5AXMA

Crystal structure of thg1 like protein (tlp) with trna(phe)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
213
Chain Sequence
TREIYAEMRCIPPVVLRADGRNFKNTLSGLGFEKPYDKTFARAMADTAELFIKKSGLSPLFAYTFSDEISFLFTDLPFDGRVEKIDSVVASFLGSALTIKLRLEEPIAFDSRLVALQKEEIPEYFHRRQLEAWRNFVASWGYYALRNMGRNEAAKYLKRKKESEIHEMLFERGINLATLPSWQRRGVIISKRKITQNWEIPKFKSPFLEKLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Template-dependent nucleotide addition in the reverse (3'-5') direction by Thg1-like protein
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Transferase/rna
molecule keywords tRNA(His)-5'-guanylyltransferase (Thg1) like protein
total genus 61
structure length 213
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5axmA00
3OTEA 5AXLA 3OTBA 5AXNA 3WC2A 3OTDA 3OTCA 5AXKA 4KGMA 4KGKA 5AXMA 3WBZA 3WC0A
chains in the Genus database with same CATH superfamily
1EX8A 1X4FA 4DXLA 1PO6A 2P6TA 1MWYA 2BW7A 2WRMA 4RWXA 1FDDA 1BQXA 1R0CB 1FKAF 3ONQA 1E6YB 3ILLA 3MMBB 3MPUB 4I2QB 5T7LB 4CQ1A 1F5AA 4DF4A 4PWDB 1GTHA 1LWFA 1CG2A 1F3FA 1QJHA 2DO4A 3ILJA 3PFOA 4GO5X 3I31A 2JC1A 3FBBA 3BN4A 1WC0A 4G65A 4PG5A 4BC9A 2W24A 3L95X 4DL0C 4DN0A 3DGVA 2W8LA 3O6QA 4F3OA 1URNA 3OQ2A 4OHXA 4LFAJ 3H5XA 1GFWB 3MM6A 4RNNA 3T5KA 3OTBA 2IAJB 3Q86A 1UFLA 2K3IA 2VPWB 3V81B 3AOCA 2HWHA 2MZJA 2JEFA 1FRXA 1S72S 4A4JA 3C6UA 3DLKA 5LXYA 2PD1A 1UVMA 3QRQA 4JI8F 1OY8A 2QEXS 4ELTA 2FY8A 2FZGB 2CQDA 3E51A 1VQ9S 3GFYA 4WP9A 2L9NA 1S1UB 1RSCA 5HQ8A 2X1AA 3H5SA 5I3UA 5D4PA 2ZWOA 1SH0A 2DNPA 2QA4S 1REVA 4FF1A 2DNQA 1IR0A 4I69A 1K47A 2ALYB 3C16B 4DFPA 4N41A 1W26A 1EP4A 2XG8A 1RTZA 4DSKA 2WONB 2YX7A 3FEZA 5DQHA 2XS7A 4R8UB 1IUJA 5DG9A 4UOHA 1QVGR 2HEKA 5CCLA 3OPKA 1I94F 2XEXA 4IOBA 4DG1B 2AIRB 3W62A 3W2VA 3KLFB 3BGRB 5HO4A 1XMBA 2CQ2A 4LRCA 3OFHA 2I6WA 1HYSB 1XK8A 2H5IB 2KL8A 2XCAA 1P1TA 1TL4A 2BEFA 3GJQB 1RBLA 2FHJD 3AOBA 2HFZA 4UZBA 1RAOA 2D9PA 2CDRB 4NA3A 5LJ5Y 2UUAF 3C15B 4USUA 4O3OA 4C0BA 5DGAA 2QZ8A 3ZC4A 1L3SA 4JV1A 2AEFA 3D68A 1AROP 2CRLA 3FZ2A 3KG1A 4K8RA 3UVJB 2LEPA 6FDRA 3WBZA 4OI6A 3KK3B 4B3MF 4LR8A 4F8RA 3B4MA 3N9UC 3QFWA 2AJFE 2ZBQA 3IRXB 4ECUA 3D6TB 1OO0B 1FKPB 2SXLA 1SBRA 2XY5A 3PNIA 4NRUA 1P9YA 2E5HA 3KUEA 3CCZA 3PHTA 2VD3A 4B9SA 4M95A 3JXOA 2GO8A 3A3PB 3RGIA 1U0HA 2J6TA 1LWEB 3CCUS 4J9PA 2ZM6J 3V4IA 2MTLA 3TAMA 1FD8A 2AJ4A 2FPHX 2EFVA 3ZO7A 4JI7F 3W60A 2DGTA 4GC6A 1HFEL 4N8OA 4CM0A 2XMKA 3RB6A 1RZMA 2N82B 1R3NA 2OSRA 1UKUA 2W2QP 4KPYA 5HL7Q 2W9CB 1V3RA 2R2SA 2RS2A 3AD9C 2CQPA 1EARA 1JLAA 2KRBA 4NCGB 1GNKA 3BO4A 2AEMA 3CCES 2L48A 1RTHB 2XC9A 3PKMA 3EXYA 1O51A 4NLQA 4YS2A 3NL0A 4QU7A 5GMEA 3E01B 3R5DA 4LSZB 1JLQB 1KTQA 1R0AA 2LLZA 2CJ9A 2P9GA 3ZZYA 5EWEA 1X5PA 2KM8C 4WE1B 3MM5B 4P75A 3QT5A 1RT7A 4LRDA 2Z0GA 4JB8B 4DQSA 4I6AA 1Q16B 3R5GA 4HH0A 2JH3A 1KQFB 4HT7A 3OXFA 3GILA 3PW2A 2B6AB 3NLCA 3NKYA 3OXGA 2DHAA 1MSWD 3NGRA 3DI6A 4OHWA 3PRVA 5H9FK 1LNQA 4ATNA 2HZVA 2ILYA 3F56A 3SXLA 1OMSA 2W4DA 2E5LF 3OFEA 2NZ4A 2N4CA 3CCWA 2W9AA 1XQIA 3BV8A 3J7A1 2AWZA 1XEZA 3PEHA 7AT1B 4FYDA 1DQAA 1R0BG 5HVHA 2HFUA 2X51A 3CJSA 2DGXA 5CD4A 2DGQA 2MZRA 3BGFA 4QOTA 3LQVA 3KFWX 1HNZJ 3NWGA 4LFBJ 1SXLA 4OZNA 4RNHA 3K89A 3CSKA 4ECWA 3HHLB 3PW0A 3BPSP 1K73T 2WBRA 2KHCA 1F5BA 1T9YA 4LSNB 1UW9A 3KJQB 1CLFA 3H40A 3FJ2A 1NU4A 3C2PA 5I3UB 2G1HA 2HRUA 2WHOA 4L76A 4WTYA 1Q53A 3I82A 3UNYA 2NXJA 4LF1A 2WW8A 4C3MA 5IWAF 1UP1A 2RE1A 3JTOA 3HSDA 4KKOB 4ZA1A 8ATCB 4FBUA 1EQ0A 1U1LA 4R0JA 1NRKA 4USIA 1N32F 3DXBA 3C14A 4WFBQ 4Z7YA 2C2RA 4DR7F 2RQKA 5CABA 2XWXA 1Y00A 2DNZA 2DGVA 4Q2MA 1S10A 3KOAA 3GYGA 2GO9A 4ZMMA 5IQQA 1FD2A 2GFFA 3MGJA 4DS4A 2MSSA 3VGUA 1M0SA 4F0HA 4K2JA 4CNYA 3GMGA 3NAIA 1BC6A 1IR1A 4NL5A 5E3QA 3H0PA 4C4WA 3M9NB 4ED7A 2BMBA 4ICLB 2KZZA 1HNZF 4WPAA 2E1AA 3US5A 2PSZA 4ZVRB 3KLHB 4PXCA 2J6UA 4N7TA 2UVRA 2HHXA 4OYWA 1N5TA 2V4JA 4BC7A 3BS9A 1HNXJ 1RAIB 1SKUB 3AQPA 4U8YA 2ZOMA 2CQ0A 3GSIA 4FZVA 3OVSA 3MR3A 5KT5A 1KOHA 2OD6A 3T5JA 3PW7A 3DMJB 3TEHB 4QPXA 2V2ZA 2YX4A 3CJ3A 4ANCA 3WIUA 3SMZA 5HQLA 3EGWB 1MMNA 4IKAA 4DPUA 4F4AA 2ZH4A 3LP2A 4Q45A 1ZAWA 2BE2B 3TYTA 2JLGA 1BQNA 2DO0A 2FIUA 3Q2SC 2HS0A 1SQEA 3SCIE 5HQMA 5GAEU 2J9CA 3HHDA 3ITHB 2AD9A 3MOJB 1JNZB 4LR9A 1RBAA 1RABB 4C98A 3I5CA 1S0VA 2IM0A 5CD4H 2EFGA 3FC9A 1EETB 3VTIA 3LWMA 4AE5A 1M5SA 4DV0F 1T94A 2YQ3A 4O0IA 3HCXA 4DR3F 2Y0BB 2MLZA 3DOKA 3W5YA 4B3SF 3LALA 2EFQA 1SQFA 1CBKA 1TKZB 3QATA 3UCUP 5E7OB 4CT9A 4C8LA 3MOZA 3OLBA 2OHDA 2DCLA 3QWUA 4NPOA 3MURP 4DL6A 1TMMA 4ES1A 3VV2B 1C0UB 1FNOA 4N77A 1JJHA 2X1FA 2QYGA 4BBYA 2A0FB 4DV5F 3ISNC 3MM9A 1BWVA 5E3AA 1SL0A 1SJ1A 1HI8A 4ALZA 3W63A 3FK4A 4IR9A 2MQOA 3TI0A 2BKPA 4AT1B 5FIIA 3J80U 1UPMB 3PIOQ 5B08A 5FDLA 3EM1A 3EZUA 1OYDA 4AYBD 5J1NA 1CJVB 3EDQB 2LECA 4QWAA 1NK4A 1MW7A 2DBBA 2F40A 3QLHB 2GV1A 1RTIB 3GCWP 2LCWA 3DGPA 3SBMA 2HAIA 2WB1D 4PG7A 3RRHA 5HROB 4CYUB 3Q8RB 1CSJA 1X9WA 2J76E 2OELA 4YR0A 4CO1A 2OJ3A 3UE2A 4ZP7A 4ECQA 5DZ6A 1CJUA 4ED6A 4OZ3A 1X31C 2DNNA 4KFBA 1NCLA 3PG9A 5HP1A 1GXLA 2NXUA 4ED4A 1I6JA 2R7UA 3R1LA 2AGPA 1UFKA 2FHOB 2WBMA 2AP6A 2MKJA 2Y0SD 3I87A 4P6QA 1FNXH 2KT3A 1X9SA 3I4PA 4I6WA 4CO0A 2M9KA 2V94A 2QA1A 1WELA 4L73A 1C4CA 4USVA 4DMZA 2HBRB 1SIZA 1VLYA 1ZOTA 2RUGA 2FGOA 3BR9A 4U8VA 5E33A 2UUCF 1SUQB 1KDNA 5E3RA 2QTWA 1G2EA 3LANA 2XLJA 2IIHA 1VJWA 1X4EA 3GIJA 1Q86T 3MEKA 3LPYA 4M1KA 1CJTA 1M5HA 4J90A 4A46A 1FKPA 3T5HA 1N34J 1I94J 5L1IA 1B0PA 2DK2A 1S7IA 2FQQB 4JI4F 1T9WA 2YQ1A 1GXTA 4GVBB 4CLLA 4JV2A 1IKVB 3I6PA 1LWEA 1JMTA 2BKOA 3AA8A 3ZFVA 4EZ9A 3SDEA 1RWVB 3KJVA 1KQKA 4P2XA 3X3UA 4UF4A 3CEDA 5J2PB 2XO7A 3M8WA 3GJTB 4TNOA 2OMOA 5LSOA 1MWZA 2GGPB 4LIWA 2VC1A 1NXIA 4RNOA 2XMVA 2R7SA 1HQUA 2R8JA 3MR5A 2GIRA 1BXNA 3Q24A 2P5VA 1VQPS 3VGSA 1HLWA 1N54B 3U1MA 1VK3A 3NGKA 5IC6B 2ZH5A 2AYMA 2OIHA 3P96A 2E1MC 1SVDA 5C42B 4ECXA 1YJ9S 3A12A 4DFMA 5DLFA 1VMBA 3RB4A 3PO4A 1UVNA 4Z37A 3VAGA 4K5RA 5T14A 5ITHA 3BO3A 1FX4A 1T8EA 3MM7B 2FUG9 1JLFB 1JLQA 2K2PA 4Y6IA 1VQ4S 4A8XA 1X60A 1XR6A 3AA9A 1LWCA 2XNQA 3DI6B 4R8UA 4FVMA 2VU5A 3Q0AA 3V6HA 4B9MA 1DAXA 3UN3A 4ZS6A 4LF7J 4D3HA 1F6TA 2QJ3A 1DTTA 5DRKA 1UTAA 2WSCC 4DCJB 5C2CA 3I56S 1IWAA 4PYAA 2YTCA 3AB4B 3G8QA 3HVTA 4I4BA 2PMZD 5GADU 1R8PA 2D3UA 4PCQA 4DSFA 3TQ1A 4WFAQ 3RAQA 2DPJA 2HFOA 1N33F 5AXKA 3HF5A 5KFOA 4QJVA 3EUNA 3CJ4A 2ZJRQ 2QSWA 4PWUA 5KG5A 1UVJA 4X65J 4U95A 4DV4F 1CULB 4RW6A 2VICA 4MFBA 2GAGC 2HVDA 3IR6B 4TU8A 2V9WA 2MY7A 3BKUA 2MZ1A 4OI2A 2YWFA 5CYMB 3UNGC 1HARA 1A9NB 4ECVA 4FVCA 3BF4A 2NYHA 8RUCA 4OHYA 1RHJB 3MEDB 2FLNA 4QU6A 2M2BA 1WKJA 2Y3YA 4RW4A 3EPGA 4DUZF 2N3LA 3N0VA 5B0GA 5IT4A 4TQSA 2ZH1A 3CMAS 2R2TA 4LF7F 2ZKUA 2DHGA 4IDKA 4ZVTB 3VAIA 2JC0A 2Q66A 4EMDA 5M2PA 2M5YA 5A8WB 2WSEC 3E3XA 2UUTA 4LRAA 3D9BA 4H4OA 4O4GB 3ICLA 4UOFA 4V19X 4F26A 2Q6CA 3D66A 1WEZA 3OTOJ 3BR8A 3TARA 1YZ6A 4FF4A 1C0TB 4HI1A 2W2OP 2NUHA 2ABYA 3ZTPA 2GW8A 5HLFA 2V2QA 5J2MB 3SV4A 1B3TA 4F2SA 3SFGA 1FF2A 3PYDA 3CW2C 2E29A 5DZ7A 1I5OB 1X7VA 3IFEA 5I42A 1KOOA 2FC9A 2Z2MA 4KHMA 1DRZA 2V69A 3MI7X 3TX0A 2C3UA 4ELUA 1Q8IA 4NOHA 3PJWA 2XMUA 5KFLA 5EWFA 3BSOA 4YDDB 1VIOA 4L3NA 3J7YI 2HVZA 1YWXA 2WOMA 1NSPA 4LF4F 1VQMS 2NSCA 2FJAB 1WACA 2IPOB 4EZ6A 1ZS6A 3DLEB 2LQ9A 3V6DB 4JI5J 1NJIT 1MWQA 3MXHP 2OMLA 1NJYA 3M32A 4AL5A 3D3BJ 3PTWA 4USMA 2DNOA 2Z57B 5ETNA 3B4DA 4GVLA 4KGVB 3AFGA 3M6UA 1TKXB 3OR2A 4YN3B 4ILMA 2KH9A 3D0IE 2DR6A 3OBIA 4BS2A 2VQEJ 2R7OA 1VQNS 2EPIA 1S1WA 3MEGB 4LF9J 4Q44A 4J5OA 1VQ7S 1TP7A 2M70A 3OT9A 4ZVSB 5JXSA 4X66F 4DCOB 2I8EA 2MQLA 5B0CA 5E0OA 2B5JB 2D7SA 2EBEA 2M52A 2XYHB 2Z2YB 1TL1A 1JLGA 2PEHA 3PYFA 1FO1A 2RHSB 4PXBA 1EHWA 5IC4B 4DR3J 3QJPA 3G96A 3NNAA 2VZ9A 2ZD1B 3M8PA 3MR6A 4DSLA 3MTKA 1F9FA 4ECSA 1NAQA 4B9LA 1EKSA 2QIFA 4F0KA 3P4UB 4KHPF 1F1BB 3G2XA 2Z2LA 1SKWA 4GKJJ 1KVKA 3EGNA 4MIAA 3FNNA 4RW8B 3PXGa 4DPWA 4K4TA 2XY6A 2Y9HA 2W1BA 1H0HB 2HHHF 1UJ6A 2IYIA 3IWXA 4PEOA 1U1QA 4A8WA 3KLHA 1L5UA 3A8EA 1NSAA 3AQOA 1RKIA 2G0IA 3DFEA 4DUTA 3G9CA 1ZPWX 2ZHOA 2DH7A 4NMLA 3CCJS 2EC2A 3MECB 4RL1A 3CCQS 4JBCA 2UU9J 4NLGA 4QWEA 1NEEA 2CJBA 1EKRA 1TL5A 2IM2A 3LA0A 3VHQA 4ZJLA 1WTBA 3UFCX 1UL3A 2FHJA 1KR4A 1U6FA 2A10A 4MMOA 4J9LA 3RR7A 3DM2B 2A6MA 3WHIA 2HVHA 2Z56B 4ZK7M 2XGPA 4F4XA 2VPXB 3QGIA 3M2VA 3NRBA 3P8BB 2G0JA 2YNFB 4CP5A 1RE1B 1X8DA 3EE3A 4RW4B 1WF0A 5F0UA 4CLTA 5CA5A 2RAQA 3KTQA 3NNHA 1PCAA 1BQMA 2HGNA 5F8NA 1L3TA 1YJUA 4KHPJ 1WC1A 3K2YA 3S6EA 2MGZB 1JXLA 2X1GA 4GKJF 2EK1A 1N32J 1WKLA 2IC3A 4C0OC 4PUOA 2CVEA 1CS4A 4LQ9A 1YLXA 2NUUG 4F02A 3AJ1A 1S4EA 3BZQA 2Y1IA 1QAJA 4N76A 4WU3A 2GNKA 4NZ7A 5D0RA 3WX4A 1HQUB 3T1HJ 1RLDA 3VF0B 1OQ6A 2Y8WA 2W25A 2UXDF 4IG0A 3QBCA 4OYBA 2HNYB 5K9FA 4YB6A 3MPVA 1SJQA 1U25A 1XNQJ 4B3SJ 2ZEJA 4JP8A 1MNEA 1UWBA 1ZTWA 1ZETA 5JUMA 2WVDA 3IBWA 1F60B 1RTDA 3MR7A 4MK8A 3ZTSA 1JLFA 1YZ7A 3SYZA 1SV5B 2BXJA 2MLYA 3DU5A 2LQ8A 3EDRB 2AGQA 1S9FA 3Q8VA 2GJ2A 3G8TA 2ROEA 3I96A 1IXKA 4L3KA 2DR7A 4DL3A 1U1MA 1P27B 2RQMA 2JEIA 2CPZA 4WU2A 1BHNA 2HHHJ 2NREA 3RZAA 4LJMA 3GIMA 1H2VZ 2YNIA 4M5KA 3G6YA 1LQ9A 2I38A 4OYAA 4RW6B 3R7SB 2B7BB 5KFJA 2AZ3A 3R7NB 3VALA 2MZSA 5KFSA 4EI2A 3T1HF 3CF5Q 3RJMB 1Y3JA 3QSYB 1N6QB 2DRBA 2YKNB 4JV5J 4AL6A 1N5YA 4NA2A 4NX9A 3KHRA 5LSLA 2GVDA 3CDAA 4ZP6A 4CTAA 4DUYF 3NMRA 3R2CJ 4QR1A 4YY3F 5K5MA 1U4BA 2QL5B 3IWNC 3GJSB 1YJVA 2MJNA 4HT5A 1HMVA 2E44A 3I0SB 3JTPA 3ZZTA 2YPZA 2AGOA 4CRJA 2ALZA 1XMOJ 3VAKA 4K4VA 3ENVA 4FS1A 3LTOA 4U7UK 4ITSA 5BR8J 4N56A 3CMQA 4MIWA 4OJ3A 5CQGA 4EWTA 1N52B 2GMHA 3RRGA 1FHTA 5J1EA 3L4BC 2X3GA 5A8WA 5D3GA 4FXDA 3W5XA 1K0TA 3DRSA 3QO9B 1IKXA 1RT5A 1TELA 4CLSA 2A1BA 3D0HE 4K2XA 3D3CJ 1CPZA 2G1DA 4NLPA 1JKHA 1XJWB 2ZHBA 2QV6A 3JAMU 2A6OA 4I7FA 3EJMA 4B3OB 5B0AA 4A8YA 4W98A 1S48A 4ED5A 5K8OA 5EN1A 1NMEB 1Y4ZB 3IAS9 3LPEA 4RJVA 4ZPAA 2CUYA 3RW7A 1QTNB 3K7RA 1L3UA 4FYVB 3CDBA 1IQTA 2RHQB 4OX8A 5I42B 1QAXA 4OI0A 4URSA 5JMNA 3OVAA 5E2QA 1YK9A 2RF2B 4A8QA 1VQ5S 4GKKF 2G13A 2LU1A 3BBFA 1N0UA 2JSXA 2KFZA 2VG6B 4NASA 1VQKS 1YSJA 4O3PA 2RILA 1KSPA 1DTQA 4KAIA 1N34F 2HQCA 1GK8A 1U0SA 2WCXA 1BQMB 3QGGA 1DQ9A 1AB8A 1NDKA 3TJ9A 4EU0A 3J7ZT 4OV6A 4LF4J 2HHUA 1ZM4A 4QIEA 2OFGX 1H7XA 2HFNA 3BJYA 3HJFA 5D4OA 4X2BA 3MHYA 5D4NA 2KT5A 3G6VA 4EGLA 2VKZG 2YKQA 4P73A 1WOSA 1KEKA 1SL1A 2DRDA 3BEGB 4Y00A 2UVUA 3QT6A 2AV5A 1S1WB 3MEGA 3CCVS 5DQGA 1VBZA 1AXQA 2OUGA 3NS7B 3RBZA 4CT8A 2MXYA 1Z4UA 1F9HA 5ETOA 4D3GA 3HT0A 5A6PA 1LW0A 2CNKB 4JI2J 1Y9OA 5C5JA 3CJKB 2FC8A 4P71A 2L9DA 5KFYA 3DLLQ 4F0MA 1RTJA 3Q23A 1WHXA 4U67Q 4LMZA 5KFVA 3OFGA 4ZP8A 2E1CA 1SCJB 1JNRB 1TV6B 1YRXA 2K7KA 1KONA 4DG1A 2ZC4A 2FYXA 1UVKA 4ZPBA 3CJTA 2H4WB 3O1LA 4ED8A 3GSDA 2WONA 1JK9B 2DY9A 1VQ8S 2ZVSA 3CJRA 3D1HA 2ZNZA 4K0KJ 2VC0A 2BV3A 2GA7A 5KT2A 3H20A 2K3KA 1DTTB 3ZZ0A 3IN5A 2FVSA 2EG2A 1G6BA 4DQPA 4DSIA 2HQGA 4AQYJ 2RRAA 1TZ0A 2KN4A 2M8HA 2QE5A 4B3MJ 4DV1F 2P9CA 2OH2A 5BYRA 2J8AA 4DL2A 1G3OA 5J2MA 2KRRA 4WK3A 1RAGB 3NS6A 4U96A 4PG8A 4DLGA 5D0EA 3VZIA 3GIIA 1WKKA 3CDUA 2R7TA 4QPTA 1IVZA 2YQ0A 3NCRA 1WG5A 1R89A 1RT6A 2R4FA 1TKTA 4OYZA 3SQGB 2HHWA 4YHHJ 4DX7A 4RKUC 5B0BA 3MPYA 2ZJQQ 3MM6B 4O23A 2YNHA 2B56A 1FRLA 1KFSA 1HWLA 4RUAA 1YJTA 4OYPA 1NLKL 1TTHB 1PJ7A 2R7QA 1YITS 4LUBA 2YNGB 3F73A 2LEBA 1TK5A 1W7WA 1IBLJ 3PRDA 2OPRA 1E6YA 2LMIA 3I55S 3CPWR 2KHDA 2B51A 2OI2A 3ZTRA 1XWLA 4DDFA 1SC3B 1XBWA 2W7AA 5L39A 2VG7A 8AT1B 4K4YA 3PX6A 4ZKAA 2UUBF 2YXLA 1HW8A 3DRYA 3POTA 1S5ZA 1PC4A 1ZAVA 2C3PA 1ZPVA 3EZOA 3HKZD 4RO0A 4AQYF 4FBTA 2FJDB 2E5GA 2HHPA 4TU7A 3RTVA 1OY6A 2VUGA 4U7UD 3PFEA 3HT3A 4NEYA 2C3YA 3A4TA 2VOPA 2F1FA 5KFCA 1KP6A 2OPQA 3BM7A 2KG1A 4NZ0A 2BOAA 3W8GA 4UOGA 4B3TF 3DMJA 1RT4B 1TFYA 1MU2A 3ET6B 3G82B 5I4MA 3KDNA 4IG3B 4DQQA 2ZWPA 2HK2A 4KGXB 4HKQA 3BH6B 4ID5B 5IV3A 3LF0A 2AKWB 1WORA 3DRPB 3VZHA 4DV1J 4G1QA 3G6ES 3NEKA 1FERA 1QE1A 1X5SA 5THWA 3UI3A 4ZLPA 2ZOGA 3M8RA 1D8ZA 1I51B 1FFSB 1DY3A 2DXEA 2AEJA 4RX6A 2DEIA 5KFXA 1GQEA 4FYWB 2ZBPA 3RR8A 4DL5A 2E5JA 5ETSA 3HHLD 1PAEX 2GX8A 1FDNA 4Q43A 3KLVA 1LV5A 1H3DA 1RHKB 5DO2A 3R5BA 2HGMA 1HR0F 5B7WA 4CTAB 1F2HA 1VJQA 1F3VA 1KVJA 2MY8A 3A8IA 2AU0A 2FVCA 2GVZB 4WF9Q 1VRUB 3MF5A 3ETMA 2DNYA 4I56A 4K59A 4OYXA 3M1VA 2C28A 1U45A 4DOZA 1Q8BA 4QWBA 1T9XA 1SH2A 2CZVC 3EX7B 5HMWA 2EWHA 3FSXA 2IFXA 3H2LA 2IA6A 1YJWS 2DD8S 3K17A 4X64J 2PN6A 2CG8A 1K1SA 5A0YA 3BREA 1UJ4A 4P7VA 1WG4A 2BBEA 3DOMA 1FXDA 1R0AB 2JX2A 1IKYB 4P74A 5CHCB 4UZCA 3M8YA 2EXUA 1R8AA 1S1XB 2KJWA 3D5MA 4K5SA 4F3MA 4URGA 5F8LA 2L08A 5C7PA 3UPFA 1V5VA 2JL9A 5EHHA 5DJBA 3MCNA 4ECYA 3GR1A 3MD3A 5AE3A 1QY7A 4DEZA 2XMJA 3N5FA 3DXSX 3R6LB 4JOUA 4C97A 3HD1A 4RUHA 4DR1J 5LL6d 3W8PA 4LT6A 4OLOA 5CH7B 5E3PA 4X4PA 4DWIA 2HHQA 5KFEA 2YX1A 3KJNB 2OP5A 2VFVA 3K5MA 2ASLA 2HNDA 1UA1A 3GE9A 1VOMA 2CXEA 1TKDA 5KT3A 2H4YB 5EX0A 1UETA 4P9SA 3L09A 5GAHI 3PR4A 4DV7J 1WJ9A 2B0GA 3H8YA 3PDNA 4PXEA 2ZH8A 2XI2A 3OHBA 1U02A 4Y2IA 3UD3P 2AQ4A 2XMMA 5C2GA 3HJVA 4DV0J 3TJAA 1VHFA 3GIRA 3CDWA 2G0CA 3MEEB 1S57A 5H9EJ 1JIHA 2NZCA 2D3O1 4OHZA 1BGXT 3PX0A 2GC8A 1IKWB 3I0RB 3JQJA 1YDLA 4HHHA 4I6YA 1HNVB 1HBNA 3VGTA 1IJFB 2QMWA 3RBXA 1S97A 4LR7A 4MK7A 2DIUA 4RZRA 1SI9A 2HRTA 2PI5A 4URQU 2LQJA 4A8FA 3I9ZA 2J0XA 1HQEA 3GU0A 4K4UA 2DGWA 2HNZA 3PW4A 1NZ8A 3KJFB 2JOQA 4GKKJ 2WVCA 1VBKA 4CLKA 4MH8A 5GAEI 3AD8C 4DV7F 2DT9A 3NG8A 4LF8F 1LW0B 4JI1J 5C25A 4QYRA 2CDQA 2C2KB 2RH3A 2V6AA 1H2TZ 4USKA 1LFWA 4UTGA 3TZWA 3DGPB 3N4WA 3FSIA 1DZ5A 2FB0A 1Z2LA 2HNYA 4PAAA 1H38A 1XNQF 2J7KA 3PJXA 2CPIA 2V2KA 4FN5A 3VAJA 3QRPA 3GONA 2UXCF 1NJWA 2BJEA 3J7YU 3HZEA 1JX4A 3IWLA 3HHEA 3KG4A 1A6LA 4KFBB 1NHKL 3IR7B 5D4LA 5JVHQ 3EWGA 2MKYA 1R8CA 3HVTB 1S1VB 2QMUB 4Q8EA 5HVGA 1SPBP 1JKHB 4E0DA 1FA0A 4J9KA 4DSJA 3BSNA 1PBUA 1C1CA 3AJ2A 1RWNB 2BYCA 3N6MA 3WQPA 1XNRF 4KB7A 1X5OA 3MZIA 2YWWA 4OZJA 1LEOA 4DPOA 1RT6B 3FSYA 1T9TA 5AE2A 5KFFA 5BR8F 2CNNB 5CYQB 1ZBTA 4QW9A 4J37A 5KFNA 4DX5A 3C6TB 2PFFB 4A8MP 1LFPA 4ED2A 1FTRA 1PSDA 4EBDA 1U26A 4KSEB 1GX6A 2YWKA 2YNGA 4BWMA 3CMES 3KK3A 4TU9A 4ZLJA 3TUJC 2JZ5A 3M8ZA 3TA1A 1RGVA 3D54A 5M2RA 4K0KF 2X3DA 2DGOA 4I68A 1KQGB 3BGLA 3CVKA 2O66A 4HACB 5IXUA 4DL7A 3MCSA 4KIAA 2R2RA 2VQFF 2EI5A 4BCAA 1PGZA 1KNZA 2E9RX 1DFDA 3JQKA 4IQXA 3T19A 2HFVA 3TOQA 2QSFA 2QMXA 2VONA 3G71S 1Y5NB 3UN2A 2UUBJ 4ILRA 2BW2A 2AJ2A 3S1TA 1XNRJ 2KTQA 3AY0A 1WEXA 2EFOA 5KG7A 3BYPA 5HROA 2EW9A 4QIWD 2BDPA 2RKIB 1QSSA 2P9EA 3I9V9 4ZJQA 1MG7A 2BJ8A 2VH7A 3R5JB 4G6VB 4KHRA 4O3RA 2W2PP 2XI3A 2NQPA 3LP1A 2ZE2A 3ZNUA 3Q22A 1ZZNA 1HA1A 5KG0A 4ID5A 1S7HA 2B8PA 3P5BP 2ACYA 2Y1JA 3L7OA 2LA6A 1S77D 1E6VA 4HH1A 3G82A 5D15A 3PJ9A 2FDNA 4IFYA 1NSKL 2QGFB 3DLGB 4LRFA 4RBTA 3CCLS 1D9FA 3QFHA 1WUUA 2IVFB 4EEYA 4X4VA 4KT0C 4QIFA 3X1LB 4DHVA 1TK8A 3CTRA 4F04B 1LK7A 1RT7B 4CIOA 2J9DA 3R5CA 3ZZOA 4C11A 1V9OA 3OXLA 4DUZJ 1HBNB 1T05A 2DRAA 2D1CA 1JLCB 4DFKA 4DU7A 2C3OA 1D3WA 2E5IA 5T41A 2DXFA 2C2MB 2V9KA 3T3FA 1HBMA 4QW8A 2YKPA 3BSCA 2GZOA 4LBPA 4CLZA 5I3QA 1T11A 4IR1A 2IJRA 3VVUA 1KLMA 3KNGA 2UXBF 3HVAA 2AJQA 3EXCX 3HXMA 3AXMA 3C3LA 3CD6S 2CPXA 1H98A 2MKCA 1SQGA 1NPRA 1BUXA 4WFNQ 3Q89A 3OVBA 1WD6A 1JLGB 1RCXB 1RWWB 2DTJA 2G2ZA 3GZ7A 4FKYA 4NI2B 2QX0A 4PWWA 4Q7AA 5A76A 4CH1A 2CPFA 4GVBA 2XSJA 1IBKJ 2VASA 4WCEQ 3Q8YA 1TV6A 5MAOA 4LQ3A 2BJ9A 3DKDA 3K58A 4JYAF 2E5LJ 3KG0A 2KXNB 3CCSS 2R8GA 4A8OA 4OZ2A 1I1GA 1J5EJ 3FCHA 5AJ3F 2HLUA 5E5NA 5KFBA 1HHQA 2F63A 2MQPA 3HO1A 3C15A 3T5LA 3KHGA 5HANA 4EFAC 2PEBA 5AXLA 4DV5J 3A8KA 2CJYB 2MHEA 1XMQF 4IOAQ 2YH1A 1JLBA 2AMCB 3BSAA 3LO3A 4MTPA 1HI0P 4JI3F 3B8HA 4KY3A 3OL9A 2DVIA 1SJFA 4DR5J 4H4KA 4I1TA 3BB5A 3MPDA 4ETXA 4J9MA 2KVQE 1JLEA 5AT1B 1TKTB 4M5IA 3CD5A 2MLXA 2V67A 3CO0P 4ZVOB 1U0HB 4C8NA 3VQSA 2V2VA 2R42A 5HATA 4YDXA 5GMKa 2VDIA 2IBOA 3N5BA 4NZ6A 2H54B 3KLIB 2FGCA 1T03A 3M30A 4LF6F 4USHA 2G2OA 3QSIA 3PV8A 2CG4A 1U48A 1Y3KA 4QIGA 2GCFA 4NA1A 2BANA 1U1PA 1ZH5A 2GS8A 2JNJA 2OSQA 3C6UB 3HPOA 4B9VA 1GEHA 5GAGI 3ELHA 1QAYA 4JI4J 1B70B 3IG1B 3L9ZA 3KLGB 4F4ZA 4G1IA 2W2NP 3CD7A 4NE9C 4O44B 3ZZPA 4C8OA 4JV0A 1FVSA 2Q43A 3PHEA 2B4VA 4X4SA 2DNGA 4ANDA 1N5QA 3DLHA 4DFJA 1UZHA 3PO5A 2B9EA 1RT3A 1SC4B 1VGYA 4UQTA 5L38A 4M8LA 3OJSA 5HSPA 2UUCJ 1UCNA 3E01A 4P2MA 1X5TA 4PQAA 4A48A 3OSPA 3KDOA 1ULRA 2OPQB 3HFVA 4WE1A 2NCKL 4CZCA 1FXLA 1KRPA 3NAHA 4JV5F 3M7VA 3M9OB 3TUPA 1HNXF 1FJGF 3M8SA 3HHLC 2QO3A 3JSMA 4IDKB 3JYTB 2K1RB 2D3ZA 2CJQA 2FHKA 2DY1A 1QSYA 3UDLA 4MYTA 5G0RA 2M8DB 3KK1B 1RTIA 2E7WA 1AZSA 2YKMA 3KLFA 2ACMA 1FVQA 3FVYA 1SC1B 2XZTB 4OI1A 4OV1A 1AFJA 2D69A 2JEJA 4LSLB 4NWBA 3O5TB 2VBXA 2XYPB 5C24A 2DGSA 1Y7PA 9ATCB 2I5JA 5F8MA 1S6QB 5DDPC 5DDOC 3D1OA 5B0DA 5A2QU 3M2RA 4PZVA 4E8UA 1U2RA 1T3OA 2ZH7A 4JI6F 4XO0A 1T0TV 2CAJA 1R8HA 2ZBRA 5HBMA 5DQIA 3OJUA 2VJVA 4AL7A 4LVOP 2W9BB 4IOCQ 4FF2A 4I2PA 3GG0A 4CO2A 2R8HA 4PG4A 2EC0A 3DLKB 4M5GA 1XR7A 1TL7B 3M2UA 1S9GA 1WEYA 5DDRC 1APSA 1BE4A 1S6PA 3C14B 2XSJB 4WFZA 3K5LA 4CO5A 3Q8UA 3RAXA 4PWDA 2AZ1A 4ZLNA 2FVQA 3PIPQ 3KK2A 4J9VA 2A2CA 3V6JA 3MMCB 4J9OA 4QIVA 3HFKA 3RAMA 1SL2A 4KTQA 3CCTA 3FKBA 1VC6A 2VKRA 3K5NA 1N48A 2VBZA 4WXWA 5F8GA 4UY8T 2NR0A 3SDEB 3LW5C 2LXFA 5IM0A 2E1PA 3SFUA 4NXNF 4V19J 3P45B 2LXIA 1RHUB 1OPZA 1FK9A 3T9ZA 3ZNJ1 3HSJA 1F2GA 4HDHA 3J81U 2CQ4A 5HK4A 4WZMA 2M4MA 5HLFB 2VPYB 2J0QD 2BQRA 1Q81T 1X4DA 1N56A 4IRCA 3MUTP 1REVB 4C6AA 3BO2A 3T6BA 1FDAA 5F8HA 2VQFJ 3QGHA 4YEAA 2KG0A 3BQ2A 5HMYA 3UVJA 4PQUB 1RU1A 1RAHB 2OD4A 4WP8A 1FRJA 3JSYA 4R0EA 5IZHA 1N36J 2VA3A 2VFUA 1AFIA 2AHOB 4IFYB 4UT4A 2L3MA 2QT7A 2LKZA 3DHWC 2D9OA 4ED0A 1FCAA 1S0OA 3C46A 2E9ZA 2IY5B 2WOMB 1NDCA 3MMJA 1SB6A 2Z30B 2ZFHA 4EUVA 4TYAA 4B9TA 3FRZA 4IH7A 3RB3A 5IS2A 3CCRS 1OPIA 4NLOA 1P9QC 3PW5A 4PPDA 3CD0A 3FCVA 4MAKA 4WTOB 3QZ8A 2BQUA 3LP0A 2BZ2A 3ENWA 2I9SA 2YY3A 5CZVA 5BXIA 3TZXA 3CUNA 3H90A 4WJBA 4ZCKA 1ZZFA 4GC7A 4QR2A 2F4FA 3EGVA 3FFIB 3MMBA 5T7LA 2YWEA 3LWLA 1RAFB 2PIIA 3JAMY 2EK6A 2KO1A 4HI2A 1RISA 1H74A 1DLOA 2FLOA 3QIPB 1XMOF 2YVSA 2X7IA 4PYDA 4K4SA 3AODA 1M90T 2BACA 1EB0A 5LM7E 1RP5A 3THPA 2GHVC 3VAMA 1S1UA 2MQNA 3PM9A 3MAQA 1S4FA 2B5JA 4M5LA 2QLJB 4NLDA 2MPUA 5D78A 2RQ4A 4YMEA 4USWA 2MMYA 1PJ6A 3S01A 2K1RA 1NB7A 2R7XA 2V68A 1WC6A 2G2YA 3ULHA 4H4KC 4P7TA 4JI5F 1ITPA 4FNIA 3A1YG 1B7YB 1FRHA 3HVWA 5ETPA 1GMVA 4J9UE 2QL9B 3DCAA 4I0WA 4DLEA 2GIQA 4H54A 1NK9A 2XS5A 1RT2B 3FMBA 4HL9A 2JJ4D 2CNOB 3JS9A 4ZITA 5HN0A 1Z1ZA 3O2IA 1PYSB 2CQIA 3CIMA 3R9LA 1AUSL 1RAEB 3W9IA 3EYZA 2VIHA 4CM2A 2R2UA 4F4YA 3M2RB 2QFJA 4X4NA 4CLPA 1IM4A 3GFZA 5ETLA 1M5PC 1IQZA 1X4HA 1F5CA 4Y2AA 2OAUA 4X66J 1VQOS 1B99A 3ITHA 4OX6A 2VG6A 2IVMA 3IAM9 3IBFB 1M1HA 3H2UB 5KFHA 5DM6Q 1UVIA 1N33J 2JFDA 3C6TA 4GMKA 3J81Y 2YKAA 3DDKA 2Z4PA 3KLIA 1TL7A 3M2UB 2GAHC 4Y2KA 5KAKA 3GV8B 5KFWA 1RDRA 4KE5A 2BE9B 5KT6A 4KYZA 4NCAA 2OPSB 4OLPA 4JI0F 4LRBA 2QC3A 2ZM6F 1HR0J 3KJVB 1JLCA 2CA9A 2VV5A 3SI8A 1NK8A 5AXMA 4MKAA 3POTB 3CJQA 1DBDA 1YRTA 4M5MA 4C7QA 3BBCA 4ER8A 1UVLA 1TKZA 3IGVA 3Q8SB 1X4AA 1VQ6S 2VG5B 4FDFA 5F3TA 5KOXA 4L75A 5F8JA 2GMLA 2ZZTA 3R7BB 4OHVA 1DURA 4AFFA 4TQRA 3PZPA 3DRSB 4ES3A 3IS9A 4RWWA 2HAFA 4TY9A 5K14B 4PG6A 1YTYA 2HIYA 4RBUA 3GJRB 1AUDA 3CB4A 4NYPA 1NBEB 2VB6A 3GFHA 4OYMA 5KFPA 1RAAB 2M0GB 1K9MT 1MU2B 3ET6A 3QNWB 4DR6J 1UWAA 1SC6A 3IM8A 4IG0B 4O4RA 4NRTA 2E1RA 3N01A 1ZM3A 4KPCA 1RXOB 4RNMA 2BM1A 4WXOA 1KLNA 4LVNP 1HBOB 4TY8B 1VC0A 3GR0A 4XK8C 3THTA 1NDPA 3JQMA 4ES2A 4MK9A 5FLXU 2IRYA 1NK7A 2IYGA 1TL3A 4IFVB 4CO4A 3BBBA 1JXEA 1D1UA 4ZHRA 5FD1A 2B4OA 2V34A 4GO7X 1OJ4A 3B54A 3I32A 3UDVA 1EP4B 1EQMA 1NNDA 2MKHA 3MAAA 4F4WA 4ECTA 3DLBA 1OSDA 1EZZB 1YBAA 2RDDA 3QPIA 3F41A 1Y5IB 5KG4A 1WOOA 1RBOB 5ETVA 1JXVA 5L1KA 5B09A 2W7OA 2WTFA 1HIYA 2VHGA 4F50A 3L7PA 4Y2MA 5HP1B 5ETRA 3G6XA 1SIWB 3K8VA 4RU9A 1T9UA 3AD7C 2ASYA 1GXUA 4RW9A 1FE4A 3DRXA 5LJ3Y 3U1NA 2QA4G 1TR0A 3FFIA 3T9NA 2BR0A 3EGZA 2FY1A 1JLBB 5MLCV 1HD1A 2BUNA 4Y0FA 3BYRA 1HWKA 2ZBCA 1ZYQA 4MKBA 1I3OB 2BA9A 2L41A 1SKRA 4NXMF 3MPWA 3QGPA 1HWIA 5LMNJ 3ILOA 3MFIA 4O3QA 4AD6A 1S6PB 2G9OA 1NK0A 4TN2A 3ADAC 2W2MP 4W4MA 1CJTB 2UZAA 2ZH3A 4E98A 3TRGA 2MJUA 2AYBA 3DM2A 2B4UA 2J6SA 5DETA 1UPPA 1HKAA 1TU0B 1FJ7A 3HI9A 1NM2A 3R1HA 3AT1B 1NPPA 4TKTA 3W7BA 1FRMA 1NH8A 3MD1A 1QVFR 1NJXA 1W2IA 1WC5A 5EWGA 5E3CA 5IOLA 2P6SA 5U47A 4YFUA 4DV3J 1P8GA 4DJBA 4FPIA 4DPXA 3R5AA 3QO9A 5LMNF 5DLGA 3ILIA 3KLGA 2DNMA 1S6OA 1PJ5A 1N5YB 1DHMA 1RJJA 3DOLB 7FDRA 2FJEB 4OZ5A 3AXKA 2OTLS 4NXNJ 2F4VF 4NXMJ 3RBDA 3MAHA 2UUWA 1M1KT 4C9DA 1RHMB 1YBUA 4G1PA 5D8HB 2ZJPQ 2CYYA 5DGBA 1KD1T 3PRBA 2ASDA 4OX9F 5HMZA 2RNEA 4H4MB 3HMJG 2V4JB 5LMUJ 1GAOA 3LP2B 2V63A 1VFJA 3NCQA 4NLTA 1HI1A 5KTQA 4DZ6A 1JLEB 1SUQA 4DI6A 2UP1A 1QDUB 2KU7A 5D0GA 3Q8QB 4KV8A 2DXDA 2NPIA 4KRWA 2JEGA 5IV4A 3KK1A 3HM9A 2GHPA 3IMQJ 1HQ2A 2B8QA 2CZ9A 2CWXA 4LREA 4M5DB 2A2DA 2DR8A 4HHUA 2ZZMA 1S59A 4KJIA 5KG2A 5IT9Y 4LSLA 2VFRA 2A18A 3WC0A 4PRFA 1GMWD 4WWSA 4P10A 2BANB 3LP0B 3IBCB 5KFMA 2C22A 1BWEA 3FRYA 3QIPA 2KM8B 4ZPDA 4LF5J 3MEDA 2VFSA 1VCTA 4ZP9A 1A0OB 4ZLLA 2ATLA 2BQ3A 3NBPA 3FQLA 1HW9A 4S0MA 3UW1A 4M5HA 1CQNA 1FEEA 2MDAA 2PA3A 2MQQA 5J2NA 1GMWA 3DYAB 3TEGA 2E7VA 2GQCA 2IMOA 2GVDB 4PABA 1PAUB 3H4DA 1NKCA 2M7SA 5C42A 3A8JA 1Y11A 2H5JB 1HWUA 2ZD1A 4WIIA 3H25A 1J27A 3M6XA 1BLUA 2QN6B 1C4AA 4RW7A 3G86A 3GV7B 3HD2A 3AH6A 3UDCA 3TAQA 5F0WA 4QYZK 4PXDA 2XMTA 3JB9k 4NEZA 1NUEA 2E7XA 4YB1P 4WYWA 5J1EB 4ZVUB 2ZH6A 2DKOB 4YQWA 1QAIA 5I3PA 3H59A 4CLUA 1BY9A 4FPRA 2PGCA 4OX9J 3SSRA 3VCDA 4W92B 1U49A 4IO1A 1WDDA 4ZPVR 4OI4A 1C0TA 5A8KA 3FUYA 5H9FJ 1O5JA 3SIPB 4P52A 3KLEB 2HHTA 4HLBA 3ZXWA 2KKHA 4OI3A 4OL8A 3TVZA 1NB2A 4X4UA 3HULA 1PIEA 1X4CA 3BGOP 2XB2D 4B3RJ 4E2FB 1S6QA 4JI8J 1C1BB 5D77A 1YKWA 2A3JA 2IRUA 4F2RA 1VRTA 4EYHB 2HURA 3R27A 4AXJA 3I0RA 4EYIB 1CEZA 2LXUA 3P5TL 4FYXB 1VS3A 3FQKA 4QWCA 1D8YA 2J0WA 3SSSA 1P6TA 1Z2ZA 2XTJP 3DHXA 1CQMA 1TMJA 2MZQA 1IKVA 2W4PA 3H5UA 3K57A 3NMAA 1X0PA 3O44A 2ZBIA 2WB4A 3JTNA 2HIQA 2HMIB 4Q0BA 2QLFB 2DPIA 2P2CB 3ZZUA 1VBXA 3NP5A 2UXBJ 1MN7A 4NLXA 3I5AA 3UCGA 1WNEA 1XERA 1S0MA 4J91A 1WHVA 4LF8J 4ZVEA 3CC4S 4B9NA 3TANA 1GTEA 2BKNA 5B0FA 1GH8A 1PC5A 4DPYA 1K0VA 2O1PA 2BE7D 2KI2A 1LXJA 1BMQB 1A7GE 1YJ7A 2VBYA 2V8HA 3MM9B 5A8RA 3ZTQA 2Y8YA 1G1XA 4MKYA 1ZA2B 3GPAA 4DS5A 4X62J 3QIDA 4JI0J 4L72B 3IC1A 1U09A 3T1YF 4H4MA 1K8AT 4IG3A 5H1SV 3TVYA 2FTRA 1WHYA 3J7Z5 3R3TA 4ED1A 4OIXA 1UJ5A 3OFFA 4WK1A 2OEMA 3RYLA 3DRRA 3S8SA 4X4OA 1N4LA 3PKYA 4PQUA 1AW0A 1NKEA 3DRPA 3CIZA 2MHNA 3DDNA 4ZN1A 4WYLA 1FDBA 2IBKA 2HKEA 3W2VB 1Q7YT 4B17A 4KGKA 2UVWA 1KFDA 2HWIA 2E9TA 4X65F 1V3SA 4DR4J 2AX1A 1FJCA 3PCOB 2R8KA 1R7IA 1EAYC 2B7CB 3DLEA 1C1CB 2W7PA 3JSRA 3CXCR 2CQBA 2W01A 2YKNA 1U6ZA 2FVPA 4WKYA 3J81j 2W8KA 1VHIA 3M05A 2RU9A 4RW9B 5ADZA 5D6GA 5KFTA 3UD5A 3SQOP 3KUHA 4YP3A 2FJXA 3MCMA 5G4DA 4U7CA 3V81A 2HBQB 2HS4A 3UN5A 1R27B 2IDEA 3W3SA 4ZDNA 3D0GE 5J2NB 4YR2A 2OEJA 3K5OA 5KFQA 3Q8PB 4TLQA 3OW2R 2QLXA 3W9HA 5LT5A 2DITA 4MIBA 5K8PA 1UMJA 1URRA 4CWBA 2C2NA 2F8HA 2OPSA 4RR5A 3LAKA 1D0EA 5EDWA 1TUVA 1TK0A 2UU9F 3TAPA 2B9YA 1QLNA 3IA0A 3OLAA 4C8KA 4AXIA 2MQ8A 1WI8A 2IAJA 2ZUGA 3C66A 2J8SA 2UVVA 2H48B 3CJ5A 1NO8A 1OY9A 3GIKA 1ICEB 4ANEA 3H4BA 3OTEA 4HYKA 1D9DA 3FCWA 1M5OC 4IH5A 2IDLA 1YVFA 2W9CA 3A13A 3BGRA 2ZDOA 2QRRA 3QQCD 4XAKA 4YB5A 2HQIA 3IRWP 1S1VA 2DGUA 3V5RA 3DOLA 2N3OA 4J9QA 3H42A 4HDGA 4ECRA 4DV6F 1VLOA 3R8YA 2CPEA 4OJ1A 1W25A 2O67A 3GG1A 4A8KA 2BJ3A 3NGUA 3NGDA 4N8NA 1UEKA 3C16A 5KG1A 2DIVA 3MR2A 1JJCB 4EBEA 1FT8A 3ISND 3MUVP 2AJ0A 1U1KA 1IBLF 4DR4F 1LXNA 1XTZA 1VIXA 2IM1A 4OZ1A 2AX0A 2BM0A 1NPKA 5LOQA 1XIQA 2MKIA 1HPZA 3QZ7A 3OL8A 3KNAA 2DNHA 4DCPB 2FJVA 3H2VE 2KDOA 3UR3C 4ZIWA 2EKYA 2IRXA 4KV8B 3AB2B 2KFNA 4KR0B 1FKOB 3FBFA 1GX5A 5DS7A 2J0SD 1MMDA 2BJDA 3AAWB 1MN9A 3K8WA 3MM8B 2NXNA 2JHEA 2LQBA 4Y65A 4CNZA 1SJ4P 2EFPA 1Q0NA 2ZNYA 4N47A 5F3ZA 2BX6A 2Y1LB 1TKXA 1LWFB 4CLYA 2VG5A 4R5PB 5ETKA 4ZCMA 5GVQA 3HHLA 4W90B 1R6VA 3N6LA 2XBPA 1FTCA 1O6XA 3GWCA 4LSNA 3TA2A 4TVAB 4IUFA 1REGX 2RKIA 2BJ7A 2V0NA 1DJ0A 4FNHA 1X0FA 2FVRA 3H98A 1RTHA 2EKNA 4QQBA 4B02A 1H73A 2VPZB 4XDCA 2VOOA 4JYAJ 3I4HX 1YRUA 4NI2A 1RI7A 2J9DE 2OLWA 2O3DA 1OSCA 3SSQA 4DR2J 1Y10A 2D3OR 2WVBA 4RW7B 1FESA 1S79A 1S1TB 5CAAA 1VQLS 5G0RB 1F0XA 1EIYB 1LK5A 3QYYA 4QCLA 3MMAA 3A3OB 4Y34A 3OTDA 3THVA 2B6AA 4OMFG 3CO9A 3U02A 1MLAA 1RCOB 2C42A 2KXFA 3SEOA 4YY3J 2ZDPA 1VYAA 3C8YA 3TR5A 3ZZRA 3CC7S 3WZ0A 3N79A 2B9WA 3PR5B 1HBUA 1TVRA 2OGUA 3M8QA 3MFHA 1O0PA 4FS2A 3NOGA 3LP1B 2BOPA 2ROGA 3SQGA 2WW4A 3CNQP 2D41A 2PA8D 5HMXA 1RHQB 5CYQA 2PDAA 1UWBB 3D67A 1YIJS 2W9BA 2HRYA 1NK5A 2MSTA 1TUGB 4J9RA 4FXWA 5DG7A 4WFXA 2F65A 5EUHA 1RTDB 1BQNB 2Q1LA 1RK8A 1T3NA 4DQIA 1K44A 3P49B 2GQ2A 4HR2A 4ELVA 2N4DA 2UXCJ 3D4JA 1IJEB 1R6YA 3D1QA 4WKRA 1WDTA 4OFZA 2HFSA 3NNCA 4FXVA 4DV4J 2QL7B 1T03B 3CGIA 5J2PA 4ZVQB 3MEEA 3U27A 2ZHAA 4K4WA 2ZC3A 2L9WA 3FGVA 3NOCA 3M9MB 1N8RT 3HHNB 5FJ4A 3M6VA 3H5YA 4PUOB 2NLWA 1N0VC 3W61A 4ECZA 4HTIA 2ZKTA 2XO6A 3GTYX 3V4IB 4DX8H 2UUAJ 4C2MA 1S99A 4G3IA 3FZBA 3NCPA 5LMUF 2MGZA 2MQMA 4JI7J 3OUYB 2PC6A 3QAEA 5RUBA 1FXRA 2IC3B 4CLWA 3PX4A 2ZOFA 2XHWA 3UQSA 3GQCA 1YG0A 2JLFA 2I2YA 3LOUA 3LGMA 1UZDA 2B3TB 5F41A 3KMSA 1RQ0A 3I5BA 2XGQA 3MUMP 3HVRA 4DR1F 3HK2A 4CCHA 1U8SA 2DHSA 4RBVA 1G4CA 4CI0B 5KFDA 5B0EA 2RU3A 2U2FA 3CJ2A 2YWGA 1N5SA 4DPTA 2W4CA 3K59A 5L1LA 1G7CB 1RACB 3TA0A 4CH7A 2MEWA 4UQGA 1C2PA 1YQHA 2JVOA 2OPPA 3RU0A 4F36A 4DX6A 1JJ2R 1HPZB 2OTJS 4DUYJ 2RF2A 3TQEA 2OFHX 2HQFA 2CADA 5F9LA 1RYRA 3DU6A 3GFXA 1WTFA 2CNLB 4WP3A 5C24B 1S9EB 1UFWA 5KFZA 4QBUA 1Q7LB 4MFBB 1QUPA 3BKFA 4NYZA 4O3NA 2KYZA 5KFIA 3OV7A 2ERRA 2CJAA 2ASJA 3LAMA 1VBYA 1L3VA 2N7CA 1ZAXA 2CQHA 2XLIA 1KWMA 5KFAA 4J9SA 3M1VB 2BE2A 1S49A 3PYGA 2CQGA 3T6JA 9RUBA 4YOEA 3O8WA 4K50A 2DHXA 3AJDA 3ZTOA 2H65B 2U1AA 4DBQA 1RWXB 1JJ4A 2ZH2A 4LFBF 2M88A 3GYNA 1LW2B 3NBPB 2KXHA 3R6GB 1QSLA 1VK8A 3KK2B 1S76D 1RUSA 1CC7A 1RTJB 3EVMA 3BDEA 2XCPA 1RLCL 2JVRA 4DZDA 4N5SA 2HHVA 2OO4A 3OL7A 2RMLA 2MKSA 3I0SA 1IBMJ 1R31A 2G4BA 2QLBB 3V6KA 4HACA 2KT2A 3IXQA 3QMQA 1SJRA 4IO9Q 2XLKA 1QUVA 2LP4A 3MMAB 3UR0A 2E66A 3BN7A 4CYUA 3K0JA 1IR2A 4ENOA 5AXNA 4XTTA 1U1RA 2F3JA 2HZAA 4XPCA 2C2OB 2HS3A 2IJNA 4OJHA 4DF8A 3S7RA 1RT4A 2PMWA 2V4QA 3CC2S 4F4KA 1JWWA 1NHUA 2FZCB 2POKA 2NPFA 5IM0B 2V8VA 3NXZA 1IKXB 1RT5B 4NMXA 1J5EF 5A6WA 2LVWA 1CJVA 2DCUB 1FWLA 1ROFA 3KHHA 5ETTA 2CPYA 1Q95G 3UDEA 1WF1A 2CPDA 2LYVA 1SH3A 2EG1A 1U1OA 1KS2A 5L46A 4M5JA 2XMWA 1HHTP 1Q8KA 2CWKA 1V3ZA 4RPFA 2MB0B 5KFRA 2CQ1A 2F7VA 5HI7A 4O3SA 6AT1B 4OYOA 3VGVA 3OSNA 1T9VA 1LWCB 3VVTA 1NHVA 2EVZA 2CZ4A 2IM3A 3J7AN 4WFYA 2HSEB 5J2QA 4DR5F 3W9JA 3R2DJ 5EX3A 1V6HA 1FX2A 1NDLA 2F8EX 3QAUA 4KO0B 1WF2A 3RBEA 1SV5A 3M32B 1GMUA 2CJXB 1CJKB 3MM8A 3DOKB 1Y0HA 3N28A 5K8NA 4X4QA 3HSGA 2RQCA 2RS8A 4U9RA 4ZOSA 1FWKA 1FKOA 1Q79A 2LDYA 3HLUA 2DEJA 2QYCA 1EETA 3NS5A 4F25A 4Z2XA 1UW4A 3CULA 1OWXA 2YNIB 1C0UA 3IS9B 4HVZA 4O44A 4P2FA 4OZ0A 5BYSA 4M63A 2ZVIA 1RU2A 2NSBA 3N6NA 5F8IA 1KQSR 1ZM9A 1XN9A 3OD2A 5DDQC 1OIAA 2QFIA 4V1Ak 5KOWA 2RUSA 5A0YB 3GV5B 2PI4A 2KZMA 1U24A 2D74B 4C8MA 2DB1A 2H5EA 3IO1A 5CXTA 1FK9B 2WVFA 4HHJA 2B4PA 2ZZNA 2ADBA 4QYZJ 1HMVB 2Q79A 2BRKA 2WVEA 1J5OB 4IRKA 2F8MA 2H9ZA 4XPEA 2VG7B 2LFVA 3QLHA 3G4SS 5L1JA 3TX8A 4WIQA 4LF6J 1DARA 2O01C 3OL6A 2YPYA 1QM9A 5D0HA 3JYTA 3HP6A 1H7WA 3P6YC 4ID8A 1WC3A 3Q83A 3IM9A 2UXDJ 2WZ1A 2X1BA 3QJJA 1FEHA 1P1LA 3CWJA 1RWKB 3KXDA 3TP2A 3D2WA 4EBCA 1X9MA 4I67A 3TNVA 3QT8A 1TUWA 5JVGQ 2F9DA 1HBUB 1CJUB 1TVRB 2PE8A 3M8QB 3W2WA 4FKXA 5IWAJ 2HNDB 4DV2F 4LFCJ 1R8BA 1RWUA 3MM7A 2ZITA 4FYYB 4XDDA 2XSFA 4OZLA 2F9JA 4IQMA 2BVZA 4NYOA 5HJXA 4G1QB 4EO8A 3DNCA 1UEUA 3PY8A 3IGNA 4CLFA 4CO3A 1X4BA 2H51B 2VL1A 2KB2A 3VWSA 1FJGJ 1LOUA 4IYQA 2GJFA 2Q3PA 2FLPA 1HHSA 2EFNA 2J7WA 3B6BA 1S0NA 2IVYA 1IKWA 3GB0A 5IFMA 4QR0A 4PR6A 1DTQB 1AYEA 3D28A 3LUYA 1NJZA 1UAWA 2AW0A 2XY7A 5ETQA 4C8ZA 1NKBA 5KFKA 4K4ZA 1S6UA 2VQEF 3OUYA 3RG6A 1PG5B 1HL6A 2VFTA 2GGPA 3D6FB 1RA6A 1ZA1B 5LXRA 1T7PA 5L9XA 4F7VA 5SZTA 1KVIA 1RADB 2J7UA 3V2UC 4ZCIA 2MYFA 3SZ2A 2XS2A 2Y1RI 2I0XA 1FRIA 3KWMA 2GHWA 4DR6F 4UY85 4P2SA 2RSQA 2C1EB 3W65A 3WC2A 4USJC 3MTJA 2XYGB 3LGNA 1WG1A 5FLXY 2Z8QA 1NSQA 1RT3B 1KTVA 2OPPB 2EBGA 4NLRA 3DLGA 2XZWA 1HWJA 4OX7A 4KQZA 4TYBA 5CZXA 5HAOA 3SCKE 4ETZA 2GQQA 2YH0A 5IT9U 2RJZA 4CDIA 2HG4A 5KT7A 5F9NA 4FP9A 4KC5A 4ZJOA 4M5DA 3J80Y 2DR5A 3E2EA 4KO0A 4LFCF 4BWJA 3UCZP 3ETOA 3HSZA 2BRLA 3VR1A 1QTMA 2WK4A 3NY0A 3DC2A 3MAAB 5A2QY 1K1QA 1HYSA 1XR5A 4A8SA 1N36F 2HWTA 4I2QA 4LBIA 5DG8A 4JI1F 2GJIA 3D6HB 2BJ1A 4UUWA 1H6KX 2B43A 4NLVA 1S9EA 4OYIA 3VQTA 3ISZA 6FD1A 1SJ3P 4JUZA 2R9LA 3BQ0A 4X4TA 3SCLE 1CULA 1WSVA 1YJRA 1YGYA 1GT8A 2LEAA 2GVZA 4WBFA 1AA1B 1VRUA 5JJBA 4R5PA 2UV8G 5L8RC 1FWPA 2R7VA 3DYAA 3TW0A 1ACMB 2IA0A 2WSFC 1FFWB 4B08A 1SKSA 3HKWA 2C3MA 3M2VB 2KFYA 1KHWA 5K14A 4DL4A 1RT1B 2Z2ZA 1PYTA 3D7SB 2IHR1 1ZTTA 1RAJA 1HNVA 2V50A 5C25B 2R3VA 2FHMA 2AYEA 2YBVA 4PPZA 1Q82T 3F44A 1S9GB 2CJKA 4BDPA 4F67A 2VF3A 1RB0A 2VDHA 3DOMB 2HW3A 1IKYA 1IN0A 2RT3A 3WX8A 3TWZA 4JI2F 3IP0A 2CVIA 3OR2B 1WOPA 2AF6A 1B0VA 1Q78A 2V8PA 4I7FB 4KH0B 4KGMA 3L3CA 3KHLA 4I64A 1FRKA 2CFXA 3FMWA 5GAGU 1BD6A 2K7JA 2DR9A 1KHVA 4RUCA 2XULA 1S12A 3DN9A 2B9XA 3A3NB 1X4GA 4M5NA 3QWPA 4NLUA 3U7JA 4C0HA 1XC9A 4ILLA 1JQGA 3HX9A 2NXCA 4NLWA 2MKKA 2HQ3A 4Q2LA 2F5GA 2CPHA 4OJGA 1UEVA 4C3KA 1WHWA 3MECA 2DNRA 1VISA 2VODA 1T95A 3ENAA 1O8BA 3OR1A 2FLLA 3KYLA 1KN6A 2K06A 1IM6A 2RB7A 4IRDA 5SUHA 2R7WA 3H7HB 4ZHRB 3P3DA 1F9EB 3TO8A 3VAFA 4RW8A 2YKOA 4EO6A 5GMDA 3TUZC 1JB0C 1HD0A 1OYEA 1ELOA 3CJ0A 2I1RA 2JRSA 5KG3A 4ZPWR 3W5ZA 5J2QB 2HZCA 2DH8A 3M6WA 3T1YJ 4C11B 3NGSA 2KVIA 1T05B 4PKDB 2CIMA 2HK3A 1PKUA 1N88A 2RD5C 4ZN3A 4YHHF 1RKJA 1WI6A 2LQ5A 1TAQA 2ADCA 4AUKA 2JLEA 3PVXA 2HBZB 4P72A 2JDJA 3WDOA 2XMAA 2J9EA 3TZZA 3V6DA 1HQEB 2FD2A 3AOAA 1Q1KA 2CQCA 2HNZB 2QG9B 1M5KC 1B64A 1M5VC 2HPUA 1U8WA 1WSRA 3V4MA 2UV8A 1U7LA 2FZKB 5A8RB 2APOA 2P8IA 1B0TA 3F0NA 4KBIA 3TZYA 1YBTA 1RWMB 4M94A 1PILA 1J5OA 2HLTA 3OTCA 5CYMA 1WWHA 4B3RF 1TL1B 2AT1B 3PYEA 3W66A 2KYXA 4C48A 4C8YA 1UA0A 2J5AA 4DR7J 3QRRA 3JSMB 1YI2S 2ILZA 3M8PB 1FJEB 3B78A 1HBOA 2YWHA 1Q5YA 3BH7B 4QZVB 4TY8A 4TLRA 4FF3A 5K8MA 3BKTA 4HEA9 2HHSA 1TL3B 4IFVA 3RRKA 1LWXA 4ERDA 2C2EA 3KUGA 4Q8FA 5CCMA 2M3DA 3MCOA 2GMJA 2V4RA 3EZ5A 3BQ1A 1NK6A 1KC8T 4NLYA 3W1YC 4O0NA 4RLEA 5KG6A 3ZZZA 4H4OB 2H1YA 3HDSA 4O4GA 2XM3A 4LF9F 1HNWF 1MMLA 1YX2A 3IR5B 2XNRA 1TQLA 1HNIA 2DHHA 1C1BA 1VQYA 4NCBA 4C3LA 1RT2A 2XWYA 4Y28C 1HBMB 2YNHB 3HZGA 4YUDA 4I2PB 2JWNA 3W2WB 1RWOB 3IRXA 2KJVA 1EJ7L 2LA4A 3KKFA 4K4XA 2Z58B 2DJWA 3M30B 1IWGA 2VJUA 5AJ3J 1FNMA 3C19A 5LSRA 2CKWA 2H3EB 1DQ8A 1RT1A 1RWPB 3DDIA 2ATCB 2COLA 4ZVFA 5K20B 1U2FA 1YHQS 2V8GA 2AYGA 1J2VA 1LW2A 3O3LA 1MROB 4X62F 2HMIA 4Q0BB 3FBEA 2RRBA 4KKOA 2O5DA 4UUXA 4ZVHA 2NS1B 1U2CA 2RIJA 1L3KA 1VI7A 3FBCA 2DH9A 3IG1A 5BJRA 3QT7A 5GADI 4J9NA 1FE0A 1WC4A 4KGZB 4ZCLA 1U6BA 3NGTA 4ED3A 3RB0A 4JI3J 4DV2J 3KMQA 2LU2A 1IBMF 5IT0A 4LF2A 2Q6BA 4B9UA 2K8GA 3HHKA 3TAMB 1VQSA 1FI4A 1KLMB 3U1LA 4Q5VA 4LBHA 3BDPA 1CVJA 2HGLA 1HNWJ 3PACA 2R8IA 1R43A 1CS4B 3TVKA 4ICLA 1Q8LA 1H2UX 2QA2A 4LIRA 2HVEA 4UW2A 4WZQA 1NH7A 2V5HG 3GLJA 4RUBA 1KBRA 1OS5A 5EGYA 1CC8A 5HJYA 3HFZB 2XHCA 1VRQC 3L7UA 3BPDA 5GAHU 3OTOF 4DSEA 1PYOB 4USTA 3DRRB 5A8KB 3KLEA 4BHQA 3RW6A 2HBYB 3NWRA 3Q2TC 2HQDA 4CH0S 1LKZA 5E41A 2ZUAA 1QE1B 3K5PA 3FEYB 5ETMA 4Z7CA 3MWBA 3LGHA 1D9AA 1N5VA 3T41A 1OQ3A 5IQ6A 2HVIA 3MM5A 1NZAA 1TAUA 3WIVA 1E6VB 4OQJA 4X64F 1B7FA 2C2ZB 3GP9A 2YKMB 3E8OA 4DV3F 1FFGB 1RYSA 3CDEA 2WAQD 3FEXB 4DN9A 4DR2F 5H9EK 2JFKA 4NLSA 3OHAA 2XQCA 3G8SA 1YJNS 1CJKA 3RUBL 5HBMB 3R97A 4UOCA 3SV3A 1M1GA 1B4SA 2PMHA 5J1PA 4KH1B 2NYIA 1TFWA 2CQ3A 2LDIA 4MJKA 2I5JB 2F4VJ 1QD1A 4BLGA 1ZM2A 2IMWP 1DLOB 4F3QA 3CJ8A 4JI6J 4J7CA 4L6V3 2DNKA 3EVOA 3W64A 4RU2A 3DLJA 1RHRB 4X4RA 3T1AA 1VRTB 2PO4A 4MYUA 4HTJA 2EEYA 1KKHA 2V8DA 4L74A 2ZH9A 1N6QA 3JSBA 2RRNA 3MDFA 3UWTA 3EMTA 4Y2CA 2PT0A 2PFDA 1VDHA 2C2DA 4LF5F 5KT4A 4MKVA 1W2BR 1VC5A 1IBCB 3EICA 5FDLB 5AE1A 7FD1A 5L9NA 3UD4P 3QJLA 1D09B 3CCMS 2OPRB 5CYJA 1U47A 1IBKF 2YNFA 3UO0A 2XZDB 2OKQA 1S1XA 2HYIB 2VA2A 1S1TA 3TUIC 3MMCA 5D3GB 4U6PA 1T02A 4ZPTR 4K7QA 5M2UA 3BGUA 4RNFA 1U1NA 5DM7Q 4A47A 1Y5LB 2OEKA 2VBWA 3LH2S 4GRSA 1AT1B 3GCXP 4X84A 3AHPA 1VR6A 3PEJA 4YR3A 3VAHA 3CJKA 4DQRA 2RVJA 3B82A 4B3TJ 2GIFA 4YB7A 4ZIVA 2ROPA 5HVFA 3FDSA 3G87A 5KFUA 2FJWA 2IJFA 2CPJA 1HNIB 1H72C 2QLWA 4ZPCA 4XIUA 1RA7A 2DNLA 4LFAF 1JLAB 4NCGA 3CE8A 3CT9A 3D6MB 4R25A 2MZTA 1XMQJ 3OR1B 3ENQA 4B3OA 2RDIA 4EK2A 4DV6J 2N7YA 4MT1A 5BYQA 2ZE2B 2DYAA 1PBAA 2AJ1A 2DISA 2FJBB 4IH6A 4TXSA 4Y3CA 4ZVPB 1Q4RA 4QWDA 3EPIA 4ZVGA 3SCJE 3EVWA 1Q5VA 2NXEA 5KFGA 2BABA 3TJ8A 2R7RA 3M4XA 1V5IB 1AZSB 1MROA 4DU8A 3GYXB 2RDJA
chains in the Genus database with same CATH topology
1X4FA 1PO6A 2P6TA 1MWYA 4RWXA 2WRMA 1FDDA 1BQXA 1FKAF 3ONQA 1E6YB 4I2QB 3MMBB 5T7LB 4DF4A 4CQ1A 4PWDB 1F5AA 1GTHA 1LWFA 1CG2A 1QJHA 2DO4A 3PFOA 4GO5X 4PG5A 3I31A 2JC1A 4BC9A 3BN4A 4X65F 3G9CA 4DL0C 2W24A 3L95X 4DN0A 4F3OA 2W8LA 3O6QA 1URNA 3OQ2A 4OHXA 3H5XA 4RNNA 3MM6A 3T5KA 3OTBA 2IAJB 3V81B 1UFLA 2K3IA 2VPWB 2HWHA 2MZJA 2JEFA 1FRXA 1S72S 4A4JA 3C6UA 3DLKA 5LXYA 2PD1A 4JI8F 2QEXS 4ELTA 2CQDA 3E51A 1VQ9S 3GFYA 2L9NA 1S1UB 2X1AA 5HQ8A 5I3UA 3H5SA 5D4PA 1SH0A 2DNPA 2QA4S 1REVA 4FF1A 2DNQA 1IR0A 4I69A 4N41A 4DFPA 1EP4A 2XG8A 4DSKA 2WONB 2YX7A 3FEZA 5DQHA 2XS7A 4R8UB 1IUJA 5DG9A 5CCLA 3OPKA 1I94F 2XEXA 4IOBA 4DG1B 3KLFB 3W2VA 4DV6F 3BGRB 5HO4A 1XMBA 2CQ2A 3OFHA 1HYSB 1XK8A 2XCAA 1P1TA 1TL4A 2FHJD 2HFZA 2D9PA 4NA3A 5LJ5Y 2UUAF 4O3OA 4C0BA 1L3SA 5DGAA 4JV1A 2QZ8A 3ZC4A 3KG1A 1AROP 2CRLA 3FZ2A 1JX4A 4B3MF 2LEPA 6FDRA 3WBZA 4OI6A 3KK3B 4F8RA 3B4MA 3N9UC 2AJFE 3IRXB 4ECUA 1OO0B 1FKPB 2SXLA 1SBRA 2XY5A 3PNIA 4NRUA 2E5HA 3CCZA 4B9SA 2VD3A 4M95A 2GO8A 1LWEB 3CCUS 4J9PA 3V4IA 3TAMA 1FD8A 2AJ4A 2FPHX 2EFVA 4JI7F 2DGTA 4GC6A 1HFEL 4N8OA 2XMKA 3RB6A 2N82B 1R3NA 2OSRA 1UKUA 4KPYA 5HL7Q 2W9CB 1V3RA 2R2SA 2RS2A 2CQPA 1JLAA 4NCGB 2KRBA 1GNKA 3BO4A 3CCES 2L48A 1RTHB 2XC9A 3PKMA 3EXYA 1O51A 4NLQA 3NL0A 4QU7A 3E01B 3R5DA 1R0AA 1JLQB 1KTQA 2LLZA 2CJ9A 2P9GA 3ZZYA 5EWEA 1X5PA 2KM8C 4WE1B 3MM5B 1RT7A 2Z0GA 4DQSA 4I6AA 1Q16B 4HH0A 2JH3A 1KQFB 4HT7A 3OXFA 3GILA 3PW2A 2B6AB 3NLCA 3NKYA 3OXGA 2DHAA 1MSWD 3DI6A 4OHWA 4ATNA 2ILYA 3F56A 3SXLA 2E5LF 2W4DA 2NZ4A 3OFEA 2N4CA 3CCWA 2W9AA 3J7A1 2AWZA 1XEZA 3PEHA 4FYDA 1DQAA 2X51A 2DGXA 2DGQA 2MZRA 3BGFA 4QOTA 3LQVA 3KFWX 3NWGA 1SXLA 4OZNA 4RNHA 3CSKA 4ECWA 3HHLB 3PW0A 1K73T 2WBRA 2KHCA 1F5BA 4LSNB 1CLFA 3H40A 3FJ2A 1NU4A 3C2PA 5I3UB 4WTYA 2HRUA 2WHOA 1Q53A 3I82A 4C3MA 5IWAF 2WW8A 1HHTP 1UP1A 2RE1A 3JTOA 4KKOB 4ZA1A 4FBUA 1U1LA 4R0JA 1NRKA 4USIA 1N32F 3DXBA 4WFBQ 2C2RA 4DR7F 2RQKA 2XWXA 1Y00A 2DNZA 2DGVA 4Q2MA 1S10A 3KOAA 2GO9A 4ZMMA 5IQQA 1FD2A 2GFFA 3MGJA 4DS4A 2MSSA 1M0SA 4CNYA 3GMGA 3NAIA 1BC6A 4NL5A 5E3QA 4C4WA 3M9NB 4ED7A 4ICLB 2KZZA 1HNZF 3US5A 2E1AA 2PSZA 3KLHB 4PXCA 2J6UA 2UVRA 2HHXA 1N5TA 2V4JA 4BC7A 3BS9A 3AQPA 2ZOMA 2CQ0A 4FZVA 3OVSA 3MR3A 5KT5A 1KOHA 2OD6A 3T5JA 3PW7A 3DMJB 4QPXA 2YX4A 3CJ3A 2ZH4A 3SMZA 3EGWB 1MMNA 4IKAA 3LP2A 4Q45A 1ZAWA 2BE2B 3TYTA 2JLGA 1BQNA 2DO0A 2FIUA 3Q2SC 2HS0A 1SQEA 3SCIE 5GAEU 2J9CA 3HHDA 3ITHB 2AD9A 3MOJB 1JNZB 4C98A 3I5CA 1S0VA 2IM0A 5CD4H 2EFGA 1EETB 3VTIA 3LWMA 4AE5A 1M5SA 4DV0F 1T94A 2YQ3A 4O0IA 4DR3F 3DOKA 4B3SF 3LALA 2EFQA 1TKZB 3UCUP 5E7OB 4CT9A 4C8LA 3MOZA 3OLBA 2DCLA 3QWUA 4NPOA 3MURP 4DL6A 4BDPA 4ES1A 2X1FA 1C0UB 1FNOA 4N77A 1JJHA 4BBYA 4DV5F 3ISNC 3MM9A 5E3AA 1SL0A 1SJ1A 1HI8A 4ALZA 4IR9A 2MQOA 3TI0A 5FIIA 3PIOQ 5B08A 5FDLA 3EZUA 4AYBD 5J1NA 2LECA 4QWAA 1NK4A 1MW7A 2DBBA 2F40A 3QLHB 2GV1A 1RTIB 2LCWA 3DGPA 3RRHA 2HAIA 2WB1D 4PG7A 1X9WA 5HROB 3Q8RB 1CSJA 2J76E 4YR0A 4CO1A 2OJ3A 3UE2A 4ZP7A 4ECQA 4ED6A 2DNNA 4KFBA 5HP1A 1GXLA 2NXUA 1I6JA 2R7UA 3R1LA 2AGPA 4P6QA 2FHOB 2WBMA 2AP6A 2MKJA 2Y0SD 3I87A 1FNXH 2KT3A 1X9SA 3I4PA 4I6WA 4CO0A 2M9KA 2V94A 2QA1A 1WELA 1C4CA 4DMZA 1SIZA 1VLYA 1ZOTA 2RUGA 2FGOA 3BR9A 5E33A 2UUCF 1SUQB 5E3RA 1G2EA 3LANA 2XLJA 1VJWA 1X4EA 3GIJA 1Q86T 3MEKA 3LPYA 4M1KA 4A46A 1M5HA 1FKPA 3T5HA 5L1IA 1B0PA 2DK2A 4JI4F 1GXTA 4JV2A 1IKVB 3I6PA 1LWEA 1JMTA 3AA8A 3ZFVA 4EZ9A 3SDEA 3KJVA 1KQKA 3X3UA 5J2PB 3CEDA 2XO7A 1N5YA 4TNOA 2OMOA 5LSOA 1MWZA 2GGPB 4LIWA 2VC1A 4RNOA 2J6TA 2XMVA 2R7SA 1HQUA 2R8JA 3MR5A 2GIRA 1VQPS 3Q24A 2P5VA 2ZH5A 1N54B 3U1MA 1VK3A 3NGKA 2OIHA 2AYMA 3P96A 2E1MC 5C42B 4ECXA 1YJ9S 4DFMA 5DLFA 1VMBA 3RB4A 3PO4A 1UVNA 4Z37A 3VAGA 4K5RA 5T14A 5ITHA 3BO3A 1T8EA 3MM7B 2FUG9 1JLFB 1JLQA 2K2PA 4Y6IA 1VQ4S 4A8XA 1XR6A 3AA9A 1LWCA 2XNQA 3DI6B 4R8UA 4FVMA 3Q0AA 3V6HA 4B9MA 1DAXA 4ZS6A 4D3HA 1DTTA 5DRKA 3I56S 2WSCC 2YTCA 3AB4B 3G8QA 3HVTA 4I4BA 2PMZD 5GADU 1R8PA 2D3UA 4PCQA 4DSFA 3TQ1A 4WFAQ 3RAQA 2DPJA 2HFOA 1N33F 5AXKA 3HF5A 5KFOA 4QJVA 3EUNA 3CJ4A 2ZJRQ 2QSWA 4PWUA 5KG5A 1UVJA 4DV4F 4RW6A 4MFBA 3IR6B 4TU8A 2V9WA 2MY7A 2MZ1A 4OI2A 2YWFA 5CYMB 3UNGC 1HARA 1A9NB 4ECVA 4FVCA 3BF4A 4OHYA 3MEDB 2FLNA 4QU6A 2M2BA 4RW4A 3EPGA 4DUZF 2N3LA 3N0VA 5B0GA 5IT4A 4TQSA 2ZH1A 3CMAS 2R2TA 2ZKUA 2DHGA 4IDKA 3VAIA 2JC0A 2Q66A 5M2PA 2M5YA 5A8WB 2WSEC 3E3XA 2UUTA 4V19X 4H4OA 4O4GB 3ICLA 4F26A 2Q6CA 1WEZA 3BR8A 3TARA 4FF4A 1C0TB 4HI1A 2NUHA 2ABYA 4F2SA 2GW8A 5HLFA 5J2MB 3SV4A 3SFGA 1FF2A 2E29A 5I42A 3IFEA 1X7VA 1DRZA 1KOOA 2FC9A 2Z2MA 4KHMA 3MI7X 2C3UA 4ELUA 1Q8IA 4NOHA 3PJWA 2XMUA 5KFLA 5EWFA 3BSOA 4YDDB 1VIOA 4L3NA 3J7YI 2HVZA 1YWXA 2WOMA 4LF4F 1VQMS 2NSCA 2FJAB 1WACA 4EZ6A 3DLEB 2LQ9A 3V6DB 1NJIT 3MXHP 2OMLA 1NJYA 3M32A 4AL5A 2DNOA 3B4DA 3M6UA 1TKXB 3OR2A 4ILMA 2KH9A 3D0IE 4BS2A 3OBIA 2R7OA 1VQNS 2EPIA 1S1WA 3MEGB 4Q44A 4J5OA 1VQ7S 1TP7A 2M70A 5JXSA 4X66F 2I8EA 2MQLA 5B0CA 5E0OA 2B5JB 2D7SA 2EBEA 2M52A 1TL1A 1JLGA 2PEHA 4PXBA 1FO1A 3QJPA 3G96A 3NNAA 2VZ9A 2ZD1B 3M8PA 3MR6A 4DSLA 3MTKA 1F9FA 4ECSA 1NAQA 4B9LA 2QIFA 4KHPF 2Z2LA 1SKWA 4MIAA 3EGNA 3FNNA 4RW8B 3PXGa 4K4TA 2XY6A 1H0HB 1UJ6A 2IYIA 3IWXA 1U1QA 4A8WA 3KLHA 1L5UA 3A8EA 3AQOA 1RKIA 3DFEA 1ZPWX 2ZHOA 2DH7A 4NMLA 3CCJS 3CCQS 3MECB 4NLGA 4JBCA 4QWEA 1NEEA 2CJBA 2IM2A 1TL5A 1WTBA 3UFCX 1UL3A 2FHJA 1KR4A 1U6FA 2A10A 4MMOA 4J9LA 3DM2B 2HVHA 4ZK7M 2XGPA 4F4XA 2VPXB 3QGIA 3M2VA 3NRBA 2YNFB 1X8DA 4RW4B 1WF0A 5F0UA 5CA5A 3KTQA 3NNHA 2HGNA 1BQMA 5F8NA 1L3TA 1YJUA 3K2YA 3S6EA 2MGZB 1JXLA 2X1GA 4GKJF 2EK1A 2IC3A 4C0OC 4PUOA 2CVEA 4LQ9A 2NUUG 4F02A 3AJ1A 3BZQA 2Y1IA 1QAJA 4N76A 4WU3A 2GNKA 4NZ7A 3WX4A 1HQUB 3VF0B 1OQ6A 2W25A 2UXDF 4IG0A 2HNYB 5K9FA 4YB6A 3MPVA 1SJQA 1U25A 1MNEA 1UWBA 1ZTWA 1ZETA 5JUMA 3IBWA 1F60B 1RTDA 4MK8A 1JLFA 1X0FA 3SYZA 1SV5B 2BXJA 2AGQA 3DU5A 1S9FA 2GJ2A 3G8TA 2ROEA 3I96A 1IXKA 2DR7A 4DL3A 1U1MA 1P27B 2RQMA 2JEIA 2CPZA 4WU2A 2NREA 3RZAA 4LJMA 3GIMA 1H2VZ 2YNIA 3G6YA 1LQ9A 2I38A 4RW6B 5KFJA 2B7BB 3VALA 2MZSA 5KFSA 3T1HF 3CF5Q 2DRBA 1Y3JA 1N6QB 2YKNB 4AL6A 4NA2A 4NX9A 3KHRA 5LSLA 3CDAA 4ZP6A 4DUYF 4CTAA 3NMRA 4QR1A 4YY3F 5K5MA 1U4BA 3IWNC 1YJVA 2MJNA 4HT5A 1HMVA 2E44A 3I0SB 3JTPA 3ZZTA 2AGOA 4K4VA 2ALZA 3VAKA 3ENVA 4FS1A 4U7UK 4ITSA 4N56A 4MIWA 4OJ3A 5CQGA 4EWTA 1N52B 2GMHA 3RRGA 1FHTA 5J1EA 5A8WA 2X3GA 5D3GA 4FXDA 1K0TA 3DRSA 3QO9B 1IKXA 1RT5A 2A1BA 3D0HE 4K2XA 1CPZA 2G1DA 4NLPA 1JKHA 2ZHBA 2QV6A 4I7FA 4B3OB 5B0AA 4A8YA 1S48A 4ED5A 5K8OA 5EN1A 1Y4ZB 4ZPAA 3IAS9 3RW7A 3K7RA 1L3UA 3CDBA 1IQTA 4OX8A 5I42B 1QAXA 4OI0A 4URSA 3OVAA 5E2QA 2RF2B 4A8QA 1VQ5S 4GKKF 2G13A 2LU1A 1N0UA 2JSXA 2KFZA 2VG6B 1VQKS 1YSJA 4O3PA 2RILA 1KSPA 1DTQA 4KAIA 1N34F 3QGGA 4EU0A 2WCXA 1BQMB 3J7ZT 1DQ9A 3THVA 2HHUA 1ZM4A 4QIEA 2OFGX 1H7XA 2HFNA 3BJYA 3HJFA 5D4OA 4X2BA 3MHYA 5D4NA 2KT5A 3G6VA 4EGLA 2VKZG 2YKQA 1KEKA 1SL1A 3BEGB 4Y00A 2UVUA 2AV5A 1S1WB 3MEGA 3CCVS 5DQGA 1VBZA 1AXQA 4CT8A 2MXYA 1Z4UA 4D3GA 5A6PA 1LW0A 1Y9OA 5C5JA 3CJKB 2FC8A 2L9DA 5KFYA 3DLLQ 1RTJA 3Q23A 1WHXA 4U67Q 4LMZA 5KFVA 3OFGA 4ZP8A 2E1CA 1JNRB 1TV6B 1YRXA 2K7KA 1KONA 4DG1A 2ZC4A 1UVKA 4ZPBA 3O1LA 4ED8A 3GSDA 2WONA 1JK9B 1VQ8S 2ZVSA 3D1HA 2ZNZA 2VC0A 2BV3A 2GA7A 5KT2A 3H20A 2K3KA 1DTTB 3ZZ0A 3IN5A 2FVSA 2EG2A 1G6BA 4DQPA 4DSIA 2RRAA 1TZ0A 2KN4A 2M8HA 2QE5A 4DV1F 2P9CA 2OH2A 5BYRA 2J8AA 4DL2A 1G3OA 5J2MA 2KRRA 4WK3A 3NS6A 4PG8A 4DLGA 3VZIA 3GIIA 3CDUA 4QPTA 3NCRA 3SQGB 1WG5A 1R89A 1RT6A 2R4FA 1TKTA 2HHWA 4RKUC 5B0BA 3MPYA 2ZJQQ 3MM6B 4O23A 2YNHA 2B56A 1FRLA 1KFSA 1HWLA 4RUAA 1YJTA 2R7QA 1YITS 4LUBA 2YNGB 3F73A 2LEBA 1TK5A 3PRDA 2OPRA 1E6YA 2LMIA 3I55S 3CPWR 2KHDA 2B51A 1XWLA 4DDFA 1XBWA 2W7AA 5L39A 3PX6A 2VG7A 4K4YA 2UUBF 4ZKAA 1HW8A 3DRYA 3POTA 1PC4A 1ZAVA 2C3PA 1ZPVA 3HKZD 4AQYF 4FBTA 2FJDB 2E5GA 2HHPA 4TU7A 3RTVA 2VUGA 3PFEA 3HT3A 2C3YA 2VOPA 2F1FA 5KFCA 2OPQA 3BM7A 2KG1A 4NZ0A 4B3TF 3DMJA 1RT4B 1MU2A 5I4MA 4IG3B 4DQQA 4HKQA 4ID5B 3LF0A 3DRPB 3VZHA 4G1QA 3G6ES 1FERA 1QE1A 1X5SA 5THWA 3UI3A 4ZLPA 2ZOGA 3M8RA 1D8ZA 4RX6A 5KFXA 1GQEA 3RR8A 4DL5A 2E5JA 3HHLD 2GX8A 1FDNA 4Q43A 3KLVA 1LV5A 1H3DA 5DO2A 3R5BA 2HGMA 1HR0F 5B7WA 4CTAB 1KVJA 2MY8A 2AU0A 2FVCA 4WF9Q 1VRUB 3MF5A 4I56A 2DNYA 4K59A 2C28A 1U45A 3M1VA 4DOZA 1Q8BA 4QWBA 1SH2A 2CZVC 3EX7B 5HMWA 2EWHA 3FSXA 2IFXA 3H2LA 2IA6A 1YJWS 2DD8S 2PN6A 1K1SA 5A0YA 3BREA 1UJ4A 4P7VA 1WG4A 2BBEA 3DOMA 1FXDA 1R0AB 2JX2A 1IKYB 5CHCB 1R8AA 1S1XB 2KJWA 3D5MA 4K5SA 4F3MA 4URGA 5F8LA 2L08A 3UPFA 5EHHA 2JL9A 5DJBA 4ECYA 3GR1A 3MD3A 5AE3A 1QY7A 4DEZA 2XMJA 3N5FA 3DXSX 4JOUA 4C97A 4RUHA 5LL6d 4LT6A 4OLOA 5CH7B 5E3PA 4X4PA 4DWIA 2HHQA 5KFEA 2YX1A 2OP5A 2VFVA 3K5MA 2ASLA 2HNDA 1UA1A 3GE9A 1VOMA 1TKDA 5KT3A 5EX0A 5GAHI 1UETA 3L09A 3PR4A 2ZH8A