3C14B

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and ca
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
189
Chain Sequence
HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for inhibition of mammalian adenylyl cyclase by calcium.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase inhibitor
molecule keywords Adenylate cyclase type 5
total genus 53
structure length 189
sequence length 199
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3c14B00
4CLKA 1CJUB 3C14B 4P2XA 1CS4B 1U0HB 4WP3A 1Y11A 4CLUA 3ET6B 3MAAB 4OZ3A 4CLZA 4OZ2A 1CJTB 4USWA 5D0RA 1YBUA 4CLWA 1CS4A 3ET6A 3UVJB 2GVDA 4OYBA 3C16A 5D0GA 1CULB 5IV4A 3G82B 4CLFA 4CM0A 5IV3A 1WC0A 1TL7A 4P2FA 1FX2A 3C16B 4OYAA 4P2MA 4OYZA 1CJVB 3C15A 4CLPA 1CJKB 1Y10A 2GVZB 1TL7B 2BW7A 1YK9A 2QV6A 4NI2A 3MR7A 3C14A 4CLTA 4USVA 4OYOA 4CLLA 5D0EA 4NI2B 1AZSA 4OYPA 1AZSB 4USTA 1CJVA 1U0HA 4WPAA 1AB8A 3MAAA 1FX4A 4OYWA 1WC5A 2WZ1A 1WC3A 5D0HA 4USUA 1CJTA 1WC4A 4WP8A 5D15A 4WP9A 1CJUA 1WC1A 1YBTA 4CLSA 4OYIA 1WC6A 3G82A 4CM2A 3C15B 2W01A 3UVJA 4OYMA 4CLYA 4OYXA 3R5GA 1CJKA 2GVZA 2GVDB 1CULA
chains in the Genus database with same CATH superfamily
2R7TA 4IFYA 3SQGB 1X0PA 3ZZOA 2X1AA 2J7WA 2C3OA 1RA7A 4EFAC 1PAUB 1FRXA 2RKIA 4NA1A 4EU0A 1XNRF 5KFYA 4AL5A 2WBRA 1YVFA 1UL3A 3N5BA 2W9BB 2L3MA 3CF5Q 2B56A 3KHRA 1YJNS 4GVLA 2P5VA 5F41A 2NUUG 5BR8J 2H48B 1LWFA 4WCEQ 1ZA1B 1RHKB 2OPSA 2MGZB 1AA1B 2E1MC 3Q8SB 2G2YA 3DGPB 3GYNA 4FNHA 1CBKA 1JNZB 2VG5B 2XLIA 1PCAA 1RHRB 1UVJA 2H5JB 3EGZA 3IA0A 1W2IA 2HAFA 4DR3J 2FUG9 3KUEA 1IM4A 4DV7F 5D0RA 2DO4A 1H3DA 4M8LA 1VBYA 2GJ2A 2CYYA 3MPYA 4TY8B 2IMWP 1BXNA 2W7AA 2XMWA 3KUHA 1HW9A 4DQSA 3M8QB 2BE7D 3ONQA 5D6GA 1CLFA 1RISA 3JTOA 4X65F 5D0GA 1TVRA 4DFMA 1CULB 4DL6A 4ERDA 1JLEB 1Q5YA 1LNQA 1UCNA 1I6JA 1RAFB 3VZHA 2RUSA 3EE3A 2GCFA 2M7SA 2MYFA 4DL3A 2BKPA 3C6TB 2YKPA 3BPSP 4L76A 5KFMA 4LF2A 2Z57B 1KOOA 3K7RA 1XMQJ 2YBVA 2B8PA 4TVAB 3K59A 4ECYA 4KHPJ 1XR7A 4LFBF 5HSPA 1VJQA 3HHLC 1REVB 3QO9B 3M9OB 4DXLA 3OSNA 3SV3A 2VZ9A 4ECQA 2ZOMA 3KK2B 2AF6A 3QGGA 2M8HA 3P3DA 5G0RB 3GFXA 3D54A 2KT5A 1TAUA 1RJJA 4JI4J 1Q78A 1RGVA 4WZQA 4ZHRA 4NLDA 4JI0J 3CUNA 2AEJA 5K8PA 3PKMA 1JXEA 4JI3F 4ZOSA 2AD9A 1HBOA 2WCXA 2QL7B 3ZZUA 2R2TA 1R0AA 2ADCA 1D9DA 3RR7A 4B9MA 4B3RJ 2YKMB 3H4DA 4OZLA 2OD6A 2XS5A 2V50A 2DR6A 3DRPA 1APSA 3PYDA 5BYRA 1GTEA 3BH7B 4DSJA 2X3DA 1CJVA 2J7KA 1U0HA 8ATCB 3M6VA 1H73A 4KQZA 3KLHA 1LW2B 1JLFA 2R8KA 4I2QA 1DY3A 1NK5A 4DPOA 2XM3A 2YWKA 3TJAA 2XSFA 3CW2C 2Z56B 1UJ4A 1WSRA 2ZH6A 5E3AA 2RHSB 3VTIA 2YX1A 2BE9B 1TL3A 2DK2A 2DNOA 2DTJA 3IGNA 3QIPB 3NOGA 4KFBB 1Z1ZA 4I68A 2AP6A 2BKNA 2QYCA 3T6BA 3NNCA 1YBTA 1V5VA 2LEAA 2QLXA 3PFEA 3HSJA 4WYWA 2BYCA 3UPFA 4A8YA 3LGMA 5F9LA 3UR0A 3D68A 3C19A 2HZCA 3CCJS 2BACA 3NOCA 2CQ1A 3NLCA 4Y2MA 4F3MA 1RA6A 1R0CB 2QA4S 1FKPA 3BBCA 3MEGA 1NUEA 2F7VA 1EHWA 3HMJG 2J0QD 1URNA 1KONA 1TKZB 5HQMA 4DR4F 2HYIB 4B9LA 4ZVFA 1FJCA 3QRRA 1S1UB 2BQRA 3QRQA 1NK8A 2FJWA 3H2VE 3LPEA 4ED2A 4DUZF 3D2WA 2J6TA 1LK7A 3OXLA 4OYMA 4R0EA 2KZMA 1NAQA 2WSCC 1FJEB 5H9EK 3I5CA 3GCWP 2IA0A 1TAQA 2Y8WA 3L4BC 4K4TA 1GFWB 4Y2KA 3OQ2A 4WFAQ 1S79A 3TOQA 3BGRA 2XYHB 4PXEA 5A8KB 2FD2A 1OY9A 3R7BB 1QAIA 1RWPB 1KQSR 1FWLA 2MKKA 1N56A 1TFYA 2HPUA 4LJMA 3SEOA 4URGA 3HVRA 4OHWA 1ZETA 1PGZA 1S4EA 3R6GB 1U1KA 4ICLA 1N33J 5E2QA 1CC8A 4HEA9 4FXDA 3BGUA 1JLEA 1UPPA 5HMYA 2RD5C 2FZGB 2W4PA 3BO4A 3LP2B 3MAAB 4MIWA 3SDEA 1ITPA 5GMEA 2OPPA 3CCES 4ED6A 4NCGA 1T05B 4WIIA 3OLBA 3OL9A 2ZBQA 4ECXA 5JUMA 1HNIB 3MEGB 5A2QU 4MIBA 1RCOB 4LR8A 5L38A 2OH2A 4O0NA 3HVTB 1FEHA 5GAEU 2R8IA 2B6AA 1RKJA 5I42A 2ASLA 3RR8A 3UW1A 1S77D 2K7KA 2HS0A 1UVMA 2GVDA 3RBZA 2BEFA 1UVLA 2IM0A 2B4PA 2IRYA 3N4WA 3AAWB 4RO0A 4U6PA 3OTCA 2WSFC 1K0VA 4RW9A 1HNIA 4AQYJ 5FDLA 3LWMA 1RHMB 2WW8A 4Y6IA 1Q16B 1VK8A 1WELA 3Q8YA 2W9BA 4F4ZA 1V3SA 4UTGA 4I7FB 4LFAJ 3H98A 2HNDB 1FRLA 1NNDA 3ISND 2MHEA 4NPOA 3UWTA 2G4BA 1S5ZA 2PFDA 3L7PA 3OR2A 3KXDA 2ZWOA 2FZKB 4J9RA 1WEYA 3UO0A 4ZMMA 2MLXA 2ZUGA 1CSJA 3SSQA 3MR3A 4JYAJ 2CWXA 1NZAA 2GVZB 2NXNA 1TL7B 5D3GA 1LKZA 3ZNUA 1FDDA 4F2RA 1X4GA 4ZN1A 1RT1A 5CCMA 4C8NA 4Q44A 2JFKA 2XI2A 4QWDA 3W2VA 4ZK7M 3EDQB 4EMDA 3VGTA 4OYOA 1EZZB 5EUHA 3W9JA 1X5OA 3WHIA 1EB0A 4O44A 2HGNA 5E3CA 4JP8A 3RB6A 3M8ZA 4QIGA 4R8UA 2E5LF 2UXDJ 1F5CA 1OYEA 3TR5A 4L74A 4TU9A 3ILIA 4RW6A 3D1QA 2FY8A 2C2OB 2FLLA 2IRXA 3OFEA 3DDIA 3MEDA 4NLXA 1UETA 3CO0P 2A18A 1U8WA 2OFGX 2NXEA 4XPCA 4F4XA 2Q66A 2IYGA 3MCNA 1FFWB 1UTAA 1H7XA 1AYEA 2H51B 2HVZA 2WSEC 3E01B 4DPUA 1HL6A 1OQ3A 1RKIA 2VH7A 2ZKTA 4DV2F 2YH0A 1T94A 1TR0A 2H5IB 3DLJA 3G6XA 5D0HA 3CCRS 3MM8A 2V63A 4K8RA 4UQGA 2N4CA 7AT1B 1T05A 1UKUA 4DLGA 5HROA 3IBCB 1FDBA 4NZ0A 4PKDB 3QFWA 1NKCA 4UZCA 4PAAA 1ZAVA 4QWCA 1WG5A 2LECA 4OHZA 2G13A 1OSDA 1WUUA 2A2DA 1NLKL 2LQ9A 3MM8B 2AZ1A 2VIHA 1S6UA 2QMWA 4JI1F 1I1GA 2IM1A 4P71A 4ZCKA 4NMLA 2GMLA 3C15B 4B9VA 2AYBA 4F8RA 2MEWA 1OY8A 4UW2A 5GAEI 5DG7A 1CEZA 4DPXA 3M2UA 1AUDA 2FC8A 2IVFB 5I3QA 3HD1A 4NL5A 5GVQA 3TEGA 2LEBA 3I5BA 2DVIA 1YRUA 2XYGB 5K14A 4YHHJ 4HI1A 5IWAJ 4OI3A 3OVSA 2CNKB 5L1IA 2DXDA 3PHTA 5AT1B 3R5AA 4W4MA 3CCMS 2F8EX 2ZOFA 4DJBA 2IRUA 4PPDA 3CCQS 3D67A 4NLUA 2KFZA 1VCTA 4OV1A 3CIMA 1H72C 3POTA 4PXBA 2LDYA 4HDHA 3GIIA 2PC6A 3N28A 4TY9A 3TP2A 3GG0A 1IKVB 2ZH1A 5KFRA 3IR7B 4R25A 4FKXA 4P2XA 3F44A 4ILRA 2J6SA 2C1EB 1SQEA 4UUXA 4A8MP 2CQIA 1FWKA 5B0CA 4RNOA 3DOMB 3BM7A 3R97A 4IRKA 1WG1A 2V8DA 2HRTA 2RE1A 4JI5J 4W92B 3H2UB 4KH1B 4DX8H 5A8RB 4LF4J 4U8YA 5EDWA 4YB6A 1N32F 1QE1A 4CQ1A 2K7JA 3LWLA 4LF8J 1G1XA 4C8ZA 2NXCA 4ZLPA 2UXBJ 1B99A 4USWA 1TELA 2AGPA 2ZH5A 4NWBA 3HJVA 1ZZFA 4LRFA 2AW0A 5B0BA 3J7Z5 5A2QY 2LCWA 1GMWA 4TLRA 1I3OB 1FJGJ 5KFZA 1L5UA 2WK4A 2XMKA 2ROPA 1REGX 5IV4A 4JI8J 4JBCA 4CM0A 2GC8A 2YWHA 3BBFA 4ZITA 4XK8C 2V5HG 1YGYA 2VBYA 1I5OB 1YRXA 4I64A 5IQQA 5A6PA 4DSEA 2VG7B 3M8WA 4P2MA 3O5TB 3RGIA 2PN6A 4B3TJ 4OIXA 4QQBA 3KMSA 3M8RA 1Q53A 2WVDA 1F3FA 1H6KX 3IGVA 4L3NA 2ZH8A 2A3JA 2FB0A 2NZ4A 2GO9A 1RU1A 1SKWA 1QUPA 5E5NA 2Z30B 4TU7A 4NLGA 3DOKB 1A9NB 1YG0A 1U1MA 2HBQB 2G0IA 5IZHA 3D1OA 1S49A 1HW8A 5J1PA 4OX6A 4NLTA 3W5YA 2BJEA 3MM6A 2HQ3A 3NG8A 3FZBA 3Q8RB 2GQQA 3J7ZT 3NMAA 4I69A 1WOSA 1AZSB 2XCAA 2NSCA 1VISA 1C0TA 4DV3F 2Y3YA 1X9MA 4DZ6A 1TMMA 3KK1A 1OS5A 1NH7A 3MM5B 1HI8A 1SKRA 1SPBP 4ECWA 3WIUA 2HNDA 2AGQA 1N6QB 1Z2ZA 1VQNS 1FX4A 1RWMB 3CGIA 4OYWA 4P75A 1N5YB 2HHHF 4H4OB 2Z8QA 1RAEB 4EEYA 1IBMF 5E41A 3VAKA 1U47A 4ATNA 3KJNB 1RWOB 3IC1A 4J37A 4USUA 2D9OA 4ZP9A 3M8YA 4N47A 3ENQA 4P9SA 3D0IE 4AE5A 2HHQA 1YJVA 2XNRA 4WF9Q 3C6UA 2QLFB 2W9CA 2QO3A 2HK2A 2CQGA 4DSLA 2MKJA 1T02A 3EUNA 1WF2A 2L9DA 2J8SA 3TAQA 1R89A 4ANEA 5HMWA 1RDRA 3CE8A 4IKAA 1S0VA 1WEZA 2DGQA 2P9EA 1KN6A 1JK9B 2ZC4A 4ECSA 1P9YA 3DMJB 3LAMA 4NXNJ 3FUYA 1Q0NA 5L1KA 1NZ8A 2B9WA 2RDDA 3HO1A 1DLOB 2VF3A 1NPPA 1UP1A 1D8YA 1U7LA 2JLFA 3CNQP 3FCHA 5HBMA 4M5DB 3SSSA 2DR8A 2XS2A 1FXLA 4EK2A 1KS2A 1SJQA 1G3OA 3D7SB 3MMJA 5A6WA 5CH7B 3GQCA 4MIAA 1K44A 1R3NA 3T5KA 4KGZB 3G8QA 4DL5A 1BWEA 3HM9A 1PKUA 9ATCB 5HVGA 5KFXA 3HLUA 1P9QC 1NSQA 4CTAB 3TJ8A 3BF4A 1ROFA 2EFVA 3W8GA 3BBBA 2UXBF 2CPYA 5DRKA 3WBZA 3HJFA 2QL9B 3KLFA 1FKOA 3UR3C 2ZHAA 2VODA 5CYMB 5KOWA 4Q8EA 2XMMA 3KWMA 2CZ4A 2P6TA 1GQEA 2B5JB 2EFPA 1R8HA 1J27A 3MD3A 4AXJA 3OHAA 2EG1A 2F8HA 1JMTA 1RP5A 4ID5B 3LP1A 3EWGA 5B09A 3KK2A 5ADZA 2RIJA 5J2QA 2VOOA 2BOPA 2OFHX 3N6NA 3TZZA 1R8BA 4ED0A 2P2CB 1NPRA 2V2VA 3R7SB 2ZH2A 4NYZA 3GLJA 3MI7X 1DARA 4DX5A 3MWBA 4ZKAA 1EETA 1WHYA 2NCKL 2M88A 1RWVB 1K47A 1KDNA 2KYXA 3MF5A 5IFMA 4TQRA 2DRDA 2ZBCA 3GSIA 1YQHA 2H5EA 5BYQA 2A6OA 3I87A 1KVKA 7FD1A 2MY8A 4F4YA 4IQXA 1IKXB 5DG9A 3PNIA 2L9WA 4YQWA 2ZVSA 4HACA 3QPIA 1U24A 3P45B 1FXRA 1S1WA 2Z2ZA 3FGVA 4EO8A 2J6UA 3DRXA 2J5AA 4OHVA 3R5JB 2XMUA 1SJ4P 4J9KA 4PXCA 2M52A 1WC0A 1XTZA 4MKBA 5CYJA 1K8AT 4I6WA 4ZA1A 5L8RC 4LSNA 4DU7A 4YFUA 2HWIA 4F0MA 1C4AA 5ETTA 5KG6A 2JVRA 4OYAA 3S1TA 4J9OA 1BQNA 1CJVB 4HVZA 3HK2A 1QUVA 1HA1A 3DLGA 2C3UA 1CJKB 2EG2A 2W7OA 1GX5A 2K06A 2C3YA 1MN9A 2V34A 2RF2A 3ILJA 1Z2LA 1HHSA 1L3KA 1BQXA 2GQ2A 2XHCA 3SCLE 2C2EA 4PRFA 3AXMA 1WHXA 2OAUA 2RKIB 2R7WA 2GV1A 3DRSB 3MR7A 3PRBA 1FNXH 1HNXJ 3QJLA 2LP4A 4DCJB 4B9SA 2AJ4A 2K8GA 1S1TA 3OV7A 1RU2A 4YS2A 3V6HA 2ATCB 1HPZA 2DR7A 2DR9A 3UNYA 4MKVA 1WDDA 1RT1B 3AJDA 4X66J 4C3LA 4K0KF 1O8BA 2DEIA 2RAQA 4ES2A 4OLOA 3QATA 5A0YA 2QLJB 5AJ3F 2V0NA 3P5TL 4O3OA 3IMQJ 4CT8A 3QZ7A 3DN9A 2UVRA 1R8AA 4IRDA 1HBMB 3HFKA 2HWHA 1DHMA 2XS7A 3W3SA 1E6VB 3CJ2A 2QG9B 3PJWA 4B17A 3CC4S 2BJ8A 1X4HA 3D0HE 2DD8S 4KV8A 1MSWD 4DX7A 2ASDA 3AB2B 2R8JA 3MEEB 3TO8A 2WB1D 3G8TA 2ASYA 3QFHA 3OJUA 3MCSA 1SQFA 1HNVB 1RT6A 3CCUS 4BBYA 4RNFA 1DRZA 2FVSA 1TQLA 2R4FA 5J2PA 1WC1A 1S4FA 1UA0A 3FQKA 4F50A 5I42B 3Q83A 2Y1RI 3CPWR 1DZ5A 1NKEA 5AXKA 3KDOA 4MK7A 1KQGB 2G1DA 2CJYB 3NRBA 3W62A 5JJBA 1F9HA 1HNWJ 1RAOA 3DM2B 4QYRA 2XGPA 4DR7F 3A3PB 2WRMA 3I9ZA 4A8XA 1NBEB 2YWWA 3Q0AA 2CJKA 4LF6F 4EYHB 5CYQB 1MLAA 5FLXU 2MQPA 1NPKA 1CQNA 3TI0A 2ZDOA 2ZUAA 1NXIA 1LOUA 2JRSA 3JTPA 4URQU 3OTOF 3PZPA 1NK4A 2FJVA 3D3BJ 1S6PB 3PCOB 2Q6CA 1M5PC 3AOCA 2VJUA 3QBCA 5HMZA 4GKJF 4EUVA 3PYGA 4Q7AA 4ZPCA 1QAJA 3IO1A 4CCHA 2QIFA 2J76E 2EEYA 2YKNA 3GILA 2V2QA 3KOAA 1C1CB 1NSPA 1VOMA 3AQPA 4Q0BA 5THWA 2A0FB 4ZCLA 3ULHA 4RR5A 2VFTA 3U1LA 2X51A 1QTMA 3OR2B 4JI7J 1QD1A 3M6UA 2Q79A 5HN0A 1T9XA 1RT2B 1UWBA 2H3EB 4N7TA 4K4YA 2HQGA 1VBZA 5B0DA 2J0SD 4CWBA 3AD9C 1X5SA 4M5NA 1HR0J 3A13A 3PR5B 4ED5A 3OFFA 4DG1A 3BDPA 1CJTB 5MLCV 2GA7A 2JH3A 4CYUA 5KT2A 5BJRA 2AMCB 4TKTA 4CO5A 2VQEJ 4DPWA 2NPFA 5BYSA 2ROGA 4OZJA 3H5YA 3V6KA 3QWUA 1Y00A 4I56A 5IM0A 3P96A 2FHKA 3PM9A 3DMJA 3VAIA 4FS2A 2KFNA 1KR4A 2KKHA 4PYAA 4BDPA 4FXWA 1PC4A 3KLVA 2M4MA 2QE5A 3Q2TC 2R7OA 2DXFA 1NHKL 4KE5A 2P9GA 2HFOA 2CQ2A 2OMOA 2AQ4A 4H54A 4NLOA 1VQMS 4RNNA 3QAUA 1SUQA 2WB4A 3HVAA 4MYTA 4P73A 5E33A 5ETKA 4CT9A 1Q79A 2B6AB 2RQMA 4UOFA 4USIA 1FK9B 3BGFA 3PY8A 2BJ9A 4CLPA 3QQCD 2N3LA 3D6FB 3OR1B 3THTA 1VBXA 2HHSA 2EKNA 2IPOB 2ZWPA 2UUBF 1GXUA 3QGHA 4ECZA 1HARA 2HFZA 1SKSA 4C8LA 1TKXB 3FKBA 2FJDB 2C2RA 3SFUA 4C6AA 2VONA 3JS9A 5FD1A 3NNHA 4UZBA 4FPIA 3A3NB 1S9EB 1NK9A 1TV6B 4ICLB 3FSIA 1S72S 4USTA 4MKYA 4DSIA 1O0PA 4DQRA 3QSYB 2ZM6J 1X4DA 4TNOA 3BR9A 3S7RA 2CQDA 4X62F 1W25A 3D6MB 5GAGI 4DR1J 1ZYQA 1FXDA 3I82A 4G65A 3BN7A 1RT4A 5F0WA 2W7PA 2N3OA 1VQKS 4B9NA 1PSDA 3TAMA 2LXIA 1YZ6A 5KFVA 4M5HA 5DZ6A 1S76D 4V19J 1Q5VA 5HJYA 2XZTB 3NMRA 2M9KA 5D4PA 2EBEA 1JJCB 2XGQA 3HVWA 2HFVA 4G1QB 3UD4P 2K3IA 2GW8A 2CIMA 3M8QA 2QT7A 8AT1B 4ELTA 2FVRA 4GRSA 4CZCA 2RILA 4X64F 4J9VA 2JDJA 3Q24A 4JV5F 4LRCA 5EWGA 5KAKA 1MU2B 4DQQA 3G2XA 4QIEA 4ZCIA 1NDCA 4PABA 1J5EF 2V4JB 4NMXA 1CC7A 2GGPA 2FLOA 5CHCB 3F56A 1KQKA 2W4CA 1NJYA 3Q22A 2NYIA 2DGSA 5KFDA 2CXEA 2D41A 2KO1A 3GV5B 1KTVA 1NH8A 2AV5A 2X1FA 2B51A 1HHQA 1WEXA 3ADAC 3DLEA 1OMSA 3JYTA 2ZH9A 2BR0A 2BOAA 3BQ2A 3QT7A 2EKYA 4LVNP 1PO6A 1WOOA 4RNMA 4X4OA 3NGTA 1Y5LB 2PO4A 2OSRA 4QYZK 1FNOA 3VAMA 5A0YB 3PVXA 2JC1A 3W60A 4ZVUB 3KK3B 1WF0A 2VPWB 5KG5A 2M8DB 4Q0BB 4BCAA 3BDEA 4WP3A 3MUMP 4QJVA 1A6LA 1FA0A 3MM6B 1EP4B 3GYGA 2HBYB 2WVBA 4DMZA 5DDQC 3V2UC 5F8LA 4A8KA 4AXIA 2IAJB 5C2GA 4IO9Q 1FJ7A 1UWBB 2CPXA 3P4UB 2R2RA 3R1HA 4PCQA 2IHR1 3FVYA 1SV5A 4H4MA 1TKTA 5HL7Q 1IBCB 1XMBA 1YJTA 2HIQA 3CJTA 3TX8A 5J2NA 3KLEB 1YBUA 2BRKA 2I5JA 4RW9B 1KNZA 2Y9HA 4L73A 1EX8A 3NWRA 3T41A 1UW4A 5I3UA 2W2MP 2DO0A 2FTRA 2GGPB 4U67Q 3FMBA 2AYMA 3KJFB 5KG7A 2MZ1A 4PYDA 3CCWA 3J81U 4DWIA 3CJSA 5DDPC 3AA8A 2VOPA 4DV6F 3DRYA 1S1VA 5JVHQ 4X4VA 1A7GE 2XEXA 3LP0A 2X7IA 2XSJB 4HH1A 1WJ9A 4KKOB 1D1UA 5HLFA 4KHPF 1J5OA 1ZPVA 2DH7A 2VV5A 1ICEB 3A4TA 1EIYB 1RACB 2VPZB 3SZ2A 4IG0A 5J2PB 4P10A 2NYHA 2OPSB 1UMJA 4WE1A 3AODA 5ETRA 4ZS6A 1IBLF 4DF8A 4W90B 1R6VA 5G4DA 4P7VA 2ZJRQ 5GAHI 1P6TA 3L95X 2W8KA 5DQHA 2I0XA 2FGOA 1NRKA 2MQ8A 2UU9F 4GKKF 2RRNA 2VFRA 2QZ8A 4IFYB 3X3UA 1NJWA 4KB7A 2CJ9A 4NLQA 4RJVA 5ITHA 2KG0A 1VQOS 4KGKA 1G2EA 1AT1B 3RAXA 2NSBA 4C3KA 4N8NA 2W2QP 5D0EA 1C0UA 4WXOA 4E0DA 3BQ1A 3X1LB 4MMOA 4X4QA 3HD2A 4K5SA 3W63A 4J9MA 1U45A 1FKOB 2YXLA 4WU3A 2N82B 3CULA 3CT9A 4O44B 1U2FA 3RW6A 4PQUA 5HI7A 3POTB 3GR0A 2HHXA 3MR5A 2JFDA 3EDRB 2MKHA 3NS5A 4ZCMA 3LH2S 1TK8A 3GJTB 4LVOP 5E3RA 3D6HB 2PDAA 4CH7A 2LMIA 1LFPA 1RE1B 1LV5A 2BDPA 3KTQA 2ZZNA 1JLGB 3HCXA 2JEIA 3FEZA 2U2FA 3MECB 1N36J 2ALYB 4U8VA 2Y1IA 1SL0A 3U1MA 1VQSA 1IJFB 1X5PA 2JWNA 4TYAA 2IVMA 3BYRA 2FJEB 3MMBA 1ZS6A 1MWZA 1RTDB 1HNZJ 2WOMB 4NYPA 2XMAA 1S6QB 4ELVA 3MGJA 5KFGA 2D7SA 3D0GE 3K8VA 2OO4A 1S9GA 4ZJLA 2QMUB 4PWUA 3H25A 2ILZA 3CJ8A 1Q8IA 4A8FA 2RF2B 1KQFB 4Y65A 4IUFA 5I3PA 4YB5A 3TZWA 4DV4J 4DR7J 2YX4A 4EZ9A 1H2VZ 2CJXB 2Z58B 5LT5A 3RBEA 2ZZMA 4C8YA 5E7OB 1VK3A 2KHCA 3DRRB 4QCLA 4MTPA 2IBKA 1DQAA 1F5BA 4LUBA 1X4FA 4DPTA 2VA3A 4LREA 2PI4A 3MPUB 2UUAF 4B3MJ 5B0EA 2BJ1A 1JLQB 2GAGC 3OTOJ 3BEGB 2RS8A 2CA9A 3CD5A 4Q8FA 3JXOA 2IY5B 2XWYA 2OPPB 4R5PA 5ETMA 2CNLB 2VDIA 1UW9A 1U49A 2VKRA 2YNIA 3H8YA 3W2WA 3V6DA 1RT2A 4ZVPB 3KLEA 3K0JA 3RU0A 5T14A 2FGCA 3NGSA 3JSYA 4G1PA 3T3FA 2O5DA 2OKQA 1NHVA 4DCPB 4A8OA 3IXQA 2QFJA 1CQMA 2C2NA 1IVZA 4JI3J 2YNIB 2V8HA 2VFVA 2CJAA 2E7VA 3GPAA 2DGTA 4L6V3 2U1AA 3A8EA 4OZ3A 4ANDA 3B54A 3W5ZA 4HHHA 3R3TA 1N33F 4ED7A 1F1BB 2XY6A 1EKRA 1N36F 3A8JA 2E66A 2HBZB 1GMUA 5B0AA 1XR6A 4P6QA 3MMAB 5B7WA 4FYWB 3PV8A 3CJKA 2MQMA 1I94J 1W2BR 4HI2A 3MR6A 1XWLA 3M6WA 2VASA 2EFOA 4M5MA 1TUGB 3PX6A 1S97A 2E7XA 2DRAA 4PG6A 1N5VA 4ECVA 4KJIA 2G9OA 3H7HB 2RU3A 3Q8PB 2MTLA 3IN5A 2RDJA 1WOPA 4DL0C 5KFJA 2CNOB 4QR0A 2YH1A 1N32J 1QSLA 2C3PA 2RJZA 1HIYA 5FDLB 3EM1A 5GAGU 4AFFA 4EGLA 3TA1A 5KG2A 3CCZA 3RYLA 3GFZA 1NEEA 1S6QA 3T6JA 2UVWA 4PWWA 2UVVA 1IM6A 3W66A 2BE2B 5HBMB 1DBDA 2OPRA 2OPQA 3FRYA 5A8WB 4Y34A 2BRLA 2LFVA 3H0PA 1S48A 1SJRA 2OEMA 1ELOA 4DV5J 3K58A 3MECA 4DV7J 2AJ1A 4ZP6A 4YY3F 2LQJA 3OT9A 3J7YI 1PYSB 1SCJB 3T1HF 1TZ0A 4MK9A 5HVFA 3Q8QB 3GIMA 1U09A 3DLLQ 1EKSA 2NUHA 3H5XA 6AT1B 4USVA 5ETLA 3VCDA 1U4BA 5HVHA 4DV1F 1U1PA 4FBUA 1WWHA 3FSXA 3GCXP 3HHLB 3CD0A 4OYPA 3IR5B 1RTZA 5K8MA 1C1CA 1O6XA 2CQ0A 3P5BP 2ABYA 1FRHA 1R8CA 2HURA 3MMCA 3DXSX 2X3GA 4RW7A 4ZP8A 3U7JA 1MWQA 1YDLA 1F5AA 2MZJA 3BGRB 3K5OA 4KSEB 2BM1A 3W8PA 3HPOA 3G71S 1T03B 1RSCA 3PRDA 2K1RA 4HT5A 3GMGA 3G86A 2F9JA 2XBPA 2OGUA 2GIRA 2W25A 2DIVA 3D66A 4PEOA 5T41A 1RLCL 4AT1B 3RAQA 4NCAA 2V4QA 2B7BB 4RLEA 3WDOA 2GHVC 1WC4A 3QLHA 3HT3A 1C0UB 1RWXB 5D15A 2CPDA 4EBDA 2KJVA 3K2YA 2HK3A 3GTYX 4IDKB 4RBUA 2W8LA 1HYSA 2P8IA 1EAYC 3GIKA 2OUGA 1VI7A 3LGHA 3VQTA 4ZLJA 2NR0A 2EC2A 4K59A 2W2OP 4KKOA 2BANA 2AJ0A 5LXRA 3SBMA 1WC6A 3V4IB 3UD5A 2OMLA 1YI2S 4BS2A 4U7CA 4XIUA 4ZVTB 3DGPA 2HNYA 5KT5A 3QJPA 3DRRA 3ILOA 5L39A 2CAJA 3R5CA 3T9ZA 1N52B 3IWNC 4OHXA 3D6TB 1ZBTA 5HROB 4ZLNA 3K8WA 4KAIA 4J9UE 4LRDA 1NK6A 4FF3A 5H9FK 1J2VA 3N0VA 2V6AA 6FD1A 2XSJA 1ZTTA 3R5GA 3QT5A 4GO7X 3H4BA 3RRHA 3D1HA 4HH0A 4USHA 2CG8A 5DS7A 4ZVRB 2Q6BA 1DJ0A 1H0HB 2GMHA 4JV2A 2E5JA 1YLXA 1X5TA 2IM3A 1IQTA 4EBCA 1VRQC 3LP1B 1KVIA 2XI3A 4N5SA 4ED4A 3AD8C 4TLQA 5GADI 3KJVB 2M3DA 3W9HA 4LBPA 4DS4A 5KG0A 5DGBA 3FBEA 4GMKA 1FD8A 2YKMA 4P52A 3I9V9 1M1GA 1LWCA 2IJNA 3NGKA 4DBQA 4J9SA 1GEHA 2PE8A 1UZHA 1JJHA 2HZVA 2Z2YB 3MAQA 3CD7A 3Q89A 4MJKA 5FJ4A 2UUCJ 3TAPA 2MJNA 1GNKA 3MAHA 3OJSA 4GC6A 2NPIA 2FLPA 4DR6J 1NDKA 3DDNA 1S7IA 1OWXA 2ZFHA 3MMCB 1EP4A 2DNPA 4RBTA 1GK8A 4TU8A 2R7SA 3D9BA 1CPZA 1GXTA 1SH0A 3NP5A 5K14B 1N8RT 1QAYA 2M0GB 2D1CA 4KY3A 2XTJP 1RXOB 3UDVA 1IBKF 4JI0F 4QYZJ 5KFTA 4R0JA 4QWAA 3LUYA 1Z4UA 2MKSA 4J5OA 1JLAB 3TUZC 4JI7F 1N0UA 1TL1A 2HIYA 1YWXA 4LR7A 2LYVA 4CO1A 4K4WA 2UUCF 4KIAA 3HZEA 3UDCA 2PEBA 5DLGA 4DV6J 4C48A 1N48A 3SCKE 2EK1A 1U1QA 5CYQA 4DL7A 2R7RA 4LF7J 1RHUB 3E3XA 1IBKJ 5L9XA 4XPEA 2LKZA 2J9CA 2OPRB 5A8WA 1F9EB 2NS1B 2ZZTA 4TY8A 1X9WA 3TA0A 4U7UK 1JX4A 5HLFB 5IT9U 2B9XA 3LP0B 3R2CJ 3W64A 4D3HA 1YK9A 3TZXA 3TW0A 4CO3A 1Q8BA 3CC7S 2V8PA 4GKKJ 5HP1B 3NEKA 3PYFA 2HG4A 5J2QB 4KR0B 3H20A 2LQ5A 1X4BA 2PEHA 2RHQB 2MQLA 1FI4A 3UDLA 3D3CJ 3TARA 3RRKA 3NY0A 2RRBA 4KO0B 2HHWA 1TKTB 2UUTA 1FRKA 1C0TB 1TV6A 2MHNA 2R42A 3B6BA 4WU2A 4HHJA 3N6MA 2YWGA 1RT5B 1UVKA 3K57A 2ZHBA 3PHEA 4DUYF 4ZN3A 1QSSA 1FESA 1T03A 4F3OA 2D3OR 2M70A 1S0NA 4DR4J 2HHHJ 4KGXB 1P8GA 5I4MA 3PJ9A 4RW4B 2W4DA 3KJQB 4FF4A 2DNHA 2LU2A 2MLYA 3A8KA 4RW6B 1FEEA 5ETVA 5J1NA 3GE9A 4C11B 3U1NA 4DHVA 3EYZA 1QSYA 1BHNA 2FJXA 4LRBA 3VQSA 3IS9A 3G6VA 3J81j 2HVEA 4BHQA 5KFPA 4KBIA 1U6FA 1HWUA 1YX2A 5J2MA 5HAOA 3TZYA 1UFKA 2Q1LA 3TUIC 3LPYA 3Q2SC 1YJUA 3QGPA 1HQEA 5DM7Q 4FYDA 2ZNZA 3UN5A 2GNKA 4ZVSB 1SC1B 2XULA 3BH6B 2MXYA 4DFJA 2EFNA 3CMAS 3THVA 2LA6A 4FZVA 4NZ6A 4WFNQ 4WFBQ 4DV2J 1WNEA 4RUCA 3P6YC 2DEJA 4F26A 4JV1A 1UWAA 3NCRA 3PFOA 4QWEA 2GX8A 2K2PA 5DG8A 2RU9A 1HD1A 1DLOA 2IC3A 3IM8A 2AWZA 4NLPA 3PW5A 3S6EA 1GX6A 2PA3A 4DS5A 2H1YA 1N34F 1SJ1A 2ROEA 2FY1A 1R43A 2F65A 3LOUA 1CG2A 4J7CA 4KPYA 1FFGB 2H65B 3W5XA 5KFWA 3GV8B 5DM6Q 2J9DA 2QYGA 1RK8A 4ZVHA 5HQ8A 3MR2A 1P1LA 2JL9A 2VG6B 1T9UA 3E8OA 2DNQA 2OTJS 2J9EA 3I56S 4H4KC 4OI1A 4JI1J 1U0HB 1B7FA 3HX9A 1FE0A 3G6YA 3MPVA 4ANCA 2BANB 2YNHA 1M1HA 4IFVB 4CYUB 2BKOA 2D74B 2FJBB 4P2SA 2BJDA 4I67A 3NGUA 4JI6J 4H4KA 1WD6A 5SUHA 2ASJA 1P1TA 3V81A 1IKVA 1NHUA 2EK6A 3ET6B 5D77A 1HBOB 1NO8A 1SXLA 1TL4A 3H5UA 4QR2A 5IS2A 1RT5A 2XY7A 4C3MA 1JQGA 1RBOB 2Y1LB 1KFSA 4K7QA 4RNHA 5T7LA 4YR3A 4UY85 5AXNA 2UV8A 1S0MA 4PUOB 2KT3A 3M1VA 2RQKA 3LALA 1S57A 3QGIA 3KLFB 3SXLA 4NASA 2XG8A 3KHHA 2AGOA 3M8PB 1U2RA 1V9OA 1VYAA 2CQPA 3ET6A 3TNVA 3M9NB 1EQ0A 1MMDA 2JC0A 2APOA 1YSJA 3IRXA 5IT9Y 1KKHA 1AUSL 1URRA 2HRUA 3KLGB 2DH9A 1L3UA 4O0IA 5KFBA 3ZTQA 3EZOA 4CLFA 1HWIA 2DNGA 5DJBA 2WVCA 1ZA2B 2D3UA 4M5DA 1WTBA 1FX2A 2YPYA 2DCUB 3DHXA 1AFIA 4ETXA 4X4UA 5KFQA 1XMOF 1VQ5S 3IWLA 2QSWA 3MFIA 3CC2S 4M94A 1XR5A 1QAXA 2BV3A 4KGVB 1YTYA 1M90T 2AIRB 2HGLA 2YKOA 2KRRA 2ZVIA 3WX4A 3T1HJ 1S1VB 1UEUA 4E8UA 1K9MT 4ZPAA 3F0NA 5JMNA 4O4GA 1VIOA 3VGVA 3C14A 3EGNA 2EFQA 4X4PA 1LW2A 3BKTA 3FFIA 5KFLA 2CDRB 1UAWA 3BKFA 4ZPWR 4PQUB 1RAGB 3OXGA 5L1JA 2SXLA 2D69A 1FD2A 2HFUA 4DV5F 3OSPA 1SL1A 1PIEA 1JJ2R 1B3TA 1FWPA 3OBIA 4OFZA 2AX0A 1FO1A 3KYLA 3NKYA 5AXMA 1M5KC 5LSRA 1NB2A 5B0GA 5IOLA 2JLGA 3RTVA 2XY5A 4A8WA 4ZDNA 3HDSA 3DU6A 2OP5A 2W2PP 4KC5A 4BWMA 1RYRA 1F60B 1WC5A 3ITHA 4C0BA 1YJ9S 3HSZA 1JIHA 2MKYA 2V8VA 4WXWA 5KG3A 1Y0HA 3PTWA 2DHAA 2DPJA 2ZITA 2EC0A 3H59A 3DLGB 4F4WA 1W26A 2IYIA 2QEXS 2C22A 4K50A 4XDDA 4FPRA 1I94F 2GS8A 2KDOA 3M32B 4UQTA 4F36A 1HD0A 3BYPA 4M5GA 3OW2R 1HR0F 2JLEA 1S6OA 4K4ZA 4L75A 1OPZA 1MG7A 1S6PA 1Q86T 4U7UD 5M2PA 1B7YB 2BUNA 5K20B 3MURP 3KLIB 3O8WA 5EWFA 2MZTA 5CCLA 1Y7PA 4PG7A 5C42A 1FJGF 3KG4A 2XNQA 4WE1B 4UOGA 1FTCA 4F67A 2W01A 3G8SA 1QVGR 3K89A 1PILA 1DQ8A 3OL7A 2B4UA 3J80Y 3FFIB 3NL0A 1HQUA 2ZJQQ 3ZO7A 1D9FA 1YJ7A 4M1KA 3E51A 2CUYA 4NYOA 3T19A 3B78A 1JLQA 4XTTA 3IBFB 4CLYA 1SBRA 1JLCB 5E3QA 3AOAA 2J7UA 4OI2A 3HHDA 2KB2A 2KG1A 1HQUB 4I1TA 6FDRA 1PBAA 4OJHA 4F4KA 1RHJB 1CULA 4FDFA 2PD1A 3HFVA 4NLYA 2X1BA 2B0GA 1Q95G 3BGOP 3DFEA 3I32A 2I6WA 3SV4A 2AYGA 5HO4A 1M5SA 2ILYA 3DCAA 2GO8A 4FN5A 3DNCA 2ATLA 2HLUA 3I4HX 3W7BA 4JI2F 3R6LB 2V68A 3LTOA 3IG1A 1S9GB 3AY0A 4X62J 1TUVA 1HMVB 1LXNA 2CQHA 2ZBIA 4NA3A 5HQLA 3JAMU 4IRCA 2ACMA 5F9NA 1KRPA 4U95A 4LF6J 5KFNA 4HTIA 3TA2A 3KLGA 1VQYA 3E01A 2YWFA 4YP3A 4NRTA 1T3OA 5A8RA 2CQBA 2R8HA 2NQPA 1DFDA 2EWHA 2CVIA 2IJRA 3KKFA 1WKJA 4NXMF 2AU0A 3PG9A 1DURA 5C2CA 4JB8B 3I6PA 4HDGA 1X8DA 1S7HA 3KLIA 5F3ZA 4PUOA 2KJWA 2JHEA 3JQKA 1HHTP 1XQIA 4OX9F 1GAOA 4WJBA 3RB0A 3BN4A 4LF4F 2WONB 4ZIVA 4I7FA 2FVQA 5LMUJ 1VC5A 1QVFR 3L7UA 4K2JA 4C4WA 4WBFA 1IKYB 5ETOA 3ZZ0A 1TL7A 3J81Y 1MROB 2DNLA 3KDNA 4RX6A 3Q8VA 2WW4A 2IA6A 2CNNB 2OPQB 3CSKA 5LL6d 3SFGA 1FRJA 1SUQB 2B4VA 3M8SA 3BO3A 1MU2A 3UQSA 2HHTA 1S1XA 3UCGA 2JVOA 1UA1A 3FQLA 2E9TA 2RVJA 1KHWA 1OSCA 4ES1A 2F3JA 3AJ2A 4QBUA 1RZMA 1HWLA 3H40A 3T5HA 3UCZP 2XCPA 2VHGA 2CPEA 3TUJC 1QM9A 4ITSA 4DU8A 1ZOTA 1RBLA 5K8NA 2XLJA 4ENOA 4IOCQ 2E9ZA 4X4SA 4NI2B 1AZSA 4K5RA 2E5IA 3BB5A 1VQPS 1Y5IB 3BKUA 4DR1F 1C1BA 2G1HA 2GIFA 1VBKA 4HTJA 5GMKa 3MFHA 4EBEA 3AFGA 4A8SA 4M63A 1BWVA 2XYPB 3MTKA 4F3QA 1N6QA 4V19X 4FYXB 1B0PA 2MB0B 1FVSA 3AA9A 2QJ3A 4C9DA 1MNEA 5CD4A 4DPYA 4DV1J 1V3ZA 4EYIB 2JEGA 3OUYB 5AE1A 1WF1A 3F73A 1HI1A 5IXUA 4YEAA 2MSSA 2RH3A 4B3RF 1AROP 3GB0A 3TEHB 3PRVA 4DX6A 4DV0F 1RQ0A 3MD1A 3FCVA 4G1IA 4G3IA 3E2EA 3I0SA 3R1LA 1XNQJ 1M0SA 2XMVA 3M2VB 3M1VB 2ZM6F 1TMJA 3ITHB 1U25A 2HQDA 2XMTA 1V5IB 3B4MA 4CM2A 5KFCA 2VA2A 1GXLA 4KGMA 4Y2AA 3NS7B 2DGOA 2EVZA 4KHRA 3S01A 3K5MA 4LSLB 5GAHU 1YITS 3D28A 3C8YA 3BS9A 3UN3A 3M30B 3P8BB 5E3PA 4XAKA 4R5PB 3DYAB 3EJMA 3J80U 4OJ3A 1QLNA 2CFXA 1DQ9A 3CJ4A 3JSBA 1KLMB 2E29A 3CJQA 5BR8F 3BQ0A 4F2SA 4LF9J 4PG5A 3VAGA 1K1SA 2JSXA 2XZDB 4KRWA 4QR1A 4CO2A 4Z2XA 5KOXA 5GMDA 3CD6S 2IC3B 4NLVA 4ZJOA 2GVDB 1FNMA 4YB7A 1PAEX 2X1GA 2HLTA 1L3TA 4IO1A 4O3SA 5LMNF 1UEKA 2HS4A 4QZVB 3EVMA 3EXCX 2HGMA 4CLKA 1BLUA 1F2HA 1Q81T 2MGZA 2I38A 4C0OC 4CNYA 3M05A 2Z2MA 2DBBA 2KVQE 4B3SF 2A6MA 4C0HA 4ZPTR 3M4XA 3DOLA 2MQOA 1N34J 2YNGA 3Q23A 1Q8LA 3QNWB 5DLFA 1VHFA 1J5EJ 4O3RA 4OJ1A 2HKEA 4C98A 3P49B 4PG4A 3JAMY 1TU0B 5KT6A 2PIIA 3C2PA 3HHKA 2WHOA 2BXJA 4MAKA 4CLZA 4C8KA 5DQGA 3MCOA 2CPIA 4OLPA 1UFWA 3NNAA 2E1AA 3QJJA 3DOMA 4YR2A 1SIZA 3O6QA 4CH1A 3OVAA 4C11A 3HSGA 1WDTA 1JLBA 4X2BA 4RW4A 1HKAA 1PYTA 4TXSA 1B0TA 2L48A 3QSIA 2CRLA 2DHXA 1HNZF 3CDWA 4P72A 1U1LA 2KYZA 2WONA 3R27A 1KSPA 5J2MB 3O2IA 2GFFA 3A3OB 1MMNA 3FRZA 4LF8F 3SYZA 1PBUA 1X60A 1R7IA 1RT7B 3GJSB 1RHQB 1GT8A 3FEXB 1AXQA 5IV3A 2VJVA 5IT0A 4ED1A 4UOCA 3KJVA 4NCBA 4ZVOB 4LF5J 3PW0A 1TVRB 2JZ5A 4HT7A 3JB9k 3B4DA 3NXZA 1EQMA 2ZD1A 3C16B 3ILLA 5I3UB 3GFHA 3US5A 1B70B 2ADBA 2AYEA 4XO0A 3DM2A 4O4GB 3VAFA 3C15A 5AXLA 4DZDA 4U9RA 1FKAF 1T7PA 3CDEA 1FE4A 3I55S 2HMIB 1IR2A 4DQIA 4UUWA 4DSFA 3PYEA 2V2KA 4ECUA 4RU2A 3C66A 1XN9A 3FNNA 5KG4A 4LF7F 4LIWA 2W2NP 5RUBA 1ZTWA 3KG1A 1ZAXA 5C25B 3LW5C 4PPZA 2UUAJ 1SC6A 2H4YB 1OY6A 2XO7A 2HMIA 1PC5A 1JLCA 2UUWA 2BW2A 4DF4A 4KTQA 2DYAA 3TQEA 2C42A 3SCIE 3TYTA 4O3NA 2WOMA 2YNFA 4FXVA 1BD6A 4WPAA 1YIJS 3QIDA 2VPXB 3PKYA 5AE2A 3KHGA 1LWEB 3KHLA 4J9QA 3M32A 3IRXB 2DR5A 5CQGA 2F9DA 3EVOA 4IDKA 2R8GA 1FT8A 2CKWA 2FHMA 2E5HA 4WKRA 1FF2A 2I5JB 1DTTA 5DO2A 1HLWA 1JLGA 2V69A 3CDBA 4OX7A 4KV8B 2CPFA 2FHJA 2B9EA 2KN4A 3GIJA 4Y2IA 1N4LA 1QTNB 3ETOA 1X7VA 5H9FJ 4LMZA 2BM0A 2FDNA 2KI2A 3DRSA 2G2ZA 3SCJE 2ZH7A 1N0VC 2E1PA 4JYAF 1NJXA 4C8OA 2I8EA 3PR4A 2E44A 1T9WA 2MSTA 2LLZA 4DI6A 4K4SA 2AZ3A 4O3QA 4QOTA 1WSVA 3MDFA 3G82A 1BQNB 2YKNB 1D09B 1TL5A 4CH0S 1BQMA 1U2CA 3MUVP 2OLWA 3K5PA 3M2UB 3J7A1 3T9NA 1X0FA 4F04B 3OTEA 4EI2A 2DITA 4I4BA 3QMQA 4PQAA 5LSLA 3VAHA 2R9LA 4B3SJ 2C2KB 4ID8A 3ZZYA 4K4VA 1BC6A 2BMBA 3NS6A 3R8YA 3L3CA 1HBUA 5HATA 1LEOA 5D4OA 1ZAWA 2IDEA 4TYBA 2QFIA 2HQIA 1WI6A 3GZ7A 4ZJQA 2ZC3A 1VQ7S 1RB0A 2E5GA 1R8PA 1R31A 2NXUA 3AD7C 3ETMA 4IG0B 1U02A 5CABA 4LQ3A 1VS3A 2VUGA 3C14B 1DAXA 5HMXA 3F41A 1CS4B 1S10A 2PA8D 3NBPA 4LR9A 1EETB 3CCSS 2UXCJ 2I9SA 5LJ3Y 3PDNA 3MOJB 2LXUA 3PIPQ 4X4NA 5ETSA 1Y11A 3FDSA 1ZZNA 3GG1A 5AE3A 4YOEA 1TK0A 2KXHA 1H7WA 2QL5B 3SSRA 1VIXA 1T95A 2JNJA 4HACB 3M9MB 5LJ5Y 3AH6A 2MJUA 3ZZPA 2LQBA 2KM8B 3MPDA 4Z7YA 2KXNB 2Y1JA 2Z4PA 1LW0A 3MEEA 2WTFA 2B5JA 5DZ7A 3LQVA 2OEKA 4R8UB 5T7LB 3G96A 1D3WA 3FBFA 3V4IA 4FBTA 4CLWA 5DDOC 1Y4ZB 2DJWA 1KD1T 1WHWA 2IAJA 2O66A 2LVWA 1UFLA 4Y28C 3VV2B 5CXTA 3BSAA 3NCQA 4YDXA 3I4PA 1PJ6A 2BVZA 3TANA 1Y3JA 3AQOA 3H5SA 3K17A 4DFPA 2DNYA 4X64J 1ZH5A 4L72B 1RT7A 2CJBA 4WTOB 4RPFA 3HHNB 1VLOA 1XMQF 1XERA 1E6YB 2IM2A 2AJ2A 4FP9A 2K1RB 4B08A 8RUCA 3VAJA 2ZNYA 4OYZA 4EO6A 2YPZA 3V81B 2E5LJ 1M5HA 1RWUA 3PXGa 3RRGA 2UXDF 1H98A 1Y10A 3HULA 3IP0A 4K2XA 4Q43A 3OVBA 1RTHA 5CD4H 2QSFA 2DISA 2QV6A 1SKUB 2VD3A 3UCUP 4NI2A 4KHMA 3TQ1A 1KTQA 1N5SA 1LXJA 4URSA 1H38A 4A4JA 2AJFE 4I6AA 3TJ9A 5H9EJ 5LSOA 3HP6A 3JSRA 1JKHB 4PWDB 5KT4A 2UXCF 1M1KT 4N56A 1RTHB 1FERA 3K5LA 1KOHA 2CPJA 1KLMA 3MHYA 1B0VA 3UNGC 4WWSA 1F6TA 2HAIA 4C8MA 3ZTOA 4C2MA 1VRTB 3SIPB 4Z7CA 3R5BA 1XC9A 5EN1A 4QPXA 2RRAA 2DY1A 4JV5J 3ICLA 1TTHB 3O44A 4QWBA 3MM5A 4ER8A 4ECTA 5MAOA 2BE2A 2NLWA 3LO3A 2A1BA 1HFEL 4MFBA 5CZXA 3CJKB 4LBIA 4Q45A 1KEKA 1F0XA 1RTIA 2VC1A 3CB4A 4I0WA 2O67A 3DDKA 3I0SB 5KFOA 5G0RA 3C46A 4DR3F 1HNXF 3MXHP 2LU1A 2HNZA 3LF0A 1SQGA 3RB3A 4F02A 4LFAF 2DXEA 3B8HA 4LSZB 2GJIA 1X4AA 2HQCA 3ENAA 3N79A 4LSLA 3UE2A 9RUBA 3T1YF 5F8JA 3AHPA 4F7VA 3RBXA 3C6TA 2KH9A 3RAMA 4USJC 3OUYA 4OYIA 1IN0A 1OPIA 1G6BA 1PJ7A 1SB6A 3IS9B 3MOZA 3JQMA 4YMEA 3VGUA 2MMYA 2F4FA 4P74A 4ZPVR 2GQCA 3N9UC 3TVYA 1VMBA 4RUBA 5IT4A 5F8HA 3J7YU 1F9FA 2NXJA 3FBBA 2F8MA 4FS1A 3DKDA 1S1UA 4GO5X 4ZIWA 4RW7B 1CVJA 1KP6A 2DT9A 4AYBD 1KWMA 2XB2D 4DL4A 4GC7A 1TK5A 4HYKA 3DOKA 3WZ0A 1U8SA 4IR9A 2VL1A 2CG4A 3THPA 4WFYA 1Q82T 2JEJA 1ULRA 2GHPA 2ERRA 3MM9A 2V67A 2DGWA 3HZGA 1BGXT 4QU6A 4DR5J 4M95A 2YWEA 2WAQD 4MYUA 3PW4A 2VU5A 2WVEA 4L3KA 3QZ8A 2BQUA 4NEYA 2HNYB 2R7XA 5J1EB 1IKWB 3DLKB 4F25A 2UU9J 2DH8A 3RJMB 3RUBL 1U6BA 3EZ5A 3NBPB 3VVTA 1RADB 3HI9A 1JKHA 1YBAA 1FRMA 3SMZA 1TL1B 1VHIA 4ZVGA 3SQGA 4TN2A 4EWTA 2QA4G 2D3ZA 4DN9A 5D78A 1BQMB 1SVDA 3RBDA 5L9NA 5SZTA 4B9TA 2QLWA 2XHWA 2F4VJ 1MROA 3L09A 4UOHA 1NJIT 1HYSB 4K4UA 3J7AN 3GWCA 4HR2A 2AT1B 3QLHB 2COLA 3MUTP 4DR2J 4IQMA 5DGAA 3KUGA 2HFSA 2O1PA 5CZVA 5LOQA 3NGDA 1VQ8S 4GKJJ 2KTQA 1E6VA 3UD3P 2VBZA 3EVWA 3UVJB 1QE1B 1JLAA 2FC9A 2EBGA 4QW8A 4OYBA 1LWCB 3IM9A 3BSNA 1YKWA 3LA0A 3MM7A 2DNMA 2KVIA 4UF4A 4DUZJ 1NKBA 4OHYA 3MMAA 3G82B 4ALZA 2P6SA 5K5MA 4JI5F 2C2DA 1IKYA 4P2FA 4ZP7A 4WK1A 3ZZRA 3KK3A 1IWGA 2G0JA 1RAHB 3G9CA 3CWJA 3ENWA 2VQFF 4FF1A 4LSNB 2CADA 1O51A 1U1RA 3PW2A 1XNQF 2Z2LA 1WI8A 1RTJA 3VALA 1KHVA 4FVCA 4K4XA 2BQ3A 1Q7YT 4J9PA 4B3OA 4DN0A 4K0KJ 1LW0B 4UY8T 2EI5A 2MQQA 1T3NA 3N01A 4W98A 2Q3PA 2VBWA 4FKYA 4QPTA 1SC4B 4DOZA 3BSCA 2R7UA 4Y0FA 1UVIA 1IKXA 3I96A 1LWEA 4DL2A 1IBMJ 4LF9F 2FVCA 1RBAA 5KT3A 5IQ6A 4CI0B 2ZH3A 1DTQA 5HK4A 1UJ6A 4O23A 2KT2A 3BJYA 2VFUA 4M5IA 5D4NA 4FVMA 3BV8A 2RQCA 1WHVA 5J1EA 4NCGB 3WC0A 5CAAA 3RG6A 1AW0A 5KTQA 2XQCA 2F4VF 2I2YA 2CDQA 4FYVB 1LWFB 4QIWD 1X9SA 3KNGA 1HBNA 2HVDA 2ZE2A 4YHHF 4FYYB 1Y9OA 2ZEJA 4IH7A 1WC3A 3UN2A 1HI0P 2OTLS 2LEPA 2DNZA 4CIOA 4IOAQ 2V94A 4WP8A 2LA4A 3TAMB 1FFSB 3ELHA 1CJUA 4NX9A 1RT4B 3EGWB 2IVYA 3MMBB 3A1YG 3FBCA 3WC2A 2LDIA 2R7VA 1VC0A 3PEHA 1A0OB 2VFSA 5LMNJ 4Z37A 3M8PA 4PWDA 4RL1A 4RU9A 2OELA 1FDAA 2MZSA 3NAIA 2V2ZA 1IWAA 1MWYA 4IOBA 5M2RA 3HKWA 4CLSA 5EHHA 2GMJA 4Q2LA 5J2NB 4F4AA 5AJ3J 5JVGQ 3WX8A 2W9AA 1N5QA 1YRTA 3JTNA 1VFJA 3MM7B 3NAHA 4M5LA 4LQ9A 2W1BA 1N54B 4X4RA 4ECRA 1TKDA 3UDEA 1X4EA 4YN3B 4GVBA 4CTAA 2HRYA 3D5MA 1HWKA 2DNRA 5BXIA 2CJQA 1MMLA 2Z0GA 2YNGB 3RW7A 5DETA 4HKQA 1TKZA 1EJ7L 2PFFB 1JLBB 2BJ3A 2YQ0A 2A2CA 5EX3A 4ES3A 2FIUA 4ED8A 1SIWB 1RTIB 3OR1A 1YJRA 5EX0A 2OJ3A 2YKQA 5KFEA 1X4CA 2DGXA 1Q8KA 3CIZA 2BJ7A 1R6YA 3QYYA 2VG6A 3AOBA 4HHUA 2DHHA 3CCTA 1RAIB 3I0RB 1GTHA 4DFKA 1BE4A 1JWWA 2V8GA 2KXFA 1IQZA 3EMTA 3RZAA 2FVPA 1RAJA 2QMXA 3DOLB 4KFBA 3ZZZA 3BR8A 3DLHA 1VRUA 3DYAA 5C25A 2GAHC 3UI3A 3NGRA 3R5DA 3GIRA 2UP1A 2W24A 4S0MA 1N5TA 4OMFG 4RWWA 4NLSA 1XEZA 2EXUA 3ZFVA 2W9CB 1YHQS 4KH0B 4Q2MA 4FF2A 3NWGA 1S59A 3GJRB 4OZ2A 4AQYF 4BC7A 2L08A 3PIOQ 3MZIA 2RDIA 2IFXA 4A47A 2CPZA 3HSDA 3ZC4A 3IFEA 2CQ3A 3T5LA 2QA2A 4H4OA 4BLGA 4IR1A 1RWNB 4YDDB 1HQEB 2DPIA 4JV0A 2C2ZB 3MEDB 2KRBA 3CJ5A 2VICA 1D0EA 1VQ4S 1JB0C 1B64A 1XNRJ 4FNIA 1E6YA 3W1YC 3V5RA 1VR6A 1WG4A 2ZHOA 3PW7A 2BA9A 4JI6F 5KFIA 3GONA 2I1RA 5KFSA 4YR0A 1IR0A 5KFFA 1NDPA 2DGVA 1KBRA 2EW9A 4IYQA 2WVFA 1TP7A 2VG7A 4DDFA 3R9LA 1U48A 4DUYJ 4OX9J 4WZMA 3W2VB 4ZVEA 2RT3A 3ISZA 4OZ1A 1NJZA 2Q43A 1BUXA 2H54B 3K5NA 2ZBPA 5U47A 5DDRC 1QJHA 2CZ9A 2JX2A 4IH6A 3G6ES 3T5JA 4A46A 1V3RA 2B4OA 3IG1B 4NE9C 1VJWA 2DHSA 2OI2A 3HKZD 1XBWA 2Y0SD 3BGLA 4KO0A 4BC9A 4RKUC 1HWJA 1VQLS 4A48A 4CLTA 1TFWA 2KFYA 3WQPA 4HLBA 4DQPA 1U1NA 1NM2A 1PG5B 2FJAB 3DLEB 1QY7A 1OO0B 1RCXB 2IMOA 1VGYA 3IAS9 3JYTB 1RT3A 2G0CA 1V6HA 2JOQA 3VVUA 5HP1A 1WACA 3PO4A 2XMJA 4UT4A 1IUJA 3HFZB 1KC8T 4ZLLA 3U27A 5F8GA 1ZM3A 4NXNF 3FC9A 4NXMJ 1JLFB 1FDNA 5EWEA 1T11A 2UVUA 2C2MB 3DI6A 1T9YA 2M2BA 2GZOA 5C42B 1S9FA 1HNWF 1HBUB 3CEDA 2P9CA 1VRTA 4Y3CA 3VHQA 4Y2CA 1TL3B 3H90A 1SV5B 2PI5A 1FVQA 2RSQA 4JOUA 2J8AA 5ETQA 2DGUA 4DUTA 2BABA 3EXYA 3I0RA 4C97A 4G1QA 1T9VA 2HQFA 3MEKA 4OZ0A 2V9WA 3KK1B 2MLZA 4PXDA 1W7WA 1YZ7A 4QIVA 4CDIA 3KLHB 2D3O1 4B3TF 1GH8A 2A10A 1XIQA 1NMEB 5KFAA 5GADU 1H74A 1UZDA 2VQEF 3C3LA 1RYSA 2PSZA 4EZ6A 1YJWS 1KVJA 5D8HB 4DCOB 2BBEA 4NA2A 3AJ1A 4CO0A 3QRPA 4LFBJ 2DKOB 3HXMA 4DSKA 2HWTA 2GIQA 2QC3A 3M2RB 4QW9A 2KZZA 1JNRB 4GVBB 3FSYA 1S1TB 1U0SA 1D8ZA 1C4CA 4E98A 2MKIA 4I6YA 3CTRA 3BSOA 3QT8A 2IJFA 3VF0B 1HMVA 2HVIA 1LK5A 4NEZA 3JSMB 3M6XA 3T1YJ 2QLBB 1ZM2A 3M7VA 3UFCX 4ZHRB 2UV8G 2E9RX 2CVEA 1ACMB 3H2LA 3CXCR 1DTTB 1CJKA 4OX8A 1S9EA 5KFKA 3PACA 2IBOA 4OL8A 3OHBA 1KFDA 2ZBRA 3LGNA 4WYLA 4RZRA 3O1LA 4AUKA 1NK7A 3IBWA 4NOHA 2CPHA 3IR6B 4DR5F 5JXSA 1CJUB 3IWXA 3ENVA 3OL8A 2J0XA 3HF5A 2BZ2A 2MZQA 1U6ZA 2HHUA 3KNAA 2B3TB 2CQCA 4B02A 5C7PA 1RI7A 5A76A 1HBNB 2ZE2B 4XDCA 2MQNA 1JXLA 2ZKUA 1D9AA 2MKCA 1SL2A 3V6JA 1SJ3P 1PYOB 2VC0A 4OI6A 1J5OB 2XO6A 3FMWA 3ZTRA 2ACYA 2RB7A 1EARA 2R3VA 2FHOB 4KT0C 3TRGA 5B08A 3VGSA 5M2UA 5DQIA 1SJFA 1CS4A 1RUSA 1S1XB 5HANA 4J9NA 4ZVQB 3FCWA 1JXVA 1WKLA 3MTJA 2VG5A 4I2QB 4LIRA 4O4RA 2YTCA 1T9TA 3T1AA 4F0HA 3L9ZA 1I51B 2XZWA 2ZD1B 2M5YA 2QGFB 2QTWA 3C16A 1NSKL 3CJRA 3DGVA 4ID5A 3KFWX 5KT7A 1N88A 2DIUA 4LRAA 5IC6B 1IXKA 2OHDA 4OV6A 4J9LA 3EPGA 2ALZA 3KMQA 1LWXA 2N7CA 1TUWA 1L3SA 1IJEB 1HQ2A 4RUAA 1HPZB 3ZNJ1 2HS3A 4RWXA 2F5GA 4DV3J 1NU4A 2F63A 1HBMA 1R0AB 2VBXA 3S8SA 4IG3A 2NREA 1ZM4A 1TKXA 3JQJA 2PMZD 2F1FA 2BW7A 3CVKA 3OLAA 4ZPBA 2L9NA 3EZUA 5D3GB 2LXFA 2MDAA 2YQ3A 3CJ3A 1VQ9S 4J91A 4ETZA 1REVA 3CJ0A 4KYZA 2POKA 4LBHA 2V4JA 1XK8A 4PZVA 1LFWA 2YNFB 3AXKA 4LT6A 1JJ4A 2DCLA 5IC4B 3CMES 4CLLA 3N5FA 2CZVC 3PEJA 4DR6F 1IR1A 3ZXWA 2CWKA 1FHTA 1SC3B 4M5JA 1SI9A 5F8IA 1IKWA 3DLKA 2CQ4A 2QX0A 3FJ2A 1XMOJ 3OPKA 2KHDA 3LP2A 3MAAA 5CA5A 1K1QA 4ZPDA 2Y8YA 1AFJA 1G7CB 4RW8A 2QRRA 5E0OA 1S0OA 2VB6A 3PX4A 3HT0A 4B9UA 1T8EA 4AL7A 4X65J 1KLNA 3FEYB 2UUBJ 2N4DA 4YY3J 2AHOB 2WZ1A 3SQOP 4ED3A 3DLBA 3AT1B 1UVNA 2DY9A 4D3GA 2XC9A 5LXYA 2OIHA 4C7QA 1CJTA 4USKA 1LQ9A 1RT3B 2O3DA 3N6LA 3VR1A 2OEJA 3OL6A 1L3VA 1Q7LB 4DEZA 2DNNA 4WP9A 1S1WB 2VDHA 2H9ZA 1N5YA 2JEFA 4RUHA 2UZAA 5L1LA 1FTRA 3A8IA 3VWSA 3TVZA 4U96A 2YY3A 3EPIA 2JJ4D 2H4WB 1Q4RA 2PMWA 4H4MB 3RB4A 1R0BG 3NCPA 2EFGA 4B3OB 1OYDA 3M2VA 4OI4A 2J0WA 3MPWA 5KG1A 3VZIA 1RABB 1WKKA 2YVSA 4CO4A 3D4JA 3OFHA 4DLEA 2C28A 2YQ1A 1F2GA 3R7NB 4NZ7A 1P27B 4E2FB 1Y5NB 3M2RA 2ZJPQ 3I31A 4RBVA 5A8KA 4ILMA 2HNZB 3DC2A 5K9FA 3W61A 1QDUB 2OD4A 4JUZA 4Y00A 2GHWA 1H2TZ 1FKPB 1WORA 3HHLA 4X84A 1C2PA 2DNKA 1FK9A 4KPCA 4PG8A 1SH2A 2AEMA 5CYMA 4LFCJ 3PX0A 5C5JA 4X4TA 3O3LA 1RWKB 4P7TA 4MK8A 3V4MA 3W9IA 1S99A 4DV0J 2VPYB 1OJ4A 4TQSA 3PO5A 2MZRA 4HL9A 3BREA 1C1BB 2PMHA 2MPUA 4WIQA 2GJFA 1PJ5A 2ZDPA 2VKZG 2HFNA 5F3TA 5FIIA 4O3PA 4DV4F 4N76A 2AJQA 2V9KA 2YKAA 4F0KA 3DI6B 2EPIA 4CLUA 1RLDA 4MFBB 5L46A 3OTBA 4CNZA 1VLYA 2HSEB 1VC6A 2QA1A 3C6UB 3IRWP 4OJGA 4I2PB 3HVTA 5C24A 2VQFJ 3BPDA 2O01C 3OXFA 4MT1A 2ZOGA 2KM8C 3KG0A 1RT6B 4B3MF 1Q1KA 4CRJA 2QN6B 3TVKA 4YUDA 1VRUB 2DB1A 2RQ4A 4N8OA 2R2UA 4AL6A 2XLKA 2B7CB 3CCVS 4JI2J 2E1RA 2F40A 4M5KA 3SDEB 3B82A 3CMQA 3G4SS 1U26A 5H1SV 1O5JA 3QWPA 4MH8A 4I2PA 5C24B 5IM0B 2B43A 3MM9B 3SI8A 2RS2A 1R27B 4N41A 3GSDA 2HZAA 4QIFA 3BO2A 2E1CA 3PJXA 4QU7A 3OTDA 2PT0A 2FPHX 1GMVA 2IDLA 4WKYA 5KFHA 1NSAA 3DU5A 1F3VA 4DG1B 4DR2F 3Q8UA 2L41A 3IAM9 1VDHA 2BX6A 3QO9A 1GMWD 3M30A 3GV7B 1UPMB 4WTYA 4IG3B 5B0FA 3GFYA 5K8OA 1FCAA 2Y0BB 4Q5VA 2G2OA 4J90A 4NLRA 4V1Ak 2FLNA 3TUPA 1B4SA 4WFZA 3EX7B 1UJ5A 2KL8A 3ZTSA 2HBRB 2ZH4A 2NZCA 3ZZTA 1H2UX 1BY9A 2B8QA 1S12A 5HJXA 2FYXA 3L7OA 4OQJA 3W2WB 2AX1A 3V6DB 4WFXA 3FZ2A 4CP5A 5LMUF 3H42A 3QT6A 2DRBA 2YNHB 4IFVA 1DTQB 5ETPA 4PR6A 1K0TA 1ZM9A 4AD6A 2LQ8A 3LAKA 2E7WA 3GJQB 3OFGA 2R2SA 2HW3A 1XJWB 5ETNA 1U1OA 1AB8A 3R2DJ 2FZCB 2V4RA 2XWXA 4LF1A 4RW8B 1WTFA 3GR1A 5EGYA 2R7QA 3W65A 2IIHA 5F8NA 2OSQA 3TWZA 1HNVA 2RMLA 4A8QA 2WBMA 5F0UA 1NDLA 1SH3A 3AB4B 3QIPA 3U02A 2FQQB 2HHPA 4ILLA 1BMQB 1RTJB 4NLWA 1RAAB 4G6VB 4JI8F 5LM7E 1MN7A 2N7YA 4BWJA 3HHLD 2HHVA 4OZ5A 3DHWC 1T0TV 3QAEA 1M5OC 3GYXB 2AEFA 3CDUA 3ZTPA 2AKWB 2RNEA 2D9PA 1Y3KA 1RWWB 2RUGA 3MCMA 1FRIA 1M5VC 1G4CA 1NCLA 1NK0A 1IBLJ 3ISNC 7FDRA 3GP9A 4OZNA 2PGCA 4X66F 3WIVA 2MY7A 3LANA 2KU7A 4N77A 4WK3A 4LFCF 4YB1P 3DRPB 3Q86A 5FLXY 3EGVA 2FHJD 3JSMA 2K3KA 3TX0A 4ELUA 3DXBA 2HEKA 3UVJA 1RTDA 1VQ6S 3FK4A 1K73T 2YX7A 2B9YA 2DHGA 3I5AA 1NB7A 1ZPWX 2J9DE 3CCLS 3G87A 5D4LA 3GU0A 1OIAA 3A12A 5F8MA 1MW7A 1OQ6A 3OD2A 3CDAA 4NRUA 4LF5F 5IWAF 3BZQA 4OYXA 3EICA 4MKAA 4USMA 2HVHA 2GVZA 1UEVA 3HHEA 4JI4F 4OI0A 3CO9A 1X31C 5KFUA 2C3MA 4IH5A
chains in the Genus database with same CATH topology
4CLKA 1CJUB 3C14B 4P2XA 1CS4B 1U0HB 4WP3A 1Y11A 4CLUA 3ET6B 3MAAB 4OZ3A 4CLZA 4OZ2A 1CJTB 4USWA 5D0RA 1YBUA 4CLWA 1CS4A 3ET6A 3UVJB 2GVDA 4OYBA 3C16A 5D0GA 1CULB 5IV4A 3G82B 4CLFA 4CM0A 5IV3A 1WC0A 1TL7A 4P2FA 1FX2A 3C16B 4OYAA 4P2MA 4OYZA 1CJVB 3C15A 4CLPA 1CJKB 1Y10A 2GVZB 1TL7B 2BW7A 1YK9A 2QV6A 4NI2A 3MR7A 3C14A 4CLTA 4USVA 4OYOA 4CLLA 5D0EA 4NI2B 1AZSA 4OYPA 1AZSB 4USTA 1CJVA 1U0HA 4WPAA 1AB8A 3MAAA 1FX4A 4OYWA 1WC5A 2WZ1A 1WC3A 5D0HA 4USUA 1CJTA 1WC4A 4WP8A 5D15A 4WP9A 1CJUA 1WC1A 1YBTA 4CLSA 4OYIA 1WC6A 3G82A 4CM2A 3C15B 2W01A 3UVJA 4OYMA 4CLYA 4OYXA 3R5GA 1CJKA 2GVZA 2GVDB 1CULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLK A;  1CJU B;  3C14 B;  4P2X A;  1CS4 B;  1U0H B;  4WP3 A;  1Y11 A;  4CLU A;  3ET6 B;  3MAA B;  4OZ3 A;  4CLZ A;  4OZ2 A;  1CJT B;  4USW A;  5D0R A;  1YBU A;  4CLW A;  1CS4 A;  3ET6 A;  3UVJ B;  2GVD A;  4OYB A;  3C16 A;  5D0G A;  1CUL B;  5IV4 A;  3G82 B;  4CLF A;  4CM0 A;  5IV3 A;  1WC0 A;  1TL7 A;  4P2F A;  1FX2 A;  3C16 B;  4OYA A;  4P2M A;  4OYZ A;  1CJV B;  3C15 A;  4CLP A;  1CJK B;  1Y10 A;  2GVZ B;  1TL7 B;  2BW7 A;  1YK9 A;  2QV6 A;  4NI2 A;  3MR7 A;  3C14 A;  4CLT A;  4USV A;  4OYO A;  4CLL A;  5D0E A;  4NI2 B;  1AZS A;  4OYP A;  1AZS B;  4UST A;  1CJV A;  1U0H A;  4WPA A;  1AB8 A;  3MAA A;  1FX4 A;  4OYW A;  1WC5 A;  2WZ1 A;  1WC3 A;  5D0H A;  4USU A;  1CJT A;  1WC4 A;  4WP8 A;  5D15 A;  4WP9 A;  1CJU A;  1WC1 A;  1YBT A;  4CLS A;  4OYI A;  1WC6 A;  3G82 A;  4CM2 A;  3C15 B;  2W01 A;  3UVJ A;  4OYM A;  4CLY A;  4OYX A;  3R5G A;  1CJK A;  2GVZ A;  2GVD B;  1CUL A; 
#chains in the Genus database with same CATH topology
 2R7T A;  4IFY A;  3SQG B;  1X0P A;  3ZZO A;  2X1A A;  2J7W A;  2C3O A;  1RA7 A;  4EFA C;  1PAU B;  1FRX A;  2RKI A;  4NA1 A;  4EU0 A;  1XNR F;  5KFY A;  4AL5 A;  2WBR A;  1YVF A;  1UL3 A;  3N5B A;  2W9B B;  2L3M A;  3CF5 Q;  2B56 A;  3KHR A;  1YJN S;  4GVL A;  2P5V A;  5F41 A;  2NUU G;  5BR8 J;  2H48 B;  1LWF A;  4WCE Q;  1ZA1 B;  1RHK B;  2OPS A;  2MGZ B;  1AA1 B;  2E1M C;  3Q8S B;  2G2Y A;  3DGP B;  3GYN A;  4FNH A;  1CBK A;  1JNZ B;  2VG5 B;  2XLI A;  1PCA A;  1RHR B;  1UVJ A;  2H5J B;  3EGZ A;  3IA0 A;  1W2I A;  2HAF A;  4DR3 J;  2FUG 9;  3KUE A;  1IM4 A;  4DV7 F;  5D0R A;  2DO4 A;  1H3D A;  4M8L A;  1VBY A;  2GJ2 A;  2CYY A;  3MPY A;  4TY8 B;  2IMW P;  1BXN A;  2W7A A;  2XMW A;  3KUH A;  1HW9 A;  4DQS A;  3M8Q B;  2BE7 D;  3ONQ A;  5D6G A;  1CLF A;  1RIS A;  3JTO A;  4X65 F;  5D0G A;  1TVR A;  4DFM A;  1CUL B;  4DL6 A;  4ERD A;  1JLE B;  1Q5Y A;  1LNQ A;  1UCN A;  1I6J A;  1RAF B;  3VZH A;  2RUS A;  3EE3 A;  2GCF A;  2M7S A;  2MYF A;  4DL3 A;  2BKP A;  3C6T B;  2YKP A;  3BPS P;  4L76 A;  5KFM A;  4LF2 A;  2Z57 B;  1KOO A;  3K7R A;  1XMQ J;  2YBV A;  2B8P A;  4TVA B;  3K59 A;  4ECY A;  4KHP J;  1XR7 A;  4LFB F;  5HSP A;  1VJQ A;  3HHL C;  1REV B;  3QO9 B;  3M9O B;  4DXL A;  3OSN A;  3SV3 A;  2VZ9 A;  4ECQ A;  2ZOM A;  3KK2 B;  2AF6 A;  3QGG A;  2M8H A;  3P3D A;  5G0R B;  3GFX A;  3D54 A;  2KT5 A;  1TAU A;  1RJJ A;  4JI4 J;  1Q78 A;  1RGV A;  4WZQ A;  4ZHR A;  4NLD A;  4JI0 J;  3CUN A;  2AEJ A;  5K8P A;  3PKM A;  1JXE A;  4JI3 F;  4ZOS A;  2AD9 A;  1HBO A;  2WCX A;  2QL7 B;  3ZZU A;  2R2T A;  1R0A A;  2ADC A;  1D9D A;  3RR7 A;  4B9M A;  4B3R J;  2YKM B;  3H4D A;  4OZL A;  2OD6 A;  2XS5 A;  2V50 A;  2DR6 A;  3DRP A;  1APS A;  3PYD A;  5BYR A;  1GTE A;  3BH7 B;  4DSJ A;  2X3D A;  1CJV A;  2J7K A;  1U0H A;  8ATC B;  3M6V A;  1H73 A;  4KQZ A;  3KLH A;  1LW2 B;  1JLF A;  2R8K A;  4I2Q A;  1DY3 A;  1NK5 A;  4DPO A;  2XM3 A;  2YWK A;  3TJA A;  2XSF A;  3CW2 C;  2Z56 B;  1UJ4 A;  1WSR A;  2ZH6 A;  5E3A A;  2RHS B;  3VTI A;  2YX1 A;  2BE9 B;  1TL3 A;  2DK2 A;  2DNO A;  2DTJ A;  3IGN A;  3QIP B;  3NOG A;  4KFB B;  1Z1Z A;  4I68 A;  2AP6 A;  2BKN A;  2QYC A;  3T6B A;  3NNC A;  1YBT A;  1V5V A;  2LEA A;  2QLX A;  3PFE A;  3HSJ A;  4WYW A;  2BYC A;  3UPF A;  4A8Y A;  3LGM A;  5F9L A;  3UR0 A;  3D68 A;  3C19 A;  2HZC A;  3CCJ S;  2BAC A;  3NOC A;  2CQ1 A;  3NLC A;  4Y2M A;  4F3M A;  1RA6 A;  1R0C B;  2QA4 S;  1FKP A;  3BBC A;  3MEG A;  1NUE A;  2F7V A;  1EHW A;  3HMJ G;  2J0Q D;  1URN A;  1KON A;  1TKZ B;  5HQM A;  4DR4 F;  2HYI B;  4B9L A;  4ZVF A;  1FJC A;  3QRR A;  1S1U B;  2BQR A;  3QRQ A;  1NK8 A;  2FJW A;  3H2V E;  3LPE A;  4ED2 A;  4DUZ F;  3D2W A;  2J6T A;  1LK7 A;  3OXL A;  4OYM A;  4R0E A;  2KZM A;  1NAQ A;  2WSC C;  1FJE B;  5H9E K;  3I5C A;  3GCW P;  2IA0 A;  1TAQ A;  2Y8W A;  3L4B C;  4K4T A;  1GFW B;  4Y2K A;  3OQ2 A;  4WFA Q;  1S79 A;  3TOQ A;  3BGR A;  2XYH B;  4PXE A;  5A8K B;  2FD2 A;  1OY9 A;  3R7B B;  1QAI A;  1RWP B;  1KQS R;  1FWL A;  2MKK A;  1N56 A;  1TFY A;  2HPU A;  4LJM A;  3SEO A;  4URG A;  3HVR A;  4OHW A;  1ZET A;  1PGZ A;  1S4E A;  3R6G B;  1U1K A;  4ICL A;  1N33 J;  5E2Q A;  1CC8 A;  4HEA 9;  4FXD A;  3BGU A;  1JLE A;  1UPP A;  5HMY A;  2RD5 C;  2FZG B;  2W4P A;  3BO4 A;  3LP2 B;  3MAA B;  4MIW A;  3SDE A;  1ITP A;  5GME A;  2OPP A;  3CCE S;  4ED6 A;  4NCG A;  1T05 B;  4WII A;  3OLB A;  3OL9 A;  2ZBQ A;  4ECX A;  5JUM A;  1HNI B;  3MEG B;  5A2Q U;  4MIB A;  1RCO B;  4LR8 A;  5L38 A;  2OH2 A;  4O0N A;  3HVT B;  1FEH A;  5GAE U;  2R8I A;  2B6A A;  1RKJ A;  5I42 A;  2ASL A;  3RR8 A;  3UW1 A;  1S77 D;  2K7K A;  2HS0 A;  1UVM A;  2GVD A;  3RBZ A;  2BEF A;  1UVL A;  2IM0 A;  2B4P A;  2IRY A;  3N4W A;  3AAW B;  4RO0 A;  4U6P A;  3OTC A;  2WSF C;  1K0V A;  4RW9 A;  1HNI A;  4AQY J;  5FDL A;  3LWM A;  1RHM B;  2WW8 A;  4Y6I A;  1Q16 B;  1VK8 A;  1WEL A;  3Q8Y A;  2W9B A;  4F4Z A;  1V3S A;  4UTG A;  4I7F B;  4LFA J;  3H98 A;  2HND B;  1FRL A;  1NND A;  3ISN D;  2MHE A;  4NPO A;  3UWT A;  2G4B A;  1S5Z A;  2PFD A;  3L7P A;  3OR2 A;  3KXD A;  2ZWO A;  2FZK B;  4J9R A;  1WEY A;  3UO0 A;  4ZMM A;  2MLX A;  2ZUG A;  1CSJ A;  3SSQ A;  3MR3 A;  4JYA J;  2CWX A;  1NZA A;  2GVZ B;  2NXN A;  1TL7 B;  5D3G A;  1LKZ A;  3ZNU A;  1FDD A;  4F2R A;  1X4G A;  4ZN1 A;  1RT1 A;  5CCM A;  4C8N A;  4Q44 A;  2JFK A;  2XI2 A;  4QWD A;  3W2V A;  4ZK7 M;  3EDQ B;  4EMD A;  3VGT A;  4OYO A;  1EZZ B;  5EUH A;  3W9J A;  1X5O A;  3WHI A;  1EB0 A;  4O44 A;  2HGN A;  5E3C A;  4JP8 A;  3RB6 A;  3M8Z A;  4QIG A;  4R8U A;  2E5L F;  2UXD J;  1F5C A;  1OYE A;  3TR5 A;  4L74 A;  4TU9 A;  3ILI A;  4RW6 A;  3D1Q A;  2FY8 A;  2C2O B;  2FLL A;  2IRX A;  3OFE A;  3DDI A;  3MED A;  4NLX A;  1UET A;  3CO0 P;  2A18 A;  1U8W A;  2OFG X;  2NXE A;  4XPC A;  4F4X A;  2Q66 A;  2IYG A;  3MCN A;  1FFW B;  1UTA A;  1H7X A;  1AYE A;  2H51 B;  2HVZ A;  2WSE C;  3E01 B;  4DPU A;  1HL6 A;  1OQ3 A;  1RKI A;  2VH7 A;  2ZKT A;  4DV2 F;  2YH0 A;  1T94 A;  1TR0 A;  2H5I B;  3DLJ A;  3G6X A;  5D0H A;  3CCR S;  3MM8 A;  2V63 A;  4K8R A;  4UQG A;  2N4C A;  7AT1 B;  1T05 A;  1UKU A;  4DLG A;  5HRO A;  3IBC B;  1FDB A;  4NZ0 A;  4PKD B;  3QFW A;  1NKC A;  4UZC A;  4PAA A;  1ZAV A;  4QWC A;  1WG5 A;  2LEC A;  4OHZ A;  2G13 A;  1OSD A;  1WUU A;  2A2D A;  1NLK L;  2LQ9 A;  3MM8 B;  2AZ1 A;  2VIH A;  1S6U A;  2QMW A;  4JI1 F;  1I1G A;  2IM1 A;  4P71 A;  4ZCK A;  4NML A;  2GML A;  3C15 B;  4B9V A;  2AYB A;  4F8R A;  2MEW A;  1OY8 A;  4UW2 A;  5GAE I;  5DG7 A;  1CEZ A;  4DPX A;  3M2U A;  1AUD A;  2FC8 A;  2IVF B;  5I3Q A;  3HD1 A;  4NL5 A;  5GVQ A;  3TEG A;  2LEB A;  3I5B A;  2DVI A;  1YRU A;  2XYG B;  5K14 A;  4YHH J;  4HI1 A;  5IWA J;  4OI3 A;  3OVS A;  2CNK B;  5L1I A;  2DXD A;  3PHT A;  5AT1 B;  3R5A A;  4W4M A;  3CCM S;  2F8E X;  2ZOF A;  4DJB A;  2IRU A;  4PPD A;  3CCQ S;  3D67 A;  4NLU A;  2KFZ A;  1VCT A;  4OV1 A;  3CIM A;  1H72 C;  3POT A;  4PXB A;  2LDY A;  4HDH A;  3GII A;  2PC6 A;  3N28 A;  4TY9 A;  3TP2 A;  3GG0 A;  1IKV B;  2ZH1 A;  5KFR A;  3IR7 B;  4R25 A;  4FKX A;  4P2X A;  3F44 A;  4ILR A;  2J6S A;  2C1E B;  1SQE A;  4UUX A;  4A8M P;  2CQI A;  1FWK A;  5B0C A;  4RNO A;  3DOM B;  3BM7 A;  3R97 A;  4IRK A;  1WG1 A;  2V8D A;  2HRT A;  2RE1 A;  4JI5 J;  4W92 B;  3H2U B;  4KH1 B;  4DX8 H;  5A8R B;  4LF4 J;  4U8Y A;  5EDW A;  4YB6 A;  1N32 F;  1QE1 A;  4CQ1 A;  2K7J A;  3LWL A;  4LF8 J;  1G1X A;  4C8Z A;  2NXC A;  4ZLP A;  2UXB J;  1B99 A;  4USW A;  1TEL A;  2AGP A;  2ZH5 A;  4NWB A;  3HJV A;  1ZZF A;  4LRF A;  2AW0 A;  5B0B A;  3J7Z 5;  5A2Q Y;  2LCW A;  1GMW A;  4TLR A;  1I3O B;  1FJG J;  5KFZ A;  1L5U A;  2WK4 A;  2XMK A;  2ROP A;  1REG X;  5IV4 A;  4JI8 J;  4JBC A;  4CM0 A;  2GC8 A;  2YWH A;  3BBF A;  4ZIT A;  4XK8 C;  2V5H G;  1YGY A;  2VBY A;  1I5O B;  1YRX A;  4I64 A;  5IQQ A;  5A6P A;  4DSE A;  2VG7 B;  3M8W A;  4P2M A;  3O5T B;  3RGI A;  2PN6 A;  4B3T J;  4OIX A;  4QQB A;  3KMS A;  3M8R A;  1Q53 A;  2WVD A;  1F3F A;  1H6K X;  3IGV A;  4L3N A;  2ZH8 A;  2A3J A;  2FB0 A;  2NZ4 A;  2GO9 A;  1RU1 A;  1SKW A;  1QUP A;  5E5N A;  2Z30 B;  4TU7 A;  4NLG A;  3DOK B;  1A9N B;  1YG0 A;  1U1M A;  2HBQ B;  2G0I A;  5IZH A;  3D1O A;  1S49 A;  1HW8 A;  5J1P A;  4OX6 A;  4NLT A;  3W5Y A;  2BJE A;  3MM6 A;  2HQ3 A;  3NG8 A;  3FZB A;  3Q8R B;  2GQQ A;  3J7Z T;  3NMA A;  4I69 A;  1WOS A;  1AZS B;  2XCA A;  2NSC A;  1VIS A;  1C0T A;  4DV3 F;  2Y3Y A;  1X9M A;  4DZ6 A;  1TMM A;  3KK1 A;  1OS5 A;  1NH7 A;  3MM5 B;  1HI8 A;  1SKR A;  1SPB P;  4ECW A;  3WIU A;  2HND A;  2AGQ A;  1N6Q B;  1Z2Z A;  1VQN S;  1FX4 A;  1RWM B;  3CGI A;  4OYW A;  4P75 A;  1N5Y B;  2HHH F;  4H4O B;  2Z8Q A;  1RAE B;  4EEY A;  1IBM F;  5E41 A;  3VAK A;  1U47 A;  4ATN A;  3KJN B;  1RWO B;  3IC1 A;  4J37 A;  4USU A;  2D9O A;  4ZP9 A;  3M8Y A;  4N47 A;  3ENQ A;  4P9S A;  3D0I E;  4AE5 A;  2HHQ A;  1YJV A;  2XNR A;  4WF9 Q;  3C6U A;  2QLF B;  2W9C A;  2QO3 A;  2HK2 A;  2CQG A;  4DSL A;  2MKJ A;  1T02 A;  3EUN A;  1WF2 A;  2L9D A;  2J8S A;  3TAQ A;  1R89 A;  4ANE A;  5HMW A;  1RDR A;  3CE8 A;  4IKA A;  1S0V A;  1WEZ A;  2DGQ A;  2P9E A;  1KN6 A;  1JK9 B;  2ZC4 A;  4ECS A;  1P9Y A;  3DMJ B;  3LAM A;  4NXN J;  3FUY A;  1Q0N A;  5L1K A;  1NZ8 A;  2B9W A;  2RDD A;  3HO1 A;  1DLO B;  2VF3 A;  1NPP A;  1UP1 A;  1D8Y A;  1U7L A;  2JLF A;  3CNQ P;  3FCH A;  5HBM A;  4M5D B;  3SSS A;  2DR8 A;  2XS2 A;  1FXL A;  4EK2 A;  1KS2 A;  1SJQ A;  1G3O A;  3D7S B;  3MMJ A;  5A6W A;  5CH7 B;  3GQC A;  4MIA A;  1K44 A;  1R3N A;  3T5K A;  4KGZ B;  3G8Q A;  4DL5 A;  1BWE A;  3HM9 A;  1PKU A;  9ATC B;  5HVG A;  5KFX A;  3HLU A;  1P9Q C;  1NSQ A;  4CTA B;  3TJ8 A;  3BF4 A;  1ROF A;  2EFV A;  3W8G A;  3BBB A;  2UXB F;  2CPY A;  5DRK A;  3WBZ A;  3HJF A;  2QL9 B;  3KLF A;  1FKO A;  3UR3 C;  2ZHA A;  2VOD A;  5CYM B;  5KOW A;  4Q8E A;  2XMM A;  3KWM A;  2CZ4 A;  2P6T A;  1GQE A;  2B5J B;  2EFP A;  1R8H A;  1J27 A;  3MD3 A;  4AXJ A;  3OHA A;  2EG1 A;  2F8H A;  1JMT A;  1RP5 A;  4ID5 B;  3LP1 A;  3EWG A;  5B09 A;  3KK2 A;  5ADZ A;  2RIJ A;  5J2Q A;  2VOO A;  2BOP A;  2OFH X;  3N6N A;  3TZZ A;  1R8B A;  4ED0 A;  2P2C B;  1NPR A;  2V2V A;  3R7S B;  2ZH2 A;  4NYZ A;  3GLJ A;  3MI7 X;  1DAR A;  4DX5 A;  3MWB A;  4ZKA A;  1EET A;  1WHY A;  2NCK L;  2M88 A;  1RWV B;  1K47 A;  1KDN A;  2KYX A;  3MF5 A;  5IFM A;  4TQR A;  2DRD A;  2ZBC A;  3GSI A;  1YQH A;  2H5E A;  5BYQ A;  2A6O A;  3I87 A;  1KVK A;  7FD1 A;  2MY8 A;  4F4Y A;  4IQX A;  1IKX B;  5DG9 A;  3PNI A;  2L9W A;  4YQW A;  2ZVS A;  4HAC A;  3QPI A;  1U24 A;  3P45 B;  1FXR A;  1S1W A;  2Z2Z A;  3FGV A;  4EO8 A;  2J6U A;  3DRX A;  2J5A A;  4OHV A;  3R5J B;  2XMU A;  1SJ4 P;  4J9K A;  4PXC A;  2M52 A;  1WC0 A;  1XTZ A;  4MKB A;  5CYJ A;  1K8A T;  4I6W A;  4ZA1 A;  5L8R C;  4LSN A;  4DU7 A;  4YFU A;  2HWI A;  4F0M A;  1C4A A;  5ETT A;  5KG6 A;  2JVR A;  4OYA A;  3S1T A;  4J9O A;  1BQN A;  1CJV B;  4HVZ A;  3HK2 A;  1QUV A;  1HA1 A;  3DLG A;  2C3U A;  1CJK B;  2EG2 A;  2W7O A;  1GX5 A;  2K06 A;  2C3Y A;  1MN9 A;  2V34 A;  2RF2 A;  3ILJ A;  1Z2L A;  1HHS A;  1L3K A;  1BQX A;  2GQ2 A;  2XHC A;  3SCL E;  2C2E A;  4PRF A;  3AXM A;  1WHX A;  2OAU A;  2RKI B;  2R7W A;  2GV1 A;  3DRS B;  3MR7 A;  3PRB A;  1FNX H;  1HNX J;  3QJL A;  2LP4 A;  4DCJ B;  4B9S A;  2AJ4 A;  2K8G A;  1S1T A;  3OV7 A;  1RU2 A;  4YS2 A;  3V6H A;  2ATC B;  1HPZ A;  2DR7 A;  2DR9 A;  3UNY A;  4MKV A;  1WDD A;  1RT1 B;  3AJD A;  4X66 J;  4C3L A;  4K0K F;  1O8B A;  2DEI A;  2RAQ A;  4ES2 A;  4OLO A;  3QAT A;  5A0Y A;  2QLJ B;  5AJ3 F;  2V0N A;  3P5T L;  4O3O A;  3IMQ J;  4CT8 A;  3QZ7 A;  3DN9 A;  2UVR A;  1R8A A;  4IRD A;  1HBM B;  3HFK A;  2HWH A;  1DHM A;  2XS7 A;  3W3S A;  1E6V B;  3CJ2 A;  2QG9 B;  3PJW A;  4B17 A;  3CC4 S;  2BJ8 A;  1X4H A;  3D0H E;  2DD8 S;  4KV8 A;  1MSW D;  4DX7 A;  2ASD A;  3AB2 B;  2R8J A;  3MEE B;  3TO8 A;  2WB1 D;  3G8T A;  2ASY A;  3QFH A;  3OJU A;  3MCS A;  1SQF A;  1HNV B;  1RT6 A;  3CCU S;  4BBY A;  4RNF A;  1DRZ A;  2FVS A;  1TQL A;  2R4F A;  5J2P A;  1WC1 A;  1S4F A;  1UA0 A;  3FQK A;  4F50 A;  5I42 B;  3Q83 A;  2Y1R I;  3CPW R;  1DZ5 A;  1NKE A;  5AXK A;  3KDO A;  4MK7 A;  1KQG B;  2G1D A;  2CJY B;  3NRB A;  3W62 A;  5JJB A;  1F9H A;  1HNW J;  1RAO A;  3DM2 B;  4QYR A;  2XGP A;  4DR7 F;  3A3P B;  2WRM A;  3I9Z A;  4A8X A;  1NBE B;  2YWW A;  3Q0A A;  2CJK A;  4LF6 F;  4EYH B;  5CYQ B;  1MLA A;  5FLX U;  2MQP A;  1NPK A;  1CQN A;  3TI0 A;  2ZDO A;  2ZUA A;  1NXI A;  1LOU A;  2JRS A;  3JTP A;  4URQ U;  3OTO F;  3PZP A;  1NK4 A;  2FJV A;  3D3B J;  1S6P B;  3PCO B;  2Q6C A;  1M5P C;  3AOC A;  2VJU A;  3QBC A;  5HMZ A;  4GKJ F;  4EUV A;  3PYG A;  4Q7A A;  4ZPC A;  1QAJ A;  3IO1 A;  4CCH A;  2QIF A;  2J76 E;  2EEY A;  2YKN A;  3GIL A;  2V2Q A;  3KOA A;  1C1C B;  1NSP A;  1VOM A;  3AQP A;  4Q0B A;  5THW A;  2A0F B;  4ZCL A;  3ULH A;  4RR5 A;  2VFT A;  3U1L A;  2X51 A;  1QTM A;  3OR2 B;  4JI7 J;  1QD1 A;  3M6U A;  2Q79 A;  5HN0 A;  1T9X A;  1RT2 B;  1UWB A;  2H3E B;  4N7T A;  4K4Y A;  2HQG A;  1VBZ A;  5B0D A;  2J0S D;  4CWB A;  3AD9 C;  1X5S A;  4M5N A;  1HR0 J;  3A13 A;  3PR5 B;  4ED5 A;  3OFF A;  4DG1 A;  3BDP A;  1CJT B;  5MLC V;  2GA7 A;  2JH3 A;  4CYU A;  5KT2 A;  5BJR A;  2AMC B;  4TKT A;  4CO5 A;  2VQE J;  4DPW A;  2NPF A;  5BYS A;  2ROG A;  4OZJ A;  3H5Y A;  3V6K A;  3QWU A;  1Y00 A;  4I56 A;  5IM0 A;  3P96 A;  2FHK A;  3PM9 A;  3DMJ A;  3VAI A;  4FS2 A;  2KFN A;  1KR4 A;  2KKH A;  4PYA A;  4BDP A;  4FXW A;  1PC4 A;  3KLV A;  2M4M A;  2QE5 A;  3Q2T C;  2R7O A;  2DXF A;  1NHK L;  4KE5 A;  2P9G A;  2HFO A;  2CQ2 A;  2OMO A;  2AQ4 A;  4H54 A;  4NLO A;  1VQM S;  4RNN A;  3QAU A;  1SUQ A;  2WB4 A;  3HVA A;  4MYT A;  4P73 A;  5E33 A;  5ETK A;  4CT9 A;  1Q79 A;  2B6A B;  2RQM A;  4UOF A;  4USI A;  1FK9 B;  3BGF A;  3PY8 A;  2BJ9 A;  4CLP A;  3QQC D;  2N3L A;  3D6F B;  3OR1 B;  3THT A;  1VBX A;  2HHS A;  2EKN A;  2IPO B;  2ZWP A;  2UUB F;  1GXU A;  3QGH A;  4ECZ A;  1HAR A;  2HFZ A;  1SKS A;  4C8L A;  1TKX B;  3FKB A;  2FJD B;  2C2R A;  3SFU A;  4C6A A;  2VON A;  3JS9 A;  5FD1 A;  3NNH A;  4UZB A;  4FPI A;  3A3N B;  1S9E B;  1NK9 A;  1TV6 B;  4ICL B;  3FSI A;  1S72 S;  4UST A;  4MKY A;  4DSI A;  1O0P A;  4DQR A;  3QSY B;  2ZM6 J;  1X4D A;  4TNO A;  3BR9 A;  3S7R A;  2CQD A;  4X62 F;  1W25 A;  3D6M B;  5GAG I;  4DR1 J;  1ZYQ A;  1FXD A;  3I82 A;  4G65 A;  3BN7 A;  1RT4 A;  5F0W A;  2W7P A;  2N3O A;  1VQK S;  4B9N A;  1PSD A;  3TAM A;  2LXI A;  1YZ6 A;  5KFV A;  4M5H A;  5DZ6 A;  1S76 D;  4V19 J;  1Q5V A;  5HJY A;  2XZT B;  3NMR A;  2M9K A;  5D4P A;  2EBE A;  1JJC B;  2XGQ A;  3HVW A;  2HFV A;  4G1Q B;  3UD4 P;  2K3I A;  2GW8 A;  2CIM A;  3M8Q A;  2QT7 A;  8AT1 B;  4ELT A;  2FVR A;  4GRS A;  4CZC A;  2RIL A;  4X64 F;  4J9V A;  2JDJ A;  3Q24 A;  4JV5 F;  4LRC A;  5EWG A;  5KAK A;  1MU2 B;  4DQQ A;  3G2X A;  4QIE A;  4ZCI A;  1NDC A;  4PAB A;  1J5E F;  2V4J B;  4NMX A;  1CC7 A;  2GGP A;  2FLO A;  5CHC B;  3F56 A;  1KQK A;  2W4C A;  1NJY A;  3Q22 A;  2NYI A;  2DGS A;  5KFD A;  2CXE A;  2D41 A;  2KO1 A;  3GV5 B;  1KTV A;  1NH8 A;  2AV5 A;  2X1F A;  2B51 A;  1HHQ A;  1WEX A;  3ADA C;  3DLE A;  1OMS A;  3JYT A;  2ZH9 A;  2BR0 A;  2BOA A;  3BQ2 A;  3QT7 A;  2EKY A;  4LVN P;  1PO6 A;  1WOO A;  4RNM A;  4X4O A;  3NGT A;  1Y5L B;  2PO4 A;  2OSR A;  4QYZ K;  1FNO A;  3VAM A;  5A0Y B;  3PVX A;  2JC1 A;  3W60 A;  4ZVU B;  3KK3 B;  1WF0 A;  2VPW B;  5KG5 A;  2M8D B;  4Q0B B;  4BCA A;  3BDE A;  4WP3 A;  3MUM P;  4QJV A;  1A6L A;  1FA0 A;  3MM6 B;  1EP4 B;  3GYG A;  2HBY B;  2WVB A;  4DMZ A;  5DDQ C;  3V2U C;  5F8L A;  4A8K A;  4AXI A;  2IAJ B;  5C2G A;  4IO9 Q;  1FJ7 A;  1UWB B;  2CPX A;  3P4U B;  2R2R A;  3R1H A;  4PCQ A;  2IHR 1;  3FVY A;  1SV5 A;  4H4M A;  1TKT A;  5HL7 Q;  1IBC B;  1XMB A;  1YJT A;  2HIQ A;  3CJT A;  3TX8 A;  5J2N A;  3KLE B;  1YBU A;  2BRK A;  2I5J A;  4RW9 B;  1KNZ A;  2Y9H A;  4L73 A;  1EX8 A;  3NWR A;  3T41 A;  1UW4 A;  5I3U A;  2W2M P;  2DO0 A;  2FTR A;  2GGP B;  4U67 Q;  3FMB A;  2AYM A;  3KJF B;  5KG7 A;  2MZ1 A;  4PYD A;  3CCW A;  3J81 U;  4DWI A;  3CJS A;  5DDP C;  3AA8 A;  2VOP A;  4DV6 F;  3DRY A;  1S1V A;  5JVH Q;  4X4V A;  1A7G E;  2XEX A;  3LP0 A;  2X7I A;  2XSJ B;  4HH1 A;  1WJ9 A;  4KKO B;  1D1U A;  5HLF A;  4KHP F;  1J5O A;  1ZPV A;  2DH7 A;  2VV5 A;  1ICE B;  3A4T A;  1EIY B;  1RAC B;  2VPZ B;  3SZ2 A;  4IG0 A;  5J2P B;  4P10 A;  2NYH A;  2OPS B;  1UMJ A;  4WE1 A;  3AOD A;  5ETR A;  4ZS6 A;  1IBL F;  4DF8 A;  4W90 B;  1R6V A;  5G4D A;  4P7V A;  2ZJR Q;  5GAH I;  1P6T A;  3L95 X;  2W8K A;  5DQH A;  2I0X A;  2FGO A;  1NRK A;  2MQ8 A;  2UU9 F;  4GKK F;  2RRN A;  2VFR A;  2QZ8 A;  4IFY B;  3X3U A;  1NJW A;  4KB7 A;  2CJ9 A;  4NLQ A;  4RJV A;  5ITH A;  2KG0 A;  1VQO S;  4KGK A;  1G2E A;  1AT1 B;  3RAX A;  2NSB A;  4C3K A;  4N8N A;  2W2Q P;  5D0E A;  1C0U A;  4WXO A;  4E0D A;  3BQ1 A;  3X1L B;  4MMO A;  4X4Q A;  3HD2 A;  4K5S A;  3W63 A;  4J9M A;  1U45 A;  1FKO B;  2YXL A;  4WU3 A;  2N82 B;  3CUL A;  3CT9 A;  4O44 B;  1U2F A;  3RW6 A;  4PQU A;  5HI7 A;  3POT B;  3GR0 A;  2HHX A;  3MR5 A;  2JFD A;  3EDR B;  2MKH A;  3NS5 A;  4ZCM A;  3LH2 S;  1TK8 A;  3GJT B;  4LVO P;  5E3R A;  3D6H B;  2PDA A;  4CH7 A;  2LMI A;  1LFP A;  1RE1 B;  1LV5 A;  2BDP A;  3KTQ A;  2ZZN A;  1JLG B;  3HCX A;  2JEI A;  3FEZ A;  2U2F A;  3MEC B;  1N36 J;  2ALY B;  4U8V A;  2Y1I A;  1SL0 A;  3U1M A;  1VQS A;  1IJF B;  1X5P A;  2JWN A;  4TYA A;  2IVM A;  3BYR A;  2FJE B;  3MMB A;  1ZS6 A;  1MWZ A;  1RTD B;  1HNZ J;  2WOM B;  4NYP A;  2XMA A;  1S6Q B;  4ELV A;  3MGJ A;  5KFG A;  2D7S A;  3D0G E;  3K8V A;  2OO4 A;  1S9G A;  4ZJL A;  2QMU B;  4PWU A;  3H25 A;  2ILZ A;  3CJ8 A;  1Q8I A;  4A8F A;  2RF2 B;  1KQF B;  4Y65 A;  4IUF A;  5I3P A;  4YB5 A;  3TZW A;  4DV4 J;  4DR7 J;  2YX4 A;  4EZ9 A;  1H2V Z;  2CJX B;  2Z58 B;  5LT5 A;  3RBE A;  2ZZM A;  4C8Y A;  5E7O B;  1VK3 A;  2KHC A;  3DRR B;  4QCL A;  4MTP A;  2IBK A;  1DQA A;  1F5B A;  4LUB A;  1X4F A;  4DPT A;  2VA3 A;  4LRE A;  2PI4 A;  3MPU B;  2UUA F;  4B3M J;  5B0E A;  2BJ1 A;  1JLQ B;  2GAG C;  3OTO J;  3BEG B;  2RS8 A;  2CA9 A;  3CD5 A;  4Q8F A;  3JXO A;  2IY5 B;  2XWY A;  2OPP B;  4R5P A;  5ETM A;  2CNL B;  2VDI A;  1UW9 A;  1U49 A;  2VKR A;  2YNI A;  3H8Y A;  3W2W A;  3V6D A;  1RT2 A;  4ZVP B;  3KLE A;  3K0J A;  3RU0 A;  5T14 A;  2FGC A;  3NGS A;  3JSY A;  4G1P A;  3T3F A;  2O5D A;  2OKQ A;  1NHV A;  4DCP B;  4A8O A;  3IXQ A;  2QFJ A;  1CQM A;  2C2N A;  1IVZ A;  4JI3 J;  2YNI B;  2V8H A;  2VFV A;  2CJA A;  2E7V A;  3GPA A;  2DGT A;  4L6V 3;  2U1A A;  3A8E A;  4OZ3 A;  4AND A;  3B54 A;  3W5Z A;  4HHH A;  3R3T A;  1N33 F;  4ED7 A;  1F1B B;  2XY6 A;  1EKR A;  1N36 F;  3A8J A;  2E66 A;  2HBZ B;  1GMU A;  5B0A A;  1XR6 A;  4P6Q A;  3MMA B;  5B7W A;  4FYW B;  3PV8 A;  3CJK A;  2MQM A;  1I94 J;  1W2B R;  4HI2 A;  3MR6 A;  1XWL A;  3M6W A;  2VAS A;  2EFO A;  4M5M A;  1TUG B;  3PX6 A;  1S97 A;  2E7X A;  2DRA A;  4PG6 A;  1N5V A;  4ECV A;  4KJI A;  2G9O A;  3H7H B;  2RU3 A;  3Q8P B;  2MTL A;  3IN5 A;  2RDJ A;  1WOP A;  4DL0 C;  5KFJ A;  2CNO B;  4QR0 A;  2YH1 A;  1N32 J;  1QSL A;  2C3P A;  2RJZ A;  1HIY A;  5FDL B;  3EM1 A;  5GAG U;  4AFF A;  4EGL A;  3TA1 A;  5KG2 A;  3CCZ A;  3RYL A;  3GFZ A;  1NEE A;  1S6Q A;  3T6J A;  2UVW A;  4PWW A;  2UVV A;  1IM6 A;  3W66 A;  2BE2 B;  5HBM B;  1DBD A;  2OPR A;  2OPQ A;  3FRY A;  5A8W B;  4Y34 A;  2BRL A;  2LFV A;  3H0P A;  1S48 A;  1SJR A;  2OEM A;  1ELO A;  4DV5 J;  3K58 A;  3MEC A;  4DV7 J;  2AJ1 A;  4ZP6 A;  4YY3 F;  2LQJ A;  3OT9 A;  3J7Y I;  1PYS B;  1SCJ B;  3T1H F;  1TZ0 A;  4MK9 A;  5HVF A;  3Q8Q B;  3GIM A;  1U09 A;  3DLL Q;  1EKS A;  2NUH A;  3H5X A;  6AT1 B;  4USV A;  5ETL A;  3VCD A;  1U4B A;  5HVH A;  4DV1 F;  1U1P A;  4FBU A;  1WWH A;  3FSX A;  3GCX P;  3HHL B;  3CD0 A;  4OYP A;  3IR5 B;  1RTZ A;  5K8M A;  1C1C A;  1O6X A;  2CQ0 A;  3P5B P;  2ABY A;  1FRH A;  1R8C A;  2HUR A;  3MMC A;  3DXS X;  2X3G A;  4RW7 A;  4ZP8 A;  3U7J A;  1MWQ A;  1YDL A;  1F5A A;  2MZJ A;  3BGR B;  3K5O A;  4KSE B;  2BM1 A;  3W8P A;  3HPO A;  3G71 S;  1T03 B;  1RSC A;  3PRD A;  2K1R A;  4HT5 A;  3GMG A;  3G86 A;  2F9J A;  2XBP A;  2OGU A;  2GIR A;  2W25 A;  2DIV A;  3D66 A;  4PEO A;  5T41 A;  1RLC L;  4AT1 B;  3RAQ A;  4NCA A;  2V4Q A;  2B7B B;  4RLE A;  3WDO A;  2GHV C;  1WC4 A;  3QLH A;  3HT3 A;  1C0U B;  1RWX B;  5D15 A;  2CPD A;  4EBD A;  2KJV A;  3K2Y A;  2HK3 A;  3GTY X;  4IDK B;  4RBU A;  2W8L A;  1HYS A;  2P8I A;  1EAY C;  3GIK A;  2OUG A;  1VI7 A;  3LGH A;  3VQT A;  4ZLJ A;  2NR0 A;  2EC2 A;  4K59 A;  2W2O P;  4KKO A;  2BAN A;  2AJ0 A;  5LXR A;  3SBM A;  1WC6 A;  3V4I B;  3UD5 A;  2OML A;  1YI2 S;  4BS2 A;  4U7C A;  4XIU A;  4ZVT B;  3DGP A;  2HNY A;  5KT5 A;  3QJP A;  3DRR A;  3ILO A;  5L39 A;  2CAJ A;  3R5C A;  3T9Z A;  1N52 B;  3IWN C;  4OHX A;  3D6T B;  1ZBT A;  5HRO B;  4ZLN A;  3K8W A;  4KAI A;  4J9U E;  4LRD A;  1NK6 A;  4FF3 A;  5H9F K;  1J2V A;  3N0V A;  2V6A A;  6FD1 A;  2XSJ A;  1ZTT A;  3R5G A;  3QT5 A;  4GO7 X;  3H4B A;  3RRH A;  3D1H A;  4HH0 A;  4USH A;  2CG8 A;  5DS7 A;  4ZVR B;  2Q6B A;  1DJ0 A;  1H0H B;  2GMH A;  4JV2 A;  2E5J A;  1YLX A;  1X5T A;  2IM3 A;  1IQT A;  4EBC A;  1VRQ C;  3LP1 B;  1KVI A;  2XI3 A;  4N5S A;  4ED4 A;  3AD8 C;  4TLQ A;  5GAD I;  3KJV B;  2M3D A;  3W9H A;  4LBP A;  4DS4 A;  5KG0 A;  5DGB A;  3FBE A;  4GMK A;  1FD8 A;  2YKM A;  4P52 A;  3I9V 9;  1M1G A;  1LWC A;  2IJN A;  3NGK A;  4DBQ A;  4J9S A;  1GEH A;  2PE8 A;  1UZH A;  1JJH A;  2HZV A;  2Z2Y B;  3MAQ A;  3CD7 A;  3Q89 A;  4MJK A;  5FJ4 A;  2UUC J;  3TAP A;  2MJN A;  1GNK A;  3MAH A;  3OJS A;  4GC6 A;  2NPI A;  2FLP A;  4DR6 J;  1NDK A;  3DDN A;  1S7I A;  1OWX A;  2ZFH A;  3MMC B;  1EP4 A;  2DNP A;  4RBT A;  1GK8 A;  4TU8 A;  2R7S A;  3D9B A;  1CPZ A;  1GXT A;  1SH0 A;  3NP5 A;  5K14 B;  1N8R T;  1QAY A;  2M0G B;  2D1C A;  4KY3 A;  2XTJ P;  1RXO B;  3UDV A;  1IBK F;  4JI0 F;  4QYZ J;  5KFT A;  4R0J A;  4QWA A;  3LUY A;  1Z4U A;  2MKS A;  4J5O A;  1JLA B;  3TUZ C;  4JI7 F;  1N0U A;  1TL1 A;  2HIY A;  1YWX A;  4LR7 A;  2LYV A;  4CO1 A;  4K4W A;  2UUC F;  4KIA A;  3HZE A;  3UDC A;  2PEB A;  5DLG A;  4DV6 J;  4C48 A;  1N48 A;  3SCK E;  2EK1 A;  1U1Q A;  5CYQ A;  4DL7 A;  2R7R A;  4LF7 J;  1RHU B;  3E3X A;  1IBK J;  5L9X A;  4XPE A;  2LKZ A;  2J9C A;  2OPR B;  5A8W A;  1F9E B;  2NS1 B;  2ZZT A;  4TY8 A;  1X9W A;  3TA0 A;  4U7U K;  1JX4 A;  5HLF B;  5IT9 U;  2B9X A;  3LP0 B;  3R2C J;  3W64 A;  4D3H A;  1YK9 A;  3TZX A;  3TW0 A;  4CO3 A;  1Q8B A;  3CC7 S;  2V8P A;  4GKK J;  5HP1 B;  3NEK A;  3PYF A;  2HG4 A;  5J2Q B;  4KR0 B;  3H20 A;  2LQ5 A;  1X4B A;  2PEH A;  2RHQ B;  2MQL A;  1FI4 A;  3UDL A;  3D3C J;  3TAR A;  3RRK A;  3NY0 A;  2RRB A;  4KO0 B;  2HHW A;  1TKT B;  2UUT A;  1FRK A;  1C0T B;  1TV6 A;  2MHN A;  2R42 A;  3B6B A;  4WU2 A;  4HHJ A;  3N6M A;  2YWG A;  1RT5 B;  1UVK A;  3K57 A;  2ZHB A;  3PHE A;  4DUY F;  4ZN3 A;  1QSS A;  1FES A;  1T03 A;  4F3O A;  2D3O R;  2M70 A;  1S0N A;  4DR4 J;  2HHH J;  4KGX B;  1P8G A;  5I4M A;  3PJ9 A;  4RW4 B;  2W4D A;  3KJQ B;  4FF4 A;  2DNH A;  2LU2 A;  2MLY A;  3A8K A;  4RW6 B;  1FEE A;  5ETV A;  5J1N A;  3GE9 A;  4C11 B;  3U1N A;  4DHV A;  3EYZ A;  1QSY A;  1BHN A;  2FJX A;  4LRB A;  3VQS A;  3IS9 A;  3G6V A;  3J81 j;  2HVE A;  4BHQ A;  5KFP A;  4KBI A;  1U6F A;  1HWU A;  1YX2 A;  5J2M A;  5HAO A;  3TZY A;  1UFK A;  2Q1L A;  3TUI C;  3LPY A;  3Q2S C;  1YJU A;  3QGP A;  1HQE A;  5DM7 Q;  4FYD A;  2ZNZ A;  3UN5 A;  2GNK A;  4ZVS B;  1SC1 B;  2XUL A;  3BH6 B;  2MXY A;  4DFJ A;  2EFN A;  3CMA S;  3THV A;  2LA6 A;  4FZV A;  4NZ6 A;  4WFN Q;  4WFB Q;  4DV2 J;  1WNE A;  4RUC A;  3P6Y C;  2DEJ A;  4F26 A;  4JV1 A;  1UWA A;  3NCR A;  3PFO A;  4QWE A;  2GX8 A;  2K2P A;  5DG8 A;  2RU9 A;  1HD1 A;  1DLO A;  2IC3 A;  3IM8 A;  2AWZ A;  4NLP A;  3PW5 A;  3S6E A;  1GX6 A;  2PA3 A;  4DS5 A;  2H1Y A;  1N34 F;  1SJ1 A;  2ROE A;  2FY1 A;  1R43 A;  2F65 A;  3LOU A;  1CG2 A;  4J7C A;  4KPY A;  1FFG B;  2H65 B;  3W5X A;  5KFW A;  3GV8 B;  5DM6 Q;  2J9D A;  2QYG A;  1RK8 A;  4ZVH A;  5HQ8 A;  3MR2 A;  1P1L A;  2JL9 A;  2VG6 B;  1T9U A;  3E8O A;  2DNQ A;  2OTJ S;  2J9E A;  3I56 S;  4H4K C;  4OI1 A;  4JI1 J;  1U0H B;  1B7F A;  3HX9 A;  1FE0 A;  3G6Y A;  3MPV A;  4ANC A;  2BAN B;  2YNH A;  1M1H A;  4IFV B;  4CYU B;  2BKO A;  2D74 B;  2FJB B;  4P2S A;  2BJD A;  4I67 A;  3NGU A;  4JI6 J;  4H4K A;  1WD6 A;  5SUH A;  2ASJ A;  1P1T A;  3V81 A;  1IKV A;  1NHU A;  2EK6 A;  3ET6 B;  5D77 A;  1HBO B;  1NO8 A;  1SXL A;  1TL4 A;  3H5U A;  4QR2 A;  5IS2 A;  1RT5 A;  2XY7 A;  4C3M A;  1JQG A;  1RBO B;  2Y1L B;  1KFS A;  4K7Q A;  4RNH A;  5T7L A;  4YR3 A;  4UY8 5;  5AXN A;  2UV8 A;  1S0M A;  4PUO B;  2KT3 A;  3M1V A;  2RQK A;  3LAL A;  1S57 A;  3QGI A;  3KLF B;  3SXL A;  4NAS A;  2XG8 A;  3KHH A;  2AGO A;  3M8P B;  1U2R A;  1V9O A;  1VYA A;  2CQP A;  3ET6 A;  3TNV A;  3M9N B;  1EQ0 A;  1MMD A;  2JC0 A;  2APO A;  1YSJ A;  3IRX A;  5IT9 Y;  1KKH A;  1AUS L;  1URR A;  2HRU A;  3KLG B;  2DH9 A;  1L3U A;  4O0I A;  5KFB A;  3ZTQ A;  3EZO A;  4CLF A;  1HWI A;  2DNG A;  5DJB A;  2WVC A;  1ZA2 B;  2D3U A;  4M5D A;  1WTB A;  1FX2 A;  2YPY A;  2DCU B;  3DHX A;  1AFI A;  4ETX A;  4X4U A;  5KFQ A;  1XMO F;  1VQ5 S;  3IWL A;  2QSW A;  3MFI A;  3CC2 S;  4M94 A;  1XR5 A;  1QAX A;  2BV3 A;  4KGV B;  1YTY A;  1M90 T;  2AIR B;  2HGL A;  2YKO A;  2KRR A;  2ZVI A;  3WX4 A;  3T1H J;  1S1V B;  1UEU A;  4E8U A;  1K9M T;  4ZPA A;  3F0N A;  5JMN A;  4O4G A;  1VIO A;  3VGV A;  3C14 A;  3EGN A;  2EFQ A;  4X4P A;  1LW2 A;  3BKT A;  3FFI A;  5KFL A;  2CDR B;  1UAW A;  3BKF A;  4ZPW R;  4PQU B;  1RAG B;  3OXG A;  5L1J A;  2SXL A;  2D69 A;  1FD2 A;  2HFU A;  4DV5 F;  3OSP A;  1SL1 A;  1PIE A;  1JJ2 R;  1B3T A;  1FWP A;  3OBI A;  4OFZ A;  2AX0 A;  1FO1 A;  3KYL A;  3NKY A;  5AXM A;  1M5K C;  5LSR A;  1NB2 A;  5B0G A;  5IOL A;  2JLG A;  3RTV A;  2XY5 A;  4A8W A;  4ZDN A;  3HDS A;  3DU6 A;  2OP5 A;  2W2P P;  4KC5 A;  4BWM A;  1RYR A;  1F60 B;  1WC5 A;  3ITH A;  4C0B A;  1YJ9 S;  3HSZ A;  1JIH A;  2MKY A;  2V8V A;  4WXW A;  5KG3 A;  1Y0H A;  3PTW A;  2DHA A;  2DPJ A;  2ZIT A;  2EC0 A;  3H59 A;  3DLG B;  4F4W A;  1W26 A;  2IYI A;  2QEX S;  2C22 A;  4K50 A;  4XDD A;  4FPR A;  1I94 F;  2GS8 A;  2KDO A;  3M32 B;  4UQT A;  4F36 A;  1HD0 A;  3BYP A;  4M5G A;  3OW2 R;  1HR0 F;  2JLE A;  1S6O A;  4K4Z A;  4L75 A;  1OPZ A;  1MG7 A;  1S6P A;  1Q86 T;  4U7U D;  5M2P A;  1B7Y B;  2BUN A;  5K20 B;  3MUR P;  3KLI B;  3O8W A;  5EWF A;  2MZT A;  5CCL A;  1Y7P A;  4PG7 A;  5C42 A;  1FJG F;  3KG4 A;  2XNQ A;  4WE1 B;  4UOG A;  1FTC A;  4F67 A;  2W01 A;  3G8S A;  1QVG R;  3K89 A;  1PIL A;  1DQ8 A;  3OL7 A;  2B4U A;  3J80 Y;  3FFI B;  3NL0 A;  1HQU A;  2ZJQ Q;  3ZO7 A;  1D9F A;  1YJ7 A;  4M1K A;  3E51 A;  2CUY A;  4NYO A;  3T19 A;  3B78 A;  1JLQ A;  4XTT A;  3IBF B;  4CLY A;  1SBR A;  1JLC B;  5E3Q A;  3AOA A;  2J7U A;  4OI2 A;  3HHD A;  2KB2 A;  2KG1 A;  1HQU B;  4I1T A;  6FDR A;  1PBA A;  4OJH A;  4F4K A;  1RHJ B;  1CUL A;  4FDF A;  2PD1 A;  3HFV A;  4NLY A;  2X1B A;  2B0G A;  1Q95 G;  3BGO P;  3DFE A;  3I32 A;  2I6W A;  3SV4 A;  2AYG A;  5HO4 A;  1M5S A;  2ILY A;  3DCA A;  2GO8 A;  4FN5 A;  3DNC A;  2ATL A;  2HLU A;  3I4H X;  3W7B A;  4JI2 F;  3R6L B;  2V68 A;  3LTO A;  3IG1 A;  1S9G B;  3AY0 A;  4X62 J;  1TUV A;  1HMV B;  1LXN A;  2CQH A;  2ZBI A;  4NA3 A;  5HQL A;  3JAM U;  4IRC A;  2ACM A;  5F9N A;  1KRP A;  4U95 A;  4LF6 J;  5KFN A;  4HTI A;  3TA2 A;  3KLG A;  1VQY A;  3E01 A;  2YWF A;  4YP3 A;  4NRT A;  1T3O A;  5A8R A;  2CQB A;  2R8H A;  2NQP A;  1DFD A;  2EWH A;  2CVI A;  2IJR A;  3KKF A;  1WKJ A;  4NXM F;  2AU0 A;  3PG9 A;  1DUR A;  5C2C A;  4JB8 B;  3I6P A;  4HDG A;  1X8D A;  1S7H A;  3KLI A;  5F3Z A;  4PUO A;  2KJW A;  2JHE A;  3JQK A;  1HHT P;  1XQI A;  4OX9 F;  1GAO A;  4WJB A;  3RB0 A;  3BN4 A;  4LF4 F;  2WON B;  4ZIV A;  4I7F A;  2FVQ A;  5LMU J;  1VC5 A;  1QVF R;  3L7U A;  4K2J A;  4C4W A;  4WBF A;  1IKY B;  5ETO A;  3ZZ0 A;  1TL7 A;  3J81 Y;  1MRO B;  2DNL A;  3KDN A;  4RX6 A;  3Q8V A;  2WW4 A;  2IA6 A;  2CNN B;  2OPQ B;  3CSK A;  5LL6 d;  3SFG A;  1FRJ A;  1SUQ B;  2B4V A;  3M8S A;  3BO3 A;  1MU2 A;  3UQS A;  2HHT A;  1S1X A;  3UCG A;  2JVO A;  1UA1 A;  3FQL A;  2E9T A;  2RVJ A;  1KHW A;  1OSC A;  4ES1 A;  2F3J A;  3AJ2 A;  4QBU A;  1RZM A;  1HWL A;  3H40 A;  3T5H A;  3UCZ P;  2XCP A;  2VHG A;  2CPE A;  3TUJ C;  1QM9 A;  4ITS A;  4DU8 A;  1ZOT A;  1RBL A;  5K8N A;  2XLJ A;  4ENO A;  4IOC Q;  2E9Z A;  4X4S A;  4NI2 B;  1AZS A;  4K5R A;  2E5I A;  3BB5 A;  1VQP S;  1Y5I B;  3BKU A;  4DR1 F;  1C1B A;  2G1H A;  2GIF A;  1VBK A;  4HTJ A;  5GMK a;  3MFH A;  4EBE A;  3AFG A;  4A8S A;  4M63 A;  1BWV A;  2XYP B;  3MTK A;  4F3Q A;  1N6Q A;  4V19 X;  4FYX B;  1B0P A;  2MB0 B;  1FVS A;  3AA9 A;  2QJ3 A;  4C9D A;  1MNE A;  5CD4 A;  4DPY A;  4DV1 J;  1V3Z A;  4EYI B;  2JEG A;  3OUY B;  5AE1 A;  1WF1 A;  3F73 A;  1HI1 A;  5IXU A;  4YEA A;  2MSS A;  2RH3 A;  4B3R F;  1ARO P;  3GB0 A;  3TEH B;  3PRV A;  4DX6 A;  4DV0 F;  1RQ0 A;  3MD1 A;  3FCV A;  4G1I A;  4G3I A;  3E2E A;  3I0S A;  3R1L A;  1XNQ J;  1M0S A;  2XMV A;  3M2V B;  3M1V B;  2ZM6 F;  1TMJ A;  3ITH B;  1U25 A;  2HQD A;  2XMT A;  1V5I B;  3B4M A;  4CM2 A;  5KFC A;  2VA2 A;  1GXL A;  4KGM A;  4Y2A A;  3NS7 B;  2DGO A;  2EVZ A;  4KHR A;  3S01 A;  3K5M A;  4LSL B;  5GAH U;  1YIT S;  3D28 A;  3C8Y A;  3BS9 A;  3UN3 A;  3M30 B;  3P8B B;  5E3P A;  4XAK A;  4R5P B;  3DYA B;  3EJM A;  3J80 U;  4OJ3 A;  1QLN A;  2CFX A;  1DQ9 A;  3CJ4 A;  3JSB A;  1KLM B;  2E29 A;  3CJQ A;  5BR8 F;  3BQ0 A;  4F2S A;  4LF9 J;  4PG5 A;  3VAG A;  1K1S A;  2JSX A;  2XZD B;  4KRW A;  4QR1 A;  4CO2 A;  4Z2X A;  5KOX A;  5GMD A;  3CD6 S;  2IC3 B;  4NLV A;  4ZJO A;  2GVD B;  1FNM A;  4YB7 A;  1PAE X;  2X1G A;  2HLT A;  1L3T A;  4IO1 A;  4O3S A;  5LMN F;  1UEK A;  2HS4 A;  4QZV B;  3EVM A;  3EXC X;  2HGM A;  4CLK A;  1BLU A;  1F2H A;  1Q81 T;  2MGZ A;  2I38 A;  4C0O C;  4CNY A;  3M05 A;  2Z2M A;  2DBB A;  2KVQ E;  4B3S F;  2A6M A;  4C0H A;  4ZPT R;  3M4X A;  3DOL A;  2MQO A;  1N34 J;  2YNG A;  3Q23 A;  1Q8L A;  3QNW B;  5DLF A;  1VHF A;  1J5E J;  4O3R A;  4OJ1 A;  2HKE A;  4C98 A;  3P49 B;  4PG4 A;  3JAM Y;  1TU0 B;  5KT6 A;  2PII A;  3C2P A;  3HHK A;  2WHO A;  2BXJ A;  4MAK A;  4CLZ A;  4C8K A;  5DQG A;  3MCO A;  2CPI A;  4OLP A;  1UFW A;  3NNA A;  2E1A A;  3QJJ A;  3DOM A;  4YR2 A;  1SIZ A;  3O6Q A;  4CH1 A;  3OVA A;  4C11 A;  3HSG A;  1WDT A;  1JLB A;  4X2B A;  4RW4 A;  1HKA A;  1PYT A;  4TXS A;  1B0T A;  2L48 A;  3QSI A;  2CRL A;  2DHX A;  1HNZ F;  3CDW A;  4P72 A;  1U1L A;  2KYZ A;  2WON A;  3R27 A;  1KSP A;  5J2M B;  3O2I A;  2GFF A;  3A3O B;  1MMN A;  3FRZ A;  4LF8 F;  3SYZ A;  1PBU A;  1X60 A;  1R7I A;  1RT7 B;  3GJS B;  1RHQ B;  1GT8 A;  3FEX B;  1AXQ A;  5IV3 A;  2VJV A;  5IT0 A;  4ED1 A;  4UOC A;  3KJV A;  4NCB A;  4ZVO B;  4LF5 J;  3PW0 A;  1TVR B;  2JZ5 A;  4HT7 A;  3JB9 k;  3B4D A;  3NXZ A;  1EQM A;  2ZD1 A;  3C16 B;  3ILL A;  5I3U B;  3GFH A;  3US5 A;  1B70 B;  2ADB A;  2AYE A;  4XO0 A;  3DM2 A;  4O4G B;  3VAF A;  3C15 A;  5AXL A;  4DZD A;  4U9R A;  1FKA F;  1T7P A;  3CDE A;  1FE4 A;  3I55 S;  2HMI B;  1IR2 A;  4DQI A;  4UUW A;  4DSF A;  3PYE A;  2V2K A;  4ECU A;  4RU2 A;  3C66 A;  1XN9 A;  3FNN A;  5KG4 A;  4LF7 F;  4LIW A;  2W2N P;  5RUB A;  1ZTW A;  3KG1 A;  1ZAX A;  5C25 B;  3LW5 C;  4PPZ A;  2UUA J;  1SC6 A;  2H4Y B;  1OY6 A;  2XO7 A;  2HMI A;  1PC5 A;  1JLC A;  2UUW A;  2BW2 A;  4DF4 A;  4KTQ A;  2DYA A;  3TQE A;  2C42 A;  3SCI E;  3TYT A;  4O3N A;  2WOM A;  2YNF A;  4FXV A;  1BD6 A;  4WPA A;  1YIJ S;  3QID A;  2VPX B;  3PKY A;  5AE2 A;  3KHG A;  1LWE B;  3KHL A;  4J9Q A;  3M32 A;  3IRX B;  2DR5 A;  5CQG A;  2F9D A;  3EVO A;  4IDK A;  2R8G A;  1FT8 A;  2CKW A;  2FHM A;  2E5H A;  4WKR A;  1FF2 A;  2I5J B;  1DTT A;  5DO2 A;  1HLW A;  1JLG A;  2V69 A;  3CDB A;  4OX7 A;  4KV8 B;  2CPF A;  2FHJ A;  2B9E A;  2KN4 A;  3GIJ A;  4Y2I A;  1N4L A;  1QTN B;  3ETO A;  1X7V A;  5H9F J;  4LMZ A;  2BM0 A;  2FDN A;  2KI2 A;  3DRS A;  2G2Z A;  3SCJ E;  2ZH7 A;  1N0V C;  2E1P A;  4JYA F;  1NJX A;  4C8O A;  2I8E A;  3PR4 A;  2E44 A;  1T9W A;  2MST A;  2LLZ A;  4DI6 A;  4K4S A;  2AZ3 A;  4O3Q A;  4QOT A;  1WSV A;  3MDF A;  3G82 A;  1BQN B;  2YKN B;  1D09 B;  1TL5 A;  4CH0 S;  1BQM A;  1U2C A;  3MUV P;  2OLW A;  3K5P A;  3M2U B;  3J7A 1;  3T9N A;  1X0F A;  4F04 B;  3OTE A;  4EI2 A;  2DIT A;  4I4B A;  3QMQ A;  4PQA A;  5LSL A;  3VAH A;  2R9L A;  4B3S J;  2C2K B;  4ID8 A;  3ZZY A;  4K4V A;  1BC6 A;  2BMB A;  3NS6 A;  3R8Y A;  3L3C A;  1HBU A;  5HAT A;  1LEO A;  5D4O A;  1ZAW A;  2IDE A;  4TYB A;  2QFI A;  2HQI A;  1WI6 A;  3GZ7 A;  4ZJQ A;  2ZC3 A;  1VQ7 S;  1RB0 A;  2E5G A;  1R8P A;  1R31 A;  2NXU A;  3AD7 C;  3ETM A;  4IG0 B;  1U02 A;  5CAB A;  4LQ3 A;  1VS3 A;  2VUG A;  3C14 B;  1DAX A;  5HMX A;  3F41 A;  1CS4 B;  1S10 A;  2PA8 D;  3NBP A;  4LR9 A;  1EET B;  3CCS S;  2UXC J;  2I9S A;  5LJ3 Y;  3PDN A;  3MOJ B;  2LXU A;  3PIP Q;  4X4N A;  5ETS A;  1Y11 A;  3FDS A;  1ZZN A;  3GG1 A;  5AE3 A;  4YOE A;  1TK0 A;  2KXH A;  1H7W A;  2QL5 B;  3SSR A;  1VIX A;  1T95 A;  2JNJ A;  4HAC B;  3M9M B;  5LJ5 Y;  3AH6 A;  2MJU A;  3ZZP A;  2LQB A;  2KM8 B;  3MPD A;  4Z7Y A;  2KXN B;  2Y1J A;  2Z4P A;  1LW0 A;  3MEE A;  2WTF A;  2B5J A;  5DZ7 A;  3LQV A;  2OEK A;  4R8U B;  5T7L B;  3G96 A;  1D3W A;  3FBF A;  3V4I A;  4FBT A;  4CLW A;  5DDO C;  1Y4Z B;  2DJW A;  1KD1 T;  1WHW A;  2IAJ A;  2O66 A;  2LVW A;  1UFL A;  4Y28 C;  3VV2 B;  5CXT A;  3BSA A;  3NCQ A;  4YDX A;  3I4P A;  1PJ6 A;  2BVZ A;  3TAN A;  1Y3J A;  3AQO A;  3H5S A;  3K17 A;  4DFP A;  2DNY A;  4X64 J;  1ZH5 A;  4L72 B;  1RT7 A;  2CJB A;  4WTO B;  4RPF A;  3HHN B;  1VLO A;  1XMQ F;  1XER A;  1E6Y B;  2IM2 A;  2AJ2 A;  4FP9 A;  2K1R B;  4B08 A;  8RUC A;  3VAJ A;  2ZNY A;  4OYZ A;  4EO6 A;  2YPZ A;  3V81 B;  2E5L J;  1M5H A;  1RWU A;  3PXG a;  3RRG A;  2UXD F;  1H98 A;  1Y10 A;  3HUL A;  3IP0 A;  4K2X A;  4Q43 A;  3OVB A;  1RTH A;  5CD4 H;  2QSF A;  2DIS A;  2QV6 A;  1SKU B;  2VD3 A;  3UCU P;  4NI2 A;  4KHM A;  3TQ1 A;  1KTQ A;  1N5S A;  1LXJ A;  4URS A;  1H38 A;  4A4J A;  2AJF E;  4I6A A;  3TJ9 A;  5H9E J;  5LSO A;  3HP6 A;  3JSR A;  1JKH B;  4PWD B;  5KT4 A;  2UXC F;  1M1K T;  4N56 A;  1RTH B;  1FER A;  3K5L A;  1KOH A;  2CPJ A;  1KLM A;  3MHY A;  1B0V A;  3UNG C;  4WWS A;  1F6T A;  2HAI A;  4C8M A;  3ZTO A;  4C2M A;  1VRT B;  3SIP B;  4Z7C A;  3R5B A;  1XC9 A;  5EN1 A;  4QPX A;  2RRA A;  2DY1 A;  4JV5 J;  3ICL A;  1TTH B;  3O44 A;  4QWB A;  3MM5 A;  4ER8 A;  4ECT A;  5MAO A;  2BE2 A;  2NLW A;  3LO3 A;  2A1B A;  1HFE L;  4MFB A;  5CZX A;  3CJK B;  4LBI A;  4Q45 A;  1KEK A;  1F0X A;  1RTI A;  2VC1 A;  3CB4 A;  4I0W A;  2O67 A;  3DDK A;  3I0S B;  5KFO A;  5G0R A;  3C46 A;  4DR3 F;  1HNX F;  3MXH P;  2LU1 A;  2HNZ A;  3LF0 A;  1SQG A;  3RB3 A;  4F02 A;  4LFA F;  2DXE A;  3B8H A;  4LSZ B;  2GJI A;  1X4A A;  2HQC A;  3ENA A;  3N79 A;  4LSL A;  3UE2 A;  9RUB A;  3T1Y F;  5F8J A;  3AHP A;  4F7V A;  3RBX A;  3C6T A;  2KH9 A;  3RAM A;  4USJ C;  3OUY A;  4OYI A;  1IN0 A;  1OPI A;  1G6B A;  1PJ7 A;  1SB6 A;  3IS9 B;  3MOZ A;  3JQM A;  4YME A;  3VGU A;  2MMY A;  2F4F A;  4P74 A;  4ZPV R;  2GQC A;  3N9U C;  3TVY A;  1VMB A;  4RUB A;  5IT4 A;  5F8H A;  3J7Y U;  1F9F A;  2NXJ A;  3FBB A;  2F8M A;  4FS1 A;  3DKD A;  1S1U A;  4GO5 X;  4ZIW A;  4RW7 B;  1CVJ A;  1KP6 A;  2DT9 A;  4AYB D;  1KWM A;  2XB2 D;  4DL4 A;  4GC7 A;  1TK5 A;  4HYK A;  3DOK A;  3WZ0 A;  1U8S A;  4IR9 A;  2VL1 A;  2CG4 A;  3THP A;  4WFY A;  1Q82 T;  2JEJ A;  1ULR A;  2GHP A;  2ERR A;  3MM9 A;  2V67 A;  2DGW A;  3HZG A;  1BGX T;  4QU6 A;  4DR5 J;  4M95 A;  2YWE A;  2WAQ D;  4MYU A;  3PW4 A;  2VU5 A;  2WVE A;  4L3K A;  3QZ8 A;  2BQU A;  4NEY A;  2HNY B;  2R7X A;  5J1E B;  1IKW B;  3DLK B;  4F25 A;  2UU9 J;  2DH8 A;  3RJM B;  3RUB L;  1U6B A;  3EZ5 A;  3NBP B;  3VVT A;  1RAD B;  3HI9 A;  1JKH A;  1YBA A;  1FRM A;  3SMZ A;  1TL1 B;  1VHI A;  4ZVG A;  3SQG A;  4TN2 A;  4EWT A;  2QA4 G;  2D3Z A;  4DN9 A;  5D78 A;  1BQM B;  1SVD A;  3RBD A;  5L9N A;  5SZT A;  4B9T A;  2QLW A;  2XHW A;  2F4V J;  1MRO A;  3L09 A;  4UOH A;  1NJI T;  1HYS B;  4K4U A;  3J7A N;  3GWC A;  4HR2 A;  2AT1 B;  3QLH B;  2COL A;  3MUT P;  4DR2 J;  4IQM A;  5DGA A;  3KUG A;  2HFS A;  2O1P A;  5CZV A;  5LOQ A;  3NGD A;  1VQ8 S;  4GKJ J;  2KTQ A;  1E6V A;  3UD3 P;  2VBZ A;  3EVW A;  3UVJ B;  1QE1 B;  1JLA A;  2FC9 A;  2EBG A;  4QW8 A;  4OYB A;  1LWC B;  3IM9 A;  3BSN A;  1YKW A;  3LA0 A;  3MM7 A;  2DNM A;  2KVI A;  4UF4 A;  4DUZ J;  1NKB A;  4OHY A;  3MMA A;  3G82 B;  4ALZ A;  2P6S A;  5K5M A;  4JI5 F;  2C2D A;  1IKY A;  4P2F A;  4ZP7 A;  4WK1 A;  3ZZR A;  3KK3 A;  1IWG A;  2G0J A;  1RAH B;  3G9C A;  3CWJ A;  3ENW A;  2VQF F;  4FF1 A;  4LSN B;  2CAD A;  1O51 A;  1U1R A;  3PW2 A;  1XNQ F;  2Z2L A;  1WI8 A;  1RTJ A;  3VAL A;  1KHV A;  4FVC A;  4K4X A;  2BQ3 A;  1Q7Y T;  4J9P A;  4B3O A;  4DN0 A;  4K0K J;  1LW0 B;  4UY8 T;  2EI5 A;  2MQQ A;  1T3N A;  3N01 A;  4W98 A;  2Q3P A;  2VBW A;  4FKY A;  4QPT A;  1SC4 B;  4DOZ A;  3BSC A;  2R7U A;  4Y0F A;  1UVI A;  1IKX A;  3I96 A;  1LWE A;  4DL2 A;  1IBM J;  4LF9 F;  2FVC A;  1RBA A;  5KT3 A;  5IQ6 A;  4CI0 B;  2ZH3 A;  1DTQ A;  5HK4 A;  1UJ6 A;  4O23 A;  2KT2 A;  3BJY A;  2VFU A;  4M5I A;  5D4N A;  4FVM A;  3BV8 A;  2RQC A;  1WHV A;  5J1E A;  4NCG B;  3WC0 A;  5CAA A;  3RG6 A;  1AW0 A;  5KTQ A;  2XQC A;  2F4V F;  2I2Y A;  2CDQ A;  4FYV B;  1LWF B;  4QIW D;  1X9S A;  3KNG A;  1HBN A;  2HVD A;  2ZE2 A;  4YHH F;  4FYY B;  1Y9O A;  2ZEJ A;  4IH7 A;  1WC3 A;  3UN2 A;  1HI0 P;  2OTL S;  2LEP A;  2DNZ A;  4CIO A;  4IOA Q;  2V94 A;  4WP8 A;  2LA4 A;  3TAM B;  1FFS B;  3ELH A;  1CJU A;  4NX9 A;  1RT4 B;  3EGW B;  2IVY A;  3MMB B;  3A1Y G;  3FBC A;  3WC2 A;  2LDI A;  2R7V A;  1VC0 A;  3PEH A;  1A0O B;  2VFS A;  5LMN J;  4Z37 A;  3M8P A;  4PWD A;  4RL1 A;  4RU9 A;  2OEL A;  1FDA A;  2MZS A;  3NAI A;  2V2Z A;  1IWA A;  1MWY A;  4IOB A;  5M2R A;  3HKW A;  4CLS A;  5EHH A;  2GMJ A;  4Q2L A;  5J2N B;  4F4A A;  5AJ3 J;  5JVG Q;  3WX8 A;  2W9A A;  1N5Q A;  1YRT A;  3JTN A;  1VFJ A;  3MM7 B;  3NAH A;  4M5L A;  4LQ9 A;  2W1B A;  1N54 B;  4X4R A;  4ECR A;  1TKD A;  3UDE A;  1X4E A;  4YN3 B;  4GVB A;  4CTA A;  2HRY A;  3D5M A;  1HWK A;  2DNR A;  5BXI A;  2CJQ A;  1MML A;  2Z0G A;  2YNG B;  3RW7 A;  5DET A;  4HKQ A;  1TKZ A;  1EJ7 L;  2PFF B;  1JLB B;  2BJ3 A;  2YQ0 A;  2A2C A;  5EX3 A;  4ES3 A;  2FIU A;  4ED8 A;  1SIW B;  1RTI B;  3OR1 A;  1YJR A;  5EX0 A;  2OJ3 A;  2YKQ A;  5KFE A;  1X4C A;  2DGX A;  1Q8K A;  3CIZ A;  2BJ7 A;  1R6Y A;  3QYY A;  2VG6 A;  3AOB A;  4HHU A;  2DHH A;  3CCT A;  1RAI B;  3I0R B;  1GTH A;  4DFK A;  1BE4 A;  1JWW A;  2V8G A;  2KXF A;  1IQZ A;  3EMT A;  3RZA A;  2FVP A;  1RAJ A;  2QMX A;  3DOL B;  4KFB A;  3ZZZ A;  3BR8 A;  3DLH A;  1VRU A;  3DYA A;  5C25 A;  2GAH C;  3UI3 A;  3NGR A;  3R5D A;  3GIR A;  2UP1 A;  2W24 A;  4S0M A;  1N5T A;  4OMF G;  4RWW A;  4NLS A;  1XEZ A;  2EXU A;  3ZFV A;  2W9C B;  1YHQ S;  4KH0 B;  4Q2M A;  4FF2 A;  3NWG A;  1S59 A;  3GJR B;  4OZ2 A;  4AQY F;  4BC7 A;  2L08 A;  3PIO Q;  3MZI A;  2RDI A;  2IFX A;  4A47 A;  2CPZ A;  3HSD A;  3ZC4 A;  3IFE A;  2CQ3 A;  3T5L A;  2QA2 A;  4H4O A;  4BLG A;  4IR1 A;  1RWN B;  4YDD B;  1HQE B;  2DPI A;  4JV0 A;  2C2Z B;  3MED B;  2KRB A;  3CJ5 A;  2VIC A;  1D0E A;  1VQ4 S;  1JB0 C;  1B64 A;  1XNR J;  4FNI A;  1E6Y A;  3W1Y C;  3V5R A;  1VR6 A;  1WG4 A;  2ZHO A;  3PW7 A;  2BA9 A;  4JI6 F;  5KFI A;  3GON A;  2I1R A;  5KFS A;  4YR0 A;  1IR0 A;  5KFF A;  1NDP A;  2DGV A;  1KBR A;  2EW9 A;  4IYQ A;  2WVF A;  1TP7 A;  2VG7 A;  4DDF A;  3R9L A;  1U48 A;  4DUY J;  4OX9 J;  4WZM A;  3W2V B;  4ZVE A;  2RT3 A;  3ISZ A;  4OZ1 A;  1NJZ A;  2Q43 A;  1BUX A;  2H54 B;  3K5N A;  2ZBP A;  5U47 A;  5DDR C;  1QJH A;  2CZ9 A;  2JX2 A;  4IH6 A;  3G6E S;  3T5J A;  4A46 A;  1V3R A;  2B4O A;  3IG1 B;  4NE9 C;  1VJW A;  2DHS A;  2OI2 A;  3HKZ D;  1XBW A;  2Y0S D;  3BGL A;  4KO0 A;  4BC9 A;  4RKU C;  1HWJ A;  1VQL S;  4A48 A;  4CLT A;  1TFW A;  2KFY A;  3WQP A;  4HLB A;  4DQP A;  1U1N A;  1NM2 A;  1PG5 B;  2FJA B;  3DLE B;  1QY7 A;  1OO0 B;  1RCX B;  2IMO A;  1VGY A;  3IAS 9;  3JYT B;  1RT3 A;  2G0C A;  1V6H A;  2JOQ A;  3VVU A;  5HP1 A;  1WAC A;  3PO4 A;  2XMJ A;  4UT4 A;  1IUJ A;  3HFZ B;  1KC8 T;  4ZLL A;  3U27 A;  5F8G A;  1ZM3 A;  4NXN F;  3FC9 A;  4NXM J;  1JLF B;  1FDN A;  5EWE A;  1T11 A;  2UVU A;  2C2M B;  3DI6 A;  1T9Y A;  2M2B A;  2GZO A;  5C42 B;  1S9F A;  1HNW F;  1HBU B;  3CED A;  2P9C A;  1VRT A;  4Y3C A;  3VHQ A;  4Y2C A;  1TL3 B;  3H90 A;  1SV5 B;  2PI5 A;  1FVQ A;  2RSQ A;  4JOU A;  2J8A A;  5ETQ A;  2DGU A;  4DUT A;  2BAB A;  3EXY A;  3I0R A;  4C97 A;  4G1Q A;  1T9V A;  2HQF A;  3MEK A;  4OZ0 A;  2V9W A;  3KK1 B;  2MLZ A;  4PXD A;  1W7W A;  1YZ7 A;  4QIV A;  4CDI A;  3KLH B;  2D3O 1;  4B3T F;  1GH8 A;  2A10 A;  1XIQ A;  1NME B;  5KFA A;  5GAD U;  1H74 A;  1UZD A;  2VQE F;  3C3L A;  1RYS A;  2PSZ A;  4EZ6 A;  1YJW S;  1KVJ A;  5D8H B;  4DCO B;  2BBE A;  4NA2 A;  3AJ1 A;  4CO0 A;  3QRP A;  4LFB J;  2DKO B;  3HXM A;  4DSK A;  2HWT A;  2GIQ A;  2QC3 A;  3M2R B;  4QW9 A;  2KZZ A;  1JNR B;  4GVB B;  3FSY A;  1S1T B;  1U0S A;  1D8Z A;  1C4C A;  4E98 A;  2MKI A;  4I6Y A;  3CTR A;  3BSO A;  3QT8 A;  2IJF A;  3VF0 B;  1HMV A;  2HVI A;  1LK5 A;  4NEZ A;  3JSM B;  3M6X A;  3T1Y J;  2QLB B;  1ZM2 A;  3M7V A;  3UFC X;  4ZHR B;  2UV8 G;  2E9R X;  2CVE A;  1ACM B;  3H2L A;  3CXC R;  1DTT B;  1CJK A;  4OX8 A;  1S9E A;  5KFK A;  3PAC A;  2IBO A;  4OL8 A;  3OHB A;  1KFD A;  2ZBR A;  3LGN A;  4WYL A;  4RZR A;  3O1L A;  4AUK A;  1NK7 A;  3IBW A;  4NOH A;  2CPH A;  3IR6 B;  4DR5 F;  5JXS A;  1CJU B;  3IWX A;  3ENV A;  3OL8 A;  2J0X A;  3HF5 A;  2BZ2 A;  2MZQ A;  1U6Z A;  2HHU A;  3KNA A;  2B3T B;  2CQC A;  4B02 A;  5C7P A;  1RI7 A;  5A76 A;  1HBN B;  2ZE2 B;  4XDC A;  2MQN A;  1JXL A;  2ZKU A;  1D9A A;  2MKC A;  1SL2 A;  3V6J A;  1SJ3 P;  1PYO B;  2VC0 A;  4OI6 A;  1J5O B;  2XO6 A;  3FMW A;  3ZTR A;  2ACY A;  2RB7 A;  1EAR A;  2R3V A;  2FHO B;  4KT0 C;  3TRG A;  5B08 A;  3VGS A;  5M2U A;  5DQI A;  1SJF A;  1CS4 A;  1RUS A;  1S1X B;  5HAN A;  4J9N A;  4ZVQ B;  3FCW A;  1JXV A;  1WKL A;  3MTJ A;  2VG5 A;  4I2Q B;  4LIR A;  4O4R A;  2YTC A;  1T9T A;  3T1A A;  4F0H A;  3L9Z A;  1I51 B;  2XZW A;  2ZD1 B;  2M5Y A;  2QGF B;  2QTW A;  3C16 A;  1NSK L;  3CJR A;  3DGV A;  4ID5 A;  3KFW X;  5KT7 A;  1N88 A;  2DIU A;  4LRA A;  5IC6 B;  1IXK A;  2OHD A;  4OV6 A;  4J9L A;  3EPG A;  2ALZ A;  3KMQ A;  1LWX A;  2N7C A;  1TUW A;  1L3S A;  1IJE B;  1HQ2 A;  4RUA A;  1HPZ B;  3ZNJ 1;  2HS3 A;  4RWX A;  2F5G A;  4DV3 J;  1NU4 A;  2F63 A;  1HBM A;  1R0A B;  2VBX A;  3S8S A;  4IG3 A;  2NRE A;  1ZM4 A;  1TKX A;  3JQJ A;  2PMZ D;  2F1F A;  2BW7 A;  3CVK A;  3OLA A;  4ZPB A;  2L9N A;  3EZU A;  5D3G B;  2LXF A;  2MDA A;  2YQ3 A;  3CJ3 A;  1VQ9 S;  4J91 A;  4ETZ A;  1REV A;  3CJ0 A;  4KYZ A;  2POK A;  4LBH A;  2V4J A;  1XK8 A;  4PZV A;  1LFW A;  2YNF B;  3AXK A;  4LT6 A;  1JJ4 A;  2DCL A;  5IC4 B;  3CME S;  4CLL A;  3N5F A;  2CZV C;  3PEJ A;  4DR6 F;  1IR1 A;  3ZXW A;  2CWK A;  1FHT A;  1SC3 B;  4M5J A;  1SI9 A;  5F8I A;  1IKW A;  3DLK A;  2CQ4 A;  2QX0 A;  3FJ2 A;  1XMO J;  3OPK A;  2KHD A;  3LP2 A;  3MAA A;  5CA5 A;  1K1Q A;  4ZPD A;  2Y8Y A;  1AFJ A;  1G7C B;  4RW8 A;  2QRR A;  5E0O A;  1S0O A;  2VB6 A;  3PX4 A;  3HT0 A;  4B9U A;  1T8E A;  4AL7 A;  4X65 J;  1KLN A;  3FEY B;  2UUB J;  2N4D A;  4YY3 J;  2AHO B;  2WZ1 A;  3SQO P;  4ED3 A;  3DLB A;  3AT1 B;  1UVN A;  2DY9 A;  4D3G A;  2XC9 A;  5LXY A;  2OIH A;  4C7Q A;  1CJT A;  4USK A;  1LQ9 A;  1RT3 B;  2O3D A;  3N6L A;  3VR1 A;  2OEJ A;  3OL6 A;  1L3V A;  1Q7L B;  4DEZ A;  2DNN A;  4WP9 A;  1S1W B;  2VDH A;  2H9Z A;  1N5Y A;  2JEF A;  4RUH A;  2UZA A;  5L1L A;  1FTR A;  3A8I A;  3VWS A;  3TVZ A;  4U96 A;  2YY3 A;  3EPI A;  2JJ4 D;  2H4W B;  1Q4R A;  2PMW A;  4H4M B;  3RB4 A;  1R0B G;  3NCP A;  2EFG A;  4B3O B;  1OYD A;  3M2V A;  4OI4 A;  2J0W A;  3MPW A;  5KG1 A;  3VZI A;  1RAB B;  1WKK A;  2YVS A;  4CO4 A;  3D4J A;  3OFH A;  4DLE A;  2C28 A;  2YQ1 A;  1F2G A;  3R7N B;  4NZ7 A;  1P27 B;  4E2F B;  1Y5N B;  3M2R A;  2ZJP Q;  3I31 A;  4RBV A;  5A8K A;  4ILM A;  2HNZ B;  3DC2 A;  5K9F A;  3W61 A;  1QDU B;  2OD4 A;  4JUZ A;  4Y00 A;  2GHW A;  1H2T Z;  1FKP B;  1WOR A;  3HHL A;  4X84 A;  1C2P A;  2DNK A;  1FK9 A;  4KPC A;  4PG8 A;  1SH2 A;  2AEM A;  5CYM A;  4LFC J;  3PX0 A;  5C5J A;  4X4T A;  3O3L A;  1RWK B;  4P7T A;  4MK8 A;  3V4M A;  3W9I A;  1S99 A;  4DV0 J;  2VPY B;  1OJ4 A;  4TQS A;  3PO5 A;  2MZR A;  4HL9 A;  3BRE A;  1C1B B;  2PMH A;  2MPU A;  4WIQ A;  2GJF A;  1PJ5 A;  2ZDP A;  2VKZ G;  2HFN A;  5F3T A;  5FII A;  4O3P A;  4DV4 F;  4N76 A;  2AJQ A;  2V9K A;  2YKA A;  4F0K A;  3DI6 B;  2EPI A;  4CLU A;  1RLD A;  4MFB B;  5L46 A;  3OTB A;  4CNZ A;  1VLY A;  2HSE B;  1VC6 A;  2QA1 A;  3C6U B;  3IRW P;  4OJG A;  4I2P B;  3HVT A;  5C24 A;  2VQF J;  3BPD A;  2O01 C;  3OXF A;  4MT1 A;  2ZOG A;  2KM8 C;  3KG0 A;  1RT6 B;  4B3M F;  1Q1K A;  4CRJ A;  2QN6 B;  3TVK A;  4YUD A;  1VRU B;  2DB1 A;  2RQ4 A;  4N8O A;  2R2U A;  4AL6 A;  2XLK A;  2B7C B;  3CCV S;  4JI2 J;  2E1R A;  2F40 A;  4M5K A;  3SDE B;  3B82 A;  3CMQ A;  3G4S S;  1U26 A;  5H1S V;  1O5J A;  3QWP A;  4MH8 A;  4I2P A;  5C24 B;  5IM0 B;  2B43 A;  3MM9 B;  3SI8 A;  2RS2 A;  1R27 B;  4N41 A;  3GSD A;  2HZA A;  4QIF A;  3BO2 A;  2E1C A;  3PJX A;  4QU7 A;  3OTD A;  2PT0 A;  2FPH X;  1GMV A;  2IDL A;  4WKY A;  5KFH A;  1NSA A;  3DU5 A;  1F3V A;  4DG1 B;  4DR2 F;  3Q8U A;  2L41 A;  3IAM 9;  1VDH A;  2BX6 A;  3QO9 A;  1GMW D;  3M30 A;  3GV7 B;  1UPM B;  4WTY A;  4IG3 B;  5B0F A;  3GFY A;  5K8O A;  1FCA A;  2Y0B B;  4Q5V A;  2G2O A;  4J90 A;  4NLR A;  4V1A k;  2FLN A;  3TUP A;  1B4S A;  4WFZ A;  3EX7 B;  1UJ5 A;  2KL8 A;  3ZTS A;  2HBR B;  2ZH4 A;  2NZC A;  3ZZT A;  1H2U X;  1BY9 A;  2B8Q A;  1S12 A;  5HJX A;  2FYX A;  3L7O A;  4OQJ A;  3W2W B;  2AX1 A;  3V6D B;  4WFX A;  3FZ2 A;  4CP5 A;  5LMU F;  3H42 A;  3QT6 A;  2DRB A;  2YNH B;  4IFV A;  1DTQ B;  5ETP A;  4PR6 A;  1K0T A;  1ZM9 A;  4AD6 A;  2LQ8 A;  3LAK A;  2E7W A;  3GJQ B;  3OFG A;  2R2S A;  2HW3 A;  1XJW B;  5ETN A;  1U1O A;  1AB8 A;  3R2D J;  2FZC B;  2V4R A;  2XWX A;  4LF1 A;  4RW8 B;  1WTF A;  3GR1 A;  5EGY A;  2R7Q A;  3W65 A;  2IIH A;  5F8N A;  2OSQ A;  3TWZ A;  1HNV A;  2RML A;  4A8Q A;  2WBM A;  5F0U A;  1NDL A;  1SH3 A;  3AB4 B;  3QIP A;  3U02 A;  2FQQ B;  2HHP A;  4ILL A;  1BMQ B;  1RTJ B;  4NLW A;  1RAA B;  4G6V B;  4JI8 F;  5LM7 E;  1MN7 A;  2N7Y A;  4BWJ A;  3HHL D;  2HHV A;  4OZ5 A;  3DHW C;  1T0T V;  3QAE A;  1M5O C;  3GYX B;  2AEF A;  3CDU A;  3ZTP A;  2AKW B;  2RNE A;  2D9P A;  1Y3K A;  1RWW B;  2RUG A;  3MCM A;  1FRI A;  1M5V C;  1G4C A;  1NCL A;  1NK0 A;  1IBL J;  3ISN C;  7FDR A;  3GP9 A;  4OZN A;  2PGC A;  4X66 F;  3WIV A;  2MY7 A;  3LAN A;  2KU7 A;  4N77 A;  4WK3 A;  4LFC F;  4YB1 P;  3DRP B;  3Q86 A;  5FLX Y;  3EGV A;  2FHJ D;  3JSM A;  2K3K A;  3TX0 A;  4ELU A;  3DXB A;  2HEK A;  3UVJ A;  1RTD A;  1VQ6 S;  3FK4 A;  1K73 T;  2YX7 A;  2B9Y A;  2DHG A;  3I5A A;  1NB7 A;  1ZPW X;  2J9D E;  3CCL S;  3G87 A;  5D4L A;  3GU0 A;  1OIA A;  3A12 A;  5F8M A;  1MW7 A;  1OQ6 A;  3OD2 A;  3CDA A;  4NRU A;  4LF5 F;  5IWA F;  3BZQ A;  4OYX A;  3EIC A;  4MKA A;  4USM A;  2HVH A;  2GVZ A;  1UEV A;  3HHE A;  4JI4 F;  4OI0 A;  3CO9 A;  1X31 C;  5KFU A;  2C3M A;  4IH5 A; 
#chains in the Genus database with same CATH homology
 4CLK A;  1CJU B;  3C14 B;  4P2X A;  1CS4 B;  1U0H B;  4WP3 A;  1Y11 A;  4CLU A;  3ET6 B;  3MAA B;  4OZ3 A;  4CLZ A;  4OZ2 A;  1CJT B;  4USW A;  5D0R A;  1YBU A;  4CLW A;  1CS4 A;  3ET6 A;  3UVJ B;  2GVD A;  4OYB A;  3C16 A;  5D0G A;  1CUL B;  5IV4 A;  3G82 B;  4CLF A;  4CM0 A;  5IV3 A;  1WC0 A;  1TL7 A;  4P2F A;  1FX2 A;  3C16 B;  4OYA A;  4P2M A;  4OYZ A;  1CJV B;  3C15 A;  4CLP A;  1CJK B;  1Y10 A;  2GVZ B;  1TL7 B;  2BW7 A;  1YK9 A;  2QV6 A;  4NI2 A;  3MR7 A;  3C14 A;  4CLT A;  4USV A;  4OYO A;  4CLL A;  5D0E A;  4NI2 B;  1AZS A;  4OYP A;  1AZS B;  4UST A;  1CJV A;  1U0H A;  4WPA A;  1AB8 A;  3MAA A;  1FX4 A;  4OYW A;  1WC5 A;  2WZ1 A;  1WC3 A;  5D0H A;  4USU A;  1CJT A;  1WC4 A;  4WP8 A;  5D15 A;  4WP9 A;  1CJU A;  1WC1 A;  1YBT A;  4CLS A;  4OYI A;  1WC6 A;  3G82 A;  4CM2 A;  3C15 B;  2W01 A;  3UVJ A;  4OYM A;  4CLY A;  4OYX A;  3R5G A;  1CJK A;  2GVZ A;  2GVD B;  1CUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...