3C14B

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and ca
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
189
Chain Sequence
HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase type 5
publication title Structural basis for inhibition of mammalian adenylyl cyclase by calcium.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase inhibitor
total genus 53
structure length 189
sequence length 199
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3c14B00
3C16A 3MAAA 5D0HA 5IV4A 3C15A 4OYPA 4CLSA 4CM0A 3G82B 4USVA 3C14B 3ET6B 1WC0A 4OYOA 1TL7B 4NI2B 1CULA 1CS4A 1FX4A 4WPAA 3MR7A 4CLUA 4CLTA 1AZSA 4CLPA 4CLKA 4CLWA 1CJUB 3UVJA 2GVDA 3C15B 2GVZA 5D0RA 1FX2A 4WP8A 4OYWA 4OYBA 2QV6A 4CLFA 1CJKB 1CULB 1CS4B 4OZ2A 1AB8A 4CLYA 1WC4A 1U0HB 1AZSB 4CLLA 4WP3A 4WP9A 1CJVB 1YK9A 2WZ1A 3G82A 3R5GA 4OZ3A 4USUA 3C16B 5D0GA 3MAAB 4OYIA 4CLZA 1TL7A 4P2XA 2GVZB 1YBTA 5IV3A 1CJTA 4P2MA 4OYAA 5D0EA 4USWA 1WC3A 1WC1A 1CJUA 4USTA 4P2FA 4OYXA 1WC6A 2W01A 1YBUA 3C14A 3ET6A 2BW7A 5D15A 3UVJB 2GVDB 4NI2A 1Y10A 4OYMA 1CJKA 4OYZA 4CM2A 1CJTB 1U0HA 1WC5A 1CJVA 1Y11A
chains in the Genus database with same CATH superfamily
3DGPA 3QT7A 4YMEA 2ZZTA 2AQ4A 1FX4A 1IR0A 4AL6A 4FS1A 3MR7A 2YNGB 1NKBA 1PAEX 4C0BA 1HFEL 2UXDF 3MR2A 3OFHA 3MI7X 4A46A 4N7TA 4A47A 3PO5A 5IT9U 3DYAB 3B82A 4MKAA 1U7LA 2BRLA 3MCSA 3D6MB 3OVBA 1LK5A 1FHTA 3GCWP 4DCJB 2W2OP 2I38A 4RW4A 1U24A 3AOBA 3PYGA 5KG6A 1HWKA 3KLGA 1WHVA 5KFLA 4GKJF 4CLLA 4M8LA 2DH8A 1AA1B 2E5LJ 2GMLA 3AD7C 4IQXA 3AY0A 1WKKA 4XDCA 4OI4A 3PV8A 2N82B 5D3GA 5K8OA 3D4JA 4FYVB 3BQ0A 5E7OB 2B0GA 4DS4A 1IBMJ 2IFXA 2CYYA 3EVMA 4B9VA 3CJ3A 1ZETA 3ET6A 3NAHA 2ZZNA 3NBPB 1TV6A 3IN5A 5KFGA 2L9NA 2NXEA 5B0AA 4ALZA 3TI0A 4IRKA 1SJ1A 2X1BA 4ZITA 4KPCA 2NYHA 1A7GE 1R8AA 1R6VA 1U1KA 4ZPAA 2AX1A 1FXDA 2GS8A 2FJVA 3BO2A 1WSVA 3KDOA 1S6OA 1ZM2A 1LW0A 2DNRA 2NPIA 1TVRB 1JXLA 1X4EA 3W5XA 1RISA 1F9HA 3M32A 2DTJA 2B6AB 1OY8A 1CPZA 5GAEU 3UN3A 1HNXF 2IVFB 4Q2MA 3IXQA 4ZVEA 2XHWA 5DM6Q 3Q86A 5A0YA 1U02A 2GIFA 4HH1A 1N36F 4OZ3A 3R8YA 1QLNA 4XTTA 3L3CA 4DI6A 2RSQA 2YNHB 3JAMY 2RAQA 4FDFA 2HVHA 4C48A 2UXDJ 2XCPA 2W9CA 1UVKA 1WI8A 1AUSL 1UKUA 3CGIA 3SSSA 2HHWA 4NRTA 3A3PB 4RBTA 4DUZF 2BE2B 1TUWA 2FJEB 3KHHA 1NSPA 4RL1A 4OI3A 3C15A 4GKJJ 2GJ2A 2C42A 6FD1A 1Q53A 3CC2S 4TQRA 2PE8A 2ZJPQ 3JSYA 4ZLNA 2K3KA 5D77A 3P49B 2GO8A 2WCXA 4BLGA 3QT6A 1TFYA 1Y5IB 2DGWA 3UR3C 1Y5LB 3E8OA 3GLJA 2DIVA 3M30B 4X62F 4ERDA 5DDPC 4FF1A 1UWBB 2POKA 3IMQJ 2IHR1 4W92B 3TA0A 3KUGA 2X7IA 2J76E 3DLJA 1UFLA 2AEFA 1KOHA 2FLNA 4FVCA 1HBUB 3M8PB 4MKVA 1NK7A 2C2KB 2R8GA 3GE9A 1X8DA 2OH2A 3P45B 3QBCA 4ZA1A 4XDDA 2E29A 1FWKA 2ILZA 3IG1B 4ZP8A 4KRWA 4F4ZA 3J7YU 3L7UA 2Q6CA 1PJ6A 2XYPB 4ZS6A 2V9KA 2CWKA 1JLFA 1IKXA 3PW4A 2SXLA 4U8VA 1Z2LA 4NZ6A 4ZLLA 1XMOF 2FHMA 3WX4A 3ITHA 2ZUAA 1HBNB 1KLMB 1N36J 1RWWB 1JMTA 1O5JA 3GFZA 3H2UB 1HW9A 1V5VA 3SCJE 3CCLS 1HQUA 4URQU 2ZH9A 3R1HA 2KYXA 3PIPQ 4KV8A 1OMSA 1GAOA 3H5XA 1XN9A 5C5JA 2OGUA 3GV7B 1VQ5S 4C8YA 3K7RA 4O3PA 2A0FB 1Q81T 2Y1IA 1XMQF 3M8QA 2GIQA 2LXIA 4J9RA 4CLYA 4JI2F 4DUZJ 4NCAA 5A8KB 4UTGA 5JVHQ 4LVOP 5DLFA 6FDRA 2GV1A 1XNQF 1U1PA 4NLVA 4BC7A 2ATLA 1QSSA 3KXDA 1TP7A 3KJVB 1LOUA 3E51A 3R6GB 4Z37A 5K8NA 2ZDPA 4ZOSA 2QSFA 1T3NA 4DSKA 2ZFHA 5E3RA 1FDBA 4V19J 1S6UA 2YKMB 1FTRA 2V2KA 2ZBRA 1MROA 3UNGC 1DTQA 1IBCB 2GA7A 1IKVB 2JFKA 1JLBA 3MFHA 2JC1A 2JEGA 4NE9C 1KONA 2CJXB 1Q16B 4DU8A 2D9PA 3MOJB 3UE2A 1HL6A 3G6YA 1F2GA 2MB0B 2IIHA 1HHQA 2ZNZA 4N77A 4HDHA 3G2XA 3Q22A 5HBMA 3J80U 3OLAA 3MR3A 1H73A 3SV3A 4L6V3 4OZJA 3TNVA 2KG1A 1EP4A 3CDBA 4DR5F 4ECRA 1RA6A 1UJ6A 2E44A 4R0EA 4AL7A 3DLKB 1IR2A 5JVGQ 1KD1T 1XMOJ 4MT1A 2AT1B 5KFZA 3QGGA 3TUJC 4QOTA 1VRTB 2XSFA 3CCWA 3BS9A 1FD8A 4ZCKA 2VICA 1PGZA 2BQ3A 4F4WA 4U96A 2C2MB 5CQGA 1S1VA 1XMQJ 4TKTA 2DGXA 1HNVA 3CEDA 4JI2J 3AB4B 2HGMA 1X60A 1RT3B 2RF2A 5I3UA 5I42B 2O1PA 3BBBA 1XNQJ 1NEEA 2UXCF 2PA3A 5B08A 1WKLA 5DDOC 3VCDA 1NAQA 2FJXA 5C7PA 2VC0A 5LM7E 2V67A 1RU1A 3CJTA 2ZKUA 4YB6A 5DZ6A 3OJSA 2QSWA 2XMUA 2XYGB 2D3OR 2LU2A 2XM3A 4LFAF 2H5EA 1Q0NA 3C6TA 2MQ8A 4B3SF 2MKKA 4NCGB 2W24A 3E01A 2W7OA 3E2EA 3NNAA 3KLEB 1DAXA 2V9WA 3CCRS 1BY9A 2BM0A 4M5GA 1M5PC 2VFUA 1LV5A 1WOPA 2GGPA 1RWUA 4ECQA 3PACA 1CQMA 2HRUA 4DR1J 1K0TA 3H4DA 5BYSA 3ISNC 4RU2A 2OIHA 2E1PA 3THPA 3DN9A 2NZCA 2RS8A 1EJ7L 2QMXA 3C6UB 5C42B 2VF3A 1R8CA 2FQQB 4CLKA 3UR0A 5B7WA 5T7LB 5E0OA 4L3NA 4ES1A 5E3CA 3FCHA 3W63A 5HROA 2QMUB 2GQCA 3JSRA 4RR5A 1XWLA 3FGVA 3RW7A 1PIEA 4O3NA 2E9RX 1LWFA 1LWXA 3LUYA 2QFJA 4ICLA 4UZBA 3H2VE 1REVB 1IR1A 3MCNA 4NMXA 4OZ1A 4EGLA 1X4CA 3UW1A 2UXCJ 2DKOB 3D1QA 2BJDA 3VGVA 3K5LA 1IJFB 3CJSA 1B70B 2W4DA 2OMLA 2B8PA 3GWCA 4FBTA 1RT1A 4J9PA 4DFMA 1IBKF 4E8UA 1JJCB 3ZNJ1 4LFAJ 3N6LA 3DC2A 1S1TA 2IDEA 1DY3A 1TZ0A 2I5JB 1IKYB 5MAOA 1K9MT 2Z2MA 1S72S 4NXMF 4UY85 3NMRA 1FXRA 1F5AA 5DZ7A 4H4KC 1C1BB 3HF5A 3G6ES 2VB6A 2D3O1 2F9DA 2VDHA 4MKBA 3BO3A 4RW7B 2OTLS 1ELOA 4DPUA 4DFKA 4FYDA 3MOZA 3UN5A 1VQ8S 3HFVA 1D3WA 3CCMS 1T7PA 2XYHB 1JKHA 2XCAA 2JFDA 3KHRA 2YBVA 3AA9A 1FWPA 2XZDB 4I2PB 4I6YA 4PQUA 1NU4A 3PRBA 5E2QA 1K1SA 4DUTA 3CXCR 3ETOA 1D8ZA 4OV6A 4DQRA 3V6HA 1RU2A 1HQEA 3TJAA 3K57A 2OHDA 4KFBB 4V1Ak 1RT7A 2WSCC 2ILYA 4UW2A 5FDLB 3F0NA 3PEHA 1O51A 2DD8S 4OLOA 5KFFA 1WKJA 2KO1A 3FSXA 1RTDB 1WNEA 1XC9A 1ZYQA 3G8TA 4IG0A 3RBEA 2DGQA 4MMOA 5H9EK 2ZH2A 3DLGB 2QMWA 4IOBA 5GMKa 5KFKA 3W64A 3LANA 2HHHF 5ETKA 4EI2A 1RWPB 3FRZA 3NS7B 3K5MA 1RWVB 1D9AA 2HBYB 2DHXA 2QL5B 1YITS 2BMBA 4OHXA 4YDXA 3DOMB 2YNGA 2ZBCA 1CEZA 2IM0A 3NAIA 2XS7A 4ZPTR 2AV5A 3TA2A 4OZ5A 1TFWA 1RT4B 1H7XA 1X4BA 3T19A 1RGVA 1JX4A 3NGTA 4NXMJ 4X4PA 3TJ8A 2XQCA 2Z0GA 4ZPVR 2RUGA 2E9TA 4LFBF 3GCXP 2RRAA 1Y10A 2J6SA 3BB5A 1UVJA 2KT3A 3ONQA 2LEBA 1VRQC 4TQSA 1TKDA 1TAUA 1XTZA 3MZIA 1FE0A 2DGVA 9ATCB 1AUDA 4BC9A 4XPEA 4J9MA 3DGVA 2CPZA 1RLDA 2ZWPA 4CNYA 2VBZA 4HTJA 3RB4A 1FRHA 3GPAA 3CMQA 1SI9A 3P8BB 3MEGB 3DXSX 3KTQA 1FRLA 2WRMA 4GVBA 2IYGA 2KVIA 5ETTA 4NCBA 4CTAB 4DHVA 3CIZA 1N34F 2Z30B 2DRAA 2PEBA 3MEEB 4C8MA 4J5OA 4MFBB 1U0HB 4QIFA 1ZBTA 4OHWA 3DU5A 2CZ4A 4G1QB 3FFIA 3EYZA 4EBDA 3IC1A 4WF9Q 3EZ5A 1T05B 4FVMA 1TVRA 4ZVQB 4A8YA 1RBOB 4JI6F 1FEEA 2RRBA 4K2JA 1TK5A 4YP3A 2HNDB 2XO7A 2VH7A 2LQ5A 3VV2B 4F36A 1WTBA 1P6TA 3T5JA 3UPFA 3H98A 4BDPA 3PZPA 4DV0F 2HHHJ 2EXUA 3EPIA 4K8RA 5HMXA 2B9XA 3T9NA 2Y1RI 1VQ9S 2YNHA 2R9LA 4EEYA 4BWMA 1GX6A 1NM2A 1KWMA 1VBXA 2WAQD 2IM1A 1RABB 4FPIA 1C0UA 4JI1J 1XQIA 4OI0A 3QMQA 1YRTA 1FE4A 1Q78A 2H48B 3CJ5A 5IOLA 2R2RA 2BE2A 4LFBJ 3CCQS 5KT5A 3D54A 2VKRA 3PJ9A 4QWEA 4M5MA 3V6DA 1VC6A 2CJYB 2RQMA 1KQKA 4I64A 1FDAA 2BV3A 2XMMA 4Y34A 2FVCA 3P96A 5FLXY 4UOCA 4H4MB 1S57A 2EC0A 5E5NA 3EXCX 2MKCA 2Y8WA 4ECSA 3HZEA 4DQIA 3NGKA 2F65A 3KMQA 2R2UA 4K59A 3B54A 3M30A 2DR7A 1IJEB 2B4VA 5G4DA 4A8XA 3LGHA 1UWBA 1RYSA 1NJZA 1Q8KA 3GV5B 3KLHA 3DRRA 3SSQA 3FVYA 1HBUA 3UCUP 3P5TL 3MURP 1FRXA 3FQLA 1U2FA 4TY8B 4P52A 3D0GE 4PABA 2DCUB 1FD2A 2RT3A 4RUCA 4WFNQ 4JI6J 1U1RA 1X5SA 2DNZA 2IJNA 3CWJA 3OTCA 3V5RA 5A8RB 1RP5A 3D6TB 5KG4A 4ZPDA 2G2OA 2DPIA 2K8GA 4DV0J 3A8IA 4U7UK 2P6TA 1KLMA 4DMZA 2DVIA 3UDEA 2RJZA 3JSBA 4RBVA 4JI7F 3M4XA 2HVZA 3KLFA 2MHNA 4K4WA 3CB4A 2Q66A 1VBZA 1ZAWA 4FKXA 4B3TF 4H4OB 3U27A 3NGUA 2O67A 5J2QB 4NL5A 3UDCA 5CZXA 4QIWD 2HQ3A 1X9MA 3LF0A 2BEFA 3F73A 4JV5F 3PNIA 1F1BB 4WE1B 2VIHA 1F5BA 3VALA 4ED8A 4DWIA 2V34A 1KTQA 2CRLA 3BPSP 2BA9A 2XMKA 1CJUB 3RBZA 4M5DB 4HI2A 1OPIA 2R7TA 4DPTA 5DG9A 5HI7A 4FPRA 1IKVA 1EZZB 4KY3A 5CAAA 2E5HA 3IM8A 1X4DA 4M5IA 2YKOA 1E6YB 5ETVA 2IMOA 2GVZB 2W9BB 3EPGA 2FVPA 5C25A 2RIJA 3CJ2A 4N5SA 3R6LB 2CPXA 2VG5A 2DEJA 4ILRA 1O6XA 1XBWA 3JTNA 4KTQA 1QE1B 4V19X 1ACMB 2XI3A 5LOQA 5AXNA 3Q8QB 4OHVA 4KSEB 1EKSA 3TVZA 4YB5A 4PYAA 4WJBA 4HEA9 2R3VA 3N4WA 3OL6A 3PJXA 2GNKA 2XB2D 5F8NA 3MD3A 2C2DA 2VBYA 1JK9B 2EPIA 3M6UA 5F8HA 1MMDA 3HHKA 4EMDA 4CYUB 3H90A 3GJTB 4JI7J 3AHPA 1TL5A 3PHTA 1TKTB 4IO9Q 4QYZJ 1DQ8A 3DDIA 3BO4A 2HNZB 3ILIA 2O01C 4B3TJ 2JRSA 1N56A 4CLZA 5I42A 5F8LA 5GADI 2E9ZA 3BKTA 1S77D 1FO1A 4DL4A 4M5LA 2B43A 3MECB 1OJ4A 2B56A 4JV5J 4PWDB 1KLNA 3JB9k 3V4IA 4QR1A 3FNNA 4KJIA 1KRPA 3HJFA 2CPEA 3EE3A 2J9DE 3HSDA 5KT4A 1B3TA 4EUVA 2D69A 1WC5A 1WOSA 1QAJA 3GILA 2WSFC 2W9AA 1WF0A 3KLEA 4CLTA 1KVKA 1CBKA 1C2PA 5DGAA 2M8DB 5KFDA 3MM6B 4B3RJ 3HULA 4USJC 3GJQB 3I31A 3UD3P 3G9CA 3CD5A 4LUBA 1UVIA 4J9QA 3CT9A 4R8UB 1SL0A 2BANB 3J81U 2EBGA 3CCUS 2I2YA 4WIIA 1AYEA 3KK1B 1KVJA 4HI1A 2HZCA 2KVQE 2QFIA 2KZMA 3BEGB 5D8HB 5FJ4A 4JV1A 3HT3A 5C42A 3H7HB 1K1QA 1TKXB 4ZP6A 1ZZFA 4TU8A 2QEXS 4OYXA 2LXFA 1VISA 3GR1A 3IAS9 4JI0F 4USMA 5I3PA 4H4KA 4K4ZA 4IG3A 2GX8A 3PXGa 4HR2A 2DRDA 2ZHOA 3BR8A 1EETB 4O3OA 4OZ0A 2RDJA 4CM0A 1M1KT 3W9IA 1REVA 3I0RB 1CS4A 2IYIA 5KFVA 3L95X 2ZC4A 3SSRA 3MPUB 4LRFA 1Q8IA 5KTQA 1RSCA 1FESA 2NS1B 4QW9A 2GW8A 4J9NA 4W90B 1RYRA 2ATCB 3SCLE 2JVOA 4LF8F 2Q79A 4CP5A 1RLCL 4P74A 1FNMA 3VVTA 2XY5A 4OX8A 3CJKA 3RZAA 4IFVB 1XR6A 5J1PA 3TYTA 3ZZZA 2MZ1A 3B78A 4ANDA 1C1BA 2CQHA 4U95A 2HHUA 3D6HB 2W01A 3CCVS 2DHSA 4DL2A 1T9XA 1U2RA 1L5UA 4PEOA 4ELUA 2C2EA 3IWLA 4KPYA 3RB3A 3FEXB 4Y3CA 4ZIWA 2FTRA 3TO8A 1HBOA 2M2BA 2RQ4A 1Q7YT 2KHDA 8RUCA 3G82B 2B7BB 4I2PA 2MYFA 1AROP 3GV8B 1YQHA 1M1HA 2EEYA 4X4VA 4B9MA 1WUUA 1IUJA 4RNHA 2JVRA 4DL0C 2X51A 1VMBA 5DQIA 2G9OA 4C0HA 1IKWB 1FVQA 2FHJA 2QC3A 1P1TA 4KFBA 2WVFA 2EFNA 2CNOB 1AZSB 3KUEA 3CD6S 3BBFA 3THVA 3B4DA 4GO5X 1FCAA 2W4CA 4ID5B 4FF2A 2XLKA 1Y0HA 2FDNA 2D7SA 3WZ0A 1I1GA 3BGOP 2KL8A 1M5OC 4NASA 1RTDA 2ZD1B 2M8HA 1F9EB 1FFGB 3OR1B 2HWTA 1RE1B 4F7VA 2G2ZA 2DIUA 3DLGA 4RW6A 4DSEA 5A8WB 3UVJB 4DL6A 3PO4A 2HKEA 3OW2R 3F41A 2HAIA 4ENOA 1D0EA 5DLGA 2ROEA 4I1TA 3DHWC 2MY7A 1HA1A 3BSCA 3L7OA 5KFIA 2ACYA 3FBEA 4F67A 4LF8J 4EBEA 3DOMA 4AXJA 2KXHA 2NXCA 2H4WB 3CPWR 3IRXA 4IH6A 1RT4A 3TP2A 2AD9A 4GKKF 2DO0A 3R1LA 2G2YA 2G13A 3R7SB 3SCIE 2DPJA 3CW2C 2QV6A 2COLA 4F3QA 3MM5A 2HG4A 4RU9A 5L9XA 2HIQA 3KKFA 2PI5A 3DMJA 2BM1A 2XLIA 1SKRA 4AT1B 1WD6A 1PYOB 2F8HA 3QGPA 3HHDA 4LT6A 3OVAA 2DO4A 4X66F 4DV4F 2H65B 4GC6A 3IR5B 2W8LA 2XSJA 4PZVA 4K4SA 4NLYA 3NCRA 4NA3A 1LXJA 3QIPB 4F3OA 3MEEA 4IOCQ 2JLFA 3I56S 1UCNA 1U0HA 1Y00A 4G1QA 1CC7A 4KBIA 2CXEA 2HBRB 3O5TB 4CT9A 1WWHA 3I55S 1PILA 4LF5F 3GQCA 2MMYA 3M9MB 1QSYA 1OYEA 3MMJA 1HMVA 2HNDA 4PXCA 1S4FA 1T95A 3ZZYA 2DR9A 2M0GB 3DGPB 4TYAA 3OXGA 1X7VA 3HHNB 1VFJA 1VS3A 3V81A 3ENQA 1P1LA 3FUYA 4LSNA 1S99A 3CO9A 2K3IA 2H5JB 5IXUA 4P7VA 3MF5A 2J9DA 2R4FA 2AZ1A 3B8HA 2HIYA 2G1HA 1RT6B 4DS5A 1S7IA 3ISZA 4OX9F 4RW4B 1S49A 3ADAC 3GMGA 5KFTA 1WC3A 1PYTA 1WC6A 3FQKA 3DFEA 2XGPA 3BH6B 5HJXA 2IA6A 1SBRA 1NZAA 2E5GA 3I4HX 5D3GB 1Q8BA 1YKWA 4IDKA 3I4PA 2J9EA 5CZVA 5CYQB 2C3OA 4L72B 3HCXA 3CJ0A 3ET6B 2RU9A 1B0PA 4H4MA 1TV6B 1WJ9A 3QT8A 1NJIT 2WB4A 1RWKB 3J80Y 3PYDA 4DSIA 2CPIA 4X66J 4DV4J 3H5SA 1TL1A 4B08A 1V9OA 2YNIA 5KT3A 1SJ4P 2MKHA 3PG9A 2XEXA 5L9NA 5J1EA 3QZ7A 4A8SA 1S59A 2UVVA 1LW0B 2WHOA 1X0PA 3PX6A 2QG9B 4I6WA 1N5SA 3VF0B 4JUZA 1H2UX 2QA1A 3M32B 3RYLA 4FP9A 4YUDA 2QLJB 4NLOA 5FIIA 2B9YA 2E5JA 3GG0A 3OD2A 5G0RB 1F60B 4OI1A 1X5PA 3H0PA 4NX9A 2IM2A 1H7WA 2FIUA 2IVMA 5I4MA 5A0YB 2BOAA 4LF5J 4LIWA 2LP4A 4HACB 2RU3A 1S1XB 2GHWA 3R2CJ 1L3UA 4B02A 2CQ1A 2XHCA 1L3KA 1CC8A 2BOPA 2OD4A 3O8WA 3CDUA 4ZPBA 2DJWA 3AD9C 3CTRA 2FLLA 4Y0FA 1JIHA 2W9CB 4ECVA 1ZA2B 3ETMA 1IM6A 3R2DJ 4TU7A 2ZM6J 4DR6F 3ZZOA 1WHWA 2QGFB 4BHQA 2QO3A 1N88A 4OX9J 3G87A 5HATA 4QJVA 1W7WA 3C15B 5ADZA 1YJ9S 2VG7A 3MM7B 4F0MA 2UUAF 4IYQA 3DM2A 1FJGF 3TAPA 4OZ2A 4AQYF 5AE2A 3A12A 4R5PB 2WBMA 1MSWD 5HAOA 5J2QA 4M63A 1JLEB 1U0SA 1V6HA 1WDTA 3P6YC 4WE1A 1Q95G 5F41A 1R31A 2M88A 2C3PA 3OFFA 5KFOA 4OJ1A 1CJUA 3FRYA 2X3DA 4M5DA 4OI2A 3W9HA 5ETQA 1B4SA 1KVIA 3HT0A 4KH0B 4P6QA 4LRBA 2BXJA 4LREA 1OSCA 4HYKA 1E6YA 3V4MA 2N7YA 1M5VC 2IC3A 2GMHA 5KT2A 2ALYB 5F8GA 2KKHA 3IR6B 4OYPA 2FLPA 4EZ6A 2NUHA 1U1QA 4JB8B 4I2QB 1X4HA 4K50A 3GJSB 5T41A 2F5GA 3WHIA 1GXUA 2XO6A 4R0JA 3TQ1A 2GFFA 4KGXB 1JLFB 1IKXB 1Y9OA 7FD1A 4ZHRB 2WW8A 1EX8A 2NR0A 5BJRA 4F4KA 2L9WA 3NNHA 4TLQA 3NY0A 2ABYA 3N0VA 2RILA 2DXDA 4OHZA 1Y7PA 2MQPA 2MZTA 4AL5A 5HANA 1HQUB 2Z2ZA 5HMYA 2BJ8A 1T9VA 4Y28C 1A6LA 1ZTTA 4Y2CA 5D4LA 2ZOFA 3CCJS 5B0CA 4DZ6A 3TVKA 1AT1B 2NSCA 1DHMA 4CYUA 5DO2A 1HI1A 2YWHA 2ZKTA 4P75A 3W2VB 4TY9A 3M8ZA 1VOMA 2UUAJ 1FJGJ 4L74A 3MEDB 3ZC4A 1GNKA 1NHVA 5IQ6A 4AQYJ 1FJEB 1HIYA 4RKUC 1UMJA 3QFHA 1VQ7S 2OPQA 1WSRA 1RTIB 2RH3A 3OJUA 4OJ3A 3MECA 2BRKA 2HHPA 1MROB 4PWDA 4QIVA 4F02A 1U26A 1BUXA 1Q5VA 3R27A 1G2EA 1FK9A 3FEYB 4HTIA 1GMWD 1TTHB 4JOUA 2W25A 4ECYA 1X4AA 1XR7A 5GAHI 2JC0A 2P9EA 2CNNB 3M2UB 1HWUA 1MN9A 5AXKA 2PMZD 2PFFB 5HBMB 5AE1A 3L4BC 2OJ3A 4YDDB 2CJ9A 5DM7Q 3MM6A 3NKYA 3TOQA 1EP4B 1LEOA 4O44B 3N5BA 4NXNF 1NKEA 1ZM9A 2A6OA 2J7UA 2HFZA 3C14A 4I67A 4FBUA 3M6WA 5B0FA 4QR0A 5GMDA 3ENVA 1APSA 2W8KA 2BANA 1YJUA 2MQQA 2PN6A 4LQ3A 2QA4G 2OO4A 3KK1A 3KG4A 4CLSA 3QRRA 4Q0BB 2F63A 2V4JB 3JSMB 2BE9B 3CCTA 3W5ZA 1TKXA 3HK2A 2A2CA 4CLUA 4ETXA 4R25A 2FZCB 5BYQA 2D41A 4ZVPB 3T41A 5E3AA 2CPYA 2V63A 1KKHA 2ZWOA 3TUIC 1U1NA 4P73A 5C24B 2DH7A 4DXLA 5KFWA 1MU2A 1ZZNA 1RAIB 1VQNS 4WFYA 3K8VA 3WDOA 2HK2A 4DV1F 5KG2A 4YY3F 4ECWA 2HWIA 3DLEB 3C6TB 2CQ4A 5K8PA 1VHIA 5B0EA 5D15A 2GVDB 3E01B 1C1CB 3IM9A 1M5KC 2ZNYA 2HVIA 1C4CA 2IBOA 4DLEA 3TZWA 3BGRB 2B8QA 4KGMA 3T1AA 2VU5A 3D5MA 4IFVA 2AMCB 5KFBA 2HHSA 1U6BA 1Q86T 3C3LA 1LNQA 5CA5A 4ZVUB 4QIGA 3OUYB 3OFEA 4CH0S 1FRKA 2IMWP 2BBEA 3PFOA 5E3QA 1S9EB 1HNZF 2HRTA 3I32A 3VZIA 1URNA 1R27B 1C0TA 1S9GA 1UA1A 3MPYA 2DNLA 5HK4A 3GYXB 1ULRA 2CQ2A 4C6AA 2HS0A 1N33J 2CQPA 3GIKA 1YTYA 2MSSA 3PYFA 2A1BA 1S7HA 2HBQB 3HVRA 2RMLA 3G82A 4QQBA 3VAFA 1YDLA 2YPZA 1W2BR 1JXVA 3MCOA 2R7WA 2EWHA 3JQKA 2HQFA 4LJMA 5M2RA 5ETNA 3NCPA 2DNMA 3JXOA 2H54B 3FJ2A 2CNKB 4ZDNA 2V4QA 1PC4A 4DR3F 1VYAA 2Y3YA 3VAGA 3UI3A 5GAGU 1SXLA 4G65A 4UUXA 1IKWA 1H38A 2VODA 5J1NA 3RBXA 3IGVA 2DCLA 4ICLB 4OV1A 1UVLA 2EK1A 1SUQB 2XTJP 4TXSA 3FCWA 1DRZA 4ID5A 4CH7A 2VHGA 1RHKB 5H9FK 5CABA 2P9CA 2BYCA 3W62A 3DCAA 2IRUA 2HVEA 3Q8RB 5KFEA 5KFRA 1FXLA 3OR1A 4DV1J 2XG8A 4RLEA 4YY3J 5A8WA 1M5SA 4YN3B 3UVJA 4CRJA 2CVIA 2G0JA 1J2VA 4NLRA 1S1TB 1Z4UA 2QLBB 1NUEA 3PRDA 2XY7A 3CJ4A 3O44A 2IY5B 4UQGA 2Q6BA 5L8RC 1TMMA 3PCOB 3HHLB 2VZ9A 3UD4P 1GMVA 3D66A 3FDSA 2BQRA 1PC5A 4E0DA 2JWNA 2YQ3A 2ZC3A 4RWXA 4I6AA 4TYBA 1RB0A 1JLQB 2MZQA 1FNOA 3CNQP 4PG6A 2K7JA 4KGKA 4FXDA 2B9EA 3G6VA 3KHLA 4YHHF 1FT8A 4Z7CA 1HNZJ 3CMES 4PWWA 3KLIB 1JKHB 1NK9A 4K5RA 1XEZA 2OPPB 4PQUB 2PFDA 2IBKA 3OXLA 4ED7A 3TWZA 3BSOA 1SQFA 2R7RA 1HNIB 1N0UA 5KOXA 1VC0A 1UW9A 4ANEA 3R5AA 1R8PA 1REGX 4KC5A 1VQOS 2AJ4A 2FC8A 2KRBA 1VK3A 4IQMA 2VONA 4ATNA 3BH7B 2KRRA 2EG2A 2OLWA 2V68A 2W2MP 4DR3J 3HHLC 4F04B 4CDIA 4DR2F 3THTA 2FPHX 1RACB 3OPKA 3EGZA 4ZCIA 1NH8A 4WP3A 3HHEA 1KC8T 4OIXA 1TL4A 1Q7LB 3WX8A 1MW7A 4USUA 2LQ8A 2VV5A 3NGSA 1UAWA 4C97A 1J27A 4FS2A 1JWWA 1TMJA 4QWAA 4CCHA 3C19A 3RRHA 3POTB 2YWEA 9RUBA 3DNCA 3NCQA 1YJRA 1WELA 2AHOB 2EVZA 3M9NB 3KNAA 4K4UA 3D9BA 2EG1A 1QTNB 4NLWA 3M9OB 5KFNA 2EI5A 3AXKA 4JI8J 5AXLA 4HH0A 1RAOA 3W2WB 5KAKA 2X1AA 2VPXB 2LU1A 2IAJA 4NLXA 5IV4A 1RT6A 2ZH6A 5KFUA 1UL3A 2DITA 4WYLA 4EYIB 3M1VB 3MM8B 3I87A 4DX7A 2E1AA 1H3DA 3I9ZA 1PAUB 1IQZA 2PD1A 3N6NA 4X4UA 4WTOB 5CD4A 2CJAA 1FNXH 3D6FB 4Q7AA 4YHHJ 2HYIB 4FKYA 1CJKB 4D3HA 3FEZA 3VAKA 4LRCA 5CYQA 3IWXA 1IN0A 4GVBB 2DYAA 4FYXB 2CPJA 2VDIA 4HVZA 1EQMA 4I0WA 2DR8A 4ZN1A 2UUBF 1JLGB 2NREA 2LQJA 4LBPA 4M5NA 3H4BA 4FNIA 1PYSB 3JTPA 2UUTA 1K47A 2C2NA 1NKCA 4WCEQ 1VHFA 3MMBA 2AW0A 3FFIB 4NLQA 1DTTB 3OHAA 3EGWB 1FA0A 4XPCA 1FDDA 4DR2J 4NMLA 5G0RA 4OYOA 1WHXA 4H54A 4MK9A 3KUHA 4RNNA 1ZAVA 4C8NA 4HACA 1NDKA 2H4YB 3W61A 1S1XA 1ZS6A 3CJ8A 1QVGR 1VIXA 3CMAS 1RBLA 2BKOA 4HKQA 2FGOA 2KI2A 1TK0A 2V2ZA 1KP6A 1UW4A 2QYGA 3T1HF 4DQQA 1C0UB 4K4XA 5D4OA 4N47A 3A8EA 4YB1P 4WIQA 3T1YF 1PBUA 3HI9A 1NHUA 3GB0A 2PMWA 4ZVHA 4BWJA 1R0AB 1TAQA 1T9UA 3V6DB 3MM7A 3P3DA 4G6VB 3HKZD 2YWFA 2ASDA 3MMCA 3VVUA 3HKWA 2VPYB 4L76A 4PPZA 1YZ7A 4R5PA 4AYBD 2HMIA 2AJ2A 2W4PA 2XMVA 1N32F 1JLEA 2VG6B 2W2PP 5SUHA 2DXFA 4CT8A 4QW8A 1H2TZ 4MIBA 4DF4A 3AODA 3LAKA 1FTCA 1T8EA 5CXTA 3UD5A 2X1GA 2D3ZA 3HVTA 1RKJA 2OPSB 4LVNP 2UV8A 3MXHP 2MJUA 4ZVSB 3J81Y 3KLHB 5A2QU 3DRRB 2NQPA 1D9FA 1QAIA 3DRPB 3CCSS 3AFGA 4O3SA 1UPMB 2CG8A 2KH9A 3R5GA 4ZLPA 3MAAB 3EDQB 4I2QA 3ZO7A 1EHWA 4C8LA 4A8KA 3GJRB 4ELVA 4PUOA 1HNXJ 3AOCA 4ZHRA 2M5YA 3L09A 1X5OA 1U2CA 2C28A 1GMWA 4B9TA 1IM4A 3QSIA 1RT5A 4ZLJA 4E2FB 1U49A 3LW5C 4OYZA 2CQ3A 2V0NA 4JV2A 3C2PA 1JLAA 2MKYA 4W4MA 1OYDA 2KN4A 5K5MA 4I56A 5KFJA 2HPUA 5L46A 2VKZG 3JTOA 3NRBA 4DFPA 1X4GA 3KLFB 3T1HJ 4PQAA 1WHYA 4N8OA 2P8IA 3I0SB 1S6PB 1ZOTA 4K5SA 3T1YJ 3CULA 1BLUA 3J81j 3W2VA 3I5AA 4IFYA 6AT1B 2AGQA 1DURA 3GYNA 2C2OB 4DN0A 2O66A 3MEDA 3DI6A 2QA2A 4I69A 4WP9A 3PVXA 1N32J 1SV5B 1RTIA 3G8QA 2QTWA 3Q2TC 4EBCA 3A4TA 2EK6A 1MWYA 5ETSA 4WBFA 5BR8F 4CQ1A 3BKUA 3IFEA 2KG0A 3IAM9 4X62J 4LRAA 1BQMB 2YVSA 4URGA 1PO6A 1LFPA 2WOMB 5C25B 2HZAA 2ZH4A 2VG5B 3OXFA 4RNOA 1NB7A 4NEZA 3M2UA 2EFVA 5D0HA 3NWGA 3KLVA 1IBLF 5CYMB 4LSLB 3CO0P 1NDPA 1SKUB 1UJ5A 4O44A 5DG8A 2KFYA 2FJBB 2PGCA 1NPKA 3P5BP 5JXSA 2AYGA 2MQNA 3SEOA 3QQCD 2AU0A 1A0OB 3DDNA 3VGSA 5L1LA 2YX4A 4FXWA 4Q0BA 2HQDA 2V4JA 3JSMA 4G1PA 1VCTA 2YKPA 5IV3A 2ZDOA 1VBKA 4P2MA 1BXNA 2L48A 1SIWB 2E5IA 2HZVA 1VLOA 2EFGA 2KYZA 2VOPA 5HO4A 1KQFB 4P2SA 2RD5C 2MXYA 1BWEA 3OT9A 5HL7Q 3WC0A 2UU9F 5EDWA 4MH8A 2HRYA 1EIYB 1RCXB 3L7PA 3T5HA 4CM2A 5IZHA 3X1LB 1PSDA 4AXIA 2MY8A 5C24A 3OTDA 2HHVA 2DRBA 4ECZA 3V4IB 4LFCF 2GJIA 3ULHA 2VQEF 2FGCA 2ERRA 4FYYB 3MUVP 1BQNA 1YZ6A 3DLEA 2J0WA 2YY3A 5BR8J 3P4UB 4NLPA 1RA7A 4A8QA 4Q8EA 2GVDA 2IDLA 3CD7A 4UZCA 3QZ8A 1C1CA 2CUYA 5K9FA 2FY1A 3BPDA 2XULA 2P2CB 3TRGA 3LP2B 3BGRA 2PEHA 5KFYA 2DY9A 4W98A 1RADB 1MG7A 3HLUA 2YWGA 2HHTA 1F3FA 1IBLJ 1LW2B 3OUYA 4OMFG 2ZHAA 2R7OA 4MIAA 1S9EA 2ZH1A 2U2FA 2VBXA 3KJFB 4DR5J 3T5KA 3SQGA 5GMEA 5JUMA 1LWCB 1YWXA 2XC9A 1UVMA 2XNQA 3NLCA 4FN5A 2NXNA 3Q23A 2NPFA 3ZZUA 1HKAA 2B5JB 4F26A 4CH1A 2F40A 3W1YC 4AFFA 3BJYA 1WI6A 1VQPS 1UP1A 2B9WA 3N79A 1YGYA 1QTMA 4IG3B 1KHWA 5K20B 4C8KA 3NEKA 4LF2A 1H98A 1CS4B 1SUQA 1FI4A 4EK2A 2WW4A 2UU9J 1VRUA 2MKIA 4GMKA 1QSLA 5HQMA 1B0VA 3WC2A 1N5TA 1SIZA 4ES2A 4PG4A 4OYIA 2B51A 1JNRB 2JL9A 1V3RA 4KAIA 4LFCJ 3UDLA 2OI2A 2MDAA 1YRXA 5DDQC 1WACA 2P6SA 4ED6A 4B3SJ 3G8SA 3OHBA 4RWWA 5EX3A 1Q5YA 1B7FA 2RKIA 2K2PA 1HI8A 3CJKB 3MUTP 2IRYA 1A9NB 4C2MA 3CC4S 1T0TV 4AD6A 3HHLA 2V8DA 3W5YA 5J2MA 2FVSA 2VC1A 2J8AA 3TVYA 1YBAA 1T9TA 2DNGA 4AUKA 3QO9B 1YG0A 3KK2B 1K73T 1L3SA 1G1XA 1JLQA 4NLTA 4WFZA 3OVSA 4DCOB 4WZMA 2FUG9 4Z7YA 3TARA 1T03B 2XMWA 1HBOB 3TEHB 3TZYA 3JYTB 3M6XA 2FVQA 3KLIA 4AE5A 2JEIA 2YNFA 1FKOA 2OPPA 2P5VA 2QT7A 4EO6A 3GU0A 3S1TA 2QL9B 4NLGA 3LPEA 1HNIA 2CKWA 3NS5A 2WONA 1RWXB 4C7QA 1GFWB 1SPBP 2FD2A 4K2XA 2VPZB 3BR9A 2QA4S 4WZQA 4P2FA 5I3QA 4TNOA 3A8JA 1QD1A 3UFCX 3K58A 2NCKL 1PBAA 3PX4A 4LQ9A 2BUNA 3PHEA 5CYJA 3K17A 5F8MA 3HSGA 3Q24A 1L3TA 2OFHX 3CE8A 5HMZA 2RS2A 3OTBA 2DK2A 4RW6B 2RDDA 1N5YB 3W60A 3DLLQ 2PA8D 4DDFA 4NRUA 2R8JA 1RUSA 1I3OB 3POTA 4K0KF 2CPFA 2M7SA 3KG0A 2QLXA 2HBZB 2BE7D 1HHSA 2Q43A 1IBKJ 4JV0A 1SC4B 3SXLA 4NZ7A 1KBRA 3W2WA 3H8YA 2CQDA 1HBMA 3IRXB 1I94F 2RNEA 2DGUA 2HLTA 4J9VA 3M1VA 3MM8A 2GQQA 3K89A 1S10A 3Q83A 3MM5B 1GX5A 1KQSR 1O8BA 3DMJB 2KM8B 1HYSA 3PW7A 3D1OA 4DPXA 3BYPA 4XO0A 5B0DA 3RR7A 3SDEA 4OYMA 1CJKA 4EWTA 1L3VA 2YKNA 3KJQB 3SMZA 2NXUA 2VA3A 2Y8YA 2DNYA 4OLPA 1S97A 4HHJA 4CO3A 2ZBIA 3BBCA 1RI7A 2XSJB 2QE5A 1RJJA 1NK6A 1OQ3A 4C3MA 1SC6A 3VAJA 1JLGA 3FBBA 4WPAA 1UVNA 3RU0A 2AX0A 4J9UE 1W2IA 3AH6A 3N5FA 2DHGA 1H6KX 1DTTA 4F4YA 4UY8T 5KFHA 4WFAQ 3VAHA 2CQ0A 1KFSA 5EUHA 2C2ZB 2A18A 1V5IB 1F3VA 5BXIA 1HMVB 3OR2B 1HPZA 1ZAXA 1TUVA 5D6GA 4DFJA 5ETMA 3ELHA 2KM8C 3AQPA 4WXOA 2EW9A 3KDNA 3D28A 4LR7A 4OJGA 3V81B 4LSNB 5EWFA 3BV8A 4IR9A 1RHRB 4ANCA 4K0KJ 1RAAB 5LSLA 5KOWA 5DS7A 4OHYA 3VQTA 1LWEB 2WB1D 1S79A 1I94J 3O6QA 3IBWA 1VLYA 2DNNA 1OY6A 2RVJA 2HFUA 1YJNS 1T11A 2HQGA 1R0AA 2RHSB 1X0FA 4MK8A 3KMSA 1PJ5A 3U7JA 4DCPB 3C8YA 3BQ2A 4IDKB 3CJRA 3PR4A 3FCVA 1RAGB 4DQPA 2K06A 4P7TA 2EKYA 1T9WA 1ZH5A 2JZ5A 2VG6A 2Z58B 2ZEJA 5A6PA 1IWAA 1TL1B 4YFUA 4ZVOB 2YNIB 3LP0B 4NYPA 4Q43A 2CNLB 2AYMA 4Y6IA 2FVRA 1CJTA 3U1MA 1N34J 2OPSA 2V5HG 5J1EB 5HVHA 3SYZA 2YWWA 4N8NA 3LOUA 4MKYA 3GG1A 3HO1A 3QGHA 3DRPA 3EX7B 1KDNA 4NI2A 3G96A 3TZZA 4A8WA 3UWTA 1TUGB 3Q89A 3OL7A 5IM0A 4TLRA 4A8FA 5KFAA 4N56A 3DOLB 4ZIVA 5JMNA 1C4AA 3K5PA 3MAAA 3DLHA 2UXBF 3MDFA 1X5TA 2B4PA 5HSPA 3FZBA 1GTHA 3CDWA 3ZNUA 3TAMB 3FSYA 4PG7A 2CIMA 2M4MA 1XK8A 2QLWA 5DRKA 4CNZA 3QIDA 3OTEA 3HP6A 4K4VA 3R97A 2KJWA 4RX6A 4ED4A 2CDRB 5A6WA 2LLZA 3V6JA 2C22A 1U8SA 2VFSA 3ILLA 1RBAA 1ROFA 2DEIA 1TL3B 4P2XA 2M52A 4NWBA 2VG7B 4QCLA 3VHQA 3I0SA 1S6PA 3DM2B 4EZ9A 2MPUA 2RB7A 5GAEI 4RW9A 1EARA 2M3DA 4J9KA 4DPYA 2LFVA 1KS2A 4B9LA 1YBUA 2V8PA 2E7WA 1JJ2R 1FFSB 4LMZA 1K0VA 1T9YA 1UA0A 2BDPA 4CO1A 1S0NA 2MQLA 1UEVA 5L39A 5JJBA 3US5A 2HGNA 2VOOA 3I9V9 2HK3A 4NPOA 4ER8A 1SV5A 4EYHB 3X3UA 2DR6A 2CAJA 1QUPA 4QWCA 2FJWA 3OL8A 4F2SA 3GFHA 3ZZPA 4M94A 1FEHA 1J5EF 4KE5A 1B99A 3LP1B 2CJKA 3DRSA 1BQMA 1VR6A 2IC3B 2CADA 2DNKA 1F2HA 2WOMA 1G3OA 3K0JA 2A2DA 3M8YA 1ZPWX 5EWEA 3LAMA 3BDEA 1H72C 3GIIA 2AJ0A 1KSPA 2OPRB 4FF4A 4WK3A 1JJ4A 5CYMA 4J90A 4LSLA 2J5AA 2BJ3A 1PG5B 2UXBJ 3IBCB 4PWUA 1WG5A 4M5HA 3W8PA 1DJ0A 3DKDA 2M70A 2KTQA 3CJQA 3JQMA 4ZCMA 2XBPA 1DZ5A 1N5VA 1U47A 4KHMA 1RDRA 1R7IA 3CCZA 2GIRA 3LQVA 2MGZB 4DV2F 1NBEB 3J7YI 3QATA 1Q8LA 3TZXA 4ZPCA 1DFDA 5CHCB 4X4NA 4PAAA 4MYTA 5GADU 2F9JA 4DU7A 4LR9A 4ITSA 3SCKE 1R6YA 4S0MA 4WYWA 1GXTA 2HNYB 3VQSA 2OPQB 4CWBA 2PC6A 1D09B 2DGOA 3HPOA 2KB2A 3DHXA 1PKUA 4UOHA 2ZJRQ 2RRNA 1MLAA 3MGJA 3VAMA 1FK9B 4RW8A 2CJBA 1ZA1B 1YJ7A 1NK8A 2DXEA 5L1KA 1NCLA 1B7YB 1J5EJ 5F3TA 3EMTA 2RUSA 4QU6A 3HD1A 1NRKA 4CZCA 1HHTP 3LP2A 1LQ9A 3WIUA 3R5JB 4ECUA 2C3UA 1NSKL 3T3FA 2V8HA 3NGDA 4F3MA 4NLSA 3F56A 4DF8A 1P9YA 3C14B 2PI4A 1LW2A 3PR5B 4Q8FA 2JX2A 3FC9A 4QYZK 2Z4PA 4NA1A 4HHHA 4Q5VA 1LWCA 4L75A 2HURA 2MLZA 3V6KA 2K1RB 3TX8A 2WK4A 3D1HA 3NL0A 3EXYA 1N6QB 3D0HE 4U6PA 3KG1A 1BHNA 2B5JA 4X4TA 3Q8PB 1H74A 4Q44A 2QRRA 4YS2A 3NMAA 1AFIA 4MYUA 2ZHBA 4DV2J 5HP1B 3K5NA 2PMHA 4DR1F 3LTOA 3CD0A 3Q8YA 4HT5A 3MM9B 2YX7A 2J0QD 1NLKL 1FRJA 3J7AN 1S1WB 3QRQA 3OTOF 1MU2B 4ZJQA 2HVDA 2L41A 2CWXA 3KFWX 1F9FA 2M9KA 3MAHA 2FYXA 2LDIA 1EB0A 1X31C 4B3OA 3PDNA 2E1MC 1CULA 1GMUA 2ASJA 1S9FA 2QL7B 2U1AA 2GMJA 2CPHA 4U7CA 4CLWA 2KFNA 2DISA 3MTKA 4KHRA 3ILJA 3PKYA 4ZKAA 2ADCA 4KB7A 1MMLA 4J9OA 5EWGA 3HFKA 3D67A 1FRMA 2EFQA 3QO9A 3M2VB 3KK2A 2UUCF 1C0TB 1S9GB 3GONA 2MEWA 1SQEA 1CSJA 5L1IA 3S7RA 1N54B 1T03A 2OMOA 5IQQA 1UZHA 3HM9A 4HHUA 3JYTA 1WC1A 2FLOA 5IWAF 3VTIA 1H0HB 3CC7S 2ACMA 3EZUA 4I7FB 1NJYA 2LMIA 2ZE2A 3BM7A 2CQIA 1JNZB 3PW5A 3T6JA 4IO1A 5KFPA 3TA1A 1TQLA 1B64A 1RTHB 2J0XA 2ZOGA 1Q4RA 2E7VA 3ZXWA 4M5JA 4N76A 1P9QC 1F6TA 2W2QP 3BN4A 4JI0J 1QM9A 5T14A 5F8JA 4ZMMA 5THWA 1RKIA 4IRDA 4DV6F 2R7VA 4DSFA 4PYDA 4OYWA 1NPRA 5CCLA 4CLFA 4DV3F 3OTOJ 4C4WA 2P9GA 2MQMA 5KFMA 4WTYA 2Q1LA 4Y65A 4QBUA 1S12A 3RGIA 2AEJA 2AJFE 2AIRB 1N5YA 2DY1A 1HLWA 1U6FA 3QJLA 1DBDA 3ISND 2QX0A 2GHVC 2ALZA 5IC6B 2XWYA 1GEHA 3A1YG 2J7KA 3QAEA 2Y0BB 3PKMA 2HWHA 2BJEA 3PJWA 1SL2A 4DG1A 4OJHA 3SQOP 1Y3KA 1WG4A 1PCAA 3MTJA 4ILMA 4OZNA 3MPDA 4DLGA 2E1RA 3HVWA 3RAMA 5A2QY 3OLBA 2UUCJ 3RB0A 3EVWA 7AT1B 1WOOA 3I5CA 2LXUA 2LEPA 4GRSA 3RR8A 3LWLA 2XWXA 5IWAJ 4OYBA 2NZ4A 2FHKA 1RTZA 2V4RA 5H9EJ 1X9SA 3BGFA 2WZ1A 2D9OA 3MMAA 5DJBA 1SQGA 3C16B 2F7VA 1GK8A 4LIRA 1VJWA 4ZCLA 3B6BA 2FJAB 1ZTWA 2ZH3A 3ZZTA 3O1LA 1SC1B 5EX0A 2KJVA 3Q8UA 2HFOA 4DV6J 1TK8A 3D2WA 4O23A 3AOAA 3OR2A 3PFEA 2QN6B 4DV3J 2Z57B 3C66A 1RT2B 4LF1A 1OSDA 3KJNB 2LA4A 1Q1KA 3PEJA 5KFQA 3H25A 1S76D 4RUBA 3TAQA 2IAJB 1RQ0A 1MWQA 1URRA 2OELA 3I6PA 4PRFA 2HW3A 1LWEA 4C8OA 1CJVB 3T9ZA 4GKKJ 1VQSA 4A4JA 1MNEA 2CQGA 3NOGA 2F3JA 1EQ0A 2HS3A 4NOHA 2KXNB 1G7CB 3W66A 4F25A 4JI4F 2VA2A 2DT9A 3NP5A 4PG8A 2BJ9A 1KTVA 4QR2A 3DYAA 7FDRA 3S01A 4JI1F 2KHCA 4P10A 4PXDA 3NS6A 1WORA 4ELTA 2Z2YB 5EN1A 3LP0A 3MMBB 4M5KA 1U1LA 4USVA 2EBEA 4J9LA 1RAJA 4OFZA 4ETZA 3D68A 1H2VZ 2C3MA 1FDNA 1FKPB 2V2VA 5LL6d 3GZ7A 4PKDB 5LT5A 3M6VA 2I6WA 5IC4B 4CO4A 1WEXA 2AZ3A 2FHJD 1M90T 2BX6A 5ETRA 2R7UA 5KFXA 4C98A 3DOLA 4MJKA 4X84A 1SL1A 4XIUA 3EUNA 1K8AT 1WF2A 2CZVC 3NBPA 2H9ZA 3W3SA 2R7XA 3GSIA 5L1JA 3TAMA 2MZSA 4OZLA 3I96A 1F5CA 4OI6A 1JLCB 3LALA 3QAUA 1F0XA 4USTA 3B4MA 1O0PA 2IM3A 4JYAF 4K4TA 2CJQA 2GCFA 2ZH5A 3MUMP 4ED5A 2X1FA 1R8HA 2DBBA 3E3XA 1WEYA 3EM1A 1FKAF 1VBYA 3PX0A 1TL3A 2DGSA 4Y2AA 2B6AA 3LGMA 3MMCB 3QPIA 4OX7A 2KZZA 3LWMA 2OEMA 2HMIB 2VFTA 1GH8A 4JI4J 4DV7F 1FX2A 1BD6A 3M8WA 4YEAA 1RAHB 2KU7A 2YH0A 3G86A 1AB8A 2FZKB 1CVJA 2ASYA 3HVTB 4RUHA 2OFGX 2EKNA 2NXJA 4KYZA 2JH3A 1OO0B 2LEAA 2G1DA 1UWAA 2AGOA 1VJQA 1VC5A 5HVFA 2XI2A 3LP1A 3MCMA 4OQJA 1Y4ZB 4OX6A 2W7PA 5BYRA 1R3NA 2HLUA 5C2CA 3AXMA 2I0XA 5IT4A 4ZPWR 2CQBA 3QT5A 3W65A 3HJVA 3UCZP 1QVFR 4PUOB 1S48A 4F4XA 2KT2A 4USIA 2C2RA 2OPRA 2F8EX 2ZZMA 1SC3B 3QRPA 3CSKA 2H3EB 8ATCB 1M5HA 1JJHA 4KQZA 4L3KA 4DL7A 2OTJS 3AJ1A 1RT5B 1U6ZA 3HZGA 3AJ2A 4DOZA 5SZTA 2E1CA 2VL1A 3TEGA 1JLAB 4ILLA 4USHA 1VQYA 1RWMB 1LFWA 2A3JA 2V69A 3M7VA 3QWUA 3M8PA 4RNMA 2I9SA 4XAKA 4JYAJ 2OSQA 2IRXA 3BGLA 3J7Z5 1Y5NB 2Z56B 4DR6J 2MLXA 3IG1A 2HHXA 4Y2KA 1QDUB 4IFYB 2HGLA 2MGZA 2N3OA 3UN2A 1M1GA 4LRDA 4F50A 5J2PB 3DI6B 2IJRA 5KT6A 5AJ3F 5IS2A 4KR0B 2NYIA 2HNYA 3Q2SC 1HBNA 1NJWA 2YTCA 1QAYA 4DV7J 2V94A 1S4EA 2LKZA 2HEKA 5H1SV 2HHQA 2CFXA 1KFDA 1R89A 3BKFA 4ZJOA 1YX2A 1VDHA 4LF9F 5L38A 1YLXA 1FFWB 2Z8QA 1VQLS 2VASA 4B3MF 5GAHU 3UCGA 3BREA 3MD1A 3MEKA 4P9SA 2YPYA 5A8KA 3LA0A 2XS5A 2YKAA 1OS5A 3R3TA 3KJVA 2O5DA 4NZ0A 3RJMB 1U09A 3IS9B 3DOKB 1HWJA 3T5LA 2YKMA 4IRCA 2WVEA 4DR4F 4C0OC 3MWBA 5HLFB 3RRKA 4DUYF 3N01A 3QLHB 2FB0A 5DQHA 4J37A 1J5OB 4O0NA 1ZM3A 2PIIA 3JS9A 2J8SA 3ENAA 2K1RA 1U25A 3EGNA 1E6VB 4EO8A 3RBDA 4WU3A 3PYEA 3DLBA 2JJ4D 1N6QA 3H42A 1BQXA 2RQCA 3QNWB 4B3RF 1YVFA 3FSIA 3IRWP 2IA0A 4RNFA 2GAHC 2GC8A 3SZ2A 3UNYA 1YI2S 2BJ7A 3RB6A 1QY7A 1R0BG 2FHOB 2PO4A 5HP1A 3DDKA 2JEFA 3MM9A 1KR4A 1SH0A 1S1WA 3HFZB 3DLKA 4JI3F 1LKZA 1QJHA 5AJ3J 1RXOB 1RTJB 2DB1A 2Y1LB 5E33A 4KT0C 2AGPA 4DEZA 3QSYB 1VRTA 4FXVA 3KYLA 4ZK7M 4J9SA 1NK0A 4NLUA 1BQNB 1ICEB 3NOCA 5AXMA 1NZ8A 4B17A 2GZOA 3CUNA 4IUFA 1NDLA 1MN7A 1YBTA 4YR2A 4LF9J 5B0GA 3MAQA 3G6XA 4HDGA 4USWA 4B3MJ 1RT3A 2W2NP 5DG7A 3JAMU 3J7ZT 4IH5A 3ENWA 2UV8G 4G1IA 1XJWB 1ZM4A 2FC9A 1KOOA 5C2GA 4KIAA 1RHMB 1QUVA 2ZH7A 1S6QB 3M2VA 3U02A 4NXNJ 3SQGB 3FZ2A 5ETLA 3R5DA 1TL7B 1NHKL 2EFPA 2XZWA 1NXIA 4DR4J 4DUYJ 2ZBPA 5KG5A 2CVEA 1NPPA 2Y0SD 3RRGA 8AT1B 2DGTA 4NCGA 4I7FA 3NWRA 3K8WA 3EGVA 5ITHA 3KNGA 4WKRA 2LCWA 4C11B 4D3GA 3N28A 4LSZB 2ASLA 2XNRA 1UTAA 3FK4A 4U67Q 1RTHA 4URSA 5HJYA 4QWDA 3ZTSA 5LMUF 3HMJG 3TJ9A 3SFUA 4DX8H 1NO8A 1G6BA 3CIMA 3BZQA 2KXFA 4FF3A 1FRIA 4X4OA 2C3YA 1VRUB 4KH1B 2MKSA 4I4BA 2CA9A 5LMNF 2YQ1A 1S1UB 2VUGA 1B0TA 3SV4A 2ZOMA 4JI3J 3KK3B 4F2RA 3C6UA 2VFVA 1IQTA 3PW2A 4O3RA 2MTLA 5LXRA 4KO0B 5T7LA 4DL3A 4I68A 2ZJQQ 1DQAA 2MHEA 2AF6A 2N4DA 1HNWF 2RKIB 3M2RB 3IGNA 3N6MA 2JSXA 3QYYA 4WWSA 2J7WA 3H2LA 2GO9A 3TQEA 2VD3A 5J2MB 3GSDA 4DL5A 5IT9Y 4F0HA 4J91A 3LH2S 2UVWA 4QIEA 2GHPA 2R2TA 2VFRA 3H5UA 3F44A 1RHQB 3UO0A 3RG6A 1TKZB 3WIVA 3HVAA 2AKWB 1N4LA 2C1EB 2WBRA 1FJCA 1VQ6S 2YQ0A 4GC7A 1FF2A 1MMNA 2YNFB 1FKOB 3MFIA 4WXWA 4C9DA 3OV7A 1SJQA 2AP6A 3CDEA 2KFZA 3GP9A 5HQ8A 2R42A 1HWIA 4LF4F 4EU0A 4F0KA 4ID8A 2WONB 2BABA 2BKPA 2I5JA 1IKYA 2NUUG 4QU7A 1SJFA 1U8WA 3A3NB 4YQWA 2W7AA 5DQGA 1PJ7A 3C16A 2BR0A 2BJ1A 5E3PA 3PIOQ 3DRXA 4WFBQ 3L9ZA 2ZH8A 3H40A 1KN6A 4RW7A 5EGYA 5LMUJ 2KDOA 4DJBA 2BKNA 2MQOA 1JQGA 4RBUA 3GYGA 4A8OA 1CLFA 3I5BA 3QFWA 2BQUA 2QLFB 1HR0F 5LMNJ 2GQ2A 2B3TB 1SKWA 1FVSA 2ZUGA 1RT2A 4DV5F 4JP8A 4CI0B 2V2QA 3AQOA 2PSZA 1BMQB 5HQLA 2H5IB 4ZVRB 5LXYA 2R8IA 1HNWJ 3EVOA 1IWGA 1HBMB 3TR5A 2MJNA 4ED2A 1OWXA 5FDLA 2F4VF 5K14B 2DNQA 4M95A 2MZRA 4O4GB 2F1FA 1T94A 4PXEA 2I8EA 2Z2LA 1CJVA 5LSRA 2XY6A 3SBMA 1HYSB 2RHQB 2L08A 2WSEC 1KEKA 3SDEB 2N4CA 2YKNB 1T02A 1VGYA 4YB7A 1X4FA 2WTFA 3N9UC 4NEYA 1AXQA 4UT4A 5D0RA 3FBCA 1GT8A 2D74B 4LF4J 2OEKA 3W8GA 3WQPA 2NSBA 4KGVB 1NNDA 1DQ9A 4QPXA 2IJFA 3M8RA 1RAEB 3R5CA 3IWNC 1UFWA 3IA0A 3DRYA 1NMEB 3S6EA 1I51B 3TANA 2APOA 1KQGB 3RW6A 2LDYA 1FKPA 2UUWA 3HD2A 3HX9A 2F8MA 1S0OA 3GFXA 1UPPA 1NH7A 1HPZB 2R2SA 3OBIA 4ZP7A 1T3OA 3R5BA 4C3KA 4WU2A 3W9JA 5K8MA 1LXNA 5J2NB 1HR0J 3MEGA 5CD4H 2QJ3A 3G4SS 1Y11A 3FMWA 2CDQA 3PW0A 3D7SB 4DV5J 4CTAA 3GTYX 4G3IA 3R9LA 2HSEB 4UF4A 2CQCA 1DLOB 1RK8A 3ZZ0A 1JLCA 4MFBA 1N0VC 3PTWA 4KKOB 4CIOA 5HMWA 4CLPA 3D3CJ 4K4YA 2B7CB 2G4BA 3EJMA 2F4VJ 2L3MA 2JEJA 1T05A 5F0UA 2WVCA 5KT7A 3JQJA 1N5QA 3VZHA 1WDDA 1SJRA 2AYEA 2E66A 2ZBQA 3K59A 2N7CA 3K2YA 2ZITA 5GVQA 1SJ3P 1SH3A 3MR6A 4GVLA 5D0GA 2Q3PA 3VGTA 4FNHA 3KHGA 1VQ4S 1G4CA 1UEKA 4HT7A 4DX6A 2VJUA 1UEUA 2DNPA 3T6BA 1SCJB 1AFJA 1D8YA 4RJVA 1Z1ZA 2UP1A 3RTVA 1NSAA 2X3GA 2ZM6F 2LQ9A 2K7KA 2OAUA 1CJTB 2UUBJ 4TVAB 2IVYA 1XERA 4IH7A 3KLGB 1SKSA 2J9CA 4IKAA 1R8BA 4BCAA 3R7NB 3FBFA 2HQIA 4Q45A 3K5OA 4NI2B 1U4BA 1HD0A 3U1NA 3I82A 3LGNA 3BF4A 5IM0B 5KFSA 1P27B 3BSNA 1VQKS 2WVBA 5M2UA 4FZVA 3AT1B 2VPWB 3KWMA 3Q8SB 3AAWB 4C3LA 5F9LA 5DETA 2XMAA 2MSTA 4M1KA 2OUGA 4IR1A 3QWPA 4E98A 3ICLA 4OYAA 4DQSA 3J7A1 4RPFA 1YJWS 2OKQA 4UOFA 3UDVA 2IPOB 2BW7A 3MR5A 3DXBA 4FYWB 3NXZA 2NLWA 4CO5A 2BVZA 3BSAA 4TY8A 2JLGA 1LK7A 3NG8A 1ZPVA 4LF7F 3GFYA 2Y9HA 4RW9B 3M05A 1RCOB 1S0VA 2YWKA 2AJ1A 1WC0A 5J2PA 2XLJA 5A8RA 5HN0A 4ZJLA 3H20A 2AYBA 1TR0A 5AE3A 2XMTA 2QIFA 2OP5A 1TU0B 3ZTRA 4B9UA 4PCQA 3S8SA 4ECXA 5F0WA 2RDIA 3R7BB 4ZVFA 3GR0A 4KHPF 4WK1A 3FMBA 2KT5A 2OEJA 1OPZA 5U47A 4JBCA 5KG3A 4O0IA 4ES3A 2I1RA 4MK7A 5D4PA 3DRSB 4YR3A 4K7QA 1NK4A 4PG5A 3SFGA 4DSLA 2R7QA 4DR7F 5ETPA 2YXLA 4H4OA 1NJXA 4BS2A 2HS4A 1GQEA 4IOAQ 3M8SA 4YOEA 2J6TA 3PY8A 3OL9A 3CVKA 2EC2A 3QGIA 4Y00A 5HVGA 3EWGA 3IS9A 3DOKA 1BGXT 2D1CA 5HLFA 3SI8A 1YIJS 3QLHA 1QAXA 1J5OA 1DARA 2E7XA 5RUBA 1V3ZA 4UQTA 4Z2XA 2N3LA 1E6VA 3FKBA 1N48A 2A10A 2GVZA 2W9BA 5LJ3Y 4JI5F 1BWVA 4PPDA 3MHYA 2DNHA 3BGUA 2CG4A 4ED0A 3GIJA 5KG0A 3IBFB 1QE1A 5KG1A 5EHHA 4X4QA 4LF7J 3IO1A 2J0SD 2AWZA 1K44A 1FJ7A 3ITHB 4U8YA 5D0EA 1VI7A 3AB2B 1RHUB 2DNOA 3H59A 2LQBA 3EZOA 1UZDA 1U45A 1RTJA 1JXEA 4KV8B 4LBIA 2DH9A 4RW8B 4DPOA 4UOGA 3TUZC 4C8ZA 1GXLA 3M8QB 4KHPJ 1W26A 2XGQA 3O2IA 2PDAA 3CDAA 3GIRA 1TKTA 3LO3A 1W25A 2FZGB 1FERA 2BACA 1I6JA 4LBHA 5F3ZA 1Z2ZA 2HNZA 3O3LA 4DR7J 3HSJA 1YRUA 1D1UA 2EFOA 1UFKA 1P8GA 3OQ2A 4QWBA 2DR5A 2ADBA 1Y3JA 1AW0A 2DHHA 1V3SA 3QJPA 2HAFA 1S6QA 1R43A 1DTQB 2F4FA 1JLBB 3OSNA 3EDRB 4U9RA 1MWZA 4X64F 2JLEA 1XR5A 1TL7A 2ZVIA 4P71A 1YJTA 2VQFF 5ETOA 2RE1A 1VK8A 3D3BJ 1BC6A 4ED3A 1HW8A 2ROPA 3HXMA 5FLXU 4USKA 3HDSA 4ZN3A 3TUPA 3VAIA 4C11A 2V50A 4JI5J 1RWNB 4OL8A 4B9SA 4UUWA 3OSPA 2FY8A 1HWLA 3ZZRA 4F4AA 1WTFA 3V2UC 3CF5Q 1N33F 1JB0C 2W1BA 4MTPA 4ZVTB 3VWSA 1U48A 4DBQA 4R8UA 5M2PA 2V8VA 2G0CA 2R8HA 3GIMA 4LF6F 3SIPB 2HFSA 2A6MA 2MZJA 5B0BA 1S1UA 1KHVA 4B3OB 3KK3A 4WKYA 4RUAA 5DDRC 1CULB 2MLYA 2JDJA 3W7BA 2HFVA 2QYCA 2VQEJ 4KO0A 1S1VB 1CG2A 3BQ1A 5AT1B 1RZMA 1HNVB 3M2RA 3MPWA 5FD1A 4DSJA 2V6AA 5D4NA 5CH7B 2RF2B 4Q2LA 3NGRA 5I3UB 5D78A 5A76A 4MAKA 3PRVA 4O3QA 2YKQA 1EETA 2JHEA 2XMJA 1S5ZA 1XIQA 3C46A 1N52B 4DX5A 2DHAA 3I0RA 2BW2A 2B4OA 3BDPA 4A8MP 1TKZA 3HSZA 5IT0A 3BYRA 1HARA 2UZAA 3OFGA 4DZDA 2GAGC 4CO2A 2GJFA 1OIAA 3IP0A 1SB6A 2UVUA 2ZVSA 2AJQA 1NSQA 4X64J 2WVDA 2RQKA 1IXKA 2VQFJ 2ZE2B 5B09A 1RWOB 4TN2A 2JNJA 5H9FJ 3TX0A 1YJVA 2CZ9A 1YHQS 4WP8A 1CQNA 2VJVA 2YX1A 2FJDB 1NK5A 1X9WA 3A13A 2MKJA 4QYRA 1EKRA 2GGPB 4X4SA 4X4RA 1NDCA 3MPVA 1YK9A 5LSOA 1NB2A 3ILOA 1BE4A 3UQSA 1XNRF 3ZFVA 3D0IE 3AD8C 1XMBA 3KOAA 2J6UA 3QJJA 3ZTOA 5LJ5Y 4L73A 5F9NA 4A48A 4LF6J 4KGZB 4TU9A 4DN9A 1RAFB 1WF1A 2OSRA 4X65F 2LECA 4J7CA 5HROB 3RUBL 5IFMA 5F8IA 1RHJB 3ZTQA 2H1YA 4NA2A 4HLBA 1LWFB 1M0SA 5GAGI 4X2BA 1Q79A 3VR1A 3Q0AA 4QZVB 1AZSA 4DG1B 5K14A 2AEMA 4MIWA 4BBYA 4O4RA 1WEZA 4DPWA 1I5OB 2PT0A 4O4GA 1UJ4A 4GO7X 4ZVGA 1UETA 1HI0P 2R8KA 2ZD1A 4PR6A 2BZ2A 1N8RT 3G71S 4NYOA 2JOQA 2LYVA 4B9NA 1FWLA 1RT1B 2HFNA 4YR0A 4Y2MA 2XS2A 3WBZA 3A3OB 4JI8F 1IVZA 4XK8C 3AJDA 3BN7A 4NLDA 3NNCA 1HQ2A 3RAQA 2B4UA 2V8GA 1WG1A 1HD1A 2CPDA 3Q8VA 3MMAB 4PXBA 5KFCA 3A8KA 4LR8A 4RO0A 2E5LF 5E41A 4F8RA 3IR7B 1YSJA 1KNZA 2VBWA 4CO0A 4EFAC 4ZP9A 2OD6A 3ZTPA 4RZRA 1D9DA 4U7UD 2Y1JA 1VQMS 1XNRJ 1IBMF 2LA6A 1S0MA 1TELA 1OQ6A 3EICA 2O3DA 2LVWA 1VIOA 2L9DA 1R0CB 5DGBA 2H51B 4Y2IA 5J2NA 3AA8A 1OY9A 2YH1A 1U1OA 1ITPA 2HQCA 1HQEB 2D3UA 1WC4A 1U1MA 4ECTA 3VGUA 4X65J 1RT7B 3QIPA 5KG7A 1Q82T 3DU6A 4HL9A 2XZTB 3CCES 1DLOA 1EAYC 1SVDA 3U1LA 4KKOA 2UVRA 4N41A 3RAXA 3LPYA 4WFXA 4P72A 5MLCV 4QPTA 4IG0B 3TW0A 3H5YA 2R7SA 1SH2A 4NYZA 5CCMA 4ED1A 3HHLD 1GTEA 2G0IA 2QZ8A 2ROGA 3PM9A
chains in the Genus database with same CATH topology
3C16A 3MAAA 5D0HA 5IV4A 3C15A 4OYPA 4CLSA 4CM0A 3G82B 4USVA 3C14B 3ET6B 1WC0A 4OYOA 1TL7B 4NI2B 1CULA 1CS4A 1FX4A 4WPAA 3MR7A 4CLUA 4CLTA 1AZSA 4CLPA 4CLKA 4CLWA 1CJUB 3UVJA 2GVDA 3C15B 2GVZA 5D0RA 1FX2A 4WP8A 4OYWA 4OYBA 2QV6A 4CLFA 1CJKB 1CULB 1CS4B 4OZ2A 1AB8A 4CLYA 1WC4A 1U0HB 1AZSB 4CLLA 4WP3A 4WP9A 1CJVB 1YK9A 2WZ1A 3G82A 3R5GA 4OZ3A 4USUA 3C16B 5D0GA 3MAAB 4OYIA 4CLZA 1TL7A 4P2XA 2GVZB 1YBTA 5IV3A 1CJTA 4P2MA 4OYAA 5D0EA 4USWA 1WC3A 1WC1A 1CJUA 4USTA 4P2FA 4OYXA 1WC6A 2W01A 1YBUA 3C14A 3ET6A 2BW7A 5D15A 3UVJB 2GVDB 4NI2A 1Y10A 4OYMA 1CJKA 4OYZA 4CM2A 1CJTB 1U0HA 1WC5A 1CJVA 1Y11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C16 A;  3MAA A;  5D0H A;  5IV4 A;  3C15 A;  4OYP A;  4CLS A;  4CM0 A;  3G82 B;  4USV A;  3C14 B;  3ET6 B;  1WC0 A;  4OYO A;  1TL7 B;  4NI2 B;  1CUL A;  1CS4 A;  1FX4 A;  4WPA A;  3MR7 A;  4CLU A;  4CLT A;  1AZS A;  4CLP A;  4CLK A;  4CLW A;  1CJU B;  3UVJ A;  2GVD A;  3C15 B;  2GVZ A;  5D0R A;  1FX2 A;  4WP8 A;  4OYW A;  4OYB A;  2QV6 A;  4CLF A;  1CJK B;  1CUL B;  1CS4 B;  4OZ2 A;  1AB8 A;  4CLY A;  1WC4 A;  1U0H B;  1AZS B;  4CLL A;  4WP3 A;  4WP9 A;  1CJV B;  1YK9 A;  2WZ1 A;  3G82 A;  3R5G A;  4OZ3 A;  4USU A;  3C16 B;  5D0G A;  3MAA B;  4OYI A;  4CLZ A;  1TL7 A;  4P2X A;  2GVZ B;  1YBT A;  5IV3 A;  1CJT A;  4P2M A;  4OYA A;  5D0E A;  4USW A;  1WC3 A;  1WC1 A;  1CJU A;  4UST A;  4P2F A;  4OYX A;  1WC6 A;  2W01 A;  1YBU A;  3C14 A;  3ET6 A;  2BW7 A;  5D15 A;  3UVJ B;  2GVD B;  4NI2 A;  1Y10 A;  4OYM A;  1CJK A;  4OYZ A;  4CM2 A;  1CJT B;  1U0H A;  1WC5 A;  1CJV A;  1Y11 A; 
#chains in the Genus database with same CATH topology
 3DGP A;  3QT7 A;  4YME A;  2ZZT A;  2AQ4 A;  1FX4 A;  1IR0 A;  4AL6 A;  4FS1 A;  3MR7 A;  2YNG B;  1NKB A;  1PAE X;  4C0B A;  1HFE L;  2UXD F;  3MR2 A;  3OFH A;  3MI7 X;  4A46 A;  4N7T A;  4A47 A;  3PO5 A;  5IT9 U;  3DYA B;  3B82 A;  4MKA A;  1U7L A;  2BRL A;  3MCS A;  3D6M B;  3OVB A;  1LK5 A;  1FHT A;  3GCW P;  4DCJ B;  2W2O P;  2I38 A;  4RW4 A;  1U24 A;  3AOB A;  3PYG A;  5KG6 A;  1HWK A;  3KLG A;  1WHV A;  5KFL A;  4GKJ F;  4CLL A;  4M8L A;  2DH8 A;  1AA1 B;  2E5L J;  2GML A;  3AD7 C;  4IQX A;  3AY0 A;  1WKK A;  4XDC A;  4OI4 A;  3PV8 A;  2N82 B;  5D3G A;  5K8O A;  3D4J A;  4FYV B;  3BQ0 A;  5E7O B;  2B0G A;  4DS4 A;  1IBM J;  2IFX A;  2CYY A;  3EVM A;  4B9V A;  3CJ3 A;  1ZET A;  3ET6 A;  3NAH A;  2ZZN A;  3NBP B;  1TV6 A;  3IN5 A;  5KFG A;  2L9N A;  2NXE A;  5B0A A;  4ALZ A;  3TI0 A;  4IRK A;  1SJ1 A;  2X1B A;  4ZIT A;  4KPC A;  2NYH A;  1A7G E;  1R8A A;  1R6V A;  1U1K A;  4ZPA A;  2AX1 A;  1FXD A;  2GS8 A;  2FJV A;  3BO2 A;  1WSV A;  3KDO A;  1S6O A;  1ZM2 A;  1LW0 A;  2DNR A;  2NPI A;  1TVR B;  1JXL A;  1X4E A;  3W5X A;  1RIS A;  1F9H A;  3M32 A;  2DTJ A;  2B6A B;  1OY8 A;  1CPZ A;  5GAE U;  3UN3 A;  1HNX F;  2IVF B;  4Q2M A;  3IXQ A;  4ZVE A;  2XHW A;  5DM6 Q;  3Q86 A;  5A0Y A;  1U02 A;  2GIF A;  4HH1 A;  1N36 F;  4OZ3 A;  3R8Y A;  1QLN A;  4XTT A;  3L3C A;  4DI6 A;  2RSQ A;  2YNH B;  3JAM Y;  2RAQ A;  4FDF A;  2HVH A;  4C48 A;  2UXD J;  2XCP A;  2W9C A;  1UVK A;  1WI8 A;  1AUS L;  1UKU A;  3CGI A;  3SSS A;  2HHW A;  4NRT A;  3A3P B;  4RBT A;  4DUZ F;  2BE2 B;  1TUW A;  2FJE B;  3KHH A;  1NSP A;  4RL1 A;  4OI3 A;  3C15 A;  4GKJ J;  2GJ2 A;  2C42 A;  6FD1 A;  1Q53 A;  3CC2 S;  4TQR A;  2PE8 A;  2ZJP Q;  3JSY A;  4ZLN A;  2K3K A;  5D77 A;  3P49 B;  2GO8 A;  2WCX A;  4BLG A;  3QT6 A;  1TFY A;  1Y5I B;  2DGW A;  3UR3 C;  1Y5L B;  3E8O A;  3GLJ A;  2DIV A;  3M30 B;  4X62 F;  4ERD A;  5DDP C;  4FF1 A;  1UWB B;  2POK A;  3IMQ J;  2IHR 1;  4W92 B;  3TA0 A;  3KUG A;  2X7I A;  2J76 E;  3DLJ A;  1UFL A;  2AEF A;  1KOH A;  2FLN A;  4FVC A;  1HBU B;  3M8P B;  4MKV A;  1NK7 A;  2C2K B;  2R8G A;  3GE9 A;  1X8D A;  2OH2 A;  3P45 B;  3QBC A;  4ZA1 A;  4XDD A;  2E29 A;  1FWK A;  2ILZ A;  3IG1 B;  4ZP8 A;  4KRW A;  4F4Z A;  3J7Y U;  3L7U A;  2Q6C A;  1PJ6 A;  2XYP B;  4ZS6 A;  2V9K A;  2CWK A;  1JLF A;  1IKX A;  3PW4 A;  2SXL A;  4U8V A;  1Z2L A;  4NZ6 A;  4ZLL A;  1XMO F;  2FHM A;  3WX4 A;  3ITH A;  2ZUA A;  1HBN B;  1KLM B;  1N36 J;  1RWW B;  1JMT A;  1O5J A;  3GFZ A;  3H2U B;  1HW9 A;  1V5V A;  3SCJ E;  3CCL S;  1HQU A;  4URQ U;  2ZH9 A;  3R1H A;  2KYX A;  3PIP Q;  4KV8 A;  1OMS A;  1GAO A;  3H5X A;  1XN9 A;  5C5J A;  2OGU A;  3GV7 B;  1VQ5 S;  4C8Y A;  3K7R A;  4O3P A;  2A0F B;  1Q81 T;  2Y1I A;  1XMQ F;  3M8Q A;  2GIQ A;  2LXI A;  4J9R A;  4CLY A;  4JI2 F;  4DUZ J;  4NCA A;  5A8K B;  4UTG A;  5JVH Q;  4LVO P;  5DLF A;  6FDR A;  2GV1 A;  1XNQ F;  1U1P A;  4NLV A;  4BC7 A;  2ATL A;  1QSS A;  3KXD A;  1TP7 A;  3KJV B;  1LOU A;  3E51 A;  3R6G B;  4Z37 A;  5K8N A;  2ZDP A;  4ZOS A;  2QSF A;  1T3N A;  4DSK A;  2ZFH A;  5E3R A;  1FDB A;  4V19 J;  1S6U A;  2YKM B;  1FTR A;  2V2K A;  2ZBR A;  1MRO A;  3UNG C;  1DTQ A;  1IBC B;  2GA7 A;  1IKV B;  2JFK A;  1JLB A;  3MFH A;  2JC1 A;  2JEG A;  4NE9 C;  1KON A;  2CJX B;  1Q16 B;  4DU8 A;  2D9P A;  3MOJ B;  3UE2 A;  1HL6 A;  3G6Y A;  1F2G A;  2MB0 B;  2IIH A;  1HHQ A;  2ZNZ A;  4N77 A;  4HDH A;  3G2X A;  3Q22 A;  5HBM A;  3J80 U;  3OLA A;  3MR3 A;  1H73 A;  3SV3 A;  4L6V 3;  4OZJ A;  3TNV A;  2KG1 A;  1EP4 A;  3CDB A;  4DR5 F;  4ECR A;  1RA6 A;  1UJ6 A;  2E44 A;  4R0E A;  4AL7 A;  3DLK B;  1IR2 A;  5JVG Q;  1KD1 T;  1XMO J;  4MT1 A;  2AT1 B;  5KFZ A;  3QGG A;  3TUJ C;  4QOT A;  1VRT B;  2XSF A;  3CCW A;  3BS9 A;  1FD8 A;  4ZCK A;  2VIC A;  1PGZ A;  2BQ3 A;  4F4W A;  4U96 A;  2C2M B;  5CQG A;  1S1V A;  1XMQ J;  4TKT A;  2DGX A;  1HNV A;  3CED A;  4JI2 J;  3AB4 B;  2HGM A;  1X60 A;  1RT3 B;  2RF2 A;  5I3U A;  5I42 B;  2O1P A;  3BBB A;  1XNQ J;  1NEE A;  2UXC F;  2PA3 A;  5B08 A;  1WKL A;  5DDO C;  3VCD A;  1NAQ A;  2FJX A;  5C7P A;  2VC0 A;  5LM7 E;  2V67 A;  1RU1 A;  3CJT A;  2ZKU A;  4YB6 A;  5DZ6 A;  3OJS A;  2QSW A;  2XMU A;  2XYG B;  2D3O R;  2LU2 A;  2XM3 A;  4LFA F;  2H5E A;  1Q0N A;  3C6T A;  2MQ8 A;  4B3S F;  2MKK A;  4NCG B;  2W24 A;  3E01 A;  2W7O A;  3E2E A;  3NNA A;  3KLE B;  1DAX A;  2V9W A;  3CCR S;  1BY9 A;  2BM0 A;  4M5G A;  1M5P C;  2VFU A;  1LV5 A;  1WOP A;  2GGP A;  1RWU A;  4ECQ A;  3PAC A;  1CQM A;  2HRU A;  4DR1 J;  1K0T A;  3H4D A;  5BYS A;  3ISN C;  4RU2 A;  2OIH A;  2E1P A;  3THP A;  3DN9 A;  2NZC A;  2RS8 A;  1EJ7 L;  2QMX A;  3C6U B;  5C42 B;  2VF3 A;  1R8C A;  2FQQ B;  4CLK A;  3UR0 A;  5B7W A;  5T7L B;  5E0O A;  4L3N A;  4ES1 A;  5E3C A;  3FCH A;  3W63 A;  5HRO A;  2QMU B;  2GQC A;  3JSR A;  4RR5 A;  1XWL A;  3FGV A;  3RW7 A;  1PIE A;  4O3N A;  2E9R X;  1LWF A;  1LWX A;  3LUY A;  2QFJ A;  4ICL A;  4UZB A;  3H2V E;  1REV B;  1IR1 A;  3MCN A;  4NMX A;  4OZ1 A;  4EGL A;  1X4C A;  3UW1 A;  2UXC J;  2DKO B;  3D1Q A;  2BJD A;  3VGV A;  3K5L A;  1IJF B;  3CJS A;  1B70 B;  2W4D A;  2OML A;  2B8P A;  3GWC A;  4FBT A;  1RT1 A;  4J9P A;  4DFM A;  1IBK F;  4E8U A;  1JJC B;  3ZNJ 1;  4LFA J;  3N6L A;  3DC2 A;  1S1T A;  2IDE A;  1DY3 A;  1TZ0 A;  2I5J B;  1IKY B;  5MAO A;  1K9M T;  2Z2M A;  1S72 S;  4NXM F;  4UY8 5;  3NMR A;  1FXR A;  1F5A A;  5DZ7 A;  4H4K C;  1C1B B;  3HF5 A;  3G6E S;  2VB6 A;  2D3O 1;  2F9D A;  2VDH A;  4MKB A;  3BO3 A;  4RW7 B;  2OTL S;  1ELO A;  4DPU A;  4DFK A;  4FYD A;  3MOZ A;  3UN5 A;  1VQ8 S;  3HFV A;  1D3W A;  3CCM S;  1T7P A;  2XYH B;  1JKH A;  2XCA A;  2JFD A;  3KHR A;  2YBV A;  3AA9 A;  1FWP A;  2XZD B;  4I2P B;  4I6Y A;  4PQU A;  1NU4 A;  3PRB A;  5E2Q A;  1K1S A;  4DUT A;  3CXC R;  3ETO A;  1D8Z A;  4OV6 A;  4DQR A;  3V6H A;  1RU2 A;  1HQE A;  3TJA A;  3K57 A;  2OHD A;  4KFB B;  4V1A k;  1RT7 A;  2WSC C;  2ILY A;  4UW2 A;  5FDL B;  3F0N A;  3PEH A;  1O51 A;  2DD8 S;  4OLO A;  5KFF A;  1WKJ A;  2KO1 A;  3FSX A;  1RTD B;  1WNE A;  1XC9 A;  1ZYQ A;  3G8T A;  4IG0 A;  3RBE A;  2DGQ A;  4MMO A;  5H9E K;  2ZH2 A;  3DLG B;  2QMW A;  4IOB A;  5GMK a;  5KFK A;  3W64 A;  3LAN A;  2HHH F;  5ETK A;  4EI2 A;  1RWP B;  3FRZ A;  3NS7 B;  3K5M A;  1RWV B;  1D9A A;  2HBY B;  2DHX A;  2QL5 B;  1YIT S;  2BMB A;  4OHX A;  4YDX A;  3DOM B;  2YNG A;  2ZBC A;  1CEZ A;  2IM0 A;  3NAI A;  2XS7 A;  4ZPT R;  2AV5 A;  3TA2 A;  4OZ5 A;  1TFW A;  1RT4 B;  1H7X A;  1X4B A;  3T19 A;  1RGV A;  1JX4 A;  3NGT A;  4NXM J;  4X4P A;  3TJ8 A;  2XQC A;  2Z0G A;  4ZPV R;  2RUG A;  2E9T A;  4LFB F;  3GCX P;  2RRA A;  1Y10 A;  2J6S A;  3BB5 A;  1UVJ A;  2KT3 A;  3ONQ A;  2LEB A;  1VRQ C;  4TQS A;  1TKD A;  1TAU A;  1XTZ A;  3MZI A;  1FE0 A;  2DGV A;  9ATC B;  1AUD A;  4BC9 A;  4XPE A;  4J9M A;  3DGV A;  2CPZ A;  1RLD A;  2ZWP A;  4CNY A;  2VBZ A;  4HTJ A;  3RB4 A;  1FRH A;  3GPA A;  3CMQ A;  1SI9 A;  3P8B B;  3MEG B;  3DXS X;  3KTQ A;  1FRL A;  2WRM A;  4GVB A;  2IYG A;  2KVI A;  5ETT A;  4NCB A;  4CTA B;  4DHV A;  3CIZ A;  1N34 F;  2Z30 B;  2DRA A;  2PEB A;  3MEE B;  4C8M A;  4J5O A;  4MFB B;  1U0H B;  4QIF A;  1ZBT A;  4OHW A;  3DU5 A;  2CZ4 A;  4G1Q B;  3FFI A;  3EYZ A;  4EBD A;  3IC1 A;  4WF9 Q;  3EZ5 A;  1T05 B;  4FVM A;  1TVR A;  4ZVQ B;  4A8Y A;  1RBO B;  4JI6 F;  1FEE A;  2RRB A;  4K2J A;  1TK5 A;  4YP3 A;  2HND B;  2XO7 A;  2VH7 A;  2LQ5 A;  3VV2 B;  4F36 A;  1WTB A;  1P6T A;  3T5J A;  3UPF A;  3H98 A;  4BDP A;  3PZP A;  4DV0 F;  2HHH J;  2EXU A;  3EPI A;  4K8R A;  5HMX A;  2B9X A;  3T9N A;  2Y1R I;  1VQ9 S;  2YNH A;  2R9L A;  4EEY A;  4BWM A;  1GX6 A;  1NM2 A;  1KWM A;  1VBX A;  2WAQ D;  2IM1 A;  1RAB B;  4FPI A;  1C0U A;  4JI1 J;  1XQI A;  4OI0 A;  3QMQ A;  1YRT A;  1FE4 A;  1Q78 A;  2H48 B;  3CJ5 A;  5IOL A;  2R2R A;  2BE2 A;  4LFB J;  3CCQ S;  5KT5 A;  3D54 A;  2VKR A;  3PJ9 A;  4QWE A;  4M5M A;  3V6D A;  1VC6 A;  2CJY B;  2RQM A;  1KQK A;  4I64 A;  1FDA A;  2BV3 A;  2XMM A;  4Y34 A;  2FVC A;  3P96 A;  5FLX Y;  4UOC A;  4H4M B;  1S57 A;  2EC0 A;  5E5N A;  3EXC X;  2MKC A;  2Y8W A;  4ECS A;  3HZE A;  4DQI A;  3NGK A;  2F65 A;  3KMQ A;  2R2U A;  4K59 A;  3B54 A;  3M30 A;  2DR7 A;  1IJE B;  2B4V A;  5G4D A;  4A8X A;  3LGH A;  1UWB A;  1RYS A;  1NJZ A;  1Q8K A;  3GV5 B;  3KLH A;  3DRR A;  3SSQ A;  3FVY A;  1HBU A;  3UCU P;  3P5T L;  3MUR P;  1FRX A;  3FQL A;  1U2F A;  4TY8 B;  4P52 A;  3D0G E;  4PAB A;  2DCU B;  1FD2 A;  2RT3 A;  4RUC A;  4WFN Q;  4JI6 J;  1U1R A;  1X5S A;  2DNZ A;  2IJN A;  3CWJ A;  3OTC A;  3V5R A;  5A8R B;  1RP5 A;  3D6T B;  5KG4 A;  4ZPD A;  2G2O A;  2DPI A;  2K8G A;  4DV0 J;  3A8I A;  4U7U K;  2P6T A;  1KLM A;  4DMZ A;  2DVI A;  3UDE A;  2RJZ A;  3JSB A;  4RBV A;  4JI7 F;  3M4X A;  2HVZ A;  3KLF A;  2MHN A;  4K4W A;  3CB4 A;  2Q66 A;  1VBZ A;  1ZAW A;  4FKX A;  4B3T F;  4H4O B;  3U27 A;  3NGU A;  2O67 A;  5J2Q B;  4NL5 A;  3UDC A;  5CZX A;  4QIW D;  2HQ3 A;  1X9M A;  3LF0 A;  2BEF A;  3F73 A;  4JV5 F;  3PNI A;  1F1B B;  4WE1 B;  2VIH A;  1F5B A;  3VAL A;  4ED8 A;  4DWI A;  2V34 A;  1KTQ A;  2CRL A;  3BPS P;  2BA9 A;  2XMK A;  1CJU B;  3RBZ A;  4M5D B;  4HI2 A;  1OPI A;  2R7T A;  4DPT A;  5DG9 A;  5HI7 A;  4FPR A;  1IKV A;  1EZZ B;  4KY3 A;  5CAA A;  2E5H A;  3IM8 A;  1X4D A;  4M5I A;  2YKO A;  1E6Y B;  5ETV A;  2IMO A;  2GVZ B;  2W9B B;  3EPG A;  2FVP A;  5C25 A;  2RIJ A;  3CJ2 A;  4N5S A;  3R6L B;  2CPX A;  2VG5 A;  2DEJ A;  4ILR A;  1O6X A;  1XBW A;  3JTN A;  4KTQ A;  1QE1 B;  4V19 X;  1ACM B;  2XI3 A;  5LOQ A;  5AXN A;  3Q8Q B;  4OHV A;  4KSE B;  1EKS A;  3TVZ A;  4YB5 A;  4PYA A;  4WJB A;  4HEA 9;  2R3V A;  3N4W A;  3OL6 A;  3PJX A;  2GNK A;  2XB2 D;  5F8N A;  3MD3 A;  2C2D A;  2VBY A;  1JK9 B;  2EPI A;  3M6U A;  5F8H A;  1MMD A;  3HHK A;  4EMD A;  4CYU B;  3H90 A;  3GJT B;  4JI7 J;  3AHP A;  1TL5 A;  3PHT A;  1TKT B;  4IO9 Q;  4QYZ J;  1DQ8 A;  3DDI A;  3BO4 A;  2HNZ B;  3ILI A;  2O01 C;  4B3T J;  2JRS A;  1N56 A;  4CLZ A;  5I42 A;  5F8L A;  5GAD I;  2E9Z A;  3BKT A;  1S77 D;  1FO1 A;  4DL4 A;  4M5L A;  2B43 A;  3MEC B;  1OJ4 A;  2B56 A;  4JV5 J;  4PWD B;  1KLN A;  3JB9 k;  3V4I A;  4QR1 A;  3FNN A;  4KJI A;  1KRP A;  3HJF A;  2CPE A;  3EE3 A;  2J9D E;  3HSD A;  5KT4 A;  1B3T A;  4EUV A;  2D69 A;  1WC5 A;  1WOS A;  1QAJ A;  3GIL A;  2WSF C;  2W9A A;  1WF0 A;  3KLE A;  4CLT A;  1KVK A;  1CBK A;  1C2P A;  5DGA A;  2M8D B;  5KFD A;  3MM6 B;  4B3R J;  3HUL A;  4USJ C;  3GJQ B;  3I31 A;  3UD3 P;  3G9C A;  3CD5 A;  4LUB A;  1UVI A;  4J9Q A;  3CT9 A;  4R8U B;  1SL0 A;  2BAN B;  3J81 U;  2EBG A;  3CCU S;  2I2Y A;  4WII A;  1AYE A;  3KK1 B;  1KVJ A;  4HI1 A;  2HZC A;  2KVQ E;  2QFI A;  2KZM A;  3BEG B;  5D8H B;  5FJ4 A;  4JV1 A;  3HT3 A;  5C42 A;  3H7H B;  1K1Q A;  1TKX B;  4ZP6 A;  1ZZF A;  4TU8 A;  2QEX S;  4OYX A;  2LXF A;  1VIS A;  3GR1 A;  3IAS 9;  4JI0 F;  4USM A;  5I3P A;  4H4K A;  4K4Z A;  4IG3 A;  2GX8 A;  3PXG a;  4HR2 A;  2DRD A;  2ZHO A;  3BR8 A;  1EET B;  4O3O A;  4OZ0 A;  2RDJ A;  4CM0 A;  1M1K T;  3W9I A;  1REV A;  3I0R B;  1CS4 A;  2IYI A;  5KFV A;  3L95 X;  2ZC4 A;  3SSR A;  3MPU B;  4LRF A;  1Q8I A;  5KTQ A;  1RSC A;  1FES A;  2NS1 B;  4QW9 A;  2GW8 A;  4J9N A;  4W90 B;  1RYR A;  2ATC B;  3SCL E;  2JVO A;  4LF8 F;  2Q79 A;  4CP5 A;  1RLC L;  4P74 A;  1FNM A;  3VVT A;  2XY5 A;  4OX8 A;  3CJK A;  3RZA A;  4IFV B;  1XR6 A;  5J1P A;  3TYT A;  3ZZZ A;  2MZ1 A;  3B78 A;  4AND A;  1C1B A;  2CQH A;  4U95 A;  2HHU A;  3D6H B;  2W01 A;  3CCV S;  2DHS A;  4DL2 A;  1T9X A;  1U2R A;  1L5U A;  4PEO A;  4ELU A;  2C2E A;  3IWL A;  4KPY A;  3RB3 A;  3FEX B;  4Y3C A;  4ZIW A;  2FTR A;  3TO8 A;  1HBO A;  2M2B A;  2RQ4 A;  1Q7Y T;  2KHD A;  8RUC A;  3G82 B;  2B7B B;  4I2P A;  2MYF A;  1ARO P;  3GV8 B;  1YQH A;  1M1H A;  2EEY A;  4X4V A;  4B9M A;  1WUU A;  1IUJ A;  4RNH A;  2JVR A;  4DL0 C;  2X51 A;  1VMB A;  5DQI A;  2G9O A;  4C0H A;  1IKW B;  1FVQ A;  2FHJ A;  2QC3 A;  1P1T A;  4KFB A;  2WVF A;  2EFN A;  2CNO B;  1AZS B;  3KUE A;  3CD6 S;  3BBF A;  3THV A;  3B4D A;  4GO5 X;  1FCA A;  2W4C A;  4ID5 B;  4FF2 A;  2XLK A;  1Y0H A;  2FDN A;  2D7S A;  3WZ0 A;  1I1G A;  3BGO P;  2KL8 A;  1M5O C;  4NAS A;  1RTD A;  2ZD1 B;  2M8H A;  1F9E B;  1FFG B;  3OR1 B;  2HWT A;  1RE1 B;  4F7V A;  2G2Z A;  2DIU A;  3DLG A;  4RW6 A;  4DSE A;  5A8W B;  3UVJ B;  4DL6 A;  3PO4 A;  2HKE A;  3OW2 R;  3F41 A;  2HAI A;  4ENO A;  1D0E A;  5DLG A;  2ROE A;  4I1T A;  3DHW C;  2MY7 A;  1HA1 A;  3BSC A;  3L7O A;  5KFI A;  2ACY A;  3FBE A;  4F67 A;  4LF8 J;  4EBE A;  3DOM A;  4AXJ A;  2KXH A;  2NXC A;  2H4W B;  3CPW R;  3IRX A;  4IH6 A;  1RT4 A;  3TP2 A;  2AD9 A;  4GKK F;  2DO0 A;  3R1L A;  2G2Y A;  2G13 A;  3R7S B;  3SCI E;  2DPJ A;  3CW2 C;  2QV6 A;  2COL A;  4F3Q A;  3MM5 A;  2HG4 A;  4RU9 A;  5L9X A;  2HIQ A;  3KKF A;  2PI5 A;  3DMJ A;  2BM1 A;  2XLI A;  1SKR A;  4AT1 B;  1WD6 A;  1PYO B;  2F8H A;  3QGP A;  3HHD A;  4LT6 A;  3OVA A;  2DO4 A;  4X66 F;  4DV4 F;  2H65 B;  4GC6 A;  3IR5 B;  2W8L A;  2XSJ A;  4PZV A;  4K4S A;  4NLY A;  3NCR A;  4NA3 A;  1LXJ A;  3QIP B;  4F3O A;  3MEE A;  4IOC Q;  2JLF A;  3I56 S;  1UCN A;  1U0H A;  1Y00 A;  4G1Q A;  1CC7 A;  4KBI A;  2CXE A;  2HBR B;  3O5T B;  4CT9 A;  1WWH A;  3I55 S;  1PIL A;  4LF5 F;  3GQC A;  2MMY A;  3M9M B;  1QSY A;  1OYE A;  3MMJ A;  1HMV A;  2HND A;  4PXC A;  1S4F A;  1T95 A;  3ZZY A;  2DR9 A;  2M0G B;  3DGP B;  4TYA A;  3OXG A;  1X7V A;  3HHN B;  1VFJ A;  1VS3 A;  3V81 A;  3ENQ A;  1P1L A;  3FUY A;  4LSN A;  1S99 A;  3CO9 A;  2K3I A;  2H5J B;  5IXU A;  4P7V A;  3MF5 A;  2J9D A;  2R4F A;  2AZ1 A;  3B8H A;  2HIY A;  2G1H A;  1RT6 B;  4DS5 A;  1S7I A;  3ISZ A;  4OX9 F;  4RW4 B;  1S49 A;  3ADA C;  3GMG A;  5KFT A;  1WC3 A;  1PYT A;  1WC6 A;  3FQK A;  3DFE A;  2XGP A;  3BH6 B;  5HJX A;  2IA6 A;  1SBR A;  1NZA A;  2E5G A;  3I4H X;  5D3G B;  1Q8B A;  1YKW A;  4IDK A;  3I4P A;  2J9E A;  5CZV A;  5CYQ B;  2C3O A;  4L72 B;  3HCX A;  3CJ0 A;  3ET6 B;  2RU9 A;  1B0P A;  4H4M A;  1TV6 B;  1WJ9 A;  3QT8 A;  1NJI T;  2WB4 A;  1RWK B;  3J80 Y;  3PYD A;  4DSI A;  2CPI A;  4X66 J;  4DV4 J;  3H5S A;  1TL1 A;  4B08 A;  1V9O A;  2YNI A;  5KT3 A;  1SJ4 P;  2MKH A;  3PG9 A;  2XEX A;  5L9N A;  5J1E A;  3QZ7 A;  4A8S A;  1S59 A;  2UVV A;  1LW0 B;  2WHO A;  1X0P A;  3PX6 A;  2QG9 B;  4I6W A;  1N5S A;  3VF0 B;  4JUZ A;  1H2U X;  2QA1 A;  3M32 B;  3RYL A;  4FP9 A;  4YUD A;  2QLJ B;  4NLO A;  5FII A;  2B9Y A;  2E5J A;  3GG0 A;  3OD2 A;  5G0R B;  1F60 B;  4OI1 A;  1X5P A;  3H0P A;  4NX9 A;  2IM2 A;  1H7W A;  2FIU A;  2IVM A;  5I4M A;  5A0Y B;  2BOA A;  4LF5 J;  4LIW A;  2LP4 A;  4HAC B;  2RU3 A;  1S1X B;  2GHW A;  3R2C J;  1L3U A;  4B02 A;  2CQ1 A;  2XHC A;  1L3K A;  1CC8 A;  2BOP A;  2OD4 A;  3O8W A;  3CDU A;  4ZPB A;  2DJW A;  3AD9 C;  3CTR A;  2FLL A;  4Y0F A;  1JIH A;  2W9C B;  4ECV A;  1ZA2 B;  3ETM A;  1IM6 A;  3R2D J;  4TU7 A;  2ZM6 J;  4DR6 F;  3ZZO A;  1WHW A;  2QGF B;  4BHQ A;  2QO3 A;  1N88 A;  4OX9 J;  3G87 A;  5HAT A;  4QJV A;  1W7W A;  3C15 B;  5ADZ A;  1YJ9 S;  2VG7 A;  3MM7 B;  4F0M A;  2UUA F;  4IYQ A;  3DM2 A;  1FJG F;  3TAP A;  4OZ2 A;  4AQY F;  5AE2 A;  3A12 A;  4R5P B;  2WBM A;  1MSW D;  5HAO A;  5J2Q A;  4M63 A;  1JLE B;  1U0S A;  1V6H A;  1WDT A;  3P6Y C;  4WE1 A;  1Q95 G;  5F41 A;  1R31 A;  2M88 A;  2C3P A;  3OFF A;  5KFO A;  4OJ1 A;  1CJU A;  3FRY A;  2X3D A;  4M5D A;  4OI2 A;  3W9H A;  5ETQ A;  1B4S A;  1KVI A;  3HT0 A;  4KH0 B;  4P6Q A;  4LRB A;  2BXJ A;  4LRE A;  1OSC A;  4HYK A;  1E6Y A;  3V4M A;  2N7Y A;  1M5V C;  2IC3 A;  2GMH A;  5KT2 A;  2ALY B;  5F8G A;  2KKH A;  3IR6 B;  4OYP A;  2FLP A;  4EZ6 A;  2NUH A;  1U1Q A;  4JB8 B;  4I2Q B;  1X4H A;  4K50 A;  3GJS B;  5T41 A;  2F5G A;  3WHI A;  1GXU A;  2XO6 A;  4R0J A;  3TQ1 A;  2GFF A;  4KGX B;  1JLF B;  1IKX B;  1Y9O A;  7FD1 A;  4ZHR B;  2WW8 A;  1EX8 A;  2NR0 A;  5BJR A;  4F4K A;  2L9W A;  3NNH A;  4TLQ A;  3NY0 A;  2ABY A;  3N0V A;  2RIL A;  2DXD A;  4OHZ A;  1Y7P A;  2MQP A;  2MZT A;  4AL5 A;  5HAN A;  1HQU B;  2Z2Z A;  5HMY A;  2BJ8 A;  1T9V A;  4Y28 C;  1A6L A;  1ZTT A;  4Y2C A;  5D4L A;  2ZOF A;  3CCJ S;  5B0C A;  4DZ6 A;  3TVK A;  1AT1 B;  2NSC A;  1DHM A;  4CYU A;  5DO2 A;  1HI1 A;  2YWH A;  2ZKT A;  4P75 A;  3W2V B;  4TY9 A;  3M8Z A;  1VOM A;  2UUA J;  1FJG J;  4L74 A;  3MED B;  3ZC4 A;  1GNK A;  1NHV A;  5IQ6 A;  4AQY J;  1FJE B;  1HIY A;  4RKU C;  1UMJ A;  3QFH A;  1VQ7 S;  2OPQ A;  1WSR A;  1RTI B;  2RH3 A;  3OJU A;  4OJ3 A;  3MEC A;  2BRK A;  2HHP A;  1MRO B;  4PWD A;  4QIV A;  4F02 A;  1U26 A;  1BUX A;  1Q5V A;  3R27 A;  1G2E A;  1FK9 A;  3FEY B;  4HTI A;  1GMW D;  1TTH B;  4JOU A;  2W25 A;  4ECY A;  1X4A A;  1XR7 A;  5GAH I;  2JC0 A;  2P9E A;  2CNN B;  3M2U B;  1HWU A;  1MN9 A;  5AXK A;  2PMZ D;  2PFF B;  5HBM B;  5AE1 A;  3L4B C;  2OJ3 A;  4YDD B;  2CJ9 A;  5DM7 Q;  3MM6 A;  3NKY A;  3TOQ A;  1EP4 B;  1LEO A;  4O44 B;  3N5B A;  4NXN F;  1NKE A;  1ZM9 A;  2A6O A;  2J7U A;  2HFZ A;  3C14 A;  4I67 A;  4FBU A;  3M6W A;  5B0F A;  4QR0 A;  5GMD A;  3ENV A;  1APS A;  2W8K A;  2BAN A;  1YJU A;  2MQQ A;  2PN6 A;  4LQ3 A;  2QA4 G;  2OO4 A;  3KK1 A;  3KG4 A;  4CLS A;  3QRR A;  4Q0B B;  2F63 A;  2V4J B;  3JSM B;  2BE9 B;  3CCT A;  3W5Z A;  1TKX A;  3HK2 A;  2A2C A;  4CLU A;  4ETX A;  4R25 A;  2FZC B;  5BYQ A;  2D41 A;  4ZVP B;  3T41 A;  5E3A A;  2CPY A;  2V63 A;  1KKH A;  2ZWO A;  3TUI C;  1U1N A;  4P73 A;  5C24 B;  2DH7 A;  4DXL A;  5KFW A;  1MU2 A;  1ZZN A;  1RAI B;  1VQN S;  4WFY A;  3K8V A;  3WDO A;  2HK2 A;  4DV1 F;  5KG2 A;  4YY3 F;  4ECW A;  2HWI A;  3DLE B;  3C6T B;  2CQ4 A;  5K8P A;  1VHI A;  5B0E A;  5D15 A;  2GVD B;  3E01 B;  1C1C B;  3IM9 A;  1M5K C;  2ZNY A;  2HVI A;  1C4C A;  2IBO A;  4DLE A;  3TZW A;  3BGR B;  2B8Q A;  4KGM A;  3T1A A;  2VU5 A;  3D5M A;  4IFV A;  2AMC B;  5KFB A;  2HHS A;  1U6B A;  1Q86 T;  3C3L A;  1LNQ A;  5CA5 A;  4ZVU B;  4QIG A;  3OUY B;  3OFE A;  4CH0 S;  1FRK A;  2IMW P;  2BBE A;  3PFO A;  5E3Q A;  1S9E B;  1HNZ F;  2HRT A;  3I32 A;  3VZI A;  1URN A;  1R27 B;  1C0T A;  1S9G A;  1UA1 A;  3MPY A;  2DNL A;  5HK4 A;  3GYX B;  1ULR A;  2CQ2 A;  4C6A A;  2HS0 A;  1N33 J;  2CQP A;  3GIK A;  1YTY A;  2MSS A;  3PYF A;  2A1B A;  1S7H A;  2HBQ B;  3HVR A;  2RML A;  3G82 A;  4QQB A;  3VAF A;  1YDL A;  2YPZ A;  1W2B R;  1JXV A;  3MCO A;  2R7W A;  2EWH A;  3JQK A;  2HQF A;  4LJM A;  5M2R A;  5ETN A;  3NCP A;  2DNM A;  3JXO A;  2H54 B;  3FJ2 A;  2CNK B;  4ZDN A;  2V4Q A;  1PC4 A;  4DR3 F;  1VYA A;  2Y3Y A;  3VAG A;  3UI3 A;  5GAG U;  1SXL A;  4G65 A;  4UUX A;  1IKW A;  1H38 A;  2VOD A;  5J1N A;  3RBX A;  3IGV A;  2DCL A;  4ICL B;  4OV1 A;  1UVL A;  2EK1 A;  1SUQ B;  2XTJ P;  4TXS A;  3FCW A;  1DRZ A;  4ID5 A;  4CH7 A;  2VHG A;  1RHK B;  5H9F K;  5CAB A;  2P9C A;  2BYC A;  3W62 A;  3DCA A;  2IRU A;  2HVE A;  3Q8R B;  5KFE A;  5KFR A;  1FXL A;  3OR1 A;  4DV1 J;  2XG8 A;  4RLE A;  4YY3 J;  5A8W A;  1M5S A;  4YN3 B;  3UVJ A;  4CRJ A;  2CVI A;  2G0J A;  1J2V A;  4NLR A;  1S1T B;  1Z4U A;  2QLB B;  1NUE A;  3PRD A;  2XY7 A;  3CJ4 A;  3O44 A;  2IY5 B;  4UQG A;  2Q6B A;  5L8R C;  1TMM A;  3PCO B;  3HHL B;  2VZ9 A;  3UD4 P;  1GMV A;  3D66 A;  3FDS A;  2BQR A;  1PC5 A;  4E0D A;  2JWN A;  2YQ3 A;  2ZC3 A;  4RWX A;  4I6A A;  4TYB A;  1RB0 A;  1JLQ B;  2MZQ A;  1FNO A;  3CNQ P;  4PG6 A;  2K7J A;  4KGK A;  4FXD A;  2B9E A;  3G6V A;  3KHL A;  4YHH F;  1FT8 A;  4Z7C A;  1HNZ J;  3CME S;  4PWW A;  3KLI B;  1JKH B;  1NK9 A;  4K5R A;  1XEZ A;  2OPP B;  4PQU B;  2PFD A;  2IBK A;  3OXL A;  4ED7 A;  3TWZ A;  3BSO A;  1SQF A;  2R7R A;  1HNI B;  1N0U A;  5KOX A;  1VC0 A;  1UW9 A;  4ANE A;  3R5A A;  1R8P A;  1REG X;  4KC5 A;  1VQO S;  2AJ4 A;  2FC8 A;  2KRB A;  1VK3 A;  4IQM A;  2VON A;  4ATN A;  3BH7 B;  2KRR A;  2EG2 A;  2OLW A;  2V68 A;  2W2M P;  4DR3 J;  3HHL C;  4F04 B;  4CDI A;  4DR2 F;  3THT A;  2FPH X;  1RAC B;  3OPK A;  3EGZ A;  4ZCI A;  1NH8 A;  4WP3 A;  3HHE A;  1KC8 T;  4OIX A;  1TL4 A;  1Q7L B;  3WX8 A;  1MW7 A;  4USU A;  2LQ8 A;  2VV5 A;  3NGS A;  1UAW A;  4C97 A;  1J27 A;  4FS2 A;  1JWW A;  1TMJ A;  4QWA A;  4CCH A;  3C19 A;  3RRH A;  3POT B;  2YWE A;  9RUB A;  3DNC A;  3NCQ A;  1YJR A;  1WEL A;  2AHO B;  2EVZ A;  3M9N B;  3KNA A;  4K4U A;  3D9B A;  2EG1 A;  1QTN B;  4NLW A;  3M9O B;  5KFN A;  2EI5 A;  3AXK A;  4JI8 J;  5AXL A;  4HH0 A;  1RAO A;  3W2W B;  5KAK A;  2X1A A;  2VPX B;  2LU1 A;  2IAJ A;  4NLX A;  5IV4 A;  1RT6 A;  2ZH6 A;  5KFU A;  1UL3 A;  2DIT A;  4WYL A;  4EYI B;  3M1V B;  3MM8 B;  3I87 A;  4DX7 A;  2E1A A;  1H3D A;  3I9Z A;  1PAU B;  1IQZ A;  2PD1 A;  3N6N A;  4X4U A;  4WTO B;  5CD4 A;  2CJA A;  1FNX H;  3D6F B;  4Q7A A;  4YHH J;  2HYI B;  4FKY A;  1CJK B;  4D3H A;  3FEZ A;  3VAK A;  4LRC A;  5CYQ A;  3IWX A;  1IN0 A;  4GVB B;  2DYA A;  4FYX B;  2CPJ A;  2VDI A;  4HVZ A;  1EQM A;  4I0W A;  2DR8 A;  4ZN1 A;  2UUB F;  1JLG B;  2NRE A;  2LQJ A;  4LBP A;  4M5N A;  3H4B A;  4FNI A;  1PYS B;  3JTP A;  2UUT A;  1K47 A;  2C2N A;  1NKC A;  4WCE Q;  1VHF A;  3MMB A;  2AW0 A;  3FFI B;  4NLQ A;  1DTT B;  3OHA A;  3EGW B;  1FA0 A;  4XPC A;  1FDD A;  4DR2 J;  4NML A;  5G0R A;  4OYO A;  1WHX A;  4H54 A;  4MK9 A;  3KUH A;  4RNN A;  1ZAV A;  4C8N A;  4HAC A;  1NDK A;  2H4Y B;  3W61 A;  1S1X A;  1ZS6 A;  3CJ8 A;  1QVG R;  1VIX A;  3CMA S;  1RBL A;  2BKO A;  4HKQ A;  2FGO A;  2KI2 A;  1TK0 A;  2V2Z A;  1KP6 A;  1UW4 A;  2QYG A;  3T1H F;  4DQQ A;  1C0U B;  4K4X A;  5D4O A;  4N47 A;  3A8E A;  4YB1 P;  4WIQ A;  3T1Y F;  1PBU A;  3HI9 A;  1NHU A;  3GB0 A;  2PMW A;  4ZVH A;  4BWJ A;  1R0A B;  1TAQ A;  1T9U A;  3V6D B;  3MM7 A;  3P3D A;  4G6V B;  3HKZ D;  2YWF A;  2ASD A;  3MMC A;  3VVU A;  3HKW A;  2VPY B;  4L76 A;  4PPZ A;  1YZ7 A;  4R5P A;  4AYB D;  2HMI A;  2AJ2 A;  2W4P A;  2XMV A;  1N32 F;  1JLE A;  2VG6 B;  2W2P P;  5SUH A;  2DXF A;  4CT8 A;  4QW8 A;  1H2T Z;  4MIB A;  4DF4 A;  3AOD A;  3LAK A;  1FTC A;  1T8E A;  5CXT A;  3UD5 A;  2X1G A;  2D3Z A;  3HVT A;  1RKJ A;  2OPS B;  4LVN P;  2UV8 A;  3MXH P;  2MJU A;  4ZVS B;  3J81 Y;  3KLH B;  5A2Q U;  3DRR B;  2NQP A;  1D9F A;  1QAI A;  3DRP B;  3CCS S;  3AFG A;  4O3S A;  1UPM B;  2CG8 A;  2KH9 A;  3R5G A;  4ZLP A;  3MAA B;  3EDQ B;  4I2Q A;  3ZO7 A;  1EHW A;  4C8L A;  4A8K A;  3GJR B;  4ELV A;  4PUO A;  1HNX J;  3AOC A;  4ZHR A;  2M5Y A;  3L09 A;  1X5O A;  1U2C A;  2C28 A;  1GMW A;  4B9T A;  1IM4 A;  3QSI A;  1RT5 A;  4ZLJ A;  4E2F B;  1U49 A;  3LW5 C;  4OYZ A;  2CQ3 A;  2V0N A;  4JV2 A;  3C2P A;  1JLA A;  2MKY A;  4W4M A;  1OYD A;  2KN4 A;  5K5M A;  4I56 A;  5KFJ A;  2HPU A;  5L46 A;  2VKZ G;  3JTO A;  3NRB A;  4DFP A;  1X4G A;  3KLF B;  3T1H J;  4PQA A;  1WHY A;  4N8O A;  2P8I A;  3I0S B;  1S6P B;  1ZOT A;  4K5S A;  3T1Y J;  3CUL A;  1BLU A;  3J81 j;  3W2V A;  3I5A A;  4IFY A;  6AT1 B;  2AGQ A;  1DUR A;  3GYN A;  2C2O B;  4DN0 A;  2O66 A;  3MED A;  3DI6 A;  2QA2 A;  4I69 A;  4WP9 A;  3PVX A;  1N32 J;  1SV5 B;  1RTI A;  3G8Q A;  2QTW A;  3Q2T C;  4EBC A;  3A4T A;  2EK6 A;  1MWY A;  5ETS A;  4WBF A;  5BR8 F;  4CQ1 A;  3BKU A;  3IFE A;  2KG0 A;  3IAM 9;  4X62 J;  4LRA A;  1BQM B;  2YVS A;  4URG A;  1PO6 A;  1LFP A;  2WOM B;  5C25 B;  2HZA A;  2ZH4 A;  2VG5 B;  3OXF A;  4RNO A;  1NB7 A;  4NEZ A;  3M2U A;  2EFV A;  5D0H A;  3NWG A;  3KLV A;  1IBL F;  5CYM B;  4LSL B;  3CO0 P;  1NDP A;  1SKU B;  1UJ5 A;  4O44 A;  5DG8 A;  2KFY A;  2FJB B;  2PGC A;  1NPK A;  3P5B P;  5JXS A;  2AYG A;  2MQN A;  3SEO A;  3QQC D;  2AU0 A;  1A0O B;  3DDN A;  3VGS A;  5L1L A;  2YX4 A;  4FXW A;  4Q0B A;  2HQD A;  2V4J A;  3JSM A;  4G1P A;  1VCT A;  2YKP A;  5IV3 A;  2ZDO A;  1VBK A;  4P2M A;  1BXN A;  2L48 A;  1SIW B;  2E5I A;  2HZV A;  1VLO A;  2EFG A;  2KYZ A;  2VOP A;  5HO4 A;  1KQF B;  4P2S A;  2RD5 C;  2MXY A;  1BWE A;  3OT9 A;  5HL7 Q;  3WC0 A;  2UU9 F;  5EDW A;  4MH8 A;  2HRY A;  1EIY B;  1RCX B;  3L7P A;  3T5H A;  4CM2 A;  5IZH A;  3X1L B;  1PSD A;  4AXI A;  2MY8 A;  5C24 A;  3OTD A;  2HHV A;  2DRB A;  4ECZ A;  3V4I B;  4LFC F;  2GJI A;  3ULH A;  2VQE F;  2FGC A;  2ERR A;  4FYY B;  3MUV P;  1BQN A;  1YZ6 A;  3DLE A;  2J0W A;  2YY3 A;  5BR8 J;  3P4U B;  4NLP A;  1RA7 A;  4A8Q A;  4Q8E A;  2GVD A;  2IDL A;  3CD7 A;  4UZC A;  3QZ8 A;  1C1C A;  2CUY A;  5K9F A;  2FY1 A;  3BPD A;  2XUL A;  2P2C B;  3TRG A;  3LP2 B;  3BGR A;  2PEH A;  5KFY A;  2DY9 A;  4W98 A;  1RAD B;  1MG7 A;  3HLU A;  2YWG A;  2HHT A;  1F3F A;  1IBL J;  1LW2 B;  3OUY A;  4OMF G;  2ZHA A;  2R7O A;  4MIA A;  1S9E A;  2ZH1 A;  2U2F A;  2VBX A;  3KJF B;  4DR5 J;  3T5K A;  3SQG A;  5GME A;  5JUM A;  1LWC B;  1YWX A;  2XC9 A;  1UVM A;  2XNQ A;  3NLC A;  4FN5 A;  2NXN A;  3Q23 A;  2NPF A;  3ZZU A;  1HKA A;  2B5J B;  4F26 A;  4CH1 A;  2F40 A;  3W1Y C;  4AFF A;  3BJY A;  1WI6 A;  1VQP S;  1UP1 A;  2B9W A;  3N79 A;  1YGY A;  1QTM A;  4IG3 B;  1KHW A;  5K20 B;  4C8K A;  3NEK A;  4LF2 A;  1H98 A;  1CS4 B;  1SUQ A;  1FI4 A;  4EK2 A;  2WW4 A;  2UU9 J;  1VRU A;  2MKI A;  4GMK A;  1QSL A;  5HQM A;  1B0V A;  3WC2 A;  1N5T A;  1SIZ A;  4ES2 A;  4PG4 A;  4OYI A;  2B51 A;  1JNR B;  2JL9 A;  1V3R A;  4KAI A;  4LFC J;  3UDL A;  2OI2 A;  2MDA A;  1YRX A;  5DDQ C;  1WAC A;  2P6S A;  4ED6 A;  4B3S J;  3G8S A;  3OHB A;  4RWW A;  5EX3 A;  1Q5Y A;  1B7F A;  2RKI A;  2K2P A;  1HI8 A;  3CJK B;  3MUT P;  2IRY A;  1A9N B;  4C2M A;  3CC4 S;  1T0T V;  4AD6 A;  3HHL A;  2V8D A;  3W5Y A;  5J2M A;  2FVS A;  2VC1 A;  2J8A A;  3TVY A;  1YBA A;  1T9T A;  2DNG A;  4AUK A;  3QO9 B;  1YG0 A;  3KK2 B;  1K73 T;  1L3S A;  1G1X A;  1JLQ A;  4NLT A;  4WFZ A;  3OVS A;  4DCO B;  4WZM A;  2FUG 9;  4Z7Y A;  3TAR A;  1T03 B;  2XMW A;  1HBO B;  3TEH B;  3TZY A;  3JYT B;  3M6X A;  2FVQ A;  3KLI A;  4AE5 A;  2JEI A;  2YNF A;  1FKO A;  2OPP A;  2P5V A;  2QT7 A;  4EO6 A;  3GU0 A;  3S1T A;  2QL9 B;  4NLG A;  3LPE A;  1HNI A;  2CKW A;  3NS5 A;  2WON A;  1RWX B;  4C7Q A;  1GFW B;  1SPB P;  2FD2 A;  4K2X A;  2VPZ B;  3BR9 A;  2QA4 S;  4WZQ A;  4P2F A;  5I3Q A;  4TNO A;  3A8J A;  1QD1 A;  3UFC X;  3K58 A;  2NCK L;  1PBA A;  3PX4 A;  4LQ9 A;  2BUN A;  3PHE A;  5CYJ A;  3K17 A;  5F8M A;  3HSG A;  3Q24 A;  1L3T A;  2OFH X;  3CE8 A;  5HMZ A;  2RS2 A;  3OTB A;  2DK2 A;  4RW6 B;  2RDD A;  1N5Y B;  3W60 A;  3DLL Q;  2PA8 D;  4DDF A;  4NRU A;  2R8J A;  1RUS A;  1I3O B;  3POT A;  4K0K F;  2CPF A;  2M7S A;  3KG0 A;  2QLX A;  2HBZ B;  2BE7 D;  1HHS A;  2Q43 A;  1IBK J;  4JV0 A;  1SC4 B;  3SXL A;  4NZ7 A;  1KBR A;  3W2W A;  3H8Y A;  2CQD A;  1HBM A;  3IRX B;  1I94 F;  2RNE A;  2DGU A;  2HLT A;  4J9V A;  3M1V A;  3MM8 A;  2GQQ A;  3K89 A;  1S10 A;  3Q83 A;  3MM5 B;  1GX5 A;  1KQS R;  1O8B A;  3DMJ B;  2KM8 B;  1HYS A;  3PW7 A;  3D1O A;  4DPX A;  3BYP A;  4XO0 A;  5B0D A;  3RR7 A;  3SDE A;  4OYM A;  1CJK A;  4EWT A;  1L3V A;  2YKN A;  3KJQ B;  3SMZ A;  2NXU A;  2VA3 A;  2Y8Y A;  2DNY A;  4OLP A;  1S97 A;  4HHJ A;  4CO3 A;  2ZBI A;  3BBC A;  1RI7 A;  2XSJ B;  2QE5 A;  1RJJ A;  1NK6 A;  1OQ3 A;  4C3M A;  1SC6 A;  3VAJ A;  1JLG A;  3FBB A;  4WPA A;  1UVN A;  3RU0 A;  2AX0 A;  4J9U E;  1W2I A;  3AH6 A;  3N5F A;  2DHG A;  1H6K X;  1DTT A;  4F4Y A;  4UY8 T;  5KFH A;  4WFA Q;  3VAH A;  2CQ0 A;  1KFS A;  5EUH A;  2C2Z B;  2A18 A;  1V5I B;  1F3V A;  5BXI A;  1HMV B;  3OR2 B;  1HPZ A;  1ZAX A;  1TUV A;  5D6G A;  4DFJ A;  5ETM A;  3ELH A;  2KM8 C;  3AQP A;  4WXO A;  2EW9 A;  3KDN A;  3D28 A;  4LR7 A;  4OJG A;  3V81 B;  4LSN B;  5EWF A;  3BV8 A;  4IR9 A;  1RHR B;  4ANC A;  4K0K J;  1RAA B;  5LSL A;  5KOW A;  5DS7 A;  4OHY A;  3VQT A;  1LWE B;  2WB1 D;  1S79 A;  1I94 J;  3O6Q A;  3IBW A;  1VLY A;  2DNN A;  1OY6 A;  2RVJ A;  2HFU A;  1YJN S;  1T11 A;  2HQG A;  1R0A A;  2RHS B;  1X0F A;  4MK8 A;  3KMS A;  1PJ5 A;  3U7J A;  4DCP B;  3C8Y A;  3BQ2 A;  4IDK B;  3CJR A;  3PR4 A;  3FCV A;  1RAG B;  4DQP A;  2K06 A;  4P7T A;  2EKY A;  1T9W A;  1ZH5 A;  2JZ5 A;  2VG6 A;  2Z58 B;  2ZEJ A;  5A6P A;  1IWA A;  1TL1 B;  4YFU A;  4ZVO B;  2YNI B;  3LP0 B;  4NYP A;  4Q43 A;  2CNL B;  2AYM A;  4Y6I A;  2FVR A;  1CJT A;  3U1M A;  1N34 J;  2OPS A;  2V5H G;  5J1E B;  5HVH A;  3SYZ A;  2YWW A;  4N8N A;  3LOU A;  4MKY A;  3GG1 A;  3HO1 A;  3QGH A;  3DRP A;  3EX7 B;  1KDN A;  4NI2 A;  3G96 A;  3TZZ A;  4A8W A;  3UWT A;  1TUG B;  3Q89 A;  3OL7 A;  5IM0 A;  4TLR A;  4A8F A;  5KFA A;  4N56 A;  3DOL B;  4ZIV A;  5JMN A;  1C4A A;  3K5P A;  3MAA A;  3DLH A;  2UXB F;  3MDF A;  1X5T A;  2B4P A;  5HSP A;  3FZB A;  1GTH A;  3CDW A;  3ZNU A;  3TAM B;  3FSY A;  4PG7 A;  2CIM A;  2M4M A;  1XK8 A;  2QLW A;  5DRK A;  4CNZ A;  3QID A;  3OTE A;  3HP6 A;  4K4V A;  3R97 A;  2KJW A;  4RX6 A;  4ED4 A;  2CDR B;  5A6W A;  2LLZ A;  3V6J A;  2C22 A;  1U8S A;  2VFS A;  3ILL A;  1RBA A;  1ROF A;  2DEI A;  1TL3 B;  4P2X A;  2M52 A;  4NWB A;  2VG7 B;  4QCL A;  3VHQ A;  3I0S A;  1S6P A;  3DM2 B;  4EZ9 A;  2MPU A;  2RB7 A;  5GAE I;  4RW9 A;  1EAR A;  2M3D A;  4J9K A;  4DPY A;  2LFV A;  1KS2 A;  4B9L A;  1YBU A;  2V8P A;  2E7W A;  1JJ2 R;  1FFS B;  4LMZ A;  1K0V A;  1T9Y A;  1UA0 A;  2BDP A;  4CO1 A;  1S0N A;  2MQL A;  1UEV A;  5L39 A;  5JJB A;  3US5 A;  2HGN A;  2VOO A;  3I9V 9;  2HK3 A;  4NPO A;  4ER8 A;  1SV5 A;  4EYH B;  3X3U A;  2DR6 A;  2CAJ A;  1QUP A;  4QWC A;  2FJW A;  3OL8 A;  4F2S A;  3GFH A;  3ZZP A;  4M94 A;  1FEH A;  1J5E F;  4KE5 A;  1B99 A;  3LP1 B;  2CJK A;  3DRS A;  1BQM A;  1VR6 A;  2IC3 B;  2CAD A;  2DNK A;  1F2H A;  2WOM A;  1G3O A;  3K0J A;  2A2D A;  3M8Y A;  1ZPW X;  5EWE A;  3LAM A;  3BDE A;  1H72 C;  3GII A;  2AJ0 A;  1KSP A;  2OPR B;  4FF4 A;  4WK3 A;  1JJ4 A;  5CYM A;  4J90 A;  4LSL A;  2J5A A;  2BJ3 A;  1PG5 B;  2UXB J;  3IBC B;  4PWU A;  1WG5 A;  4M5H A;  3W8P A;  1DJ0 A;  3DKD A;  2M70 A;  2KTQ A;  3CJQ A;  3JQM A;  4ZCM A;  2XBP A;  1DZ5 A;  1N5V A;  1U47 A;  4KHM A;  1RDR A;  1R7I A;  3CCZ A;  2GIR A;  3LQV A;  2MGZ B;  4DV2 F;  1NBE B;  3J7Y I;  3QAT A;  1Q8L A;  3TZX A;  4ZPC A;  1DFD A;  5CHC B;  4X4N A;  4PAA A;  4MYT A;  5GAD U;  2F9J A;  4DU7 A;  4LR9 A;  4ITS A;  3SCK E;  1R6Y A;  4S0M A;  4WYW A;  1GXT A;  2HNY B;  3VQS A;  2OPQ B;  4CWB A;  2PC6 A;  1D09 B;  2DGO A;  3HPO A;  2KB2 A;  3DHX A;  1PKU A;  4UOH A;  2ZJR Q;  2RRN A;  1MLA A;  3MGJ A;  3VAM A;  1FK9 B;  4RW8 A;  2CJB A;  1ZA1 B;  1YJ7 A;  1NK8 A;  2DXE A;  5L1K A;  1NCL A;  1B7Y B;  1J5E J;  5F3T A;  3EMT A;  2RUS A;  4QU6 A;  3HD1 A;  1NRK A;  4CZC A;  1HHT P;  3LP2 A;  1LQ9 A;  3WIU A;  3R5J B;  4ECU A;  2C3U A;  1NSK L;  3T3F A;  2V8H A;  3NGD A;  4F3M A;  4NLS A;  3F56 A;  4DF8 A;  1P9Y A;  3C14 B;  2PI4 A;  1LW2 A;  3PR5 B;  4Q8F A;  2JX2 A;  3FC9 A;  4QYZ K;  2Z4P A;  4NA1 A;  4HHH A;  4Q5V A;  1LWC A;  4L75 A;  2HUR A;  2MLZ A;  3V6K A;  2K1R B;  3TX8 A;  2WK4 A;  3D1H A;  3NL0 A;  3EXY A;  1N6Q B;  3D0H E;  4U6P A;  3KG1 A;  1BHN A;  2B5J A;  4X4T A;  3Q8P B;  1H74 A;  4Q44 A;  2QRR A;  4YS2 A;  3NMA A;  1AFI A;  4MYU A;  2ZHB A;  4DV2 J;  5HP1 B;  3K5N A;  2PMH A;  4DR1 F;  3LTO A;  3CD0 A;  3Q8Y A;  4HT5 A;  3MM9 B;  2YX7 A;  2J0Q D;  1NLK L;  1FRJ A;  3J7A N;  1S1W B;  3QRQ A;  3OTO F;  1MU2 B;  4ZJQ A;  2HVD A;  2L41 A;  2CWX A;  3KFW X;  1F9F A;  2M9K A;  3MAH A;  2FYX A;  2LDI A;  1EB0 A;  1X31 C;  4B3O A;  3PDN A;  2E1M C;  1CUL A;  1GMU A;  2ASJ A;  1S9F A;  2QL7 B;  2U1A A;  2GMJ A;  2CPH A;  4U7C A;  4CLW A;  2KFN A;  2DIS A;  3MTK A;  4KHR A;  3ILJ A;  3PKY A;  4ZKA A;  2ADC A;  4KB7 A;  1MML A;  4J9O A;  5EWG A;  3HFK A;  3D67 A;  1FRM A;  2EFQ A;  3QO9 A;  3M2V B;  3KK2 A;  2UUC F;  1C0T B;  1S9G B;  3GON A;  2MEW A;  1SQE A;  1CSJ A;  5L1I A;  3S7R A;  1N54 B;  1T03 A;  2OMO A;  5IQQ A;  1UZH A;  3HM9 A;  4HHU A;  3JYT A;  1WC1 A;  2FLO A;  5IWA F;  3VTI A;  1H0H B;  3CC7 S;  2ACM A;  3EZU A;  4I7F B;  1NJY A;  2LMI A;  2ZE2 A;  3BM7 A;  2CQI A;  1JNZ B;  3PW5 A;  3T6J A;  4IO1 A;  5KFP A;  3TA1 A;  1TQL A;  1B64 A;  1RTH B;  2J0X A;  2ZOG A;  1Q4R A;  2E7V A;  3ZXW A;  4M5J A;  4N76 A;  1P9Q C;  1F6T A;  2W2Q P;  3BN4 A;  4JI0 J;  1QM9 A;  5T14 A;  5F8J A;  4ZMM A;  5THW A;  1RKI A;  4IRD A;  4DV6 F;  2R7V A;  4DSF A;  4PYD A;  4OYW A;  1NPR A;  5CCL A;  4CLF A;  4DV3 F;  3OTO J;  4C4W A;  2P9G A;  2MQM A;  5KFM A;  4WTY A;  2Q1L A;  4Y65 A;  4QBU A;  1S12 A;  3RGI A;  2AEJ A;  2AJF E;  2AIR B;  1N5Y A;  2DY1 A;  1HLW A;  1U6F A;  3QJL A;  1DBD A;  3ISN D;  2QX0 A;  2GHV C;  2ALZ A;  5IC6 B;  2XWY A;  1GEH A;  3A1Y G;  2J7K A;  3QAE A;  2Y0B B;  3PKM A;  2HWH A;  2BJE A;  3PJW A;  1SL2 A;  4DG1 A;  4OJH A;  3SQO P;  1Y3K A;  1WG4 A;  1PCA A;  3MTJ A;  4ILM A;  4OZN A;  3MPD A;  4DLG A;  2E1R A;  3HVW A;  3RAM A;  5A2Q Y;  3OLB A;  2UUC J;  3RB0 A;  3EVW A;  7AT1 B;  1WOO A;  3I5C A;  2LXU A;  2LEP A;  4GRS A;  3RR8 A;  3LWL A;  2XWX A;  5IWA J;  4OYB A;  2NZ4 A;  2FHK A;  1RTZ A;  2V4R A;  5H9E J;  1X9S A;  3BGF A;  2WZ1 A;  2D9O A;  3MMA A;  5DJB A;  1SQG A;  3C16 B;  2F7V A;  1GK8 A;  4LIR A;  1VJW A;  4ZCL A;  3B6B A;  2FJA B;  1ZTW A;  2ZH3 A;  3ZZT A;  3O1L A;  1SC1 B;  5EX0 A;  2KJV A;  3Q8U A;  2HFO A;  4DV6 J;  1TK8 A;  3D2W A;  4O23 A;  3AOA A;  3OR2 A;  3PFE A;  2QN6 B;  4DV3 J;  2Z57 B;  3C66 A;  1RT2 B;  4LF1 A;  1OSD A;  3KJN B;  2LA4 A;  1Q1K A;  3PEJ A;  5KFQ A;  3H25 A;  1S76 D;  4RUB A;  3TAQ A;  2IAJ B;  1RQ0 A;  1MWQ A;  1URR A;  2OEL A;  3I6P A;  4PRF A;  2HW3 A;  1LWE A;  4C8O A;  1CJV B;  3T9Z A;  4GKK J;  1VQS A;  4A4J A;  1MNE A;  2CQG A;  3NOG A;  2F3J A;  1EQ0 A;  2HS3 A;  4NOH A;  2KXN B;  1G7C B;  3W66 A;  4F25 A;  4JI4 F;  2VA2 A;  2DT9 A;  3NP5 A;  4PG8 A;  2BJ9 A;  1KTV A;  4QR2 A;  3DYA A;  7FDR A;  3S01 A;  4JI1 F;  2KHC A;  4P10 A;  4PXD A;  3NS6 A;  1WOR A;  4ELT A;  2Z2Y B;  5EN1 A;  3LP0 A;  3MMB B;  4M5K A;  1U1L A;  4USV A;  2EBE A;  4J9L A;  1RAJ A;  4OFZ A;  4ETZ A;  3D68 A;  1H2V Z;  2C3M A;  1FDN A;  1FKP B;  2V2V A;  5LL6 d;  3GZ7 A;  4PKD B;  5LT5 A;  3M6V A;  2I6W A;  5IC4 B;  4CO4 A;  1WEX A;  2AZ3 A;  2FHJ D;  1M90 T;  2BX6 A;  5ETR A;  2R7U A;  5KFX A;  4C98 A;  3DOL A;  4MJK A;  4X84 A;  1SL1 A;  4XIU A;  3EUN A;  1K8A T;  1WF2 A;  2CZV C;  3NBP A;  2H9Z A;  3W3S A;  2R7X A;  3GSI A;  5L1J A;  3TAM A;  2MZS A;  4OZL A;  3I96 A;  1F5C A;  4OI6 A;  1JLC B;  3LAL A;  3QAU A;  1F0X A;  4UST A;  3B4M A;  1O0P A;  2IM3 A;  4JYA F;  4K4T A;  2CJQ A;  2GCF A;  2ZH5 A;  3MUM P;  4ED5 A;  2X1F A;  1R8H A;  2DBB A;  3E3X A;  1WEY A;  3EM1 A;  1FKA F;  1VBY A;  3PX0 A;  1TL3 A;  2DGS A;  4Y2A A;  2B6A A;  3LGM A;  3MMC B;  3QPI A;  4OX7 A;  2KZZ A;  3LWM A;  2OEM A;  2HMI B;  2VFT A;  1GH8 A;  4JI4 J;  4DV7 F;  1FX2 A;  1BD6 A;  3M8W A;  4YEA A;  1RAH B;  2KU7 A;  2YH0 A;  3G86 A;  1AB8 A;  2FZK B;  1CVJ A;  2ASY A;  3HVT B;  4RUH A;  2OFG X;  2EKN A;  2NXJ A;  4KYZ A;  2JH3 A;  1OO0 B;  2LEA A;  2G1D A;  1UWA A;  2AGO A;  1VJQ A;  1VC5 A;  5HVF A;  2XI2 A;  3LP1 A;  3MCM A;  4OQJ A;  1Y4Z B;  4OX6 A;  2W7P A;  5BYR A;  1R3N A;  2HLU A;  5C2C A;  3AXM A;  2I0X A;  5IT4 A;  4ZPW R;  2CQB A;  3QT5 A;  3W65 A;  3HJV A;  3UCZ P;  1QVF R;  4PUO B;  1S48 A;  4F4X A;  2KT2 A;  4USI A;  2C2R A;  2OPR A;  2F8E X;  2ZZM A;  1SC3 B;  3QRP A;  3CSK A;  2H3E B;  8ATC B;  1M5H A;  1JJH A;  4KQZ A;  4L3K A;  4DL7 A;  2OTJ S;  3AJ1 A;  1RT5 B;  1U6Z A;  3HZG A;  3AJ2 A;  4DOZ A;  5SZT A;  2E1C A;  2VL1 A;  3TEG A;  1JLA B;  4ILL A;  4USH A;  1VQY A;  1RWM B;  1LFW A;  2A3J A;  2V69 A;  3M7V A;  3QWU A;  3M8P A;  4RNM A;  2I9S A;  4XAK A;  4JYA J;  2OSQ A;  2IRX A;  3BGL A;  3J7Z 5;  1Y5N B;  2Z56 B;  4DR6 J;  2MLX A;  3IG1 A;  2HHX A;  4Y2K A;  1QDU B;  4IFY B;  2HGL A;  2MGZ A;  2N3O A;  3UN2 A;  1M1G A;  4LRD A;  4F50 A;  5J2P B;  3DI6 B;  2IJR A;  5KT6 A;  5AJ3 F;  5IS2 A;  4KR0 B;  2NYI A;  2HNY A;  3Q2S C;  1HBN A;  1NJW A;  2YTC A;  1QAY A;  4DV7 J;  2V94 A;  1S4E A;  2LKZ A;  2HEK A;  5H1S V;  2HHQ A;  2CFX A;  1KFD A;  1R89 A;  3BKF A;  4ZJO A;  1YX2 A;  1VDH A;  4LF9 F;  5L38 A;  1YLX A;  1FFW B;  2Z8Q A;  1VQL S;  2VAS A;  4B3M F;  5GAH U;  3UCG A;  3BRE A;  3MD1 A;  3MEK A;  4P9S A;  2YPY A;  5A8K A;  3LA0 A;  2XS5 A;  2YKA A;  1OS5 A;  3R3T A;  3KJV A;  2O5D A;  4NZ0 A;  3RJM B;  1U09 A;  3IS9 B;  3DOK B;  1HWJ A;  3T5L A;  2YKM A;  4IRC A;  2WVE A;  4DR4 F;  4C0O C;  3MWB A;  5HLF B;  3RRK A;  4DUY F;  3N01 A;  3QLH B;  2FB0 A;  5DQH A;  4J37 A;  1J5O B;  4O0N A;  1ZM3 A;  2PII A;  3JS9 A;  2J8S A;  3ENA A;  2K1R A;  1U25 A;  3EGN A;  1E6V B;  4EO8 A;  3RBD A;  4WU3 A;  3PYE A;  3DLB A;  2JJ4 D;  1N6Q A;  3H42 A;  1BQX A;  2RQC A;  3QNW B;  4B3R F;  1YVF A;  3FSI A;  3IRW P;  2IA0 A;  4RNF A;  2GAH C;  2GC8 A;  3SZ2 A;  3UNY A;  1YI2 S;  2BJ7 A;  3RB6 A;  1QY7 A;  1R0B G;  2FHO B;  2PO4 A;  5HP1 A;  3DDK A;  2JEF A;  3MM9 A;  1KR4 A;  1SH0 A;  1S1W A;  3HFZ B;  3DLK A;  4JI3 F;  1LKZ A;  1QJH A;  5AJ3 J;  1RXO B;  1RTJ B;  2DB1 A;  2Y1L B;  5E33 A;  4KT0 C;  2AGP A;  4DEZ A;  3QSY B;  1VRT A;  4FXV A;  3KYL A;  4ZK7 M;  4J9S A;  1NK0 A;  4NLU A;  1BQN B;  1ICE B;  3NOC A;  5AXM A;  1NZ8 A;  4B17 A;  2GZO A;  3CUN A;  4IUF A;  1NDL A;  1MN7 A;  1YBT A;  4YR2 A;  4LF9 J;  5B0G A;  3MAQ A;  3G6X A;  4HDG A;  4USW A;  4B3M J;  1RT3 A;  2W2N P;  5DG7 A;  3JAM U;  3J7Z T;  4IH5 A;  3ENW A;  2UV8 G;  4G1I A;  1XJW B;  1ZM4 A;  2FC9 A;  1KOO A;  5C2G A;  4KIA A;  1RHM B;  1QUV A;  2ZH7 A;  1S6Q B;  3M2V A;  3U02 A;  4NXN J;  3SQG B;  3FZ2 A;  5ETL A;  3R5D A;  1TL7 B;  1NHK L;  2EFP A;  2XZW A;  1NXI A;  4DR4 J;  4DUY J;  2ZBP A;  5KG5 A;  2CVE A;  1NPP A;  2Y0S D;  3RRG A;  8AT1 B;  2DGT A;  4NCG A;  4I7F A;  3NWR A;  3K8W A;  3EGV A;  5ITH A;  3KNG A;  4WKR A;  2LCW A;  4C11 B;  4D3G A;  3N28 A;  4LSZ B;  2ASL A;  2XNR A;  1UTA A;  3FK4 A;  4U67 Q;  1RTH A;  4URS A;  5HJY A;  4QWD A;  3ZTS A;  5LMU F;  3HMJ G;  3TJ9 A;  3SFU A;  4DX8 H;  1NO8 A;  1G6B A;  3CIM A;  3BZQ A;  2KXF A;  4FF3 A;  1FRI A;  4X4O A;  2C3Y A;  1VRU B;  4KH1 B;  2MKS A;  4I4B A;  2CA9 A;  5LMN F;  2YQ1 A;  1S1U B;  2VUG A;  1B0T A;  3SV4 A;  2ZOM A;  4JI3 J;  3KK3 B;  4F2R A;  3C6U A;  2VFV A;  1IQT A;  3PW2 A;  4O3R A;  2MTL A;  5LXR A;  4KO0 B;  5T7L A;  4DL3 A;  4I68 A;  2ZJQ Q;  1DQA A;  2MHE A;  2AF6 A;  2N4D A;  1HNW F;  2RKI B;  3M2R B;  3IGN A;  3N6M A;  2JSX A;  3QYY A;  4WWS A;  2J7W A;  3H2L A;  2GO9 A;  3TQE A;  2VD3 A;  5J2M B;  3GSD A;  4DL5 A;  5IT9 Y;  4F0H A;  4J91 A;  3LH2 S;  2UVW A;  4QIE A;  2GHP A;  2R2T A;  2VFR A;  3H5U A;  3F44 A;  1RHQ B;  3UO0 A;  3RG6 A;  1TKZ B;  3WIV A;  3HVA A;  2AKW B;  1N4L A;  2C1E B;  2WBR A;  1FJC A;  1VQ6 S;  2YQ0 A;  4GC7 A;  1FF2 A;  1MMN A;  2YNF B;  1FKO B;  3MFI A;  4WXW A;  4C9D A;  3OV7 A;  1SJQ A;  2AP6 A;  3CDE A;  2KFZ A;  3GP9 A;  5HQ8 A;  2R42 A;  1HWI A;  4LF4 F;  4EU0 A;  4F0K A;  4ID8 A;  2WON B;  2BAB A;  2BKP A;  2I5J A;  1IKY A;  2NUU G;  4QU7 A;  1SJF A;  1U8W A;  3A3N B;  4YQW A;  2W7A A;  5DQG A;  1PJ7 A;  3C16 A;  2BR0 A;  2BJ1 A;  5E3P A;  3PIO Q;  3DRX A;  4WFB Q;  3L9Z A;  2ZH8 A;  3H40 A;  1KN6 A;  4RW7 A;  5EGY A;  5LMU J;  2KDO A;  4DJB A;  2BKN A;  2MQO A;  1JQG A;  4RBU A;  3GYG A;  4A8O A;  1CLF A;  3I5B A;  3QFW A;  2BQU A;  2QLF B;  1HR0 F;  5LMN J;  2GQ2 A;  2B3T B;  1SKW A;  1FVS A;  2ZUG A;  1RT2 A;  4DV5 F;  4JP8 A;  4CI0 B;  2V2Q A;  3AQO A;  2PSZ A;  1BMQ B;  5HQL A;  2H5I B;  4ZVR B;  5LXY A;  2R8I A;  1HNW J;  3EVO A;  1IWG A;  1HBM B;  3TR5 A;  2MJN A;  4ED2 A;  1OWX A;  5FDL A;  2F4V F;  5K14 B;  2DNQ A;  4M95 A;  2MZR A;  4O4G B;  2F1F A;  1T94 A;  4PXE A;  2I8E A;  2Z2L A;  1CJV A;  5LSR A;  2XY6 A;  3SBM A;  1HYS B;  2RHQ B;  2L08 A;  2WSE C;  1KEK A;  3SDE B;  2N4C A;  2YKN B;  1T02 A;  1VGY A;  4YB7 A;  1X4F A;  2WTF A;  3N9U C;  4NEY A;  1AXQ A;  4UT4 A;  5D0R A;  3FBC A;  1GT8 A;  2D74 B;  4LF4 J;  2OEK A;  3W8G A;  3WQP A;  2NSB A;  4KGV B;  1NND A;  1DQ9 A;  4QPX A;  2IJF A;  3M8R A;  1RAE B;  3R5C A;  3IWN C;  1UFW A;  3IA0 A;  3DRY A;  1NME B;  3S6E A;  1I51 B;  3TAN A;  2APO A;  1KQG B;  3RW6 A;  2LDY A;  1FKP A;  2UUW A;  3HD2 A;  3HX9 A;  2F8M A;  1S0O A;  3GFX A;  1UPP A;  1NH7 A;  1HPZ B;  2R2S A;  3OBI A;  4ZP7 A;  1T3O A;  3R5B A;  4C3K A;  4WU2 A;  3W9J A;  5K8M A;  1LXN A;  5J2N B;  1HR0 J;  3MEG A;  5CD4 H;  2QJ3 A;  3G4S S;  1Y11 A;  3FMW A;  2CDQ A;  3PW0 A;  3D7S B;  4DV5 J;  4CTA A;  3GTY X;  4G3I A;  3R9L A;  2HSE B;  4UF4 A;  2CQC A;  1DLO B;  1RK8 A;  3ZZ0 A;  1JLC A;  4MFB A;  1N0V C;  3PTW A;  4KKO B;  4CIO A;  5HMW A;  4CLP A;  3D3C J;  4K4Y A;  2B7C B;  2G4B A;  3EJM A;  2F4V J;  2L3M A;  2JEJ A;  1T05 A;  5F0U A;  2WVC A;  5KT7 A;  3JQJ A;  1N5Q A;  3VZH A;  1WDD A;  1SJR A;  2AYE A;  2E66 A;  2ZBQ A;  3K59 A;  2N7C A;  3K2Y A;  2ZIT A;  5GVQ A;  1SJ3 P;  1SH3 A;  3MR6 A;  4GVL A;  5D0G A;  2Q3P A;  3VGT A;  4FNH A;  3KHG A;  1VQ4 S;  1G4C A;  1UEK A;  4HT7 A;  4DX6 A;  2VJU A;  1UEU A;  2DNP A;  3T6B A;  1SCJ B;  1AFJ A;  1D8Y A;  4RJV A;  1Z1Z A;  2UP1 A;  3RTV A;  1NSA A;  2X3G A;  2ZM6 F;  2LQ9 A;  2K7K A;  2OAU A;  1CJT B;  2UUB J;  4TVA B;  2IVY A;  1XER A;  4IH7 A;  3KLG B;  1SKS A;  2J9C A;  4IKA A;  1R8B A;  4BCA A;  3R7N B;  3FBF A;  2HQI A;  4Q45 A;  3K5O A;  4NI2 B;  1U4B A;  1HD0 A;  3U1N A;  3I82 A;  3LGN A;  3BF4 A;  5IM0 B;  5KFS A;  1P27 B;  3BSN A;  1VQK S;  2WVB A;  5M2U A;  4FZV A;  3AT1 B;  2VPW B;  3KWM A;  3Q8S B;  3AAW B;  4C3L A;  5F9L A;  5DET A;  2XMA A;  2MST A;  4M1K A;  2OUG A;  4IR1 A;  3QWP A;  4E98 A;  3ICL A;  4OYA A;  4DQS A;  3J7A 1;  4RPF A;  1YJW S;  2OKQ A;  4UOF A;  3UDV A;  2IPO B;  2BW7 A;  3MR5 A;  3DXB A;  4FYW B;  3NXZ A;  2NLW A;  4CO5 A;  2BVZ A;  3BSA A;  4TY8 A;  2JLG A;  1LK7 A;  3NG8 A;  1ZPV A;  4LF7 F;  3GFY A;  2Y9H A;  4RW9 B;  3M05 A;  1RCO B;  1S0V A;  2YWK A;  2AJ1 A;  1WC0 A;  5J2P A;  2XLJ A;  5A8R A;  5HN0 A;  4ZJL A;  3H20 A;  2AYB A;  1TR0 A;  5AE3 A;  2XMT A;  2QIF A;  2OP5 A;  1TU0 B;  3ZTR A;  4B9U A;  4PCQ A;  3S8S A;  4ECX A;  5F0W A;  2RDI A;  3R7B B;  4ZVF A;  3GR0 A;  4KHP F;  4WK1 A;  3FMB A;  2KT5 A;  2OEJ A;  1OPZ A;  5U47 A;  4JBC A;  5KG3 A;  4O0I A;  4ES3 A;  2I1R A;  4MK7 A;  5D4P A;  3DRS B;  4YR3 A;  4K7Q A;  1NK4 A;  4PG5 A;  3SFG A;  4DSL A;  2R7Q A;  4DR7 F;  5ETP A;  2YXL A;  4H4O A;  1NJX A;  4BS2 A;  2HS4 A;  1GQE A;  4IOA Q;  3M8S A;  4YOE A;  2J6T A;  3PY8 A;  3OL9 A;  3CVK A;  2EC2 A;  3QGI A;  4Y00 A;  5HVG A;  3EWG A;  3IS9 A;  3DOK A;  1BGX T;  2D1C A;  5HLF A;  3SI8 A;  1YIJ S;  3QLH A;  1QAX A;  1J5O A;  1DAR A;  2E7X A;  5RUB A;  1V3Z A;  4UQT A;  4Z2X A;  2N3L A;  1E6V A;  3FKB A;  1N48 A;  2A10 A;  2GVZ A;  2W9B A;  5LJ3 Y;  4JI5 F;  1BWV A;  4PPD A;  3MHY A;  2DNH A;  3BGU A;  2CG4 A;  4ED0 A;  3GIJ A;  5KG0 A;  3IBF B;  1QE1 A;  5KG1 A;  5EHH A;  4X4Q A;  4LF7 J;  3IO1 A;  2J0S D;  2AWZ A;  1K44 A;  1FJ7 A;  3ITH B;  4U8Y A;  5D0E A;  1VI7 A;  3AB2 B;  1RHU B;  2DNO A;  3H59 A;  2LQB A;  3EZO A;  1UZD A;  1U45 A;  1RTJ A;  1JXE A;  4KV8 B;  4LBI A;  2DH9 A;  4RW8 B;  4DPO A;  4UOG A;  3TUZ C;  4C8Z A;  1GXL A;  3M8Q B;  4KHP J;  1W26 A;  2XGQ A;  3O2I A;  2PDA A;  3CDA A;  3GIR A;  1TKT A;  3LO3 A;  1W25 A;  2FZG B;  1FER A;  2BAC A;  1I6J A;  4LBH A;  5F3Z A;  1Z2Z A;  2HNZ A;  3O3L A;  4DR7 J;  3HSJ A;  1YRU A;  1D1U A;  2EFO A;  1UFK A;  1P8G A;  3OQ2 A;  4QWB A;  2DR5 A;  2ADB A;  1Y3J A;  1AW0 A;  2DHH A;  1V3S A;  3QJP A;  2HAF A;  1S6Q A;  1R43 A;  1DTQ B;  2F4F A;  1JLB B;  3OSN A;  3EDR B;  4U9R A;  1MWZ A;  4X64 F;  2JLE A;  1XR5 A;  1TL7 A;  2ZVI A;  4P71 A;  1YJT A;  2VQF F;  5ETO A;  2RE1 A;  1VK8 A;  3D3B J;  1BC6 A;  4ED3 A;  1HW8 A;  2ROP A;  3HXM A;  5FLX U;  4USK A;  3HDS A;  4ZN3 A;  3TUP A;  3VAI A;  4C11 A;  2V50 A;  4JI5 J;  1RWN B;  4OL8 A;  4B9S A;  4UUW A;  3OSP A;  2FY8 A;  1HWL A;  3ZZR A;  4F4A A;  1WTF A;  3V2U C;  3CF5 Q;  1N33 F;  1JB0 C;  2W1B A;  4MTP A;  4ZVT B;  3VWS A;  1U48 A;  4DBQ A;  4R8U A;  5M2P A;  2V8V A;  2G0C A;  2R8H A;  3GIM A;  4LF6 F;  3SIP B;  2HFS A;  2A6M A;  2MZJ A;  5B0B A;  1S1U A;  1KHV A;  4B3O B;  3KK3 A;  4WKY A;  4RUA A;  5DDR C;  1CUL B;  2MLY A;  2JDJ A;  3W7B A;  2HFV A;  2QYC A;  2VQE J;  4KO0 A;  1S1V B;  1CG2 A;  3BQ1 A;  5AT1 B;  1RZM A;  1HNV B;  3M2R A;  3MPW A;  5FD1 A;  4DSJ A;  2V6A A;  5D4N A;  5CH7 B;  2RF2 B;  4Q2L A;  3NGR A;  5I3U B;  5D78 A;  5A76 A;  4MAK A;  3PRV A;  4O3Q A;  2YKQ A;  1EET A;  2JHE A;  2XMJ A;  1S5Z A;  1XIQ A;  3C46 A;  1N52 B;  4DX5 A;  2DHA A;  3I0R A;  2BW2 A;  2B4O A;  3BDP A;  4A8M P;  1TKZ A;  3HSZ A;  5IT0 A;  3BYR A;  1HAR A;  2UZA A;  3OFG A;  4DZD A;  2GAG C;  4CO2 A;  2GJF A;  1OIA A;  3IP0 A;  1SB6 A;  2UVU A;  2ZVS A;  2AJQ A;  1NSQ A;  4X64 J;  2WVD A;  2RQK A;  1IXK A;  2VQF J;  2ZE2 B;  5B09 A;  1RWO B;  4TN2 A;  2JNJ A;  5H9F J;  3TX0 A;  1YJV A;  2CZ9 A;  1YHQ S;  4WP8 A;  1CQN A;  2VJV A;  2YX1 A;  2FJD B;  1NK5 A;  1X9W A;  3A13 A;  2MKJ A;  4QYR A;  1EKR A;  2GGP B;  4X4S A;  4X4R A;  1NDC A;  3MPV A;  1YK9 A;  5LSO A;  1NB2 A;  3ILO A;  1BE4 A;  3UQS A;  1XNR F;  3ZFV A;  3D0I E;  3AD8 C;  1XMB A;  3KOA A;  2J6U A;  3QJJ A;  3ZTO A;  5LJ5 Y;  4L73 A;  5F9N A;  4A48 A;  4LF6 J;  4KGZ B;  4TU9 A;  4DN9 A;  1RAF B;  1WF1 A;  2OSR A;  4X65 F;  2LEC A;  4J7C A;  5HRO B;  3RUB L;  5IFM A;  5F8I A;  1RHJ B;  3ZTQ A;  2H1Y A;  4NA2 A;  4HLB A;  1LWF B;  1M0S A;  5GAG I;  4X2B A;  1Q79 A;  3VR1 A;  3Q0A A;  4QZV B;  1AZS A;  4DG1 B;  5K14 A;  2AEM A;  4MIW A;  4BBY A;  4O4R A;  1WEZ A;  4DPW A;  1I5O B;  2PT0 A;  4O4G A;  1UJ4 A;  4GO7 X;  4ZVG A;  1UET A;  1HI0 P;  2R8K A;  2ZD1 A;  4PR6 A;  2BZ2 A;  1N8R T;  3G71 S;  4NYO A;  2JOQ A;  2LYV A;  4B9N A;  1FWL A;  1RT1 B;  2HFN A;  4YR0 A;  4Y2M A;  2XS2 A;  3WBZ A;  3A3O B;  4JI8 F;  1IVZ A;  4XK8 C;  3AJD A;  3BN7 A;  4NLD A;  3NNC A;  1HQ2 A;  3RAQ A;  2B4U A;  2V8G A;  1WG1 A;  1HD1 A;  2CPD A;  3Q8V A;  3MMA B;  4PXB A;  5KFC A;  3A8K A;  4LR8 A;  4RO0 A;  2E5L F;  5E41 A;  4F8R A;  3IR7 B;  1YSJ A;  1KNZ A;  2VBW A;  4CO0 A;  4EFA C;  4ZP9 A;  2OD6 A;  3ZTP A;  4RZR A;  1D9D A;  4U7U D;  2Y1J A;  1VQM S;  1XNR J;  1IBM F;  2LA6 A;  1S0M A;  1TEL A;  1OQ6 A;  3EIC A;  2O3D A;  2LVW A;  1VIO A;  2L9D A;  1R0C B;  5DGB A;  2H51 B;  4Y2I A;  5J2N A;  3AA8 A;  1OY9 A;  2YH1 A;  1U1O A;  1ITP A;  2HQC A;  1HQE B;  2D3U A;  1WC4 A;  1U1M A;  4ECT A;  3VGU A;  4X65 J;  1RT7 B;  3QIP A;  5KG7 A;  1Q82 T;  3DU6 A;  4HL9 A;  2XZT B;  3CCE S;  1DLO A;  1EAY C;  1SVD A;  3U1L A;  4KKO A;  2UVR A;  4N41 A;  3RAX A;  3LPY A;  4WFX A;  4P72 A;  5MLC V;  4QPT A;  4IG0 B;  3TW0 A;  3H5Y A;  2R7S A;  1SH2 A;  4NYZ A;  5CCM A;  4ED1 A;  3HHL D;  1GTE A;  2G0I A;  2QZ8 A;  2ROG A;  3PM9 A; 
#chains in the Genus database with same CATH homology
 3C16 A;  3MAA A;  5D0H A;  5IV4 A;  3C15 A;  4OYP A;  4CLS A;  4CM0 A;  3G82 B;  4USV A;  3C14 B;  3ET6 B;  1WC0 A;  4OYO A;  1TL7 B;  4NI2 B;  1CUL A;  1CS4 A;  1FX4 A;  4WPA A;  3MR7 A;  4CLU A;  4CLT A;  1AZS A;  4CLP A;  4CLK A;  4CLW A;  1CJU B;  3UVJ A;  2GVD A;  3C15 B;  2GVZ A;  5D0R A;  1FX2 A;  4WP8 A;  4OYW A;  4OYB A;  2QV6 A;  4CLF A;  1CJK B;  1CUL B;  1CS4 B;  4OZ2 A;  1AB8 A;  4CLY A;  1WC4 A;  1U0H B;  1AZS B;  4CLL A;  4WP3 A;  4WP9 A;  1CJV B;  1YK9 A;  2WZ1 A;  3G82 A;  3R5G A;  4OZ3 A;  4USU A;  3C16 B;  5D0G A;  3MAA B;  4OYI A;  4CLZ A;  1TL7 A;  4P2X A;  2GVZ B;  1YBT A;  5IV3 A;  1CJT A;  4P2M A;  4OYA A;  5D0E A;  4USW A;  1WC3 A;  1WC1 A;  1CJU A;  4UST A;  4P2F A;  4OYX A;  1WC6 A;  2W01 A;  1YBU A;  3C14 A;  3ET6 A;  2BW7 A;  5D15 A;  3UVJ B;  2GVD B;  4NI2 A;  1Y10 A;  4OYM A;  1CJK A;  4OYZ A;  4CM2 A;  1CJT B;  1U0H A;  1WC5 A;  1CJV A;  1Y11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...