4CP5A

Ndpk in complex with (rp)-spmpapp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
KVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic Synthesis of Acyclic Nucleoside Thiophosphonate Diphosphates: Effect of the Alpha-Phosphorus Configuration on HIV-1 RT Activity.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE, CYTOSOLIC
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4cp5A00
4KPCA 4WBFA 3EVWA 3VGUA 3ZTPA 4DI6A 1F3FA 3EVMA 5CABA 1BHNA 4FKYA 3PRVA 4ENOA 1W7WA 3JS9A 3Q83A 4F4AA 3BBFA 3FCWA 2BEFA 3VGSA 1NDKA 1S59A 1NPKA 1B4SA 4F36A 3DDIA 1NCLA 1NHKL 4O0NA 1EHWA 1BE4A 3EICA 1K44A 3WX8A 1MN9A 1NB2A 1NDCA 2DXFA 4UOFA 1B99A 1UCNA 2ZUAA 3ZTSA 3BH6B 3ZTOA 4C6AA 3ZTRA 1ZS6A 3DKDA 2HVDA 3R9LA 4S0MA 3B54A 5CAAA 3ELHA 3NGSA 1S57A 3NGUA 2B8PA 1KDNA 3VGTA 2AZ1A 3FKBA 1BUXA 4DZ6A 4FKXA 1F6TA 2HVEA 3BBCA 1NDLA 1JXVA 1WKKA 1NSQA 3ZTQA 3Q8YA 1WKJA 1HIYA 3EMTA 3FCVA 3GPAA 3Q8UA 3FBBA 1PAEX 1LEOA 2B8QA 3VGVA 2BX6A 3L7UA 1MN7A 1NSKL 4EK2A 3FBEA 2AZ3A 4HR2A 1NDPA 4UOHA 3VVTA 5BXIA 5C7PA 2HURA 4ANDA 3VVUA 2CWKA 1LWXA 3G2XA 3EJMA 4ANCA 3FBFA 3B6BA 2DYAA 2VU5A 3BH7B 4CP5A 3FBCA 1HHQA 2DY9A 3ETMA 2DXEA 1NUEA 4UOGA 3ENAA 3FC9A 1HLWA 4DUTA 3EVOA 3NGRA 3Q89A 4W98A 2DXDA 3EM1A 3PJ9A 1S5ZA 1VYAA 3Q8VA 2NCKL 1XIQA 3MPDA 1PKUA 1NLKL 3Q86A 1NSPA 1WKLA 3GP9A 1XQIA 3EE3A 4ANEA 1U8WA 3BBBA 3NGTA 5IOLA
chains in the Genus database with same CATH superfamily
2VPXB 4L3KA 3DI6A 5EGYA 1CSJA 2UZAA 3IS9B 4ZLJA 4J9QA 2DPIA 4M5MA 3QATA 3G96A 2YWWA 4EO8A 3NS6A 5L1LA 2ALZA 1LV5A 2XS7A 1B7FA 4RW8B 4MH8A 4ZK7M 2W9CB 1ITPA 3OTCA 5I3QA 3M8SA 3JB9k 4P74A 1NJIT 2MJNA 4Y00A 1J5EJ 2R2TA 2BW7A 1LXNA 4F8RA 2Y0BB 3RB0A 2B7CB 2V34A 1XEZA 4ZPCA 2MKJA 1B4SA 1ZAWA 3MMBA 1CJTB 4L75A 3BGFA 1SQEA 3D6HB 4HTJA 5K5MA 2NREA 3CGIA 3KJQB 4O3QA 1DAXA 1TKZB 3E01A 3RAMA 4B3SJ 4K59A 1RBLA 1K44A 2C2NA 4URSA 1IBLF 1URNA 1GTHA 2Q3PA 2VC0A 4NEZA 4LQ3A 5HVGA 3NL0A 2DH9A 4MK9A 4YB5A 2H1YA 5AJ3F 1T9VA 1S6QB 2VPYB 1TUGB 2FIUA 1P6TA 3W62A 3KHLA 4LF4F 4U96A 5ETLA 3QT5A 3MUVP 2WZ1A 3H0PA 3S7RA 4DFPA 1CPZA 2MQ8A 1S6QA 3FZ2A 2KHDA 3CW2C 3ZTOA 1SIWB 4K50A 1IUJA 1U0SA 1LW0A 1YDLA 3HDSA 1ZS6A 2DGVA 2FGCA 4QZVB 5F3TA 3THTA 2OP5A 4PG4A 1VGYA 4CO2A 3FJ2A 2W2OP 4F4WA 5KFBA 3LWMA 2CQ1A 3PVXA 2NUHA 3M1VA 2DGSA 2ZDOA 1IBKF 4RU2A 5HP1A 2XMWA 3C6UB 3HSGA 5HVFA 4DR4F 4O4GB 1XWLA 1T3OA 3GV7B 3T41A 3FKBA 1T03B 2CPYA 3CO0P 2BJ9A 1PAUB 1S1XA 1S7HA 4LF8F 2OFGX 3DOLB 3UR0A 1FKAF 1LOUA 3GCXP 4WFZA 2KU7A 5HJXA 4ED3A 1F6TA 1VQ8S 1Y7PA 1NSAA 1FRLA 2HGNA 2Y1JA 1UVNA 3FQKA 2HKEA 1N32F 4F3MA 1JKHB 4AXIA 3MCNA 2EFOA 2FVQA 3SFUA 5H9FK 3M4XA 2YKPA 4RJVA 3VHQA 4LF9F 1WKJA 1LW2B 3DGPA 2W7OA 1HYSB 1SQGA 1TAQA 4CH1A 4PWDA 4KGMA 4IQMA 4Y6IA 3OXLA 3W2WB 2XCAA 4DV7J 2KM8B 2JHEA 3AOAA 2CIMA 3KLIA 4P10A 3BREA 5KFQA 4N77A 4EI2A 3X1LB 4ZS6A 3LA0A 3DYAB 1K1SA 2FJBB 4IFYA 2LECA 4K4YA 1D0EA 4FF3A 4JV5J 2RHSB 3V4IA 1YIJS 1KN6A 3OHAA 2OPPA 5B0FA 1CEZA 2YKAA 1NXIA 1Y0HA 3DYAA 3RU0A 2GVDA 3TA1A 3O6QA 5KFOA 1U8SA 4BWJA 1BWVA 2CWKA 2KT3A 5E3CA 3QIDA 4QQBA 2V8VA 3CCVS 1DZ5A 2XLKA 2LYVA 2FLOA 3KMSA 3MAAA 1RAEB 2CVEA 3OXFA 4GC6A 1KD1T 2UP1A 3FBCA 5C25A 5CYJA 1RAIB 1LWFB 4ECSA 1TKTB 2X3GA 3DLEB 4OX8A 4DV4J 1J27A 3TRGA 3VZIA 2HHVA 2A3JA 2DISA 2NSBA 4NWBA 2XS5A 1AFJA 2ZHAA 4A8KA 2XZDB 1YX2A 4RNMA 2I8EA 5KT6A 1DURA 2CPFA 2D3ZA 1C4AA 2VFUA 4DF8A 1YRXA 2FPHX 5KFTA 2LA6A 2RVJA 4O3SA 1CULA 2GQCA 1RT5B 2RKIA 2HBRB 2BQUA 5CH7B 2IFXA 3TO8A 1HNXJ 1U1PA 1SXLA 3VR1A 2R3VA 2FGOA 4L72B 4CRJA 5F8IA 3BYPA 3KG1A 3GP9A 1RP5A 2M0GB 2QRRA 3W9JA 4ANEA 5I42B 2UUAJ 1U8WA 4K7QA 3L09A 1DARA 3NGTA 4AD6A 5D3GB 1UVIA 2L9DA 3T1HJ 1LXJA 1ACMB 2P6SA 3N5BA 1OPZA 2HFZA 4DU7A 2B0GA 3VZHA 4ELVA 2J5AA 2EBEA 3R5GA 4NA3A 4Z37A 4NYZA 1FDNA 3Q83A 1WSVA 1FRKA 4DZDA 2Y1IA 1RWKB 2RUSA 4E0DA 3A8KA 3UD3P 3HI9A 3FCWA 4KGKA 4RNHA 2HGLA 5K8NA 2WONA 4TU9A 2MQMA 5GVQA 1IM6A 1E6VB 1UTAA 4EYIB 2J0SD 2CZVC 2QSWA 5EWFA 3Q22A 4DN9A 5BYQA 4RW6A 3Q23A 1JX4A 2RRNA 3FVYA 4FYXB 4LUBA 4ZVGA 3VAIA 3TAPA 4Y65A 1HNIB 2YTCA 2E1PA 4EFAC 4OI0A 1T9YA 2C1EB 1UMJA 2ZBIA 4FN5A 1U2FA 4DSFA 5BYRA 3GSDA 3JTOA 2H5EA 2HZCA 2NS1B 2VQEF 2FJWA 2XLIA 2YNIA 1S4EA 1RYRA 3RZAA 4OLOA 3TI0A 4L76A 3IN5A 2FVCA 2Q43A 3PIOQ 5KT4A 1HNZJ 3MM9B 2GHWA 4FYWB 1NHUA 4O3RA 2QLJB 3VWSA 3MHYA 1QD1A 2GVZB 3TVKA 5HQLA 3CCSS 4WFXA 3NG8A 3RAQA 3BPDA 2OPRB 4HHJA 4A8WA 4CLWA 4ZP6A 4X62F 4XIUA 2KXHA 3RR7A 2VB6A 3TYTA 3GG1A 1CC7A 4KYZA 4MYUA 2DD8S 4FF4A 3MMAB 2CZ4A 3C16B 4QYZJ 4N41A 3ZZYA 4JV2A 3G4SS 1P27B 1U09A 2K7KA 1WOOA 2HEKA 2WW8A 3OFGA 5J1EA 2DGQA 2LEAA 4HT5A 5IC6B 1RWNB 1UVJA 1NKCA 1UVLA 3RW6A 1ZAXA 3M9MB 4JV5F 5A8KA 2CJAA 2CPEA 2R8IA 2KVQE 4KPYA 5KFAA 5F8HA 2HIQA 2AIRB 1HBMB 1HIYA 2HNZB 3LOUA 1FWPA 4TU8A 1DFDA 4OV1A 2RUGA 3RB4A 4UTGA 2QA2A 3P5TL 3C46A 4QR0A 5KFIA 1U1MA 2HNDB 1S9GA 4K4XA 1NNDA 1SPBP 1S1TB 1WC1A 3K89A 4HI2A 4RPFA 4Y2MA 4Q5VA 1RHRB 3FBBA 2E1AA 3DDKA 3OUYB 5LSOA 1KRPA 4P2SA 1FFGB 4ZMMA 2BANB 2Y8YA 2GC8A 4WWSA 1RTJA 1S1XB 2G1DA 3MFHA 1N5VA 3FBEA 1GH8A 2BW2A 3R7BB 4HTIA 4I2PA 7AT1B 1H7WA 4O44B 1RCOB 2H5JB 2XWXA 3I96A 2MZRA 1P9QC 1FTRA 4CLKA 3F44A 2XYGB 3HJVA 1HI8A 2CADA 3SI8A 4LF8J 4NZ0A 3SSRA 4GKKJ 4K4SA 2CQBA 1M1GA 2OPSA 3DRSB 2LMIA 3UNYA 4DV3F 3CCMS 2V63A 3OW2R 4YDXA 4ATNA 3LP2A 3POTB 4DXLA 3DLJA 3IBWA 2DRDA 1NK7A 2XC9A 1Q82T 2F4VJ 1HBNA 2ZDPA 1MNEA 2VQEJ 4U8YA 1Q79A 2PA8D 3K59A 2W9AA 2EEYA 2RQKA 4QU6A 1HD1A 2RT3A 1QTMA 2WK4A 2AGQA 3Q8VA 4YN3B 3CJ3A 1XIQA 1Y11A 3M2VA 1RA7A 2CQDA 3PJWA 3E01B 3BYRA 4H4MB 4OX9F 3GFZA 5DDQC 4Q8FA 2HHSA 1BQMA 2LQ8A 3BR8A 2N4DA 3R7NB 4WFAQ 3JTPA 4GO7X 1IBLJ 4PQUA 2A2DA 2OPSB 1GTEA 3MTJA 5GAHI 4KV8A 5LSRA 1TK0A 1FDBA 1RHJB 4M5DA 2P8IA 1CJVB 4GVBA 2HNYB 2DGXA 2M4MA 4M1KA 4F67A 2JFDA 2B9EA 2BACA 3W2WA 5GADI 2B5JA 4DV5J 3R6LB 3SV3A 4BHQA 1U1KA 1TVRB 1JMTA 1RKJA 4A8MP 2WOMA 5IM0A 4EEYA 5IT9Y 2KZMA 1I1GA 4Q2MA 3KNAA 2DHGA 2RAQA 3DFEA 2ZZMA 1OYDA 2EG2A 4DL6A 1B0TA 4ECXA 4GKJJ 1NAQA 1O6XA 3KG0A 4NLXA 1GQEA 4O0NA 2ZZTA 2ALYB 2XSFA 4IG3B 3NGDA 3AAWB 1YRUA 3WC0A 3ONQA 2O01C 3WX8A 3OTOJ 3BSAA 3AQPA 1RI7A 2LU2A 3OL8A 3IM9A 1EB0A 1YI2S 3H4DA 4YDDB 2OTLS 1V3RA 1WEYA 2HG4A 2LEBA 2F4VF 4TYAA 4XTTA 2ZH3A 3MM5B 3TOQA 3NCRA 4MIAA 4ZN1A 4KHPF 4QCLA 1NPRA 4JI8F 2LU1A 2H65B 3MMCA 3IBCB 4LFAF 2I38A 4ID5B 4UT4A 4RW9B 2OEJA 4WXWA 3TAMB 1NJXA 4NCAA 2VA3A 4DCJB 3CO9A 2Y8WA 1OY6A 2IJRA 3S6EA 2DHHA 3AD9C 4JUZA 5KFXA 2YQ0A 2VJVA 1YZ6A 4NLRA 4CDIA 5I3UA 3M8PB 3H2VE 2N4CA 4FNIA 4HH1A 2ASJA 1UZDA 2F40A 3CULA 1H3DA 3CC2S 3OFFA 2NXJA 4J9PA 3GV8B 5CD4H 3UCUP 2Q66A 4DQRA 4DOZA 2I2YA 4X4OA 3D0HE 4QWAA 1FESA 5I3PA 1X60A 3EWGA 3ZZRA 3H5XA 2EFPA 1YG0A 2JEGA 3IC1A 3R27A 1N34F 1WKKA 2ZD1A 3M6WA 1UZHA 2J7KA 3FQLA 1MSWD 3AA9A 2G0CA 4XDCA 4C97A 3OJUA 1HBUA 1UWAA 5B08A 4PXDA 8AT1B 3C6UA 5THWA 2VJUA 1VQ7S 3T5KA 3EDQB 2AEJA 1HI1A 1RB0A 1KKHA 4NEYA 2MGZB 5F9NA 1FERA 3TP2A 3GIIA 4DCOB 2UVVA 4LF7J 2XB2D 2J9CA 2P6TA 3QFWA 4XPEA 4U95A 2C2EA 2GQ2A 4DL5A 2CG4A 3QO9B 4YQWA 1ZETA 2JH3A 2V50A 3L7UA 3T5HA 3HFZB 1A6LA 4USTA 3CDEA 3UI3A 4OZLA 1R8CA 3PHTA 5EUHA 3M8WA 2V4JB 3QT6A 2ATCB 5D6GA 2XO7A 3EJMA 4JV0A 2YWHA 1TQLA 4RUAA 1FKOB 2EKNA 4CI0B 4MJKA 4DPWA 3W64A 2ZH4A 4JI1F 3I0RA 4R0JA 4IRCA 1HHQA 1D9DA 2N82B 1K73T 4CWBA 3KLEA 2V4RA 3BSOA 3BV8A 1WC5A 2PC6A 4JI5F 3DRRA 5DDOC 3S01A 1QSYA 2R7SA 4C2MA 2A2CA 2V2QA 2LQJA 4FS1A 3KK3A 1TELA 3JSRA 3I5CA 1IQZA 1S0OA 1RGVA 3C8YA 2O67A 2DXDA 1RWVB 3CJ2A 2ZC4A 2CVIA 4N56A 1RT5A 3P4UB 3GFYA 5KFYA 4MKBA 1RJJA 3JQMA 5D15A 2GAGC 2Z2ZA 3MM7A 3A12A 2E66A 2ZVSA 3KJNB 1TKXB 4NLWA 1RQ0A 3QRRA 4AL5A 2BBEA 5HN0A 4DSKA 5IOLA 4DR7F 4ID8A 1PG5B 3MM7B 3PX6A 3W66A 3SIPB 4NRUA 3JQKA 2XO6A 3RGIA 4JYAF 3PEHA 3Q8QB 4DJBA 1N56A 1TL7B 2X1BA 3PEJA 1MROB 4PYDA 1KHVA 3BF4A 3KK3B 4P7VA 2B4PA 4L3NA 7FD1A 3KHHA 4OZ3A 2HHHF 2V6AA 1FVQA 3DDIA 3RRKA 2GJFA 3W63A 1S79A 5DLFA 4QOTA 3CCES 4DPOA 2VC1A 3DM2A 4ZJLA 3J80U 1K0VA 1KWMA 3TX0A 1I5OB 1C0UB 2R42A 2UUWA 3NCPA 3H5UA 1REVA 2GVDB 4WFBQ 1FXLA 4QWEA 1D8YA 4AE5A 4YY3J 2VBYA 5GMDA 1VJWA 2RNEA 2FB0A 5EDWA 1SKRA 3T9ZA 4CCHA 4QWCA 1B64A 1T94A 4K8RA 1PC5A 1S1WA 4P73A 4XAKA 3OLAA 5CAAA 1T8EA 2YNHA 1N36F 2MQOA 4DQSA 4ZVRB 2JFKA 4ILRA 1U1QA 2BJ3A 3RG6A 1IKXA 4ETZA 2EK6A 1ZPVA 3K58A 1RHMB 3GZ7A 2BOPA 2OPRA 5G0RB 1OMSA 2Y0SD 3M30A 4KC5A 4RW7B 5A8RB 3A8JA 2BANA 2P9CA 2XMTA 3GU0A 2CYYA 5KFUA 8RUCA 5J2MB 4DS4A 1NEEA 3BO2A 1X5OA 1VQOS 3FSYA 3I9ZA 4ZVPB 1VK3A 1DTTB 2VFRA 4WCEQ 2YKNB 5KT3A 2EC2A 4PPDA 2HZVA 1JNRB 3UD4P 2V9WA 5HAOA 2JOQA 3EPGA 4ZLPA 1HWJA 4UQGA 2DBBA 1WC3A 4PUOB 1RZMA 2NZCA 3MZIA 1WHWA 1M5SA 3UWTA 2G0JA 2G2ZA 3OV7A 1FJGF 4A47A 3THVA 1DQ8A 2NPIA 3D54A 1TKZA 1X4EA 4ZITA 5HROB 1KSPA 2QTWA 1DTQA 2YVSA 2PIIA 4PPZA 2A18A 1NJWA 4B9VA 1YJUA 4ED5A 1LEOA 2B8QA 4F7VA 5L1KA 4YOEA 1Q95G 2F8HA 4C3KA 2AJFE 1RLCL 1XK8A 2XMVA 3VV2B 3VVTA 1HQEA 3P5BP 4ED1A 4I67A 1RAAB 2W24A 1M90T 2W8KA 4DR4J 2D3OR 1RAGB 1EJ7L 2K3IA 2LQ5A 1QDUB 3QBCA 4NRTA 4MKAA 3TWZA 3CCUS 5DG7A 1F9FA 2DB1A 1HNWF 3BH7B 5HBMB 1C0TB 2YKQA 3J7ZT 4CM0A 2DY9A 2XMKA 4C8MA 3MM8A 1JKHA 2MPUA 2FYXA 1K1QA 3MUTP 1N5YB 2PMZD 4LF5J 1P8GA 3N0VA 4H4KA 2AYBA 2O66A 4F25A 3PRBA 2C42A 2RDIA 4QW9A 1BQXA 1UPPA 2MKKA 2UXBF 1RXOB 2B7BB 1FDDA 3EVOA 1VQLS 1DQ9A 3UCGA 4OI1A 4IFYB 4G1IA 4OYOA 1YJ7A 1SV5B 4CYUB 5F8GA 1NSPA 4J9MA 1Y4ZB 2Z56B 3KDNA 4ECRA 1NK6A 3G8SA 2HWIA 1FJGJ 3O2IA 3BO4A 3C2PA 2FHJA 4RUHA 1FVSA 5A6WA 4IH5A 3M8QB 3N6NA 1VQYA 3MCSA 2H9ZA 4Y2AA 2VD3A 3U02A 3VQTA 2K7JA 3ENVA 4LIWA 4QJVA 5T14A 1IBMF 4K0KF 2HHXA 1IR0A 3EZUA 3TR5A 2YKNA 1F5CA 2ZOMA 2M52A 1TL3B 2F65A 1KONA 2PE8A 3FSXA 4O23A 4M5HA 3CMAS 2W1BA 3C6TA 1VHFA 1RTHA 1NDKA 2HS3A 3HCXA 5B0EA 1RADB 4D3GA 4E98A 4OHWA 5K8MA 1U47A 1S77D 2EFVA 1ZPWX 3ITHB 2OEMA 3BKFA 3JXOA 1NHKL 5G0RA 1FI4A 2XG8A 2Z57B 2BABA 2FC9A 1R0CB 3RUBL 4ES1A 1M1KT 3CIZA 1SKUB 1FE4A 2XMUA 4C7QA 1IM4A 2JX2A 3MD1A 3QAEA 4ZCLA 2GW8A 2UUCF 4DBQA 1B0PA 1UEVA 3RRGA 2AEFA 3LW5C 3LPYA 1UCNA 2CNOB 2ZUAA 3IM8A 4USUA 2AW0A 5IXUA 1MWQA 4X65J 4DV6J 2KFNA 3PO5A 6FDRA 2IY5B 2E1CA 4P75A 3HT3A 2DK2A 4YR2A 2HW3A 4ZPWR 4OZNA 1CJUB 4OMFG 1RTHB 2APOA 2M2BA 3GILA 3EGNA 1X5SA 1MROA 1NBEB 3CIMA 1Q4RA 3UO0A 1HQUB 2E7XA 3NBPA 2BE7D 4N8NA 1KDNA 3PXGa 2FHKA 3ZZZA 4C3MA 5T7LA 5KFHA 3J7Z5 4B9SA 2XEXA 4RBUA 3VAHA 2ZOFA 2A6MA 4P9SA 5LSLA 2HMIB 1OS5A 3UW1A 4MKYA 2HLUA 2R7XA 3V4IB 1U02A 4MIBA 3C15A 3CJTA 1RKIA 3X3UA 2VL1A 2HHHJ 2DIVA 1Z1ZA 2CPHA 1DY3A 1OY9A 2ERRA 4HI1A 5FIIA 3IFEA 4BS2A 1Q5YA 1FX4A 4HL9A 4LFBJ 3MMCB 1PSDA 1GEHA 4IFVA 3FUYA 3OR2B 3QSIA 4M63A 5KTQA 3RBEA 4Q45A 2C28A 4I0WA 1YK9A 2HFUA 4AUKA 3DLBA 1AYEA 1FKPA 1RE1B 3DRRB 4NPOA 4RUBA 3AA8A 4Q44A 3UVJA 4NASA 2XSJA 2NQPA 2DNKA 2P9GA 4LF9J 3FFIB 3HXMA 3GLJA 1S6PA 2EFGA 3Q8UA 1VQ5S 2KTQA 4CYUA 4YFUA 1JLCA 3UDCA 2C2KB 4K4TA 2JEJA 4NLGA 1MN7A 4B3MJ 1RU2A 2G4BA 3HKWA 3MPVA 3I4HX 4MT1A 1U6BA 4NCGB 2HSEB 2WVBA 3HP6A 3ZO7A 3VQSA 5HQ8A 3DLLQ 2DYAA 1X4CA 4M5DB 4RU9A 4DR5F 2GA7A 4B9UA 4F2RA 1ZM3A 2PSZA 1RTDA 4I64A 1R0AA 4XK8C 4OYAA 5E0OA 4WP3A 4C11B 1Y00A 4IG0B 2XY7A 2BYCA 1LWFA 1T95A 1C2PA 2N3LA 3I9V9 3MM6A 3EYZA 2WHOA 1S76D 2UV8A 2EVZA 5GAGI 4DUTA 1JLFA 2DNQA 2JC1A 3D0IE 3THPA 3IAM9 1EQ0A 1YBTA 3QO9A 4NI2A 1YHQS 4JI5J 3IG1A 1L3VA 2BRLA 3NAHA 5KFMA 1T03A 2K1RB 4NXMF 5IC4B 3LWLA 3EDRB 2E5IA 2DITA 5C24A 1DHMA 1Q8KA 3WDOA 2JWNA 1LK7A 1PILA 1S99A 1RWWB 2LEPA 2LQ9A 3ENQA 1RLDA 3EVWA 4CNZA 3J7AN 2V67A 4UW2A 4DX5A 5B0BA 1TFYA 3DOMB 3QGPA 4ZIWA 1W2IA 4WP9A 1FK9B 2VODA 5GMKa 4OL8A 2POKA 4GVLA 4DU8A 1SI9A 2BZ2A 1NH8A 2V8DA 3PDNA 4Y2CA 3V81B 1J5OB 2IAJB 5L46A 4ZPDA 1SJ3P 1EETB 1FRMA 2HFSA 3NAIA 2MGZA 3HM9A 4KO0A 3IRXA 3FGVA 3GSIA 5HVHA 2MLZA 1EP4A 2KZZA 1JLCB 1NDCA 3K5LA 2A1BA 4DSJA 1U1OA 1I6JA 1JWWA 4K2XA 4WTOB 5L9NA 3D3BJ 4DL2A 3D67A 3R2DJ 4AFFA 5HMZA 3HHLB 1S1WB 1CQMA 1GMWD 2KH9A 2VQFJ 2RS2A 5LXYA 2YWKA 3ZTRA 3LUYA 5EX0A 3TVYA 2XBPA 2VKZG 4DQIA 1RU1A 2NLWA 3M32B 4BC7A 1HFEL 4OZ0A 3W65A 2XQCA 2W4PA 1JLGB 3O44A 4WFNQ 1XMOF 1S0NA 2R9LA 2XS2A 1U0HA 1YZ7A 2JZ5A 2WSCC 4BCAA 4I1TA 3DOKA 1YRTA 3LO3A 4B3MF 1R89A 3OT9A 4E8UA 1JLEA 2KHCA 3SQGB 1S1UA 2MKYA 3CD6S 4FKXA 2AV5A 4CLTA 3VCDA 2M9KA 3KXDA 4IO1A 2C3YA 5SUHA 1SJ4P 2DO4A 2XLJA 3KG4A 1SH2A 4C3LA 2KG1A 4ERDA 1TL3A 3GJSB 2L48A 4LRAA 5CHCB 4KQZA 3K5OA 3TJ8A 2GIRA 4OI2A 4QYRA 1ROFA 3GG0A 4KHMA 3HHNB 1TK5A 2MB0B 4A8FA 1VK8A 2V8GA 1X7VA 3KDOA 4QPXA 2I1RA 4ED2A 1LWCA 1BC6A 3CPWR 4OZ2A 2H4YB 1D09B 2KVIA 4OI4A 4EWTA 2V8HA 4EYHB 1X9WA 1BMQB 3FNNA 3MEDB 4IDKA 4ZVEA 2HQCA 5E41A 1XNRJ 1UPMB 1WHXA 4EMDA 1QUVA 3A3NB 1LNQA 3D7SB 3GB0A 3SCLE 1NMEB 2BX6A 3A3OB 3PHEA 2FTRA 1C1BB 2AGOA 1VBKA 3G8QA 3I55S 3J81Y 2Z30B 3PCOB 2PI5A 1N0UA 4ANDA 3H90A 3QIPB 5F0UA 3J7YI 4PXEA 1RTJB 1LWXA 2IM1A 2W2MP 2W2PP 2I0XA 1CQNA 5CYMA 2OGUA 4JP8A 2J0XA 3IGNA 5B0CA 4RUCA 1U45A 2J0QD 4C8LA 1QJHA 5FLXY 4M5JA 3RW7A 3QFHA 2YXLA 4PXCA 1K47A 4WFYA 5I4MA 1DQAA 1FT8A 2ACYA 1QY7A 4JI2F 2ZH6A 3FRYA 3CCRS 1RWPB 2HQDA 2PMWA 3UD5A 1O51A 1HWLA 3I87A 4UOGA 3H40A 4NLDA 3H4BA 1H74A 4YB6A 4G1PA 3KLFA 1GNKA 2DR7A 2IRUA 4B9LA 4JI0F 1PJ5A 1OJ4A 5D0GA 3BDPA 1A9NB 5KG5A 5SZTA 2W01A 1XMBA 2Y1LB 3DRXA 3K5MA 4DV3J 4L6V3 2ILZA 3DXBA 4NCBA 4N8OA 1ZZFA 2RF2A 3PW0A 2XM3A 3CJKB 4NZ6A 2F63A 2D74B 1UFWA 2OPQB 3A8EA 3SQGA 4CLZA 4P71A 2CJKA 1DJ0A 2HVIA 2WSFC 4J7CA 2FC8A 1BQMB 3BDEA 4FYVB 4DI6A 1T9UA 2AKWB 2F8MA 3EVMA 2MZTA 2IC3B 2I9SA 3MAAB 1FRIA 3UN5A 1KOOA 2DCUB 3QWPA 2O1PA 3BGLA 3R6GB 1N5SA 1F9HA 2C3MA 3UPFA 5DDPC 1WD6A 2W9BA 4MYTA 1NZAA 1TV6B 2CNNB 3MECB 3R5BA 4NLYA 3JYTA 3KHRA 2K2PA 1U6ZA 2C2DA 2ZE2B 1GT8A 2WAQD 1TUVA 4R0EA 2Z2MA 1VBZA 3OVSA 3BB5A 1F3VA 2JNJA 2VG7B 2WVFA 4CNYA 5DGAA 2DHAA 1LK5A 1I3OB 1EHWA 1FX2A 1WWHA 2M7SA 2MHNA 2YNGA 3GFXA 2HNDA 3IBFB 4LF2A 4ZVOB 2GMLA 3CD7A 3UDVA 3OBIA 3LP0B 3PO4A 4K4VA 5LM7E 1FXRA 3TARA 1U2CA 1U1RA 3CUNA 2XZTB 2E29A 3M8QA 2QEXS 3EGWB 4YB7A 2MKIA 2QMXA 1NJYA 2IYGA 4UOFA 5F3ZA 1HMVA 5FDLB 2LQBA 3K57A 2J7WA 3QMQA 2QV6A 3EUNA 4ELUA 4DHVA 2YPZA 3H8YA 3KLGB 3K5NA 5IM0B 1T3NA 2HVDA 1LFWA 2LP4A 1VBYA 2C3UA 2HHPA 3TZWA 5ETSA 3H25A 4LRCA 4Q43A 1ELOA 3MGJA 4HKQA 2CJ9A 3NGUA 2BJDA 4NMXA 4RLEA 2VDHA 3MFIA 2O5DA 4M5LA 2RB7A 1JLQA 2RJZA 1Q8BA 3A13A 3CEDA 4URQU 5JXSA 4CT8A 3CJSA 5IFMA 1HNZF 3B78A 2EXUA 1BWEA 1NU4A 1UA0A 3NWGA 1T05A 4PQAA 1M5PC 4EBDA 4J9NA 5H9EJ 3K8WA 3ISND 3F73A 1FHTA 3R5AA 1C1CA 1R3NA 3M2VB 2ROPA 4H4MA 1LKZA 2DT9A 1WC0A 4P2MA 3M8YA 4DPTA 1CS4A 3OVBA 1IN0A 1RHUB 3DGVA 2MY7A 3AXMA 4CQ1A 3PM9A 2F8EX 3D1HA 5B09A 2VG6A 2PFDA 2V9KA 4LBHA 2BR0A 3FEZA 4LMZA 4IH7A 1F2HA 1YTYA 1XERA 1TP7A 1IR2A 1U26A 2E5LJ 1WG5A 3OFHA 4X2BA 1PJ7A 3GMGA 1TVRA 2ZOGA 4A8OA 2HMIA 2ZITA 3E2EA 5HMXA 3CC7S 1DBDA 3C3LA 1CJTA 4O0IA 5CCLA 4OYWA 2ZH8A 2YX1A 5CXTA 2V4QA 1KTVA 4HYKA 2BMBA 4OQJA 5KG2A 3W5XA 2UXBJ 4ITSA 5D4LA 3N6LA 2MQQA 5IT0A 3CDBA 1RACB 1RBAA 2ZH9A 3BSCA 3LALA 2VG5A 1H2UX 3A8IA 1GXLA 3KNGA 2BKPA 3V6HA 3NP5A 2VFTA 3KLEB 4IG0A 1T0TV 4HACA 2MEWA 4K5RA 4OYMA 2W9BB 1WSRA 1Y5IB 1KVJA 1TV6A 3MECA 2GCFA 2ZKTA 3ZZUA 5KG7A 5A2QU 4LVOP 2UUBF 3G82B 1R7IA 3DU6A 5IV3A 1HBMA 4PUOA 1IKXB 2UVWA 3D4JA 2OTJS 1QM9A 1N52B 2BE9B 1O5JA 5DG8A 2UU9F 1CLFA 4N76A 4I2QB 1V3SA 1RTIA 1YBAA 2K3KA 3Q89A 1VC0A 1S1UB 1SVDA 2CQ0A 2QN6B 1XMQJ 2OKQA 3I5BA 1VYAA 4OX7A 4N5SA 3J7YU 4FYDA 5FJ4A 2JLEA 3FCHA 1JLQB 3Q86A 4JI4F 2GO8A 3UCZP 4L74A 4OI3A 3L4BC 1HPZB 3NNCA 2R8KA 1XN9A 3QZ8A 5H9FJ 5JVGQ 2VG5B 1IQTA 3DOLA 2FHOB 4KPCA 5KG4A 3H98A 4MK8A 1X9MA 1REVB 4NLSA 3WC2A 3QGHA 5CA5A 3VALA 1ZM2A 3HLUA 1C4CA 2H48B 1JNZB 3K8VA 3P49B 1WOSA 3UFCX 1KQFB 4R8UB 3GTYX 4IFVB 1QSSA 1S9GB 2KJWA 2CG8A 2BEFA 2KL8A 3VGSA 1M1HA 5KFDA 2MQPA 4DUYJ 3TANA 1U48A 4B3OA 4KHRA 3PX0A 4DS5A 1F60B 3HFVA 1NCLA 3V2UC 1OQ6A 4IH6A 5A6PA 3PIPQ 3KLIB 1IKWA 1Y3KA 3CXCR 2GAHC 4FPIA 4ZCMA 2RQCA 4V1Ak 1SQFA 3N5FA 5D0RA 2HQGA 2A6OA 1F1BB 3D1OA 5LL6d 3VAMA 4H4KC 2J9DA 3OTEA 2KI2A 4E2FB 1UW9A 2MKHA 4ZVQB 1TMMA 2CNLB 3MEEB 3MPYA 1D1UA 1JIHA 1VQ6S 2ZM6F 2XGQA 1NO8A 5KFSA 1T9XA 2IIHA 2COLA 3QLHA 1U4BA 4ZVTB 3W60A 1W26A 4DV2J 1OIAA 3G9CA 2CQ4A 2R7VA 3ET6B 2HHTA 1H98A 1RK8A 2ZJPQ 4IRDA 1U1NA 2BJ7A 4MK7A 4ZHRB 4LF6J 1APSA 2UUBJ 2JJ4D 3N79A 3H2UB 4FDFA 4USWA 2XWYA 3TQEA 4F3QA 2PDAA 1DTQB 2MHEA 2U2FA 2QE5A 1WTFA 1JJHA 3KJVB 2KYXA 2DNGA 2RILA 3OTBA 3KUGA 4Y2KA 5DJBA 3QT7A 3TX8A 2UXDF 2AU0A 1NM2A 3TVZA 4PEOA 2L08A 2KB2A 4WKRA 3DRYA 3GFHA 2W9CA 1GXTA 1FXDA 3W3SA 2W4DA 1MWZA 2MQLA 4NX9A 5KFVA 4RZRA 4KGXB 3ITHA 1HR0J 1VHIA 2HPUA 2VG7A 3Q2TC 3HSJA 3IP0A 4LBPA 5BJRA 2PT0A 1Q16B 2M8HA 2RIJA 4I2QA 3RBZA 2OSQA 2VASA 3TEGA 3UE2A 4DLEA 1V6HA 5HL7Q 4FYYB 2BXJA 1Q7LB 2CJBA 1S0MA 2E1RA 1SH0A 2MYFA 2OFHX 1D9AA 1Q1KA 1X0PA 4ECTA 1NSKL 1YJ9S 3L95X 4DR1F 1VQKS 1FCAA 2VFSA 2E7VA 1RT2A 3C14A 4I68A 5C24B 5KOWA 1PO6A 4Q7AA 2BJEA 3DCAA 2ZHOA 2BM1A 2RHQB 3WX4A 3E51A 1XR7A 5KFKA 4Y3CA 4ANCA 3N01A 1AT1B 5D78A 1MW7A 2DKOB 4TNOA 5FD1A 1X9SA 1NK0A 4KTQA 1VRTA 3QJPA 1LWEB 1M0SA 3NRBA 2QMUB 4UOCA 1SKWA 3OR2A 1HARA 5MAOA 1Y3JA 4NLTA 3M2UB 5CZVA 5A2QY 5L1IA 3AOBA 4WJBA 4IKAA 1SC3B 3A1YG 1RYSA 3EXCX 3PFOA 1RWMB 1E6VA 3M8PA 3M6VA 5DRKA 5LMNJ 3POTA 4YMEA 1HLWA 3M32A 1K9MT 4B3RF 2OMLA 3O8WA 4X4QA 1NPPA 4YP3A 4NLVA 4PKDB 2GVZA 4C0OC 1H2VZ 1AW0A 4DUZF 4X65F 4ES2A 2ZJQQ 4DV6F 2RRAA 1T7PA 4WF9Q 3MPDA 2LXFA 4Y34A 3CF5Q 3DOKB 3H20A 4JBCA 2FJVA 3NMRA 5DM6Q 2HS0A 4NYPA 3B4DA 1XQIA 1IR1A 4Y28C 2OI2A 3O5TB 1H6KX 1IJEB 4RW7A 4DX7A 1MU2A 4EZ9A 1ZM4A 3ZTPA 3AJDA 1S12A 3BQ0A 3T1YF 3CJ5A 1HYSA 1FRXA 5CABA 5EHHA 1BHNA 1HHTP 4K4ZA 2M3DA 2UXDJ 2V8PA 1JLBA 1RT6B 2ZNZA 5JUMA 3IS9A 4WYWA 2QX0A 2QL7B 1ZBTA 2I5JB 2XSJB 4NA1A 1UA1A 3P6YC 3R8YA 3OSPA 3NS5A 4DV0J 4IYQA 5GADU 3Q8SB 1AXQA 4CZCA 1YJNS 2UXCF 4ED0A 1RTIB 2ZH7A 5A8RA 1YWXA 1OO0B 4IR1A 3ZC4A 4JI7J 4I69A 1HNXF 1MN9A 1SJRA 5B0GA 2AMCB 2G0IA 1WC4A 1YJVA 2H51B 4Y2IA 2CQPA 2IYIA 2VIHA 3AJ2A 1RT2B 3AB2B 3CE8A 4KFBB 4NLQA 4UZCA 4XO0A 1RT7B 4CIOA 4F02A 3N6MA 4C6AA 1UP1A 3PTWA 1VRUA 3CJQA 2EG1A 4BBYA 1FWKA 5J2PB 4IO9Q 1FNXH 2HNZA 3IXQA 4J90A 2J6SA 4PG6A 1HQUA 3NBPB 1RT3B 4O4GA 2I6WA 5LXRA 1Y9OA 1RSCA 1TL7A 2Z4PA 2MY8A 4USMA 5KT5A 3BJYA 3M2UA 1UWBB 2QA1A 1X4GA 4Q8EA 3VGTA 2DNNA 2MSTA 3HMJG 1V5IB 1URRA 2P2CB 3LGMA 2ZBPA 4WE1A 1EIYB 4C9DA 1M5HA 2GFFA 2W7PA 2VQFF 1R8AA 3RB6A 2DH7A 4FBUA 4DQPA 4IRKA 3B82A 3UDLA 3TZZA 2R2UA 4DV7F 4W92B 3MOJB 1VC5A 1HNVB 3HD1A 4V19J 5D4PA 1XBWA 2LFVA 1VLOA 4RWWA 3LAMA 3W5ZA 2R7WA 4JI4J 4X4NA 2DCLA 4HACB 5KFZA 1A7GE 3WHIA 3J81j 4B02A 4DL7A 3HVRA 2FJXA 2WVEA 1EKSA 3BKTA 3DNCA 3HSZA 4CLYA 4N7TA 9ATCB 4AT1B 2YKMB 3SV4A 2P9EA 5C5JA 3MCMA 3DLHA 1VMBA 2KN4A 2C2RA 1N54B 1KFSA 3GPAA 2FLNA 4CH0S 3RTVA 5D0HA 3GJQB 1KQKA 2RD5C 3GWCA 2X3DA 2YNFA 4EK2A 2QYCA 1T9TA 1TR0A 5E3RA 5ITHA 3QZ7A 1R31A 2GGPB 4HVZA 5IQQA 3PX4A 3OL9A 1MU2B 1J5EF 5D8HB 1TKXA 1VQSA 4LSZB 2PMHA 2IVMA 3B6BA 1QE1B 2IHR1 2VU5A 2M8DB 5EN1A 4DV2F 1QAXA 4M5IA 4CP5A 3PACA 3FZBA 2BE2B 4PG5A 3MD3A 1B70B 2RH3A 3HZEA 2EW9A 4DR2F 5F8LA 2CQ2A 3QYYA 1RTZA 1T9WA 2FDNA 4YR3A 1XNQJ 1I51B 2J9EA 3ILJA 5DZ6A 3MMBB 2AGPA 5FLXU 2FVRA 2VKRA 2X1FA 3FFIA 2DRAA 2WVCA 3MPWA 3MDFA 2W4CA 2MZSA 3BPSP 3CVKA 3FMWA 4TXSA 3WZ0A 2E7WA 3PR4A 3NNHA 2BUNA 4ZP7A 3M9NB 1KLMB 3EZOA 1PKUA 1NLKL 4J9KA 5T7LB 3JAMY 5DGBA 1GX5A 2GMJA 4KHPJ 5AXMA 2UU9J 3W2VB 1LFPA 3IG1B 1ZA2B 2QLXA 2ZH1A 4O4RA 2J0WA 3LP1B 1KBRA 4RW4B 3HULA 3D5MA 3A3PB 3BQ2A 4TYBA 3JSMA 1F3FA 4J5OA 2RU3A 3D2WA 1FEEA 4DPUA 4U8VA 3BSNA 2XNRA 3GIJA 1PYSB 4ENOA 4IOBA 3D28A 3MM8B 4WU3A 1X4BA 3DXSX 2Y9HA 1X5PA 3IWLA 2YH1A 4LQ9A 2ZH2A 4R8UA 1JXEA 3KLHB 4YHHF 1FKPB 3H7HB 2HBYB 3OD2A 3G6VA 1KC8T 2D9OA 1SH3A 3CJ8A 5J2NB 1H0HB 1HQEB 4I6AA 4F0HA 2ASDA 2KG0A 1XJWB 3T1YJ 3Q2SC 4CO0A 4LF6F 3GJRB 1U2RA 1QTNB 3H5SA 3R1HA 1SBRA 1PC4A 2HFOA 4LFBF 4H4OA 1NB2A 4RBTA 2D41A 3IR5B 3HHLA 2OHDA 5B0DA 3BGUA 4KGZB 1SKSA 2B3TB 5HLFB 2F9DA 2DXFA 4MTPA 4OX9J 4JI3J 2PN6A 5MLCV 5EWEA 3BH6B 1T02A 2AYGA 4EUVA 3BS9A 4KB7A 2QLWA 2DGTA 3HVTB 4NLPA 5KAKA 2YWEA 2HBQB 3CJ4A 1S9FA 4B3RJ 2MSSA 4LJMA 3R9LA 2ASLA 1PYOB 1ZOTA 4K4UA 4ER8A 1FWLA 4QIFA 3JSBA 2J7UA 1IWGA 3PW7A 2IAJA 3SBMA 2ROGA 3OHBA 3V6KA 2DNRA 2C22A 2XTJP 3GJTB 5ETKA 2HK3A 3D6FB 3DM2B 1B3TA 2QIFA 5F8NA 2V2VA 1NJZA 2CKWA 2VBZA 2E9TA 4DZ6A 5HMYA 4IG3A 3T5JA 3L7OA 1WUUA 3ZNUA 3SMZA 3KFWX 1FNMA 1WDDA 2WRMA 4A46A 2BJ1A 1WORA 3BBCA 1YJWS 2X1AA 1L5UA 1NDLA 4DR1J 3R5JB 3SYZA 1ZZNA 2J6UA 1AROP 3H2LA 3MUMP 2B5JB 3DDNA 4P2FA 1XNRF 2XY5A 4KIAA 5LOQA 3D6TB 2VV5A 1GX6A 1LWEA 1X4FA 4QBUA 4Z7CA 4U7CA 2AJ1A 4DR6J 4X4UA 1PBAA 3NOCA 5HROA 2ZBQA 2R7UA 2KXFA 2B4OA 1S49A 3IWXA 3EX7B 4ZIVA 4UY85 4CT9A 2M5YA 4KBIA 1RBOB 2D3O1 1PAEX 4ED8A 4NMLA 3AD8C 3I32A 3MCOA 4TKTA 3U7JA 5C42B 4DR2J 4DG1B 3W2VA 2HWTA 4RW4A 2DHXA 4LREA 4QW8A 1G3OA 2ROEA 1DRZA 5HANA 2RF2B 1M5KC 2PFFB 1C0TA 1XR6A 3M2RB 3U27A 1ZH5A 4DFJA 4ID5A 4YR0A 2XHCA 4KT0C 2FHMA 3ZXWA 3LP2B 2DR8A 1RT3A 4G65A 2QGFB 4L73A 2ZD1B 3IWNC 4U7UD 5IV4A 1JQGA 1T11A 2OJ3A 3D1QA 4RWXA 5F9LA 4B3TF 2HAIA 2FY8A 2XHWA 3WQPA 1N88A 3DMJB 6AT1B 4LF4J 2NYHA 4C8YA 2ZE2A 1YITS 1PGZA 4AL6A 4RX6A 2EI5A 2KT2A 2NYIA 2NZ4A 2B4VA 5G4DA 3T3FA 4LF5F 1AUSL 4OJ3A 4LFAJ 4JI8J 3RJMB 4FXDA 3GYNA 4PRFA 1UJ5A 2CA9A 2DNLA 1SJFA 3KOAA 3ADAC 3FEYB 4PCQA 2D3UA 3QAUA 4X66F 2VHGA 2CPDA 3CCLS 5KG0A 5RUBA 3TUJC 3I6PA 3NXZA 4LVNP 2YX7A 4DL4A 2JL9A 4DDFA 4JI7F 2AT1B 1CJKA 2Z8QA 4LSNA 2IVYA 3WIVA 3R3TA 1S10A 2FVSA 4HHHA 3ISNC 1Q7YT 1RT1B 1X4DA 2AYMA 3OL6A 3PRVA 3MEGA 4F4AA 3JS9A 2EPIA 1TKTA 2WW4A 3SSSA 3RRHA 3QJJA 2DEJA 4PG7A 3WBZA 4AXJA 1QVFR 1V3ZA 1S48A 4ZHRA 2B43A 5ETTA 5EWGA 4Z7YA 3TJ9A 4F36A 4ZVHA 1FRJA 3D3CJ 3W9HA 2XNQA 3LP0A 2DO0A 4JB8B 2ADBA 2HRUA 1S72S 2DNMA 2DIUA 1IBMJ 3ISZA 4K0KJ 3HVWA 2WVDA 1BE4A 3DN9A 5K14B 2BQRA 3TUZC 3UQSA 2E9ZA 1VISA 3MR2A 5KFEA 2AX1A 1S7IA 1CBKA 1GAOA 1WF2A 4DPXA 3VAGA 3AY0A 3PZPA 2ACMA 3KTQA 1HMVB 5FDLA 4C0BA 1F9EB 2ZBCA 3HD2A 2NXUA 3CD5A 2OELA 3D68A 4M5GA 4P7TA 5E33A 3TJAA 1R0AB 5A0YB 1I94F 4UY8T 2FLLA 1RABB 2HNYA 1JLBB 4USJC 1X4HA 4QYZK 2YQ3A 2KXNB 3BO3A 1NK4A 5AXNA 1PBUA 2JVRA 2KJVA 3AQOA 3GR1A 5EX3A 4CTAA 3ICLA 5J2PA 3NGSA 1VS3A 2H5IB 1UEKA 2DGOA 3N28A 2ZWPA 4FXVA 4BWMA 5AJ3J 2RQ4A 4NXNF 1G2EA 2HHWA 2BV3A 2RMLA 4HH0A 2IBKA 2AZ1A 5J2QA 2RRBA 4AL7A 1BLUA 2VFVA 4AQYF 3I31A 5AXKA 2F5GA 1FFSB 1HNIA 2Y3YA 1QLNA 3HO1A 1CC8A 2E1MC 4A8SA 3TW0A 5DQHA 2IDLA 5CYMB 1WACA 4KRWA 1MMNA 4FVMA 3G86A 3NEKA 5F0WA 3W5YA 4R5PA 2KM8C 2ZKUA 2E5LF 3EGZA 2D69A 1FD2A 1WEZA 2OPQA 3QSYB 2AD9A 2LA4A 2GNKA 3HX9A 3CSKA 1X5TA 3TZYA 1VJQA 1YBUA 4DUZJ 1N48A 1RUSA 1UWBA 3H59A 3I0SA 4USKA 1OPIA 2DJWA 2LCWA 3PYEA 4U7UK 3S8SA 3AB4B 3OJSA 1NK5A 1ULRA 2OEKA 3W8GA 2B9YA 3CDWA 4URGA 2CQGA 4RR5A 3R5DA 2F1FA 3QGGA 9RUBA 5HI7A 1Z4UA 1S4FA 4J9UE 4Z2XA 2HRYA 1SJQA 2DNOA 5C2CA 2ADCA 1S6PB 1J2VA 3PW5A 1KS2A 2KRRA 4NYOA 4ZLLA 4OZJA 5U47A 2XZWA 2BVZA 3GYXB 3CD0A 3P8BB 1P1TA 2QO3A 3VVUA 2Q6BA 1ZTTA 1VQ4S 3GCWP 2JEFA 2CWXA 3LANA 5LMUJ 1SC4B 4KH1B 2AWZA 3HVAA 4QR2A 3FDSA 4TY9A 2D7SA 4WZQA 4TQSA 1SL0A 5E2QA 2QT7A 4TLRA 1VQPS 5A8KB 1R6YA 3M6XA 2LXIA 3ILOA 3W9IA 3J7A1 2CXEA 1HWUA 1S0VA 3ETMA 1RT4A 4OX6A 4EZ6A 1CULB 1IXKA 2RKIB 4MIWA 1WHYA 1VQNS 4I6YA 1UEUA 2F3JA 4C11A 4WK3A 4Q0BB 2BQ3A 1KLMA 4GO5X 3N9UC 3CCTA 1L3UA 4W98A 1AB8A 4WTYA 1SJ1A 2CPZA 4RW6B 2ZM6J 5LJ5Y 4ED6A 4MKVA 1IKWB 1RISA 2PO4A 4DEZA 4DFKA 3EE3A 5AE3A 2YBVA 2PEBA 3ENWA 1R6VA 3PJXA 4UUWA 4DV0F 2GHPA 1D8ZA 1EKRA 3QIPA 1UW4A 2BE2A 1C1CB 3NS7B 4B3SF 4KY3A 3IMQJ 1Q78A 5HSPA 2NUUG 1WNEA 2UVUA 5L9XA 1W7WA 2BM0A 4FZVA 4DCPB 4AQYJ 4ALZA 3M1VB 4DSIA 5LT5A 1BQNB 1J5OA 2HHQA 3UNGC 4NL5A 1JJ2R 3KK1B 4OLPA 1RWOB 1WG1A 2IPOB 2WBMA 3DMJA 3SZ2A 2O3DA 4LR9A 4WPAA 2E44A 3SQOP 3KK1A 2CQHA 1WC6A 2CQCA 4C8OA 2YPYA 3Q8PB 3RR8A 4DR6F 4I2PB 2GS8A 5HK4A 3R5CA 1G7CB 1EETA 1VDHA 1UJ4A 2A10A 2B6AB 1SCJB 1JJCB 2DNPA 1VLYA 2X51A 2ZWOA 3KJVA 1BY9A 4ZPBA 1Q86T 1QSLA 3JSYA 5HQMA 2CPIA 2Q79A 4KH0B 3RAXA 2NR0A 1S9EB 3FEXB 1FDAA 1XR5A 2KT5A 3IR6B 1B99A 3DRPA 2IM2A 3NMAA 2G2OA 3O3LA 2E5JA 2NSCA 2VPWB 1R27B 4ZCKA 3AD7C 2K06A 3GV5B 1XMQF 4KV8B 1HBUB 2P5VA 3MEKA 3MPUB 4DF4A 1N33J 4TU7A 5KFFA 4A8YA 3UVJB 3NGKA 4X4TA 1H72C 2ASYA 2B8PA 4I4BA 3W1YC 3HHEA 4TLQA 1Z2LA 4OHZA 1PYTA 1SV5A 4Q2LA 4GC7A 2VBXA 2YWFA 2BJ8A 2GV1A 1X0FA 2HAFA 3MMAA 2QJ3A 4UUXA 5DDRC 2RDDA 2RQMA 4YUDA 2GQQA 1VOMA 2GO9A 5JJBA 5K14A 2W8LA 1UKUA 1SUQB 2FZGB 3D0GE 1VQ9S 4F4YA 3C14B 2GIQA 3CMQA 4QWBA 4ZJOA 2Z58B 3NNAA 1OSDA 2L3MA 4P6QA 4A8QA 1FJ7A 5M2RA 1HR0F 2RSQA 1BGXT 3DLEA 1NRKA 1D3WA 4ZA1A 3OTDA 3SXLA 3JSMB 2G1HA 2DEIA 4CLFA 2W2QP 4KR0B 2IRXA 2N7YA 2GJ2A 1JLGA 1Q8LA 5E3AA 5KFPA 3FCVA 4GKJF 4YS2A 1HBOB 2R7QA 4NXMJ 3U1LA 1S6UA 2DNHA 4LR7A 2DR6A 4LR8A 2JDJA 2IRYA 1C1BA 4DV5F 2C2MB 3KLHA 1TK8A 2MMYA 1AZSB 3OR1B 4DV4F 2NXNA 2GMHA 4DMZA 4OYZA 2E5GA 3KUHA 2AZ3A 4K2JA 4UOHA 3CDUA 3IA0A 5E5NA 3V4MA 4CLPA 3KK2A 1N5QA 1GMUA 2H3EB 2HFNA 3C15B 3CCJS 2DR9A 5IWAF 1Y5LB 2MZJA 5L38A 2B51A 3D6MB 3QNWB 3L9ZA 4H4OB 4RW9A 2PGCA 3QPIA 5HJYA 1O0PA 4RKUC 2R8HA 4V19X 2CAJA 1AUDA 4ED7A 2ZEJA 3NOGA 1IVZA 2FZCB 4QWDA 3BQ1A 4CLUA 4CO5A 1NUEA 5IWAJ 1KNZA 5CYQB 4DX6A 2J9DE 4I6WA 3QLHB 4IDKB 4OJHA 4H54A 4X66J 4LBIA 3AODA 1X8DA 4WIIA 5KFLA 5IS2A 3QT8A 3PJ9A 4P2XA 1EZZB 1S5ZA 1UAWA 4G1QB 2NCKL 2Z2LA 5AT1B 2DHSA 1GK8A 5BYSA 5KFWA 3CJRA 3OSNA 4DQQA 1TL5A 1NKBA 1FO1A 1P9YA 3M6UA 2YQ1A 3H5YA 1EARA 2QLBB 1G4CA 2PA3A 1DLOA 2G13A 2ZUGA 3BBBA 3PV8A 3TAQA 2DY1A 2KFYA 3DHXA 3FK4A 1CJVA 3BGRA 4GVBB 3OTOF 2XULA 1YQHA 1VI7A 5KFJA 4XPCA 3HVTA 5KFRA 3JYTB 2QA4S 2PEHA 4NA2A 4OZ1A 4FPRA 4WP8A 4PWWA 4ZPVR 1SIZA 5L8RC 1YJRA 3T6JA 3BBFA 1WTBA 2IA6A 2HRTA 3P45B 3R1LA 4LRBA 2VONA 1NPKA 2HVHA 4M5KA 3PW2A 2OIHA 2QLFB 2NXCA 3DLKB 2PI4A 4M95A 5B0AA 2QZ8A 4JOUA 3GIRA 4IUFA 2MLYA 1MMLA 2FJDB 3NKYA 4U9RA 4USIA 2N3OA 3VAJA 1N4LA 4ECZA 3TUIC 4ECQA 4QIVA 2CNKB 1F5AA 3RYLA 4PR6A 1QE1A 2GJIA 3EXYA 3WIUA 1HPZA 1T05B 2FVPA 1B7YB 4KKOB 5I42A 4LSNB 1SL2A 5DM7Q 4DFMA 4FVCA 4F04B 3TEHB 1HHSA 3BKUA 3TA0A 1H7XA 2N7CA 4F4KA 1TZ0A 4RW8A 2WTFA 3T5LA 1NZ8A 1QVGR 3SCKE 2OLWA 3T19A 4PZVA 2BOAA 3Q8RB 1B0VA 1RT7A 2G9OA 1Q0NA 1RAFB 4RNOA 4OFZA 4S0MA 2AQ4A 2XMMA 2HBZB 3ELHA 2L41A 1HNWJ 3GYGA 5DO2A 1G6BA 1TTHB 3KJFB 5E3PA 4X4RA 1N5YA 2R8GA 2OAUA 2JRSA 2EFQA 3OPKA 2QFJA 4M94A 1VIOA 2KDOA 2DTJA 3MAHA 1AZSA 1L3KA 2CDRB 1HKAA 1BUXA 2ZHBA 4Y0FA 2WCXA 4X4PA 1N6QA 5J1NA 1PIEA 5K8OA 3QRPA 3MR5A 2XCPA 3DLGA 1KR4A 1RHKB 1N36J 3NY0A 1N0VC 3OL7A 2AJ0A 1Y5NB 4TN2A 4ZKAA 2VDIA 3IR7B 2MXYA 1N8RT 2FQQB 2MZQA 3DLGB 1JXVA 7FDRA 1IBCB 2QL5B 4G6VB 4O3PA 1IKYA 4FNHA 3DRPB 4FP9A 3Q8YA 4UQTA 1K0TA 4HDHA 3HFKA 3J81U 5IT9U 1RWXB 1YGYA 4USHA 4OHVA 2MLXA 4YB1P 1YKWA 2CRLA 2HK2A 4QPTA 5ETMA 1EX8A 3CNQP 2UUAF 2W7AA 5KG3A 2L9NA 2YNHB 1NKEA 4F4ZA 4C0HA 1XC9A 5F8JA 2OPPB 3I0SB 2YNFB 1MMDA 4UZBA 1UETA 3M05A 3MTKA 4ED4A 1RCXB 3VGVA 4BLGA 4R25A 5BR8J 2D9PA 2E9RX 4EGLA 1JLEB 4J9RA 3EZ5A 4JI1J 3CJ0A 5BXIA 4FS2A 3ZNJ1 1VIXA 2MDAA 2XI3A 1KLNA 5D3GA 3H42A 1FNOA 5HO4A 4DSLA 4G3IA 1RT1A 4NCGA 2EKYA 4ZJQA 3IAS9 2NXEA 4I56A 4USVA 1U49A 3MURP 5DG9A 3N4WA 5A8WB 1JLAB 1FTCA 3FRZA 1VRUB 4LSLB 5LMUF 2DPJA 4ILMA 2DGUA 3VTIA 2AF6A 3SDEA 3NCQA 1FA0A 5CD4A 3KLGA 2UUCJ 3HZGA 3NGRA 1HQ2A 1UFLA 4HHUA 3CDAA 2MTLA 1U6FA 5DS7A 4D3HA 4OJ1A 5L1JA 1HWIA 4BDPA 1HW8A 1TMJA 3MI7X 3RBXA 4Q0BA 2AJQA 5ETOA 4KO0B 4W90B 5ETRA 4J9OA 2DNZA 1C0UA 2RU9A 1WF1A 2V2KA 2K8GA 3PYDA 4EO6A 3KK2B 4B9TA 2B9WA 3E8OA 4F4XA 4DUYF 1S97A 4DL3A 5HLFA 1R8BA 4WXOA 2U1AA 3TAMA 1QAYA 1FK9A 4HEA9 1UJ6A 4P52A 5D4OA 4B08A 1R43A 1JLAA 2AJ4A 4LSLA 3KWMA 3M9OB 1IKYB 3GE9A 3T9NA 1U25A 5KG1A 2QA4G 3C66A 3P3DA 3W61A 5KT2A 3V6DB 2JVOA 4CH7A 1S59A 1RA6A 5H1SV 4DR7J 1OSCA 1JK9B 3SCJE 4QR1A 3K0JA 3TNVA 4ILLA 2AYEA 3P96A 1ZAVA 3K7RA 3CWJA 4OYBA 4TVAB 5KG6A 2J8SA 3LTOA 4C8ZA 2XI2A 1IWAA 4ZCIA 2FY1A 2DGWA 2VOOA 3GQCA 4ZVSB 2FD2A 4ECYA 1VBXA 2ZZNA 1U7LA 2LKZA 2OSRA 3CJKA 4JI0J 2V5HG 1VFJA 3DRSA 4WKYA 2GGPA 4B3TJ 1KVIA 5DLGA 1HI0P 3KKFA 3GIKA 3DOMA 2VZ9A 1LW2A 2V69A 3DGPB 4M5NA 3MEEA 1ZA1B 5GAGU 2DR5A 6FD1A 4PWDB 4WIQA 3EPIA 3V6DA 1RTDB 4FBTA 1VR6A 1P1LA 4F26A 2AP6A 2CDQA 2YKMA 1WI8A 1S57A 4FXWA 4ICLA 2FJEB 4QIGA 3VAFA 1JJ4A 1VCTA 2HZAA 1BXNA 2IM0A 3PKYA 3CB4A 2R7RA 4X84A 2AJ2A 3VAKA 4GKKF 2IDEA 4KE5A 2B6AA 2B9XA 3LF0A 5KFCA 5GAEU 1EP4B 4DWIA 1JXLA 4X4SA 4DLGA 4B9NA 1GMWA 2V4JA 2VPZB 3U1NA 5KOXA 1XMOJ 5AXLA 5H9EK 1R8HA 2HVEA 2GX8A 1FJEB 1MLAA 1SUQA 3W8PA 3MEGB 1R8PA 3SFGA 1L3SA 5A0YA 3NWRA 2J8AA 2UUTA 3I5AA 1NSQA 4W4MA 1VRTB 3CT9A 2A0FB 1LW0B 3TQ1A 3G6XA 4QIEA 3SDEB 3ETOA 2C3OA 3ZFVA 3KHGA 1GMVA 1UFKA 2OMOA 2UV8G 3B8HA 4OYXA 3R97A 3IRWP 1SC1B 4KSEB 3BN7A 3M8RA 1BQNA 4P72A 1HBOA 2MKCA 5D4NA 2FHJD 4ZPTR 1RWUA 2AX0A 3TUPA 4G1QA 5IT4A 1CG2A 2HWHA 2Z0GA 1NDPA 4HR2A 4OZ5A 4IOAQ 5C7PA 2QSFA 4RNNA 1NHVA 3Q24A 3AJ1A 5HBMA 1QUPA 3CCZA 3ZZOA 1DLOB 1F0XA 2FUG9 3QGIA 3JAMU 2HQIA 2XGPA 2ATLA 1OYEA 2UVRA 5CCMA 1EAYC 1KOHA 5GMEA 4F0KA 1Y10A 1Q81T 2YNIB 3JQJA 1TUWA 2MZ1A 1TL1B 1PCAA 1NK8A 4A48A 5K9FA 3BN4A 4J9VA 1SC6A 1S1VA 4JI3F 3AXKA 3ENAA 3IO1A 2ZBRA 2WB4A 1S6OA 2XMJA 3AT1B 2DH8A 4QIWD 3BZQA 1S1VB 4GMKA 1OQ3A 4XDDA 4ZPAA 8ATCB 1Q53A 1X4AA 3OXGA 1RAOA 2BKNA 2RE1A 2EWHA 2WSEC 3DU5A 3EM1A 3OR1A 5C42A 4K4WA 4F50A 1NB7A 3HK2A 1FE0A 5ADZA 4YY3F 3HT0A 4ZP9A 4LF7F 4RNFA 2JC0A 4FF2A 4PQUB 2UXCJ 1CJKB 3K2YA 3MMJA 4YEAA 4B17A 2KRBA 1W25A 3G87A 3I4PA 5GAEI 3EGVA 4DR3F 4DSEA 2JSXA 3VGUA 4KKOA 2FZKB 5E3QA 4ZP8A 3PRDA 4WU2A 4U6PA 1Z2ZA 3MM9A 2LDIA 4PAAA 2JLGA 4TQRA 2VH7A 4U67Q 1KHWA 4OHYA 3UN3A 2DVIA 4JI6F 3FMBA 4ICLB 3OVAA 1FD8A 1KP6A 5D0EA 4UF4A 3ULHA 4X62J 1MG7A 3KLFB 1HBNB 1TFWA 5AE1A 3BM7A 1R0BG 3PYGA 4NLUA 2VA2A 3TA2A 1D9FA 3GR0A 4ZOSA 5HATA 3MR3A 3LGNA 1FRHA 2OUGA 4RO0A 5T41A 4EBEA 1AFIA 2W2NP 3LPEA 3MEDA 4OJGA 3US5A 4J91A 2EC0A 1TKDA 3KLVA 2XYPB 2YNGB 3C16A 1GXUA 4O3NA 4AYBD 5IZHA 3HPOA 4O3OA 4RBVA 2K1RA 3DC2A 3BGOP 2IVFB 3BGRB 4ZN3A 2MQNA 1TAUA 4A4JA 4X4VA 2JLFA 2C2OB 3ZZTA 5A76A 3G71S 4ETXA 3A4TA 4OI6A 5M2PA 4CLLA 3G6ES 2CFXA 2Q6CA 3ZTSA 4ZDNA 4J37A 1XNQF 3QRQA 4CO1A 1HNVA 1HA1A 2KO1A 3G82A 4M8LA 4MAKA 3MR6A 2HQ3A 2LXUA 4X64F 1CVJA 3DKDA 2CPJA 4LIRA 3MM6B 2QMWA 4CO3A 1M5OC 3IGVA 3CCWA 1MWYA 1IKVA 4J9LA 2XYHB 1KQSR 2KFZA 1AA1B 5KFNA 1RDRA 2MKSA 4CTAB 2EFNA 3V5RA 1PJ6A 3KYLA 4MFBB 3PG9A 3K17A 4NOHA 1YSJA 2CQ3A 4DPYA 1NK9A 2VUGA 4DG1A 2DRBA 4FF1A 1WOPA 4LRDA 3V6JA 5J2NA 3ILIA 2HQFA 3C19A 5JVHQ 2BA9A 3UN2A 3GIMA 1Q5VA 3PFEA 5F8MA 1ZYQA 1CS4B 3E3XA 4DV1F 1GFWB 3MM5A 1REGX 1VC6A 1WJ9A 4PABA 4TY8B 3D66A 5ETVA 2CJQA 1A0OB 2CPXA 2LLZA 2YWGA 4N47A 2BDPA 2QC3A 5LMNF 4C4WA 1TL1A 1F2GA 1YLXA 2ILYA 2VOPA 4HT7A 1OWXA 1UL3A 2E5HA 4F0MA 5C25B 2WONB 5J1PA 5ETNA 2LVWA 2BKOA 3ILLA 5CYQA 2XY6A 2CZ9A 1H38A 3HJFA 4MMOA 2DNYA 2F9JA 4LT6A 4LF1A 2F4FA 2WOMB 1ZM9A 3F41A 2R2SA 1QAIA 3LGHA 4HLBA 2V68A 2R7TA 2PD1A 1EQMA 4LFCJ 1E6YA 1N32J 1RAJA 4JV1A 2H54B 3U1MA 3O1LA 3NLCA 3M30B 1HL6A 2VICA 2J6TA 3B4MA 3R2CJ 1W2BR 4NE9C 4J9SA 1UVMA 3FSIA 4CO4A 2AHOB 1FKOA 3GONA 3OFEA 1WDTA 2VF3A 4NXNJ 3G2XA 4I7FB 3W7BA 3MOZA 1ICEB 4NLOA 4BC9A 3I56S 2F7VA 2M88A 3SEOA 2VG6B 2YKOA 1KFDA 3AH6A 1WHVA 4C98A 5A8WA 1FFWB 2ZC3A 4EU0A 2ABYA 4F2SA 2DXEA 4GRSA 3CMES 4K5SA 5M2UA 3G8TA 1WI6A 1CJUA 3FC9A 1RT4B 1V9OA 1IKVB 2LDYA 2Z2YB 3QWUA 4EBCA 3HHLD 3D9BA 4KGVB 3MF5A 4A8XA 1VQMS 3Q0AA 1JLFB 2MJUA 2SXLA 1OY8A 1JB0C 4QU7A 2IM3A 2ZNYA 1WKLA 5CQGA 2CUYA 3JTNA 2OH2A 3HHDA 4ECUA 4B9MA 2EBGA 3BEGB 4I7FA 2V2ZA 5KFGA 2XMAA 4KFBA 4KAIA 5DETA 3T6BA 4O44A 4WBFA 3PR5B 4ZLNA 3LP1A 1LQ9A 5D77A 3PY8A 2RDJA 1HWKA 1K8AT 5ETPA 3TZXA 2Q1LA 2GHVC 4FKYA 4LRFA 2GIFA 4ZVFA 4WZMA 1WEXA 1V5VA 2FLPA 1KQGB 1S1TA 3BR9A 3ZZ0A 2KKHA 1BD6A 5HMWA 3RB3A 4DV1J 5I3UB 4MFBA 2V94A 3HHKA 2EK1A 1WF0A 4OIXA 1WELA 2AEMA 2R8JA 4B3OB 2HHUA 2YY3A 4PYAA 2B4UA 3EICA 3S1TA 1S9EA 3L7PA 3AFGA 2ZVIA 2QYGA 1E6YB 1X31C 3HKZD 2OO4A 1WG4A 2W25A 3M8ZA 2ZFHA 4NZ7A 4WYLA 4ZVUB 4TY8A 4R5PB 1KEKA 5DQGA 4C8KA 4HDGA 2WBRA 5C2GA 2C2ZB 5KT7A 2X1GA 1N33F 2OD6A 5DQIA 2FJAB 4PXBA 5JMNA 3G6YA 2JEIA 2IC3A 2KYZA 1SB6A 2R7OA 2C3PA 1O8BA 2R4FA 4C48A 4DR5J 3I0RB 3UDEA 3OQ2A 3HF5A 3B54A 4OYIA 3PYFA 3RBDA 2I5JA 4OYPA 1QAJA 3AHPA 2ZH5A 5F41A 5K8PA 1H2TZ 3SCIE 3PKMA 2IJNA 3PNIA 1YVFA 5DZ7A 5IQ6A 5E7OB 3MR7A 3R7SB 4IR9A 2HVZA 2Y1RI 3LAKA 4X64J 1Q8IA 2QG9B 2HYIB 4JYAJ 2QFIA 1KTQA 3M7VA 4WK1A 3MAQA 4NI2B 4ES3A 1FF2A 5J1EB 3DHWC 3L3CA 1DTTA 4ELTA 2IBOA 3ZZPA 4CM2A 1IBKJ 2QL9B 1H73A 1YJTA 2HLTA 4PWUA 4C8NA 5AE2A 5J2MA 1FJCA 4JI6J 5BR8F 1XTZA 1RT6A 2BRKA 2V0NA 3CCQS 4ECWA 4DL0C 3ZTQA 1LWCB 1TU0B 3F0NA 2CQIA 3T1HF 1FEHA 3SSQA 3EMTA 5GAHU 1KVKA 5B7WA 4DR3J 2IJFA 3LH2S 1TL4A 3VF0B 3KMQA 1U0HB 3HSDA 1VRQC 2OD4A 3LQVA 3OLBA 2RS8A 4IQXA 5ETQA 2B56A 2GZOA 1IJFB 2D1CA 3PW4A 2HGMA 4WE1B 4DN0A 4JI2J 4DX8H 4YHHJ 3MXHP 3QJLA 3K5PA 3OUYA 1M5VC 4LFCF 2X7IA 2HURA 2WB1D 3F56A 2J76E 1ZTWA 2M70A 2HIYA 3FBFA 1N5TA 4KJIA 1RAHB 4ECVA 5CZXA 2IMWP 1UVKA 2HS4A 4CLSA 2YH0A 3T1AA 2ZJRQ 3CTRA 3I82A 4PG8A 2NPFA 5HP1B 2R2RA 1F5BA 3HHLC 5LJ3Y 2HFVA 4RL1A 1U24A 2YX4A 2L9WA 5J2QB 3V81A 1U1LA 1I94J 1NH7A 1RHQB 3C6TB 4OHXA 3CC4S 1G1XA 2CJXB 3J80Y 2H4WB 4IOCQ 3ET6A 1N6QB 1L3TA 1HW9A 3DLKA 3IRXB 2G2YA 3UR3C 5K20B 3MWBA 1SL1A 4F3OA 2VBWA 3KUEA 1HD0A 3AOCA 3DI6B 1N34J 3M2RA 5L39A 3QQCD 2CJYB 2IMOA 2IA0A 4OV6A
chains in the Genus database with same CATH topology
4KPCA 4WBFA 3EVWA 3VGUA 3ZTPA 4DI6A 1F3FA 3EVMA 5CABA 1BHNA 4FKYA 3PRVA 4ENOA 1W7WA 3JS9A 3Q83A 4F4AA 3BBFA 3FCWA 2BEFA 3VGSA 1NDKA 1S59A 1NPKA 1B4SA 4F36A 3DDIA 1NCLA 1NHKL 4O0NA 1EHWA 1BE4A 3EICA 1K44A 3WX8A 1MN9A 1NB2A 1NDCA 2DXFA 4UOFA 1B99A 1UCNA 2ZUAA 3ZTSA 3BH6B 3ZTOA 4C6AA 3ZTRA 1ZS6A 3DKDA 2HVDA 3R9LA 4S0MA 3B54A 5CAAA 3ELHA 3NGSA 1S57A 3NGUA 2B8PA 1KDNA 3VGTA 2AZ1A 3FKBA 1BUXA 4DZ6A 4FKXA 1F6TA 2HVEA 3BBCA 1NDLA 1JXVA 1WKKA 1NSQA 3ZTQA 3Q8YA 1WKJA 1HIYA 3EMTA 3FCVA 3GPAA 3Q8UA 3FBBA 1PAEX 1LEOA 2B8QA 3VGVA 2BX6A 3L7UA 1MN7A 1NSKL 4EK2A 3FBEA 2AZ3A 4HR2A 1NDPA 4UOHA 3VVTA 5BXIA 5C7PA 2HURA 4ANDA 3VVUA 2CWKA 1LWXA 3G2XA 3EJMA 4ANCA 3FBFA 3B6BA 2DYAA 2VU5A 3BH7B 4CP5A 3FBCA 1HHQA 2DY9A 3ETMA 2DXEA 1NUEA 4UOGA 3ENAA 3FC9A 1HLWA 4DUTA 3EVOA 3NGRA 3Q89A 4W98A 2DXDA 3EM1A 3PJ9A 1S5ZA 1VYAA 3Q8VA 2NCKL 1XIQA 3MPDA 1PKUA 1NLKL 3Q86A 1NSPA 1WKLA 3GP9A 1XQIA 3EE3A 4ANEA 1U8WA 3BBBA 3NGTA 5IOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPC A;  4WBF A;  3EVW A;  3VGU A;  3ZTP A;  4DI6 A;  1F3F A;  3EVM A;  5CAB A;  1BHN A;  4FKY A;  3PRV A;  4ENO A;  1W7W A;  3JS9 A;  3Q83 A;  4F4A A;  3BBF A;  3FCW A;  2BEF A;  3VGS A;  1NDK A;  1S59 A;  1NPK A;  1B4S A;  4F36 A;  3DDI A;  1NCL A;  1NHK L;  4O0N A;  1EHW A;  1BE4 A;  3EIC A;  1K44 A;  3WX8 A;  1MN9 A;  1NB2 A;  1NDC A;  2DXF A;  4UOF A;  1B99 A;  1UCN A;  2ZUA A;  3ZTS A;  3BH6 B;  3ZTO A;  4C6A A;  3ZTR A;  1ZS6 A;  3DKD A;  2HVD A;  3R9L A;  4S0M A;  3B54 A;  5CAA A;  3ELH A;  3NGS A;  1S57 A;  3NGU A;  2B8P A;  1KDN A;  3VGT A;  2AZ1 A;  3FKB A;  1BUX A;  4DZ6 A;  4FKX A;  1F6T A;  2HVE A;  3BBC A;  1NDL A;  1JXV A;  1WKK A;  1NSQ A;  3ZTQ A;  3Q8Y A;  1WKJ A;  1HIY A;  3EMT A;  3FCV A;  3GPA A;  3Q8U A;  3FBB A;  1PAE X;  1LEO A;  2B8Q A;  3VGV A;  2BX6 A;  3L7U A;  1MN7 A;  1NSK L;  4EK2 A;  3FBE A;  2AZ3 A;  4HR2 A;  1NDP A;  4UOH A;  3VVT A;  5BXI A;  5C7P A;  2HUR A;  4AND A;  3VVU A;  2CWK A;  1LWX A;  3G2X A;  3EJM A;  4ANC A;  3FBF A;  3B6B A;  2DYA A;  2VU5 A;  3BH7 B;  4CP5 A;  3FBC A;  1HHQ A;  2DY9 A;  3ETM A;  2DXE A;  1NUE A;  4UOG A;  3ENA A;  3FC9 A;  1HLW A;  4DUT A;  3EVO A;  3NGR A;  3Q89 A;  4W98 A;  2DXD A;  3EM1 A;  3PJ9 A;  1S5Z A;  1VYA A;  3Q8V A;  2NCK L;  1XIQ A;  3MPD A;  1PKU A;  1NLK L;  3Q86 A;  1NSP A;  1WKL A;  3GP9 A;  1XQI A;  3EE3 A;  4ANE A;  1U8W A;  3BBB A;  3NGT A;  5IOL A; 
#chains in the Genus database with same CATH topology
 2VPX B;  4L3K A;  3DI6 A;  5EGY A;  1CSJ A;  2UZA A;  3IS9 B;  4ZLJ A;  4J9Q A;  2DPI A;  4M5M A;  3QAT A;  3G96 A;  2YWW A;  4EO8 A;  3NS6 A;  5L1L A;  2ALZ A;  1LV5 A;  2XS7 A;  1B7F A;  4RW8 B;  4MH8 A;  4ZK7 M;  2W9C B;  1ITP A;  3OTC A;  5I3Q A;  3M8S A;  3JB9 k;  4P74 A;  1NJI T;  2MJN A;  4Y00 A;  1J5E J;  2R2T A;  2BW7 A;  1LXN A;  4F8R A;  2Y0B B;  3RB0 A;  2B7C B;  2V34 A;  1XEZ A;  4ZPC A;  2MKJ A;  1B4S A;  1ZAW A;  3MMB A;  1CJT B;  4L75 A;  3BGF A;  1SQE A;  3D6H B;  4HTJ A;  5K5M A;  2NRE A;  3CGI A;  3KJQ B;  4O3Q A;  1DAX A;  1TKZ B;  3E01 A;  3RAM A;  4B3S J;  4K59 A;  1RBL A;  1K44 A;  2C2N A;  4URS A;  1IBL F;  1URN A;  1GTH A;  2Q3P A;  2VC0 A;  4NEZ A;  4LQ3 A;  5HVG A;  3NL0 A;  2DH9 A;  4MK9 A;  4YB5 A;  2H1Y A;  5AJ3 F;  1T9V A;  1S6Q B;  2VPY B;  1TUG B;  2FIU A;  1P6T A;  3W62 A;  3KHL A;  4LF4 F;  4U96 A;  5ETL A;  3QT5 A;  3MUV P;  2WZ1 A;  3H0P A;  3S7R A;  4DFP A;  1CPZ A;  2MQ8 A;  1S6Q A;  3FZ2 A;  2KHD A;  3CW2 C;  3ZTO A;  1SIW B;  4K50 A;  1IUJ A;  1U0S A;  1LW0 A;  1YDL A;  3HDS A;  1ZS6 A;  2DGV A;  2FGC A;  4QZV B;  5F3T A;  3THT A;  2OP5 A;  4PG4 A;  1VGY A;  4CO2 A;  3FJ2 A;  2W2O P;  4F4W A;  5KFB A;  3LWM A;  2CQ1 A;  3PVX A;  2NUH A;  3M1V A;  2DGS A;  2ZDO A;  1IBK F;  4RU2 A;  5HP1 A;  2XMW A;  3C6U B;  3HSG A;  5HVF A;  4DR4 F;  4O4G B;  1XWL A;  1T3O A;  3GV7 B;  3T41 A;  3FKB A;  1T03 B;  2CPY A;  3CO0 P;  2BJ9 A;  1PAU B;  1S1X A;  1S7H A;  4LF8 F;  2OFG X;  3DOL B;  3UR0 A;  1FKA F;  1LOU A;  3GCX P;  4WFZ A;  2KU7 A;  5HJX A;  4ED3 A;  1F6T A;  1VQ8 S;  1Y7P A;  1NSA A;  1FRL A;  2HGN A;  2Y1J A;  1UVN A;  3FQK A;  2HKE A;  1N32 F;  4F3M A;  1JKH B;  4AXI A;  3MCN A;  2EFO A;  2FVQ A;  3SFU A;  5H9F K;  3M4X A;  2YKP A;  4RJV A;  3VHQ A;  4LF9 F;  1WKJ A;  1LW2 B;  3DGP A;  2W7O A;  1HYS B;  1SQG A;  1TAQ A;  4CH1 A;  4PWD A;  4KGM A;  4IQM A;  4Y6I A;  3OXL A;  3W2W B;  2XCA A;  4DV7 J;  2KM8 B;  2JHE A;  3AOA A;  2CIM A;  3KLI A;  4P10 A;  3BRE A;  5KFQ A;  4N77 A;  4EI2 A;  3X1L B;  4ZS6 A;  3LA0 A;  3DYA B;  1K1S A;  2FJB B;  4IFY A;  2LEC A;  4K4Y A;  1D0E A;  4FF3 A;  4JV5 J;  2RHS B;  3V4I A;  1YIJ S;  1KN6 A;  3OHA A;  2OPP A;  5B0F A;  1CEZ A;  2YKA A;  1NXI A;  1Y0H A;  3DYA A;  3RU0 A;  2GVD A;  3TA1 A;  3O6Q A;  5KFO A;  1U8S A;  4BWJ A;  1BWV A;  2CWK A;  2KT3 A;  5E3C A;  3QID A;  4QQB A;  2V8V A;  3CCV S;  1DZ5 A;  2XLK A;  2LYV A;  2FLO A;  3KMS A;  3MAA A;  1RAE B;  2CVE A;  3OXF A;  4GC6 A;  1KD1 T;  2UP1 A;  3FBC A;  5C25 A;  5CYJ A;  1RAI B;  1LWF B;  4ECS A;  1TKT B;  2X3G A;  3DLE B;  4OX8 A;  4DV4 J;  1J27 A;  3TRG A;  3VZI A;  2HHV A;  2A3J A;  2DIS A;  2NSB A;  4NWB A;  2XS5 A;  1AFJ A;  2ZHA A;  4A8K A;  2XZD B;  1YX2 A;  4RNM A;  2I8E A;  5KT6 A;  1DUR A;  2CPF A;  2D3Z A;  1C4A A;  2VFU A;  4DF8 A;  1YRX A;  2FPH X;  5KFT A;  2LA6 A;  2RVJ A;  4O3S A;  1CUL A;  2GQC A;  1RT5 B;  2RKI A;  2HBR B;  2BQU A;  5CH7 B;  2IFX A;  3TO8 A;  1HNX J;  1U1P A;  1SXL A;  3VR1 A;  2R3V A;  2FGO A;  4L72 B;  4CRJ A;  5F8I A;  3BYP A;  3KG1 A;  3GP9 A;  1RP5 A;  2M0G B;  2QRR A;  3W9J A;  4ANE A;  5I42 B;  2UUA J;  1U8W A;  4K7Q A;  3L09 A;  1DAR A;  3NGT A;  4AD6 A;  5D3G B;  1UVI A;  2L9D A;  3T1H J;  1LXJ A;  1ACM B;  2P6S A;  3N5B A;  1OPZ A;  2HFZ A;  4DU7 A;  2B0G A;  3VZH A;  4ELV A;  2J5A A;  2EBE A;  3R5G A;  4NA3 A;  4Z37 A;  4NYZ A;  1FDN A;  3Q83 A;  1WSV A;  1FRK A;  4DZD A;  2Y1I A;  1RWK B;  2RUS A;  4E0D A;  3A8K A;  3UD3 P;  3HI9 A;  3FCW A;  4KGK A;  4RNH A;  2HGL A;  5K8N A;  2WON A;  4TU9 A;  2MQM A;  5GVQ A;  1IM6 A;  1E6V B;  1UTA A;  4EYI B;  2J0S D;  2CZV C;  2QSW A;  5EWF A;  3Q22 A;  4DN9 A;  5BYQ A;  4RW6 A;  3Q23 A;  1JX4 A;  2RRN A;  3FVY A;  4FYX B;  4LUB A;  4ZVG A;  3VAI A;  3TAP A;  4Y65 A;  1HNI B;  2YTC A;  2E1P A;  4EFA C;  4OI0 A;  1T9Y A;  2C1E B;  1UMJ A;  2ZBI A;  4FN5 A;  1U2F A;  4DSF A;  5BYR A;  3GSD A;  3JTO A;  2H5E A;  2HZC A;  2NS1 B;  2VQE F;  2FJW A;  2XLI A;  2YNI A;  1S4E A;  1RYR A;  3RZA A;  4OLO A;  3TI0 A;  4L76 A;  3IN5 A;  2FVC A;  2Q43 A;  3PIO Q;  5KT4 A;  1HNZ J;  3MM9 B;  2GHW A;  4FYW B;  1NHU A;  4O3R A;  2QLJ B;  3VWS A;  3MHY A;  1QD1 A;  2GVZ B;  3TVK A;  5HQL A;  3CCS S;  4WFX A;  3NG8 A;  3RAQ A;  3BPD A;  2OPR B;  4HHJ A;  4A8W A;  4CLW A;  4ZP6 A;  4X62 F;  4XIU A;  2KXH A;  3RR7 A;  2VB6 A;  3TYT A;  3GG1 A;  1CC7 A;  4KYZ A;  4MYU A;  2DD8 S;  4FF4 A;  3MMA B;  2CZ4 A;  3C16 B;  4QYZ J;  4N41 A;  3ZZY A;  4JV2 A;  3G4S S;  1P27 B;  1U09 A;  2K7K A;  1WOO A;  2HEK A;  2WW8 A;  3OFG A;  5J1E A;  2DGQ A;  2LEA A;  4HT5 A;  5IC6 B;  1RWN B;  1UVJ A;  1NKC A;  1UVL A;  3RW6 A;  1ZAX A;  3M9M B;  4JV5 F;  5A8K A;  2CJA A;  2CPE A;  2R8I A;  2KVQ E;  4KPY A;  5KFA A;  5F8H A;  2HIQ A;  2AIR B;  1HBM B;  1HIY A;  2HNZ B;  3LOU A;  1FWP A;  4TU8 A;  1DFD A;  4OV1 A;  2RUG A;  3RB4 A;  4UTG A;  2QA2 A;  3P5T L;  3C46 A;  4QR0 A;  5KFI A;  1U1M A;  2HND B;  1S9G A;  4K4X A;  1NND A;  1SPB P;  1S1T B;  1WC1 A;  3K89 A;  4HI2 A;  4RPF A;  4Y2M A;  4Q5V A;  1RHR B;  3FBB A;  2E1A A;  3DDK A;  3OUY B;  5LSO A;  1KRP A;  4P2S A;  1FFG B;  4ZMM A;  2BAN B;  2Y8Y A;  2GC8 A;  4WWS A;  1RTJ A;  1S1X B;  2G1D A;  3MFH A;  1N5V A;  3FBE A;  1GH8 A;  2BW2 A;  3R7B B;  4HTI A;  4I2P A;  7AT1 B;  1H7W A;  4O44 B;  1RCO B;  2H5J B;  2XWX A;  3I96 A;  2MZR A;  1P9Q C;  1FTR A;  4CLK A;  3F44 A;  2XYG B;  3HJV A;  1HI8 A;  2CAD A;  3SI8 A;  4LF8 J;  4NZ0 A;  3SSR A;  4GKK J;  4K4S A;  2CQB A;  1M1G A;  2OPS A;  3DRS B;  2LMI A;  3UNY A;  4DV3 F;  3CCM S;  2V63 A;  3OW2 R;  4YDX A;  4ATN A;  3LP2 A;  3POT B;  4DXL A;  3DLJ A;  3IBW A;  2DRD A;  1NK7 A;  2XC9 A;  1Q82 T;  2F4V J;  1HBN A;  2ZDP A;  1MNE A;  2VQE J;  4U8Y A;  1Q79 A;  2PA8 D;  3K59 A;  2W9A A;  2EEY A;  2RQK A;  4QU6 A;  1HD1 A;  2RT3 A;  1QTM A;  2WK4 A;  2AGQ A;  3Q8V A;  4YN3 B;  3CJ3 A;  1XIQ A;  1Y11 A;  3M2V A;  1RA7 A;  2CQD A;  3PJW A;  3E01 B;  3BYR A;  4H4M B;  4OX9 F;  3GFZ A;  5DDQ C;  4Q8F A;  2HHS A;  1BQM A;  2LQ8 A;  3BR8 A;  2N4D A;  3R7N B;  4WFA Q;  3JTP A;  4GO7 X;  1IBL J;  4PQU A;  2A2D A;  2OPS B;  1GTE A;  3MTJ A;  5GAH I;  4KV8 A;  5LSR A;  1TK0 A;  1FDB A;  1RHJ B;  4M5D A;  2P8I A;  1CJV B;  4GVB A;  2HNY B;  2DGX A;  2M4M A;  4M1K A;  4F67 A;  2JFD A;  2B9E A;  2BAC A;  3W2W A;  5GAD I;  2B5J A;  4DV5 J;  3R6L B;  3SV3 A;  4BHQ A;  1U1K A;  1TVR B;  1JMT A;  1RKJ A;  4A8M P;  2WOM A;  5IM0 A;  4EEY A;  5IT9 Y;  2KZM A;  1I1G A;  4Q2M A;  3KNA A;  2DHG A;  2RAQ A;  3DFE A;  2ZZM A;  1OYD A;  2EG2 A;  4DL6 A;  1B0T A;  4ECX A;  4GKJ J;  1NAQ A;  1O6X A;  3KG0 A;  4NLX A;  1GQE A;  4O0N A;  2ZZT A;  2ALY B;  2XSF A;  4IG3 B;  3NGD A;  3AAW B;  1YRU A;  3WC0 A;  3ONQ A;  2O01 C;  3WX8 A;  3OTO J;  3BSA A;  3AQP A;  1RI7 A;  2LU2 A;  3OL8 A;  3IM9 A;  1EB0 A;  1YI2 S;  3H4D A;  4YDD B;  2OTL S;  1V3R A;  1WEY A;  2HG4 A;  2LEB A;  2F4V F;  4TYA A;  4XTT A;  2ZH3 A;  3MM5 B;  3TOQ A;  3NCR A;  4MIA A;  4ZN1 A;  4KHP F;  4QCL A;  1NPR A;  4JI8 F;  2LU1 A;  2H65 B;  3MMC A;  3IBC B;  4LFA F;  2I38 A;  4ID5 B;  4UT4 A;  4RW9 B;  2OEJ A;  4WXW A;  3TAM B;  1NJX A;  4NCA A;  2VA3 A;  4DCJ B;  3CO9 A;  2Y8W A;  1OY6 A;  2IJR A;  3S6E A;  2DHH A;  3AD9 C;  4JUZ A;  5KFX A;  2YQ0 A;  2VJV A;  1YZ6 A;  4NLR A;  4CDI A;  5I3U A;  3M8P B;  3H2V E;  2N4C A;  4FNI A;  4HH1 A;  2ASJ A;  1UZD A;  2F40 A;  3CUL A;  1H3D A;  3CC2 S;  3OFF A;  2NXJ A;  4J9P A;  3GV8 B;  5CD4 H;  3UCU P;  2Q66 A;  4DQR A;  4DOZ A;  2I2Y A;  4X4O A;  3D0H E;  4QWA A;  1FES A;  5I3P A;  1X60 A;  3EWG A;  3ZZR A;  3H5X A;  2EFP A;  1YG0 A;  2JEG A;  3IC1 A;  3R27 A;  1N34 F;  1WKK A;  2ZD1 A;  3M6W A;  1UZH A;  2J7K A;  3FQL A;  1MSW D;  3AA9 A;  2G0C A;  4XDC A;  4C97 A;  3OJU A;  1HBU A;  1UWA A;  5B08 A;  4PXD A;  8AT1 B;  3C6U A;  5THW A;  2VJU A;  1VQ7 S;  3T5K A;  3EDQ B;  2AEJ A;  1HI1 A;  1RB0 A;  1KKH A;  4NEY A;  2MGZ B;  5F9N A;  1FER A;  3TP2 A;  3GII A;  4DCO B;  2UVV A;  4LF7 J;  2XB2 D;  2J9C A;  2P6T A;  3QFW A;  4XPE A;  4U95 A;  2C2E A;  2GQ2 A;  4DL5 A;  2CG4 A;  3QO9 B;  4YQW A;  1ZET A;  2JH3 A;  2V50 A;  3L7U A;  3T5H A;  3HFZ B;  1A6L A;  4UST A;  3CDE A;  3UI3 A;  4OZL A;  1R8C A;  3PHT A;  5EUH A;  3M8W A;  2V4J B;  3QT6 A;  2ATC B;  5D6G A;  2XO7 A;  3EJM A;  4JV0 A;  2YWH A;  1TQL A;  4RUA A;  1FKO B;  2EKN A;  4CI0 B;  4MJK A;  4DPW A;  3W64 A;  2ZH4 A;  4JI1 F;  3I0R A;  4R0J A;  4IRC A;  1HHQ A;  1D9D A;  2N82 B;  1K73 T;  4CWB A;  3KLE A;  2V4R A;  3BSO A;  3BV8 A;  1WC5 A;  2PC6 A;  4JI5 F;  3DRR A;  5DDO C;  3S01 A;  1QSY A;  2R7S A;  4C2M A;  2A2C A;  2V2Q A;  2LQJ A;  4FS1 A;  3KK3 A;  1TEL A;  3JSR A;  3I5C A;  1IQZ A;  1S0O A;  1RGV A;  3C8Y A;  2O67 A;  2DXD A;  1RWV B;  3CJ2 A;  2ZC4 A;  2CVI A;  4N56 A;  1RT5 A;  3P4U B;  3GFY A;  5KFY A;  4MKB A;  1RJJ A;  3JQM A;  5D15 A;  2GAG C;  2Z2Z A;  3MM7 A;  3A12 A;  2E66 A;  2ZVS A;  3KJN B;  1TKX B;  4NLW A;  1RQ0 A;  3QRR A;  4AL5 A;  2BBE A;  5HN0 A;  4DSK A;  5IOL A;  4DR7 F;  4ID8 A;  1PG5 B;  3MM7 B;  3PX6 A;  3W66 A;  3SIP B;  4NRU A;  3JQK A;  2XO6 A;  3RGI A;  4JYA F;  3PEH A;  3Q8Q B;  4DJB A;  1N56 A;  1TL7 B;  2X1B A;  3PEJ A;  1MRO B;  4PYD A;  1KHV A;  3BF4 A;  3KK3 B;  4P7V A;  2B4P A;  4L3N A;  7FD1 A;  3KHH A;  4OZ3 A;  2HHH F;  2V6A A;  1FVQ A;  3DDI A;  3RRK A;  2GJF A;  3W63 A;  1S79 A;  5DLF A;  4QOT A;  3CCE S;  4DPO A;  2VC1 A;  3DM2 A;  4ZJL A;  3J80 U;  1K0V A;  1KWM A;  3TX0 A;  1I5O B;  1C0U B;  2R42 A;  2UUW A;  3NCP A;  3H5U A;  1REV A;  2GVD B;  4WFB Q;  1FXL A;  4QWE A;  1D8Y A;  4AE5 A;  4YY3 J;  2VBY A;  5GMD A;  1VJW A;  2RNE A;  2FB0 A;  5EDW A;  1SKR A;  3T9Z A;  4CCH A;  4QWC A;  1B64 A;  1T94 A;  4K8R A;  1PC5 A;  1S1W A;  4P73 A;  4XAK A;  3OLA A;  5CAA A;  1T8E A;  2YNH A;  1N36 F;  2MQO A;  4DQS A;  4ZVR B;  2JFK A;  4ILR A;  1U1Q A;  2BJ3 A;  3RG6 A;  1IKX A;  4ETZ A;  2EK6 A;  1ZPV A;  3K58 A;  1RHM B;  3GZ7 A;  2BOP A;  2OPR A;  5G0R B;  1OMS A;  2Y0S D;  3M30 A;  4KC5 A;  4RW7 B;  5A8R B;  3A8J A;  2BAN A;  2P9C A;  2XMT A;  3GU0 A;  2CYY A;  5KFU A;  8RUC A;  5J2M B;  4DS4 A;  1NEE A;  3BO2 A;  1X5O A;  1VQO S;  3FSY A;  3I9Z A;  4ZVP B;  1VK3 A;  1DTT B;  2VFR A;  4WCE Q;  2YKN B;  5KT3 A;  2EC2 A;  4PPD A;  2HZV A;  1JNR B;  3UD4 P;  2V9W A;  5HAO A;  2JOQ A;  3EPG A;  4ZLP A;  1HWJ A;  4UQG A;  2DBB A;  1WC3 A;  4PUO B;  1RZM A;  2NZC A;  3MZI A;  1WHW A;  1M5S A;  3UWT A;  2G0J A;  2G2Z A;  3OV7 A;  1FJG F;  4A47 A;  3THV A;  1DQ8 A;  2NPI A;  3D54 A;  1TKZ A;  1X4E A;  4ZIT A;  5HRO B;  1KSP A;  2QTW A;  1DTQ A;  2YVS A;  2PII A;  4PPZ A;  2A18 A;  1NJW A;  4B9V A;  1YJU A;  4ED5 A;  1LEO A;  2B8Q A;  4F7V A;  5L1K A;  4YOE A;  1Q95 G;  2F8H A;  4C3K A;  2AJF E;  1RLC L;  1XK8 A;  2XMV A;  3VV2 B;  3VVT A;  1HQE A;  3P5B P;  4ED1 A;  4I67 A;  1RAA B;  2W24 A;  1M90 T;  2W8K A;  4DR4 J;  2D3O R;  1RAG B;  1EJ7 L;  2K3I A;  2LQ5 A;  1QDU B;  3QBC A;  4NRT A;  4MKA A;  3TWZ A;  3CCU S;  5DG7 A;  1F9F A;  2DB1 A;  1HNW F;  3BH7 B;  5HBM B;  1C0T B;  2YKQ A;  3J7Z T;  4CM0 A;  2DY9 A;  2XMK A;  4C8M A;  3MM8 A;  1JKH A;  2MPU A;  2FYX A;  1K1Q A;  3MUT P;  1N5Y B;  2PMZ D;  4LF5 J;  1P8G A;  3N0V A;  4H4K A;  2AYB A;  2O66 A;  4F25 A;  3PRB A;  2C42 A;  2RDI A;  4QW9 A;  1BQX A;  1UPP A;  2MKK A;  2UXB F;  1RXO B;  2B7B B;  1FDD A;  3EVO A;  1VQL S;  1DQ9 A;  3UCG A;  4OI1 A;  4IFY B;  4G1I A;  4OYO A;  1YJ7 A;  1SV5 B;  4CYU B;  5F8G A;  1NSP A;  4J9M A;  1Y4Z B;  2Z56 B;  3KDN A;  4ECR A;  1NK6 A;  3G8S A;  2HWI A;  1FJG J;  3O2I A;  3BO4 A;  3C2P A;  2FHJ A;  4RUH A;  1FVS A;  5A6W A;  4IH5 A;  3M8Q B;  3N6N A;  1VQY A;  3MCS A;  2H9Z A;  4Y2A A;  2VD3 A;  3U02 A;  3VQT A;  2K7J A;  3ENV A;  4LIW A;  4QJV A;  5T14 A;  1IBM F;  4K0K F;  2HHX A;  1IR0 A;  3EZU A;  3TR5 A;  2YKN A;  1F5C A;  2ZOM A;  2M52 A;  1TL3 B;  2F65 A;  1KON A;  2PE8 A;  3FSX A;  4O23 A;  4M5H A;  3CMA S;  2W1B A;  3C6T A;  1VHF A;  1RTH A;  1NDK A;  2HS3 A;  3HCX A;  5B0E A;  1RAD B;  4D3G A;  4E98 A;  4OHW A;  5K8M A;  1U47 A;  1S77 D;  2EFV A;  1ZPW X;  3ITH B;  2OEM A;  3BKF A;  3JXO A;  1NHK L;  5G0R A;  1FI4 A;  2XG8 A;  2Z57 B;  2BAB A;  2FC9 A;  1R0C B;  3RUB L;  4ES1 A;  1M1K T;  3CIZ A;  1SKU B;  1FE4 A;  2XMU A;  4C7Q A;  1IM4 A;  2JX2 A;  3MD1 A;  3QAE A;  4ZCL A;  2GW8 A;  2UUC F;  4DBQ A;  1B0P A;  1UEV A;  3RRG A;  2AEF A;  3LW5 C;  3LPY A;  1UCN A;  2CNO B;  2ZUA A;  3IM8 A;  4USU A;  2AW0 A;  5IXU A;  1MWQ A;  4X65 J;  4DV6 J;  2KFN A;  3PO5 A;  6FDR A;  2IY5 B;  2E1C A;  4P75 A;  3HT3 A;  2DK2 A;  4YR2 A;  2HW3 A;  4ZPW R;  4OZN A;  1CJU B;  4OMF G;  1RTH B;  2APO A;  2M2B A;  3GIL A;  3EGN A;  1X5S A;  1MRO A;  1NBE B;  3CIM A;  1Q4R A;  3UO0 A;  1HQU B;  2E7X A;  3NBP A;  2BE7 D;  4N8N A;  1KDN A;  3PXG a;  2FHK A;  3ZZZ A;  4C3M A;  5T7L A;  5KFH A;  3J7Z 5;  4B9S A;  2XEX A;  4RBU A;  3VAH A;  2ZOF A;  2A6M A;  4P9S A;  5LSL A;  2HMI B;  1OS5 A;  3UW1 A;  4MKY A;  2HLU A;  2R7X A;  3V4I B;  1U02 A;  4MIB A;  3C15 A;  3CJT A;  1RKI A;  3X3U A;  2VL1 A;  2HHH J;  2DIV A;  1Z1Z A;  2CPH A;  1DY3 A;  1OY9 A;  2ERR A;  4HI1 A;  5FII A;  3IFE A;  4BS2 A;  1Q5Y A;  1FX4 A;  4HL9 A;  4LFB J;  3MMC B;  1PSD A;  1GEH A;  4IFV A;  3FUY A;  3OR2 B;  3QSI A;  4M63 A;  5KTQ A;  3RBE A;  4Q45 A;  2C28 A;  4I0W A;  1YK9 A;  2HFU A;  4AUK A;  3DLB A;  1AYE A;  1FKP A;  1RE1 B;  3DRR B;  4NPO A;  4RUB A;  3AA8 A;  4Q44 A;  3UVJ A;  4NAS A;  2XSJ A;  2NQP A;  2DNK A;  2P9G A;  4LF9 J;  3FFI B;  3HXM A;  3GLJ A;  1S6P A;  2EFG A;  3Q8U A;  1VQ5 S;  2KTQ A;  4CYU A;  4YFU A;  1JLC A;  3UDC A;  2C2K B;  4K4T A;  2JEJ A;  4NLG A;  1MN7 A;  4B3M J;  1RU2 A;  2G4B A;  3HKW A;  3MPV A;  3I4H X;  4MT1 A;  1U6B A;  4NCG B;  2HSE B;  2WVB A;  3HP6 A;  3ZO7 A;  3VQS A;  5HQ8 A;  3DLL Q;  2DYA A;  1X4C A;  4M5D B;  4RU9 A;  4DR5 F;  2GA7 A;  4B9U A;  4F2R A;  1ZM3 A;  2PSZ A;  1RTD A;  4I64 A;  1R0A A;  4XK8 C;  4OYA A;  5E0O A;  4WP3 A;  4C11 B;  1Y00 A;  4IG0 B;  2XY7 A;  2BYC A;  1LWF A;  1T95 A;  1C2P A;  2N3L A;  3I9V 9;  3MM6 A;  3EYZ A;  2WHO A;  1S76 D;  2UV8 A;  2EVZ A;  5GAG I;  4DUT A;  1JLF A;  2DNQ A;  2JC1 A;  3D0I E;  3THP A;  3IAM 9;  1EQ0 A;  1YBT A;  3QO9 A;  4NI2 A;  1YHQ S;  4JI5 J;  3IG1 A;  1L3V A;  2BRL A;  3NAH A;  5KFM A;  1T03 A;  2K1R B;  4NXM F;  5IC4 B;  3LWL A;  3EDR B;  2E5I A;  2DIT A;  5C24 A;  1DHM A;  1Q8K A;  3WDO A;  2JWN A;  1LK7 A;  1PIL A;  1S99 A;  1RWW B;  2LEP A;  2LQ9 A;  3ENQ A;  1RLD A;  3EVW A;  4CNZ A;  3J7A N;  2V67 A;  4UW2 A;  4DX5 A;  5B0B A;  1TFY A;  3DOM B;  3QGP A;  4ZIW A;  1W2I A;  4WP9 A;  1FK9 B;  2VOD A;  5GMK a;  4OL8 A;  2POK A;  4GVL A;  4DU8 A;  1SI9 A;  2BZ2 A;  1NH8 A;  2V8D A;  3PDN A;  4Y2C A;  3V81 B;  1J5O B;  2IAJ B;  5L46 A;  4ZPD A;  1SJ3 P;  1EET B;  1FRM A;  2HFS A;  3NAI A;  2MGZ A;  3HM9 A;  4KO0 A;  3IRX A;  3FGV A;  3GSI A;  5HVH A;  2MLZ A;  1EP4 A;  2KZZ A;  1JLC B;  1NDC A;  3K5L A;  2A1B A;  4DSJ A;  1U1O A;  1I6J A;  1JWW A;  4K2X A;  4WTO B;  5L9N A;  3D3B J;  4DL2 A;  3D67 A;  3R2D J;  4AFF A;  5HMZ A;  3HHL B;  1S1W B;  1CQM A;  1GMW D;  2KH9 A;  2VQF J;  2RS2 A;  5LXY A;  2YWK A;  3ZTR A;  3LUY A;  5EX0 A;  3TVY A;  2XBP A;  2VKZ G;  4DQI A;  1RU1 A;  2NLW A;  3M32 B;  4BC7 A;  1HFE L;  4OZ0 A;  3W65 A;  2XQC A;  2W4P A;  1JLG B;  3O44 A;  4WFN Q;  1XMO F;  1S0N A;  2R9L A;  2XS2 A;  1U0H A;  1YZ7 A;  2JZ5 A;  2WSC C;  4BCA A;  4I1T A;  3DOK A;  1YRT A;  3LO3 A;  4B3M F;  1R89 A;  3OT9 A;  4E8U A;  1JLE A;  2KHC A;  3SQG B;  1S1U A;  2MKY A;  3CD6 S;  4FKX A;  2AV5 A;  4CLT A;  3VCD A;  2M9K A;  3KXD A;  4IO1 A;  2C3Y A;  5SUH A;  1SJ4 P;  2DO4 A;  2XLJ A;  3KG4 A;  1SH2 A;  4C3L A;  2KG1 A;  4ERD A;  1TL3 A;  3GJS B;  2L48 A;  4LRA A;  5CHC B;  4KQZ A;  3K5O A;  3TJ8 A;  2GIR A;  4OI2 A;  4QYR A;  1ROF A;  3GG0 A;  4KHM A;  3HHN B;  1TK5 A;  2MB0 B;  4A8F A;  1VK8 A;  2V8G A;  1X7V A;  3KDO A;  4QPX A;  2I1R A;  4ED2 A;  1LWC A;  1BC6 A;  3CPW R;  4OZ2 A;  2H4Y B;  1D09 B;  2KVI A;  4OI4 A;  4EWT A;  2V8H A;  4EYH B;  1X9W A;  1BMQ B;  3FNN A;  3MED B;  4IDK A;  4ZVE A;  2HQC A;  5E41 A;  1XNR J;  1UPM B;  1WHX A;  4EMD A;  1QUV A;  3A3N B;  1LNQ A;  3D7S B;  3GB0 A;  3SCL E;  1NME B;  2BX6 A;  3A3O B;  3PHE A;  2FTR A;  1C1B B;  2AGO A;  1VBK A;  3G8Q A;  3I55 S;  3J81 Y;  2Z30 B;  3PCO B;  2PI5 A;  1N0U A;  4AND A;  3H90 A;  3QIP B;  5F0U A;  3J7Y I;  4PXE A;  1RTJ B;  1LWX A;  2IM1 A;  2W2M P;  2W2P P;  2I0X A;  1CQN A;  5CYM A;  2OGU A;  4JP8 A;  2J0X A;  3IGN A;  5B0C A;  4RUC A;  1U45 A;  2J0Q D;  4C8L A;  1QJH A;  5FLX Y;  4M5J A;  3RW7 A;  3QFH A;  2YXL A;  4PXC A;  1K47 A;  4WFY A;  5I4M A;  1DQA A;  1FT8 A;  2ACY A;  1QY7 A;  4JI2 F;  2ZH6 A;  3FRY A;  3CCR S;  1RWP B;  2HQD A;  2PMW A;  3UD5 A;  1O51 A;  1HWL A;  3I87 A;  4UOG A;  3H40 A;  4NLD A;  3H4B A;  1H74 A;  4YB6 A;  4G1P A;  3KLF A;  1GNK A;  2DR7 A;  2IRU A;  4B9L A;  4JI0 F;  1PJ5 A;  1OJ4 A;  5D0G A;  3BDP A;  1A9N B;  5KG5 A;  5SZT A;  2W01 A;  1XMB A;  2Y1L B;  3DRX A;  3K5M A;  4DV3 J;  4L6V 3;  2ILZ A;  3DXB A;  4NCB A;  4N8O A;  1ZZF A;  2RF2 A;  3PW0 A;  2XM3 A;  3CJK B;  4NZ6 A;  2F63 A;  2D74 B;  1UFW A;  2OPQ B;  3A8E A;  3SQG A;  4CLZ A;  4P71 A;  2CJK A;  1DJ0 A;  2HVI A;  2WSF C;  4J7C A;  2FC8 A;  1BQM B;  3BDE A;  4FYV B;  4DI6 A;  1T9U A;  2AKW B;  2F8M A;  3EVM A;  2MZT A;  2IC3 B;  2I9S A;  3MAA B;  1FRI A;  3UN5 A;  1KOO A;  2DCU B;  3QWP A;  2O1P A;  3BGL A;  3R6G B;  1N5S A;  1F9H A;  2C3M A;  3UPF A;  5DDP C;  1WD6 A;  2W9B A;  4MYT A;  1NZA A;  1TV6 B;  2CNN B;  3MEC B;  3R5B A;  4NLY A;  3JYT A;  3KHR A;  2K2P A;  1U6Z A;  2C2D A;  2ZE2 B;  1GT8 A;  2WAQ D;  1TUV A;  4R0E A;  2Z2M A;  1VBZ A;  3OVS A;  3BB5 A;  1F3V A;  2JNJ A;  2VG7 B;  2WVF A;  4CNY A;  5DGA A;  2DHA A;  1LK5 A;  1I3O B;  1EHW A;  1FX2 A;  1WWH A;  2M7S A;  2MHN A;  2YNG A;  3GFX A;  2HND A;  3IBF B;  4LF2 A;  4ZVO B;  2GML A;  3CD7 A;  3UDV A;  3OBI A;  3LP0 B;  3PO4 A;  4K4V A;  5LM7 E;  1FXR A;  3TAR A;  1U2C A;  1U1R A;  3CUN A;  2XZT B;  2E29 A;  3M8Q A;  2QEX S;  3EGW B;  4YB7 A;  2MKI A;  2QMX A;  1NJY A;  2IYG A;  4UOF A;  5F3Z A;  1HMV A;  5FDL B;  2LQB A;  3K57 A;  2J7W A;  3QMQ A;  2QV6 A;  3EUN A;  4ELU A;  4DHV A;  2YPZ A;  3H8Y A;  3KLG B;  3K5N A;  5IM0 B;  1T3N A;  2HVD A;  1LFW A;  2LP4 A;  1VBY A;  2C3U A;  2HHP A;  3TZW A;  5ETS A;  3H25 A;  4LRC A;  4Q43 A;  1ELO A;  3MGJ A;  4HKQ A;  2CJ9 A;  3NGU A;  2BJD A;  4NMX A;  4RLE A;  2VDH A;  3MFI A;  2O5D A;  4M5L A;  2RB7 A;  1JLQ A;  2RJZ A;  1Q8B A;  3A13 A;  3CED A;  4URQ U;  5JXS A;  4CT8 A;  3CJS A;  5IFM A;  1HNZ F;  3B78 A;  2EXU A;  1BWE A;  1NU4 A;  1UA0 A;  3NWG A;  1T05 A;  4PQA A;  1M5P C;  4EBD A;  4J9N A;  5H9E J;  3K8W A;  3ISN D;  3F73 A;  1FHT A;  3R5A A;  1C1C A;  1R3N A;  3M2V B;  2ROP A;  4H4M A;  1LKZ A;  2DT9 A;  1WC0 A;  4P2M A;  3M8Y A;  4DPT A;  1CS4 A;  3OVB A;  1IN0 A;  1RHU B;  3DGV A;  2MY7 A;  3AXM A;  4CQ1 A;  3PM9 A;  2F8E X;  3D1H A;  5B09 A;  2VG6 A;  2PFD A;  2V9K A;  4LBH A;  2BR0 A;  3FEZ A;  4LMZ A;  4IH7 A;  1F2H A;  1YTY A;  1XER A;  1TP7 A;  1IR2 A;  1U26 A;  2E5L J;  1WG5 A;  3OFH A;  4X2B A;  1PJ7 A;  3GMG A;  1TVR A;  2ZOG A;  4A8O A;  2HMI A;  2ZIT A;  3E2E A;  5HMX A;  3CC7 S;  1DBD A;  3C3L A;  1CJT A;  4O0I A;  5CCL A;  4OYW A;  2ZH8 A;  2YX1 A;  5CXT A;  2V4Q A;  1KTV A;  4HYK A;  2BMB A;  4OQJ A;  5KG2 A;  3W5X A;  2UXB J;  4ITS A;  5D4L A;  3N6L A;  2MQQ A;  5IT0 A;  3CDB A;  1RAC B;  1RBA A;  2ZH9 A;  3BSC A;  3LAL A;  2VG5 A;  1H2U X;  3A8I A;  1GXL A;  3KNG A;  2BKP A;  3V6H A;  3NP5 A;  2VFT A;  3KLE B;  4IG0 A;  1T0T V;  4HAC A;  2MEW A;  4K5R A;  4OYM A;  2W9B B;  1WSR A;  1Y5I B;  1KVJ A;  1TV6 A;  3MEC A;  2GCF A;  2ZKT A;  3ZZU A;  5KG7 A;  5A2Q U;  4LVO P;  2UUB F;  3G82 B;  1R7I A;  3DU6 A;  5IV3 A;  1HBM A;  4PUO A;  1IKX B;  2UVW A;  3D4J A;  2OTJ S;  1QM9 A;  1N52 B;  2BE9 B;  1O5J A;  5DG8 A;  2UU9 F;  1CLF A;  4N76 A;  4I2Q B;  1V3S A;  1RTI A;  1YBA A;  2K3K A;  3Q89 A;  1VC0 A;  1S1U B;  1SVD A;  2CQ0 A;  2QN6 B;  1XMQ J;  2OKQ A;  3I5B A;  1VYA A;  4OX7 A;  4N5S A;  3J7Y U;  4FYD A;  5FJ4 A;  2JLE A;  3FCH A;  1JLQ B;  3Q86 A;  4JI4 F;  2GO8 A;  3UCZ P;  4L74 A;  4OI3 A;  3L4B C;  1HPZ B;  3NNC A;  2R8K A;  1XN9 A;  3QZ8 A;  5H9F J;  5JVG Q;  2VG5 B;  1IQT A;  3DOL A;  2FHO B;  4KPC A;  5KG4 A;  3H98 A;  4MK8 A;  1X9M A;  1REV B;  4NLS A;  3WC2 A;  3QGH A;  5CA5 A;  3VAL A;  1ZM2 A;  3HLU A;  1C4C A;  2H48 B;  1JNZ B;  3K8V A;  3P49 B;  1WOS A;  3UFC X;  1KQF B;  4R8U B;  3GTY X;  4IFV B;  1QSS A;  1S9G B;  2KJW A;  2CG8 A;  2BEF A;  2KL8 A;  3VGS A;  1M1H A;  5KFD A;  2MQP A;  4DUY J;  3TAN A;  1U48 A;  4B3O A;  4KHR A;  3PX0 A;  4DS5 A;  1F60 B;  3HFV A;  1NCL A;  3V2U C;  1OQ6 A;  4IH6 A;  5A6P A;  3PIP Q;  3KLI B;  1IKW A;  1Y3K A;  3CXC R;  2GAH C;  4FPI A;  4ZCM A;  2RQC A;  4V1A k;  1SQF A;  3N5F A;  5D0R A;  2HQG A;  2A6O A;  1F1B B;  3D1O A;  5LL6 d;  3VAM A;  4H4K C;  2J9D A;  3OTE A;  2KI2 A;  4E2F B;  1UW9 A;  2MKH A;  4ZVQ B;  1TMM A;  2CNL B;  3MEE B;  3MPY A;  1D1U A;  1JIH A;  1VQ6 S;  2ZM6 F;  2XGQ A;  1NO8 A;  5KFS A;  1T9X A;  2IIH A;  2COL A;  3QLH A;  1U4B A;  4ZVT B;  3W60 A;  1W26 A;  4DV2 J;  1OIA A;  3G9C A;  2CQ4 A;  2R7V A;  3ET6 B;  2HHT A;  1H98 A;  1RK8 A;  2ZJP Q;  4IRD A;  1U1N A;  2BJ7 A;  4MK7 A;  4ZHR B;  4LF6 J;  1APS A;  2UUB J;  2JJ4 D;  3N79 A;  3H2U B;  4FDF A;  4USW A;  2XWY A;  3TQE A;  4F3Q A;  2PDA A;  1DTQ B;  2MHE A;  2U2F A;  2QE5 A;  1WTF A;  1JJH A;  3KJV B;  2KYX A;  2DNG A;  2RIL A;  3OTB A;  3KUG A;  4Y2K A;  5DJB A;  3QT7 A;  3TX8 A;  2UXD F;  2AU0 A;  1NM2 A;  3TVZ A;  4PEO A;  2L08 A;  2KB2 A;  4WKR A;  3DRY A;  3GFH A;  2W9C A;  1GXT A;  1FXD A;  3W3S A;  2W4D A;  1MWZ A;  2MQL A;  4NX9 A;  5KFV A;  4RZR A;  4KGX B;  3ITH A;  1HR0 J;  1VHI A;  2HPU A;  2VG7 A;  3Q2T C;  3HSJ A;  3IP0 A;  4LBP A;  5BJR A;  2PT0 A;  1Q16 B;  2M8H A;  2RIJ A;  4I2Q A;  3RBZ A;  2OSQ A;  2VAS A;  3TEG A;  3UE2 A;  4DLE A;  1V6H A;  5HL7 Q;  4FYY B;  2BXJ A;  1Q7L B;  2CJB A;  1S0M A;  2E1R A;  1SH0 A;  2MYF A;  2OFH X;  1D9A A;  1Q1K A;  1X0P A;  4ECT A;  1NSK L;  1YJ9 S;  3L95 X;  4DR1 F;  1VQK S;  1FCA A;  2VFS A;  2E7V A;  1RT2 A;  3C14 A;  4I68 A;  5C24 B;  5KOW A;  1PO6 A;  4Q7A A;  2BJE A;  3DCA A;  2ZHO A;  2BM1 A;  2RHQ B;  3WX4 A;  3E51 A;  1XR7 A;  5KFK A;  4Y3C A;  4ANC A;  3N01 A;  1AT1 B;  5D78 A;  1MW7 A;  2DKO B;  4TNO A;  5FD1 A;  1X9S A;  1NK0 A;  4KTQ A;  1VRT A;  3QJP A;  1LWE B;  1M0S A;  3NRB A;  2QMU B;  4UOC A;  1SKW A;  3OR2 A;  1HAR A;  5MAO A;  1Y3J A;  4NLT A;  3M2U B;  5CZV A;  5A2Q Y;  5L1I A;  3AOB A;  4WJB A;  4IKA A;  1SC3 B;  3A1Y G;  1RYS A;  3EXC X;  3PFO A;  1RWM B;  1E6V A;  3M8P A;  3M6V A;  5DRK A;  5LMN J;  3POT A;  4YME A;  1HLW A;  3M32 A;  1K9M T;  4B3R F;  2OML A;  3O8W A;  4X4Q A;  1NPP A;  4YP3 A;  4NLV A;  4PKD B;  2GVZ A;  4C0O C;  1H2V Z;  1AW0 A;  4DUZ F;  4X65 F;  4ES2 A;  2ZJQ Q;  4DV6 F;  2RRA A;  1T7P A;  4WF9 Q;  3MPD A;  2LXF A;  4Y34 A;  3CF5 Q;  3DOK B;  3H20 A;  4JBC A;  2FJV A;  3NMR A;  5DM6 Q;  2HS0 A;  4NYP A;  3B4D A;  1XQI A;  1IR1 A;  4Y28 C;  2OI2 A;  3O5T B;  1H6K X;  1IJE B;  4RW7 A;  4DX7 A;  1MU2 A;  4EZ9 A;  1ZM4 A;  3ZTP A;  3AJD A;  1S12 A;  3BQ0 A;  3T1Y F;  3CJ5 A;  1HYS A;  1FRX A;  5CAB A;  5EHH A;  1BHN A;  1HHT P;  4K4Z A;  2M3D A;  2UXD J;  2V8P A;  1JLB A;  1RT6 B;  2ZNZ A;  5JUM A;  3IS9 A;  4WYW A;  2QX0 A;  2QL7 B;  1ZBT A;  2I5J B;  2XSJ B;  4NA1 A;  1UA1 A;  3P6Y C;  3R8Y A;  3OSP A;  3NS5 A;  4DV0 J;  4IYQ A;  5GAD U;  3Q8S B;  1AXQ A;  4CZC A;  1YJN S;  2UXC F;  4ED0 A;  1RTI B;  2ZH7 A;  5A8R A;  1YWX A;  1OO0 B;  4IR1 A;  3ZC4 A;  4JI7 J;  4I69 A;  1HNX F;  1MN9 A;  1SJR A;  5B0G A;  2AMC B;  2G0I A;  1WC4 A;  1YJV A;  2H51 B;  4Y2I A;  2CQP A;  2IYI A;  2VIH A;  3AJ2 A;  1RT2 B;  3AB2 B;  3CE8 A;  4KFB B;  4NLQ A;  4UZC A;  4XO0 A;  1RT7 B;  4CIO A;  4F02 A;  3N6M A;  4C6A A;  1UP1 A;  3PTW A;  1VRU A;  3CJQ A;  2EG1 A;  4BBY A;  1FWK A;  5J2P B;  4IO9 Q;  1FNX H;  2HNZ A;  3IXQ A;  4J90 A;  2J6S A;  4PG6 A;  1HQU A;  3NBP B;  1RT3 B;  4O4G A;  2I6W A;  5LXR A;  1Y9O A;  1RSC A;  1TL7 A;  2Z4P A;  2MY8 A;  4USM A;  5KT5 A;  3BJY A;  3M2U A;  1UWB B;  2QA1 A;  1X4G A;  4Q8E A;  3VGT A;  2DNN A;  2MST A;  3HMJ G;  1V5I B;  1URR A;  2P2C B;  3LGM A;  2ZBP A;  4WE1 A;  1EIY B;  4C9D A;  1M5H A;  2GFF A;  2W7P A;  2VQF F;  1R8A A;  3RB6 A;  2DH7 A;  4FBU A;  4DQP A;  4IRK A;  3B82 A;  3UDL A;  3TZZ A;  2R2U A;  4DV7 F;  4W92 B;  3MOJ B;  1VC5 A;  1HNV B;  3HD1 A;  4V19 J;  5D4P A;  1XBW A;  2LFV A;  1VLO A;  4RWW A;  3LAM A;  3W5Z A;  2R7W A;  4JI4 J;  4X4N A;  2DCL A;  4HAC B;  5KFZ A;  1A7G E;  3WHI A;  3J81 j;  4B02 A;  4DL7 A;  3HVR A;  2FJX A;  2WVE A;  1EKS A;  3BKT A;  3DNC A;  3HSZ A;  4CLY A;  4N7T A;  9ATC B;  4AT1 B;  2YKM B;  3SV4 A;  2P9E A;  5C5J A;  3MCM A;  3DLH A;  1VMB A;  2KN4 A;  2C2R A;  1N54 B;  1KFS A;  3GPA A;  2FLN A;  4CH0 S;  3RTV A;  5D0H A;  3GJQ B;  1KQK A;  2RD5 C;  3GWC A;  2X3D A;  2YNF A;  4EK2 A;  2QYC A;  1T9T A;  1TR0 A;  5E3R A;  5ITH A;  3QZ7 A;  1R31 A;  2GGP B;  4HVZ A;  5IQQ A;  3PX4 A;  3OL9 A;  1MU2 B;  1J5E F;  5D8H B;  1TKX A;  1VQS A;  4LSZ B;  2PMH A;  2IVM A;  3B6B A;  1QE1 B;  2IHR 1;  2VU5 A;  2M8D B;  5EN1 A;  4DV2 F;  1QAX A;  4M5I A;  4CP5 A;  3PAC A;  3FZB A;  2BE2 B;  4PG5 A;  3MD3 A;  1B70 B;  2RH3 A;  3HZE A;  2EW9 A;  4DR2 F;  5F8L A;  2CQ2 A;  3QYY A;  1RTZ A;  1T9W A;  2FDN A;  4YR3 A;  1XNQ J;  1I51 B;  2J9E A;  3ILJ A;  5DZ6 A;  3MMB B;  2AGP A;  5FLX U;  2FVR A;  2VKR A;  2X1F A;  3FFI A;  2DRA A;  2WVC A;  3MPW A;  3MDF A;  2W4C A;  2MZS A;  3BPS P;  3CVK A;  3FMW A;  4TXS A;  3WZ0 A;  2E7W A;  3PR4 A;  3NNH A;  2BUN A;  4ZP7 A;  3M9N B;  1KLM B;  3EZO A;  1PKU A;  1NLK L;  4J9K A;  5T7L B;  3JAM Y;  5DGB A;  1GX5 A;  2GMJ A;  4KHP J;  5AXM A;  2UU9 J;  3W2V B;  1LFP A;  3IG1 B;  1ZA2 B;  2QLX A;  2ZH1 A;  4O4R A;  2J0W A;  3LP1 B;  1KBR A;  4RW4 B;  3HUL A;  3D5M A;  3A3P B;  3BQ2 A;  4TYB A;  3JSM A;  1F3F A;  4J5O A;  2RU3 A;  3D2W A;  1FEE A;  4DPU A;  4U8V A;  3BSN A;  2XNR A;  3GIJ A;  1PYS B;  4ENO A;  4IOB A;  3D28 A;  3MM8 B;  4WU3 A;  1X4B A;  3DXS X;  2Y9H A;  1X5P A;  3IWL A;  2YH1 A;  4LQ9 A;  2ZH2 A;  4R8U A;  1JXE A;  3KLH B;  4YHH F;  1FKP B;  3H7H B;  2HBY B;  3OD2 A;  3G6V A;  1KC8 T;  2D9O A;  1SH3 A;  3CJ8 A;  5J2N B;  1H0H B;  1HQE B;  4I6A A;  4F0H A;  2ASD A;  2KG0 A;  1XJW B;  3T1Y J;  3Q2S C;  4CO0 A;  4LF6 F;  3GJR B;  1U2R A;  1QTN B;  3H5S A;  3R1H A;  1SBR A;  1PC4 A;  2HFO A;  4LFB F;  4H4O A;  1NB2 A;  4RBT A;  2D41 A;  3IR5 B;  3HHL A;  2OHD A;  5B0D A;  3BGU A;  4KGZ B;  1SKS A;  2B3T B;  5HLF B;  2F9D A;  2DXF A;  4MTP A;  4OX9 J;  4JI3 J;  2PN6 A;  5MLC V;  5EWE A;  3BH6 B;  1T02 A;  2AYG A;  4EUV A;  3BS9 A;  4KB7 A;  2QLW A;  2DGT A;  3HVT B;  4NLP A;  5KAK A;  2YWE A;  2HBQ B;  3CJ4 A;  1S9F A;  4B3R J;  2MSS A;  4LJM A;  3R9L A;  2ASL A;  1PYO B;  1ZOT A;  4K4U A;  4ER8 A;  1FWL A;  4QIF A;  3JSB A;  2J7U A;  1IWG A;  3PW7 A;  2IAJ A;  3SBM A;  2ROG A;  3OHB A;  3V6K A;  2DNR A;  2C22 A;  2XTJ P;  3GJT B;  5ETK A;  2HK3 A;  3D6F B;  3DM2 B;  1B3T A;  2QIF A;  5F8N A;  2V2V A;  1NJZ A;  2CKW A;  2VBZ A;  2E9T A;  4DZ6 A;  5HMY A;  4IG3 A;  3T5J A;  3L7O A;  1WUU A;  3ZNU A;  3SMZ A;  3KFW X;  1FNM A;  1WDD A;  2WRM A;  4A46 A;  2BJ1 A;  1WOR A;  3BBC A;  1YJW S;  2X1A A;  1L5U A;  1NDL A;  4DR1 J;  3R5J B;  3SYZ A;  1ZZN A;  2J6U A;  1ARO P;  3H2L A;  3MUM P;  2B5J B;  3DDN A;  4P2F A;  1XNR F;  2XY5 A;  4KIA A;  5LOQ A;  3D6T B;  2VV5 A;  1GX6 A;  1LWE A;  1X4F A;  4QBU A;  4Z7C A;  4U7C A;  2AJ1 A;  4DR6 J;  4X4U A;  1PBA A;  3NOC A;  5HRO A;  2ZBQ A;  2R7U A;  2KXF A;  2B4O A;  1S49 A;  3IWX A;  3EX7 B;  4ZIV A;  4UY8 5;  4CT9 A;  2M5Y A;  4KBI A;  1RBO B;  2D3O 1;  1PAE X;  4ED8 A;  4NML A;  3AD8 C;  3I32 A;  3MCO A;  4TKT A;  3U7J A;  5C42 B;  4DR2 J;  4DG1 B;  3W2V A;  2HWT A;  4RW4 A;  2DHX A;  4LRE A;  4QW8 A;  1G3O A;  2ROE A;  1DRZ A;  5HAN A;  2RF2 B;  1M5K C;  2PFF B;  1C0T A;  1XR6 A;  3M2R B;  3U27 A;  1ZH5 A;  4DFJ A;  4ID5 A;  4YR0 A;  2XHC A;  4KT0 C;  2FHM A;  3ZXW A;  3LP2 B;  2DR8 A;  1RT3 A;  4G65 A;  2QGF B;  4L73 A;  2ZD1 B;  3IWN C;  4U7U D;  5IV4 A;  1JQG A;  1T11 A;  2OJ3 A;  3D1Q A;  4RWX A;  5F9L A;  4B3T F;  2HAI A;  2FY8 A;  2XHW A;  3WQP A;  1N88 A;  3DMJ B;  6AT1 B;  4LF4 J;  2NYH A;  4C8Y A;  2ZE2 A;  1YIT S;  1PGZ A;  4AL6 A;  4RX6 A;  2EI5 A;  2KT2 A;  2NYI A;  2NZ4 A;  2B4V A;  5G4D A;  3T3F A;  4LF5 F;  1AUS L;  4OJ3 A;  4LFA J;  4JI8 J;  3RJM B;  4FXD A;  3GYN A;  4PRF A;  1UJ5 A;  2CA9 A;  2DNL A;  1SJF A;  3KOA A;  3ADA C;  3FEY B;  4PCQ A;  2D3U A;  3QAU A;  4X66 F;  2VHG A;  2CPD A;  3CCL S;  5KG0 A;  5RUB A;  3TUJ C;  3I6P A;  3NXZ A;  4LVN P;  2YX7 A;  4DL4 A;  2JL9 A;  4DDF A;  4JI7 F;  2AT1 B;  1CJK A;  2Z8Q A;  4LSN A;  2IVY A;  3WIV A;  3R3T A;  1S10 A;  2FVS A;  4HHH A;  3ISN C;  1Q7Y T;  1RT1 B;  1X4D A;  2AYM A;  3OL6 A;  3PRV A;  3MEG A;  4F4A A;  3JS9 A;  2EPI A;  1TKT A;  2WW4 A;  3SSS A;  3RRH A;  3QJJ A;  2DEJ A;  4PG7 A;  3WBZ A;  4AXJ A;  1QVF R;  1V3Z A;  1S48 A;  4ZHR A;  2B43 A;  5ETT A;  5EWG A;  4Z7Y A;  3TJ9 A;  4F36 A;  4ZVH A;  1FRJ A;  3D3C J;  3W9H A;  2XNQ A;  3LP0 A;  2DO0 A;  4JB8 B;  2ADB A;  2HRU A;  1S72 S;  2DNM A;  2DIU A;  1IBM J;  3ISZ A;  4K0K J;  3HVW A;  2WVD A;  1BE4 A;  3DN9 A;  5K14 B;  2BQR A;  3TUZ C;  3UQS A;  2E9Z A;  1VIS A;  3MR2 A;  5KFE A;  2AX1 A;  1S7I A;  1CBK A;  1GAO A;  1WF2 A;  4DPX A;  3VAG A;  3AY0 A;  3PZP A;  2ACM A;  3KTQ A;  1HMV B;  5FDL A;  4C0B A;  1F9E B;  2ZBC A;  3HD2 A;  2NXU A;  3CD5 A;  2OEL A;  3D68 A;  4M5G A;  4P7T A;  5E33 A;  3TJA A;  1R0A B;  5A0Y B;  1I94 F;  4UY8 T;  2FLL A;  1RAB B;  2HNY A;  1JLB B;  4USJ C;  1X4H A;  4QYZ K;  2YQ3 A;  2KXN B;  3BO3 A;  1NK4 A;  5AXN A;  1PBU A;  2JVR A;  2KJV A;  3AQO A;  3GR1 A;  5EX3 A;  4CTA A;  3ICL A;  5J2P A;  3NGS A;  1VS3 A;  2H5I B;  1UEK A;  2DGO A;  3N28 A;  2ZWP A;  4FXV A;  4BWM A;  5AJ3 J;  2RQ4 A;  4NXN F;  1G2E A;  2HHW A;  2BV3 A;  2RML A;  4HH0 A;  2IBK A;  2AZ1 A;  5J2Q A;  2RRB A;  4AL7 A;  1BLU A;  2VFV A;  4AQY F;  3I31 A;  5AXK A;  2F5G A;  1FFS B;  1HNI A;  2Y3Y A;  1QLN A;  3HO1 A;  1CC8 A;  2E1M C;  4A8S A;  3TW0 A;  5DQH A;  2IDL A;  5CYM B;  1WAC A;  4KRW A;  1MMN A;  4FVM A;  3G86 A;  3NEK A;  5F0W A;  3W5Y A;  4R5P A;  2KM8 C;  2ZKU A;  2E5L F;  3EGZ A;  2D69 A;  1FD2 A;  1WEZ A;  2OPQ A;  3QSY B;  2AD9 A;  2LA4 A;  2GNK A;  3HX9 A;  3CSK A;  1X5T A;  3TZY A;  1VJQ A;  1YBU A;  4DUZ J;  1N48 A;  1RUS A;  1UWB A;  3H59 A;  3I0S A;  4USK A;  1OPI A;  2DJW A;  2LCW A;  3PYE A;  4U7U K;  3S8S A;  3AB4 B;  3OJS A;  1NK5 A;  1ULR A;  2OEK A;  3W8G A;  2B9Y A;  3CDW A;  4URG A;  2CQG A;  4RR5 A;  3R5D A;  2F1F A;  3QGG A;  9RUB A;  5HI7 A;  1Z4U A;  1S4F A;  4J9U E;  4Z2X A;  2HRY A;  1SJQ A;  2DNO A;  5C2C A;  2ADC A;  1S6P B;  1J2V A;  3PW5 A;  1KS2 A;  2KRR A;  4NYO A;  4ZLL A;  4OZJ A;  5U47 A;  2XZW A;  2BVZ A;  3GYX B;  3CD0 A;  3P8B B;  1P1T A;  2QO3 A;  3VVU A;  2Q6B A;  1ZTT A;  1VQ4 S;  3GCW P;  2JEF A;  2CWX A;  3LAN A;  5LMU J;  1SC4 B;  4KH1 B;  2AWZ A;  3HVA A;  4QR2 A;  3FDS A;  4TY9 A;  2D7S A;  4WZQ A;  4TQS A;  1SL0 A;  5E2Q A;  2QT7 A;  4TLR A;  1VQP S;  5A8K B;  1R6Y A;  3M6X A;  2LXI A;  3ILO A;  3W9I A;  3J7A 1;  2CXE A;  1HWU A;  1S0V A;  3ETM A;  1RT4 A;  4OX6 A;  4EZ6 A;  1CUL B;  1IXK A;  2RKI B;  4MIW A;  1WHY A;  1VQN S;  4I6Y A;  1UEU A;  2F3J A;  4C11 A;  4WK3 A;  4Q0B B;  2BQ3 A;  1KLM A;  4GO5 X;  3N9U C;  3CCT A;  1L3U A;  4W98 A;  1AB8 A;  4WTY A;  1SJ1 A;  2CPZ A;  4RW6 B;  2ZM6 J;  5LJ5 Y;  4ED6 A;  4MKV A;  1IKW B;  1RIS A;  2PO4 A;  4DEZ A;  4DFK A;  3EE3 A;  5AE3 A;  2YBV A;  2PEB A;  3ENW A;  1R6V A;  3PJX A;  4UUW A;  4DV0 F;  2GHP A;  1D8Z A;  1EKR A;  3QIP A;  1UW4 A;  2BE2 A;  1C1C B;  3NS7 B;  4B3S F;  4KY3 A;  3IMQ J;  1Q78 A;  5HSP A;  2NUU G;  1WNE A;  2UVU A;  5L9X A;  1W7W A;  2BM0 A;  4FZV A;  4DCP B;  4AQY J;  4ALZ A;  3M1V B;  4DSI A;  5LT5 A;  1BQN B;  1J5O A;  2HHQ A;  3UNG C;  4NL5 A;  1JJ2 R;  3KK1 B;  4OLP A;  1RWO B;  1WG1 A;  2IPO B;  2WBM A;  3DMJ A;  3SZ2 A;  2O3D A;  4LR9 A;  4WPA A;  2E44 A;  3SQO P;  3KK1 A;  2CQH A;  1WC6 A;  2CQC A;  4C8O A;  2YPY A;  3Q8P B;  3RR8 A;  4DR6 F;  4I2P B;  2GS8 A;  5HK4 A;  3R5C A;  1G7C B;  1EET A;  1VDH A;  1UJ4 A;  2A10 A;  2B6A B;  1SCJ B;  1JJC B;  2DNP A;  1VLY A;  2X51 A;  2ZWO A;  3KJV A;  1BY9 A;  4ZPB A;  1Q86 T;  1QSL A;  3JSY A;  5HQM A;  2CPI A;  2Q79 A;  4KH0 B;  3RAX A;  2NR0 A;  1S9E B;  3FEX B;  1FDA A;  1XR5 A;  2KT5 A;  3IR6 B;  1B99 A;  3DRP A;  2IM2 A;  3NMA A;  2G2O A;  3O3L A;  2E5J A;  2NSC A;  2VPW B;  1R27 B;  4ZCK A;  3AD7 C;  2K06 A;  3GV5 B;  1XMQ F;  4KV8 B;  1HBU B;  2P5V A;  3MEK A;  3MPU B;  4DF4 A;  1N33 J;  4TU7 A;  5KFF A;  4A8Y A;  3UVJ B;  3NGK A;  4X4T A;  1H72 C;  2ASY A;  2B8P A;  4I4B A;  3W1Y C;  3HHE A;  4TLQ A;  1Z2L A;  4OHZ A;  1PYT A;  1SV5 A;  4Q2L A;  4GC7 A;  2VBX A;  2YWF A;  2BJ8 A;  2GV1 A;  1X0F A;  2HAF A;  3MMA A;  2QJ3 A;  4UUX A;  5DDR C;  2RDD A;  2RQM A;  4YUD A;  2GQQ A;  1VOM A;  2GO9 A;  5JJB A;  5K14 A;  2W8L A;  1UKU A;  1SUQ B;  2FZG B;  3D0G E;  1VQ9 S;  4F4Y A;  3C14 B;  2GIQ A;  3CMQ A;  4QWB A;  4ZJO A;  2Z58 B;  3NNA A;  1OSD A;  2L3M A;  4P6Q A;  4A8Q A;  1FJ7 A;  5M2R A;  1HR0 F;  2RSQ A;  1BGX T;  3DLE A;  1NRK A;  1D3W A;  4ZA1 A;  3OTD A;  3SXL A;  3JSM B;  2G1H A;  2DEI A;  4CLF A;  2W2Q P;  4KR0 B;  2IRX A;  2N7Y A;  2GJ2 A;  1JLG A;  1Q8L A;  5E3A A;  5KFP A;  3FCV A;  4GKJ F;  4YS2 A;  1HBO B;  2R7Q A;  4NXM J;  3U1L A;  1S6U A;  2DNH A;  4LR7 A;  2DR6 A;  4LR8 A;  2JDJ A;  2IRY A;  1C1B A;  4DV5 F;  2C2M B;  3KLH A;  1TK8 A;  2MMY A;  1AZS B;  3OR1 B;  4DV4 F;  2NXN A;  2GMH A;  4DMZ A;  4OYZ A;  2E5G A;  3KUH A;  2AZ3 A;  4K2J A;  4UOH A;  3CDU A;  3IA0 A;  5E5N A;  3V4M A;  4CLP A;  3KK2 A;  1N5Q A;  1GMU A;  2H3E B;  2HFN A;  3C15 B;  3CCJ S;  2DR9 A;  5IWA F;  1Y5L B;  2MZJ A;  5L38 A;  2B51 A;  3D6M B;  3QNW B;  3L9Z A;  4H4O B;  4RW9 A;  2PGC A;  3QPI A;  5HJY A;  1O0P A;  4RKU C;  2R8H A;  4V19 X;  2CAJ A;  1AUD A;  4ED7 A;  2ZEJ A;  3NOG A;  1IVZ A;  2FZC B;  4QWD A;  3BQ1 A;  4CLU A;  4CO5 A;  1NUE A;  5IWA J;  1KNZ A;  5CYQ B;  4DX6 A;  2J9D E;  4I6W A;  3QLH B;  4IDK B;  4OJH A;  4H54 A;  4X66 J;  4LBI A;  3AOD A;  1X8D A;  4WII A;  5KFL A;  5IS2 A;  3QT8 A;  3PJ9 A;  4P2X A;  1EZZ B;  1S5Z A;  1UAW A;  4G1Q B;  2NCK L;  2Z2L A;  5AT1 B;  2DHS A;  1GK8 A;  5BYS A;  5KFW A;  3CJR A;  3OSN A;  4DQQ A;  1TL5 A;  1NKB A;  1FO1 A;  1P9Y A;  3M6U A;  2YQ1 A;  3H5Y A;  1EAR A;  2QLB B;  1G4C A;  2PA3 A;  1DLO A;  2G13 A;  2ZUG A;  3BBB A;  3PV8 A;  3TAQ A;  2DY1 A;  2KFY A;  3DHX A;  3FK4 A;  1CJV A;  3BGR A;  4GVB B;  3OTO F;  2XUL A;  1YQH A;  1VI7 A;  5KFJ A;  4XPC A;  3HVT A;  5KFR A;  3JYT B;  2QA4 S;  2PEH A;  4NA2 A;  4OZ1 A;  4FPR A;  4WP8 A;  4PWW A;  4ZPV R;  1SIZ A;  5L8R C;  1YJR A;  3T6J A;  3BBF A;  1WTB A;  2IA6 A;  2HRT A;  3P45 B;  3R1L A;  4LRB A;  2VON A;  1NPK A;  2HVH A;  4M5K A;  3PW2 A;  2OIH A;  2QLF B;  2NXC A;  3DLK B;  2PI4 A;  4M95 A;  5B0A A;  2QZ8 A;  4JOU A;  3GIR A;  4IUF A;  2MLY A;  1MML A;  2FJD B;  3NKY A;  4U9R A;  4USI A;  2N3O A;  3VAJ A;  1N4L A;  4ECZ A;  3TUI C;  4ECQ A;  4QIV A;  2CNK B;  1F5A A;  3RYL A;  4PR6 A;  1QE1 A;  2GJI A;  3EXY A;  3WIU A;  1HPZ A;  1T05 B;  2FVP A;  1B7Y B;  4KKO B;  5I42 A;  4LSN B;  1SL2 A;  5DM7 Q;  4DFM A;  4FVC A;  4F04 B;  3TEH B;  1HHS A;  3BKU A;  3TA0 A;  1H7X A;  2N7C A;  4F4K A;  1TZ0 A;  4RW8 A;  2WTF A;  3T5L A;  1NZ8 A;  1QVG R;  3SCK E;  2OLW A;  3T19 A;  4PZV A;  2BOA A;  3Q8R B;  1B0V A;  1RT7 A;  2G9O A;  1Q0N A;  1RAF B;  4RNO A;  4OFZ A;  4S0M A;  2AQ4 A;  2XMM A;  2HBZ B;  3ELH A;  2L41 A;  1HNW J;  3GYG A;  5DO2 A;  1G6B A;  1TTH B;  3KJF B;  5E3P A;  4X4R A;  1N5Y A;  2R8G A;  2OAU A;  2JRS A;  2EFQ A;  3OPK A;  2QFJ A;  4M94 A;  1VIO A;  2KDO A;  2DTJ A;  3MAH A;  1AZS A;  1L3K A;  2CDR B;  1HKA A;  1BUX A;  2ZHB A;  4Y0F A;  2WCX A;  4X4P A;  1N6Q A;  5J1N A;  1PIE A;  5K8O A;  3QRP A;  3MR5 A;  2XCP A;  3DLG A;  1KR4 A;  1RHK B;  1N36 J;  3NY0 A;  1N0V C;  3OL7 A;  2AJ0 A;  1Y5N B;  4TN2 A;  4ZKA A;  2VDI A;  3IR7 B;  2MXY A;  1N8R T;  2FQQ B;  2MZQ A;  3DLG B;  1JXV A;  7FDR A;  1IBC B;  2QL5 B;  4G6V B;  4O3P A;  1IKY A;  4FNH A;  3DRP B;  4FP9 A;  3Q8Y A;  4UQT A;  1K0T A;  4HDH A;  3HFK A;  3J81 U;  5IT9 U;  1RWX B;  1YGY A;  4USH A;  4OHV A;  2MLX A;  4YB1 P;  1YKW A;  2CRL A;  2HK2 A;  4QPT A;  5ETM A;  1EX8 A;  3CNQ P;  2UUA F;  2W7A A;  5KG3 A;  2L9N A;  2YNH B;  1NKE A;  4F4Z A;  4C0H A;  1XC9 A;  5F8J A;  2OPP B;  3I0S B;  2YNF B;  1MMD A;  4UZB A;  1UET A;  3M05 A;  3MTK A;  4ED4 A;  1RCX B;  3VGV A;  4BLG A;  4R25 A;  5BR8 J;  2D9P A;  2E9R X;  4EGL A;  1JLE B;  4J9R A;  3EZ5 A;  4JI1 J;  3CJ0 A;  5BXI A;  4FS2 A;  3ZNJ 1;  1VIX A;  2MDA A;  2XI3 A;  1KLN A;  5D3G A;  3H42 A;  1FNO A;  5HO4 A;  4DSL A;  4G3I A;  1RT1 A;  4NCG A;  2EKY A;  4ZJQ A;  3IAS 9;  2NXE A;  4I56 A;  4USV A;  1U49 A;  3MUR P;  5DG9 A;  3N4W A;  5A8W B;  1JLA B;  1FTC A;  3FRZ A;  1VRU B;  4LSL B;  5LMU F;  2DPJ A;  4ILM A;  2DGU A;  3VTI A;  2AF6 A;  3SDE A;  3NCQ A;  1FA0 A;  5CD4 A;  3KLG A;  2UUC J;  3HZG A;  3NGR A;  1HQ2 A;  1UFL A;  4HHU A;  3CDA A;  2MTL A;  1U6F A;  5DS7 A;  4D3H A;  4OJ1 A;  5L1J A;  1HWI A;  4BDP A;  1HW8 A;  1TMJ A;  3MI7 X;  3RBX A;  4Q0B A;  2AJQ A;  5ETO A;  4KO0 B;  4W90 B;  5ETR A;  4J9O A;  2DNZ A;  1C0U A;  2RU9 A;  1WF1 A;  2V2K A;  2K8G A;  3PYD A;  4EO6 A;  3KK2 B;  4B9T A;  2B9W A;  3E8O A;  4F4X A;  4DUY F;  1S97 A;  4DL3 A;  5HLF A;  1R8B A;  4WXO A;  2U1A A;  3TAM A;  1QAY A;  1FK9 A;  4HEA 9;  1UJ6 A;  4P52 A;  5D4O A;  4B08 A;  1R43 A;  1JLA A;  2AJ4 A;  4LSL A;  3KWM A;  3M9O B;  1IKY B;  3GE9 A;  3T9N A;  1U25 A;  5KG1 A;  2QA4 G;  3C66 A;  3P3D A;  3W61 A;  5KT2 A;  3V6D B;  2JVO A;  4CH7 A;  1S59 A;  1RA6 A;  5H1S V;  4DR7 J;  1OSC A;  1JK9 B;  3SCJ E;  4QR1 A;  3K0J A;  3TNV A;  4ILL A;  2AYE A;  3P96 A;  1ZAV A;  3K7R A;  3CWJ A;  4OYB A;  4TVA B;  5KG6 A;  2J8S A;  3LTO A;  4C8Z A;  2XI2 A;  1IWA A;  4ZCI A;  2FY1 A;  2DGW A;  2VOO A;  3GQC A;  4ZVS B;  2FD2 A;  4ECY A;  1VBX A;  2ZZN A;  1U7L A;  2LKZ A;  2OSR A;  3CJK A;  4JI0 J;  2V5H G;  1VFJ A;  3DRS A;  4WKY A;  2GGP A;  4B3T J;  1KVI A;  5DLG A;  1HI0 P;  3KKF A;  3GIK A;  3DOM A;  2VZ9 A;  1LW2 A;  2V69 A;  3DGP B;  4M5N A;  3MEE A;  1ZA1 B;  5GAG U;  2DR5 A;  6FD1 A;  4PWD B;  4WIQ A;  3EPI A;  3V6D A;  1RTD B;  4FBT A;  1VR6 A;  1P1L A;  4F26 A;  2AP6 A;  2CDQ A;  2YKM A;  1WI8 A;  1S57 A;  4FXW A;  4ICL A;  2FJE B;  4QIG A;  3VAF A;  1JJ4 A;  1VCT A;  2HZA A;  1BXN A;  2IM0 A;  3PKY A;  3CB4 A;  2R7R A;  4X84 A;  2AJ2 A;  3VAK A;  4GKK F;  2IDE A;  4KE5 A;  2B6A A;  2B9X A;  3LF0 A;  5KFC A;  5GAE U;  1EP4 B;  4DWI A;  1JXL A;  4X4S A;  4DLG A;  4B9N A;  1GMW A;  2V4J A;  2VPZ B;  3U1N A;  5KOX A;  1XMO J;  5AXL A;  5H9E K;  1R8H A;  2HVE A;  2GX8 A;  1FJE B;  1MLA A;  1SUQ A;  3W8P A;  3MEG B;  1R8P A;  3SFG A;  1L3S A;  5A0Y A;  3NWR A;  2J8A A;  2UUT A;  3I5A A;  1NSQ A;  4W4M A;  1VRT B;  3CT9 A;  2A0F B;  1LW0 B;  3TQ1 A;  3G6X A;  4QIE A;  3SDE B;  3ETO A;  2C3O A;  3ZFV A;  3KHG A;  1GMV A;  1UFK A;  2OMO A;  2UV8 G;  3B8H A;  4OYX A;  3R97 A;  3IRW P;  1SC1 B;  4KSE B;  3BN7 A;  3M8R A;  1BQN A;  4P72 A;  1HBO A;  2MKC A;  5D4N A;  2FHJ D;  4ZPT R;  1RWU A;  2AX0 A;  3TUP A;  4G1Q A;  5IT4 A;  1CG2 A;  2HWH A;  2Z0G A;  1NDP A;  4HR2 A;  4OZ5 A;  4IOA Q;  5C7P A;  2QSF A;  4RNN A;  1NHV A;  3Q24 A;  3AJ1 A;  5HBM A;  1QUP A;  3CCZ A;  3ZZO A;  1DLO B;  1F0X A;  2FUG 9;  3QGI A;  3JAM U;  2HQI A;  2XGP A;  2ATL A;  1OYE A;  2UVR A;  5CCM A;  1EAY C;  1KOH A;  5GME A;  4F0K A;  1Y10 A;  1Q81 T;  2YNI B;  3JQJ A;  1TUW A;  2MZ1 A;  1TL1 B;  1PCA A;  1NK8 A;  4A48 A;  5K9F A;  3BN4 A;  4J9V A;  1SC6 A;  1S1V A;  4JI3 F;  3AXK A;  3ENA A;  3IO1 A;  2ZBR A;  2WB4 A;  1S6O A;  2XMJ A;  3AT1 B;  2DH8 A;  4QIW D;  3BZQ A;  1S1V B;  4GMK A;  1OQ3 A;  4XDD A;  4ZPA A;  8ATC B;  1Q53 A;  1X4A A;  3OXG A;  1RAO A;  2BKN A;  2RE1 A;  2EWH A;  2WSE C;  3DU5 A;  3EM1 A;  3OR1 A;  5C42 A;  4K4W A;  4F50 A;  1NB7 A;  3HK2 A;  1FE0 A;  5ADZ A;  4YY3 F;  3HT0 A;  4ZP9 A;  4LF7 F;  4RNF A;  2JC0 A;  4FF2 A;  4PQU B;  2UXC J;  1CJK B;  3K2Y A;  3MMJ A;  4YEA A;  4B17 A;  2KRB A;  1W25 A;  3G87 A;  3I4P A;  5GAE I;  3EGV A;  4DR3 F;  4DSE A;  2JSX A;  3VGU A;  4KKO A;  2FZK B;  5E3Q A;  4ZP8 A;  3PRD A;  4WU2 A;  4U6P A;  1Z2Z A;  3MM9 A;  2LDI A;  4PAA A;  2JLG A;  4TQR A;  2VH7 A;  4U67 Q;  1KHW A;  4OHY A;  3UN3 A;  2DVI A;  4JI6 F;  3FMB A;  4ICL B;  3OVA A;  1FD8 A;  1KP6 A;  5D0E A;  4UF4 A;  3ULH A;  4X62 J;  1MG7 A;  3KLF B;  1HBN B;  1TFW A;  5AE1 A;  3BM7 A;  1R0B G;  3PYG A;  4NLU A;  2VA2 A;  3TA2 A;  1D9F A;  3GR0 A;  4ZOS A;  5HAT A;  3MR3 A;  3LGN A;  1FRH A;  2OUG A;  4RO0 A;  5T41 A;  4EBE A;  1AFI A;  2W2N P;  3LPE A;  3MED A;  4OJG A;  3US5 A;  4J91 A;  2EC0 A;  1TKD A;  3KLV A;  2XYP B;  2YNG B;  3C16 A;  1GXU A;  4O3N A;  4AYB D;  5IZH A;  3HPO A;  4O3O A;  4RBV A;  2K1R A;  3DC2 A;  3BGO P;  2IVF B;  3BGR B;  4ZN3 A;  2MQN A;  1TAU A;  4A4J A;  4X4V A;  2JLF A;  2C2O B;  3ZZT A;  5A76 A;  3G71 S;  4ETX A;  3A4T A;  4OI6 A;  5M2P A;  4CLL A;  3G6E S;  2CFX A;  2Q6C A;  3ZTS A;  4ZDN A;  4J37 A;  1XNQ F;  3QRQ A;  4CO1 A;  1HNV A;  1HA1 A;  2KO1 A;  3G82 A;  4M8L A;  4MAK A;  3MR6 A;  2HQ3 A;  2LXU A;  4X64 F;  1CVJ A;  3DKD A;  2CPJ A;  4LIR A;  3MM6 B;  2QMW A;  4CO3 A;  1M5O C;  3IGV A;  3CCW A;  1MWY A;  1IKV A;  4J9L A;  2XYH B;  1KQS R;  2KFZ A;  1AA1 B;  5KFN A;  1RDR A;  2MKS A;  4CTA B;  2EFN A;  3V5R A;  1PJ6 A;  3KYL A;  4MFB B;  3PG9 A;  3K17 A;  4NOH A;  1YSJ A;  2CQ3 A;  4DPY A;  1NK9 A;  2VUG A;  4DG1 A;  2DRB A;  4FF1 A;  1WOP A;  4LRD A;  3V6J A;  5J2N A;  3ILI A;  2HQF A;  3C19 A;  5JVH Q;  2BA9 A;  3UN2 A;  3GIM A;  1Q5V A;  3PFE A;  5F8M A;  1ZYQ A;  1CS4 B;  3E3X A;  4DV1 F;  1GFW B;  3MM5 A;  1REG X;  1VC6 A;  1WJ9 A;  4PAB A;  4TY8 B;  3D66 A;  5ETV A;  2CJQ A;  1A0O B;  2CPX A;  2LLZ A;  2YWG A;  4N47 A;  2BDP A;  2QC3 A;  5LMN F;  4C4W A;  1TL1 A;  1F2G A;  1YLX A;  2ILY A;  2VOP A;  4HT7 A;  1OWX A;  1UL3 A;  2E5H A;  4F0M A;  5C25 B;  2WON B;  5J1P A;  5ETN A;  2LVW A;  2BKO A;  3ILL A;  5CYQ A;  2XY6 A;  2CZ9 A;  1H38 A;  3HJF A;  4MMO A;  2DNY A;  2F9J A;  4LT6 A;  4LF1 A;  2F4F A;  2WOM B;  1ZM9 A;  3F41 A;  2R2S A;  1QAI A;  3LGH A;  4HLB A;  2V68 A;  2R7T A;  2PD1 A;  1EQM A;  4LFC J;  1E6Y A;  1N32 J;  1RAJ A;  4JV1 A;  2H54 B;  3U1M A;  3O1L A;  3NLC A;  3M30 B;  1HL6 A;  2VIC A;  2J6T A;  3B4M A;  3R2C J;  1W2B R;  4NE9 C;  4J9S A;  1UVM A;  3FSI A;  4CO4 A;  2AHO B;  1FKO A;  3GON A;  3OFE A;  1WDT A;  2VF3 A;  4NXN J;  3G2X A;  4I7F B;  3W7B A;  3MOZ A;  1ICE B;  4NLO A;  4BC9 A;  3I56 S;  2F7V A;  2M88 A;  3SEO A;  2VG6 B;  2YKO A;  1KFD A;  3AH6 A;  1WHV A;  4C98 A;  5A8W A;  1FFW B;  2ZC3 A;  4EU0 A;  2ABY A;  4F2S A;  2DXE A;  4GRS A;  3CME S;  4K5S A;  5M2U A;  3G8T A;  1WI6 A;  1CJU A;  3FC9 A;  1RT4 B;  1V9O A;  1IKV B;  2LDY A;  2Z2Y B;  3QWU A;  4EBC A;  3HHL D;  3D9B A;  4KGV B;  3MF5 A;  4A8X A;  1VQM S;  3Q0A A;  1JLF B;  2MJU A;  2SXL A;  1OY8 A;  1JB0 C;  4QU7 A;  2IM3 A;  2ZNY A;  1WKL A;  5CQG A;  2CUY A;  3JTN A;  2OH2 A;  3HHD A;  4ECU A;  4B9M A;  2EBG A;  3BEG B;  4I7F A;  2V2Z A;  5KFG A;  2XMA A;  4KFB A;  4KAI A;  5DET A;  3T6B A;  4O44 A;  4WBF A;  3PR5 B;  4ZLN A;  3LP1 A;  1LQ9 A;  5D77 A;  3PY8 A;  2RDJ A;  1HWK A;  1K8A T;  5ETP A;  3TZX A;  2Q1L A;  2GHV C;  4FKY A;  4LRF A;  2GIF A;  4ZVF A;  4WZM A;  1WEX A;  1V5V A;  2FLP A;  1KQG B;  1S1T A;  3BR9 A;  3ZZ0 A;  2KKH A;  1BD6 A;  5HMW A;  3RB3 A;  4DV1 J;  5I3U B;  4MFB A;  2V94 A;  3HHK A;  2EK1 A;  1WF0 A;  4OIX A;  1WEL A;  2AEM A;  2R8J A;  4B3O B;  2HHU A;  2YY3 A;  4PYA A;  2B4U A;  3EIC A;  3S1T A;  1S9E A;  3L7P A;  3AFG A;  2ZVI A;  2QYG A;  1E6Y B;  1X31 C;  3HKZ D;  2OO4 A;  1WG4 A;  2W25 A;  3M8Z A;  2ZFH A;  4NZ7 A;  4WYL A;  4ZVU B;  4TY8 A;  4R5P B;  1KEK A;  5DQG A;  4C8K A;  4HDG A;  2WBR A;  5C2G A;  2C2Z B;  5KT7 A;  2X1G A;  1N33 F;  2OD6 A;  5DQI A;  2FJA B;  4PXB A;  5JMN A;  3G6Y A;  2JEI A;  2IC3 A;  2KYZ A;  1SB6 A;  2R7O A;  2C3P A;  1O8B A;  2R4F A;  4C48 A;  4DR5 J;  3I0R B;  3UDE A;  3OQ2 A;  3HF5 A;  3B54 A;  4OYI A;  3PYF A;  3RBD A;  2I5J A;  4OYP A;  1QAJ A;  3AHP A;  2ZH5 A;  5F41 A;  5K8P A;  1H2T Z;  3SCI E;  3PKM A;  2IJN A;  3PNI A;  1YVF A;  5DZ7 A;  5IQ6 A;  5E7O B;  3MR7 A;  3R7S B;  4IR9 A;  2HVZ A;  2Y1R I;  3LAK A;  4X64 J;  1Q8I A;  2QG9 B;  2HYI B;  4JYA J;  2QFI A;  1KTQ A;  3M7V A;  4WK1 A;  3MAQ A;  4NI2 B;  4ES3 A;  1FF2 A;  5J1E B;  3DHW C;  3L3C A;  1DTT A;  4ELT A;  2IBO A;  3ZZP A;  4CM2 A;  1IBK J;  2QL9 B;  1H73 A;  1YJT A;  2HLT A;  4PWU A;  4C8N A;  5AE2 A;  5J2M A;  1FJC A;  4JI6 J;  5BR8 F;  1XTZ A;  1RT6 A;  2BRK A;  2V0N A;  3CCQ S;  4ECW A;  4DL0 C;  3ZTQ A;  1LWC B;  1TU0 B;  3F0N A;  2CQI A;  3T1H F;  1FEH A;  3SSQ A;  3EMT A;  5GAH U;  1KVK A;  5B7W A;  4DR3 J;  2IJF A;  3LH2 S;  1TL4 A;  3VF0 B;  3KMQ A;  1U0H B;  3HSD A;  1VRQ C;  2OD4 A;  3LQV A;  3OLB A;  2RS8 A;  4IQX A;  5ETQ A;  2B56 A;  2GZO A;  1IJF B;  2D1C A;  3PW4 A;  2HGM A;  4WE1 B;  4DN0 A;  4JI2 J;  4DX8 H;  4YHH J;  3MXH P;  3QJL A;  3K5P A;  3OUY A;  1M5V C;  4LFC F;  2X7I A;  2HUR A;  2WB1 D;  3F56 A;  2J76 E;  1ZTW A;  2M70 A;  2HIY A;  3FBF A;  1N5T A;  4KJI A;  1RAH B;  4ECV A;  5CZX A;  2IMW P;  1UVK A;  2HS4 A;  4CLS A;  2YH0 A;  3T1A A;  2ZJR Q;  3CTR A;  3I82 A;  4PG8 A;  2NPF A;  5HP1 B;  2R2R A;  1F5B A;  3HHL C;  5LJ3 Y;  2HFV A;  4RL1 A;  1U24 A;  2YX4 A;  2L9W A;  5J2Q B;  3V81 A;  1U1L A;  1I94 J;  1NH7 A;  1RHQ B;  3C6T B;  4OHX A;  3CC4 S;  1G1X A;  2CJX B;  3J80 Y;  2H4W B;  4IOC Q;  3ET6 A;  1N6Q B;  1L3T A;  1HW9 A;  3DLK A;  3IRX B;  2G2Y A;  3UR3 C;  5K20 B;  3MWB A;  1SL1 A;  4F3O A;  2VBW A;  3KUE A;  1HD0 A;  3AOC A;  3DI6 B;  1N34 J;  3M2R A;  5L39 A;  3QQC D;  2CJY B;  2IMO A;  2IA0 A;  4OV6 A; 
#chains in the Genus database with same CATH homology
 4KPC A;  4WBF A;  3EVW A;  3VGU A;  3ZTP A;  4DI6 A;  1F3F A;  3EVM A;  5CAB A;  1BHN A;  4FKY A;  3PRV A;  4ENO A;  1W7W A;  3JS9 A;  3Q83 A;  4F4A A;  3BBF A;  3FCW A;  2BEF A;  3VGS A;  1NDK A;  1S59 A;  1NPK A;  1B4S A;  4F36 A;  3DDI A;  1NCL A;  1NHK L;  4O0N A;  1EHW A;  1BE4 A;  3EIC A;  1K44 A;  3WX8 A;  1MN9 A;  1NB2 A;  1NDC A;  2DXF A;  4UOF A;  1B99 A;  1UCN A;  2ZUA A;  3ZTS A;  3BH6 B;  3ZTO A;  4C6A A;  3ZTR A;  1ZS6 A;  3DKD A;  2HVD A;  3R9L A;  4S0M A;  3B54 A;  5CAA A;  3ELH A;  3NGS A;  1S57 A;  3NGU A;  2B8P A;  1KDN A;  3VGT A;  2AZ1 A;  3FKB A;  1BUX A;  4DZ6 A;  4FKX A;  1F6T A;  2HVE A;  3BBC A;  1NDL A;  1JXV A;  1WKK A;  1NSQ A;  3ZTQ A;  3Q8Y A;  1WKJ A;  1HIY A;  3EMT A;  3FCV A;  3GPA A;  3Q8U A;  3FBB A;  1PAE X;  1LEO A;  2B8Q A;  3VGV A;  2BX6 A;  3L7U A;  1MN7 A;  1NSK L;  4EK2 A;  3FBE A;  2AZ3 A;  4HR2 A;  1NDP A;  4UOH A;  3VVT A;  5BXI A;  5C7P A;  2HUR A;  4AND A;  3VVU A;  2CWK A;  1LWX A;  3G2X A;  3EJM A;  4ANC A;  3FBF A;  3B6B A;  2DYA A;  2VU5 A;  3BH7 B;  4CP5 A;  3FBC A;  1HHQ A;  2DY9 A;  3ETM A;  2DXE A;  1NUE A;  4UOG A;  3ENA A;  3FC9 A;  1HLW A;  4DUT A;  3EVO A;  3NGR A;  3Q89 A;  4W98 A;  2DXD A;  3EM1 A;  3PJ9 A;  1S5Z A;  1VYA A;  3Q8V A;  2NCK L;  1XIQ A;  3MPD A;  1PKU A;  1NLK L;  3Q86 A;  1NSP A;  1WKL A;  3GP9 A;  1XQI A;  3EE3 A;  4ANE A;  1U8W A;  3BBB A;  3NGT A;  5IOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...