1RT2B

Crystal structure of hiv-1 reverse transcriptase complexed with tnk-651
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 107
structure length 402
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B03
5F8NA 1S1UA 2YNIB 3GIIA 2RDJA 4Y2CA 3I0SB 3H5UA 1R0AB 5DGAA 1JLFB 4DL7A 5KFLA 3EPGA 3FRZA 1SH2A 1C0TA 3RAXA 3I0RA 3LAKA 2IA6A 3OL7A 3KMQA 2IJNA 2V0NA 5J2NB 2OPSA 4I7FA 4RNHA 5F8HA 4KHMA 3OSNA 5KFZA 4FBTA 4ZHRA 1S1XA 1S9EB 3QZ7A 3MEDA 4ZPAA 2CJQA 4JUZA 3DRSA 5FDLB 1N5YA 1FKPB 4Q0BB 4LSNA 2O5DA 1JLQB 3CJ2A 4IH5A 4DL2A 3DYAB 1EP4A 1TV6A 4PQUB 3NAIA 5KG3A 4EBCA 1N48A 3LP0A 2HNYA 5HROA 1J5OB 2HNDA 4RNFA 4URQU 5F8LA 2YNGA 2EC0A 4Y2AA 4Q45A 4MK8A 3PW2A 1TQLA 2YNFB 3CDEA 3QGHA 4NLRA 5I42A 3DLGA 4EO8A 2ZE2A 3HVTA 4IFYB 4TY8B 5HP1B 5JUMA 3MEEB 4ED3A 4DL5A 5KFYA 5KFUA 2HWHA 3IN5A 1KHWA 1RTDB 4TQRA 2BE2B 4ECWA 3LP1B 3KLHA 4XO0A 5J2MB 5J2PB 5DQHA 1FKOB 3H5XA 2OH2A 1DLOA 1ZTWA 1EETB 1JKHA 4ED1A 3FDSA 4MFBA 1N56A 2QE5A 2I5JB 2OPRB 1JLEB 4RUCA 2D3UA 1QUVA 1OS5A 3OLBA 1KLMA 4WFZA 3M8QA 4FS2A 3V6KA 4WZQA 2FVRA 3KHRA 4DG1A 2W9BB 4ZVHA 3RB0A 5KFOA 1IKVB 4H4MA 1DTQA 3E01A 3IG1A 5CYMB 4R5PA 3ITHA 1TL1A 1SH0A 5F9NA 5KFMA 1TVRA 4IDKA 3MR2A 3ISNC 4J9KA 3T1AA 4ID5A 5CYQB 4ZP8A 3BQ1A 3FSIA 3IS9B 3JYTA 1I6JA 4Q43A 4IRDA 3C6UA 5KFIA 1RT1B 3QO9B 1XR6A 2FJVA 2GIQA 1C1CB 3IRXA 3ICLA 3GV8B 1RTHA 2FJWA 1T05B 2HMIA 1Z4UA 1NNDA 1S1VB 1XR7A 3DM2A 4LSLB 4M94A 2ILZA 1TP7A 3UDLA 4WE1A 3BREA 4EBEA 2BQ3A 2WOMA 5KT4A 2C28A 3H2LA 5KFPA 4U7CA 4RNNA 4NRUA 4ED8A 2BR0A 1S0NA 4ED6A 3MR6A 3DOKB 4O3RA 3MEGA 1S6PB 1RTIB 1JLGA 1UWBA 4KFBB 4TN2A 1JLBB 2AX1A 3CO9A 3M8PB 3N6LA 1LWFA 2UVUA 5KFDA 4TLRA 3MR5A 2FLNA 4MIAA 4I2PA 4B3OA 1IKYA 2WHOA 3NL0A 5C25A 4ZP9A 1IKWA 2JEFA 3BJYA 2IMWP 1RYSA 1HPZA 3DLKB 4RW9B 1NHVA 1SH3A 4MK9A 3QYYA 3H59A 1S9GB 2HNZA 2FVCA 4M95A 5EWFA 4Q8EA 3CJ5A 3CDUA 3V81A 4TYBA 3QGIA 1TL3B 3SI8A 4PUOB 4NCGB 1LW2A 3I5AA 3KLGA 4ZVGA 4KSEB 5KFFA 1VRUB 1T03A 4NLDA 5KFJA 3JSMA 3N6NA 5JXSA 3OSPA 2V9WA 4NRTA 1S1UB 3V6DA 4NLQA 3T19A 5HLFA 1RT7A 4EYHB 3RB4A 1FK9A 2WCXA 3H98A 4YR3A 2W7OA 5L1JA 2BANA 4NYZA 4ECSA 1S6QB 2W8LA 1C0TB 3KLVA 1K1SA 4IG0A 2WRMA 3HKWA 2OPSB 1HARA 4I7FB 1S4FA 4WXWA 4O3NA 4J9QA 4ECTA 3CJ3A 4EEYA 4IQXA 2B5JA 3BR9A 1S1XB 3EZUA 5KFCA 2RDIA 3C6TA 3PHEA 3MEDB 5DQGA 1REVA 4MK7A 4F4ZA 3QIDA 1N5YB 3DMJA 5F8GA 4YMEA 2FLPA 4K4VA 4LSNB 5C24A 1K1QA 3MECA 1EP4B 5C42A 2FLLA 3NKYA 3MR3A 5KT2A 1TV6B 3KK1A 3D28A 3LP0B 2HNYB 5HROB 3H5SA 1HQUA 2HNDB 4PWDA 5KFXA 2YNGB 5L9XA 5F8MA 2IM3A 1RT2A 5DG9A 4JV1A 5KG0A 4ZPBA 3N6MA 2XCPA 4ECZA 1HMVA 3KLIB 3DLGB 5I42B 2RF2B 2ZE2B 3HVTB 2E9RX 1RA7A 4RW8A 3D5MA 1RDRA 1DTTA 5DG7A 1BQMA 2BQUA 1ZETA 2R8GA 1C1BA 2I1RA 4ECUA 2VG7B 3KLHB 3RBEA 5KFEA 4HKQA 3HHKA 1DLOB 1LW0A 3G6VA 1JKHB 2JLEA 5F8IA 3PW0A 5DLGA 3GV7B 1KLMB 5D3GB 3M8QB 4ECQA 2WB4A 3CVKA 4QWDA 1IM4A 2IM1A 3M9OB 3OLAA 4FS1A 4O4GA 3NBPA 3T5KA 5I3UB 2ILYA 4H4MB 1DTQB 3E01B 3IG1B 4R5PB 4ZPCA 1TL1B 3ITHB 3GIMA 3G6YA 2R8IA 1TVRB 4K4XA 1HNIB 1D1UA 1N6QA 3GILA 4ID5B 3PW5A 3KK2A 1RT5A 3JYTB 4TY9A 1SV5A 3KHGA 4O3SA 3C6UB 3VQSA 4NLTA 3UPFA 3M9NB 4K4ZA 2R2UA 2AX0A 2D41A 4K4SA 3IRXB 1RYRA 3KHHA 1SUQA 1RTHB 2HMIB 4O44A 3PR5B 3DM2B 3DI6A 4NLVA 3OL9A 4WE1B 3G86A 3GIJA 2WOMB 4RZRA 3V6HA 2J6SA 4ED2A 4H4OA 2F8EX 4KO0A 2OPQA 3CDWA 2ATLA 3I5BA 5KFBA 1QAIA 3CJ4A 1JLCB 3MEGB 1S48A 5KFQA 5KT3A 1RTJB 4ECRA 1JLGB 1UWBB 2JC0A 4KBIA 3GYNA 5L1IA 4DL6A 4O3PA 1S0MA 5F8JA 1LWFB 2YKNA 4U6PA 4I2PB 3RB6A 1RT6A 4B3OB 1IKYB 4KKOB 4RW7A 4MH8A 5C25B 5J1EA 5DG8A 1JLAB 4K4TA 1TKTA 1HPZB 2XGPA 1S1WA 4K4YA 5FDLA 2HNZB 4NLSA 4NLXA 3OL8A 3DRPA 3NGDA 2BQRA 3Q8PB 4QWBA 3V81B 5EDWA 1LW2B 3KLGB 2QV6A 1T03B 4ZPDA 4URGA 4GC6A 4O3QA 5J2QA 3QLHA 2D7SA 3V6DB 5HLFB 4URSA 1RT7B 1GX5A 1FK9B 4QWCA 4IFVA 3H4DA 2R2SA 2BANB 4ZVEA 3PJWA 3PVXA 2E9TA 4MKBA 3DLEB 1MU2A 2BE2A 3LAMA 4IG0B 2R2RA 3KJVA 4ZMMA 1EETA 5L1LA 4IRCA 2XI3A 1BQNB 1RT4A 2B5JB 4J9SA 1JLEA 2XGQA 3KK3B 3PJXA 2DPJA 4O3OA 4EBDA 4IH6A 2DPIA 1W25A 1REVB 3BSNA 4G1QA 3DMJB 2C2RA 1TKXA 4KV8A 5C24B 4K4UA 1IKVA 1RAJA 1C0UA 1JIHA 3OHBA 3MECB 5C42B 2W9AA 2AU0A 4YP3A 3T5JA 3KK1B 3UR0A 2VA3A 3KLFA 4YR2A 3TVKA 1HQUB 4KHRA 4PWDB 1S9FA 2IM2A 2ZD1A 4Q44A 3OHAA 3BGRA 2GIRA 4J9MA 3H5YA 1S1TA 3SFUA 1HMVB 2IAJA 4GC7A 2YNHA 2AGQA 4WZMA 4I2QA 1XR5A 5F9LA 3I0RB 4RW8B 5EWGA 1DTTB 1BQMB 3CJ0A 1C1BB 3NMAA 5KT7A 3BQ0A 1N4LA 5L1KA 3DRRA 3GIKA 3PR4A 3V6JA 4ZHRB 3BQ2A 2RKIA 1LW0B 2IM0A 1TKZA 3KLEA 3MF5A 3DRSB 2VG6A 1U09A 3DOKA 4EYIB 2R2TA 4FBUA 4QWAA 2YKMA 3PW7A 1IKXA 5KFRA 5DLFA 1LWCA 4RW6A 3LP2A 1RT3A 3SFGA 5KFGA 4R8UA 4ECVA 2OPPA 1N6QB 4ZP7A 3KHLA 3KMSA 5KT5A 4MKAA 4ECYA 1RT5B 5K14A 3V4IA 1SV5B 1HYSA 5EUHA 3OL6A 4IG3A 2JEJA 1HNVA 4QPXA 1SUQB 1HQEA 4RU9A 4O44B 4WYWA 1TL3A 4K4WA 3DI6B 3FFIA 3MFIA 4MFBB 4ECXA 4RW4A 2HWIA 1QE1A 4IH7A 4KE5A 4H4OB 5DGBA 4KO0B 2OPQB 3QIPA 3G6XA 3DDKA 4DG1B 4IOBA 2UVWA 3BSOA 4LQ9A 2D3ZA 3FQKA 4WFXA 4NLGA 5KFSA 1LWEA 5KFVA 3RBDA 5HBMA 1S6QA 4IDKB 3IGNA 3GQCA 2YKNB 2IBKA 1RT6B 3PW4A 3Q8RB 4RW7B 2V4RA 2W9CA 5J1EB 4RNOA 2WTFA 4WYLA 3IGVA 2ASDA 1TKTB 2B6AA 4YQWA 1S1WB 4YR0A 2JC1A 2XWYA 3QGGA 3LANA 4ICLA 4NLPA 3DRPB 4HYKA 2W8KA 1VRTA 4JV0A 2W7PA 2WONA 2VG5A 3TAMA 2UUTA 5DQIA 3DOLA 2JEGA 2IC3A 5KFNA 4ED7A 3RB3A 2C2DA 2YNIA 4RNMA 1JXLA 3I0SA 5J2QB 1QAJA 3QLHB 1R0AA 1T94A 1JLFA 4IRKA 3KLIA 5KG7A 2RF2A 4R0EA 3KOAA 4H54A 1YVFA 4IFVB 2FJXA 2HAIA 4J9RA 4IR1A 2CKWA 2J6TA 3E51A 5J2NA 4F4YA 3T5HA 3M9MB 1MU2B 1D0EA 2VG7A 3H40A 1JX4A 1CSJA 4NLYA 2ASJA 3KJVB 1IKWB 1S9EA 5KG1A 1RT4B 4OL8A 3I5CA 4IKAA 3QZ8A 4J9NA 4RUAA 1KHVA 1FKPA 4Q0BA 2UVVA 5D3GA 1JLQA 5KFWA 4G1QB 3EPIA 2ALZA 3DYAA 4PQUA 1TKXB 4KV8B 2UUWA 4IR9A 5I3UA 1J5OA 1C0UB 5KFHA 3JSMB 5KG4A 2E9ZA 4QW8A 1HNIA 1GX6A 2YNFA 3KLFB 2ZD1B 2FVPA 2ZKUA 3BGRB 4IFYA 4X2BA 4TY8A 5HP1A 1S1TB 3ISND 2FVQA 3MEEA 2IAJB 4K50A 2YNHB 5T14A 2XI2A 4I2QB 1RTDA 3HVWA 5KG5A 4NLWA 3LP1A 3TQ1A 5J2MA 3LALA 5J2PA 1FKOA 5KFAA 3Q8SB 2VA2A 3DRRB 2C2EA 2I5JA 2OPRA 2FVSA 1T3NA 4EO6A 2RKIB 3C6TB 2ASLA 4Y3CA 1TKZB 3KLEB 3GV5B 3CIZA 2BRLA 5KT6A 5KG6A 2VG6B 4XPEA 3FQLA 4NZ0A 1JLCA 4WFYA 2W9BA 4J9OA 1S97A 4TYAA 5CYMA 1RTJA 2YKMB 3CWJA 4NLOA 4ZP6A 2IJFA 4QW9A 2J6UA 1IKXB 1LWCB 4KAIA 4RW6B 5CYQA 2B43A 3LP2B 1RT3B 2GC8A 1WNEA 1RT2B 3IS9A 1S49A 4R8UB 1ZTTA 2OPPB 4F4WA 4ZVFA 2AQ4A 4KKOA 2WK4A 2V4QA 4WXOA 1RT1A 1JLAA 3QO9A 5K14B 3V4IB 1HYSB 1C1CA 2R8JA 4KB7A 1T05A 1MMLA 4DL3A 2AGOA 1S1VA 4O4RA 4IG3B 4LSLA 3T5LA 1HNVB 4Q8FA 1HQEB 5KFTA 4F50A 2UVRA 3FFIB 1C2PA 4RW4B 1QE1B 5EWEA 4NLUA 4DL4A 4DEZA 4Y34A 2JEIA 3QIPB 2AGPA 1S6PA 3PZPA 1RTIA 4KFBA 1S0OA 4O4GB 3NBPB 3MFHA 1JLBA 5C5JA 3M8PA 4ED0A 1LWEB 4MIBA 2C22A 4LQ3A 5HBMB 4TQSA 3DLEA 3NAHA 4J9PA 3RAQA 2R8KA 2BRKA 3HVAA 2AWZA 3KK2B 4J9LA 3KNAA 3BSAA 4RW9A 3DLKA 1BQNA 3BSCA 4G3IA 5KFKA 2W9CB 3KK3A 4TXSA 1S9GA 1RA6A 2B6AB 4XPCA 3Q8QB 4F4XA 3MTKA 4JV2A 1NHUA 2XCAA 2R8HA 3H4BA 4ICLB 4QWEA 4PUOA 4NCGA 5KG2A 3UQSA 1VRTB 1VRUA 2XC9A 2WONB 2VG5B 3TAMB 3DOLB 2IC3B 1S10A
chains in the Genus database with same CATH superfamily
4CH0S 1XMQF 2HHVA 8ATCB 3G6ES 2IJNA 4P2FA 4RNHA 5F8HA 3C46A 1Y10A 3SSSA 1S1XA 4P74A 5D4PA 2D1CA 5HK4A 5B08A 4DSEA 5F8LA 2UZAA 2BZ2A 3PW2A 2YNFB 1G1XA 1WSRA 4I0WA 5HP1B 4FF4A 3VAJA 1DHMA 4UZCA 1UEKA 4MFBA 4ZVPB 3HZEA 2E1AA 3DNCA 4ILMA 2RHSB 3KHRA 1URNA 3AAWB 2DGQA 4DV5F 3IG1A 2ALYB 2BM1A 5I3PA 4JI7F 1R0CB 2QT7A 1AFIA 2YWFA 4FYDA 1OQ3A 4EBEA 5KT4A 2HKEA 4O3RA 4ED4A 1Y5LB 3HI9A 1Q8BA 4NE9C 5K8MA 2G2ZA 2X1BA 1HPZA 5G0RA 3J81U 4MK9A 3GFYA 4HR2A 3Q86A 2VJVA 2XY6A 1MSWD 1WWHA 3S6EA 4CLZA 1T3OA 4N76A 1DAXA 4FF3A 1C0TB 3T41A 3HF5A 4ECTA 3KFWX 4OZ2A 3TEHB 3S8SA 4K4VA 2FLPA 2GFFA 3MECA 1B7YB 5FLXY 2BJDA 4PWDA 5L9XA 3G8SA 2IM3A 4RPFA 4L74A 2DNNA 2XCPA 4RO0A 1WC0A 1EARA 2CQ1A 1C1BA 4ECUA 4RWXA 3HHKA 1LW0A 3HFVA 4P9SA 3PIOQ 2DGTA 4KY3A 3VZHA 3RJMB 3E01B 4ZIWA 4HLBA 4DCJB 1N54B 5HMXA 2GGPA 3EX7B 1NK6A 3KHHA 2KN4A 2JOQA 2W24A 3NS6A 4PXCA 1GMVA 2K8GA 2OJ3A 4ZOSA 4LF2A 4DL6A 3ILLA 1R43A 5L46A 4WIIA 2JH3A 4ALZA 2HS0A 2ZVIA 5FDLA 4NLXA 1RUSA 3NGDA 4MAKA 4OX6A 2YKQA 4JI8J 3CCWA 3V6DB 3MPYA 4JI1J 2BANB 2E9TA 3PJWA 2FZKB 1UVJA 1XNQJ 2BE2A 5ETNA 3S1TA 2BJ1A 2VQEF 1W2BR 2C2RA 2EEYA 4QZVB 4EFAC 2HHXA 4Q44A 1QSLA 1TFYA 1AW0A 2VDIA 4RW8B 2K3KA 2FB0A 4CLWA 1R31A 4HACA 3QRPA 1TKZA 1HWUA 2D9PA 2X3DA 5H9FJ 1XERA 1PYTA 1Q1KA 5A0YA 2VH7A 4RW6A 2WVCA 1Q5VA 2ZBCA 5KFGA 1HYSA 4J7CA 4AQYF 1VQSA 4RW4A 3TUJC 2J7UA 1QE1A 2Q66A 1MNEA 4KGVB 2YX1A 4GKKJ 4CO5A 1LWEA 4F4KA 5HBMA 3GQCA 2BJ3A 2KVIA 3PW4A 4QR1A 2GW8A 5KFNA 2JL9A 2Z30B 3GPAA 1SKUB 3DLHA 1T94A 2DNLA 1FWLA 2XYHB 1YHQS 2V4JA 2BX6A 1IKWB 2E1PA 3I5CA 4P2XA 4NZ6A 2UVVA 1N34J 5AE1A 4F02A 2DGOA 3BBFA 1HNIA 4DFMA 4LSZB 2IDEA 3RW7A 3MAAB 1B0PA 4PRFA 3PFOA 2OFGX 3CCJS 4JI2J 3P4UB 1U2CA 3OUYB 4CLUA 1S6OA 1QJHA 2YKMB 4KAIA 3LUYA 1H7WA 4F4WA 2IRUA 3TANA 3A1YG 3HFZB 3JAMU 1OYDA 3GTYX 3G8TA 1FDDA 2H65B 1OYEA 2VASA 3OVBA 1TMJA 8RUCA 1AB8A 2IRYA 4FDFA 2WSCC 4DS4A 1BC6A 4OHXA 4J9PA 2AWZA 3KNAA 4UY85 1WORA 3DLKA 2IVMA 1IBMF 3GSDA 4R0JA 4C8NA 1S9GA 3MPVA 4I67A 3RR7A 1CQMA 4QWEA 1G7CB 1HNWJ 3TAMB 4GMKA 3TJ8A 3DOLB 2J9CA 3OTBA 3CMES 1R0AB 4DR5F 5B0FA 3SMZA 3SSRA 2BW2A 2C2KB 2CVEA 2W7AA 3MURP 3DXBA 2VV5A 5CH7B 4WWSA 3OFHA 3CJ2A 4TNOA 1WEZA 5IT9U 2EC0A 1U45A 5BJRA 1VBXA 3ADAC 1XMBA 2BOPA 4NXMJ 1BHNA 3QBCA 4WF9Q 4Y6IA 1KLNA 4MMOA 2HRTA 2HHHJ 3ISNC 3NXZA 2V6AA 5B09A 4ID5A 2HQDA 2GO9A 3IS9B 4C3KA 2X1FA 1FWPA 3QWUA 1N5SA 3GV8B 1HLWA 2MKKA 1S1VB 3HSDA 4DR6F 2ILZA 1CJTA 1LNQA 4NA3A 4ED6A 5A6WA 4KFBB 4X65J 2V67A 3J7AN 4DOZA 3N5FA 4DSLA 4WU2A 3H0PA 1XJWB 4USJC 5E5NA 2QJ3A 3I5AA 4KR0B 2MQLA 3FGVA 2G0CA 2NXUA 3VQTA 2PEHA 3PYFA 3GFZA 3PKMA 3CD7A 2CJKA 5LMUJ 4L6V3 1V5IB 5KT2A 5GADI 2RF2B 1GK8A 3BM7A 1F6TA 4XAKA 1FXRA 2I38A 1SC1B 3V5RA 4HKQA 4HHHA 3HHLC 2ZBQA 3PYDA 2FHJA 4I6YA 1RLDA 2J9DA 2ZBPA 5ETPA 3QT7A 4ZPCA 1TL1B 3ITHB 1ZM4A 2NLWA 1RT5A 2HQ3A 3CJ8A 2DNOA 3JSYA 4DV0J 4YFUA 1BQXA 3OTOJ 4G65A 2Z8QA 5E2QA 2KT3A 3MEGB 2H3EB 2QSFA 1YBTA 1KOOA 3NCPA 2DHSA 2W25A 3JS9A 4RLEA 5LT5A 4KQZA 3D0HE 4BDPA 3JAMY 5B0CA 1FE0A 5CZVA 2HFZA 4CM2A 5DZ6A 3NGSA 4ZVEA 4QIVA 2V8PA 2LECA 4O3OA 3EWGA 3G4SS 3I9ZA 1JIHA 1UVLA 5C42B 2UU9F 2W1BA 3RBXA 4JB8B 3EMTA 4GC7A 1DTTB 2PA8D 3BN7A 1N4LA 4USTA 2AJQA 4HT7A 3KLEA 3DRSB 2ROPA 3QSIA 5EGYA 4QWAA 4YB6A 4DPWA 4DPXA 3ONQA 2PO4A 2Z2YB 3KMSA 5IT9Y 1SXLA 2XEXA 4W92B 2RNEA 4TU8A 2DNMA 3OFGA 3POTA 4F25A 3HHLA 3RU0A 2M2BA 1YI2S 5AE3A 2Q43A 5HMYA 1HNZF 4YR0A 3H2UB 1XMQJ 3BZQA 5CCLA 2ZJQQ 2WONA 5DQIA 1K9MT 4K8RA 5B0EA 3LWLA 1JXLA 1QAJA 1I94J 1JLFA 3B8HA 1NK5A 1PBUA 3H8YA 1RWMB 3TAQA 3FSYA 1CJUB 1PILA 2C3YA 3DFEA 4IKAA 1KHVA 2J76E 4PQUA 2UUWA 2CRLA 5HSPA 1YJ9S 1J5OA 4QW8A 4WP9A 2ZDPA 1WDDA 4CO3A 3QT6A 4DV5J 4XDDA 3J7A1 2MGZA 4CLTA 2HS4A 2AJFE 4JI7J 2J6UA 3DU6A 2CQ2A 2DVIA 4DR1J 4CTAA 1WNEA 4U67Q 5K14B 3V4IB 3M8RA 2AGOA 3T5LA 4F0KA 2UUBF 1S0VA 3JSBA 1PSDA 4FYXB 3IC1A 3PZPA 2E1MC 1U49A 1KRPA 3KG1A 3H25A 1NK0A 1L3VA 2QA4S 2MPUA 4ZKAA 3BSAA 1GMWD 3LF0A 3EXCX 3H4BA 4ICLB 2AJ0A 3WX4A 2VG5B 5KAKA 5LXYA 4IH5A 1AXQA 2YNIB 4DV2F 2IDLA 2WVDA 1IUJA 3EPGA 4F3OA 1YBUA 3RG6A 3CTRA 4Z7CA 3N5BA 4ZHRA 2B0GA 3O1LA 3UD3P 1FKPB 2AHOB 3VWSA 1U6BA 3LP0A 5HROA 2F63A 2V8VA 4RNFA 4TU7A 3R7BB 4OI3A 3IBFB 4URQU 4LF9F 1R7IA 2M7SA 2ZE2A 2VQFF 1KQKA 3NNHA 4ECWA 3MM8A 4XO0A 1DLOA 4ZVRB 2A6MA 3LGHA 2MHNA 4WFZA 1U0SA 4DG1A 4TVAB 3R5GA 3TA1A 1AUSL 3PIPQ 1D8ZA 5HVFA 2ZITA 2MHEA 1IQTA 2FHKA 4NRUA 2OGUA 3DOKB 3CMQA 2XNQA 2KVQE 1I5OB 3M8PB 1L3SA 2IMWP 1RYSA 4ES2A 4RUBA 3CUNA 3W8PA 4B08A 4ILRA 2B4OA 2AEFA 1SJFA 5K8NA 1AZSB 5KFJA 1DFDA 1FRIA 3G87A 1UMJA 2VQEJ 3HVRA 1CEZA 4OZJA 3Q2SC 4IG0A 3CO0P 2PIIA 3U02A 3CDBA 1HARA 4O3NA 4OZNA 4EEYA 3MWBA 2ZFHA 1N36J 2M8DB 3BO2A 4F4ZA 4YMEA 4LSNB 4G1PA 4RL1A 2YNGB 4MKVA 2KRBA 5LSOA 4JYAF 3F44A 4ECZA 4OJGA 1YWXA 5HAOA 1OPZA 2RRNA 3LTOA 4FN5A 2GJ2A 3THTA 2VG7B 1B0VA 1Q95G 2JLEA 3CCZA 3EZOA 2CWKA 2GMHA 3SDEA 3LOUA 2R8IA 4YB1P 2CJYB 3MCNA 4TY9A 4AQYJ 2FC8A 1RLCL 4UOFA 3FBFA 2ZH1A 3V6HA 4H4OA 2MKYA 3I5BA 5LSRA 1RTJB 2QEXS 2VB6A 2CPXA 2L9WA 2HVZA 4K4YA 1UETA 4QWBA 3GR1A 1FRMA 1OSDA 2R7UA 2ABYA 2OKQA 3UWTA 2EK1A 5BYRA 4C0OC 2RSQA 2R2SA 3PVXA 2MZQA 5EX0A 3AB2B 5L1LA 4FYYB 1BQNB 1VQPS 2XGQA 3KK3B 1WEYA 2AZ3A 2ZH3A 3DMJB 1V5VA 5K8PA 4KH0B 4E2FB 2CZVC 2PGCA 1HMVB 2H9ZA 2KRRA 3TAPA 4I2QA 1T11A 2B4PA 2LDIA 2HQIA 3ET6B 5FD1A 2OLWA 4CLYA 1ZAWA 2MZJA 5HMWA 5KT5A 4WJBA 1SV5B 5EUHA 1URRA 3N01A 3MMAB 1CPZA 1HQEA 3FFIA 4CNYA 2VFTA 3G6XA 2UVWA 1FNOA 1SC3B 2ZH9A 1UPPA 1IBMJ 2ZHBA 3AA9A 5J1EB 3KNGA 4PZVA 2ROGA 1S1WB 2XWYA 3LANA 3HHLD 5C2CA 4DR5J 3FZ2A 3GCWP 4ED7A 5M2RA 5D77A 4QU7A 4WCEQ 1YTYA 3P45B 5KG7A 4C3LA 2H4WB 2YWGA 4LREA 1WC4A 2ASJA 3D6TB 3D1OA 1U48A 4U7UK 3M8SA 4J9NA 2D9OA 2OAUA 1TMMA 2GVDA 5A8RB 2DRBA 4PG5A 3KLFB 6FDRA 1HBOB 3MEEA 1HKAA 3LP1A 3TQ1A 5BR8F 5J2PA 1U2RA 3CIZA 5CXTA 2W9BA 4JI0F 4TYAA 3O6QA 2GJFA 4DR6J 1RT1A 3SZ2A 4PCQA 4PEOA 4DL3A 1WI8A 2B4VA 2CPJA 5A8KB 2DNZA 1QAXA 5AXNA 4LF7F 2VBWA 3DLBA 4F04B 3SCLE 4RW9A 2NCKL 4TXSA 1TUWA 3M8YA 2GVZB 4JI4F 3CJRA 5KG2A 1VQKS 4N77A 2AGQA 1QUPA 2OHDA 2IRXA 5KFLA 2MDAA 3PCOB 4OJ3A 1Y3KA 4C11A 3NS7B 3QGPA 1T9VA 2B4UA 5IC6B 1N48A 2B9EA 4NMXA 1BE4A 3NS5A 4Y2AA 4WFAQ 2VPZB 2XG8A 3UDEA 1VLOA 4ED3A 4AL5A 3H5XA 2OH2A 2OD4A 3FJ2A 2VPXB 2DXFA 3F56A 4W4MA 1IKVB 1KSPA 2B8PA 1KC8T 2QRRA 4HH1A 1FDNA 1O5JA 5KFIA 1XR6A 1SIZA 2GIQA 4ZCLA 1RHKB 4WP8A 1XR7A 4JP8A 3NCRA 1LXJA 3PEJA 5KFPA 1BMQB 3NOGA 1S6PB 1QDUB 2CQCA 1X7VA 4CT8A 2UVUA 2ZUAA 1SQEA 4MIAA 1FJEB 2QLXA 2FVCA 2HNZA 1BUXA 2P6TA 3QGIA 3SI8A 3KLGA 5IC4B 1DJ0A 2UXDF 1T03A 3N6NA 2BJ7A 2HQFA 4A8QA 4CZCA 3RB4A 1NSKL 4YR3A 5L1JA 2FJDB 2MXYA 3KWMA 5KFCA 1S1XB 2UU9J 1TTHB 2H54B 2VKRA 2FLLA 1NK7A 3NY0A 1AYEA 1K44A 3LPEA 4ZPBA 3JTOA 2EI5A 3R5CA 4K2JA 4DCPB 4NASA 3TJ9A 4EWTA 4DQPA 1CJVA 3PW0A 5DLGA 2MEWA 4ECQA 2MZSA 3IG1B 2DTJA 3M05A 1FRJA 1UVKA 4NLVA 2CADA 4C4WA 4M5KA 2OPQA 5KFBA 1KP6A 3M32A 3OBIA 1HNZJ 3RW6A 3MM7A 1UVNA 3WIVA 1HPZB 5G0RB 4NLSA 5GADU 2OFHX 1KN6A 2XLKA 3QLHA 4YUDA 3P5BP 1VR6A 2PC6A 1BLUA 1RT4A 3PJXA 2IBOA 1D9FA 3A12A 4KV8A 5D0HA 3MECB 2W9AA 2VA3A 4KHRA 4PWDB 3PDNA 3SFUA 5A2QY 2IAJA 4WZMA 3BS9A 1C1BB 5L1KA 2IVFB 4I4BA 1LW0B 2LQ9A 1R8CA 1KBRA 5E3QA 1KDNA 4WKRA 4OZLA 3CCVS 3OJUA 2OPPA 2JJ4D 2UUBJ 3B78A 3I31A 1JXEA 2GGPB 3K17A 2WB1D 4B9TA 1HNVA 2A3JA 4WYWA 2VC1A 4K4WA 2DCUB 4DF4A 3GYGA 2NPIA 4WFXA 2YVSA 4X4TA 4IDKB 4DSKA 7FDRA 2L48A 2IBKA 3FBEA 1WHYA 2B6AA 5MAOA 3SBMA 1WG1A 3HLUA 4DV2J 3K5LA 2QFJA 1F0XA 4PPZA 4IYQA 4Y28C 3CJTA 4DSFA 4DPTA 3HFKA 4U7UD 1CSJA 3VHQA 5K20B 4Q0BA 4LF9J 1ULRA 4KH1B 1TR0A 2HRUA 3W5ZA 3SQGB 5ETKA 1ZZNA 2PFFB 2ZKUA 2HVIA 4N41A 2HZCA 1KVJA 4QJVA 5J2MA 1OIAA 1M5KC 4HACB 1TKZB 4X4UA 4MKYA 1SQGA 1P9YA 2DEIA 1WI6A 4TKTA 5A0YB 3VTIA 4RW6B 2GC8A 1RT2B 4BCAA 1ZTTA 4ZVFA 1HYSB 1IR2A 4ZCIA 4LSLA 2CQGA 4PYDA 2UVRA 1R0BG 4RW4B 1QE1B 1K0VA 3U1NA 3NNCA 1UEUA 4M5HA 3R7NB 3Q22A 4S0MA 3J80U 1LWEB 5HBMB 3LGMA 2WSFC 2YKPA 2DH8A 2J8SA 4UOGA 4PUOA 4GO5X 5ETVA 1D9AA 2MTLA 3FZBA 3GIIA 1QTMA 4KGMA 1NLKL 2V4JB 4DUYF 3MEDA 3PTWA 2YKOA 1N5YA 3EYZA 4IUFA 4JYAJ 3QPIA 1WF1A 4DS5A 3W66A 5I42A 2NQPA 3Q83A 1X9SA 4WK3A 5KFUA 3D1HA 3OR2A 1DURA 1VCTA 1Y11A 1ZTWA 2QLWA 4ZITA 2HQCA 2RT3A 1JLEB 1QUVA 1OS5A 4FS2A 4ZJOA 3DDIA 1DTQA 1SH0A 3FNNA 4J9KA 3GR0A 4FXWA 5GAEI 1QM9A 5J1NA 4ECRA 3BREA 2P6SA 1UFKA 2BR0A 3BGFA 3I6PA 1G6BA 5E3PA 4YS2A 1XEZA 1LWFA 2PI4A 4DR3F 1X5OA 4B3OA 1FKAF 4OHWA 1IKWA 4GRSA 1RKJA 3DLKB 5ETMA 2VFSA 5D15A 1S9GB 1HI8A 4RBUA 4DX7A 2ZZTA 3ZC4A 1FHTA 9ATCB 1AA1B 4UUXA 2ZM6F 2LEBA 4UTGA 2W7OA 2HWTA 1LK5A 1S6QB 2GMJA 1S59A 3HKWA 2ZOGA 2XO6A 2KM8C 1I3OB 4L3KA 1L3UA 1LKZA 3D1QA 2N4CA 2ZEJA 2R7TA 2CPFA 3G8QA 1X60A 1UW4A 3H42A 1TK5A 3TA2A 2EWHA 1WUUA 1UA1A 1NJWA 3UVJB 1X4GA 4CYUB 3G6YA 1CS4A 3OW2R 4ID5B 1GXTA 3IAS9 3WZ0A 5T41A 4WFBQ 4K4SA 2LU1A 3L9ZA 1HA1A 2MQOA 1Q7YT 1EKSA 1CJTB 4DU8A 3CDWA 2ATLA 7AT1B 3QSYB 1S48A 2K7KA 1UTAA 4KT0C 4KJIA 1TKTA 1UJ4A 1T9UA 3KUGA 2CQ3A 1T8EA 5J2QA 4MJKA 1SVDA 1MU2A 2HHPA 4C3MA 4ZMMA 5E33A 2MLYA 3PRVA 5ITHA 2JX2A 1TKXA 4A48A 2Z58B 4MTPA 1WEXA 3M30B 1VC6A 2HIYA 5BR8J 1DRZA 2EK6A 2FHMA 1X4DA 3ZTSA 3I0RB 3NMAA 4JI0J 3DRRA 1U1KA 5U47A 2LDYA 4P6QA 2HBQB 4NA1A 3LP2A 2PE8A 4USMA 4ECYA 1RT5B 4BHQA 4LR9A 1NDCA 4JBCA 3UI3A 4FYWB 2KYZA 4J37A 2VICA 4ID8A 1A7GE 3BSOA 1N8RT 2NXEA 2RS8A 3OJSA 4JI4J 4QOTA 1NKEA 3MPDA 4X4QA 1FVSA 4I1TA 1UKUA 2B9XA 2VOOA 2G0IA 2RF2A 2MB0B 2HAIA 2F4VF 3E51A 4IOCQ 3T5HA 1RBOB 4LFAJ 4C7QA 5KG1A 2OI2A 4CH7A 1NPKA 1FCAA 1KQFB 5M2UA 2FGOA 3VAMA 3I55S 2FY1A 2DNGA 1YJUA 1VC0A 4LF1A 2NXJA 3SCJE 3Q8YA 3A8EA 1Y3JA 2GNKA 5F3TA 2CQ0A 1D3WA 3TARA 1RTDA 3RAMA 1NBEB 4PXEA 2D3O1 1SJ1A 3J7YI 2AJ1A 4B3MF 3KLEB 2R7QA 4XPEA 4ELVA 4DR7F 2HBRB 2MQMA 2GQ2A 1CC7A 4DFJA 3GFXA 1MMLA 2LXUA 4Q7AA 4LR7A 2QMUB 1EB0A 1UCNA 4A8WA 4GKJF 4DL4A 4CCHA 2HHTA 2D3OR 4NYOA 3HHLB 3HVAA 1NKBA 1VQ9S 2PMWA 1FA0A 2UXDJ 2CJXB 4B3SF 2QYGA 5B0AA 2WONB 1IWAA 1S1UA 3L7OA 1XTZA 2N82B 1JLFB 3L7PA 3ZZ0A 3I32A 2CJAA 4ELUA 2Z0GA 4AXJA 1L5UA 2HZVA 1RWKB 1JJ2R 5LXRA 3DRSA 3GMGA 3BGLA 4PQUB 1J5OB 2CYYA 2CPEA 1DZ5A 3QGHA 2DT9A 3HVTA 1XWLA 1U1LA 2VHGA 1VIOA 1AFJA 2MGZB 2QGFB 1NEEA 5IWAJ 1VK8A 2XYGB 1TVRA 1X8DA 2B56A 4CTAB 4CWBA 3BQ1A 1DBDA 4UQGA 1RTHA 2BDPA 4OJ1A 1WELA 2M4MA 1JK9B 2WBMA 4TN2A 2W4CA 2K3IA 5DRKA 3NL0A 4FKXA 2D69A 1HFEL 3CJ5A 2K1RA 3WBZA 4NLDA 4WKYA 4P10A 1VQ5S 5F0WA 3GFHA 2LCWA 2FJAB 2DEJA 1EZZB 3D67A 5A8WA 4J90A 4LRCA 3HD1A 2B5JA 3W5YA 3K5MA 4U8YA 3QIDA 2C42A 2AYGA 1X5TA 4PG6A 3MR3A 3KK1A 3LP0B 5HROB 2DR5A 3NNAA 3UCZP 3ZTOA 2ZE2B 1ZOTA 3D5MA 3MM8B 5KFEA 1DLOB 1NSPA 2XMJA 4DUZF 3GV7B 1ITPA 3OLAA 2MKSA 2ILYA 1SI9A 3GIMA 4DR4F 1P6TA 1FERA 3PW5A 3BV8A 5DDRC 2JHEA 4ZPTR 2LEAA 4MYTA 4UY8T 3BGUA 3NWRA 1W2IA 3M9NB 3ZZTA 1ZAVA 2OIHA 1FRLA 3PR5B 3K0JA 3FEZA 1R3NA 3Q24A 4C6AA 3CJ4A 3G96A 4LRDA 3MMJA 5ETOA 2QTWA 3B4MA 2BQRA 2MKHA 3CXCR 3DLLQ 4ZPDA 3TEGA 2D7SA 2NZ4A 3O5TB 1GQEA 2LMIA 4IG0B 3AY0A 1I1GA 1WHXA 3DOMA 4Q5VA 1RWPB 5F3ZA 2GQCA 3DLJA 1M0SA 4YR2A 3C66A 3OHAA 2Y1IA 1TL5A 1F2GA 2DGXA 3GIKA 1ZS6A 2O67A 1J2VA 3DOKA 4EK2A 2Q6CA 3SDEB 3FC9A 1PIEA 2G0JA 3HJVA 3ZTRA 2A1BA 4R8UA 4OYPA 3IWLA 4M5GA 1NAQA 1LFPA 2JEJA 1NM2A 3MR7A 1N33F 1ZA1B 4H4OB 3QIPA 4ZPVR 1M1HA 5L8RC 5ETQA 2IA0A 4QQBA 3EXYA 1VQNS 2UUTA 2IC3A 3FKBA 2HPUA 1XK8A 1U1RA 1NRKA 2AKWB 3H20A 4DUYJ 3KOAA 2YWHA 1N32F 3D3BJ 2FJXA 2APOA 2VG7A 3NMRA 4DV4F 4OL8A 2BM0A 1JLQA 1R6YA 5HVHA 4PWUA 3EUNA 3CDAA 3JSMB 5KG4A 2J8AA 4RR5A 1GTHA 4LRBA 5T14A 4I2QB 2VIHA 2QL5B 4QIGA 3VVUA 3C6TB 4Y3CA 1FFWB 1NZ8A 1AROP 5CYMA 1RTJA 1YX2A 2RB7A 2HS3A 2ZOMA 2DR6A 9RUBA 2J0XA 1T05A 3W65A 4Q8FA 1HQEB 1MROA 3BYPA 3CJKB 3FFIB 4OYWA 3VGTA 3AXKA 1WKJA 4DR3J 4DEZA 2AGPA 4A8SA 3WC2A 3U1LA 1RTIA 1K47A 3M4XA 3A8JA 1UEVA 1BQNA 3BSCA 3KK3A 3W9IA 3MXHP 2XZTB 3QMQA 1L3KA 2ZM6J 4NCGA 2XC9A 1G4CA 4C48A 1S10A 2IFXA 4ZN3A 2V50A 3IBCB 2B7BB 2GA7A 1RHJB 2XNRA 1VJQA 3VAFA 2J9EA 2MJNA 5HATA 2RRBA 3QZ7A 3ZZPA 3ZZOA 1TKDA 1T9WA 3ET6A 3PM9A 2O5DA 1FO1A 2NXCA 2HNYA 2GVDB 5H1SV 1OPIA 2H5EA 5CAAA 2YWEA 3TJAA 4AUKA 1LK7A 2A6OA 3MEEB 2UXCJ 2HWHA 3RRKA 1KHWA 3LP1B 4I6AA 5J2PB 2QE5A 2XMKA 1Q53A 3AA8A 3V6KA 2FVRA 4CT9A 2FZGB 2W9BB 5LM7E 2O1PA 3MPUB 3TOQA 2ZH2A 1WOSA 4X65F 1RT1B 3OV7A 3IRXA 3CCES 2ZC3A 1CVJA 3DM2A 2WOMA 4ZVOB 2VFVA 3MR6A 3N4WA 5DDOC 2K7JA 2WHOA 4ZP9A 2Z2ZA 4RW9B 4DL0C 4M95A 2XMTA 3ETOA 2QO3A 1LW2A 5JXSA 3T6JA 5HLFA 2BBEA 1RT7A 1GNKA 1HBOA 3A3OB 1SB6A 1FESA 4QIWD 4PWWA 4X4PA 3B4DA 4HHJA 5DDPC 3MAQA 1LEOA 2CXEA 4K2XA 4W98A 4C11B 4WIQA 5HL7Q 5C24A 4F26A 4C8YA 2LA4A 5GAEU 4M5DA 4QYZJ 3N6MA 5E3AA 2ZZMA 1NUEA 1FEHA 4L75A 5DG7A 1BQMA 2POKA 2MLXA 3UN3A 2LU2A 2H5JB 4X66F 2WB4A 4B3TF 2IM1A 2AIRB 2DXDA 4PR6A 5F41A 2ZBIA 2KI2A 1R89A 3CC2S 3NGKA 2R2UA 1T9YA 2GO8A 3ILOA 1YBAA 4ED2A 1IJFB 2B9WA 2RQ4A 2GHVC 2R7OA 5SUHA 3GYNA 2XHCA 4YEAA 5CD4A 1UVIA 2CPYA 2AW0A 4K4TA 2XGPA 5GMDA 3IWXA 2HNZB 1WOPA 3OQ2A 3Q8PB 3ENVA 2A10A 3GWCA 1H2UX 3KLGB 1T03B 4URGA 3MM6A 2F4VJ 3DCAA 2GAHC 1JNRB 1M90T 3HSJA 3BKFA 3M1VA 3DLEB 5IZHA 2HFNA 2NREA 2FQQB 4IRCA 1YRTA 1WHWA 1ZM2A 4X4RA 2YX7A 2DPIA 4LBPA 4G1QA 2OO4A 3CD0A 1IKVA 1C0UA 3UDCA 5LMNF 3WDOA 3UDVA 2KT2A 2ZD1A 2CQPA 1MWYA 3R7SB 2B7CB 2YNHA 1CC8A 2BKPA 3ZZYA 4B3MJ 1XNRJ 4DR7J 1CJVB 1P9QC 1RAAB 1WKKA 1NSQA 4TU9A 5DLFA 4DJBA 2RUSA 1RGVA 2DNHA 2UXBF 4Y00A 2F40A 1KEKA 2DRAA 3OL6A 4GKJJ 1G2EA 2JLFA 2X1AA 4KYZA 4KE5A 2HK3A 2OPQB 3TI0A 4LQ9A 4C9DA 5ETLA 3M32B 1FNXH 4AL6A 1Q86T 4B3SJ 4Y2MA 1I94F 3MM7B 2W9CA 1GXUA 3D6HB 3IGVA 4ITSA 1SL1A 3RBZA 1M1KT 2ACYA 1GMUA 2GQQA 3D4JA 3OXLA 1H38A 3RB3A 2HBYB 2H4YB 3QLHB 2C3UA 2ADCA 2PFDA 3FRYA 1UZDA 3GJTB 4LIRA 1RT4B 3BDEA 3H90A 4ZPWR 3RR8A 3DYAA 3I87A 4KV8B 1EX8A 3CMAS 2NUUG 2BACA 2NZCA 2FVPA 4TY8A 3M2VA 2IAJB 4DR1F 3LW5C 1FKOA 2XLIA 1XBWA 2XO7A 2ADBA 2OPRA 3MUTP 1RACB 3MI7X 2LP4A 3SXLA 4J91A 2C2ZB 3R97A 4AE5A 3VV2B 4OZ1A 3W1YC 2OPPB 2R8JA 3ZZUA 2V8HA 1HNVB 1A0OB 4JI5F 2KHDA 5EWEA 4A4JA 3NBPB 1NPRA 2DYAA 3FBCA 4MYUA 3MM5A 3KK2B 2CWXA 2AEJA 5LJ5Y 4P52A 5KFKA 3BO4A 2V2QA 1P1TA 2B6AB 2I2YA 4BS2A 2RIJA 2NUHA 3OPKA 1VYAA 5EN1A 3AJ1A 4Y2CA 3H5UA 1B70B 2M52A 2LKZA 1M5PC 1UP1A 3J7YU 4I7FA 1X4HA 5FIIA 2YPYA 3CE8A 4Q0BB 2H48B 1K0TA 2Y8WA 1NJIT 5D78A 1Q0NA 3S7RA 1N5VA 6FD1A 1U6FA 3QRQA 4DUZJ 5KOWA 5J1PA 5J2MB 3MMBA 2B3TB 3HO1A 4DR4J 3M8QA 1MN7A 5D4NA 4G6VB 5KFMA 4IDKA 2QA2A 4OYZA 4KPYA 3C6UA 2M0GB 3UCUP 4K5SA 3PEHA 2EVZA 4LSLB 1GT8A 1X4AA 1YGYA 1U26A 2DGUA 1JLGA 1UWBA 3CO9A 3VAKA 3TW0A 2FLNA 4I2PA 3U1MA 5C25A 1RJJA 4Q8EA 3WQPA 3V81A 4UUWA 4PUOB 2ZWOA 4QYRA 3SQGA 1N36F 4FXVA 3E3XA 4NLQA 4I64A 3QFWA 3SIPB 1HWIA 1VDHA 2WSEC 4BWMA 3BR9A 1RBLA 4K59A 2BKNA 5GMKa 3MEDB 1REVA 1N5YB 3R8YA 1XQIA 2PEBA 3W2WA 3A13A 4OLPA 1RT2A 4JV1A 5I42B 2CPHA 3UO0A 3NGRA 3T3FA 1HNXF 2ZJRQ 1VFJA 3OR2B 1PAEX 3KJFB 3DGVA 3G6VA 1VK3A 3GP9A 5GVQA 2XSFA 4GVLA 4AT1B 3AOBA 3T5KA 1DTQB 3CD5A 3FMBA 2M9KA 2MSSA 2MLZA 2KFNA 4ATNA 1N33J 4NLTA 2AX0A 1FJGF 2FY8A 5D0RA 2AMCB 4DN0A 2F3JA 4NCBA 3ELHA 2EKNA 2JC0A 2QA4G 1LWFB 4B3OB 1QSYA 4AD6A 3O3LA 1FDAA 1Y5NB 4JI6F 3R5JB 2VOPA 1IXKA 1GAOA 3J81Y 4NMLA 5CYJA 1N32J 3JQKA 2XHWA 3O44A 4URSA 4DV4J 1RCOB 1TUVA 3BKUA 4KHPF 3LAMA 3Q89A 1Q7LB 3KJVA 4CH1A 4NA2A 2VODA 1PJ6A 1JLEA 3TRGA 5D0GA 2QG9B 3T9NA 4K4UA 2AU0A 3T5JA 1Y00A 1IR1A 2E7VA 1OMSA 3UD5A 3IAM9 1O8BA 3PX6A 2VZ9A 3WIUA 3JXOA 3CJ0A 3D54A 2EFNA 1HD0A 1TL4A 3U27A 3HPOA 3A8IA 2XMMA 1Y7PA 3HK2A 1P27B 1GMWA 2DH7A 1LWCA 1N5QA 1CS4B 4ZP7A 3MMCA 3GIRA 2NSBA 4LVOP 2DH9A 4CRJA 1T0TV 2DR7A 5HJYA 2ZH5A 1VQLS 4IOBA 2X7IA 3HSGA 5KFSA 1S6QA 2KO1A 4K5RA 3HD2A 1TKTB 2HURA 2W7PA 3VGUA 2DGVA 3U7JA 3O8WA 3IXQA 5J2QB 4OQJA 2KB2A 2N3LA 4R0EA 5J2NA 1MU2B 4LF4F 4F4AA 2DO0A 1T9XA 1TKXB 3UVJA 4DSJA 4CYUA 5L39A 4A8YA 1K73T 2CQIA 2J0QD 3GJQB 5KG5A 2HQGA 5IOLA 5K5MA 3DRRB 2C2EA 1HWKA 3BF4A 1RE1B 4NZ0A 1Y9OA 3P5TL 2IJFA 3AOAA 5CYQA 3LP2B 3ISZA 3C19A 2E5LF 4C8KA 2WK4A 2KM8B 3QO9A 3K59A 2WAQD 4FKYA 3CC7S 3H2VE 1RABB 5DM6Q 2V8GA 2JDJA 2FDNA 2YH0A 4O4GB 5C5JA 4WTOB 1YZ6A 2VBXA 3GLJA 4G3IA 1CJKA 4CLLA 5DETA 2HGLA 1Q79A 3UQSA 3QT5A 3M30A 1V3ZA 1T02A 4DL7A 2I6WA 3ENWA 3HHEA 2VD3A 2OMLA 3KUHA 3I0RA 1OY8A 3ZXWA 1H73A 4ES3A 1TL7A 1WHVA 4CLKA 1U47A 2KXHA 2PMZD 2EW9A 1AUDA 3FCVA 3HZGA 2DNYA 3DLGA 3W61A 2MQNA 4N7TA 3HJFA 1QSSA 2LQJA 1XMOF 4LBHA 5KFYA 3UR3C 1RTDB 5IT4A 3KLHA 4X66J 4B3TJ 3PYGA 1BGXT 2FZCB 5JMNA 4RUCA 1Y0HA 1U0HA 3BBBA 2E1CA 3SEOA 4USHA 3MR2A 2AYMA 3TZXA 2QFIA 3QWPA 4ZLJA 5HI7A 2QLJB 4NCAA 5GAHI 2GS8A 5GAGI 2NR0A 2VPYB 2BE9B 4M94A 2G2OA 3TQEA 1Q81T 4QU6A 2GHPA 2A18A 4PYAA 3H2LA 3R6LB 1H0HB 1NSAA 2E1RA 4DQRA 2AX1A 4UOCA 5RUBA 2CAJA 3QYYA 5G4DA 2MY7A 4TYBA 1MWQA 2KKHA 2A2CA 4F36A 1S1UB 3TA0A 4EYHB 1FK9A 1U1NA 2LXIA 2DY9A 3KLVA 2HBZB 1R8PA 3KG4A 4MIWA 1RISA 3PRBA 5LMNJ 1F9FA 4B9VA 1IBCB 2HW3A 2YXLA 3TVZA 3HVTB 4FNHA 3W7BA 1P1LA 4PXBA 4NEZA 2DY1A 2I1RA 1YDLA 2HVHA 2V69A 4L76A 4W90B 3G2XA 3ZO7A 2UXBJ 4Q2MA 2XY5A 4F3MA 2CJBA 1TVRB 1N6QA 2K2PA 4P72A 3R5AA 3MM9A 3Q23A 4D3GA 1X0PA 1YJTA 2D41A 4LT6A 1RTHB 4O44A 1RHQB 1ZM9A 4RZRA 4DLEA 1RWWB 2HAFA 1BXNA 4X62F 1RWUA 4QIEA 5F8JA 2Y1RI 2WVFA 4KIAA 5AXLA 3GG1A 1PBAA 1S77D 2ZUGA 2K1RB 5IFMA 2R7XA 3CT9A 2ZH8A 2DD8S 4NWBA 5T7LB 4EU0A 3O2IA 5A8WB 1KOHA 2OP5A 3ETMA 1R8HA 2B5JB 2LQBA 3P3DA 1WC5A 1RAJA 3OHBA 3KK1B 2DISA 1S7IA 2DXEA 3VR1A 3BGRA 5GMEA 1C4CA 3N28A 5K9FA 1VS3A 1CQNA 3AFGA 3BQ2A 2RKIA 1GFWB 4EYIB 4CQ1A 2V9KA 1IKXA 4QR2A 2U2FA 3LH2S 1J27A 3D6FB 2XLJA 4JI5J 4OX7A 1S72S 4IQMA 3OVSA 2ZC4A 2HIQA 1J5EF 2ZH7A 5L38A 4IH7A 4DR2F 1YK9A 1MWZA 3K2YA 1YJVA 1WDTA 2ZNZA 3HULA 2BE7D 2JSXA 3K5OA 1E6YA 5IQQA 2XMUA 1W7WA 3OD2A 2AJ2A 2KH9A 2C2DA 1HBMA 1WC1A 5I4MA 2WVBA 2G4BA 4ZN1A 4H54A 4B17A 1D0EA 4X84A 4IO1A 5E41A 3DOMB 2V94A 2WBRA 4DV3F 2M8HA 3R1LA 2PN6A 2KYXA 1HR0F 2RUGA 5KTQA 2XZDB 4NLWA 3GE9A 5ETSA 2W2OP 2HYIB 4NI2A 1HWJA 4X4VA 3J7ZT 5AE2A 2CFXA 5KT6A 5KG6A 1HBUB 3Q8VA 3NGTA 2PSZA 4R8UB 2AQ4A 4A46A 3B6BA 1C1CA 4C0BA 4O4RA 2HFSA 3C8YA 1FXLA 4F50A 1FTCA 3HCXA 3QIPB 3HXMA 1M5HA 3MCMA 2F1FA 4TQSA 1X31C 2EFGA 4USIA 3Q8QB 3MTKA 4ANCA 4JV2A 2CNLB 2IC3B 5L9NA 1QLNA 1NB2A 1PCAA 3FRZA 3QJJA 2IA6A 2DHXA 2OPSA 4FBTA 4OYXA 5FLXU 4JUZA 2BJ8A 1JLQB 1SCJB 1G3OA 2HG4A 1TV6A 2XM3A 1HNXJ 3TP2A 1M5OC 1YG0A 3KXDA 3IRWP 5JUMA 3HT0A 1JKHA 2M3DA 2JLGA 1P8GA 1D09B 4FYVB 5CYMB 2HLUA 1FJGJ 2VF3A 4Q43A 1IWGA 1VQ4S 1KQSR 1VQ8S 4FPIA 2FJVA 1T05B 1TP7A 4WE1A 2BQ3A 5AT1B 1MROB 3K5NA 2CPIA 1B99A 1X9WA 4KC5A 4OHYA 1RTIB 4RKUC 3MCOA 3N6LA 4YY3F 3CIMA 3IO1A 4JI6J 1RAGB 1DY3A 3UCGA 4F0MA 4NCGB 3JSMA 1ZYQA 4KHPJ 3DDNA 1OSCA 3I96A 3H98A 1UFWA 2CNKB 4U96A 1PYOB 1K1SA 5HQLA 2HK2A 3CJ3A 1SL0A 3C6TA 1SKRA 2E5IA 1JJ4A 2HNYB 1HQUA 1H72C 2O01C 3BH7B 1EHWA 1KFDA 1RDRA 3BYRA 4F7VA 3CJKA 2G1HA 3KJQB 3M6XA 3N9UC 2IIHA 5AXKA 3CVKA 4QWDA 3JSRA 4F2SA 4C98A 4FS1A 1NCLA 2D74B 1U24A 1D1UA 2W4DA 4CLPA 3FSXA 3TVYA 2LQ8A 3IRXB 2W2QP 3DM2B 2NXNA 3DI6A 1N5TA 2IMOA 2WOMB 1IN0A 2IHR1 1F5CA 2XBPA 3A3PB 2Y0SD 5IS2A 2JNJA 4M8LA 1WC6A 1JLAB 2JWNA 3UN2A 5E7OB 3DRPA 3EVOA 1I51B 4U95A 5EDWA 1T9TA 5CABA 1LW2B 1NO8A 5HO4A 4GC6A 4O3QA 3T9ZA 3CCMS 5HLFB 1RT7B 1GX5A 5IXUA 2P5VA 5DJBA 4LF4J 5B7WA 4OX8A 3NOCA 2DPJA 2CZ4A 4EBDA 2JRSA 4KPCA 3BSNA 5C24B 1A9NB 3TUPA 1LFWA 3VALA 4X64F 2HHUA 1SIWB 1IBKF 1Y4ZB 4M5DB 3H5YA 1U7LA 4WBFA 1BQMB 2P9EA 2EFQA 4HDHA 3PR4A 4RBTA 3NCQA 4DHVA 1NDPA 1NK4A 3MF5A 2VG6A 3W5XA 2E5LJ 2RU3A 3EGWB 4CI0B 1RAIB 4BLGA 5B0GA 3BEGB 3PACA 1SJQA 1EIYB 3MFIA 2DNKA 4CIOA 1HBNA 2DCLA 2RS2A 5KFVA 2E7XA 3RBDA 1HL6A 2V4RA 2YQ1A 1NZAA 2DK2A 1REGX 4DX8H 4F8RA 4HYKA 4JV0A 4LFAF 5D0EA 3IWNC 2JEGA 3MM6B 1C4AA 4IR1A 1PC4A 3EZ5A 3M1VB 2QN6B 2H51B 2P9CA 2LYVA 4NLYA 1ZAXA 2UV8G 2G13A 4OZ0A 4G1QB 1SC4B 3VVTA 1IBLF 2V2VA 1C0UB 2KG1A 1XMOJ 4PPDA 2E9ZA 3S01A 2ZD1B 4X2BA 4K50A 2YNHB 5KFAA 4EO6A 4DV6F 2A0FB 1O51A 1ZBTA 4WFYA 4YDXA 4WFNQ 1NJZA 5H9FK 1FEEA 1VISA 3EVMA 1RXOB 2XMVA 1RP5A 1YLXA 3HKZD 3IM8A 4ZJQA 2GIFA 3CEDA 3RAQA 3DLEA 4HT5A 4J9LA 2E44A 2W9CB 3QRRA 2NPFA 1VRUA 2Z4PA 3TUIC 4M63A 3CCQS 2RDJA 5IM0A 2C2NA 1VQMS 1Q4RA 2J7WA 2UP1A 1PAUB 3OL7A 2EFVA 4I56A 2I8EA 3W2VA 4KGXB 1HD1A 3DYAB 1X5SA 3NAIA 4LF8F 1VLYA 3M6VA 4Q45A 3MZIA 1CULA 3PV8A 5IWAF 2XY7A 4TY8B 3M2VB 4XK8C 4DL5A 3IN5A 5DQHA 1FKOB 3FCHA 2M88A 1EETB 2OPRB 4OV6A 3D6MB 2DHAA 3NLCA 3AD8C 3MDFA 2MKCA 4HTJA 1F3VA 1PKUA 1FJCA 3OXFA 1FRKA 1HW9A 4J5OA 4O23A 3QFHA 2ZH6A 1R8BA 2FJWA 2HMIA 1X4FA 2C1EB 3UDLA 4LJMA 1OY9A 4X62J 2IJRA 3AJDA 2BVZA 4ED8A 4GO7X 1NK8A 1FX2A 1YKWA 3G82A 3H7HB 1YRXA 2XMAA 3NG8A 1TK0A 1KFSA 1HHSA 2EPIA 3MM5B 1ZPWX 1YJWS 3W3SA 3PX0A 3H59A 2Z2MA 2OD6A 5KFFA 2KG0A 3FEXB 3VGVA 3PO4A 1Y5IB 2AJ4A 2BJEA 4I7FB 3HT3A 2OEKA 5E3CA 3EZUA 3NWGA 4MK7A 2L3MA 4CLFA 3MUVP 2HLTA 3NKYA 3D28A 4E8UA 4X4NA 1FDBA 3PHTA 5GAHU 5GAGU 3M2UA 2FC9A 3M8WA 5DS7A 2ZDOA 3G71S 3MMBB 2YY3A 3F73A 3M6UA 1B0TA 1DQ8A 5D3GB 3M8QB 1IM4A 3NBPA 1BWEA 4PG4A 1TK8A 1J5EJ 4C8LA 3GILA 3KK2A 4OI1A 2RE1A 4ZVQB 3C6UB 3VQSA 3RUBL 2RH3A 4DR2J 1SUQA 1O0PA 3MUMP 3FK4A 3GZ7A 3C16A 1OQ6A 4ZDNA 2W01A 2HHSA 4P71A 1QY7A 3D68A 3QJPA 1JLGB 1UWBB 1GXLA 2YKNA 3GU0A 4I2PB 3RB6A 2JVRA 4RW7A 5C25B 1XC9A 2LA6A 2KL8A 1JNZB 3V81B 1WD6A 3PO5A 2Y1LB 3DGPA 4C8MA 4NZ7A 1RWOB 4DV3J 2FYXA 3R1HA 2HSEB 1EQMA 5THWA 2IVYA 5CA5A 1REVB 4WP3A 3THPA 1VHFA 1HR0J 2EFPA 3L95X 2BMBA 3W2WB 2JZ5A 4WPAA 3BPDA 5EWGA 1U8WA 2UUCJ 3ZZZA 3T1HF 2MYFA 1H3DA 4USWA 2R2TA 1PJ7A 2DIVA 4ECVA 2Q1LA 2Y0BB 3OR1A 2HGNA 2OELA 3TZZA 3OTEA 3A4TA 3B54A 2XSJA 4E0DA 2KJWA 3SSQA 2FLOA 4AFFA 5DZ7A 3RGIA 1RI7A 4OIXA 4N5SA 1PYSB 4DV7F 4GVBA 1L3TA 2WTFA 4WYLA 3TUZC 5LOQA 2JC1A 2BA9A 2AF6A 3GCXP 4FVCA 4NLPA 2W8KA 3X1LB 2Z56B 1MG7A 3I0SA 4B9LA 1U02A 3EGNA 1KWMA 2YKAA 1WTBA 2V5HG 4F4YA 3ZZRA 3KJVB 1S9EA 1LXNA 1TU0B 3BN4A 2O3DA 3CC4S 4ES1A 1XIQA 2NYHA 1GX6A 1EJ7L 2XYPB 2YWWA 4N8OA 4I68A 1RADB 4ANDA 2FGCA 4F0HA 4LVNP 2VA2A 3QJLA 1VBKA 3W60A 4R25A 3FQLA 3CWJA 1HWLA 4DLGA 1LWCB 3CGIA 2MMYA 3MMCB 4OHVA 2QIFA 3CCLS 1NH7A 4KB7A 3HHDA 3AHPA 1ELOA 2AYEA 3BKTA 3FVYA 4YY3J 3PYEA 2JEIA 5CQGA 1R8AA 3JQJA 2CNNB 1JLBA 2ERRA 2C22A 3GG0A 3NAHA 3IP0A 2CQDA 2F5GA 4XPCA 2XCAA 1SPBP 2YTCA 3I82A 1TAQA 1SL2A 5DGAA 3RAXA 3IR7B 1YZ7A 5J2NB 3OSNA 5KFZA 3AODA 4DQIA 1YRUA 2UXCF 1IQZA 1IJEB 4DL2A 4D3HA 2RVJA 4EBCA 1U4BA 2HNDA 2BXJA 4NLRA 3HSZA 1B3TA 1JMTA 3N79A 4QIFA 3PJ9A 2GV1A 1S99A 3FDSA 3V4MA 1M5VC 3ENQA 4WZQA 2VBZA 4H4MA 4R5PA 4OFZA 2R7VA 3T1AA 5CYQB 1I6JA 5LSLA 4WK1A 3QO9B 1SBRA 3CD6S 1NNDA 2C28A 1KS2A 1RQ0A 4U7CA 1S0NA 5D6GA 2FPHX 1KTQA 3D66A 4CP5A 1PGZA 4K0KF 2X1GA 3J80Y 2V2ZA 3GYXB 1CJKB 2I0XA 4ZVTB 1OO0B 1S79A 4ZCKA 2W4PA 1NK9A 3MEKA 4Z7YA 1GTEA 1N88A 3OT9A 2KJVA 3LGNA 4ZCMA 2EC2A 2WRMA 8AT1B 4J9QA 3TWZA 4EZ6A 1TL7B 3SCKE 4X64J 1IBKJ 1K8AT 5B0BA 3DHXA 1Q8KA 1KKHA 2KZMA 5KG0A 1NMEB 3KLIB 3DLGB 1Z1ZA 2E5JA 4YHHF 3CF5Q 1VJWA 3KLHB 4USUA 2FTRA 3PFEA 1U0HB 7FD1A 4O4GA 4P73A 2MQQA 1RHMB 1KVIA 2WW8A 3KHGA 4O3SA 1RSCA 2AZ1A 2NYIA 4DPYA 1UWAA 3NP5A 3R9LA 1U1MA 3GIJA 1WACA 3AD9C 4ZJLA 2ZKTA 2HGMA 4KO0A 5KFQA 2N7YA 4OI2A 1JB0C 4O3PA 1LQ9A 1WG4A 1RT6A 1LWXA 1BD6A 1V9OA 2KFZA 1YJ7A 1PJ5A 2V34A 4OI0A 1FK9B 4QWCA 3M7VA 4KTQA 2PI5A 2VPWB 1UJ6A 4YB7A 3UNGC 1IBLJ 4J9SA 1XNRF 3T6BA 3RRHA 2RHQB 3C14A 4FVMA 2B51A 2MSTA 3G9CA 1XR5A 4B9UA 4DV6J 5KT7A 3ZFVA 3BQ0A 3W8GA 1RHUB 3V6JA 5E3RA 3JTPA 2DJWA 1EQ0A 1WTFA 1VI7A 1N6QB 3KHLA 1SJ3P 2VKZG 3MM9B 3MHYA 2EG1A 4IG3A 1GEHA 2CQBA 3RRGA 4O44B 4ECXA 4NEYA 4CO2A 3LA0A 5DGBA 4Y65A 2FUG9 3IGNA 4QR0A 3EDQB 2FHJD 2GAGC 4RNOA 2ASDA 2ZJPQ 3AQPA 3MPWA 1VRTA 1NDKA 3K7RA 4DQSA 1UJ5A 2CPZA 1YVFA 2LLZA 2J6TA 2XS5A 4DF8A 2F8HA 4TLQA 4U9RA 1UVMA 3M2RA 4LF8J 2JVOA 3QZ8A 4RUAA 2C3MA 5KFWA 4OYOA 1H98A 4QCLA 1U2FA 4FPRA 1F9HA 2AT1B 3GJSB 1H6KX 3BGRB 4IFYA 1NJYA 1H2VZ 3ISND 2FVQA 2XI2A 3HVWA 3LALA 2DHGA 4B3RF 3P8BB 2I5JA 1T3NA 1EKRA 2RKIB 1ZH5A 2N4DA 1IKXB 2Q3PA 4A8KA 3PXGa 2CIMA 2OTLS 4XTTA 1X4EA 4HI2A 3IR5B 4NLUA 3A8KA 2CG8A 5T7LA 3UD4P 4ED0A 2P9GA 4LQ3A 3OVAA 5IT0A 5CD4H 1E6YB 1Q8LA 1RA6A 3W64A 5JJBA 3PX4A 2ZVSA 1SQFA 3AJ2A 1VBZA 3MTJA 1TELA 5F8NA 1HBMB 1ZM3A 3MOZA 4LRFA 1FRHA 2V0NA 2YX4A 2CJQA 3ULHA 1EP4A 5EX3A 5KG3A 3AOCA 2RJZA 2DNRA 2ZNYA 3CDEA 4EO8A 3KUEA 4I69A 2JFDA 4L72B 1X0FA 4TQRA 4RBVA 4ED5A 4NI2B 2D3UA 1KLMA 4IO9Q 1RU2A 1WF0A 2EBEA 5F9NA 3L4BC 1FD2A 3JYTA 4P75A 1C1CB 4YB5A 1RBAA 1NB7A 5BYSA 1B4SA 1OY6A 4M5JA 4UT4A 2PD1A 2GZOA 1ACMB 4FF1A 5KFDA 3MR5A 3GB0A 1IKYA 4FZVA 1RAFB 2JEFA 3TR5A 1QTNB 4NL5A 1TL3B 3PRDA 1X4BA 4A8MP 2G2YA 3OSPA 4NRTA 3L3CA 5MLCV 4DV1F 1Q78A 1ROFA 4ECSA 1RCXB 2W8LA 2OPSB 1S4FA 4WXWA 4OI4A 2RDIA 4DPOA 2M70A 5F8GA 2DO4A 5H9EK 1HBUA 1TV6B 5CHCB 4LFBF 5A2QU 3H5SA 1MMDA 3I56S 5KFXA 3K57A 1QVFR 2W2NP 3T1HJ 1TAUA 5IV4A 1U25A 2PDAA 1ZETA 2B9YA 2BOAA 1WG5A 2BUNA 4P7TA 1JKHB 1E6VA 5H9EJ 4OYMA 1RZMA 3TNVA 3C15A 2KZZA 2GX8A 3GJRB 3V2UC 5I3UB 3KTQA 4OLOA 3AD7C 2BYCA 3HM9A 3RTVA 4J9VA 2CVIA 4DPUA 1RYRA 4WE1B 3G86A 2J6SA 3K89A 1S6UA 1JLCB 4DV7J 3RZAA 1S0MA 4AL7A 4KKOB 4ETZA 3TX8A 3PY8A 3OL8A 1YJNS 3SV3A 4LFCF 1R6VA 2QV6A 3UN5A 4IFVA 3H4DA 3HP6A 1MMNA 2R2RA 4FNIA 2G1DA 2A2DA 4ZIVA 2XI3A 4RUHA 3J81j 1W25A 2G9OA 1MW7A 4KRWA 4OJHA 2J0SD 4USVA 1V6HA 1RWNB 4YP3A 4NYPA 1S57A 1HQUB 3TVKA 3EGZA 1S1TA 5DO2A 4BWJA 5F9LA 4NXNF 2ROEA 4K7QA 1BY9A 2IM0A 3OTDA 1U1QA 4Q2LA 2C3PA 2GMLA 4Y2KA 2RAQA 3R5DA 1RT3A 1Q5YA 4MKAA 1RTZA 4F3QA 4ZS6A 3DI6B 3FEYB 4MFBB 3KDOA 1NH8A 1U8SA 4YDDB 1UL3A 1N0VC 1F9EB 3QNWB 3W9JA 2AYBA 2RQCA 3QGGA 4UQTA 3WHIA 3DRPB 4P2SA 3L7UA 1UPMB 4DI6A 3WC0A 4PQAA 3D3CJ 5A6PA 1S76D 3M6WA 4Z37A 1FXDA 1ZPVA 1B7FA 4KGKA 3IFEA 2E7WA 2YQ3A 3R27A 5F0UA 2CPDA 3T1YF 3EPIA 3OFFA 4IR9A 4DMZA 4JV5F 2YNFA 3DXSX 4UOHA 2OEJA 2XQCA 2KHCA 5HP1A 4DCOB 4ENOA 3HMJG 2VFRA 4H4KC 3X3UA 5ETRA 4DX5A 2E5GA 2FVSA 4UZBA 2BRLA 4DZ6A 2VG6B 2KXNB 1S97A 4C2MA 5CCMA 2MJUA 3F41A 1VGYA 2LQ5A 5HVGA 2HFOA 1WSVA 1JLAA 1ZA2B 3TO8A 2Z57B 1SC6A 4K0KJ 2CA9A 3ILJA 1SJRA 1HBNB 4MIBA 3IA0A 1KONA 4Y2IA 2ZZNA 4OMFG 1PG5B 4OZ3A 4G1IA 2Y9HA 1NHKL 2Y3YA 2GCFA 2IYGA 2OUGA 1RAHB 2DKOB 3IM9A 3CCSS 3Q0AA 3GONA 1SH2A 1C0TA 2R7WA 2RMLA 3K5PA 2R4FA 4DBQA 5FDLB 4XDCA 1FVQA 3THVA 4QPTA 4YHHJ 3JB9k 4RWWA 3CULA 4OV1A 1V3RA 2BE2B 2HEKA 4CM0A 3CW2C 4JI3F 4MT1A 2IYIA 3QQCD 4ZVHA 2ZWPA 5KFOA 2VQFJ 3E01A 2MQPA 2V8DA 1GH8A 3FSIA 3ZNJ1 1T95A 3EM1A 1JWWA 1VQ6S 2VFUA 3CSKA 5CZXA 3D7SB 4V19J 3HDSA 1M1GA 1F1BB 4ERDA 3I4HX 4O0NA 2DIUA 1F60B 4YOEA 4H4KA 4FXDA 2LFVA 4TLRA 2DRDA 2RU9A 4LF5F 2KXFA 3QT8A 2CNOB 3CDUA 1KR4A 2QYCA 4ZVGA 4KSEB 1VRUB 4O0IA 4EZ9A 5E0OA 3V6DA 5IM0B 2LXFA 2WCXA 2BANA 1Q8IA 2ZHOA 2XZWA 3EVWA 2MY8A 4IQXA 1HW8A 4C0HA 2XS2A 3W2VB 5DQGA 3AB4B 2DHHA 2EXUA 1CULB 1S12A 3FBBA 2AV5A 4RW8A 2QZ8A 3TYTA 2RDDA 3RBEA 5KOXA 4NPOA 3NGUA 5F8IA 3TZWA 4XIUA 4PG8A 4CO4A 4PAAA 3ENAA 3QATA 3ZTPA 2VDHA 2PA3A 1HNIB 3NEKA 1HIYA 3K8VA 4IOAQ 2HMIB 4M5LA 5HMZA 2QL7B 4I6WA 2WZ1A 1QAIA 3IBWA 4ILLA 5KT3A 3G82B 3KYLA 2HZAA 4CLSA 4LMZA 2DB1A 1U1OA 4LF6F 2AEMA 3SV4A 4DUTA 3JTNA 1YSJA 3BBCA 1WC3A 1LV5A 3BO3A 2CG4A 1EETA 2P8IA 3ZTQA 3C2PA 3AQOA 4M5NA 2C2MB 1S9FA 4B3RJ 1VC5A 2CZ9A 2GIRA 1NJXA 3MAAA 2MQ8A 3M2UB 2ACMA 2CJ9A 2ATCB 2OEMA 2J9DE 1UW9A 2H1YA 4E98A 4V19X 2J5AA 3OUYA 4FP9A 2L41A 5HQMA 4ZLLA 2YKMA 5KFRA 2QA1A 4B9NA 4J9UE 3SFGA 4CDIA 1FRXA 1O6XA 3E8OA 2QMXA 5D4LA 2DBBA 1QAYA 4B9SA 4QPXA 1SUQB 3C16B 3QAUA 4LUBA 1FFSB 2I9SA 2QL9B 2OTJS 1WOOA 2FD2A 2VU5A 5C2GA 2YKNB 3R6GB 1HI0P 2IY5B 1IVZA 4RW7B 3K58A 4YQWA 2VL1A 1KTVA 4CO0A 3TAMA 3DOLA 3J7Z5 2C3OA 1R0AA 4IRKA 3DGPB 5ETTA 3KG0A 1JX4A 5D3GA 1FI4A 4RJVA 1RAEB 4P7VA 2L9DA 4NOHA 1FNMA 1UA0A 3QAEA 2FJEB 4OX9F 2F65A 1TUGB 5AJ3F 3GV5B 1D9DA 5K8OA 3WX8A 2UUAF 4ZP6A 1A6LA 3BPSP 3IS9A 1VOMA 4JOUA 2N3OA 3OR1B 2V63A 1S1VA 1AT1B 2NSCA 4EGLA 4Y0FA 4M5IA 2BJ9A 2XSJB 2XMWA 5ADZA 4Y34A 4KFBA 5JVHQ 2R8KA 2FIUA 1JQGA 1B64A 3D0GE 4USKA 2J0WA 2HFVA 4GVBB 1D8YA 3FUYA 3L09A 3LQVA 4DV1J 2HFUA 4LF7J 3I0SB 3VAIA 2XS7A 2KDOA 4UF4A 1KNZA 4X4SA 2YH1A 3BDPA 1YJRA 5D4OA 1S9EB 1Z2ZA 4LFBJ 4ER8A 3MD3A 1YIJS 1Z2LA 3DKDA 1KD1T 2VBYA 3UFCX 2KFYA 3AXMA 3UE2A 4L3NA 5FJ4A 2XB2D 1W26A 3Q2TC 2XWXA 2Q6BA 1N56A 2FHOB 4BC7A 2R9LA 5D8HB 2QMWA 3RB0A 1ZZFA 1NXIA 3ITHA 1TL1A 4YN3B 4HVZA 1TFWA 2EG2A 2MZTA 3OXGA 4C8ZA 2VJUA 3E2EA 2E29A 3VAGA 5LL6d 1VMBA 3CB4A 3MEGA 3PKYA 4Z2XA 2M5YA 1XN9A 2DNQA 1JLBB 1LOUA 4A47A 3TX0A 3BJYA 1FD8A 4LFCJ 1SH3A 1NHVA 5EWFA 1RB0A 2ZH4A 2P2CB 1CBKA 2COLA 4M5MA 3POTB 3VCDA 3W9HA 2HVEA 4P2MA 2YWKA 2AP6A 3CCRS 3W63A 4X4OA 3BR8A 3SQOP 1RWVB 2HVDA 4U8VA 5DDQC 5C42A 2U1AA 2HNDB 4NXNJ 1JXVA 5DG9A 1F2HA 2E9RX 1RA7A 2Q79A 4RX6A 1DTTA 2R8GA 1CG2A 2BABA 2BQUA 1HHTP 4N8NA 1UAWA 3P6YC 3M9OB 4H4MB 1HI1A 4R5PB 1KVKA 2L08A 2HHQA 2MKIA 4A8FA 3KDNA 4DFKA 4K4ZA 3MGJA 5IV3A 1CLFA 2PMHA 2EFOA 3R2DJ 4CNZA 4KBIA 5L1IA 2F9JA 1U1PA 1UFLA 2B8QA 4LRAA 1DQAA 2Y1JA 5HQ8A 3LPYA 2MZ1A 4ELTA 1FJ7A 3MD1A 2VONA 2BW7A 1F5AA 2R7SA 1H7XA 1Q82T 1SKWA 4DWIA 3ZNUA 3VZIA 2CQHA 3T1YJ 1NU4A 1CJUA 4QBUA 2DR9A 2H5IB 4JV5J 4B02A 1VRQC 3MAHA 1HHQA 4PKDB 3UR0A 5C7PA 2IM2A 1X4CA 4J9MA 4PABA 4ZK7M 3GSIA 4HDGA 2MZRA 4OYBA 4ZHRB 2AD9A 5LJ3Y 5DM7Q 4FBUA 1RKIA 4V1Ak 3PW7A 1QVGR 2SXLA 3B82A 1MN9A 1U6ZA 5K14A 3V4IA 4OI6A 1F3FA 2V2KA 1FWKA 2KT5A 3P49B 4RU9A 2R7RA 4KO0B 3NRBA 3R3TA 4DG1B 3FQKA 3P96A 3BH6B 4OYIA 1RT6B 4C97A 3Q8RB 3I4PA 1RAOA 3UW1A 4ICLA 3PNIA 4DXLA 5HJXA 2VG5A 1IM6A 2YNIA 3UNYA 4F2RA 4WTYA 3RYLA 3F0NA 3KLIA 4NX9A 1PC5A 2EKYA 2XULA 4J9RA 2C2OB 4JI8F 3M9MB 1FT8A 3H40A 4JI1F 2OSQA 3SYZA 1XNQF 1FKPA 1TZ0A 1T7PA 1NKCA 5KFHA 4OYAA 5B0DA 3C14B 1BWVA 1SJ4P 4JI3J 3K8WA 2RRAA 3Q8SB 5A76A 2W2MP 2ASLA 2E5HA 2YPZA 1DARA 5M2PA 4QW9A 1NDLA 2B43A 2KTQA 4AYBD 4PG7A 2V4QA 4WXOA 2N7CA 2NS1B 2QLFB 2MKJA 4DN9A 3R2CJ 2HHWA 4IG3B 3OFEA 1WJ9A 3I9V9 4ZVUB 1VHIA 4LF5J 3M8PA 5AXMA 4GKKF 2L9NA 4DU7A 1H2TZ 3DN9A 1NHUA 4EMDA 3CPWR 3MCSA 2F9DA 4L73A 4A8XA 1VRTB 1AZSA 3FCWA 4N56A 4HTIA 2OSRA 3KJNB 1VBYA 3LAKA 3KMQA 3HHNB 4KHMA 2F4FA 4HH0A 1PO6A 3M2RB 4ZPAA 4KGZB 2QSWA 4LSNA 1FFGB 2BKOA 3W62A 3IR6B 5HN0A 2YNGA 4MK8A 1N34F 1TQLA 3MOJB 1S7HA 4IFYB 3D9BA 1DQ9A 3D2WA 4ED1A 1NPPA 2I5JB 3OLBA 1EAYC 3DRYA 1KQGB 2OMOA 4JI2F 3VF0B 3OTCA 2J7KA 4ZP8A 1M5SA 2WVEA 4IRDA 1SKSA 3A3NB 1JJCB 3ICLA 1F5BA 3LWMA 1Z4UA 4HHUA 2FJBB 3DRXA 4RNNA 1RWXB 4A8OA 3EICA 2QC3A 1H74A 2F8MA 2BV3A 4AXIA 4LF6J 1VIXA 1Q16B 1APSA 3SCIE 5I3QA 1S4EA 2F7VA 2W2PP 2V9WA 3T19A 1X5PA 2QX0A 6AT1B 2VC0A 1HNWF 2RQKA 3US5A 1YITS 4NYZA 3CNQP 1FE4A 2DR8A 4DDFA 2R3VA 2RD5C 3TZYA 3CJQA 1V3SA 3PHEA 4LBIA 3AT1B 2GJIA 3DMJA 1K1QA 1EP4B 2Z2LA 3CCUS 5F8MA 1JJHA 1HMVA 1MLAA 2CQ4A 4RU2A 3PG9A 4EUVA 1ICEB 4ETXA 3CJSA 4BBYA 1KLMB 2KU7A 4NXMF 4DX6A 3JQMA 4K4XA 2ZBRA 4WU3A 2VUGA 3JYTB 1SV5A 1RHRB 2HHHF 3UPFA 3MMAA 4CO1A 1X9MA 3OL9A 2F8EX 2QLBB 4ZVSB 4C8OA 1WKLA 4FF2A 2EBGA 3AH6A 2K06A 4U6PA 4LR8A 1IKYB 3EJMA 3EGVA 2RQMA 2YQ0A 4MH8A 5J1EA 4DSIA 5DG8A 1S1WA 3HX9A 1UZHA 2Y8YA 2PT0A 3VGSA 2E66A 4OZ5A 2CDRB 2IPOB 4MKBA 3VAHA 3M8ZA 4N47A 4IH6A 1N0UA 5LMUF 2ZOFA 2UUCF 5A8RA 4OX9J 3KLFA 2BEFA 2HRYA 3C3LA 1QD1A 4QYZK 4ZLPA 4M1KA 5AJ3J 2CDQA 4ZLNA 4BC9A 1S5ZA 2UUAJ 1E6VB 1FX4A 1WF2A 1U09A 3C15B 2WW4A 3EDRB 4HL9A 4DQQA 5IQ6A 3N0VA 1IR0A 1R27B 4DZDA 1FF2A 1TL3A 5A8KA 2HWIA 4DV0F 4PXDA 3DDKA 2JFKA 2D3ZA 3OTOF 4NLGA 1OJ4A 2XTJP 4EI2A 2DGSA 1VQ7S 2X51A 5BXIA 2O66A 2GVZA 4HI1A 2UV8A 3DU5A 3D0IE 2YBVA 4RNMA 3LO3A 1FTRA 4IFVB 2CKWA 4DFPA 3DC2A 5HANA 4B9MA 1YQHA 4ZA1A 3CCTA 2ALZA 5I3UA 4HEA9 3BGOP 4F67A 1S1TB 3FMWA 1RK8A 2DGWA 1JLCA 4J9OA 2GHWA 4NLOA 3EE3A 1VQOS 3KKFA 2X3GA 3ILIA 1RT3B 1S49A 2LEPA 2V68A 4KKOA 4UW2A 2R42A 2DITA 1RU1A 5JVGQ 1N52B 5BYQA 2CUYA 5KFTA 3IMQJ 1C2PA 2ZHAA 2RILA 2DNPA 5SZTA 1S6PA 3BB5A 2ASYA 1S0OA 3MFHA 5EHHA 3Q8UA 3R5BA 1VQYA 2BRKA 1HQ2A 3DHWC 1OWXA 4ANEA 4OHZA 4F4XA 2R8HA 4LIWA 2LVWA
chains in the Genus database with same CATH topology
4CH0S 1HBMB 5F8NA 3FZBA 3M30A 3GIIA 1XMQF 1ZM3A 1V3ZA 2HHVA 1T02A 4DL7A 1QTMA 3G6ES 3ENWA 4KGMA 3HHEA 2VD3A 2OMLA 3I0RA 3MOZA 2IJNA 1FRHA 2V0NA 2V4JB 4RNHA 5F8HA 3C46A 4ES3A 4DUYF 1WHVA 3SSSA 1S1XA 3MEDA 1U47A 2YKOA 5D4PA 2YX4A 2CJQA 2D1CA 1N5YA 5B08A 3EYZA 4DSEA 3ULHA 4IUFA 2KXHA 1EP4A 2PMZD 5EX3A 5KG3A 3QPIA 2EW9A 1AUDA 5F8LA 2UZAA 3HZGA 1WF1A 4DS5A 2BZ2A 3PW2A 2YNFB 1G1XA 2DNYA 2RJZA 2DNRA 2ZNYA 3CDEA 5I42A 3DLGA 4EO8A 2MQNA 2NQPA 3HJFA 4I0WA 1QSSA 5HP1B 4FF4A 4I69A 2JFDA 2LQJA 4WK3A 1XMOF 4L72B 5KFYA 5KFUA 1X0FA 3D1HA 3VAJA 1DHMA 3OR2A 1RTDB 4RBVA 3UR3C 4TQRA 1DURA 5IT4A 3KLHA 1ZTWA 4MFBA 2QLWA 1BGXT 2RT3A 1JLEB 4ED5A 4RUCA 2D3UA 1QUVA 1OS5A 3HZEA 1KLMA 2E1AA 3DNCA 4FS2A 4ILMA 1Y0HA 3KHRA 1URNA 3AAWB 4IO9Q 2DGQA 2E1CA 1WF0A 4DV5F 3SEOA 1DTQA 3IG1A 1SH0A 2EBEA 3FNNA 2AYMA 4USHA 5F9NA 3MR2A 4J9KA 2BM1A 5I3PA 3GR0A 3QWPA 1FD2A 3JYTA 4FXWA 5HI7A 5GAEI 4JI7F 4NCAA 5GAHI 1QM9A 1C1CB 5J1NA 5GAGI 2QT7A 2VPYB 4YB5A 2NR0A 1AFIA 4ECRA 2YWFA 4FYDA 4M94A 1OQ3A 3BREA 4EBEA 1Q81T 4QU6A 2P6SA 2GHPA 2A18A 5KT4A 1NB7A 3H2LA 5BYSA 2BR0A 3BGFA 1H0HB 4O3RA 2E1RA 1Y5LB 2PD1A 1Q8BA 3HI9A 5K8MA 3I6PA 1G6BA 5E3PA 2AX1A 4DQRA 4FF1A 1XEZA 1LWFA 4UOCA 5KFDA 3MR5A 2PI4A 3GB0A 1X5OA 4DR3F 4B3OA 1IKYA 2X1BA 4FZVA 1FKAF 4OHWA 1IKWA 2JEFA 3TR5A 1RKJA 1HPZA 3DLKB 5G0RA 4MK9A 3GFYA 3QYYA 2VFSA 5G4DA 1S9GB 1HI8A 4RBUA 2MY7A 4TYBA 4NL5A 1TL3B 2XY6A 1MSWD 3PRDA 1X4BA 4A8MP 2KKHA 1WWHA 2A2CA 3S6EA 3ZC4A 1FHTA 3OSPA 4NRTA 1T3OA 1S1UB 4UUXA 3L3CA 3TA0A 4EYHB 5MLCV 2ZM6F 1FK9A 4DV1F 1U1NA 2LEBA 4N76A 1Q78A 1DAXA 1ROFA 2LXIA 2W7OA 2HWTA 1LK5A 4ECSA 1S6QB 4FF3A 2GMJA 2W8LA 1C0TB 3KLVA 3HF5A 3HKWA 2OPSB 1S4FA 4WXWA 4ECTA 1R8PA 2ZOGA 3KG4A 4OI4A 2RDIA 4MIWA 1RISA 3PRBA 4DPOA 3KFWX 2M70A 1F9FA 3S8SA 2DO4A 5F8GA 2KM8C 2FLPA 4K4VA 4B9VA 2GFFA 1HBUA 3MECA 5FLXY 1TV6B 5CHCB 2HW3A 2BJDA 4LFBF