1RT2B

Crystal structure of hiv-1 reverse transcriptase complexed with tnk-651
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 107
structure length 402
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B03
2HNZA 3DLEA 3IG1B 5KT2A 5T14A 3LAMA 3M9OB 1JLFA 2B5JB 2GIRA 3LP1B 1LWFB 2IM0A 4ZPBA 5J2NB 5EWEA 4QWDA 4EYIB 1RTDA 2WK4A 4Q8EA 1T05A 4K4UA 3H5SA 1K1SA 3G6VA 2VG6B 5F8HA 3KLFA 2B43A 4O4RA 2AGQA 2QE5A 1HNIB 3LAKA 4NYZA 3MR5A 2OH2A 4NCGA 2FVPA 2ILYA 3PR5B 3T5HA 3BJYA 1S9GA 1LW2B 2WRMA 1JLQA 2JC0A 4EO8A 3NAHA 5EWGA 2J6SA 1FK9B 4IG0A 5D3GB 3EPIA 4MKBA 4NLUA 2HNZB 4NLQA 2YKNB 3IRXB 2FVRA 5JUMA 5HBMB 2WONB 5EWFA 3JSMA 2W7PA 3KLGB 4ECVA 2YKNA 3IRXA 3H98A 1RAJA 1RTHB 3DRRA 3NL0A 5CYMB 5KFYA 3DRSA 4ID5B 4XO0A 4HKQA 5F8LA 2HNDA 2YNFA 4YP3A 2HWIA 3CVKA 3Q8QB 3GIKA 4DL4A 1S1UA 2VG5A 1HARA 1D1UA 5KFSA 4RU9A 4U6PA 3QZ8A 3PZPA 2HMIB 1LW0A 4J9LA 4NLVA 3BR9A 3G6XA 1FKPA 2R2UA 3M8QA 5F8GA 2IM3A 5KT5A 1BQMA 1C0TA 2D3ZA 1IKYA 3RB3A 4ZPDA 4H4OB 4U7CA 5KFGA 1LWFA 5J1EB 1NHVA 2R2SA 5I42A 2D7SA 5KG4A 1Z4UA 3G6YA 1TL3A 5CYQA 2WOMA 3GIJA 4K4ZA 3DLGA 2IC3B 3PW4A 2XGPA 4FBTA 3QIDA 1SH2A 2BQRA 3FQLA 5HP1B 1QE1B 4Q0BB 5KFOA 5KFLA 3RAQA 2BE2B 2CJQA 3DLKA 1S1VA 2IM1A 5DQGA 3IGVA 1LW0B 4RNOA 3RBEA 4KKOA 5K14B 3OL9A 2UVRA 2UUTA 5KG3A 4KV8B 4NZ0A 4H54A 4RUCA 2C22A 1RYRA 1KHWA 2BRKA 3IS9B 4Y2AA 1T05B 5C42A 2C2RA 1HQEA 5J2MB 3KK1A 3OL6A 2VG6A 2OPSA 4RNHA 3NAIA 3KK1B 5J2MA 4TY9A 3PVXA 4TY8A 3KHLA 1BQNA 2WCXA 3DLGB 4KO0A 3HKWA 4RNMA 3BQ1A 1MMLA 3TVKA 2YNHA 2F8EX 4FS2A 4JV2A 4JV1A 2IA6A 4OL8A 5J2PA 2YNHB 3SI8A 1T94A 2WHOA 3D28A 5J2PB 4IFYA 1UWBA 2OPPA 4WFYA 2FLNA 4URQU 3QIPA 2J6UA 1RT1A 2I5JB 3KK3B 4NLSA 3MF5A 4DL2A 3FRZA 3KK2B 1DLOA 3T19A 4ED6A 2ZE2B 3MEDA 3FSIA 1RA7A 3DYAA 2QV6A 1RDRA 1TKTB 2V4QA 2XI3A 4ED0A 1JLEA 4RNFA 2AU0A 4RW9A 4ECWA 3MTKA 1JLEB 2IC3A 4ZHRB 4URGA 4KO0B 4I7FB 1QAIA 2RDIA 4DL3A 1RT3A 4ZP9A 3H59A 1WNEA 3MEGA 4F4YA 4NLYA 4IDKA 2CKWA 3PW2A 3RB0A 2OPPB 1UWBB 3OSPA 1RTIB 4RW8B 2RF2A 4ECRA 4RW4B 1LWCB 1C1CB 4XPCA 2ZE2A 3MEDB 2ALZA 5C24A 4Y34A 1HQEB 1LWCA 4O4GB 4I2QA 4ZPCA 1TV6B 2OPSB 4TXSA 5F8MA 2W9BB 3NBPA 1MU2A 2ATLA 3H2LA 3DM2B 3HVWA 2YKMB 5JXSA 2ASJA 5HROB 5DQIA 4RZRA 1S6QB 4KFBB 3KLHA 3PR4A 3T5KA 4IFYB 3KLHB 3I0SA 1S10A 2ILZA 5KFJA 4DL7A 1EP4B 4RW4A 5KT3A 2E9ZA 1R0AB 2ZD1B 1N6QB 2IAJB 3PW0A 2W8KA 4WXWA 2JEGA 4EO6A 5L9XA 4YR0A 5DGAA 4KB7A 3DI6B 2BR0A 1N48A 4O3SA 4FBUA 2VG7A 4R5PA 4ED1A 2YKMA 1TL1A 4LQ9A 2HNYA 3CDUA 3MECA 4YQWA 1S1TA 5KFWA 3MFHA 4F50A 1C0UB 4J9RA 4NRTA 2J6TA 1JLCB 2RF2B 4XPEA 1ZTWA 3GV5B 3DYAB 3DLEB 4H4MB 4PWDA 3Q8RB 2ASDA 4RUAA 4TN2A 4NLDA 5J2NA 1IKWB 1JLBA 1RT6B 1S48A 3OL7A 2IMWP 2IAJA 1IKVA 4K4YA 1JLAB 3NGDA 1RYSA 1S97A 2XI2A 2VA2A 3CIZA 1JLAA 2HAIA 1XR6A 3CDEA 3LP0B 3T5LA 3I0RA 2XGQA 1TL1B 4Y3CA 4I2PB 4Y2CA 5F8NA 3TAMB 2ASLA 5KT6A 1S1TB 5C25B 3DRPB 2B6AB 4NLXA 3TAMA 4G3IA 2R2RA 1JIHA 3QO9A 4KAIA 1JLFB 1ZETA 4PQUA 5DLFA 3QYYA 1KHVA 1RTDB 1TV6A 3M8PA 1N4LA 4ZVHA 5KT7A 3OHAA 3KHHA 3GIMA 4DL5A 3QLHA 5KG7A 3D5MA 1T03B 1IKVB 1W25A 1RTHA 4NLGA 1TKZA 3DOLA 4LSNA 5J2QB 3BSCA 5KFIA 2RDJA 3TQ1A 3ISND 4ICLB 4ZPAA 3EPGA 1C1BA 1JX4A 5FDLB 2W9CB 5KG0A 3RBDA 5KFXA 1CSJA 4ICLA 4EEYA 4IR9A 1YVFA 1C0UA 4K4VA 3KHRA 1HYSA 5C25A 2GIQA 1JLCA 2OPRA 1S0OA 3QGGA 4J9KA 3V6HA 3LP1A 1DTQA 1QUVA 3DDKA 4NLWA 5KFBA 1R0AA 3KLGA 2EC0A 4IH6A 1DTQB 3BSOA 3LP2A 1IKXA 3C6TA 2JEFA 2AX1A 2JC1A 2VA3A 4DG1A 4M94A 4F4WA 1SV5A 1FKOA 4IFVA 2HNDB 2RKIB 4IRKA 5KFNA 1SH0A 1C1BB 2DPJA 2RKIA 1QE1A 4Q0BA 2GC8A 4WZQA 3BGRA 4F4ZA 2HMIA 4B3OA 4KBIA 4LSLB 2FJWA 3BGRB 2C28A 1RT2A 1RT7A 5K14A 5C5JA 2WTFA 3QO9B 3DOKB 3UQSA 3PW5A 2UUWA 4PQUB 2WB4A 2W9AA 3KMQA 1GX6A 1KLMB 3SFUA 1DTTA 1S4FA 3KLVA 1N5YA 4ED8A 1DTTB 2R2TA 4IH5A 3PJWA 1N56A 4KSEB 4HYKA 2OPQA 5KFQA 3GIIA 4MH8A 4YR3A 3M9MB 1HNIA 5DG9A 4DL6A 1S6PB 4MKAA 1K1QA 4R0EA 1VRUB 3RB4A 1IKYB 1LWEA 3BREA 3ITHB 4RW6A 3JSMB 4QWCA 4O3OA 1RT7B 5KFPA 1HMVA 1LWEB 3OLAA 3GYNA 5J1EA 4O3PA 2IJFA 3VQSA 3IS9A 3V6JA 3M8PB 1C2PA 1HMVB 1TL3B 1RT5A 2YNGB 3BQ0A 1T03A 5KG2A 1REVB 1EETA 2YNIB 1HQUA 4TY8B 4JV0A 1OS5A 5HLFB 1REVA 4ZHRA 1U09A 5KFEA 2V0NA 2V4RA 2HWHA 2UVWA 5HLFA 4DEZA 3IN5A 4ID5A 3G86A 2YNFB 4WFXA 4Q43A 4ECQA 4QWEA 2FVSA 1HYSB 3V6DA 1S1UB 2VG5B 1HQUB 2I5JA 3DMJB 3QIPB 4KKOB 4TLRA 4O3QA 4YMEA 2OPRB 2FVQA 4H4OA 1S0MA 5EDWA 3CJ5A 2BRLA 4ZMMA 3ITHA 4RW6B 5DGBA 5F8IA 4ECUA 3H40A 1C1CA 5HBMA 2WOMB 2FJXA 4WYLA 1HNVB 3IGNA 4J9SA 2IM2A 3OLBA 5I42B 4RW9B 4URSA 4J9MA 1SV5B 4EBEA 3NBPB 5CYQB 2AWZA 3GILA 4M95A 2OPQB 4ECTA 4QPXA 1S0NA 4NCGB 3PJXA 2FVCA 1XR7A 1TVRA 5HROA 4EYHB 1S49A 3SFGA 2BANB 4NLOA 5KT4A 3KK3A 3H4DA 1JKHA 3OHBA 2D3UA 3BQ2A 2BQUA 4IQXA 2BE2A 5DG8A 3ICLA 3IG1A 1JKHB 4LQ3A 3MR3A 3CJ4A 5KFFA 3H5YA 5KFHA 3QGIA 4K4XA 1TKTA 3H5XA 3QZ7A 1I6JA 1J5OB 5L1KA 1BQNB 1N5YB 1J5OA 4Q44A 4ED3A 5I3UB 5KFTA 4IH7A 4MK8A 4WYWA 3MFIA 5DQHA 5KFMA 2R8HA 4ECYA 3QGHA 4KFBA 1TQLA 2HNYB 3UR0A 4TQSA 2W8LA 2BANA 3KK2A 5D3GA 3CJ2A 1S1VB 3MEEB 1JLGB 4IKAA 4NLRA 4J9OA 1C0TB 1BQMB 2UVVA 2AQ4A 1JLGA 3LALA 4Q45A 3FFIB 4I2QB 2YNGA 4WXOA 1N6QA 3KHGA 4ZP6A 3KLIA 4PUOB 3DRRB 3E51A 1S1XA 3KLIB 1S1WB 4PUOA 3DM2A 3DRSB 4ZP8A 4GC7A 4ECZA 3RB6A 3HVAA 5L1IA 4IRDA 3E01A 4IDKB 3ISNC 5DG7A 5HP1A 3I0RB 5KFAA 5EUHA 5KFDA 3BSNA 1RT3B 2O5DA 2AGOA 4WE1A 3V6DB 1RTIA 5KFCA 1FKPB 4KV8A 1DLOB 1IM4A 4YR2A 3V6KA 4O44A 3JYTB 2JLEA 2I1RA 3M9NB 5KFRA 3T1AA 1JXLA 5C24B 1SUQA 4KHRA 4MK7A 3Q8PB 4WZMA 4TYBA 4ZP7A 3OL8A 1S1XB 3I5AA 1RA6A 5KFUA 4ZVGA 2VG7B 4R5PB 3N6LA 3KMSA 2R8IA 3N6MA 3LANA 3FDSA 1TKXA 4IG3A 4I2PA 4KE5A 3DLKB 2DPIA 3MEGB 4ZVFA 1HPZB 4WE1B 3DRPA 3GV7B 4K4SA 3MEEA 3V4IA 1EP4A 4MK9A 4H4MA 4PWDB 4MFBA 3V4IB 4WFZA 1NHUA 2ZD1A 3PW7A 2C2DA 1XR5A 5C42B 1RTJA 4MFBB 3H5UA 1IKWA 1RT6A 1S9EA 3KOAA 4X2BA 2AGPA 1RTJB 4ED2A 3QLHB 5I3UA 3HVTA 1S1WA 2AX0A 3H4BA 4J9PA 4IRCA 4I7FA 4MIBA 1FKOB 4QW8A 3Q8SB 3E01B 1TP7A 3DI6A 1RT4A 3V81A 3NMAA 2IJNA 2BQ3A 2E9RX 3CWJA 3MR6A 3RAXA 1RT1B 1ZTTA 3KJVB 2R8KA 3GQCA 4RW8A 2FJVA 4R8UB 4LSLA 3I0SB 5L1LA 3T5JA 4K4TA 2FLPA 3FFIA 2FLLA 2UVUA 4O3NA 5KG1A 3DOKA 4QW9A 4ECSA 2B5JA 3BSAA 4NLTA 4O44B 3JYTA 3GV8B 4EBDA 3CO9A 5KFZA 3C6TB 3CJ0A 4TYAA 4NLPA 5F9LA 2R8JA 1MU2B 2R8GA 4QWAA 3KLFB 4RW7A 3KNAA 5KFVA 4RNNA 2E9TA 1T3NA 2XCPA 1GX5A 2XWYA 3V81B 3CDWA 1S6QA 3FQKA 4J9NA 4FS1A 2XC9A 1JLQB 4J9QA 1S6PA 2XCAA 5F8JA 3UDLA 3KJVA 5KG5A 4ED7A 1RT2B 1NNDA 3HHKA 4NRUA 4R8UA 5F9NA 3UPFA 4IR1A 4K50A 4IOBA 4O4GA 2WONA 3MR2A 1KLMA 1SUQB 5KFKA 1VRTA 2W9BA 1RT5B 1JLBB 4GC6A 5DLGA 3NKYA 1VRTB 1EETB 2YNIA 4IFVB 1QAJA 4QWBA 3KLEB 2W7OA 2V9WA 5J2QA 1TKXB 4IG3B 4Q8FA 1S9GB 1LW2A 3MECB 1HPZA 5FDLA 2W9CA 4O3RA 4ZVEA 3C6UA 1SH3A 1VRUA 2JEIA 2B6AA 4ECXA 2IBKA 3C6UB 5L1JA 3EZUA 3I5BA 1S9EB 1IKXB 4KHMA 4JUZA 3PHEA 4MIAA 4DG1B 3OSNA 3HVTB 1HNVA 4TQRA 2C2EA 3I5CA 3LP2B 4EBCA 1D0EA 5CYMA 4RW7B 1TKZB 3DOLB 4LSNB 3N6NA 1RT4B 5KG6A 3KLEA 3LP0A 4G1QA 3CJ3A 2ZKUA 4K4WA 2JEJA 4B3OB 4G1QB 1TVRB 2D41A 1S9FA 1FK9A 4IG0B 4F4XA 3DMJA 3M8QB
chains in the Genus database with same CATH superfamily
1CJVB 3VF0B 4ED5A 3LAMA 1U25A 2E66A 2IM0A 4RKUC 4U96A 3MM7B 3DXSX 5EWEA 2YWHA 2WK4A 4Q8EA 3PDNA 4K4UA 3VAHA 3M32B 1X5SA 2K7KA 3CMES 3BBBA 3S7RA 4DR4J 2BJ8A 2O1PA 4NYZA 3OJSA 3CCES 2OH2A 2FVPA 2ILYA 2D69A 3NGUA 4NASA 4OZ1A 3T5HA 1FE0A 1DQ9A 2MKIA 3RR7A 1LW2B 4EO8A 3GR0A 4PG7A 5D3GB 3ZO7A 1X4FA 1EX8A 3Q2SC 4NLUA 2HNZB 5EWFA 3IRXB 2V8HA 2WONB 3ENQA 3BPDA 2YX4A 1GMVA 3IRXA 4KH0B 1B0TA 3A3PB 3GFYA 4JI5J 2FC8A 5CCLA 4WU3A 5GADU 4Q5VA 2HNDA 1RLDA 2O66A 3DKDA 4U7UK 1VIOA 4OI6A 2DEJA 1D1UA 1HARA 2FHKA 5KFSA 4RU9A 3PZPA 2UUAF 4J9LA 3C19A 3N79A 2XO7A 1RU2A 3G6XA 5IT9U 1FKPA 2V9KA 4A8XA 3M8QA 3BN4A 5IV3A 4WFNQ 3CCJS 1C0TA 1CULA 5K5MA 1FJEB 1V3RA 2LU2A 2E29A 2L41A 1D9DA 2LMIA 3G6YA 2D7SA 2HFSA 1FRMA 2LLZA 1DURA 3X3UA 3GIJA 3DLGA 4OYAA 2QG9B 3SSSA 1GMWD 1FNMA 4OX9F 2XGPA 2B4VA 1JXEA 2R9LA 4I6YA 2Y0SD 1N0UA 1SJ3P 3EWGA 4PEOA 4AUKA 4PYAA 4Q0BB 4HLBA 5KFOA 5KFLA 4JYAF 2FY8A 1G2EA 1KLNA 3DLKA 7AT1B 1S1VA 1DBDA 5FLXU 3IGVA 4KKOA 2WB1D 2JFDA 2QLWA 3JQKA 4F26A 3OTOF 4ELTA 2BJ9A 2UUTA 3B82A 4KV8B 1D3WA 4FDFA 4WK1A 5KG3A 4RUCA 2C22A 4FPRA 1WC5A 1T05B 5J2MB 3D0IE 3GP9A 2EK1A 2V8VA 1N36J 1VK3A 4AFFA 2UUBJ 3NAIA 3KK1B 1AFJA 2QL7B 3H0PA 2GX8A 2WCXA 4KO0A 4RNMA 2LDYA 2RRAA 1Q82T 3TVKA 2X3DA 3NXZA 4FS2A 3THTA 4CP5A 4E2FB 1WEZA 1T94A 2B56A 2DISA 3OXFA 5GMDA 2H5JB 2ZZNA 1TK0A 3MPVA 1UWBA 2GVZB 4UF4A 3W61A 2J6UA 4OYPA 5A0YB 4E0DA 3MF5A 4DL2A 3EM1A 3KK2B 1NKBA 5CZXA 3CF5Q 3T19A 5GAHI 3D1OA 2ZE2B 1DQ8A 1RA7A 5L39A 2W2OP 2UXCJ 1UPPA 1RDRA 3ETMA 3VR1A 4LFBF 2DK2A 1SVDA 2X51A 3JSBA 2FUG9 3LQVA 1Q8BA 5AJ3J 1DZ5A 1X4CA 4RW9A 4LVOP 2BW2A 2V6AA 2XEXA 4DI6A 1SL2A 3GWCA 1GEHA 1H73A 4KO0B 1QAIA 1NZ8A 3I87A 3AD9C 4URGA 3MAQA 1RT3A 4ZP9A 3PV8A 2IYIA 1BLUA 2CKWA 4DS5A 3A12A 1UWBB 3WBZA 3J7YU 2GVDA 3BO4A 4RW8B 4A4JA 2XLJA 4DV5J 4JI0J 1MSWD 4B9MA 1RADB 4LUBA 4ZCLA 3A3NB 2Z8QA 2KHCA 2ALZA 2ZE2A 4M5JA 5C24A 1RU1A 2ZDOA 2QC3A 1Q7LB 1KS2A 2CPZA 4I2QA 2QLJB 1Q79A 3K58A 3SYZA 2OP5A 4TKTA 2OPSB 4O0IA 5HI7A 4FF2A 2WVBA 2QTWA 2XMAA 3DM2B 3BGUA 3L95X 2V5HG 1RBOB 3CCWA 2YKMB 4H4KA 1QY7A 3A8EA 4Z7YA 4ZVSB 5HROB 4LF7F 3AA9A 4PPZA 4TU9A 1RWNB 2YKAA 5HMXA 4IFYB 3PCOB 1J2VA 2O01C 2ZBRA 1FX4A 1E6YA 4LF9J 4IOCQ 4PG8A 4RX6A 2DNMA 1R6YA 1CJUA 4ZCKA 2UV8A 1SKRA 4RW4A 1VQ5S 2F9JA 4GKKF 3WHIA 3DLBA 2ZD1B 4M5DB 4ZVRB 3R5CA 2J76E 4I6WA 3PW0A 2W8KA 2V69A 4PR6A 4WXWA 2DNHA 2XYPB 1RSCA 5L9XA 4PAAA 1XMBA 4EO6A 1IQZA 5LSLA 3OVSA 1J5EF 5LXYA 2LEPA 4FBUA 3LF0A 5DZ6A 3FEXB 3VZIA 1WF1A 2CZVC 2IRUA 2YKMA 3T6JA 1FRKA 3CGIA 2XQCA 3HT3A 4AL7A 4JI6J 2CJKA 4DX8H 2C3MA 2VPXB 1YIJS 4OJ3A 1C0UB 3B54A 4AE5A 4DV3F 2W4CA 1XMOF 4NRTA 1FXRA 2A6OA 4XPEA 4YB6A 4JI1F 3GV5B 1WORA 2FZKB 2Q43A 3MCMA 3DLEB 4H4MB 1EKRA 2JZ5A 4HH1A 4PXDA 3THPA 2F4VJ 2VICA 2MZTA 4ELUA 1IKWB 1HKAA 2M70A 2WW8A 1XQIA 2RD5C 1QJHA 1Y3KA 2XI2A 2PEHA 3GZ7A 1VBXA 1SC4B 3Q8VA 4C3MA 3RAMA 3QWUA 2HS0A 4ID8A 3T5LA 2A18A 1WC4A 3IBCB 3KJNB 1SXLA 3CCLS 1P9QC 4OX9J 3TAMB 3S6EA 4C3LA 3G82B 3DRPB 1VQYA 4QR2A 3Q8YA 3VAJA 1NXIA 3EUNA 1CJVA 1YDLA 2IDLA 4OX7A 1IBMJ 2W2QP 1UA1A 3CD0A 3PACA 5DLFA 5B0AA 1KHVA 4ZVHA 3LH2S 2P2CB 2VUGA 3EICA 4K8RA 5KG7A 1T03B 1IKVB 5IT9Y 1RTHA 2MDAA 3DOLA 2PDAA 2Z0GA 5KFIA 4LF8F 2QX0A 1AYEA 3ISND 4ICLB 2ZJQQ 2HHXA 1JK9B 5FDLB 2AZ1A 1X4EA 4CH0S 4ICLA 3FMWA 4EEYA 2HLTA 4IR9A 1SC1B 3TZWA 4N77A 4LF4J 3UVJB 2XSJA 4FF3A 3M2VA 3G82A 1F9FA 2B9YA 2XM3A 1S0OA 2W7AA 4A8YA 1L3VA 3MCSA 3OJUA 1QUVA 1U0HB 3DDKA 1CS4B 1R0AA 3ENVA 3LUYA 3N28A 4NLWA 4NWBA 1DTQB 3JTPA 3M32A 3LP2A 2R7TA 1TU0B 3Q89A 4MTPA 1RAOA 1O0PA 4O23A 4DLEA 4DS4A 4LF5J 4F4WA 1SV5A 1HWIA 3RRGA 4F25A 4CRJA 3M6WA 1O6XA 2M3DA 3EVMA 2YY3A 2N4DA 1GMWA 1IXKA 2GC8A 1WWHA 3OTBA 3RUBL 1LV5A 4NXMF 4WZQA 3M1VB 1UVMA 2L9DA 2X1AA 2DO4A 1CULB 2KG0A 1TMJA 2JJ4D 2HQ3A 2KHDA 3BF4A 3U7JA 4OHWA 3UQSA 5LT5A 3JQMA 1KR4A 1EKSA 1CS4A 1GX6A 1WG4A 2DNRA 3BBCA 3I55S 4DV5F 1L3SA 2WW4A 1DTTA 4P71A 2PI4A 4MAKA 3M2UB 1Q81T 2M7SA 3Q83A 3QATA 3VTIA 1NKEA 4LF6J 2ADBA 1VLYA 3AH6A 1UCNA 1WDDA 3HSGA 3KUHA 1N34J 2JHEA 3QRQA 4OFZA 3GIIA 1FJGF 2M5YA 4X66J 2XNRA 5DG9A 3MEKA 4DL6A 4IQMA 4MKAA 2Y8WA 2J0XA 3QGPA 4R0EA 4OHXA 1OYEA 2VD3A 3BREA 4KC5A 1XMQF 4QWCA 4DR7F 2N7CA 3MXHP 5E3QA 4DPYA 1IN0A 3GYNA 3OLAA 3RRHA 2Y1IA 3VQSA 4FPIA 2B7CB 1HMVB 1TL3B 1WEYA 1P27B 2QFJA 3BQ0A 2K3KA 4LIWA 2YNIB 2KZZA 1DAXA 2ACYA 2IBOA 5B0BA 1REVA 1U09A 5C2GA 1RCXB 1RXOB 1WF0A 1YBTA 3HFKA 3TA1A 1S0VA 5HLFA 3BPSP 4TVAB 3IN5A 1RKJA 1UFLA 2Y0BB 4I1TA 3G86A 1AT1B 2VPWB 2KB2A 1RAEB 1YGYA 2ACMA 2FVSA 1KTQA 1HYSB 4DUTA 1PYOB 3QIPB 8AT1B 2UUBF 3G2XA 4JI2F 4YMEA 2VU5A 1BMQB 2HBRB 4XDDA 3K7RA 3VAIA 2HS3A 1YWXA 1AW0A 4NA3A 3CJSA 2QN6B 5F8IA 3MUTP 3HVRA 3IFEA 4B3TJ 3PEJA 2WOMB 1X5PA 2EEYA 1EJ7L 4WYLA 4CLFA 3IGNA 2R3VA 4UT4A 1WKJA 2XZTB 4RW9B 1S4EA 4URSA 2M88A 1NSPA 2DIVA 3OLBA 4AQYF 5CYQB 3GILA 1SJQA 2KXHA 4QOTA 2P9CA 4RO0A 4C8LA 3TUIC 1F6TA 1XR7A 2VBZA 2GNKA 1PBAA 5LMUJ 4KPCA 1S49A 3SFGA 3IWLA 3Q0AA 2BANB 4DPWA 1M5KC 5KT4A 2YH0A 2IJRA 2BQUA 3P6YC 2BE2A 2AIRB 3G71S 2HSEB 2GQCA 4XTTA 1RB0A 4I6AA 5KFFA 3CDAA 5KFHA 2XS7A 5DDOC 2ZH9A 5LJ3Y 1YJNS 1J5OB 2XTJP 4DFKA 3PX6A 2KI2A 3F0NA 2KRRA 4DCOB 1J5OA 5RUBA 1H74A 4D3HA 1DARA 3IM9A 5CYJA 2R7RA 4IH7A 4Q7AA 4QYZJ 3C16B 4JI8F 2R7OA 1N54B 2PEBA 3ILOA 1VRQC 3MFIA 1B7FA 4J37A 3EGNA 5KFMA 2ZUAA 4DFMA 2R7WA 3QGHA 3VVUA 3W5YA 4WTOB 3J7Z5 3UR0A 3MMAA 1SBRA 2BANA 2W8LA 3HHLA 1ZA2B 5CQGA 4P2MA 1QSLA 3BKTA 3J7ZT 3TJ8A 1JLGA 2E5LJ 2Q66A 3LALA 1WHVA 2KJWA 4ZCMA 4I2QB 1HHQA 1AZSA 2GA7A 2MJUA 2U2FA 3JS9A 4FYWB 4PUOB 1YJTA 5F0WA 2HQIA 1VQOS 3W3SA 3TUJC 3MWBA 1S1XA 2KT3A 1UZDA 4PUOA 1S1WB 5D0EA 2GJFA 5E0OA 3NLCA 4ZP8A 4GC7A 4ECZA 2ZUGA 2JOQA 3HVAA 5L1IA 3DCAA 4OJHA 2PMZD 4CTAB 3E01A 4J90A 4IDKB 1IBLJ 3UCZP 4LRFA 4PABA 5KFDA 2OHDA 3MM5A 1RT3B 2DHSA 2ZH4A 1NK0A 3IO1A 1FKPB 5KFCA 2HIQA 2MQ8A 1NH8A 2RHSB 4NEZA 1WKKA 4KGVB 4E98A 5ETNA 3AJ2A 1DLOB 2RJZA 4FYYB 4YR2A 2E1RA 3V6KA 4IYQA 1D9FA 1FWPA 2DHAA 1DQAA 4O44A 4RU2A 2JLEA 4X4TA 5KFRA 4DR3F 1JXLA 4MK7A 2J7KA 3Q8PB 4ERDA 4F8RA 1WSRA 2J9DA 3PYDA 3OL8A 1X9WA 1P1TA 2R8IA 3ISZA 5AXMA 1IBKJ 4FVCA 1PKUA 1T0TV 4HHUA 4PG6A 1RZMA 4KE5A 3SCLE 1HR0J 3DLKB 3A8IA 2DPIA 3MPWA 1IJFB 3DRPA 3GV7B 5IFMA 1FA0A 4OJ1A 3HHEA 3MEEA 4PWDB 4CO5A 1Q86T 4ZDNA 3GONA 1E6YB 3MI7X 2VKRA 1XNRJ 2HBQB 2L3MA 1ZZNA 4OZ2A 4P6QA 1FJCA 2CJBA 2U1AA 4OI4A 4QJVA 2AJ2A 3H4BA 1TR0A 5A8RB 2LXFA 3DRYA 3FMBA 1FKOB 4QW8A 5K20B 2FHOB 1S79A 1TP7A 2HVEA 3HI9A 4OZ5A 3CC7S 4ZLPA 4ALZA 3NMAA 4Y6IA 2V8GA 5HK4A 1E6VA 2VZ9A 4UOGA 4ZLLA 4A8SA 1RT1B 3OD2A 5GAEU 2KTQA 1R0BG 1YQHA 1T9XA 2PA8D 3KG1A 3SDEB 2FJVA 3R5GA 3N9UC 4R8UB 5L1LA 2L9NA 3T5JA 2FLPA 4RUBA 1S12A 3GR1A 2J9EA 5KG1A 3I56S 3DU5A 3HJVA 4ECSA 2UXBF 2R7XA 1KC8T 1JXVA 2C3OA 3FRYA 3GV8B 4X4UA 2DKOB 3QJJA 5KFZA 4OYIA 3A1YG 4X64F 1KQSR 2H65B 3DU6A 1RABB 3M6VA 3L9ZA 4P2SA 1MU2B 4QWAA 2OSRA 3FCHA 5E2QA 5AXLA 3I4PA 2MQMA 2EWHA 3KNAA 1R3NA 2UP1A 3ILJA 4LVNP 1WOOA 1EZZB 4BDPA 4J9NA 4DV7J 3G4SS 1FRXA 4K5SA 1ICEB 3FZ2A 1LFPA 3BDPA 4DMZA 4B9NA 3TWZA 1U4BA 5CXTA 2NSBA 3UDLA 3KJVA 1RISA 1UPMB 4CLWA 4CT8A 4NRUA 1NNDA 5HVFA 5F9NA 4ED7A 4F2RA 2HW3A 4C8OA 4IR1A 4NMXA 4DV0J 4K50A 4IOBA 2WONA 2O67A 2YWKA 3GJRB 1SUQB 4NE9C 2YQ0A 1VRTA 1RT5B 3EE3A 2C3YA 2CIMA 1VRTB 5GADI 4KT0C 4QWBA 5E3RA 3KLEB 1ELOA 3IBFB 2V9WA 3RW6A 3TQEA 4BWMA 4Q8FA 3ILLA 3KTQA 5JVHQ 1LW2A 3W65A 1HPZA 4DF4A 2J9DE 4B9LA 3SCJE 3P3DA 3C6UA 2JEIA 2GGPA 2B6AA 1WOPA 2VQFJ 1ZH5A 4B3RF 3CJTA 2HRYA 2H5EA 3EZUA 3GSDA 4K5RA 4NZ6A 1XJWB 1ZOTA 2G2OA 2CQPA 1IKXB 3HXMA 3HK2A 2RE1A 3IWXA 3PRDA 2DGWA 4MIAA 4DG1B 3OSNA 1HNVA 2CZ4A 3HPOA 1Y4ZB 3LP2B 4NA2A 1M5SA 4G1IA 4RW7B 2K1RB 3QT6A 2NR0A 3N6NA 2H54B 2K1RA 1AB8A 3F56A 2DTJA 2QA2A 1WUUA 1VGYA 4USMA 2J7UA 2AKWB 1U02A 1FK9A 1S59A 2CAJA 5KOWA 4F4XA 1XTZA 1S9FA 5GVQA 1VBZA 1IBLF 1R8CA 1REGX 3M8QB 1R31A 3EGZA 4F02A 2WSEC 4HI2A 5KT2A 3G8TA 1A9NB 2DGVA 3M9OB 1JLFA 1RHUB 4QWDA 1U2CA 1LWFB 4EYIB 2JNJA 4HVZA 4KTQA 3T3FA 2ZBPA 4DCPB 5HATA 4FN5A 3TX0A 3QWPA 4AXJA 2OTLS 3FNNA 2A2CA 2LQ5A 2XMJA 4C3KA 3N4WA 2EKYA 1OPZA 3M2UA 3W9HA 2AGQA 1QVFR 1OJ4A 1HNIB 3LAKA 2XWXA 5K8MA 2HGLA 3MR5A 3LPEA 3JSRA 5CABA 4FXVA 1UEKA 1VR6A 3N5FA 1VQLS 2UV8G 2WRMA 2ASYA 2AJ0A 3NAHA 3I96A 3OVAA 1FEEA 1MLAA 1VIXA 1R0CB 1RWVB 1FK9B 3SEOA 3SSQA 4YB5A 5B09A 3TAPA 2JVRA 1XNQF 2VPZB 3B4MA 3B78A 4MKBA 4USJC 4A8MP 4CYUB 1FTCA 3KFWX 4DDFA 3K59A 3DLJA 1F2HA 3KLGB 4ECVA 1APSA 1Q0NA 2YKNA 1H72C 4J5OA 2ROPA 3AY0A 2OLWA 1CJTA 2OAUA 2MQLA 2BEFA 1RGVA 3ZZOA 3UCUP 3NL0A 2G1DA 4KHPF 3DRSA 3SXLA 1NHKL 2V4JB 4XO0A 4RL1A 5F8LA 2MQOA 2YNFA 4DL4A 3CVKA 4DF8A 1X9MA 2XS2A 2IRXA 2G0JA 1S1UA 2VG5A 3OR2A 4ZN1A 2XZWA 3QSYB 1U1NA 3QT7A 1LW0A 1RWXB 2DNGA 1X9SA 3N0VA 3AXKA 3TRGA 4JI6F 3R2DJ 2KFZA 2D3ZA 2VFSA 4LF8J 4ZS6A 4QIWD 3RB3A 2EFGA 1OSCA 4ZPDA 3K2YA 4U7CA 2KJVA 5J1EB 4L76A 4ED4A 4ETZA 5KG4A 1Z4UA 2ERRA 2E1PA 4ZLNA 3RRKA 1IVZA 4GVBB 3B4DA 3VGTA 4K4ZA 3LGMA 5ETMA 2QL9B 3PW4A 4HDHA 4FBTA 1NSKL 2H9ZA 4E8UA 1U45A 2YVSA 4FZVA 5MLCV 5HP1B 2XG8A 4C8MA 1QE1B 2WVEA 1M0SA 2DGTA 3AOCA 4L3KA 4GKJF 3EGVA 2CVIA 1MN7A 3G87A 3HHLB 1T9TA 3ZZUA 2VASA 3CCMS 2J7WA 3GPAA 4M5KA 4FXWA 4DV6F 5K14B 3LGHA 2RRBA 2KYZA 5D6GA 1WOSA 4H54A 3BKUA 5HANA 4CDIA 1BE4A 1CJUB 2ZH5A 2BRKA 3IS9B 2MZQA 4MJKA 4DU8A 1ZAWA 2HIYA 3ZZZA 2FHJA 3K5PA 4MIWA 4R25A 2OPSA 3D66A 4RNHA 4YY3J 3PVXA 1Y5LB 4P52A 3WX4A 3TZYA 2QIFA 2ZWPA 3H8YA 2F8EX 1JJCB 3N5BA 2YXLA 4HT7A 4ZA1A 2Q79A 1OQ3A 3W8GA 2IA6A 4JV2A 2YNHB 3DRXA 3SI8A 3HT0A 3K5NA 5J2PB 4IFYA 5EN1A 2KL8A 4URQU 1UZHA 2M52A 3KK3B 1D8ZA 2GV1A 2GHPA 1LXNA 1YHQS 2DHHA 3CCRS 1HI1A 1DLOA 3PNIA 4LF6F 4ED6A 3MEDA 1SIZA 3FSIA 4F3MA 3U02A 3R5AA 2BVZA 2QT7A 3BH7B 3VVTA 2ZHBA 4OI0A 4ZKAA 4ED0A 1JLEA 4RNFA 1WKLA 1X31C 2HWTA 2QLBB 1AZSB 3OXLA 1Q7YT 1M5OC 4X65J 3NY0A 2BKNA 2Z56B 2DR8A 4B9SA 3CUNA 1F3VA 5F41A 1KFSA 3TVZA 2OFGX 5D8HB 4DL3A 3MTJA 4KRWA 4CNZA 1XIQA 1UKUA 2BBEA 3O5TB 3MEGA 1T11A 4G65A 2YWFA 5I3QA 1GH8A 3UCGA 2VFUA 4OHZA 1CC8A 3TO8A 1PJ6A 3UN3A 4V19J 1Y3JA 1URNA 4ECRA 3TARA 1HBNB 2NUUG 1VQ8S 2KO1A 2KRBA 3HX9A 1NDCA 1QD1A 2ZHAA 4TU7A 3K8WA 4Y34A 1LWCA 4O4GB 3AB4B 4JB8B 1OSDA 5ADZA 3PIOQ 4TXSA 5F8MA 4MYTA 3NBPA 2CPYA 4LREA 4OZNA 2LP4A 3NMRA 4JI3J 1YK9A 4DR6F 4QYRA 2EG2A 3OR1A 3IP0A 3ZC4A 4WKYA 4RZRA 4KFBB 3KLHA 1N5VA 2BJEA 2CNLB 3KG4A 3PR4A 1PO6A 5FIIA 2DGQA 1VQNS 2NXNA 4C97A 4UTGA 4BWJA 3I0SA 2BM0A 1M5VC 4FXDA 3BYRA 3T9ZA 2VOOA 3M8RA 3GU0A 1TK5A 1T7PA 2HBYB 2I38A 1HBNA 2I0XA 3P5TL 3UI3A 2CPHA 2BE7D 1N6QB 2IHR1 2JL9A 4NL5A 1ULRA 2DGUA 4UOHA 3A4TA 3PRVA 2DB1A 4LR7A 3F41A 2YWWA 3DI6B 2Y1JA 1VI7A 4GKJJ 1FXLA 2VG7A 4R5PA 1CLFA 5DS7A 4ITSA 4DX5A 1TL1A 2YX7A 1VMBA 1NU4A 3CDUA 3FEYB 3CJ8A 1N5SA 1VS3A 3OR1B 3UW1A 1Q5YA 1S6UA 2QRRA 3CO0P 5KFWA 3MFHA 2CQ4A 3NEKA 3M1VA 3CIMA 4J9RA 1ZM2A 1FVSA 3QRRA 2NUHA 3R7SB 2HK3A 4LR8A 3C14A 3FJ2A 3ADAC 3Q8RB 1XNRF 2LCWA 2NQPA 4L6V3 5FLXY 5J2NA 1RT6B 1JLBA 1S48A 2AV5A 2ZOFA 3KXDA 4GMKA 5HVGA 3OL7A 2KU7A 2RH3A 2B7BB 2RQMA 4OV1A 2VA2A 2L08A 3R6GB 4F2SA 1UFWA 1HIYA 1T3OA 2P6TA 3TA2A 4F0MA 3CDEA 3S8SA 3LP0B 1UETA 3BGFA 3I0RA 3H2VE 4I2PB 2JVOA 2CPFA 4PXCA 2ASLA 5KT6A 1S1TB 3HFVA 2ZZMA 3M2RB 4CM2A 4ZOSA 2A0FB 3D6FB 4MT1A 2APOA 2AMCB 4RPFA 3VGSA 4KAIA 1JLFB 1ZETA 2GHWA 5IQQA 2Y9HA 1Y0HA 3SSRA 2MJNA 3I9ZA 6FD1A 2ZJRQ 3HP6A 3OHAA 3HULA 2OJ3A 5F0UA 1WEXA 5BJRA 3QLHA 2AYEA 2BMBA 3D5MA 3PIPQ 1SCJB 1TKZA 3WQPA 2RDJA 2A6MA 1KONA 3I31A 2YPZA 4F04B 1Q8KA 1FDDA 5EHHA 1C1BA 4I68A 4LR9A 2W9CB 3EPGA 1JX4A 2OIHA 1CSJA 3AOAA 2DT9A 2KT2A 4C0HA 2G2ZA 2UXDJ 4ZLJA 1TFWA 3KHRA 1HYSA 5C25A 4UQGA 2CG4A 4CH1A 2XMVA 3J80U 5C2CA 2HQFA 1YJVA 2GMHA 2YQ1A 5LXRA 4DR2F 3R7BB 1Y00A 4F4KA 1YBUA 5L8RC 4ES3A 1IKXA 1X4AA 3C6TA 5AE1A 3QBCA 2AX1A 2JC1A 2CQDA 2V2KA 3BB5A 1FKOA 4NEYA 4IFVA 3OV7A 2XY5A 3MD3A 4CLUA 5KFNA 3CCUS 1SH0A 3HZEA 1C1BB 1T8EA 2DPJA 2RKIA 1NCLA 2FZGB 3TA0A 2HMIA 3H2UB 5DDQC 2CNKB 2BV3A 3VZHA 5HN0A 4LSLB 1SB6A 4Y28C 2DEIA 2E7WA 1RT2A 1Q95G 1S6OA 2VV5A 3QO9B 1HBMA 3W1YC 2CQHA 2OEKA 2VDHA 4QR0A 6FDRA 1SL1A 2GS8A 3TZZA 2QJ3A 2EFVA 3X1LB 1CJKB 3SFUA 5THWA 3OTDA 3LW5C 1FDNA 2ZDPA 3OQ2A 3SQGB 3KLVA 2HHVA 2BJ3A 4IH5A 1N56A 3P4UB 5A76A 2GQQA 3NS7B 2F7VA 3OT9A 3M9MB 1NSAA 1HNIA 3PYGA 1IUJA 3LOUA 4JI7J 4KY3A 2M0GB 2P6SA 2K3IA 4DLGA 2DITA 3RB4A 4C48A 2RS2A 1X7VA 2OD4A 1C4CA 2WVFA 1HBUB 3ITHB 4WTYA 3JSMB 2F65A 2IPOB 2VKZG 1U24A 4O3OA 1B64A 3V6JA 5J1EA 1WC0A 4O3PA 5D78A 3DFEA 3R8YA 1ZS6A 1RTZA 4EWTA 1XK8A 3D1HA 4F67A 5SUHA 1XMQJ 4I4BA 9RUBA 1EETA 2AHOB 4JV0A 4RWXA 1QSYA 4B17A 3OTOJ 5KFEA 4QIFA 5D4NA 2V4RA 2HWHA 2Z30B 4DEZA 2RMLA 2LVWA 1LOUA 2E7XA 1W2BR 2YNFB 4WFXA 3H90A 4QWEA 1U2RA 1FRJA 1S1UB 2VG5B 3R97A 4BC7A 1Y7PA 1EB0A 1XWLA 3ZNUA 4O3QA 1G7CB 2FVQA 1RWUA 3KUEA 4A47A 4K0KF 1S0MA 2V2ZA 3D68A 4ZMMA 3ITHA 2AP6A 4ILMA 3EDQB 1C1CA 5HBMA 5B0GA 2FJXA 2XZDB 5I4MA 4CO4A 1HD1A 4J9SA 4FF1A 4PRFA 1SV5B 3A8JA 1KTVA 3RJMB 3WIVA 3G96A 4MKYA 4GVBA 3O3LA 2AWZA 4X64J 3P49B 4M95A 2WZ1A 2OD6A 4UZBA 4DN0A 2FVCA 2JSXA 2IVMA 4M8LA 4OX8A 5HROA 1KSPA 2LXIA 2YKPA 1VQSA 1BUXA 2ZH6A 4YN3B 1CQNA 3OW2R 4DN9A 1CBKA 3OHBA 3BQ2A 3THVA 2NZ4A 4IQXA 1NJXA 2IY5B 5DG8A 3ICLA 1RWWB 4M63A 4LBHA 1ZM4A 9ATCB 2XULA 2J0WA 3CJ4A 4CZCA 3M6XA 2CUYA 3CNQP 2DHGA 1A6LA 3H5YA 3QGIA 1YJ9S 3W64A 1O8BA 1KBRA 4Z2XA 1SQGA 1YSJA 5ETQA 3HMJG 4KPYA 3F73A 4PQAA 4F4AA 3NCQA 3MAAB 4DBQA 4MK8A 5D77A 4WYWA 3CEDA 2F9DA 1KP6A 2RDDA 3CJKA 2HHHJ 2FHMA 3ZXWA 1SKSA 3M8YA 2G4BA 3PX0A 3PG9A 1TQLA 3EZ5A 2HNYB 1F5AA 4QQBA 5HQMA 5KOXA 5B08A 3QAUA 1LNQA 1S1VB 3I32A 3A3OB 2N3LA 4NLRA 1C0TB 4NOHA 4A8WA 2C42A 2AYMA 4B9VA 1M1GA 2FLOA 1WG5A 2AJFE 4L75A 3UO0A 5L46A 4Q45A 2IRYA 1MN9A 3NNCA 1WJ9A 5DJBA 1N6QA 2KM8B 3KHGA 3SZ2A 3UD3P 3TAQA 2CJAA 4LFBJ 2XB2D 3DRSB 2JX2A 1T9VA 2HEKA 2DGSA 3PRBA 4QPTA 2F5GA 3O8WA 2Q6CA 4CIOA 1Q53A 3RB6A 4IRDA 1Y11A 3D67A 1U26A 1NMEB 4HACA 5DG7A 2UUCJ 1K44A 5KFAA 4DSKA 1UW4A 2O5DA 2MXYA 1RTIA 4FP9A 3TJ9A 2H1YA 2L48A 4FYVB 2GIFA 4U95A 2AT1B 3SDEA 3OUYA 1VYAA 2EPIA 5B0EA 1HBOA 4WP8A 4F3OA 1MWZA 4EK2A 1HQ2A 1UEVA 1BWEA 3KG0A 4OI1A 2RB7A 3FEZA 3CSKA 3MUVP 2HZAA 5U47A 3ZZRA 1N0VC 4KHRA 1SUQA 1P8GA 3AQPA 2KFNA 1C4AA 2YWGA 2FPHX 3I5AA 5KFUA 1VISA 1VBYA 1LFWA 3N6LA 3N6MA 1BQXA 1NO8A 3LANA 2ATCB 4OLPA 4K7QA 1WTFA 1TKXA 4IG3A 4I2PA 2KVQE 2V2QA 3IXQA 4XK8C 4YUDA 3A8KA 4NXNF 1V5IB 4ZVFA 4K4SA 1HWLA 1IBKF 4JI0F 3CD7A 1NEEA 3B8HA 1CG2A 4HHHA 1OO0B 1EP4A 4LRDA 4WP3A 4MK9A 4WFZA 3MM9A 2K7JA 3V4IB 2HK2A 1YX2A 4WU2A 1GT8A 1WC1A 3ZZYA 5IQ6A 2C2OB 2ZVSA 4C0BA 1RTJA 4EUVA 3PW7A 1FO1A 1RT6A 3KOAA 2F40A 2AGPA 1L5UA 4GKKJ 1RTJB 1WC3A 2XMKA 3QLHB 5I3UA 1S1WA 2I8EA 2AEFA 3AXMA 3FGVA 3OTEA 4CLYA 3PXGa 3W2VA 4BHQA 4QCLA 2RNEA 4MMOA 3PO5A 3E01B 3DI6A 3V81A 4F0KA 3TUPA 1HW9A 4W98A 1H7XA 2XY7A 2E9RX 4JP8A 3SIPB 4PG5A 3RAXA 2KXNB 4V19X 3W63A 2VC0A 3MPYA 4RW8A 4LF9F 1GMUA 4FNHA 3OPKA 5IT0A 2FLLA 4N76A 3DOKA 1SPBP 3I6PA 1RI7A 3BSAA 2XS5A 4NLTA 4O44B 2JRSA 4EBDA 2MYFA 3Q2TC 1VLOA 3R6LB 2XMWA 2CQ2A 4KGKA 3KLFB 2H3EB 4XDCA 4W90B 2E9TA 1T3NA 4OYZA 4I0WA 2MZSA 2NZCA 2FD2A 2HS4A 2XWYA 3R2CJ 3NWGA 4FS1A 4OI3A 2YKOA 2HFVA 2XC9A 1JLQB 1S7IA 5J1PA 1SI9A 1S6PA 5IT4A 1R8BA 1SIWB 1RAFB 4YB7A 3W5ZA 3LTOA 4K2JA 5HMZA 2XCAA 1ZYQA 1RT2B 3HHKA 1KRPA 2QYCA 2WSCC 5MAOA 5DETA 2J0SD 3IMQJ 4AL5A 3J81Y 4QIEA 4O4GA 3MR2A 4P75A 1R89A 5LL6d 3T41A 4AXIA 5KFKA 1FFSB 2W9BA 4U67Q 3H7HB 1UVKA 3NKYA 4PPDA 4DXLA 3J81j 4EZ6A 2QO3A 4K0KJ 4IFVB 4J9VA 2MKKA 4ZVOB 5D0HA 1L3KA 1MROB 3OR2B 3W5XA 2W9CA 4B3MF 2R7SA 4O3RA 3HDSA 4LF4F 2XNQA 2CYYA 1F2GA 4ECXA 1NJZA 2IBKA 5L1JA 1MMNA 3NWRA 1HNZJ 2MY8A 1VQ7S 1NDKA 1NPRA 3IR5B 5EX0A 2HVHA 2X7IA 1PGZA 1RWMB 1FJGJ 5LOQA 1CJTB 2VQEJ 1UVLA 1I51B 3NCPA 5A8RA 4LSNB 1NUEA 5KG6A 3R7NB 1RT4B 2HQGA 1DFDA 1K73T 1JNZB 3RU0A 3TUZC 2LA4A 4ZVTB 2JEJA 3ET6A 4B3OB 2A1BA 4LRAA 4ZJOA 2IFXA 1VFJA 5M2UA 2CPXA 3PTWA 1S76D 4J9UE 4L72B 2HNZA 3IWNC 3O2IA 4ZVQB 5IOLA 4EMDA 1FHTA 3MUMP 2B5JB 3LP1B 3U1LA 5DRKA 5J2NB 4OZJA 3HHLD 1HFEL 3V4MA 1RCOB 3H5SA 2VIHA 1K1SA 4DSJA 2VG6B 5CCMA 3QT5A 1GFWB 2A3JA 2B43A 4ZVPB 2X3GA 4ETXA 5F8HA 3O6QA 1HHTP 1DJ0A 4CO1A 2DHXA 2EK6A 2ZH3A 2FY1A 1S9GA 3DGVA 2HHQA 1BXNA 3DGPA 3MZIA 3ET6B 3RW7A 1TUGB 2CRLA 4N41A 1YJRA 5IC4B 2V8DA 3EPIA 1XERA 2DR5A 1O5JA 1HR0F 3E2EA 4DQPA 2D3OR 3W2WA 1SKUB 3HD2A 5JUMA 2GMLA 5HBMB 2W7PA 4JI1J 3JSMA 1TL7B 1PJ5A 1N5QA 3H98A 1NLKL 2B4PA 1U8SA 4Y2MA 3QRPA 1NBEB 2JFKA 2DH9A 2YWEA 3C8YA 1HNWJ 1RAJA 1TL4A 1W26A 5CYMB 5KFYA 1MMDA 3NNHA 4FYDA 2CQGA 1B7YB 1NK8A 3GIKA 3J80Y 2EKNA 5H9FK 3QZ8A 1SL0A 1TL5A 1LQ9A 1NK7A 2CADA 3BR9A 4NLVA 4USIA 2CWXA 2R2UA 1G3OA 5F8GA 1K0TA 5KT5A 3UFCX 3EZOA 1IQTA 1XC9A 2POKA 2W2PP 4LSZB 4H4OB 4H4KC 1LWFA 2DNOA 4M5MA 1NHVA 2R2SA 5I42A 2FIUA 2GMJA 1PYSB 2M8HA 3MMJA 1D8YA 1TL3A 3MAAA 5AE3A 5CYQA 5GMEA 1PILA 4C7QA 3CCVS 5DM6Q 4B3TF 2ZZTA 2IC3B 3HD1A 2D9PA 3HSZA 2AD9A 5LSOA 2CQ0A 2ZNYA 2MPUA 5D4OA 3FCVA 2GFFA 2BQRA 3FQLA 1FFGB 1PIEA 2HGNA 1JMTA 3EX7B 3V5RA 2MZ1A 1VC6A 1RACB 5F3TA 2HRTA 2FC9A 2VL1A 2BE2B 2CJQA 3K89A 2MQQA 5DDRC 2EW9A 2IM1A 5LMUF 2DCUB 1QTMA 4LMZA 5F8JA 1M5HA 3BBFA 1YKWA 4NYPA 4M5NA 4BC9A 2UVRA 3OL9A 1ZM3A 1QLNA 1SJRA 3I82A 1QVGR 2DH7A 2DNZA 4LF1A 4ILLA 2A10A 1OPIA 5C42A 4LT6A 3KK1A 3PEHA 3OL6A 2C2MB 2CDRB 3HHNB 2HBZB 4ZIVA 4ZITA 5J2MA 2MGZA 4AQYJ 1U0SA 4YHHJ 3KHLA 3HKWA 2VHGA 3DLGB 2H4YB 2Q6BA 4NCAA 4X4OA 2FB0A 5E3AA 2OKQA 3M4XA 2N82B 4EU0A 1HD0A 3IM8A 2M4MA 4QZVB 5G4DA 2WHOA 4WP9A 2OPPA 2DY1A 2ROGA 4WFYA 1EQMA 3QIPA 4G6VB 4GO7X 1RT1A 2WBRA 5ETSA 2VPYB 4NLSA 3UR3C 3W60A 5CD4A 2QFIA 1UTAA 3LGNA 2VFTA 4DUZJ 3WIUA 3DYAA 1Z2LA 3FCWA 2QV6A 5HAOA 1TKTB 2V4QA 4ATNA 3CD6S 2XI3A 4X4PA 2VBWA 2AU0A 2R7UA 4ECWA 2XLIA 3CC4S 3GMGA 3VAGA 4ZHRB 4DSLA 4ZJQA 2KVIA 5K8PA 4I7FB 2HYIB 3G6ES 1H6KX 2MKJA 2YPYA 1B4SA 4DHVA 8ATCB 2QZ8A 4CLSA 8RUCA 3VQTA 3FC9A 1R8PA 2OPPB 3CTRA 3OSPA 1RTIB 3AD7C 5IWAF 3PKMA 3MD1A 2Z2MA 2JLFA 2LDIA 3PO4A 4FKXA 3C3LA 4RW4B 2HRUA 2P9EA 1RAAB 1C1CB 4XPCA 1G1XA 4OIXA 3TJAA 1HQEB 2BUNA 4ZPCA 2B8PA 2G2YA 3TW0A 1RWPB 2COLA 5FD1A 3CE8A 4RUHA 2VJUA 1F3FA 2ATLA 3H2LA 4CLTA 4DQSA 3HVWA 1KKHA 1NB2A 3AA8A 3AAWB 4RWWA 1JJ4A 4C8YA 1PYTA 4J7CA 1S6QB 2MKCA 2NCKL 2XMUA 3CMQA 2K2PA 2CVEA 4C0OC 3T5KA 2CPDA 2V8PA 4EFAC 4C8NA 4ED1A 1KVJA 1S10A 2QMXA 1XN9A 1F5CA 2RQKA 3CCSS 5ETVA 2DBBA 4PCQA 5KFJA 2ADCA 1EP4B 1RHRB 3ONQA 4WK3A 3G8SA 2D3O1 3RBZA 1U1LA 1FRIA 1N32F 2LFVA 2B4OA 1F60B 3K17A 1R8HA 5A2QY 3LO3A 4BS2A 2QLXA 1RWOB 4A8QA 4A8KA 3CJKB 4YR0A 4OZ3A 5DGAA 2BR0A 3FSYA 3TEHB 4RR5A 3UNYA 4O3SA 1UW9A 2BM1A 2PA3A 2QGFB 3AD8C 1U1PA 3ZFVA 2HNYA 1Z2ZA 3MECA 3KNGA 4YOEA 3DOMB 2C3UA 2ZEJA 2DNYA 4GO5X 2QLFB 1GXTA 4A46A 2J6TA 1X0FA 1UVNA 2RF2B 2VB6A 1ZTWA 3HO1A 3BH6B 4OLOA 4PWDA 4JV5F 2DNQA 4BCAA 1CQMA 5GAGU 3FVYA 4OI2A 1PJ7A 2IMWP 4CQ1A 2EI5A 1IKVA 4NI2A 3NGDA 4F7VA 4C11B 2IDEA 3CDBA 4M5GA 3BR8A 3W9JA 1S97A 3M6UA 1K8AT 5BR8J 4HL9A 3W62A 2IVYA 3JXOA 3FKBA 3VV2B 2QMWA 2DD8S 3AQOA 1GK8A 1RE1B 1HNZF 2Z58B 2XGQA 4DSIA 2HQCA 5IV4A 2OFHX 4HI1A 3BGLA 3FUYA 2LU1A 2KM8C 2ZITA 4CLKA 1RAGB 4NLXA 5B7WA 3TAMA 4G3IA 3G9CA 1O51A 2R2RA 1RLCL 3AB2B 2HQDA 1JIHA 4WWSA 3CCZA 4DL0C 1NK6A 3QO9A 1A0OB 1HBMB 3L09A 3ZZPA 3CMAS 2ZBCA 3JTNA 1YTYA 1T95A 2VONA 3QYYA 2LECA 1TV6A 3M8PA 1N4LA 2KDOA 3KHHA 1SQFA 2KG1A 1VK8A 2SXLA 4LF2A 3UDVA 2ZNZA 1W25A 1I5OB 3SQOP 4LSNA 2NXEA 4O0NA 2PI5A 1V3SA 2DNKA 3IR6B 4ZPAA 5DO2A 2NXJA 4CO2A 1WI6A 5KG0A 4CO3A 3OBIA 4USVA 4TU8A 3RBDA 4DR5F 2W4PA 4K59A 2NPIA 4ES1A 4CO0A 3QJPA 2CPJA 1G6BA 5EX3A 3CPWR 2EG1A 1JLCA 1U0HA 5D15A 2OPRA 2XO6A 2ROEA 3LP1A 5FJ4A 1DTQA 1U8WA 2ZBIA 1GXUA 1TL7A 3JSYA 3HHLC 2E5LF 4OYMA 4UY8T 3NG8A 2BJDA 4W92B 2BKOA 2Y1RI 3GFZA 1RBLA 2DY9A 1ITPA 2HNDB 4IRKA 1IR2A 3DGPB 3K5OA 1ZZFA 3VAMA 3PM9A 1QE1A 2Q3PA 3BGRA 2RUSA 2YBVA 6AT1B 1N5TA 1PCAA 2NXCA 4B3OA 3CJQA 3PFOA 1U1KA 2UUCF 3BGRB 2VQFF 2AJ1A 1OYDA 2C28A 5K14A 5C5JA 2WTFA 3EYZA 2EC2A 3DOKB 3NGRA 4FVMA 3H5XA 1TUWA 1VDHA 2UUWA 4PQUB 3EVOA 3IC1A 3UDCA 4WFAQ 1DRZA 1KLMB 2H48B 1S4FA 4DR4F 2GO9A 1N5YA 1FRLA 3JTOA 3VAFA 1DTTB 2R2TA 3Q86A 1FWLA 4KSEB 2OPQA 5KFQA 1RJJA 1NPKA 3ULHA 4YB1P 4YR3A 1KDNA 2BX6A 1FX2A 4DFJA 1LKZA 3R5BA 5AT1B 1F1BB 1QM9A 3K0JA 1S6PB 1K1QA 1RHJB 2PE8A 1MW7A 1J27A 1RP5A 3U27A 4Y00A 4NXNJ 3L7OA 3RG6A 1LWEA 2MLXA 3R5DA 1HNXF 3HZGA 3NS5A 4RBVA 1FNOA 3T6BA 5KFPA 1HMVA 1LWEB 2W25A 4X84A 1KQKA 3GTYX 1XNQJ 2B8QA 2MEWA 1C2PA 4GVLA 4N8NA 2YNGB 4OMFG 1KQFB 2DJWA 5KG2A 3ILIA 1REVB 3QNWB 2V4JA 3QAEA 1OS5A 2BA9A 3KKFA 5HLFB 1R8AA 4DV6J 4F0HA 1Y9OA 2V0NA 3CCTA 3QFWA 4Z7CA 3LWLA 4JI5F 2DIUA 2D74B 2RS8A 1TKDA 3O44A 1KOOA 4Q43A 1ZA1B 3C15B 3MM8B 4ECQA 1AA1B 1YJUA 3BGOP 2CQ1A 1HQUB 2I5JA 3DMJB 4KKOB 2GJ2A 3NOCA 3VWSA 5AE2A 2RU3A 1NK9A 1KVIA 5EDWA 4CLZA 2BRLA 2N7YA 5DGBA 3L7PA 5H9FJ 1ZPWX 1I3OB 3QMQA 3H40A 4X4VA 3AJDA 1X5OA 1U1MA 1WDTA 2EFNA 3S1TA 2CPEA 2IM2A 5I42B 1GAOA 1KEKA 2BZ2A 4EBEA 3NBPB 2VBYA 3C66A 1X5TA 1FEHA 3AOBA 4Z37A 3Q24A 2PMWA 5G0RA 4NCGB 3PJXA 2RT3A 5T7LA 4QPXA 4DUZF 4DQQA 1S0NA 5H9EJ 1B3TA 3LWMA 1U2FA 2R7VA 4NLOA 3TNVA 5LM7E 2D3UA 4UOCA 3RYLA 5HL7Q 2CZ9A 2VQEF 4CLPA 4LQ3A 2W2MP 3UE2A 4AYBD 3MR3A 4C6AA 5E41A 2V94A 4K4XA 1TKTA 1RWKB 4HDGA 4C98A 3HHDA 4ENOA 3SV3A 1I6JA 1EARA 2CJ9A 2XSFA 5L38A 1URRA 1BQNB 3KDOA 3OVBA 1K47A 3EGWB 1NPPA 2NSCA 2ZFHA 3IAS9 2WBMA 3SCKE 5HSPA 4Q44A 5LMNJ 5I3UB 5KFTA 3CJRA 4ED3A 1U1QA 1CEZA 2BABA 2HURA 4USUA 3W9IA 3PKYA 1QSSA 4LFCJ 2K06A 1P6TA 4OV6A 4ECYA 2XHCA 1MG7A 3WC0A 1BWVA 1RK8A 4DPUA 1RHMB 5ITHA 1KVKA 2PFDA 3P45B 4B3SF 1S5ZA 3JB9k 5D3GA 3J7A1 1JQGA 1JLGB 3GFHA 4M5IA 7FDRA 2IIHA 1BQMB 2XYHB 5HMYA 1F5BA 4J9OA 1M1KT 4NA1A 1RQ0A 1MWYA 5E5NA 2UXDF 3FFIB 2Y8YA 1FWKA 2G0IA 4UOFA 3MOJB 4X65F 4ZP6A 3KLIA 2EBEA 2DXDA 2LYVA 3KLIB 4DR2J 1WF2A 3DM2A 2YQ3A 5IC6B 3WDOA 3Q23A 2NREA 1DY3A 2OELA 4DR1F 1IWGA 5HP1A 2YX1A 3I0RB 1SQEA 1FXDA 2J9CA 5JJBA 2I9SA 3V6DB 2HFZA 2E5HA 3B6BA 4FNIA 2X1BA 2AYBA 3AT1B 4P2FA 2BJ7A 2GVDB 3MURP 2GAHC 3MM6B 3DDIA 5K8NA 2CG8A 4U8VA 4DX6A 1K0VA 3JYTB 2I1RA 2XY6A 1WACA 2QEXS 2CQIA 3T1AA 4KH1B 5C24B 1H38A 3POTB 3VGVA 4WZMA 2O3DA 4CWBA 2EFOA 4ZP7A 2Z2LA 1S1XB 1KWMA 1RA6A 3M8SA 2ZHOA 4ZVGA 3U1NA 4KHPJ 1V9OA 5T41A 1JWWA 2PC6A 3M05A 4C8ZA 1BY9A 5BYRA 1Y10A 3NGTA 5IS2A 4XIUA 1E6VB 2ZH2A 4L74A 3ZZ0A 2QA4S 3R27A 3MEGB 1FD2A 3CULA 3TVYA 4QYZK 4HEA9 5IM0A 1PAEX 1S99A 2F1FA 2HHTA 5CAAA 3GYXB 4PG4A 4H4MA 2CQ3A 3MMCA 4L73A 1QAYA 5C42B 1IKWA 5ETOA 4X2BA 2MTLA 2QA1A 2W1BA 2RHQB 3NCRA 2MGZB 1NK5A 5DZ7A 3HVTA 2CPIA 3POTA 2AX0A 4IRCA 5ETPA 2OTJS 2HKEA 1X0PA 2NLWA 2R7QA 4Y2IA 3WC2A 3VHQA 1RT4A 1PC4A 2FGCA 1NB7A 2BQ3A 1LEOA 2H4WB 4V1Ak 1RAHB 3D54A 1VBKA 1YBAA 4CLLA 2AJ4A 3KJVB 2W01A 2X1GA 3AFGA 3DOMA 3MMBA 3JAMY 4DSFA 4LSLA 3I0SB 2MHNA 4N56A 4K4TA 4LFAF 4YEAA 3NGSA 1ZBTA 2UVUA 1ZAVA 2MLYA 3MMCB 4QW9A 2XLKA 2B5JA 1WG1A 2RQ4A 1NH7A 2ALYB 3CO9A 3CJ0A 4TYAA 1Q1KA 2DNPA 4KIAA 4NLPA 4N47A 5AXKA 2R8JA 2R8GA 3DLLQ 4BBYA 1OQ6A 4W4MA 5KFVA 2RRNA 4RNNA 1L3UA 4HACB 4KGXB 4LFCF 2NXUA 3DC2A 4PXBA 4ZJLA 3UDEA 2M9KA 1X4HA 4WKRA 3M2RA 3US5A 3J7AN 4BLGA 2OI2A 5HO4A 1U48A 1N8RT 2VC1A 3IBWA 4NMLA 4QR1A 2CA9A 4N5SA 2UU9J 5KG5A 1QAXA 3PYEA 3J7YI 4R8UA 4DQIA 1VJWA 3QFHA 2DNNA 2OMOA 3IRWP 1U1RA 3KUGA 2C1EB 1KFDA 1W2IA 1KLMA 3UWTA 3M30B 2BOAA 1UFKA 5E3CA 2K8GA 2MMYA 1JLBB 1IWAA 3FZBA 4OZ0A 5DLGA 1UEUA 4X62J 4DV1J 3K5LA 4GC6A 4NCBA 1EETB 2X1FA 4ZIWA 2W7OA 1GQEA 2FJDB 4RJVA 3VCDA 1TKXB 4IG3B 1FJ7A 1S9GB 4WF9Q 4LRCA 2CXEA 1N88A 1OMSA 1VHIA 1WTBA 1SKWA 1I94J 5FDLA 2XHWA 4DV4F 1N33J 1UVJA 1FDAA 3LPYA 5A6PA 2CQBA 4ANEA 2XYGB 1EIYB 3C6UB 1S7HA 5D0GA 2AF6A 5AJ3F 1M90T 2MKYA 4X4QA 2DVIA 3DHXA 5HJXA 1S9EB 1R43A 5ETTA 1FI4A 2KYXA 4KHMA 2EVZA 1D09B 3D0HE 3KJQB 4TQRA 2HG4A 3C2PA 5CYMA 3ZTOA 1TKZB 1UJ4A 1VOMA 3K57A 3KLEA 3LP0A 3CJ3A 4PXEA 2RVJA 2FJBB 2ZKUA 3D6HB 3V2UC 2D41A 1TVRB 2LQ9A 4JBCA 4IG0B 3D2WA 5LMNF 2I5JB 1HQUA 3DMJA 1U6ZA 2LKZA 1WHYA 2E1MC 4ILRA 3ZTPA 4A8OA 2VF3A 2FTRA 3DLEA 3IG1B 1WI8A 2ZH7A 5A8WB 5AXNA 1NDLA 5T14A 4DR3J 1CJKA 3RGIA 2GIRA 2RILA 4ZPBA 2N3OA 1U7LA 2DYAA 2GZOA 1RTDA 3DLHA 3H20A 1T05A 5B0FA 5CD4H 1BD6A 4P10A 5KAKA 1Y5NB 5GAGI 3CCQS 1AUSL 3G6VA 1YITS 3KLFA 1YRTA 4O4RA 2QE5A 2FZCB 4USTA 4DZDA 4NCGA 5T7LB 3PR5B 3PYFA 4HT5A 4N8OA 3BJYA 2AYGA 1JLQA 2JC0A 2FJAB 2LA6A 4IO1A 4OZLA 2WAQD 5C7PA 2JLGA 2HHSA 5EWGA 4B02A 2GVZA 4IG0A 2VBXA 3D1QA 5IWAJ 3K5MA 2LQ8A 2J6SA 1QDUB 4CYUA 3NS6A 4U8YA 2ZKTA 4OYXA 2C2NA 4NLQA 2YKNB 3TP2A 2FVRA 4YDDB 3NOGA 3FBCA 1NKCA 1PG5B 3N01A 3MCOA 3QPIA 1VQ4S 1RTHB 3DRRA 4KJIA 3D0GE 1TMMA 1X4GA 4ES2A 2UUAJ 2G0CA 5G0RB 4ID5B 3E8OA 4HKQA 1R7IA 4YP3A 1SJFA 2HWIA 2MKHA 3MCNA 1OWXA 1SC3B 2BKPA 2HZCA 4F3QA 3Q8QB 1KNZA 1U6FA 3ZTRA 4U6PA 2HMIB 1T9WA 4KGZB 2HHWA 1H3DA 4C8KA 1HNXJ 1B0PA 4P74A 2IM3A 1BQMA 3PFEA 1IKYA 1H2VZ 4NZ7A 4X66F 3KJFB 2CDQA 2Z2ZA 5KFGA 4DX7A 2DRAA 2PGCA 4KYZA 2DGXA 3QJLA 3AODA 4CNYA 2WOMA 3PY8A 2BOPA 2MZJA 4DV1F 2E5JA 2QMUB 5ETKA 3QIDA 1TAUA 3GJQB 4X4RA 2PT0A 1SH2A 4C2MA 3RBXA 4JI4F 1V5VA 3D9BA 3GLJA 1FERA 1PAUB 1Z1ZA 3RAQA 1FESA 2HLUA 4B08A 5DQGA 3RBEA 1LW0B 3D4JA 4L3NA 4RNOA 4AD6A 2LQJA 2F8MA 4DV0F 3CXCR 4NZ0A 1FDBA 3TEGA 1EHWA 1G4CA 3MM9B 2F3JA 4YDXA 5A6WA 1RYRA 1KHWA 4G1PA 4Y2AA 3G8QA 2V2VA 4CI0B 2C2RA 1HQEA 4CCHA 2LEAA 2CFXA 4IOAQ 2A2DA 2M2BA 2VG6A 1UA0A 1KN6A 3BV8A 4HHJA 4TY9A 5J1NA 3CD5A 4TY8A 3JAMU 1BQNA 3BQ1A 1CVJA 4XAKA 2E44A 2Z57B 1MMLA 3P5BP 4OYOA 2YNHA 4CTAA 4B9UA 3PHTA 5L9NA 4JV1A 4OL8A 4X62F 5J2PA 4DV2J 1RUSA 3D28A 2FLNA 2UXCF 4B3RJ 1HLWA 2C3PA 3D6TB 4OHYA 2B4UA 3FRZA 2XMMA 3MM6A 4LBIA 2VDIA 2FGOA 2G1HA 1X4BA 2HVIA 3KYLA 5GMKa 3R1LA 1HWKA 1JLEB 2GJIA 2IC3A 2PMHA 2WSFC 2ZVIA 2Y1LB 3MTKA 4NI2B 3BM7A 1JJHA 2RDIA 2NPFA 5A8KB 4KGMA 5A2QU 3H59A 3T1YJ 1WNEA 4ZPWR 4F4YA 4NLYA 4IDKA 3PW2A 4B3SJ 3RB0A 4LBPA 1FCAA 4DJBA 3Q8UA 4LJMA 2RF2A 3FBEA 3TX8A 1T9YA 1LWCB 3MEDB 3TANA 2RIJA 3BDEA 4FKYA 3AHPA 1BC6A 3QT8A 1YLXA 3C46A 1TV6B 2W9BB 3MR7A 1MU2A 4ZPVR 2OGUA 1RBAA 1JB0C 2ASJA 5JXSA 1U47A 5BYSA 4IUFA 2ZOGA 4PYDA 4P72A 5DQIA 4AT1B 1NAQA 1GNKA 3HM9A 1F9EB 3W66A 2G13A 4KQZA 1U49A 3KLHB 2B9WA 5HQ8A 4WPAA 5A0YA 2Z2YB 3UD5A 3M2VB 4ANDA 3T1HF 1U1OA 1M5PC 5IM0B 2ILZA 1HBOB 1HI0P 1P9YA 1LXJA 1JJ2R 4DL7A 2QSWA 3BZQA 3CC2S 3U1MA 5KT3A 2IYGA 1R0AB 2E9ZA 2IAJB 1X4DA 2DXFA 1OY9A 1WD6A 4OYBA 1NJYA 2H51B 2KFYA 4DUYF 2JEGA 3C16A 4KB7A 1N48A 1GTEA 1N32J 1UP1A 5D4LA 1UMJA 3MPUB 4I69A 4P2XA 5KTQA 4QIVA 1HNWF 1PC5A 3EXYA 4LQ9A 7FD1A 1AFIA 4YQWA 1S1TA 2B0GA 1HA1A 2F4VF 4F50A 4P73A 1VC5A 1HWUA 1RHKB 2EBGA 2G9OA 1K9MT 3DDNA 1JLCB 2CNOB 5M2RA 4ELVA 1VQPS 3DYAB 3GE9A 2L9WA 4TLQA 4AL6A 4RUAA 2ASDA 2H5IB 4OX6A 4TN2A 1NM2A 4UUXA 3WZ0A 4NLDA 3MM7A 1FE4A 1EAYC 2UZAA 2IAJA 4K4YA 1RYSA 1JLAB 2UXBJ 2WVCA 4JV5J 4PWUA 3MDFA 1IBCB 3CIZA 3D3BJ 1JLAA 2P8IA 2HAIA 1TFYA 1XR6A 1HW8A 1VJQA 2LQBA 3JQJA 2ZOMA 2IA0A 3O1LA 4ER8A 3SMZA 3GCXP 1TL1B 4Y3CA 5ETRA 4Y2CA 2FHJD 5F8NA 3D6MB 1XBWA 2VFRA 5C25B 2BACA 1A7GE 2B6AB 1L3TA 2MLZA 5HJYA 1CC7A 5BXIA 4OQJA 3QSIA 1Q16B 1KD1T 4GRSA 4HTIA 4YY3F 4DR1J 4PQUA 4F4ZA 3ZNJ1 1RTDB 2GW8A 3Q22A 2VJVA 5KT7A 3SBMA 3GIMA 2M8DB 4DL5A 4M5LA 3SCIE 4NLGA 2J5AA 2Q1LA 3BSCA 5J2QB 1N52B 2MHEA 5LJ5Y 3OUYB 3TQ1A 2V68A 1LWXA 3KDNA 2HZVA 1IM6A 2LXUA 4S0MA 5KFXA 2E1AA 4ANCA 4NYOA 5K8OA 1YVFA 1B0VA 1C0UA 2ZBQA 4NPOA 5LSRA 4K4VA 4RLEA 1S72S 1I1GA 2GIQA 4MKVA 3ENWA 3OFGA 3QGGA 1NDPA 2GGPB 3M7VA 4J9KA 3V6HA 4QU6A 5KFBA 1Y5IB 2PSZA 3KLGA 2EC0A 2EFQA 2OEJA 4IH6A 3BSOA 1YRUA 3UD4P 5E7OB 2JEFA 4C11A 1VQMS 2VA3A 4DG1A 4M94A 3D7SB 3HLUA 2CJXB 2BYCA 1F9HA 3CB4A 3L7UA 3R5JB 4WIQA 2FQQB 1AROP 2QYGA 2RKIB 2C2KB 2RAQA 3DHWC 4YFUA 1AUDA 2RUGA 3DXBA 1B70B 4UUWA 5ETLA 4Q0BA 5I3PA 4EZ9A 3W7BA 2KXFA 4KBIA 2GAGC 2D1CA 2DR7A 4X4NA 2FJWA 1HBUA 4F36A 3T1YF 2IMOA 1RT7A 1VQ6S 4QIGA 3PW5A 1UL3A 3GG0A 1X8DA 3BO3A 5D0RA 1UJ5A 3KMQA 2WB4A 2W9AA 3L4BC 1YG0A 5EGYA 4I64A 3S01A 2YKQA 1V3ZA 4ED8A 4RBTA 3TI0A 3HF5A 3PJWA 4LF7J 2VODA 1H2TZ 4HYKA 1JNRB 2XMTA 3ENAA 4WJBA 2RQCA 3TR5A 4MH8A 1UJ6A 4ZCIA 4ZVUB 5B0CA 2J8SA 1H98A 3P96A 3OFHA 2F63A 2XSJB 3MMAB 1VRUB 5GAHU 2PN6A 1IKYB 2AW0A 3EJMA 4WIIA 2AEMA 4RW6A 2MZRA 1NJIT 1RT7B 1UAWA 1W7WA 4DCJB 4ZN3A 2JDJA 5JMNA 1Q8LA 2IJFA 3IS9A 2VFVA 3IR7B 3M8PB 2J8AA 2XBPA 3FBBA 4P7TA 1RT5A 1J5EJ 4DPXA 1T03A 2DGOA 4DSEA 1LK5A 4D3GA 5JVGQ 5HMWA 4TY8B 1XEZA 2BE9B 4A48A 3EVWA 1F0XA 4ZHRA 2HPUA 2MQNA 2W4DA 3F44A 2BJ1A 1HHSA 1TELA 3ZTSA 1YZ6A 2UVWA 3RR8A 3E3XA 1ZAXA 4JI2J 2MY7A 1U6BA 4ID5A 2J0QD 3HCXA 1S77D 4DV3J 4WBFA 3PJ9A 1R6VA 5IZHA 4JYAJ 3OFEA 1TUVA 3V6DA 1B99A 2W24A 1FRHA 3D3CJ 2P5VA 3A13A 3EXCX 4TLRA 4DWIA 2OPRB 4LRBA 3BO2A 4YHHF 4H4OA 3VAKA 1FT8A 4R0JA 5H9EK 4C9DA 3CJ5A 4ECUA 4RW6B 3T9NA 4RBUA 3GG1A 4I56A 1TK8A 2DXEA 3TZXA 3MOZA 1HNVB 4DFPA 1I94F 4P7VA 5D4PA 2KZMA 3K8VA 4J9MA 3R1HA 3FK4A 2I2YA 4KR0B 3H25A 3BKFA 4UQTA 2AZ3A 1GXLA 2OPQB 3MAHA 4ECTA 2DR9A 3OXGA 3M8WA 4NX9A 3OTCA 1TVRA 4EYHB 3MM5B 3VGUA 2DO0A 1AXQA 2ABYA 5BR8F 3NRBA 3KK3A 2F4FA 1JKHA 2FDNA 3H4DA 4LFAJ 2HAFA 4DPOA 1ZPVA 3IG1A 1ACMB 1JKHB 2YTCA 3ZTQA 1QTNB 2V63A 3W2WB 3GJSB 2UU9F 3DN9A 2YH1A 3QZ7A 2HVDA 1OIAA 1WELA 4JI8J 3NP5A 3I9V9 5L1KA 3PX4A 4N7TA 1N5YB 1XMOJ 4DQRA 4LF5F 3R3TA 1TAQA 4OYWA 2DNLA 2LEBA 1VC0A 1Q4RA 2OMLA 5A8KA 4UY85 4DU7A 1H2UX 2CNNB 5DQHA 2N4CA 1H7WA 4EI2A 2R8HA 5GAEI 2DR6A 4KFBA 4QU7A 4NXMJ 2RU9A 4TQSA 1OY8A 3KK2A 2PIIA 3CJ2A 3MEEB 1ROFA 4IKAA 3HSJA 3MMBB 3EMTA 4MYUA 1NK4A 4B3MJ 3M8ZA 4LIRA 4HH0A 1MNEA 3L3CA 2AQ4A 2UVVA 2R4FA 2QA4G 1NJWA 2JWNA 2HHHF 5SZTA 4M1KA 2YNGA 4WXOA 5E3PA 1RAIB 3DRRB 5H1SV 1EQ0A 1FF2A 1WHWA 2V34A 3E51A 1H0HB 1YZ7A 3FSXA 3GSIA 1IR1A 1BHNA 3IAM9 4Q2LA 5IXUA 3GCWP 3H42A 1WSVA 4QBUA 1N34F 3ISNC 4USWA 3TYTA 1FNXH 2AGOA 3BSNA 1VHFA 2RSQA 4PWWA 5CZVA 5EUHA 4DV4J 4WE1A 3RTVA 1N33F 1NRKA 2D9OA 2CQCA 2BDPA 2V50A 3IA0A 2NYIA 2AEJA 3QQCD 2KKHA 4DUYJ 1YI2S 4Y0FA 4YS2A 2GQ2A 4KV8A 3DNCA 4DR7J 4UW2A 1IM4A 4ZPTR 5K9FA 1Q78A 2BW7A 2ZM6J 2HFOA 3M9NB 1TTHB 1DHMA 3R9LA 3P8BB 3M30A 4TYBA 1P1LA 4UZCA 3MHYA 4USHA 3W2VB 3BN7A 4DR6J 2ZWOA 2VG7B 4R5PB 2E5GA 4CT9A 2PD1A 3KMSA 4JI7F 1PBUA 5CH7B 3W8PA 2NS1B 3J81U 3FDSA 3GJTB 4J91A 2BXJA 2IVFB 1UWAA 1HPZB 4WE1B 1IR0A 1D9AA 1HI8A 2NYHA 3V4IA 2MQPA 1IJEB 2EXUA 2HHUA 4PKDB 1VQKS 3ELHA 2HFUA 4MFBA 3MPDA 2B3TB 3UN2A 2WVDA 1NHUA 2ZD1A 1TZ0A 3UN5A 4P9SA 1XR5A 3H5UA 4K2XA 4MFBB 4FYXB 2C2DA 2KT5A 3GIRA 1S9EA 2HHPA 2Y3YA 1Q5VA 2E7VA 2VH7A 3GYGA 4ED2A 3TOQA 1R27B 5CHCB 2OUGA 3FBFA 3WX8A 4J9PA 2DRBA 2GO8A 4ZK7M 4I7FA 4MIBA 4TNOA 3Q8SB 2AJQA 3GB0A 3OFFA 4WFBQ 3MGJA 4DOZA 4IO9Q 2E1CA 2PFFB 4USKA 2W2NP 2IJNA 3GFXA 3CWJA 3HFZB 4CM0A 2QSFA 3HSDA 2CWKA 1S57A 3MR6A 1ZTTA 1T02A 2MB0B 4CH7A 1N36F 2KN4A 3GQCA 2R8KA 4EGLA 2OEMA 2CJYB 3LA0A 4DPTA 3AJ1A 2P9GA 3HKZD 3FFIA 2V67A 2EFPA 5B0DA 4O3NA 4OHVA 1X60A 3C14B 3JYTA 3CW2C 1M1HA 2MKSA 2R42A 3C6TB 2B9XA 1BGXT 4HTJA 4DV2F 5F9LA 1SJ4P 2ZH1A 1KQGB 4DV7F 3NNAA 4RW7A 3BEGB 3RZAA 4DZ6A 1YRXA 2QL5B 2XCPA 1YJWS 3HJFA 1GX5A 2FJEB 3V81B 3CDWA 1S6QA 2DRDA 3FQKA 2I6WA 1RHQB 5HQLA 2OSQA 2Z4PA 2HVZA 4J9QA 4JI4J 3ZZTA 1HL6A 4A8FA 2VOPA 1LK7A 4JOUA 4M5HA 4Y65A 2ZJPQ 1WC6A 5A8WA 3UPFA 2OO4A 3BS9A 4WCEQ 1FKAF 3BYPA 4M5DA 1FTRA 5M2PA 2MSSA 4X4SA 5BYQA 1VCTA 1ZM9A 1QAJA 2YNIA 1RKIA 5DDPC 3VALA 2E5IA 1V6HA 1CPZA 5E33A 2GCFA 5J2QA 3SV4A 1FFWB 2DCLA 2PO4A 2FYXA 3MECB 4OJGA 1KOHA 5CA5A 3ETOA 1NSQA 3C15A 3MM8A 4ZVEA 1SH3A 1VRUA 1QUPA 1SJ1A 2DH8A 4Y2KA 4DR5J 5DM7Q 4B9TA 1OY6A 5HVHA 4JI3F 1WHXA 4U7UD 1HWJA 4U9RA 4C4WA 2B9EA 2HFNA 3I5BA 1Q8IA 1FVQA 4HR2A 4JUZA 1NZAA 3PHEA 2B51A 3SQGA 2ZM6F 1FD8A 2F8HA 3HVTB 2C2EA 1T9UA 2ZC4A 3EDRB 3I5CA 1UVIA 1YJ7A 3NGKA 2ZH8A 4EBCA 4I67A 1D0EA 3UNGC 3T1HJ 2JH3A 3CT9A 1GTHA 3DOLB 1PSDA 1IBMF 2ZC3A 4G1QA 2KH9A 3I4HX 1VQ9S 1MWQA 2C2ZB 2HGMA 3KWMA 5F3ZA 4Q2MA 4K4WA 4FF4A 4G1QB 2GHVC 1SC6A 1MROA 4PZVA 3UVJA 2MSTA
chains in the Genus database with same CATH topology
3VF0B 4ED5A 3LAMA 1U25A 2E66A 2IM0A 4RKUC 3MM7B 3DXSX 5EWEA 2YWHA 2WK4A 4Q8EA 3PDNA 4K4UA 3VAHA 3M32B 1X5SA 2K7KA 3CMES 3S7RA 4NYZA 2O1PA 3OJSA 3CCES 2OH2A 2FVPA 2ILYA 3RR7A 4OZ1A 3T5HA 1FE0A 1DQ9A 2MKIA 1LW2B 4EO8A 3GR0A 4PG7A 5D3GB 1X4FA 3Q2SC 4NLUA 2HNZB 5EWFA 3IRXB 2V8HA 2WONB 3ENQA 2YX4A 3IRXA 1B0TA 3GFYA 2FC8A 5CCLA 4WU3A 5GADU 4Q5VA 2HNDA 2O66A 4U7UK 1VIOA 4OI6A 1D1UA 1HARA 2FHKA 5KFSA 4RU9A 3PZPA 2UUAF 4J9LA 3N79A 2XO7A 3G6XA 1FKPA 2V9KA 4A8XA 3M8QA 3BN4A 4WFNQ 3CCJS 1FJEB 1C0TA 5K5MA 1V3RA 2LU2A 2E29A 2L41A 1D9DA 2LMIA 3G6YA 2D7SA 1FRMA 2LLZA 1DURA 3X3UA 3GIJA 3DLGA 3SSSA 4OX9F 1FNMA 2XGPA 2B4VA 1JXEA 2R9LA 4I6YA 2Y0SD 1N0UA 1SJ3P 4AUKA 4Q0BB 4HLBA 5KFOA 5KFLA 4JYAF 1G2EA 1KLNA 3DLKA 1S1VA 1DBDA 3IGVA 4KKOA 2WB1D 2JFDA 2QLWA 4F26A 3OTOF 4ELTA 2UUTA 3B82A 5KG3A 4KV8B 1D3WA 4WK1A 4RUCA 2C22A 4FPRA 1T05B 5J2MB 3D0IE 2EK1A 2V8VA 1AFJA 1VK3A 4AFFA 3NAIA 3KK1B 2GX8A 2WCXA 4KO0A 4RNMA 2LDYA 2RRAA 1Q82T 3TVKA 4FS2A 3THTA 1WEZA 1T94A 2B56A 2DISA 3OXFA 2ZZNA 1TK0A 3MPVA 1UWBA 2J6UA 5A0YB 4E0DA 3MF5A 4DL2A 1NKBA 3KK2B 5CZXA 3CF5Q 3T19A 5GAHI 3D1OA 2ZE2B 1DQ8A 1RA7A 5L39A 3VR1A 1RDRA 4LFBF 2DK2A 3LQVA 2X51A 3JSBA 2FUG9 1DZ5A 1Q8BA 1X4CA 4RW9A 4LVOP 2BW2A 2XEXA 1SL2A 3GWCA 4URGA 4KO0B 1QAIA 3I87A 3MAQA 1RT3A 4ZP9A 3PV8A 2IYIA 1BLUA 2CKWA 4DS5A 3J7YU 1UWBB 3WBZA 3BO4A 4RW8B 4A4JA 2XLJA 1MSWD 4LUBA 4ZCLA 2Z8QA 2KHCA 2ALZA 2ZE2A 5C24A 2ZDOA 1Q7LB 1KS2A 2CPZA 4I2QA 3K58A 1Q79A 3SYZA 2OP5A 4TKTA 2OPSB 4O0IA 5HI7A 4FF2A 3DM2B 3BGUA 3L95X 2V5HG 3CCWA 4H4KA 2YKMB 1QY7A 3A8EA 5HROB 4LF7F 3AA9A 4PPZA 4TU9A 2YKAA 5HMXA 4IFYB 1J2VA 2O01C 1E6YA 4IOCQ 4PG8A 4RX6A 2DNMA 1R6YA 4ZCKA 1VQ5S 2UV8A 1SKRA 4RW4A 4GKKF 2F9JA 3DLBA 2ZD1B 4M5DB 3R5CA 2J76E 4I6WA 3PW0A 2W8KA 4PR6A 4WXWA 2DNHA 5LSLA 4EO6A 5L9XA 3OVSA 1XMBA 1J5EF 1IQZA 4B9MA 4F3OA 5LXYA 2LEPA 4FBUA 3LF0A 3FEXB