3M8QB

Hiv-1 rt with aminopyrimidine nnrti
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
424
structure length
398
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 112
structure length 398
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qB04
4MK9A 4XPCA 3UR0A 5CYMA 5F8LA 1N56A 2JC1A 2AGOA 1BQMB 1LWFB 4RNNA 1C1BB 1OS5A 3H2LA 3OHAA 4NLVA 1S9GA 3KK3A 3E51A 2IAJB 4O44B 4NLYA 4MH8A 2IBKA 2JEJA 2C2EA 3N6NA 1DLOB 3HHKA 1JLGA 2OPQA 3DRSA 2FJWA 4NLRA 4YR0A 4KO0A 1NHUA 1VRTA 1DTTB 3OL9A 2FVQA 1SUQB 2HWHA 1HPZB 1JLFB 4ZHRB 1C2PA 4MKAA 2UVUA 4ZP6A 4NLWA 2ZKUA 2HNDB 3FFIB 5EWEA 3EPIA 3V6JA 3MR2A 1EETA 3C6TA 5KFAA 4WFYA 3KJVB 4QWDA 3M9NB 4ZP8A 4RNMA 3GIJA 2ZD1A 2O5DA 4EBDA 2R8HA 3KMSA 4DG1A 1HQEB 3N6LA 4ZVEA 5L1LA 3BQ0A 4FBTA 3TVKA 5KG1A 1S1UB 4Y3CA 5J2NA 2ASLA 1KHWA 4O3SA 4G1QA 5DLFA 1IKVA 4IH7A 3V6DB 1RDRA 4R5PB 2YKNB 1XR5A 3CJ2A 4K4ZA 5J2PA 1KLMB 3CJ0A 1TL1A 4TY9A 5K14A 3KLGB 3E01A 3DI6A 2IM3A 3GIMA 2I1RA 5KFJA 4O4GB 3LP1B 3G86A 5J1EA 5C24B 4LSNB 3QIPB 5KT7A 1WNEA 1JLBA 4URQU 1MU2A 4YP3A 1BQMA 3M9OB 4NYZA 1LWFA 4O4RA 3IGVA 5KFVA 1LWEB 3M8PA 4J9KA 5C5JA 2IM2A 3CIZA 5JXSA 1K1SA 3QGIA 5L9XA 5J2QB 1ZTTA 5KFCA 3PW2A 2WCXA 2YKMB 3HVAA 2E9ZA 1FKOA 2YNGA 2BQUA 3JYTA 2AX1A 5KFNA 5KFQA 5KG5A 5DQIA 1RT2A 1TL3B 2B5JB 3KK2A 4TY8A 1T05A 2OPRB 1SUQA 4U6PA 3DLKA 4Q43A 1HNIB 4ECQA 4NLGA 2W7OA 3OL7A 3JSMB 4WZMA 4NLUA 3DOLB 2R8IA 3KLEB 2RF2A 1ZTWA 1RYRA 1NNDA 1RTJB 2ASDA 3PR4A 3V6HA 1IM4A 2D41A 2B6AB 4WE1B 2WB4A 4F4YA 2YNIB 2FJXA 5KG7A 3NAHA 5KT3A 1RTDA 4ZVGA 4FS1A 4ZPBA 2XWYA 1RT5A 4NLXA 3KLHB 3PW4A 4LSLA 1QUVA 3UDLA 4RW6B 4ZPDA 4ED2A 2ZE2A 4RW9B 5F8GA 4K4WA 3DLEA 3NAIA 5CYMB 4DL6A 4K50A 4EBCA 4WFXA 3Q8QB 3GIIA 3GV8B 4U7CA 3IG1A 1S9GB 2HMIA 2W9AA 2WONA 1EP4A 2FJVA 5KG0A 1T3NA 3SFGA 1JLGB 2OPQB 3DRSB 4LQ3A 4Y34A 3QIPA 4I7FA 4EEYA 1JLCA 4JUZA 1S1XA 4YQWA 3RB6A 2AWZA 2D3ZA 1N5YA 4F4ZA 4ECWA 3KHLA 3TQ1A 3EPGA 4F4XA 4IDKA 4MK7A 3G6YA 2GC8A 5J2QA 2VG6A 3C6TB 4RW4B 4NLPA 3T19A 3BR9A 3T5KA 1S6QA 2D7SA 5D3GA 4NLOA 5KFMA 1U09A 2XGPA 5FDLB 2ZD1B 3PW7A 3I0RB 3D5MA 1S0OA 4RW8B 3RBEA 5KG2A 4DG1B 2QV6A 1HNIA 2V0NA 5KFDA 4EBEA 3RB4A 5KT5A 3DOLA 4ZP7A 2UUWA 3KLEA 5J2NB 5KFSA 3MFHA 4ECYA 3BSNA 2C22A 4G1QB 2IM1A 2IM0A 4MIBA 3UPFA 4RUAA 3PZPA 1JLQB 1HYSA 4NLSA 4I2PA 3ISND 2YNIA 5DQHA 3LP0A 5J2PB 2IC3B 3T1AA 5K14B 1RAJA 3E01B 2FVCA 3DI6B 1S9FA 2W9BA 5KG6A 3KNAA 4ECZA 5J1EB 2JEGA 5KFKA 3OLAA 1S9EA 2R8GA 1N4LA 3KK1A 5F8NA 4GC7A 3BGRA 3H5SA 1JLBB 4KSEB 1MU2B 1XR6A 5DG9A 4ED7A 4J9MA 4NZ0A 3M8PB 3GILA 4TXSA 3GV5B 2V4RA 4IR9A 2ILZA 1JIHA 1N48A 2ALZA 4RU9A 1FKOB 2YNGB 3IS9A 3JYTB 1RT2B 5DG8A 3KK2B 2FLNA 3M8QB 4B3OB 4TY8B 1T05B 4WYLA 2XC9A 3DLKB 4J9LA 4DL7A 2QE5A 3H5XA 3Q8RB 4IG3B 2FVRA 2RF2B 4EYHB 1S0MA 5I42A 4RUCA 4NRTA 1RT7B 1TKTB 4RW4A 4NLQA 3ISNC 4HKQA 2AX0A 5T14A 3SI8A 4KBIA 1TVRB 1RTDB 5FDLA 1JLEA 5C25B 3I0RA 4RZRA 3IRXA 1RT5B 4RW8A 3MEDB 3ICLA 4WYWA 4LSLB 5HP1B 1JXLA 2C28A 3QZ7A 1I6JA 2ZE2B 5I3UA 4K4VA 3DLEB 1REVA 4FBUA 1JLQA 1SV5A 1S1WA 2JEFA 1RTIA 4PWDA 4QWCA 4DL3A 1ZETA 3MEEA 3IG1B 4WFZA 2IC3A 2HMIB 4F4WA 2WONB 3KOAA 1EP4B 3MR6A 1IKXA 5EUHA 3BJYA 4KKOB 2UVWA 4IR1A 4KHRA 1GX6A 3PW5A 4I7FB 4EO8A 4KB7A 1JLCB 1S1XB 3NBPA 5EDWA 2V9WA 1N5YB 3SFUA 1JX4A 5KFZA 2WTFA 5HLFA 4ZPAA 4IDKB 4ED6A 4IFVA 5HBMA 1S10A 2VG6B 3V6KA 3MECA 3CJ3A 1S6QB 1J5OA 5D3GB 2CKWA 1T03A 5F9LA 2OH2A 2VG7A 4M95A 3M8QA 4B3OA 2AGPA 2OPPA 4QWBA 4IG3A 2B43A 1IKWA 3RB0A 3KHHA 1RT7A 1TKTA 1UWBA 4NRUA 1HYSB 4ZVHA 3G6VA 2DPJA 3HVWA 4I2PB 4K4TA 2FLLA 2BQ3A 3LP0B 1TKXB 1TVRA 1KHVA 2XGQA 5C25A 3GYNA 2HAIA 4Y2AA 4DEZA 4R8UA 2WOMB 1RYSA 3MEGA 3MEDA 4ICLA 5KFIA 2W9BB 1YVFA 3QYYA 5KT6A 4H4OB 4GC6A 5HP1A 1S9EB 5DLGA 4TYBA 4MFBA 3KK1B 4J9RA 3BGRB 1S48A 5DGBA 4LQ9A 2RKIA 3GQCA 1MMLA 1TKZB 4Q0BA 4KKOA 4URGA 2XCAA 3IS9B 5L1KA 3PJWA 3NL0A 2OPSB 3ITHA 1QAJA 2R8KA 4ED1A 4NLDA 3V81A 2F8EX 4ZVFA 1HARA 5KFGA 2ASJA 4TN2A 3MF5A 3HVTB 2R2SA 4ED3A 4ID5A 3KLFB 4PUOA 5KFXA 3MR5A 5I42B 4K4SA 5KFEA 2BR0A 3T5JA 1JKHA 4M94A 3I0SA 2RDJA 1C0UA 3KLIB 4IRDA 1JLEB 3M9MB 1RA6A 3IRXB 4MKBA 5KFWA 3QO9A 2HWIA 3DM2A 3BSCA 1NHVA 5KG4A 4IFYA 1XR7A 3CJ4A 5I3UB 3CVKA 2R2UA 5KFUA 1S97A 3BREA 2XCPA 1REVB 1HNVA 1SV5B 4IKAA 5KT4A 1S1WB 1QE1A 2ILYA 1RTIB 3V4IB 4PWDB 2IJNA 4K4YA 1TKXA 4ECXA 2AU0A 3MEEB 2BQRA 2WOMA 5F9NA 2FVPA 2GIQA 5KT2A 1TV6A 4H4OA 1IKXB 2C2RA 3NGDA 4JV1A 1SH3A 2YNFA 2BANA 3NBPB 5KG3A 2JLEA 1RTHA 1QAIA 4XPEA 1RA7A 1C0TA 5J2MA 5HLFB 4NCGA 4ZP9A 2HNYA 2VG5B 1RT4A 2IJFA 5F8IA 1TKZA 4IFVB 5HBMB 3RAXA 3MECB 4O3QA 1HMVA 1LW2A 1J5OB 4Q8EA 1FKPA 2I5JA 1T03B 4O3OA 2VG7B 2OPSA 3LAMA 2AGQA 3H59A 2OPPB 3DRRA 3HVTA 3FQLA 4J9NA 1IKYA 3GV7B 1DTQA 4FS2A 2ATLA 3KLFA 4Q44A 1IKWB 2FLPA 4J9PA 1UWBB 1S6PB 3FQKA 4J9OA 4TYAA 3KLIA 2C2DA 1N6QA 3G6XA 4TLRA 3VQSA 2BRLA 3RBDA 3H98A 4R8UB 3MEGB 4ICLB 5CYQB 4JV0A 3T5HA 2DPIA 2VA3A 1JLAB 3EZUA 1SH0A 4IH6A 3MFIA 4MFBB 4ED0A 1S1TB 3MTKA 4KAIA 1LW0B 4O3NA 3C6UB 3KHRA 1RT3A 2YNHA 2R8JA 4ZMMA 3H5YA 1RT6B 2RKIB 3V4IA 4IQXA 5KFYA 1LWCA 3TAMA 4URSA 3QLHA 5KFLA 5KFTA 4Q0BB 3OL8A 4Q45A 3CDUA 2JC0A 1S1VA 4PQUA 5KFRA 4ECVA 3Q8PB 3RAQA 3CJ5A 4DL4A 1C1CA 4H54A 3ITHB 2V4QA 3BQ1A 1TP7A 3BQ2A 3V81B 3IN5A 1VRUA 2RDIA 2VA2A 5DG7A 4OL8A 4EYIB 1FK9A 2VG5A 4QWEA 3DMJA 4ID5B 4PUOB 3DRPB 4I2QA 4KV8A 5C42A 1JKHB 1BQNA 3H5UA 3I0SB 2IA6A 1C0UB 3DYAA 2W9CA 2WK4A 1K1QA 3FSIA 5EWFA 4ZPCA 4YMEA 4ECTA 3RB3A 1RT1A 4F50A 1HQUA 3QO9B 4O3RA 3DOKB 2J6UA 5HROA 4RW7A 3DM2B 3CWJA 4ECSA 4JV2A 4KHMA 3NKYA 4IFYB 2W8LA 2CJQA 3PR5B 3KLVA 2BE2A 4TQSA 3KMQA 5F8MA 1S6PA 3OSNA 1HNVB 1QE1B 3LALA 1D0EA 2BRKA 1C1BA 4G3IA 5EWGA 3LP2B 5CYQA 1SH2A 4RNHA 5KFOA 2IAJA 4O44A 1TV6B 3I5CA 3CDEA 1JLAA 2XI2A 4NLTA 4QW9A 1DLOA 4RNFA 3OLBA 4HYKA 1S1TA 4QWAA 2GIRA 2WRMA 1LW0A 2YNFB 3CO9A 3C6UA 3D28A 2BANB 1GX5A 1DTTA 5L1JA 2XI3A 2AQ4A 1RTHB 1HPZA 1JLFA 4ZHRA 1RT6A 2FVSA 3DLGB 3DDKA 1C0TB 5J2MB 5F8HA 4NCGB 1D1UA 2HNYB 3H40A 1RT4B 2HNDA 3FFIA 4ECRA 4QPXA 3FRZA 4J9SA 3T5LA 1Z4UA 2WHOA 1HMVB 1LW2B 3KJVA 4IOBA 1FKPB 2I5JB 3HKWA 3I5BA 4QW8A 4H4MB 4KFBB 3OL6A 3H4BA 4ECUA 4IG0B 5DGAA 5KFPA 4RNOA 3QZ8A 1HQEA 1R0AB 3DRRB 4WXWA 4MK8A 3UQSA 4WXOA 4R0EA 3LANA 1IKYB 5DQGA 1DTQB 2HNZB 2E9TA 1W25A 3PJXA 1S1UA 4X2BA 3DRPA 4Y2CA 4TQRA 3GIKA 2E9RX 3V6DA 4R5PA 1S49A 3IGNA 2YKNA 3QGHA 4MIAA 4O3PA 1N6QB 1T94A 4ED8A 1S0NA 3NMAA 2R2RA 2D3UA 3FDSA 1KLMA 3KK3B 2W7PA 3KLGA 5KFBA 2EC0A 3DOKA 4XO0A 4O4GA 3LP1A 2J6TA 4DL5A 3H4DA 5F8JA 5C24A 4LSNA 3CDWA 1S4FA 4KO0B 1VRTB 4WZQA 1RT3B 2YNHB 4IRCA 2JEIA 2UVVA 1LWCB 1LWEA 3LP2A 3TAMB 3PVXA 3QIDA 3QLHB 3PW0A 3I5AA 1EETB 4J9QA 2YKMA 1S1VB 4PQUB 2R2TA 3BSAA 3OHBA 1C1CB 2B5JA 1TL3A 5JUMA 4K4XA 1VRUB 2OPRA 5KFHA 3DLGA 3JSMA 4IH5A 1FK9B 3DMJB 4YR3A 4DL2A 4I2QB 4KV8B 5C42B 3LAKA 3OSPA 1RTJA 3BSOA 1IKVB 1BQNB 3MR3A 3PHEA 4YR2A 2IMWP 2J6SA 4Q8FA 2W9CB 3DYAB 2B6AA 4WE1A 3Q8SB 4H4MA 4KFBA 2UVRA 4IG0A 1RT1B 1TL1B 4EO6A 1HQUB 4KE5A 5L1IA 4IRKA 3KLHA 1R0AA 5HROB 4RW7B 2UUTA 2W8KA 2HNZA 1TQLA 3N6MA 4RW6A 3KHGA 4K4UA 3QGGA 2BE2B 4RW9A 5KFFA 1CSJA
chains in the Genus database with same CATH superfamily
1RAOA 1OS5A 2K7KA 1S9GA 3K7RA 2IAJB 1PC4A 4ZOSA 4FYVB 4OZLA 1U2RA 3FFIB 1FRHA 2DYAA 1NB7A 3N9UC 4OYOA 1RU2A 1XR5A 2C3MA 5GADU 2YY3A 5H9FK 2ZBQA 3BR8A 2F7VA 4J9KA 2BMBA 5CABA 3LO3A 4XDDA 4X4NA 5JVGQ 2BQUA 4M5JA 4O0IA 1ITPA 1HL6A 2HAFA 2LVWA 3L4BC 2L41A 2N4DA 4PWUA 2RHSB 1Y9OA 2GNKA 4B9TA 1CJUB 3AXMA 3N01A 4KGXB 3EM1A 4ED2A 2ZE2A 4K4WA 1HWKA 4WFXA 3GIIA 3TW0A 1MROB 1RWWB 2ACMA 4I7FA 4KJIA 4YQWA 3RB6A 2KM8B 2KG1A 1D8ZA 3A13A 5ETNA 3C6TB 4RW4B 3P5BP 1UFLA 2C3PA 4P73A 3W8PA 2D7SA 2K1RA 1YDLA 3RBEA 4LFCF 1KVIA 4M1KA 4LF5F 1S6UA 4RUAA 4C2MA 3PZPA 3VQTA 3LP0A 3ENWA 1ZM4A 4DS4A 5HATA 5J1EB 2NPIA 4AL5A 2A10A 3H5SA 1GT8A 1H38A 4WPAA 3GV5B 2RMLA 1PIEA 2K2PA 1MN9A 4LF5J 2HK3A 2EVZA 2JX2A 2DIVA 4PEOA 3H5XA 5I42A 5THWA 4DPTA 1S57A 5CZXA 2FHKA 1OY8A 1YTYA 4WYWA 2GMLA 3S7RA 4FF1A 1GTHA 4QWCA 3VHQA 1VGYA 2DNHA 3EVMA 2XNRA 4KTQA 3TVZA 3TVYA 3Q0AA 1ZAVA 1JLCB 2QRRA 2DGSA 2C3YA 2F4FA 1U48A 1CJVA 3IRWP 3VZIA 2FHMA 1P6TA 1Q86T 1UWBA 3I55S 1JXEA 4A47A 1MWZA 2XGQA 4LF2A 3CTRA 4Y2AA 4R8UA 1UPMB 5CQGA 2AF6A 1VC5A 1Q7YT 1WEYA 2CQDA 1NLKL 2AJ0A 1CBKA 4PAAA 3NL0A 2R2SA 4ID5A 2NXNA 4JI3F 3G2XA 1C0UA 4FPRA 1U6FA 4UOCA 1UKUA 4Y65A 1RAGB 3IM8A 2KKHA 4RPFA 4XIUA 3UFCX 2UXCF 5FIIA 1RTIB 2LCWA 3MEEB 1N5TA 1VDHA 2AEJA 3UE2A 1KOHA 3DLLQ 1UPPA 2VG5B 1TKZA 4ES1A 2CRLA 1YJVA 2X7IA 3DU6A 1QJHA 3IBWA 2E7WA 2UXCJ 5LT5A 1IKWB 2EC2A 1PBAA 4CLTA 1FESA 2VOPA 5CYQB 4QR0A 3ISZA 1JLAB 4F3OA 2PD1A 4RR5A 1IQZA 2W4CA 3FEYB 2YNHA 1RBAA 1CQMA 1LWCA 4MIWA 4J9VA 1FVSA 2FY8A 3MR7A 3QWPA 1XQIA 4O23A 2JL9A 2PEBA 5DG7A 4OL8A 1IXKA 3CMES 3SV3A 5M2RA 2HZVA 4OZ1A 2BE2A 3PRVA 3AA9A 1FFWB 4G3IA 3I5CA 4W4MA 1U24A 1S1TA 1FRLA 4ID8A 3DDNA 2BM1A 4NCGB 4QIGA 1SC6A 4WP3A 4ECUA 3WX8A 3UQSA 2E9TA 4R0EA 4JI2F 1DTQB 4FZVA 4ED8A 1DY3A 2KI2A 2EC0A 2RAQA 4XO0A 3FSXA 2M70A 4DL5A 2VODA 3DHXA 1H2VZ 2ZBCA 3JS9A 1ICEB 3CCWA 3M6WA 2V2ZA 4J9QA 4JI2J 2YKMA 1GQEA 1FD2A 3THPA 2D69A 6AT1B 4DL2A 4M5MA 4YB5A 2FJBB 3M1VB 3L09A 2O3DA 3FZBA 2B7CB 2MDAA 1YIJS 1VCTA 2OEJA 3KHGA 3QGGA 1TUVA 2JC1A 1FD8A 2KN4A 1HBNB 2NUHA 1JJCB 2CYYA 4L73A 2FZKB 2IBKA 4OIXA 1KOOA 1F2HA 3H2VE 3O6QA 1SKSA 1I51B 3PV8A 2OSRA 2HQIA 3VGSA 3JQKA 1UL3A 1F0XA 2LFVA 4DZDA 4B3SJ 1S1UB 3OR1B 5J2NA 1N33F 1X4EA 1IKVA 3V6DB 5A8KB 1KQFB 2ZNYA 5CHCB 3A8KA 3GIMA 4O4GB 3G86A 2GFFA 4EMDA 1BQMA 3ONQA 1LWEB 1IBKJ 3PXGa 2AX1A 1N33J 4X65J 2YX4A 1YBTA 1CS4A 3KLEB 1L3UA 1NH8A 4GKJJ 2BDPA 2F3JA 1LFWA 2EFVA 1Q8BA 2HMIA 2HS3A 3R5AA 2HFZA 2YQ0A 2WVEA 1KP6A 2V4JB 4AYBD 5D8HB 3KHLA 3EMTA 5D3GA 5ETTA 3PW7A 1JJHA 4RW8B 2V0NA 3RB4A 4ZP7A 3MFHA 1LK5A 5IXUA 4UY8T 3DGVA 2RRNA 2PE8A 5F3TA 3D2WA 1Y7PA 2QFJA 3CO0P 2OLWA 1G6BA 2DCLA 2Z8QA 1RBLA 1HNXJ 4FF4A 3IR6B 3M8QB 3ILJA 4M5IA 3DLKB 2KVIA 3Q8RB 1S0MA 4ANCA 2J9EA 2XBPA 1RTDB 2PT0A 3CJRA 5LJ3Y 2VBWA 4XDCA 4KHPJ 3B8HA 4PYDA 1TL7A 5L38A 3KG0A 1OJ4A 2GVZA 2CQ1A 3B4DA 3IWLA 3V6KA 2DNRA 2V2QA 4LF4F 2CQPA 2B7BB 1FEHA 4M95A 2QLFB 3U7JA 4C8ZA 3E3XA 7AT1B 3FMWA 2HZCA 3VAJA 4FXWA 2J0WA 2HAIA 2J9DA 3MEGA 2JVOA 2CIMA 1EQMA 3UD3P 2V2VA 5FLXY 3PO5A 1RZMA 2OPSB 3ITHA 3BPDA 2ATCB 2XMTA 4TN2A 5LMNF 5H9EK 4F3MA 3OVSA 4C97A 5E3RA 3D3BJ 1RA6A 5KFWA 1Y00A 2Z2YB 1SIZA 2F5GA 2R2UA 3EGVA 2OO4A 1SV5B 2X1GA 3F56A 2DJWA 4CM2A 3NNAA 1U0SA 2HHQA 4ZDNA 5A6WA 4FP9A 3NGDA 2NUUG 5LMNJ 3CMQA 3BKUA 1HWIA 1RA7A 2BYCA 2HNYA 2WB1D 3OFFA 2KYZA 2E1PA 5IOLA 3CD6S 2E7VA 2XZWA 4DCJB 4PQAA 2VHGA 2I5JA 3DRRA 4DQSA 5T7LB 3ULHA 4L75A 4OHYA 2HKEA 3MPYA 3KLIA 3RBDA 4TLRA 2VU5A 3H98A 4JI0F 2MKIA 4JV0A 3QAUA 1YBUA 4WKYA 2OGUA 2Y0BB 3BV8A 3KHRA 2RRAA 3N0VA 2VQEF 3RZAA 3Q24A 5KFTA 3KXDA 3MGJA 2ZNZA 3O44A 4JI0J 3MAAA 3DDIA 1UVLA 3QRRA 2IYGA 4F50A 2LA4A 2VQEJ 1S99A 3OTDA 2ACYA 1QE1B 3J80Y 1KQKA 2IAJA 3CDEA 2Z30B 1TK0A 4USJC 3MXHP 3DNCA 1RTHB 1YBAA 3Q2TC 3FFIA 2W24A 3CCRS 1PG5B 3PEHA 4ZLNA 4DR2F 2FJDB 2CDRB 1JB0C 3J81U 5DQGA 2XY7A 3QJLA 4TQRA 2ROPA 5HJXA 1N56A 1S49A 3P96A 2MMYA 2W7PA 3HI9A 3OUYB 3DOKA 1NEEA 1ZM2A 3H4DA 4P2SA 4DU8A 1NZAA 4NX9A 3QIDA 4X62J 1KFSA 4DV4F 3OTOF 1F6TA 1XMQF 4YR3A 3OSPA 4DX5A 4DHVA 3K17A 3T6JA 2UVRA 1FNMA 1HQUB 1CJUA 2K3KA 2W8KA 1H7WA 5DDPC 4DV4J 4K7QA 3AB4B 1XMQJ 1MROA 4CO2A 2PMZD 3TZYA 2FVQA 2DGWA 1X5PA 3V6JA 3ILOA 3C6TA 1X4FA 1Y5LB 4ZP8A 4E0DA 2AJ2A 3GIJA 3P4UB 4Y3CA 2KDOA 3VAIA 2A1BA 2Q66A 2EEYA 4F36A 3IA0A 2CWXA 5J1EA 4L72B 4I4BA 1WNEA 1RLCL 2GA7A 2U1AA 3CIZA 3NP5A 2DEIA 1WF2A 2B5JB 2E29A 3D6MB 2O67A 1SL1A 3NAHA 3BYRA 3N4WA 4NLXA 4KGZB 2AW0A 4ZPDA 2NR0A 5F8GA 5CYMB 4EBCA 4L3NA 4U7CA 5B0AA 4DR5F 4AL6A 1SL0A 4QR1A 1HI0P 1JLCA 4YEAA 3WC2A 2WW4A 2HRYA 4O0NA 4AL7A 4P2XA 5C7PA 2HZAA 3RYLA 4MKYA 1T8EA 3VVUA 4ALZA 4WP8A 1WEZA 2P6TA 4DR1J 1U09A 1RWPB 2IVYA 5C2GA 4DR5J 1QD1A 2IM1A 3UPFA 4QYZJ 2IC3B 3E01B 3DI6B 3HDSA 3KNAA 5ITHA 5KFKA 1FRJA 4GC7A 1X4DA 4AE5A 4F04B 1RUSA 1CG2A 4JI1F 2DHAA 1FKOB 1V5IB 1IR1A 2FGCA 1FWPA 2GV1A 4FN5A 1Z1ZA 8ATCB 5IS2A 2RF2B 4Y28C 1Q8LA 5K8NA 1YJ7A 2VPYB 5E7OB 4JI5F 2DR5A 1F5BA 1NU4A 2DNYA 4JI1J 3QZ7A 1RWKB 2VBZA 1WKJA 2PEHA 4YB6A 1WTBA 1RTIA 1VHIA 3MEEA 1IVZA 3MDFA 2ZJRQ 4F4WA 1TELA 3W66A 1OYEA 1NRKA 4IR1A 1GX6A 3GLJA 3ZZZA 2E5HA 1MMDA 2V8PA 4C6AA 4ZPVR 3RR7A 3K5NA 2E5IA 3T9ZA 5DM7Q 4CP5A 1FRKA 3VAKA 1H74A 1WHYA 1N54B 5M2UA 1IKWA 2BQ3A 1TKXB 3D4JA 2EG2A 3CJ8A 4GKKJ 2BKNA 5KAKA 2VB6A 1H3DA 1RAIB 3W63A 2MZRA 1NBEB 2GVDB 4ZVFA 3HVTB 4ZITA 1J5EF 5KFEA 2BR0A 1NKBA 5BJRA 1SC3B 3OPKA 2JFDA 1R0BG 2XLIA 2G4BA 4YB7A 1NHVA 1XR7A 1RCOB 3CVKA 1AT1B 1REVB 3MTJA 1LNQA 5K20B 2AU0A 2P2CB 3LQVA 1WI6A 2EFQA 4LUBA 1S76D 4NCGA 1U49A 4HL9A 1J5OB 4DF8A 4L6V3 1DTQA 3PDNA 4JI6F 1U25A 2Y1JA 4OV1A 3AJ2A 1M5OC 4DOZA 1FE0A 2F40A 3V4IA 2DT9A 3OFHA 4DLGA 4Z7CA 1UW9A 2NYIA 2BE7D 1VBYA 4JI6J 4DL4A 1XERA 2LXIA 3TQEA 1B3TA 2JOQA 3GJRB 3EVOA 1R89A 5EHHA 1R8AA 3M1VA 4XK8C 4OX6A 3VCDA 4A4JA 3KMQA 1HNVB 2CJ9A 1HBNA 2PSZA 2VFRA 5HQLA 3CCES 4CYUB 2LECA 2DH9A 1EIYB 4ZLPA 2GIRA 5L1JA 4OYWA 3C16B 4IO1A 3DLGB 2UP1A 3OW2R 4PPDA 1FKPB 2LA6A 5KFPA 1M5HA 1S1UA 3OR1A 2OUGA 3GR0A 3WBZA 2Q79A 3V6DA 3D1OA 5A8KA 1QM9A 2X3GA 1FJ7A 2QG9B 3HHLC 2J6TA 4O4GA 3IP0A 3D3CJ 1PAEX 3C19A 3HO1A 2MQQA 1LWEA 3PW0A 3VTIA 3LPEA 1UVJA 1VFJA 3TOQA 2GQQA 3DMJB 4PKDB 2DH8A 4DZ6A 5FD1A 2B9WA 4NOHA 1TL1B 1RAEB 4RW7B 4F4KA 1CJKB 3N6MA 2UUBF 1G7CB 1NKEA 4ZVOB 4QPTA 1DLOB 3HHKA 1DTTB 1HPZB 1C2PA 2V4JA 4UOFA 2UVUA 1RHMB 1Y4ZB 5KOXA 4A8OA 2OIHA 5KOWA 5GMKa 1U1MA 2Q1LA 2VDHA 3ZZ0A 4O3SA 3MPWA 3KFWX 1NB2A 3HSJA 1KD1T 4RKUC 4O4RA 1P9QC 3QBCA 2HGNA 2V9KA 4C9DA 3DLKA 4LRFA 1QAYA 1H73A 4GO7X 4DPWA 2AJFE 1IM4A 1URNA 2HHVA 4D3GA 2YNIB 1EB0A 4FS1A 1RTDA 1SJ3P 2MJNA 4LBHA 1Y3KA 1NDLA 1VQLS 2KXFA 4OYIA 5GAGI 4DWIA 5JVHQ 4WFBQ 4RWWA 2F4VJ 4ECWA 1E6YB 2R42A 1U1LA 3QJJA 1NPKA 5FDLB 3I0RB 2BACA 1F5CA 4QIWD 4UZCA 4ZCIA 3DOLA 3HJVA 3TX0A 2LKZA 3TX8A 4KYZA 4TVAB 2R8GA 2KG0A 2HRTA 4M5LA 1XR6A 1ZH5A 3D54A 4MYUA 2V4RA 4RO0A 2QYGA 2AYBA 2WSEC 3JYTB 4BLGA 4TY8B 4DL7A 2LYVA 1NK4A 4IG3B 3SSSA 1TKTB 2M52A 4X4RA 2GJ2A 4LSLB 4DPYA 2PA3A 1UMJA 1JXLA 3FBEA 1SV5A 2JEFA 4U67Q 1RHKB 4DQRA 2WONB 4FYXB 2OTJS 4EO8A 3L7PA 1VC0A 3SFUA 2ZH5A 2VFUA 3WX4A 4RJVA 4ZJLA 2CJKA 2DCUB 2M2BA 1UTAA 2Z2MA 2FHJA 2X1AA 1X4HA 2MZSA 4HI1A 4OLPA 5T7LA 5HSPA 3RGIA 2J9DE 3MM5B 1HYSB 2L48A 1RYSA 5KFIA 3QYYA 4H4OB 2ZH3A 4WJBA 2UUAF 1O6XA 3GQCA 2ZFHA 4AFFA 4CLKA 2H5EA 3K58A 3JXOA 1Z2LA 1U8SA 1TFYA 1UEUA 3RJMB 4DSIA 2UUCF 3MR5A 4NI2B 4Q2LA 1XEZA 2MKSA 3ENAA 3H90A 2DITA 3IRXB 3BN4A 1YZ6A 1SB6A 2JVRA 4ZIWA 2ZUAA 1S1WB 1QE1A 1X9SA 2WOMA 3D67A 2ROGA 2C3UA 2UUCJ 5BXIA 2ZHAA 1RTHA 4YDXA 3TZXA 5HLFB 2XB2D 1NK9A 3TO8A 4HACA 2XG8A 3MWBA 4J9NA 2DD8S 3GCWP 1R0CB 2O01C 3OUYA 1B64A 2MY8A 3EZUA 3ZFVA 3MFIA 4O3NA 1L5UA 3R6LB 1VLYA 3BKFA 4DI6A 3CCVS 5E3AA 4N41A 2GGPB 4DJBA 3ZZOA 2OSQA 3EGZA 3V81B 4YY3J 3D1HA 3U27A 3SMZA 1G3OA 2VFVA 1FXRA 4NYPA 4H4KA 3RB3A 1HQUA 4X4QA 2P5VA 1D9DA 3CWJA 1XIQA 4ECSA 3W2VA 4IFYB 5CXTA 2NYHA 2ZM6F 3IFEA 1Q78A 1H6KX 3POTB 4PG7A 3A3OB 3AH6A 3DHWC 4UT4A 2W2MP 2RSQA 4GRSA 3MHYA 4CLPA 2MQNA 2KM8C 2HFOA 1EARA 1CQNA 3NMAA 5HL7Q 3FSYA 1NXIA 4OZ0A 2EK6A 2EFNA 2UV8G 3NS6A 2JLGA 4BCAA 1YHQS 3I5AA 4Y6IA 1EETB 2G2ZA 2QL5B 2R2TA 2B5JA 2ZHOA 4E8UA 2CNOB 3IXQA 2QJ3A 3MCMA 3Q8SB 2HNZA 2DNPA 2QIFA 2ZVIA 4A8QA 4JB8B 5CYMA 3OHAA 3TEHB 2P6SA 4DV6F 3T1HF 3AQPA 2V63A 1B7YB 1SUQB 2HWHA 2OEKA 5IV3A 2DR8A 2AEMA 2G13A 3EZOA 2CQHA 2V8VA 4DV1J 2ZZMA 1CC8A 5L1LA 2KZMA 2EK1A 4DV6J 3JQJA 1NAQA 1VRQC 3H7HB 4KT0C 3E01A 3DI6A 2IM3A 2I1RA 1F3VA 1X8DA 3CMAS 2DXEA 1U45A 4KGKA 2RJZA 3R7NB 4DR4F 1C4CA 3S6EA 3ILIA 2WCXA 3HVAA 1FKOA 4ED5A 1YZ7A 1R6YA 4WZMA 2KHCA 2RF2A 3IAS9 1QTMA 3I87A 1N8RT 3NG8A 1YRUA 1LQ9A 2CPEA 2EWHA 4C3LA 1DRZA 1QUVA 1T9TA 4DR4J 1HBMB 1R3NA 4K50A 1B7FA 3UI3A 3O5TB 4KGMA 3SFGA 5AE1A 4LQ3A 3HX9A 4OJ1A 3SCKE 1M5KC 2XMWA 4CT9A 1PKUA 2GCFA 3T5KA 1ZYQA 2BJEA 4DG1B 2NREA 2B9XA 2B51A 2MB0B 3LH2S 3MCOA 3A3PB 4F67A 2Y1IA 2BA9A 3R7BB 2KT5A 3IBFB 3RRGA 3MEKA 2M3DA 2YKPA 7FDRA 3B54A 1U2CA 4F0MA 3G8SA 3JTOA 3TARA 3I32A 2GVDA 4C8KA 4B3OB 1BWVA 4S0MA 3QSIA 5LSRA 5GAEU 4KBIA 1EKRA 4N5SA 5ETPA 1REVA 1IM6A 1TL5A 5IC4B 4DDFA 3RW7A 4DX7A 4X4TA 3UCUP 5D4LA 1XBWA 1L3SA 1X5TA 1J5OA 2AGPA 3TWZA 2W25A 1VR6A 3G6VA 2HLTA 2FB0A 1FO1A 1B0PA 1SKUB 4J9RA 2XS2A 2MQOA 3T6BA 1HHQA 1K8AT 1HWLA 3MM7B 2CPJA 3AJDA 5KFGA 2R7SA 2CNNB 3ZZRA 4MKBA 2C2MB 2J8SA 3CJ4A 3MMAB 5I3UB 1VOMA 4CDIA 1HNVA 2GIQA 2MSSA 2GHVC 4EGLA 1AYEA 3C16A 4OJ3A 2XO7A 1GTEA 4CTAB 1FKPA 4I0WA 3OTEA 3UD5A 1KC8T 1D3WA 1FKAF 1IWGA 3EUNA 1AZSB 1SH0A 4GMKA 1QDUB 3TZWA 1H98A 3S8SA 5KFYA 5B7WA 2LEAA 2O1PA 5KFLA 2BOPA 1NDPA 3BN7A 5KFRA 4F2RA 1VJWA 2X1FA 2I9SA 3DMJA 1URRA 3NOGA 3CJQA 4O3RA 1R6VA 4DFJA 3M8SA 4RW7A 4RBVA 4HHJA 1CJKA 3NKYA 4DLEA 2LDYA 2XM3A 5F8MA 1YLXA 3JTPA 2EKYA 2B4PA 1SH2A 3I6PA 1VK3A 1DLOA 4USHA 1Q16B 4XTTA 1DTTA 1HPZA 5F8HA 1RT4B 3OT9A 4ILRA 4Y2IA 3FRZA 1TAQA 2C1EB 3UWTA 4YOEA 1VQOS 1FTCA 2BXJA 2BJ9A 2CPXA 2W2NP 1ZAXA 2R2RA 4DSLA 2MZJA 2FHJD 5ETSA 2O66A 3CUNA 2UVVA 4C0HA 2ZH7A 1WHXA 1IBMJ 2VF3A 3LTOA 4KV8B 2E5GA 4YR2A 2IMWP 2J6SA 3PO4A 5D77A 4H4MA 4CZCA 1V3SA 4BC9A 2RQCA 3MI7X 5F8LA 3R5CA 3N28A 1N0VC 4QOTA 4TKTA 2GJFA 2ZKUA 1E6YA 1R43A 2HK2A 1VQ9S 4LF8F 4MKVA 2ASLA 7FD1A 2YWGA 1RDRA 2MTLA 4TY9A 2LEBA 2QMUB 4LSNB 3NGSA 3PRDA 4Y00A 1OY9A 1SKRA 4P7TA 4I68A 4LF8J 3CCSS 2GQ2A 2ZH8A 2H5IB 3NRBA 3JYTA 5KG5A 4OI4A 3HP6A 4TY8A 2JRSA 4PXCA 2R7WA 2OPRB 1REGX 3FCWA 3JSMB 3HZEA 3CCJS 4A8WA 1RKJA 2ZH1A 4DF4A 2NQPA 1ULRA 4V1Ak 4LSLA 5HMYA 3UDLA 1GXTA 1RK8A 2H65B 1L3VA 4EWTA 1WWHA 2WONA 1WTFA 5KG0A 2IDLA 4LF1A 3GJSB 3VALA 3HZGA 2EBEA 1SQEA 3HK2A 4I6YA 2F8HA 1N36F 2BE9B 4EBEA 2Z58B 2HHHF 1HYSA 3CW2C 3W2WB 3T1AA 2PDAA 4M5DB 2KH9A 5F8NA 1F2GA 2N4CA 1JLBB 1JXVA 3M8PB 1N36J 5E41A 4OYPA 5E3QA 2FC9A 2RQMA 1CJVB 5E0OA 3FBFA 4R0JA 4NI2A 4NLQA 4HKQA 1RWMB 3EE3A 3IRXA 4UOHA 2B4OA 2KO1A 2FTRA 3HULA 2E7XA 1JLQA 1S1WA 3FEXB 4YHHF 3MR6A 2M9KA 1BQXA 4KB7A 1S59A 4TNOA 5HLFA 3W9HA 3R9LA 2RU3A 2VG6B 2VJUA 2OH2A 2YBVA 1SC1B 3G96A 2AZ1A 4YHHJ 3RB0A 1I1GA 3J7YI 2MQLA 5CA5A 1WF0A 3T1YJ 2FHOB 1YJTA 4PPZA 2J7KA 1MMLA 1TKZB 2GGPA 1I94F 3ELHA 4KKOA 3TR5A 2P9EA 3IS9B 2RH3A 4LREA 2RUSA 4OI2A 3V81A 2ASJA 3LA0A 4ZVUB 3NY0A 2RT3A 4JP8A 1OPZA 5A8WB 2PC6A 1T7PA 3P49B 4IFYA 2DISA 1I94J 1DHMA 3UO0A 2ILYA 4C98A 4PWDB 2IHR1 3VAHA 4ZLJA 2R7UA 2VV5A 3ZTQA 3VF0B 3R2CJ 5D4PA 2X1BA 3S1TA 3W7BA 3NLCA 3KLFA 4ZCMA 4MMOA 3PHTA 5L46A 5BYRA 4B9LA 3TA2A 3M30B 3PNIA 1HA1A 3CJSA 4NEZA 4ED0A 1S1TB 4KAIA 2R8JA 1RKIA 4WFAQ 3M32A 1XNRF 1RWOB 5DO2A 3OL8A 4Q45A 2XMVA 3Q8PB 1FWLA 1UEVA 4NCAA 5BYQA 5CCLA 3I0SB 3SBMA 2WK4A 2WAQD 2HBQB 2ZZNA 4KH1B 1KBRA 2DK2A 3J7ZT 3DM2B 1NH7A 2CJQA 2ROEA 5CZVA 3VGUA 2DR9A 1S6PA 2ZKTA 1WG5A 3TZZA 1WOSA 5AE3A 3NNHA 2PIIA 2YNFB 3EICA 4C0BA 4PABA 1HMVB 3HKWA 3IAM9 2YWKA 3H4BA 1V3RA 4AQYF 4RL1A 1KR4A 4WXWA 3PJXA 1YKWA 4X4VA 1BGXT 3DGPB 5IT0A 3CDWA 3MPDA 1YI2S 1RT3B 2JEIA 4AQYJ 3QLHB 3W64A 4PQUB 1QUPA 2SXLA 1QVFR 3HMJG 4JOUA 2QEXS 3A4TA 2OD4A 1F60B 1IKVB 1SJ4P 3KJQB 4K4UA 1IWAA 1HBMA 4MK9A 1BQMB 2R9LA 3A3NB 3KK3A 3K5LA 2C2EA 3PACA 3X3UA 2ZWPA 1EX8A 4MKAA 4ILMA 1JLFB 4NLWA 5GAGU 2K06A 3QNWB 4LIRA 2CAJA 2DEJA 4MJKA 5MLCV 1V3ZA 4YS2A 4DG1A 1VIOA 4IH7A 4DBQA 2ZVSA 1KRPA 1XNQJ 2LP4A 5JJBA 3RG6A 1T11A 3EXCX 5C5JA 2IM2A 3A1YG 1Y11A 3THTA 5KFCA 4C3MA 3MAHA 4KQZA 2QL9B 1HHTP 5DETA 4NLUA 3BO2A 2ASDA 3PYEA 4KY3A 4FKXA 3MCSA 3DU5A 5ADZA 3FC9A 2AEFA 2RB7A 3HT0A 2W9AA 1PJ6A 2HQDA 4Y34A 1VQ5S 3QIPA 4JUZA 3HPOA 2AWZA 3HSZA 4F4ZA 4MK7A 2GC8A 3D5MA 3WZ0A 1F9FA 1HNIA 4G1QB 1K0VA 3DC2A 1GMVA 1SIWB 1S9FA 2GHPA 3GG0A 2KXNB 2JEGA 1U0HB 4G1PA 1AUSL 1R8BA 1OO0B 2GVZB 5HJYA 1WORA 4OYXA 5D15A 2I6WA 1JIHA 1RAFB 1RU1A 2NXCA 3AOCA 2V8GA 1ACMB 1T05B 4N56A 1NSQA 2QX0A 4QCLA 4P71A 1JMTA 3R27A 2XMJA 3ISNC 4W92B 3ICLA 2QSFA 2P9CA 2AD9A 3MMAA 1I6JA 1MWYA 5I3UA 4B9UA 4DL3A 3C15B 4UUXA 3F44A 1DQAA 4NCBA 1EP4B 4J91A 3IWNC 4F8RA 4F25A 1S1XB 2DKOB 3OBIA 4CTAA 2DHXA 2W2QP 3PX6A 3K57A 2AYMA 2CKWA 1VBKA 1UEKA 1UZHA 2LMIA 4F3QA 4DV3F 2FLOA 4CT8A 2G2YA 4RLEA 4OX9F 2J9CA 1RI7A 3E2EA 1RT7A 3Q8YA 4K4TA 1KHVA 4DEZA 2Z2LA 3FCHA 2DPIA 3MEDA 1YVFA 1U7LA 4OX8A 1AZSA 5IM0A 3CIMA 2GAGC 2NS1B 4CLYA 1NJXA 3HKZD 2HHTA 4OX9J 1DQ8A 4OFZA 1B70B 2RQKA 1WC5A 1YGYA 1G2EA 3MF5A 2E44A 1TKDA 1HNZF 3KLIB 2HS0A 1W7WA 4J37A 4OYAA 2HGMA 5GADI 2F1FA 3GG1A 1U1OA 3ZO7A 1Q8IA 2C2RA 2YKAA 2V68A 4I6AA 4K2JA 1RT4A 3FMBA 3HD2A 2N82B 2HQFA 4P72A 5MAOA 3FVYA 5HMZA 1WJ9A 3EGNA 2ATLA 2XO6A 4G65A 2EFOA 5B0EA 2FLPA 4FVCA 2MQMA 1M5PC 4N7TA 4EU0A 2MXYA 4ZPWR 3G6ES 1XTZA 1OMSA 3PKMA 2BKOA 2V4QA 4DV2F 3BGUA 4A8KA 4QWEA 3R5JB 4KV8A 4U7UK 2KJWA 1YJ9S 4FVMA 2BBEA 3QO9B 3DOKB 3PRBA 2DXFA 4U7UD 5CAAA 1K47A 4DV2J 3VGVA 1YK9A 2YX7A 1RHQB 2DRAA 4OV6A 4F26A 2HFSA 2Y1RI 3PIOQ 2BEFA 4QYRA 2EPIA 2GZOA 1CJTB 2G1HA 4IOBA 1WHVA 3EVWA 3CDAA 2F65A 2W01A 5F0UA 1IKYB 1T3OA 3H42A 2A0FB 3QGHA 2B56A 5D4NA 2QZ8A 2GO8A 4DN9A 2ZDOA 4DX6A 2VQFJ 4LSNA 1GNKA 2M8HA 4IRCA 3TAMB 4LBIA 5E3PA 3TAPA 3J7Z5 4KH0B 3ZNUA 2OPRA 3JSMA 3PEJA 1FK9B 1U1PA 1FRMA 3BSOA 1TFWA 2R7VA 4ZA1A 3D9BA 1R0AA 4DCOB 2UUTA 3D0HE 4OJHA 4KPYA 3ZC4A 1V6HA 4B17A 3MPVA 2XSFA 4RNNA 3H2LA 2BJDA 1VQ4S 4NLYA 2KB2A 2DGQA 4NLRA 3UN3A 1VRTA 2DRDA 3UD4P 3ZZPA 2J7UA 1HQEB 4QJVA 3V5RA 1UZDA 3W2WA 4M5DA 1Y0HA 4ZJOA 1ZA2B 1KWMA 4U96A 1JLBA 1LWFA 3SEOA 3W5XA 1N34F 3M8PA 5JXSA 1HNWF 3CC4S 4C8YA 4U6PA 2NZ4A 4ZN3A 4K0KJ 2ZUGA 3VR1A 2RD5C 4B3TF 4QU6A 1N34J 4RW9B 1HNWJ 4DL6A 4FF2A 3NGTA 1WI8A 1HD1A 2CFXA 1VQKS 2H9ZA 4B3TJ 4ENOA 5J2QA 2VG6A 2MYFA 2FD2A 3NS7B 2K7JA 3PYDA 4ZPTR 3EJMA 3TANA 1UVIA 2D1CA 1S72S 4GVBB 3C14B 2ZBRA 3G87A 1G4CA 5DG9A 1WSVA 4J9MA 3R3TA 4IR9A 2CXEA 1FJGJ 4KGVB 3IS9A 1YG0A 1HBOB 2DO0A 3FK4A 1RT2B 3GTYX 2IJRA 3KTQA 4C8LA 5T14A 3SI8A 5A8WA 3OJUA 5H9FJ 2KT2A 5EX3A 2RDDA 2F63A 4PWDA 3A8IA 1ZETA 2ABYA 5HO4A 3R2DJ 5EUHA 2YPYA 4HDHA 2ZITA 1E6VA 1N5YB 5KFZA 1D8YA 2AIRB 4PR6A 4ED6A 4CCHA 2E1AA 3CJ3A 5F9LA 5D0HA 3AQOA 2MZQA 3MM8B 3BS9A 3OXLA 3VGTA 2PA8D 2HW3A 2W9BB 3M30A 5HP1A 4OLOA 3BGRB 2DGXA 1S48A 3J81Y 1ROFA 3W62A 4M5NA 3FBCA 4RBUA 3MMCB 3M6XA 2BJ8A 4URGA 4DV0F 5GMDA 1RCXB 4Q7AA 3AD9C 4UOGA 4B9NA 4DUTA 4LR7A 3S01A 5KFXA 4FYYB 1B99A 3IMQJ 4USUA 4ANEA 3I0SA 3RBZA 2Z4PA 3QJPA 1NK8A 3DM2A 2LU1A 3DXSX 3BREA 2XCPA 4FXDA 2IJNA 3V4IB 2KFNA 4DV0J 5F9NA 2FVPA 1L3TA 1ZAWA 2JH3A 2YNFA 2MKKA 1HWUA 3O3LA 4ZVRB 5HQMA 2XHWA 1HMVA 3FCVA 4IOAQ 4L76A 1S77D 3L7UA 2MY7A 2VC1A 4OI0A 4Q44A 4J90A 4B3SF 3DGPA 2DBBA 4ICLB 3P3DA 3UN2A 3SXLA 1T9XA 1RT3A 3WC0A 2FY1A 5HK4A 3RRKA 1I5OB 4BBYA 4URSA 3QLHA 4PQUA 5DS7A 4ECVA 1Q53A 3UDEA 3HFVA 5AXKA 1IBKF 3M2VB 5B0CA 1UAWA 4X65F 1P1TA 4OI3A 1WG1A 3D6FB 1XN9A 3LUYA 1UFWA 2LXFA 4KHMA 4GKJF 1LFPA 4R25A 3AHPA 1YWXA 2E66A 3HFZB 3LGNA 4CIOA 4OZ5A 1JLFA 3M6VA 2FDNA 1K9MT 5DJBA 1Z4UA 5DM6Q 3R5GA 4L74A 5DGAA 3NS5A 3CD5A 4MK8A 3LANA 2XMUA 1SJ1A 3GFXA 3AJ1A 1MN7A 4PZVA 1GAOA 3Q86A 2A2CA 1NSPA 2WBMA 4WTOB 2JHEA 1V9OA 4LR9A 4KR0B 1N5QA 3I82A 3B4MA 3CCTA 2Y8WA 1HNXF 2V5HG 2K8GA 4HI2A 4HH0A 3M8YA 4CLSA 3QRPA 2GHWA 3UR0A 2QT7A 4K2XA 3Q22A 3E51A 2RU9A 2XMKA 2JEJA 3N6NA 2ERRA 1RB0A 4A8MP 4V19J 2QA4G 4KHPF 2V50A 1UJ4A 2XS7A 4HDGA 2CUYA 2YKQA 4QWDA 3M9NB 1WUUA 2R8HA 2Y3YA 3TVKA 1IBLF 4G1QA 5DLFA 2VPWB 1U47A 1YRTA 1ELOA 4NA1A 1U0HA 3AFGA 4URQU 5KFVA 4U8VA 5DZ6A 1AB8A 1K1SA 1ZTTA 3TI0A 1NUEA 3NGRA 1IBLJ 1VIXA 1T05A 1WKKA 4ECQA 3R5BA 4NLGA 3DOLB 5DRKA 2D41A 2B6AB 1JNRB 2WB4A 2Q6CA 4DPXA 5L8RC 1VMBA 3QPIA 1R8PA 3CD0A 3C15A 1HW8A 5A2QY 1EP4A 3U1NA 3HFKA 4EUVA 1BY9A 3U1LA 3SSRA 4TU8A 1AA1B 3J81j 1S1XA 1M0SA 4HT7A 1UVMA 3BYPA 3IBCB 3W8GA 5ETKA 3UDVA 4N47A 5KFMA 1GH8A 2DY1A 2V94A 1WC3A 4N77A 3G9CA 2IM0A 5EX0A 2RIJA 3KKFA 3TA0A 1UCNA 5HMXA 4ES2A 5KG6A 3GZ7A 1UW4A 2CPDA 2NPFA 4PRFA 3J7YU 2Z57B 2XC9A 1SPBP 1U6ZA 3GONA 1M90T 1S0VA 3AODA 1RT5B 1RWVB 4P6QA 3BB5A 4DQQA 3IG1B 1QTNB 1KTVA 1HFEL 2C2KB 4JBCA 2CQ2A 4LF7J 1QAXA 4IDKB 3O8WA 1SJRA 4NL5A 1S6QB 1FRIA 1WC4A 4DQIA 3W1YC 4NRUA 4Q5VA 4HTIA 3H20A 5C25A 2WOMB 3TRGA 2ZHBA 2DHSA 2JFKA 4HR2A 1Q0NA 2XCAA 4LRDA 4HACB 4HH1A 1HARA 1BWEA 4X62F 5I3QA 4ZKAA 4IRDA 4NXNF 3HHLB 1M5VC 1MNEA 1VQYA 3QO9A 3SCIE 3G82B 4LRAA 3OXGA 2UV8A 1SKWA 5KT4A 3SV4A 2BQRA 4K4YA 1LOUA 2ZH2A 1LXJA 2YX1A 2QGFB 2CJAA 3TJ9A 1U2FA 4ZN1A 3NBPB 1KTQA 4NXNJ 1CJTA 3ADAC 4Q8EA 1T03B 3M4XA 1W26A 2C2ZB 5J1PA 4FS2A 1IKYA 3W2VB 3BF4A 1D09B 4OJGA 4J9PA 4WK3A 2BJ3A 2BW7A 3ZXWA 2J0SD 3HXMA 4ZMMA 1HKAA 1RTZA 3TAMA 4DUZJ 4CH1A 2XHCA 5HI7A 2OAUA 1XJWB 4PG4A 1FK9A 5HN0A 2DNLA 1JKHB 4ZPCA 3KNGA 4X4PA 3K8WA 4IYQA 5IT9U 2IYIA 1F3FA 4NZ7A 5IC6B 4AXJA 3TUPA 4Q2MA 1NSKL 4RNHA 1RQ0A 4RX6A 1VHFA 3OD2A 2L9WA 4CLUA 5H9EJ 2AQ4A 2HVEA 2V34A 2BW2A 5HVFA 2CJXB 2WW8A 4ZCKA 1HQEA 1TZ0A 2DGVA 2HNZB 1X0FA 5K8MA 4DR1F 2ASYA 2QLJB 3FRYA 2D3UA 4NPOA 4F0HA 3IC1A 2KJVA 1S4FA 2ADBA 2L9NA 3LP2A 5D0EA 5LM7E 3ETOA 3IM9A 1U1NA 4XAKA 1VRUB 3PY8A 1KFDA 5KFHA 2XYGB 4ETZA 3JAMU 3LAKA 3HLUA 1I3OB 4HVZA 1RT1B 3CE8A 4EO6A 1UA0A 3LGMA 1TQLA 4RW9A 1MLAA 2LXUA 3M8WA 2CQ4A 3I9ZA 1WDDA 4X66J 1ZOTA 1TK8A 1NKCA 5EN1A 2N7YA 1T0TV 2HNDB 3EPIA 1Q81T 4CNZA 3MR2A 1J27A 2DH7A 1H0HB 1HWJA 2YVSA 3PYFA 5GVQA 1X4BA 1FVQA 1VC6A 1KLMB 4I1TA 2BM0A 4I67A 2Z0GA 5KFJA 4DX8H 4GVBA 3C14A 2MZTA 4CQ1A 2G9OA 3MD3A 1KQGB 1JNZB 3M9OB 4NYZA 5ETOA 2M5YA 2EXUA 2BVZA 2DNNA 3U02A 4ERDA 4GKKF 2QA1A 1HBOA 1RT2A 1DARA 3H8YA 4CI0B 5BR8J 1RYRA 2UXDF 1RTJB 3CNQP 5KT3A 5FJ4A 2XWYA 3CULA 5LXYA 5HAOA 1T9WA 1YJWS 2ALYB 4F2SA 9ATCB 5CH7B 2UXDJ 1JLGB 1N5YA 3TYTA 3PM9A 5AE2A 3T19A 1XWLA 5CD4A 1UA1A 2UUWA 3MM8A 2C22A 4NLSA 3UW1A 5J2PB 4X4SA 4PG8A 2W9BA 4DPOA 4DV5F 3BGRA 3K5OA 1MU2B 2R7OA 5DDRC 1Q79A 1T9YA 1M1KT 3MMCA 1ZS6A 2DHHA 2HBYB 2ZZTA 2J76E 2AHOB 1VQNS 3BM7A 4DV5J 4UQTA 1T9UA 3NEKA 3MUMP 1NJIT 5K8PA 4FBUA 4UUWA 4OX7A 3PW5A 2CQIA 3WDOA 4W90B 3DCAA 5RUBA 1U8WA 3GFYA 3RR8A 1HW9A 3BO4A 2MHNA 4ICLA 1WDTA 3EWGA 1D9FA 2VPXB 4TYBA 4B08A 4CO4A 3DN9A 1FE4A 1Q4RA 4N8NA 2HRUA 4C7QA 3MZIA 2DTJA 4OHVA 5G0RA 1WOPA 4YN3B 3MMJA 4KRWA 3M2VA 1MSWD 2A2DA 2RILA 3OTBA 1QLNA 3T5JA 4M94A 1SQFA 2BABA 2ZH9A 5I3PA 4IKAA 1DBDA 2F8MA 1IQTA 1RADB 4WTYA 1MG7A 8AT1B 3I4PA 1UVKA 2WSCC 3RUBL 4JI8F 1QAIA 5A6PA 1UFKA 4K5SA 2R4FA 1DJ0A 4LFCJ 5D6GA 4FNIA 5IT4A 2WVDA 2XSJB 2AGQA 3FQLA 3GV7B 2YWHA 2JZ5A 3CCQS 4K59A 2LQ8A 5ETVA 1OPIA 3G6XA 4RWXA 4DFPA 4WK1A 4Z7YA 4JI8J 3T9NA 2IFXA 3B78A 3W5ZA 4DR3F 2RKIB 1CLFA 3BPSP 4Q0BB 2VBYA 1VQ7S 2AT1B 3O2IA 2BJ7A 2DNQA 4YMEA 4DR3J 3M2UB 1R27B 2H54B 3AAWB 1U02A 1R31A 3P8BB 5C2CA 1SCJB 5KFOA 4E2FB 2DNMA 3MPUB 4OYMA 4IUFA 3C6UA 2AKWB 1D1UA 4LMZA 3GWCA 2F4VF 3MM9B 2VBXA 4K4ZA 5E5NA 4QW8A 4H4MB 1CEZA 1EKSA 3FBBA 2CNKB 3HJFA 3OVAA 3BGLA 3QFHA 5A8RB 4X2BA 3GIKA 3IGNA 1S0NA 2B8QA 1CPZA 1T95A 2I2YA 1RHUB 4C8NA 2UU9F 4ZVSB 2VIHA 1MW7A 4JI3J 2VD3A 2MQPA 1VISA 4WF9Q 3BH7B 3CB4A 1WOOA 3QWUA 1HBUB 2OFGX 1AFJA 1SQGA 2B6AA 1B4SA 2B4VA 4KFBA 1AFIA 4IG0A 4CWBA 2F9JA 2NXJA 3KYLA 3ZTRA 5L1IA 3CDBA 4IRKA 3G4SS 2DGTA 2UU9J 2QMXA 4UTGA 2IRYA 3QSYB 4XPCA 3H0PA 1M5SA 1RABB 4M5GA 3LPYA 1X4AA 3QT6A 3CCUS 4UF4A 2IRUA 3CD7A 1P27B 1KLNA 1PAUB 1PYOB 4ZVEA 1MWQA 4G1IA 2AMCB 3FUYA 2YKNB 4ZK7M 1YSJA 3LOUA 4F02A 4Z2XA 1EZZB 3TUZC 2NXEA 5KFQA 4OHWA 1FJEB 3ETMA 2FJAB 2AZ3A 4B9SA 4ZPBA 1RT5A 3M6UA 3KLHB 4FNHA 3UVJB 3PW4A 1DZ5A 3AOAA 4DQPA 2DRBA 4FF3A 1RBOB 3IG1A 3M2RB 3I9V9 3ENQA 3NXZA 1NZ8A 2V8HA 1T3NA 2IY5B 5D0RA 2QN6B 4EEYA 1FA0A 4LRBA 3I56S 4F4XA 4IDKA 4NLPA 1S6QA 1O5JA 3Q8VA 1S0OA 2CQBA 2XMAA 3BGFA 2GAHC 4MIBA 1JLQB 1XMOF 2H5JB 4BC7A 1RAJA 2Q6BA 2B8PA 2OELA 4USTA 4ECZA 1BUXA 2RUGA 3DFEA 3RU0A 4NEYA 4NMXA 4WYLA 4J9LA 1XMOJ 2I8EA 4RUCA 4NRTA 1L3KA 1IBCB 2DNOA 4FYWB 4YY3F 3OQ2A 3HHLA 2DNGA 3BH6B 2R7TA 2A6MA 1WSRA 2M4MA 2AJQA 3G82A 2VONA 4P52A 4KKOB 2D9PA 2HSEB 3EZ5A 2G1DA 2OMOA 3NBPA 3P45B 5D78A 4J7CA 2GIFA 2WVCA 4GVLA 2MEWA 1T03A 2VASA 2QL7B 3KG4A 4RUBA 4LT6A 1TVRA 3CGIA 4ANDA 4A8YA 4OI6A 3D0IE 4LRCA 1U1KA 1TAUA 2IRXA 4C3KA 5E2QA 3Q23A 4NLDA 3D7SB 4ED3A 3KLFB 1NK6A 1JKHA 2MZ1A 1SL2A 2H4WB 2ZH4A 2QLBB 2C3OA 4HT5A 4FPIA 2HGLA 4NYOA 5KFUA 1S97A 2H51B 2ZBIA 3M32B 1Y3JA 5KT2A 3GB0A 1DQ9A 1KS2A 3QGPA 1IUJA 3LWLA 4Y0FA 4IFVB 5HBMB 2XLKA 2VG7B 1N52B 1IR2A 1PJ5A 4OHZA 2JDJA 1S6PB 1FDDA 4DV1F 2DVIA 2BRLA 3J7A1 3GFHA 2PI5A 1X0PA 2WVFA 1OSDA 4P7VA 2QTWA 3CDUA 2JC0A 3L7OA 2N3OA 1VBZA 3ZTSA 1VRUA 1SJFA 2VA2A 2FYXA 4OMFG 2CA9A 5HVHA 4AXIA 1K1QA 3FSIA 2YWFA 4WWSA 4RU2A 1RT1A 4QIVA 1B0VA 3K0JA 2ZDPA 2XZDB 2PI4A 1A6LA 1LW0A 3LGHA 3DDKA 4LF4J 1RT6A 5CCMA 2L9DA 1C0TB 3H40A 4DS5A 2HNDA 2HBZB 5GAEI 3K2YA 1BMQB 3EDRB 5B0DA 3I5BA 2YWEA 3JSBA 3QFWA 3DRPA 3GR1A 2NSBA 3KDOA 1T94A 1NO8A 1KLMA 4CRJA 3KK3B 3A12A 2V2KA 2VDIA 3EGWB 1VS3A 3L9ZA 2EI5A 5IQ6A 1AROP 3GYXB 3CC2S 1GEHA 3OHBA 4QR2A 1C1CB 1OIAA 1RTJA 4Q8FA 1BQNB 2W9CB 3X1LB 3AB2B 3W9JA 1PO6A 1VQMS 3UCGA 2ZJPQ 4QWAA 1KVJA 3IR5B 5B09A 4NLVA 4QYZK 3OTCA 4NASA 4A8SA 1JLGA 2LLZA 4KO0A 3AXKA 2F9DA 3KJVB 2VUGA 3K59A 3K5MA 2XS5A 4DR7F 1JJ2R 1X9WA 3CJ2A 2BOAA 5J2PA 4QQBA 1A0OB 1RAAB 3QIPB 1N88A 1MU2A 1FNXH 1BD6A 3QGIA 5KFNA 4DR7J 1W2BR 1FI4A 1X9MA 1HNIB 2AYGA 1C4AA 3IR7B 1NNDA 2GQCA 5KG7A 2Y0SD 4ZVGA 1FEEA 3BBFA 4RUHA 4ELUA 2J8AA 3Q8QB 5IV4A 4EFAC 5D0GA 2FJVA 5L39A 3DRSB 1N32F 3MAQA 1TMMA 3DRXA 1SI9A 4DR2J 1S7HA 2QYCA 4YB1P 2ZD1B 2XTJP 2QV6A 5KFDA 4M5HA 3R5DA 5B0FA 2HG4A 2H1YA 1N32J 5K14B 1Q1KA 3HSDA 3OTOJ 3GILA 1IR0A 5SUHA 5JMNA 1TL4A 2ALZA 5DZ7A 3HF5A 3MMBB 5IQQA 5DG8A 3KK2B 2FLNA 2CDQA 4EK2A 4L3KA 3M7VA 1HR0F 1QSSA 1RT7B 4RW4A 2VH7A 3MEDB 1EHWA 5IM0B 3DLEB 5A0YB 1F9EB 4YUDA 2YPZA 3KOAA 4PG6A 2UVWA 1HR0J 1DURA 2V9WA 5AT1B 1HIYA 3GE9A 1KN6A 2E5JA 4F4AA 2FZCB 1R8CA 2XSJA 4DU7A 4K5RA 1RWNB 2POKA 1UVNA 1FERA 3PJ9A 3KHHA 4I2PB 3K89A 3R1HA 4LBPA 2KRBA 2EKNA 2RKIA 1FT8A 4CH0S 3FKBA 2AJ1A 4Q0BA 3EYZA 1PC5A 2NZCA 2XMMA 3E8OA 4X4UA 2QMWA 1IBMF 4C0OC 2FUG9 2MKCA 2J7WA 2MKHA 3RAMA 1YJUA 2NXUA 3GU0A 3US5A 3VAFA 1VQ6S 3BSCA 3W61A 3M2UA 5KG4A 2EG1A 1KDNA 5J1NA 2XYPB 1IKXB 3B82A 4JV1A 3FGVA 5IFMA 2QLXA 4O3QA 3MM9A 2H4YB 4NE9C 4OHXA 4QU7A 4TLQA 4B02A 3UN5A 2HHUA 5A8RA 2KVQE 4J9OA 3PFEA 5LJ5Y 1IN0A 2R7RA 4DFMA 4ATNA 3D6HB 4U8YA 4I6WA 1EQ0A 3SQGB 3H5YA 4ZVTB 2GX8A 2OD6A 1U26A 3K8VA 4LF9F 1X31C 3BQ1A 1Q82T 4ZLLA 3RTVA 4UY85 3KUGA 3PFOA 2VG5A 4ZS6A 4JI5J 1YQHA 3JSYA 1HBUA 3H5UA 1BHNA 2RHQB 2OP5A 1JK9B 4LF9J 1QSYA 2IMOA 3MM6B 3FJ2A 5EWGA 5CYQA 1TV6B 1N5VA 1RJJA 1JLAA 3HHLD 4RNFA 2WRMA 4N8OA 2Y1LB 2BANB 3O1LA 4NA2A 2FVSA 5J2MB 2CG4A 3FEZA 1UWAA 1K0TA 4J9SA 2L08A 2WHOA 3OL6A 3C2PA 4RNOA 2VL1A 1R0AB 1KNZA 5FLXU 2CJYB 4Y2CA 4AT1B 4CO1A 5A2QU 2E9RX 4DXLA 2YKNA 1TK5A 1N6QB 3FDSA 4C48A 3Q83A 1Y5NB 2HFVA 4AD6A 1VRTB 2DGOA 4WZQA 1FHTA 3R6GB 1VQPS 3MOZA 1J5EJ 4GO5X 2VKZG 5JUMA 3UNYA 4JI7F 4I2QB 1TUWA 2OHDA 2VFSA 3PHEA 3P6YC 3DYAB 3KJFB 3F41A 5DDQC 3UR3C 3ENVA 3KLHA 2E5LF 1IJEB 3UVJA 2B0GA 2K3IA 2AGOA 1Y10A 1LWFB 3L3CA 3M2RA 3W60A 4ER8A 1Q7LB 4B3MF 4JI7J 2QFIA 2PO4A 2RVJA 2E5LJ 2XNQA 4ED4A 1F9HA 4EBDA 1LKZA 3KMSA 2PN6A 1PJ7A 1OY6A 4B3MJ 3VV2B 5GAHI 2J5AA 3KLGB 3AOBA 3BEGB 5C24B 1OQ3A 2GJIA 3T1YF 2BZ2A 3WIUA 2HYIB 2ZJQQ 1EJ7L 5J2QB 2BUNA 2CQ0A 3GCXP 3HHEA 2E9ZA 2HVIA 3AY0A 4K8RA 1PYTA 4Q43A 3OL7A 3J80U 2W2OP 3PR4A 5HMWA 3V6HA 4WE1B 1KEKA 2AJ4A 1T9VA 4DFKA 5M2PA 4QIFA 3TQ1A 3RW6A 4ZIVA 1NJZA 1FNOA 1AW0A 3OV7A 4NLOA 2L3MA 2NCKL 3ILLA 3KLEA 3NOCA 2QA4S 4BHQA 3MUTP 4ZJQA 4H4KC 4ZCLA 1E6VB 3AD7C 3G8TA 2MQ8A 2ILZA 5HVGA 3TEGA 2YNGB 1EAYC 2VFTA 2QE5A 2FVRA 4B9MA 5F0WA 4I64A 3F73A 2ZC3A 4LVNP 4ZVPB 1ZZNA 4RZRA 2UUBJ 4RW8A 3C3LA 3D66A 5HP1B 2C28A 4K4VA 1AXQA 5E3CA 2YQ1A 1PCAA 2G0CA 1S7IA 3BJYA 3KUHA 1BLUA 4PXBA 3BGOP 4CNYA 4ZPAA 5CD4H 1NM2A 4IFVA 5HBMA 2R3VA 2KTQA 1SC4B 2VG7A 3ZTOA 3M8QA 1O0PA 3D6TB 2ZOFA 4ZVHA 2FLLA 3OR2B 3OJSA 2IA0A 2OMLA 5KT6A 1VK8A 3KWMA 1FTRA 4C8MA 2HURA 4KPCA 3KK1B 5IWAF 3VZHA 2HVHA 1OYDA 5DGBA 2EBGA 4JYAF 3HVRA 1FX2A 8RUCA 5L1KA 3MUVP 1TMJA 3VAMA 3CSKA 1QAJA 2R8KA 2F8EX 3NMRA 1UJ5A 1RAHB 3D1QA 1HI8A 1UJ6A 5HANA 3C66A 3CJTA 5IWAJ 1VQSA 4A8FA 3GP9A 4W98A 4JYAJ 2M8DB 2WZ1A 4WU2A 3MD1A 5A76A 4CLFA 3SCLE 3HHDA 4E98A 4IOCQ 3GSDA 2D3O1 1VYAA 4DSJA 1SH3A 5ETRA 4XPEA 1C0TA 2DO4A 4ZP9A 4C8OA 4OZ2A 4U9RA 4TU9A 2ZC4A 2OPSA 4N76A 1FXLA 3KG1A 2HFNA 2HWTA 2CPHA 3QRQA 1F1BB 4BWJA 2M0GB 1YJRA 2P9GA 1X4CA 2C2DA 3VQSA 2C42A 2VA3A 3OXFA 4DSEA 3ZNJ1 4FDFA 3BO3A 1XNQF 3SCJE 2J0QD 2ZBPA 2A3JA 1KSPA 1C1CA 4DUYF 1TP7A 2E1MC 2FZGB 3PYGA 5K9FA 2HS4A 1BQNA 1NMEB 3LW5C 2W9CA 2KL8A 3CXCR 1P9YA 1PILA 2J6UA 4JV2A 1Q5YA 1B0TA 3PR5B 2UXBF 3OVBA 3CPWR 1NJYA 3JB9k 2BRKA 4DUYJ 5I4MA 1IJFB 1APSA 3OLBA 4HYKA 4ITSA 3CT9A 2HIQA 4QPXA 2HEKA 1LW2B 3KJVA 3SIPB 4ILLA 2UXBJ 3MCNA 4NWBA 3VVTA 4WXOA 2ZWOA 4JV5F 1CC7A 2UUAJ 3GJQB 1FCAA 3AT1B 4PCQA 2H48B 1U4BA 2W4DA 2CVEA 2B4UA 4WIIA 4FYDA 3GMGA 3CEDA 2MKJA 1M1GA 3U1MA 1X60A 4JV5J 3FZ2A 1XK8A 1LV5A 1WC6A 2DB1A 3PTWA 4DR6F 4KE5A 5HROB 4O3PA 5KFFA 4V19X 2MHEA 4AUKA 4O44B 4MH8A 2LQ5A 1K44A 3DRSA 2XEXA 4QZVB 3H2UB 4DR6J 3CJKB 4ZP6A 5H1SV 5KFAA 2ZD1A 3AD8C 1TU0B 1HLWA 2MLXA 5KG1A 4R5PB 1TR0A 4Y2KA 4BS2A 3CJ0A 5K14A 3LP1B 3F0NA 5HQ8A 3SYZA 3KUEA 1A7GE 5KT7A 2N7CA 2Z2ZA 1RHRB 1CULB 1TUGB 3JTNA 3MMBA 4FXVA 1TL3B 3KK2A 3OFEA 2A18A 1PSDA 3V4MA 1ZTWA 3QATA 1Q8KA 2FJXA 1NSAA 1YJNS 3HSGA 2ZM6J 4RW6B 1FFSB 3R7SB 2JSXA 3DLEA 3NAIA 1ZA1B 5A0YA 3GV8B 1QVGR 1WEXA 1WELA 6FDRA 4OYBA 3TUIC 3I31A 4F7VA 4YDDB 2OPQB 1JWWA 4NMLA 3EPGA 3RRHA 2JWNA 2CPYA 3BR9A 1VI7A 2HQ3A 5KG2A 3R1LA 2GW8A 2AV5A 2A6OA 4PWWA 2X3DA 4I2PA 4EZ6A 5DQHA 2CPIA 1X4GA 4HHUA 4ED7A 4X4OA 4NA3A 2COLA 2NSCA 4KIAA 4DSKA 3A8JA 3W65A 5IZHA 4EYHB 3N79A 2V8DA 2DGUA 5C25B 3KDNA 2W7AA 4FKYA 4WBFA 3T1HJ 2CQCA 4CH7A 4I56A 3TA1A 2IC3A 1O8BA 1FX4A 1IKXA 2Q3PA 5EDWA 1JX4A 1U6BA 3DKDA 2YWWA 1S10A 4CM0A 3CF5Q 4RBTA 4CO5A 2MLZA 1WG4A 3LF0A 1WC0A 1BXNA 3PCOB 5T41A 2B43A 5GMEA 1OQ6A 5ETQA 3GYNA 2HBRB 1HQ2A 2MJUA 4GC6A 1S9EB 3SQGA 1ZZFA 1D9AA 2VQFF 3QT8A 3N5BA 4DSFA 4CLZA 5CYJA 2RRBA 1P8GA 3CCMS 2DY9A 3UCZP 1H72C 4CO3A 2RDJA 3IO1A 1KKHA 1JLEB 4LR8A 2HWIA 1S79A 1LXNA 2FC8A 1SJQA 3MM6A 1TKXA 1GMWA 1TV6A 5LXRA 2BANA 3GPAA 4P9SA 5KG3A 5J2MA 2LQBA 2HPUA 2FPHX 3RAXA 3MECB 1KQSR 4PYAA 4O3OA 3LAMA 4IQMA 3TJ8A 3H59A 2OPPB 3HVTA 2FJEB 4P74A 1XC9A 3P5TL 4TYAA 1N6QA 4MFBB 1FWKA 4M8LA 1DAXA 3CJ5A 1KVKA 4PUOB 4I2QA 2IPOB 3DYAA 1N5SA 1NPPA 1W2IA 3SDEB 4K0KF 2UZAA 2W8LA 1SVDA 3KLVA 4TQSA 3LALA 2QA2A 1WD6A 3LP2B 1QSLA 2E1CA 1JJ4A 4NLTA 4MAKA 1GFWB 3M9MB 2HHXA 2XI3A 3G8QA 4ECRA 3Q89A 4G6VB 4U95A 1FDBA 3HD1A 2M7SA 4Z37A 2HQGA 3J7AN 4ETXA 2CVIA 1V5VA 2LQJA 3SSQA 1A9NB 3HHNB 3KLGA 1BC6A 3GJTB 4OQJA 1RP5A 5C24A 2OI2A 2RS2A 4DPUA 1FXDA 4HTJA 3EX7B 4CYUA 1S1VB 2MGZB 4KC5A 2OJ3A 1FJGF 3DLGA 4IH5A 3BDEA 5C42B 3MR3A 3DOMB 4WE1A 3UDCA 1S12A 1M1HA 1TTHB 2D74B 2DR6A 2KZZA 2PMWA 3WIVA 1C1BB 1RWUA 2QLWA 1CVJA 2FJWA 1RHJB 3OL9A 4ZHRB 1X5OA 5EWEA 2E1RA 2CPFA 3N6LA 4C11B 3BQ0A 3THVA 1RXOB 2OKQA 2LDIA 2CWKA 1ZPWX 2R7XA 4HEA9 1TL1A 5B0BA 3B6BA 1MMNA 2Q43A 2LU2A 4WIQA 4YP3A 3PKYA 3PW2A 2YNGA 5DQIA 2YKOA 5K8OA 1SXLA 4X84A 2R8IA 2CZVC 3ET6B 1Q5VA 3K5PA 2VJVA 4IO9Q 2LQ9A 1XMBA 4DV7F 2C2OB 4LFBF 1S9GB 1Y5IB 1Z2ZA 2CQ3A 1J2VA 3HT3A 4BWMA 2KFYA 4USWA 2D3ZA 1PBUA 4DV7J 1HI1A 2CADA 1VJQA 2QO3A 4LFBJ 5KFSA 1R7IA 4MYTA 2MSTA 3BSNA 4ECYA 3PG9A 2DNKA 2YNIA 4OI1A 3UNGC 3OR2A 2FVCA 1UETA 1N4LA 3KK1A 2XY6A 3M8ZA 3DLBA 3NWGA 1N48A 1S6OA 3TP2A 4RU9A 4A48A 3Q8UA 4P2FA 4J9UE 1S4EA 2HHSA 5ETLA 4USIA 2AX0A 2G0JA 4J5OA 5FDLA 3I0RA 1RGVA 2GS8A 1H2TZ 2KXHA 2ZE2B 4A46A 2W4PA 4WFZA 5G0RB 4UW2A 2AYEA 4KHRA 2FGOA 4I7FB 3ZZUA 2ADCA 5IT9Y 1WC1A 2WTFA 2K1RB 3I4HX 1DFDA 4PG5A 5KTQA 1JQGA 5LMUF 4IG3A 3BDPA 1TKTA 3LP0B 2YH1A 3W3SA 1R8HA 2RE1A 2DIUA 2WBRA 4LQ9A 1AUDA 4EI2A 5LMUJ 3PJWA 1H2UX 1RSCA 2IVMA 2IVFB 4K4SA 5I42B 3I96A 3QAEA 4LF6F 2XQCA 2NLWA 2CZ9A 2YQ3A 3MM5A 1FRXA 4ECXA 3JAMY 1U1RA 5F3ZA 4H4OA 4M63A 4LF6J 2JLEA 2XWXA 4CO0A 3TNVA 2EFGA 3PX0A 5F8IA 4OZ3A 2XLJA 2KFZA 2V6AA 1LW2A 2HQCA 3CCZA 2HHHJ 2QC3A 1UWBB 3FQKA 4LFAF 4F0KA 6FD1A 4R8UB 3PIPQ 4OZNA 4IH6A 4USKA 2G0IA 3MTKA 3C6UB 3NWRA 2JLFA 1K73T 3BKTA 1BE4A 4HLBA 3HM9A 3RAQA 3VWSA 3GIRA 3SZ2A 4TU7A 2WVBA 4LFAJ 2RDIA 2XY5A 4B9VA 1U1QA 4ID5B 3FNNA 1C0UB 3VAGA 2I0XA 5EWFA 2OTLS 3D0GE 1FF2A 3ZTPA 4OZJA 3WHIA 5HROA 4Y2MA 1FDNA 1WKLA 3T41A 3OSNA 2CQGA 5BYSA 3DXBA 5B0GA 1D0EA 1T02A 4O44A 3JQMA 1YITS 2XI2A 2VICA 4QW9A 4QIEA 3CO9A 4BDPA 3CJKA 3NCPA 2MLYA 2OFHX 2BV3A 4KFBB 1LWXA 3A8EA 4IG0B 2CPZA 3QZ8A 4USVA 3PX4A 1W25A 1FJCA 1N0UA 3V2UC 2PFFB 5G4DA 4R5PA 2HLUA 3HCXA 1SBRA 2PFDA 5KFBA 4CLWA 2GO9A 3LP1A 2BKPA 5F8JA 5U47A 5E33A 5AXLA 2YNHB 2IDEA 1S5ZA 1LWCB 3BBBA 5LL6d 4USMA 3PVXA 1CULA 5GAHU 2GMHA 4I69A 3BSAA 2VKRA 1Q95G 4X64F 1TL3A 3POTA 1NJWA 1QY7A 5SZTA 4OYZA 3AA8A 2B9YA 1YRXA 2Y9HA 4RW6A 4DL0C 2BE2B 1CSJA 4PXEA 2J0XA 4X64J 1NHKL 5LOQA 1RISA 2OPQA 2HIYA 4YR0A 1NHUA 1RACB 3C8YA 3NNCA 1X7VA 2GMJA 1EETA 4WFYA 4UZBA 3N5FA 1GMWD 1P1LA 1WHWA 2BJ1A 3GSIA 4RNMA 2B9EA 2O5DA 4LF7F 3OFGA 3ZZYA 4FBTA 1KHWA 4MT1A 4ELVA 2VPZB 2CJBA 2H3EB 2V67A 2RNEA 2YXLA 1XNRJ 4WP9A 5L9NA 3IGVA 2EFPA 4DN0A 5L9XA 4P75A 2YKMB 1LK7A 2Z56B 3GYGA 1SUQA 3BBCA 2C2NA 2KU7A 2W7OA 1VQ8S 5EGYA 5D4OA 4F4YA 2U2FA 2G2OA 4ZVQB 2VC0A 2CZ4A 4LIWA 1FDAA 2W2PP 4B3RF 3H25A 2OEMA 3W5YA 4WKRA 3R8YA 4DCPB 4ELTA 3T3FA 4PXDA 3DLHA 5AXMA 1NDCA 2KHDA 3MURP 2PMHA 3JSRA 5B08A 3G6YA 4B3RJ 2XGPA 1F5AA 2JJ4D 1VBXA 2DXDA 5KT5A 1G1XA 5J2NB 4P2MA 1HHSA 3ISND 3RBXA 3M8RA 2LEPA 2FQQB 1NPRA 1FFGB 3OLAA 1S9EA 3G71S 4KSEB 4EZ9A 3QT7A 4NZ0A 4TXSA 3Q2SC 3NCQA 2V69A 2FIUA 4WFNQ 4DUZF 4YFUA 2IBOA 2MKYA 1CS4B 4ES3A 5AJ3F 1TVRB 1WF1A 1JLEA 2M88A 3R97A 3ZZTA 3EDQB 3DLJA 2HMIB 1UP1A 3TJAA 3KJNB 2PGCA 5K5MA 5AJ3J 1ZM9A 3NGUA 1GXLA 3MECA 5D3GB 2VZ9A 2CG8A 4B3OA 5ETMA 2OPPA 4QWBA 1YX2A 2DHGA 2D9OA 3QQCD 3DRYA 2DPJA 3HVWA 2D3OR 2DR7A 4JI4F 2WSFC 3TUJC 5DDOC 5DLGA 4MFBA 4M5KA 1X5SA 3D68A 4DMZA 2KYXA 3IWXA 1NK7A 5F41A 1OSCA 1NK5A 4ED1A 2ZOMA 4JI4J 4PUOA 1NDKA 3CCLS 2CNLB 2IIHA 2X51A 3TAQA 2XZTB 3SDEA 1HD0A 2XYHB 2RQ4A 2AP6A 2YH0A 1RWXB 2EW9A 4CLLA 2YTCA 3QT5A 4WU3A 1NCLA 1ZBTA 1RLDA 1TL7B 4D3HA 4X66F 2IJFA 2KT3A 1ZPVA 3MM7A 2RS8A 1GMUA 1H7XA 3GFZA 4MTPA 3MEGB 2MPUA 3T5HA 1LW0B 5AXNA 1RT6B 2VOOA 4IQXA 1GXUA 1PYSB 3M05A 2HFUA 2W1BA 1S1VA 2MGZA 3L95X 4H54A 3ITHB 3BQ2A 3IN5A 4QBUA 4EYIB 3DRPB 3W9IA 5C42A 9RUBA 3DOMA 2IA6A 3NCRA 1PGZA 4ECTA 1RE1B 5BR8F 2ZH6A 1LEOA 2B3TB 4HHHA 2JNJA 3EXYA 4P10A 4NXMF 1C1BA 1VLOA 1WACA 2HHPA 3D28A 1GX5A 1GK8A 3NGKA 4ZHRA 4UQGA 2I38A 1NK0A 3C46A 2HNYB 4DV3J 3QMQA 1OWXA 2N3LA 3T5LA 2ZOGA 4LJMA 2I5JB 4C11A 3MOJB 3DRRB 4NXMJ 4LVOP 2XULA 3WQPA 4MIAA 4WCEQ 2HVZA 2DNZA 3CC7S 2P8IA 2HVDA 3SQOP 4KO0B 2BX6A 1KONA 5LSOA 5LSLA 2HHWA 4K4XA 1HNZJ 3BZQA 3LWMA 4C4WA 1ZM3A 3MAAB 4NZ6A 3ET6A 1O51A 2ZEJA 2QSWA 2R7QA 4LSZB 2KRRA 4A8XA 2Y8YA 2APOA
chains in the Genus database with same CATH topology
2K3IA 3UR0A 5CYMA 2AGOA 2QT7A 4K2XA 1LWFB 3OHAA 1OS5A 2K7KA 3L3CA 1S9GA 3M2RA 2P6SA 3Q22A 4DV6F 3E51A 3K7RA 2IAJB 3T1HF 2RU9A 3AQPA 1Q7LB 2XMKA 1PC4A 3N6NA 2JEJA 4B3MF 2ERRA 4A8MP 4V19J 2QA4G 4KHPF 4ZOSA 1SUQB 2HWHA 1UJ4A 4OZLA 2XS7A 1U2RA 2DR8A 4HDGA 3FFIB 1FRHA 2PO4A 2RVJA 2XNQA 2G13A 2YKQA 4QWDA 2CQHA 3M9NB 4EBDA 1LKZA 2V8VA 2R8HA 3KMSA 1NB7A 2ZZMA 2PN6A 1CC8A 5L1LA 3TVKA 2KZMA 2EK1A 1IBLF 4G1QA 3N9UC 1NAQA 5DLFA 1XR5A 2VPWB 1U47A 5GAHI 2J5AA 1YRTA 4KT0C 3KLGB 3E01A 3DI6A 2IM3A 2I1RA 1ELOA 2C3MA 3BEGB 4NA1A 1X8DA 5GADU 5C24B 2YY3A 4A8QA 3CMAS 1OQ3A 4URQU 1U45A 2GJIA 4KGKA 3BR8A 2BZ2A 3T1YF 2F7VA 2RJZA 5KFVA 4J9KA 2HYIB 2ZJQQ 3LO3A 4DR4F 1C4CA 1K1SA 4XDDA 3S6EA 5J2QB 1ZTTA 3TI0A 4X4NA 2BUNA 2CQ0A 2WCXA 3HHEA 3HVAA 5JVGQ 2E9ZA 1FKOA 2BQUA 2HVIA 4ED5A 3AY0A 4O0IA 1VIXA 1T05A 4Q43A 4ECQA 3R5BA 1R6YA 4NLGA 1HL6A 3OL7A 4WZMA 3DOLB 2KHCA 2LVWA 5DRKA 2RF2A 3IAS9 2L41A 2N4DA 3PR4A 1QTMA 3I87A 5HMWA 3V6HA 2D41A 4PWUA 2B6AB 4WE1B 1JNRB 2WB4A 1N8RT 1KEKA 1Y9OA 2GNKA 4B9TA 3NG8A 1YRUA 2Q6CA 1LQ9A 3N01A 2CPEA 2AJ4A 2EWHA 5L8RC 4C3LA 1QUVA 1DRZA 1VMBA 3QPIA 4ED2A 2ZE2A 4K4WA 1HBMB 1R8PA 1R3NA 1HWKA 4K50A 4WFXA 3GIIA 3CD0A 3TW0A 1B7FA 4DFKA 3UI3A 1HW8A 5A2QY 3O5TB 1MROB 1EP4A 3U1NA 3HFKA 4EUVA 1BY9A 4KGMA 3U1LA 3SFGA 3SSRA 5AE1A 4TU8A 4LQ3A 3HX9A 4OJ1A 3SCKE 5M2PA 4I7FA 4KJIA 4YQWA 3RB6A 1S1XA 1M0SA 4HT7A 2KM8B 2KG1A 1D8ZA 1M5KC 4QIFA 1UVMA 3TQ1A 3RW6A 2XMWA 1FNOA 1NJZA 1AW0A 4CT9A 3C6TB 4RW4B 3OV7A 1UFLA 2C3PA 2GCFA 3T5KA 2D7SA 4N47A 2K1RA 4NLOA 5KFMA 1GH8A 1ZYQA 2L3MA 2BJEA 3RBEA 2V94A 4DG1B 2NREA 4N77A 4LFCF 1KVIA 2B9XA 2B51A 2MB0B 3G9CA 4M1KA 4LF5F 3KLEA 1S6UA 2IM0A 5EX0A 3LH2S 2RIJA 3KKFA 4C2MA 4RUAA 3PZPA 3VQTA 3TA0A 3LP0A 2QA4S 3ENWA 4BHQA 1ZM4A 3MUTP 4DS4A 5HMXA 4F67A 4ES2A 2Y1IA 2BA9A 4H4KC 4ZCLA 5KG6A 2KT5A 5J1EB 2NPIA 3RRGA 4AL5A 3MEKA 3GZ7A 2A10A <