5AXMA

Crystal structure of thg1 like protein (tlp) with trna(phe)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
213
Chain Sequence
TREIYAEMRCIPPVVLRADGRNFKNTLSGLGFEKPYDKTFARAMADTAELFIKKSGLSPLFAYTFSDEISFLFTDLPFDGRVEKIDSVVASFLGSALTIKLRLEEPIAFDSRLVALQKEEIPEYFHRRQLEAWRNFVASWGYYALRNMGRNEAAKYLKRKKESEIHEMLFERGINLATLPSWQRRGVIISKRKITQNWEIPKFKSPFLEKLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA(His)-5'-guanylyltransferase (Thg1) like protein
publication title Template-dependent nucleotide addition in the reverse (3'-5') direction by Thg1-like protein
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Transferase/rna
total genus 61
structure length 213
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5axmA00
3OTEA 5AXKA 3WC2A 5AXMA 4KGMA 5AXNA 3WC0A 4KGKA 3WBZA 5AXLA 3OTDA 3OTCA 3OTBA
chains in the Genus database with same CATH superfamily
1RWOB 3VGSA 3VAHA 5AJ3F 1FA0A 1PYSB 4DL5A 4RW7A 3NCQA 1F60B 5A0YA 3W8GA 2YNFB 4URGA 5KAKA 4F4YA 3NCPA 1MMNA 2HNYA 3P5BP 4HT7A 2DR9A 4LJMA 2HVDA 4YB6A 3MGJA 5KFPA 4ZVHA 3AY0A 1QUVA 4RW8A 2YNHB 1JLBB 2R2TA 5C2GA 4ZP6A 4RW4A 2JNJA 1S1XA 4J9MA 3MM9B 2AX0A 2OI2A 5KG0A 4B9LA 3CD0A 1P6TA 2ZE2B 3QFWA 4BC7A 4ATNA 3KUEA 2RJZA 3KHGA 2FY1A 2KG0A 2XBPA 4O4RA 3PX6A 4YN3B 1LW2B 4HKQA 2MQMA 3DMJA 3DYAB 1M90T 1O8BA 2UXBJ 3KHRA 1P1LA 4RLEA 1NKBA 1FKPB 3MZIA 3IO1A 3NKYA 5B0BA 3O6QA 4YR3A 3W66A 1K73T 1UKUA 5THWA 1S6UA 3MAQA 4DV2F 1U8WA 4PPDA 3KLHA 1NDPA 4CLSA 2X51A 1WC6A 1CJTA 2MQQA 3Q83A 2UV8A 4GVLA 3ENAA 4YDXA 3GJSB 3K17A 5A8WA 4HACA 1X4DA 1FEHA 2WOMB 3SYZA 3OBIA 4Q44A 2HQFA 5HVFA 5H9EJ 3KG1A 5KFDA 1UPMB 2Y0BB 2HGMA 2DPIA 2LCWA 2R7VA 4YY3F 1FTCA 1U6ZA 1BC6A 3P45B 4ZVPB 3CUNA 3QWPA 1RT6B 5KFZA 3MEGB 1TU0B 2BM1A 2WVFA 4C98A 5LMNJ 3H20A 2GX8A 1TKXA 4K4YA 3T6JA 1Y5IB 4LSLB 3KNAA 4F0MA 2C3PA 4DQRA 1E6VA 2Q3PA 4OYWA 2B56A 2V9WA 2BJ1A 3R5GA 4YHHJ 2JHEA 1B4SA 3MHYA 3QJPA 3KK2B 2XS5A 4RU2A 4KY3A 1HNVA 4B3MF 1HBNA 1RT4A 2AWZA 4WKRA 4ECQA 3CDBA 4LRDA 5CAAA 3UCGA 3CJQA 3NY0A 4UF4A 2ZOMA 3M8YA 2HK2A 2OPSA 1WC0A 2LU1A 1HLWA 5AXNA 3DRXA 4N41A 1XWLA 1F3VA 5DDPC 1SVDA 4OX7A 5HP1A 4RO0A 1HR0J 4TQRA 2CZ9A 3DRRA 1OYDA 1QVFR 2BE7D 1BY9A 4WKYA 4IOCQ 4XPCA 2B8QA 2XSFA 3EVOA 2LVWA 3PO5A 1RU1A 4NCAA 2H5EA 1UL3A 2B5JA 1FD2A 4IDKB 1VQPS 1GMWD 1IBKF 2B6AA 1HI1A 2LQBA 4C8ZA 4J5OA 3K58A 5HSPA 1HNIA 1VR6A 4NYZA 1KOHA 5A8RB 3K8VA 3KG4A 2FJWA 2C2DA 4IG0B 2W9CB 4YB7A 1T05B 3MCOA 3BR9A 5KT7A 3M30B 1QTMA 1YJUA 3BGFA 4ZVGA 5IWAF 4ZJOA 1FE0A 5B08A 1UWAA 2PN6A 3OTOF 5F8MA 3S1TA 3LP1B 3R5JB 3C19A 2F8HA 3WDOA 4L76A 1DZ5A 3AD9C 2W9BB 3OUYA 5E3QA 3TZWA 1RHQB 4U9RA 2XMJA 1H2VZ 4DPWA 3KK3B 3ITHB 3GB0A 3MEDA 5KFQA 3OVBA 2D3OR 4OV6A 2HK3A 4CLYA 4I4BA 5KOXA 3J80U 4CLZA 1R8BA 2VHGA 4DV7F 1RHMB 3T3FA 3C15B 3CCTA 4MKAA 3HULA 1ZAVA 4RUHA 2QSWA 1N34J 5KT4A 2DBBA 2OELA 4EZ9A 2LDIA 2BOPA 3QPIA 3B4MA 2P9EA 3HSGA 3PRDA 1HNWF 1K44A 5HBMB 3B4DA 2J0XA 3BN4A 4NRTA 4AQYF 4J9RA 2CPYA 3KG0A 3Q8RB 4DR3F 2OTLS 5M2RA 1VBYA 4CNYA 3PX4A 2K3IA 2ZBRA 2I6WA 4YR2A 1S6QB 4X4UA 1ZAWA 4KSEB 1F9HA 4RBUA 4DV4J 5DG9A 2A3JA 2MGZB 4IQXA 1LOUA 1FT8A 2W1BA 1F0XA 2YQ3A 2KB2A 2ZBQA 3UWTA 2IMOA 4X4VA 5D77A 2FDNA 2OUGA 4EWTA 1IKYA 3KHLA 1ZAXA 4QZVB 4TY8A 3Q8SB 2R7SA 1NK7A 2IRXA 2FTRA 5KFWA 2O01C 2ZH8A 4OX8A 3A3PB 4NEYA 3TUJC 3CO0P 5KFRA 1NJIT 1KLMA 2HZCA 3W7BA 4OYAA 2YWFA 4RBTA 2H48B 4J9VA 3G71S 3BB5A 3UN5A 2Z2LA 3DLJA 2DT9A 4H54A 4TLRA 2ATLA 5H9FK 4I7FB 2WB4A 4PUOA 4K0KF 2VOPA 2KFYA 3TA2A 4DR4F 2QO3A 2CPFA 2DK2A 2KKHA 3DRSA 4DX7A 3AOAA 1HBOA 1KEKA 4H4OB 3S8SA 3ZXWA 3I4HX 2R7OA 3DOLA 4J7CA 3GIIA 4FP9A 4M5LA 1VQ6S 4L3KA 3CJ2A 3OTBA 1RYRA 3OXLA 3MAAA 2ZNZA 3TJ9A 1U6FA 1K47A 3MUTP 3R1LA 2BKNA 1W2IA 3BQ2A 4NLWA 1F5AA 4FYVB 1F5CA 5CZXA 1EQ0A 3MUVP 2OGUA 2CDQA 1KTQA 3PW2A 3AB2B 4JI8F 1C1BB 1K8AT 3JSMB 2RUGA 3V6KA 1D8YA 3D66A 5SZTA 2AYMA 5KFFA 4DSJA 3C16B 1A9NB 1UVNA 1N5VA 1S7HA 2YXLA 4JI2F 3JXOA 4ED7A 5K14B 2RT3A 5HATA 2GAGC 4J9KA 4Q8FA 2VG7A 3KLVA 4PZVA 4X66J 2QFJA 2JFKA 3NBPB 3PYGA 4GVBB 2E7XA 3PTWA 1SL2A 3QT6A 4XTTA 4DV1F 2D1CA 4KAIA 1KN6A 2WONB 3CPWR 3FCWA 2UU9J 2K7JA 4F4ZA 1QAXA 1R7IA 1S0MA 5IXUA 4N76A 2QE5A 4DLEA 5U47A 2QRRA 4DV3J 3H59A 2RE1A 4DWIA 3DLKA 3V6DB 2VFSA 1KD1T 4PPZA 5LM7E 1N52B 3IR7B 2DNQA 5J2MB 2ZOGA 1XMOF 2BJ3A 4WFNQ 3FSIA 1VQ9S 5LOQA 1TKZB 4WXOA 3VAJA 2B4PA 3FQKA 2ZKTA 1R31A 1YSJA 3HKWA 4RR5A 3K57A 4ZVQB 3WHIA 1NHUA 1M5VC 2HQ3A 1ZA2B 2OEMA 2OPRA 4O3OA 1TK8A 4IQMA 4B3SJ 3MR3A 1HPZB 1HQUA 4K5RA 2CJAA 2IBKA 4KKOB 1E6YB 5JVGQ 1NDKA 2AV5A 2CUYA 1RBAA 1RU2A 1RBLA 4Y2MA 3G96A 4MIAA 4ZJLA 1GTHA 3KLGA 1YRXA 3N5BA 5HMWA 1YJ7A 3MM6B 4UT4A 5F8HA 1AXQA 2V2QA 1YDLA 3GJRB 2Z57B 1HFEL 4F36A 1T94A 4QR0A 2CQDA 3DKDA 3M9NB 3DC2A 3KK1A 1WC5A 5JUMA 1BWEA 5CD4H 2DXDA 3D67A 1NSQA 2P6SA 3ZZ0A 1PO6A 5FD1A 2E1CA 3IBCB 2SXLA 4CO2A 2DNOA 5L38A 3JQMA 1TP7A 2MZ1A 1VQ5S 4O3QA 5AJ3J 3MD1A 3KLFA 1V5VA 1RTDA 3A3NB 3R5CA 5T7LA 5RUBA 2H4WB 3D0GE 5F0UA 1TK0A 4IFYB 1X5OA 4OLPA 2VIHA 2DHXA 3THPA 1RKJA 4WWSA 4JV2A 3MAHA 3HFZB 4DV6J 2F4VF 3VAMA 4IRCA 2YNFA 4USTA 4PAAA 1PYTA 3UN2A 3GU0A 4M94A 4ZA1A 3ZFVA 2YPYA 3BN7A 3FBCA 1Q78A 3RGIA 4DX8H 3M2RB 1TMJA 4ZKAA 4IH6A 3HHLC 2MZSA 4JI6F 2MEWA 2X3GA 2HHSA 2AX1A 3HJVA 1JLBA 2B9YA 3HHLD 2UV8G 4ZN3A 1NKEA 1FXDA 3J81Y 3DHWC 3MM9A 2AJ0A 2C2MB 5A2QU 2ZE2A 3QT7A 5HVHA 5L9XA 1JX4A 4RNFA 2HHPA 2YPZA 2R8KA 4GKKF 4ITSA 4CLWA 5KG3A 2C2ZB 4DV2J 1SKRA 3TI0A 4TNOA 1LW2A 3GYGA 1JJ4A 3MPWA 3TQEA 2FB0A 3DYAA 1S6PB 1KBRA 4IR1A 3H0PA 2HW3A 1FX4A 3SV3A 1SIWB 4JBCA 2RU9A 5DQIA 2XMWA 3KJNB 1SB6A 1Y11A 3HVAA 4JUZA 5BYQA 5BJRA 1VJWA 5DETA 3M2VA 5DG7A 2AJQA 3CDUA 4ZMMA 3IWNC 4OHWA 4ED0A 1S9GB 2RS2A 4MMOA 5F8LA 1UEVA 3FQLA 1RAJA 4YY3J 1SBRA 1TVRB 4RNOA 1P8GA 2WOMA 1ROFA 2QN6B 5KT3A 2CPEA 4ZVUB 1SQEA 1WEXA 1Z2LA 3BBFA 4F0HA 2Z56B 2LECA 2F63A 3KKFA 5BXIA 3QT5A 4AUKA 4DR1F 2KJWA 1KNZA 2WSCC 2HRTA 2HEKA 3H2LA 4PABA 2NUHA 3P6YC 4FNIA 3DHXA 1RT6A 2GJFA 2E1MC 1DLOB 4MKYA 1L3TA 3IWLA 1RLDA 1Y3KA 1TL7B 4O4GA 5GMDA 3DRPB 1R8AA 2V2ZA 1D0EA 4LSLA 5DM6Q 1HD0A 4JI0F 2ZUGA 1B99A 1RDRA 4JOUA 2MDAA 1C4CA 3U02A 3KK2A 4OYBA 2JC1A 1Q8LA 4NCGB 4QIFA 4CQ1A 4KTQA 2KRBA 3OHAA 1N36J 5F0WA 2A2DA 5D0RA 3D68A 4ENOA 3ULHA 1BUXA 5HLFB 2IM0A 1ZZNA 1B0VA 4R0EA 2L08A 2DRBA 3HO1A 1VQKS 2R7QA 4PG4A 3SEOA 1VIXA 1IBKJ 4A46A 2UVRA 1WJ9A 3HKZD 3FDSA 1UP1A 2XMVA 2J7UA 2O3DA 5LSRA 4AL6A 4I67A 2CJ9A 4ZVTB 3M32A 3IXQA 4K4UA 4J9QA 4OQJA 4K50A 2HNZB 4DQIA 4EBDA 2XSJA 3TZYA 2VF3A 4BC9A 5B0CA 5A8RA 4ZPWR 4C8NA 1U1NA 4N5SA 4EO8A 1Q1KA 5B0DA 2RQCA 5E3PA 2O66A 3D2WA 4IG0A 4PXCA 2W9CA 1T05A 3FNNA 4M8LA 4ID8A 4IG3B 1OPZA 3O2IA 3H90A 3MEKA 4DXLA 5IQ6A 3GCWP 4URQU 2IVFB 4ECZA 2PEBA 2RIJA 2X1AA 4ILMA 2CZVC 2E1AA 2OSRA 2E5JA 1RTIA 2VC1A 2HQCA 1RAOA 4KV8B 1SIZA 2MPUA 4USHA 5KFOA 2OO4A 2W9BA 4LF9F 4DV7J 3AA9A 1H2UX 2MSTA 3ITHA 1OQ6A 3MPUB 2I5JB 3VTIA 2WVBA 4TYAA 2VOOA 1JJCB 4KC5A 2AW0A 3F44A 1VQ7S 1WF1A 3Q0AA 1CLFA 4WF9Q 4KHPJ 1REGX 1XC9A 2ATCB 3WBZA 1O51A 1TKTB 4UOCA 1LFWA 2KDOA 3DM2B 2VBWA 4JI4F 4XAKA 3OV7A 5HBMA 4OI4A 3W65A 3K5MA 2D41A 5SUHA 2JDJA 3W61A 4ED6A 3LO3A 5DDQC 3VV2B 4B3TF 2QG9B 5CCLA 1S6QA 2PO4A 1KC8T 3Q8PB 1C0UB 1SQFA 5DRKA 2BANB 4RWWA 4BDPA 3DDKA 4OLOA 1QAIA 2E5LF 2YKPA 3UQSA 1I6JA 4F7VA 2HMIA 1NMEB 5HROB 3OSPA 1WEYA 1U0HB 4FVCA 4WXWA 2A18A 3MM8B 5FDLB 2HGLA 4F04B 2XI2A 3PR4A 2B7BB 1BE4A 4OV1A 4PWUA 3HMJG 2WSEC 4EK2A 4O0NA 5DQHA 2QL9B 3EICA 5D4OA 2M88A 2KM8C 5D3GB 4PYDA 5AE2A 3O1LA 3R7NB 2PFFB 2EI5A 3R6LB 3TR5A 3ZTPA 4DR4J 1O5JA 4MFBA 1T11A 2OEKA 5CD4A 3ETOA 1UW4A 2PFDA 4I7FA 3X1LB 8RUCA 2XLKA 3BO3A 4IO9Q 3JSRA 3HSDA 5C5JA 2AKWB 1CBKA 2N7YA 1VQ8S 3KDOA 3M8ZA 4C3KA 1O6XA 4ZCLA 2ZM6J 4H4OA 4K4SA 2RNEA 3TA0A 4U95A 3KTQA 3L7PA 4B9SA 1NJXA 1EQMA 3Q24A 2OFHX 4JI8J 5J1EB 1U45A 5KFXA 1VYAA 1A7GE 3GV7B 3KFWX 1KVIA 1KQGB 4QYRA 1RT7B 2AEJA 2C2RA 4LBHA 2OD6A 1FRIA 4TQSA 4B3RF 3CMES 4ZK7M 4CO3A 4JI2J 4WFBQ 3IFEA 4L74A 3JSMA 3AD7C 1RE1B 1JNRB 4M95A 1S5ZA 2OPPA 4U8YA 5BR8F 3NWRA 3BKUA 3GLJA 5F3ZA 2Z30B 1EETB 2K1RB 4I2PB 1JLQB 1HWKA 3WC2A 2LXUA 4DV1J 5HMZA 2HS3A 2R3VA 5K14A 4DS5A 1SKUB 1Q79A 5DZ7A 5B0EA 3IS9A 3IG1B 3R1HA 1D1UA 4OI6A 2FHKA 4DR6F 1YLXA 3PEJA 2VB6A 3HHDA 3LP2B 1P1TA 3NBPA 4XO0A 3NCRA 3QAEA 2BA9A 2DEJA 2WONA 4CI0B 2BJ8A 3G8TA 3KUGA 3I31A 1LWFB 1XR7A 4OJGA 3FKBA 3H2VE 3GP9A 3KJQB 2YKOA 1F2GA 4QQBA 1WOPA 1FESA 4PXDA 4USVA 4P73A 3Q2SC 1C0TB 3V6DA 1UWBA 4Q43A 1Q8KA 3PY8A 2KJVA 4WJBA 5J2MA 4JI1F 1CS4B 4X4QA 1YIJS 2B4UA 2FVPA 1RT1B 3M8QB 3BYRA 1TKZA 3MMCB 2CQHA 2UVUA 2V8GA 5KT6A 2MTLA 3UI3A 3WIUA 3HLUA 3GILA 2Z4PA 2GVDB 1JIHA 5IM0B 2W2OP 1HPZA 2QLJB 2CJBA 3AXMA 1XEZA 1E6YA 3B8HA 4W92B 2YKMB 4PQAA 4NX9A 3EGWB 2MQPA 2MQLA 4DUZF 1OY8A 1OWXA 4DZDA 1VIOA 1IQZA 1RWNB 3CJ4A 1FWKA 4LR7A 4WFZA 2E5IA 4PR6A 1CJUB 5HJYA 2L3MA 1HBMA 1VC6A 2HFNA 1H2TZ 2HRUA 1BXNA 1AUDA 3Q22A 2BE2A 2MZTA 2KU7A 2ZHOA 4C0HA 2DH7A 4RL1A 5GMKa 3M8PB 2QIFA 5CYJA 2D9PA 4ZPVR 3A8JA 1G6BA 1DJ0A 1X0PA 3TEHB 2HFVA 2W2PP 4JI6J 1F9EB 2BR0A 4OMFG 1RCOB 4TLQA 2DHGA 5D4PA 2B9EA 4FPIA 1RWVB 4WYLA 1RA7A 3W2WB 3M6WA 2WW8A 2XULA 2VBZA 2XI3A 1OY6A 2BBEA 1EARA 5DDOC 3M2RA 2G0CA 4RW9B 2IM3A 4C7QA 2PA3A 2QT7A 2DY9A 4F4AA 4JYAF 2K06A 2ZBPA 3DLEB 2GMHA 2ZH4A 3MOJB 1N54B 3OTEA 3L9ZA 3R7BB 2VODA 1EP4B 1I5OB 1K9MT 1VHIA 4ES1A 2BQ3A 4A47A 3KJVB 2R7WA 2MYFA 2VFRA 4W4MA 1U6BA 3N6MA 1LEOA 1S6PA 2RRAA 3ET6B 2FJXA 2N82B 3FEXB 2JSXA 1CVJA 1FVSA 3H5XA 3CNQP 1X4AA 3NGKA 1FKOB 3OL6A 2HNDA 4NRUA 1FRJA 2FC8A 4CCHA 2MKHA 1IBMF 1AUSL 3I4PA 4M5JA 4WTOB 3RRKA 1KFDA 2KO1A 3D1QA 1H0HB 1S9GA 1GXTA 3PACA 3R5BA 1H38A 4G1QB 3U27A 2V34A 2UXCJ 5ADZA 2NPIA 2MLXA 4QPTA 3UVJB 1DAXA 2J0SD 4JV1A 3BF4A 1PC5A 2G1HA 4P75A 1TVRA 3VGUA 4B9VA 1V3SA 2ZBCA 2QA2A 2L9NA 2ZH6A 1OO0B 4N77A 1VI7A 2CJXB 4AT1B 2G4BA 3PRBA 3N0VA 2M7SA 3MMAB 2HLTA 2BEFA 2H4YB 2MJUA 2AQ4A 4RX6A 4JI0J 4K2XA 3RJMB 1YX2A 4MKVA 4ECXA 1Q16B 5HK4A 5C25B 2A10A 2ZH9A 3THTA 1NNDA 2C1EB 1G2EA 2HQIA 2XMUA 4YEAA 1APSA 2ZD1B 3AD8C 3HSZA 3VWSA 2HGNA 3ILOA 1KOOA 3OVSA 2XWYA 3ZZZA 1D9FA 3CIZA 1VC5A 1QSYA 1N8RT 4A8OA 4OHXA 2APOA 4RW7B 1AROP 1FWLA 3MCSA 5A0YB 2CPIA 2JWNA 3VAKA 3TZXA 4LF5F 3PYDA 2HNYB 4TU8A 2RB7A 1U1KA 3N28A 2CA9A 4FYYB 3W64A 4F4WA 2MZQA 2RSQA 3I0SB 4LF1A 2IFXA 2NSCA 3F0NA 1ACMB 5HLFA 4OYZA 1GXUA 3GIMA 4F26A 4JI5F 2M70A 1IBLF 1RI7A 1S1XB 4NL5A 4ZN1A 4L72B 2GS8A 3GZ7A 4B17A 2ZZMA 1T9UA 4G6VB 4FZVA 1C1CA 1RSCA 5CYQB 3EUNA 1Q95G 1PAEX 1U47A 5EUHA 3PW5A 4FS2A 3HT0A 5ETOA 2HNZA 4PWWA 1WOSA 3DMJB 4DOZA 3HP6A 2F5GA 4AXJA 3E01A 2EFOA 5A2QY 2IIHA 1T8EA 2GZOA 3H5YA 1FWPA 3I0RA 4RUAA 1YI2S 5GAEU 3GR0A 2IDEA 2FHMA 2XNRA 4F25A 3KLHB 3DOKB 1PKUA 4EEYA 1U1PA 5A6WA 5KTQA 1HHQA 4KGKA 5HJXA 1YBUA 2BJEA 2KVQE 3OXGA 4HVZA 1X9MA 4LMZA 2R4FA 2RHQB 5EX0A 4KV8A 2Z2YB 3N6LA 4HACB 3R8YA 1SL1A 4IKAA 2DCUB 3GCXP 4NLRA 2VL1A 3DGPA 3PKYA 4LRAA 2AJ1A 4Y6IA 3JAMU 4D3HA 3SQOP 4N56A 1WEZA 2I5JA 1CQNA 2N7CA 4C8LA 3NGUA 1X0FA 3BGUA 2E5HA 2JEJA 4E8UA 4LF4J 3IMQJ 3NNAA 1RWPB 4RKUC 2DNYA 4KT0C 2GNKA 2KRRA 5LMUF 1RTZA 3WX8A 1X4BA 5CZVA 1X60A 3POTA 2HRYA 4ETZA 1E6VB 3PIPQ 2QMWA 2HBRB 1AFIA 5G0RA 8ATCB 2YTCA 1DURA 4V19X 4DV5J 1ZETA 4FDFA 1WC3A 3KOAA 4E98A 2EKYA 1C0UA 4NOHA 3FEYB 1OY9A 1M5HA 1BD6A 1LNQA 2OIHA 2Q1LA 3J81j 5HP1B 2LA4A 2F8MA 2RQ4A 1NZ8A 1RADB 1N48A 4OYOA 4OYPA 3H2UB 1FDDA 5HROA 4F02A 3FRZA 2Y1JA 1U0HA 1FFGB 3IRXB 4IOBA 2XY6A 3MM8A 4KFBB 5FDLA 3D54A 2ZUAA 1FKAF 5DO2A 2H65B 2B6AB 1ZM3A 2POKA 3UN3A 5D3GA 3V2UC 4I68A 2FD2A 1A0OB 2H54B 2VFVA 3CE8A 3IN5A 1VRTA 4ELUA 1RHJB 1IJEB 1REVA 2RDIA 3N9UC 4MAKA 4QWBA 3I32A 5GAGI 2HWTA 1JLCB 2YKQA 2H5JB 1G3OA 2BM0A 3JSYA 1TFYA 2JX2A 1FDNA 3OR2A 4C8KA 1OSDA 2DISA 2ZOFA 4GKJJ 4TXSA 5EHHA 3GV8B 3T5JA 3CJ8A 1U1QA 1LFPA 3VR1A 2AD9A 2CXEA 3R7SB 1S99A 1DRZA 1UEUA 6FDRA 2IVMA 3SSSA 1S1VB 5IV3A 5FLXU 2GMLA 3DLBA 4DV0J 2MLYA 4C2MA 2RDJA 4C11B 3K7RA 2IC3A 3KLIB 2IY5B 1XR6A 2E1RA 2FVCA 3PHEA 3J7YI 1MN7A 3HHKA 3DXSX 2XEXA 4P2XA 1RT7A 3GPAA 5KFBA 5BR8J 3P8BB 4YUDA 2VV5A 3MD3A 4H4MB 2CNNB 2Q79A 4X4OA 2MQ8A 3JS9A 1U2CA 1DTTB 2QC3A 1FTRA 4OX6A 4KRWA 5E41A 4K4TA 1YK9A 1YJRA 1JLGA 5C7PA 4BCAA 2K1RA 4I2PA 1ZM9A 1FRLA 1JLQA 3EDRB 4MJKA 2W4DA 3U7JA 5H1SV 2ASJA 1MW7A 4LIRA 2NZ4A 1IWAA 1IBCB 2Y1LB 3W5XA 1RTHB 2F65A 1WD6A 4P2MA 3WX4A 3CW2C 4DR7J 1LWFA 1T03A 4OJHA 1NSAA 1GK8A 4ZP9A 3BS9A 3MPYA 3BJYA 1U2FA 4ZPBA 1C0TA 4J9OA 4FVMA 4TY8B 5LJ3Y 2AU0A 1X4EA 2EXUA 1CS4A 4WZMA 1CG2A 2B0GA 2VBYA 1LWXA 1OSCA 5D4LA 1Q4RA 1RT1A 3MMCA 4F3QA 4NA1A 4RUCA 4ES3A 2AYBA 2W2MP 1ZS6A 1IM4A 3GE9A 3PJ9A 5KFVA 2AHOB 2GVDA 3N01A 4Y00A 2A0FB 4IR9A 2RDDA 2DVIA 2KYZA 3JTOA 2PI4A 3BR8A 5A6PA 4DUZJ 2EFQA 4C0OC 4LFBJ 1Y3JA 2N3OA 4YMEA 4G1IA 3UDEA 4WP8A 4QYZK 2YNGB 4PUOB 4QU7A 2YKMA 4QU6A 3MXHP 4OZ0A 3B82A 4LF2A 3BO2A 3NOCA 3CSKA 6FD1A 4Q0BB 4DFMA 1QDUB 2OFGX 3T5LA 1JLAA 2GHWA 3DOLB 3VZIA 3IBWA 4JI3F 3EZUA 3PXGa 2RF2B 3GIRA 1KQKA 3FCHA 5L1JA 1N32J 2HVHA 2WTFA 1M5SA 1YRUA 5D4NA 5G4DA 1RJJA 3CJKA 2XWXA 3FEZA 1RGVA 3DI6B 5B09A 3ICLA 2HHUA 5ETNA 3K0JA 5M2PA 3KLEB 3M8PA 2LQ9A 2HFSA 4CM2A 1IR2A 2BRLA 2HKEA 3A8EA 5HVGA 2V5HG 3GTYX 3G6ES 2OJ3A 4ZDNA 4CTAB 2FY8A 4S0MA 4GO7X 2EFGA 4CLUA 1HHTP 1S9EB 3OT9A 2VASA 4UY8T 3GFXA 3FVYA 4P74A 4AYBD 3W2WA 2HHXA 1RP5A 4PG7A 4RW9A 1LK5A 2YWHA 4DSFA 5AXKA 5HL7Q 2R8JA 1VOMA 1LXNA 4FYXB 3EGZA 2DNPA 4Y2IA 2GA7A 1NJZA 3HHNB 2CQPA 1QVGR 3CJ3A 1BMQB 3Q8UA 2HFZA 1UA1A 3AODA 4G1PA 2ZZTA 4ECUA 3KJVA 2XGQA 3ILJA 3HHEA 5K9FA 4NLDA 1RACB 4PEOA 3LA0A 2NUUG 1FJGF 2L9DA 2J6TA 1S4EA 4U6PA 2DGOA 1JMTA 3ET6A 4FF4A 2DPJA 1MU2A 1IBMJ 5ETQA 2FZGB 2QX0A 3PKMA 3S01A 3OFEA 3L7OA 1M0SA 1FKOA 4WIQA 5E5NA 3DLGA 2OPRB 4DX5A 2V4RA 4NLYA 2AZ1A 1PYOB 1M5OC 3NG8A 1T9YA 1SQGA 3CCSS 1FCAA 3RBXA 4DU7A 3HD2A 2CQ4A 4JI7F 2PA8D 4CLTA 2CQIA 2HQDA 3UD3P 3CIMA 2H51B 3HDSA 3G4SS 4DEZA 3KLGB 2CWKA 3QBCA 3FZBA 1HNZF 4LR8A 4F67A 2EC2A 4MH8A 3AJ1A 2HQGA 2NXNA 2IM2A 2QA1A 1BQXA 2ASYA 3RRGA 2DHSA 3IWXA 3LWMA 3QZ8A 3KK1B 5CYMB 3BQ0A 1ZPWX 1IKVA 1VQ4S 3G87A 5KFYA 4QIGA 3X3UA 1M5KC 1VS3A 2XYHB 2LU2A 3BH6B 4ZOSA 5C25A 5T41A 3UNYA 5AE3A 4DU8A 4LF8J 5T7LB 2KH9A 3F41A 1B3TA 4NYPA 2ACMA 3W9IA 2HAIA 2IYGA 2NXJA 3N5FA 4DCJB 1RT3A 5LSOA 2CNOB 2DHAA 1HI8A 3FSXA 4DMZA 3MM7B 3PNIA 4JI5J 5MAOA 4N7TA 1UPPA 2OPQB 1FNXH 4ZVRB 4NXNF 1IBLJ 2W25A 3I0SA 3SFGA 4LR9A 1LKZA 2KZMA 1IKXB 3T41A 3JB9k 3J7YU 4X62F 1SCJB 5IV4A 1TL5A 1LWCB 4RU9A 3D0HE 2X1BA 1BHNA 1HYSB 1KDNA 4H4KC 4QIWD 3ZTOA 3BGRB 1DTQB 3W60A 4P2FA 1JJHA 4YB5A 4PG8A 1FRXA 2W7AA 4O3PA 4LUBA 1U24A 4ID5A 7FD1A 1I1GA 5CYQA 1VQOS 2DRDA 2QA4S 1MWQA 1RWUA 2DXFA 4J9UE 3J7AN 3T1HF 1R0BG 2L41A 3ISZA 4CH7A 4NLSA 4LQ3A 4I6WA 1RQ0A 4LSNA 1UW9A 5C42B 2Q6BA 5IS2A 2FJDB 2JOQA 3CMAS 5KFUA 2ILYA 3DOKA 4CLPA 2C2NA 5LJ5Y 1WI6A 2X1GA 3M2VB 2UVWA 1YJ9S 4C48A 2EG2A 4BLGA 2FGOA 3TVYA 3VCDA 3RR8A 4FXDA 3K5LA 1GX6A 1WSVA 2ZITA 1T3NA 1RT5B 1BQNA 4B3OB 4NLUA 2ABYA 4DPXA 2X7IA 1Y5NB 3M7VA 3NAIA 4YDDB 3L09A 4CDIA 4CZCA 3PW7A 5KT2A 1XNQJ 2RMLA 5LMUJ 4Y2CA 1KQSR 4OYMA 1XMBA 2W8LA 4L73A 2WBRA 1B64A 4O4GB 2LQ8A 4GRSA 1ZZFA 1YKWA 2D3ZA 4TY9A 2XS2A 4LBPA 1UZHA 1P27B 7AT1B 4NLOA 5E33A 4ED2A 1VHFA 2BVZA 5HANA 5F8NA 4TU7A 2FQQB 2CAJA 2BYCA 4UOGA 2W4CA 3AJ2A 1RHRB 1NHKL 1DQAA 2I2YA 2XLIA 3CC2S 1UVIA 1YQHA 2ZFHA 1FFSB 2RHSB 4ZP8A 5KFKA 3RBZA 4NI2B 3H40A 1HL6A 1UAWA 1FRHA 4UZCA 4NXMJ 3IRXA 4USJC 2WW4A 1WOOA 1HARA 4KFBA 9ATCB 3D1HA 2CNKB 1VLYA 5D6GA 3M32B 3UW1A 1CC7A 4P9SA 3TAQA 1S76D 4KGXB 2XSJB 2DNRA 4FS1A 2RUSA 3I96A 1OYEA 4KHMA 1XMQJ 4QWEA 1X4FA 2VA2A 3PEHA 2CJYB 3KYLA 2IHR1 2B8PA 2DR8A 1JLCA 2E1PA 2V2VA 5DGBA 3CVKA 4BWJA 2XYPB 1S6OA 3GFZA 3QJJA 3SIPB 2LA6A 3BBCA 2D7SA 3HVTB 3IBFB 1RTIB 2WVEA 2C28A 2FHJA 5KG6A 4ZS6A 3I5BA 3NS5A 4DG1A 2R2SA 2UXBF 4KPYA 2VQEF 2PMWA 1S1VA 5IT0A 4CIOA 2W9AA 2J9CA 4C11A 1JXEA 1TTHB 3W3SA 3KLIA 2BKOA 2XNQA 5J1NA 4OZ5A 2GIRA 2LQ5A 3HFKA 4QR1A 1M1KT 2BKPA 1FE4A 1FVQA 4KGVB 5J2QA 2HHWA 4H4MA 3W2VB 3IR5B 4RW6B 1YGYA 1DTTA 2RRNA 3JAMY 4JV5J 1CC8A 3WIVA 4C8MA 4BWMA 5EWFA 2ZC3A 4USKA 3AQPA 1FNMA 3M9MB 2UUAF 2IJFA 3TW0A 3HXMA 3JQKA 2LXIA 5ETRA 2ZH1A 1JKHB 2ZVIA 3SI8A 3RTVA 4B9NA 2KT3A 1OMSA 2DGWA 1C4AA 4M5IA 5EGYA 2AMCB 1H74A 1ZPVA 2OEJA 4HTJA 1RTHA 3OL9A 2O1PA 3C2PA 4OZ3A 2L9WA 4K8RA 4Y28C 2DITA 3QRQA 1WG5A 3BSNA 4ECRA 2COLA 2CNLB 4QIEA 2HMIB 4KIAA 3ZTQA 1L3KA 2E44A 3IM9A 4TYBA 4WIIA 1T9VA 3AAWB 4ER8A 4FKYA 3RAXA 1S1TB 2FZCB 3RRHA 3PCOB 3EPIA 1QJHA 4NWBA 3D4JA 2FGCA 3A13A 1WDTA 3KDNA 1XTZA 2VG6B 4NLQA 2XZWA 3OL8A 3KMQA 2QMUB 3EVWA 1UVMA 2F9JA 1HR0F 3OTCA 1DBDA 3VAIA 4DQQA 2ZHBA 1KVJA 4I1TA 2QZ8A 4ELTA 1WUUA 1CEZA 2VQFF 4MFBB 2KG1A 2AIRB 1Q5VA 3QATA 4JI3J 1N5YB 3ISNC 2J8SA 4I2QB 2YNGA 3OVAA 3IAS9 2J9DE 4UUWA 2KXHA 2NCKL 3TA1A 1RAHB 3ISND 4Q0BA 4F8RA 3MMJA 2XCPA 2PD1A 5K8NA 2QTWA 1KR4A 3LANA 1RT2A 4ECVA 1RAFB 1MMLA 2RF2A 4OHVA 1YJTA 3CCLS 3PJXA 3RBEA 2IJNA 5IQQA 3C14B 5AE1A 1KS2A 3DI6A 4DCOB 1DFDA 5FLXY 4WU2A 4M5GA 3H98A 3KLEA 1VFJA 4DUYF 4DL2A 1HIYA 3DCAA 1I3OB 2OPPB 1WWHA 4E2FB 1S4FA 5DS7A 1FEEA 4NYOA 1FF2A 4CNZA 5I3UB 4M5DB 4O3RA 4CTAA 3MTKA 5KFSA 1T9XA 4MT1A 5JVHQ 1D3WA 1S9EA 1NB2A 5F9LA 2QEXS 1TR0A 1Q0NA 3IS9B 1H73A 1J5EJ 1ZM4A 2QLFB 2HYIB 2FHOB 2ALYB 1UVJA 3LGHA 3CB4A 1WHYA 3IR6B 1N34F 2C2KB 4PQUB 1R0AA 4YB1P 1Q5YA 4R0JA 3OLBA 2VZ9A 4WU3A 4ZP7A 1SV5A 1R89A 3NLCA 3UO0A 2UVVA 5E3CA 4ZCMA 1UWBB 5ETLA 3D3BJ 3MI7X 3T1YF 2HHHJ 4KYZA 4KR0B 1W25A 1NCLA 4Y65A 4DV4F 1HA1A 2Z8QA 1R6YA 1NJWA 5DDRC 3VAFA 1S79A 3D0IE 4DS4A 1WTBA 3MFIA 4EZ6A 3AT1B 5BYRA 3MR6A 1RAIB 4JI7J 1H7XA 1NUEA 2G2OA 3R6GB 3FMWA 2W7PA 1TK5A 5KFHA 5KFCA 1PJ7A 3VVUA 2M4MA 2E9ZA 3R5AA 2NZCA 1RTJB 3TX0A 4NZ7A 4NZ0A 3LWLA 3EPGA 4IFVB 2MKSA 2PC6A 2AGOA 5KFAA 2J7WA 3DDIA 4A8WA 1PG5B 4ES2A 4C8YA 3CC4S 4WK1A 4LFAJ 4CM0A 1U26A 4ZPAA 1RHKB 1RWMB 5AXMA 4F4XA 1QAJA 4DL4A 3FBEA 3SMZA 2BJ7A 2XB2D 3TYTA 1XERA 3ENVA 1IUJA 5E7OB 1HBMB 1PC4A 5CYMA 1Q82T 1YHQS 2CADA 4JP8A 1HMVB 1X5SA 2QSFA 1F6TA 4UW2A 1IKWB 1S12A 2BE2B 2BOAA 2YWWA 2RU3A 3Q8QB 4UY85 1VQNS 1WHWA 4R8UB 3I5CA 4NZ6A 3SCLE 1RYSA 4GC7A 4OZJA 4Z37A 1F1BB 3RUBL 4NPOA 3MM7A 2WHOA 4ILLA 5B0AA 4ECYA 4FPRA 2Y1IA 4M5HA 4DN9A 1R6VA 4X62J 2VPXB 3R2DJ 2ZJQQ 4FXVA 2VA3A 4PG6A 2DNMA 2OPQA 1VBXA 2YKAA 4KB7A 4IUFA 2RH3A 2VPWB 1RABB 1SUQA 4LT6A 3PX0A 1X9WA 1Q8BA 1IKXA 4V19J 4N47A 2P2CB 2W2NP 3RU0A 4M5NA 1WC4A 1R43A 1LWCA 4Z7CA 3DOMA 1HYSA 2VBXA 3BGRA 1DTQA 4FYDA 3J7ZT 3T1HJ 2ZZNA 2MHNA 5ETTA 4NMLA 3RAQA 3D3CJ 2CYYA 2ADCA 3ZTSA 2PMHA 3FZ2A 3GG0A 4C3LA 4ED4A 4LRBA 2EG1A 3VGTA 2DR7A 1NK4A 1EB0A 2XTJP 3MR2A 4X66F 4K59A 3FMBA 1X5PA 4G3IA 1NLKL 3QGPA 1JK9B 2M8DB 2MB0B 2HVIA 1AA1B 2EPIA 1X4HA 5C42A 2XS7A 2BACA 3NXZA 3H5SA 2UU9F 1BQMA 3CEDA 3HHLB 3CXCR 2HNDB 2JVRA 4EYHB 1S0NA 4I6YA 2XHWA 2QA4G 1G4CA 4DV3F 4DFPA 1TKDA 4DPYA 3CJ5A 3K5PA 3CCZA 1KLNA 2F9DA 2Q6CA 1PIEA 2C42A 5GMEA 2DXEA 3SSQA 3ZNJ1 1TAUA 1RT5A 4ED1A 1CJVB 1DY3A 4B3OA 1JXVA 3G8SA 3GONA 3CF5Q 3QZ7A 5CXTA 4F3OA 1YJWS 4OI2A 1K0TA 5IC4B 3IA0A 2IPOB 4ZLJA 3MR7A 3ZNUA 2DB1A 2GHVC 3UR0A 3OFHA 1PSDA 2RD5C 2YX7A 4ERDA 3VQTA 3PFOA 3QIDA 3FBFA 4CO0A 4B3MJ 3E3XA 1FXLA 3T5KA 1EX8A 1FDAA 2G13A 2KYXA 1NK5A 4USWA 4CLLA 3GR1A 4R5PB 3NGDA 2CQGA 4LRFA 4PCQA 3TZZA 3G6VA 1ZH5A 3UDLA 4Q45A 1QY7A 1RB0A 3LAKA 2YWGA 2HURA 3BV8A 2DGQA 4ICLB 4ZLNA 2OLWA 2FYXA 2BXJA 3LOUA 4M63A 1MWYA 5A8KB 5L39A 1NO8A 1NBEB 4W98A 1VQLS 3OXFA 1U4BA 3GWCA 1QE1A 4NI2A 3NP5A 4DV6F 4XIUA 3G6XA 4OJ3A 3CGIA 4R25A 1C1CB 2E29A 2GJ2A 1N6QB 4DF4A 4ANEA 3RW6A 1X7VA 3ZZUA 5KG7A 4LQ9A 4HI2A 3UFCX 1LW0B 4CLKA 3E01B 5IWAJ 3CD5A 2HIYA 2QJ3A 1NB7A 4A8XA 2KHCA 3I0RB 1T7PA 3OTOJ 2MHEA 1FX2A 2VQEJ 5KFGA 1KONA 4ELVA 3QMQA 1TELA 3PG9A 3HVTA 5KFLA 5K8OA 3C46A 3PFEA 3EZ5A 4WBFA 3BGLA 2IMWP 1GMWA 3MEEB 1N0UA 4ECSA 2ILZA 1VLOA 3DGPB 4OI1A 1HKAA 4OFZA 2UZAA 4BHQA 1G7CB 4DSKA 1EZZB 3K2YA 2W8KA 2V0NA 2CDRB 4DF8A 1DARA 2GC8A 2DNKA 1RZMA 3M9OB 5LL6d 3U1MA 2AZ3A 2FZKB 2IAJB 2UUAJ 3U1NA 3W2VA 3NMRA 3BM7A 1HNWJ 4RW6A 4UTGA 4DCPB 3OHBA 2DR6A 1Y7PA 3A8IA 4AQYJ 3CULA 4MTPA 4DR3J 3MM5A 2B9WA 3HT3A 4KJIA 2R7RA 3BZQA 1SH3A 4WZQA 2XMAA 1YBTA 3POTB 3G82B 1HWJA 1JKHA 5GVQA 5G0RB 1WHXA 2KT2A 2E9TA 1UMJA 2IM1A 1URNA 5L8RC 1IR1A 3SBMA 4Q8EA 5CHCB 1FI4A 5JXSA 2ZHAA 4UOFA 2JVOA 2HFUA 3CCVS 2J6SA 1WSRA 2EK1A 2O5DA 2NQPA 2H1YA 1Y9OA 5B7WA 4X2BA 4Y34A 5DQGA 3MECA 2ZJRQ 1TQLA 4DQSA 2PSZA 2LEPA 3FSYA 4HH0A 3CWJA 3PRVA 4AE5A 4Z2XA 1LXJA 2PGCA 2VKZG 3BEGB 1S1TA 3AXKA 5LT5A 1D09B 1GEHA 4MKBA 1R0CB 3TX8A 1N36F 2HHQA 2QYGA 3SFUA 3JYTB 3GYXB 2VQFJ 2F1FA 3CD7A 2VG6A 4U7UK 3QO9B 3FBBA 4ZLPA 4F2SA 4QJVA 1VRTB 2A6MA 1QTNB 2PIIA 4K0KJ 1REVB 2ZEJA 1QAYA 3D5MA 4QWDA 5EWEA 3DDNA 1O0PA 3EGVA 4HHHA 4CO5A 2FVQA 1ITPA 1N5YA 2CPJA 3LAMA 3OR2B 4I2QA 2YWKA 3CJSA 5A76A 1D9AA 2CPDA 4U67Q 2B3TB 5D8HB 4QR2A 3HPOA 3QGIA 2C2OB 2K7KA 1D9DA 1WNEA 2BRKA 3MTJA 3I6PA 2BDPA 5DM7Q 2FJVA 3A8KA 2IC3B 4KE5A 2EFPA 3ONQA 1TUGB 2KM8B 4DUYJ 3C14A 5ETKA 1Y0HA 3T6BA 2MY7A 3NS6A 4B08A 4P71A 3TUPA 3I87A 3RB3A 1NPKA 1VJQA 3K89A 1WDDA 2HHVA 2YNIB 2R7UA 3CCES 4G65A 1F5BA 3BKTA 2M0GB 3D1OA 1SC1B 5I4MA 4BS2A 4IYQA 1H72C 2H9ZA 2YKNB 5BYSA 2YQ1A 3L7UA 2NXCA 5I3UA 4M5DA 1HW9A 1JLGB 4DPUA 2F8EX 1UETA 4MIBA 1NXIA 3O8WA 4YFUA 4DHVA 4O3NA 3P5TL 3L4BC 1TFWA 1UFKA 4FF3A 3VQSA 4L3NA 4NLVA 4RPFA 4ANCA 3QYYA 2CPHA 2AGPA 1JLEA 2CQ1A 4KHPF 3NGTA 4Z7YA 2ZDPA 2HS0A 3R27A 3T1YJ 2ZJPQ 1XMOJ 4X84A 1HWUA 3FFIB 1T03B 1FD8A 2YX1A 2AJ4A 4PQUA 3EX7B 2GV1A 2V8HA 1FXRA 4WYWA 2NYIA 2DRAA 2F40A 3SCJE 2EBGA 2G0IA 1MSWD 2EFNA 1H6KX 4N8NA 2GJIA 5D0GA 4J9NA 1TL4A 4WFYA 3M6UA 5I3PA 4C0BA 1NAQA 2XYGB 3D6TB 1SJQA 4LF6F 2QV6A 1GMVA 2JLFA 2AGQA 2GHPA 3PYFA 3QLHB 1VK8A 1WG4A 2DGSA 3GSIA 4J91A 2KVIA 1J5OB 3E51A 3S7RA 2Y9HA 2K8GA 3LQVA 1NJYA 2HBZB 4K2JA 1RTJA 4A48A 4DR2F 4IFVA 2QL7B 4M5MA 2E7VA 4X65F 2Y1RI 2ZKUA 3SSRA 4YQWA 2KHDA 2DH9A 1S1UB 5E0OA 1Q81T 1UFWA 1JLAB 3EZOA 1EHWA 1EJ7L 3JQJA 2R8GA 3MMBA 1YJVA 1Q86T 1TL3B 4EFAC 5CQGA 4OL8A 4NA2A 4Q5VA 2G9OA 3CJKB 1JB0C 1LK7A 1HMVA 3RB4A 1IKWA 1F2HA 1WTFA 3TUZC 1FHTA 3FK4A 4J9SA 2WRMA 2J6UA 3MUMP 2AEMA 2F4VJ 4CO4A 3LF0A 4R8UA 4NMXA 4QOTA 3GQCA 2ZM6F 2FJEB 1R27B 1M1HA 4WFXA 5GAHI 3MFHA 4LFCF 2DY1A 2D3UA 4PXEA 1PJ5A 1KHWA 1V3ZA 3C6UB 5HO4A 4K7QA 1IWGA 2UP1A 5IT9U 1NPPA 2J8AA 3OLAA 3CTRA 1HI0P 4X4TA 2BQUA 4B9TA 1L5UA 3H4DA 3G86A 4CRJA 3W5YA 4O44B 4GKKJ 3MDFA 1KWMA 3BPDA 4LREA 1KRPA 3W62A 3GV5B 1K1QA 5CA5A 2VONA 4QYZJ 1CSJA 2J9EA 5J1PA 2GVZB 1SC4B 1Y10A 4OX9F 1DQ9A 3UCZP 3TO8A 2BJ9A 5DLGA 3BREA 3M1VB 2GFFA 2XLJA 3I56S 2EFVA 3PO4A 1NM2A 4X4RA 4LF7F 1U8SA 4LBIA 2ALZA 4LVNP 1FJ7A 1MU2B 1JWWA 1G1XA 3U1LA 2ACYA 4IH5A 2IA0A 3T5HA 4ECTA 2OKQA 3LALA 5HQLA 2DNNA 1YZ7A 3RR7A 1I51B 3DLHA 1RLCL 3ZZOA 3BPSP 1L3SA 3DU6A 1L3UA 3HHLA 3TJAA 1RHUB 2D69A 2VG5B 3DLGB 4HR2A 3V6JA 5HMYA 1U02A 2VDIA 2CQ2A 1HQEA 3SZ2A 4IOAQ 2NREA 4KQZA 3D7SB 1T02A 3OW2R 5C24B 3HFVA 1VDHA 5F8IA 1RAAB 2CG4A 2XC9A 3HVWA 5B0GA 4DR1J 4A8SA 2RKIB 2IYIA 2OH2A 2I0XA 2LFVA 1CJVA 3IGVA 5KG1A 4HHUA 2WVCA 2XZTB 3BQ1A 1PCAA 2JC0A 1WG1A 2GQCA 1HHSA 2D74B 2PEHA 2GCFA 4DL7A 1ZYQA 4D3GA 5ETVA 1IKVB 3GSDA 3O5TB 2UUWA 2CJQA 4KO0B 1YTYA 2V4QA 4ZHRB 3F73A 2WZ1A 2ZH2A 4EO6A 1S59A 2ROGA 3K5NA 3PYEA 1WF0A 1RWXB 3QIPB 3M2UB 3DN9A 1SXLA 3N79A 2GGPB 5KT5A 4FBTA 1TV6B 1SH0A 3I9ZA 1HW8A 1NSKL 4BBYA 1RT3B 1U25A 4OZ1A 1HWLA 2DR5A 4R5PA 1X9SA 1JXLA 3J7Z5 1RKIA 4DL6A 1S77D 1NKCA 1IM6A 5CCMA 2PI5A 4RNNA 4FKXA 4ICLA 4CLFA 3TEGA 3MWBA 2MSSA 1QLNA 1UTAA 1M1GA 1VQSA 2I9SA 1MWZA 4P7VA 4E0DA 3Q89A 4DSLA 2X1FA 5A8KA 1R3NA 5KG4A 5H9EK 2ZH7A 4EBEA 4PYAA 6AT1B 2DGUA 3NRBA 3FJ2A 2B43A 3I5AA 2J9DA 2KXNB 2M52A 2P9GA 2VD3A 2GO9A 2JL9A 2HG4A 3G2XA 3R5DA 4ID5B 2YNHA 4HDHA 1AZSB 1HWIA 1W26A 1N6QA 1YWXA 3D9BA 3EM1A 5FIIA 5HAOA 3TARA 1LW0A 2EEYA 3AQOA 1CJKB 2PDAA 4LSNB 3E2EA 3DNCA 2FJBB 3W1YC 2FLNA 4W90B 1ULRA 1N88A 1T9WA 1RA6A 2OMLA 4HLBA 1U1RA 1MMDA 4K4WA 1FKPA 3K59A 1FJEB 2F3JA 3LH2S 2UUCF 1RISA 1N33F 2R9LA 4P2SA 3AOBA 4LF9J 1U0SA 2NPFA 3J7A1 2XY5A 4ZPDA 4QWCA 3AFGA 1J2VA 2HWIA 3V4IB 3T9ZA 1FRKA 3MEEA 4I69A 2OSQA 1BQNB 3MCMA 3H8YA 2MZJA 2BV3A 2VKRA 1T0TV 5GADI 2CIMA 2LDYA 3UE2A 2EC0A 1D8ZA 4CT9A 4QCLA 4A8QA 1NH7A 2QLWA 1NK9A 2IAJA 3OR1B 3FC9A 4YP3A 4A4JA 2W4PA 4J9PA 5KFTA 3KUHA 2WK4A 4RWXA 2VJVA 4JI4J 1VMBA 3LUYA 1CULB 2CPZA 3GIKA 4ZCKA 3TJ8A 4WPAA 2DO0A 2UXCF 1ZTWA 1JQGA 2FLPA 1V3RA 2DKOB 1SJ4P 2OP5A 4B3TJ 2NXUA 1XR5A 2RRBA 2FVSA 2WCXA 3QRPA 4DPOA 3G82A 3MEGA 2V68A 2HFOA 3PZPA 2PE8A 3QSIA 3E8OA 9RUBA 4O23A 2HHTA 2V6AA 2E5LJ 1L3VA 4ZJQA 1MROB 3DU5A 4KH0B 1WKKA 4IH7A 2CPXA 4N8OA 3DFEA 4WP9A 1NU4A 2W01A 4TKTA 2ADBA 2AYGA 5J2PB 3MR5A 1YRTA 2HPUA 4DFJA 4DJBA 3P49B 3W9HA 2F4FA 4QBUA 4I0WA 1IJFB 4V1Ak 2V94A 2OHDA 4LVOP 3WC0A 5GAHU 3BGOP 4HDGA 1HBUB 4WE1B 1OQ3A 2MXYA 4CH1A 2W7OA 1N0VC 3JYTA 2DHHA 3NOGA 3PR5B 2GMJA 1V6HA 3QO9A 2QFIA 1B0PA 3B6BA 1N5SA 3IM8A 2MKJA 3TVZA 4EYIB 4IDKA 2B4VA 3CCMS 1UZDA 1TL1B 2H3EB 4OIXA 1MNEA 3UDVA 4WP3A 1PGZA 4MYTA 2V2KA 3ENWA 4NLXA 3R9LA 2FLOA 3CCRS 4NE9C 4DQPA 2MJNA 1RAGB 1NK0A 3ETMA 1SJRA 2C3MA 3Q86A 3M30A 4DG1B 2XO7A 1KSPA 2CVIA 2B9XA 1V9OA 1J27A 5ETSA 1Q7YT 2DCLA 1XNRF 2OTJS 4B3RJ 2LEAA 3NMAA 2IJRA 5AXLA 4P72A 4GO5X 4UQGA 2XGPA 3CT9A 3UDCA 3LP1A 3C8YA 3TOQA 3LPYA 3OD2A 5J2QB 1P9QC 3HX9A 4HEA9 3KK3A 2YNIA 3QT8A 1U7LA 3BSOA 1I94F 2F7VA 1UEKA 3QSYB 4EU0A 4USIA 2J7KA 3L95X 2YKNA 3BKFA 3N6NA 3CCWA 2C3UA 3NWGA 3G6YA 4DR6J 1WELA 2Z2MA 5L1KA 2VU5A 2YH0A 2C3OA 2N4CA 2V8VA 3MPDA 3C15A 2QMXA 1WHVA 1FRMA 3ZC4A 2HZVA 3C6TB 1WORA 4F4KA 5JJBA 1AFJA 1DQ8A 1SC6A 4FXWA 5KFNA 4LF4F 5D0EA 2RVJA 3TANA 1RWKB 1K1SA 1UVLA 3SCKE 4TU9A 4ECWA 5B0FA 1VBKA 1BGXT 2AF6A 2VUGA 3ZZYA 4JI1J 3AB4B 3FFIA 2BABA 4OI3A 1URRA 2HAFA 5K20B 2XQCA 1IN0A 3CC7S 2QLBB 5KFEA 3W5ZA 1XK8A 4M5KA 4LF6J 5LXYA 2MGZA 4DV5F 2MKYA 3G8QA 4WCEQ 3CDEA 3FGVA 4LSZB 3OJSA 4NASA 5K5MA 2KFZA 2XMMA 5KG5A 2B7CB 2IVYA 3D6FB 2V4JB 4MK7A 4OHZA 5L9NA 4EUVA 4ILRA 3TUIC 2NLWA 5L1IA 4GMKA 3VZHA 1NPRA 1OS5A 2KZZA 2A2CA 4DR2J 3HCXA 4PKDB 1H7WA 4X65J 5KG2A 1R8CA 3LP0B 3QLHA 1SH2A 4ANDA 1J5OA 1B70B 4FN5A 4PRFA 1TAQA 2BQRA 1FK9B 2JLEA 2CQ0A 3H25A 3GG1A 1Q8IA 4J90A 1V5IB 2V63A 2DH8A 2M2BA 1S1UA 2JFDA 1NZAA 4KHRA 4WK3A 3QGHA 1TUWA 2Y3YA 5HMXA 3HD1A 4I64A 5L46A 4FF1A 1RT2B 2DNZA 1QSSA 3TAMB 1TL3A 1B7YB 1Q53A 1S72S 4F2RA 1T3OA 1ZOTA 4EGLA 3T1AA 4HTIA 1UJ4A 3QJLA 4LFCJ 3RB0A 3OJUA 1NDCA 3H5UA 1R8HA 3DGVA 2NSBA 1S0VA 1SKSA 4QW9A 4J9LA 4GKJF 1S1WB 1RXOB 2N4DA 1ICEB 1BLUA 4DLGA 3TAPA 1QUPA 3ADAC 4U7UD 3A4TA 4DV0F 1AT1B 4CYUB 4FYWB 3MF5A 3N4WA 1TZ0A 2FJAB 4X4PA 2DO4A 1GH8A 1RCXB 1VRUB 2BZ2A 2B51A 1KQFB 2BUNA 1C1BA 2V8DA 1GAOA 1S9FA 3C6UA 2VDHA 3SCIE 4JYAJ 2CWXA 5DJBA 1GTEA 2D9OA 4ZLLA 3C16A 2YVSA 3BH7B 5GADU 1FJCA 3KXDA 1RAEB 3J80Y 3QFHA 4X64F 1VBZA 1AYEA 4OX9J 3H42A 4O44A 1KVKA 3TVKA 2KN4A 3HVRA 4Y0FA 2DNLA 4QW8A 4U96A 5GAEI 4LF7J 4P7TA 4I6AA 3P3DA 5ETPA 2NYHA 3A12A 3GIJA 1R0AB 3SQGB 5H9FJ 3CCJS 4GVBA 2AP6A 5EX3A 1EIYB 3IC1A 1SV5B 2GVZA 4C6AA 2RILA 2Y0SD 2V8PA 4HH1A 4JB8B 3MURP 4L6V3 2MKCA 3M1VA 3VGVA 4NCBA 3LTOA 4Y3CA 4ED5A 2U1AA 3MCNA 4ZIVA 2FUG9 4DR7F 1H98A 3V4MA 2X3DA 2H5IB 1QD1A 3O44A 2UXDF 3FCVA 4DFKA 1X8DA 4FBUA 2VG5A 5KFIA 1ELOA 4TN2A 2JEGA 5AT1B 1HNXF 1VISA 3UCUP 2XHCA 1MN9A 1QSLA 2IRYA 4OZNA 2P9CA 4HHJA 5C24A 4CH0S 4DBQA 2Q66A 4AD6A 1NRKA 1RUSA 4DL0C 3BO4A 2RKIA 2ZVSA 5FJ4A 4A8FA 1GXLA 4KKOA 3VVTA 3L3CA 2YWEA 4UUXA 2VPYB 3HZEA 2EK6A 2ERRA 3Q8YA 2GQ2A 3AOCA 3CJTA 3MM6A 2FLLA 2CKWA 4K4ZA 4ZCIA 4LFBF 4KO0A 4ZHRA 1LWEB 2OD4A 2XCAA 5GAGU 4USMA 2CFXA 3UD4P 3QIPA 3A3OB 3M2UA 4LF5J 2GGPA 2Z2ZA 2QL5B 4MIWA 2FC9A 4P52A 1N5TA 1TV6A 3M8WA 5D78A 5DZ6A 1EKRA 4WTYA 5HQ8A 3RW7A 3DLLQ 8AT1B 1YG0A 3M05A 5CH7B 1N32F 2XMKA 2KT5A 2XY7A 3NAHA 4HI1A 2DNHA 5C2CA 5J2NB 4OHYA 1KKHA 2MQNA 3FUYA 4IFYA 3H4BA 2WAQD 2GW8A 1SUQB 5F41A 2K2PA 4HL9A 4DR5F 4P6QA 4QPXA 1IVZA 5K8MA 3DOMB 1PILA 3G9CA 3CMQA 3OSNA 2HWHA 4ZVFA 5IT9Y 2RAQA 3M4XA 2BW2A 2V9KA 1NSPA 4DX6A 2HBQB 2NXEA 2Y8YA 1AZSA 2DGXA 5HQMA 2J0QD 4LIWA 3HI9A 4DN0A 4UOHA 2MKKA 3OPKA 3QWUA 3CJ0A 1CJKA 4NLTA 2UUCJ 2R7TA 2EBEA 2NR0A 1ZA1B 1N33J 2LP4A 2I8EA 3HJFA 4XK8C 2W2QP 2DJWA 1XN9A 1BQMB 2LEBA 5EDWA 2VFUA 3T9NA 4LRCA 4B02A 4YOEA 2HLUA 3BDEA 4RBVA 3SDEB 3IRWP 2DGVA 3PIOQ 2PT0A 4EBCA 1WACA 2C22A 1JLFB 4CT8A 2RS8A 2DGTA 1Q7LB 3PHTA 1VRQC 3R3TA 1XIQA 5DGAA 2IRUA 3V4IA 3VALA 2P5VA 4C9DA 2BW7A 2NS1B 4Q7AA 3M6VA 2HBYB 2EKNA 1IXKA 1NK8A 2AT1B 4ZPCA 1VC0A 5D0HA 3EYZA 2HZAA 3OR1A 2M5YA 3V81B 2XM3A 4PXBA 4HT5A 2M3DA 5F9NA 1CULA 2AJ2A 3UPFA 4PWDB 1KTVA 4F3MA 3TQ1A 3Q8VA 2WBMA 3F56A 2LYVA 3M8SA 5I42B 2YQ0A 2GO8A 1W2BR 2HS4A 2KXFA 4URSA 1S97A 2VPZB 5IFMA 3ENQA 3RAMA 1DLOA 3H7HB 5IZHA 1SJ3P 1DHMA 2M9KA 3UD5A 1UVKA 3NGRA 1TL7A 3DRPA 4YR0A 2IDLA 5CABA 3TP2A 2GIFA 4C3MA 4RJVA 1MROA 1UJ5A 3OL7A 2JEIA 2DTJA 3VF0B 2E66A 2MLZA 1XQIA 4F50A 1ZTTA 2P6TA 1AW0A 3DRYA 4LF8F 2QGFB 1GNKA 2J0WA 5J2PA 2UUBF 3D6HB 4NCGA 2K3KA 3ZZRA 2JZ5A 3OFGA 2L48A 1QE1B 2AYEA 2EWHA 2BX6A 4RW8B 3MPVA 2ZDOA 1HBUA 4WE1A 1X4CA 2JH3A 4RW4B 1U49A 2ASDA 3IP0A 1VQMS 2N3LA 2EVZA 2E5GA 1U1OA 2MQOA 1UJ6A 3PM9A 4ETXA 3NS7B 1TL1A 3ZZTA 5KOWA 1WF2A 5E3AA 3PDNA 1Z4UA 3CO9A 2QLXA 1RK8A 3B78A 3M6XA 5KFJA 2C2EA 1Y00A 2A6OA 5K8PA 3V6HA 1XNRJ 2D3O1 1U48A 3LGMA 4IG3A 2GIQA 1VCTA 2ROPA 3NL0A 1HD1A 2YBVA 1CJTB 4UZBA 2JEFA 2V50A 2ZWPA 4ED3A 1W7WA 1I94J 4RNHA 5A8WB 4GC6A 4NLPA 4DSIA 1IQTA 5IC6B 4X4SA 3GJTB 1S10A 1IR0A 3QGGA 3OFFA 5DG8A 3MM5B 1KP6A 3CDAA 4KH1B 1S49A 1KHVA 4HYKA 3P4UB 3ILIA 3KNGA 3R97A 3QRRA 4DZ6A 2ZNYA 4MYUA 2R8IA 2E7WA 1C2PA 1NHVA 1TKTA 3VAGA 2ASLA 4DPTA 1TKXB 1XNQF 3B54A 1BWVA 3C6TA 3DM2A 1MG7A 3HM9A 1YITS 3S6EA 4A8KA 2R2UA 2CG8A 1YJNS 5T14A 1PJ6A 3ZZPA 3BDPA 4TVAB 5LMNF 1X31C 5EWGA 1FERA 4OI0A 2ZH5A 2O67A 2G2YA 1HNVB 3MECB 3GJQB 3DXBA 1HBNB 1F3FA 1RT4B 3R2CJ 4ZVEA 3C3LA 4K4XA 3HK2A 2BANA 2OPSB 4YHHF 1PAUB 4KPCA 3AJDA 3NNHA 2P8IA 3EGNA 4L75A 1VGYA 3I55S 5IT4A 2HSEB 1GX5A 2V4JA 2WVDA 3DRRB 2OMOA 2HVZA 1N5QA 5DLFA 4Y2KA 2KFNA 1K0VA 4OZ2A 4PG5A 2FHJD 3GFYA 1WKLA 4DUTA 3LP0A 2B5JB 4NA3A 2BJDA 2M8HA 3NGSA 4XDCA 3WZ0A 5JMNA 3TRGA 2DYAA 2VH7A 1SKWA 1HNIB 1CPZA 3PW0A 1FK9A 3BYPA 4NXMF 3C66A 1T95A 5LXRA 1HQ2A 4AXIA 3WQPA 2ROEA 1TUVA 3LGNA 1S48A 2Q43A 2J76E 3PVXA 1TMMA 2CRLA 3W9JA 4U8VA 4FNHA 1XMQF 3AHPA 1NH8A 2VC0A 3RBDA 3TAMA 4A8YA 2VICA 4Y2AA 4IRKA 4C97A 2FPHX 3RB6A 4MK9A 3QQCD 3OUYB 5J1EA 2AEFA 4QWAA 1S1WA 1SC3B 1WI8A 1YVFA 3KMSA 2QYCA 3MEDB 2G2ZA 2V69A 1X5TA 2GAHC 3ELHA 1X4GA 4CYUA 4DL3A 4KBIA 3UR3C 4B9MA 1N4LA 4KGMA 2EW9A 2FIUA 1VRUA 4RZRA 3GFHA 4X64J 3JTNA 1OJ4A 2VFTA 1FO1A 2RQKA 3KWMA 7FDRA 4Q2MA 2LLZA 3PJWA 3CCUS 3O3LA 5EN1A 4XDDA 2E9RX 2I38A 4AL5A 4USUA 1EETA 4IO1A 3V5RA 3SXLA 1U2RA 1JLEB 2C3YA 3I9V9 4B9UA 4JV5F 2GQQA 3IG1A 2YX4A 1SI9A 2JRSA 2LKZA 1FJGJ 3KJFB 2I1RA 4ALZA 3LP2A 4O3SA 4OYIA 1F9FA 3SQGA 3TWZA 5M2UA 4AL7A 2KTQA 4I56A 1SJFA 5D15A 2G0JA 2MKIA 1JJ2R 2UXDJ 5E2QA 3GYNA 2V67A 1YZ6A 2W24A 3HSJA 3BSAA 4ED8A 1IKYB 4U7CA 4P10A 3OQ2A 1HNXJ 1FDBA 1S57A 4ZVOB 1FNOA 2XZDB 3T19A 1P9YA 4J37A 1U1LA 3NEKA 1NEEA 3BBBA 2JJ4D 5MLCV 3M8QA 1Z2ZA 1NDLA 4EI2A 3BSCA 5HN0A 1HNZJ 1ZM2A 1KLMB 2MY8A 3FRYA 1SL0A 2HVEA 3VHQA 2VJUA 5IM0A 2Z58B 2ZWOA 3LW5C 1MLAA 3D6MB 1T9TA 2Y8WA 3I82A 1FFWB 1UFLA 3JSBA 3MMBB 3K5OA 2IBOA 2A1BA 2HIQA 3HZGA 3DRSB 2CJKA 1HBOB 5IOLA 2CQCA 4CWBA 4WFAQ 4A8MP 3MAAB 2CZ4A 4MK8A 1GQEA 5F3TA 1LWEA 1CJUA 3EMTA 2ZC4A 2OAUA 1Y4ZB 2U2FA 3P96A 5E3RA 2DNGA 2LXFA 1PBAA 3PV8A 2R42A 4NXNJ 3EXYA 2R8HA 2IA6A 4DSEA 4RNMA 4DDFA 4DR5J 4CP5A 1OIAA 2KL8A 1QM9A 1RWWB 2G1DA 3Q23A 2AJFE 1XBWA 3AA8A 4IRDA 5J2NA 5HI7A 2CQBA 3CD6S 2R7XA 2RQMA 3UNGC 1OPIA 2CVEA 4K5SA 4XPEA 1U1MA 2R2RA 3EVMA 4RUBA 4ZVSB 3W63A 3QAUA 3J81U 2VG7B 3CCQS 1RBOB 1U09A 2YY3A 2LQJA 3A1YG 3CDWA 1B7FA 1N56A 1KFSA 1A6LA 1UCNA 4C8OA 1GMUA 3ZO7A 4AFFA 5F8GA 3DLEA 2DIVA 3THVA 1WKJA 1J5EF 1SPBP 4X4NA 3RZAA 1EP4A 1EKSA 2DEIA 2BE9B 3OTDA 1S0OA 4Q2LA 3Q2TC 2XMTA 4K4VA 3DLKB 3PW4A 2FVRA 1AB8A 5ETMA 3LPEA 1ZBTA 5LSLA 2YH1A 4QIVA 3ILLA 5KFMA 3HF5A 2B4OA 2KI2A 4OYXA 1R8PA 1UA0A 3W8PA 3JTPA 3SDEA 1YBAA 3RG6A 2MMYA 1WC1A 3EJMA 3K8WA 4F0KA 4H4KA 1GT8A 4M1KA 1HQEB 2WB1D 2J5AA 1M5PC 1GFWB 1JLFA 2UUTA 3IGNA 2HHHF 1VQYA 2BMBA 3CJRA 1H3DA 4CO1A 3ZTRA 1Z1ZA 3EXCX 1HQUB 4ZPTR 4UQTA 1CQMA 2Z0GA 2XG8A 3D28A 2DIUA 3GMGA 2WSFC 5F8JA 2LMIA 4KGZB 1B0TA 3IAM9 4G1QA 2MZRA 3UVJA 3MOZA 4DI6A 2ZH3A 4B3SF 4O0IA 2DD8S 2ZBIA 1XJWB 3EE3A 3V81A 4ZITA 1JNZB 4C4WA 4NLGA 3EWGA 1VK3A 3AH6A 4PWDA 4OJ1A 3RYLA 1LV5A 1NK6A 4EMDA 5I3QA 3QNWB 1Y5LB 3MMAA 4YS2A 4LFAF 5I42A 3US5A 1LQ9A 3M8RA 2CQ3A 4JV0A 4OZLA 4NEZA 3EDQB 1EAYC 3SV4A 1SJ1A 3TNVA 5ITHA 1S7IA 3KLFB 5L1LA 4ZIWA 2PMZD 1PBUA 1RTDB 3KHHA 2XO6A 2JLGA 2UUBJ 3NNCA 4FF2A 2ZD1A
chains in the Genus database with same CATH topology
5GAHU 2L3MA 4HDGA 1HBMA 1HBUB 4WE1B 1OQ3A 3VAHA 1VC6A 2HFNA 1N5YB 2MXYA 3ISNC 4CH1A 5AJ3F 1FA0A 2W7OA 4DL5A 1H2TZ 4I2QB 3NCQA 4RW7A 1F60B 1N0VC 2YNGA 3JYTA 5A0YA 2HRUA 2YNFB 3IAS9 4URGA 5KAKA 3NCPA 3PR5B 2J9DE 3OVAA 4UUWA 2KXHA 4F4YA 1MMNA 2HNYA 1AUDA 3TA1A 4HT7A 2BE2A 2GMJA 3Q22A 2DR9A 1V6HA 3QO9A 4LJMA 3ISND 4Q0BA 2MZTA 1B0PA 2KU7A 4F8RA 2ZHOA 4YB6A 4C0HA 2DH7A 1N5SA 3MMJA 2XCPA 5GMKa 3M8PB 2QIFA 3MGJA 2D9PA 5CYJA 2MKJA 5KFPA 3TVZA 4EYIB 4ZPVR 1G6BA 2PD1A 4IDKA 1DJ0A 2B4VA 3CCMS 5K8NA 4ZVHA 1KR4A 3LANA 3AY0A 1QUVA 1RT2A 1TL1B 1X0PA 4OIXA 1MMLA 2RF2A 4OHVA 1MNEA 1YJTA 4ECVA 4RW8A 2YNHB 3CCLS 1JLBB 2R2TA 3PJXA 3RBEA 1PGZA 4MYTA 2V2KA 3ENWA 4NLXA 2IJNA 5IQQA 4ZP6A 4RW4A 5AE1A 1KS2A 1S1XA 2BR0A 2FLOA 4OMFG 4J9MA 3CCRS 4TLQA 3MM9B 2AX0A 5KG0A 2DHGA 4B9LA 4DQPA 5D4PA 3CD0A 1P6TA 3DI6A 2ZE2B 2MJNA 4BC7A 1DFDA 4WYLA 1NK0A 1SJRA 4ATNA 5FLXY 4WU2A 2C3MA 1RA7A 3M30A 3W2WB 4DG1B 3M6WA 2WW8A 2XULA 2XO7A 2VBZA 2XI3A 1KSPA 2CVIA 2RJZA 2BBEA 2B9XA 3H98A 3KLEA 3KHGA 2FY1A 2KG0A 5DDOC 1VFJA 3M2RA 1V9OA 2XBPA 2G0CA 4O4RA 4RW9B 4DUYF 3PX6A 2DCLA 1Q7YT 4DL2A 1LW2B 2IM3A 4C7QA 4HKQA 3DCAA 2MQMA 2OPPB 3DMJA 2PA3A 1O8BA 1WWHA 3DYAB 1S4FA 2QT7A 1M90T 1XNRF 2OTJS 3KHRA 5DS7A 1FEEA 1P1LA 4RLEA 1NKBA 1FKPB 3MZIA 2LEAA 4NYOA 1FF2A 3NMAA 4JYAF 3IO1A 4CNZA 4M5DB 3DLEB 5I3UB 5AXLA 4O3RA 2GMHA 3NKYA 5B0BA 4GO5X 4UQGA 2ZH4A 4CTAA 2XGPA 3O6QA 3CT9A 4YR3A 1N54B 3MOJB 3UDCA 3MTKA 3LP1A 5KFSA 5JVHQ 1K73T 1UKUA 3OTEA 5THWA 3C8YA 3TOQA 1D3WA 1S9EA 3LPYA 1S6UA 3MAQA 4DV2F 2VODA 5F9LA 1EP4B 1K9MT 5J2QB 4ES1A 2BQ3A 4PPDA 1TR0A 2QEXS 4A47A 3KLHA 1P9QC 3KJVB 3HX9A 2R7WA 2MYFA 3IS9B 4HEA9 1ZM4A 2VFRA 2HYIB 3KK3A 2X51A 2YNIA 1U6BA 1U7LA 2FHOB 3N6MA 2MQQA 3BSOA 1I94F 2F7VA 4EU0A 1UVJA 3CB4A 4USIA 1WHYA 2J7KA 1S6PA 2RRAA 3L95X 3IR6B 2UV8A 2YKNA 3N6NA 3CCWA 2C3UA 3NWGA 2FJXA 3G6YA 2N82B 3FEXB 4YDXA 1N34F 1WELA 2JSXA 2Z2MA 1CVJA 1FVSA 5L1KA 2YH0A 5A8WA 3H5XA 2C3OA 2N4CA 2V8VA 1X4DA 2QMXA 4PQUB 1FEHA 1WHVA 1X4AA 1R0AA 3NGKA 4YB1P 2WOMB 1FKOB 4R0JA 1FRMA 3OLBA 3SYZA 2VZ9A 3OL6A 2HNDA 4NRUA 4WU3A 4ZP7A 1SV5A 3OBIA 1FRJA 1R89A 3NLCA 3ZC4A 4Q44A 2UVVA 2FC8A 4CCHA 3C6TB 2MKHA 1IBMF 4F4KA 5E3CA 5H9EJ 3KG1A 4ZCMA 1UWBB 5JJBA 3I4PA 1AFJA 1DQ8A 5KFDA 1SC6A 4FXWA 5KFNA 4LF4F 3RRKA 3MI7X 2RVJA 3T1YF 1KFDA 2HGMA 2KO1A 2DPIA 3TANA 3D1QA 2LCWA 2R7VA 4YY3F 1H0HB 1S9GA 4KR0B 1W25A 1K1SA 1UVLA 1GXTA 3SCKE 1FTCA 1U6ZA 3PACA 4TU9A 4Y65A 3R5BA 1BC6A 4ECWA 1H38A 5B0FA 4G1QB 3U27A 4DV4F 3CUNA 1HA1A 3QWPA 2Z8QA 1R6YA 1NJWA 5DDRC 5ADZA 2NPIA 4QPTA 1BGXT 2AF6A 3VAFA 2VUGA 3ZZYA 1S79A 1DAXA 1RT6B 3D0IE 3AB4B 3MEGB 5KFZA 4DS4A 1WTBA 2J0SD 2BM1A 4JV1A 3FFIA 3BF4A 5BYRA 1PC5A 2BABA 4OI3A 3MFIA 1URRA 3MR6A 4EZ6A 1TVRA 4B9VA 1V3SA 1IN0A 3CC7S 2ZBCA 4C98A 2QA2A 5KFEA 1H7XA 2L9NA 1XK8A 2ZH6A 3FMWA 3H20A 2GX8A 1TKXA 2W7PA 4K4YA 1OO0B 1TK5A 3T6JA 4N77A 5LXYA 2MGZA 5KFHA 5KFCA 1Y5IB 4LSLB 4DV5F 3KNAA 2M4MA 2E9ZA 1VI7A 3G8QA 2C3PA 3R5AA 3CDEA 4WCEQ 1RTJB 4DQRA 2G4BA 1E6VA 2Q3PA 2B56A 2V9WA 3FGVA 3PRBA 4NZ7A 3OJSA 4NZ0A 3N0VA 2M7SA 3LWLA 3MMAB 2HLTA 5K5MA 3EPGA 4IFVB 2MKSA 2PC6A 2AGOA 2KFZA 2XMMA 5KG5A 2B7CB 2JHEA 2IVYA 2V4JB 5KFAA 3MHYA 3QJPA 2MJUA 4MK7A 4OHZA 5L9NA 3KK2B 2J7WA 4EUVA 2XS5A 4ILRA 4A8WA 4RU2A 3TUIC 2NLWA 5L1IA 2AQ4A 4ES2A 4GMKA 4RX6A 1HNVA 4C8YA 3CC4S 3VZHA 4B3MF 1HBNA 1OS5A 2KZZA 1RT4A 2A2CA 4K2XA 4WK1A 2AWZA 4WKRA 4ECQA 4ECXA 1Q16B 3CDBA 4PKDB 1H7WA 3UCGA 5C25B 1U26A 2A10A 4ZPAA 2ZH9A 5KG2A 2ZOMA 3THTA 1R8CA 3LP0B 5AXMA 3QLHA 1NNDA 1SH2A 4F4XA 1QAJA 2OPSA 4DL4A 1G2EA 1J5OA 2HQIA 2LU1A 2XMUA 3SMZA 4YEAA 5AXNA 3DRXA 3TYTA 2XB2D 4FN5A 1APSA 1XERA 2ZD1B 3ENVA 4N41A 4PRFA 1XWLA 1IUJA 5DDPC 1TAQA 5E7OB 4OX7A 5HP1A 3VWSA 2HGNA 1KOOA 3OVSA 2BQRA 1FK9B 1HBMB 2XWYA 4TQRA 1PC4A 2JLEA 3ZZZA 3CIZA 1D9FA 1VC5A 5CYMA 1QSYA 1N8RT 4A8OA 1Q82T 4OHXA 2CQ0A 1YHQS 2APOA 4RW7B 3H25A 1AROP 3DRRA 3MCSA 1QVFR 5A0YB 2CPIA 1HMVB 2JWNA 1Q8IA 3GG1A 1BY9A 3VAKA 4WKYA 4LF5F 4IOCQ 4XPCA 1X5SA 2QSFA 4UW2A 2HNYB 4TU8A 2RB7A 1IKWB 2XSFA 2BE2B 2LVWA 2DH8A 1U1KA 3N28A 2M2BA 1S1UA 2RU3A 2JFDA 3Q8QB 1NZAA 3PO5A 4F4WA 4NCAA 2MZQA 2H5EA 2RSQA 1UL3A 3I0SB 4UY85 4KHRA 1VQNS 4WK3A 2B5JA 1WHWA 1FD2A 4R8UB 2IFXA 2NSCA 3I5CA 3QGHA 4IDKB 4NZ6A 3SCLE 5HMXA 5HLFA 1VQPS 1GXUA 1IBKF 2B6AA 1RYSA 4I64A 1HI1A 2LQBA 4FF1A 4C8ZA 4J5OA 1RT2B 3K58A 4GC7A 3GIMA 4F26A 2DNZA 4JI5F 1QSSA 3TAMB 1HNIA 1TL3A 4NYZA 1Q53A 4OZJA 4Z37A 1KOHA 1S72S 5A8RB 4F2RA 1T3OA 3K8VA 1ZOTA 2M70A 4NPOA 3KG4A 3MM7A 2WHOA 4EGLA 4ILLA 5B0AA 4ECYA 4FPRA 2Y1IA 1IBLF 1RI7A 1S1XB 3T1AA 2FJWA 4DN9A 4HTIA 4NL5A 1UJ4A 3QJLA 2VPXB 4L72B 3RB0A 2C2DA 4IG0B 2ZJQQ 4FXVA 2W9CB 3GZ7A 4B17A 4YB7A 2VA3A 4PG6A 2DNMA 2OPQA 1T05B 3OJUA 2ZZMA 4G6VB 3BR9A 3H5UA 1R8HA 4FZVA 1C1CA 5KT7A 1VBXA 2NSBA 2YKAA 3M30B 3EUNA 4KB7A 5CYQB 1YJUA 1SKSA 4QW9A 1QTMA 4J9LA 1S0VA 4GKJF 4IUFA 2RH3A 2VPWB 3BGFA 4ZVGA 1S1WB 5IWAF 2N4DA 1BLUA 5EUHA 4LT6A 1SUQA 3PW5A 3PX0A 1U47A 1X9WA 1FE0A 4DLGA 1Q8BA 1IKXA 4V19J 4FS2A 3TAPA 5EN1A 1QUPA 4N47A 2HNZA 3DMJB 3HP6A 3RU0A 4DOZA 4DV0F 4AXJA 1R43A 3E01A 5B08A 1LWCA 3MF5A 3N4WA 1TZ0A 2EFOA 3DOMA 2FJAB 4X4PA 2DO4A 1GH8A 1HYSA 2PN6A 5A2QY 3OTOF 2VBXA 3BGRA 1VRUB 1DTQA 1T8EA 4FYDA 5F8MA 2BZ2A 3J7ZT 2B51A 1KQFB 3S1TA 2BUNA 3H5YA 1C1BA 2ZZNA 2V8DA 3LP1B 2MHNA 1GAOA 1S9FA 3C6UA 3I0RA 4RUAA 1YI2S 4NMLA 3RAQA 3SCIE 5GAEU 2CYYA 2F8HA 3WDOA 3GR0A 2ADCA 5DJBA 2PMHA 2FHMA 3FZ2A 3GG0A 4C3LA 1DZ5A 1GTEA 2XNRA 2W9BB 4F25A 3OUYA 3KLHB 3DOKB 5E3QA 4U9RA 2XMJA 1H2VZ 2D9OA 2YVSA 2EG1A 4EEYA 3KK3B 2DR7A 1NK4A 3ITHB 3GB0A 3MEDA 5GADU 3MR2A 1U1PA 1FJCA 5A6WA 5KTQA 5KFQA 3OVBA 4X66F 3J80Y 2D3OR 4X64F 4K59A 3FMBA 1X5PA 4G3IA 1VBZA 4KGKA 3QGPA 1JK9B 2BJEA 2M8DB 4I4BA 4O44A 3TVKA 5KOXA 2MB0B 3OXGA 2KN4A 4HVZA 1X9MA 1R8BA 3HVRA 2HVIA 2EPIA 1X4HA 4Y0FA 2DNLA 4LMZA 4QW8A 2R4FA 4DV7F 5C42A 5EX0A 4KV8A 2XS7A 5GAEI 2BACA 3N6LA 4I6AA 4P7TA 3H5SA 3T3FA 3P3DA 2UU9F 1SL1A 4IKAA 3GIJA 3CCTA 2DCUB 1BQMA 3CEDA 4NLRA 3SQGB 1R0AB 2VL1A 3DGPA 4MKAA 5H9FJ 3PKYA 2AP6A 3HHLB 5EX3A 3CXCR 1ZAVA 3IC1A 2HNDB 2AJ1A 4Y6IA 4RUHA 2JVRA 4EYHB 2QSWA 1SV5B 5KT4A 2DBBA 1S0NA 4I6YA 2XHWA 2RILA 4EZ9A 2LDIA 2BOPA 2QA4G 4D3HA 2Y0SD 3QPIA 4DV3F 4DFPA 4HH1A 3B4MA 4N56A 2P9EA 1TKDA 1WEZA 3MURP 2I5JA 1CQNA 3PRDA 1HNWF 4L6V3 2MKCA 3M1VA 3CJ5A 5HBMB 3B4DA 2N7CA 2J0XA 4C8LA 3K5PA 3BN4A 3CCZA 1KLNA 4NRTA 4AQYF 4J9RA 1X0FA 4NCBA 2CPYA 4Y3CA 3KG0A 3Q8RB 4DR3F 2OTLS 5M2RA 1VBYA 2F9DA 3BGUA 4CNYA 3PX4A 2Q6CA 2E5HA 2K3IA 2C42A 2JEJA 4ED5A 2U1AA 4E8UA 3SSQA 3NNAA 2FUG9 4RKUC 4YR2A 2DNYA 1S6QB 4KT0C 1H98A 4DR7F 4X4UA 3V4MA 3O44A 1ZAWA 1TAUA 4KSEB 2UXDF 1RT5A 4ED1A 4B3OA 4DFKA 4RBUA 3G8SA 1X8DA 3CF5Q 4FBUA 2GNKA 2KRRA 2VG5A 5DG9A 5KFIA 3QZ7A 2A3JA 1ELOA 2MGZB 5CXTA 4F3OA 4TN2A 4IQXA 5LMUF 1LOUA 1X4BA 5CZVA 2JEGA 3POTA 2HRYA 4ETZA 1FT8A 1HNXF 1E6VB 1YJWS 3PIPQ 1F0XA 2QMWA 1AFIA 5G0RA 2YQ3A 2KB2A 4OI2A 3UWTA 1K0TA 2IMOA 3UCUP 3IA0A 2FVQA 2YTCA 5D77A 4X4VA 1DURA 2FDNA 1QSLA 2IRYA 4EWTA 4OZNA 4V19X 2P9CA 4HHJA 1IKYA 5C24A 1ZETA 4CH0S 3KOAA 2DB1A 4DBQA 3KHLA 2GHVC 3UR0A 2Q66A 3OFHA 1NRKA 1ZAXA 1PSDA 4E98A 4DL0C 4QZVB 4TY8A 3BO4A 2EKYA 3Q8SB 2R7SA 2RKIA 2RD5C 2ZVSA 1C0UA 5FJ4A 2YX7A 4ERDA 4NOHA 1NK7A 4A8FA 1GXLA 3FEYB 4KKOA 3VQTA 3PFOA 3QIDA 1M5HA 2IRXA 2FTRA 4CO0A 3L3CA 1BD6A 5KFWA 2O01C 2YWEA 3E3XA 1FXLA 3T5KA 2ZH8A 2OIHA 2Q1LA 4OX8A 4UUXA 1FDAA 2G13A 2VPYB 5HP1B 3HZEA 2EK6A 3TUJC 2KYXA 2LA4A 5KFRA 2F8MA 1NK5A 2ERRA 1NJIT 1KLMA 2GQ2A 2RQ4A 3GR1A 2HZCA 1N48A 4R5PB 3NGDA 2CQGA 3H2UB 3MM6A 3W7BA 4PCQA 2CKWA 2FLLA 4K4ZA 4ZCIA 4LFBF 2YWFA 4KO0A 1FDDA 4RBTA 3G6VA 3G71S 1ZH5A 4ZHRA 3UDLA 5HROA 4Q45A 4F02A 1QY7A 3BB5A 3FRZA 2Y1JA 1LWEB 2OD4A 2Z2LA 2XCAA 5GAGU 3IRXB 3LAKA 4IOBA 2YWGA 2XY6A 3DLJA 2CFXA 3MM8A 4KFBB 5FDLA 2DT9A 4H54A 3D54A 2DGQA 3UD4P 4ICLB 3QIPA 3M2UA 4TLRA 2ATLA 1FKAF 2GGPA 4I7FB 2OLWA 2WB4A 5DO2A 4PUOA 4K0KF 4MIWA 2VOPA 2FC9A 2B6AB 1N5TA 2KFYA 1TV6A 1ZM3A 2BXJA 3LOUA 4M63A 1MWYA 2POKA 5A8KB 5L39A 5D78A 3TA2A 1NO8A 5D3GA 3V2UC 4I68A 2QO3A 4DR4F 2FD2A 2CPFA 2DK2A 2KKHA 4WTYA 5HQ8A 3RW7A 3DRSA 2VFVA 3CE8A 3IN5A 1VQLS 1HBOA 1VRTA 3DLLQ 3OXFA 1YG0A 1KEKA 4ELUA 3M05A 4H4OB 3S8SA 1IJEB 1REVA 5CH7B 1N32F 2RDIA 2XMKA 3I4HX 2R7OA 3DOLA 3GWCA 2KT5A 3GIIA 1U4BA 4FP9A 3N9UC 1QE1A 1VQ6S 3CJ2A 4MAKA 2XY7A 3OTBA 4QWBA 3I32A 3NAHA 3NP5A 4HI1A 5GAGI 1RYRA 4DV6F 4XIUA 3OXLA 3G6XA 2DNHA 4OJ3A 2HWTA 3CGIA 5J2NB 1JLCB 4R25A 2ZNZA 1C1CB 4OHYA 2E29A 2GJ2A 2YKQA 2MQNA 1U6FA 1N6QB 4IFYA 3H4BA 1G3OA 2BM0A 4DF4A 3MUTP 3R1LA 3JSYA 1W2IA 3RW6A 2WAQD 2GW8A 1SUQB 5F41A 2JX2A 3BQ2A 1X7VA 1FDNA 2K2PA 4HL9A 3ZZUA 1TFYA 3OR2A 4NLWA 4C8KA 1OSDA 4DR5F 2DISA 1F5AA 5KG7A 4LQ9A 4HI2A 3UFCX 1F5CA 5CZXA