1RT2B

Crystal structure of hiv-1 reverse transcriptase complexed with tnk-651
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
402
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 107
structure length 402
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2B03
1D1UA 1JLGB 1TL3A 2XI2A 5F8LA 4KAIA 2R2TA 4GC6A 5DGBA 3DLEA 3G6YA 3V6KA 1IKVB 4KSEB 1JLGA 3KK2B 4TN2A 4YR0A 5F8NA 3FFIA 3H40A 1IM4A 3GYNA 3ISNC 4NLQA 2B5JA 5KFHA 2IM3A 2V4RA 3G86A 5KG3A 1S1WB 2C28A 5J1EB 2BE2B 3IN5A 3HKWA 4WFZA 1RTHB 3BGRA 1JLAB 4IFYB 4QWCA 4KBIA 2FJWA 5J1EA 2BE2A 3QIDA 4M95A 3GIIA 2BANB 4B3OB 1T94A 5F9NA 4ED7A 1RT3A 4NLPA 1RTHA 1LWEB 1JLAA 4IFYA 1J5OB 1N5YB 3RB0A 4IH6A 2W9BB 2CJQA 1RT1B 1IKXB 3PVXA 4B3OA 4J9LA 5HP1A 2R8GA 4ED1A 4TY8A 1S49A 2J6UA 4RNHA 2GIRA 1IKXA 4Q44A 4K4ZA 4RW4B 3PW4A 3FDSA 4WXOA 5F8JA 5KT5A 4ZVEA 1D0EA 4K50A 2HNZB 3HHKA 3DRSA 1HMVB 1S1VB 4ZHRA 2GC8A 2GIQA 4RW4A 4TY9A 1REVB 4YR2A 2AU0A 1TKZA 3DLKB 4FBUA 5I3UB 4FS1A 2YKMB 1T03B 3KLEB 1HMVA 1S1VA 3CWJA 4RNOA 4J9MA 3KK3A 5KFDA 1TKTB 5KT7A 2YKMA 3PJWA 1T03A 1S1XB 4ECVA 4LQ3A 5DLFA 2R8IA 1JKHB 2AX1A 3SFGA 4DL7A 1HPZA 1S1XA 1C0TA 3DRRA 3JYTB 4RNFA 1C0UA 1RA6A 4U6PA 4K4VA 1T3NA 1TV6B 1S1TB 5HLFB 1RTDB 2FJXA 1BQNB 1RA7A 5KG6A 3KLVA 3OLAA 2JEIA 3CJ0A 4G1QA 5KG2A 1RTDA 1XR5A 5HLFA 4F4XA 4MIAA 2J6TA 3OL8A 5CYMB 1EP4B 4NCGA 2IJFA 1HQUB 4J9OA 3QZ8A 3BJYA 2YNIB 1T05B 2I1RA 2XC9A 5CYMA 1EP4A 1RT6B 1QUVA 3RB6A 2UUTA 3SFUA 3DMJB 1RTJA 3BR9A 3N6LA 4TYBA 4LSLB 1HYSA 5KFBA 1RT6A 3CIZA 2J6SA 2OH2A 2C2EA 3H5XA 3EPIA 1IKYA 4O3SA 2ZKUA 4LSLA 4QW9A 3E01B 4KO0A 1RT5B 4Q8EA 4DEZA 3ICLA 3PW0A 2XGQA 1JLFB 3DI6A 1SH0A 1RT7B 2VA3A 4WZQA 4M94A 1HNIA 2WRMA 3MF5A 4MFBB 3UDLA 4TQSA 4YR3A 3NBPB 5KFSA 2IAJB 2D3UA 3UQSA 1SUQA 1RDRA 3UR0A 5KG4A 3EZUA 4K4XA 1IKWB 1I6JA 3I5BA 4MH8A 3I5CA 3PR5B 4MFBA 4J9KA 3KK1A 3NBPA 5J2PB 1GX5A 4EEYA 2IAJA 5EWGA 4TQRA 1EETB 4NRUA 5FDLA 1XR7A 5F8GA 3DLGA 3GIMA 2JEGA 5KG0A 4MKAA 2C22A 3KLGB 2E9TA 3KHLA 2HNDA 2ILYA 2VG5B 5DGAA 3BREA 3GV5B 5J2MB 1HARA 4RNNA 3KLGA 3V81B 2W7PA 1N48A 3JSMB 2UVWA 2C2DA 2BQUA 3OHAA 5KFKA 2FVPA 5DG8A 5HROB 1TL1B 3JSMA 3G6XA 4O3PA 5KFLA 4KKOB 5F9LA 5DQIA 3ISND 3FSIA 3PR4A 4NLUA 5L1KA 4O3RA 1TKXB 4NLWA 1K1SA 5DQHA 1RT2B 4PQUB 1TL1A 4DL5A 5C24B 5CYQB 4LSNA 1VRUA 5C42B 4R5PA 1RT2A 4PQUA 4WXWA 1S4FA 2IM2A 4Q45A 1RYSA 1VRTB 2BRKA 4H4MA 4ZP6A 1BQMB 2VG6A 4I2QB 4RW6A 3BQ1A 1Z4UA 4WFXA 1VRTA 1NHVA 4RW7B 1BQMA 4NLDA 2R8KA 3QLHB 3V6JA 4J9SA 3DLEB 4YQWA 3MR6A 1JLQB 3PHEA 4RW7A 4K4UA 3FFIB 3KLHB 3QLHA 5KG5A 1N56A 3DDKA 1CSJA 2B5JB 2UVRA 4NLVA 4Y2AA 1JLQA 3KLHA 4RW9B 5KT3A 3BGRB 1S9GB 4JV0A 4O4GA 5D3GA 4MK7A 4RW9A 3DOLB 1RT3B 5KFUA 4ECRA 1S9GA 2DPJA 2C2RA 1C1CA 5KFQA 3OL7A 2OPQB 3DOLA 5HP1B 1OS5A 4EO8A 1NHUA 4TY8B 5KG7A 5DLGA 2UVUA 4J9NA 4HKQA 2OPQA 3CJ4A 2FVRA 1JLEB 2E9RX 5F8HA 4EYHB 4ECUA 2BQ3A 4ECXA 1HNVA 5KFFA 3DRSB 1JLEA 4ZHRB 1S6QB 4IQXA 4MKBA 2IM1A 2FJVA 4KHRA 4WFYA 1TKZB 3KHHA 3RAQA 2E9ZA 4TLRA 1S6PA 2RDJA 2AGOA 1S6QA 4F4YA 3KK3B 3DRPA 1UWBB 2JC1A 4O3QA 3C6TB 5KFEA 5L1LA 4J9PA 5KFAA 5KFVA 1FKOB 5KFNA 1RT4A 1UWBA 3Q8QB 3KLFB 3C6TA 2V9WA 4KE5A 1HPZB 2YNFB 3KMSA 3FRZA 4I2PA 1C0TB 3DRRB 4QWEA 1C0UB 5KFPA 3MFIA 1FKOA 3MEEB 3KLFA 2YNFA 4O44B 1MU2B 4IDKA 5HBMA 4O3NA 3UPFA 4G1QB 1SH3A 3GILA 5EDWA 3MEEA 3IG1B 4O44A 4NCGB 3QYYA 2XCPA 1MU2A 3C6UB 2I5JB 3BQ0A 3PW7A 3IG1A 1S1UB 3BSCA 5C25B 4F4WA 3C6UA 2AGPA 2I5JA 1RTJB 1DLOA 3MTKA 2DPIA 1S1UA 3DYAA 3Q8SB 1HYSB 2ASDA 4LQ9A 3T5JA 5C25A 2WOMB 1IKYB 5L1JA 2W9AA 4TXSA 2QV6A 3MR3A 4KO0B 4Y3CA 3GV7B 3KHRA 2WOMA 5EWFA 2JEFA 3KHGA 3I0SB 4ECYA 2HMIA 4YMEA 3DI6B 3M8PA 3G6VA 1C1BB 1HNIB 3DOKB 5KT4A 3I0SA 3RAXA 5DG7A 3D28A 4Q43A 2EC0A 3LALA 1SUQB 1KHVA 2AWZA 3TQ1A 4X2BA 2BRLA 2WCXA 1U09A 4EBCA 1S10A 1C1BA 3T19A 3DOKA 1TQLA 4ZPBA 4ZMMA 3KK1B 4K4WA 2HNYA 4QWBA 2VG7B 1N6QB 4ICLA 2OPSA 5FDLB 2UUWA 5KFIA 4EBDA 3DLGB 1N4LA 2VG7A 1JLBB 1N6QA 2QE5A 4ID5B 3H5SA 5KFXA 4DL4A 3CO9A 2XGPA 3H5YA 2R2RA 1JLBA 2HNDB 5KFOA 3M8QA 4ID5A 4EO6A 3IS9A 2BR0A 3LP0B 3MFHA 1LWCA 1LWFA 3I0RA 5KT2A 3KLIB 3IGNA 3Q8PB 4K4TA 2YNHB 3LP0A 3M9MB 2FLPA 3BSOA 2D3ZA 3H59A 2R2UA 3KLIA 5K14B 2IC3B 4RNMA 1KLMA 4H54A 2AX0A 4FS2A 2YNHA 2RF2B 5KFZA 5EWEA 4XO0A 4IR9A 1S9EA 1FKPA 1RTIB 2IC3A 5K14A 4ED6A 4ZP7A 2RF2A 4LSNB 4OL8A 1VRUB 1RTIA 4KV8B 4R5PB 3BSNA 4NLRA 3QGGA 3GIKA 2IBKA 3IGVA 4PWDB 4H4MB 1ZTWA 1JIHA 5JXSA 3V6HA 3NMAA 2VG6B 4KV8A 4RW6B 2IJNA 4PWDA 1LW2A 3TAMA 5T14A 4RUAA 1RYRA 2IMWP 4PUOA 3H4DA 4O3OA 2OPPA 3NGDA 2JEJA 2HWHA 3CJ3A 1S0OA 5DQGA 3H4BA 3CJ2A 3RBEA 1HQEB 3ITHB 3KJVB 2HAIA 3T5HA 4IKAA 2YNGB 4O4GB 5D3GB 5EUHA 4HYKA 3MEDB 3KMQA 3BQ2A 1HQEA 3Q8RB 1GX6A 1S97A 3ITHA 3KJVA 1C1CB 2YNGA 1ZETA 3MEDA 2FVQA 4RU9A 1S0NA 1DTQA 4IRKA 1FK9A 3QIPA 4NLYA 3N6MA 4ED3A 4H4OA 4EYIB 5I42B 4XPCA 4NRTA 5KFRA 5KFYA 3NAIA 2VA2A 4IRCA 4I7FA 4WE1A 3KOAA 4F4ZA 4DG1A 4EBEA 1HNVB 2FLNA 5I42A 3QO9B 4NLGA 3HVTB 5DG9A 3MR5A 3E51A 2XI3A 4WYWA 3CVKA 1S6PB 4WYLA 4JUZA 4R8UB 3QO9A 4QWDA 4IFVB 4MK8A 4ECQA 3HVTA 3DRPB 3V6DB 4RUCA 4Q8FA 1IKVA 4IG0B 3KK2A 4ZVFA 4XPEA 4R8UA 1K1QA 5KFWA 2B43A 4IFVA 3NL0A 3V6DA 1RT4B 5J2QB 4IG0A 3HVWA 1S1WA 3PW2A 3RB3A 2W8KA 4I2PB 1TP7A 4IOBA 2D7SA 2W8LA 2WONB 1LW0B 5J2QA 4IR1A 1TVRB 3H5UA 3M9OB 5HBMB 4IDKB 2BANA 2F8EX 4DL3A 4IG3B 2WONA 1LWEA 1LW0A 1J5OA 1N5YA 1RAJA 3CDWA 5C5JA 1W25A 4ZPAA 1TVRA 2W9BA 1S0MA 1RT1A 1WNEA 3LAKA 4IG3A 4MK9A 5KG1A 4J9RA 2AQ4A 2WB4A 5KT6A 2RKIB 4ECZA 4O4RA 2JC0A 3SI8A 2ALZA 3LAMA 2WHOA 1DLOB 4ZP9A 3DYAB 4RZRA 2RKIA 2HNZA 2R8HA 4URSA 4ZPCA 3OSPA 4NLOA 1REVA 3QZ7A 3HVAA 3DLKA 1C2PA 5I3UA 1JLCB 1JXLA 4F50A 3KLEA 4ZVGA 3GQCA 2ASLA 2HMIB 3GV8B 1TKTA 3M8PB 3MR2A 1JLCA 2FLLA 4MIBA 4URGA 5JUMA 1JKHA 4ECWA 1QE1B 4QWAA 4KFBB 3OSNA 1KHWA 3PW5A 3MECB 2B6AB 3JYTA 3LP2B 3OLBA 2WK4A 3OHBA 3T5KA 2HNYB 1QAJA 3RBDA 1QE1A 1TV6A 1S1TA 4IH7A 4KFBA 2XCAA 4NLTA 4ICLB 1BQNA 2OPSB 3LP1B 3MECA 5KFJA 2B6AA 3GIJA 3LP2A 4DL6A 5KFTA 3LP1A 1HQUA 3CJ5A 3OL6A 4K4YA 2YNIA 4URQU 2RDIA 4QPXA 1T05A 4QW8A 3M8QB 2BQRA 3IS9B 3FQLA 3QGHA 1LWCB 3M9NB 4ECSA 1LWFB 3I0RB 3DMJA 5F8MA 1DTTB 3N6NA 1XR6A 4ZVHA 2V4QA 4RW8B 4KB7A 4TYAA 1NNDA 4NLXA 4IRDA 2JLEA 1DTTA 4RW8A 3RB4A 1KLMB 3CDUA 3TVKA 2ZE2B 3E01A 2AGQA 3KNAA 1RT5A 5J2NB 2W7OA 2ZD1B 4ED8A 2R8JA 1S9EB 1FKPB 5KFMA 3D5MA 1JLFA 3H98A 3PZPA 1RT7A 2ZE2A 3DM2B 4ZPDA 3VQSA 2W9CB 5J2NA 2ZD1A 3FQKA 3PJXA 4Y2CA 4YP3A 2ATLA 4JV1A 3DM2A 2IM0A 2W9CA 1SH2A 1IKWA 1ZTTA 5KFGA 5J2PA 1S48A 4ED2A 2CKWA 1EETA 1LW2B 3TAMB 4NZ0A 4Q0BB 4PUOB 4NYZA 5F8IA 4WZMA 1S9FA 2OPRB 3LANA 2OPPB 2YKNB 3OL9A 4JV2A 4IH5A 4G3IA 3V4IB 4Q0BA 5L1IA 4FBTA 1JX4A 4KHMA 3IRXB 2OPRA 4DL2A 2VG5A 1QAIA 2YKNA 3V4IA 5J2MA 4ED0A 2FVSA 3IRXA 3V81A 4Y34A 4U7CA 4R0EA 2ASJA 1MMLA 3T5LA 2WTFA 3NKYA 4NLSA 3QGIA 3EPGA 3T1AA 4K4SA 5HROA 3I5AA 2IA6A 4KKOA 2R2SA 2FVCA 1SV5B 4ECTA 3CDEA 1DTQB 1TKXA 1FK9B 3QIPB 4ZP8A 3H2LA 1R0AB 3NAHA 4H4OB 5C24A 2V0NA 5CYQA 2XWYA 2O5DA 1SV5A 4I7FB 4WE1B 2HWIA 5KFCA 5C42A 4J9QA 3MEGB 4DG1B 2UVVA 1R0AA 4GC7A 1YVFA 2D41A 5L9XA 1TL3B 3BSAA 3MEGA 4I2QA 2ILZA
chains in the Genus database with same CATH superfamily
1CQMA 2RQKA 2ZH5A 1V3ZA 1RHQB 3ISNC 2B5JA 3A8IA 2Q43A 2GA7A 3IWLA 1SL2A 3FMBA 4X4QA 4JI5J 4B3OB 2GMLA 2DCUB 3KUHA 2OMOA 1KWMA 2R8GA 4ED1A 1YJ7A 4LFAJ 5K8MA 2AD9A 2CDQA 4FS1A 1S1VA 1HKAA 1KFDA 3DOMB 1M5SA 2VL1A 1FNXH 2DD8S 4YDXA 1BQNB 5KTQA 1XN9A 2JOQA 1HQUB 3D0GE 3BJYA 2K1RA 4CYUA 1NM2A 1QSYA 2F4VJ 1Y11A 4TYBA 2HRUA 3BS9A 4QZVB 3W9JA 3P4UB 2GO9A 4L72B 3SXLA 3KG0A 4BDPA 2X3DA 3DLHA 2APOA 1ULRA 5KG0A 1ZS6A 2W7PA 3QSYB 2KT5A 3OHAA 4CT8A 2VJVA 3FSIA 5ETSA 4PQUB 2IYGA 1VK3A 2UP1A 3CCTA 2UUBF 3ILOA 1BQMB 4LFCJ 1Z4UA 1TUVA 2W7AA 1RU1A 4M5HA 2B5JB 2GMJA 5B0AA 1RWKB 2E5LF 1S9GB 1W2IA 3OL7A 5DDRC 3BGUA 5DZ7A 1RACB 3TARA 5D0HA 1FRJA 4LF5F 3DRPA 5KFAA 4PWUA 4NWBA 4I2PA 1ZA2B 2CZVC 3P8BB 3FBFA 3MEEB 1YGYA 2YNFA 4O3NA 2COLA 4O44A 4DPYA 3BQ0A 5E2QA 5E33A 1KEKA 3C6UA 3JQJA 2VICA 4CO1A 4TU9A 4F2SA 3IRWP 3W1YC 4ELVA 2ZWOA 3I0SA 5JVGQ 2CPFA 1U09A 4X66F 4ZVTB 4LVNP 1U48A 2AYMA 4UOGA 4ZVPB 5K8PA 3AXKA 4NMLA 4DFMA 3CO9A 3H5YA 3UI3A 4EO6A 3MFHA 1R3NA 3KLIB 4V19J 1X4HA 3GFHA 2FJEB 3GFZA 5KFZA 1EB0A 1B70B 1UA1A 3DLLQ 2DK2A 1NB2A 1RKJA 2DNNA 1HBOA 4IO1A 1NDPA 4ALZA 1DY3A 2IMWP 4YB5A 2OPPA 5DM6Q 4HACB 2IVFB 3VALA 4KY3A 1KLNA 1U4BA 4U8YA 1MROA 2DCLA 3AD7C 3N6MA 2IMOA 4N47A 1SJ3P 2FLNA 1ZBTA 2QMWA 4JUZA 2H3EB 3LF0A 3V6DB 3DRPB 3AFGA 3KK2A 1T8EA 4I2PB 4OX9J 1RBAA 2XLIA 2AIRB 3H5UA 3W63A 4IUFA 2F8EX 3EZOA 3FJ2A 1N5YA 5C5JA 5DJBA 5CABA 4JYAJ 5FJ4A 1IJFB 2DXFA 5KG1A 1P1TA 1UEUA 3C66A 2ALZA 2BABA 1FWKA 2LEAA 3W8PA 1N52B 5DZ6A 3TVZA 1JXLA 3IA0A 4WWSA 3R9LA 4ECWA 2QL7B 4QWAA 3PW5A 3GE9A 3FRYA 4B3RJ 2XCAA 2DY1A 3LP2A 3BN7A 5E41A 8RUCA 2BQRA 3QGHA 2QYGA 3M9NB 1N8RT 1O51A 2C2MB 1YBAA 4PXDA 2XMVA 5HMZA 1Y00A 2I38A 2ZD1B 3QJJA 2X1AA 3CC4S 2ZE2A 1PILA 4NYOA 4BLGA 1IKWA 2HBRB 3AJDA 3A4TA 4B9MA 1IBLF 1S7HA 2OPPB 2AF6A 3HP6A 3SV3A 2GV1A 3V4IA 1WI8A 4HHJA 4R0EA 3SYZA 2P2CB 2WAQD 1R43A 1MROB 2ZVIA 2IA6A 2ZUAA 2ZJRQ 4UZBA 1YVFA 4P72A 3BSAA 3MEGA 1EKRA 2GNKA 4DSJA 3I96A 3GP9A 3G6YA 2QA4S 3KK2B 4FPRA 3BR8A 3ETOA 4CM0A 3L3CA 3QT7A 4DR3J 3KDOA 3SV4A 1F3VA 1RWPB 1N5YB 2VZ9A 3VQTA 2XWXA 3PVXA 2VOPA 5A2QY 3LTOA 4ZJLA 4RNHA 1E6YA 1VQKS 2YKMB 3KTQA 5KFDA 4RU2A 3R97A 4B9UA 5BR8J 1NSPA 1C0TA 1TUGB 2XYPB 4WK3A 1S12A 5KG6A 2B9YA 3PXGa 2JEIA 3OLAA 2HVHA 2J0SD 5KG2A 1RTDA 4MIAA 2OEJA 3HULA 2KJVA 3HHEA 4LIWA 1X0PA 2ZKUA 2MXYA 4DR4F 5C2CA 2KFZA 3NBPB 3ULHA 2RMLA 1IJEB 2PA3A 1IKWB 4MFBA 4J9KA 4G1IA 2OEMA 1DZ5A 1Z2ZA 2LECA 2UUAF 1J5EJ 1M5OC 2V2VA 2W4CA 3W64A 1PBAA 3CUNA 2WSEC 1FXRA 1C4CA 5DQIA 3ISND 3CJRA 4DDFA 4NLWA 1HWUA 4WXWA 1GFWB 3P6YC 4ZCIA 3MMCB 2KRBA 2EG2A 1VLOA 3R2DJ 3GPAA 2JX2A 1D09B 3MR6A 2CJKA 1X5PA 4C7QA 3DRYA 1UFLA 1SI9A 3GWCA 4HL9A 5KFUA 4ECRA 5AE1A 2DPJA 3BF4A 2Y3YA 2KXNB 1E6YB 2ADCA 1NJYA 1NSAA 4DQIA 3M4XA 2LXUA 2R7QA 1S5ZA 3M6XA 2ZFHA 3G71S 3KLFB 1C0TB 2A10A 2BM1A 5CCLA 5CH7B 2X7IA 4JI6F 2F8MA 4F4WA 1NK7A 4DUZJ 4N77A 1U24A 3MR3A 2FZKB 2WOMA 4F04B 2QL5B 1L3VA 1NJXA 1C1BB 2DTJA 2QN6B 4B9VA 3WIVA 2B4UA 2NCKL 3B78A 3J80U 4GVLA 1RGVA 3MMBA 2FY8A 2QE5A 3NG8A 2R4FA 2YX1A 2LA6A 3UWTA 2DNYA 4CTAB 4WU3A 4C97A 2C2ZB 2AX0A 3WDOA 4HDHA 1ELOA 1N0VC 3RRHA 2I2YA 5E7OB 2H54B 2KYXA 4F3OA 2JH3A 3DCAA 1W7WA 4ZVSB 2UXBJ 3FVYA 5HATA 1H2UX 2QSFA 1S0OA 3H4BA 1AZSB 3T5HA 2HAIA 4U96A 2OIHA 4USIA 4LBHA 1NK8A 1WKJA 1CJKB 2KM8C 4ETXA 2HQDA 3MM5A 1OO0B 2LU1A 1RBOB 4IRCA 2HRTA 2CA9A 3BKTA 5FLXU 3LOUA 1LEOA 2AMCB 4L75A 3D6FB 4AL7A 3CJ8A 2ZNZA 4IOBA 1EZZB 1F0XA 1V3SA 3I31A 4DFKA 1TVRB 1WF0A 4DU7A 4QYZJ 4Y65A 4P10A 4UY8T 2AZ1A 4A8FA 3R1HA 1ZZNA 1N32J 1VQLS 3GQCA 1KVKA 1GQEA 2GFFA 3UCZP 4URGA 2VC1A 3CPWR 4QJVA 5D77A 2HGLA 2B6AB 4C11B 4NZ7A 4OZ1A 5KFJA 4ZOSA 1S72S 5KFTA 5LXYA 1NKBA 4QW8A 4ZKAA 3ZZUA 2PI5A 4QQBA 4BS2A 2JLEA 2HHWA 1Q53A 2K7JA 2YWGA 4QU6A 3SSRA 5KFMA 2LU2A 1O8BA 3VQSA 2UXCJ 4WU2A 4LF1A 3MOJB 2U1AA 4CH1A 4B3SJ 2R7UA 5B0BA 4WIIA 4BC9A 4OZ3A 2LEPA 3JTOA 4FBTA 2RU9A 2G1HA 2ZNYA 3M8RA 3T1AA 5H1SV 4HI2A 1SV5B 3JXOA 2KTQA 1OYDA 2G2YA 3H2LA 4HVZA 9RUBA 2K8GA 3C14B 3QMQA 1WHYA 4DPXA 2E1PA 1NLKL 2ZEJA 5ETVA 4NLQA 3IN5A 5BXIA 2DHHA 1ZM2A 1YBTA 2L48A 3MUMP 2A0FB 1U6BA 1RQ0A 3UVJA 3R27A 5D4PA 5HSPA 2V8HA 3NGTA 1S1XB 5DLFA 1ZAWA 5IT4A 1VOMA 3JB9k 1R27B 1C0UA 3TRGA 1VC6A 1GH8A 5CYMB 3TAPA 5L46A 1HNXF 3HJFA 4CLWA 4DN9A 4HH0A 2J9DE 4KO0A 1WG1A 3MCNA 4JB8B 3AJ1A 4UOFA 2D3O1 5LL6d 5LMUJ 5ETMA 1XBWA 3KK1A 2EK6A 3LGNA 2PI4A 2MKCA 5LXRA 3EE3A 3CJKB 2C22A 1RK8A 3IP0A 2FPHX 1NDLA 2KZZA 2QJ3A 1FDAA 5L1KA 3G8TA 2A6MA 3GONA 3EM1A 2YKQA 2RVJA 2J0QD 1FFWB 4I1TA 1QY7A 4P75A 1PAUB 2CDRB 5LM7E 4UUWA 3NCPA 3DDNA 3NCQA 4NXNF 2R42A 2IY5B 2DRBA 3THVA 4L3NA 2EBGA 1NHUA 5KG7A 4NCAA 6FDRA 1ZM3A 2YX7A 4A8OA 1VHIA 2ZJPQ 4IQXA 3MD1A 3VAGA 3QGPA 3UVJB 5IM0B 2JFDA 2KU7A 2BOAA 4JI2F 5DO2A 2DNZA 1RT4A 4KRWA 1C0UB 4AUKA 5KFPA 2AYEA 4DV2F 1MU2B 1IR0A 1OPIA 4OI6A 1NDKA 2WBMA 3W9IA 1GAOA 1DLOA 3D0IE 2EFQA 3TJAA 4ZIVA 4KO0B 1HBUA 2XLKA 4GKJJ 1EHWA 1B99A 1XERA 1K8AT 1HNZF 2AWZA 4X2BA 2WCXA 3KK1B 3GR0A 1O5JA 2OPSA 2ZBIA 2VG7A 1N6QA 2RU3A 5IWAF 1N36F 1F2GA 3VAIA 3BO2A 2R2UA 1FI4A 3W62A 1IN0A 2LDIA 1QSSA 4ZP7A 2A1BA 3BSNA 1I94J 2C2KB 2BJ7A 1V5VA 2KG1A 2MQQA 2BJEA 4OFZA 1RWXB 2O66A 3TZZA 2HS4A 1FRMA 1Q7LB 3OR1A 5T41A 3KMQA 3AODA 3K17A 2G0IA 1ZM4A 1ZETA 2QGFB 3NP5A 1T0TV 4WF9Q 2GW8A 3NAIA 4LRCA 4WE1A 3ENQA 2AP6A 2J8AA 5C7PA 4C8KA 1UPPA 1Q16B 4WYWA 4F8RA 3B82A 4IG0B 1FJGF 3POTA 3PYEA 3NL0A 1RT4B 1KS2A 3NGKA 1KQGB 5A8KB 1VQMS 4IR1A 3HM9A 4FZVA 5G0RA 2WVBA 1S0MA 1HW8A 1KP6A 5ETQA 2M2BA 3BGFA 2DEIA 2JC0A 1DLOB 2F63A 2HNZA 5IC6B 3UE2A 1R6VA 2RAQA 1HBUB 3GV8B 2AZ3A 4EWTA 1WORA 4C0BA 4LJMA 4M5MA 1HHSA 1TV6A 1X5OA 3TUJC 2OPSB 2CZ9A 1PBUA 2L9WA 3LP1A 1U26A 4K4YA 2W4DA 3CCMS 2HHSA 3QJLA 3M1VB 3MTJA 4I64A 1U6FA 3C16A 3RU0A 4RW8B 4BBYA 1UA0A 1NNDA 1UETA 4Q5VA 3GU0A 2CG8A 2CPIA 1AROP 3DM2B 2ZZMA 5E3PA 3SSQA 4ZIWA 2UUBJ 1KONA 3W5YA 3GLJA 4U7UK 4Y34A 3OR1B 1HFEL 2E5LJ 4E0DA 3OUYA 4WE1B 1M5HA 2VIHA 3RAMA 2BACA 3MM8B 1H7WA 4RR5A 5DGBA 3L7PA 4JV5F 3POTB 4LF5J 4IFYB 1VQ5S 5FIIA 3MHYA 4P6QA 3S8SA 4U7UD 4NL5A 1B3TA 5F8JA 4K50A 2HNZB 2GIQA 2GC8A 2UV8A 1NMEB 2MHEA 1T03A 4M5KA 3JSRA 1TV6B 2EFOA 4X66J 2Y1RI 3T6JA 1NAQA 2Z2ZA 4CT9A 2MZSA 2O3DA 2W2PP 2KM8B 4LSZB 1VQYA 1PYTA 2J0WA 1UW4A 2XGQA 3DI6A 3HHLA 3VF0B 4EK2A 1HNIA 4ATNA 4G1PA 1GX5A 2LYVA 5EWGA 1QSLA 5L8RC 4DLEA 4UTGA 1CJTA 2JFKA 3HHLD 4LF4F 1JJ4A 2XQCA 2GHVC 1HIYA 2XZDB 5DGAA 3GFYA 2E1AA 1X4EA 2BJ9A 5D15A 5GAEU 3MWBA 1Q8LA 7AT1B 3G6XA 1SC3B 3N0VA 2MY7A 3G8QA 5HMWA 4H4MA 1FD8A 3FKBA 3QLHB 5B0CA 4CLFA 2IYIA 4RW7A 3G2XA 2ALYB 2ZBPA 2ASYA 1YJ9S 1VS3A 2CPEA 2RS8A 3LWLA 3ISZA 2WB1D 2OPQB 2QSWA 1V9OA 2MY8A 2KXFA 1S6QB 2E9ZA 5I3QA 3J81j 1PG5B 4UW2A 3MXHP 2CWXA 2B8QA 3C6TB 3CCWA 3UN5A 2HFNA 4QWEA 1OWXA 1NK0A 3HSZA 2JLFA 4WFBQ 4YHHF 3B6BA 2GJ2A 1ZM9A 1X4AA 2EXUA 3K5PA 1EQMA 2YH1A 1X0FA 4GKKF 2JEFA 3DI6B 1N88A 3HHLB 2B0GA 1HNIB 5H9FK 1FDNA 1EJ7L 1PSDA 2HKEA 2C3MA 1CJTB 2N7YA 2EG1A 1Q78A 1JLBA 1IBLJ 5KT2A 2E1CA 2YWWA 5E3QA 3Q8PB 3UD3P 4P2SA 2RF2B 2FHJD 1RTIB 5IT0A 3HSDA 1U0HA 2ZH8A 4KV8B 3ZTSA 3IGVA 3WQPA 5JXSA 4H4MB 3RR7A 2JRSA 1LW2A 2AJ1A 3DGVA 2V63A 3CULA 2IPOB 1Q7YT 1WOSA 3ITHB 3BKFA 3CD0A 4CH7A 1AA1B 3MEDA 4NLYA 2BA9A 3SZ2A 4EBEA 2ZKTA 3QO9A 4QWDA 3EJMA 1UL3A 3PW2A 2Z4PA 1P9QC 2BW2A 2VH7A 4P52A 1YK9A 1FRXA 3LAKA 1NK4A 3DKDA 4O4RA 3MCSA 4URSA 3C8YA 3DLKA 1JLCB 2LEBA 3SQOP 1VBZA 4ZK7M 1JKHA 3K5LA 1QE1B 4E98A 4DZ6A 4DR4J 2M7SA 3Q2SC 1U1MA 4LF6F 3GZ7A 4ZPVR 3OPKA 3V4MA 1XTZA 4RX6A 3S01A 1WKKA 2UUAJ 4OHWA 1AW0A 1Q95G 4PXCA 2W7OA 4X4VA 1KVJA 1RT7A 3PJXA 2ATLA 1MMNA 3L4BC 1HR0F 1S48A 2GQCA 1LW2B 1S9FA 2OPRB 2DH7A 3LANA 3W2VB 2HS0A 4DX6A 2OAUA 2FVSA 2F1FA 3WBZA 2DNOA 1YJUA 3K2YA 3W9HA 3NRBA 2Z8QA 2HZAA 3TZYA 1R0AB 4R0JA 5HQ8A 3T6BA 1GMUA 3G4SS 1NKCA 4M5DB 2KDOA 2Z0GA 3FNNA 2OO4A 3ADAC 5LMNF 2V4RA 1LXJA 1RTHB 1R7IA 4J9LA 2NUUG 3N5FA 1QUPA 3FDSA 1FJEB 2H5EA 4JI6J 1KNZA 4DSLA 3DLKB 5T7LA 4TVAB 2ZOMA 4OJHA 1SIWB 3QT5A 2MKKA 5J1PA 2Y9HA 1L3TA 1JKHB 2G13A 2M8DB 4U6PA 2OELA 4K4VA 1T9WA 2XYGB 1FWLA 4G1QA 5HLFA 2BKPA 2XC9A 2N4DA 5A2QU 3KWMA 1RKIA 3O3LA 2MMYA 3N6LA 3BH6B 3H5XA 3VGTA 3ICLA 1SKWA 1RT7B 5DDOC 2AT1B 3OVSA 1TK8A 2D3UA 1N0UA 3I5CA 1I6JA 3I5BA 4NPOA 1UVNA 2E7VA 4NA1A 2HHXA 2HBYB 3CF5Q 4J9VA 3EYZA 2RNEA 4YB1P 4OZLA 4KGMA 3GIMA 4MKAA 3KHLA 1Q8IA 4DQSA 2ZH1A 1XJWB 1TL4A 2UVWA 4YY3F 2KG0A 4JI3F 5KFLA 2WW8A 1K1SA 2XHWA 2W2OP 2L3MA 1VRTB 1RB0A 2A2DA 4C9DA 3U1LA 1VQ7S 4LF9F 1LV5A 1RHRB 4YB7A 2G4BA 4RW9B 5KT3A 1UVLA 3DLJA 3R7BB 2LXFA 2RH3A 3QBCA 1IQTA 1DFDA 1U02A 1OS5A 3E3XA 2BDPA 3I6PA 2ZUGA 1K73T 1JLEA 2IM1A 4C3KA 4KHRA 5T7LB 5CAAA 3TYTA 3DDIA 2JC1A 2AEFA 2V9WA 2DR7A 4LRFA 5IQ6A 2NSCA 3TO8A 3MFIA 1XMQF 4ZCKA 4G1QB 4D3GA 2ZH7A 4DR2F 3SDEB 1JXEA 2I5JB 4Y6IA 5I3PA 1S1UA 2BX6A 4JI4F 2ZHBA 5EWFA 3FBBA 2F9JA 3H0PA 4F4KA 3D28A 4C0OC 4X62F 3W61A 3GJQB 2BZ2A 2V5HG 3M2RA 4J5OA 2ROPA 1FE0A 3R5BA 4CM2A 3O5TB 2XGPA 2VDIA 3EGWB 1J27A 5KFOA 2B8PA 1AB8A 1QD1A 4USKA 1D9FA 2J9CA 3M9MB 2HFVA 1KLMA 4IR9A 3AOAA 2QMXA 1P8GA 1SKRA 1KD1T 2L08A 2JZ5A 3MPUB 1QAXA 3ZNJ1 1FCAA 3G82A 2YQ1A 4IKAA 3OD2A 3BDPA 3QFWA 3VHQA 2LQBA 4NLGA 1B0VA 3MR5A 2NPFA 1FNOA 1WF2A 3G87A 2CADA 2B43A 4IFVA 3RB3A 3AB4B 2KHDA 3WIUA 3PKYA 4OI3A 4DCJB 4EU0A 3QAUA 4FXWA 5AT1B 5CQGA 4DUTA 1JJHA 2XO7A 2WB4A 5F0UA 2XS2A 1SC6A 5ETTA 1HNXJ 1ZH5A 1AXQA 2OJ3A 2VPWB 3KLEA 5KOXA 2FHOB 3ZTOA 1F9EB 3MECB 1WC5A 3FSXA 5E0OA 1LXNA 4KR0B 4AD6A 3PIPQ 4NI2A 4P9SA 3OL6A 2DNRA 3ET6A 3FQLA 2FZGB 3DMJA 4I69A 1KLMB 3K5OA 3I9V9 2M8HA 4Y2CA 2F8HA 3MM6A 1B7YB 4ED2A 2XSJA 2YKNB 4DV1J 5JVHQ 4MYUA 2XULA 3IR5B 4DSKA 4LR9A 2N82B 3QGIA 2XS5A 3A12A 2EK1A 5GAGI 2GQ2A 4WFAQ 4RKUC 5KFXA 4NXNJ 4C8MA 1U1KA 3D3BJ 2D41A 1VBXA 2KVQE 1IQZA 2R2TA 1JK9B 1D9DA 4YR0A 1WD6A 2KFNA 2XBPA 1IM4A 5GADI 1JNRB 5J1EB 3A8EA 1M1HA 4WFZA 1QDUB 4JI2J 3BGRA 1JLAB 4KBIA 5J1NA 3GIIA 4NLPA 1RXOB 1R0CB 2WVDA 2R7OA 2CJQA 1LOUA 4DV2J 4FXVA 1OIAA 1P9YA 1CPZA 4C8YA 4C8LA 2XM3A 4K4ZA 4RW4B 4DR7F 5ETNA 2QO3A 1HMVB 3KLEB 3MEKA 2ZC4A 4ECVA 1B7FA 2CXEA 3D3CJ 1RADB 2CPYA 1CG2A 2J8SA 2DGQA 1HNZJ 4GO7X 5ADZA 4NI2B 3OW2R 3K8VA 2ZDPA 3K58A 5ETPA 2NXNA 1QUVA 3DMJB 5IWAJ 3O6QA 1HYSA 2OH2A 3CIZA 4PPZA 1N36J 3EUNA 1A9NB 3UCGA 4LSLA 2WSCC 1BHNA 4ZVUB 2KT3A 4FF1A 3MM6B 2BVZA 1WC0A 4AE5A 2FY1A 5FDLA 3KLGB 1N54B 2D9OA 2A3JA 2P9EA 2FB0A 3BKUA 2GGPA 2FVPA 3M8SA 2OD6A 4O3PA 4HI1A 3D6MB 4FF3A 2PEHA 3DC2A 2IM2A 4ED4A 3EGZA 3BQ1A 3FSYA 3TX0A 2V4JB 5LSOA 4OQJA 2V34A 5H9EK 2CRLA 1B4SA 1FXLA 2V94A 2YWEA 2IIHA 2Z57B 3KLHA 1FJGJ 5HK4A 3BGRB 2DR6A 3DOLB 2JVRA 1T7PA 3U1NA 1BGXT 5DLGA 4OV6A 1AFJA 3PV8A 9ATCB 4EYHB 2LLZA 2HHVA 1UPMB 3TEHB 1YZ6A 4QIGA 5JMNA 1CQNA 4USMA 1EAYC 2E44A 1UWBA 4KE5A 1LFWA 2HEKA 4MMOA 4USVA 3AA9A 5D4LA 2YY3A 5HBMA 3UN3A 2MQOA 3FEXB 4WPAA 1Y5LB 3KYLA 1IUJA 3DN9A 2AGPA 2K3IA 2V50A 3Q8SB 1HYSB 4OI4A 4GMKA 5L1JA 3G8SA 1Q8BA 4FYDA 3DOKB 4ZLJA 4I67A 4CLZA 3DFEA 3BO4A 3W5XA 4OI0A 4ICLA 1GXLA 5FDLB 3D1QA 4A46A 3M8QA 4ID5A 3LH2S 5A8WA 3IGNA 2DNLA 2FLPA 2GGPB 3BSOA 3H59A 5K14B 2ATCB 2AV5A 5HL7Q 4RNMA 1VHFA 4H54A 2HHPA 3ENWA 2QC3A 4ITSA 1OQ6A 4K5SA 1GMWA 5LJ5Y 1VBYA 3QGGA 3V6HA 2O01C 3ZZZA 4PWDA 5GMEA 2BUNA 4WTYA 2GS8A 3G96A 2JEJA 2CNLB 2HWHA 5JJBA 4BCAA 1UJ4A 4JV5J 2VBXA 2VD3A 1P27B 1S97A 4AXIA 2ACMA 2X3GA 4LRBA 1RHMB 3HX9A 4ZDNA 3NEKA 2DYAA 4I7FA 2XMMA 3FBCA 3QWUA 3HVTB 4R8UB 4B3MF 3N79A 2MB0B 2GO8A 4ECQA 4ZVFA 3FCWA 4QCLA 3C19A 1UVMA 3KJNB 2WONB 1LW0B 3M9OB 5HBMB 3NLCA 4OHYA 2OFHX 3TA1A 4Z7CA 2KYZA 4WBFA 2RKIA 3OSPA 1XC9A 1H73A 2AJFE 1WUUA 1FEEA 1VQSA 2V67A 3QJPA 3JYTA 3B8HA 2B7CB 4IH7A 3CXCR 4ICLB 3GG0A 3LWMA 2ZH6A 4MYTA 2YWKA 3CJ5A 1RLDA 4QPXA 3M8QB 3I87A 2XMAA 4LF4J 5A8WB 1Q4RA 3TZXA 1UVJA 4WP8A 3RUBL 1Y7PA 2XY7A 1RT5A 4ZPDA 1OPZA 2XEXA 3MUTP 4FDFA 2H4YB 3CE8A 2MQ8A 5K9FA 3ZTRA 2V68A 1QVGR 3D6HB 2IRXA 1JX4A 3DXBA 2WVFA 3IRXA 3OXLA 4X84A 3CC7S 4S0MA 3HCXA 3ZZ0A 5U47A 3CDEA 2F65A 2OI2A 4KIAA 3T9ZA 4I7FB 3T1HF 4NRTA 2HAFA 1NH8A 3FEYB 1RAOA 2GIFA 1JLGA 1E6VB 2NPIA 3FFIA 2GVZA 3W66A 2HHHF 4FPIA 1FVQA 1WEZA 1T94A 4ED7A 1RT3A 4ZVRB 1IKXB 4DR6F 4QIEA 1XQIA 2HVIA 3NCRA 4YHHJ 1KOOA 4OZJA 4WXOA 1RAEB 5DM7Q 4Y28C 2CPJA 1QAYA 1H2VZ 4GKKJ 4DL7A 3JYTB 1DARA 2DGXA 2GJFA 5IFMA 1EP4B 2IJFA 2X1GA 1N34F 2DGOA 2AEMA 2UUTA 3SFUA 3BR9A 5LT5A 2HGMA 5CZXA 1RT6A 3WHIA 1YIJS 3IWXA 2B56A 3BBBA 3NGRA 1RT5B 3PG9A 2BE7D 3X3UA 3UDEA 2CZ4A 2PC6A 4EEYA 2DGTA 4TQRA 1WC6A 4OX7A 3S6EA 1NXIA 2JEGA 2GVDA 2N3LA 4RNNA 1AYEA 3JSMB 1JMTA 4OLPA 5HVFA 4NLUA 4QPTA 2WVCA 3CJSA 4HDGA 1DHMA 3IM8A 2DNMA 4DPWA 1NJZA 3FFIB 1YJRA 2GVZB 4DV5F 1WTFA 3GJRB 2EFPA 2JL9A 2PIIA 1NZ8A 1ZAVA 1H7XA 1RT3B 2C2RA 1QLNA 5ETKA 3A1YG 2XMUA 4DR1F 2YKPA 3AOBA 2WZ1A 3D6TB 3RZAA 1T95A 5EGYA 5L1LA 5KFEA 2BMBA 1FKOB 3W2WA 3PY8A 1TAQA 2FQQB 4LF7F 5EDWA 1KTQA 2FJBB 2I0XA 3CDBA 3QYYA 1T9TA 5IQQA 2CQ4A 2QLXA 4KJIA 4LF6J 3T5JA 2UXDF 4A8XA 4YMEA 1RUSA 2L41A 2J76E 4NXMF 2XZWA 2BRLA 3I32A 4ZMMA 2H5JB 2MSTA 2PT0A 4EZ6A 1HR0J 3TJ8A 4DL4A 1S77D 1VIXA 2GVDB 4RL1A 2O67A 3HZGA 1X4FA 1CJUA 2YNHB 2XB2D 3ENVA 3VTIA 3JSBA 1B0PA 1FKPA 4M5JA 4DUYF 2B9XA 3J7YI 2E29A 3DGPA 3CDAA 2CQGA 2IJNA 3TAMA 4Q2MA 5T14A 3HI9A 4O0NA 1NB7A 2G1DA 1UJ5A 5LMNJ 2VFTA 3HPOA 1SB6A 1Y5NB 3PEHA 2OFGX 4ED3A 4H4OA 4K8RA 5I42A 3PYDA 1BXNA 1RISA 1FX4A 1VQ9S 1IKVA 3T9NA 3IR7B 2ROGA 3W2WB 2RE1A 2W8LA 2IHR1 2H1YA 5J2QA 2ZDOA 2BV3A 2HLTA 4DL3A 2ZHOA 3CDWA 3SQGB 2QTWA 4L74A 4PXBA 1TTHB 4R25A 3OQ2A 2DO0A 3PX6A 1NHKL 2QX0A 3UFCX 3D54A 4IQMA 2HFOA 1FX2A 2YNIA 1FRKA 4OIXA 4ECSA 4PYDA 1DTTB 3N6NA 2V4QA 1IR1A 2HG4A 2K7KA 3RB4A 1R8PA 4YY3J 1FKPB 2CYYA 1R89A 3D5MA 4JI3J 2MLZA 3DGPB 4N56A 3J81Y 3TAMB 5D6GA 3LUYA 4Q0BA 3I82A 4LF9J 2J5AA 5HVGA 3FGVA 5J2MA 4B02A 3SBMA 1RJJA 3P3DA 3N5BA 1H98A 2DY9A 2OEKA 2KL8A 3P96A 4H4OB 3NOCA 4X4RA 1YBUA 4NA3A 2IRUA 3GSDA 2HW3A 4PG5A 2XI2A 3GJSB 1IKVB 3BPDA 4QIVA 3Q83A 3NWRA 1Y3JA 2BE2A 4C8NA 3P5BP 4IH6A 2BJ3A 1XMQJ 1RSCA 4CNZA 4TY8A 4DR2J 3AT1B 1CVJA 3NOGA 4YB6A 1S1VB 4DL0C 1NK6A 3EXYA 4FBUA 1RAGB 4QR1A 3LO3A 2DKOB 5MLCV 4JI4J 3PJWA 2DGVA 4HR2A 3PTWA 2H51B 3WC2A 1MWQA 4X62J 1QVFR 4O0IA 2Q3PA 2K1RB 4CYUB 2YNIB 3GYXB 2UZAA 1RWMB 2XS7A 4KYZA 2C2EA 2XG8A 5IXUA 4DMZA 3F0NA 5KG4A 4P7VA 1YJNS 1C4AA 2IAJA 1FE4A 3DXSX 1HI1A 4L73A 2OP5A 3M32A 3R5JB 3TA0A 2HNDA 3J7AN 1XWLA 1FTRA 5J2MB 4P7TA 2GX8A 4DWIA 1TFYA 1NK9A 5ITHA 3PYGA 1JWWA 4ENOA 4B9LA 2CJXB 2CNNB 1PYSB 1H3DA 4WFXA 4HT7A 1UFWA 1WC4A 3V6JA 1GT8A 3G6ES 2P6TA 2QLWA 2HZVA 3DDKA 1FFSB 1JLQA 2E5GA 4P2FA 4CO5A 4MK7A 5EN1A 1HWJA 2BKNA 2C1EB 2RT3A 2PMZD 4YDDB 2ZBCA 3FZBA 3GIRA 2FD2A 4TY8B 2MEWA 2OKQA 5IV3A 1HNVA 2EWHA 2CQCA 4WKYA 4A8KA 2HFUA 3A3PB 2HWTA 2BKOA 5KFNA 2YNFB 1FDDA 4O44B 1I3OB 3VAKA 5GAHI 1WHWA 1FRLA 1FDBA 3C6UB 4HHUA 4U9RA 4ZJOA 3LGMA 3OJSA 1G3OA 1QM9A 4TXSA 2QA2A 3I0SB 1NPPA 3KNGA 1WACA 3AOCA 1TQLA 2HNYA 4QWBA 2H4WB 4CZCA 1U1QA 1HHQA 5KFIA 3TAQA 3A3NB 4Z2XA 4L76A 3M32B 3PHTA 2HNDB 2BR0A 2B9EA 1WSVA 3H2UB 2DHSA 2IC3A 4OX8A 1HBOB 3WC0A 3D9BA 1TELA 4EFAC 1GMVA 2DR5A 1NSKL 4PUOA 1P1LA 2RQ4A 4O3OA 3GMGA 2NXUA 3NGSA 5HMXA 3IFEA 1Q5YA 4IOCQ 2VASA 1SPBP 3BQ2A 1HQEA 2YNGA 2MQMA 3QIPA 1QTNB 3EDRB 3HD2A 1DQAA 1HNVB 4C2MA 1NZAA 4KHPF 1WC1A 4WYLA 4DR7J 3RBXA 3V2UC 2HVDA 3UN2A 4KC5A 2W8KA 1X4DA 1RCXB 3NNAA 1RT1A 3PM9A 4ECZA 3ZTPA 3Q22A 2DRDA 5AE2A 2D3OR 1HA1A 4ZVGA 3PJ9A 3QAEA 1TKTA 3R5CA 1T9XA 1VQNS 1NRKA 3LP2B 2HNYB 2B4VA 4KFBA 3KG4A 4MIWA 1SKSA 2ZH9A 3CMES 4TLQA 4CNYA 1PAEX 2HVEA 4RJVA 1YJWS 2VKRA 1WF1A 2KXHA 2ZE2B 3U1MA 2R8JA 2G2OA 1HBNA 1RAHB 2V2KA 4OZNA 2W9CA 1F5BA 4PUOB 2QZ8A 2Y8WA 3V4IB 1QAIA 1HLWA 2J0XA 3WX4A 4UT4A 4O23A 4I4BA 4Z7YA 2QLBB 2DXEA 4ZJQA 4F25A 5SZTA 2HURA 1TKXA 1KTVA 3QIPB 2HWIA 5C42A 3MEGB 4A4JA 4Q7AA 3JSYA 4JOUA 1TL3A 1WSRA 2DGSA 2MTLA 1WELA 5DRKA 2IM3A 2MZQA 2VQFF 1D3WA 4QWCA 2D74B 3U7JA 1NBEB 3TUPA 4CO0A 1RT1B 4DF4A 4P74A 6AT1B 1FFGB 2J6UA 3CJQA 4PYAA 5HQLA 1GTHA 2DO4A 4TY9A 4USWA 5IZHA 4RBTA 3CWJA 1TZ0A 4RNOA 4W98A 1TKTB 3TNVA 1O0PA 3AD9C 3GFXA 4JBCA 2CPDA 1RTDB 3CT9A 4DX7A 3PEJA 1YRUA 1PJ7A 2PFFB 2A6OA 1VIOA 1TUWA 3RB6A 1RTJA 1LQ9A 2VFVA 4BC7A 1Q79A 4WZQA 4DSEA 4MFBB 3K89A 5KFSA 3EZUA 4KGXB 1X5TA 2AKWB 1GEHA 2XY5A 1KDNA 2DGWA 3L95X 2LVWA 2KHCA 5B7WA 2R7XA 2VQEF 2V8PA 3D68A 1TKXB 1Q82T 1TL1A 1R6YA 4X4OA 2RSQA 3SIPB 5C42B 4PG8A 1RT2A 4ZP6A 2BJDA 2JVOA 3MUVP 1TU0B 1NPKA 3D67A 3CTRA 3QFHA 5KG5A 4B3MJ 3BBCA 3MAAA 4CI0B 2DHGA 5D0RA 1C1CA 2ZOFA 4DU8A 1WOPA 5CCMA 4HKQA 4K5RA 2RB7A 2DT9A 1NKEA 2KRRA 2YQ0A 3M8ZA 3LPYA 3DRXA 1VDHA 3IAM9 1BD6A 3H2VE 3FRZA 4F0MA 3IXQA 2PGCA 2IDLA 4IDKA 1SH3A 1M0SA 2KH9A 2WBRA 1F5AA 3KFWX 4XK8C 4KTQA 3IG1A 3B4MA 1RTJB 3PDNA 5C25A 4F7VA 2WOMB 1CC7A 2VHGA 2C3UA 1RWNB 3KHGA 4J91A 1BWVA 3M8PA 2MZTA 1BLUA 3DNCA 3M2UA 3T19A 3MMBB 4K4WA 4LBIA 4ZPWR 2CIMA 4GVBA 3GCXP 1M1GA 4PAAA 1XEZA 3F56A 4K2XA 1OY8A 3LP0A 2F5GA 4I0WA 4JI8F 1U47A 4CLTA 2M0GB 4XO0A 3MOZA 1VQPS 1MWYA 1S9EA 3PIOQ 1CJVA 4OYZA 3OBIA 3JAMU 3GIKA 4Y0FA 3EVMA 1SL0A 3T1HJ 8AT1B 1RYRA 1JQGA 4HTIA 1UVKA 1XNQF 2FHKA 3BH7B 1F3FA 3MAAB 3ZNUA 4HYKA 2KVIA 5EUHA 2HHHJ 3MM5B 3AY0A 1UAWA 3KJVA 1C1CB 2FVQA 2GAHC 3HHLC 4OJ1A 4ILMA 2MGZA 3QRQA 4DR6J 3MD3A 4I56A 1Z2LA 4XPEA 1AT1B 3CCLS 3EGVA 4B17A 3R5DA 4UOHA 4I68A 3A13A 2KB2A 4IDKB 3PFEA 4XIUA 4ZPAA 2CVEA 4IG3A 1BY9A 2H9ZA 3LPEA 5HAOA 1SJQA 2JHEA 1N34J 1UZHA 3CB4A 4Y2MA 4F50A 2VB6A 4DV6F 3M8PB 1U8SA 4MTPA 4WP9A 4I6WA 2FUG9 1SVDA 3M2UB 4ZVQB 1SQEA 4GVBB 3QT8A 3PFOA 4MKVA 4C8ZA 3MPDA 4KB7A 1YRXA 2YH0A 3HHNB 2L9DA 3TVKA 3KNAA 1XMOF 2R7WA 1S9EB 2VJUA 3PZPA 1CJVB 1PJ5A 4QBUA 4Z37A 5J2NA 1XIQA 4DBQA 4ZLNA 4LF8F 5J2PA 1JJCB 2YKOA 4PABA 3PX0A 4NZ0A 3JQKA 1RBLA 2CPZA 2ROEA 4JV2A 3VV2B 1X9MA 3G9CA 3HDSA 4DV5J 1LWXA 2LKZA 2ASJA 4DPUA 2WTFA 3UR3C 2BOPA 1VC5A 4UQTA 4ECTA 2XWYA 3X1LB 1N5VA 4DLGA 1RE1B 2F7VA 4ES2A 4DV1F 2ILZA 3ILJA 1Y10A 4DR1J 1VI7A 1X4CA 4KAIA 4LREA 3SCJE 3VR1A 1YDLA 5F8NA 4FYYB 3HKWA 1YWXA 2E1MC 1ZPVA 3OTDA 4B3OA 5G4DA 1D8YA 4LF7J 1VQ6S 3DU5A 3RTVA 3CSKA 4Q44A 1VLYA 3DRSA 1U25A 4ZHRA 4YR2A 4B3TF 1CEZA 2LMIA 3TEGA 2UXDJ 1BC6A 4PKDB 4RWWA 1YJVA 5LOQA 2HK2A 3CC2S 1GXUA 1M5KC 3AJ2A 1RA7A 4NXMJ 4TU8A 1FD2A 4F02A 1OSDA 2I1RA 3BZQA 5DS7A 3Q8YA 2XMKA 4H4KA 4RUHA 2ZZTA 3IR6B 3SCLE 3KKFA 4RBUA 5CD4H 4NYPA 4DEZA 1ITPA 1SH0A 1TMMA 1HD1A 3FMWA 3UDLA 2WRMA 4YR3A 2DIVA 1RDRA 2C3PA 2HQ3A 3PR5B 5J2PB 4DQPA 4DUYJ 2NXJA 4M5GA 1S7IA 5F8GA 2GCFA 2QFJA 3UO0A 1R31A 4YEAA 1MMDA 3HHDA 2JJ4D 2OTJS 3H90A 4PG6A 3GCWP 3BEGB 3K8WA 1KBRA 2DJWA 2EPIA 4O3RA 1K0VA 5DQHA 2C3YA 4DL5A 4PQUA 1FERA 1S4FA 2ACYA 2KJWA 3CCUS 4M8LA 2VONA 1BQMA 1DBDA 4J9SA 2VKZG 2JLGA 4NEYA 4USHA 2M4MA 4JV0A 4C4WA 4OJGA 1S9GA 2UVUA 2NS1B 4ECUA 5KFFA 1KR4A 3DRSB 4ZHRB 2AGOA 4XDDA 4USUA 2C2OB 2E5JA 2ZBQA 2MJNA 4FKYA 1AUSL 4OHVA 1S0VA 3UPFA 1SJ1A 3MEEA 4PG7A 2MKIA 3HKZD 2I9SA 3HSGA 3MTKA 2QV6A 3KHRA 4PEOA 4ZPTR 3K59A 1OJ4A 5M2RA 1UFKA 3W5ZA 2C2NA 4PZVA 1Q81T 3LALA 1RP5A 1Q5VA 2VG7B 1N6QB 4ZCLA 3PX4A 1LK7A 2V8GA 1UZDA 1HBMA 5HI7A 1W2BR 2MKHA 2MDAA 2XZTB 5BYSA 3KLIA 1EQ0A 3HFKA 4RUBA 4HT5A 2Q79A 3NMAA 1N5QA 1VGYA 3H4DA 3R2CJ 2CVIA 4ES1A 1M5VC 2AYBA 3RBEA 4HACA 5GVQA 3JTPA 1NH7A 1F60B 1S76D 1CULA 1WDDA 1PIEA 1IWGA 4CLYA 4F4ZA 3TQEA 1NK5A 3HSJA 1Y5IB 5DG9A 5B0GA 3Q8UA 2MQPA 3CVKA 2R7TA 3V6DA 5G0RB 4DFPA 2ZH4A 1GNKA 2V9KA 1IM6A 1WNEA 1U2FA 4ZVOB 3ZC4A 3MDFA 4OZ0A 5KT6A 4QU7A 1UEKA 2BEFA 1T11A 2CQ1A 1IR2A 1EX8A 3MR2A 1RTZA 1NEEA 4N8OA 1K44A 1S1TA 1U45A 3LP1B 2H5IB 2PN6A 5THWA 1HBMB 1X9WA 3C16B 2RDIA 2HQIA 1UP1A 3QT6A 1XR6A 4DX5A 4OYBA 3E01A 4ED8A 1BUXA 2ZD1A 3FQKA 2DHXA 3VZHA 3Q2TC 5CA5A 4DHVA 1IBMJ 1FTCA 4D3HA 1PKUA 3T5LA 4YFUA 4X4PA 3HMJG 3OUYB 1CULB 4F0HA 1YZ7A 4LRDA 3BB5A 3TW0A 1CC8A 4OHZA 3MM7A 3MMJA 2UVVA 4PR6A 1YLXA 2HIYA 1OSCA 1D1UA 4N7TA 1BE4A 3D0HE 4MKYA 3J81U 2W24A 4XAKA 3N28A 3G86A 2AYGA 5F0WA 2CAJA 3QIDA 2XSFA 5F9NA 3EVOA 2CQDA 2K3KA 1YITS 5IOLA 5FD1A 2LCWA 2YX4A 3NXZA 3CCES 1RAIB 2V69A 2E7WA 3O8WA 2EEYA 3HHKA 3BBFA 2E5IA 4ZCMA 2DNPA 4PQAA 1OYEA 1T03B 4J9MA 4P2MA 2IBOA 3ONQA 2YKMA 1B0TA 5B08A 1ZA1B 2AHOB 1T3NA 1S1TB 3CJ0A 2R9LA 4ILLA 2PDAA 3T1YF 4J9OA 3N01A 3WX8A 1S59A 5DDQC 4PRFA 5KFBA 2J6SA 3EPIA 3E01B 2IJRA 3ILLA 1RHJB 1IBKF 1SUQA 3W7BA 5KAKA 3NBPA 1PO6A 1K47A 3SMZA 2HHUA 1XR7A 3DLGA 4ANEA 3IC1A 2XNQA 4X65F 3OVAA 3UDCA 4DV0F 4N5SA 4QIFA 2J9EA 5DETA 3MM7B 4USTA 2P9GA 4C48A 1NCLA 1VK8A 4RW7B 2R3VA 3MMCA 4CLSA 4KHPJ 4Y2AA 4Q2LA 2A18A 1K9MT 5D3GA 2NYIA 3LA0A 2YKAA 4OZ5A 2EFVA 2EW9A 4OV1A 4NEZA 4EO8A 3HFZB 4PXEA 1Q86T 3CJ4A 3UNYA 2FGOA 5B0DA 2LQ9A 4WFYA 3MMAA 2RDDA 4F4YA 1FESA 1TKDA 2KKHA 5GAGU 1HWIA 3LW5C 1TK5A 3KLFA 4J37A 1FJCA 2B51A 3QATA 5F3TA 4ED5A 1DAXA 2G9OA 1X4GA 1KN6A 4F3MA 4C0HA 2DPIA 3DYAA 5GADU 1V3RA 2RUGA 1G2EA 2MQLA 1EKSA 2HMIA 3QRRA 2KO1A 2HGNA 5DG7A 1SUQB 1JXVA 1C1BA 2CPXA 3BGLA 2FTRA 1U7LA 3DLGB 1JLBB 1RU2A 4LT6A 3F73A 3GJTB 2Y1IA 2Y0SD 2W01A 3IAS9 2RRAA 1CBKA 4LFBF 3PYFA 3AQPA 2J7UA 2KN4A 2D3ZA 4CTAA 1VRQC 1U0HB 3NY0A 5EWEA 1RHKB 5AJ3F 5H9FJ 1X60A 3BM7A 2NZ4A 4NLRA 2HIQA 1ZTWA 3NS7B 1X7VA 2GJIA 4JI0J 3AB2B 2JSXA 2PE8A 2CQBA 1WTBA 1PCAA 3FUYA 2GMHA 5D3GB 3MEDB 1AZSA 1TL5A 2VQFJ 1GX6A 4N8NA 2KI2A 2PSZA 1CJKA 4QYZK 3S7RA 4KGVB 3QO9B 1HD0A 4OMFG 4AQYF 3MMAB 2P6SA 4LIRA 2MYFA 4FP9A 4F0KA 2FIUA 3R6GB 2LA4A 2LQJA 1TP7A 4A48A 1ZYQA 4KH0B 1J5OA 1TVRA 1R8AA 3HLUA 1G6BA 3TJ9A 1TL7A 3DYAB 2HMIB 3OHBA 5A6PA 1T02A 3UD4P 4NLTA 4RLEA 4ERDA 5AXMA 2B6AA 4C11A 1U0SA 4C6AA 4ETZA 1DQ8A 2HQGA 4WK1A 3RW7A 5L39A 1WEYA 2GHWA 3F41A 3Q23A 4NLXA 4IRDA 3IBCB 3FC9A 2M3DA 2VQEJ 1SH2A 1YI2S 1ZTTA 4ZS6A 2CKWA 1GTEA 2HLUA 5D78A 2UUCF 2E66A 2DB1A 3BYRA 1MMLA 3NKYA 2W2MP 4KKOA 2R2SA 3NAHA 3OFHA 4CIOA 5C24A 1SV5A 5KFCA 1BWEA 3CGIA 2EFNA 3JTNA 1N5TA 3C14A 3OTOF 3ETMA 5F8LA 1YSJA 4HTJA 4KSEB 4UF4A 5KFHA 3GR1A 2X51A 2QLJB 4XDCA 8ATCB 3I55S 5HJYA 2XNRA 3CMAS 1J5OB 2CJ9A 3IMQJ 2QG9B 5HP1A 1WDTA 2K2PA 2FJDB 1S49A 2GIRA 1BQXA 4CP5A 3KG1A 1TL7B 1U2RA 3PKMA 4BWMA 1S4EA 3WZ0A 5K20B 3R1LA 4AFFA 1S1XA 1L5UA 5HLFB 3D2WA 3GYGA 1KFSA 1P6TA 4F4XA 1G7CB 1VQ4S 1XK8A 2DH8A 4ILRA 5CYMA 3I56S 4DPTA 4DR5F 2CUYA 2OD4A 3PCOB 3AA8A 2LQ5A 1PYOB 5F3ZA 3MF5A 2HHQA 4JI8J 1HNWF 2G0CA 3UQSA 4W92B 1G4CA 4MH8A 4NRUA 4C3MA 2LDYA 2XLJA 4OYAA 4DV7F 1IWAA 1XNQJ 3CJKA 1YX2A 3BN4A 2BQUA 1WEXA 4F2RA 4KKOB 3W65A 1WJ9A 3K7RA 3ELHA 5C24B 2QLFB 5LSLA 3J7Z5 4RW6A 1U1OA 2YPYA 4LMZA 1MW7A 3VVTA 6FD1A 2B7BB 3L09A 3VWSA 4NOHA 4AL5A 2PFDA 1VISA 5GMDA 4JI1F 3D66A 3VAHA 3MPWA 2YXLA 1XNRF 5HP1B 1KC8T 2OGUA 1JLEB 2QRRA 4IOAQ 3OTBA 1KQKA 2AJ2A 1HI0P 2RDJA 2EKNA 5IM0A 1O6XA 3Q8QB 1ZZFA 4DV6J 4OI1A 3P45B 2H48B 3GILA 1MU2A 2Z30B 1S1UB 3BSCA 1S57A 5HANA 1T9YA 4DZDA 4WIQA 4QR2A 1FRIA 5KT4A 1XMOJ 3M2RB 2YWHA 3GG1A 3RR8A 4CCHA 2UUWA 4TNOA 4LF8J 3GB0A 1F6TA 3LQVA 4N41A 2MZ1A 2RIJA 3IS9A 5E3AA 5HQMA 1EIYB 4K4TA 2F40A 3CIMA 2BM0A 4DI6A 4DS5A 4CWBA 5CHCB 2HS3A 4OL8A 3GSIA 1JIHA 3QQCD 4RW6B 1Z1ZA 3K0JA 3G82B 3QSIA 5A8RA 1N5SA 3CJ3A 4OYWA 5DQGA 3C3LA 2Y1JA 3OFEA 5B0EA 5I4MA 4C8OA 2VFSA 4DN0A 1DTQA 4MT1A 5KFRA 3BGOP 4U95A 2NXCA 1UW9A 3CO0P 2GAGC 4IFVB 3T41A 4RUCA 4B3TJ 4KGZB 1JNZB 3AQOA 3L9ZA 3D1HA 4IG0A 2D7SA 1YG0A 3EVWA 3CEDA 5A8KA 3M7VA 2W9BA 4MK9A 3SI8A 3LAMA 4ZP9A 4RZRA 4RBVA 2MHNA 3TVYA 4ZPCA 1UKUA 4NASA 1IVZA 2FLLA 4MIBA 1DURA 2FGCA 1SC1B 1VJQA 3ET6B 4DJBA 2CNKB 3TI0A 3K57A 3IS9B 2MLYA 1MG7A 3ZTQA 3M1VA 5IV4A 4ID8A 4RW8A 3IM9A 3EDQB 4DV4F 4NZ6A 4DS4A 4YP3A 1BMQB 1R8CA 2Z2LA 1MLAA 1H72C 3DM2A 2XSJB 1GK8A 1WI6A 2C42A 2LFVA 2R7RA 2OUGA 5F8IA 1OMSA 3SCKE 2CQIA 3OL9A 4G3IA 4IH5A 5A8RB 3L7UA 1NO8A 3ILIA 2VG5A 1WHVA 4TU7A 4NLSA 3EPGA 2D1CA 1NDCA 1VR6A 1DTQB 5IT9U 3MCOA 1I1GA 2O5DA 1X5SA 2RQMA 4L3KA 4B9NA 4I2QA 4NMXA 3MM8A 2ZWPA 2CQPA 4PPDA 3H20A 4DPOA 1TFWA 1KSPA 5KG3A 2MPUA 3O1LA 4HLBA 4WJBA 2YQ3A 4YUDA 4IFYA 3J7YU 2W9BB 2IDEA 4ZLLA 1AUDA 4DSFA 4NX9A 4YOEA 3VAFA 1LK5A 1HWKA 2AU0A 1W26A 1TKZA 3LGHA 3D4JA 4GO5X 5KT7A 5E3CA 3HF5A 3U27A 1HPZA 3MGJA 3CCRS 4M1KA 2ZJQQ 3MPYA 3KLVA 3M6VA 3RBZA 2H65B 3D7SB 1XR5A 4K0KF 1XMBA 2K06A 2M70A 2XMJA 4YN3B 1UWAA 4LSLB 1Q8KA 2XTJP 2RJZA 3JAMY 1H74A 2V6AA 1FT8A 3QPIA 4TQSA 1J2VA 4NE9C 1FKAF 4FVCA 2MSSA 3DHXA 1MN9A 4FVMA 1YJTA 2ILYA 2VG5B 1N48A 3QNWB 4WP3A 4HEA9 5F9LA 3SSSA 3EICA 1NPRA 3VCDA 4LSNA 2PEBA 4R5PA 4Q45A 2DGUA 1OY9A 4I2QB 3BDEA 1GMWD 1NHVA 3CCJS 2OMLA 3MCMA 1PC5A 4FYVB 3GTYX 3KLHB 3QLHA 2UVRA 3FBEA 1UMJA 4ELTA 2FC8A 2AJ0A 5KFQA 3VGUA 1RCOB 2JWNA 3MI7X 2J7KA 2VPYB 2OPQA 1FF2A 3TZWA 2UU9F 4FNHA 5CYJA 4C3LA 1URNA 1TKZB 3MAHA 1SCJB 1S6QA 1UWBB 4J9PA 5H9EJ 4EZ9A 3TR5A 1VFJA 3C6TA 1U2CA 1HPZB 2RRNA 2YVSA 2RS2A 2XCPA 2DXDA 3CNQP 1SBRA 2ABYA 2CJBA 4AXJA 2ZM6F 1D9AA 2NZCA 3EWGA 2VBZA 5M2UA 2M5YA 1R0BG 2W9AA 2FYXA 2HHTA 4BHQA 5D8HB 3HT0A 2A2CA 4GRSA 3TQ1A 2MJUA 2CQ3A 3TUIC 5SUHA 3MM9A 4ID5B 3IBWA 1LKZA 1WC3A 4X64F 2AW0A 3TOQA 2B3TB 1Q0NA 2CQ2A 5IC4B 2ZZNA 2XMWA 1S79A 1MN7A 4ED6A 4FXDA 2RF2A 4LSNB 3SCIE 1RTIA 4R5PB 5K8OA 4PWDB 2PMWA 4KV8A 2OSQA 2DVIA 4RUAA 3FCHA 3OXGA 3BO3A 3CJ2A 4K59A 2DNKA 1U6ZA 1F9FA 2PMHA 3ITHA 2QL9B 1U1LA 2DIUA 2VUGA 5AXKA 4XPCA 2VA2A 1LFPA 1SJRA 4LF2A 3ZFVA 4MK8A 2VU5A 1V6HA 1K1QA 2VPZB 2UV8G 4B08A 2DISA 2RKIB 2Q6BA 4L6V3 3T1YJ 3W8GA 3PO4A 4V19X 1C2PA 1HL6A 1KKHA 2ASLA 2OHDA 1JLCA 4XTTA 1KQSR 1KVIA 3HZEA 3OSNA 2W4PA 4FYXB 3T5KA 1TR0A 1IBKJ 1UVIA 1QE1A 3GIJA 4QOTA 3MM9B 4KPYA 4KGKA 4HHHA 1T05A 1Y4ZB 1Y0HA 2DNQA 2FHJA 4DF8A 4X65J 4TYAA 3CDUA 1TK0A 5EHHA 4DV0J 1UTAA 3H98A 5EX0A 4UUXA 4OX6A 5GAHU 2F9DA 2IM0A 2C3OA 1VQOS 3Q24A 1JJ2R 1DJ0A 1SJ4P 3O44A 4TKTA 4WZMA 1RHUB 2DHAA 2IFXA 4OYMA 3H42A 3IRXB 2OPRA 2I8EA 4CO4A 2R7SA 4ED0A 3V81A 4MAKA 3W2VA 4U7CA 4ANDA 4K4SA 5HROA 5BYRA 1N33F 2Z2MA 2V0NA 2FHMA 1R0AA 2BXJA 2V2ZA 1JLGB 1KQFB 4M5DA 4GC6A 1HW9A 3OT9A 3V6KA 3DLEA 2VBYA 4TN2A 2HPUA 1M90T 1SQGA 3GYNA 1X4BA 5CD4A 3NGUA 2QEXS 2FJWA 1GXTA 3VAJA 1RTHA 1FRHA 3UCUP 1QTMA 4WKRA 5KT5A 4ZVEA 1D0EA 4JI7F 1YKWA 1X9SA 4LQ3A 5MAOA 2AX1A 4U8VA 2KZMA 1KOHA 4RNFA 2ZH3A 3VGVA 4NA2A 2J6TA 3OL8A 3RG6A 4NCGA 1VBKA 1T05B 4J9UE 2XMTA 1RT6B 3OJUA 2ADBA 1YTYA 2BYCA 2QFIA 4A8WA 1H0HB 2ZOGA 3A3OB 3PRDA 4O3SA 4QW9A 4LFBJ 3Q8VA 4LVOP 4DV3F 3W3SA 4DXLA 3KXDA 2RRBA 4K4XA 5AJ3J 2CWKA 4DQQA 3C15A 4UZCA 1ICEB 2P9CA 2E9TA 4A8SA 2NLWA 1F2HA 3BREA 4I6YA 3V81B 1X31C 2CJYB 4AL6A 2C2DA 5D4OA 2DBBA 5KFKA 5HROB 3PR4A 4M5NA 2W2QP 4DFJA 4G65A 2M9KA 4KT0C 1VJWA 2BRKA 1L3UA 2DH9A 1VRTA 4K7QA 1UJ6A 2R8KA 1X8DA 3DLEB 3CD5A 3VAMA 4AQYJ 3FK4A 3RGIA 2EFGA 3ZZTA 3F44A 1SC4B 2OSRA 1YHQS 4V1Ak 4RW9A 5B09A 2Z58B 2LP4A 3KUGA 1L3KA 2RHQB 2FVRA 3HT3A 4ECXA 1I51B 3M2VA 1U1PA 4TLRA 2B4PA 5GMKa 1RI7A 5KFVA 4JI5F 3KMSA 1S6UA 2BBEA 2HQCA 2JNJA 3ENAA 1RAAB 5AE3A 4LFAF 4KQZA 4NCGB 3PRVA 2ZHAA 2ZC3A 3SDEA 3IO1A 2I5JA 4LQ9A 2LQ8A 4KH1B 1FVSA 1D8ZA 4Q43A 3EX7B 1VCTA 3C15B 3L7OA 3H5SA 4DX8H 2F4VF 2R2RA 1F5CA 4B9TA 1CJUB 1ROFA 3CD6S 2IVMA 2UUCJ 3BV8A 1S99A 2B9WA 2RQCA 4FS2A 2HYIB 2WSFC 1A7GE 4KPCA 3KJQB 3OFFA 3AXMA 3DLBA 1FHTA 3OTOJ 2HK3A 2QIFA 3M30A 3SEOA 2FZCB 4FN5A 3Q8RB 1HQ2A 1OQ3A 2NYHA 2KFYA 1S0NA 5I42B 2HQFA 3J7ZT 2N7CA 4LFCF 3KOAA 3M2VB 5HO4A 2QMUB 3E51A 2DR8A 2XI3A 1UEVA 2CPHA 3B4DA 5J2QB 2IVYA 3CW2C 4WFNQ 1FO1A 1AFIA 1ZAXA 2AQ4A 4J9RA 3HFVA 1R8HA 1M5PC 1RZMA 2WHOA 3UD5A 2W2NP 2R8HA 2VF3A 4NLOA 3HVAA 3HXMA 5I3UA 4DR5J 4PG4A 2XHCA 1WKLA 5GAEI 3RBDA 3OLBA 1MSWD 1QAJA 4X4UA 1HNWJ 3MECA 1FWPA 4URQU 2IRYA 1OY6A 5F8MA 4DV7J 4A8YA 4IO9Q 3CMQA 2B4OA 3RJMB 2VBWA 1JLFA 5KOWA 3MURP 3MAQA 1CLFA 2CQHA 3A8KA 3CJTA 3OR2A 4Q0BB 2M52A 2AJ4A 3R8YA 1FEHA 4CLKA 4Y2IA 3R3TA 4YS2A 2YKNA 1WG5A 3M30B 4E8UA 2V8DA 5AXLA 1MWZA 3Q0AA 2AJQA 2HFZA 2MKSA 3VZIA 4JI1J 3S1TA 1RAFB 1HWLA 3RYLA 3PNIA 2BE9B 5RUBA 4LRAA 3Q86A 1XNRJ 4GC7A 1IBMF 5L9XA 3EGNA 5C2GA 1FXDA 1ZPWX 2E7XA 1RLCL 2E5HA 1QJHA 3ZZRA 2BE2B 3CCZA 5A76A 2HZCA 5J1EA 2HVZA 3RB0A 1JLAA 2GQQA 3MR7A 4RO0A 2RILA 5A6WA 4OYXA 3JS9A 4QYRA 3PW4A 4DOZA 4DCOB 4RW4A 2VPXB 5I3UB 1ZOTA 1T3OA 3M6WA 4FF2A 1HMVA 4OX9F 3FEZA 2R8IA 5CZVA 3SFGA 4QIWD 3DRRA 4CLLA 4F67A 4JYAF 2FJXA 2QYCA 2LXIA 3HD1A 1S6OA 2YTCA 3AD8C 3P49B 2J9DA 4Q8EA 1JLFB 4M94A 3H8YA 4B3RF 2IAJB 4PWWA 4OYPA 1RWOB 4M63A 4K2JA 3OR2B 3K5NA 3I9ZA 2N3OA 1NUEA 2HFSA 3KLGA 1WHXA 3H7HB 3THPA 3OTEA 1Y3KA 1RYSA 2PO4A 5D0GA 1JLQB 4K4UA 1FJ7A 2V4JA 4NLVA 2OTLS 3AAWB 4FF4A 2BJ8A 4O4GA 2EBEA 4F3QA 3CD7A 3NWGA 3DOLA 5HVHA 2X1FA 1NU4A 3QRPA 3ZZOA 1U1RA 3ZZPA 1WG4A 2ZH2A 4P2XA 2BQ3A 4PCQA 1B64A 4MKBA 2FJVA 3RAQA 1F1BB 5DDPC 4DCPB 4A47A 4DR3F 3PRBA 3J80Y 4X4SA 2GZOA 1L3SA 3DRRB 2CJAA 1RWWB 3FZ2A 4AYBD 3R7NB 5L9NA 2D9PA 3KDNA 4OHXA 2RD5C 3UW1A 4CLPA 2QA4G 2HBZB 2EC2A 2I6WA 5D0EA 3OFGA 1IXKA 4WTOB 5BR8F 2MQNA 2DNGA 5K8NA 3G6VA 3TWZA 2W1BA 2EC0A 4X4TA 1NSQA 1S10A 4DV4J 1SJFA 3DOKA 2YPZA 1K0TA 2POKA 1R8BA 1N4LA 2FDNA 1ACMB 3KJFB 7FDRA 3I0RA 1F9HA 1WOOA 2IC3B 5ETRA 5K14A 2DITA 3H25A 4FKXA 1DRZA 5FLXY 4U67Q 3M8YA 2ZBRA 1J5EF 2RHSB 1LNQA 2CFXA 1I5OB 4H4KC 3T3FA 5LJ3Y 1HQEB 2EI5A 3EZ5A 2YNGB 4O4GB 2EKYA 5BYQA 3ZZYA 4RU9A 4IRKA 4ES3A 4JI0F 4LR7A 2XY6A 5KFYA 4G6VB 4HH1A 4OLOA 4DG1A 2Y1LB 4EI2A 4ANCA 1A6LA 3I4HX 4Q8FA 3HVTA 2NREA 4R8UA 5KFWA 2FC9A 2VFUA 3HVWA 1S1WA 2SXLA 1NJWA 4OZ2A 2BANA 5LSRA 2WONA 1LWEA 1LW0A 4F26A 1RAJA 5K5MA 1W25A 1IBCB 2XYHB 4AT1B 3PO5A 4P71A 4K0KJ 1Y9OA 4X4NA 2KT2A 1SQFA 1REVA 3QZ7A 2DNHA 3W60A 1RABB 2DR9A 4W90B 4KFBB 1KHWA 3AH6A 4DL6A 1YRTA 3CCSS 3NNCA 1RWVB 2L9NA 4DUZF 3I0RB 1SIZA 4ZVHA 1SL1A 1G1XA 4CO2A 3VGSA 2AGQA 3CCQS 1HBNB 4M5IA 4EUVA 2W9CB 3MZIA 3E8OA 3HVRA 4OJ3A 1HHTP 4JV1A 4UQGA 5HMYA 5KFGA 1RWUA 2VV5A 5ETLA 4A8QA 1EETA 5A0YA 3TX8A 3BYPA 3PACA 5BJRA 5E5NA 3N4WA 2PA8D 3NS6A 4KHMA 4ZITA 1H6KX 5M2PA 2QA1A 2J7WA 2VDHA 3I5AA 4P73A 4LUBA 3HO1A 4ZP8A 1Q1KA 5CYQA 2Q1LA 3TP2A 4DG1B 4BWJA 2UXBF 1TL3B 5HJXA 2OLWA 2UU9J 2VC0A 5AXNA 2HBQB 2QT7A 3H40A 4M5LA 1S1WB 2C28A 3C2PA 1E6VA 3QWPA 3R6LB 4M95A 2BANB 3DHWC 3JQMA 3TANA 1LWEB 4WCEQ 4FNIA 1PC4A 1IKXA 1T9UA 3R5AA 3J7A1 2ZM6J 3FCVA 2W25A 4RPFA 1REVB 2BJ1A 2G0JA 2DEJA 3KK3A 4MJKA 1RA6A 2MKYA 2NXEA 3O2IA 3QZ8A 2MLXA 2Z2YB 1EP4A 3N9UC 2VFRA 1N32F 3BPSP 4X64J 1IKYA 2NUHA 2V2QA 3PW0A 2VA3A 3EMTA 3UR0A 3NMRA 2YWFA 2Q66A 1EETB 5A0YB 2HSEB 2VODA 3GV5B 3DU6A 1HARA 4B9SA 2WW4A 5DG8A 2RUSA 3R5GA 1TL1B 3JSMA 2UXCF 2ERRA 1RT2B 5CYQB 2NQPA 4J7CA 4B3SF 1VRUA 4OYIA 3UDVA 2CQ0A 2VG6A 4NLDA 3VVUA 4YQWA 4LR8A 3PHEA 2MZRA 1N56A 2NR0A 1CSJA 2AEJA 2CG4A 4CO3A 2FLOA 3R7SB 3NS5A 3V5RA 2O1PA 1URRA 4J9NA 2X1BA 2E9RX 4FYWB 5F8HA 1VMBA 4UY85 1CS4A 3TA2A 4CRJA 3KHHA 2WVEA 1S6PA 3AHPA 4ZN1A 3TUZC 3KK3B 4O3QA 3KUEA 1APSA 1FKOA 4ZN3A 3M05A 3IG1B 3PW7A 4W4MA 7FD1A 5C25B 4IYQA 2IA0A 2MZJA 4JP8A 2ASDA 1VC0A 1A0OB 1IKYB 2CNOB 4CQ1A 3GV7B 4Y3CA 3C46A 4ECYA 5HN0A 1FNMA 2PD1A 4NCBA 3RAXA 1KHVA 4EBCA 4QR0A 4ZPBA 1UCNA 1U1NA 3IWNC 4EBDA 1WWHA 5IS2A 4ER8A 2EVZA 1PGZA 4CLUA 2FJAB 4LBPA 1YQHA 3LP0B 4EGLA 1LWCA 5E3RA 1LWFA 3OTCA 5IT9Y 1FA0A 2R7VA 2YNHA 5LMUF 1T9VA 4ZLPA 1VRUB 1H2TZ 1N33J 2IBKA 3K5MA 2VG6B 4J90A 3HK2A 1U8WA 2VOOA 1MNEA 2P8IA 2XO6A 4C98A 3NGDA 5CXTA 1SXLA 2V8VA 3KJVB 1NJIT 2Q6CA 2MGZB 3NNHA 4CDIA 4F36A 1FK9A 4ZA1A 4I6AA 2DRAA 4EYIB 2ZITA 3RW6A 3OV7A 2YBVA 1CS4B 2Z56B 2Y0BB 4Y00A 1KRPA 3UNGC 1S6PB 3B54A 1U49A 4JI7J 2M88A 1TAUA 4Y2KA 1SKUB 3US5A 5F41A 4IG3B 5L38A 3THTA 1TMJA 5EX3A 3SQGA 3A8JA 4RWXA 3ZXWA 5JUMA 4DQRA 3DOMA 3OVBA 1VYAA 2JDJA 2WK4A 3HJVA 4DV3J 2MKJA 2P5VA 1BQNA 2N4CA 3P5TL 4OYOA 1VQ8S 3MPVA 1HQUA 3Q89A 2U2FA 3I4PA 2GHPA 2D69A 1M1KT 1LWCB 1LWFB 4USJC 3IBFB 2NSBA 4ELUA 4A8MP 2G2ZA 1V5IB 4GKJF 1DTTA 1JB0C 5J2NB 3D1OA 3U02A 1EARA 4EMDA 3RRGA 4OI2A 4DSIA 3EXCX 4N76A 3M8WA 3CCVS 2ZVSA 2HRYA 3M6UA 5B0FA 4NYZA 3RRKA 2Y8YA 4E2FB 2F4FA 4F4AA 5L1IA 5ETOA 4DL2A 2BW7A 2E1RA 1HI8A 3OXFA 3ZO7A 1H38A 3E2EA 4CH0S 1REGX 2FVCA 1PJ6A 1FK9B 2F3JA 1DQ9A 4J9QA 1I94F 4UOCA 5D4NA
chains in the Genus database with same CATH topology
2KDOA 3JSYA 1CQMA 2Z0GA 3FNNA 4JOUA 1TL3A 2RQKA 3MM8A 2DGSA 2CQPA 2ZH5A 1V3ZA 4PPDA 3H20A 1WELA 2OO4A 4DPOA 3ISNC 2B5JA 1TFWA 5DRKA 2IM3A 2MZQA 5LMNF 2V4RA 5KG3A 1KSPA 1LXJA 2VQFF 2MPUA 2Q43A 1D3WA 2GA7A 3IWLA 1RTHB 4QWCA 2D74B 1SL2A 3FMBA 3O1LA 3U7JA 4X4QA 4HLBA 4B3OB 4WJBA 2GMLA 2YQ3A 4YUDA 4IFYA 2DCUB 3J7YU 2W9BB 4CO0A 2OMOA 1RT1B 4DF4A 1R7IA 4J9LA 2NUUG 1AUDA 4ED1A 2R8GA 2J6UA 4DSFA 4NX9A 4YOEA 3VAFA 1GTHA 3N5FA 5K8MA 2AD9A 1QUPA 2DO4A 3FDSA 1FJEB 1LK5A 2H5EA 1HWKA 2CDQA 4TY9A 1KNZA 4DSLA 2AU0A 1TKZA 3DLKB 5T7LA 5IZHA 4FS1A 4RBTA 1S1VA 2ZOMA 1TZ0A 3CWJA 4RNOA 4OJHA 1SIWB 4GO5X 1TKTB 1KFDA 5KT7A 5J1PA 2MKKA 3TNVA 1O0PA 5E3CA 3HF5A 1L3TA 1JKHB 2G13A 3U27A 2M8DB 3GFXA 1HPZA 1M5SA 4JBCA 3MGJA 2VL1A 4U6PA 3CCRS 4K4VA 2CPDA 1RTDB 4M1KA 3CT9A 2ZJQQ 3MPYA 2DD8S 4YDXA 1BQNB 3KLVA 1FNXH 3PEJA 1YRUA 3M6VA 4G1QA 5KTQA 1XN9A 1XR5A 5HLFA 2JOQA 4K0KF 1XMBA 2PFFB 1HQUB 3D0GE 3BJYA 2M70A 1VIOA 2XMJA 2XC9A 2K1RA 2N4DA 3KWMA 3RB6A 1RKIA 3O3LA 1RTJA 2MMYA 1LQ9A 2VFVA 3N6LA 4BC7A 1QSYA 4TYBA 4LSLB 2HRUA 3H5XA 2RJZA 3JAMY 3BS9A 1Q79A 3ICLA 4QZVB 1FT8A 3QPIA 1SKWA 1RT7B 2GO9A 5DDOC 4WZQA 4TQSA 4MFBB 4DSEA 3OVSA 1TK8A 5KFSA 2D3UA 4L72B 1N0UA 3SXLA 3EZUA 1X5TA 1I6JA 3I5BA 3I5CA 1J2VA 3KG0A 2XY5A 4BDPA 4NPOA 1FKAF 1UVNA 2DGWA 4NA1A 2HHXA 3CF5Q 4FVCA 2MSSA 3EYZA 3DHXA 2RNEA 4YB1P 3DLHA 4OZLA 2APOA 4KGMA 1ULRA 3GIMA 3L95X 4FVMA 4MKAA 5KG0A 3KHLA 1YJTA 2ILYA 2VG5B 1Q8IA 4DQSA 2LVWA 2ZH1A 1TL4A 2KHCA 2W7PA 1N48A 2UVWA 4YY3F 2KT5A 3OHAA 5B7WA 4CT8A 2KG0A 4JI3F 5KFLA 4HEA9 2R7XA 5F9LA 3FSIA 3SSSA 2VQEF 1TKXB 2WW8A 1K1SA 4PQUB 1Q82T 1TL1A 1R6YA 2XHWA 4X4OA 2RSQA 2IYGA 1VK3A 2UP1A 3CCTA 3VCDA 4LSNA 2UUBF 5C42B 4PG8A 4R5PA 1RT2A 4Q45A 2L3MA 1VRTB 4ZP6A 1BQMB 2BJDA 2DGUA 4I2QB 2JVOA 2A2DA 3BDEA 4C9DA 1Z4UA 3MUVP 1NHVA 1TUVA 3U1LA 3CCJS 1VQ7S 4LF9F 2W7AA 2OMLA 1PC5A 3CTRA 3KLHB