5AXMA

Crystal structure of thg1 like protein (tlp) with trna(phe)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
213
Chain Sequence
TREIYAEMRCIPPVVLRADGRNFKNTLSGLGFEKPYDKTFARAMADTAELFIKKSGLSPLFAYTFSDEISFLFTDLPFDGRVEKIDSVVASFLGSALTIKLRLEEPIAFDSRLVALQKEEIPEYFHRRQLEAWRNFVASWGYYALRNMGRNEAAKYLKRKKESEIHEMLFERGINLATLPSWQRRGVIISKRKITQNWEIPKFKSPFLEKLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords tRNA(His)-5'-guanylyltransferase (Thg1) like protein
publication title Template-dependent nucleotide addition in the reverse (3'-5') direction by Thg1-like protein
pubmed doi rcsb
source organism Methanosarcina acetivorans
total genus 61
structure length 213
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5axmA00
3WC2A 3WBZA 5AXNA 4KGKA 3OTEA 5AXLA 3OTDA 4KGMA 3WC0A 5AXKA 3OTBA 5AXMA 3OTCA
chains in the Genus database with same CATH superfamily
1IKXA 1VRQC 3Q8RB 1K0TA 1U1QA 1XTZA 2MMYA 5D78A 1SBRA 2AQ4A 1EETA 4OV6A 1UWBB 1CPZA 2GVDA 3IGVA 1YDLA 1RWMB 4N56A 2YQ0A 3GR0A 1CLFA 1PKUA 3EGWB 3M2UA 2D3O1 1IR1A 2YTCA 1GFWB 4PAAA 4NLWA 5ETSA 2XC9A 3IXQA 4M5KA 1OSDA 2YKPA 4DUYF 3MM5B 1SC3B 5MAOA 1JXVA 2RMLA 3GFXA 4RUAA 4OYZA 2WSFC 3B54A 2QL7B 5KG6A 3GP9A 2XG8A 3LP2A 1U2RA 1X60A 4H4MB 2IC3A 4J9PA 3M7VA 4Q45A 4DN9A 1UJ5A 1NK4A 3TARA 3JAMY 4RW4B 3CUNA 3EGNA 4AFFA 4FYVB 1H7WA 3QIPB 4LBHA 4O3NA 3VGVA 1ZPWX 2MYFA 4DV0J 4ECQA 3DRRA 2ZHAA 1TL3B 5C42A 3JQJA 5HLFA 1VK3A 4URGA 1PBUA 2QN6B 5EDWA 2IIHA 2KXHA 4CH0S 3DGVA 3QT5A 3GSIA 2ZWPA 3M8QB 3R2CJ 4N47A 4DL5A 3LP0A 2ZUAA 4CLLA 4CTAA 2RU3A 5E3AA 1YBAA 3KUHA 3QZ7A 4DCJB 3D66A 4NI2B 3GILA 3FEXB 4PWDB 3C6TB 4MIWA 1UPPA 2VFRA 3QATA 3M1VB 3WX4A 3W5YA 2GGPA 4HH0A 4D3GA 4FVCA 1RDRA 3TZZA 1XERA 1U2CA 4C48A 1F1BB 5A8KA 3JTOA 5CYQB 1FF2A 1HQEB 2VA2A 2AP6A 2DNKA 3IR7B 5C2GA 1YJNS 3DU5A 7FDRA 4F4XA 3TJAA 3NNHA 3NOCA 1MNEA 1U0HB 2H5IB 2VFSA 1HNXF 5A8RA 2C2OB 5HI7A 1RTHA 1HMVA 1T95A 2KVIA 5D4LA 3GJRB 2F5GA 2R7TA 2JH3A 2HMIA 4HT7A 3QT8A 2P2CB 3CD0A 1NKEA 2HBYB 2V8DA 4DX5A 3AOBA 2HFUA 2B0GA 3C8YA 4BBYA 2ZBIA 3T19A 1UMJA 2F8MA 3VZIA 4RBUA 3H4BA 4NA1A 4EFAC 4K59A 1UFLA 3IRXB 3C6UB 1RHQB 3MPYA 5F8LA 4ZJLA 2R2RA 2CPDA 2HRUA 4N8NA 3CXCR 4ERDA 2YWGA 1QSSA 4IYQA 3HSJA 5KG4A 4KY3A 4M5DA 3FSYA 2XSJB 4ED5A 2ZOFA 1G1XA 2M52A 3IGNA 2GC8A 2MKCA 4RNNA 1AZSB 2KYZA 1WDDA 5AXNA 2BRKA 4ER8A 1FESA 1RTJB 2QSWA 1N34F 3EGVA 2EWHA 3M05A 2DK2A 2DIUA 3UR3C 2AEJA 4BC7A 4KKOA 1HNIB 5HQLA 4JI5J 1HNZJ 1N56A 2ALZA 1RCXB 2GIRA 4WKRA 3W1YC 4J9UE 1F9EB 1J5OA 1RB0A 2DIVA 2QA4S 5FDLB 3CCRS 1IR0A 5HATA 4K4UA 4RBTA 4C2MA 4OFZA 3QWPA 4L74A 1S1WB 1VQYA 1MMLA 2L9NA 1ZAXA 2PI4A 1VC5A 2PDAA 2GVZB 1FRJA 1P27B 3MAAB 2AMCB 3B8HA 3DLKB 1S1VA 3RAXA 1Q7LB 3VR1A 3Q8VA 1O6XA 3T5KA 3V6KA 5DGAA 3CJSA 4IFVB 1TMJA 1YK9A 1SJFA 1Q16B 1RISA 4CLZA 2MY8A 4F2RA 5J2QB 2A6OA 1NK8A 2K2PA 2N7YA 4RKUC 3I31A 4OYOA 1RAEB 1F5BA 3JAMU 1GT8A 5GAGI 4DUZJ 3DRSA 1EAYC 4F25A 5AE2A 4ATNA 3CDWA 1IJFB 1QAIA 2B6AB 4I6AA 1T94A 3UVJA 5FJ4A 2VQEF 1S6PB 3OW2R 1LFWA 2LDYA 2LU2A 3QLHB 4QIWD 4J9RA 5CCMA 4ZIWA 1FFSB 1U09A 1XR7A 1PC4A 2DRDA 1U7LA 3BSNA 4Y28C 1FJGJ 3CC7S 1SV5B 1TQLA 3EUNA 5HL7Q 4EUVA 3JSMA 2DCUB 2HZAA 1FXRA 2R7XA 3DLEB 1T02A 3EXCX 3G8SA 2XTJP 2W2OP 3RBDA 3J7YU 4JV1A 1JB0C 1X4AA 3GE9A 2DHGA 1PIEA 2CPEA 2G2ZA 3EGZA 4ZCLA 2JZ5A 2IPOB 2W4DA 4QOTA 4ID5A 2V69A 2VPWB 4ZOSA 2MKJA 3SYZA 1OQ3A 4ED6A 3T1YF 2H3EB 2BM0A 1F5AA 3UFCX 1JJ2R 3UDCA 4LRBA 2GMJA 4RW8A 3PX0A 2F8HA 2E29A 4F3QA 4O4RA 2N7CA 3UN2A 5DM7Q 3DCAA 5HAOA 2AYEA 1P9YA 1BC6A 4M1KA 5KG5A 2SXLA 3Q0AA 3UDEA 2IJNA 1C0TB 4DL4A 2K7JA 1B0TA 4TU9A 3KKFA 2CPFA 5D8HB 2ZFHA 4ES2A 1GMUA 1LXJA 3FNNA 4CO4A 1S0VA 3KOAA 3NAHA 2W9BB 2Q6BA 2BVZA 2CG4A 1GMWA 2XMVA 3RB4A 3KJQB 2ASYA 4QWCA 2YXLA 2EFPA 3CVKA 1S4FA 4EBEA 2BJ9A 1FX2A 3EYZA 1Y10A 4LJMA 5J2MB 1GXTA 1HD0A 2FC9A 1RTZA 4ED4A 3ZFVA 1VQ8S 4QYZK 3M30A 2DY9A 1C4CA 3ZZYA 3DLGB 3CCMS 3MM8A 3SCKE 3KMQA 2IVFB 4JV5J 3I0SA 4DQPA 2K8GA 4QU6A 3C15A 3I9V9 5H9FJ 4ZVHA 1FWPA 1QVGR 4DR7J 2D7SA 4DV0F 2A3JA 3VALA 2JL9A 1UEVA 3FBCA 1GMWD 1RU2A 2HWIA 3UCGA 1HD1A 2D9PA 1TUWA 4NWBA 1RQ0A 3C14B 1MN9A 3AHPA 4TQRA 2CNOB 2F1FA 1PJ5A 1LFPA 1JLBB 1RT4B 3KYLA 4OHWA 2DNLA 4YR0A 2W4PA 4ZPAA 1TKZA 2VJVA 1AW0A 1FDBA 4DSIA 1SQEA 1EQ0A 4U8YA 2MSSA 3FC9A 3PR5B 1Q53A 5KFPA 1TK8A 1TL7A 2DJWA 3ENVA 2IRXA 1UA0A 2Y0SD 3QGHA 1YSJA 1JLGB 2JSXA 1GH8A 1FCAA 3BO2A 3G86A 2DGOA 1EP4B 2IRYA 1YGYA 2LQ5A 1CJKA 1CULB 1U1MA 1NJZA 3CNQP 4X64F 2DXEA 1CC7A 4K50A 4P2XA 1OYEA 3M8PA 4AL7A 4GC7A 1U1NA 1RABB 5L1JA 2QLXA 1R0CB 4DL3A 4MH8A 4DU7A 1PC5A 2XHWA 1Z4UA 4DL7A 1M1HA 2I2YA 3UR0A 1Y00A 1NZ8A 1CSJA 1SKRA 2PC6A 4NXMJ 4OYAA 2IJRA 2NZCA 2JFKA 4DSFA 4RW9B 5FLXY 3NMAA 2EW9A 1ZZFA 4MIAA 3WBZA 1LV5A 2VOPA 2UP1A 2B43A 2JFDA 2ZH7A 1RWNB 2DEIA 4FPIA 2BANB 3B78A 2EEYA 4X4UA 2ASDA 4DR5J 4UZBA 3K8WA 3MM7B 1MG7A 2LEAA 4ED7A 3TOQA 3SI8A 1R8PA 4CCHA 2HAFA 1NDPA 1WHYA 3FFIA 1GX6A 2DR8A 2ZBQA 1FO1A 4DSJA 2HQFA 3G87A 1HQUB 1VHIA 2MPUA 3QIPA 1ACMB 1IM4A 1WHVA 3NCQA 4YY3J 1L5UA 4JI5F 2DNPA 2GMLA 4B9NA 1RT1A 4TU8A 1RBAA 3Q8UA 4DX7A 3MEGA 3KG0A 2ZH6A 2BA9A 5KFHA 2P6TA 5I42A 3KLIA 3P45B 3CJ5A 3VQSA 2EK1A 3CT9A 2O66A 1B64A 2BACA 4PWDA 3CGIA 2IA0A 1S10A 4ZS6A 2HQCA 3CO9A 1H7XA 1KLNA 2E5LJ 2WZ1A 2BJ7A 1ZM3A 3MUMP 5GMDA 4OJGA 3KLHA 1WEZA 1HBUB 4B9MA 2UXCJ 2H65B 2R8GA 4ZVEA 3GQCA 1KQKA 1S0OA 3GSDA 2RS2A 1DHMA 2NYIA 2HGLA 2LU1A 3BM7A 5L9XA 1HARA 3Q8QB 3ET6B 1R0AA 3BBBA 4DR3J 1S7IA 2MB0B 2K06A 2UUCJ 3M9OB 2R9LA 3MEKA 3NY0A 4MYTA 3RRGA 3OJUA 3OHAA 1AFIA 3J80Y 3EZUA 1NPPA 3O44A 1WHXA 4NEZA 4CT9A 3HT3A 2D74B 2HRTA 3UNGC 1FJGF 1S9EB 3C3LA 3A3OB 4X66J 3PFOA 2ZH8A 1VRTA 5ETQA 3MOZA 5LSRA 2CJAA 1FE4A 3KK2A 4ZP8A 2FHJA 1WOSA 4MKVA 5A6PA 3HKZD 5F8HA 2YWHA 1MW7A 2P9GA 4HTJA 4OJ3A 4WIIA 3D4JA 2QA4G 4NCGA 3DXBA 2V4QA 1ZETA 1URNA 1Q4RA 2OGUA 4Z37A 4P2FA 2CVIA 4QJVA 5A6WA 3VAHA 3M8YA 2XMJA 2FJXA 1U6FA 5IFMA 4M5IA 4C6AA 1S59A 3IWNC 1HPZA 1RWUA 4V1Ak 2B56A 2ACMA 1VC6A 3CCZA 4KC5A 1HNVB 3ICLA 5DGBA 4C8NA 3WZ0A 1LWCA 1ZA1B 4K5RA 4N8OA 4XDCA 5HQ8A 2CJQA 4DQSA 4DR6F 1YJUA 4ELVA 2V2KA 4U67Q 4JB8B 1XNQJ 4FYXB 1R6YA 2DEJA 2FHJD 2HHWA 2AJ1A 5FLXU 4WIQA 1NJXA 3QFHA 1H0HB 4EZ9A 3I4PA 1U0SA 3OSPA 4FYDA 4LF4J 1W2BR 4J91A 2WVEA 3M8WA 1WG5A 5D6GA 3KK3A 5AE3A 3R27A 2MQLA 2QL5B 3IRWP 3HO1A 3KLGB 4C0HA 3MECB 2IBOA 4I2PB 2HRYA 3T1HJ 1OO0B 2BABA 2L08A 5IZHA 1SKUB 2VPZB 3BGRB 2DNGA 3DLBA 4CM0A 1TR0A 2G4BA 2MKSA 2R7VA 4X65F 3PFEA 1LW2A 2DBBA 2VB6A 3W66A 3LWMA 1ITPA 5B0GA 2V6AA 5EHHA 4NXNJ 3KWMA 2B6AA 3LUYA 3D1HA 2CDRB 1S6PA 1JQGA 3TAPA 4JV5F 2GCFA 2KYXA 2DHHA 4RNMA 1DQ8A 1PBAA 1FK9A 3UN3A 1U1KA 2V4JA 3DOMA 3PZPA 1Q86T 3I0RA 1F2GA 3FSIA 3DDIA 2RDJA 3I87A 1YJ7A 2E1PA 4CO2A 3BGUA 5HP1A 5T7LA 2IAJB 3TZXA 4M5MA 2JC1A 2OPPB 5DJBA 2HW3A 5I4MA 3AH6A 4I2QB 2BKOA 4EWTA 1K1SA 1XMOJ 5D77A 5CQGA 2HG4A 1OPIA 2CQDA 3TVZA 3CD6S 4YR3A 4K7QA 3GJSB 1RSCA 4LF1A 5ETRA 3PNIA 1R8HA 2V68A 1S1UB 4ZVSB 5KFFA 3N6MA 2RQ4A 1CJVB 2K3KA 4HLBA 3HHDA 2QMXA 5JUMA 1RKJA 4IOBA 2QZ8A 1JLFB 4X84A 5D0GA 3TJ8A 2XO7A 2FYXA 4QCLA 4C4WA 1PCAA 3GU0A 4L3KA 4LIRA 3BDPA 5A0YB 1NKCA 4CRJA 1V3RA 5D0RA 2R7SA 2EC2A 4QPXA 4IFYA 3HXMA 4PZVA 5KFYA 5DDQC 5GAEU 4USJC 3GV5B 2F4VJ 2CPZA 3BSCA 1DTTA 3E51A 4PYAA 2BUNA 1QD1A 1WD6A 2EFNA 2M4MA 2VDHA 4DV7F 4ITSA 4Z7CA 3GYXB 1H6KX 2QIFA 1HR0F 1WUUA 4ILRA 2H48B 1FHTA 4OHYA 2NSBA 4DR5F 2KH9A 4MMOA 5IM0B 5LMUJ 4J9SA 4OLPA 2ADCA 4CI0B 4DLGA 1REVB 2W2MP 3DLGA 2PIIA 4Q43A 4LSLA 1JLEB 5IC4B 2RQKA 2FPHX 5K8OA 3KK1B 4A47A 5I3UA 1IKVA 3ZNJ1 3BF4A 1F2HA 1RHJB 5CYMB 3M6WA 4H4KC 4KV8B 1ULRA 2IFXA 2E1MC 3FEYB 4V19J 4YY3F 4C97A 3IR6B 5EWGA 3RBZA 3KG4A 4DPYA 1FT8A 2WVCA 1H38A 2VKZG 1RT2B 2JDJA 3KHGA 4WZQA 2W9CB 2NLWA 2DNMA 4J9KA 2ZHOA 2J0XA 5A8WB 1RI7A 4BHQA 4WE1B 2WAQD 1MWYA 1NSQA 4NLGA 4H4OA 4FF1A 4LFBF 2HSEB 1ICEB 3BJYA 4NLYA 1DQ9A 2UXCF 1UVNA 3FRYA 2YQ1A 3VAMA 5L1KA 1VQKS 3N28A 1WC0A 5THWA 2XS7A 4OZ1A 3W5XA 1MWZA 3SFUA 3WHIA 3IBCB 3HFZB 4DR3F 1NK7A 1T9YA 3CW2C 1Y5IB 2UUCF 2DR9A 1HBNB 1RBLA 3O2IA 4RO0A 1J5EJ 1JLAB 4DPOA 1RXOB 2J0WA 1SIZA 2QRRA 2EBGA 3AQPA 3NGUA 2XY6A 1T03A 1SJ3P 3OTOJ 3AA9A 4O3OA 1YZ7A 3CF5Q 2W8LA 4ED2A 3CCJS 2J5AA 2OAUA 2XLKA 2HNYA 2J0QD 1FRMA 2W2QP 1WOOA 2XZDB 1S1XA 2BM1A 3SQOP 5CZXA 2QLBB 4PXCA 1YQHA 3ZO7A 3JTPA 4DOZA 3M32B 3I5AA 1C1CB 4P74A 2VG6B 1S7HA 4KH1B 4OHZA 3UD3P 2ZDPA 4PYDA 2R8IA 3T5LA 4DPXA 2CQ1A 2OELA 1ZAWA 3NL0A 3R5AA 2AZ1A 4RNFA 3FMBA 1X8DA 2AJQA 1MROA 2CZ4A 2GFFA 4USKA 2HHXA 2FLLA 3R7BB 1D9AA 4DSEA 1SH2A 2M3DA 1FJ7A 4KH0B 4FF4A 1LK7A 3EPIA 2WONB 3WDOA 4UQTA 4A8WA 1XNQF 3RB3A 2J6TA 2HBZB 1H2TZ 1HL6A 4F7VA 1EZZB 2FJBB 4WPAA 3CC4S 2L41A 3QRPA 3HHLA 3G82A 3DDKA 1ZZNA 2KFZA 2F9DA 2D3OR 5HVFA 3OTBA 4MK7A 4PQAA 1NJIT 4OZ5A 2RSQA 4KGZB 2PMZD 3W7BA 4ECXA 1R8BA 1Y3KA 3L3CA 1PG5B 3W9JA 5J1EB 4O44A 3ZZUA 3M9NB 2RRNA 5JVGQ 5ADZA 3CJ8A 2B4OA 1LWFA 2YKNB 5DRKA 4ZVGA 2G0JA 2XYPB 3HVTA 5IT0A 1QE1A 4NXNF 1CJTB 2V2QA 4KBIA 4OJHA 1U8SA 3PYGA 3OR2A 3QGIA 2MLXA 4CLFA 2VD3A 4YB5A 3LAMA 3EM1A 5KFMA 2W7PA 2UVUA 4ID8A 4R8UA 2FJVA 1UWAA 1O8BA 2J76E 4TXSA 4NRUA 1IBLJ 2Z30B 3HHLD 4ALZA 3CC2S 4XPEA 1IJEB 2IVMA 2V34A 4KPYA 2HNZA 4TYBA 4R5PB 3MHYA 4ES1A 3UCZP 3KLFA 4NOHA 3CEDA 4OI3A 3OL7A 2YPZA 1XMOF 3KLEB 1FJCA 5AXKA 1TV6B 1VJQA 1GMVA 1JJ4A 4IG0A 2CJYB 2CJBA 3ISZA 2XYHB 1Q7YT 2VFVA 4DBQA 5D4PA 1HWIA 2MQ8A 1N0VC 3DRPB 5J2NB 2HS3A 4OI4A 4IR9A 1HA1A 3D0IE 2FHOB 1MU2B 2MGZA 2HZCA 4N41A 2HLUA 1T05B 2Y1IA 3Q8SB 1FFWB 5K8PA 2K3IA 1VQNS 2LXUA 2H5EA 2Z56B 2OD6A 3RAQA 2L9WA 4EO8A 1RWOB 4A8FA 2NZ4A 2KB2A 4J7CA 2UUAF 5L8RC 2A1BA 1Q1KA 2GHVC 1YITS 2FHMA 3PO4A 3KUGA 2PSZA 4GKJJ 5DZ6A 4HACA 5KTQA 4WFZA 2X1GA 3GMGA 3J81Y 3DKDA 2XQCA 1CEZA 2XMTA 1HNWF 1K0VA 2WSCC 4DLEA 2KFYA 2UUWA 1KOOA 4W4MA 5J2PA 4RW7B 4YHHF 3M8SA 3C16A 1S6QA 3ZC4A 2L48A 3BGLA 4JI0J 3QBCA 3LGHA 4F3OA 4ZVUB 1UAWA 4S0MA 3V4IB 2OHDA 3GIKA 4PG6A 3HHEA 4QWEA 1UW4A 3RB6A 2ZE2A 4OI6A 3LGNA 2AF6A 1RACB 1TKTA 2HHUA 1V5VA 3TX0A 1SC1B 4HHHA 3UI3A 3SMZA 1VQ4S 1N33J 2DHAA 1PYTA 3H59A 4Q8FA 4DEZA 3QO9A 3OTEA 2VHGA 2WHOA 1SKWA 3OJSA 5E3CA 2OPSA 4KHPJ 4JYAF 2N82B 4JP8A 2X3DA 2WVDA 4CYUA 2V0NA 1QSLA 2RE1A 1KSPA 3CULA 3HM9A 5D0EA 4XO0A 2IBKA 4ZP6A 4UUXA 4DZ6A 4K4WA 4L72B 2ZZTA 4AYBD 2LDIA 3GTYX 2HYIB 2BW2A 5BJRA 2BMBA 4GVLA 4LFCJ 5A76A 2HFVA 2OEKA 2MJUA 2UUTA 5EUHA 2CNKB 1UPMB 5GMEA 3VZHA 2YH0A 3I55S 1V3SA 3A8EA 3PDNA 4ECWA 2GIFA 4B3TJ 5I3QA 3VGUA 1VISA 4JI7F 3CDEA 2VG7A 2AV5A 1Y5LB 1Q8IA 4X4PA 2B8QA 2UV8A 2CFXA 2J7UA 1RT5B 2AJ4A 1C4AA 4Y2KA 5GAHI 2FJAB 1B7YB 2XI2A 2LKZA 1KBRA 2XHCA 1WG4A 1CJUA 4RW6B 1AUDA 1A7GE 1J5EF 3NGTA 3MWBA 2R7QA 3V6DA 4JI2F 1VLYA 4OLOA 2JVRA 1BLUA 3VAGA 4YMEA 2CKWA 3H5UA 4AXIA 1YG0A 1TFWA 1RADB 4E2FB 3D0GE 1DARA 2ILYA 4E0DA 1I1GA 2NXNA 3DC2A 4FNHA 1RYRA 5KFJA 2E5HA 1K1QA 2COLA 3G6YA 2NS1B 4Y3CA 3GCWP 5GAEI 2EK6A 2F8EX 2DGXA 1ZYQA 4OZLA 3DGPA 5D3GA 4O4GA 3DM2B 4LF2A 3T3FA 3IM8A 1SUQB 3KFWX 1UVJA 1JLEA 3ILJA 2YNGA 4ZVTB 3AJ2A 5F8GA 2AEMA 4JUZA 4DV6J 1QM9A 4C11A 4JI4F 4NL5A 3W2VB 2GV1A 3JXOA 2JEJA 4DL0C 3M2VB 3TWZA 1WJ9A 4DX6A 1H73A 3OSNA 2X1FA 4IG3B 4PEOA 2CVEA 2J9DA 1RGVA 3NEKA 2LA4A 3IG1B 4MFBA 1NO8A 2JEIA 4N5SA 5D4NA 1RT3A 4UY85 1M5OC 2E66A 4JI1J 2P8IA 2ZWOA 1JLQB 1F9HA 3R5BA 4KYZA 4X4RA 1NK5A 4ZVRB 1R43A 5KFGA 4QWBA 4BLGA 2Y1JA 2NREA 2D69A 3H5YA 1VQ6S 2MHEA 8RUCA 4UW2A 3W2WB 1HFEL 2K1RA 1YWXA 3AY0A 5C24A 3UO0A 2QJ3A 4FN5A 2ZNZA 1FKOB 4CLTA 1KTVA 3PYDA 1WC5A 3NS7B 3UD5A 1N6QB 2NR0A 4LT6A 2M8HA 3B4MA 4Q2LA 5IXUA 2HQGA 2V50A 1U24A 4IQMA 4EEYA 4NCAA 2FVRA 3ILLA 1HHTP 1M5PC 1NDLA 4DQIA 4PPDA 3DOLB 2ZZMA 2V67A 1O51A 1XEZA 5F8IA 3NGRA 2G2YA 1VLOA 3R9LA 2VA3A 1RUSA 2IYIA 3TAMB 4EBDA 4RU9A 1TKXB 2DXDA 1WTFA 3O3LA 1JWWA 2FJEB 3KXDA 3MCNA 3AOCA 2NPIA 3GWCA 1NSKL 4DUYJ 1RU1A 3BS9A 4DG1A 1FKPB 3SIPB 3U7JA 4LRAA 2XM3A 1TK0A 2KG1A 3HSDA 2ASJA 3HI9A 5IQ6A 3NMRA 3AQOA 5DETA 3M2RB 4QBUA 4X4OA 5DG8A 4DCPB 1ZTTA 4LF8F 4FP9A 4C8MA 5ITHA 3RBXA 2FY1A 3DNCA 3K5NA 3SV3A 1HYSA 1D09B 2GHPA 3IWLA 4C8LA 4B3OA 1PILA 2Q79A 1CG2A 3IM9A 1TAUA 3WC0A 2Y8YA 2MLZA 1BQMA 2V9KA 1T7PA 3CCSS 4GKJF 1XBWA 4KHMA 4ELUA 4FBTA 1SJRA 4YDXA 2OTLS 5GAGU 1HBOB 3BZQA 1NJWA 4MTPA 1KRPA 4PG7A 1CVJA 4ZKAA 1B4SA 1U2FA 1WEXA 3ZZTA 4B08A 4B9UA 4JI0F 2I6WA 2GZOA 5LSLA 1NAQA 1FFGB 5J1EA 3QGGA 5ETTA 3AODA 1FJEB 2DO0A 4Y0FA 2R7RA 2YKNA 3SQGA 1DJ0A 3MMAB 3EICA 2DTJA 4UOCA 3D0HE 4N76A 2W24A 4UOFA 2OTJS 3R1HA 1WC6A 1RAJA 3KHRA 4DFKA 1FKAF 2WOMB 1TVRA 3R7SB 2OSRA 3E01A 5K14B 2XZWA 5JMNA 4NLUA 4ETXA 1F0XA 3U02A 1FNOA 3IC1A 4R0EA 3OD2A 2B4PA 4JI8J 2ZH1A 3TVYA 4KT0C 3CJKA 2OH2A 1NCLA 2G1HA 4WK1A 2XSFA 2AIRB 4N7TA 2XCPA 3CMAS 4KHPF 3MGJA 1VMBA 3ZXWA 3GFYA 3ULHA 7FD1A 4F4AA 3CJ4A 2V63A 3MR6A 2FUG9 2P9EA 3W64A 3D7SB 3S8SA 2GO9A 4ECUA 2FLNA 4UOGA 3F44A 2P9CA 2HPUA 3Q2TC 1LW0B 1S76D 2GQ2A 4G65A 1BQNA 4IRKA 5IT4A 1SL0A 2FVCA 1QAXA 1NDCA 1K44A 3PXGa 1IUJA 3A3NB 2CQPA 2EC0A 2OPRB 2Z58B 2FGOA 1PSDA 1KEKA 2XO6A 2J7WA 4URSA 1D0EA 3N01A 4PRFA 3W9HA 2XWYA 4KSEB 3BR9A 4DL6A 4O3SA 3V2UC 2RNEA 4LR7A 3EE3A 5HQMA 2FC8A 4G1QB 3VAIA 3KJNB 4O0IA 3D6TB 1C2PA 4AE5A 2VZ9A 3MZIA 3NCPA 3IR5B 2HZVA 3RTVA 3JYTA 2VPXB 1YJWS 2VOOA 1XJWB 4ICLA 2YNHA 5B08A 4IUFA 1VRUB 1DBDA 5KFQA 1X5PA 4CIOA 1YJRA 2VG5B 2P5VA 2AD9A 1U1PA 1Y0HA 2WVBA 2Z4PA 4EBCA 1X9MA 1UVLA 1X0PA 2B3TB 3BSAA 3C2PA 3MMCB 2MKKA 4WP3A 3RGIA 4ZVFA 3F41A 3MCOA 2DH8A 1HBMA 5KFOA 2MQQA 2DCLA 1NHUA 4OX9J 1S9GA 5M2UA 1VQOS 3JSYA 2FQQB 3OT9A 2LP4A 1I51B 1RTIB 1B0VA 5DLGA 5KAKA 2MEWA 1NMEB 2YVSA 3PVXA 4NYZA 4ED8A 1TK5A 4Z7YA 1L3UA 4DF8A 1LWEA 4ANCA 3G6XA 2QFIA 3CMQA 4QPTA 3H7HB 1K47A 4KGVB 1W7WA 2LXIA 1Q82T 2HS4A 4DV6F 3V5RA 1N5YB 2V8HA 3LTOA 3MEEB 3QJJA 2WSEC 2VC0A 2ZBRA 3N5BA 4W98A 3LQVA 2VKRA 2ZOMA 5JJBA 2B9YA 4DR2F 4MKBA 3IA0A 3HZGA 3OPKA 4M5NA 1CS4A 5AXMA 3GIIA 5HROA 1OY6A 2ZOGA 1M1KT 1YI2S 5GADI 3MI7X 2BJEA 4JI1F 1OSCA 3CCWA 3W63A 4G1IA 1JKHA 4LF7J 1BUXA 1V9OA 4ZIVA 1RWVB 3PW4A 3DYAB 3MURP 5H1SV 3GIMA 3SSRA 2C2RA 1ZM9A 2EKNA 3DMJA 2PT0A 3EWGA 2E7WA 2GMHA 2OPQB 5IT9Y 2Q3PA 3GFZA 4I6YA 3PKMA 3MEDB 5LM7E 1DRZA 4I7FB 3DOKA 3F56A 1RLCL 3Q86A 2R8HA 1RT7B 2B9XA 3DI6B 1IKWA 2MZTA 3FCHA 3R5GA 1DTQB 3PHTA 2YQ3A 2DD8S 1N5QA 5KFEA 1IKYB 1WKKA 5G0RB 1SPBP 3MCMA 2WBMA 3T5JA 2HHPA 1JMTA 5BYRA 3PW7A 2GA7A 1EJ7L 2V8GA 3OL8A 1WELA 1RTDA 2AJ0A 1C1BA 2YNFB 4HH1A 1SL1A 1SIWB 3L4BC 1IBCB 2Z8QA 3EVOA 2EVZA 4CNYA 1C0UA 1OJ4A 1WSVA 3MF5A 3DRXA 5AJ3J 1KLMA 1T9WA 4PR6A 4EGLA 1T9UA 5KT5A 2I5JA 3K2YA 3K0JA 2JJ4D 4LBPA 3QZ8A 3IAM9 1NLKL 3AJ1A 4KTQA 2EKYA 4LSNB 3ZTSA 4C8YA 1RA6A 3PG9A 4GVBA 2AWZA 4NMLA 1IN0A 2ABYA 2R3VA 1NH8A 4Q5VA 1P9QC 4UQGA 1VQ9S 1E6VB 1QUPA 3QYYA 3TP2A 1HHQA 4B9VA 1W2IA 1PYSB 2R8JA 4HTIA 4ES3A 4B9SA 3DDNA 1VCTA 4Q8EA 4P2SA 2RUGA 4USVA 1WDTA 2ADBA 2CJKA 4LRDA 2BRLA 1KWMA 2J8AA 2W9AA 1ZM2A 4PG8A 3G6ES 2R7OA 5FIIA 3UDLA 3MMBA 4ZPVR 2PD1A 2YH1A 4KE5A 1R31A 3R3TA 2HGMA 4PQUA 1U45A 3SCIE 3G96A 4TU7A 2CPJA 4WF9Q 2HNDA 2XMAA 4KR0B 1N6QA 2PFFB 5DO2A 1RYSA 1KQSR 3BYRA 3BH7B 1QTNB 3POTB 1M90T 2B5JA 2WB1D 4K4SA 4X64J 2HVIA 3WIUA 1G7CB 4C8ZA 3CJ3A 1NDKA 1WTBA 3MM9A 4USMA 4EMDA 1AUSL 4JI8F 2HWHA 4X62J 4QQBA 3A13A 1KHWA 4ZPBA 2KTQA 4B9LA 4ZITA 1TP7A 2HHTA 4PWWA 2HGNA 3LWLA 1R89A 1AFJA 5M2PA 1EB0A 5KFSA 5JVHQ 4FF2A 2G0CA 2RF2B 3RU0A 2C22A 3OLBA 4Y2IA 2DR5A 1J27A 5LJ3Y 4EYIB 4RUCA 5IQQA 2VBXA 2QC3A 3IS9B 1NUEA 1S72S 4LREA 4K2XA 5KOWA 2MQNA 4B3RF 3HHKA 1DLOB 2IYGA 2Y8WA 2PFDA 3TQEA 2F3JA 3ITHB 1RAIB 5IT9U 1NNDA 1S1TA 2BE2A 4PG4A 1NK0A 5D15A 2JNJA 3EDRB 4OZJA 1N36J 3E3XA 4P2MA 5F9NA 4LF5J 3NWGA 1P8GA 2ZC4A 1TKDA 1XR5A 5HJYA 3JSBA 5DG7A 3O5TB 3AT1B 3MDFA 1S49A 5T14A 3BKTA 1NPRA 4AT1B 2Z2YB 3VGTA 3CJRA 1VR6A 1KN6A 3DU6A 1IKXB 2B7CB 3AXMA 3TANA 4C3KA 1Z2ZA 4OX9F 2HHSA 1EETB 2GVDB 3L7UA 4B02A 3NBPA 1CQMA 2YKMA 4XK8C 1J2VA 5EX3A 3KDOA 2RKIA 3M2UB 2AGOA 2NYHA 2BOPA 2HBRB 1OPZA 3CIZA 5C25A 2F7VA 2B4UA 4DHVA 3N79A 4CLUA 2BE7D 1T8EA 3HULA 3PW0A 5H9EJ 4G1PA 1JXEA 1H2VZ 4U96A 2IC3B 2FLPA 1K9MT 3NS5A 4P7TA 2XLIA 1FEEA 3FEZA 1WF1A 2QSFA 4X4TA 3RZAA 3U1MA 3OUYA 2CDQA 9RUBA 5L39A 1OY8A 4P52A 2W8KA 3DRRB 3MPWA 2V2ZA 5C42B 5HLFB 1IM6A 5LMNF 3UCUP 4I69A 4CTAB 3NNCA 5EWFA 3M9MB 4IH6A 1PO6A 4LVNP 2H4YB 5HJXA 3JS9A 4IOAQ 4NA2A 1YJ9S 1IBKJ 1X5TA 5B0CA 2QT7A 3CWJA 4NLSA 5KFNA 1N0UA 6AT1B 1VIXA 1VBXA 4LF7F 3BH6B 2GGPB 2WW8A 3OR1A 4PXDA 1E6YA 3IAS9 2DR6A 2RHSB 3GJTB 4DSLA 1GAOA 5A8KB 1TL1A 1H98A 2R7UA 1HHSA 4TYAA 3K57A 3HX9A 3U1NA 4ED1A 4DR6J 1APSA 3BQ0A 4ZHRA 4U8VA 2BQRA 2LEBA 3FSXA 2UU9F 5CXTA 5LSOA 4WWSA 5A8RB 1RTHB 1HMVB 3F0NA 1VBZA 3HFVA 2RJZA 3D1OA 2C1EB 2RIJA 3QNWB 2HMIB 2Y1RI 4U7CA 2C2ZB 2FZGB 3HCXA 4KO0A 4A8XA 4C3MA 3DXSX 3KJVA 2FVPA 3LP1A 2IRUA 3AOAA 3D9BA 4WFNQ 2DGVA 2DPJA 1LKZA 2GW8A 5HMYA 3OVAA 1BXNA 3EVMA 1IVZA 3I32A 5ETNA 5SUHA 4X65J 1M5KC 1X4BA 5DLFA 4K4ZA 3OFGA 3SCLE 1ZS6A 2V94A 2X1BA 4A8QA 2IM0A 5AJ3F 1EKSA 1Q8BA 3KNAA 4DWIA 3SDEA 2CRLA 4M5DB 2NXUA 3FZBA 4KFBA 2CQHA 1YX2A 2B9EA 4OV1A 5K8MA 3LF0A 3LOUA 2A18A 3MEEA 2JEFA 3V81A 1H72C 2HQDA 2KT5A 4J9MA 1TUVA 3OL9A 4KKOB 3ADAC 4WFAQ 2CZVC 1YRTA 1XIQA 3MAHA 2VPYB 4OYXA 1W25A 2HKEA 2ZH2A 4UZCA 5KOXA 1HWLA 3SCJE 1J5OB 4CLWA 3LANA 2JC0A 4I68A 1JLCA 2ZD1A 5T41A 1AYEA 3PR4A 5KFCA 1Y9OA 3OLAA 2LQ8A 2Z2LA 1RAFB 5H9FK 3TRGA 3TQ1A 4PG5A 1S1VB 2HHHJ 5J1NA 2NQPA 3HLUA 3UW1A 2KFNA 3HHNB 4L3NA 3DYAA 6FDRA 5JXSA 2XB2D 2HQIA 3PX4A 3HK2A 2HIQA 3CCUS 3A12A 4J9VA 4YS2A 1TZ0A 2QEXS 3QQCD 4OL8A 3PTWA 2HK2A 5B0BA 1HW8A 1X4FA 3BN4A 5KFRA 3BV8A 2YWEA 2M8DB 1TL4A 3TAQA 4K4YA 3MPUB 3DRSB 3GLJA 2YX1A 1FERA 3BKUA 3AB2B 2FVQA 4HDHA 5MLCV 5G4DA 3UVJB 5GMKa 2IM2A 2AT1B 3J7Z5 2E1AA 4X62F 2EG2A 2YKOA 2KXNB 1RZMA 1NPKA 3ZTPA 2XMKA 4QWDA 1IWGA 1RWWB 3O8WA 3Q8PB 2WBRA 1UWBA 3IBWA 5E41A 4DV7J 3X3UA 4USHA 5KG2A 4Y2MA 1HR0J 3JSMB 2MQMA 1R3NA 2N3OA 3FKBA 1B0PA 3MM5A 4LFAJ 2BX6A 1YTYA 4H4MA 4ECSA 1Y4ZB 1FD2A 5E3RA 3US5A 2AKWB 4ID5B 4RW4A 1RHKB 5KFBA 2EI5A 1T9VA 3HD2A 5SZTA 1U1OA 3VVUA 3FCWA 1KFSA 4CP5A 3EZ5A 2HURA 3OXFA 4RW8B 3C19A 1B7FA 1QUVA 4Y34A 4JV0A 2BE9B 2HFOA 3GV8B 1TL3A 1N36F 1EARA 4LF5F 2KL8A 2MZJA 1XWLA 3JQMA 1REGX 1UCNA 5KFXA 5F3ZA 3CIMA 2KXFA 3M8QA 2AJFE 3B6BA 4QW8A 2RDIA 1R8CA 2W25A 4AL6A 1GQEA 4X4VA 4DV2F 1YIJS 4NI2A 3FMWA 5ETKA 2UVWA 1S0NA 3C6TA 4OZNA 3M1VA 2BJ1A 3IMQJ 3BPDA 1MWQA 2MZ1A 2LQ9A 3B4DA 4LFBJ 1UKUA 2BYCA 2UZAA 2M7SA 1UJ4A 3HFKA 2D3UA 2UVRA 1CQNA 2KM8B 5CYQA 1S0MA 4DX8H 1HQEA 3EXYA 2L3MA 4UOHA 3H2VE 4FXVA 1UL3A 1U0HA 5F0UA 4U7UD 2QLJB 2UV8G 3G9CA 4DJBA 2B8PA 2EG1A 2MJNA 4ZJQA 3M30B 5CA5A 3AXKA 1SJ1A 3OFFA 1T9TA 3MPVA 2DYAA 2DGSA 1VQSA 1T0TV 1HI8A 3NP5A 2O01C 1LOUA 3I0SB 3P49B 4PPZA 1FRIA 4CLSA 2LA6A 3C15B 3P5BP 3HDSA 4KB7A 1SI9A 1Y11A 3I96A 1Q0NA 1MN7A 3BBFA 2GIQA 3VF0B 3W65A 3DRYA 3L7OA 2V2VA 4CLKA 1NM2A 3IRXA 3C6UA 1GEHA 2IM3A 5KFVA 2ZDOA 2ZC3A 1L3TA 1VQ5S 1OY9A 2POKA 2VONA 4G6VB 3TR5A 2XSJA 4F04B 3F73A 2PO4A 4RNHA 5EGYA 1IBKF 4MT1A 3DN9A 1AZSA 4CQ1A 4ZCMA 1N54B 4Q7AA 1TKZB 2WB4A 2ZITA 3NNAA 3TUJC 1RTJA 1U47A 1TL7B 1HNIA 1QY7A 3ENQA 1XN9A 1VBYA 1XMQF 3QWUA 2CJ9A 3S01A 1X31C 3GJQB 3UDVA 3CMES 1VBKA 1ZTWA 3Q24A 2QX0A 5FDLA 2ZBCA 1CJKB 4LQ9A 1U1LA 1WEYA 4NLXA 4P73A 1S1WA 3GR1A 3M8PB 2FZKB 2ZM6J 2GVZA 3MAAA 3DLKA 3EJMA 2M0GB 2JOQA 3PW5A 2V4RA 4J9NA 4IFVA 2GNKA 1O5JA 1X4HA 2VJUA 4DV3F 4DDFA 3WX8A 1Y3JA 3AAWB 1URRA 2QG9B 4D3HA 2QTWA 4C8KA 1NXIA 4UF4A 5J2QA 3TA2A 4P72A 2BW7A 4DL2A 3UE2A 2KVQE 3MFHA 1S6OA 2BXJA 2O3DA 1TAQA 5B0AA 5HANA 3V6HA 2IJFA 1R7IA 2GO8A 1U6BA 2DKOB 4XTTA 4U9RA 4LQ3A 3Q2SC 2RAQA 4NCBA 3RBEA 2HFNA 2BR0A 1HWUA 4YFUA 3QLHA 3Q89A 1PGZA 2XLJA 4ECRA 3FFIB 1KFDA 4GO5X 4DQQA 2LEPA 3FQKA 4RZRA 5CZVA 1SV5A 4U95A 4MJKA 5KFKA 2AX0A 1WF2A 1RT1B 3DLEA 2ZBPA 3LPYA 2FLOA 3Q23A 3MEGB 4NYOA 4OI0A 3V4MA 2PEBA 2G2OA 2RRBA 3CJTA 5I42B 1DURA 1EQMA 3KLIB 3T9ZA 4KQZA 2OFHX 3UQSA 4USIA 2ROEA 5B09A 1YVFA 4MAKA 2Q66A 1FRLA 5GAHU 2QGFB 2IDLA 3RR8A 1KNZA 1KVKA 2HHHF 3R5JB 4E8UA 1UP1A 1CBKA 3QT7A 2OUGA 1RT6B 2IA6A 4ZJOA 3BKFA 3KLHB 1AT1B 1FDAA 2N3LA 1XMBA 5AE1A 3RW6A 2M2BA 1FWLA 2HS0A 2UXDJ 1WC1A 3FGVA 5B0EA 4NEYA 4CLYA 1C0TA 2YBVA 2UUAJ 1NSPA 5LXYA 4KGKA 1R0AB 3H42A 5CABA 4OI2A 1KVIA 3R6GB 1UEUA 1NJYA 2DGWA 2W9BA 1VYAA 3ZTOA 4BWJA 1VK8A 3VWSA 1HNWJ 5DS7A 3T6BA 2KT3A 4BCAA 1VGYA 1Q78A 4HI1A 4CM2A 1O0PA 4DFJA 4YHHJ 4OI1A 5KFIA 4DPUA 4NE9C 3AA8A 5J2MA 2RILA 1VRTB 2RRAA 4A8YA 2AX1A 1RCOB 2M88A 3KK2B 1YHQS 4LFAF 1KS2A 1HW9A 2CQ0A 3BQ1A 4O3RA 5KG1A 4FVMA 2MZSA 2HVHA 3CD7A 4R0JA 4NCGB 3FBFA 2CNLB 3MUVP 2Q43A 2QYCA 2BKNA 2ALYB 2APOA 2DGTA 2B4VA 3HD1A 4JYAJ 2CQ4A 1NK9A 4WYLA 4XDDA 4DUTA 1HPZB 2CA9A 4I1TA 1FRKA 2E7VA 1N4LA 2W7AA 2D41A 4A8SA 4F50A 3C14A 4WKYA 3T1AA 2NUHA 5B0FA 1LWCB 1R27B 4F67A 3BO3A 4K8RA 3AD7C 2OD4A 2KM8C 2VUGA 2HFZA 3GG1A 3RRHA 1JLBA 1RT4A 2JLFA 4DZDA 3E8OA 2X1AA 3R97A 3ILIA 3RYLA 1X4DA 3PY8A 2KDOA 2H54B 1ZAVA 1MLAA 2D1CA 2XMMA 3KK3B 4YB7A 5HVGA 4PKDB 3TZWA 1FRXA 4M5LA 1GXUA 5CCLA 4JI7J 1RAGB 2C3MA 3JQKA 1JLGA 2J9DE 2EFVA 2VBYA 1EP4A 2CNNB 4QU7A 2GJ2A 4ED3A 1KQFB 3NWRA 2HVEA 3PRDA 1OYDA 1CULA 1Q5VA 2KZZA 4QIGA 2UXBF 1LW2B 2WK4A 2FZCB 4YUDA 5IV4A 2ERRA 5CHCB 4A8KA 1BGXT 5ETMA 2JWNA 3CJQA 2RQCA 3K17A 2UUBJ 3PYEA 4JI2J 4ZPCA 1M1GA 2RH3A 2BKPA 1FK9B 3I82A 4L75A 4PXEA 4RW9A 1TL5A 2V4JB 3DOMB 2CWXA 3MR5A 3I0RB 3PW2A 5HMXA 3M6XA 5HP1B 2FJDB 2BANA 4F4YA 1R0BG 3CCVS 5T7LB 3UNYA 4GMKA 4M94A 2BJ3A 3GYGA 2HAIA 2CPHA 3MM7A 3MD1A 6FD1A 2MZRA 2XCAA 2FIUA 2AHOB 2D9OA 3L9ZA 4ENOA 2E9ZA 1P1LA 2XS5A 1VFJA 1V5IB 2ILZA 2I1RA 2XMWA 1NBEB 2DT9A 1YLXA 3OXLA 2ZNYA 3MM6B 4WP8A 4HHJA 1HQUA 3EPGA 3L95X 2DO4A 5KFDA 4EU0A 4IO9Q 1HWJA 4JI4J 4DR4F 1W26A 4K4XA 5HO4A 2DNYA 3MFIA 3G4SS 5DDRC 1Q95G 4CLPA 4DS4A 3NS6A 2J7KA 1TUGB 1T3OA 2MKIA 1L3VA 3GV7B 4KRWA 3M4XA 4TN2A 2KU7A 1G4CA 2VC1A 3K8VA 1FE0A 3RG6A 1JNRB 2CQIA 4OYPA 4H4KA 4HT5A 1HWKA 1QTMA 1FXLA 3H2UB 1N5SA 4QYZJ 1NU4A 2ZJRQ 2ZM6F 1N32F 1KP6A 3TJ9A 4IFYB 1WORA 1JJCB 1NRKA 4DV4F 1U4BA 2PA3A 4PUOB 4OYBA 3RW7A 1HBUA 1DTTB 1QAYA 3FZ2A 4QR1A 1S79A 3HSZA 5K5MA 4DR1J 4LUBA 4P6QA 4RUHA 1ZOTA 1NKBA 3TO8A 3CCTA 2J6UA 3IBFB 3NRBA 1U49A 1UJ6A 2F63A 3NGSA 3VQTA 3BDEA 4O3PA 1M5SA 3A3PB 3ET6A 1RAHB 1U1RA 1FNXH 1AA1B 2ATCB 4WFBQ 5D0HA 4I4BA 5LJ5Y 4L73A 5DDPC 5FD1A 3OL6A 1VDHA 4LSLB 4LVOP 2VFUA 5I3UB 1IKVB 2PI5A 3BR8A 2RS8A 4ECVA 1S9EA 5C2CA 2C28A 4BS2A 3UWTA 2ZJPQ 2E1CA 2DY1A 2M70A 1FDDA 4OHVA 3P5TL 4C98A 2VV5A 4ANEA 4RJVA 3HMJG 2ATLA 5KFTA 4IH5A 4OX7A 4J9OA 2DHSA 1WSRA 2RUSA 2QLWA 2KKHA 5F0WA 1IBMJ 1FXDA 3VCDA 1BD6A 2VQFJ 2MQPA 4OZ2A 4C3LA 1EKRA 1WOPA 2XNRA 3MXHP 4H4OB 1U48A 3ISNC 4LF8J 5B7WA 5M2RA 1D3WA 1Q8KA 2Q1LA 1DFDA 1YKWA 4GO7X 2QE5A 2R2SA 3QRRA 2O1PA 1Y5NB 1S9FA 2UXDF 4IH7A 5F8NA 1HNVA 3QPIA 1UW9A 1VQPS 2LVWA 1QAJA 1PAUB 4FS2A 1YZ6A 3ETMA 2D3ZA 1FVQA 2R8KA 2BDPA 3UN5A 4HKQA 2DR7A 4UTGA 1H2UX 5BYSA 4OQJA 4F4WA 2YWFA 3M6UA 3H0PA 1VI7A 3JTNA 4B9TA 2HHQA 3BPSP 3KLGA 2E9TA 1ZPVA 3MECA 1T03B 4LRFA 4I2PA 2DH9A 3H5XA 3THPA 1U02A 3BGRA 1FWKA 1LWXA 2BJDA 2HNYB 3HVRA 3D54A 4O0NA 1S1XB 3FBEA 3TUIC 3KLVA 3PYFA 5HBMB 3PEJA 3N0VA 1V3ZA 2XI3A 2XS2A 1VOMA 4CO5A 2LLZA 3N6NA 3HJVA 3VAKA 2Z2MA 5DQHA 5DQIA 3FQLA 3KHHA 5GADU 4TLQA 4PABA 3AD8C 4HVZA 1G6BA 4Q2MA 1MROB 4TY8B 2NXCA 3BEGB 5ETOA 3U27A 1HNZF 3RJMB 2IAJA 3P3DA 2OPPA 3RAMA 4NASA 4KIAA 2DGUA 3R1LA 4I2QA 1YBUA 5K20B 4DMZA 5K8NA 4IO1A 4U7UK 4FYWB 3R2DJ 4XAKA 3PACA 4CO0A 1BWEA 5KFAA 1S1UA 5A2QY 1UZHA 3HHLB 1CJVA 2CUYA 3G82B 2U1AA 3LAKA 2HLTA 4ZPDA 1KKHA 1SCJB 1RT6A 1HIYA 5I3PA 5B0DA 1JLFA 2OLWA 1KOHA 1VIOA 2DNRA 1UVKA 5HMWA 2EFOA 3MD3A 3MUTP 1OIAA 1L3SA 3HJFA 4O44B 3ELHA 5E33A 1V6HA 1N52B 1LWFB 5A0YA 3UD4P 1OMSA 5LL6d 4DUZF 3D6MB 4PWUA 3HVTB 4WU3A 1NHVA 1QE1B 1X4CA 1WI6A 4C7QA 4GKKJ 3Q83A 2UUBF 2YKQA 3M8RA 4OIXA 1RK8A 2XMUA 3E2EA 3OR2B 3H4DA 1UTAA 3MR7A 2WTFA 2R4FA 2R2TA 4HDGA 2ZKUA 4ZVQB 1NEEA 3LW5C 4R8UB 2OIHA 4I67A 1F6TA 4FXDA 4Q0BB 5DM6Q 4AUKA 4EO6A 1SH3A 3KJFB 2BEFA 4O23A 2Q6CA 3KUEA 3BSOA 2HNZB 1CC8A 3M6VA 5IM0A 2DRAA 1WKLA 3KLFB 4LSZB 2N4DA 4C0BA 1REVA 3W8PA 4DV1J 1SH0A 4KGXB 3JSRA 4IG0B 4B3SJ 2C42A 3AD9C 3KK1A 3SZ2A 3ISND 2OEMA 2XGQA 4BDPA 2HWTA 1HLWA 2DB1A 5CYMA 1M5HA 2MGZB 4KV8A 4DPWA 2IM1A 2N4CA 3S1TA 4DR2J 2W4CA 4A48A 1JX4A 3R6LB 4MIBA 3HT0A 3CSKA 4NA3A 3BGOP 1VQLS 2H51B 4U6PA 1KR4A 1RT2A 2JX2A 4A8MP 3I56S 2M5YA 3MR2A 2W9CA 2DITA 3ZZRA 5A8WA 3I5CA 4WE1A 2MQOA 4HACB 2XY5A 3ETOA 2KN4A 1KTQA 4P9SA 4NPOA 1Q8LA 1I94J 1GNKA 2PEHA 3L7PA 3QIDA 2J8SA 4RU2A 4GC6A 4DR1F 5J2PB 1DAXA 3C16B 4NLRA 1S6QB 3H25A 2DNQA 2OI2A 2ZH4A 3DHXA 3RUBL 5KT3A 3PIOQ 4UY8T 3VAJA 5KFWA 2GJIA 4K4VA 2ZE2B 3CDUA 1HBNA 4CO1A 2ZEJA 1EIYB 3TX8A 5KG7A 1D9DA 4L76A 2KJVA 3P4UB 1TKTB 4Z2XA 1K8AT 1JLAA 2QLFB 5IWAJ 3MPDA 1S4EA 4F26A 2DNHA 1NK6A 2QV6A 3BB5A 3DHWC 4M63A 5L1LA 3HF5A 4RWWA 2Z2ZA 4NMXA 3QO9B 2MZQA 4ECZA 1KHVA 3SSSA 4CNZA 3MAQA 2OPSB 4DQRA 4DR7F 3A8KA 4EI2A 4DN0A 4CH7A 5U47A 3OV7A 2J9CA 4IDKB 4CYUB 4WXWA 3LA0A 4USTA 5KT7A 4DXLA 3OFEA 1LXNA 3IFEA 3M32A 4NLTA 1C1CA 3N4WA 5A2QU 2VG6A 2CXEA 3HVAA 2E7XA 4J9LA 3MOJB 1IBMF 1FNMA 2IY5B 2VQFF 1A9NB 2YNIB 1A0OB 3MM6A 2G13A 3J81j 2CZ9A 2OKQA 1UFWA 4JV2A 1RWPB 3HKWA 1T11A 3N6LA 3J7YI 4Y65A 2J9EA 3PRVA 2VG7B 1FRHA 5KG0A 1N8RT 1NSAA 4TNOA 3H5SA 2C2EA 3H98A 4OX6A 4NLOA 3EDQB 2WONA 2C2MB 3OFHA 3D6FB 2VASA 2NSCA 3J80U 1RLDA 4G3IA 1FVSA 2G0IA 4YB1P 4IR1A 2KHDA 4RUBA 2CWKA 1FD8A 1CJUB 3FJ2A 2CYYA 2QA2A 4WZMA 2O5DA 3QGPA 3B82A 2ROPA 3V6DB 1GK8A 2DNZA 4PUOA 5KT4A 3T5HA 5F9LA 4K0KJ 4NXMF 3QSYB 2J6SA 2VODA 1U25A 4IKAA 5L46A 3V6JA 8ATCB 2OMLA 4A4JA 2CAJA 1WNEA 3D5MA 4QR2A 3QMQA 2XYGB 2OP5A 3DLLQ 2LCWA 4NLQA 3MMJA 4ZPTR 4RLEA 2OFGX 1JIHA 2AYMA 1CJTA 3DGPB 4O4GB 5D3GB 1A6LA 5L1IA 4MKYA 3WIVA 3TEHB 1N5TA 4WTOB 4LBIA 3PEHA 2W1BA 4TLRA 2CQBA 4ZP7A 2YNGB 1UA1A 3BBCA 4LIWA 4UT4A 4F02A 4C11B 4K5SA 5DDOC 4KPCA 1RHRB 1IQZA 2AGQA 5E3QA 1S77D 4R5PA 3HHLC 2XGPA 1IQTA 4MFBB 3W60A 3KLEA 2CADA 2EFQA 2CQGA 5EX0A 1TV6A 1RT3B 5E7OB 2IMOA 4B3RJ 3QJPA 5KFUA 2RHQB 2ZH9A 3CCES 4WJBA 3NXZA 2U2FA 4ZN1A 3DRPA 5J2NA 1XC9A 1MU2A 2E5LF 2KG0A 2DISA 1SXLA 4YEAA 3NAIA 3FUYA 4YN3B 5F8MA 1T05A 1KVJA 1SQFA 2QA1A 1JXLA 2JEGA 2YWWA 4ILMA 1FEHA 1RKIA 5C5JA 2K1RB 3GIJA 1DQAA 5C24B 2ROGA 4RPFA 4JOUA 4ZCIA 2Z57B 3EMTA 1JNZB 2VFTA 4F36A 2DRBA 4HL9A 4DU8A 5CD4A 2F9JA 4WXOA 1TU0B 2AZ3A 4A8OA 4ANDA 4FPRA 2A2CA 4FKYA 2AYBA 4M5GA 3PCOB 4XIUA 1IXKA 1RHUB 2EXUA 3GFHA 2LXFA 1I6JA 1F5CA 4GKKF 3KG1A 3G8TA 5CD4H 4ILLA 1RWKB 1K73T 4TY9A 3K58A 4PXBA 3LALA 4OZ0A 3OVSA 4J90A 4EZ6A 3OTDA 4M8LA 3CD5A 4RW7A 1LK5A 3QSIA 3HP6A 2HVZA 5KFLA 4X66F 2W01A 3W8GA 1TTHB 2NXJA 2B51A 1LNQA 3ILOA 3KNGA 3V4IA 3CCLS 4CWBA 1N5VA 2ZUGA 5C7PA 4DG1B 2PMWA 4YQWA 3HVWA 3PX6A 1DY3A 2AJ2A 1XK8A 4WK3A 3SSQA 5LXRA 4DV1F 3GB0A 2L9DA 1RE1B 5HBMA 1KC8T 1WACA 4B3SF 1PAEX 4GRSA 4DV5J 3K7RA 2DH7A 5AT1B 4JI3J 3D2WA 3WC2A 4IOCQ 3CDBA 1KQGB 2ZZNA 1X5SA 4FKXA 1AXQA 4DPTA 1X9SA 1KDNA 4P75A 3LGMA 2MHNA 1MMNA 3R5CA 1XNRJ 1Q5YA 1UVMA 2QL9B 4ZN3A 4TY8A 3NCRA 1B3TA 3NKYA 1HYSB 2A2DA 4Y2CA 1KONA 3CE8A 4B3OB 5LMNJ 2FJWA 2R42A 8AT1B 1SQGA 1BQMB 5F41A 2Y0BB 1NB2A 2QYGA 4WFXA 5ETLA 4IQXA 1GX5A 3W3SA 3RR7A 4LF4F 1RBOB 1SL2A 1I94F 4F3MA 3GONA 1UFKA 2A0FB 2AEFA 4FS1A 2HVDA 4WTYA 3PHEA 2V8PA 1RP5A 1TMMA 5AXLA 3X1LB 3D3CJ 2XULA 4ZCKA 1HKAA 3T1HF 3VHQA 3NOGA 3MCSA 4ZMMA 1RT5A 4AXJA 2FHKA 2F40A 2BBEA 1TELA 3SQGB 4I56A 4R25A 2VBWA 2UU9J 1P1TA 1I5OB 1FTCA 2KO1A 5D4OA 1H74A 2ZKTA 1TVRB 4RW6A 4ZA1A 1EX8A 1S99A 3ZTRA 4QW9A 3GIRA 3E01B 4RX6A 4ECYA 1BWVA 5IWAF 3ZZ0A 2MXYA 4URQU 5HN0A 1X4GA 4ZVOB 1XQIA 2Y9HA 1RJJA 3CJKB 1ZBTA 5DZ7A 3P8BB 1OWXA 3BQ2A 5BR8J 1IR2A 4DFPA 4OJ1A 4KHRA 4Q0BA 5LOQA 3PM9A 4K4TA 4WP9A 4I0WA 3W62A 1BE4A 2R2UA 1RA7A 3OHBA 5KFZA 3DLHA 3H2LA 1QDUB 4CO3A 3K5PA 4QWAA 1BQNB 3DM2A 1ZH5A 4ETZA 5IV3A 3N5FA 1SUQA 4LMZA 1TFYA 3TEGA 2LYVA 3GZ7A 2RD5C 4QZVB 4BC9A 1RHMB 3CB4A 4W90B 3J7A1 2HHVA 4OYIA 3SEOA 1UZDA 3VV2B 3D28A 4QIFA 3Q8YA 3BO4A 3W2VA 2W7OA 2WW4A 3M2VA 2CG8A 3M8ZA 4Q44A 4IG3A 1VC0A 1D8YA 3Q22A 3IG1A 1UEKA 4O3QA 2RQMA 2GQCA 5CYJA 4MK9A 3JYTB 5E2QA 2JHEA 5IOLA 4ICLB 2YNHB 4YP3A 1G2EA 3A8JA 2RVJA 2CPXA 4CH1A 5LT5A 1JLQA 2QMWA 3L09A 4W92B 3AB4B 4DSKA 3THTA 2HQ3A 3IO1A 2CPYA 2NCKL 2J0SD 4WYWA 2HBQB 2F4VF 2OO4A 1WG1A 2FB0A 2V8VA 4K0KF 3G6VA 4FZVA 3W2WA 2KI2A 4LR9A 2C3OA 4ELTA 2B7BB 3D67A 1HBMB 1X9WA 2XNQA 5IS2A 2H5JB 1FKOA 1HQ2A 1S9GB 1Z2LA 5EWEA 1YBTA 1Z1ZA 3NGDA 1ZA2B 3H20A 3QFWA 1SVDA 4CDIA 5LMUF 2DNOA 1LWEB 1WKJA 3PIPQ 2IVYA 3A8IA 3DOLA 4V19X 4JI6J 3OBIA 5KT6A 2JRSA 4OYMA 1FA0A 3BN7A 3T41A 3TAMA 3IP0A 4FDFA 4ZK7M 1TKXA 2MLYA 4ECTA 9ATCB 1X7VA 5EN1A 4P7VA 1YJVA 1P6TA 7AT1B 3OVBA 2VIHA 3EVWA 3FK4A 4IDKA 4NRTA 2O67A 1F60B 3TYTA 3GYNA 1FKPA 2Z0GA 4PCQA 2I0XA 2LQBA 2DGQA 4RBVA 4QIVA 2C3PA 2CQCA 1CS4B 3EZOA 2Y3YA 1D9FA 2HEKA 5HROB 3KDNA 4ZLLA 2QFJA 3M2RA 4X4NA 2YNIA 3TUZC 4QYRA 1AROP 2A6MA 5K9FA 2X3GA 3A1YG 4AL5A 1JKHB 1H3DA 3BREA 2BQ3A 1X5OA 3MTKA 2RDDA 3A4TA 4LF9J 5GVQA 2XBPA 3GG0A 2JLEA 4NLVA 2E1RA 3CCQS 3DMJB 3I5BA 1XR6A 2GS8A 4C0OC 2VH7A 3ENWA 1WC4A 2E9RX 4WU2A 2KJWA 2ZHBA 2VDIA 4ZLJA 4IRCA 4AQYJ 3K59A 4J37A 4B3MJ 3DOKB 2NXEA 3CJ0A 2OEJA 5KT2A 3C46A 1SB6A 4OZ3A 1IKWB 2QMUB 3K5LA 4DV2J 3UPFA 2VBZA 4MK8A 3N9UC 2P6SA 4FYYB 1SJQA 1MMDA 4RR5A 1HBOA 2WRMA 1QSYA 2LECA 2GAGC 2I8EA 2M9KA 3OTOF 3OTCA 3ZTQA 3D68A 1ELOA 1RTDB 2YX4A 1NB7A 2JVOA 3TI0A 1C1BB 4QIEA 3MMAA 2VF3A 5DQGA 4MYUA 4NZ7A 4LR8A 3FVYA 4F4KA 5E3PA 4RNOA 2H1YA 2EPIA 1C0UB 2WOMA 4JBCA 1HI0P 2KT2A 2ZVSA 3LP2B 5K14A 1KLMB 3P96A 4ZDNA 3HPOA 4NZ0A 4DV5F 3ENAA 2KRBA 4Y6IA 2I5JB 4HI2A 4JI3F 4J5OA 5HK4A 2W2PP 2PN6A 1XNRF 4WCEQ 5HSPA 2H4WB 1Q81T 1N48A 4CZCA 4GVBB 4I6WA 4FF3A 2VICA 3W61A 3FRZA 1D8ZA 1LW0A 3IWXA 5BXIA 2LMIA 2PGCA 5CAAA 2E44A 1T3NA 3ONQA 3LP0B 3KHLA 2MTLA 2AGPA 3J81U 3ZZPA 1RWXB 1N88A 5H9EK 2AW0A 1UVIA 3R5DA 2RT3A 2OPRA 5DG9A 3AJDA 3CO0P 2IHR1 3BYPA 3PKYA 4NX9A 3FCVA 1PYOB 2WCXA 5IC6B 4YB6A 4K2JA 1VS3A 2X51A 1GTEA 2BQUA 4LF6J 2IMWP 1KD1T 4G1QA 1WWHA 3DFEA 2EBEA 3MMBB 2FY8A 1S48A 2V5HG 1JK9B 4WBFA 1XMQJ 2RB7A 4PQUB 1BY9A 1F3VA 2DPIA 4NLPA 2HNDB 1VRUA 4F0KA 5E0OA 4H54A 2VG5A 2B5JB 2FD2A 3CPWR 2BJ8A 3HZEA 3RRKA 1U6ZA 1VQMS 1MSWD 3MM9B 3I4HX 4L6V3 4I64A 4ZLPA 2DHXA 3MMCA 1VQ7S 1NHKL 1GTHA 3NLCA 3JB9k 4B17A 2I38A 5BR8F 1WF0A 1D1UA 4BWMA 4DV3J 2G1DA 2AU0A 3H40A 1YJTA 1VJWA 2GQQA 1IBLF 4OMFG 4ZPWR 1RTIA 3TZYA 3H8YA 1Q79A 1DZ5A 5CH7B 2DXFA 3I9ZA 3ZNUA 1QVFR 4M95A 1QLNA 4ZP9A 4F4ZA 1ZM4A 3QAUA 2BZ2A 3DLJA 3FDSA 2AYGA 2ZJQQ 4FBUA 1GXLA 3ZZOA 2C2DA 2HIYA 3SFGA 4NZ6A 2V9WA 1N5YA 5BYQA 1S1TB 5L9NA 5E5NA 1X4EA 2BE2B 4HR2A 2YX7A 4LRCA 4X4QA 1S57A 3ZZZA 4FNIA 2VU5A 2YWKA 3K5OA 2NUUG 2LQJA 2OMOA 3OQ2A 1SKSA 2GX8A 4M5HA 5HVHA 2DNNA 3THVA 3QAEA 3K5MA 4TQSA 3PJ9A 1M0SA 3QT6A 4OHXA 1IWAA 2FDNA 3G8QA 4P71A 2CQ3A 1WHWA 1I3OB 1R6VA 2K7KA 1PJ7A 3G2XA 2OPQA 1FDNA 2R7WA 2KRRA 3NBPB 2PMHA 1FI4A 2YKMB 3MEDA 4YR2A 2NPFA 1U26A 3HSGA 2RKIB 4I7FA 1NH7A 4EYHB 2KZMA 1RT7A 3DI6A 4OYWA 1LEOA 3R8YA 1QJHA 1B70B 1HNXJ 3D1QA 1DTQA 2MKHA 3FBBA 5C25B 3T6JA 3BGFA 2ZH3A 3CJ2A 3O6QA 4IRDA 2XY7A 1IKYA 4JI6F 1S6UA 2E5IA 5G0RA 4C8OA 1SC6A 3SBMA 4USUA 1N33F 2C3YA 2VL1A 1Y7PA 3W5ZA 3KTQA 4KGMA 2FTRA 3SXLA 3OUYB 3IN5A 2YNFA 4Y00A 4F0MA 5KG3A 2MDAA 3LO3A 4P10A 3OXGA 2HFSA 5RUBA 4YOEA 1R8AA 4X2BA 4DFMA 2E5GA 3AFGA 3NGKA 4ZLNA 2CPIA 1X0FA 4LFCF 3J7ZT 4CT8A 2LFVA 3J7AN 2PE8A 1M5VC 1BHNA 2HK3A 1FTRA 4Y2AA 3K89A 3VTIA 3C66A 4WFYA 2C2KB 3P6YC 3SV4A 2C3UA 4FXWA 4LSNA 3TNVA 5HMZA 1N34J 3I6PA 4B3TF 3OR1B 4LF9F 3WQPA 2ACYA 3S6EA 1E6YB 4UUWA 3S7RA 4E98A 4KJIA 1TL1B 1S12A 2XWXA 4F8RA 4NYPA 1E6VA 4YDDB 4EK2A 4AQYF 1SC4B 4B3MF 1BMQB 2OSQA 4KAIA 4ZHRB 3QJLA 2GAHC 4USWA 3RB0A 2E5JA 3CTRA 2CQ2A 2Y1LB 2C2NA 1B99A 1PJ6A 1NZAA 3QRQA 3TW0A 1OQ6A 4C9DA 3PV8A 2I9SA 2FVSA 3MTJA 3VAFA 1F3FA 2PA8D 2W2NP 3TVKA 3D6HB 2IDEA 4DI6A 2XZTB 4KO0B 2MSTA 4TKTA 3KJVB 2KHCA 1T9XA 2H9ZA 4DS5A 2GHWA 2CJXB 3LP1B 4F0HA 3NG8A 4X4SA 1G3OA 2ZVIA 4AD6A 4RWXA 4HYKA 3POTA 2UXBJ 1FX4A 2JLGA 1LQ9A 4DCOB 4HEA9 2GJFA 1VHFA 1WC3A 3VVTA 4M5JA 3GPAA 1U8WA 3T9NA 3MM8B 3SDEB 2VQEJ 2MKYA 3TA1A 4ED0A 1L3KA 2F4FA 4KFBB 1AB8A 3O1LA 3PJXA 4TVAB 2BV3A 3U1LA 5J1PA 3V81B 3TA0A 4A46A 1EHWA 2RF2A 4DF4A 1SJ4P 3R7NB 1YRXA 1RAOA 3LH2S 2OJ3A 4XPCA 5F3TA 5ETPA 2QO3A 2A10A 3IS9A 3MR3A 1S5ZA 1DLOA 4ZVPB 2MY7A 1HI1A 3D3BJ 4J9QA 2UVVA 3EX7B 1JLCB 3CDAA 2ZD1B 1JJHA 3G71S 4QR0A 4NLDA 2G9OA 4HHUA 3ITHA 1ROFA 2FGCA 1RAAB 2YPYA 3PRBA 4LF6F 3T1YJ 3H90A 4DR4J 2DVIA 2RU9A 1F9FA 5L38A 1UETA 2BOAA 1S97A 3W9IA 2YY3A 2EFGA 1BQXA 4F2SA 3VGSA 2WVFA 1WI8A 4RL1A 2XEXA 5F8JA 4MKAA 3KMSA 2F65A 2YKAA 3TUPA 2ZH5A 1YRUA 3LPEA 5ETVA 3GCXP 1OS5A 4N77A 2CIMA 3PO5A 1N32J 2X7IA 2ASLA 2B9WA 4DV4J 3PJWA 4OX8A
chains in the Genus database with same CATH topology
1IKXA 3Q8RB 1K0TA 4ZVGA 1U1QA 1XTZA 4K4VA 2MMYA 4KO0A 2ZE2B 3HVTA 4A8XA 4C3MA 3DXSX 1QE1A 5D78A 5IT0A 3CDUA 1SBRA 3KJVA 2AQ4A 2FVPA 1EETA 4NXNF 1HBNA 1UWBB 3LP1A 4CO1A 1CPZA 4KBIA 2IRUA 3IGVA 4N56A 3TX8A 5KG7A 3GR0A 1D9DA 4OJHA 4WFNQ 2DGVA 1U8SA 2DPJA 1CLFA 2KJVA 1LKZA 2GW8A 3EGWB 5HMYA 1TKTB 3M2UA 4Z2XA 3OVAA 1K8AT 3OR2A 3QGIA 1JLAA 2YTCA 2VD3A 4YB5A 3I32A 3LAMA 4NLWA 5SUHA 4F26A 2DNHA 5KFMA 1NK6A 2XC9A 2QV6A 1M5KC 3IXQA 2W7PA 2UVUA 1X4BA 1OSDA 3BB5A 3DHWC 2YKPA 4ID8A 4M63A 4DUYF 5DLFA 3OFGA 4K4ZA 4R8UA 5L1LA 3HF5A 2FJVA 3SCLE 1O8BA 4RWWA 3MM5B 2V94A 2X1BA 4A8QA 2J76E 3QO9B 2MZQA 2IM0A 4NRUA 1KHVA 4TXSA 2RMLA 5MAOA 4ECZA 3SSSA 3GFXA 5AJ3F 4RUAA 4CNZA 3MAQA 2WSFC 1Q8BA 2OPSB 3HHLD 4DQRA 3KNAA 4DR7F 5KG6A 3LP2A 2XG8A 1U2RA 4DN0A 4CH7A 4DWIA 4H4MB 3SDEA 4ALZA 3CC2S 2CRLA 4M5DB 4XPEA 1IJEB 2IVMA 5U47A 2IC3A 4J9PA 3OV7A 2J9CA 4KPYA 2NXUA 2HNZA 3FZBA 4Q45A 4KFBA 1UJ5A 4DN9A 2CQHA 4IDKB 3TARA 1NK4A 3JAMY 4TYBA 4R5PB 4OV1A 3MHYA 4WXWA 4RW4B 4ES1A 3CUNA 3EGNA 4AFFA 5KT7A 3UCZP 3KLFA 5K8MA 3OFEA 1LXNA 3IFEA 3M32A 4NLTA 4NOHA 3LF0A 1H7WA 1C1CA 3CEDA 4OI3A 3OL7A 3LOUA 2A18A 3MEEA 3N4WA 3QIPB 2JEFA 1XMOF 4O3NA 3KLEB 2VG6A 3V81A 3HVAA 1FJCA 2KT5A 2E7XA 4J9LA 4J9MA 5AXKA 1TV6B 1TUVA 1JJ4A 1ZPWX 4IG0A 3OL9A 2CJBA 3ISZA 3MOJB 2MYFA 4ECQA 1Q7YT 1IBMF 3DRRA 1FNMA 2VFVA 2ZHAA 4DBQA 4KKOB 2VQFF 5D4PA 2YNIB 1TL3B 4WFAQ 1HWIA 1A9NB 2CZVC 5C42A 1YRTA 1N0VC 3MM6A 5HLFA 3DRPB 3MAHA 1VK3A 2HS3A 2VPYB 4OI4A 5J2NB 2G13A 4URGA 4IR9A 1HA1A 1W25A 3D0IE 2FHOB 5EDWA 2ZH2A 1MU2B 2KXHA 4CH0S 5KOXA 2MGZA 1HWLA 3SCJE 2OKQA 3M8QB 2HZCA 1J5OB 4N47A 1UFWA 4DL5A 4JV2A 4N41A 3LP0A 2HLUA 4CTAA 1T05B 3LANA 3HKWA 2Y1IA 2JC0A 2RU3A 4I68A 5E3AA 3Q8SB 1YBAA 3N6LA 1JLCA 3QZ7A 2ZD1A 5T41A 3J7YI 4Y65A 5K8PA 2J9EA 2K3IA 3PR4A 1VQNS 5KFCA 1Y9OA 2LXUA 2VG7B 3OLAA 3GILA 1FRHA 3FEXB 5KG0A 4PWDB 1N8RT 2H5EA 3C6TB 2OD6A 4MIWA 2VFRA 3RAQA 4TNOA 2L9WA 3M1VB 3H5SA 3WX4A 2Z2LA 2C2EA 3H98A 4OX6A 4EO8A 4NLOA 2WONA 4A8FA 3TRGA 3TQ1A 4PG5A 2NZ4A 1S1VB 2KB2A 5J1NA 2NQPA 3HLUA 3OFHA 3UW1A 2GGPA 2UUAF 2KFNA 2HVIA 5L8RC 3HHNB 4HH0A 4D3GA 2A1BA 1Q1KA 4FVCA 3DYAA 2VASA 2GHVC 2NSCA 4L3NA 5JXSA 6FDRA 1RDRA 1YITS 2XB2D 4G3IA 2HQIA 1FVSA 2FHMA 3PX4A 2HIQA 3CCUS 4YB1P 4IR1A 3HK2A 2KHDA 1XERA 3PO4A 2PSZA 1FD8A 5A8KA 1TZ0A 3JTOA 3FJ2A 2CYYA 5CYQB 2QEXS 4OL8A 1FF2A 5KTQA 1HQEB 2QA2A 4WZMA 2VA2A 2AP6A 2DNKA 4WFZA 3IR7B 2X1GA 1YJNS 3GMGA 2O5DA 3QGPA 1HW8A 3DU5A 5B0BA 1X4FA 3BN4A 5KFRA 7FDRA 3J81Y 4F4XA 1CEZA 3B82A 2ROPA 2YWEA 2M8DB 3NNHA 2XMTA 3V6DB 1MNEA 1TL4A 2DNZA 3TAQA 1HNWF 1K0VA 4PUOA 4K4YA 2WSCC 4DLEA 2KFYA 2VFSA 5KT4A 3T5HA 1HNXF 5F9LA 4NXMF 2UUWA 5A8RA 3DRSB 1KOOA 5HI7A 5J2PA 1RTHA 1HMVA 2J6SA 2YX1A 4RW7B 1FERA 1T95A 4YHHF 3M8SA 1U25A 4IKAA 2VODA 3AB2B 2KVIA 1S6QA 3ZC4A 5D4LA 3V6JA 2OMLA 4A4JA 1WNEA 2FVQA 2L48A 3BGLA 4HDHA 2R7TA 5MLCV 2JH3A 5G4DA 2HMIA 4HT7A 5GMKa 2IM2A 3D5MA 4F3OA 4QR2A 3QMQA 1UAWA 3J7Z5 2E1AA 4X62F 2OP5A 3DLLQ 2LCWA 3CD0A 3V4IB 3GIKA 2EG2A 2YKOA 4PG6A 3HHEA 4NLQA 4QWEA 2KXNB 1UW4A 3MMJA 2XMKA 4ZPTR 1NKEA 4RLEA 3RB6A 2ZE2A 2OFGX 4QWDA 4OI6A 3O8WA 3Q8PB 2WBRA 1JIHA 1UWBA 2AYMA 2V8DA 3LGNA 3IBWA 5E41A 4O4GB 5D3GB 1A6LA 2B0GA 3X3UA 3C8YA 2AF6A 4BBYA 5L1IA 4MKYA 2ZBIA 4USHA 1TKTA 3T19A 1N5TA 1UMJA 5KG2A 2HHUA 2F8MA 3PEHA 3VZIA 4Y2MA 4RBUA 3JSMB 4TLRA 2CQBA 3H4BA 4NA1A 4EFAC 4K59A 4ZP7A 3UI3A 2MQMA 1UFLA 1R3NA 2N3OA 2YNGB 3SMZA 1VQ4S 3IRXB 2DHAA 3C6UB 3H59A 1B0PA 1UA1A 4Q8FA 4DEZA 3MM5A 4LIWA 3QO9A 3OTEA 3MPYA 5F8LA 2WHOA 1SKWA 4F02A 3OJSA 4C11B 2R2RA 5E3CA 1YTYA 2OPSA 2CPDA 2HRUA 4JYAF 4N8NA 4K5SA 5DDOC 3CXCR 2N82B 4ERDA 2YWGA 4H4MA 4ECSA 1QSSA 4IYQA 5KG4A 4M5DA 1IQZA 1Y4ZB 3FSYA 1FD2A 2XSJB 2AGQA 4ED5A 2ZOFA 1G1XA 2M52A 3IGNA 2GC8A 5E3RA 5E3QA 3US5A 1S77D 4R5PA 1ZYQA 2V0NA 4ID5B 1QSLA 2RE1A 3HHLC 4RW4A 1KSPA 2XGPA 1IQTA 4MFBB 3CULA 5KFBA 2MKCA 4RNNA 2EI5A 2KYZA 5SZTA 1U1OA 5AXNA 3KLEA 4XO0A 3HM9A 2IBKA 4ZP6A 1KFSA 2BRKA 2EFQA 4UUXA 1FESA 1RTJB 2QSWA 2CQGA 4K4WA 4L72B 5EX0A 1N34F 4AYBD 2EWHA 2LDIA 3M05A 3EZ5A 1TV6A 1RT3B 5E7OB 2DK2A 2DIUA 3OXFA 4RW8B 2IMOA 2BW2A 5BJRA 2HYIB 3UR3C 3QJPA 5KFUA 4BC7A 2ZH9A 3CCES 1B7FA 1QUVA 4KKOA 4WJBA 4Y34A 4JV0A 1HNIB 2HFOA 1TL3A 3GV8B 1N36F 2U2FA 3DRPA 5J2NA 1N56A 4LF5F 2MJUA 2ALZA 2MZJA 1XC9A 2UUTA 1MU2A 1XWLA 2GIRA 5EUHA 2E5LF 4WKRA 2KG0A 2DISA 1SXLA 4YEAA 5KFXA 3VZHA 5F3ZA 3CIMA 2KXFA 3M8QA 1J5OA 2AJFE 3NAIA 5F8MA 2YH0A 3I55S 1V3SA 4QW8A 3A8EA 3PDNA 1T05A 2DIVA 2QA4S 2RDIA 1KVJA 1R8CA 4ECWA 2W25A 5FDLB 3CCRS 1IR0A 4AL6A 2QA1A 1JXLA 1GQEA 2JEGA 4K4UA 4X4VA 5I3QA 4RBTA 4ILMA 1FEHA 4C2MA 4DV2F 4OFZA 3QWPA 1YIJS 4JI7F 3FMWA 3CDEA 2UVWA 1RKIA 5C5JA 2VG7A 1S1WB 1VQYA 1S0NA 1Y5LB 2AV5A 1MMLA 2K1RB 2L9NA 1Q8IA 4X4PA 3C6TA 3GIJA 1ZAXA 1DQAA 2PI4A 4OZNA 5C24B 2UV8A 3M1VA 2ROGA 2CFXA 2J7UA 1VC5A 2PDAA 4JOUA 1RT5B 4ZCIA 1FRJA 2AJ4A 1JNZB 2MZ1A 1P27B 2VFTA 2LQ9A 3B8HA 1C4AA 4HL9A 2DRBA 3DLKB 1S1VA 4Y2KA 3B4DA 3RAXA 5GAHI 1Q7LB 2F9JA 3VR1A 4WXOA 3T5KA 1UKUA 2BYCA 4A8OA 3V6KA 2FJAB 4FPRA 2A2CA 2UZAA 2M7SA 1UJ4A 5DGAA 4IFVB 3HFKA 2XI2A 2LKZA 2AYBA 1SJFA 4XIUA 1IXKA 1Q16B 2D3UA 1RISA 1CQNA 3GFHA 2LXFA 1WG4A 2UVRA 1I6JA 1F5CA 2KM8B 4GKKF 5CYQA 3KG1A 1S0MA 2MY8A 4DX8H 1HQEA 3EXYA 3G8TA 4RW6B 1AUDA 4F2RA 5CD4H 1A7GE 5J2QB 1J5EF 4ILLA 1NK8A 2K2PA 2L3MA 3MWBA 2N7YA 2R7QA 3H2VE 1K73T 4FXVA 4TY9A 3K58A 1UL3A 3V6DA 4JI2F 5F0UA 1VLYA 4RKUC 3I31A 4PXBA 4OLOA 3LALA 2UV8G 3G9CA 1F5BA 4DJBA 2JVRA 4OZ0A 3OVSA 1GT8A 5GAGI 4EZ6A 1BLUA 3DRSA 3OTDA 2EG1A 2MJNA 4F25A 4ATNA 5AE2A 3CDWA 4M8LA 1IJFB 3CD5A 4RW7A 1LK5A 3VAGA 4YMEA 1QAIA 2CKWA 3M30B 3H5UA 4AXIA 5CA5A 1YG0A 2B6AB 4I6AA 3HP6A 2HVZA 5KFLA 1TFWA 1SJ1A 3OFFA 4X66F 1T94A 3MPVA 3D0GE 2B51A 5FJ4A 1DARA 1VQSA 2DGSA 2ILYA 4E0DA 2VQEF 1I1GA 1S6PB 3KNGA 3OW2R 1LFWA 2LDYA 3DC2A 1HI8A 3V4IA 3CCLS 4FNHA 3NP5A 1RYRA 5KFJA 1N5VA 2E5HA 2LU2A 1K1QA 2COLA 2O01C 3QLHB 4QIWD 3G6YA 1LOUA 2NS1B 4Y3CA 4J9RA 2ZUGA 3I0SB 3P49B 4PPZA 5GAEI 5CCMA 1FRIA 2EK6A 2F8EX 2DGXA 4DG1B 4OZLA 3DGPA 2LA6A 4O4GA 4YQWA 1XR7A 1U09A 3HDSA 3HVWA 1SI9A 1PC4A 4KB7A 3PX6A 1XK8A 4WK3A 3SSQA 5LXRA 3DM2B 1U7LA 3I96A 3GB0A 2L9DA 4Y28C 3BSNA 4DV1F 5HBMA 3CC7S 1KC8T 1SV5B 1WACA 3T3FA 2GIQA 1SUQB 4B3SF 1TQLA 3EUNA 3VF0B 5HL7Q 4EUVA 3JSMA 3KFWX 2DCUB 3DRYA 3L7OA 1UVJA 1JLEA 1FXRA 3K7RA 2YNGA 3IRXA 2DH7A 2R7XA 3DLEB 1T02A 3C6UA 3EXCX 3G8SA 3AJ2A 5F8GA 3D2WA 2IM3A 3WC2A 3RBDA 4IOCQ 3J7YU 4JUZA 5KFVA 2ZDOA 3CDBA 4JV1A 1JB0C 1KQGB 2ZZNA 1QM9A 4C11A 2ZC3A 1X5SA 1X9SA 1AXQA 1L3TA 1VQ5S 4JI4F 4NL5A 3LGMA 2MHNA 2POKA 1MMNA 3R5CA 2VONA 3W2VB 2GV1A 1X4AA 1UVMA 2JEJA 3GE9A 4DL0C 2DHGA 4G6VB 3TR5A 2XSJA 3M2VB 2CPEA 3EGZA 3F73A 2PO4A 4ZCLA 4TY8A 3NCRA 2JZ5A 3OSNA 2X1FA 4IG3B 4RNHA 2CVEA 5EGYA 2J9DA 2W4DA 4QOTA 1IBKF 1RGVA 4ID5A 2LA4A 2VPWB 4ZOSA 3NKYA 1HYSB 3IG1B 4MFBA 2A2DA 3DN9A 1NO8A 2MKJA 2JEIA 4CQ1A 4Y2CA 3SYZA 1OQ3A 1KONA 4ZCMA 4ED6A 1N54B 4Q7AA 1TKZB 2WB4A 3CE8A 3T1YF 5D3GA 4B3OB 4N5SA 2BM0A 2ZITA 2FJWA 3NNAA 3TUJC 1F5AA 1RTJA 3UFCX 5D4NA 1JJ2R 3UDCA 1U47A 1RT3A 2GMJA 4RW8A 4UY85 1M5OC 2E66A 1BQMB 5F41A 3PX0A 2F8HA 2E29A 1HNIA 1QY7A 4F3QA 3ENQA 1XN9A 1VBYA 4O4RA 2N7CA 4WFXA 5DM7Q 3DCAA 4IQXA 1JLQB 2AYEA 1GX5A 1XMQF 3QWUA 1BC6A 4M1KA 2CJ9A 3S01A 3W3SA 3R5BA 3RR7A 4LF4F 4X4RA 5KG5A 2SXLA 3Q0AA 1NK5A 2IJNA 3CMES 1R43A 1SL2A 1ZTWA 3Q24A 1I94F 5KFGA 1C0TB 4F3MA 4QWBA 5FDLA 2ZBCA 2Y1JA 2NREA 3H5YA 1VQ6S 4DL4A 2MHEA 4LQ9A 1U1LA 1WEYA 2K7JA 4FS1A 4UW2A 4WTYA 3W2WB 4NLXA 3PHEA 1RP5A 1S1WA 1B0TA 3GR1A 1HFEL 5AXLA 2K1RA 3X1LB 1YWXA 4TU9A 2XULA 3KKFA 4ZCKA 3T1HF 3AY0A 3M8PB 5C24A 2CPFA 4FN5A 3MCSA 5D8HB 2ZFHA 1FKOB 2ZNZA 4ZMMA 1RT5A 4AXJA 1KTVA 2FHKA 4ES2A 2F40A 1LXJA 3FNNA 3DLKA 4CO4A 1S0VA 2M0GB 2BBEA 2JOQA 3KOAA 3NAHA 2W9BB 3PW5A 1N6QB 2V4RA 2NR0A 2Q6BA 4LT6A 4J9NA 2BVZA 2CG4A 3SQGB 2XMVA 4I56A 4R25A 2VBWA 2M8HA 4IFVA 2GNKA 1O5JA 3B4MA 4Q2LA 5IXUA 1X4HA 3RB4A 4DV3F 1P1TA 1U24A 4DDFA 4IQMA 1Y3JA 3AAWB 4EEYA 1URRA 2ASYA 4QWCA 1FTCA 2EFPA 4NCAA 2FVRA 2KO1A 5D4OA 4D3HA 3CVKA 2ZKTA 4C8KA 1TVRB 4RW6A 4ZA1A 1S4FA 1S99A 1HHTP 4EBEA 5J2QA 3TA2A 4QW9A 1M5PC 3EYZA 4DL2A 3E01B 3UE2A 4DQIA 4RX6A 4LJMA 4ECYA 4PPDA 3DOLB 5J2MB 2ZZMA 5IWAF 3ZZ0A 1GXTA 3MFHA 1O51A 1S6OA 2BXJA 1XEZA 2MXYA 5F8IA 4URQU 5HN0A 1HD0A 2O3DA 1TAQA 5B0AA 1X4GA 3V6HA 2FC9A 1RJJA 3CJKB 2IJFA 3ZFVA 1VQ8S 1R7IA 1ZBTA 2VA3A 2GO8A 1OWXA 3BQ2A 2IYIA 1U6BA 3TAMB 4EBDA 3M30A 4DFPA 4OJ1A 4U9RA 4KHRA 1C4CA 4Q0BA 4RU9A 1TKXB 4LQ3A 3ZZYA 3Q2SC 3PM9A 3DLGB 1WTFA 4K4TA 3CCMS 4NCBA 4I0WA 3RBEA 3O3LA 3MM8A 1JWWA 2FJEB 2HFNA 3SCKE 2R2UA 2BR0A 1HWUA 1RA7A 3OHBA 3KMQA 5KFZA 4YFUA 3DLHA 3QLHA 2IVFB 1PGZA 2XLJA 2NPIA 3I0SA 3FFIB 4ECRA 4DQPA 2K8GA 4QU6A 1KFDA