8J A;  3IWN C;  4N7T A;  4YFU A;  1D9F A;  2WBM A;  3PHT A;  3HLU A;  2F8M A;  3GV8 B;  1RT7 A;  1TL3 B;  1Q82 T;  1T9T A;  3KNG A;  4NLY A;  4DF4 A;  2DNZ A;  4IFY A;  2VOP A;  5LMU F;  3PVX A;  3J7A N;  3NGK A;  3IN5 A;  4FBU A;  2UXB J;  1U2F A;  2IRY A;  4EZ9 A;  2Q43 A;  4FP9 A;  5KT7 A;  3KFW X;  3TUI C;  2AYM A;  5G4D A;  3A3O B;  3MXH P;  5GAD I;  2OAU A;  5HI7 A;  1S99 A;  2CQ0 A;  2WSE C;  2PE8 A;  4C11 A;  3PX4 A;  4K2X A;  1UFK A;  4WYL A;  4X2B A;  4USU A;  4ELV A;  3SDE B;  1ZYQ A;  4K7Q A;  2BM1 A;  2B9W A;  2CYY A;  3M8Q B;  1CVJ A;  1YK9 A;  2Y1L B;  5EUH A;  2V8H A;  3V81 A;  4QR0 A;  1E6Y B;  2M8H A;  4NLO A;  4M94 A;  2W2P P;  3CXC R;  2SXL A;  3TZW A;  4I68 A;  3TVK A;  3PYD A;  3MOZ A;  4X4O A;  3IA0 A;  1K47 A;  3OQ2 A;  3NGD A;  4IG0 A;  2CZ9 A;  5L9X A;  2C3Y A;  3FC9 A;  2WB1 D;  1MMD A;  4H4M B;  3HJF A;  1IBK F;  4HAC A;  4A8K A;  2QV6 A;  1Q81 T;  1XIQ A;  3V4I A;  4DV2 F;  5IM0 A;  2AZ3 A;  2HLT A;  1TMM A;  4YR2 A;  3K5P A;  4MH8 A;  4N8O A;  3HX9 A;  3BH6 B;  5I3P A;  5KFW A;  4V1A k;  4NCG B;  1B99 A;  2JLF A;  4HH1 A;  4DR5 F;  1TK8 A;  3E2E A;  2CDR B;  1MLA A;  1DFD A;  1FNX H;  4B3O B;  3T1Y J;  5KT5 A;  1PIL A;  3HCX A;  4PUO B;  1H2T Z;  3TAQ A;  4IG3 B;  4HT5 A;  3KJF B;  3HUL A;  5L46 A;  1NLK L;  1SJQ A;  3NL0 A;  2YWE A;  1RWV B;  2LEA A;  5J2P A;  2LDY A;  4RNF A;  2AEJ A;  3PRV A;  5IT4 A;  3EGW B;  1DUR A;  1P6T A;  2KFY A;  3TEH B;  4C98 A;  3A3P B;  3M05 A;  1OY9 A;  4RNN A;  2QE5 A;  3OLB A;  2VPX B;  4WTY A;  1GXU A;  3Q8U A;  2FJV A;  4KAI A;  3G6E S;  4RNH A;  3JTP A;  4NLS A;  3ZZZ A;  2E1C A;  4RU9 A;  1YVF A;  1WDD A;  2E1P A;  3UR0 A;  3MUR P;  2VBZ A;  2U2F A;  5L8R C;  4QYZ J;  2GW8 A;  2HEK A;  2E66 A;  3PYF A;  4BS2 A;  1YJT A;  4B3S J;  1R89 A;  1WC3 A;  4C8N A;  2RU9 A;  4I67 A;  4ZCK A;  4NLU A;  4JBC A;  3EDQ B;  1MU2 B;  4K4V A;  4J9R A;  4QU6 A;  2B9Y A;  3AA8 A;  5GMD A;  5KFO A;  3PJX A;  4C97 A;  1PYO B;  1ACM B;  1D09 B;  4WF9 Q;  4HL9 A;  4DPO A;  2Z8Q A;  3BJY A;  3VTI A;  2LVW A;  2CIM A;  3M2V A;  1UFL A;  3N6L A;  3FZ2 A;  2AW0 A;  2W2Q P;  4CLT A;  1KC8 T;  4KHP J;  1NH7 A;  2AJ0 A;  2RQ4 A;  1YZ6 A;  4NYZ A;  1H3D A;  2LEP A;  3PHE A;  3KLH A;  2KHD A;  3TAN A;  3I56 S;  1ITP A;  2G1H A;  2DNN A;  2VFV A;  3UN5 A;  2H4W B;  2ZBC A;  3KNA A;  4CO3 A;  2X51 A;  4J37 A;  3O44 A;  1C0U A;  4UY8 T;  2ZBR A;  4MYT A;  3POT A;  1F3F A;  3M6U A;  3D6M B;  1FKA F;  3ZZO A;  4HR2 A;  2DHX A;  2MKC A;  2AYB A;  4X64 J;  4P73 A;  4ZHR B;  2VKR A;  2K1R B;  2MZ1 A;  3A1Y G;  3AOC A;  2BZ2 A;  2XI3 A;  2RUS A;  3T1A A;  3JAM Y;  4H4K A;  5K14 A;  4RW4 B;  2Z4P A;  5LOQ A;  3QWP A;  4RW6 B;  4B08 A;  2VH7 A;  2AQ4 A;  4ZA1 A;  3K59 A;  1HBM B;  4XPC A;  1LFP A;  3ZFV A;  5KFJ A;  2CQD A;  1XBW A;  2HLU A;  2VKZ G;  3C16 B;  3FBC A;  2KJW A;  3BSC A;  2CNL B;  5J2N B;  4JV2 A;  4QU7 A;  2QG9 B;  3M32 A;  4MFB B;  2IAJ B;  2LYV A;  4MIB A;  1U26 A;  1CG2 A;  1PYS B;  4JI0 J;  1R27 B;  3DYA B;  3D1Q A;  3VGT A;  1VQS A;  1YIJ S;  2QLF B;  2ERR A;  1HNI A;  2P9G A;  5IWA F;  3BBC A;  1RWU A;  4ZJO A;  2FVR A;  1WUU A;  4K5R A;  3BBF A;  3PM9 A;  1YDL A;  1E6V B;  1WOO A;  4F8R A;  3BR8 A;  4OX7 A;  1I3O B;  1N5T A;  3K0J A;  2AJQ A;  5T14 A;  4GRS A;  3AT1 B;  4KTQ A;  2OPP B;  3I55 S;  5BYS A;  1I51 B;  1HNX F;  2W4P A;  2CPX A;  2ZHO A;  2ZE2 A;  4KE5 A;  3TR5 A;  1N6Q B;  3US5 A;  3AFG A;  4Y2I A;  4LJM A;  1Y7P A;  3D6T B;  3UO0 A;  2XMA A;  5HP1 A;  4CO0 A;  2FZC B;  2DNM A;  3P5T L;  4FYD A;  1VMB A;  3HP6 A;  1WG1 A;  4N76 A;  3G8S A;  2ZUA A;  3GFX A;  4DR1 J;  1NH8 A;  4UST A;  3HXM A;  2COL A;  2V4J A;  1VC0 A;  2WON B;  1Q95 G;  1S1W A;  4EBD A;  4G6V B;  2IY5 B;  4J90 A;  2XGP A;  1VLY A;  3QWU A;  2FC8 A;  3WHI A;  1KFS A;  1KLM A;  2XSF A;  3OSN A;  1KNZ A;  1RHJ B;  2I1R A;  1IKY B;  1XR7 A;  2QLW A;  1U49 A;  4H4O A;  2LQB A;  4IKA A;  2XSJ B;  6FD1 A;  3UDV A;  5EX3 A;  2OJ3 A;  3SSS A;  4C0H A;  2A1B A;  2DGW A;  4UOC A;  4DV7 F;  3V5R A;  4EI2 A;  2J6S A;  2VJV A;  3IS9 B;  3RYL A;  4HVZ A;  2F8E X;  2RQC A;  4ILM A;  2HIQ A;  3KLF A;  1IM6 A;  2DGQ A;  1X5T A;  3LQV A;  1SQF A;  3FKB A;  3QIP A;  4J9M A;  1UPP A;  1B70 B;  3QT7 A;  1VRU B;  3HZE A;  2VIC A;  2V2K A;  4DUT A;  2EFV A;  4DFJ A;  2ZM6 F;  1GK8 A;  2QA4 G;  1ZAW A;  2FHO B;  1OY8 A;  1GMW D;  4F36 A;  4NL5 A;  2W25 A;  3ZTR A;  2MKY A;  1T7P A;  1VBZ A;  3I9V 9;  2AEF A;  3OL6 A;  1P9Y A;  3I96 A;  1N4L A;  1LK7 A;  2I6W A;  2GQ2 A;  1HFE L;  1TAU A;  2QL9 B;  3NEK A;  1GTH A;  3DOK B;  5L1I A;  4Y0F A;  3UNY A;  2O01 C;  4UOF A;  3FBF A;  3TA1 A;  2GMH A;  2MZQ A;  3CDW A;  4P9S A;  1SJ4 P;  3MUV P;  4CO2 A;  1ZA1 B;  1S59 A;  1HWJ A;  4OYP A;  2YWF A;  4AL6 A;  3ZZR A;  1KTQ A;  4DX8 H;  3H5X A;  4K4W A;  2MGZ B;  3PDN A;  1FEE A;  3M8S A;  2EW9 A;  2HND A;  4ZJQ A;  3KLG A;  5C2G A;  5J2M A;  4O44 A;  3NWG A;  3NCQ A;  4RW9 B;  1K1S A;  2IC3 B;  3TVZ A;  3KHG A;  4QIW D;  5KOX A;  1DAX A;  2NZ4 A;  3N5F A;  4LF8 F;  2C3M A;  1S6Q B;  3V4M A;  3TUP A;  1X0P A;  2VIH A;  1JLB A;  1WJ9 A;  1VBK A;  4XIU A;  3SI8 A;  4DSL A;  1VFJ A;  2UUT A;  1JXL A;  1LWC A;  2HVI A;  3MPD A;  4QJV A;  3DC2 A;  4Z7Y A;  2GIQ A;  5GAH I;  2RRA A;  5CXT A;  4ZVF A;  1FDB A;  2KTQ A;  4HYK A;  1RHR B;  2BV3 A;  1TFY A;  1B0P A;  5KG4 A;  2PMZ D;  2JJ4 D;  1FVS A;  4DJB A;  3R27 A;  4RR5 A;  4R0E A;  4DL4 A;  3R5A A;  3GMG A;  1NU4 A;  2C3O A;  3LP0 B;  4JI3 J;  1UZD A;  4HHU A;  3PEJ A;  4I6Y A;  1B4S A;  3CF5 Q;  3SV4 A;  4KY3 A;  3QLH A;  2EBG A;  4O4G B;  4LF9 J;  3R1H A;  3UE2 A;  4UT4 A;  1F5C A;  4Q8F A;  2HHT A;  1U09 A;  4CO1 A;  3L95 X;  1M5O C;  1X9S A;  1URN A;  1RAB B;  1T9Y A;  1WHX A;  2OPS A;  4TY9 A;  1IKW B;  2ZZN A;  3BGU A;  1NJI T;  1N36 J;  1YX2 A;  1RYR A;  5HBM B;  4CO5 A;  1FE0 A;  2RF2 A;  2H65 B;  4DR3 F;  2F4F A;  3ENW A;  3W2W A;  4EBE A;  1CS4 B;  1DQ8 A;  4Q5V A;  1VS3 A;  1NBE B;  5KT6 A;  2FVC A;  1B3T A;  4X4T A;  2FHJ D;  4F3Q A;  3O8W A;  4OI4 A;  3CD0 A;  3D1O A;  4O0N A;  3QFW A;  1ZH5 A;  3CJ3 A;  4DV1 J;  4PXB A;  5BYQ A;  2XUL A;  1X7V A;  3TX8 A;  1SUQ A;  3UFC X;  1SC3 B;  1WC5 A;  5JVH Q;  1ZZN A;  4JI4 J;  4I2P A;  4JI8 F;  3JB9 k;  2ASJ A;  4CLZ A;  1HYS B;  1EET A;  2WVE A;  3GB0 A;  1BQN B;  1WC4 A;  3JS9 A;  2DTJ A;  4ZOS A;  2QL7 B;  4X4S A;  4JV5 F;  2M5Y A;  2VDI A;  2O3D A;  3QSI A;  2XO6 A;  3EXY A;  1RKJ A;  2ZJQ Q;  4F04 B;  4X4P A;  3H20 A;  1FEH A;  2R7Q A;  3EGZ A;  3M8P A;  5KFH A;  1GNK A;  2P9C A;  3UVJ A;  3HVR A;  3DNC A;  2M52 A;  4PWD B;  1LWE A;  3M1V B;  3Q8P B;  3IR5 B;  1JIH A;  5F3T A;  1YRU A;  2J6T A;  3GPA A;  3GIR A;  2YKA A;  4ZVR B;  3C19 A;  2VG6 B;  2MKS A;  4O3R A;  3CDE A;  5EGY A;  1KON A;  2DNH A;  2D41 A;  2WRM A;  1UW9 A;  4LSN A;  5KFV A;  3TAM A;  4ED0 A;  1QD1 A;  2HS0 A;  3I6P A;  1AYE A;  1M5S A;  2J8A A;  5D6G A;  1YKW A;  5IXU A;  4AQY F;  5J1E B;  1BQM B;  3G6X A;  1WF0 A;  5IQ6 A;  5I42 B;  1N5Y A;  3NCR A;  1AB8 A;  3ETO A;  5LMN J;  4CTA B;  3SXL A;  4ID8 A;  2NSB A;  3TVY A;  3TA0 A;  3BQ0 A;  2B7B B;  2P9E A;  5J1P A;  4QWE A;  2WB4 A;  1LKZ A;  3G6Y A;  3HZG A;  5D0H A;  4NOH A;  5A8K B;  3IGN A;  1XTZ A;  4YB6 A;  1X60 A;  3T6B A;  3M9O B;  2FPH X;  2DNK A;  2VQE J;  3OFH A;  2JNJ A;  4Q44 A;  1NDL A;  3H5S A;  1HNV A;  1LNQ A;  2YWK A;  1CJU B;  2HS4 A;  4LRA A;  3GLJ A;  4DPT A;  3GYN A;  4DSF A;  5F8M A;  2OI2 A;  1RT3 B;  1YIT S;  2VG7 A;  5C2C A;  1OQ3 A;  1XWL A;  3ENA A;  3LP1 B;  1WF2 A;  1P1L A;  2HFZ A;  2HFS A;  5B0D A;  4J9S A;  3DLE A;  4DXL A;  4M8L A;  2MPU A;  3ILJ A;  2A3J A;  3KOA A;  2MZS A;  4OZ3 A;  5KAK A;  4ZIV A;  2BW2 A;  2P5V A;  1NDC A;  2F65 A;  3VAI A;  4OV6 A;  4IH5 A;  4ZCI A;  4DR2 F;  4DCJ B;  4IR9 A;  2WVD A;  2QA2 A;  3IBF B;  4CH7 A;  1JJH A;  1R7I A;  1QAX A;  4E0D A;  3AA9 A;  4DSE A;  2BEF A;  2J9E A;  2CZV C;  3KK2 A;  5BXI A;  4ZVE A;  5KTQ A;  2B9X A;  3NS7 B;  4JI6 F;  4DV4 F;  3MAA A;  3BDE A;  2A18 A;  3TUJ C;  2KM8 C;  2BE2 A;  1BE4 A;  2W2O P;  3GTY X;  1VK3 A;  2QO3 A;  2HHQ A;  3QO9 B;  2HVD A;  4KV8 A;  1YRT A;  5KT3 A;  2UXD F;  1VQ5 S;  2HNY A;  4U7U K;  1WHY A;  3CIZ A;  1RAA B;  2HRT A;  1QUP A;  4WCE Q;  2V6A A;  3MED A;  1Y0H A;  3D6F B;  3KJN B;  4LRC A;  3S8S A;  1APS A;  3EVM A;  4X65 J;  4JI2 J;  4N8N A;  3RW6 A;  3I82 A;  4RNM A;  4RUA A;  2OPQ A;  1UL3 A;  3QNW B;  1WG5 A;  4DV0 J;  4OZN A;  3AB4 B;  3SV3 A;  5CD4 H;  1LW0 B;  5D0G A;  2RML A;  4OX8 A;  3CCW A;  4P2F A;  4TLQ A;  4EO6 A;  2K7J A;  5A2Q U;  3BGL A;  1WF1 A;  1WI8 A;  3I4H X;  1XR5 A;  4QWB A;  2RS2 A;  4MKB A;  3EMT A;  1T94 A;  2XG8 A;  1R8C A;  4PKD B;  2RB7 A;  2QYC A;  1T03 B;  1D9D A;  1NSA A;  3KMQ A;  2L9N A;  3IO1 A;  1LXN A;  3HM9 A;  2VBX A;  1RHU B;  5CYM B;  3BGR A;  2YY3 A;  3BGO P;  3Q2T C;  3OSP A;  1BMQ B;  2GAG C;  1HHQ A;  2UUA F;  1U1P A;  4L75 A;  4F2R A;  2M2B A;  4DUY J;  2DPI A;  1CSJ A;  1KEK A;  1VQO S;  4DSI A;  2KKH A;  3CO0 P;  1BD6 A;  1HA1 A;  4NLD A;  2OGU A;  1S12 A;  3MMB A;  3HVT B;  2HK2 A;  4J9L A;  4KQZ A;  2B5J B;  1YQH A;  4ZVO B;  1NHK L;  4P74 A;  3UDC A;  4W4M A;  2F63 A;  3EGV A;  2CPY A;  3IM8 A;  4ED6 A;  2DCL A;  1C1C A;  2CPF A;  1SC1 B;  2CJY B;  4B9N A;  1UWA A; 
#chains in the Genus database with same CATH homology
 1CJK A;  3G82 B;  4USU A;  4OYI A;  5IV3 A;  5D0H A;  3UVJ B;  1TL7 A;  2GVD A;  1CJU A;  3G82 A;  4WP8 A;  4OYZ A;  4NI2 B;  3MR7 A;  2GVZ B;  3UVJ A;  4CLY A;  3C14 A;  1YBT A;  1YK9 A;  4OYA A;  4USW A;  2GVZ A;  4CLF A;  4CLW A;  4CLU A;  2WZ1 A;  1CJU B;  4WP9 A;  4USV A;  1CUL B;  4CLK A;  3R5G A;  4CM2 A;  5D0E A;  3C14 B;  1CS4 B;  1CUL A;  3ET6 B;  4CLT A;  4UST A;  4OYB A;  4P2X A;  1CS4 A;  3ET6 A;  5D15 A;  3C16 B;  4OYX A;  1CJV A;  2W01 A;  4CLL A;  4WP3 A;  3C16 A;  1WC0 A;  4WPA A;  1YBU A;  1Y11 A;  3C15 B;  4OZ3 A;  1CJT B;  4CM0 A;  2QV6 A;  1TL7 B;  1U0H B;  1AZS A;  1FX4 A;  3C15 A;  4OZ2 A;  5D0G A;  1CJV B;  1CJT A;  4P2F A;  1WC5 A;  4P2M A;  1U0H A;  4NI2 A;  5D0R A;  4CLP A;  1FX2 A;  2BW7 A;  4OYM A;  1AB8 A;  4OYP A;  1AZS B;  1Y10 A;  4CLZ A;  1WC4 A;  3MAA B;  4CLS A;  1CJK B;  4OYO A;  4OYW A;  1WC3 A;  5IV4 A;  3MAA A;  1WC6 A;  1WC1 A;  2GVD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...