2GJIA

Nmr solution structure of vp9 from white spot syndrome virus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
82
structure length
82
Chain Sequence
MATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEELRLLTGDSTLEIQPMIVPTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a Novel Nonstructural Protein, VP9, from White Spot Syndrome Virus: Its Structure Reveals a Ferredoxin Fold with Specific Metal Binding Sites
pubmed doi rcsb
source organism Shrimp white spot syndrome virus
molecule tags Metal binding protein
molecule keywords wsv230
total genus 7
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09625 VP9 VP9 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2070 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gjiA00
2ZUGA 2GJIA 2GJ2A
chains in the Genus database with same CATH superfamily
1A7GE 2N7CA 3IP0A 3BGUA 2POKA 1HQEB 4NX9A 5HJXA 3R97A 4CDIA 2GX8A 4P73A 5CABA 4FF3A 4X4SA 4CQ1A 3EYZA 1M5SA 2BM1A 4MAKA 5KFWA 4C8YA 2DXEA 3DGPB 3HHKA 1VQLS 4DR1F 1KRPA 3EE3A 3TANA 4PPDA 5GAGU 2MGZB 4EK2A 4E0DA 2OAUA 2HHSA 4M5DB 4LR7A 3MPDA 3F0NA 1HW8A 1OO0B 4ZHRB 1VQSA 2DJWA 2HS3A 4OLOA 1YX2A 3UN5A 1Z2LA 2XTJP 2H9ZA 3EXCX 1PAUB 2MZSA 3GG0A 4A8WA 3DHXA 4HLBA 3TWZA 2XMWA 3M9NB 3Q2SC 5B0EA 1QSYA 2RUSA 4R8UA 1CQNA 4QWBA 1VISA 1TKTB 5CYQB 3GYXB 4NA3A 2I38A 2HHHF 4RUHA 2CPJA 3BGRB 1ZZFA 3HVWA 2YNFA 1SKSA 3MOZA 2HGMA 2P9EA 1EETB 1TL7B 1V3ZA 2YQ0A 3EM1A 3UWTA 4FBTA 1T03B 2AV5A 3VZIA 3HLUA 3PACA 3BR8A 4DR3J 1RJJA 2XB2D 1EJ7L 2DNGA 2APOA 3UI3A 3GP9A 5KT4A 1FDBA 1EB0A 2ACYA 2L48A 4CNYA 5A2QY 1ZZNA 3OL6A 3TUJC 2CWKA 1RTHA 3GMGA 4PEOA 1RT1B 5E3AA 4TVAB 3RYLA 5K8MA 1FRXA 1SC1B 5DDOC 2DGVA 3P6YC 4DR7J 5B0FA 3ISZA 4MKYA 4USMA 2NXJA 1OY8A 2MZQA 2CQPA 4Y00A 1JJHA 3BR9A 1FERA 3UD3P 5DGAA 1YJVA 2DNRA 2BBEA 1UEUA 3M2UA 2EFVA 4Z2XA 4BLGA 2IA6A 2F40A 2LA6A 1FVQA 1F9HA 4NLDA 1N8RT 2ZBQA 2E7VA 3KK3A 1SKWA 2CVIA 3DM2A 3OXGA 2UU9J 2XYHB 1UW9A 2D7SA 3QJLA 1JK9B 4K4ZA 4AL6A 1RQ0A 1UWAA 2GJIA 3IR5B 1REGX 1YVFA 1GMWD 2XI3A 4LJMA 3WBZA 3A1YG 3WX8A 4CLFA 3CC4S 2HBZB 1M0SA 2SXLA 3IWLA 1S6UA 2UXDJ 4R25A 4PQUA 4A46A 5IQ6A 3HD2A 1HBMA 1P6TA 3K5PA 1MMDA 2Z2LA 1KQKA 3AFGA 1X9MA 4B02A 3TJ8A 4QU7A 2WSCC 2QMUB 4NPOA 2J0SD 5AXKA 4PRFA 1PYSB 5IV4A 4X66J 4YP3A 2UV8A 1I6JA 1VQKS 3LF0A 1JLQA 1DQ8A 1KHWA 1DAXA 3LP1A 3N4WA 5RUBA 2EFPA 2G4BA 2XSJB 1JNRB 2BJ9A 1SI9A 3X1LB 4OHXA 4URGA 5HJYA 3MR5A 4FDFA 2AJ1A 2KVQE 3R27A 2XO7A 1UAWA 3M2RB 3ZNUA 1KTQA 2B4PA 3BM7A 4KBIA 5A8WB 3KNAA 3VAGA 4TY8B 3KG1A 4RW7A 1SKUB 2AJ4A 4AFFA 2C42A 2M5YA 2QA4S 2DNPA 4ECRA 1ZTWA 2V8GA 3J7A1 3SEOA 5HN0A 1HWLA 3JTOA 5GMEA 1SL0A 1SVDA 3LPEA 4YN3B 4RU2A 4ECYA 2PD1A 2UXCJ 2BOAA 2I2YA 1TP7A 2FC8A 2M88A 1VOMA 2GIQA 3FEYB 1C1CB 4Y65A 1KQGB 4NLTA 8RUCA 2NCKL 5AJ3J 1YKWA 1RWMB 2HZAA 1RCXB 5KG7A 3MEGA 1JQGA 2ZUAA 4DF4A 2MQQA 3CMES 4UY85 2VIHA 3V2UC 4ZCKA 2VFUA 3QATA 4RW4A 1RGVA 2DHAA 3TA0A 1JIHA 2OEJA 3AD7C 2OPRB 4TQRA 1IR0A 4CLKA 3N6NA 4X62J 2ZM6J 2CFXA 1FNXH 2DY9A 1FO1A 4I64A 3VTIA 3HVTA 2DO0A 3MTJA 3OTOF 2D3O1 4B3SF 3MCMA 1FJEB 2B6AA 1IKWA 2KN4A 5LL6d 2F4VF 2Y8WA 4HVZA 5F8HA 1CEZA 3PW0A 3IMQJ 4OYIA 3L4BC 4DV4J 3TARA 1LKZA 2QLJB 1QM9A 1URRA 3C15A 2W7PA 3NP5A 2W4PA 1FXDA 3MUTP 1WI8A 2CNLB 1TAUA 1EARA 2VHGA 4ZCMA 3FSYA 1HQUA 1NK9A 2V8VA 2DHXA 2WVEA 3MUVP 5A8WA 1YBAA 2MTLA 4IOBA 3CJQA 4DU8A 1QVFR 2YNFB 3PR4A 3GONA 3PV8A 3LTOA 3RW7A 8ATCB 4NYZA 1S97A 2IJNA 3MEEA 2DVIA 4OYWA 4OHVA 1HHTP 2GAGC 2Y8YA 2VG6A 5CCMA 2W9BA 2G2YA 2WZ1A 2C2OB 5H9FK 1GMUA 3OLAA 1X4GA 1G7CB 3ZO7A 4C11B 1S0VA 3NWGA 2VZ9A 1KS2A 3F41A 4UOHA 1RBOB 5G0RB 4LSNA 4JYAJ 1L3KA 1PGZA 3W3SA 7FDRA 2KM8C 1IR2A 3H5YA 4WZQA 4I4BA 2CQBA 2B8QA 2Q3PA 2VQFJ 4DUZJ 1N36J 4DG1B 4WF9Q 4K0KF 2COLA 3T1AA 2XY5A 2J6SA 4ED5A 1RK8A 1WC1A 5DS7A 3HP6A 4EU0A 3GIJA 1HYSB 2HVDA 1NDKA 4K4XA 3OXLA 1HI8A 4LBPA 2F8MA 1HYSA 1RKIA 1ACMB 5HP1A 2RJZA 2V8DA 4YHHJ 5KFKA 4JI4J 4LVNP 2ROPA 8AT1B 1EHWA 3FC9A 4GMKA 4RWWA 1J5EJ 1S6OA 2XMVA 1WOOA 2RDJA 3QJJA 4NI2A 3ZC4A 1F5BA 4ILMA 4PWDA 4NEZA 5JMNA 4ZPBA 2PFDA 4WK1A 6FD1A 1LWEA 5C5JA 1VQOS 3QT8A 5HQMA 4JI3F 2XHCA 1NK7A 4DV2J 2AX0A 2H1YA 4IFYB 2HFVA 5C25A 2A2DA 4DFMA 1ELOA 3WX4A 1ROFA 3HVRA 2BACA 3ETMA 3PIPQ 2DEJA 4F4WA 2VA2A 2ZNZA 2DNYA 1VR6A 3LP0B 3AD9C 2EFOA 3DCAA 4NEYA 3P5BP 3H8YA 3MCNA 4DV0J 2DT9A 4O3PA 5A2QU 4AL5A 1VQ6S 1HQUB 3GSDA 2ZHOA 2HAFA 3RBZA 1NK0A 1UEKA 2P8IA 1K1QA 1RP5A 4OYOA 4P9SA 2YQ3A 4KV8B 5EGYA 3G4SS 1TL5A 3MD1A 3I9V9 4PYDA 3V81A 1PYTA 3E8OA 5T7LB 4YB1P 2W9AA 3PRBA 1YJUA 2VC1A 4IG3B 1CLFA 1FI4A 1HWJA 1S1WB 2NYIA 3PDNA 3SI8A 4KPYA 3KG4A 3GTYX 4ZLNA 4X4OA 1EAYC 4NCBA 1DJ0A 3FCHA 3QIDA 4PXEA 2JOQA 1BQNA 3TOQA 2W2MP 3CCRS 1A0OB 2Y0BB 1AUDA 3JTNA 3AOCA 1IBCB 3AOAA 3DKDA 2J9EA 4CO2A 2MYFA 2OPRA 4M5DA 1RWWB 3CVKA 4KH1B 3DN9A 5KOXA 4C0OC 4DR5J 3MM7A 1VC5A 5I42A 4GKKF 5HP1B 1Q1KA 3RBEA 4K5RA 4MFBA 1VLOA 1N6QB 2UUAF 3HKWA 2CJ9A 1T9TA 1RLCL 1T9UA 3NS7B 1Y5NB 1YJNS 4X64J 2L3MA 3IS9A 2PA3A 4HH1A 4LF7F 3KLIA 5K14B 3MMAA 1SH2A 1XNQF 4Q8EA 2VPZB 3FBBA 2DCUB 2HWTA 4B9MA 3THTA 1VGYA 2HNYB 3RB0A 1NSKL 1WKLA 1TUVA 2ZE2A 4CP5A 4XPCA 4Y6IA 2HSEB 1FKOB 4DI6A 2D74B 3IXQA 4IFVA 3QT7A 1NKEA 3NNCA 3RU0A 3W7BA 1GXTA 3PW2A 1UFLA 4QR0A 1TV6A 5KFNA 1NH7A 1ZM4A 1WNEA 2I1RA 2XWXA 1ZA1B 2LEPA 4BBYA 4V19J 1DFDA 3G6ES 4P52A 1RACB 3K8VA 4NL5A 3KLGB 2AHOB 4ZPCA 2FJVA 2CNKB 1D9FA 4Y3CA 2FQQB 3J81Y 1U1QA 1PKUA 3T5LA 1NDCA 3CSKA 4OI3A 4C3MA 3QAUA 3H25A 3TX0A 1O6XA 1H2UX 2JJ4D 4UOGA 2AGQA 4O4RA 4MKVA 3VALA 1CBKA 5AXLA 2RDDA 4ILLA 1VQ4S 2QA4G 2EXUA 2QIFA 1HHQA 1Z4UA 4TU7A 4DSFA 4ZDNA 4DMZA 1YITS 1C0UA 1SV5A 2RU9A 3LANA 5LJ3Y 3CJSA 4ZLPA 1FWPA 2ZFHA 1VC0A 1QVGR 1WHYA 1DARA 2QL7B 1M1GA 3R8YA 3K58A 4F2SA 3GFHA 4QW8A 4JV5F 4RW6A 1U2FA 3CW2C 5KFSA 1R0AA 2EG1A 2OD4A 2VD3A 4LFAJ 3DMJA 3X3UA 3JS9A 5KG1A 2E5LF 1OYEA 3C6UA 5KT3A 2L08A 3S1TA 3ZZ0A 2BKPA 1UVMA 4NASA 1TK8A 1IM6A 4OZ2A 3LPYA 1N54B 1RLDA 4RKUC 4DFJA 2UXBF 3ZZRA 7AT1B 4C8ZA 4Q2LA 2UVVA 3JSYA 4QWCA 1K0VA 2FVSA 2A10A 3DMJB 5E3CA 5KG6A 3UN2A 3FZ2A 3A8IA 1CJVA 2EBGA 1CC7A 2V50A 1WC3A 2OI2A 3VGSA 2UVRA 3PO4A 1NU4A 1BQMA 2IMOA 4NLXA 5IT0A 5DG8A 4IR9A 5D77A 3SQGA 3KUHA 3UN3A 3C6TA 3OTBA 3QSYB 2KJVA 4KV8A 2V94A 4QIGA 2W4DA 2CQ0A 1X9WA 1N5QA 2C3MA 2H4WB 2WBMA 1T03A 1Q82T 4RNHA 2XEXA 3U1MA 1YZ7A 1EETA 1TL7A 3PNIA 1DTTB 1FEHA 3M2RA 3IO1A 2ZBPA 5KG2A 2FZCB 2WONA 2VICA 2XMMA 1YTYA 3BGRA 1D1UA 1ZH5A 3IFEA 3ZZUA 4IQXA 1KDNA 3NAIA 3OHBA 3KKFA 1ZPWX 4LRAA 1DQAA 1F3FA 2W2PP 3Q8VA 4L6V3 5CYMA 1G3OA 3TRGA 4X64F 4MIWA 4ANEA 3BSCA 3QZ7A 2X3DA 1U1RA 1M5VC 4L73A 4LF5J 1CJKB 5CHCB 2HLTA 3WC0A 2JSXA 1UA0A 1JLQB 1UETA 3KHRA 4USVA 2LQJA 3M6WA 2QLWA 2RQKA 1HI0P 2HQDA 4ANCA 2DTJA 1NUEA 2O3DA 3M8QB 4NLOA 4Q0BB 4CH7A 3NGUA 3W2VB 4FKXA 2C2NA 5MLCV 3DOKB 3MAAB 1RA6A 5KG5A 3NGTA 2XCAA 4DU7A 1KWMA 2HIYA 2IRXA 3ET6A 4C8NA 3J81U 3BQ0A 2XGPA 2M3DA 3TJ9A 4IG0A 2CRLA 5I42B 4KR0B 1SJQA 4I7FA 3O2IA 5D0EA 4BWJA 2OGUA 2OFHX 4KH0B 3W2VA 1DTQB 2DNLA 2FDNA 2JX2A 1CSJA 3JSMB 2NZ4A 2QC3A 1MU2B 2HKEA 3FQLA 3UDLA 3CCES 5J2PA 3V6DA 1UVIA 1GX6A 1NHKL 2QV6A 2R7OA 4KHRA 3M8WA 4ZK7M 2BJ3A 5A8KA 5D4OA 2NXEA 3OJSA 4WXWA 2MZTA 1CULB 5CYJA 4XO0A 1QY7A 3NNHA 3C19A 3JAMU 2OPPB 3ETOA 2AEFA 2IRYA 4C8MA 1KN6A 1NKBA 2Z0GA 2IDEA 2IVYA 2FD2A 1IBLF 4JI0J 1BUXA 3HT0A 5D78A 2ZD1A 1TR0A 4KB7A 4DV2F 1AT1B 3CD5A 3H5XA 1FJGF 2EFQA 3KNGA 4NRTA 3K2YA 4WTYA 1WG5A 3WIVA 4ECWA 1NK8A 3FVYA 1ZETA 2GVZB 2HGNA 5IFMA 3R2CJ 3RBXA 1X60A 5DLFA 3A8EA 2ZBRA 1E6YB 5H9FJ 4DCPB 2BQUA 1EQ0A 3Q8UA 4WFYA 1U8SA 4KPCA 1HBNA 1Y10A 2IBOA 5FLXU 4ICLA 2HHQA 3OUYB 4C7QA 1GEHA 1PJ5A 3MFIA 3UD5A 1LK7A 2D3ZA 5C24A 4X4TA 3BKTA 3BQ1A 4EFAC 4L75A 3MPUB 3G8TA 3JSBA 1VK3A 2BRKA 1U1MA 1MU2A 2HPUA 5DO2A 5J2PB 5GADU 1RE1B 4P2SA 3V6DB 1BY9A 2CPEA 4ZHRA 4PWDB 1RKJA 5J1NA 1FVSA 3SMZA 2UZAA 1HL6A 2KXHA 1FRMA 1DTQA 4NOHA 3SBMA 3G6XA 2JFDA 3HZEA 3UQSA 4B9VA 4H4KA 4LQ3A 1TUWA 2KL8A 4G65A 4RNFA 2AYEA 5B09A 2R7RA 2J7UA 1HPZA 4ZPTR 1PYOB 3HJVA 1ZYQA 2F7VA 3DOKA 3ILOA 4ED4A 3F44A 4CLUA 4DG1A 3U7JA 4CCHA 1X9SA 3CD7A 4OL8A 3HHEA 4ZVRB 1JNZB 1C0UB 1VLYA 1OPIA 5LM7E 1RWVB 4HDHA 4Q5VA 1HHSA 3CDAA 1NBEB 4KSEB 4ATNA 3OW2R 4DR5F 5KT2A 3K7RA 4AQYF 3T9ZA 2VQEJ 4X4PA 1HIYA 4OZ3A 3VGTA 2HBRB 3AQPA 2DBBA 2MDAA 4CLPA 1WKKA 5HL7Q 4RNNA 5J2MA 1S4EA 2PFFB 2VG6B 4KFBA 2C22A 1U45A 1KHVA 2ZH5A 3GV5B 1UWBB 3BO4A 2R42A 1NB7A 1VQ5S 4NXMF 3MR7A 4X4UA 2CAJA 4TKTA 1E6VB 4KJIA 5HVGA 4WKRA 2H65B 1UWBA 4DQSA 5L9XA 2PEHA 4FYWB 1T9VA 2ZITA 4G1QB 4TLRA 3OV7A 3OTOJ 2F4VJ 3CMQA 4OHWA 2KB2A 4OYPA 3QMQA 4DSJA 4NLGA 1F2GA 2B9EA 3DLHA 2XI2A 3W8GA 2KZZA 1N5SA 2DITA 1SJ4P 3KFWX 1XWLA 4W4MA 1XERA 3SQGB 5B0AA 1IBMF 4DZDA 2Y1LB 3MAHA 2CJBA 1XMBA 4AYBD 5DG7A 3IS9B 3TYTA 4JV5J 4M5IA 4F36A 2EC0A 5A76A 3J7YU 2CPYA 2RS2A 2CJKA 2MKKA 2HS4A 4DUTA 2QE5A 1R89A 3MMCB 5BJRA 2HVZA 1VRUA 2L9DA 2ZH3A 3Q89A 4IO1A 3ZZOA 4DL6A 1HMVB 1U09A 4F4KA 1J5OB 2N3OA 1CS4A 3FBFA 1F6TA 1H6KX 3GU0A 1RHKB 5GMDA 5I3QA 1LWFB 2M9KA 2XS7A 1AXQA 2BKOA 2HNZA 3M6UA 3TAMA 3UNYA 5GAHU 2FHOB 1NJZA 3QRRA 1S0MA 2AJQA 3F56A 4U96A 1B0TA 5HMWA 1B0PA 2GS8A 2XS5A 2IVMA 1O8BA 2FJWA 4K4WA 1LXNA 2DRDA 1HLWA 1Z1ZA 1RU1A 5KFYA 2ZKUA 1TVRA 1ZS6A 2DNNA 1ZM2A 2E7XA 4X66F 2E9TA 4C98A 4PQAA 4DL4A 1UA1A 4USUA 1FTRA 4F4AA 1RHRB 2CNOB 4FVMA 3N6LA 2DGWA 4V1Ak 3SZ2A 1RYSA 3LGHA 2DPJA 1G1XA 2W2OP 3E01B 1U49A 4FN5A 1IJFB 3BV8A 1TL1A 2OMOA 4DV7F 2QLBB 2X1GA 2DIVA 4DPOA 1X7VA 3NAHA 3DU6A 2GO8A 5L38A 1GAOA 1SC3B 2QYGA 4R8UB 2ZH7A 1Q8KA 4JI2J 4C97A 3EGWB 2JC1A 1FX4A 2YX7A 4MYUA 4IFYA 1T9YA 2CQ1A 3TQEA 2P2CB 2VKRA 3LWLA 1Q81T 1T11A 3Q2TC 1N5YA 1IKYB 1FFSB 4OZ5A 3GPAA 3I56S 2GJ2A 2H5EA 3BSOA 4YB7A 3N9UC 3QQCD 1VC6A 3D6FB 1PJ7A 4ZIWA 1YSJA 3RJMB 5F9NA 4N77A 5K5MA 1X0FA 2YWFA 2W9CB 3PRVA 4IR1A 2DRAA 2GMLA 1K44A 1TL3A 2EKYA 5BYQA 2N7YA 2W7AA 2HS0A 3ICLA 2R2SA 3VV2B 2JZ5A 1C1BA 1KP6A 2O5DA 3K8WA 3IBWA 3KUGA 4X65J 2V4RA 1IBLJ 4MT1A 1CVJA 5KFCA 4EMDA 1N6QA 2IPOB 4JP8A 2RMLA 4YQWA 2HNDA 2OFGX 2OPQA 4OX6A 1RAJA 2J6UA 3G9CA 4Y2AA 3MXHP 2FHMA 2KT3A 3EZ5A 1REVB 4DUYJ 4NA1A 5CD4H 2ALYB 3FKBA 3IR6B 3FGVA 2Q43A 3O1LA 4AXIA 3BS9A 5IC4B 3JB9k 2HHHJ 3GIRA 3HMJG 2ZNYA 3HSDA 2GO9A 3UFCX 5I4MA 3EVMA 2FHJA 1BMQB 1SKRA 1TELA 1WC4A 4NE9C 4QOTA 4ZVTB 1MN7A 5I3PA 1UJ4A 5HLFB 4DX5A 4LF8J 4M5GA 1HNIA 2K06A 3E01A 1JLBA 1WORA 3BDEA 1W26A 5ETPA 2BQRA 4H4OB 1MN9A 1OQ3A 2K1RB 2RHQB 3MM8B 4LVOP 4OI4A 3VVTA 4FS1A 3CJ0A 4AD6A 2A0FB 3EX7B 2MLYA 3PEHA 1RZMA 5M2RA 4YHHF 2VQEF 1PJ6A 1TVRB 2G13A 2G2OA 3KG0A 1NPRA 1RTIA 1TKTA 2LP4A 5CYQA 4ZN3A 2X1FA 3GE9A 3ZZTA 1BQMB 2YKMB 3FMBA 3GIKA 3UPFA 1M5OC 4LF7J 2VV5A 3JQJA 5AXMA 1D8ZA 1FCAA 2DHSA 1KLMB 2OUGA 4M5LA 1X8DA 2C3UA 2VDHA 3MHYA 2FB0A 1LWEB 4QIVA 2PO4A 3M1VB 2IVFB 2NS1B 4LIWA 4F04B 3HVTB 4OYZA 4FS2A 2P9GA 1KONA 3I87A 2K8GA 1TTHB 3CJ4A 4NLRA 1VMBA 3B4DA 1U2CA 4C0HA 3GIIA 3CCTA 3G82A 1UMJA 3MEDA 2F1FA 5CXTA 4GC6A 4C8OA 3PY8A 3MTKA 2DGOA 3THVA 2YWEA 1U2RA 4LSZB 2QTWA 3R3TA 2YH0A 2MMYA 2NREA 4E8UA 3W64A 2B9YA 2AQ4A 1RUSA 1S1XB 1K47A 2LXUA 2MHNA 2ZZTA 1X5TA 2G2ZA 4HEA9 5EHHA 5KFMA 2CPIA 3ZTPA 5D3GB 1HQEA 1JMTA 3LP2A 3N6MA 4ES1A 4A8MP 1JXLA 2W1BA 2XCPA 4DV6F 1BGXT 1L3SA 5D0HA 4FBUA 4H4MB 2FVRA 2IAJA 1PSDA 2JLFA 4NLQA 2VJVA 2DHHA 2AF6A 3GFZA 4Y2IA 3VAFA 1HBOA 4A8XA 3PFOA 1HD0A 2W9BB 2LQ5A 1T05A 2G1HA 1IM4A 5HBMA 3K59A 1DLOA 2RILA 1NDLA 1E6VA 2V2VA 4C2MA 2XSJA 4P10A 4P7VA 5LT5A 3CCJS 5ADZA 1RT2A 2DIUA 4TXSA 2BQ3A 3LH2S 2UUCJ 5BXIA 2Z4PA 2NXUA 1MMLA 1RHJB 3LP1B 1RHUB 5IOLA 4NXNF 3BGFA 6AT1B 4WE1B 2H54B 3DI6B 2B4UA 2VKZG 3P8BB 3QSIA 1JJ4A 2ZBCA 3CULA 2QGFB 3POTB 2IYIA 1JB0C 1HW9A 1OSCA 3UE2A 4JI6J 4DR6F 2XLKA 1S4FA 2EFGA 3AA8A 3GZ7A 4JBCA 5CZVA 5HVFA 3UCGA 2HVIA 1T02A 3B6BA 3NGSA 5E3RA 4ILRA 4ELUA 2FZKB 3VCDA 4QR2A 3PEJA 3IBCB 1S77D 2O01C 4FZVA 3OSNA 3CDBA 4OZNA 3SV4A 4B3OB 4I67A 4J9MA 3KLVA 2D9PA 3HD1A 1P9YA 2AT1B 4IO9Q 3HKZD 2G0IA 4EBEA 5IXUA 2XO6A 1S6QA 4WKYA 3NGDA 2B4OA 3IM8A 2VG7A 3RB4A 4CZCA 4CLWA 3PJWA 4WFXA 2FJXA 4NLSA 4Y2MA 1VBXA 3PW5A 1KBRA 1N52B 3W2WA 3KLFB 5SUHA 3T19A 3M8PA 5KFXA 3MMBB 4ZJLA 2A1BA 1N48A 2HVHA 3A13A 4RX6A 5DRKA 4DLGA 1S1WA 1U7LA 2HFZA 4CWBA 4EZ9A 1RT1A 1XBWA 2BZ2A 3MECB 4ZVPB 1FF2A 3J7YI 3J80Y 1WJ9A 2Q6CA 4ICLB 1EIYB 2HZCA 5T7LA 4HTIA 2E5HA 1FKPA 4EZ6A 4LF4J 3TUZC 2PIIA 4FP9A 4Z37A 1E6YA 4OZLA 5JVGQ 3PG9A 1G4CA 3QFHA 2HRTA 2VFRA 5SZTA 5CD4A 4ETXA 3M8SA 4HR2A 2H4YB 2WB4A 1NB2A 2GVZA 3R7NB 3F73A 4UY8T 2YNGB 1U02A 4PCQA 4WIQA 1S76D 5KFEA 1RAAB 1U24A 3B78A 2FLPA 1O51A 2V68A 2OSRA 4CIOA 1D9DA 4O0NA 3KHHA 5FDLA 2OEKA 5IT4A 4X4RA 1CJUA 3MPWA 4UT4A 4I2PB 3VR1A 4DL2A 2KFZA 5F8MA 2L9WA 1IR1A 4M63A 3IC1A 3EZUA 3NBPB 4OI6A 3I96A 4ZOSA 2QL5B 1AW0A 3OL7A 1BC6A 5F0UA 4CT9A 2VBZA 4CLLA 5JVHQ 4ZP6A 4ZP8A 1P27B 1RAIB 2GZOA 2ROEA 3D6TB 3VVUA 3D5MA 4N56A 2QMXA 1B99A 4HHHA 4I68A 2MGZA 1YJRA 2W24A 1JLGA 3SSQA 3KK1B 3HPOA 1IKVB 2JFKA 1EQMA 3R5DA 2RIJA 3TZXA 3TAQA 1JWWA 4DV1F 4U8VA 5J2QA 2BE2B 5E7OB 2WBRA 1FDDA 3DLGB 3DM2B 4M1KA 2V34A 3T5HA 4OYAA 2AZ3A 5ETRA 5KT6A 2HG4A 1B64A 2BUNA 5LMNJ 1H0HB 2BX6A 1PAEX 2PGCA 2FHJD 1PC4A 3O44A 1NMEB 1IBMJ 2E5GA 2CADA 3IRWP 2B51A 5F41A 5LMUF 1HWUA 1S79A 2K3IA 3H5UA 4NCGB 4URSA 3VQTA 3WHIA 4WFZA 2P6TA 2U1AA 2FJAB 3R5JB 2DNZA 2YPZA 2JLGA 1J27A 1VRTA 2HQIA 2C2EA 3G86A 1VBZA 2DH8A 4F3MA 4R5PB 5DETA 4CRJA 3T1YF 2DNQA 5E2QA 1WC6A 2AEJA 1M5KC 2QMWA 3A12A 1KVKA 1NK5A 3UR3C 1RSCA 1VBKA 5KFZA 3OLBA 1QE1B 4FF2A 2NLWA 2HFSA 4ZPAA 2M0GB 1TMJA 2A18A 3BSAA 2UV8G 2MQNA 2ZZMA 1N0UA 4G1PA 1VRQC 3Q8SB 1M1KT 1B0VA 1XK8A 3CXCR 2C3PA 5DJBA 2HURA 2WB1D 3ITHB 3SFGA 2HYIB 1S49A 3TO8A 1TZ0A 5D0GA 3OR1B 4YDDB 1XJWB 5IWAJ 2K2PA 1L3VA 4DDFA 1MNEA 5ETLA 2LEBA 2BEFA 1GMWA 1HARA 3KJVB 3OTEA 3PFEA 1Q4RA 3TVZA 5C42A 4Q7AA 1WOPA 3TUIC 2VPWB 3M2VB 1N33J 4XDCA 3MCSA 2H51B 1X5SA 3CJ2A 3CJKA 2WHOA 1WSVA 1S1UA 2HEKA 2HBYB 3C6UB 3CGIA 2VG7B 3I5CA 4KGXB 5GAGI 2DO4A 1Q8BA 3DGPA 3DXSX 3I9ZA 3IGVA 3L7PA 4QU6A 4K50A 5K8PA 1C1CA 5E41A 4HT7A 4DV1J 4F25A 1JXVA 4ZMMA 1WF1A 2IM1A 4QW9A 3RTVA 2CWXA 4Y2CA 1VQNS 4MMOA 2D9OA 2W8KA 4DX8H 3ZZPA 1S9GA 1WEYA 2OO4A 1FE4A 2HRYA 4N8OA 2FTRA 4LQ9A 4IOCQ 4MJKA 1GX5A 4WU3A 4ZPDA 1FA0A 1OSDA 3DLKB 1U0SA 3BH6B 2CQ4A 5ETMA 1R43A 4ECTA 3M8RA 1CG2A 2N4DA 1RISA 4FKYA 4P72A 3Q24A 2B5JA 4EYHB 2HW3A 2ZHBA 4HL9A 5L1JA 2KI2A 3CO9A 4HACB 4DFPA 2EFNA 1N88A 1SQFA 4JI8F 3TP2A 4DV7J 3MR6A 1UZDA 3JQKA 1ZM9A 3OFEA 1BE4A 3HFVA 4HACA 4JI0F 3KTQA 2MJNA 3VGVA 1IWAA 2CPFA 3KHLA 1OWXA 1RT3A 4A4JA 2Z57B 3JXOA 1SQGA 1VHFA 2PI4A 4PXDA 3W60A 1NHVA 3EJMA 4JI3J 1FDAA 4Q8FA 2ZH9A 1IWGA 1WC5A 1F5CA 1I3OB 1SQEA 2FGOA 2QG9B 2FZGB 2FJEB 2E9RX 3NCQA 5F3TA 1JX4A 1ZBTA 2J7KA 4H4MA 3M30A 2OKQA 4ZLLA 4JB8B 2GHWA 2KKHA 1ITPA 1S6PA 2IJRA 3R7BB 2B4VA 1GFWB 3LGNA 4OYMA 4ELVA 3DFEA 3KMQA 2RKIB 4CNZA 1N4LA 4C3KA 3ADAC 1FK9A 1S1XA 3N5FA 4MFBB 4ERDA 3T1HJ 3A3PB 1VQ7S 4YMEA 2R7UA 3M2UB 1RWKB 2ZDPA 2NSCA 3KDOA 3V4MA 3CCVS 2XY7A 3K5NA 1HR0F 3M2VA 3QO9B 3HT3A 1VJQA 1SJ1A 4LR8A 3K5OA 5EWGA 3NRBA 4JYAF 1IQTA 3R1LA 4ZIVA 2LDYA 5C42B 2HIQA 3O3LA 4GVLA 2XMJA 3TUPA 2OSQA 1SUQA 3C16B 4TU9A 4RW8A 4JI7J 2V0NA 4RWXA 2V4JB 2ZH1A 3I0RB 4M5KA 3JYTB 2QN6B 5KFIA 3H2UB 1V3SA 2E7WA 4E98A 2Y3YA 4IUFA 3QAEA 4OHYA 2VJUA 3AT1B 4J91A 4H54A 2KXFA 3FBCA 4OJ3A 1L3UA 1QTMA 5ETSA 5HROA 4MK8A 4O23A 5K9FA 4DFKA 2FLLA 4J5OA 3QWUA 1ZAVA 1T7PA 2ZOGA 4B3OA 3IAM9 1XN9A 1RWXB 2HWHA 3OVAA 4NXNJ 2XNRA 4GKJJ 3MOJB 3MF5A 2K1RA 2CPHA 4JOUA 2DNMA 2GA7A 4R0JA 4RUCA 2DPIA 4QQBA 4IH6A 1Q78A 4OI2A 3ZTRA 4NXMJ 4DL7A 2EKNA 3WZ0A 2W01A 4KY3A 1X5OA 3K5MA 4ZVQB 2HRUA 2V4JA 1FWLA 4O3RA 3KMSA 1SUQB 3C16A 2NUHA 4HH0A 3R5BA 4QYRA 4WWSA 5C2GA 1GQEA 4AQYJ 4P7TA 1UP1A 3UO0A 2VDIA 4O4GA 3MR3A 1FX2A 2ZH4A 1RAOA 1V9OA 1S9FA 4A47A 3K89A 2WW4A 2ZKTA 4CH0S 2HZVA 1Q7LB 2IDLA 2X1BA 2Z2MA 4K4YA 1ZAWA 1APSA 5KOWA 4NWBA 1LW0A 4M5JA 1YJWS 1XR6A 3MM5B 2XMTA 2XZTB 4DZ6A 1AZSB 3WIUA 1SL2A 4CLTA 4KTQA 2RKIA 4EBDA 1S57A 2VU5A 3DLGA 4I69A 1JLEA 4JI7F 2VB6A 2W7OA 4V19X 2ACMA 3I5BA 4ES3A 2QYCA 2VBXA 1QSLA 2BE9B 1H2VZ 4RZRA 1NPPA 5EWEA 2I9SA 1OPZA 3E51A 1JLCA 1U0HA 3I4HX 1YGYA 4J9UE 3UCUP 5F3ZA 1HR0J 1B7FA 1EP4B 2W2NP 2CVEA 3BF4A 4UTGA 5KG3A 1NHUA 4EBCA 4I6AA 4DS5A 1RXOB 1TKXA 5E33A 2Y1RI 3CC2S 2QEXS 4LR9A 3MEEB 3DLBA 4C8KA 2XYGB 5KFOA 4D3GA 1Y3JA 4JI5J 1RYRA 2OJ3A 2ZOMA 5T41A 1LW2A 2VOOA 5LSOA 1TKZA 4WFAQ 2XQCA 1GK8A 1X0PA 2Q1LA 1RT5B 2O67A 4OJHA 4ZVHA 2ZJRQ 4DV3F 2Y1IA 2EPIA 5J2NB 1WOSA 2OLWA 4JV2A 3SSRA 2YNGA 3PHTA 3D9BA 2CPXA 2MKCA 3GV8B 3DLKA 3IWNC 2XZWA 4USHA 2WRMA 2JNJA 2KH9A 1CC8A 4OJ1A 3KUEA 1OY6A 3DRRA 5ETVA 4PR6A 1OS5A 3D67A 3PCOB 4UOFA 5AE1A 3ONQA 5C2CA 2UXDF 2NPIA 2RQ4A 2EWHA 3RG6A 2V2ZA 4CYUB 1XNQJ 3Q83A 3PHEA 5IQQA 5GAEI 1VBYA 2R7XA 1BWEA 2B6AB 3D4JA 4QPTA 2CJQA 2V5HG 2R7TA 2EW9A 3GILA 1VCTA 4DR4J 4ECZA 1Y11A 3HHLA 3LALA 4BCAA 3MMBA 3EPGA 4DPYA 1XMOJ 1W25A 2DHGA 1JKHB 4ZLJA 4DF8A 5A8RA 1W2BR 2QSWA 1RTJA 1NK4A 3D0GE 2IM0A 2PMWA 5BYRA 5IC6B 1SL1A 2MLXA 4B08A 3N5BA 2VOPA 2V67A 4WBFA 4QYZJ 3KLEB 1FFGB 1F1BB 4L3KA 1S7IA 4OV1A 3DRXA 2J0XA 3PO5A 4KKOA 2IHR1 3CO0P 2CNNB 2HVEA 4UQGA 3QIPB 4DJBA 4IH5A 1RB0A 3KJFB 5B08A 5LXYA 1RT6A 3CNQP 1S10A 1GXUA 3TA2A 3D68A 1WHXA 1HNZJ 1XIQA 2MKHA 1DZ5A 3CD6S 4JV0A 2K7KA 3FCVA 1N5TA 2EG2A 3DRPA 5B0GA 3NMAA 1NK6A 3CWJA 1UZHA 1SH3A 2YNHA 3AQOA 2VFVA 1QE1A 3QLHB 4MK7A 4ZVEA 2KRBA 4ANDA 1TKZB 5F8NA 1UJ5A 4JI2F 2GW8A 2KT5A 1YHQS 4QR1A 2DXDA 3TW0A 5F8LA 5IWAF 1LQ9A 1Q16B 2R3VA 3AY0A 1U1KA 3R9LA 1P8GA 4QZVB 3U02A 4R5PA 4ZITA 1UJ6A 2XSFA 3OPKA 3AJ2A 4PUOB 1FXLA 1H7XA 3THPA 1Q53A 1XNRJ 5J2MB 1KVJA 2VL1A 2HQGA 2DGTA 2NUUG 5HQLA 3PIOQ 1O5JA 3RBDA 5E0OA 2GVDA 4EI2A 4TU8A 1GMVA 1WKJA 4QIWD 4RBTA 3M6XA 3W5YA 3HSGA 5EX0A 4DV3J 2YXLA 1VQMS 1J5EF 2J6TA 3Q8YA 3FFIA 1NDPA 3D0HE 1RA7A 3D1QA 2GGPB 3EGNA 3QIPA 5D3GA 3V4IA 1J5OA 2CUYA 3L09A 4J9VA 2DR6A 1WD6A 2HMIA 3KK3B 2VASA 2OMLA 2MQOA 1HPZB 2UUTA 3FUYA 3MURP 2ADCA 1KFSA 4EYIB 2J8AA 4Z7YA 5KFJA 1MWZA 1NPKA 2YKAA 3R6GB 1NSPA 2BM0A 2RAQA 2RQCA 1NZAA 4RW9A 1S0NA 3HHLC 3NXZA 1WSRA 3D66A 4J90A 2D41A 2L41A 3E3XA 4U95A 1FRKA 2WVCA 5L9NA 3M9OB 4K4VA 2E5LJ 4WIIA 1M5PC 1IJEB 2EK6A 3MGJA 1UW4A 4MIAA 5JXSA 1KQSR 4CO3A 4ALZA 2B3TB 3DOMA 1RTHB 4OYXA 3ZTOA 2ASLA 1YI2S 1K0TA 3EGVA 1GXLA 2CZVC 4LRDA 4YOEA 2QFJA 5A0YA 2CJAA 2JVOA 3VF0B 3TNVA 1IKXB 1TUGB 3BO3A 4CI0B 3TJAA 4LBIA 3OUYA 4ZCIA 4CTAB 2BR0A 1Q8LA 4DL3A 4F3OA 5EDWA 3W9JA 3BB5A 3EGZA 3M4XA 2PEBA 3IRXB 4KE5A 2ZJQQ 3BREA 1R8BA 3L9ZA 4ZKAA 1YQHA 4L3NA 2LQ9A 3KLHB 2PI5A 1L3TA 2VG5A 4ED0A 4FF1A 3DC2A 1WC0A 2JEIA 2W4CA 3OQ2A 3IR7B 4FYVB 4ZVSB 2ZD1B 4QWDA 3QZ8A 3M9MB 4MIBA 4ECQA 2I5JA 4HI1A 5CZXA 4DV4F 2AYGA 4FVCA 2CDRB 1MROB 1XC9A 2QA2A 3DOMB 3OTDA 4ZP7A 2BRLA 1OQ6A 3M8PB 4MKAA 4R0EA 1HA1A 1UFWA 4ECVA 2XLJA 4Q45A 3CCQS 3EXYA 3JAMY 2RE1A 3D6HB 2IC3B 1Y5IB 1FRLA 2B7CB 2GMHA 2ASDA 3PYGA 1B4SA 4NLWA 4URQU 1I1GA 2NXNA 1WACA 4I2QA 3D28A 3W5ZA 3OT9A 2FVPA 3KOAA 3M32A 1NJIT 4F7VA 3EVWA 3RRHA 2UUAJ 3IGNA 1S5ZA 4ID5A 2ALZA 3LAKA 3MM5A 2WVDA 2M4MA 3M32B 4DN9A 5J2QB 4KHPJ 4W98A 4J9RA 1CJTA 1FJGJ 1FKAF 1FRJA 3FFIB 3LO3A 3R5AA 2IIHA 4IOAQ 2B9XA 1TU0B 2UXCF 4OZ1A 2HGLA 3RZAA 4USTA 3W9HA 3VAHA 2C3OA 2RU3A 4O44A 1SBRA 4ED2A 5GAHI 5ETTA 3K0JA 1R31A 1U1OA 3AJ1A 5IZHA 2MZJA 3BBCA 3DLJA 3SQOP 4TNOA 2QJ3A 4OHZA 4M94A 2PMZD 1D09B 4FPRA 3GFXA 3EMTA 5B0DA 4RNOA 3NBPA 2XS2A 4C4WA 1LFPA 4DV5J 5U47A 3H2LA 2HQ3A 3S6EA 3OR2A 4C6AA 5CYMB 2Q6BA 3HVAA 5HBMB 3T5JA 4LIRA 1YIJS 4EO8A 3R2DJ 1Y9OA 4AXJA 1NEEA 2YNIA 2YWGA 2XY6A 3BQ2A 3G8QA 4E2FB 2R7WA 2RDIA 4F4YA 4AUKA 3MUMP 1TK0A 5L39A 3JTPA 3US5A 9RUBA 1ULRA 2IAJB 5HVHA 3BKUA 3DLEB 4CLSA 3CDUA 2V6AA 5KFBA 1FXRA 4YR3A 1A9NB 1VQ9S 4WFNQ 4KHMA 2FY8A 2AP6A 3OJUA 3KYLA 5H1SV 3JYTA 2UUBJ 4KYZA 1S1VB 3DU5A 1AA1B 1R8HA 1H38A 2UUCF 1X4EA 2AIRB 4YDXA 5M2UA 3G96A 3S8SA 4AT1B 4WYWA 4BS2A 2QSFA 1ZOTA 1P9QC 3IWXA 5F0WA 1TK5A 5KT5A 2MEWA 1UEVA 1S1UB 2VH7A 3NGKA 3QT6A 4U6PA 2JEJA 2R7VA 1N0VC 1MWQA 3EVOA 5F9LA 4FXWA 1RAEB 1U6FA 2RRNA 5DM6Q 4HHJA 2XMKA 3K5LA 3PX6A 1S72S 1UCNA 2CQDA 3FDSA 4ZVOB 1RCOB 3GFYA 1Z2ZA 4D3HA 4ZPVR 4DV6J 2RH3A 4HHUA 2KU7A 2YWHA 2YX4A 1SH0A 3MMJA 2PSZA 5DQGA 2CKWA 2E1PA 1N5VA 2WOMA 2YWKA 2CG4A 3FSXA 3PYEA 2HLUA 5JUMA 4CYUA 1S6PB 1JLAA 2P6SA 2VQFF 1QAYA 3BPDA 4EGLA 3NS5A 4DX6A 4DUZF 4A48A 1N36F 2YKNB 4DPUA 4PWUA 3GSIA 2I6WA 3RR7A 1G2EA 3NS6A 3TVYA 2O1PA 3A8JA 4TLQA 4P2XA 5GVQA 2XM3A 2M52A 1UVKA 4DR3F 2E1AA 2LLZA 1AYEA 4ITSA 2IM3A 2HFOA 4PPZA 5K8OA 5A6WA 3KHGA 2B56A 2YNIB 1U26A 2VC0A 3I0SB 1UPMB 4IDKA 3UVJB 4NLYA 1K73T 1UPPA 2B8PA 1RAGB 2Q66A 4OX8A 5GAEU 4GKJF 3VZHA 5LSLA 1VK8A 2GQQA 1FESA 1HNVA 2XNQA 4OX9J 3D6MB 1S1TA 2F8EX 3HFKA 3EWGA 4L76A 4YB6A 2KZMA 1V5VA 1X31C 2HHVA 4J9KA 3GQCA 2DGUA 2QX0A 2ZHAA 2FY1A 3SFUA 2IM2A 3W65A 1VRTB 3ENWA 4B9UA 2KHDA 4IRKA 5HO4A 2CZ9A 1YBUA 1HBOB 2JHEA 3MM6B 4I6YA 2AX1A 3W8PA 2OEMA 1FKOA 2QLXA 3QGIA 4NZ6A 5IT9Y 3O8WA 3GV7B 1IBKF 1VJWA 4JI5F 1REVA 3SIPB 2DISA 4K2XA 3TAPA 4F2RA 3A3OB 2KFNA 1VQPS 5L1LA 3KWMA 2VPYB 1U8WA 1WELA 3KLIB 2YWWA 5K14A 1KNZA 4DR1J 4X4QA 5KFTA 4L72B 3BN4A 1KFDA 3IN5A 3I6PA 2D3OR 1U48A 1FNMA 4DQQA 3HZGA 3C14B 1I94F 1C1BB 1VQYA 2A6MA 3UW1A 4J9LA 3ENAA 1Q86T 3RUBL 1SB6A 2ILZA 2NYHA 2QT7A 3D7SB 3DGVA 3GCWP 3KJQB 3MM7B 1R8CA 2EI5A 4LSLB 4Q2MA 5DZ6A 4ZA1A 1NO8A 5A8RB 3H0PA 1JKHA 1SJFA 2PA8D 2OIHA 3NG8A 3H40A 4DUYF 3J7ZT 5AJ3F 2ASJA 4LFAF 3OFGA 2VBWA 4XK8C 4M95A 1RI7A 2CXEA 3AXKA 3H59A 4ZJOA 3SSSA 5H9EK 4I0WA 3MM9B 3MZIA 1X4HA 2RT3A 2YBVA 2DNOA 3BN7A 4O3NA 2X7IA 1YDLA 1MMNA 1T9XA 2X3GA 3ILIA 3P96A 4B17A 2OPSA 1EKRA 3DLEA 1HQ2A 3CJ5A 1S0OA 4RNMA 4CLYA 4RO0A 2EVZA 4NLPA 4B9SA 4B9LA 3IG1A 2CA9A 2D1CA 5KG0A 1LWCA 4QJVA 3LWMA 5DDQC 2HK3A 4XAKA 4FYDA 3IRXA 1YJ7A 2QFIA 4OMFG 1NKCA 1NZ8A 1WDTA 4GVBB 2RF2B 3KDNA 3LP0A 4CTAA 2ADBA 1URNA 3QRPA 1RBAA 4OZ0A 3GR0A 2A2CA 1HBUA 1Q79A 2V8PA 3I0RA 5DG9A 2OPPA 1XEZA 1BLUA 5HK4A 5C25B 2C1EB 3FRYA 2C2MB 4DQRA 2DRBA 1J2VA 1R8AA 3CPWR 4B3TF 4ZVFA 2ERRA 3BSNA 2YH1A 1X4BA 5A8KB 3VAMA 1Y0HA 4ED8A 1JLCB 1U0HB 1R7IA 3HSZA 2KM8B 1N34J 2HHTA 4LSLA 5D4LA 2IMWP 4ELTA 1U25A 5E3QA 4QBUA 2K7JA 1HMVA 2LEAA 2JEFA 3NWRA 1AUSL 3KJNB 4LF4F 3CDWA 4OLPA 2FJBB 1WF2A 3ISND 2MQMA 3MPVA 3QBCA 2UU9F 1PCAA 1RT4B 2GHPA 4GKKJ 2CQIA 2XC9A 1KVIA 5EWFA 1VS3A 4M8LA 2A6OA 3TZZA 2VBYA 4LF1A 5L1IA 5D8HB 4FYYB 3SXLA 3KK1A 1QAXA 5L8RC 3UDEA 1ZA2B 3VWSA 3RB6A 1SJRA 4HYKA 4ETZA 1F5AA 4RR5A 3CEDA 3M8QA 4P2MA 4ED3A 2R2UA 4Q0BA 4NZ7A 1SIWB 4Y28C 2Z8QA 3CE8A 1Y7PA 5D4NA 1YJ9S 3RGIA 5DM7Q 4P74A 3PKYA 2V9WA 1RHQB 4KGMA 5KFFA 4DQIA 4I6WA 2MQ8A 5F8GA 2Y1JA 3P49B 2MQPA 3HJFA 1UFKA 2Y0SD 2C28A 4DQPA 1RT2B 1SPBP 2G9OA 4ED1A 4USJC 4DL0C 1NNDA 3PZPA 2FJDB 2MKIA 2J9CA 1DLOB 2CPZA 4DLEA 4DV0F 1RAHB 1FNOA 2WONB 5J1EA 3MR2A 4K4SA 1FT8A 3U1NA 4A8OA 1C4AA 3MFHA 4AE5A 1V3RA 3C2PA 4JI6F 5LXRA 4DR6J 1KR4A 2RUGA 2OTLS 4KIAA 3N01A 4C8LA 1ICEB 4ENOA 4G6VB 1D3WA 1RT6B 3BJYA 3G8SA 5A0YB 5F8IA 4J9QA 1WHVA 2KXNB 1YRXA 2AYBA 1RWOB 4F50A 1HD1A 1N32J 1HNWJ 1CJVB 1V6HA 3TA1A 1GH8A 4LFCF 3SCIE 3WDOA 2M8HA 4M5HA 2LQBA 2OH2A 1RTJB 1BQXA 4RW9B 2YKOA 2E9ZA 1S9EB 2ZWPA 1T3NA 5KFVA 2HAIA 2R4FA 3R5CA 3CC7S 3OTCA 2YX1A 1TAQA 5T14A 3MEGB 1FK9B 5ETQA 2HHWA 5E3PA 5G4DA 2E1RA 3NLCA 3D1HA 2DR9A 1ZAXA 3T3FA 2FYXA 4OZJA 3ILJA 5C24B 4OFZA 1LV5A 4K4TA 2GC8A 2ZH6A 1MG7A 2V2QA 3ZXWA 2JC0A 1GTHA 5HANA 4G1IA 1Y3KA 2GV1A 1QUVA 3CCUS 2X51A 1FE0A 1RWUA 4TY8A 2G0CA 2BJEA 2RD5C 1OYDA 3PXGa 5J2NA 2FVQA 2NQPA 4Y2KA 3P3DA 4KGKA 1UTAA 3LGMA 3TZYA 1RTDB 1HNIB 1S1TB 2RB7A 3S7RA 4O0IA 1QSSA 2KTQA 3UCZP 3O6QA 3OSPA 2JH3A 3KLGA 3SV3A 1RTDA 2IBKA 1BHNA 3D3CJ 3H98A 5CQGA 1KC8T 5HMXA 3GLJA 3TZWA 3I0SA 2Q79A 2M8DB 1DURA 2J5AA 3PX4A 3UR0A 3RB3A 1RHMB 2RHSB 4NMLA 4FNIA 1Y5LB 3NY0A 3DRPB 4PG7A 2AJFE 1OIAA 3AD8C 4F0KA 1F0XA 3K57A 1Q0NA 2ZE2B 4X4VA 1MLAA 1IVZA 1M5HA 2J9DE 2YKNA 3IBFB 5K20B 1YRUA 5GMKa 2BANB 4NRUA 4PQUB 2HFNA 1N32F 4GRSA 1CJTB 2RS8A 3RAXA 1JLEB 2IJFA 3NMRA 3ENVA 1YWXA 4KKOB 1MSWD 3FRZA 2BA9A 4LFBF 3EPIA 4DL5A 1PC5A 4UQTA 1NSAA 1VIOA 2YKQA 4KGZB 2BJ1A 4PWWA 4FXVA 3PW7A 2AJ0A 3TX8A 3AB4B 4OQJA 3HHDA 4ZVGA 3UNGC 3KK2A 3CJ8A 2W9CA 1RADB 5D4PA 4ZVUB 3NCRA 1AFJA 4O4GB 2GMJA 1FJCA 4ZJQA 2M70A 3Q8QB 1S1VA 5KFLA 4DV5F 3C66A 3JSRA 2MJUA 4F4XA 3SCJE 2BJ8A 2WVFA 2ZC3A 3SCLE 2FGCA 2WCXA 3O5TB 2BOPA 3GB0A 2V8HA 2YKMA 4BC9A 2XGQA 4IRCA 4X65F 1B3TA 2QRRA 2L9NA 4YY3J 3B82A 2MKJA 2R2RA 4G3IA 2QL9B 3LOUA 2DYAA 3H2VE 1VIXA 3ZTSA 2A3JA 3DDNA 5DQHA 5DZ7A 3CMAS 1XMQF 1OMSA 2AYMA 1VYAA 3KLHA 3QRQA 4LF9F 3OVSA 3W1YC 1LWCB 4ID8A 4ER8A 1U1PA 3GJQB 2QA1A 3ENQA 3IG1B 3M6VA 3I82A 3N79A 1H72C 1JLBB 3FJ2A 2KT2A 3BYPA 3GYNA 3LUYA 4RJVA 3QGPA 5ETKA 4DPXA 3L7UA 1B70B 1NJXA 3GG1A 2ZJPQ 2KRRA 4K59A 4ZCLA 4DPTA 5IT9U 3LA0A 2AKWB 2MY7A 2XLIA 4LF5F 1C4CA 2Y9HA 1H73A 5HSPA 1FTCA 1GNKA 1T3OA 2RRBA 4PG8A 1TKDA 2VPXB 2C2KB 3W63A 4U9RA 3FSIA 3PJ9A 3TR5A 1QAIA 1X4AA 3GR1A 3AODA 2HNZB 1BD6A 2KYXA 2WVBA 5KFQA 1LWFA 4NI2B 4JV1A 1KEKA 3OL8A 3P45B 3DYAB 3GJTB 4WP8A 2KG1A 1MW7A 2AJ2A 3TEGA 1RT4A 2J0WA 1H74A 2BVZA 2JRSA 1FEEA 1H3DA 2HQFA 1T95A 3CIZA 3FCWA 3H7HB 4JUZA 3ET6B 4HKQA 3V4IB 3BGLA 1WG4A 5CA5A 4N7TA 4RW6B 3PKMA 4KC5A 1IKVA 4Y34A 4QWEA 3CUNA 4HTJA 3RR8A 3OVBA 4Y0FA 1QD1A 4FNHA 4MTPA 1JLFA 1NM2A 4M5NA 4F0HA 4TQSA 2MZRA 1OY9A 2GVDB 3HULA 3QWPA 2AWZA 4BDPA 3BH7B 1QUPA 3C3LA 1YG0A 1JJCB 2E1MC 1HKAA 2RSQA 3RW6A 1AB8A 2F4FA 2PT0A 2UP1A 3ZZYA 3POTA 3D2WA 4CO5A 3HM9A 3R5GA 4PKDB 2M2BA 4WJBA 2I5JB 2HK2A 1HBUB 3TQ1A 2LVWA 2VFSA 3I5AA 1NCLA 1HWIA 1WEZA 2LYVA 3CJTA 5B0CA 4NCAA 1IUJA 3PRDA 4OJGA 2ZBIA 1WUUA 4S0MA 2RF2A 1CJUB 2DEIA 3HF5A 1DY3A 2J0QD 2IA0A 2FPHX 1HFEL 1TV6B 5I3UA 1PO6A 2YNHB 2Z2YB 3WC2A 2BJ7A 3OD2A 1F9FA 1HI1A 5HROB 4J9OA 5IM0B 1QLNA 4L74A 2ROGA 3BYRA 5AE2A 3Q8PB 4TN2A 5FD1A 3NCPA 4ED6A 2DNKA 1I94J 3S01A 9ATCB 2AZ1A 1EKSA 3LP2B 3AAWB 4F4ZA 1F2HA 2DH7A 1MWYA 2WOMB 4XDDA 3MM9A 2CJXB 4LF6F 3Q22A 2XBPA 3DRSB 2N4CA 3QFWA 4W90B 3IM9A 4XPEA 2ZOFA 4N47A 3R1HA 1T8EA 4FXDA 2R9LA 1IBKJ 2QO3A 1C2PA 1G6BA 3TAMB 5DDRC 3UD4P 3CTRA 3SYZA 1Q8IA 4QIFA 3G82B 3MEDB 2BABA 2YQ1A 3JQMA 1CS4B 3H20A 3C14A 1XNRF 2DKOB 3B8HA 1LFWA 1XR5A 3N28A 4BWMA 1S7HA 3ZZZA 2HMIB 3W5XA 4JI1J 3DDIA 1VDHA 4OX9F 2E29A 2NPFA 2DR5A 2QZ8A 2E5IA 1VQ8S 1U6ZA 2F5GA 1DBDA 2PE8A 3CCLS 4PXCA 3CCZA 2AMCB 2HWIA 1DRZA 5ETNA 2HHXA 2QLFB 1LEOA 2XMUA 1Q5YA 4HT5A 3SDEA 5THWA 4IH7A 1SV5B 5IM0A 1IQZA 3FBEA 5DLGA 4X84A 1CQMA 3MM6A 3WQPA 1D8YA 5J1EB 5I3UB 1WI6A 4RW7B 2U2FA 4ZP9A 3QJPA 2YKPA 3KXDA 1WWHA 4HI2A 1RT3B 3MM8A 1W2IA 1T94A 5KFUA 3DI6A 4OYBA 4PUOA 2LECA 1M90T 2YTCA 1HNZF 2E44A 2GJFA 2J76E 2AEMA 4DPWA 1FHTA 4OIXA 4UUWA 4RPFA 1HNXF 1O0PA 4WXOA 2FVCA 3T41A 5HLFA 2R7QA 1H98A 4KT0C 4FYXB 2B5JB 2DB1A 1UVLA 3CD0A 2DCLA 3G71S 5ETOA 5DQIA 4RL1A 1FFWB 1LOUA 3G2XA 5J1PA 2CIMA 1KLNA 3QPIA 2CQCA 2CQ2A 3CIMA 5K8NA 5L1KA 2RQMA 1JLFB 1VI7A 3OXFA 1FD2A 2JEGA 2J9DA 5LOQA 1W7WA 3DHWC 4I7FB 2OPQB 1XQIA 4LF2A 4DEZA 5BR8F 4IG0B 4RU9A 3H42A 3J7Z5 2UUBF 4Q44A 2YVSA 2UVUA 1QAJA 2BE2A 3DYAA 3PW4A 2V2KA 3DNCA 4DR2F 3V6HA 4KGVB 4DSKA 1L5UA 4QYZK 2H5IB 3W66A 4KQZA 1TL3B 5IV3A 2KFYA 2AW0A 3B54A 2IC3A 2XZDB 4XIUA 3T5KA 3BDPA 2J7WA 1QTNB 2VFTA 2EK1A 2WSEC 2DGXA 4LUBA 2MZ1A 4LSNB 3DXBA 2VONA 2X1AA 3ISNC 4O3QA 3MCOA 5DGBA 3ZFVA 3J80U 4C11A 4B9NA 4CO0A 2B7BB 3M1VA 5BYSA 5MAOA 5LJ5Y 1H7WA 1RTZA 2DNHA 4DOZA 2Z56B 2N82B 4JI4F 1KLMA 2NXCA 2MHEA 2BW2A 4MYTA 3GWCA 4N8NA 3ULHA 5B0BA 1FDNA 4RBUA 5ITHA 2W8LA 4I2PA 5LSRA 2R8KA 4GVBA 1HBNB 2EC2A 2VG5B 4B3RF 1HNXJ 1RAFB 3PTWA 1HWKA 3GJRB 1T0TV 4LF8F 2R8IA 1SJ3P 3MWBA 4IKAA 4TYBA 1R3NA 5KFDA 4PG6A 4X4NA 2XYPB 2ZH2A 2MLZA 1DTTA 3NGRA 2H48B 3QGHA 4GO5X 2GAHC 2V69A 3K17A 1JXEA 3U1LA 3W62A 4NYPA 4U7UK 2BW7A 4X2BA 2DGSA 1IKXA 3A4TA 4O3OA 1WTFA 2MPUA 2F8HA 1FWKA 3C6TB 1FRIA 4MKBA 4BC7A 1S99A 4DN0A 4TYAA 1WHWA 3MECA 3Q23A 1TKXB 4RUBA 1CULA 5HATA 2IFXA 1BWVA 1FD8A 5AXNA 1EP4A 1IXKA 3PX0A 4B3MJ 2WW8A 2XWYA 4JI1F 2BYCA 3PJXA 2MB0B 4OX7A 3W2WB 1SC4B 5CAAA 1PIEA 4RLEA 1K1SA 3EZOA 2LXIA 3FEZA 4P2FA 3T9NA 4N5SA 4KO0A 3KK2B 4XTTA 4A8KA 2CQGA 3IAS9 4RW4B 1V5IB 3T6JA 3EICA 1F9EB 4LFCJ 3VAKA 2F3JA 4ID5B 1R0CB 4ZN1A 1YZ6A 3GYGA 1YBTA 4O3SA 5FIIA 2GGPA 1LW0B 1RABB 4I2QB 5HMYA 4UUXA 3OL9A 1LK5A 3TVKA 5F8JA 2BANA 4OV6A 1R6YA 4LF6J 3M30B 5KFRA 2AGOA 2D69A 2I8EA 4ED7A 2ZVSA 2HHUA 4F8RA 4B9TA 2ZZNA 3VQSA 4A8SA 3GJSB 2UXBJ 2MQLA 1YJTA 2GHVC 2R8GA 3H5SA 2ATCB 1MROA 1X4FA 2YY3A 4PXBA 3V6KA 3V6JA 1N5YB 2VA3A 2D3UA 4QPXA 1WDDA 1SCJB 2EEYA 2O66A 4DS4A 4NZ0A 1SC6A 5KFGA 2B0GA 4QCLA 1CJKA 2F9JA 3NOGA 3PR5B 1HNVB 2KDOA 5FDLB 4WP3A 5KAKA 5M2PA 2MY8A 2CJYB 2ABYA 1RWPB 1P1LA 3QLHA 2RNEA 2LFVA 4KFBB 4YB5A 1T05B 2XMAA 3AOBA 3BBFA 2CYYA 5FJ4A 3HX9A 1UVNA 3GIMA 2BMBA 3CJ3A 1NSQA 3PVXA 3UDVA 5EUHA 3OFHA 2GIRA 1TL4A 5EN1A 1FKPB 2HNYA 3T1HF 3C15B 4DX7A 1PG5B 2WSFC 4OI0A 2Z58B 2VODA 1NH8A 2MKYA 2OP5A 3BZQA 4CT8A 5B7WA 5IS2A 1ZTTA 2LQ8A 4CM2A 1X5PA 2R2TA 4ECXA 2DY1A 7FD1A 3HO1A 3RRKA 5E5NA 3QT5A 2MSSA 3CCMS 5EX3A 2H5JB 2VUGA 1S9EA 4ZS6A 1Y00A 1S48A 3M8ZA 3QYYA 4F02A 4U7CA 2WTFA 1U47A 4UOCA 2BDPA 4DCJB 3W61A 3P5TL 4MH8A 4F67A 1VRUB 2C2DA 1BQNB 1QJHA 3NKYA 1NJWA 3MMCA 3R7SB 2FLOA 3SCKE 1UVJA 4CH1A 4DSEA 1SXLA 1X4CA 2BKNA 3DRYA 3EDQB 1I5OB 4CM0A 3OBIA 4QIEA 4DBQA 1Q95G 3M7VA 2WK4A 3T6BA 2MKSA 4IG3A 2ZUGA 3NEKA 1CPZA 1KOHA 1LNQA 2G0JA 2OTJS 2NSBA 2V9KA 3DRRB 2JWNA 3G6VA 3ITHA 3QNWB 5L46A 2NR0A 2JVRA 1RTIB 2BXJA 2DK2A 1R6VA 3L7OA 4TY9A 3AXMA 3ILLA 1NAQA 4LT6A 3ZNJ1 2C2ZB 3CJRA 2EBEA 1NLKL 2BE7D 3N0VA 4M5MA 5AT1B 3HXMA 3HK2A 3G6YA 2W2QP 2HQCA 3PYDA 2XULA 2KJWA 4WPAA 5GADI 3H4BA 4J9PA 1RT5A 4LF9J 4WCEQ 2GQ2A 4H4OA 4H4KC 3OR2B 2B43A 1XMQJ 3BO2A 1RBLA 4YEAA 1RDRA 4K4UA 1BXNA 3AH6A 2VF3A 1LXJA 3HDSA 3H90A 4DCOB 4UZBA 4A8YA 2DR7A 4DR7F 5HI7A 4AL7A 1FJ7A 2XHWA 2LMIA 3ELHA 4DHVA 5AE3A 5H9EJ 1TFYA 4WZMA 4YR2A 3GCXP 1H2TZ 3Q8RB 3FEXB 3MD3A 1U1NA 1TFWA 4W92B 3C8YA 4IFVB 4NCGA 2GFFA 1JJ2R 3CDEA 1N33F 4NMXA 4P75A 2DXFA 1UKUA 3EDRB 4GC7A 1XMOF 3D3BJ 2KYZA 2PC6A 4K8RA 4F26A 3I55S 1S9GB 4DR4F 3HSJA 3HHLD 4FPIA 1K8AT 2LA4A 4K7QA 5KTQA 1D9AA 3V5RA 1KSPA 4FF4A 1YK9A 4LRBA 2MXYA 4LFBJ 5KFHA 3PYFA 3IA0A 2BV3A 1R0BG 5KFPA 2P5VA 4WP9A 3DLLQ 5KG4A 1JLGB 2Z2ZA 2P9CA 2OD6A 2KVIA 2ZC4A 4BHQA 4UZCA 4KO0B 3AHPA 4IYQA 4C48A 1S59A 2ZH8A 3Q0AA 2OHDA 3DOLA 1UL3A 2YPYA 3P4UB 4WTOB 3VAJA 4ECUA 4LBHA 4DSLA 3BEGB 1VHIA 3TEHB 2ZVIA 4F0MA 3NOCA 3I32A 2JDJA 4RUAA 1U6BA 2GIFA 3R6LB 1OJ4A 2DD8S 3I31A 4A8QA 3T1YJ 3OR1A 2C2RA 1A6LA 3C46A 3VHQA 3D0IE 3VGUA 1KD1T 5KT7A 2LU2A 1C0TA 1F60B 3V81B 4NLUA 2KHCA 4PZVA 4USWA 4DXLA 3M8YA 3HCXA 1TL1B 4EEYA 1XR7A 2CZ4A 4K0KJ 2LKZA 2PMHA 4LRCA 4KAIA 1U4BA 1Y4ZB 3OFFA 4YUDA 3L95X 5LMUJ 1DHMA 5A6PA 2H3EB 2GQCA 3FK4A 5D15A 1LW2B 4YFUA 5LMNF 4J9SA 2AU0A 1NRKA 4HDGA 1WTBA 1R27B 2IRUA 2OPSB 2ZWOA 4UF4A 4I1TA 1IN0A 2ZEJA 3DDKA 2UVWA 2UUWA 4U7UD 3QGGA 2FC9A 3FQKA 4PYAA 5HQ8A 3LAMA 2CQ3A 3HHNB 2F63A 4A8FA 1SIZA 4YR0A 5C7PA 4ZPWR 4LRFA 4PG4A 4J9NA 5HMZA 2IY5B 3QO9A 1FRHA 5HAOA 3MI7X 4USKA 3HFZB 4USIA 3MDFA 1S6QB 4LREA 3RAQA 3UDCA 2HNDB 2C3YA 2OELA 4NLVA 2KG0A 3FNNA 3TI0A 1AZSA 3D1OA 2V4QA 3ZTQA 1U1LA 1HNWF 5KFAA 5JJBA 1I51B 4NA2A 4U67Q 2MSTA 3MAAA 3M05A 4C0BA 4EWTA 2FIUA 4WFBQ 3VAIA 4I56A 3RRGA 1GTEA 1PBAA 2E5JA 3BBBA 3G87A 4WYLA 4Z7CA 5DDPC 3CCSS 2R8JA 4B3SJ 5G0RA 3NNAA 4B3MF 1KTVA 2CG8A 4X62F 2ZM6F 1XTZA 2HFUA 1Q5VA 4CO1A 2CDQA 2XG8A 1EZZB 2KO1A 1IKYA 1M1HA 2F65A 1AFIA 1RT7B 1WEXA 3HI9A 1F3VA 4G1QA 1TMMA 2M7SA 2BJDA 2HBQB 1T9WA 1WG1A 3EUNA 3RAMA 2G1DA 2JLEA 2ATLA 5CH7B 2JL9A 4IDKB 4OI1A 3UVJA 2LDIA 2WAQD 3FZBA 4QWAA 2W25A 3AJDA 3U27A 3MPYA 2Z30B 1YLXA 3A3NB 2GCFA 1RT7A 3FMWA 2E1CA 2GNKA 1PBUA 1RU2A 2F9DA 3A8KA 5CCLA 5D6GA 1PILA 1YRTA 3I4PA 4YY3F 3BPSP 3CCWA 1NXIA 3MEKA 4GO7X 4MK9A 4PAAA 4B3RJ 3D54A 4IQMA 4J37A 3CT9A 2N3LA 4P71A 1JLAB 2FLNA 2AGPA 4DSIA 2R7SA 3E2EA 4PABA 3SDEB 4ECSA 3H4DA 3MMAB 1QDUB 4RW8B 3W9IA 2R8HA 2K3KA 4KRWA 3KLEA 4N41A 4KHPF 2RVJA 4UW2A 1IKWB 1P1TA 1R8PA 4EUVA 3KLFA 4LMZA 2I0XA 4K2JA 2E66A 1Q7YT 3CJKB 4C9DA 1GT8A 2LU1A 3AA9A 3NL0A 4DR2J 2LCWA 3HHLB 4WU2A 3KJVA 1N34F 4DWIA 1RWNB 5FLXY 2DR8A 1WF0A 3OHAA 1VFJA 4B3TJ 4JI8J 5BR8J 1KKHA 1R0AB 1B7YB 1KOOA 4PG5A 2FUG9 2PDAA 2HHPA 3DRSA 1KQFB 2IYGA 4C3LA 3J7AN 3CB4A 4K5SA 2CPDA 1X4DA 2B9WA 2ASYA 1DQ9A 1S12A 2FHKA 1TQLA 4CO4A 2ZDOA 4Q43A 4NYOA 3J81j 4CLZA 4EO6A 1ZPVA 2ILYA 3L3CA 1AROP 4RBVA 3AB2B 6FDRA 3BGOP 4WE1A 4YS2A 4ES2A 1K9MT 3LQVA 3PM9A 4P6QA 2DGQA 1C0TB 2NZCA 4J7CA 3LW5C 4WK3A 2V63A 1EX8A 3Q86A 3CF5Q 1NJYA 5D0RA 4F3QA 2RRAA 2CQHA 4U8YA 2AD9A 2PN6A 4O44B 2DH9A 2J8SA 3B4MA 1N56A 3MAQA 1ZM3A 1D0EA 1LWXA 3BKFA 4IRDA 4N76A 3JSMA 3DOLB 1HBMB 2LXFA
chains in the Genus database with same CATH topology
1A7GE 2N7CA 3BGUA 2POKA 1HQEB 4NX9A 2GX8A 4FF3A 4X4SA 4CQ1A 3EYZA 1M5SA 2BM1A 4MAKA 5KFWA 3HHKA 1VQLS 4DR1F 1KRPA 3TANA 4PPDA 5GAGU 2MGZB 4E0DA 2OAUA 2HHSA 4M5DB 1HW8A 1OO0B 4ZHRB 1VQSA 2DJWA 2HS3A 4OLOA 1Z2LA 3EXCX 2H9ZA 2MZSA 3GG0A 4A8WA 3DHXA 4HLBA 3M9NB 2XMWA 3Q2SC 5B0EA 1QSYA 4R8UA 1CQNA 4QWBA 1TKTB 5CYQB 3GYXB 4NA3A 2I38A 2HHHF 4RUHA 2CPJA 3BGRB 1ZZFA 3HVWA 2YNFA 1SKSA 3MOZA 2HGMA 2P9EA 1EETB 3UWTA 1V3ZA 4FBTA 1T03B 2AV5A 3VZIA 3HLUA 3PACA 3BR8A 1RJJA 2XB2D 2DNGA 3UI3A 2APOA 5KT4A 1FDBA 2ACYA 2L48A 4CNYA 5A2QY 1ZZNA 3OL6A 3TUJC 1RTHA 3GMGA 5E3AA 1RT1B 5K8MA 5DDOC 3RYLA 1IBLF 1FRXA 2DGVA 3P6YC 5B0FA 3ISZA 4MKYA 2MZQA 2CQPA 4Y00A 1JJHA 3BR9A 1FERA 3UD3P 5DGAA 1YJVA 2DNRA 2BBEA 1UEUA 3M2UA 2EFVA 4Z2XA 2IA6A 2F40A 2LA6A 1FVQA 4NLDA 1N8RT 3KK3A 1SKWA 2CVIA 3DM2A 3OXGA 2D7SA 1JK9B 4K4ZA 4AL6A 1RQ0A 3IR5B 2GJIA 4LJMA 3G6VA 1YVFA 3WBZA 2XI3A 1NKEA 3CC4S 3A1YG 1M0SA 2SXLA 3IWLA 1S6UA 4R25A 4PQUA 4A46A 1HBMA 1P6TA 3K5PA 1MMDA 2Z2LA 1KQKA 1X9MA 4B02A 4QU7A 2WSCC 4NPOA 2J0SD 4PRFA 5AXKA 1VQKS 4YP3A 2UV8A 1I6JA 3LF0A 1JLQA 1DQ8A 1KHWA 1DAXA 3LP1A 3N4WA 2EFPA 2G4BA 2XSJB 1JNRB 1SI9A 3X1LB 4OHXA 4URGA 3MR5A 2AJ1A 3R27A 2XO7A 1UAWA 3M2RB 1KTQA 2B4PA 3BM7A 4KBIA 5A8WB 3KNAA 3VAGA 4TY8B 3KG1A 4RW7A 2AJ4A 4AFFA 2QA4S 2C42A 2M5YA 4ECRA 2DNPA 1ZTWA 2V8GA 3J7A1 3SEOA 5HN0A 1HWLA 3JTOA 1SL0A 4RU2A 4ECYA 2PD1A 2I2YA 1TP7A 2FC8A 2M88A 1VOMA 2GIQA 3FEYB 1C1CB 4Y65A 1KQGB 4NLTA 5KG7A 3MEGA 4DF4A 2MQQA 3CMES 4UY85 3V2UC 4ZCKA 2VFUA 4RW4A 3TA0A 1RGVA 2DHAA 1JIHA 4TQRA 2OPRB 1J5OA 1IR0A 3N6NA 1FNXH 2CFXA 1FO1A 4I64A 3VTIA 3HVTA 2DO0A 3MTJA 3OTOF 4B3SF 2F4VF 1FJEB 2B6AA 1IKWA 2KN4A 5LL6d 4HVZA 5F8HA 1CEZA 3PW0A 3TARA 1LKZA 1QM9A 1URRA 2W7PA 3NP5A 2W4PA 1FXDA 3MUTP 1WI8A 1TAUA 4ZCMA 3FSYA 1HQUA 1NK9A 2V8VA 2DHXA 3MUVP 5A8WA 1YBAA 4IOBA 1QVFR 2YNFB 3PR4A 3PV8A 3RW7A 4NYZA 1S97A 2IJNA 3MEEA 2DVIA 4OHVA 1HHTP 2VG6A 5CCMA 2W9BA 3OLAA 1X4GA 1G7CB 4C11B 1S0VA 3NWGA 2VZ9A 1KS2A 3F41A 5G0RB 4LSNA 1L3KA 1PGZA 3W3SA 7FDRA 2KM8C 4WZQA 3H5YA 4I4BA 2CQBA 2Q3PA 4WF9Q 4DG1B 4K0KF 2COLA 3T1AA 2XY5A 2J6SA 4ED5A 1RK8A 5DS7A 3HP6A 1HYSB 4EU0A 3GIJA 4K4XA 3OXLA 1HI8A 2F8MA 1HYSA 1RKIA 5HP1A 2RJZA 2V8DA 5KFKA 4LVNP 2ROPA 4GMKA 4RWWA 3QJJA 1S6OA 2XMVA 2RDJA 3ZC4A 1F5BA 4ILMA 4PWDA 4ZPBA 4WK1A 6FD1A 1LWEA 5C5JA 1VQOS 4JI3F 1NK7A 2AX0A 4IFYB 5C25A 2A2DA 1ELOA 3WX4A 1ROFA 3HVRA 2BACA 3PIPQ 4F4WA 2VA2A 2ZNZA 2DNYA 3LP0B 2EFOA 3DCAA 3H8YA 2DT9A 4O3PA 4AL5A 1VQ6S 1HQUB 3GSDA 2ZHOA 1NK0A 3G4SS 1K1QA 1RP5A 5EGYA 2YQ3A 4KV8B 1TL5A 3MD1A 3I9V9 3V81A 3E8OA 5T7LB 4YB1P 2W9AA 3PRBA 1YJUA 2VC1A 4IG3B 1CLFA 1HWJA 1S1WB 2NYIA 3PDNA 3SI8A 4KPYA 3KG4A 4X4OA 4NCBA 1DJ0A 3FCHA 3QIDA 4PXEA 2JOQA 1BQNA 3TOQA 3CCRS 1AUDA 3JTNA 2J9EA 4CO2A 2MYFA 2OPRA 4M5DA 3CVKA 5KOXA 3DN9A 4C0OC 3MM7A 1VC5A 5I42A 4GKKF 5HP1B 1Q1KA 3RBEA 4K5RA 4MFBA 2UUAF 1N6QB 3HKWA 2CJ9A 1Y5NB 1YJNS 2L3MA 3IS9A 2PA3A 4HH1A 4LF7F 3KLIA 5K14B 3MMAA 1SH2A 1XNQF 4Q8EA 2VPZB 2DCUB 2HWTA 4B9MA 3THTA 1VGYA 2HNYB 3RB0A 1TUVA 2ZE2A 4XPCA 4Y6IA 1FKOB 2D74B 3IXQA 4IFVA 3NNCA 3RU0A 3W7BA 1GXTA 3PW2A 1UFLA 4QR0A 1TV6A 5KFNA 1NH7A 1ZM4A 1WNEA 2I1RA 2XWXA 4BBYA 2LEPA 4V19J 1DFDA 3G6ES 3K8VA 4NL5A 3KLGB 4ZPCA 1D9FA 4Y3CA 3J81Y 1U1QA 3T5LA 3CSKA 4OI3A 3QAUA 3H25A 1H2UX 2JJ4D 2AGQA 4O4RA 3VALA 5AXLA 4ILLA 1VQ4S 2QA4G 2QIFA 1Z4UA 4TU7A 1YITS 4DSFA 4ZDNA 4DMZA 1C0UA 1SV5A 2RU9A 3LANA 5LJ3Y 4ZLPA 2ZFHA 1VC0A 1QVGR 1WHYA 1DARA 3K58A 4F2SA 3GFHA 4QW8A 4JV5F 4RW6A 1U2FA 5KFSA 1R0AA 2EG1A 2OD4A 2VD3A 3X3UA 3DMJA 5KG1A 2E5LF 3C6UA 5KT3A 2L08A 3S1TA 3ZZ0A 1UVMA 1TK8A 3LPYA 1N54B 4DFJA 4RKUC 2UXBF 3ZZRA 4C8ZA 4Q2LA 2UVVA 3JSYA 4QWCA 2FVSA 2A10A 3DMJB 5E3CA 5KG6A 3FZ2A 2EBGA 1CC7A 2UVRA 3PO4A 1NU4A 1BQMA 2IMOA 4NLXA 5IT0A 5DG8A 4IR9A 5D77A 3SQGA 3C6TA 3OTBA 2KJVA 4KV8A 2V94A 4QIGA 2W4DA 2CQ0A 1X9WA 1N5QA 2C3MA 2WBMA 1T03A 1Q82T 4RNHA 2XEXA 3U1MA 1EETA 3PNIA 1N48A 1DTTB 1FEHA 3M2RA 3IO1A 5KG2A 1YTYA 1D1UA 2WONA 1UVIA 2XMMA 3BGRA 1ZH5A 3IFEA 3ZZUA 4IQXA 3NAIA 3OHBA 3KKFA 1ZPWX 1DQAA 5CYMA 3TRGA 4L6V3 4X64F 1G3OA 3QZ7A 4MIWA 1M5VC 3BSCA 1U1RA 5CHCB 2HLTA 3WC0A 2JSXA 1UA0A 1JLQB 1UETA 3KHRA 2LQJA 3M6WA 2QLWA 2RQKA 1HI0P 2DTJA 2O3DA 3M8QB 4NLOA 4Q0BB 4CH7A 3W2VB 5MLCV 3DOKB 1RA6A 5KG5A 2XCAA 2IRXA 4C8NA 3BQ0A 2XGPA 2M3DA 4IG0A 2CRLA 5I42B 4KR0B 1SJQA 4I7FA 3O2IA 4BWJA 2OFHX 3W2VA 1DTQB 2DNLA 2FDNA 2JX2A 1CSJA 3JSMB 2NZ4A 3FQLA 1MU2B 3UDLA 5J2PA 3V6DA 3CCES 1GX6A 2QV6A 2R7OA 4KHRA 4ZK7M 5A8KA 5D4OA 3OJSA 4WXWA 2MZTA 5CYJA 4XO0A 1QY7A 3NNHA 2OPPB 3ETOA 2IRYA 4C8MA 1KN6A 1NKBA 2Z0GA 2IVYA 2FD2A 3H5XA 5D78A 2ZD1A 1TR0A 4KB7A 4DV2F 3CD5A 2EFQA 3KNGA 4NRTA 3K2YA 4WTYA 1WG5A 4ECWA 1NK8A 3FVYA 1ZETA 2HGNA 5IFMA 5DLFA 3A8EA 1E6YB 5H9FJ 2BQUA 4WFYA 1U8SA 1HBNA 2IBOA 4ICLA 2HHQA 3OUYB 4C7QA 3MFIA 1LK7A 2D3ZA 5C24A 4X4TA 3BQ1A 4EFAC 3G8TA 3JSBA 1VK3A 2BRKA 1U1MA 1MU2A 2HPUA 5DO2A 5J2PB 5GADU 3V6DB 4P2SA 4PWDB 1BY9A 2CPEA 4ZHRA 1RKJA 5J1NA 1FVSA 3SMZA 2UZAA 1HL6A 2KXHA 1FRMA 1DTQA 4NOHA 3G6XA 2JFDA 3HZEA 3UQSA 4B9VA 4H4KA 4LQ3A 4RNFA 2AYEA 5B09A 2R7RA 2J7UA 1HPZA 4ZPTR 1ZYQA 2F7VA 3DOKA 4OL8A 3F44A 4DG1A 3U7JA 1X9SA 3CD7A 3HHEA 1JNZB 1C0UB 1VLYA 1OPIA 4HDHA 4Q5VA 1HHSA 3CDAA 4KSEB 4ATNA 3OW2R 5KT2A 3K7RA 4AQYF 3T9ZA 4X4PA 3AQPA 2DBBA 2MDAA 5HL7Q 4RNNA 2PFFB 5J2MA 2VG6B 4KFBA 2C22A 1U45A 1KHVA 2ZH5A 3GV5B 1UWBB 3BO4A 1VQ5S 1NB7A 4NXMF 4TKTA 1E6VB 4KJIA 4WKRA 1UWBA 4DQSA 5L9XA 2PEHA 3OV7A 2ZITA 4G1QB 4TLRA 4OHWA 2KB2A 3QMQA 4DSJA 4NLGA 1F2GA 3DLHA 2XI2A 2KZZA 1N5SA 2DITA 1SJ4P 3KFWX 1XWLA 1XERA 3SQGB 5B0AA 1IBMF 3MAHA 2CJBA 1XMBA 4AYBD 5DG7A 3IS9B 3TYTA 2EC0A 3J7YU 2CPYA 2RS2A 2CJKA 2MKKA 2HS4A 2QE5A 1R89A 3MMCB 5BJRA 2HVZA 1VRUA 2L9DA 2ZH3A 3ZZOA 4IO1A 4DL6A 1HMVB 1U09A 4F4KA 1J5OB 2N3OA 1H6KX 5I3QA 2XS7A 1LWFB 2M9KA 1AXQA 2HNZA 3M6UA 3TAMA 5GAHU 1NJZA 2FHOB 1S0MA 3F56A 1B0TA 5HMWA 1B0PA 2XS5A 2IVMA 1O8BA 2FJWA 4K4WA 1LXNA 1Z1ZA 5KFYA 2ZKUA 1TVRA 2DNNA 2E7XA 1ZM2A 2E9TA 4X66F 4C98A 4PQAA 4DL4A 1UA1A 1FTRA 4FVMA 3N6LA 2DGWA 3SZ2A 1RYSA 2DPJA 1G1XA 3E01B 1U49A 4FN5A 1IJFB 1TL1A 2OMOA 4DV7F 2X1GA 5L38A 2DIVA 4DPOA 1X7VA 3NAHA 3DU6A 2GO8A 4N41A 1GAOA 2ZH7A 4R8UB 4C97A 3EGWB 2JC1A 2YX7A 4MYUA 4IFYA 2CQ1A 2VKRA 3LWLA 1Q81T 3Q2TC 1N5YA 1IKYB 4OZ5A 3I56S 3BSOA 2GJ2A 2H5EA 4YB7A 3N9UC 1VC6A 1YSJA 5F9NA 4N77A 5K5MA 1X0FA 2YWFA 2W9CB 4IR1A 2DRAA 2GMLA 2EKYA 1TL3A 5BYQA 2N7YA 2W7AA 2HS0A 3ICLA 2R2SA 2JZ5A 1C1BA 2O5DA 3K8WA 3IBWA 1CVJA 2V4RA 5KFCA 1N6QA 2RMLA 4YQWA 2HNDA 2OFGX 2OPQA 4OX6A 1RAJA 2J6UA 3G9CA 4Y2AA 3MXHP 2FHMA 2KT3A 3EZ5A 1REVB 4NA1A 5CD4H 3IR6B 3FGVA 2Q43A 3O1LA 4AXIA 3BS9A 3JB9k 3HMJG 2ZNYA 2GO9A 3UFCX 5I4MA 2FHJA 1SKRA 5HLFB 4QOTA 5I3PA 1UJ4A 1HNIA 3E01A 1JLBA 3BDEA 2BQRA 4H4OB 1OQ3A 2K1RB 4LVOP 4OI4A 3MM8B 4FS1A 3CJ0A 3EX7B 3PEHA 2VQEF 5M2RA 4YHHF 2AJQA 1TVRB 5DGBA 2G13A 3KG0A 1TKTA 1RTIA 5CYQA 2X1FA 3GE9A 3ZZTA 1BQMB 2YKMB 3FMBA 3GIKA 3UPFA 1M5OC 2VV5A 5AXMA 1D8ZA 1FCAA 2DHSA 1KLMB 1X8DA 2C3UA 3MHYA 2FB0A 1LWEB 4QIVA 2PO4A 3M1VB 2IVFB 2NS1B 4LIWA 3HVTB 4FS2A 2P9GA 1KONA 3I87A 2K8GA 3CJ4A 4NLRA 1VMBA 3B4DA 4C0HA 3GIIA 3CCTA 3MEDA 1UMJA 2F1FA 5CXTA 4GC6A 4C8OA 3PY8A 3MTKA 2DGOA 3THVA 2YWEA 1U2RA 3R3TA 2YH0A 2MMYA 2NREA 4E8UA 2B9YA 2AQ4A 1S1XB 2LXUA 2MHNA 5EHHA 4X4UA 1X5TA 4HEA9 5KFMA 2CPIA 5D3GB 1HQEA 1JMTA 3LP2A 3N6MA 4ES1A 4A8MP 1JXLA 4DV6F 2XCPA 1L3SA 1BGXT 4FBUA 4H4MB 2FVRA 2IAJA 1PSDA 2JLFA 4NLQA 2AF6A 3GFZA 4Y2IA 3VAFA 1HBOA 4A8XA 3PFOA 1HD0A 2W9BB 2LQ5A 1T05A 3K59A 1IM4A 5HBMA 1DLOA 2RILA 4C2MA 1E6VA 5LT5A 2XSJA 3CCJS 4P7VA 5ADZA 1RT2A 2DIUA 4TXSA 2BQ3A 3LH2S 2Z4PA 2NXUA 1MMLA 3LP1B 4NXNF 3BGFA 4WE1B 3DI6B 2B4UA 2VKZG 1JJ4A 2ZBCA 3CULA 3POTB 2IYIA 1JB0C 1HW9A 1OSCA 3UE2A 4DR6F 2XLKA 1S4FA 2EFGA 3AA8A 3GZ7A 4JBCA 5CZVA 3UCGA 2HVIA 1T02A 5E3RA 4ILRA 4ELUA 3VCDA 4QR2A 3PEJA 1S77D 2O01C 4FZVA 3OSNA 3CDBA 4OZNA 3SV4A 4B3OB 4I67A 4J9MA 3KLVA 2D9PA 4IO9Q 3HKZD 4EBEA 5IXUA 1S6QA 4WKYA 3NGDA 2B4OA 2VG7A 3RB4A 4CZCA 3PJWA 4WFXA 2FJXA 4NLSA 4Y2MA 1VBXA 3PW5A 1N52B 3W2WA 3KLFB 5SUHA 3T19A 3M8PA 5KFXA 3MMBB 2A1BA 2HVHA 4RX6A 5DRKA 4DLGA 1S1WA 1U7LA 2HFZA 4EZ9A 3QJLA 1RT1A 1XBWA 2BZ2A 3MECB 3J7YI 1FF2A 3J80Y 2Q6CA 4ICLB 2HZCA 5T7LA 4HTIA 2E5HA 1FKPA 4EZ6A 3TUZC 2PIIA 4FP9A 4Z37A 1E6YA 4OZLA 5JVGQ 5SZTA 2VFRA 3M8SA 4ETXA 2WB4A 3F73A 4UY8T 2YNGB 4PCQA 1S76D 5KFEA 2FLPA 1U24A 3B78A 1O51A 2OSRA 4CIOA 1D9DA 3KHHA 5FDLA 4X4RA 3MPWA 4I2PB 3VR1A 4DL2A 2KFZA 5F8MA 2L9WA 4M63A 3IC1A 3EZUA 3NBPB 4OI6A 3I96A 4ZOSA 1BC6A 3OL7A 5F0UA 4CT9A 2VBZA 5JVHQ 4ZP6A 4ZP8A 1P27B 2ROEA 3D5MA 4N56A 2QMXA 4I68A 2MGZA 1YJRA 2W24A 1JLGA 3SSQA 3KK1B 3HPOA 1IKVB 2JFKA 3R5DA 1JWWA 2RIJA 3TAQA 4DV1F 5J2QA 2BE2B 5E7OB 2WBRA 1FDDA 3DLGB 3DM2B 4M1KA 3T5HA 5KT6A 2HG4A 1B64A<