1RT2B

Crystal structure of hiv-1 reverse transcriptase complexed with tnk-651
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 107
structure length 402
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B03
3GV5B 3GV8B 3BQ1A 4IKAA 3GYNA 1KLMA 1S6PB 3DRRB 5KFZA 4R8UA 1JLBB 3TVKA 5C42A 4IR9A 3CVKA 4EYHB 3DMJB 1FKPA 3LAKA 2FVSA 1SH2A 3Q8RB 3DOKB 2HNYB 2JLEA 1LWEA 1TV6A 1C2PA 4YMEA 4KKOA 2RF2B 2HWHA 5F8IA 2RDIA 3NAIA 3IS9A 2RKIB 2BQUA 1T05B 1JKHA 4TY8A 4RW6A 1S1XA 3ICLA 2XGQA 3M9OB 4DG1A 4I2QB 4M94A 2FLPA 4JV2A 1EETB 2E9RX 3BSCA 1K1SA 3T5JA 3EPGA 5HROA 1CSJA 2R2RA 2RDJA 4H4MA 2IJFA 4EBDA 1XR6A 4J9KA 5DG7A 1HNVA 4RW9B 3QZ8A 1IKXB 4YR3A 3NMAA 4I2PA 4TQSA 2JC0A 3DYAA 3UQSA 2BQ3A 3DI6B 4ECYA 3V6DB 5T14A 5KFWA 4G1QB 4JV1A 1LW2B 3FQKA 2UVWA 4KHRA 5F8HA 3MTKA 4NLXA 5CYQA 5EWGA 3KLIB 4PWDA 1RTJA 4ZVEA 4O44A 2ZD1B 4Q43A 3PW4A 2B6AB 4YR0A 2IBKA 4QWCA 3DLKB 2R2TA 4R5PA 3DLEB 3KLHA 5HBMA 5FDLB 4PUOB 3G6XA 1N48A 4WZMA 2W8LA 2IM0A 4MK7A 4KV8A 1EP4B 1C1BB 3MECB 3OHBA 4ICLA 1HNIA 1QE1A 5KFOA 2W7PA 3Q8SB 1S6QB 2FVQA 3CDWA 2XC9A 5J2PA 3IRXB 3LP2A 1C0TB 4EEYA 2B6AA 3CDEA 2C2RA 3MF5A 1RT6A 2R8KA 4IDKA 5F8MA 5C5JA 3MEDA 3QIPB 1TP7A 3GIJA 3BSOA 5KG6A 2WOMA 2VG5B 4B3OA 4ECVA 2HMIA 3PVXA 5KT5A 2V0NA 3MECA 1S49A 3VQSA 2JEJA 1RT7B 4ECZA 3KLVA 3KK1B 3IRXA 2R2SA 2OPPB 3H5SA 1DTQB 3TAMB 1RTIB 4RW4A 2YNHA 3KK3B 5I42A 4MIBA 5HP1A 4NLYA 4TXSA 5EUHA 4IFVA 3QLHA 5F8LA 3BREA 4HKQA 3OLBA 3PW5A 3M8QA 2C28A 2D7SA 2YNIB 1IKVA 1DTTB 1RT4A 4ZP7A 3IGVA 5KFAA 4DL6A 1UWBA 4KO0B 5KT2A 2R8IA 1S1TB 5L1KA 1IKYA 2BE2A 2IAJA 3CIZA 3I5AA 2R8GA 1REVB 1JLQB 3DOLB 1HMVB 2CJQA 3QGIA 1VRTA 5KFIA 4TN2A 4O3QA 1FK9B 3I5BA 3RB0A 3N6LA 2WTFA 1T03B 4K4SA 2WONA 3RBDA 2IMWP 3N6MA 1BQMA 2VG7A 4NLWA 5J2MB 5KG2A 2AQ4A 3DRSB 4KO0A 2AX1A 2FVRA 4H4OB 4Q44A 2ZE2B 4YQWA 1TKTA 4IG0A 3N6NA 2R8HA 1S9GB 3DDKA 4ID5B 4HYKA 3CJ0A 3PR5B 3ITHA 1S1WB 1FKOB 3KJVA 3E51A 3KLGA 3KLFB 3G86A 5KFPA 4U7CA 5C24A 1SUQA 1S1UB 3MFIA 3H4DA 5KFJA 4PQUB 3MEGB 3MEEA 3OSPA 2QV6A 1GX5A 1JLAA 5KFFA 2HNZB 1ZTTA 1JLCA 2OPSA 4J9RA 3GIIA 1HYSB 5L1LA 1S9GA 2YNGA 4IG3B 2WHOA 4NLVA 2FJVA 3KOAA 3LALA 3DM2B 5HLFB 1ZETA 1HQUB 4RNHA 1HQEA 3E01A 1KHVA 4LQ3A 1N4LA 5J2QB 3MFHA 3BR9A 2UVRA 5KFGA 4O3OA 2I1RA 2DPIA 3PHEA 4WXWA 5I3UB 2C22A 4IOBA 3UR0A 4ZVFA 5CYMA 4ECQA 5DQHA 4RZRA 1HPZB 3DRPA 4ZPBA 2GIRA 1HQUA 3HVAA 4WE1B 4H54A 4NLDA 5KFNA 4NLGA 4K4UA 4LSLA 1NHUA 5EWFA 3KLEB 2E9TA 3CJ2A 4U6PA 1SV5B 4RNMA 4FS2A 4Q0BA 4LSNA 2ILZA 3PW7A 4Q8EA 5KFCA 4MFBA 4IFYA 3FQLA 3LP0A 2ZKUA 2VA3A 2IA6A 1RA6A 3SFGA 3OLAA 5L9XA 2ASLA 1S6PA 4Y34A 5KFHA 3DRRA 2ILYA 1JLBA 3QO9B 5KT7A 1T3NA 4RNNA 1N5YB 3DMJA 3JYTB 5DQGA 2W9BB 4QW8A 2VG6B 3D28A 4TYBA 5DGBA 2UUWA 5KFKA 3GILA 4DL7A 2ALZA 1JLEB 3DOKA 2HNYA 2I5JB 1W25A 1TL1B 4TLRA 1U09A 4ZP9A 3IG1B 5C25B 3HVTB 2RF2A 3DLGB 2W9AA 2RKIA 3GIMA 1T05A 1C1CB 3I0SB 3V6KA 2OPQB 1MMLA 5D3GB 3JYTA 5KG7A 2J6SA 4K50A 4I2QA 4RUAA 4F4WA 2R8JA 1EETA 1T94A 4Q8FA 4URGA 1RTHB 1QUVA 3QZ7A 3FFIB 2W9CB 2HNDB 3OL8A 4IRCA 4RW9A 4NLPA 2UVVA 3HVWA 1IKXA 2V4RA 2JEIA 1N56A 4G3IA 3KHHA 3SFUA 1RT1B 3DI6A 2VA2A 4XPCA 3V6DA 4K4XA 1S9EB 3BSAA 4G1QA 3C6UB 1LW2A 2V4QA 4J9QA 4F50A 2EC0A 5EDWA 1KHWA 3EPIA 4IH7A 3ISNC 1IKWB 3KLIA 4GC6A 4EBCA 4ECSA 5KFQA 5KFDA 1N6QB 3OL6A 2ZD1A 4OL8A 5KFUA 1R0AB 5KG0A 1RT3B 3DLKA 4I7FB 3DLEA 5K14B 4PUOA 5FDLA 4RUCA 2IM2A 2YKMB 4EO8A 3H40A 1RYRA 1RT2B 1RTDB 2XI2A 2IC3B 2YKNB 2BQRA 1EP4A 1C1BA 3D5MA 1RT5B 4ED1A 3RAQA 2ATLA 1S6QA 3MR5A 1S1VB 4ZPDA 1DLOB 1C0TA 3BSNA 2C2EA 3BGRB 5DG8A 4O3PA 2B43A 3QIPA 4MH8A 2QE5A 1RYSA 2YKMA 2VG5A 3NKYA 1RT2A 4MK9A 5KFTA 2UUTA 4NLOA 4RNOA 1RT7A 3KK2B 4J9SA 4NCGB 3KK1A 4ZP8A 4TY9A 5F8NA 2OPPA 1DTQA 3TAMA 1RTIA 4O3NA 5F8GA 4JUZA 5KG4A 4EBEA 4R0EA 4XPEA 3KK3A 5DLFA 4ZVGA 2XGPA 5KG3A 1S0NA 2J6TA 4RW8B 1LWFB 1TVRB 4Q45A 3OSNA 5KFXA 2YNIA 1NNDA 1DTTA 3T1AA 5J1EB 2FJXA 5KG5A 2XCPA 5DLGA 1S1TA 5KFEA 2AGQA 3LP1B 1MU2B 4O4GB 2FLLA 2HAIA 2JC1A 3I0RB 1REVA 3T5KA 1JLQA 3DOLA 1HMVA 4NRTA 5KT4A 5KFRA 4K4YA 1FK9A 3SI8A 4ED0A 1T03A 4J9LA 4ECUA 5DGAA 3NL0A 2CKWA 2JEFA 1TKXB 2IM3A 5J1EA 5J2MA 3DRSA 2B5JB 1TKZB 3NBPB 2AWZA 3I5CA 5KFSA 4IRKA 4H4OA 3LANA 1MU2A 1JLFB 2ZE2A 4ZHRB 3MR6A 3G6YA 4JV0A 4ID5A 1VRUB 2AGPA 4F4ZA 4IR1A 2ASDA 1S1WA 1FKOA 3H4BA 3KLFA 4IRDA 1S1UA 4RW7B 3V4IB 3MEGA 4PQUA 3BJYA 2YNFB 5KT3A 3Q8PB 2HNZA 4KFBB 5J2NB 1S0MA 2OPRB 1HYSA 3M8PB 3MR2A 3LAMA 4IG3A 4MKBA 3V81B 5HLFA 3DM2A 3KHRA 1LWCB 2OH2A 1C0UB 1NHVA 4ECWA 5KFVA 2BANB 2C2DA 3V4IA 1JLGB 5J2QA 1BQNB 4ED3A 3HKWA 2AU0A 4FBTA 1XR5A 3MR3A 5JUMA 3IN5A 2GC8A 4NLTA 5I3UA 1KLMB 3PR4A 4R8UB 1SH3A 1LWCA 1HPZA 2DPJA 3ISND 1GX6A 4WFXA 1FKPB 4WE1A 4WXOA 3H98A 1LWEB 4EYIB 2WRMA 4KKOB 3KLEA 3RB4A 2E9ZA 2WCXA 4WYLA 3CWJA 1SV5A 3KHLA 4WFYA 3IS9B 5DG9A 2D3ZA 4QW9A 1JKHB 4TY8B 4RW6B 1S1XB 4FS1A 2W8KA 2V9WA 4IQXA 4KSEB 4DG1B 4Y2AA 3CJ4A 4ZP6A 3T19A 3QO9A 1I6JA 4QWEA 3PZPA 4DL2A 4X2BA 5L1JA 1N5YA 3QGGA 1LW0B 4NZ0A 2W9BA 5HROB 5L1IA 5KG1A 2VG6A 2AGOA 3JSMB 3C6TB 4YP3A 4H4MB 1JLEA 4IH6A 5KFBA 2I5JA 3IGNA 1TL1A 4ZVHA 1HNVB 4MIAA 3IG1A 5C25A 4DEZA 3HVTA 3OL7A 3GV7B 3DLGA 4ECTA 4I2PB 4KHMA 3V6HA 5F9NA 4ED8A 3DYAB 2F8EX 1C1CA 3TQ1A 3I0SA 2OPQA 5D3GA 3UPFA 1LW0A 4WYWA 3QGHA 3H2LA 3JSMA 3C6TA 5CYQB 4J9NA 1TQLA 4LQ9A 4NLQA 4PWDB 1RTJB 4O44B 1RTHA 4NLRA 4QWDA 4ED7A 4R5PB 3OL9A 4EO6A 3FFIA 3KLHB 5HBMB 3BQ0A 2W9CA 2HNDA 4DL3A 1RDRA 2GIQA 5EWEA 4ED2A 4KB7A 4KV8B 3NGDA 1RT1A 4ICLB 1HNIB 1QE1B 4F4XA 1S9EA 2FVPA 3C6UA 3FSIA 4ZPAA 3EZUA 3H5YA 5J2PB 3LP2B 3CDUA 3FRZA 1RT6B 3GQCA 3Q8QB 1IKWA 4IDKB 4M95A 4QPXA 3MEDB 1SH0A 1S97A 1D1UA 1N6QA 2WOMB 2D41A 4B3OB 1R0AA 2IM1A 2HMIB 2BRKA 1RT3A 4I7FA 1JIHA 5K14A 4K4WA 4J9MA 4YR2A 1JXLA 4K4ZA 4ZPCA 3RAXA 4ECRA 2JEGA 3KNAA 3T5LA 4WZQA 1RTDA 1J5OB 2IC3A 2YKNA 1WNEA 4WFZA 1RT5A 4RW4B 2YNHB 4URSA 5I42B 5HP1B 3V6JA 2ASJA 1S1VA 4IFVB 1DLOA 3QLHB 1S48A 3CO9A 3NAHA 4TQRA 3BGRA 5F8JA 3M8QB 2BR0A 1IKVB 3G6VA 1RT4B 5KFLA 1QAJA 2BRLA 1UWBB 4IH5A 4NYZA 4ZMMA 5KT6A 1IKYB 2BE2B 2IAJB 1J5OA 4MK8A 3HHKA 1JX4A 3OHAA 5KFYA 4RU9A 4XO0A 1VRTB 1S9FA 3KK2A 2AX0A 4NCGA 2R2UA 5JXSA 3RB6A 2W7OA 4ED6A 3PJWA 2WONB 4NRUA 2FJWA 4NLSA 4KAIA 3KMSA 4KBIA 1HARA 1BQMB 2VG7B 1OS5A 5DQIA 3KMQA 4J9OA 1S4FA 2FLNA 3CJ5A 3QIDA 3UDLA 5F9LA 4RW8A 1LWFA 1TVRA 1TKTB 1TL3B 4IG0B 4KE5A 5KFMA 3M9MB 3RBEA 2WK4A 2HWIA 4K4VA 3ITHB 3LP1A 4O4GA 4QWBA 3KJVB 3M9NB 4O3RA 3KLGB 2O5DA 4K4TA 3I0RA 5C24B 1SUQB 2WB4A 3MEEB 1K1QA 1YVFA 1D0EA 1S0OA 2FVCA 4GC7A 1JLAB 1Z4UA 4MKAA 3PW0A 3KHGA 3FDSA 1JLCB 1TKXA 2OPSB 1TL3A 3PW2A 4Y3CA 2YNGB 4QWAA 3BQ2A 2B5JA 1TKZA 3NBPA 1RAJA 2XCAA 4ZHRA 1JLFA 4O4RA 4URQU 4DL5A 4DL4A 1HQEB 3T5HA 3E01B 1QAIA 1VRUA 1RA7A 4FBUA 4ECXA 2XWYA 3GIKA 1XR7A 2J6UA 1S10A 3H5UA 4RW7A 1ZTWA 4F4YA 2YNFA 5CYMB 4TYAA 4KFBA 3DRPB 5J2NA 4Y2CA 3RB3A 2IJNA 2OPRA 3CJ3A 3M8PA 4O3SA 3V81A 3H5XA 2UVUA 5C42B 4J9PA 1C0UA 4RNFA 4LSLB 2BANA 3H59A 3QYYA 1JLGA 1IM4A 1BQNA 2D3UA 4Q0BB 4LSNB 2XI3A 3PJXA 4MFBB 1TV6B 4IFYB 3LP0B 4NLUA
chains in the Genus database with same CATH superfamily
4DPUA 1CC7A 2AJQA 3NGKA 3LAKA 1WC6A 2VDIA 3KXDA 4HT7A 5B0CA 4PAAA 3MUVP 2FY8A 1NJXA 3NEKA 1U0HA 1X4BA 3BYPA 3OVBA 4HACA 4EBDA 3ENWA 2DITA 2MQOA 2BQ3A 3DI6B 3GB0A 2VC1A 4CH7A 2VV5A 4NLXA 2C3YA 1XEZA 1RTJA 5DDRC 2LU2A 3FBEA 4EWTA 1YIJS 2LXIA 2AJFE 4B02A 1C1BB 3PJ9A 4EEYA 3ZZ0A 2UZAA 3G82A 3I31A 1OO0B 2FTRA 2JEJA 2YY3A 1TL7A 3L7UA 2Y1RI 4DR4J 5KT2A 3IBFB 1AFJA 4F0MA 2PIIA 1IWAA 2R8GA 3HPOA 4KPYA 3DOLB 5KFIA 4MKYA 2WTFA 3PKYA 2RRBA 3IP0A 1T02A 3DDIA 3RBDA 5J2MB 4H4OB 1R27B 3CD7A 2G0IA 1JJ4A 2B0GA 2ZHBA 2V9KA 2RSQA 2D74B 1W2BR 1HQEA 2BJDA 1N4LA 5J2QB 4PG5A 1KVJA 4K2XA 3OT9A 1BE4A 2DPIA 2IDLA 2MGZA 4M63A 2XS2A 3NGUA 1N33F 4U6PA 1C4CA 3M30A 3J7ZT 4IFYA 1RA6A 5F3TA 4DN0A 3QO9B 1FE4A 3JYTB 1F2HA 1G4CA 3BGUA 3V5RA 2NPIA 1F0XA 3GFXA 1T05A 3I0SB 2LCWA 2KRBA 2XULA 3PO5A 4Q8FA 2YX1A 2F40A 1RBAA 4UTGA 3U1MA 1U1NA 1ZPWX 2HNDB 3KG0A 4LF4J 3CMAS 5HMWA 3W66A 2WW4A 4OZ1A 2ZVSA 2ZH9A 1VISA 1N34F 4A8MP 4NXNF 2V4QA 3CSKA 2ZWOA 2H54B 3KLIA 4GC6A 1N6QB 4IQMA 4OI2A 1KDNA 2AJ2A 4EZ6A 2CJKA 5JVHQ 2LU1A 5FLXU 4C8OA 3MR5A 3BGRB 2B43A 1NBEB 4USVA 4B3RF 4NLOA 3D9BA 4LRDA 4M8LA 4NCGB 2OPPA 5KG4A 4AL5A 2AKWB 2IVMA 2EW9A 4B9VA 5H9EK 4GVLA 1U25A 4QU6A 2AYBA 4FDFA 1R8AA 3OTEA 3HZEA 1FK9A 1U49A 3KFWX 2VL1A 1R89A 2D3OR 3D54A 3I5CA 2L9DA 4DI6A 2XLJA 1X60A 2K7JA 4HVZA 3Q8PB 3OV7A 2OFGX 1T9WA 4Q2LA 5KFVA 3MM5A 1I5OB 5ADZA 1WG4A 1CS4B 3PR4A 4CO5A 5GADI 1NJYA 1SL1A 2DT9A 2QMXA 2HVDA 1F1BB 5DS7A 5E7OB 2KM8C 2VFUA 2W9BA 3IWLA 4WTOB 3AJ2A 3PX6A 4IOCQ 4DR1F 2HQFA 3C6TA 4PWDB 4DV6F 4DQQA 3QJPA 5HVGA 1R3NA 4EO6A 1CEZA 4B08A 3C6UA 1BGXT 1U7LA 2Y9HA 1RT3A 3OD2A 4J9MA 2LQ5A 2I38A 3RG6A 1J5OB 2YNHB 4JI6F 2ZVIA 4JI4F 1DLOA 4ANCA 3OVAA 1HIYA 1KONA 2XTJP 4DSFA 2DR9A 3KK2A 5SUHA 4PKDB 4ED6A 3KMSA 2FJAB 2VG7B 3ENVA 1NKEA 4IO1A 1S4FA 4D3GA 3QIDA 2ZDOA 2FHJD 3TW0A 2WK4A 4K4VA 3EGWB 1RU1A 2HHVA 3ENQA 3L9ZA 2K3KA 4W92B 3AD8C 3NBPA 2BKOA 3OFEA 3T5HA 1QLNA 2XWYA 3VGSA 2CFXA 3VTIA 4O3SA 1B99A 1RWPB 2BJ7A 4Q0BB 2VOOA 1ZM3A 1UVNA 5DETA 2HURA 3R1LA 5KFZA 3CCTA 1MROA 2FVSA 1C2PA 1S1XA 1DURA 4I2QB 1U2CA 4F4KA 2OIHA 1RK8A 1MWYA 1GAOA 2ROGA 3KG1A 1IKXB 2EI5A 4XK8C 4DV0F 3TI0A 4DHVA 2OGUA 2N82B 1AUDA 3DLEB 3G6XA 2F4FA 4E0DA 4LIRA 2XC9A 5J2PA 1YDLA 2WVFA 5F8MA 5KG6A 3T3FA 3D3CJ 5KT5A 1RT7B 5A0YB 4ES3A 5D4NA 1Q53A 2P8IA 5SZTA 1HLWA 2L41A 3WBZA 3RBXA 4HKQA 3PW5A 2VJUA 1FTRA 2BE2A 4Y6IA 4F2RA 2CJQA 5J1PA 5DM7Q 2FPHX 2PEBA 1XNQJ 5KG2A 1W2IA 3LF0A 3DRSB 1CG2A 3SV3A 3SQGA 3CUNA 3OR1A 5ETRA 3BGFA 3G86A 3TAPA 1X4FA 3QPIA 4DR4F 1ZTTA 3KUGA 2OPSA 3DM2B 2XQCA 3E01A 1Y11A 3GSDA 2DNPA 3L7PA 2YKAA 4ZVFA 3LH2S 3DRPA 1URRA 1S7IA 2ZH5A 3AJ1A 4DV3J 5EWFA 1KFSA 2N4DA 3N79A 3QSYB 1KWMA 3ZXWA 3GILA 3NS7B 4B3MJ 3AOCA 4ZP9A 3LOUA 2RF2A 1REGX 4JV5F 4B9TA 2B7BB 1LOUA 3BN7A 1AW0A 2JEIA 1N56A 3NNAA 3NWRA 2CPDA 3L3CA 1RT1B 3WIUA 1X4HA 2W2PP 1IBLF 1IR2A 1XMOF 2ZD1A 5K14B 1VQ7S 1CJTB 1RACB 3IAS9 2QL9B 4LF4F 2KYZA 1LFWA 4FXVA 1WELA 2CJ9A 1VQOS 3DLHA 1FJGJ 5DGAA 5J1EA 1DQ8A 2Q6CA 1TKZB 3OPKA 1RWXB 1YTYA 1WD6A 3TAQA 4PQUA 3IXQA 3IBCB 3EDQB 2OJ3A 5LMUF 1FNOA 4CLFA 1RCOB 3HKWA 4M5GA 5G0RB 4C48A 2KXNB 3MM8A 2JLGA 2ZEJA 3T1HJ 1KEKA 2J9DE 4QBUA 2EFQA 3W65A 3R7BB 1LWEB 2WRMA 4DR3J 4NA1A 3EDRB 2EKYA 2DK2A 1ZM4A 3KTQA 4LFBF 1HWUA 4ZP6A 4TVAB 5KG1A 3K7RA 2AGOA 5FLXY 2N7CA 1FX4A 3NOCA 3FZBA 4JI8F 3IG1A 3IRWP 2RE1A 5D15A 2C3MA 3AH6A 1JWWA 3F0NA 5F3ZA 5DZ6A 4O44B 4AXIA 4ZPVR 3OFFA 1SJ4P 1H74A 4QYRA 5E3AA 5B0EA 3D67A 3LWMA 1S97A 1SH0A 1GMUA 2VBWA 3FC9A 4I7FA 3UVJB 3N01A 2CNOB 5A8WA 4ECRA 2JZ5A 4BDPA 1IKVB 5BR8F 3DGPB 3WX4A 3OHAA 2R2UA 3TVZA 1HWJA 5ETLA 2Q1LA 4Y65A 5DQIA 1Y3KA 3OFGA 4J9VA 4E8UA 4ZA1A 2HVEA 3LA0A 1S0OA 2VASA 4W4MA 1Z4UA 4ZCIA 1TKXA 5FJ4A 5HVHA 3FRYA 4JI0J 2VQEJ 3SSSA 2VBXA 3JTOA 2CQBA 3HULA 2K2PA 5C2CA 5LM7E 4TYAA 4UQTA 1TTHB 4LVOP 4Y2CA 2IJNA 2PC6A 5HATA 1BQNA 4OLOA 1VK8A 2SXLA 4EUVA 4OQJA 4DOZA 3G6ES 3R6GB 3R7NB 3P96A 3FMBA 1U1LA 4X4NA 3HF5A 3DOMA 1FFGB 5F8IA 2RDIA 4LF6J 4ERDA 3K57A 2E9RX 2UUBJ 5ETSA 3HSDA 3OTBA 3HX9A 1WACA 4YR3A 2E5LJ 4ZKAA 3Q86A 3HT3A 1LW2B 2QYCA 3TUZC 3MM9B 1DARA 4LFCJ 5IC4B 3QGPA 2H4WB 3TZWA 2QA4S 1L3VA 1RAAB 3MECA 4E2FB 5D8HB 3IRXA 1RTIB 2W2MP 2NYHA 3QLHA 1HA1A 3IGVA 4NCAA 2KYXA 1S1TB 1T9UA 2NPFA 2KJWA 2CWKA 3X1LB 2YTCA 1BLUA 1NDKA 5KFPA 5C24A 2B9WA 4Y0FA 3KJQB 5LSOA 3GIRA 2YNGA 1V6HA 1VQ8S 2XWXA 4U67Q 4RNHA 3BZQA 4CLYA 4Z7CA 1SBRA 4O3OA 1XNQF 1ACMB 1U0SA 4ECQA 4ES1A 1WOSA 3UW1A 4WE1B 1NK4A 2ZZNA 3P45B 4LSLA 4PWUA 2BKNA 3R5BA 1HHTP 2ZBIA 2HGLA 4M5NA 2MKJA 2JX2A 5LXRA 2LECA 3G8SA 4USKA 4DV3F 3HJVA 4F4WA 2A1BA 2OMOA 3NCPA 2UVVA 4NMXA 2Y0BB 4Y28C 2AIRB 3CC2S 5LJ5Y 1B0TA 2ZKTA 3KDOA 1I51B 4B3MF 3TUIC 2BV3A 5KG0A 3H40A 1RTDB 2ZFHA 3GYXB 1YG0A 3Q23A 2L9WA 3NGTA 2AYEA 3NKYA 1NK0A 5DO2A 3KK1A 1WG1A 2BX6A 1PYTA 3QRPA 3SDEA 2J6TA 1VQNS 5KFXA 2KJVA 2XCPA 2VPYB 2HAIA 2RQKA 2DHSA 2E66A 5D0EA 2DO0A 2CKWA 4CP5A 2B5JB 1KP6A 2OD6A 3LANA 3VAJA 3THVA 3QJJA 2BJ1A 1RLCL 1FKOA 2E1AA 4IRDA 1KR4A 4M5HA 3WC0A 2RJZA 3Q22A 4KFBB 3W9IA 2QLWA 2XHCA 4B3TF 3EZ5A 3HFKA 3EX7B 3DKDA 3GE9A 2DR7A 2P9EA 3C66A 4EK2A 2RRAA 2BUNA 1WWHA 1P1LA 4X4QA 1UFWA 1SV5A 4WFYA 1B7FA 5HI7A 1TMMA 1Y7PA 1L3UA 3LQVA 2V9WA 3D1HA 3HSGA 2DNMA 3D0HE 2UXDF 2MQ8A 1O0PA 3JSMB 1YJTA 4NMLA 2CUYA 3DYAB 2CPEA 2G1DA 2OI2A 4DXLA 3M2VB 3A4TA 1AZSB 1N5QA 2GO8A 3V4MA 3IM8A 1URNA 1K9MT 4ZLLA 1WUUA 2XSJB 3T5LA 2BOPA 3VAGA 2Y1JA 3V6JA 3GLJA 3HKZD 5KFLA 2BRLA 5LSLA 4DR6F 1IKYB 4DV4F 2ZOFA 1R7IA 1G7CB 5LMNJ 1SKRA 4DQPA 3PJWA 3CJ5A 1TKTB 2AP6A 3M9MB 4S0MA 3RBEA 1FRJA 2CVIA 5HK4A 4C9DA 3IFEA 4P9SA 3W7BA 3GG0A 3M2UA 3RBZA 4RWXA 4QWAA 3ISZA 4ZHRA 3BM7A 4LVNP 4A4JA 1M5HA 3GFHA 3GIKA 1HNZF 4DCPB 1KQFB 1ZAXA 3H5XA 2UVUA 5D4OA 1FHTA 3BB5A 2CYYA 1JLGA 4MFBB 2YXLA 3O1LA 5IV3A 4AYBD 1JLBB 1BUXA 1T9YA 2JH3A 1FJEB 4YMEA 4KKOA 5DDQC 5H9FJ 3GFZA 1I3OB 2XGQA 3M7VA 4DG1A 1S79A 3ONQA 5HROA 2XO6A 1WG5A 4NE9C 3QRRA 3FQKA 1E6VB 5T7LB 4LF6F 3OUYB 4R5PA 3KLHA 1N48A 3EE3A 1RADB 4LJMA 4OYPA 2UUBF 3M2RB 3TO8A 4TU8A 2GZOA 3GIJA 2QT7A 3MAAB 1DTQB 3I56S 4WFNQ 1VQKS 4U8VA 4E98A 4X66J 3M8QA 4ES2A 1DTTB 1RT4A 4JP8A 1IN0A 2EFGA 4CTAA 2IFXA 3LGHA 2ZJPQ 4WWSA 1H0HB 2XMKA 4I4BA 4HYKA 1H72C 1S6OA 2A3JA 5JJBA 3MEGB 4DV1F 1EAYC 1JLCA 5LJ3Y 4ITSA 4LBHA 4JI2J 3PFEA 5IQ6A 1PJ7A 4ZVRB 5CYMA 4HDHA 4NX9A 1HBOA 1H73A 1GT8A 2M8HA 3MR7A 3FQLA 4F25A 2HRUA 4Y34A 3OR2A 3TYTA 1PSDA 1RWVB 3D0GE 3C46A 5C25B 4P10A 3GIMA 3FCWA 1C1CB 2V8HA 2OPQB 4FN5A 1IBMF 4PYDA 1GH8A 2W9CB 4C97A 4RW9A 3W3SA 1D9FA 1KHWA 3M8RA 1P8GA 3MOJB 1IKWB 3D6HB 2GX8A 5CQGA 2O3DA 4LF1A 1HW8A 1RYRA 2HVZA 3UCUP 2X51A 2ZNYA 2MKYA 3UCGA 1S4EA 4CNZA 1OYEA 2Y8YA 5BYQA 4CO2A 2ZUAA 1M5VC 2F63A 2QC3A 1X7VA 1OPIA 2IJRA 4J9SA 1H98A 4ZP8A 2XMJA 4O3NA 2P6SA 4TLQA 4Y2MA 3MWBA 3RYLA 3EMTA 3LP1B 2B7CB 4OIXA 5KFRA 3SI8A 5BYSA 4ECUA 1XK8A 1PAUB 3DGVA 3OTOJ 3PYGA 1MU2A 3G6YA 3SMZA 2AGPA 4F4ZA 4N76A 2W25A 1Z1ZA 3OVSA 3MXHP 4OI1A 1VBXA 1X4CA 4B3SJ 4OYMA 3LAMA 1YWXA 4DS4A 4RPFA 4ECWA 3NNCA 2AU0A 4OZ5A 2E7VA 4DR7J 4OYBA 4B9UA 5IWAJ 2RU3A 4I64A 4GO7X 3W61A 4DUZJ 3TZZA 3H98A 4EYIB 3HHLA 3KLEA 4F4AA 4B9LA 3GR0A 1KNZA 1JKHB 2G0JA 2EWHA 2Y0SD 2W8KA 1JB0C 2VKZG 1ZZFA 2CAJA 2HFNA 4DR5F 4YP3A 3KNGA 5KFBA 4IH6A 3FNNA 3IGNA 3CCSS 4I2PB 4ED8A 1N52B 4AQYF 3KJFB 3QGHA 2FHOB 4GVBB 3SXLA 1RHMB 2MY7A 2KFZA 3NXZA 2LP4A 4DX8H 5D4LA 4ED7A 3SQOP 5HBMB 3BQ0A 4J37A 4KB7A 4FYWB 3OXLA 3H5YA 3ILJA 4LF2A 1RT6B 1H2VZ 1N0VC 2HMIB 3GJQB 4L72B 3HHNB 4K4ZA 3FCHA 4A47A 3A8JA 2ERRA 1TL5A 1VK3A 4IFVB 1GXTA 2BR0A 4KC5A 3IA0A 2MKKA 3QFWA 3RB6A 1BXNA 2GVZA 2RHSB 2X1BA 1VBZA 2RIJA 3QMQA 4RW8A 4ZJOA 4I0WA 4CQ1A 2FZKB 2B4OA 1PO6A 1EKSA 4L75A 5ETMA 4BLGA 1DQ9A 3U02A 2EFOA 4Y3CA 2DYAA 4QYZK 3T1YF 3JSBA 5LMNF 5ETOA 5LT5A 1RA7A 3BDEA 1S10A 3A1YG 4F4YA 1SCJB 2RB7A 4ATNA 4CO4A 4CH1A 1Y5IB 3VCDA 3R3TA 2D3UA 3PNIA 2DGSA 2OP5A 2PE8A 3ZTQA 3EXCX 1YBTA 1Y10A 2G0CA 1U6BA 4A8YA 2GO9A 3CJKA 1CJVA 1EX8A 4H4MA 4OV6A 1HNVA 5MLCV 1UWAA 4LBPA 3RZAA 4AFFA 4DFJA 4F0KA 3JQKA 1OWXA 2DJWA 2YWGA 2P5VA 1H3DA 4NI2B 3W9HA 3UFCX 1XNRJ 1C0TB 2D69A 2B6AA 4CZCA 2N3LA 5C5JA 4HT5A 2MKCA 2VPWB 3A13A 3TWZA 2CQ4A 4Z7YA 2KVQE 4AL7A 3TAMB 2E5IA 5F8LA 3BREA 4ZP7A 1UWBA 3SCKE 5B0FA 1REVB 3K5MA 1G1XA 3N6LA 1E6YB 2IMWP 1BQMA 4X64F 3HSJA 4Q44A 4YQWA 3LO3A 3ZZRA 1CULA 1S57A 4U7CA 3H4DA 2CA9A 2IDEA 2CQ0A 3IR6B 2D1CA 2G2OA 5U47A 1RXOB 2XLIA 2WHOA 5HLFB 3B82A 2NYIA 4UOFA 3M1VB 2NZ4A 5MAOA 5DQHA 1HQUA 1X31C 4IOAQ 3JSRA 4NLGA 3QBCA 1X9MA 1WOOA 4Q2MA 2W4PA 3UDVA 3ZNJ1 3OLAA 3K5NA 4U8YA 2ASLA 5AE2A 1HHSA 2HGMA 4CO3A 2C3UA 1Y9OA 1M1HA 1V9OA 2V67A 1KC8T 2F8HA 1U09A 1U2RA 1KSPA 1KFDA 3C14B 2HHHF 3SZ2A 2R8JA 2HZVA 1RTZA 1X8DA 4NXMJ 3FFIB 2ZZMA 1NH8A 4MIWA 4YHHF 3GZ7A 3DI6A 2J0QD 3JQJA 2LQBA 3HHEA 1VQ5S 2ADCA 5KFQA 1T95A 3OL6A 1HWIA 3WQPA 4DSIA 2YKMB 1L3TA 2YKNB 2DBBA 1C1BA 4OLPA 1RT5B 1FKAF 3MGJA 1S1VB 1UW4A 2C2EA 1M5PC 2BJEA 4HI2A 1IJEB 2OLWA 3MM6B 4YOEA 3RAMA 3FEYB 4OYIA 5F8NA 4EBEA 5GAGI 1OY8A 1N5TA 2R42A 3GFYA 2WW8A 4ZOSA 3K2YA 1NNDA 2V4JB 1DQAA 4X62J 3U27A 3DOLA 2QGFB 2BJ3A 5K8MA 2IYGA 4J9LA 1Y4ZB 5J2MA 3M8SA 4H4OA 2B4UA 1PCAA 2ASDA 1RABB 4L74A 3ETMA 2H65B 4N8OA 3DLBA 2QYGA 2BANB 2U1AA 5J2QA 2O67A 2Z56B 1WKKA 1TUGB 2EXUA 3GJTB 1SVDA 2JFDA 3Q8UA 1W26A 1HBNB 2Z2ZA 2WCXA 1NJWA 2X1GA 3SSQA 2CZ9A 1SJFA 1EQ0A 4OHZA 3QO9A 1JK9B 4F8RA 4J90A 5IWAF 4QIGA 2X1FA 4I6WA 2AYMA 2Q6BA 3I0SA 2DTJA 2R7SA 2MPUA 1WHYA 2D9PA 2HNDA 2Y1IA 4EGLA 2V2ZA 3SCIE 3UO0A 1N6QA 4WJBA 3H7HB 4YR2A 1U1RA 1R31A 3BGRA 1UVIA 2B9XA 4NYZA 2H1YA 5KT6A 3K59A 4NCGA 5JXSA 2OEMA 2WONB 1T11A 3UD4P 5KFMA 2R4FA 2HHQA 2HWIA 2HVHA 3ITHB 2LXUA 2O5DA 5IOLA 1YVFA 3GR1A 2DR5A 4OX6A 4MKAA 2F65A 3PW0A 1TL3A 1S76D 2LEBA 1XMBA 4LFAF 1T3OA 4DV5J 4ECXA 2ZC3A 2HBRB 4FVMA 2GCFA 4OHXA 5K8NA 1AUSL 4DLEA 1K47A 1QDUB 5IS2A 4LSNB 1MNEA 1FE0A 4KGVB 1CS4A 2XY7A 3M4XA 1UPMB 3DHXA 1X5TA 1YRTA 4OJ1A 2ADBA 1VQ6S 3QWUA 3DOKB 2JLEA 1HI0P 1GXUA 1RAHB 5E3QA 4F36A 5ETPA 2PD1A 2ZUGA 4ZIVA 5DG7A 4KYZA 4NZ6A 2CQHA 1NDCA 2HFUA 4G1QB 1FDDA 5F8HA 3Q89A 4PWDA 5IM0A 4Q43A 1VYAA 2Z57B 3FEZA 1S6QB 1R0BG 2H5JB 2NXJA 4PCQA 2UXCF 1FNXH 1LQ9A 1BMQB 2VBZA 1GQEA 3BPSP 1SKUB 3AHPA 3H5SA 3D6MB 3MUMP 2YNHA 1N5SA 1UVLA 2XMAA 4A8KA 4RBTA 1RWNB 4C4WA 2EFPA 1H6KX 2CWXA 3ZZUA 3I5AA 2IHR1 1HMVB 3EVWA 2VG7A 4ER8A 2LKZA 3BPDA 4DPWA 3DDKA 2YQ1A 5E3RA 2XS5A 3E51A 1S1UB 3OSPA 3VR1A 1GX5A 2DNHA 1KLNA 1O51A 3BR8A 2KDOA 4ILMA 5EHHA 3C3LA 3M6UA 4FF4A 3EVOA 3Q24A 1Q16B 4Y2IA 2W4DA 3POTB 4NLDA 1F60B 1JXEA 3VVUA 1ZA2B 4RNMA 4Q0BA 4YB7A 1XJWB 3OJSA 1PJ6A 5D0RA 2KZMA 1RU2A 1FNMA 1ZM9A 2I5JB 4D3HA 3HVTB 3CMES 3DLGB 2HIQA 2LFVA 2HKEA 4I2QA 2F1FA 1HD0A 1RTHB 5K5MA 2HZCA 1IKXA 4XPCA 3NCRA 5L9NA 3AODA 2BJ9A 4G65A 1XERA 2F3JA 2NUHA 3DLEA 2XMVA 2IC3B 1IR0A 2BA9A 4KIAA 1WF1A 2Z4PA 3NMRA 4U9RA 4O3PA 2QE5A 4LRFA 5KFTA 2XG8A 4GKJJ 1RT7A 5HJYA 5D4PA 4TY9A 5A0YA 2ZH1A 4JUZA 2BYCA 2XGPA 1LWFB 4Q45A 3T1AA 1IM6A 1Y5NB 5DLGA 1B0VA 2AGQA 1MG7A 3MEKA 3DRXA 5HQLA 3IWNC 1X9SA 4CLWA 2FC9A 4M5IA 3DRSA 2DB1A 4IRKA 3A3PB 2JL9A 5B0GA 2GFFA 2CPYA 5IV4A 2PSZA 2DHAA 2YKPA 3ELHA 4JBCA 4RW7B 4B9NA 1S99A 3MR2A 2C2ZB 3DM2A 1RWWB 1NHVA 1OQ3A 1ZAWA 4ZCMA 2QSFA 4F04B 3RRGA 1XR5A 1N54B 2MQNA 2CDRB 2LLZA 3L09A 3MZIA 1Z2ZA 2J9EA 2XBPA 1Q1KA 3CDAA 4TY8B 3CCRS 2YWFA 4FKYA 2O1PA 4IQXA 2XYPB 4LRAA 3I82A 2FZGB 2KXFA 3CJRA 4EFAC 3C6TB 2X3GA 5L46A 4JI5F 1KTVA 1BD6A 2AEMA 3V6HA 2OKQA 1FT8A 1U4BA 2PI4A 2AD9A 1KRPA 1RT1A 1HNIB 5HMZA 3K8VA 2GJFA 4B3OB 2NZCA 5K14A 3AB4B 4WP3A 4WZQA 2C2MB 4RW4B 1CJTA 4URSA 4X84A 2ASJA 3GJSB 2DO4A 4M5DB 2IIHA 5IFMA 4UOGA 1D9AA 2MZQA 4DX6A 1BQXA 3R97A 3UDLA 2KT2A 4ZLJA 4K4TA 1SUQB 3HMJG 4C3LA 2XMWA 2EBGA 4RX6A 3FDSA 5FD1A 3CCMS 4UZCA 1TKZA 4O4RA 4Y00A 1JJ2R 4R25A 3HFVA 1EQMA 5B0DA 4ZVOB 3HLUA 4QCLA 1WF0A 2GGPB 2XNQA 5G0RA 3HD2A 3VAFA 3GYNA 2DIVA 2GA7A 4ED5A 1SH2A 1LWEA 3ETOA 4WF9Q 3AAWB 2AJ0A 4C8NA 3EJMA 2QEXS 7AT1B 2IJFA 2RQ4A 1YK9A 3QZ8A 5C2GA 4CLPA 1RKJA 2B8QA 2OMLA 4K0KJ 4O44A 1KOOA 2EFVA 1VQ4S 4QWCA 5FDLB 4GKKJ 2OTLS 4X4UA 3TR5A 4YB5A 3TJAA 2MJNA 2HFVA 1UCNA 4KHPF 1TP7A 3UVJA 3BS9A 1ZPVA 2NSBA 2B4PA 1UP1A 4K5SA 4TXSA 3BGLA 2OTJS 4XDDA 4DV2F 3M32B 1IKVA 2E1CA 4Z37A 3DGPA 2PMZD 1JLQB 3EWGA 4O3QA 5AXKA 1H7XA 1XC9A 3W60A 1NLKL 1RAIB 2ZJQQ 2YQ0A 3KUHA 1UVMA 3HO1A 2QV6A 3AY0A 1HYSB 2LQ9A 1S9GA 3PRVA 4IG3B 3KOAA 3CCWA 1WEXA 2PN6A 3K5PA 3O3LA 3J81j 1NAQA 1S7HA 4WXWA 2OEJA 4WP9A 2AZ3A 3THPA 2XZWA 1X9WA 1I94F 5D77A 1JXVA 2GS8A 4C11B 2V34A 5KT7A 3G87A 3RGIA 4RNNA 2DRBA 2V8VA 4DL7A 5GADU 1JLEB 1V3SA 3T41A 1NDPA 1C4AA 3IR7B 2BE7D 5D3GB 1FXLA 2CJBA 2J76E 2YWEA 4UW2A 2FHMA 3KDNA 1F2GA 2H51B 1NU4A 2ZJRQ 1LW2A 5EDWA 2QMWA 3MM9A 3MD3A 4OL8A 3GG1A 4FNHA 5K20B 3QATA 4LF9F 2XI2A 3D5MA 1RBLA 4MH8A 1FD2A 3C16B 1RT2A 3AA8A 1UEKA 4OI6A 1RTIA 3O6QA 2UXBJ 4NYPA 5J1EB 1S1TA 3I0RB 1UZHA 3VALA 2ZM6F 1QSLA 2JEFA 2ZHOA 4JV0A 1RISA 2JWNA 2VU5A 2WVEA 3PM9A 2DNKA 1YSJA 3MM8B 4AUKA 4MKBA 3UN5A 3H2UB 5CD4A 4A8QA 3IN5A 1GMWA 2L48A 1IR1A 4C8MA 1LWCA 3E3XA 3HHLC 1FKPB 3H20A 4WE1A 5AJ3J 5ETVA 1S0VA 4RL1A 3CCUS 3IS9B 2LA4A 5CZXA 4MKVA 4J91A 4NZ0A 2V8GA 1GTEA 2BABA 3PEJA 4ZVHA 4CDIA 1QAYA 2FGOA 4P74A 1JNZB 3UPFA 4JI3J 3SCJE 5CYJA 4OI0A 3D1OA 2KVIA 1NK9A 1KQSR 4ICLB 1QE1B 2B9EA 2JFKA 4CIOA 2KT5A 2JRSA 4FPRA 3BO4A 4OI3A 1DFDA 4K4WA 4P7TA 1RTDA 5E3PA 3DXSX 1VQ9S 4CT8A 2DISA 4IH5A 3X3UA 5EX3A 3HHKA 2QLFB 5KFYA 1W7WA 4JI7F 1S9FA 1QM9A 2AHOB 1U1OA 4WFAQ 1T7PA 4UOCA 5D6GA 2E1PA 2QN6B 1NSQA 1FEEA 1MLAA 1GFWB 2V2KA 3MEEB 2DRDA 3TUJC 1HFEL 1MMNA 1ELOA 3BQ2A 2B5JA 3CEDA 2J9DA 2ZH3A 3U1NA 2XLKA 4K7QA 4HHHA 2MLXA 2RDDA 4USUA 4KFBA 2DNQA 5CXTA 3ILIA 2HQCA 4DBQA 2W24A 4NLUA 3LWLA 3BQ1A 4DPOA 1F9EB 2DNZA 3DMJB 2X3DA 1RHJB 2OHDA 4OZNA 1EHWA 1HWLA 1IQTA 2NR0A 3BO3A 4FPIA 2B3TB 2VUGA 1VI7A 3DDNA 3HXMA 4L6V3 3DYAA 4NYOA 2UU9J 3M2VA 3MTKA 4DQIA 2RS2A 1AZSA 1HW9A 1KVIA 3MECB 1R6VA 1RWMB 2LQ8A 2FVQA 2V50A 3IRXB 4C0BA 1VQPS 2MLZA 3QIPB 1S72S 2VG5B 2KB2A 4NWBA 1ITPA 1OSCA 1T8EA 2HBYB 2NQPA 2XSJA 3W63A 2JHEA 1X0FA 3UDEA 1TMJA 1DJ0A 2HBZB 2V94A 1D3WA 2C28A 2D7SA 2DY9A 2CPZA 1HBMB 5BYRA 1IKYA 2PFFB 4CLLA 1B0PA 4YDDB 2M8DB 3RB0A 1T03B 4NLWA 4X65J 2FVRA 5GMDA 4I68A 1TKTA 1N32J 2CRLA 2C3OA 3KLFB 2GQCA 5L8RC 1NK6A 5KFFA 2HNZB 4EI2A 2FJVA 3MFHA 3FMWA 1QVGR 3FCVA 2C22A 1HPZB 4ZPBA 2CQDA 5KFNA 3PTWA 2DKOB 4ANDA 3CJ2A 4X4OA 3TZYA 1NRKA 3PW7A 3BH6B 4MFBA 1NCLA 1T9XA 4XAKA 1RGVA 1JLBA 2DCUB 1B70B 1DHMA 4JI1J 4HI1A 1NB2A 1TL1B 1SKSA 2BE9B 4AE5A 3ILOA 4JYAF 2R7XA 4OZLA 2J7KA 2BZ2A 4RUAA 3MMCB 4LF5F 3RR7A 3JTPA 3PDNA 1YLXA 5DZ7A 2KFYA 1NMEB 3MMJA 2VC0A 3JB9k 3CJSA 2WSCC 4K4XA 1S9EB 2FLOA 1FEHA 4AD6A 2MHNA 4YY3F 1E6VA 5T7LA 3W62A 3OUYA 1HR0J 3PRDA 4DX5A 2MJUA 1IBCB 1N0UA 3RAQA 3M2RA 1OQ6A 2XY5A 3TARA 1NEEA 1PC5A 3VGTA 1PIEA 3MAAA 2DY1A 1DTQA 4K8RA 4XPEA 3O2IA 2PA8D 1RZMA 1DTTA 1RLDA 1RAEB 2OSQA 1HNXF 3S6EA 4NCBA 1NK7A 3PEHA 3P3DA 3MEGA 1PILA 1LXJA 4AXJA 1O6XA 1GK8A 1UEUA 2NS1B 2MSTA 4OYWA 4R8UB 1SH3A 3RUBL 1D8YA 3VV2B 5HAOA 1VHFA 1X5OA 2ZBCA 2OEKA 1I6JA 2MKSA 4QWEA 1YJ7A 4FXDA 1RCXB 1QD1A 3QGGA 2M70A 2R7QA 2V2QA 5C25A 2QX0A 1C1CA 3TQ1A 2OPQA 5AJ3F 1SXLA 4WBFA 4F3QA 4DR2F 4P2SA 3OL9A 4BBYA 1EKRA 2W9CA 2M0GB 4ED2A 4BC9A 2RNEA 3QQCD 2DH7A 2Y3YA 3LP2B 3LGMA 1IKWA 4IDKB 3HP6A 1VMBA 2XMUA 1CC8A 1VBKA 2ZBRA 5HP1B 2CJYB 1WC0A 1S48A 3D4JA 3NAHA 4PG7A 2BMBA 3LUYA 2IAJB 5KOXA 1VRTB 3ZTOA 3TOQA 4NRUA 1K0VA 1SIWB 4QYZJ 4IG0B 3ZFVA 3LP1A 3PYFA 2YX4A 1Q8KA 1YX2A 3S01A 4DUTA 1RAJA 1RP5A 1QAIA 2VD3A 4CLTA 1XR7A 3H5UA 3C15B 4L3NA 1SB6A 1KS2A 3G8TA 1U1QA 3C8YA 4HR2A 3LP0B 3GV5B 3DRRB 1TK5A 2AMCB 1ZOTA 3Q8RB 2HNYB 4ZVTB 5LXYA 2ACYA 1D9DA 4RU2A 2HWHA 2YPZA 1JKHA 2LQJA 4LMZA 2DNYA 2H5EA 4M94A 4WIIA 3T5JA 2LDYA 1CSJA 1NM2A 2XZDB 5LSRA 4DN9A 1I1GA 4ID8A 4I2PA 2BACA 2FY1A 2JDJA 2A2CA 4IYQA 4JOUA 4OJGA 1OSDA 4GVBA 1XMQJ 2HQ3A 3AXKA 2IBKA 1MN7A 5HBMA 2W8LA 4MK7A 1EP4B 1WSVA 3GU0A 1XIQA 4F02A 3MF5A 1RT6A 2R8KA 1CJUB 1UVJA 2HMIA 3A3NB 1S49A 5A6PA 2OD4A 2UU9F 1A7GE 1LXNA 2R2SA 3KK3B 1XTZA 1NUEA 4IFVA 3OLBA 3TUPA 4U95A 4CM0A 5KFAA 2W2NP 2A0FB 3H42A 4ZN3A 3CIMA 1Q4RA 1X5PA 2AQ4A 4UY85 1CLFA 2AX1A 2ZE2B 5CH7B 2QJ3A 2DXFA 4MMOA 2XEXA 1HI8A 5T41A 4OYXA 4DU7A 1U47A 1ICEB 2GHPA 1RHRB 1KHVA 4PEOA 3C2PA 1IBKJ 4DCOB 1J5EJ 4X65F 4IOBA 3CDBA 4YDXA 2G1HA 2C2NA 2HHXA 4ZCKA 3HVAA 1GTHA 1U02A 2YH0A 2HHTA 3F56A 1NJZA 2E9TA 2HFSA 2ILZA 3PKMA 2ZOGA 5KFHA 2HW3A 2ZITA 1D09B 5DQGA 1VC0A 3D68A 4MJKA 5DGBA 4ZK7M 4KJIA 4ETXA 4TLRA 2HSEB 3DHWC 4I69A 3CULA 2GJIA 4W90B 2DGWA 3TA2A 2BM0A 2UP1A 2DGTA 4HL9A 2AW0A 2VA2A 2EEYA 4WU3A 1LFPA 3EGNA 3ISNC 2NXUA 2APOA 2DGOA 2RQCA 1HL6A 1R0AB 5KFUA 1MWZA 3CF5Q 2G2YA 1U26A 4A46A 1C0TA 4P7VA 4C6AA 5GAHU 3K5OA 3UI3A 3G71S 1PBAA 1WTFA 2GAGC 3W2WB 4ED4A 3TAMA 3P5TL 3MPVA 3P6YC 5KTQA 4J5OA 2KXHA 2YWWA 1MU2B 2FLLA 2ZZTA 1SPBP 1REVA 3T5KA 2Y1LB 2JVRA 4K4YA 1N33J 4ED0A 2HLTA 2HEKA 1E6YA 5D0HA 1U1MA 1CQNA 4PABA 2AWZA 5B08A 3A3OB 4N5SA 3FVYA 4LREA 3QFHA 4WU2A 4C3KA 3S7RA 1S0MA 3V81B 2A10A 4OZ2A 5HLFA 3CGIA 2WVCA 4RR5A 1PAEX 5JUMA 3M1VA 2K7KA 3ZO7A 1KLMB 4LRBA 1RSCA 5HO4A 1UVKA 2FGCA 1L3SA 4F2SA 1N34J 2QRRA 4HTIA 2IBOA 3KHLA 2CQCA 4DU8A 1J27A 4KSEB 3D3BJ 2NREA 4HEA9 4MIAA 3CJ8A 4CLKA 2E7WA 4DJBA 3C14A 2ZBPA 3CC4S 4J9NA 4V19J 3FFIA 1ZA1B 3IR5B 2W1BA 5DM6Q 5B0AA 4ZLNA 4RKUC 4LR8A 4P2FA 1FRHA 2FJEB 1RBOB 3RAXA 2YKNA 4PXDA 4TU7A 7FDRA 1RT5A 1Q79A 5I42B 1S1VA 3A8EA 3MM6A 3C19A 1JX4A 1WJ9A 1NXIA 3VWSA 2AX0A 2DVIA 3HHLD 1Y3JA 4DSEA 2WBMA 4TU9A 3PO4A 4B9SA 4KE5A 5BXIA 3M9NB 1TK0A 3KJVB 3KLGB 2V6AA 5CA5A 2ZNZA 3Q8VA 4U96A 4JB8B 3BKUA 3IMQJ 1YJ9S 3R1HA 2P9CA 3UN3A 5HANA 2E1MC 2GVDB 1F5BA 2B56A 3RB3A 1T9TA 4UZBA 5A8RB 4RNFA 1P9QC 2BANA 1SQFA 3QYYA 3MOZA 1NB7A 4DV6J 1S6PB 1Y0HA 6AT1B 1HBNA 1HBUB 2PO4A 3TEHB 1U6ZA 2FLPA 1K1SA 3BGOP 3ZTSA 4LSZB 2IRYA 3UR3C 2Z58B 2KHCA 4JI4J 5T14A 4JV1A 4FKXA 3KWMA 1L3KA 3JAMU 1FFSB 1WC5A 2B6AB 3PW4A 5E3CA 1NHKL 1B4SA 5AXNA 9ATCB 4ZVPB 3UNGC 3OW2R 2COLA 1YJRA 4N41A 2Q66A 1KTQA 1VC5A 1GMVA 1WORA 1UKUA 1VJWA 4P75A 4MIBA 1MN9A 5DDPC 1QTNB 4WP8A 1Q8BA 3QGIA 2QLXA 3J7AN 2WONA 2AJ1A 3ZZTA 4KO0A 3TA1A 4N8NA 1P1TA 3M8WA 1WKJA 2R8HA 3N6NA 3ITHA 1T9VA 3QT8A 5M2PA 1FTCA 2YVSA 4UQGA 4C98A 4QJVA 1ZM2A 2DGVA 2MMYA 4NLVA 2CQPA 5E2QA 1ZETA 4HH1A 1HQUB 1V3ZA 1VHIA 2VOPA 3EYZA 3OTDA 1RHQB 5K9FA 1TFWA 1FJGF 5DDOC 5AT1B 2VFVA 4K4UA 4DV0J 2GIFA 1VRQC 4NASA 4LSNA 3N28A 3JSYA 1HQ2A 2CPIA 3T6JA 2UV8G 1T3NA 3VGVA 2IVYA 1PYSB 1IBKF 2E5HA 4UOHA 3HVRA 3DOKA 1J5EF 2KM8B 1AFIA 2CQ3A 1NDLA 4QR2A 1G3OA 2H4YB 4K59A 3VAMA 1MMLA 4A8FA 2K1RB 3M6VA 3T1HF 3J81U 2GV1A 4RUHA 2V4RA 2AZ1A 2ZH8A 4DR3F 3PX0A 4G1QA 5CZVA 2WB1D 2HWTA 3W9JA 3MAQA 2AYGA 2FJBB 2EK1A 4RUCA 1DBDA 5GAHI 2NSCA 2VICA 1S6QA 5K8OA 4DQSA 2VPZB 4ZPDA 1WOPA 1WI8A 2GW8A 5CABA 1WI6A 4KGMA 8RUCA 3B78A 4ZLPA 2MZJA 4KGZB 3NLCA 4DFKA 3P8BB 3ADAC 2M7SA 4O4GB 2MYFA 3QWPA 1FJ7A 1HMVA 4NRTA 3N9UC 1VJQA 2MXYA 1BHNA 2M52A 2RAQA 2KZZA 2XS7A 1VRUB 4I67A 1S1UA 2XZTB 2VFSA 2OPRB 4HHUA 1Z2LA 3BV8A 3KHRA 2KFNA 2FZCB 4ELTA 1C0UB 4DMZA 1KKHA 4JV5J 3AD7C 4M5MA 4BHQA 3V4IA 3LGNA 4NLTA 3FZ2A 2E5JA 2QA1A 2OFHX 5LL6d 4CYUA 2KG1A 3RW6A 2GHVC 3POTA 2WVDA 4NA2A 4CH0S 2E9ZA 4JI0F 3ENAA 1SIZA 3PACA 4OHVA 2VQEF 3RRHA 1IBLJ 4RW6B 2YKOA 3PXGa 1XMOJ 4Y2AA 3P4UB 5IT4A 3BBBA 5D0GA 3J80Y 2FUG9 2I5JA 3HVTA 3DLGA 2JLFA 2F8EX 3FK4A 5E0OA 1FDBA 1RB0A 5H1SV 1RTHA 4UUXA 1HNWJ 4KV8B 2FVPA 1WHWA 1R8PA 1JIHA 4EU0A 2IC3A 3U7JA 3N5FA 2E5LF 1P6TA 3W2VB 3VAIA 4LUBA 4DSJA 4XO0A 1PBUA 4LFCF 5LMUJ 3CB4A 4KAIA 2HGNA 4R0JA 2FLNA 1VFJA 3AD9C 1LWFA 1TL3B 4M5KA 4OYOA 3B4MA 3CC7S 2LEAA 4GC7A 5ITHA 3G96A 3KHGA 3SV4A 1HWKA 1HHQA 1OY6A 2AF6A 4URQU 3UNYA 4LFBJ 5B09A 3BBCA 1ZAVA 4FYYB 2V63A 4RW7A 4QR0A 4PXEA 1LKZA 4JI8J 3OTCA 2VODA 4OYAA 2P6TA 3GV8B 2E29A 3V2UC 1M90T 4IR9A 3CVKA 2IPOB 2QMUB 2ROEA 2RUSA 2B51A 3G4SS 2RKIB 4DPYA 4TY8A 2V2VA 1EETB 2J7UA 3BSCA 2R2RA 2EVZA 5IM0B 3L7OA 5E33A 3V6DB 1RWKB 4QPTA 5BR8J 4HLBA 3UD3P 3KUEA 1VGYA 3OBIA 3DLKB 2R2TA 1CJKB 2IA0A 3CCVS 3HSZA 1HNIA 2H48B 4L76A 5KFOA 3A8IA 4N56A 3Q8SB 3PY8A 1PG5B 1ULRA 3GSIA 4B3OA 2B8PA 2KI2A 4RW4A 4J7CA 3CT9A 2MQMA 4NLYA 4M5DA 2YNIB 1AYEA 3QRQA 2FHKA 3CIZA 3MPYA 2NXEA 3HK2A 2E7XA 5HSPA 3N6MA 3ZNUA 4KH1B 5GAGU 4UT4A 2K8GA 4UF4A 1PJ5A 4ILLA 3RR8A 1PKUA 1S1WB 3O5TB 1SUQA 4P52A 2E1RA 3D0IE 2VBYA 2MSSA 4I6YA 5A76A 2EBEA 3CD0A 1WDDA 1UETA 3BR9A 2MQQA 1R43A 2HLUA 5I3UB 3UR0A 4WIQA 1BC6A 4FF3A 2HHPA 1VQMS 1R0CB 5D78A 2R7UA 4CI0B 4CM2A 5AXMA 1UJ5A 1L5UA 2HG4A 5AE3A 2GGPA 1K73T 3IO1A 3JAMY 3GJRB 1N5YB 2KN4A 3MMBB 4PG6A 2UUWA 5KFKA 2UUAJ 3QAUA 3HFZB 3RTVA 2EC2A 3EZOA 1K8AT 1UAWA 4URGA 1WHVA 2V69A 3QZ7A 1CQMA 4OX9J 4C0OC 2V5HG 2CNKB 2YH1A 2VQFJ 4ECSA 5KFDA 4MT1A 4DUYJ 5FDLA 2QL7B 4ILRA 3TJ9A 4K2JA 2V8DA 4ED1A 1UA1A 3M6WA 3PX4A 2QLJB 3RU0A 2XO7A 2UUTA 5DLFA 1S0NA 4CO0A 1TVRB 3M32A 5KG5A 4WTYA 1JLQA 3GMGA 5KT4A 5AXLA 3CO0P 4YS2A 5LOQA 4KGKA 4LT6A 1JLFB 2ZH4A 2CJAA 3D66A 3MCSA 1S59A 2B9YA 2YQ3A 3CCJS 3NG8A 1HYSA 1XWLA 4IG3A 1SC6A 4FP9A 1Q78A 2OH2A 3NCQA 4F26A 2KO1A 4YUDA 3BH7B 2MDAA 4F67A 1ZZNA 3J81Y 3ISND 1HI1A 1FRMA 1TZ0A 3MCMA 1BWVA 3CWJA 3ET6B 3GWCA 4C11A 4C2MA 1FWLA 1RKIA 1PGZA 3RRKA 3PZPA 5L1JA 2VFRA 3SYZA 1JLEA 7FD1A 2R3VA 2H9ZA 5D3GA 2DEIA 4QU7A 1LW0A 4ZJLA 5CYQB 4LQ9A 2IVFB 4RO0A 1U1PA 2HRYA 1RAGB 3OFHA 4DL3A 2DGUA 2MY8A 3AQPA 2VKRA 3B54A 2P9GA 2KH9A 3FRZA 3LPYA 4QPXA 4K5RA 3MEDB 2WOMB 2D3O1 3VGUA 3J7A1 2N3OA 3KNAA 1H7WA 2RH3A 2HYIB 2O66A 3I55S 4TQRA 2J0WA 4ZMMA 5HMXA 1HNWF 3C16A 3HM9A 2POKA 1WC4A 4RU9A 1FVSA 2LEPA 4QOTA 1EZZB 3PHTA 4B3TJ 2FJWA 2F8MA 1OIAA 4DLGA 3AFGA 5F0WA 2CADA 3I0RA 1UTAA 2EG2A 3KYLA 1JLAB 2HAFA 2CPHA 3IBWA 9RUBA 4A8SA 4DL5A 4NA3A 4USJC 2I6WA 4X66F 2AEJA 3WDOA 1U6FA 2UXDJ 4X4PA 3Q2TC 4FYVB 2GHWA 4ZVSB 1QSYA 3A12A 2W2OP 3W1YC 1N88A 3OQ2A 2XI3A 1AA1B 3H25A 1YJWS 3TVKA 3WIVA 1YZ7A 5C42A 4G1IA 1FKPA 3HD1A 1TV6A 3ULHA 5B0BA 1NSPA 3IS9A 3AOBA 4JI2F 5HQMA 5BJRA 4ZITA 2XB2D 1TKDA 1NJIT 1XR6A 4O0IA 3W64A 3I9V9 5A8KB 4DR6J 2UVWA 1P9YA 4DV4J 4PUOB 4YEAA 3M8YA 3MAHA 1QVFR 3FBFA 5CHCB 4ICLA 1QE1A 2RMLA 4A8OA 1WC3A 2DNRA 2V0NA 3MM7B 3I4PA 2ZWPA 1R8HA 3DU5A 2Q79A 3FUYA 5F0UA 5FIIA 4DL6A 1HNZJ 4KPCA 1UA0A 5L1KA 2K3IA 4OX7A 5GAEU 4LF8J 2OELA 2HS3A 3JQMA 1RHKB 1AXQA 2NXNA 3Q0AA 3ZZOA 1S9GB 4ID5B 2OUGA 3MFIA 2HFOA 3MEEA 5I4MA 2R7VA 1WC1A 5L1LA 5A6WA 3LALA 5ETKA 4QR1A 4LQ3A 3R9LA 3NRBA 4M5JA 4H54A 4CRJA 5DRKA 3LPEA 3HDSA 2Z8QA 3OTOF 4C7QA 3PCOB 2VA3A 2BBEA 3SFGA 4USHA 2MZRA 2ZDPA 3DMJA 4QW8A 2VG6B 3D28A 4TYBA 4B3SF 1SL0A 1W25A 2LXFA 2F4VJ 2XNRA 3K58A 3JYTA 2J6SA 4K50A 4DFMA 4DR7F 1F9HA 1QUVA 4DUZF 3VHQA 3OL8A 4NLPA 5M2RA 4PZVA 4MYTA 2MHEA 3VZHA 4G3IA 2DRAA 3GP9A 1VIXA 4XDCA 3EPIA 2UUAF 4EBCA 2QA2A 3TP2A 3W5XA 4MAKA 3H0PA 1RT2B 2BQRA 3S1TA 5IT0A 4DPTA 4OX9F 3QIPA 2VG5A 4DV1J 2EPIA 4J9UE 2KU7A 2CQ1A 2VQFF 2QSWA 2JOQA 4USTA 1NSAA 4R0EA 4DUYF 3EM1A 2YPYA 1HBMA 4BCAA 3FSXA 4UY8T 1TUVA 1T03A 3MMAB 5KFSA 2ZH6A 1KBRA 2KHDA 1Q95G 1TUWA 2BM1A 2VHGA 3KLFA 4B9MA 4OFZA 2FDNA 2YNFB 2HNZA 2ZC4A 5J2NB 3M8PB 4CLZA 1LWCB 3KJNB 4HDGA 2VPXB 3HJFA 2QA4G 3CJTA 1IBMJ 1Q8LA 2M5YA 1HPZA 3CJQA 1RJJA 3MPUB 1F5CA 4DPXA 1FX2A 2HHUA 1U8SA 3DFEA 1UJ6A 2FHJA 1QTMA 1U0HB 4DL2A 4X2BA 1NSKL 4HACB 1FI4A 1TL1A 1G2EA 4DEZA 3BN4A 3O44A 1MW7A 5IC6B 1FERA 2CQIA 3MMCA 2MQLA 1O8BA 4NLQA 1RTJB 1NPPA 4QQBA 2JJ4D 3SSRA 1WEYA 4NLRA 4QWDA 1NK5A 3LTOA 5F41A 2HQIA 3L95X 1S9EA 3GQCA 5L39A 4A48A 3Q8QB 1D1UA 3G82B 4OJHA 1KOHA 3CTRA 1X4DA 1JQGA 2RVJA 3BDPA 2EFNA 3N4WA 1TL7B 2VJVA 4WK1A 5GMEA 1CVJA 1GMWD 1OYDA 1V3RA 1J5OA 4MK8A 2ALYB 4H4KA 4X4VA 1OS5A 2WSEC 5RUBA 2OAUA 1XNRF 1FWPA 1LNQA 4L3KA 3JTNA 4I1TA 2WB4A 3EUNA 3NGRA 2XCAA 2RRNA 3GCXP 2OSRA 2ASYA 1HQEB 4FBUA 2J6UA 3TZXA 2PEHA 4DR5J 3IM9A 1UEVA 2MGZB 3H2VE 3D2WA 2HIYA 4F7VA 1UZDA 4OI4A 4ZIWA 3H59A 4AQYJ 3D6TB 3M30B 2G4BA 3OXGA 4IFYB 5EGYA 1VOMA 1U24A 4R8UA 4EYHB 2JSXA 2AJ4A 1SJRA 2DNLA 1IJFB 3NAIA 2CQGA 2BQUA 1T05B 2C2OB 3T6BA 1FXRA 4AL6A 2JVOA 1U8WA 1N5VA 4J9KA 1AB8A 1QY7A 2QFJA 1R6YA 5KFWA 3R5DA 5EWGA 1EB0A 3KLIB 2DR6A 4ZVEA 4YR0A 1M5KC 4CCHA 4DFPA 4WZMA 4ETZA 1X4GA 2FQQB 3TJ8A 4KGXB 3LP2A 4IDKA 4MTPA 4ECVA 2NXCA 2QZ8A 3MCOA 4NXMF 2OPPB 3T1YJ 5GAEI 5HP1A 3ZZYA 3GPAA 2R8IA 2IAJA 1VRTA 2WVBA 1FK9B 4K4SA 1RWOB 2GQQA 4IG0A 4O0NA 3PR5B 4DDFA 4J9RA 2A18A 3KKFA 3F41A 3MM5B 4LF8F 2M9KA 1O5JA 1ZH5A 3C15A 3DC2A 3HZGA 4X62F 2GIRA 1VDHA 2RU9A 1NHUA 2VFTA 2Z30B 4FS2A 3DLJA 2J0XA 3LP0A 2BJ8A 3DRRA 4DX7A 5HVFA 3AA9A 4ZDNA 2W9BB 4HHJA 2HNYA 2YX7A 5ETNA 2W9AA 2J0SD 1VIOA 5KG7A 1YI2S 2W7AA 1B64A 1OMSA 2J7WA 4C0HA 1Y00A 3SFUA 3FEXB 1NH7A 3C6UB 3R8YA 2EC0A 3Q83A 4PXBA 1D8ZA 2F4VF 2BKPA 1NK8A 1RT3B 3I32A 4X64J 1IUJA 2MZTA 2DH9A 1EP4A 3GONA 3NOGA 1DLOB 2ZBQA 4P71A 1CJUA 3WHIA 4MK9A 4YB1P 3KK2B 2RQMA 4HTJA 5L38A 3KK3A 4ZVGA 1N36J 5KG3A 2D9OA 1Q7YT 2N4CA 3UD5A 1AROP 2DHHA 2X7IA 2JC1A 1B3TA 3WX8A 4NPOA 3NBPB 2ZE2A 3G2XA 4OJ3A 2CZVC 4PG8A 3DRYA 5CCLA 1Q81T 1V5IB 4PRFA 3R5JB 1XN9A 5AE1A 2DNOA 1WHXA 4Q5VA 2HHHJ 2C2DA 3SBMA 3MR3A 2LVWA 2GC8A 5IZHA 1F6TA 4YN3B 1MROB 1V5VA 4YHHJ 5ETTA 2GMHA 2CZ4A 4WXOA 5ETQA 5HL7Q 3T9NA 5DG9A 2D3ZA 1SI9A 3K0JA 2ZH7A 1S1XB 4IO9Q 4DV5F 1EARA 3T19A 3EGZA 1X5SA 2NUUG 3BKTA 3CCZA 1FF2A 1F3FA 3PV8A 2IRUA 4P6QA 3PYDA 1X4EA 3NGDA 2ATCB 5J2PB 3CDUA 1UL3A 2Q43A 1SC3B 2D41A 1R0AA 3QJLA 1WNEA 3RJMB 5JMNA 3Q2SC 1DAXA 5HN0A 1YJNS 1KQGB 2ABYA 5F8JA 4EZ9A 2BE2B 4CT9A 3AT1B 3W2WA 2QL5B 2W7OA 4USIA 1BY9A 4J9OA 3SQGB 4LRCA 3OR1B 4N7TA 2XYHB 4OYZA 2CXEA 3LW5C 3EGVA 2HFZA 1GXLA 3AJDA 2OPSB 3PW2A 4QIVA 5EX0A 4DL4A 3CXCR 1GNKA 3E01B 4ALZA 3K8WA 1R8CA 1YJUA 1VQSA 4WKYA 3DRPB 3THTA 4KQZA 1YRXA 3V81A 2Z0GA 1Q86T 2CG8A 2DHGA 2DH8A 2CPXA 1QSSA 3PRBA 1KLMA 1NZAA 4GMKA 1TU0B 3J7Z5 2A2DA 2Z2LA 4P73A 2RF2B 4PQAA 2G13A 1YJVA 4ZJQA 3R5GA 4WFBQ 3ICLA 1WDTA 4C8YA 4JV2A 1M5SA 5E41A 4DSLA 3EPGA 3B8HA 2RDJA 2RD5C 4ZVUB 4PXCA 1WSRA 4KHRA 3UWTA 4WPAA 2OO4A 3TVYA 1A6LA 2ZD1B 2L9NA 1S77D 3SIPB 1TELA 2F9DA 2Z2MA 3CDWA 4W98A 2DCLA 2R7WA 3CDEA 1G6BA 3TX0A 3BSOA 2DR8A 1TK8A 3SCLE 3BF4A 1HKAA 4FXWA 2E5GA 4LFAJ 5I42A 2ZHAA 1DZ5A 2ROPA 4TN2A 5IQQA 3TA0A 2Q3PA 1TR0A 4F3MA 2MKHA 3KJVA 3CE8A 3KLGA 2LA6A 4PQUB 4USWA 3IC1A 2F9JA 4GKJF 3GIIA 4LF7J 3K17A 2EG1A 3DXBA 4ENOA 2UVRA 2GVDA 4QIWD 2CVEA 3CPWR 3NS6A 5A8RA 4C8LA 4OZJA 4KY3A 5KFCA 2ZKUA 2C3PA 2PT0A 1GEHA 5L9XA 1S6PA 2ILYA 4F3OA 1QUPA 4PR6A 4RBUA 1R8BA 2KT3A 3W8GA 3KG4A 1VQLS 3IG1B 1HBUA 2QLBB 1IWGA 3V6KA 2XSFA 2UXCJ 4OHYA 3D7SB 1PYOB 1T94A 2LMIA 2PGCA 4DCJB 1Q8IA 2VF3A 4IRCA 3HVWA 2F5GA 2AT1B 3M8ZA 2MZ1A 1UW9A 2J8SA 1TAUA 1VLOA 4I7FB 1ZBTA 5A8WB 3R2CJ 2PMHA 4DS5A 2FB0A 2ATLA 3Q8YA 1FESA 3BSNA 1FA0A 2WZ1A 3QAEA 2CPJA 4CNYA 4RJVA 3K89A 4RUBA 3DCAA 2BXJA 5F8GA 4Z2XA 3FBCA 2DNNA 1JNRB 4F0HA 4Y2KA 1Q82T 2EKNA 1T0TV 1WF2A 3NWGA 3NL0A 4CWBA 2UV8A 1TKXB 1S5ZA 2IM3A 4LR9A 5THWA 3MR6A 2QIFA 4P2XA 3BBFA 1N36F 1XQIA 4Q7AA 1SL2A 1BQNB 4FBTA 3HCXA 2GMJA 1SKWA 1NZ8A 4ZS6A 1VCTA 3DNCA 3DOMB 3VF0B 4AT1B 4KTQA 3MI7X 2X1AA 2HS0A 3RB4A 1S12A 4WYLA 1FRXA 1FFWB 1FRIA 3CJ4A 4X4TA 3OJUA 3F73A 4OX8A 2CJXB 4BC7A 3JSMA 2K1RA 3I4HX 3ZZPA 1VR6A 4FF1A 3WC2A 4U7UK 2VB6A 5K8PA 4TKTA 1JMTA 1JXLA 5H9EJ 1ROFA 2BEFA 4WFZA 4ZPWR 2BW2A 3TX8A 3QLHB 2MLYA 2QG9B 1QAJA 1VS3A 2E44A 4K0KF 2Y8WA 2R9LA 4RWWA 3GTYX 4NLSA 1F9FA 1HARA 3RW7A 4GKKF 3EXYA 2R7OA 4OZ3A 1PC4A 2BOAA 3BO2A 4O4GA 4QWBA 3P5BP 4MYUA 5C24B 3NS5A 1D0EA 3P49B 4C8KA 3QNWB 2YNGB 4U7UD 4OV1A 1M5OC 1VRUA 3JXOA 2XY6A 3K5LA 1RE1B 2RS8A 5B7WA 4DZ6A 4IUFA 2MEWA 1ZTWA 1Q0NA 2O01C 4CLSA 1FD8A 4JI5J 4LR7A 2OPRA 3CJ3A 3WZ0A 1X0PA 4J9PA 1C0UA 4LSLB 1LK5A 1YZ6A 4FVCA 1YBUA 4N47A 4YB6A 1RI7A 3AQOA 3DN9A 1KN6A 1FJCA 2A6MA 1RQ0A 2DXEA 4OMFG 4BWMA 1NO8A 2DEJA 5J1NA 4NL5A 2HQDA 1FCAA 4RW6A 1JJHA 4NEYA 3M9OB 1QJHA 4A8WA 4KH0B 3MDFA 3CW2C 1YRUA 3NMAA 1Q5YA 2ZH2A 4TQSA 4LBIA 4DF8A 1DRZA 2JC0A 4ECYA 2H3EB 3ZTRA 4DZDA 3US5A 2CNLB 2CG4A 2NLWA 2MB0B 3ZTPA 4KV8A 3OHBA 1N8RT 3W8PA 4ANEA 3PIOQ 2KTQA 3UE2A 2GAHC 3M6XA 3ZC4A 2W4CA 1VLYA 3VQSA 5CCMA 3KLVA 3KK1B 2L3MA 4G1PA 3R2DJ 3CCES 1YQHA 5EUHA 3SDEB 2WBRA 3W2VA 2UUCJ 4KO0B 3I6PA 2M4MA 4L73A 1UFLA 2WAQD 1UPPA 3I5BA 5JVGQ 2CIMA 1FKOB 3TNVA 1MMDA 2Z2YB 2IRXA 4FF2A 2UXBF 1MWQA 4DSKA 3ILLA 3PYEA 3QT7A 5I3QA 5KFGA 3NGSA 4TNOA 5IT9U 1OY9A 3PHEA 4USMA 4RZRA 4EMDA 2ACMA 1WTBA 1SV5B 1VQYA 4Q8EA 1CBKA 3E2EA 4QIEA 1LWXA 2CPFA 4LF7F 3H8YA 2IMOA 1J2VA 1IQZA 1RAFB 3AB2B 4X4RA 5EN1A 2XMTA 2ALZA 2KG0A 4KR0B 4DWIA 4CO1A 1F3VA 3CMQA 2RKIA 2DXDA 4KHPJ 1MSWD 3IAM9 1EJ7L 2RHQB 3AOAA 1EETA 1NPRA 3HHDA 4LIWA 4FYDA 3KHHA 1TAQA 3V6DA 1RAOA 3SEOA 4DV2J 3BSAA 3QT6A 1A0OB 2HRTA 4IH7A 4M1KA 4PPZA 1YGYA 2YKQA 3DLKA 1SC1B 1CJKA 5KAKA 2M2BA 5A2QU 1ZYQA 5DG8A 2F7VA 4JI3F 2DD8S 1UFKA 4RBVA 1SJ1A 2C42A 4A8XA 2VH7A 4PYAA 3OSNA 2YNIA 2FJXA 2BVZA 8ATCB 4P2MA 5KFEA 1KVKA 1XBWA 1EIYB 1H2TZ 2BW7A 1I94J 3M2UB 4PG4A 1BWEA 4ZHRB 2DGQA 1S1WA 2JNJA 1FWKA 3H4BA 2HVIA 3V4IB 5KT3A 2MTLA 2XMMA 2NCKL 2J5AA 4DV7J 3EICA 4CYUB 1P27B 2VONA 1JLGB 5I3UA 1SJQA 4FZVA 2AV5A 3UN2A 4NZ7A 3PIPQ 4KKOB 1WKLA 4FYXB 4QW9A 6FDRA 3EVMA 4DG1B 5KOWA 2QFIA 1N5YA 5HROB 3MMBA 5L1IA 4LF9J 3AXMA 2B4VA 3CCLS 3DU6A 3OL7A 3GV7B 2HS4A 3I9ZA 4KHMA 5F9NA 1YBAA 4WK3A 4WYWA 1TQLA 3W5YA 4V19X 1KQKA 4R5PB 3KLHB 3MHYA 1RDRA 2GIQA 4F4XA 2J9CA 4ZPAA 1LK7A 2ZM6J 2IM1A 3F44A 4ZPCA 4KRWA 4NEZA 4C3MA 3CO9A 3A8KA 3M8QB 3G6VA 1RT4B 1OPZA 1TL4A 2VIHA 4H4KC 2PDAA 3MURP 4CTAB 2HHWA 1AT1B 1YHQS 2YBVA 3J7YU 1TVRA 3MCNA 1RHUB 4G6VB 4XTTA 4GO5X 2N7YA 1K1QA 4BWJA 1M0SA 2DHXA 1OJ4A 1JLCB 1VC6A 2I2YA 1JLFA 4ZN1A 3TQEA 1NPKA 2K06A 4QZVB 2I9SA 3VVTA 2LYVA 3DLLQ 5CYMB 1HBOB 3R27A 3UCZP 2IYIA 2I0XA 2M3DA 2VZ9A 2FIUA 3BKFA 3PJXA 1N32F 2AEFA 4IKAA 1H2UX 2QO3A 3HT0A 3OR2B 1WEZA 1YKWA 2G9OA 2MQPA 4HH0A 2YWHA 3ET6A 4XIUA 4N77A 1F5AA 2HK3A 3BEGB 3U1LA 4I56A 2DNGA 2KKHA 1CPZA 3MD1A 4DL0C 4RW9B 1B7YB 2HBQB 4O23A 3UQSA 5H9FK 3FJ2A 4DQRA 3G9CA 1K0TA 1ZS6A 1KD1T 1RUSA 5CYQA 2DGXA 2FD2A 2KRRA 3GCWP 4JI7J 3FSYA 3E8OA 2YWKA 4ELUA 4JI1F 3M05A 2IM0A 3IWXA 4WCEQ 2W7PA 4KT0C 2C2RA 3MEDA 1A9NB 2WOMA 3J80U 3PVXA 4NI2A 4ECZA 1RWUA 3CCQS 2R7RA 1U48A 2P2CB 3FKBA 2HZAA 5C7PA 5GVQA 2PFDA 5HMYA 4UUWA 1HR0F 2C1EB 1SC4B 2KL8A 4OHWA 3CJ0A 1SQGA 4B17A 2PMWA 5KFJA 4NOHA 1JLAA 2A6OA 3CD5A 2UUCF 3H90A 6FD1A 3N5BA 1QAXA 2W01A 2M88A 2PI5A 2I1RA 3R5AA 3VZIA 2J8AA 2U2FA 2VDHA 3HHLB 3KLEB 1TFYA 1SJ3P 2IA6A 1Y5LB 4NXNJ 4ELVA 1U1KA 2GMLA 3JS9A 3CD6S 3BYRA 3TEGA 2MKIA 3I87A 4CLUA 3D1QA 4GRSA 1UMJA 1NKBA 1FRKA 3QT5A 4B3RJ 2FC8A 5M2UA 5A8KA 4J9QA 4F50A 2LDIA 4ZVQB 1SQEA 1U2FA 4PUOA 2IM2A 4EO8A 3UDCA 3QSIA 1S6UA 3GYGA 2I8EA 3MPWA 4BS2A 3S8SA 5IXUA 1RYSA 4V1Ak 2YKMA 4PWWA 5CAAA 5CD4H 3MM7A 4RNOA 1JJCB 2GVZB 1K44A 4RW8B 3OXFA 5IT9Y 2EK6A 4FNIA 3NP5A 2V68A 3TANA 1FDNA 3MUTP 3TRGA 3O8WA 2V4JA 4ID5A 4IR1A 3T9ZA 4P72A 3BJYA 1FO1A 4JYAJ 3MTJA 8AT1B 1FVQA 2WSFC 3MPDA 5E5NA 4DF4A 2CNNB 4ED3A 1Q7LB 1VBYA 4LF5J 3L4BC 1NKCA 2GJ2A 2DPJA 4ZPTR 4DR1J 1GX6A 3G8QA 4WFXA 1FXDA 4ZCLA 3VQTA 3ZZZA 1IVZA 2GQ2A 5G4DA 2GNKA 2C2KB 3CJKB 4YY3J 4DV7F 4FS1A 2G2ZA 1CJVB 3R7SB 2RILA 1HD1A 1LW0B 2VG6A 2V8PA 2FJDB 1FDAA 4H4MB 4RLEA 5A2QY 1YITS 1HNVB 2FYXA 4ECTA 1M1KT 2HHSA 5HJXA 2HQGA 5DJBA 1LV5A 3H2LA 3NNHA 1UJ4A 4JI6J 2PA3A 2XM3A 4X4SA 4OZ0A 5EWEA 4M5LA 3FSIA 3EZUA 3FBBA 2H5IB 4M95A 2DIUA 3B6BA 1HNXJ 2BRKA 2L08A 3W5ZA 2JEGA 4WKRA 1M1GA 1FRLA 2ZOMA 2HK2A 5HQ8A 5GMKa 1UWBB 1Q5VA 1U45A 3FGVA 2HPUA 1XMQF 5I3PA 1H38A 3J7YI 4KBIA 1BQMB 2IY5B 1LEOA 3KMQA 2CQ2A 5F9LA 2MZSA 1APSA 2RUGA 3D6FB 3NY0A 1CULB 3VAHA 4O3RA 4QIFA 3PFOA 3R5CA 4PPDA 1X4AA 2FVCA 3CNQP 3MMAA 3R6LB 2CDQA 4YFUA 2R7TA 3PG9A 3N0VA 3VAKA 2XYGB 2RT3A 4I6AA 3HI9A 2YNFA 2QTWA 2W2QP 4C8ZA 5J2NA 3I96A 1DY3A 3M8PA 1IXKA 5C42B 3B4DA 1IM4A 2BDPA 1TV6B 2XHWA 4DR2J
chains in the Genus database with same CATH topology
5EGYA 3GV5B 3PNIA 2DGSA 1VOMA 2OP5A 1CC7A 2PE8A 3DRRB 1U24A 1TK5A 4R8UA 3EXCX 4EYHB 2AJQA 3NGKA 3LAKA 2JSXA 1ZOTA 3Q8RB 2G0CA 2HNYB 1U6BA 2AJ4A 5LXYA 2ACYA 1SJRA 4HT7A 4A8YA 1D9DA 5B0CA 4RU2A 2HWHA 2DNLA 1IJFB 3NAIA 2CQGA 2BQUA 1T05B 1JKHA 2LQJA 2GO9A 3CJKA 2DNYA 3MUVP 4LMZA 1NJXA 3T6BA 2H5EA 4M94A 1FXRA 4WIIA 1X4BA 4AL6A 3OVBA 3T5JA 2JVOA 2LDYA 1CSJA 1N5VA 4H4MA 4EBDA 4J9KA 1HNVA 5LSRA 4DN9A 1I1GA 1QY7A 5MLCV 3ENWA 2QFJA 4ID8A 3RZAA 4I2PA 4AFFA 2DITA 4DFJA 2MQOA 2BACA 2BQ3A 3DI6B 1R6YA 2FY1A 3GB0A 5KFWA 2JDJA 3R5DA 2VC1A 2A2CA 4CH7A 2VV5A 4IYQA 4NLXA 5EWGA 2C3YA 4JOUA 1OSDA 4OJGA 3KLIB 1OWXA 2DJWA 1XEZA 1RTJA 5DDRC 4ZVEA 2YWGA 2P5VA 2LU2A 2HQ3A 4EWTA 4YR0A 2IBKA 5HBMA 4CCHA 1M5KC 4DFPA 4WZMA 4ETZA 2W8LA 1YIJS 4MK7A 2LXIA 1H3DA 2AJFE 1EP4B 1C1BB 4B02A 1X4GA 3UFCX 4F02A 3LP2A 1C0TB 4CZCA 2B6AA 4EEYA 2N3LA 1RT6A 3MF5A 2R8KA 4IDKA 5C5JA 3ZZ0A 4MTPA 4HT5A 2MKCA 1UVJA 4ECVA 2HMIA 2UZAA 1S49A 2VPWB 5A6PA 2OD4A 3I31A 1OO0B 2FTRA 2UU9F 2JEJA 2QZ8A 1A7GE 4NXMF 2CQ4A 1LXNA 2R2SA 2OPPB 4AL7A 3TAMB 2YY3A 2E5IA 3KK3B 5GAEI 5HP1A 1XTZA 2Y1RI 4IFVA 3ZZYA 5F8LA 3BREA 3OLBA 4ZP7A 5KFAA 1UWBA 5KT2A 1AFJA 2R8IA 2PIIA 3SCKE 5B0FA 2R8GA 2IAJA 1REVB 3HPOA 4KPYA 3DOLB 3K5MA 1VRTA 5KFIA 1FK9B 4MKYA 1G1XA 3N6LA 3PKYA 2RRBA 2WTFA 1E6YB 1T02A 4K4SA 3RBDA 2IMWP 1BQMA 3CIMA 1Q4RA 4X64F 5J2MB 1X5PA 2AQ4A 4UY85 1CLFA 2AX1A 4H4OB 4Q44A 2ZE2B 1R27B 2GQQA 5CH7B 3LO3A 4IG0A 4YQWA 3CD7A 3ZZRA 3PR5B 1JJ4A 4MMOA 4U7CA 2XEXA 3H4DA 2B0GA 2ZHBA 1HI8A 5T41A 2V9KA 4DDFA 2CQ0A 3IR6B 2D1CA 2RSQA 2D74B 4J9RA 2A18A 5U47A 2XLIA 1W2BR 1U47A 2WHOA 3KKFA 5HLFB 3B82A 2NYIA 3F41A 3MM5B 4LF8F 1HQEA 2GHPA 2BJDA 2M9KA 1KHVA 1N4LA 5J2QB 4PG5A 1KVJA 1O5JA 3C2PA 4K2XA 3M1VB 2DPIA 4X65F 1ZH5A 4IOBA 3CDBA 2NZ4A 3DC2A 4YDXA 5MAOA 5DQHA 2MGZA 2HHXA 3HZGA 4X62F 2GIRA 1HQUA 4ZCKA 4M63A 3HVAA 2XS2A 1N33F 4IOAQ