3TZXA

Crystal structure of a fragment containing the acyltransferase domain of pks13 from mycobacterium tuberculosis in tetragonal apo form at 2.3 a
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
465
structure length
465
Chain Sequence
PELPGVTEEALRLKEAALEELAAQEVTAPLVPLAVSAFLTSRKKAAAAELADWMQSPEGQASSLESIGRSLSRRNHGRSRAVVLAHDHDEAIKGLRAVAAGKQAPNVFSVDGPVTTGPVWVLAGFGAQHRKMGKSLYLRNEVFAAWIEKVDALVQDELGYSVLELILDDAQDYGIETTQVTIFAIQIALGELLRHHGAKPAAVIGQSLGEAASAYFAGGLSLRDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIREVFSDFPDLEVCVYAAPTQTVIGGPPEQVDAILARAEAEGKFARKFATKGASHTSQMDPLLGELTAELQGIKPTSPTCGIFSTVHEGRYIKPGGEPIHDVEYWKKGLRHSVYFTHGIRNAVDSGHTTFLELAPNPVALMQVALTTADAGLHDAQLIPTLARKQDEVSSMVSTMAQLYVYGHDLDIRTLFSRASGPQDYANIPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Polyketide synthase PKS13
publication title Biochemical and structural study of the atypical acyltransferase domain from the mycobacterial polyketide synthase pks13
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 179
structure length 465
sequence length 465
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3tzxA02
3.40.366.20 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 3tzxA01
4QBUA 4AMMA 2CUYA 3CJ8A 3HJVA 3SBMA 5DZ6A 2QJ3A 3G87A 3IM8A 3TZXA 3TQEA 3H0PA 2C2NA 2G1HA 3RGIA 4RR5A 3HHDA 4RL1A 2G2ZA 2H1YA 3K89A 4AMNA 1NM2A 3TZZA 3IM9A 2JFKA 3QATA 3EZOA 5DZ7A 2JFDA 3TZYA 2QC3A 2G2OA 4AMOA 3R97A 3PTWA 4AMPA 3BV8A 3R8YA 2G2YA 1MLAA 3TZWA
chains in the Genus database with same CATH superfamily
2NPFA 2UUBJ 3LF0A 4UOCA 4X65J 1BGXT 2AF6A 3M8WA 4P9SA 3U02A 1RTIA 2DNLA 5KFQA 3C16B 4ZP6A 5EX3A 2DGSA 1CJTA 4A8XA 1QSYA 4O3QA 3SXLA 5DDOC 2RB7A 4C0OC 4YUDA 4TKTA 3UE2A 1NK7A 2VC0A 4J9OA 3QLHB 2W8LA 2IYIA 2R7XA 1UCNA 1OYDA 3EWGA 2DRDA 3EDQB 2VA2A 1YJ9S 3M2RA 4NMLA 2CVEA 5GMDA 2MKKA 2E66A 2DGUA 4B3MJ 1S6OA 1S99A 4DPTA 1UKUA 4U8YA 4LIRA 3Q0AA 4NZ7A 5LT5A 2WZ1A 2EPIA 2G13A 3G82B 1TV6B 1UJ6A 2RKIB 2VG5B 1TFYA 1X5SA 1N5TA 3EYZA 2I5JA 5DZ6A 2R8JA 1FWKA 4H4OB 3D3BJ 1CS4B 3QJJA 3GCXP 3KYLA 4LREA 3BQ0A 4DWIA 1M5SA 1HPZA 1N5QA 5K20B 4RBTA 2AJ4A 4J9UE 2DGTA 2C2ZB 5HANA 5KT5A 3CTRA 2AGOA 2M52A 1RHRB 3K57A 1KR4A 3CT9A 3K5NA 4ZVQB 3CEDA 4K0KJ 3AJDA 1LWCA 4AMPA 4FF4A 3GPAA 3OLAA 5DQHA 5ETRA 5DG9A 4DS5A 1GXUA 2QV6A 2BACA 2KHDA 2QL7B 2E9RX 4AE5A 4GKJF 2DISA 3G6YA 5ETVA 2A6OA 5BR8J 2L08A 3IAS9 1REGX 5KFCA 2CG8A 1F6TA 2XYGB 1O6XA 5C42A 2J0QD 8AT1B 4MK7A 2AEJA 1R8BA 3MD3A 3TRGA 2B51A 2CNOB 5F0WA 3HVTB 4F02A 1V6HA 4MKVA 2DRAA 5CYQB 4JI3J 3QPIA 2J7KA 2DK2A 2R7UA 2D3UA 3ADAC 3W63A 2OMOA 3TUZC 3K5MA 8RUCA 4MYTA 1QVGR 3OJSA 3RBZA 2CNLB 2HNDB 1UWAA 1W2IA 2HK2A 4M5MA 1RWOB 1HBNB 2V5HG 4UQGA 3M1VA 1KEKA 3LP2A 1T05A 1YKWA 2ZM6F 2RRBA 5AXNA 4R0EA 2UXDJ 4J91A 4RUHA 1WELA 4M5LA 3SSRA 2A2CA 4F3QA 2R2SA 3RB4A 3DYAB 2QYGA 4MK8A 3UO0A 1YDLA 4EUVA 4ENOA 2P5VA 4GMKA 4I1TA 2YQ1A 4WP3A 2YPZA 2CQIA 3POTB 3L7UA 1REVA 2I6WA 5GADU 2DNHA 5CD4H 2AZ1A 2KXHA 1F60B 1HNXF 3CCLS 3OPKA 5HAOA 4QU7A 3ETOA 3QRPA 3DDIA 3NNHA 4ANCA 3VQTA 3CCRS 2H3EB 1EHWA 3CE8A 4FVCA 1BWVA 2YY3A 1U24A 2B9EA 4ECQA 3QRQA 1NHKL 1S57A 2IA0A 3ET6B 4LSLB 4PAAA 1YIJS 2ZITA 2ERRA 1C0UB 3OSPA 1T9UA 1NK4A 1FD8A 2Z56B 4HHJA 1QSSA 1RHUB 3MCMA 4LJMA 2DHHA 3B82A 2CJAA 5L39A 1HD1A 1YJ7A 5E33A 1WUUA 1KD1T 1IBMF 1FX4A 3IS9A 1NM2A 4QIEA 2VBWA 4M94A 2UV8A 2QG9B 2ZBIA 5EWEA 2OPPB 3AFGA 1WF0A 4HTIA 4J90A 1T3OA 2FC8A 4DJBA 2G4BA 1S6PA 2XLKA 2RHSB 2PMHA 2A6MA 1WC4A 3BR9A 3HULA 4H4MA 4FYDA 3CUNA 3BGRA 1LXJA 2G1HA 3H2UB 2MEWA 3DXBA 1G2EA 4DUYJ 2D3OR 1TK8A 2FLOA 4HACB 5IM0A 1EETA 1JJCB 3PG9A 4P2FA 2BZ2A 1DLOA 1S59A 2YH0A 6FDRA 3ZZPA 3IRXB 4C8MA 2WVFA 1M1GA 2QL5B 5KFSA 1SC4B 3FK4A 4PCQA 1TL1B 4USKA 1N48A 3VGTA 2J6UA 1VR6A 1SKUB 3ZTRA 1N8RT 1LWFA 1JXVA 2ZC4A 4QWDA 1CQNA 1WKKA 3MM5B 2ABYA 1Q8BA 1GNKA 2XB2D 3M30B 4LR7A 4QQBA 3J7YI 3TW0A 3H20A 4QW8A 3PFEA 1SC1B 2YKNB 3BM7A 2YH1A 3JYTA 2FVQA 4C4WA 5FJ4A 2EC2A 3KK1B 1IJFB 4F2SA 2MHEA 4LUBA 2MZRA 3N01A 3T6JA 2CPJA 1RT5B 3A8KA 2MKHA 3M7VA 1R8CA 3PYGA 1FRMA 3RRKA 3H0PA 3UDEA 3H25A 1HWLA 2P2CB 2F4VF 4LF6J 1VIOA 2XEXA 3FZ2A 3BV8A 4J7CA 4LF4J 2X3GA 2ZUAA 1ZAWA 2J8SA 3I0RB 2R42A 5DDQC 1NK0A 2UUWA 5HQ8A 4F4AA 4PWWA 2IC3B 1RSCA 2H1YA 3FCWA 2KU7A 1X4CA 1YBTA 4PPZA 3N6MA 4DSIA 3DOMB 2XWYA 1R6YA 5DRKA 4ELUA 1AFIA 4JI1J 3N6NA 4KPYA 2QEXS 1UZHA 4XDCA 1RT4B 2KJWA 2AJQA 2NS1B 2SXLA 4TU7A 4LFCJ 1XNRJ 2ZBRA 2FD2A 2E7WA 3PO4A 5HSPA 1UVJA 2E1MC 5A0YB 2KHCA 4ID8A 3ENAA 1QD1A 2HK3A 3AHPA 3MF5A 3KJQB 1LW2A 5D0RA 1JJ2R 5C2CA 1MSWD 3V6JA 3C2PA 1RQ0A 2VPZB 4IG3A 3JQMA 4C48A 3EMTA 1NRKA 2CPIA 1BWEA 1TV6A 2VG5A 2RKIA 1F9FA 3HO1A 1L3UA 4LSNA 3KDNA 1L3VA 2NXNA 4U7UD 4XK8C 3PW5A 4CLPA 2QJ3A 3NS7B 3P4UB 3HVRA 1HWIA 4DCPB 4DR7F 2GX8A 2N3OA 2E9TA 3MOJB 1U48A 1UZDA 1U02A 3M2UB 3CCSS 2ZFHA 2DGXA 4Q5VA 1NB7A 3GCWP 3MAQA 2XMWA 4U9RA 4JI7J 3CCZA 1V3RA 2GHVC 1AT1B 4HHHA 2F8MA 3DM2B 4B02A 5KFBA 4WXWA 2BJ3A 5KFMA 1D9DA 5FDLA 3PR4A 4KE5A 5CYMB 3KUHA 1WF1A 2M8HA 5ETKA 1HQEB 2PI4A 4RKUC 1S7HA 3K17A 1KHVA 2KN4A 3OQ2A 1W7WA 4USWA 1XR5A 1NH8A 4NLTA 2HHPA 2XBPA 4NX9A 1ZA2B 2BQUA 5H9FK 1V5VA 1YLXA 1PC5A 2LKZA 2X1GA 3Q8QB 1N5VA 3HVTA 5CYJA 1CJKA 3CD7A 1GX6A 2OTJS 1TKZB 4Z2XA 2VOOA 4M5DA 3IG1B 4TLRA 4BS2A 2ZH5A 1HI1A 1SJRA 2V6AA 2CPXA 2OKQA 3PX6A 3M8RA 2M8DB 5D0GA 5J2NB 2BKNA 1JXEA 1S9EB 2HNDA 4JUZA 2EBEA 1XIQA 3GSIA 4H54A 2OFHX 4QIVA 2IRXA 4DV7J 3MMJA 2ZJQQ 2VFSA 1FTCA 1Q78A 4OLOA 4O0NA 2H5JB 3A4TA 1BQMB 3VZHA 1VHFA 1QUPA 1VBXA 3NY0A 3DYAA 2M5YA 3J7ZT 1RDRA 3M8ZA 4AL7A 2NUUG 4S0MA 1J27A 4K8RA 1WC1A 3H42A 2DGQA 4TLQA 3T5JA 2PD1A 1JIHA 2ASJA 4YS2A 2Y8WA 2ROGA 2DKOB 3EXYA 3K5LA 5LL6d 4JI8F 4MTPA 4FNHA 1QDUB 1VQYA 5M2RA 4L72B 4TQSA 2GFFA 1TKTB 1G4CA 4P6QA 1FESA 4DS4A 1X4FA 4N41A 4QYZK 2UP1A 3BDPA 2BE7D 3NOCA 3W3SA 2J0XA 2DO4A 3MM8A 4DFJA 4NEYA 4W98A 2MKYA 2R8GA 5ETTA 3HJVA 4KKOB 3IAM9 3D0IE 1HR0J 3ET6A 3D6FB 5C25A 1ZTWA 4C9DA 5I42B 2E29A 3TYTA 3UI3A 3C6UB 2QA1A 3HPOA 1APSA 2ZBQA 4K59A 4RNHA 2G1DA 3DLKB 1OQ6A 1XMBA 4FN5A 1TL5A 4A46A 3R9LA 4DR6F 3W5ZA 3JSYA 5KFAA 2MQQA 5CXTA 4FZVA 1GMVA 3MPVA 1QTMA 3P96A 4OX9F 2GQ2A 3ZZTA 2FZKB 1D8YA 4P72A 4ECYA 5FLXU 4ED1A 4GKKJ 2OPPA 4I67A 3CDBA 4P7VA 4DI6A 2DB1A 1S1UB 1TKDA 4PKDB 4OYPA 2DNRA 4X4VA 1PYOB 2DH9A 1S4FA 2DNZA 3TZZA 2BUNA 3SFUA 3CDUA 3QGPA 3CJKB 4DPWA 3J7AN 2V2ZA 5I4MA 2KO1A 2KRRA 4HACA 4NPOA 3MCNA 2KH9A 3H40A 5E41A 2JNJA 1N0VC 2DIVA 4ZPBA 1RYSA 2CQHA 5HMWA 4Q2MA 4C97A 2MGZB 3IRXA 3KTQA 3W61A 2BBEA 1JLFB 2J0SD 1T9YA 1CC7A 4K4XA 4JI4F 3UVJA 3G6ES 4E0DA 5HL7Q 1JLBA 3J7Z5 1LW0A 4B9TA 2O66A 1NDLA 2IDLA 3D4JA 2DITA 3CCMS 2EXUA 3MM5A 2YNIB 1VISA 4D3HA 3THPA 4YY3F 3MEGB 2QLBB 4OYIA 3DKDA 3BO2A 3NGDA 4OYOA 4QWAA 3MCOA 3TVYA 3M2VB 2I8EA 2W9AA 4J37A 3MUVP 2GIFA 2M4MA 2WVEA 1T11A 5D0EA 3W9HA 4RL1A 1H74A 4OJ1A 2XNQA 1RT5A 4HT7A 4PQUB 2E5LF 1Q0NA 4EBDA 1M90T 1TUGB 3W8GA 2IRUA 2FGCA 1MU2A 3MPUB 2IVYA 1VRTB 2ILYA 4OZ3A 5KFJA 4FP9A 4QWBA 3SZ2A 2Q3PA 3DRPB 1DBDA 2FY1A 1FJGF 2DHAA 2IC3A 5ETSA 2HBYB 5BYQA 2B9XA 3PFOA 5IC4B 4LFAJ 3PDNA 2DT9A 5I3PA 4HHUA 1J5EJ 3CC2S 3GMGA 1NAQA 3KJFB 1WORA 4F8RA 3SFGA 4C8ZA 2K2PA 1YZ6A 4OI6A 2UUTA 3I82A 1U4BA 4B3RF 1KHWA 5AXKA 1F1BB 4CYUA 1VQ9S 2MMYA 3K0JA 1TMMA 1M5VC 1VYAA 1Y5IB 1LFWA 2EFVA 2OEMA 1OPZA 3HSZA 3QAUA 3GJRB 1D3WA 5F9LA 3A8JA 2OPSA 4TU9A 4BWJA 2Z58B 4USUA 1N36F 3PRBA 1KWMA 1JNRB 2PO4A 4KV8A 5J2PB 2RE1A 3JB9k 1F5AA 4H4KA 4V1Ak 3E01B 1VMBA 3AB2B 3ETMA 1T9XA 1X4HA 2WW8A 3FBBA 2DGOA 2F4FA 1N5YA 2OEKA 4WBFA 4FYXB 2OPRB 1RTZA 3GONA 3ZFVA 2J5AA 3KDOA 1MN7A 4L3NA 1RU1A 1UJ5A 2BOAA 5KFIA 5KFYA 3BKFA 3V6DA 3H5XA 3PRVA 1LFPA 5E3CA 5RUBA 1S5ZA 1FRLA 4EFAC 3DC2A 1I51B 2MQMA 5I3QA 2HGMA 1HL6A 2HHUA 3PW4A 3R5BA 3H4BA 1RBOB 2KG0A 3MMCB 1HMVA 1G7CB 1QVFR 1R8HA 4WF9Q 4KB7A 4ES1A 4EGLA 2XSJB 5CYMA 4DUZJ 1HQUB 1IR1A 3KMSA 2O01C 5F8IA 3MTKA 2OHDA 2YNFB 3TJAA 2QA4G 2LP4A 3TX8A 4OX8A 3OXGA 1BC6A 2B7CB 4K5RA 4KGXB 3UNGC 2UU9F 3BQ2A 2XLJA 1PYTA 1EKSA 2LQBA 1HNZF 1SL0A 2UUAJ 4ZVPB 4AXJA 3GU0A 3PX4A 4Y00A 4G3IA 5KFVA 3ZNJ1 1TKZA 3KJVA 3CPWR 1GK8A 3TNVA 2GVDA 3IR5B 3NXZA 1QUVA 4QJVA 1FDDA 4Q8FA 4WE1B 5FLXY 2VG6B 3CJ3A 2CNNB 1U49A 1NJIT 3CMQA 5J2NA 4ZIVA 5A8KA 3MR3A 3X1LB 4FYYB 1S97A 1YTYA 5KG5A 1S1TA 5KOWA 2Y8YA 1HLWA 1I94F 4FXWA 5C7PA 2BDPA 5MAOA 2VONA 3KHRA 4YR3A 4OFZA 1BQMA 4L73A 3SDEA 1Q4RA 3FEYB 3DOKB 2R3VA 1M5PC 2MQPA 1O5JA 2VICA 4B3TF 2VQEF 8ATCB 3K8WA 1S9GB 4ZOSA 3HSDA 2YNHA 4DU7A 3JSMB 1XBWA 4ZVFA 4K5SA 1U1MA 4ER8A 1F3FA 2AV5A 5FIIA 5CABA 3SCKE 5AXLA 5H9EJ 3I31A 4GVBB 2DVIA 3ILLA 2L41A 1V5IB 3V4IB 3OL9A 2QX0A 2OUGA 1X9SA 4JI6F 1TKTA 4ZPWR 4TYAA 3KG0A 4F7VA 2HHHJ 3MAHA 4HH0A 3IXQA 4QWCA 3LQVA 1AFJA 1U1KA 4O23A 3WX4A 3NG8A 4DV5F 2FJAB 1NEEA 1AYEA 1TVRA 2ACMA 5D6GA 3MR6A 4NXNF 1SL2A 2DXFA 1RT3A 4ED5A 1JLGA 2V63A 5I42A 3DOLA 2ALZA 1IKVB 4USVA 4MKYA 5B0CA 1HYSB 4DG1B 1WTFA 1NZAA 3KG1A 2IM2A 4RNMA 2OI2A 3HHNB 3W1YC 3QFHA 2VDIA 5F41A 4RJVA 2DPJA 1GXTA 1O0PA 2XCPA 6FD1A 3GTYX 3ZTQA 3RTVA 4HYKA 2NSCA 1H3DA 2JSXA 4RUCA 2EFPA 3GJQB 1VOMA 1IQZA 5L46A 2RDIA 4ICLA 3AJ1A 4AMMA 1HWKA 4OIXA 1X5TA 1RHKB 3UR0A 2WBRA 2L9NA 3DMJA 4GO7X 2QE5A 3UDCA 1X4DA 2C2RA 3P45B 2GV1A 4DF4A 3GIJA 4K7QA 1WI8A 3R1LA 1EP4B 1HBMB 2DH7A 4CI0B 2MGZA 2ZHAA 4PPDA 1BXNA 3D67A 2BM0A 3CDWA 1IBLJ 1YJRA 3LALA 1N4LA 3N0VA 3R2CJ 2AYMA 1WHXA 2DXDA 3M6WA 4KGVB 5DQGA 4ZHRA 3PYEA 5D15A 2J9DE 1LOUA 3BEGB 5LMNF 3NBPB 4I2QA 5F9NA 1ZM3A 3GIRA 1TQLA 2RDJA 2FJWA 1S0NA 4KHRA 4OJHA 1MROB 1HBUB 2YNIA 5KTQA 3HI9A 3UPFA 3QMQA 1U1PA 3QO9B 5K8NA 2QL9B 4A8OA 2UXBF 1JLEA 1B70B 4U96A 1QLNA 3J81Y 1HFEL 4X62F 2OEJA 3VV2B 2HVHA 4LQ3A 1X5OA 1HNWF 5G4DA 4LF2A 3H59A 2BJDA 2W1BA 4PQUA 1YBAA 3RGIA 4NI2A 4ELVA 3CJTA 3TR5A 1WEZA 1NJXA 2MYFA 2HFNA 3PJ9A 3F56A 2F9JA 2HS0A 4B3MF 4JB8B 2XY7A 3OTOF 2KFYA 4OZ2A 3WDOA 5KT2A 5DM6Q 3KLIB 3VAMA 2FLLA 1UW9A 3C66A 2DH8A 1H73A 1QE1B 4MYUA 1DTQA 1CG2A 2MKIA 1IWGA 5LJ3Y 2IJNA 1OYEA 3P5TL 1ZZNA 4X66J 1O51A 1RISA 5HMXA 3TEGA 2WOMB 2ATCB 4RWWA 3PR5B 1Q8LA 4RO0A 3OV7A 1Q86T 3MMAB 2YX7A 4NYOA 4B9NA 1FDNA 2DNMA 1HHQA 4O0IA 1LXNA 1N5SA 1T9TA 2ZUGA 1XMOJ 1VLYA 2C3MA 2ZOGA 1S49A 3BGUA 4DLEA 2HNZB 3FMBA 1FXRA 3RG6A 2AGQA 3MUMP 3M9MB 1HWUA 2XG8A 3HHLD 2JWNA 2QYCA 1C4AA 3UDLA 1QAXA 3E01A 3DRRA 2VPWB 3OLBA 4LF7J 2VFRA 3BR8A 1S1XB 2M2BA 1U09A 2GIQA 3C15A 4PR6A 4NASA 2DD8S 4CDIA 3GG1A 2HSEB 3EVMA 2Y1IA 3VGSA 1R31A 1UPPA 4JYAF 4CO3A 1AUDA 4ILLA 2IMOA 3D2WA 3P5BP 3FGVA 1KFDA 4B9LA 1N52B 1U47A 2ZD1A 9ATCB 4DPXA 2ILZA 1FFGB 1URNA 5EWFA 2XMJA 3LPYA 1HD0A 3TAPA 1O8BA 3MMCA 3KNGA 3OXFA 2DR6A 1FKPB 4WFBQ 2U2FA 2OMLA 2LXIA 2WCXA 2DYAA 1HQUA 3FRZA 2GVZB 2HBRB 1Q95G 2OPQA 4FF2A 3TX0A 3A12A 1VJWA 2YNFA 1SPBP 1RCXB 2QA4S 3HHKA 2XS2A 2C3YA 4LIWA 4F3MA 4IR9A 4F25A 4WZMA 4TNOA 1JLAA 1C1CA 1UETA 2GA7A 3RB3A 4DV3F 2HFOA 2NXEA 4C3LA 1WDDA 3R7BB 2ASDA 4DMZA 2WB4A 4TY8B 3R5DA 4CLFA 2DY1A 4RW4B 1WJ9A 3MDFA 4MIBA 4KRWA 1K8AT 3LP1B 4QIGA 2OD6A 4UZCA 4WJBA 2LQJA 4LBPA 1WG1A 4PG7A 3BSOA 2DHGA 2PI5A 2R7VA 1DTTB 2P6SA 1JX4A 1X4GA 1KFSA 5KFOA 2IAJB 4O4GA 3HP6A 2EI5A 4NCAA 1JLCA 3PNIA 4JV5F 4B9MA 1HNVB 3CB4A 3DOKA 3LH2S 3MM6B 4ZPAA 3TO8A 3KJNB 1U6ZA 1LK5A 4O4RA 1S9GA 3QGGA 1JLQB 2YWFA 5F8LA 2LDYA 1VQKS 1QSLA 5GMEA 4EU0A 2AX1A 3P3DA 4GVBA 4ZLLA 3VAGA 4K4TA 3GG0A 1IUJA 2BA9A 1B7YB 1UP1A 3V4IA 4KAIA 4DR3F 4QYRA 2XHWA 5HN0A 2B6AB 3VHQA 2B8PA 4CH1A 4BC7A 5B08A 4OHVA 1S0VA 2HNYA 4DL4A 2W2QP 2WTFA 2IMWP 1T8EA 1HNIB 3UWTA 2BW7A 2GNKA 3TAQA 3DU6A 4ED2A 3MD1A 4C8OA 3ITHA 2UXCJ 4CH7A 5J1EA 2ZC3A 2XHCA 2FLNA 2BJ1A 3DN9A 2JOQA 3RBEA 2VB6A 1FE4A 3FEZA 5LM7E 1IKVA 2MSSA 4X4SA 3TP2A 2C2EA 3KMQA 1DARA 4YP3A 4OL8A 1HYSA 1JMTA 2KFNA 2R7RA 3Q86A 4ZN1A 3JXOA 1N0UA 3KWMA 3HK2A 1RA6A 3IR6B 1D0EA 4FS2A 1FKOB 4ZCKA 5A8RA 2XC9A 4NWBA 1WI6A 2V8DA 1VBZA 1BQNA 4K4VA 4I7FA 5T7LA 4DV0J 3PHEA 3CGIA 4HDHA 1C2PA 2X1FA 3R97A 4MIWA 2V4JB 1TL7B 3ILOA 3FFIB 5HVHA 2LECA 2MQLA 2XI3A 4JI2J 3SSSA 2D74B 3AQOA 4WTYA 3OTDA 2C2DA 1EP4A 1GH8A 1JJHA 1HBMA 3H98A 5CAAA 1FEHA 1FK9A 1JK9B 2AJ0A 3OTCA 2J9CA 3Q8YA 1FNXH 5L1IA 3GWCA 4RWXA 4DV1F 3W8PA 3PCOB 2V9WA 3IGNA 3MCSA 1SCJB 2QTWA 2N4CA 2C1EB 2XMVA 2JDJA 2HQGA 3GV8B 4DCOB 3KUGA 1LEOA 4IRDA 1TTHB 2RAQA 1XNQJ 2W9BA 2COLA 4F4YA 2PFFB 1CVJA 4AQYF 1FCAA 2W9CB 3NLCA 4B9VA 1VRUB 2AU0A 2ZKUA 1HQ2A 1PSDA 2NSBA 4AFFA 2B7BB 3LAKA 4DBQA 1U26A 4QPXA 1VK3A 2IRYA 5U47A 1CJTB 1WF2A 1OS5A 2J8AA 2YKPA 4CLTA 1WD6A 3T9NA 4NMXA 3KLIA 4DFMA 4Z37A 1Y3JA 1NJYA 1D09B 3EDRB 2RIJA 3OL8A 2JEFA 2IA6A 2Q79A 1RWPB 1W2BR 3ZZ0A 2GC8A 2C3PA 4RLEA 4OHYA 4F3OA 3MGJA 4UQTA 1A7GE 4DR4J 2H48B 4XDDA 4K50A 2EKNA 3Q8RB 2HNZA 5GAEI 4DPUA 1GQEA 2I5JB 4WU2A 4USIA 1NSKL 1RWXB 3DRSA 3GIKA 1HPZB 2AYBA 1S12A 1VQLS 2DR9A 4OI1A 5L9XA 3THTA 3N4WA 4I0WA 3PW7A 2XULA 1RWWB 4J9KA 2QC3A 2Y1LB 2GHWA 3B4MA 2VH7A 1LWCB 3TQ1A 1F2HA 4ECRA 3A8IA 3R5GA 1IR0A 5KAKA 2IVFB 1JWWA 4OX7A 2CJQA 1DHMA 5DDRC 4QOTA 2JLFA 1ZAXA 5LOQA 4H4KC 4NLUA 1PC4A 4WFZA 2ZZNA 1ZM2A 1GMWA 1SUQA 4JI0F 1U6FA 1FKPA 2GAGC 4FYVB 3ISND 1S72S 3ILIA 3MAAA 4C8NA 3T19A 3TA2A 2W25A 2BW2A 3MR2A 4GKJJ 5B0DA 5AE3A 2LVWA 3AD7C 3MEEB 3CO0P 1QJHA 3Q89A 3VGUA 1NHVA 4IG0A 2VZ8A 3KLHB 1T0TV 4MFBB 5K5MA 4ZKAA 3OFGA 2PDAA 2NZCA 4ZLPA 4TY8A 4B9SA 3DGPA 3QT5A 1ZPWX 1YQHA 3QT6A 3RYLA 3M1VB 5HJYA 4DCJB 3LP2B 1T05B 2Y0SD 1XMQF 3LWMA 5EN1A 3BBBA 3LP1A 1D8ZA 2RUGA 2AEMA 2RSQA 1P8GA 3KHLA 4LQ9A 1KQGB 1DTTA 3H2LA 5A6WA 5EDWA 3CWJA 4NLGA 4F04B 1GX5A 2Z57B 2IAJA 4PEOA 1FKAF 2DNGA 2K7JA 4J9SA 2ZM6J 2KXFA 1NCLA 2VKZG 5KFNA 1G3OA 4ALZA 3BS9A 1IKXA 3O3LA 3MM6A 2MXYA 4BCAA 1WEYA 1PILA 3EZOA 4DZ6A 4URGA 5D3GB 4CM0A 2CQBA 4WKRA 5D8HB 1SC6A 1H72C 1U6BA 4X4NA 3VR1A 1HW8A 3QZ7A 4OI3A 4RW8A 5HMZA 4B08A 1Y9OA 5B0GA 4Y2AA 1KBRA 1S1VA 2CYYA 1KLMA 1HNXJ 4BHQA 1RT2B 1Z2LA 5DQIA 4P74A 3EXCX 3D66A 2PMWA 2W4PA 5CHCB 2EVZA 2IDEA 5CQGA 2MKJA 2EC0A 1T95A 2F9DA 2B4UA 1EQMA 4DQRA 3WIVA 1RTHB 2FDNA 3DLGB 5D78A 2ZKTA 1AB8A 4P75A 5H9EK 4AD6A 3V4MA 2W01A 4F2RA 2NXJA 3MR7A 1X7VA 2ZEJA 3R3TA 1FHTA 4AL5A 2YWEA 1UEVA 2DCUB 4KFBA 1KS2A 2B4VA 1SI9A 4YOEA 4KIAA 3LANA 1SL1A 3OW2R 1S6PB 1FKOA 3OUYB 3VALA 1IBMJ 4H4MB 4WK3A 4DSLA 1WKLA 4ED0A 2LMIA 4I68A 2VBZA 2BE9B 1S1WA 3IMQJ 3KLFB 1X9WA 1RAFB 3ENQA 3MEDB 4M5JA 5DETA 5IM0B 1N33F 2EKYA 1F5BA 1TK0A 1ZBTA 5I3UB 2V4JA 1TL7A 3FFIA 2R8IA 4P7TA 3MTJA 1DQ9A 2YKMA 4N8NA 2UVWA 4IH5A 2C3UA 1RZMA 4LVNP 4J9RA 4ECVA 1FD2A 5FD1A 2JHEA 4AMNA 3DDNA 5E2QA 1LWEA 3PX0A 1Y3KA 3UCZP 1I5OB 5J2MA 4ZDNA 3E8OA 2EFGA 2FIUA 2RRAA 2H54B 2WHOA 4OX6A 4ZVGA 1PCAA 2V2KA 3R27A 1NDKA 3JTNA 2E7XA 3LWLA 2IPOB 2LCWA 4RNNA 2W4DA 1UTAA 3BF4A 4J9LA 1VCTA 5E7OB 3FDSA 3N6LA 2Y1RI 2LQ8A 3BKTA 3G71S 1NKEA 5K8OA 5GAEU 4F36A 3FBCA 2R7OA 4DFKA 4PZVA 3NKYA 3V81B 2HAIA 4ZPVR 4F4KA 2W9CA 1VRUA 4KR0B 1TK5A 1QAJA 3R6LB 1CC8A 5A6PA 1HBOA 4OYAA 5CD4A 2YQ0A 3UN5A 3KUEA 5K9FA 4NCBA 2B43A 3FCVA 4ZIWA 3MXHP 2IM1A 4X4PA 2HW3A 1KLNA 3NGKA 1PJ7A 2BXJA 3W65A 4ID5A 1N32F 4DQSA 4FPIA 1UW4A 2F4VJ 2AWZA 3DLEB 5K8MA 4LF8F 1SIWB 3K7RA 5F8GA 1VQMS 1TFWA 3DXSX 2J6SA 1NNDA 2F65A 3QGHA 1ZA1B 4O3PA 1FVSA 4FBTA 2XSFA 4NRUA 2AYGA 1WC5A 3MECB 4OZ5A 1UMJA 3LW5C 1LW2B 2BQRA 4DX5A 3QJLA 4J9NA 5D77A 3MI7X 3D1OA 4WTOB 2CPZA 3CCES 4IG3B 1PGZA 1GMWD 1YRXA 2C2OB 3LP0B 2BX6A 3NNAA 1UEKA 1OO0B 2R4FA 4LSNB 1P1TA 4D3GA 1C0TA 4M5GA 2D41A 5KFXA 3CDEA 2QA2A 2F5GA 2LA4A 4DX7A 4LR8A 1A9NB 3RAXA 2E5GA 3ZTPA 3VAHA 3M9NB 3US5A 3DI6A 3W2WB 4ES2A 2V67A 3GP9A 4ZK7M 4C0BA 1RT1B 4FF1A 3QWPA 5HQLA 1VI7A 1RHQB 4PWDB 3Q83A 4G65A 4F0KA 5FDLB 3BGFA 4DR7J 1XJWB 2AKWB 2N4DA 3MZIA 3I0SA 4ANDA 2BKPA 5KG4A 2D3ZA 3TANA 1N34F 3FQKA 3HX9A 3M32A 1CLFA 5KT3A 1VDHA 4USTA 5KT7A 4RW7B 1M5OC 2JX2A 2Y9HA 5JXSA 3HD2A 1U25A 2A0FB 2C2KB 5IC6B 1CJKB 1KP6A 1FWLA 5F8NA 1E6VA 3KK2B 3MEEA 1I3OB 4OYXA 3QT8A 1T3NA 4M5DB 4BC9A 5KG0A 2JVRA 3NEKA 2Z2YB 2ZNZA 3KLHA 4F4WA 4MFBA 4I64A 1P9QC 4AYBD 3OBIA 1TU0B 3JSBA 4OQJA 1WSVA 3OR1A 2HWTA 3EUNA 2MY7A 1X4AA 1VK8A 2QZ8A 2B3TB 3DFEA 4DHVA 3GJSB 4LBHA 3RAMA 4TVAB 5C5JA 4N7TA 4RW9A 2V68A 4CM2A 1DQAA 2X51A 3CD0A 4DL7A 3QZ8A 4M8LA 3D9BA 3PKMA 4WYLA 2KI2A 4YN3B 3AY0A 3C3LA 1YI2S 4C8KA 3C46A 2DHXA 3N79A 2B0GA 1B4SA 5KFWA 5CZVA 3G87A 5D3GA 5HI7A 4IQMA 1Y5NB 3T5HA 3A3NB 2Q6CA 2Q43A 4DV2F 1UFLA 3PJWA 1XERA 1F3VA 3R6GB 1CJUB 2LFVA 3MM8B 1S77D 2M7SA 5E5NA 2LU2A 4X4UA 4NYPA 3B6BA 1WACA 3C8YA 4JI8J 3ZZOA 5C25B 3AAWB 1C1BA 4IH6A 2GQQA 1RT2A 1S6QA 1YJTA 1MWQA 3AJ2A 1CBKA 1EARA 3Q23A 1WC3A 3PZPA 2MTLA 1UPMB 2WSFC 3RR8A 4OI0A 2F7VA 2ATLA 2ASYA 2VL1A 3OT9A 1RTHA 5IT4A 3DLGA 5DS7A 3FVYA 2CQ4A 1BHNA 4DPOA 3TWZA 4DV6F 1N6QB 2J0WA 2QLJB 2QMXA 1PAUB 3MOZA 3M8QA 5ETQA 3RB0A 5LSLA 3MPYA 4DR6J 3FMWA 2B9YA 4MT1A 2ZBPA 4YR0A 3OD2A 3KLGB 2AGPA 4IO9Q 1CSJA 3Q2SC 3IBFB 3OUYA 1UVIA 4DSEA 1WHWA 4OX9J 2POKA 4RW6A 2CQPA 4Y3CA 4ZLNA 2RH3A 3KLFA 3MEDA 3ENWA 2XS7A 2YX4A 4DZDA 1RAJA 5I3UA 3HXMA 1EX8A 4PABA 1VQOS 1ZZFA 3VTIA 1ZM4A 2CJBA 5DZ7A 1RTJB 1UAWA 4O3SA 2MZQA 3WC0A 1MWYA 4MIAA 4ZVEA 4NOHA 3FSYA 4Y6IA 4B17A 3UVJB 1YG0A 1DJ0A 1M0SA 5HBMA 2K1RB 2MQ8A 4LF5F 4ZMMA 1JLBB 4IQXA 2HHVA 1LW0B 1RKJA 1N56A 2GJ2A 7FDRA 2NPIA 2FHMA 4QW9A 2FZCB 1S10A 1UA0A 1TL3A 4I56A 2BEFA 3SV3A 1IBKF 1FT8A 3B54A 4JI4J 3IBCB 2RQ4A 4WFNQ 2LU1A 1K47A 2ZHOA 2YPYA 3HZGA 4DFPA 1IM4A 3M8SA 1X5PA 4DEZA 2KKHA 5B0FA 2BANA 2GO9A 3V6HA 3T1YF 3I96A 2OIHA 3FKBA 2J76E 4YY3J 3V81A 1U45A 1MU2B 4RUBA 4PXBA 1T7PA 1GFWB 3PTWA 4FBUA 2CJXB 4I6AA 2OLWA 2QMWA 4KHPF 1SQFA 3ZNUA 5KFPA 4Y0FA 4DQIA 3JTOA 1E6YA 2RMLA 2NYHA 2E5LJ 3LOUA 2W2OP 3D6HB 3KHHA 1V9OA 2HPUA 4OZLA 3DLEA 1L3SA 2LEPA 4K4ZA 4WP9A 3KXDA 3OHBA 1HI0P 1RAEB 4X84A 3HFKA 2Y3YA 4CYUB 3M6VA 2HIQA 3UW1A 1Q5VA 1PBUA 4U6PA 1FJGJ 5GAGU 5HLFB 3UR3C 5IT9U 4IOCQ 3DLBA 2GQCA 2HRUA 4NRTA 1Q82T 2XMUA 3UCUP 3NWGA 5SZTA 3R5CA 2OPSB 4O44B 3MECA 3EPIA 4KV8B 4P52A 4UW2A 1Q81T 3C19A 1RI7A 4F50A 1ICEB 4B3RJ 2QFIA 4JI5J 2R7QA 4CIOA 4YHHJ 3T5KA 5AE2A 4WZQA 5EUHA 1Q8KA 3LP0A 1DFDA 1N5YB 3H4DA 2P6TA 5KFEA 1YHQS 3DRXA 3M4XA 1MLAA 3S1TA 2XCAA 1N36J 1D1UA 4L6V3 4WIIA 3V6DB 2JJ4D 1RBLA 4K4YA 1R0BG 5HROB 3W2WA 3PY8A 1VC5A 1GTEA 3DRYA 1TZ0A 4E98A 4ETXA 5JUMA 3G8TA 1RT1A 3JQKA 2YXLA 4E2FB 2HYIB 4PWDA 4OV6A 4XO0A 3P8BB 4FKXA 1HMVB 2QIFA 2V8GA 5KFUA 5M2PA 1NHUA 1FI4A 4V19J 2LQ9A 1YSJA 3O5TB 2Z2LA 5AT1B 3FC9A 3HHLB 1FRHA 2X1AA 2VQFJ 1KOOA 3UFCX 5IWAF 2CQ2A 2MPUA 3V2UC 2QLFB 2K3IA 5J2QA 2I1RA 1OIAA 2BYCA 2BV3A 2CWXA 4NLXA 4M63A 1MMDA 5BJRA 2V0NA 3NGSA 3MM9B 4RW7A 5E3RA 3SMZA 5K14A 3KJVB 4DR2F 1DY3A 3KK2A 3U7JA 2GVDB 2MHNA 1GMUA 3RU0A 3L7OA 3MR5A 2K06A 2QO3A 1NKCA 2Z8QA 3OFHA 4U7UK 4YQWA 2UU9J 2FVRA 3NAHA 3SQGA 5A8KB 1HNZJ 1Z1ZA 4W92B 1XN9A 3NWRA 3OR2B 1S1TB 2MLYA 3GYGA 4JBCA 1QAYA 4IUFA 4ZCLA 2WB1D 3UD5A 2ZE2A 4CLYA 2KZZA 4BWMA 4BDPA 3B78A 2FJBB 3SDEB 2UV8G 2HQIA 1S6UA 3A1YG 2DPIA 3PEHA 2HWIA 4EO6A 1EJ7L 4AXIA 4ERDA 1GXLA 4GRSA 2V9KA 5GAHI 2C2MB 4G1QA 4RU2A 4F0MA 3C6TA 1W25A 3FSIA 4HT5A 1VQ6S 2KT5A 1XTZA 2YNHB 4WXOA 2QGFB 4EBCA 2I38A 1I94J 1NLKL 4QR0A 3DHXA 2HHXA 1RP5A 2VU5A 3RW7A 3BPDA 1LV5A 3F41A 2CAJA 2W24A 4R8UB 3R2DJ 2ZDOA 1SQGA 3S01A 2UXCF 5ETNA 2ZBCA 5KT4A 4NXMF 4B3TJ 4C2MA 3T6BA 1BUXA 2BVZA 3L7PA 4DV4F 3I87A 3ISZA 2OO4A 3DDKA 4XPEA 3GIIA 1CJUA 3CDAA 3NNCA 3FRYA 1VFJA 3U1NA 1TVRB 3NCPA 4DSKA 3I5AA 1DAXA 2YTCA 4FDFA 1RT3B 3VVTA 1JLGB 1L3TA 3VWSA 2IM3A 4JI6J 1T9WA 3FBEA 3BDEA 1S79A 3T1HF 4F4XA 4I69A 3DOLB 1GAOA 1NZ8A 1TKXA 1RAOA 4CTAA 1MG7A 3ENVA 4FVMA 1FF2A 2F1FA 4DV5J 4PYAA 3I6PA 2PA8D 5AJ3F 4NXNJ 2UUCF 3B8HA 4LRBA 3IC1A 2XMKA 3G6VA 5DG7A 1CJVA 2KT3A 1S48A 1N6QA 3R5AA 3BYPA 3MPDA 2NR0A 1FRJA 3E51A 1KKHA 3DU5A 4KPCA 3FJ2A 2PE8A 4CLUA 4ZJOA 1RADB 2VPXB 3CVKA 4ICLB 3KLGA 2KJVA 3QIDA 5CZCA 2BMBA 5IT9Y 2CQGA 1EAYC 4ED4A 3DMJB 3CJSA 1D9FA 2AHOB 3HMJG 3C14A 2FJXA 1VQ5S 1YRUA 3NGTA 1S0OA 4DU8A 4DQQA 3BH6B 3H2VE 3IA0A 1U7LA 5E3QA 1IJEB 2EEYA 3AA9A 3W64A 3L4BC 4X4OA 5HP1A 1ACMB 1RTJA 2HFZA 2YWKA 3LUYA 2G9OA 3L9ZA 3LGMA 2CNKB 4ZHRB 2AJ1A 1RHJB 4HLBA 4MKAA 2HEKA 3CJ0A 2K1RA 1SKWA 2ZH3A 2EG2A 4I2QB 4FF3A 4IFVB 2HLUA 1DURA 3R1HA 4X4TA 4URQU 4Q7AA 3EVWA 3H5YA 3AXMA 4NLOA 1FFWB 2DBBA 1P27B 4USMA 1JLEB 4DL3A 2LXFA 5IFMA 4IDKA 2CUYA 3HF5A 4LFBF 1KN6A 3HT3A 5LMNJ 3AD9C 2AD9A 2W7PA 1EZZB 4NI2B 3LGNA 4EBEA 3PYDA 1YJVA 2OTLS 3ELHA 9RUBA 3J80Y 2UXBJ 1ZYQA 3G6XA 2LLZA 2O1PA 1Q53A 2Z4PA 2DO0A 3BN7A 4X62J 4IYQA 2XS5A 4NLRA 4DR4F 1HNWJ 2BJ9A 2YKAA 3LPEA 1DTQB 2DTJA 4U8VA 4HKQA 2KYZA 4QZVB 2ZH9A 2UVUA 4OJGA 2FVCA 1SC3B 2G2OA 3MWBA 4EI2A 2HHTA 2FVPA 1UWBA 5HK4A 3Q8SB 5KFTA 3NMRA 2KXNB 3RAQA 2RQCA 2H4WB 2GCFA 4LR9A 3PYFA 3OTOJ 1SH0A 4PQAA 4IFYB 4A8SA 2ASLA 5HLFA 2E7VA 2BJ8A 4Z7CA 4TY9A 2PMZD 2Q6BA 4DL0C 4O44A 2QSWA 2E5IA 4OZ1A 4QCLA 3BQ1A 4CNYA 1F5CA 1B3TA 3NL0A 3WZ0A 1EIYB 5L38A 2KVIA 1FO1A 3DRRB 1UVKA 3THVA 1A0OB 4LF9F 3BBFA 2WW4A 3BKUA 4CWBA 2ZH8A 3C15B 1WC0A 2OSRA 4KO0B 2BJEA 2FHJD 2DNPA 3CJ5A 1LK7A 2PEHA 3ZC4A 3TAMA 1YZ7A 1R3NA 4I6WA 5HROA 1NK9A 1SB6A 3ZTOA 2FTRA 3SCJE 4BBYA 1J5OB 4KH0B 3QNWB 2AP6A 2ZD1B 3TOQA 1TAUA 2H5EA 2AJFE 3NP5A 3AA8A 3OVAA 1VQ7S 4F4ZA 4ZVRB 3J81U 2LEBA 5KFLA 3HHEA 4ZCIA 4JYAJ 5F3TA 3BPSP 4UF4A 2XM3A 3AH6A 3HHLA 3EGVA 2YKOA 1X0PA 1I1GA 3ZO7A 5GAHU 2N7CA 3E3XA 2RU3A 4CO2A 2OPQB 3BH7B 1U0HA 3TUPA 2NYIA 3DGVA 5ETPA 2Q1LA 1K1QA 2FJDB 4ZCMA 1HI8A 1WWHA 1S0MA 4KGMA 4KH1B 4DR1F 2DRBA 5ADZA 1JLAB 1K0TA 1C1CB 2L9DA 1Y4ZB 3RZAA 2XTJP 3MM9A 4C98A 3BGLA 3TZXA 5DJBA 1CULB 1OY9A 2JZ5A 1ZS6A 1KONA 3MM7A 3BBCA 2R7TA 5HVGA 2R2UA 1OQ3A 1MN9A 3L3CA 5KG3A 1RUSA 2KZMA 3K89A 4DV3J 3OR2A 4NLVA 1FFSB 3GYXB 4RNFA 2R7WA 3OTEA 1F9EB 1YITS 1NK8A 3I9V9 4O4GB 5HJXA 4A8YA 1JLCB 2HVDA 3J7A1 5LXRA 3VQSA 1NK5A 2R2RA 2RS2A 1FERA 2HRYA 1UA1A 3A3OB 1KQSR 2KDOA 4LRFA 4NE9C 1XK8A 3EGZA 2DJWA 4CT8A 2OJ3A 2JFKA 3SQOP 2V69A 4A4JA 1BLUA 4ITSA 4CRJA 2WVBA 4UOGA 4CLLA 4TU8A 1FNMA 3CXCR 2DXEA 4R8UA 2AQ4A 4JV5J 1SQEA 3SEOA 1QM9A 2ZH1A 3ZZUA 2FJVA 5F8MA 3UDVA 3G8SA 4B3SF 3LGHA 1ITPA 3TEHB 4KSEB 4XIUA 2HZVA 5KFRA 2HNYB 2Z0GA 4X64J 5HMYA 3AQPA 2E5HA 1EQ0A 5L9NA 1TELA 4NLPA 4Q2LA 2DNKA 5DDPC 3ITHB 5J1EB 1ZPVA 2R7SA 2CQ3A 4DR3J 4Q43A 3T41A 5ETMA 3G9CA 3GFYA 4YFUA 1VGYA 4G1IA 1WOOA 3NGUA 3N9UC 1SJFA 2HFVA 3U1MA 4M1KA 4OV1A 3PIPQ 2VDHA 1VS3A 2ZZTA 2J9DA 4OHWA 2X3DA 2HVEA 2ZZMA 1RWKB 2JEGA 2B5JB 2W7AA 4UUXA 1U8SA 3VCDA 1KRPA 5JJBA 5EGYA 2B9WA 1GEHA 5A8RB 4R5PA 1Q7YT 1RACB 2RD5C 5A2QU 4DL5A 2B4PA 1T94A 1RAIB 2WVCA 1OY8A 2FC9A 4EYIB 1RWMB 5F0UA 1BQNB 4ZS6A 2IHR1 5LMUF 4K2XA 1B0PA 1ZAVA 4ZA1A 3UD4P 4I7FB 5T7LB 3SIPB 2UVVA 3HM9A 4UTGA 1JKHB 1YVFA 1YWXA 5E3PA 3ZZYA 4WIQA 3PM9A 2G0IA 2RF2A 2HMIB 1X8DA 2V4QA 1RCOB 4Q0BA 2YQ3A 1VQPS 3NCQA 2LXUA 3HJFA 1MWZA 4PUOA 4HTJA 4ECXA 2CQDA 4R25A 2JEIA 1SV5A 3M8PA 4U95A 3MPWA 1FK9B 2N82B 2VPYB 2EFOA 3VAKA 1NXIA 1SJ3P 4C6AA 5CZXA 2XZWA 2UUBF 4PYDA 1JJ4A 4X65F 4B3OA 4IFVA 3GFXA 2XO6A 4JV1A 2CPHA 3W5XA 2JEJA 1LWXA 3CCWA 2VASA 1K44A 4MJKA 2W9BB 1HHTP 3D6TB 4Y34A 1X60A 3EJMA 4RNOA 5IXUA 4GVLA 2HQFA 2HHWA 4GC6A 4DV1J 1R27B 2MDAA 1U1RA 3P49B 2ZOFA 1FRXA 1UJ4A 2RU9A 4LVOP 3C16A 3G8QA 3HDSA 4OYBA 3H5UA 2I9SA 2W2MP 1FVQA 2XGPA 2P9EA 1QAIA 4E8UA 3QLHA 4AQYJ 2K7KA 1WC6A 3OFEA 3KLVA 2CA9A 2CVIA 2BR0A 4CLKA 3CCJS 3D0HE 2D69A 3CCQS 1Q7LB 1WG5A 4ED6A 4CO5A 3HSJA 3W60A 3W62A 1H2TZ 4IFYA 4OI4A 3CJRA 2W7OA 1H2VZ 1K9MT 3GR1A 3G82A 2P8IA 3HHDA 2DNYA 2CRLA 3NMAA 4K0KF 4EWTA 4H4OA 3CW2C 1CS4A 3GFHA 2RHQB 2CZVC 1K1SA 1R8AA 3DRSB 2J6TA 1RJJA 4I2PB 4DL2A 1RLCL 5KOXA 3CCVS 2M70A 4KBIA 3CJ4A 1UL3A 4N47A 5BR8F 1Q1KA 2C3OA 5ETOA 3QBCA 2F3JA 4KO0A 2VG7B 2D9OA 3IFEA 4J9PA 2GS8A 1NPRA 4DUTA 2MLZA 3RR7A 4IOBA 1L3KA 1Y11A 2HGLA 3ZTSA 3M9OB 1H2UX 3FCHA 5IV4A 3M05A 4RU9A 1J5OA 2G0CA 3OL7A 4JI3F 3OSNA 4EYHB 1P9YA 2PN6A 4ZPDA 2Z30B 1PJ6A 1SUQB 3Q2TC 3LO3A 1FRIA 4EEYA 4DF8A 2PEBA 2VZ9A 2XZDB 2CQ0A 4LBIA 4UY8T 2ROPA 4N77A 2KB2A 2VIHA 2V2VA 4F0HA 2FJEB 3MAAB 3BN4A 3DNCA 4DDFA 2XMAA 2AT1B 2M0GB 5CYQA 3T3FA 3L95X 3CCTA 2EK1A 1OMSA 4JI0J 2UXDF 3KOAA 1KTVA 3BO3A 1K73T 3N5BA 3X3UA 5J1PA 3GB0A 4IG0B 4A48A 1OY6A 5GMKa 4KHMA 4C3MA 4WK1A 4LRAA 2I0XA 2OELA 2O5DA 5THWA 4HL9A 4ED8A 1CULA 4PXEA 4Y65A 2XYPB 1IM6A 1HBNA 2DEIA 4XPCA 3DGPB 2IFXA 2BRKA 2QT7A 1X9MA 3HFVA 4NA3A 5A2QY 4ZLJA 3QSYB 1VQ8S 1KQKA 2QRRA 3RUBL 1YK9A 3WHIA 3PVXA 2FPHX 2H9ZA 5HVFA 2V2QA 4OZJA 3V5RA 3KNAA 1VHIA 2PC6A 3QFWA 4NLYA 3EGWB 3RBXA 1MNEA 2U1AA 1KC8T 4DR5J 4Y2CA 1PJ5A 3Q8VA 3WX8A 2UZAA 3EICA 3ONQA 1XMQJ 3POTA 2MZJA 2FQQB 1G1XA 4L3KA 1QTNB 2D3O1 2WBMA 1TMJA 1IKXB 3F73A 5A76A 1YJNS 4P2SA 7FD1A 3EZ5A 2GIRA 1XEZA 1FTRA 4PG4A 3VAFA 2JC1A 1WHYA 2XY6A 2HVZA 2BRLA 5KG7A 4RW8B 4K4UA 2CDRB 4USHA 2WK4A 4LF1A 1S1VB 3D1QA 2BQ3A 2ZH4A 1KLMB 3H5SA 4LSLA 2MB0B 1SKSA 1C0UA 2V8VA 4WCEQ 3HVWA 4YEAA 4P2XA 1RAAB 3JAMU 2IBOA 4KY3A 3D1HA 3KFWX 3UCGA 2IIHA 1IKYB 4PWUA 1KOHA 2V34A 4WPAA 4WKYA 3TA1A 3MHYA 2K8GA 4ECZA 1ZM9A 2F40A 1VJQA 2YKQA 4NCGB 5KFZA 3DHWC 1M5KC 5M2UA 5BYRA 2M3DA 1JNZB 4RUAA 3BYRA 1PG5B 1RK8A 3J7YU 1TL4A 5F3ZA 4DUYF 5CCMA 3IBWA 4UY85 5B7WA 1RXOB 3O2IA 2P9GA 3PEJA 4FYWB 4KFBB 3O1LA 1OWXA 2B5JA 2VFVA 3ULHA 2CQCA 5L1JA 1FJEB 3MUTP 3IR7B 4HH1A 4KTQA 3MURP 3I4HX 5JMNA 3W2VB 1JQGA 1S1WB 2RDDA 2Y0BB 3PW2A 2HURA 2A1BA 5K8PA 1SH3A 4LRDA 1NJZA 3PO5A 1NK6A 4RBVA 1JKHA 2B8QA 3AD8C 3K5PA 3NAIA 4UT4A 2WSEC 3IWNC 1FWPA 2YKMB 4EMDA 4WU3A 2KTQA 2HMIA 3I5CA 1IQTA 1FX2A 3AODA 3D54A 1TL1A 3GR0A 2PGCA 1KDNA 4UOFA 2QMUB 1LWEB 3RRHA 1RYRA 1N33J 4NEZA 3F44A 2AMCB 5J2MB 4FXVA 3PW0A 3D68A 4V19X 4M5NA 3VF0B 2NREA 3M30A 3JTPA 1R89A 4LF6F 2XGQA 2W8KA 4LF4F 2J9EA 2YKNA 3K2YA 4DOZA 4X4RA 3AOAA 3ILJA 3KK1A 2EWHA 3L09A 2BKOA 4O3OA 2PT0A 4U67Q 4CNZA 3CJ8A 3BZQA 4JI1F 4OZNA 3TI0A 2B4OA 1KTQA 3I0RA 4LFCF 2CFXA 3A8EA 1XNRF 1G6BA 1HBOB 4NYZA 1KQFB 3D6MB 1IXKA 1DQ8A 3IO1A 4YB1P 1JXLA 3DOMA 2A18A 4DLGA 4ID5B 1S7IA 4RX6A 3PHTA 2J7WA 1RT4A 3QQCD 4QR2A 4JI5F 4YHHF 1XWLA 2D9PA 1RHMB 4ES3A 1YJWS 4JOUA 4KGKA 5A0YA 3ICLA 3U27A 2KT2A 4M5HA 2AZ3A 2WRMA 2YNGB 1P1LA 5C24B 1N32J 2DIUA 3KHGA 4Q8EA 4YB6A 2NLWA 4LF8J 2VFTA 3E2EA 4M95A 3TA0A 4OLPA 5KFHA 3QSIA 2CPEA 2DNQA 2JRSA 1H7WA 4JI7F 1C0TB 2FZGB 1WKJA 3IRWP 4I2PA 2BABA 2BE2B 5KG1A 2FB0A 2VQFF 2F63A 4CO4A 2R9LA 4HEA9 3Q24A 1RKIA 3M2UA 3QYYA 3D3CJ 3DI6B 2VG7A 5B0BA 2IVMA 3HKWA 3TJ8A 3VVUA 4PXDA 1V3SA 4ATNA 4WFAQ 4M5KA 1J2VA 3DM2A 1U2RA 1OPIA 3WIUA 2AYEA 3G96A 4OHXA 4QIFA 3FNNA 3AOBA 1BMQB 2MZTA 3IM9A 4N8OA 5KFFA 3CC4S 3VGVA 2GO8A 1HQEA 2WONB 3I0SB 2LEAA 2KRBA 1YJUA 4L75A 1Q5YA 1K0VA 2JLEA 3NOGA 1NPKA 2ZOMA 3M32B 5KT6A 3JAMY 2BM1A 3SI8A 4IOAQ 2V50A 4LRCA 3OJUA 4Y28C 2RQMA 4LMZA 1S4EA 4C7QA 1EKRA 4DSJA 4DV7F 3RBDA 2KVQE 2QSFA 2G2ZA 3W7BA 3HLUA 1E6VB 3V6KA 1N34J 3IG1A 1HA1A 4KC5A 4PG5A 4KQZA 3P6YC 1FXLA 3NCRA 2NUHA 5GVQA 2HHQA 2IYGA 1S9EA 2RJZA 1EB0A 3QWUA 4YB5A 3OR1B 2HBZB 2OSQA 3WC2A 1HIYA 3HHLC 1XR7A 3TVZA 2HG4A 4QPTA 5DGBA 1MW7A 2ZVIA 3CSKA 4WP8A 5L1LA 4WWSA 1PAEX 5DG8A 1N88A 1PO6A 2PFDA 3R8YA 4IRCA 2W2PP 4CP5A 3HZEA 4G6VB 1H7XA 4TYBA 3DLHA 4RW9B 4P2MA 2FY8A 1V3ZA 3PKYA 3TZYA 1ZH5A 2D7SA 3O44A 4KYZA 1W26A 2X1BA 4CLZA 1BQXA 4GO5X 1HR0F 1F2GA 3S8SA 1Y7PA 1LQ9A 2CPYA 4DXLA 1WOSA 1T03B 5B0AA 3BSNA 4EZ9A 1R8PA 2V8PA 4KT0C 1WNEA 3DCAA 1AZSB 2N3LA 1YRTA 1NSAA 2E1CA 1FEEA 2ACYA 4WYWA 1LNQA 3OVBA 3BGOP 1B0VA 1NKBA 1VBKA 3GQCA 4ZJQA 2RQKA 4KKOA 2N7YA 3M6UA 4ECWA 2DR8A 2ZVSA 3R5JB 2FLPA 2EG1A 3JQJA 4DN9A 1C1BB 1XQIA 1S6QB 5LJ5Y 2HVIA 3Q22A 2O3DA 2XY5A 3C6UA 3W66A 7AT1B 5EX0A 4URSA 4GKKF 1OJ4A 1WTBA 3DLKA 4DV2J 1R0AB 1NU4A 1UVNA 1IKYA 3PV8A 3KLEB 2OD4A 3S6EA 4ECUA 1GTHA 4NCGA 2GHPA 2A2DA 3EE3A 2DEJA 1NBEB 4NLSA 3G86A 5KFGA 1PKUA 3M8QB 1VC6A 2F8EX 1R6VA 2XYHB 2XI2A 2QLWA 4IRKA 1S1UA 4IH7A 1R43A 1RLDA 3QGIA 2JL9A 1RT6B 4C0HA 1SVDA 3JS9A 3OFFA 4RW6B 5CA5A 4DV6J 1Y00A 1BD6A 4UZBA 3W2VA 3CJKA 6AT1B 1AROP 5CH7B 3GZ7A 2BOPA 1SKRA 2CXEA 3GFZA 3VAJA 4WFYA 1ZOTA 3FUYA 2CG4A 1NH7A 4OI2A 1RE1B 4ED3A 1JLFA 2MKSA 3QIPB 1X31C 2E44A 2F8HA 2QLXA 1RAHB 2D1CA 1DRZA 2GMJA 4DX6A 3GLJA 1U2CA 5HBMB 4A8MP 2HIYA 2YX1A 1IVZA 4AL6A 2HZAA 2CJKA 3G2XA 3H90A 3MMBB 1Q8IA 3KG4A 5IV3A 3MEGA 1B7FA 3HVAA 1TL3B 5EWGA 3PIOQ 2VC1A 2NXCA 3M2VA 4ZVUB 2XQCA 1KSPA 5JVGQ 4UOHA 2V8HA 1UFKA 2CZ4A 1AA1B 4OYMA 4J5OA 1VLOA 4DSFA 4LF5J 2MJUA 3HCXA 4LFAF 4FS1A 1HARA 2A3JA 1J5EF 2BANB 1WSRA 3J81j 1UFWA 2ZJPQ 4A8WA 1KNZA 1VRTA 3SSQA 3FZBA 3GV5B 3K5OA 3OHAA 2VHGA 2MY8A 2P9CA 3DRPA 1IBKJ 1U1LA 2OH2A 4KGZB 2E1RA 4WFXA 3DLJA 1E6YB 2OAUA 1H98A 1N54B 2CWKA 3O6QA 1TR0A 3OL6A 2VJVA 2KM8C 3RJMB 2O67A 2GGPB 4ECSA 3T1YJ 1HWJA 4CZCA 3I32A 2VBYA 2JC0A 1I6JA 3HKZD 3U1LA 2LYVA 3TUJC 5F8JA 5G0RB 4G1PA 1HHSA 3OTBA 1IR2A 4HI1A 4KHPJ 4O3RA 3EVOA 3KKFA 4CO1A 4J9MA 3N5FA 1U1QA 3GYNA 3UN2A 2IY5B 2GMHA 4TXSA 2YNGA 5J2PA 1SBRA 5C24A 3AXKA 3TUIC 2VODA 2KFZA 3GSDA 5BXIA 2R2TA 1Y0HA 3ZXWA 3TARA 1VIXA 1P6TA 2ZH7A 2VOPA 3UQSA 2GJIA 2OPRA 1RT7B 1XC9A 1URRA 3NS6A 2WVDA 2C22A 3WQPA 1ULRA 1WG4A 2BE2A 1IKWB 4F67A 4OHZA 3IP0A 1WEXA 4J9VA 1FNOA 1QY7A 2VFUA 4DUZF 1NB2A 3H7HB 2HAFA 3TJ9A 2E1AA 4ZPTR 2ROEA 4P71A 3QT7A 2H65B 4J9QA 3AOCA 2ZWPA 1U2FA 2CIMA 4NA2A 4ZP7A 2VD3A 1H6KX 2UUAF 3SCLE 2FGOA 2R8KA 2XSJA 5CZDA 2NXUA 4XAKA 2MQOA 2WONA 5JVHQ 3OXLA 1SIZA 1CEZA 5GAGI 3CIMA 4C8LA 4P10A 4R0JA 1NO8A 3R7NB 4QIWD 5J2QB 3BSAA 5F8HA 1TAQA 1ZETA 4CH0S 3BREA 1M1HA 1MMLA 1UVMA 2GMLA 5E3AA 5K14B 4ELTA 3LA0A 1NUEA 5IWAJ 4L76A 5KFKA 2RVJA 2PIIA 1GT8A 2EK6A 4EK2A 4USJC 4WE1A 2DCLA 2DR5A 2EW9A 2VG6A 4C8YA 5D4OA 5SUHA 3CULA 2AIRB 3SQGB 3GILA 2YVSA 1LKZA 4CQ1A 2DGVA 2ZH2A 3QRRA 3KK3B 2G0JA 3H8YA 5T14A 1U1OA 5IQ6A 1TUVA 2APOA 4DR2J 2ZE2B 5EHHA 3GE9A 4IO1A 4Q44A 2VA3A 2E9ZA 3SBMA 2OP5A 4A8FA 5DM7Q 4DQPA 4PG6A 3K59A 1TP7A 2DGWA 2CZ9A 2KG1A 2XO7A 1UVLA 2R8HA 1PBAA 3N28A 1RTDB 2ZWOA 1RGVA 4G1QB 2G2YA 2HHHF 3C6TB 3W9JA 4NL5A 4ZVTB 4ED7A 2HRTA 4X64F 3JSMA 5A8WB 2JH3A 2VV5A 2YBVA 1S9FA 5D4NA 2XMMA 5ETLA 4NA1A 5HATA 1F9HA 2E5JA 4HI2A 3AB4B 1PIEA 2FHKA 1T03A 2HS4A 2MQNA 2GJFA 2HGNA 1AZSA 1NSPA 3F0NA 2DY9A 3ISNC 4MH8A 2Y1JA 3PJXA 4GC7A 3I55S 4B9UA 5DGAA 2ZHBA 3CJQA 2VUGA 3SV4A 4A8KA 2IJRA 2CJYB 4NXMJ 3UD3P 2IJFA 4NLQA 4C11B 1XR6A 4HDGA 1U0SA 4ETZA 4DV4J 3SYZA 1R0AA 1TKXB 3EPGA 3RW6A 4N5SA 2QFJA 4CTAB 2XLIA 4DG1A 4ECTA 4F26A 3KLEA 2CQ1A 4FXDA 1SJ1A 1X4EA 1VRQC 2MKCA 1KVJA 1YBUA 4I4BA 1CJVB 1R0CB 1ELOA 3T1HJ 3IWXA 4CCHA 4JV0A 2V4RA 4K4WA 4Y2MA 1AXQA 2LQ5A 1JB0C 2GZOA 1NPPA 4HR2A 1WOPA 1RWVB 2C2NA 4MMOA 4A47A 5BYSA 5AJ3J 2NQPA 3AT1B 2ZH6A 1VQ4S 1UEUA 1RT6A 1CQMA 1IBLF 2UUCJ 2AJ2A 4ZVSB 4W4MA 1RAGB 3C14B 3QAEA 1VC0A 2Z2ZA 1FXDA 1NJWA 4OZ0A 2J7UA 2EFNA 2JLGA 3ZZZA 1RU2A 3CMES 3T1AA 2HWHA 1FDAA 3DLLQ 4ZVOB 2XMTA 5HP1B 2QN6B 2YWWA 3NGRA 3MFIA 3Q8UA 3A3PB 3QIPA 1NMEB 4EO8A 5T41A 3FSXA 3PRDA 3NBPA 5CCLA 4DN0A 3K8VA 2E1PA 1BE4A 2IM0A 3CMAS 5IS2A 4QR1A 2RNEA 4PG8A 1MROA 1HBUA 3MMBA 4K4SA 4CLSA 1PYSB 4DL6A 5IOLA 5DO2A 3QO9A 2EBGA 2VKRA 4JV2A 3PACA 4P73A 4IDKB 2PA3A 4W90B 4YMEA 3LTOA 3EZUA 4ZP8A 1T9VA 4IR1A 1Z2ZA 4X66F 1RTIB 2I2YA 2ZDPA 2RRNA 4OYWA 3HFZB 5DLGA 3EGNA 2KYXA 3HD1A 2VF3A 4LFBJ 1Q79A 2MLXA 1QE1A 1RBAA 4MKBA 4RZRA 4YB7A 1XMOF 5LSOA 2Q66A 2GGPA 2W2NP 4CO0A 2CKWA 4FKYA 1FRKA 2WOMA 3UN3A 2K3KA 3M2RB 2AX0A 1M1KT 3B4DA 1WHVA 1UWBB 3EX7B 4Z7YA 1HKAA 3MMAA 5G0RA 3WBZA 1NSQA 1T02A 1RWNB 3I4PA 5KG2A 4LF7F 4MAKA 2CPDA 2XWXA 2HQCA 4ILMA 3IM8A 4M5IA 2OFGX 3FBFA 3IWLA 5IZHA 1FDBA 3LAMA 4CLWA 3GJTB 1B99A 2MJNA 1H38A 4KJIA 3G4SS 1A6LA 1IWAA 2M9KA 2KL8A 2OGUA 4PXCA 2C28A 1RA7A 2RT3A 4RBUA 1NDPA 3CO9A 1S1XA 2AEFA 4IKAA 1B64A 5H9FJ 1RT7A 5D4PA 3CC7S 1U8WA 1IKWA 2CADA 2LDIA 3TAMB 5L1KA 4AUKA 2ADBA 1YX2A 4X2BA 2B56A 4DPYA 4YR2A 2L9WA 1RWUA 2FVSA 3IGVA 1AW0A 3BJYA 3VAIA 1M5HA 4LF9J 2JVOA 2M88A 2IBKA 5IT0A 1TUWA 4X4QA 2ALYB 1U1NA 4ZITA 2BJ7A 2WSCC 5C42B 1F0XA 3Q8PB 4UUWA 1R7IA 4AMOA 5D0HA 2HQDA 2NZ4A 2H4YB 2GVZA 2HKEA 3VZIA 4ZJLA 3CNQP 5E0OA 3MFHA 1L5UA 2RS8A 2HHSA 5AXMA 1U0HB 3I5BA 2FUG9 3I56S 4Y2IA 1OSDA 4FPRA 1S76D 3J80U 3OVSA 2FYXA 3QJPA 1X0FA 4YDXA 2FHJA 2MZSA 2C42A 2VJUA 5D4LA 1CPZA 3M8YA 4OJ3A 2MZ1A 2L3MA 4L74A 5HO4A 3BSCA 4DR5F 4ANEA 5J1NA 3MM7B 3CF5Q 3IN5A 1RB0A 4TN2A 2CPFA 2W4CA 4RW4A 4NLDA 5H1SV 4DR1J 4JP8A 3MEKA 1MMNA 1FJ7A 4TQRA 4QYZJ 3KK3A 5C2GA 4YDDB 1X4BA 2DNNA 3CD5A 4RPFA 5LSRA 4MK9A 3T5LA 3BB5A 4OMFG 4NLWA 2HFSA 1HNVA 1ZTTA 3FEXB 5B09A 3T9ZA 2HFUA 1REVB 4LSZB 1NDCA 2DR7A 5MLCV 1KVIA 1RTDA 1FE0A 5LXYA 2YWGA 1JLQA 3PXGa 3RRGA 5A8WA 2V94A 1ROFA 3GIMA 4AT1B 2HLTA 2H51B 1FA0A 4I6YA 2UVRA 4CT9A 5ITHA 3HSGA 1H0HB 4FNIA 1Q16B 2ZJRQ 3UNYA 1KVKA 1VQSA 2VQEJ 1SJQA 2B6AA 4U7CA 2RUSA 2VBXA 1VQNS 2CJ9A 2HBQB 5AE1A 2PSZA 5KFDA 1SH2A 1HNIA 4C3KA 4NZ0A 2FHOB 4Q45A 1IBCB 4Y2KA 2EFQA 3A13A 2H5IB 4HVZA 4PRFA 1DZ5A 4DX8H 3S7RA 3HT0A 4B3SJ 1B0TA 2HS3A 4C11A 3IS9B 1Z4UA 5DLFA 3CCUS 3NS5A 2Z2MA 1IN0A 4QWEA 4DV0F 5GADI 3BO4A 5B0EA 2AW0A 4QBUA 2ADCA 1OSCA 3CJ2A 4LT6A 1RABB 4JI2F 4A8QA 2GAHC 4RR5A 4R5PB 3D28A 4NZ6A 2JFDA 3GV7B 2DHSA 3BGRB 4ZPCA 5HQMA 4ZN3A 3D5MA 1Y5LB 3RB6A 4K2JA 1BY9A 3FQLA 3CIZA 3I9ZA 1EETB 4ILRA 2MSTA 1SXLA 4EZ6A 4O3NA 5IQQA 3W9IA 1C4CA 1DLOB 3K58A 5KG6A 3TZWA 2RF2B 4ZP9A 4Q0BB 1AUSL 1SJ4P 4PUOB 3W5YA 2GW8A 4OYZA 2CDQA 4BLGA 2XZTB 3QATA 1SV5B 5LMUJ 1XNQF 1VBYA 3M8PB 4XTTA 4ZVHA 1LWFB 3SCIE 2RILA 4QU6A 3R7SB 2ZNYA 2X7IA 3TVKA 1HW9A 3JSRA 5L8RC 3TQEA 1YGYA 3M6XA 4N56A 3CD6S 2KM8B 3ZZRA 3JYTB 4N76A 4B3OB 3D7SB 2WAQD 2HQ3A 2HZCA 2NCKL 1FJCA 3EM1A 2XNRA 3D0GE 1D9AA 2L48A 2A10A 2LA6A 1WDTA 1Y10A 2YWHA 2DNOA 3NRBA 3O8WA
chains in the Genus database with same CATH topology
4QBUA 4AMMA 2CUYA 3CJ8A 3HJVA 3SBMA 5DZ6A 2QJ3A 3G87A 3IM8A 3TZXA 3TQEA 3H0PA 2C2NA 2G1HA 3RGIA 4RR5A 3HHDA 4RL1A 2G2ZA 2H1YA 3K89A 4AMNA 1NM2A 3TZZA 3IM9A 2JFKA 3QATA 3EZOA 5DZ7A 2JFDA 3TZYA 2QC3A 2G2OA 4AMOA 3R97A 3PTWA 4AMPA 3BV8A 3R8YA 2G2YA 1MLAA 3TZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QBU A;  4AMM A;  2CUY A;  3CJ8 A;  3HJV A;  3SBM A;  5DZ6 A;  2QJ3 A;  3G87 A;  3IM8 A;  3TZX A;  3TQE A;  3H0P A;  2C2N A;  2G1H A;  3RGI A;  4RR5 A;  3HHD A;  4RL1 A;  2G2Z A;  2H1Y A;  3K89 A;  4AMN A;  1NM2 A;  3TZZ A;  3IM9 A;  2JFK A;  3QAT A;  3EZO A;  5DZ7 A;  2JFD A;  3TZY A;  2QC3 A;  2G2O A;  4AMO A;  3R97 A;  3PTW A;  4AMP A;  3BV8 A;  3R8Y A;  2G2Y A;  1MLA A;  3TZW A; 
#chains in the Genus database with same CATH topology
 2NPF A;  2UUB J;  3LF0 A;  4UOC A;  4X65 J;  1BGX T;  2AF6 A;  3M8W A;  4P9S A;  3U02 A;  1RTI A;  2DNL A;  5KFQ A;  3C16 B;  4ZP6 A;  5EX3 A;  2DGS A;  1CJT A;  4A8X A;  1QSY A;  4O3Q A;  3SXL A;  5DDO C;  2RB7 A;  4C0O C;  4YUD A;  4TKT A;  3UE2 A;  1NK7 A;  2VC0 A;  4J9O A;  3QLH B;  2W8L A;  2IYI A;  2R7X A;  1UCN A;  1OYD A;  3EWG A;  2DRD A;  3EDQ B;  2VA2 A;  1YJ9 S;  3M2R A;  4NML A;  2CVE A;  5GMD A;  2MKK A;  2E66 A;  2DGU A;  4B3M J;  1S6O A;  1S99 A;  4DPT A;  1UKU A;  4U8Y A;  4LIR A;  3Q0A A;  4NZ7 A;  5LT5 A;  2WZ1 A;  2EPI A;  2G13 A;  3G82 B;  1TV6 B;  1UJ6 A;  2RKI B;  2VG5 B;  1TFY A;  1X5S A;  1N5T A;  3EYZ A;  2I5J A;  5DZ6 A;  2R8J A;  1FWK A;  4H4O B;  3D3B J;  1CS4 B;  3QJJ A;  3GCX P;  3KYL A;  4LRE A;  3BQ0 A;  4DWI A;  1M5S A;  1HPZ A;  1N5Q A;  5K20 B;  4RBT A;  2AJ4 A;  4J9U E;  2DGT A;  2C2Z B;  5HAN A;  5KT5 A;  3CTR A;  2AGO A;  2M52 A;  1RHR B;  3K57 A;  1KR4 A;  3CT9 A;  3K5N A;  4ZVQ B;  3CED A;  4K0K J;  3AJD A;  1LWC A;  4AMP A;  4FF4 A;  3GPA A;  3OLA A;  5DQH A;  5ETR A;  5DG9 A;  4DS5 A;  1GXU A;  2QV6 A;  2BAC A;  2KHD A;  2QL7 B;  2E9R X;  4AE5 A;  4GKJ F;  2DIS A;  3G6Y A;  5ETV A;  2A6O A;  5BR8 J;  2L08 A;  3IAS 9;  1REG X;  5KFC A;  2CG8 A;  1F6T A;  2XYG B;  1O6X A;  5C42 A;  2J0Q D;  8AT1 B;  4MK7 A;  2AEJ A;  1R8B A;  3MD3 A;  3TRG A;  2B51 A;  2CNO B;  5F0W A;  3HVT B;  4F02 A;  1V6H A;  4MKV A;  2DRA A;  5CYQ B;  4JI3 J;  3QPI A;  2J7K A;  2DK2 A;  2R7U A;  2D3U A;  3ADA C;  3W63 A;  2OMO A;  3TUZ C;  3K5M A;  8RUC A;  4MYT A;  1QVG R;  3OJS A;  3RBZ A;  2CNL B;  2HND B;  1UWA A;  1W2I A;  2HK2 A;  4M5M A;  1RWO B;  1HBN B;  2V5H G;  4UQG A;  3M1V A;  1KEK A;  3LP2 A;  1T05 A;  1YKW A;  2ZM6 F;  2RRB A;  5AXN A;  4R0E A;  2UXD J;  4J91 A;  4RUH A;  1WEL A;  4M5L A;  3SSR A;  2A2C A;  4F3Q A;  2R2S A;  3RB4 A;  3DYA B;  2QYG A;  4MK8 A;  3UO0 A;  1YDL A;  4EUV A;  4ENO A;  2P5V A;  4GMK A;  4I1T A;  2YQ1 A;  4WP3 A;  2YPZ A;  2CQI A;  3POT B;  3L7U A;  1REV A;  2I6W A;  5GAD U;  2DNH A;  5CD4 H;  2AZ1 A;  2KXH A;  1F60 B;  1HNX F;  3CCL S;  3OPK A;  5HAO A;  4QU7 A;  3ETO A;  3QRP A;  3DDI A;  3NNH A;  4ANC A;  3VQT A;  3CCR S;  2H3E B;  1EHW A;  3CE8 A;  4FVC A;  1BWV A;  2YY3 A;  1U24 A;  2B9E A;  4ECQ A;  3QRQ A;  1NHK L;  1S57 A;  2IA0 A;  3ET6 B;  4LSL B;  4PAA A;  1YIJ S;  2ZIT A;  2ERR A;  1C0U B;  3OSP A;  1T9U A;  1NK4 A;  1FD8 A;  2Z56 B;  4HHJ A;  1QSS A;  1RHU B;  3MCM A;  4LJM A;  2DHH A;  3B82 A;  2CJA A;  5L39 A;  1HD1 A;  1YJ7 A;  5E33 A;  1WUU A;  1KD1 T;  1IBM F;  1FX4 A;  3IS9 A;  1NM2 A;  4QIE A;  2VBW A;  4M94 A;  2UV8 A;  2QG9 B;  2ZBI A;  5EWE A;  2OPP B;  3AFG A;  1WF0 A;  4HTI A;  4J90 A;  1T3O A;  2FC8 A;  4DJB A;  2G4B A;  1S6P A;  2XLK A;  2RHS B;  2PMH A;  2A6M A;  1WC4 A;  3BR9 A;  3HUL A;  4H4M A;  4FYD A;  3CUN A;  3BGR A;  1LXJ A;  2G1H A;  3H2U B;  2MEW A;  3DXB A;  1G2E A;  4DUY J;  2D3O R;  1TK8 A;  2FLO A;  4HAC B;  5IM0 A;  1EET A;  1JJC B;  3PG9 A;  4P2F A;  2BZ2 A;  1DLO A;  1S59 A;  2YH0 A;  6FDR A;  3ZZP A;  3IRX B;  4C8M A;  2WVF A;  1M1G A;  2QL5 B;  5KFS A;  1SC4 B;  3FK4 A;  4PCQ A;  1TL1 B;  4USK A;  1N48 A;  3VGT A;  2J6U A;  1VR6 A;  1SKU B;  3ZTR A;  1N8R T;  1LWF A;  1JXV A;  2ZC4 A;  4QWD A;  1CQN A;  1WKK A;  3MM5 B;  2ABY A;  1Q8B A;  1GNK A;  2XB2 D;  3M30 B;  4LR7 A;  4QQB A;  3J7Y I;  3TW0 A;  3H20 A;  4QW8 A;  3PFE A;  1SC1 B;  2YKN B;  3BM7 A;  2YH1 A;  3JYT A;  2FVQ A;  4C4W A;  5FJ4 A;  2EC2 A;  3KK1 B;  1IJF B;  4F2S A;  2MHE A;  4LUB A;  2MZR A;  3N01 A;  3T6J A;  2CPJ A;  1RT5 B;  3A8K A;  2MKH A;  3M7V A;  1R8C A;  3PYG A;  1FRM A;  3RRK A;  3H0P A;  3UDE A;  3H25 A;  1HWL A;  2P2C B;  2F4V F;  4LF6 J;  1VIO A;  2XEX A;  3FZ2 A;  3BV8 A;  4J7C A;  4LF4 J;  2X3G A;  2ZUA A;  1ZAW A;  2J8S A;  3I0R B;  2R42 A;  5DDQ C;  1NK0 A;  2UUW A;  5HQ8 A;  4F4A A;  4PWW A;  2IC3 B;  1RSC A;  2H1Y A;  3FCW A;  2KU7 A;  1X4C A;  1YBT A;  4PPZ A;  3N6M A;  4DSI A;  3DOM B;  2XWY A;  1R6Y A;  5DRK A;  4ELU A;  1AFI A;  4JI1 J;  3N6N A;  4KPY A;  2QEX S;  1UZH A;  4XDC A;  1RT4 B;  2KJW A;  2AJQ A;  2NS1 B;  2SXL A;  4TU7 A;  4LFC J;  1XNR J;  2ZBR A;  2FD2 A;  2E7W A;  3PO4 A;  5HSP A;  1UVJ A;  2E1M C;  5A0Y B;  2KHC A;  4ID8 A;  3ENA A;  1QD1 A;  2HK3 A;  3AHP A;  3MF5 A;  3KJQ B;  1LW2 A;  5D0R A;  1JJ2 R;  5C2C A;  1MSW D;  3V6J A;  3C2P A;  1RQ0 A;  2VPZ B;  4IG3 A;  3JQM A;  4C48 A;  3EMT A;  1NRK A;  2CPI A;  1BWE A;  1TV6 A;  2VG5 A;  2RKI A;  1F9F A;  3HO1 A;  1L3U A;  4LSN A;  3KDN A;  1L3V A;  2NXN A;  4U7U D;  4XK8 C;  3PW5 A;  4CLP A;  2QJ3 A;  3NS7 B;  3P4U B;  3HVR A;  1HWI A;  4DCP B;  4DR7 F;  2GX8 A;  2N3O A;  2E9T A;  3MOJ B;  1U48 A;  1UZD A;  1U02 A;  3M2U B;  3CCS S;  2ZFH A;  2DGX A;  4Q5V A;  1NB7 A;  3GCW P;  3MAQ A;  2XMW A;  4U9R A;  4JI7 J;  3CCZ A;  1V3R A;  2GHV C;  1AT1 B;  4HHH A;  2F8M A;  3DM2 B;  4B02 A;  5KFB A;  4WXW A;  2BJ3 A;  5KFM A;  1D9D A;  5FDL A;  3PR4 A;  4KE5 A;  5CYM B;  3KUH A;  1WF1 A;  2M8H A;  5ETK A;  1HQE B;  2PI4 A;  4RKU C;  1S7H A;  3K17 A;  1KHV A;  2KN4 A;  3OQ2 A;  1W7W A;  4USW A;  1XR5 A;  1NH8 A;  4NLT A;  2HHP A;  2XBP A;  4NX9 A;  1ZA2 B;  2BQU A;  5H9F K;  1V5V A;  1YLX A;  1PC5 A;  2LKZ A;  2X1G A;  3Q8Q B;  1N5V A;  3HVT A;  5CYJ A;  1CJK A;  3CD7 A;  1GX6 A;  2OTJ S;  1TKZ B;  4Z2X A;  2VOO A;  4M5D A;  3IG1 B;  4TLR A;  4BS2 A;  2ZH5 A;  1HI1 A;  1SJR A;  2V6A A;  2CPX A;  2OKQ A;  3PX6 A;  3M8R A;  2M8D B;  5D0G A;  5J2N B;  2BKN A;  1JXE A;  1S9E B;  2HND A;  4JUZ A;  2EBE A;  1XIQ A;  3GSI A;  4H54 A;  2OFH X;  4QIV A;  2IRX A;  4DV7 J;  3MMJ A;  2ZJQ Q;  2VFS A;  1FTC A;  1Q78 A;  4OLO A;  4O0N A;  2H5J B;  3A4T A;  1BQM B;  3VZH A;  1VHF A;  1QUP A;  1VBX A;  3NY0 A;  3DYA A;  2M5Y A;  3J7Z T;  1RDR A;  3M8Z A;  4AL7 A;  2NUU G;  4S0M A;  1J27 A;  4K8R A;  1WC1 A;  3H42 A;  2DGQ A;  4TLQ A;  3T5J A;  2PD1 A;  1JIH A;  2ASJ A;  4YS2 A;  2Y8W A;  2ROG A;  2DKO B;  3EXY A;  3K5L A;  5LL6 d;  4JI8 F;  4MTP A;  4FNH A;  1QDU B;  1VQY A;  5M2R A;  4L72 B;  4TQS A;  2GFF A;  1TKT B;  1G4C A;  4P6Q A;  1FES A;  4DS4 A;  1X4F A;  4N41 A;  4QYZ K;  2UP1 A;  3BDP A;  2BE7 D;  3NOC A;  3W3S A;  2J0X A;  2DO4 A;  3MM8 A;  4DFJ A;  4NEY A;  4W98 A;  2MKY A;  2R8G A;  5ETT A;  3HJV A;  4KKO B;  3IAM 9;  3D0I E;  1HR0 J;  3ET6 A;  3D6F B;  5C25 A;  1ZTW A;  4C9D A;  5I42 B;  2E29 A;  3TYT A;  3UI3 A;  3C6U B;  2QA1 A;  3HPO A;  1APS A;  2ZBQ A;  4K59 A;  4RNH A;  2G1D A;  3DLK B;  1OQ6 A;  1XMB A;  4FN5 A;  1TL5 A;  4A46 A;  3R9L A;  4DR6 F;  3W5Z A;  3JSY A;  5KFA A;  2MQQ A;  5CXT A;  4FZV A;  1GMV A;  3MPV A;  1QTM A;  3P96 A;  4OX9 F;  2GQ2 A;  3ZZT A;  2FZK B;  1D8Y A;  4P72 A;  4ECY A;  5FLX U;  4ED1 A;  4GKK J;  2OPP A;  4I67 A;  3CDB A;  4P7V A;  4DI6 A;  2DB1 A;  1S1U B;  1TKD A;  4PKD B;  4OYP A;  2DNR A;  4X4V A;  1PYO B;  2DH9 A;  1S4F A;  2DNZ A;  3TZZ A;  2BUN A;  3SFU A;  3CDU A;  3QGP A;  3CJK B;  4DPW A;  3J7A N;  2V2Z A;  5I4M A;  2KO1 A;  2KRR A;  4HAC A;  4NPO A;  3MCN A;  2KH9 A;  3H40 A;  5E41 A;  2JNJ A;  1N0V C;  2DIV A;  4ZPB A;  1RYS A;  2CQH A;  5HMW A;  4Q2M A;  4C97 A;  2MGZ B;  3IRX A;  3KTQ A;  3W61 A;  2BBE A;  1JLF B;  2J0S D;  1T9Y A;  1CC7 A;  4K4X A;  4JI4 F;  3UVJ A;  3G6E S;  4E0D A;  5HL7 Q;  1JLB A;  3J7Z 5;  1LW0 A;  4B9T A;  2O66 A;  1NDL A;  2IDL A;  3D4J A;  2DIT A;  3CCM S;  2EXU A;  3MM5 A;  2YNI B;  1VIS A;  4D3H A;  3THP A;  4YY3 F;  3MEG B;  2QLB B;  4OYI A;  3DKD A;  3BO2 A;  3NGD A;  4OYO A;  4QWA A;  3MCO A;  3TVY A;  3M2V B;  2I8E A;  2W9A A;  4J37 A;  3MUV P;  2GIF A;  2M4M A;  2WVE A;  1T11 A;  5D0E A;  3W9H A;  4RL1 A;  1H74 A;  4OJ1 A;  2XNQ A;  1RT5 A;  4HT7 A;  4PQU B;  2E5L F;  1Q0N A;  4EBD A;  1M90 T;  1TUG B;  3W8G A;  2IRU A;  2FGC A;  1MU2 A;  3MPU B;  2IVY A;  1VRT B;  2ILY A;  4OZ3 A;  5KFJ A;  4FP9 A;  4QWB A;  3SZ2 A;  2Q3P A;  3DRP B;  1DBD A;  2FY1 A;  1FJG F;  2DHA A;  2IC3 A;  5ETS A;  2HBY B;  5BYQ A;  2B9X A;  3PFO A;  5IC4 B;  4LFA J;  3PDN A;  2DT9 A;  5I3P A;  4HHU A;  1J5E J;  3CC2 S;  3GMG A;  1NAQ A;  3KJF B;  1WOR A;  4F8R A;  3SFG A;  4C8Z A;  2K2P A;  1YZ6 A;  4OI6 A;  2UUT A;  3I82 A;  1U4B A;  4B3R F;  1KHW A;  5AXK A;  1F1B B;  4CYU A;  1VQ9 S;  2MMY A;  3K0J A;  1TMM A;  1M5V C;  1VYA A;  1Y5I B;  1LFW A;  2EFV A;  2OEM A;  1OPZ A;  3HSZ A;  3QAU A;  3GJR B;  1D3W A;  5F9L A;  3A8J A;  2OPS A;  4TU9 A;  4BWJ A;  2Z58 B;  4USU A;  1N36 F;  3PRB A;  1KWM A;  1JNR B;  2PO4 A;  4KV8 A;  5J2P B;  2RE1 A;  3JB9 k;  1F5A A;  4H4K A;  4V1A k;  3E01 B;  1VMB A;  3AB2 B;  3ETM A;  1T9X A;  1X4H A;  2WW8 A;  3FBB A;  2DGO A;  2F4F A;  1N5Y A;  2OEK A;  4WBF A;  4FYX B;  2OPR B;  1RTZ A;  3GON A;  3ZFV A;  2J5A A;  3KDO A;  1MN7 A;  4L3N A;  1RU1 A;  1UJ5 A;  2BOA A;  5KFI A;  5KFY A;  3BKF A;  3V6D A;  3H5X A;  3PRV A;  1LFP A;  5E3C A;  5RUB A;  1S5Z A;  1FRL A;  4EFA C;  3DC2 A;  1I51 B;  2MQM A;  5I3Q A;  2HGM A;  1HL6 A;  2HHU A;  3PW4 A;  3R5B A;  3H4B A;  1RBO B;  2KG0 A;  3MMC B;  1HMV A;  1G7C B;  1QVF R;  1R8H A;  4WF9 Q;  4KB7 A;  4ES1 A;  4EGL A;  2XSJ B;  5CYM A;  4DUZ J;  1HQU B;  1IR1 A;  3KMS A;  2O01 C;  5F8I A;  3MTK A;  2OHD A;  2YNF B;  3TJA A;  2QA4 G;  2LP4 A;  3TX8 A;  4OX8 A;  3OXG A;  1BC6 A;  2B7C B;  4K5R A;  4KGX B;  3UNG C;  2UU9 F;  3BQ2 A;  2XLJ A;  1PYT A;  1EKS A;  2LQB A;  1HNZ F;  1SL0 A;  2UUA J;  4ZVP B;  4AXJ A;  3GU0 A;  3PX4 A;  4Y00 A;  4G3I A;  5KFV A;  3ZNJ 1;  1TKZ A;  3KJV A;  3CPW R;  1GK8 A;  3TNV A;  2GVD A;  3IR5 B;  3NXZ A;  1QUV A;  4QJV A;  1FDD A;  4Q8F A;  4WE1 B;  5FLX Y;  2VG6 B;  3CJ3 A;  2CNN B;  1U49 A;  1NJI T;  3CMQ A;  5J2N A;  4ZIV A;  5A8K A;  3MR3 A;  3X1L B;  4FYY B;  1S97 A;  1YTY A;  5KG5 A;  1S1T A;  5KOW A;  2Y8Y A;  1HLW A;  1I94 F;  4FXW A;  5C7P A;  2BDP A;  5MAO A;  2VON A;  3KHR A;  4YR3 A;  4OFZ A;  1BQM A;  4L73 A;  3SDE A;  1Q4R A;  3FEY B;  3DOK B;  2R3V A;  1M5P C;  2MQP A;  1O5J A;  2VIC A;  4B3T F;  2VQE F;  8ATC B;  3K8W A;  1S9G B;  4ZOS A;  3HSD A;  2YNH A;  4DU7 A;  3JSM B;  1XBW A;  4ZVF A;  4K5S A;  1U1M A;  4ER8 A;  1F3F A;  2AV5 A;  5FII A;  5CAB A;  3SCK E;  5AXL A;  5H9E J;  3I31 A;  4GVB B;  2DVI A;  3ILL A;  2L41 A;  1V5I B;  3V4I B;  3OL9 A;  2QX0 A;  2OUG A;  1X9S A;  4JI6 F;  1TKT A;  4ZPW R;  4TYA A;  3KG0 A;  4F7V A;  2HHH J;  3MAH A;  4HH0 A;  3IXQ A;  4QWC A;  3LQV A;  1AFJ A;  1U1K A;  4O23 A;  3WX4 A;  3NG8 A;  4DV5 F;  2FJA B;  1NEE A;  1AYE A;  1TVR A;  2ACM A;  5D6G A;  3MR6 A;  4NXN F;  1SL2 A;  2DXF A;  1RT3 A;  4ED5 A;  1JLG A;  2V63 A;  5I42 A;  3DOL A;  2ALZ A;  1IKV B;  4USV A;  4MKY A;  5B0C A;  1HYS B;  4DG1 B;  1WTF A;  1NZA A;  3KG1 A;  2IM2 A;  4RNM A;  2OI2 A;  3HHN B;  3W1Y C;  3QFH A;  2VDI A;  5F41 A;  4RJV A;  2DPJ A;  1GXT A;  1O0P A;  2XCP A;  6FD1 A;  3GTY X;  3ZTQ A;  3RTV A;  4HYK A;  2NSC A;  1H3D A;  2JSX A;  4RUC A;  2EFP A;  3GJQ B;  1VOM A;  1IQZ A;  5L46 A;  2RDI A;  4ICL A;  3AJ1 A;  4AMM A;  1HWK A;  4OIX A;  1X5T A;  1RHK B;  3UR0 A;  2WBR A;  2L9N A;  3DMJ A;  4GO7 X;  2QE5 A;  3UDC A;  1X4D A;  2C2R A;  3P45 B;  2GV1 A;  4DF4 A;  3GIJ A;  4K7Q A;  1WI8 A;  3R1L A;  1EP4 B;  1HBM B;  2DH7 A;  4CI0 B;  2MGZ A;  2ZHA A;  4PPD A;  1BXN A;  3D67 A;  2BM0 A;  3CDW A;  1IBL J;  1YJR A;  3LAL A;  1N4L A;  3N0V A;  3R2C J;  2AYM A;  1WHX A;  2DXD A;  3M6W A;  4KGV B;  5DQG A;  4ZHR A;  3PYE A;  5D15 A;  2J9D E;  1LOU A;  3BEG B;  5LMN F;  3NBP B;  4I2Q A;  5F9N A;  1ZM3 A;  3GIR A;  1TQL A;  2RDJ A;  2FJW A;  1S0N A;  4KHR A;  4OJH A;  1MRO B;  1HBU B;  2YNI A;  5KTQ A;  3HI9 A;  3UPF A;  3QMQ A;  1U1P A;  3QO9 B;  5K8N A;  2QL9 B;  4A8O A;  2UXB F;  1JLE A;  1B70 B;  4U96 A;  1QLN A;  3J81 Y;  1HFE L;  4X62 F;  2OEJ A;  3VV2 B;  2HVH A;  4LQ3 A;  1X5O A;  1HNW F;  5G4D A;  4LF2 A;  3H59 A;  2BJD A;  2W1B A;  4PQU A;  1YBA A;  3RGI A;  4NI2 A;  4ELV A;  3CJT A;  3TR5 A;  1WEZ A;  1NJX A;  2MYF A;  2HFN A;  3PJ9 A;  3F56 A;  2F9J A;  2HS0 A;  4B3M F;  4JB8 B;  2XY7 A;  3OTO F;  2KFY A;  4OZ2 A;  3WDO A;  5KT2 A;  5DM6 Q;  3KLI B;  3VAM A;  2FLL A;  1UW9 A;  3C66 A;  2DH8 A;  1H73 A;  1QE1 B;  4MYU A;  1DTQ A;  1CG2 A;  2MKI A;  1IWG A;  5LJ3 Y;  2IJN A;  1OYE A;  3P5T L;  1ZZN A;  4X66 J;  1O51 A;  1RIS A;  5HMX A;  3TEG A;  2WOM B;  2ATC B;  4RWW A;  3PR5 B;  1Q8L A;  4RO0 A;  3OV7 A;  1Q86 T;  3MMA B;  2YX7 A;  4NYO A;  4B9N A;  1FDN A;  2DNM A;  1HHQ A;  4O0I A;  1LXN A;  1N5S A;  1T9T A;  2ZUG A;  1XMO J;  1VLY A;  2C3M A;  2ZOG A;  1S49 A;  3BGU A;  4DLE A;  2HNZ B;  3FMB A;  1FXR A;  3RG6 A;  2AGQ A;  3MUM P;  3M9M B;  1HWU A;  2XG8 A;  3HHL D;  2JWN A;  2QYC A;  1C4A A;  3UDL A;  1QAX A;  3E01 A;  3DRR A;  2VPW B;  3OLB A;  4LF7 J;  2VFR A;  3BR8 A;  1S1X B;  2M2B A;  1U09 A;  2GIQ A;  3C15 A;  4PR6 A;  4NAS A;  2DD8 S;  4CDI A;  3GG1 A;  2HSE B;  3EVM A;  2Y1I A;  3VGS A;  1R31 A;  1UPP A;  4JYA F;  4CO3 A;  1AUD A;  4ILL A;  2IMO A;  3D2W A;  3P5B P;  3FGV A;  1KFD A;  4B9L A;  1N52 B;  1U47 A;  2ZD1 A;  9ATC B;  4DPX A;  2ILZ A;  1FFG B;  1URN A;  5EWF A;  2XMJ A;  3LPY A;  1HD0 A;  3TAP A;  1O8B A;  3MMC A;  3KNG A;  3OXF A;  2DR6 A;  1FKP B;  4WFB Q;  2U2F A;  2OML A;  2LXI A;  2WCX A;  2DYA A;  1HQU A;  3FRZ A;  2GVZ B;  2HBR B;  1Q95 G;  2OPQ A;  4FF2 A;  3TX0 A;  3A12 A;  1VJW A;  2YNF A;  1SPB P;  1RCX B;  2QA4 S;  3HHK A;  2XS2 A;  2C3Y A;  4LIW A;  4F3M A;  4IR9 A;  4F25 A;  4WZM A;  4TNO A;  1JLA A;  1C1C A;  1UET A;  2GA7 A;  3RB3 A;  4DV3 F;  2HFO A;  2NXE A;  4C3L A;  1WDD A;  3R7B B;  2ASD A;  4DMZ A;  2WB4 A;  4TY8 B;  3R5D A;  4CLF A;  2DY1 A;  4RW4 B;  1WJ9 A;  3MDF A;  4MIB A;  4KRW A;  1K8A T;  3LP1 B;  4QIG A;  2OD6 A;  4UZC A;  4WJB A;  2LQJ A;  4LBP A;  1WG1 A;  4PG7 A;  3BSO A;  2DHG A;  2PI5 A;  2R7V A;  1DTT B;  2P6S A;  1JX4 A;  1X4G A;  1KFS A;  5KFO A;  2IAJ B;  4O4G A;  3HP6 A;  2EI5 A;  4NCA A;  1JLC A;  3PNI A;  4JV5 F;  4B9M A;  1HNV B;  3CB4 A;  3DOK A;  3LH2 S;  3MM6 B;  4ZPA A;  3TO8 A;  3KJN B;  1U6Z A;  1LK5 A;  4O4R A;  1S9G A;  3QGG A;  1JLQ B;  2YWF A;  5F8L A;  2LDY A;  1VQK S;  1QSL A;  5GME A;  4EU0 A;  2AX1 A;  3P3D A;  4GVB A;  4ZLL A;  3VAG A;  4K4T A;  3GG0 A;  1IUJ A;  2BA9 A;  1B7Y B;  1UP1 A;  3V4I A;  4KAI A;  4DR3 F;  4QYR A;  2XHW A;  5HN0 A;  2B6A B;  3VHQ A;  2B8P A;  4CH1 A;  4BC7 A;  5B08 A;  4OHV A;  1S0V A;  2HNY A;  4DL4 A;  2W2Q P;  2WTF A;  2IMW P;  1T8E A;  1HNI B;  3UWT A;  2BW7 A;  2GNK A;  3TAQ A;  3DU6 A;  4ED2 A;  3MD1 A;  4C8O A;  3ITH A;  2UXC J;  4CH7 A;  5J1E A;  2ZC3 A;  2XHC A;  2FLN A;  2BJ1 A;  3DN9 A;  2JOQ A;  3RBE A;  2VB6 A;  1FE4 A;  3FEZ A;  5LM7 E;  1IKV A;  2MSS A;  4X4S A;  3TP2 A;  2C2E A;  3KMQ A;  1DAR A;  4YP3 A;  4OL8 A;  1HYS A;  1JMT A;  2KFN A;  2R7R A;  3Q86 A;  4ZN1 A;  3JXO A;  1N0U A;  3KWM A;  3HK2 A;  1RA6 A;  3IR6 B;  1D0E A;  4FS2 A;  1FKO B;  4ZCK A;  5A8R A;  2XC9 A;  4NWB A;  1WI6 A;  2V8D A;  1VBZ A;  1BQN A;  4K4V A;  4I7F A;  5T7L A;  4DV0 J;  3PHE A;  3CGI A;  4HDH A;  1C2P A;  2X1F A;  3R97 A;  4MIW A;  2V4J B;  1TL7 B;  3ILO A;  3FFI B;  5HVH A;  2LEC A;  2MQL A;  2XI3 A;  4JI2 J;  3SSS A;  2D74 B;  3AQO A;  4WTY A;  3OTD A;  2C2D A;  1EP4 A;  1GH8 A;  1JJH A;  1HBM A;  3H98 A;  5CAA A;  1FEH A;  1FK9 A;  1JK9 B;  2AJ0 A;  3OTC A;  2J9C A;  3Q8Y A;  1FNX H;  5L1I A;  3GWC A;  4RWX A;  4DV1 F;  3W8P A;  3PCO B;  2V9W A;  3IGN A;  3MCS A;  1SCJ B;  2QTW A;  2N4C A;  2C1E B;  2XMV A;  2JDJ A;  2HQG A;  3GV8 B;  4DCO B;  3KUG A;  1LEO A;  4IRD A;  1TTH B;  2RAQ A;  1XNQ J;  2W9B A;  2COL A;  4F4Y A;  2PFF B;  1CVJ A;  4AQY F;  1FCA A;  2W9C B;  3NLC A;  4B9V A;  1VRU B;  2AU0 A;  2ZKU A;  1HQ2 A;  1PSD A;  2NSB A;  4AFF A;  2B7B B;  3LAK A;  4DBQ A;  1U26 A;  4QPX A;  1VK3 A;  2IRY A;  5U47 A;  1CJT B;  1WF2 A;  1OS5 A;  2J8A A;  2YKP A;  4CLT A;  1WD6 A;  3T9N A;  4NMX A;  3KLI A;  4DFM A;  4Z37 A;  1Y3J A;  1NJY A;  1D09 B;  3EDR B;  2RIJ A;  3OL8 A;  2JEF A;  2IA6 A;  2Q79 A;  1RWP B;  1W2B R;  3ZZ0 A;  2GC8 A;  2C3P A;  4RLE A;  4OHY A;  4F3O A;  3MGJ A;  4UQT A;  1A7G E;  4DR4 J;  2H48 B;  4XDD A;  4K50 A;  2EKN A;  3Q8R B;  2HNZ A;  5GAE I;  4DPU A;  1GQE A;  2I5J B;  4WU2 A;  4USI A;  1NSK L;  1RWX B;  3DRS A;  3GIK A;  1HPZ B;  2AYB A;  1S12 A;  1VQL S;  2DR9 A;  4OI1 A;  5L9X A;  3THT A;  3N4W A;  4I0W A;  3PW7 A;  2XUL A;  1RWW B;  4J9K A;  2QC3 A;  2Y1L B;  2GHW A;  3B4M A;  2VH7 A;  1LWC B;  3TQ1 A;  1F2H A;  4ECR A;  3A8I A;  3R5G A;  1IR0 A;  5KAK A;  2IVF B;  1JWW A;  4OX7 A;  2CJQ A;  1DHM A;  5DDR C;  4QOT A;  2JLF A;  1ZAX A;  5LOQ A;  4H4K C;  4NLU A;  1PC4 A;  4WFZ A;  2ZZN A;  1ZM2 A;  1GMW A;  1SUQ A;  4JI0 F;  1U6F A;  1FKP A;  2GAG C;  4FYV B;  3ISN D;  1S72 S;  3ILI A;  3MAA A;  4C8N A;  3T19 A;  3TA2 A;  2W25 A;  2BW2 A;  3MR2 A;  4GKJ J;  5B0D A;  5AE3 A;  2LVW A;  3AD7 C;  3MEE B;  3CO0 P;  1QJH A;  3Q89 A;  3VGU A;  1NHV A;  4IG0 A;  2VZ8 A;  3KLH B;  1T0T V;  4MFB B;  5K5M A;  4ZKA A;  3OFG A;  2PDA A;  2NZC A;  4ZLP A;  4TY8 A;  4B9S A;  3DGP A;  3QT5 A;  1ZPW X;  1YQH A;  3QT6 A;  3RYL A;  3M1V B;  5HJY A;  4DCJ B;  3LP2 B;  1T05 B;  2Y0S D;  1XMQ F;  3LWM A;  5EN1 A;  3BBB A;  3LP1 A;  1D8Z A;  2RUG A;  2AEM A;  2RSQ A;  1P8G A;  3KHL A;  4LQ9 A;  1KQG B;  1DTT A;  3H2L A;  5A6W A;  5EDW A;  3CWJ A;  4NLG A;  4F04 B;  1GX5 A;  2Z57 B;  2IAJ A;  4PEO A;  1FKA F;  2DNG A;  2K7J A;  4J9S A;  2ZM6 J;  2KXF A;  1NCL A;  2VKZ G;  5KFN A;  1G3O A;  4ALZ A;  3BS9 A;  1IKX A;  3O3L A;  3MM6 A;  2MXY A;  4BCA A;  1WEY A;  1PIL A;  3EZO A;  4DZ6 A;  4URG A;  5D3G B;  4CM0 A;  2CQB A;  4WKR A;  5D8H B;  1SC6 A;  1H72 C;  1U6B A;  4X4N A;  3VR1 A;  1HW8 A;  3QZ7 A;  4OI3 A;  4RW8 A;  5HMZ A;  4B08 A;  1Y9O A;  5B0G A;  4Y2A A;  1KBR A;  1S1V A;  2CYY A;  1KLM A;  1HNX J;  4BHQ A;  1RT2 B;  1Z2L A;  5DQI A;  4P74 A;  3EXC X;  3D66 A;  2PMW A;  2W4P A;  5CHC B;  2EVZ A;  2IDE A;  5CQG A;  2MKJ A;  2EC0 A;  1T95 A;  2F9D A;  2B4U A;  1EQM A;  4DQR A;  3WIV A;  1RTH B;  2FDN A;  3DLG B;  5D78 A;  2ZKT A;  1AB8 A;  4P75 A;  5H9E K;  4AD6 A;  3V4M A;  2W01 A;  4F2R A;  2NXJ A;  3MR7 A;  1X7V A;  2ZEJ A;  3R3T A;  1FHT A;  4AL5 A;  2YWE A;  1UEV A;  2DCU B;  4KFB A;  1KS2 A;  2B4V A;  1SI9 A;  4YOE A;  4KIA A;  3LAN A;  1SL1 A;  3OW2 R;  1S6P B;  1FKO A;  3OUY B;  3VAL A;  1IBM J;  4H4M B;  4WK3 A;  4DSL A;  1WKL A;  4ED0 A;  2LMI A;  4I68 A;  2VBZ A;  2BE9 B;  1S1W A;  3IMQ J;  3KLF B;  1X9W A;  1RAF B;  3ENQ A;  3MED B;  4M5J A;  5DET A;  5IM0 B;  1N33 F;  2EKY A;  1F5B A;  1TK0 A;  1ZBT A;  5I3U B;  2V4J A;  1TL7 A;  3FFI A;  2R8I A;  4P7T A;  3MTJ A;  1DQ9 A;  2YKM A;  4N8N A;  2UVW A;  4IH5 A;  2C3U A;  1RZM A;  4LVN P;  4J9R A;  4ECV A;  1FD2 A;  5FD1 A;  2JHE A;  4AMN A;  3DDN A;  5E2Q A;  1LWE A;  3PX0 A;  1Y3K A;  3UCZ P;  1I5O B;  5J2M A;  4ZDN A;  3E8O A;  2EFG A;  2FIU A;  2RRA A;  2H54 B;  2WHO A;  4OX6 A;  4ZVG A;  1PCA A;  2V2K A;  3R27 A;  1NDK A;  3JTN A;  2E7X A;  3LWL A;  2IPO B;  2LCW A;  4RNN A;  2W4D A;  1UTA A;  3BF4 A;  4J9L A;  1VCT A;  5E7O B;  3FDS A;  3N6L A;  2Y1R I;  2LQ8 A;  3BKT A;  3G71 S;  1NKE A;  5K8O A;  5GAE U;  4F36 A;  3FBC A;  2R7O A;  4DFK A;  4PZV A;  3NKY A;  3V81 B;  2HAI A;  4ZPV R;  4F4K A;  2W9C A;  1VRU A;  4KR0 B;  1TK5 A;  1QAJ A;  3R6L B;  1CC8 A;  5A6P A;  1HBO A;  4OYA A;  5CD4 A;  2YQ0 A;  3UN5 A;  3KUE A;  5K9F A;  4NCB A;  2B43 A;  3FCV A;  4ZIW A;  3MXH P;  2IM1 A;  4X4P A;  2HW3 A;  1KLN A;  3NGK A;  1PJ7 A;  2BXJ A;  3W65 A;  4ID5 A;  1N32 F;  4DQS A;  4FPI A;  1UW4 A;  2F4V J;  2AWZ A;  3DLE B;  5K8M A;  4LF8 F;  1SIW B;  3K7R A;  5F8G A;  1VQM S;  1TFW A;  3DXS X;  2J6S A;  1NND A;  2F65 A;  3QGH A;  1ZA1 B;  4O3P A;  1FVS A;  4FBT A;  2XSF A;  4NRU A;  2AYG A;  1WC5 A;  3MEC B;  4OZ5 A;  1UMJ A;  3LW5 C;  1LW2 B;  2BQR A;  4DX5 A;  3QJL A;  4J9N A;  5D77 A;  3MI7 X;  3D1O A;  4WTO B;  2CPZ A;  3CCE S;  4IG3 B;  1PGZ A;  1GMW D;  1YRX A;  2C2O B;  3LP0 B;  2BX6 A;  3NNA A;  1UEK A;  1OO0 B;  2R4F A;  4LSN B;  1P1T A;  4D3G A;  1C0T A;  4M5G A;  2D41 A;  5KFX A;  3CDE A;  2QA2 A;  2F5G A;  2LA4 A;  4DX7 A;  4LR8 A;  1A9N B;  3RAX A;  2E5G A;  3ZTP A;  3VAH A;  3M9N B;  3US5 A;  3DI6 A;  3W2W B;  4ES2 A;  2V67 A;  3GP9 A;  4ZK7 M;  4C0B A;  1RT1 B;  4FF1 A;  3QWP A;  5HQL A;  1VI7 A;  1RHQ B;  4PWD B;  3Q83 A;  4G65 A;  4F0K A;  5FDL B;  3BGF A;  4DR7 J;  1XJW B;  2AKW B;  2N4D A;  3MZI A;  3I0S A;  4AND A;  2BKP A;  5KG4 A;  2D3Z A;  3TAN A;  1N34 F;  3FQK A;  3HX9 A;  3M32 A;  1CLF A;  5KT3 A;  1VDH A;  4UST A;  5KT7 A;  4RW7 B;  1M5O C;  2JX2 A;  2Y9H A;  5JXS A;  3HD2 A;  1U25 A;  2A0F B;  2C2K B;  5IC6 B;  1CJK B;  1KP6 A;  1FWL A;  5F8N A;  1E6V A;  3KK2 B;  3MEE A;  1I3O B;  4OYX A;  3QT8 A;  1T3N A;  4M5D B;  4BC9 A;  5KG0 A;  2JVR A;  3NEK A;  2Z2Y B;  2ZNZ A;  3KLH A;  4F4W A;  4MFB A;  4I64 A;  1P9Q C;  4AYB D;  3OBI A;  1TU0 B;  3JSB A;  4OQJ A;  1WSV A;  3OR1 A;  2HWT A;  3EUN A;  2MY7 A;  1X4A A;  1VK8 A;  2QZ8 A;  2B3T B;  3DFE A;  4DHV A;  3GJS B;  4LBH A;  3RAM A;  4TVA B;  5C5J A;  4N7T A;  4RW9 A;  2V68 A;  4CM2 A;  1DQA A;  2X51 A;  3CD0 A;  4DL7 A;  3QZ8 A;  4M8L A;  3D9B A;  3PKM A;  4WYL A;  2KI2 A;  4YN3 B;  3AY0 A;  3C3L A;  1YI2 S;  4C8K A;  3C46 A;  2DHX A;  3N79 A;  2B0G A;  1B4S A;  5KFW A;  5CZV A;  3G87 A;  5D3G A;  5HI7 A;  4IQM A;  1Y5N B;  3T5H A;  3A3N B;  2Q6C A;  2Q43 A;  4DV2 F;  1UFL A;  3PJW A;  1XER A;  1F3V A;  3R6G B;  1CJU B;  2LFV A;  3MM8 B;  1S77 D;  2M7S A;  5E5N A;  2LU2 A;  4X4U A;  4NYP A;  3B6B A;  1WAC A;  3C8Y A;  4JI8 J;  3ZZO A;  5C25 B;  3AAW B;  1C1B A;  4IH6 A;  2GQQ A;  1RT2 A;  1S6Q A;  1YJT A;  1MWQ A;  3AJ2 A;  1CBK A;  1EAR A;  3Q23 A;  1WC3 A;  3PZP A;  2MTL A;  1UPM B;  2WSF C;  3RR8 A;  4OI0 A;  2F7V A;  2ATL A;  2ASY A;  2VL1 A;  3OT9 A;  1RTH A;  5IT4 A;  3DLG A;  5DS7 A;  3FVY A;  2CQ4 A;  1BHN A;  4DPO A;  3TWZ A;  4DV6 F;  1N6Q B;  2J0W A;  2QLJ B;  2QMX A;  1PAU B;  3MOZ A;  3M8Q A;  5ETQ A;  3RB0 A;  5LSL A;  3MPY A;  4DR6 J;  3FMW A;  2B9Y A;  4MT1 A;  2ZBP A;  4YR0 A;  3OD2 A;  3KLG B;  2AGP A;  4IO9 Q;  1CSJ A;  3Q2S C;  3IBF B;  3OUY A;  1UVI A;  4DSE A;  1WHW A;  4OX9 J;  2POK A;  4RW6 A;  2CQP A;  4Y3C A;  4ZLN A;  2RH3 A;  3KLF A;  3MED A;  3ENW A;  2XS7 A;  2YX4 A;  4DZD A;  1RAJ A;  5I3U A;  3HXM A;  1EX8 A;  4PAB A;  1VQO S;  1ZZF A;  3VTI A;  1ZM4 A;  2CJB A;  5DZ7 A;  1RTJ B;  1UAW A;  4O3S A;  2MZQ A;  3WC0 A;  1MWY A;  4MIA A;  4ZVE A;  4NOH A;  3FSY A;  4Y6I A;  4B17 A;  3UVJ B;  1YG0 A;  1DJ0 A;  1M0S A;  5HBM A;  2K1R B;  2MQ8 A;  4LF5 F;  4ZMM A;  1JLB B;  4IQX A;  2HHV A;  1LW0 B;  1RKJ A;  1N56 A;  2GJ2 A;  7FDR A;  2NPI A;  2FHM A;  4QW9 A;  2FZC B;  1S10 A;  1UA0 A;  1TL3 A;  4I56 A;  2BEF A;  3SV3 A;  1IBK F;  1FT8 A;  3B54 A;  4JI4 J;  3IBC B;  2RQ4 A;  4WFN Q;  2LU1 A;  1K47 A;  2ZHO A;  2YPY A;  3HZG A;  4DFP A;  1IM4 A;  3M8S A;  1X5P A;  4DEZ A;  2KKH A;  5B0F A;  2BAN A;  2GO9 A;  3V6H A;  3T1Y F;  3I96 A;  2OIH A;  3FKB A;  2J76 E;  4YY3 J;  3V81 A;  1U45 A;  1MU2 B;  4RUB A;  4PXB A;  1T7P A;  1GFW B;  3PTW A;  4FBU A;  2CJX B;  4I6A A;  2OLW A;  2QMW A;  4KHP F;  1SQF A;  3ZNU A;  5KFP A;  4Y0F A;  4DQI A;  3JTO A;  1E6Y A;  2RML A;  2NYH A;  2E5L J;  3LOU A;  2W2O P;  3D6H B;  3KHH A;  1V9O A;  2HPU A;  4OZL A;  3DLE A;  1L3S A;  2LEP A;  4K4Z A;  4WP9 A;  3KXD A;  3OHB A;  1HI0 P;  1RAE B;  4X84 A;  3HFK A;  2Y3Y A;  4CYU B;  3M6V A;  2HIQ A;  3UW1 A;  1Q5V A;  1PBU A;  4U6P A;  1FJG J;  5GAG U;  5HLF B;  3UR3 C;  5IT9 U;  4IOC Q;  3DLB A;  2GQC A;  2HRU A;  4NRT A;  1Q82 T;  2XMU A;  3UCU P;  3NWG A;  5SZT A;  3R5C A;  2OPS B;  4O44 B;  3MEC A;  3EPI A;  4KV8 B;  4P52 A;  4UW2 A;  1Q81 T;  3C19 A;  1RI7 A;  4F50 A;  1ICE B;  4B3R J;  2QFI A;  4JI5 J;  2R7Q A;  4CIO A;  4YHH J;  3T5K A;  5AE2 A;  4WZQ A;  5EUH A;  1Q8K A;  3LP0 A;  1DFD A;  1N5Y B;  3H4D A;  2P6T A;  5KFE A;  1YHQ S;  3DRX A;  3M4X A;  1MLA A;  3S1T A;  2XCA A;  1N36 J;  1D1U A;  4L6V 3;  4WII A;  3V6D B;  2JJ4 D;  1RBL A;  4K4Y A;  1R0B G;  5HRO B;  3W2W A;  3PY8 A;  1VC5 A;  1GTE A;  3DRY A;  1TZ0 A;  4E98 A;  4ETX A;  5JUM A;  3G8T A;  1RT1 A;  3JQK A;  2YXL A;  4E2F B;  2HYI B;  4PWD A;  4OV6 A;  4XO0 A;  3P8B B;  4FKX A;  1HMV B;  2QIF A;  2V8G A;  5KFU A;  5M2P A;  1NHU A;  1FI4 A;  4V19 J;  2LQ9 A;  1YSJ A;  3O5T B;  2Z2L A;  5AT1 B;  3FC9 A;  3HHL B;  1FRH A;  2X1A A;  2VQF J;  1KOO A;  3UFC X;  5IWA F;  2CQ2 A;  2MPU A;  3V2U C;  2QLF B;  2K3I A;  5J2Q A;  2I1R A;  1OIA A;  2BYC A;  2BV3 A;  2CWX A;  4NLX A;  4M63 A;  1MMD A;  5BJR A;  2V0N A;  3NGS A;  3MM9 B;  4RW7 A;  5E3R A;  3SMZ A;  5K14 A;  3KJV B;  4DR2 F;  1DY3 A;  3KK2 A;  3U7J A;  2GVD B;  2MHN A;  1GMU A;  3RU0 A;  3L7O A;  3MR5 A;  2K06 A;  2QO3 A;  1NKC A;  2Z8Q A;  3OFH A;  4U7U K;  4YQW A;  2UU9 J;  2FVR A;  3NAH A;  3SQG A;  5A8K B;  1HNZ J;  1Z1Z A;  4W92 B;  1XN9 A;  3NWR A;  3OR2 B;  1S1T B;  2MLY A;  3GYG A;  4JBC A;  1QAY A;  4IUF A;  4ZCL A;  2WB1 D;  3UD5 A;  2ZE2 A;  4CLY A;  2KZZ A;  4BWM A;  4BDP A;  3B78 A;  2FJB B;  3SDE B;  2UV8 G;  2HQI A;  1S6U A;  3A1Y G;  2DPI A;  3PEH A;  2HWI A;  4EO6 A;  1EJ7 L;  4AXI A;  4ERD A;  1GXL A;  4GRS A;  2V9K A;  5GAH I;  2C2M B;  4G1Q A;  4RU2 A;  4F0M A;  3C6T A;  1W25 A;  3FSI A;  4HT5 A;  1VQ6 S;  2KT5 A;  1XTZ A;  2YNH B;  4WXO A;  2QGF B;  4EBC A;  2I38 A;  1I94 J;  1NLK L;  4QR0 A;  3DHX A;  2HHX A;  1RP5 A;  2VU5 A;  3RW7 A;  3BPD A;  1LV5 A;  3F41 A;  2CAJ A;  2W24 A;  4R8U B;  3R2D J;  2ZDO A;  1SQG A;  3S01 A;  2UXC F;  5ETN A;  2ZBC A;  5KT4 A;  4NXM F;  4B3T J;  4C2M A;  3T6B A;  1BUX A;  2BVZ A;  3L7P A;  4DV4 F;  3I87 A;  3ISZ A;  2OO4 A;  3DDK A;  4XPE A;  3GII A;  1CJU A;  3CDA A;  3NNC A;  3FRY A;  1VFJ A;  3U1N A;  1TVR B;  3NCP A;  4DSK A;  3I5A A;  1DAX A;  2YTC A;  4FDF A;  1RT3 B;  3VVT A;  1JLG B;  1L3T A;  3VWS A;  2IM3 A;  4JI6 J;  1T9W A;  3FBE A;  3BDE A;  1S79 A;  3T1H F;  4F4X A;  4I69 A;  3DOL B;  1GAO A;  1NZ8 A;  1TKX A;  1RAO A;  4CTA A;  1MG7 A;  3ENV A;  4FVM A;  1FF2 A;  2F1F A;  4DV5 J;  4PYA A;  3I6P A;  2PA8 D;  5AJ3 F;  4NXN J;  2UUC F;  3B8H A;  4LRB A;  3IC1 A;  2XMK A;  3G6V A;  5DG7 A;  1CJV A;  2KT3 A;  1S48 A;  1N6Q A;  3R5A A;  3BYP A;  3MPD A;  2NR0 A;  1FRJ A;  3E51 A;  1KKH A;  3DU5 A;  4KPC A;  3FJ2 A;  2PE8 A;  4CLU A;  4ZJO A;  1RAD B;  2VPX B;  3CVK A;  4ICL B;  3KLG A;  2KJV A;  3QID A;  5CZC A;  2BMB A;  5IT9 Y;  2CQG A;  1EAY C;  4ED4 A;  3DMJ B;  3CJS A;  1D9F A;  2AHO B;  3HMJ G;  3C14 A;  2FJX A;  1VQ5 S;  1YRU A;  3NGT A;  1S0O A;  4DU8 A;  4DQQ A;  3BH6 B;  3H2V E;  3IA0 A;  1U7L A;  5E3Q A;  1IJE B;  2EEY A;  3AA9 A;  3W64 A;  3L4B C;  4X4O A;  5HP1 A;  1ACM B;  1RTJ A;  2HFZ A;  2YWK A;  3LUY A;  2G9O A;  3L9Z A;  3LGM A;  2CNK B;  4ZHR B;  2AJ1 A;  1RHJ B;  4HLB A;  4MKA A;  2HEK A;  3CJ0 A;  2K1R A;  1SKW A;  2ZH3 A;  2EG2 A;  4I2Q B;  4FF3 A;  4IFV B;  2HLU A;  1DUR A;  3R1H A;  4X4T A;  4URQ U;  4Q7A A;  3EVW A;  3H5Y A;  3AXM A;  4NLO A;  1FFW B;  2DBB A;  1P27 B;  4USM A;  1JLE B;  4DL3 A;  2LXF A;  5IFM A;  4IDK A;  2CUY A;  3HF5 A;  4LFB F;  1KN6 A;  3HT3 A;  5LMN J;  3AD9 C;  2AD9 A;  2W7P A;  1EZZ B;  4NI2 B;  3LGN A;  4EBE A;  3PYD A;  1YJV A;  2OTL S;  3ELH A;  9RUB A;  3J80 Y;  2UXB J;  1ZYQ A;  3G6X A;  2LLZ A;  2O1P A;  1Q53 A;  2Z4P A;  2DO0 A;  3BN7 A;  4X62 J;  4IYQ A;  2XS5 A;  4NLR A;  4DR4 F;  1HNW J;  2BJ9 A;  2YKA A;  3LPE A;  1DTQ B;  2DTJ A;  4U8V A;  4HKQ A;  2KYZ A;  4QZV B;  2ZH9 A;  2UVU A;  4OJG A;  2FVC A;  1SC3 B;  2G2O A;  3MWB A;  4EI2 A;  2HHT A;  2FVP A;  1UWB A;  5HK4 A;  3Q8S B;  5KFT A;  3NMR A;  2KXN B;  3RAQ A;  2RQC A;  2H4W B;  2GCF A;  4LR9 A;  3PYF A;  3OTO J;  1SH0 A;  4PQA A;  4IFY B;  4A8S A;  2ASL A;  5HLF A;  2E7V A;  2BJ8 A;  4Z7C A;  4TY9 A;  2PMZ D;  2Q6B A;  4DL0 C;  4O44 A;  2QSW A;  2E5I A;  4OZ1 A;  4QCL A;  3BQ1 A;  4CNY A;  1F5C A;  1B3T A;  3NL0 A;  3WZ0 A;  1EIY B;  5L38 A;  2KVI A;  1FO1 A;  3DRR B;  1UVK A;  3THV A;  1A0O B;  4LF9 F;  3BBF A;  2WW4 A;  3BKU A;  4CWB A;  2ZH8 A;  3C15 B;  1WC0 A;  2OSR A;  4KO0 B;  2BJE A;  2FHJ D;  2DNP A;  3CJ5 A;  1LK7 A;  2PEH A;  3ZC4 A;  3TAM A;  1YZ7 A;  1R3N A;  4I6W A;  5HRO A;  1NK9 A;  1SB6 A;  3ZTO A;  2FTR A;  3SCJ E;  4BBY A;  1J5O B;  4KH0 B;  3QNW B;  2AP6 A;  2ZD1 B;  3TOQ A;  1TAU A;  2H5E A;  2AJF E;  3NP5 A;  3AA8 A;  3OVA A;  1VQ7 S;  4F4Z A;  4ZVR B;  3J81 U;  2LEB A;  5KFL A;  3HHE A;  4ZCI A;  4JYA J;  5F3T A;  3BPS P;  4UF4 A;  2XM3 A;  3AH6 A;  3HHL A;  3EGV A;  2YKO A;  1X0P A;  1I1G A;  3ZO7 A;  5GAH U;  2N7C A;  3E3X A;  2RU3 A;  4CO2 A;  2OPQ B;  3BH7 B;  1U0H A;  3TUP A;  2NYI A;  3DGV A;  5ETP A;  2Q1L A;  1K1Q A;  2FJD B;  4ZCM A;  1HI8 A;  1WWH A;  1S0M A;  4KGM A;  4KH1 B;  4DR1 F;  2DRB A;  5ADZ A;  1JLA B;  1K0T A;  1C1C B;  2L9D A;  1Y4Z B;  3RZA A;  2XTJ P;  3MM9 A;  4C98 A;  3BGL A;  3TZX A;  5DJB A;  1CUL B;  1OY9 A;  2JZ5 A;  1ZS6 A;  1KON A;  3MM7 A;  3BBC A;  2R7T A;  5HVG A;  2R2U A;  1OQ3 A;  1MN9 A;  3L3C A;  5KG3 A;  1RUS A;  2KZM A;  3K89 A;  4DV3 J;  3OR2 A;  4NLV A;  1FFS B;  3GYX B;  4RNF A;  2R7W A;  3OTE A;  1F9E B;  1YIT S;  1NK8 A;  3I9V 9;  4O4G B;  5HJX A;  4A8Y A;  1JLC B;  2HVD A;  3J7A 1;  5LXR A;  3VQS A;  1NK5 A;  2R2R A;  2RS2 A;  1FER A;  2HRY A;  1UA1 A;  3A3O B;  1KQS R;  2KDO A;  4LRF A;  4NE9 C;  1XK8 A;  3EGZ A;  2DJW A;  4CT8 A;  2OJ3 A;  2JFK A;  3SQO P;  2V69 A;  4A4J A;  1BLU A;  4ITS A;  4CRJ A;  2WVB A;  4UOG A;  4CLL A;  4TU8 A;  1FNM A;  3CXC R;  2DXE A;  4R8U A;  2AQ4 A;  4JV5 J;  1SQE A;  3SEO A;  1QM9 A;  2ZH1 A;  3ZZU A;  2FJV A;  5F8M A;  3UDV A;  3G8S A;  4B3S F;  3LGH A;  1ITP A;  3TEH B;  4KSE B;  4XIU A;  2HZV A;  5KFR A;  2HNY B;  2Z0G A;  4X64 J;  5HMY A;  3AQP A;  2E5H A;  1EQ0 A;  5L9N A;  1TEL A;  4NLP A;  4Q2L A;  2DNK A;  5DDP C;  3ITH B;  5J1E B;  1ZPV A;  2R7S A;  2CQ3 A;  4DR3 J;  4Q43 A;  3T41 A;  5ETM A;  3G9C A;  3GFY A;  4YFU A;  1VGY A;  4G1I A;  1WOO A;  3NGU A;  3N9U C;  1SJF A;  2HFV A;  3U1M A;  4M1K A;  4OV1 A;  3PIP Q;  2VDH A;  1VS3 A;  2ZZT A;  2J9D A;  4OHW A;  2X3D A;  2HVE A;  2ZZM A;  1RWK B;  2JEG A;  2B5J B;  2W7A A;  4UUX A;  1U8S A;  3VCD A;  1KRP A;  5JJB A;  5EGY A;  2B9W A;  1GEH A;  5A8R B;  4R5P A;  1Q7Y T;  1RAC B;  2RD5 C;  5A2Q U;  4DL5 A;  2B4P A;  1T94 A;  1RAI B;  2WVC A;  1OY8 A;  2FC9 A;  4EYI B;  1RWM B;  5F0U A;  1BQN B;  4ZS6 A;  2IHR 1;  5LMU F;  4K2X A;  1B0P A;  1ZAV A;  4ZA1 A;  3UD4 P;  4I7F B;  5T7L B;  3SIP B;  2UVV A;  3HM9 A;  4UTG A;  1JKH B;  1YVF A;  1YWX A;  5E3P A;  3ZZY A;  4WIQ A;  3PM9 A;  2G0I A;  2RF2 A;  2HMI B;  1X8D A;  2V4Q A;  1RCO B;  4Q0B A;  2YQ3 A;  1VQP S;  3NCQ A;  2LXU A;  3HJF A;  1MWZ A;  4PUO A;  4HTJ A;  4ECX A;  2CQD A;  4R25 A;  2JEI A;  1SV5 A;  3M8P A;  4U95 A;  3MPW A;  1FK9 B;  2N82 B;  2VPY B;  2EFO A;  3VAK A;  1NXI A;  1SJ3 P;  4C6A A;  5CZX A;  2XZW A;  2UUB F;  4PYD A;  1JJ4 A;  4X65 F;  4B3O A;  4IFV A;  3GFX A;  2XO6 A;  4JV1 A;  2CPH A;  3W5X A;  2JEJ A;  1LWX A;  3CCW A;  2VAS A;  1K44 A;  4MJK A;  2W9B B;  1HHT P;  3D6T B;  4Y34 A;  1X60 A;  3EJM A;  4RNO A;  5IXU A;  4GVL A;  2HQF A;  2HHW A;  4GC6 A;  4DV1 J;  1R27 B;  2MDA A;  1U1R A;  3P49 B;  2ZOF A;  1FRX A;  1UJ4 A;  2RU9 A;  4LVO P;  3C16 A;  3G8Q A;  3HDS A;  4OYB A;  3H5U A;  2I9S A;  2W2M P;  1FVQ A;  2XGP A;  2P9E A;  1QAI A;  4E8U A;  3QLH A;  4AQY J;  2K7K A;  1WC6 A;  3OFE A;  3KLV A;  2CA9 A;  2CVI A;  2BR0 A;  4CLK A;  3CCJ S;  3D0H E;  2D69 A;  3CCQ S;  1Q7L B;  1WG5 A;  4ED6 A;  4CO5 A;  3HSJ A;  3W60 A;  3W62 A;  1H2T Z;  4IFY A;  4OI4 A;  3CJR A;  2W7O A;  1H2V Z;  1K9M T;  3GR1 A;  3G82 A;  2P8I A;  3HHD A;  2DNY A;  2CRL A;  3NMA A;  4K0K F;  4EWT A;  4H4O A;  3CW2 C;  1CS4 A;  3GFH A;  2RHQ B;  2CZV C;  1K1S A;  1R8A A;  3DRS B;  2J6T A;  1RJJ A;  4I2P B;  4DL2 A;  1RLC L;  5KOX A;  3CCV S;  2M70 A;  4KBI A;  3CJ4 A;  1UL3 A;  4N47 A;  5BR8 F;  1Q1K A;  2C3O A;  5ETO A;  3QBC A;  2F3J A;  4KO0 A;  2VG7 B;  2D9O A;  3IFE A;  4J9P A;  2GS8 A;  1NPR A;  4DUT A;  2MLZ A;  3RR7 A;  4IOB A;  1L3K A;  1Y11 A;  2HGL A;  3ZTS A;  3M9O B;  1H2U X;  3FCH A;  5IV4 A;  3M05 A;  4RU9 A;  1J5O A;  2G0C A;  3OL7 A;  4JI3 F;  3OSN A;  4EYH B;  1P9Y A;  2PN6 A;  4ZPD A;  2Z30 B;  1PJ6 A;  1SUQ B;  3Q2T C;  3LO3 A;  1FRI A;  4EEY A;  4DF8 A;  2PEB A;  2VZ9 A;  2XZD B;  2CQ0 A;  4LBI A;  4UY8 T;  2ROP A;  4N77 A;  2KB2 A;  2VIH A;  2V2V A;  4F0H A;  2FJE B;  3MAA B;  3BN4 A;  3DNC A;  4DDF A;  2XMA A;  2AT1 B;  2M0G B;  5CYQ A;  3T3F A;  3L95 X;  3CCT A;  2EK1 A;  1OMS A;  4JI0 J;  2UXD F;  3KOA A;  1KTV A;  3BO3 A;  1K73 T;  3N5B A;  3X3U A;  5J1P A;  3GB0 A;  4IG0 B;  4A48 A;  1OY6 A;  5GMK a;  4KHM A;  4C3M A;  4WK1 A;  4LRA A;  2I0X A;  2OEL A;  2O5D A;  5THW A;  4HL9 A;  4ED8 A;  1CUL A;  4PXE A;  4Y65 A;  2XYP B;  1IM6 A;  1HBN A;  2DEI A;  4XPC A;  3DGP B;  2IFX A;  2BRK A;  2QT7 A;  1X9M A;  3HFV A;  4NA3 A;  5A2Q Y;  4ZLJ A;  3QSY B;  1VQ8 S;  1KQK A;  2QRR A;  3RUB L;  1YK9 A;  3WHI A;  3PVX A;  2FPH X;  2H9Z A;  5HVF A;  2V2Q A;  4OZJ A;  3V5R A;  3KNA A;  1VHI A;  2PC6 A;  3QFW A;  4NLY A;  3EGW B;  3RBX A;  1MNE A;  2U1A A;  1KC8 T;  4DR5 J;  4Y2C A;  1PJ5 A;  3Q8V A;  3WX8 A;  2UZA A;  3EIC A;  3ONQ A;  1XMQ J;  3POT A;  2MZJ A;  2FQQ B;  1G1X A;  4L3K A;  1QTN B;  2D3O 1;  2WBM A;  1TMJ A;  1IKX B;  3F73 A;  5A76 A;  1YJN S;  4P2S A;  7FD1 A;  3EZ5 A;  2GIR A;  1XEZ A;  1FTR A;  4PG4 A;  3VAF A;  2JC1 A;  1WHY A;  2XY6 A;  2HVZ A;  2BRL A;  5KG7 A;  4RW8 B;  4K4U A;  2CDR B;  4USH A;  2WK4 A;  4LF1 A;  1S1V B;  3D1Q A;  2BQ3 A;  2ZH4 A;  1KLM B;  3H5S A;  4LSL A;  2MB0 B;  1SKS A;  1C0U A;  2V8V A;  4WCE Q;  3HVW A;  4YEA A;  4P2X A;  1RAA B;  3JAM U;  2IBO A;  4KY3 A;  3D1H A;  3KFW X;  3UCG A;  2IIH A;  1IKY B;  4PWU A;  1KOH A;  2V34 A;  4WPA A;  4WKY A;  3TA1 A;  3MHY A;  2K8G A;  4ECZ A;  1ZM9 A;  2F40 A;  1VJQ A;  2YKQ A;  4NCG B;  5KFZ A;  3DHW C;  1M5K C;  5M2U A;  5BYR A;  2M3D A;  1JNZ B;  4RUA A;  3BYR A;  1PG5 B;  1RK8 A;  3J7Y U;  1TL4 A;  5F3Z A;  4DUY F;  5CCM A;  3IBW A;  4UY8 5;  5B7W A;  1RXO B;  3O2I A;  2P9G A;  3PEJ A;  4FYW B;  4KFB B;  3O1L A;  1OWX A;  2B5J A;  2VFV A;  3ULH A;  2CQC A;  5L1J A;  1FJE B;  3MUT P;  3IR7 B;  4HH1 A;  4KTQ A;  3MUR P;  3I4H X;  5JMN A;  3W2V B;  1JQG A;  1S1W B;  2RDD A;  2Y0B B;  3PW2 A;  2HUR A;  2A1B A;  5K8P A;  1SH3 A;  4LRD A;  1NJZ A;  3PO5 A;  1NK6 A;  4RBV A;  1JKH A;  2B8Q A;  3AD8 C;  3K5P A;  3NAI A;  4UT4 A;  2WSE C;  3IWN C;  1FWP A;  2YKM B;  4EMD A;  4WU3 A;  2KTQ A;  2HMI A;  3I5C A;  1IQT A;  1FX2 A;  3AOD A;  3D54 A;  1TL1 A;  3GR0 A;  2PGC A;  1KDN A;  4UOF A;  2QMU B;  1LWE B;  3RRH A;  1RYR A;  1N33 J;  4NEZ A;  3F44 A;  2AMC B;  5J2M B;  4FXV A;  3PW0 A;  3D68 A;  4V19 X;  4M5N A;  3VF0 B;  2NRE A;  3M30 A;  3JTP A;  1R89 A;  4LF6 F;  2XGQ A;  2W8K A;  4LF4 F;  2J9E A;  2YKN A;  3K2Y A;  4DOZ A;  4X4R A;  3AOA A;  3ILJ A;  3KK1 A;  2EWH A;  3L09 A;  2BKO A;  4O3O A;  2PT0 A;  4U67 Q;  4CNZ A;  3CJ8 A;  3BZQ A;  4JI1 F;  4OZN A;  3TI0 A;  2B4O A;  1KTQ A;  3I0R A;  4LFC F;  2CFX A;  3A8E A;  1XNR F;  1G6B A;  1HBO B;  4NYZ A;  1KQF B;  3D6M B;  1IXK A;  1DQ8 A;  3IO1 A;  4YB1 P;  1JXL A;  3DOM A;  2A18 A;  4DLG A;  4ID5 B;  1S7I A;  4RX6 A;  3PHT A;  2J7W A;  1RT4 A;  3QQC D;  4QR2 A;  4JI5 F;  4YHH F;  1XWL A;  2D9P A;  1RHM B;  4ES3 A;  1YJW S;  4JOU A;  4KGK A;  5A0Y A;  3ICL A;  3U27 A;  2KT2 A;  4M5H A;  2AZ3 A;  2WRM A;  2YNG B;  1P1L A;  5C24 B;  1N32 J;  2DIU A;  3KHG A;  4Q8E A;  4YB6 A;  2NLW A;  4LF8 J;  2VFT A;  3E2E A;  4M95 A;  3TA0 A;  4OLP A;  5KFH A;  3QSI A;  2CPE A;  2DNQ A;  2JRS A;  1H7W A;  4JI7 F;  1C0T B;  2FZG B;  1WKJ A;  3IRW P;  4I2P A;  2BAB A;  2BE2 B;  5KG1 A;  2FB0 A;  2VQF F;  2F63 A;  4CO4 A;  2R9L A;  4HEA 9;  3Q24 A;  1RKI A;  3M2U A;  3QYY A;  3D3C J;  3DI6 B;  2VG7 A;  5B0B A;  2IVM A;  3HKW A;  3TJ8 A;  3VVU A;  4PXD A;  1V3S A;  4ATN A;  4WFA Q;  4M5K A;  1J2V A;  3DM2 A;  1U2R A;  1OPI A;  3WIU A;  2AYE A;  3G96 A;  4OHX A;  4QIF A;  3FNN A;  3AOB A;  1BMQ B;  2MZT A;  3IM9 A;  4N8O A;  5KFF A;  3CC4 S;  3VGV A;  2GO8 A;  1HQE A;  2WON B;  3I0S B;  2LEA A;  2KRB A;  1YJU A;  4L75 A;  1Q5Y A;  1K0V A;  2JLE A;  3NOG A;  1NPK A;  2ZOM A;  3M32 B;  5KT6 A;  3JAM Y;  2BM1 A;  3SI8 A;  4IOA Q;  2V50 A;  4LRC A;  3OJU A;  4Y28 C;  2RQM A;  4LMZ A;  1S4E A;  4C7Q A;  1EKR A;  4DSJ A;  4DV7 F;  3RBD A;  2KVQ E;  2QSF A;  2G2Z A;  3W7B A;  3HLU A;  1E6V B;  3V6K A;  1N34 J;  3IG1 A;  1HA1 A;  4KC5 A;  4PG5 A;  4KQZ A;  3P6Y C;  1FXL A;  3NCR A;  2NUH A;  5GVQ A;  2HHQ A;  2IYG A;  1S9E A;  2RJZ A;  1EB0 A;  3QWU A;  4YB5 A;  3OR1 B;  2HBZ B;  2OSQ A;  3WC2 A;  1HIY A;  3HHL C;  1XR7 A;  3TVZ A;  2HG4 A;  4QPT A;  5DGB A;  1MW7 A;  2ZVI A;  3CSK A;  4WP8 A;  5L1L A;  4WWS A;  1PAE X;  5DG8 A;  1N88 A;  1PO6 A;  2PFD A;  3R8Y A;  4IRC A;  2W2P P;  4CP5 A;  3HZE A;  4G6V B;  1H7X A;  4TYB A;  3DLH A;  4RW9 B;  4P2M A;  2FY8 A;  1V3Z A;  3PKY A;  3TZY A;  1ZH5 A;  2D7S A;  3O44 A;  4KYZ A;  1W26 A;  2X1B A;  4CLZ A;  1BQX A;  4GO5 X;  1HR0 F;  1F2G A;  3S8S A;  1Y7P A;  1LQ9 A;  2CPY A;  4DXL A;  1WOS A;  1T03 B;  5B0A A;  3BSN A;  4EZ9 A;  1R8P A;  2V8P A;  4KT0 C;  1WNE A;  3DCA A;  1AZS B;  2N3L A;  1YRT A;  1NSA A;  2E1C A;  1FEE A;  2ACY A;  4WYW A;  1LNQ A;  3OVB A;  3BGO P;  1B0V A;  1NKB A;  1VBK A;  3GQC A;  4ZJQ A;  2RQK A;  4KKO A;  2N7Y A;  3M6U A;  4ECW A;  2DR8 A;  2ZVS A;  3R5J B;  2FLP A;  2EG1 A;  3JQJ A;  4DN9 A;  1C1B B;  1XQI A;  1S6Q B;  5LJ5 Y;  2HVI A;  3Q22 A;  2O3D A;  2XY5 A;  3C6U A;  3W66 A;  7AT1 B;  5EX0 A;  4URS A;  4GKK F;  1OJ4 A;  1WTB A;  3DLK A;  4DV2 J;  1R0A B;  1NU4 A;  1UVN A;  1IKY A;  3PV8 A;  3KLE B;  2OD4 A;  3S6E A;  4ECU A;  1GTH A;  4NCG A;  2GHP A;  2A2D A;  3EE3 A;  2DEJ A;  1NBE B;  4NLS A;  3G86 A;  5KFG A;  1PKU A;  3M8Q B;  1VC6 A;  2F8E X;  1R6V A;  2XYH B;  2XI2 A;  2QLW A;  4IRK A;  1S1U A;  4IH7 A;  1R43 A;  1RLD A;  3QGI A;  2JL9 A;  1RT6 B;  4C0H A;  1SVD A;  3JS9 A;  3OFF A;  4RW6 B;  5CA5 A;  4DV6 J;  1Y00 A;  1BD6 A;  4UZB A;  3W2V A;  3CJK A;  6AT1 B;  1ARO P;  5CH7 B;  3GZ7 A;  2BOP A;  1SKR A;  2CXE A;  3GFZ A;  3VAJ A;  4WFY A;  1ZOT A;  3FUY A;  2CG4 A;  1NH7 A;  4OI2 A;  1RE1 B;  4ED3 A;  1JLF A;  2MKS A;  3QIP B;  1X31 C;  2E44 A;  2F8H A;  2QLX A;  1RAH B;  2D1C A;  1DRZ A;  2GMJ A;  4DX6 A;  3GLJ A;  1U2C A;  5HBM B;  4A8M P;  2HIY A;  2YX1 A;  1IVZ A;  4AL6 A;  2HZA A;  2CJK A;  3G2X A;  3H90 A;  3MMB B;  1Q8I A;  3KG4 A;  5IV3 A;  3MEG A;  1B7F A;  3HVA A;  1TL3 B;  5EWG A;  3PIO Q;  2VC1 A;  2NXC A;  3M2V A;  4ZVU B;  2XQC A;  1KSP A;  5JVG Q;  4UOH A;  2V8H A;  1UFK A;  2CZ4 A;  1AA1 B;  4OYM A;  4J5O A;  1VLO A;  4DSF A;  4LF5 J;  2MJU A;  3HCX A;  4LFA F;  4FS1 A;  1HAR A;  2A3J A;  1J5E F;  2BAN B;  1WSR A;  3J81 j;  1UFW A;  2ZJP Q;  4A8W A;  1KNZ A;  1VRT A;  3SSQ A;  3FZB A;  3GV5 B;  3K5O A;  3OHA A;  2VHG A;  2MY8 A;  2P9C A;  3DRP A;  1IBK J;  1U1L A;  2OH2 A;  4KGZ B;  2E1R A;  4WFX A;  3DLJ A;  1E6Y B;  2OAU A;  1H98 A;  1N54 B;  2CWK A;  3O6Q A;  1TR0 A;  3OL6 A;  2VJV A;  2KM8 C;  3RJM B;  2O67 A;  2GGP B;  4ECS A;  3T1Y J;  1HWJ A;  4CZC A;  3I32 A;  2VBY A;  2JC0 A;  1I6J A;  3HKZ D;  3U1L A;  2LYV A;  3TUJ C;  5F8J A;  5G0R B;  4G1P A;  1HHS A;  3OTB A;  1IR2 A;  4HI1 A;  4KHP J;  4O3R A;  3EVO A;  3KKF A;  4CO1 A;  4J9M A;  3N5F A;  1U1Q A;  3GYN A;  3UN2 A;  2IY5 B;  2GMH A;  4TXS A;  2YNG A;  5J2P A;  1SBR A;  5C24 A;  3AXK A;  3TUI C;  2VOD A;  2KFZ A;  3GSD A;  5BXI A;  2R2T A;  1Y0H A;  3ZXW A;  3TAR A;  1VIX A;  1P6T A;  2ZH7 A;  2VOP A;  3UQS A;  2GJI A;  2OPR A;  1RT7 B;  1XC9 A;  1URR A;  3NS6 A;  2WVD A;  2C22 A;  3WQP A;  1ULR A;  1WG4 A;  2BE2 A;  1IKW B;  4F67 A;  4OHZ A;  3IP0 A;  1WEX A;  4J9V A;  1FNO A;  1QY7 A;  2VFU A;  4DUZ F;  1NB2 A;  3H7H B;  2HAF A;  3TJ9 A;  2E1A A;  4ZPT R;  2ROE A;  4P71 A;  3QT7 A;  2H65 B;  4J9Q A;  3AOC A;  2ZWP A;  1U2F A;  2CIM A;  4NA2 A;  4ZP7 A;  2VD3 A;  1H6K X;  2UUA F;  3SCL E;  2FGO A;  2R8K A;  2XSJ A;  5CZD A;  2NXU A;  4XAK A;  2MQO A;  2WON A;  5JVH Q;  3OXL A;  1SIZ A;  1CEZ A;  5GAG I;  3CIM A;  4C8L A;  4P10 A;  4R0J A;  1NO8 A;  3R7N B;  4QIW D;  5J2Q B;  3BSA A;  5F8H A;  1TAQ A;  1ZET A;  4CH0 S;  3BRE A;  1M1H A;  1MML A;  1UVM A;  2GML A;  5E3A A;  5K14 B;  4ELT A;  3LA0 A;  1NUE A;  5IWA J;  4L76 A;  5KFK A;  2RVJ A;  2PII A;  1GT8 A;  2EK6 A;  4EK2 A;  4USJ C;  4WE1 A;  2DCL A;  2DR5 A;  2EW9 A;  2VG6 A;  4C8Y A;  5D4O A;  5SUH A;  3CUL A;  2AIR B;  3SQG B;  3GIL A;  2YVS A;  1LKZ A;  4CQ1 A;  2DGV A;  2ZH2 A;  3QRR A;  3KK3 B;  2G0J A;  3H8Y A;  5T14 A;  1U1O A;  5IQ6 A;  1TUV A;  2APO A;  4DR2 J;  2ZE2 B;  5EHH A;  3GE9 A;  4IO1 A;  4Q44 A;  2VA3 A;  2E9Z A;  3SBM A;  2OP5 A;  4A8F A;  5DM7 Q;  4DQP A;  4PG6 A;  3K59 A;  1TP7 A;  2DGW A;  2CZ9 A;  2KG1 A;  2XO7 A;  1UVL A;  2R8H A;  1PBA A;  3N28 A;  1RTD B;  2ZWO A;  1RGV A;  4G1Q B;  2G2Y A;  2HHH F;  3C6T B;  3W9J A;  4NL5 A;  4ZVT B;  4ED7 A;  2HRT A;  4X64 F;  3JSM A;  5A8W B;  2JH3 A;  2VV5 A;  2YBV A;  1S9F A;  5D4N A;  2XMM A;  5ETL A;  4NA1 A;  5HAT A;  1F9H A;  2E5J A;  4HI2 A;  3AB4 B;  1PIE A;  2FHK A;  1T03 A;  2HS4 A;  2MQN A;  2GJF A;  2HGN A;  1AZS A;  1NSP A;  3F0N A;  2DY9 A;  3ISN C;  4MH8 A;  2Y1J A;  3PJX A;  4GC7 A;  3I55 S;  4B9U A;  5DGA A;  2ZHB A;  3CJQ A;  2VUG A;  3SV4 A;  4A8K A;  2IJR A;  2CJY B;  4NXM J;  3UD3 P;  2IJF A;  4NLQ A;  4C11 B;  1XR6 A;  4HDG A;  1U0S A;  4ETZ A;  4DV4 J;  3SYZ A;  1R0A A;  1TKX B;  3EPG A;  3RW6 A;  4N5S A;  2QFJ A;  4CTA B;  2XLI A;  4DG1 A;  4ECT A;  4F26 A;  3KLE A;  2CQ1 A;  4FXD A;  1SJ1 A;  1X4E A;  1VRQ C;  2MKC A;  1KVJ A;  1YBU A;  4I4B A;  1CJV B;  1R0C B;  1ELO A;  3T1H J;  3IWX A;  4CCH A;  4JV0 A;  2V4R A;  4K4W A;  4Y2M A;  1AXQ A;  2LQ5 A;  1JB0 C;  2GZO A;  1NPP A;  4HR2 A;  1WOP A;  1RWV B;  2C2N A;  4MMO A;  4A47 A;  5BYS A;  5AJ3 J;  2NQP A;  3AT1 B;  2ZH6 A;  1VQ4 S;  1UEU A;  1RT6 A;  1CQM A;  1IBL F;  2UUC J;  2AJ2 A;  4ZVS B;  4W4M A;  1RAG B;  3C14 B;  3QAE A;  1VC0 A;  2Z2Z A;  1FXD A;  1NJW A;  4OZ0 A;  2J7U A;  2EFN A;  2JLG A;  3ZZZ A;  1RU2 A;  3CME S;  3T1A A;  2HWH A;  1FDA A;  3DLL Q;  4ZVO B;  2XMT A;  5HP1 B;  2QN6 B;  2YWW A;  3NGR A;  3MFI A;  3Q8U A;  3A3P B;  3QIP A;  1NME B;  4EO8 A;  5T41 A;  3FSX A;  3PRD A;  3NBP A;  5CCL A;  4DN0 A;  3K8V A;  2E1P A;  1BE4 A;  2IM0 A;  3CMA S;  5IS2 A;  4QR1 A;  2RNE A;  4PG8 A;  1MRO A;  1HBU A;  3MMB A;  4K4S A;  4CLS A;  1PYS B;  4DL6 A;  5IOL A;  5DO2 A;  3QO9 A;  2EBG A;  2VKR A;  4JV2 A;  3PAC A;  4P73 A;  4IDK B;  2PA3 A;  4W90 B;  4YME A;  3LTO A;  3EZU A;  4ZP8 A;  1T9V A;  4IR1 A;  1Z2Z A;  4X66 F;  1RTI B;  2I2Y A;  2ZDP A;  2RRN A;  4OYW A;  3HFZ B;  5DLG A;  3EGN A;  2KYX A;  3HD1 A;  2VF3 A;  4LFB J;  1Q79 A;  2MLX A;  1QE1 A;  1RBA A;  4MKB A;  4RZR A;  4YB7 A;  1XMO F;  5LSO A;  2Q66 A;  2GGP A;  2W2N P;  4CO0 A;  2CKW A;  4FKY A;  1FRK A;  2WOM A;  3UN3 A;  2K3K A;  3M2R B;  2AX0 A;  1M1K T;  3B4D A;  1WHV A;  1UWB B;  3EX7 B;  4Z7Y A;  1HKA A;  3MMA A;  5G0R A;  3WBZ A;  1NSQ A;  1T02 A;  1RWN B;  3I4P A;  5KG2 A;  4LF7 F;  4MAK A;  2CPD A;  2XWX A;  2HQC A;  4ILM A;  3IM8 A;  4M5I A;  2OFG X;  3FBF A;  3IWL A;  5IZH A;  1FDB A;  3LAM A;  4CLW A;  3GJT B;  1B99 A;  2MJN A;  1H38 A;  4KJI A;  3G4S S;  1A6L A;  1IWA A;  2M9K A;  2KL8 A;  2OGU A;  4PXC A;  2C28 A;  1RA7 A;  2RT3 A;  4RBU A;  1NDP A;  3CO9 A;  1S1X A;  2AEF A;  4IKA A;  1B64 A;  5H9F J;  1RT7 A;  5D4P A;  3CC7 S;  1U8W A;  1IKW A;  2CAD A;  2LDI A;  3TAM B;  5L1K A;  4AUK A;  2ADB A;  1YX2 A;  4X2B A;  2B56 A;  4DPY A;  4YR2 A;  2L9W A;  1RWU A;  2FVS A;  3IGV A;  1AW0 A;  3BJY A;  3VAI A;  1M5H A;  4LF9 J;  2JVO A;  2M88 A;  2IBK A;  5IT0 A;  1TUW A;  4X4Q A;  2ALY B;  1U1N A;  4ZIT A;  2BJ7 A;  2WSC C;  5C42 B;  1F0X A;  3Q8P B;  4UUW A;  1R7I A;  4AMO A;  5D0H A;  2HQD A;  2NZ4 A;  2H4Y B;  2GVZ A;  2HKE A;  3VZI A;  4ZJL A;  3CNQ P;  5E0O A;  3MFH A;  1L5U A;  2RS8 A;  2HHS A;  5AXM A;  1U0H B;  3I5B A;  2FUG 9;  3I56 S;  4Y2I A;  1OSD A;  4FPR A;  1S76 D;  3J80 U;  3OVS A;  2FYX A;  3QJP A;  1X0F A;  4YDX A;  2FHJ A;  2MZS A;  2C42 A;  2VJU A;  5D4L A;  1CPZ A;  3M8Y A;  4OJ3 A;  2MZ1 A;  2L3M A;  4L74 A;  5HO4 A;  3BSC A;  4DR5 F;  4ANE A;  5J1N A;  3MM7 B;  3CF5 Q;  3IN5 A;  1RB0 A;  4TN2 A;  2CPF A;  2W4C A;  4RW4 A;  4NLD A;  5H1S V;  4DR1 J;  4JP8 A;  3MEK A;  1MMN A;  1FJ7 A;  4TQR A;  4QYZ J;  3KK3 A;  5C2G A;  4YDD B;  1X4B A;  2DNN A;  3CD5 A;  4RPF A;  5LSR A;  4MK9 A;  3T5L A;  3BB5 A;  4OMF G;  4NLW A;  2HFS A;  1HNV A;  1ZTT A;  3FEX B;  5B09 A;  3T9Z A;  2HFU A;  1REV B;  4LSZ B;  1NDC A;  2DR7 A;  5MLC V;  1KVI A;  1RTD A;  1FE0 A;  5LXY A;  2YWG A;  1JLQ A;  3PXG a;  3RRG A;  5A8W A;  2V94 A;  1ROF A;  3GIM A;  4AT1 B;  2HLT A;  2H51 B;  1FA0 A;  4I6Y A;  2UVR A;  4CT9 A;  5ITH A;  3HSG A;  1H0H B;  4FNI A;  1Q16 B;  2ZJR Q;  3UNY A;  1KVK A;  1VQS A;  2VQE J;  1SJQ A;  2B6A A;  4U7C A;  2RUS A;  2VBX A;  1VQN S;  2CJ9 A;  2HBQ B;  5AE1 A;  2PSZ A;  5KFD A;  1SH2 A;  1HNI A;  4C3K A;  4NZ0 A;  2FHO B;  4Q45 A;  1IBC B;  4Y2K A;  2EFQ A;  3A13 A;  2H5I B;  4HVZ A;  4PRF A;  1DZ5 A;  4DX8 H;  3S7R A;  3HT0 A;  4B3S J;  1B0T A;  2HS3 A;  4C11 A;  3IS9 B;  1Z4U A;  5DLF A;  3CCU S;  3NS5 A;  2Z2M A;  1IN0 A;  4QWE A;  4DV0 F;  5GAD I;  3BO4 A;  5B0E A;  2AW0 A;  4QBU A;  2ADC A;  1OSC A;  3CJ2 A;  4LT6 A;  1RAB B;  4JI2 F;  4A8Q A;  2GAH C;  4RR5 A;  4R5P B;  3D28 A;  4NZ6 A;  2JFD A;  3GV7 B;  2DHS A;  3BGR B;  4ZPC A;  5HQM A;  4ZN3 A;  3D5M A;  1Y5L B;  3RB6 A;  4K2J A;  1BY9 A;  3FQL A;  3CIZ A;  3I9Z A;  1EET B;  4ILR A;  2MST A;  1SXL A;  4EZ6 A;  4O3N A;  5IQQ A;  3W9I A;  1C4C A;  1DLO B;  3K58 A;  5KG6 A;  3TZW A;  2RF2 B;  4ZP9 A;  4Q0B B;  1AUS L;  1SJ4 P;  4PUO B;  3W5Y A;  2GW8 A;  4OYZ A;  2CDQ A;  4BLG A;  2XZT B;  3QAT A;  1SV5 B;  5LMU J;  1XNQ F;  1VBY A;  3M8P B;  4XTT A;  4ZVH A;  1LWF B;  3SCI E;  2RIL A;  4QU6 A;  3R7S B;  2ZNY A;  2X7I A;  3TVK A;  1HW9 A;  3JSR A;  5L8R C;  3TQE A;  1YGY A;  3M6X A;  4N56 A;  3CD6 S;  2KM8 B;  3ZZR A;  3JYT B;  4N76 A;  4B3O B;  3D7S B;  2WAQ D;  2HQ3 A;  2HZC A;  2NCK L;  1FJC A;  3EM1 A;  2XNR A;  3D0G E;  1D9A A;  2L48 A;  2A10 A;  2LA6 A;  1WDT A;  1Y10 A;  2YWH A;  2DNO A;  3NRB A;  3O8W A; 
#chains in the Genus database with same CATH homology
 4QBU A;  4AMM A;  2CUY A;  3CJ8 A;  3HJV A;  3SBM A;  5DZ6 A;  2QJ3 A;  3G87 A;  3IM8 A;  3TZX A;  3TQE A;  3H0P A;  2C2N A;  2G1H A;  3RGI A;  4RR5 A;  3HHD A;  4RL1 A;  2G2Z A;  2H1Y A;  3K89 A;  4AMN A;  1NM2 A;  3TZZ A;  3IM9 A;  2JFK A;  3QAT A;  3EZO A;  5DZ7 A;  2JFD A;  3TZY A;  2QC3 A;  2G2O A;  4AMO A;  3R97 A;  3PTW A;  4AMP A;  3BV8 A;  3R8Y A;  2G2Y A;  1MLA A;  3TZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...