3M8QB

Hiv-1 rt with aminopyrimidine nnrti
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
424
structure length
398
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 112
structure length 398
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qB04
4O3RA 1S4FA 3N6LA 4DL4A 4IKAA 5KFOA 3KOAA 1S1VB 3LP2A 5KG0A 4O4RA 1IKVB 2BR0A 5F8JA 3Q8RB 1KLMB 4KKOB 1HYSB 2IMWP 4O3QA 5JXSA 3KK2B 4EBEA 2E9TA 3KK1B 5FDLB 3OHBA 3KLHA 5J2QA 3BSOA 4TLRA 3PR4A 4NLXA 3MECB 3DI6A 4MFBA 3H59A 1TVRA 1S1WA 3BR9A 3DRRA 2FLLA 5J1EA 3KLHB 1JKHA 4YR3A 2JEIA 4IH6A 5KFDA 5J2QB 4K4SA 5KFNA 4WYWA 1RT5A 5KG7A 4KFBA 2R2UA 3BGRA 3QGGA 4ECSA 2DPJA 2WONB 4TYAA 4IRDA 1DTTB 2QE5A 2XCPA 4K4TA 1RT3A 1S1WB 1LWCA 4F50A 2ILYA 4TYBA 5KFXA 5I3UA 4KAIA 2R2SA 4J9OA 1LWEA 4MIBA 1GX5A 5JUMA 1RT5B 3KMSA 3LP1A 2BQRA 4KFBB 3DMJB 3OL9A 3QO9A 5DQGA 1ZTWA 3UR0A 3RAXA 5CYMA 3Q8QB 4J9RA 5DG9A 2YNIA 5I3UB 2BE2A 4X2BA 3QZ8A 1U09A 5DQHA 2RDIA 1FK9B 2YKMB 5KG3A 4QWEA 3QO9B 5K14B 2O5DA 4TXSA 4YMEA 3RAQA 2BE2B 4TY9A 1JLBA 4IG0A 3E01A 5L9XA 5KFGA 3IG1B 5HP1B 1QAJA 3G86A 3IGNA 4TY8A 2ILZA 3MFIA 4RNNA 3T5JA 3M8QB 4O3OA 4M94A 3HVTB 1QUVA 5DLGA 1RAJA 3CVKA 4FS2A 4I2PA 3JYTA 2HAIA 3E51A 4RNFA 3MF5A 3OLBA 1JLBB 3E01B 2AGQA 3DRPA 3VQSA 3QGIA 3HHKA 4KO0A 3PJWA 4TN2A 5L1KA 4Y2CA 1SH0A 2FJWA 1GX6A 3GILA 2W9AA 4GC6A 5KG5A 4DG1A 4NZ0A 4RW8A 3HVWA 1TV6A 3JYTB 4LQ3A 2AX0A 1XR6A 3GIKA 2JLEA 4ZP9A 1JLAB 3FDSA 5F8GA 2ASDA 1C1BB 3DM2B 3DOLA 2FJVA 3GIIA 3IN5A 1S1TB 5KG2A 4MKBA 4ECVA 4NCGA 3OL8A 4ED1A 2JC1A 1FKOA 4DG1B 1RTDA 4KBIA 2IM0A 4TQSA 2D3ZA 2ATLA 1HNVB 1TV6B 3EZUA 4F4YA 1UWBA 2W9BB 3QLHB 3PR5B 3KJVA 1OS5A 1HQEA 4G1QA 4ZPDA 2GC8A 1C0UA 5KFYA 2OPSA 1HQUB 5DGBA 1FKOB 1RT7A 1RTDB 3H4BA 4RW6B 1D1UA 4H4OB 2W7OA 3DLEA 2RF2A 3G6XA 2C22A 4MK9A 4DL5A 2RKIA 1LW2A 2AU0A 2J6SA 4IG3B 3KJVB 4G1QB 2I1RA 1C0UB 1RTIA 3I5CA 1JXLA 2WHOA 1RT7B 4QWBA 5EWEA 3N6MA 3DLEB 1BQMB 4O4GA 3H5XA 4NLOA 2RDJA 1N48A 2VG6A 2RKIB 1S49A 3NAIA 5J2PB 5HROB 4IR1A 4KSEB 1VRTA 3LP0A 4EYIB 2BQUA 4QW9A 2XWYA 4G3IA 1JLFB 2WB4A 5KFVA 4O44A 4O4GB 5KT7A 4IH7A 1K1SA 5KFUA 3UPFA 3GYNA 4RNMA 1IKVA 2DPIA 1KLMA 3FFIB 4ID5A 4KKOA 4URQU 1VRTB 5KFHA 3PVXA 1RA6A 1N4LA 3KK2A 3RB0A 4O44B 3KK1A 4MKAA 5FDLA 5HLFA 4FBUA 4K4ZA 4LSLB 3H4DA 1R0AA 2AQ4A 4NLDA 3QIDA 3I0SB 4ID5B 3BSNA 1HPZA 3MECA 1JLEA 5KG4A 1RTHB 4RW7A 1KHWA 4ZP6A 4DEZA 1K1QA 1S9GB 1S1UA 5KFWA 5HLFB 4Q44A 3DRSB 3I0RB 4XPEA 4OL8A 2V4RA 4J9NA 1R0AB 2C2EA 2B43A 2YNFB 1HPZB 1W25A 4ZPAA 2WONA 1TL1A 4NLTA 4F4XA 1DTTA 4R0EA 3TVKA 1SV5A 2AX1A 1JLEB 4ZP7A 3RBDA 4I7FA 3T5KA 4RW7B 4ZHRB 1RT1A 4K4YA 1S1UB 2IC3B 3MTKA 4Q45A 1JLQB 5KFKA 1TKXB 2R8HA 5KT3A 3DMJA 2VG7B 1TL1B 4QW8A 4QPXA 3CJ4A 1RA7A 1SV5B 3M9NB 5KG1A 4IR9A 4I7FB 5KFAA 4RZRA 3T5HA 1RT1B 4ZPBA 4IQXA 2XI2A 1N6QB 4ECWA 2OPQA 1IKYB 1FK9A 2YKMA 2R2RA 4J9SA 3Q8SB 5K14A 3BSAA 5L1LA 2ASLA 3H2LA 4Y3CA 3UQSA 4J9PA 3TQ1A 2OH2A 2XGPA 3Q8PB 3DLKB 2FVQA 4JV2A 4H4MB 3KLEB 3IG1A 5HP1A 2OPQB 3JSMB 1IKWB 1LWFA 3M8QA 3FSIA 3HVTA 1TL3B 3OL7A 4Q0BB 1RTJB 3DYAB 5L1JA 3NMAA 2E9RX 2UVWA 5KFMA 3OSPA 1DLOA 4F4WA 2ZE2B 3KHGA 3V81A 1LWFB 4H54A 3BREA 3RB6A 4Q43A 2R8GA 4WFZA 2YNGB 3PW5A 2FVCA 2WOMB 1CSJA 2HWHA 5KT2A 2IM3A 1DLOB 4NLPA 2BRLA 2FLPA 3NBPA 1S97A 1JLAA 3I5BA 2WRMA 1C1BA 3DM2A 3V81B 4ED8A 1S1TA 4K4UA 4ECXA 2E9ZA 2IAJB 4IFYB 5F8IA 4DL2A 1HNVA 1HNIA 5KFLA 5D3GB 3KLIB 4O3NA 5I42A 3BJYA 5F8HA 4K4WA 1TP7A 3CJ2A 1D0EA 3NBPB 2W9BA 3QLHA 3FRZA 3SFUA 2J6UA 3D5MA 3MEGA 4DL3A 1EETB 2VA2A 4ED7A 1HQUA 3CDEA 4PQUB 2D41A 3MR3A 2ZD1B 4RW6A 4HKQA 4H4OA 5CYQB 1HNIB 4PUOB 2IM1A 5EUHA 1IM4A 3C6UA 1REVA 2FVSA 5I42B 3BQ1A 2AWZA 5DGAA 3I5AA 5KFIA 4IG3A 2UVUA 3PW7A 1BQNB 3KLFB 3V4IA 3MEGB 3GV7B 5EDWA 1HMVA 4PWDB 3SI8A 3PHEA 4WYLA 2JEJA 4EO6A 1BQMA 2JEGA 3SFGA 5C5JA 3C6UB 1REVB 1XR7A 1TKTA 4M95A 4J9KA 5KT6A 5J2PA 2GIRA 3QIPB 5HROA 4J9LA 4ZP8A 4ZVEA 4J9MA 3V4IB 5C42B 1S0NA 2JC0A 1JLFA 1HMVB 3KK3A 4GC7A 3RB3A 4JUZA 2V4QA 1TKZA 1MU2A 4ZVGA 5KT5A 4R5PB 2VA3A 4B3OB 1C1CA 1TKTB 3ICLA 2HNDB 3PJXA 4NLRA 2ZKUA 1HARA 3FFIA 5KFSA 5C25A 4Y34A 4RUCA 1JLCA 2C2RA 5KFRA 4ED3A 1T03A 3KK3B 1S48A 2UUTA 5DG8A 4YQWA 1SUQA 1MMLA 1TKZB 1MU2B 3OHAA 3PW2A 4DL6A 4QWAA 3GV8B 1NNDA 4WZQA 1S9EB 2HNYA 1C0TB 2I5JB 4LSLA 4KHRA 4NLSA 1C1CB 3G6VA 4Q8EA 3V6KA 2D3UA 4WXOA 5KT4A 3I0SA 1JIHA 1I6JA 5F9LA 4WE1A 5C25B 3NAHA 1JLCB 2IBKA 1T03B 2BQ3A 2EC0A 1FKPB 1SUQB 4JV0A 1RTHA 3MR5A 1S1XB 4URSA 3M9OB 1S9GA 3DRSA 2B6AA 2HNYB 3I0RA 5T14A 4ECTA 1QE1B 3KMQA 3IRXA 3ITHB 1T05B 3OSNA 2J6TA 3QGHA 1RT6A 2YNFA 4WE1B 3NGDA 3CJ5A 3IGVA 2F8EX 5DQIA 3DLGA 3N6NA 1S6PB 5F9NA 3C6TB 4ZVFA 4HYKA 2JEFA 4ZHRA 4MIAA 3FQKA 5C24A 1J5OA 3T5LA 2IC3A 4MK7A 2B6AB 1JLQA 1S6QA 1IKXB 2OPRB 2VG5B 3IRXB 1RT2B 4WZMA 2UVRA 1TKXA 3CJ3A 1RT6B 2UUWA 3ISND 2VG7A 4F4ZA 3ISNC 4U7CA 3DLGB 2XGQA 4ED2A 4ICLA 2W9CA 2FVRA 2GIQA 5KFEA 2ASJA 5C24B 1J5OB 2HNZA 3CJ0A 4IOBA 3KHLA 2XCAA 1S6QB 1N6QA 3GIMA 1IKYA 1DTQA 3MEDB 4I2QA 1RYSA 4NLWA 4RUAA 4ZPCA 2HWIA 5F8LA 4IFVA 4ICLB 1XR5A 2WCXA 3GIJA 2IM2A 4QWCA 3H5UA 2W9CB 4JV1A 5F8NA 2HNZB 3DLKA 4QWDA 4ED0A 4H4MA 3LP2B 3KLEA 4RW4A 1SH3A 3MR2A 4YR0A 3JSMA 5J2NA 3M9MB 1IKWA 1DTQB 1RYRA 3LAKA 4I2QB 4URGA 3H40A 3G6YA 5EWGA 4ECQA 1TL3A 4NRUA 3DOKA 4Q0BA 4RNOA 1RTJA 3DYAA 4U6PA 4IFVB 2C2DA 3KNAA 3H5SA 1T3NA 4LSNA 3M8PA 4MK8A 4RNHA 4ECUA 4ECYA 4RW4B 2ZE2A 2R2TA 1RDRA 2R8KA 5J2NB 5KFBA 1RT4A 1JLGA 1EP4A 1LW0A 3DI6B 2D7SA 3V6JA 4MFBB 3T1AA 3DOKB 3CDUA 4ZVHA 1TVRB 2YNGA 3DRRB 2WOMA 5J1EB 4LSNB 1JKHB 3M8PB 2HMIA 2WK4A 5KFTA 4TQRA 4IRKA 5EWFA 2ALZA 1RT4B 1JLGB 3PZPA 3BGRB 1EP4B 1LW0B 3HVAA 1VRUA 3KHRA 2IAJA 4IFYA 2FLNA 1RT3B 1LWCB 2XC9A 5D3GA 3KLIA 3T19A 2HMIB 1LWEB 5KFJA 3H98A 3LP1B 4O3PA 2IA6A 1EETA 3QYYA 5KG6A 4WFYA 4NLUA 1VRUB 2QV6A 4EBDA 4PQUA 2ZD1A 2IJFA 1ZETA 5CYQA 5CYMB 4PUOA 3KLGA 3NKYA 2YNIB 4IDKA 3NL0A 1ZTTA 3CO9A 3PW0A 2OPPA 1BQNA 4KV8A 3KLFA 1QAIA 3H5YA 4Y2AA 4PWDA 4YP3A 4LQ9A 4IH5A 5L1IA 3KLGB 4IDKB 5HBMA 3TAMA 5DLFA 5J2MA 4IG0B 4TY8B 3QIPA 2OPPB 4KV8B 5C42A 3UDLA 2BRKA 2YNHA 1SH2A 3OLAA 4I2PB 3CWJA 1Z4UA 5F8MA 4ED6A 2YKNA 3MEEA 4O3SA 4R5PA 5HBMB 3TAMB 4B3OA 1TQLA 2XI3A 5J2MB 2CKWA 3V6HA 2HNDA 3DRPB 3IS9A 3KHHA 2W8KA 1WNEA 5DG7A 4KO0B 4K4VA 4J9QA 2BANA 2R8IA 1N5YA 4EO8A 3MR6A 3LANA 2W7PA 2YNHB 4RW8B 3PW4A 3OL6A 2FJXA 3HKWA 3KLVA 3RBEA 3LAMA 2YKNB 3MEEB 2CJQA 1S9EA 4ECRA 1C0TA 2I5JA 4IRCA 4K50A 2AGPA 3IS9B 4XO0A 1JX4A 5KFZA 4RW9A 3QZ7A 2BANB 3DOLB 3LALA 1N5YB 3MFHA 4ECZA 3V6DA 4NCGB 1FKPA 1S1XA 4DL7A 1N56A 1S9FA 4WFXA 3BQ2A 2C28A 1QE1A 4KB7A 3BSCA 2WTFA 3EPGA 2AGOA 3ITHA 1KHVA 1T05A 1UWBB 4XPCA 1T94A 2IJNA 4RW9B 4KHMA 1HQEB 2FVPA 3CDWA 4KE5A 4NLVA 3V6DB 1NHUA 1S6PA 2OPSB 4NLQA 1S0OA 3C6TA 4NYZA 2V9WA 2R8JA 3CIZA 4R8UA 2RF2B 4FS1A 4NLGA 2V0NA 5KFFA 5KFQA 2VG5A 1IKXA 2OPRA 1C2PA 1RT2A 1YVFA 1LW2B 1NHVA 3DDKA 4NLYA 2UVVA 4YR2A 1S10A 4MH8A 1RTIB 2B5JA 3FQLA 3GV5B 4R8UB 3RB4A 4ZMMA 3GQCA 1S1VA 2W8LA 2VG6B 4EYHB 3EPIA 3D28A 1HYSA 3MEDA 4WXWA 5KFPA 3BQ0A 3LP0B 1S0MA 4EBCA 4EEYA 4FBTA 4Q8FA 5KFCA 4NRTA 4K4XA 2B5JB 4RU9A
chains in the Genus database with same CATH superfamily
3N6LA 2ZDOA 4B9VA 2B4PA 2M9KA 4C9DA 4O3QA 4DI6A 1PBUA 2NXUA 3R3TA 3PR4A 1RXOB 3PEHA 2DNGA 2XHCA 1CS4A 5LSLA 2FLLA 4JI3F 3LO3A 4G65A 2GVDB 1V6HA 2JX2A 1AZSA 2OTLS 4XAKA 3BS9A 4I6YA 1FKAF 1Y3JA 5CYMA 5I3UB 4L73A 4TXSA 1M1HA 3M8SA 1JB0C 3R6LB 1XMQJ 5BR8F 3OLBA 1JLBB 2BE7D 3CTRA 1X4DA 4GC6A 1CEZA 4RW8A 3JYTB 1WSRA 4WK1A 4KGVB 5BYQA 2MY8A 2RQ4A 3GIIA 2BJEA 3AODA 4MKBA 4WKRA 1XMOF 4C8LA 3D6HB 2W4PA 1PJ5A 3CJ8A 2BM1A 3BM7A 3G6XA 2DNYA 2MKYA 2AIRB 2G2YA 2KT3A 2P6TA 3CD0A 1TAUA 2J6SA 2ROPA 2Q43A 2DGUA 5J2PB 4LIWA 3KG1A 4FYVB 3P5BP 2DRBA 1XBWA 3P45B 4C8ZA 2MQNA 2B0GA 1OO0B 3NGRA 3K0JA 3KK1A 2JFKA 2WVDA 4ZOSA 5FDLA 1O0PA 4FBUA 3ENQA 1R0AA 4FZVA 1D9AA 3G6ES 2QZ8A 1WKJA 4RW7A 1D8YA 4F4XA 4LR7A 5FLXY 1QSLA 4DUZJ 5GADU 2VPWB 1TK5A 1FK9A 2AJ1A 4U96A 4OYBA 2XB2D 4DUTA 2K1RB 2C1EB 2KKHA 3IA0A 3TW0A 4DDFA 1WF2A 4OJ1A 2IM3A 3THTA 2ZH9A 5KFLA 4A8WA 4CQ1A 2VA2A 3GJSB 4OI0A 1HFEL 2OLWA 1HNIB 2E5GA 1RAHB 1T11A 4UT4A 1FWPA 3SFGA 1TKTA 4M95A 2MLXA 4F8RA 2UZAA 1FRIA 4C4WA 3Q2SC 5AXMA 3CCJS 3B78A 5C25A 4PG8A 2UUTA 5K5MA 1U2RA 4LSLA 3CCZA 3OR2A 3FUYA 2GS8A 4DLEA 3EDRB 4AQYF 2IBKA 3QT6A 3M9OB 3MR5A 1MG7A 3EE3A 2BZ2A 2MLZA 2RSQA 3QGHA 4WE1B 4M5DA 1N34F 1HI8A 3FSXA 3F41A 1SJ4P 1HBUB 2O66A 3RAMA 2R7TA 4L74A 2BUNA 2Y3YA 2ASJA 3KHLA 3HFZB 4LRAA 3EYZA 4RUAA 2DCUB 2HBRB 2DEIA 1TZ0A 5IWAJ 2NCKL 4UOHA 4F4KA 3DOKA 1LWXA 1JLGA 4HH0A 2MQ8A 4PPZA 3HHEA 1T9YA 2LQ5A 3KHRA 2AHOB 4C98A 1FXRA 3KLIA 2B8PA 1QUPA 3SIPB 2IA6A 1XNRJ 1EETA 4PQUA 1WC6A 2DO4A 3PYGA 4LFBF 3TUZC 2VFUA 1B0VA 4C8YA 2VF3A 4JI2F 3LH2S 5I4MA 1WOOA 2EPIA 4I2PB 2RILA 2BVZA 2LQBA 2CPIA 2CQ1A 4CYUA 1RISA 2BANA 3VGSA 1SI9A 4DF4A 2WAQD 4ECRA 2KJVA 5KFZA 5H9EJ 2P8IA 4USKA 5HANA 4DFKA 1EARA 4QR2A 3MUVP 2YQ0A 2MKSA 1M90T 5M2RA 4FS1A 2KHDA 1IBLF 2J9DE 2VB6A 1RTIB 2R7WA 1VQ8S 1AT1B 1OIAA 3I55S 1SJRA 3LP0B 4K2XA 4RU9A 4WP8A 1RWVB 2VBWA 3MM8B 4BWJA 4F4AA 3TUPA 1QAXA 3CIMA 1Q16B 3ZTRA 3QRPA 5KFNA 1YI2S 4XIUA 3KG0A 1T9TA 6FD1A 4J9OA 3FEXB 5HMYA 3EUNA 4LRBA 2VDHA 2CPFA 2KM8C 1SKRA 1U1QA 3UVJB 2FJEB 2XMKA 3DOMB 4IQMA 1UEUA 4C11B 4DOZA 4YB5A 1NKCA 3PJWA 4Y2CA 2DXDA 1G3OA 3C46A 1X9SA 3IN5A 4X4UA 2OGUA 1HNVB 2CPYA 3BYRA 3GSDA 1IM6A 3WZ0A 4H4OB 4LUBA 1YBAA 3NNCA 2ZBIA 3FEYB 2AEJA 3B8HA 2IA0A 2FC8A 2Z56B 2OFGX 1S49A 3M8WA 1VBXA 3I4PA 2PEBA 4IH7A 4G1PA 1KFSA 2MZRA 3GFHA 3VWSA 1VJQA 3QSIA 1YX2A 2E5LJ 1P8GA 1X4FA 3AHPA 3MECA 3B6BA 2K2PA 1S1UA 2C2EA 1KC8T 1TL1A 1VQYA 1SV5A 2HHVA 4CTAA 2IC3B 2J0QD 3GJTB 3BO3A 4J9VA 1SJQA 2FDNA 4P74A 3DMJA 3CJ4A 4IR9A 5KG1A 4P71A 4OI6A 1DQAA 2R7RA 4CH0S 1HHQA 2R2RA 4UF4A 5B0BA 1TL5A 4J9PA 4OI4A 2XGPA 3UI3A 3DLKB 4DQRA 3MCNA 4WKYA 4P10A 4WK3A 2ZUAA 2DRDA 2M8DB 3DRYA 3CXCR 4FF2A 4LF8F 2FLPA 3OR1B 3PHTA 4ECXA 2VFRA 3RG6A 4NA1A 1SVDA 1XNQF 4ZVSB 5JVGQ 4HVZA 2W9BA 2JRSA 2DNMA 5EUHA 1O8BA 4F0KA 4IG3A 1RCOB 3DNCA 4LIRA 1MROA 3EVWA 4EO6A 1S76D 1HBOA 5C5JA 3QAEA 2VQEF 5LM7E 3D3BJ 2VODA 1TKZA 4ENOA 3TZZA 4B17A 2XY5A 4D3GA 2COLA 4X65J 4LBPA 2I5JB 4LFCF 1MWYA 4B3RF 1RTHA 1WHWA 2B6AA 1IBMJ 3W2VA 3GR1A 4PXEA 3VAFA 4OQJA 5F9NA 2LXUA 2HLUA 2RMLA 1NPKA 4KHPF 3T9NA 3RR8A 2VG7A 4F4ZA 3T9ZA 4K2JA 3G9CA 3CJ0A 4IOBA 1FNOA 1N6QA 3F73A 2KG0A 4CWBA 3P6YC 1KVIA 2DT9A 4I2QA 3HO1A 4CO5A 2W9CB 2DNPA 3I9ZA 2NUHA 1Q8KA 5J1NA 3H40A 5EWGA 2JFDA 3DYAA 2C2DA 5FLXU 2Q6CA 4RNHA 5E3AA 3HZEA 4RW4B 5HL7Q 1RDRA 3BB5A 3VAHA 1RT4A 2GVZA 1NK6A 2PDAA 3M8PB 1K9MT 2XULA 1R8PA 2V4JA 4AUKA 4DFMA 1QJHA 5D3GA 3ETOA 3PYEA 5LMNJ 4LRFA 2QV6A 2HFUA 5IXUA 2BOPA 1WC4A 4DQIA 4PYAA 5J2MA 3AH6A 3S7RA 3CCUS 2OPPB 3K59A 5C42A 2BJDA 2BRKA 4ITSA 1BY9A 2QLJB 4EI2A 3GG0A 3D6MB 3IAS9 3LANA 3O1LA 3OL6A 3MEEB 2F4VF 2GGPB 2Q1LA 4OX7A 1Z2LA 3M05A 2PI4A 2F63A 1WKLA 3UFCX 4TU7A 5K8NA 3AB4B 3C6TA 1ZAXA 4ZJQA 1IKXA 4HI2A 4MH8A 2QN6B 4B3MF 3TA1A 1AROP 1GFWB 4HH1A 5K8MA 3IFEA 4EBCA 4FBTA 4ETZA 2QLFB 3EGNA 1NCLA 3WC2A 4I0WA 4OYMA 2XMMA 4E0DA 3T1YF 4HDHA 3VHQA 3EXCX 2KU7A 1S6UA 3H59A 3IWXA 4ECSA 4DV3F 4FNIA 2VKZG 2XCPA 3Q89A 5I3UA 3HFKA 2XY6A 2D1CA 2ROGA 2MQQA 2FHJA 2DGOA 1RGVA 2J0SD 2JHEA 3PIPQ 1WSVA 3QZ8A 5L39A 4A8FA 1FXDA 2B4OA 1JLBA 2P6SA 5KFGA 3IG1B 2M8HA 4ZN3A 4FS2A 2EFOA 4NEZA 1QLNA 3JYTA 2PMWA 4TN2A 5G4DA 1UVLA 2E44A 3HK2A 1YJNS 2PA3A 3PXGa 4J37A 2HVDA 1FDAA 3LOUA 4NA2A 2D3ZA 3PX6A 3EZUA 1MWQA 1U02A 4A8QA 1YWXA 2E5IA 3HFVA 4G1QB 3QQCD 1CJVB 4FN5A 5DZ7A 4LFAJ 2ATCB 3DLEB 4TLQA 2K3IA 2HHTA 4L6V3 1KBRA 3AAWB 1UP1A 1FT8A 5LXYA 4LF6F 5IM0B 8ATCB 3A1YG 2KHCA 3CC7S 3RB0A 2VV5A 1BC6A 2CDRB 2AD9A 2XMVA 3BZQA 3FBEA 4P2MA 1K1QA 4MTPA 1HW8A 4NLTA 4BHQA 2AX1A 3RBDA 4ZP7A 4Q45A 2RIJA 1DJ0A 4AD6A 2K7JA 5FJ4A 1NB7A 2CXEA 2XZTB 2K1RA 4FPRA 3MGJA 1FEEA 1WDTA 3M6WA 1R0BG 4CLUA 4GKJJ 2E9RX 5KFMA 2G0JA 4ZIVA 1PYSB 4H54A 1W7WA 2PC6A 4BS2A 3Q83A 2AZ1A 4PZVA 1GQEA 4RR5A 3DM2A 4HDGA 4ED8A 4D3HA 1HNIA 4FXVA 2PI5A 3DLHA 3NBPB 1L3KA 4ETXA 2BDPA 1WORA 4IUFA 2HQCA 2DHAA 5I42B 1SQGA 4RUBA 2XO6A 4N41A 5EDWA 4L3NA 3CO0P 1NDPA 3HULA 3C6UB 5D4NA 2V4QA 4R5PB 3BKTA 1KN6A 1NB2A 4ZS6A 4BCAA 2IVYA 5HN0A 5KFRA 3R1LA 1S48A 2CJXB 3BV8A 5IT9Y 1P6TA 1H7WA 1UPPA 3NS6A 4WE1A 2ADBA 1VQLS 3GIRA 2CVEA 4QQBA 3ITHB 3PTWA 1M5PC 4RLEA 1S6PB 3IWNC 3T5LA 2VG5B 2DIUA 3ISND 2E1PA 4WWSA 2GIQA 3R1HA 5C24B 4P7VA 2AF6A 1RYSA 4CI0B 4OHZA 1NKBA 5F8LA 3GIJA 1JQGA 5LJ3Y 2DY1A 3NWGA 2CQ4A 3MOJB 3M2UB 1U0HB 1N5VA 1M5SA 2IJRA 4MK8A 3M2RA 3RW7A 1S4EA 2HEKA 2CDQA 5HO4A 3CD6S 2X1GA 2BMBA 3CCES 3W9JA 2EFNA 4USIA 3VZHA 5ETRA 1X4HA 1VQSA 2XS2A 1LWEB 1KFDA 3LP1B 4DZDA 4NLUA 1F5CA 1F2GA 4YB6A 3NKYA 1T9XA 1Y0HA 1RLCL 4C97A 2QGFB 1FD8A 4MKYA 4IG0B 1XQIA 1TKDA 4JB8B 4B3OA 2XI3A 1FFWB 5BYSA 1SIZA 2ZH6A 2X7IA 2G4BA 2E5HA 4CNYA 2HURA 2C28A 1QE1A 2AGOA 2V2QA 5D0HA 2LEBA 4NYZA 2A3JA 2YQ3A 5KFFA 4L75A 4RBUA 1RT2A 4HI1A 4JI3J 1VCTA 4EYHB 3EPIA 3HF5A 3J7YU 3MM8A 3R6GB 4PG5A 1U6BA 4DU8A 2HS4A 3GONA 3BF4A 1VQPS 2GJFA 2CVIA 1WOPA 3OQ2A 3JTPA 1YLXA 2CQGA 3BH6B 4HR2A 2ZM6J 3BSOA 2DEJA 1PJ7A 4MFBA 4ZJOA 1IQTA 2KVIA 2HKEA 3KLHB 4Y2MA 2MQPA 4DV1F 2VKRA 4X4PA 1DTTB 2QE5A 4F25A 1N33J 5A2QY 1UL3A 3DGVA 5E3CA 3ILJA 4X2BA 1K44A 2RDIA 2CQ3A 3DOMA 1VQ6S 4OHXA 3MXHP 4C11A 2LEPA 2Y1JA 2HQGA 1U1NA 2W2QP 2XMWA 4O3OA 4ZVTB 3HVTB 2DNLA 1V3ZA 4JI0F 2CZ4A 2RAQA 1ROFA 2LMIA 3HHKA 4YY3F 1GX6A 4QIVA 3GB0A 2H9ZA 5KOWA 2ASDA 4ZPVR 1GXLA 1NU4A 1M5HA 4U8YA 3FZ2A 4OX9J 3JSYA 1FFSB 2UV8A 1FKOB 2Y0BB 4MK9A 4DL5A 4MT1A 4DQPA 3IO1A 2ZOFA 3G2XA 2R7UA 2FTRA 3E8OA 4CM2A 4OHVA 4NXMJ 2PN6A 1B99A 4IYQA 3DU5A 1VRTB 2AJ4A 1RA6A 2W2OP 2PD1A 1U8SA 4NLDA 3QIDA 4KT0C 1IR1A 3FBBA 4KIAA 1R27B 2IIHA 1QDUB 1TTHB 4R0EA 3L09A 3ENVA 1SKSA 3L7UA 1PC4A 3A8EA 1TKXB 3F0NA 1FDNA 3ETMA 1A6LA 2V8HA 3N0VA 4A46A 1RWPB 4ECWA 2M7SA 4FYWB 3GFXA 2CJYB 2D3O1 3TQ1A 1HR0F 1OJ4A 4H4MB 3CMAS 1FCAA 4GVBA 4Y0FA 2UVWA 2DISA 3OSPA 2RNEA 3OR1A 3IM9A 2VBXA 1KD1T 3B4DA 1Y00A 1JLAA 2K3KA 1FJGJ 3SCKE 4F02A 3BJYA 1NO8A 4DXLA 4H4KA 4LRDA 2M5YA 4AQYJ 3MMAB 2DNRA 2Y8YA 4QCLA 3CDAA 5B0AA 1H2UX 5KFIA 2M3DA 3T3FA 2NREA 5E3QA 3SCJE 4XTTA 3BGLA 3H90A 4ZP8A 1U2FA 3C16A 2JLFA 1V3SA 4NLRA 2HS3A 5KFSA 1R89A 1M1KT 1LXJA 1NNDA 1S9EB 2QFJA 2UV8G 3MM5B 1S9GA 2EWHA 3OSNA 2EFVA 2P5VA 1PYOB 2HVHA 4DF8A 1QD1A 1VR6A 3D1QA 2W9CA 2CRLA 4M5KA 1IKYA 1DQ8A 3LWLA 3D6TB 3V4MA 2ALYB 3TUIC 4ERDA 4PPDA 4RW4A 4JV5J 1IKWA 1RUSA 4ECQA 4CLYA 1AA1B 4IFVB 4LFBJ 3KDOA 3M8PA 1WG4A 3OD2A 2YNGA 2XSJB 3W9HA 4OZNA 3NG8A 3BGRB 3OUYB 2CAJA 3HJFA 1U1MA 2P9CA 4O3PA 5CHCB 1VRUB 3BKFA 5CYQA 2GMHA 3CNQP 1EKRA 5K8OA 2OPPA 1BQNA 1G4CA 2KFYA 4TY8B 2UXCF 2K06A 4H4KC 3MEEA 2HK2A 4DPUA 4OZLA 2XG8A 3QRQA 2NZCA 3PW4A 3HKWA 4ELVA 3KLVA 1VHIA 3DOLB 4EMDA 4N7TA 1S1XA 2HHWA 4OV1A 3NCPA 4XPCA 3HHDA 3UR3C 2FVPA 2CPEA 3V6DB 3UNYA 4K5RA 1NRKA 1WC3A 3BBCA 4NLGA 1RWNB 3BR8A 5ETQA 1S10A 3PM9A 4G6VB 4JP8A 1T3OA 5IT9U 3W64A 3DGPB 3ZZPA 4JI1F 1L3UA 4DR4J 2EW9A 3AY0A 2FLOA 1WEYA 3TRGA 2I8EA 2L41A 1UPMB 1IKVB 1UW9A 2IDLA 2BKPA 1HNXJ 2GV1A 2FPHX 4J7CA 2VICA 1M0SA 1WACA 5KFDA 4K4SA 3HM9A 1BWEA 1LWCA 2UUBF 1DURA 5KFXA 4UUWA 3SV3A 3ILLA 2M88A 2MDAA 2ZVSA 3R27A 2QSFA 2A6MA 1S79A 5IOLA 3RAQA 1FDDA 1NK0A 1XN9A 1EKSA 2ILZA 2JLGA 3TZXA 5SZTA 2LDIA 3D6FB 4M63A 2IPOB 3E01B 2AGQA 5F0WA 1TAQA 1RWUA 4FF4A 1OWXA 4OYXA 2R7SA 4JI7F 3MURP 4NCGA 4JI6J 2IM0A 3FCHA 3AT1B 2R4FA 3QT7A 2HQDA 4G1QA 3FJ2A 2CQPA 1YDLA 2G13A 2J9DA 3DLEA 1FA0A 2NXEA 2PIIA 4Y28C 1LXNA 1RAFB 1T7PA 1ZM9A 3K5OA 1U1KA 2BKOA 1U24A 3DKDA 2RU3A 3KWMA 3OTCA 3PKYA 4AXJA 3PVXA 4URQU 2FJAB 4I6WA 4DPTA 2AQ4A 2J9CA 3I0SB 3CCWA 3QWUA 2AYMA 5KG4A 1CQMA 5A8WA 1H38A 2YNFB 1IR0A 1JLEB 2BACA 4WTYA 2XEXA 3P49B 3C15B 3T6JA 5IFMA 2FY8A 2IBOA 4QPXA 1RHUB 4I7FB 1LNQA 4RZRA 3BGUA 5DDOC 4P6QA 2FC9A 4QYZK 3HDSA 4CLFA 4FYDA 1Q1KA 4Y00A 5E3RA 5HP1A 4F26A 1PKUA 1TL3B 4OMFG 1FF2A 4ZVRB 4F4WA 5U47A 3BREA 5D0EA 2VQEJ 2NSCA 1MNEA 4WFZA 2GQ2A 3R5AA 2YKQA 5KTQA 3NBPA 2DNNA 1S97A 3NNHA 1X4BA 3MCOA 2KXHA 5I42A 2QFIA 2XS7A 2D41A 3MR3A 3C6UA 1HBMB 2FVSA 3LWMA 4OX6A 2JEJA 2L9NA 3WBZA 1EAYC 1SKUB 3T41A 4J9KA 4KHPJ 4GC7A 1ULRA 1DAXA 4R25A 2HFVA 3I56S 4DV6J 3QJJA 2ZKUA 5CZXA 2ZH1A 1MU2B 3PW2A 4DL6A 3PJ9A 4WZQA 2DBBA 3V6KA 4KY3A 2EFQA 2RRBA 1YIJS 1O6XA 4DR5F 2EC0A 1RSCA 3DDIA 2AEMA 3MPVA 2IYIA 1JJHA 1L3SA 3NGDA 3CJ5A 5H9FJ 4ZHRA 3AFGA 4MIAA 3FQKA 5C24A 2CQBA 1RT6B 4ED4A 1WD6A 5MAOA 2FZKB 2JOQA 3CT9A 3M2UA 1U6ZA 1U0HA 4JV1A 2E1RA 4ED0A 3LTOA 4YB1P 2POKA 3GFZA 4RNOA 1WHYA 4NASA 3ILIA 1QY7A 1YITS 5KFBA 1WKKA 1CS4B 2ALZA 3EX7B 3TUJC 4IFYA 1FX2A 1XIQA 3T1HF 1TL7B 4DN0A 2UUCF 4EBDA 2J0WA 4KGKA 5CYMB 2D9OA 1R8AA 1FRJA 2QA4G 3OJSA 1M1GA 5EN1A 2IVMA 1EX8A 3I6PA 3QIPA 3OTOJ 4IO9Q 3R8YA 1AFJA 3CWJA 2WSCC 4B3MJ 4RW8B 4QJVA 1SIWB 5G0RB 3ZNUA 4GKKJ 3IS9B 1GMWA 1AFIA 3QZ7A 3NRBA 2FIUA 3TWZA 4L76A 1KHVA 4PG6A 2LQ8A 3VZIA 3ELHA 3VAJA 5ITHA 2HVIA 2KN4A 1S7HA 2OPRA 2OSQA 3H0PA 1SL2A 1SJ1A 4ZMMA 3GQCA 2CNKB 1K8AT 3CD5A 4PXDA 3MEDA 1S0MA 4CO2A 2CQIA 3HP6A 2VPYB 4AFFA 3CPWR 3ISZA 3CJQA 5B0DA 3PDNA 4RBTA 3RU0A 3KK1B 5FDLB 3KLHA 4ANEA 1HWIA 4PABA 2OUGA 1T02A 1TVRA 1HKAA 3POTB 5J2QB 2CJAA 4LF7J 3L4BC 1WHXA 2P9EA 3MPUB 5LSOA 4ZVQB 4RUHA 1FX4A 5JUMA 3CCSS 3DHWC 3MAQA 4J9RA 1U09A 1FK9B 2ERRA 1K0VA 2R7XA 3X1LB 2C2MB 1L3TA 1R43A 1QAJA 1QUVA 1RAJA 2AJ2A 3DRPA 3VQSA 3H2VE 2FUG9 5HAOA 4NZ0A 2AJQA 3UE2A 4LF9J 5F8GA 3ZTPA 5DDQC 1FKOA 5HMXA 4DSLA 4OHYA 4F4YA 4U7UK 1UWBA 4A8YA 4WCEQ 2GC8A 2JVRA 2OPSA 4RBVA 1UMJA 2W7OA 3QMQA 1URRA 4UZBA 2EFPA 2MY7A 2B51A 4ZA1A 5GAGU 1JXLA 5EWEA 4B9LA 3QBCA 1N48A 1XEZA 2RKIB 1VRTA 2QMWA 2QMUB 2MKKA 4EZ6A 5GADI 4FP9A 2NLWA 3U1LA 2LCWA 1WF0A 3KK2A 1KTVA 3PRDA 3J7Z5 3W1YC 4LSLB 2BKNA 3KUGA 4MYUA 4USWA 1BXNA 3CE8A 4J9NA 4XPEA 2V4RA 3G4SS 1KQGB 2WONA 4WU3A 2ZEJA 3AXKA 4NE9C 4OZ1A 1F5BA 2CQ0A 2C2NA 4K59A 1PCAA 1ZS6A 3QFWA 4J9SA 2LVWA 1TU0B 1QAYA 4B08A 4TU8A 2CPXA 1CJKB 2GW8A 2OPQB 3M8QA 1UJ4A 3OTEA 2DK2A 4CZCA 1VQNS 4W98A 3CJKB 2R8GA 1HWKA 4ER8A 3IR7B 4IO1A 3EZ5A 4NLPA 2WRMA 5HI7A 1S1TA 2C2ZB 1YRXA 3KLIB 2MZTA 1OSCA 2I2YA 2J0XA 1TP7A 2IFXA 3FCWA 3N79A 1EETB 2F9JA 3J81j 5H9FK 3CB4A 4PQUB 2QL9B 1KR4A 2V8PA 1BQMA 2DH7A 3KNGA 3WIUA 3OTDA 1S99A 1X0FA 4J9MA 3FC9A 1MMNA 3QT8A 3LPYA 3ICLA 4CYUB 6AT1B 4YQWA 3A13A 2GHVC 5IT0A 3QJPA 1XC9A 4ILRA 1MW7A 3W3SA 1CC7A 4ANDA 2CADA 2HNYB 2ZC3A 1RABB 3NXZA 5CH7B 3N6NA 3TEGA 1URNA 4ZVFA 1W2IA 2A10A 2Z2ZA 3IRXB 1UFLA 5ETTA 3M2VA 2XMAA 1LOUA 3H7HB 4UTGA 1ZOTA 2E7XA 4JYAF 1P9YA 4IFVA 1TK0A 4KR0B 2FHKA 2PGCA 4C0OC 4LVNP 2XSJA 1ITPA 2KB2A 4HT5A 2R2TA 2ZHAA 1KSPA 4CO0A 3EICA 3T1AA 3CDUA 2Y8WA 5A6WA 2WOMA 2WK4A 1T9WA 1CULB 4X4VA 1MSWD 2MLYA 1LW0B 1VRUA 1E6VB 3W5YA 1SBRA 1BLUA 2YWKA 2MJUA 3S8SA 4M5GA 4UOCA 2EKNA 2F8HA 3NL0A 4K0KF 2XO7A 3CO9A 3QGPA 1IJFB 2XMUA 2QL5B 3SV4A 2OHDA 3NS7B 1RKJA 2XLJA 4R0JA 1NSQA 2FJXA 5B0FA 2CNNB 1LFWA 3KJNB 7AT1B 1RKIA 3O5TB 1M5KC 3V6DA 3CC4S 3Q8UA 3MM9B 3ZTOA 1RK8A 4RW9B 4LT6A 1W26A 3N9UC 1Q82T 1Y9OA 1RAGB 4NLQA 1OQ3A 1AUSL 1X8DA 1NK4A 2MQLA 3DGPA 4DR6F 1YVFA 4JI8J 5BYRA 1RWOB 3IBCB 5EHHA 2HK3A 1P1LA 1D3WA 1HBNA 1VK8A 3BPSP 3DLLQ 4NRTA 4CNZA 1UA1A 3OV7A 3LP2A 2AKWB 1OY9A 5ETMA 3K2YA 2V94A 1C4AA 1V5VA 3G82B 1ZM3A 4KGXB 4J9UE 3MECB 1YSJA 3BR9A 1VGYA 4QIGA 5J1EA 3HD2A 1JKHA 2JEIA 1R0CB 4YY3J 4B3SJ 1KVKA 1DARA 4GO7X 1I94J 3R5BA 2ZH7A 3DHXA 1APSA 4KFBB 3DMJB 2MHEA 3IR5B 3O2IA 2CPHA 5DQHA 2RRAA 2O5DA 2MZSA 2BE2B 4TY9A 3E01A 3IGNA 3BYPA 1XWLA 4C3KA 5B0EA 2MKHA 1RAOA 2W2PP 2FJWA 4DR2J 1UEVA 4DS5A 4ECVA 4ED1A 2HPUA 1X5OA 3RRKA 1TV6B 4M5NA 1IUJA 2OKQA 2W9BB 1OS5A 4USMA 4P2SA 5C2GA 3BEGB 3NMRA 1X4GA 2AU0A 4IG3B 3OFFA 2OO4A 4KH1B 1D09B 4B9UA 2VL1A 2AP6A 1TUGB 3LGMA 2NYHA 2LA6A 1KLMA 4DL0C 2V9KA 1Q8IA 3H4DA 2YQ1A 1JLEA 1RWMB 2UXBF 1RTHB 3C15A 1I51B 1N88A 4ZPAA 1UZDA 4I7FA 4L3KA 4OZJA 2A2CA 1AW0A 1HNZF 2R7QA 2VG7B 3M9NB 2VQFJ 3MWBA 3N28A 1N6QB 2ZJPQ 4X4NA 2YKMA 3AA9A 1RAEB 1WI6A 4ZKAA 1HI1A 3FSYA 3J81Y 4B9SA 3DYAB 4DUYJ 5LXRA 3NS5A 2GVZB 2NXNA 4B02A 4ZPWR 1PILA 1RB0A 2P2CB 1DLOB 2FJDB 1WHVA 2DHGA 2V4JB 3OXLA 4LMZA 1VYAA 5D3GB 1FJ7A 3D5MA 3JXOA 2W1BA 2QMXA 4HKQA 1T95A 1FRHA 3BQ1A 3I5AA 2UVUA 3SI8A 4WYLA 2JEGA 1REVB 2PMZD 1XMQF 3V4IB 5C42B 3L7OA 4JUZA 1MU2A 3SSQA 1FJEB 3RRGA 2DYAA 3U02A 2C2RA 4OI2A 3SSSA 1Y10A 2N4DA 4P2FA 3G6VA 4HL9A 3P8BB 3I0RA 4KJIA 5H1SV 5GMEA 2G2ZA 1RT6A 2HIQA 2DNOA 5A0YB 5DJBA 4KH0B 3C6TB 3CMQA 1FNXH 1IKXB 1T8EA 2R42A 1SC1B 1RJJA 3K5MA 4MMOA 4QBUA 3JAMY 4WJBA 4DV4J 3KDNA 1JNZB 1RHMB 3RZAA 3E2EA 1X5PA 2K8GA 4LREA 5K9FA 4F7VA 1NSPA 3DFEA 2WCXA 2ZHOA 2G9OA 5BJRA 4Q0BA 3QATA 3D1OA 4CLKA 1RZMA 1OMSA 2ZE2A 4EFAC 5D4OA 3D1HA 3OJUA 1TL7A 1U48A 3HVAA 2IAJA 3DU6A 3T19A 3I82A 4DUZF 4OX8A 1BWVA 8RUCA 3RRHA 3HJVA 4PUOA 2V8VA 3H8YA 3C66A 1RBOB 2B9YA 3H5YA 1SJFA 3VR1A 4DN9A 1YRTA 5HQ8A 5DLFA 2A18A 4USVA 3OXGA 2DH8A 2Y0SD 1SH2A 5G0RA 4A47A 3TAMB 4P73A 3IS9A 1VIOA 2M0GB 1RE1B 2Q66A 4XO0A 1R8HA 1N56A 4FXWA 1F2HA 4KHMA 2V9WA 4AT1B 4UZCA 4X4SA 1FRMA 3H25A 1NHVA 3DDKA 4AL5A 1UWAA 2UVVA 1R6VA 5HJYA 2UUBJ 3SQGB 4HACA 2FHOB 3BQ0A 3F44A 3FZBA 3ZZUA 1E6YB 4A8OA 4OLPA 3UD5A 3POTA 5J2QA 3M6UA 3S6EA 3A8JA 3PV8A 4ZCLA 2OI2A 1RADB 2DPJA 4F50A 3Q8VA 2DGQA 2HRYA 1NJWA 2H65B 3RAXA 2QL7B 3UCGA 3FMBA 2YX7A 3A12A 2BW2A 4GMKA 3G86A 1FE0A 3GJRB 2WVBA 2X1BA 2B4VA 1GH8A 3MMCB 4DV2F 4NZ6A 1RU1A 3WC0A 3AQPA 3BDEA 2JLEA 1V3RA 1FFGB 3DM2B 3NGSA 3OL8A 2JC1A 1HA1A 3AJDA 2X3GA 1XNRF 1HQEA 3KUEA 1RTDB 4DCOB 3OBIA 4FKXA 2RKIA 3UN3A 4DQSA 1FDBA 3OPKA 4DZ6A 2DITA 1NH8A 3H5XA 1UAWA 3BN4A 2RDJA 2HHHF 4Q2MA 3ADAC 1VC5A 5KT7A 2Z4PA 3UPFA 1VIXA 4KKOA 5KFHA 2XMTA 3RW6A 1SL1A 2C3UA 2ZJQQ 2HHUA 3FK4A 3M32A 4A8KA 1Q8LA 3K17A 2DXEA 4Q44A 3PFEA 2DH9A 2CJKA 3NGKA 2Y1RI 1HPZB 1W25A 3UN5A 1VQ5S 3D0IE 3MAAA 2AYEA 1WEZA 2DNQA 1A0OB 2MHNA 1CJKA 2OPQA 3M1VA 4UUXA 5IT4A 2VPZB 5D8HB 1NJZA 3CCLS 3QRRA 2CWKA 3K5NA 3UCZP 1GTHA 2CQ2A 3CJKA 2OELA 3R97A 3M2RB 3N5FA 1NK8A 4TVAB 3SZ2A 3P3DA 5RUBA 4K4UA 2XWXA 3CJ2A 4OIXA 1GK8A 2HFNA 3PW7A 2KYXA 4QIFA 1FRXA 2JC0A 2DY9A 4WTOB 4WF9Q 5AJ3J 4B3OB 3PJXA 1FRKA 2HNYA 4EU0A 1JIHA 4OYWA 2L48A 1IVZA 1BE4A 1P1TA 2DNZA 3BO4A 1QE1B 3IRXA 1SL0A 4QOTA 1T0TV 2X1AA 4NYPA 1P9QC 4EUVA 4F67A 2CWXA 1JLQA 1RT2B 4E2FB 4P7TA 3BDPA 5E33A 3DLGB 4ED2A 2XCAA 3T1HJ 2G1DA 4TU9A 2O67A 1G1XA 2HWIA 3W61A 3JQMA 4QWCA 3H5UA 3KKFA 1U25A 1VBYA 1SH3A 3M9MB 1NJIT 1ZBTA 4NRUA 4YHHF 2PSZA 3KNAA 2CZVC 4ECUA 1FI4A 1UVNA 1CULA 2KRBA 5J2NB 1LW0A 4MFBB 1E6VA 4ZIWA 3M8ZA 2ASYA 2B7BB 2V63A 2WB1D 2N3LA 2ZBCA 3RJMB 1OY6A 1H98A 3J81U 1CQNA 3G8TA 3QYYA 2X3DA 2ZD1A 2RH3A 4CO3A 1QAIA 1O5JA 5EX0A 5D77A 3U1NA 2UP1A 4NCAA 4GRSA 1TQLA 3TYTA 3EWGA 3ZZ0A 3O6QA 1A9NB 4ZLPA 1LEOA 3MM9A 4HHJA 4NMLA 4RW9A 4GO5X 3J7YI 1UVMA 2PFDA 5AE2A 1YKWA 4WU2A 4PAAA 4DR3J 3C14A 1OY8A 1EB0A 2VFVA 4WIIA 1JXVA 2DCLA 2RT3A 4FXDA 3D28A 4WXWA 2QIFA 3TAPA 3G82A 3PNIA 4O4RA 4EGLA 2RU9A 4X65F 2CNOB 4EBEA 4NXNJ 3BGFA 5ETNA 2GIFA 3PX0A 3D9BA 3THVA 3JAMU 1FEHA 1PAUB 1IBMF 2XSFA 3CEDA 1YHQS 4YR3A 4CDIA 2E1AA 1HWJA 4KFBA 3QGGA 5I3QA 1REGX 3V5RA 4TYBA 1Y4ZB 3KMSA 1ACMB 2BE2A 2ZH3A 2HRTA 3FBFA 2XYPB 4B9MA 3GTYX 4PQAA 3ZZRA 4GVBB 1N36J 4ZPTR 3U7JA 3QJLA 5GMDA 1H72C 1KVJA 4KO0A 1YTYA 1TV6A 1XR6A 4FPIA 1JLAB 5F41A 2VC0A 1WOSA 2MSSA 3DDNA 5IS2A 1IN0A 5LMNF 3QT5A 4CCHA 4DV7J 2JSXA 2XBPA 8AT1B 2C22A 1LW2A 5E7OB 4KC5A 1ZM2A 5CZVA 1FERA 4E98A 4RX6A 3W8GA 1JWWA 2ZZTA 4O4GB 3C16B 3VCDA 2FY1A 3GYNA 2DPIA 4YEAA 1OSDA 3G8SA 4LSZB 4HEA9 1YJTA 4DBQA 3AXMA 5E3PA 2ROEA 4X4QA 3IR6B 9ATCB 3DC2A 2LQ9A 1S9GB 2GO9A 2ZJRQ 3WX8A 2WSFC 3H2UB 2Z0GA 3FBCA 2PEHA 1OPZA 4NWBA 4X62J 4DR7J 4RO0A 3CDBA 3EM1A 2UXDJ 2DJWA 3P4UB 4IQXA 1IKYB 1R31A 5K14A 2ASLA 4Y3CA 2H54B 3KXDA 1IKWB 2LECA 2UU9J 4DMZA 1DLOA 4C8MA 3R7SB 4DSJA 1NLKL 1R7IA 2YNGB 3OFEA 2BRLA 3LQVA 1QVFR 3V81B 4RPFA 4DPXA 3MOZA 4O3NA 3QLHA 4MKVA 2XQCA 3SBMA 1Q81T 3MMBA 2QSWA 1VQ9S 4RW6A 5CYQB 3W2WB 1REVA 3UNGC 5K20B 2AYBA 2XY7A 3UD4P 1BQNB 3V4IA 1S77D 5HK4A 1XR7A 5HROA 3IBWA 1EIYB 1ZH5A 3A3OB 4ZVGA 1VC6A 5T41A 4JYAJ 4AL6A 2RD5C 2DR9A 2FHMA 2LXIA 2EEYA 1H73A 2BOAA 5KT4A 3GYGA 4DV5J 5A0YA 1SUQB 3UW1A 1S1XB 3DRSA 3PKMA 5A6PA 2CFXA 4WZMA 1FD2A 4B9TA 4LFAF 3ISNC 4M8LA 1IQZA 2HW3A 2E1MC 1VJWA 2MYFA 5GVQA 3BN7A 1UZHA 4ZDNA 2HHQA 4CLWA 2QRRA 2OEMA 2GNKA 3NOGA 5B08A 5D6GA 1NJYA 4NI2A 3LA0A 2KZZA 3PCOB 4I64A 3KUHA 2DGSA 4KPYA 4IRKA 2Z30B 1U26A 4DCPB 2GX8A 2XM3A 1LWCB 2DGTA 2FJBB 5HATA 4OYOA 4WFBQ 1Q7LB 4DX5A 5KG6A 1U8WA 4NX9A 1RWKB 1UJ5A 4PWDA 1PYTA 3LGNA 5D0RA 3TAMA 4DR6J 1WTFA 4GKJF 2CPDA 1M5VC 3AD9C 1SQEA 5F8MA 4EWTA 4KYZA 2C3OA 4DU7A 4IRCA 1C0TA 4OI1A 1JX4A 1OPIA 1GEHA 4ZLLA 4N77A 1FTRA 4NCGB 1J27A 1IWAA 1EQMA 2DNKA 2XTJP 3VAIA 5IC4B 1T05A 4WP3A 2Y1IA 4YS2A 2VIHA 5M2PA 2OSRA 3CIZA 4PKDB 3SQGA 4WFAQ 2ZFHA 1I5OB 2GCFA 1F3VA 3FGVA 2HFSA 3DLBA 1X0PA 5A76A 1E6YA 4Q8FA 3VVUA 5KFOA 4N76A 4DLGA 4F3QA 1VLYA 2DGVA 2HYIB 4ZK7M 3EGVA 4V19J 3EJMA 3DRRA 5A8WB 2VC1A 1B7FA 4IRDA 5AT1B 2M2BA 2M70A 4X64J 4K4TA 1RT3A 2EFGA 1QTMA 4O0IA 4CIOA 4C8OA 1CC8A 4B3TJ 3MM7B 2YNIA 1SQFA 4UOGA 1B70B 5B0GA 2EI5A 2QJ3A 4ES1A 5L9XA 1HNWJ 5HP1B 3MMCA 4ATNA 1ZZNA 3PFOA 5CD4H 3T5JA 2R3VA 2VBZA 3IMQJ 4O0NA 2ZH8A 1SB6A 3MF5A 2CPJA 3GG1A 3O3LA 3FKBA 1RACB 1SH0A 4N5SA 2N4CA 4OZ0A 2OEJA 1Z2ZA 3R5GA 2HGNA 4PXCA 3HHLD 2FJVA 3GJQB 4DG1B 4TQSA 1RTDA 4KBIA 2ATLA 1XTZA 3CJRA 4P75A 2RF2A 2UXBJ 5DM6Q 4LF5F 3IM8A 2I1RA 2HFOA 2MKIA 4ILLA 1FNMA 1Y7PA 2LLZA 1WC0A 4KSEB 2D9PA 4G3IA 4NYOA 5DS7A 3GR0A 2VJVA 2VBYA 2IRYA 2ABYA 1LFPA 2WW8A 4YDXA 2YPYA 1YZ6A 2MZQA 1CLFA 3CMES 4ID5B 4UOFA 1HPZA 4AL7A 1U7LA 1PAEX 4HLBA 5L9NA 1NZ8A 4OL8A 2QA1A 1VLOA 2YWEA 3R5JB 3TVKA 3GPAA 4ZHRB 3EMTA 1N32F 3EXYA 5KT3A 4USTA 1HI0P 4JI5J 4A48A 2XI2A 5DDRC 3MTJA 2QLXA 3BSAA 2FVQA 1OYEA 2NR0A 3GSIA 5LMUJ 3F56A 3Q23A 4DFJA 2Z2YB 2IYGA 2ZM6F 1LV5A 1Q53A 3KHGA 3RB6A 3NY0A 1H0HB 2NSBA 2QEXS 4HHUA 2IDEA 1UFKA 1C1BA 4X4OA 2MEWA 1N33F 4IFYB 1Y11A 1S57A 2PMHA 1S59A 2L9DA 2OIHA 3CDEA 2A2DA 5IV4A 1X9MA 1UEKA 1RI7A 4F0MA 1GMUA 3WQPA 1ZA2B 2R7VA 2MZ1A 3QIPB 3UCUP 1X4CA 1KDNA 3FNNA 1ZAVA 3UWTA 3TI0A 3FFIA 2IVFB 5DG8A 1OYDA 3OHAA 4QWAA 2D3UA 3LF0A 4JOUA 2MKJA 3M6XA 3NAHA 5ETOA 2YWFA 2ZNZA 3P5TL 4URSA 4OX9F 2EBGA 3QAUA 1M5OC 4W90B 2DR8A 1UFWA 2RQKA 2JH3A 3DLGA 2C2OB 5D0GA 2OPRB 1MN9A 5LT5A 4NCBA 3GLJA 3RUBL 4LR8A 2ADCA 3NWRA 5JMNA 1J5OB 1DZ5A 1S6QB 1N0UA 2VU5A 1XJWB 4BDPA 2HSEB 2BE9B 3MEDB 1UVJA 4NXMF 1XR5A 4Q2LA 2HNZB 2D74B 3KLEA 2W24A 3JSMA 5J2NA 2F1FA 1DTQB 2BABA 4URGA 2J7WA 1RTJA 4DX6A 5BR8J 7FDRA 3H20A 1QVGR 1TVRB 4Z7CA 3VAGA 2F5GA 2CA9A 5KFTA 4TQRA 3PZPA 1EP4B 1WF1A 3ENWA 3NP5A 1X4EA 1XMOJ 4ED5A 2J8AA 3PW0A 4PXBA 3CULA 2QLBB 5T7LB 1YJ9S 4IH5A 1TL4A 3VAMA 3KLGB 2Q6BA 3DXSX 1VQMS 5ETVA 2HG4A 1RWWB 2ACYA 3DRXA 3DRPB 3KHHA 2MPUA 4J9QA 2L9WA 2YNHB 2YKNB 4PG7A 3MFHA 1N5YB 1FJGF 4ECZA 2XNRA 2BX6A 2ZZNA 3L7PA 2GMLA 3PACA 3OT9A 4NEYA 2OP5A 1UWBB 4I6AA 3O44A 2OPSB 3TP2A 1HL6A 5KFQA 4NLYA 2YXLA 4U67Q 3JSBA 4F2SA 3FQLA 5E0OA 1J2VA 2I6WA 3O8WA 3B4MA 5KFCA 1QSSA 3MHYA 1S4FA 1HQ2A 1S1VB 2BR0A 3Q8RB 3VGVA 3KK2B 1NDKA 3KG4A 2L3MA 4WIQA 5E5NA 4IH6A 4WYWA 2E5JA 2R2UA 2WONB 2X51A 4DV2J 2ILYA 2EK1A 4KAIA 3HSGA 4ZLJA 3G71S 4RJVA 4QWEA 3QO9B 1YK9A 1X31C 4JV5F 3IBFB 2NPFA 3MFIA 3M8QB 2H1YA 4YFUA 1U1LA 5DLGA 3IXQA 1YJWS 4OHWA 3VAKA 2HHHJ 5L1KA 1F9EB 3ET6A 2DGWA 5GAGI 4PR6A 3HPOA 4M5IA 4LQ3A 2AX0A 2YTCA 4C0BA 3GIKA 2XLKA 2VDIA 3HT0A 4TNOA 1S1TB 1G7CB 2QA2A 2H3EB 3ZC4A 1GXTA 4W92B 4QYZJ 4ZVPB 1N34J 3GFYA 1KQKA 1VQ4S 2WHOA 1RT7B 2B3TB 4O4GA 1BQMB 3SSRA 4NLOA 3PIOQ 4LVOP 3NAIA 1L5UA 5KFVA 4DV0F 2JJ4D 3HXMA 2QA4S 5BXIA 5GAHU 2FYXA 4U9RA 2JZ5A 2IMOA 4HTIA 4O44B 3TX8A 4NL5A 4YUDA 1BUXA 3UDVA 4ZP6A 4DEZA 4W4MA 2ZOMA 5C2CA 2E7VA 1B64A 1J5EF 3M2VB 1RAAB 5GAEU 2B56A 4DR4F 4FYYB 4ELUA 2DR7A 4JI2J 2F3JA 3TARA 3T6BA 4RWXA 1HNXF 1JMTA 3NMAA 3BBFA 3SDEA 3VTIA 2KL8A 3V81A 2J7KA 2BXJA 2ZH2A 2WOMB 1R8CA 4N8NA 3CJSA 2E9ZA 3W2WA 4KQZA 3KYLA 4K4WA 6FDRA 2L08A 1HQUA 2JL9A 1IBLJ 5B09A 3GV7B 3PHEA 1WDDA 1W2BR 3MM6B 4M5JA 3TZYA 4ZVEA 2IY5B 2RQCA 1JLFA 3RB3A 4OZ2A 3PY8A 2PA8D 4OJGA 3ZTSA 4RUCA 2GQQA 1SUQA 2OMOA 2V8DA 1CJUA 2GJ2A 4JI6F 4JV0A 4YHHJ 4ECTA 5T14A 1K73T 2B8QA 2J6TA 1VISA 5LSRA 2JEFA 2FB0A 2LYVA 3NLCA 3M30A 2NUUG 4K8RA 2XGQA 1R3NA 2VFSA 3LUYA 2DGXA 1HBNB 3JQKA 1X5TA 2MGZA 3GIMA 2C3YA 2CZ9A 3CCQS 1FVSA 2IM2A 3W7BA 3LP2B 1RYRA 3MEKA 1SPBP 4OJ3A 3H5SA 1T3NA 3FRYA 4QR0A 2V2KA 2WBRA 1UTAA 4ZVHA 1KNZA 2ZBPA 5J1EB 4LSNB 1JKHB 2DR6A 1DRZA 3CCVS 3BH7B 2QC3A 2FD2A 1U2CA 1U47A 1H6KX 1ZTTA 3EZOA 1Q0NA 4QZVB 2HGLA 3KLFA 1UKUA 3TZWA 4YP3A 2JNJA 1VBKA 5DETA 3AOCA 1Z4UA 4MYTA 5HVGA 5EGYA 1VHFA 2HNDA 2W8KA 1WNEA 5THWA 4LBHA 1BMQB 2BJ1A 1Q79A 1HHTP 3LAMA 2CJQA 2IRUA 1X5SA 2BBEA 3TX0A 1FKPA 4LBIA 5CA5A 3DXBA 3MMJA 1S9FA 4WFXA 1NBEB 3A8IA 1HLWA 3W8PA 4CO4A 4FF1A 4DPWA 1P27B 3AA8A 1I3OB 4YR2A 2CPZA 2I38A 3I31A 5L46A 3GV5B 3I96A 1Q78A 4OLOA 1EZZB 2XHWA 5KFPA 2N7YA 1NMEB 5KAKA 4K4XA 4DV6F 1WEXA 3J7A1 2QX0A 5F8JA 1KLMB 2IMWP 1IJEB 1TMMA 4J91A 5A8KA 2E9TA 3TEHB 2NPIA 2EG1A 3M8YA 3DI6A 1IWGA 4LF8J 2EK6A 3MM7A 1MWZA 1XNQJ 3SCIE 5H9EK 1UA0A 2KFZA 3LGHA 1U45A 1ZTWA 1SKWA 1TELA 1R6YA 2YKMB 5E41A 4OYPA 5AXLA 2YWWA 5A2QU 3HZGA 2OD4A 3CVKA 4RNFA 5ADZA 3AD7C 4WPAA 3HSDA 2H4WB 4DG1A 4AYBD 4F2RA 3J80Y 1WELA 2GQCA 4LFCJ 4B3RJ 2ZC4A 4I69A 1NM2A 2RHQB 1V9OA 4Y65A 1KQSR 1NPPA 3I87A 3W9IA 1Q95G 1TK8A 2B9EA 2KO1A 2SXLA 3AJ2A 5CCLA 3KJVB 2VG6A 3OTOF 2BQUA 2CJ9A 4QW9A 3RBXA 1CJTB 1H74A 4BBYA 3M7VA 4X4RA 1K1SA 4NA3A 3KJFB 4ID5A 5F3TA 1N4LA 2KYZA 5AXKA 4GKKF 3OVBA 4V19X 4K4ZA 4CLZA 2P9GA 1GMVA 3CUNA 3AB2B 1KONA 1FESA 5CQGA 2W7AA 4EK2A 2VOOA 4U8VA 3I0RB 1MMDA 4C6AA 2GVDA 1UJ6A 2AMCB 1N54B 3KJQB 3ONQA 1F5AA 3OVAA 3MTKA 2H4YB 2CG4A 4MJKA 4QW8A 4WBFA 3U27A 5HQMA 1FWKA 4ZPBA 2BJ7A 3IP0A 4V1Ak 1RHKB 1R8BA 5L1LA 3H2LA 3UQSA 2MSTA 4Q0BB 5CD4A 5M2UA 2DXFA 1RTZA 2G2OA 2ZE2B 1N5SA 3K7RA 1B4SA 4Y6IA 1F9FA 3AQOA 4Q43A 2FVCA 1PG5B 2H5EA 2F4VJ 4EZ9A 2CG8A 4LF7F 1ICEB 2LXFA 2IAJB 5F8IA 5DM7Q 4AXIA 4OI3A 3TJ9A 3WIVA 1D0EA 2ZKTA 1UETA 4PUOB 2DB1A 3I4HX 2AWZA 3D0GE 4DPYA 3K5LA 1ZYQA 5J2PA 1LQ9A 4ZVOB 2GO8A 2V67A 2WZ1A 3V2UC 2R7OA 1RHJB 2UUAF 4Q8EA 1TMJA 4LF9F 1C1CB 3T1YJ 3ILOA 1UW4A 1T03B 2BQ3A 2VASA 2YPZA 1HWUA 4Q5VA 2OMLA 4DV3J 4ZVUB 1Y5NB 2BA9A 1X60A 2OJ3A 1J5OA 2OD6A 2Z57B 1S6QA 2WBMA 4A8XA 5AXNA 2UVRA 1RBAA 4ANCA 2ZUGA 1YGYA 2OFHX 5KFEA 2HNZA 4HACB 1DTQA 2QTWA 2VD3A 3VF0B 2HGMA 2LU2A 1YJRA 4QWDA 3GCXP 1IR2A 3LAKA 2KG1A 3KOAA 2VOPA 5B7WA 2DTJA 2G0IA 4S0MA 3FEZA 2OTJS 3BGOP 1EP4A 3TQEA 3HSJA 4AE5A 3A3PB 1NPRA 3HHNB 2KXFA 2B9WA 2HMIB 5KFJA 1YBTA 4C48A 3FCVA 3K8WA 4PWWA 2J9EA 5T7LA 3CD7A 3KLGA 3MPDA 3H42A 1QM9A 1RP5A 2RS8A 4LQ9A 2K7KA 3EVOA 2A6OA 3RGIA 5I3PA 1H2VZ 4Y2IA 2YNHA 4ED6A 2WVFA 2YKNA 3V6HA 4K4VA 3TA2A 1LK5A 1N5YA 4EO8A 4LF6J 3M6VA 2J8SA 1ELOA 2RRNA 2AGPA 1RQ0A 1YRUA 4IOAQ 2ZBQA 1K47A 1WTBA 2N82B 1Q4RA 2X1FA 4DL7A 1BGXT 9RUBA 1TUWA 2WTFA 3EPGA 2H5JB 1CG2A 1JXEA 3EVMA 1HQEB 3CDWA 4KE5A 3BO2A 1IBCB 1HBUA 4OV6A 2KVQE 3MD1A 1SC4B 2CYYA 2NXCA 1S1VA 1DQ9A 5ETSA 3R5DA 4EEYA 2ZHBA 1SXLA 4IKAA 4LRCA 3HD1A 3SQOP 1HYSB 4KKOB 3IRWP 2E1CA 2V2ZA 2H5IB 4NMXA 4TLRA 4PCQA 3M32B 4JI4F 4X66F 3D67A 1PBAA 2HLTA 1NAQA 4TYAA 3MAAB 1VOMA 2BQRA 1IBKF 4DCJB 3QO9A 5DQGA 2MQOA 1CBKA 3M4XA 4C8KA 4E8UA 3M1VB 5KG3A 5AE3A 2HBZB 3NNAA 2FQQB 4LF5J 4UY8T 4KTQA 1RAIB 4LR9A 4I2PA 2XS5A 3K5PA 3D7SB 4FVMA 1VQ7S 2ZOGA 2WSEC 5KG5A 3CSKA 3PO5A 3HVWA 4I56A 5ETKA 1ZA1B 3VALA 3GCWP 1VMBA 5LL6d 1U1RA 1SC3B 2CJBA 1YG0A 4KPCA 3OXFA 4DX7A 3PR5B 1RT7A 2HQ3A 5DO2A 1C4CA 1VQKS 1LK7A 4G1IA 1RTIA 1UVIA 1SJ3P 4QWBA 3W66A 2F7VA 5HVFA 3QFHA 2I9SA 4QU7A 1N32J 3LP0A 4OJHA 2Z2LA 2Z58B 2ZWPA 4LF2A 4O44A 2VJUA 4OFZA 1YBUA 3J7AN 1N0VC 1QTNB 2GHPA 4DHVA 1B0TA 3GE9A 2BV3A 4MKAA 4UY85 2KTQA 2KI2A 3P96A 1N52B 2VZ9A 3BSNA 1KRPA 1KHWA 1HD1A 5HLFB 1U0SA 1YQHA 2AT1B 2F9DA 4USHA 2V2VA 2RVJA 5D15A 4GVLA 4K4YA 1JLQB 4JI8F 5KFKA 2CQCA 4DSEA 3GU0A 4DX8H 1RT1B 2N7CA 4M5HA 4LF4F 2W01A 2NS1B 1DBDA 3UVJA 4MIWA 2ZWOA 4USJC 3OL7A 2FHJD 3S01A 2HQIA 2R9LA 1Z1ZA 1YJVA 2GHWA 4DR1F 3GYXB 4ES3A 5D78A 1NDLA 2HS0A 3QPIA 4PG4A 1PGZA 3OTBA 4B3SF 2ZH5A 1HNVA 1I94F 1B0PA 5F8HA 1KWMA 2VPXB 2Y9HA 3CW2C 2ZD1B 4H4OA 3MM6A 2XMJA 5FIIA 4OZ3A 3W60A 5K8PA 2HVEA 1I1GA 1XERA 3J80U 3W63A 4RWWA 1HMVB 4KGZB 4Y34A 3CJTA 3KK3B 3ZZTA 4DR2F 5CABA 3HMJG 4NOHA 3GV8B 2MXYA 1S6OA 4B9NA 3WDOA 2OAUA 4DV1J 2F8EX 3JB9k 4P9SA 3TVYA 3C14B 5E2QA 3NOCA 2IC3A 1RHRB 5LJ5Y 3GP9A 3I32A 4I67A 2BJ3A 2G0CA 2WW4A 4CT8A 3D66A 1JJ2R 3DLKA 2BJ8A 4QIEA 2GJIA 2J76E 1FVQA 3OW2R 1ZPVA 2JVOA 4JI0J 4LSNA 4ECYA 2NYIA 4DQQA 1PJ6A 1HIYA 3ZO7A 1KS2A 3FVYA 4BWMA 2VHGA 3ZTQA 1FRLA 3S1TA 2RUSA 3I9V9 2ACMA 3H98A 4JBCA 4WFYA 3GMGA 2VQFF 3IAM9 2DIVA 5A8RB 1NZAA 5L1IA 1U6FA 4IDKB 4F0HA 2QO3A 4A8MP 4DUYF 3UDLA 3TVZA 3W62A 1BQXA 5HVHA 5HBMB 3HHLB 4KO0B 3MCSA 1KQFB 1GNKA 1YJUA 3B82A 4K50A 2JDJA 2I5JA 3NGTA 5IZHA 1WG1A 2LKZA 3U1MA 3BQ2A 4PYDA 2IJNA 4C2MA 4Z37A 4NLVA 2R8JA 1Q7YT 4F3OA 1C2PA 5HSPA 1LW2B 5JJBA 5L8RC 4R8UB 3RB4A 3JTNA 2B5JB 4DL4A 1HR0J 4CM0A 5KG0A 3R2DJ 4C0HA 1EHWA 2DRAA 4F04B 1LKZA 2Z2MA 3NGUA 4KRWA 4NLXA 2CNLB 4ZCKA 3D3CJ 2BYCA 2AV5A 2HHPA 4ZLNA 5KG7A 5EX3A 1GT8A 3JS9A 1S1WB 4FNHA 2R2SA 2KXNB 1KOHA 2NQPA 1RT5B 1KKHA 1KEKA 4I1TA 4DV4F 2WVCA 2KT5A 2HWTA 2VH7A 1RCXB 2CQDA 1HHSA 3AJ1A 2YH0A 5K14B 1B3TA 5J1PA 5HMZA 5DG9A 1NHKL 5D4PA 4RNNA 4QU6A 3E51A 4Q7AA 4WP9A 3GILA 3SMZA 4DV0J 1WC1A 2XZWA 2GGPA 3FDSA 5IQ6A 2LU1A 3RTVA 3IC1A 5KG2A 1XMBA 3KTQA 3G96A 3MUMP 3QLHB 3KJVA 4PEOA 2HBQB 3MMBB 4RW6B 2HQFA 3L3CA 1C0UB 3I5CA 1CJTA 3N6MA 3RBZA 2HZCA 3R5CA 4I68A 5HROB 1J5EJ 2XWYA 2RE1A 3DLJA 2YX1A 4YDDB 3TOQA 3IWLA 4RNMA 2V34A 1WG5A 3X3UA 2W4DA 3RR7A 2KJWA 4RU2A 1VC0A 3UD3P 3VGTA 5KFWA 3DRSB 1N8RT 3TO8A 1K0TA 4QR1A 5DDPC 3C3LA 1JK9B 2R8HA 2AYGA 2EKYA 1KOOA 4J5OA 3ZZZA 4LJMA 2C3MA 3IG1A 3FSIA 2MTLA 3JQJA 2UXCJ 3Q22A 2GA7A 2F65A 2V68A 4NI2B 4DWIA 4N8OA 1LWFB 3CF5Q 2H48B 2YKAA 4ZJLA 2EBEA 3I5BA 1H2TZ 4F36A 1PO6A 4DL2A 2XNQA 2IHR1 3L95X 2J6UA 3D2WA 3G87A 3EGWB 2ZNYA 2IM1A 1NKEA 4LF1A 1FHTA 3MEGB 4PWDB 1CJVA 1VRQC 3C8YA 2LA4A 4JI1J 2BW7A 4CLSA 4J9LA 1S0NA 3TR5A 2DO0A 3TAQA 3ZFVA 4CLPA 1C1CA 5IM0A 3HCXA 1T03A 1F60B 1RBLA 1C0TB 4KGMA 2GZOA 3WX4A 1SCJB 1I6JA 1JLCB 2QYCA 2E66A 1JJCB 3D0HE 4Z2XA 4OZ5A 2OEKA 1T05B 1A7GE 3VV2B 1NXIA 4U7CA 2HZAA 4CO1A 3ENAA 4NLWA 3ZZOA 1RLDA 4ES2A 4ICLB 3AD8C 4YR0A 7FD1A 4U6PA 3GZ7A 2D7SA 3V6JA 2MZJA 3DRRB 1KLNA 2HMIA 5EWFA 4JI7J 1YZ7A 2FLNA 1RT3B 3R7NB 1BHNA 1EQ0A 2LFVA 2BEFA 2IJFA 2HRUA 2YNIB 5IWAF 4DSIA 3C19A 4M5MA 1S0VA 2MMYA 5CAAA 1AYEA 4KV8B 4NZ7A 4R5PA 2ZZMA 3K58A 1F9HA 2VFTA 2LP4A 3RBEA 2GAHC 1D9FA 4HHHA 4YB7A 2EC2A 1D9DA 2V8GA 2ZBRA 3LALA 1H3DA 1HW9A 1Y5IB 1D8ZA 3HLUA 4KB7A 3ITHA 1T94A 5HJXA 1S6PA 1S0OA 1U49A 3UDEA 5HMWA 2RF2B 1NDCA 2VG5A 3SYZA 1S5ZA 2W8LA 1HYSA 2F4FA 3QNWB 4PWUA 1KTQA 4O3RA 5AJ3F 3CCMS 3JTOA 2LEAA 1Q5VA 1F1BB 2HZVA 1N5TA 1B7YB 2PE8A 2GFFA 4XDDA 3WHIA 4K7QA 2GAGC 1Q8BA 1FWLA 3EDQB 3K8VA 3HX9A 1LWEA 1GX5A 3LP1A 3MCMA 1EJ7L 1WC5A 4CH7A 1AZSB 2AJFE 3HT3A 1JNRB 1VS3A 1WUUA 3HKZD 4YMEA 5ETLA 2AJ0A 4K5SA 2BM0A 4IG0A 4BLGA 3R2CJ 1TR0A 4M94A 3QSYB 3M8RA 5HQLA 2APOA 2HAIA 2VUGA 3MPWA 3W5XA 4OYIA 1DY3A 4DJBA 2W9AA 1TFYA 3CCTA 1C1BB 4DR5J 2DKOB 4QIWD 2XYGB 4DS4A 5D4LA 5DGBA 1D1UA 2IRXA 3E3XA 2G1HA 1PSDA 2NZ4A 1WWHA 2DR5A 3OVSA 1GAOA 4IR1A 2WB4A 5KFUA 1PIEA 3FFIB 4MAKA 2HHXA 2RQMA 5HLFA 3AOBA 3LPEA 1O51A 1NSKL 1R0AB 1GXUA 5FD1A 2FGCA 1DTTA 4DR3F 1FTCA 3T5KA 4RW7B 1RT1A 1Y3KA 2NXJA 4CRJA 2YX4A 1SC6A 2Q3PA 2UUCJ 2Q79A 3PYFA 1RA7A 3CC2S 4P52A 3T5HA 4OYZA 2GMJA 4C3MA 3A3NB 2YH1A 2OH2A 1OQ6A 2DNHA 2E5LF 3Q8PB 4JV2A 1ZAWA 3KLEB 1GTEA 3JSMB 2PFFB 3HVTA 1RTJB 1WJ9A 5L1JA 4NXNF 2QT7A 1DFDA 4BC7A 3J7ZT 3A8KA 4U95A 3ZNJ1 5CCMA 1V5IB 1CSJA 2DHSA 4DSKA 2B9XA 3DN9A 2UUAJ 3PX4A 4XDCA 3CGIA 3FRZA 3SFUA 1G2EA 4DL3A 4ED7A 2XLIA 2KH9A 5KOXA 1NSAA 2D69A 2B7CB 2XYHB 3MAHA 3JSRA 1HMVA 5L38A 2U2FA 4ID8A 1VDHA 3KFWX 3PYDA 2W25A 2N3OA 3NCQA 4P2XA 2B4UA 3ZXWA 3KK3A 1N36F 5KT5A 1X9WA 2VA3A 1TKTB 2CUYA 3D4JA 3A4TA 4ED3A 4X84A 1MMLA 1FO1A 2H51B 2PO4A 4NLSA 4WXOA 4CP5A 5C25B 3PEJA 1UCNA 4FDFA 2W2MP 3OR2B 3KMQA 3W5ZA 4DV7F 2BJ9A 4J90A 4I4BA 3PRBA 4FYXB 1NJXA 3C2PA 4MK7A 1RWXB 1TKXA 4M5DB 2HVZA 2O1PA 3NEKA 3QWPA 1HD0A 4DFPA 2RJZA 5F8NA 4H4MA 3MR2A 1NH7A 4YN3B 3G6YA 2HBYB 2V50A 2F40A 3NCRA 3L9ZA 3DOKB 2M4MA 2ZVIA 1XK8A 1F6TA 4Z7YA 2DHXA 1JLGB 2YKPA 3VVTA 2KM8B 4X62F 4DR7F 1VI7A 1QSYA 4UQGA 4F3MA 3HI9A 5A8RA 2UXDF 3MMAA 1ZETA 4IDKA 1G6BA 4C8NA 3DCAA 3PG9A 1S7IA 5CXTA 2Y1LB 5HBMA 4QPTA 1L3VA 3HHLA 3LW5C 2UU9F 3TNVA 1KP6A 5IV3A 2EG2A 2LQJA 3OLAA 4O3SA 3SCLE 2RDDA 1TFWA 5DG7A 2YWHA 2R8IA 3MR6A 3ET6B 5IQQA 4ZCIA 2D3OR 1S9EA 1TUVA 1FJCA 2BANB 2AZ3A 1F0XA 2V6AA 3GWCA 3MM5A 4ILMA 2HFZA 3BSCA 4FKYA 2RHSB 2W4CA 4R8UA 3MUTP 3PRVA 4JI4J 1Y5LB 4NPOA 4X66J 2B5JA 2KZMA 3AOAA 4C7QA 2KRRA 1IBKJ 2ZDPA 2AEFA 2MB0B 3OFHA 1S72S 1H7XA 2E29A 3BBBA 5JXSA 3Q8YA 3OHBA 2VONA 4DV5F 3D68A 1S1WA 3R7BB 3SEOA 2C42A 4M1KA 1RT5A 5AE1A 3MD3A 3BGRA 2C3PA 3OUYA 1NEEA 2AW0A 2M52A 4MIBA 1N5QA 4ZCMA 1ZZFA 3B54A 2YWGA 2YBVA 3OL9A 2A1BA 3UR0A 3Q8QB 1F3FA 1NK9A 3RYLA 4L72B 1X4AA 3K89A 4TY8A 3UO0A 4CLTA 3SDEB 2MKCA 5C7PA 3QGIA 4C3LA 4HT7A 5B0CA 4N56A 4ZP9A 3DOLA 3TJAA 3HHLC 1S12A 5GAHI 3HSZA 4WFNQ 4ZPDA 1C0UA 5KFYA 3H4BA 1HQUB 1RU2A 4A4JA 4X4TA 2FGOA 2KFNA 4QYRA 2F8MA 1GMWD 2A0FB 4ZN1A 1IXKA 3D54A 3FMWA 2QG9B 4EYIB 3MPYA 1JLFB 5CYJA 4ALZA 1UVKA 4LF4J 3MR7A 1IKVA 5JVHQ 1YJ7A 1ZPWX 2J7UA 5GAEI 2FZCB 3N4WA 5DRKA 1CJUB 1RHQB 2KDOA 3R9LA 4Y2KA 3OFGA 2B43A 3EGZA 4CH1A 4DR1J 2EVZA 1S1UB 1WI8A 4XK8C 3M30B 2DVIA 1TL1B 2HAFA 1SV5B 5KFAA 3CCRS 4CTAB 2DD8S 2MGZB 2YVSA 2V69A 4K0KJ 2RUGA 3TANA 3Q8SB 5MLCV 4CLLA 1MN7A 2HIYA 2JWNA 1LWFA 1T9VA 3N5BA 2CIMA 1VFJA 2U1AA 1Q5YA 4ELTA 1FE4A 3TA0A 1Q86T 2J5AA 3PW5A 4P72A 5KT2A 2HWHA 4DPOA 5ETPA 3W65A 4X64F 1U1OA 2KT2A 3Q2TC 3MEGA 4B3TF 4A8SA 2C2KB 1IM4A 5SUHA 5DGAA 1T9UA 2I0XA 4OYAA 5IC6B 3KLFB 4U7UD 1FXLA 3MDFA 3HVRA 1HNWF 5KT6A 2GIRA 1MROB 4IOCQ 3ULHA 3THPA 1HBOB 4FF3A 2HNDB 1HARA 1JLCA 1TKZB 1X7VA 4KHRA 3PO4A 3I0SA 1PC5A 5F9LA 4M5LA 5LOQA 3BKUA 1FKPB 3K57A 3Q24A 1U4BA 2YNFA 3IGVA 5DQIA 3ZZYA 4HYKA 3VGUA 4YOEA 4PRFA 2B6AB 1HWLA 3US5A 3W2VB 3N01A 3Q0AA 1AXQA 3CJ3A 2UUWA 5GMKa 4ICLA 2FVRA 3SXLA 4TKTA 2O3DA 2E7WA 4ZPCA 3VQTA 1AB8A 2Z8QA 3Q86A 2MQMA 4I2QB 1VBZA 4USUA 1TL3A 5A8KB 2ZITA 3TJ8A 2R8KA 1JJ4A 3MI7X 1U1PA 4HTJA 3DI6B 1VQOS 2QYGA 4BC9A 1RT4B 2YY3A 5F3ZA 2XC9A 4N47A 5DZ6A 1VK3A 4JI5F 4O23A 2DHHA 2CQHA 2RB7A 1HBMA 1NUEA 5F0UA 2MJNA 4KV8A 4Y2AA 2LDYA 4DSFA 4RKUC 3UDCA 2V5HG 5LMUF 3G8QA 2HHSA 2QLWA 2PT0A 1BD6A 2O01C 5J2MB 2CKWA 2W2NP 3MZIA 2WVEA 2W7PA 2XZDB 4ZITA 1DHMA 4UQTA 2RS2A 3BPDA 2ZH4A 1NK7A 1AUDA 4RL1A 4FVCA 1NHUA 1ZM4A 1CPZA 2V0NA 1NK5A 1MLAA 1HNZJ 2FZGB 4CT9A 4UW2A 2YKOA 3UN2A 2VG6B 2EXUA 1CVJA
chains in the Genus database with same CATH topology
1WEYA 3N6LA 2I8EA 3TRGA 2L41A 2ZDOA 2ZHBA 1SXLA 4IKAA 4B9VA 2B4PA 3PNIA 4O4RA 1IKVB 2M9KA 1HYSB 4KKOB 4EGLA 4C9DA 4O3QA 3IRWP 2E1CA 2RU9A 4X65F 4EBEA 2GV1A 2FPHX 2NXUA 3BGFA 1M0SA 1WACA 3PX0A 4TLRA 3R3TA 3PR4A 3THVA 3PEHA 4PCQA 3M32B 1FEHA 2DNGA 5LSLA 2FLLA 4JI4F 1IBMF 2XSFA 3CEDA 1YHQS 4YR3A 5KFDA 4K4SA 4X66F 2E1AA 1HWJA 4KFBA 3QGGA 3HM9A 2HLTA 4JI3F 1NAQA 3LO3A 4TYAA 5I3QA 1BWEA 1V6HA 1LWCA 2UUBF 1VOMA 1DURA 4TYBA 5KFXA 3V5RA 2JX2A 4UUWA 1Y4ZB 3SV3A 2OTLS 4XAKA 3BS9A 2M88A 4I6YA 3KMSA 2BQRA 1IBKF 1FKAF 1Y3JA 2MDAA 2ZVSA 3R27A 3QO9A 5DQGA 2MQOA 3M4XA 5CYMA 2QSFA 5I3UB 2BE2A 4C8KA 4E8UA 3M1VB 1S79A 2ZH3A 5KG3A 5AE3A 4TXSA 3RAQA 3NNAA 3M8SA 1FDDA 1NK0A 1XN9A 1JB0C 4UY8T 4B9MA 2ILZA 2JLGA 4KTQA 4PQAA 5BR8F 3ZZRA 4I2PA 2LDIA 5SZTA 2XS5A 4M63A 3K5PA 4ZPTR 3U7JA 3OLBA 4FVMA 1VQ7S 3QJLA 1JLBB 3E01B 2AGQA 2ZOGA 1KVJA 4KO0A 3CTRA 2WSEC 1TAQA 5F0WA 1X4DA 4GC6A 1CEZA 5KG5A 3CSKA 4RW8A 1RWUA 1YTYA 4FF4A 1OWXA 3PO5A 3HVWA 1TV6A 3JYTB 2R7SA 4I56A 1XR6A 4WK1A 4JI7F 1JLAB 5F41A 5BYQA 2MY8A 2VC0A 2RQ4A 3GIIA 3VALA 2BJEA 4MKBA 3MURP 4NCGA 2MSSA 3DDNA 2IM0A 5IS2A 3FCHA 4WKRA 1IN0A 5LMNF 1VMBA 1XMOF 5LL6d 1U1RA 4C8LA 2R4FA 2CJBA 1YG0A 2W4PA 3OXFA 3PR5B 4CCHA 4G1QA 3FJ2A 2CQPA 2BM1A 2G13A 1RT7A 2J9DA 2JSXA 2HQ3A 3BM7A 3DLEA 2XBPA 2DNYA 5DO2A 3G6XA 2C22A 1C4CA 1FA0A 2KT3A 2P6TA 3CD0A 1LK7A 4G1IA 1VQKS 1LW2A 5E7OB 2J6SA 1TAUA 4KC5A 1ZM2A 1RTIA 2PIIA 1SJ3P 1UVIA 4QWBA 4Y28C 2F7VA 1LXNA 2ROPA 2Q43A 5CZVA 1FERA 2I9SA 4E98A 4RX6A 2DGUA 1T7PA 1ZM9A 3K5OA 5J2PB 4QU7A 1U1KA 3LP0A 4LIWA 4OJHA 1U24A 2Z2LA 3KG1A 2RU3A 4O44A 2DRBA 1JWWA 3KWMA 1XBWA 4O4GB 3VCDA 4OFZA 3OTCA 3PKYA 2FY1A 4AXJA 3GYNA 1N0VC 2MQNA 4C8ZA 2DPIA 2B0GA 2GHPA 4URQU 1OO0B 4DHVA 3PVXA 4YEAA 1B0TA 3GE9A 2BV3A 3K0JA 1OSDA 3G8SA 3KK1A 2FJAB 4I6WA 2JFKA 4MKAA 4ZOSA 5FDLA 1O0PA 4UY85 4FBUA 2KTQA 3ENQA 4HEA9 2KI2A