2GJIA

Nmr solution structure of vp9 from white spot syndrome virus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
82
structure length
82
Chain Sequence
b'MATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEELRLLTGDSTLEIQPMIVPTTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords wsv230
publication title Identification of a Novel Nonstructural Protein, VP9, from White Spot Syndrome Virus: Its Structure Reveals a Ferredoxin Fold with Specific Metal Binding Sites
pubmed doi rcsb
source organism Shrimp white spot syndrome virus
molecule tags Metal binding protein
total genus 7
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09625 VP9 VP9 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2070 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gjiA00
2GJ2A 2GJIA 2ZUGA
chains in the Genus database with same CATH superfamily
3IP0A 3BH6B 4NI2B 4U96A 1C0UA 4MK9A 1UPPA 1XNQF 1UTAA 1MWYA 3M8RA 1NDKA 5H9FJ 2LU2A 1F9FA 1WD6A 1HNIB 2FLOA 3VQSA 1LOUA 3JTOA 3PO5A 2YNHA 1ZM9A 3ETMA 3V5RA 2LQ9A 4ZN1A 2VA2A 5DDRC 4LT6A 3UNYA 3QATA 3HSZA 3CPWR 2P8IA 3VGSA 1RYRA 4M63A 2NXEA 4BS2A 2MKIA 2WBRA 4JV0A 1BLUA 4Q43A 2CNLB 1KWMA 3BR8A 4KE5A 4WCEQ 5D15A 2HWHA 1WC5A 5KFKA 5HP1B 2AYEA 2B6AB 2VQFJ 2ILZA 1X31C 2Z2MA 1FEHA 3EGWB 1U0HB 1QE1B 2GA7A 1VLOA 1F3VA 5I3UA 2JVRA 4U6PA 2Y0BB 3W3SA 5KT2A 1UVJA 1V3SA 5DDPC 3PKMA 4DR3J 3HFKA 2E44A 2YX4A 3DGPA 4ECXA 1PO6A 3ZZTA 1AA1B 1FWLA 5B0EA 1DQ8A 4WFAQ 4IFYA 3IA0A 2JC0A 3N28A 3D67A 3DN9A 3W5XA 1UZDA 1WF1A 3T9NA 5A0YA 5M2RA 4PG8A 2AEJA 1SI9A 3BN7A 2W9BB 2RNEA 2NXJA 4IFVB 2RU3A 3D0GE 3JYTB 3BO4A 1NH7A 5F3TA 3QNWB 1YBAA 3MD1A 4KGVB 3KHLA 3IR6B 4LF1A 3KLIA 4RNHA 1VQ9S 3I9V9 1N5VA 2OELA 3F0NA 5F9NA 3GU0A 2FHJA 1HKAA 4ICLB 3HKWA 4DU8A 4IOAQ 2DEJA 2QL7B 3UCZP 2EXUA 1FT8A 1TUGB 2FVSA 3NLCA 1M90T 1NK8A 3TQEA 2E7VA 1NK5A 3C8YA 2XMMA 1VCTA 1CJVA 4JI1F 1ZZFA 2UUWA 1LWFA 2FLPA 4A8FA 3SV3A 2YTCA 4EBCA 2IPOB 2FJWA 2V4QA 3QGGA 5M2PA 2ZBCA 1YG0A 2R9LA 3DOKB 1CJKA 1KS2A 1R3NA 3M6VA 5B0BA 3QSIA 4ANEA 3W64A 3KK3A 3LH2S 4DS4A 2VUGA 4B17A 1IWAA 3J7ZT 3K8WA 1VJWA 2IBOA 3J81U 4AL6A 4C11A 1T9VA 3PYGA 2VFRA 3HHLD 4JI8F 1T95A 4YR3A 3WBZA 3KLEA 5H9EK 3W65A 1F0XA 2C3OA 2QFJA 3Q23A 1S9GB 3OQ2A 3R27A 3V6HA 2UUAJ 1AZSB 2EFNA 2WSFC 3NXZA 4DDFA 1T9YA 2P5VA 2HS0A 2GIQA 3D68A 4M5DB 3RBZA 2HFVA 3RUBL 3H8YA 3DRRB 4JI6F 4OZ5A 3GE9A 1K44A 5HBMA 2K2PA 3IS9B 2ZC3A 1V5IB 4JI3F 2VG7A 2ZITA 4I68A 3BB5A 4ZCIA 1NSKL 1E6YA 4FYXB 2XGQA 4UQGA 4WZMA 2L41A 2BYCA 2GQCA 3MR5A 2JH3A 1YIJS 2IYGA 2XS2A 3I5CA 4EYHB 1Q8KA 4O3OA 2B9EA 1PCAA 1ZM3A 3DLHA 4NEYA 4KPYA 2BUNA 2ZWOA 2HBZB 1VHIA 1IKXA 2ZWPA 2H48B 1HR0F 3MR3A 1S1UB 2R8GA 1IR0A 3ILJA 3CO9A 2XSFA 2GMLA 3N6MA 3M1VA 5KFVA 3KK1A 2XCPA 3RG6A 4Q44A 3IWLA 5A2QU 3TW0A 4Q5VA 1YGYA 3FQKA 4FP9A 4ZVRB 1PKUA 3KYLA 3DU6A 4JYAF 2FVCA 1WC1A 2N82B 1JLGA 4OHVA 3EPIA 2KYZA 4ZP6A 1N8RT 2M3DA 4CH1A 1N0VC 4ENOA 3PJXA 3QRRA 4QWAA 1SL1A 4F3OA 1YI2S 1ZPWX 2RT3A 1YX2A 4KH0B 4KGMA 4LF9F 4OX7A 5H9EJ 1LEOA 2MQNA 1OQ3A 1XK8A 1Q78A 2HVZA 3P4UB 5JJBA 5MLCV 5SZTA 2HQDA 2UVWA 2CKWA 2E29A 4NRUA 4Y28C 4K4SA 3BO2A 1QD1A 2E1PA 3NG8A 2W2QP 1F5AA 2GVZA 4N8OA 1KLMA 2CPDA 2QZ8A 2FDNA 3AODA 2JRSA 2AX0A 3PACA 3SIPB 1VIXA 4F26A 3LWMA 3B78A 5KFWA 2CDQA 2AT1B 3FCHA 3OW2R 4KHRA 3LAKA 2WW8A 2D9PA 1HWIA 1YZ6A 2B4VA 2EFGA 3CO0P 2YX1A 1P8GA 3MEDB 3LF0A 1XMOJ 1GQEA 2I0XA 2DR5A 1FK9A 1VQ4S 2C3PA 2JEGA 2MYFA 3KJFB 3SFGA 1JLEB 2W01A 1DBDA 5KFSA 5IT9Y 1IR1A 4ECYA 2IM0A 4LUBA 3GFHA 5K8MA 3FSIA 5LOQA 2X1AA 4KGXB 2ZHOA 2E5LF 1UEKA 3VGVA 1MROB 2UV8A 1GMUA 2IM2A 1UETA 2ZUGA 3AAWB 2IY5B 3J7Z5 2AV5A 4C8MA 2HLTA 4ED3A 2WVFA 1T05B 1AB8A 4NCGB 5IT4A 3OVBA 3KLVA 3NWGA 1S4EA 4LF5J 4ZP9A 4NCBA 4DMZA 3H2LA 1S1TA 1XR7A 4O23A 3C66A 1KQFB 2LA6A 1D0EA 3LGNA 1Z2LA 4C3LA 5C5JA 1HNXF 1REVA 3QO9A 1P27B 1UL3A 1N33J 2AJQA 5EHHA 2WB4A 5DGAA 3PKYA 2MZQA 3BYRA 4LJMA 4Y3CA 5HJXA 5J1EA 2K3KA 3MR2A 1UFKA 4KH1B 5A8RB 3H5UA 2VKRA 2DNHA 5KFCA 2C2DA 2QG9B 3PEHA 3M30B 4JI0F 1RU1A 1NBEB 5ETQA 4LR9A 3T3FA 3PW2A 3N4WA 2J76E 5K8OA 4PXEA 5GMKa 2A6MA 3E51A 3H4DA 2I2YA 4CLPA 3CC4S 2XY6A 2RHSB 2AJFE 1VQOS 4PQUB 3MAAA 2ZM6F 1RZMA 4WKRA 4RW9B 2WHOA 4DUZJ 4USWA 4L6V3 2BQRA 3RAQA 3BO3A 3Q8YA 4DHVA 2EBEA 5THWA 1H7WA 1NKEA 3GG1A 4QPTA 4QIEA 1Y0HA 1EX8A 4L72B 2IVMA 2CA9A 4YB6A 1VGYA 3OJUA 5T7LA 2C28A 4I4BA 1XMQJ 3P8BB 2B5JA 4F0KA 3KK2A 4X4RA 2PD1A 3FC9A 1RU2A 4EEYA 4X4QA 1GEHA 3GTYX 1JLQB 1R8BA 2AYMA 3E8OA 5D78A 5G0RB 1UP1A 1NPKA 2ZD1B 2B51A 2CNOB 3F44A 2BE7D 5AJ3J 1M5HA 3POTA 4U8YA 5J2NB 2DNYA 3MPUB 5A6WA 4NXMJ 2WVDA 1RWOB 4U7UD 3UDVA 1IBKF 1GMVA 1K0TA 5E41A 5DM7Q 2MJNA 1HBUB 2AJ1A 2F5GA 3DXBA 2HWIA 3CMES 3HI9A 4OZNA 1EETB 4WU2A 2XM3A 2F9JA 1KONA 3QQCD 2MLZA 3G71S 2HW3A 4NMLA 3RBXA 3M2VB 5KTQA 5CD4A 4OHYA 3GYXB 1BXNA 1DAXA 1REGX 2LQ8A 4I7FB 1XBWA 3MM6B 2OP5A 3T6BA 1HNZJ 1DY3A 5K5MA 2CRLA 4M8LA 2FHJD 3BJYA 1URNA 3IBFB 3UDLA 3NBPA 1SV5A 3HDSA 2V8GA 2CPIA 2ROEA 3MMBB 3RRGA 3CCSS 4GKJJ 2XTJP 3E2EA 5HQ8A 1H74A 2NXCA 1Q82T 1N36F 2CQ0A 2IC3A 4HL9A 2DGUA 4JB8B 4B3OB 1SJ1A 2EK1A 1V3ZA 4ZVOB 1CQNA 2A2DA 5BR8F 5IM0A 3QGIA 3FJ2A 1EKSA 1N5TA 4B9TA 2DGVA 2DO0A 4N77A 4QJVA 3DI6B 4DSLA 2DCUB 2CAJA 3OD2A 3CJ5A 3LTOA 2U1AA 1NJYA 2N3LA 2E1RA 4OZ0A 2YVSA 1ZM4A 2G1DA 3C6UA 1RTDB 2RKIA 2YWKA 2YNIA 2IM1A 1NK6A 3S6EA 2A2CA 3MM5A 1M5KC 2M0GB 2HAIA 3W7BA 1KR4A 2ZH6A 1TK0A 4O3RA 1ZETA 4P2FA 2VBWA 4X62F 4TU9A 2YNFA 2GHVC 1WOOA 2C2ZB 3T19A 3OLAA 3TX0A 3MEGA 1BGXT 2Y1IA 4NYPA 3RR8A 1FVSA 1LXNA 1R8HA 5KFHA 1OY9A 4U9RA 3AHPA 1RT6B 2FJEB 1HD0A 4WFBQ 4P73A 4QR1A 2BKPA 3T5JA 5FDLB 4FS2A 2XLJA 2LECA 1JLAB 3TARA 3DDIA 1NAQA 1YJRA 2IDLA 4HI2A 1L3VA 1S1WA 1NRKA 1NHUA 3M2UA 3NAIA 2HMIB 4XK8C 4HHUA 4JI6J 2BANA 2BXJA 3DM2B 4C8YA 3HHEA 1XNRF 3T41A 5IC4B 3LP2A 5IC6B 3IBCB 1UPMB 4WTYA 4NASA 4UW2A 5HMYA 4F7VA 1DURA 2XO6A 4WTOB 1MNEA 4OX8A 4CT8A 1S4FA 1HNWJ 2CQDA 3CCTA 2XI2A 5AE3A 2JLFA 1B7YB 4P71A 1MG7A 3QSYB 5AXNA 3QT6A 1S57A 2B9XA 3K5PA 1RB0A 1U6BA 1WWHA 3R97A 4HLBA 2NREA 3DOLA 2IRUA 1X8DA 5ETVA 4WBFA 3F41A 3P96A 5DLFA 1BQMB 2MXYA 4DV1J 4A4JA 4IDKA 3THPA 3GV5B 5LMUF 2KI2A 2BW7A 2RE1A 4NI2A 3NS6A 2O5DA 5F0WA 3O1LA 3VAJA 3IRXA 3HMJG 1FTCA 2ZBRA 2VH7A 1RHJB 3T9ZA 4DR7F 2L3MA 1FJGJ 1C2PA 2MLYA 1TFWA 5CYMB 3JAMU 3SSQA 1GMWA 1H73A 2R2RA 3BGLA 1LFPA 1GTHA 1WACA 3CCRS 3FMWA 4TXSA 1KKHA 2C2EA 4UQTA 1WNEA 4YN3B 3DLBA 3ZZOA 1NSQA 4PYDA 5ETTA 3UN5A 3K5NA 5L46A 1VJQA 1HQUB 5EWEA 2MQOA 5HP1A 4G1QB 1SKRA 2G13A 4W92B 4QCLA 2V4RA 1KOOA 3ISZA 2R2UA 2W24A 1W7WA 3O2IA 5HATA 2FVQA 1U0HA 1FNOA 1FXRA 4ZCMA 5HJYA 4R0EA 4I67A 3EWGA 2DR6A 1SB6A 4ILLA 1QLNA 4HACB 5HLFB 1E6VA 5C24A 2LFVA 4AQYF 3EYZA 2OLWA 4RW8B 2UXDJ 3MFHA 4CO2A 1DRZA 2C3YA 3GIIA 2W8LA 4DV6F 5CYQB 4EBEA 1SH0A 2QLFB 1Y9OA 4B08A 4O44B 2OGUA 4IFVA 3UO0A 1KLNA 3JYTA 2AKWB 2AJ0A 5L38A 2FZKB 1EKRA 3NGRA 1TL1B 1K8AT 4QYRA 1JXVA 4IOCQ 3HHDA 2CQIA 2V8HA 3MMAB 2CJYB 3H5SA 2MGZB 5L8RC 2DR8A 3NNAA 4ICLA 4PQAA 3LGHA 2FZCB 1MWZA 3G82A 1U1QA 3VGUA 1FNMA 2KM8C 3BSCA 5LSRA 2IVFB 2C2KB 2V50A 4OQJA 1RAOA 4D3GA 4LF7F 5L1IA 2NUUG 3D6MB 1RBAA 4K7QA 1NLKL 2UXCF 1IBMJ 2VV5A 2IJFA 1TFYA 4WIIA 4UUWA 4J9MA 5IXUA 1U09A 3FZ2A 4V19X 2M8HA 1RT2B 1UWBA 2WSCC 4UZBA 4ED8A 1EQ0A 2XMAA 1VLYA 2VC1A 3CIMA 1H6KX 2CNNB 4USHA 2CPYA 1I1GA 2CPJA 4ZIWA 2UUTA 1SH2A 3TZYA 2R7QA 4C0BA 3IGVA 4ZP7A 4CRJA 2XZWA 3AA8A 1GX6A 4BLGA 1DLOA 5ETNA 1AXQA 3TAMB 4NYOA 1WC6A 4K4WA 1B70B 9RUBA 4KR0B 5B0FA 3CC2S 5B0CA 4QU6A 1X9SA 8RUCA 3VZIA 2KT2A 1ZA1B 3HHLB 3BKTA 3VVTA 1R8PA 4PUOA 4FNIA 1DTTA 4P2SA 2Z58B 4TY8B 1OPZA 2V63A 4FYVB 1AZSA 3MMCB 3WIVA 2B4UA 3FDSA 1YTYA 4M5DA 4KV8A 5A8WB 4DR5J 2C22A 2LA4A 5FJ4A 3IS9A 4IRDA 1X4HA 1FRXA 2DNLA 5D0HA 4X66J 1GXLA 4WFNQ 4FF1A 1Y5IB 2GX8A 2JEIA 2HQ3A 4OHZA 2QN6B 2KJWA 5IV4A 1K1SA 3X3UA 4ES3A 1T0TV 4HT7A 2HKEA 3NRBA 3QZ7A 1UJ6A 4C0HA 2CQ1A 1QAJA 3ISND 2DRBA 2GJFA 1HWKA 2KJVA 1T9UA 3TWZA 4OL8A 4BHQA 2RDDA 4ITSA 2MKCA 2AP6A 1S1UA 5GMDA 1JLCB 3V2UC 4H4MB 3B82A 4NLRA 4NOHA 4YR0A 1FDAA 3PCOB 3FUYA 4C0OC 2OEKA 1IQTA 3GIKA 2VPZB 1SJFA 2XGPA 2DPJA 2F1FA 4CQ1A 2DNQA 2DK2A 2PO4A 3IBWA 4Z2XA 2VJUA 3D6FB 3C6TB 2RQCA 2BM0A 3HO1A 4HT5A 2MHEA 3CNQP 4F3MA 2HHQA 2HG4A 4N56A 3HHKA 2KRRA 2HHWA 3LPYA 4ED5A 2DBBA 1YDLA 4DPWA 1WELA 1J27A 4FVCA 2HFOA 4QQBA 1H2VZ 5GADU 2W1BA 3DMJA 4C97A 1M1GA 2UZAA 5I3QA 2Q3PA 3S01A 3V81A 1JK9B 3PV8A 3ZNJ1 2GIRA 2DISA 1WHXA 4ZHRA 2VDIA 3V6KA 4NA3A 1CJTB 2A18A 4J9KA 4NXNJ 2GW8A 1RBOB 1LWCB 3SCIE 1FKAF 1N36J 5KFMA 3MPYA 1RLDA 4DZDA 2C3UA 2PA8D 2PEBA 2HNDB 4Q0BB 2HHVA 1XC9A 1TVRA 3HHNB 3MTKA 1FF2A 1YJ7A 2AF6A 1WHWA 4ZLPA 1LW0B 4C7QA 1QM9A 3AQOA 1FFGB 4DCJB 2YWEA 2HURA 4DN0A 1K73T 4WP9A 2WAQD 2LEAA 1RAFB 4DV3F 1I94F 4AXIA 3MMJA 5J1NA 3U1MA 2MKKA 1FWPA 4ZOSA 4PKDB 1CEZA 3FBFA 2FJBB 2IMOA 2ZKUA 1BMQB 1T05A 4NCGA 1U25A 4A8SA 2UVVA 2EPIA 3I6PA 2KT5A 1HI1A 2DO4A 4DXLA 2XLIA 2R7SA 2Z2YB 2MZSA 3TRGA 4DSFA 3MXHP 5D4OA 3D66A 5L1KA 3JQKA 1UVLA 3QGHA 4LQ3A 2QE5A 1NJXA 2QSWA 2E1CA 1S10A 4J9RA 4FF2A 1IJFB 3OTCA 5B0DA 1TV6B 5A8RA 6AT1B 4WK3A 1Q1KA 4KO0A 3M30A 4YMEA 1IKWB 5DQHA 5ETKA 2V4JA 1KQGB 4R5PB 3SQOP 1GT8A 3VGTA 4F4KA 1U4BA 3O8WA 1M1HA 3TZZA 1FRLA 1NO8A 1WG1A 2G0JA 2VICA 1CVJA 2GAHC 2VG6B 4Q45A 4PQUA 1WF0A 3OHAA 2DXDA 4FYYB 4RW9A 2EEYA 1AFIA 3FZBA 4F0MA 2JZ5A 1C0UB 1X4EA 2MQMA 2W9AA 2WVEA 2VODA 1HBOB 4OX6A 4DL7A 2R7RA 1GMWD 3C15B 4URSA 3GR1A 5EWFA 4FYWB 3UDEA 4MFBB 1FRJA 1F9EB 4M5NA 1KVIA 2KYXA 4U95A 1AFJA 1CJUA 2F4VJ 4KJIA 3RBEA 2V2ZA 1TKZA 1QJHA 2VB6A 3DDKA 4BBYA 1NJWA 4DR7J 4JV2A 3R6LB 1H2UX 3BBBA 2D3UA 2ZD1A 1R89A 2MKJA 2MKYA 3SEOA 3HVWA 5EDWA 2PE8A 2VHGA 2E7WA 2GMJA 3I4PA 5HMZA 1RHRB 2N7YA 3MI7X 5J2NA 3RAMA 1N48A 1X7VA 3GWCA 3VCDA 4F3QA 4O3QA 2Z30B 3ZTSA 2CWKA 2KO1A 5KFTA 3KMQA 4J9UE 3OUYB 4ED0A 1KVJA 4WKYA 1HBUA 1IXKA 1RA7A 4YP3A 1QAYA 1FFWB 2BQUA 1SJ3P 5KFDA 2VFSA 4MK8A 1TL3A 1JWWA 4FVMA 4RX6A 1TK8A 2EI5A 3KLIB 2MSSA 4A48A 4Y65A 4F4AA 1U1PA 3QWPA 3MM6A 2XQCA 4BCAA 1VRUB 4NYZA 3G2XA 1UA0A 2J6SA 4X65J 3M9NB 3OPKA 3VAKA 3MMBA 4PG4A 2OPQB 5E5NA 4LF8J 2AYGA 1HHQA 4P74A 5CD4H 5F8NA 4OI3A 1ZAWA 2DHAA 4B3OA 2J0WA 1LWFB 3GP9A 4FDFA 1X9WA 2HVDA 1OO0B 1UVIA 1P1TA 2LYVA 4CM2A 3FEZA 5LXYA 2DGTA 4DV5F 2DD8S 2JVOA 3J80Y 2QT7A 1CJKB 5E3CA 2OPRA 3DI6A 3CJTA 1DQAA 4K5SA 1IR2A 5DDOC 1TP7A 3Q8PB 3AD7C 3KK3B 2ADCA 3MFIA 2ZZMA 5CZXA 5AXMA 4M5KA 2FGOA 2WZ1A 1S0VA 4J5OA 3HFVA 1RTDA 3TA0A 4QYZJ 2ZH3A 2OMOA 3NGDA 3A3OB 4WP8A 3WHIA 3CD0A 4UT4A 1U45A 2B0GA 3Q86A 4FBTA 3KLEB 3CT9A 3MOJB 2J0SD 3MCOA 2LXIA 1HWUA 3DDNA 1RAEB 5HVFA 1QVGR 1UVKA 1RXOB 1X5SA 3ADAC 3GB0A 3AB4B 2C42A 2AEFA 1FKOB 1OS5A 2HZVA 5K14A 4FPIA 2MB0B 5B0GA 1RT6A 2BR0A 1I6JA 2RB7A 2GFFA 3M05A 4NLPA 1RAIB 5IWAF 1B7FA 3RW7A 1M0SA 5FDLA 1E6YB 5F8MA 2RH3A 1GH8A 4M5IA 1JLAA 2LQ5A 3C14B 4NWBA 1D09B 3J7A1 3T1YF 4DFJA 2G2YA 4UF4A 4CYUB 3LWLA 2V68A 4DR4J 3KOAA 1GK8A 2HMIA 1YJTA 3BDEA 2M4MA 1QSYA 3ULHA 4C3MA 2GGPB 1CQMA 2VC0A 3DM2A 5L9XA 4ED7A 5JUMA 3M32A 4Q8FA 4J90A 4QIWD 4WFYA 3FRYA 1NEEA 2FZGB 2WRMA 5KFBA 3M8WA 4FYDA 1RT5A 5JVGQ 3I4HX 3DLEB 2YPYA 1Y00A 4M5HA 2Y0SD 2QC3A 1HQEB 3RTVA 3HVTB 4CNYA 1IN0A 1LWEA 5EX0A 3NOGA 2FJVA 5DETA 4QWEA 1UFWA 4NLTA 4GO7X 3TR5A 4P72A 4TLQA 2MPUA 2Q43A 2JNJA 1BQMA 1WKLA 2KG0A 4WWSA 1Q8LA 4YQWA 2HZAA 5D4LA 1J5EJ 5IZHA 2OO4A 5AT1B 3BREA 3NY0A 3FCVA 4I56A 3RB6A 1U26A 1NKCA 2V34A 2YKNB 3CCVS 5CYMA 2LKZA 2O1PA 3PHEA 1H7XA 1WJ9A 2CIMA 2YBVA 4J9VA 4XPCA 2GV1A 3U1LA 1R8CA 2X1BA 2ZJRQ 3TP2A 3I96A 5B0AA 3SZ2A 2DXFA 1RTJB 2GVZB 3CC7S 2H5EA 2IIHA 4KKOB 5E7OB 2RQ4A 5D4NA 4WJBA 4EBDA 4DCOB 4DR3F 5D77A 3RB3A 2IHR1 1HQUA 3VQTA 3K89A 3GCXP 3AJ2A 2W9CA 3DHWC 3LOUA 2QMWA 4TYAA 2CQ2A 4Y2CA 2FHOB 3CD5A 4LSLA 1UEUA 3IM9A 1Q8BA 1JLBB 5HLFA 1SL2A 3VF0B 2HHHJ 3U7JA 1VQPS 2DCLA 1IKYA 1NK0A 3ICLA 3IN5A 4RW8A 1UCNA 3D4JA 1O0PA 3KLFA 4DV7J 5A6PA 5CYQA 2K06A 4N7TA 4DX7A 1VS3A 4ECQA 1CPZA 2YWGA 4O44A 1M1KT 1S5ZA 3PJWA 4KFBB 4WE1B 3T1HJ 5JVHQ 1S6QB 2QGFB 3LPEA 3R8YA 1TL1A 2LP4A 1YBUA 1F3FA 3D0IE 1F6TA 2YQ1A 2VONA 3CB4A 1BY9A 5J2MA 1VFJA 3MMAA 1S6PB 2MGZA 2YX7A 4RWWA 3Q2TC 1REVB 2JSXA 2KRBA 4K4YA 3QO9B 5DG9A 3HF5A 5CHCB 4CLUA 2O66A 3S7RA 4B3MJ 4AYBD 3RR7A 3NS5A 3DLLQ 4DSKA 2UXBJ 3NWRA 2W2MP 2N3OA 4FF4A 3KHRA 1U8SA 2C1EB 4PR6A 4I2PB 4O3NA 2B4OA 2DHGA 2D9OA 3PG9A 3THVA 1VC5A 2FJXA 3GV8B 3PYDA 2M70A 4U8VA 3AOCA 2BACA 3OFEA 4DJBA 2WK4A 4ES2A 2DT9A 4JOUA 2UUAF 2ROPA 3E3XA 3FGVA 3GILA 1RTIB 1RT3B 2MLXA 5FLXU 3G96A 1ULRA 4QR0A 2ZOGA 4EO8A 1APSA 2MY8A 3W2VA 1AYEA 5KFQA 3CJ0A 1SCJB 4A8OA 2XHWA 4TY8A 5T7LB 1IBLJ 1SL0A 3W60A 5F0UA 2BE9B 1TR0A 3MMCA 2B5JB 2GJ2A 4HHJA 3KK2B 4EUVA 1ZA2B 3TO8A 3PW0A 1M5OC 1RT1A 3D5MA 5A8WA 1U1MA 2FVRA 2P9CA 1KNZA 2HHPA 4L74A 2KL8A 3CJ2A 1GFWB 2DB1A 2QLBB 3IG1B 4OYAA 1X0PA 4BWJA 2KDOA 1N0UA 4GMKA 3QPIA 2W25A 1V3RA 1KHVA 1F2GA 4CM0A 3HT0A 2EBGA 3MAQA 2LEBA 1CC8A 2COLA 4LVNP 5GAGU 4ZDNA 3OSNA 2OPSA 2WVBA 2R7VA 1PAUB 1UKUA 1TTHB 2XI3A 5CABA 1HBMB 1KFDA 4X64J 2ZVSA 4OZJA 1Q81T 2NR0A 2ZNYA 3W2WA 3CJSA 4AFFA 1VQNS 1UW4A 1MWQA 1EZZB 4DV0J 2ERRA 2E5HA 3H40A 4F02A 3OFGA 3TVKA 4X4SA 1S49A 1HD1A 3MHYA 3QMQA 2LLZA 3C6TA 4HDGA 2POKA 4PG6A 4UTGA 1KHWA 5F8IA 4MKAA 4PXDA 1U24A 2BRKA 5AXKA 3CCUS 4P6QA 4IKAA 3CJ8A 3NGSA 4UUXA 1N56A 1F60B 4KY3A 4IOBA 3DC2A 4C3KA 1LQ9A 2KTQA 2VQEJ 2AD9A 1WC0A 1RHKB 3CULA 1H98A 3EZOA 3QJPA 1LNQA 3QT7A 1RLCL 1SXLA 2IC3B 3A3PB 4KPCA 3M6XA 4AD6A 3GFXA 1FE0A 2HWTA 1XMOF 1S72S 1RISA 1OJ4A 2VFUA 4QPXA 2DH7A 3US5A 5IM0B 2LVWA 2MHNA 1CJTA 3OL7A 4DQQA 1CULB 2KHDA 1P6TA 2CG8A 2JFDA 2HGMA 3N5FA 2BABA 5D0EA 5CCLA 4WFZA 4J9OA 1LWCA 2FLNA 4DOZA 5HK4A 1MN7A 1X4DA 2MZ1A 3CE8A 2EWHA 5CZVA 4IR1A 1OYEA 2GZOA 2JLEA 5LM7E 3BF4A 2DNNA 4DPOA 4KGKA 3H98A 2HNDA 5EX3A 2YNIB 4Q0BA 4NLXA 4DR1J 4AUKA 2AJ2A 2F3JA 2XO7A 2KZZA 3BGRB 3RGIA 2ZE2B 4MKBA 4MIWA 4ZJQA 2MDAA 4PAAA 3GIRA 3MEKA 4EK2A 5H9FK 1LW0A 1IKVB 2IMWP 4TKTA 2ZKTA 2J7KA 4OYIA 5IT0A 4A47A 3MEGB 3N5BA 3C16B 4LF5F 1SC6A 3ILOA 3QIPA 2IJRA 2GVDB 2JC1A 2Y9HA 2WTFA 4ZVTB 1PYOB 3I31A 1N33F 2RUSA 4WYLA 4CDIA 1HHSA 2HPUA 3G6YA 3C19A 4RBVA 3T6JA 4DR2J 2LDIA 4ZPAA 1YJWS 1EB0A 3EVOA 3GSDA 3P49B 5J2PA 4ID5A 1SC3B 5EGYA 5F8JA 4F2RA 3KHHA 2UUBJ 3R5BA 2Z2LA 3GFZA 2K3IA 2HK3A 5KFFA 2G2OA 2FY8A 3LP2B 4FXWA 3HSGA 2BJ1A 3VAHA 3MR7A 3OFFA 5AXLA 1M5SA 4RR5A 1TV6A 2HFZA 2MZJA 2LMIA 5KG1A 3FBCA 4TQSA 4DUZF 5GAEI 3Q2SC 3K59A 5KT3A 2B9WA 1RKJA 3IRWP 3HD1A 1VBYA 4KGZB 2KFNA 2FHKA 2I8EA 4ECTA 2Y1JA 1Q4RA 3NOCA 4DU7A 4ZJLA 4Y2IA 2NPIA 1XMQF 1TMMA 4GRSA 2QYCA 2QA1A 3MM8B 1Q5VA 4ZVFA 4IDKB 3Q0AA 2HIYA 2WW4A 1ZS6A 1XR5A 3MCNA 1S1VB 1QVFR 3IRXB 3P45B 1HBOA 1BWEA 4TU8A 1S6UA 3P3DA 4DQRA 1NPRA 3C15A 4MT1A 3ZTPA 3MD3A 5AJ3F 4DX6A 2FUG9 3BGOP 2L9NA 4MFBA 1FTRA 2VDHA 2YH1A 2H4WB 4TYBA 2RILA 5DG7A 4NXMF 2GHPA 1SC4B 1U0SA 3BQ2A 4Z37A 4HI1A 3PW4A 2DH8A 4EYIB 3QAEA 4FS1A 3K5LA 2OTJS 2RVJA 1FKPA 4FZVA 2QO3A 2QA4S 4UY85 4F4ZA 3ZZ0A 2DHXA 5KFRA 1XIQA 3KNGA 1E6VB 3G6VA 3G86A 4KT0C 5C24B 4LMZA 1X4BA 1HBNB 3U1NA 3KTQA 5F41A 3G9CA 3AD9C 2RF2B 3OUYA 4TLRA 2R8IA 1HNZF 4YFUA 5GMEA 1JXLA 2AZ3A 1QTMA 2V8PA 1ZBTA 2RRNA 4ETZA 2Z0GA 2YKMB 1U1LA 4GKJF 4KIAA 4C6AA 2G1HA 1RCXB 1S7IA 3SMZA 3GONA 4PWDB 1I5OB 2HLUA 4A8MP 2PMWA 3TNVA 3MM7B 2GJIA 4CNZA 1RAAB 4DFPA 3RB4A 1VQSA 4DL3A 1VRUA 1QY7A 3UWTA 4DBQA 3UE2A 3G82B 3SQGB 4LREA 1WDTA 3CCJS 4LIWA 3A1YG 2VOOA 1BWVA 2OPQA 2EFOA 4B9MA 4G1PA 1R0BG 4OI4A 3NKYA 2VFVA 3L95X 2KZMA 3HVAA 3V6DB 4DQPA 3AT1B 2DNOA 2AIRB 4N47A 1UWBB 3VAFA 1JX4A 5KFEA 1VDHA 2XMWA 2UV8G 1T03B 1Y4ZB 1SVDA 4B9LA 3K5OA 1OSCA 4B3RJ 4B9VA 1WHYA 3PFOA 3EMTA 1DLOB 3N9UC 3OXFA 4NCAA 2MJUA 4B9SA 2BV3A 4ED2A 1HWLA 4OIXA 4LF4J 5J1PA 4DCPB 2NCKL 1WG4A 4Q8EA 2VFTA 1S77D 3RU0A 3HZEA 4PUOB 1DTTB 1FEEA 2N4DA 4I69A 2HAFA 5CXTA 1VQYA 1R31A 3ELHA 3AY0A 1Y5NB 3MDFA 4K4VA 3TAQA 2NQPA 4B9UA 1FKOA 1L3UA 1R8AA 2H9ZA 4KV8B 3JSYA 1NU4A 2IA6A 1A9NB 2XG8A 3PZPA 1NM2A 2RHQB 2CZ9A 3K58A 2PGCA 4F50A 1NJIT 5IT9U 3DCAA 1QUVA 3SXLA 2ZUAA 4DL5A 3PX0A 4ZPDA 1KC8T 3C14A 1HARA 1XMBA 3A13A 4Y2AA 4CYUA 1HNWF 4Q2LA 2V2VA 2FD2A 1RWPB 2VKZG 2V69A 2GGPA 3QBCA 1HPZA 4ZPBA 1F1BB 5KG6A 2B8PA 1VISA 1RK8A 4KHMA 1TL7B 1ZPVA 4F04B 4AL5A 2IJNA 4NLYA 2XSJB 4AE5A 1WUUA 4DV1F 3RRKA 1SQGA 1OY6A 3DLEA 1J2VA 1S7HA 5KFJA 3M8ZA 4OV6A 2XZTB 4OX9J 2DY1A 1HQEA 8ATCB 4HKQA 3MPVA 1QDUB 1VRQC 2JL9A 5DDQC 3HVTA 2R4FA 1UMJA 1FJGF 2DXEA 4LBPA 3AFGA 3E01B 4DUYJ 2W7PA 1ITPA 3MPDA 3RJMB 3CXCR 2RU9A 3NNHA 1EARA 1WKJA 2EW9A 2ZVIA 3M6UA 2IFXA 4HVZA 3FEYB 1OWXA 4PG5A 2P6TA 3DMJB 1JIHA 2OSQA 5T14A 1YJUA 2BMBA 1N54B 2YKNA 3V81B 3AJDA 1V6HA 2EK6A 5ETPA 2J5AA 4YDXA 4ZHRB 2QA2A 1RTJA 2ATCB 1MN9A 4KKOA 5G4DA 2HS3A 4ZPTR 5DG8A 1KVKA 4LR8A 2NLWA 5DM6Q 3NGUA 3IWXA 3I55S 4S0MA 3QLHB 3O3LA 3SYZA 4ER8A 4J9QA 2FB0A 4I6WA 2UXDF 2AHOB 1RAHB 3RAXA 1SKWA 1RSCA 4RW6A 3LGMA 2XWXA 2V9KA 4QZVB 4C8LA 1TVRB 1WEXA 3NMAA 1RWXB 1JLBA 2ZHAA 1YK9A 4XDDA 4LQ9A 4X4PA 3TUJC 4WIQA 4ZPWR 3ZTQA 3HCXA 2HFSA 3M2RA 2PFDA 5DJBA 3GG0A 2XMVA 3R5CA 5ETMA 3KUGA 1HW8A 1JKHB 2G9OA 2HQIA 2BJ8A 4KFBA 3TEHB 4WE1A 4RWXA 1S6QA 4KYZA 1O51A 2FPHX 3L7UA 4LF6J 4ED6A 2MEWA 4ANDA 3CF5Q 3CDUA 1IBMF 3BPSP 4X4UA 2DIUA 4ETXA 3NL0A 4GVBB 1S6PA 2QEXS 4M95A 2PFFB 1JB0C 2E7XA 3QFWA 3CD6S 3ZNUA 2LQBA 1R27B 4RJVA 2YWHA 3F56A 5KFIA 1FX4A 4MMOA 3D3CJ 1R6VA 2ABYA 4KO0B 1QAIA 2V94A 2CXEA 4I2PA 2V4JB 3OSPA 1VC0A 4IO1A 4DZ6A 4E98A 2V67A 3DGVA 3HX9A 2CQCA 2HQGA 2EKNA 1UWAA 2Q66A 2MZTA 1U47A 1PJ6A 1KBRA 1FI4A 3P6YC 2OD6A 3EXCX 2ZH8A 3GYNA 3W66A 3GJRB 3ILIA 1RTIA 2GQQA 1RT3A 3TJAA 4HH1A 7FD1A 4DR5F 2J0XA 3H0PA 2GC8A 1XTZA 4R0JA 4X66F 2HBQB 4XTTA 2DEIA 3K2YA 1J5OB 1KFSA 4MAKA 2KH9A 1RACB 1N6QB 1P9YA 2C2NA 5HAOA 3VWSA 2ZH5A 1CJUB 1RT4B 5K20B 3DLJA 3TQ1A 3ZTOA 1Q86T 1TKZB 4KRWA 1U2CA 1EP4B 2IRYA 4JI4J 3LANA 1M5PC 3OBIA 4JV1A 2CJKA 2XWYA 3IG1A 4OYZA 2CJQA 2BJ9A 2XMKA 1QSLA 4ZKAA 4WZQA 4QBUA 5KG3A 1NHVA 1KRPA 1X5TA 2CPXA 1FJCA 5MAOA 1SJRA 4NX9A 3TZWA 3I0SB 2BKOA 2DGXA 4G1IA 4EU0A 1A0OB 5HI7A 3DRSB 1HBMA 4IRCA 1GTEA 5IOLA 3K5MA 1DZ5A 1YZ7A 1K9MT 4LSZB 2R2SA 2GO9A 3DRPB 1WEYA 2HFNA 3KUEA 4MIAA 1TL3B 1PJ5A 2L9DA 3VTIA 4NLOA 3ZZZA 2FC8A 2HQCA 5KFNA 2HEKA 2R7UA 3AA9A 4A8KA 3QJJA 3U27A 3TUIC 3GMGA 4TQRA 5IV3A 1IM4A 4NXNF 4FXVA 1TUVA 3HT3A 3WZ0A 5ITHA 1N32J 3HPOA 3CCMS 2E66A 3K57A 1RWKB 3R7SB 3KG4A 3DLKA 2YXLA 2OH2A 3BSNA 5C25B 2R3VA 1SQEA 2DYAA 1L3SA 2KXHA 3OTBA 4JBCA 4F67A 2UUCJ 1CULA 4ZVEA 2OPRB 1KTVA 4KC5A 6FDRA 3FQLA 4K2JA 2EKYA 5IS2A 3LP0A 2E1MC 1ZOTA 4I6YA 1R0AB 3SSRA 2Z57B 2ASJA 1C1CB 4TVAB 5K9FA 1B3TA 3T1AA 4YOEA 2D3ZA 3DYAB 4P9SA 1WORA 4LFCJ 2JHEA 2ZNZA 4RBUA 2D69A 2ZOMA 3M8PB 3X1LB 3N0VA 1WOSA 3PM9A 4N41A 4RPFA 4I2QA 4OYMA 4DEZA 2Y1RI 3BGRA 2ZE2A 3KKFA 5FD1A 5BXIA 1IKVA 1I51B 4YDDB 1VQLS 2B4PA 4IG0B 2ZH4A 3TAPA 3C16A 2PMHA 4DV4J 3HLUA 4DF8A 2GCFA 4MKVA 4LFAJ 3OV7A 2JEJA 5LMNF 3MUMP 4WK1A 5K14B 5IFMA 2GVDA 3LA0A 2J9DE 3T5KA 1OY8A 3EJMA 3RBDA 3ZZYA 1UFLA 1N5YA 3SCKE 4P52A 2HVHA 2BW2A 4JI5J 2A0FB 3KHGA 4U7UK 1PILA 5K8PA 2CZVC 1NKBA 2XS5A 1U6FA 2CPEA 3L7PA 3IR7B 1VQ7S 4E2FB 3JXOA 2ZZTA 4JUZA 4GKKJ 3D6HB 2XZDB 2XNQA 2CDRB 2W2PP 3M32B 1VRTB 3FNNA 4QR2A 4JI7J 1RT5B 2J9CA 3MM9B 2H4YB 1GXUA 4CO0A 2VIHA 4GO5X 2QYGA 2OJ3A 4RNFA 3HFZB 2ZDPA 5SUHA 2OAUA 3GPAA 4X2BA 2B8QA 2ZH2A 3I32A 1LWEB 3OT9A 2R7OA 4U67Q 1ZTTA 3BQ0A 3UQSA 4YUDA 3OVSA 4ZCKA 4A8WA 1N52B 3MM8A 4PABA 3B6BA 3H42A 3IC1A 2KU7A 4L73A 3CSKA 2F4VF 1S1VA 4LSNB 2W2NP 2DGOA 2QL9B 3Q22A 3UNGC 4M5GA 4DR6J 3QT5A 2JX2A 2ILYA 1YLXA 4KSEB 5F9LA 1VBZA 5KFOA 3A3NB 4XDCA 4Y2KA 2CPZA 3GV7B 4WFXA 2KXNB 2VZ9A 1RWMB 4UOHA 5GAHU 3AXKA 3FCWA 1DQ9A 3G6XA 2CQHA 4J7CA 2W9CB 4JI2F 3I5BA 2OSRA 5GAHI 5EWGA 3GJQB 4W90B 1TKXB 3FMBA 4YEAA 1KD1T 1JJCB 5JXSA 8AT1B 4LSLB 4B3SJ 1KEKA 1H0HB 4USUA 3R7BB 1B0VA 5DRKA 1HYSB 3LQVA 4DQIA 1DTQB 1HBNA 2K1RA 1UA1A 3ENVA 1IKYB 4C8OA 4WYWA 1RWUA 2RF2A 2XCAA 3JS9A 2AGPA 3KLFB 3ZZRA 3THTA 4O4GB 2XY5A 4A8YA 4X65F 1H72C 2MTLA 2LDYA 1MU2B 2YKMA 1PYSB 4Y0FA 2F8MA 2Y1LB 4LF8F 4DI6A 3I0RA 3D1QA 3FVYA 4F25A 3CCQS 4PWDA 3R9LA 1WC3A 3UR3C 2Z8QA 3MM7A 1X60A 5J2MB 2ASYA 3W5YA 2FC9A 3ET6A 1S59A 1RAGB 3PJ9A 2FIUA 2AGQA 1Z1ZA 3SQGA 4WXWA 1RTZA 1WF2A 3DLGB 4OJ3A 3ZZUA 3QRPA 2YWFA 4GC7A 3V4IB 1IUJA 5KFUA 1VK3A 1RE1B 3BGFA 2AEMA 2DGQA 5CQGA 3PYFA 2MKHA 2LXUA 1X5OA 3V6DA 2A3JA 1C4AA 2K7JA 1RI7A 3PHTA 4RNMA 3R2CJ 3BSAA 1NSPA 2EG1A 1B0TA 4B9NA 2QV6A 4J9SA 1R43A 5J2QB 2CQBA 4QIGA 2PA3A 2GIFA 1T03A 1ROFA 4DL2A 4H4KC 2KM8B 3ENWA 4PWUA 4ECSA 3W8PA 4IUFA 3K17A 1HMVB 2XLKA 3CUNA 1AROP 2I6WA 2VL1A 2BDPA 3W2VB 1SQFA 1TKDA 3VR1A 6FD1A 4RUCA 4O3SA 5D0RA 2UU9J 1ZAXA 1XJWB 2HFUA 2J0QD 1S79A 5A8KB 4RUBA 4ECWA 4DR4F 3A12A 1TL4A 4IH6A 1RT1B 2QTWA 5KFXA 1FNXH 2KVIA 4RNOA 1F5BA 2W7OA 1A6LA 1FX2A 2E1AA 1NHKL 2BBEA 2W8KA 4IQMA 2APOA 2OFHX 2KVQE 3BEGB 2BE2B 2LQJA 5I42A 4K0KJ 3MF5A 4MH8A 2CJAA 2CJ9A 2W4DA 2WOMA 3BN4A 2P9EA 2FY1A 1UVMA 2OPSB 3B54A 3OFHA 4RKUC 2HNZA 1RGVA 2X3GA 3IGNA 4QWBA 3W2WB 4YHHJ 2I9SA 1TL7A 1ZM2A 4USJC 4CTAA 5E3QA 4CO1A 1YJVA 2XSJA 4HEA9 4J91A 2W2OP 4LBHA 5DO2A 4ECZA 2CQ4A 1AT1B 5IQQA 5L1LA 3FKBA 1KQKA 1J5EF 3PY8A 4RBTA 1GX5A 3KJVA 3DHXA 3DXSX 2V9WA 4A8XA 3Q24A 5CYJA 1FESA 3EDRB 3J7AN 3TZXA 2M9KA 3FSXA 1RWWB 1WSRA 3PXGa 2R8HA 2I5JB 4NMXA 5EN1A 1AUDA 3E01A 4CIOA 5K8NA 3J81j 1WTFA 4NL5A 2JOQA 4HHHA 2HNYA 4IH5A 3N6LA 4JV5J 3JSMA 3BV8A 2QLWA 4KHPJ 4V1Ak 3GCWP 3L09A 2ROGA 4F4XA 2HRUA 4LRFA 3EX7B 3MECB 4OI6A 1YWXA 5GADI 3ZO7A 5L9NA 1BUXA 2AQ4A 2BM1A 2HHHF 2JDJA 3J81Y 4XIUA 1TK5A 3JSBA 1FE4A 3QLHA 3ZFVA 2C2OB 3EGNA 4AT1B 2CVIA 3TANA 2GQ2A 2NXNA 3DNCA 3MURP 3PW5A 4DV7F 2J6UA 4Z7CA 1YRXA 4QOTA 4LRBA 1G3OA 1T7PA 3UVJA 4DQSA 3UR0A 4LR7A 4QIVA 3T1HF 1D9AA 3GZ7A 4OYPA 2E5GA 2IAJB 2HSEB 2DHSA 2JFKA 5H1SV 2XNRA 3MAHA 5KFPA 3DFEA 2ADBA 4XAKA 3Q8QB 1G6BA 4DV2J 3QIPB 3ZC4A 4ZVPB 2DR7A 4NZ6A 2HHXA 3HP6A 4N76A 2PN6A 1HFEL 1JKHA 1N34F 2EFQA 3BKUA 3M9OB 4NRTA 4YY3J 3GYGA 4OHXA 4B3MF 4M5LA 4X4OA 3IAM9 1SIWB 4WPAA 4RUAA 2UXBF 2H5JB 4CH7A 3A8EA 5HROB 4TY9A 5J2PB 2X1GA 1ICEB 2ZH1A 3LAMA 4ID5B 5AE2A 3CJQA 4GVBA 5LMNJ 4H4OB 2J8AA 4MIBA 4K4TA 4HTIA 1JQGA 3W8GA 2VPWB 3TUPA 5C7PA 5LSOA 1NNDA 5A2QY 4USMA 1JJ4A 1LKZA 5E2QA 3KLGB 1Y5LB 1O5JA 4O3PA 3MUVP 1WEZA 5JMNA 4ZK7M 2NS1B 3NMRA 2BX6A 2EFVA 2HVIA 3KG1A 3BSOA 4ZN3A 1SBRA 4NLWA 3ZTRA 2DPIA 3G8SA 3PR5B 1RABB 1IBLF 2VG5A 4UOFA 3OHBA 3SV4A 3MPWA 2BQ3A 2DNZA 2DNPA 2X51A 2WVCA 1L3TA 1B64A 1OPIA 2C2MB 3TI0A 3J80U 2MQ8A 3Q89A 2ZOFA 2VF3A 1SKUB 1RUSA 1PBUA 1URRA 2YQ3A 2XMJA 5CH7B 3MEEB 2FVPA 4R25A 1J5OA 1CLFA 3DOMB 2ASDA 1N6QA 5L39A 2GS8A 2DNRA 4CLLA 1RT4A 1U1OA 4CLYA 3D9BA 3QRQA 1MMNA 3FK4A 2AZ1A 1FHTA 4X64F 3EVMA 2FTRA 1EP4A 2HZCA 2L08A 1NK7A 1T8EA 2KHCA 5D6GA 5KFAA 1FKPB 1XNQJ 3CTRA 4DV0F 4QYZK 2YWWA 3GJTB 1RWNB 2RRBA 3I0SA 2ALZA 2CJBA 2FJAB 3WC2A 4X4VA 3DRSA 4JI2J 2EG2A 1RHQB 1CBKA 4KBIA 1R6YA 3CMQA 5C42B 2Z2ZA 3OTDA 3DRPA 4USTA 3KWMA 1S6OA 5KAKA 4ELUA 5CAAA 2V2QA 4RW7A 2VQEF 4ZLNA 4W4MA 2YKPA 5HQLA 3VAIA 4M94A 3B4MA 2OPPB 4UOCA 3H59A 2V2KA 5KG0A 2HK2A 3D6TB 4IH7A 7AT1B 4PPZA 2DKOB 3K0JA 1HI8A 1V5VA 2YKAA 3G87A 5E33A 2ZBIA 1RTHA 4TN2A 3O5TB 2KB2A 2BJ7A 3JTNA 1SJQA 2JWNA 2X3DA 4UZCA 5KFLA 1LK5A 3SDEA 4KB7A 1RADB 1MMLA 4NLVA 2ZEJA 1P9QC 5C25A 3MGJA 4RU2A 1F2HA 4DR1F 3MZIA 3QFHA 2VD3A 4ZVSB 5E0OA 3Q8SB 2NXUA 3ETOA 4OI1A 3BPDA 1K0VA 1DARA 2OHDA 3PX6A 2ACMA 1R0AA 1HW9A 4Y34A 4LIRA 1C1CA 1QTNB 4OJHA 1TU0B 3DYAA 4W98A 3M8PA 1L3KA 1QUPA 1N5QA 1YBTA 1HL6A 5IQ6A 2ZFHA 3HXMA 4H54A 3RW6A 3OXGA 1PBAA 4FNHA 2HVEA 4JI1J 2AGOA 2O3DA 3MCMA 4DR2F 2WONA 2AX1A 4USVA 4ECRA 3O44A 2OMLA 4IG0A 2OEJA 3QWUA 3ZXWA 4RNNA 4NLQA 2PEHA 1KTQA 2P9GA 2W4CA 3FBBA 1YSJA 3SFUA 2UUBF 2J8SA 4OYOA 1FFSB 4DL6A 3NS7B 1Y10A 1UJ5A 2UVRA 1S9FA 4WF9Q 1O6XA 1Q0NA 4X84A 3TX8A 4DG1A 1WI8A 2G2ZA 3EVWA 4K2XA 1S97A 5I3PA 2OKQA 1IBCB 4JI8J 3CDAA 4IYQA 4RUHA 1TMJA 2MSTA 1HPZB 2MQPA 2KFZA 1S0NA 3B8HA 1A7GE 5DGBA 1VRTA 1HLWA 2YKQA 2M8DB 3ENQA 3ONQA 4GC6A 2IYIA 4P2MA 3MM9A 1P1LA 3PTWA 2WB1D 4ANCA 4I0WA 5F8HA 3CCZA 2QSFA 4DSIA 2UVUA 4JI3J 1DHMA 2R7TA 4LF2A 1XERA 1HNVA 4BWMA 1UZHA 2E5IA 4WXOA 2J6TA 2M5YA 2NZ4A 3W9IA 2YY3A 1T9TA 1T9WA 4MJKA 1SH3A 3MR6A 1R0CB 1IVZA 1XQIA 4USIA 1FO1A 4MYTA 2KFYA 4EFAC 4G65A 3PW7A 4ZP8A 2ATLA 3CJKB 1CS4A 1HR0J 3D0HE 3TOQA 4LSNA 3H25A 3IAS9 5KT7A 3CEDA 5F8GA 3R5DA 4J9LA 5ETSA 3KXDA 3MOZA 2XMUA 4JYAJ 1GNKA 1PAEX 3ITHB 1HWJA 2QIFA 4WP3A 1HNIA 4ZJOA 2HQFA 2R7WA 1SJ4P 2HHTA 3OL8A 3L3CA 2FGCA 3WC0A 2YQ0A 1ZH5A 1T3NA 4KTQA 2NSCA 4RW6B 5HANA 1TKXA 1SUQB 4YB7A 2Z56B 1H2TZ 1S1XB 4ELTA 1RBLA 3CCWA 5KG7A 3IR5B 1VC6A 4LF9J 3MWBA 4EWTA 2KN4A 3EPGA 1SKSA 3L9ZA 1FDDA 1HYSA 1FXLA 4M5MA 1DTQA 2B6AA 4XPEA 4KQZA 3CJRA 1NDPA 2IBKA 1QE1A 3M2RB 2BOPA 3GJSB 1WHVA 2CUYA 2E9TA 4ES1A 1G7CB 2ZJPQ 4O4GA 3AOBA 5FIIA 4DPUA 4OV1A 4ZA1A 1O8BA 2YNGB 5HMWA 1X9MA 1MU2A 4EGLA 4URQU 4ED4A 1T3OA 1GAOA 3SCJE 4DX5A 1CC7A 2B3TB 2C2RA 3KDNA 1T11A 3AJ1A 3EZUA 4WU3A 3SBMA 1RT7B 2CVEA 1RHMB 3FFIB 1SPBP 2W9BA 3EICA 2M7SA 2D74B 3QYYA 2ZHBA 1HQ2A 1MW7A 3KLHB 1MSWD 3B4DA 5M2UA 4IG3B 1VQMS 1N34J 1U2RA 2H65B 3DLGA 2ZZNA 2PMZD 3RYLA 3V4IA 4C4WA 2G4BA 4MK7A 3PO4A 1PG5B 3PX4A 4B02A 2E5LJ 3UCUP 3FRZA 4B3RF 3W5ZA 5BYSA 3F73A 1K47A 2V0NA 1VMBA 3C2PA 1FDNA 4IQXA 2NYHA 5HL7Q 1EIYB 4LF4F 1QSSA 5J2QA 4UOGA 2EC2A 1EQMA 2FJDB 3HHLC 1LFWA 2N4CA 5KT5A 1HNXJ 1Y11A 2R42A 3GLJA 5BJRA 2E9RX 3DOKA 5LXRA 1JNRB 3JAMY 4U7CA 3H20A 1HMVA 3CDWA 2M2BA 4CLZA 2K7KA 4HTJA 2VU5A 3W62A 4JI0J 2HGLA 2MMYA 4ZITA 1C0TB 2DR9A 1F9HA 3I9ZA 2FLLA 5A8KA 1S48A 1TL5A 4OYXA 4BDPA 1JLFB 4OLOA 3GIMA 3GFYA 4H4KA 4DLEA 3NCPA 1R7IA 3R7NB 3KG0A 1S9GA 2ZM6J 2RD5C 4YB1P 2QLJB 1MLAA 3V6JA 2Y8YA 2E5JA 2PC6A 2M88A 4A46A 1NK9A 2CPFA 4P7TA 4EMDA 3BZQA 2I1RA 2DH9A 3CJ3A 2YPZA 5HMXA 3Q8UA 4G3IA 5GVQA 1YKWA 2A10A 2BE2A 4EI2A 4ILMA 4PRFA 4OZ2A 1FCAA 3DRRA 2QLXA 3BR9A 1S12A 4L75A 1T9XA 1U1KA 4OX9F 1U2FA 3HULA 1NCLA 3R5GA 4HR2A 2H3EB 1YRTA 4L3KA 4K4UA 3BS9A 4DL0C 3EZ5A 2F8EX 1PSDA 3CVKA 2J7WA 2DGSA 5GAGI 4CP5A 1TQLA 5D3GB 1W25A 4DUYF 3ENAA 1Q53A 4F2SA 1N5SA 3AB2B 3D7SB 2BRLA 2XS7A 1YQHA 1KN6A 1Q5YA 1FRMA 2H51B 1BHNA 2ZDOA 3M8QB 2NUHA 3JTPA 2O67A 4DF4A 2NYIA 3D54A 4BC9A 1I3OB 2RIJA 3J7YU 2MQQA 2I5JA 2RDIA 3EDQB 3IFEA 1W26A 2HRYA 4PXCA 1IBKJ 3J7YI 3IWNC 3BM7A 2HRTA 2R8JA 2EC0A 3OR1B 4CLTA 3G8TA 4URGA 4OLPA 2AJ4A 4DN9A 3GQCA 3RRHA 4ZVHA 3H2VE 4E0DA 4NEZA 4DX8H 2F7VA 5BYRA 2NPFA 2IVYA 3DLKB 1OQ6A 4C8ZA 4O4RA 2DY9A 3KJNB 3R1HA 3K7RA 3MECA 1BD6A 2WSEC 4ZMMA 3N79A 2LEPA 1C1BB 2RRAA 2ACYA 2GO8A 3CD7A 2DITA 3S8SA 2XY7A 2U2FA 3TVYA 4CCHA 4C98A 3CW2C 4AL7A 3UPFA 3LP0B 3N6NA 1B4SA 1KOHA 1SC1B 1L5UA 5B7WA 3OL6A 3M7VA 4CLWA 2HHUA 3LALA 2RJZA 1U49A 1BQNB 3AOAA 2KT3A 2RUGA 4I2QB 4J9NA 4ID8A 3M8SA 3PVXA 3D1HA 2VOPA 4RO0A 5DS7A 1NJZA 2IAJA 4DS5A 3PFEA 5AE1A 1TKTB 3CIZA 4CLFA 2F8HA 3MEDA 4RW4B 4ELVA 4LF6F 5RUBA 4DSJA 2QA4G 5ETRA 3EGVA 3LP1B 5BR8J 3M9MB 1IJEB 1JLEA 1D9DA 1LW2B 4PXBA 5LT5A 2QMXA 1S99A 2D41A 1Q8IA 3IO1A 1N5YB 1LK7A 2M52A 2OD4A 1WSVA 1TUWA 2OTLS 4PG7A 2JJ4D 1MROA 5HROA 2RS8A 4TNOA 1DFDA 3QJLA 3SI8A 3CCLS 1FJ7A 4K4ZA 3OR2B 5E3AA 1RP5A 1WKKA 4GVLA 2XMTA 2FHMA 2HGNA 4H4OA 3DKDA 5E3PA 1D8ZA 1GXTA 3IXQA 4LBIA 4ZIVA 3PIOQ 4QW9A 4X62J 1X4AA 3MCSA 3W9JA 1KP6A 1WDDA 3HKZD 4K5RA 3R1LA 4ZVGA 3TA2A 3CMAS 2R2TA 4Z7YA 3BDPA 2MZRA 3KLGA 3CDEA 3QAUA 4FF3A 3UW1A 2CNKB 4CH0S 4RL1A 4OYBA 2CYYA 4C8KA 1ZZNA 3S1TA 4OJ1A 4A8QA 3LW5C 1ACMB 3BH7B 5E3RA 4R8UB 3VHQA 3UD3P 3I5AA 5F8LA 2A1BA 3BYPA 3MUTP 1Z2ZA 1S9EB 4MYUA 3DRXA 1NK4A 3CJ4A 1RCOB 4PEOA 1D1UA 2P2CB 3W61A 2GNKA 5HVGA 1VR6A 2EVZA 1Q7LB 2JEFA 4G6VB 4PPDA 1XNRJ 5DZ7A 2OUGA 2V5HG 5T41A 4HH0A 2J9EA 3HSJA 4JI4F 1FERA 4N8NA 4D3HA 4O0IA 3MEEA 3VZHA 4DUTA 3NNCA 2RAQA 1JMTA 3DOMA 1XEZA 3WX4A 5I4MA 2H5IB 1U8WA 1Y7PA 5F3ZA 3PRDA 4X4NA 2CQ3A 2ALYB 3UN2A 4C9DA 4ZLJA 2OFGX 2Q6CA 2YNHB 2CWXA 2VJVA 2PSZA 3PEJA 4ECUA 1U6ZA 4NPOA 4F0HA 4K8RA 3FBEA 5LMUJ 1JXEA 1C4CA 2LXFA 3AXMA 2IM3A 3A8JA 5KT4A 2Q1LA 4J37A 1JLQA 4F36A 1JJHA 5LSLA 2AU0A 1ZTWA 1FWKA 5G0RA 4IR9A 2DJWA 4ERDA 3WX8A 2K1RB 3CDBA 3D2WA 3NCRA 2BOAA 4DFKA 1OMSA 5I3UB 1KDNA 3I56S 2RS2A 2JLGA 2RQMA 2QRRA 5C42A 1PJ7A 5BYQA 3R3TA 2D1CA 1WC4A 4B3TF 3DU5A 2F4FA 4RLEA 4LFBF 1IWGA 2DNMA 3DGPB 1HI0P 1N32F 3I0RB 4HDHA 4IFYB 3KFWX 9ATCB 3H5YA 3HK2A 1X0FA 1RAJA 2OPPA 1EETA 5A0YB 4NLSA 1NH8A 3ET6B 4DPTA 4CLSA 1KQSR 3M2VA 4N5SA 3T5LA 3UD5A 3HJFA 2CQPA 1NUEA 2UUCF 3PIPQ 4AQYJ 2B43A 4I7FA 5HSPA 3I82A 2XEXA 3G6ES 1NDLA 2QMUB 1FXDA 4F4YA 1T02A 4PWWA 4DV6J 4CO3A 1KSPA 4RU9A 3KJQB 3UDCA 4LFCF 4PZVA 3JQMA 2BVZA 3OTOF 2CJXB 4OZ3A 2DRAA 3U02A 5L1JA 1CJVB 1S76D 3A8IA 2OEMA 3I87A 4ZPCA 3A4TA 1S0OA 2X7IA 4OHWA 5DLGA 4NA2A 3Q8RB 4DV4F 3HVRA 1U1RA 1U1NA 4LFAF 2IDEA 3EUNA 1VOMA 3OJSA 4DFMA 3A8KA 2PI5A 1TAQA 2R7XA 4LF7J 4YS2A 4PYAA 4ED1A 1VBKA 1JJ2R 4V19J 4L3NA 3NGTA 2GAGC 2QL5B 2UXCJ 4JI5F 2KG1A 2RDJA 5CA5A 2Q6BA 2NZCA 4C11B 3R5JB 3VVUA 3L4BC 1AUSL 3PRBA 1OSDA 2AW0A 5DQIA 3L7OA 1FD2A 1V9OA 4OZ1A 4GKKF 3VALA 2LU1A 4MKYA 2BKNA 2B56A 3C3LA 4JI7F 1N88A 2VBXA 2PDAA 3R6GB 5I42B 1B99A 1X5PA 2WOMB 5HBMB 2PT0A 1U02A 2SXLA 2FQQB 4DSEA 2VG7B 3H2UB 1NMEB 2IRXA 2LCWA 2HNZB 2CFXA 3QIDA 3UN3A 1FA0A 1FRIA 2VBYA 4CTAB 3D3BJ 4FN5A 1LV5A 4X4TA 5ETOA 1D3WA 4NLUA 2H54B 4DPYA 4Y6IA 4YR2A 1EJ7L 1RKIA 4PCQA 1TAUA 1IKXB 3KJVB 2AMCB 2V8VA 2XHCA 2BZ2A 4QWCA 3UCGA 3M1VB 3KK1B 3AD8C 4DR6F 1G4CA 5KFGA 3O6QA 1EAYC 2O01C 1LWXA 3H90A 2ASLA 1YVFA 3D28A 2MQLA 4C2MA 2G0CA 1JLGB 2XYHB 2ZBPA 4OZLA 4K4XA 2HNYB 4CZCA 1RJJA 1YRUA 3CJKA 1VQ5S 1G2EA 2BEFA 3PDNA 2DNGA 3GSIA 4I64A 5D4PA 1TZ0A 3JSMB 1WG5A 4CWBA 5KG4A 3BQ1A 4NE9C 3WDOA 2KXFA 1XR6A 2V8DA 1RWVB 5KFZA 1VBXA 4B3SF 4ZVQB 3ITHA 4QU7A 2CPHA 1UAWA 3QT8A 3TA1A 4ATNA 3OLBA 3MTJA 2VQFF 3EM1A 2B7CB 2DNKA 1NB7A 3H4BA 3QZ8A 2VA3A 4NLGA 5LL6d 3VAGA 2J7UA 2EFPA 5DZ6A 1SUQA 1VQ6S 1KLMB 1S1XA 2W7AA 5LJ5Y 2DHHA 4NLDA 3UVJB 5KOXA 4CLKA 2HBRB 1D9FA 4IRKA 4OYWA 3GR0A 3NCQA 4G1QA 5HO4A 1IQZA 2YH0A 4CT9A 3M8YA 1G1XA 1VHFA 1FK9B 1F5CA 1OYDA 2DRDA 2N7CA 5U47A 2R8KA 3UI3A 2ZBQA 4HACA 4FXDA 2H1YA 4QIFA 2YNGA 3UFCX 4OI2A 4I1TA 4Q2MA 1W2BR 4DWIA 3RZAA 1K1QA 4FKXA 1RQ0A 4K50A 1NZAA 2D7SA 4NZ7A 3M6WA 3D1OA 3G8QA 4LRCA 2CZ4A 2CG4A 2ZJQQ 3JSRA 2QFIA 1RT7A 3V4MA 3FFIA 4QW8A 4AXJA 3AQPA 3KLHA 3N01A 4IG3A 3CWJA 2K8GA 1UEVA 1PGZA 3HZGA 2NSBA 4DLGA 2PIIA 3UD4P 4P7VA 2V6AA 1JNZB 1YJNS 1S1TB 1M5VC 4DV3J 1I94J 1VK8A 3IM8A 3BBFA 1UJ4A 2DTJA 4DL4A 5D8HB 4ILRA 4L76A 2E9ZA 4TU7A 1VQ8S 1VIOA 5J1EB 4QWDA 2XYGB 1Q16B 7FDRA 1PYTA 2VG5B 4KAIA 1AW0A 2UU9F 2GHWA 2OIHA 3R2DJ 3BBCA 2B9YA 3OVAA 1RT2A 2VBZA 3JQJA 5KG2A 4FBUA 1H38A 1RYSA 2AYBA 1X4GA 3TVZA 3TJ9A 3HSDA 5A76A 3IMQJ 1VI7A 4F8RA 3VAMA 1YITS 3MAAB 1S0MA 3K8VA 2L48A 1UW9A 2VPXB 2G0IA 3FEXB 3TAMA 3HJVA 1C0TA 4Y2MA 4K0KF 4USKA 3ZZPA 2ZH7A 2VASA 5LJ3Y 2XB2D 3PYEA 1DJ0A 3H7HB 4I6AA 1JLFA 3HHLA 3EGZA 3C46A 2OI2A 2A6OA 4FKYA 1N4LA 3CGIA 2HHSA 4ZCLA 2D3O1 3ISNC 1PC5A 4O0NA 4JP8A 4YHHF 2CADA 3H5XA 2MY7A 3FSYA 3W9HA 1NSAA 2BA9A 2BJDA 4C8NA 3WQPA 2ZC4A 5KOWA 2MKSA 1X4CA 1W2IA 4NZ0A 1NDCA 1HHTP 2W4PA 1VYAA 5DQGA 3P5BP 5HVHA 4CI0B 2HIQA 3LO3A 1RA6A 3POTB 2BJ3A 5D3GA 1EHWA 4ALZA 3PRVA 2B7BB 2XC9A 3KUHA 3SSSA 2XBPA 1RHUB 4BC7A 1UVNA 4RW7B 3M8QA 4OMFG 2XULA 4E8UA 1JLCA 5KG5A 4H4MA 4JV5F 4ZVUB 4KHPF 5B08A 2KKHA 5D0GA 2AWZA 1BE4A 2Y8WA 4P75A 2Q79A 4B3TJ 1SIZA 4LFBJ 1RTHB 1FDBA 3OR1A 2BJEA 3LUYA 3GIJA 3RB0A 1YHQS 1WOPA 3SCLE 2PI4A 1VQKS 5B09A 1D8YA 2RMLA 2XYPB 4OJGA 3NBPB 3SDEB 1NPPA 1SV5B 4CO5A 2GMHA 4ZLLA 1ZYQA 4M1KA 4IO9Q 2VPYB 1NXIA 1C1BA 2DIVA 3Q83A 2F65A 2F63A 1Y3KA 1FJEB 5C2GA 4Q7AA 4UY8T 4K59A 4J9PA 3NAHA 1U7LA 1Z4UA 4OFZA 5FLXY 3PR4A 4LRAA 3NP5A 3R5AA 1QAXA 1BQXA 1XN9A 4DV2F 1BQNA 4HYKA 3PNIA 3TJ8A 3OXLA 3HD2A 5CCMA 4XO0A 4FPRA 3OTOJ 2F9DA 1HA1A 3G4SS 1NB2A 2YKOA 1Q7YT 4YY3F 3TEGA 1RDRA 3OTEA 1PIEA 2WONB 5KT6A 1TKTA 3C6UB 4RW4A 3WIUA 2RKIB 4DV5J 2J9DA 3EXYA 2DGWA 3LP1A 3MM5B 1YJ9S 2QX0A 4M5JA 1LW2A 1WI6A 2HYIB 3VV2B 2RSQA 2YNFB 3BKFA 1ZAVA 3HM9A 4LVOP 4MTPA 4EZ6A 3JB9k 2Y3YA 4DG1B 2D3OR 4ZS6A 3OR2A 1X4FA 1LXJA 3KMSA 5ETLA 1Q95G 4DPXA 3CCES 3W63A 1CSJA 4YB5A 3DRYA 2C3MA 1CG2A 2L9WA 1Y3JA 1NZ8A 4EZ9A 3KDOA 5ADZA 3QGPA 4ZPVR 1FVQA 3T5HA 3NGKA 1U48A 1S1WB 3M2UB 4C48A 4NA1A 2DVIA 3TYTA 3BGUA 2CQGA 1IM6A 2BANB 4RZRA 3W1YC 3Q8VA 1TELA 5KFYA 2RQKA 1WTBA 4CO4A 1HNVB 1HIYA 3TUZC 5IWAJ 1Q79A 2QJ3A 5GAEU 2HBYB 5EUHA 1T94A 1OIAA 2P6SA 1FRKA 1MMDA 2WBMA 3P5TL 4R8UA 3M4XA 4Y00A 3T1YJ 2HS4A 1S9EA 1FD8A 4LRDA 1IKWA 4P10A 1FRHA 2IA0A 4OI0A 4R5PA 1XWLA 4P2XA 3EE3A 3NEKA 4EO6A 1PC4A 2I38A 3AH6A 2FYXA 2X1FA 1B0PA 1CS4B 5HN0A 1BC6A 2Z4PA 4ECVA 3ILLA 2F40A 3KNAA 1H3DA 1ELOA 2UP1A 3DOLB 2VG6A 3OL9A 2WCXA 4F4WA 5C2CA 2ZH9A 5HQMA
chains in the Genus database with same CATH topology
3CCWA 5B0DA 5KG7A 1TV6B 1S6QA 3IR5B 5A8RA 1VC6A 3MWBA 4EWTA 2KN4A 3EPGA 4WK3A 1Q1KA 1SKSA 1C0UA 4MK9A 4KO0A 1FDDA 1O51A 2FPHX 1XNQF 1HYSA 3M30A 4YMEA 1IKWB 1FXLA 5DQHA 2V4JA 1MWYA 3M8RA 1DTQA 4ED6A 1KQGB 5H9FJ 3CF5Q 2B6AA 2LU2A 1F9FA 1WD6A 3CDUA 4R5PB 1IBMF 4XPEA 4KQZA 1HNIB 2FLOA 4X4UA 2DIUA 1GT8A 3VQSA 1LOUA 3JTOA 4ETXA 3NL0A 3PO5A 2YNHA 1S6PA 1ZM9A 2IBKA 4F4KA 1U4BA 3V5RA 3O8WA 2QEXS 2LQ9A 4M95A 1QE1A 3M2RB 2BOPA 2PFFB 1WHVA 2VA2A 2E9TA 5DDRC 4LT6A 1JB0C 1FRLA 1NO8A 1WG1A 4ES1A 1CVJA 1G7CB 2ZJPQ 4O4GA 5FIIA 2E7XA 3CD6S 2LQBA 2VG6B 4Q45A 4OV1A 4ZA1A 3CPWR 1RYRA 4PQUA 1WF0A 1O8BA 1R27B 2YNGB 5HMWA 1X9MA 1MU2A 4M63A 3OHAA 4EGLA 4URQU 2YWHA 3F56A 4BS2A 5KFIA 2MKIA 4RW9A 2WBRA 4MMOA 1AFIA 1T3OA 1GAOA 1BLUA 3FZBA 4JV0A 3SCJE 2JZ5A 2ABYA 1C0UB 1X4EA 4Q43A 1CC7A 2B3TB 3BR8A 2MQMA 4KO0B 1QAIA 2W9AA 2V94A 4KE5A 4WCEQ 2C2RA 2VODA 1HBOB 4I2PA 2HWHA 4OX6A 2V4JB 3OSPA 3AJ1A 1VC0A 3EZUA 5KFKA 4DL7A 5HP1B 4IO1A 2AYEA 2B6AB 4WU3A 4E98A 2R7RA 2ILZA 1RT7B 2Z2MA 2CVEA 1FEHA 3EGWB 3FFIB 2W9BA 2M7SA 2D74B 1QE1B 3HX9A 2GA7A 3QYYA 2ZHBA 1MW7A 3KLHB 1MSWD 3B4DA 2CQCA 5M2UA 4URSA 5I3UA 4IG3B 3GR1A 1VQMS 2Q66A 5EWFA 2JVRA 2MZTA 4U6PA 1U47A 3W3SA 1U2RA 3DLGA 2ZZNA 3P6YC 2OD6A 3EXCX 2PMZD 4MFBB 3RYLA 5KT2A 3V4IA 1UVJA 1FRJA 4C4WA 1V3SA 2G4BA 4MK7A 3PO4A 1KVIA 2KYXA 5DDPC 2ZH8A 3PX4A 1AFJA 3GYNA 3PKMA 3HFKA 2E44A 4B02A 2YX4A 3UCUP 3FRZA 4KJIA 3RBEA 3DGPA 4ECXA 1PO6A 3ZZTA 4B3RF 5BYSA 5B0EA 1RTIA 1TKZA 1QJHA 1DQ8A 1RT3A 2GQQA 2VB6A 3DDKA 4WFAQ 4HH1A 4BBYA 4IFYA 3IA0A 1NJWA 3F73A 7FD1A 2JC0A 4DR5F 3N28A 2J0XA 1VMBA 2V0NA 3DN9A 4JV2A 3C2PA 1FDNA 1WF1A 4IQXA 1H2UX 5HL7Q 2D3UA 2GC8A 3T9NA 2ZD1A 1XTZA 1R89A 5A0YA 5M2RA 4R0JA 4PG8A 2MKJA 3SEOA 4X66F 4LF4F 3HVWA 1SI9A 3BN7A 2W9BB 5EDWA 1QSSA 2PE8A 2RNEA 4IFVB 2RU3A 3D0GE 2E7WA 2GMJA 3K2YA 3I4PA 3JYTB 3BO4A 4MAKA 5HMZA 1J5OB 1KFSA 1NH7A 5J2QA 2FJDB 2N7YA 3MI7X 5F3TA 2KH9A 1YBAA 3MD1A 5J2NA 3RAMA 3KHLA 3IR6B 1N6QB 3HHLC 1LFWA 3KLIA 4RNHA 1N48A 1X7VA 1VQ9S 3GWCA 3VCDA 2N4CA 4ELTA 3I9V9 4F3QA 3VWSA 1N5VA 4O3QA 2ZH5A 5KT5A 2KO1A 1RT4B 5KFTA 3KMQA 5F9NA 3DLJA 3OUYB 4ED0A 3TQ1A 1KVJA 2FHJA 5BJRA 4WKYA 4ICLB 1Q86T 3HKWA 1HBUA 1TKZB 1IXKA 1RA7A 4YP3A 2E9RX 4IOAQ 3UCZP 1QAYA 3DOKA 4KRWA 5LXRA 1JNRB 3JAMY 4U7CA 1EP4B 3H20A 2IRYA 2BQUA 1HMVA 1SJ3P 3LANA 5KFDA 2VFSA 1FT8A 3CDWA 1M5PC 3OBIA 4JV1A 4MK8A 2CJKA 2FVSA 2M2BA 3NLCA 2XWYA 3IG1A 1TL3A 1M90T 1NK8A 2K7KA 2UXDF 4HTJA 1JWWA 2CJQA 1NK5A 2XMKA 4FVMA 3C8YA 1QSLA 4ZKAA 4RX6A 1TK8A 4WZQA 2XMMA 4QBUA 5KG3A 1NHVA 2HGLA 1X5TA 2CPXA 2EI5A 2MMYA 1KRPA 4JI1F 1C0TB 1ZZFA 5MAOA 2DR9A 1SJRA 2UUWA 3KLIB 1LWFA 2MSSA 3I9ZA 4NX9A 2FLPA 2FLLA 5A8KA 1S48A 4A8FA 4A48A 1TL5A 3I0SB 4Y65A 3SV3A 1U1PA 2DGXA 2YTCA 3QWPA 4EBCA 3MM6A 4BDPA 1JLFB 2FJWA 4G1IA 4OLOA 4BCAA 2V4QA 3QGGA 1VRUB 3GIMA 5M2PA 4EU0A 3GFYA 2ZBCA 4H4KA 3NCPA 4NYZA 3DRSB 1HBMA 1R7IA 5HI7A 4DLEA 1GTEA 1UA0A 4IRCA 1YG0A 2R9LA 2J6SA 3KG0A 1S9GA 3K5MA 3DOKB 1KS2A 1DZ5A 1R3NA 1K9MT 3M9NB 3OPKA 3VAKA 3M6VA 2RD5C 5B0BA 2R2SA 4YB1P 3V6JA 2E5JA 2PC6A 2M88A 4A46A 3MMBA 4PG4A 2GO9A 1NK9A 2CPFA 3DRPB 2OPQB 4P7TA 1WEYA 2HFNA 3KK3A 4MIAA 3BZQA 5E5NA 2I1RA 3LH2S 2DH9A 3CJ3A 4DS4A 1TL3B 2VUGA 4B17A 5HMXA 2L9DA 4G3IA 5GVQA 3VTIA 2A10A 3J7ZT 2BE2A 2AYGA 4ILMA 4NLOA 3K8WA 4PRFA 1VJWA 1FCAA 5CD4H 3DRRA 5F8NA 2QLXA 3BR9A 2IBOA 4OI3A 3ZZZA 1ZAWA 2DHAA 2FC8A 4AL6A 1FJCA 4B3OA 2J0WA 1LWFB 4C11A 1U1KA 4OX9F 1X9WA 1U2FA 5KFNA 2R7UA 1OO0B 1UVIA 3AA9A 1P1TA 2LYVA 3FEZA 4A8KA 1YRTA 5LXYA 3QJJA 2VFRA 3HHLD 4K4UA 3BS9A 2DGTA 3U27A 4DV5F 2DD8S 4JI8F 1T95A 2JVOA 4DL0C 4YR3A 3J80Y 3WBZA 3KLEA 3EZ5A 2F8EX 1F0XA 3TUIC 2C3OA 2QT7A 2QFJA 3Q23A 1PSDA 1S9GB 3GMGA 5E3CA 3OQ2A 4TQRA 2OPRA 3DI6A 3R27A 3CVKA 2J7WA 2DGSA 1IM4A 1DQAA 4K5SA 5DDOC 5GAGI 1TQLA 3V6HA 5D3GB 1TP7A 4NXNF 1W25A 2EFNA 2WSFC 4FXVA 4DUYF 1Q53A 4DDFA 1N5SA 3Q8PB 4F2SA 3KK3B 2ADCA 1TUVA 2P5VA 3AB2B 2HS0A 3MFIA 3HT3A 3WZ0A 2ZZMA 2GIQA 5ITHA 2BRLA 2XS7A 4M5DB 5CZXA 3HPOA 5AXMA 2FGOA 1YQHA 1S0VA 3CCMS 1KN6A 3H8YA 2E66A 3DRRB 4JI6F 4J5OA 4OZ5A 3GE9A 3K57A 1FRMA 3M8QB 2ZDOA 2NUHA 5HBMA 2K2PA 3IS9B 1RTDA 3JTPA 3TA0A 2O67A 2ZC3A 3KG4A 3DLKA 4DF4A 2NYIA 3D54A 2OMOA 3NGDA 2ZH3A 2OH2A 4JI3F 4QYZJ 3CD0A 4BC9A 2VG7A 2ZITA 4I68A 3BB5A 4ZCIA 3BSNA 5C25B 2RIJA 3J7YU 1E6YA 1U45A 2MQQA 2XGQA 2B0GA 4UQGA 1SQEA 4WZMA 2L41A 4FBTA 3KLEB 2I5JA 1L3SA 2KXHA 2RDIA 2BYCA 2GQCA 3OTBA 4JBCA 3IFEA 3MR5A 2JH3A 4F67A 1YIJS 3CT9A 3MOJB 2J0SD 2IYGA 4ZVEA 2OPRB 2XS2A 1KTVA 4KC5A 2HRYA 2LXIA 1HWUA 4PXCA 3DDNA 6FDRA 3FQLA 3I5CA 4EYHB 1QVGR 2EKYA 4O3OA 5IS2A 3J7YI 3IWNC 1UVKA 3BM7A 1X5SA 2R8JA 2EC0A 3GB0A 1ZM3A 3LP0A 2E1MC 3DLHA 3OR1B 3G8TA 4URGA 3AB4B 4KPYA 2BUNA 2C42A 1ZOTA 4I6YA 4OLPA 1R0AB 1FKOB 2AJ4A 3SSRA 4DN9A 3GQCA 1OS5A 3RRHA 4ZVHA 3H2VE 2ASJA 5K14A 1C1CB 5K9FA 4E0DA 4DX8H 1IKXA 3T1AA 4YOEA 2F7VA 5BYRA 2MB0B 2D3ZA 3DYAB 5B0GA 2NPFA 1HR0F 3MR3A 1S1UB 2IVYA 2R8GA 1RT6A 2BR0A 2JHEA 2ZNZA 1I6JA 4RBUA 1IR0A 2GFFA 2RB7A 2ZOMA 1OQ6A 3DLKB 3M05A 3M8PB 3CO9A 3X1LB 2XSFA 3N0VA 2GMLA 3N6MA 3PM9A 4NLPA 3M1VA 4O4RA 5IWAF 5KFVA 3R1HA 4N41A 4C8ZA 1B7FA 3RW7A 1M0SA 4I2QA 3KK1A 5FDLA 3K7RA 2XCPA 1E6YB 4DEZA 5F8MA 2Y1RI 2RH3A 3MECA 1BD6A 2WSEC 1GH8A 4Q44A 4ZMMA 3IWLA 3BGRA 3N79A 2LEPA 2ZE2A 1C1BB 1JLAA 1YGYA 3TW0A 3FQKA 3KKFA 4Q5VA 2RRAA 5FD1A 2ACYA 2LQ5A 4FP9A 4NWBA 2GO8A 3KYLA 3J7A1 3T1YF 4DFJA 3CD7A 1IKVA 2DITA 3DU6A 3S8SA 2XY7A 3LWLA 2U2FA 4JYAF 2FVCA 3TVYA 4CCHA 4C98A 4YDDB 1VQLS 2B4PA 2N82B 1JLGA 4AL7A 4IG0B 3UPFA 2ZH4A 3KOAA 4OHVA 3LP0B 3EPIA 2HMIA 1YJTA 3N6NA 2KYZA 3BDEA 2M4MA 3TAPA 1QSYA 2PMHA 3ULHA 3HLUA 4ZP6A 4C3MA 4DF8A 1N8RT 2GCFA 2M3DA 2GGPB 4CH1A 3OV7A 2JEJA 1CQMA 5LMNF 1KOHA 1N0VC 3MUMP 2VC0A 3DM2A 4WK1A 5B7WA 3PJXA 3OL6A 1L5UA 5K14B 5L9XA 5IFMA 4QWAA 2HHUA 3LALA 1SL1A 2RJZA 4ED7A 2J9DE 1U49A 5JUMA 4F3OA 1BQNB 3M32A 3T5KA 4Q8FA 3RBDA 3ZZYA 1YI2S 1UFLA 4QIWD 4WFYA 2KT3A 2RUGA 3FRYA 1NEEA 2ZH9A 1N5YA 1ZPWX 2WRMA 4I2QB 3SCKE 2RT3A 4J9NA 5KFBA 2HVHA 4ID8A 2BW2A 3M8SA 4FYDA 3PVXA 1RT5A 3D1HA 3KHGA 5JVGQ 2VOPA 3I4HX 4KGMA 5DS7A 1NJZA 3DLEB 2IAJA 4LF9F 4OX7A 5H9EJ 4U7UK 1Y00A 1PILA 4DS5A 2MQNA 3PFEA 5K8PA 1OQ3A 5AE1A 1TKTB 2CZVC 1NKBA 1XK8A 2Y0SD 3CIZA 1Q78A 2XS5A 1HQEB 1U6FA 2CPEA 2F8HA 3MEDA 2HVZA 4RW4B 4ELVA 5JJBA 3L7PA 3IR7B 1VQ7S 4DSJA 4LF6F 5MLCV 5SZTA 3RTVA 2UVWA 2QA4G 2CKWA 3HVTB 3LP1B 4CNYA 1IN0A 1LWEA 3M9MB 4JUZA 1IJEB 2E29A 5EX0A 1JLEA 4NRUA 2FJVA 1D9DA 4Y28C 5DETA 1LW2B 4PXBA 4K4SA 4QWEA 5LT5A 3BO2A 2QMXA 1UFWA 1S99A 4NLTA 2D41A 2XNQA 3NG8A 4GO7X 1Q8IA 3TR5A 3M32B 1F5AA 1VRTB 4FF2A 3FNNA 4N8OA 4QR2A 4TLQA 2MPUA 2Q43A 3IO1A 1KLMA 1N5YB 2CPDA 1BQMA 1LK7A 2QZ8A 2KG0A 2M52A 2FDNA 2OD4A 2JRSA 2AX0A 1Q8LA 2OTLS 4YQWA 3PACA 1RT5B 1VIXA 2J9CA 3MM9B 4F26A 3LWMA 4PG7A 5D4LA 2JJ4D 3B78A 1GXUA 1MROA 5IZHA 2CDQA 2OO4A 3FCHA 4CO0A 5KFWA 3OW2R 2RS8A 4KHRA 4TNOA 4GO5X 1DFDA 3LAKA 2WW8A 2D9PA 3QJLA 1HWIA 2B4VA 3BREA 2EFGA 3SI8A 3CCLS 2YX1A 1FJ7A 1P8GA 4K4ZA 4I56A 2OJ3A 3OR2B 3RB6A 3MEDB 1U26A 5E3AA 1NKCA 1RP5A 3LF0A 2XMTA 4RNFA 1GQEA 2YKNB 2ZDPA 2FHMA 2I0XA 5CYMA 5SUHA 2HGNA 2OAUA 2LKZA 2O1PA 4H4OA 3CCVS 2DR5A 1FK9A 4X2BA 1VQ4S 5E3PA 2ZH2A 1D8ZA 1H7XA 2C3PA 3I32A 1GXTA 1LWEB 2CIMA 2MYFA 3PHEA 2JEGA 3IXQA 2R7OA 3SFGA 1JLEB 1DBDA 4XPCA 5KFSA 5IT9Y 4U67Q 3PIOQ 1ZTTA 2GV1A 3U1LA 4QW9A 3BQ0A 1R8CA 2X1BA 2ZJRQ 1X4AA 3MCSA 3TP2A 3UQSA 3I96A 5B0AA 3HKZD 3SZ2A 4YUDA 4K5RA 1RTJB 3R1LA 4ZVGA 2IM0A 4ECYA 3CC7S 3TA2A 4LUBA 3OVSA 4ZCKA 3CMAS 4A8WA 2R2TA 1N52B 2H5EA 4KKOB 5E7OB 3GFHA 5K8MA 3MM8A 3FSIA 2X1AA 3BDPA 2RQ4A 2MZRA 3IC1A 2KU7A 5D4NA 3CSKA 4WJBA 4EBDA 3KLGA 4DR3F 2ZHOA 5D77A 3RB3A 2E5LF 3CDEA 3QAUA 2F4VF 2IHR1 1S1VA 1HQUA 4FF3A 1MROB 3UW1A 3VQTA 3AJ2A 2UV8A 2W9CA 3DHWC 4CH0S 4LSNB 2CYYA 4C8KA 2DGOA 1ZZNA 2IM2A 3Q22A 3LOUA 2QMWA 3S1TA 1UETA 4TYAA 2ZUGA 2CQ2A 3AAWB 4Y2CA 3UNGC 4OJ1A 4A8QA 2FHOB 3J7Z5 3LW5C 2JX2A 2AV5A 3CD5A 4LSLA 4C8MA 2ILYA 1UEUA 5E3RA 4KSEB 4R8UB 2HLTA 3UD3P 1Q8BA 3I5AA 5F9LA 4ED3A 5F8LA 1VBZA 2A1BA 3MUTP 5KFOA 1Z2ZA 1JLBB 1T05B 4NCGB 1S9EB 4XDCA 5HLFA 4Y2KA 2CPZA 4MYUA 5IT4A 3DRXA 1SL2A 3VF0B 3GV7B 4WFXA 1NK4A 3CJ4A 2KXNB 2VZ9A 3OVBA 3KLVA 3U7JA 1VQPS 3NWGA 1D1UA 2DCLA 4ZP9A 5GAHU 1IKYA 4NCBA 2GNKA 1NK0A 4DMZA 2EVZA 1DQ9A 3H2LA 1S1TA 1XR7A 3ICLA 4O23A 3C66A 1KQFB 1Q7LB 3IN5A 2LA6A 4G6VB 1D0EA 3LGNA 1Z2LA 4RW8A 4C3LA 2JEFA 3KLFA 1O0PA 4PPDA 5C5JA 3G6XA 2CQHA 1HNXF 1REVA 2W9CB 3QO9A 1P27B 1UL3A 2AJQA 4JI2F 2V5HG 2OSRA 3I5BA 5EHHA 5A6PA 2WB4A 5T41A 4HH0A 5DGAA 2J9EA 3PKYA 5GAHI 5EWGA 2MZQA 4W90B 1TKXB 5CYQA 1VS3A 4ECQA 3FMBA 1CPZA 4JI4F 2YWGA 1FERA 4LJMA 4O44A 4Y3CA 4YEAA 1KD1T 1M1KT 4N8NA 5JXSA 3PJWA 4KFBB 4D3HA 3MEEA 4WE1B 5J1EA 4O0IA 2K3KA 4LSLB 3MR2A 3VZHA 5JVHQ 1S6QB 3NNCA 5A8RB 3H5UA