4CP5A

Ndpk in complex with (rp)-spmpapp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
b'KVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE, CYTOSOLIC
publication title Enzymatic Synthesis of Acyclic Nucleoside Thiophosphonate Diphosphates: Effect of the Alpha-Phosphorus Configuration on HIV-1 RT Activity.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4cp5A00
3Q83A 3JS9A 4F36A 4W98A 1W7WA 3MPDA 3BH6B 3EJMA 1BHNA 3Q8YA 4UOGA 1NPKA 3DKDA 3VVUA 2AZ3A 3EVOA 1F3FA 4CP5A 5BXIA 3ETMA 4ENOA 2VU5A 1LEOA 4DUTA 1NSQA 5CAAA 3EM1A 2DY9A 3Q89A 1WKLA 3FBEA 4HR2A 1XIQA 4FKYA 3NGTA 3Q8UA 2ZUAA 3VGTA 1LWXA 3DDIA 3GPAA 1NSPA 1EHWA 1F6TA 3PRVA 3ZTRA 1HLWA 3NGUA 3ZTPA 4ANEA 5C7PA 4FKXA 3VGUA 1NDLA 1NCLA 1S5ZA 3BBCA 1NDKA 1WKKA 1PKUA 1WKJA 1S57A 3WX8A 1HHQA 1B4SA 1MN7A 3FBBA 1NSKL 1ZS6A 1MN9A 1UCNA 2BX6A 1PAEX 3Q86A 1K44A 4DZ6A 4S0MA 4ANDA 2HURA 1JXVA 3PJ9A 3EVMA 1NDPA 3FBFA 3ELHA 3FCWA 3ZTOA 2HVEA 4C6AA 1XQIA 3EICA 3FKBA 3ZTQA 3EE3A 1KDNA 1NHKL 3NGRA 2NCKL 4O0NA 5CABA 2CWKA 3VVTA 3FC9A 4WBFA 3VGVA 1NUEA 3G2XA 3NGSA 3BBFA 2B8PA 2BEFA 1U8WA 1B99A 4F4AA 4EK2A 3ZTSA 3BBBA 1BE4A 1VYAA 3EVWA 1S59A 1HIYA 3EMTA 3L7UA 2AZ1A 4DI6A 2HVDA 3R9LA 3B54A 3FBCA 5IOLA 4UOHA 3FCVA 3ENAA 1NDCA 3B6BA 1NLKL 2DXFA 4UOFA 2DXEA 2DXDA 2B8QA 4ANCA 1BUXA 1NB2A 4KPCA 3Q8VA 3GP9A 3BH7B 3VGSA 2DYAA
chains in the Genus database with same CATH superfamily
2IMOA 3CE8A 5K8PA 1BHNA 1MLAA 4OX9J 1RXOB 5ETMA 3CMES 5J2PA 3MECA 1U6ZA 4Q43A 3PIOQ 4DV7J 2GVZB 1WTFA 3RG6A 2OPSB 3P8BB 4AQYJ 4CLYA 2R2SA 3D28A 3MM6B 3B4DA 4B9VA 4DQPA 3AXKA 1U48A 4USKA 2KU7A 4F4WA 1FRKA 2DISA 2RDJA 2ZM6J 2G4BA 1VBKA 1JLQA 3J7ZT 3SSRA 2RKIA 1IUJA 2PT0A 5J2NB 2OPRB 2YNFB 1F5BA 3CCLS 3QSYB 2HS0A 3KYLA 1PJ6A 5LMUJ 3KDNA 1JLFB 4HDHA 4ZLJA 2V9WA 3FRZA 1BWVA 3MD3A 2ZH6A 3HHDA 3HI9A 4YUDA 2MLXA 4DR4J 1RADB 4X62J 3HKZD 2EG2A 2KJWA 1UJ6A 2VBXA 3KDOA 1NPKA 5D4PA 5IT9U 2KFYA 4MFBB 1JKHA 1T3OA 1O6XA 4FNHA 1C0UB 4USTA 5DDQC 1G6BA 2LA6A 2CQGA 5A8RB 2XMVA 1VHFA 2DHXA 2MJNA 1C4CA 5KFQA 2ZDPA 4OX9F 5F8NA 3AFGA 2XYHB 3A3NB 4WTOB 1DRZA 3PJ9A 1PBAA 5K20B 4DWIA 1KQFB 4F2RA 1VJWA 4CT8A 4AQYF 1SH0A 3TEGA 5F3TA 3AJ2A 4BWJA 2A6OA 2V2VA 2BJ1A 1QSSA 5B0CA 2N3LA 4C48A 1UVMA 3B8HA 4OHXA 3KG1A 5K8OA 4TNOA 4CH0S 1GFWB 2OSRA 3KUEA 4WTYA 2QN6B 3B78A 4YMEA 4K5RA 3CC2S 3M8QB 1TK8A 2NPIA 1HQ2A 1REVA 1N8RT 2EI5A 2DNRA 4FYVB 1S9GB 2YKAA 1LEOA 4O3PA 4TQRA 3T5JA 1HWIA 2CQIA 2K1RA 4FKYA 1IKWA 2VIHA 2WK4A 2JFKA 4XDDA 3KHGA 2XULA 4FS1A 2HNYA 5MLCV 1T94A 1S5ZA 4BC9A 3BJYA 4RU9A 2A10A 1UZDA 4WKRA 3MPWA 3C8YA 1MN7A 1FRLA 3ET6A 2B7CB 4EYHB 4EYIB 4IOCQ 4KHPF 5U47A 1PAEX 4FN5A 4ZP7A 2ZH7A 5H9EK 1J2VA 1MWZA 4G1PA 2HG4A 5F8LA 1IVZA 3RJMB 4M94A 3ZZRA 1NMEB 1PBUA 3QWPA 4NLYA 1HI0P 1N6QA 1H73A 3OR1A 3D3CJ 4WZQA 5E7OB 2ZH2A 2ZC4A 2F8EX 3AD7C 4DL7A 4LR9A 1A7GE 1RT2B 1TAQA 2MXYA 2Z57B 4RW4B 2CKWA 1J5OB 4KGMA 4DX5A 1YIJS 2ZDOA 3RU0A 4UY8T 3OSNA 4LFCF 3DCAA 1HNIB 4JYAJ 2D3UA 4MTPA 3AY0A 5E5NA 2R2UA 3E01B 4V19J 1U2RA 4LF6F 1X4FA 2ZUAA 4FF4A 3OL8A 1EIYB 2XMTA 3JYTA 1AUSL 2DRBA 4K4TA 4U95A 4EUVA 2XMUA 1N5TA 4Y2MA 4ZN1A 1TKXB 3G82A 3WX8A 2P9GA 1NK9A 5DDOC 1JLAA 3HVRA 4CTAA 3M2UA 2P6SA 2CPDA 2VJUA 2YQ3A 2RF2B 3EICA 2QJ3A 2HSEB 1AA1B 3PCOB 1CULA 3NOCA 3UQSA 3ZZTA 2Z2LA 1RWUA 3SFUA 3GIJA 3LWMA 3JSBA 4JI1J 1VRUA 1VBZA 4KH1B 3FRYA 4DU8A 3QT7A 4PYAA 4Y28C 2J0WA 4J9QA 2NUUG 2VA2A 3SIPB 2QL5B 4CO0A 4N5SA 1SXLA 2NXJA 2DR9A 2HVHA 2DGVA 2KFZA 2LQ5A 3MCOA 4ZMMA 3SV4A 3RBXA 1RAFB 1UJ5A 1HI1A 4DFPA 2QA2A 5T7LB 4ECRA 3OXGA 2DT9A 4J9LA 2XY7A 3R5CA 4X2BA 3MTJA 4LJMA 4QR0A 3CW2C 1VFJA 3KJVB 4U8YA 1VQ8S 2M8DB 3BR8A 3DOMB 1OJ4A 4Y2KA 1JLEB 1YJTA 3W2VA 1NKCA 1Z2LA 3THVA 5BR8J 2J9DE 4DL2A 1U1KA 3OL9A 1WC6A 5HQLA 1OWXA 3EWGA 1IBCB 2MHNA 1FX4A 3GSDA 1YRUA 4C8ZA 2W2OP 4PWUA 3L4BC 2EBGA 1U8WA 1RWKB 3IG1B 2G0CA 3OQ2A 5IT0A 4FZVA 2BE7D 4NLDA 3QRRA 1BE4A 4A46A 2GHWA 4NPOA 4OL8A 2NQPA 5ETLA 1JLQB 4M5MA 2F7VA 1Q78A 3H25A 1KVKA 2YXLA 2GIRA 1HWKA 2H51B 1VK3A 2WOMB 3BYRA 4CYUB 3SQOP 2KXHA 4JI1F 1BQNA 2C1EB 2A0FB 3HDSA 2DEIA 3PTWA 2O3DA 3ISND 2WONB 3TJAA 2VPWB 3BGRB 1C1CB 1M5PC 3FUYA 5KOWA 1YITS 4W4MA 3OPKA 1QTNB 1FDAA 3MMCB 2BX6A 4O3QA 1JKHB 3FFIA 1F2GA 1N34J 4F3QA 1JNZB 4YP3A 2MZJA 2HZCA 3OVBA 4ZVTB 2XS2A 4Y0FA 4IOAQ 3UO0A 4ZPDA 2BACA 4I6YA 1YWXA 4JI0F 4DV6J 1KP6A 5BR8F 3ENWA 2OJ3A 2C2RA 4ZITA 2YNHB 2JH3A 3KUHA 3GIIA 2W8KA 1FRIA 4MK9A 3QWUA 2F8HA 2PA3A 3Q2TC 4KTQA 1RTDA 3CCWA 4F36A 4B02A 1VISA 4TYAA 4TYBA 3W2WB 4CH1A 2VQEJ 1J5EJ 1Q7LB 3JAMU 2EPIA 3KLEA 3I5AA 4ZVRB 4X66J 5C7PA 3UE2A 1HW8A 1CJTB 4F02A 5HI7A 3TP2A 1HBMA 5DDRC 1U4BA 4L73A 1W25A 1QUPA 2XI2A 2XTJP 2JLGA 1N4LA 3O6QA 3M8PA 4LSZB 4CZCA 2HNYB 3QMQA 4M1KA 1U26A 2XZTB 2F40A 1VYAA 2J8SA 3FQKA 4OZJA 4WFYA 1NJZA 2IM2A 4N8NA 3THPA 5D77A 2JLEA 2JLFA 2DXDA 4K2JA 2ATCB 3IAM9 1HHTP 2J7WA 3N01A 3MTKA 4B3TJ 4DV6F 2QEXS 2DR7A 1SUQA 4PG8A 2LEAA 3M2VA 3VZHA 2AP6A 1DZ5A 2BOPA 3DU5A 2CADA 3KK3A 2XZWA 1CC7A 1G2EA 4WP3A 4KSEB 2BANB 3OUYB 2LU2A 2HHUA 3OTDA 4B9UA 4QU6A 1J5EF 4USJC 1N88A 1U1RA 1GT8A 4NLQA 5SUHA 5A0YA 4WP8A 2DR6A 5LJ3Y 4M8LA 5AJ3J 2MGZA 2VD3A 2B9YA 4P2XA 3CPWR 3EVWA 3CCUS 1JLAB 1RAEB 4H4OB 5CYQA 2IA6A 4OHWA 2B4OA 1FNXH 4CTAB 2ZFHA 1FKOB 1RWXB 3FK4A 2KHDA 3T1YJ 5HN0A 3W3SA 3NP5A 3TANA 3CCZA 2BR0A 1OY8A 1IBLJ 2VOOA 1PYOB 4RO0A 1VC5A 1WC0A 2E29A 1CSJA 2JHEA 4Q7AA 1FTCA 1VQOS 1F9HA 4AFFA 1AW0A 1KVJA 2BJDA 2YY3A 5CCMA 3NL0A 2ZE2B 3NGUA 2QT7A 4B3TF 5KFTA 2X1GA 2ZITA 2FTRA 4OX8A 3KUGA 2YNIB 4CO2A 2HWHA 2HBQB 2H4YB 4IR9A 2QRRA 4IO9Q 2YWWA 2GO8A 3KTQA 2OPPA 2ZEJA 1FJGF 3FEYB 2R7OA 5B09A 4C98A 4QBUA 2KL8A 3NOGA 4KFBA 4NI2B 1SCJB 5FDLB 2IRXA 3JTPA 4K4SA 2ACMA 5K5MA 2K2PA 3W2VB 1OO0B 4DV0F 3EXYA 1QAXA 9ATCB 1WG5A 2NYIA 2UUAJ 2D9OA 2FJDB 1Y3KA 1EKSA 4QWAA 1MU2A 3H5SA 3WIVA 5AJ3F 1VRQC 2BOAA 4B3OB 4YR3A 3SDEA 1FE0A 4MT1A 5CH7B 4J9SA 3A13A 2VFRA 5FJ4A 1WKLA 4O44A 2ASDA 3W66A 2VPXB 1Q53A 4FXVA 2Z56B 1ZETA 3H7HB 1GTHA 2KKHA 1V3RA 4C0HA 1JXEA 4B17A 3TA2A 1WOOA 4YN3B 1RKIA 2PO4A 3BV8A 1E6YB 3AD9C 4OHZA 1JLBA 4DFKA 5F41A 4OJ1A 2CQHA 3KFWX 1IXKA 5HJXA 1XNQJ 4ETZA 2F65A 2EW9A 3KHLA 4ATNA 1AT1B 2C42A 1SV5A 3ILJA 4JI4J 2G0IA 3B6BA 4USMA 1NLKL 2WCXA 1F3VA 4C8YA 5F8GA 4F25A 1DARA 2KI2A 2R7TA 4WXOA 1Q95G 4DV1J 1SJ3P 1NK7A 2ZBPA 1UETA 1X9MA 5H1SV 3RBEA 1MW7A 1APSA 4QIEA 2FIUA 3S8SA 4KO0B 3A8JA 4DQIA 1CJVB 4YB7A 3ZZ0A 3TO8A 4LREA 4ID5B 2WSFC 4QZVB 3H4DA 3T19A 1R0AB 2J6SA 3QJPA 3OTEA 2XCAA 4OQJA 2CDRB 2M7SA 4C2MA 4LQ3A 4AXJA 3CDWA 4WE1A 3RAQA 1U6BA 1YX2A 2RE1A 1DTQB 1NH7A 4O0NA 4C8LA 1FJEB 2V63A 4NMXA 5KFEA 4K4UA 5J2MA 3KJQB 5EWFA 2W4PA 3NGDA 4QR2A 4ELVA 1RTJA 1N52B 1TL3B 1JLCB 4PPZA 1M5KC 5BYQA 4ES1A 1YZ6A 1G1XA 1CQMA 2ROEA 3GG0A 2CPXA 5KFJA 1T9TA 1C0TB 2B4VA 4ANCA 4D3HA 2JNJA 1XNQF 2DRDA 1X9WA 5HP1B 3NY0A 3V6HA 1U0HB 1OS5A 4NZ7A 2W25A 2XS7A 2H4WB 3VVUA 4OYAA 4JI4F 2ZVSA 1RTHA 5KG4A 4CLKA 1HNWJ 4J9MA 4RL1A 3FEXB 2AV5A 4OI2A 3R6GB 2EVZA 4ZVGA 4DL0C 2CQ0A 4DLEA 1ZTWA 4PQAA 3H42A 5GAHU 3IN5A 4DV1F 1WKJA 3I31A 5BJRA 4ER8A 3M2VB 3T1HF 3GJTB 3QRQA 1BMQB 2AGOA 2LCWA 1KTQA 4C6AA 3KK3B 1Y5IB 4KGXB 4UQGA 4RNFA 2VG5A 1PC4A 4TY8B 4KRWA 4TXSA 4ICLA 4MIWA 1C4AA 4WYLA 2AW0A 2QYCA 4IH6A 3U1NA 4KHRA 3PW4A 3CJKB 4M5JA 3MR6A 5CYJA 2NR0A 2EKNA 1SIWB 3MEGA 2FHOB 1LW0B 4UY85 2PGCA 2MKHA 4ZJOA 1U47A 2E7XA 5I3UA 2VZ9A 5KFKA 1SJ4P 4I6AA 1VIOA 2DYAA 4W98A 1UVJA 2ZH4A 4X4VA 3DLEB 4IYQA 4C7QA 1NSQA 3WZ0A 2V8VA 3PRDA 4A8WA 1X4EA 3H5UA 2X1AA 3D0IE 3NBPA 4JI3F 3LAMA 3W9HA 3IRWP 4ILRA 2HNZB 3C16A 3OL6A 3AAWB 4F4ZA 1HNWF 5RUBA 1P27B 2QFJA 2C3OA 1FJCA 3RBDA 3NWGA 1DQ9A 2AYMA 1Z4UA 3C15B 3L7PA 1GX6A 2Q79A 2LA4A 4X4QA 1RLDA 1KHVA 2QLJB 3MFIA 4EBCA 1K1QA 4DCPB 4O4GB 2BV3A 2AYEA 1KWMA 2XNRA 1U6FA 5LL6d 4RW9A 2GW8A 1JB0C 2GVDA 3M6VA 5IOLA 4CO1A 3W5YA 3CWJA 3CCES 1Y9OA 2LP4A 2D1CA 3QIPA 2HNDA 2QSFA 2BUNA 4P9SA 3OJUA 2K3IA 1Y10A 3HD2A 1L3VA 4AUKA 3HULA 3LA0A 4ZKAA 4NMLA 2VPYB 1OQ6A 1HMVA 1TKZA 1K73T 1EP4A 3UI3A 1Q0NA 2D3O1 3CXCR 2UUWA 4QWBA 2MMYA 5CXTA 2H3EB 3GIKA 3TZXA 4UTGA 2XB2D 3CGIA 3MZIA 4RUBA 1PKUA 1OMSA 4X4PA 3SDEB 4X4TA 2VL1A 4UUWA 4RBUA 3KKFA 2ROGA 2HURA 1QUVA 4E0DA 5HLFA 2JEJA 3ICLA 1NJXA 4OHYA 2AJ4A 2YTCA 1RHQB 3W63A 2AGPA 3G86A 3A8IA 2GZOA 4NLXA 4IFVA 4CQ1A 4LSLB 3KLIA 3KLFB 2E1CA 4QWEA 1QJHA 1ZBTA 2A6MA 1SQEA 4AT1B 2DH7A 1KONA 2GC8A 1CBKA 2QE5A 2F4VF 4ERDA 1HQEB 3QAUA 4PKDB 2OFHX 3DOKA 3SSQA 4J7CA 4QR1A 1JK9B 4IG3B 3P96A 4F0KA 2HQCA 1RT5B 2AEMA 3G6XA 1RDRA 4PXEA 1SV5B 3HX9A 4LR7A 1RHMB 2XMAA 2RQ4A 2QSWA 2BE2B 2X3DA 1WEXA 3HSZA 1BD6A 4FVCA 4KKOA 3TNVA 3DXSX 4U67Q 3NNHA 2R7QA 1OYEA 4UT4A 2DNYA 3MAQA 2J7KA 1KOOA 5D6GA 2WBRA 3PFOA 1S1TB 2L9DA 2W9CB 4PAAA 1VQYA 3CMAS 4IQMA 1GK8A 1PC5A 1JIHA 2OPQB 2E9RX 4XIUA 3MMBA 4ZP6A 1URNA 2QLXA 2RRNA 1N5SA 4EI2A 1VS3A 4ECQA 1O51A 2BMBA 4DL3A 4MMOA 4ED3A 1HNXJ 3VF0B 2LKZA 1X5OA 4DR1J 5AXMA 1GAOA 1QD1A 2Y0SD 2LQBA 2F8MA 1YRXA 4P75A 1H98A 5IS2A 3PX6A 4CO5A 2BABA 1KQSR 1TL1B 1Y0HA 4YOEA 3CVKA 2B0GA 3TUIC 4O3SA 2FVQA 4CLWA 3OFFA 4OYOA 2ZJRQ 4ECSA 4TKTA 4FVMA 4DLGA 4C97A 1YGYA 2HPUA 1HPZA 5KFGA 5KFMA 2PEBA 2YWFA 4WK3A 4DQRA 4DJBA 1ZA1B 1W26A 2YNGA 2OGUA 1RTHB 1MWQA 3GG1A 4HDGA 2AYBA 2MSTA 5C25B 3DXBA 1PIEA 2D7SA 3I82A 1KLNA 4F2SA 1RACB 1ROFA 2Y1RI 4C8MA 3TJ8A 2ZHOA 5HBMA 1XTZA 4Y65A 3MM9B 1YRTA 1HIYA 5IQQA 4L74A 3MOZA 5L1LA 1FWLA 2KZMA 4DX6A 2L9WA 2A1BA 5A8KA 2A2DA 3T9ZA 4DR3J 1WHYA 1N36F 2PDAA 4LRFA 3D0GE 1XMOF 2ZUGA 2EG1A 1VDHA 4Y2AA 4LF7J 4JI2J 4CLLA 2ZZTA 4TU8A 1UKUA 1S1VB 2ZH5A 4U9RA 3SFGA 3KG4A 2ZH3A 3F41A 5J1EB 4MKAA 1KHWA 1TQLA 1S4FA 3CT9A 2HHHF 2LXFA 2C22A 3LOUA 1HR0F 2M52A 2P2CB 5DQHA 4LIWA 2YQ1A 2OD4A 1RHJB 1JWWA 2OEMA 1NZAA 1Q7YT 2CWKA 1TU0B 4WFZA 4MIAA 2B6AB 2LFVA 2MQNA 1ZM2A 1S59A 4LVOP 3UNGC 2HMIA 1NXIA 4DR7J 2E9ZA 1S6UA 1YJWS 2E9TA 2GGPA 4ILMA 2JRSA 1CEZA 1R7IA 2AJQA 4JV5J 1PYSB 4F3OA 4P74A 5IT9Y 1T0TV 2FDNA 3PIPQ 4KBIA 2ZNYA 5AE2A 2AZ3A 1EQMA 2FJEB 4AL7A 5CAAA 4DR3F 2M8HA 3Q8UA 1WOPA 3VCDA 4HACB 3VAJA 2XI3A 2JX2A 1JXLA 2UU9J 3D0HE 2R8IA 4M5DA 4G1IA 4QWCA 3A8KA 1PO6A 4LF7F 2XLIA 4JI2F 2XHWA 1FDBA 3IGVA 3OFEA 4QYZJ 3MM7A 3M05A 3TOQA 4DUYF 2OI2A 1B70B 1P9YA 3OJSA 1RT1A 3AXMA 1TKZB 3OLAA 4CT9A 1AZSA 5D0HA 4ZVSB 1UW9A 4P7VA 1Q79A 3R1HA 4R5PA 1NUEA 3NGSA 3CCMS 2BEFA 4YY3J 1FJ7A 3TX0A 2LDYA 3CUNA 2DNQA 5F0WA 3RGIA 3CCVS 4ZPCA 3B54A 2KRRA 2GV1A 3SCLE 3DLJA 3E3XA 5GMEA 5ADZA 4F8RA 3Q8VA 2RB7A 3ZZPA 1NB7A 1IR2A 3KLIB 2V94A 3QIDA 4DR7F 4DN0A 4DR6F 3O5TB 2QA1A 3IGNA 2R42A 4O0IA 1VRTB 3NGTA 1LFPA 3N0VA 3PZPA 4JV5F 1NSPA 1OSCA 2J0QD 1F6TA 4OZ3A 3ITHB 2PD1A 3IR7B 3D67A 1IKXA 1I94J 2E1PA 4LFBF 4F4XA 4QIFA 4NX9A 3GU0A 7FDRA 1IR0A 3T1AA 1VQ5S 3UN3A 2Y0BB 2Q43A 2VDIA 3Q8RB 4X4SA 3EE3A 3MUTP 1FTRA 2OEKA 2F63A 1F1BB 3W7BA 4RW6B 2DHSA 3HHKA 2HWTA 5EHHA 4KKOB 1S9EB 2VQFJ 1N48A 5F0UA 2ABYA 4HL9A 3R5AA 4ZDNA 1FVSA 3ZNUA 1X0FA 3M6WA 3QO9A 3Q0AA 4AYBD 2UXDJ 3N6MA 2MQOA 2LEBA 1H6KX 2DXFA 3GWCA 3DMJA 3VAFA 5DO2A 4CM0A 1WHVA 3IM9A 2DNMA 3Q22A 3Q8YA 2ATLA 2COLA 3GLJA 5KG6A 3GV8B 4DUTA 4ECTA 5J2QB 3X3UA 2WVBA 5KT3A 3EM1A 3NNAA 4EFAC 3A8EA 2E5LJ 3SBMA 5G0RA 2L48A 3ADAC 2VBWA 1XBWA 2LVWA 2CPEA 2I0XA 3GFHA 1DLOA 2GJ2A 3PJWA 2CG8A 3OFGA 4IUFA 3WDOA 2WVFA 1T03B 3HM9A 1LWCA 2Z30B 1Q82T 2ASJA 2CPHA 1F5AA 1H2UX 5B08A 2IIHA 1I94F 2NXUA 3BQ0A 1NK0A 3KLGB 2B43A 3CB4A 4F4AA 5HVFA 1CC8A 4I7FA 3R7SB 2E7VA 4EK2A 1RWNB 1ZAVA 2MQPA 4P10A 1VC6A 1U09A 3J81Y 4NRUA 3ILOA 2AU0A 2BW2A 3DKDA 3IC1A 3TAQA 2ZD1A 1U24A 2HQIA 4ZJQA 4JI7J 1SJFA 1TR0A 1SKSA 3F0NA 1LWXA 2OD6A 1YBUA 5D0GA 2OFGX 3M1VB 5KFNA 4JI5F 1K1SA 4FKXA 4R8UA 2JVRA 4LF5F 1WG4A 4URSA 5I4MA 5E0OA 4GMKA 1X60A 1TZ0A 3L09A 5ETOA 3J7A1 4F04B 3D54A 2BZ2A 4OLPA 3BEGB 1HBOA 4NCGA 2WVEA 1XERA 3FCHA 3BBFA 4IG0B 3A4TA 4OX7A 1D8ZA 2VUGA 3W65A 2NXEA 2IM0A 1RT6A 4X64J 2HHSA 5AT1B 2VKRA 2ZKUA 4RJVA 2GQQA 1RA6A 3W5XA 1GMWD 3AJDA 1RT3B 2R9LA 5E2QA 2HGNA 3SYZA 1GMUA 2ZWPA 2OH2A 4MKBA 3MMAA 3TAPA 1SC1B 4KPCA 1HNVA 4LF4F 3UR0A 2CAJA 3QPIA 3VGSA 5F9NA 4OYZA 3PW7A 1GXUA 4LUBA 2OP5A 2PA8D 2FVSA 2VONA 2IY5B 1ZM3A 3IAS9 1OY6A 4HR2A 4HI1A 4E8UA 3GJQB 2DH9A 3K17A 2ERRA 5DETA 1JNRB 4NLWA 3OR2A 3CC4S 3D7SB 4ZS6A 2WTFA 3I5CA 4R0EA 2V67A 3JSMA 2F9DA 2CNKB 3SQGA 1R43A 4B9MA 6FDRA 2EFNA 1H38A 3OVAA 3MR3A 4DSJA 2FPHX 3ISZA 1PJ5A 2YPZA 1HWUA 1TKTA 1WC4A 1QE1A 1RT4B 4LSNB 1S6PA 4MYTA 3DRSA 3H8YA 2OHDA 3TUPA 3UVJA 4A8QA 1FF2A 3KK2B 2KN4A 4PCQA 5C42B 3MPUB 4KC5A 1IBMF 3V4IA 1RHRB 4PWDA 4ECUA 4QU7A 4X64F 8ATCB 1UWBA 3V6DB 2O67A 3THTA 3QQCD 2G1DA 3BSNA 2IJFA 3BO2A 4RZRA 4F0HA 3C6UB 3VQSA 3GJSB 3ZFVA 4ZLLA 1BQMA 3TZWA 2RS2A 1S57A 1HQUA 4KV8B 4QCLA 1J27A 5HSPA 3GFXA 4RPFA 4GO7X 1HBUB 4K7QA 3C6TB 3WBZA 2JEFA 3UW1A 2ZVIA 2MZSA 2B8PA 2NPFA 3CCRS 2DHHA 3POTB 2KVIA 2DB1A 4EMDA 2Y8YA 2UZAA 1XNRJ 2XC9A 2FVPA 2HS3A 2RS8A 1FKAF 4OJHA 1B3TA 1R31A 2AT1B 1XN9A 2CYYA 3N6LA 2O1PA 3BKFA 1F3FA 4ZPWR 2QYGA 1KFSA 2BE9B 1WSRA 1YJ9S 3UDEA 5HO4A 5LSOA 1S0VA 1T05A 3CCTA 4Q2LA 4M63A 1DFDA 1KFDA 3C2PA 4GKJJ 2E1RA 4EBEA 3DLGA 4KB7A 5M2RA 2NXNA 4K50A 3GB0A 2MZQA 2VH7A 4ZLPA 3LGMA 3T5LA 2R7RA 3MMJA 1FXLA 4NZ0A 3JQMA 2WBMA 2VG7B 3MCSA 4K4YA 4BWMA 4CLTA 4JBCA 4J90A 1UPPA 4DFJA 2MJUA 4CDIA 1CJUB 3TYTA 4GKKJ 3PW0A 3R7BB 4IO1A 3P3DA 1LV5A 2RU3A 4LRDA 4IFYB 2B4PA 2V6AA 5JVHQ 3DGVA 4H4MA 1CG2A 3J80U 2C2KB 1S4EA 2W9BA 3HKWA 3D1OA 3PR4A 4J9OA 5A8WB 2YWKA 1RT7B 2HQGA 1XNRF 3K59A 1EKRA 2XLJA 1RZMA 3V81A 2V4JB 2E44A 5C2CA 1FVQA 3W62A 1UJ4A 2ZBQA 3CCJS 3GFZA 4ZLNA 1QAYA 2VV5A 1S99A 2VHGA 1H0HB 3I0RA 3BGOP 2ZD1B 3HHLB 3VWSA 1KLMB 4DG1B 2RILA 5ETTA 2HFVA 1SH2A 1L5UA 1KSPA 2UVWA 2QA4G 4P73A 4DMZA 2GCFA 3JQKA 1U2FA 3MXHP 1H7WA 5AXNA 4UOCA 1S7IA 2IDEA 2MZTA 3EUNA 4ECYA 4F50A 1R89A 4IQXA 2V8HA 4ZVFA 2I5JA 3TA0A 1WELA 1VI7A 2UP1A 1QAIA 4MJKA 4GKKF 5MAOA 1N5YA 2J76E 2O5DA 4XPEA 4OI3A 3G96A 5HANA 1NAQA 3C14B 3NMRA 2QG9B 3EZ5A 4MYUA 4F7VA 1EETA 1Q8IA 3UCZP 1B64A 2FZCB 4KIAA 4K4ZA 5HMZA 1FA0A 2V8PA 4KE5A 3GJRB 2EFQA 5KTQA 3AA8A 4ZOSA 2WVCA 2YKMA 1D9FA 2LECA 2XO6A 1VBYA 1WC1A 1ZM4A 4HHUA 2YPYA 5DS7A 3GCWP 3IO1A 2ASYA 3MEEB 4DV2F 3Q8SB 1FK9B 3OTOJ 2XBPA 3NS7B 5HQMA 3MF5A 4WBFA 3LANA 2U2FA 3DGPB 3MEDB 3OR2B 1Q8KA 1ZAXA 2VICA 1XMBA 2BRKA 3HHLC 3M8RA 2FGOA 3MM8A 1H74A 5KFUA 5CHCB 3KLHA 1WI8A 1A6LA 1JQGA 3UDCA 4GC6A 5HATA 2MTLA 4M5IA 2FD2A 4I64A 1S6PB 4WF9Q 2H54B 2FJWA 1C2PA 3DRRB 3TUJC 3PHTA 4J9NA 3DYAB 3I56S 4WCEQ 4F0MA 3C19A 5LOQA 5HVHA 5GADI 5CCLA 3ZTRA 3D6HB 1EZZB 3GE9A 3CJ2A 1NDKA 3M8YA 1QVFR 2P8IA 2CQ4A 1N32F 4RUAA 1AXQA 1UWBB 4AL5A 2OMOA 2BRLA 2E66A 3LQVA 4ALZA 1Q81T 4C11A 1RBAA 2RHSB 4NCAA 2XM3A 4DUZJ 1LK5A 2OTLS 2VG6B 3IS9A 1YSJA 1WHWA 1IKYB 4PUOA 2DGUA 4MH8A 2DPJA 3OTOF 4MKYA 3LP0A 5JJBA 2WAQD 3MFHA 1VQSA 2AHOB 2VKZG 4DV5F 1MMNA 5CD4H 4Z7YA 2HAIA 1Y7PA 1XEZA 1WC5A 1FDDA 4DFMA 1O0PA 3CD0A 2BA9A 2CXEA 1S1XA 4B3MF 1CQNA 1B7YB 2DGTA 5D4NA 1S6QA 1FFSB 5B7WA 1CJKB 2IAJB 3CJSA 1JJHA 1BC6A 3KNAA 5BYRA 1NBEB 2APOA 3MI7X 1MNEA 2G2ZA 1GXLA 2HZAA 3ZNJ1 3KMQA 4QWDA 3H4BA 3NNCA 1TMJA 2B51A 1X4GA 1DY3A 3OLBA 1VQ6S 4JV2A 3HHNB 3QT6A 1H2VZ 5L1JA 4I2PA 4JUZA 2IVFB 1YBTA 4IDKA 5AXKA 4DSIA 1Y3JA 1PG5B 3FC9A 3QSIA 3FSYA 3PR5B 1TL7A 2GQ2A 2UUBF 3LUYA 3FVYA 4LF9F 1LXNA 3MEKA 4B08A 4KHPJ 1R0BG 5ETNA 3HVAA 4DUZF 2GQCA 1UTAA 3WIUA 2GO9A 4I67A 4J37A 1UAWA 1PILA 3CJ4A 1RAOA 4NLRA 4UOGA 5IM0B 1TKDA 3QRPA 1ELOA 4ED7A 1E6VB 3G6VA 1ZPVA 2DY9A 3LP1B 3AH6A 4N47A 1TUVA 1VHIA 4H4MB 2JDJA 1V3ZA 2MYFA 2EEYA 4ZCKA 4U6PA 2CJKA 1U7LA 2IRUA 5HMWA 3DLKB 2YQ0A 1QY7A 3TWZA 5CZXA 3VV2B 1ZS6A 4LFCJ 4GRSA 2L3MA 3I0SB 1TVRA 4AD6A 1HW9A 5KFSA 3LP2A 3FCWA 2N4DA 2RRAA 4QIGA 4LF6J 4WFXA 4P52A 2HFUA 2EBEA 2YKQA 4ECVA 1RAGB 2CFXA 2ZJPQ 1FKPB 5E3CA 3FSXA 2KT3A 3LW5C 3L7UA 3TR5A 1TFYA 3S01A 3CIZA 1DTTA 2ALYB 4B3SF 4OV6A 2M4MA 2W8LA 1JJ4A 2UVVA 3I6PA 4H4KC 3Q23A 2CZVC 1ZH5A 1SKWA 4DS5A 1LW2B 4DSFA 1W7WA 4XTTA 3A12A 3IRXB 4DEZA 1V5IB 4UUXA 3ILLA 1RTIA 3AB2B 1YJNS 3M2RB 2DR5A 5L39A 4MKVA 3M32B 5DGAA 2I5JB 3RR8A 3FQLA 1VLYA 3U27A 4IKAA 3DLHA 3VAMA 4C0BA 2LQ9A 4PQUB 3J7AN 1RB0A 2VC1A 3MAHA 4WIIA 4HTJA 3D2WA 1JXVA 2JC1A 3BN7A 1KC8T 1VR6A 2B5JA 2QMXA 1RP5A 3OVSA 4IR1A 4U96A 2Y1LB 4K4VA 1WHXA 3UN2A 3CDBA 4NCBA 2WW8A 2H5EA 4KY3A 2DEJA 3M30A 1FFWB 2HVDA 2EC0A 3FEZA 5LM7E 4FYXB 2M70A 1VQLS 1LWEB 3QLHA 1URRA 4K8RA 2I6WA 1IBKF 2IYGA 3W5ZA 3MD1A 2DO0A 2Q6CA 5FIIA 1WTBA 4OIXA 3MM8B 3TAMA 4XO0A 5J1NA 3SCKE 3JTNA 2NSBA 1VOMA 4CM2A 4M5KA 3I87A 4I2QB 4CLPA 4PG4A 4RW8B 3R5JB 4FYYB 3F56A 5D3GA 1GQEA 1WKKA 2MLZA 1FT8A 2RHQB 1FRMA 1S1UA 3MGJA 3W8GA 4S0MA 2KO1A 4CNZA 3BO4A 4V1Ak 1IKVA 2JC0A 1HBNA 2PC6A 2DCUB 2FZGB 2C3YA 4NOHA 4Y00A 3FKBA 5KFCA 3IMQJ 2PE8A 4TY9A 1NZ8A 3J81U 5B0FA 1VCTA 3NWRA 4C9DA 2BKNA 4C0OC 2DBBA 2HIYA 5DLGA 4WFAQ 4HKQA 4P6QA 2EC2A 4J5OA 2BDPA 1L3UA 3DOLA 3HSJA 4LRCA 4DF4A 1S1WB 2V5HG 3DN9A 3NEKA 4GVBB 3EZUA 1WACA 1RBOB 1H3DA 5L1IA 1U1NA 2AKWB 5EUHA 3ETMA 2BJ9A 2G2OA 2KVQE 1TMMA 2HFSA 3ULHA 5KAKA 1U1OA 3HJVA 3OTBA 3PO4A 4JI0J 5J2PB 3MECB 4C8KA 1FE4A 4EZ9A 2KT5A 1LXJA 2W2PP 3MCNA 5B0BA 1WF2A 3BR9A 4DQSA 1D9AA 4C3KA 2ZBCA 5DG8A 4G65A 1UPMB 3AJ1A 1RU1A 4G3IA 5BYSA 3LPEA 2CG4A 5DG7A 3G8QA 4ZP8A 1GX5A 1JLGA 3WC2A 1Q8BA 5KFOA 2RKIB 4PG5A 3U02A 3WC0A 2MB0B 4DN9A 1AROP 3BGFA 3LGNA 4EZ6A 4C3LA 2GS8A 1WEZA 3T9NA 3IBFB 5F9LA 3HO1A 2B4UA 2B7BB 2HHTA 2IYIA 1KR4A 4MK7A 1DHMA 2AWZA 3L7OA 4RUHA 1KD1T 2OO4A 4N8OA 2XSJA 1TL7B 1UEVA 3GONA 4ENOA 4YDDB 5F3ZA 4LIRA 3K5NA 3KJFB 3FSIA 2MQQA 4RW7A 4CLZA 5ETSA 3TW0A 2BJEA 2CJXB 4ELTA 3DRPA 4OX6A 3TA1A 4FF3A 3KHHA 1TL5A 1FRJA 4LF8F 3FBBA 4Z7CA 2F4FA 2YWEA 1MROA 5ETVA 4OYWA 3H5XA 2Q1LA 3U1LA 3R1LA 1NJYA 1PYTA 2IA0A 3HFVA 2C2NA 4JV0A 4NRTA 2RUSA 1RA7A 1K47A 3PVXA 3NRBA 2EFGA 2DNNA 1WWHA 5DGBA 4ZHRA 4BCAA 3M9MB 1FXDA 3DU6A 3N4WA 3R7NB 3QT5A 3LP2B 1D8YA 2C28A 2NSCA 2KYXA 1LWFA 2EK6A 1H7XA 4WXWA 1VIXA 4UQTA 3VZIA 1XWLA 4ED1A 4ZIVA 3G87A 3VTIA 2DD8S 3FZ2A 3BQ2A 2B3TB 2GVZA 1NNDA 2X1FA 1REVB 2P9CA 2ZOFA 5D8HB 1NSAA 1F2HA 3B4MA 1BLUA 1U49A 2DTJA 4Z37A 2UV8G 4UZBA 4J9KA 3CDUA 2C3MA 2K1RB 5ETKA 1IKWB 1DAXA 2V4RA 2BJ7A 3NG8A 1I5OB 1U25A 1DURA 1TP7A 3HFZB 1M5OC 2DNZA 4NE9C 3EVMA 5J2NA 3ET6B 5CA5A 3R97A 4K4XA 4HTIA 3NAHA 2RQMA 3CJ3A 3GV5B 1JLFA 4OJ3A 1NK8A 3DRYA 4J9VA 2D69A 1RWMB 1N6QB 4ZCMA 3OR1B 2V4QA 3DDNA 1UEUA 3BGLA 3QGGA 4J9RA 1S0NA 1T9WA 2B5JB 5THWA 4RNHA 3MAAA 4B9SA 1ITPA 3C46A 1FJGJ 3BH7B 2VDHA 3AOAA 1S97A 3MPDA 3TVYA 2KHCA 1C0UA 1REGX 1IQZA 3KNGA 1VK8A 4PXDA 2OMLA 2D74B 3H2UB 2Y1IA 1HWLA 1FESA 2RJZA 4DV0J 1EHWA 2L41A 1FX2A 4LT6A 2XEXA 2HQ3A 3JYTB 1ZZFA 1GMVA 2IBOA 1UW4A 2IVYA 2FY1A 3G82B 2QIFA 3DC2A 2MLYA 4NA2A 3BKUA 2CPJA 2DITA 2DGXA 3EGVA 3WX4A 4C4WA 3M2UB 3W60A 5KG1A 2HEKA 5DZ6A 2IFXA 2KRBA 2KXFA 4UZCA 5IC4B 2LQJA 4DR5F 3DDKA 3BB5A 1N56A 1CULB 2XY6A 1ACMB 4KJIA 2AJ2A 1VRUB 5KFXA 1WSVA 3M8QA 1T7PA 2V69A 2HHWA 3TX8A 2KTQA 3NAIA 2XGPA 4L3NA 1X4BA 3GP9A 4K5SA 2QL7B 5CZVA 3IR5B 1S9GA 1CVJA 4N41A 2CQCA 3HK2A 4HEA9 2X3GA 3PHEA 4CRJA 2B9EA 1YJRA 3RB4A 5D4LA 1X4CA 1L3TA 4NLOA 4DX7A 4RKUC 4HH1A 3P5BP 3CD6S 3TZZA 3QZ7A 1RHUB 2FC8A 2RNEA 3BQ1A 3K8VA 2NZCA 1RAAB 2RQCA 3IFEA 2FUG9 1M1HA 2DY1A 1D0EA 1RUSA 1JJ2R 4B9NA 3NKYA 1SJRA 5F8HA 4QW8A 1KRPA 3DM2A 4M5HA 1RT2A 1QSYA 2H5JB 1WD6A 1RE1B 4RW4A 1Q5VA 1J5OA 2JVOA 2I9SA 3AA9A 2F3JA 1S72S 5T14A 5KFYA 3K0JA 2C2MB 2BQRA 3E01A 1BGXT 2FLLA 2B9WA 2AJ1A 3AB4B 4FNIA 1AFIA 3K2YA 1U2CA 2W4CA 1FERA 5L1KA 1BQNB 1P1TA 4ED5A 4JI8J 2MQLA 2YX7A 1WORA 2YH0A 1HL6A 3K5OA 1HLWA 4OYXA 1ZZNA 1VQPS 1RABB 2MPUA 3TEHB 4XK8C 1UVKA 3S6EA 4NWBA 5F8MA 1X9SA 2RF2A 2U1AA 3TQ1A 1ICEB 3UR3C 4LFAF 1QM9A 3ELHA 3RB3A 2LMIA 3FFIB 3LO3A 3RAXA 3VVTA 3RW6A 1EJ7L 3VGVA 3VAIA 4NLVA 4E98A 3DNCA 4USHA 4RR5A 2AIRB 3H98A 4NLTA 2R2TA 4CH7A 3HFKA 4ED2A 1CPZA 1N33J 2UXBF 1YQHA 1R8HA 2AZ1A 2CJBA 2VPZB 3GMGA 1UL3A 3CULA 3T1HJ 3T3FA 1RSCA 3JS9A 5T7LA 2Y3YA 4CO3A 2BQ3A 3E8OA 1RTDB 1G4CA 1HA1A 1VGYA 1O8BA 1A0OB 4G1QA 3D1HA 5DM7Q 3KJVA 2H1YA 5I3PA 2G9OA 2ILYA 3VGTA 4DL4A 3H90A 4Z2XA 1YG0A 4ZJLA 2K8GA 2FY8A 1JLEA 3PYGA 2UXCF 3KLEB 4DPOA 4DV3F 2HGMA 1N0VC 2OELA 1I6JA 4NEYA 3CD7A 2LYVA 4JI8F 5EWEA 1YI2S 3DI6A 4NLGA 1U8SA 4Q8EA 2OSQA 5DLFA 2VFVA 1HBMB 2WSCC 1XQIA 1RU2A 1S6OA 3ZTQA 3IG1A 4ITSA 1WNEA 2N3OA 3JXOA 2KDOA 2LLZA 3M8PB 4NYZA 3MUVP 4OI0A 2R8JA 1QVGR 2XMMA 1XC9A 4JI3J 2KB2A 4NZ6A 2QZ8A 1FEEA 3CJRA 4K4WA 2WOMA 1M90T 5L8RC 4CYUA 4DU7A 2K7KA 4FF1A 2G0JA 3NCQA 1G7CB 1EAYC 4LQ9A 2ZZMA 2A18A 3AHPA 2QMWA 4OLOA 4DR2F 4TU7A 2AX0A 1N33F 3M8ZA 5IV4A 2VOPA 1ZPWX 4OMFG 5EDWA 1ZAWA 2WONA 1SUQB 2HFZA 1WG1A 3BGRA 4M5GA 4DSLA 1U0SA 4PXCA 3MAAB 2OUGA 1C1CA 1RHKB 5IV3A 1P1LA 1NHVA 2DGWA 3TI0A 3BBCA 3MMCA 5K14A 2CA9A 1HFEL 2NXCA 5DJBA 2PI4A 2J6UA 4NLUA 2AGQA 4KH0B 2EFOA 1UVNA 1UFKA 3TVZA 4NLSA 3KXDA 2G2YA 3JSRA 2W7PA 1NPPA 5A0YB 3HMJG 5G4DA 1D9DA 2YNHA 4YS2A 1Q8LA 1B99A 3UNYA 4DV7F 3ISNC 2JOQA 2W2NP 2MGZB 2NUHA 3CSKA 4PPDA 1SQFA 1R6VA 1B0VA 1OPIA 2HZVA 2C2ZB 5CYQB 4HH0A 4P71A 5GAEI 5HJYA 2GMJA 2HFNA 3W2WA 2ZM6F 4ZPVR 1AUDA 5KFWA 3R8YA 1M1KT 2ZNZA 3N5BA 2EWHA 3EDRB 2LQ8A 4WIQA 2FVRA 2MKYA 2V9KA 2DNGA 5HAOA 5LMUF 5LSRA 1CJTA 2F4VJ 4A47A 2KG1A 3GQCA 4KR0B 1PGZA 4OI1A 2V34A 2DKOB 3F73A 1FEHA 5I42A 2R2RA 4DR4F 4FYDA 4IH7A 4X62F 4J9UE 1H2TZ 2HVEA 2FJBB 2BKOA 2R7VA 1HYSA 2LDIA 2OPPB 1UVIA 2V50A 3WQPA 2Q6BA 4DPUA 3K7RA 4KFBB 3ZTSA 1UMJA 3CJ0A 3J80Y 2Q66A 4NXNJ 3EZOA 2W2MP 5GAGI 2ILZA 1S48A 4DCOB 3RBZA 4TQSA 2Q3PA 4A8SA 4A4JA 2XGQA 3I9V9 3RRGA 4NYOA 1MU2B 2M88A 4USWA 4ECWA 4ILLA 4EU0A 3DM2B 2HKEA 5K9FA 3VAKA 4USIA 2XMWA 3OW2R 1VBXA 3EGZA 1U1QA 4CWBA 5E41A 3KLVA 3MR2A 2BANA 5AXLA 3OUYA 3DDIA 5KFIA 2C2DA 4BBYA 4O44B 3EXCX 2HK2A 3HT0A 2W1BA 1NH8A 2QV6A 3HJFA 2XY5A 4WYWA 3S1TA 2Z2ZA 1XMQJ 1UA0A 4FP9A 1WOSA 2DK2A 1X4HA 2IVMA 4WFBQ 2ZH9A 1T9XA 2XSFA 1KDNA 3QYYA 1JLBB 2AEJA 2JJ4D 2FZKB 3BS9A 1YHQS 4H4OA 1KBRA 1Y5NB 1M5VC 1WJ9A 1FKOA 4LRBA 3M7VA 3ILIA 4EBDA 3UCUP 3R27A 3MOJB 1SBRA 2HBYB 5LSLA 1RBLA 1MSWD 3T6BA 4NXNF 3EYZA 4YB5A 1SL1A 1N5VA 2ZE2A 1S0OA 3RRKA 2JEGA 5KG5A 4N77A 3Q24A 1GNKA 5IWAJ 2BJ3A 4OZ5A 3HVTA 1VQKS 1RGVA 2YNIA 4EEYA 2CRLA 4ANEA 5D4OA 1N36J 1MMDA 5E33A 4JP8A 5E3PA 2AQ4A 1FRHA 1HHQA 1VMBA 4ED8A 1NM2A 2W9AA 1XMOJ 2E5GA 3LGHA 4HLBA 1X4AA 4ZVQB 5IXUA 4G1QB 4NI2A 3BM7A 5EN1A 2VFTA 4JYAF 2UVRA 3QGIA 4WE1B 5FDLA 1NHKL 2PIIA 3G2XA 4QIVA 1M5HA 1B7FA 2D3OR 4JOUA 1JX4A 5EX0A 2RDDA 2VBZA 1XMQF 3J81j 5J2MB 1SB6A 4MIBA 3GTYX 4NL5A 3DI6B 3SI8A 1RTJB 2VC0A 1OPZA 2HHHJ 3TJ9A 2ZWOA 1NEEA 1YLXA 4B3OA 1HR0J 5B0AA 4YQWA 2KG0A 1MWYA 3MWBA 1SC6A 2CQ1A 1EB0A 3W8PA 3GR0A 2DIUA 3LPYA 4CP5A 2RH3A 2DPIA 5EWGA 4ZVUB 3QJJA 5ETPA 5IC6B 2KYZA 5I3QA 3CDEA 2HLTA 2NLWA 2RIJA 5L9XA 1FWKA 2BBEA 4ED0A 1K0TA 1E6YA 4V19X 2XWYA 4ZVOB 2YKOA 4O23A 5IWAF 4DZDA 1TL4A 4FYWB 2IC3A 2CNOB 1A9NB 5IZHA 3K57A 2J0SD 4X4OA 4PR6A 4CCHA 1TV6A 2VG5B 1I3OB 2FB0A 5K14B 2VODA 1IR1A 4JB8B 4ICLB 5KT5A 2BVZA 4NASA 3ZC4A 3Q8QB 2RD5C 2ACYA 1WF1A 3CJTA 3FBCA 2VFUA 1PAUB 5EGYA 2QTWA 2CQBA 3C3LA 2IM3A 1U1LA 2Z4PA 5KOXA 4DUYJ 3MEGB 2PSZA 4CIOA 2WZ1A 3PX4A 5I3UB 3HZEA 3X1LB 2R4FA 5EX3A 1RISA 3GYNA 4KO0A 1CJVA 3Q89A 1TUWA 1IJFB 5FD1A 4BHQA 1FXRA 1R27B 2OAUA 2JZ5A 4ID5A 5KFZA 3IR6B 4LBPA 1R0AA 3OXLA 1YJUA 3PEJA 3T6JA 2ZOMA 1SPBP 3A1YG 3NBPB 3I32A 4WWSA 4ZPAA 2DO4A 3C16B 3MPVA 1S49A 4DZ6A 1DTQA 1XR7A 4DR6J 3JB9k 1U1PA 3T5KA 4Y2IA 4W92B 1WI6A 1WDTA 3W61A 1IWAA 1TL3A 2GX8A 1JLCA 2IDLA 1WUUA 3R3TA 5I42B 1Y11A 1KKHA 3CNQP 4LFBJ 1C0TA 3PJXA 2CJYB 4I56A 3FMWA 2HFOA 2YKPA 3TUZC 5KFAA 4URGA 4RW9B 2IJNA 2AYGA 5HP1A 2GVDB 1HYSB 1NPRA 1U0HA 1M5SA 4DQQA 3J7YI 2YH1A 1Z1ZA 3CDAA 2AF6A 3QIPB 2HNDB 3PYDA 4KGVB 2XLKA 2DCLA 2HVZA 1OYDA 3BSOA 3CO9A 3US5A 1N34F 3LAKA 4Q2MA 1D3WA 1HMVB 3GPAA 3TRGA 2M5YA 1EP4B 4ZA1A 1NK4A 4AL6A 1TK5A 3WHIA 2BKPA 1LOUA 5ITHA 1GTEA 3JTOA 3HVWA 1KVIA 4QQBA 4CLFA 2NS1B 2MEWA 4TY8A 2ZBRA 1KTVA 1SC4B 3UPFA 1X4DA 5DDPC 1P8GA 3ZZUA 2LXIA 1S9FA 3JSYA 5HLFB 2J5AA 3CJKA 4Q5VA 1SI9A 2DNOA 2VQEF 1C1BA 2CJ9A 3IWNC 3AQPA 3M4XA 1LW0A 2R8KA 4YB6A 1YVFA 2V8GA 4IFVB 2M3DA 4DF8A 4X66F 4KYZA 3D68A 4P2SA 5KFHA 2RDIA 1TFWA 3DLEA 3DOKB 3D5MA 1DJ0A 5A2QY 3EDQB 3GR1A 5K8MA 5L9NA 2HNZA 1R8CA 1OY9A 5LXYA 2CQ2A 3UN5A 5GVQA 3L3CA 3MM5A 4Y3CA 5CD4A 2FHJD 5C24A 1MN9A 3C15A 2FLOA 4X4UA 2NREA 3I5BA 1SC3B 5M2UA 4G6VB 4J9PA 3HVTB 2RU9A 2GA7A 4O4GA 1RWVB 5ETQA 2ZOGA 4NA3A 1Q5YA 4DCJB 4OI4A 2Z58B 2N7YA 2P9EA 1YZ7A 4JI5J 2X51A 1KNZA 3MMBB 2ROPA 2EK1A 1O5JA 4LF5J 5GADU 1BXNA 2HHVA 3M8WA 3CD5A 3N6NA 3E51A 1RTZA 2VASA 3EX7B 2MKSA 3H0PA 4YR0A 1TTHB 2CUYA 2WW4A 4XAKA 3IXQA 3PRVA 4LR8A 1HPZB 4TN2A 1Q86T 3D9BA 4LF1A 2XHCA 1N5QA 1QLNA 4LF4J 3W1YC 2YNGB 3HCXA 4DDFA 4ANDA 2FHJA 3T1YF 3AT1B 3FJ2A 1HD0A 1SJ1A 3FDSA 2QX0A 1IBLF 2FHMA 1EQ0A 4LSLA 1QAJA 3KLFA 4ZPBA 3J7Z5 3SEOA 4DX8H 4QIWD 4DSKA 3EGNA 4C3MA 2K3KA 3BPSP 4OZLA 1HQEA 2ZHAA 4OZ0A 5HBMB 5H9FJ 1SL0A 4HHJA 2IC3B 2QA4S 2RVJA 4P2MA 1NO8A 4X4NA 1NB2A 4IG3A 5A8KB 1EARA 1RT5A 2WB4A 4U8VA 3Q83A 1TV6B 3EJMA 2NYHA 1UP1A 2J8AA 3C66A 5B0GA 4NXMJ 2PMHA 2BE2A 3GZ7A 2B56A 5HMXA 2BM1A 2M2BA 4TLRA 4WZMA 3RTVA 2XZDB 4X84A 2LEPA 3IWXA 1S1TA 2WVDA 3CMQA 1IM4A 3V5RA 1IBMJ 2W9CA 2UUAF 2Z2YB 4HT5A 4UF4A 1S10A 3HXMA 2HHXA 3RB6A 3RUBL 2OPQA 2A3JA 4I6WA 4YR2A 3I4PA 1NRKA 4N76A 5AE1A 3LALA 5KG7A 3QZ8A 2P5VA 2KJVA 1UEKA 3L9ZA 3AD8C 3H40A 1QDUB 2HMIB 4KAIA 4YB1P 3MPYA 3UFCX 1TL1A 4ID8A 2GGPB 1KQGB 3IWLA 1MG7A 2GNKA 1YKWA 3GILA 2V0NA 4RBVA 1T11A 2DGSA 2DR8A 1N54B 3D3BJ 4A8KA 3QT8A 3HZGA 2WB1D 3R5DA 2CJQA 3K5LA 2EFPA 3GYXB 3NXZA 2J9DA 2ZC3A 3W9JA 2CNLB 5KFPA 4Q44A 2GHVC 3ENQA 1DQ8A 2GAHC 3DRXA 1FCAA 4M5DB 1B0TA 1NSKL 1FWPA 4QW9A 5C25A 4NXMF 1SIZA 4DHVA 3RAMA 3MM7B 5A6WA 1RT1B 5KFLA 4ZVPB 2SXLA 5CABA 3TQEA 3PV8A 2DNKA 2QO3A 1AZSB 3MM9A 1GMWA 1UWAA 4DPYA 7FD1A 4R5PB 3BBBA 4Y2CA 4KGZB 3QFHA 3R9LA 1WC3A 3K89A 1CS4A 3W64A 2FJXA 4FXWA 2POKA 4GVLA 2XYGB 2FVCA 1K8AT 4ES3A 4PEOA 3F44A 1C1BB 1S1VA 2CZ4A 4PABA 5D0RA 3IBCB 2VU5A 2YWHA 2X7IA 1UZHA 4QPTA 1SKUB 3V4MA 2ZJQQ 5J1EA 1NK6A 2FQQB 2PEHA 2C2EA 1Q4RA 4OJGA 3PW5A 4EO6A 1UA1A 2ZZNA 4N7TA 1IKXB 1KOHA 2BYCA 4B3RJ 4C8NA 1FNOA 3FBFA 4YFUA 3K5PA 3H59A 2XG8A 4NEZA 1HD1A 4EWTA 4P72A 1HWJA 1X8DA 2B6AA 1RWPB 3E2EA 3LF0A 4GO5X 2DGQA 1QSLA 2RAQA 3MM5B 4QYRA 1R8PA 3BDPA 4PG6A 4ZPTR 2K06A 4FF2A 5C24B 1OIAA 4OV1A 3OHAA 3NS6A 5KG0A 1Y4ZB 3GIMA 3RYLA 3QO9B 2DXEA 1M0SA 2DNLA 2GJIA 3Q2SC 3H2VE 2E5HA 1Y00A 2WRMA 1NK5A 2KFNA 3IBWA 4KHMA 2HS4A 1QTMA 3PYEA 3AODA 3DMJB 1F0XA 1AB8A 4KQZA 4DSEA 4HACA 1M1GA 3OTCA 5D15A 2YX4A 2FGCA 4RNOA 2AJ0A 2D41A 5G0RB 3VGUA 2IJRA 2R8HA 2J9CA 4WFNQ 2GIFA 1V6HA 2CQDA 1DLOB 3DHXA 1G3OA 2GFFA 4USUA 1LWCB 2NCKL 3T41A 2XMJA 1XK8A 2VJVA 2NZ4A 2Z8QA 4U7CA 1W2BR 4R25A 2GAGC 4B3RF 4FS2A 3RB0A 3P49B 3EMTA 5B0DA 3VQTA 2CZ9A 4I7FB 6FD1A 3H5YA 1NDCA 1LNQA 1KN6A 4RWWA 2UUTA 2R8GA 3MCMA 4OZNA 2B8QA 3AOCA 1PJ7A 1BQXA 1L3KA 4N56A 2H5IB 4DV2J 3SZ2A 3VAGA 2O01C 5FLXY 1VRTA 4CO4A 5HMYA 2Z0GA 2DH8A 3ITHA 1RAIB 1RCOB 4Q45A 3PFEA 2RQKA 1S76D 4BLGA 3KG0A 1V5VA 3HT3A 3GYGA 2AJFE 4HT7A 3QJLA 3HPOA 4U7UK 1B4SA 2X1BA 4L6V3 1MMLA 4R8UB 4K0KJ 2O66A 1JMTA 3AOBA 1K44A 1FRXA 2MKCA 4FBUA 2FHKA 4AXIA 3ZZZA 1T02A 4RW6A 2FJAB 2BXJA 3G8TA 1S9EA 1HBOB 1V9OA 2R7SA 1RJJA 1RQ0A 4NCGB 4QYZK 4QJVA 3HSGA 1UFWA 3PNIA 2MKKA 1Q1KA 2JEIA 3BSAA 4ZN3A 1OSDA 1T9VA 3QGHA 5HL7Q 4IRDA 5DM6Q 2H65B 1T8EA 1N32J 1RT6B 4MAKA 2CWXA 3G71S 3HHEA 5DG9A 3BPDA 3D4JA 3MHYA 1IQTA 4U7UD 1U1MA 5KFBA 1KS2A 1RCXB 3P5TL 2D3ZA 1FFGB 3P6YC 5HQ8A 4KPYA 3QFWA 3I55S 1V3SA 5J2QA 3MMAB 1HNVB 3CCSS 4I69A 2HRUA 2W24A 2UVUA 4IOBA 4O3OA 5F8IA 1SJQA 3N9UC 2CNNB 4FPRA 4TU9A 3PRBA 4M95A 4Y34A 3KWMA 4HVZA 3O2IA 3D6TB 3NLCA 3PACA 3PX0A 3UDLA 1T03A 2DGOA 3W9IA 2XO7A 4L75A 1UCNA 4DV5J 4Q8FA 2Z2MA 3HLUA 3JSMB 4IRCA 4CLUA 1UFLA 5JVGQ 3SQGB 4B3MJ 4FDFA 3KLGA 3MUMP 4L3KA 1NJWA 3DLBA 2I2YA 2XMKA 4K0KF 4CLSA 1X0PA 1FDNA 1YBAA 3UD3P 1TKTB 3IM8A 1QE1B 5B0EA 3DRSB 3ZXWA 2MKIA 1BUXA 3PKYA 3UVJB 5C2GA 1FHTA 5E3AA 4PG7A 3OXFA 1X5TA 4DOZA 2CPFA 4ZVHA 1I51B 4UW2A 2IMWP 3D6FB 3M9OB 3V4IB 5BXIA 1YJVA 4PWDB 1UVLA 3CO0P 3M1VA 2CPZA 3JQJA 1XJWB 3R5GA 2UUBJ 3DFEA 1CS4B 2YWGA 1YTYA 4LF9J 3BDEA 1NDLA 4WJBA 1W2IA 1HNXF 3R6LB 4DR1F 4F67A 3R5BA 1BQMB 1VC0A 1RAHB 5J1PA 3I96A 4DPXA 1HQUB 4CNYA 4BS2A 1X5PA 4IG0A 3NGRA 3M6UA 4OZ2A 3O44A 3CJ8A 4PZVA 2ALZA 5A6PA 4WKYA 5KFFA 3BKTA 4YEAA 2QLFB 1RT3A 3OV7A 3G6ES 3PO5A 1NJIT 2DNHA 1X31C 4DPTA 2HVIA 1WEYA 1ZYQA 5CYMA 3OFHA 2H9ZA 2D9PA 4LVNP 3TZYA 4J91A 2HLUA 3D66A 2E1MC 3LTOA 4I68A 4RLEA 5IQ6A 1VQNS 1IM6A 2C3UA 5L38A 3K5MA 2VA3A 2GMLA 4EGLA 2DNPA 2DRAA 3NGKA 3BREA 3FBEA 3UD5A 2IM1A 4E2FB 3KK1A 3EPIA 1T05B 3R2CJ 4B3SJ 4Y6IA 5H9FK 4F26A 1RI7A 5M2PA 3KJNB 2MQ8A 3DLGB 1U45A 2RT3A 4O4RA 4ZCIA 2ADBA 3G8SA 3V6KA 5ETRA 2UV8A 3RW7A 4FBTA 1RT4A 4JI6J 3G4SS 4LSNA 3UD4P 3R2DJ 4ZP9A 1SKRA 1F9EB 1HHSA 8RUCA 3KK2A 2AEFA 3OHBA 4WU3A 5C42A 2KH9A 2GJFA 2V2KA 1H72C 5D78A 4RUCA 1ZA2B 1DQAA 3K8WA 3V6DA 2W9BB 4B9LA 9RUBA 1F9FA 3U7JA 3UWTA 5HK4A 5IFMA 2MZRA 2HRYA 2E7WA 4LRAA 4TVAB 1R6YA 3C6UA 4IRKA 2ZH1A 3V81B 1FI4A 4XDCA 1T3NA 3P45B 3PXGa 2P6TA 1HNZJ 1U02A 3BF4A 3RRHA 4KV8A 4WPAA 3M8SA 5KT2A 4QPXA 2HAFA 1IBKJ 3OD2A 1HBUA 2ADCA 3I0RB 4DV4J 3C6TA 1HI8A 4FXDA 1Y5LB 3AQOA 1GH8A 1FD8A 1KQKA 2PMZD 4Q0BA 3N79A 3FGVA 7AT1B 3POTA 5GAHI 3SMZA 2QLBB 3SXLA 1WDDA 1R3NA 3PM9A 2UU9F 3FCVA 1OQ3A 5SZTA 5F8JA 4JI6F 1FD2A 5A2QU 2FC9A 3VHQA 4DPWA 2QC3A 3A3PB 1T9YA 2VB6A 2Y9HA 2C2OB 1ZOTA 5JMNA 1N5YB 1TUGB 3GCXP 2B9XA 1D09B 3QGPA 4YHHJ 1EX8A 2MKJA 2OLWA 2E1AA 4B9TA 1LKZA 2L9NA 2V8DA 2VFSA 4YY3F 2A2CA 3HP6A 3HHLD 1EETB 2Y8WA 5DZ7A 3DLLQ 1TAUA 3PG9A 2F5GA 3MR7A 2VG7A 3GV7B 2YKMB 4I1TA 1NHUA 1K9MT 5KT4A 2E5IA 1S0MA 2BW7A 1CJUA 1HNZF 5A76A 4QOTA 1DBDA 2R7UA 3NS5A 2YX1A 4IFYA 1L3SA 2H48B 3OSPA 4F4YA 4W90B 4DV4F 1FNMA 2M9KA 1IWGA 2DVIA 3PY8A 2N4CA 2XCPA 5HROA 4HYKA 5A8WA 2EKYA 3SV3A 1Z2ZA 2ZKTA 3CIMA 1RT7A 2VBYA 3KLHB 2V4JA 2XS5A 2IBKA 3V6JA 5KFVA 1RYRA 2DHAA 3MDFA 2C3PA 2R3VA 2YBVA 3BGUA 2KXNB 2VQFF 3B82A 3EGWB 1VQ9S 3M9NB 1F60B 3GIRA 3HHLA 1KLMA 3QATA 4DG1A 4RBTA 2UXDF 5DQIA 4YHHF 2RUGA 3Q86A 5AE3A 2V2QA 3BZQA 2K7JA 3UDVA 2CQPA 2Y1JA 4YDXA 5GMKa 4C11B 1RLCL 2W01A 4ETXA 4PYDA 3HF5A 2GIQA 3CCQS 2AD9A 1T95A 1R0CB 4OFZA 3TVKA 2E5LF 2G13A 3IS9B 2E5JA 2XQCA 2AX1A 4LF8J 4M5LA 2R7XA 2F1FA 4PUOB 4DBQA 2HQFA 2FJVA 3LP0B 4OYBA 3C14A 1KEKA 1WF0A 2MSSA 6AT1B 4DL6A 4M5NA 2HIQA 4I0WA 4XPCA 5CYMB 4LMZA 2YKNA 1S1XB 1VQ7S 1JJCB 4I4BA 1ZM9A 3H2LA 1S6QB 2CJAA 3CJ5A 3DHWC 2CIMA 3BYPA 4URQU 3VALA 2J6TA 2HW3A 2DIVA 2FYXA 3MEEA 3KHRA 1I1GA 2CPIA 2CVIA 1FK9A 4ECXA 1SQGA 2RSQA 2YVSA 1ZTTA 2KZZA 3DGPA 5GAEU 3SCIE 3MEDA 3KK1B 4I2PB 2V2ZA 2I38A 4JI7F 4IDKB 4NYPA 2W7OA 1RYSA 2N7CA 2I8EA 1VQ4S 5IT4A 4O3RA 4DI6A 1AYEA 2KT2A 3CC7S 2HHQA 4F3MA 3H20A 4NA1A 5H9EJ 1X5SA 4A48A 3DRRA 3CEDA 3FNNA 3FZBA 3DYAA 3O8WA 2IHR1 3OBIA 4ZIWA 2IPOB 3FMBA 1P9QC 5KG2A 4RX6A 5L46A 1XIQA 1R8BA 4AE5A 2FLNA 4ZK7M 1CLFA 5KFDA 5D0EA 2HYIB 2ASLA 2LXUA 2UUCJ 3JAMY 4BDPA 3VR1A 1VQMS 1AFJA 3CJQA 2N82B 3LWLA 5GAGU 2GHPA 1NDPA 3TARA 3NCPA 1TVRB 1LFWA 3OL7A 5E3QA 2VG6A 2KM8B 3IA0A 2ZBIA 1IKYA 2PN6A 2DJWA 5DRKA 4D3GA 2J9EA 4CI0B 4ELUA 4WU2A 3ENVA 3QNWB 3BN4A 2PFDA 3ZZOA 2OPSA 4H54A 4Q0BB 4DXLA 1GEHA 4OHVA 2GMHA 1DTTB 2EXUA 4WK1A 1BY9A 4ECZA 2IRYA 3MM6A 2JFDA 1PCAA 2V68A 3U1MA 3SCJE 2JSXA 4DR5J 4LBHA 1CJKA 2IAJA 2ZH8A 4PWWA 5KG3A 1RTIB 2OPRA 2YNFA 5LMNJ 2R7WA 4MK8A 3ZTPA 4FPIA 2HQDA 2VF3A 3ONQA 4PRFA 1VJQA 2QFIA 2W7AA 2HK3A 3SSSA 2XYPB 1FO1A 5JXSA 3GSIA 5LXRA 1PSDA 1YDLA 3I4HX 5KFRA 2OEJA 3MURP 5LT5A 2QL9B 4H4KA 1XR5A 2UUCF 3G9CA 3PYFA 4L76A 4OYIA 3Q8PB 2HBZB 1R8AA 4ZVEA 4BC7A 4ED6A 4MFBA 3N28A 2J7UA 4C8OA 3OT9A 4OI6A 8AT1B 1T9UA 2BJ8A 2OIHA 3ZO7A 3O1LA 2HGLA 4UOHA 4PXBA 3P4UB 1SH3A 3M30B 5A8RA 1TELA 4OYMA 2KM8C 4USVA 2J0XA 3QLHB 1XR6A 1SL2A 4P7TA 5IM0A 4KT0C 1E6VA 1S79A 3EVOA 3LP1A 4RNNA 3UCGA 2W2QP 2HRTA 1IJEB 2CQ3A 4RWXA 3CF5Q 2CDQA 4DL5A 5C5JA 4HHHA 5HROB 3DLKA 3TAMB 1RWWB 3RZAA 4K2XA 1TK0A 3HSDA 3K58A 1NCLA 4RNMA 2G1HA 3PDNA 3I0SA 3S7RA 2BM0A 5D3GB 2I1RA 2F9JA 5HVGA 3BO3A 2RRBA 2WHOA 3O3LA 3MR5A 3BSCA 1S1UB 3L95X 3ZTOA 1D1UA 5LMNF 2CVEA 3ZZYA 3NCRA 1IKVB 1HBNB 1K0VA 1FKPA 4X4RA 4ZCLA 2XWXA 3CTRA 3M6XA 4ED4A 3N5FA 1NKBA 2MY8A 4A8FA 3PEHA 4LF2A 4OZ1A 4GKJF 1HKAA 3ETOA 4UOFA 1LW2A 5FLXU 4HI2A 2QGFB 4LFAJ 3V2UC 4EO8A 3IRXA 4IH5A 3RR7A 2OKQA 3D6MB 5CQGA 3DOLB 2OTJS 3M2RA 3NMAA 3PW2A 1RK8A 2JWNA 5GMDA 1VLOA 5KT6A 3M32A 2W4DA 2MHEA 2HBRB 1F5CA 3A3OB 2UXBJ 4KGKA 3GFYA 4PQUA 1HARA 1LQ9A 1RKJA 2M0GB 3QBCA 5JUMA 2WSEC 3KOAA 4GC7A 4TLQA 3EPGA 3HD1A 4NLPA 2RMLA 2QMUB 4A8MP 2XNQA 4LBIA 2MZ1A 1NU4A 1S7HA 2YKNB 1LK7A 1P6TA 1HNIA 1JLGB 4X65J 2PI5A 2DHGA 2PFFB 1YJ7A 2UXCJ 1LWEA 4DV3J 4RU2A 2QLWA 1RWOB 3ENAA 2MQMA 4A8OA 4F4KA 2MDAA 3I9ZA 5DQGA 3D1QA 1Q16B 1S12A 3G6YA 1IN0A 1RAJA 3BH6B 1TKXA 3VAHA 4DS4A 2XSJB 2HHPA 4O3NA 4I2QA 4R0JA 4RW8A 2AMCB 2FLPA 4RW7B 2HWIA 4A8YA 4OYPA 2LU1A 1YK9A 4P2FA 3LH2S 5T41A 3PKMA 3DRPB 2PMWA 2MY7A 2L08A 4DR2J 1S77D 2EFVA 5E3RA 2BQUA 1X7VA 3T5HA 2CPYA 1MROB 4ES2A 5LJ5Y 3J7YU 4WP9A 4JV1A 4A8XA 4K59A 2ZHBA 1GXTA 3KMSA 1B0PA 4L72B 1N0UA 5KT7A 1SVDA 1BWEA 1NKEA 4ZHRB 1ULRA 1S1WA 3QAEA 3IP0A 4GVBA 2JL9A 5K8NA 4X65F 3DOMA 1LWFB
chains in the Genus database with same CATH topology
3Q83A 3JS9A 4F36A 4W98A 1W7WA 3MPDA 3BH6B 3EJMA 1BHNA 3Q8YA 4UOGA 1NPKA 3DKDA 3VVUA 2AZ3A 3EVOA 1F3FA 4CP5A 5BXIA 3ETMA 4ENOA 2VU5A 1LEOA 4DUTA 1NSQA 5CAAA 3EM1A 2DY9A 3Q89A 1WKLA 3FBEA 4HR2A 1XIQA 4FKYA 3NGTA 3Q8UA 2ZUAA 3VGTA 1LWXA 3DDIA 3GPAA 1NSPA 1EHWA 1F6TA 3PRVA 3ZTRA 1HLWA 3NGUA 3ZTPA 4ANEA 5C7PA 4FKXA 3VGUA 1NDLA 1NCLA 1S5ZA 3BBCA 1NDKA 1WKKA 1PKUA 1WKJA 1S57A 3WX8A 1HHQA 1B4SA 1MN7A 3FBBA 1NSKL 1ZS6A 1MN9A 1UCNA 2BX6A 1PAEX 3Q86A 1K44A 4DZ6A 4S0MA 4ANDA 2HURA 1JXVA 3PJ9A 3EVMA 1NDPA 3FBFA 3ELHA 3FCWA 3ZTOA 2HVEA 4C6AA 1XQIA 3EICA 3FKBA 3ZTQA 3EE3A 1KDNA 1NHKL 3NGRA 2NCKL 4O0NA 5CABA 2CWKA 3VVTA 3FC9A 4WBFA 3VGVA 1NUEA 3G2XA 3NGSA 3BBFA 2B8PA 2BEFA 1U8WA 1B99A 4F4AA 4EK2A 3ZTSA 3BBBA 1BE4A 1VYAA 3EVWA 1S59A 1HIYA 3EMTA 3L7UA 2AZ1A 4DI6A 2HVDA 3R9LA 3B54A 3FBCA 5IOLA 4UOHA 3FCVA 3ENAA 1NDCA 3B6BA 1NLKL 2DXFA 4UOFA 2DXEA 2DXDA 2B8QA 4ANCA 1BUXA 1NB2A 4KPCA 3Q8VA 3GP9A 3BH7B 3VGSA 2DYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q83 A;  3JS9 A;  4F36 A;  4W98 A;  1W7W A;  3MPD A;  3BH6 B;  3EJM A;  1BHN A;  3Q8Y A;  4UOG A;  1NPK A;  3DKD A;  3VVU A;  2AZ3 A;  3EVO A;  1F3F A;  4CP5 A;  5BXI A;  3ETM A;  4ENO A;  2VU5 A;  1LEO A;  4DUT A;  1NSQ A;  5CAA A;  3EM1 A;  2DY9 A;  3Q89 A;  1WKL A;  3FBE A;  4HR2 A;  1XIQ A;  4FKY A;  3NGT A;  3Q8U A;  2ZUA A;  3VGT A;  1LWX A;  3DDI A;  3GPA A;  1NSP A;  1EHW A;  1F6T A;  3PRV A;  3ZTR A;  1HLW A;  3NGU A;  3ZTP A;  4ANE A;  5C7P A;  4FKX A;  3VGU A;  1NDL A;  1NCL A;  1S5Z A;  3BBC A;  1NDK A;  1WKK A;  1PKU A;  1WKJ A;  1S57 A;  3WX8 A;  1HHQ A;  1B4S A;  1MN7 A;  3FBB A;  1NSK L;  1ZS6 A;  1MN9 A;  1UCN A;  2BX6 A;  1PAE X;  3Q86 A;  1K44 A;  4DZ6 A;  4S0M A;  4AND A;  2HUR A;  1JXV A;  3PJ9 A;  3EVM A;  1NDP A;  3FBF A;  3ELH A;  3FCW A;  3ZTO A;  2HVE A;  4C6A A;  1XQI A;  3EIC A;  3FKB A;  3ZTQ A;  3EE3 A;  1KDN A;  1NHK L;  3NGR A;  2NCK L;  4O0N A;  5CAB A;  2CWK A;  3VVT A;  3FC9 A;  4WBF A;  3VGV A;  1NUE A;  3G2X A;  3NGS A;  3BBF A;  2B8P A;  2BEF A;  1U8W A;  1B99 A;  4F4A A;  4EK2 A;  3ZTS A;  3BBB A;  1BE4 A;  1VYA A;  3EVW A;  1S59 A;  1HIY A;  3EMT A;  3L7U A;  2AZ1 A;  4DI6 A;  2HVD A;  3R9L A;  3B54 A;  3FBC A;  5IOL A;  4UOH A;  3FCV A;  3ENA A;  1NDC A;  3B6B A;  1NLK L;  2DXF A;  4UOF A;  2DXE A;  2DXD A;  2B8Q A;  4ANC A;  1BUX A;  1NB2 A;  4KPC A;  3Q8V A;  3GP9 A;  3BH7 B;  3VGS A;  2DYA A; 
#chains in the Genus database with same CATH topology
 2IMO A;  3CE8 A;  5K8P A;  1BHN A;  1MLA A;  4OX9 J;  1RXO B;  5ETM A;  3CME S;  5J2P A;  3MEC A;  1U6Z A;  4Q43 A;  3PIO Q;  4DV7 J;  2GVZ B;  1WTF A;  3RG6 A;  2OPS B;  3P8B B;  4AQY J;  4CLY A;  2R2S A;  3D28 A;  3MM6 B;  3B4D A;  4B9V A;  4DQP A;  3AXK A;  1U48 A;  4USK A;  2KU7 A;  4F4W A;  1FRK A;  2DIS A;  2RDJ A;  2ZM6 J;  2G4B A;  1VBK A;  1JLQ A;  3J7Z T;  3SSR A;  2RKI A;  1IUJ A;  2PT0 A;  5J2N B;  2OPR B;  2YNF B;  1F5B A;  3CCL S;  3QSY B;  2HS0 A;  3KYL A;  1PJ6 A;  5LMU J;  3KDN A;  1JLF B;  4HDH A;  4ZLJ A;  2V9W A;  3FRZ A;  1BWV A;  3MD3 A;  2ZH6 A;  3HHD A;  3HI9 A;  4YUD A;  2MLX A;  4DR4 J;  1RAD B;  4X62 J;  3HKZ D;  2EG2 A;  2KJW A;  1UJ6 A;  2VBX A;  3KDO A;  1NPK A;  5D4P A;  5IT9 U;  2KFY A;  4MFB B;  1JKH A;  1T3O A;  1O6X A;  4FNH A;  1C0U B;  4UST A;  5DDQ C;  1G6B A;  2LA6 A;  2CQG A;  5A8R B;  2XMV A;  1VHF A;  2DHX A;  2MJN A;  1C4C A;  5KFQ A;  2ZDP A;  4OX9 F;  5F8N A;  3AFG A;  2XYH B;  3A3N B;  4WTO B;  1DRZ A;  3PJ9 A;  1PBA A;  5K20 B;  4DWI A;  1KQF B;  4F2R A;  1VJW A;  4CT8 A;  4AQY F;  1SH0 A;  3TEG A;  5F3T A;  3AJ2 A;  4BWJ A;  2A6O A;  2V2V A;  2BJ1 A;  1QSS A;  5B0C A;  2N3L A;  4C48 A;  1UVM A;  3B8H A;  4OHX A;  3KG1 A;  5K8O A;  4TNO A;  4CH0 S;  1GFW B;  2OSR A;  3KUE A;  4WTY A;  2QN6 B;  3B78 A;  4YME A;  4K5R A;  3CC2 S;  3M8Q B;  1TK8 A;  2NPI A;  1HQ2 A;  1REV A;  1N8R T;  2EI5 A;  2DNR A;  4FYV B;  1S9G B;  2YKA A;  1LEO A;  4O3P A;  4TQR A;  3T5J A;  1HWI A;  2CQI A;  2K1R A;  4FKY A;  1IKW A;  2VIH A;  2WK4 A;  2JFK A;  4XDD A;  3KHG A;  2XUL A;  4FS1 A;  2HNY A;  5MLC V;  1T94 A;  1S5Z A;  4BC9 A;  3BJY A;  4RU9 A;  2A10 A;  1UZD A;  4WKR A;  3MPW A;  3C8Y A;  1MN7 A;  1FRL A;  3ET6 A;  2B7C B;  4EYH B;  4EYI B;  4IOC Q;  4KHP F;  5U47 A;  1PAE X;  4FN5 A;  4ZP7 A;  2ZH7 A;  5H9E K;  1J2V A;  1MWZ A;  4G1P A;  2HG4 A;  5F8L A;  1IVZ A;  3RJM B;  4M94 A;  3ZZR A;  1NME B;  1PBU A;  3QWP A;  4NLY A;  1HI0 P;  1N6Q A;  1H73 A;  3OR1 A;  3D3C J;  4WZQ A;  5E7O B;  2ZH2 A;  2ZC4 A;  2F8E X;  3AD7 C;  4DL7 A;  4LR9 A;  1A7G E;  1RT2 B;  1TAQ A;  2MXY A;  2Z57 B;  4RW4 B;  2CKW A;  1J5O B;  4KGM A;  4DX5 A;  1YIJ S;  2ZDO A;  3RU0 A;  4UY8 T;  3OSN A;  4LFC F;  3DCA A;  1HNI B;  4JYA J;  2D3U A;  4MTP A;  3AY0 A;  5E5N A;  2R2U A;  3E01 B;  4V19 J;  1U2R A;  4LF6 F;  1X4F A;  2ZUA A;  4FF4 A;  3OL8 A;  1EIY B;  2XMT A;  3JYT A;  1AUS L;  2DRB A;  4K4T A;  4U95 A;  4EUV A;  2XMU A;  1N5T A;  4Y2M A;  4ZN1 A;  1TKX B;  3G82 A;  3WX8 A;  2P9G A;  1NK9 A;  5DDO C;  1JLA A;  3HVR A;  4CTA A;  3M2U A;  2P6S A;  2CPD A;  2VJU A;  2YQ3 A;  2RF2 B;  3EIC A;  2QJ3 A;  2HSE B;  1AA1 B;  3PCO B;  1CUL A;  3NOC A;  3UQS A;  3ZZT A;  2Z2L A;  1RWU A;  3SFU A;  3GIJ A;  3LWM A;  3JSB A;  4JI1 J;  1VRU A;  1VBZ A;  4KH1 B;  3FRY A;  4DU8 A;  3QT7 A;  4PYA A;  4Y28 C;  2J0W A;  4J9Q A;  2NUU G;  2VA2 A;  3SIP B;  2QL5 B;  4CO0 A;  4N5S A;  1SXL A;  2NXJ A;  2DR9 A;  2HVH A;  2DGV A;  2KFZ A;  2LQ5 A;  3MCO A;  4ZMM A;  3SV4 A;  3RBX A;  1RAF B;  1UJ5 A;  1HI1 A;  4DFP A;  2QA2 A;  5T7L B;  4ECR A;  3OXG A;  2DT9 A;  4J9L A;  2XY7 A;  3R5C A;  4X2B A;  3MTJ A;  4LJM A;  4QR0 A;  3CW2 C;  1VFJ A;  3KJV B;  4U8Y A;  1VQ8 S;  2M8D B;  3BR8 A;  3DOM B;  1OJ4 A;  4Y2K A;  1JLE B;  1YJT A;  3W2V A;  1NKC A;  1Z2L A;  3THV A;  5BR8 J;  2J9D E;  4DL2 A;  1U1K A;  3OL9 A;  1WC6 A;  5HQL A;  1OWX A;  3EWG A;  1IBC B;  2MHN A;  1FX4 A;  3GSD A;  1YRU A;  4C8Z A;  2W2O P;  4PWU A;  3L4B C;  2EBG A;  1U8W A;  1RWK B;  3IG1 B;  2G0C A;  3OQ2 A;  5IT0 A;  4FZV A;  2BE7 D;  4NLD A;  3QRR A;  1BE4 A;  4A46 A;  2GHW A;  4NPO A;  4OL8 A;  2NQP A;  5ETL A;  1JLQ B;  4M5M A;  2F7V A;  1Q78 A;  3H25 A;  1KVK A;  2YXL A;  2GIR A;  1HWK A;  2H51 B;  1VK3 A;  2WOM B;  3BYR A;  4CYU B;  3SQO P;  2KXH A;  4JI1 F;  1BQN A;  2C1E B;  2A0F B;  3HDS A;  2DEI A;  3PTW A;  2O3D A;  3ISN D;  2WON B;  3TJA A;  2VPW B;  3BGR B;  1C1C B;  1M5P C;  3FUY A;  5KOW A;  1YIT S;  4W4M A;  3OPK A;  1QTN B;  1FDA A;  3MMC B;  2BX6 A;  4O3Q A;  1JKH B;  3FFI A;  1F2G A;  1N34 J;  4F3Q A;  1JNZ B;  4YP3 A;  2MZJ A;  2HZC A;  3OVB A;  4ZVT B;  2XS2 A;  4Y0F A;  4IOA Q;  3UO0 A;  4ZPD A;  2BAC A;  4I6Y A;  1YWX A;  4JI0 F;  4DV6 J;  1KP6 A;  5BR8 F;  3ENW A;  2OJ3 A;  2C2R A;  4ZIT A;  2YNH B;  2JH3 A;  3KUH A;  3GII A;  2W8K A;  1FRI A;  4MK9 A;  3QWU A;  2F8H A;  2PA3 A;  3Q2T C;  4KTQ A;  1RTD A;  3CCW A;  4F36 A;  4B02 A;  1VIS A;  4TYA A;  4TYB A;  3W2W B;  4CH1 A;  2VQE J;  1J5E J;  1Q7L B;  3JAM U;  2EPI A;  3KLE A;  3I5A A;  4ZVR B;  4X66 J;  5C7P A;  3UE2 A;  1HW8 A;  1CJT B;  4F02 A;  5HI7 A;  3TP2 A;  1HBM A;  5DDR C;  1U4B A;  4L73 A;  1W25 A;  1QUP A;  2XI2 A;  2XTJ P;  2JLG A;  1N4L A;  3O6Q A;  3M8P A;  4LSZ B;  4CZC A;  2HNY B;  3QMQ A;  4M1K A;  1U26 A;  2XZT B;  2F40 A;  1VYA A;  2J8S A;  3FQK A;  4OZJ A;  4WFY A;  1NJZ A;  2IM2 A;  4N8N A;  3THP A;  5D77 A;  2JLE A;  2JLF A;  2DXD A;  4K2J A;  2ATC B;  3IAM 9;  1HHT P;  2J7W A;  3N01 A;  3MTK A;  4B3T J;  4DV6 F;  2QEX S;  2DR7 A;  1SUQ A;  4PG8 A;  2LEA A;  3M2V A;  3VZH A;  2AP6 A;  1DZ5 A;  2BOP A;  3DU5 A;  2CAD A;  3KK3 A;  2XZW A;  1CC7 A;  1G2E A;  4WP3 A;  4KSE B;  2BAN B;  3OUY B;  2LU2 A;  2HHU A;  3OTD A;  4B9U A;  4QU6 A;  1J5E F;  4USJ C;  1N88 A;  1U1R A;  1GT8 A;  4NLQ A;  5SUH A;  5A0Y A;  4WP8 A;  2DR6 A;  5LJ3 Y;  4M8L A;  5AJ3 J;  2MGZ A;  2VD3 A;  2B9Y A;  4P2X A;  3CPW R;  3EVW A;  3CCU S;  1JLA B;  1RAE B;  4H4O B;  5CYQ A;  2IA6 A;  4OHW A;  2B4O A;  1FNX H;  4CTA B;  2ZFH A;  1FKO B;  1RWX B;  3FK4 A;  2KHD A;  3T1Y J;  5HN0 A;  3W3S A;  3NP5 A;  3TAN A;  3CCZ A;  2BR0 A;  1OY8 A;  1IBL J;  2VOO A;  1PYO B;  4RO0 A;  1VC5 A;  1WC0 A;  2E29 A;  1CSJ A;  2JHE A;  4Q7A A;  1FTC A;  1VQO S;  1F9H A;  4AFF A;  1AW0 A;  1KVJ A;  2BJD A;  2YY3 A;  5CCM A;  3NL0 A;  2ZE2 B;  3NGU A;  2QT7 A;  4B3T F;  5KFT A;  2X1G A;  2ZIT A;  2FTR A;  4OX8 A;  3KUG A;  2YNI B;  4CO2 A;  2HWH A;  2HBQ B;  2H4Y B;  4IR9 A;  2QRR A;  4IO9 Q;  2YWW A;  2GO8 A;  3KTQ A;  2OPP A;  2ZEJ A;  1FJG F;  3FEY B;  2R7O A;  5B09 A;  4C98 A;  4QBU A;  2KL8 A;  3NOG A;  4KFB A;  4NI2 B;  1SCJ B;  5FDL B;  2IRX A;  3JTP A;  4K4S A;  2ACM A;  5K5M A;  2K2P A;  3W2V B;  1OO0 B;  4DV0 F;  3EXY A;  1QAX A;  9ATC B;  1WG5 A;  2NYI A;  2UUA J;  2D9O A;  2FJD B;  1Y3K A;  1EKS A;  4QWA A;  1MU2 A;  3H5S A;  3WIV A;  5AJ3 F;  1VRQ C;  2BOA A;  4B3O B;  4YR3 A;  3SDE A;  1FE0 A;  4MT1 A;  5CH7 B;  4J9S A;  3A13 A;  2VFR A;  5FJ4 A;  1WKL A;  4O44 A;  2ASD A;  3W66 A;  2VPX B;  1Q53 A;  4FXV A;  2Z56 B;  1ZET A;  3H7H B;  1GTH A;  2KKH A;  1V3R A;  4C0H A;  1JXE A;  4B17 A;  3TA2 A;  1WOO A;  4YN3 B;  1RKI A;  2PO4 A;  3BV8 A;  1E6Y B;  3AD9 C;  4OHZ A;  1JLB A;  4DFK A;  5F41 A;  4OJ1 A;  2CQH A;  3KFW X;  1IXK A;  5HJX A;  1XNQ J;  4ETZ A;  2F65 A;  2EW9 A;  3KHL A;  4ATN A;  1AT1 B;  2C42 A;  1SV5 A;  3ILJ A;  4JI4 J;  2G0I A;  3B6B A;  4USM A;  1NLK L;  2WCX A;  1F3V A;  4C8Y A;  5F8G A;  4F25 A;  1DAR A;  2KI2 A;  2R7T A;  4WXO A;  1Q95 G;  4DV1 J;  1SJ3 P;  1NK7 A;  2ZBP A;  1UET A;  1X9M A;  5H1S V;  3RBE A;  1MW7 A;  1APS A;  4QIE A;  2FIU A;  3S8S A;  4KO0 B;  3A8J A;  4DQI A;  1CJV B;  4YB7 A;  3ZZ0 A;  3TO8 A;  4LRE A;  4ID5 B;  2WSF C;  4QZV B;  3H4D A;  3T19 A;  1R0A B;  2J6S A;  3QJP A;  3OTE A;  2XCA A;  4OQJ A;  2CDR B;  2M7S A;  4C2M A;  4LQ3 A;  4AXJ A;  3CDW A;  4WE1 A;  3RAQ A;  1U6B A;  1YX2 A;  2RE1 A;  1DTQ B;  1NH7 A;  4O0N A;  4C8L A;  1FJE B;  2V63 A;  4NMX A;  5KFE A;  4K4U A;  5J2M A;  3KJQ B;  5EWF A;  2W4P A;  3NGD A;  4QR2 A;  4ELV A;  1RTJ A;  1N52 B;  1TL3 B;  1JLC B;  4PPZ A;  1M5K C;  5BYQ A;  4ES1 A;  1YZ6 A;  1G1X A;  1CQM A;  2ROE A;  3GG0 A;  2CPX A;  5KFJ A;  1T9T A;  1C0T B;  2B4V A;  4ANC A;  4D3H A;  2JNJ A;  1XNQ F;  2DRD A;  1X9W A;  5HP1 B;  3NY0 A;  3V6H A;  1U0H B;  1OS5 A;  4NZ7 A;  2W25 A;  2XS7 A;  2H4W B;  3VVU A;  4OYA A;  4JI4 F;  2ZVS A;  1RTH A;  5KG4 A;  4CLK A;  1HNW J;  4J9M A;  4RL1 A;  3FEX B;  2AV5 A;  4OI2 A;  3R6G B;  2EVZ A;  4ZVG A;  4DL0 C;  2CQ0 A;  4DLE A;  1ZTW A;  4PQA A;  3H42 A;  5GAH U;  3IN5 A;  4DV1 F;  1WKJ A;  3I31 A;  5BJR A;  4ER8 A;  3M2V B;  3T1H F;  3GJT B;  3QRQ A;  1BMQ B;  2AGO A;  2LCW A;  1KTQ A;  4C6A A;  3KK3 B;  1Y5I B;  4KGX B;  4UQG A;  4RNF A;  2VG5 A;  1PC4 A;  4TY8 B;  4KRW A;  4TXS A;  4ICL A;  4MIW A;  1C4A A;  4WYL A;  2AW0 A;  2QYC A;  4IH6 A;  3U1N A;  4KHR A;  3PW4 A;  3CJK B;  4M5J A;  3MR6 A;  5CYJ A;  2NR0 A;  2EKN A;  1SIW B;  3MEG A;  2FHO B;  1LW0 B;  4UY8 5;  2PGC A;  2MKH A;  4ZJO A;  1U47 A;  2E7X A;  5I3U A;  2VZ9 A;  5KFK A;  1SJ4 P;  4I6A A;  1VIO A;  2DYA A;  4W98 A;  1UVJ A;  2ZH4 A;  4X4V A;  3DLE B;  4IYQ A;  4C7Q A;  1NSQ A;  3WZ0 A;  2V8V A;  3PRD A;  4A8W A;  1X4E A;  3H5U A;  2X1A A;  3D0I E;  3NBP A;  4JI3 F;  3LAM A;  3W9H A;  3IRW P;  4ILR A;  2HNZ B;  3C16 A;  3OL6 A;  3AAW B;  4F4Z A;  1HNW F;  5RUB A;  1P27 B;  2QFJ A;  2C3O A;  1FJC A;  3RBD A;  3NWG A;  1DQ9 A;  2AYM A;  1Z4U A;  3C15 B;  3L7P A;  1GX6 A;  2Q79 A;  2LA4 A;  4X4Q A;  1RLD A;  1KHV A;  2QLJ B;  3MFI A;  4EBC A;  1K1Q A;  4DCP B;  4O4G B;  2BV3 A;  2AYE A;  1KWM A;  2XNR A;  1U6F A;  5LL6 d;  4RW9 A;  2GW8 A;  1JB0 C;  2GVD A;  3M6V A;  5IOL A;  4CO1 A;  3W5Y A;  3CWJ A;  3CCE S;  1Y9O A;  2LP4 A;  2D1C A;  3QIP A;  2HND A;  2QSF A;  2BUN A;  4P9S A;  3OJU A;  2K3I A;  1Y10 A;  3HD2 A;  1L3V A;  4AUK A;  3HUL A;  3LA0 A;  4ZKA A;  4NML A;  2VPY B;  1OQ6 A;  1HMV A;  1TKZ A;  1K73 T;  1EP4 A;  3UI3 A;  1Q0N A;  2D3O 1;  3CXC R;  2UUW A;  4QWB A;  2MMY A;  5CXT A;  2H3E B;  3GIK A;  3TZX A;  4UTG A;  2XB2 D;  3CGI A;  3MZI A;  4RUB A;  1PKU A;  1OMS A;  4X4P A;  3SDE B;  4X4T A;  2VL1 A;  4UUW A;  4RBU A;  3KKF A;  2ROG A;  2HUR A;  1QUV A;  4E0D A;  5HLF A;  2JEJ A;  3ICL A;  1NJX A;  4OHY A;  2AJ4 A;  2YTC A;  1RHQ B;  3W63 A;  2AGP A;  3G86 A;  3A8I A;  2GZO A;  4NLX A;  4IFV A;  4CQ1 A;  4LSL B;  3KLI A;  3KLF B;  2E1C A;  4QWE A;  1QJH A;  1ZBT A;  2A6M A;  1SQE A;  4AT1 B;  2DH7 A;  1KON A;  2GC8 A;  1CBK A;  2QE5 A;  2F4V F;  4ERD A;  1HQE B;  3QAU A;  4PKD B;  2OFH X;  3DOK A;  3SSQ A;  4J7C A;  4QR1 A;  1JK9 B;  4IG3 B;  3P96 A;  4F0K A;  2HQC A;  1RT5 B;  2AEM A;  3G6X A;  1RDR A;  4PXE A;  1SV5 B;  3HX9 A;  4LR7 A;  1RHM B;  2XMA A;  2RQ4 A;  2QSW A;  2BE2 B;  2X3D A;  1WEX A;  3HSZ A;  1BD6 A;  4FVC A;  4KKO A;  3TNV A;  3DXS X;  4U67 Q;  3NNH A;  2R7Q A;  1OYE A;  4UT4 A;  2DNY A;  3MAQ A;  2J7K A;  1KOO A;  5D6G A;  2WBR A;  3PFO A;  1S1T B;  2L9D A;  2W9C B;  4PAA A;  1VQY A;  3CMA S;  4IQM A;  1GK8 A;  1PC5 A;  1JIH A;  2OPQ B;  2E9R X;  4XIU A;  3MMB A;  4ZP6 A;  1URN A;  2QLX A;  2RRN A;  1N5S A;  4EI2 A;  1VS3 A;  4ECQ A;  1O51 A;  2BMB A;  4DL3 A;  4MMO A;  4ED3 A;  1HNX J;  3VF0 B;  2LKZ A;  1X5O A;  4DR1 J;  5AXM A;  1GAO A;  1QD1 A;  2Y0S D;  2LQB A;  2F8M A;  1YRX A;  4P75 A;  1H98 A;  5IS2 A;  3PX6 A;  4CO5 A;  2BAB A;  1KQS R;  1TL1 B;  1Y0H A;  4YOE A;  3CVK A;  2B0G A;  3TUI C;  4O3S A;  2FVQ A;  4CLW A;  3OFF A;  4OYO A;  2ZJR Q;  4ECS A;  4TKT A;  4FVM A;  4DLG A;  4C97 A;  1YGY A;  2HPU A;  1HPZ A;  5KFG A;  5KFM A;  2PEB A;  2YWF A;  4WK3 A;  4DQR A;  4DJB A;  1ZA1 B;  1W26 A;  2YNG A;  2OGU A;  1RTH B;  1MWQ A;  3GG1 A;  4HDG A;  2AYB A;  2MST A;  5C25 B;  3DXB A;  1PIE A;  2D7S A;  3I82 A;  1KLN A;  4F2S A;  1RAC B;  1ROF A;  2Y1R I;  4C8M A;  3TJ8 A;  2ZHO A;  5HBM A;  1XTZ A;  4Y65 A;  3MM9 B;  1YRT A;  1HIY A;  5IQQ A;  4L74 A;  3MOZ A;  5L1L A;  1FWL A;  2KZM A;  4DX6 A;  2L9W A;  2A1B A;  5A8K A;  2A2D A;  3T9Z A;  4DR3 J;  1WHY A;  1N36 F;  2PDA A;  4LRF A;  3D0G E;  1XMO F;  2ZUG A;  2EG1 A;  1VDH A;  4Y2A A;  4LF7 J;  4JI2 J;  4CLL A;  2ZZT A;  4TU8 A;  1UKU A;  1S1V B;  2ZH5 A;  4U9R A;  3SFG A;  3KG4 A;  2ZH3 A;  3F41 A;  5J1E B;  4MKA A;  1KHW A;  1TQL A;  1S4F A;  3CT9 A;  2HHH F;  2LXF A;  2C22 A;  3LOU A;  1HR0 F;  2M52 A;  2P2C B;  5DQH A;  4LIW A;  2YQ1 A;  2OD4 A;  1RHJ B;  1JWW A;  2OEM A;  1NZA A;  1Q7Y T;  2CWK A;  1TU0 B;  4WFZ A;  4MIA A;  2B6A B;  2LFV A;  2MQN A;  1ZM2 A;  1S59 A;  4LVO P;  3UNG C;  2HMI A;  1NXI A;  4DR7 J;  2E9Z A;  1S6U A;  1YJW S;  2E9T A;  2GGP A;  4ILM A;  2JRS A;  1CEZ A;  1R7I A;  2AJQ A;  4JV5 J;  1PYS B;  4F3O A;  4P74 A;  5IT9 Y;  1T0T V;  2FDN A;  3PIP Q;  4KBI A;  2ZNY A;  5AE2 A;  2AZ3 A;  1EQM A;  2FJE B;  4AL7 A;  5CAA A;  4DR3 F;  2M8H A;  3Q8U A;  1WOP A;  3VCD A;  4HAC B;  3VAJ A;  2XI3 A;  2JX2 A;  1JXL A;  2UU9 J;  3D0H E;  2R8I A;  4M5D A;  4G1I A;  4QWC A;  3A8K A;  1PO6 A;  4LF7 F;  2XLI A;  4JI2 F;  2XHW A;  1FDB A;  3IGV A;  3OFE A;  4QYZ J;  3MM7 A;  3M05 A;  3TOQ A;  4DUY F;  2OI2 A;  1B70 B;  1P9Y A;  3OJS A;  1RT1 A;  3AXM A;  1TKZ B;  3OLA A;  4CT9 A;  1AZS A;  5D0H A;  4ZVS B;  1UW9 A;  4P7V A;  1Q79 A;  3R1H A;  4R5P A;  1NUE A;  3NGS A;  3CCM S;  2BEF A;  4YY3 J;  1FJ7 A;  3TX0 A;  2LDY A;  3CUN A;  2DNQ A;  5F0W A;  3RGI A;  3CCV S;  4ZPC A;  3B54 A;  2KRR A;  2GV1 A;  3SCL E;  3DLJ A;  3E3X A;  5GME A;  5ADZ A;  4F8R A;  3Q8V A;  2RB7 A;  3ZZP A;  1NB7 A;  1IR2 A;  3KLI B;  2V94 A;  3QID A;  4DR7 F;  4DN0 A;  4DR6 F;  3O5T B;  2QA1 A;  3IGN A;  2R42 A;  4O0I A;  1VRT B;  3NGT A;  1LFP A;  3N0V A;  3PZP A;  4JV5 F;  1NSP A;  1OSC A;  2J0Q D;  1F6T A;  4OZ3 A;  3ITH B;  2PD1 A;  3IR7 B;  3D67 A;  1IKX A;  1I94 J;  2E1P A;  4LFB F;  4F4X A;  4QIF A;  4NX9 A;  3GU0 A;  7FDR A;  1IR0 A;  3T1A A;  1VQ5 S;  3UN3 A;  2Y0B B;  2Q43 A;  2VDI A;  3Q8R B;  4X4S A;  3EE3 A;  3MUT P;  1FTR A;  2OEK A;  2F63 A;  1F1B B;  3W7B A;  4RW6 B;  2DHS A;  3HHK A;  2HWT A;  5EHH A;  4KKO B;  1S9E B;  2VQF J;  1N48 A;  5F0U A;  2ABY A;  4HL9 A;  3R5A A;  4ZDN A;  1FVS A;  3ZNU A;  1X0F A;  3M6W A;  3QO9 A;  3Q0A A;  4AYB D;  2UXD J;  3N6M A;  2MQO A;  2LEB A;  1H6K X;  2DXF A;  3GWC A;  3DMJ A;  3VAF A;  5DO2 A;  4CM0 A;  1WHV A;  3IM9 A;  2DNM A;  3Q22 A;  3Q8Y A;  2ATL A;  2COL A;  3GLJ A;  5KG6 A;  3GV8 B;  4DUT A;  4ECT A;  5J2Q B;  3X3U A;  2WVB A;  5KT3 A;  3EM1 A;  3NNA A;  4EFA C;  3A8E A;  2E5L J;  3SBM A;  5G0R A;  2L48 A;  3ADA C;  2VBW A;  1XBW A;  2LVW A;  2CPE A;  2I0X A;  3GFH A;  1DLO A;  2GJ2 A;  3PJW A;  2CG8 A;  3OFG A;  4IUF A;  3WDO A;  2WVF A;  1T03 B;  3HM9 A;  1LWC A;  2Z30 B;  1Q82 T;  2ASJ A;  2CPH A;  1F5A A;  1H2U X;  5B08 A;  2IIH A;  1I94 F;  2NXU A;  3BQ0 A;  1NK0 A;  3KLG B;  2B43 A;  3CB4 A;  4F4A A;  5HVF A;  1CC8 A;  4I7F A;  3R7S B;  2E7V A;  4EK2 A;  1RWN B;  1ZAV A;  2MQP A;  4P10 A;  1VC6 A;  1U09 A;  3J81 Y;  4NRU A;  3ILO A;  2AU0 A;  2BW2 A;  3DKD A;  3IC1 A;  3TAQ A;  2ZD1 A;  1U24 A;  2HQI A;  4ZJQ A;  4JI7 J;  1SJF A;  1TR0 A;  1SKS A;  3F0N A;  1LWX A;  2OD6 A;  1YBU A;  5D0G A;  2OFG X;  3M1V B;  5KFN A;  4JI5 F;  1K1S A;  4FKX A;  4R8U A;  2JVR A;  4LF5 F;  1WG4 A;  4URS A;  5I4M A;  5E0O A;  4GMK A;  1X60 A;  1TZ0 A;  3L09 A;  5ETO A;  3J7A 1;  4F04 B;  3D54 A;  2BZ2 A;  4OLP A;  3BEG B;  1HBO A;  4NCG A;  2WVE A;  1XER A;  3FCH A;  3BBF A;  4IG0 B;  3A4T A;  4OX7 A;  1D8Z A;  2VUG A;  3W65 A;  2NXE A;  2IM0 A;  1RT6 A;  4X64 J;  2HHS A;  5AT1 B;  2VKR A;  2ZKU A;  4RJV A;  2GQQ A;  1RA6 A;  3W5X A;  1GMW D;  3AJD A;  1RT3 B;  2R9L A;  5E2Q A;  2HGN A;  3SYZ A;  1GMU A;  2ZWP A;  2OH2 A;  4MKB A;  3MMA A;  3TAP A;  1SC1 B;  4KPC A;  1HNV A;  4LF4 F;  3UR0 A;  2CAJ A;  3QPI A;  3VGS A;  5F9N A;  4OYZ A;  3PW7 A;  1GXU A;  4LUB A;  2OP5 A;  2PA8 D;  2FVS A;  2VON A;  2IY5 B;  1ZM3 A;  3IAS 9;  1OY6 A;  4HR2 A;  4HI1 A;  4E8U A;  3GJQ B;  2DH9 A;  3K17 A;  2ERR A;  5DET A;  1JNR B;  4NLW A;  3OR2 A;  3CC4 S;  3D7S B;  4ZS6 A;  2WTF A;  3I5C A;  4R0E A;  2V67 A;  3JSM A;  2F9D A;  2CNK B;  3SQG A;  1R43 A;  4B9M A;  6FDR A;  2EFN A;  1H38 A;  3OVA A;  3MR3 A;  4DSJ A;  2FPH X;  3ISZ A;  1PJ5 A;  2YPZ A;  1HWU A;  1TKT A;  1WC4 A;  1QE1 A;  1RT4 B;  4LSN B;  1S6P A;  4MYT A;  3DRS A;  3H8Y A;  2OHD A;  3TUP A;  3UVJ A;  4A8Q A;  1FF2 A;  3KK2 B;  2KN4 A;  4PCQ A;  5C42 B;  3MPU B;  4KC5 A;  1IBM F;  3V4I A;  1RHR B;  4PWD A;  4ECU A;  4QU7 A;  4X64 F;  8ATC B;  1UWB A;  3V6D B;  2O67 A;  3THT A;  3QQC D;  2G1D A;  3BSN A;  2IJF A;  3BO2 A;  4RZR A;  4F0H A;  3C6U B;  3VQS A;  3GJS B;  3ZFV A;  4ZLL A;  1BQM A;  3TZW A;  2RS2 A;  1S57 A;  1HQU A;  4KV8 B;  4QCL A;  1J27 A;  5HSP A;  3GFX A;  4RPF A;  4GO7 X;  1HBU B;  4K7Q A;  3C6T B;  3WBZ A;  2JEF A;  3UW1 A;  2ZVI A;  2MZS A;  2B8P A;  2NPF A;  3CCR S;  2DHH A;  3POT B;  2KVI A;  2DB1 A;  4EMD A;  2Y8Y A;  2UZA A;  1XNR J;  2XC9 A;  2FVP A;  2HS3 A;  2RS8 A;  1FKA F;  4OJH A;  1B3T A;  1R31 A;  2AT1 B;  1XN9 A;  2CYY A;  3N6L A;  2O1P A;  3BKF A;  1F3F A;  4ZPW R;  2QYG A;  1KFS A;  2BE9 B;  1WSR A;  1YJ9 S;  3UDE A;  5HO4 A;  5LSO A;  1S0V A;  1T05 A;  3CCT A;  4Q2L A;  4M63 A;  1DFD A;  1KFD A;  3C2P A;  4GKJ J;  2E1R A;  4EBE A;  3DLG A;  4KB7 A;  5M2R A;  2NXN A;  4K50 A;  3GB0 A;  2MZQ A;  2VH7 A;  4ZLP A;  3LGM A;  3T5L A;  2R7R A;  3MMJ A;  1FXL A;  4NZ0 A;  3JQM A;  2WBM A;  2VG7 B;  3MCS A;  4K4Y A;  4BWM A;  4CLT A;  4JBC A;  4J90 A;  1UPP A;  4DFJ A;  2MJU A;  4CDI A;  1CJU B;  3TYT A;  4GKK J;  3PW0 A;  3R7B B;  4IO1 A;  3P3D A;  1LV5 A;  2RU3 A;  4LRD A;  4IFY B;  2B4P A;  2V6A A;  5JVH Q;  3DGV A;  4H4M A;  1CG2 A;  3J80 U;  2C2K B;  1S4E A;  2W9B A;  3HKW A;  3D1O A;  3PR4 A;  4J9O A;  5A8W B;  2YWK A;  1RT7 B;  2HQG A;  1XNR F;  3K59 A;  1EKR A;  2XLJ A;  1RZM A;  3V81 A;  2V4J B;  2E44 A;  5C2C A;  1FVQ A;  3W62 A;  1UJ4 A;  2ZBQ A;  3CCJ S;  3GFZ A;  4ZLN A;  1QAY A;  2VV5 A;  1S99 A;  2VHG A;  1H0H B;  3I0R A;  3BGO P;  2ZD1 B;  3HHL B;  3VWS A;  1KLM B;  4DG1 B;  2RIL A;  5ETT A;  2HFV A;  1SH2 A;  1L5U A;  1KSP A;  2UVW A;  2QA4 G;  4P73 A;  4DMZ A;  2GCF A;  3JQK A;  1U2F A;  3MXH P;  1H7W A;  5AXN A;  4UOC A;  1S7I A;  2IDE A;  2MZT A;  3EUN A;  4ECY A;  4F50 A;  1R89 A;  4IQX A;  2V8H A;  4ZVF A;  2I5J A;  3TA0 A;  1WEL A;  1VI7 A;  2UP1 A;  1QAI A;  4MJK A;  4GKK F;  5MAO A;  1N5Y A;  2J76 E;  2O5D A;  4XPE A;  4OI3 A;  3G96 A;  5HAN A;  1NAQ A;  3C14 B;  3NMR A;  2QG9 B;  3EZ5 A;  4MYU A;  4F7V A;  1EET A;  1Q8I A;  3UCZ P;  1B64 A;  2FZC B;  4KIA A;  4K4Z A;  5HMZ A;  1FA0 A;  2V8P A;  4KE5 A;  3GJR B;  2EFQ A;  5KTQ A;  3AA8 A;  4ZOS A;  2WVC A;  2YKM A;  1D9F A;  2LEC A;  2XO6 A;  1VBY A;  1WC1 A;  1ZM4 A;  4HHU A;  2YPY A;  5DS7 A;  3GCW P;  3IO1 A;  2ASY A;  3MEE B;  4DV2 F;  3Q8S B;  1FK9 B;  3OTO J;  2XBP A;  3NS7 B;  5HQM A;  3MF5 A;  4WBF A;  3LAN A;  2U2F A;  3DGP B;  3MED B;  3OR2 B;  1Q8K A;  1ZAX A;  2VIC A;  1XMB A;  2BRK A;  3HHL C;  3M8R A;  2FGO A;  3MM8 A;  1H74 A;  5KFU A;  5CHC B;  3KLH A;  1WI8 A;  1A6L A;  1JQG A;  3UDC A;  4GC6 A;  5HAT A;  2MTL A;  4M5I A;  2FD2 A;  4I64 A;  1S6P B;  4WF9 Q;  2H54 B;  2FJW A;  1C2P A;  3DRR B;  3TUJ C;  3PHT A;  4J9N A;  3DYA B;  3I56 S;  4WCE Q;  4F0M A;  3C19 A;  5LOQ A;  5HVH A;  5GAD I;  5CCL A;  3ZTR A;  3D6H B;  1EZZ B;  3GE9 A;  3CJ2 A;  1NDK A;  3M8Y A;  1QVF R;  2P8I A;  2CQ4 A;  1N32 F;  4RUA A;  1AXQ A;  1UWB B;  4AL5 A;  2OMO A;  2BRL A;  2E66 A;  3LQV A;  4ALZ A;  1Q81 T;  4C11 A;  1RBA A;  2RHS B;  4NCA A;  2XM3 A;  4DUZ J;  1LK5 A;  2OTL S;  2VG6 B;  3IS9 A;  1YSJ A;  1WHW A;  1IKY B;  4PUO A;  2DGU A;  4MH8 A;  2DPJ A;  3OTO F;  4MKY A;  3LP0 A;  5JJB A;  2WAQ D;  3MFH A;  1VQS A;  2AHO B;  2VKZ G;  4DV5 F;  1MMN A;  5CD4 H;  4Z7Y A;  2HAI A;  1Y7P A;  1XEZ A;  1WC5 A;  1FDD A;  4DFM A;  1O0P A;  3CD0 A;  2BA9 A;  2CXE A;  1S1X A;  4B3M F;  1CQN A;  1B7Y B;  2DGT A;  5D4N A;  1S6Q A;  1FFS B;  5B7W A;  1CJK B;  2IAJ B;  3CJS A;  1JJH A;  1BC6 A;  3KNA A;  5BYR A;  1NBE B;  2APO A;  3MI7 X;  1MNE A;  2G2Z A;  1GXL A;  2HZA A;  3ZNJ 1;  3KMQ A;  4QWD A;  3H4B A;  3NNC A;  1TMJ A;  2B51 A;  1X4G A;  1DY3 A;  3OLB A;  1VQ6 S;  4JV2 A;  3HHN B;  3QT6 A;  1H2V Z;  5L1J A;  4I2P A;  4JUZ A;  2IVF B;  1YBT A;  4IDK A;  5AXK A;  4DSI A;  1Y3J A;  1PG5 B;  3FC9 A;  3QSI A;  3FSY A;  3PR5 B;  1TL7 A;  2GQ2 A;  2UUB F;  3LUY A;  3FVY A;  4LF9 F;  1LXN A;  3MEK A;  4B08 A;  4KHP J;  1R0B G;  5ETN A;  3HVA A;  4DUZ F;  2GQC A;  1UTA A;  3WIU A;  2GO9 A;  4I67 A;  4J37 A;  1UAW A;  1PIL A;  3CJ4 A;  1RAO A;  4NLR A;  4UOG A;  5IM0 B;  1TKD A;  3QRP A;  1ELO A;  4ED7 A;  1E6V B;  3G6V A;  1ZPV A;  2DY9 A;  3LP1 B;  3AH6 A;  4N47 A;  1TUV A;  1VHI A;  4H4M B;  2JDJ A;  1V3Z A;  2MYF A;  2EEY A;  4ZCK A;  4U6P A;  2CJK A;  1U7L A;  2IRU A;  5HMW A;  3DLK B;  2YQ0 A;  1QY7 A;  3TWZ A;  5CZX A;  3VV2 B;  1ZS6 A;  4LFC J;  4GRS A;  2L3M A;  3I0S B;  1TVR A;  4AD6 A;  1HW9 A;  5KFS A;  3LP2 A;  3FCW A;  2N4D A;  2RRA A;  4QIG A;  4LF6 J;  4WFX A;  4P52 A;  2HFU A;  2EBE A;  2YKQ A;  4ECV A;  1RAG B;  2CFX A;  2ZJP Q;  1FKP B;  5E3C A;  3FSX A;  2KT3 A;  3LW5 C;  3L7U A;  3TR5 A;  1TFY A;  3S01 A;  3CIZ A;  1DTT A;  2ALY B;  4B3S F;  4OV6 A;  2M4M A;  2W8L A;  1JJ4 A;  2UVV A;  3I6P A;  4H4K C;  3Q23 A;  2CZV C;  1ZH5 A;  1SKW A;  4DS5 A;  1LW2 B;  4DSF A;  1W7W A;  4XTT A;  3A12 A;  3IRX B;  4DEZ A;  1V5I B;  4UUX A;  3ILL A;  1RTI A;  3AB2 B;  1YJN S;  3M2R B;  2DR5 A;  5L39 A;  4MKV A;  3M32 B;  5DGA A;  2I5J B;  3RR8 A;  3FQL A;  1VLY A;  3U27 A;  4IKA A;  3DLH A;  3VAM A;  4C0B A;  2LQ9 A;  4PQU B;  3J7A N;  1RB0 A;  2VC1 A;  3MAH A;  4WII A;  4HTJ A;  3D2W A;  1JXV A;  2JC1 A;  3BN7 A;  1KC8 T;  1VR6 A;  2B5J A;  2QMX A;  1RP5 A;  3OVS A;  4IR1 A;  4U96 A;  2Y1L B;  4K4V A;  1WHX A;  3UN2 A;  3CDB A;  4NCB A;  2WW8 A;  2H5E A;  4KY3 A;  2DEJ A;  3M30 A;  1FFW B;  2HVD A;  2EC0 A;  3FEZ A;  5LM7 E;  4FYX B;  2M70 A;  1VQL S;  1LWE B;  3QLH A;  1URR A;  4K8R A;  2I6W A;  1IBK F;  2IYG A;  3W5Z A;  3MD1 A;  2DO0 A;  2Q6C A;  5FII A;  1WTB A;  4OIX A;  3MM8 B;  3TAM A;  4XO0 A;  5J1N A;  3SCK E;  3JTN A;  2NSB A;  1VOM A;  4CM2 A;  4M5K A;  3I87 A;  4I2Q B;  4CLP A;  4PG4 A;  4RW8 B;  3R5J B;  4FYY B;  3F56 A;  5D3G A;  1GQE A;  1WKK A;  2MLZ A;  1FT8 A;  2RHQ B;  1FRM A;  1S1U A;  3MGJ A;  3W8G A;  4S0M A;  2KO1 A;  4CNZ A;  3BO4 A;  4V1A k;  1IKV A;  2JC0 A;  1HBN A;  2PC6 A;  2DCU B;  2FZG B;  2C3Y A;  4NOH A;  4Y00 A;  3FKB A;  5KFC A;  3IMQ J;  2PE8 A;  4TY9 A;  1NZ8 A;  3J81 U;  5B0F A;  1VCT A;  3NWR A;  4C9D A;  2BKN A;  4C0O C;  2DBB A;  2HIY A;  5DLG A;  4WFA Q;  4HKQ A;  4P6Q A;  2EC2 A;  4J5O A;  2BDP A;  1L3U A;  3DOL A;  3HSJ A;  4LRC A;  4DF4 A;  1S1W B;  2V5H G;  3DN9 A;  3NEK A;  4GVB B;  3EZU A;  1WAC A;  1RBO B;  1H3D A;  5L1I A;  1U1N A;  2AKW B;  5EUH A;  3ETM A;  2BJ9 A;  2G2O A;  2KVQ E;  1TMM A;  2HFS A;  3ULH A;  5KAK A;  1U1O A;  3HJV A;  3OTB A;  3PO4 A;  4JI0 J;  5J2P B;  3MEC B;  4C8K A;  1FE4 A;  4EZ9 A;  2KT5 A;  1LXJ A;  2W2P P;  3MCN A;  5B0B A;  1WF2 A;  3BR9 A;  4DQS A;  1D9A A;  4C3K A;  2ZBC A;  5DG8 A;  4G65 A;  1UPM B;  3AJ1 A;  1RU1 A;  4G3I A;  5BYS A;  3LPE A;  2CG4 A;  5DG7 A;  3G8Q A;  4ZP8 A;  1GX5 A;  1JLG A;  3WC2 A;  1Q8B A;  5KFO A;  2RKI B;  4PG5 A;  3U02 A;  3WC0 A;  2MB0 B;  4DN9 A;  1ARO P;  3BGF A;  3LGN A;  4EZ6 A;  4C3L A;  2GS8 A;  1WEZ A;  3T9N A;  3IBF B;  5F9L A;  3HO1 A;  2B4U A;  2B7B B;  2HHT A;  2IYI A;  1KR4 A;  4MK7 A;  1DHM A;  2AWZ A;  3L7O A;  4RUH A;  1KD1 T;  2OO4 A;  4N8O A;  2XSJ A;  1TL7 B;  1UEV A;  3GON A;  4ENO A;  4YDD B;  5F3Z A;  4LIR A;  3K5N A;  3KJF B;  3FSI A;  2MQQ A;  4RW7 A;  4CLZ A;  5ETS A;  3TW0 A;  2BJE A;  2CJX B;  4ELT A;  3DRP A;  4OX6 A;  3TA1 A;  4FF3 A;  3KHH A;  1TL5 A;  1FRJ A;  4LF8 F;  3FBB A;  4Z7C A;  2F4F A;  2YWE A;  1MRO A;  5ETV A;  4OYW A;  3H5X A;  2Q1L A;  3U1L A;  3R1L A;  1NJY A;  1PYT A;  2IA0 A;  3HFV A;  2C2N A;  4JV0 A;  4NRT A;  2RUS A;  1RA7 A;  1K47 A;  3PVX A;  3NRB A;  2EFG A;  2DNN A;  1WWH A;  5DGB A;  4ZHR A;  4BCA A;  3M9M B;  1FXD A;  3DU6 A;  3N4W A;  3R7N B;  3QT5 A;  3LP2 B;  1D8Y A;  2C28 A;  2NSC A;  2KYX A;  1LWF A;  2EK6 A;  1H7X A;  4WXW A;  1VIX A;  4UQT A;  3VZI A;  1XWL A;  4ED1 A;  4ZIV A;  3G87 A;  3VTI A;  2DD8 S;  3FZ2 A;  3BQ2 A;  2B3T B;  2GVZ A;  1NND A;  2X1F A;  1REV B;  2P9C A;  2ZOF A;  5D8H B;  1NSA A;  1F2H A;  3B4M A;  1BLU A;  1U49 A;  2DTJ A;  4Z37 A;  2UV8 G;  4UZB A;  4J9K A;  3CDU A;  2C3M A;  2K1R B;  5ETK A;  1IKW B;  1DAX A;  2V4R A;  2BJ7 A;  3NG8 A;  1I5O B;  1U25 A;  1DUR A;  1TP7 A;  3HFZ B;  1M5O C;  2DNZ A;  4NE9 C;  3EVM A;  5J2N A;  3ET6 B;  5CA5 A;  3R97 A;  4K4X A;  4HTI A;  3NAH A;  2RQM A;  3CJ3 A;  3GV5 B;  1JLF A;  4OJ3 A;  1NK8 A;  3DRY A;  4J9V A;  2D69 A;  1RWM B;  1N6Q B;  4ZCM A;  3OR1 B;  2V4Q A;  3DDN A;  1UEU A;  3BGL A;  3QGG A;  4J9R A;  1S0N A;  1T9W A;  2B5J B;  5THW A;  4RNH A;  3MAA A;  4B9S A;  1ITP A;  3C46 A;  1FJG J;  3BH7 B;  2VDH A;  3AOA A;  1S97 A;  3MPD A;  3TVY A;  2KHC A;  1C0U A;  1REG X;  1IQZ A;  3KNG A;  1VK8 A;  4PXD A;  2OML A;  2D74 B;  3H2U B;  2Y1I A;  1HWL A;  1FES A;  2RJZ A;  4DV0 J;  1EHW A;  2L41 A;  1FX2 A;  4LT6 A;  2XEX A;  2HQ3 A;  3JYT B;  1ZZF A;  1GMV A;  2IBO A;  1UW4 A;  2IVY A;  2FY1 A;  3G82 B;  2QIF A;  3DC2 A;  2MLY A;  4NA2 A;  3BKU A;  2CPJ A;  2DIT A;  2DGX A;  3EGV A;  3WX4 A;  4C4W A;  3M2U B;  3W60 A;  5KG1 A;  2HEK A;  5DZ6 A;  2IFX A;  2KRB A;  2KXF A;  4UZC A;  5IC4 B;  2LQJ A;  4DR5 F;  3DDK A;  3BB5 A;  1N56 A;  1CUL B;  2XY6 A;  1ACM B;  4KJI A;  2AJ2 A;  1VRU B;  5KFX A;  1WSV A;  3M8Q A;  1T7P A;  2V69 A;  2HHW A;  3TX8 A;  2KTQ A;  3NAI A;  2XGP A;  4L3N A;  1X4B A;  3GP9 A;  4K5S A;  2QL7 B;  5CZV A;  3IR5 B;  1S9G A;  1CVJ A;  4N41 A;  2CQC A;  3HK2 A;  4HEA 9;  2X3G A;  3PHE A;  4CRJ A;  2B9E A;  1YJR A;  3RB4 A;  5D4L A;  1X4C A;  1L3T A;  4NLO A;  4DX7 A;  4RKU C;  4HH1 A;  3P5B P;  3CD6 S;  3TZZ A;  3QZ7 A;  1RHU B;  2FC8 A;  2RNE A;  3BQ1 A;  3K8V A;  2NZC A;  1RAA B;  2RQC A;  3IFE A;  2FUG 9;  1M1H A;  2DY1 A;  1D0E A;  1RUS A;  1JJ2 R;  4B9N A;  3NKY A;  1SJR A;  5F8H A;  4QW8 A;  1KRP A;  3DM2 A;  4M5H A;  1RT2 A;  1QSY A;  2H5J B;  1WD6 A;  1RE1 B;  4RW4 A;  1Q5V A;  1J5O A;  2JVO A;  2I9S A;  3AA9 A;  2F3J A;  1S72 S;  5T14 A;  5KFY A;  3K0J A;  2C2M B;  2BQR A;  3E01 A;  1BGX T;  2FLL A;  2B9W A;  2AJ1 A;  3AB4 B;  4FNI A;  1AFI A;  3K2Y A;  1U2C A;  2W4C A;  1FER A;  5L1K A;  1BQN B;  1P1T A;  4ED5 A;  4JI8 J;  2MQL A;  2YX7 A;  1WOR A;  2YH0 A;  1HL6 A;  3K5O A;  1HLW A;  4OYX A;  1ZZN A;  1VQP S;  1RAB B;  2MPU A;  3TEH B;  4XK8 C;  1UVK A;  3S6E A;  4NWB A;  5F8M A;  1X9S A;  2RF2 A;  2U1A A;  3TQ1 A;  1ICE B;  3UR3 C;  4LFA F;  1QM9 A;  3ELH A;  3RB3 A;  2LMI A;  3FFI B;  3LO3 A;  3RAX A;  3VVT A;  3RW6 A;  1EJ7 L;  3VGV A;  3VAI A;  4NLV A;  4E98 A;  3DNC A;  4USH A;  4RR5 A;  2AIR B;  3H98 A;  4NLT A;  2R2T A;  4CH7 A;  3HFK A;  4ED2 A;  1CPZ A;  1N33 J;  2UXB F;  1YQH A;  1R8H A;  2AZ1 A;  2CJB A;  2VPZ B;  3GMG A;  1UL3 A;  3CUL A;  3T1H J;  3T3F A;  1RSC A;  3JS9 A;  5T7L A;  2Y3Y A;  4CO3 A;  2BQ3 A;  3E8O A;  1RTD B;  1G4C A;  1HA1 A;  1VGY A;  1O8B A;  1A0O B;  4G1Q A;  3D1H A;  5DM7 Q;  3KJV A;  2H1Y A;  5I3P A;  2G9O A;  2ILY A;  3VGT A;  4DL4 A;  3H90 A;  4Z2X A;  1YG0 A;  4ZJL A;  2K8G A;  2FY8 A;  1JLE A;  3PYG A;  2UXC F;  3KLE B;  4DPO A;  4DV3 F;  2HGM A;  1N0V C;  2OEL A;  1I6J A;  4NEY A;  3CD7 A;  2LYV A;  4JI8 F;  5EWE A;  1YI2 S;  3DI6 A;  4NLG A;  1U8S A;  4Q8E A;  2OSQ A;  5DLF A;  2VFV A;  1HBM B;  2WSC C;  1XQI A;  1RU2 A;  1S6O A;  3ZTQ A;  3IG1 A;  4ITS A;  1WNE A;  2N3O A;  3JXO A;  2KDO A;  2LLZ A;  3M8P B;  4NYZ A;  3MUV P;  4OI0 A;  2R8J A;  1QVG R;  2XMM A;  1XC9 A;  4JI3 J;  2KB2 A;  4NZ6 A;  2QZ8 A;  1FEE A;  3CJR A;  4K4W A;  2WOM A;  1M90 T;  5L8R C;  4CYU A;  4DU7 A;  2K7K A;  4FF1 A;  2G0J A;  3NCQ A;  1G7C B;  1EAY C;  4LQ9 A;  2ZZM A;  2A18 A;  3AHP A;  2QMW A;  4OLO A;  4DR2 F;  4TU7 A;  2AX0 A;  1N33 F;  3M8Z A;  5IV4 A;  2VOP A;  1ZPW X;  4OMF G;  5EDW A;  1ZAW A;  2WON A;  1SUQ B;  2HFZ A;  1WG1 A;  3BGR A;  4M5G A;  4DSL A;  1U0S A;  4PXC A;  3MAA B;  2OUG A;  1C1C A;  1RHK B;  5IV3 A;  1P1L A;  1NHV A;  2DGW A;  3TI0 A;  3BBC A;  3MMC A;  5K14 A;  2CA9 A;  1HFE L;  2NXC A;  5DJB A;  2PI4 A;  2J6U A;  4NLU A;  2AGQ A;  4KH0 B;  2EFO A;  1UVN A;  1UFK A;  3TVZ A;  4NLS A;  3KXD A;  2G2Y A;  3JSR A;  2W7P A;  1NPP A;  5A0Y B;  3HMJ G;  5G4D A;  1D9D A;  2YNH A;  4YS2 A;  1Q8L A;  1B99 A;  3UNY A;  4DV7 F;  3ISN C;  2JOQ A;  2W2N P;  2MGZ B;  2NUH A;  3CSK A;  4PPD A;  1SQF A;  1R6V A;  1B0V A;  1OPI A;  2HZV A;  2C2Z B;  5CYQ B;  4HH0 A;  4P71 A;  5GAE I;  5HJY A;  2GMJ A;  2HFN A;  3W2W A;  2ZM6 F;  4ZPV R;  1AUD A;  5KFW A;  3R8Y A;  1M1K T;  2ZNZ A;  3N5B A;  2EWH A;  3EDR B;  2LQ8 A;  4WIQ A;  2FVR A;  2MKY A;  2V9K A;  2DNG A;  5HAO A;  5LMU F;  5LSR A;  1CJT A;  2F4V J;  4A47 A;  2KG1 A;  3GQC A;  4KR0 B;  1PGZ A;  4OI1 A;  2V34 A;  2DKO B;  3F73 A;  1FEH A;  5I42 A;  2R2R A;  4DR4 F;  4FYD A;  4IH7 A;  4X62 F;  4J9U E;  1H2T Z;  2HVE A;  2FJB B;  2BKO A;  2R7V A;  1HYS A;  2LDI A;  2OPP B;  1UVI A;  2V50 A;  3WQP A;  2Q6B A;  4DPU A;  3K7R A;  4KFB B;  3ZTS A;  1UMJ A;  3CJ0 A;  3J80 Y;  2Q66 A;  4NXN J;  3EZO A;  2W2M P;  5GAG I;  2ILZ A;  1S48 A;  4DCO B;  3RBZ A;  4TQS A;  2Q3P A;  4A8S A;  4A4J A;  2XGQ A;  3I9V 9;  3RRG A;  4NYO A;  1MU2 B;  2M88 A;  4USW A;  4ECW A;  4ILL A;  4EU0 A;  3DM2 B;  2HKE A;  5K9F A;  3VAK A;  4USI A;  2XMW A;  3OW2 R;  1VBX A;  3EGZ A;  1U1Q A;  4CWB A;  5E41 A;  3KLV A;  3MR2 A;  2BAN A;  5AXL A;  3OUY A;  3DDI A;  5KFI A;  2C2D A;  4BBY A;  4O44 B;  3EXC X;  2HK2 A;  3HT0 A;  2W1B A;  1NH8 A;  2QV6 A;  3HJF A;  2XY5 A;  4WYW A;  3S1T A;  2Z2Z A;  1XMQ J;  1UA0 A;  4FP9 A;  1WOS A;  2DK2 A;  1X4H A;  2IVM A;  4WFB Q;  2ZH9 A;  1T9X A;  2XSF A;  1KDN A;  3QYY A;  1JLB B;  2AEJ A;  2JJ4 D;  2FZK B;  3BS9 A;  1YHQ S;  4H4O A;  1KBR A;  1Y5N B;  1M5V C;  1WJ9 A;  1FKO A;  4LRB A;  3M7V A;  3ILI A;  4EBD A;  3UCU P;  3R27 A;  3MOJ B;  1SBR A;  2HBY B;  5LSL A;  1RBL A;  1MSW D;  3T6B A;  4NXN F;  3EYZ A;  4YB5 A;  1SL1 A;  1N5V A;  2ZE2 A;  1S0O A;  3RRK A;  2JEG A;  5KG5 A;  4N77 A;  3Q24 A;  1GNK A;  5IWA J;  2BJ3 A;  4OZ5 A;  3HVT A;  1VQK S;  1RGV A;  2YNI A;  4EEY A;  2CRL A;  4ANE A;  5D4O A;  1N36 J;  1MMD A;  5E33 A;  4JP8 A;  5E3P A;  2AQ4 A;  1FRH A;  1HHQ A;  1VMB A;  4ED8 A;  1NM2 A;  2W9A A;  1XMO J;  2E5G A;  3LGH A;  4HLB A;  1X4A A;  4ZVQ B;  5IXU A;  4G1Q B;  4NI2 A;  3BM7 A;  5EN1 A;  2VFT A;  4JYA F;  2UVR A;  3QGI A;  4WE1 B;  5FDL A;  1NHK L;  2PII A;  3G2X A;  4QIV A;  1M5H A;  1B7F A;  2D3O R;  4JOU A;  1JX4 A;  5EX0 A;  2RDD A;  2VBZ A;  1XMQ F;  3J81 j;  5J2M B;  1SB6 A;  4MIB A;  3GTY X;  4NL5 A;  3DI6 B;  3SI8 A;  1RTJ B;  2VC0 A;  1OPZ A;  2HHH J;  3TJ9 A;  2ZWO A;  1NEE A;  1YLX A;  4B3O A;  1HR0 J;  5B0A A;  4YQW A;  2KG0 A;  1MWY A;  3MWB A;  1SC6 A;  2CQ1 A;  1EB0 A;  3W8P A;  3GR0 A;  2DIU A;  3LPY A;  4CP5 A;  2RH3 A;  2DPI A;  5EWG A;  4ZVU B;  3QJJ A;  5ETP A;  5IC6 B;  2KYZ A;  5I3Q A;  3CDE A;  2HLT A;  2NLW A;  2RIJ A;  5L9X A;  1FWK A;  2BBE A;  4ED0 A;  1K0T A;  1E6Y A;  4V19 X;  2XWY A;  4ZVO B;  2YKO A;  4O23 A;  5IWA F;  4DZD A;  1TL4 A;  4FYW B;  2IC3 A;  2CNO B;  1A9N B;  5IZH A;  3K57 A;  2J0S D;  4X4O A;  4PR6 A;  4CCH A;  1TV6 A;  2VG5 B;  1I3O B;  2FB0 A;  5K14 B;  2VOD A;  1IR1 A;  4JB8 B;  4ICL B;  5KT5 A;  2BVZ A;  4NAS A;  3ZC4 A;  3Q8Q B;  2RD5 C;  2ACY A;  1WF1 A;  3CJT A;  3FBC A;  2VFU A;  1PAU B;  5EGY A;  2QTW A;  2CQB A;  3C3L A;  2IM3 A;  1U1L A;  2Z4P A;  5KOX A;  4DUY J;  3MEG B;  2PSZ A;  4CIO A;  2WZ1 A;  3PX4 A;  5I3U B;  3HZE A;  3X1L B;  2R4F A;  5EX3 A;  1RIS A;  3GYN A;  4KO0 A;  1CJV A;  3Q89 A;  1TUW A;  1IJF B;  5FD1 A;  4BHQ A;  1FXR A;  1R27 B;  2OAU A;  2JZ5 A;  4ID5 A;  5KFZ A;  3IR6 B;  4LBP A;  1R0A A;  3OXL A;  1YJU A;  3PEJ A;  3T6J A;  2ZOM A;  1SPB P;  3A1Y G;  3NBP B;  3I32 A;  4WWS A;  4ZPA A;  2DO4 A;  3C16 B;  3MPV A;  1S49 A;  4DZ6 A;  1DTQ A;  1XR7 A;  4DR6 J;  3JB9 k;  1U1P A;  3T5K A;  4Y2I A;  4W92 B;  1WI6 A;  1WDT A;  3W61 A;  1IWA A;  1TL3 A;  2GX8 A;  1JLC A;  2IDL A;  1WUU A;  3R3T A;  5I42 B;  1Y11 A;  1KKH A;  3CNQ P;  4LFB J;  1C0T A;  3PJX A;  2CJY B;  4I56 A;  3FMW A;  2HFO A;  2YKP A;  3TUZ C;  5KFA A;  4URG A;  4RW9 B;  2IJN A;  2AYG A;  5HP1 A;  2GVD B;  1HYS B;  1NPR A;  1U0H A;  1M5S A;  4DQQ A;  3J7Y I;  2YH1 A;  1Z1Z A;  3CDA A;  2AF6 A;  3QIP B;  2HND B;  3PYD A;  4KGV B;  2XLK A;  2DCL A;  2HVZ A;  1OYD A;  3BSO A;  3CO9 A;  3US5 A;  1N34 F;  3LAK A;  4Q2M A;  1D3W A;  1HMV B;  3GPA A;  3TRG A;  2M5Y A;  1EP4 B;  4ZA1 A;  1NK4 A;  4AL6 A;  1TK5 A;  3WHI A;  2BKP A;  1LOU A;  5ITH A;  1GTE A;  3JTO A;  3HVW A;  1KVI A;  4QQB A;  4CLF A;  2NS1 B;  2MEW A;  4TY8 A;  2ZBR A;  1KTV A;  1SC4 B;  3UPF A;  1X4D A;  5DDP C;  1P8G A;  3ZZU A;  2LXI A;  1S9F A;  3JSY A;  5HLF B;  2J5A A;  3CJK A;  4Q5V A;  1SI9 A;  2DNO A;  2VQE F;  1C1B A;  2CJ9 A;  3IWN C;  3AQP A;  3M4X A;  1LW0 A;  2R8K A;  4YB6 A;  1YVF A;  2V8G A;  4IFV B;  2M3D A;  4DF8 A;  4X66 F;  4KYZ A;  3D68 A;  4P2S A;  5KFH A;  2RDI A;  1TFW A;  3DLE A;  3DOK B;  3D5M A;  1DJ0 A;  5A2Q Y;  3EDQ B;  3GR1 A;  5K8M A;  5L9N A;  2HNZ A;  1R8C A;  1OY9 A;  5LXY A;  2CQ2 A;  3UN5 A;  5GVQ A;  3L3C A;  3MM5 A;  4Y3C A;  5CD4 A;  2FHJ D;  5C24 A;  1MN9 A;  3C15 A;  2FLO A;  4X4U A;  2NRE A;  3I5B A;  1SC3 B;  5M2U A;  4G6V B;  4J9P A;  3HVT B;  2RU9 A;  2GA7 A;  4O4G A;  1RWV B;  5ETQ A;  2ZOG A;  4NA3 A;  1Q5Y A;  4DCJ B;  4OI4 A;  2Z58 B;  2N7Y A;  2P9E A;  1YZ7 A;  4JI5 J;  2X51 A;  1KNZ A;  3MMB B;  2ROP A;  2EK1 A;  1O5J A;  4LF5 J;  5GAD U;  1BXN A;  2HHV A;  3M8W A;  3CD5 A;  3N6N A;  3E51 A;  1RTZ A;  2VAS A;  3EX7 B;  2MKS A;  3H0P A;  4YR0 A;  1TTH B;  2CUY A;  2WW4 A;  4XAK A;  3IXQ A;  3PRV A;  4LR8 A;  1HPZ B;  4TN2 A;  1Q86 T;  3D9B A;  4LF1 A;  2XHC A;  1N5Q A;  1QLN A;  4LF4 J;  3W1Y C;  2YNG B;  3HCX A;  4DDF A;  4AND A;  2FHJ A;  3T1Y F;  3AT1 B;  3FJ2 A;  1HD0 A;  1SJ1 A;  3FDS A;  2QX0 A;  1IBL F;  2FHM A;  1EQ0 A;  4LSL A;  1QAJ A;  3KLF A;  4ZPB A;  3J7Z 5;  3SEO A;  4DX8 H;  4QIW D;  4DSK A;  3EGN A;  4C3M A;  2K3K A;  3BPS P;  4OZL A;  1HQE A;  2ZHA A;  4OZ0 A;  5HBM B;  5H9F J;  1SL0 A;  4HHJ A;  2IC3 B;  2QA4 S;  2RVJ A;  4P2M A;  1NO8 A;  4X4N A;  1NB2 A;  4IG3 A;  5A8K B;  1EAR A;  1RT5 A;  2WB4 A;  4U8V A;  3Q83 A;  1TV6 B;  3EJM A;  2NYH A;  1UP1 A;  2J8A A;  3C66 A;  5B0G A;  4NXM J;  2PMH A;  2BE2 A;  3GZ7 A;  2B56 A;  5HMX A;  2BM1 A;  2M2B A;  4TLR A;  4WZM A;  3RTV A;  2XZD B;  4X84 A;  2LEP A;  3IWX A;  1S1T A;  2WVD A;  3CMQ A;  1IM4 A;  3V5R A;  1IBM J;  2W9C A;  2UUA F;  2Z2Y B;  4HT5 A;  4UF4 A;  1S10 A;  3HXM A;  2HHX A;  3RB6 A;  3RUB L;  2OPQ A;  2A3J A;  4I6W A;  4YR2 A;  3I4P A;  1NRK A;  4N76 A;  5AE1 A;  3LAL A;  5KG7 A;  3QZ8 A;  2P5V A;  2KJV A;  1UEK A;  3L9Z A;  3AD8 C;  3H40 A;  1QDU B;  2HMI B;  4KAI A;  4YB1 P;  3MPY A;  3UFC X;  1TL1 A;  4ID8 A;  2GGP B;  1KQG B;  3IWL A;  1MG7 A;  2GNK A;  1YKW A;  3GIL A;  2V0N A;  4RBV A;  1T11 A;  2DGS A;  2DR8 A;  1N54 B;  3D3B J;  4A8K A;  3QT8 A;  3HZG A;  2WB1 D;  3R5D A;  2CJQ A;  3K5L A;  2EFP A;  3GYX B;  3NXZ A;  2J9D A;  2ZC3 A;  3W9J A;  2CNL B;  5KFP A;  4Q44 A;  2GHV C;  3ENQ A;  1DQ8 A;  2GAH C;  3DRX A;  1FCA A;  4M5D B;  1B0T A;  1NSK L;  1FWP A;  4QW9 A;  5C25 A;  4NXM F;  1SIZ A;  4DHV A;  3RAM A;  3MM7 B;  5A6W A;  1RT1 B;  5KFL A;  4ZVP B;  2SXL A;  5CAB A;  3TQE A;  3PV8 A;  2DNK A;  2QO3 A;  1AZS B;  3MM9 A;  1GMW A;  1UWA A;  4DPY A;  7FD1 A;  4R5P B;  3BBB A;  4Y2C A;  4KGZ B;  3QFH A;  3R9L A;  1WC3 A;  3K89 A;  1CS4 A;  3W64 A;  2FJX A;  4FXW A;  2POK A;  4GVL A;  2XYG B;  2FVC A;  1K8A T;  4ES3 A;  4PEO A;  3F44 A;  1C1B B;  1S1V A;  2CZ4 A;  4PAB A;  5D0R A;  3IBC B;  2VU5 A;  2YWH A;  2X7I A;  1UZH A;  4QPT A;  1SKU B;  3V4M A;  2ZJQ Q;  5J1E A;  1NK6 A;  2FQQ B;  2PEH A;  2C2E A;  1Q4R A;  4OJG A;  3PW5 A;  4EO6 A;  1UA1 A;  2ZZN A;  4N7T A;  1IKX B;  1KOH A;  2BYC A;  4B3R J;  4C8N A;  1FNO A;  3FBF A;  4YFU A;  3K5P A;  3H59 A;  2XG8 A;  4NEZ A;  1HD1 A;  4EWT A;  4P72 A;  1HWJ A;  1X8D A;  2B6A A;  1RWP B;  3E2E A;  3LF0 A;  4GO5 X;  2DGQ A;  1QSL A;  2RAQ A;  3MM5 B;  4QYR A;  1R8P A;  3BDP A;  4PG6 A;  4ZPT R;  2K06 A;  4FF2 A;  5C24 B;  1OIA A;  4OV1 A;  3OHA A;  3NS6 A;  5KG0 A;  1Y4Z B;  3GIM A;  3RYL A;  3QO9 B;  2DXE A;  1M0S A;  2DNL A;  2GJI A;  3Q2S C;  3H2V E;  2E5H A;  1Y00 A;  2WRM A;  1NK5 A;  2KFN A;  3IBW A;  4KHM A;  2HS4 A;  1QTM A;  3PYE A;  3AOD A;  3DMJ B;  1F0X A;  1AB8 A;  4KQZ A;  4DSE A;  4HAC A;  1M1G A;  3OTC A;  5D15 A;  2YX4 A;  2FGC A;  4RNO A;  2AJ0 A;  2D41 A;  5G0R B;  3VGU A;  2IJR A;  2R8H A;  2J9C A;  4WFN Q;  2GIF A;  1V6H A;  2CQD A;  1DLO B;  3DHX A;  1G3O A;  2GFF A;  4USU A;  1LWC B;  2NCK L;  3T41 A;  2XMJ A;  1XK8 A;  2VJV A;  2NZ4 A;  2Z8Q A;  4U7C A;  1W2B R;  4R25 A;  2GAG C;  4B3R F;  4FS2 A;  3RB0 A;  3P49 B;  3EMT A;  5B0D A;  3VQT A;  2CZ9 A;  4I7F B;  6FD1 A;  3H5Y A;  1NDC A;  1LNQ A;  1KN6 A;  4RWW A;  2UUT A;  2R8G A;  3MCM A;  4OZN A;  2B8Q A;  3AOC A;  1PJ7 A;  1BQX A;  1L3K A;  4N56 A;  2H5I B;  4DV2 J;  3SZ2 A;  3VAG A;  2O01 C;  5FLX Y;  1VRT A;  4CO4 A;  5HMY A;  2Z0G A;  2DH8 A;  3ITH A;  1RAI B;  1RCO B;  4Q45 A;  3PFE A;  2RQK A;  1S76 D;  4BLG A;  3KG0 A;  1V5V A;  3HT3 A;  3GYG A;  2AJF E;  4HT7 A;  3QJL A;  3HPO A;  4U7U K;  1B4S A;  2X1B A;  4L6V 3;  1MML A;  4R8U B;  4K0K J;  2O66 A;  1JMT A;  3AOB A;  1K44 A;  1FRX A;  2MKC A;  4FBU A;  2FHK A;  4AXI A;  3ZZZ A;  1T02 A;  4RW6 A;  2FJA B;  2BXJ A;  3G8T A;  1S9E A;  1HBO B;  1V9O A;  2R7S A;  1RJJ A;  1RQ0 A;  4NCG B;  4QYZ K;  4QJV A;  3HSG A;  1UFW A;  3PNI A;  2MKK A;  1Q1K A;  2JEI A;  3BSA A;  4ZN3 A;  1OSD A;  1T9V A;  3QGH A;  5HL7 Q;  4IRD A;  5DM6 Q;  2H65 B;  1T8E A;  1N32 J;  1RT6 B;  4MAK A;  2CWX A;  3G71 S;  3HHE A;  5DG9 A;  3BPD A;  3D4J A;  3MHY A;  1IQT A;  4U7U D;  1U1M A;  5KFB A;  1KS2 A;  1RCX B;  3P5T L;  2D3Z A;  1FFG B;  3P6Y C;  5HQ8 A;  4KPY A;  3QFW A;  3I55 S;  1V3S A;  5J2Q A;  3MMA B;  1HNV B;  3CCS S;  4I69 A;  2HRU A;  2W24 A;  2UVU A;  4IOB A;  4O3O A;  5F8I A;  1SJQ A;  3N9U C;  2CNN B;  4FPR A;  4TU9 A;  3PRB A;  4M95 A;  4Y34 A;  3KWM A;  4HVZ A;  3O2I A;  3D6T B;  3NLC A;  3PAC A;  3PX0 A;  3UDL A;  1T03 A;  2DGO A;  3W9I A;  2XO7 A;  4L75 A;  1UCN A;  4DV5 J;  4Q8F A;  2Z2M A;  3HLU A;  3JSM B;  4IRC A;  4CLU A;  1UFL A;  5JVG Q;  3SQG B;  4B3M J;  4FDF A;  3KLG A;  3MUM P;  4L3K A;  1NJW A;  3DLB A;  2I2Y A;  2XMK A;  4K0K F;  4CLS A;  1X0P A;  1FDN A;  1YBA A;  3UD3 P;  1TKT B;  3IM8 A;  1QE1 B;  5B0E A;  3DRS B;  3ZXW A;  2MKI A;  1BUX A;  3PKY A;  3UVJ B;  5C2G A;  1FHT A;  5E3A A;  4PG7 A;  3OXF A;  1X5T A;  4DOZ A;  2CPF A;  4ZVH A;  1I51 B;  4UW2 A;  2IMW P;  3D6F B;  3M9O B;  3V4I B;  5BXI A;  1YJV A;  4PWD B;  1UVL A;  3CO0 P;  3M1V A;  2CPZ A;  3JQJ A;  1XJW B;  3R5G A;  2UUB J;  3DFE A;  1CS4 B;  2YWG A;  1YTY A;  4LF9 J;  3BDE A;  1NDL A;  4WJB A;  1W2I A;  1HNX F;  3R6L B;  4DR1 F;  4F67 A;  3R5B A;  1BQM B;  1VC0 A;  1RAH B;  5J1P A;  3I96 A;  4DPX A;  1HQU B;  4CNY A;  4BS2 A;  1X5P A;  4IG0 A;  3NGR A;  3M6U A;  4OZ2 A;  3O44 A;  3CJ8 A;  4PZV A;  2ALZ A;  5A6P A;  4WKY A;  5KFF A;  3BKT A;  4YEA A;  2QLF B;  1RT3 A;  3OV7 A;  3G6E S;  3PO5 A;  1NJI T;  2DNH A;  1X31 C;  4DPT A;  2HVI A;  1WEY A;  1ZYQ A;  5CYM A;  3OFH A;  2H9Z A;  2D9P A;  4LVN P;  3TZY A;  4J91 A;  2HLU A;  3D66 A;  2E1M C;  3LTO A;  4I68 A;  4RLE A;  5IQ6 A;  1VQN S;  1IM6 A;  2C3U A;  5L38 A;  3K5M A;  2VA3 A;  2GML A;  4EGL A;  2DNP A;  2DRA A;  3NGK A;  3BRE A;  3FBE A;  3UD5 A;  2IM1 A;  4E2F B;  3KK1 A;  3EPI A;  1T05 B;  3R2C J;  4B3S J;  4Y6I A;  5H9F K;  4F26 A;  1RI7 A;  5M2P A;  3KJN B;  2MQ8 A;  3DLG B;  1U45 A;  2RT3 A;  4O4R A;  4ZCI A;  2ADB A;  3G8S A;  3V6K A;  5ETR A;  2UV8 A;  3RW7 A;  4FBT A;  1RT4 A;  4JI6 J;  3G4S S;  4LSN A;  3UD4 P;  3R2D J;  4ZP9 A;  1SKR A;  1F9E B;  1HHS A;  8RUC A;  3KK2 A;  2AEF A;  3OHB A;  4WU3 A;  5C42 A;  2KH9 A;  2GJF A;  2V2K A;  1H72 C;  5D78 A;  4RUC A;  1ZA2 B;  1DQA A;  3K8W A;  3V6D A;  2W9B B;  4B9L A;  9RUB A;  1F9F A;  3U7J A;  3UWT A;  5HK4 A;  5IFM A;  2MZR A;  2HRY A;  2E7W A;  4LRA A;  4TVA B;  1R6Y A;  3C6U A;  4IRK A;  2ZH1 A;  3V81 B;  1FI4 A;  4XDC A;  1T3N A;  3P45 B;  3PXG a;  2P6T A;  1HNZ J;  1U02 A;  3BF4 A;  3RRH A;  4KV8 A;  4WPA A;  3M8S A;  5KT2 A;  4QPX A;  2HAF A;  1IBK J;  3OD2 A;  1HBU A;  2ADC A;  3I0R B;  4DV4 J;  3C6T A;  1HI8 A;  4FXD A;  1Y5L B;  3AQO A;  1GH8 A;  1FD8 A;  1KQK A;  2PMZ D;  4Q0B A;  3N79 A;  3FGV A;  7AT1 B;  3POT A;  5GAH I;  3SMZ A;  2QLB B;  3SXL A;  1WDD A;  1R3N A;  3PM9 A;  2UU9 F;  3FCV A;  1OQ3 A;  5SZT A;  5F8J A;  4JI6 F;  1FD2 A;  5A2Q U;  2FC9 A;  3VHQ A;  4DPW A;  2QC3 A;  3A3P B;  1T9Y A;  2VB6 A;  2Y9H A;  2C2O B;  1ZOT A;  5JMN A;  1N5Y B;  1TUG B;  3GCX P;  2B9X A;  1D09 B;  3QGP A;  4YHH J;  1EX8 A;  2MKJ A;  2OLW A;  2E1A A;  4B9T A;  1LKZ A;  2L9N A;  2V8D A;  2VFS A;  4YY3 F;  2A2C A;  3HP6 A;  3HHL D;  1EET B;  2Y8W A;  5DZ7 A;  3DLL Q;  1TAU A;  3PG9 A;  2F5G A;  3MR7 A;  2VG7 A;  3GV7 B;  2YKM B;  4I1T A;  1NHU A;  1K9M T;  5KT4 A;  2E5I A;  1S0M A;  2BW7 A;  1CJU A;  1HNZ F;  5A76 A;  4QOT A;  1DBD A;  2R7U A;  3NS5 A;  2YX1 A;  4IFY A;  1L3S A;  2H48 B;  3OSP A;  4F4Y A;  4W90 B;  4DV4 F;  1FNM A;  2M9K A;  1IWG A;  2DVI A;  3PY8 A;  2N4C A;  2XCP A;  5HRO A;  4HYK A;  5A8W A;  2EKY A;  3SV3 A;  1Z2Z A;  2ZKT A;  3CIM A;  1RT7 A;  2VBY A;  3KLH B;  2V4J A;  2XS5 A;  2IBK A;  3V6J A;  5KFV A;  1RYR A;  2DHA A;  3MDF A;  2C3P A;  2R3V A;  2YBV A;  3BGU A;  2KXN B;  2VQF F;  3B82 A;  3EGW B;  1VQ9 S;  3M9N B;  1F60 B;  3GIR A;  3HHL A;  1KLM A;  3QAT A;  4DG1 A;  4RBT A;  2UXD F;  5DQI A;  4YHH F;  2RUG A;  3Q86 A;  5AE3 A;  2V2Q A;  3BZQ A;  2K7J A;  3UDV A;  2CQP A;  2Y1J A;  4YDX A;  5GMK a;  4C11 B;  1RLC L;  2W01 A;  4ETX A;  4PYD A;  3HF5 A;  2GIQ A;  3CCQ S;  2AD9 A;  1T95 A;  1R0C B;  4OFZ A;  3TVK A;  2E5L F;  2G13 A;  3IS9 B;  2E5J A;  2XQC A;  2AX1 A;  4LF8 J;  4M5L A;  2R7X A;  2F1F A;  4PUO B;  4DBQ A;  2HQF A;  2FJV A;  3LP0 B;  4OYB A;  3C14 A;  1KEK A;  1WF0 A;  2MSS A;  6AT1 B;  4DL6 A;  4M5N A;  2HIQ A;  4I0W A;  4XPC A;  5CYM B;  4LMZ A;  2YKN A;  1S1X B;  1VQ7 S;  1JJC B;  4I4B A;  1ZM9 A;  3H2L A;  1S6Q B;  2CJA A;  3CJ5 A;  3DHW C;  2CIM A;  3BYP A;  4URQ U;  3VAL A;  2J6T A;  2HW3 A;  2DIV A;  2FYX A;  3MEE A;  3KHR A;  1I1G A;  2CPI A;  2CVI A;  1FK9 A;  4ECX A;  1SQG A;  2RSQ A;  2YVS A;  1ZTT A;  2KZZ A;  3DGP A;  5GAE U;  3SCI E;  3MED A;  3KK1 B;  4I2P B;  2V2Z A;  2I38 A;  4JI7 F;  4IDK B;  4NYP A;  2W7O A;  1RYS A;  2N7C A;  2I8E A;  1VQ4 S;  5IT4 A;  4O3R A;  4DI6 A;  1AYE A;  2KT2 A;  3CC7 S;  2HHQ A;  4F3M A;  3H20 A;  4NA1 A;  5H9E J;  1X5S A;  4A48 A;  3DRR A;  3CED A;  3FNN A;  3FZB A;  3DYA A;  3O8W A;  2IHR 1;  3OBI A;  4ZIW A;  2IPO B;  3FMB A;  1P9Q C;  5KG2 A;  4RX6 A;  5L46 A;  1XIQ A;  1R8B A;  4AE5 A;  2FLN A;  4ZK7 M;  1CLF A;  5KFD A;  5D0E A;  2HYI B;  2ASL A;  2LXU A;  2UUC J;  3JAM Y;  4BDP A;  3VR1 A;  1VQM S;  1AFJ A;  3CJQ A;  2N82 B;  3LWL A;  5GAG U;  2GHP A;  1NDP A;  3TAR A;  3NCP A;  1TVR B;  1LFW A;  3OL7 A;  5E3Q A;  2VG6 A;  2KM8 B;  3IA0 A;  2ZBI A;  1IKY A;  2PN6 A;  2DJW A;  5DRK A;  4D3G A;  2J9E A;  4CI0 B;  4ELU A;  4WU2 A;  3ENV A;  3QNW B;  3BN4 A;  2PFD A;  3ZZO A;  2OPS A;  4H54 A;  4Q0B B;  4DXL A;  1GEH A;  4OHV A;  2GMH A;  1DTT B;  2EXU A;  4WK1 A;  1BY9 A;  4ECZ A;  2IRY A;  3MM6 A;  2JFD A;  1PCA A;  2V68 A;  3U1M A;  3SCJ E;  2JSX A;  4DR5 J;  4LBH A;  1CJK A;  2IAJ A;  2ZH8 A;  4PWW A;  5KG3 A;  1RTI B;  2OPR A;  2YNF A;  5LMN J;  2R7W A;  4MK8 A;  3ZTP A;  4FPI A;  2HQD A;  2VF3 A;  3ONQ A;  4PRF A;  1VJQ A;  2QFI A;  2W7A A;  2HK3 A;  3SSS A;  2XYP B;  1FO1 A;  5JXS A;  3GSI A;  5LXR A;  1PSD A;  1YDL A;  3I4H X;  5KFR A;  2OEJ A;  3MUR P;  5LT5 A;  2QL9 B;  4H4K A;  1XR5 A;  2UUC F;  3G9C A;  3PYF A;  4L76 A;  4OYI A;  3Q8P B;  2HBZ B;  1R8A A;  4ZVE A;  4BC7 A;  4ED6 A;  4MFB A;  3N28 A;  2J7U A;  4C8O A;  3OT9 A;  4OI6 A;  8AT1 B;  1T9U A;  2BJ8 A;  2OIH A;  3ZO7 A;  3O1L A;  2HGL A;  4UOH A;  4PXB A;  3P4U B;  1SH3 A;  3M30 B;  5A8R A;  1TEL A;  4OYM A;  2KM8 C;  4USV A;  2J0X A;  3QLH B;  1XR6 A;  1SL2 A;  4P7T A;  5IM0 A;  4KT0 C;  1E6V A;  1S79 A;  3EVO A;  3LP1 A;  4RNN A;  3UCG A;  2W2Q P;  2HRT A;  1IJE B;  2CQ3 A;  4RWX A;  3CF5 Q;  2CDQ A;  4DL5 A;  5C5J A;  4HHH A;  5HRO B;  3DLK A;  3TAM B;  1RWW B;  3RZA A;  4K2X A;  1TK0 A;  3HSD A;  3K58 A;  1NCL A;  4RNM A;  2G1H A;  3PDN A;  3I0S A;  3S7R A;  2BM0 A;  5D3G B;  2I1R A;  2F9J A;  5HVG A;  3BO3 A;  2RRB A;  2WHO A;  3O3L A;  3MR5 A;  3BSC A;  1S1U B;  3L95 X;  3ZTO A;  1D1U A;  5LMN F;  2CVE A;  3ZZY A;  3NCR A;  1IKV B;  1HBN B;  1K0V A;  1FKP A;  4X4R A;  4ZCL A;  2XWX A;  3CTR A;  3M6X A;  4ED4 A;  3N5F A;  1NKB A;  2MY8 A;  4A8F A;  3PEH A;  4LF2 A;  4OZ1 A;  4GKJ F;  1HKA A;  3ETO A;  4UOF A;  1LW2 A;  5FLX U;  4HI2 A;  2QGF B;  4LFA J;  3V2U C;  4EO8 A;  3IRX A;  4IH5 A;  3RR7 A;  2OKQ A;  3D6M B;  5CQG A;  3DOL B;  2OTJ S;  3M2R A;  3NMA A;  3PW2 A;  1RK8 A;  2JWN A;  5GMD A;  1VLO A;  5KT6 A;  3M32 A;  2W4D A;  2MHE A;  2HBR B;  1F5C A;  3A3O B;  2UXB J;  4KGK A;  3GFY A;  4PQU A;  1HAR A;  1LQ9 A;  1RKJ A;  2M0G B;  3QBC A;  5JUM A;  2WSE C;  3KOA A;  4GC7 A;  4TLQ A;  3EPG A;  3HD1 A;  4NLP A;  2RML A;  2QMU B;  4A8M P;  2XNQ A;  4LBI A;  2MZ1 A;  1NU4 A;  1S7H A;  2YKN B;  1LK7 A;  1P6T A;  1HNI A;  1JLG B;  4X65 J;  2PI5 A;  2DHG A;  2PFF B;  1YJ7 A;  2UXC J;  1LWE A;  4DV3 J;  4RU2 A;  2QLW A;  1RWO B;  3ENA A;  2MQM A;  4A8O A;  4F4K A;  2MDA A;  3I9Z A;  5DQG A;  3D1Q A;  1Q16 B;  1S12 A;  3G6Y A;  1IN0 A;  1RAJ A;  3BH6 B;  1TKX A;  3VAH A;  4DS4 A;  2XSJ B;  2HHP A;  4O3N A;  4I2Q A;  4R0J A;  4RW8 A;  2AMC B;  2FLP A;  4RW7 B;  2HWI A;  4A8Y A;  4OYP A;  2LU1 A;  1YK9 A;  4P2F A;  3LH2 S;  5T41 A;  3PKM A;  3DRP B;  2PMW A;  2MY7 A;  2L08 A;  4DR2 J;  1S77 D;  2EFV A;  5E3R A;  2BQU A;  1X7V A;  3T5H A;  2CPY A;  1MRO B;  4ES2 A;  5LJ5 Y;  3J7Y U;  4WP9 A;  4JV1 A;  4A8X A;  4K59 A;  2ZHB A;  1GXT A;  3KMS A;  1B0P A;  4L72 B;  1N0U A;  5KT7 A;  1SVD A;  1BWE A;  1NKE A;  4ZHR B;  1ULR A;  1S1W A;  3QAE A;  3IP0 A;  4GVB A;  2JL9 A;  5K8N A;  4X65 F;  3DOM A;  1LWF B; 
#chains in the Genus database with same CATH homology
 3Q83 A;  3JS9 A;  4F36 A;  4W98 A;  1W7W A;  3MPD A;  3BH6 B;  3EJM A;  1BHN A;  3Q8Y A;  4UOG A;  1NPK A;  3DKD A;  3VVU A;  2AZ3 A;  3EVO A;  1F3F A;  4CP5 A;  5BXI A;  3ETM A;  4ENO A;  2VU5 A;  1LEO A;  4DUT A;  1NSQ A;  5CAA A;  3EM1 A;  2DY9 A;  3Q89 A;  1WKL A;  3FBE A;  4HR2 A;  1XIQ A;  4FKY A;  3NGT A;  3Q8U A;  2ZUA A;  3VGT A;  1LWX A;  3DDI A;  3GPA A;  1NSP A;  1EHW A;  1F6T A;  3PRV A;  3ZTR A;  1HLW A;  3NGU A;  3ZTP A;  4ANE A;  5C7P A;  4FKX A;  3VGU A;  1NDL A;  1NCL A;  1S5Z A;  3BBC A;  1NDK A;  1WKK A;  1PKU A;  1WKJ A;  1S57 A;  3WX8 A;  1HHQ A;  1B4S A;  1MN7 A;  3FBB A;  1NSK L;  1ZS6 A;  1MN9 A;  1UCN A;  2BX6 A;  1PAE X;  3Q86 A;  1K44 A;  4DZ6 A;  4S0M A;  4AND A;  2HUR A;  1JXV A;  3PJ9 A;  3EVM A;  1NDP A;  3FBF A;  3ELH A;  3FCW A;  3ZTO A;  2HVE A;  4C6A A;  1XQI A;  3EIC A;  3FKB A;  3ZTQ A;  3EE3 A;  1KDN A;  1NHK L;  3NGR A;  2NCK L;  4O0N A;  5CAB A;  2CWK A;  3VVT A;  3FC9 A;  4WBF A;  3VGV A;  1NUE A;  3G2X A;  3NGS A;  3BBF A;  2B8P A;  2BEF A;  1U8W A;  1B99 A;  4F4A A;  4EK2 A;  3ZTS A;  3BBB A;  1BE4 A;  1VYA A;  3EVW A;  1S59 A;  1HIY A;  3EMT A;  3L7U A;  2AZ1 A;  4DI6 A;  2HVD A;  3R9L A;  3B54 A;  3FBC A;  5IOL A;  4UOH A;  3FCV A;  3ENA A;  1NDC A;  3B6B A;  1NLK L;  2DXF A;  4UOF A;  2DXE A;  2DXD A;  2B8Q A;  4ANC A;  1BUX A;  1NB2 A;  4KPC A;  3Q8V A;  3GP9 A;  3BH7 B;  3VGS A;  2DYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...