3TZXA

Crystal structure of a fragment containing the acyltransferase domain of pks13 from mycobacterium tuberculosis in tetragonal apo form at 2.3 a
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
465
structure length
465
Chain Sequence
PELPGVTEEALRLKEAALEELAAQEVTAPLVPLAVSAFLTSRKKAAAAELADWMQSPEGQASSLESIGRSLSRRNHGRSRAVVLAHDHDEAIKGLRAVAAGKQAPNVFSVDGPVTTGPVWVLAGFGAQHRKMGKSLYLRNEVFAAWIEKVDALVQDELGYSVLELILDDAQDYGIETTQVTIFAIQIALGELLRHHGAKPAAVIGQSLGEAASAYFAGGLSLRDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIREVFSDFPDLEVCVYAAPTQTVIGGPPEQVDAILARAEAEGKFARKFATKGASHTSQMDPLLGELTAELQGIKPTSPTCGIFSTVHEGRYIKPGGEPIHDVEYWKKGLRHSVYFTHGIRNAVDSGHTTFLELAPNPVALMQVALTTADAGLHDAQLIPTLARKQDEVSSMVSTMAQLYVYGHDLDIRTLFSRASGPQDYANIPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and structural study of the atypical acyltransferase domain from the mycobacterial polyketide synthase pks13
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Polyketide synthase PKS13
total genus 179
structure length 465
sequence length 465
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3tzxA02
3.40.366.20 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 3tzxA01
3HJVA 3CJ8A 2C2NA 3TQEA 3H0PA 4RL1A 3G87A 3IM9A 3TZZA 1MLAA 3IM8A 4AMNA 3R8YA 5DZ7A 3K89A 3TZYA 4RR5A 2CUYA 3TZXA 3TZWA 3QATA 3PTWA 3BV8A 4AMOA 3SBMA 4AMPA 3HHDA 3RGIA 2G1HA 3R97A 3EZOA 2G2OA 2QJ3A 2JFDA 4QBUA 2G2ZA 2G2YA 2H1YA 1NM2A 5DZ6A 2QC3A 4AMMA 2JFKA
chains in the Genus database with same CATH superfamily
3V81B 3D5MA 4I2QB 1H2TZ 2Q3PA 1Q16B 5ETMA 1TL1A 3JAMU 1FKPA 3MM7A 2ZH8A 5KFPA 3MM6B 1BMQB 1VRTA 2LMIA 3MEGB 1UZHA 3KTQA 5KFIA 1S77D 2DCLA 2ZE2A 3UN5A 2H5EA 4AE5A 3V2UC 4MFBB 3PACA 4F3MA 2GC8A 2Z30B 4NLVA 3KLGB 1U45A 4P7TA 4J9LA 3HD2A 4DEZA 4IRCA 1OSCA 3IGVA 4P52A 1NK8A 5C42A 3QNWB 5CYMB 3RB0A 3P96A 1ZS6A 4Z37A 4DFJA 3M8QB 2NR0A 1UZDA 2CNOB 4OJ1A 4LBIA 2B0GA 3I31A 4DF4A 3A1YG 1KWMA 1FCAA 2GVZA 2ALZA 5GADI 2FVPA 2GIRA 4QWBA 2DXEA 2DRAA 3D0GE 5DO2A 4JI2J 4NXMF 1WI8A 4PQAA 3GYNA 1URRA 3HKZD 1KHWA 3PHTA 2Y1LB 3QRRA 2UXDF 1WHWA 2C42A 1HIYA 1LXJA 1M5KC 2ZOFA 1BUXA 1S6QA 4AL5A 1RT3B 2CIMA 5KAKA 1WG1A 2I1RA 4A8XA 2E7WA 3BO4A 3UNGC 1TV6A 1OO0B 2KYXA 1EKSA 2MMYA 2YNFB 1CQNA 3D6FB 1MW7A 2G2OA 4X4VA 4QR0A 4PXEA 3ET6B 3FNNA 5DLGA 1NJYA 2X51A 1REGX 4ZITA 2HS4A 2OPQB 3HVTA 1GXLA 1IKYA 1TKZA 3V6DB 2IRXA 2K7JA 3CJRA 1I6JA 1WHVA 4ED4A 1DRZA 2M8HA 2BJ3A 2LVWA 2XS5A 4TXSA 5KFXA 1X4CA 3DLJA 2XMVA 3N5BA 5H9EJ 1T9WA 2EFNA 1JXVA 1TR0A 2VPZB 4NZ6A 1PAEX 3SIPB 1E6VA 5LSOA 2Y1JA 5KFQA 3KOAA 5HJXA 4C7QA 4UOGA 3ELHA 2UV8A 4QW9A 2GO8A 1HNXF 2HK3A 1HI8A 3QJPA 1KBRA 5IC4B 1IWGA 4QWDA 2IBOA 2QA2A 1ZTWA 1TKZB 3DKDA 3KJVA 3EMTA 1TL7B 1UA0A 3CD0A 4EGLA 5CXTA 1NLKL 2KRRA 2HNDB 4Q0BB 1UMJA 3BGUA 2IC3A 3ENQA 1GT8A 4LREA 4OLOA 1FNMA 1Q4RA 3E01A 2YKNA 4ZCLA 1W2IA 3SXLA 3UDLA 3J80Y 2ALYB 4AD6A 4ETZA 2RU9A 3V6HA 3HSZA 1FD8A 3O6QA 3UE2A 2CJBA 2V9WA 1RWWB 3HDSA 3M2RB 4NLOA 1VHIA 4DJBA 1QVGR 2FC9A 3TVYA 2MJNA 3OXFA 4USTA 2UXBF 1QD1A 1P27B 4I2PA 4QYZJ 5DQGA 2BANA 3GZ7A 2AYBA 3RYLA 3SFGA 3HHLB 4C97A 3PM9A 3ILJA 3FJ2A 4K4ZA 4BHQA 2VA2A 4FXWA 4AXJA 5T14A 5HANA 4PQUA 1MNEA 1VJWA 2LQ9A 2VL1A 1HBOA 4RBVA 2P6SA 3OD2A 1WDTA 2W2QP 3M1VB 4CO1A 3G6YA 2QZ8A 2K1RB 3MUMP 5DRKA 2DJWA 4DV4J 3H2LA 2JOQA 1EETB 2GGPA 1HQUB 4ZIWA 3EZ5A 2MQPA 2GAHC 3FFIB 5FDLB 5DZ6A 6FDRA 1N6QB 4LF9J 2AJQA 4J9QA 2XHWA 2V34A 4X4TA 1JLBA 3OUYA 1B7YB 1U6ZA 1Y7PA 2NXEA 1OQ3A 4HI2A 3H40A 2W9BA 3FMWA 3H25A 4XK8C 2LEBA 1EARA 2KTQA 2HMIA 4ICLB 4IOCQ 1RP5A 5KFUA 1QAIA 4ZP7A 1DLOB 2DNGA 2XO7A 1XNQF 2R7VA 1KP6A 1ZAVA 2G1DA 3V81A 1C1BA 3BN4A 1MSWD 3IWXA 4C2MA 1PIEA 1NKCA 4C8ZA 2CNNB 1Q8LA 5HROB 3QT8A 4WCEQ 4RO0A 2Z2YB 3BB5A 2FLNA 3HFZB 2XY5A 5BYSA 3KFWX 4IOBA 3VAFA 3VQSA 1RA7A 1H98A 3CD5A 2BABA 1HYSA 4IFVA 2GMLA 4LF4J 3IO1A 3D3BJ 3RBDA 1RAJA 2BEFA 2C2OB 5GMDA 2IM3A 4OZ0A 2XGQA 1NM2A 1LOUA 4L3NA 3KMSA 2HHPA 2B51A 4U67Q 5AXKA 5B0FA 3S6EA 3PIPQ 3KK3B 4OX8A 5KFGA 4AXIA 3QZ8A 3TJ9A 3H5XA 2R7OA 2DCUB 2W4CA 1YX2A 4RJVA 1S1XA 2DH7A 4DL5A 3IRWP 4PKDB 2YKOA 2ZC3A 4C11A 4DL3A 4RPFA 3KG4A 1UFLA 4WK1A 4QOTA 2Z2ZA 4GVBB 2VG6A 1S6OA 1CJUB 1FDBA 2L08A 2QLFB 4LBPA 1FWKA 4DR6J 1HW8A 1W26A 2AMCB 1RXOB 3UDEA 3EDQB 1KDNA 1RCOB 3NY0A 3PTWA 3CNQP 4I1TA 4L6V3 2DNMA 4RLEA 3PX6A 2CJXB 3VV2B 2Y1RI 1S10A 4RNNA 1NZ8A 5LSLA 3NCPA 3AFGA 1YI2S 2KZZA 1D0EA 5J2QB 1S1UA 2HZVA 2G9OA 2V9KA 2HZCA 1QAJA 4LFBJ 5A8KA 2QLWA 3Q2SC 1P1LA 3AJDA 1WEXA 2AJFE 3QFWA 2MY7A 4G65A 3W5ZA 4YMEA 4PWWA 3K5OA 4F8RA 4OL8A 2R7WA 3NBPB 2YPYA 4DS4A 1IM6A 4RBTA 5AJ3J 1EP4A 4KFBB 3SSQA 2VG7B 3T9ZA 2J0XA 5I3UB 2UV8G 2ZHOA 1JJ2R 3MEEA 2CPXA 3RR7A 4DZDA 1RTJB 1XBWA 3FEYB 2DNQA 2N4CA 2YH0A 1Z2LA 2Z0GA 2QX0A 4UOFA 4BWJA 2FJAB 4Q2MA 3GQCA 1XIQA 3MAQA 2Y9HA 5T7LA 4F67A 2YTCA 2HFUA 1HBUB 1X0PA 3W60A 3POTB 5E41A 2RRAA 2GNKA 1TKXB 4J9NA 3G9CA 1VQNS 1TVRA 5F8IA 2OELA 2AGOA 3W8GA 3ZZTA 3M8RA 1RGVA 4LIRA 3N6MA 4EU0A 2H51B 2BRKA 5KFWA 3HSDA 3GR0A 5G4DA 1G3OA 4EEYA 2VH7A 3S8SA 1CC7A 4DR1J 2OIHA 3CD7A 1NZAA 2DHAA 1DTQA 1RHQB 3Q23A 3QLHA 5BXIA 1UEVA 3ZFVA 2X1BA 1KVIA 4DCOB 2RQMA 2ZHAA 2VG5B 3LAKA 4DX5A 2RB7A 3IBFB 3LQVA 1S0NA 4F36A 3F73A 3CC4S 1H2VZ 2VOPA 2NUHA 3W9IA 3G71S 2DY9A 4U95A 2H4WB 2A6OA 5D4NA 4GKJF 2R8IA 1NK5A 1H38A 3OXLA 2R8GA 1NPKA 1PYSB 2Z8QA 1FFWB 4NMLA 3U1NA 5AE3A 2AYMA 3VR1A 2C2DA 2AGPA 4IR1A 4K2JA 2XYHB 2DITA 1HHSA 4ALZA 1W2BR 1DFDA 3H5UA 2XM3A 1U6FA 5CZCA 3IA0A 2FLOA 2DGQA 1CSJA 2APOA 4OHXA 1S12A 2R8KA 2LYVA 5F41A 2KJVA 5CA5A 2VKZG 2QMUB 4J9VA 1LW0A 1N4LA 1SJQA 5LT5A 2XS7A 3D67A 2HQ3A 3SI8A 4BDPA 2VQEF 4FYVB 4EK2A 3OTDA 4MIWA 1VMBA 2Q6BA 4DDFA 4NLRA 5IWAJ 2FTRA 5KTQA 2FYXA 1QTMA 3HSJA 4M94A 5D3GA 2NS1B 3G4SS 1IUJA 4ES3A 1DQ8A 5E33A 1ZM9A 2ZNYA 2XQCA 4HHJA 4I69A 3JSMA 2VOOA 4LSLB 1F9HA 3SBMA 2C1EB 1FE0A 1RTHA 4P75A 2RH3A 4NPOA 1FKAF 1IWAA 1YRTA 1LW2B 4OJ3A 2QE5A 1BWVA 3T3FA 1VQSA 3F44A 1RT1B 1PAUB 5KG3A 2BQ3A 3VHQA 1N5SA 1PYTA 2W7PA 2HIYA 3DU6A 2G4BA 2KJWA 2LQBA 3HKWA 1FERA 3BO3A 1QUPA 4NA3A 3CCVS 2UUBJ 2RF2B 3HF5A 1CJVB 2D69A 1Q95G 4OYZA 3BSNA 4RL1A 3BGLA 3VF0B 4U9RA 1JLQB 2HSEB 2ZBRA 1HKAA 8RUCA 4DV2J 2FC8A 2A2CA 2MZQA 2C3PA 2XTJP 1U47A 2HW3A 2BJ7A 2K3KA 1NSQA 2BE2A 2EW9A 2JH3A 2XBPA 4C8NA 2W2MP 4N8NA 1NDLA 2MKSA 3M8WA 3SMZA 1S1WA 5B0EA 2PDAA 2UUCJ 3NL0A 3N28A 2KXFA 2PSZA 1RA6A 4OYXA 5LM7E 4HTIA 3J7Z5 1X4DA 2R2TA 3K0JA 2IPOB 2DIUA 3BQ1A 1G7CB 1XC9A 2KVQE 2OTJS 5HVHA 2GS8A 4QYZK 2YWHA 2DNOA 2IYGA 2JVRA 4FVCA 1D9DA 2VBYA 2XWYA 2FHKA 5HK4A 1KVKA 3QLHB 1Q1KA 1WSVA 5EDWA 2LDIA 2B6AA 3DYAA 4YR3A 4Y65A 3GTYX 2GZOA 3D9BA 3NGDA 1I94F 3LALA 4LRCA 2VHGA 1QSLA 2JL9A 1W7WA 2V2KA 2UVVA 4DV1F 3SV3A 3K2YA 3LP2A 2GIFA 1FA0A 1YBAA 3A13A 4DV6J 3C66A 1RJJA 4QZVB 2J0SD 4P2XA 1Z4UA 3DLBA 2LCWA 1IR0A 2BDPA 2YWGA 1HNZF 2Y8WA 2CPJA 1XERA 3TAMA 4B9NA 1HNVB 1UP1A 1HR0F 4QW8A 4DU7A 3I82A 1YDLA 1U24A 2MTLA 4ES2A 1UVKA 3QWPA 3HJVA 3OV7A 2QSFA 4WFBQ 2JEJA 3TEHB 3R7SB 5EWFA 5ETQA 3MOZA 1RT7A 2CPZA 4WP3A 4PYAA 4CQ1A 2KM8C 4F26A 1PC5A 2XNRA 4JI1J 2OP5A 2J6SA 5J2QA 5DZ7A 3OTOJ 2OD6A 3NXZA 4ELTA 5A8WA 4JI5J 3OFHA 5ADZA 4NLGA 3THTA 2DH9A 1JK9B 1U09A 3NGUA 4N7TA 1N36J 3GJSB 2KM8B 2E7VA 2HHUA 1FEEA 1R31A 3PJ9A 3LP1A 1S1TB 3GMGA 1UAWA 3MECA 4H4OB 2R2RA 1R8AA 2UXCJ 3ZC4A 3KLIA 2HNZA 4X4NA 2LQJA 1X7VA 2POKA 5CZDA 2DVIA 4PUOB 3A3NB 1FRIA 2L9NA 2PE8A 4PPDA 3DMJA 2KVIA 2JLEA 2OSQA 2V8DA 4NLDA 5J2NB 3TQEA 4DR3F 3BO2A 4DR2J 4BC7A 4NA1A 4RW7A 3W2VA 1DARA 2NSBA 4D3HA 5I4MA 3OHBA 3RAXA 1YRXA 3DOMB 2J7UA 1B4SA 3KDNA 3OVBA 3CMES 1V3RA 1R0AB 1J2VA 3MXHP 2ACMA 4MIBA 1V3ZA 5FIIA 2P6TA 1FESA 3OR2A 3PYGA 1FNOA 3RG6A 3CCTA 5LL6d 5JUMA 4ZLJA 3DFEA 3FUYA 3EXYA 5CABA 3BS9A 4M5DB 4W92B 2AWZA 1PG5B 4EFAC 2H5JB 2CVEA 2B4VA 2E1PA 1NK4A 3WX8A 2DYAA 2DY1A 2QA4G 2IAJB 3ETMA 1RU2A 3JS9A 3M30B 1CULB 2CRLA 2VUGA 3WBZA 2I5JB 3GWCA 1UPPA 1S6UA 4I68A 1WWHA 3W61A 2OTLS 2I9SA 5F8JA 4QWEA 1JMTA 1MWZA 2A1BA 5FDLA 5KG0A 3VGUA 1R8HA 4N77A 2HEKA 1C1CB 4ECWA 5J2PA 1H7WA 2D9OA 5H9EK 4JI0J 1RT4B 3FBFA 2OMOA 1F1BB 1YSJA 1S1VB 2XZTB 3TZXA 1U1OA 1UVJA 4USUA 2BM1A 4ZJQA 2AD9A 4YDXA 3FSIA 5IS2A 2FLLA 1HQ2A 1JJCB 1WUUA 5DDQC 3DGPA 5EX0A 1LWEB 1RAIB 1RSCA 2FGOA 2LXFA 3FZBA 3RGIA 5IT9U 3PO5A 1FJGJ 3TUPA 2HQFA 2DNHA 3DXBA 1XR5A 1SJ1A 2FGCA 2EEYA 3LH2S 4ZA1A 2AT1B 1PJ7A 4ED1A 2BANB 1HMVA 4MT1A 1S4EA 2CG8A 4I2PB 5J2MA 2ZUAA 3GFHA 5GMKa 1FJCA 1XNQJ 1QE1B 3KG0A 4HACB 5EUHA 4F3QA 1BQNB 1E6YA 3NNHA 3GJQB 3UWTA 2V2QA 1S4FA 4DMZA 2YNIB 1Q53A 4LSZB 2F40A 1NH8A 1SQEA 2PIIA 3H42A 3SCLE 4CLLA 7AT1B 2W9AA 1HNWF 2OMLA 1M5HA 2ADBA 1RKJA 1VJQA 4LF4F 1OIAA 4I0WA 1JXEA 1V5VA 2B9EA 3WHIA 3BGRA 2HFSA 3CB4A 3JYTB 4K5RA 2OPPA 3GP9A 1IM4A 2ZKUA 4OZ3A 6AT1B 4YY3J 1KFSA 2VQFF 3TI0A 1VISA 4OX9F 1B0TA 4K50A 1FX2A 3EDRB 3G86A 3QIPB 2WVDA 3DLKA 4OZ5A 3M9MB 3KLVA 4K4SA 1ZOTA 3U1LA 5K8PA 4X4RA 1HMVB 5DG7A 4DV0F 2HBRB 1IKXB 2KT3A 3PG9A 5GAGI 4C4WA 3CC7S 2DNNA 2OPQA 4USIA 3HJFA 4WU3A 4MK8A 4IFYB 2UVWA 4H4KA 5HMYA 2FVSA 2JLFA 4PCQA 2CJAA 4NE9C 4C3KA 1LWEA 2YQ3A 1J5OA 4TYAA 3HHEA 4HDHA 5FLXU 1KN6A 1MMDA 1M1KT 1RT5A 1NEEA 4LF2A 1RT4A 2E5JA 3DHWC 5L38A 5EN1A 1U1PA 1VC0A 3HO1A 3IWLA 1QY7A 5J2PB 4W98A 4I67A 1U49A 2PN6A 5ETPA 2V8PA 3C8YA 3QT7A 4P10A 2FHMA 4B08A 1V3SA 1REVA 1S9GA 2I5JA 2VD3A 1F0XA 3PEHA 4DR7F 1YKWA 1CULA 3H0PA 3R27A 5DDRC 1J5OB 3THVA 1GTHA 2FVRA 2DEJA 2XMTA 2HAIA 4OZNA 1RT2B 2VPYB 5B0DA 2R7SA 4YDDB 4LRFA 1HARA 1RT6B 2HQGA 5LSRA 3DLHA 2VODA 1EJ7L 2P8IA 3R5CA 5L46A 2WRMA 4DHVA 2CUYA 3V4IB 2B9XA 1IKXA 3GONA 3MM9B 3AQOA 3H4BA 4Z7CA 5IXUA 2M8DB 5D4OA 4F0HA 2B9WA 3TA2A 4KY3A 2IM2A 3BPSP 4AL7A 3GYXB 4NMXA 1JLFA 4M5JA 4NOHA 3B54A 3MEGA 2WSEC 2GIQA 5HVFA 1M90T 3VAKA 1APSA 3PXGa 1FDAA 1SC6A 3GG0A 1K73T 2XCPA 2QFJA 5A2QU 4M8LA 2M4MA 4X4QA 3HZEA 4ERDA 1HWJA 4NYZA 3T6BA 5GADU 4OYPA 4USMA 4DL2A 4CCHA 4OZ2A 5ETOA 3B4DA 4DV5J 3IC1A 3CCUS 3K5PA 4U8YA 2AEFA 1FNXH 3EZUA 3UR3C 1NJWA 1E6YB 4HR2A 9ATCB 1VC5A 4CLPA 3M8SA 2CFXA 2VBXA 1D8ZA 1SL0A 2D74B 3M6UA 4E0DA 4R8UA 3FBEA 5KOXA 4KE5A 4HI1A 3I5CA 1UJ4A 1VBZA 3E3XA 2DPIA 4DSIA 2J8AA 2QLBB 3A8KA 5A8WB 5IQ6A 2ZD1A 3TAPA 1CBKA 1FDNA 2QV6A 1C0TB 4G1IA 1O0PA 2C2EA 2H4YB 4WIIA 3OR1B 4WK3A 4ENOA 4ILRA 4X4SA 4J9KA 4DR5J 1P9QC 1JLEB 2RSQA 2YX4A 2ZUGA 3KMQA 4O0NA 2I2YA 1LXNA 2C2ZB 2C3MA 1YIJS 4DN9A 3OBIA 3DGPB 4DV7F 5HP1B 3D4JA 4F4KA 3B78A 3TR5A 4DQIA 5IV4A 3IRXA 4KYZA 2RNEA 1S57A 1D9AA 5I42B 2HBZB 1FVQA 1N5YA 1SJ3P 2HURA 3TAMB 4A8YA 1C1CA 2GA7A 2GV1A 2EPIA 3PZPA 1WORA 4F3OA 1NK7A 3AJ1A 1WHXA 5L9XA 1Y3KA 3SDEA 1NHKL 3UFCX 4OV1A 2RILA 3LW5C 1HWIA 3MD3A 2RMLA 1Q5YA 1KSPA 2V63A 2BKOA 3BYRA 4E98A 3CE8A 4ZHRB 4B3RJ 1T9VA 3M7VA 3MMAA 2ZVSA 2XO6A 2FZKB 2IM1A 2ZKTA 5C2GA 4LFCJ 3X1LB 2NPIA 4ED6A 2AGQA 1U25A 3NCQA 1R7IA 4ZDNA 3EM1A 5K5MA 2CVIA 2G0IA 5K14B 1YTYA 1R6YA 5AXMA 4DV2F 1DQAA 2NXCA 4C98A 3MCMA 4A8QA 2CQBA 1BQXA 4ELUA 3HMJG 2R42A 4NCAA 1GMVA 2KFNA 3DM2B 4FVMA 2NYIA 5E2QA 2CQDA 4GO5X 2E5LJ 1CG2A 2E5HA 4KKOB 3AOCA 4OI3A 3CD6S 1DJ0A 5AE2A 2UUCF 4RNMA 1OS5A 1TK5A 4P2FA 4RW7B 1WF0A 1SQFA 3MZIA 3W2VB 5A76A 3GV5B 5DGBA 2QMXA 5GMEA 3LP0A 4RUHA 2RT3A 1H2UX 3C6TB 1X5OA 1LQ9A 3L9ZA 2J9EA 3R6LB 3BBBA 1J27A 5JMNA 2XSJB 1NSAA 1U26A 5IM0A 4FNHA 3H20A 2RS8A 3UW1A 1UWAA 1S72S 2HNZB 2PMHA 2YNGB 2OD4A 1S7IA 1FRHA 3JSYA 4LF1A 4DL6A 4B9SA 1RDRA 1J5EJ 2AEJA 4V19X 3K5MA 3OHAA 1TAQA 3CMAS 1F6TA 2HLUA 4I6WA 2VFUA 4LF7J 1KS2A 4MJKA 4B3OA 2V0NA 4JOUA 3KJQB 2Y0SD 3BBCA 3G8QA 1NRKA 3L09A 5CAAA 5LMUF 4DV6F 1RT1A 2X3GA 3NMRA 2ZZMA 3I9V9 1GXUA 2GCFA 2DNLA 4BBYA 1KC8T 4IDKA 1TELA 3JSRA 1UVNA 4NCGA 3FCVA 3AOAA 5E3QA 1IKVA 3DC2A 1C4AA 2OPSA 2VFTA 1OY8A 4Y2IA 4O3OA 4ID5B 1RAHB 1U7LA 2RKIB 2ZC4A 3DCAA 4ZP6A 2R8JA 2WBMA 2FHJA 3L3CA 4Z7YA 1HNVA 3R3TA 1Z2ZA 1EKRA 1H7XA 4RW4B 3H5YA 4N56A 3TAQA 2V8GA 2QC3A 5HMZA 2CNLB 2O5DA 2W8KA 1Q8KA 3VAGA 1M5OC 1BXNA 2CQ0A 4O3NA 2HFOA 1FT8A 2FUG9 1VR6A 2ILZA 2QL5B 2V68A 3JXOA 4MKYA 2KB2A 2SXLA 3IAM9 1TL5A 2RKIA 4ID5A 4G1QB 1S79A 5HVGA 2OPSB 4DPXA 2EFQA 3HFVA 2C3OA 3S1TA 1GMUA 1KOOA 1PJ6A 2XYPB 2WCXA 3F0NA 1T7PA 4MMOA 3BR9A 2XLKA 5IFMA 3I0RB 1HBNB 1ICEB 2QSWA 3HP6A 2LU2A 4P6QA 2HHVA 3QRPA 3BH7B 1NPRA 3LWMA 4XPCA 4CLSA 3I6PA 3IWNC 3PEJA 4WFYA 5THWA 2IDLA 2W8LA 4K4WA 4EBEA 1OMSA 2KI2A 1FXLA 3CO0P 3MD1A 4DSEA 1FI4A 3TANA 1RTDA 1SL2A 3FCWA 1JKHA 3N01A 2VG5A 2PI4A 5EHHA 3C14A 4X65F 1KR4A 5KG7A 5DDOC 3MM5A 1AZSB 1Y00A 4K4TA 3I0RA 1GNKA 1HW9A 2E29A 5IM0B 1PGZA 4X4UA 1TFWA 1U0HA 3GU0A 2HS3A 1K0VA 3UN2A 1X31C 3UCGA 1XQIA 3D68A 3DNCA 3PVXA 1NH7A 1UFKA 1Y5NB 1GAOA 1FRKA 3D6MB 7FD1A 1X4AA 2YX1A 1HBUA 1UTAA 2RF2A 1LFPA 4IYQA 1C4CA 2D3O1 3BF4A 3SSRA 5EWEA 5GAGU 3V6JA 1LNQA 1XR6A 3T5LA 4JP8A 4WFNQ 4Q7AA 1HPZA 4CIOA 2KT5A 2MKCA 5K14A 3NNAA 1N33F 3SV4A 4FNIA 3QJLA 3EUNA 3MEEB 3M6VA 1KQSR 4JV2A 2GAGC 1JNZB 2AIRB 4QQBA 4TYBA 5KFZA 1IKVB 3MMAB 1Q5VA 5F3TA 5F8LA 2YX7A 4W90B 3C3LA 1RWMB 1KHVA 2EG1A 4I7FB 4YQWA 4R0JA 3OVAA 2QYGA 1RTZA 5E3PA 1TUWA 2ZEJA 4FKXA 2FHJD 5HL7Q 5GAEI 5DG9A 2RHSB 2WOMB 3CDBA 3I96A 3JTOA 2WVCA 3SDEB 2MQOA 3BPDA 3B82A 4GMKA 4P7VA 3EWGA 5KFCA 3C46A 4ED2A 4BCAA 3PRVA 1YBTA 4TY9A 5KT6A 5I42A 5A0YB 1TKDA 4TNOA 3M32B 2W24A 5DJBA 4FBUA 1T94A 1YGYA 4KPCA 2ILYA 3C15B 5J1PA 4GVBA 4ZVHA 2XC9A 3MUTP 3VGVA 4EBDA 4UY85 1VQ9S 3L7PA 3D28A 1CJTA 3A12A 4H4MB 4F4YA 5CD4H 1IQZA 4YOEA 3D3CJ 4LQ9A 1AT1B 2ZHBA 3B8HA 4KO0A 3VGSA 3D1HA 2UUAJ 1CPZA 2ASYA 3ZNUA 2BXJA 3EGWB 4KKOA 1S9EA 2WSFC 1S0OA 3GE9A 3MCOA 4IFVB 2OUGA 4Y2AA 1P1TA 3M8YA 4KHRA 1K44A 1N56A 3HHNB 2PO4A 4PR6A 3SZ2A 3BGFA 3GFZA 2OH2A 4C48A 2DK2A 5H1SV 3BZQA 3M6WA 4J37A 3QSYB 2J9CA 2QJ3A 3CJSA 3V5RA 2RRNA 1VK8A 3IS9A 2NREA 1HD0A 5SUHA 5F8HA 1L3TA 4ZHRA 3UD5A 2MHEA 4U7UD 3UPFA 1S97A 2MKJA 1Q81T 3POTA 3A8JA 3DDKA 1CC8A 3B4MA 1TL4A 2CAJA 2CQPA 1FTRA 5B0AA 3TA0A 5GAHI 2E1CA 4LMZA 2WW4A 5IC6B 3QT5A 2X3DA 4ZCIA 2I38A 2MZJA 1SCJB 5CCLA 4U6PA 3CF5Q 2MPUA 2ZFHA 1RTJA 4ER8A 5ETVA 2GGPB 4N8OA 5J1NA 2YKMB 1FVSA 3M9NB 3MMJA 2VDIA 2ZBIA 3W9JA 1IXKA 2HBQB 1TMJA 4LF6J 3M1VA 3DDIA 4QIEA 1UCNA 1VS3A 4J9UE 5L1KA 2KT2A 1HWLA 3Q22A 4PQUB 2U1AA 4JI4J 2GJ2A 3JTPA 3LA0A 2A0FB 3OR1A 5KG2A 4OHVA 1AA1B 4WBFA 1C0TA 5CYJA 2Y1IA 3CWJA 3FSXA 1QAXA 3NLCA 2IVMA 4LSNA 3EPIA 5FD1A 5ETNA 3KLFA 1I5OB 4USWA 4FDFA 2RDJA 4NX9A 1MMLA 4RBUA 3UD3P 3TQ1A 1OY6A 2FZGB 3BKFA 3DRXA 3W64A 5J1EA 4WFAQ 4QIVA 2XNQA 3OJSA 3S01A 1TAUA 3NGTA 1RWKB 2OEJA 4FYXB 4A46A 3K7RA 4UT4A 5KT5A 3KNGA 3GIMA 3Q0AA 1CJUA 1S7HA 3P6YC 1S76D 2NUUG 5L39A 1LWCB 3J7YU 4OYBA 1MROA 1DTTA 4Q2LA 3ZZYA 2MKKA 2OFHX 2Z2MA 5GAEU 3BJYA 2R2SA 2EKNA 1R6VA 1VDHA 3ONQA 1WC5A 5K9FA 1M5SA 1RHUB 3TRGA 2MGZB 1UA1A 5KFDA 3UCUP 1NK9A 4LF5J 4O44B 3MPWA 2B3TB 4UQTA 4LF8J 1A9NB 2J0WA 2B4OA 3TVKA 2EK1A 2RDIA 2DEIA 2HQCA 3R9LA 3RRKA 4KGKA 1BY9A 1MWQA 1KNZA 4OIXA 2Q79A 4DV5F 2G0CA 2OPPB 3IN5A 3PFOA 4GKJJ 4CLUA 3JYTA 4C0OC 3BGRB 4DX8H 2CJKA 2JVOA 4LT6A 3NS5A 1TQLA 1RYSA 1IKYB 1RQ0A 5A6WA 3V6DA 4IUFA 2VC0A 1TP7A 4ZVPB 1RT6A 4AMNA 2Z58B 1WELA 2AYEA 2P2CB 2VF3A 1GXTA 3OT9A 2YNIA 3D6TB 3QATA 3QGIA 4ICLA 3PKYA 4DLEA 1N32J 4F02A 1TV6B 2E9ZA 2CQ3A 2JWNA 2KO1A 1REVB 1JLBB 1O8BA 3FCHA 4FYWB 4HACA 4DR5F 3G82A 4LRAA 1D9FA 2IY5B 2JHEA 2VZ9A 4KH0B 3CVKA 3EVMA 3FFIA 5GVQA 4CI0B 5L9NA 3OFEA 1HQUA 5F8NA 4LRBA 1FRJA 2HPUA 4G6VB 3SCJE 3NWGA 4LSNB 4EYHB 2L9DA 5KT3A 1VYAA 1X0FA 2UVRA 4DPYA 1OSDA 2GVZB 1HD1A 4PG7A 2K3IA 3FMBA 3RB3A 2D1CA 2YXLA 4K2XA 5DGAA 2O01C 4UZCA 2KG1A 1T05A 1QUVA 2L3MA 2PMWA 5IQQA 1NSPA 2BM0A 2DKOB 1YZ7A 2BKPA 3MDFA 1FRMA 2CG4A 2M88A 2ZWOA 3CJTA 1V5IB 3CIZA 3JQKA 1IBCB 1KONA 4QPTA 2IVFB 5ITHA 4TU7A 1DY3A 2L9WA 3BR8A 1D3WA 1HQEA 3HLUA 3DLKB 4B9UA 4B3RF 4CO5A 4Q43A 3NOCA 4DV3F 1WACA 3M2RA 2EFVA 5MAOA 2VONA 2F9JA 3IFEA 2BJ8A 1IBKF 3IR7B 4OHZA 3PFEA 4TY8B 3J7YI 3DHXA 1HWKA 3QSIA 2NPFA 2UXBJ 5D8HB 2GJFA 1ITPA 3AHPA 1QDUB 4OI0A 4C0HA 1UEKA 3QIDA 4KQZA 1SH0A 2CDQA 3QAUA 3IS9B 1TL7A 2F7VA 3FVYA 4L72B 2FPHX 2OHDA 4IKAA 2QFIA 1NJZA 4ZPBA 4GC7A 2E5LF 3G87A 4DQSA 2FY1A 2LU1A 2OJ3A 3OR2B 4NLWA 4C0BA 2RU3A 3FSYA 3PDNA 3BKUA 4A8WA 3ILLA 3CJKB 2LECA 4KPYA 1R43A 4E8UA 1E6VB 3OTBA 4MK9A 4O3PA 3SYZA 4M5KA 3Q8UA 2RUSA 2NCKL 5LOQA 2F4VF 4QU6A 2WSCC 4URQU 1YITS 3TJ8A 3W66A 1NBEB 2ASDA 4FF2A 2HHXA 2AW0A 4AFFA 4TLRA 3R6GB 4FP9A 1FWPA 4KO0B 4KC5A 4P72A 3J81j 3V6KA 1Y10A 4KB7A 2MGZA 2A6MA 1HLWA 1FD2A 3CMQA 3BYPA 1GMWA 3GSIA 3R5JB 3ZZPA 4USHA 5J2NA 2DGSA 1I94J 3BDEA 2C3YA 1CJTB 2VC1A 5CZXA 5L1JA 2D41A 2YNFA 3BN7A 2I6WA 3HVRA 4HL9A 1VQKS 3MURP 1BLUA 1VBKA 4O4GA 1X9WA 2R2UA 1KEKA 4H4OA 3T1HJ 2KU7A 2QO3A 4WU2A 3UCZP 2Q66A 1SQGA 2MLZA 4WXOA 4ANEA 1RWOB 3KLFB 4URSA 2QL7B 1JLAB 2DHHA 5C7PA 1FFGB 3K8WA 4LR7A 3OFFA 1HR0J 1BQMB 3LGHA 4I7FA 3CDUA 4OI6A 4X2BA 2DR7A 1FXRA 3O3LA 1RBLA 4B3MJ 2GJIA 2BW2A 2O67A 2ZZNA 4JYAJ 2JX2A 4TU9A 3W63A 3FRZA 3MCNA 1WHYA 2ZOMA 4GVLA 1NU4A 1DBDA 2DHGA 2YKMA 3H7HB 2MXYA 1MU2B 4HT7A 1TKTB 3PY8A 4HEA9 1GX5A 5KFJA 4JI5F 3WC0A 1TUGB 2CJYB 3M2UB 4UTGA 5H9FK 3H2UB 3EVWA 1GTEA 3K58A 3CJ0A 1RHKB 3OFGA 2OI2A 4DN0A 4F04B 4K8RA 4CO4A 2EVZA 1SB6A 3DOMA 3W2WB 4OHWA 4O3RA 1TUVA 5KFYA 5BJRA 4B9LA 2PFFB 1T9UA 3TEGA 4I2QA 3CJ4A 2ZM6J 1VOMA 4FF4A 1U1NA 1H73A 2CPDA 2I8EA 3CSKA 4P2SA 2RS2A 1UL3A 5DG8A 2B6AB 3DYAB 3HHKA 5T41A 3IR6B 2C2KB 2MKHA 3DOLA 1S6PB 4ITSA 1AZSA 4Q45A 4DR2F 2F8HA 3HI9A 2PFDA 3VALA 4AMMA 3MPVA 4JI6F 2BBEA 3LP1B 1JJHA 3MECB 4X66J 5B0CA 4CO3A 2PD1A 3IR5B 4PG6A 1WC1A 1N88A 3P4UB 2I0XA 2JC0A 3HSGA 1FX4A 2F8MA 4KV8B 2HFVA 2WZ1A 1IQTA 1MLAA 1CJKB 2ZITA 2YY3A 2B7CB 2F65A 3MF5A 4H4MA 4J9SA 3DRYA 1IBLJ 3L4BC 4LBHA 1NKBA 5DQHA 3C15A 2M3DA 4ZVEA 3KLEB 2LEPA 2R7RA 2R8HA 1NJIT 4DFKA 1JLQA 5CYMA 2XCAA 2E44A 1R0CB 1K1SA 1VQ7S 1N8RT 1UJ6A 2IM0A 2MLYA 1HNIB 4ZVTB 2HWIA 5HJYA 3CCJS 4ED7A 1RHMB 4WTOB 3L7OA 1T9TA 1SIWB 2N3LA 3PW0A 2X1FA 4FPRA 4OQJA 3H8YA 3BH6B 4H4KC 4EZ9A 1YJ9S 4K7QA 1RAGB 2CQGA 2BQRA 1SKRA 3R2CJ 2NYHA 3BQ0A 2FJEB 2HRTA 1FRXA 2WONA 1SUQB 1F2HA 1RTHB 3GG1A 1RCXB 3AA8A 2UUWA 3IM8A 4HVZA 4NI2A 3AY0A 1RTIA 1VRUA 2F4FA 1Y5IB 2OPRA 3O2IA 4K59A 4NCGB 4IDKB 4NRUA 2O66A 1FTCA 1TU0B 2B4UA 1OPIA 4RUCA 2CZVC 3D1QA 1PKUA 3RAQA 5D3GB 3MMCA 2IA0A 1JNRB 1HPZB 1T03B 3DGVA 2H65B 2CA9A 3ISNC 5F8GA 3ZZUA 4GKKJ 4WKRA 1NNDA 3UR0A 3ZTSA 3FQLA 1LWFB 3TWZA 2PI5A 2LEAA 4NYPA 4B3TF 1LW0B 2D7SA 1NHVA 3O44A 3ZXWA 3CDWA 5CD4A 3T6JA 3MM8A 1VCTA 2RDDA 4R5PA 4M5HA 4YR0A 2YWEA 1NKEA 1GH8A 1T02A 4CNYA 3MEDB 4TQRA 1FEHA 2JSXA 2ZJQQ 4CLZA 1HNWJ 1VGYA 4YFUA 2MQ8A 1TFYA 4QR1A 2ACYA 3LP0B 4DR4J 1Q78A 3I5BA 4F50A 2J6TA 4J9RA 2MYFA 2XMKA 4RR5A 2H48B 4G1PA 1T8EA 3TX0A 4K0KJ 3PV8A 1GEHA 1LWFA 4OX9J 4WXWA 5JVHQ 5D0HA 2CWXA 4W4MA 5EWGA 1U0SA 4C3MA 4KHPJ 2AJ2A 2B5JB 4FKYA 4DUYF 3MMCB 4WTYA 3NOGA 2QRRA 4JI8F 1FKOB 1IBMF 4OHYA 3GCWP 3KHLA 2MEWA 2HZAA 2UUBF 3N9UC 1V6HA 3BGOP 1DQ9A 5BYRA 4Y0FA 3K59A 2MB0B 5B08A 2YKQA 4LSLA 2J5AA 4WIQA 3JSMB 4C8KA 3UI3A 4OYIA 1TMMA 2A10A 2WONB 3ETOA 1TVRB 5BR8F 2ZH1A 2D9PA 2OKQA 4XPEA 5KOWA 1BHNA 2ZH5A 3UN3A 4PG4A 3CC2S 2B8PA 1MN7A 4XDDA 5CCMA 4KTQA 1ZA1B 5T7LB 3K89A 1ZPVA 3KDOA 4ILLA 4NLUA 5ETSA 3OL6A 1H74A 5HQMA 3Q8QB 4DG1B 1DZ5A 4NYOA 4RW4A 2EG2A 4RWXA 2WK4A 5E5NA 1FHTA 1AROP 4NLTA 1UETA 4GO7X 4KFBA 1SJFA 1X5TA 3LPYA 4DQPA 1WNEA 3VWSA 1Q0NA 4ZKAA 5K8MA 4DUZF 3W1YC 4DU8A 2HRUA 2UZAA 3MHYA 2HBYB 3PIOQ 2MJUA 4ANDA 5E3CA 3BQ2A 1HI1A 3C16B 5BYQA 1XMOF 4AQYF 1B64A 3DI6B 2ZD1B 4B3OB 4WP8A 3J81U 4DV1J 4YHHJ 2XYGB 3R5DA 1Q7LB 3DXSX 3D54A 3CCWA 1D1UA 2BRLA 1Z1ZA 3D1OA 2KG0A 1YQHA 2E5GA 4ZVRB 4CWBA 4ECYA 2BX6A 1F3FA 2YNGA 2VG6B 4FN5A 1DTQB 1ZTTA 3PYEA 4X62F 1VC6A 1L3VA 3GV8B 2G1HA 4C11B 3Q2TC 4PABA 2IVYA 4N47A 3T1YJ 2ERRA 1SI9A 4ZPVR 1KLNA 4LF8F 1LEOA 5CYQB 1RWPB 2EKYA 2X7IA 3AQPA 3C6TA 5AXNA 4CH7A 2GVDA 4RNOA 3BSAA 5C2CA 4RNHA 4DS5A 4NXNJ 1RWUA 2W1BA 1TKXA 5L1LA 3THPA 5KFLA 1C0UA 3VTIA 1N5QA 2KDOA 3P49B 1AFIA 3DM2A 2CPFA 3ZZRA 1JLFB 2UU9J 2HIQA 2HG4A 4NA2A 1JXLA 1VQ8S 2QGFB 3T5HA 1HYSB 1I1GA 5AXLA 3M2UA 1NDKA 4ZP8A 3VGTA 1P8GA 3OTOF 3G6VA 3ENWA 2QL9B 4A4JA 4EYIB 2C22A 1N32F 2XSFA 4MKVA 3MWBA 2V5HG 3RBZA 3BSCA 4AL6A 4IO9Q 2VV5A 5KT7A 3CCZA 1PCAA 2VG7A 5KFBA 4FYYB 1EP4B 4K5SA 1C1BB 3KYLA 3KNAA 3F56A 2E66A 1RZMA 3PJXA 3QMQA 2RUGA 1JIHA 4Q44A 3AA9A 3Q83A 2MDAA 2V2ZA 4WWSA 4OJGA 2W9BB 1S1UB 2BACA 4FS2A 1B70B 2N4DA 3OUYB 5E7OB 4MK7A 4YB1P 2G0JA 3I32A 3HVAA 2JC1A 4L75A 3VZIA 2ZH6A 4B3SJ 4LQ3A 3PW2A 1TK0A 1HNXJ 4OI1A 3C6UB 3QQCD 5IT4A 4X64J 2PT0A 1KQKA 5HMXA 2N82B 4N5SA 1PBAA 4KH1B 1SC1B 4CLKA 4A47A 3OTEA 4DWIA 2BE9B 5G0RB 5HP1A 4PEOA 3ZO7A 1SXLA 4IH5A 3Q8YA 2ZH9A 5D4LA 3KUEA 4KGVB 1UW9A 2VKRA 2D3OR 1YJ7A 3PYFA 3GV7B 1T3NA 1JLGB 2ZWPA 5M2PA 5HLFA 3C2PA 1CS4A 2MQLA 4FXVA 3M8PA 1L3KA 2H5IB 1SC4B 3LGNA 4ZVOB 2K2PA 2IJFA 5JXSA 1UWBA 4IR9A 5I3QA 2NZ4A 3T5KA 1VLYA 3BM7A 1ZM4A 3QIPA 4CYUB 4DL0C 8AT1B 3PRDA 2C28A 1VBYA 2KFZA 1C2PA 3CJKA 1ROFA 2V4JB 4JV1A 2EFPA 4KGMA 2Q1LA 1DAXA 3DRRB 3LGMA 4UW2A 4JI2F 3E51A 3KJVB 4ZVUB 1DLOA 2ZH7A 2F4VJ 4WFZA 3Q24A 2CJ9A 4DF8A 1HHQA 1N34F 2R3VA 5HQLA 3GIIA 1RBAA 3AD9C 2COLA 5KFSA 3BSOA 4A8SA 1JLCA 4DFMA 2YH1A 2R7UA 1KOHA 2BOPA 2FJVA 4XIUA 4YB6A 1FE4A 1WC4A 2W4DA 3W62A 2BV3A 1DHMA 2M52A 2RVJA 1X5PA 4ED3A 2DXDA 3I56S 5F3ZA 2IA6A 2CPIA 4LF7F 3NRBA 3MM9A 4OZJA 2XZWA 1EETA 5KFEA 2KN4A 3CJQA 3V4IA 3AODA 3QJJA 2IHR1 3HVTB 3T1HF 4JUZA 3QO9A 1IJFB 1RT2A 2YVSA 1MWYA 3IBCB 2B8QA 3J80U 2VJUA 2U2FA 4WKYA 3D66A 2FQQB 5DS7A 4ECSA 2ATCB 2EXUA 3CJ5A 3I9ZA 3OW2R 2FY8A 4K4UA 5SZTA 3K8VA 3GSDA 3G6ES 9RUBA 3JTNA 5E3RA 4OFZA 4Q8FA 4QPXA 3MOJB 1Y3JA 4I6AA 3VAJA 2KZMA 3D6HB 3A3OB 3RB4A 3R7BB 2ZZTA 3G82B 1PSDA 1U1QA 2F9DA 2N3OA 1RT5B 5C25B 1X9SA 3IG1A 1O6XA 3CCQS 3R1HA 3ZTOA 5DETA 3WC2A 1T9YA 3SSSA 3PR5B 1TZ0A 3H4DA 4DV0J 2DXFA 2LXIA 2XMWA 3D2WA 4HT5A 3HXMA 4U8VA 3UD4P 4MTPA 2FDNA 4NLYA 2V2VA 4M5DA 1WG4A 2O3DA 4UUXA 2IMOA 2CNKB 2E5IA 2HWHA 4P9SA 8ATCB 3PCOB 3MFIA 3HT0A 1K8AT 4EUVA 1W25A 4PZVA 4QCLA 2ZDPA 5KT2A 3CDEA 3JSBA 5D6GA 2W9CA 2ROGA 1F5BA 4OYOA 2DB1A 2E1AA 4RW6A 2AU0A 4LRDA 4Y3CA 2ZE2B 1X4EA 3M4XA 3ZTRA 5ETLA 4ELVA 4C8MA 1VRTB 3EXCX 5CHCB 5KFAA 5B09A 4PAAA 2AP6A 3UNYA 4F25A 3OL8A 3HK2A 3DRSB 3M2VA 1KQGB 1PBUA 2QN6B 3RBXA 3M9OB 3KHGA 3W7BA 1Y9OA 2XMUA 3RTVA 2MSTA 1KFDA 3U1MA 2VIHA 2CADA 1DTTB 1MROB 1OPZA 3BEGB 4WE1A 3QAEA 4OZ1A 4CH0S 5IT0A 2R9LA 3T1AA 3MPDA 5LMNF 5IZHA 1KLMB 2DNKA 4LF9F 4PUOA 1FJGF 3KLIB 4OI4A 5HN0A 3G6XA 2BQUA 1WDDA 4NZ7A 1SPBP 3QFHA 2IYIA 3W65A 3J7A1 2Z4PA 2OO4A 3KG1A 2VJVA 4K4YA 5B7WA 1HWUA 2LDYA 3ILOA 4F0MA 4ZK7M 5H9FJ 5J2MB 3ZZ0A 3EGVA 5IV3A 4B9TA 4M5MA 1PILA 4KSEB 1QSYA 3VZHA 3M8PB 4F7VA 4X84A 1N0VC 1X4BA 2ZBQA 4XO0A 1LKZA 1IKWA 3CW2C 3ISND 4X4PA 2VU5A 5JVGQ 4DR1F 3EGZA 1WC6A 2RD5C 4TVAB 1B99A 3HULA 3CGIA 6FD1A 3R5GA 5KFKA 3T9NA 5LJ5Y 4RU9A 4FS1A 3VVUA 3R5BA 5DLFA 1Q82T 1XN9A 2GO9A 4IQXA 1S0VA 2JFKA 2MZRA 1S1VA 3I87A 2H3EB 5D0RA 4OZLA 1MMNA 3C6UA 2ABYA 4TU8A 2V4QA 3PW4A 3NGRA 1HBMB 1WOSA 5FJ4A 4YY3F 2XG8A 4N41A 4UQGA 4ECTA 3H2VE 4C3LA 3P8BB 1SKSA 3NMAA 1EX8A 1ULRA 1U48A 4DR6F 4HDGA 4A8MP 3RUBL 1FJ7A 3NCRA 1RHJB 4P74A 4YN3B 3VAIA 4JV5F 4ECQA 2XMAA 1XK8A 3G8TA 2HHHF 3GIJA 1VLOA 2MHNA 2GFFA 4J91A 2QA4S 2OSRA 4J7CA 1RWXB 2PGCA 3TUZC 2VQEJ 2HNYB 2M2BA 3CPWR 1R0AA 1IVZA 2HHQA 2DH8A 3MR6A 2NQPA 1EZZB 3FDSA 3O5TB 2CQCA 4I64A 4NWBA 2W4PA 2VICA 4ECUA 3OLAA 3H59A 1S9EB 2QT7A 1N54B 4ES1A 4DR4F 3TZZA 1SH2A 2AJ0A 3MTKA 2GVDB 4JI3F 1VRQC 3CULA 4DXLA 2KL8A 2BJDA 2BYCA 4ED5A 4NLPA 2BE2B 2QLXA 3A4TA 3MR2A 4EBCA 1V9OA 3BDPA 1TL3B 1WSRA 1NUEA 2IRYA 3IGNA 5HBMB 2XLJA 3RRHA 1B3TA 3M32A 3TUIC 4KHPF 2R7XA 4DUYJ 3PYDA 5JJBA 4CH1A 4L76A 1RE1B 4JI8J 4O0IA 1F9FA 4QBUA 3DOKA 1WEYA 1RAOA 2ZBCA 2AZ3A 3FGVA 3GILA 1WKLA 5IT9Y 1YJRA 3AD8C 5LJ3Y 3KK2A 1YBUA 2EI5A 3NKYA 1UEUA 1SL1A 1N0UA 1Y4ZB 2RJZA 2WOMA 4HH1A 4B17A 2HVZA 3TP2A 1AW0A 1ZM3A 4ATNA 4NASA 4BS2A 1S48A 3H90A 1JQGA 2BA9A 1X9MA 1FK9B 2KHCA 3JB9k 2B4PA 4DL4A 2BVZA 2DR5A 4JI7F 1G1XA 4CDIA 2YQ1A 1OY9A 3QGPA 4NXMJ 1T95A 5A2QY 2R7QA 2XY6A 4YP3A 1Y5LB 1SKUB 2UXDJ 1LFWA 1RAFB 1A7GE 2AHOB 3KJFB 2QTWA 3G2XA 2G2YA 2P5VA 2C2RA 4OYWA 3I0SB 4IG3B 4PPZA 1J5EF 2KXNB 2CZ9A 2W01A 3QRQA 1TTHB 1FXDA 3LP2B 4QIFA 3MR5A 4DFPA 2J7KA 3SQGA 2YKAA 1UPMB 3HPOA 4ZVGA 2V50A 3MR3A 2QLJB 2X1AA 3AXMA 1O51A 3MGJA 3NGSA 4Y2KA 2QIFA 5KG5A 4YHHF 1SJRA 4RW8A 1U0HB 4RWWA 3F41A 5HI7A 2GHWA 2FJWA 3QT6A 2DIVA 2B5JA 4JBCA 4DV7J 4OMFG 4TKTA 2JEFA 4LFAF 4U96A 3MMBA 4CO2A 1UVLA 4FYDA 5IWAF 2MZTA 3FC9A 2EFOA 1JKHB 3K17A 3LAMA 3TA1A 1KKHA 1RTDB 2BJEA 3NAHA 2XULA 4NEYA 5KFHA 2HQDA 4OYAA 1M5PC 5KFVA 2ROEA 2J9DA 4PXBA 3BKTA 3GIRA 4L3KA 4MKBA 4WYWA 3RJMB 3VQTA 3MAAA 4UOHA 1NCLA 2F5GA 1N48A 4NXNF 1NXIA 1SH3A 5KG4A 1HBNA 1SC3B 1M1HA 2M7SA 2NXJA 3ZNJ1 3LPEA 4F2SA 3MEDA 2HQIA 4Y34A 2VFSA 1ZBTA 4EWTA 3IP0A 3MM8B 4D3GA 4R5PB 1NPPA 3RBEA 3KJNB 3SQGB 1L5UA 3WIUA 2FD2A 1B7FA 4G1QA 1BE4A 2LA4A 4LFCF 2F3JA 3GLJA 2WTFA 3MAHA 2CQIA 1CJVA 3HD1A 4EI2A 4LR9A 4CRJA 1M5VC 2LFVA 5C24B 5C5JA 3QWUA 4DPTA 3KHHA 4DSKA 2D3ZA 5F0WA 2DNYA 2QMWA 4CTAB 1NHUA 2XMMA 3ZTPA 3PW7A 1T9XA 3N4WA 2BJ9A 2M0GB 2W25A 3NP5A 1Q8BA 1KTVA 4U7UK 2FJDB 5HMWA 2VBZA 4WPAA 4UZBA 3NBPA 4ZN1A 3TX8A 4FF3A 1FK9A 2GQCA 3MR7A 5M2UA 2QEXS 1SUQA 1YG0A 4HLBA 3Q86A 4X64F 2KXHA 4DV4F 1R0BG 4ZS6A 1YWXA 1L3SA 2FZCB 2ZH4A 1F9EB 2VBWA 3QGGA 4CTAA 1VK3A 4USJC 3CJ2A 3V4MA 1U02A 2AX1A 2DO0A 2FIUA 4ZPAA 1XMQF 3Q89A 3R5AA 2JNJA 2LQ5A 2ZJPQ 4ZPDA 4ZVFA 1NB2A 1RKIA 1UFWA 4OYMA 5HAOA 1VQOS 5EGYA 1HL6A 4AMOA 3L7UA 4CLYA 3KLEA 2NXUA 2RQ4A 2YBVA 2BR0A 2HYIB 3JQJA 2M70A 3I55S 5KG6A 1NAQA 2KFYA 2XSJA 1K47A 1N33J 4MYTA 3LOUA 2D3UA 2EC0A 2DGUA 5MLCV 2B9YA 2WBRA 4PWUA 2E9RX 1YZ6A 2A18A 5K8OA 3M8ZA 2MY8A 1CJKA 2PA3A 3HZGA 3WX4A 1S99A 5KT4A 1B0VA 1HNZJ 1QVFR 2YWWA 4JI0F 2ASLA 1RLDA 3J7AN 2HVIA 1JJ4A 3CJ8A 1Q8IA 2HHTA 2DT9A 2Z2LA 4ZP9A 1FO1A 3WIVA 1WI6A 2IJRA 4DI6A 5L8RC 1U1RA 3G96A 3PO4A 2YNHB 3QPIA 2GQ2A 2XI2A 3ISZA 1M1GA 5ETRA 1OYDA 1R8PA 1X4HA 2CJQA 3H5SA 3R8YA 1U1LA 5HROA 1D09B 4FXDA 4C6AA 3UO0A 2YQ0A 3IXQA 1KRPA 3B6BA 1NK0A 1RUSA 4KT0C 2JJ4D 3GCXP 1F2GA 5DM6Q 4AUKA 2G13A 1AFJA 3D0HE 4NLSA 3PRBA 1N36F 4DPOA 3EE3A 2W2PP 2BMBA 2HMIB 3W2WA 1HA1A 2VPWB 3ENAA 4ZVSB 4F4XA 3GJTB 4ECXA 1YK9A 4J9PA 4YUDA 1N6QA 4J90A 1RU1A 1XWLA 2FHOB 4XDCA 4FF1A 4WP9A 1TKTA 1RWVB 4URGA 1MU2A 4J9OA 1N5YB 1P9YA 2AJ1A 4DSFA 3IM9A 4IH6A 4ECZA 1XNRF 3IRXB 3M05A 1ZYQA 4ZOSA 2GX8A 2K1RA 2CXEA 3CUNA 4CLWA 3CDAA 4X65J 2W2NP 5K8NA 1HBOB 3SEOA 2VDHA 4CM2A 4ECVA 3R2DJ 3KWMA 5HQ8A 1N5VA 7FDRA 1JLEA 4EO6A 1IKWB 3QYYA 3WDOA 4DLGA 1BGXT 4ZJLA 4ZLLA 3P5BP 2DO4A 2CYYA 1RBOB 3HX9A 4OI2A 3OL9A 1ACMB 1JLAA 3HHLA 5LXRA 1WEZA 3AH6A 3NS6A 2JFDA 1Q7YT 1GK8A 1G2EA 1AUSL 2N7CA 4IH7A 3AD7C 3A8EA 2H1YA 2AX0A 3DOKB 3IMQJ 2MZ1A 1R8CA 3RZAA 3UQSA 2GHPA 4R8UB 4KJIA 3UDCA 4DX7A 4O4GB 3ADAC 5A6PA 3OTCA 4Q8EA 1KLMA 3LTOA 4NLXA 2J6UA 5M2RA 2WB4A 2YKNB 2QA1A 4PWDA 3N0VA 1S0MA 1DURA 1S1XB 1XMBA 1Y11A 3N5FA 1S9FA 4O3QA 3RW7A 1B0PA 4G3IA 4ZCKA 1RACB 2AF6A 3DRSA 3M2VB 1RK8A 4ZPCA 1S59A 1YJNS 2KKHA 3PJWA 4HH0A 1AYEA 1FRLA 2AJ4A 2CKWA 2JRSA 2HRYA 2LQ8A 2ZDOA 3Q8VA 4P73A 4X66F 3EZOA 3EGNA 4DR7J 3Q8PB 2HNYA 2W9CB 1WOPA 1VIOA 5LMNJ 4WZMA 4NL5A 1XTZA 1VFJA 2IJNA 1ELOA 1YJVA 4Y2MA 3UDVA 4J5OA 5D77A 3R7NB 3AXKA 4ID8A 4F0KA 1FJEB 3KLHA 1EB0A 3U7JA 4YR2A 4HTJA 2OAUA 2DGTA 4ZMMA 4DSJA 4CLTA 4Y00A 1IBLF 2MLXA 2LLZA 1VQYA 4F4ZA 2V94A 3HHLC 1RYRA 3X3UA 2HGNA 4RW9A 4TY8A 5A8RB 3AJ2A 4DUTA 2HVHA 1MN9A 1S9GB 2QYCA 3IG1B 3US5A 3KHRA 5C25A 1RT3A 1EQMA 2N7YA 2LXUA 4QYRA 4OLPA 4ED8A 1WTBA 1RWNB 2MQNA 2MKIA 4DOZA 1HQEB 3FEXB 3SCIE 4KGXB 1RB0A 2YWFA 4DL7A 4M95A 1H0HB 3I5AA 2HLTA 4ZCMA 3EPGA 2KRBA 2Z56B 3GFYA 2DPJA 4PWDB 2WVFA 3OSNA 3CCRS 3VAMA 2EK6A 1T05B 2A3JA 4JB8B 4QJVA 4GRSA 1GX6A 2X1GA 2DBBA 5F9NA 1CQMA 4IFYA 2E1MC 3QO9B 3M8QA 4Y28C 2C2MB 2IRUA 1U8WA 3P5TL 3OLBA 4A8OA 4X4OA 3PR4A 5L1IA 4O4RA 2O1PA 3N79A 3MI7X 1AB8A 1EIYB 1ZZNA 4DSLA 1VQ6S 2V8VA 3UVJA 3NG8A 2AKWB 3R1LA 4KHMA 4XAKA 1CLFA 2CPYA 2WVBA 4M63A 3CT9A 1P6TA 4FZVA 2DRDA 1X4FA 2ATLA 3FRYA 2V69A 3EX7B 5E0OA 3C19A 3W8PA 4B3MF 1IN0A 1JLCB 1K1QA 2Q6CA 2HHHJ 4RW9B 5A8RA 4B9VA 1T3OA 3E01B 4RU2A 1TL1B 4CT8A 2IC3B 2YKPA 3FKBA 4TN2A 2HNDA 4ED0A 4C8YA 4Q0BA 2P9CA 1U2CA 3T19A 4MAKA 4LF6F 5ETKA 3TUJC 3DRRA 1NDPA 2EFGA 4ZPWR 1OJ4A 4LR8A 4KGZB 1MG7A 4P71A 2W7AA 2LA6A 2DGWA 4V1Ak 5I3PA 4HHHA 5KFRA 2V4JA 4PXDA 3VCDA 1RAEB 1YJUA 3MPUB 5K20B 3JQMA 3TO8A 3M6XA 3FZ2A 1BQNA 1HFEL 2ZBPA 4EO8A 3U27A 2IBKA 1QE1A 4JI3J 4CYUA 2ADCA 4RW6B 4TLQA 1UWBB 4PXCA 4NLQA 2K7KA 5CQGA 4USVA 2AQ4A 1K9MT 5AT1B 3UVJB 3TJAA 4IRDA 3TZWA 3RB6A 1UKUA 2VPXB 3FBBA 2XZDB 3CJ3A 4O44A 3SQOP 3CCES 2W2OP 5HLFB 1RISA 3E2EA 4YS2A 2XI3A 1EAYC 5GAHU 4DV3J 4ILMA 3HHDA 3ET6A 5AE1A 2B43A 3FQKA 1VBXA 3ULHA 1LWCA 1IBKJ 4DZ6A 4RUBA 3OJUA 1H3DA 2J0QD 4WFXA 2A2DA 4XTTA 3RW6A 1URNA 3HHLD 3T41A 2FVCA 1QJHA 3VAHA 3H98A 2DHXA 1S6QB 4LF5F 2DGXA 3HFKA 4UOCA 1PC4A 5J1EB 5FLXY 1WTFA 1GFWB 2HWTA 2DHSA 4LJMA 5DDPC 3AOBA 4R0EA 1JWWA 1F5CA 2M5YA 4HHUA 5RUBA 2ROPA 4QIGA 3QGHA 2DISA 2V4RA 1VQ5S 4AYBD 2XS2A 5DQIA 4FPIA 1AUDA 4JI7J 4H54A 4PYDA 2BZ2A 2E1RA 1U2FA 3M30A 1KTQA 3SFUA 1X5SA 2RAQA 2IAJA 2XWXA 4DPWA 2HK2A 3W5XA 1YJWS 5E3AA 4MYUA 4QR2A 1I51B 3KLHB 4WZQA 2RQKA 4JI1F 3VVTA 5C42B 2CQ2A 2ASJA 3T5JA 3OQ2A 3PNIA 4OX6A 2MQMA 2MSSA 3OVSA 3KKFA 2HFZA 1Q79A 1WC3A 1UW4A 3DLEA 4NRTA 1A0OB 1R8BA 3KLGA 4ECRA 1S5ZA 4MFBA 2MQQA 5DM7Q 2RRBA 4B9MA 4YEAA 5LMUJ 2FVQA 1I3OB 2MZSA 1GMWD 3ZZOA 2DR8A 3MCSA 4K4VA 2BOAA 2C2NA 2IDEA 1FFSB 2Q43A 5LXYA 2UXCF 2PEHA 4L73A 1WF2A 3MM6A 5F9LA 1FKPB 3MM7B 4LFAJ 4EZ6A 2OEKA 4X62J 4MH8A 4IOAQ 1SJ4P 1PJ5A 1WD6A 2XHCA 4DR3J 3DMJB 2GMJA 1JX4A 3U02A 4A8FA 3DRPA 2JEIA 3KK1B 3GIKA 4I4BA 2F63A 3BREA 3I4HX 5D0GA 5B0BA 3LWLA 1IBMJ 3D0IE 1KD1T 1ZZFA 3FK4A 4DCJB 4CO0A 4ZN3A 1XR7A 1ZETA 3W3SA 1S1TA 3NS7B 2Y8YA 2VB6A 3I4PA 3N6NA 5D0EA 3K57A 4LUBA 2G2ZA 3DU5A 2DNRA 3ENVA 3PW5A 2ZJRQ 1UVMA 2RHQB 2FLPA 2GHVC 2WHOA 1FF2A 2HHSA 2XGPA 1CS4B 3DI6A 3EJMA 1JLGA 4ZJOA 3TARA 1CVJA 1N5TA 5D15A 1N52B 3C16A 2JEGA 1YRUA 1G6BA 2F8EX 1RT7B 5B0GA 2AYGA 3MEKA 4IQMA 2VA3A 2K06A 2R4FA 1NDCA 2XEXA 3EVOA 5HSPA 2EC2A 5HO4A 5G0RA 2DD8S 4DX6A 4HYKA 3RRGA 3RR8A 5A0YA 1F3VA 4O23A 4DBQA 3HM9A 4PRFA 4ZLNA 1PYOB 3CCLS 2OLWA 1YHQS 4DG1A 1D8YA 4B3SF 1JB0C 3RU0A 4C9DA 1VQPS 1KQFB 1RLCL 4B02A 1A6LA 4JI6J 5CH7B 2DR9A 1OQ6A 4KRWA 3DDNA 1XEZA 1U1MA 1SVDA 3GYGA 2VFRA 3O8WA 3ITHA 4WJBA 2VFVA 1XMQJ 2OGUA 1LWXA 1WKKA 2ZNZA 3LANA 4QWAA 3AT1B 4L74A 1FKOA 1NK6A 4DPUA 1SKWA 1SV5A 1ZPWX 2HFNA 3GJRB 3DLGB 3FEZA 4S0MA 1RADB 2HGMA 2JZ5A 2DNZA 1ZAXA 2YNHA 3TOQA 4QWCA 3PX4A 4UY8T 1FWLA 4CP5A 2WB1D 4TQSA 1BC6A 4RKUC 3HVWA 1C0UB 3DN9A 3ZZZA 2ZVIA 4IG0B 4YB7A 2EBEA 1R27B 3PKMA 4V19J 3J81Y 3MTJA 1NO8A 2B7BB 1S49A 4MKAA 2XB2D 3SCKE 5CYQA 2JDJA 1S1WB 1WC0A 3AAWB 4LVOP 4KBIA 2H9ZA 3IAS9 4LIWA 2IMWP 3DLLQ 4JV0A 1EQ0A 1YLXA 1T0TV 1HI0P 3MM5B 1RI7A 2M9KA 3LF0A 1U6BA 5D4PA 4RNFA 3C14B 3MAAB 4Z2XA 2AV5A 1QTNB 1N34J 4JYAF 5IOLA 2VQFJ 2LP4A 5F8MA 2RIJA 4O3SA 2XMJA 1QM9A 3E8OA 4F4WA 2IFXA 3CCSS 3CIMA 3ICLA 1WF1A 2L48A 3CEDA 1SBRA 2F1FA 2FB0A 1WKJA 4KIAA 3HT3A 2HAFA 2CDRB 2NLWA 1NJXA 2LKZA 2DRBA 2HS0A 2Y0BB 1X60A 1LW2A 2NXNA 4ANCA 1VQLS 1KVJA 4EMDA 1IR1A 4B3TJ 4I6YA 4BC9A 1RTIB 1VRUB 2OPRB 3K5NA 4I56A 4NI2B 4CLFA 1CEZA 3WQPA 2ZM6F 3CTRA 1ZAWA 3L95X 1NMEB 2YWKA 1ZA2B 3GR1A 3MPYA 3NGKA 4DQQA 3OSPA 4LFBF 2J8SA 3GB0A 2W7OA 1XNRJ 4RUAA 4M5LA 2CPHA 3ILIA 1H6KX 1U2RA 1RAAB 2Y3YA 4KAIA 2J7WA 5AJ3F 1K0TA 3OXGA 5C24A 2BW7A 2DGOA 5KFNA 3IBWA 1HNIA 3N6LA 2XY7A 4ZLPA 4K0KF 2C3UA 2BKNA 1SIZA 3S7RA 4NZ0A 1UJ5A 2CPEA 4BWMA 4ETXA 3Q8RB 2RQCA 1F60B 3MFHA 4QIWD 2OFGX 2RE1A 1IR2A 1Y0HA 2DGVA 2HKEA 2HHWA 3W9HA 3A8IA 1YVFA 4E2FB 2XLIA 2KHDA 2BJ1A 3OL7A 2QG9B 4CM0A 4P2MA 3EICA 4ZPTR 1U1KA 4HKQA 3BBFA 4F2RA 4WF9Q 2NSCA 4KV8A 4CT9A 3GFXA 4IO1A 3FBCA 3ZTQA 5BR8J 3AB2B 3W5YA 4FBTA 1VQ4S 2ZH2A 4YB5A 1VIXA 2AZ1A 3GPAA 3P45B 5KFMA 4NCBA 2BUNA 1RHRB 2GW8A 3MMBB 2HVEA 5KG1A 4U7CA 1TK8A 2AEMA 1QSSA 1S6PA 4Y6IA 2CWKA 1QAYA 2H54B 2GQQA 2OEMA 2GMHA 3DRPB 2PMZD 4K4XA 4RW8B 4C8LA 2PEBA 3KUGA 4Y2CA 4A8KA 2VZ8A 4KR0B 4UUWA 3J7ZT 2V6AA 5F0UA 4AMPA 4DUZJ 4IG0A 1U8SA 1QLNA 2L41A 3MUVP 1LK5A 4IG3A 2P9GA 3I0SA 1IJEB 5ETTA 5HATA 1XMOJ 2FJBB 3P3DA 3NWRA 3AB4B 4CZCA 3K5LA 4AQYJ 3KUHA 3PX0A 4OJHA 2CQHA 3RAMA 1T03A 3DLGA 1OYEA 5KFTA 3EYZA 4GKKF 1SV5B 1PO6A 3DLEB 4NEZA 1EHWA 2EBGA 4PG8A 3NAIA 1VQMS 1T11A 4M5GA 5KFFA 4IRKA 5I3UA 1NB7A 2V8HA 2VASA 4RX6A 2KYZA 1X8DA 1F5AA 2WVEA 1R3NA 1RABB 4F4AA 2UUAF 1FDDA 3ITHB 3TZYA 1H72C 3JAMY 1YJTA 3D7SB 2DTJA 4DCPB 3A3PB 3QZ7A 3G8SA 2UVUA 5CZVA 1BQMA 2CQ1A 2EWHA 5EX3A 5A8KB 3T1YF 4QU7A 2NZCA 4R25A 2E7XA 3O1LA 3NNCA 3Q8SB 2DR6A 2PA8D 4UF4A 1G4CA 2CZ4A 3KK2B 4DQRA 1HBMA 2UP1A 2KH9A 3TVZA 3CXCR 2FJXA 2BE7D 1GQEA 4A48A 1LV5A 2CQ4A 4RZRA 3TW0A 4OV6A 1O5JA 2JLGA 3OPKA 2UU9F 5HBMA 1AXQA 1LK7A 3LUYA 4M5NA 3NEKA 2ZH3A 1TL3A 1BWEA 1ZM2A 1OWXA 2WW8A 1HHTP 1R89A 2P9EA 4M5IA 4MIAA 1L3UA 2E9TA 2R7TA 4ZIVA 4OX7A 4GC6A 3CO9A 4CNZA 5U47A 4JV5J 3TYTA 2HGLA 2WAQD 2ZOGA 1NSKL 1BD6A 3CCMS 1X4GA 5D78A 4J9MA 2UUTA 2J9DE 4LVNP 3HCXA 4USKA 2V67A 3KK3A 4WYLA 1Q86T 3KXDA 3BV8A 3TNVA 1ZH5A 1WG5A 2PC6A 3QBCA 2Z57B 3WZ0A 2J76E 1UVIA 4M1KA 3R97A 1U4BA 2YPZA 2DNPA 2B56A 4PG5A 4Q5VA 2IIHA 1M0SA 1WJ9A 1VI7A 4AT1B 2HVDA 3PHEA 4C8OA 4N76A 3DOLB 3KK1A 3LO3A 4JI4F 2K8GA 4BLGA 1VHFA 1WOOA 4WE1B 2MKYA 5KFOA 4ZVQB 1XJWB
chains in the Genus database with same CATH topology
3HJVA 3CJ8A 2C2NA 3TQEA 3H0PA 4RL1A 3G87A 3IM9A 3TZZA 1MLAA 3IM8A 4AMNA 3R8YA 5DZ7A 3K89A 3TZYA 4RR5A 2CUYA 3TZXA 3TZWA 3QATA 3PTWA 3BV8A 4AMOA 3SBMA 4AMPA 3HHDA 3RGIA 2G1HA 3R97A 3EZOA 2G2OA 2QJ3A 2JFDA 4QBUA 2G2ZA 2G2YA 2H1YA 1NM2A 5DZ6A 2QC3A 4AMMA 2JFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJV A;  3CJ8 A;  2C2N A;  3TQE A;  3H0P A;  4RL1 A;  3G87 A;  3IM9 A;  3TZZ A;  1MLA A;  3IM8 A;  4AMN A;  3R8Y A;  5DZ7 A;  3K89 A;  3TZY A;  4RR5 A;  2CUY A;  3TZX A;  3TZW A;  3QAT A;  3PTW A;  3BV8 A;  4AMO A;  3SBM A;  4AMP A;  3HHD A;  3RGI A;  2G1H A;  3R97 A;  3EZO A;  2G2O A;  2QJ3 A;  2JFD A;  4QBU A;  2G2Z A;  2G2Y A;  2H1Y A;  1NM2 A;  5DZ6 A;  2QC3 A;  4AMM A;  2JFK A; 
#chains in the Genus database with same CATH topology
 3V81 B;  3D5M A;  4I2Q B;  1H2T Z;  2Q3P A;  1Q16 B;  5ETM A;  1TL1 A;  3JAM U;  1FKP A;  3MM7 A;  2ZH8 A;  5KFP A;  3MM6 B;  1BMQ B;  1VRT A;  2LMI A;  3MEG B;  1UZH A;  3KTQ A;  5KFI A;  1S77 D;  2DCL A;  2ZE2 A;  3UN5 A;  2H5E A;  4AE5 A;  3V2U C;  4MFB B;  3PAC A;  4F3M A;  2GC8 A;  2Z30 B;  4NLV A;  3KLG B;  1U45 A;  4P7T A;  4J9L A;  3HD2 A;  4DEZ A;  4IRC A;  1OSC A;  3IGV A;  4P52 A;  1NK8 A;  5C42 A;  3QNW B;  5CYM B;  3RB0 A;  3P96 A;  1ZS6 A;  4Z37 A;  4DFJ A;  3M8Q B;  2NR0 A;  1UZD A;  2CNO B;  4OJ1 A;  4LBI A;  2B0G A;  3I31 A;  4DF4 A;  3A1Y G;  1KWM A;  1FCA A;  2GVZ A;  2ALZ A;  5GAD I;  2FVP A;  2GIR A;  4QWB A;  2DXE A;  2DRA A;  3D0G E;  5DO2 A;  4JI2 J;  4NXM F;  1WI8 A;  4PQA A;  3GYN A;  1URR A;  3HKZ D;  1KHW A;  3PHT A;  2Y1L B;  3QRR A;  2UXD F;  1WHW A;  2C42 A;  1HIY A;  1LXJ A;  1M5K C;  2ZOF A;  1BUX A;  1S6Q A;  4AL5 A;  1RT3 B;  2CIM A;  5KAK A;  1WG1 A;  2I1R A;  4A8X A;  2E7W A;  3BO4 A;  3UNG C;  1TV6 A;  1OO0 B;  2KYX A;  1EKS A;  2MMY A;  2YNF B;  1CQN A;  3D6F B;  1MW7 A;  2G2O A;  4X4V A;  4QR0 A;  4PXE A;  3ET6 B;  3FNN A;  5DLG A;  1NJY A;  2X51 A;  1REG X;  4ZIT A;  2HS4 A;  2OPQ B;  3HVT A;  1GXL A;  1IKY A;  1TKZ A;  3V6D B;  2IRX A;  2K7J A;  3CJR A;  1I6J A;  1WHV A;  4ED4 A;  1DRZ A;  2M8H A;  2BJ3 A;  2LVW A;  2XS5 A;  4TXS A;  5KFX A;  1X4C A;  3DLJ A;  2XMV A;  3N5B A;  5H9E J;  1T9W A;  2EFN A;  1JXV A;  1TR0 A;  2VPZ B;  4NZ6 A;  1PAE X;  3SIP B;  1E6V A;  5LSO A;  2Y1J A;  5KFQ A;  3KOA A;  5HJX A;  4C7Q A;  4UOG A;  3ELH A;  2UV8 A;  4QW9 A;  2GO8 A;  1HNX F;  2HK3 A;  1HI8 A;  3QJP A;  1KBR A;  5IC4 B;  1IWG A;  4QWD A;  2IBO A;  2QA2 A;  1ZTW A;  1TKZ B;  3DKD A;  3KJV A;  3EMT A;  1TL7 B;  1UA0 A;  3CD0 A;  4EGL A;  5CXT A;  1NLK L;  2KRR A;  2HND B;  4Q0B B;  1UMJ A;  3BGU A;  2IC3 A;  3ENQ A;  1GT8 A;  4LRE A;  4OLO A;  1FNM A;  1Q4R A;  3E01 A;  2YKN A;  4ZCL A;  1W2I A;  3SXL A;  3UDL A;  3J80 Y;  2ALY B;  4AD6 A;  4ETZ A;  2RU9 A;  3V6H A;  3HSZ A;  1FD8 A;  3O6Q A;  3UE2 A;  2CJB A;  2V9W A;  1RWW B;  3HDS A;  3M2R B;  4NLO A;  1VHI A;  4DJB A;  1QVG R;  2FC9 A;  3TVY A;  2MJN A;  3OXF A;  4UST A;  2UXB F;  1QD1 A;  1P27 B;  4I2P A;  4QYZ J;  5DQG A;  2BAN A;  3GZ7 A;  2AYB A;  3RYL A;  3SFG A;  3HHL B;  4C97 A;  3PM9 A;  3ILJ A;  3FJ2 A;  4K4Z A;  4BHQ A;  2VA2 A;  4FXW A;  4AXJ A;  5T14 A;  5HAN A;  4PQU A;  1MNE A;  1VJW A;  2LQ9 A;  2VL1 A;  1HBO A;  4RBV A;  2P6S A;  3OD2 A;  1WDT A;  2W2Q P;  3M1V B;  4CO1 A;  3G6Y A;  2QZ8 A;  2K1R B;  3MUM P;  5DRK A;  2DJW A;  4DV4 J;  3H2L A;  2JOQ A;  1EET B;  2GGP A;  1HQU B;  4ZIW A;  3EZ5 A;  2MQP A;  2GAH C;  3FFI B;  5FDL B;  5DZ6 A;  6FDR A;  1N6Q B;  4LF9 J;  2AJQ A;  4J9Q A;  2XHW A;  2V34 A;  4X4T A;  1JLB A;  3OUY A;  1B7Y B;  1U6Z A;  1Y7P A;  2NXE A;  1OQ3 A;  4HI2 A;  3H40 A;  2W9B A;  3FMW A;  3H25 A;  4XK8 C;  2LEB A;  1EAR A;  2KTQ A;  2HMI A;  4ICL B;  4IOC Q;  1RP5 A;  5KFU A;  1QAI A;  4ZP7 A;  1DLO B;  2DNG A;  2XO7 A;  1XNQ F;  2R7V A;  1KP6 A;  1ZAV A;  2G1D A;  3V81 A;  1C1B A;  3BN4 A;  1MSW D;  3IWX A;  4C2M A;  1PIE A;  1NKC A;  4C8Z A;  2CNN B;  1Q8L A;  5HRO B;  3QT8 A;  4WCE Q;  4RO0 A;  2Z2Y B;  3BB5 A;  2FLN A;  3HFZ B;  2XY5 A;  5BYS A;  3KFW X;  4IOB A;  3VAF A;  3VQS A;  1RA7 A;  1H98 A;  3CD5 A;  2BAB A;  1HYS A;  4IFV A;  2GML A;  4LF4 J;  3IO1 A;  3D3B J;  3RBD A;  1RAJ A;  2BEF A;  2C2O B;  5GMD A;  2IM3 A;  4OZ0 A;  2XGQ A;  1NM2 A;  1LOU A;  4L3N A;  3KMS A;  2HHP A;  2B51 A;  4U67 Q;  5AXK A;  5B0F A;  3S6E A;  3PIP Q;  3KK3 B;  4OX8 A;  5KFG A;  4AXI A;  3QZ8 A;  3TJ9 A;  3H5X A;  2R7O A;  2DCU B;  2W4C A;  1YX2 A;  4RJV A;  1S1X A;  2DH7 A;  4DL5 A;  3IRW P;  4PKD B;  2YKO A;  2ZC3 A;  4C11 A;  4DL3 A;  4RPF A;  3KG4 A;  1UFL A;  4WK1 A;  4QOT A;  2Z2Z A;  4GVB B;  2VG6 A;  1S6O A;  1CJU B;  1FDB A;  2L08 A;  2QLF B;  4LBP A;  1FWK A;  4DR6 J;  1HW8 A;  1W26 A;  2AMC B;  1RXO B;  3UDE A;  3EDQ B;  1KDN A;  1RCO B;  3NY0 A;  3PTW A;  3CNQ P;  4I1T A;  4L6V 3;  2DNM A;  4RLE A;  3PX6 A;  2CJX B;  3VV2 B;  2Y1R I;  1S10 A;  4RNN A;  1NZ8 A;  5LSL A;  3NCP A;  3AFG A;  1YI2 S;  2KZZ A;  1D0E A;  5J2Q B;  1S1U A;  2HZV A;  2G9O A;  2V9K A;  2HZC A;  1QAJ A;  4LFB J;  5A8K A;  2QLW A;  3Q2S C;  1P1L A;  3AJD A;  1WEX A;  2AJF E;  3QFW A;  2MY7 A;  4G65 A;  3W5Z A;  4YME A;  4PWW A;  3K5O A;  4F8R A;  4OL8 A;  2R7W A;  3NBP B;  2YPY A;  4DS4 A;  1IM6 A;  4RBT A;  5AJ3 J;  1EP4 A;  4KFB B;  3SSQ A;  2VG7 B;  3T9Z A;  2J0X A;  5I3U B;  2UV8 G;  2ZHO A;  1JJ2 R;  3MEE A;  2CPX A;  3RR7 A;  4DZD A;  1RTJ B;  1XBW A;  3FEY B;  2DNQ A;  2N4C A;  2YH0 A;  1Z2L A;  2Z0G A;  2QX0 A;  4UOF A;  4BWJ A;  2FJA B;  4Q2M A;  3GQC A;  1XIQ A;  3MAQ A;  2Y9H A;  5T7L A;  4F67 A;  2YTC A;  2HFU A;  1HBU B;  1X0P A;  3W60 A;  3POT B;  5E41 A;  2RRA A;  2GNK A;  1TKX B;  4J9N A;  3G9C A;  1VQN S;  1TVR A;  5F8I A;  2OEL A;  2AGO A;  3W8G A;  3ZZT A;  3M8R A;  1RGV A;  4LIR A;  3N6M A;  4EU0 A;  2H51 B;  2BRK A;  5KFW A;  3HSD A;  3GR0 A;  5G4D A;  1G3O A;  4EEY A;  2VH7 A;  3S8S A;  1CC7 A;  4DR1 J;  2OIH A;  3CD7 A;  1NZA A;  2DHA A;  1DTQ A;  1RHQ B;  3Q23 A;  3QLH A;  5BXI A;  1UEV A;  3ZFV A;  2X1B A;  1KVI A;  4DCO B;  2RQM A;  2ZHA A;  2VG5 B;  3LAK A;  4DX5 A;  2RB7 A;  3IBF B;  3LQV A;  1S0N A;  4F36 A;  3F73 A;  3CC4 S;  1H2V Z;  2VOP A;  2NUH A;  3W9I A;  3G71 S;  2DY9 A;  4U95 A;  2H4W B;  2A6O A;  5D4N A;  4GKJ F;  2R8I A;  1NK5 A;  1H38 A;  3OXL A;  2R8G A;  1NPK A;  1PYS B;  2Z8Q A;  1FFW B;  4NML A;  3U1N A;  5AE3 A;  2AYM A;  3VR1 A;  2C2D A;  2AGP A;  4IR1 A;  4K2J A;  2XYH B;  2DIT A;  1HHS A;  4ALZ A;  1W2B R;  1DFD A;  3H5U A;  2XM3 A;  1U6F A;  5CZC A;  3IA0 A;  2FLO A;  2DGQ A;  1CSJ A;  2APO A;  4OHX A;  1S12 A;  2R8K A;  2LYV A;  5F41 A;  2KJV A;  5CA5 A;  2VKZ G;  2QMU B;  4J9V A;  1LW0 A;  1N4L A;  1SJQ A;  5LT5 A;  2XS7 A;  3D67 A;  2HQ3 A;  3SI8 A;  4BDP A;  2VQE F;  4FYV B;  4EK2 A;  3OTD A;  4MIW A;  1VMB A;  2Q6B A;  4DDF A;  4NLR A;  5IWA J;  2FTR A;  5KTQ A;  2FYX A;  1QTM A;  3HSJ A;  4M94 A;  5D3G A;  2NS1 B;  3G4S S;  1IUJ A;  4ES3 A;  1DQ8 A;  5E33 A;  1ZM9 A;  2ZNY A;  2XQC A;  4HHJ A;  4I69 A;  3JSM A;  2VOO A;  4LSL B;  1F9H A;  3SBM A;  2C1E B;  1FE0 A;  1RTH A;  4P75 A;  2RH3 A;  4NPO A;  1FKA F;  1IWA A;  1YRT A;  1LW2 B;  4OJ3 A;  2QE5 A;  1BWV A;  3T3F A;  1VQS A;  3F44 A;  1RT1 B;  1PAU B;  5KG3 A;  2BQ3 A;  3VHQ A;  1N5S A;  1PYT A;  2W7P A;  2HIY A;  3DU6 A;  2G4B A;  2KJW A;  2LQB A;  3HKW A;  1FER A;  3BO3 A;  1QUP A;  4NA3 A;  3CCV S;  2UUB J;  2RF2 B;  3HF5 A;  1CJV B;  2D69 A;  1Q95 G;  4OYZ A;  3BSN A;  4RL1 A;  3BGL A;  3VF0 B;  4U9R A;  1JLQ B;  2HSE B;  2ZBR A;  1HKA A;  8RUC A;  4DV2 J;  2FC8 A;  2A2C A;  2MZQ A;  2C3P A;  2XTJ P;  1U47 A;  2HW3 A;  2BJ7 A;  2K3K A;  1NSQ A;  2BE2 A;  2EW9 A;  2JH3 A;  2XBP A;  4C8N A;  2W2M P;  4N8N A;  1NDL A;  2MKS A;  3M8W A;  3SMZ A;  1S1W A;  5B0E A;  2PDA A;  2UUC J;  3NL0 A;  3N28 A;  2KXF A;  2PSZ A;  1RA6 A;  4OYX A;  5LM7 E;  4HTI A;  3J7Z 5;  1X4D A;  2R2T A;  3K0J A;  2IPO B;  2DIU A;  3BQ1 A;  1G7C B;  1XC9 A;  2KVQ E;  2OTJ S;  5HVH A;  2GS8 A;  4QYZ K;  2YWH A;  2DNO A;  2IYG A;  2JVR A;  4FVC A;  1D9D A;  2VBY A;  2XWY A;  2FHK A;  5HK4 A;  1KVK A;  3QLH B;  1Q1K A;  1WSV A;  5EDW A;  2LDI A;  2B6A A;  3DYA A;  4YR3 A;  4Y65 A;  3GTY X;  2GZO A;  3D9B A;  3NGD A;  1I94 F;  3LAL A;  4LRC A;  2VHG A;  1QSL A;  2JL9 A;  1W7W A;  2V2K A;  2UVV A;  4DV1 F;  3SV3 A;  3K2Y A;  3LP2 A;  2GIF A;  1FA0 A;  1YBA A;  3A13 A;  4DV6 J;  3C66 A;  1RJJ A;  4QZV B;  2J0S D;  4P2X A;  1Z4U A;  3DLB A;  2LCW A;  1IR0 A;  2BDP A;  2YWG A;  1HNZ F;  2Y8W A;  2CPJ A;  1XER A;  3TAM A;  4B9N A;  1HNV B;  1UP1 A;  1HR0 F;  4QW8 A;  4DU7 A;  3I82 A;  1YDL A;  1U24 A;  2MTL A;  4ES2 A;  1UVK A;  3QWP A;  3HJV A;  3OV7 A;  2QSF A;  4WFB Q;  2JEJ A;  3TEH B;  3R7S B;  5EWF A;  5ETQ A;  3MOZ A;  1RT7 A;  2CPZ A;  4WP3 A;  4PYA A;  4CQ1 A;  2KM8 C;  4F26 A;  1PC5 A;  2XNR A;  4JI1 J;  2OP5 A;  2J6S A;  5J2Q A;  5DZ7 A;  3OTO J;  2OD6 A;  3NXZ A;  4ELT A;  5A8W A;  4JI5 J;  3OFH A;  5ADZ A;  4NLG A;  3THT A;  2DH9 A;  1JK9 B;  1U09 A;  3NGU A;  4N7T A;  1N36 J;  3GJS B;  2KM8 B;  2E7V A;  2HHU A;  1FEE A;  1R31 A;  3PJ9 A;  3LP1 A;  1S1T B;  3GMG A;  1UAW A;  3MEC A;  4H4O B;  2R2R A;  1R8A A;  2UXC J;  3ZC4 A;  3KLI A;  2HNZ A;  4X4N A;  2LQJ A;  1X7V A;  2POK A;  5CZD A;  2DVI A;  4PUO B;  3A3N B;  1FRI A;  2L9N A;  2PE8 A;  4PPD A;  3DMJ A;  2KVI A;  2JLE A;  2OSQ A;  2V8D A;  4NLD A;  5J2N B;  3TQE A;  4DR3 F;  3BO2 A;  4DR2 J;  4BC7 A;  4NA1 A;  4RW7 A;  3W2V A;  1DAR A;  2NSB A;  4D3H A;  5I4M A;  3OHB A;  3RAX A;  1YRX A;  3DOM B;  2J7U A;  1B4S A;  3KDN A;  3OVB A;  3CME S;  1V3R A;  1R0A B;  1J2V A;  3MXH P;  2ACM A;  4MIB A;  1V3Z A;  5FII A;  2P6T A;  1FES A;  3OR2 A;  3PYG A;  1FNO A;  3RG6 A;  3CCT A;  5LL6 d;  5JUM A;  4ZLJ A;  3DFE A;  3FUY A;  3EXY A;  5CAB A;  3BS9 A;  4M5D B;  4W92 B;  2AWZ A;  1PG5 B;  4EFA C;  2H5J B;  2CVE A;  2B4V A;  2E1P A;  1NK4 A;  3WX8 A;  2DYA A;  2DY1 A;  2QA4 G;  2IAJ B;  3ETM A;  1RU2 A;  3JS9 A;  3M30 B;  1CUL B;  2CRL A;  2VUG A;  3WBZ A;  2I5J B;  3GWC A;  1UPP A;  1S6U A;  4I68 A;  1WWH A;  3W61 A;  2OTL S;  2I9S A;  5F8J A;  4QWE A;  1JMT A;  1MWZ A;  2A1B A;  5FDL A;  5KG0 A;  3VGU A;  1R8H A;  4N77 A;  2HEK A;  1C1C B;  4ECW A;  5J2P A;  1H7W A;  2D9O A;  5H9E K;  4JI0 J;  1RT4 B;  3FBF A;  2OMO A;  1F1B B;  1YSJ A;  1S1V B;  2XZT B;  3TZX A;  1U1O A;  1UVJ A;  4USU A;  2BM1 A;  4ZJQ A;  2AD9 A;  4YDX A;  3FSI A;  5IS2 A;  2FLL A;  1HQ2 A;  1JJC B;  1WUU A;  5DDQ C;  3DGP A;  5EX0 A;  1LWE B;  1RAI B;  1RSC A;  2FGO A;  2LXF A;  3FZB A;  3RGI A;  5IT9 U;  3PO5 A;  1FJG J;  3TUP A;  2HQF A;  2DNH A;  3DXB A;  1XR5 A;  1SJ1 A;  2FGC A;  2EEY A;  3LH2 S;  4ZA1 A;  2AT1 B;  1PJ7 A;  4ED1 A;  2BAN B;  1HMV A;  4MT1 A;  1S4E A;  2CG8 A;  4I2P B;  5J2M A;  2ZUA A;  3GFH A;  5GMK a;  1FJC A;  1XNQ J;  1QE1 B;  3KG0 A;  4HAC B;  5EUH A;  4F3Q A;  1BQN B;  1E6Y A;  3NNH A;  3GJQ B;  3UWT A;  2V2Q A;  1S4F A;  4DMZ A;  2YNI B;  1Q53 A;  4LSZ B;  2F40 A;  1NH8 A;  1SQE A;  2PII A;  3H42 A;  3SCL E;  4CLL A;  7AT1 B;  2W9A A;  1HNW F;  2OML A;  1M5H A;  2ADB A;  1RKJ A;  1VJQ A;  4LF4 F;  1OIA A;  4I0W A;  1JXE A;  1V5V A;  2B9E A;  3WHI A;  3BGR A;  2HFS A;  3CB4 A;  3JYT B;  4K5R A;  2OPP A;  3GP9 A;  1IM4 A;  2ZKU A;  4OZ3 A;  6AT1 B;  4YY3 J;  1KFS A;  2VQF F;  3TI0 A;  1VIS A;  4OX9 F;  1B0T A;  4K50 A;  1FX2 A;  3EDR B;  3G86 A;  3QIP B;  2WVD A;  3DLK A;  4OZ5 A;  3M9M B;  3KLV A;  4K4S A;  1ZOT A;  3U1L A;  5K8P A;  4X4R A;  1HMV B;  5DG7 A;  4DV0 F;  2HBR B;  1IKX B;  2KT3 A;  3PG9 A;  5GAG I;  4C4W A;  3CC7 S;  2DNN A;  2OPQ A;  4USI A;  3HJF A;  4WU3 A;  4MK8 A;  4IFY B;  2UVW A;  4H4K A;  5HMY A;  2FVS A;  2JLF A;  4PCQ A;  2CJA A;  4NE9 C;  4C3K A;  1LWE A;  2YQ3 A;  1J5O A;  4TYA A;  3HHE A;  4HDH A;  5FLX U;  1KN6 A;  1MMD A;  1M1K T;  1RT5 A;  1NEE A;  4LF2 A;  1RT4 A;  2E5J A;  3DHW C;  5L38 A;  5EN1 A;  1U1P A;  1VC0 A;  3HO1 A;  3IWL A;  1QY7 A;  5J2P B;  4W98 A;  4I67 A;  1U49 A;  2PN6 A;  5ETP A;  2V8P A;  3C8Y A;  3QT7 A;  4P10 A;  2FHM A;  4B08 A;  1V3S A;  1REV A;  1S9G A;  2I5J A;  2VD3 A;  1F0X A;  3PEH A;  4DR7 F;  1YKW A;  1CUL A;  3H0P A;  3R27 A;  5DDR C;  1J5O B;  3THV A;  1GTH A;  2FVR A;  2DEJ A;  2XMT A;  2HAI A;  4OZN A;  1RT2 B;  2VPY B;  5B0D A;  2R7S A;  4YDD B;  4LRF A;  1HAR A;  1RT6 B;  2HQG A;  5LSR A;  3DLH A;  2VOD A;  1EJ7 L;  2P8I A;  3R5C A;  5L46 A;  2WRM A;  4DHV A;  2CUY A;  3V4I B;  2B9X A;  1IKX A;  3GON A;  3MM9 B;  3AQO A;  3H4B A;  4Z7C A;  5IXU A;  2M8D B;  5D4O A;  4F0H A;  2B9W A;  3TA2 A;  4KY3 A;  2IM2 A;  3BPS P;  4AL7 A;  3GYX B;  4NMX A;  1JLF A;  4M5J A;  4NOH A;  3B54 A;  3MEG A;  2WSE C;  2GIQ A;  5HVF A;  1M90 T;  3VAK A;  1APS A;  3PXG a;  1FDA A;  1SC6 A;  3GG0 A;  1K73 T;  2XCP A;  2QFJ A;  5A2Q U;  4M8L A;  2M4M A;  4X4Q A;  3HZE A;  4ERD A;  1HWJ A;  4NYZ A;  3T6B A;  5GAD U;  4OYP A;  4USM A;  4DL2 A;  4CCH A;  4OZ2 A;  5ETO A;  3B4D A;  4DV5 J;  3IC1 A;  3CCU S;  3K5P A;  4U8Y A;  2AEF A;  1FNX H;  3EZU A;  3UR3 C;  1NJW A;  1E6Y B;  4HR2 A;  9ATC B;  1VC5 A;  4CLP A;  3M8S A;  2CFX A;  2VBX A;  1D8Z A;  1SL0 A;  2D74 B;  3M6U A;  4E0D A;  4R8U A;  3FBE A;  5KOX A;  4KE5 A;  4HI1 A;  3I5C A;  1UJ4 A;  1VBZ A;  3E3X A;  2DPI A;  4DSI A;  2J8A A;  2QLB B;  3A8K A;  5A8W B;  5IQ6 A;  2ZD1 A;  3TAP A;  1CBK A;  1FDN A;  2QV6 A;  1C0T B;  4G1I A;  1O0P A;  2C2E A;  2H4Y B;  4WII A;  3OR1 B;  4WK3 A;  4ENO A;  4ILR A;  4X4S A;  4J9K A;  4DR5 J;  1P9Q C;  1JLE B;  2RSQ A;  2YX4 A;  2ZUG A;  3KMQ A;  4O0N A;  2I2Y A;  1LXN A;  2C2Z B;  2C3M A;  1YIJ S;  4DN9 A;  3OBI A;  3DGP B;  4DV7 F;  5HP1 B;  3D4J A;  4F4K A;  3B78 A;  3TR5 A;  4DQI A;  5IV4 A;  3IRX A;  4KYZ A;  2RNE A;  1S57 A;  1D9A A;  5I42 B;  2HBZ B;  1FVQ A;  1N5Y A;  1SJ3 P;  2HUR A;  3TAM B;  4A8Y A;  1C1C A;  2GA7 A;  2GV1 A;  2EPI A;  3PZP A;  1WOR A;  4F3O A;  1NK7 A;  3AJ1 A;  1WHX A;  5L9X A;  1Y3K A;  3SDE A;  1NHK L;  3UFC X;  4OV1 A;  2RIL A;  3LW5 C;  1HWI A;  3MD3 A;  2RML A;  1Q5Y A;  1KSP A;  2V63 A;  2BKO A;  3BYR A;  4E98 A;  3CE8 A;  4ZHR B;  4B3R J;  1T9V A;  3M7V A;  3MMA A;  2ZVS A;  2XO6 A;  2FZK B;  2IM1 A;  2ZKT A;  5C2G A;  4LFC J;  3X1L B;  2NPI A;  4ED6 A;  2AGQ A;  1U25 A;  3NCQ A;  1R7I A;  4ZDN A;  3EM1 A;  5K5M A;  2CVI A;  2G0I A;  5K14 B;  1YTY A;  1R6Y A;  5AXM A;  4DV2 F;  1DQA A;  2NXC A;  4C98 A;  3MCM A;  4A8Q A;  2CQB A;  1BQX A;  4ELU A;  3HMJ G;  2R42 A;  4NCA A;  1GMV A;  2KFN A;  3DM2 B;  4FVM A;  2NYI A;  5E2Q A;  2CQD A;  4GO5 X;  2E5L J;  1CG2 A;  2E5H A;  4KKO B;  3AOC A;  4OI3 A;  3CD6 S;  1DJ0 A;  5AE2 A;  2UUC F;  4RNM A;  1OS5 A;  1TK5 A;  4P2F A;  4RW7 B;  1WF0 A;  1SQF A;  3MZI A;  3W2V B;  5A76 A;  3GV5 B;  5DGB A;  2QMX A;  5GME A;  3LP0 A;  4RUH A;  2RT3 A;  1H2U X;  3C6T B;  1X5O A;  1LQ9 A;  3L9Z A;  2J9E A;  3R6L B;  3BBB A;  1J27 A;  5JMN A;  2XSJ B;  1NSA A;  1U26 A;  5IM0 A;  4FNH A;  3H20 A;  2RS8 A;  3UW1 A;  1UWA A;  1S72 S;  2HNZ B;  2PMH A;  2YNG B;  2OD4 A;  1S7I A;  1FRH A;  3JSY A;  4LF1 A;  4DL6 A;  4B9S A;  1RDR A;  1J5E J;  2AEJ A;  4V19 X;  3K5M A;  3OHA A;  1TAQ A;  3CMA S;  1F6T A;  2HLU A;  4I6W A;  2VFU A;  4LF7 J;  1KS2 A;  4MJK A;  4B3O A;  2V0N A;  4JOU A;  3KJQ B;  2Y0S D;  3BBC A;  3G8Q A;  1NRK A;  3L09 A;  5CAA A;  5LMU F;  4DV6 F;  1RT1 A;  2X3G A;  3NMR A;  2ZZM A;  3I9V 9;  1GXU A;  2GCF A;  2DNL A;  4BBY A;  1KC8 T;  4IDK A;  1TEL A;  3JSR A;  1UVN A;  4NCG A;  3FCV A;  3AOA A;  5E3Q A;  1IKV A;  3DC2 A;  1C4A A;  2OPS A;  2VFT A;  1OY8 A;  4Y2I A;  4O3O A;  4ID5 B;  1RAH B;  1U7L A;  2RKI B;  2ZC4 A;  3DCA A;  4ZP6 A;  2R8J A;  2WBM A;  2FHJ A;  3L3C A;  4Z7Y A;  1HNV A;  3R3T A;  1Z2Z A;  1EKR A;  1H7X A;  4RW4 B;  3H5Y A;  4N56 A;  3TAQ A;  2V8G A;  2QC3 A;  5HMZ A;  2CNL B;  2O5D A;  2W8K A;  1Q8K A;  3VAG A;  1M5O C;  1BXN A;  2CQ0 A;  4O3N A;  2HFO A;  1FT8 A;  2FUG 9;  1VR6 A;  2ILZ A;  2QL5 B;  2V68 A;  3JXO A;  4MKY A;  2KB2 A;  2SXL A;  3IAM 9;  1TL5 A;  2RKI A;  4ID5 A;  4G1Q B;  1S79 A;  5HVG A;  2OPS B;  4DPX A;  2EFQ A;  3HFV A;  2C3O A;  3S1T A;  1GMU A;  1KOO A;  1PJ6 A;  2XYP B;  2WCX A;  3F0N A;  1T7P A;  4MMO A;  3BR9 A;  2XLK A;  5IFM A;  3I0R B;  1HBN B;  1ICE B;  2QSW A;  3HP6 A;  2LU2 A;  4P6Q A;  2HHV A;  3QRP A;  3BH7 B;  1NPR A;  3LWM A;  4XPC A;  4CLS A;  3I6P A;  3IWN C;  3PEJ A;  4WFY A;  5THW A;  2IDL A;  2W8L A;  4K4W A;  4EBE A;  1OMS A;  2KI2 A;  1FXL A;  3CO0 P;  3MD1 A;  4DSE A;  1FI4 A;  3TAN A;  1RTD A;  1SL2 A;  3FCW A;  1JKH A;  3N01 A;  2VG5 A;  2PI4 A;  5EHH A;  3C14 A;  4X65 F;  1KR4 A;  5KG7 A;  5DDO C;  3MM5 A;  1AZS B;  1Y00 A;  4K4T A;  3I0R A;  1GNK A;  1HW9 A;  2E29 A;  5IM0 B;  1PGZ A;  4X4U A;  1TFW A;  1U0H A;  3GU0 A;  2HS3 A;  1K0V A;  3UN2 A;  1X31 C;  3UCG A;  1XQI A;  3D68 A;  3DNC A;  3PVX A;  1NH7 A;  1UFK A;  1Y5N B;  1GAO A;  1FRK A;  3D6M B;  7FD1 A;  1X4A A;  2YX1 A;  1HBU A;  1UTA A;  2RF2 A;  1LFP A;  4IYQ A;  1C4C A;  2D3O 1;  3BF4 A;  3SSR A;  5EWE A;  5GAG U;  3V6J A;  1LNQ A;  1XR6 A;  3T5L A;  4JP8 A;  4WFN Q;  4Q7A A;  1HPZ A;  4CIO A;  2KT5 A;  2MKC A;  5K14 A;  3NNA A;  1N33 F;  3SV4 A;  4FNI A;  3QJL A;  3EUN A;  3MEE B;  3M6V A;  1KQS R;  4JV2 A;  2GAG C;  1JNZ B;  2AIR B;  4QQB A;  4TYB A;  5KFZ A;  1IKV B;  3MMA B;  1Q5V A;  5F3T A;  5F8L A;  2YX7 A;  4W90 B;  3C3L A;  1RWM B;  1KHV A;  2EG1 A;  4I7F B;  4YQW A;  4R0J A;  3OVA A;  2QYG A;  1RTZ A;  5E3P A;  1TUW A;  2ZEJ A;  4FKX A;  2FHJ D;  5HL7 Q;  5GAE I;  5DG9 A;  2RHS B;  2WOM B;  3CDB A;  3I96 A;  3JTO A;  2WVC A;  3SDE B;  2MQO A;  3BPD A;  3B82 A;  4GMK A;  4P7V A;  3EWG A;  5KFC A;  3C46 A;  4ED2 A;  4BCA A;  3PRV A;  1YBT A;  4TY9 A;  5KT6 A;  5I42 A;  5A0Y B;  1TKD A;  4TNO A;  3M32 B;  2W24 A;  5DJB A;  4FBU A;  1T94 A;  1YGY A;  4KPC A;  2ILY A;  3C15 B;  5J1P A;  4GVB A;  4ZVH A;  2XC9 A;  3MUT P;  3VGV A;  4EBD A;  4UY8 5;  1VQ9 S;  3L7P A;  3D28 A;  1CJT A;  3A12 A;  4H4M B;  4F4Y A;  5CD4 H;  1IQZ A;  4YOE A;  3D3C J;  4LQ9 A;  1AT1 B;  2ZHB A;  3B8H A;  4KO0 A;  3VGS A;  3D1H A;  2UUA J;  1CPZ A;  2ASY A;  3ZNU A;  2BXJ A;  3EGW B;  4KKO A;  1S9E A;  2WSF C;  1S0O A;  3GE9 A;  3MCO A;  4IFV B;  2OUG A;  4Y2A A;  1P1T A;  3M8Y A;  4KHR A;  1K44 A;  1N56 A;  3HHN B;  2PO4 A;  4PR6 A;  3SZ2 A;  3BGF A;  3GFZ A;  2OH2 A;  4C48 A;  2DK2 A;  5H1S V;  3BZQ A;  3M6W A;  4J37 A;  3QSY B;  2J9C A;  2QJ3 A;  3CJS A;  3V5R A;  2RRN A;  1VK8 A;  3IS9 A;  2NRE A;  1HD0 A;  5SUH A;  5F8H A;  1L3T A;  4ZHR A;  3UD5 A;  2MHE A;  4U7U D;  3UPF A;  1S97 A;  2MKJ A;  1Q81 T;  3POT A;  3A8J A;  3DDK A;  1CC8 A;  3B4M A;  1TL4 A;  2CAJ A;  2CQP A;  1FTR A;  5B0A A;  3TA0 A;  5GAH I;  2E1C A;  4LMZ A;  2WW4 A;  5IC6 B;  3QT5 A;  2X3D A;  4ZCI A;  2I38 A;  2MZJ A;  1SCJ B;  5CCL A;  4U6P A;  3CF5 Q;  2MPU A;  2ZFH A;  1RTJ A;  4ER8 A;  5ETV A;  2GGP B;  4N8O A;  5J1N A;  2YKM B;  1FVS A;  3M9N B;  3MMJ A;  2VDI A;  2ZBI A;  3W9J A;  1IXK A;  2HBQ B;  1TMJ A;  4LF6 J;  3M1V A;  3DDI A;  4QIE A;  1UCN A;  1VS3 A;  4J9U E;  5L1K A;  2KT2 A;  1HWL A;  3Q22 A;  4PQU B;  2U1A A;  4JI4 J;  2GJ2 A;  3JTP A;  3LA0 A;  2A0F B;  3OR1 A;  5KG2 A;  4OHV A;  1AA1 B;  4WBF A;  1C0T A;  5CYJ A;  2Y1I A;  3CWJ A;  3FSX A;  1QAX A;  3NLC A;  2IVM A;  4LSN A;  3EPI A;  5FD1 A;  5ETN A;  3KLF A;  1I5O B;  4USW A;  4FDF A;  2RDJ A;  4NX9 A;  1MML A;  4RBU A;  3UD3 P;  3TQ1 A;  1OY6 A;  2FZG B;  3BKF A;  3DRX A;  3W64 A;  5J1E A;  4WFA Q;  4QIV A;  2XNQ A;  3OJS A;  3S01 A;  1TAU A;  3NGT A;  1RWK B;  2OEJ A;  4FYX B;  4A46 A;  3K7R A;  4UT4 A;  5KT5 A;  3KNG A;  3GIM A;  3Q0A A;  1CJU A;  1S7H A;  3P6Y C;  1S76 D;  2NUU G;  5L39 A;  1LWC B;  3J7Y U;  4OYB A;  1MRO A;  1DTT A;  4Q2L A;  3ZZY A;  2MKK A;  2OFH X;  2Z2M A;  5GAE U;  3BJY A;  2R2S A;  2EKN A;  1R6V A;  1VDH A;  3ONQ A;  1WC5 A;  5K9F A;  1M5S A;  1RHU B;  3TRG A;  2MGZ B;  1UA1 A;  5KFD A;  3UCU P;  1NK9 A;  4LF5 J;  4O44 B;  3MPW A;  2B3T B;  4UQT A;  4LF8 J;  1A9N B;  2J0W A;  2B4O A;  3TVK A;  2EK1 A;  2RDI A;  2DEI A;  2HQC A;  3R9L A;  3RRK A;  4KGK A;  1BY9 A;  1MWQ A;  1KNZ A;  4OIX A;  2Q79 A;  4DV5 F;  2G0C A;  2OPP B;  3IN5 A;  3PFO A;  4GKJ J;  4CLU A;  3JYT A;  4C0O C;  3BGR B;  4DX8 H;  2CJK A;  2JVO A;  4LT6 A;  3NS5 A;  1TQL A;  1RYS A;  1IKY B;  1RQ0 A;  5A6W A;  3V6D A;  4IUF A;  2VC0 A;  1TP7 A;  4ZVP B;  1RT6 A;  4AMN A;  2Z58 B;  1WEL A;  2AYE A;  2P2C B;  2VF3 A;  1GXT A;  3OT9 A;  2YNI A;  3D6T B;  3QAT A;  3QGI A;  4ICL A;  3PKY A;  4DLE A;  1N32 J;  4F02 A;  1TV6 B;  2E9Z A;  2CQ3 A;  2JWN A;  2KO1 A;  1REV B;  1JLB B;  1O8B A;  3FCH A;  4FYW B;  4HAC A;  4DR5 F;  3G82 A;  4LRA A;  1D9F A;  2IY5 B;  2JHE A;  2VZ9 A;  4KH0 B;  3CVK A;  3EVM A;  3FFI A;  5GVQ A;  4CI0 B;  5L9N A;  3OFE A;  1HQU A;  5F8N A;  4LRB A;  1FRJ A;  2HPU A;  4G6V B;  3SCJ E;  3NWG A;  4LSN B;  4EYH B;  2L9D A;  5KT3 A;  1VYA A;  1X0F A;  2UVR A;  4DPY A;  1OSD A;  2GVZ B;  1HD1 A;  4PG7 A;  2K3I A;  3FMB A;  3RB3 A;  2D1C A;  2YXL A;  4K2X A;  5DGA A;  2O01 C;  4UZC A;  2KG1 A;  1T05 A;  1QUV A;  2L3M A;  2PMW A;  5IQQ A;  1NSP A;  2BM0 A;  2DKO B;  1YZ7 A;  2BKP A;  3MDF A;  1FRM A;  2CG4 A;  2M88 A;  2ZWO A;  3CJT A;  1V5I B;  3CIZ A;  3JQK A;  1IBC B;  1KON A;  4QPT A;  2IVF B;  5ITH A;  4TU7 A;  1DY3 A;  2L9W A;  3BR8 A;  1D3W A;  1HQE A;  3HLU A;  3DLK B;  4B9U A;  4B3R F;  4CO5 A;  4Q43 A;  3NOC A;  4DV3 F;  1WAC A;  3M2R A;  2EFV A;  5MAO A;  2VON A;  2F9J A;  3IFE A;  2BJ8 A;  1IBK F;  3IR7 B;  4OHZ A;  3PFE A;  4TY8 B;  3J7Y I;  3DHX A;  1HWK A;  3QSI A;  2NPF A;  2UXB J;  5D8H B;  2GJF A;  1ITP A;  3AHP A;  1QDU B;  4OI0 A;  4C0H A;  1UEK A;  3QID A;  4KQZ A;  1SH0 A;  2CDQ A;  3QAU A;  3IS9 B;  1TL7 A;  2F7V A;  3FVY A;  4L72 B;  2FPH X;  2OHD A;  4IKA A;  2QFI A;  1NJZ A;  4ZPB A;  4GC7 A;  2E5L F;  3G87 A;  4DQS A;  2FY1 A;  2LU1 A;  2OJ3 A;  3OR2 B;  4NLW A;  4C0B A;  2RU3 A;  3FSY A;  3PDN A;  3BKU A;  4A8W A;  3ILL A;  3CJK B;  2LEC A;  4KPY A;  1R43 A;  4E8U A;  1E6V B;  3OTB A;  4MK9 A;  4O3P A;  3SYZ A;  4M5K A;  3Q8U A;  2RUS A;  2NCK L;  5LOQ A;  2F4V F;  4QU6 A;  2WSC C;  4URQ U;  1YIT S;  3TJ8 A;  3W66 A;  1NBE B;  2ASD A;  4FF2 A;  2HHX A;  2AW0 A;  4AFF A;  4TLR A;  3R6G B;  4FP9 A;  1FWP A;  4KO0 B;  4KC5 A;  4P72 A;  3J81 j;  3V6K A;  1Y10 A;  4KB7 A;  2MGZ A;  2A6M A;  1HLW A;  1FD2 A;  3CMQ A;  3BYP A;  1GMW A;  3GSI A;  3R5J B;  3ZZP A;  4USH A;  5J2N A;  2DGS A;  1I94 J;  3BDE A;  2C3Y A;  1CJT B;  2VC1 A;  5CZX A;  5L1J A;  2D41 A;  2YNF A;  3BN7 A;  2I6W A;  3HVR A;  4HL9 A;  1VQK S;  3MUR P;  1BLU A;  1VBK A;  4O4G A;  1X9W A;  2R2U A;  1KEK A;  4H4O A;  3T1H J;  2KU7 A;  2QO3 A;  4WU2 A;  3UCZ P;  2Q66 A;  1SQG A;  2MLZ A;  4WXO A;  4ANE A;  1RWO B;  3KLF B;  4URS A;  2QL7 B;  1JLA B;  2DHH A;  5C7P A;  1FFG B;  3K8W A;  4LR7 A;  3OFF A;  1HR0 J;  1BQM B;  3LGH A;  4I7F A;  3CDU A;  4OI6 A;  4X2B A;  2DR7 A;  1FXR A;  3O3L A;  1RBL A;  4B3M J;  2GJI A;  2BW2 A;  2O67 A;  2ZZN A;  4JYA J;  2JX2 A;  4TU9 A;  3W63 A;  3FRZ A;  3MCN A;  1WHY A;  2ZOM A;  4GVL A;  1NU4 A;  1DBD A;  2DHG A;  2YKM A;  3H7H B;  2MXY A;  1MU2 B;  4HT7 A;  1TKT B;  3PY8 A;  4HEA 9;  1GX5 A;  5KFJ A;  4JI5 F;  3WC0 A;  1TUG B;  2CJY B;  3M2U B;  4UTG A;  5H9F K;  3H2U B;  3EVW A;  1GTE A;  3K58 A;  3CJ0 A;  1RHK B;  3OFG A;  2OI2 A;  4DN0 A;  4F04 B;  4K8R A;  4CO4 A;  2EVZ A;  1SB6 A;  3DOM A;  3W2W B;  4OHW A;  4O3R A;  1TUV A;  5KFY A;  5BJR A;  4B9L A;  2PFF B;  1T9U A;  3TEG A;  4I2Q A;  3CJ4 A;  2ZM6 J;  1VOM A;  4FF4 A;  1U1N A;  1H73 A;  2CPD A;  2I8E A;  3CSK A;  4P2S A;  2RS2 A;  1UL3 A;  5DG8 A;  2B6A B;  3DYA B;  3HHK A;  5T41 A;  3IR6 B;  2C2K B;  2MKH A;  3DOL A;  1S6P B;  4ITS A;  1AZS A;  4Q45 A;  4DR2 F;  2F8H A;  3HI9 A;  2PFD A;  3VAL A;  4AMM A;  3MPV A;  4JI6 F;  2BBE A;  3LP1 B;  1JJH A;  3MEC B;  4X66 J;  5B0C A;  4CO3 A;  2PD1 A;  3IR5 B;  4PG6 A;  1WC1 A;  1N88 A;  3P4U B;  2I0X A;  2JC0 A;  3HSG A;  1FX4 A;  2F8M A;  4KV8 B;  2HFV A;  2WZ1 A;  1IQT A;  1MLA A;  1CJK B;  2ZIT A;  2YY3 A;  2B7C B;  2F65 A;  3MF5 A;  4H4M A;  4J9S A;  3DRY A;  1IBL J;  3L4B C;  4LBH A;  1NKB A;  5DQH A;  3C15 A;  2M3D A;  4ZVE A;  3KLE B;  2LEP A;  2R7R A;  2R8H A;  1NJI T;  4DFK A;  1JLQ A;  5CYM A;  2XCA A;  2E44 A;  1R0C B;  1K1S A;  1VQ7 S;  1N8R T;  1UJ6 A;  2IM0 A;  2MLY A;  1HNI B;  4ZVT B;  2HWI A;  5HJY A;  3CCJ S;  4ED7 A;  1RHM B;  4WTO B;  3L7O A;  1T9T A;  1SIW B;  2N3L A;  3PW0 A;  2X1F A;  4FPR A;  4OQJ A;  3H8Y A;  3BH6 B;  4H4K C;  4EZ9 A;  1YJ9 S;  4K7Q A;  1RAG B;  2CQG A;  2BQR A;  1SKR A;  3R2C J;  2NYH A;  3BQ0 A;  2FJE B;  2HRT A;  1FRX A;  2WON A;  1SUQ B;  1F2H A;  1RTH B;  3GG1 A;  1RCX B;  3AA8 A;  2UUW A;  3IM8 A;  4HVZ A;  4NI2 A;  3AY0 A;  1RTI A;  1VRU A;  2F4F A;  1Y5I B;  2OPR A;  3O2I A;  4K59 A;  4NCG B;  4IDK B;  4NRU A;  2O66 A;  1FTC A;  1TU0 B;  2B4U A;  1OPI A;  4RUC A;  2CZV C;  3D1Q A;  1PKU A;  3RAQ A;  5D3G B;  3MMC A;  2IA0 A;  1JNR B;  1HPZ B;  1T03 B;  3DGV A;  2H65 B;  2CA9 A;  3ISN C;  5F8G A;  3ZZU A;  4GKK J;  4WKR A;  1NND A;  3UR0 A;  3ZTS A;  3FQL A;  1LWF B;  3TWZ A;  2PI5 A;  2LEA A;  4NYP A;  4B3T F;  1LW0 B;  2D7S A;  1NHV A;  3O44 A;  3ZXW A;  3CDW A;  5CD4 A;  3T6J A;  3MM8 A;  1VCT A;  2RDD A;  4R5P A;  4M5H A;  4YR0 A;  2YWE A;  1NKE A;  1GH8 A;  1T02 A;  4CNY A;  3MED B;  4TQR A;  1FEH A;  2JSX A;  2ZJQ Q;  4CLZ A;  1HNW J;  1VGY A;  4YFU A;  2MQ8 A;  1TFY A;  4QR1 A;  2ACY A;  3LP0 B;  4DR4 J;  1Q78 A;  3I5B A;  4F50 A;  2J6T A;  4J9R A;  2MYF A;  2XMK A;  4RR5 A;  2H48 B;  4G1P A;  1T8E A;  3TX0 A;  4K0K J;  3PV8 A;  1GEH A;  1LWF A;  4OX9 J;  4WXW A;  5JVH Q;  5D0H A;  2CWX A;  4W4M A;  5EWG A;  1U0S A;  4C3M A;  4KHP J;  2AJ2 A;  2B5J B;  4FKY A;  4DUY F;  3MMC B;  4WTY A;  3NOG A;  2QRR A;  4JI8 F;  1FKO B;  1IBM F;  4OHY A;  3GCW P;  3KHL A;  2MEW A;  2HZA A;  2UUB F;  3N9U C;  1V6H A;  3BGO P;  1DQ9 A;  5BYR A;  4Y0F A;  3K59 A;  2MB0 B;  5B08 A;  2YKQ A;  4LSL A;  2J5A A;  4WIQ A;  3JSM B;  4C8K A;  3UI3 A;  4OYI A;  1TMM A;  2A10 A;  2WON B;  3ETO A;  1TVR B;  5BR8 F;  2ZH1 A;  2D9P A;  2OKQ A;  4XPE A;  5KOW A;  1BHN A;  2ZH5 A;  3UN3 A;  4PG4 A;  3CC2 S;  2B8P A;  1MN7 A;  4XDD A;  5CCM A;  4KTQ A;  1ZA1 B;  5T7L B;  3K89 A;  1ZPV A;  3KDO A;  4ILL A;  4NLU A;  5ETS A;  3OL6 A;  1H74 A;  5HQM A;  3Q8Q B;  4DG1 B;  1DZ5 A;  4NYO A;  4RW4 A;  2EG2 A;  4RWX A;  2WK4 A;  5E5N A;  1FHT A;  1ARO P;  4NLT A;  1UET A;  4GO7 X;  4KFB A;  1SJF A;  1X5T A;  3LPY A;  4DQP A;  1WNE A;  3VWS A;  1Q0N A;  4ZKA A;  5K8M A;  4DUZ F;  3W1Y C;  4DU8 A;  2HRU A;  2UZA A;  3MHY A;  2HBY B;  3PIO Q;  2MJU A;  4AND A;  5E3C A;  3BQ2 A;  1HI1 A;  3C16 B;  5BYQ A;  1XMO F;  4AQY F;  1B64 A;  3DI6 B;  2ZD1 B;  4B3O B;  4WP8 A;  3J81 U;  4DV1 J;  4YHH J;  2XYG B;  3R5D A;  1Q7L B;  3DXS X;  3D54 A;  3CCW A;  1D1U A;  2BRL A;  1Z1Z A;  3D1O A;  2KG0 A;  1YQH A;  2E5G A;  4ZVR B;  4CWB A;  4ECY A;  2BX6 A;  1F3F A;  2YNG A;  2VG6 B;  4FN5 A;  1DTQ B;  1ZTT A;  3PYE A;  4X62 F;  1VC6 A;  1L3V A;  3GV8 B;  2G1H A;  4C11 B;  3Q2T C;  4PAB A;  2IVY A;  4N47 A;  3T1Y J;  2ERR A;  1SI9 A;  4ZPV R;  1KLN A;  4LF8 F;  1LEO A;  5CYQ B;  1RWP B;  2EKY A;  2X7I A;  3AQP A;  3C6T A;  5AXN A;  4CH7 A;  2GVD A;  4RNO A;  3BSA A;  5C2C A;  4RNH A;  4DS5 A;  4NXN J;  1RWU A;  2W1B A;  1TKX A;  5L1L A;  3THP A;  5KFL A;  1C0U A;  3VTI A;  1N5Q A;  2KDO A;  3P49 B;  1AFI A;  3DM2 A;  2CPF A;  3ZZR A;  1JLF B;  2UU9 J;  2HIQ A;  2HG4 A;  4NA2 A;  1JXL A;  1VQ8 S;  2QGF B;  3T5H A;  1HYS B;  1I1G A;  5AXL A;  3M2U A;  1NDK A;  4ZP8 A;  3VGT A;  1P8G A;  3OTO F;  3G6V A;  3ENW A;  2QL9 B;  4A4J A;  4EYI B;  2C22 A;  1N32 F;  2XSF A;  4MKV A;  3MWB A;  2V5H G;  3RBZ A;  3BSC A;  4AL6 A;  4IO9 Q;  2VV5 A;  5KT7 A;  3CCZ A;  1PCA A;  2VG7 A;  5KFB A;  4FYY B;  1EP4 B;  4K5S A;  1C1B B;  3KYL A;  3KNA A;  3F56 A;  2E66 A;  1RZM A;  3PJX A;  3QMQ A;  2RUG A;  1JIH A;  4Q44 A;  3AA9 A;  3Q83 A;  2MDA A;  2V2Z A;  4WWS A;  4OJG A;  2W9B B;  1S1U B;  2BAC A;  4FS2 A;  1B70 B;  2N4D A;  3OUY B;  5E7O B;  4MK7 A;  4YB1 P;  2G0J A;  3I32 A;  3HVA A;  2JC1 A;  4L75 A;  3VZI A;  2ZH6 A;  4B3S J;  4LQ3 A;  3PW2 A;  1TK0 A;  1HNX J;  4OI1 A;  3C6U B;  3QQC D;  5IT4 A;  4X64 J;  2PT0 A;  1KQK A;  5HMX A;  2N82 B;  4N5S A;  1PBA A;  4KH1 B;  1SC1 B;  4CLK A;  4A47 A;  3OTE A;  4DWI A;  2BE9 B;  5G0R B;  5HP1 A;  4PEO A;  3ZO7 A;  1SXL A;  4IH5 A;  3Q8Y A;  2ZH9 A;  5D4L A;  3KUE A;  4KGV B;  1UW9 A;  2VKR A;  2D3O R;  1YJ7 A;  3PYF A;  3GV7 B;  1T3N A;  1JLG B;  2ZWP A;  5M2P A;  5HLF A;  3C2P A;  1CS4 A;  2MQL A;  4FXV A;  3M8P A;  1L3K A;  2H5I B;  1SC4 B;  3LGN A;  4ZVO B;  2K2P A;  2IJF A;  5JXS A;  1UWB A;  4IR9 A;  5I3Q A;  2NZ4 A;  3T5K A;  1VLY A;  3BM7 A;  1ZM4 A;  3QIP A;  4CYU B;  4DL0 C;  8AT1 B;  3PRD A;  2C28 A;  1VBY A;  2KFZ A;  1C2P A;  3CJK A;  1ROF A;  2V4J B;  4JV1 A;  2EFP A;  4KGM A;  2Q1L A;  1DAX A;  3DRR B;  3LGM A;  4UW2 A;  4JI2 F;  3E51 A;  3KJV B;  4ZVU B;  1DLO A;  2ZH7 A;  2F4V J;  4WFZ A;  3Q24 A;  2CJ9 A;  4DF8 A;  1HHQ A;  1N34 F;  2R3V A;  5HQL A;  3GII A;  1RBA A;  3AD9 C;  2COL A;  5KFS A;  3BSO A;  4A8S A;  1JLC A;  4DFM A;  2YH1 A;  2R7U A;  1KOH A;  2BOP A;  2FJV A;  4XIU A;  4YB6 A;  1FE4 A;  1WC4 A;  2W4D A;  3W62 A;  2BV3 A;  1DHM A;  2M52 A;  2RVJ A;  1X5P A;  4ED3 A;  2DXD A;  3I56 S;  5F3Z A;  2IA6 A;  2CPI A;  4LF7 F;  3NRB A;  3MM9 A;  4OZJ A;  2XZW A;  1EET A;  5KFE A;  2KN4 A;  3CJQ A;  3V4I A;  3AOD A;  3QJJ A;  2IHR 1;  3HVT B;  3T1H F;  4JUZ A;  3QO9 A;  1IJF B;  1RT2 A;  2YVS A;  1MWY A;  3IBC B;  2B8Q A;  3J80 U;  2VJU A;  2U2F A;  4WKY A;  3D66 A;  2FQQ B;  5DS7 A;  4ECS A;  2ATC B;  2EXU A;  3CJ5 A;  3I9Z A;  3OW2 R;  2FY8 A;  4K4U A;  5SZT A;  3K8V A;  3GSD A;  3G6E S;  9RUB A;  3JTN A;  5E3R A;  4OFZ A;  4Q8F A;  4QPX A;  3MOJ B;  1Y3J A;  4I6A A;  3VAJ A;  2KZM A;  3D6H B;  3A3O B;  3RB4 A;  3R7B B;  2ZZT A;  3G82 B;  1PSD A;  1U1Q A;  2F9D A;  2N3O A;  1RT5 B;  5C25 B;  1X9S A;  3IG1 A;  1O6X A;  3CCQ S;  3R1H A;  3ZTO A;  5DET A;  3WC2 A;  1T9Y A;  3SSS A;  3PR5 B;  1TZ0 A;  3H4D A;  4DV0 J;  2DXF A;  2LXI A;  2XMW A;  3D2W A;  4HT5 A;  3HXM A;  4U8V A;  3UD4 P;  4MTP A;  2FDN A;  4NLY A;  2V2V A;  4M5D A;  1WG4 A;  2O3D A;  4UUX A;  2IMO A;  2CNK B;  2E5I A;  2HWH A;  4P9S A;  8ATC B;  3PCO B;  3MFI A;  3HT0 A;  1K8A T;  4EUV A;  1W25 A;  4PZV A;  4QCL A;  2ZDP A;  5KT2 A;  3CDE A;  3JSB A;  5D6G A;  2W9C A;  2ROG A;  1F5B A;  4OYO A;  2DB1 A;  2E1A A;  4RW6 A;  2AU0 A;  4LRD A;  4Y3C A;  2ZE2 B;  1X4E A;  3M4X A;  3ZTR A;  5ETL A;  4ELV A;  4C8M A;  1VRT B;  3EXC X;  5CHC B;  5KFA A;  5B09 A;  4PAA A;  2AP6 A;  3UNY A;  4F25 A;  3OL8 A;  3HK2 A;  3DRS B;  3M2V A;  1KQG B;  1PBU A;  2QN6 B;  3RBX A;  3M9O B;  3KHG A;  3W7B A;  1Y9O A;  2XMU A;  3RTV A;  2MST A;  1KFD A;  3U1M A;  2VIH A;  2CAD A;  1DTT B;  1MRO B;  1OPZ A;  3BEG B;  4WE1 A;  3QAE A;  4OZ1 A;  4CH0 S;  5IT0 A;  2R9L A;  3T1A A;  3MPD A;  5LMN F;  5IZH A;  1KLM B;  2DNK A;  4LF9 F;  4PUO A;  1FJG F;  3KLI B;  4OI4 A;  5HN0 A;  3G6X A;  2BQU A;  1WDD A;  4NZ7 A;  1SPB P;  3QFH A;  2IYI A;  3W65 A;  3J7A 1;  2Z4P A;  2OO4 A;  3KG1 A;  2VJV A;  4K4Y A;  5B7W A;  1HWU A;  2LDY A;  3ILO A;  4F0M A;  4ZK7 M;  5H9F J;  5J2M B;  3ZZ0 A;  3EGV A;  5IV3 A;  4B9T A;  4M5M A;  1PIL A;  4KSE B;  1QSY A;  3VZH A;  3M8P B;  4F7V A;  4X84 A;  1N0V C;  1X4B A;  2ZBQ A;  4XO0 A;  1LKZ A;  1IKW A;  3CW2 C;  3ISN D;  4X4P A;  2VU5 A;  5JVG Q;  4DR1 F;  3EGZ A;  1WC6 A;  2RD5 C;  4TVA B;  1B99 A;  3HUL A;  3CGI A;  6FD1 A;  3R5G A;  5KFK A;  3T9N A;  5LJ5 Y;  4RU9 A;  4FS1 A;  3VVU A;  3R5B A;  5DLF A;  1Q82 T;  1XN9 A;  2GO9 A;  4IQX A;  1S0V A;  2JFK A;  2MZR A;  1S1V A;  3I87 A;  2H3E B;  5D0R A;  4OZL A;  1MMN A;  3C6U A;  2ABY A;  4TU8 A;  2V4Q A;  3PW4 A;  3NGR A;  1HBM B;  1WOS A;  5FJ4 A;  4YY3 F;  2XG8 A;  4N41 A;  4UQG A;  4ECT A;  3H2V E;  4C3L A;  3P8B B;  1SKS A;  3NMA A;  1EX8 A;  1ULR A;  1U48 A;  4DR6 F;  4HDG A;  4A8M P;  3RUB L;  1FJ7 A;  3NCR A;  1RHJ B;  4P74 A;  4YN3 B;  3VAI A;  4JV5 F;  4ECQ A;  2XMA A;  1XK8 A;  3G8T A;  2HHH F;  3GIJ A;  1VLO A;  2MHN A;  2GFF A;  4J91 A;  2QA4 S;  2OSR A;  4J7C A;  1RWX B;  2PGC A;  3TUZ C;  2VQE J;  2HNY B;  2M2B A;  3CPW R;  1R0A A;  1IVZ A;  2HHQ A;  2DH8 A;  3MR6 A;  2NQP A;  1EZZ B;  3FDS A;  3O5T B;  2CQC A;  4I64 A;  4NWB A;  2W4P A;  2VIC A;  4ECU A;  3OLA A;  3H59 A;  1S9E B;  2QT7 A;  1N54 B;  4ES1 A;  4DR4 F;  3TZZ A;  1SH2 A;  2AJ0 A;  3MTK A;  2GVD B;  4JI3 F;  1VRQ C;  3CUL A;  4DXL A;  2KL8 A;  2BJD A;  2BYC A;  4ED5 A;  4NLP A;  2BE2 B;  2QLX A;  3A4T A;  3MR2 A;  4EBC A;  1V9O A;  3BDP A;  1TL3 B;  1WSR A;  1NUE A;  2IRY A;  3IGN A;  5HBM B;  2XLJ A;  3RRH A;  1B3T A;  3M32 A;  3TUI C;  4KHP F;  2R7X A;  4DUY J;  3PYD A;  5JJB A;  4CH1 A;  4L76 A;  1RE1 B;  4JI8 J;  4O0I A;  1F9F A;  4QBU A;  3DOK A;  1WEY A;  1RAO A;  2ZBC A;  2AZ3 A;  3FGV A;  3GIL A;  1WKL A;  5IT9 Y;  1YJR A;  3AD8 C;  5LJ3 Y;  3KK2 A;  1YBU A;  2EI5 A;  3NKY A;  1UEU A;  1SL1 A;  1N0U A;  1Y4Z B;  2RJZ A;  2WOM A;  4HH1 A;  4B17 A;  2HVZ A;  3TP2 A;  1AW0 A;  1ZM3 A;  4ATN A;  4NAS A;  4BS2 A;  1S48 A;  3H90 A;  1JQG A;  2BA9 A;  1X9M A;  1FK9 B;  2KHC A;  3JB9 k;  2B4P A;  4DL4 A;  2BVZ A;  2DR5 A;  4JI7 F;  1G1X A;  4CDI A;  2YQ1 A;  1OY9 A;  3QGP A;  4NXM J;  1T95 A;  5A2Q Y;  2R7Q A;  2XY6 A;  4YP3 A;  1Y5L B;  1SKU B;  2UXD J;  1LFW A;  1RAF B;  1A7G E;  2AHO B;  3KJF B;  2QTW A;  3G2X A;  2G2Y A;  2P5V A;  2C2R A;  4OYW A;  3I0S B;  4IG3 B;  4PPZ A;  1J5E F;  2KXN B;  2CZ9 A;  2W01 A;  3QRQ A;  1TTH B;  1FXD A;  3LP2 B;  4QIF A;  3MR5 A;  4DFP A;  2J7K A;  3SQG A;  2YKA A;  1UPM B;  3HPO A;  4ZVG A;  2V50 A;  3MR3 A;  2QLJ B;  2X1A A;  3AXM A;  1O51 A;  3MGJ A;  3NGS A;  4Y2K A;  2QIF A;  5KG5 A;  4YHH F;  1SJR A;  4RW8 A;  1U0H B;  4RWW A;  3F41 A;  5HI7 A;  2GHW A;  2FJW A;  3QT6 A;  2DIV A;  2B5J A;  4JBC A;  4DV7 J;  4OMF G;  4TKT A;  2JEF A;  4LFA F;  4U96 A;  3MMB A;  4CO2 A;  1UVL A;  4FYD A;  5IWA F;  2MZT A;  3FC9 A;  2EFO A;  1JKH B;  3K17 A;  3LAM A;  3TA1 A;  1KKH A;  1RTD B;  2BJE A;  3NAH A;  2XUL A;  4NEY A;  5KFH A;  2HQD A;  4OYA A;  1M5P C;  5KFV A;  2ROE A;  2J9D A;  4PXB A;  3BKT A;  3GIR A;  4L3K A;  4MKB A;  4WYW A;  3RJM B;  3VQT A;  3MAA A;  4UOH A;  1NCL A;  2F5G A;  1N48 A;  4NXN F;  1NXI A;  1SH3 A;  5KG4 A;  1HBN A;  1SC3 B;  1M1H A;  2M7S A;  2NXJ A;  3ZNJ 1;  3LPE A;  4F2S A;  3MED A;  2HQI A;  4Y34 A;  2VFS A;  1ZBT A;  4EWT A;  3IP0 A;  3MM8 B;  4D3G A;  4R5P B;  1NPP A;  3RBE A;  3KJN B;  3SQG B;  1L5U A;  3WIU A;  2FD2 A;  1B7F A;  4G1Q A;  1BE4 A;  2LA4 A;  4LFC F;  2F3J A;  3GLJ A;  2WTF A;  3MAH A;  2CQI A;  1CJV A;  3HD1 A;  4EI2 A;  4LR9 A;  4CRJ A;  1M5V C;  2LFV A;  5C24 B;  5C5J A;  3QWU A;  4DPT A;  3KHH A;  4DSK A;  2D3Z A;  5F0W A;  2DNY A;  2QMW A;  4CTA B;  1NHU A;  2XMM A;  3ZTP A;  3PW7 A;  1T9X A;  3N4W A;  2BJ9 A;  2M0G B;  2W25 A;  3NP5 A;  1Q8B A;  1KTV A;  4U7U K;  2FJD B;  5HMW A;  2VBZ A;  4WPA A;  4UZB A;  3NBP A;  4ZN1 A;  3TX8 A;  4FF3 A;  1FK9 A;  2GQC A;  3MR7 A;  5M2U A;  2QEX S;  1SUQ A;  1YG0 A;  4HLB A;  3Q86 A;  4X64 F;  2KXH A;  4DV4 F;  1R0B G;  4ZS6 A;  1YWX A;  1L3S A;  2FZC B;  2ZH4 A;  1F9E B;  2VBW A;  3QGG A;  4CTA A;  1VK3 A;  4USJ C;  3CJ2 A;  3V4M A;  1U02 A;  2AX1 A;  2DO0 A;  2FIU A;  4ZPA A;  1XMQ F;  3Q89 A;  3R5A A;  2JNJ A;  2LQ5 A;  2ZJP Q;  4ZPD A;  4ZVF A;  1NB2 A;  1RKI A;  1UFW A;  4OYM A;  5HAO A;  1VQO S;  5EGY A;  1HL6 A;  4AMO A;  3L7U A;  4CLY A;  3KLE A;  2NXU A;  2RQ4 A;  2YBV A;  2BR0 A;  2HYI B;  3JQJ A;  2M70 A;  3I55 S;  5KG6 A;  1NAQ A;  2KFY A;  2XSJ A;  1K47 A;  1N33 J;  4MYT A;  3LOU A;  2D3U A;  2EC0 A;  2DGU A;  5MLC V;  2B9Y A;  2WBR A;  4PWU A;  2E9R X;  1YZ6 A;  2A18 A;  5K8O A;  3M8Z A;  2MY8 A;  1CJK A;  2PA3 A;  3HZG A;  3WX4 A;  1S99 A;  5KT4 A;  1B0V A;  1HNZ J;  1QVF R;  2YWW A;  4JI0 F;  2ASL A;  1RLD A;  3J7A N;  2HVI A;  1JJ4 A;  3CJ8 A;  1Q8I A;  2HHT A;  2DT9 A;  2Z2L A;  4ZP9 A;  1FO1 A;  3WIV A;  1WI6 A;  2IJR A;  4DI6 A;  5L8R C;  1U1R A;  3G96 A;  3PO4 A;  2YNH B;  3QPI A;  2GQ2 A;  2XI2 A;  3ISZ A;  1M1G A;  5ETR A;  1OYD A;  1R8P A;  1X4H A;  2CJQ A;  3H5S A;  3R8Y A;  1U1L A;  5HRO A;  1D09 B;  4FXD A;  4C6A A;  3UO0 A;  2YQ0 A;  3IXQ A;  1KRP A;  3B6B A;  1NK0 A;  1RUS A;  4KT0 C;  2JJ4 D;  3GCX P;  1F2G A;  5DM6 Q;  4AUK A;  2G13 A;  1AFJ A;  3D0H E;  4NLS A;  3PRB A;  1N36 F;  4DPO A;  3EE3 A;  2W2P P;  2BMB A;  2HMI B;  3W2W A;  1HA1 A;  2VPW B;  3ENA A;  4ZVS B;  4F4X A;  3GJT B;  4ECX A;  1YK9 A;  4J9P A;  4YUD A;  1N6Q A;  4J90 A;  1RU1 A;  1XWL A;  2FHO B;  4XDC A;  4FF1 A;  4WP9 A;  1TKT A;  1RWV B;  4URG A;  1MU2 A;  4J9O A;  1N5Y B;  1P9Y A;  2AJ1 A;  4DSF A;  3IM9 A;  4IH6 A;  4ECZ A;  1XNR F;  3IRX B;  3M05 A;  1ZYQ A;  4ZOS A;  2GX8 A;  2K1R A;  2CXE A;  3CUN A;  4CLW A;  3CDA A;  4X65 J;  2W2N P;  5K8N A;  1HBO B;  3SEO A;  2VDH A;  4CM2 A;  4ECV A;  3R2D J;  3KWM A;  5HQ8 A;  1N5V A;  7FDR A;  1JLE A;  4EO6 A;  1IKW B;  3QYY A;  3WDO A;  4DLG A;  1BGX T;  4ZJL A;  4ZLL A;  3P5B P;  2DO4 A;  2CYY A;  1RBO B;  3HX9 A;  4OI2 A;  3OL9 A;  1ACM B;  1JLA A;  3HHL A;  5LXR A;  1WEZ A;  3AH6 A;  3NS6 A;  2JFD A;  1Q7Y T;  1GK8 A;  1G2E A;  1AUS L;  2N7C A;  4IH7 A;  3AD7 C;  3A8E A;  2H1Y A;  2AX0 A;  3DOK B;  3IMQ J;  2MZ1 A;  1R8C A;  3RZA A;  3UQS A;  2GHP A;  4R8U B;  4KJI A;  3UDC A;  4DX7 A;  4O4G B;  3ADA C;  5A6P A;  3OTC A;  4Q8E A;  1KLM A;  3LTO A;  4NLX A;  2J6U A;  5M2R A;  2WB4 A;  2YKN B;  2QA1 A;  4PWD A;  3N0V A;  1S0M A;  1DUR A;  1S1X B;  1XMB A;  1Y11 A;  3N5F A;  1S9F A;  4O3Q A;  3RW7 A;  1B0P A;  4G3I A;  4ZCK A;  1RAC B;  2AF6 A;  3DRS A;  3M2V B;  1RK8 A;  4ZPC A;  1S59 A;  1YJN S;  2KKH A;  3PJW A;  4HH0 A;  1AYE A;  1FRL A;  2AJ4 A;  2CKW A;  2JRS A;  2HRY A;  2LQ8 A;  2ZDO A;  3Q8V A;  4P73 A;  4X66 F;  3EZO A;  3EGN A;  4DR7 J;  3Q8P B;  2HNY A;  2W9C B;  1WOP A;  1VIO A;  5LMN J;  4WZM A;  4NL5 A;  1XTZ A;  1VFJ A;  2IJN A;  1ELO A;  1YJV A;  4Y2M A;  3UDV A;  4J5O A;  5D77 A;  3R7N B;  3AXK A;  4ID8 A;  4F0K A;  1FJE B;  3KLH A;  1EB0 A;  3U7J A;  4YR2 A;  4HTJ A;  2OAU A;  2DGT A;  4ZMM A;  4DSJ A;  4CLT A;  4Y00 A;  1IBL F;  2MLX A;  2LLZ A;  1VQY A;  4F4Z A;  2V94 A;  3HHL C;  1RYR A;  3X3U A;  2HGN A;  4RW9 A;  4TY8 A;  5A8R B;  3AJ2 A;  4DUT A;  2HVH A;  1MN9 A;  1S9G B;  2QYC A;  3IG1 B;  3US5 A;  3KHR A;  5C25 A;  1RT3 A;  1EQM A;  2N7Y A;  2LXU A;  4QYR A;  4OLP A;  4ED8 A;  1WTB A;  1RWN B;  2MQN A;  2MKI A;  4DOZ A;  1HQE B;  3FEX B;  3SCI E;  4KGX B;  1RB0 A;  2YWF A;  4DL7 A;  4M95 A;  1H0H B;  3I5A A;  2HLT A;  4ZCM A;  3EPG A;  2KRB A;  2Z56 B;  3GFY A;  2DPJ A;  4PWD B;  2WVF A;  3OSN A;  3CCR S;  3VAM A;  2EK6 A;  1T05 B;  2A3J A;  4JB8 B;  4QJV A;  4GRS A;  1GX6 A;  2X1G A;  2DBB A;  5F9N A;  1CQM A;  4IFY A;  2E1M C;  3QO9 B;  3M8Q A;  4Y28 C;  2C2M B;  2IRU A;  1U8W A;  3P5T L;  3OLB A;  4A8O A;  4X4O A;  3PR4 A;  5L1I A;  4O4R A;  2O1P A;  3N79 A;  3MI7 X;  1AB8 A;  1EIY B;  1ZZN A;  4DSL A;  1VQ6 S;  2V8V A;  3UVJ A;  3NG8 A;  2AKW B;  3R1L A;  4KHM A;  4XAK A;  1CLF A;  2CPY A;  2WVB A;  4M63 A;  3CT9 A;  1P6T A;  4FZV A;  2DRD A;  1X4F A;  2ATL A;  3FRY A;  2V69 A;  3EX7 B;  5E0O A;  3C19 A;  3W8P A;  4B3M F;  1IN0 A;  1JLC B;  1K1Q A;  2Q6C A;  2HHH J;  4RW9 B;  5A8R A;  4B9V A;  1T3O A;  3E01 B;  4RU2 A;  1TL1 B;  4CT8 A;  2IC3 B;  2YKP A;  3FKB A;  4TN2 A;  2HND A;  4ED0 A;  4C8Y A;  4Q0B A;  2P9C A;  1U2C A;  3T19 A;  4MAK A;  4LF6 F;  5ETK A;  3TUJ C;  3DRR A;  1NDP A;  2EFG A;  4ZPW R;  1OJ4 A;  4LR8 A;  4KGZ B;  1MG7 A;  4P71 A;  2W7A A;  2LA6 A;  2DGW A;  4V1A k;  5I3P A;  4HHH A;  5KFR A;  2V4J A;  4PXD A;  3VCD A;  1RAE B;  1YJU A;  3MPU B;  5K20 B;  3JQM A;  3TO8 A;  3M6X A;  3FZ2 A;  1BQN A;  1HFE L;  2ZBP A;  4EO8 A;  3U27 A;  2IBK A;  1QE1 A;  4JI3 J;  4CYU A;  2ADC A;  4RW6 B;  4TLQ A;  1UWB B;  4PXC A;  4NLQ A;  2K7K A;  5CQG A;  4USV A;  2AQ4 A;  1K9M T;  5AT1 B;  3UVJ B;  3TJA A;  4IRD A;  3TZW A;  3RB6 A;  1UKU A;  2VPX B;  3FBB A;  2XZD B;  3CJ3 A;  4O44 A;  3SQO P;  3CCE S;  2W2O P;  5HLF B;  1RIS A;  3E2E A;  4YS2 A;  2XI3 A;  1EAY C;  5GAH U;  4DV3 J;  4ILM A;  3HHD A;  3ET6 A;  5AE1 A;  2B43 A;  3FQK A;  1VBX A;  3ULH A;  1LWC A;  1IBK J;  4DZ6 A;  4RUB A;  3OJU A;  1H3D A;  2J0Q D;  4WFX A;  2A2D A;  4XTT A;  3RW6 A;  1URN A;  3HHL D;  3T41 A;  2FVC A;  1QJH A;  3VAH A;  3H98 A;  2DHX A;  1S6Q B;  4LF5 F;  2DGX A;  3HFK A;  4UOC A;  1PC4 A;  5J1E B;  5FLX Y;  1WTF A;  1GFW B;  2HWT A;  2DHS A;  4LJM A;  5DDP C;  3AOB A;  4R0E A;  1JWW A;  1F5C A;  2M5Y A;  4HHU A;  5RUB A;  2ROP A;  4QIG A;  3QGH A;  2DIS A;  2V4R A;  1VQ5 S;  4AYB D;  2XS2 A;  5DQI A;  4FPI A;  1AUD A;  4JI7 J;  4H54 A;  4PYD A;  2BZ2 A;  2E1R A;  1U2F A;  3M30 A;  1KTQ A;  3SFU A;  1X5S A;  2RAQ A;  2IAJ A;  2XWX A;  4DPW A;  2HK2 A;  3W5X A;  1YJW S;  5E3A A;  4MYU A;  4QR2 A;  1I51 B;  3KLH B;  4WZQ A;  2RQK A;  4JI1 F;  3VVT A;  5C42 B;  2CQ2 A;  2ASJ A;  3T5J A;  3OQ2 A;  3PNI A;  4OX6 A;  2MQM A;  2MSS A;  3OVS A;  3KKF A;  2HFZ A;  1Q79 A;  1WC3 A;  1UW4 A;  3DLE A;  4NRT A;  1A0O B;  1R8B A;  3KLG A;  4ECR A;  1S5Z A;  4MFB A;  2MQQ A;  5DM7 Q;  2RRB A;  4B9M A;  4YEA A;  5LMU J;  2FVQ A;  1I3O B;  2MZS A;  1GMW D;  3ZZO A;  2DR8 A;  3MCS A;  4K4V A;  2BOA A;  2C2N A;  2IDE A;  1FFS B;  2Q43 A;  5LXY A;  2UXC F;  2PEH A;  4L73 A;  1WF2 A;  3MM6 A;  5F9L A;  1FKP B;  3MM7 B;  4LFA J;  4EZ6 A;  2OEK A;  4X62 J;  4MH8 A;  4IOA Q;  1SJ4 P;  1PJ5 A;  1WD6 A;  2XHC A;  4DR3 J;  3DMJ B;  2GMJ A;  1JX4 A;  3U02 A;  4A8F A;  3DRP A;  2JEI A;  3KK1 B;  3GIK A;  4I4B A;  2F63 A;  3BRE A;  3I4H X;  5D0G A;  5B0B A;  3LWL A;  1IBM J;  3D0I E;  1KD1 T;  1ZZF A;  3FK4 A;  4DCJ B;  4CO0 A;  4ZN3 A;  1XR7 A;  1ZET A;  3W3S A;  1S1T A;  3NS7 B;  2Y8Y A;  2VB6 A;  3I4P A;  3N6N A;  5D0E A;  3K57 A;  4LUB A;  2G2Z A;  3DU5 A;  2DNR A;  3ENV A;  3PW5 A;  2ZJR Q;  1UVM A;  2RHQ B;  2FLP A;  2GHV C;  2WHO A;  1FF2 A;  2HHS A;  2XGP A;  1CS4 B;  3DI6 A;  3EJM A;  1JLG A;  4ZJO A;  3TAR A;  1CVJ A;  1N5T A;  5D15 A;  1N52 B;  3C16 A;  2JEG A;  1YRU A;  1G6B A;  2F8E X;  1RT7 B;  5B0G A;  2AYG A;  3MEK A;  4IQM A;  2VA3 A;  2K06 A;  2R4F A;  1NDC A;  2XEX A;  3EVO A;  5HSP A;  2EC2 A;  5HO4 A;  5G0R A;  2DD8 S;  4DX6 A;  4HYK A;  3RRG A;  3RR8 A;  5A0Y A;  1F3V A;  4O23 A;  4DBQ A;  3HM9 A;  4PRF A;  4ZLN A;  1PYO B;  3CCL S;  2OLW A;  1YHQ S;  4DG1 A;  1D8Y A;  4B3S F;  1JB0 C;  3RU0 A;  4C9D A;  1VQP S;  1KQF B;  1RLC L;  4B02 A;  1A6L A;  4JI6 J;  5CH7 B;  2DR9 A;  1OQ6 A;  4KRW A;  3DDN A;  1XEZ A;  1U1M A;  1SVD A;  3GYG A;  2VFR A;  3O8W A;  3ITH A;  4WJB A;  2VFV A;  1XMQ J;  2OGU A;  1LWX A;  1WKK A;  2ZNZ A;  3LAN A;  4QWA A;  3AT1 B;  4L74 A;  1FKO A;  1NK6 A;  4DPU A;  1SKW A;  1SV5 A;  1ZPW X;  2HFN A;  3GJR B;  3DLG B;  3FEZ A;  4S0M A;  1RAD B;  2HGM A;  2JZ5 A;  2DNZ A;  1ZAX A;  2YNH A;  3TOQ A;  4QWC A;  3PX4 A;  4UY8 T;  1FWL A;  4CP5 A;  2WB1 D;  4TQS A;  1BC6 A;  4RKU C;  3HVW A;  1C0U B;  3DN9 A;  3ZZZ A;  2ZVI A;  4IG0 B;  4YB7 A;  2EBE A;  1R27 B;  3PKM A;  4V19 J;  3J81 Y;  3MTJ A;  1NO8 A;  2B7B B;  1S49 A;  4MKA A;  2XB2 D;  3SCK E;  5CYQ A;  2JDJ A;  1S1W B;  1WC0 A;  3AAW B;  4LVO P;  4KBI A;  2H9Z A;  3IAS 9;  4LIW A;  2IMW P;  3DLL Q;  4JV0 A;  1EQ0 A;  1YLX A;  1T0T V;  1HI0 P;  3MM5 B;  1RI7 A;  2M9K A;  3LF0 A;  1U6B A;  5D4P A;  4RNF A;  3C14 B;  3MAA B;  4Z2X A;  2AV5 A;  1QTN B;  1N34 J;  4JYA F;  5IOL A;  2VQF J;  2LP4 A;  5F8M A;  2RIJ A;  4O3S A;  2XMJ A;  1QM9 A;  3E8O A;  4F4W A;  2IFX A;  3CCS S;  3CIM A;  3ICL A;  1WF1 A;  2L48 A;  3CED A;  1SBR A;  2F1F A;  2FB0 A;  1WKJ A;  4KIA A;  3HT3 A;  2HAF A;  2CDR B;  2NLW A;  1NJX A;  2LKZ A;  2DRB A;  2HS0 A;  2Y0B B;  1X60 A;  1LW2 A;  2NXN A;  4ANC A;  1VQL S;  1KVJ A;  4EMD A;  1IR1 A;  4B3T J;  4I6Y A;  4BC9 A;  1RTI B;  1VRU B;  2OPR B;  3K5N A;  4I56 A;  4NI2 B;  4CLF A;  1CEZ A;  3WQP A;  2ZM6 F;  3CTR A;  1ZAW A;  3L95 X;  1NME B;  2YWK A;  1ZA2 B;  3GR1 A;  3MPY A;  3NGK A;  4DQQ A;  3OSP A;  4LFB F;  2J8S A;  3GB0 A;  2W7O A;  1XNR J;  4RUA A;  4M5L A;  2CPH A;  3ILI A;  1H6K X;  1U2R A;  1RAA B;  2Y3Y A;  4KAI A;  2J7W A;  5AJ3 F;  1K0T A;  3OXG A;  5C24 A;  2BW7 A;  2DGO A;  5KFN A;  3IBW A;  1HNI A;  3N6L A;  2XY7 A;  4ZLP A;  4K0K F;  2C3U A;  2BKN A;  1SIZ A;  3S7R A;  4NZ0 A;  1UJ5 A;  2CPE A;  4BWM A;  4ETX A;  3Q8R B;  2RQC A;  1F60 B;  3MFH A;  4QIW D;  2OFG X;  2RE1 A;  1IR2 A;  1Y0H A;  2DGV A;  2HKE A;  2HHW A;  3W9H A;  3A8I A;  1YVF A;  4E2F B;  2XLI A;  2KHD A;  2BJ1 A;  3OL7 A;  2QG9 B;  4CM0 A;  4P2M A;  3EIC A;  4ZPT R;  1U1K A;  4HKQ A;  3BBF A;  4F2R A;  4WF9 Q;  2NSC A;  4KV8 A;  4CT9 A;  3GFX A;  4IO1 A;  3FBC A;  3ZTQ A;  5BR8 J;  3AB2 B;  3W5Y A;  4FBT A;  1VQ4 S;  2ZH2 A;  4YB5 A;  1VIX A;  2AZ1 A;  3GPA A;  3P45 B;  5KFM A;  4NCB A;  2BUN A;  1RHR B;  2GW8 A;  3MMB B;  2HVE A;  5KG1 A;  4U7C A;  1TK8 A;  2AEM A;  1QSS A;  1S6P A;  4Y6I A;  2CWK A;  1QAY A;  2H54 B;  2GQQ A;  2OEM A;  2GMH A;  3DRP B;  2PMZ D;  4K4X A;  4RW8 B;  4C8L A;  2PEB A;  3KUG A;  4Y2C A;  4A8K A;  2VZ8 A;  4KR0 B;  4UUW A;  3J7Z T;  2V6A A;  5F0U A;  4AMP A;  4DUZ J;  4IG0 A;  1U8S A;  1QLN A;  2L41 A;  3MUV P;  1LK5 A;  4IG3 A;  2P9G A;  3I0S A;  1IJE B;  5ETT A;  5HAT A;  1XMO J;  2FJB B;  3P3D A;  3NWR A;  3AB4 B;  4CZC A;  3K5L A;  4AQY J;  3KUH A;  3PX0 A;  4OJH A;  2CQH A;  3RAM A;  1T03 A;  3DLG A;  1OYE A;  5KFT A;  3EYZ A;  4GKK F;  1SV5 B;  1PO6 A;  3DLE B;  4NEZ A;  1EHW A;  2EBG A;  4PG8 A;  3NAI A;  1VQM S;  1T11 A;  4M5G A;  5KFF A;  4IRK A;  5I3U A;  1NB7 A;  2V8H A;  2VAS A;  4RX6 A;  2KYZ A;  1X8D A;  1F5A A;  2WVE A;  1R3N A;  1RAB B;  4F4A A;  2UUA F;  1FDD A;  3ITH B;  3TZY A;  1H72 C;  3JAM Y;  1YJT A;  3D7S B;  2DTJ A;  4DCP B;  3A3P B;  3QZ7 A;  3G8S A;  2UVU A;  5CZV A;  1BQM A;  2CQ1 A;  2EWH A;  5EX3 A;  5A8K B;  3T1Y F;  4QU7 A;  2NZC A;  4R25 A;  2E7X A;  3O1L A;  3NNC A;  3Q8S B;  2DR6 A;  2PA8 D;  4UF4 A;  1G4C A;  2CZ4 A;  3KK2 B;  4DQR A;  1HBM A;  2UP1 A;  2KH9 A;  3TVZ A;  3CXC R;  2FJX A;  2BE7 D;  1GQE A;  4A48 A;  1LV5 A;  2CQ4 A;  4RZR A;  3TW0 A;  4OV6 A;  1O5J A;  2JLG A;  3OPK A;  2UU9 F;  5HBM A;  1AXQ A;  1LK7 A;  3LUY A;  4M5N A;  3NEK A;  2ZH3 A;  1TL3 A;  1BWE A;  1ZM2 A;  1OWX A;  2WW8 A;  1HHT P;  1R89 A;  2P9E A;  4M5I A;  4MIA A;  1L3U A;  2E9T A;  2R7T A;  4ZIV A;  4OX7 A;  4GC6 A;  3CO9 A;  4CNZ A;  5U47 A;  4JV5 J;  3TYT A;  2HGL A;  2WAQ D;  2ZOG A;  1NSK L;  1BD6 A;  3CCM S;  1X4G A;  5D78 A;  4J9M A;  2UUT A;  2J9D E;  4LVN P;  3HCX A;  4USK A;  2V67 A;  3KK3 A;  4WYL A;  1Q86 T;  3KXD A;  3BV8 A;  3TNV A;  1ZH5 A;  1WG5 A;  2PC6 A;  3QBC A;  2Z57 B;  3WZ0 A;  2J76 E;  1UVI A;  4M1K A;  3R97 A;  1U4B A;  2YPZ A;  2DNP A;  2B56 A;  4PG5 A;  4Q5V A;  2IIH A;  1M0S A;  1WJ9 A;  1VI7 A;  4AT1 B;  2HVD A;  3PHE A;  4C8O A;  4N76 A;  3DOL B;  3KK1 A;  3LO3 A;  4JI4 F;  2K8G A;  4BLG A;  1VHF A;  1WOO A;  4WE1 B;  2MKY A;  5KFO A;  4ZVQ B;  1XJW B; 
#chains in the Genus database with same CATH homology
 3HJV A;  3CJ8 A;  2C2N A;  3TQE A;  3H0P A;  4RL1 A;  3G87 A;  3IM9 A;  3TZZ A;  1MLA A;  3IM8 A;  4AMN A;  3R8Y A;  5DZ7 A;  3K89 A;  3TZY A;  4RR5 A;  2CUY A;  3TZX A;  3TZW A;  3QAT A;  3PTW A;  3BV8 A;  4AMO A;  3SBM A;  4AMP A;  3HHD A;  3RGI A;  2G1H A;  3R97 A;  3EZO A;  2G2O A;  2QJ3 A;  2JFD A;  4QBU A;  2G2Z A;  2G2Y A;  2H1Y A;  1NM2 A;  5DZ6 A;  2QC3 A;  4AMM A;  2JFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...