5AXMA

Crystal structure of thg1 like protein (tlp) with trna(phe)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
213
Chain Sequence
TREIYAEMRCIPPVVLRADGRNFKNTLSGLGFEKPYDKTFARAMADTAELFIKKSGLSPLFAYTFSDEISFLFTDLPFDGRVEKIDSVVASFLGSALTIKLRLEEPIAFDSRLVALQKEEIPEYFHRRQLEAWRNFVASWGYYALRNMGRNEAAKYLKRKKESEIHEMLFERGINLATLPSWQRRGVIISKRKITQNWEIPKFKSPFLEKLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Template-dependent nucleotide addition in the reverse (3'-5') direction by Thg1-like protein
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Transferase/rna
molecule keywords tRNA(His)-5'-guanylyltransferase (Thg1) like protein
total genus 61
structure length 213
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5axmA00
3OTDA 3WC2A 3OTEA 4KGMA 5AXMA 5AXLA 3WBZA 5AXNA 4KGKA 3WC0A 3OTBA 3OTCA 5AXKA
chains in the Genus database with same CATH superfamily
4J9PA 1HL6A 4KGZB 1LOUA 2VFUA 4FN5A 5KFIA 2EXUA 3VV2B 2XO7A 3HP6A 3LH2S 2FZGB 4FYWB 5CHCB 3Q8PB 3CCQS 3UD3P 3T41A 2QO3A 4OYIA 1BY9A 1R6YA 1HIYA 1V3SA 3EUNA 2BUNA 4WPAA 1F3VA 1SQFA 3TR5A 2UUBF 2GHWA 4NLVA 5THWA 4WXWA 5ETSA 3DRPA 3VAJA 3R1LA 5CYMA 4DV4F 1GX5A 1RT7B 3MMBA 4FPRA 1WC0A 1HW9A 2SXLA 5T7LA 1JQGA 3LP2A 1T3NA 3DLHA 2HW3A 4DV2J 5AE2A 3MR6A 2JJ4D 1I94J 3FBEA 2CNOB 2F65A 4DR6J 4B3RF 2H9ZA 2E5IA 2FD2A 1QDUB 1RE1B 3M2UA 5SZTA 1JLCB 3J7Z5 4DR4F 1NZ8A 3THTA 2VDIA 2UU9F 3CJKB 2CZ4A 2CG4A 2GJ2A 2JFDA 2ZOFA 1SJ4P 4NL5A 1HI1A 3TEGA 3E01B 2QSFA 4HLBA 3SDEA 1EHWA 3KLGB 4PXCA 4FVCA 5LM7E 3G8SA 5IXUA 4G3IA 2BJ7A 5L1JA 4X84A 2E66A 2OPQB 1FCAA 2RDJA 1G4CA 3M6UA 4PWUA 3CPWR 4LFBF 1C0UA 5H9FJ 3IG1A 4WE1B 1CJTA 4NZ7A 1RKIA 2B9XA 3HZGA 5E5NA 3IG1B 3W3SA 1NHKL 2GVZB 3E3XA 5HATA 2KZZA 2BEFA 2LKZA 2OPPB 4L74A 4P74A 5I42A 4DV3F 4JYAJ 2CJBA 4KO0B 3AT1B 4NLWA 5KFYA 1IR2A 2F63A 1QAIA 4QPTA 3AOAA 4DMZA 4B17A 4F2RA 4UY8T 2XBPA 3R2CJ 1FJCA 1GT8A 5F3ZA 4NRTA 4MKBA 2QYCA 3R5AA 2Z56B 2RKIA 3GWCA 2C28A 3ETMA 1ZZFA 2YNGB 5DM7Q 4RW7B 4ZVGA 2F5GA 4IH5A 5LXRA 1VISA 4Z7YA 3OBIA 4URSA 3AD8C 1OSDA 2KM8C 2KO1A 5J2NB 3OTBA 3HVTA 1RTIB 1TVRA 2AJ4A 2QMUB 2MY7A 2QT7A 3K2YA 4OHVA 4LQ3A 2RQMA 1CJKB 3A12A 1NB7A 2VFVA 4HDGA 4RJVA 1TKZA 2HAFA 1YI2S 3P6YC 1XMQJ 2EK6A 1U2FA 4UOCA 5A2QY 4DI6A 4QCLA 2CQBA 1FK9B 4BC9A 2HK3A 3GG0A 2IM0A 2XC9A 4B3SJ 1K1QA 2HGNA 1RBOB 1F2HA 4N8NA 1RT6B 3K17A 1U6FA 1RWWB 4HACA 3ETOA 1MU2B 2HS4A 1RT2A 5A8KA 5KFRA 1UVJA 4ANDA 1SIZA 3DKDA 3HHLB 2IYGA 4KQZA 1I51B 3LP0B 1VI7A 3SIPB 2XMAA 1J5OA 3AY0A 4OI3A 1R7IA 2KT2A 4KBIA 3ZFVA 4USMA 2NSCA 4DZDA 1BUXA 3WBZA 4LF9J 2WVFA 1CS4B 4I6AA 4J9SA 3KFWX 3GILA 1FFGB 1TMMA 1FX4A 2EFNA 4IG3A 4PXDA 5CD4A 2AD9A 2DPJA 5A2QU 2NREA 3QAUA 1T9YA 2FJDB 1MROB 2NS1B 2D3UA 2GMJA 4KFBA 4UTGA 3DU6A 4IDKA 5IT9Y 3AXMA 4DV0J 1JNZB 5HI7A 2Y9HA 1RJJA 2BW2A 2HAIA 3DOMB 3TZZA 3R9LA 1KTVA 2F4VF 1K0TA 1JNRB 1NPPA 4C3KA 2Z30B 4I6WA 4OZ3A 3G9CA 2D3OR 4FF1A 4NLOA 4KHMA 2YWGA 2QFJA 3VWSA 5C5JA 4J90A 4X4OA 3V6JA 2UXDF 2I5JB 4Q2LA 3QGPA 4DR1F 2A6OA 1O5JA 4OV1A 1RA6A 2XLIA 2KYZA 5HP1B 4MKVA 4O0NA 4Y28C 2ZVIA 2WCXA 2JWNA 2IA6A 4KGVB 1OPZA 4ZPCA 3R6LB 1GMVA 2GQ2A 1S0MA 1U6ZA 4TYAA 2EVZA 2RF2A 2W25A 1X9WA 1JLFB 4IQXA 3EGZA 5D6GA 2IHR1 2M3DA 4DL0C 5E33A 2AKWB 1X5PA 2GIFA 2WK4A 5H9EJ 1CJUB 5LMUF 2CPFA 1NJZA 1Y3JA 1TKDA 5CABA 4LJMA 2KZMA 1M1GA 4QIWD 1WNEA 4F26A 2G1DA 3BDEA 5GADI 4PG6A 2CXEA 3CJ5A 2DO0A 3JTPA 4WU3A 3KLHB 1TQLA 3EYZA 1HHSA 1BMQB 2MJNA 4P52A 4RBTA 1TV6B 2BYCA 3DYAA 3AXKA 5GAEI 4CZCA 3M4XA 3OL8A 1APSA 4DSFA 4ANEA 3ITHA 4B9LA 4PG4A 2GAHC 2N82B 2HYIB 2E7WA 3AB2B 1FVQA 4NPOA 1G6BA 1SJRA 2CIMA 4EUVA 2BJ3A 1Q1KA 5DLFA 2UXCJ 1LW2B 1S49A 2W9AA 2VA2A 3B82A 3A8JA 3MM6B 2OSRA 4UQGA 1L5UA 4HHUA 5HVFA 3Q8RB 4CO1A 2D3ZA 2R7RA 1VBZA 3O44A 5LMUJ 1AA1B 2DNZA 4WF9Q 1HKAA 2J0QD 3OXFA 4Y3CA 2CJAA 2MSTA 2C2KB 3D3CJ 4QW8A 1YZ7A 1BQMB 5DLGA 3PO5A 4CLSA 5I3UA 2DR5A 1CC7A 2IJFA 4KT0C 5KFUA 4ZVTB 2XMTA 3QLHB 4JI2J 1U25A 4B9SA 2R4FA 2F9DA 2BZ2A 2YKNB 1WOPA 1R0BG 2CNNB 2H54B 2YKPA 3PJ9A 4CTAB 4DPOA 5FD1A 4DPXA 4DBQA 1RT6A 5CZXA 1HQ2A 3W65A 3SZ2A 4LF6F 4LF7J 3TJAA 2L3MA 2ZE2A 3MM7A 4K4YA 3HHNB 2B4OA 3O3LA 4LSLA 5G4DA 3UVJA 4E98A 4F3QA 4L76A 1R43A 4IRDA 3CJSA 1TR0A 3QLHA 3MCNA 2WAQD 3SCKE 2MXYA 1A9NB 2ACYA 4X4QA 1Q8IA 1P6TA 3PJXA 3ENWA 3K5MA 2CQIA 4ZLJA 1PYTA 4LQ9A 1MSWD 5J2NA 3R6GB 4PWWA 1NJIT 2DRBA 1N48A 2DGUA 4NA2A 1JLGA 4YN3B 1T9TA 3RU0A 2RT3A 2LXIA 2DHAA 2KM8B 4RNNA 1PJ7A 3OL6A 4QW9A 2ZVSA 4JI8J 2QN6B 5A6WA 2YNGA 3KHGA 3PW2A 1IKYB 3L9ZA 2CQDA 1SKRA 1OIAA 3HSJA 1X5TA 2ZJRQ 3I0SB 4CI0B 3EJMA 1P9QC 2LEAA 2ADCA 1JLBB 3BSCA 2P5VA 5CCMA 1UETA 1WKLA 2P9CA 1GMWA 2W24A 3LOUA 4OV6A 4O3NA 3JSRA 3UDVA 2F8EX 1SUQB 3HMJG 2BV3A 4U95A 3PV8A 3BV8A 3IAM9 5I42B 4Q45A 2OTLS 4IR9A 1J2VA 1CLFA 1EX8A 8RUCA 2BE2B 2M70A 5HL7Q 1U8WA 4NA3A 1Q82T 4DJBA 3CC7S 3NNHA 3N28A 2QA1A 4RU2A 2RB7A 3TZXA 3R5CA 3VTIA 2XMMA 3X1LB 4KHRA 2RRAA 2EI5A 3L7OA 2MZRA 2WONA 3DGPA 2GA7A 3SDEB 2HHQA 3KUGA 2D69A 4G65A 2KRRA 2OPSB 3C8YA 3PKYA 2M4MA 2HGLA 1VQYA 2VG7B 3NMRA 2K1RB 2B56A 1I6JA 1SV5A 4OX8A 3CCVS 3JB9k 1KQKA 1BWVA 4RW6B 1AB8A 3P8BB 3J81Y 2P9GA 4ZJLA 5A8WB 4K5SA 2YH0A 1TKXA 3A8EA 4TNOA 3G8QA 1RT7A 5HAOA 2J0WA 3OJSA 4CT9A 2DNNA 1QY7A 2FUG9 3ULHA 3Q8VA 4A8YA 4ES1A 4QU6A 2DGXA 4IRCA 3Q8UA 2BJ1A 1KC8T 3F41A 1HWIA 2CQ3A 2BR0A 1RWXB 1X7VA 3DXBA 1SL2A 3M30B 3DRRB 4PRFA 1WKKA 3TA2A 3HT0A 2M7SA 4L3NA 1VC0A 1IJFB 1KS2A 1MROA 2ABYA 5C42A 5HQMA 4IG0B 5HVGA 3FCHA 1FNXH 3KK2B 1QVGR 2IVMA 3C14B 2PFFB 3PR4A 3W2WB 2XNQA 1YITS 1S9EA 4CRJA 3RW6A 2CYYA 2FYXA 1B0VA 2MZJA 1UW4A 3O8WA 3T5HA 1FXDA 1P27B 5ETNA 4OX7A 2Y0BB 1J5OB 1NNDA 1UWBB 4NYZA 2MLZA 3FRZA 1VR6A 3HHLA 3NAIA 1FRLA 3I32A 1ZBTA 3HSZA 2PT0A 3MD1A 3QGGA 4PYAA 4EZ9A 5L1IA 4JYAF 1IUJA 4IO9Q 4USUA 3CULA 1VQ4S 2IM3A 2AP6A 3BGUA 5EWEA 4R8UB 2P6TA 1D8YA 2HHHF 2VBWA 3SFUA 3D2WA 5KG3A 4KHPJ 2YKMB 3DRRA 4ZIVA 5KG2A 2ZJQQ 2CJYB 1NUEA 4TN2A 3DRSB 5E2QA 3UN2A 4U96A 2YTCA 2ASDA 3TARA 1Q81T 2V9WA 2H4WB 4V1Ak 2MGZB 3IWXA 1HD1A 2IAJA 1NM2A 3H5UA 3ZZTA 1C1BA 2HEKA 2WVDA 2BE7D 2HS3A 4Q2MA 3KYLA 1U1KA 1PBUA 1MN9A 3BGRB 4ZVSB 2GQCA 3K58A 1TKXB 4NCAA 1NPKA 3L7PA 2W7OA 3ZZPA 1BGXT 3FEXB 4RKUC 2FPHX 2JHEA 4DPYA 4B3RJ 5FDLA 4K4WA 3ZO7A 1GAOA 1OY6A 1MMDA 2KVQE 2K1RA 4J37A 4OJ3A 4EK2A 5T14A 1UFWA 4C97A 1TK5A 2DB1A 2W2OP 2Z8QA 4DV4J 1S77D 4K4TA 2YXLA 2F8MA 3IWNC 2DNMA 2G2ZA 2V8VA 5CYQB 1Y00A 3PW4A 1RQ0A 4XTTA 4BS2A 4NCBA 4ERDA 1LQ9A 2YX7A 3BGOP 4HHHA 4R0EA 3TW0A 1X5SA 3BBCA 3R5BA 1UVNA 3RRGA 4DV1F 2O66A 4DWIA 2YPZA 3P45B 1FRIA 3PW0A 1JXLA 1U6BA 1Q8LA 2Q6CA 2D74B 4FP9A 1CBKA 2FY8A 2ZNZA 1C0UB 1FJGJ 3QT5A 5K14B 2VL1A 4FKYA 5IS2A 3NGDA 1H73A 1WDDA 3CEDA 3MR7A 2ZH4A 1VBXA 1VOMA 5LL6d 4Q44A 3V6DA 1TK8A 1HNWF 2W9CA 5M2PA 3W9HA 1KBRA 1TTHB 1X4AA 3UR0A 2DH9A 4EU0A 4JI5J 5LJ3Y 4F02A 1IKWA 3BSOA 1S6QB 2VC0A 3ZTSA 3UCUP 3CT9A 3I0RB 3OUYA 1S0VA 3BREA 1BWEA 5BXIA 2AYEA 4NLPA 4QWDA 1YLXA 3W2WA 2HQDA 2ZH2A 5E3AA 3K57A 3VALA 5JMNA 1R8HA 4WU2A 1IM6A 4QR0A 2VPWB 2H5EA 3D1OA 3DRPB 2B0GA 4RNOA 2MHNA 3E51A 3H59A 2V8HA 5CAAA 4DV1J 1J27A 2L9DA 4ZP6A 2X3DA 1U49A 1HYSA 4USWA 4BBYA 3M1VA 4O0IA 4P9SA 3H5XA 2D7SA 1REVB 3A8KA 2B6AB 3EX7B 3H42A 5C2CA 3CVKA 4K2XA 3W60A 3JSYA 1TL3B 4BWMA 3OFEA 2D3O1 4ES2A 3V81A 3W5XA 1QSYA 4IH7A 1U0HA 2DISA 3I9V9 3HCXA 4KGMA 4ZPAA 4MIAA 5ITHA 2E29A 4NLGA 1RISA 4R25A 2MQMA 2U2FA 1KNZA 3VAMA 2GNKA 2RHSB 3KKFA 2P2CB 2QC3A 1RAAB 3OTDA 4DR7F 1QTNB 1VQMS 1RWOB 2AJ0A 3FNNA 2KT3A 3G71S 4NLDA 1SH2A 1WTFA 4OLPA 2XY7A 1UPPA 2EEYA 3OLBA 2VH7A 3PYGA 2VHGA 5GAEU 5KOWA 4H4OA 2HQIA 3KJFB 4YR2A 2OEJA 1S57A 1RU2A 5KFXA 4DQIA 3LF0A 4KHPF 4Q0BA 3EGVA 3PACA 4ZN3A 2HHHJ 3KK1A 5DQGA 2G1HA 5HQ8A 5JUMA 2MKIA 5AXKA 1RWPB 2EC2A 4FVMA 3JXOA 1YKWA 5DG9A 5LMNJ 1T03A 4B3OB 3EMTA 3P3DA 1Q53A 1YJRA 3SEOA 3VAFA 2GVDA 1N52B 3QT8A 3OFFA 5HMYA 4RUBA 2IA0A 5KFAA 2FJVA 3CGIA 3W2VB 2FHOB 2MDAA 1RCOB 2PMWA 2V4QA 2B8PA 2CWXA 1JKHA 3EVMA 3KLHA 2HNYB 2WRMA 4B3OA 3KXDA 4N56A 1C0TB 5FIIA 2QL9B 2O1PA 4F4YA 3ZC4A 4I69A 3IC1A 4F0HA 3V4IA 1CJUA 1HNIB 3U1NA 3PW7A 3GONA 3MWBA 1CEZA 3CO9A 3MR5A 2OFHX 4P2FA 1E6VB 1WDTA 5IM0B 4ZP7A 2J7KA 1JX4A 4RW4B 3CIMA 4H4MB 1WG1A 4ZVPB 2H5JB 3N4WA 2PA8D 1LWXA 3QAEA 1EKSA 2A2CA 4ZOSA 3MCMA 1N88A 2DITA 2DNOA 2BRLA 2DNRA 2PSZA 5HVHA 4F4WA 1U4BA 1RWMB 1RT5A 1RCXB 3FZBA 3MMCA 3CDAA 4WFYA 5F8MA 1JIHA 2KG1A 5J2QB 2DRDA 3TANA 1UVMA 1IBKF 2A1BA 2PEHA 4MYTA 1K9MT 2I2YA 2HHXA 2MQLA 2ZE2B 3MM7B 2VDHA 3UFCX 2AWZA 5L1KA 2YNFB 4K0KJ 2Y1LB 4TXSA 4UW2A 3FBBA 3RW7A 4XDCA 3D6HB 3ZZ0A 1S7IA 3MMCB 1ICEB 5C7PA 1VQ8S 3IO1A 1S0OA 4NXNF 1LK5A 4GVBA 2MZSA 5E7OB 3C6TB 3RB6A 2UVWA 3UO0A 5KG7A 4KH0B 3ILOA 4Z37A 2J9DA 1RHRB 2ZBPA 1M1HA 3GP9A 4H4MA 4MYUA 3TOQA 4F4AA 2BABA 2HZVA 4O4GA 2JNJA 2AJ1A 2C2OB 4ELTA 5F9NA 4DUYJ 1RLDA 3QGHA 3BSAA 1S1XB 4USKA 2B4PA 2B7BB 2DK2A 1IKXB 2QSWA 3BKFA 3EXCX 3KG0A 1IQTA 2MLYA 2CPEA 1ZA1B 1FDAA 4FYYB 3RYLA 5CA5A 3GV8B 2GIQA 3D66A 4Y2AA 2DGSA 3UN3A 3DC2A 5KFJA 3T19A 2RUGA 4Q43A 3I87A 1SJ1A 3KNGA 4ZCIA 4CNZA 1RI7A 2PGCA 2YNFA 5J1EA 1CVJA 2ZH8A 1NHVA 5F8JA 2VODA 2ZFHA 1QUPA 4C2MA 4MH8A 1IR0A 2JRSA 3GR1A 3MMAA 4JUZA 2GS8A 3WHIA 4RWXA 4JI0J 4DQPA 3CJ4A 1Y7PA 5ETVA 2JEJA 4AXIA 2R8IA 2J9CA 2KFYA 1TU0B 4N5SA 1KLMA 2DH8A 4OZNA 4F67A 4RNMA 1RWUA 5DDOC 2GFFA 2M52A 3BM7A 4PEOA 4P10A 1SC4B 4P2XA 1N5YB 2RF2B 4CLZA 5KT6A 1R0AB 2WW8A 4ECUA 1RYRA 3W64A 3G2XA 2FJEB 1NRKA 2VUGA 5C24A 5CCLA 2B43A 2YVSA 2IVFB 1TL1A 4UQTA 3AH6A 1T8EA 3W9JA 4B3MJ 4GMKA 1N5TA 4LF6J 2C2DA 4ES3A 5DQIA 3WIVA 3C6UA 1CULB 4EGLA 2CPHA 1VK3A 2CQ4A 4KO0A 4M5GA 3MDFA 3RGIA 4C0BA 4DG1B 1H2TZ 3TI0A 2QEXS 3CCWA 3BQ2A 3OXGA 4IFVA 2CKWA 2OPPA 1WHVA 2LXFA 1IBLF 3M32B 1REVA 3H2LA 2PIIA 4E2FB 2LECA 1PKUA 2FQQB 1F5AA 2MYFA 2OMLA 4O23A 2XI2A 4A8OA 4DF4A 1XNRF 4K4VA 1NJWA 2V4RA 2J0SD 3NS7B 1R31A 1IN0A 4AL6A 4PQAA 4OYAA 3GJQB 4CDIA 1IBLJ 1N54B 1SPBP 3P4UB 2G9OA 4FXDA 1X4FA 1BD6A 2DYAA 1RKJA 2AV5A 1Q79A 5D3GA 2BA9A 3EWGA 1UEKA 1F3FA 5ETRA 4A4JA 4AQYF 4KYZA 3NRBA 1X4CA 3PFEA 4MIBA 2EKNA 1DURA 1UWAA 3IFEA 5IV4A 1BE4A 1N32J 1YG0A 1MU2A 4LFCJ 4B3MF 2HVIA 4C8OA 4ECWA 2CWKA 2C3MA 2HWIA 1RYSA 3NNAA 5A6PA 5J2PA 1SIWB 4OX6A 3V81B 1ZH5A 3GCWP 4J9QA 3US5A 3LA0A 4M63A 1Z2LA 2E1AA 3NGSA 4Q5VA 5HROA 2WTFA 1N6QB 3HM9A 4U7UK 1MG7A 5BYRA 2WOMA 2D9PA 4IQMA 1W7WA 2ZM6F 3WX4A 2L9NA 4PQUB 4CH1A 2HFZA 2H65B 1DTTB 8AT1B 5GMDA 3Q22A 4OHZA 1KQSR 2F40A 4ZCLA 3MM5B 3SBMA 2HFNA 2X7IA 3G87A 3OFHA 2R2SA 3BR9A 4JI0F 1T05B 1SKSA 4J9VA 1DHMA 3RB0A 1L3VA 1REGX 1IQZA 3MEEB 2DRAA 2R2TA 2HK2A 1B64A 1X4GA 2YX4A 1UJ6A 4J9KA 4A8MP 1SV5B 1SCJB 1KEKA 3ELHA 2Y8YA 2XCAA 2L41A 2MB0B 1HLWA 1IJEB 2HVZA 3PHTA 3H5SA 3I82A 5B09A 3IM8A 1B4SA 2JH3A 2BANB 4ZP8A 5DG8A 3OVSA 4ED7A 3MHYA 2UVRA 4DPTA 1FXLA 2W9CB 1U0SA 4LR7A 3MR3A 3JSMB 4K59A 1WORA 4B9TA 2KT5A 1W26A 2X1GA 2IAJB 4M5MA 2RS2A 2YH1A 3PHEA 3BQ0A 3QJLA 2K06A 3OL9A 4PPZA 5F8HA 2DCUB 2CQHA 2RIJA 1NSQA 1ZM9A 1JLAA 3DDIA 1S72S 2YKMA 2Z4PA 1VCTA 5AE3A 1RWKB 4P6QA 4IFVB 1DY3A 1IVZA 3FVYA 2XGQA 1Y4ZB 2R7WA 4QWEA 2RRNA 4P2SA 1Q4RA 3M9MB 3ZNUA 5KFZA 1QUVA 1RAIB 3TP2A 2MKKA 3JSMA 2BMBA 5KFSA 4A46A 2VKRA 3UW1A 3D1HA 2OHDA 2YBVA 1HNXJ 4B9MA 2HHVA 1RLCL 1YWXA 5M2RA 4HH0A 1ELOA 4ZHRB 3M2UB 2CPYA 1T9VA 1WWHA 1TL1B 5EGYA 2YPYA 3G86A 4O44B 2XSJB 3ZZYA 3BQ1A 3PX6A 2AZ3A 3TZYA 4CO2A 2XEXA 2JOQA 3OJUA 1GK8A 1QLNA 4KPYA 3MMBB 3P5TL 1EB0A 2YKOA 4UZCA 1SC1B 1P1LA 2JSXA 1ZA2B 3I5CA 2W4PA 4RUAA 4U6PA 1N5YA 1YBAA 4DEZA 5DDPC 4LF4F 2YNIA 3CJ8A 4EYIB 4GKJJ 5EWGA 2IM2A 3RJMB 3PY8A 4UUWA 8ATCB 4DV5F 3R5JB 1GMUA 2IYIA 4KGKA 3VHQA 3DNCA 1N34J 1X4HA 2XHCA 4IFYA 3T5KA 2V50A 1WEZA 1SQEA 1C4AA 4MKAA 4PZVA 4FNIA 5HROB 1NK5A 1FD2A 1WELA 3GPAA 2C2EA 2AT1B 1VYAA 1ZM2A 2CDRB 1CQMA 2Q79A 3M2VB 4LF2A 3GIJA 3F56A 1NKBA 2YX1A 4HL9A 1H0HB 3S8SA 4X4TA 1N33J 1UP1A 1WEXA 1OWXA 2O01C 4DUZJ 3FEYB 3GYXB 1UZHA 2DIVA 5H9EK 1XMOF 4LSNA 1VRTA 4JI3F 3HHKA 1H7XA 3GYNA 4YUDA 3Q8QB 4DV3J 3C14A 2BKOA 1YVFA 1VHFA 4ZVQB 3NWRA 5KFFA 3GV5B 2HNDB 3DGPB 4J91A 3UE2A 1FE4A 2BW7A 4FKXA 1H7WA 2A2DA 2NLWA 4LSZB 3NG8A 2ZDPA 4QIFA 4YB7A 3J7ZT 1U1RA 4O3SA 4ZJQA 2C3OA 3AJ2A 4RNHA 1YJVA 1HHQA 5I4MA 1RTHA 3DN9A 3ITHB 1YJUA 3VAKA 4FYDA 1S1VB 4ALZA 3D6FB 3T6JA 1GMWD 1JLQA 3N01A 2MKHA 2ZITA 2E5LF 2IRXA 2HRUA 5D15A 2RQCA 4BWJA 3U7JA 4NMLA 3L4BC 3HSDA 1PAUB 2VBZA 3ILIA 3SXLA 4I1TA 4DV7J 4DV2F 1I94F 2V5HG 1S4EA 2ZJPQ 4KTQA 3LANA 4I0WA 3CDEA 2C42A 2QG9B 1I5OB 1OS5A 1UKUA 2AX1A 3M8SA 4DSJA 4HHJA 4GKKF 1RHQB 4NLQA 1Y9OA 2HHPA 5D4PA 4RZRA 1S0NA 1FRKA 2E5JA 4RW4A 1UZDA 2RSQA 3POTA 1D9AA 2DHHA 2CG8A 1EP4B 3GTYX 3K8WA 2GJIA 1RTJB 1U26A 4DS5A 4HKQA 3OR1B 3EZ5A 4DL4A 1NSPA 4MTPA 2HVHA 2N3LA 3EPIA 2E1MC 3MAQA 2MQNA 2HNYA 2ATLA 4OIXA 4K0KF 3A8IA 5HBMA 3WC0A 4OX9F 4YY3J 3PVXA 3N9UC 2W2QP 1Y5LB 1NPRA 4CO0A 1WJ9A 4LBIA 4KC5A 5J1EB 3QJJA 4RLEA 4JI1J 3KJNB 2YKNA 2QGFB 3LGHA 4LUBA 2X1AA 2FLOA 1RTHB 3D0HE 1ZM3A 3N5FA 2C3YA 1IBCB 2QLJB 2ZC4A 5A76A 3IGVA 1BQMA 4KKOA 5IQ6A 3OLAA 2EBGA 2ZHBA 2C2NA 3KLFB 1UFLA 2X3GA 5FLXU 2MKJA 5EX3A 4IYQA 5HJYA 5J2MB 2RDIA 4H4OB 2VASA 1S4FA 2JLFA 1OMSA 2HQFA 4P75A 4DN0A 1NLKL 4QU7A 2RU9A 1VQSA 2MKCA 4HDHA 1VQ7S 2KXHA 4GVBB 3FRYA 5LSRA 4HI2A 3BJYA 3D5MA 3BBBA 1G3OA 1RUSA 4NA1A 4C8MA 2Q6BA 3BGFA 1NDPA 1FNMA 3CCUS 3MUTP 4F4XA 1EAYC 2PDAA 3O6QA 2FGCA 4I4BA 2C3PA 3JQKA 4DFPA 1YRUA 3T1HF 3LQVA 1TFWA 6FD1A 4I7FA 4LMZA 3P49B 4K7QA 4ATNA 3OTEA 3GSDA 5LXYA 2FJWA 1TAQA 1WSVA 1WG4A 3M8RA 3FQKA 4FYXB 4ECTA 1J5EJ 3DI6B 1TL4A 1RTZA 2I8EA 1ZPVA 1NK6A 4EMDA 1RTJA 3MAAA 5DGAA 1KONA 1TVRB 2PMHA 4OYMA 4X65F 2LLZA 5AJ3J 2J9DE 5LT5A 4MKYA 2I1RA 2CPXA 4WFZA 3RBZA 1S9GB 3Q2TC 3MECA 2RRBA 3M6VA 2Y1IA 1HA1A 3FDSA 1AUSL 1HQUA 1QE1B 5GAHU 1RSCA 1DLOB 2XMVA 3DLKA 3TO8A 4JI3J 2KFZA 1ZZNA 2VG6A 2J5AA 4DCPB 4DR5J 3TA0A 3TX8A 4TQSA 1HMVB 1OQ3A 2N7YA 2V69A 4TLQA 3UD5A 3SV3A 3NMAA 1JKHB 1ZS6A 5KTQA 4K8RA 2GC8A 1JLQB 4ED5A 3LGNA 2ZZTA 3DLGB 4X64F 3TVYA 4A8KA 4C7QA 3V6DB 1LWFA 3GB0A 4DR2F 4OZJA 4FBUA 2Y3YA 4I2QA 2V2ZA 1T03B 2DVIA 1T11A 1UMJA 1NDLA 2YWWA 1SKUB 2BJEA 1O51A 4WBFA 2J6SA 2ZUAA 2DD8S 2VG5B 2FC9A 2DGOA 2J6UA 2XO6A 1E6YB 4J9RA 2VFSA 5CYQA 4IG3B 3FFIA 3LP1A 2J6TA 1KVJA 2QX0A 2BM1A 2EPIA 3CDUA 5ETOA 5KFLA 2VV5A 2BQ3A 2DNQA 4DLEA 2IJRA 1Q8BA 2RJZA 4WFBQ 1Z2ZA 4OYBA 3GFHA 2ZZNA 3ZZZA 4EI2A 2M8HA 1OQ6A 4ITSA 3AA8A 2AYBA 4DU8A 3GMGA 4LRFA 2PE8A 5CYMB 4ZVEA 4DQRA 1HPZB 3CB4A 2IC3A 2HZAA 4WFXA 4Y2MA 1S1UA 1RZMA 4RU9A 1GXTA 2I38A 1YK9A 1ZPWX 4NX9A 3UDEA 2JEGA 1DBDA 1S48A 3NXZA 4GC7A 3HHLD 1O8BA 1TUGB 1R27B 3PEHA 3M1VB 1JXVA 2JVRA 4OMFG 1IBMF 2OH2A 2GV1A 4HEA9 5AXNA 5J1PA 4KFBB 4OI0A 1VQ6S 4U8VA 5J2PB 4KIAA 2NYHA 3D6MB 3BH6B 3V4MA 4URQU 4NZ6A 2ZHOA 3ZTPA 1BHNA 2NXCA 1N36J 5E3CA 3NAHA 4CYUB 1MMLA 2GMHA 4RW9A 1CS4A 3Q23A 4ECRA 1RXOB 1KFSA 3PJWA 1FJGF 2P8IA 4YP3A 3GJSB 3AODA 2KB2A 5EUHA 4ZS6A 3GCXP 4ED4A 2EKYA 1UAWA 5I3QA 4ZHRA 2WVCA 4YS2A 2IM1A 3LP0A 2JDJA 4DL6A 1YIJS 2QE5A 2NSBA 3D6TB 4CCHA 3NEKA 4RL1A 1ZTWA 3WIUA 2DT9A 3F73A 1Q78A 1Q7LB 1RABB 3Q86A 3TQ1A 3BDPA 2ASYA 2AJFE 2XYPB 2CQCA 5KAKA 1N5QA 2VA3A 2HFOA 5IT0A 3D1QA 1WC3A 1T0TV 5F0WA 9ATCB 5EN1A 2IDLA 3D0GE 2HFSA 3M30A 4LRAA 4XIUA 4DL5A 1YJ9S 3AJ1A 3M32A 4KE5A 3H2UB 2KXNB 3RUBL 2H1YA 3AOBA 3CXCR 1D3WA 3UR3C 2CFXA 2VQEJ 1L3KA 1PC4A 3NGRA 1NH7A 2N4DA 1YGYA 1VLOA 2GX8A 3JS9A 4A8XA 5A0YB 3IM9A 4UY85 4D3GA 2CJ9A 3H5YA 5KFBA 4C8YA 1IKVA 1OYEA 2FHJD 5A8WA 4OI2A 3ZXWA 3NY0A 4RW6A 3CJKA 4PG5A 4DHVA 1V5IB 1Z4UA 2IPOB 1HW8A 3A13A 3NBPB 3SFGA 3V6HA 1JXEA 3PKMA 2OPRB 4D3HA 1FX2A 2AW0A 2J8AA 4JI2F 3HVWA 3ET6B 4C11B 4PWDA 4ZDNA 5HSPA 3BGRA 4M5DA 2ALYB 2B7CB 3BZQA 1E6YA 2AIRB 4J9MA 1M5OC 5HLFA 3R3TA 1HR0J 1RK8A 2RQ4A 3GLJA 3KJQB 4X62F 1W2BR 1L3SA 2KHDA 1T7PA 1VMBA 2V63A 4LF4J 1HFEL 3IBWA 3MM8B 3OR2B 3DI6A 4RPFA 4U67Q 3PIPQ 3HK2A 4IOAQ 5L1LA 1F9HA 4A8WA 1PO6A 5ADZA 4Y6IA 2LCWA 1U1PA 4L75A 3QRRA 2GQQA 1CJVA 1VRUB 3FJ2A 3MR2A 3QJPA 1R8CA 4ILRA 2VPZB 4LBHA 4NLSA 2EWHA 1YHQS 1NDCA 1OY9A 3P96A 4ID5A 3N0VA 4MT1A 4F3OA 2JC1A 3TX0A 3E01A 2QLFB 4NZ0A 3DHWC 3KLGA 5IT9U 3GJRB 4W4MA 4WP3A 4XAKA 3DHXA 2VG6B 2XYHB 4P7VA 5EHHA 2NYIA 2UUCF 2LVWA 1DLOA 3PRBA 1SL1A 5KG5A 5CXTA 1PYOB 2VIHA 1SKWA 1IKXA 3GG1A 1FDBA 2HNZB 2A6MA 2R2UA 1KFDA 1F0XA 3MF5A 1LWEA 1LWCA 2O5DA 3W5ZA 3TRGA 5HMXA 3GIRA 2LFVA 1F6TA 1HQEA 1HBMB 4JOUA 3HD1A 3P5BP 1PGZA 3FSYA 4B3TF 4N76A 3MAAB 2DEIA 3CCLS 3EZUA 1F9FA 1RDRA 2MJUA 2EG2A 4NCGA 3UI3A 3AD7C 1G2EA 2W4DA 3R7NB 1KDNA 4OL8A 1VQ9S 1XNQJ 3TYTA 3NL0A 1S6PB 5I3PA 2AHOB 4LSLB 2JVOA 4A8QA 4ECXA 3HXMA 3DXSX 2HVDA 2CJQA 3NGTA 4U7CA 1U45A 2IC3B 3HO1A 1NZAA 1C1CB 2VJVA 2XI3A 1HI8A 3I5AA 4ZCMA 4EZ6A 2QA4S 1PC5A 3PO4A 3RG6A 3SCIE 3W7BA 4XPCA 2Z2ZA 5I3UB 4HTIA 4LVNP 3VGUA 2R7VA 1YJNS 1VQLS 1DTQA 5D77A 4ENOA 4FZVA 4H54A 4CLUA 2QTWA 3M8PA 4X66F 4O3RA 1FDNA 2OELA 2NR0A 3TJ8A 4DX6A 3CD7A 2HHWA 4USIA 4F4ZA 5J2MA 4CO5A 2PI4A 4ED1A 2XS5A 2VOOA 4ID8A 2V8PA 1VBYA 3HI9A 2MZ1A 1RAOA 2R7SA 4DFMA 4QYRA 1KLMB 1RHJB 2JX2A 2OTJS 3TUJC 2E44A 1QTMA 1WF0A 4NLUA 3R5GA 5IWAF 4A8SA 1X31C 3SQOP 4F04B 2RAQA 3B4MA 3LALA 3QGIA 4LF7F 2QA2A 3ZTOA 3BPSP 3CCRS 1DFDA 1Y10A 3MOJB 2CJKA 3SCJE 1TV6A 3DYAB 2R9LA 2YWEA 2UUCJ 3CCMS 1QJHA 3KHLA 4ECQA 1PIEA 4ZA1A 4PCQA 2C2MB 4WYLA 1CSJA 5E0OA 2EFVA 4LRDA 3T6BA 4CLTA 1ZM4A 4Y00A 4YOEA 2CRLA 1TKTA 1WEYA 2DCLA 2A18A 3LGMA 5BYQA 1S59A 2DNYA 2W9BA 3IP0A 3WC2A 2FVSA 1I3OB 3MCSA 1EP4A 5KOXA 2CPDA 2VONA 4P71A 4ZK7M 3K89A 1MMNA 4LFAF 4CLYA 3IAS9 5HANA 2LXUA 4R5PB 4X62J 2NXEA 3MGJA 2MZQA 2HRYA 1SH0A 2G0JA 4C3MA 1HR0F 1K44A 1SC6A 1CPZA 3BR8A 1W2IA 2V2KA 1VJWA 1HWUA 1AZSA 2KRBA 3D7SB 3KG4A 4L3KA 2J7UA 4O4RA 1R89A 2HURA 2QLWA 2PO4A 4KR0B 3SCLE 3V5RA 5FJ4A 3JYTA 3UVJB 4DF8A 3PDNA 3DDNA 2F4FA 5DZ6A 2BACA 3THVA 4M94A 2VICA 2RNEA 3SV4A 2OGUA 2ALZA 3KLIA 1S6PA 3QIPA 2M88A 4PPDA 4WYWA 3CJ3A 5F3TA 3EGWB 4C9DA 3AOCA 1UFKA 4FXVA 5GAHI 1TK0A 2RS8A 2CDQA 3RZAA 3MEGA 4OHXA 4DUTA 4CLLA 3M9NB 3PYDA 1VJQA 3KMQA 1I1GA 2P6SA 1NK0A 2Z58B 3MEKA 3ZTRA 1XJWB 2HQCA 5B7WA 1VIXA 3VAGA 2XQCA 3T3FA 1PILA 3AA9A 2AJ2A 3NCPA 2B9WA 2XY5A 1WC4A 3DLEA 4FYVB 5AE1A 1Y5NB 1B0TA 3OT9A 3GR0A 4P7TA 1GXLA 2FGOA 3VGVA 4DR1J 2E9ZA 2HBYB 5E3PA 2X1BA 1YQHA 5ETQA 4WK1A 4WTOB 1NK7A 4EO6A 1CQNA 2B4UA 2F9JA 4C8LA 3TUIC 4DR4J 4RO0A 2FHKA 2W2NP 4LF1A 2Y0SD 1XK8A 1X4DA 3IR5B 4OJGA 4A8FA 4IOCQ 1SC3B 2XB2D 1EZZB 2DBBA 3X3UA 1XMQF 4DUYF 1LNQA 1K47A 2V9KA 1S9FA 4X4PA 3OR1A 3KK1B 1TKZB 2NCKL 3EM1A 2IMOA 1Q8KA 3H2VE 4Y34A 1WD6A 4I56A 4Q0BB 2COLA 1TL7A 1V6HA 1RTDB 4GRSA 1RB0A 2F7VA 2IRUA 3DOKB 3IS9A 3OTCA 4OYOA 4F0MA 5F41A 2BJDA 3VQTA 2KKHA 4M5KA 4ZKAA 4NLTA 4AL7A 1GTHA 2FTRA 5ETMA 5IQQA 4OJ1A 1KQFB 1FD8A 4C11A 1S6OA 5B0DA 5CYJA 4EBDA 3S6EA 2QLBB 3MPDA 5DDRC 2NQPA 1S79A 2HBZB 2B5JB 2AYGA 2HBRB 5K8NA 3PX4A 2R8JA 4UT4A 2OKQA 1HNZF 3CC2S 2ZBIA 3KG1A 2MSSA 3MM9B 2J76E 3MPWA 2OP5A 3NNCA 2DR8A 3EPGA 2K7JA 1IBKJ 4KB7A 3QWUA 4HR2A 1S76D 2G0CA 3UDCA 1KHWA 1N5SA 1U0HB 2ZWOA 2OIHA 1S97A 3VZIA 3M05A 5A0YA 5RUBA 1DTTA 3C46A 3GJTB 3Q89A 6AT1B 5KFHA 4F2SA 1B3TA 4PQUA 3CWJA 3CUNA 4QOTA 2R8GA 3ENVA 2RDDA 2R42A 4H4KC 4NYOA 3W5YA 1GQEA 3KUHA 3FSIA 1GH8A 3QRQA 3OSNA 3MZIA 3RBEA 4OZ5A 5B0AA 3Q8SB 2F3JA 3EICA 4QPXA 4AL5A 5E41A 2FVQA 1AXQA 1LWCB 2FHJA 4JV0A 4DR2J 2UVVA 2Z2YB 3D3BJ 4W92B 3CF5Q 2G4BA 1DRZA 5E3RA 4BCAA 3CD6S 1RAFB 2FJBB 1FE0A 5ETPA 2JLGA 2C22A 1IKWB 1MW7A 5K5MA 4DOZA 3MEEA 2ZH6A 3EDRB 3KK2A 1NK8A 2D9OA 1S10A 4OLOA 4CYUA 2KXFA 5LMNF 2W01A 3SI8A 3M2VA 4ID5B 2AGOA 4B08A 1XR5A 3GE9A 4FPIA 4NMXA 4KAIA 1X8DA 2MY8A 3D9BA 2NUUG 3KLEB 3CCJS 4RBUA 4MIWA 3RBXA 3DM2A 3I31A 1LXJA 3QZ8A 2WOMB 4ZP9A 3PCOB 5AJ3F 4ER8A 4ILLA 4MAKA 1BQXA 3EXYA 2UV8G 1TUVA 2HRTA 2YNIB 1FWLA 3R27A 2EFQA 5A8RA 2BX6A 4MJKA 1LW0B 2MLXA 4CT8A 2PD1A 3C3LA 2JEFA 4DQSA 1U1MA 1TELA 4OI6A 5HQLA 4RW7A 3RB4A 3THPA 1WOOA 3NGUA 1WSRA 4DSLA 1JLEB 2AEJA 4HYKA 5C24B 1N5VA 1S99A 2WSEC 3GSIA 2CVIA 1AW0A 3FSXA 3HF5A 3MTJA 2FB0A 3NCQA 4WXOA 2UUTA 3OHAA 3GFXA 5IOLA 3HVRA 2UUBJ 1FRHA 1KVKA 1ZETA 4YB5A 2WONB 1UPMB 2AQ4A 1BQNA 5KFTA 2H48B 1AFJA 4ZMMA 5F8IA 4CNYA 1RT3B 2CQGA 4Z2XA 3G6VA 2E1RA 1RGVA 4EEYA 1JLAB 1ROFA 3K7RA 1CJTB 3MPYA 4DX5A 1RAEB 4JI4F 1HNVA 4Q7AA 2Z57B 4DV6J 4WKRA 1LWFB 3OHBA 5CQGA 4PG8A 4J9UE 2O3DA 3G82B 3DLGA 4PR6A 4AFFA 4DSEA 4IR1A 3CJRA 2LQ5A 4ED3A 3W1YC 4K4XA 1SJQA 4RR5A 4J7CA 4LRBA 4NE9C 2XULA 1Q7YT 1HMVA 2HLTA 3TZWA 4JI1F 2ZD1A 2B51A 3ZTQA 3ILJA 3IA0A 1A6LA 5KFPA 1VBKA 3VVUA 1ZTTA 4LIRA 5L46A 4PUOB 4PXBA 2V2VA 5DGBA 1Y5IB 3ISZA 4CO3A 1HNZJ 3DLEB 1FA0A 2CQPA 2UZAA 1KD1T 5K9FA 1ZAXA 3UWTA 2WHOA 1VC5A 4O4GB 1H6KX 1IWGA 3M9OB 2FZCB 3C16A 1FTCA 2L9WA 4OI4A 4A47A 5C42B 1WHYA 1QM9A 3M2RB 3K5NA 1MNEA 1XTZA 1YBUA 2J9EA 3C6TA 5T41A 4CWBA 1RT1B 2EK1A 3CIZA 4ED6A 3T1YF 5K20B 2FVRA 1L3UA 5DS7A 4ICLB 1XMBA 4A48A 1RT4B 4WFAQ 2XM3A 2MEWA 4ZPTR 3KLEA 1ZOTA 3CC4S 3CO0P 4CH7A 5CD4H 1NJYA 1PG5B 4KY3A 2G2YA 1NBEB 2RILA 3HSGA 1XBWA 2YQ3A 2CQ2A 5EX0A 2HHUA 4M5IA 4CM2A 1NAQA 4ZPWR 1GEHA 4OJHA 2ZBQA 3FUYA 2ZH9A 2E5LJ 3K5PA 1K0VA 5D0RA 2AF6A 3C15A 3ADAC 4DCJB 2PC6A 1VK8A 5KT2A 5LSLA 4CH0S 2ROPA 2QMXA 5L38A 2HG4A 2VBYA 1NDKA 4UZBA 2FVPA 4U9RA 1PJ6A 2MQ8A 4GO7X 4M5NA 5IM0A 2XSFA 4F8RA 1M5SA 5J1NA 2LU2A 3M7VA 2BJ8A 3R7BB 3BF4A 2VG5A 5D78A 3SMZA 3TAMB 1MWZA 4DDFA 2KYXA 2VOPA 2W9BB 3PRVA 2C3UA 3CD0A 3EGNA 2PI5A 2Y8WA 3BB5A 3SQGB 4OI1A 3K0JA 4LT6A 4I2QB 2ERRA 3U1LA 4G6VB 2DGWA 2OEKA 3DOLA 4ZN1A 2HQGA 1U1QA 1TL5A 2ZUGA 4JV5J 3B4DA 3LAMA 4C98A 3W2VA 3AFGA 1FRXA 1SUQA 1X4BA 2GW8A 2ILZA 4LVOP 3PFOA 4ZIWA 4DSKA 1UL3A 3CDWA 3HJVA 2K8GA 3MURP 3QPIA 2M8DB 1CULA 4I64A 3K8VA 4RUCA 2DR9A 3OXLA 3QT7A 3QNWB 1WACA 3I0SA 3DLKB 2AEFA 2VQFJ 1KWMA 4N41A 1R6VA 2B5JA 1M5PC 4ETZA 2DXEA 1N34F 3CMQA 2CQ1A 4DV5J 1S9GA 2FJAB 1FFWB 3BPDA 2YNHA 4K5RA 1PAEX 2OD4A 3QMQA 5AXMA 3V2UC 5KFGA 2ZH5A 2DPIA 2DHGA 1Z1ZA 4C8ZA 1SQGA 3K59A 2BQRA 3T5JA 4K4UA 1FEEA 2XZWA 3V4IB 2POKA 3K5OA 1YRTA 3BO3A 2GAGC 5C25A 2VU5A 3VGTA 9RUBA 1DARA 4NI2B 4ZVOB 3B8HA 4F7VA 2H3EB 2VPXB 5F8LA 4C0OC 1O0PA 4LBPA 1EARA 2XMUA 2GVDB 3DLJA 3GFZA 4CTAA 2DGTA 3HT3A 4N7TA 3M8QA 3VGSA 2JLEA 4AD6A 3T1YJ 3TVKA 4N8OA 4YR0A 1LKZA 3FZ2A 3Q2SC 5IWAJ 1R3NA 4W98A 4FF3A 4X4RA 2ILYA 2KI2A 2NXUA 1SBRA 3CCZA 3J7YU 4DX7A 1D1UA 1HQEB 1VS3A 2Y1RI 4URGA 2F4VJ 1LXNA 1AYEA 1KOOA 1VDHA 4JBCA 4W90B 1TUWA 1U7LA 4KV8A 4R0JA 3HFZB 4YFUA 4ILMA 1RBLA 1H2VZ 1U8SA 1R8AA 3A3NB 3MXHP 3OSPA 2R8KA 3UD4P 3RRKA 1S1WB 3ISNC 4QR1A 2ZNYA 1H74A 5F9LA 1T3OA 2XLJA 3QIPB 1ITPA 2W7PA 1KN6A 1FERA 2UXDJ 2V2QA 2P9EA 4USJC 2LQ8A 2QL7B 1OYDA 1S12A 2CZVC 2GGPA 4DCOB 2R7UA 4J9NA 2VKZG 4JI8F 3W61A 1VGYA 5MAOA 4NLRA 5C25B 1RT4A 4OZLA 2I9SA 1PJ5A 1YJTA 2A10A 2YWFA 2KU7A 3F44A 2MKYA 3MOZA 4MK7A 2V4JA 1OSCA 1FTRA 1JMTA 1FJEB 1JJ2R 1V5VA 2ZM6J 2KN4A 2BKPA 1JWWA 3FQLA 5KFWA 1U09A 4M5DB 2IY5B 1M1KT 2VZ9A 2K3IA 4PWDB 2XHWA 2QL5B 3R97A 4QWBA 2NXNA 2ROEA 3ONQA 2R3VA 1S7HA 1FDDA 4ZLNA 4ZITA 5KT5A 2R2RA 1K8AT 3DMJA 2ZOGA 2LQ9A 4P2MA 4AE5A 4V19X 1NKEA 1FWPA 1HBOA 1RWNB 2X51A 3GIMA 3W9IA 2DNPA 2H5IB 2GZOA 5HK4A 2KH9A 3HKWA 2RHQB 1RAGB 4U7UD 3B78A 4DPUA 4BDPA 4LF5J 3R7SB 4TLRA 7FDRA 5DQHA 1GXUA 2LYVA 1WC5A 4TU9A 2EW9A 1IR1A 5IFMA 2QLXA 4LF8J 3DRXA 1XNQF 3IBFB 1UW9A 2W1BA 1T9WA 1XIQA 1TMJA 3HHLC 3B54A 3NKYA 3U02A 3HVAA 3UDLA 3A3OB 4B3SF 2YWKA 4ZVFA 5KFMA 2AGQA 1FO1A 3PW5A 4B3TJ 1Q16B 1RT3A 2BOAA 3FCWA 4NYPA 1YRXA 1U47A 3N79A 1LFWA 2ROGA 1EIYB 1NHUA 3D68A 3NLCA 5L8RC 1F5CA 4WJBA 3D0IE 2KJVA 1D09B 2HIYA 1M0SA 2EFGA 2WB1D 3LUYA 1BXNA 1RBAA 4UF4A 4TU8A 1VRTB 4ECSA 2YQ0A 1N0UA 2GCFA 3U27A 2XGPA 3V6KA 2RD5C 1RACB 2IMWP 3A1YG 3S7RA 2FJXA 3S01A 1R0CB 2K3KA 3QSIA 4NLYA 4FS1A 5A8RB 2FHMA 5GMKa 4V19J 3AAWB 3PIOQ 1KVIA 3RRHA 4O3OA 5KFKA 4M8LA 2MGZA 2FZKB 2DJWA 4IUFA 1FK9A 4WTYA 1B99A 1XQIA 3PYEA 3GYGA 3TVZA 2VB6A 4NLXA 4K50A 5B0EA 1F60B 1WC1A 2PMZD 4F36A 3MAHA 2AMCB 3J7A1 4OYWA 4DQQA 4R8UA 1HNWJ 3FMBA 3PYFA 1LV5A 2OO4A 1S1UB 3CDBA 3IN5A 2B9YA 4JI6F 3H4DA 4B9NA 2UUWA 1F5BA 1HBMA 1O6XA 3BYPA 1UEVA 3MMJA 3TAQA 2N3OA 2DR7A 3OV7A 2HMIA 2HNZA 3EVWA 2IBKA 2CADA 3QT6A 4M5JA 1H98A 3I0RA 5D0EA 3OUYB 2CPIA 2RKIB 2UU9J 1S9EB 3QO9A 4C8KA 5KFVA 4JV5F 4OFZA 3J80Y 3DFEA 1F2GA 1RA7A 4ZVHA 2XWXA 1Y0HA 1FI4A 4IG0A 3DLLQ 4X4UA 2QRRA 5GAGU 1IM4A 3L09A 3GZ7A 2Z0GA 1N36F 2VQEF 4YHHJ 1OPIA 3HFVA 1HWKA 4QQBA 1HNVB 1LFPA 5K14A 2Y1JA 1X60A 2HVEA 1Q95G 3AB4B 1RHMB 3EZOA 4YB1P 1DZ5A 1T02A 1X9MA 1D9FA 4X4SA 3QWPA 1KQGB 4PAAA 3TA1A 4UOGA 1D9DA 3MM8A 3OR2A 2BE2A 3NS5A 1A0OB 6FDRA 1UVIA 2BOPA 2JL9A 3VCDA 3H25A 4G1QB 1B0PA 2OPQA 1BQNB 4P72A 4NXMJ 1F1BB 2XTJP 3R2DJ 4USVA 3HHEA 5AXLA 4KRWA 2LEPA 4ZVRB 4C48A 3T9ZA 4ETXA 2HBQB 3CJ0A 1JLBA 1UEUA 1U1LA 2XYGB 3VF0B 3IXQA 1PYSB 3KK3A 2CPZA 2JFKA 1UA1A 1HBOB 2CA9A 2OPRA 2WVBA 3DMJB 3NBPA 5FDLB 1T9XA 4J9LA 1P9YA 4ZLPA 3LP2B 3EDQB 3UCGA 2G0IA 1IKVB 3TJ9A 1GNKA 4LRCA 5D4NA 1SH3A 2WB4A 2WVEA 3VAIA 3MM5A 1IBMJ 2HPUA 2VFRA 4RX6A 4EWTA 1TAUA 2HS0A 4USTA 2ASLA 1S6UA 3WX8A 1L3TA 4P73A 4QR2A 3M8WA 2M5YA 3DRSA 4ZJOA 3DM2B 3LPEA 3KOAA 2AU0A 4YEAA 3MMAB 4I7FB 2JEIA 2DY1A 4WIQA 4XO0A 2PFDA 4WCEQ 2ADBA 2L08A 2E1PA 4QZVB 3Q8YA 4ZLLA 3RAXA 4EYHB 4EBCA 4HH1A 3H7HB 3QSYB 4Y2KA 1WOSA 1QD1A 1UWBA 3CCSS 3CCTA 2QZ8A 2XMJA 3NOCA 1IKYA 3E2EA 1FKPA 1NCLA 1XERA 2A0FB 2DNGA 4S0MA 2N7CA 1Y11A 2XLKA 3ZZOA 1DJ0A 1EJ7L 1XEZA 3G96A 2HMIB 3MTKA 4G1IA 2AEMA 2H4YB 2RVJA 3IWLA 3M6XA 5KFEA 5DM6Q 3MFIA 1UJ4A 2B4VA 1RHKB 1OY8A 1LEOA 3PTWA 2R7XA 2YY3A 1XR6A 3BKTA 5LSOA 4LR8A 3MM6A 1H38A 2Q1LA 2XWYA 5U47A 3FBCA 4X65J 4XDDA 1N0VC 1WG5A 3MEGB 2QFIA 2KFNA 4CM0A 4YDDB 1FRJA 2HQ3A 2V94A 1ZAWA 3OD2A 1J5EF 5KFCA 1VRQC 2EFPA 1RHUB 1X5OA 1DQAA 1HPZA 4QIEA 4C3LA 4XPEA 2FY1A 1DQ9A 3KNAA 2OLWA 3T1HJ 3DGVA 1AZSB 1RT5B 1FWKA 3FGVA 2LU1A 4CLWA 1VQNS 4DR3F 2XMKA 3G4SS 2IRYA 1Q5YA 4FDFA 2LQBA 2V8DA 3ZNJ1 3L3CA 1RP5A 1YX2A 2CAJA 3W66A 3GIKA 3POTB 1R0AA 4RNFA 2NUHA 3J81U 2CZ9A 3FK4A 3PZPA 4FF4A 3MCOA 4OHWA 5IV3A 3O2IA 4PYDA 2WZ1A 3KMSA 2DXFA 4DL7A 1NK4A 3CNQP 4JB8B 1B70B 4U8YA 1WHXA 2OFGX 2XCPA 4QIGA 3IBCB 4AUKA 3KHRA 4OHYA 3MFHA 2VQFF 3J7YI 2OD6A 3KJVB 1NJXA 3EVOA 2F8HA 4I68A 5DETA 2NPFA 1NH8A 2BXJA 3NP5A 4I6YA 4B9UA 1EQ0A 1S1VA 1UJ5A 4DFKA 3DOLB 1XN9A 1C2PA 1WF1A 2V68A 3AHPA 1C4CA 2UV8A 1Q5VA 3S1TA 4CLKA 2DGQA 1S1WA 1GTEA 4L6V3 2AYMA 2ASJA 4OX9J 2VFTA 5KFDA 1U1OA 3BSNA 3HULA 2XZTB 3SSRA 1QAYA 1T94A 2KG0A 1WTBA 4ELUA 3VQSA 4JI7J 3OVBA 4M5HA 1S1XA 4I67A 5HMWA 4KJIA 3M8ZA 1VLYA 2PEBA 1JLFA 2IBOA 2RH3A 2C1EB 3I6PA 3TWZA 3WQPA 3DU5A 4M1KA 3H8YA 1HHTP 1WC6A 3VZHA 2F1FA 3A3PB 2OJ3A 5EDWA 4NEZA 4GVLA 3TQEA 2V4JB 4WZQA 4DSIA 2NZ4A 4RUHA 3C15B 3GV7B 2GJFA 4HT5A 1KSPA 4GKKJ 3PEJA 3QIDA 1SJFA 4AXJA 2IVYA 4GO5X 4MFBA 3H20A 3O1LA 2AZ1A 2G13A 4HACB 3N6MA 2GGPB 4DV7F 4EBEA 1VC6A 4TVAB 3HD2A 1B7YB 5GVQA 4BLGA 2Z2LA 2CVEA 4TKTA 1RWVB 2HKEA 3OVAA 1GFWB 4NI2A 2D1CA 3C66A 1QSSA 2WBRA 3NGKA 3DDKA 2BKNA 1R8BA 2APOA 4IDKB 4WK3A 2LA4A 5KG1A 1NKCA 4HT7A 1HYSB 1M5HA 1AROP 1KTQA 2LA6A 5JJBA 3CD5A 3M2RA 4FXWA 3JTNA 1YJ7A 3HVTB 3CJ2A 2AGPA 5BJRA 2YNHB 1HD0A 3JTOA 4TYBA 1HWJA 1B7FA 1LWEB 2EC0A 2CJXB 1NSKL 3D54A 2DO4A 2LMIA 3MUVP 3KLFA 3N5BA 2GO8A 1HNIA 3JAMU 2L48A 3FBFA 1FFSB 1S6QA 2R7OA 3KDOA 1YJWS 4ELVA 1H2UX 5B0CA 2V6AA 2OUGA 4O3QA 3PM9A 3NOGA 3HLUA 3M8QB 3BO4A 2BQUA 1RT2B 4ED8A 1KHVA 4K4SA 3N6LA 1RADB 5HN0A 1N33F 4ECVA 2J7WA 3F0NA 2D41A 2MTLA 5CH7B 4BHQA 3TNVA 2AJQA 3OTOJ 3IRWP 3KJVA 1HBNA 5AT1B 1CJVB 1SB6A 3ENQA 1SL0A 3PR5B 4JI6J 3AD9C 1T9UA 2BM0A 4F50A 2VPYB 1KLNA 2H51B 1CJKA 4QIVA 3TAMA 1TZ0A 4GKJF 4DFJA 3I9ZA 5L9XA 2HHSA 1M5VC 2DNKA 1QVFR 3T1AA 2IIHA 2UXBJ 2BE9B 4DL2A 4K2JA 5B0BA 2ZH1A 1A7GE 1XMOJ 2X1FA 5HP1A 1JLEA 1ZAVA 4DUZF 3Q83A 2U1AA 3KK3B 4Q8EA 1VQOS 3C19A 3BEGB 1MLAA 3RR8A 4G1PA 1WKJA 3HDSA 3KWMA 3PNIA 4IKAA 1C1CA 1MN7A 4LREA 5D8HB 1HNXF 3ZZUA 2HFVA 4F25A 2MPUA 2W7AA 1CG2A 4TU7A 1NB2A 2GHPA 1RAHB 3CMAS 3MPUB 2B6AA 2MHEA 1HBUB 1QAXA 3IR7B 5DRKA 3BS9A 1UA0A 4WE1A 5F8NA 4LFAJ 2IFXA 3H98A 2ZBRA 3LW5C 1VQPS 3TEHB 1HWLA 1NO8A 4NASA 2OEMA 3ILLA 1JB0C 1P8GA 3GFYA 5GAGI 2E9RX 4WFNQ 1NEEA 3C16B 4JP8A 3ICLA 3UN5A 2Z2MA 3QFWA 3W8GA 1SI9A 5F8GA 3HKZD 1X4EA 3I96A 4OZ1A 3QRPA 4BC7A 3IRXA 3QO9B 3H90A 1N8RT 4LF8F 4NRUA 3H40A 5BR8J 3N6NA 3NS6A 4B02A 5ETTA 4LF5F 2XS2A 3A4TA 4OZ2A 5MLCV 4RWWA 2ZD1B 4RW9B 1CC8A 2UP1A 4NXMF 2WSFC 4QWCA 3BN4A 2GMLA 1FESA 2RU3A 3TAPA 2LQJA 3MD3A 4HVZA 2OSQA 1VQKS 2XNRA 2MKSA 4QYZJ 2BJ9A 3FMWA 3HPOA 4ZVUB 3M6WA 2O67A 2PN6A 4QBUA 3CE8A 1DAXA 1OJ4A 1IWAA 2GHVC 5KFNA 2UUAJ 4IFYB 3LAKA 4J5OA 4WWSA 3AQPA 3PXGa 4F0KA 5KG6A 5M2UA 2C2RA 3BYRA 3TUPA 1FKOA 4YHHF 3IR6B 1QSLA 5DO2A 3Q0AA 1RT1A 2I0XA 5B0FA 3ENAA 4X66J 3T5LA 2MQPA 5HLFB 1RTIA 4C6AA 4IH6A 4TY8B 1EETB 4HI1A 1FRMA 2CQ0A 2KTQA 1KP6A 2YQ1A 4DU7A 2B8QA 4LFCF 4NOHA 3BBFA 1U1NA 1MWYA 2XSJA 1GX6A 1N32F 3G8TA 2FLNA 4QYZK 4RW8B 1X0PA 3QBCA 5HO4A 2YWHA 1KRPA 2J8SA 2VG7A 5H1SV 2OAUA 1JJ4A 3QQCD 2VC1A 1Y3KA 3CMES 1LW0A 3FFIB 3LP1B 3OFGA 1EETA 3JQJA 2DKOB 2G2OA 4YQWA 3DOKA 3FCVA 3IS9B 4N77A 4ZPDA 3W8PA 1TL7B 3G82A 4G1QA 4H4KA 2BBEA 5IT4A 1R8PA 4TY9A 5G0RA 2R8HA 2NZCA 2W2PP 1FKOB 1FEHA 2EFOA 3HHDA 4CIOA 5C2GA 2ZEJA 1UTAA 1PBAA 2WW4A 5KG4A 4X2BA 2DH7A 2ZHAA 2RUSA 3HX9A 5D0GA 5EWFA 2UXCF 1URNA 1M5KC 1V3ZA 1U02A 2KJWA 2VD3A 5K8MA 1K1SA 3KTQA 4JV2A 4C4WA 5ETLA 1FKAF 5K8PA 4OYZA 4AQYJ 2DHXA 2RQKA 4Q8FA 1AT1B 1JLCA 2CUYA 1FNOA 5SUHA 2ZH3A 1SVDA 2QYGA 4E8UA 1VIOA 3IMQJ 3KUEA 4TQRA 1JJHA 3IRXB 3RB3A 2E5GA 4X4VA 3PX0A 1JLGB 1W25A 4WP9A 2OI2A 4Y2IA 5IC4B 5T7LB 4AYBD 1KR4A 2CNLB 4ZCKA 1NU4A 2QMWA 4MK8A 2MMYA 1RU1A 2J0XA 3VR1A 1N56A 1XNRJ 1TP7A 2W2MP 3QFHA 3VVTA 5DDQC 2FLPA 1RAJA 1NSAA 1VFJA 2EG1A 2VF3A 2DEJA 2E5HA 3H0PA 5D0HA 2K7KA 5IC6B 3SSSA 4Z7CA 1HBUA 3VAHA 4AT1B 2C2ZB 4Y65A 3OPKA 2IJNA 1ACMB 4NWBA 3LO3A 1N6QA 1NXIA 1URRA 3I55S 2E9TA 2ZZMA 2KDOA 2ZC3A 3OTOF 5JXSA 1TFYA 3U1MA 4CLFA 3H4BA 1UVLA 1FHTA 2LDIA 3RAMA 2QA4G 4I2PA 4LIWA 2HZCA 4E0DA 4YDXA 4ECZA 3MM9A 4WKYA 5E3QA 4LR9A 3W62A 3MPVA 4WZMA 1V9OA 2ZWPA 3JQMA 1MWQA 1EKRA 1WF2A 2E7XA 2NPIA 5K8OA 1YSJA 4USHA 5D3GB 1U2RA 5F0UA 4CQ1A 4KV8B 4ED2A 2Q66A 2OPSA 1S1TB 1PSDA 3TUZC 3BO2A 1ULRA 2Q3PA 3L95X 3CJQA 3LTOA 1E6VA 4DV0F 3UCZP 3E8OA 3KLVA 3MI7X 3G6ES 2UUAF 4WIIA 2BVZA 2XG8A 4KKOB 4YB6A 1LW2A 4EFAC 2MQQA 2YKQA 1BLUA 2R7TA 3JSBA 3D28A 1G1XA 1TKTB 3GU0A 2R7QA 1UCNA 4NXNJ 3SYZA 1Q0NA 4LF9F 2GIRA 2HWHA 4UOHA 1HBNB 2ZOMA 5DJBA 4KSEB 4F3MA 1ZYQA 4PG7A 3LPYA 3QZ7A 5JVGQ 1EQMA 4IOBA 4DG1A 3LWLA 1P1TA 3AQOA 4PKDB 5HBMB 5BR8F 5KFQA 1U24A 2HIQA 3C6UB 4XK8C 3I4HX 3W63A 5FLXY 1T95A 4OZ0A 1HI0P 1HQUB 1QE1A 2KVIA 5KG0A 2K2PA 3ISND 1X0FA 2LP4A 3IGNA 2ZH7A 2DHSA 2ZDOA 3MEDB 4Y0FA 1V3RA 3HJFA 3MECB 2FDNA 2FIUA 3NWGA 1S5ZA 2V34A 4X4NA 4O3PA 2XY6A 5B0GA 4IO1A 1D8ZA 4GC6A 3M8PB 4QWAA 5KT7A 4IRKA 3GIIA 3OL7A 1DTQB 2B3TB 3DRYA 4ZPBA 5LOQA 1RTDA 2CPJA 3C2PA 1WHWA 2XS7A 2ZKUA 1DQ8A 4OYPA 7FD1A 4JI7F 1FF2A 5BYSA 3BGLA 3CCES 2RMLA 4CO4A 4ECYA 4L73A 2ZBCA 2W4CA 2V0NA 5D4OA 4CP5A 1WUUA 2QJ3A 2AX0A 5LJ5Y 3J80U 2Q43A 2E1CA 1TL3A 3UPFA 2CNKB 2QIFA 3Q24A 4MFBB 4UOFA 3J7AN 5H9FK 2DIUA 4K4ZA 3DOMA 4PABA 3SQGA 2UXBF 1HARA 4FS2A 2RE1A 2YKAA 4NCGB 4DS4A 3I4PA 3I56S 2DNHA 3I5BA 4KGXB 3B6BA 5GADU 3WZ0A 4JI4J 4J9OA 2BDPA 4R5PA 1YBTA 4HTJA 4CLPA 1SXLA 5HMZA 4UUXA 4N47A 3WDOA 3LWMA 1S1TA 4M5LA 5KT4A 4FBTA 4LFBJ 2ACMA 2LEBA 1D0EA 3CSKA 1KOHA 3EE3A 4PXEA 1NMEB 2M2BA 2GO9A 1WI6A 4X64J 4QJVA 4KH1B 4DX8H 2W8LA 3K5LA 5DZ7A 2M9KA 3OQ2A 2PA3A 4ANCA 4DPWA 4DXLA 5A8KB 4YR3A 4DR3J 3D4JA 3KDNA 3ZZRA 5L9NA 3KLIB 4ED0A 3R1HA 4DR5F 3RAQA 2XMWA 4DR6F 1UVKA 5GMEA 4L72B 7AT1B 3JYTB 1AUDA 4OQJA 3DLBA 1VRUA 3HFKA 2DTJA 5J2QA 1OO0B 3FEZA 4NEYA 1G7CB 3L7UA 1AFIA 2MZTA 4ICLA 2OMOA 4Y2CA 4KPCA 1BC6A 3MUMP 1YZ6A 2I6WA 3J81j 1K73T 3O5TB 2B9EA 1XR7A 3CW2C 4FF2A 2HLUA 2ATCB 4C8NA 2XZDB 2IDEA 2NXJA 2V67A 2HFUA 5IZHA 3PG9A 5KFOA 3ET6A 2LDYA 4YMEA 2HHTA 4F4KA 3MEDA 5CZVA 2E7VA 4O44A 2FLLA 3UNYA 1YDLA 2WSCC 2W8KA 1M90T 4PUOA 4DR7J 1VHIA 3CJTA 4DZ6A 4WP8A 3KHHA 2N4CA 2DGVA 3R8YA 3M8YA 4DN9A 1U48A 1C0TA 1PCAA 4B9VA 2I5JA 3RTVA 3GQCA 3T9NA 1LK7A 4M95A 2BRKA 3QYYA 2DNLA 2VJUA 5ETKA 1C1BB 2FC8A 4FNHA 1VQ5S 2VBXA 3D67A 4RBVA 1KKHA 3DCAA 2JZ5A 3OW2R 2GVZA 1YTYA 2A3JA 1FT8A 2EBEA 2HWTA 3G6XA 5HJXA 1JJCB 2KL8A 3FKBA 3CTRA 3SSQA 5JVHQ 1XC9A 3RR7A 5G0RB 2FVCA 2UVUA 1F9EB 2DXDA 3RBDA 4DLGA 2M0GB 5B08A 4JV1A 2HSEB 2V8GA 2MQOA 1NK9A 2HNDA 3BKUA 3FC9A 5D4LA 3UNGC 3JAMY 2HGMA 2JC0A 4C0HA 2BANA 3QATA 2QV6A 3G6YA 3UQSA 1FJ7A 3NCRA 2KHCA 3AJDA 5KT3A 4MK9A 3BN7A 4RW8A 1X9SA 1FKPB 1H3DA 1H72C 4LSNB 1SJ3P 4MMOA 4JI5F 4OYXA 1U2CA 1WI8A 1XWLA 2DY9A 5L39A 4YY3F 1Q86T 4I2PB 3BH7B 2ZKTA 3R5DA 1JK9B 4DL3A 1FVSA 1IXKA 1T05A 3PRDA 4TY8A 2WBMA 4ZPVR 4EO8A 1QAJA 4DV6F 1N4LA 3HZEA 1FXRA 5DG7A 2DR6A
chains in the Genus database with same CATH topology
4J9PA 1HL6A 1LOUA 2VFUA 4FN5A 5KFIA 2XO7A 3HP6A 3LH2S 5CHCB 3Q8PB 3CCQS 3UD3P 2QO3A 1BY9A 1R6YA 1V3SA 4UY8T 3EUNA 2BUNA 2UUBF 4FF1A 3TR5A 2GHWA 4NLVA 5THWA 4WXWA 3DRPA 3VAJA 3R1LA 5CYMA 4DV4F 1GX5A 1RT7B 3MMBA 4FPRA 5T7LA 1HW9A 2SXLA 1T3NA 3LP2A 2HW3A 3DLHA 5AE2A 3MR6A 2JJ4D 4B3RF 2H9ZA 2E5IA 2FD2A 5SZTA 3J7Z5 3M2UA 4DR4F 1JLCB 3THTA 2UU9F 3CJKB 2CZ4A 2CG4A 2GJ2A 2JFDA 2ZOFA 1SJ4P 4NL5A 1HI1A 3E01B 2QSFA 4HLBA 3SDEA 3KLGB 3G8SA 4PXCA 4FVCA 4G3IA 5IXUA 5L1JA 4X84A 2E66A 2OPQB 1FCAA 2RDJA 3M6UA 4PWUA 4LFBF 1C0UA 5H9FJ 3IG1A 4WE1B 4NZ7A 3W3SA 1RKIA 2B9XA 3HZGA 5E5NA 3IG1B 3E3XA 2KZZA 2LKZA 2OPPB 5I42A 4DV3F 2CJBA 4KO0B 5KFYA 4NLWA 1QAIA 4QPTA 4DMZA 4B17A 4F2RA 2XBPA 1FJCA 1GT8A 5F3ZA 4NRTA 4MKBA 2QYCA 3R5AA 3GWCA 2RKIA 2C28A 1ZZFA 2YNGB 5DM7Q 4RW7B 4ZVGA 4IH5A 5LXRA 3OBIA 4URSA 1OSDA 2KM8C 2KO1A 5J2NB 3OTBA 3HVTA 1RTIB 1TVRA 2AJ4A 2QT7A 2MY7A 3K2YA 4LQ3A 4OHVA 2RQMA 1NB7A 2VFVA 4HDGA 1TKZA 1YI2S 3P6YC 2EK6A 1U2FA 4UOCA 5A2QY 4QCLA 2CQBA 1FK9B 4BC9A 3GG0A 2IM0A 2XC9A 1K1QA 2HGNA 4N8NA 1RT6B 1U6FA 3ETOA 1MU2B 2HS4A 1RT2A 5A8KA 5KFRA 1UVJA 1SIZA 3HHLB 2IYGA 4KQZA 3LP0B 1VI7A 1J5OA 3AY0A 4OI3A 1R7IA 2KT2A 4KBIA 3ZFVA 2NSCA 3WBZA 4I6AA 4J9SA 3KFWX 3GILA 4NLGA 3E2EA 2EFNA 4IG3A 4PXDA 2AD9A 2NREA 3QAUA 2FJDB 1MROB 2NS1B 2D3UA 2GMJA 4KFBA 3DU6A 4IDKA 5IT9Y 1JNZB 5HI7A 1RJJA 2BW2A 2HAIA 1KTVA 2F4VF 1K0TA 1JNRB 4C3KA 4I6WA 3G9CA 2D3OR 4NLOA 4KHMA 2YWGA 2QFJA 3VWSA 5C5JA 4X4OA 3V6JA 2UXDF 2I5JB 4Q2LA 3QGPA 4DR1F 1O5JA 4OV1A 1RA6A 2XLIA 2KYZA 5HP1B 4Y28C 2WCXA 2JWNA 2IA6A 1OPZA 4ZPCA 2GQ2A 1S0MA 1U6ZA 4TYAA 2EVZA 2RF2A 2W25A 1X9WA 1JLFB 4IQXA 3EGZA 5D6GA 2IHR1 2M3DA 5H9EJ 5E33A 1X5PA 2WK4A 5LMUF 2CPFA 1NJZA 1Y3JA 1TKDA 2KZMA 4LJMA 4QIWD 1WNEA 4F26A 2G1DA 3BDEA 5GADI 4PG6A 3CJ5A 2DO0A 3JTPA 4WU3A 3KLHB 1TQLA 3EYZA 1HHSA 2MJNA 4RBTA 1TV6B 2BYCA 3DYAA 5GAEI 4CZCA 3M4XA 3OL8A 1APSA 4DSFA 3ITHA 4B9LA 4PG4A 2N82B 2HYIB 2E7WA 3AB2B 1FVQA 4NPOA 1G6BA 1SJRA 2CIMA 4EUVA 5DLFA 1Q1KA 1LW2B 1S49A 2W9AA 2VA2A 3B82A 3MM6B 4UQGA 2OSRA 1L5UA 2R7RA 3Q8RB 4CO1A 2D3ZA 3O44A 4WF9Q 2DNZA 2J0QD 3OXFA 4Y3CA 2CJAA 2MSTA 4QW8A 1BQMB 5DLGA 3PO5A 5I3UA 2DR5A 1CC7A 2IJFA 4KT0C 5KFUA 2XMTA 3QLHB 1U25A 4B9SA 2R4FA 2F9DA 2BZ2A 2YKNB 4DPOA 2R8HA 2YKPA 4DBQA 4CTAB 5FD1A 1RT6A 5CZXA 3SZ2A 4LF6F 4K4YA 2L3MA 2ZE2A 3MM7A 3HHNB 2B4OA 3O3LA 4LSLA 5G4DA 4E98A 4F3QA 4IRDA 1R43A 1TR0A 3QLHA 2WAQD 3SCKE 2MXYA 1A9NB 2ACYA 4X4QA 1Q8IA 1P6TA 3PJXA 3ENWA 3K5MA 2CQIA 4LQ9A 1MSWD 5J2NA 1NJIT 2DRBA 1N48A 2DGUA 4NA2A 1JLGA 3RU0A 2KM8B 2RT3A 2LXIA 2DHAA 4RNNA 3OL6A 4QW9A 2ZVSA 5A6WA 2YNGA 3KHGA 3PW2A 1IKYB 1SKRA 2CQDA 1OIAA 1X5TA 2ZJRQ 3I0SB 4CI0B 1P9QC 2LEAA 2ADCA 1JLBB 3BSCA 2P5VA 5CCMA 1UETA 2P9CA 2W24A 4O3NA 3LOUA 3JSRA 2F8EX 1SUQB 3HMJG 2BV3A 3PV8A 3IAM9 5I42B 4IR9A 4Q45A 2OTLS 1J2VA 1CLFA 2BE2B 2M70A 5HL7Q 3NNHA 4NA3A 1Q82T 4DJBA 3CC7S 3N28A 2QA1A 4RU2A 2RB7A 3R5CA 3VTIA 2XMMA 3X1LB 4KHRA 2RRAA 2EI5A 3L7OA 2MZRA 2WONA 3DGPA 2GA7A 3SDEB 2HHQA 3PKYA 2KRRA 2OPSB 3C8YA 2M4MA 2HGLA 1VQYA 2VG7B 3NMRA 2K1RB 2B56A 1I6JA 1SV5A 4OX8A 3CCVS 3JB9k 1KQKA 4RW6B 3J81Y 2P9GA 5A8WB 4K5SA 2YH0A 1TKXA 3A8EA 4TNOA 3G8QA 1RT7A 3OJSA 2J0WA 4CT9A 2DNNA 1QY7A 2FUG9 3ULHA 4A8YA 4QU6A 4ES1A 2DGXA 4IRCA 1KC8T 3F41A 1HWIA 2CQ3A 2BR0A 1X7VA 3DXBA 1SL2A 3M30B 3DRRB 4PRFA 3TA2A 2M7SA 4L3NA 1VC0A 1IJFB 1KS2A 1MROA 2ABYA 5C42A 4IG0B 1FNXH 3FCHA 3KK2B 1QVGR 2IVMA 2PFFB 3PR4A 3W2WB 2XNQA 1YITS 1S9EA 3RW6A 2CYYA 2MZJA 1B0VA 1UW4A 3O8WA 3T5HA 1FXDA 1P27B 4OX7A 1J5OB 1NNDA 1UWBB 4NYZA 3FRZA 3NAIA 3HHLA 1FRLA 3I32A 1ZBTA 3MD1A 2PT0A 3QGGA 4EZ9A 4JYAF 5L1IA 1IUJA 4IO9Q 3CULA 1VQ4S 2IM3A 2AP6A 3BGUA 5EWEA 4R8UB 2P6TA 1D8YA 2HHHF 2VBWA 3SFUA 3D2WA 5KG3A 2YKMB 3DRRA 5KG2A 2ZJQQ 4TN2A 3DRSB 5E2QA 2YTCA 2ASDA 3TARA 1Q81T 2V9WA 2MGZB 1HD1A 3IWXA 2IAJA 3H5UA 3ZZTA 1C1BA 2HS3A 4Q2MA 3KYLA 1U1KA 3BGRB 3K58A 2GQCA 4NCAA 1TKXB 3L7PA 2W7OA 1BGXT 3FEXB 4RKUC 2FPHX 2JHEA 5FDLA 4K4WA 1GAOA 1MMDA 4OJ3A 2K1RA 4J37A 5T14A 1UFWA 4C97A 1TK5A 2DB1A 2Z8QA 1S77D 4K4TA 3IWNC 2F8MA 2DNMA 2V8VA 5CYQB 1Y00A 3PW4A 1RQ0A 4BS2A 4NCBA 4ERDA 1LQ9A 2YX7A 3TW0A 4R0EA 1X5SA 3R5BA 1UVNA 3RRGA 4DV1F 2O66A 4DWIA 1U6BA 1FRIA 3PW0A 1JXLA 1Q8LA 2Q6CA 2D74B 4FP9A 2ZNZA 1C0UB 5K14B 2VL1A 5IS2A 3NGDA 2ZH4A 1VBXA 3CEDA 1VOMA 5LL6d 4Q44A 3V6DA 1TK8A 2W9CA 5M2PA 1X4AA 3UR0A 2DH9A 4EU0A 5LJ3Y 4F02A 1IKWA 3BSOA 1S6QB 2VC0A 3UCUP 3CT9A 3I0RB 3OUYA 1S0VA 3BREA 1BWEA 2AYEA 4NLPA 4QWDA 2ZH2A 3W2WA 3VALA 5E3AA 3K57A 1R8HA 4WU2A 4QR0A 2VPWB 2H5EA 3D1OA 3DRPB 2B0GA 4RNOA 2MHNA 3E51A 3H59A 2V8HA 1U49A 2L9DA 4ZP6A 1HYSA 4BBYA 3M1VA 4O0IA 3H5XA 2D7SA 1REVB 2B6AB 3EX7B 3CVKA 4K2XA 3JSYA 1TL3B 4BWMA 3OFEA 4ES2A 3V81A 1QSYA 4IH7A 2DISA 3I9V9 4KGMA 5ITHA 4ZPAA 4MIAA 2E29A 1RISA 4R25A 2MQMA 2U2FA 1KNZA 3VAMA 2GNKA 3KKFA 3OTDA 4DR7F 1VQMS 2AJ0A 3FNNA 2KT3A 3G71S 4NLDA 1SH2A 1WTFA 4OLPA 2XY7A 3OLBA 2VH7A 5GAEU 5KOWA 4H4OA 2HQIA 4YR2A 5KFXA 4DQIA 3LF0A 4KHPF 4Q0BA 3PACA 3KK1A 5DQGA 5JUMA 5HQ8A 2MKIA 5AXKA 4B3OB 4FVMA 1T03A 5DG9A 3P3DA 1Q53A 1YJRA 3SEOA 3VAFA 1N52B 5HMYA 3OFFA 2IA0A 5KFAA 2FJVA 3CGIA 3W2VB 2FHOB 2MDAA 2V4QA 1JKHA 3KLHA 2HNYB 2WRMA 4B3OA 4N56A 1C0TB 5FIIA 2O1PA 4F4YA 3ZC4A 4I69A 3IC1A 3V4IA 3U1NA 1HNIB 3PW7A 3MWBA 1CEZA 3CO9A 3MR5A 2OFHX 1E6VB 5IM0B 4ZP7A 2J7KA 1JX4A 4RW4B 3CIMA 4H4MB 1WG1A 3N4WA 2PA8D 3QAEA 4ZOSA 2A2CA 1N88A 2DITA 2DNOA 2BRLA 2DNRA 2PSZA 4F4WA 1U4BA 1RT5A 3FZBA 4WFYA 5F8MA 3MMCA 3CDAA 2KG1A 1JIHA 5J2QB 1UVMA 3TANA 1IBKF 2A1BA 2PEHA 4MYTA 1K9MT 2I2YA 2HHXA 2MQLA 2ZE2B 3MM7B 3UFCX 2AWZA 5L1KA 2YNFB 4TXSA 4UW2A 3RW7A 4XDCA 3ZZ0A 3MMCB 1VQ8S 3IO1A 1S0OA 4NXNF 1LK5A 2MZSA 5E7OB 3C6TB 3RB6A 5KG7A 4Z37A 2J9DA 3TOQA 4H4MA 4MYUA 2BABA 4O4GA 2AJ1A 4ELTA 5F9NA 3QGHA 3BSAA 1S1XB 2B4PA 2B7BB 2DK2A 1IKXB 2QSWA 3EXCX 1IQTA 3KG0A 2CPEA 1FDAA 3RYLA 5CA5A 3GV8B 2GIQA 5KFJA 4Y2AA 2DGSA 3DC2A 3T19A 2RUGA 4Q43A 3I87A 1SJ1A 3KNGA 4ZCIA 4CNZA 2PGCA 1RI7A 2YNFA 5J1EA 1CVJA 2ZH8A 1NHVA 5F8JA 2VODA 2ZFHA 1QUPA 4C2MA 4MH8A 1IR0A 2JRSA 3GR1A 3MMAA 4JUZA 4RWXA 4DQPA 3CJ4A 1Y7PA 2JEJA 4AXIA 2R8IA 2J9CA 2KFYA 4N5SA 1KLMA 2DH8A 4OZNA 4F67A 4RNMA 1RWUA 5DDOC 2GFFA 2M52A 3BM7A 1N5YB 2RF2B 5KT6A 1R0AB 2WW8A 4ECUA 1RYRA 2FJEB 1NRKA 2VUGA 5C24A 5CCLA 2B43A 2YVSA 2IVFB 1TL1A 4UQTA 3AH6A 1T8EA 4GMKA 1N5TA 2C2DA 4ES3A 5DQIA 3C6UA 4EGLA 2CPHA 1VK3A 2CQ4A 4KO0A 3MDFA 4C0BA 4DG1B 1H2TZ 3TI0A 2QEXS 3CCWA 3BQ2A 3OXGA 4IFVA 2CKWA 2OPPA 1WHVA 2LXFA 1IBLF 3M32B 1REVA 3H2LA 2PIIA 2MYFA 1F5AA 2OMLA 4O23A 2XI2A 4A8OA 4DF4A 1XNRF 4K4VA 2V4RA 2J0SD 1R31A 1IN0A 4AL6A 4PQAA 1N54B 4FXDA 2G9OA 1X4FA 1BD6A 1RKJA 2AV5A 1Q79A 5D3GA 2BA9A 4A4JA 4AQYF 3NRBA 1X4CA 3PFEA 4MIBA 1DURA 3IFEA 1YG0A 1MU2A 4B3MF 2HVIA 4C8OA 4ECWA 2C3MA 2HWIA 1RYSA 3NNAA 5A6PA 5J2PA 1SIWB 4OX6A 3V81B 1ZH5A 4J9QA 3US5A 4M63A 5HROA 1Z2LA 2E1AA 4Q5VA 1N6QB 2WTFA 3HM9A 4U7UK 5BYRA 2WOMA 2D9PA 4IQMA 2ZM6F 3WX4A 2L9NA 4PQUB 4CH1A 2HFZA 3Q22A 1DTTB 1KQSR 4OHZA 2F40A 4ZCLA 3MM5B 2HFNA 3OFHA 2R2SA 1T05B 3BR9A 4JI0F 1SKSA 1DHMA 3RB0A 1L3VA 2DRAA 1IQZA 3MEEB 2R2TA 1B64A 1X4GA 2YX4A 1UJ6A 4J9KA 4A8MP 1SV5B 1KEKA 2XCAA 2L41A 2MB0B 1IJEB 2HVZA 5B09A 3H5SA 3I82A 2JH3A 2BANB 4ZP8A 5DG8A 3OVSA 4ED7A 3MHYA 2UVRA 1FXLA 2W9CB 3JSMB 3MR3A 4K59A 4B9TA 2KT5A 2X1GA 2IAJB 2RS2A 2YH1A 3QJLA 3PHEA 3BQ0A 3OL9A 4PPZA 5F8HA 2DCUB 2CQHA 2RIJA 1ZM9A 1JLAA 1S72S 2YKMA 2Z4PA 5AE3A 4P6QA 4IFVB 3FVYA 2XGQA 1Y4ZB 2R7WA 4QWEA 2RRNA 4P2SA 1Q4RA 3M9MB 5KFZA 1QUVA 3TP2A 2MKKA 3JSMA 5KFSA 4A46A 2VKRA 3UW1A 3D1HA 4B9MA 2HHVA 5M2RA 1YWXA 4HH0A 1ELOA 4ZHRB 3M2UB 2CPYA 1WWHA 1TL1B 5EGYA 3G86A 4O44B 2XSJB 3ZZYA 3BQ1A 3PX6A 4CO2A 2XEXA 2JOQA 3OJUA 1QLNA 4KPYA 3MMBB 3P5TL 2YKOA 4RUAA 1P1LA 2JSXA 3I5CA 1N5YA 2W4PA 4U6PA 1YBAA 4DEZA 5DDPC 4LF4F 2YNIA 4EYIB 5EWGA 2IM2A 3PY8A 4UUWA 4DV5F 4KGKA 2IYIA 3DNCA 1X4HA 4IFYA 3T5KA 1WEZA 1SQEA 1C4AA 4MKAA 5HROB 4FNIA 1NK5A 1FD2A 1WELA 2C2EA 1ZM2A 2Q79A 1CQMA 3M2VB 3GIJA 3F56A 1NKBA 2YX1A 4HL9A 1H0HB 3S8SA 4X4TA 1UP1A 1WEXA 1OWXA 2O01C 3FEYB 3GYXB 2DIVA 1XMOF 4LSNA 1VRTA 4JI3F 3HHKA 1H7XA 3GYNA 4YUDA 3Q8QB 1YVFA 1VHFA 5KFFA 3GV5B 2HNDB 3UE2A 1FE4A 1H7WA 2A2DA 2NLWA 4YB7A 3NG8A 2ZDPA 4QIFA 3J7ZT 1U1RA 4O3SA 2C3OA 3AJ2A 4RNHA 1YJVA 5I4MA 1RTHA 3DN9A 3ITHB 1YJUA 3VAKA 4FYDA 1S1VB 4ALZA 3T6JA 1JLQA 3N01A 2MKHA 2ZITA 2E5LF 2IRXA 2HRUA 2RQCA 4BWJA 3U7JA 4NMLA 2VBZA 3SXLA 4I1TA 4DV2F 1I94F 2V5HG 2ZJPQ 4KTQA 3LANA 4I0WA 3CDEA 2C42A 1OS5A 1UKUA 2AX1A 3M8SA 4DSJA 4HHJA 4GKKF 4NLQA 1Y9OA 2HHPA 5D4PA 4RZRA 1S0NA 1FRKA 2E5JA 4RW4A 2RSQA 3POTA 1D9AA 1EP4B 3K8WA 2GJIA 1RTJB 1U26A 4DS5A 4HKQA 3OR1B 3EZ5A 4DL4A 4MTPA 2HVHA 2N3LA 3EPIA 2E1MC 3MAQA 2MQNA 2HNYA 2ATLA 4OIXA 4K0KF 5HBMA