4CP5A

Ndpk in complex with (rp)-spmpapp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
KVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic Synthesis of Acyclic Nucleoside Thiophosphonate Diphosphates: Effect of the Alpha-Phosphorus Configuration on HIV-1 RT Activity.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE, CYTOSOLIC
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4cp5A00
2B8PA 3GP9A 1HLWA 1F6TA 4HR2A 4DI6A 3EVMA 1NSPA 3FBCA 1KDNA 4UOFA 1F3FA 3BBCA 3GPAA 3ETMA 3BH7B 1NCLA 3R9LA 1B4SA 3PRVA 3Q8UA 4WBFA 1NHKL 3EM1A 3ZTPA 2NCKL 3Q83A 4UOHA 1NPKA 3ZTQA 1W7WA 3Q89A 1XIQA 4S0MA 1S57A 3G2XA 4EK2A 3VGUA 3Q8YA 5CABA 1NSKL 3EMTA 1JXVA 3VGVA 5C7PA 1S5ZA 4C6AA 4O0NA 3VVTA 4UOGA 3FKBA 3L7UA 1EHWA 3B6BA 2DXEA 4ANEA 3ELHA 3FC9A 2HVDA 4KPCA 3FBFA 3NGUA 2DXFA 1NDKA 1B99A 3ZTOA 3EJMA 1PKUA 3EVWA 1NLKL 1BUXA 2DXDA 4DUTA 1XQIA 2VU5A 4ANCA 3VGTA 3DDIA 4DZ6A 3NGRA 1VYAA 2HVEA 3WX8A 1NSQA 5CAAA 1NUEA 3EVOA 3JS9A 2AZ3A 1NDPA 1WKJA 3ZTRA 1NDLA 3EICA 4FKYA 3NGSA 1BE4A 4FKXA 3VGSA 4CP5A 1ZS6A 4ENOA 3PJ9A 3BBFA 3VVUA 1MN7A 1NDCA 2AZ1A 2HURA 3FCWA 3EE3A 1PAEX 1UCNA 2DYAA 3BBBA 3FBEA 2DY9A 1HIYA 4ANDA 1HHQA 3ENAA 1S59A 3ZTSA 3FCVA 4F4AA 2BEFA 1U8WA 1BHNA 3Q8VA 1LEOA 3Q86A 1LWXA 3NGTA 2CWKA 3B54A 1WKKA 2ZUAA 2BX6A 2B8QA 1MN9A 4F36A 5IOLA 1K44A 5BXIA 3MPDA 3FBBA 4W98A 1NB2A 3DKDA 1WKLA 3BH6B
chains in the Genus database with same CATH superfamily
2QA4S 1PAUB 3BR8A 4X4RA 4HR2A 1IBMF 1LXNA 2CPJA 1H73A 4HKQA 5IWAF 1K9MT 2NLWA 1HMVB 1M5HA 4OZ2A 1FWKA 2CPYA 4PPDA 3GPAA 4NLOA 3PR5B 4J9NA 1JKHA 1XEZA 1U48A 3GWCA 1NCLA 2RD5C 2HGLA 4RUHA 3CMES 1S9GB 2JSXA 3DOKA 4HH1A 3TARA 1Q8BA 3HJVA 1NPPA 4B3RF 1I1GA 2VASA 2HIYA 4LF4J 3J7A1 4R25A 3KG1A 2QFJA 2PD1A 1DRZA 4O3SA 3OTBA 2N82B 3GJSB 4M95A 2HFUA 2CQPA 3LGMA 3QIDA 4IFVB 2I5JB 3E01A 3GSDA 3D9BA 3MEDB 4NCAA 1YSJA 2YXLA 4P6QA 4RZRA 1TVRB 5JJBA 5D6GA 5KFCA 5FLXY 3NGDA 4DF8A 4J9PA 2QLJB 3M2UA 5L9XA 3R5JB 1VCTA 2F9JA 1R7IA 3TNVA 3W8PA 4DX5A 1A0OB 3MHYA 4JV5J 2K3IA 1BLUA 4MKBA 2ZH3A 3BKTA 1S1WB 3MM8A 3P45B 1HHSA 3W9HA 1S72S 3X1LB 1SH2A 4TYAA 1R27B 2VG7A 1UAWA 4PYDA 2DD8S 1YBAA 3BO4A 2UXBF 1ZAVA 2LQBA 3OJSA 4AQYF 4N41A 1PIEA 3VTIA 1RTDA 1FJCA 1JNZB 4ECWA 3RGIA 3CMAS 1JX4A 2V9KA 1FTCA 4LF7F 3C3LA 1BD6A 4DR7F 3MR5A 2COLA 2D69A 2CPDA 2N4CA 3M8RA 4RX6A 1CC8A 3UDVA 4ZLPA 1XQIA 4HLBA 5LSRA 1FE0A 3M32B 3BJYA 4URQU 2BE2A 1BQMA 2FC8A 1SC4B 1WOSA 2AJ1A 2GVZA 2HKEA 2V8GA 4HHJA 2P8IA 4GC6A 5LSOA 5FDLA 2MLXA 3F44A 2A6OA 4Y6IA 4YDDB 1U7LA 2YKNB 1QSYA 5CYMA 4UUXA 2JEFA 1V5IB 2UUAF 1RAFB 1S1TB 1T9UA 2GV1A 2DGTA 4NZ6A 1S4FA 3ZTRA 3HXMA 2UU9J 3BGRB 4CCHA 4ZPCA 5THWA 2OHDA 2I9SA 3THVA 1AW0A 3AQPA 2QA4G 3VF0B 1KQGB 2G1DA 2CQCA 4YDXA 2V9WA 1ULRA 5C42B 5DQGA 1I5OB 4DSEA 1T3NA 1ZYQA 4O0IA 5A8WA 1TR0A 2VFTA 1F9HA 1SJ1A 2UUWA 3PJ9A 5DG8A 1NK6A 2XI2A 5IT9U 5CXTA 2NYIA 4MFBB 1FDNA 3V5RA 1VHFA 3GIMA 2GAGC 3HKZD 1CJUA 1U6BA 4Z7YA 2FVPA 4Y2CA 2MHNA 1CS4A 2KDOA 1KC8T 1Q86T 5CA5A 1YLXA 4XPEA 5SZTA 2ASLA 4F02A 4KGMA 2A10A 3M1VB 3M8YA 3R6LB 2LKZA 3UI3A 5HMYA 1VC0A 3E8OA 3IRXB 1HIYA 2YH0A 2LYVA 4ZVTB 1L3SA 3LANA 2EG1A 2WZ1A 4F4AA 3J80Y 2CWXA 1S1UA 1RHJB 4KE5A 2JX2A 1NK5A 4QIFA 1VQ8S 4C4WA 3OT9A 4RW6A 3QZ8A 4CYUB 2E5LJ 2GHPA 4KGXB 1PILA 3CEDA 4HACB 2MZRA 5L8RC 2N3OA 3VAMA 2FC9A 2BX6A 2XZDB 3GONA 1JKHB 4ITSA 1VQ7S 1Y4ZB 5AE2A 4DR3F 4ECSA 4LF5F 2F4VF 4TNOA 2M2BA 1MU2B 2Q79A 2RRBA 2H9ZA 3CW2C 4OZ1A 3R7NB 2V2QA 1WC1A 3T9NA 5KG6A 3P49B 3KYLA 4W98A 2W8LA 5DZ6A 2ZWPA 3TJ9A 1SH0A 3BH6B 4U8YA 3EX7B 1XMQF 3BREA 4X62J 4LFBJ 5FIIA 3GV7B 2UU9F 4JV2A 2HHPA 3MCSA 4ED6A 1FNMA 2XULA 2W9CA 4DV5J 3FBCA 1VFJA 4P7TA 2EC0A 3Q24A 4MIWA 4RW4A 3SCJE 1IBCB 1UTAA 4J9MA 2D9OA 3H5XA 1CVJA 4X4UA 3V6DB 4EUVA 2HHHJ 2E1PA 4ZCMA 3ET6B 3DLLQ 2J8AA 3KLIA 2B9XA 4HL9A 3RB4A 4C7QA 1XR7A 3NOGA 4GRSA 3CJKB 5DGAA 1NAQA 2DT9A 3AXMA 4WPAA 4FS2A 3FSYA 2R7OA 2ZM6J 5M2PA 1UVIA 1RKIA 1KOOA 3CCJS 2HRYA 3GJTB 4XDDA 5DDRC 5ETVA 2LXUA 4IFVA 2Y8YA 3A3PB 4FDFA 2QO3A 2KH9A 5H9FK 1VQMS 2WVBA 3UD5A 3NKYA 5LL6d 4X2BA 2ZOGA 4ZVEA 1Q81T 2DNLA 1NEEA 1CULA 1RADB 4YMEA 2AYEA 4WF9Q 4E98A 4XO0A 1RYSA 2CPFA 2JC0A 4TU7A 4RBUA 1AUSL 3O8WA 3G8TA 1IQZA 1S1WA 3MDFA 1QE1A 4J5OA 2V2VA 4MYUA 1Q8KA 5B0CA 1BQNA 1VOMA 1RT7B 2AJQA 3MFIA 2HHVA 3EVWA 1B7YB 4NLGA 4YB7A 3OXGA 4DR6F 4LF2A 3A8JA 1LOUA 4TU9A 1NK4A 4GMKA 2ROGA 4BC7A 5L39A 4J9LA 3KK1B 1JXLA 2C3UA 3R7SB 4DV4J 1P8GA 4PQAA 5J1EB 2IA0A 1SKSA 1VISA 2WBMA 2K2PA 4DUTA 5EWGA 4X4OA 4X4PA 3HHLB 1UFLA 4DR7J 1RU2A 1RJJA 2BUNA 3VGTA 5CCLA 2UUBJ 1TAUA 2IJRA 2G2OA 4OYOA 5E5NA 2DK2A 1G4CA 3MECB 4NLWA 3WX8A 3OL6A 1JLAB 2R9LA 3PY8A 4MFBA 1IN0A 2CYYA 2F8HA 2AZ3A 3LUYA 3AD7C 4P2XA 2Z57B 3Q0AA 1VQ4S 3QFWA 4DUYJ 1VRTA 4KFBA 1IBKJ 2RS2A 3DXSX 4K2XA 4ZK7M 3D54A 1O51A 2HQIA 2MQOA 2MKIA 2H48B 2KFYA 3DLJA 3UD3P 2PSZA 3UN3A 2XGPA 4EBDA 2FLPA 5D0GA 1GNKA 3VAJA 4ZKAA 3VAKA 3BEGB 3SCIE 5K20B 4CO5A 4IG3A 4OZJA 5KFRA 3TAPA 2RU3A 4FBTA 2DY1A 1Q82T 1HI1A 3FQLA 2G2YA 1SUQB 3CJTA 3FFIB 4C11A 3JYTB 3VWSA 3W60A 2EFGA 4JI2F 3WHIA 3KLGB 4QWDA 2MZJA 2ZITA 2OPPA 5KFHA 2BRLA 4DPXA 2GVDA 3HO1A 3R2CJ 5B08A 2ATLA 4P73A 3GV5B 1JWWA 1FCAA 4AFFA 1GAOA 4RUBA 1Q0NA 2CG4A 2JVOA 1KFDA 3D6TB 1VQ6S 4PWDB 2YKPA 2AEJA 3UVJB 3H5SA 2DHXA 3TP2A 2AYBA 3RW6A 4B9TA 1JLGA 2DJWA 2OPRB 3D28A 2OFHX 5KFBA 2R3VA 3UCGA 3EZOA 3HHKA 1JLQB 1FDAA 1T9YA 3SV4A 4K0KJ 5ETRA 2XMKA 3OTOJ 1PJ5A 2H1YA 3IWLA 1SJ4P 4DPWA 5KFDA 2BM1A 1DBDA 2HWIA 5K5MA 3QRQA 1RABB 4A8FA 3KK2A 1NB2A 1OY6A 2B9YA 2E29A 4I2PB 3EPIA 4G1QB 1Q7YT 3KJFB 2W24A 2J9DE 1XMBA 4KHMA 4U7UD 5J1NA 1QE1B 1EETA 4U7UK 2MXYA 1RU1A 1V3ZA 3GJRB 1J5EF 5DLGA 4B08A 4O3NA 1SQFA 4UOFA 2ZBQA 4DSKA 1W2IA 1NK8A 5AXKA 1AZSB 4JI4J 4LF6F 3KMSA 3OVAA 2UXDF 2Z0GA 3EXCX 5E3AA 4U7CA 3G96A 4KBIA 4PUOB 1U1PA 1V5VA 3GE9A 2HNDA 1S6QA 3Q83A 4ZN1A 4DR4F 4MK7A 2XSJA 3GYXB 3W9IA 1DAXA 1T3OA 1W7WA 2V8HA 3I87A 3RB6A 4CO4A 2OO4A 1SIZA 2CADA 2C3PA 2XZWA 3HFVA 1TKDA 3CDUA 5IM0B 1JXVA 1O0PA 1SPBP 4QIEA 3C16A 4WFXA 4WFBQ 2IM1A 2Y0SD 4DS5A 3QJPA 4JYAJ 2W8KA 4OYXA 1W26A 1FEHA 2OH2A 3GG0A 4I7FA 2D3ZA 3LAMA 3M2VB 1YX2A 2PT0A 2IA6A 3GCWP 1HBOA 1VQOS 2MKCA 2HQ3A 2RDDA 5B0GA 1GH8A 2CQHA 5H9EK 2BRKA 2LQ9A 1TV6B 1FXDA 4C48A 5EX3A 3RBZA 3PDNA 1PKUA 3KWMA 3HULA 4M5LA 3SXLA 5A2QU 1E6VA 4USWA 4YR0A 1IKYA 1HWUA 2YWWA 3KFWX 1WHWA 2HFVA 3I0RA 2QN6B 1PJ7A 2G13A 3R5DA 3N6NA 4LRAA 4GKKF 4QQBA 4PZVA 4DSFA 4RU9A 2DR8A 3DGVA 4KJIA 4Q8EA 2AJFE 1VIOA 3TJAA 2FZKB 4J9VA 4A8KA 1VI7A 2OPRA 4R0EA 1Z2LA 3U1NA 1Y5IB 3DI6B 1LQ9A 2EVZA 5KFUA 1SQEA 5KFOA 1T03B 2DHSA 4OX7A 1U1KA 4JI7F 2V69A 4FKYA 4CTAA 1S9FA 1VC6A 4B9NA 1FVQA 1RLDA 4FF1A 1UPPA 1PCAA 4ES3A 3S7RA 5BR8J 4WTOB 3CC2S 3ILJA 1QM9A 3DMJB 2F5GA 2Q66A 1ZOTA 5F8HA 1VBYA 5G0RA 2WOMB 2DNYA 4Y2AA 5DS7A 3V4MA 4F25A 4IOCQ 2LXIA 2RQMA 1DTQA 2X3GA 3GR1A 4ATNA 3OW2R 3CPWR 8ATCB 3EE3A 2VFSA 2LEAA 3E2EA 1U0SA 2C42A 2G1HA 3GV8B 1HBOB 1S6PA 3CMQA 2KHCA 4ZP7A 2H4YB 2BV3A 4ECVA 2FGOA 3IRWP 4A8WA 3TYTA 2R7VA 1GTEA 1ZA1B 2XHWA 3RUBL 5LT5A 1CJVB 2KXNB 3PO4A 4I4BA 1JJ4A 1O6XA 1RHKB 3NNCA 1VQ5S 5IM0A 1O5JA 2BBEA 3Q86A 1HNVA 2HIQA 1HNIB 2RB7A 1AROP 3CJ2A 4DFMA 1KVJA 4U95A 2JZ5A 3W1YC 2HNZA 2QLWA 2ZHAA 1B7FA 2LECA 1MN9A 3IWNC 1MROB 2FJWA 3OFFA 4NRTA 3W5YA 4RWWA 2ZJQQ 1K44A 3MOZA 3MPDA 2DR6A 2GS8A 2DEIA 4LRDA 3DLGA 1C0UB 5KAKA 3C6UB 2ZM6F 2PE8A 4ED0A 2J7WA 2GIRA 4YN3B 3IGVA 3H5UA 2AKWB 3NNHA 1LW2A 3T1HF 1OO0B 4DDFA 1N4LA 2ZH4A 2ACMA 3I0SA 5JMNA 1LWEB 4DPUA 5IQQA 1SH3A 2XQCA 2M52A 4P75A 4EGLA 3AJ1A 4IO1A 3BKUA 1NHKL 2J5AA 1S4EA 1X7VA 2G2ZA 2NCKL 2B4UA 4NI2A 5A76A 2ZH7A 4M5DA 3Q2TC 3PX4A 3H8YA 4EMDA 3F73A 3W2WA 4S0MA 2KYZA 3VAGA 2VV5A 3M7VA 4KY3A 4DV2J 4Q2LA 2CZ4A 3Q8YA 4WCEQ 3EGZA 4CT8A 4LIWA 2VBWA 5CD4H 2WVCA 2DRAA 4F0KA 4JI8F 2XEXA 4ES2A 2ACYA 2YPYA 2LP4A 2IRYA 2AYMA 2R7QA 4DXLA 4WP8A 1WEZA 5HMWA 1S99A 1R89A 3ZZUA 4USVA 4LVOP 3WZ0A 4X4SA 2NYHA 4HTIA 1HI0P 3KOAA 5DRKA 3CIZA 1IKVA 3CXCR 3HZEA 3MEDA 3FK4A 1JJ2R 2WRMA 2HAIA 3P96A 4FYYB 3IBWA 4WWSA 2V67A 5GAGI 3IBCB 3HX9A 2PIIA 3H59A 5T7LA 2KZMA 4D3HA 3FQKA 2AX0A 4DR5J 1D3WA 2R2UA 2DR5A 2F3JA 4J9UE 1CEZA 2VJVA 5ETOA 2HAFA 1SI9A 1HL6A 3ZZTA 4HI2A 4URSA 4PWWA 3RG6A 3KK3B 5GVQA 1IKYB 3PW7A 2A3JA 2MY7A 1UJ4A 2KU7A 1R8HA 2UV8A 1XR6A 3PHEA 4JUZA 4C97A 4PXEA 3MD3A 1FXLA 1DURA 4C8NA 2HVEA 4KSEB 4OIXA 4P10A 1RQ0A 1RT4B 4PKDB 4C8LA 4UW2A 1TL1B 2CPXA 5I4MA 3P4UB 4MYTA 2H4WB 4HHHA 2HNZB 1HPZA 3RB0A 4P74A 1S1TA 1WEYA 2V4JB 4ZVGA 3ZO7A 4YEAA 4Z2XA 2R8KA 3KJNB 3OBIA 2M9KA 2VA2A 3PFEA 2N7YA 1S6PB 1HNXJ 1QAYA 1R8AA 1VMBA 2CQBA 4XDCA 3A4TA 1CJUB 3G71S 3KDOA 3TJ8A 3BN7A 4DCJB 4OHWA 4CDIA 2DGSA 1OYEA 3TI0A 2JLGA 2GX8A 2FD2A 4WFAQ 3I0SB 4BCAA 5MLCV 5G4DA 4L6V3 5D4NA 2AQ4A 1J27A 1KLNA 4ELTA 4ED5A 2DGWA 3OLAA 4RL1A 1GXTA 2C3YA 2V68A 2YQ0A 1P27B 3LAKA 4KC5A 3THTA 3N79A 3PW5A 1M5PC 2J0QD 3ZTSA 1KN6A 4O3OA 3D0IE 5T14A 1UVMA 1VLYA 1FHTA 4RW7B 5KFFA 4IG0B 2H3EB 5KFKA 4ID5A 2H54B 1G7CB 1KOHA 2CZVC 2P5VA 4WFZA 4CYUA 1QAXA 1UEKA 2ATCB 1WG1A 2LMIA 1KONA 1MU2A 3B8HA 3L7PA 4TYBA 3WX4A 2XMMA 2RSQA 5ETKA 4PG5A 1C1CB 2WSFC 5KFZA 2W1BA 2UVWA 3LPEA 2DH9A 4K2JA 2H51B 1RISA 5GMEA 1LW0A 3CTRA 4TY8B 4DU8A 3G6YA 3K5NA 1S79A 1RT4A 2AYGA 3ULHA 5J2QB 5CQGA 2WVFA 1B0PA 2KJVA 1FNOA 5KFIA 3NCPA 2FJDB 4J9OA 2D3OR 4NMLA 3W62A 3EUNA 3BBCA 3QSYB 4JI0J 1RI7A 2ZH6A 3D3CJ 3D5MA 1REVB 1RA6A 3AH6A 5LJ5Y 1UVKA 2RJZA 2KT3A 3G82A 3HKWA 3I4HX 4MAKA 3DLKA 1NKBA 4FPIA 2PMWA 1M0SA 2OPQB 3FUYA 2KXFA 3IAM9 4HTJA 1M1KT 4XTTA 3LW5C 2HHXA 2AJ4A 2B43A 3D6FB 4DCPB 3T5KA 3RYLA 2HGNA 1S7IA 3GILA 3QRRA 3MCNA 5C7PA 2FVCA 4O4GA 2LDYA 4ZP8A 4USTA 3VCDA 1DTQB 2BJEA 4RNFA 1RACB 3FKBA 1DFDA 2ZZNA 5AXMA 4BS2A 6FD1A 3UR0A 3G4SS 3HSGA 4Q2MA 4UZCA 2XY5A 1P9QC 1F3VA 2EBEA 4JB8B 2P9EA 1JLFB 5EGYA 4CH1A 5F3ZA 3KK3A 5I3UA 1VQPS 1DTTB 4G1IA 3IR6B 4Y2MA 4FF4A 2IDEA 4F3QA 1U2CA 4KPCA 4DOZA 1EAYC 1TUGB 1JXEA 1AA1B 4J91A 3KTQA 4G65A 3OV7A 1HQEA 2IAJA 4AL6A 1EP4A 4DR2F 5EUHA 3G8SA 4WZQA 2DNKA 4NE9C 2G0IA 4X64J 1NK0A 2M8DB 2DXDA 2R2SA 4DR2J 5HBMA 4QWEA 2ZFHA 4MMOA 3GIKA 3NAHA 2FB0A 2CQ2A 1LV5A 2AJ2A 2VQEJ 4FZVA 3T41A 1IKXB 2AD9A 3R97A 1HA1A 1GEHA 4DPYA 4FYDA 1IJFB 2IC3B 1RWVB 3HHEA 3OXFA 2AP6A 5KG1A 2Y1JA 2VPXB 1G6BA 1S9GA 2MKYA 1K1SA 3NG8A 1Z2ZA 2YNIB 1YIJS 2XO7A 4USJC 2ROEA 4B9LA 3BB5A 4UUWA 1X5PA 1HYSB 3QGGA 2LXFA 2HHTA 4FKXA 4NXNF 3M2RB 2WW4A 1R8PA 1S0VA 2HHWA 4WU3A 2CNOB 1Y9OA 5T41A 4F4WA 5F8LA 4F50A 1SKUB 4IG3B 3UW1A 2R2RA 4OYZA 1FTRA 2GIFA 3C6TB 4RNHA 1GT8A 4RW8A 3PR4A 1T11A 2DH8A 2K7JA 2FJXA 1RHUB 2JFKA 2DGQA 2HLUA 5JXSA 1RTZA 1RAHB 3T6JA 1HWIA 4N8OA 4QYRA 2FDNA 1N33J 2OPPB 1M5OC 4Z7CA 5HROB 4OYBA 2BKNA 2VG7B 3IR7B 5D3GB 3AA9A 2CQ0A 3ENQA 5GADI 2RDIA 4W4MA 5J2MA 7FDRA 3Q8VA 5JVGQ 4DQRA 1ITPA 1WHXA 2YKMB 3BO3A 2EKNA 5CYQA 3I9ZA 2KYXA 2VL1A 3OUYB 3QGPA 3T5JA 4DV3J 1XNQJ 3CCLS 4WXWA 4B9MA 1QVFR 4F36A 4A47A 1BGXT 1IQTA 4JBCA 2D3O1 1R8CA 2DIUA 5AXLA 3PIOQ 3UCZP 2DNRA 1UA0A 3PTWA 3PIPQ 2HS4A 1MMNA 1EETB 2ILZA 4OJGA 5I42B 3CCSS 1PC5A 1TFWA 1RCXB 4I0WA 2MQNA 2Q6BA 2V0NA 5HVHA 2R7RA 1OIAA 1QAJA 4O3PA 5BR8F 4BBYA 4ECTA 4DF4A 3D1HA 5D4LA 4FVCA 2R42A 1N36F 4JI1J 3AJ2A 3D1OA 1LXJA 3PKMA 1TUVA 5B0BA 1E6YA 3AOCA 1ROFA 3R5AA 3OVSA 1S6QB 4ECRA 1JLBB 3EM1A 1HQ2A 2DCLA 3M2RA 4URGA 2C3OA 2LQ8A 4OLPA 4TQSA 1H7XA 1KFSA 4C3MA 1FWLA 1PYOB 4I2PA 2L41A 1FJ7A 1DTTA 2NZ4A 5L1LA 4LBHA 1KHVA 1DLOA 1EARA 2EFPA 1VQKS 4OI1A 5CABA 1NSKL 3BGOP 2DGOA 3CDBA 1L3TA 1VQ9S 7FD1A 1H98A 4K4WA 1AZSA 1K1QA 4K59A 4FXDA 3BSNA 5IT0A 4F0MA 3FDSA 2YBVA 1H2UX 3GU0A 3L7UA 4R8UB 2PA3A 5HVGA 1GMUA 1IR0A 1S49A 2HNDB 2FLLA 3KMQA 3KUHA 3JAMU 3PV8A 2Y8WA 1O8BA 3PZPA 3OXLA 1J5EJ 4CM2A 1UFWA 1KS2A 3WC2A 5HLFB 4CLFA 2VIHA 4O3QA 2AGQA 1IKXA 4WKRA 2DXFA 1KBRA 2VPWB 3FEZA 4AXIA 2CQ3A 5CH7B 2JOQA 4ZOSA 4U6PA 3T3FA 2UXDJ 3L95X 1X4AA 1UMJA 3TX0A 4DX8H 1A9NB 3NCRA 3TEGA 4ZCLA 1T9XA 3ZZRA 1DARA 1N32J 5DG7A 1TUWA 2V2KA 3PCOB 3C14A 1NBEB 1WI8A 2DPIA 3OHAA 3JTPA 1SVDA 1C0TB 1OYDA 3DDIA 2XY7A 3CC7S 2MB0B 1S1XA 2Z2MA 5D0EA 1VYAA 1REGX 4L76A 1NSQA 3JSBA 4ZP6A 4QCLA 2IY5B 3O3LA 3EVOA 4NLYA 2Y0BB 1OY8A 2MZ1A 1Y00A 2QT7A 3F0NA 3TRGA 4ETXA 2YNFB 5A0YA 4PG8A 3K5LA 1RYRA 1RT3B 1TVRA 1Y11A 2HLTA 5FD1A 1NDLA 4ZVQB 4N47A 3W2VA 4CLLA 1F0XA 1RKJA 3MAQA 2RDJA 4J37A 1IKWA 1KP6A 3JQKA 3QYYA 4HT5A 1RHMB 3MR6A 5B0EA 2IBKA 2EK1A 2QE5A 3FZBA 2X1FA 3HCXA 4CH7A 4ZJQA 1XK8A 3E3XA 8RUCA 3M8SA 4IRCA 1MMDA 4IUFA 1ZS6A 1U09A 2GC8A 4LRBA 4PPZA 4F26A 1VQNS 2O1PA 2PN6A 2V8DA 2ZOMA 1TMMA 3DRSB 2XMJA 2CQIA 4FYVB 4NLRA 3BQ0A 1PYSB 2VUGA 1VDHA 5F41A 2JFDA 3DLEA 1WI6A 3L7OA 4CLYA 3M9NB 2W9BB 1RBAA 2I5JA 4EBCA 1SJ3P 2F8EX 1NMEB 2FZCB 2P6TA 4OQJA 4RPFA 5I3QA 2ASDA 4LF7J 1RWPB 5KFGA 1Y3JA 1JIHA 2J7UA 5C25B 1WACA 2Q6CA 2J6SA 2PA8D 3QT5A 4UF4A 3QPIA 4A8XA 2DY9A 2QSWA 3NLCA 1HHQA 4M5NA 3ZXWA 7AT1B 2CG8A 2FJBB 4ZIVA 4ECQA 2PI4A 4JV5F 2A6MA 1Q79A 3BZQA 2N4DA 3RJMB 2BEFA 4LQ9A 1NU4A 2BJ8A 2MMYA 1K47A 3M8WA 4E0DA 1XNRJ 1SJQA 2EI5A 3MM8B 4WTYA 2BR0A 4C8OA 3G6XA 1LEOA 2KN4A 2DR9A 3BS9A 2YKQA 3MEGA 4I6AA 4M5JA 1RE1B 5HQLA 3FSIA 1N8RT 3F41A 3DLBA 2AEFA 3RTVA 2ZUAA 2YKMA 2Y1RI 1S10A 2RAQA 4OZ5A 1KLMB 3UPFA 2ASYA 3BSOA 3C6UA 3MMAB 5DQIA 4FS1A 2C28A 1Q78A 2F4VJ 3I82A 2ABYA 3HHLD 3MI7X 3GR0A 3DOMA 3DOLA 3PKYA 1S1UB 1VRUA 4NL5A 2EXUA 3M32A 2RUSA 1GMWA 3DRPB 3IAS9 5HL7Q 4OJ3A 3KLEB 3C2PA 3SEOA 1CC7A 2VONA 3WBZA 1B64A 2POKA 2HBZB 3M9OB 2V50A 3MTKA 3FEYB 1FESA 3O6QA 3UCUP 2BACA 3HF5A 3P5TL 1SC6A 2YNIA 1HBNA 4ED7A 4MK9A 1Y5LB 1NJYA 2Y9HA 4LF6J 4EFAC 3M8PA 4B02A 2ALZA 2CQ4A 3DRSA 3Q89A 5MAOA 4EK2A 4QIGA 2R7WA 3LP1A 3J7YU 3VQTA 1UFKA 3DU6A 5CZXA 3EXYA 4EU0A 1C1BA 2LEPA 3EDQB 2PC6A 3N01A 2ZBIA 5HK4A 3US5A 5KOWA 1SL0A 1HHTP 2VD3A 2GQQA 4C6AA 2XCAA 1FKAF 1SKWA 4DN9A 1K8AT 1TKZB 4ZVUB 2W2OP 4OV1A 4RBVA 2XMTA 4O44B 3IXQA 2EK6A 2DXEA 1FKOB 3KXDA 2V4QA 1UJ5A 1KVKA 2JDJA 4WXOA 4ZHRB 5B0FA 5D0HA 3J7AN 1YTYA 4DSIA 4A8QA 5HI7A 3V4IA 1V3SA 4DV6F 1S1XB 3D1QA 4HT7A 2ZH8A 3MFHA 2HRTA 1GXUA 1Q1KA 2W9CB 1OMSA 4NOHA 4ZS6A 2YKOA 3IS9A 2D3UA 2P9GA 4OYWA 2DTJA 2MLYA 1FKPB 1PYTA 1MWZA 2IVMA 5IC6B 3O5TB 1WHVA 4F4YA 2D9PA 1NJXA 2FHKA 2DRBA 1WG4A 3H42A 4IDKB 3PXGa 4ECZA 2J7KA 2ZJPQ 4DQPA 4B3MJ 2FHJD 4NYPA 1HBMA 4LF4F 3R3TA 2SXLA 5KFXA 2CVIA 2ZEJA 3OTOF 2NR0A 4ZVSB 1YHQS 3IR5B 1FRIA 1WF0A 2FYXA 1FFSB 5CAAA 3CULA 1Y0HA 3TR5A 1NUEA 1K0TA 2LFVA 5GAHU 3BO2A 1IM4A 2XLKA 3UQSA 2B5JB 3HHDA 4N8NA 2KT5A 4OZLA 3JSMA 2IPOB 1S97A 4PQUB 1FJGF 3J7ZT 3RR7A 3VAIA 4HEA9 1RAAB 2QYGA 4FYWB 1CJTB 4X84A 2CDQA 3FNNA 4OYIA 2BOAA 2Z4PA 5ETTA 5J1EA 4USHA 5C25A 3V6DA 5HANA 3IM9A 4X4TA 3VQSA 4YR3A 4DV0F 4DQSA 1FJGJ 2G9OA 5B0AA 1RT5A 2WW8A 4GKJJ 3NS6A 2IJNA 4V1Ak 4Q44A 4X62F 4OZ3A 4Y3CA 3DRPA 3TOQA 2ZJRQ 3FMBA 4D3GA 3ENWA 3LWLA 2R8IA 3K0JA 2R7UA 1NDCA 2C22A 4C9DA 2V8PA 3OSNA 1HMVA 4M5GA 3PVXA 1SKRA 2WBRA 3CD6S 4ED2A 4A8SA 2HZVA 3PX0A 2ZWOA 3OL7A 4NA1A 3MAAB 1RA7A 2ZE2B 4X4QA 2YPZA 3POTB 3W5ZA 5KT3A 3TZXA 1KQSR 2UXBJ 5B09A 1F5BA 3R27A 2V63A 1RT2B 3NBPA 1JMTA 1RUSA 2W2PP 2HFNA 2A1BA 4C0BA 2I2YA 4K8RA 4LJMA 3J7YI 1RHQB 2IMOA 3H20A 4OI3A 4CM0A 3OD2A 2HHQA 3CO9A 1H72C 5IV4A 4JV1A 1TKZA 3G6VA 4ZCKA 4BLGA 3NY0A 3BV8A 3TWZA 2EFOA 1VRTB 3R8YA 3QO9A 2XYGB 4QOTA 2HQCA 2OIHA 4B9SA 3AY0A 5A8RB 3OL8A 4Q0BA 2B4OA 1J2VA 3HFKA 5HJYA 4RNOA 1G2EA 3DRRA 1VQSA 2C3MA 2MY8A 4JP8A 5KFPA 4MKVA 1AXQA 4AD6A 1YITS 1ZTWA 2OAUA 4FN5A 3E01B 1NNDA 2NPIA 2V34A 1C1BB 1WORA 2GMLA 2KVIA 2QV6A 5E3RA 1ZM4A 3QNWB 5LOQA 5KFWA 3KLEA 3TZWA 1U26A 1QAIA 3O1LA 3MZIA 4M5HA 3W63A 1ZTTA 4WBFA 2GFFA 4H4OA 1VBXA 1NJIT 4G1PA 5KFSA 3LWMA 2QL7B 2RHQB 3N6LA 5DETA 5B7WA 4AXJA 2CJXB 1K0VA 2YX1A 4LVNP 1S57A 4LSZB 2MTLA 3UVJA 4LRFA 3IA0A 3DN9A 5DZ7A 3CCTA 3HSJA 3N9UC 2GJFA 2QSFA 4EI2A 5H9FJ 4DV1J 4F4ZA 4M94A 1N48A 1XC9A 4GKJF 4KRWA 5KG4A 1N34J 4KHPF 2IRUA 2DO0A 2X1AA 4M5KA 3UD4P 3ZZZA 1MWYA 2V5HG 3R7BB 3MAAA 2C2DA 3IWXA 4ELUA 2OMLA 3BYRA 1SJRA 1VHIA 3ZFVA 2HQFA 2OEMA 5L1IA 1RP5A 2BA9A 4QYZK 4NLDA 1WOOA 3ELHA 4F7VA 2AWZA 2BABA 2HNYB 3H40A 4DQIA 1VR6A 4MIBA 1LKZA 1JLFA 3B82A 3S1TA 2PEHA 3SI8A 2UXCF 3DRXA 1IM6A 3KNGA 4KGVB 2DIVA 3HJFA 5IFMA 1HW9A 2UZAA 4E8UA 2B51A 3CGIA 3LP2A 4X4NA 1S9EA 2K06A 1RT6A 4I2QA 3LQVA 1F2HA 2LLZA 1UW9A 3I5AA 1WC6A 4R0JA 4WKYA 4TVAB 4TQRA 1VLOA 4DV7F 3V81B 3UDEA 2O67A 3DLGB 4F8RA 1WELA 3KLHB 2VC1A 3TAMB 4Z37A 5KT7A 2RS8A 5C2GA 3H2VE 2KKHA 1RT2A 3NBPB 4MKYA 4DZ6A 1K73T 1D09B 3QT8A 2U2FA 4OX6A 3G9CA 2CXEA 1HBMB 1NH8A 1U49A 1HBUA 4JI4F 1M5SA 1ZZNA 1HNVB 4CNYA 5FDLB 4C2MA 4JI3F 1WNEA 4Y2KA 2GNKA 4L72B 2R8JA 3EICA 4AE5A 1X4FA 2HS0A 4LR7A 2DEJA 2YVSA 1F1BB 5KFLA 2XC9A 4CIOA 4Q8FA 2ZE2A 3RRGA 1RWUA 2CPEA 3CJ4A 4PG7A 3TVKA 4X66F 2B7CB 2HBYB 1U1QA 3L09A 3VGSA 5J1PA 2WCXA 3TANA 2KJWA 1D0EA 4PUOA 3RU0A 1M1GA 2YNHA 4I64A 4NYOA 5ITHA 2L3MA 4IOAQ 2NXUA 4LRCA 2Q1LA 1VJWA 2F63A 3QGIA 2DO4A 2WAQD 3D4JA 5K8NA 4AQYJ 3TVZA 2NUUG 2BQRA 3CB4A 1FRKA 3OR1A 1TL3B 1L3VA 2NZCA 3PRDA 1SJFA 1NSAA 4YHHJ 2UVRA 1BQXA 4M5DB 3UWTA 2RU9A 5KT2A 3CJKA 1S77D 3SQGA 4ED8A 3CCZA 2VHGA 2VFUA 3CDWA 4KKOB 1DY3A 3VV2B 1BWVA 2PGCA 4RUCA 1S9EB 1BHNA 2JEJA 2KM8B 1S0MA 1J5OB 5A6WA 2HVHA 4ZPTR 3OUYA 5DLFA 3DI6A 2UUAJ 2X1BA 2CWKA 3BGUA 3SYZA 2UUCF 4LF9F 2K1RB 4A48A 1U1MA 2P6SA 2KVQE 3CJ5A 4CTAB 1FWPA 4DR1J 5FJ4A 2BXJA 1FKPA 4TN2A 3GFHA 2XGQA 3GYGA 1HNWJ 4K0KF 3DMJA 3FJ2A 3QO9B 3ZZOA 2NXCA 1WG5A 3QLHA 1YRXA 1F6TA 5D77A 4R5PA 2RT3A 4F2RA 5H1SV 1NHVA 4DI6A 5DJBA 3DRRB 4YS2A 1YG0A 3W66A 2XS5A 4WP9A 1F3FA 2MZTA 2V4JA 5T7LB 5CYJA 4DUZF 1FJEB 1IBLJ 2J0WA 3ETMA 2E1CA 3NAIA 4AUKA 4PXBA 1T9VA 4FPRA 1ZBTA 3IO1A 2MSTA 5KFYA 4X65F 5K14B 1S0OA 5AXNA 3GIJA 4ALZA 2AGPA 4P2FA 4DFPA 1S48A 3RAQA 4JI3J 4DHVA 3FZ2A 5CZVA 2Z2YB 3U1MA 4DPOA 5F8IA 1XIQA 2W4CA 4DV4F 3FSXA 1GX5A 3MM9A 4WIQA 2OEJA 4ZA1A 1TKXA 1S1VA 3LA0A 4CLUA 4N56A 2CNKB 2KL8A 1YWXA 2CPIA 3BPDA 2EWHA 3VR1A 3RAXA 1H74A 5CHCB 3H2LA 4QR0A 4DLGA 3VVTA 3T9ZA 3TQ1A 2RE1A 3VAHA 2HEKA 2KG0A 1H7WA 1UKUA 2YQ1A 3GSIA 3B6BA 3NWGA 4NI2B 3SQGB 2ADBA 3QQCD 3THPA 4MK8A 4CLWA 3W2WB 4DUYF 1FX4A 1QSSA 3NMAA 4DJBA 1WEXA 2DNNA 2EPIA 2RUGA 3HD2A 4MH8A 1HFEL 2M88A 4MT1A 4YHHF 2XYHB 4Y28C 1OWXA 4K4SA 1LW2B 1GFWB 1YJ9S 3ZNJ1 1FRLA 4IFYB 1Q5YA 3SSQA 1YDLA 2VKRA 3C8YA 3LP2B 3MPYA 3G8QA 3IGNA 3OR1B 4JI0F 5B0DA 2WONB 3QATA 4GVBA 4HH0A 1YJNS 4KPYA 1RAJA 1RWXB 2DNQA 2DB1A 4OMFG 3CCQS 3OL9A 3LH2S 1NPRA 2PEBA 3BR9A 3EWGA 3HSZA 5KFJA 4K4XA 1FRMA 2WVDA 1KEKA 4X64F 1TL7B 2ZUGA 5EWFA 3C46A 2ZDOA 1IKVB 2ZD1B 2ZHBA 4LQ3A 1C0TA 3NXZA 3T1YJ 4IG0A 2HWHA 5A0YB 4GVLA 5E33A 1Q16B 3U1LA 2JL9A 2FY1A 3QJLA 4HVZA 1XNRF 3S8SA 2BKOA 3UNYA 8AT1B 1UEVA 4M1KA 4WFYA 4PCQA 2PI5A 2VPZB 4XIUA 2QEXS 1AFIA 3NGSA 1HNZF 1MNEA 1BE4A 3TW0A 1QVGR 1YJRA 2JEGA 1FDDA 1KKHA 1XERA 4Y0FA 1WUUA 1WSVA 2ROPA 2HRUA 3QLHB 3MM5A 3PYFA 4B3TF 4UY85 4XK8C 3BGFA 4WFNQ 4DFJA 2X3DA 2W9BA 3VVUA 5LXRA 2XI3A 1X5SA 3TZZA 5GMDA 1SBRA 5D3GA 1RTIB 1B70B 1ZM2A 2HYIB 2GW8A 1RAGB 1RT3A 2CJAA 3HLUA 3V6JA 1T02A 3SFUA 3QWUA 4DR5F 2Z8QA 1KTQA 3CJSA 3DGPB 5E3PA 5J2PB 1CLFA 3MM6B 4JOUA 3FCHA 3HVRA 2QJ3A 2HHSA 1ACMB 1TK5A 3BQ2A 1S59A 3UDCA 3KK2B 2VPYB 3RAMA 3MM9B 3MPVA 2ERRA 3W8GA 1U6FA 2G0CA 4DWIA 4WYLA 5HP1B 2V8VA 3ZZPA 1Q53A 2E5GA 3TX8A 1VGYA 2I0XA 3C16B 2OPSB 3OR2A 1R3NA 4DL3A 4HDHA 1KLMA 2HK2A 2N3LA 4MKAA 4FF3A 3AODA 2ASJA 4WK3A 2Z2ZA 4F4KA 4NEYA 1URNA 4H4KC 2L9DA 4HHUA 1V3RA 2ZH9A 3ZC4A 9ATCB 2LEBA 4CI0B 2XHCA 4YQWA 1RTHB 2YQ3A 2B4PA 2AHOB 2F7VA 3GYNA 4M8LA 2QLBB 3C15A 4IH5A 4RW7A 3L9ZA 1R43A 3QSIA 1NSPA 4GO5X 3SCKE 4ER8A 1YGYA 3BQ1A 5GMKa 2B6AA 4EO8A 5DM6Q 4PAAA 3TA0A 1S12A 3BH7B 2V6AA 3I5BA 5C24A 3JAMY 1B4SA 2KB2A 4J7CA 2FHOB 1HPZB 3UN2A 1U1RA 1IBLF 3M2VA 3ZZ0A 2CJKA 3FEXB 2BZ2A 2PO4A 4USIA 2CA9A 2FUG9 1FVSA 3D0HE 5E0OA 3SZ2A 1OY9A 3KNAA 3IBFB 5J2QA 4CO3A 4ETZA 2CPHA 3H90A 3N4WA 4QPXA 2I38A 1PG5B 1UW4A 1FERA 1HKAA 2RNEA 3H2UB 5DG9A 2MHEA 4NXNJ 4M63A 1YJWS 1PC4A 1NJWA 2YWGA 3M2UB 3PW2A 1NKCA 4UOGA 4RWXA 1T05A 2H5EA 2WONA 1RWMB 2IHR1 3W7BA 5KG5A 2D74B 5KTQA 2E1RA 2ZVSA 3EYZA 2APOA 3O44A 3CVKA 1YQHA 3ITHB 4Y00A 4V19J 1APSA 3I4PA 2CQ1A 3OPKA 1P6TA 4OHVA 1N54B 3C66A 4YB5A 3KUEA 3LP1B 3FC9A 3IC1A 3MWBA 2M7SA 1U1OA 1N5VA 3CJ0A 3H98A 4ICLA 3K58A 1LWFA 4EYHB 2HMIA 4IQXA 1YZ7A 4K4UA 1U0HA 2ALYB 4OZ0A 4QYZJ 1FFGB 1KHWA 5J2PA 2OFGX 3M6WA 2GO9A 2W7OA 2C1EB 2EW9A 1E6VB 1RTHA 1RWKB 2HFZA 1LWCA 1N5SA 1OQ3A 2CJQA 3BPSP 3DU5A 2RHSB 3K5PA 4NLTA 5AE3A 4C3LA 1Z4UA 2VQEF 2BJ7A 2GHVC 3B4DA 3MR7A 5KG7A 2IM3A 1N5QA 2BKPA 3EZUA 2BANA 4I6WA 4ZJLA 4ILMA 1RWOB 2VICA 4P72A 1H3DA 2RKIB 2UXCJ 3MXHP 4OYMA 2MKJA 2MPUA 4KH0B 2QA2A 2OD6A 1CJTA 3PNIA 4KV8A 5ETQA 2PMZD 5K8OA 4EWTA 2EFQA 2VG6A 2CIMA 3CC4S 4PQUA 4DX7A 5KG0A 1RZMA 3LF0A 4KYZA 4CO0A 1SV5B 3SCLE 3W9JA 5HBMB 1TAQA 1BMQB 2EBGA 1N34F 2KRBA 1WDDA 5GAGU 4RLEA 2E1AA 2FY8A 1FF2A 1JQGA 2YKAA 2VH7A 3B4MA 3D66A 2EKYA 3GFXA 2QG9B 4QPTA 2IMWP 1OPIA 2AZ1A 2OELA 2RF2B 1WC4A 2RIJA 2W2MP 3BM7A 3ISZA 4BWMA 3W64A 3ADAC 4AYBD 1I3OB 4PXCA 3WIUA 1I94J 2B6AB 2OPSA 3OR2B 1Y7PA 2M5YA 2MLZA 2UUTA 1Q4RA 2W01A 2QGFB 3M1VA 2CFXA 1XWLA 4QIVA 1IVZA 3E51A 3QRPA 3CJQA 4XAKA 1EZZB 3TUZC 1DZ5A 4B3RJ 5KFMA 4LMZA 2KZZA 1RCOB 2E7XA 4LT6A 4OLOA 4C8KA 5KFAA 4UY8T 3FCVA 3NNAA 3RRHA 2E7WA 3MM7A 3U02A 4FXWA 1VBZA 1N33F 4RW6B 4NX9A 5J2NB 4ECUA 2LU2A 4B9VA 3G87A 3R2DJ 4KIAA 3D68A 4Y65A 3HVWA 4USMA 1SL1A 4LFAF 3BN4A 1RBOB 5ETPA 3KDNA 2BOPA 4O23A 2ZH5A 3ILLA 5D8HB 5ADZA 1B0VA 1UETA 2QYCA 3SDEA 3AD9C 3D6MB 4DL2A 4NA3A 1RAOA 3FBBA 2LCWA 3KG0A 2CVEA 4PXDA 1FNXH 4C8YA 2E7VA 4NCGB 3HSDA 1HQUA 4ZVOB 4CZCA 5IV3A 4B3TJ 3Q22A 4PG6A 1QUPA 2EC2A 2GQ2A 3GMGA 1W25A 4OFZA 3EVMA 4CT9A 2JHEA 2DPJA 1KDNA 5CYQB 1HNZJ 4N76A 2VG6B 2Q43A 5F0UA 2NUHA 1M5KC 1BXNA 2RRNA 2F1FA 4OV6A 3QMQA 1RWNB 1T94A 2I6WA 3TUIC 1LWEA 3HFZB 3OJUA 1Q7LB 1LWCB 2KT2A 4C0HA 1OS5A 1FFWB 4OYPA 3TAQA 1RXOB 4TU8A 2KRRA 2X7IA 5KT6A 4B3OB 1X4HA 2BANB 3C19A 3GLJA 3ITHA 5F9LA 1RB0A 2N7CA 1JLCA 2JC1A 3GCXP 2ILYA 1WSRA 3A12A 4FXVA 2LA6A 4OI4A 4TLRA 3VGUA 2DNOA 1IWGA 5J2MB 1WC5A 3QAUA 4ICLB 2HWTA 1T95A 4ZPDA 1U2RA 2YNFA 3MUVP 4P52A 4DU7A 2JJ4D 2R7XA 4NYZA 4CLTA 3M9MB 1FRXA 3RR8A 4LSLB 1SXLA 2C2KB 1PJ6A 1X4GA 2DKOB 2XMUA 2FGCA 5I3PA 3R1HA 1RK8A 1FXRA 2BJ3A 1YRUA 3PACA 4LF1A 4A46A 3PRBA 1X9WA 3MM6A 1P1TA 3HT3A 1X0PA 2R8HA 1Y10A 4ZP9A 2VBZA 1HNXF 2MQLA 1S6UA 1N6QA 1WC3A 3DLEB 2MDAA 3I56S 1RHRB 5DO2A 1IJEB 4Y34A 4BC9A 4DL4A 2J9EA 1NLKL 4RW4B 2OD4A 1U02A 3K17A 4L73A 5LMNF 1N36J 4EZ9A 2DISA 4L3NA 3QZ7A 3MTJA 3VAFA 1E6YB 3S6EA 2DHHA 1BC6A 3FMWA 1OPZA 2D7SA 2E66A 1Q8IA 3V81A 1LK5A 3SQOP 3DOMB 2HNYA 2IBOA 3DOLB 4QJVA 4ZVFA 3TAMA 4P71A 4ZPBA 4ZLLA 1JLAA 5GAHI 1RLCL 4DEZA 4DN0A 2E5LF 5H9EJ 3ETOA 4B3SJ 2XBPA 1RT6B 3P6YC 1WWHA 3JS9A 1C2PA 3IG1B 2AIRB 2L08A 4I1TA 4ECYA 4W90B 3KK1A 1WTBA 1C1CA 1MG7A 5EWEA 2JLFA 3MMBA 3HI9A 1NH7A 2RVJA 2CRLA 1CULB 3HVTA 2MGZB 1NK9A 1N56A 4GKKJ 2J76E 4UTGA 1V6HA 5E3CA 3K5MA 2K3KA 4I69A 3FFIA 4P2SA 1CG2A 2BQUA 1ZA2B 2CAJA 3H5YA 1HNWF 4DL5A 3CCMS 2VOOA 3LGHA 3TQEA 3A8KA 5KOXA 4CQ1A 4CNZA 1PAEX 2MYFA 3DFEA 3L4BC 4KH1B 4KT0C 4O44A 3AA8A 1HR0J 3R6GB 4ZPAA 2YTCA 3EPGA 2BW7A 3SFGA 3NOCA 2XG8A 2YX4A 2HZAA 5HO4A 3K89A 3M8PB 3C14B 4R8UA 3GG1A 1ZPVA 1KQFB 1YJUA 3RZAA 3RBXA 2HG4A 1SQGA 1AB8A 3T1HJ 2FZGB 1D8ZA 1R0AA 4BDPA 3CNQP 3MM7B 1UP1A 4J9SA 2DITA 2J9CA 3MCOA 4KKOA 1JLQA 5GAEI 1UVLA 4RW9B 2KTQA 1TELA 4JYAF 3PJXA 3W65A 4PRFA 4LSLA 4Y2IA 1WTFA 2B8QA 1JNRB 2EEYA 3NS5A 4OJ1A 4IDKA 4PABA 1REVA 3TUJC 4WE1B 3P8BB 4DCOB 5DDPC 2V94A 2W9AA 2NXNA 2XYPB 2L9WA 4BWJA 3NS7B 4ZMMA 1NO8A 3K8WA 4DV0J 4QZVB 3V4IB 2KFZA 1PBAA 4DV2F 2XTJP 2ZKUA 1DHMA 5CYMB 1UL3A 2NXEA 1D1UA 1IWAA 3BSCA 3CCWA 4DS4A 2MZSA 3KJQB 2OGUA 3FGVA 1RTDB 5KG3A 3B78A 2NREA 1BY9A 4UT4A 2OTLS 2WK4A 3MR2A 3CO0P 4RU2A 2Z58B 2HS3A 5K9FA 5LM7E 3PRVA 4KV8B 3G86A 2XSJB 3K5OA 1GTHA 1VK8A 1LFPA 2CZ9A 2FPHX 2YNGB 3ZTPA 1M1HA 3A1YG 1H38A 4NXMF 4DL6A 1NPKA 3GQCA 2AGOA 2HFSA 4EO6A 2WSEC 4C0OC 3G2XA 3AT1B 2OPQA 3GIRA 3IMQJ 1Q95G 1N52B 3PYDA 1WHYA 1QUVA 5ETSA 1JLGB 3KKFA 3VGVA 1FA0A 3EGNA 1TMJA 2I1RA 4DZDA 2HQGA 2DNHA 3CD5A 3N0VA 2OTJS 4LFCJ 4PG4A 3M05A 4N77A 1HARA 3HVAA 1RTJA 1D9DA 1A6LA 2ZBPA 4GC7A 3KG4A 1L3KA 3JSYA 1EHWA 2W4PA 1CQNA 1U47A 2FVSA 3MMBB 5L1KA 5E2QA 1MWQA 5C42A 5C5JA 2KG1A 5A6PA 4A8MP 3KHHA 4H4MA 2BJ1A 3NWRA 1NM2A 2MQ8A 2HVDA 4LFBF 1SCJB 3MUTP 2BMBA 3Q8SB 2PDAA 3W3SA 5IWAJ 4LSNB 3MCMA 4A4JA 1X4CA 1OQ6A 2RH3A 5E41A 5DM7Q 1M5VC 4EYIB 3R5BA 1KSPA 3UE2A 1S7HA 4K4YA 2XS2A 5AT1B 1QSLA 2UVVA 3V6KA 3BGRA 3J7Z5 1IUJA 2OMOA 2QTWA 4B3MF 1JJHA 2E9RX 1U25A 5HROA 3QBCA 5GADU 3PYEA 3BDPA 4AL5A 2DHAA 3V2UC 2VU5A 4JI6J 1D8YA 3VZHA 4QU6A 1CSJA 2JWNA 2VC0A 3DCAA 3QGHA 1T0TV 2BM0A 1U1LA 4OX8A 3LPYA 3BKFA 4MJKA 1YZ6A 2H65B 2ZD1A 1T03A 4NA2A 2RILA 4RUAA 4DL7A 2ZVIA 2B56A 3A8IA 1C4AA 2MQMA 1FDBA 2L48A 3G6ES 1NDPA 1WKJA 3EGWB 3KLIB 4DLEA 1N88A 2YWEA 3V6HA 2GMJA 1TL4A 3JSRA 1VK3A 3MMCB 2KI2A 3KUGA 1UWBA 2CKWA 3WDOA 2NS1B 1X0FA 4OZNA 1HBNB 1XR5A 2D1CA 5HMXA 2YWHA 1UJ6A 5HSPA 2VBYA 1XMQJ 2R4FA 4OX9J 4F04B 5LJ3Y 2VDHA 2CPZA 2M8HA 4J9QA 1EB0A 2XY6A 3I9V9 4F3MA 1F5AA 3PEHA 3HK2A 2VFRA 1I51B 2AW0A 4H54A 4DPTA 2V4RA 1Z1ZA 1T9TA 4WIIA 3U7JA 2BYCA 3FBEA 4I56A 1KQKA 1X8DA 3ENAA 3FRYA 5EN1A 3DHXA 2WOMA 4YFUA 4DG1B 3J81U 2PMHA 5HP1A 1DJ0A 1BQMB 3JB9k 4CLZA 4DFKA 1FD8A 1WC0A 3K8VA 1WOPA 2DHGA 2E5JA 4RNMA 3CCRS 2QZ8A 4YB6A 3IFEA 4J90A 2VA3A 2HBQB 1U1NA 1OSCA 2J0XA 4B3SF 4OHZA 2W25A 2IM2A 1Y3KA 5L1JA 3B54A 1JLEB 2M70A 3UDLA 5IXUA 1Q8LA 4UQTA 1U6ZA 3HT0A 4QIWD 2BJDA 4QW8A 4PYAA 3X3UA 3CIMA 3QJJA 1WJ9A 1XMOF 2A2CA 4DR3J 2DNZA 4GO7X 2QX0A 1X4EA 2XNQA 4F67A 3D3BJ 1X60A 3MPWA 2M4MA 1ELOA 1A7GE 1X4DA 2FHJA 4LSNA 4IYQA 4FYXB 3AXKA 3JQJA 5FLXU 3BGLA 3LALA 2NQPA 4Q43A 1T9WA 2HFOA 5BYSA 1YBTA 4E2FB 5IQ6A 2ZDPA 5RUBA 3DDKA 4LFAJ 4LR9A 1MROA 5EX0A 1UWAA 3CWJA 3T6BA 3KLHA 3OTDA 2VQFF 3AHPA 4QWAA 3LTOA 1H0HB 1C4CA 4LUBA 5IT9Y 3OLBA 3ILIA 4UOHA 3ZTQA 4A8OA 4JI7J 2JLEA 2VB6A 1FRJA 2A18A 2CQDA 4USKA 2UUBF 2R7TA 4DQQA 2C2RA 2WHOA 5HN0A 3KLGA 2G0JA 4JI6F 1DLOB 1FRHA 3SSRA 2BQ3A 1S5ZA 2DNPA 1URRA 3FVYA 1RT7A 3SMZA 2GVDB 3OTCA 4CLKA 4AL7A 2UUCJ 4LF9J 1XNQF 3LOUA 2QRRA 1T05B 4FBUA 2Q3PA 2W4DA 3BDEA 3MOJB 1LNQA 2C2EA 3POTA 3CCES 4ZPVR 3MPUB 5HATA 5HVFA 3AD8C 3QFHA 3NGUA 1JJCB 3T19A 5HJXA 2KXHA 1R0AB 3P3DA 1ZM3A 4TY9A 6FDRA 3BSAA 5ETNA 3J81Y 6AT1B 3K59A 2Y3YA 4DUZJ 2WB4A 1U0HB 3PYGA 4YB1P 2E44A 2GAHC 3KLFA 5F8JA 2J6UA 2QLFB 3ET6A 1I94F 4DR6J 4OJHA 2IVFB 2XO6A 1R6YA 3PJWA 4WE1A 1NHUA 4ES1A 4C8MA 4ANCA 3A3OB 2HSEB 1RT1B 1UZDA 2ZC4A 1CJKB 2ZBRA 3DM2A 4C3KA 5F8GA 1S6OA 2F9DA 3HZGA 4TXSA 2C2ZB 1DQ8A 4DV1F 3MEGB 3QT6A 4EZ6A 3CD7A 4J9RA 1R8BA 4IRDA 1UVJA 1NK7A 5K14A 1U8SA 2VG5B 1SB6A 3PW0A 2MJUA 2Z30B 4PEOA 3JQMA 3Q8QB 3EZ5A 2AEMA 5BYRA 1V9OA 3GB0A 1IKWB 2CJ9A 4YUDA 4QW9A 4O3RA 1F9EB 3MMCA 1TL5A 2F65A 2YNGA 3DXBA 1HWJA 4LF8F 3ZNUA 2RKIA 3PO5A 4KGKA 2DBBA 4JI2J 2HURA 4KGZB 3PEJA 4RR5A 2UP1A 1SC1B 1TL1A 4F0HA 2FLOA 2ZBCA 2ZNZA 4BHQA 3Q8PB 3KHLA 4LF5J 2O5DA 2RRAA 2KM8C 3D2WA 2J0SD 2ZKTA 1EX8A 5M2RA 2NSBA 4ZIWA 1UCNA 3NMRA 1ZPWX 3MEEA 2HK3A 3QT7A 2GHWA 4DR4J 2IDLA 2YH1A 3AAWB 4G6VB 4XPCA 3SV3A 3HHLA 1FEEA 3KHGA 1FK9A 1VIXA 5D0RA 3VALA 2IYIA 2DGVA 2XMWA 1NKEA 1KVIA 5F9NA 1U45A 1RAEB 2IJFA 4IFYA 1VC5A 2MKHA 1HBUB 1NRKA 2AJ0A 4JI8J 4RJVA 1N5TA 2B0GA 1X9SA 2OUGA 2F40A 2AU0A 4ZPWR 3DNCA 1BQNB 4I2QB 1JK9B 5EDWA 3L3CA 4QWCA 1GX6A 2P9CA 5IOLA 1HR0F 4OHYA 3TO8A 4KFBB 2OJ3A 1LK7A 4TY8A 4CLPA 4NRUA 1TK0A 3JTNA 3M6VA 4DL0C 1L3UA 4IR1A 4NLQA 4ZVRB 2AF6A 2WVEA 3R5GA 2FJVA 3F56A 2EFVA 5J2NA 1PBUA 1XMOJ 1N5YA 3CCVS 1R0CB 1HQUB 2GGPB 3R1LA 1M90T 2E1MC 4K4TA 5ETLA 1QDUB 3JYTA 3WQPA 1X4BA 2UV8G 1RWWB 4QBUA 4KB7A 4CO1A 4DV6J 3G82B 4EEYA 4ZITA 2OLWA 3SDEB 1PGZA 4CH0S 3Q8UA 1TL3A 9RUBA 2AT1B 2LA4A 4U9RA 2R7SA 5KFQA 3OHBA 2O01C 1TL7A 1YJ7A 2CQGA 1F5CA 1G3OA 2HVZA 1UEUA 1N0VC 3DOKB 4LIRA 3UNGC 4TLQA 2Y1IA 2PFFB 4NLSA 4B3OA 3TUPA 1IXKA 2W2QP 4ID8A 1EKSA 4OL8A 2NPFA 2HVIA 1MSWD 3AB4B 2QL5B 3MAHA 1CBKA 4U67Q 1TFYA 3IS9B 4O0NA 2HW3A 1HD1A 5KFEA 4KTQA 1WD6A 1R0BG 3DLKB 3JXOA 1TP7A 3OFGA 5D78A 4CWBA 5K8PA 2FLNA 3ICLA 2BDPA 3Q2SC 5AJ3F 3ONQA 3LP0A 2R8GA 4LBPA 4NXMJ 2WTFA 2VBXA 3TA1A 3AJDA 1QJHA 4ZVPB 5U47A 4UZBA 1S1VB 5AJ3J 4TKTA 1AUDA 3TVYA 3CF5Q 1EP4B 2C2NA 3ZTOA 2YKNA 1IR2A 2XWXA 2KO1A 1RGVA 2M0GB 1QTMA 2MZQA 4K5RA 3H25A 3ISND 2LVWA 3M8QA 1YVFA 4LR8A 2VZ9A 2WSCC 4NMXA 4PR6A 1GMWD 1ICEB 2QMWA 3C15B 5JUMA 3PM9A 2ADCA 2IM0A 4OX9F 2DGUA 3NGRA 5L38A 3J81j 3RB3A 1ZETA 3ENVA 2BE2B 5DGBA 4G1QA 4IR9A 3HPOA 3IN5A 3OFEA 3D7SB 4R5PB 4Q7AA 5L46A 1HI8A 4A8YA 1ZZFA 1IBKF 2V2ZA 5IS2A 1T7PA 1CS4B 4DMZA 4OHXA 1B0TA 4X66J 4L3KA 4K50A 3LGNA 3IG1A 1HYSA 1QY7A 4F4XA 3AQOA 3HVTB 3PG9A 4USUA 2MGZA 4G3IA 1S76D 3HMJG 3MEEB 1VBKA 2I8EA 3VHQA 1R6VA 2PFDA 4IQMA 1X9MA 4CP5A 1SIWB 1GQEA 1RT5B 2UVUA 2M3DA 2K8GA 4UQGA 4HI1A 2ZH1A 4V19X 5LMNJ 5IT4A 3K57A 4ERDA 1TV6A 2Y1LB 5E3QA 1GXLA 3FCWA 5DDQC 2IRXA 2IFXA 2MSSA 4IH7A 2W7AA 5C24B 2VOPA 3W61A 4X65J 3IRXA 4H4OB 4WYWA 3CJRA 3GJQB 1TZ0A 3QAEA 4GVBB 2OKQA 4KR0B 3QIPB 5F3TA 3M6XA 2IIHA 2VFVA 3UFCX 4NLPA 1LFWA 2GMHA 1NXIA 4ELVA 2JRSA 3CSKA 4I7FB 5A8RA 4YY3F 1KTVA 2MJNA 2MKSA 3S01A 5A2QY 2XMAA 4ZJOA 2YX7A 4CO2A 4C8ZA 2QL9B 3OFHA 5CD4A 3DHWC 3PFOA 1RSCA 2XB2D 2A0FB 4OYAA 4HDGA 2F4FA 3PW4A 3C6TA 1B3TA 5K8MA 4LBIA 4MIAA 2R2TA 2BW2A 3TA2A 4U8VA 3SSSA 3WIVA 1H2TZ 3N28A 1PSDA 2JNJA 1QD1A 2YY3A 2DRDA 2JH3A 2HBRB 3UN5A 3IM8A 4OI0A 2B7BB 3TEHB 1WKLA 1AFJA 4UOCA 4LF8J 4C98A 2BE9B 2ZNYA 5A8KA 1HW8A 2DNGA 4RBTA 2H5IB 3U27A 1CJKA 3DM2B 4WJBA 5EHHA 2GJIA 2U1AA 4U96A 4H4KA 4K4ZA 2HGMA 3M6UA 2GGPA 4L74A 4KQZA 1UA1A 4K5SA 1SV5A 5IC4B 1QTNB 3R9LA 3MMJA 4ECXA 3M30B 3CDEA 4IH6A 1MLAA 2Z56B 2GO8A 1WF1A 2FTRA 3LP0B 3N5FA 1L5UA 2B9WA 4ZN3A 5GAEU 1X5OA 4NZ7A 2VDIA 3KLVA 1CJVA 1T8EA 3MM5B 2QMXA 2GCFA 4DX6A 5HQ8A 3DYAA 2AMCB 2E9ZA 1MMLA 3R5CA 3NP5A 4LREA 4K4VA 5M2UA 3UO0A 4MTPA 5HQMA 3QIPA 4WZMA 3I96A 1TU0B 2DNMA 1HWKA 1SC3B 3I6PA 5BJRA 2O66A 4RKUC 3GFZA 2XM3A 3H4BA 1TKTB 1EQMA 4QR1A 5F0WA 2X51A 2VODA 2NSCA 4NCBA 2MKKA 4DV5F 1XTZA 1ZM9A 2YNHB 3NL0A 2IYGA 3EDRB 1U2FA 2CJBA 4QWBA 4JI1F 3FBFA 4H4MB 3CE8A 2CJYB 1NDKA 2JEIA 1B99A 5CCMA 4NLUA 1YI2S 2QA1A 2DH7A 3NCQA 2GZOA 3AB2B 3BYPA 4FP9A 5F8MA 2J9DA 1HNIA 2QLXA 2QFIA 3NRBA 1BUXA 2B9EA 1DQAA 2J8SA 3NEKA 2MQPA 1FE4A 3NGKA 3KHRA 3I55S 1IR1A 2GJ2A 2ZHOA 5DQHA 1HD0A 1YK9A 1ZAXA 1GK8A 4YR2A 1EQ0A 4ZDNA 1XN9A 4DV3F 1N0UA 5ETMA 1RDRA 4N7TA 3HHLC 4NLXA 1J5OA 3K7RA 3CCUS 3MGJA 2MQQA 1W2BR 4YY3J 2VQFJ 1N5YB 3MUMP 3CD0A 1SUQA 3MECA 2RQCA 1HWLA 2K1RA 3W5XA 2FVRA 4I6YA 4WP3A 3CT9A 4ED3A 2LQJA 2FVQA 1VS3A 3FRZA 4ILRA 1UWBB 3UR3C 4B17A 1P9YA 2C2MB 3OQ2A 3OVBA 4DG1A 2LU1A 2GQCA 2HZCA 4KO0B 3Q23A 4FNIA 3WC0A 4NCGA 2BJ9A 1CPZA 2AX1A 1SL2A 4DR1F 3DYAB 2XSFA 5KFNA 3BBFA 3D6HB 3SBMA 5HLFA 1MN7A 3PHTA 1LWFB 3OTEA 3ZZYA 4WU2A 1GMVA 1S0NA 3W2VB 4C11B 4DV7J 2CNLB 2D41A 1TKTA 2DYAA 2K7KA 3BBBA 5I3UB 2XZTB 2BE7D 1YJTA 2FHMA 3MD1A 2GA7A 3JTOA 4ANDA 3Q8RB 1TK8A 1LW0B 1NZAA 1TKXB 2RQ4A 2WB1D 4YP3A 1U8WA 2RF2A 5JVHQ 1FI4A 3RBDA 2ZH2A 3CDAA 1RBLA 1LWXA 4O4GB 2Z2LA 1JLEA 2W7PA 2RMLA 1DQ9A 2HMIB 2BVZA 2EG2A 3A3NB 1WKKA 2ZOFA 5KFVA 4YOEA 4ZLJA 1VRQC 4FF2A 1F9FA 1OJ4A 5HMZA 3VZIA 1U24A 4J9KA 3T1YF 2VKZG 2XMVA 3QWPA 2F8MA 3M8QB 3H4DA 2L9NA 1F2GA 3I5CA 3MF5A 2VF3A 4ZCIA 4Q45A 3OSPA 1UPMB 2B8PA 3GP9A 1HLWA 4ED1A 2IC3A 4OI2A 2J6TA 5KFTA 3M4XA 1FD2A 2P2CB 3J80U 1VQYA 4ILLA 2OSQA 2W2NP 3GZ7A 3SIPB 3PX6A 4L75A 3MEKA 4ZVHA 1UVNA 1FO1A 3AFGA 4AT1B 3ISNC 3DLHA 2CDRB 4NEZA 4CLSA 1D9FA 1NJZA 2XWYA 5A8WB 2YWFA 4PWUA 3M30A 2DVIA 1KNZA 1AYEA 3T1AA 1OSDA 1NZ8A 1VRUB 2B4VA 5SUHA 3D0GE 4JI5J 2NXJA 2CNNB 4O4RA 4F2SA 3EMTA 1YKWA 1X5TA 1EKRA 4ID5B 1KWMA 1R31A 3KJVB 5HAOA 1UZHA 1I6JA 2QMUB 1P1LA 5LMUF 2KFNA 4ZHRA 4JV0A 2OSRA 4RO0A 1D9AA 1H2VZ 3A8EA 3GIIA 4KO0A 4Q5VA 2G4BA 2DR7A 4ANEA 3LO3A 3MMAA 4NZ0A 3MURP 1BWEA 5KT5A 2OEKA 1KD1T 3IP0A 1JB0C 2YWKA 3MR3A 3HHNB 4RNNA 2HQDA 1XBWA 4I68A 2RQKA 1QLNA 3O2IA 4HACA 1RTIA 5IZHA 4OI6A 1F60B 2E5HA 3EJMA 2FJEB 1ZH5A 4P9SA 5LSLA 4KHPJ 4IOBA 5LXYA 5KT4A 3HM9A 3DGPA 3N5BA 3CJ8A 3HDSA 1NB7A 1YJVA 4LFCF 4NASA 3P5BP 5D15A 2KHDA 2XLJA 2DCUB 2XS7A 4K7QA 1IBMJ 3N6MA 1WF2A 1X31C 3I0RB 3CUNA 5DDOC 4IRKA 3T5HA 5G0RB 1G1XA 2GIQA 3AOBA 4DBQA 1TQLA 1JLCB 3HP6A 2MEWA 4QU7A 2FQQB 2B5JA 2C2OB 3HD1A 4RW9A 5A8KB 3JSMB 4M5IA 2VG5A 2CUYA 3DC2A 4NPOA 2ZC3A 3GFYA 1KRPA 5F8NA 4RW8B 4B9UA 4Q0BB 3KLFB 4W92B 2HPUA 1YRTA 2B3TB 1VJQA 3H7HB 1EIYB 1FKOA 4DSLA 2HHUA 3CJ3A 2A2DA 3M8ZA 1YBUA 1RT1A 2O3DA 2OI2A 2QIFA 4ENOA 2GVZB 4IO9Q 4I67A 2DGXA 2XCPA 5LMUJ 5D4OA 2IVYA 1ZAWA 2ZZTA 3DRYA 2LDIA 5E7OB 2E5IA 3TZYA 3KJVA 4IKAA 2AV5A 4P2MA 4KAIA 2EFNA 4KHRA 3RBEA 1KR4A 1FT8A 2FJAB 2VJUA 4M5MA 4JI5F 5C2CA 4WK1A 2OP5A 4FNHA 1JLBA 2HHHF 1AT1B 1EJ7L 3H0PA 1U4BA 4F3OA 1WDTA 3GTYX 2ZZMA 5AE1A 3RRKA 1N32F 2E9TA 4PWDA 1CQMA 3D67A 3I31A 3EGVA 1C0UA 2QC3A 3A13A 1MW7A 1Y5NB 3ILOA 4NWBA 2X1GA 3T5LA 3BF4A 4DSJA 1FX2A 5I42A 1FK9B 5BYQA 3RW7A 4QR2A 4CRJA 1TTHB 1N6QB 4ED4A 1Q5VA 1RAIB 3NGTA 5KG2A 1H6KX 4HYKA 5D4PA 1RTJB 1XJWB 2LQ5A 4ZLNA 1PO6A 4X4VA 1HQEB 2IAJB 4N5SA 4EBEA 1VQLS 3AOAA 2FIUA 5BXIA 4NLVA 4P7VA 3I32A 5L9NA 4FVMA 3K2YA 2H5JB 3DDNA 2XNRA 3DKDA 2JVRA 2XLIA
chains in the Genus database with same CATH topology
2B8PA 3GP9A 1HLWA 1F6TA 4HR2A 4DI6A 3EVMA 1NSPA 3FBCA 1KDNA 4UOFA 1F3FA 3BBCA 3GPAA 3ETMA 3BH7B 1NCLA 3R9LA 1B4SA 3PRVA 3Q8UA 4WBFA 1NHKL 3EM1A 3ZTPA 2NCKL 3Q83A 4UOHA 1NPKA 3ZTQA 1W7WA 3Q89A 1XIQA 4S0MA 1S57A 3G2XA 4EK2A 3VGUA 3Q8YA 5CABA 1NSKL 3EMTA 1JXVA 3VGVA 5C7PA 1S5ZA 4C6AA 4O0NA 3VVTA 4UOGA 3FKBA 3L7UA 1EHWA 3B6BA 2DXEA 4ANEA 3ELHA 3FC9A 2HVDA 4KPCA 3FBFA 3NGUA 2DXFA 1NDKA 1B99A 3ZTOA 3EJMA 1PKUA 3EVWA 1NLKL 1BUXA 2DXDA 4DUTA 1XQIA 2VU5A 4ANCA 3VGTA 3DDIA 4DZ6A 3NGRA 1VYAA 2HVEA 3WX8A 1NSQA 5CAAA 1NUEA 3EVOA 3JS9A 2AZ3A 1NDPA 1WKJA 3ZTRA 1NDLA 3EICA 4FKYA 3NGSA 1BE4A 4FKXA 3VGSA 4CP5A 1ZS6A 4ENOA 3PJ9A 3BBFA 3VVUA 1MN7A 1NDCA 2AZ1A 2HURA 3FCWA 3EE3A 1PAEX 1UCNA 2DYAA 3BBBA 3FBEA 2DY9A 1HIYA 4ANDA 1HHQA 3ENAA 1S59A 3ZTSA 3FCVA 4F4AA 2BEFA 1U8WA 1BHNA 3Q8VA 1LEOA 3Q86A 1LWXA 3NGTA 2CWKA 3B54A 1WKKA 2ZUAA 2BX6A 2B8QA 1MN9A 4F36A 5IOLA 1K44A 5BXIA 3MPDA 3FBBA 4W98A 1NB2A 3DKDA 1WKLA 3BH6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8P A;  3GP9 A;  1HLW A;  1F6T A;  4HR2 A;  4DI6 A;  3EVM A;  1NSP A;  3FBC A;  1KDN A;  4UOF A;  1F3F A;  3BBC A;  3GPA A;  3ETM A;  3BH7 B;  1NCL A;  3R9L A;  1B4S A;  3PRV A;  3Q8U A;  4WBF A;  1NHK L;  3EM1 A;  3ZTP A;  2NCK L;  3Q83 A;  4UOH A;  1NPK A;  3ZTQ A;  1W7W A;  3Q89 A;  1XIQ A;  4S0M A;  1S57 A;  3G2X A;  4EK2 A;  3VGU A;  3Q8Y A;  5CAB A;  1NSK L;  3EMT A;  1JXV A;  3VGV A;  5C7P A;  1S5Z A;  4C6A A;  4O0N A;  3VVT A;  4UOG A;  3FKB A;  3L7U A;  1EHW A;  3B6B A;  2DXE A;  4ANE A;  3ELH A;  3FC9 A;  2HVD A;  4KPC A;  3FBF A;  3NGU A;  2DXF A;  1NDK A;  1B99 A;  3ZTO A;  3EJM A;  1PKU A;  3EVW A;  1NLK L;  1BUX A;  2DXD A;  4DUT A;  1XQI A;  2VU5 A;  4ANC A;  3VGT A;  3DDI A;  4DZ6 A;  3NGR A;  1VYA A;  2HVE A;  3WX8 A;  1NSQ A;  5CAA A;  1NUE A;  3EVO A;  3JS9 A;  2AZ3 A;  1NDP A;  1WKJ A;  3ZTR A;  1NDL A;  3EIC A;  4FKY A;  3NGS A;  1BE4 A;  4FKX A;  3VGS A;  4CP5 A;  1ZS6 A;  4ENO A;  3PJ9 A;  3BBF A;  3VVU A;  1MN7 A;  1NDC A;  2AZ1 A;  2HUR A;  3FCW A;  3EE3 A;  1PAE X;  1UCN A;  2DYA A;  3BBB A;  3FBE A;  2DY9 A;  1HIY A;  4AND A;  1HHQ A;  3ENA A;  1S59 A;  3ZTS A;  3FCV A;  4F4A A;  2BEF A;  1U8W A;  1BHN A;  3Q8V A;  1LEO A;  3Q86 A;  1LWX A;  3NGT A;  2CWK A;  3B54 A;  1WKK A;  2ZUA A;  2BX6 A;  2B8Q A;  1MN9 A;  4F36 A;  5IOL A;  1K44 A;  5BXI A;  3MPD A;  3FBB A;  4W98 A;  1NB2 A;  3DKD A;  1WKL A;  3BH6 B; 
#chains in the Genus database with same CATH topology
 2QA4 S;  1PAU B;  3BR8 A;  4X4R A;  4HR2 A;  1IBM F;  1LXN A;  2CPJ A;  1H73 A;  4HKQ A;  5IWA F;  1K9M T;  2NLW A;  1HMV B;  1M5H A;  4OZ2 A;  1FWK A;  2CPY A;  4PPD A;  3GPA A;  4NLO A;  3PR5 B;  4J9N A;  1JKH A;  1XEZ A;  1U48 A;  3GWC A;  1NCL A;  2RD5 C;  2HGL A;  4RUH A;  3CME S;  1S9G B;  2JSX A;  3DOK A;  4HH1 A;  3TAR A;  1Q8B A;  3HJV A;  1NPP A;  4B3R F;  1I1G A;  2VAS A;  2HIY A;  4LF4 J;  3J7A 1;  4R25 A;  3KG1 A;  2QFJ A;  2PD1 A;  1DRZ A;  4O3S A;  3OTB A;  2N82 B;  3GJS B;  4M95 A;  2HFU A;  2CQP A;  3LGM A;  3QID A;  4IFV B;  2I5J B;  3E01 A;  3GSD A;  3D9B A;  3MED B;  4NCA A;  1YSJ A;  2YXL A;  4P6Q A;  4RZR A;  1TVR B;  5JJB A;  5D6G A;  5KFC A;  5FLX Y;  3NGD A;  4DF8 A;  4J9P A;  2QLJ B;  3M2U A;  5L9X A;  3R5J B;  1VCT A;  2F9J A;  1R7I A;  3TNV A;  3W8P A;  4DX5 A;  1A0O B;  3MHY A;  4JV5 J;  2K3I A;  1BLU A;  4MKB A;  2ZH3 A;  3BKT A;  1S1W B;  3MM8 A;  3P45 B;  1HHS A;  3W9H A;  1S72 S;  3X1L B;  1SH2 A;  4TYA A;  1R27 B;  2VG7 A;  1UAW A;  4PYD A;  2DD8 S;  1YBA A;  3BO4 A;  2UXB F;  1ZAV A;  2LQB A;  3OJS A;  4AQY F;  4N41 A;  1PIE A;  3VTI A;  1RTD A;  1FJC A;  1JNZ B;  4ECW A;  3RGI A;  3CMA S;  1JX4 A;  2V9K A;  1FTC A;  4LF7 F;  3C3L A;  1BD6 A;  4DR7 F;  3MR5 A;  2COL A;  2D69 A;  2CPD A;  2N4C A;  3M8R A;  4RX6 A;  1CC8 A;  3UDV A;  4ZLP A;  1XQI A;  4HLB A;  5LSR A;  1FE0 A;  3M32 B;  3BJY A;  4URQ U;  2BE2 A;  1BQM A;  2FC8 A;  1SC4 B;  1WOS A;  2AJ1 A;  2GVZ A;  2HKE A;  2V8G A;  4HHJ A;  2P8I A;  4GC6 A;  5LSO A;  5FDL A;  2MLX A;  3F44 A;  2A6O A;  4Y6I A;  4YDD B;  1U7L A;  2YKN B;  1QSY A;  5CYM A;  4UUX A;  2JEF A;  1V5I B;  2UUA F;  1RAF B;  1S1T B;  1T9U A;  2GV1 A;  2DGT A;  4NZ6 A;  1S4F A;  3ZTR A;  3HXM A;  2UU9 J;  3BGR B;  4CCH A;  4ZPC A;  5THW A;  2OHD A;  2I9S A;  3THV A;  1AW0 A;  3AQP A;  2QA4 G;  3VF0 B;  1KQG B;  2G1D A;  2CQC A;  4YDX A;  2V9W A;  1ULR A;  5C42 B;  5DQG A;  1I5O B;  4DSE A;  1T3N A;  1ZYQ A;  4O0I A;  5A8W A;  1TR0 A;  2VFT A;  1F9H A;  1SJ1 A;  2UUW A;  3PJ9 A;  5DG8 A;  1NK6 A;  2XI2 A;  5IT9 U;  5CXT A;  2NYI A;  4MFB B;  1FDN A;  3V5R A;  1VHF A;  3GIM A;  2GAG C;  3HKZ D;  1CJU A;  1U6B A;  4Z7Y A;  2FVP A;  4Y2C A;  2MHN A;  1CS4 A;  2KDO A;  1KC8 T;  1Q86 T;  5CA5 A;  1YLX A;  4XPE A;  5SZT A;  2ASL A;  4F02 A;  4KGM A;  2A10 A;  3M1V B;  3M8Y A;  3R6L B;  2LKZ A;  3UI3 A;  5HMY A;  1VC0 A;  3E8O A;  3IRX B;  1HIY A;  2YH0 A;  2LYV A;  4ZVT B;  1L3S A;  3LAN A;  2EG1 A;  2WZ1 A;  4F4A A;  3J80 Y;  2CWX A;  1S1U A;  1RHJ B;  4KE5 A;  2JX2 A;  1NK5 A;  4QIF A;  1VQ8 S;  4C4W A;  3OT9 A;  4RW6 A;  3QZ8 A;  4CYU B;  2E5L J;  2GHP A;  4KGX B;  1PIL A;  3CED A;  4HAC B;  2MZR A;  5L8R C;  2N3O A;  3VAM A;  2FC9 A;  2BX6 A;  2XZD B;  3GON A;  1JKH B;  4ITS A;  1VQ7 S;  1Y4Z B;  5AE2 A;  4DR3 F;  4ECS A;  4LF5 F;  2F4V F;  4TNO A;  2M2B A;  1MU2 B;  2Q79 A;  2RRB A;  2H9Z A;  3CW2 C;  4OZ1 A;  3R7N B;  2V2Q A;  1WC1 A;  3T9N A;  5KG6 A;  3P49 B;  3KYL A;  4W98 A;  2W8L A;  5DZ6 A;  2ZWP A;  3TJ9 A;  1SH0 A;  3BH6 B;  4U8Y A;  3EX7 B;  1XMQ F;  3BRE A;  4X62 J;  4LFB J;  5FII A;  3GV7 B;  2UU9 F;  4JV2 A;  2HHP A;  3MCS A;  4ED6 A;  1FNM A;  2XUL A;  2W9C A;  4DV5 J;  3FBC A;  1VFJ A;  4P7T A;  2EC0 A;  3Q24 A;  4MIW A;  4RW4 A;  3SCJ E;  1IBC B;  1UTA A;  4J9M A;  2D9O A;  3H5X A;  1CVJ A;  4X4U A;  3V6D B;  4EUV A;  2HHH J;  2E1P A;  4ZCM A;  3ET6 B;  3DLL Q;  2J8A A;  3KLI A;  2B9X A;  4HL9 A;  3RB4 A;  4C7Q A;  1XR7 A;  3NOG A;  4GRS A;  3CJK B;  5DGA A;  1NAQ A;  2DT9 A;  3AXM A;  4WPA A;  4FS2 A;  3FSY A;  2R7O A;  2ZM6 J;  5M2P A;  1UVI A;  1RKI A;  1KOO A;  3CCJ S;  2HRY A;  3GJT B;  4XDD A;  5DDR C;  5ETV A;  2LXU A;  4IFV A;  2Y8Y A;  3A3P B;  4FDF A;  2QO3 A;  2KH9 A;  5H9F K;  1VQM S;  2WVB A;  3UD5 A;  3NKY A;  5LL6 d;  4X2B A;  2ZOG A;  4ZVE A;  1Q81 T;  2DNL A;  1NEE A;  1CUL A;  1RAD B;  4YME A;  2AYE A;  4WF9 Q;  4E98 A;  4XO0 A;  1RYS A;  2CPF A;  2JC0 A;  4TU7 A;  4RBU A;  1AUS L;  3O8W A;  3G8T A;  1IQZ A;  1S1W A;  3MDF A;  1QE1 A;  4J5O A;  2V2V A;  4MYU A;  1Q8K A;  5B0C A;  1BQN A;  1VOM A;  1RT7 B;  2AJQ A;  3MFI A;  2HHV A;  3EVW A;  1B7Y B;  4NLG A;  4YB7 A;  3OXG A;  4DR6 F;  4LF2 A;  3A8J A;  1LOU A;  4TU9 A;  1NK4 A;  4GMK A;  2ROG A;  4BC7 A;  5L39 A;  4J9L A;  3KK1 B;  1JXL A;  2C3U A;  3R7S B;  4DV4 J;  1P8G A;  4PQA A;  5J1E B;  2IA0 A;  1SKS A;  1VIS A;  2WBM A;  2K2P A;  4DUT A;  5EWG A;  4X4O A;  4X4P A;  3HHL B;  1UFL A;  4DR7 J;  1RU2 A;  1RJJ A;  2BUN A;  3VGT A;  5CCL A;  2UUB J;  1TAU A;  2IJR A;  2G2O A;  4OYO A;  5E5N A;  2DK2 A;  1G4C A;  3MEC B;  4NLW A;  3WX8 A;  3OL6 A;  1JLA B;  2R9L A;  3PY8 A;  4MFB A;  1IN0 A;  2CYY A;  2F8H A;  2AZ3 A;  3LUY A;  3AD7 C;  4P2X A;  2Z57 B;  3Q0A A;  1VQ4 S;  3QFW A;  4DUY J;  1VRT A;  4KFB A;  1IBK J;  2RS2 A;  3DXS X;  4K2X A;  4ZK7 M;  3D54 A;  1O51 A;  2HQI A;  2MQO A;  2MKI A;  2H48 B;  2KFY A;  3DLJ A;  3UD3 P;  2PSZ A;  3UN3 A;  2XGP A;  4EBD A;  2FLP A;  5D0G A;  1GNK A;  3VAJ A;  4ZKA A;  3VAK A;  3BEG B;  3SCI E;  5K20 B;  4CO5 A;  4IG3 A;  4OZJ A;  5KFR A;  3TAP A;  2RU3 A;  4FBT A;  2DY1 A;  1Q82 T;  1HI1 A;  3FQL A;  2G2Y A;  1SUQ B;  3CJT A;  3FFI B;  4C11 A;  3JYT B;  3VWS A;  3W60 A;  2EFG A;  4JI2 F;  3WHI A;  3KLG B;  4QWD A;  2MZJ A;  2ZIT A;  2OPP A;  5KFH A;  2BRL A;  4DPX A;  2GVD A;  3HO1 A;  3R2C J;  5B08 A;  2ATL A;  4P73 A;  3GV5 B;  1JWW A;  1FCA A;  4AFF A;  1GAO A;  4RUB A;  1Q0N A;  2CG4 A;  2JVO A;  1KFD A;  3D6T B;  1VQ6 S;  4PWD B;  2YKP A;  2AEJ A;  3UVJ B;  3H5S A;  2DHX A;  3TP2 A;  2AYB A;  3RW6 A;  4B9T A;  1JLG A;  2DJW A;  2OPR B;  3D28 A;  2OFH X;  5KFB A;  2R3V A;  3UCG A;  3EZO A;  3HHK A;  1JLQ B;  1FDA A;  1T9Y A;  3SV4 A;  4K0K J;  5ETR A;  2XMK A;  3OTO J;  1PJ5 A;  2H1Y A;  3IWL A;  1SJ4 P;  4DPW A;  5KFD A;  2BM1 A;  1DBD A;  2HWI A;  5K5M A;  3QRQ A;  1RAB B;  4A8F A;  3KK2 A;  1NB2 A;  1OY6 A;  2B9Y A;  2E29 A;  4I2P B;  3EPI A;  4G1Q B;  1Q7Y T;  3KJF B;  2W24 A;  2J9D E;  1XMB A;  4KHM A;  4U7U D;  5J1N A;  1QE1 B;  1EET A;  4U7U K;  2MXY A;  1RU1 A;  1V3Z A;  3GJR B;  1J5E F;  5DLG A;  4B08 A;  4O3N A;  1SQF A;  4UOF A;  2ZBQ A;  4DSK A;  1W2I A;  1NK8 A;  5AXK A;  1AZS B;  4JI4 J;  4LF6 F;  3KMS A;  3OVA A;  2UXD F;  2Z0G A;  3EXC X;  5E3A A;  4U7C A;  3G96 A;  4KBI A;  4PUO B;  1U1P A;  1V5V A;  3GE9 A;  2HND A;  1S6Q A;  3Q83 A;  4ZN1 A;  4DR4 F;  4MK7 A;  2XSJ A;  3GYX B;  3W9I A;  1DAX A;  1T3O A;  1W7W A;  2V8H A;  3I87 A;  3RB6 A;  4CO4 A;  2OO4 A;  1SIZ A;  2CAD A;  2C3P A;  2XZW A;  3HFV A;  1TKD A;  3CDU A;  5IM0 B;  1JXV A;  1O0P A;  1SPB P;  4QIE A;  3C16 A;  4WFX A;  4WFB Q;  2IM1 A;  2Y0S D;  4DS5 A;  3QJP A;  4JYA J;  2W8K A;  4OYX A;  1W26 A;  1FEH A;  2OH2 A;  3GG0 A;  4I7F A;  2D3Z A;  3LAM A;  3M2V B;  1YX2 A;  2PT0 A;  2IA6 A;  3GCW P;  1HBO A;  1VQO S;  2MKC A;  2HQ3 A;  2RDD A;  5B0G A;  1GH8 A;  2CQH A;  5H9E K;  2BRK A;  2LQ9 A;  1TV6 B;  1FXD A;  4C48 A;  5EX3 A;  3RBZ A;  3PDN A;  1PKU A;  3KWM A;  3HUL A;  4M5L A;  3SXL A;  5A2Q U;  1E6V A;  4USW A;  4YR0 A;  1IKY A;  1HWU A;  2YWW A;  3KFW X;  1WHW A;  2HFV A;  3I0R A;  2QN6 B;  1PJ7 A;  2G13 A;  3R5D A;  3N6N A;  4LRA A;  4GKK F;  4QQB A;  4PZV A;  4DSF A;  4RU9 A;  2DR8 A;  3DGV A;  4KJI A;  4Q8E A;  2AJF E;  1VIO A;  3TJA A;  2FZK B;  4J9V A;  4A8K A;  1VI7 A;  2OPR A;  4R0E A;  1Z2L A;  3U1N A;  1Y5I B;  3DI6 B;  1LQ9 A;  2EVZ A;  5KFU A;  1SQE A;  5KFO A;  1T03 B;  2DHS A;  4OX7 A;  1U1K A;  4JI7 F;  2V69 A;  4FKY A;  4CTA A;  1S9F A;  1VC6 A;  4B9N A;  1FVQ A;  1RLD A;  4FF1 A;  1UPP A;  1PCA A;  4ES3 A;  3S7R A;  5BR8 J;  4WTO B;  3CC2 S;  3ILJ A;  1QM9 A;  3DMJ B;  2F5G A;  2Q66 A;  1ZOT A;  5F8H A;  1VBY A;  5G0R A;  2WOM B;  2DNY A;  4Y2A A;  5DS7 A;  3V4M A;  4F25 A;  4IOC Q;  2LXI A;  2RQM A;  1DTQ A;  2X3G A;  3GR1 A;  4ATN A;  3OW2 R;  3CPW R;  8ATC B;  3EE3 A;  2VFS A;  2LEA A;  3E2E A;  1U0S A;  2C42 A;  2G1H A;  3GV8 B;  1HBO B;  1S6P A;  3CMQ A;  2KHC A;  4ZP7 A;  2H4Y B;  2BV3 A;  4ECV A;  2FGO A;  3IRW P;  4A8W A;  3TYT A;  2R7V A;  1GTE A;  1ZA1 B;  2XHW A;  3RUB L;  5LT5 A;  1CJV B;  2KXN B;  3PO4 A;  4I4B A;  1JJ4 A;  1O6X A;  1RHK B;  3NNC A;  1VQ5 S;  5IM0 A;  1O5J A;  2BBE A;  3Q86 A;  1HNV A;  2HIQ A;  1HNI B;  2RB7 A;  1ARO P;  3CJ2 A;  4DFM A;  1KVJ A;  4U95 A;  2JZ5 A;  3W1Y C;  2HNZ A;  2QLW A;  2ZHA A;  1B7F A;  2LEC A;  1MN9 A;  3IWN C;  1MRO B;  2FJW A;  3OFF A;  4NRT A;  3W5Y A;  4RWW A;  2ZJQ Q;  1K44 A;  3MOZ A;  3MPD A;  2DR6 A;  2GS8 A;  2DEI A;  4LRD A;  3DLG A;  1C0U B;  5KAK A;  3C6U B;  2ZM6 F;  2PE8 A;  4ED0 A;  2J7W A;  2GIR A;  4YN3 B;  3IGV A;  3H5U A;  2AKW B;  3NNH A;  1LW2 A;  3T1H F;  1OO0 B;  4DDF A;  1N4L A;  2ZH4 A;  2ACM A;  3I0S A;  5JMN A;  1LWE B;  4DPU A;  5IQQ A;  1SH3 A;  2XQC A;  2M52 A;  4P75 A;  4EGL A;  3AJ1 A;  4IO1 A;  3BKU A;  1NHK L;  2J5A A;  1S4E A;  1X7V A;  2G2Z A;  2NCK L;  2B4U A;  4NI2 A;  5A76 A;  2ZH7 A;  4M5D A;  3Q2T C;  3PX4 A;  3H8Y A;  4EMD A;  3F73 A;  3W2W A;  4S0M A;  2KYZ A;  3VAG A;  2VV5 A;  3M7V A;  4KY3 A;  4DV2 J;  4Q2L A;  2CZ4 A;  3Q8Y A;  4WCE Q;  3EGZ A;  4CT8 A;  4LIW A;  2VBW A;  5CD4 H;  2WVC A;  2DRA A;  4F0K A;  4JI8 F;  2XEX A;  4ES2 A;  2ACY A;  2YPY A;  2LP4 A;  2IRY A;  2AYM A;  2R7Q A;  4DXL A;  4WP8 A;  1WEZ A;  5HMW A;  1S99 A;  1R89 A;  3ZZU A;  4USV A;  4LVO P;  3WZ0 A;  4X4S A;  2NYH A;  4HTI A;  1HI0 P;  3KOA A;  5DRK A;  3CIZ A;  1IKV A;  3CXC R;  3HZE A;  3MED A;  3FK4 A;  1JJ2 R;  2WRM A;  2HAI A;  3P96 A;  4FYY B;  3IBW A;  4WWS A;  2V67 A;  5GAG I;  3IBC B;  3HX9 A;  2PII A;  3H59 A;  5T7L A;  2KZM A;  4D3H A;  3FQK A;  2AX0 A;  4DR5 J;  1D3W A;  2R2U A;  2DR5 A;  2F3J A;  4J9U E;  1CEZ A;  2VJV A;  5ETO A;  2HAF A;  1SI9 A;  1HL6 A;  3ZZT A;  4HI2 A;  4URS A;  4PWW A;  3RG6 A;  3KK3 B;  5GVQ A;  1IKY B;  3PW7 A;  2A3J A;  2MY7 A;  1UJ4 A;  2KU7 A;  1R8H A;  2UV8 A;  1XR6 A;  3PHE A;  4JUZ A;  4C97 A;  4PXE A;  3MD3 A;  1FXL A;  1DUR A;  4C8N A;  2HVE A;  4KSE B;  4OIX A;  4P10 A;  1RQ0 A;  1RT4 B;  4PKD B;  4C8L A;  4UW2 A;  1TL1 B;  2CPX A;  5I4M A;  3P4U B;  4MYT A;  2H4W B;  4HHH A;  2HNZ B;  1HPZ A;  3RB0 A;  4P74 A;  1S1T A;  1WEY A;  2V4J B;  4ZVG A;  3ZO7 A;  4YEA A;  4Z2X A;  2R8K A;  3KJN B;  3OBI A;  2M9K A;  2VA2 A;  3PFE A;  2N7Y A;  1S6P B;  1HNX J;  1QAY A;  1R8A A;  1VMB A;  2CQB A;  4XDC A;  3A4T A;  1CJU B;  3G71 S;  3KDO A;  3TJ8 A;  3BN7 A;  4DCJ B;  4OHW A;  4CDI A;  2DGS A;  1OYE A;  3TI0 A;  2JLG A;  2GX8 A;  2FD2 A;  4WFA Q;  3I0S B;  4BCA A;  5MLC V;  5G4D A;  4L6V 3;  5D4N A;  2AQ4 A;  1J27 A;  1KLN A;  4ELT A;  4ED5 A;  2DGW A;  3OLA A;  4RL1 A;  1GXT A;  2C3Y A;  2V68 A;  2YQ0 A;  1P27 B;  3LAK A;  4KC5 A;  3THT A;  3N79 A;  3PW5 A;  1M5P C;  2J0Q D;  3ZTS A;  1KN6 A;  4O3O A;  3D0I E;  5T14 A;  1UVM A;  1VLY A;  1FHT A;  4RW7 B;  5KFF A;  4IG0 B;  2H3E B;  5KFK A;  4ID5 A;  2H54 B;  1G7C B;  1KOH A;  2CZV C;  2P5V A;  4WFZ A;  4CYU A;  1QAX A;  1UEK A;  2ATC B;  1WG1 A;  2LMI A;  1KON A;  1MU2 A;  3B8H A;  3L7P A;  4TYB A;  3WX4 A;  2XMM A;  2RSQ A;  5ETK A;  4PG5 A;  1C1C B;  2WSF C;  5KFZ A;  2W1B A;  2UVW A;  3LPE A;  2DH9 A;  4K2J A;  2H51 B;  1RIS A;  5GME A;  1LW0 A;  3CTR A;  4TY8 B;  4DU8 A;  3G6Y A;  3K5N A;  1S79 A;  1RT4 A;  2AYG A;  3ULH A;  5J2Q B;  5CQG A;  2WVF A;  1B0P A;  2KJV A;  1FNO A;  5KFI A;  3NCP A;  2FJD B;  4J9O A;  2D3O R;  4NML A;  3W62 A;  3EUN A;  3BBC A;  3QSY B;  4JI0 J;  1RI7 A;  2ZH6 A;  3D3C J;  3D5M A;  1REV B;  1RA6 A;  3AH6 A;  5LJ5 Y;  1UVK A;  2RJZ A;  2KT3 A;  3G82 A;  3HKW A;  3I4H X;  4MAK A;  3DLK A;  1NKB A;  4FPI A;  2PMW A;  1M0S A;  2OPQ B;  3FUY A;  2KXF A;  3IAM 9;  4HTJ A;  1M1K T;  4XTT A;  3LW5 C;  2HHX A;  2AJ4 A;  2B43 A;  3D6F B;  4DCP B;  3T5K A;  3RYL A;  2HGN A;  1S7I A;  3GIL A;  3QRR A;  3MCN A;  5C7P A;  2FVC A;  4O4G A;  2LDY A;  4ZP8 A;  4UST A;  3VCD A;  1DTQ B;  2BJE A;  4RNF A;  1RAC B;  3FKB A;  1DFD A;  2ZZN A;  5AXM A;  4BS2 A;  6FD1 A;  3UR0 A;  3G4S S;  3HSG A;  4Q2M A;  4UZC A;  2XY5 A;  1P9Q C;  1F3V A;  2EBE A;  4JB8 B;  2P9E A;  1JLF B;  5EGY A;  4CH1 A;  5F3Z A;  3KK3 A;  5I3U A;  1VQP S;  1DTT B;  4G1I A;  3IR6 B;  4Y2M A;  4FF4 A;  2IDE A;  4F3Q A;  1U2C A;  4KPC A;  4DOZ A;  1EAY C;  1TUG B;  1JXE A;  1AA1 B;  4J91 A;  3KTQ A;  4G65 A;  3OV7 A;  1HQE A;  2IAJ A;  4AL6 A;  1EP4 A;  4DR2 F;  5EUH A;  3G8S A;  4WZQ A;  2DNK A;  4NE9 C;  2G0I A;  4X64 J;  1NK0 A;  2M8D B;  2DXD A;  2R2S A;  4DR2 J;  5HBM A;  4QWE A;  2ZFH A;  4MMO A;  3GIK A;  3NAH A;  2FB0 A;  2CQ2 A;  1LV5 A;  2AJ2 A;  2VQE J;  4FZV A;  3T41 A;  1IKX B;  2AD9 A;  3R97 A;  1HA1 A;  1GEH A;  4DPY A;  4FYD A;  1IJF B;  2IC3 B;  1RWV B;  3HHE A;  3OXF A;  2AP6 A;  5KG1 A;  2Y1J A;  2VPX B;  1G6B A;  1S9G A;  2MKY A;  1K1S A;  3NG8 A;  1Z2Z A;  2YNI B;  1YIJ S;  2XO7 A;  4USJ C;  2ROE A;  4B9L A;  3BB5 A;  4UUW A;  1X5P A;  1HYS B;  3QGG A;  2LXF A;  2HHT A;  4FKX A;  4NXN F;  3M2R B;  2WW4 A;  1R8P A;  1S0V A;  2HHW A;  4WU3 A;  2CNO B;  1Y9O A;  5T41 A;  4F4W A;  5F8L A;  4F50 A;  1SKU B;  4IG3 B;  3UW1 A;  2R2R A;  4OYZ A;  1FTR A;  2GIF A;  3C6T B;  4RNH A;  1GT8 A;  4RW8 A;  3PR4 A;  1T11 A;  2DH8 A;  2K7J A;  2FJX A;  1RHU B;  2JFK A;  2DGQ A;  2HLU A;  5JXS A;  1RTZ A;  1RAH B;  3T6J A;  1HWI A;  4N8O A;  4QYR A;  2FDN A;  1N33 J;  2OPP B;  1M5O C;  4Z7C A;  5HRO B;  4OYB A;  2BKN A;  2VG7 B;  3IR7 B;  5D3G B;  3AA9 A;  2CQ0 A;  3ENQ A;  5GAD I;  2RDI A;  4W4M A;  5J2M A;  7FDR A;  3Q8V A;  5JVG Q;  4DQR A;  1ITP A;  1WHX A;  2YKM B;  3BO3 A;  2EKN A;  5CYQ A;  3I9Z A;  2KYX A;  2VL1 A;  3OUY B;  3QGP A;  3T5J A;  4DV3 J;  1XNQ J;  3CCL S;  4WXW A;  4B9M A;  1QVF R;  4F36 A;  4A47 A;  1BGX T;  1IQT A;  4JBC A;  2D3O 1;  1R8C A;  2DIU A;  5AXL A;  3PIO Q;  3UCZ P;  2DNR A;  1UA0 A;  3PTW A;  3PIP Q;  2HS4 A;  1MMN A;  1EET B;  2ILZ A;  4OJG A;  5I42 B;  3CCS S;  1PC5 A;  1TFW A;  1RCX B;  4I0W A;  2MQN A;  2Q6B A;  2V0N A;  5HVH A;  2R7R A;  1OIA A;  1QAJ A;  4O3P A;  5BR8 F;  4BBY A;  4ECT A;  4DF4 A;  3D1H A;  5D4L A;  4FVC A;  2R42 A;  1N36 F;  4JI1 J;  3AJ2 A;  3D1O A;  1LXJ A;  3PKM A;  1TUV A;  5B0B A;  1E6Y A;  3AOC A;  1ROF A;  3R5A A;  3OVS A;  1S6Q B;  4ECR A;  1JLB B;  3EM1 A;  1HQ2 A;  2DCL A;  3M2R A;  4URG A;  2C3O A;  2LQ8 A;  4OLP A;  4TQS A;  1H7X A;  1KFS A;  4C3M A;  1FWL A;  1PYO B;  4I2P A;  2L41 A;  1FJ7 A;  1DTT A;  2NZ4 A;  5L1L A;  4LBH A;  1KHV A;  1DLO A;  1EAR A;  2EFP A;  1VQK S;  4OI1 A;  5CAB A;  1NSK L;  3BGO P;  2DGO A;  3CDB A;  1L3T A;  1VQ9 S;  7FD1 A;  1H98 A;  4K4W A;  1AZS A;  1K1Q A;  4K59 A;  4FXD A;  3BSN A;  5IT0 A;  4F0M A;  3FDS A;  2YBV A;  1H2U X;  3GU0 A;  3L7U A;  4R8U B;  2PA3 A;  5HVG A;  1GMU A;  1IR0 A;  1S49 A;  2HND B;  2FLL A;  3KMQ A;  3KUH A;  3JAM U;  3PV8 A;  2Y8W A;  1O8B A;  3PZP A;  3OXL A;  1J5E J;  4CM2 A;  1UFW A;  1KS2 A;  3WC2 A;  5HLF B;  4CLF A;  2VIH A;  4O3Q A;  2AGQ A;  1IKX A;  4WKR A;  2DXF A;  1KBR A;  2VPW B;  3FEZ A;  4AXI A;  2CQ3 A;  5CH7 B;  2JOQ A;  4ZOS A;  4U6P A;  3T3F A;  2UXD J;  3L95 X;  1X4A A;  1UMJ A;  3TX0 A;  4DX8 H;  1A9N B;  3NCR A;  3TEG A;  4ZCL A;  1T9X A;  3ZZR A;  1DAR A;  1N32 J;  5DG7 A;  1TUW A;  2V2K A;  3PCO B;  3C14 A;  1NBE B;  1WI8 A;  2DPI A;  3OHA A;  3JTP A;  1SVD A;  1C0T B;  1OYD A;  3DDI A;  2XY7 A;  3CC7 S;  2MB0 B;  1S1X A;  2Z2M A;  5D0E A;  1VYA A;  1REG X;  4L76 A;  1NSQ A;  3JSB A;  4ZP6 A;  4QCL A;  2IY5 B;  3O3L A;  3EVO A;  4NLY A;  2Y0B B;  1OY8 A;  2MZ1 A;  1Y00 A;  2QT7 A;  3F0N A;  3TRG A;  4ETX A;  2YNF B;  5A0Y A;  4PG8 A;  3K5L A;  1RYR A;  1RT3 B;  1TVR A;  1Y11 A;  2HLT A;  5FD1 A;  1NDL A;  4ZVQ B;  4N47 A;  3W2V A;  4CLL A;  1F0X A;  1RKJ A;  3MAQ A;  2RDJ A;  4J37 A;  1IKW A;  1KP6 A;  3JQK A;  3QYY A;  4HT5 A;  1RHM B;  3MR6 A;  5B0E A;  2IBK A;  2EK1 A;  2QE5 A;  3FZB A;  2X1F A;  3HCX A;  4CH7 A;  4ZJQ A;  1XK8 A;  3E3X A;  8RUC A;  3M8S A;  4IRC A;  1MMD A;  4IUF A;  1ZS6 A;  1U09 A;  2GC8 A;  4LRB A;  4PPZ A;  4F26 A;  1VQN S;  2O1P A;  2PN6 A;  2V8D A;  2ZOM A;  1TMM A;  3DRS B;  2XMJ A;  2CQI A;  4FYV B;  4NLR A;  3BQ0 A;  1PYS B;  2VUG A;  1VDH A;  5F41 A;  2JFD A;  3DLE A;  1WI6 A;  3L7O A;  4CLY A;  3M9N B;  2W9B B;  1RBA A;  2I5J A;  4EBC A;  1SJ3 P;  2F8E X;  1NME B;  2FZC B;  2P6T A;  4OQJ A;  4RPF A;  5I3Q A;  2ASD A;  4LF7 J;  1RWP B;  5KFG A;  1Y3J A;  1JIH A;  2J7U A;  5C25 B;  1WAC A;  2Q6C A;  2J6S A;  2PA8 D;  3QT5 A;  4UF4 A;  3QPI A;  4A8X A;  2DY9 A;  2QSW A;  3NLC A;  1HHQ A;  4M5N A;  3ZXW A;  7AT1 B;  2CG8 A;  2FJB B;  4ZIV A;  4ECQ A;  2PI4 A;  4JV5 F;  2A6M A;  1Q79 A;  3BZQ A;  2N4D A;  3RJM B;  2BEF A;  4LQ9 A;  1NU4 A;  2BJ8 A;  2MMY A;  1K47 A;  3M8W A;  4E0D A;  1XNR J;  1SJQ A;  2EI5 A;  3MM8 B;  4WTY A;  2BR0 A;  4C8O A;  3G6X A;  1LEO A;  2KN4 A;  2DR9 A;  3BS9 A;  2YKQ A;  3MEG A;  4I6A A;  4M5J A;  1RE1 B;  5HQL A;  3FSI A;  1N8R T;  3F41 A;  3DLB A;  2AEF A;  3RTV A;  2ZUA A;  2YKM A;  2Y1R I;  1S10 A;  2RAQ A;  4OZ5 A;  1KLM B;  3UPF A;  2ASY A;  3BSO A;  3C6U A;  3MMA B;  5DQI A;  4FS1 A;  2C28 A;  1Q78 A;  2F4V J;  3I82 A;  2ABY A;  3HHL D;  3MI7 X;  3GR0 A;  3DOM A;  3DOL A;  3PKY A;  1S1U B;  1VRU A;  4NL5 A;  2EXU A;  3M32 A;  2RUS A;  1GMW A;  3DRP B;  3IAS 9;  5HL7 Q;  4OJ3 A;  3KLE B;  3C2P A;  3SEO A;  1CC7 A;  2VON A;  3WBZ A;  1B64 A;  2POK A;  2HBZ B;  3M9O B;  2V50 A;  3MTK A;  3FEY B;  1FES A;  3O6Q A;  3UCU P;  2BAC A;  3HF5 A;  3P5T L;  1SC6 A;  2YNI A;  1HBN A;  4ED7 A;  4MK9 A;  1Y5L B;  1NJY A;  2Y9H A;  4LF6 J;  4EFA C;  3M8P A;  4B02 A;  2ALZ A;  2CQ4 A;  3DRS A;  3Q89 A;  5MAO A;  4EK2 A;  4QIG A;  2R7W A;  3LP1 A;  3J7Y U;  3VQT A;  1UFK A;  3DU6 A;  5CZX A;  3EXY A;  4EU0 A;  1C1B A;  2LEP A;  3EDQ B;  2PC6 A;  3N01 A;  2ZBI A;  5HK4 A;  3US5 A;  5KOW A;  1SL0 A;  1HHT P;  2VD3 A;  2GQQ A;  4C6A A;  2XCA A;  1FKA F;  1SKW A;  4DN9 A;  1K8A T;  1TKZ B;  4ZVU B;  2W2O P;  4OV1 A;  4RBV A;  2XMT A;  4O44 B;  3IXQ A;  2EK6 A;  2DXE A;  1FKO B;  3KXD A;  2V4Q A;  1UJ5 A;  1KVK A;  2JDJ A;  4WXO A;  4ZHR B;  5B0F A;  5D0H A;  3J7A N;  1YTY A;  4DSI A;  4A8Q A;  5HI7 A;  3V4I A;  1V3S A;  4DV6 F;  1S1X B;  3D1Q A;  4HT7 A;  2ZH8 A;  3MFH A;  2HRT A;  1GXU A;  1Q1K A;  2W9C B;  1OMS A;  4NOH A;  4ZS6 A;  2YKO A;  3IS9 A;  2D3U A;  2P9G A;  4OYW A;  2DTJ A;  2MLY A;  1FKP B;  1PYT A;  1MWZ A;  2IVM A;  5IC6 B;  3O5T B;  1WHV A;  4F4Y A;  2D9P A;  1NJX A;  2FHK A;  2DRB A;  1WG4 A;  3H42 A;  4IDK B;  3PXG a;  4ECZ A;  2J7K A;  2ZJP Q;  4DQP A;  4B3M J;  2FHJ D;  4NYP A;  1HBM A;  4LF4 F;  3R3T A;  2SXL A;  5KFX A;  2CVI A;  2ZEJ A;  3OTO F;  2NR0 A;  4ZVS B;  1YHQ S;  3IR5 B;  1FRI A;  1WF0 A;  2FYX A;  1FFS B;  5CAA A;  3CUL A;  1Y0H A;  3TR5 A;  1NUE A;  1K0T A;  2LFV A;  5GAH U;  3BO2 A;  1IM4 A;  2XLK A;  3UQS A;  2B5J B;  3HHD A;  4N8N A;  2KT5 A;  4OZL A;  3JSM A;  2IPO B;  1S97 A;  4PQU B;  1FJG F;  3J7Z T;  3RR7 A;  3VAI A;  4HEA 9;  1RAA B;  2QYG A;  4FYW B;  1CJT B;  4X84 A;  2CDQ A;  3FNN A;  4OYI A;  2BOA A;  2Z4P A;  5ETT A;  5J1E A;  4USH A;  5C25 A;  3V6D A;  5HAN A;  3IM9 A;  4X4T A;  3VQS A;  4YR3 A;  4DV0 F;  4DQS A;  1FJG J;  2G9O A;  5B0A A;  1RT5 A;  2WW8 A;  4GKJ J;  3NS6 A;  2IJN A;  4V1A k;  4Q44 A;  4X62 F;  4OZ3 A;  4Y3C A;  3DRP A;  3TOQ A;  2ZJR Q;  3FMB A;  4D3G A;  3ENW A;  3LWL A;  2R8I A;  3K0J A;  2R7U A;  1NDC A;  2C22 A;  4C9D A;  2V8P A;  3OSN A;  1HMV A;  4M5G A;  3PVX A;  1SKR A;  2WBR A;  3CD6 S;  4ED2 A;  4A8S A;  2HZV A;  3PX0 A;  2ZWO A;  3OL7 A;  4NA1 A;  3MAA B;  1RA7 A;  2ZE2 B;  4X4Q A;  2YPZ A;  3POT B;  3W5Z A;  5KT3 A;  3TZX A;  1KQS R;  2UXB J;  5B09 A;  1F5B A;  3R27 A;  2V63 A;  1RT2 B;  3NBP A;  1JMT A;  1RUS A;  2W2P P;  2HFN A;  2A1B A;  4C0B A;  2I2Y A;  4K8R A;  4LJM A;  3J7Y I;  1RHQ B;  2IMO A;  3H20 A;  4OI3 A;  4CM0 A;  3OD2 A;  2HHQ A;  3CO9 A;  1H72 C;  5IV4 A;  4JV1 A;  1TKZ A;  3G6V A;  4ZCK A;  4BLG A;  3NY0 A;  3BV8 A;  3TWZ A;  2EFO A;  1VRT B;  3R8Y A;  3QO9 A;  2XYG B;  4QOT A;  2HQC A;  2OIH A;  4B9S A;  3AY0 A;  5A8R B;  3OL8 A;  4Q0B A;  2B4O A;  1J2V A;  3HFK A;  5HJY A;  4RNO A;  1G2E A;  3DRR A;  1VQS A;  2C3M A;  2MY8 A;  4JP8 A;  5KFP A;  4MKV A;  1AXQ A;  4AD6 A;  1YIT S;  1ZTW A;  2OAU A;  4FN5 A;  3E01 B;  1NND A;  2NPI A;  2V34 A;  1C1B B;  1WOR A;  2GML A;  2KVI A;  2QV6 A;  5E3R A;  1ZM4 A;  3QNW B;  5LOQ A;  5KFW A;  3KLE A;  3TZW A;  1U26 A;  1QAI A;  3O1L A;  3MZI A;  4M5H A;  3W63 A;  1ZTT A;  4WBF A;  2GFF A;  4H4O A;  1VBX A;  1NJI T;  4G1P A;  5KFS A;  3LWM A;  2QL7 B;  2RHQ B;  3N6L A;  5DET A;  5B7W A;  4AXJ A;  2CJX B;  1K0V A;  2YX1 A;  4LVN P;  1S57 A;  4LSZ B;  2MTL A;  3UVJ A;  4LRF A;  3IA0 A;  3DN9 A;  5DZ7 A;  3CCT A;  3HSJ A;  3N9U C;  2GJF A;  2QSF A;  4EI2 A;  5H9F J;  4DV1 J;  4F4Z A;  4M94 A;  1N48 A;  1XC9 A;  4GKJ F;  4KRW A;  5KG4 A;  1N34 J;  4KHP F;  2IRU A;  2DO0 A;  2X1A A;  4M5K A;  3UD4 P;  3ZZZ A;  1MWY A;  2V5H G;  3R7B B;  3MAA A;  2C2D A;  3IWX A;  4ELU A;  2OML A;  3BYR A;  1SJR A;  1VHI A;  3ZFV A;  2HQF A;  2OEM A;  5L1I A;  1RP5 A;  2BA9 A;  4QYZ K;  4NLD A;  1WOO A;  3ELH A;  4F7V A;  2AWZ A;  2BAB A;  2HNY B;  3H40 A;  4DQI A;  1VR6 A;  4MIB A;  1LKZ A;  1JLF A;  3B82 A;  3S1T A;  2PEH A;  3SI8 A;  2UXC F;  3DRX A;  1IM6 A;  3KNG A;  4KGV B;  2DIV A;  3HJF A;  5IFM A;  1HW9 A;  2UZA A;  4E8U A;  2B51 A;  3CGI A;  3LP2 A;  4X4N A;  1S9E A;  2K06 A;  1RT6 A;  4I2Q A;  3LQV A;  1F2H A;  2LLZ A;  1UW9 A;  3I5A A;  1WC6 A;  4R0J A;  4WKY A;  4TVA B;  4TQR A;  1VLO A;  4DV7 F;  3V81 B;  3UDE A;  2O67 A;  3DLG B;  4F8R A;  1WEL A;  3KLH B;  2VC1 A;  3TAM B;  4Z37 A;  5KT7 A;  2RS8 A;  5C2G A;  3H2V E;  2KKH A;  1RT2 A;  3NBP B;  4MKY A;  4DZ6 A;  1K73 T;  1D09 B;  3QT8 A;  2U2F A;  4OX6 A;  3G9C A;  2CXE A;  1HBM B;  1NH8 A;  1U49 A;  1HBU A;  4JI4 F;  1M5S A;  1ZZN A;  1HNV B;  4CNY A;  5FDL B;  4C2M A;  4JI3 F;  1WNE A;  4Y2K A;  2GNK A;  4L72 B;  2R8J A;  3EIC A;  4AE5 A;  1X4F A;  2HS0 A;  4LR7 A;  2DEJ A;  2YVS A;  1F1B B;  5KFL A;  2XC9 A;  4CIO A;  4Q8F A;  2ZE2 A;  3RRG A;  1RWU A;  2CPE A;  3CJ4 A;  4PG7 A;  3TVK A;  4X66 F;  2B7C B;  2HBY B;  1U1Q A;  3L09 A;  3VGS A;  5J1P A;  2WCX A;  3TAN A;  2KJW A;  1D0E A;  4PUO A;  3RU0 A;  1M1G A;  2YNH A;  4I64 A;  4NYO A;  5ITH A;  2L3M A;  4IOA Q;  2NXU A;  4LRC A;  2Q1L A;  1VJW A;  2F63 A;  3QGI A;  2DO4 A;  2WAQ D;  3D4J A;  5K8N A;  4AQY J;  3TVZ A;  2NUU G;  2BQR A;  3CB4 A;  1FRK A;  3OR1 A;  1TL3 B;  1L3V A;  2NZC A;  3PRD A;  1SJF A;  1NSA A;  4YHH J;  2UVR A;  1BQX A;  4M5D B;  3UWT A;  2RU9 A;  5KT2 A;  3CJK A;  1S77 D;  3SQG A;  4ED8 A;  3CCZ A;  2VHG A;  2VFU A;  3CDW A;  4KKO B;  1DY3 A;  3VV2 B;  1BWV A;  2PGC A;  4RUC A;  1S9E B;  1BHN A;  2JEJ A;  2KM8 B;  1S0M A;  1J5O B;  5A6W A;  2HVH A;  4ZPT R;  3OUY A;  5DLF A;  3DI6 A;  2UUA J;  2X1B A;  2CWK A;  3BGU A;  3SYZ A;  2UUC F;  4LF9 F;  2K1R B;  4A48 A;  1U1M A;  2P6S A;  2KVQ E;  3CJ5 A;  4CTA B;  1FWP A;  4DR1 J;  5FJ4 A;  2BXJ A;  1FKP A;  4TN2 A;  3GFH A;  2XGQ A;  3GYG A;  1HNW J;  4K0K F;  3DMJ A;  3FJ2 A;  3QO9 B;  3ZZO A;  2NXC A;  1WG5 A;  3QLH A;  1YRX A;  1F6T A;  5D77 A;  4R5P A;  2RT3 A;  4F2R A;  5H1S V;  1NHV A;  4DI6 A;  5DJB A;  3DRR B;  4YS2 A;  1YG0 A;  3W66 A;  2XS5 A;  4WP9 A;  1F3F A;  2MZT A;  2V4J A;  5T7L B;  5CYJ A;  4DUZ F;  1FJE B;  1IBL J;  2J0W A;  3ETM A;  2E1C A;  3NAI A;  4AUK A;  4PXB A;  1T9V A;  4FPR A;  1ZBT A;  3IO1 A;  2MST A;  5KFY A;  4X65 F;  5K14 B;  1S0O A;  5AXN A;  3GIJ A;  4ALZ A;  2AGP A;  4P2F A;  4DFP A;  1S48 A;  3RAQ A;  4JI3 J;  4DHV A;  3FZ2 A;  5CZV A;  2Z2Y B;  3U1M A;  4DPO A;  5F8I A;  1XIQ A;  2W4C A;  4DV4 F;  3FSX A;  1GX5 A;  3MM9 A;  4WIQ A;  2OEJ A;  4ZA1 A;  1TKX A;  1S1V A;  3LA0 A;  4CLU A;  4N56 A;  2CNK B;  2KL8 A;  1YWX A;  2CPI A;  3BPD A;  2EWH A;  3VR1 A;  3RAX A;  1H74 A;  5CHC B;  3H2L A;  4QR0 A;  4DLG A;  3VVT A;  3T9Z A;  3TQ1 A;  2RE1 A;  3VAH A;  2HEK A;  2KG0 A;  1H7W A;  1UKU A;  2YQ1 A;  3GSI A;  3B6B A;  3NWG A;  4NI2 B;  3SQG B;  2ADB A;  3QQC D;  3THP A;  4MK8 A;  4CLW A;  3W2W B;  4DUY F;  1FX4 A;  1QSS A;  3NMA A;  4DJB A;  1WEX A;  2DNN A;  2EPI A;  2RUG A;  3HD2 A;  4MH8 A;  1HFE L;  2M88 A;  4MT1 A;  4YHH F;  2XYH B;  4Y28 C;  1OWX A;  4K4S A;  1LW2 B;  1GFW B;  1YJ9 S;  3ZNJ 1;  1FRL A;  4IFY B;  1Q5Y A;  3SSQ A;  1YDL A;  2VKR A;  3C8Y A;  3LP2 B;  3MPY A;  3G8Q A;  3IGN A;  3OR1 B;  4JI0 F;  5B0D A;  2WON B;  3QAT A;  4GVB A;  4HH0 A;  1YJN S;  4KPY A;  1RAJ A;  1RWX B;  2DNQ A;  2DB1 A;  4OMF G;  3CCQ S;  3OL9 A;  3LH2 S;  1NPR A;  2PEB A;  3BR9 A;  3EWG A;  3HSZ A;  5KFJ A;  4K4X A;  1FRM A;  2WVD A;  1KEK A;  4X64 F;  1TL7 B;  2ZUG A;  5EWF A;  3C46 A;  2ZDO A;  1IKV B;  2ZD1 B;  2ZHB A;  4LQ3 A;  1C0T A;  3NXZ A;  3T1Y J;  4IG0 A;  2HWH A;  5A0Y B;  4GVL A;  5E33 A;  1Q16 B;  3U1L A;  2JL9 A;  2FY1 A;  3QJL A;  4HVZ A;  1XNR F;  3S8S A;  2BKO A;  3UNY A;  8AT1 B;  1UEV A;  4M1K A;  4WFY A;  4PCQ A;  2PI5 A;  2VPZ B;  4XIU A;  2QEX S;  1AFI A;  3NGS A;  1HNZ F;  1MNE A;  1BE4 A;  3TW0 A;  1QVG R;  1YJR A;  2JEG A;  1FDD A;  1KKH A;  1XER A;  4Y0F A;  1WUU A;  1WSV A;  2ROP A;  2HRU A;  3QLH B;  3MM5 A;  3PYF A;  4B3T F;  4UY8 5;  4XK8 C;  3BGF A;  4WFN Q;  4DFJ A;  2X3D A;  2W9B A;  3VVU A;  5LXR A;  2XI3 A;  1X5S A;  3TZZ A;  5GMD A;  1SBR A;  5D3G A;  1RTI B;  1B70 B;  1ZM2 A;  2HYI B;  2GW8 A;  1RAG B;  1RT3 A;  2CJA A;  3HLU A;  3V6J A;  1T02 A;  3SFU A;  3QWU A;  4DR5 F;  2Z8Q A;  1KTQ A;  3CJS A;  3DGP B;  5E3P A;  5J2P B;  1CLF A;  3MM6 B;  4JOU A;  3FCH A;  3HVR A;  2QJ3 A;  2HHS A;  1ACM B;  1TK5 A;  3BQ2 A;  1S59 A;  3UDC A;  3KK2 B;  2VPY B;  3RAM A;  3MM9 B;  3MPV A;  2ERR A;  3W8G A;  1U6F A;  2G0C A;  4DWI A;  4WYL A;  5HP1 B;  2V8V A;  3ZZP A;  1Q53 A;  2E5G A;  3TX8 A;  1VGY A;  2I0X A;  3C16 B;  2OPS B;  3OR2 A;  1R3N A;  4DL3 A;  4HDH A;  1KLM A;  2HK2 A;  2N3L A;  4MKA A;  4FF3 A;  3AOD A;  2ASJ A;  4WK3 A;  2Z2Z A;  4F4K A;  4NEY A;  1URN A;  4H4K C;  2L9D A;  4HHU A;  1V3R A;  2ZH9 A;  3ZC4 A;  9ATC B;  2LEB A;  4CI0 B;  2XHC A;  4YQW A;  1RTH B;  2YQ3 A;  2B4P A;  2AHO B;  2F7V A;  3GYN A;  4M8L A;  2QLB B;  3C15 A;  4IH5 A;  4RW7 A;  3L9Z A;  1R43 A;  3QSI A;  1NSP A;  4GO5 X;  3SCK E;  4ER8 A;  1YGY A;  3BQ1 A;  5GMK a;  2B6A A;  4EO8 A;  5DM6 Q;  4PAA A;  3TA0 A;  1S12 A;  3BH7 B;  2V6A A;  3I5B A;  5C24 A;  3JAM Y;  1B4S A;  2KB2 A;  4J7C A;  2FHO B;  1HPZ B;  3UN2 A;  1U1R A;  1IBL F;  3M2V A;  3ZZ0 A;  2CJK A;  3FEX B;  2BZ2 A;  2PO4 A;  4USI A;  2CA9 A;  2FUG 9;  1FVS A;  3D0H E;  5E0O A;  3SZ2 A;  1OY9 A;  3KNA A;  3IBF B;  5J2Q A;  4CO3 A;  4ETZ A;  2CPH A;  3H90 A;  3N4W A;  4QPX A;  2I38 A;  1PG5 B;  1UW4 A;  1FER A;  1HKA A;  2RNE A;  3H2U B;  5DG9 A;  2MHE A;  4NXN J;  4M63 A;  1YJW S;  1PC4 A;  1NJW A;  2YWG A;  3M2U B;  3PW2 A;  1NKC A;  4UOG A;  4RWX A;  1T05 A;  2H5E A;  2WON A;  1RWM B;  2IHR 1;  3W7B A;  5KG5 A;  2D74 B;  5KTQ A;  2E1R A;  2ZVS A;  3EYZ A;  2APO A;  3O44 A;  3CVK A;  1YQH A;  3ITH B;  4Y00 A;  4V19 J;  1APS A;  3I4P A;  2CQ1 A;  3OPK A;  1P6T A;  4OHV A;  1N54 B;  3C66 A;  4YB5 A;  3KUE A;  3LP1 B;  3FC9 A;  3IC1 A;  3MWB A;  2M7S A;  1U1O A;  1N5V A;  3CJ0 A;  3H98 A;  4ICL A;  3K58 A;  1LWF A;  4EYH B;  2HMI A;  4IQX A;  1YZ7 A;  4K4U A;  1U0H A;  2ALY B;  4OZ0 A;  4QYZ J;  1FFG B;  1KHW A;  5J2P A;  2OFG X;  3M6W A;  2GO9 A;  2W7O A;  2C1E B;  2EW9 A;  1E6V B;  1RTH A;  1RWK B;  2HFZ A;  1LWC A;  1N5S A;  1OQ3 A;  2CJQ A;  3BPS P;  3DU5 A;  2RHS B;  3K5P A;  4NLT A;  5AE3 A;  4C3L A;  1Z4U A;  2VQE F;  2BJ7 A;  2GHV C;  3B4D A;  3MR7 A;  5KG7 A;  2IM3 A;  1N5Q A;  2BKP A;  3EZU A;  2BAN A;  4I6W A;  4ZJL A;  4ILM A;  1RWO B;  2VIC A;  4P72 A;  1H3D A;  2RKI B;  2UXC J;  3MXH P;  4OYM A;  2MKJ A;  2MPU A;  4KH0 B;  2QA2 A;  2OD6 A;  1CJT A;  3PNI A;  4KV8 A;  5ETQ A;  2PMZ D;  5K8O A;  4EWT A;  2EFQ A;  2VG6 A;  2CIM A;  3CC4 S;  4PQU A;  4DX7 A;  5KG0 A;  1RZM A;  3LF0 A;  4KYZ A;  4CO0 A;  1SV5 B;  3SCL E;  3W9J A;  5HBM B;  1TAQ A;  1BMQ B;  2EBG A;  1N34 F;  2KRB A;  1WDD A;  5GAG U;  4RLE A;  2E1A A;  2FY8 A;  1FF2 A;  1JQG A;  2YKA A;  2VH7 A;  3B4M A;  3D66 A;  2EKY A;  3GFX A;  2QG9 B;  4QPT A;  2IMW P;  1OPI A;  2AZ1 A;  2OEL A;  2RF2 B;  1WC4 A;  2RIJ A;  2W2M P;  3BM7 A;  3ISZ A;  4BWM A;  3W64 A;  3ADA C;  4AYB D;  1I3O B;  4PXC A;  3WIU A;  1I94 J;  2B6A B;  2OPS A;  3OR2 B;  1Y7P A;  2M5Y A;  2MLZ A;  2UUT A;  1Q4R A;  2W01 A;  2QGF B;  3M1V A;  2CFX A;  1XWL A;  4QIV A;  1IVZ A;  3E51 A;  3QRP A;  3CJQ A;  4XAK A;  1EZZ B;  3TUZ C;  1DZ5 A;  4B3R J;  5KFM A;  4LMZ A;  2KZZ A;  1RCO B;  2E7X A;  4LT6 A;  4OLO A;  4C8K A;  5KFA A;  4UY8 T;  3FCV A;  3NNA A;  3RRH A;  2E7W A;  3MM7 A;  3U02 A;  4FXW A;  1VBZ A;  1N33 F;  4RW6 B;  4NX9 A;  5J2N B;  4ECU A;  2LU2 A;  4B9V A;  3G87 A;  3R2D J;  4KIA A;  3D68 A;  4Y65 A;  3HVW A;  4USM A;  1SL1 A;  4LFA F;  3BN4 A;  1RBO B;  5ETP A;  3KDN A;  2BOP A;  4O23 A;  2ZH5 A;  3ILL A;  5D8H B;  5ADZ A;  1B0V A;  1UET A;  2QYC A;  3SDE A;  3AD9 C;  3D6M B;  4DL2 A;  4NA3 A;  1RAO A;  3FBB A;  2LCW A;  3KG0 A;  2CVE A;  4PXD A;  1FNX H;  4C8Y A;  2E7V A;  4NCG B;  3HSD A;  1HQU A;  4ZVO B;  4CZC A;  5IV3 A;  4B3T J;  3Q22 A;  4PG6 A;  1QUP A;  2EC2 A;  2GQ2 A;  3GMG A;  1W25 A;  4OFZ A;  3EVM A;  4CT9 A;  2JHE A;  2DPJ A;  1KDN A;  5CYQ B;  1HNZ J;  4N76 A;  2VG6 B;  2Q43 A;  5F0U A;  2NUH A;  1M5K C;  1BXN A;  2RRN A;  2F1F A;  4OV6 A;  3QMQ A;  1RWN B;  1T94 A;  2I6W A;  3TUI C;  1LWE A;  3HFZ B;  3OJU A;  1Q7L B;  1LWC B;  2KT2 A;  4C0H A;  1OS5 A;  1FFW B;  4OYP A;  3TAQ A;  1RXO B;  4TU8 A;  2KRR A;  2X7I A;  5KT6 A;  4B3O B;  1X4H A;  2BAN B;  3C19 A;  3GLJ A;  3ITH A;  5F9L A;  1RB0 A;  2N7C A;  1JLC A;  2JC1 A;  3GCX P;  2ILY A;  1WSR A;  3A12 A;  4FXV A;  2LA6 A;  4OI4 A;  4TLR A;  3VGU A;  2DNO A;  1IWG A;  5J2M B;  1WC5 A;  3QAU A;  4ICL B;  2HWT A;  1T95 A;  4ZPD A;  1U2R A;  2YNF A;  3MUV P;  4P52 A;  4DU7 A;  2JJ4 D;  2R7X A;  4NYZ A;  4CLT A;  3M9M B;  1FRX A;  3RR8 A;  4LSL B;  1SXL A;  2C2K B;  1PJ6 A;  1X4G A;  2DKO B;  2XMU A;  2FGC A;  5I3P A;  3R1H A;  1RK8 A;  1FXR A;  2BJ3 A;  1YRU A;  3PAC A;  4LF1 A;  4A46 A;  3PRB A;  1X9W A;  3MM6 A;  1P1T A;  3HT3 A;  1X0P A;  2R8H A;  1Y10 A;  4ZP9 A;  2VBZ A;  1HNX F;  2MQL A;  1S6U A;  1N6Q A;  1WC3 A;  3DLE B;  2MDA A;  3I56 S;  1RHR B;  5DO2 A;  1IJE B;  4Y34 A;  4BC9 A;  4DL4 A;  2J9E A;  1NLK L;  4RW4 B;  2OD4 A;  1U02 A;  3K17 A;  4L73 A;  5LMN F;  1N36 J;  4EZ9 A;  2DIS A;  4L3N A;  3QZ7 A;  3MTJ A;  3VAF A;  1E6Y B;  3S6E A;  2DHH A;  1BC6 A;  3FMW A;  1OPZ A;  2D7S A;  2E66 A;  1Q8I A;  3V81 A;  1LK5 A;  3SQO P;  3DOM B;  2HNY A;  2IBO A;  3DOL B;  4QJV A;  4ZVF A;  3TAM A;  4P71 A;  4ZPB A;  4ZLL A;  1JLA A;  5GAH I;  1RLC L;  4DEZ A;  4DN0 A;  2E5L F;  5H9E J;  3ETO A;  4B3S J;  2XBP A;  1RT6 B;  3P6Y C;  1WWH A;  3JS9 A;  1C2P A;  3IG1 B;  2AIR B;  2L08 A;  4I1T A;  4ECY A;  4W90 B;  3KK1 A;  1WTB A;  1C1C A;  1MG7 A;  5EWE A;  2JLF A;  3MMB A;  3HI9 A;  1NH7 A;  2RVJ A;  2CRL A;  1CUL B;  3HVT A;  2MGZ B;  1NK9 A;  1N56 A;  4GKK J;  2J76 E;  4UTG A;  1V6H A;  5E3C A;  3K5M A;  2K3K A;  4I69 A;  3FFI A;  4P2S A;  1CG2 A;  2BQU A;  1ZA2 B;  2CAJ A;  3H5Y A;  1HNW F;  4DL5 A;  3CCM S;  2VOO A;  3LGH A;  3TQE A;  3A8K A;  5KOX A;  4CQ1 A;  4CNZ A;  1PAE X;  2MYF A;  3DFE A;  3L4B C;  4KH1 B;  4KT0 C;  4O44 A;  3AA8 A;  1HR0 J;  3R6G B;  4ZPA A;  2YTC A;  3EPG A;  2BW7 A;  3SFG A;  3NOC A;  2XG8 A;  2YX4 A;  2HZA A;  5HO4 A;  3K89 A;  3M8P B;  3C14 B;  4R8U A;  3GG1 A;  1ZPV A;  1KQF B;  1YJU A;  3RZA A;  3RBX A;  2HG4 A;  1SQG A;  1AB8 A;  3T1H J;  2FZG B;  1D8Z A;  1R0A A;  4BDP A;  3CNQ P;  3MM7 B;  1UP1 A;  4J9S A;  2DIT A;  2J9C A;  3MCO A;  4KKO A;  1JLQ A;  5GAE I;  1UVL A;  4RW9 B;  2KTQ A;  1TEL A;  4JYA F;  3PJX A;  3W65 A;  4PRF A;  4LSL A;  4Y2I A;  1WTF A;  2B8Q A;  1JNR B;  2EEY A;  3NS5 A;  4OJ1 A;  4IDK A;  4PAB A;  1REV A;  3TUJ C;  4WE1 B;  3P8B B;  4DCO B;  5DDP C;  2V94 A;  2W9A A;  2NXN A;  2XYP B;  2L9W A;  4BWJ A;  3NS7 B;  4ZMM A;  1NO8 A;  3K8W A;  4DV0 J;  4QZV B;  3V4I B;  2KFZ A;  1PBA A;  4DV2 F;  2XTJ P;  2ZKU A;  1DHM A;  5CYM B;  1UL3 A;  2NXE A;  1D1U A;  1IWA A;  3BSC A;  3CCW A;  4DS4 A;  2MZS A;  3KJQ B;  2OGU A;  3FGV A;  1RTD B;  5KG3 A;  3B78 A;  2NRE A;  1BY9 A;  4UT4 A;  2OTL S;  2WK4 A;  3MR2 A;  3CO0 P;  4RU2 A;  2Z58 B;  2HS3 A;  5K9F A;  5LM7 E;  3PRV A;  4KV8 B;  3G86 A;  2XSJ B;  3K5O A;  1GTH A;  1VK8 A;  1LFP A;  2CZ9 A;  2FPH X;  2YNG B;  3ZTP A;  1M1H A;  3A1Y G;  1H38 A;  4NXM F;  4DL6 A;  1NPK A;  3GQC A;  2AGO A;  2HFS A;  4EO6 A;  2WSE C;  4C0O C;  3G2X A;  3AT1 B;  2OPQ A;  3GIR A;  3IMQ J;  1Q95 G;  1N52 B;  3PYD A;  1WHY A;  1QUV A;  5ETS A;  1JLG B;  3KKF A;  3VGV A;  1FA0 A;  3EGN A;  1TMJ A;  2I1R A;  4DZD A;  2HQG A;  2DNH A;  3CD5 A;  3N0V A;  2OTJ S;  4LFC J;  4PG4 A;  3M05 A;  4N77 A;  1HAR A;  3HVA A;  1RTJ A;  1D9D A;  1A6L A;  2ZBP A;  4GC7 A;  3KG4 A;  1L3K A;  3JSY A;  1EHW A;  2W4P A;  1CQN A;  1U47 A;  2FVS A;  3MMB B;  5L1K A;  5E2Q A;  1MWQ A;  5C42 A;  5C5J A;  2KG1 A;  5A6P A;  4A8M P;  3KHH A;  4H4M A;  2BJ1 A;  3NWR A;  1NM2 A;  2MQ8 A;  2HVD A;  4LFB F;  1SCJ B;  3MUT P;  2BMB A;  3Q8S B;  2PDA A;  3W3S A;  5IWA J;  4LSN B;  3MCM A;  4A4J A;  1X4C A;  1OQ6 A;  2RH3 A;  5E41 A;  5DM7 Q;  1M5V C;  4EYI B;  3R5B A;  1KSP A;  3UE2 A;  1S7H A;  4K4Y A;  2XS2 A;  5AT1 B;  1QSL A;  2UVV A;  3V6K A;  3BGR A;  3J7Z 5;  1IUJ A;  2OMO A;  2QTW A;  4B3M F;  1JJH A;  2E9R X;  1U25 A;  5HRO A;  3QBC A;  5GAD U;  3PYE A;  3BDP A;  4AL5 A;  2DHA A;  3V2U C;  2VU5 A;  4JI6 J;  1D8Y A;  3VZH A;  4QU6 A;  1CSJ A;  2JWN A;  2VC0 A;  3DCA A;  3QGH A;  1T0T V;  2BM0 A;  1U1L A;  4OX8 A;  3LPY A;  3BKF A;  4MJK A;  1YZ6 A;  2H65 B;  2ZD1 A;  1T03 A;  4NA2 A;  2RIL A;  4RUA A;  4DL7 A;  2ZVI A;  2B56 A;  3A8I A;  1C4A A;  2MQM A;  1FDB A;  2L48 A;  3G6E S;  1NDP A;  1WKJ A;  3EGW B;  3KLI B;  4DLE A;  1N88 A;  2YWE A;  3V6H A;  2GMJ A;  1TL4 A;  3JSR A;  1VK3 A;  3MMC B;  2KI2 A;  3KUG A;  1UWB A;  2CKW A;  3WDO A;  2NS1 B;  1X0F A;  4OZN A;  1HBN B;  1XR5 A;  2D1C A;  5HMX A;  2YWH A;  1UJ6 A;  5HSP A;  2VBY A;  1XMQ J;  2R4F A;  4OX9 J;  4F04 B;  5LJ3 Y;  2VDH A;  2CPZ A;  2M8H A;  4J9Q A;  1EB0 A;  2XY6 A;  3I9V 9;  4F3M A;  1F5A A;  3PEH A;  3HK2 A;  2VFR A;  1I51 B;  2AW0 A;  4H54 A;  4DPT A;  2V4R A;  1Z1Z A;  1T9T A;  4WII A;  3U7J A;  2BYC A;  3FBE A;  4I56 A;  1KQK A;  1X8D A;  3ENA A;  3FRY A;  5EN1 A;  3DHX A;  2WOM A;  4YFU A;  4DG1 B;  3J81 U;  2PMH A;  5HP1 A;  1DJ0 A;  1BQM B;  3JB9 k;  4CLZ A;  4DFK A;  1FD8 A;  1WC0 A;  3K8V A;  1WOP A;  2DHG A;  2E5J A;  4RNM A;  3CCR S;  2QZ8 A;  4YB6 A;  3IFE A;  4J90 A;  2VA3 A;  2HBQ B;  1U1N A;  1OSC A;  2J0X A;  4B3S F;  4OHZ A;  2W25 A;  2IM2 A;  1Y3K A;  5L1J A;  3B54 A;  1JLE B;  2M70 A;  3UDL A;  5IXU A;  1Q8L A;  4UQT A;  1U6Z A;  3HT0 A;  4QIW D;  2BJD A;  4QW8 A;  4PYA A;  3X3U A;  3CIM A;  3QJJ A;  1WJ9 A;  1XMO F;  2A2C A;  4DR3 J;  2DNZ A;  4GO7 X;  2QX0 A;  1X4E A;  2XNQ A;  4F67 A;  3D3B J;  1X60 A;  3MPW A;  2M4M A;  1ELO A;  1A7G E;  1X4D A;  2FHJ A;  4LSN A;  4IYQ A;  4FYX B;  3AXK A;  3JQJ A;  5FLX U;  3BGL A;  3LAL A;  2NQP A;  4Q43 A;  1T9W A;  2HFO A;  5BYS A;  1YBT A;  4E2F B;  5IQ6 A;  2ZDP A;  5RUB A;  3DDK A;  4LFA J;  4LR9 A;  1MRO A;  5EX0 A;  1UWA A;  3CWJ A;  3T6B A;  3KLH A;  3OTD A;  2VQF F;  3AHP A;  4QWA A;  3LTO A;  1H0H B;  1C4C A;  4LUB A;  5IT9 Y;  3OLB A;  3ILI A;  4UOH A;  3ZTQ A;  4A8O A;  4JI7 J;  2JLE A;  2VB6 A;  1FRJ A;  2A18 A;  2CQD A;  4USK A;  2UUB F;  2R7T A;  4DQQ A;  2C2R A;  2WHO A;  5HN0 A;  3KLG A;  2G0J A;  4JI6 F;  1DLO B;  1FRH A;  3SSR A;  2BQ3 A;  1S5Z A;  2DNP A;  1URR A;  3FVY A;  1RT7 A;  3SMZ A;  2GVD B;  3OTC A;  4CLK A;  4AL7 A;  2UUC J;  4LF9 J;  1XNQ F;  3LOU A;  2QRR A;  1T05 B;  4FBU A;  2Q3P A;  2W4D A;  3BDE A;  3MOJ B;  1LNQ A;  2C2E A;  3POT A;  3CCE S;  4ZPV R;  3MPU B;  5HAT A;  5HVF A;  3AD8 C;  3QFH A;  3NGU A;  1JJC B;  3T19 A;  5HJX A;  2KXH A;  1R0A B;  3P3D A;  1ZM3 A;  4TY9 A;  6FDR A;  3BSA A;  5ETN A;  3J81 Y;  6AT1 B;  3K59 A;  2Y3Y A;  4DUZ J;  2WB4 A;  1U0H B;  3PYG A;  4YB1 P;  2E44 A;  2GAH C;  3KLF A;  5F8J A;  2J6U A;  2QLF B;  3ET6 A;  1I94 F;  4DR6 J;  4OJH A;  2IVF B;  2XO6 A;  1R6Y A;  3PJW A;  4WE1 A;  1NHU A;  4ES1 A;  4C8M A;  4ANC A;  3A3O B;  2HSE B;  1RT1 B;  1UZD A;  2ZC4 A;  1CJK B;  2ZBR A;  3DM2 A;  4C3K A;  5F8G A;  1S6O A;  2F9D A;  3HZG A;  4TXS A;  2C2Z B;  1DQ8 A;  4DV1 F;  3MEG B;  3QT6 A;  4EZ6 A;  3CD7 A;  4J9R A;  1R8B A;  4IRD A;  1UVJ A;  1NK7 A;  5K14 A;  1U8S A;  2VG5 B;  1SB6 A;  3PW0 A;  2MJU A;  2Z30 B;  4PEO A;  3JQM A;  3Q8Q B;  3EZ5 A;  2AEM A;  5BYR A;  1V9O A;  3GB0 A;  1IKW B;  2CJ9 A;  4YUD A;  4QW9 A;  4O3R A;  1F9E B;  3MMC A;  1TL5 A;  2F65 A;  2YNG A;  3DXB A;  1HWJ A;  4LF8 F;  3ZNU A;  2RKI A;  3PO5 A;  4KGK A;  2DBB A;  4JI2 J;  2HUR A;  4KGZ B;  3PEJ A;  4RR5 A;  2UP1 A;  1SC1 B;  1TL1 A;  4F0H A;  2FLO A;  2ZBC A;  2ZNZ A;  4BHQ A;  3Q8P B;  3KHL A;  4LF5 J;  2O5D A;  2RRA A;  2KM8 C;  3D2W A;  2J0S D;  2ZKT A;  1EX8 A;  5M2R A;  2NSB A;  4ZIW A;  1UCN A;  3NMR A;  1ZPW X;  3MEE A;  2HK3 A;  3QT7 A;  2GHW A;  4DR4 J;  2IDL A;  2YH1 A;  3AAW B;  4G6V B;  4XPC A;  3SV3 A;  3HHL A;  1FEE A;  3KHG A;  1FK9 A;  1VIX A;  5D0R A;  3VAL A;  2IYI A;  2DGV A;  2XMW A;  1NKE A;  1KVI A;  5F9N A;  1U45 A;  1RAE B;  2IJF A;  4IFY A;  1VC5 A;  2MKH A;  1HBU B;  1NRK A;  2AJ0 A;  4JI8 J;  4RJV A;  1N5T A;  2B0G A;  1X9S A;  2OUG A;  2F40 A;  2AU0 A;  4ZPW R;  3DNC A;  1BQN B;  4I2Q B;  1JK9 B;  5EDW A;  3L3C A;  4QWC A;  1GX6 A;  2P9C A;  5IOL A;  1HR0 F;  4OHY A;  3TO8 A;  4KFB B;  2OJ3 A;  1LK7 A;  4TY8 A;  4CLP A;  4NRU A;  1TK0 A;  3JTN A;  3M6V A;  4DL0 C;  1L3U A;  4IR1 A;  4NLQ A;  4ZVR B;  2AF6 A;  2WVE A;  3R5G A;  2FJV A;  3F56 A;  2EFV A;  5J2N A;  1PBU A;  1XMO J;  1N5Y A;  3CCV S;  1R0C B;  1HQU B;  2GGP B;  3R1L A;  1M90 T;  2E1M C;  4K4T A;  5ETL A;  1QDU B;  3JYT A;  3WQP A;  1X4B A;  2UV8 G;  1RWW B;  4QBU A;  4KB7 A;  4CO1 A;  4DV6 J;  3G82 B;  4EEY A;  4ZIT A;  2OLW A;  3SDE B;  1PGZ A;  4CH0 S;  3Q8U A;  1TL3 A;  9RUB A;  2AT1 B;  2LA4 A;  4U9R A;  2R7S A;  5KFQ A;  3OHB A;  2O01 C;  1TL7 A;  1YJ7 A;  2CQG A;  1F5C A;  1G3O A;  2HVZ A;  1UEU A;  1N0V C;  3DOK B;  4LIR A;  3UNG C;  4TLQ A;  2Y1I A;  2PFF B;  4NLS A;  4B3O A;  3TUP A;  1IXK A;  2W2Q P;  4ID8 A;  1EKS A;  4OL8 A;  2NPF A;  2HVI A;  1MSW D;  3AB4 B;  2QL5 B;  3MAH A;  1CBK A;  4U67 Q;  1TFY A;  3IS9 B;  4O0N A;  2HW3 A;  1HD1 A;  5KFE A;  4KTQ A;  1WD6 A;  1R0B G;  3DLK B;  3JXO A;  1TP7 A;  3OFG A;  5D78 A;  4CWB A;  5K8P A;  2FLN A;  3ICL A;  2BDP A;  3Q2S C;  5AJ3 F;  3ONQ A;  3LP0 A;  2R8G A;  4LBP A;  4NXM J;  2WTF A;  2VBX A;  3TA1 A;  3AJD A;  1QJH A;  4ZVP B;  5U47 A;  4UZB A;  1S1V B;  5AJ3 J;  4TKT A;  1AUD A;  3TVY A;  3CF5 Q;  1EP4 B;  2C2N A;  3ZTO A;  2YKN A;  1IR2 A;  2XWX A;  2KO1 A;  1RGV A;  2M0G B;  1QTM A;  2MZQ A;  4K5R A;  3H25 A;  3ISN D;  2LVW A;  3M8Q A;  1YVF A;  4LR8 A;  2VZ9 A;  2WSC C;  4NMX A;  4PR6 A;  1GMW D;  1ICE B;  2QMW A;  3C15 B;  5JUM A;  3PM9 A;  2ADC A;  2IM0 A;  4OX9 F;  2DGU A;  3NGR A;  5L38 A;  3J81 j;  3RB3 A;  1ZET A;  3ENV A;  2BE2 B;  5DGB A;  4G1Q A;  4IR9 A;  3HPO A;  3IN5 A;  3OFE A;  3D7S B;  4R5P B;  4Q7A A;  5L46 A;  1HI8 A;  4A8Y A;  1ZZF A;  1IBK F;  2V2Z A;  5IS2 A;  1T7P A;  1CS4 B;  4DMZ A;  4OHX A;  1B0T A;  4X66 J;  4L3K A;  4K50 A;  3LGN A;  3IG1 A;  1HYS A;  1QY7 A;  4F4X A;  3AQO A;  3HVT B;  3PG9 A;  4USU A;  2MGZ A;  4G3I A;  1S76 D;  3HMJ G;  3MEE B;  1VBK A;  2I8E A;  3VHQ A;  1R6V A;  2PFD A;  4IQM A;  1X9M A;  4CP5 A;  1SIW B;  1GQE A;  1RT5 B;  2UVU A;  2M3D A;  2K8G A;  4UQG A;  4HI1 A;  2ZH1 A;  4V19 X;  5LMN J;  5IT4 A;  3K57 A;  4ERD A;  1TV6 A;  2Y1L B;  5E3Q A;  1GXL A;  3FCW A;  5DDQ C;  2IRX A;  2IFX A;  2MSS A;  4IH7 A;  2W7A A;  5C24 B;  2VOP A;  3W61 A;  4X65 J;  3IRX A;  4H4O B;  4WYW A;  3CJR A;  3GJQ B;  1TZ0 A;  3QAE A;  4GVB B;  2OKQ A;  4KR0 B;  3QIP B;  5F3T A;  3M6X A;  2IIH A;  2VFV A;  3UFC X;  4NLP A;  1LFW A;  2GMH A;  1NXI A;  4ELV A;  2JRS A;  3CSK A;  4I7F B;  5A8R A;  4YY3 F;  1KTV A;  2MJN A;  2MKS A;  3S01 A;  5A2Q Y;  2XMA A;  4ZJO A;  2YX7 A;  4CO2 A;  4C8Z A;  2QL9 B;  3OFH A;  5CD4 A;  3DHW C;  3PFO A;  1RSC A;  2XB2 D;  2A0F B;  4OYA A;  4HDG A;  2F4F A;  3PW4 A;  3C6T A;  1B3T A;  5K8M A;  4LBI A;  4MIA A;  2R2T A;  2BW2 A;  3TA2 A;  4U8V A;  3SSS A;  3WIV A;  1H2T Z;  3N28 A;  1PSD A;  2JNJ A;  1QD1 A;  2YY3 A;  2DRD A;  2JH3 A;  2HBR B;  3UN5 A;  3IM8 A;  4OI0 A;  2B7B B;  3TEH B;  1WKL A;  1AFJ A;  4UOC A;  4LF8 J;  4C98 A;  2BE9 B;  2ZNY A;  5A8K A;  1HW8 A;  2DNG A;  4RBT A;  2H5I B;  3U27 A;  1CJK A;  3DM2 B;  4WJB A;  5EHH A;  2GJI A;  2U1A A;  4U96 A;  4H4K A;  4K4Z A;  2HGM A;  3M6U A;  2GGP A;  4L74 A;  4KQZ A;  1UA1 A;  4K5S A;  1SV5 A;  5IC4 B;  1QTN B;  3R9L A;  3MMJ A;  4ECX A;  3M30 B;  3CDE A;  4IH6 A;  1MLA A;  2Z56 B;  2GO8 A;  1WF1 A;  2FTR A;  3LP0 B;  3N5F A;  1L5U A;  2B9W A;  4ZN3 A;  5GAE U;  1X5O A;  4NZ7 A;  2VDI A;  3KLV A;  1CJV A;  1T8E A;  3MM5 B;  2QMX A;  2GCF A;  4DX6 A;  5HQ8 A;  3DYA A;  2AMC B;  2E9Z A;  1MML A;  3R5C A;  3NP5 A;  4LRE A;  4K4V A;  5M2U A;  3UO0 A;  4MTP A;  5HQM A;  3QIP A;  4WZM A;  3I96 A;  1TU0 B;  2DNM A;  1HWK A;  1SC3 B;  3I6P A;  5BJR A;  2O66 A;  4RKU C;  3GFZ A;  2XM3 A;  3H4B A;  1TKT B;  1EQM A;  4QR1 A;  5F0W A;  2X51 A;  2VOD A;  2NSC A;  4NCB A;  2MKK A;  4DV5 F;  1XTZ A;  1ZM9 A;  2YNH B;  3NL0 A;  2IYG A;  3EDR B;  1U2F A;  2CJB A;  4QWB A;  4JI1 F;  3FBF A;  4H4M B;  3CE8 A;  2CJY B;  1NDK A;  2JEI A;  1B99 A;  5CCM A;  4NLU A;  1YI2 S;  2QA1 A;  2DH7 A;  3NCQ A;  2GZO A;  3AB2 B;  3BYP A;  4FP9 A;  5F8M A;  2J9D A;  1HNI A;  2QLX A;  2QFI A;  3NRB A;  1BUX A;  2B9E A;  1DQA A;  2J8S A;  3NEK A;  2MQP A;  1FE4 A;  3NGK A;  3KHR A;  3I55 S;  1IR1 A;  2GJ2 A;  2ZHO A;  5DQH A;  1HD0 A;  1YK9 A;  1ZAX A;  1GK8 A;  4YR2 A;  1EQ0 A;  4ZDN A;  1XN9 A;  4DV3 F;  1N0U A;  5ETM A;  1RDR A;  4N7T A;  3HHL C;  4NLX A;  1J5O A;  3K7R A;  3CCU S;  3MGJ A;  2MQQ A;  1W2B R;  4YY3 J;  2VQF J;  1N5Y B;  3MUM P;  3CD0 A;  1SUQ A;  3MEC A;  2RQC A;  1HWL A;  2K1R A;  3W5X A;  2FVR A;  4I6Y A;  4WP3 A;  3CT9 A;  4ED3 A;  2LQJ A;  2FVQ A;  1VS3 A;  3FRZ A;  4ILR A;  1UWB B;  3UR3 C;  4B17 A;  1P9Y A;  2C2M B;  3OQ2 A;  3OVB A;  4DG1 A;  2LU1 A;  2GQC A;  2HZC A;  4KO0 B;  3Q23 A;  4FNI A;  3WC0 A;  4NCG A;  2BJ9 A;  1CPZ A;  2AX1 A;  1SL2 A;  4DR1 F;  3DYA B;  2XSF A;  5KFN A;  3BBF A;  3D6H B;  3SBM A;  5HLF A;  1MN7 A;  3PHT A;  1LWF B;  3OTE A;  3ZZY A;  4WU2 A;  1GMV A;  1S0N A;  3W2V B;  4C11 B;  4DV7 J;  2CNL B;  2D41 A;  1TKT A;  2DYA A;  2K7K A;  3BBB A;  5I3U B;  2XZT B;  2BE7 D;  1YJT A;  2FHM A;  3MD1 A;  2GA7 A;  3JTO A;  4AND A;  3Q8R B;  1TK8 A;  1LW0 B;  1NZA A;  1TKX B;  2RQ4 A;  2WB1 D;  4YP3 A;  1U8W A;  2RF2 A;  5JVH Q;  1FI4 A;  3RBD A;  2ZH2 A;  3CDA A;  1RBL A;  1LWX A;  4O4G B;  2Z2L A;  1JLE A;  2W7P A;  2RML A;  1DQ9 A;  2HMI B;  2BVZ A;  2EG2 A;  3A3N B;  1WKK A;  2ZOF A;  5KFV A;  4YOE A;  4ZLJ A;  1VRQ C;  4FF2 A;  1F9F A;  1OJ4 A;  5HMZ A;  3VZI A;  1U24 A;  4J9K A;  3T1Y F;  2VKZ G;  2XMV A;  3QWP A;  2F8M A;  3M8Q B;  3H4D A;  2L9N A;  1F2G A;  3I5C A;  3MF5 A;  2VF3 A;  4ZCI A;  4Q45 A;  3OSP A;  1UPM B;  2B8P A;  3GP9 A;  1HLW A;  4ED1 A;  2IC3 A;  4OI2 A;  2J6T A;  5KFT A;  3M4X A;  1FD2 A;  2P2C B;  3J80 U;  1VQY A;  4ILL A;  2OSQ A;  2W2N P;  3GZ7 A;  3SIP B;  3PX6 A;  4L75 A;  3MEK A;  4ZVH A;  1UVN A;  1FO1 A;  3AFG A;  4AT1 B;  3ISN C;  3DLH A;  2CDR B;  4NEZ A;  4CLS A;  1D9F A;  1NJZ A;  2XWY A;  5A8W B;  2YWF A;  4PWU A;  3M30 A;  2DVI A;  1KNZ A;  1AYE A;  3T1A A;  1OSD A;  1NZ8 A;  1VRU B;  2B4V A;  5SUH A;  3D0G E;  4JI5 J;  2NXJ A;  2CNN B;  4O4R A;  4F2S A;  3EMT A;  1YKW A;  1X5T A;  1EKR A;  4ID5 B;  1KWM A;  1R31 A;  3KJV B;  5HAO A;  1UZH A;  1I6J A;  2QMU B;  1P1L A;  5LMU F;  2KFN A;  4ZHR A;  4JV0 A;  2OSR A;  4RO0 A;  1D9A A;  1H2V Z;  3A8E A;  3GII A;  4KO0 A;  4Q5V A;  2G4B A;  2DR7 A;  4ANE A;  3LO3 A;  3MMA A;  4NZ0 A;  3MUR P;  1BWE A;  5KT5 A;  2OEK A;  1KD1 T;  3IP0 A;  1JB0 C;  2YWK A;  3MR3 A;  3HHN B;  4RNN A;  2HQD A;  1XBW A;  4I68 A;  2RQK A;  1QLN A;  3O2I A;  4HAC A;  1RTI A;  5IZH A;  4OI6 A;  1F60 B;  2E5H A;  3EJM A;  2FJE B;  1ZH5 A;  4P9S A;  5LSL A;  4KHP J;  4IOB A;  5LXY A;  5KT4 A;  3HM9 A;  3DGP A;  3N5B A;  3CJ8 A;  3HDS A;  1NB7 A;  1YJV A;  4LFC F;  4NAS A;  3P5B P;  5D15 A;  2KHD A;  2XLJ A;  2DCU B;  2XS7 A;  4K7Q A;  1IBM J;  3N6M A;  1WF2 A;  1X31 C;  3I0R B;  3CUN A;  5DDO C;  4IRK A;  3T5H A;  5G0R B;  1G1X A;  2GIQ A;  3AOB A;  4DBQ A;  1TQL A;  1JLC B;  3HP6 A;  2MEW A;  4QU7 A;  2FQQ B;  2B5J A;  2C2O B;  3HD1 A;  4RW9 A;  5A8K B;  3JSM B;  4M5I A;  2VG5 A;  2CUY A;  3DC2 A;  4NPO A;  2ZC3 A;  3GFY A;  1KRP A;  5F8N A;  4RW8 B;  4B9U A;  4Q0B B;  3KLF B;  4W92 B;  2HPU A;  1YRT A;  2B3T B;  1VJQ A;  3H7H B;  1EIY B;  1FKO A;  4DSL A;  2HHU A;  3CJ3 A;  2A2D A;  3M8Z A;  1YBU A;  1RT1 A;  2O3D A;  2OI2 A;  2QIF A;  4ENO A;  2GVZ B;  4IO9 Q;  4I67 A;  2DGX A;  2XCP A;  5LMU J;  5D4O A;  2IVY A;  1ZAW A;  2ZZT A;  3DRY A;  2LDI A;  5E7O B;  2E5I A;  3TZY A;  3KJV A;  4IKA A;  2AV5 A;  4P2M A;  4KAI A;  2EFN A;  4KHR A;  3RBE A;  1KR4 A;  1FT8 A;  2FJA B;  2VJU A;  4M5M A;  4JI5 F;  5C2C A;  4WK1 A;  2OP5 A;  4FNH A;  1JLB A;  2HHH F;  1AT1 B;  1EJ7 L;  3H0P A;  1U4B A;  4F3O A;  1WDT A;  3GTY X;  2ZZM A;  5AE1 A;  3RRK A;  1N32 F;  2E9T A;  4PWD A;  1CQM A;  3D67 A;  3I31 A;  3EGV A;  1C0U A;  2QC3 A;  3A13 A;  1MW7 A;  1Y5N B;  3ILO A;  4NWB A;  2X1G A;  3T5L A;  3BF4 A;  4DSJ A;  1FX2 A;  5I42 A;  1FK9 B;  5BYQ A;  3RW7 A;  4QR2 A;  4CRJ A;  1TTH B;  1N6Q B;  4ED4 A;  1Q5V A;  1RAI B;  3NGT A;  5KG2 A;  1H6K X;  4HYK A;  5D4P A;  1RTJ B;  1XJW B;  2LQ5 A;  4ZLN A;  1PO6 A;  4X4V A;  1HQE B;  2IAJ B;  4N5S A;  4EBE A;  1VQL S;  3AOA A;  2FIU A;  5BXI A;  4NLV A;  4P7V A;  3I32 A;  5L9N A;  4FVM A;  3K2Y A;  2H5J B;  3DDN A;  2XNR A;  3DKD A;  2JVR A;  2XLI A; 
#chains in the Genus database with same CATH homology
 2B8P A;  3GP9 A;  1HLW A;  1F6T A;  4HR2 A;  4DI6 A;  3EVM A;  1NSP A;  3FBC A;  1KDN A;  4UOF A;  1F3F A;  3BBC A;  3GPA A;  3ETM A;  3BH7 B;  1NCL A;  3R9L A;  1B4S A;  3PRV A;  3Q8U A;  4WBF A;  1NHK L;  3EM1 A;  3ZTP A;  2NCK L;  3Q83 A;  4UOH A;  1NPK A;  3ZTQ A;  1W7W A;  3Q89 A;  1XIQ A;  4S0M A;  1S57 A;  3G2X A;  4EK2 A;  3VGU A;  3Q8Y A;  5CAB A;  1NSK L;  3EMT A;  1JXV A;  3VGV A;  5C7P A;  1S5Z A;  4C6A A;  4O0N A;  3VVT A;  4UOG A;  3FKB A;  3L7U A;  1EHW A;  3B6B A;  2DXE A;  4ANE A;  3ELH A;  3FC9 A;  2HVD A;  4KPC A;  3FBF A;  3NGU A;  2DXF A;  1NDK A;  1B99 A;  3ZTO A;  3EJM A;  1PKU A;  3EVW A;  1NLK L;  1BUX A;  2DXD A;  4DUT A;  1XQI A;  2VU5 A;  4ANC A;  3VGT A;  3DDI A;  4DZ6 A;  3NGR A;  1VYA A;  2HVE A;  3WX8 A;  1NSQ A;  5CAA A;  1NUE A;  3EVO A;  3JS9 A;  2AZ3 A;  1NDP A;  1WKJ A;  3ZTR A;  1NDL A;  3EIC A;  4FKY A;  3NGS A;  1BE4 A;  4FKX A;  3VGS A;  4CP5 A;  1ZS6 A;  4ENO A;  3PJ9 A;  3BBF A;  3VVU A;  1MN7 A;  1NDC A;  2AZ1 A;  2HUR A;  3FCW A;  3EE3 A;  1PAE X;  1UCN A;  2DYA A;  3BBB A;  3FBE A;  2DY9 A;  1HIY A;  4AND A;  1HHQ A;  3ENA A;  1S59 A;  3ZTS A;  3FCV A;  4F4A A;  2BEF A;  1U8W A;  1BHN A;  3Q8V A;  1LEO A;  3Q86 A;  1LWX A;  3NGT A;  2CWK A;  3B54 A;  1WKK A;  2ZUA A;  2BX6 A;  2B8Q A;  1MN9 A;  4F36 A;  5IOL A;  1K44 A;  5BXI A;  3MPD A;  3FBB A;  4W98 A;  1NB2 A;  3DKD A;  1WKL A;  3BH6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...