2GJIA

Nmr solution structure of vp9 from white spot syndrome virus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
82
structure length
82
Chain Sequence
MATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEELRLLTGDSTLEIQPMIVPTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords wsv230
publication title Identification of a Novel Nonstructural Protein, VP9, from White Spot Syndrome Virus: Its Structure Reveals a Ferredoxin Fold with Specific Metal Binding Sites
pubmed doi rcsb
source organism Shrimp white spot syndrome virus
total genus 7
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09625 VP9 VP9 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2070 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gjiA00
2ZUGA 2GJIA 2GJ2A
chains in the Genus database with same CATH superfamily
3ILJA 5LMUJ 4J37A 3QJJA 2HS3A 2VQFF 3OXFA 1Q53A 4O0NA 1L3UA 5CYJA 1X4DA 5IOLA 2AIRB 3MOZA 4PPZA 2BRKA 5KFDA 1FKAF 2HGNA 4NZ7A 1NNDA 4DN0A 2W9AA 1WHWA 2LQ5A 4ZCLA 4QQBA 1ZTTA 4CO4A 1C4CA 1NH8A 2MGZA 4DCPB 3BV8A 3NXZA 1H7XA 5C2CA 2MQOA 5C24A 1VQPS 2J6SA 4YB6A 1M1KT 4FXDA 2KFNA 1HD0A 4WKRA 2W9BA 2RH3A 1KR4A 1TAQA 2PN6A 2V69A 1UVJA 2RDDA 3P4UB 2UZAA 3W1YC 2ROPA 2OP5A 2OEKA 2W24A 2WRMA 4JI2J 3OL7A 4EMDA 3F56A 5E3QA 1HBNB 1HWUA 4K5SA 3MPYA 4NRUA 4TKTA 4X4UA 4OL8A 4P10A 1JXLA 5HN0A 3RBZA 1VQ6S 4ALZA 1IQZA 5F3TA 1HNXJ 1R27B 1ZA2B 1CS4A 3CO0P 4LFCF 4OJGA 3T5KA 1RP5A 2XMAA 1YRUA 3AAWB 3D6FB 3HD2A 4LIWA 1RT3B 4DS5A 3RR7A 5K8MA 1WKLA 2QLJB 3CDBA 2HHPA 4DZDA 3QJPA 3Q8YA 3QGHA 3ITHB 5K14B 1Q82T 2EFVA 1HNWJ 1SC1B 4KRWA 2Y1IA 2Y9HA 1S77D 3UN5A 3DM2B 3A3OB 1VQOS 4YOEA 4PRFA 4R5PA 1YJTA 2K8GA 4QIVA 3FC9A 2IC3B 2DXDA 2WSCC 1FEHA 2RU9A 3C3LA 1FFSB 3NKYA 4RNHA 3H40A 4WU2A 2HYIB 1QD1A 4RUHA 3FSXA 1O0PA 4ZIWA 1PILA 2V63A 4CO2A 4H54A 4RW9A 4DX5A 1N56A 3P6YC 3PEJA 3PACA 4IQMA 1FERA 2WVCA 4OI0A 3LP0B 2RE1A 2BDPA 3O5TB 2E1RA 1OO0B 2WAQD 2GS8A 1RT4B 3I96A 3HLUA 2HHHJ 2OAUA 5A0YB 3NGSA 2VFUA 3GIMA 3EICA 1NK5A 4LSLB 4DV4F 1X4EA 3N4WA 3H5SA 1U6ZA 8ATCB 4X84A 2O3DA 1Y10A 1JKHB 5BR8J 3CT9A 4ZIVA 2XNRA 3T1YJ 2Y0BB 2KT3A 2YKNB 1PYOB 4K0KF 3I0RA 4IR9A 3FUYA 2XEXA 1YZ6A 3ULHA 4F4YA 4B9VA 5HJYA 3J81U 1XMQF 4IFVB 1S0NA 2KYZA 1UL3A 1DLOB 3RW6A 4YQWA 2G1HA 3WX4A 3AB4B 2AGOA 4O3NA 1RTHB 1U0SA 5K8PA 1Q8LA 1CEZA 2RVJA 3W65A 4QJVA 5ETSA 2GW8A 1H72C 4O44B 2DRAA 2HG4A 1KSPA 5IC6B 4Q44A 1JJHA 1X5TA 4K4VA 2BJ1A 2JC0A 2HK2A 4B3RJ 1NSQA 2IRYA 2QO3A 2CVEA 1JLBA 3IMQJ 4U7UD 4C3KA 2R3VA 3ADAC 4DV1F 1CJUB 2MLXA 1JXVA 2VV5A 4I6WA 4LRDA 3PR5B 3KLEA 2MKJA 2OFGX 2YNFB 2CWXA 2ZUGA 2GGPA 2PEBA 4M95A 3MI7X 2NUUG 2VJUA 3CDEA 5DM7Q 4HHJA 1M5PC 4LUBA 1FE0A 3IWLA 2P9CA 2UUBF 3SYZA 2G2ZA 4D3HA 4X4TA 2JX2A 3TEGA 2LQ9A 3Q24A 2V67A 4UY85 2UXDF 5GAEI 4N41A 1VQ8S 1M5VC 1N36F 2FHOB 5HP1B 5KFPA 1RQ0A 3MAQA 1F3VA 1TL1B 3VTIA 4DLEA 3AOCA 2Z0GA 4DUZF 2VPYB 1FRHA 2B3TB 1FRKA 4DV3J 5GVQA 3MM6A 4OZ2A 1MU2B 4CWBA 4Q5VA 2HMIA 3TJ8A 1H73A 1Y5NB 1NHVA 3D2WA 3FEZA 4K4WA 1Q4RA 2ZOGA 2MKYA 4USHA 1H2VZ 4XO0A 4FF4A 2GVDB 4LF6J 4IR1A 2R8GA 2HQDA 2KRRA 3HJVA 2E7XA 1C0TA 2VQFJ 1IXKA 1RHJB 4X4SA 2CYYA 2NZCA 2UV8G 3I9V9 1K1QA 1FX4A 3NS5A 5ETPA 3BO2A 1JLFB 4ES3A 2MKKA 2K1RB 1FFGB 4LQ9A 3QZ7A 3C15A 5GMKa 4TYAA 2HVDA 3LALA 4G1PA 2PIIA 4CNZA 2P5VA 2NUHA 3J81Y 1FJGF 1QTMA 2E1PA 2NXNA 2FJAB 4TNOA 1IKYA 2BW7A 2MEWA 2OHDA 4ECQA 4RW9B 4OI2A 1NM2A 3Q8VA 3TA0A 1WKKA 3V4IB 2IVFB 1WDTA 3OFHA 4IUFA 4KH1B 4KGMA 5J2PA 2CQ3A 3DGPB 2CRLA 2ZZMA 3K5PA 3HMJG 2N4CA 3CJKA 2FTRA 5HAOA 4Z7CA 2Q3PA 1NJYA 3T5JA 3KLHA 3K17A 3M30B 4NLWA 4CP5A 2FVRA 1F9EB 1VGYA 3M1VB 3NS6A 4DQRA 4G1QB 2UVVA 4P52A 1V3RA 4LFCJ 2HNDB 2LU1A 4AQYJ 3EYZA 5GAGU 2MKCA 1WHVA 2K3IA 3BO4A 4OYBA 1VRTA 2QFJA 4M5DB 2M2BA 1I1GA 2GAGC 4CLWA 1ZZNA 1UWAA 4G65A 3PTWA 1OS5A 4ICLB 4CLPA 3IXQA 5DG7A 3AJ2A 5IFMA 4B9UA 1N34F 2JZ5A 2QLBB 1XWLA 5HQLA 4F2SA 1SH2A 2DH9A 4IFYA 1U7LA 5DS7A 2ZH6A 4B9SA 1F1BB 3HFZB 1YJUA 1PCAA 4FVMA 1MN9A 2CWKA 3IBWA 3OFEA 1TL7A 2ACMA 1RCOB 2HQFA 1RAOA 3FJ2A 1VLYA 2B8QA 2LXIA 3A8JA 1RYSA 4FBTA 2C42A 4DX8H 2H65B 4C7QA 3DLEB 3KMSA 3R1HA 3NS7B 4HH0A 5JMNA 1VBKA 1TL3B 2HAIA 1REGX 3NNAA 2KU7A 4C8MA 4DUYF 1H3DA 3MM7B 2QSFA 4IKAA 2WOMA 3DRXA 2IY5B 3IR5B 4A4JA 2RUGA 1JNZB 1JNRB 3A1YG 3KHHA 2LKZA 2FJDB 3K5NA 3TAQA 2DK2A 3R8YA 3G6VA 1EHWA 5SZTA 3M8YA 4F0KA 4OYWA 4JI1F 4O3QA 3W5YA 2COLA 4DV4J 1SL1A 2V4JA 3IP0A 3C16A 1KRPA 1DTQB 2PFFB 1S7HA 1XK8A 2XS7A 2B6AA 2V9KA 2EC0A 1TK8A 4P75A 1E6VA 3V81B 1CULB 4RU2A 4ZA1A 4K0KJ 4FKYA 4X62F 4J9QA 4C8ZA 3I4PA 2QA2A 4A46A 4QWCA 3BGLA 1SIWB 2WW8A 4P73A 1XMQJ 3FEYB 2ILYA 2NXUA 2XZTB 2YVSA 5AJ3F 1SJRA 1N5YA 5KFYA 1T03A 2Y1JA 4OHVA 1YG0A 3MEKA 3FNNA 5T7LB 3MCMA 1RTJB 3J7YI 4HLBA 4PYDA 5A76A 1JWWA 2OO4A 3OQ2A 4RWWA 1Q79A 2XMJA 3A8KA 3CPWR 1FXLA 1URRA 4KYZA 1HYSA 3TWZA 2AGQA 1OMSA 4UW2A 4Y2AA 1RBLA 4LVOP 4QYZK 2KT5A 4H4OA 2WVDA 4NX9A 1U09A 1RI7A 3KHRA 3Q0AA 4J7CA 2GIQA 2BZ2A 3GIIA 4DV1J 5ADZA 1AZSB 3LAMA 4HI2A 4MAKA 4PR6A 2VBXA 4GMKA 1JB0C 2HIQA 1MNEA 3PYFA 3KHGA 1NJWA 4PPDA 6FDRA 3K7RA 2MMYA 2XGPA 4JV5J 2MLZA 3CNQP 2CA9A 2UUBJ 2FZKB 2DNHA 3MECA 5BYQA 4CI0B 4USJC 4NI2B 1UJ6A 1YITS 2RKIA 1MWYA 2QC3A 1LQ9A 5HATA 2DY9A 5E3RA 3SDEB 2UXDJ 3P96A 1KKHA 2A1BA 2WTFA 3WHIA 7FD1A 1N36J 4I69A 5GAHI 1UJ4A 3G6XA 3V6DB 4DXLA 4DR7F 2XNQA 3JQJA 2YPYA 2V50A 8RUCA 2BACA 1UZDA 2R8IA 3DHXA 5HROB 4ZJLA 3FCWA 3UCUP 2C2OB 3FQLA 4WK1A 3RB3A 2FLOA 3MUMP 2IA6A 2XTJP 2IPOB 5KOWA 2R7UA 3OTCA 3JYTB 1S4EA 1N5TA 4YP3A 4M5LA 2DHXA 3EXYA 3D3BJ 4MYUA 1B7YB 5D3GA 5IC4B 2VG6B 3H20A 3O6QA 3IS9A 1L3VA 4ZITA 1S1VB 5KTQA 4KBIA 4TVAB 4AL5A 2BOAA 2XHWA 3ZZRA 1Y00A 1PBUA 4Q0BB 2VL1A 2ZHOA 3MPWA 3U27A 4K8RA 5DGAA 3HSZA 1MSWD 3OHAA 2VASA 4ILLA 2IMOA 1LWFA 1HI0P 4ED6A 5D78A 1P1TA 1YI2S 4DBQA 3P8BB 4L3KA 3ELHA 1MLAA 3R2CJ 4DU7A 5HMWA 4RU9A 1FJGJ 4DSLA 3OTBA 1ZAVA 3OL9A 2YKOA 4F3MA 3Q8SB 1MMNA 5CXTA 2W2QP 4L72B 4FYVB 3TR5A 2ZJPQ 3N5FA 2DY1A 1CJKB 1X4GA 3UCGA 1WG1A 3MD3A 3BBCA 9RUBA 4TQRA 2PD1A 3M2VA 4KJIA 4DCJB 2CDQA 2WOMB 2JEFA 2DB1A 3WC0A 3CJ8A 5LSLA 2XO6A 3RAQA 1RHQB 2B0GA 4RW6A 4C8KA 4BWMA 1Z2ZA 1S5ZA 3EDQB 3M32B 3DOLA 4P72A 1NU4A 4QBUA 3PW5A 3EZ5A 4EYIB 3ZC4A 2OPPA 2EKNA 4HT5A 2UXBF 2FVQA 3S7RA 1FK9B 1NH7A 2YWFA 4JI5F 2APOA 1ZM4A 4LT6A 2BBEA 1KEKA 3FFIA 1XNRF 4HACB 2G0JA 2X1GA 4TN2A 3TYTA 2MHNA 1JLCA 3W7BA 4YFUA 5L1LA 2Z2LA 3GPAA 3VGVA 1N34J 3W61A 3M8ZA 3AY0A 3GR0A 1S6PB 4OFZA 1K0TA 2XWYA 2YKPA 1TKXB 1RXOB 4Y34A 2DJWA 3ENAA 4WXWA 4DQPA 4M5NA 5M2UA 4Q2MA 3A3NB 1LV5A 2Z4PA 2C3PA 1N8RT 4I2PB 2R8HA 4KQZA 1AT1B 3O8WA 2EI5A 5D0RA 2F40A 2CVIA 3ZO7A 1TELA 2VC1A 2ZFHA 2Y1RI 1JLAA 4JI0F 1FRIA 3I32A 4KAIA 3GV5B 4DUYJ 3CDWA 4OYZA 5HVFA 1ZETA 2AX1A 4OYOA 1U26A 1DZ5A 3MXHP 4AXJA 4CH1A 1KQFB 2RQ4A 4WP3A 3CEDA 4MFBB 4DQIA 3W2WA 3QFHA 2O67A 1KLMB 6FD1A 1IR0A 2PI5A 2QRRA 2X1AA 3CJSA 3W3SA 2OSRA 1MG7A 2UVUA 1UVMA 3T6BA 2C2MB 1RTIB 3MHYA 4OX8A 1HWLA 3B4DA 5KFLA 2MKSA 4X62J 3GFYA 4WTOB 1FA0A 4V1Ak 4AD6A 3KLGB 4PKDB 3EPIA 3KNGA 2W7AA 3BPDA 4IH5A 4ED1A 4N77A 1I94F 2HNZA 1V5VA 3BBBA 2XSJA 2YWEA 5AJ3J 3P49B 3B6BA 4ZVOB 4LBPA 4OIXA 2B5JA 5KFSA 1MWQA 3E2EA 1HW9A 1C2PA 4Y3CA 2R9LA 1FRJA 1V9OA 1SBRA 3C6TA 1C1CA 3DLKA 3QNWB 2EKYA 1FNMA 5KG4A 2M8HA 5L8RC 3J7ZT 3PX0A 2JLFA 2DTJA 1R6YA 2VODA 4NWBA 3HHDA 4V19J 2YKQA 3AD9C 3NMRA 4N47A 3PHEA 1Q81T 1Z1ZA 1APSA 5LMNF 4LFAF 2AJ4A 4ECXA 2CKWA 2YX7A 2RQCA 4DR4F 2BE9B 3UVJB 2QFIA 3N6MA 5HJXA 1LOUA 3LO3A 4EBCA 4NCAA 4FP9A 1OY9A 1RBOB 5DG9A 2OUGA 2UUAF 4HTIA 2NXJA 2CNKB 3QYYA 3VV2B 3I5AA 2UV8A 3HM9A 1GNKA 3EVOA 4EBDA 4P2FA 3MOJB 1UAWA 2F8EX 2N7YA 4PXEA 5GADU 2UUCF 4X64F 2H1YA 2UVWA 3T6JA 4Y2MA 3N6NA 1LK5A 4DR7J 5KFKA 3D1QA 4NLOA 3ZZOA 2J76E 4UTGA 2JH3A 3HHLA 1NK6A 5M2RA 3U1LA 3BYRA 1HBUB 1I51B 3R7SB 3R6LB 3TZYA 2BVZA 2R7RA 4K2XA 3OL6A 4C0OC 4NLVA 1TKTA 1TVRA 3MUVP 4RW7A 4K59A 1O6XA 2ZC4A 4HL9A 5I3QA 3DHWC 2QG9B 2N7CA 4QZVB 2M7SA 3T41A 3TUJC 2C2DA 4A8SA 1TMJA 3DRSA 5F0UA 4B9TA 2CPDA 2P6SA 2B56A 5L38A 1GMVA 4CRJA 2Z2MA 1N54B 1CVJA 2OIHA 3BKTA 1ZZFA 5FDLA 4DEZA 1O5JA 2KFYA 5IT9U 4EO8A 1VFJA 2QLFB 3KK3A 2WW4A 2WONB 4HI1A 4CTAA 1ZPWX 5EWFA 1QJHA 1WI8A 1RLCL 1I6JA 2BM0A 5AXNA 2FVSA 3RRGA 2M0GB 2XS2A 3K59A 1HNIB 2XMWA 2QT7A 2NCKL 5HQ8A 4IG0A 2K3KA 4RZRA 1NMEB 3EZUA 1RK8A 1BQNA 1PG5B 3NWRA 3BSCA 1VQ9S 1RHMB 3UNGC 3D0HE 1AUDA 4KT0C 4N8NA 1CJVA 3GYGA 3PRVA 2QMXA 4P71A 4CYUB 4Q43A 3JSMA 2E9ZA 1YBTA 2GIFA 2UXBJ 1D8YA 3BN7A 4DSFA 1JX4A 1NLKL 2CNNB 4Y28C 2BE7D 5KOXA 3VAGA 5GAEU 3BSNA 4JI5J 2A0FB 5A8KA 4F7VA 4IDKB 2ZC3A 1XNRJ 1ZBTA 3PW0A 3TW0A 2CQ0A 2VZ9A 4DOZA 1YVFA 3EJMA 1NEEA 1XQIA 1KC8T 4B3TF 3S8SA 2BX6A 4J91A 3HF5A 4F4KA 5A2QU 1TFWA 1U1PA 3IBCB 3DMJB 2HPUA 1IKVB 1LWEA 4LRBA 3QGPA 5IM0A 1ZPVA 1NUEA 1HR0J 3H5XA 2KT2A 3GFZA 4IG3A 4F36A 2HLUA 1IKXA 3LGHA 2HFVA 3V6JA 5HQMA 1LXNA 4DR2F 4WBFA 4M5KA 1WTBA 2B4VA 1XIQA 3RAMA 3S01A 3UQSA 3H4BA 1N5VA 5L9NA 3KG4A 4JI0J 4A8XA 2WB4A 2ZBQA 2ZJQQ 1NK4A 3R9LA 4TLQA 3C8YA 4YR2A 3KLVA 3Q89A 1KONA 1HPZB 4YS2A 2ZBRA 3MMCB 2MQ8A 5IV4A 5U47A 5KAKA 4CO3A 2QLWA 3MD1A 3HJFA 3JQKA 2VQEF 1OIAA 1Q86T 1SH3A 2FHJD 1SV5A 1BGXT 1QTNB 1T05B 3MCOA 1FVSA 2J0WA 3W2VA 2JLGA 1WKJA 3A3PB 4Q2LA 3Q8QB 1EETB 5KT4A 3OR2A 1MMLA 4M63A 5IT9Y 1I94J 1D1UA 2J8SA 4GC6A 2RHQB 3I55S 4KE5A 1VQKS 3HVTB 3IRXA 1VIXA 3CCWA 1RT7B 1Q95G 2D3O1 3HT0A 3KJVA 3QRPA 2Y1LB 4M5IA 2FJBB 4A8YA 3POTA 3QGIA 1W2BR 2R7XA 4K4YA 3V6KA 3L7UA 5KT2A 2NPFA 3QO9B 1T8EA 5KFVA 2A6MA 2OMLA 1W7WA 2WK4A 3MCSA 4C8OA 4C97A 3MR2A 2IJRA 2DXFA 1O8BA 1NDKA 3TA1A 4JI7F 4YB1P 1NDPA 1BUXA 4X4OA 4D3GA 5AE3A 4PAAA 4LFAJ 5LMNJ 4DR4J 3IAM9 2CPHA 4KHPF 2J9CA 1G4CA 4L74A 4OZ0A 4J9NA 1DHMA 2F8MA 2BQ3A 2VG5A 2DNGA 3DLBA 1PKUA 5CHCB 1QM9A 3FDSA 4DS4A 4Q8EA 3NP5A 4XPEA 2UUAJ 4WCEQ 4WFAQ 3PX6A 5L1KA 2G1DA 2XG8A 3KUGA 4UOGA 5A2QY 2LYVA 4A47A 1TFYA 1KBRA 4FF1A 4FZVA 2UUCJ 4JV2A 3DU5A 2BKOA 4XAKA 4F67A 3KYLA 2UU9F 4LBIA 3DRPB 4KPYA 1XMOF 4I2QB 3RBXA 4DSJA 4DL3A 4LBHA 5J2QA 3HHNB 1T9WA 4DHVA 1GH8A 3EGZA 4OI4A 4E8UA 1J5OA 2EFPA 2JEJA 3VAKA 3QZ8A 3QMQA 1RLDA 2NXEA 4NCGA 2UUWA 2I0XA 4ECTA 1EZZB 5KFQA 3CMES 1DURA 2PMZD 4ECWA 2VPWB 3E01B 4Y65A 2HHTA 3D1OA 3MEEA 2JSXA 4E2FB 2W2MP 3M4XA 4KC5A 2DNZA 4K4TA 3DRRA 2VBZA 2HFZA 5B08A 4YHHF 3HZGA 3RBEA 2YNGB 5LM7E 2DH8A 1JLQA 1IQTA 3OFGA 1FKOB 3IO1A 2HWTA 4A8MP 2W8LA 3THVA 1D0EA 2WBMA 5EHHA 5CYQB 2PFDA 1D9FA 5K5MA 2OI2A 4ES2A 1HNVB 3SEOA 1H74A 4WIIA 3MM9B 4AYBD 1IBLF 2RQMA 2O1PA 4E0DA 1S1TB 3QWUA 4KV8B 3AQOA 2QV6A 1DAXA 4WTYA 5J2NA 1LW2A 1HBOB 1UA0A 5DQIA 3GQCA 2FYXA 4F4ZA 3NRBA 1RAHB 3FBBA 4NLPA 2BM1A 1Y5LB 2J0QD 2I38A 1T94A 3PYEA 3NCPA 4X66J 3OSPA 1N0VC 2A18A 2VICA 1KFDA 1NSAA 5H9EK 5GAHU 2RUSA 1U2FA 3TQEA 2I1RA 1SB6A 3CW2C 1BY9A 3PRBA 3KK2B 2MZQA 3X1LB 3HHKA 4ED3A 2YWWA 4NXNF 4UOHA 4A48A 1S57A 2DD8S 5KFFA 4DG1B 4B3TJ 1LFPA 2CQBA 5G0RA 1B0TA 5D77A 4GVBB 4LMZA 4YN3B 1D3WA 2FB0A 2RNEA 3KLIA 1R8BA 2HKEA 2GX8A 1SKWA 1F5BA 1TR0A 3D5MA 2YNIB 3UE2A 4ELTA 3I82A 4DR2J 3R5DA 2AJ1A 2J5AA 3LGNA 1IN0A 3SQOP 1ZH5A 2ZD1B 2IAJA 4TU9A 4MKBA 1AB8A 4F25A 5KFGA 4FDFA 3KK1A 1ZTWA 1EQMA 3IG1B 3A4TA 1Y5IB 4N8OA 4ZPAA 4JI3F 2VQEJ 1M1GA 5GMDA 3G6ES 2XYPB 4ECRA 4ED7A 2OPQB 1FD2A 4FKXA 2CJ9A 2ZDPA 4Y2CA 1GAOA 1RWVB 1HW8A 2E1MC 2CPIA 4QU6A 3BREA 1KQSR 1SCJB 1SC3B 2ZH8A 4P6QA 1RWNB 4CNYA 3M6VA 4DL4A 5KT7A 3AD8C 2W9CB 4WFZA 1TKZB 2VG7B 4DCOB 2FVPA 2P9EA 3UN3A 1MROB 3SCLE 2RS2A 3M6WA 4ZPVR 4NCBA 3ETOA 2PE8A 3D4JA 1TV6A 2V2QA 3MFHA 3CUNA 2XO7A 2E5LF 3D28A 2CZ4A 1KN6A 4MT1A 2LXFA 3QT6A 2ADBA 2B9XA 4OX7A 4P9SA 3HFKA 3QJLA 3NBPA 2EEYA 1B64A 2Q6CA 2XI3A 3UO0A 7FDRA 5K9FA 3U1MA 3BKUA 3W60A 4HVZA 1HQUA 1VQ4S 2J9DE 2RF2A 4JI7J 5EWEA 4IYQA 5CYMB 1CG2A 4M5HA 1DQ8A 4QW8A 4DPUA 1FTRA 1AA1B 3W5XA 4ZPDA 4MMOA 4KHPJ 4NLQA 3R7NB 3FZBA 1QE1B 1GXUA 2MQNA 1UTAA 3GCXP 4LSZB 4RX6A 2ROEA 2MSSA 4OLPA 3KHLA 5DQGA 1GEHA 4RUAA 3NAIA 2CJKA 5F8JA 4QWEA 3DI6B 3D6TB 1X0FA 4KFBA 1X7VA 3RTVA 2IA0A 1IBKF 3K5LA 2CQHA 5L39A 2UU9J 4USUA 5HSPA 4DPXA 3DDIA 3M7VA 2ATCB 4C11A 3BDPA 1OQ6A 3CCUS 1T9UA 3VGSA 3R97A 3VAIA 1VISA 3ETMA 3NOCA 4I68A 4WE1A 4ELUA 3B4MA 2YH1A 2DPIA 2VPXB 1F60B 4RNOA 1NK0A 4DL2A 2E66A 3AA8A 1LW0B 3UD5A 4X4NA 4YEAA 4FS2A 3CGIA 1GXTA 2LCWA 2AHOB 3PEHA 4ECVA 3DFEA 1KQGB 4ZKAA 3BM7A 3TUZC 2RU3A 1S9EB 3L09A 2W25A 3MAAB 3VAJA 2FD2A 3HSJA 1S1WA 4YHHJ 5EN1A 2I2YA 1UVKA 4ID5A 2M52A 1TL5A 4DPYA 4H4MB 4TY8B 1YLXA 1S6OA 1NO8A 1U2CA 3VAFA 4YMEA 5IWAF 1FKPB 4TYBA 3RJMB 1P8GA 4DQSA 4Q7AA 1H98A 3NMAA 3EM1A 4RW8A 1IBLJ 3IGNA 3AB2B 2CPJA 3M8PA 4Q8FA 2MXYA 4PABA 2IBOA 3CCTA 1FNOA 1A0OB 5D0GA 1IKWB 4X4QA 3G96A 4U67Q 3BQ2A 5DDQC 3M9NB 3OXLA 2DKOB 1JLGB 3W8GA 2CPFA 3GB0A 1WC3A 5HANA 4M1KA 4F8RA 3FVYA 4RNMA 4A8QA 2M88A 1NXIA 4QWDA 2CADA 2YX1A 2I6WA 3CD7A 3GMGA 3L4BC 2W7OA 1FVQA 4MKVA 1T7PA 3RW7A 3LANA 3H59A 4WZMA 1YKWA 1YQHA 4RW4B 2GCFA 2QSWA 4OI1A 4CLSA 3VVTA 1B99A 3QT8A 2Z58B 1T0TV 2ZH7A 4DV6F 4NXNJ 2CG4A 4X65F 2A10A 3L7OA 1FX2A 1W2IA 2IDEA 2NR0A 1T02A 1CJTB 2XZWA 2XCAA 2E9RX 5SUHA 3G8SA 1K0VA 3SSSA 5E3PA 3O44A 1ACMB 2OD4A 4NEZA 3BR9A 1OWXA 4ED2A 4GO7X 2EWHA 4OJHA 1BWVA 4GO5X 3ZZUA 1VDHA 3H0PA 1S1UB 1FWLA 3L9ZA 4UOFA 1EIYB 3QQCD 3EWGA 1S10A 4LREA 3A8IA 4ZLLA 3MEDB 3KLFB 3GSIA 3BSOA 2XZDB 1PAEX 1RT3A 3WQPA 2EXUA 2JHEA 3H98A 5KFXA 1NPKA 4A8FA 4JI3J 1SQGA 1SIZA 5HMZA 3CSKA 3ITHA 5K14A 1GX5A 5D4OA 3M2RB 2E9TA 2HRUA 3NGKA 2BQUA 2FY1A 1N4LA 3KUHA 3V6HA 2EBGA 3HSGA 2KXHA 1OY6A 3DM2A 4BWJA 5CZXA 1KLNA 2DNKA 1NRKA 3D6HB 1U2RA 5IS2A 4RUCA 5F8NA 2IC3A 4B3OB 1U1NA 2XYHB 2AYEA 1TKDA 5I4MA 2Y8WA 4PG8A 4OZJA 2B4PA 1OYEA 3FMWA 1H7WA 4PEOA 1HWKA 1WEZA 1U45A 2HQIA 1JJ4A 1S76D 5E7OB 1YBAA 3OVAA 3AA9A 1J2VA 2QL5B 1HMVB 1U0HB 5KFOA 5M2PA 3LP0A 3UWTA 4BHQA 1NK7A 1WUUA 4O3RA 2E5LJ 2Y0SD 2DGVA 5C42B 1S9GB 2DHHA 3HZEA 3GCWP 1RT4A 3I87A 4F3OA 3H2UB 2IJNA 5A0YA 1YK9A 3WBZA 4CT8A 1ZAWA 1RWMB 3HSDA 4EZ6A 4WFBQ 3NAHA 2IVYA 4L73A 1YJNS 4LSLA 1WOOA 3ONQA 5B0FA 2KVQE 2DGOA 2AYMA 3NLCA 1JKHA 2MY8A 4ATNA 2D3OR 4NMLA 4B9NA 3D0GE 2YKNA 3EE3A 3VQTA 5FD1A 1WG4A 5A8WB 4ZJQA 2GO9A 1A7GE 3NGTA 2IMWP 1IJFB 1KDNA 3DXBA 4IFVA 1KVJA 2IM2A 5ETKA 1DLOA 1RTDA 4MJKA 1RTHA 5BYSA 4CLUA 5F41A 2KVIA 5L46A 3D3CJ 2HNYB 4C8NA 3MR6A 4O44A 4DL5A 2XWXA 1IBKJ 1ROFA 2E1AA 2LDIA 3U1NA 2HRTA 2HHXA 3M6XA 2MZJA 4UQGA 1XERA 1NK8A 2I5JB 4J9LA 4CM2A 3D7SB 3AT1B 1CJUA 2KL8A 2GVZB 4CM0A 3TUPA 2JJ4D 1WTFA 2YNFA 2DCUB 2K7JA 2HBQB 1SKRA 2H4WB 1G1XA 2PMWA 2BV3A 3E8OA 4CO1A 4FF2A 4NZ0A 3OW2R 3KJFB 3CJ2A 3LWLA 3R7BB 2RB7A 4YUDA 2WSEC 1RAEB 2X51A 1S0OA 4PQAA 4PG5A 2XULA 3THPA 4PWDB 1H2TZ 3T5HA 4B3MF 2BYCA 4NLUA 4U6PA 2RRNA 4FF3A 3QRQA 1VR6A 1S48A 2QMWA 2L08A 2LFVA 5HP1A 5F3ZA 2H54B 2M70A 2KKHA 2X3GA 3GP9A 1TL1A 2PO4A 1YZ7A 2Z56B 5DO2A 4W90B 4E98A 1MMDA 1RUSA 3CCJS 2F4VF 2BXJA 5DM6Q 2W1BA 1UP1A 1MU2A 2LA4A 4Y0FA 1KWMA 2BRLA 3HDSA 1S1XB 1TUGB 1J5EF 2J8AA 4QR0A 3R5JB 2HFOA 5D15A 5HMXA 5H9EJ 2GVDA 1IJEB 2CNLB 4JI4J 1TU0B 2W2PP 3GSDA 3AOBA 3LA0A 2DYAA 5J2MB 3CWJA 3PYGA 5I3UB 3KFWX 4IRDA 4N76A 2PDAA 3BGRB 2RT3A 4IQXA 1PGZA 2XGQA 1H38A 4I6YA 3EGVA 2BJ9A 2XI2A 1F2GA 3RB6A 2GQQA 1JLFA 5CCMA 5HO4A 1YX2A 2K1RA 5BYRA 2B51A 2BABA 4X4RA 2XY7A 4F50A 4CLTA 3H25A 2FHJA 4DV6J 1RKIA 2OPRB 2XMUA 4LRAA 4X65J 2ZH1A 3DGVA 4AXIA 1E6YB 1F6TA 3V4IA 2AYBA 1FO1A 1UPMB 4FXWA 3BH7B 3DGPA 2BUNA 3NCQA 5CH7B 4V19X 2PC6A 4LQ3A 3M2UB 5DRKA 3HKZD 3M30A 2CPZA 2B4OA 2XM3A 1CLFA 2XC9A 2H5JB 1HI1A 1WF1A 4DV5F 3VR1A 3M1VA 1OPZA 4URSA 4G1QA 2FHKA 1XMBA 3OLAA 1UEVA 1RAFB 5F8IA 2AJFE 5AXKA 2HNDA 2KG1A 4LR9A 4ZOSA 2HIYA 4FXVA 3CCZA 4ZVQB 3TX0A 1N6QB 4LF5F 2WB1D 2VFVA 4M5DA 1F3FA 1CPZA 3AXMA 2DGTA 3OVSA 2YH0A 2W4DA 5LOQA 4ICLA 2GQCA 3ZZPA 2KTQA 2V94A 3K8WA 3TZWA 1TL4A 4USIA 1S9FA 1RTDB 3GJTB 4JV0A 2L41A 1TQLA 3DLGB 4XTTA 2CJXB 3R5CA 3GIKA 5L1JA 2LLZA 4ELVA 1ICEB 3I9ZA 4ZDNA 4CLZA 1V3ZA 4Y2IA 4M8LA 3CTRA 5IQQA 1UWBB 1UFKA 3PXGa 1RA6A 3VAMA 2KB2A 3DOKB 1L3SA 2BJEA 2CQCA 5B0CA 4PQUB 3DLEA 2AJQA 1TL3A 2CPYA 2ALYB 1F9FA 2FZGB 4EUVA 1RGVA 1TZ0A 3H2LA 3MM7A 2XYGB 3BPSP 2BANB 1UVIA 3G86A 4ETXA 3CMQA 3C46A 3MM5B 2BE2B 4B3SF 3M6UA 2FLLA 4K4SA 2F8HA 4NLYA 2MTLA 3GZ7A 3E3XA 1B3TA 1EP4B 3H5YA 5A8RB 5DQHA 1DTQA 4BCAA 4C0BA 2C2NA 1S0MA 4USTA 4HH1A 4OX9J 1K8AT 2GJIA 3V81A 4KH0B 1RWKB 2IFXA 1CULA 3TVYA 2E7WA 4WU3A 3MR7A 3A12A 2V2ZA 3PZPA 2DT9A 4OX6A 4L6V3 4JYAF 3QIDA 2L9DA 3VCDA 3EZOA 4H4KA 4O0IA 4OZ3A 1YWXA 3SQGB 1NKCA 4MH8A 3NWGA 3ICLA 1CQNA 1Q8KA 2ASLA 3W62A 5J1EB 1HQEB 1X31C 4KPCA 2PT0A 1BQMB 5T7LA 1RTJA 4W4MA 1IR2A 2J9DA 3M8RA 3W63A 2ZJRQ 2HGMA 4ID8A 4DSIA 1NKEA 4JP8A 2OPSB 5H9FJ 1KHWA 1VK3A 3TZXA 2FLNA 5DLFA 1ZM3A 3US5A 3J81j 1N5SA 2ZOMA 2V8VA 1HIYA 4K4XA 1QUPA 2XSFA 4FYDA 3QAUA 1AZSA 2SXLA 2LEBA 1AFJA 2EG2A 2ZH2A 5BJRA 2G4BA 3NGUA 3B54A 1U1KA 2ZNZA 4Z2XA 4I67A 3TAMB 1VQYA 2EVZA 2BKPA 1IBCB 4P2SA 4DV0F 3KNAA 1S49A 1UETA 4USVA 2IHR1 5EUHA 4BC9A 2RIJA 3TO8A 2LU2A 4NI2A 5DDPC 1U49A 3KG0A 3HD1A 5GMEA 5E2QA 5DDOC 3SDEA 1BC6A 1Q78A 1W26A 4RL1A 4ZP7A 1NAQA 2CNOB 2U1AA 3BQ1A 3V6DA 2C2ZB 5D0EA 3S6EA 4KHMA 4KKOB 3ENQA 4ZLPA 2AEJA 5HROA 1D09B 4OZLA 2OSQA 3FBCA 3BKFA 2DRBA 2F4VJ 5LXYA 2GA7A 3JYTA 2DVIA 4C0HA 1J5EJ 2R7WA 1SL2A 3CD6S 4KO0B 1VRUB 4ZK7M 2VG6A 2LQBA 1R8AA 1I5OB 1YHQS 3KUEA 1NSKL 1F9HA 3GYNA 4JV1A 3PY8A 1PYTA 3H2VE 1S1VA 2CQIA 1RT1A 3IM9A 1RKJA 1M5KC 1RBAA 3PKMA 3CO9A 4Q0BA 1RT5B 2VFSA 2NXCA 3M8SA 3H4DA 1M0SA 1O51A 4OHZA 5C25B 5DJBA 3M8WA 4DV2F 3J80U 4O4GB 1GMUA 5JJBA 4LF4F 2UXCF 1EKSA 1VLOA 3JTPA 4O3PA 1KD1T 1WG5A 3MMAB 4NXMF 2YQ1A 4WK3A 4J9KA 5KFHA 3CC7S 1Q8BA 2DIUA 1RABB 2RQKA 3OSNA 4FN5A 2VA2A 1CJKA 3CD0A 2EG1A 3OUYB 3JTNA 3DDNA 3ET6B 1C1BB 1PO6A 4J5OA 3BN4A 1XR6A 1QVFR 2HS4A 1YRTA 4U7CA 1UJ5A 3U7JA 4CO5A 2ZEJA 2FVCA 2OGUA 2FPHX 3D6MB 2MQQA 2KI2A 2ZZTA 2IRUA 2V2VA 4DV5J 1WEXA 2GMLA 1U02A 3M32A 1QDUB 2FHMA 1S72S 3Q22A 3C66A 4TU8A 2QL9B 1FK9A 4ZHRB 3TARA 1PJ5A 4LF5J 1JJ2R 2EW9A 3D66A 2CJQA 1T9XA 4ZN1A 4RO0A 1U8SA 3QSIA 2ERRA 2YBVA 4HACA 1UEKA 2D69A 4CZCA 1OSDA 4NZ6A 2W7PA 1OJ4A 3BYPA 4PZVA 2V5HG 1M1HA 4DR3F 1ZS6A 5A6PA 1S6PA 3TOQA 1TKXA 1HNWF 1DTTB 3OTOF 2ZH4A 2R8JA 5E0OA 3C14B 2HZCA 1F2HA 3VGTA 1C4AA 1GTEA 4I2PA 2JFDA 2DNMA 2KHDA 3I0SB 3LP1B 1LWCB 4DPOA 3NCRA 5B0GA 1S79A 3TZZA 2VOPA 3EDRB 2YWGA 1UFLA 2DHSA 4L75A 3OD2A 2GC8A 3ZXWA 1EQ0A 3PJWA 4PXCA 4P2MA 2LP4A 2D3UA 4JUZA 3GR1A 1ZM9A 3GONA 3TAPA 3EVWA 3P3DA 2QZ8A 4ZP6A 2G13A 1PAUB 1REVB 4B3SJ 3BGUA 2VF3A 4MFBA 5RUBA 3BS9A 1FFWB 3JXOA 3T9NA 5HBMB 1KLMA 4KGXB 3OL8A 4ILRA 2BKNA 4PG6A 4MTPA 3TA2A 2HHHF 1VBYA 3PKYA 1BLUA 2QJ3A 1RTIA 1RHKB 3SI8A 2BW2A 1BD6A 4RUBA 3GTYX 3SSQA 3TNVA 2PI4A 2DEJA 4AUKA 4JYAJ 3BBFA 3KLGA 2QX0A 1SH0A 4NASA 3K2YA 1RU1A 3Q83A 3J80Y 2XY6A 5F9NA 4ZVPB 2KXNB 3ISZA 4CIOA 1X4HA 4OYPA 2R2RA 4C6AA 1WWHA 2Q43A 4DUZJ 4ED8A 2F63A 4J9MA 2A3JA 2Z2YB 1C0UB 2OMOA 2A2DA 1HFEL 4EGLA 4NLGA 4ZCMA 1VC0A 3UDCA 4EBEA 1RT2B 2RRAA 3Q8RB 3C6UB 4DU8A 3MGJA 5LJ5Y 4C8LA 4C3MA 4ECUA 1RB0A 2AU0A 2B9YA 4J9VA 4B17A 4DI6A 4I1TA 5KFWA 1RT1B 1VI7A 1TUWA 1N32F 3GV7B 4OI3A 1QSSA 5KFMA 4PXBA 1JLEB 1VBZA 2DPJA 3CULA 2VUGA 3W66A 2NS1B 1Y3KA 1XTZA 2ZVIA 4UZCA 3DN9A 3GLJA 3UVJA 2HHQA 2PA8D 1Z4UA 3MMBB 2NYIA 2RSQA 3KJQB 4ZP8A 1FRXA 2V8GA 3FRZA 1HQ2A 5A6WA 4ZVEA 4OLOA 2AMCB 2B4UA 3VHQA 2CIMA 5LT5A 2YKMB 3QPIA 3OR1B 3K5OA 1JJCB 5HLFB 3TVKA 1SKSA 3UFCX 4OI6A 1KOHA 2J7UA 4QR2A 3DOMA 4C9DA 2YX4A 3MM8B 2KM8C 1JXEA 4USWA 4J9RA 2K7KA 1VJWA 4FBUA 1HBUA 1WC6A 1NJZA 3QWPA 2KH9A 2JDJA 2I9SA 4ZLNA 4LF8F 2AJ0A 1VIOA 1VYAA 5I42B 1K47A 4M5GA 1TK5A 4ZN3A 1U48A 3M8QB 2WCXA 3QIPB 1CSJA 2XHCA 2QEXS 1DBDA 2WBRA 3HK2A 4DFMA 1UA1A 3RR8A 4IO1A 3PW4A 2RILA 2JWNA 2AV5A 2E5HA 4NRTA 1VQ5S 1NKBA 4NA2A 4F4AA 4OYXA 4BLGA 4DV2J 2JEIA 4X4VA 4LF4J 2W2OP 2UXCJ 3LUYA 2FC9A 1JIHA 2WONA 2BQRA 2HHSA 3RU0A 4NXMJ 1S7IA 4TLRA 1NPPA 2FJVA 5FIIA 3R27A 3QBCA 2QA1A 1SQFA 2XB2D 3BSAA 3HVWA 4IOCQ 1HNIA 2Z57B 3HHLD 1HARA 3PW7A 3EMTA 1R7IA 3G2XA 3CDAA 2CQGA 4ZPBA 3PVXA 1HD1A 4JOUA 1HNZF 5ETRA 1B0PA 4CQ1A 1UW9A 1X8DA 4OQJA 5LSRA 2F4FA 4JI1J 4CYUA 2KZMA 4I7FB 1RHUB 1V6HA 4R8UB 2W4CA 1U1MA 2C22A 2ZH3A 2AKWB 2E44A 4KGZB 2B43A 4YDDB 1VJQA 4OYAA 4IDKA 3AXKA 2ACYA 4UY8T 4AQYF 5FJ4A 4NMXA 4RPFA 2CG8A 4YR3A 1VQ7S 5ETMA 5HVHA 2ZE2B 2PGCA 2ATLA 4LF7F 3NGRA 1IM6A 1ELOA 2DNQA 2AX0A 4DR3J 3BQ0A 5ETTA 2ZVSA 4WIQA 1VK8A 5IT4A 1Y9OA 1S97A 3DMJA 2H5IB 3I5BA 1IKVA 3OTOJ 2EPIA 3HHLC 4C8YA 4QW9A 4WWSA 3VQSA 1GMWA 3SV3A 2OH2A 2XS5A 5E3CA 3MDFA 5KG2A 1U1OA 4PUOB 2DO0A 4FNHA 5KFBA 1LXJA 1SUQB 3CE8A 1RYRA 3WC2A 3PYDA 2HLTA 2AEFA 2HURA 5DLGA 1HPZA 4RNNA 3IR6B 3MMCA 3LP2B 4MK8A 2GV1A 3GYXB 1LFWA 3SIPB 3GG1A 2P9GA 4DUTA 1XNQF 3CJRA 3IGVA 3SZ2A 3RBDA 5GADI 5ETVA 5K8NA 2GJ2A 4NLTA 1T05A 2QN6B 3MEGB 1NZAA 2N3OA 3W64A 1UPPA 1U8WA 4OJ1A 2WZ1A 1XBWA 4QU7A 3DOMB 1XEZA 2JRSA 1EETA 1EKRA 1AROP 1R0AA 2C3UA 4DF8A 4AL7A 3CB4A 2R2TA 2XMVA 3HXMA 4I6AA 3F44A 3ZZYA 3DKDA 4G1IA 2PA3A 2HQGA 3HVTA 4K5RA 1RT7A 2MZSA 2A2CA 3QLHB 1ZM2A 1G2EA 3ZTPA 1CC7A 4WFYA 4LSNB 2DNOA 3IBFB 5HMYA 2M5YA 1VC6A 3DYAB 3QO9A 2CQDA 3AH6A 3PFOA 2HW3A 4NYPA 1D9DA 4DWIA 3G4SS 4PG7A 2ROGA 1N32J 2VIHA 1DY3A 1EAYC 5B0AA 3FZ2A 2LDYA 2ZKUA 4KB7A 4O4RA 4QIFA 4EU0A 2HWIA 3BB5A 4Z7YA 1IM4A 1NBEB 3FGVA 2V8PA 3D9BA 1L3TA 1R31A 2CQ2A 5KG1A 2AP6A 3QGGA 3LWMA 4NA1A 5AT1B 2N3LA 1HHQA 1WC5A 4MIBA 3T1HF 3FBFA 3EGNA 2MGZB 4JV5F 4BDPA 2CDRB 2KDOA 5C24B 1WEYA 3GFXA 1Z2LA 3OJUA 2RRBA 2VU5A 3OBIA 1U47A 4WZQA 2HFSA 1FDBA 2W9BB 2DHGA 4IRCA 2O01C 1U25A 2CQPA 4IRKA 4ETZA 3I4HX 3DRPA 4ZPWR 2HGLA 4I2QA 5F8LA 1MWZA 1GTHA 1KP6A 3PO4A 3HKWA 3BH6B 2V0NA 4WXOA 2E1CA 4LF8J 4Q45A 4ZMMA 2GHWA 1Y7PA 4X4PA 2L9WA 1R43A 2CZVC 1RA7A 5IXUA 4HTJA 2C2RA 2DNLA 1CS4B 2EK1A 3PJXA 1Q7LB 4U7UK 2J6UA 3E01A 1FEEA 3SCJE 2UUTA 2CXEA 2IM0A 2ABYA 3ILOA 4MYTA 2HBRB 3J7Z5 5CA5A 4C98A 3UDLA 3HO1A 3QRRA 1V5IB 5LXRA 3ZNJ1 5B0BA 2YNGA 3IWNC 1PJ6A 2R8KA 1FKOA 2O66A 5E5NA 1NJXA 5HVGA 4QPTA 2C3OA 2P2CB 1NB2A 3CXCR 5CYQA 4R5PB 5F8MA 1HWIA 4CT9A 1M5SA 2HZAA 3JSBA 4DL6A 1HNVA 1B7FA 2O5DA 2HAFA 5E41A 3MM9A 4C3LA 2V68A 1VMBA 4WYWA 1S0VA 5AXLA 1S1TA 1U6BA 4KV8A 3CJ5A 1EX8A 1JQGA 2J0XA 1HNZJ 1HBOA 3ZFVA 4FPRA 4DSEA 3VWSA 7AT1B 4ZPTR 4J9UE 3UD4P 1BE4A 1SXLA 4HT7A 2YQ0A 2E5GA 4DFPA 2XLJA 4ZVRB 2CPXA 3LW5C 1X0PA 3QT7A 2OKQA 1R3NA 3MCNA 3CMAS 1R0AB 4N56A 3KK2A 3KTQA 4OYIA 3ENVA 3Q8UA 3SBMA 3I0RB 4DG1A 4LF7J 2H3EB 4DR5F 1IVZA 1B0VA 4PWWA 3RRHA 4QYZJ 2ZHAA 2ALZA 3WIVA 4GVBA 2B9EA 3MURP 3TRGA 4DMZA 3PIPQ 3AODA 5L9XA 1SL0A 2LEPA 4TQSA 2X3DA 2DHAA 4MK9A 3TQ1A 2YNIA 2HQ3A 1K9MT 3OPKA 4G6VB 3CC2S 2DH7A 3ZNUA 3SFGA 4I4BA 3CF5Q 3R5GA 4UOCA 2ZD1A 5KFAA 2KFZA 3IG1A 4HDGA 2MDAA 1JLBB 5AXMA 2F9DA 1S4FA 5CAAA 2ZOFA 3MWBA 3AD7C 1XNQJ 3NY0A 2F9JA 2R7QA 3KLEB 2WVFA 2AWZA 2W4PA 2X1BA 1I3OB 2J6TA 2GMJA 2GGPB 2OPQA 1T3OA 2K2PA 4F4WA 2ZBIA 2JC1A 3K89A 4DX6A 3EGWB 1VBXA 3PRDA 1LK7A 1FF2A 4ZVUB 4X64J 4ITSA 2YWKA 4DN9A 3HPOA 5IV3A 2OJ3A 3ISND 2W9CA 4EK2A 2XMMA 3QAEA 4OYMA 1TKZA 2VG7A 1MROA 3GIRA 2ZITA 2D1CA 1HLWA 2J9EA 4F3QA 2KG0A 5CABA 4DFKA 2NZ4A 2RHSB 5E3AA 1RT6A 4XDDA 4URQU 5ITHA 3LPYA 3D68A 1ZAXA 3MM6B 2HMIB 3NNHA 3OFFA 1YGYA 2QYGA 1IBMF 4WYLA 3H42A 2BJ8A 4JI8F 5CYMA 3QFWA 1WNEA 5AE2A 2AJ2A 3PW2A 2GHVC 3LH2S 3T1AA 5E33A 4LRCA 3J7YU 4NLRA 3BR8A 1C0TB 4U8VA 2DGSA 4WJBA 3N6LA 5LL6d 1QE1A 2D3ZA 5F8GA 4CO0A 2YNHA 4QCLA 4LIRA 2CJAA 3KDNA 4UZBA 5JUMA 3GU0A 3T1HJ 3ISNC 3C15B 2QA4G 3TVZA 2JVOA 4GVLA 4WP9A 3G9CA 4OJ3A 3DI6A 1GFWB 2AGPA 3CJ4A 1IKYB 3PIOQ 1AYEA 4BS2A 2ZWPA 3DU6A 3CCES 1WHXA 2ZH5A 3IAS9 2MLYA 2ZBCA 1NB7A 2Q66A 2Z30B 2M9KA 2VDIA 2UP1A 1W25A 3TJAA 2CZ9A 1FXRA 2LXUA 3MTKA 4KTQA 4ZVGA 5J2PB 2E5IA 8AT1B 3CJKB 4EFAC 5JVGQ 5LJ3Y 3KLHB 5KFNA 1YJWS 3AHPA 2R7SA 3RRKA 3K0JA 2VFTA 2IM3A 3MMJA 1LW0A 1NDLA 1RCXB 3PV8A 1L3KA 3DRYA 2OFHX 4QWBA 3SSRA 3G6YA 1U6FA 2MPUA 3EPGA 3FSYA 1HBMA 4K2JA 2FGCA 1VRTB 2Z8QA 3U02A 2KXFA 3IRWP 1TK0A 1U4BA 4YY3F 1S9EA 1RWOB 3CDUA 3CJ0A 4LF1A 4R25A 3MAAA 2HHUA 1FESA 3MR5A 5KG7A 2F1FA 2L9NA 1Y4ZB 4M5JA 4DJBA 2OEJA 3VGUA 4H4MA 1VQMS 2MYFA 4TY8A 1F0XA 2BEFA 4F2RA 3I5CA 4OMFG 1EJ7L 3H8YA 1FKPA 3ZTSA 2WHOA 4RBTA 1KS2A 2XMTA 4IFYB 3OT9A 2VD3A 3FSIA 5BXIA 1QVGR 2H51B 3Q23A 3D1HA 3NG8A 1SVDA 2DGQA 4ENOA 4F02A 1TL7B 2KJVA 2DBBA 4NL5A 2MKHA 1HHSA 3RB4A 5HK4A 3OV7A 1FXDA 1IKWA 3HX9A 1UMJA 3CJTA 1JLGA 4DL0C 4RNFA 3R6GB 5DZ6A 3N28A 4N5SA 4JBCA 2HQCA 4PG4A 2R7VA 2ZH9A 4RJVA 5D4PA 2MY7A 4DLGA 4YR0A 4UUWA 1X5PA 2V4JB 2LVWA 3C16B 2MQPA 4DF4A 3PDNA 2B6AB 3JSRA 4RW4A 1RZMA 4LF9F 2OEMA 1XR5A 1E6VB 5D8HB 4A8KA 1YTYA 4HYKA 2VC0A 2KJWA 3BGFA 4S0MA 4DR5J 4ZVHA 1CJTA 3I31A 1RAAB 1RT6B 2CJYB 2NLWA 1Q16B 4I64A 2DNYA 1ZYQA 1N5YB 1T03B 4C4WA 4DSKA 3BZQA 3TX8A 5T41A 4J90A 2L3MA 1TAUA 3MF5A 2UVRA 3VF0B 1S1UA 4GRSA 1HR0F 2R2SA 2Z2ZA 4KR0B 1OYDA 1X9MA 2FUG9 1HYSB 2NYHA 3AFGA 3MEDA 3TI0A 3KLFA 3CJ3A 3IFEA 3PO5A 1WC0A 1TP7A 4H4OB 2KHCA 4QIWD 3VAHA 2GJFA 4YB7A 3ILIA 5C5JA 3K5MA 1T9YA 3Q2TC 2YNHB 3N0VA 1Q8IA 2M3DA 3M2RA 2ZWOA 5KG5A 3I6PA 4YB5A 1Y11A 4R0EA 4U9RA 2YWHA 1RAJA 5EX0A 1FRMA 1ITPA 2F7VA 1FDDA 2IDLA 3Q2SC 5F8HA 4DPTA 2MJUA 1VQLS 1FDAA 2HBZB 4B3OA 1VHIA 3MECB 5T14A 1H0HB 4U8YA 2RKIB 4HHUA 3QSYB 4GC7A 2XY5A 1KVIA 3OVBA 3CCLS 1FCAA 3Q8PB 1N88A 1A6LA 1XMOJ 4ZCIA 1HWJA 3LF0A 3FEXB 3CC4S 3P45B 2PEHA 5KFEA 3N01A 1G6BA 1HMVA 1U0HA 2V8DA 2MQMA 3AOAA 2KRBA 2IRXA 3MR3A 1TTHB 4NLXA 5C42A 1S9GA 1F5CA 2NPIA 2YTCA 2VBWA 4K4UA 3LPEA 3DNCA 1RHRB 4DFJA 2AZ3A 1IBMJ 3W9IA 4FPIA 1HBMB 4EWTA 4JI8J 2HHVA 1OPIA 5D3GB 3PM9A 2H5EA 3IS9B 1FJ7A 1QAJA 1RAGB 2CPEA 1GX6A 3W5ZA 2RDJA 3WIUA 3T3FA 2GQ2A 4YDXA 5A8WA 3L95X 3OXGA 3HP6A 2LA6A 1WOPA 4MKYA 2M4MA 3GJQB 4USKA 4NPOA 1K44A 2ZKTA 1LWFB 2DGWA 2FJXA 3ZZTA 2HBYB 2HFNA 2EBEA 1RWXB 3BGOP 3H5UA 3UDVA 3O1LA 3D67A 2ASJA 2HNYA 1X9SA 1HL6A 1LWXA 1RWUA 3G71S 2VDHA 2MZRA 1U1LA 1PSDA 1FDNA 4CH0S 3M2VB 1WACA 2AT1B 1KTVA 2DR6A 2I5JA 5KFZA 2C1EB 5KG6A 5KG0A 2B8PA 2BMBA 2GVZA 2BR0A 2W8KA 4RW6B 2E5JA 2G0CA 4IOBA 3G87A 2BJDA 3DOLB 2M8DB 1AW0A 2OPPB 4LVNP 1YJRA 4RKUC 2W2NP 3WZ0A 2GHPA 2A6OA 5EDWA 4L3NA 4YY3J 5AE1A 3FFIB 3B78A 4B02A 1WF0A 4KIAA 3N9UC 4PWDA 3ZZZA 2VFRA 4NLDA 4B9MA 2EFQA 1ULRA 4K7QA 1FWPA 4QR1A 4O3SA 1JLCB 4U96A 4UT4A 4DX7A 3THTA 3NOGA 2ASDA 3DLJA 3UDEA 1MN7A 3VALA 3J7A1 1WJ9A 2DITA 3PHTA 3BDEA 2MB0B 3L7PA 3RUBL 4OZNA 2KO1A 1MW7A 2DNPA 4TXSA 5KFCA 4CLKA 2JVRA 3TANA 4JI6F 5KT6A 1DQ9A 2DXEA 1NCLA 4LFBF 4I0WA 3HVAA 1S1XA 4NLSA 2KM8B 4IH6A 2B9WA 3SXLA 1YJVA 1JLAB 4XDCA 3M05A 3R5BA 2DISA 3O2IA 2XLIA 5J2MA 5I3UA 2LQ8A 3UD3P 2FJWA 2BOPA 3BGRA 2XMKA 1YDLA 3T9ZA 2OD6A 4JB8B 4P2XA 4LRFA 3W2WB 2HVHA 1FHTA 3A13A 2G2OA 4ZVTB 2VKZG 1QSYA 2D41A 2C3YA 1TUVA 4X66F 4LF9J 3DLLQ 5JVHQ 1ZA1B 2OTLS 3VZHA 5DG8A 2OPRA 4PYAA 1CBKA 5D6GA 3CCSS 3H7HB 1NDCA 3UR0A 2K06A 1E6YA 3RB0A 1RE1B 2EFGA 1IWAA 4NYZA 3OJSA 2IVMA 2HNZB 1NHUA 4ANEA 1PIEA 1VS3A 2XSJB 4DQQA 1U24A 1OSCA 2F65A 5ETNA 4P7VA 3M2UA 1RACB 3ZTRA 2DR5A 2B5JB 1QUVA 2I8EA 2VOOA 3SCKE 1RADB 3C6TB 4U95A 5CD4A 1C1CB 3DLKB 3GILA 3RG6A 3GJSB 1XC9A 1FTCA 1KNZA 3SCIE 1N6QA 4UUXA 2R7TA 1KHVA 4OV6A 3EVMA 4KHRA 5CD4H 1RU2A 2QGFB 1Q1KA 1QLNA 2QIFA 4M94A 1T11A 4A8WA 3WDOA 2HEKA 2EFNA 5MLCV 1Y3JA 1LNQA 3DLGA 2J7KA 2XCPA 4FYXB 1UVNA 4O23A 3FCVA 1TMMA 4Y6IA 5EX3A 2RJZA 3FQKA 4Y00A 3AJ1A 4ZS6A 3KXDA 2D7SA 1UVLA 1AXQA 5DZ7A 1UWBA 1L5UA 4AL6A 3DOKA 2YPZA 2G2YA 2IBKA 4PQUA 2CQ1A 5IT0A 4EO6A 5KFJA 4DR1F 3HHLB 3JS9A 1K73T 5K8OA 3HHEA 5I3PA 2BANA 4QYRA 1H2UX 4CLYA 1J27A 2F5GA 1S12A 3MM5A 2IJFA 2BE2A 3ZZ0A 4ER8A 1RWPB 2VH7A 3V2UC 1GT8A 4KGKA 5J1PA 1QSLA 3CD5A 1SJQA 1EP4A 4F26A 4LR7A 2RS8A 1TKTB 1TVRB 5A8RA 1FWKA 3C2PA 4G3IA 3IN5A 3L3CA 4O3OA 4RW7B 1ZOTA 2Q6BA 2VA3A 3AJDA 3CCVS 2VPZB 4ILMA 4XIUA 1WC1A 2QMUB 5L1IA 3LGMA 1DQAA 1M5HA 5ETLA 3K58A 3DRSB 1Q5YA 2HFUA 2GAHC 3UNYA 1VC5A 1XJWB 2V9WA 2Y8YA 5B0EA 2IYIA 1IUJA 5IWAJ 4EZ9A 3MZIA 4HDHA 3SFUA 2XQCA 3UR3C 4GKKF 4N7TA 3SQGA 2AEMA 3PNIA 5FDLB 3RZAA 2VJVA 3E51A 5J1NA 3TEHB 3KK3B 3MUTP 1U1RA 5J1EA 1HQEA 1DJ0A 2ZUAA 3KJNB 4CTAB 3X3UA 1BQMA 4RLEA 1EB0A 1KQKA 1X4AA 3HFVA 1RSCA 1URNA 1S99A 2OPSA 4IG0B 2V4RA 2MKIA 1UFWA 4DZ6A 5KFIA 1BQNB 1D9AA 2JEGA 1WHYA 3K57A 4R0JA 4NEYA 2V2KA 1CJVB 4DDFA 2N4DA 4HEA9 2POKA 3K8VA 4OHXA 3UCZP 4IH7A 3G82A 4AE5A 3I56S 2G9OA 3TAMA 3JSMB 2OLWA 1YSJA 4DPWA 1R8PA 5A8KB 4WF9Q 2HSEB 4WPAA 2ILZA 2U2FA 2ZNYA 2DIVA 3MPUB 4GKJF 2WSFC 4WFXA 2E7VA 3RAXA 1BWEA 4ANCA 3HVRA 1RWWB 4FVCA 4OZ1A 4OV1A 4CDIA 2WVEA 2R42A 4TU7A 5K20B 2R2UA 4RBUA 3OHBA 1T95A 4PWUA 1T3NA 4KKOA 4EI2A 2XLKA 1LWEB 2NSBA 4FNIA 1SQEA 3UN2A 5IM0B 3KOAA 3CCQS 3MPVA 2V6AA 3GJRB 4JI6J 3DC2A 1FJCA 2G0IA 3LTOA 4IG3B 4PCQA 4NYOA 4LFBJ 1IKXB 3FBEA 4W98A 4QIEA 4M5MA 2YXLA 4C2MA 1SJ4P 1CQMA 5G4DA 4KO0A 1X4BA 1VRUA 4MIWA 3PR4A 4ED4A 5ETQA 2H48B 2R7OA 4UQTA 3CCMS 2VHGA 4F4XA 3F0NA 4ECZA 3O3LA 1GK8A 1RT5A 1RAIB 2FQQB 4DV7F 2AW0A 3HT3A 1M90T 2JFKA 3KWMA 5C25A 3CVKA 3LQVA 1SV5B 2B7BB 4H4KC 3RGIA 2LMIA 3C19A 4O4GA 2AQ4A 9ATCB 3W2VB 3MMAA 5HL7Q 1PC4A 5KT3A 1UKUA 3IM8A 2DNRA 5D0HA 1VRQC 3GV8B 3OR2B 2JL9A 2Q79A 1UZHA 2P8IA 3OUYA 1SPBP 4ANDA 3ET6A 1C1BA 2HZVA 4WP8A 2RAQA 3IRXB 2DR8A 3KJVB 2F3JA 1M5OC 1FI4A 1N0UA 3POTB 2LEAA 1XR7A 1S59A 3OTEA 4FYWB 2WVBA 3M9OB 1X4FA 1WDDA 3QATA 2X7IA 3ZTOA 1RDRA 5KFUA 3N5BA 3LAKA 4F04B 2MZ1A 1Q7YT 2CAJA 1FNXH 1QAYA 1AFIA 4ZHRA 2CUYA 3UI3A 1JMTA 2PSZA 2V8HA 1R0CB 3TJ9A 2J0SD 3GE9A 5B09A 2AZ1A 1VCTA 3OLBA 2VG5B 2CJBA 4EYHB 1YBUA 3IR7B 1YJ7A 4HKQA 3TP2A 1QY7A 2YQ3A 2HWHA 2RDIA 1R89A 4FS1A 2ASYA 1DTTA 4AFFA 2CFXA 3C14A 4QPXA 1UW4A 3I0SA 3LP1A 5HI7A 1LWCA 3KKFA 3BO3A 1KTQA 2QYCA 4ZVSB 1S6QA 1VOMA 5JXSA 4X2BA 1PYSB 1P27B 3FRYA 4DR1J 1B70B 2V4QA 5J2QB 5FLXU 3KMQA 1OY8A 1V3SA 2ZHBA 3T19A 3G82B 1REVA 1J5OB 1K1SA 5CZVA 2FIUA 1N33F 2X1FA 4NCGB 1FJEB 5HBMA 3UPFA 1BXNA 2E29A 4DR6F 4OHWA 4TY9A 1SJ3P 4ED0A 3EUNA 3B8HA 3EX7B 4K4ZA 4W92B 1KFSA 4B3MJ 2DEIA 3MEEB 4QOTA 1HA1A 3P5TL 2ZM6F 4HHHA 2HRYA 3DRRB 3BEGB 4RBVA 4K50A 4EEYA 4J9PA 4PXDA 4LF2A 1N5QA 3DDKA 4BBYA 2R4FA 4GKKJ 1JLQB 5GAGI 4Z37A 3RYLA 2KYXA 1C0UA 4P74A 3IC1A 3GWCA 2C2EA 1RT2A 4HR2A 3PG9A 3CIMA 1WF2A 3C6UA 1D8ZA 1R0BG 3D54A 5C2GA 3DCAA 3MFIA 4KGVB 3DXSX 1CC8A 3VZIA 3F41A 4CCHA 3UW1A 5MAOA 2JOQA 2FGOA 1GQEA 2ZDOA 1R6VA 4J9SA 2FLPA 5H1SV 1JLEA 5J2NB 1LW2B 4B08A 4ZLJA 2IYGA 3EXCX 3QT5A 1YIJS 4F0MA 4Y2KA 5DETA 2FDNA 5LMUF 3PJ9A 1PJ7A 3MMBA 5ETOA 3LOUA 4IOAQ 1FE4A 3MTJA 2FY8A 1A9NB 5DGBA 2IM1A 5IQ6A 4KSEB 1NHKL 3FKBA 2ZZNA 1RTZA 2DRDA 5F9LA 1SKUB 5H9FK 2YKMA 3OR1A 1X5OA 2AD9A 5HLFA 1NJIT 2HVZA 6AT1B 1Q0NA 2B7CB 3W9HA 4GKJJ 2EC2A 1IWGA 3G8QA 5CCLA 4I56A 2OTJS 2EK6A 4ZCKA 3P5BP 3VVUA 3R1LA 2VB6A 3MM8A 5G0RB 1DFDA 1JK9B 1WC4A 1WD6A 3J7AN 2N82B 5IZHA 3NGDA 1RJJA 1SJ1A 3SV4A 2HHWA 2GMHA 1FD8A 3BJYA 1NPRA 4JI2F 1SI9A 3KLIB 1FRLA 4MIAA 1N48A 2C28A 1PBAA 2QE5A 2GNKA 3CJQA 1FT8A 2MQLA 2QTWA 1P1LA 2J7WA 4ZPCA 3WX8A 2MSTA 1SJFA 5EGYA 3A8EA 3BF4A 1DARA 4NE9C 2RD5C 2IAJB 1HNXF 4OHYA 3NL0A 5FLXY 3T5LA 5I42A 3M8QA 3KK1B 4C48A 3QIPA 4OZ5A 2L48A 2FC8A 2LQJA 1VQNS 2MZTA 5D4NA 4JI4F 2HS0A 2KN4A 1X9WA 3R5AA 4DV7J 4NOHA 4ZP9A 2FJEB 2QA4S 2ADCA 1UCNA 2Q1LA 2NSCA 2DGXA 3ILLA 1UEUA 4F0HA 1T9TA 3PCOB 1DRZA 1BHNA 2DGUA 2NQPA 3JAMU 3PFEA 1R8HA 2RMLA 2HVEA 3ZTQA 1YJ9S 1LKZA 3JSYA 1SC4B 2GIRA 4URGA 1S6QB 2YKAA 2V34A 3F73A 1WORA 2C2KB 2D74B 4WFNQ 2BJ3A 5DDRC 1TV6B 2VKRA 4ECSA 1LEOA 3IA0A 2C3MA 1IR1A 1YRXA 1NZ8A 1VHFA 1QAIA 3G8TA 2MJNA 2VONA 5KT5A 1WOSA 3FK4A 4I7FA 1R8CA 1GXLA 1HBNA 2EFOA 4R8UA 5B0DA 1WSRA 3NBPB 3FCHA 1KVKA 4ES1A 1RISA 2GO8A 1HQUB 1B4SA 3GIJA 1AUSL 2RF2B 1P9QC 1P6TA 3N79A 3IWXA 1X5SA 3V5RA 5CQGA 3FMBA 1HHTP 4AT1B 5BR8F 2GZOA 4CH7A 4CLLA 4UF4A 4QWAA 3T1YF 5EWGA 3SMZA 2ZE2A 4KY3A 3ENWA 4LJMA 1SC6A 4XPCA 5KFTA 2BJ7A 3CCRS 1HI8A 5F0WA 1WI6A 2HK3A 5B7WA 1XN9A 4QIGA 3CIZA 3H90A 3NEKA 2D9OA 2P6TA 2CQ4A 2DR7A 2DO4A 3HULA 3R3TA 2GFFA 3GG0A 5KG3A 4USMA 1X60A 2D9PA 2DR9A 2JNJA 2XBPA 4CLFA 5KFRA 4KFBB 4PUOA 3GFHA 1PC5A 1SUQA 4ED5A 1NSPA 2HVIA 4RWXA 1X4CA 3TUIC 4B3RF 4WKYA 2MHEA 3M9MB 4J9OA 4FYYB 4C11B 3LP2A 4ERDA 1T9VA 3HCXA 1HKAA 3MPDA 1BMQB 4WE1B 4ZJOA 5D4LA 3S1TA 3R2DJ 2BA9A 2JLEA 1N33J 4MK7A 1WELA 2YY3A 4DV0J 2W01A 4ECYA 3KDOA 3D0IE 2IIHA 4DR6J 2QL7B 1H6KX 1P9YA 3MEGA 2KZZA 2Y3YA 1OQ3A 1F5AA 4ZVFA 2VBYA 1WSVA 1Q5VA 2ZM6J 3HI9A 3KG1A 1N52B 4OX9F 2AF6A 1KOOA 1BQXA 2FZCB 1S1WB 5C7PA 2DNNA 3DLHA 4P7TA 3Q86A 1Y0HA 3W9JA 4L76A 3JAMY 3NNCA 2H4YB 4ID5B 4LR8A 4DL7A 1U1QA 4XK8C 1GMWD 3QLHA 2ZBPA 4MKAA 2DCLA 2AYGA 4LSNA 2QLXA 1S6UA 3DYAA 2LECA 4DV3F 4IO9Q 3JB9k 1NK9A 4A8OA 1VQSA 4RW8B 5THWA 3B82A 3MAHA 3W8PA 3PX4A 3M8PB 1QAXA 2NREA 4NA3A 4B9LA 4LF6F 2H9ZA 4RR5A 4BC7A 5LSOA 3JQMA 2OELA 3JTOA 2PMHA 3V4MA 1EARA 1G7CB 3OTDA 3AQPA 1G3OA
chains in the Genus database with same CATH topology
1FVSA 4KR0B 2MQOA 4J37A 2J0WA 3W2VA 1X9MA 3S6EA 2JLGA 3QJJA 4KHMA 2HS3A 2VQFF 4KKOB 2FUG9 3ENQA 1HYSB 3OXFA 4ZLPA 3MEDA 3TI0A 1Q53A 4Q2LA 3KLFA 3CJ3A 5HROA 3Q8QB 1EETB 5KT4A 1L3UA 5CYJA 1X4DA 4OZLA 2OSQA 3IFEA 3MOZA 4PPZA 3PO5A 3OR2A 2BRKA 1TP7A 1MMLA 5KFDA 1FKAF 2HGNA 4H4OB 4NZ7A 2KHCA 4M63A 2DRBA 5LXYA 4QIWD 5IT9Y 1NNDA 1D1UA 4DN0A 2GA7A 4GC6A 3VAHA 2W9AA 1WHWA 2LQ5A 4YB7A 4ZCLA 4QQBA 3JYTA 2DVIA 1ZTTA 4C0HA 5C5JA 4KE5A 3I55S 4CO4A 1VQKS 1C4CA 3K5MA 3HVTB 3IRXA 1VIXA 3CCWA 1RT7B 1NH8A 2R7WA 2MGZA 3KJVA 1SL2A 3CD6S 3Q2TC 4KO0B 2YNHB 1H7XA 2FJBB 1VRUB 1Q8IA 2M3DA 3N0VA 5C24A 4ZK7M 3M2RA 2VG6A 3POTA 2LQBA 4A8YA 1VQPS 1R8AA 3QGIA 1W2BR 2R7XA 2J6SA 5KG5A 1YHQS 4YB6A 1M1KT 3I6PA 4K4YA 3V6KA 4FXDA 2KFNA 3GYNA 4JV1A 1HD0A 3PY8A 3H2VE 4YB5A 1S1VA 2W9BA 2CQIA 2RH3A 1RT1A 4WKRA 4R0EA 4U9RA 2YWHA 5KT2A 2NPFA 1KR4A 3QO9B 1RAJA 1T8EA 5EX0A 1FRMA 5KFVA 1TAQA 1RKJA 1M5KC 2F7VA 1FDDA 2OMLA 3Q2SC 5F8HA 2WK4A 2PN6A 3MCSA 4C8OA 2MJUA 4C97A 1VQLS 1UVJA 3CO9A 3PKMA 3MR2A 4Q0BA 1RT5B 2UZAA 2ROPA 2VFSA 1FDAA 3M8SA 3H4DA 1M0SA 4B3OA 2OP5A 3MECB 2W24A 2WRMA 5T14A 1H0HB 1O51A 4OHZA 3OL7A 1O8BA 5C25B 2RKIB 3F56A 5E3QA 5DJBA 3TA1A 4GC7A 2XY5A 4JI7F 4YB1P 1KVIA 1HBNB 3OVBA 1HWUA 4K5SA 4X4OA 3MPYA 3CCLS 4D3GA 5AE3A 1FCAA 3Q8PB 1N88A 4NRUA 1A6LA 4DV2F 4TKTA 4O4GB 5JJBA 4ZCIA 4LF4F 4X4UA 2UXCF 1HWJA 3LF0A 4OL8A 1JXLA 5HN0A 3FEXB 3CC4S 1VQ6S 3JTPA 2PEHA 3IAM9 4O3PA 5KFEA 1KD1T 3N01A 2CPHA 4ALZA 1IQZA 1G6BA 2V8DA 1HMVA 5F3TA 1WG5A 2MQMA 3MMAB 4KHPF 4NXMF 2J9CA 4WK3A 4J9KA 4OZ0A 1R27B 4J9NA 1DHMA 2F8MA 5KFHA 2BQ3A 3CC7S 2KRBA 1Q8BA 2IRXA 2DIUA 4LFCF 2VG5A 3MR3A 2DNGA 3DLBA 4OJGA 4NLXA 2RQKA 3OSNA 3T5KA 1RP5A 4FN5A 5CHCB 5C42A 1S9GA 2VA2A 1QM9A 3FDSA 3CD0A 1YRUA 3AAWB 1F5CA 2EG1A 1RT3B 2NPIA 2YTCA 4LIWA 5K8MA 4DS4A 4DS5A 3RR7A 4Q8EA 2VBWA 3CDBA 4K4UA 3OUYB 2HHPA 3JTNA 3DDNA 1PO6A 1C1BB 4J5OA 3BN4A 3DNCA 3NP5A 1XR6A 4XPEA 4DFJA 1QVFR 3QJPA 4WCEQ 2HS4A 1YRTA 4U7CA 1UJ5A 4WFAQ 3U7JA 3QGHA 1HBMB 4CO5A 3ITHB 3PX6A 5K14B 4EWTA 2FVCA 2FPHX 1Q82T 2HHVA 1OPIA 5D3GB 5L1KA 2G1DA 3PM9A 2EFVA 2XG8A 2MQQA 2KI2A 5A2QY 2LYVA 2H5EA 3IS9B 4A47A 1TFYA 4KRWA 2Y1IA 1FJ7A 1QAJA 4FZVA 4FF1A 2IRUA 1S77D 4JV2A 3DU5A 3DM2B 1VQOS 4XAKA 2CPEA 1GX6A 1WEXA 2GMLA 2RDJA 3M32A 4F67A 4YOEA 3KYLA 3T3FA 2UU9F 2GQ2A 2FHMA 3DRPB 4YDXA 3L95X 5A8WA 3Q22A 3OXGA 3C66A 4TU8A 3HP6A 1S72S 4PRFA 4KPYA 4R5PA 2K8GA 1YJTA 4QIVA 1XMOF 2IC3B 4I2QB 2LA6A 4DSJA 1FK9A 4DL3A 2WSCC 4MKYA 4ZHRB 3TARA 1FEHA 2M4MA 2RU9A 5J2QA 3HHNB 3C3LA 3NKYA 4NPOA 4DHVA 4RNHA 1GH8A 3H40A 4WU2A 3EGZA 2ZKTA 4OI4A 2HYIB 1JJ2R 2EW9A 4E8UA 1LWFB 2CJQA 2DGWA 2FJXA 1J5OA 2EFPA 3ZZTA 2JEJA 1U8SA 4RUHA 3FSXA 3VAKA 2HFNA 2ERRA 1O0PA 2EBEA 3QZ8A 3QMQA 4CZCA 1PILA 4CO2A 4H54A 4NCGA 2UUWA 4RW9A 2I0XA 1N56A 3P6YC 1OSDA 4NZ6A 3PEJA 2W7PA 4ECTA 3PACA 4IQMA 1FERA 3H5UA 2V5HG 3O1LA 2ASJA 2HNYA 1X9SA 5KFQA 3LP0B 1DURA 3CMES 4OI0A 2RE1A 1HL6A 2PMZD 1RWUA 3G71S 4DR3F 4ECWA 5A6PA 2VPWB 1S6PA 2BDPA 3E01B 4Y65A 3TOQA 3O5TB 2HHTA 3D1OA 3MEEA 2E1RA 1TKXA 2MZRA 1U1LA 1OO0B 1PSDA 2JSXA 2WAQD 1FDNA 1HNWF 1RT4B 1DTTB 3I96A 3HLUA 4CH0S 3M4XA 3OTOF 3M2VB 4KC5A 2ZH4A 1WACA 2DNZA 2OAUA 5A0YB 1KTVA 2R8JA 4K4TA 2VFUA 5E0OA 3DRRA 2I5JA 2VBZA 2HZCA 2HFZA 5B08A 4YHHF 3GIMA 3HZGA 3RBEA 1NK5A 4LSLB 4DV4F 2YNGB 1C4AA 1GTEA 1X4EA 3N4WA 2JFDA 4I2PA 5KFZA 2DH8A 3H5SA 2DNMA 2KHDA 3I0SB 3LP1B 1JLQA 1LWCB 4DPOA 1IQTA 5KG6A 3NCRA 1U6ZA 5B0GA 5KG0A 3OFGA 1S79A 1FKOB 3IO1A 2HWTA 4X84A 2BR0A 2VOPA 2O3DA 2YWGA 1UFLA 2W8KA 4RW6B 1JKHB 4A8MP 2DHSA 3CT9A 2GC8A 2E5JA 2XNRA 2G0CA 2W8LA 4IOBA 3THVA 2KT3A 1D0EA 2YKNB 4K0KF 2BJDA 3DOLB 3I0RA 3PJWA 2M8DB 4PXCA 4IR9A 2WBMA 2XEXA 5EHHA 2D3UA 1AW0A 5CYQB 2OPPB 4LVNP 4JUZA 3ULHA 1YJRA 4F4YA 4RKUC 1D9FA 3GR1A 1ZM9A 4B9VA 3WZ0A 2GHPA 5K5MA 3TAPA 4ES2A 1XMQF 1HNVB 3SEOA 3P3DA 4WIIA 5EDWA 4IFVB 2QZ8A 1S0NA 4ZP6A 2G13A 2KYZA 4L3NA 1REVB 3MM9B 4AYBD 1UL3A 1IBLF 1DLOB 2RQMA 5AE1A 2O1PA 3BGUA 3FFIB 4E0DA 3B78A 4MFBA 4B02A 3RW6A 4YQWA 1S1TB 1WF0A 4KIAA 3N9UC 3QWUA 3WX4A 4PWDA 3ZZZA 2VFRA 3AB4B 4NLDA 2AGOA 4KV8B 1RTHB 4O3NA 2EFQA 4B9MA 1ULRA 3BS9A 3AQOA 2QV6A 3T9NA 1DAXA 1KLMA 5HBMB 4WTYA 5K8PA 3OL8A 5J2NA 4QR1A 1LW2A 1JLCB 4O3SA 1Q8LA 4ILRA 1HBOB 1CEZA 2RVJA 4PG6A 4MTPA 3TA2A 1UA0A 4QJVA 1VBYA 5DQIA 2HHHF 3PKYA 3THTA 1BLUA 3GQCA 2ASDA 2GW8A 4F4ZA 4O44B 3NRBA 2DRAA 2HG4A 1RTIA 3DLJA 3SI8A 1KSPA 4NLPA 2BW2A 3VALA 2BM1A 1BD6A 4Q44A 3J7A1 1JJHA 2DITA 1X5TA 4K4VA 1Y5LB 2JC0A 3SSQA 3TNVA 2J0QD 3BDEA 2PI4A 2MB0B 2I38A 3L7PA 1T94A 4AUKA 2IRYA 3KLGA 4OZNA 2QO3A 3NCPA 2KO1A 1MW7A 2DNPA 1SH0A 2XY6A 3K2YA 4TXSA 3J80Y 3OSPA 5KFCA 1N0VC 2CVEA 2JVRA 5F9NA 3TANA 2KXNB 1JLBA 2A18A 4JI6F 3ISZA 1KFDA 4CIOA 1X4HA 5KT6A 4C3KA 2R2RA 1DQ9A 5GAHU 1U2FA 4LFBF 2I1RA 4DV1F 1WWHA 2Q43A 4I0WA 4ED8A 1SB6A 1S1XA 3HVAA 4J9MA 2VV5A 4I6WA 2A3JA 1BY9A 4NLSA 3PW4A 1C0UB 3PRBA 3PR5B 2KM8B 3KLEA 3KK2B 2MKJA 2OFGX 2OMOA 2MZQA 3X1LB 4IH6A 3HHKA 2A2DA 1HFEL 2YNFB 4ED3A 4EGLA 4NLGA 2B9WA 4ZCMA 2ZUGA 3SXLA 1VC0A 2GGPA 3UDCA 4NXNF 4EBEA 4A48A 1RT2B 2RRAA 1YJVA 1JLAB 2DD8S 4XDCA 3M05A 3Q8RB 4M95A 5KFFA 3C6UB 4DG1B 3MI7X 3R5BA 2DISA 3MGJA 2NUUG 5LJ5Y 1LFPA 4C8LA 2CQBA 4C3MA 3O2IA 5G0RA 2XLIA 3CDEA 5DM7Q 4ECUA 5J2MA 1B0TA 2AU0A 4HHJA 5I3UA 4LUBA 5D77A 1M5PC 3UD3P 2FJWA 1FE0A 3IWLA 4LMZA 2BOPA 2B9YA 2P9CA 3BGRA 2XMKA 2UUBF 1D3WA 4B17A 3SYZA 4I1TA 3T9ZA 2FB0A 4K50A 2OD6A 5KFWA 4D3HA 1RT1B 1VI7A 2RNEA 1N32F 3W2WB 3KLIA 2HVHA 3GV7B 1FHTA 1R8BA 4OI3A 4X4TA 2GX8A 1SKWA 2JX2A 1F5BA 5KFMA 1QSSA 4PXBA 1TR0A 2LQ9A 3D5MA 3Q24A 2VKZG 2YNIB 1JLEB 1QSYA 4UY85 1VBZA 2UXDF 2DPJA 3CULA 2VUGA 3UE2A 5GAEI 2D41A 4ELTA 3I82A 4N41A 1VQ8S 1M5VC 2C3YA 1TUVA 4X66F 3R5DA 2NS1B 1Y3KA 1XTZA 3DLLQ 5JVHQ 1N36F 2OTLS 2FHOB 2AJ1A 2J5AA 3LGNA 5HP1B 1IN0A 3VZHA 1ZH5A 2ZD1B 3DN9A 1RQ0A 5KFPA 5DG8A 3MAQA 2IAJA 4TU9A 4MKBA 4F25A 2OPRA 1TL1B 3VTIA 2HHQA 4DLEA 5KFGA 2PA8D 1Z4UA 3MMBB 5D6GA 2Z0GA 3CCSS 4DUZF 2NYIA 3KK1A 2VPYB 2RSQA 4ZP8A 1FRXA 2V8GA 1ZTWA 1FRHA 3FRZA 2B3TB 3IG1B 3UR0A 1FRKA 1E6YA 3RB0A 1Y5IB 2EFGA 4NYZA 4N8OA 5A6WA 5GVQA 3OJSA 4ZVEA 4OLOA 3MM6A 2B4UA 2IVMA 2HNZB 1MU2B 2CIMA 4Q5VA 5LT5A 2HMIA 1NHUA 2YKMB 3QPIA 3OR1B 4ZPAA 1VS3A 1Y5NB 3K5OA 2XSJB 4DQQA 4JI3F 5HLFB 3TVKA 1NHVA 3D2WA 1SKSA 1U24A 3FEZA 4K4WA 1Q4RA 1OSCA 3UFCX 3G6ES 2ZOGA 4OI6A 4P7VA 4ECRA 1KOHA 4ED7A 3M2UA 2J7UA 4USHA 1H2VZ 4XO0A 4QR2A 4FF4A 2DR5A 3DOMA 2B5JB 2OPQB 4IR1A 1FD2A 1QUVA 2R8GA 2I8EA 4C9DA 2CJ9A 2VOOA 2KRRA 2ZDPA 4Y2CA 3SCKE 2E7XA 1GAOA 2YX4A 3MM8B 1HW8A 3C6TB 2E1MC 2KM8C 1C0TA 2CPIA 1C1CB 3DLKB 1IXKA 3GILA 4QU6A 1JXEA 3BREA 4J9RA 1KQSR 4X4SA 2CYYA 1XC9A 2UV8G 3I9V9 1FTCA 2ZH8A 4P6QA 2K7KA 1K1QA 1VJWA 4FBUA 1KNZA 1HBUA 4CNYA 3NS5A 3M6VA 3SCIE 1N6QA 1NJZA 4DL4A 3BO2A 5KT7A 1JLFB 2W9CB 4WFZA 3QWPA 4UUXA 1TKZB 2VG7B 2KH9A 4ES3A 2JDJA 2FVPA 2MKKA 2I9SA 2K1RB 2P9EA 2R7TA 1MROB 1KHVA 3SCLE 4LQ9A 3QZ7A 4LF8F 2RS2A 5GMKa 4TYAA 2AJ0A 3M6WA 4ZPVR 3LALA 4NCBA 1VIOA 3ETOA 2PIIA 4G1PA 4KHRA 5CD4H 4CNZA 2PE8A 1TV6A 2P5VA 2NUHA 1Q1KA 1QLNA 3J81Y 3MFHA 1FJGF 1QTMA 2QIFA 3CUNA 2FJAB 5I42B 4M94A 1TK5A 4TNOA 1IKYA 3WDOA 4A8WA 1U48A 2XO7A 3M8QB 2E5LF 3D28A 2CZ4A 1KN6A 3MOJB 2WCXA 2LXFA 2EFNA 5MLCV 3QIPB 1Y3JA 1CSJA 4ECQA 2ADBA 2B9XA 4OX7A 2QEXS 4RW9B 1DBDA 4OI2A 2WBRA 3DLGA 3HK2A 2J7KA 3TA0A 2XCPA 1UVNA 3HFKA 3V4IB 3QJLA 2IVFB 3NBPA 4DFMA 4O23A 3OFHA 1UA1A 3RR8A 1B64A 2Q6CA 4IUFA 2XI3A 4IO1A 4KGMA 4Y6IA 5EX3A 2RILA 5K9FA 3U1MA 2JWNA 7FDRA 5J2PA 2CQ3A 2RJZA 2AV5A 2CRLA 2ZZMA 4HVZA 3K5PA 1HQUA 1VQ4S 2E5HA 3HMJG 2J9DE 2N4CA 3FQKA 4Y00A 3CJKA 2FTRA 2RF2A 3AJ1A 2D7SA 4ZS6A 4NRTA 1VQ5S 1NKBA 5EWEA 4IYQA 4NA2A 2Q3PA 5CYMB 3T5JA 1NJYA 1AXQA 1UWBA 1CG2A 3KLHA 1DQ8A 4QW8A 1L5UA 3M30B 2JEIA 4AL6A 4X4VA 3DOKA 4NLWA 1FTRA 3LUYA 2IBKA 4PQUA 2FVRA 4ZPDA 2FC9A 1VGYA 1JIHA 2WONA 2CQ1A 3M1VB 3NS6A 4MMOA 4DQRA 2BQRA 2HHSA 4G1QB 3RU0A 5IT0A 2UVVA 4EO6A 5KFJA 4TLRA 1V3RA 4NLQA 4DR1F 2FJVA 3HHLB 1K73T 5FIIA 3FZBA 2HNDB 5K8OA 3HHEA 2LU1A 1QE1B 5I3PA 3EYZA 2BANA 5GAGU 4QYRA 1H2UX 1GXUA 2MKCA 1WHVA 2K3IA 2QA1A 3R27A 3BO4A 2XB2D 1VRTA 3BSAA 3HVWA 4IOCQ 1HNIA 2QFJA 2MQNA 3HHLD 3MM5A 2IJFA 2BE2A 4M5DB 3ZZ0A 1HARA 3PW7A 4RX6A 2M2BA 1I1GA 1R7IA 2ROEA 2MSSA 2VH7A 1ZZNA 4OLPA 3V2UC 3CDAA 1GT8A 4KGKA 5J1PA 3KHLA 1QSLA 2CQGA 1OS5A 4ICLB 4ZPBA 5DQGA 3CD5A 4RUAA 3PVXA 1SJQA 3NAIA 1EP4A 3IXQA 2CJKA 1HD1A 4F26A 5F8JA 2RS8A 1TKTB 1TVRB 4JOUA 4QWEA 3DI6B 5A8RA 5DG7A 1HNZF 3C2PA 4G3IA 3IN5A 3L3CA 4O3OA 4RW7B 1X0FA 1ZOTA 1B0PA 4CQ1A 4KFBA 3AJ2A 2Q6BA 1X7VA 5IFMA 3RTVA 2VA3A 4B9UA 1N34F 1X8DA 2IA0A 3CCVS 2VPZB 4ILMA 2JZ5A 4XIUA 1XWLA 4OQJA 5LSRA 4F2SA 1IBKF 3K5LA 5L1IA 3LGMA 2CQHA 1DQAA 1M5HA 1SH2A 2KZMA 4I7FB 2DH9A 5L39A 1V6HA 3K58A 4IFYA 3DRSB 1U7LA 4R8UB 5DS7A 2W4CA