3C14B

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and ca
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
189
Chain Sequence
b'HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase type 5
publication title Structural basis for inhibition of mammalian adenylyl cyclase by calcium.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase inhibitor
total genus 53
structure length 189
sequence length 199
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3c14B00
3C14B 1U0HA 1FX2A 1WC3A 4CLSA 1CULA 4CLFA 1CJVA 5IV4A 2WZ1A 4USUA 1TL7B 4CM0A 3ET6B 1AZSB 4WPAA 1WC5A 3C15A 3C16A 5D0HA 1CJTB 3G82A 4OYXA 4OYZA 4WP3A 4NI2B 2GVZA 4USTA 5IV3A 3C14A 3MAAB 4USWA 5D15A 4CLKA 1U0HB 1YBTA 1CS4A 1WC6A 4OYPA 4WP8A 1CJVB 1CJUA 4OYAA 1TL7A 1CJKB 4P2MA 1AZSA 2W01A 3UVJA 4CLTA 4CLPA 2GVDA 1WC4A 4OZ2A 3C15B 1YBUA 5D0RA 3MR7A 4CLLA 1AB8A 4CLWA 5D0GA 2GVZB 3R5GA 4USVA 4CLUA 1CULB 4OYMA 5D0EA 4CLZA 4WP9A 1YK9A 3ET6A 1CS4B 4P2FA 4CLYA 4OYIA 1WC1A 1FX4A 1CJKA 1CJTA 1CJUB 4OYOA 4OZ3A 4P2XA 2BW7A 3C16B 1Y11A 1WC0A 2QV6A 4NI2A 3G82B 4OYBA 3UVJB 4OYWA 1Y10A 3MAAA 4CM2A 2GVDB
chains in the Genus database with same CATH superfamily
2EFQA 4JI1F 4UZCA 4DR2F 2FVSA 4LIWA 1QE1A 3T6JA 5JJBA 3A3OB 2NYHA 4GO5X 2POKA 4HKQA 3HZGA 3K5NA 4NXMF 2YQ0A 5IC6B 1WACA 3MEEA 3W9JA 3C14A 3M8PA 3HVAA 2RHSB 4N5SA 1SKUB 3TUZC 1XERA 3TWZA 1PAUB 3C2PA 2JJ4D 1HR0F 2QJ3A 4XPEA 1JJHA 3NKYA 4WZQA 4Q43A 5IWAJ 1LQ9A 3V81A 2IYGA 3AJ2A 3D1HA 1FJGJ 2QL9B 2RT3A 5KG6A 4X4TA 2BRLA 4DQPA 2WK4A 4YP3A 4JYAF 2EW9A 1Z4UA 2R2SA 3I96A 3MCMA 3ILOA 3U7JA 2XLJA 5KFEA 1YRXA 2AU0A 4K5RA 1DLOA 1VQNS 3HSJA 2O1PA 2J7UA 3BBCA 3R5CA 3MFIA 4RW7A 3PX6A 1RUSA 4PEOA 3CDBA 2DPIA 3RB4A 1RTHA 2C2KB 4KC5A 3L9ZA 3Q8VA 1FF2A 2PT0A 1SQGA 2K1RA 3IS9A 4WJBA 3EICA 1N88A 3J7Z5 1FKPA 5DQGA 3RBEA 1DHMA 3D4JA 3I55S 2AYGA 5DLFA 2D74B 2HNYA 3MMJA 2QA2A 2LQ5A 3PX0A 1TL7A 4F26A 1UPMB 4DEZA 4F4ZA 2GCFA 1VQLS 1NXIA 3DMJA 3IR7B 4M5DB 3FSIA 1JLGB 1Y5NB 4LQ9A 3QZ7A 1NHUA 1RTIB 2DNGA 2CZ9A 2HZCA 5D8HB 3AA8A 3V6HA 4OX6A 3C16B 5B0EA 3HVTB 4U7UK 2ZH9A 1ACMB 3BGFA 3KWMA 2OEKA 1Z1ZA 2HVHA 3BS9A 2E1PA 4UOFA 3DLKA 1HBUA 3PVXA 3LPYA 4QYZJ 2KB2A 4PXEA 2SXLA 4RPFA 4QWBA 3D7SB 2XC9A 3HHKA 1RA7A 4DUZJ 1GAOA 1REGX 2CPFA 2AQ4A 4Y6IA 2NPIA 1U47A 3TI0A 4CCHA 1ZM4A 1YI2S 1FEHA 4K4WA 3K8WA 2DNHA 5LXYA 2FVQA 4WFNQ 2NZ4A 3OLAA 4HHJA 1FEEA 4OHWA 2VU5A 1DY3A 2LMIA 1MN7A 3OTCA 2W9BB 3MPUB 2M5YA 2O67A 2OUGA 1RWUA 1YITS 4O3SA 2UV8A 2AV5A 3ITHA 1RJJA 1HW8A 3T19A 1HYSB 2A6MA 4ETXA 4BWJA 1RBAA 4CO2A 2DNZA 2ZZMA 1FX4A 4DFKA 3HCXA 1S59A 1WC0A 5J2MB 1ZYQA 3IM9A 2HBRB 1SI9A 3J81j 1RDRA 2MZQA 3M30B 2ILZA 2LVWA 1LV5A 3BBBA 4HLBA 4ZLLA 3FGVA 1GH8A 1RYSA 4ZK7M 2MHNA 5HANA 2QMUB 1UJ5A 2KU7A 4LF5J 3MUMP 2YKOA 2MLZA 2F5GA 3DFEA 1LW0A 3GG0A 4TNOA 4K0KJ 4FYXB 1NH7A 2B4PA 3GTYX 3EZOA 4M8LA 2EC2A 4N56A 1RKJA 5HI7A 4ECXA 3ISND 5DQIA 3PJXA 2CQCA 2ZZNA 1KOOA 1FDAA 2DGXA 1P1TA 5C25A 4Y2KA 3KKFA 2J9CA 1R8AA 1SBRA 3T41A 2V8PA 3I82A 2JLEA 3KLGA 4TY9A 1NK4A 3TJ8A 2BDPA 1N36J 1S72S 1U7LA 3OSPA 4BLGA 4FF1A 3UVJB 2JLFA 2VFSA 3DRPB 4L3KA 4K4SA 1QVGR 1U1RA 1FRIA 2ZFHA 4EI2A 5HAOA 1NDLA 2IVMA 1HD0A 1WKJA 2ASDA 3QRQA 5HVGA 4DQQA 4P52A 3Q8PB 3HZEA 1UVNA 4DPXA 4RUCA 3CO9A 1HPZB 1BC6A 3ZZOA 2G13A 1ICEB 3FEYB 2E9ZA 4MKAA 1RHJB 5KFGA 1FFSB 2QIFA 3EPIA 2Q3PA 4JI1J 1IQTA 4DR2J 3AH6A 1N5YA 1SC4B 4MTPA 1XR7A 1YJVA 3TANA 4B9SA 4ES2A 1T3OA 4FPIA 3M8SA 2MKHA 4MK8A 4NXMJ 1KQKA 3AA9A 3NS6A 5D0RA 2L9DA 3DOMA 3FMBA 4IG0B 1RHRB 1RLDA 1L3SA 3AXKA 1HR0J 1FTCA 3I9V9 4OJ1A 1UAWA 3KJQB 5ETQA 3MEKA 1JK9B 1CC8A 1D9DA 4NI2A 4AD6A 3G8QA 2K3KA 1RWPB 2CQDA 4KYZA 1JXVA 3HHNB 2IPOB 4HTJA 4JYAJ 1IBCB 1UFKA 1HWKA 2QEXS 1LWCB 3BB5A 3W2VA 4I68A 3M7VA 1HMVB 5BYRA 3ONQA 2O01C 4R8UA 2NXJA 2JEFA 5GADU 4KSEB 2NUUG 1DJ0A 1QVFR 1AFIA 3HLUA 1M5SA 3IM8A 2KM8C 3HX9A 4OIXA 2P6SA 1RAJA 1KC8T 4NOHA 4E98A 3GIMA 1J2VA 5KFDA 3MCOA 3QBCA 2KL8A 3C66A 4KFBB 3ZZPA 1JX4A 3OR2A 4MFBB 1SL2A 4F8RA 4KGVB 3MCNA 3NCQA 2LKZA 5DO2A 3F41A 1PYOB 1WORA 1FTRA 4ZS6A 2QA4S 5MLCV 3LQVA 4YDDB 2CJYB 2WVCA 2AEJA 4KGZB 3WIVA 4RL1A 1UA1A 3G8SA 4X66F 2M70A 4Q2MA 3Q24A 3OXGA 3GZ7A 1F9FA 4NXNF 1A6LA 4R5PB 1UVKA 2HQDA 1ZETA 2HFNA 1C4AA 4TU7A 3MWBA 3CIZA 2U1AA 2ZH5A 5HQMA 3UN2A 2JFKA 3MMBA 1NDCA 1RWOB 3EVOA 1Y5LB 1KD1T 2WOMA 2OJ3A 4IYQA 4KQZA 1KQSR 1VDHA 3DGPA 3LOUA 2HZVA 2ZC3A 4GVBB 4CQ1A 2B5JA 5T7LA 4B3OB 4NA3A 5A8KB 4EBDA 2XMJA 5C2CA 1J27A 1K1QA 4F25A 3C6UA 1X0PA 2XLIA 1OY8A 4OHYA 3Q2TC 4YB5A 1TR0A 3IA0A 3TYTA 1F2GA 1S9EA 2CNNB 4OZJA 1S4FA 1S6QA 1U8WA 3AT1B 3TAPA 4KY3A 3I0SA 3V4IA 2DR8A 2M8DB 2XMUA 2FY1A 3MM5B 5AJ3F 1FDBA 4MIAA 3TEHB 1HKAA 4R25A 3MAHA 3VAGA 3KLHA 2MZ1A 2J6SA 3WQPA 3OLBA 5IT9Y 4FZVA 4IG3B 1C1CB 5KFTA 1YZ7A 4O4GB 1WTBA 3L3CA 2R8KA 2FGOA 2Z2ZA 1W26A 4LRDA 5DDOC 3W5ZA 5DQHA 1APSA 1TK5A 2LEAA 5BXIA 2JSXA 2JZ5A 4NPOA 4K2XA 2ZOGA 2ZJPQ 1KKHA 4AXJA 1P9YA 3W5YA 1S99A 3W5XA 4CLKA 2VUGA 4ZN3A 2YX1A 1HL6A 4RW4A 1NHKL 5CZXA 1OJ4A 1B99A 2Z58B 1K1SA 3CD5A 3CULA 4A46A 3X1LB 1JLCB 3BM7A 2BVZA 1FRMA 2HK3A 5EWFA 5J2PA 2M88A 6FD1A 1SQFA 3HHLA 4NEYA 3OVAA 2EG1A 3U1LA 4LF4F 5I42A 1YRUA 3PR5B 1RB0A 3MDFA 1M0SA 2FGCA 3BF4A 3BKUA 3P4UB 2C22A 3MAAA 1C1BB 2EFGA 1ULRA 4C0OC 5FD1A 3IAM9 2BJDA 2CQGA 3FDSA 5B0AA 2F40A 2DIUA 3Q8RB 4WKRA 1BGXT 3N0VA 1UMJA 2HMIB 3DXBA 1BD6A 1UTAA 1NUEA 1X5PA 3D66A 2CPYA 3BSOA 1HARA 4FF3A 1KTVA 2UV8G 3FC9A 5CYQB 2ERRA 4J9KA 5IQ6A 1TUVA 5F41A 4H4KA 1PYSB 2XB2D 1QTNB 4IFVB 1NPKA 5FLXU 1H7XA 3ZZYA 1MU2A 1WI8A 5J2QA 4M5LA 4QPTA 3RU0A 1HWJA 1VOMA 4CO4A 2FVPA 3G6XA 2PI5A 4RUBA 1S57A 1XK8A 1T9WA 1I51B 1FDNA 3V6JA 3CCWA 2KH9A 3GCXP 4O44B 5ETSA 1R31A 4KBIA 2QN6B 5M2UA 1DZ5A 5F9LA 3DRRA 3BO4A 1EQMA 4ECSA 1RT1B 3N5BA 1X4EA 3KLEA 2A18A 2FVRA 1EP4A 3E3XA 1X4CA 2BJ8A 3G4SS 1S77D 4F36A 2AW0A 3CTRA 3R3TA 5KG2A 1WOPA 4C48A 4LIRA 5KG7A 1HWUA 3QZ8A 3ZNJ1 4DR6F 2H3EB 3GJSB 3WC2A 2GHPA 4X4PA 4KHPF 5H9EK 1RWKB 5GADI 1F1BB 4NEZA 2M3DA 4LVOP 1JNZB 4PR6A 3P45B 4CLLA 2MQMA 3SCJE 2XCAA 4CWBA 4CLUA 2MHEA 4Y65A 3PM9A 1D09B 2VOPA 2XWXA 3TQEA 4ED4A 4ENOA 3K5MA 2Q79A 4C8MA 3JAMU 3DM2B 2B43A 3M9OB 3NMAA 3FCHA 4MAKA 4DL5A 1NKEA 2GJFA 3VTIA 2Z8QA 4NMXA 1AROP 4X66J 2HAFA 4AL7A 4IH7A 4FF4A 1JLBA 2CG4A 2ZOFA 4NXNJ 1AYEA 1FK9A 4WXWA 4J9LA 3JQJA 3TZXA 3POTA 2XCPA 3O44A 5DDPC 3T3FA 3D0GE 5CZVA 4LSLB 4EK2A 1U6BA 2OTLS 3U27A 4ZLJA 1R0AB 3BPSP 3ILIA 4N8NA 4OV6A 2UUWA 1CC7A 2F3JA 1HQUB 1XQIA 4GC6A 4L6V3 1VCTA 4N41A 2XM3A 4CYUB 1QUVA 4OYMA 3GPAA 4TU9A 3CPWR 3AOAA 4ZCKA 5D6GA 4F2RA 3NGRA 1H2VZ 3SEOA 3RBDA 3LW5C 4PG4A 2H5JB 2OIHA 1KHVA 2NREA 1WOOA 5AJ3J 2V68A 2VPWB 2GVDB 2VJVA 5BYSA 2CVIA 3C6TA 1Q5YA 4EO6A 3CMQA 4Q45A 4G3IA 4GVLA 4F3OA 1VRUB 3C15A 4OFZA 4XPCA 4ZP8A 1RZMA 2V2VA 2E1AA 2OAUA 4KGXB 3US5A 1U1QA 1EHWA 1O5JA 4NYPA 2C3OA 1K44A 5U47A 1KONA 3RRHA 1XJWB 4XTTA 2I0XA 3G71S 2K06A 4HR2A 3HHLC 1FKOA 1SCJB 2C2ZB 4OZ2A 1TK0A 4JV1A 2GFFA 3DDKA 1YHQS 3R9LA 4M1KA 1B70B 3F56A 2EBGA 1FRHA 1URRA 3BGRA 5CD4H 4RUAA 5I4MA 1T05B 1RA6A 3NL0A 1FFGB 3JYTA 4ECZA 1TL1A 1PILA 2C2RA 4NRTA 4JI5F 1Q0NA 4G1PA 1VQ7S 1LW2B 2YTCA 3VVTA 4YFUA 4N8OA 3KUGA 2COLA 4LF4J 2CQBA 3LWMA 1TMJA 2B4UA 5E3CA 2BE2A 1GX6A 1LNQA 4L74A 3AODA 3MM8A 3I5AA 2IY5B 2RMLA 4U8YA 3RR8A 2PDAA 4LF9F 3OTBA 4GC7A 1Q7LB 1DURA 3HHLD 1WUUA 1K8AT 2KHCA 4QIFA 2CPDA 4ZVEA 1EKRA 4CO5A 2GZOA 1SJ4P 3M8WA 2ZHAA 5D4NA 2F1FA 4C8OA 2EFPA 4PPDA 2OPRA 2ZC4A 5G0RB 1RAGB 1OIAA 5L46A 3KJFB 3VAMA 3HHEA 5HLFB 2XYHB 3LGNA 5AXLA 4FNHA 3K7RA 3QIPA 2BBEA 2PA8D 2V94A 2YNHB 4NLTA 3DI6B 3R2CJ 2YKNB 3FEZA 3D67A 4GO7X 3BR8A 1YJUA 1WSVA 1RT4B 4RJVA 1V5VA 2PIIA 4FKXA 1MROB 2YQ3A 1E6VA 3DRSB 1YG0A 4DR4F 4M63A 1IBKF 1SIWB 2MQLA 4IOBA 4F4YA 2B8QA 4QWCA 2IJFA 4DSLA 3CDEA 1Z2LA 3GILA 2MKKA 1Q53A 3TA0A 3VZHA 3SDEB 4F02A 1A9NB 3TJAA 2MY8A 1BHNA 2R3VA 1YZ6A 3A3NB 3UCUP 2EG2A 3SQGA 5IT4A 4BHQA 2KXHA 3PNIA 2YNGA 1DTTB 4ZIVA 3FKBA 4KE5A 2ZH6A 2VPYB 1HNIA 1YGYA 1JMTA 1AB8A 2WVBA 3OTEA 4DR6J 5GAGU 1TTHB 2Z2MA 2JWNA 5I3QA 4KHPJ 3CCES 2QE5A 2E9RX 3UN5A 4P2XA 3PO4A 1NK7A 4FS1A 1NDKA 3D6TB 4HACB 3ZTQA 4PQAA 1F5CA 4IO1A 4J7CA 5DG7A 4KV8B 3N4WA 1KBRA 1YWXA 4J9QA 1SC1B 2E9TA 1SH0A 1RT2B 2AMCB 1D0EA 4F3MA 4YY3F 1QUPA 5KG1A 4DG1A 1G2EA 4MKBA 3BPDA 2VH7A 4P75A 3CGIA 3KDOA 4U9RA 1G1XA 4DL4A 1JLQA 4C3KA 2J0QD 4RW6A 2LCWA 3GIIA 4YQWA 2DXDA 4QR0A 1FT8A 4BC7A 4MKYA 3T5KA 4OMFG 3GE9A 3G6YA 5DG9A 2RF2A 5HL7Q 4RO0A 3UW1A 3GONA 2X7IA 3LP2A 1VIOA 2KT3A 4ID5A 2APOA 1B3TA 2HVEA 3CJSA 1IKXA 4C6AA 1RADB 1JKHA 1GTHA 1Y11A 4DS5A 1LOUA 2PGCA 3M4XA 5KFYA 3KHHA 4ZVFA 5HVFA 2YPYA 4DN9A 1SV5A 4B3RF 3HSZA 4KO0B 4KAIA 4XDDA 2BQRA 4IFYB 1ZTWA 4I64A 1RT3A 1VQPS 1N56A 1FWKA 4A8YA 3ZFVA 2DGSA 5ITHA 2P5VA 1UVJA 1PIEA 2NQPA 4ILRA 3THTA 3CJKA 4FDFA 2BA9A 3QT7A 3JSBA 3UR0A 2HHSA 2YWKA 5D3GB 2CNKB 4LJMA 1VQ8S 4YHHF 4DV6F 2VG7B 1U1OA 2ZBCA 1K73T 1B7FA 3UNYA 1NH8A 4CT9A 2BOPA 4DDFA 3TZWA 4EWTA 2PE8A 3LF0A 2W2PP 4C97A 3OJUA 1RAAB 3ZNUA 1BQNB 1NK8A 3B4MA 5FJ4A 4ZLNA 1FNMA 2VIHA 3BO2A 3OPKA 3W61A 4FF2A 2CJAA 2GHVC 2N7CA 2EXUA 1WDDA 1WHWA 2XO7A 4X4NA 2H51B 2GS8A 1HNWF 3SSRA 4QOTA 3KHRA 3MTKA 1PSDA 5A8WB 2RS2A 4YS2A 3CT9A 4J9UE 2QYGA 3I6PA 3M2VA 3MM9A 4JV5F 2DHSA 3TVKA 3CD6S 5B08A 3PYFA 1R8CA 4QR1A 1S1XB 2BM0A 4JI5J 3R6LB 2BW2A 2YKPA 3GMGA 4ICLB 1S1WA 2YNIA 1JLEA 2RKIB 5G4DA 1VQ6S 1KQFB 4OV1A 5KT6A 1HBMA 4FS2A 2IAJB 3VGUA 2IM1A 4F0KA 4LF9J 4TY8A 4W98A 2PA3A 2DNRA 2GC8A 2H9ZA 3QAUA 2OD4A 2P6TA 3AHPA 3EXYA 1REVA 2FPHX 3ENWA 8RUCA 2AX1A 4URSA 1FRJA 3QWUA 2XS5A 1F0XA 3HVWA 1NK6A 2IYIA 2XZDB 5KFMA 5SZTA 2BM1A 1EX8A 3V6DA 4QIWD 3QJJA 4IDKB 5C24B 1U24A 2KO1A 1RT5B 1S6PB 4CLFA 2DXFA 1JXEA 1HQEB 2IMOA 2FLOA 5GAEU 2AJ1A 2IDEA 4DSKA 2HKEA 2FJXA 2GNKA 1NM2A 4P74A 1X31C 1IXKA 2KHDA 2H4YB 4OLPA 2C1EB 4DR4J 1IBKJ 3IN5A 3EMTA 1HA1A 3MMCB 3EGWB 3RAMA 1BQMB 3IC1A 3GJTB 3K17A 3RRKA 5E3RA 1CQNA 1SJ1A 1VQSA 3R7NB 1W2BR 3GYNA 4ERDA 3LGHA 4K4XA 1PG5B 3H2LA 5KG5A 2OPSA 1IKVA 5DS7A 3CMAS 4Y3CA 5HMZA 2ZEJA 4J91A 4N77A 3FBCA 5IT0A 2E44A 2M8HA 2EBEA 3CF5Q 3DRXA 4USMA 2H1YA 3M8RA 1B0TA 3Q2SC 5GAGI 1VQ9S 2WBRA 3QQCD 2BX6A 2ZHOA 3H59A 1GNKA 4R0JA 1RP5A 2LQBA 4I2QB 3LWLA 3DLBA 4PABA 2Q1LA 1DQAA 2IHR1 3TNVA 4A8MP 4PAAA 3T1YF 2RRBA 2R7RA 5F8HA 5E0OA 2VZ9A 4M94A 3K5OA 2R7WA 3D6HB 4J5OA 1UVLA 3TAMB 4AUKA 3GSDA 1NDPA 2AEFA 2B4VA 1U0HB 4QBUA 3PX4A 4YY3J 1S6UA 2R7VA 2HHVA 2UVUA 1EKSA 2D69A 2WAQD 3HULA 2IC3B 2ZBRA 3I0RA 4DL2A 5GVQA 5K8OA 5J1PA 4FVCA 1N32F 1LXNA 1S12A 5LSRA 1QSSA 4DPYA 5EWEA 4DUYF 2RU9A 2HHXA 1S1UB 2YKMB 2Q66A 3QLHA 4KH0B 1HWLA 2EPIA 2QLWA 2CG8A 3QAEA 3MHYA 1RHQB 1UEUA 1GK8A 2K7KA 5ETVA 3MECA 1OPZA 1TL4A 4O3RA 4P71A 5K14B 3M2UB 2GA7A 1M1GA 3QT6A 1WELA 1TV6A 1H2TZ 4LR8A 3UQSA 2L3MA 3W2WB 1JLGA 3M05A 2DJWA 1C0UA 4YUDA 3I32A 5B0FA 5L9XA 3JSMB 1X4AA 2HBYB 2RQMA 3HVTA 3HD2A 3E51A 1YVFA 4YHHJ 4I2PB 4DV6J 1FRXA 2CXEA 2PN6A 1RISA 2CJQA 3FVYA 4HI1A 2CVEA 1UPPA 5ETRA 3OFGA 2R2RA 2HQFA 1F9EB 3L7UA 4FPRA 3L7OA 4FKYA 1CJKA 2IJNA 2Y3YA 5AXMA 4RW8A 5CH7B 3TVZA 2JX2A 3JAMY 3N6NA 3C14B 3M8PB 2VC1A 2VASA 4P6QA 4P10A 3PHEA 4OI1A 2BJ7A 4X4SA 3N6LA 5E2QA 3QO9B 1P9QC 2D3ZA 2QA4G 3GG1A 1Q8LA 7AT1B 2RRNA 3O1LA 5CCLA 2W9BA 1RYRA 3IRWP 3ET6B 1NSQA 2RDIA 1O0PA 2LYVA 3TQ1A 3KK1A 2NUHA 5EWGA 1I5OB 2OEMA 4A48A 1DRZA 1HYSA 3TRGA 2VBXA 4XDCA 1E6YA 4ZVUB 4ZVTB 4JI8F 2F8HA 3ILJA 2ADCA 4S0MA 5J2MA 4Q44A 1RXOB 2ZZTA 3I31A 2QSWA 4YR3A 2LECA 2I1RA 1DLOB 4DN0A 3M30A 4AE5A 2OEJA 2RD5C 1RCOB 3CC4S 1NK5A 3LUYA 3DRYA 4DCJB 1NPPA 4B9NA 2ATLA 1RTHB 5HROA 3H25A 4CLYA 2DRAA 2Z2LA 2PFFB 1WC1A 4NE9C 2A3JA 3PW5A 3FQLA 1HFEL 3G6ES 3QJLA 3BSCA 2CQ3A 3U02A 3IS9B 2CJ9A 4PUOA 2LA6A 1FKPB 4NZ6A 4CO0A 2CYYA 4GKKF 2DNKA 2XI2A 3MM6A 1TL7B 1M5KC 1WF0A 1MLAA 4IOAQ 1U1MA 2LFVA 4NCAA 2K7JA 3KK2B 2KM8B 1SC6A 4G1QB 1T9UA 3JQKA 3B54A 4P2SA 3ISZA 3AFGA 1VGYA 5GAEI 5C2GA 2WHOA 1YJWS 1QY7A 3J81Y 1UETA 2MQOA 3UVJA 2HHQA 5FIIA 5A8RB 3DRPA 1NJIT 4IUFA 3NXZA 3MR7A 2WB4A 1X4BA 2MSSA 2VKRA 4UZBA 5AE2A 3PFOA 4O4RA 4O0NA 3Q22A 1TAUA 2VQFF 2DH9A 4OX7A 2HS3A 2GIRA 2QO3A 1HPZA 2DO0A 1FXLA 4USIA 4NZ0A 4QWEA 1T95A 1RWNB 3NAHA 1RWWB 4FNIA 4Y2CA 2UZAA 5K20B 2GJIA 4DPTA 2RRAA 4OHVA 4DV7F 1T9VA 3F73A 2GGPB 3N9UC 4QYZK 5DRKA 3GB0A 2BJEA 3CVKA 3UD3P 4FYDA 5LJ3Y 3UNGC 4E8UA 3NAIA 4YEAA 2YBVA 4IG0A 3VGTA 3ITHB 3BKTA 3IP0A 4GRSA 3CJ5A 3T1YJ 1L3TA 2FJBB 3P49B 3CD7A 3NY0A 3CC2S 1HNZF 1MG7A 3BR9A 1TAQA 4ZVGA 5BR8F 5ETNA 8ATCB 2KXNB 3CDAA 4Q7AA 1QAYA 3EGZA 3AD9C 3FQKA 4Y00A 2G0CA 3UDCA 3BGUA 2G1HA 5HK4A 1HMVA 3KTQA 3PRBA 4A8WA 1XEZA 4HDGA 1N32J 2RHQB 1Y10A 3L4BC 4R0EA 3H4DA 4DUYJ 3ADAC 1SKRA 4M95A 3A8EA 4I4BA 1W7WA 1N34F 5IWAF 2BJ9A 1K0VA 4KFBA 1VBYA 4WFZA 4DSEA 2XHWA 4FBUA 3T9ZA 1TL5A 2I9SA 4B3SF 3KJNB 5C25B 1DQ8A 4CT8A 1GXLA 1U6ZA 4NLRA 1G6BA 2DITA 1OY9A 3IRXB 1KR4A 4X62F 3ELHA 3K5LA 1TUGB 1KSPA 4R5PA 4RNOA 2W7PA 5AT1B 1RTZA 1YBUA 4X4VA 4QQBA 4ED6A 3SBMA 3TA1A 1M1KT 3Q89A 4WP9A 1QM9A 2DGUA 5KFBA 2ADBA 4K2JA 3G9CA 3RBXA 4NLQA 2NXEA 2LLZA 1VBXA 2ATCB 5ETKA 1X7VA 4B3OA 5A8KA 4DR7F 2R7TA 4RNNA 3VQTA 5LT5A 2YQ1A 1YQHA 1CSJA 2W25A 3G2XA 5L1IA 3DLGB 4O3NA 2CQ0A 1RKIA 3QRRA 1UEVA 3JS9A 5GAHU 3V2UC 4ZLPA 1UVIA 3DOMB 1KN6A 3FJ2A 2HBQB 2W4DA 5KFJA 5EDWA 3HDSA 1WC6A 4FXVA 4DZ6A 5L1KA 5CABA 4ZPVR 3S7RA 4J9OA 3NEKA 1B0PA 1C1CA 2P8IA 2X1GA 3H2VE 4F2SA 3ZZ0A 2H5IB 2HGMA 4O4GA 4CP5A 4JI8J 5CCMA 4IRKA 1FFWB 3EPGA 5C42B 1H0HB 4OZ0A 3W2VB 3TZZA 3HHDA 5A76A 1B64A 3MPDA 3ZC4A 3KJVA 4USHA 2JNJA 1X5OA 3DDIA 5B7WA 1AUDA 3SYZA 3OV7A 1RAEB 4X4QA 5KT2A 2EWHA 3HJVA 1XNQF 1VS3A 3OTOF 3IAS9 1U8SA 2HHTA 1X5TA 4PXDA 4USJC 4AXIA 3OR2B 3DNCA 1CJTB 4DL3A 3G82A 5MAOA 2DGQA 4GKKJ 2MGZA 1VFJA 1VHFA 1FE0A 2WBMA 3D6FB 3WX4A 5LSLA 4A8KA 4B3TF 2W24A 2DH7A 1N48A 4OZNA 1I6JA 1EB0A 5L39A 2DRBA 2LXIA 1S0MA 3TO8A 3OVBA 2YWGA 5I3PA 4LFBF 1C1BA 4QWAA 2XS7A 1H7WA 2W9CB 4A8FA 4ED3A 4B08A 3B4DA 4AYBD 2BE9B 2JVOA 3BYRA 4PWDA 2R7XA 4ATNA 2WOMB 4CZCA 4BS2A 1CJUB 5L1JA 1BLUA 1U26A 1ZPWX 1L5UA 3OL6A 3TW0A 3DXSX 3MPVA 4ILLA 5CYQA 5KFHA 3UR3C 2DCLA 3C6UB 1VBKA 1F9HA 4FYWB 4USUA 5H1SV 1IR1A 4LR9A 4DV3J 1S0OA 2X3GA 4NLPA 1S6QB 4IFVA 2L9NA 1X4HA 2XZWA 3V4IB 4NLSA 2OGUA 4DV7J 2KFNA 2UP1A 2W8LA 4DV1F 3BQ1A 3TR5A 4Z7CA 2DT9A 4RKUC 4RLEA 4B9UA 1AZSA 4DX8H 2HLTA 5JXSA 2HVZA 1KLMA 3VAJA 4WFBQ 4O44A 3OD2A 3MXHP 3EDRB 5HMYA 4KPYA 1TU0B 2KT5A 1TKXB 1H74A 2W2NP 1HNZJ 1RT1A 3W64A 1VLOA 5BR8J 2MDAA 3BEGB 1NJYA 3TJ9A 4I1TA 2CAJA 1LWEB 1U6FA 1RABB 3NGSA 4LMZA 4IR1A 3UI3A 4EBEA 1T0TV 4MIWA 3NMRA 1NB2A 1R3NA 3HI9A 3TP2A 4C3LA 3BH6B 2CWXA 2IIHA 4G6VB 3A8KA 3AXMA 3RBZA 4Y0FA 1MNEA 4O3PA 2A2CA 2CZVC 3MR3A 1VC5A 1RT7A 5JVGQ 4C8NA 1LWXA 1N34J 3V6KA 5E41A 2GHWA 4XK8C 2RIJA 2BACA 2JH3A 4RUHA 4ED5A 2LP4A 2CPHA 3MOJB 3DM2A 4ZN1A 4B3SJ 2M0GB 1WKLA 2MSTA 4CNYA 2HPUA 4QU6A 3EX7B 3PYGA 4EZ6A 4O23A 4A4JA 1TFWA 2YKQA 1MMLA 5DM7Q 3MGJA 4X62J 3P5BP 5LM7E 2NYIA 5J1EA 4KGMA 3FFIB 2OMLA 4EBCA 2HW3A 3CDWA 1R0BG 4N47A 2PD1A 2YWFA 1URNA 2V2KA 1IKWB 2BQ3A 1IKYB 4ECVA 3HFZB 1UW4A 3CCZA 2DY9A 2JOQA 4FVMA 2CQ4A 1R0AA 4J9RA 3D6MB 2AD9A 4WZMA 2AGPA 1JIHA 4DR3F 1HQUA 1WSRA 2ZHBA 4DR7J 1PGZA 2V4JB 3QIDA 4M5IA 2RAQA 2PEHA 4HT7A 2F4VJ 4CYUA 1N8RT 2W4PA 1SPBP 2VBZA 2KYZA 5GAHI 4ES3A 2IJRA 2RDJA 3QNWB 5AE1A 3QT8A 8AT1B 2GVDA 3MZIA 4WYWA 1KEKA 4ECWA 5GMDA 2KG1A 1XMQF 2V63A 1CS4B 1RSCA 3KLEB 2JLGA 3GSIA 5B0DA 2XGPA 4LF6F 3L09A 1PJ7A 2Z30B 3K89A 3RYLA 2GO9A 3ZTPA 2VPZB 1Y9OA 2M4MA 4LUBA 4LQ3A 2VPXB 4LSNA 2HIYA 4OI3A 2BQUA 4WK1A 2WRMA 2R8JA 3BV8A 1SH2A 3BSNA 2AHOB 5LOQA 4C3MA 4ED0A 2LU2A 1U4BA 3D0HE 2WSCC 1XNQJ 1QAIA 3SXLA 2RH3A 3M1VA 2CPZA 2GX8A 3ISNC 3OTOJ 4H4MB 2G1DA 4DL6A 1VISA 1T05A 2RQ4A 1JJCB 1YBAA 3MURP 2LDYA 2RE1A 1Q81T 2J6TA 2XY5A 2QLXA 3BSAA 4B3TJ 1TL3A 2HNZA 2VFRA 3RGIA 5D0GA 1AUSL 4MIBA 1G4CA 2Y0SD 3Q23A 3MTJA 1HNXF 4MYTA 3R97A 5T14A 4D3GA 3M8QA 4LFBJ 2GIFA 2NSBA 5DGAA 2XMMA 3OSNA 4LFCF 1JWWA 1IR0A 3UE2A 3D5MA 2IFXA 3D1OA 3NG8A 2E5JA 1FK9B 1F3VA 1EETA 4XIUA 1ROFA 5F8JA 4C8LA 3QATA 5BJRA 1GMVA 2H4WB 1HBOB 2VBYA 5HO4A 1A0OB 4CI0B 4ZHRA 2MXYA 1S76D 3EVMA 3QSYB 1JLAB 2IA0A 2BKNA 3MMAB 2GW8A 4MK7A 1X0FA 2FJVA 2ZBQA 3UO0A 1NHVA 2ASLA 5G0RA 4ELVA 3HK2A 3A8JA 3VAKA 1DAXA 3S8SA 4P9SA 4ZP6A 1S79A 1JJ4A 3RJMB 5HLFA 3IBWA 4OYAA 4WBFA 2JEJA 3MEDA 3NBPB 2W01A 2CJBA 2CNLB 3DI6A 2VA2A 1S7IA 3M9NB 2YKNA 4URGA 3KMSA 3MD3A 1H72C 3R1LA 4DV1J 1RT4A 1VJWA 2Y8WA 3R5BA 5KFXA 1YKWA 1MROA 3DRSA 3H42A 1N33F 2LA4A 4CLZA 3ZTOA 4DSIA 5F8IA 2J8SA 3CJ2A 1TKTB 3DGVA 3PYEA 5KFAA 2QL7B 3KLFB 1FE4A 1WNEA 2DNYA 3OXLA 2I6WA 3NWGA 4KIAA 1H3DA 2ZD1B 3KG0A 4TQSA 1S9FA 2EEYA 3MM7B 3TX8A 2A1BA 2F9DA 1IN0A 4KHRA 4F50A 1X8DA 1VQYA 1A7GE 1DTTA 3I87A 4YR2A 3R5JB 3W8PA 4RX6A 2Q6CA 2HRUA 1GQEA 4WP3A 4RWXA 3DCAA 5D15A 1GTEA 1XR5A 2AJQA 2N3LA 4HT5A 3BGRB 1RHMB 2H5EA 1S1TA 4ED2A 2DIVA 2YWWA 2BE7D 5T41A 1WTFA 1N0VC 4HACA 2DGWA 1KHWA 1QDUB 1TKZB 5HBMA 4HH0A 4KV8A 3PJWA 1S5ZA 1WHVA 1OSDA 2J0WA 3Q8SB 1NSAA 1RT2A 1S9GA 1UA0A 3OQ2A 5EGYA 2QMWA 2PEBA 4JI3F 4OJ3A 3HF5A 1NJXA 2N3OA 3NWRA 1SXLA 2KFZA 5CYMB 4P2FA 4J37A 2Y8YA 4F67A 1L3UA 4DU7A 3JTPA 2UU9F 1SQEA 1QSLA 3A1YG 4ILMA 5EX3A 2LXFA 2PMWA 2MKSA 3D68A 1VLYA 5CAAA 1NZ8A 3IBCB 3CDUA 3S1TA 4X65F 4TYAA 5LXRA 3GFZA 4DL7A 3WHIA 1Z2ZA 2ZH7A 2MZSA 3O3LA 3KK3A 3AD7C 4I6WA 2CWKA 2OPRB 2HFUA 2IVFB 2IDLA 3VGVA 2O5DA 4Q5VA 3GV8B 1Q1KA 1X5SA 1FERA 2L9WA 1HBNB 4DR3J 3KNAA 4URQU 3QIPB 1YJNS 1NJZA 1HI8A 3FCVA 3VAIA 4ZMMA 2QX0A 1NSKL 5KT4A 2CPEA 5EUHA 1E6VB 1AW0A 2ALZA 2DNPA 4V19X 4WF9Q 1W25A 4KHMA 4TYBA 3CWJA 2B7CB 5D3GA 3MPYA 1XMQJ 2XMVA 4UOGA 4EUVA 3R5DA 2FLLA 3HO1A 4LF6J 3KLVA 2OELA 2YNGB 3K5PA 2AEMA 1NU4A 2DNOA 3Q86A 2VG6B 5HATA 2AJ0A 3IGNA 4Q2LA 4L73A 3RTVA 1U1PA 2J8AA 1OS5A 1Q4RA 3J7A1 4WTYA 3CJQA 1SVDA 3MUVP 2UUAF 2J0SD 2WSEC 2BANA 4JI6F 4AQYF 5CD4A 3SMZA 1TKDA 2BXJA 2GV1A 4F7VA 4JI4F 4RNMA 2RSQA 4LR7A 3OL8A 2OH2A 4FYYB 4W90B 1VI7A 2R8HA 2P9EA 2ZKUA 5A2QU 3VR1A 1UFWA 1D9AA 3AQOA 5H9FJ 2ZE2B 2AJ2A 2YNFB 7FD1A 1YJ9S 4P7VA 2V8HA 5K9FA 2KRRA 1BXNA 1D3WA 4RR5A 2XY7A 5KFUA 2V6AA 4B3MF 1J5OA 2R7SA 4DR5F 1TK8A 1WEZA 1HNXJ 4L75A 1FKAF 4DWIA 1JLQB 2RKIA 2NSCA 2BJ1A 4KKOB 2ZJQQ 2MY7A 1TP7A 3DHWC 4PPZA 3L95X 3R2DJ 1Q5VA 1O8BA 4LFCJ 4F3QA 2V8VA 2VFUA 2GAHC 4IH6A 2IAJA 4ZJOA 2CQHA 1NEEA 5I3UB 3CUNA 3NP5A 1ZA2B 4WIIA 4B9MA 2BOAA 4WXOA 3LP2B 5HQLA 4OZ5A 1FNXH 5DJBA 3OHBA 2OO4A 4WTOB 3JTNA 1JKHB 3W60A 4K4UA 2AP6A 3UN3A 5C7PA 4CLTA 2V8DA 3DLEB 3SSQA 2DO4A 4IDKA 1U48A 4ZP7A 2HG4A 1RQ0A 2ZH8A 1DTQB 1S6PA 1NK0A 2E7XA 4QW9A 4F0MA 1RAHB 2FUG9 2QYCA 9ATCB 1VRTA 2OP5A 4NYZA 1N33J 4M5JA 3MMCA 1ZPVA 1KVIA 2G9OA 3PY8A 2YPZA 1FCAA 3IWXA 3MF5A 1QTMA 2CPJA 3DC2A 2YH1A 1VQMS 1RK8A 4CNZA 2EFNA 3ZZTA 1K9MT 5KFWA 4YN3B 1IVZA 2DD8S 2HHWA 3KHLA 4EU0A 3EXCX 3BDEA 3W65A 1T7PA 2ILYA 4DFJA 5E3QA 2CQ2A 3QYYA 5HSPA 1L3KA 2GMHA 3H20A 2MJNA 1R7IA 2JC0A 3NNHA 1N0UA 4CRJA 4PRFA 4ZIWA 5KT5A 2E1CA 2C3MA 2OTJS 2R9LA 4ZJLA 4I2QA 3A13A 4K8RA 3AB4B 2V67A 4UQGA 2QLBB 3M2VB 3CCQS 4NRUA 2OMOA 2NXUA 1NB7A 2P2CB 4CH1A 5KFFA 1CQMA 3EM1A 4CDIA 4CTAB 1XC9A 4LRCA 4NCGB 1S48A 2KG0A 1U0HA 4JI3J 4HL9A 3EZUA 4DPOA 1SIZA 1CULA 2XSJB 3VAFA 3HT0A 3CO0P 4F4KA 2C28A 5E5NA 2UU9J 4DQRA 3ZZRA 5L1LA 5D78A 1UP1A 1NSPA 4LF2A 4YB1P 2HAIA 4ZCLA 4C8KA 2Y1LB 2FIUA 5L8RC 1TELA 4JI7F 4EYHB 3AOBA 3SCLE 2I38A 1VC0A 1REVB 1S1UA 4X65J 2YKMA 3M6XA 4DXLA 1SB6A 3VGSA 2M52A 2UUTA 4NA2A 5JUMA 3GFHA 4NMLA 4DSFA 1UKUA 2D41A 2VA3A 3UDEA 1RBOB 3CJRA 3LH2S 1Y3KA 2B51A 4PXBA 2ZH2A 3DLHA 3IWNC 4A8QA 5B09A 1VK3A 1GXUA 3TVYA 4CH7A 1HHTP 2AJFE 2OPPA 3IO1A 4BCAA 2HZAA 2XTJP 1WKKA 5LMUF 1AXQA 3GYXB 3W2WA 4QIEA 1WWHA 3PZPA 3VF0B 2IRXA 1F60B 1PBAA 4CLSA 1H38A 5IS2A 4RBUA 1IBLF 2MKCA 3LGMA 2ROPA 2OKQA 2HFZA 2RQCA 2AZ3A 2YWHA 1UWAA 1IKVB 3ENQA 4OYXA 3LP1A 4OX9F 5LJ5Y 2HHPA 3M9MB 2ZNYA 2VQEF 2QC3A 3SI8A 2OHDA 5FDLB 3UFCX 1JB0C 2EC0A 4K59A 4Q0BB 3W9IA 1EQ0A 2LXUA 3RB6A 3VWSA 3DDNA 2KFYA 1T3NA 1GXTA 3FK4A 3BZQA 3CJTA 2UUAJ 5ADZA 5CQGA 1PKUA 4JI6J 4AQYJ 5L38A 4ECYA 3QO9A 3OXFA 1HD1A 4JI4J 3ET6A 3EYZA 3KNGA 5E7OB 1MMNA 4GKJF 3BO3A 2KDOA 3EGNA 3EDQB 3OFHA 1Q78A 4WFYA 2ZWPA 4JOUA 2WTFA 3CC7S 1R8PA 3VZIA 3Q8QB 3NCRA 3RB3A 1SUQA 3J81U 2CZ4A 4B3MJ 3Q8UA 3EZ5A 4DR5J 2W8KA 4ZVQB 3CB4A 3I0RB 4J9NA 4Z2XA 4DU8A 2E5HA 1NLKL 2KVQE 5HP1B 1D1UA 4NLOA 2P9CA 4I56A 4PG7A 4ZP9A 1RHUB 4WFAQ 2QL5B 4D3HA 2GMJA 5ETTA 3QLHB 4WFXA 1PBUA 3I9ZA 1UZDA 4LVNP 2IRYA 4H4OB 2BZ2A 3B6BA 1T02A 3I4PA 3CMES 1EIYB 2ROGA 5CXTA 3JB9k 1JLFB 4DHVA 3MECB 4JBCA 1PO6A 3UCGA 4EMDA 2MQQA 2KXFA 1H2UX 3KK2A 3T5JA 3ETOA 1ZAWA 5IM0A 1YJRA 1TV6B 4G1QA 1I1GA 2NCKL 3OR1B 4QJVA 4DI6A 3N28A 7FDRA 1C0UB 2RNEA 3SCIE 5HN0A 4ALZA 4B17A 2DHAA 4H4KC 3HXMA 2FJAB 4GMKA 5A8RA 3OUYB 4WPAA 1N54B 1ZAVA 2FZGB 4NZ7A 4ZCMA 2M7SA 3C8YA 1UVMA 4LF8F 1VJQA 3NNCA 1LWFB 4UT4A 3PKYA 2MJUA 4QYRA 3RR7A 1IM6A 3UD4P 3T9NA 1RHKB 2DBBA 1XMOF 2XULA 2RUGA 1SJ3P 2B56A 4OYPA 4RW9B 5EHHA 5KOWA 2AIRB 1CJKB 2XQCA 3ICLA 1UJ6A 1FESA 4U95A 2UUCF 4RW8B 1IBMF 5F8LA 1OQ6A 4NLDA 2GVZB 3M2RB 1WF1A 2GGPA 2DCUB 3TOQA 1C0TB 4ECRA 2MKYA 2IM0A 3TUPA 2FJEB 1LK7A 4ITSA 2ZM6F 3KK1B 5A0YB 4Y34A 3QMQA 2DGTA 3G8TA 3G96A 4MK9A 5C5JA 3AY0A 1M5PC 4QU7A 5E33A 2QFJA 1T11A 4W92B 1H6KX 4DBQA 1E6YB 1RAIB 1Y7PA 3W7BA 1LK5A 3JQMA 2B6AA 2AYBA 3UDLA 2QMXA 2JRSA 2B0GA 4KPCA 2QLJB 2XYPB 3PW7A 1FJ7A 2FC8A 2RDDA 1FWLA 3PHTA 5HROB 2IRUA 3DOLA 4FXDA 2ALYB 2G2YA 4OI0A 4XAKA 4JI7J 4I7FB 1WF2A 3MCSA 2CDQA 2R7QA 3DLJA 4PUOB 5KFIA 3HM9A 1R6VA 5AXNA 4I6YA 3ULHA 1XR6A 2JVRA 3E01B 3MM6B 4MYUA 2FJWA 4IKAA 3CEDA 2C42A 3P3DA 4OYOA 1G3OA 4KH1B 2BW7A 1NK9A 4C4WA 3SCKE 2D3UA 1NMEB 1U2CA 1T03B 4U96A 1BWVA 2HWTA 4JI2F 2AGOA 1FJEB 1V3RA 3H2UB 3IRXA 2FLPA 3IR5B 2WZ1A 4DX6A 5LMUJ 1RU2A 3UCZP 1NCLA 1S1VB 4C2MA 5ETPA 1JJ2R 4ELTA 4X4RA 3H40A 2DHXA 3H4BA 4ECQA 1F6TA 1X60A 1IBLJ 1W2IA 3KG1A 3I56S 1KQGB 2CKWA 4DF8A 3GQCA 2DYAA 2L41A 3P5TL 3ENAA 2X1FA 4OX9J 1RTJB 3I5BA 2VQEJ 1CPZA 4PWUA 4WE1A 1NPRA 4NYOA 4J9SA 3DLGA 4HTIA 2E5GA 2IBKA 4UF4A 5J2NB 4KGKA 3H5UA 1OY6A 2MMYA 4QIGA 2FJDB 1PJ5A 3C19A 3ZXWA 3MR6A 1RBLA 5D4LA 4ECUA 3IWLA 2UVWA 2C3YA 4U7UD 3BN4A 2FHMA 1FX2A 3PKMA 5IXUA 4GKJJ 4EO8A 2BRKA 2Z0GA 3RAXA 2CQIA 3M8ZA 4OX8A 1R43A 3PTWA 3AAWB 1Y0HA 3BJYA 3DKDA 3K58A 2J9DA 4G1IA 2C2EA 4DCOB 4J9VA 5C42A 3GR0A 3M32B 4O3OA 3KUEA 5HMWA 4N76A 4X64F 4C9DA 3KMQA 2GO8A 5F3ZA 4DFMA 3VV2B 2FTRA 2FQQB 2Q6BA 3LTOA 3C3LA 1M5HA 5CHCB 4P73A 3SZ2A 3MR5A 2B9WA 1N5QA 2U2FA 3I4HX 1S7HA 3NS5A 2CPXA 2XMTA 4HHHA 3LAMA 4EEYA 2LQ9A 2AZ1A 2X1AA 1R89A 5ETOA 1CJTA 2L48A 3KHGA 4QCLA 4IR9A 1SJRA 3M6VA 2C2NA 3OT9A 2LEPA 1R8BA 2DRDA 5DGBA 2CJXB 2VG5A 2DH8A 3CJ8A 2FZCB 4EGLA 1J5EF 4J9PA 2Y1IA 2Q43A 4U6PA 3KUHA 4NLWA 5KFOA 3HVRA 1FHTA 3DYAB 4QW8A 1OYDA 5DG8A 1TMMA 2E1RA 3NRBA 2ACMA 4U7CA 3PDNA 1V9OA 2W9CA 2DNMA 2D7SA 1T94A 2I5JB 4BBYA 2KJWA 5KT7A 1UCNA 2KZZA 5CA5A 2V69A 3J80U 3MEGB 2EKNA 3IG1B 1CJUA 1Y4ZB 2J5AA 2YX7A 4LF8J 5GMEA 4K4TA 4C7QA 5EN1A 1UEKA 1HWIA 3DOKA 2J7WA 1NZAA 1XMOJ 4PQUB 4XO0A 1UL3A 2LU1A 5A2QY 2MQPA 2WONB 1ZS6A 3VHQA 3K8VA 3TUIC 4B02A 1R8HA 3O8WA 2UUCJ 2D9OA 1IBMJ 2IA6A 3MAQA 4JP8A 1HNVB 3RUBL 1FRKA 1Q79A 4M5KA 4DX7A 2OI2A 1CVJA 2AX0A 2FZKB 1DFDA 1RT6B 1VQ5S 2HWIA 1YSJA 2AF6A 3G87A 1VIXA 2VKZG 3K57A 3QGHA 1AT1B 2HNDA 1TVRB 2ZKTA 1FA0A 3HFVA 2ZM6J 4ZVOB 2E29A 1UWBB 4DPWA 1JQGA 4K50A 2VBWA 4ZPAA 4USTA 4DLEA 2EK1A 4X4OA 1TKXA 5CYJA 3SV4A 2CDRB 4PYAA 2O3DA 2VDHA 4WP8A 2MZRA 1LWEA 3O5TB 4OI6A 3KJVB 2QG9B 3DU6A 3U1MA 1RTDB 4TVAB 4IQXA 3T1AA 4DV5F 3BQ2A 1T9YA 2DPJA 3V4MA 3FCWA 2R7OA 3WC0A 3KG4A 2E7VA 1RWVB 3FBBA 1U02A 3D3BJ 4QPXA 4V19J 2OPQB 3W63A 2WVDA 1XBWA 3G82B 1PYTA 2MGZB 2G0JA 1ELOA 2UVVA 3KLIB 3JTOA 4PCQA 1CG2A 2W2QP 1KTQA 1M1HA 2FYXA 3CJ0A 2X51A 3PW4A 4UTGA 2MB0B 1ITPA 3QGIA 5B0CA 4JI2J 5HMXA 4UOCA 4DQIA 3FRYA 2ACYA 2HGLA 3U1NA 4PWDB 3M6WA 3FFIA 4I67A 2DISA 1CJVB 2DKOB 5JVHQ 2CJKA 1IKWA 3LP0B 3H5SA 2XYGB 1IKYA 4QIVA 4OHZA 2NR0A 2VD3A 3BGLA 1O51A 4PWWA 1I3OB 1FO1A 1RWMB 3KXDA 5ETLA 2OSQA 2OD6A 5LL6d 4ZDNA 3MUTP 2V4JA 4Z7YA 2EVZA 1LKZA 2KKHA 3PW2A 4J9MA 1NJWA 1SL1A 1C4CA 4M5DA 5IOLA 1HLWA 3GIJA 2YH0A 1N6QB 2CIMA 1QD1A 1S0NA 1RTIA 3JXOA 4WIQA 2RILA 1DBDA 3KFWX 1AZSB 4ELUA 4DMZA 2V9KA 3DLLQ 3C16A 3GLJA 4C11B 1KLMB 4K4YA 3UWTA 3LPEA 5DZ7A 4LRAA 2R7UA 4B9TA 1DQ9A 3RW6A 2XMWA 1KP6A 3PIOQ 3PJ9A 3OTDA 1CS4A 2F8MA 1QE1B 2W7AA 1OMSA 3PFEA 1WG1A 1BE4A 4YDXA 4WWSA 5D77A 1OSCA 1SKWA 3MEEB 3IFEA 4X64J 3GYGA 3CD0A 2XHCA 5KFNA 3CCTA 4I69A 4OHXA 4Y2IA 1PJ6A 4P7TA 3OL7A 5BYQA 1RT7B 3J7AN 2XMAA 4Q8FA 2RS8A 3IGVA 4H4MA 3V81B 3OBIA 3OW2R 2DB1A 3W62A 4WCEQ 4CM0A 3LA0A 4JI0F 1N52B 2EKYA 1RGVA 2VB6A 4F4XA 1AFJA 2E5IA 5KFKA 4O3QA 2BYCA 1NRKA 1J5EJ 2PI4A 2LQJA 5DM6Q 2XSFA 1OYEA 5J1EB 4RW7B 1XN9A 5SUHA 2ZBIA 2UXCF 4M5NA 3DU5A 3MD1A 4M5MA 5A6WA 1IQZA 1KOHA 1WC4A 4OI2A 3B8HA 2DGVA 4K7QA 2V5HG 2K1RB 1VMBA 1KWMA 3QPIA 1VC6A 4NLYA 1U49A 2DR6A 1HBOA 2XMKA 2KT2A 1P1LA 3NGUA 2C2DA 1S6OA 2C2OB 1F5BA 4UY8T 5KAKA 2BABA 1Y3JA 1OPIA 2HNYB 1TZ0A 3HP6A 1JLAA 3TUJC 2HURA 4K5SA 3QGPA 4J90A 3MMAA 2QV6A 3M8YA 3V5RA 2DHHA 2KRBA 2CPIA 3NOGA 3DMJB 2QGFB 2HGNA 4Z37A 1SJFA 3FZBA 3HPOA 4MJKA 1NAQA 2KYXA 3NBPA 3RW7A 1WJ9A 4WK3A 1P8GA 1X4GA 2C2MB 3T1HF 2PSZA 3IBFB 1V3ZA 2R8GA 3P8BB 5IZHA 1U45A 2WVEA 4G65A 2G2OA 2H54B 2HYIB 3C46A 1QSYA 4ID8A 2ZNZA 3KDNA 4DV2F 4PG6A 3DLKB 1HBUB 2IM2A 1TKTA 2PFDA 2A0FB 3KLFA 2WW8A 4DCPB 2Z2YB 1Q86T 2WSFC 3G86A 2X3DA 4EZ9A 2A2DA 2ASJA 2ZD1A 4OZLA 3DN9A 4DV3F 3OL9A 1ZTTA 3MM7A 2UXBF 4LSNB 3NOCA 3TZYA 2ZOMA 5K8PA 4ZVHA 4LRBA 5J1NA 1LFPA 1ZM2A 2Z57B 2GJ2A 1GT8A 2M2BA 5D4OA 3BREA 4DV5J 5E3AA 1N5TA 3UDVA 4HI2A 3M1VB 4NLVA 3BGOP 3QGGA 4ZPBA 3D0IE 4A8XA 1FXDA 1M5OC 3LAKA 1WHYA 1U25A 3PIPQ 1TKZA 4TLQA 3ZO7A 1YIJS 1TL3B 2HNZB 1YRTA 4YMEA 2BV3A 3HJFA 3F0NA 1WEYA 1YBTA 5CYMA 1IJEB 2W4CA 3R5AA 2F8EX 3PACA 3M8QB 2N7YA 4IRCA 1LWCA 2B8PA 4I6AA 4P2MA 5JMNA 1PCAA 1VQKS 1EETB 4NWBA 4MT1A 2MZJA 1V6HA 2KVIA 4ECTA 1LW0B 3PXGa 5IFMA 5D0EA 3B82A 4HYKA 4MH8A 3T5HA 1HI1A 2HK2A 1ZAXA 3PYDA 2XNQA 1FJCA 4DF4A 3W9HA 4ZHRB 3H8YA 1VRQC 2B9XA 1ZZNA 4NCBA 3VAHA 5HJYA 4FYVB 1UZHA 1JNRB 4MFBA 5KG3A 3WZ0A 2DR5A 3RZAA 3S01A 3GJRB 3ZZZA 3CCLS 1NNDA 1VK8A 3UPFA 1HBNA 4E2FB 3E8OA 5IV4A 2XGQA 2UVRA 2A10A 5KT3A 4RU9A 3GV5B 3MEDB 2F65A 2R2TA 3GCWP 1WC5A 3KLGB 2PO4A 2NPFA 1KFSA 2OFGX 3TX0A 1PAEX 2IBOA 3PR4A 2XLKA 3H0PA 3CCVS 4KT0C 1U1NA 2YY3A 3LALA 3AJ1A 2VOOA 4GVBA 2HFOA 2WCXA 4CLWA 4F4AA 1NKBA 2AWZA 2MZTA 1H98A 2RUSA 4PG5A 1N5YB 2MLXA 2F4VF 4HH1A 5DZ6A 3J7ZT 5LMNF 3HSDA 4KJIA 1XMBA 2DEJA 2VG6A 1B7YB 3R6GB 5HJXA 3T6BA 5F0WA 2VJUA 1IR2A 1RACB 3RRGA 2GIQA 2IMWP 2VONA 3MM5A 1S1TB 2XS2A 5F3TA 4OZ1A 2XWYA 2FC9A 5HBMB 1QAXA 3AD8C 4IG3A 1AA1B 3EGVA 4YR0A 4OYZA 2XEXA 4NI2B 3D9BA 1V5IB 2ZE2A 2YNFA 1S9GB 4OLOA 4JI0J 2HQ3A 3ENVA 3EWGA 2AJ4A 3R27A 4WKYA 1MWZA 4B9VA 4UW2A 3AQPA 3QSIA 3O2IA 2KJVA 3OFFA 1Q82T 4AT1B 4DQSA 4KKOA 4R8UB 2VFVA 2HHHF 3OFEA 3VQSA 3PW0A 1X4FA 2Y1JA 2FHKA 2UXCJ 2OSRA 5HVHA 1KLNA 1R0CB 2BMBA 2HQGA 5I3UA 1GFWB 1ZH5A 1FD2A 2F9JA 3KK3B 4LF7F 4OQJA 1JLCA 2VV5A 1XIQA 4N7TA 4UOHA 4TU8A 4F04B 4TXSA 4UQTA 4DS4A 4IH5A 3DLEA 1F2HA 5DDQC 1YJ7A 3AB2B 4IO9Q 3RAQA 1DTQA 3VVUA 2HFVA 4RWWA 4BWMA 2QSFA 4ZPWR 2V9WA 2HQIA 2R2UA 3T1HJ 1RCXB 3GJQB 3MMBB 1NBEB 2JEGA 2VC0A 4RBTA 4M5GA 2DGOA 3D1QA 4C8ZA 2HMIA 1P6TA 3DGPB 5AXKA 5KFZA 4LF1A 3A12A 4DV2J 2B5JB 4PG8A 2JL9A 1FRLA 5T7LB 3FSYA 2ZDPA 2AYMA 3H5YA 2FHJA 4TQRA 1YK9A 1D8YA 4FBTA 4JUZA 2NXNA 3D28A 2ZUAA 1S9EB 4CM2A 2ASYA 1TUWA 2UXBJ 2MPUA 3AOCA 3I0SB 2NXCA 3RB0A 2BANB 3I5CA 3ZZUA 3FNNA 4A8SA 5KFPA 4UUXA 2J0XA 5KFLA 3IMQJ 3KLHB 4HVZA 3N5FA 3FSXA 2FDNA 4OJHA 5D4PA 2K2PA 2WW4A 3K0JA 2HQCA 2N82B 2GQ2A 2BKPA 1Q16B 1VQOS 3O6QA 2ZVSA 2CA9A 1L3VA 4RU2A 3RG6A 5H9EJ 1SL0A 2A6OA 3J80Y 1WOSA 1YX2A 2PMHA 3Q8YA 1GX5A 4CTAA 3GV7B 1OWXA 4X2BA 1J5OB 4NCGA 2J76E 4WU3A 3W66A 2ZH3A 1HW9A 1LEOA 3OHAA 2XSJA 3FUYA 4ZPCA 2HLUA 4LFAF 5H9FK 2E1MC 4ZKAA 2ZITA 2X1BA 4PXCA 2PMZD 1KFDA 1UFLA 1CLFA 1Y5IB 4KB7A 4RW4B 4YOEA 3BYPA 5DDRC 4DV0F 2JEIA 1MWQA 3KYLA 3A8IA 1IWAA 1MSWD 1HQ2A 1UJ4A 1HIYA 4HDHA 5J2PB 6AT1B 3HHLB 2DHGA 3WBZA 2HSEB 2ZWOA 1YJTA 5I42B 4KR0B 2JFDA 2DTJA 4WU2A 1WD6A 3MAAB 2G2ZA 1FDDA 4OL8A 4LBIA 2UXDF 1N5SA 3A4TA 1H73A 1U1LA 5K5MA 1KVKA 2D9PA 2GAGC 5F8NA 3W3SA 1B0VA 1Q8KA 2GQCA 2DXEA 1VRTB 2J9DE 3GFXA 3N6MA 3R7BB 1RAOA 3ETMA 1RU1A 4NLUA 2V0NA 2HVIA 3CNQP 3SFGA 2R4FA 2Y0BB 4AFFA 4LSLA 4DOZA 2DVIA 1U2FA 3SV3A 1F3FA 4PZVA 3H90A 2E5LF 1EJ7L 2FB0A 1MN9A 2VFTA 3FBFA 5FDLA 5LMNJ 1ZBTA 2LEBA 1FNOA 2DNNA 4F0HA 4Q0BA 1MU2B 5J2QB 3BKFA 1Q8IA 4ZPDA 2FLNA 3BQ0A 2RB7A 2V8GA 5IV3A 2G0IA 3EE3A 3CCRS 3ILLA 4C98A 1ZA1B 4KRWA 1I94F 3DRRB 4ETZA 4IOCQ 5ETMA 3H7HB 1VRUA 2RJZA 3S6EA 2QRRA 1Q8BA 4USKA 1EP4B 2CADA 4MKVA 5F0UA 4DSJA 2HVDA 1CULB 2I2YA 2WB1D 4MMOA 4K4VA 5KG4A 3MPWA 4C0HA 4V1Ak 1EAYC 4BC9A 1FWPA 3PRDA 5KFVA 3NGKA 3TA2A 5HP1A 2HHHJ 2B9EA 1LFWA 5KG0A 2ABYA 1WC3A 5FLXY 3N79A 1QJHA 1XWLA 2EFOA 3MI7X 1IUJA 2RQKA 2HHUA 2H48B 1IWGA 1MW7A 5DETA 2FY8A 2OFHX 5AE3A 1KS2A 4A47A 4H4OA 5KTQA 1GMWA 1C2PA 3HT3A 3PEJA 4LF7J 2ZH1A 2AKWB 4X84A 4AL5A 2XBPA 3R8YA 2HEKA 2AYEA 2DK2A 5HQ8A 1JLFA 2WVFA 4L76A 5M2PA 3THVA 3HKWA 1LW2A 2VF3A 4LBPA 2XNRA 1WHXA 1KVJA 1WG4A 2OPPB 3IR6B 1Y00A 4EFAC 4B3RJ 1FVSA 1X9SA 3OR1A 1TFYA 3K2YA 2DNLA 2EFVA 1JLBB 4ZOSA 4JB8B 2CNOB 3POTB 4DR1F 2W7OA 3ZTRA 3OUYA 2MYFA 3NLCA 1T8EA 4ANEA 3FRZA 1LWFA 3LP1B 3MR2A 5L9NA 1Q95G 4DPUA 2F4FA 2BEFA 3WIUA 1VR6A 4DFPA 4ZITA 2H65B 4RW9A 1YTYA 3PCOB 2QZ8A 1MWYA 5GMKa 3G6VA 3PG9A 2DNQA 2G4BA 5D0HA 4Q8EA 3H98A 2YNHA 4JV2A 2GVZA 1HNWJ 3M2RA 2EI5A 2W1BA 1SH3A 5B0BA 2HS0A 1MMDA 2P9GA 3C6TB 2RVJA 1C0TA 2E66A 1GMUA 3CSKA 1U2RA 2FHJD 1D8ZA 2IM3A 2HRTA 4L3NA 2V34A 2M9KA 5A0YA 3C15B 1CBKA 1T9XA 4JV5J 4P72A 1B4SA 2MEWA 1X4DA 1JXLA 3SDEA 2B7BB 2VODA 2QA1A 4ZVSB 1SUQB 4OYIA 3D54A 1S97A 2GQQA 4DV4F 4Y2AA 5IC4B 4OYBA 4IRDA 3J7YU 1FKOB 4DZDA 1G7CB 4LFAJ 4NX9A 1FVQA 4K4ZA 3VALA 3LO3A 2VDIA 1BQXA 4WYLA 2MQ8A 4ED1A 3CJ3A 5KFRA 4W4MA 1VHIA 3QJPA 3IXQA 4DV0J 3BDPA 4I7FA 3W1YC 1DARA 1TQLA 3PRVA 3A3PB 2FVCA 3JYTB 3FMWA 1TL1B 1FI4A 3DHXA 3CE8A 4PYDA 1LXJA 5A6PA 3BN7A 1QLNA 3E01A 4A8OA 4C8YA 3SSSA 4U67Q 4KTQA 5IM0B 4H54A 4DLGA 1QAJA 2N4CA 1T03A 2UXDJ 2BE2B 2DR7A 2D1CA 2KZMA 3MM8B 4LRFA 3LANA 4I0WA 2XO6A 1S1VA 2KI2A 1FD8A 1GEHA 1YDLA 4ANCA 2V50A 2Y9HA 2W2MP 3P96A 4CO3A 4ZPTR 3HMJG 2HBZB 1XTZA 2R42A 1SJQA 1NKCA 5E3PA 5B0GA 1R27B 1BWEA 4LREA 3OVSA 4IQMA 2KTQA 2J6UA 3HKZD 1M90T 2E5LJ 2D3OR 1WG5A 3N01A 5LSOA 1RTJA 2XZTB 1U1KA 4DL0C 5EX0A 3HD1A 2NZCA 2V4QA 3NGTA 4KO0A 1XNRF 1WDTA 4IFYA 3KOAA 5J2NA 1ZM3A 4HHUA 3CW2C 3QWPA 2UUBF 4NL5A 4BDPA 4Y2MA 2CQ1A 5KFCA 3NCPA 4LT6A 3EJMA 3PV8A 2V4RA 2CQPA 1T9TA 3R5GA 1V3SA 2VG7A 1RAFB 3THPA 1I94J 1EZZB 1U0SA 3WX8A 2FHOB 4ED8A 2B6AB 2BR0A 3SQGB 4OZ3A 1EARA 4QWDA 1BQNA 3QFHA 1HNIB 3M32A 4CIOA 3D3CJ 2BKOA 3HFKA 3H5XA 2L08A 2ZH4A 3NS7B 2XG8A 2QFIA 1BY9A 1OQ3A 3DOLB 4ED7A 4F4WA 4C0BA 2F7VA 2V2ZA 2B3TB 2YWEA 2QLFB 1S10A 4ZA1A 4RNFA 2C3PA 1PC4A 2YX4A 2F63A 2R8IA 4HEA9 4USWA 1M5VC 5A8WA 2CFXA 4NASA 5F8MA 4RZRA 3CJ4A 3FZ2A 1VBZA 4NLXA 1FJGF 5M2RA 1RLCL 1WEXA 1S1XA 4CLPA 2O66A 1R6YA 1SKSA 4DG1B 1FXRA 1KDNA 2C3UA 1UW9A 2DEIA 4ICLA 3NGDA 3TAQA 4USVA 2K8GA 3CXCR 3DYAA 4M5HA 2FD2A 3PO5A 1VQ4S 4RW6B 1S4EA 3GFYA 5IT9U 1P27B 5F8GA 2IVYA 1U09A 1GMWD 4LSZB 1SC3B 3FBEA 2I8EA 3ZTSA 2I5JA 4FN5A 2RF2B 4DR1J 5KFQA 1IM4A 3JSRA 2K3IA 3MEGA 3Q0AA 4ID5B 2QT7A 3IG1A 1IJFB 1VYAA 2XY6A 3QT5A 1ZM9A 1KRPA 4RNHA 4ES1A 2XI3A 2DR9A 1IKXB 2HIQA 4NLGA 1CEZA 5F9NA 2VHGA 2CRLA 2AGQA 4PQUA 2JC1A 5DLGA 4DJBA 5C24A 4WE1B 3GP9A 1ZOTA 2HWHA 1SV5B 2WONA 3OJSA 1RT5A 2OLWA 1RT3B 3FEXB 2MKIA 3UD5A 1HQEA 3CIMA 4X4UA 1NO8A 1HNVA 3D2WA 3CJKB 4FP9A 3GIRA 1K0TA 3PEHA 2KN4A 1RT6A 3M6UA 4B9LA 4LBHA 2MQNA 3GR1A 1TVRA 1BQMA 2GMLA 2QTWA 4TN2A 1BUXA 2ROEA 1YLXA 1UWBA 3EUNA 2LDIA 4TLRA 2YXLA 2HFSA 2ZVIA 3L7PA 4OYWA 4CH0S 1X9WA 1S0VA 3HSGA 4DUZF 4QZVB 3CCUS 4OJGA 1F5AA 1RI7A 2BUNA 4NA1A 4QR2A 3F44A 3CCJS 4YB6A 2HS4A 5K8MA 3BBFA 4ER8A 2RU3A 4PKDB 2JDJA 4DV4J 3J7YI 3QRPA 1RTDA 4RBVA 4ZVPB 1HHQA 3MFHA 4UY85 1HHSA 4ZVRB 2PC6A 3VCDA 1HI0P 1PC5A 2YVSA 3Q83A 1K47A 5KFSA 2Y1RI 1WI6A 2BJ3A 4AL6A 1N4LA 4Y28C 2OPQA 2EK6A 2ZDOA 3MM9B 4FXWA 1ZZFA 3KLIA 4O0IA 3WDOA 1N5VA 2NLWA 2LQ8A 4ZCIA 3TAMA 2VG5B 1RWXB 3SQOP 1S1WB 2YNIB 2D3O1 3SFUA 1JLEB 3E2EA 3GIKA 4DUTA 1BMQB 5K8NA 3GWCA 2VICA 2J9EA 3B78A 3CCSS 4ZJQA 2IC3A 2W2OP 1HBMB 4ANDA 3T5LA 3W8GA 2MKJA 3NNAA 4TKTA 1Q7YT 1RE1B 1OO0B 4CO1A 2AT1B 4LF5F 2NS1B 4TY8B 2W9AA 2ZBPA 4K0KF 1CJVA 2ZJRQ 4U8VA 4DX5A 3GU0A 1D9FA 1S49A 3LP0A 4YB7A 3X3UA 3TARA 3AJDA 2ZUGA 4E0DA 3DOKB 2VQFJ 2B9YA 1KNZA 1O6XA 3V6DB 2V2QA 3BH7B 2DY1A 3R1HA 2N4DA 3P6YC 5IQQA 5K14A 3M2UA 3EVWA 5KOXA 2E7WA 4JV0A 3K59A 3CCMS 2CUYA 1N36F 1XNRJ 2Z56B 9RUBA 3SIPB 5THWA 4EYIB 1N6QA 5RUBA 4L72B 2MLYA 1X9MA 2B4OA 6FDRA 2UUBJ 3JSMA 2HNDB 2JHEA 3JSYA 2Z4PA 3QFWA 3TEGA 2HRYA 4C11A 4UUWA 2MTLA 4OI4A 2J7KA 3R7SB 2VL1A 4I2PA 3MOZA 2YKAA 2OPSB
chains in the Genus database with same CATH topology
3C14B 1U0HA 1FX2A 1WC3A 4CLSA 1CULA 4CLFA 1CJVA 5IV4A 2WZ1A 4USUA 1TL7B 4CM0A 3ET6B 1AZSB 4WPAA 1WC5A 3C15A 3C16A 5D0HA 1CJTB 3G82A 4OYXA 4OYZA 4WP3A 4NI2B 2GVZA 4USTA 5IV3A 3C14A 3MAAB 4USWA 5D15A 4CLKA 1U0HB 1YBTA 1CS4A 1WC6A 4OYPA 4WP8A 1CJVB 1CJUA 4OYAA 1TL7A 1CJKB 4P2MA 1AZSA 2W01A 3UVJA 4CLTA 4CLPA 2GVDA 1WC4A 4OZ2A 3C15B 1YBUA 5D0RA 3MR7A 4CLLA 1AB8A 4CLWA 5D0GA 2GVZB 3R5GA 4USVA 4CLUA 1CULB 4OYMA 5D0EA 4CLZA 4WP9A 1YK9A 3ET6A 1CS4B 4P2FA 4CLYA 4OYIA 1WC1A 1FX4A 1CJKA 1CJTA 1CJUB 4OYOA 4OZ3A 4P2XA 2BW7A 3C16B 1Y11A 1WC0A 2QV6A 4NI2A 3G82B 4OYBA 3UVJB 4OYWA 1Y10A 3MAAA 4CM2A 2GVDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C14 B;  1U0H A;  1FX2 A;  1WC3 A;  4CLS A;  1CUL A;  4CLF A;  1CJV A;  5IV4 A;  2WZ1 A;  4USU A;  1TL7 B;  4CM0 A;  3ET6 B;  1AZS B;  4WPA A;  1WC5 A;  3C15 A;  3C16 A;  5D0H A;  1CJT B;  3G82 A;  4OYX A;  4OYZ A;  4WP3 A;  4NI2 B;  2GVZ A;  4UST A;  5IV3 A;  3C14 A;  3MAA B;  4USW A;  5D15 A;  4CLK A;  1U0H B;  1YBT A;  1CS4 A;  1WC6 A;  4OYP A;  4WP8 A;  1CJV B;  1CJU A;  4OYA A;  1TL7 A;  1CJK B;  4P2M A;  1AZS A;  2W01 A;  3UVJ A;  4CLT A;  4CLP A;  2GVD A;  1WC4 A;  4OZ2 A;  3C15 B;  1YBU A;  5D0R A;  3MR7 A;  4CLL A;  1AB8 A;  4CLW A;  5D0G A;  2GVZ B;  3R5G A;  4USV A;  4CLU A;  1CUL B;  4OYM A;  5D0E A;  4CLZ A;  4WP9 A;  1YK9 A;  3ET6 A;  1CS4 B;  4P2F A;  4CLY A;  4OYI A;  1WC1 A;  1FX4 A;  1CJK A;  1CJT A;  1CJU B;  4OYO A;  4OZ3 A;  4P2X A;  2BW7 A;  3C16 B;  1Y11 A;  1WC0 A;  2QV6 A;  4NI2 A;  3G82 B;  4OYB A;  3UVJ B;  4OYW A;  1Y10 A;  3MAA A;  4CM2 A;  2GVD B; 
#chains in the Genus database with same CATH topology
 2EFQ A;  4JI1 F;  4UZC A;  4DR2 F;  2FVS A;  4LIW A;  1QE1 A;  3T6J A;  5JJB A;  3A3O B;  2NYH A;  4GO5 X;  2POK A;  4HKQ A;  3HZG A;  3K5N A;  4NXM F;  2YQ0 A;  5IC6 B;  1WAC A;  3MEE A;  3W9J A;  3C14 A;  3M8P A;  3HVA A;  2RHS B;  4N5S A;  1SKU B;  3TUZ C;  1XER A;  3TWZ A;  1PAU B;  3C2P A;  2JJ4 D;  1HR0 F;  2QJ3 A;  4XPE A;  1JJH A;  3NKY A;  4WZQ A;  4Q43 A;  5IWA J;  1LQ9 A;  3V81 A;  2IYG A;  3AJ2 A;  3D1H A;  1FJG J;  2QL9 B;  2RT3 A;  5KG6 A;  4X4T A;  2BRL A;  4DQP A;  2WK4 A;  4YP3 A;  4JYA F;  2EW9 A;  1Z4U A;  2R2S A;  3I96 A;  3MCM A;  3ILO A;  3U7J A;  2XLJ A;  5KFE A;  1YRX A;  2AU0 A;  4K5R A;  1DLO A;  1VQN S;  3HSJ A;  2O1P A;  2J7U A;  3BBC A;  3R5C A;  3MFI A;  4RW7 A;  3PX6 A;  1RUS A;  4PEO A;  3CDB A;  2DPI A;  3RB4 A;  1RTH A;  2C2K B;  4KC5 A;  3L9Z A;  3Q8V A;  1FF2 A;  2PT0 A;  1SQG A;  2K1R A;  3IS9 A;  4WJB A;  3EIC A;  1N88 A;  3J7Z 5;  1FKP A;  5DQG A;  3RBE A;  1DHM A;  3D4J A;  3I55 S;  2AYG A;  5DLF A;  2D74 B;  2HNY A;  3MMJ A;  2QA2 A;  2LQ5 A;  3PX0 A;  1TL7 A;  4F26 A;  1UPM B;  4DEZ A;  4F4Z A;  2GCF A;  1VQL S;  1NXI A;  3DMJ A;  3IR7 B;  4M5D B;  3FSI A;  1JLG B;  1Y5N B;  4LQ9 A;  3QZ7 A;  1NHU A;  1RTI B;  2DNG A;  2CZ9 A;  2HZC A;  5D8H B;  3AA8 A;  3V6H A;  4OX6 A;  3C16 B;  5B0E A;  3HVT B;  4U7U K;  2ZH9 A;  1ACM B;  3BGF A;  3KWM A;  2OEK A;  1Z1Z A;  2HVH A;  3BS9 A;  2E1P A;  4UOF A;  3DLK A;  1HBU A;  3PVX A;  3LPY A;  4QYZ J;  2KB2 A;  4PXE A;  2SXL A;  4RPF A;  4QWB A;  3D7S B;  2XC9 A;  3HHK A;  1RA7 A;  4DUZ J;  1GAO A;  1REG X;  2CPF A;  2AQ4 A;  4Y6I A;  2NPI A;  1U47 A;  3TI0 A;  4CCH A;  1ZM4 A;  1YI2 S;  1FEH A;  4K4W A;  3K8W A;  2DNH A;  5LXY A;  2FVQ A;  4WFN Q;  2NZ4 A;  3OLA A;  4HHJ A;  1FEE A;  4OHW A;  2VU5 A;  1DY3 A;  2LMI A;  1MN7 A;  3OTC A;  2W9B B;  3MPU B;  2M5Y A;  2O67 A;  2OUG A;  1RWU A;  1YIT S;  4O3S A;  2UV8 A;  2AV5 A;  3ITH A;  1RJJ A;  1HW8 A;  3T19 A;  1HYS B;  2A6M A;  4ETX A;  4BWJ A;  1RBA A;  4CO2 A;  2DNZ A;  2ZZM A;  1FX4 A;  4DFK A;  3HCX A;  1S59 A;  1WC0 A;  5J2M B;  1ZYQ A;  3IM9 A;  2HBR B;  1SI9 A;  3J81 j;  1RDR A;  2MZQ A;  3M30 B;  2ILZ A;  2LVW A;  1LV5 A;  3BBB A;  4HLB A;  4ZLL A;  3FGV A;  1GH8 A;  1RYS A;  4ZK7 M;  2MHN A;  5HAN A;  2QMU B;  1UJ5 A;  2KU7 A;  4LF5 J;  3MUM P;  2YKO A;  2MLZ A;  2F5G A;  3DFE A;  1LW0 A;  3GG0 A;  4TNO A;  4K0K J;  4FYX B;  1NH7 A;  2B4P A;  3GTY X;  3EZO A;  4M8L A;  2EC2 A;  4N56 A;  1RKJ A;  5HI7 A;  4ECX A;  3ISN D;  5DQI A;  3PJX A;  2CQC A;  2ZZN A;  1KOO A;  1FDA A;  2DGX A;  1P1T A;  5C25 A;  4Y2K A;  3KKF A;  2J9C A;  1R8A A;  1SBR A;  3T41 A;  2V8P A;  3I82 A;  2JLE A;  3KLG A;  4TY9 A;  1NK4 A;  3TJ8 A;  2BDP A;  1N36 J;  1S72 S;  1U7L A;  3OSP A;  4BLG A;  4FF1 A;  3UVJ B;  2JLF A;  2VFS A;  3DRP B;  4L3K A;  4K4S A;  1QVG R;  1U1R A;  1FRI A;  2ZFH A;  4EI2 A;  5HAO A;  1NDL A;  2IVM A;  1HD0 A;  1WKJ A;  2ASD A;  3QRQ A;  5HVG A;  4DQQ A;  4P52 A;  3Q8P B;  3HZE A;  1UVN A;  4DPX A;  4RUC A;  3CO9 A;  1HPZ B;  1BC6 A;  3ZZO A;  2G13 A;  1ICE B;  3FEY B;  2E9Z A;  4MKA A;  1RHJ B;  5KFG A;  1FFS B;  2QIF A;  3EPI A;  2Q3P A;  4JI1 J;  1IQT A;  4DR2 J;  3AH6 A;  1N5Y A;  1SC4 B;  4MTP A;  1XR7 A;  1YJV A;  3TAN A;  4B9S A;  4ES2 A;  1T3O A;  4FPI A;  3M8S A;  2MKH A;  4MK8 A;  4NXM J;  1KQK A;  3AA9 A;  3NS6 A;  5D0R A;  2L9D A;  3DOM A;  3FMB A;  4IG0 B;  1RHR B;  1RLD A;  1L3S A;  3AXK A;  1HR0 J;  1FTC A;  3I9V 9;  4OJ1 A;  1UAW A;  3KJQ B;  5ETQ A;  3MEK A;  1JK9 B;  1CC8 A;  1D9D A;  4NI2 A;  4AD6 A;  3G8Q A;  2K3K A;  1RWP B;  2CQD A;  4KYZ A;  1JXV A;  3HHN B;  2IPO B;  4HTJ A;  4JYA J;  1IBC B;  1UFK A;  1HWK A;  2QEX S;  1LWC B;  3BB5 A;  3W2V A;  4I68 A;  3M7V A;  1HMV B;  5BYR A;  3ONQ A;  2O01 C;  4R8U A;  2NXJ A;  2JEF A;  5GAD U;  4KSE B;  2NUU G;  1DJ0 A;  1QVF R;  1AFI A;  3HLU A;  1M5S A;  3IM8 A;  2KM8 C;  3HX9 A;  4OIX A;  2P6S A;  1RAJ A;  1KC8 T;  4NOH A;  4E98 A;  3GIM A;  1J2V A;  5KFD A;  3MCO A;  3QBC A;  2KL8 A;  3C66 A;  4KFB B;  3ZZP A;  1JX4 A;  3OR2 A;  4MFB B;  1SL2 A;  4F8R A;  4KGV B;  3MCN A;  3NCQ A;  2LKZ A;  5DO2 A;  3F41 A;  1PYO B;  1WOR A;  1FTR A;  4ZS6 A;  2QA4 S;  5MLC V;  3LQV A;  4YDD B;  2CJY B;  2WVC A;  2AEJ A;  4KGZ B;  3WIV A;  4RL1 A;  1UA1 A;  3G8S A;  4X66 F;  2M70 A;  4Q2M A;  3Q24 A;  3OXG A;  3GZ7 A;  1F9F A;  4NXN F;  1A6L A;  4R5P B;  1UVK A;  2HQD A;  1ZET A;  2HFN A;  1C4A A;  4TU7 A;  3MWB A;  3CIZ A;  2U1A A;  2ZH5 A;  5HQM A;  3UN2 A;  2JFK A;  3MMB A;  1NDC A;  1RWO B;  3EVO A;  1Y5L B;  1KD1 T;  2WOM A;  2OJ3 A;  4IYQ A;  4KQZ A;  1KQS R;  1VDH A;  3DGP A;  3LOU A;  2HZV A;  2ZC3 A;  4GVB B;  4CQ1 A;  2B5J A;  5T7L A;  4B3O B;  4NA3 A;  5A8K B;  4EBD A;  2XMJ A;  5C2C A;  1J27 A;  1K1Q A;  4F25 A;  3C6U A;  1X0P A;  2XLI A;  1OY8 A;  4OHY A;  3Q2T C;  4YB5 A;  1TR0 A;  3IA0 A;  3TYT A;  1F2G A;  1S9E A;  2CNN B;  4OZJ A;  1S4F A;  1S6Q A;  1U8W A;  3AT1 B;  3TAP A;  4KY3 A;  3I0S A;  3V4I A;  2DR8 A;  2M8D B;  2XMU A;  2FY1 A;  3MM5 B;  5AJ3 F;  1FDB A;  4MIA A;  3TEH B;  1HKA A;  4R25 A;  3MAH A;  3VAG A;  3KLH A;  2MZ1 A;  2J6S A;  3WQP A;  3OLB A;  5IT9 Y;  4FZV A;  4IG3 B;  1C1C B;  5KFT A;  1YZ7 A;  4O4G B;  1WTB A;  3L3C A;  2R8K A;  2FGO A;  2Z2Z A;  1W26 A;  4LRD A;  5DDO C;  3W5Z A;  5DQH A;  1APS A;  1TK5 A;  2LEA A;  5BXI A;  2JSX A;  2JZ5 A;  4NPO A;  4K2X A;  2ZOG A;  2ZJP Q;  1KKH A;  4AXJ A;  1P9Y A;  3W5Y A;  1S99 A;  3W5X A;  4CLK A;  2VUG A;  4ZN3 A;  2YX1 A;  1HL6 A;  4RW4 A;  1NHK L;  5CZX A;  1OJ4 A;  1B99 A;  2Z58 B;  1K1S A;  3CD5 A;  3CUL A;  4A46 A;  3X1L B;  1JLC B;  3BM7 A;  2BVZ A;  1FRM A;  2HK3 A;  5EWF A;  5J2P A;  2M88 A;  6FD1 A;  1SQF A;  3HHL A;  4NEY A;  3OVA A;  2EG1 A;  3U1L A;  4LF4 F;  5I42 A;  1YRU A;  3PR5 B;  1RB0 A;  3MDF A;  1M0S A;  2FGC A;  3BF4 A;  3BKU A;  3P4U B;  2C22 A;  3MAA A;  1C1B B;  2EFG A;  1ULR A;  4C0O C;  5FD1 A;  3IAM 9;  2BJD A;  2CQG A;  3FDS A;  5B0A A;  2F40 A;  2DIU A;  3Q8R B;  4WKR A;  1BGX T;  3N0V A;  1UMJ A;  2HMI B;  3DXB A;  1BD6 A;  1UTA A;  1NUE A;  1X5P A;  3D66 A;  2CPY A;  3BSO A;  1HAR A;  4FF3 A;  1KTV A;  2UV8 G;  3FC9 A;  5CYQ B;  2ERR A;  4J9K A;  5IQ6 A;  1TUV A;  5F41 A;  4H4K A;  1PYS B;  2XB2 D;  1QTN B;  4IFV B;  1NPK A;  5FLX U;  1H7X A;  3ZZY A;  1MU2 A;  1WI8 A;  5J2Q A;  4M5L A;  4QPT A;  3RU0 A;  1HWJ A;  1VOM A;  4CO4 A;  2FVP A;  3G6X A;  2PI5 A;  4RUB A;  1S57 A;  1XK8 A;  1T9W A;  1I51 B;  1FDN A;  3V6J A;  3CCW A;  2KH9 A;  3GCX P;  4O44 B;  5ETS A;  1R31 A;  4KBI A;  2QN6 B;  5M2U A;  1DZ5 A;  5F9L A;  3DRR A;  3BO4 A;  1EQM A;  4ECS A;  1RT1 B;  3N5B A;  1X4E A;  3KLE A;  2A18 A;  2FVR A;  1EP4 A;  3E3X A;  1X4C A;  2BJ8 A;  3G4S S;  1S77 D;  4F36 A;  2AW0 A;  3CTR A;  3R3T A;  5KG2 A;  1WOP A;  4C48 A;  4LIR A;  5KG7 A;  1HWU A;  3QZ8 A;  3ZNJ 1;  4DR6 F;  2H3E B;  3GJS B;  3WC2 A;  2GHP A;  4X4P A;  4KHP F;  5H9E K;  1RWK B;  5GAD I;  1F1B B;  4NEZ A;  2M3D A;  4LVO P;  1JNZ B;  4PR6 A;  3P45 B;  4CLL A;  2MQM A;  3SCJ E;  2XCA A;  4CWB A;  4CLU A;  2MHE A;  4Y65 A;  3PM9 A;  1D09 B;  2VOP A;  2XWX A;  3TQE A;  4ED4 A;  4ENO A;  3K5M A;  2Q79 A;  4C8M A;  3JAM U;  3DM2 B;  2B43 A;  3M9O B;  3NMA A;  3FCH A;  4MAK A;  4DL5 A;  1NKE A;  2GJF A;  3VTI A;  2Z8Q A;  4NMX A;  1ARO P;  4X66 J;  2HAF A;  4AL7 A;  4IH7 A;  4FF4 A;  1JLB A;  2CG4 A;  2ZOF A;  4NXN J;  1AYE A;  1FK9 A;  4WXW A;  4J9L A;  3JQJ A;  3TZX A;  3POT A;  2XCP A;  3O44 A;  5DDP C;  3T3F A;  3D0G E;  5CZV A;  4LSL B;  4EK2 A;  1U6B A;  2OTL S;  3U27 A;  4ZLJ A;  1R0A B;  3BPS P;  3ILI A;  4N8N A;  4OV6 A;  2UUW A;  1CC7 A;  2F3J A;  1HQU B;  1XQI A;  4GC6 A;  4L6V 3;  1VCT A;  4N41 A;  2XM3 A;  4CYU B;  1QUV A;  4OYM A;  3GPA A;  4TU9 A;  3CPW R;  3AOA A;  4ZCK A;  5D6G A;  4F2R A;  3NGR A;  1H2V Z;  3SEO A;  3RBD A;  3LW5 C;  4PG4 A;  2H5J B;  2OIH A;  1KHV A;  2NRE A;  1WOO A;  5AJ3 J;  2V68 A;  2VPW B;  2GVD B;  2VJV A;  5BYS A;  2CVI A;  3C6T A;  1Q5Y A;  4EO6 A;  3CMQ A;  4Q45 A;  4G3I A;  4GVL A;  4F3O A;  1VRU B;  3C15 A;  4OFZ A;  4XPC A;  4ZP8 A;  1RZM A;  2V2V A;  2E1A A;  2OAU A;  4KGX B;  3US5 A;  1U1Q A;  1EHW A;  1O5J A;  4NYP A;  2C3O A;  1K44 A;  5U47 A;  1KON A;  3RRH A;  1XJW B;  4XTT A;  2I0X A;  3G71 S;  2K06 A;  4HR2 A;  3HHL C;  1FKO A;  1SCJ B;  2C2Z B;  4OZ2 A;  1TK0 A;  4JV1 A;  2GFF A;  3DDK A;  1YHQ S;  3R9L A;  4M1K A;  1B70 B;  3F56 A;  2EBG A;  1FRH A;  1URR A;  3BGR A;  5CD4 H;  4RUA A;  5I4M A;  1T05 B;  1RA6 A;  3NL0 A;  1FFG B;  3JYT A;  4ECZ A;  1TL1 A;  1PIL A;  2C2R A;  4NRT A;  4JI5 F;  1Q0N A;  4G1P A;  1VQ7 S;  1LW2 B;  2YTC A;  3VVT A;  4YFU A;  4N8O A;  3KUG A;  2COL A;  4LF4 J;  2CQB A;  3LWM A;  1TMJ A;  2B4U A;  5E3C A;  2BE2 A;  1GX6 A;  1LNQ A;  4L74 A;  3AOD A;  3MM8 A;  3I5A A;  2IY5 B;  2RML A;  4U8Y A;  3RR8 A;  2PDA A;  4LF9 F;  3OTB A;  4GC7 A;  1Q7L B;  1DUR A;  3HHL D;  1WUU A;  1K8A T;  2KHC A;  4QIF A;  2CPD A;  4ZVE A;  1EKR A;  4CO5 A;  2GZO A;  1SJ4 P;  3M8W A;  2ZHA A;  5D4N A;  2F1F A;  4C8O A;  2EFP A;  4PPD A;  2OPR A;  2ZC4 A;  5G0R B;  1RAG B;  1OIA A;  5L46 A;  3KJF B;  3VAM A;  3HHE A;  5HLF B;  2XYH B;  3LGN A;  5AXL A;  4FNH A;  3K7R A;  3QIP A;  2BBE A;  2PA8 D;  2V94 A;  2YNH B;  4NLT A;  3DI6 B;  3R2C J;  2YKN B;  3FEZ A;  3D67 A;  4GO7 X;  3BR8 A;  1YJU A;  1WSV A;  1RT4 B;  4RJV A;  1V5V A;  2PII A;  4FKX A;  1MRO B;  2YQ3 A;  1E6V A;  3DRS B;  1YG0 A;  4DR4 F;  4M63 A;  1IBK F;  1SIW B;  2MQL A;  4IOB A;  4F4Y A;  2B8Q A;  4QWC A;  2IJF A;  4DSL A;  3CDE A;  1Z2L A;  3GIL A;  2MKK A;  1Q53 A;  3TA0 A;  3VZH A;  3SDE B;  4F02 A;  1A9N B;  3TJA A;  2MY8 A;  1BHN A;  2R3V A;  1YZ6 A;  3A3N B;  3UCU P;  2EG2 A;  3SQG A;  5IT4 A;  4BHQ A;  2KXH A;  3PNI A;  2YNG A;  1DTT B;  4ZIV A;  3FKB A;  4KE5 A;  2ZH6 A;  2VPY B;  1HNI A;  1YGY A;  1JMT A;  1AB8 A;  2WVB A;  3OTE A;  4DR6 J;  5GAG U;  1TTH B;  2Z2M A;  2JWN A;  5I3Q A;  4KHP J;  3CCE S;  2QE5 A;  2E9R X;  3UN5 A;  4P2X A;  3PO4 A;  1NK7 A;  4FS1 A;  1NDK A;  3D6T B;  4HAC B;  3ZTQ A;  4PQA A;  1F5C A;  4IO1 A;  4J7C A;  5DG7 A;  4KV8 B;  3N4W A;  1KBR A;  1YWX A;  4J9Q A;  1SC1 B;  2E9T A;  1SH0 A;  1RT2 B;  2AMC B;  1D0E A;  4F3M A;  4YY3 F;  1QUP A;  5KG1 A;  4DG1 A;  1G2E A;  4MKB A;  3BPD A;  2VH7 A;  4P75 A;  3CGI A;  3KDO A;  4U9R A;  1G1X A;  4DL4 A;  1JLQ A;  4C3K A;  2J0Q D;  4RW6 A;  2LCW A;  3GII A;  4YQW A;  2DXD A;  4QR0 A;  1FT8 A;  4BC7 A;  4MKY A;  3T5K A;  4OMF G;  3GE9 A;  3G6Y A;  5DG9 A;  2RF2 A;  5HL7 Q;  4RO0 A;  3UW1 A;  3GON A;  2X7I A;  3LP2 A;  1VIO A;  2KT3 A;  4ID5 A;  2APO A;  1B3T A;  2HVE A;  3CJS A;  1IKX A;  4C6A A;  1RAD B;  1JKH A;  1GTH A;  1Y11 A;  4DS5 A;  1LOU A;  2PGC A;  3M4X A;  5KFY A;  3KHH A;  4ZVF A;  5HVF A;  2YPY A;  4DN9 A;  1SV5 A;  4B3R F;  3HSZ A;  4KO0 B;  4KAI A;  4XDD A;  2BQR A;  4IFY B;  1ZTW A;  4I64 A;  1RT3 A;  1VQP S;  1N56 A;  1FWK A;  4A8Y A;  3ZFV A;  2DGS A;  5ITH A;  2P5V A;  1UVJ A;  1PIE A;  2NQP A;  4ILR A;  3THT A;  3CJK A;  4FDF A;  2BA9 A;  3QT7 A;  3JSB A;  3UR0 A;  2HHS A;  2YWK A;  5D3G B;  2CNK B;  4LJM A;  1VQ8 S;  4YHH F;  4DV6 F;  2VG7 B;  1U1O A;  2ZBC A;  1K73 T;  1B7F A;  3UNY A;  1NH8 A;  4CT9 A;  2BOP A;  4DDF A;  3TZW A;  4EWT A;  2PE8 A;  3LF0 A;  2W2P P;  4C97 A;  3OJU A;  1RAA B;  3ZNU A;  1BQN B;  1NK8 A;  3B4M A;  5FJ4 A;  4ZLN A;  1FNM A;  2VIH A;  3BO2 A;  3OPK A;  3W61 A;  4FF2 A;  2CJA A;  2GHV C;  2N7C A;  2EXU A;  1WDD A;  1WHW A;  2XO7 A;  4X4N A;  2H51 B;  2GS8 A;  1HNW F;  3SSR A;  4QOT A;  3KHR A;  3MTK A;  1PSD A;  5A8W B;  2RS2 A;  4YS2 A;  3CT9 A;  4J9U E;  2QYG A;  3I6P A;  3M2V A;  3MM9 A;  4JV5 F;  2DHS A;  3TVK A;  3CD6 S;  5B08 A;  3PYF A;  1R8C A;  4QR1 A;  1S1X B;  2BM0 A;  4JI5 J;  3R6L B;  2BW2 A;  2YKP A;  3GMG A;  4ICL B;  1S1W A;  2YNI A;  1JLE A;  2RKI B;  5G4D A;  1VQ6 S;  1KQF B;  4OV1 A;  5KT6 A;  1HBM A;  4FS2 A;  2IAJ B;  3VGU A;  2IM1 A;  4F0K A;  4LF9 J;  4TY8 A;  4W98 A;  2PA3 A;  2DNR A;  2GC8 A;  2H9Z A;  3QAU A;  2OD4 A;  2P6T A;  3AHP A;  3EXY A;  1REV A;  2FPH X;  3ENW A;  8RUC A;  2AX1 A;  4URS A;  1FRJ A;  3QWU A;  2XS5 A;  1F0X A;  3HVW A;  1NK6 A;  2IYI A;  2XZD B;  5KFM A;  5SZT A;  2BM1 A;  1EX8 A;  3V6D A;  4QIW D;  3QJJ A;  4IDK B;  5C24 B;  1U24 A;  2KO1 A;  1RT5 B;  1S6P B;  4CLF A;  2DXF A;  1JXE A;  1HQE B;  2IMO A;  2FLO A;  5GAE U;  2AJ1 A;  2IDE A;  4DSK A;  2HKE A;  2FJX A;  2GNK A;  1NM2 A;  4P74 A;  1X31 C;  1IXK A;  2KHD A;  2H4Y B;  4OLP A;  2C1E B;  4DR4 J;  1IBK J;  3IN5 A;  3EMT A;  1HA1 A;  3MMC B;  3EGW B;  3RAM A;  1BQM B;  3IC1 A;  3GJT B;  3K17 A;  3RRK A;  5E3R A;  1CQN A;  1SJ1 A;  1VQS A;  3R7N B;  1W2B R;  3GYN A;  4ERD A;  3LGH A;  4K4X A;  1PG5 B;  3H2L A;  5KG5 A;  2OPS A;  1IKV A;  5DS7 A;  3CMA S;  4Y3C A;  5HMZ A;  2ZEJ A;  4J91 A;  4N77 A;  3FBC A;  5IT0 A;  2E44 A;  2M8H A;  2EBE A;  3CF5 Q;  3DRX A;  4USM A;  2H1Y A;  3M8R A;  1B0T A;  3Q2S C;  5GAG I;  1VQ9 S;  2WBR A;  3QQC D;  2BX6 A;  2ZHO A;  3H59 A;  1GNK A;  4R0J A;  1RP5 A;  2LQB A;  4I2Q B;  3LWL A;  3DLB A;  4PAB A;  2Q1L A;  1DQA A;  2IHR 1;  3TNV A;  4A8M P;  4PAA A;  3T1Y F;  2RRB A;  2R7R A;  5F8H A;  5E0O A;  2VZ9 A;  4M94 A;  3K5O A;  2R7W A;  3D6H B;  4J5O A;  1UVL A;  3TAM B;  4AUK A;  3GSD A;  1NDP A;  2AEF A;  2B4V A;  1U0H B;  4QBU A;  3PX4 A;  4YY3 J;  1S6U A;  2R7V A;  2HHV A;  2UVU A;  1EKS A;  2D69 A;  2WAQ D;  3HUL A;  2IC3 B;  2ZBR A;  3I0R A;  4DL2 A;  5GVQ A;  5K8O A;  5J1P A;  4FVC A;  1N32 F;  1LXN A;  1S12 A;  5LSR A;  1QSS A;  4DPY A;  5EWE A;  4DUY F;  2RU9 A;  2HHX A;  1S1U B;  2YKM B;  2Q66 A;  3QLH A;  4KH0 B;  1HWL A;  2EPI A;  2QLW A;  2CG8 A;  3QAE A;  3MHY A;  1RHQ B;  1UEU A;  1GK8 A;  2K7K A;  5ETV A;  3MEC A;  1OPZ A;  1TL4 A;  4O3R A;  4P71 A;  5K14 B;  3M2U B;  2GA7 A;  1M1G A;  3QT6 A;  1WEL A;  1TV6 A;  1H2T Z;  4LR8 A;  3UQS A;  2L3M A;  3W2W B;  1JLG A;  3M05 A;  2DJW A;  1C0U A;  4YUD A;  3I32 A;  5B0F A;  5L9X A;  3JSM B;  1X4A A;  2HBY B;  2RQM A;  3HVT A;  3HD2 A;  3E51 A;  1YVF A;  4YHH J;  4I2P B;  4DV6 J;  1FRX A;  2CXE A;  2PN6 A;  1RIS A;  2CJQ A;  3FVY A;  4HI1 A;  2CVE A;  1UPP A;  5ETR A;  3OFG A;  2R2R A;  2HQF A;  1F9E B;  3L7U A;  4FPR A;  3L7O A;  4FKY A;  1CJK A;  2IJN A;  2Y3Y A;  5AXM A;  4RW8 A;  5CH7 B;  3TVZ A;  2JX2 A;  3JAM Y;  3N6N A;  3C14 B;  3M8P B;  2VC1 A;  2VAS A;  4P6Q A;  4P10 A;  3PHE A;  4OI1 A;  2BJ7 A;  4X4S A;  3N6L A;  5E2Q A;  3QO9 B;  1P9Q C;  2D3Z A;  2QA4 G;  3GG1 A;  1Q8L A;  7AT1 B;  2RRN A;  3O1L A;  5CCL A;  2W9B A;  1RYR A;  3IRW P;  3ET6 B;  1NSQ A;  2RDI A;  1O0P A;  2LYV A;  3TQ1 A;  3KK1 A;  2NUH A;  5EWG A;  1I5O B;  2OEM A;  4A48 A;  1DRZ A;  1HYS A;  3TRG A;  2VBX A;  4XDC A;  1E6Y A;  4ZVU B;  4ZVT B;  4JI8 F;  2F8H A;  3ILJ A;  2ADC A;  4S0M A;  5J2M A;  4Q44 A;  1RXO B;  2ZZT A;  3I31 A;  2QSW A;  4YR3 A;  2LEC A;  2I1R A;  1DLO B;  4DN0 A;  3M30 A;  4AE5 A;  2OEJ A;  2RD5 C;  1RCO B;  3CC4 S;  1NK5 A;  3LUY A;  3DRY A;  4DCJ B;  1NPP A;  4B9N A;  2ATL A;  1RTH B;  5HRO A;  3H25 A;  4CLY A;  2DRA A;  2Z2L A;  2PFF B;  1WC1 A;  4NE9 C;  2A3J A;  3PW5 A;  3FQL A;  1HFE L;  3G6E S;  3QJL A;  3BSC A;  2CQ3 A;  3U02 A;  3IS9 B;  2CJ9 A;  4PUO A;  2LA6 A;  1FKP B;  4NZ6 A;  4CO0 A;  2CYY A;  4GKK F;  2DNK A;  2XI2 A;  3MM6 A;  1TL7 B;  1M5K C;  1WF0 A;  1MLA A;  4IOA Q;  1U1M A;  2LFV A;  4NCA A;  2K7J A;  3KK2 B;  2KM8 B;  1SC6 A;  4G1Q B;  1T9U A;  3JQK A;  3B54 A;  4P2S A;  3ISZ A;  3AFG A;  1VGY A;  5GAE I;  5C2G A;  2WHO A;  1YJW S;  1QY7 A;  3J81 Y;  1UET A;  2MQO A;  3UVJ A;  2HHQ A;  5FII A;  5A8R B;  3DRP A;  1NJI T;  4IUF A;  3NXZ A;  3MR7 A;  2WB4 A;  1X4B A;  2MSS A;  2VKR A;  4UZB A;  5AE2 A;  3PFO A;  4O4R A;  4O0N A;  3Q22 A;  1TAU A;  2VQF F;  2DH9 A;  4OX7 A;  2HS3 A;  2GIR A;  2QO3 A;  1HPZ A;  2DO0 A;  1FXL A;  4USI A;  4NZ0 A;  4QWE A;  1T95 A;  1RWN B;  3NAH A;  1RWW B;  4FNI A;  4Y2C A;  2UZA A;  5K20 B;  2GJI A;  4DPT A;  2RRA A;  4OHV A;  4DV7 F;  1T9V A;  3F73 A;  2GGP B;  3N9U C;  4QYZ K;  5DRK A;  3GB0 A;  2BJE A;  3CVK A;  3UD3 P;  4FYD A;  5LJ3 Y;  3UNG C;  4E8U A;  3NAI A;  4YEA A;  2YBV A;  4IG0 A;  3VGT A;  3ITH B;  3BKT A;  3IP0 A;  4GRS A;  3CJ5 A;  3T1Y J;  1L3T A;  2FJB B;  3P49 B;  3CD7 A;  3NY0 A;  3CC2 S;  1HNZ F;  1MG7 A;  3BR9 A;  1TAQ A;  4ZVG A;  5BR8 F;  5ETN A;  8ATC B;  2KXN B;  3CDA A;  4Q7A A;  1QAY A;  3EGZ A;  3AD9 C;  3FQK A;  4Y00 A;  2G0C A;  3UDC A;  3BGU A;  2G1H A;  5HK4 A;  1HMV A;  3KTQ A;  3PRB A;  4A8W A;  1XEZ A;  4HDG A;  1N32 J;  2RHQ B;  1Y10 A;  3L4B C;  4R0E A;  3H4D A;  4DUY J;  3ADA C;  1SKR A;  4M95 A;  3A8E A;  4I4B A;  1W7W A;  1N34 F;  5IWA F;  2BJ9 A;  1K0V A;  4KFB A;  1VBY A;  4WFZ A;  4DSE A;  2XHW A;  4FBU A;  3T9Z A;  1TL5 A;  2I9S A;  4B3S F;  3KJN B;  5C25 B;  1DQ8 A;  4CT8 A;  1GXL A;  1U6Z A;  4NLR A;  1G6B A;  2DIT A;  1OY9 A;  3IRX B;  1KR4 A;  4X62 F;  3ELH A;  3K5L A;  1TUG B;  1KSP A;  4R5P A;  4RNO A;  2W7P A;  5AT1 B;  1RTZ A;  1YBU A;  4X4V A;  4QQB A;  4ED6 A;  3SBM A;  3TA1 A;  1M1K T;  3Q89 A;  4WP9 A;  1QM9 A;  2DGU A;  5KFB A;  2ADB A;  4K2J A;  3G9C A;  3RBX A;  4NLQ A;  2NXE A;  2LLZ A;  1VBX A;  2ATC B;  5ETK A;  1X7V A;  4B3O A;  5A8K A;  4DR7 F;  2R7T A;  4RNN A;  3VQT A;  5LT5 A;  2YQ1 A;  1YQH A;  1CSJ A;  2W25 A;  3G2X A;  5L1I A;  3DLG B;  4O3N A;  2CQ0 A;  1RKI A;  3QRR A;  1UEV A;  3JS9 A;  5GAH U;  3V2U C;  4ZLP A;  1UVI A;  3DOM B;  1KN6 A;  3FJ2 A;  2HBQ B;  2W4D A;  5KFJ A;  5EDW A;  3HDS A;  1WC6 A;  4FXV A;  4DZ6 A;  5L1K A;  5CAB A;  4ZPV R;  3S7R A;  4J9O A;  3NEK A;  1B0P A;  1C1C A;  2P8I A;  2X1G A;  3H2V E;  4F2S A;  3ZZ0 A;  2H5I B;  2HGM A;  4O4G A;  4CP5 A;  4JI8 J;  5CCM A;  4IRK A;  1FFW B;  3EPG A;  5C42 B;  1H0H B;  4OZ0 A;  3W2V B;  3TZZ A;  3HHD A;  5A76 A;  1B64 A;  3MPD A;  3ZC4 A;  3KJV A;  4USH A;  2JNJ A;  1X5O A;  3DDI A;  5B7W A;  1AUD A;  3SYZ A;  3OV7 A;  1RAE B;  4X4Q A;  5KT2 A;  2EWH A;  3HJV A;  1XNQ F;  1VS3 A;  3OTO F;  3IAS 9;  1U8S A;  2HHT A;  1X5T A;  4PXD A;  4USJ C;  4AXI A;  3OR2 B;  3DNC A;  1CJT B;  4DL3 A;  3G82 A;  5MAO A;  2DGQ A;  4GKK J;  2MGZ A;  1VFJ A;  1VHF A;  1FE0 A;  2WBM A;  3D6F B;  3WX4 A;  5LSL A;  4A8K A;  4B3T F;  2W24 A;  2DH7 A;  1N48 A;  4OZN A;  1I6J A;  1EB0 A;  5L39 A;  2DRB A;  2LXI A;  1S0M A;  3TO8 A;  3OVB A;  2YWG A;  5I3P A;  4LFB F;  1C1B A;  4QWA A;  2XS7 A;  1H7W A;  2W9C B;  4A8F A;  4ED3 A;  4B08 A;  3B4D A;  4AYB D;  2BE9 B;  2JVO A;  3BYR A;  4PWD A;  2R7X A;  4ATN A;  2WOM B;  4CZC A;  4BS2 A;  1CJU B;  5L1J A;  1BLU A;  1U26 A;  1ZPW X;  1L5U A;  3OL6 A;  3TW0 A;  3DXS X;  3MPV A;  4ILL A;  5CYQ A;  5KFH A;  3UR3 C;  2DCL A;  3C6U B;  1VBK A;  1F9H A;  4FYW B;  4USU A;  5H1S V;  1IR1 A;  4LR9 A;  4DV3 J;  1S0O A;  2X3G A;  4NLP A;  1S6Q B;  4IFV A;  2L9N A;  1X4H A;  2XZW A;  3V4I B;  4NLS A;  2OGU A;  4DV7 J;  2KFN A;  2UP1 A;  2W8L A;  4DV1 F;  3BQ1 A;  3TR5 A;  4Z7C A;  2DT9 A;  4RKU C;  4RLE A;  4B9U A;  1AZS A;  4DX8 H;  2HLT A;  5JXS A;  2HVZ A;  1KLM A;  3VAJ A;  4WFB Q;  4O44 A;  3OD2 A;  3MXH P;  3EDR B;  5HMY A;  4KPY A;  1TU0 B;  2KT5 A;  1TKX B;  1H74 A;  2W2N P;  1HNZ J;  1RT1 A;  3W64 A;  1VLO A;  5BR8 J;  2MDA A;  3BEG B;  1NJY A;  3TJ9 A;  4I1T A;  2CAJ A;  1LWE B;  1U6F A;  1RAB B;  3NGS A;  4LMZ A;  4IR1 A;  3UI3 A;  4EBE A;  1T0T V;  4MIW A;  3NMR A;  1NB2 A;  1R3N A;  3HI9 A;  3TP2 A;  4C3L A;  3BH6 B;  2CWX A;  2IIH A;  4G6V B;  3A8K A;  3AXM A;  3RBZ A;  4Y0F A;  1MNE A;  4O3P A;  2A2C A;  2CZV C;  3MR3 A;  1VC5 A;  1RT7 A;  5JVG Q;  4C8N A;  1LWX A;  1N34 J;  3V6K A;  5E41 A;  2GHW A;  4XK8 C;  2RIJ A;  2BAC A;  2JH3 A;  4RUH A;  4ED5 A;  2LP4 A;  2CPH A;  3MOJ B;  3DM2 A;  4ZN1 A;  4B3S J;  2M0G B;  1WKL A;  2MST A;  4CNY A;  2HPU A;  4QU6 A;  3EX7 B;  3PYG A;  4EZ6 A;  4O23 A;  4A4J A;  1TFW A;  2YKQ A;  1MML A;  5DM7 Q;  3MGJ A;  4X62 J;  3P5B P;  5LM7 E;  2NYI A;  5J1E A;  4KGM A;  3FFI B;  2OML A;  4EBC A;  2HW3 A;  3CDW A;  1R0B G;  4N47 A;  2PD1 A;  2YWF A;  1URN A;  2V2K A;  1IKW B;  2BQ3 A;  1IKY B;  4ECV A;  3HFZ B;  1UW4 A;  3CCZ A;  2DY9 A;  2JOQ A;  4FVM A;  2CQ4 A;  1R0A A;  4J9R A;  3D6M B;  2AD9 A;  4WZM A;  2AGP A;  1JIH A;  4DR3 F;  1HQU A;  1WSR A;  2ZHB A;  4DR7 J;  1PGZ A;  2V4J B;  3QID A;  4M5I A;  2RAQ A;  2PEH A;  4HT7 A;  2F4V J;  4CYU A;  1N8R T;  2W4P A;  1SPB P;  2VBZ A;  2KYZ A;  5GAH I;  4ES3 A;  2IJR A;  2RDJ A;  3QNW B;  5AE1 A;  3QT8 A;  8AT1 B;  2GVD A;  3MZI A;  4WYW A;  1KEK A;  4ECW A;  5GMD A;  2KG1 A;  1XMQ F;  2V63 A;  1CS4 B;  1RSC A;  3KLE B;  2JLG A;  3GSI A;  5B0D A;  2XGP A;  4LF6 F;  3L09 A;  1PJ7 A;  2Z30 B;  3K89 A;  3RYL A;  2GO9 A;  3ZTP A;  2VPZ B;  1Y9O A;  2M4M A;  4LUB A;  4LQ3 A;  2VPX B;  4LSN A;  2HIY A;  4OI3 A;  2BQU A;  4WK1 A;  2WRM A;  2R8J A;  3BV8 A;  1SH2 A;  3BSN A;  2AHO B;  5LOQ A;  4C3M A;  4ED0 A;  2LU2 A;  1U4B A;  3D0H E;  2WSC C;  1XNQ J;  1QAI A;  3SXL A;  2RH3 A;  3M1V A;  2CPZ A;  2GX8 A;  3ISN C;  3OTO J;  4H4M B;  2G1D A;  4DL6 A;  1VIS A;  1T05 A;  2RQ4 A;  1JJC B;  1YBA A;  3MUR P;  2LDY A;  2RE1 A;  1Q81 T;  2J6T A;  2XY5 A;  2QLX A;  3BSA A;  4B3T J;  1TL3 A;  2HNZ A;  2VFR A;  3RGI A;  5D0G A;  1AUS L;  4MIB A;  1G4C A;  2Y0S D;  3Q23 A;  3MTJ A;  1HNX F;  4MYT A;  3R97 A;  5T14 A;  4D3G A;  3M8Q A;  4LFB J;  2GIF A;  2NSB A;  5DGA A;  2XMM A;  3OSN A;  4LFC F;  1JWW A;  1IR0 A;  3UE2 A;  3D5M A;  2IFX A;  3D1O A;  3NG8 A;  2E5J A;  1FK9 B;  1F3V A;  1EET A;  4XIU A;  1ROF A;  5F8J A;  4C8L A;  3QAT A;  5BJR A;  1GMV A;  2H4W B;  1HBO B;  2VBY A;  5HO4 A;  1A0O B;  4CI0 B;  4ZHR A;  2MXY A;  1S76 D;  3EVM A;  3QSY B;  1JLA B;  2IA0 A;  2BKN A;  3MMA B;  2GW8 A;  4MK7 A;  1X0F A;  2FJV A;  2ZBQ A;  3UO0 A;  1NHV A;  2ASL A;  5G0R A;  4ELV A;  3HK2 A;  3A8J A;  3VAK A;  1DAX A;  3S8S A;  4P9S A;  4ZP6 A;  1S79 A;  1JJ4 A;  3RJM B;  5HLF A;  3IBW A;  4OYA A;  4WBF A;  2JEJ A;  3MED A;  3NBP B;  2W01 A;  2CJB A;  2CNL B;  3DI6 A;  2VA2 A;  1S7I A;  3M9N B;  2YKN A;  4URG A;  3KMS A;  3MD3 A;  1H72 C;  3R1L A;  4DV1 J;  1RT4 A;  1VJW A;  2Y8W A;  3R5B A;  5KFX A;  1YKW A;  1MRO A;  3DRS A;  3H42 A;  1N33 F;  2LA4 A;  4CLZ A;  3ZTO A;  4DSI A;  5F8I A;  2J8S A;  3CJ2 A;  1TKT B;  3DGV A;  3PYE A;  5KFA A;  2QL7 B;  3KLF B;  1FE4 A;  1WNE A;  2DNY A;  3OXL A;  2I6W A;  3NWG A;  4KIA A;  1H3D A;  2ZD1 B;  3KG0 A;  4TQS A;  1S9F A;  2EEY A;  3MM7 B;  3TX8 A;  2A1B A;  2F9D A;  1IN0 A;  4KHR A;  4F50 A;  1X8D A;  1VQY A;  1A7G E;  1DTT A;  3I87 A;  4YR2 A;  3R5J B;  3W8P A;  4RX6 A;  2Q6C A;  2HRU A;  1GQE A;  4WP3 A;  4RWX A;  3DCA A;  5D15 A;  1GTE A;  1XR5 A;  2AJQ A;  2N3L A;  4HT5 A;  3BGR B;  1RHM B;  2H5E A;  1S1T A;  4ED2 A;  2DIV A;  2YWW A;  2BE7 D;  5T41 A;  1WTF A;  1N0V C;  4HAC A;  2DGW A;  1KHW A;  1QDU B;  1TKZ B;  5HBM A;  4HH0 A;  4KV8 A;  3PJW A;  1S5Z A;  1WHV A;  1OSD A;  2J0W A;  3Q8S B;  1NSA A;  1RT2 A;  1S9G A;  1UA0 A;  3OQ2 A;  5EGY A;  2QMW A;  2PEB A;  4JI3 F;  4OJ3 A;  3HF5 A;  1NJX A;  2N3O A;  3NWR A;  1SXL A;  2KFZ A;  5CYM B;  4P2F A;  4J37 A;  2Y8Y A;  4F67 A;  1L3U A;  4DU7 A;  3JTP A;  2UU9 F;  1SQE A;  1QSL A;  3A1Y G;  4ILM A;  5EX3 A;  2LXF A;  2PMW A;  2MKS A;  3D68 A;  1VLY A;  5CAA A;  1NZ8 A;  3IBC B;  3CDU A;  3S1T A;  4X65 F;  4TYA A;  5LXR A;  3GFZ A;  4DL7 A;  3WHI A;  1Z2Z A;  2ZH7 A;  2MZS A;  3O3L A;  3KK3 A;  3AD7 C;  4I6W A;  2CWK A;  2OPR B;  2HFU A;  2IVF B;  2IDL A;  3VGV A;  2O5D A;  4Q5V A;  3GV8 B;  1Q1K A;  1X5S A;  1FER A;  2L9W A;  1HBN B;  4DR3 J;  3KNA A;  4URQ U;  3QIP B;  1YJN S;  1NJZ A;  1HI8 A;  3FCV A;  3VAI A;  4ZMM A;  2QX0 A;  1NSK L;  5KT4 A;  2CPE A;  5EUH A;  1E6V B;  1AW0 A;  2ALZ A;  2DNP A;  4V19 X;  4WF9 Q;  1W25 A;  4KHM A;  4TYB A;  3CWJ A;  2B7C B;  5D3G A;  3MPY A;  1XMQ J;  2XMV A;  4UOG A;  4EUV A;  3R5D A;  2FLL A;  3HO1 A;  4LF6 J;  3KLV A;  2OEL A;  2YNG B;  3K5P A;  2AEM A;  1NU4 A;  2DNO A;  3Q86 A;  2VG6 B;  5HAT A;  2AJ0 A;  3IGN A;  4Q2L A;  4L73 A;  3RTV A;  1U1P A;  2J8A A;  1OS5 A;  1Q4R A;  3J7A 1;  4WTY A;  3CJQ A;  1SVD A;  3MUV P;  2UUA F;  2J0S D;  2WSE C;  2BAN A;  4JI6 F;  4AQY F;  5CD4 A;  3SMZ A;  1TKD A;  2BXJ A;  2GV1 A;  4F7V A;  4JI4 F;  4RNM A;  2RSQ A;  4LR7 A;  3OL8 A;  2OH2 A;  4FYY B;  4W90 B;  1VI7 A;  2R8H A;  2P9E A;  2ZKU A;  5A2Q U;  3VR1 A;  1UFW A;  1D9A A;  3AQO A;  5H9F J;  2ZE2 B;  2AJ2 A;  2YNF B;  7FD1 A;  1YJ9 S;  4P7V A;  2V8H A;  5K9F A;  2KRR A;  1BXN A;  1D3W A;  4RR5 A;  2XY7 A;  5KFU A;  2V6A A;  4B3M F;  1J5O A;  2R7S A;  4DR5 F;  1TK8 A;  1WEZ A;  1HNX J;  4L75 A;  1FKA F;  4DWI A;  1JLQ B;  2RKI A;  2NSC A;  2BJ1 A;  4KKO B;  2ZJQ Q;  2MY7 A;  1TP7 A;  3DHW C;  4PPZ A;  3L95 X;  3R2D J;  1Q5V A;  1O8B A;  4LFC J;  4F3Q A;  2V8V A;  2VFU A;  2GAH C;  4IH6 A;  2IAJ A;  4ZJO A;  2CQH A;  1NEE A;  5I3U B;  3CUN A;  3NP5 A;  1ZA2 B;  4WII A;  4B9M A;  2BOA A;  4WXO A;  3LP2 B;  5HQL A;  4OZ5 A;  1FNX H;  5DJB A;  3OHB A;  2OO4 A;  4WTO B;  3JTN A;  1JKH B;  3W60 A;  4K4U A;  2AP6 A;  3UN3 A;  5C7P A;  4CLT A;  2V8D A;  3DLE B;  3SSQ A;  2DO4 A;  4IDK A;  1U48 A;  4ZP7 A;  2HG4 A;  1RQ0 A;  2ZH8 A;  1DTQ B;  1S6P A;  1NK0 A;  2E7X A;  4QW9 A;  4F0M A;  1RAH B;  2FUG 9;  2QYC A;  9ATC B;  1VRT A;  2OP5 A;  4NYZ A;  1N33 J;  4M5J A;  3MMC A;  1ZPV A;  1KVI A;  2G9O A;  3PY8 A;  2YPZ A;  1FCA A;  3IWX A;  3MF5 A;  1QTM A;  2CPJ A;  3DC2 A;  2YH1 A;  1VQM S;  1RK8 A;  4CNZ A;  2EFN A;  3ZZT A;  1K9M T;  5KFW A;  4YN3 B;  1IVZ A;  2DD8 S;  2HHW A;  3KHL A;  4EU0 A;  3EXC X;  3BDE A;  3W65 A;  1T7P A;  2ILY A;  4DFJ A;  5E3Q A;  2CQ2 A;  3QYY A;  5HSP A;  1L3K A;  2GMH A;  3H20 A;  2MJN A;  1R7I A;  2JC0 A;  3NNH A;  1N0U A;  4CRJ A;  4PRF A;  4ZIW A;  5KT5 A;  2E1C A;  2C3M A;  2OTJ S;  2R9L A;  4ZJL A;  4I2Q A;  3A13 A;  4K8R A;  3AB4 B;  2V67 A;  4UQG A;  2QLB B;  3M2V B;  3CCQ S;  4NRU A;  2OMO A;  2NXU A;  1NB7 A;  2P2C B;  4CH1 A;  5KFF A;  1CQM A;  3EM1 A;  4CDI A;  4CTA B;  1XC9 A;  4LRC A;  4NCG B;  1S48 A;  2KG0 A;  1U0H A;  4JI3 J;  4HL9 A;  3EZU A;  4DPO A;  1SIZ A;  1CUL A;  2XSJ B;  3VAF A;  3HT0 A;  3CO0 P;  4F4K A;  2C28 A;  5E5N A;  2UU9 J;  4DQR A;  3ZZR A;  5L1L A;  5D78 A;  1UP1 A;  1NSP A;  4LF2 A;  4YB1 P;  2HAI A;  4ZCL A;  4C8K A;  2Y1L B;  2FIU A;  5L8R C;  1TEL A;  4JI7 F;  4EYH B;  3AOB A;  3SCL E;  2I38 A;  1VC0 A;  1REV B;  1S1U A;  4X65 J;  2YKM A;  3M6X A;  4DXL A;  1SB6 A;  3VGS A;  2M52 A;  2UUT A;  4NA2 A;  5JUM A;  3GFH A;  4NML A;  4DSF A;  1UKU A;  2D41 A;  2VA3 A;  3UDE A;  1RBO B;  3CJR A;  3LH2 S;  1Y3K A;  2B51 A;  4PXB A;  2ZH2 A;  3DLH A;  3IWN C;  4A8Q A;  5B09 A;  1VK3 A;  1GXU A;  3TVY A;  4CH7 A;  1HHT P;  2AJF E;  2OPP A;  3IO1 A;  4BCA A;  2HZA A;  2XTJ P;  1WKK A;  5LMU F;  1AXQ A;  3GYX B;  3W2W A;  4QIE A;  1WWH A;  3PZP A;  3VF0 B;  2IRX A;  1F60 B;  1PBA A;  4CLS A;  1H38 A;  5IS2 A;  4RBU A;  1IBL F;  2MKC A;  3LGM A;  2ROP A;  2OKQ A;  2HFZ A;  2RQC A;  2AZ3 A;  2YWH A;  1UWA A;  1IKV B;  3ENQ A;  4OYX A;  3LP1 A;  4OX9 F;  5LJ5 Y;  2HHP A;  3M9M B;  2ZNY A;  2VQE F;  2QC3 A;  3SI8 A;  2OHD A;  5FDL B;  3UFC X;  1JB0 C;  2EC0 A;  4K59 A;  4Q0B B;  3W9I A;  1EQ0 A;  2LXU A;  3RB6 A;  3VWS A;  3DDN A;  2KFY A;  1T3N A;  1GXT A;  3FK4 A;  3BZQ A;  3CJT A;  2UUA J;  5ADZ A;  5CQG A;  1PKU A;  4JI6 J;  4AQY J;  5L38 A;  4ECY A;  3QO9 A;  3OXF A;  1HD1 A;  4JI4 J;  3ET6 A;  3EYZ A;  3KNG A;  5E7O B;  1MMN A;  4GKJ F;  3BO3 A;  2KDO A;  3EGN A;  3EDQ B;  3OFH A;  1Q78 A;  4WFY A;  2ZWP A;  4JOU A;  2WTF A;  3CC7 S;  1R8P A;  3VZI A;  3Q8Q B;  3NCR A;  3RB3 A;  1SUQ A;  3J81 U;  2CZ4 A;  4B3M J;  3Q8U A;  3EZ5 A;  4DR5 J;  2W8K A;  4ZVQ B;  3CB4 A;  3I0R B;  4J9N A;  4Z2X A;  4DU8 A;  2E5H A;  1NLK L;  2KVQ E;  5HP1 B;  1D1U A;  4NLO A;  2P9C A;  4I56 A;  4PG7 A;  4ZP9 A;  1RHU B;  4WFA Q;  2QL5 B;  4D3H A;  2GMJ A;  5ETT A;  3QLH B;  4WFX A;  1PBU A;  3I9Z A;  1UZD A;  4LVN P;  2IRY A;  4H4O B;  2BZ2 A;  3B6B A;  1T02 A;  3I4P A;  3CME S;  1EIY B;  2ROG A;  5CXT A;  3JB9 k;  1JLF B;  4DHV A;  3MEC B;  4JBC A;  1PO6 A;  3UCG A;  4EMD A;  2MQQ A;  2KXF A;  1H2U X;  3KK2 A;  3T5J A;  3ETO A;  1ZAW A;  5IM0 A;  1YJR A;  1TV6 B;  4G1Q A;  1I1G A;  2NCK L;  3OR1 B;  4QJV A;  4DI6 A;  3N28 A;  7FDR A;  1C0U B;  2RNE A;  3SCI E;  5HN0 A;  4ALZ A;  4B17 A;  2DHA A;  4H4K C;  3HXM A;  2FJA B;  4GMK A;  5A8R A;  3OUY B;  4WPA A;  1N54 B;  1ZAV A;  2FZG B;  4NZ7 A;  4ZCM A;  2M7S A;  3C8Y A;  1UVM A;  4LF8 F;  1VJQ A;  3NNC A;  1LWF B;  4UT4 A;  3PKY A;  2MJU A;  4QYR A;  3RR7 A;  1IM6 A;  3UD4 P;  3T9N A;  1RHK B;  2DBB A;  1XMO F;  2XUL A;  2RUG A;  1SJ3 P;  2B56 A;  4OYP A;  4RW9 B;  5EHH A;  5KOW A;  2AIR B;  1CJK B;  2XQC A;  3ICL A;  1UJ6 A;  1FES A;  4U95 A;  2UUC F;  4RW8 B;  1IBM F;  5F8L A;  1OQ6 A;  4NLD A;  2GVZ B;  3M2R B;  1WF1 A;  2GGP A;  2DCU B;  3TOQ A;  1C0T B;  4ECR A;  2MKY A;  2IM0 A;  3TUP A;  2FJE B;  1LK7 A;  4ITS A;  2ZM6 F;  3KK1 B;  5A0Y B;  4Y34 A;  3QMQ A;  2DGT A;  3G8T A;  3G96 A;  4MK9 A;  5C5J A;  3AY0 A;  1M5P C;  4QU7 A;  5E33 A;  2QFJ A;  1T11 A;  4W92 B;  1H6K X;  4DBQ A;  1E6Y B;  1RAI B;  1Y7P A;  3W7B A;  1LK5 A;  3JQM A;  2B6A A;  2AYB A;  3UDL A;  2QMX A;  2JRS A;  2B0G A;  4KPC A;  2QLJ B;  2XYP B;  3PW7 A;  1FJ7 A;  2FC8 A;  2RDD A;  1FWL A;  3PHT A;  5HRO B;  2IRU A;  3DOL A;  4FXD A;  2ALY B;  2G2Y A;  4OI0 A;  4XAK A;  4JI7 J;  4I7F B;  1WF2 A;  3MCS A;  2CDQ A;  2R7Q A;  3DLJ A;  4PUO B;  5KFI A;  3HM9 A;  1R6V A;  5AXN A;  4I6Y A;  3ULH A;  1XR6 A;  2JVR A;  3E01 B;  3MM6 B;  4MYU A;  2FJW A;  4IKA A;  3CED A;  2C42 A;  3P3D A;  4OYO A;  1G3O A;  4KH1 B;  2BW7 A;  1NK9 A;  4C4W A;  3SCK E;  2D3U A;  1NME B;  1U2C A;  1T03 B;  4U96 A;  1BWV A;  2HWT A;  4JI2 F;  2AGO A;  1FJE B;  1V3R A;  3H2U B;  3IRX A;  2FLP A;  3IR5 B;  2WZ1 A;  4DX6 A;  5LMU J;  1RU2 A;  3UCZ P;  1NCL A;  1S1V B;  4C2M A;  5ETP A;  1JJ2 R;  4ELT A;  4X4R A;  3H40 A;  2DHX A;  3H4B A;  4ECQ A;  1F6T A;  1X60 A;  1IBL J;  1W2I A;  3KG1 A;  3I56 S;  1KQG B;  2CKW A;  4DF8 A;  3GQC A;  2DYA A;  2L41 A;  3P5T L;  3ENA A;  2X1F A;  4OX9 J;  1RTJ B;  3I5B A;  2VQE J;  1CPZ A;  4PWU A;  4WE1 A;  1NPR A;  4NYO A;  4J9S A;  3DLG A;  4HTI A;  2E5G A;  2IBK A;  4UF4 A;  5J2N B;  4KGK A;  3H5U A;  1OY6 A;  2MMY A;  4QIG A;  2FJD B;  1PJ5 A;  3C19 A;  3ZXW A;  3MR6 A;  1RBL A;  5D4L A;  4ECU A;  3IWL A;  2UVW A;  2C3Y A;  4U7U D;  3BN4 A;  2FHM A;  1FX2 A;  3PKM A;  5IXU A;  4GKJ J;  4EO8 A;  2BRK A;  2Z0G A;  3RAX A;  2CQI A;  3M8Z A;  4OX8 A;  1R43 A;  3PTW A;  3AAW B;  1Y0H A;  3BJY A;  3DKD A;  3K58 A;  2J9D A;  4G1I A;  2C2E A;  4DCO B;  4J9V A;  5C42 A;  3GR0 A;  3M32 B;  4O3O A;  3KUE A;  5HMW A;  4N76 A;  4X64 F;  4C9D A;  3KMQ A;  2GO8 A;  5F3Z A;  4DFM A;  3VV2 B;  2FTR A;  2FQQ B;  2Q6B A;  3LTO A;  3C3L A;  1M5H A;  5CHC B;  4P73 A;  3SZ2 A;  3MR5 A;  2B9W A;  1N5Q A;  2U2F A;  3I4H X;  1S7H A;  3NS5 A;  2CPX A;  2XMT A;  4HHH A;  3LAM A;  4EEY A;  2LQ9 A;  2AZ1 A;  2X1A A;  1R89 A;  5ETO A;  1CJT A;  2L48 A;  3KHG A;  4QCL A;  4IR9 A;  1SJR A;  3M6V A;  2C2N A;  3OT9 A;  2LEP A;  1R8B A;  2DRD A;  5DGB A;  2CJX B;  2VG5 A;  2DH8 A;  3CJ8 A;  2FZC B;  4EGL A;  1J5E F;  4J9P A;  2Y1I A;  2Q43 A;  4U6P A;  3KUH A;  4NLW A;  5KFO A;  3HVR A;  1FHT A;  3DYA B;  4QW8 A;  1OYD A;  5DG8 A;  1TMM A;  2E1R A;  3NRB A;  2ACM A;  4U7C A;  3PDN A;  1V9O A;  2W9C A;  2DNM A;  2D7S A;  1T94 A;  2I5J B;  4BBY A;  2KJW A;  5KT7 A;  1UCN A;  2KZZ A;  5CA5 A;  2V69 A;  3J80 U;  3MEG B;  2EKN A;  3IG1 B;  1CJU A;  1Y4Z B;  2J5A A;  2YX7 A;  4LF8 J;  5GME A;  4K4T A;  4C7Q A;  5EN1 A;  1UEK A;  1HWI A;  3DOK A;  2J7W A;  1NZA A;  1XMO J;  4PQU B;  4XO0 A;  1UL3 A;  2LU1 A;  5A2Q Y;  2MQP A;  2WON B;  1ZS6 A;  3VHQ A;  3K8V A;  3TUI C;  4B02 A;  1R8H A;  3O8W A;  2UUC J;  2D9O A;  1IBM J;  2IA6 A;  3MAQ A;  4JP8 A;  1HNV B;  3RUB L;  1FRK A;  1Q79 A;  4M5K A;  4DX7 A;  2OI2 A;  1CVJ A;  2AX0 A;  2FZK B;  1DFD A;  1RT6 B;  1VQ5 S;  2HWI A;  1YSJ A;  2AF6 A;  3G87 A;  1VIX A;  2VKZ G;  3K57 A;  3QGH A;  1AT1 B;  2HND A;  1TVR B;  2ZKT A;  1FA0 A;  3HFV A;  2ZM6 J;  4ZVO B;  2E29 A;  1UWB B;  4DPW A;  1JQG A;  4K50 A;  2VBW A;  4ZPA A;  4UST A;  4DLE A;  2EK1 A;  4X4O A;  1TKX A;  5CYJ A;  3SV4 A;  2CDR B;  4PYA A;  2O3D A;  2VDH A;  4WP8 A;  2MZR A;  1LWE A;  3O5T B;  4OI6 A;  3KJV B;  2QG9 B;  3DU6 A;  3U1M A;  1RTD B;  4TVA B;  4IQX A;  3T1A A;  4DV5 F;  3BQ2 A;  1T9Y A;  2DPJ A;  3V4M A;  3FCW A;  2R7O A;  3WC0 A;  3KG4 A;  2E7V A;  1RWV B;  3FBB A;  1U02 A;  3D3B J;  4QPX A;  4V19 J;  2OPQ B;  3W63 A;  2WVD A;  1XBW A;  3G82 B;  1PYT A;  2MGZ B;  2G0J A;  1ELO A;  2UVV A;  3KLI B;  3JTO A;  4PCQ A;  1CG2 A;  2W2Q P;  1KTQ A;  1M1H A;  2FYX A;  3CJ0 A;  2X51 A;  3PW4 A;  4UTG A;  2MB0 B;  1ITP A;  3QGI A;  5B0C A;  4JI2 J;  5HMX A;  4UOC A;  4DQI A;  3FRY A;  2ACY A;  2HGL A;  3U1N A;  4PWD B;  3M6W A;  3FFI A;  4I67 A;  2DIS A;  1CJV B;  2DKO B;  5JVH Q;  2CJK A;  1IKW A;  3LP0 B;  3H5S A;  2XYG B;  1IKY A;  4QIV A;  4OHZ A;  2NR0 A;  2VD3 A;  3BGL A;  1O51 A;  4PWW A;  1I3O B;  1FO1 A;  1RWM B;  3KXD A;  5ETL A;  2OSQ A;  2OD6 A;  5LL6 d;  4ZDN A;  3MUT P;  2V4J A;  4Z7Y A;  2EVZ A;  1LKZ A;  2KKH A;  3PW2 A;  4J9M A;  1NJW A;  1SL1 A;  1C4C A;  4M5D A;  5IOL A;  1HLW A;  3GIJ A;  2YH0 A;  1N6Q B;  2CIM A;  1QD1 A;  1S0N A;  1RTI A;  3JXO A;  4WIQ A;  2RIL A;  1DBD A;  3KFW X;  1AZS B;  4ELU A;  4DMZ A;  2V9K A;  3DLL Q;  3C16 A;  3GLJ A;  4C11 B;  1KLM B;  4K4Y A;  3UWT A;  3LPE A;  5DZ7 A;  4LRA A;  2R7U A;  4B9T A;  1DQ9 A;  3RW6 A;  2XMW A;  1KP6 A;  3PIO Q;  3PJ9 A;  3OTD A;  1CS4 A;  2F8M A;  1QE1 B;  2W7A A;  1OMS A;  3PFE A;  1WG1 A;  1BE4 A;  4YDX A;  4WWS A;  5D77 A;  1OSC A;  1SKW A;  3MEE B;  3IFE A;  4X64 J;  3GYG A;  3CD0 A;  2XHC A;  5KFN A;  3CCT A;  4I69 A;  4OHX A;  4Y2I A;  1PJ6 A;  4P7T A;  3OL7 A;  5BYQ A;  1RT7 B;  3J7A N;  2XMA A;  4Q8F A;  2RS8 A;  3IGV A;  4H4M A;  3V81 B;  3OBI A;  3OW2 R;  2DB1 A;  3W62 A;  4WCE Q;  4CM0 A;  3LA0 A;  4JI0 F;  1N52 B;  2EKY A;  1RGV A;  2VB6 A;  4F4X A;  1AFJ A;  2E5I A;  5KFK A;  4O3Q A;  2BYC A;  1NRK A;  1J5E J;  2PI4 A;  2LQJ A;  5DM6 Q;  2XSF A;  1OYE A;  5J1E B;  4RW7 B;  1XN9 A;  5SUH A;  2ZBI A;  2UXC F;  4M5N A;  3DU5 A;  3MD1 A;  4M5M A;  5A6W A;  1IQZ A;  1KOH A;  1WC4 A;  4OI2 A;  3B8H A;  2DGV A;  4K7Q A;  2V5H G;  2K1R B;  1VMB A;  1KWM A;  3QPI A;  1VC6 A;  4NLY A;  1U49 A;  2DR6 A;  1HBO A;  2XMK A;  2KT2 A;  1P1L A;  3NGU A;  2C2D A;  1S6O A;  2C2O B;  1F5B A;  4UY8 T;  5KAK A;  2BAB A;  1Y3J A;  1OPI A;  2HNY B;  1TZ0 A;  3HP6 A;  1JLA A;  3TUJ C;  2HUR A;  4K5S A;  3QGP A;  4J90 A;  3MMA A;  2QV6 A;  3M8Y A;  3V5R A;  2DHH A;  2KRB A;  2CPI A;  3NOG A;  3DMJ B;  2QGF B;  2HGN A;  4Z37 A;  1SJF A;  3FZB A;  3HPO A;  4MJK A;  1NAQ A;  2KYX A;  3NBP A;  3RW7 A;  1WJ9 A;  4WK3 A;  1P8G A;  1X4G A;  2C2M B;  3T1H F;  2PSZ A;  3IBF B;  1V3Z A;  2R8G A;  3P8B B;  5IZH A;  1U45 A;  2WVE A;  4G65 A;  2G2O A;  2H54 B;  2HYI B;  3C46 A;  1QSY A;  4ID8 A;  2ZNZ A;  3KDN A;  4DV2 F;  4PG6 A;  3DLK B;  1HBU B;  2IM2 A;  1TKT A;  2PFD A;  2A0F B;  3KLF A;  2WW8 A;  4DCP B;  2Z2Y B;  1Q86 T;  2WSF C;  3G86 A;  2X3D A;  4EZ9 A;  2A2D A;  2ASJ A;  2ZD1 A;  4OZL A;  3DN9 A;  4DV3 F;  3OL9 A;  1ZTT A;  3MM7 A;  2UXB F;  4LSN B;  3NOC A;  3TZY A;  2ZOM A;  5K8P A;  4ZVH A;  4LRB A;  5J1N A;  1LFP A;  1ZM2 A;  2Z57 B;  2GJ2 A;  1GT8 A;  2M2B A;  5D4O A;  3BRE A;  4DV5 J;  5E3A A;  1N5T A;  3UDV A;  4HI2 A;  3M1V B;  4NLV A;  3BGO P;  3QGG A;  4ZPB A;  3D0I E;  4A8X A;  1FXD A;  1M5O C;  3LAK A;  1WHY A;  1U25 A;  3PIP Q;  1TKZ A;  4TLQ A;  3ZO7 A;  1YIJ S;  1TL3 B;  2HNZ B;  1YRT A;  4YME A;  2BV3 A;  3HJF A;  3F0N A;  1WEY A;  1YBT A;  5CYM A;  1IJE B;  2W4C A;  3R5A A;  2F8E X;  3PAC A;  3M8Q B;  2N7Y A;  4IRC A;  1LWC A;  2B8P A;  4I6A A;  4P2M A;  5JMN A;  1PCA A;  1VQK S;  1EET B;  4NWB A;  4MT1 A;  2MZJ A;  1V6H A;  2KVI A;  4ECT A;  1LW0 B;  3PXG a;  5IFM A;  5D0E A;  3B82 A;  4HYK A;  4MH8 A;  3T5H A;  1HI1 A;  2HK2 A;  1ZAX A;  3PYD A;  2XNQ A;  1FJC A;  4DF4 A;  3W9H A;  4ZHR B;  3H8Y A;  1VRQ C;  2B9X A;  1ZZN A;  4NCB A;  3VAH A;  5HJY A;  4FYV B;  1UZH A;  1JNR B;  4MFB A;  5KG3 A;  3WZ0 A;  2DR5 A;  3RZA A;  3S01 A;  3GJR B;  3ZZZ A;  3CCL S;  1NND A;  1VK8 A;  3UPF A;  1HBN A;  4E2F B;  3E8O A;  5IV4 A;  2XGQ A;  2UVR A;  2A10 A;  5KT3 A;  4RU9 A;  3GV5 B;  3MED B;  2F65 A;  2R2T A;  3GCW P;  1WC5 A;  3KLG B;  2PO4 A;  2NPF A;  1KFS A;  2OFG X;  3TX0 A;  1PAE X;  2IBO A;  3PR4 A;  2XLK A;  3H0P A;  3CCV S;  4KT0 C;  1U1N A;  2YY3 A;  3LAL A;  3AJ1 A;  2VOO A;  4GVB A;  2HFO A;  2WCX A;  4CLW A;  4F4A A;  1NKB A;  2AWZ A;  2MZT A;  1H98 A;  2RUS A;  4PG5 A;  1N5Y B;  2MLX A;  2F4V F;  4HH1 A;  5DZ6 A;  3J7Z T;  5LMN F;  3HSD A;  4KJI A;  1XMB A;  2DEJ A;  2VG6 A;  1B7Y B;  3R6G B;  5HJX A;  3T6B A;  5F0W A;  2VJU A;  1IR2 A;  1RAC B;  3RRG A;  2GIQ A;  2IMW P;  2VON A;  3MM5 A;  1S1T B;  2XS2 A;  5F3T A;  4OZ1 A;  2XWY A;  2FC9 A;  5HBM B;  1QAX A;  3AD8 C;  4IG3 A;  1AA1 B;  3EGV A;  4YR0 A;  4OYZ A;  2XEX A;  4NI2 B;  3D9B A;  1V5I B;  2ZE2 A;  2YNF A;  1S9G B;  4OLO A;  4JI0 J;  2HQ3 A;  3ENV A;  3EWG A;  2AJ4 A;  3R27 A;  4WKY A;  1MWZ A;  4B9V A;  4UW2 A;  3AQP A;  3QSI A;  3O2I A;  2KJV A;  3OFF A;  1Q82 T;  4AT1 B;  4DQS A;  4KKO A;  4R8U B;  2VFV A;  2HHH F;  3OFE A;  3VQS A;  3PW0 A;  1X4F A;  2Y1J A;  2FHK A;  2UXC J;  2OSR A;  5HVH A;  1KLN A;  1R0C B;  2BMB A;  2HQG A;  5I3U A;  1GFW B;  1ZH5 A;  1FD2 A;  2F9J A;  3KK3 B;  4LF7 F;  4OQJ A;  1JLC A;  2VV5 A;  1XIQ A;  4N7T A;  4UOH A;  4TU8 A;  4F04 B;  4TXS A;  4UQT A;  4DS4 A;  4IH5 A;  3DLE A;  1F2H A;  5DDQ C;  1YJ7 A;  3AB2 B;  4IO9 Q;  3RAQ A;  1DTQ A;  3VVU A;  2HFV A;  4RWW A;  4BWM A;  2QSF A;  4ZPW R;  2V9W A;  2HQI A;  2R2U A;  3T1H J;  1RCX B;  3GJQ B;  3MMB B;  1NBE B;  2JEG A;  2VC0 A;  4RBT A;  4M5G A;  2DGO A;  3D1Q A;  4C8Z A;  2HMI A;  1P6T A;  3DGP B;  5AXK A;  5KFZ A;  4LF1 A;  3A12 A;  4DV2 J;  2B5J B;  4PG8 A;  2JL9 A;  1FRL A;  5T7L B;  3FSY A;  2ZDP A;  2AYM A;  3H5Y A;  2FHJ A;  4TQR A;  1YK9 A;  1D8Y A;  4FBT A;  4JUZ A;  2NXN A;  3D28 A;  2ZUA A;  1S9E B;  4CM2 A;  2ASY A;  1TUW A;  2UXB J;  2MPU A;  3AOC A;  3I0S B;  2NXC A;  3RB0 A;  2BAN B;  3I5C A;  3ZZU A;  3FNN A;  4A8S A;  5KFP A;  4UUX A;  2J0X A;  5KFL A;  3IMQ J;  3KLH B;  4HVZ A;  3N5F A;  3FSX A;  2FDN A;  4OJH A;  5D4P A;  2K2P A;  2WW4 A;  3K0J A;  2HQC A;  2N82 B;  2GQ2 A;  2BKP A;  1Q16 B;  1VQO S;  3O6Q A;  2ZVS A;  2CA9 A;  1L3V A;  4RU2 A;  3RG6 A;  5H9E J;  1SL0 A;  2A6O A;  3J80 Y;  1WOS A;  1YX2 A;  2PMH A;  3Q8Y A;  1GX5 A;  4CTA A;  3GV7 B;  1OWX A;  4X2B A;  1J5O B;  4NCG A;  2J76 E;  4WU3 A;  3W66 A;  2ZH3 A;  1HW9 A;  1LEO A;  3OHA A;  2XSJ A;  3FUY A;  4ZPC A;  2HLU A;  4LFA F;  5H9F K;  2E1M C;  4ZKA A;  2ZIT A;  2X1B A;  4PXC A;  2PMZ D;  1KFD A;  1UFL A;  1CLF A;  1Y5I B;  4KB7 A;  4RW4 B;  4YOE A;  3BYP A;  5DDR C;  4DV0 F;  2JEI A;  1MWQ A;  3KYL A;  3A8I A;  1IWA A;  1MSW D;  1HQ2 A;  1UJ4 A;  1HIY A;  4HDH A;  5J2P B;  6AT1 B;  3HHL B;  2DHG A;  3WBZ A;  2HSE B;  2ZWO A;  1YJT A;  5I42 B;  4KR0 B;  2JFD A;  2DTJ A;  4WU2 A;  1WD6 A;  3MAA B;  2G2Z A;  1FDD A;  4OL8 A;  4LBI A;  2UXD F;  1N5S A;  3A4T A;  1H73 A;  1U1L A;  5K5M A;  1KVK A;  2D9P A;  2GAG C;  5F8N A;  3W3S A;  1B0V A;  1Q8K A;  2GQC A;  2DXE A;  1VRT B;  2J9D E;  3GFX A;  3N6M A;  3R7B B;  1RAO A;  3ETM A;  1RU1 A;  4NLU A;  2V0N A;  2HVI A;  3CNQ P;  3SFG A;  2R4F A;  2Y0B B;  4AFF A;  4LSL A;  4DOZ A;  2DVI A;  1U2F A;  3SV3 A;  1F3F A;  4PZV A;  3H90 A;  2E5L F;  1EJ7 L;  2FB0 A;  1MN9 A;  2VFT A;  3FBF A;  5FDL A;  5LMN J;  1ZBT A;  2LEB A;  1FNO A;  2DNN A;  4F0H A;  4Q0B A;  1MU2 B;  5J2Q B;  3BKF A;  1Q8I A;  4ZPD A;  2FLN A;  3BQ0 A;  2RB7 A;  2V8G A;  5IV3 A;  2G0I A;  3EE3 A;  3CCR S;  3ILL A;  4C98 A;  1ZA1 B;  4KRW A;  1I94 F;  3DRR B;  4ETZ A;  4IOC Q;  5ETM A;  3H7H B;  1VRU A;  2RJZ A;  3S6E A;  2QRR A;  1Q8B A;  4USK A;  1EP4 B;  2CAD A;  4MKV A;  5F0U A;  4DSJ A;  2HVD A;  1CUL B;  2I2Y A;  2WB1 D;  4MMO A;  4K4V A;  5KG4 A;  3MPW A;  4C0H A;  4V1A k;  1EAY C;  4BC9 A;  1FWP A;  3PRD A;  5KFV A;  3NGK A;  3TA2 A;  5HP1 A;  2HHH J;  2B9E A;  1LFW A;  5KG0 A;  2ABY A;  1WC3 A;  5FLX Y;  3N79 A;  1QJH A;  1XWL A;  2EFO A;  3MI7 X;  1IUJ A;  2RQK A;  2HHU A;  2H48 B;  1IWG A;  1MW7 A;  5DET A;  2FY8 A;  2OFH X;  5AE3 A;  1KS2 A;  4A47 A;  4H4O A;  5KTQ A;  1GMW A;  1C2P A;  3HT3 A;  3PEJ A;  4LF7 J;  2ZH1 A;  2AKW B;  4X84 A;  4AL5 A;  2XBP A;  3R8Y A;  2HEK A;  2AYE A;  2DK2 A;  5HQ8 A;  1JLF A;  2WVF A;  4L76 A;  5M2P A;  3THV A;  3HKW A;  1LW2 A;  2VF3 A;  4LBP A;  2XNR A;  1WHX A;  1KVJ A;  1WG4 A;  2OPP B;  3IR6 B;  1Y00 A;  4EFA C;  4B3R J;  1FVS A;  1X9S A;  3OR1 A;  1TFY A;  3K2Y A;  2DNL A;  2EFV A;  1JLB B;  4ZOS A;  4JB8 B;  2CNO B;  3POT B;  4DR1 F;  2W7O A;  3ZTR A;  3OUY A;  2MYF A;  3NLC A;  1T8E A;  4ANE A;  3FRZ A;  1LWF A;  3LP1 B;  3MR2 A;  5L9N A;  1Q95 G;  4DPU A;  2F4F A;  2BEF A;  3WIU A;  1VR6 A;  4DFP A;  4ZIT A;  2H65 B;  4RW9 A;  1YTY A;  3PCO B;  2QZ8 A;  1MWY A;  5GMK a;  3G6V A;  3PG9 A;  2DNQ A;  2G4B A;  5D0H A;  4Q8E A;  3H98 A;  2YNH A;  4JV2 A;  2GVZ A;  1HNW J;  3M2R A;  2EI5 A;  2W1B A;  1SH3 A;  5B0B A;  2HS0 A;  1MMD A;  2P9G A;  3C6T B;  2RVJ A;  1C0T A;  2E66 A;  1GMU A;  3CSK A;  1U2R A;  2FHJ D;  1D8Z A;  2IM3 A;  2HRT A;  4L3N A;  2V34 A;  2M9K A;  5A0Y A;  3C15 B;  1CBK A;  1T9X A;  4JV5 J;  4P72 A;  1B4S A;  2MEW A;  1X4D A;  1JXL A;  3SDE A;  2B7B B;  2VOD A;  2QA1 A;  4ZVS B;  1SUQ B;  4OYI A;  3D54 A;  1S97 A;  2GQQ A;  4DV4 F;  4Y2A A;  5IC4 B;  4OYB A;  4IRD A;  3J7Y U;  1FKO B;  4DZD A;  1G7C B;  4LFA J;  4NX9 A;  1FVQ A;  4K4Z A;  3VAL A;  3LO3 A;  2VDI A;  1BQX A;  4WYL A;  2MQ8 A;  4ED1 A;  3CJ3 A;  5KFR A;  4W4M A;  1VHI A;  3QJP A;  3IXQ A;  4DV0 J;  3BDP A;  4I7F A;  3W1Y C;  1DAR A;  1TQL A;  3PRV A;  3A3P B;  2FVC A;  3JYT B;  3FMW A;  1TL1 B;  1FI4 A;  3DHX A;  3CE8 A;  4PYD A;  1LXJ A;  5A6P A;  3BN7 A;  1QLN A;  3E01 A;  4A8O A;  4C8Y A;  3SSS A;  4U67 Q;  4KTQ A;  5IM0 B;  4H54 A;  4DLG A;  1QAJ A;  2N4C A;  1T03 A;  2UXD J;  2BE2 B;  2DR7 A;  2D1C A;  2KZM A;  3MM8 B;  4LRF A;  3LAN A;  4I0W A;  2XO6 A;  1S1V A;  2KI2 A;  1FD8 A;  1GEH A;  1YDL A;  4ANC A;  2V50 A;  2Y9H A;  2W2M P;  3P96 A;  4CO3 A;  4ZPT R;  3HMJ G;  2HBZ B;  1XTZ A;  2R42 A;  1SJQ A;  1NKC A;  5E3P A;  5B0G A;  1R27 B;  1BWE A;  4LRE A;  3OVS A;  4IQM A;  2KTQ A;  2J6U A;  3HKZ D;  1M90 T;  2E5L J;  2D3O R;  1WG5 A;  3N01 A;  5LSO A;  1RTJ A;  2XZT B;  1U1K A;  4DL0 C;  5EX0 A;  3HD1 A;  2NZC A;  2V4Q A;  3NGT A;  4KO0 A;  1XNR F;  1WDT A;  4IFY A;  3KOA A;  5J2N A;  1ZM3 A;  4HHU A;  3CW2 C;  3QWP A;  2UUB F;  4NL5 A;  4BDP A;  4Y2M A;  2CQ1 A;  5KFC A;  3NCP A;  4LT6 A;  3EJM A;  3PV8 A;  2V4R A;  2CQP A;  1T9T A;  3R5G A;  1V3S A;  2VG7 A;  1RAF B;  3THP A;  1I94 J;  1EZZ B;  1U0S A;  3WX8 A;  2FHO B;  4ED8 A;  2B6A B;  2BR0 A;  3SQG B;  4OZ3 A;  1EAR A;  4QWD A;  1BQN A;  3QFH A;  1HNI B;  3M32 A;  4CIO A;  3D3C J;  2BKO A;  3HFK A;  3H5X A;  2L08 A;  2ZH4 A;  3NS7 B;  2XG8 A;  2QFI A;  1BY9 A;  1OQ3 A;  3DOL B;  4ED7 A;  4F4W A;  4C0B A;  2F7V A;  2V2Z A;  2B3T B;  2YWE A;  2QLF B;  1S10 A;  4ZA1 A;  4RNF A;  2C3P A;  1PC4 A;  2YX4 A;  2F63 A;  2R8I A;  4HEA 9;  4USW A;  1M5V C;  5A8W A;  2CFX A;  4NAS A;  5F8M A;  4RZR A;  3CJ4 A;  3FZ2 A;  1VBZ A;  4NLX A;  1FJG F;  5M2R A;  1RLC L;  1WEX A;  1S1X A;  4CLP A;  2O66 A;  1R6Y A;  1SKS A;  4DG1 B;  1FXR A;  1KDN A;  2C3U A;  1UW9 A;  2DEI A;  4ICL A;  3NGD A;  3TAQ A;  4USV A;  2K8G A;  3CXC R;  3DYA A;  4M5H A;  2FD2 A;  3PO5 A;  1VQ4 S;  4RW6 B;  1S4E A;  3GFY A;  5IT9 U;  1P27 B;  5F8G A;  2IVY A;  1U09 A;  1GMW D;  4LSZ B;  1SC3 B;  3FBE A;  2I8E A;  3ZTS A;  2I5J A;  4FN5 A;  2RF2 B;  4DR1 J;  5KFQ A;  1IM4 A;  3JSR A;  2K3I A;  3MEG A;  3Q0A A;  4ID5 B;  2QT7 A;  3IG1 A;  1IJF B;  1VYA A;  2XY6 A;  3QT5 A;  1ZM9 A;  1KRP A;  4RNH A;  4ES1 A;  2XI3 A;  2DR9 A;  1IKX B;  2HIQ A;  4NLG A;  1CEZ A;  5F9N A;  2VHG A;  2CRL A;  2AGQ A;  4PQU A;  2JC1 A;  5DLG A;  4DJB A;  5C24 A;  4WE1 B;  3GP9 A;  1ZOT A;  2HWH A;  1SV5 B;  2WON A;  3OJS A;  1RT5 A;  2OLW A;  1RT3 B;  3FEX B;  2MKI A;  3UD5 A;  1HQE A;  3CIM A;  4X4U A;  1NO8 A;  1HNV A;  3D2W A;  3CJK B;  4FP9 A;  3GIR A;  1K0T A;  3PEH A;  2KN4 A;  1RT6 A;  3M6U A;  4B9L A;  4LBH A;  2MQN A;  3GR1 A;  1TVR A;  1BQM A;  2GML A;  2QTW A;  4TN2 A;  1BUX A;  2ROE A;  1YLX A;  1UWB A;  3EUN A;  2LDI A;  4TLR A;  2YXL A;  2HFS A;  2ZVI A;  3L7P A;  4OYW A;  4CH0 S;  1X9W A;  1S0V A;  3HSG A;  4DUZ F;  4QZV B;  3CCU S;  4OJG A;  1F5A A;  1RI7 A;  2BUN A;  4NA1 A;  4QR2 A;  3F44 A;  3CCJ S;  4YB6 A;  2HS4 A;  5K8M A;  3BBF A;  4ER8 A;  2RU3 A;  4PKD B;  2JDJ A;  4DV4 J;  3J7Y I;  3QRP A;  1RTD A;  4RBV A;  4ZVP B;  1HHQ A;  3MFH A;  4UY8 5;  1HHS A;  4ZVR B;  2PC6 A;  3VCD A;  1HI0 P;  1PC5 A;  2YVS A;  3Q83 A;  1K47 A;  5KFS A;  2Y1R I;  1WI6 A;  2BJ3 A;  4AL6 A;  1N4L A;  4Y28 C;  2OPQ A;  2EK6 A;  2ZDO A;  3MM9 B;  4FXW A;  1ZZF A;  3KLI A;  4O0I A;  3WDO A;  1N5V A;  2NLW A;  2LQ8 A;  4ZCI A;  3TAM A;  2VG5 B;  1RWX B;  3SQO P;  1S1W B;  2YNI B;  2D3O 1;  3SFU A;  1JLE B;  3E2E A;  3GIK A;  4DUT A;  1BMQ B;  5K8N A;  3GWC A;  2VIC A;  2J9E A;  3B78 A;  3CCS S;  4ZJQ A;  2IC3 A;  2W2O P;  1HBM B;  4AND A;  3T5L A;  3W8G A;  2MKJ A;  3NNA A;  4TKT A;  1Q7Y T;  1RE1 B;  1OO0 B;  4CO1 A;  2AT1 B;  4LF5 F;  2NS1 B;  4TY8 B;  2W9A A;  2ZBP A;  4K0K F;  1CJV A;  2ZJR Q;  4U8V A;  4DX5 A;  3GU0 A;  1D9F A;  1S49 A;  3LP0 A;  4YB7 A;  3X3U A;  3TAR A;  3AJD A;  2ZUG A;  4E0D A;  3DOK B;  2VQF J;  2B9Y A;  1KNZ A;  1O6X A;  3V6D B;  2V2Q A;  3BH7 B;  2DY1 A;  3R1H A;  2N4D A;  3P6Y C;  5IQQ A;  5K14 A;  3M2U A;  3EVW A;  5KOX A;  2E7W A;  4JV0 A;  3K59 A;  3CCM S;  2CUY A;  1N36 F;  1XNR J;  2Z56 B;  9RUB A;  3SIP B;  5THW A;  4EYI B;  1N6Q A;  5RUB A;  4L72 B;  2MLY A;  1X9M A;  2B4O A;  6FDR A;  2UUB J;  3JSM A;  2HND B;  2JHE A;  3JSY A;  2Z4P A;  3QFW A;  3TEG A;  2HRY A;  4C11 A;  4UUW A;  2MTL A;  4OI4 A;  2J7K A;  3R7S B;  2VL1 A;  4I2P A;  3MOZ A;  2YKA A;  2OPS B; 
#chains in the Genus database with same CATH homology
 3C14 B;  1U0H A;  1FX2 A;  1WC3 A;  4CLS A;  1CUL A;  4CLF A;  1CJV A;  5IV4 A;  2WZ1 A;  4USU A;  1TL7 B;  4CM0 A;  3ET6 B;  1AZS B;  4WPA A;  1WC5 A;  3C15 A;  3C16 A;  5D0H A;  1CJT B;  3G82 A;  4OYX A;  4OYZ A;  4WP3 A;  4NI2 B;  2GVZ A;  4UST A;  5IV3 A;  3C14 A;  3MAA B;  4USW A;  5D15 A;  4CLK A;  1U0H B;  1YBT A;  1CS4 A;  1WC6 A;  4OYP A;  4WP8 A;  1CJV B;  1CJU A;  4OYA A;  1TL7 A;  1CJK B;  4P2M A;  1AZS A;  2W01 A;  3UVJ A;  4CLT A;  4CLP A;  2GVD A;  1WC4 A;  4OZ2 A;  3C15 B;  1YBU A;  5D0R A;  3MR7 A;  4CLL A;  1AB8 A;  4CLW A;  5D0G A;  2GVZ B;  3R5G A;  4USV A;  4CLU A;  1CUL B;  4OYM A;  5D0E A;  4CLZ A;  4WP9 A;  1YK9 A;  3ET6 A;  1CS4 B;  4P2F A;  4CLY A;  4OYI A;  1WC1 A;  1FX4 A;  1CJK A;  1CJT A;  1CJU B;  4OYO A;  4OZ3 A;  4P2X A;  2BW7 A;  3C16 B;  1Y11 A;  1WC0 A;  2QV6 A;  4NI2 A;  3G82 B;  4OYB A;  3UVJ B;  4OYW A;  1Y10 A;  3MAA A;  4CM2 A;  2GVD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...