4CP5A

Ndpk in complex with (rp)-spmpapp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
KVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE, CYTOSOLIC
publication title Enzymatic Synthesis of Acyclic Nucleoside Thiophosphonate Diphosphates: Effect of the Alpha-Phosphorus Configuration on HIV-1 RT Activity.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4cp5A00
3ZTSA 1MN7A 1NUEA 2DYAA 2B8QA 3NGTA 5CABA 1XQIA 3VGUA 1UCNA 2ZUAA 2HVEA 2DXFA 2NCKL 1NCLA 3EVMA 2DXDA 4UOFA 3ZTRA 3GP9A 3NGRA 1K44A 4HR2A 1NDCA 1NSPA 4F4AA 3VGVA 2B8PA 3ZTPA 4KPCA 4O0NA 3DDIA 1B99A 4DI6A 3GPAA 3WX8A 5IOLA 5CAAA 1BUXA 3FCWA 4S0MA 3Q89A 3VVTA 3ZTOA 3BH6B 3FBEA 1S57A 3VGSA 3NGSA 3B54A 1ZS6A 2VU5A 1WKLA 1WKJA 3FBCA 1S5ZA 3NGUA 1BHNA 1VYAA 3DKDA 4EK2A 1MN9A 3EICA 1NSKL 1PAEX 3ETMA 2CWKA 4WBFA 1W7WA 1KDNA 2AZ1A 3Q8YA 1HIYA 3BH7B 3EJMA 3FC9A 1HLWA 1NPKA 1JXVA 2HVDA 3EMTA 3PRVA 3FBBA 1NDKA 2BEFA 3FBFA 3EVWA 1U8WA 3ZTQA 4DZ6A 1NB2A 3JS9A 3Q8VA 3EE3A 1PKUA 3R9LA 3VVUA 3ELHA 1NLKL 4UOHA 1XIQA 5C7PA 1F3FA 2HURA 3Q86A 3VGTA 3PJ9A 1BE4A 1B4SA 3ENAA 4CP5A 4W98A 3L7UA 2BX6A 3Q83A 3Q8UA 3BBBA 2DXEA 1NHKL 1LEOA 3MPDA 4ENOA 4DUTA 3B6BA 4F36A 3G2XA 1EHWA 1F6TA 4FKYA 1HHQA 4FKXA 4ANDA 1WKKA 1NDPA 1NSQA 4C6AA 2DY9A 1LWXA 5BXIA 3BBFA 3FKBA 1NDLA 4ANCA 3FCVA 3BBCA 1S59A 2AZ3A 4ANEA 4UOGA 3EVOA 3EM1A
chains in the Genus database with same CATH superfamily
1A9NB 2G0CA 2AT1B 2ZWOA 5K8PA 4N76A 2ZH2A 1XNRF 3IGNA 4LF9J 3KMQA 4PPDA 5CA5A 1GNKA 4O0NA 1YJTA 4NRTA 4EU0A 4CT9A 1X5SA 3AXMA 4ZCKA 3MMBB 2XY7A 3MTKA 1HPZB 3J81U 4QPTA 4NXMF 2GA7A 2FGCA 3W5ZA 1K1QA 4A8YA 4NA2A 3K0JA 1Q95G 4NLQA 5EWFA 4DV6J 1N4LA 3E01B 2VOPA 2NUUG 3SEOA 4MIBA 4DF8A 1TAQA 1T11A 4FXVA 1TVRB 1IR2A 2K3KA 2MHNA 3AQPA 3MECB 5DLGA 1FXDA 1VBKA 2WZ1A 4TQRA 4CLZA 4K4UA 4DPYA 5CYMA 5J2NA 2XMVA 3BKFA 1PBAA 1TU0B 5MLCV 2JEJA 4QR0A 3FQKA 1RGVA 3ZZTA 4ZOSA 4YQWA 1Q8LA 3DXBA 7AT1B 2CJBA 4ED1A 4Q0BA 3DN9A 3OBIA 1BQMB 4G1QA 3VV2B 3MR3A 1JLFB 4U8VA 4LF6F 4J37A 4B02A 3C6TB 2U2FA 1V3RA 2DTJA 3UN5A 1SQGA 3OTDA 4ZP9A 3LP0B 4KTQA 4O44B 3TAMA 3T5KA 5B0FA 4ZVQB 3CSKA 2XWYA 1FKAF 5EWEA 3LP2B 2FVPA 8AT1B 2CPFA 2L3MA 2XLJA 2V8GA 3QGPA 3QWUA 2JH3A 3UWTA 2RDDA 1GMUA 2CDRB 4O4GA 4ED0A 4TYBA 3IM8A 1R6VA 2LP4A 1TVRA 2VFSA 3MPYA 5IM0B 1VQ8S 2E5JA 3OSNA 2L9DA 2EFOA 1GQEA 4PYDA 1U4BA 3DGPA 1P27B 1YBAA 1NU4A 3ZTSA 5HJYA 4Y2AA 2GIQA 2A10A 1JLAB 4LR9A 2XS2A 2CUYA 2WTFA 1NNDA 3OVSA 4CLTA 2KVIA 3IM9A 2HFOA 2DHHA 4R5PB 1PGZA 8RUCA 2Y1JA 1T3NA 2N7CA 1T02A 1F2HA 5IC4B 4BHQA 4OLOA 4I4BA 3FZBA 2OFGX 3QQCD 3TRGA 5L1KA 2UXDJ 1AYEA 3LP0A 2BEFA 4IH7A 1WHWA 5DG9A 4YHHJ 2YPZA 5HN0A 1WC4A 1WOSA 4RX6A 3EXCX 1S1TB 1FF2A 3TUZC 2GIFA 3EYZA 3H5SA 3AH6A 4H4KA 2XMTA 5KFHA 2HHPA 2XC9A 2HPUA 3BGFA 3BO2A 1IKWA 2HNDB 4RNFA 2ZBPA 1ROFA 1T9YA 4BWJA 1FTRA 1WD6A 5IM0A 2Z2YB 1VQPS 2FIUA 2FD2A 2XMKA 4ZPBA 1YX2A 3T1YF 3FCWA 4CZCA 1DFDA 4JI7J 4K4XA 1S57A 1JLAA 2UXCF 3THPA 2B0GA 3CULA 4ELUA 1D9FA 1MN9A 5FLXU 1MW7A 1XR5A 1WF1A 3GJRB 5FD1A 4J9VA 4FS1A 3PRVA 1KS2A 3OQ2A 2MKKA 3CJ5A 1N52B 1FFSB 4QIVA 1YVFA 2HIYA 3UCGA 2R7WA 3C15B 2EI5A 2FLPA 1N5YB 4K2JA 3AOBA 2R8HA 4LR8A 4CT8A 1WEYA 2BE2B 1FWPA 1H6KX 1SVDA 3PKMA 5LT5A 1FRIA 3NS6A 3A12A 2AJ1A 1VQMS 1RISA 4KHMA 1GXLA 4UW2A 4ZMMA 4LJMA 3CGIA 2XLIA 4DV5J 2HNDA 2Q66A 1ZPVA 3KHGA 3UCUP 5M2PA 2B8PA 1YBUA 3HVWA 4TN2A 4LVNP 3FEYB 3NNHA 3KXDA 1IBMF 3MOJB 3OL9A 4N8NA 1ZS6A 3DOMB 3BM7A 3FSXA 3QZ8A 2HIQA 1MNEA 4PABA 2YNHB 1T9UA 3MOZA 4C4WA 1UZDA 1WSVA 3P4UB 2YNFB 4J9SA 2DH7A 5A8RB 1SC1B 3US5A 4OZ3A 2XS5A 3CMAS 3K5PA 2G2ZA 1BGXT 1M1KT 2V8VA 2E7XA 2ZEJA 4WTOB 3Q8SB 1OPZA 2ROPA 2YNIA 1CS4A 5F0UA 2VOOA 1UL3A 1UVJA 1FRMA 3MM7B 1N5YA 2DNQA 3MZIA 2J9DE 4DR4J 4ZPWR 3NGRA 3HT3A 3WDOA 2HVIA 1J5OB 4KPCA 2VG7B 2VFVA 2KDOA 5KTQA 1FVQA 1H0HB 1Q7YT 3WBZA 4DR5F 2HFVA 3D28A 3M8QB 1X5OA 2JRSA 1N88A 2NXCA 4J5OA 2AYEA 1KDNA 4OIXA 4QU7A 3RTVA 1R8PA 3ITHA 1RAGB 3DOMA 1LXNA 1FDBA 2LQ5A 1EJ7L 1IR0A 1GXTA 3RBEA 2XMMA 3GIKA 4ZJOA 3THTA 4KT0C 2VPYB 3R97A 2YNHA 3JAMU 2PD1A 3BDEA 4QOTA 4YB6A 3S7RA 2N82B 4EGLA 3KNGA 1RAFB 5K8NA 2JLGA 3A8JA 3H4DA 5D0GA 1GEHA 2YNFA 4DUYF 3J7YI 3LUYA 1O8BA 5A8RA 1QAJA 3W64A 2ZBCA 2A6MA 4KH1B 3QRPA 1RU1A 5A6PA 4Y6IA 5KFOA 4QYZK 3FCVA 4ELVA 1G7CB 5AXNA 5KFZA 4FZVA 3W1YC 2NZ4A 4K4SA 4ID5B 5L46A 3MURP 4CO0A 2ALZA 2RB7A 3AAWB 2PMWA 2VG7A 2ZC4A 5F41A 2QIFA 4X2BA 3C3LA 4DV3J 5L1IA 1RHKB 4FYWB 1DZ5A 3OV7A 2XM3A 4ZLPA 2QSFA 3DM2B 2R8IA 3OHBA 4MK8A 2NXJA 2Y3YA 1ZM4A 2FJWA 1X31C 3EGWB 5KFTA 4KRWA 3BJYA 8ATCB 3KLHB 3O8WA 1Y10A 2DXEA 4LMZA 5HMXA 2DD8S 1S10A 3CCES 2F1FA 1PJ7A 3K59A 4DQPA 1CC8A 1EHWA 2A18A 2V8DA 2FJXA 1R8CA 3MM8B 4X66J 1K8AT 1S97A 3MMJA 2HRYA 2NSCA 3ENWA 4RW8A 4KV8A 3NCPA 1QUVA 3F73A 3TVKA 4UOGA 3JXOA 3D66A 3BREA 2V8HA 1RACB 3TA0A 2NCKL 4RZRA 2YKPA 2M7SA 3D2WA 2YWHA 4OYZA 4HI1A 2CRLA 1L5UA 3NGSA 2OHDA 2V4QA 5D4PA 2D3O1 1KHVA 2MZRA 2FC9A 4ID5A 4PEOA 2F4VF 1WWHA 4DV0F 1FTCA 2HFZA 2OPQB 3MR2A 2DNKA 4F4XA 2UXBF 4JI4F 4OZ5A 3OL8A 3P45B 3UD4P 4NCBA 5KFPA 2HURA 1L3SA 3CB4A 1YKWA 1RT3B 4YB1P 4RKUC 3OVBA 3VF0B 3Q24A 4OHZA 2ZBQA 5L38A 4RW4B 4DLEA 4B9SA 3KLHA 2MYFA 1YDLA 3MCOA 1KP6A 3FKBA 2OUGA 4RJVA 1I1GA 1Y5IB 5ETRA 3QLHB 4DS4A 2LLZA 4B3MF 1JLEB 3HVTB 3BN4A 2IBOA 1Q8IA 2LMIA 4GVBA 5FIIA 1IBLF 3MEKA 2CNOB 1B99A 4DI6A 2ZKUA 3FK4A 4NRUA 5KFSA 3K5NA 2ZH1A 3J81Y 5D0HA 3NEKA 2AEFA 1S99A 2BJDA 1JJHA 3O44A 3MMAB 1E6YB 2V9WA 2CZ4A 3PX6A 4H4MB 3M05A 3AD9C 3PRBA 4NLRA 1QDUB 1N0VC 2Y1RI 4ED5A 5B0AA 2XY6A 3EE3A 3D1HA 5K9FA 3IR5B 4RW9A 5D78A 2OPQA 5J1NA 5KFUA 3R5CA 1EETA 1AZSB 4ED2A 2H48B 4J9MA 1LQ9A 1U09A 2DT9A 1RT3A 3VAJA 2V94A 4PPZA 5HL7Q 3GSDA 4CO5A 1ZAWA 3GIIA 2AJ4A 3W5XA 3IWXA 4RBUA 4RW4A 3MD3A 2DNLA 2GIRA 2PDAA 1JJ2R 1PC5A 3N4WA 3ZTRA 2E5HA 2DNYA 5AJ3J 2OTJS 5I4MA 3R5DA 1S48A 4USUA 1Z2ZA 1HR0F 2DGTA 2RQCA 3OVAA 1KLMB 1JLEA 1P8GA 4WPAA 2IMWP 3O3LA 4WE1B 4DL2A 1XBWA 1E6VA 4Y0FA 4DV4J 2CJQA 1NJWA 4KHPF 4P75A 5J2QA 1Q4RA 3M30A 3AB4B 3MCMA 1S9GB 1KNZA 4B3OA 4UY85 3MMAA 1RI7A 2R2SA 1N33J 2R8JA 3LA0A 4NZ6A 3CJ2A 1VJQA 4DWIA 1VQKS 2VHGA 2WCXA 2AX1A 1S6UA 4G1PA 1VI7A 4I6WA 2XTJP 2QG9B 1HYSA 3UDEA 1U2RA 3DDKA 3E3XA 1R0AA 4L3NA 4OV6A 2HNYB 4XIUA 5EX0A 2JLFA 4K4VA 2RJZA 4QPXA 1YJNS 4K59A 4Y65A 4ZP6A 3WC2A 5IWAF 4LF7J 4CO3A 1WG5A 4WIQA 4CWBA 1N34F 2CJAA 1FRHA 4O4RA 1FCAA 1RCOB 2KM8C 4WZQA 1R89A 2B4PA 2FLOA 2JFDA 2F5GA 3AY0A 1KLMA 4U9RA 1VYAA 2MQNA 1GT8A 1VR6A 5I3QA 4WE1A 3RBZA 1H74A 3KMSA 4BBYA 1SJQA 1UEVA 2JEFA 2CVIA 4Q43A 5B0BA 1RXOB 2P2CB 3TQEA 2V4JA 3KDOA 1RT6B 2O3DA 5H9FK 3OTOJ 2QA4G 1LKZA 5A2QU 3TR5A 4TQSA 1NB7A 1F3VA 2CZVC 3UW1A 5F8JA 4LSNB 1HWLA 1U49A 1S0OA 3I82A 2KL8A 2NXUA 2MKSA 3R7NB 3NAIA 1T9TA 2K8GA 1P9YA 5KG1A 1U1PA 3KK3B 2QC3A 4GKKF 1NK4A 2HNYA 4CO2A 1T03B 4PWUA 4U96A 4DMZA 1ZAVA 2KFNA 3LALA 2UV8G 1FRJA 4HI2A 1G3OA 2W2NP 1FWKA 1SV5B 1XMQF 1JLGA 1HFEL 3CJ3A 3PJXA 4OI4A 3PZPA 2HBQB 5FLXY 4IOCQ 1BWEA 3THVA 3KUEA 2DNPA 3MI7X 4LFBJ 3GV7B 4USIA 1T7PA 1VK3A 1PKUA 4C9DA 4ZK7M 2WVBA 3CCZA 2CPYA 4QYZJ 5KFKA 1VBZA 4IRKA 2W9CB 3WX4A 2QYCA 1YSJA 3FMWA 3FSYA 4OMFG 4X4UA 2KRRA 3QO9B 3DGVA 2HEKA 4C8MA 3QBCA 5J2MA 1SL2A 4CI0B 4V19J 1RTJB 2G13A 1SXLA 4ANEA 5L9XA 2RHSB 1LFWA 2B8QA 4MIWA 3G6ES 2MZJA 4DZDA 2OSRA 2FZCB 2L9WA 2CPIA 2VDHA 3KK3A 1CEZA 2MGZA 3I87A 2CQDA 2ZE2A 3ZZZA 3KLIB 4NASA 3VCDA 1YGYA 4DG1B 4CDIA 1T03A 3M2UA 4BWMA 5GMDA 2FUG9 1C0TB 3G82A 3PR5B 2V2QA 2MHEA 3HHLC 1RWNB 1LW0B 1HBOB 3KTQA 2HHWA 2FY1A 1T9VA 1SV5A 1NZ8A 3KK2B 2C22A 3Q8RB 3IRXA 4RW6A 4ZVUB 4C8YA 1Q5VA 1N5SA 2K7KA 2MB0B 4N5SA 3I9ZA 5CD4H 1Q53A 4ZVSB 3KLFB 2QEXS 4ENOA 3TW0A 4MK9A 4DCJB 4ILMA 1GMVA 4K4WA 5KT2A 4FF2A 4KFBB 2FY8A 2EKNA 2CXEA 2IIHA 3QO9A 4IQMA 3PR4A 3H5YA 1L3KA 3KLEB 1RTJA 1UP1A 4HR2A 1I3OB 1KBRA 3KFWX 1SJ3P 1SJRA 4OZLA 3RYLA 2ZM6J 2VASA 2QGFB 2IYIA 4M5HA 5DG8A 3K17A 4JI0F 1YITS 2FHMA 1HWJA 2WW4A 1R27B 3PM9A 3KLIA 1YIJS 4DG1A 4QQBA 1B3TA 3TZZA 1U47A 4LFCF 3TAQA 3CT9A 1ZTTA 2OP5A 1NSAA 2N7YA 1W2IA 2JX2A 1LW0A 1HBOA 2OEJA 3JAMY 1QAYA 3KK2A 1JLCB 2FB0A 3VTIA 1IQTA 4F2SA 2RDJA 3N9UC 5LOQA 2E5LJ 2RS8A 1I5OB 3UDCA 1YTYA 4JB8B 2IBKA 1FFWB 3R2CJ 1M90T 5KFNA 1SCJB 4X4TA 2YKQA 3TWZA 2FHJD 6FD1A 2MZ1A 3IG1A 1LW2B 4NZ7A 3R5BA 2P5VA 5JVHQ 3CD6S 3EVMA 4KKOA 2COLA 3K5LA 1TFYA 3DDIA 1MMDA 5EN1A 1KVKA 4KHRA 3R5JB 1N6QB 2VQFJ 3W2WB 3PEJA 1X4BA 2GS8A 2EK1A 3A3PB 4FVCA 1U25A 4ZITA 4USWA 2KXHA 1CJTB 5GAGU 1S4FA 3FUYA 4X62F 3I5AA 3NBPB 2FPHX 5L1JA 1KR4A 3CCQS 2HBRB 1PC4A 5SUHA 1NB2A 3SFGA 3VR1A 1RADB 2XSJA 1B70B 4DR2F 1XIQA 4KH0B 1NM2A 2M9KA 1SPBP 2R7VA 3BYPA 2YVSA 1RHMB 1XMOF 1FVSA 1YWXA 2XGQA 2CQ4A 1ZAXA 4ZS6A 3RU0A 5ITHA 4LBIA 4GC7A 1DHMA 2FZGB 3K2YA 4ICLB 4A8KA 2MKHA 4B9UA 2NXNA 3CW2C 1LWEA 4X84A 1U1OA 4JV5J 5DG7A 4BS2A 5GMKa 2F8HA 4B3TJ 3BZQA 1VQ6S 1WC5A 3OL6A 3BN7A 1U26A 1Q7LB 5ETMA 1NK5A 1PG5B 1YHQS 3CCWA 2M4MA 3OPKA 3CJ0A 5DDOC 3T9ZA 4DR6F 4M8LA 6AT1B 1NH8A 1A0OB 3P5BP 4NL5A 3OT9A 1SH3A 4TU8A 3W2WA 5HK4A 5HANA 2YKOA 3CJTA 3CUNA 2WVDA 2WB1D 3K8VA 4DV2F 1TKTA 1PAUB 1CJTA 2OPRA 2DITA 3T5HA 3W65A 5HROB 3KJFB 2HMIA 2G2YA 2LA4A 2IA0A 1SUQB 5ETNA 4RL1A 5K20B 3TP2A 5KFGA 4DLGA 1SBRA 2DKOB 2RKIB 2DGOA 4DL0C 3M32B 2UP1A 4FNHA 4PR6A 2R8KA 1F5BA 1XNQF 5F9NA 2UVWA 1QM9A 3DOLA 3RRHA 4DF4A 1NUEA 3CO0P 5F8IA 3H5XA 3BGLA 3MUMP 1VS3A 1HI8A 1KD1T 3OJSA 2YNGB 2J8SA 2FDNA 3DLEB 1F5CA 1VQ5S 1JWWA 1ITPA 3I0SB 5ETPA 3NGUA 5H9FJ 2H4YB 2XO7A 3PJWA 4IH5A 3FZ2A 4NCGB 2UVUA 4F02A 2PEHA 5AXKA 4HACB 5CZXA 3D4JA 1VRUB 1RB0A 1WHYA 4CTAB 1WG4A 3BR9A 1YZ7A 4GKJF 3PW2A 2Z56B 5IWAJ 1TK5A 1X8DA 3CJ8A 5E3PA 2KVQE 2M3DA 1UFWA 4RPFA 5DETA 2J7WA 1RLCL 2F9DA 3SQGA 1TL7A 4HEA9 5KG4A 1Q81T 4U7UK 1NXIA 4ILLA 4X4RA 4ZN1A 4NPOA 1LWXA 3BBFA 1SUQA 1NHVA 3R1LA 1CULB 5L1LA 1IR1A 1QD1A 2BJ8A 3LGMA 2I8EA 4QZVB 2XMAA 3W8GA 2CNKB 2DNGA 1RA6A 3CDUA 2QTWA 3CMQA 4PG8A 4F3QA 1YI2S 4PWWA 1VBYA 1HHTP 3MAAB 4I0WA 4XDCA 2HQDA 4TLQA 6FDRA 3SYZA 3OR2A 2YQ3A 4WF9Q 4MKBA 3HKWA 4N41A 5DO2A 3A1YG 2XO6A 2GJFA 5E3RA 4QWCA 2YNGA 2NPFA 1UJ5A 3DI6A 4GKKJ 2I1RA 3FBBA 1U8WA 3DC2A 2B9EA 3PKYA 3MMCA 1HMVA 4NCGA 2N4DA 4UZCA 2DR9A 4RWWA 2DH8A 5ETQA 3PNIA 5JVGQ 3CCTA 3VAFA 4JV2A 3TX8A 4ECWA 1VRUA 1MG7A 3RUBL 2B4OA 1RAEB 2JVOA 3SDEA 3GWCA 2RUSA 1GX6A 4ANDA 2W7OA 4U6PA 3OHAA 3ILLA 1FNMA 3T1HF 4Q44A 4AQYJ 4IG0B 2GMHA 2D9OA 1PILA 2EBGA 4GO7X 4KQZA 1AW0A 2V9KA 2VPWB 1FKOB 1XMBA 1CULA 3MWBA 2Q6BA 3HPOA 2DO4A 4ES2A 2CJXB 1CJUA 4P9SA 3GONA 1VC6A 2M0GB 5KG6A 4WTYA 2MY8A 4A47A 3HD1A 2DHGA 2HHVA 3GV8B 5D0RA 2CWKA 2X1AA 3AFGA 4D3GA 4EWTA 1EKRA 3FFIB 3A8EA 4Y00A 4EO6A 2L9NA 1WACA 3ZTQA 1FDDA 4EZ6A 4KIAA 3DLJA 3VAIA 2J9CA 1GMWD 3ZZPA 5A2QY 3M1VB 4KB7A 3LPYA 3FQLA 1X0FA 2J9EA 2E44A 1RTHB 2KJVA 2VBZA 3WIUA 4RR5A 3OD2A 3G8QA 2ASLA 4G1IA 2D3ZA 5LM7E 3K5OA 2J6SA 1GTEA 4OZ1A 2I9SA 2ZH3A 1Z2LA 5IZHA 1D9AA 4IG0A 2HRUA 3MR7A 1H2VZ 5H9EK 3GYNA 3RAXA 3P6YC 1RT7B 2CNLB 2M8HA 1FKOA 2KFYA 3UDLA 1O6XA 1SJ1A 4ZN3A 4DR7F 4ILRA 2M52A 5EUHA 3U1NA 2ZD1B 5MAOA 2ACYA 1TK8A 4EFAC 2BW2A 2VFUA 4FPRA 2LA6A 3RR7A 4NLGA 2GO9A 4MK7A 1HWUA 1H98A 5KOWA 2HG4A 4W98A 4DL5A 2UUBF 1FNOA 4JI5J 4M5NA 2BQRA 3NXZA 5HBMB 3CJRA 4JI0J 2QZ8A 3M1VA 2VD3A 2FQQB 5CYQB 1FD2A 1U6ZA 4AL5A 4OJGA 3NOCA 2KB2A 1WELA 2Y8WA 2B7CB 5B7WA 1S59A 2FHOB 3Q22A 3MUTP 3KLGB 2P8IA 4ERDA 4LBPA 1GK8A 2R9LA 2R7RA 1N5QA 3KG0A 2X3DA 4P73A 1DURA 5A8KA 5JXSA 2Z2LA 2F8MA 4DV1J 2GW8A 2BBEA 3C14A 2VQEJ 2OPPB 4MJKA 5L39A 3KHLA 1C1CB 4LF2A 2ZVSA 1WKJA 2FGOA 4OYIA 3PFOA 4TLRA 2WBRA 5T41A 2WB4A 3EGVA 2CQ2A 4LF5F 3H98A 1RYRA 4QCLA 3I9V9 1N36F 4C0OC 2MTLA 1FX4A 4TY9A 2MLXA 1YK9A 3W60A 3DYAA 5A0YA 1TFWA 4KGVB 1O51A 1Y5NB 4DX8H 2NYIA 4USTA 1TKXB 3JSBA 5KFDA 4U7CA 2CIMA 1PIEA 4LF4F 2FLLA 2XGPA 2ROGA 2C2DA 2AYMA 2JOQA 5CQGA 1NDPA 2GJIA 3GFHA 1HL6A 3PHTA 2QJ3A 4O3QA 3J80U 1RZMA 3D0HE 2UUCF 5CYQA 3HJFA 2P9CA 5D8HB 3M2VA 5HI7A 3D0IE 2E1AA 3UO0A 2NQPA 3I31A 5B09A 2CJKA 4UF4A 5HAOA 1UAWA 5LMNF 1Q78A 3KLGA 3LO3A 4ECUA 1WI8A 3W2VA 3NP5A 3QIPA 5ETKA 3V4IB 1XTZA 2RF2A 1FNXH 2YX4A 2QLWA 5F9LA 3O2IA 4ZHRB 2PMZD 3MEEB 3DKDA 3EICA 2XEXA 3ENQA 4PXBA 2MQ8A 2B56A 2DH9A 2HKEA 3U1MA 1NZAA 3KLVA 3VVUA 4F4WA 4X4PA 3TJ8A 2KT3A 3ZZ0A 1REGX 2XMJA 1I94J 1AA1B 2W8LA 1VFJA 2DJWA 4AD6A 4FBUA 2V50A 4X65F 2XY5A 4NLPA 1NK8A 1TKXA 2DNNA 1WTBA 2ZITA 3D68A 5J2PA 2ALYB 4YOEA 2PT0A 1HBMB 2W4PA 2KTQA 2FC8A 3OFGA 4NLWA 4J90A 2Z8QA 2FYXA 1C4AA 2A3JA 2QA1A 1UVLA 4IG3B 3VVTA 3KHRA 4F50A 3CDWA 2E1CA 3HHNB 3CE8A 3DXSX 4UUXA 4DV7F 1HBNA 1XNQJ 1U1RA 1RWUA 4K0KF 2X3GA 1DQ8A 3UR3C 4ZHRA 1K9MT 1HNWJ 4AXIA 1VHIA 2VBXA 2KJWA 1FK9B 4QJVA 3IN5A 4NI2A 2KXFA 3ENAA 2J9DA 2FJBB 3BGOP 5AT1B 3ZZUA 3K89A 4NCAA 1NJZA 3H0PA 4JV0A 4JI3F 1IJEB 2QLXA 4K5SA 3GFYA 2Z30B 4ANCA 2G1DA 3DRRB 2J0SD 1C0UB 3FRYA 4TU9A 1K47A 1TELA 4GKJJ 4K2XA 4RNMA 3PHEA 1C2PA 1NSPA 2XYPB 4F4AA 3NMRA 3UD5A 2OJ3A 4C98A 3BF4A 3G71S 4HH0A 5DQGA 2DRBA 2HNZA 3V6DA 5I42B 3X3UA 2V5HG 1N5VA 1IBKJ 4GRSA 3EPGA 1F2GA 4DSJA 2KH9A 1SI9A 4IG3A 3M8SA 2D7SA 3GIRA 2FTRA 4WK1A 1PCAA 1TL5A 2HVDA 4M5KA 4C8NA 4DU7A 5HJXA 4IDKA 3NS7B 1AROP 3WIVA 2DBBA 2BRKA 1CJKB 5SZTA 1FK9A 2CKWA 3GSIA 2ZJRQ 4RUAA 4JI2J 1FFGB 1N56A 3UCZP 1SC6A 3BO3A 3NOGA 3T5JA 1WKKA 3CC7S 3SXLA 5BXIA 1S1XA 1L3UA 5E7OB 2LEBA 2GO8A 1Y3KA 4PG7A 4KO0A 2HFNA 3L3CA 4RUHA 1R7IA 1S0MA 4IR9A 1XWLA 4F3MA 1URNA 3HI9A 4CH0S 2Z0GA 3LP1B 2AWZA 4YEAA 3LWMA 1HNVB 4NLVA 3EGZA 3M8PB 3QT7A 4ITSA 3PIPQ 4PXCA 1Y7PA 3R1HA 1HNZF 1B7FA 1EP4B 3HX9A 3HD2A 4HTIA 5GADU 3MM9B 2IVMA 5KFJA 5EX3A 2DISA 2EFNA 2NXEA 3GV5B 3NLCA 5GAEI 1H2UX 3TUPA 1DQAA 2AX0A 4WP9A 4QU6A 3KKFA 4DSFA 1Y4ZB 2JWNA 4OX9J 3C6UB 2CNNB 2H5EA 3QRRA 1J5EF 2PI5A 3TJ9A 3ENVA 4MYUA 3R5GA 2RILA 2RNEA 4DUZJ 2ZFHA 1RHUB 3DMJA 1TR0A 2VUGA 3DLLQ 3MTJA 3Q2TC 2JHEA 1RBAA 1U6FA 3CDBA 5H9EJ 2DGUA 3RRGA 5CABA 2KHDA 2FJVA 2R2TA 1YRTA 2Z2MA 3HT0A 5CCLA 1FHTA 1ZYQA 4DR1J 3PYDA 4RBTA 2GCFA 3GCXP 1U7LA 4RLEA 1FKPA 3BQ2A 1T95A 3BB5A 3M8PA 5DZ7A 3TZWA 3KUHA 4WXWA 3C2PA 1S9FA 4IR1A 2B43A 3LOUA 1VLOA 2KG0A 2PFDA 3PIOQ 1EP4A 5D4NA 3FEZA 3MM9A 4M5DA 1OO0B 1V6HA 2O5DA 5GAGI 1EIYB 3ELHA 4HHJA 1NPRA 1DTTA 3EPIA 3IBWA 2FLNA 4CNZA 2ZUGA 1IM4A 2QMUB 4QYRA 3SBMA 5C42B 3DRPA 1B0VA 1F9EB 3PACA 2VC1A 1M5VC 2LVWA 1HHQA 2VBYA 3AOAA 2CJ9A 4IOBA 1RHRB 4DR7J 3H8YA 4HTJA 3MR6A 2Q43A 4FYXB 4IFVB 3CD5A 4OFZA 3MAQA 4B9LA 2QLFB 4EI2A 3QPIA 5KFMA 1T94A 2MDAA 4I2QA 3AXKA 1Q1KA 4ZLNA 1OYDA 1RWXB 3IS9A 4IKAA 3P96A 3H4BA 2MZQA 2ERRA 2XULA 5LXYA 2M5YA 1D1UA 4ZVRB 1QSSA 1U02A 3CDAA 1WNEA 4LQ9A 5J2NB 4Z2XA 1SIWB 1S6QB 1YRXA 3N0VA 3RG6A 3EZUA 4LFAF 3TANA 5BR8F 4DZ6A 2HZVA 4I69A 2DHXA 2HSEB 4G1QB 1BQXA 2CADA 3PFEA 2HS0A 3RB3A 3Q86A 3TOQA 1NHUA 2F8EX 1VQ4S 4ECZA 4LF8J 2XI2A 2UZAA 4KGXB 3TO8A 2ZH4A 3M7VA 1I6JA 4YDXA 2M70A 4I64A 3TAMB 3G9CA 3T3FA 1JMTA 5C42A 2ROEA 2XZWA 2OPSA 3EDQB 3GG1A 1DRZA 5IT4A 2KM8B 4NLDA 2IAJA 1NDCA 2DK2A 3HFVA 3W3SA 1TL4A 4YS2A 1J27A 3C16B 4IFVA 1UKUA 2W9AA 2K3IA 3R5AA 2EEYA 3HFKA 1VISA 4O4GB 1NKEA 4JV1A 2H51B 3UN3A 1GTHA 3HF5A 1NMEB 3QATA 2NR0A 2L48A 4C3LA 4B08A 3DGPB 3EMTA 4JI6J 2ZOGA 5KFQA 2PMHA 2JNJA 4CLSA 4M5JA 1S6QA 1TKZA 1G6BA 2V2KA 2BANB 1KLNA 1IN0A 2GHVC 1ZBTA 2BJ3A 3Q8UA 5F8MA 2EK6A 3RJMB 4IRDA 2LXFA 1FJ7A 1SC4B 1QUPA 3KJQB 2MKYA 2M88A 1JK9B 3PDNA 1ZH5A 3GJQB 2HQCA 2DY9A 4GVLA 3PX4A 2KT2A 1LWCA 4Q2LA 3K8WA 4OHVA 3VAGA 4DDFA 4OHYA 1VQNS 2ZUAA 1RAOA 4U7UD 1QY7A 1U0SA 4YN3B 1U1NA 3LWLA 2DPJA 1BUXA 2QN6B 3G6VA 5BYSA 4DX6A 2VBWA 3MXHP 3OSPA 4YB5A 1VRTA 4X65J 2BJ7A 1EARA 2FJAB 3C16A 2EFPA 1BD6A 1BMQB 2AKWB 1W7WA 2H3EB 3OXLA 2G2OA 4DFMA 2CG8A 2EC0A 1IKWB 2V67A 5KFVA 3TA1A 1D8YA 4OYBA 2BACA 3NS5A 1X4EA 3H2LA 2BKPA 1M1GA 1KQFB 3R27A 2HAFA 4OI6A 1U1LA 4JI8J 5BYRA 3A4TA 3TAPA 4C7QA 3DHXA 5AE2A 3HSZA 5C2GA 2XQCA 1IJFB 4F36A 2M8DB 1MWYA 4YY3F 2BANA 3ADAC 1TL3A 1F6TA 5DGAA 3J80Y 5E5NA 5EDWA 5AXMA 2VA3A 3MDFA 1RTDA 3TARA 3MEDA 5CHCB 4TY8A 4EBDA 5IQQA 3M8RA 2B9YA 1FRXA 3VGVA 1AUSL 2IM0A 2YWGA 3HHLB 4ZJLA 2H9ZA 4JYAJ 2IFXA 1Q86T 4CLUA 4L72B 2W8KA 2C2ZB 2LECA 1U6BA 5D3GA 1RAHB 2GQ2A 2IC3B 4DPUA 2VPZB 3KK1A 1UPPA 3CJKB 3FVYA 1XC9A 3Q8VA 4B3RF 2QO3A 3D6HB 5E33A 1KWMA 2IRUA 2VIHA 3QMQA 1S1UA 2BM0A 4ATNA 4CM2A 4ETXA 1RAJA 3I0RA 3P49B 4LBHA 1K0VA 1MROA 4KY3A 2RRBA 1U1QA 1CVJA 3LW5C 2P9EA 3TVZA 3QT8A 2KHCA 5C24A 2OKQA 4PZVA 2FVCA 1X4HA 7FDRA 3SI8A 2X7IA 1YJWS 3EGNA 1FRKA 3EM1A 4O3NA 1NKCA 3QAEA 1FJGJ 1FEEA 4B3SF 2DXFA 3G6XA 4MTPA 2YH0A 3QJJA 1TUVA 1IKVB 2VB6A 1CJVA 1SIZA 2XBPA 3GPAA 2ZH7A 5D4LA 3AD8C 1NO8A 4RO0A 4K7QA 3SIPB 1Y3JA 2VONA 3HHLA 4G65A 1HW9A 2GC8A 4X64J 2YNIB 1CS4B 4P10A 5RUBA 2RT3A 1U48A 4X4QA 4BCAA 4XPEA 4JP8A 3JSMA 4DX5A 3DOKB 2W4CA 1NDKA 1N32F 2IC3A 4E8UA 3R2DJ 3MAHA 4OYAA 2UU9J 3H2VE 3TUJC 4USHA 3DLBA 5IT9U 2PE8A 2C2NA 4B9NA 1Y00A 3CJKA 2JL9A 2X1BA 4HKQA 1KOHA 2PI4A 4Y2KA 4PUOA 3D6FB 2VV5A 1BLUA 3MCSA 3KYLA 3G4SS 2H4WB 5IXUA 2BQ3A 5DZ6A 5KFLA 3BGRA 3KHHA 4PKDB 3G86A 2GMLA 3ITHB 1TL1B 5F8HA 2HHHF 2MJNA 4Y34A 3OFHA 2HQGA 4J9LA 4LREA 2CPJA 2BV3A 3N5FA 4LT6A 4BLGA 3DDNA 3M6XA 4DV6F 1IVZA 4PG4A 1S7IA 3A8IA 1Y11A 3ZZYA 1IKVA 4URSA 1WKLA 3NMAA 5DDRC 4WU3A 2CA9A 2X51A 2AJ0A 4KJIA 2WSEC 3AJ2A 4DR3J 3G87A 3UR0A 2IHR1 1OWXA 1RT2B 2HWHA 5F8NA 4J9QA 5EHHA 2HS4A 1EQ0A 3DOKA 1ELOA 4FN5A 1SJFA 1QE1A 2OFHX 4ZPAA 5A8WB 1HD0A 5JJBA 3GYGA 2J6UA 2DNHA 2EC2A 3QSYB 3AHPA 3PYGA 3J7YU 4PRFA 1HA1A 4CYUB 1MN7A 3SV3A 2LU1A 1VQYA 2KKHA 4K4YA 2LDIA 1TL1A 1HNXJ 2PA8D 1RT1A 1FDAA 3OR1B 1X4FA 4USJC 4OV1A 2VG6A 2JZ5A 2WHOA 5B0EA 2KU7A 2AGPA 3CJQA 1NK7A 3GFZA 3MEGB 2GHPA 3V6HA 1BY9A 4RW8B 3QWPA 1QVGR 4KV8B 3VAMA 3EVWA 5KT3A 2ZC3A 4KBIA 4Y28C 3VALA 4UOHA 2R2UA 1PYSB 1IM6A 1Q5YA 4R0JA 3VGTA 1RHJB 1U2CA 3UNYA 4C0HA 3IRWP 2BM1A 1VQ9S 1RT2A 1NHKL 1IKXB 3PEHA 2RIJA 4KR0B 1S4EA 3V6JA 4ZLLA 1PYOB 1T0TV 2BYCA 3M6VA 3X1LB 2QMXA 2NS1B 4NXNJ 4R8UB 5A8WA 4RUBA 2HHUA 1HQUA 2VG5A 2QL9B 1WF2A 1N5TA 1EAYC 1RUSA 1VRQC 3I32A 3HVRA 1RTIA 2OELA 2RAQA 4CYUA 3AJ1A 3DLKB 1B7YB 3BPSP 4JI1J 3SZ2A 2UXDF 2B5JB 4MMOA 2RMLA 3KDNA 1CQNA 1XNRJ 3TZYA 1VIXA 2MQPA 3NNCA 4YHHF 2YKNB 3OL7A 4LSLB 4O3PA 4QIFA 4WWSA 3EWGA 4P2FA 3OR1A 4DQRA 3Q23A 5IFMA 4NXMJ 1X0PA 1AUDA 2JFKA 1H7WA 4DFJA 4OX8A 3MEGA 2AJ2A 4CP5A 4GVBB 1UTAA 4FPIA 3I55S 3CNQP 2JJ4D 3DHWC 1JKHB 4QIWD 1HARA 3TYTA 2NPIA 4ZVFA 2KI2A 5B0DA 4KC5A 1FXRA 1IKXA 2R7SA 3MR5A 9RUBA 3DCAA 3PYEA 1S6PB 2AYGA 2DYAA 4JI7F 4R8UA 3RZAA 1T8EA 1NK6A 1M0SA 1D3WA 3C46A 4RW9B 4CIOA 3H59A 4U8YA 1TV6A 1Z1ZA 3T19A 1EETB 2GNKA 3TI0A 1N0UA 4EUVA 4LF6J 2B6AB 3DLKA 1WHVA 2D3UA 4OYOA 4NE9C 2B5JA 4ZVPB 3H42A 1UA0A 2JEGA 2VKZG 3Q8PB 4ZLJA 1H73A 2YKNA 4LSLA 2M2BA 1F0XA 3P3DA 2KN4A 1RYSA 5LJ3Y 3KJVA 1FESA 1SKRA 3UI3A 4LIRA 1UEUA 2HHXA 3IWLA 2WVFA 2GHWA 1E6VB 4O3SA 3BQ1A 3CPWR 2AW0A 3IFEA 3UVJB 3NY0A 3IXQA 5J2QB 1S0NA 1JKHA 5D0EA 1AFIA 1JLBA 3M30B 4I67A 5FDLA 1NKBA 4B3OB 5F0WA 3VGUA 3RW7A 4Q7AA 1Z4UA 1SL0A 4YUDA 1S6PA 2IJRA 1G1XA 1SB6A 1YZ6A 2RHQB 4LSZB 5DLFA 4X4SA 4UQGA 4M5LA 4YY3J 4QR1A 1NJXA 3FMBA 3G8TA 2ZZTA 1HYSB 3CF5Q 4I7FA 2C42A 3NAHA 1BQNB 3I6PA 2CQPA 4AE5A 2ZDPA 2NZCA 3W66A 4WJBA 1R0AB 4DSKA 2EPIA 2B6AA 1G4CA 4C8ZA 1FD8A 4FXDA 2W2OP 1V5VA 3BPDA 4MT1A 2B7BB 2JDJA 1JJCB 3NCQA 2A1BA 4PWDA 3S01A 2BOAA 4J9NA 1KEKA 3EZOA 2CJYB 4ZP7A 4DUTA 5KG3A 5GAHI 1S9EA 2YWWA 1KKHA 1SH0A 2H5IB 3LF0A 4X4OA 4DR4F 3TVYA 3UQSA 2HHQA 4HLBA 2AZ3A 4DEZA 2MMYA 4IH6A 2PEBA 3CEDA 4Q8EA 1VC0A 1DTQA 1F9HA 2VPXB 3UVJA 4PCQA 4UOFA 4RNHA 1CC7A 3C8YA 1PBUA 3SCIE 4B9TA 4NA3A 2V4JB 2LEAA 1MLAA 3GR0A 4S0MA 1C4CA 4YMEA 4ALZA 2CQBA 3DLHA 2WONA 2ZH5A 4G3IA 4NMXA 2LQJA 2O66A 2RVJA 3BEGB 4ZVTB 1U1MA 2ZJQQ 3T1YJ 1HQEB 1TUWA 2BABA 5J1EB 3R7BB 4HT7A 1S72S 1QVFR 3D7SB 3VQTA 4Y2IA 2YKAA 2UXCJ 1UW4A 1BQNA 5G4DA 3JS9A 3VAHA 3CCSS 4N77A 4HDHA 2E1MC 2XB2D 4FXWA 2AEJA 2QV6A 2LQ8A 3KNAA 2H5JB 2LDYA 2F63A 2DGXA 1VGYA 1J2VA 1UJ6A 1JLGB 3HCXA 1Q0NA 2YPYA 2AIRB 2YQ1A 2G1HA 4F0HA 2HFUA 4DHVA 3SCJE 2BVZA 5HLFA 4NX9A 5E0OA 1HWKA 1OY9A 4ZCIA 4AL6A 2K1RA 4JOUA 3CWJA 3QZ7A 4ECXA 4IYQA 4EBCA 4PQAA 5AE3A 3N28A 5B0CA 4J9PA 2OIHA 4DV3F 2CQ3A 3UDVA 4Y2MA 2J7UA 3W9JA 2HLTA 2O67A 2BA9A 3O1LA 2QLBB 3U27A 2YKMA 3U1LA 2MXYA 2CPHA 2I6WA 2Z58B 2DIUA 5IQ6A 1V5IB 1F5AA 5HVGA 1RLDA 4YR3A 1IBMJ 4ED7A 1W2BR 5J2MB 3GR1A 4A48A 1LK5A 4ECRA 2ACMA 3D1OA 1C1BA 5J1PA 4H4OA 2IY5B 1HQEA 1W26A 1KQGB 2HHHJ 5J1EA 2KO1A 3BKTA 4OYWA 4X66F 3EZ5A 1MU2A 1PYTA 2DR7A 2GV1A 2MLZA 1B0PA 1RWMB 2CFXA 1LFPA 2VF3A 2MGZB 1HI1A 2ZE2B 3HP6A 1WEXA 2BE7D 3D6MB 4DL3A 3FDSA 2KYXA 3QGHA 1NK9A 3CCRS 3M2UB 2ABYA 3F0NA 4USMA 3G82B 1YLXA 5CCMA 4ZA1A 2QSWA 3QFHA 4ZIWA 3KWMA 3IRXB 3QIDA 4RW6B 2OH2A 1UEKA 4FF1A 2AJQA 2IPOB 3GMGA 2G0IA 5AXLA 4K4TA 2DCLA 3GZ7A 4OI1A 4K8RA 1VK8A 4OQJA 2QFJA 3VGSA 4XO0A 3LPEA 1F9FA 4DX7A 4MIAA 2HLUA 4X4VA 1W25A 2HWTA 2CPZA 4DR5J 3FBFA 1HWIA 2FVSA 4CH7A 3UFCX 3K58A 2MY7A 5IT9Y 4NEZA 3G6YA 1JNZB 1TZ0A 2DRAA 2R42A 4EYIB 2UVRA 3MMBA 1HPZA 3D3CJ 3IBFB 1JB0C 4Z7CA 2RDIA 3TQ1A 2GVZB 5HMWA 1TAUA 4Q5VA 2BUNA 4YFUA 1P1TA 3E01A 2DNMA 2MEWA 4P6QA 4DUYJ 2DR6A 4I1TA 2D1CA 2CPEA 1HBUB 4X4NA 1H3DA 4P52A 4RNOA 2R7XA 2AYBA 2OAUA 1AXQA 1MMLA 3FJ2A 2LQBA 1CSJA 5KFCA 3MECA 1S7HA 3HULA 2G4BA 4PXDA 1OMSA 5C25B 2BR0A 2LYVA 2D3OR 2LXIA 2DHSA 2A0FB 4NLXA 2VFRA 2EG2A 4UOCA 4DQSA 3ETMA 4A8SA 3HDSA 3S1TA 3WHIA 1HLWA 4WFXA 1BQMA 1VC5A 4F2RA 1JLFA 3DU6A 4F7VA 3C6TA 3IR6B 5GVQA 1SKSA 3IG1B 1A6LA 4KKOB 2CVEA 2LCWA 2QT7A 3F56A 3KJNB 4O44A 1SQEA 3SV4A 4A8FA 4WK3A 3EXYA 2PIIA 1WDTA 1RA7A 2MPUA 3MF5A 5AJ3F 3KUGA 3LP2A 1NDLA 3SFUA 4CNYA 3OXFA 2GVZA 3K57A 1YJVA 4NA1A 2BE9B 2RE1A 4DV4F 3SQOP 2Q3PA 3J7AN 2XSJB 1HBUA 4WFZA 4DBQA 5E41A 3GLJA 4J9KA 4KGMA 2E9ZA 5JMNA 1V3SA 3KOAA 1M5OC 2BW7A 1N33F 3CD0A 5DJBA 1OYEA 2CQCA 4CLLA 5C25A 4OJ3A 2UUWA 4WP3A 2V63A 4AUKA 3D9BA 1LWEB 1X4GA 1OQ6A 2F4FA 2F4VJ 3WQPA 4R5PA 2I2YA 2DGWA 2V4RA 4DV0J 5IS2A 2QYGA 1VDHA 3BR8A 1KRPA 5M2RA 2UXBJ 4JI4J 3IWNC 1R0BG 3TZXA 4LF7F 3FCHA 1YJ9S 5ETOA 2W7PA 1LWFB 4DXLA 3MPUB 4LQ3A 2P9GA 1NCLA 3SCLE 4K5RA 1TKTB 3W61A 2WK4A 3MHYA 3H90A 2OPRB 1S1TA 3AB2B 2Q1LA 4B3MJ 2HMIB 1IBLJ 1YJUA 5K5MA 4WFBQ 3QT5A 3GIJA 2XHWA 3OTOF 4WFYA 1HQ2A 3IR7B 5K8OA 4FVMA 4WKRA 1KFSA 3DOLB 2HZAA 3NRBA 3HM9A 1QAXA 2OMLA 3N01A 3JQJA 4WYLA 4C0BA 4NYZA 2AP6A 4MH8A 4EO8A 4USVA 3MFIA 3ILOA 2G0JA 5E3AA 1HKAA 2R7QA 4G6VB 2XG8A 3RAQA 1MWQA 2CQ0A 2WVCA 3BKUA 3LQVA 5KFRA 1RJJA 4QBUA 5I3PA 5GMEA 3GTYX 4OLPA 2C28A 4DQIA 4DL4A 3IMQJ 2CYYA 2I38A 1SKUB 2N3OA 2W01A 1VCTA 2YWKA 5JUMA 2BKNA 4CM0A 3GG0A 1RABB 2HVEA 1Y0HA 1LWFA 2W9BB 2MZSA 2B4UA 4EYHB 4J9UE 5F8LA 3FGVA 2P6SA 3DU5A 2B51A 3HXMA 5CAAA 4FNIA 4ECQA 2HFSA 4IO9Q 3C15A 4WCEQ 4HT5A 2GGPB 3PCOB 2VC0A 1RDRA 2LFVA 3SQGB 4LFBF 2BE2A 1TL7B 1XR6A 1UVNA 1CPZA 1HR0J 5KFBA 4QWBA 3NKYA 1F1BB 4AFFA 3BGUA 1UJ4A 2R2RA 4FYDA 4IQXA 1WSRA 4KHPJ 3L4BC 1B0TA 2R3VA 4UUWA 3TEGA 2BQUA 1KTVA 5L8RC 4ZIVA 2Z4PA 3CMES 1VQLS 2AMCB 2HZCA 1V3ZA 3NWRA 1OPIA 4QIEA 3ZNJ1 2C3UA 2A2CA 2EFGA 1L3TA 2RU9A 4HYKA 4CCHA 4O3OA 3OR2B 3D1QA 5DQIA 3PYFA 3ONQA 4MKAA 2LU2A 2V2ZA 4ZCLA 3DI6B 1UFKA 2XZTB 2MJUA 2ASJA 1P9QC 1TQLA 2AGOA 3MMCB 1HMVB 2HW3A 2W1BA 4L75A 3D3BJ 2NUHA 3Q89A 4CLYA 1S77D 1JXLA 4C3KA 2OI2A 2W9BA 5KOXA 4I6YA 3A13A 3SDEB 2CAJA 2AZ1A 1N34J 2GGPA 3MM7A 4Y3CA 1JIHA 3R3TA 3HHKA 4CRJA 3E2EA 4P71A 2DRDA 1SL1A 1ZA2B 1J5OA 4LRDA 1FERA 1VQOS 2VH7A 1PSDA 2MQLA 3QNWB 4HH1A 2BX6A 3M8QA 5KFYA 1QTNB 4J9RA 3GE9A 3LH2S 1CJUB 2BZ2A 3C66A 4TNOA 2BJ9A 3D67A 3TUIC 1NH7A 3HSDA 3ILJA 1RBOB 2B3TB 3M9NB 2ILYA 2ZM6F 3HSGA 1APSA 4ED3A 3SSSA 1MSWD 2XYGB 4NYOA 1ZETA 3WC0A 3GP9A 4ED6A 2XLKA 1U45A 1FE0A 5HQLA 2XNRA 3FEXB 3MFHA 4KGZB 1RKIA 4DSLA 2E5GA 1TK0A 3VQSA 4LRAA 4BC9A 3HKZD 2POKA 2QA4S 1FRLA 2R7UA 2IMOA 4P72A 3ZXWA 1NJIT 5CH7B 4HDGA 1XMQJ 4DJBA 2MSTA 2IVYA 1S1WB 1TUGB 4EBEA 2E5LF 2DGVA 2C1EB 3QFWA 5LJ5Y 1DY3A 4A4JA 2UV8A 5DM7Q 4RBVA 3MPWA 3PJ9A 4YB7A 1X4DA 3R7SB 2JSXA 5EWGA 1P1LA 2Y0SD 1LEOA 4F26A 3B6BA 4QIGA 4NLTA 3MM5B 2KRBA 3BSAA 4C8LA 4BC7A 1QLNA 2N3LA 2K7JA 1ZM2A 3DM2A 4CLFA 2ZKTA 2FHJA 2OO4A 2YQ0A 2VQFF 3I4HX 1RE1B 1WC1A 2R7TA 3UPFA 3HO1A 4XTTA 3ICLA 2CQGA 1RWKB 4L3KA 2V69A 5HQ8A 2MZTA 3MM8A 3OW2R 2CZ9A 2V6AA 3KG4A 1NBEB 3QJLA 1T9WA 4YDDB 2EWHA 1GX5A 1FI4A 2JEIA 3OJUA 1FT8A 2KFZA 3PO5A 5A6WA 2UVVA 4QW8A 1KQSR 3WZ0A 2JC1A 2OLWA 5LXRA 5A8KB 2E29A 1S1WA 2ZJPQ 4PYAA 1IBCB 1URRA 4JV5F 3B78A 3W62A 2C2OB 2ZOMA 1IXKA 3C14B 3CVKA 3JSRA 4B3TF 1YBTA 3LAMA 4P7VA 5C2CA 4YP3A 1T05B 2HK3A 1JJ4A 2RS2A 1RT4B 4Y2CA 5B08A 4H54A 1M5HA 4LRFA 3H7HB 3MM5A 1PJ6A 3U02A 4A8QA 4OYXA 3T9NA 2W2QP 2OEMA 2NLWA 5KFEA 3DYAB 4C11B 5A0YB 4QW9A 1OIAA 1FJEB 2DNOA 3QJPA 4FBTA 4W90B 3J7ZT 1FO1A 1KVJA 2MQOA 3B54A 5T7LB 2AHOB 2E7WA 1JX4A 3GJSB 4WU2A 2IYGA 1PJ5A 1K1SA 4OI3A 3QLHA 1GFWB 3A3OB 1KTQA 2GMJA 3HVTA 1XERA 5ETVA 4IFYB 3MGJA 3K7RA 4NMLA 1QSLA 5DM6Q 2EBEA 4OI2A 4M5IA 4FF4A 3M2VB 1OJ4A 1KSPA 2YH1A 1BE4A 4TXSA 4LFCJ 5C5JA 3W2VB 1WI6A 2GQQA 4O3RA 3T1AA 3D54A 3QIPB 4WYWA 2RF2B 1E6YA 5HVHA 1OS5A 5D6GA 1T3OA 3A3NB 3SCKE 4ZPTR 4H4MA 1ZM3A 3OTCA 4N8OA 3G96A 3W9IA 3CDEA 4V19X 2IM1A 2GAGC 1T05A 2AJFE 1UCNA 2BDPA 4LRCA 2NSBA 1RT4A 3SSRA 1KC8T 4FYYB 2BJ1A 1AZSA 3M6UA 1L3VA 5KFXA 4YR0A 1XN9A 3CJSA 4ZPCA 4ES1A 1HNIB 4UT4A 2HBYB 2WOMB 3RB6A 4C11A 2RRNA 4WIIA 3W63A 1MMNA 4F3OA 2YX7A 5ETTA 4E2FB 5T7LA 4F4KA 4J91A 5J2PB 1Q79A 2AD9A 4ZVOB 4TYAA 1O0PA 2XMUA 2PGCA 4ZVEA 2BXJA 1RU2A 4X62J 4IFYA 2XYHB 3QAUA 3VHQA 4LVOP 4DR2J 1NSQA 1S9GA 3ISND 4I6AA 2HHTA 1HBNB 4ZKAA 2H1YA 4W4MA 3W7BA 1XMOJ 1H2TZ 2Y8YA 1WOOA 3PW0A 1OQ3A 4OL8A 2XMWA 4NI2B 3J7A1 5THWA 4P7TA 1VQ7S 3FBCA 2Y9HA 3TJAA 4EK2A 1FEHA 4V1Ak 2XNQA 1WTFA 3PO4A 3P5TL 2ZNYA 3M8ZA 1HNIA 2KXNB 4Q2MA 2WOMA 2L41A 5A76A 4DR6J 2C3PA 3T41A 5C7PA 2ZDOA 2ZZMA 1FJCA 4ED4A 3GILA 3BBBA 4IOAQ 4F0MA 4AQYF 5CYJA 2K06A 4DV2J 5E3CA 3A8KA 2HNZB 3V6DB 4H4KC 3JTNA 4GO5X 3JQMA 2HQ3A 4CO4A 4N47A 1WORA 1OY8A 4YR2A 3NGTA 4KGKA 1RT6A 1UPMB 1WC6A 3IP0A 2DNRA 2XCPA 1WHXA 2MLYA 2J7KA 2B9WA 4IDKB 5KFIA 5DRKA 4DSEA 1ACMB 1R6YA 4LSNA 4DCPB 3ZTOA 2ZHOA 5LMUF 3M9OB 4OZNA 3BQ0A 2IVFB 2SXLA 2IA6A 4MFBB 4KE5A 2QL7B 1KN6A 1LOUA 1ZM9A 4K4ZA 4F67A 3IGVA 4DL7A 1KFDA 1YG0A 2EFQA 4K50A 1S1XB 2J5AA 4KO0B 4EZ9A 5CXTA 4CLKA 3CC4S 2R4FA 1GMWA 1LV5A 3AOCA 1B4SA 2C3OA 4USKA 1XJWB 2HGLA 4UZBA 1NPPA 4FF3A 2RH3A 4F4ZA 3PW4A 3FSIA 3V6KA 2IRXA 1EKSA 1HI0P 1VLYA 1X7VA 4OYPA 3HHDA 2GZOA 2DGQA 4FDFA 4WKYA 2YWFA 1IWAA 5M2UA 2DXDA 2W9CA 2ADBA 3WX8A 1EX8A 2OMOA 5L9NA 4I2PB 2PO4A 4CLWA 3W5YA 2IM2A 4IUFA 4ZVHA 2VICA 3RBXA 2HK2A 3QSIA 1CQMA 2XZDB 4Z37A 3CCJS 1QJHA 4DU8A 3DMJB 3DNCA 2PN6A 2EKYA 4MFBA 3CCVS 1DJ0A 4JI5F 4P2MA 4TKTA 2WVEA 2XWXA 1HD1A 2WAQD 2HGMA 5GAEU 3T6JA 1HW8A 4LRBA 4DQQA 1S6OA 1CBKA 3L7UA 1RWPB 2J0XA 4C3MA 1C0TA 2DGSA 5F3ZA 1GXUA 5BYQA 1WC3A 1FKPB 3QRQA 3CO9A 4IO1A 3BSOA 2OEKA 1DAXA 2EFVA 4DV1F 1S49A 2CQHA 2U1AA 2VQEF 2EG1A 3JYTB 2W7AA 4M5DB 3DRXA 2ZHBA 3KLFA 4E98A 3PRDA 3T1HJ 2HAIA 1DTTB 5K14B 2AU0A 2XS7A 4ZPVR 3R6GB 2OTLS 3AA9A 2E1RA 4JBCA 4FS2A 3DRPB 4A8MP 4KFBA 3T6BA 4I2PA 1M1HA 2ZOFA 3MD1A 2F7VA 1NPKA 1DLOB 3KLEA 1YQHA 4M5MA 4URGA 1RHQB 1Q8KA 4I2QB 2F40A 4UTGA 4BDPA 1KONA 3AA8A 3BSNA 3IS9B 4DL6A 3B82A 4AL7A 3S6EA 3V4MA 3NG8A 1ZZNA 5E3QA 1ZTWA 2VL1A 4M95A 3BDPA 3Q0AA 2R8GA 1RWWB 1F60B 3NNAA 4PG5A 2MQMA 1CLFA 1ZZFA 2MKJA 1Q8BA 2FVQA 4QWAA 4Z7YA 1QSYA 1AT1B 4LR7A 1K44A 1JLCA 4AYBD 5KFWA 3EDRB 5ETSA 4RU9A 3QT6A 4XPCA 4NLSA 3JYTA 3FBEA 1RT5B 3DLGB 3N5BA 4WXOA 3UE2A 4DS5A 3I56S 5K14A 2RU3A 1HIYA 2Y1IA 1LW2A 1AFJA 2I5JB 3MCNA 2UUAF 5BJRA 1I94F 1WOPA 2OPSB 3HSJA 1U1KA 2PA3A 4NOHA 1OSDA 3MM6B 3CCUS 2J76E 1DLOA 4F0KA 4P2XA 2IAJB 5LSRA 1UWBB 1TP7A 1N6QA 2ASDA 4M63A 2X1FA 2D41A 1FE4A 1HHSA 2OD4A 4FKYA 2DR5A 1S76D 1WUUA 3RGIA 2VDIA 3UD3P 1IQZA 3H5UA 3NBPA 2UUBJ 5HMZA 2C2KB 3O6QA 2VFTA 4NLUA 2YY3A 2ZZNA 2P6TA 2V34A 2HRTA 3CJ4A 2PFFB 1NAQA 5DDPC 4RWXA 1H72C 1TKZB 3PG9A 4Q8FA 1HNWF 3AODA 1WJ9A 2J0WA 4ICLA 5ETLA 1O5JA 4FP9A 2IDEA 2R7OA 1RQ0A 3VAKA 3BH7B 1R0CB 4O0IA 1D09B 1RT5A 2BRLA 2BKOA 3DLGA 2RD5C 1LWCB 3N6LA 5HQMA 1ZA1B 3SSQA 4ECSA 1D8ZA 4A8WA 1N54B 2D69A 4OZ2A 4O23A 1R43A 2I5JA 4LF5J 2RQMA 3PW7A 1NK0A 2HGNA 3LTOA 1N36J 2E1PA 2EVZA 4R25A 3MM6A 2FZKB 2KYZA 5HP1B 5KAKA 1RCXB 1UWBA 1VRTB 4RU2A 3CIMA 2O1PA 4LF4J 4FYVB 5U47A 3HFZB 1X9MA 4N7TA 2GQCA 5HROA 1WG1A 1IBKF 2GVDB 4DSIA 3ZC4A 1RWOB 5HMYA 2IJNA 1XK8A 2AQ4A 1X9WA 3N6NA 2UUCJ 2C2EA 2RKIA 2ZH6A 3BS9A 3CTRA 3M32A 3PW5A 3RR8A 1QTMA 4L74A 1UZHA 4ECTA 5LMNJ 1TL3B 1KOOA 4WBFA 3Q8YA 3L95X 3GB0A 1S1VB 3BV8A 3W9HA 2H65B 3M8WA 5KG2A 1UVMA 4DPTA 3OXGA 1RTDB 3MEDB 4QR2A 4JI2F 4TY8B 1T9XA 2ZH8A 4OJHA 3IAS9 4R0EA 1S79A 3DLEA 4OZJA 5HATA 2A6OA 3GFXA 3I0SA 4E0DA 1OSCA 3I96A 1RAAB 3G2XA 3MUVP 3ULHA 1U2FA 1SJ4P 5D3GB 4L6V3 4PAAA 4HACA 2GJ2A 4CTAA 5LL6d 3L09A 4OZ0A 5HP1A 2ZVIA 2YTCA 4F4YA 2DEJA 2JC0A 5HO4A 3KK1B 2CG4A 2ZWPA 3FRZA 3TEHB 5IOLA 2VA2A 2QRRA 1S1UB 1VIOA 2MKIA 3I0RB 1MROB 4PXEA 5F8GA 4F8RA 2GVDA 2B4VA 4ZDNA 3QGIA 2VKRA 4LIWA 4AXJA 5K8MA 5I3UB 5C24B 1RK8A 3M6WA 5KFFA 4OX9F 2BJEA 3QYYA 2GX8A 1WC0A 3GU0A 1FA0A 3M8YA 4NZ0A 1KQKA 4IRCA 1YJRA 3ET6B 4DV7J 3NGDA 2Q79A 4B9VA 1K73T 4P2SA 4DUZF 3PX0A 1S1VA 2WSFC 1ICEB 3RBDA 4XDDA 1UVIA 4K0KJ 2RUGA 2G9OA 3V5RA 2GFFA 3MAAA 1CJVB 2J0QD 1X5PA 3IC1A 5LMUJ 1UW9A 2DR8A 2QE5A 2OGUA 3Q8QB 3GIMA 2WW8A 4MKYA 2V68A 3H40A 3CC2S 4CQ1A 3G8SA 2HYIB 4DR1F 4DPXA 2QMWA 3JSMB 5D77A 2XSFA 4C97A 4JI3J 3RW6A 2IRYA 4M5GA 1IUJA 2CPDA 2X1GA 3TNVA 2DO0A 4A46A 4KAIA 5E2QA 4U67Q 4N56A 1RSCA 2DNZA 4B17A 4PUOB 3GCWP 4OI0A 2WSCC 4EMDA 1AB8A 4NWBA 3BGRB 5I3UA 5D4OA 2ZBIA 3R9LA 2QX0A 3GYXB 1NEEA 2CQIA 4DOZA 1B64A 2LEPA 4HL9A 3ET6A 2YBVA 2ZNZA 2J6TA 2HQIA 1D0EA 4OYMA 3T5LA 2AV5A 3F44A 3I5BA 2QL5B 2DY1A 2RRAA 3BYRA 3FFIA 3JB9k 4DN0A 3BBCA 2JLEA 4D3HA 1X4AA 1KHWA 1VMBA 3AQOA 3CCLS 3AJDA 1UFLA 3EVOA 1FXLA 1WF0A 1JXEA 3OFFA 1MWZA 1UVKA 3ZO7A 2XHCA 1UA1A 1XR7A 5CZVA 1RTHA 3L9ZA 4DN9A 1QE1B 1VQSA 1BC6A 3PTWA 3HLUA 3DRSB 3ZZRA 4WFNQ 2LKZA 3H2UB 4RNNA 1GAOA 3L7OA 4KPYA 2ZH9A 3R8YA 2RSQA 1DQ9A 1XEZA 5HVFA 1HNZJ 2YX1A 2LXUA 4LF8F 2HWIA 3LANA 1EZZB 3DRYA 3IO1A 3AD7C 2A2DA 1U0HB 3CIZA 3BO4A 2AEMA 1NLKL 4LF9F 2AGQA 2RQKA 1CG2A 4DPWA 3PY8A 4ETZA 4J7CA 3Q83A 1VOMA 3H20A 1U8SA 1RT7A 2OD6A 1RT1B 3L7PA 4ECVA 3UNGC 1PO6A 4DFKA 4UQTA 3JQKA 3K5MA 2VG6B 1J5EJ 2NYHA 2ZD1A 2MSSA 4RW7B 3I4PA 1QAIA 3OUYB 3VZHA 4B9MA 2ADCA 2C2MB 3F41A 3DFEA 5HBMA 3KG1A 3OTBA 2E7VA 5KT4A 2J8AA 3C19A 2JVRA 1RAIB 2HHSA 4JI6F 1Y9OA 3JSYA 2Q6CA 3IAM9 1BHNA 1P6TA 4WFAQ 9ATCB 3VWSA 3HK2A 1REVB 3LGHA 3ZFVA 3DRSA 1JXVA 1X4CA 1HQUB 2IDLA 4PG6A 5CD4A 4ZVGA 1TMMA 2VG5B 3JTPA 4NLYA 5ADZA 2V0NA 1S12A 2YXLA 1H7XA 1Q16B 3M4XA 1F3FA 1RTIB 2OPPA 2ATCB 4L76A 1C1CA 1U0HA 3M9MB 1R8HA 3J81j 1DARA 1VHFA 2MQQA 3LAKA 1S0VA 1DBDA 4P74A 4DPOA 1TMJA 1X5TA 2UUAJ 2E5IA 2EW9A 4KYZA 4LF1A 1GH8A 4OJ1A 1SKWA 3NGKA 4ID8A 2W2PP 3QGGA 4J9OA 1X9SA 2QFIA 4RW7A 5IV4A 2C2RA 2HQFA 2BMBA 4C8OA 2E9TA 2O01C 5D15A 3OUYA 4XAKA 1R31A 3B4DA 1I51B 2Y0BB 2KZMA 2VJVA 1S5ZA 3B8HA 3EX7B 3EUNA 2ZHAA 4GC6A 1LXJA 4JI8F 1NRKA 4JUZA 1ZPWX 5IV3A 3IA0A 5HSPA 4TVAB 4KSEB 4F04B 1TKDA 2LQ9A 2HVZA 2DVIA 4ES3A 1REVA 5KT5A 1BWVA 4CO1A 3N6MA 1IWGA 3ETOA 2DEIA 4OHXA 1R8AA 3RB0A 3V4IA 1JQGA 4LFAJ 1BXNA 3HVAA 5BR8J 3J7Z5 3MEEA 1TV6B 1TTHB 2DPIA 2PSZA 4C6AA 4TU7A 4L73A 2F9JA 4ECYA 4WP8A 2QLJB 5LSLA 4JYAF 4UY8T 1JNRB 2K2PA 1YJ7A 3E8OA 3D0GE 5IC6B 4CH1A 2GAHC 3R6LB 1N48A 1SC3B 2D74B 3PXGa 4ZJQA 3M2RB 3CD7A 3ZNUA 3S8SA 3KJVB 1RBLA 4QWEA 2W24A 4ZPDA 1R8BA 1SQFA 4URQU 3HMJG 1Y5LB 2D9PA 3I5CA 1PAEX 3POTB 1G2EA 1HBMA 1WDDA 3Q2SC 3OLAA 1JLBB 3N79A 3E51A 1R3NA 5FDLB 4ELTA 4ED8A 1EQMA 2BOPA 3ILIA 4EEYA 4OX7A 2VJUA 5DQHA 4C8KA 1FWLA 2I0XA 3OLBA 2NREA 4U95A 2DIVA 2RQ4A 3SMZA 2CWXA 4DFPA 2Y1LB 5IT0A 4NYPA 1M5SA 1FJGF 2CQ1A 4FKXA 4F25A 2V8PA 3HZGA 5KG7A 1YRUA 3RRKA 3GJTB 2FVRA 1JLQB 4I7FB 3CXCR 4ZP8A 3ISNC 4ER8A 2N4CA 2WRMA 4ZCMA 2IM3A 4LUBA 1V9OA 4MAKA 4C2MA 1RKJA 2W4DA 3ZTPA 3U7JA 2ILZA 2C3MA 3HJVA 4GMKA 3B4MA 4X64F 4PWDB 4C48A 2KZZA 3BH6B 3ZZOA 3CCMS 4MYTA 2APOA 1S9EB 2Z2ZA 3VZIA 3MPVA 2UU9F 3DRRA 5LSOA 3M2RA 1WEZA 1C0UA 3LGNA 2C3YA 4Q45A 5F3TA 3PV8A 4QWDA 2L08A 2CPXA 1UWAA 4OHWA 1IKYB 3POTA 2ZBRA 4DV5F 1DTQB 3AT1B 1LK7A 4NEYA 4I68A 5KFAA 2QA2A 4PQUB 3MPDA 5I42A 4MKVA 5DGBA 1UETA 2WONB 3ISZA 5KT6A 5GAHU 3UN2A 5KT7A 3V81B 3NL0A 2DCUB 2AF6A 2VODA 3P8BB 2F3JA 5T14A 5EGYA 4M94A 3RB4A 1JLQA 1CJKA 1H38A 3W8PA 3PVXA 1NJYA 3GQCA 1D9DA 2FJEB 1EB0A 5B0GA 5GADI 4DR3F 2FHKA 3TX0A 1RP5A 1N8RT 1SH2A 2VU5A 2E66A 2XCAA 2EXUA 2UUTA 2B9XA 4AT1B 3OFEA 1ULRA 5DDQC 5KG0A 3EJMA 2ASYA 4OX6A 3OTEA 3BSCA 5G0RB 2OSQA 1VJWA 3HHEA 5HLFB 2VZ9A 4HHUA 3LP1A 2K1RB 1HNVA 2V2VA 4A8OA 2Z57B 7FD1A 1IKYA 3FNNA 3TA2A 4B3RJ 4HHHA 3V2UC 1K0TA 1LNQA 1Q82T 4PQUA 1A7GE 2YKMB 1FDNA 2DHAA 2CDQA 1KVIA 1HNXF 1XQIA 2PC6A 2HS3A 3V81A 1C1BB 4H4OB 3C6UA 5KG5A 1M5PC 3O5TB 5AE1A 1MU2B 1RWVB 5FJ4A 1X60A 2E9RX 3NCRA 4B3SJ 3HHLD 3D5MA 2ATLA 2IJFA 4NLOA 5H1SV 2HVHA 2KT5A 1VBXA 1NSKL 1U24A 4W92B 3FC9A 1UMJA 2H54B 4XK8C 1M5KC 2YWEA 5DS7A 4RUCA 3NWGA 2XI3A 4CLPA 5CYMB 2MKCA 2F65A 1OY6A 4NXNF 2W25A 1ZOTA 4M1KA 1RTZA 5G0RA 3H25A 2FJDB 4A8XA 3D6TB 1N32J 3HZEA 3IBCB 4I56A 2DB1A 2WBMA 3RAMA 4DCOB 2W2MP 4Q0BB 4WZMA 3JTOA 1FX2A 4HVZA 2KG1A 2HBZB 4JI1F
chains in the Genus database with same CATH topology
3ZTSA 1MN7A 1NUEA 2DYAA 2B8QA 3NGTA 5CABA 1XQIA 3VGUA 1UCNA 2ZUAA 2HVEA 2DXFA 2NCKL 1NCLA 3EVMA 2DXDA 4UOFA 3ZTRA 3GP9A 3NGRA 1K44A 4HR2A 1NDCA 1NSPA 4F4AA 3VGVA 2B8PA 3ZTPA 4KPCA 4O0NA 3DDIA 1B99A 4DI6A 3GPAA 3WX8A 5IOLA 5CAAA 1BUXA 3FCWA 4S0MA 3Q89A 3VVTA 3ZTOA 3BH6B 3FBEA 1S57A 3VGSA 3NGSA 3B54A 1ZS6A 2VU5A 1WKLA 1WKJA 3FBCA 1S5ZA 3NGUA 1BHNA 1VYAA 3DKDA 4EK2A 1MN9A 3EICA 1NSKL 1PAEX 3ETMA 2CWKA 4WBFA 1W7WA 1KDNA 2AZ1A 3Q8YA 1HIYA 3BH7B 3EJMA 3FC9A 1HLWA 1NPKA 1JXVA 2HVDA 3EMTA 3PRVA 3FBBA 1NDKA 2BEFA 3FBFA 3EVWA 1U8WA 3ZTQA 4DZ6A 1NB2A 3JS9A 3Q8VA 3EE3A 1PKUA 3R9LA 3VVUA 3ELHA 1NLKL 4UOHA 1XIQA 5C7PA 1F3FA 2HURA 3Q86A 3VGTA 3PJ9A 1BE4A 1B4SA 3ENAA 4CP5A 4W98A 3L7UA 2BX6A 3Q83A 3Q8UA 3BBBA 2DXEA 1NHKL 1LEOA 3MPDA 4ENOA 4DUTA 3B6BA 4F36A 3G2XA 1EHWA 1F6TA 4FKYA 1HHQA 4FKXA 4ANDA 1WKKA 1NDPA 1NSQA 4C6AA 2DY9A 1LWXA 5BXIA 3BBFA 3FKBA 1NDLA 4ANCA 3FCVA 3BBCA 1S59A 2AZ3A 4ANEA 4UOGA 3EVOA 3EM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTS A;  1MN7 A;  1NUE A;  2DYA A;  2B8Q A;  3NGT A;  5CAB A;  1XQI A;  3VGU A;  1UCN A;  2ZUA A;  2HVE A;  2DXF A;  2NCK L;  1NCL A;  3EVM A;  2DXD A;  4UOF A;  3ZTR A;  3GP9 A;  3NGR A;  1K44 A;  4HR2 A;  1NDC A;  1NSP A;  4F4A A;  3VGV A;  2B8P A;  3ZTP A;  4KPC A;  4O0N A;  3DDI A;  1B99 A;  4DI6 A;  3GPA A;  3WX8 A;  5IOL A;  5CAA A;  1BUX A;  3FCW A;  4S0M A;  3Q89 A;  3VVT A;  3ZTO A;  3BH6 B;  3FBE A;  1S57 A;  3VGS A;  3NGS A;  3B54 A;  1ZS6 A;  2VU5 A;  1WKL A;  1WKJ A;  3FBC A;  1S5Z A;  3NGU A;  1BHN A;  1VYA A;  3DKD A;  4EK2 A;  1MN9 A;  3EIC A;  1NSK L;  1PAE X;  3ETM A;  2CWK A;  4WBF A;  1W7W A;  1KDN A;  2AZ1 A;  3Q8Y A;  1HIY A;  3BH7 B;  3EJM A;  3FC9 A;  1HLW A;  1NPK A;  1JXV A;  2HVD A;  3EMT A;  3PRV A;  3FBB A;  1NDK A;  2BEF A;  3FBF A;  3EVW A;  1U8W A;  3ZTQ A;  4DZ6 A;  1NB2 A;  3JS9 A;  3Q8V A;  3EE3 A;  1PKU A;  3R9L A;  3VVU A;  3ELH A;  1NLK L;  4UOH A;  1XIQ A;  5C7P A;  1F3F A;  2HUR A;  3Q86 A;  3VGT A;  3PJ9 A;  1BE4 A;  1B4S A;  3ENA A;  4CP5 A;  4W98 A;  3L7U A;  2BX6 A;  3Q83 A;  3Q8U A;  3BBB A;  2DXE A;  1NHK L;  1LEO A;  3MPD A;  4ENO A;  4DUT A;  3B6B A;  4F36 A;  3G2X A;  1EHW A;  1F6T A;  4FKY A;  1HHQ A;  4FKX A;  4AND A;  1WKK A;  1NDP A;  1NSQ A;  4C6A A;  2DY9 A;  1LWX A;  5BXI A;  3BBF A;  3FKB A;  1NDL A;  4ANC A;  3FCV A;  3BBC A;  1S59 A;  2AZ3 A;  4ANE A;  4UOG A;  3EVO A;  3EM1 A; 
#chains in the Genus database with same CATH topology
 1A9N B;  2G0C A;  2AT1 B;  2ZWO A;  5K8P A;  4N76 A;  2ZH2 A;  1XNR F;  3IGN A;  4LF9 J;  3KMQ A;  4PPD A;  5CA5 A;  1GNK A;  4O0N A;  1YJT A;  4NRT A;  4EU0 A;  4CT9 A;  1X5S A;  3AXM A;  4ZCK A;  3MMB B;  2XY7 A;  3MTK A;  1HPZ B;  3J81 U;  4QPT A;  4NXM F;  2GA7 A;  2FGC A;  3W5Z A;  1K1Q A;  4A8Y A;  4NA2 A;  3K0J A;  1Q95 G;  4NLQ A;  5EWF A;  4DV6 J;  1N4L A;  3E01 B;  2VOP A;  2NUU G;  3SEO A;  4MIB A;  4DF8 A;  1TAQ A;  1T11 A;  4FXV A;  1TVR B;  1IR2 A;  2K3K A;  2MHN A;  3AQP A;  3MEC B;  5DLG A;  1FXD A;  1VBK A;  2WZ1 A;  4TQR A;  4CLZ A;  4K4U A;  4DPY A;  5CYM A;  5J2N A;  2XMV A;  3BKF A;  1PBA A;  1TU0 B;  5MLC V;  2JEJ A;  4QR0 A;  3FQK A;  1RGV A;  3ZZT A;  4ZOS A;  4YQW A;  1Q8L A;  3DXB A;  7AT1 B;  2CJB A;  4ED1 A;  4Q0B A;  3DN9 A;  3OBI A;  1BQM B;  4G1Q A;  3VV2 B;  3MR3 A;  1JLF B;  4U8V A;  4LF6 F;  4J37 A;  4B02 A;  3C6T B;  2U2F A;  1V3R A;  2DTJ A;  3UN5 A;  1SQG A;  3OTD A;  4ZP9 A;  3LP0 B;  4KTQ A;  4O44 B;  3TAM A;  3T5K A;  5B0F A;  4ZVQ B;  3CSK A;  2XWY A;  1FKA F;  5EWE A;  3LP2 B;  2FVP A;  8AT1 B;  2CPF A;  2L3M A;  2XLJ A;  2V8G A;  3QGP A;  3QWU A;  2JH3 A;  3UWT A;  2RDD A;  1GMU A;  2CDR B;  4O4G A;  4ED0 A;  4TYB A;  3IM8 A;  1R6V A;  2LP4 A;  1TVR A;  2VFS A;  3MPY A;  5IM0 B;  1VQ8 S;  2E5J A;  3OSN A;  2L9D A;  2EFO A;  1GQE A;  4PYD A;  1U4B A;  3DGP A;  1P27 B;  1YBA A;  1NU4 A;  3ZTS A;  5HJY A;  4Y2A A;  2GIQ A;  2A10 A;  1JLA B;  4LR9 A;  2XS2 A;  2CUY A;  2WTF A;  1NND A;  3OVS A;  4CLT A;  2KVI A;  3IM9 A;  2HFO A;  2DHH A;  4R5P B;  1PGZ A;  8RUC A;  2Y1J A;  1T3N A;  2N7C A;  1T02 A;  1F2H A;  5IC4 B;  4BHQ A;  4OLO A;  4I4B A;  3FZB A;  2OFG X;  3QQC D;  3TRG A;  5L1K A;  2UXD J;  1AYE A;  3LP0 A;  2BEF A;  4IH7 A;  1WHW A;  5DG9 A;  4YHH J;  2YPZ A;  5HN0 A;  1WC4 A;  1WOS A;  4RX6 A;  3EXC X;  1S1T B;  1FF2 A;  3TUZ C;  2GIF A;  3EYZ A;  3H5S A;  3AH6 A;  4H4K A;  2XMT A;  5KFH A;  2HHP A;  2XC9 A;  2HPU A;  3BGF A;  3BO2 A;  1IKW A;  2HND B;  4RNF A;  2ZBP A;  1ROF A;  1T9Y A;  4BWJ A;  1FTR A;  1WD6 A;  5IM0 A;  2Z2Y B;  1VQP S;  2FIU A;  2FD2 A;  2XMK A;  4ZPB A;  1YX2 A;  3T1Y F;  3FCW A;  4CZC A;  1DFD A;  4JI7 J;  4K4X A;  1S57 A;  1JLA A;  2UXC F;  3THP A;  2B0G A;  3CUL A;  4ELU A;  1D9F A;  1MN9 A;  5FLX U;  1MW7 A;  1XR5 A;  1WF1 A;  3GJR B;  5FD1 A;  4J9V A;  4FS1 A;  3PRV A;  1KS2 A;  3OQ2 A;  2MKK A;  3CJ5 A;  1N52 B;  1FFS B;  4QIV A;  1YVF A;  2HIY A;  3UCG A;  2R7W A;  3C15 B;  2EI5 A;  2FLP A;  1N5Y B;  4K2J A;  3AOB A;  2R8H A;  4LR8 A;  4CT8 A;  1WEY A;  2BE2 B;  1FWP A;  1H6K X;  1SVD A;  3PKM A;  5LT5 A;  1FRI A;  3NS6 A;  3A12 A;  2AJ1 A;  1VQM S;  1RIS A;  4KHM A;  1GXL A;  4UW2 A;  4ZMM A;  4LJM A;  3CGI A;  2XLI A;  4DV5 J;  2HND A;  2Q66 A;  1ZPV A;  3KHG A;  3UCU P;  5M2P A;  2B8P A;  1YBU A;  3HVW A;  4TN2 A;  4LVN P;  3FEY B;  3NNH A;  3KXD A;  1IBM F;  3MOJ B;  3OL9 A;  4N8N A;  1ZS6 A;  3DOM B;  3BM7 A;  3FSX A;  3QZ8 A;  2HIQ A;  1MNE A;  4PAB A;  2YNH B;  1T9U A;  3MOZ A;  4C4W A;  1UZD A;  1WSV A;  3P4U B;  2YNF B;  4J9S A;  2DH7 A;  5A8R B;  1SC1 B;  3US5 A;  4OZ3 A;  2XS5 A;  3CMA S;  3K5P A;  2G2Z A;  1BGX T;  1M1K T;  2V8V A;  2E7X A;  2ZEJ A;  4WTO B;  3Q8S B;  1OPZ A;  2ROP A;  2YNI A;  1CS4 A;  5F0U A;  2VOO A;  1UL3 A;  1UVJ A;  1FRM A;  3MM7 B;  1N5Y A;  2DNQ A;  3MZI A;  2J9D E;  4DR4 J;  4ZPW R;  3NGR A;  3HT3 A;  3WDO A;  2HVI A;  1J5O B;  4KPC A;  2VG7 B;  2VFV A;  2KDO A;  5KTQ A;  1FVQ A;  1H0H B;  1Q7Y T;  3WBZ A;  4DR5 F;  2HFV A;  3D28 A;  3M8Q B;  1X5O A;  2JRS A;  1N88 A;  2NXC A;  4J5O A;  2AYE A;  1KDN A;  4OIX A;  4QU7 A;  3RTV A;  1R8P A;  3ITH A;  1RAG B;  3DOM A;  1LXN A;  1FDB A;  2LQ5 A;  1EJ7 L;  1IR0 A;  1GXT A;  3RBE A;  2XMM A;  3GIK A;  4ZJO A;  3THT A;  4KT0 C;  2VPY B;  3R97 A;  2YNH A;  3JAM U;  2PD1 A;  3BDE A;  4QOT A;  4YB6 A;  3S7R A;  2N82 B;  4EGL A;  3KNG A;  1RAF B;  5K8N A;  2JLG A;  3A8J A;  3H4D A;  5D0G A;  1GEH A;  2YNF A;  4DUY F;  3J7Y I;  3LUY A;  1O8B A;  5A8R A;  1QAJ A;  3W64 A;  2ZBC A;  2A6M A;  4KH1 B;  3QRP A;  1RU1 A;  5A6P A;  4Y6I A;  5KFO A;  4QYZ K;  3FCV A;  4ELV A;  1G7C B;  5AXN A;  5KFZ A;  4FZV A;  3W1Y C;  2NZ4 A;  4K4S A;  4ID5 B;  5L46 A;  3MUR P;  4CO0 A;  2ALZ A;  2RB7 A;  3AAW B;  2PMW A;  2VG7 A;  2ZC4 A;  5F41 A;  2QIF A;  4X2B A;  3C3L A;  4DV3 J;  5L1I A;  1RHK B;  4FYW B;  1DZ5 A;  3OV7 A;  2XM3 A;  4ZLP A;  2QSF A;  3DM2 B;  2R8I A;  3OHB A;  4MK8 A;  2NXJ A;  2Y3Y A;  1ZM4 A;  2FJW A;  1X31 C;  3EGW B;  5KFT A;  4KRW A;  3BJY A;  8ATC B;  3KLH B;  3O8W A;  1Y10 A;  2DXE A;  4LMZ A;  5HMX A;  2DD8 S;  1S10 A;  3CCE S;  2F1F A;  1PJ7 A;  3K59 A;  4DQP A;  1CC8 A;  1EHW A;  2A18 A;  2V8D A;  2FJX A;  1R8C A;  3MM8 B;  4X66 J;  1K8A T;  1S97 A;  3MMJ A;  2HRY A;  2NSC A;  3ENW A;  4RW8 A;  4KV8 A;  3NCP A;  1QUV A;  3F73 A;  3TVK A;  4UOG A;  3JXO A;  3D66 A;  3BRE A;  2V8H A;  1RAC B;  3TA0 A;  2NCK L;  4RZR A;  2YKP A;  2M7S A;  3D2W A;  2YWH A;  4OYZ A;  4HI1 A;  2CRL A;  1L5U A;  3NGS A;  2OHD A;  2V4Q A;  5D4P A;  2D3O 1;  1KHV A;  2MZR A;  2FC9 A;  4ID5 A;  4PEO A;  2F4V F;  1WWH A;  4DV0 F;  1FTC A;  2HFZ A;  2OPQ B;  3MR2 A;  2DNK A;  4F4X A;  2UXB F;  4JI4 F;  4OZ5 A;  3OL8 A;  3P45 B;  3UD4 P;  4NCB A;  5KFP A;  2HUR A;  1L3S A;  3CB4 A;  1YKW A;  1RT3 B;  4YB1 P;  4RKU C;  3OVB A;  3VF0 B;  3Q24 A;  4OHZ A;  2ZBQ A;  5L38 A;  4RW4 B;  4DLE A;  4B9S A;  3KLH A;  2MYF A;  1YDL A;  3MCO A;  1KP6 A;  3FKB A;  2OUG A;  4RJV A;  1I1G A;  1Y5I B;  5ETR A;  3QLH B;  4DS4 A;  2LLZ A;  4B3M F;  1JLE B;  3HVT B;  3BN4 A;  2IBO A;  1Q8I A;  2LMI A;  4GVB A;  5FII A;  1IBL F;  3MEK A;  2CNO B;  1B99 A;  4DI6 A;  2ZKU A;  3FK4 A;  4NRU A;  5KFS A;  3K5N A;  2ZH1 A;  3J81 Y;  5D0H A;  3NEK A;  2AEF A;  1S99 A;  2BJD A;  1JJH A;  3O44 A;  3MMA B;  1E6Y B;  2V9W A;  2CZ4 A;  3PX6 A;  4H4M B;  3M05 A;  3AD9 C;  3PRB A;  4NLR A;  1QDU B;  1N0V C;  2Y1R I;  4ED5 A;  5B0A A;  2XY6 A;  3EE3 A;  3D1H A;  5K9F A;  3IR5 B;  4RW9 A;  5D78 A;  2OPQ A;  5J1N A;  5KFU A;  3R5C A;  1EET A;  1AZS B;  4ED2 A;  2H48 B;  4J9M A;  1LQ9 A;  1U09 A;  2DT9 A;  1RT3 A;  3VAJ A;  2V94 A;  4PPZ A;  5HL7 Q;  3GSD A;  4CO5 A;  1ZAW A;  3GII A;  2AJ4 A;  3W5X A;  3IWX A;  4RBU A;  4RW4 A;  3MD3 A;  2DNL A;  2GIR A;  2PDA A;  1JJ2 R;  1PC5 A;  3N4W A;  3ZTR A;  2E5H A;  2DNY A;  5AJ3 J;  2OTJ S;  5I4M A;  3R5D A;  1S48 A;  4USU A;  1Z2Z A;  1HR0 F;  2DGT A;  2RQC A;  3OVA A;  1KLM B;  1JLE A;  1P8G A;  4WPA A;  2IMW P;  3O3L A;  4WE1 B;  4DL2 A;  1XBW A;  1E6V A;  4Y0F A;  4DV4 J;  2CJQ A;  1NJW A;  4KHP F;  4P75 A;  5J2Q A;  1Q4R A;  3M30 A;  3AB4 B;  3MCM A;  1S9G B;  1KNZ A;  4B3O A;  4UY8 5;  3MMA A;  1RI7 A;  2R2S A;  1N33 J;  2R8J A;  3LA0 A;  4NZ6 A;  3CJ2 A;  1VJQ A;  4DWI A;  1VQK S;  2VHG A;  2WCX A;  2AX1 A;  1S6U A;  4G1P A;  1VI7 A;  4I6W A;  2XTJ P;  2QG9 B;  1HYS A;  3UDE A;  1U2R A;  3DDK A;  3E3X A;  1R0A A;  4L3N A;  4OV6 A;  2HNY B;  4XIU A;  5EX0 A;  2JLF A;  4K4V A;  2RJZ A;  4QPX A;  1YJN S;  4K59 A;  4Y65 A;  4ZP6 A;  3WC2 A;  5IWA F;  4LF7 J;  4CO3 A;  1WG5 A;  4WIQ A;  4CWB A;  1N34 F;  2CJA A;  1FRH A;  4O4R A;  1FCA A;  1RCO B;  2KM8 C;  4WZQ A;  1R89 A;  2B4P A;  2FLO A;  2JFD A;  2F5G A;  3AY0 A;  1KLM A;  4U9R A;  1VYA A;  2MQN A;  1GT8 A;  1VR6 A;  5I3Q A;  4WE1 A;  3RBZ A;  1H74 A;  3KMS A;  4BBY A;  1SJQ A;  1UEV A;  2JEF A;  2CVI A;  4Q43 A;  5B0B A;  1RXO B;  2P2C B;  3TQE A;  2V4J A;  3KDO A;  1RT6 B;  2O3D A;  5H9F K;  3OTO J;  2QA4 G;  1LKZ A;  5A2Q U;  3TR5 A;  4TQS A;  1NB7 A;  1F3V A;  2CZV C;  3UW1 A;  5F8J A;  4LSN B;  1HWL A;  1U49 A;  1S0O A;  3I82 A;  2KL8 A;  2NXU A;  2MKS A;  3R7N B;  3NAI A;  1T9T A;  2K8G A;  1P9Y A;  5KG1 A;  1U1P A;  3KK3 B;  2QC3 A;  4GKK F;  1NK4 A;  2HNY A;  4CO2 A;  1T03 B;  4PWU A;  4U96 A;  4DMZ A;  1ZAV A;  2KFN A;  3LAL A;  2UV8 G;  1FRJ A;  4HI2 A;  1G3O A;  2W2N P;  1FWK A;  1SV5 B;  1XMQ F;  1JLG A;  1HFE L;  3CJ3 A;  3PJX A;  4OI4 A;  3PZP A;  2HBQ B;  5FLX Y;  4IOC Q;  1BWE A;  3THV A;  3KUE A;  2DNP A;  3MI7 X;  4LFB J;  3GV7 B;  4USI A;  1T7P A;  1VK3 A;  1PKU A;  4C9D A;  4ZK7 M;  2WVB A;  3CCZ A;  2CPY A;  4QYZ J;  5KFK A;  1VBZ A;  4IRK A;  2W9C B;  3WX4 A;  2QYC A;  1YSJ A;  3FMW A;  3FSY A;  4OMF G;  4X4U A;  2KRR A;  3QO9 B;  3DGV A;  2HEK A;  4C8M A;  3QBC A;  5J2M A;  1SL2 A;  4CI0 B;  4V19 J;  1RTJ B;  2G13 A;  1SXL A;  4ANE A;  5L9X A;  2RHS B;  1LFW A;  2B8Q A;  4MIW A;  3G6E S;  2MZJ A;  4DZD A;  2OSR A;  2FZC B;  2L9W A;  2CPI A;  2VDH A;  3KK3 A;  1CEZ A;  2MGZ A;  3I87 A;  2CQD A;  2ZE2 A;  3ZZZ A;  3KLI B;  4NAS A;  3VCD A;  1YGY A;  4DG1 B;  4CDI A;  1T03 A;  3M2U A;  4BWM A;  5GMD A;  2FUG 9;  1C0T B;  3G82 A;  3PR5 B;  2V2Q A;  2MHE A;  3HHL C;  1RWN B;  1LW0 B;  1HBO B;  3KTQ A;  2HHW A;  2FY1 A;  1T9V A;  1SV5 A;  1NZ8 A;  3KK2 B;  2C22 A;  3Q8R B;  3IRX A;  4RW6 A;  4ZVU B;  4C8Y A;  1Q5V A;  1N5S A;  2K7K A;  2MB0 B;  4N5S A;  3I9Z A;  5CD4 H;  1Q53 A;  4ZVS B;  3KLF B;  2QEX S;  4ENO A;  3TW0 A;  4MK9 A;  4DCJ B;  4ILM A;  1GMV A;  4K4W A;  5KT2 A;  4FF2 A;  4KFB B;  2FY8 A;  2EKN A;  2CXE A;  2IIH A;  3QO9 A;  4IQM A;  3PR4 A;  3H5Y A;  1L3K A;  3KLE B;  1RTJ A;  1UP1 A;  4HR2 A;  1I3O B;  1KBR A;  3KFW X;  1SJ3 P;  1SJR A;  4OZL A;  3RYL A;  2ZM6 J;  2VAS A;  2QGF B;  2IYI A;  4M5H A;  5DG8 A;  3K17 A;  4JI0 F;  1YIT S;  2FHM A;  1HWJ A;  2WW4 A;  1R27 B;  3PM9 A;  3KLI A;  1YIJ S;  4DG1 A;  4QQB A;  1B3T A;  3TZZ A;  1U47 A;  4LFC F;  3TAQ A;  3CT9 A;  1ZTT A;  2OP5 A;  1NSA A;  2N7Y A;  1W2I A;  2JX2 A;  1LW0 A;  1HBO A;  2OEJ A;  3JAM Y;  1QAY A;  3KK2 A;  1JLC B;  2FB0 A;  3VTI A;  1IQT A;  4F2S A;  2RDJ A;  3N9U C;  5LOQ A;  2E5L J;  2RS8 A;  1I5O B;  3UDC A;  1YTY A;  4JB8 B;  2IBK A;  1FFW B;  3R2C J;  1M90 T;  5KFN A;  1SCJ B;  4X4T A;  2YKQ A;  3TWZ A;  2FHJ D;  6FD1 A;  2MZ1 A;  3IG1 A;  1LW2 B;  4NZ7 A;  3R5B A;  2P5V A;  5JVH Q;  3CD6 S;  3EVM A;  4KKO A;  2COL A;  3K5L A;  1TFY A;  3DDI A;  1MMD A;  5EN1 A;  1KVK A;  4KHR A;  3R5J B;  1N6Q B;  2VQF J;  3W2W B;  3PEJ A;  1X4B A;  2GS8 A;  2EK1 A;  3A3P B;  4FVC A;  1U25 A;  4ZIT A;  4USW A;  2KXH A;  1CJT B;  5GAG U;  1S4F A;  3FUY A;  4X62 F;  3I5A A;  3NBP B;  2FPH X;  5L1J A;  1KR4 A;  3CCQ S;  2HBR B;  1PC4 A;  5SUH A;  1NB2 A;  3SFG A;  3VR1 A;  1RAD B;  2XSJ A;  1B70 B;  4DR2 F;  1XIQ A;  4KH0 B;  1NM2 A;  2M9K A;  1SPB P;  2R7V A;  3BYP A;  2YVS A;  1RHM B;  1XMO F;  1FVS A;  1YWX A;  2XGQ A;  2CQ4 A;  1ZAX A;  4ZS6 A;  3RU0 A;  5ITH A;  4LBI A;  4GC7 A;  1DHM A;  2FZG B;  3K2Y A;  4ICL B;  4A8K A;  2MKH A;  4B9U A;  2NXN A;  3CW2 C;  1LWE A;  4X84 A;  1U1O A;  4JV5 J;  5DG7 A;  4BS2 A;  5GMK a;  2F8H A;  4B3T J;  3BZQ A;  1VQ6 S;  1WC5 A;  3OL6 A;  3BN7 A;  1U26 A;  1Q7L B;  5ETM A;  1NK5 A;  1PG5 B;  1YHQ S;  3CCW A;  2M4M A;  3OPK A;  3CJ0 A;  5DDO C;  3T9Z A;  4DR6 F;  4M8L A;  6AT1 B;  1NH8 A;  1A0O B;  3P5B P;  4NL5 A;  3OT9 A;  1SH3 A;  4TU8 A;  3W2W A;  5HK4 A;  5HAN A;  2YKO A;  3CJT A;  3CUN A;  2WVD A;  2WB1 D;  3K8V A;  4DV2 F;  1TKT A;  1PAU B;  1CJT A;  2OPR A;  2DIT A;  3T5H A;  3W65 A;  5HRO B;  3KJF B;  2HMI A;  2G2Y A;  2LA4 A;  2IA0 A;  1SUQ B;  5ETN A;  4RL1 A;  5K20 B;  3TP2 A;  5KFG A;  4DLG A;  1SBR A;  2DKO B;  2RKI B;  2DGO A;  4DL0 C;  3M32 B;  2UP1 A;  4FNH A;  4PR6 A;  2R8K A;  1F5B A;  1XNQ F;  5F9N A;  2UVW A;  1QM9 A;  3DOL A;  3RRH A;  4DF4 A;  1NUE A;  3CO0 P;  5F8I A;  3H5X A;  3BGL A;  3MUM P;  1VS3 A;  1HI8 A;  1KD1 T;  3OJS A;  2YNG B;  2J8S A;  2FDN A;  3DLE B;  1F5C A;  1VQ5 S;  1JWW A;  1ITP A;  3I0S B;  5ETP A;  3NGU A;  5H9F J;  2H4Y B;  2XO7 A;  3PJW A;  4IH5 A;  3FZ2 A;  4NCG B;  2UVU A;  4F02 A;  2PEH A;  5AXK A;  4HAC B;  5CZX A;  3D4J A;  1VRU B;  1RB0 A;  1WHY A;  4CTA B;  1WG4 A;  3BR9 A;  1YZ7 A;  4GKJ F;  3PW2 A;  2Z56 B;  5IWA J;  1TK5 A;  1X8D A;  3CJ8 A;  5E3P A;  2KVQ E;  2M3D A;  1UFW A;  4RPF A;  5DET A;  2J7W A;  1RLC L;  2F9D A;  3SQG A;  1TL7 A;  4HEA 9;  5KG4 A;  1Q81 T;  4U7U K;  1NXI A;  4ILL A;  4X4R A;  4ZN1 A;  4NPO A;  1LWX A;  3BBF A;  1SUQ A;  1NHV A;  3R1L A;  1CUL B;  5L1L A;  1IR1 A;  1QD1 A;  2BJ8 A;  3LGM A;  2I8E A;  4QZV B;  2XMA A;  3W8G A;  2CNK B;  2DNG A;  1RA6 A;  3CDU A;  2QTW A;  3CMQ A;  4PG8 A;  4F3Q A;  1YI2 S;  4PWW A;  1VBY A;  1HHT P;  3MAA B;  4I0W A;  4XDC A;  2HQD A;  4TLQ A;  6FDR A;  3SYZ A;  3OR2 A;  2YQ3 A;  4WF9 Q;  4MKB A;  3HKW A;  4N41 A;  5DO2 A;  3A1Y G;  2XO6 A;  2GJF A;  5E3R A;  4QWC A;  2YNG A;  2NPF A;  1UJ5 A;  3DI6 A;  4GKK J;  2I1R A;  3FBB A;  1U8W A;  3DC2 A;  2B9E A;  3PKY A;  3MMC A;  1HMV A;  4NCG A;  2N4D A;  4UZC A;  2DR9 A;  4RWW A;  2DH8 A;  5ETQ A;  3PNI A;  5JVG Q;  3CCT A;  3VAF A;  4JV2 A;  3TX8 A;  4ECW A;  1VRU A;  1MG7 A;  3RUB L;  2B4O A;  1RAE B;  2JVO A;  3SDE A;  3GWC A;  2RUS A;  1GX6 A;  4AND A;  2W7O A;  4U6P A;  3OHA A;  3ILL A;  1FNM A;  3T1H F;  4Q44 A;  4AQY J;  4IG0 B;  2GMH A;  2D9O A;  1PIL A;  2EBG A;  4GO7 X;  4KQZ A;  1AW0 A;  2V9K A;  2VPW B;  1FKO B;  1XMB A;  1CUL A;  3MWB A;  2Q6B A;  3HPO A;  2DO4 A;  4ES2 A;  2CJX B;  1CJU A;  4P9S A;  3GON A;  1VC6 A;  2M0G B;  5KG6 A;  4WTY A;  2MY8 A;  4A47 A;  3HD1 A;  2DHG A;  2HHV A;  3GV8 B;  5D0R A;  2CWK A;  2X1A A;  3AFG A;  4D3G A;  4EWT A;  1EKR A;  3FFI B;  3A8E A;  4Y00 A;  4EO6 A;  2L9N A;  1WAC A;  3ZTQ A;  1FDD A;  4EZ6 A;  4KIA A;  3DLJ A;  3VAI A;  2J9C A;  1GMW D;  3ZZP A;  5A2Q Y;  3M1V B;  4KB7 A;  3LPY A;  3FQL A;  1X0F A;  2J9E A;  2E44 A;  1RTH B;  2KJV A;  2VBZ A;  3WIU A;  4RR5 A;  3OD2 A;  3G8Q A;  2ASL A;  4G1I A;  2D3Z A;  5LM7 E;  3K5O A;  2J6S A;  1GTE A;  4OZ1 A;  2I9S A;  2ZH3 A;  1Z2L A;  5IZH A;  1D9A A;  4IG0 A;  2HRU A;  3MR7 A;  1H2V Z;  5H9E K;  3GYN A;  3RAX A;  3P6Y C;  1RT7 B;  2CNL B;  2M8H A;  1FKO A;  2KFY A;  3UDL A;  1O6X A;  1SJ1 A;  4ZN3 A;  4DR7 F;  4ILR A;  2M52 A;  5EUH A;  3U1N A;  2ZD1 B;  5MAO A;  2ACY A;  1TK8 A;  4EFA C;  2BW2 A;  2VFU A;  4FPR A;  2LA6 A;  3RR7 A;  4NLG A;  2GO9 A;  4MK7 A;  1HWU A;  1H98 A;  5KOW A;  2HG4 A;  4W98 A;  4DL5 A;  2UUB F;  1FNO A;  4JI5 J;  4M5N A;  2BQR A;  3NXZ A;  5HBM B;  3CJR A;  4JI0 J;  2QZ8 A;  3M1V A;  2VD3 A;  2FQQ B;  5CYQ B;  1FD2 A;  1U6Z A;  4AL5 A;  4OJG A;  3NOC A;  2KB2 A;  1WEL A;  2Y8W A;  2B7C B;  5B7W A;  1S59 A;  2FHO B;  3Q22 A;  3MUT P;  3KLG B;  2P8I A;  4ERD A;  4LBP A;  1GK8 A;  2R9L A;  2R7R A;  1N5Q A;  3KG0 A;  2X3D A;  4P73 A;  1DUR A;  5A8K A;  5JXS A;  2Z2L A;  2F8M A;  4DV1 J;  2GW8 A;  2BBE A;  3C14 A;  2VQE J;  2OPP B;  4MJK A;  5L39 A;  3KHL A;  1C1C B;  4LF2 A;  2ZVS A;  1WKJ A;  2FGO A;  4OYI A;  3PFO A;  4TLR A;  2WBR A;  5T41 A;  2WB4 A;  3EGV A;  2CQ2 A;  4LF5 F;  3H98 A;  1RYR A;  4QCL A;  3I9V 9;  1N36 F;  4C0O C;  2MTL A;  1FX4 A;  4TY9 A;  2MLX A;  1YK9 A;  3W60 A;  3DYA A;  5A0Y A;  1TFW A;  4KGV B;  1O51 A;  1Y5N B;  4DX8 H;  2NYI A;  4UST A;  1TKX B;  3JSB A;  5KFD A;  4U7C A;  2CIM A;  1PIE A;  4LF4 F;  2FLL A;  2XGP A;  2ROG A;  2C2D A;  2AYM A;  2JOQ A;  5CQG A;  1NDP A;  2GJI A;  3GFH A;  1HL6 A;  3PHT A;  2QJ3 A;  4O3Q A;  3J80 U;  1RZM A;  3D0H E;  2UUC F;  5CYQ A;  3HJF A;  2P9C A;  5D8H B;  3M2V A;  5HI7 A;  3D0I E;  2E1A A;  3UO0 A;  2NQP A;  3I31 A;  5B09 A;  2CJK A;  4UF4 A;  5HAO A;  1UAW A;  5LMN F;  1Q78 A;  3KLG A;  3LO3 A;  4ECU A;  1WI8 A;  3W2V A;  3NP5 A;  3QIP A;  5ETK A;  3V4I B;  1XTZ A;  2RF2 A;  1FNX H;  2YX4 A;  2QLW A;  5F9L A;  3O2I A;  4ZHR B;  2PMZ D;  3MEE B;  3DKD A;  3EIC A;  2XEX A;  3ENQ A;  4PXB A;  2MQ8 A;  2B56 A;  2DH9 A;  2HKE A;  3U1M A;  1NZA A;  3KLV A;  3VVU A;  4F4W A;  4X4P A;  3TJ8 A;  2KT3 A;  3ZZ0 A;  1REG X;  2XMJ A;  1I94 J;  1AA1 B;  2W8L A;  1VFJ A;  2DJW A;  4AD6 A;  4FBU A;  2V50 A;  4X65 F;  2XY5 A;  4NLP A;  1NK8 A;  1TKX A;  2DNN A;  1WTB A;  2ZIT A;  3D68 A;  5J2P A;  2ALY B;  4YOE A;  2PT0 A;  1HBM B;  2W4P A;  2KTQ A;  2FC8 A;  3OFG A;  4NLW A;  4J90 A;  2Z8Q A;  2FYX A;  1C4A A;  2A3J A;  2QA1 A;  1UVL A;  4IG3 B;  3VVT A;  3KHR A;  4F50 A;  3CDW A;  2E1C A;  3HHN B;  3CE8 A;  3DXS X;  4UUX A;  4DV7 F;  1HBN A;  1XNQ J;  1U1R A;  1RWU A;  4K0K F;  2X3G A;  1DQ8 A;  3UR3 C;  4ZHR A;  1K9M T;  1HNW J;  4AXI A;  1VHI A;  2VBX A;  2KJW A;  1FK9 B;  4QJV A;  3IN5 A;  4NI2 A;  2KXF A;  3ENA A;  2J9D A;  2FJB B;  3BGO P;  5AT1 B;  3ZZU A;  3K89 A;  4NCA A;  1NJZ A;  3H0P A;  4JV0 A;  4JI3 F;  1IJE B;  2QLX A;  4K5S A;  3GFY A;  2Z30 B;  4ANC A;  2G1D A;  3DRR B;  2J0S D;  1C0U B;  3FRY A;  4TU9 A;  1K47 A;  1TEL A;  4GKJ J;  4K2X A;  4RNM A;  3PHE A;  1C2P A;  1NSP A;  2XYP B;  4F4A A;  3NMR A;  3UD5 A;  2OJ3 A;  4C98 A;  3BF4 A;  3G71 S;  4HH0 A;  5DQG A;  2DRB A;  2HNZ A;  3V6D A;  5I42 B;  3X3U A;  2V5H G;  1N5V A;  1IBK J;  4GRS A;  3EPG A;  1F2G A;  4DSJ A;  2KH9 A;  1SI9 A;  4IG3 A;  3M8S A;  2D7S A;  3GIR A;  2FTR A;  4WK1 A;  1PCA A;  1TL5 A;  2HVD A;  4M5K A;  4C8N A;  4DU7 A;  5HJX A;  4IDK A;  3NS7 B;  1ARO P;  3WIV A;  2DBB A;  2BRK A;  1CJK B;  5SZT A;  1FK9 A;  2CKW A;  3GSI A;  2ZJR Q;  4RUA A;  4JI2 J;  1FFG B;  1N56 A;  3UCZ P;  1SC6 A;  3BO3 A;  3NOG A;  3T5J A;  1WKK A;  3CC7 S;  3SXL A;  5BXI A;  1S1X A;  1L3U A;  5E7O B;  2LEB A;  2GO8 A;  1Y3K A;  4PG7 A;  4KO0 A;  2HFN A;  3L3C A;  4RUH A;  1R7I A;  1S0M A;  4IR9 A;  1XWL A;  4F3M A;  1URN A;  3HI9 A;  4CH0 S;  2Z0G A;  3LP1 B;  2AWZ A;  4YEA A;  3LWM A;  1HNV B;  4NLV A;  3EGZ A;  3M8P B;  3QT7 A;  4ITS A;  3PIP Q;  4PXC A;  1Y7P A;  3R1H A;  1HNZ F;  1B7F A;  1EP4 B;  3HX9 A;  3HD2 A;  4HTI A;  5GAD U;  3MM9 B;  2IVM A;  5KFJ A;  5EX3 A;  2DIS A;  2EFN A;  2NXE A;  3GV5 B;  3NLC A;  5GAE I;  1H2U X;  3TUP A;  1DQA A;  2AX0 A;  4WP9 A;  4QU6 A;  3KKF A;  4DSF A;  1Y4Z B;  2JWN A;  4OX9 J;  3C6U B;  2CNN B;  2H5E A;  3QRR A;  1J5E F;  2PI5 A;  3TJ9 A;  3ENV A;  4MYU A;  3R5G A;  2RIL A;  2RNE A;  4DUZ J;  2ZFH A;  1RHU B;  3DMJ A;  1TR0 A;  2VUG A;  3DLL Q;  3MTJ A;  3Q2T C;  2JHE A;  1RBA A;  1U6F A;  3CDB A;  5H9E J;  2DGU A;  3RRG A;  5CAB A;  2KHD A;  2FJV A;  2R2T A;  1YRT A;  2Z2M A;  3HT0 A;  5CCL A;  1FHT A;  1ZYQ A;  4DR1 J;  3PYD A;  4RBT A;  2GCF A;  3GCX P;  1U7L A;  4RLE A;  1FKP A;  3BQ2 A;  1T95 A;  3BB5 A;  3M8P A;  5DZ7 A;  3TZW A;  3KUH A;  4WXW A;  3C2P A;  1S9F A;  4IR1 A;  2B43 A;  3LOU A;  1VLO A;  2KG0 A;  2PFD A;  3PIO Q;  1EP4 A;  5D4N A;  3FEZ A;  3MM9 A;  4M5D A;  1OO0 B;  1V6H A;  2O5D A;  5GAG I;  1EIY B;  3ELH A;  4HHJ A;  1NPR A;  1DTT A;  3EPI A;  3IBW A;  2FLN A;  4CNZ A;  2ZUG A;  1IM4 A;  2QMU B;  4QYR A;  3SBM A;  5C42 B;  3DRP A;  1B0V A;  1F9E B;  3PAC A;  2VC1 A;  1M5V C;  2LVW A;  1HHQ A;  2VBY A;  3AOA A;  2CJ9 A;  4IOB A;  1RHR B;  4DR7 J;  3H8Y A;  4HTJ A;  3MR6 A;  2Q43 A;  4FYX B;  4IFV B;  3CD5 A;  4OFZ A;  3MAQ A;  4B9L A;  2QLF B;  4EI2 A;  3QPI A;  5KFM A;  1T94 A;  2MDA A;  4I2Q A;  3AXK A;  1Q1K A;  4ZLN A;  1OYD A;  1RWX B;  3IS9 A;  4IKA A;  3P96 A;  3H4B A;  2MZQ A;  2ERR A;  2XUL A;  5LXY A;  2M5Y A;  1D1U A;  4ZVR B;  1QSS A;  1U02 A;  3CDA A;  1WNE A;  4LQ9 A;  5J2N B;  4Z2X A;  1SIW B;  1S6Q B;  1YRX A;  3N0V A;  3RG6 A;  3EZU A;  4LFA F;  3TAN A;  5BR8 F;  4DZ6 A;  2HZV A;  4I69 A;  2DHX A;  2HSE B;  4G1Q B;  1BQX A;  2CAD A;  3PFE A;  2HS0 A;  3RB3 A;  3Q86 A;  3TOQ A;  1NHU A;  2F8E X;  1VQ4 S;  4ECZ A;  4LF8 J;  2XI2 A;  2UZA A;  4KGX B;  3TO8 A;  2ZH4 A;  3M7V A;  1I6J A;  4YDX A;  2M70 A;  4I64 A;  3TAM B;  3G9C A;  3T3F A;  1JMT A;  5C42 A;  2ROE A;  2XZW A;  2OPS A;  3EDQ B;  3GG1 A;  1DRZ A;  5IT4 A;  2KM8 B;  4NLD A;  2IAJ A;  1NDC A;  2DK2 A;  3HFV A;  3W3S A;  1TL4 A;  4YS2 A;  1J27 A;  3C16 B;  4IFV A;  1UKU A;  2W9A A;  2K3I A;  3R5A A;  2EEY A;  3HFK A;  1VIS A;  4O4G B;  1NKE A;  4JV1 A;  2H51 B;  3UN3 A;  1GTH A;  3HF5 A;  1NME B;  3QAT A;  2NR0 A;  2L48 A;  4C3L A;  4B08 A;  3DGP B;  3EMT A;  4JI6 J;  2ZOG A;  5KFQ A;  2PMH A;  2JNJ A;  4CLS A;  4M5J A;  1S6Q A;  1TKZ A;  1G6B A;  2V2K A;  2BAN B;  1KLN A;  1IN0 A;  2GHV C;  1ZBT A;  2BJ3 A;  3Q8U A;  5F8M A;  2EK6 A;  3RJM B;  4IRD A;  2LXF A;  1FJ7 A;  1SC4 B;  1QUP A;  3KJQ B;  2MKY A;  2M88 A;  1JK9 B;  3PDN A;  1ZH5 A;  3GJQ B;  2HQC A;  2DY9 A;  4GVL A;  3PX4 A;  2KT2 A;  1LWC A;  4Q2L A;  3K8W A;  4OHV A;  3VAG A;  4DDF A;  4OHY A;  1VQN S;  2ZUA A;  1RAO A;  4U7U D;  1QY7 A;  1U0S A;  4YN3 B;  1U1N A;  3LWL A;  2DPJ A;  1BUX A;  2QN6 B;  3G6V A;  5BYS A;  4DX6 A;  2VBW A;  3MXH P;  3OSP A;  4YB5 A;  1VRT A;  4X65 J;  2BJ7 A;  1EAR A;  2FJA B;  3C16 A;  2EFP A;  1BD6 A;  1BMQ B;  2AKW B;  1W7W A;  2H3E B;  3OXL A;  2G2O A;  4DFM A;  2CG8 A;  2EC0 A;  1IKW B;  2V67 A;  5KFV A;  3TA1 A;  1D8Y A;  4OYB A;  2BAC A;  3NS5 A;  1X4E A;  3H2L A;  2BKP A;  1M1G A;  1KQF B;  3R27 A;  2HAF A;  4OI6 A;  1U1L A;  4JI8 J;  5BYR A;  3A4T A;  3TAP A;  4C7Q A;  3DHX A;  5AE2 A;  3HSZ A;  5C2G A;  2XQC A;  1IJF B;  4F36 A;  2M8D B;  1MWY A;  4YY3 F;  2BAN A;  3ADA C;  1TL3 A;  1F6T A;  5DGA A;  3J80 Y;  5E5N A;  5EDW A;  5AXM A;  2VA3 A;  3MDF A;  1RTD A;  3TAR A;  3MED A;  5CHC B;  4TY8 A;  4EBD A;  5IQQ A;  3M8R A;  2B9Y A;  1FRX A;  3VGV A;  1AUS L;  2IM0 A;  2YWG A;  3HHL B;  4ZJL A;  2H9Z A;  4JYA J;  2IFX A;  1Q86 T;  4CLU A;  4L72 B;  2W8K A;  2C2Z B;  2LEC A;  1U6B A;  5D3G A;  1RAH B;  2GQ2 A;  2IC3 B;  4DPU A;  2VPZ B;  3KK1 A;  1UPP A;  3CJK B;  3FVY A;  1XC9 A;  3Q8V A;  4B3R F;  2QO3 A;  3D6H B;  5E33 A;  1KWM A;  2IRU A;  2VIH A;  3QMQ A;  1S1U A;  2BM0 A;  4ATN A;  4CM2 A;  4ETX A;  1RAJ A;  3I0R A;  3P49 B;  4LBH A;  1K0V A;  1MRO A;  4KY3 A;  2RRB A;  1U1Q A;  1CVJ A;  3LW5 C;  2P9E A;  3TVZ A;  3QT8 A;  2KHC A;  5C24 A;  2OKQ A;  4PZV A;  2FVC A;  1X4H A;  7FDR A;  3SI8 A;  2X7I A;  1YJW S;  3EGN A;  1FRK A;  3EM1 A;  4O3N A;  1NKC A;  3QAE A;  1FJG J;  1FEE A;  4B3S F;  2DXF A;  3G6X A;  4MTP A;  2YH0 A;  3QJJ A;  1TUV A;  1IKV B;  2VB6 A;  1CJV A;  1SIZ A;  2XBP A;  3GPA A;  2ZH7 A;  5D4L A;  3AD8 C;  1NO8 A;  4RO0 A;  4K7Q A;  3SIP B;  1Y3J A;  2VON A;  3HHL A;  4G65 A;  1HW9 A;  2GC8 A;  4X64 J;  2YNI B;  1CS4 B;  4P10 A;  5RUB A;  2RT3 A;  1U48 A;  4X4Q A;  4BCA A;  4XPE A;  4JP8 A;  3JSM A;  4DX5 A;  3DOK B;  2W4C A;  1NDK A;  1N32 F;  2IC3 A;  4E8U A;  3R2D J;  3MAH A;  4OYA A;  2UU9 J;  3H2V E;  3TUJ C;  4USH A;  3DLB A;  5IT9 U;  2PE8 A;  2C2N A;  4B9N A;  1Y00 A;  3CJK A;  2JL9 A;  2X1B A;  4HKQ A;  1KOH A;  2PI4 A;  4Y2K A;  4PUO A;  3D6F B;  2VV5 A;  1BLU A;  3MCS A;  3KYL A;  3G4S S;  2H4W B;  5IXU A;  2BQ3 A;  5DZ6 A;  5KFL A;  3BGR A;  3KHH A;  4PKD B;  3G86 A;  2GML A;  3ITH B;  1TL1 B;  5F8H A;  2HHH F;  2MJN A;  4Y34 A;  3OFH A;  2HQG A;  4J9L A;  4LRE A;  2CPJ A;  2BV3 A;  3N5F A;  4LT6 A;  4BLG A;  3DDN A;  3M6X A;  4DV6 F;  1IVZ A;  4PG4 A;  1S7I A;  3A8I A;  1Y11 A;  3ZZY A;  1IKV A;  4URS A;  1WKL A;  3NMA A;  5DDR C;  4WU3 A;  2CA9 A;  2X51 A;  2AJ0 A;  4KJI A;  2WSE C;  3AJ2 A;  4DR3 J;  3G87 A;  3UR0 A;  2IHR 1;  1OWX A;  1RT2 B;  2HWH A;  5F8N A;  4J9Q A;  5EHH A;  2HS4 A;  1EQ0 A;  3DOK A;  1ELO A;  4FN5 A;  1SJF A;  1QE1 A;  2OFH X;  4ZPA A;  5A8W B;  1HD0 A;  5JJB A;  3GYG A;  2J6U A;  2DNH A;  2EC2 A;  3QSY B;  3AHP A;  3PYG A;  3J7Y U;  4PRF A;  1HA1 A;  4CYU B;  1MN7 A;  3SV3 A;  2LU1 A;  1VQY A;  2KKH A;  4K4Y A;  2LDI A;  1TL1 A;  1HNX J;  2PA8 D;  1RT1 A;  1FDA A;  3OR1 B;  1X4F A;  4USJ C;  4OV1 A;  2VG6 A;  2JZ5 A;  2WHO A;  5B0E A;  2KU7 A;  2AGP A;  3CJQ A;  1NK7 A;  3GFZ A;  3MEG B;  2GHP A;  3V6H A;  1BY9 A;  4RW8 B;  3QWP A;  1QVG R;  4KV8 B;  3VAM A;  3EVW A;  5KT3 A;  2ZC3 A;  4KBI A;  4Y28 C;  3VAL A;  4UOH A;  2R2U A;  1PYS B;  1IM6 A;  1Q5Y A;  4R0J A;  3VGT A;  1RHJ B;  1U2C A;  3UNY A;  4C0H A;  3IRW P;  2BM1 A;  1VQ9 S;  1RT2 A;  1NHK L;  1IKX B;  3PEH A;  2RIJ A;  4KR0 B;  1S4E A;  3V6J A;  4ZLL A;  1PYO B;  1T0T V;  2BYC A;  3M6V A;  3X1L B;  2QMX A;  2NS1 B;  4NXN J;  4R8U B;  5A8W A;  4RUB A;  2HHU A;  1HQU A;  2VG5 A;  2QL9 B;  1WF2 A;  1N5T A;  1EAY C;  1RUS A;  1VRQ C;  3I32 A;  3HVR A;  1RTI A;  2OEL A;  2RAQ A;  4CYU A;  3AJ1 A;  3DLK B;  1B7Y B;  3BPS P;  4JI1 J;  3SZ2 A;  2UXD F;  2B5J B;  4MMO A;  2RML A;  3KDN A;  1CQN A;  1XNR J;  3TZY A;  1VIX A;  2MQP A;  3NNC A;  4YHH F;  2YKN B;  3OL7 A;  4LSL B;  4O3P A;  4QIF A;  4WWS A;  3EWG A;  4P2F A;  3OR1 A;  4DQR A;  3Q23 A;  5IFM A;  4NXM J;  1X0P A;  1AUD A;  2JFK A;  1H7W A;  4DFJ A;  4OX8 A;  3MEG A;  2AJ2 A;  4CP5 A;  4GVB B;  1UTA A;  4FPI A;  3I55 S;  3CNQ P;  2JJ4 D;  3DHW C;  1JKH B;  4QIW D;  1HAR A;  3TYT A;  2NPI A;  4ZVF A;  2KI2 A;  5B0D A;  4KC5 A;  1FXR A;  1IKX A;  2R7S A;  3MR5 A;  9RUB A;  3DCA A;  3PYE A;  1S6P B;  2AYG A;  2DYA A;  4JI7 F;  4R8U A;  3RZA A;  1T8E A;  1NK6 A;  1M0S A;  1D3W A;  3C46 A;  4RW9 B;  4CIO A;  3H59 A;  4U8Y A;  1TV6 A;  1Z1Z A;  3T19 A;  1EET B;  2GNK A;  3TI0 A;  1N0U A;  4EUV A;  4LF6 J;  2B6A B;  3DLK A;  1WHV A;  2D3U A;  4OYO A;  4NE9 C;  2B5J A;  4ZVP B;  3H42 A;  1UA0 A;  2JEG A;  2VKZ G;  3Q8P B;  4ZLJ A;  1H73 A;  2YKN A;  4LSL A;  2M2B A;  1F0X A;  3P3D A;  2KN4 A;  1RYS A;  5LJ3 Y;  3KJV A;  1FES A;  1SKR A;  3UI3 A;  4LIR A;  1UEU A;  2HHX A;  3IWL A;  2WVF A;  2GHW A;  1E6V B;  4O3S A;  3BQ1 A;  3CPW R;  2AW0 A;  3IFE A;  3UVJ B;  3NY0 A;  3IXQ A;  5J2Q B;  1S0N A;  1JKH A;  5D0E A;  1AFI A;  1JLB A;  3M30 B;  4I67 A;  5FDL A;  1NKB A;  4B3O B;  5F0W A;  3VGU A;  3RW7 A;  4Q7A A;  1Z4U A;  1SL0 A;  4YUD A;  1S6P A;  2IJR A;  1G1X A;  1SB6 A;  1YZ6 A;  2RHQ B;  4LSZ B;  5DLF A;  4X4S A;  4UQG A;  4M5L A;  4YY3 J;  4QR1 A;  1NJX A;  3FMB A;  3G8T A;  2ZZT A;  1HYS B;  3CF5 Q;  4I7F A;  2C42 A;  3NAH A;  1BQN B;  3I6P A;  2CQP A;  4AE5 A;  2ZDP A;  2NZC A;  3W66 A;  4WJB A;  1R0A B;  4DSK A;  2EPI A;  2B6A A;  1G4C A;  4C8Z A;  1FD8 A;  4FXD A;  2W2O P;  1V5V A;  3BPD A;  4MT1 A;  2B7B B;  2JDJ A;  1JJC B;  3NCQ A;  2A1B A;  4PWD A;  3S01 A;  2BOA A;  4J9N A;  1KEK A;  3EZO A;  2CJY B;  4ZP7 A;  4DUT A;  5KG3 A;  5GAH I;  1S9E A;  2YWW A;  1KKH A;  1SH0 A;  2H5I B;  3LF0 A;  4X4O A;  4DR4 F;  3TVY A;  3UQS A;  2HHQ A;  4HLB A;  2AZ3 A;  4DEZ A;  2MMY A;  4IH6 A;  2PEB A;  3CED A;  4Q8E A;  1VC0 A;  1DTQ A;  1F9H A;  2VPX B;  3UVJ A;  4PCQ A;  4UOF A;  4RNH A;  1CC7 A;  3C8Y A;  1PBU A;  3SCI E;  4B9T A;  4NA3 A;  2V4J B;  2LEA A;  1MLA A;  3GR0 A;  4S0M A;  1C4C A;  4YME A;  4ALZ A;  2CQB A;  3DLH A;  2WON A;  2ZH5 A;  4G3I A;  4NMX A;  2LQJ A;  2O66 A;  2RVJ A;  3BEG B;  4ZVT B;  1U1M A;  2ZJQ Q;  3T1Y J;  1HQE B;  1TUW A;  2BAB A;  5J1E B;  3R7B B;  4HT7 A;  1S72 S;  1QVF R;  3D7S B;  3VQT A;  4Y2I A;  2YKA A;  2UXC J;  1UW4 A;  1BQN A;  5G4D A;  3JS9 A;  3VAH A;  3CCS S;  4N77 A;  4HDH A;  2E1M C;  2XB2 D;  4FXW A;  2AEJ A;  2QV6 A;  2LQ8 A;  3KNA A;  2H5J B;  2LDY A;  2F63 A;  2DGX A;  1VGY A;  1J2V A;  1UJ6 A;  1JLG B;  3HCX A;  1Q0N A;  2YPY A;  2AIR B;  2YQ1 A;  2G1H A;  4F0H A;  2HFU A;  4DHV A;  3SCJ E;  2BVZ A;  5HLF A;  4NX9 A;  5E0O A;  1HWK A;  1OY9 A;  4ZCI A;  4AL6 A;  2K1R A;  4JOU A;  3CWJ A;  3QZ7 A;  4ECX A;  4IYQ A;  4EBC A;  4PQA A;  5AE3 A;  3N28 A;  5B0C A;  4J9P A;  2OIH A;  4DV3 F;  2CQ3 A;  3UDV A;  4Y2M A;  2J7U A;  3W9J A;  2HLT A;  2O67 A;  2BA9 A;  3O1L A;  2QLB B;  3U27 A;  2YKM A;  3U1L A;  2MXY A;  2CPH A;  2I6W A;  2Z58 B;  2DIU A;  5IQ6 A;  1V5I B;  1F5A A;  5HVG A;  1RLD A;  4YR3 A;  1IBM J;  4ED7 A;  1W2B R;  5J2M B;  3GR1 A;  4A48 A;  1LK5 A;  4ECR A;  2ACM A;  3D1O A;  1C1B A;  5J1P A;  4H4O A;  2IY5 B;  1HQE A;  1W26 A;  1KQG B;  2HHH J;  5J1E A;  2KO1 A;  3BKT A;  4OYW A;  4X66 F;  3EZ5 A;  1MU2 A;  1PYT A;  2DR7 A;  2GV1 A;  2MLZ A;  1B0P A;  1RWM B;  2CFX A;  1LFP A;  2VF3 A;  2MGZ B;  1HI1 A;  2ZE2 B;  3HP6 A;  1WEX A;  2BE7 D;  3D6M B;  4DL3 A;  3FDS A;  2KYX A;  3QGH A;  1NK9 A;  3CCR S;  3M2U B;  2ABY A;  3F0N A;  4USM A;  3G82 B;  1YLX A;  5CCM A;  4ZA1 A;  2QSW A;  3QFH A;  4ZIW A;  3KWM A;  3IRX B;  3QID A;  4RW6 B;  2OH2 A;  1UEK A;  4FF1 A;  2AJQ A;  2IPO B;  3GMG A;  2G0I A;  5AXL A;  4K4T A;  2DCL A;  3GZ7 A;  4OI1 A;  4K8R A;  1VK8 A;  4OQJ A;  2QFJ A;  3VGS A;  4XO0 A;  3LPE A;  1F9F A;  4DX7 A;  4MIA A;  2HLU A;  4X4V A;  1W25 A;  2HWT A;  2CPZ A;  4DR5 J;  3FBF A;  1HWI A;  2FVS A;  4CH7 A;  3UFC X;  3K58 A;  2MY7 A;  5IT9 Y;  4NEZ A;  3G6Y A;  1JNZ B;  1TZ0 A;  2DRA A;  2R42 A;  4EYI B;  2UVR A;  3MMB A;  1HPZ A;  3D3C J;  3IBF B;  1JB0 C;  4Z7C A;  2RDI A;  3TQ1 A;  2GVZ B;  5HMW A;  1TAU A;  4Q5V A;  2BUN A;  4YFU A;  1P1T A;  3E01 A;  2DNM A;  2MEW A;  4P6Q A;  4DUY J;  2DR6 A;  4I1T A;  2D1C A;  2CPE A;  1HBU B;  4X4N A;  1H3D A;  4P52 A;  4RNO A;  2R7X A;  2AYB A;  2OAU A;  1AXQ A;  1MML A;  3FJ2 A;  2LQB A;  1CSJ A;  5KFC A;  3MEC A;  1S7H A;  3HUL A;  2G4B A;  4PXD A;  1OMS A;  5C25 B;  2BR0 A;  2LYV A;  2D3O R;  2LXI A;  2DHS A;  2A0F B;  4NLX A;  2VFR A;  2EG2 A;  4UOC A;  4DQS A;  3ETM A;  4A8S A;  3HDS A;  3S1T A;  3WHI A;  1HLW A;  4WFX A;  1BQM A;  1VC5 A;  4F2R A;  1JLF A;  3DU6 A;  4F7V A;  3C6T A;  3IR6 B;  5GVQ A;  1SKS A;  3IG1 B;  1A6L A;  4KKO B;  2CVE A;  2LCW A;  2QT7 A;  3F56 A;  3KJN B;  4O44 A;  1SQE A;  3SV4 A;  4A8F A;  4WK3 A;  3EXY A;  2PII A;  1WDT A;  1RA7 A;  2MPU A;  3MF5 A;  5AJ3 F;  3KUG A;  3LP2 A;  1NDL A;  3SFU A;  4CNY A;  3OXF A;  2GVZ A;  3K57 A;  1YJV A;  4NA1 A;  2BE9 B;  2RE1 A;  4DV4 F;  3SQO P;  2Q3P A;  3J7A N;  2XSJ B;  1HBU A;  4WFZ A;  4DBQ A;  5E41 A;  3GLJ A;  4J9K A;  4KGM A;  2E9Z A;  5JMN A;  1V3S A;  3KOA A;  1M5O C;  2BW7 A;  1N33 F;  3CD0 A;  5DJB A;  1OYE A;  2CQC A;  4CLL A;  5C25 A;  4OJ3 A;  2UUW A;  4WP3 A;  2V63 A;  4AUK A;  3D9B A;  1LWE B;  1X4G A;  1OQ6 A;  2F4F A;  2F4V J;  3WQP A;  4R5P A;  2I2Y A;  2DGW A;  2V4R A;  4DV0 J;  5IS2 A;  2QYG A;  1VDH A;  3BR8 A;  1KRP A;  5M2R A;  2UXB J;  4JI4 J;  3IWN C;  1R0B G;  3TZX A;  4LF7 F;  3FCH A;  1YJ9 S;  5ETO A;  2W7P A;  1LWF B;  4DXL A;  3MPU B;  4LQ3 A;  2P9G A;  1NCL A;  3SCL E;  4K5R A;  1TKT B;  3W61 A;  2WK4 A;  3MHY A;  3H90 A;  2OPR B;  1S1T A;  3AB2 B;  2Q1L A;  4B3M J;  2HMI B;  1IBL J;  1YJU A;  5K5M A;  4WFB Q;  3QT5 A;  3GIJ A;  2XHW A;  3OTO F;  4WFY A;  1HQ2 A;  3IR7 B;  5K8O A;  4FVM A;  4WKR A;  1KFS A;  3DOL B;  2HZA A;  3NRB A;  3HM9 A;  1QAX A;  2OML A;  3N01 A;  3JQJ A;  4WYL A;  4C0B A;  4NYZ A;  2AP6 A;  4MH8 A;  4EO8 A;  4USV A;  3MFI A;  3ILO A;  2G0J A;  5E3A A;  1HKA A;  2R7Q A;  4G6V B;  2XG8 A;  3RAQ A;  1MWQ A;  2CQ0 A;  2WVC A;  3BKU A;  3LQV A;  5KFR A;  1RJJ A;  4QBU A;  5I3P A;  5GME A;  3GTY X;  4OLP A;  2C28 A;  4DQI A;  4DL4 A;  3IMQ J;  2CYY A;  2I38 A;  1SKU B;  2N3O A;  2W01 A;  1VCT A;  2YWK A;  5JUM A;  2BKN A;  4CM0 A;  3GG0 A;  1RAB B;  2HVE A;  1Y0H A;  1LWF A;  2W9B B;  2MZS A;  2B4U A;  4EYH B;  4J9U E;  5F8L A;  3FGV A;  2P6S A;  3DU5 A;  2B51 A;  3HXM A;  5CAA A;  4FNI A;  4ECQ A;  2HFS A;  4IO9 Q;  3C15 A;  4WCE Q;  4HT5 A;  2GGP B;  3PCO B;  2VC0 A;  1RDR A;  2LFV A;  3SQG B;  4LFB F;  2BE2 A;  1TL7 B;  1XR6 A;  1UVN A;  1CPZ A;  1HR0 J;  5KFB A;  4QWB A;  3NKY A;  1F1B B;  4AFF A;  3BGU A;  1UJ4 A;  2R2R A;  4FYD A;  4IQX A;  1WSR A;  4KHP J;  3L4B C;  1B0T A;  2R3V A;  4UUW A;  3TEG A;  2BQU A;  1KTV A;  5L8R C;  4ZIV A;  2Z4P A;  3CME S;  1VQL S;  2AMC B;  2HZC A;  1V3Z A;  3NWR A;  1OPI A;  4QIE A;  3ZNJ 1;  2C3U A;  2A2C A;  2EFG A;  1L3T A;  2RU9 A;  4HYK A;  4CCH A;  4O3O A;  3OR2 B;  3D1Q A;  5DQI A;  3PYF A;  3ONQ A;  4MKA A;  2LU2 A;  2V2Z A;  4ZCL A;  3DI6 B;  1UFK A;  2XZT B;  2MJU A;  2ASJ A;  1P9Q C;  1TQL A;  2AGO A;  3MMC B;  1HMV B;  2HW3 A;  2W1B A;  4L75 A;  3D3B J;  2NUH A;  3Q89 A;  4CLY A;  1S77 D;  1JXL A;  4C3K A;  2OI2 A;  2W9B A;  5KOX A;  4I6Y A;  3A13 A;  3SDE B;  2CAJ A;  2AZ1 A;  1N34 J;  2GGP A;  3MM7 A;  4Y3C A;  1JIH A;  3R3T A;  3HHK A;  4CRJ A;  3E2E A;  4P71 A;  2DRD A;  1SL1 A;  1ZA2 B;  1J5O A;  4LRD A;  1FER A;  1VQO S;  2VH7 A;  1PSD A;  2MQL A;  3QNW B;  4HH1 A;  2BX6 A;  3M8Q A;  5KFY A;  1QTN B;  4J9R A;  3GE9 A;  3LH2 S;  1CJU B;  2BZ2 A;  3C66 A;  4TNO A;  2BJ9 A;  3D67 A;  3TUI C;  1NH7 A;  3HSD A;  3ILJ A;  1RBO B;  2B3T B;  3M9N B;  2ILY A;  2ZM6 F;  3HSG A;  1APS A;  4ED3 A;  3SSS A;  1MSW D;  2XYG B;  4NYO A;  1ZET A;  3WC0 A;  3GP9 A;  4ED6 A;  2XLK A;  1U45 A;  1FE0 A;  5HQL A;  2XNR A;  3FEX B;  3MFH A;  4KGZ B;  1RKI A;  4DSL A;  2E5G A;  1TK0 A;  3VQS A;  4LRA A;  4BC9 A;  3HKZ D;  2POK A;  2QA4 S;  1FRL A;  2R7U A;  2IMO A;  4P72 A;  3ZXW A;  1NJI T;  5CH7 B;  4HDG A;  1XMQ J;  4DJB A;  2MST A;  2IVY A;  1S1W B;  1TUG B;  4EBE A;  2E5L F;  2DGV A;  2C1E B;  3QFW A;  5LJ5 Y;  1DY3 A;  4A4J A;  2UV8 A;  5DM7 Q;  4RBV A;  3MPW A;  3PJ9 A;  4YB7 A;  1X4D A;  3R7S B;  2JSX A;  5EWG A;  1P1L A;  2Y0S D;  1LEO A;  4F26 A;  3B6B A;  4QIG A;  4NLT A;  3MM5 B;  2KRB A;  3BSA A;  4C8L A;  4BC7 A;  1QLN A;  2N3L A;  2K7J A;  1ZM2 A;  3DM2 A;  4CLF A;  2ZKT A;  2FHJ A;  2OO4 A;  2YQ0 A;  2VQF F;  3I4H X;  1RE1 B;  1WC1 A;  2R7T A;  3UPF A;  3HO1 A;  4XTT A;  3ICL A;  2CQG A;  1RWK B;  4L3K A;  2V69 A;  5HQ8 A;  2MZT A;  3MM8 A;  3OW2 R;  2CZ9 A;  2V6A A;  3KG4 A;  1NBE B;  3QJL A;  1T9W A;  4YDD B;  2EWH A;  1GX5 A;  1FI4 A;  2JEI A;  3OJU A;  1FT8 A;  2KFZ A;  3PO5 A;  5A6W A;  2UVV A;  4QW8 A;  1KQS R;  3WZ0 A;  2JC1 A;  2OLW A;  5LXR A;  5A8K B;  2E29 A;  1S1W A;  2ZJP Q;  4PYA A;  1IBC B;  1URR A;  4JV5 F;  3B78 A;  3W62 A;  2C2O B;  2ZOM A;  1IXK A;  3C14 B;  3CVK A;  3JSR A;  4B3T F;  1YBT A;  3LAM A;  4P7V A;  5C2C A;  4YP3 A;  1T05 B;  2HK3 A;  1JJ4 A;  2RS2 A;  1RT4 B;  4Y2C A;  5B08 A;  4H54 A;  1M5H A;  4LRF A;  3H7H B;  3MM5 A;  1PJ6 A;  3U02 A;  4A8Q A;  4OYX A;  3T9N A;  2W2Q P;  2OEM A;  2NLW A;  5KFE A;  3DYA B;  4C11 B;  5A0Y B;  4QW9 A;  1OIA A;  1FJE B;  2DNO A;  3QJP A;  4FBT A;  4W90 B;  3J7Z T;  1FO1 A;  1KVJ A;  2MQO A;  3B54 A;  5T7L B;  2AHO B;  2E7W A;  1JX4 A;  3GJS B;  4WU2 A;  2IYG A;  1PJ5 A;  1K1S A;  4OI3 A;  3QLH A;  1GFW B;  3A3O B;  1KTQ A;  2GMJ A;  3HVT A;  1XER A;  5ETV A;  4IFY B;  3MGJ A;  3K7R A;  4NML A;  1QSL A;  5DM6 Q;  2EBE A;  4OI2 A;  4M5I A;  4FF4 A;  3M2V B;  1OJ4 A;  1KSP A;  2YH1 A;  1BE4 A;  4TXS A;  4LFC J;  5C5J A;  3W2V B;  1WI6 A;  2GQQ A;  4O3R A;  3T1A A;  3D54 A;  3QIP B;  4WYW A;  2RF2 B;  1E6Y A;  5HVH A;  1OS5 A;  5D6G A;  1T3O A;  3A3N B;  3SCK E;  4ZPT R;  4H4M A;  1ZM3 A;  3OTC A;  4N8O A;  3G96 A;  3W9I A;  3CDE A;  4V19 X;  2IM1 A;  2GAG C;  1T05 A;  2AJF E;  1UCN A;  2BDP A;  4LRC A;  2NSB A;  1RT4 A;  3SSR A;  1KC8 T;  4FYY B;  2BJ1 A;  1AZS A;  3M6U A;  1L3V A;  5KFX A;  4YR0 A;  1XN9 A;  3CJS A;  4ZPC A;  4ES1 A;  1HNI B;  4UT4 A;  2HBY B;  2WOM B;  3RB6 A;  4C11 A;  2RRN A;  4WII A;  3W63 A;  1MMN A;  4F3O A;  2YX7 A;  5ETT A;  4E2F B;  5T7L A;  4F4K A;  4J91 A;  5J2P B;  1Q79 A;  2AD9 A;  4ZVO B;  4TYA A;  1O0P A;  2XMU A;  2PGC A;  4ZVE A;  2BXJ A;  1RU2 A;  4X62 J;  4IFY A;  2XYH B;  3QAU A;  3VHQ A;  4LVO P;  4DR2 J;  1NSQ A;  1S9G A;  3ISN D;  4I6A A;  2HHT A;  1HBN B;  4ZKA A;  2H1Y A;  4W4M A;  3W7B A;  1XMO J;  1H2T Z;  2Y8Y A;  1WOO A;  3PW0 A;  1OQ3 A;  4OL8 A;  2XMW A;  4NI2 B;  3J7A 1;  5THW A;  4P7T A;  1VQ7 S;  3FBC A;  2Y9H A;  3TJA A;  4EK2 A;  1FEH A;  4V1A k;  2XNQ A;  1WTF A;  3PO4 A;  3P5T L;  2ZNY A;  3M8Z A;  1HNI A;  2KXN B;  4Q2M A;  2WOM A;  2L41 A;  5A76 A;  4DR6 J;  2C3P A;  3T41 A;  5C7P A;  2ZDO A;  2ZZM A;  1FJC A;  4ED4 A;  3GIL A;  3BBB A;  4IOA Q;  4F0M A;  4AQY F;  5CYJ A;  2K06 A;  4DV2 J;  5E3C A;  3A8K A;  2HNZ B;  3V6D B;  4H4K C;  3JTN A;  4GO5 X;  3JQM A;  2HQ3 A;  4CO4 A;  4N47 A;  1WOR A;  1OY8 A;  4YR2 A;  3NGT A;  4KGK A;  1RT6 A;  1UPM B;  1WC6 A;  3IP0 A;  2DNR A;  2XCP A;  1WHX A;  2MLY A;  2J7K A;  2B9W A;  4IDK B;  5KFI A;  5DRK A;  4DSE A;  1ACM B;  1R6Y A;  4LSN A;  4DCP B;  3ZTO A;  2ZHO A;  5LMU F;  3M9O B;  4OZN A;  3BQ0 A;  2IVF B;  2SXL A;  2IA6 A;  4MFB B;  4KE5 A;  2QL7 B;  1KN6 A;  1LOU A;  1ZM9 A;  4K4Z A;  4F67 A;  3IGV A;  4DL7 A;  1KFD A;  1YG0 A;  2EFQ A;  4K50 A;  1S1X B;  2J5A A;  4KO0 B;  4EZ9 A;  5CXT A;  4CLK A;  3CC4 S;  2R4F A;  1GMW A;  1LV5 A;  3AOC A;  1B4S A;  2C3O A;  4USK A;  1XJW B;  2HGL A;  4UZB A;  1NPP A;  4FF3 A;  2RH3 A;  4F4Z A;  3PW4 A;  3FSI A;  3V6K A;  2IRX A;  1EKS A;  1HI0 P;  1VLY A;  1X7V A;  4OYP A;  3HHD A;  2GZO A;  2DGQ A;  4FDF A;  4WKY A;  2YWF A;  1IWA A;  5M2U A;  2DXD A;  2W9C A;  2ADB A;  3WX8 A;  1EX8 A;  2OMO A;  5L9N A;  4I2P B;  2PO4 A;  4CLW A;  3W5Y A;  2IM2 A;  4IUF A;  4ZVH A;  2VIC A;  3RBX A;  2HK2 A;  3QSI A;  1CQM A;  2XZD B;  4Z37 A;  3CCJ S;  1QJH A;  4DU8 A;  3DMJ B;  3DNC A;  2PN6 A;  2EKY A;  4MFB A;  3CCV S;  1DJ0 A;  4JI5 F;  4P2M A;  4TKT A;  2WVE A;  2XWX A;  1HD1 A;  2WAQ D;  2HGM A;  5GAE U;  3T6J A;  1HW8 A;  4LRB A;  4DQQ A;  1S6O A;  1CBK A;  3L7U A;  1RWP B;  2J0X A;  4C3M A;  1C0T A;  2DGS A;  5F3Z A;  1GXU A;  5BYQ A;  1WC3 A;  1FKP B;  3QRQ A;  3CO9 A;  4IO1 A;  3BSO A;  2OEK A;  1DAX A;  2EFV A;  4DV1 F;  1S49 A;  2CQH A;  2U1A A;  2VQE F;  2EG1 A;  3JYT B;  2W7A A;  4M5D B;  3DRX A;  2ZHB A;  3KLF A;  4E98 A;  3PRD A;  3T1H J;  2HAI A;  1DTT B;  5K14 B;  2AU0 A;  2XS7 A;  4ZPV R;  3R6G B;  2OTL S;  3AA9 A;  2E1R A;  4JBC A;  4FS2 A;  3DRP B;  4A8M P;  4KFB A;  3T6B A;  4I2P A;  1M1H A;  2ZOF A;  3MD1 A;  2F7V A;  1NPK A;  1DLO B;  3KLE A;  1YQH A;  4M5M A;  4URG A;  1RHQ B;  1Q8K A;  4I2Q B;  2F40 A;  4UTG A;  4BDP A;  1KON A;  3AA8 A;  3BSN A;  3IS9 B;  4DL6 A;  3B82 A;  4AL7 A;  3S6E A;  3V4M A;  3NG8 A;  1ZZN A;  5E3Q A;  1ZTW A;  2VL1 A;  4M95 A;  3BDP A;  3Q0A A;  2R8G A;  1RWW B;  1F60 B;  3NNA A;  4PG5 A;  2MQM A;  1CLF A;  1ZZF A;  2MKJ A;  1Q8B A;  2FVQ A;  4QWA A;  4Z7Y A;  1QSY A;  1AT1 B;  4LR7 A;  1K44 A;  1JLC A;  4AYB D;  5KFW A;  3EDR B;  5ETS A;  4RU9 A;  3QT6 A;  4XPC A;  4NLS A;  3JYT A;  3FBE A;  1RT5 B;  3DLG B;  3N5B A;  4WXO A;  3UE2 A;  4DS5 A;  3I56 S;  5K14 A;  2RU3 A;  1HIY A;  2Y1I A;  1LW2 A;  1AFJ A;  2I5J B;  3MCN A;  2UUA F;  5BJR A;  1I94 F;  1WOP A;  2OPS B;  3HSJ A;  1U1K A;  2PA3 A;  4NOH A;  1OSD A;  3MM6 B;  3CCU S;  2J76 E;  1DLO A;  4F0K A;  4P2X A;  2IAJ B;  5LSR A;  1UWB B;  1TP7 A;  1N6Q A;  2ASD A;  4M63 A;  2X1F A;  2D41 A;  1FE4 A;  1HHS A;  2OD4 A;  4FKY A;  2DR5 A;  1S76 D;  1WUU A;  3RGI A;  2VDI A;  3UD3 P;  1IQZ A;  3H5U A;  3NBP A;  2UUB J;  5HMZ A;  2C2K B;  3O6Q A;  2VFT A;  4NLU A;  2YY3 A;  2ZZN A;  2P6T A;  2V34 A;  2HRT A;  3CJ4 A;  2PFF B;  1NAQ A;  5DDP C;  4RWX A;  1H72 C;  1TKZ B;  3PG9 A;  4Q8F A;  1HNW F;  3AOD A;  1WJ9 A;  2J0W A;  4ICL A;  5ETL A;  1O5J A;  4FP9 A;  2IDE A;  2R7O A;  1RQ0 A;  3VAK A;  3BH7 B;  1R0C B;  4O0I A;  1D09 B;  1RT5 A;  2BRL A;  2BKO A;  3DLG A;  2RD5 C;  1LWC B;  3N6L A;  5HQM A;  1ZA1 B;  3SSQ A;  4ECS A;  1D8Z A;  4A8W A;  1N54 B;  2D69 A;  4OZ2 A;  4O23 A;  1R43 A;  2I5J A;  4LF5 J;  2RQM A;  3PW7 A;  1NK0 A;  2HGN A;  3LTO A;  1N36 J;  2E1P A;  2EVZ A;  4R25 A;  3MM6 A;  2FZK B;  2KYZ A;  5HP1 B;  5KAK A;  1RCX B;  1UWB A;  1VRT B;  4RU2 A;  3CIM A;  2O1P A;  4LF4 J;  4FYV B;  5U47 A;  3HFZ B;  1X9M A;  4N7T A;  2GQC A;  5HRO A;  1WG1 A;  1IBK F;  2GVD B;  4DSI A;  3ZC4 A;  1RWO B;  5HMY A;  2IJN A;  1XK8 A;  2AQ4 A;  1X9W A;  3N6N A;  2UUC J;  2C2E A;  2RKI A;  2ZH6 A;  3BS9 A;  3CTR A;  3M32 A;  3PW5 A;  3RR8 A;  1QTM A;  4L74 A;  1UZH A;  4ECT A;  5LMN J;  1TL3 B;  1KOO A;  4WBF A;  3Q8Y A;  3L95 X;  3GB0 A;  1S1V B;  3BV8 A;  3W9H A;  2H65 B;  3M8W A;  5KG2 A;  1UVM A;  4DPT A;  3OXG A;  1RTD B;  3MED B;  4QR2 A;  4JI2 F;  4TY8 B;  1T9X A;  2ZH8 A;  4OJH A;  3IAS 9;  4R0E A;  1S79 A;  3DLE A;  4OZJ A;  5HAT A;  2A6O A;  3GFX A;  3I0S A;  4E0D A;  1OSC A;  3I96 A;  1RAA B;  3G2X A;  3MUV P;  3ULH A;  1U2F A;  1SJ4 P;  5D3G B;  4L6V 3;  4PAA A;  4HAC A;  2GJ2 A;  4CTA A;  5LL6 d;  3L09 A;  4OZ0 A;  5HP1 A;  2ZVI A;  2YTC A;  4F4Y A;  2DEJ A;  2JC0 A;  5HO4 A;  3KK1 B;  2CG4 A;  2ZWP A;  3FRZ A;  3TEH B;  5IOL A;  2VA2 A;  2QRR A;  1S1U B;  1VIO A;  2MKI A;  3I0R B;  1MRO B;  4PXE A;  5F8G A;  4F8R A;  2GVD A;  2B4V A;  4ZDN A;  3QGI A;  2VKR A;  4LIW A;  4AXJ A;  5K8M A;  5I3U B;  5C24 B;  1RK8 A;  3M6W A;  5KFF A;  4OX9 F;  2BJE A;  3QYY A;  2GX8 A;  1WC0 A;  3GU0 A;  1FA0 A;  3M8Y A;  4NZ0 A;  1KQK A;  4IRC A;  1YJR A;  3ET6 B;  4DV7 J;  3NGD A;  2Q79 A;  4B9V A;  1K73 T;  4P2S A;  4DUZ F;  3PX0 A;  1S1V A;  2WSF C;  1ICE B;  3RBD A;  4XDD A;  1UVI A;  4K0K J;  2RUG A;  2G9O A;  3V5R A;  2GFF A;  3MAA A;  1CJV B;  2J0Q D;  1X5P A;  3IC1 A;  5LMU J;  1UW9 A;  2DR8 A;  2QE5 A;  2OGU A;  3Q8Q B;  3GIM A;  2WW8 A;  4MKY A;  2V68 A;  3H40 A;  3CC2 S;  4CQ1 A;  3G8S A;  2HYI B;  4DR1 F;  4DPX A;  2QMW A;  3JSM B;  5D77 A;  2XSF A;  4C97 A;  4JI3 J;  3RW6 A;  2IRY A;  4M5G A;  1IUJ A;  2CPD A;  2X1G A;  3TNV A;  2DO0 A;  4A46 A;  4KAI A;  5E2Q A;  4U67 Q;  4N56 A;  1RSC A;  2DNZ A;  4B17 A;  4PUO B;  3GCW P;  4OI0 A;  2WSC C;  4EMD A;  1AB8 A;  4NWB A;  3BGR B;  5I3U A;  5D4O A;  2ZBI A;  3R9L A;  2QX0 A;  3GYX B;  1NEE A;  2CQI A;  4DOZ A;  1B64 A;  2LEP A;  4HL9 A;  3ET6 A;  2YBV A;  2ZNZ A;  2J6T A;  2HQI A;  1D0E A;  4OYM A;  3T5L A;  2AV5 A;  3F44 A;  3I5B A;  2QL5 B;  2DY1 A;  2RRA A;  3BYR A;  3FFI A;  3JB9 k;  4DN0 A;  3BBC A;  2JLE A;  4D3H A;  1X4A A;  1KHW A;  1VMB A;  3AQO A;  3CCL S;  3AJD A;  1UFL A;  3EVO A;  1FXL A;  1WF0 A;  1JXE A;  3OFF A;  1MWZ A;  1UVK A;  3ZO7 A;  2XHC A;  1UA1 A;  1XR7 A;  5CZV A;  1RTH A;  3L9Z A;  4DN9 A;  1QE1 B;  1VQS A;  1BC6 A;  3PTW A;  3HLU A;  3DRS B;  3ZZR A;  4WFN Q;  2LKZ A;  3H2U B;  4RNN A;  1GAO A;  3L7O A;  4KPY A;  2ZH9 A;  3R8Y A;  2RSQ A;  1DQ9 A;  1XEZ A;  5HVF A;  1HNZ J;  2YX1 A;  2LXU A;  4LF8 F;  2HWI A;  3LAN A;  1EZZ B;  3DRY A;  3IO1 A;  3AD7 C;  2A2D A;  1U0H B;  3CIZ A;  3BO4 A;  2AEM A;  1NLK L;  4LF9 F;  2AGQ A;  2RQK A;  1CG2 A;  4DPW A;  3PY8 A;  4ETZ A;  4J7C A;  3Q83 A;  1VOM A;  3H20 A;  1U8S A;  1RT7 A;  2OD6 A;  1RT1 B;  3L7P A;  4ECV A;  3UNG C;  1PO6 A;  4DFK A;  4UQT A;  3JQK A;  3K5M A;  2VG6 B;  1J5E J;  2NYH A;  2ZD1 A;  2MSS A;  4RW7 B;  3I4P A;  1QAI A;  3OUY B;  3VZH A;  4B9M A;  2ADC A;  2C2M B;  3F41 A;  3DFE A;  5HBM A;  3KG1 A;  3OTB A;  2E7V A;  5KT4 A;  2J8A A;  3C19 A;  2JVR A;  1RAI B;  2HHS A;  4JI6 F;  1Y9O A;  3JSY A;  2Q6C A;  3IAM 9;  1BHN A;  1P6T A;  4WFA Q;  9ATC B;  3VWS A;  3HK2 A;  1REV B;  3LGH A;  3ZFV A;  3DRS A;  1JXV A;  1X4C A;  1HQU B;  2IDL A;  4PG6 A;  5CD4 A;  4ZVG A;  1TMM A;  2VG5 B;  3JTP A;  4NLY A;  5ADZ A;  2V0N A;  1S12 A;  2YXL A;  1H7X A;  1Q16 B;  3M4X A;  1F3F A;  1RTI B;  2OPP A;  2ATC B;  4L76 A;  1C1C A;  1U0H A;  3M9M B;  1R8H A;  3J81 j;  1DAR A;  1VHF A;  2MQQ A;  3LAK A;  1S0V A;  1DBD A;  4P74 A;  4DPO A;  1TMJ A;  1X5T A;  2UUA J;  2E5I A;  2EW9 A;  4KYZ A;  4LF1 A;  1GH8 A;  4OJ1 A;  1SKW A;  3NGK A;  4ID8 A;  2W2P P;  3QGG A;  4J9O A;  1X9S A;  2QFI A;  4RW7 A;  5IV4 A;  2C2R A;  2HQF A;  2BMB A;  4C8O A;  2E9T A;  2O01 C;  5D15 A;  3OUY A;  4XAK A;  1R31 A;  3B4D A;  1I51 B;  2Y0B B;  2KZM A;  2VJV A;  1S5Z A;  3B8H A;  3EX7 B;  3EUN A;  2ZHA A;  4GC6 A;  1LXJ A;  4JI8 F;  1NRK A;  4JUZ A;  1ZPW X;  5IV3 A;  3IA0 A;  5HSP A;  4TVA B;  4KSE B;  4F04 B;  1TKD A;  2LQ9 A;  2HVZ A;  2DVI A;  4ES3 A;  1REV A;  5KT5 A;  1BWV A;  4CO1 A;  3N6M A;  1IWG A;  3ETO A;  2DEI A;  4OHX A;  1R8A A;  3RB0 A;  3V4I A;  1JQG A;  4LFA J;  1BXN A;  3HVA A;  5BR8 J;  3J7Z 5;  3MEE A;  1TV6 B;  1TTH B;  2DPI A;  2PSZ A;  4C6A A;  4TU7 A;  4L73 A;  2F9J A;  4ECY A;  4WP8 A;  2QLJ B;  5LSL A;  4JYA F;  4UY8 T;  1JNR B;  2K2P A;  1YJ7 A;  3E8O A;  3D0G E;  5IC6 B;  4CH1 A;  2GAH C;  3R6L B;  1N48 A;  1SC3 B;  2D74 B;  3PXG a;  4ZJQ A;  3M2R B;  3CD7 A;  3ZNU A;  3S8S A;  3KJV B;  1RBL A;  4QWE A;  2W24 A;  4ZPD A;  1R8B A;  1SQF A;  4URQ U;  3HMJ G;  1Y5L B;  2D9P A;  3I5C A;  1PAE X;  3POT B;  1G2E A;  1HBM A;  1WDD A;  3Q2S C;  3OLA A;  1JLB B;  3N79 A;  3E51 A;  1R3N A;  5FDL B;  4ELT A;  4ED8 A;  1EQM A;  2BOP A;  3ILI A;  4EEY A;  4OX7 A;  2VJU A;  5DQH A;  4C8K A;  1FWL A;  2I0X A;  3OLB A;  2NRE A;  4U95 A;  2DIV A;  2RQ4 A;  3SMZ A;  2CWX A;  4DFP A;  2Y1L B;  5IT0 A;  4NYP A;  1M5S A;  1FJG F;  2CQ1 A;  4FKX A;  4F25 A;  2V8P A;  3HZG A;  5KG7 A;  1YRU A;  3RRK A;  3GJT B;  2FVR A;  1JLQ B;  4I7F B;  3CXC R;  4ZP8 A;  3ISN C;  4ER8 A;  2N4C A;  2WRM A;  4ZCM A;  2IM3 A;  4LUB A;  1V9O A;  4MAK A;  4C2M A;  1RKJ A;  2W4D A;  3ZTP A;  3U7J A;  2ILZ A;  2C3M A;  3HJV A;  4GMK A;  3B4M A;  4X64 F;  4PWD B;  4C48 A;  2KZZ A;  3BH6 B;  3ZZO A;  3CCM S;  4MYT A;  2APO A;  1S9E B;  2Z2Z A;  3VZI A;  3MPV A;  2UU9 F;  3DRR A;  5LSO A;  3M2R A;  1WEZ A;  1C0U A;  3LGN A;  2C3Y A;  4Q45 A;  5F3T A;  3PV8 A;  4QWD A;  2L08 A;  2CPX A;  1UWA A;  4OHW A;  1IKY B;  3POT A;  2ZBR A;  4DV5 F;  1DTQ B;  3AT1 B;  1LK7 A;  4NEY A;  4I68 A;  5KFA A;  2QA2 A;  4PQU B;  3MPD A;  5I42 A;  4MKV A;  5DGB A;  1UET A;  2WON B;  3ISZ A;  5KT6 A;  5GAH U;  3UN2 A;  5KT7 A;  3V81 B;  3NL0 A;  2DCU B;  2AF6 A;  2VOD A;  3P8B B;  2F3J A;  5T14 A;  5EGY A;  4M94 A;  3RB4 A;  1JLQ A;  1CJK A;  1H38 A;  3W8P A;  3PVX A;  1NJY A;  3GQC A;  1D9D A;  2FJE B;  1EB0 A;  5B0G A;  5GAD I;  4DR3 F;  2FHK A;  3TX0 A;  1RP5 A;  1N8R T;  1SH2 A;  2VU5 A;  2E66 A;  2XCA A;  2EXU A;  2UUT A;  2B9X A;  4AT1 B;  3OFE A;  1ULR A;  5DDQ C;  5KG0 A;  3EJM A;  2ASY A;  4OX6 A;  3OTE A;  3BSC A;  5G0R B;  2OSQ A;  1VJW A;  3HHE A;  5HLF B;  2VZ9 A;  4HHU A;  3LP1 A;  2K1R B;  1HNV A;  2V2V A;  4A8O A;  2Z57 B;  7FD1 A;  1IKY A;  3FNN A;  3TA2 A;  4B3R J;  4HHH A;  3V2U C;  1K0T A;  1LNQ A;  1Q82 T;  4PQU A;  1A7G E;  2YKM B;  1FDN A;  2DHA A;  2CDQ A;  1KVI A;  1HNX F;  1XQI A;  2PC6 A;  2HS3 A;  3V81 A;  1C1B B;  4H4O B;  3C6U A;  5KG5 A;  1M5P C;  3O5T B;  5AE1 A;  1MU2 B;  1RWV B;  5FJ4 A;  1X60 A;  2E9R X;  3NCR A;  4B3S J;  3HHL D;  3D5M A;  2ATL A;  2IJF A;  4NLO A;  5H1S V;  2HVH A;  2KT5 A;  1VBX A;  1NSK L;  1U24 A;  4W92 B;  3FC9 A;  1UMJ A;  2H54 B;  4XK8 C;  1M5K C;  2YWE A;  5DS7 A;  4RUC A;  3NWG A;  2XI3 A;  4CLP A;  5CYM B;  2MKC A;  2F65 A;  1OY6 A;  4NXN F;  2W25 A;  1ZOT A;  4M1K A;  1RTZ A;  5G0R A;  3H25 A;  2FJD B;  4A8X A;  3D6T B;  1N32 J;  3HZE A;  3IBC B;  4I56 A;  2DB1 A;  2WBM A;  3RAM A;  4DCO B;  2W2M P;  4Q0B B;  4WZM A;  3JTO A;  1FX2 A;  4HVZ A;  2KG1 A;  2HBZ B;  4JI1 F; 
#chains in the Genus database with same CATH homology
 3ZTS A;  1MN7 A;  1NUE A;  2DYA A;  2B8Q A;  3NGT A;  5CAB A;  1XQI A;  3VGU A;  1UCN A;  2ZUA A;  2HVE A;  2DXF A;  2NCK L;  1NCL A;  3EVM A;  2DXD A;  4UOF A;  3ZTR A;  3GP9 A;  3NGR A;  1K44 A;  4HR2 A;  1NDC A;  1NSP A;  4F4A A;  3VGV A;  2B8P A;  3ZTP A;  4KPC A;  4O0N A;  3DDI A;  1B99 A;  4DI6 A;  3GPA A;  3WX8 A;  5IOL A;  5CAA A;  1BUX A;  3FCW A;  4S0M A;  3Q89 A;  3VVT A;  3ZTO A;  3BH6 B;  3FBE A;  1S57 A;  3VGS A;  3NGS A;  3B54 A;  1ZS6 A;  2VU5 A;  1WKL A;  1WKJ A;  3FBC A;  1S5Z A;  3NGU A;  1BHN A;  1VYA A;  3DKD A;  4EK2 A;  1MN9 A;  3EIC A;  1NSK L;  1PAE X;  3ETM A;  2CWK A;  4WBF A;  1W7W A;  1KDN A;  2AZ1 A;  3Q8Y A;  1HIY A;  3BH7 B;  3EJM A;  3FC9 A;  1HLW A;  1NPK A;  1JXV A;  2HVD A;  3EMT A;  3PRV A;  3FBB A;  1NDK A;  2BEF A;  3FBF A;  3EVW A;  1U8W A;  3ZTQ A;  4DZ6 A;  1NB2 A;  3JS9 A;  3Q8V A;  3EE3 A;  1PKU A;  3R9L A;  3VVU A;  3ELH A;  1NLK L;  4UOH A;  1XIQ A;  5C7P A;  1F3F A;  2HUR A;  3Q86 A;  3VGT A;  3PJ9 A;  1BE4 A;  1B4S A;  3ENA A;  4CP5 A;  4W98 A;  3L7U A;  2BX6 A;  3Q83 A;  3Q8U A;  3BBB A;  2DXE A;  1NHK L;  1LEO A;  3MPD A;  4ENO A;  4DUT A;  3B6B A;  4F36 A;  3G2X A;  1EHW A;  1F6T A;  4FKY A;  1HHQ A;  4FKX A;  4AND A;  1WKK A;  1NDP A;  1NSQ A;  4C6A A;  2DY9 A;  1LWX A;  5BXI A;  3BBF A;  3FKB A;  1NDL A;  4ANC A;  3FCV A;  3BBC A;  1S59 A;  2AZ3 A;  4ANE A;  4UOG A;  3EVO A;  3EM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...