4CP5A

Ndpk in complex with (rp)-spmpapp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
KVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE, CYTOSOLIC
publication title Enzymatic Synthesis of Acyclic Nucleoside Thiophosphonate Diphosphates: Effect of the Alpha-Phosphorus Configuration on HIV-1 RT Activity.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4cp5A00
4WBFA 1BHNA 4UOFA 1K44A 3NGSA 2BEFA 5C7PA 3ZTPA 2DXFA 3BBCA 1MN9A 1XQIA 1S59A 2B8QA 3EVWA 3PRVA 3WX8A 1NLKL 4F36A 4FKXA 3Q8YA 3DKDA 3Q83A 4DI6A 1WKJA 3FC9A 3FCWA 1NDLA 1NSQA 3NGUA 4DUTA 1B99A 3ZTQA 3B54A 1NHKL 4C6AA 4S0MA 3FBCA 3Q86A 3FCVA 2VU5A 1F6TA 3G2XA 4UOGA 5BXIA 3ZTOA 1NSPA 2DYAA 3FKBA 1HLWA 1LWXA 1NSKL 4O0NA 1S5ZA 4F4AA 3ZTRA 1BUXA 2AZ3A 1LEOA 1W7WA 1UCNA 3VGTA 3DDIA 1PKUA 3NGTA 3VVTA 5CABA 4FKYA 3EE3A 2HURA 3VGVA 2DXDA 1WKLA 1B4SA 1NUEA 3EICA 1JXVA 4ANDA 2HVDA 1WKKA 1S57A 4EK2A 3Q8VA 1NDKA 1VYAA 1KDNA 2DY9A 4ANEA 3NGRA 2HVEA 3MPDA 3VVUA 1ZS6A 1BE4A 2B8PA 3JS9A 3Q89A 4KPCA 4UOHA 3EVMA 2BX6A 4HR2A 2NCKL 3ETMA 3BH7B 1F3FA 3ELHA 1U8WA 3BH6B 3BBFA 5IOLA 1NDPA 1MN7A 5CAAA 1NDCA 4CP5A 1NPKA 3FBEA 3L7UA 1PAEX 4ANCA 2AZ1A 3ZTSA 3FBBA 1EHWA 3EM1A 3PJ9A 1NCLA 3GP9A 3Q8UA 2CWKA 3VGSA 3R9LA 3VGUA 3ENAA 1HHQA 1HIYA 1XIQA 3EJMA 3B6BA 2DXEA 3BBBA 4DZ6A 3GPAA 3FBFA 4ENOA 1NB2A 3EMTA 2ZUAA 4W98A 3EVOA
chains in the Genus database with same CATH superfamily
3MUVP 1NK8A 2Q79A 3MAHA 4RWWA 1AB8A 3G8QA 3QQCD 3Q83A 1WEXA 1JLCB 1SL2A 3W2WB 4ED5A 5FLXY 2LKZA 2WAQD 4WE1A 2MSSA 3I5BA 3W1YC 1NRKA 1RAJA 2HZCA 4MJKA 3TAQA 3B82A 3GCXP 3I5AA 1BE4A 4PCQA 3DLKA 2I6WA 5B7WA 3GZ7A 4X64F 1P6TA 1QY7A 3NNHA 5DG8A 2VFRA 3SZ2A 3M9NB 2DH7A 5J2PB 4IG3A 2DD8S 2CUYA 4U9RA 2CZ4A 4OYIA 1S48A 2ZH7A 3QJLA 4HH0A 1UFWA 4DSJA 4GVLA 1SPBP 3D66A 1BQXA 2PD1A 4DR1J 2MZSA 3FCWA 5KFOA 2XY6A 5U47A 5E33A 2FY8A 4CO4A 3KMSA 1DTQB 4P2FA 1S4FA 4ZVQB 3D0GE 2J76E 3HO1A 5DDQC 1NJIT 1Y9OA 3V81A 1RT4A 1GH8A 4UY8T 3Q8SB 4YUDA 1DHMA 2O1PA 4R5PA 3G6YA 2YKMB 3BZQA 2D7SA 2R7SA 2ZOGA 5DS7A 2XB2D 3TA2A 1N4LA 1N36F 3MPDA 4DX7A 1SJFA 2P2CB 2DO4A 1KTVA 1TKXA 1RXOB 5GAHI 2MZTA 1ACMB 5BR8J 2HFOA 2ZBPA 1KVIA 4ZVPB 3A3OB 2L08A 3G6ES 4JI0J 4CLYA 2CWKA 3PEJA 2RKIB 3VGUA 2VF3A 3QSIA 5I42A 1RT6B 1RHRB 3QPIA 3OL8A 3CXCR 1PYSB 2VQFJ 1FA0A 2ZDPA 2AJ4A 1FJGF 1MU2A 4L72B 1MNEA 2KT3A 1XQIA 3RG6A 2LU2A 2BJEA 4GMKA 1R8HA 3U1LA 5I4MA 3LOUA 4HLBA 1REVA 3BJYA 3HX9A 1N5YA 3KUHA 1AROP 3DOKB 4I64A 4F3QA 2IMWP 3A8KA 1UJ6A 5A2QY 4M5DA 4LSNA 1TZ0A 3GFZA 3GJQB 4USMA 4Y6IA 1U2FA 4MK7A 2MQMA 3BR9A 4CI0B 2ZITA 3MHYA 2W9AA 4ILMA 3EGZA 1U2RA 4CLWA 1M90T 4QR1A 2GFFA 3WX4A 2KG0A 3ET6B 1P8GA 1V3SA 5EX3A 3CW2C 1MMNA 1IKXA 4F4KA 2W4CA 3QYYA 2V34A 2RF2A 2Y1RI 2VFUA 3FBBA 4AL5A 4QU6A 1SQGA 2ZH2A 1J27A 1HIYA 5KFEA 2BW7A 5K14A 3KHHA 4EGLA 1RTZA 3HK2A 2ZNZA 4OZ2A 1N52B 2H5IB 1S0OA 2BJDA 1N32F 4H4OA 5C7PA 1U1QA 4PWDA 3CD5A 2RRBA 1FJCA 3L7OA 1P27B 1HD0A 3J80Y 4QIWD 2ZH4A 5IT4A 2A2DA 1JJCB 4B9MA 4OIXA 3NGUA 1FDDA 1OYEA 1IJFB 2KN4A 4MKAA 3GIKA 1Q1KA 4USJC 3CVKA 3NLCA 4K59A 2KZMA 2XGPA 4IDKB 4X4VA 2VV5A 1NPPA 5I3PA 2AYGA 1X4BA 1PYTA 1NK0A 1KQKA 1TKZB 1RKJA 5ETRA 1JLQA 1G2EA 1ZS6A 2CJQA 2C2NA 1HMVB 1NJYA 2G4BA 3B4MA 3MR7A 1S1VA 1IWAA 4CP5A 3TUJC 1HI1A 2NZCA 2JFDA 1JLEA 4C11A 1FKPB 3NBPA 3L4BC 2WVCA 1E6VB 4LR8A 1RUSA 4ZHRA 1LKZA 3CCZA 4F3OA 3SBMA 1TUGB 3M2VB 3MM8B 3NRBA 3JYTA 1T05A 2J7UA 2F4VJ 4J37A 5K8MA 5C24A 5ETPA 2FC8A 1KP6A 1Q78A 1PIEA 3P4UB 4K7QA 1S4EA 3N5BA 3J81U 1RAHB 1VBYA 4LF8J 4OYBA 6FDRA 1RZMA 3MM5A 2FJBB 4M8LA 2YPZA 2V63A 2F9JA 3DOMA 3HSGA 5F8MA 4HI1A 4QIGA 4N41A 5EWEA 3DLHA 2J9DA 4CM0A 1EZZB 2H54B 2RB7A 4LRFA 3DRRA 3H5YA 1VQKS 1PJ7A 4F8RA 2A18A 3PIOQ 1HNWF 1XNRJ 1RQ0A 2HVEA 1IBKJ 4KPCA 1VK3A 3BPSP 2W2NP 4FYXB 3OFHA 5ETNA 1U1KA 2JDJA 4OX7A 1R6VA 3K0JA 4QW9A 1TQLA 3R6LB 2RRNA 1SKSA 1KWMA 4WFZA 2FY1A 3P49B 2KVIA 3AFGA 4LRDA 2RQ4A 1JLCA 2DKOB 4RWXA 3M4XA 1YBAA 2LVWA 1S59A 3W2WA 2WONB 5F9NA 4ZPCA 1FE0A 1WHVA 2H5EA 2OELA 2CQHA 4LRAA 3UD3P 2R7XA 3RRGA 1T9UA 2DYAA 4YQWA 2V4JB 4P75A 1L3VA 4CIOA 2FGCA 1FRKA 3BDEA 1S1UB 3LA0A 5KT2A 1L3UA 1EQMA 3CB4A 4DF4A 3F0NA 3BV8A 5KFPA 2AYBA 2KXNB 4DPXA 2V2ZA 5D78A 3NMAA 4PG6A 4Z2XA 4UZCA 2EC0A 2LFVA 2XI2A 4DSIA 1VBZA 2X1GA 4DR1F 3C46A 2GNKA 2RDIA 1FFWB 8ATCB 1KN6A 1U1MA 5IV4A 1ZH5A 3JQMA 3IR7B 3A8JA 1IKYB 1UWBB 3BKTA 3TZXA 5IFMA 3HHLD 1K47A 3FMBA 2E9ZA 2OGUA 4WP8A 1YK9A 4F7VA 2V0NA 1DTQA 3T5LA 4OV6A 1M5OC 2ZFHA 1Q8IA 1IR1A 4J9OA 4RPFA 2D74B 4EEYA 4AL6A 4M5IA 1LOUA 2YKMA 4IQMA 2B7CB 3WHIA 4JI0F 4PRFA 2RQMA 3M6WA 1F9HA 3OVBA 3HPOA 2R7RA 4QWDA 1WG5A 3PNIA 3DDIA 3AXMA 2VQFF 4MIBA 4B3MJ 3D6HB 1S6PB 3ULHA 3ITHB 5KFZA 1FX4A 1JNZB 5KAKA 4ZPVR 5EDWA 1VK8A 2DHGA 1DTTB 1UMJA 2KM8B 2CPFA 1VRUA 3RW7A 3SFGA 4OZ3A 3MXHP 1RTIB 1Y5NB 2HWIA 4JV5J 1GAOA 1RWNB 1CLFA 4LF4J 2F8HA 2Z56B 1BLUA 2X3DA 1UEVA 1WORA 3ZNUA 2VUGA 3NGSA 4CQ1A 3DLBA 2FUG9 3KMQA 1RT2B 3KNAA 2HGNA 2KI2A 1N6QB 3DKDA 3DDNA 4JP8A 1NSAA 2YWEA 1S12A 2OJ3A 3W66A 3PTWA 3J7AN 1N0UA 1Q79A 3N79A 2M5YA 2CQ1A 3M9OB 1F0XA 3ET6A 4I7FB 3TP2A 1U1PA 1QE1B 3UDVA 1TV6A 2ZVIA 2KFYA 2ZHAA 1RWMB 1ZM9A 3RB4A 2KT2A 2BE2B 3K8WA 4UF4A 2UVVA 1RGVA 2DNRA 2DXEA 3BB5A 4Y2CA 4XTTA 1WTFA 1Y3JA 2W25A 1Q8LA 1KQGB 2HS0A 4BC7A 4FYVB 2CPIA 2DNLA 1YSJA 2MKIA 3D9BA 1U6FA 3EVWA 4J9VA 3RYLA 1SH0A 2LQBA 2YWWA 4DL7A 2CPZA 4NLYA 3PYEA 4IDKA 4ZA1A 3D7SB 4ATNA 3D54A 3MEDB 2QRRA 3WIVA 4OHYA 2VU5A 4Q5VA 1HHSA 1M1KT 2QT7A 4HVZA 3I4HX 5ETQA 2HHXA 1TKZA 2DCUB 3J7A1 2ZBCA 3IR5B 2XMVA 3HHLC 1HMVA 1OYDA 2Q3PA 1UA0A 1RACB 1Q8BA 3KK2B 1H2VZ 2F4VF 1HWLA 2KT5A 1V5VA 2Z8QA 5C42B 3VHQA 1E6VA 1FJEB 4DQPA 5F0WA 4NXMJ 4JV2A 3GP9A 1AXQA 3M2VA 3DLGB 3MM8A 3R9LA 4LF8F 4P9SA 5GAGU 2DIUA 3ZC4A 5DM6Q 5AXLA 2W24A 3GU0A 3SI8A 4RUBA 3QO9B 3SDEA 2OTLS 2XSFA 2XG8A 4YDDB 5CXTA 4DF8A 2B56A 2AEFA 3AOAA 1UPMB 4MK8A 1XNRF 2OSRA 1IBKF 1D9FA 1NAQA 4YR2A 2PGCA 2AGPA 1KTQA 1NHKL 4UT4A 3T3FA 4PKDB 1YTYA 4DU8A 1EETB 2G13A 3MCSA 4DL5A 4AXJA 1DARA 5KFNA 4EZ6A 1NH8A 1ZAXA 1FX2A 5B0EA 3QGPA 3AOBA 1WC6A 4IRKA 4JI4F 3K5LA 4NCBA 4LT6A 1VR6A 2GHWA 4AT1B 5CAAA 1SQFA 4U7CA 4J90A 2VJUA 1MWYA 1YLXA 2BJ7A 3SV3A 3VGSA 1HW9A 3G71S 1S99A 5DGBA 2Y1LB 2MQLA 4ENOA 2WONA 2W4PA 3OUYB 2FD2A 1HKAA 4DR4J 4WBFA 3T6BA 1KD1T 2VFTA 4XIUA 5KFLA 1KONA 4R8UB 4G3IA 1FEHA 2V9KA 4ZDNA 3QNWB 2G2YA 1CC8A 3OLAA 4GC7A 2V4JA 3TX8A 5GAHU 4ZCMA 1S1UA 1I51B 2WVBA 2IJFA 3FSIA 2IIHA 2P6SA 3G2XA 1ZAWA 1WF1A 2XMTA 4KGMA 3BR8A 3F41A 3OD2A 3CCTA 4DR2J 2CXEA 3NG8A 2IM3A 1WWHA 4W4MA 3CJTA 4LBPA 2H4WB 3M9MB 5D77A 1YJTA 4DV6F 4X66J 2B8PA 2BX6A 1KFSA 2DR9A 4J9RA 2DHAA 3MEKA 5CCLA 1IKYA 4IH7A 3GIRA 4ECTA 4A4JA 5HL7Q 3KDNA 2QIFA 4QYZK 3EM1A 5ETOA 4DL3A 2BKOA 4QBUA 1FESA 2BVZA 4PYDA 4WWSA 1L3KA 2FYXA 2GMHA 3CCLS 2QMUB 3TJAA 3T9NA 1WTBA 4OX6A 2YNIA 4B3MF 3PYFA 2CQ2A 5HQ8A 2DEJA 3E51A 3NOGA 5D6GA 4N47A 3IS9B 1NDLA 4FNHA 4B9VA 2M88A 2QMXA 4C6AA 2EFNA 3QLHB 2XMMA 1JKHB 2AJ0A 2CJ9A 4NA1A 1FEEA 4UQTA 1IUJA 2AYEA 3M6VA 4JV5F 3FEYB 3ITHA 4C8ZA 1VS3A 2OPRB 1RT5B 4LF4F 4CCHA 3JSRA 3N6NA 3W8GA 3KJVA 2X1FA 4LVOP 1DTTA 1ZM4A 1F3VA 3PR5B 2O3DA 3PM9A 5CD4H 1HBUB 4ES2A 2ZWOA 5L9NA 3CIMA 1IKVB 1FWLA 4UOHA 1GMUA 1RTIA 1Y5LB 2PO4A 4DV5J 3BGUA 1O8BA 5HMXA 2LEBA 2EG2A 1P1TA 2ASYA 4YB5A 2KB2A 3QGGA 5L8RC 5ETSA 4FZVA 3DN9A 1SB6A 2ILYA 1WJ9A 4WFYA 4YOEA 2X7IA 1RT2A 5KG1A 1J5EJ 5KFCA 1KFDA 2YKAA 2Z4PA 1N6QA 4K4ZA 3OXFA 5B0CA 2GZOA 2QLJB 2HHSA 2RSQA 5F41A 4CH7A 2CRLA 3I87A 1FRIA 3P6YC 1B3TA 2MQQA 5DLFA 1RHUB 2MEWA 4CT8A 2ADCA 4C2MA 4J9NA 4OJGA 1R27B 4X4QA 4B9UA 1B7YB 1ELOA 4MIAA 3ETOA 2E5HA 5AE1A 3W5ZA 4I7FA 1NSPA 4CLKA 2Z0GA 3N28A 4TU7A 5KFSA 5L1JA 2M52A 1QE1A 4GKJF 3QJJA 3GIMA 2FVRA 2HVZA 5DDRC 3SXLA 3M2UB 5L1KA 1Q4RA 4DUZJ 4B02A 2BE2A 4IFYB 4DV0F 1RLCL 4X62J 2W1BA 4A8KA 2I2YA 2ZH9A 4NMXA 3OL9A 5DETA 2H51B 5F8NA 2W8KA 2DNQA 4ECZA 3UQSA 2PSZA 1HNZJ 2AF6A 4P2SA 3OV7A 3ISND 3GILA 1CULB 3WBZA 1GX6A 2GJIA 2YQ1A 1NKCA 1O5JA 3MEDA 4FKXA 3UDLA 2C3OA 4AE5A 3NEKA 1UEUA 2YPYA 3VAHA 5HANA 1XEZA 2VC0A 5JMNA 1CJKB 3FBCA 2NSCA 4NXMF 2IJNA 3KG0A 1DLOB 3IG1B 3FKBA 2WSCC 4A8YA 1U0HA 4LFAJ 3KK2A 4DFJA 2MKKA 3VAJA 2IDLA 1YBUA 2UVUA 5C42A 3N9UC 3AHPA 1WKLA 3UPFA 1VOMA 1JXVA 1J2VA 3NWRA 2R9LA 4FNIA 5EHHA 2IRYA 2J6SA 3ZZZA 3DLGA 2RT3A 3UN3A 2R8KA 1T9XA 2IC3B 3N5FA 3DXBA 1X5TA 2AZ1A 3CEDA 3QO9A 2FZGB 1VGYA 3GTYX 4IG0B 2WHOA 5LSOA 2MY8A 2LA6A 2P9GA 3KLFA 4IOAQ 4L73A 1UJ4A 2MB0B 4LFBJ 1NK7A 4JI6J 1R8AA 1FRXA 1HBOB 3R5JB 2FLLA 2HIQA 1RHMB 1WG4A 3C19A 5J1NA 5KTQA 4KBIA 3DOLB 1SVDA 4P74A 3P45B 3LP0B 5DZ6A 1CJTB 3MDFA 2J6TA 2XCPA 4ECWA 4C3MA 4LF2A 3M8RA 3P3DA 2HURA 4MKVA 4QWCA 2ABYA 2R7VA 2DXDA 2YQ0A 2C3YA 3D1QA 4ZK7M 2BJ3A 4HI2A 4L75A 1D1UA 1KHVA 5FIIA 4G1IA 2HYIB 5AJ3J 3PX0A 5KG0A 4EYIB 3NXZA 2W2QP 4PG8A 2RUSA 1OQ6A 2PA8D 5AE3A 2MZQA 4JV1A 4DL0C 4R8UA 5D0RA 4DR2F 1DFDA 3PZPA 3BQ1A 2VD3A 4FBTA 1LW2B 5KG4A 1SJ1A 1RT1B 1CS4B 3TA1A 3RB0A 2KYZA 2E5GA 4FDFA 3H2LA 5M2PA 2CDRB 1K9MT 2N7CA 3I0RB 4X66F 3TEHB 3CTRA 2J8SA 2AJFE 5D0EA 2KZZA 2A6MA 4OHZA 7AT1B 1SC6A 2FJXA 2GVZB 5L38A 2U1AA 2MQ8A 1SH3A 3J81Y 2HHVA 4NZ6A 2DGSA 4LQ3A 3ISNC 1ZETA 4K8RA 4OV1A 1E6YB 2IA6A 2L9DA 5IT9U 1R6YA 3CD7A 4ES1A 2AJ2A 1JQGA 5A8WB 1FWPA 1VDHA 2A6OA 1T11A 4KIAA 2J0XA 3D6FB 5GAEI 2AJQA 1PAEX 4USKA 2YNFB 3Q8PB 2ZZMA 5D4OA 5A8RB 3T1YJ 1NM2A 3IAS9 1I6JA 2QC3A 3B6BA 4ECXA 1HQEB 3N6LA 7FDRA 3V6JA 3IS9A 2J6UA 2XYHB 1M5SA 1JK9B 2OPPB 3QLHA 4KGXB 4Q8FA 1JKHA 1AZSB 3MEGB 3BF4A 4YR3A 5K20B 2XNQA 1WKJA 4LBHA 4KRWA 4DV5F 3MR2A 3MECB 2OPRA 1RT5A 2AJ1A 3PRBA 1RYRA 2HFNA 5HN0A 2DR6A 3H2VE 4K4TA 4Y2IA 2VBZA 1YX2A 2R42A 3BO2A 2HFUA 3MFIA 5I3QA 3V6DB 1HBUA 2FZCB 2RE1A 1IKVA 2UVWA 4DS4A 1J5EF 2F4FA 2XWXA 4OZ1A 4TQRA 4JBCA 2XTJP 1NHVA 3OJSA 1ZZFA 2DY1A 4PUOB 1VBKA 4NCGB 4KHPJ 2AW0A 2OPSB 3T5KA 3MI7X 2J9DE 1FTCA 3KYLA 1S79A 4CZCA 4PEOA 3Q8UA 1UZHA 1JLAB 4LF7F 5CYMB 3HLUA 4Y2MA 1WHYA 5CYJA 2MSTA 1FF2A 4KHRA 3RRHA 1R8PA 2I5JB 4DV1J 1JJ4A 3CF5Q 1HBNB 2DRBA 2WTFA 2IM0A 3VQSA 1VLYA 1S6OA 3C16B 1Y0HA 4F2SA 2V2KA 1GXTA 4X62F 2M8HA 4K0KJ 3N6MA 3RW6A 2I0XA 3AAWB 1AFJA 1AA1B 1DY3A 1R8BA 2MQOA 3M2UA 2MKCA 3US5A 4EBDA 4OHXA 2RHQB 1Q8KA 4IFYA 4X4OA 1Z4UA 5AXNA 1S9EB 4OX8A 3RZAA 3MCMA 2GQCA 2X1AA 3CCMS 2MJUA 1LWFB 1LQ9A 4PR6A 2RHSB 3IXQA 3P8BB 2L9WA 1U8WA 3BYRA 1NK5A 3QGIA 1ZAVA 1F2HA 1HI8A 1HNIA 3PJ9A 4ED0A 3EWGA 1SJ4P 2V50A 3MUMP 4DZ6A 1HR0F 4RX6A 4LFAF 1R89A 1C1CB 1X0FA 3MF5A 1D3WA 2LXIA 3HJVA 1LFPA 1CJKA 4P2MA 4F4YA 1TU0B 1SKUB 1DLOA 2QE5A 3IG1A 1MROB 2AX0A 1S1XB 5ITHA 4URGA 1IWGA 2XS5A 3OJUA 1ZM2A 5HVGA 9ATCB 1N33J 2ROPA 4YN3B 3HHDA 4DEZA 3AD8C 2PDAA 2IC3A 2HWTA 4F67A 1NDKA 3V6HA 1T0TV 2DY9A 4FXDA 1KS2A 3HD1A 1C0UB 1VQMS 1DAXA 3BN7A 4LFBF 3ELHA 2NLWA 4JI6F 3BSOA 3TVKA 2N4CA 5AT1B 4C8KA 3DU5A 2MLZA 3H90A 3PW7A 4FXVA 2DISA 3KHRA 4D3GA 1OY6A 4W90B 4KB7A 2NUHA 1HBOA 3D6MB 2ZOMA 5LJ5Y 1S7IA 3SSSA 1NLKL 5IC4B 4RJVA 4NPOA 4C8MA 3DOLA 4CT9A 4ZP8A 2F5GA 2HSEB 3LP0A 5AJ3F 4GRSA 1CJTA 2GCFA 4BLGA 4DG1B 2XNRA 4DPOA 2R2UA 1S77D 1NKEA 3NNAA 1HD1A 4PWUA 4OMFG 2V2VA 2JC0A 3IM9A 4QPTA 4M63A 4YFUA 1H73A 4NXNJ 1HNVB 4XK8C 3U7JA 4O3PA 2GVDB 3VGVA 4URQU 2Z2LA 2DIVA 3KDOA 2B4PA 4EK2A 1JLFB 3TARA 2GIFA 4I2PB 4J9UE 4CYUA 3OTBA 1Z2LA 3A13A 4AYBD 3TUPA 5H9FJ 2QTWA 4RW6B 1Q5YA 5HVFA 1BWVA 2DGOA 4DS5A 3HSJA 1BQNB 4O4GB 1LW2A 1S97A 3RBZA 5SZTA 1RT1A 1FXRA 3IP0A 2MPUA 4ZN1A 4CO0A 2O01C 3I0RA 5KFWA 3KLGB 3FEZA 2XEXA 3OHBA 2ASDA 4A47A 2ZJQQ 2ZH1A 2GVZA 2YH0A 4A8MP 4F36A 3PCOB 1I1GA 3MURP 3QT8A 2HZAA 2J9EA 1U47A 3D3BJ 4YMEA 3HT3A 3GSIA 3HCXA 2N7YA 1NJWA 4QYRA 2OMOA 3Q86A 3RBEA 2D3OR 3K57A 3TAMB 3M1VB 4DR7J 2Q1LA 1E6YA 3RB6A 1VHIA 3OLBA 3PACA 1EKSA 1KKHA 1PSDA 4ZJOA 2VASA 2VBWA 4WFAQ 3GV7B 2CPEA 1SXLA 3IC1A 3E01B 1SBRA 3NGRA 2YNFA 4FPRA 5IXUA 5A8RA 3BH6B 5F8JA 2EK6A 2XY7A 2CNOB 3BSAA 1PJ6A 2IHR1 1C2PA 4OYXA 1XNQJ 1JNRB 1VQ5S 2OPPA 2CQDA 2E9RX 1X7VA 1AZSA 2HQIA 3MEGA 1SC4B 4Q2MA 1DRZA 3MFHA 2IYGA 5L9XA 1KRPA 4C8OA 1SV5B 5T14A 3MECA 4QOTA 3SYZA 2CJKA 2FDNA 8RUCA 2HNYB 4DV4J 3GG0A 3BKFA 2DGTA 4KHPF 4RL1A 4CLLA 2VBXA 2CJAA 3QSYB 5KFTA 1DQAA 2ZWPA 5H9EJ 4MYUA 1OS5A 5LT5A 3GJSB 1RCOB 4NOHA 3H20A 4PPDA 3CCSS 3EPIA 2OHDA 2MXYA 1UW4A 4HEA9 4PUOA 4NCGA 2ZKTA 3BGFA 2OPSA 3ZO7A 3Q2TC 4FS1A 1PC4A 2ZE2B 2OO4A 3M30B 2CQPA 1S57A 4I0WA 2CVIA 4CH1A 3BO4A 2IRUA 4FS2A 3GQCA 4DV1F 4JYAJ 1VC5A 4ZCKA 2XYPB 3R2DJ 1JLAA 1U7LA 2NREA 5CYMA 2JC1A 3B8HA 2DGUA 3TA0A 5E5NA 4K0KF 2I5JA 1TAUA 4OZJA 1HBNA 4MT1A 4DUYJ 3SSRA 5LOQA 4RUCA 3EVOA 3QJPA 2XMWA 2X1BA 2C22A 2DNYA 3C16A 1GX5A 4F4XA 4LF1A 4USVA 2QLXA 2ZH8A 1CBKA 3UE2A 3FRZA 3AA9A 5MLCV 3PJXA 2W7AA 1URRA 4UUXA 4L3NA 1Z2ZA 4UUWA 2XZWA 4OZ0A 4F26A 3NWGA 1S9EA 2VQEJ 4RKUC 2EK1A 4USIA 1NZAA 3R3TA 3AJ1A 5CD4A 4K4UA 2OMLA 2VL1A 3NGTA 1R0CB 2YH1A 2C2EA 4CLFA 4ZVGA 2K06A 1WACA 2XO6A 2ZOFA 2MGZB 4HT5A 2FHMA 1KDNA 2GHPA 4IO9Q 2BA9A 3IN5A 2Y3YA 1F3FA 4KO0B 3UW1A 4J5OA 3W5XA 1KOHA 5HLFB 1DQ8A 3A1YG 4EMDA 1VI7A 3HFVA 3QGHA 2IY5B 2DHHA 2DK2A 5GMDA 3T9ZA 4IRDA 4F50A 1RCXB 3OL6A 3FJ2A 1QDUB 1N33F 2FHKA 5E3QA 3AQOA 1IJEB 1MROA 1S1XA 3CDUA 2IJRA 2AMCB 4WFBQ 4F4WA 3CJ4A 4NRTA 1N48A 1QAYA 4DZDA 4NLTA 5L1LA 5J2QB 1BXNA 1H3DA 3RR7A 3I4PA 2IVMA 4U7UK 2I1RA 2YX4A 1NK4A 4FPIA 2IVFB 4DR6J 3C15B 2HRYA 1C0UA 2B9WA 4OHWA 4C0HA 1GQEA 3S7RA 1J5OB 1FKOB 1LFWA 3HM9A 4OZNA 1Y7PA 1X0PA 5G4DA 1AW0A 3L7UA 1X4CA 4F25A 4ETXA 2MDAA 4DV3F 3ICLA 3GSDA 4N7TA 3V5RA 4OYPA 3PG9A 2QLFB 1ZOTA 4LF5F 4NXNF 3VWSA 2R7TA 1T9VA 4B17A 1M5HA 5KFXA 4PPZA 2XGQA 1LNQA 3QFWA 4RUHA 3FSYA 1RWXB 3E3XA 1U49A 3DRSB 4DG1A 2RU9A 4JB8B 2JEFA 1N54B 2LA4A 2LEAA 1JWWA 5KG2A 1WELA 1RWKB 5LSRA 1D8YA 2M7SA 2AEJA 1HNVA 1IXKA 1F60B 4WK1A 1GXUA 1H74A 1SQEA 2YWGA 3AQPA 1QAJA 2GVDA 3UD4P 2LP4A 4DCOB 1H38A 1JLFA 1XBWA 4IOBA 4U8YA 1T3NA 2HFZA 5E3AA 1NH7A 4P2XA 3VVTA 1JB0C 3O2IA 4QR2A 4RW6A 1N5TA 2GJ2A 3OT9A 3THVA 2QL7B 1LXNA 4OI1A 1NPRA 3ENQA 4XPEA 1BQNA 4XDCA 4O4GA 4CTAB 1RHJB 1LWEB 3GMGA 3RTVA 2BRLA 4OYMA 2LQ9A 1MWQA 2P6TA 1VMBA 4ZP7A 3FNNA 3KLGA 4DR7F 1RISA 2BACA 1SIWB 1FRMA 4WFXA 2WOMB 4EWTA 1W26A 1GNKA 4FVMA 4NYPA 3QWUA 3K5MA 1TAQA 1VQNS 3T19A 2L48A 3PHTA 2I8EA 4UZBA 1H98A 3MPVA 4YS2A 4C48A 4RBTA 3TAMA 1H6KX 3M1VA 1PG5B 1XR7A 5KFYA 3THPA 2QL9B 4C4WA 4I6WA 4U95A 3BGRB 1QJHA 1Y11A 4NI2B 3ZZRA 4KQZA 2XC9A 1V9OA 1CC7A 1O0PA 3NS5A 1HWKA 3W9IA 1Q7LB 1XNQF 3E01A 3WIUA 3HHEA 5ADZA 4JI3J 3VAIA 2AKWB 2YKOA 2XI3A 3WZ0A 2WBMA 4PYAA 2B0GA 2JLGA 4M95A 1VYAA 3KFWX 3NGDA 2EBGA 4WF9Q 3B78A 1K1SA 3A8IA 4P73A 4DV4F 3CCRS 1RU1A 3I55S 2JL9A 4DSEA 4EO6A 5GADU 3QT5A 2VG7B 1OSDA 1T9TA 4TLRA 5C2GA 2QO3A 3LTOA 4OI4A 2W9BB 3RRKA 3T1HJ 5HI7A 2QYGA 1FFSB 1S6QA 1TL1B 2CNLB 2FIUA 1SV5A 3SCLE 2I9SA 1QD1A 2HNYA 4NCAA 1T95A 3CIZA 5DO2A 2XMUA 2DNKA 1ZPWX 1WDDA 4CLZA 1NJXA 5DG7A 3TJ9A 2UXCJ 1RAEB 4JYAF 4DQRA 2C2KB 1S0VA 3R5GA 3CJ2A 2XLIA 2LCWA 4OX9J 2J9CA 2KHDA 3RR8A 3A3NB 2DPIA 4K5SA 4J9KA 1WC4A 2QX0A 2NXJA 3UCGA 4GVBB 1KQFB 3KG4A 2ZE2A 3QT6A 3M30A 1X60A 4ZVRB 2VB6A 4USHA 4DUYF 4H4MB 1UWAA 3HT0A 2VZ9A 2QV6A 1ULRA 3TUIC 3EX7B 1XN9A 3R7NB 2R7UA 3S8SA 1VJWA 4RBUA 4NZ0A 5ETKA 1V5IB 3MUTP 5A0YB 3IAM9 5IT9Y 4WKYA 4OZ5A 1H0HB 3TNVA 3CJ0A 5A8KB 1HNWJ 4QWBA 4P72A 4RBVA 2LDIA 1UETA 2OTJS 1TFWA 2VQEF 2JLFA 4DPUA 4KGKA 1QUPA 2BV3A 1LV5A 3LO3A 2QJ3A 2K7KA 4ZVHA 2BQ3A 5IQ6A 2AV5A 3KTQA 5GAGI 5H1SV 2K1RB 3IGNA 3DI6B 3H98A 1CQMA 2XCAA 1S0MA 3HZEA 3DC2A 2DRDA 4OLPA 2GX8A 2ATLA 2K8GA 2EG1A 2Y1JA 3HZGA 2MGZA 2OD4A 4ZVSB 2F8MA 4ZLPA 2XM3A 4KO0A 1U6ZA 4ANDA 5HLFA 3W61A 1Y4ZB 3KHGA 2JHEA 4RNOA 1SUQB 4BCAA 5CYQB 2A0FB 5THWA 4ITSA 1UVLA 1QM9A 4C7QA 1FO1A 2APOA 4ILLA 4DQQA 2HLUA 3AJDA 1HHQA 4DR6F 3J7ZT 2Y0BB 1M0SA 3KLIA 2KDOA 3PW5A 5CZVA 1TK8A 2VG6B 4PXEA 5J2QA 4YEAA 4CWBA 4DV2J 3HVAA 3H4BA 3W5YA 3PKYA 3PX6A 1LK5A 4RO0A 1S7HA 4NLWA 2YWHA 3C15A 2CIMA 1HQ2A 2BKNA 2EI5A 4N56A 1HFEL 3OQ2A 3TOQA 3WC2A 2CA9A 1DQ9A 3H5UA 2D9OA 5DRKA 2HBRB 3D6TB 1U09A 1RI7A 1J5OA 2YTCA 1FKOA 2LQ5A 1KBRA 3F44A 4NLSA 4Y0FA 4WKRA 1SC1B 5A2QU 1F5CA 2B7BB 2FVQA 2ZBQA 3DRYA 2DNNA 5L46A 3ZZUA 3CJSA 3W2VB 5HBMB 3KWMA 2QA4S 3L95X 4WZQA 4Y3CA 1N5QA 3QIPB 4ZVFA 4DDFA 3LAKA 2BABA 2V8GA 1Q95G 2UU9J 1X8DA 2HK3A 1U1RA 2GO8A 5EN1A 1WNEA 4C8NA 4Q45A 1VRTA 3BGLA 3CNQP 4ZPBA 1K1QA 3H8YA 2B9XA 2DPJA 2QLWA 2FHJD 5E3PA 3O1LA 3TZZA 2D3ZA 4DUTA 1QAXA 1FD8A 3ZZ0A 4NZ7A 2OI2A 3W60A 2L3MA 2V69A 5KFBA 1NSKL 1F9FA 4TY8B 2DR8A 5T7LB 2CZVC 5ETTA 2ALYB 4CTAA 4IUFA 2MLYA 1LWEA 4QWEA 3OFEA 4CRJA 3BM7A 2J5AA 3VR1A 3BN4A 4OYAA 5KFDA 3DMJB 2H1YA 1FWKA 4UY85 2WOMA 2RS8A 2HS3A 2OUGA 5DZ7A 2XO7A 3TR5A 2HBZB 4RUAA 4JI1J 2YKNB 1APSA 4JI3F 4NE9C 3CC2S 2HHTA 4MK9A 3BGRA 2D41A 4NYOA 4NI2A 2AP6A 2E1CA 1XMQJ 1REGX 1RKIA 1X4DA 3HFZB 3T1HF 2LXFA 5GVQA 1IVZA 2WB1D 1XR6A 1UFLA 3RUBL 5BYQA 2U2FA 4ECRA 2RVJA 4A8FA 3HXMA 2YBVA 2C2DA 3D2WA 2BJ1A 4Z7CA 5A6PA 1EIYB 4AFFA 1VQOS 4DPYA 2JVRA 2VG7A 4ID5A 3AD9C 4YDXA 1O6XA 2KO1A 2W9BA 2R2TA 4M5MA 4OJ3A 3MM6B 1TL1A 2UXCF 2NCKL 2WZ1A 2HHPA 2Z30B 2M2BA 4X4TA 2CG8A 5E7OB 4OX9F 5KG7A 3DU6A 3NCPA 1ZYQA 4H54A 4KGVB 2F40A 4CM2A 2F63A 5LSLA 4DJBA 3HVRA 2B3TB 4C3KA 1RTJB 2FPHX 2BDPA 1UZDA 1B0TA 3G86A 4CNZA 2ZD1B 1S10A 5ETLA 3HKZD 3CCES 4HTIA 2JH3A 2GV1A 4GVBA 5HROB 1X4FA 1EAYC 3G8TA 2HBYB 2OAUA 4RNHA 4Z7YA 2AGQA 1WEYA 4JOUA 4NLVA 1RYSA 3HHLB 1U02A 1DBDA 1H2TZ 4ZLJA 4I6YA 4ELUA 2AQ4A 3DNCA 3OR2B 5A0YA 4UW2A 2AWZA 5D8HB 1IBLF 4L74A 3JQJA 5A8KA 4DLGA 3CMAS 4I4BA 4DU7A 3MM7B 4B3OB 2L9NA 1VQ9S 4JI4J 4BS2A 1RWPB 2QA1A 1YHQS 2VFVA 3DYAB 2QYCA 5CH7B 4AQYJ 3C6UB 2C2MB 3HJFA 3HSDA 2K1RA 3EMTA 2ZH6A 3FUYA 3CCUS 1BHNA 3DI6A 2O66A 2H4YB 4ECQA 1S49A 2DGQA 4OZLA 2CPHA 1FRHA 1P1LA 2NPFA 3R8YA 3EGVA 1SL0A 2W2OP 2MKJA 3FVYA 3GJRB 3SEOA 5M2RA 4WCEQ 4TLQA 4N8OA 3MTKA 2M8DB 4HHUA 2QMWA 2OH2A 2ZZTA 2ZJPQ 1U2CA 3C14B 3GB0A 3FDSA 2HFSA 2PA3A 1UCNA 2V67A 1SUQA 4ZP9A 5J2PA 3ZZOA 3PKMA 4NMLA 3TQ1A 1VC0A 2LQJA 4ZPDA 4DV2F 2VPWB 3MD3A 1JXEA 1KNZA 3S01A 3W63A 1M5PC 5DQIA 2RIJA 4GO5X 4DV6J 5HSPA 2VG6A 4MKBA 2AT1B 1HARA 4DN9A 1U1NA 2P9EA 3BSCA 1FT8A 3CO0P 5H9FK 5F3ZA 2GW8A 2HPUA 1VCTA 2BZ2A 3PO4A 2GAHC 2YWFA 2B8QA 1FD2A 3TZYA 1TL3B 4TNOA 3V4IB 5B0BA 4N77A 1FVSA 1RBAA 4HL9A 1KEKA 3BKUA 5F8LA 2RKIA 2KG1A 1RT6A 1DJ0A 2PMWA 2UU9F 4P10A 4F04B 5LMNF 3W2VA 1RSCA 5HBMA 2N4DA 1TVRB 1R0BG 4WP3A 1MW7A 2RDDA 3ILOA 3QIPA 3IA0A 1RWUA 5LM7E 2HFVA 2CYYA 1LWCB 2XY5A 2R8GA 4BDPA 2M3DA 1Q16B 2YNHB 4KV8B 2KJVA 3DOKA 3QRQA 2FLPA 4WXOA 1YZ7A 2GIQA 1HYSB 2HBQB 2XULA 3GR1A 2C2OB 1FVQA 4O3NA 2MKYA 4ECYA 3BO3A 4DLEA 4BHQA 2DITA 5K8PA 3ZNJ1 3D0IE 2DXFA 1CQNA 4CO5A 1X5PA 2K3IA 3O3LA 1B64A 3QIDA 4V19J 4IOCQ 2CQ4A 3TRGA 4A8SA 4TY8A 4IFVB 2RUGA 4IRCA 2M4MA 2G2OA 4B3TJ 1UJ5A 3PEHA 2FTRA 1VQSA 3LWMA 1AT1B 2CVEA 4O0IA 2F3JA 2CNNB 1UEKA 2Z57B 4DWIA 2GHVC 3DMJA 4JI1F 3VCDA 4NLUA 4YB1P 2A3JA 2W4DA 3W9HA 5H9EK 1NU4A 5LMUJ 5JJBA 2HEKA 4PXBA 2XZDB 4GKJJ 3UNGC 4V19X 1FDBA 2RRAA 3EGWB 4CNYA 1FNXH 4QYZJ 1WOPA 1XMQF 4DCJB 2YKNA 2QN6B 4NX9A 4KTQA 1NJZA 3S6EA 2XLKA 2J7WA 4DR5J 1B0VA 4DV0J 5SUHA 3M2RB 3CCJS 4L3KA 2PI4A 2QA2A 3L9ZA 3MR3A 4FF3A 2HVIA 3BQ2A 4DL6A 2FHOB 1K44A 1YRUA 4C8LA 1UKUA 4MMOA 5G0RB 1JIHA 1RB0A 4ED8A 4DI6A 2B6AB 3D1OA 4ZJQA 1RJJA 1B0PA 4MKYA 1TUVA 3CE8A 2C3PA 1EKRA 2MQPA 2VPXB 4NLXA 5KFMA 3ADAC 4DSLA 5KFQA 4UOGA 4DQSA 3PXGa 1H2UX 4KYZA 1BQMB 1FKPA 3MM6A 1LEOA 3ZXWA 2RS2A 4FF4A 2IM2A 4KJIA 2E7WA 2R7OA 3UVJB 3RU0A 2Y8YA 1KVJA 2OSQA 2PMZD 3K89A 4ANEA 4PG7A 1PBAA 4I2QB 1BY9A 4HR2A 5AXMA 2HZVA 1MN7A 4ANCA 1RTJA 3U02A 1EHWA 4KAIA 4LVNP 4GKKJ 2C2RA 1NBEB 2YX7A 3MAAB 1R8CA 2ZD1A 2WRMA 4C97A 4LREA 5T41A 4HDHA 4QCLA 1SI9A 2HVHA 5HROA 1TL7B 4OLOA 2VBYA 2AYMA 1RE1B 1RTDB 3QMQA 4Q43A 2E7XA 3M8ZA 3HHLA 4IH6A 1I3OB 3B54A 3NCQA 1CVJA 1WI6A 4FP9A 3H5SA 5JXSA 5J2MB 3OR2A 2E29A 4AQYF 1FJ7A 2AZ3A 1Q5VA 3BDPA 3JYTB 5IV3A 1T05B 5CABA 3CSKA 4B3OA 3MM7A 1QSYA 3Q8VA 1ICEB 1T7PA 4O4RA 3MZIA 2BKPA 2N3LA 1L3TA 4J9PA 2XMAA 3DYAA 3JSBA 2ILZA 5CHCB 1QAIA 2M0GB 2CQGA 2B9EA 1UVMA 1SC3B 3C6UA 3CMQA 2E5IA 4U67Q 2VKZG 1LK7A 4KFBB 5D4NA 3Q2SC 2DEIA 1YJ7A 3MM5B 3ENAA 1D9DA 3TZWA 4AL7A 5EWGA 3VAGA 5KFGA 5HQMA 4ERDA 3SQOP 3HSZA 2PEHA 1VQ6S 2OKQA 2HMIB 4EI2A 4FYDA 3EPGA 2HAFA 3GONA 3AJ2A 4ED4A 4WK3A 4KGZB 2RD5C 3PDNA 5KT7A 3NS7B 3FGVA 2OFGX 3M8YA 4JI2J 4X4RA 3FQKA 4CLTA 1UWBA 1VQ7S 1C1BB 3ENVA 2LEPA 2DR5A 1YI2S 1D09B 1FDNA 2J0SD 1RTHB 1HWJA 3TYTA 1M5KC 4JI7J 4WTOB 5IWAJ 3JTOA 3ETMA 2XMJA 2QA4G 2BE9B 4P6QA 4TQSA 4TXSA 3QZ7A 4KC5A 5F3TA 2HGLA 1GXLA 4EO8A 1S9GB 4AUKA 4QJVA 2NXUA 3UCZP 2PIIA 1PYOB 1TL3A 4RLEA 2R7QA 2BR0A 2MLXA 1WC5A 4ZPWR 1RP5A 3V4IA 5DJBA 3NY0A 4JI5J 4DV7J 4QW8A 1S6PA 3MR6A 2RMLA 1TL4A 1GFWB 3FC9A 3T41A 4OI0A 2V8VA 3HD2A 2F7VA 3Q24A 2GAGC 4ER8A 2ASLA 5K5MA 1YITS 3PHEA 1U8SA 2R7WA 3EDRB 1EQ0A 3DGVA 1K73T 3B4DA 4J9LA 2VFSA 5DQGA 1TVRA 4R25A 1WF2A 2DGVA 5HK4A 1YZ6A 1JJ2R 3KOAA 3MCOA 1WI8A 1YJUA 3LF0A 4O23A 1X5OA 1ZPVA 1LWCA 3Q23A 5I3UB 2QL5B 5BYSA 2YNHA 4KV8A 2VPYB 1UFKA 2Z2ZA 1HYSA 3ISZA 4CDIA 3R6GB 4IO1A 1Q0NA 2O5DA 3CD6S 1U48A 4RW7B 4B3TF 1YKWA 3IM8A 1WC0A 2DNHA 3CGIA 4K4XA 1V3ZA 3NNCA 2RILA 2LDYA 3PO5A 1G7CB 3M7VA 3CD0A 3R5AA 4IFVA 4LF7J 1B70B 2UUWA 2EBEA 5LXRA 5LMUF 3EZOA 3H0PA 3A12A 3PFEA 4WZMA 1WG1A 1RK8A 3MMAB 4EBCA 1VRUB 2UV8A 4ZLLA 1B7FA 2UUCF 4OYZA 3OHAA 1SL1A 1X4HA 1TK0A 2EPIA 3K59A 3BYPA 1CJVB 2W8LA 3HDSA 3RJMB 2J0QD 3TWZA 4J9QA 4DR5F 5IQQA 4P52A 3MOZA 2B4OA 4FXWA 3K5OA 4ECVA 1R31A 2RQCA 2DO0A 5IT0A 3K7RA 4ED3A 4ILRA 2MKSA 3VVUA 1U45A 4HHJA 1KVKA 4U7UD 3M2RA 2KXHA 2FLOA 2B43A 1X5SA 2LMIA 1OIAA 1S1TB 3VZHA 1XTZA 3A8EA 2W01A 5HJYA 2NXEA 2DCLA 4LUBA 4WFNQ 2EWHA 5KFVA 1QVFR 3O5TB 3D3CJ 5G0RA 3NOCA 3FBFA 2QG9B 2ROGA 1U1OA 2XSJB 3N4WA 1VFJA 2B6AA 2HK2A 2HW3A 4UOFA 1R0AB 5IZHA 3DLEB 2FLNA 1HPZB 1TV6B 3WX8A 3TVYA 1HR0J 3QFHA 4YB6A 3PJWA 3ENWA 1VJQA 1BQMA 2R8JA 4EBEA 3ONQA 3K58A 4O3RA 1VHFA 2FJWA 1RA7A 4TYBA 4GKKF 3UVJA 3G87A 1U0SA 4BWMA 3FRYA 4GC6A 2VKRA 4I2QA 2RH3A 1NUEA 4G1PA 2UXDJ 2C28A 2CQ3A 4EZ9A 4Q44A 5DGAA 4WTYA 4NYZA 1WEZA 3MAAA 4DN0A 4UQGA 3V2UC 1NK9A 3KLEB 3FBEA 3ZZYA 1F2GA 2CAJA 2UUTA 4NASA 1TL7A 4WIQA 3RB3A 1AFIA 4Q2LA 1U24A 1WC3A 1EETA 2YX1A 4E98A 1LW0B 3DFEA 1RTDA 3F73A 1XR5A 3D1HA 2BM0A 4WJBA 4YP3A 1JLBB 1P9QC 2M70A 5KFHA 5J2MA 3D68A 2GGPB 4DXLA 5B09A 2MMYA 2UVRA 3HF5A 4J7CA 4TN2A 1T9YA 1SH2A 2ACYA 4ED2A 1M5VC 1TL5A 4ICLB 2Z2MA 4CLSA 3SDEB 1PKUA 1MWZA 5D4PA 4DMZA 1KR4A 2XS2A 1UW9A 4FKYA 1KQSR 4Y28C 3OUYA 2VG5B 2FC9A 3OTOJ 1IM6A 1JLGB 1OSCA 1VBXA 4KFBA 2VICA 3LALA 1YGYA 2FVCA 4B3SJ 1X31C 3GCWP 1HWIA 3O8WA 1LXJA 4ELVA 3LAMA 5DDPC 4JI2F 1URNA 1BMQB 2HMIA 3IRXB 2C42A 5ETMA 1I94J 4X2BA 1EX8A 4PG5A 2MJNA 5KT5A 3CDEA 3CT9A 1VIOA 3ZZPA 2XBPA 2JEGA 4DQIA 1MSWD 1ROFA 1GTEA 5DLGA 3JXOA 4JI7F 4A8WA 5IWAF 3KJQB 1B99A 4CLPA 3CC7S 4M1KA 2RJZA 4DSKA 3PRDA 1C1BA 3V4MA 7FD1A 1OPIA 2QFIA 3I0SB 1RTHA 1BUXA 5JVGQ 2Z58B 3R27A 2CJXB 1S6UA 2VPZB 1T8EA 1XERA 2G1DA 3UI3A 3PIPQ 1KOOA 4JI5F 4DV7F 3AB2B 1VRQC 1S9GA 4ZP6A 3RBXA 1AYEA 1TELA 1WC1A 5D0HA 4I69A 2BM1A 4I68A 2LLZA 5EGYA 1QSLA 1AUSL 3DLJA 3CUNA 1RWVB 2KTQA 4F0HA 4I1TA 3M8WA 4KH1B 4F3MA 3MGJA 2CZ9A 3PR4A 1OY9A 2B4VA 1FHTA 3D28A 2KU7A 2C3UA 2WVEA 5BXIA 4HYKA 4EU0A 4ZCIA 2ACMA 3QAUA 5I3UA 3LW5C 4F0MA 2YNIB 4OJ1A 2C3MA 4LQ9A 3KUEA 2HHWA 2F8EX 1XMOJ 2IPOB 5BR8F 3R2CJ 5IS2A 1WOOA 2EFGA 4G1QB 4RW7A 2EFOA 2V68A 5IOLA 2Q43A 5CA5A 4WP9A 3CCQS 4OFZA 4G6VB 1DZ5A 4NEYA 5F9LA 4Y2KA 4Y34A 3M8PB 1FXDA 2KYXA 4F4ZA 5GADI 5IM0B 9RUBA 3KJVB 3G9CA 3W9JA 2CQCA 1YRXA 5HJXA 4RU9A 3MMAA 4X4SA 3OTDA 1MN9A 2KH9A 1YIJS 3CC4S 3I96A 3QRRA 4A48A 1CJVA 4ZJLA 1T9WA 4USWA 2V8DA 4N76A 2MZJA 4ED7A 1RADB 2G0JA 2CPYA 2HNZB 5RUBA 2RNEA 1VQYA 3KKFA 4ID8A 2UZAA 3EUNA 5L39A 3FZ2A 5CCMA 1ZA1B 3D5MA 2X3GA 4KH0B 3J7YU 4LRBA 4PZVA 3SIPB 2NR0A 4ZLNA 3W62A 3CWJA 2V94A 2KFZA 4F2RA 2RU3A 5L1IA 3K8VA 3K5PA 3DLLQ 1S1TA 1R7IA 2XZTB 3OSPA 1CULA 2EFQA 1SJRA 4HHHA 2G1HA 4ECUA 2VH7A 3HKWA 4LFCJ 4J91A 5B0AA 3QWPA 3Q22A 2XSJA 3LGMA 4TU8A 2KHCA 5F8IA 3W3SA 1R0AA 1JX4A 3DLEA 2WVFA 1XIQA 1U1LA 1HPZA 2NXCA 3R1HA 1RHKB 3VF0B 3BQ0A 5LXYA 2HWHA 1FE4A 4NLDA 5BJRA 2ATCB 2UXDF 1YVFA 5J1PA 4OI6A 5E3RA 2NXNA 1IQTA 2E1PA 2E5LJ 3BPDA 2JVOA 3BEGB 3AB4B 3H5XA 2NPIA 2ROEA 4ELTA 2GQQA 4M5KA 3IMQJ 4IG0A 2X51A 4LR9A 4C3LA 4MIWA 3POTB 4I6AA 2OP5A 4FYYB 4KSEB 4WU2A 5JVHQ 4I56A 2BANB 3KLEA 2VONA 4Q8EA 4BC9A 3EZUA 5B0GA 5D3GB 2D1CA 1FERA 3QBCA 1HBMB 4EFAC 1JMTA 2BJ8A 1U4BA 2J0WA 3FK4A 2V5HG 1SKRA 3K5NA 3C6TB 4DL4A 1I5OB 2LU1A 3M8QB 1EB0A 4OL8A 1LW0A 3IFEA 2JWNA 1BC6A 1U0HB 2V4QA 2R2SA 1JLBA 3EZ5A 1S76D 2DH8A 3TQEA 2GGPA 4K5RA 5MAOA 3QT7A 4DV3J 1CG2A 2CJBA 3ZZTA 2EFVA 2JLEA 3JAMU 3UDCA 3OTOF 1A7GE 5C25B 3Q8QB 1VC6A 4LF5J 2BYCA 3MPYA 4B3SF 2EXUA 2DT9A 3GLJA 1MMLA 4ICLA 2MHEA 3JTNA 4P7VA 4A46A 2VG5A 3KNGA 3MPUB 1Z1ZA 2HRUA 1FNOA 3CULA 3AXKA 1JLGA 1SIZA 3G82B 2CQIA 3GE9A 3UDEA 1WSVA 3KLFB 3CDWA 4QQBA 2DVIA 3R7SB 3MWBA 5JUMA 3W64A 1QLNA 3HFKA 1I94F 1Q86T 3K17A 3U1MA 2HHQA 3BGOP 3LUYA 3Q89A 4X84A 3H42A 1CS4A 4X4PA 4IR1A 2DGXA 3QZ8A 5C5JA 3F56A 3IRXA 3WQPA 1F9EB 5GMKa 3NGKA 1WDTA 1N0VC 2CQ0A 3EJMA 1F1BB 2ERRA 4NLGA 1XC9A 1KLNA 1NMEB 4ZVTB 4CO2A 3TO8A 4Y65A 1HNXJ 3LGHA 4WPAA 3LPYA 2OD6A 1RBLA 4WXWA 3R97A 2H3EB 1PGZA 1A6LA 4Y00A 3Q8YA 4QWAA 2A1BA 3O44A 2HGMA 4ZPAA 2BQRA 5J1EB 2EKNA 3UWTA 3I0SA 2E5JA 5A8WA 5K9FA 4NL5A 3IWNC 3UNYA 2JX2A 1EP4B 2NUUG 4DL2A 2FGOA 2IA0A 1YBTA 4ZS6A 5FD1A 2FB0A 5KFAA 3BSNA 3ILJA 1YRTA 1V3RA 3JQKA 2YXLA 1WD6A 3R5BA 1P9YA 3IR6B 3BREA 2V4RA 1HQEA 1S1WB 4LRCA 3GYNA 2P5VA 1U25A 3R5DA 2ZBRA 4USTA 4DFMA 3UFCX 4ES3A 2MKHA 2G0CA 3BH7B 1Q53A 4WYLA 3KLVA 5KFUA 4H4KC 1EARA 4RW9B 1NDCA 3UN2A 5KFFA 3MMCB 2HQCA 2KM8C 2HRTA 1UPPA 4FF1A 3THTA 1M1HA 3V6DA 1PBUA 4EUVA 2H65B 3VALA 3G8SA 1NNDA 1XMOF 3V6KA 4IH5A 1X9MA 3MPWA 2XHCA 2JOQA 3DGPB 2A2CA 4M5GA 2DNMA 4KPYA 4G1QA 2E66A 2HQDA 3GFHA 4Y2AA 3SCKE 2CDQA 1H7XA 3VAKA 2QSWA 2MZRA 2PFFB 1IQZA 3M8PA 2K3KA 3H2UB 3X3UA 1HW8A 4FVCA 4H4KA 4DSFA 4MH8A 5IM0A 2Y8WA 5E3CA 5D0GA 5HO4A 3KUGA 2DHXA 2WSEC 3KXDA 2XLJA 4W98A 2H48B 3H4DA 1FRLA 3OFGA 1WOSA 2BRKA 3RGIA 2AU0A 1HQUB 1UL3A 1PO6A 2HNZA 2JRSA 1SJ3P 1TKDA 2OEMA 1LWFA 2UP1A 1FNMA 3X1LB 2CKWA 2NS1B 4LFCF 4B08A 4A8XA 3GJTB 4M94A 2OEJA 2V6AA 3MR5A 3TI0A 3T1AA 1LWXA 1ZTTA 4V1Ak 2JEIA 3M05A 3FCHA 4KY3A 2L41A 4LF6J 4LJMA 2WSFC 5HAOA 4KR0B 2ADBA 2V9WA 2IBOA 1HWUA 1L3SA 3OSNA 1C1CA 4LF9J 3OBIA 1FK9B 1FDAA 4PXCA 4UTGA 5D4LA 1RAIB 2H5JB 4NEZA 2E5LF 4HH1A 5LL6d 4ZKAA 3CJ8A 3ZTSA 3W8PA 2LXUA 3A4TA 4LSZB 2PEBA 2EC2A 1CJUB 1NB2A 1DURA 2ZDOA 1X4AA 3DCAA 3VV2B 1K8AT 4DX5A 1M1GA 5CZXA 1A0OB 2YWKA 1N8RT 1HNIB 3U1NA 4LR7A 2BBEA 1YJNS 1PJ5A 3POTA 1F6TA 1IN0A 4CO1A 2XS7A 2LQ8A 2BANA 4K4VA 2MZ1A 4USUA 1YJRA 2HHHJ 5LJ3Y 4K2XA 2WW8A 5D3GA 2Y0SD 2R2RA 1HBMA 2NQPA 1Q7YT 3C6TA 1W25A 4JUZA 1MG7A 3M8QA 3PW2A 1BWEA 1QVGR 2MYFA 2ZH3A 1GK8A 3EVMA 4KKOB 4B9LA 1W2IA 4OI2A 1GMWA 4FBUA 2GMJA 1NPKA 2CWXA 2AIRB 3MD1A 1C4CA 2EFPA 4OYOA 4F02A 5C25A 5AXKA 3GFXA 4X65J 2Y1IA 3OTEA 3N01A 4NWBA 1TUWA 3IRWP 2BEFA 1UP1A 5K8OA 2FVPA 4E0DA 2HNDB 3PX4A 2PT0A 2PC6A 3MEEB 1X9SA 1G4CA 1R3NA 1ZA2B 4I2PA 3TVZA 2DNZA 1T3OA 3P5BP 4X4NA 2FJVA 3G82A 2GQ2A 3JB9k 1ZBTA 2Q6CA 6FD1A 1XMBA 1HLWA 1N88A 1S5ZA 3S1TA 4EYHB 5KT3A 1IBMJ 2W9CB 2KXFA 4WIIA 4XAKA 1HNXF 2QGFB 4DR3J 3NMRA 5E41A 2ZBIA 2E7VA 1RT3B 3TX0A 4DR4F 2ZKUA 3HVTB 4N8NA 2HQ3A 2DTJA 5IC6B 1YJ9S 3UR0A 3HMJG 3H40A 2KFNA 1OJ4A 1PCAA 2BE7D 2CFXA 3OFFA 4FYWB 1TMJA 5J1EA 4CYUB 2E44A 1KLMB 3IBWA 3IWLA 1EP4A 4IQXA 5KG3A 1A9NB 2E1MC 4MFBB 3D4JA 2VODA 3HVWA 3P96A 4OYWA 1S1WA 2M9KA 1HI0P 2CNKB 1N5SA 1RDRA 3SSQA 2H9ZA 3PYGA 2KL8A 4ZITA 3N0VA 4RW9A 3UD5A 3FFIB 3JSYA 1O51A 3MMCA 1H72C 3G96A 4QZVB 3Q8RB 3L7PA 1SCJB 3UN5A 3LPEA 1K0TA 2BOAA 2YY3A 4U6PA 3LP1B 3M8SA 4K4YA 3T5JA 4OI3A 5HMWA 4FF2A 1XJWB 4ETZA 3OPKA 3BBBA 1RU2A 4C9DA 1FKAF 1TMMA 1IKWB 3H59A 1N34J 1KSPA 4N5SA 1YWXA 2OPQB 3PRVA 2VC1A 3DGPA 2ZHBA 3HP6A 2NZ4A 5FLXU 4A8QA 2YQ3A 2ZNYA 4RNMA 2LECA 3G4SS 1FRJA 4ZVOB 4K4SA 1SJQA 2HG4A 2R8HA 3ILIA 2XQCA 5BYRA 3I56S 2HVDA 1JXLA 3HI9A 2D3UA 3BS9A 2BW2A 3AD7C 2JFKA 1MLAA 2E9TA 1IBLJ 3M6XA 2VDIA 4R0JA 5KT4A 2AD9A 2ZM6J 1Y10A 2EVZA 3C8YA 3UO0A 1HQUA 2FJDB 4B9SA 3NKYA 2DNGA 3GIIA 5FJ4A 2FQQB 3PV8A 1T02A 3I5CA 4DFKA 2CQBA 2WK4A 2B4UA 5DQHA 2VJVA 4LF6F 2R3VA 2G2ZA 5HMZA 3TANA 1TTHB 4NRUA 4LIWA 1MMDA 1IR2A 3R7BB 4HT7A 3NL0A 4U8VA 5HP1B 2RQKA 4LF9F 3TUZC 3DRXA 2ZZNA 4M5HA 4O44B 2COLA 1C0TB 1VQ4S 3ZTQA 3GIJA 1V6HA 1FCAA 3CPWR 1KHWA 1IR0A 3DXSX 3MMBB 5AE2A 5FDLB 3AA8A 4DUZF 4J9SA 2PI5A 3KG1A 1RLDA 1W7WA 1JJHA 2OFHX 1FK9A 3VGTA 4QIVA 2VA2A 4MYTA 3J81j 3MM9B 2J7KA 2GO9A 3QRPA 2D3O1 2AHOB 3E8OA 3SV4A 4PWWA 1NKBA 1OY8A 3OVSA 3KK1B 1OMSA 1QSSA 4L76A 4RW4B 4D3HA 4QIEA 2DH9A 3P5TL 1CJUA 3LP2B 1RT7B 2I38A 3DDKA 3IGVA 4W92B 1HNZF 2F1FA 2XYGB 1NCLA 2MTLA 2BMBA 2B9YA 3O6QA 2B51A 2HAIA 1F5BA 2HHHF 4TU9A 1SKWA 4ZVEA 5HQLA 1ITPA 4DBQA 1RWWB 3LANA 4QR0A 2GJFA 1R43A 2PMHA 2Q66A 3SFUA 4XO0A 1UA1A 3OXGA 4LSLB 2HQFA 8AT1B 5DG9A 2VOPA 2DRAA 2BJ9A 4OHVA 3CJ5A 4B3RJ 3NS6A 4RNNA 3AODA 1UAWA 3CCWA 2HQGA 3GG1A 3TEGA 2VIHA 1KC8T 4HKQA 4KKOA 2IVYA 4X65F 3CO9A 4X4UA 3KK3B 1WKKA 3D67A 2DJWA 3EGNA 2JSXA 1UVNA 4ZOSA 3DRSA 2EKYA 4YB7A 3CJKB 2OEKA 1GMVA 5LMNJ 2ALZA 1OQ3A 3JTPA 4QPXA 3PVXA 3DM2B 4C0BA 4C0OC 4RW8B 1Y5IB 1QUVA 2PFDA 2HNDA 3KHLA 3MEEA 5B0DA 1WHXA 3QAEA 4PG4A 1PILA 1D9AA 3K2YA 3J80U 1YQHA 3EDQB 1IBMF 2IDEA 4NLPA 4I67A 1N5VA 1UVKA 3OTCA 4DR3F 3L09A 1VLOA 3J7Z5 2HS4A 2GS8A 2P8IA 4LMZA 1VIXA 4WYWA 2VDHA 3U27A 3UR3C 2W9CA 2BXJA 3JSMB 3ZTOA 3OL7A 3R5CA 1T03B 4F4AA 3NP5A 3OVAA 4RU2A 4TY9A 2WCXA 3FZBA 1TKTB 3LWLA 2G0IA 2IBKA 4HDGA 1UTAA 3IWXA 1RT3A 4Q0BB 2V2QA 3HVTA 5E2QA 3RAXA 3ZFVA 4Q7AA 3GYXB 3I6PA 4E8UA 2ZJRQ 4O3QA 2IAJB 4HACB 1NXIA 1OWXA 1KLMA 2VOOA 1ZM3A 3PYDA 1NO8A 4CH0S 3FMWA 2R4FA 2FZKB 4MFBA 1BD6A 1S72S 3OR1B 3ZTPA 2VHGA 5J2NB 3VAMA 4BBYA 2CJYB 1FFGB 4NLQA 2BOPA 3G6XA 1G3OA 2GMLA 3KLHB 3JAMY 1NSQA 4YY3J 3QATA 2NSBA 4Z37A 2OIHA 3DRPB 3FQLA 1BGXT 1TK5A 4ALZA 2OLWA 2J8AA 2PN6A 3FFIA 4O0NA 4YHHJ 4DOZA 3I31A 3VTIA 1NZ8A 1CPZA 4DPTA 1K0VA 3DHXA 3I9ZA 2UUAJ 4AXIA 2QZ8A 1Y00A 2QLBB 1C4AA 3D0HE 4NA3A 2CADA 5M2UA 1N34F 4PQUB 4OQJA 2W2MP 3LP1A 3T1YF 3GFYA 5E0OA 4XDDA 2B5JB 3BBFA 3NAIA 1GMWD 2JNJA 3SQGB 1PAUB 4MAKA 1U6BA 2VA3A 2YNGB 3AOCA 1Y3KA 1IKWA 4FN5A 5B0FA 3OW2R 4PAAA 2UXBJ 2OPQA 5KG6A 4ZN3A 2Z2YB 3HHKA 3M32B 3G6VA 4H4MA 1PC5A 1Q81T 4DPWA 4ZMMA 3PW0A 5HATA 1YDLA 3H7HB 4RNFA 1NEEA 1S6QB 5B08A 3FCVA 2KRRA 3IBCB 4ZIVA 1VQ8S 1CSJA 3CJ3A 4DHVA 2ZM6F 3NAHA 3ZTRA 1RHQB 4URSA 1VQPS 1U26A 2FJAB 2CPJA 1RAGB 5C2CA 4IYQA 3MOJB 3AT1B 2ZUGA 4JI8J 2MQNA 3IBFB 1S9FA 1RBOB 4J9MA 3MAQA 3VZIA 2CG4A 1X4EA 2JEJA 1W2BR 1HL6A 1NB7A 4RZRA 3T6JA 2FVSA 5K8NA 5HP1A 2UUBJ 5KFIA 4CLUA 1EJ7L 5EWFA 4UOCA 4P7TA 3VQTA 5HVHA 4O44A 3GWCA 5KOWA 1HHTP 1C0TA 4AD6A 2DGWA 4R0EA 5KT6A 2ZHOA 3NCRA 2IM1A 4ED1A 2EW9A 2ZH5A 4PQAA 3TW0A 3UCUP 1D8ZA 1H7WA 3MMBA 2DB1A 5FDLA 3TAPA 2YVSA 2POKA 4C8YA 5CYQA 4QU7A 2AGOA 5HMYA 3GYGA 4TKTA 4B9NA 2BQUA 3PW4A 3MM9A 1XWLA 4IR9A 2FHJA 1F5AA 3W65A 4RR5A 3WC0A 2DNPA 5F8HA 2ZVSA 2G9OA 2K7JA 3KK1A 2ZEJA 1D0EA 4RW4A 4WE1B 4YR0A 2C2ZB 1RAOA 3LP2A 1RT7A 4ZVUB 3DHWC 4IKAA 1IBCB 3RAQA 3GR0A 2C1EB 4PABA 4MTPA 2WW4A 5A6WA 4KE5A 3LH2S 2PE8A 3DLKB 4B3RF 4B9TA 1WF0A 3EYZA 1FI4A 2WVDA 5GMEA 3T5HA 3C2PA 4LSLA 4CO3A 5F8GA 2HIYA 4IG3B 2QEXS 3GV8B 2YKQA 3WDOA 1RAAB 5KOXA 4X64J 4ZIWA 1WSRA 4U96A 1NK6A 2BUNA 2XWYA 1GTHA 5DDOC 4ECSA 3KK3A 3KLIB 2DR7A 3PY8A 1T94A 2NYHA 3CJKA 2IYIA 2UV8G 2E1RA 3IO1A 4K50A 4M5NA 3V81B 1RT4B 3KJFB 3H25A 1GT8A 3RBDA 3Q0AA 2HLTA 2Y9HA 3DM2A 4RW8A 2ZC3A 4R5PB 3E2EA 2WBRA 5D15A 5CQGA 5EX0A 4WU3A 1ZZNA 1Q82T 2DNOA 2GC8A 3VAFA 1TKXB 2LYVA 2R8IA 5T7LA 1XK8A 2MY7A 4LBIA 4BWJA 2KKHA 5I42B 3CJRA 3I9V9 1N36J 1WHWA 1GEHA 2IMOA 2IFXA 4E2FB 1OO0B 6AT1B 3JSMA 2FJEB 1NHUA 1T03A 1X4GA 5A76A 3C66A 1MU2B 4DFPA 4F0KA 3M6UA 2CPXA 1TKTA 1FTRA 3R1LA 1REVB 4M5JA 2DBBA 1N5YB 4Q0BA 2UUCJ 1VQLS 3LQVA 1VRTB 3L3CA 2EEYA 1FJGJ 5GAEU 2ZC4A 4M5DB 2QFJA 3A3PB 4LSNB 3C3LA 2IAJA 4OJHA 2F65A 4HACA 2KJWA 1UVIA 2AX1A 4JV0A 2NYIA 5DM7Q 4YY3F 5F0UA 4HTJA 2P9CA 2QSFA 4TVAB 2WB4A 3W7BA 1OPZA 2XHWA 2Q6BA 1AUDA 2F9DA 1TP7A 3HHNB 3OR1A 3LGNA 5J2NA 5KG5A 4XPCA 1IKXB 3GPAA 2JZ5A 2SXLA 4YHHF 3CJQA 3I32A 2RF2B 1QTNB 3AY0A 3KLHA 3EXYA 4DX6A 1IM4A 4L6V3 4ZPTR 2UUAF 5ETVA 4K4WA 1N56A 1WUUA 3DRPA 3BBCA 2RAQA 1TFYA 5K14B 4ZCLA 2IRXA 3AH6A 1YJWS 4O3OA 3EXCX 2V8HA 2RDJA 5EUHA 2W7OA 4H4OB 4S0MA 4PWDB 1YG0A 2W7PA 4LIRA 2W2PP 1S0NA 4PQUA 4NA2A 2ASJA 1ZTWA 1X9WA 3FEXB 2D69A 2UXBF 4PXDA 1N32J 1VISA 2B5JA 3EICA 4KT0C 1TR0A 3SQGA 2YKPA 1FXLA 2YNGA 2XMKA 4ED6A 1CEZA 3J7YI 3MCNA 1UVJA 2HHUA 4DX8H 4P71A 4C98A 4A8OA 1NDPA 3RAMA 1JLQB 1RA6A 3I82A 1RAFB 2D9PA 3M32A 3MMJA 2JJ4D 1YJVA 1S1VB 4NLRA 3SCIE 4GO7X 4ID5B 2GIRA 1HA1A 2DHSA 1JLEB 4C11B 3NBPB 4O3SA 4ZHRB 4JI8F 3SCJE 2N3OA 2N82B 2GA7A 4TYAA 4M5LA 3MTJA 1G1XA 2KVQE 3OXLA 5C24B 5KFJA 4K2JA 3ILLA 4KHMA 3CMES 4DCPB 4NLOA 5KFRA 1G6BA 1RWOB 2UUBF 1QTMA 5KFKA 3EE3A 3HULA 2O67A 2V8PA 1B4SA 3SMZA 3PFOA 3JS9A 3DOMB 3CCVS 2MHNA 3DRRB 2HKEA 2A10A 3GV5B 2CPDA 4QIFA 2AEMA 2E1AA 1RABB 4G65A 2KRBA 3FSXA 3CDBA 3KJNB 1L5UA 3TJ8A 3C14A 2ZUAA 3CDAA 2K2PA
chains in the Genus database with same CATH topology
4WBFA 1BHNA 4UOFA 1K44A 3NGSA 2BEFA 5C7PA 3ZTPA 2DXFA 3BBCA 1MN9A 1XQIA 1S59A 2B8QA 3EVWA 3PRVA 3WX8A 1NLKL 4F36A 4FKXA 3Q8YA 3DKDA 3Q83A 4DI6A 1WKJA 3FC9A 3FCWA 1NDLA 1NSQA 3NGUA 4DUTA 1B99A 3ZTQA 3B54A 1NHKL 4C6AA 4S0MA 3FBCA 3Q86A 3FCVA 2VU5A 1F6TA 3G2XA 4UOGA 5BXIA 3ZTOA 1NSPA 2DYAA 3FKBA 1HLWA 1LWXA 1NSKL 4O0NA 1S5ZA 4F4AA 3ZTRA 1BUXA 2AZ3A 1LEOA 1W7WA 1UCNA 3VGTA 3DDIA 1PKUA 3NGTA 3VVTA 5CABA 4FKYA 3EE3A 2HURA 3VGVA 2DXDA 1WKLA 1B4SA 1NUEA 3EICA 1JXVA 4ANDA 2HVDA 1WKKA 1S57A 4EK2A 3Q8VA 1NDKA 1VYAA 1KDNA 2DY9A 4ANEA 3NGRA 2HVEA 3MPDA 3VVUA 1ZS6A 1BE4A 2B8PA 3JS9A 3Q89A 4KPCA 4UOHA 3EVMA 2BX6A 4HR2A 2NCKL 3ETMA 3BH7B 1F3FA 3ELHA 1U8WA 3BH6B 3BBFA 5IOLA 1NDPA 1MN7A 5CAAA 1NDCA 4CP5A 1NPKA 3FBEA 3L7UA 1PAEX 4ANCA 2AZ1A 3ZTSA 3FBBA 1EHWA 3EM1A 3PJ9A 1NCLA 3GP9A 3Q8UA 2CWKA 3VGSA 3R9LA 3VGUA 3ENAA 1HHQA 1HIYA 1XIQA 3EJMA 3B6BA 2DXEA 3BBBA 4DZ6A 3GPAA 3FBFA 4ENOA 1NB2A 3EMTA 2ZUAA 4W98A 3EVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WBF A;  1BHN A;  4UOF A;  1K44 A;  3NGS A;  2BEF A;  5C7P A;  3ZTP A;  2DXF A;  3BBC A;  1MN9 A;  1XQI A;  1S59 A;  2B8Q A;  3EVW A;  3PRV A;  3WX8 A;  1NLK L;  4F36 A;  4FKX A;  3Q8Y A;  3DKD A;  3Q83 A;  4DI6 A;  1WKJ A;  3FC9 A;  3FCW A;  1NDL A;  1NSQ A;  3NGU A;  4DUT A;  1B99 A;  3ZTQ A;  3B54 A;  1NHK L;  4C6A A;  4S0M A;  3FBC A;  3Q86 A;  3FCV A;  2VU5 A;  1F6T A;  3G2X A;  4UOG A;  5BXI A;  3ZTO A;  1NSP A;  2DYA A;  3FKB A;  1HLW A;  1LWX A;  1NSK L;  4O0N A;  1S5Z A;  4F4A A;  3ZTR A;  1BUX A;  2AZ3 A;  1LEO A;  1W7W A;  1UCN A;  3VGT A;  3DDI A;  1PKU A;  3NGT A;  3VVT A;  5CAB A;  4FKY A;  3EE3 A;  2HUR A;  3VGV A;  2DXD A;  1WKL A;  1B4S A;  1NUE A;  3EIC A;  1JXV A;  4AND A;  2HVD A;  1WKK A;  1S57 A;  4EK2 A;  3Q8V A;  1NDK A;  1VYA A;  1KDN A;  2DY9 A;  4ANE A;  3NGR A;  2HVE A;  3MPD A;  3VVU A;  1ZS6 A;  1BE4 A;  2B8P A;  3JS9 A;  3Q89 A;  4KPC A;  4UOH A;  3EVM A;  2BX6 A;  4HR2 A;  2NCK L;  3ETM A;  3BH7 B;  1F3F A;  3ELH A;  1U8W A;  3BH6 B;  3BBF A;  5IOL A;  1NDP A;  1MN7 A;  5CAA A;  1NDC A;  4CP5 A;  1NPK A;  3FBE A;  3L7U A;  1PAE X;  4ANC A;  2AZ1 A;  3ZTS A;  3FBB A;  1EHW A;  3EM1 A;  3PJ9 A;  1NCL A;  3GP9 A;  3Q8U A;  2CWK A;  3VGS A;  3R9L A;  3VGU A;  3ENA A;  1HHQ A;  1HIY A;  1XIQ A;  3EJM A;  3B6B A;  2DXE A;  3BBB A;  4DZ6 A;  3GPA A;  3FBF A;  4ENO A;  1NB2 A;  3EMT A;  2ZUA A;  4W98 A;  3EVO A; 
#chains in the Genus database with same CATH topology
 3MUV P;  1NK8 A;  2Q79 A;  3MAH A;  4RWW A;  1AB8 A;  3G8Q A;  3QQC D;  3Q83 A;  1WEX A;  1JLC B;  1SL2 A;  3W2W B;  4ED5 A;  5FLX Y;  2LKZ A;  2WAQ D;  4WE1 A;  2MSS A;  3I5B A;  3W1Y C;  1NRK A;  1RAJ A;  2HZC A;  4MJK A;  3TAQ A;  3B82 A;  3GCX P;  3I5A A;  1BE4 A;  4PCQ A;  3DLK A;  2I6W A;  5B7W A;  3GZ7 A;  4X64 F;  1P6T A;  1QY7 A;  3NNH A;  5DG8 A;  2VFR A;  3SZ2 A;  3M9N B;  2DH7 A;  5J2P B;  4IG3 A;  2DD8 S;  2CUY A;  4U9R A;  2CZ4 A;  4OYI A;  1S48 A;  2ZH7 A;  3QJL A;  4HH0 A;  1UFW A;  4DSJ A;  4GVL A;  1SPB P;  3D66 A;  1BQX A;  2PD1 A;  4DR1 J;  2MZS A;  3FCW A;  5KFO A;  2XY6 A;  5U47 A;  5E33 A;  2FY8 A;  4CO4 A;  3KMS A;  1DTQ B;  4P2F A;  1S4F A;  4ZVQ B;  3D0G E;  2J76 E;  3HO1 A;  5DDQ C;  1NJI T;  1Y9O A;  3V81 A;  1RT4 A;  1GH8 A;  4UY8 T;  3Q8S B;  4YUD A;  1DHM A;  2O1P A;  4R5P A;  3G6Y A;  2YKM B;  3BZQ A;  2D7S A;  2R7S A;  2ZOG A;  5DS7 A;  2XB2 D;  3TA2 A;  1N4L A;  1N36 F;  3MPD A;  4DX7 A;  1SJF A;  2P2C B;  2DO4 A;  1KTV A;  1TKX A;  1RXO B;  5GAH I;  2MZT A;  1ACM B;  5BR8 J;  2HFO A;  2ZBP A;  1KVI A;  4ZVP B;  3A3O B;  2L08 A;  3G6E S;  4JI0 J;  4CLY A;  2CWK A;  3PEJ A;  2RKI B;  3VGU A;  2VF3 A;  3QSI A;  5I42 A;  1RT6 B;  1RHR B;  3QPI A;  3OL8 A;  3CXC R;  1PYS B;  2VQF J;  1FA0 A;  2ZDP A;  2AJ4 A;  1FJG F;  1MU2 A;  4L72 B;  1MNE A;  2KT3 A;  1XQI A;  3RG6 A;  2LU2 A;  2BJE A;  4GMK A;  1R8H A;  3U1L A;  5I4M A;  3LOU A;  4HLB A;  1REV A;  3BJY A;  3HX9 A;  1N5Y A;  3KUH A;  1ARO P;  3DOK B;  4I64 A;  4F3Q A;  2IMW P;  3A8K A;  1UJ6 A;  5A2Q Y;  4M5D A;  4LSN A;  1TZ0 A;  3GFZ A;  3GJQ B;  4USM A;  4Y6I A;  1U2F A;  4MK7 A;  2MQM A;  3BR9 A;  4CI0 B;  2ZIT A;  3MHY A;  2W9A A;  4ILM A;  3EGZ A;  1U2R A;  4CLW A;  1M90 T;  4QR1 A;  2GFF A;  3WX4 A;  2KG0 A;  3ET6 B;  1P8G A;  1V3S A;  5EX3 A;  3CW2 C;  1MMN A;  1IKX A;  4F4K A;  2W4C A;  3QYY A;  2V34 A;  2RF2 A;  2Y1R I;  2VFU A;  3FBB A;  4AL5 A;  4QU6 A;  1SQG A;  2ZH2 A;  1J27 A;  1HIY A;  5KFE A;  2BW7 A;  5K14 A;  3KHH A;  4EGL A;  1RTZ A;  3HK2 A;  2ZNZ A;  4OZ2 A;  1N52 B;  2H5I B;  1S0O A;  2BJD A;  1N32 F;  4H4O A;  5C7P A;  1U1Q A;  4PWD A;  3CD5 A;  2RRB A;  1FJC A;  3L7O A;  1P27 B;  1HD0 A;  3J80 Y;  4QIW D;  2ZH4 A;  5IT4 A;  2A2D A;  1JJC B;  4B9M A;  4OIX A;  3NGU A;  1FDD A;  1OYE A;  1IJF B;  2KN4 A;  4MKA A;  3GIK A;  1Q1K A;  4USJ C;  3CVK A;  3NLC A;  4K59 A;  2KZM A;  2XGP A;  4IDK B;  4X4V A;  2VV5 A;  1NPP A;  5I3P A;  2AYG A;  1X4B A;  1PYT A;  1NK0 A;  1KQK A;  1TKZ B;  1RKJ A;  5ETR A;  1JLQ A;  1G2E A;  1ZS6 A;  2CJQ A;  2C2N A;  1HMV B;  1NJY A;  2G4B A;  3B4M A;  3MR7 A;  1S1V A;  1IWA A;  4CP5 A;  3TUJ C;  1HI1 A;  2NZC A;  2JFD A;  1JLE A;  4C11 A;  1FKP B;  3NBP A;  3L4B C;  2WVC A;  1E6V B;  4LR8 A;  1RUS A;  4ZHR A;  1LKZ A;  3CCZ A;  4F3O A;  3SBM A;  1TUG B;  3M2V B;  3MM8 B;  3NRB A;  3JYT A;  1T05 A;  2J7U A;  2F4V J;  4J37 A;  5K8M A;  5C24 A;  5ETP A;  2FC8 A;  1KP6 A;  1Q78 A;  1PIE A;  3P4U B;  4K7Q A;  1S4E A;  3N5B A;  3J81 U;  1RAH B;  1VBY A;  4LF8 J;  4OYB A;  6FDR A;  1RZM A;  3MM5 A;  2FJB B;  4M8L A;  2YPZ A;  2V63 A;  2F9J A;  3DOM A;  3HSG A;  5F8M A;  4HI1 A;  4QIG A;  4N41 A;  5EWE A;  3DLH A;  2J9D A;  4CM0 A;  1EZZ B;  2H54 B;  2RB7 A;  4LRF A;  3DRR A;  3H5Y A;  1VQK S;  1PJ7 A;  4F8R A;  2A18 A;  3PIO Q;  1HNW F;  1XNR J;  1RQ0 A;  2HVE A;  1IBK J;  4KPC A;  1VK3 A;  3BPS P;  2W2N P;  4FYX B;  3OFH A;  5ETN A;  1U1K A;  2JDJ A;  4OX7 A;  1R6V A;  3K0J A;  4QW9 A;  1TQL A;  3R6L B;  2RRN A;  1SKS A;  1KWM A;  4WFZ A;  2FY1 A;  3P49 B;  2KVI A;  3AFG A;  4LRD A;  2RQ4 A;  1JLC A;  2DKO B;  4RWX A;  3M4X A;  1YBA A;  2LVW A;  1S59 A;  3W2W A;  2WON B;  5F9N A;  4ZPC A;  1FE0 A;  1WHV A;  2H5E A;  2OEL A;  2CQH A;  4LRA A;  3UD3 P;  2R7X A;  3RRG A;  1T9U A;  2DYA A;  4YQW A;  2V4J B;  4P75 A;  1L3V A;  4CIO A;  2FGC A;  1FRK A;  3BDE A;  1S1U B;  3LA0 A;  5KT2 A;  1L3U A;  1EQM A;  3CB4 A;  4DF4 A;  3F0N A;  3BV8 A;  5KFP A;  2AYB A;  2KXN B;  4DPX A;  2V2Z A;  5D78 A;  3NMA A;  4PG6 A;  4Z2X A;  4UZC A;  2EC0 A;  2LFV A;  2XI2 A;  4DSI A;  1VBZ A;  2X1G A;  4DR1 F;  3C46 A;  2GNK A;  2RDI A;  1FFW B;  8ATC B;  1KN6 A;  1U1M A;  5IV4 A;  1ZH5 A;  3JQM A;  3IR7 B;  3A8J A;  1IKY B;  1UWB B;  3BKT A;  3TZX A;  5IFM A;  3HHL D;  1K47 A;  3FMB A;  2E9Z A;  2OGU A;  4WP8 A;  1YK9 A;  4F7V A;  2V0N A;  1DTQ A;  3T5L A;  4OV6 A;  1M5O C;  2ZFH A;  1Q8I A;  1IR1 A;  4J9O A;  4RPF A;  2D74 B;  4EEY A;  4AL6 A;  4M5I A;  1LOU A;  2YKM A;  4IQM A;  2B7C B;  3WHI A;  4JI0 F;  4PRF A;  2RQM A;  3M6W A;  1F9H A;  3OVB A;  3HPO A;  2R7R A;  4QWD A;  1WG5 A;  3PNI A;  3DDI A;  3AXM A;  2VQF F;  4MIB A;  4B3M J;  3D6H B;  1S6P B;  3ULH A;  3ITH B;  5KFZ A;  1FX4 A;  1JNZ B;  5KAK A;  4ZPV R;  5EDW A;  1VK8 A;  2DHG A;  1DTT B;  1UMJ A;  2KM8 B;  2CPF A;  1VRU A;  3RW7 A;  3SFG A;  4OZ3 A;  3MXH P;  1RTI B;  1Y5N B;  2HWI A;  4JV5 J;  1GAO A;  1RWN B;  1CLF A;  4LF4 J;  2F8H A;  2Z56 B;  1BLU A;  2X3D A;  1UEV A;  1WOR A;  3ZNU A;  2VUG A;  3NGS A;  4CQ1 A;  3DLB A;  2FUG 9;  3KMQ A;  1RT2 B;  3KNA A;  2HGN A;  2KI2 A;  1N6Q B;  3DKD A;  3DDN A;  4JP8 A;  1NSA A;  2YWE A;  1S12 A;  2OJ3 A;  3W66 A;  3PTW A;  3J7A N;  1N0U A;  1Q79 A;  3N79 A;  2M5Y A;  2CQ1 A;  3M9O B;  1F0X A;  3ET6 A;  4I7F B;  3TP2 A;  1U1P A;  1QE1 B;  3UDV A;  1TV6 A;  2ZVI A;  2KFY A;  2ZHA A;  1RWM B;  1ZM9 A;  3RB4 A;  2KT2 A;  2BE2 B;  3K8W A;  4UF4 A;  2UVV A;  1RGV A;  2DNR A;  2DXE A;  3BB5 A;  4Y2C A;  4XTT A;  1WTF A;  1Y3J A;  2W25 A;  1Q8L A;  1KQG B;  2HS0 A;  4BC7 A;  4FYV B;  2CPI A;  2DNL A;  1YSJ A;  2MKI A;  3D9B A;  1U6F A;  3EVW A;  4J9V A;  3RYL A;  1SH0 A;  2LQB A;  2YWW A;  4DL7 A;  2CPZ A;  4NLY A;  3PYE A;  4IDK A;  4ZA1 A;  3D7S B;  4ATN A;  3D54 A;  3MED B;  2QRR A;  3WIV A;  4OHY A;  2VU5 A;  4Q5V A;  1HHS A;  1M1K T;  2QT7 A;  4HVZ A;  3I4H X;  5ETQ A;  2HHX A;  1TKZ A;  2DCU B;  3J7A 1;  2ZBC A;  3IR5 B;  2XMV A;  3HHL C;  1HMV A;  1OYD A;  2Q3P A;  1UA0 A;  1RAC B;  1Q8B A;  3KK2 B;  1H2V Z;  2F4V F;  1HWL A;  2KT5 A;  1V5V A;  2Z8Q A;  5C42 B;  3VHQ A;  1E6V A;  1FJE B;  4DQP A;  5F0W A;  4NXM J;  4JV2 A;  3GP9 A;  1AXQ A;  3M2V A;  3DLG B;  3MM8 A;  3R9L A;  4LF8 F;  4P9S A;  5GAG U;  2DIU A;  3ZC4 A;  5DM6 Q;  5AXL A;  2W24 A;  3GU0 A;  3SI8 A;  4RUB A;  3QO9 B;  3SDE A;  2OTL S;  2XSF A;  2XG8 A;  4YDD B;  5CXT A;  4DF8 A;  2B56 A;  2AEF A;  3AOA A;  1UPM B;  4MK8 A;  1XNR F;  2OSR A;  1IBK F;  1D9F A;  1NAQ A;  4YR2 A;  2PGC A;  2AGP A;  1KTQ A;  1NHK L;  4UT4 A;  3T3F A;  4PKD B;  1YTY A;  4DU8 A;  1EET B;  2G13 A;  3MCS A;  4DL5 A;  4AXJ A;  1DAR A;  5KFN A;  4EZ6 A;  1NH8 A;  1ZAX A;  1FX2 A;  5B0E A;  3QGP A;  3AOB A;  1WC6 A;  4IRK A;  4JI4 F;  3K5L A;  4NCB A;  4LT6 A;  1VR6 A;  2GHW A;  4AT1 B;  5CAA A;  1SQF A;  4U7C A;  4J90 A;  2VJU A;  1MWY A;  1YLX A;  2BJ7 A;  3SV3 A;  3VGS A;  1HW9 A;  3G71 S;  1S99 A;  5DGB A;  2Y1L B;  2MQL A;  4ENO A;  2WON A;  2W4P A;  3OUY B;  2FD2 A;  1HKA A;  4DR4 J;  4WBF A;  3T6B A;  1KD1 T;  2VFT A;  4XIU A;  5KFL A;  1KON A;  4R8U B;  4G3I A;  1FEH A;  2V9K A;  4ZDN A;  3QNW B;  2G2Y A;  1CC8 A;  3OLA A;  4GC7 A;  2V4J A;  3TX8 A;  5GAH U;  4ZCM A;  1S1U A;  1I51 B;  2WVB A;  2IJF A;  3FSI A;  2IIH A;  2P6S A;  3G2X A;  1ZAW A;  1WF1 A;  2XMT A;  4KGM A;  3BR8 A;  3F41 A;  3OD2 A;  3CCT A;  4DR2 J;  2CXE A;  3NG8 A;  2IM3 A;  1WWH A;  4W4M A;  3CJT A;  4LBP A;  2H4W B;  3M9M B;  5D77 A;  1YJT A;  4DV6 F;  4X66 J;  2B8P A;  2BX6 A;  1KFS A;  2DR9 A;  4J9R A;  2DHA A;  3MEK A;  5CCL A;  1IKY A;  4IH7 A;  3GIR A;  4ECT A;  4A4J A;  5HL7 Q;  3KDN A;  2QIF A;  4QYZ K;  3EM1 A;  5ETO A;  4DL3 A;  2BKO A;  4QBU A;  1FES A;  2BVZ A;  4PYD A;  4WWS A;  1L3K A;  2FYX A;  2GMH A;  3CCL S;  2QMU B;  3TJA A;  3T9N A;  1WTB A;  4OX6 A;  2YNI A;  4B3M F;  3PYF A;  2CQ2 A;  5HQ8 A;  2DEJ A;  3E51 A;  3NOG A;  5D6G A;  4N47 A;  3IS9 B;  1NDL A;  4FNH A;  4B9V A;  2M88 A;  2QMX A;  4C6A A;  2EFN A;  3QLH B;  2XMM A;  1JKH B;  2AJ0 A;  2CJ9 A;  4NA1 A;  1FEE A;  4UQT A;  1IUJ A;  2AYE A;  3M6V A;  4JV5 F;  3FEY B;  3ITH A;  4C8Z A;  1VS3 A;  2OPR B;  1RT5 B;  4LF4 F;  4CCH A;  3JSR A;  3N6N A;  3W8G A;  3KJV A;  2X1F A;  4LVO P;  1DTT A;  1ZM4 A;  1F3V A;  3PR5 B;  2O3D A;  3PM9 A;  5CD4 H;  1HBU B;  4ES2 A;  2ZWO A;  5L9N A;  3CIM A;  1IKV B;  1FWL A;  4UOH A;  1GMU A;  1RTI A;  1Y5L B;  2PO4 A;  4DV5 J;  3BGU A;  1O8B A;  5HMX A;  2LEB A;  2EG2 A;  1P1T A;  2ASY A;  4YB5 A;  2KB2 A;  3QGG A;  5L8R C;  5ETS A;  4FZV A;  3DN9 A;  1SB6 A;  2ILY A;  1WJ9 A;  4WFY A;  4YOE A;  2X7I A;  1RT2 A;  5KG1 A;  1J5E J;  5KFC A;  1KFD A;  2YKA A;  2Z4P A;  1N6Q A;  4K4Z A;  3OXF A;  5B0C A;  2GZO A;  2QLJ B;  2HHS A;  2RSQ A;  5F41 A;  4CH7 A;  2CRL A;  3I87 A;  1FRI A;  3P6Y C;  1B3T A;  2MQQ A;  5DLF A;  1RHU B;  2MEW A;  4CT8 A;  2ADC A;  4C2M A;  4J9N A;  4OJG A;  1R27 B;  4X4Q A;  4B9U A;  1B7Y B;  1ELO A;  4MIA A;  3ETO A;  2E5H A;  5AE1 A;  3W5Z A;  4I7F A;  1NSP A;  4CLK A;  2Z0G A;  3N28 A;  4TU7 A;  5KFS A;  5L1J A;  2M52 A;  1QE1 A;  4GKJ F;  3QJJ A;  3GIM A;  2FVR A;  2HVZ A;  5DDR C;  3SXL A;  3M2U B;  5L1K A;  1Q4R A;  4DUZ J;  4B02 A;  2BE2 A;  4IFY B;  4DV0 F;  1RLC L;  4X62 J;  2W1B A;  4A8K A;  2I2Y A;  2ZH9 A;  4NMX A;  3OL9 A;  5DET A;  2H51 B;  5F8N A;  2W8K A;  2DNQ A;  4ECZ A;  3UQS A;  2PSZ A;  1HNZ J;  2AF6 A;  4P2S A;  3OV7 A;  3ISN D;  3GIL A;  1CUL B;  3WBZ A;  1GX6 A;  2GJI A;  2YQ1 A;  1NKC A;  1O5J A;  3MED A;  4FKX A;  3UDL A;  2C3O A;  4AE5 A;  3NEK A;  1UEU A;  2YPY A;  3VAH A;  5HAN A;  1XEZ A;  2VC0 A;  5JMN A;  1CJK B;  3FBC A;  2NSC A;  4NXM F;  2IJN A;  3KG0 A;  1DLO B;  3IG1 B;  3FKB A;  2WSC C;  4A8Y A;  1U0H A;  4LFA J;  3KK2 A;  4DFJ A;  2MKK A;  3VAJ A;  2IDL A;  1YBU A;  2UVU A;  5C42 A;  3N9U C;  3AHP A;  1WKL A;  3UPF A;  1VOM A;  1JXV A;  1J2V A;  3NWR A;  2R9L A;  4FNI A;  5EHH A;  2IRY A;  2J6S A;  3ZZZ A;  3DLG A;  2RT3 A;  3UN3 A;  2R8K A;  1T9X A;  2IC3 B;  3N5F A;  3DXB A;  1X5T A;  2AZ1 A;  3CED A;  3QO9 A;  2FZG B;  1VGY A;  3GTY X;  4IG0 B;  2WHO A;  5LSO A;  2MY8 A;  2LA6 A;  2P9G A;  3KLF A;  4IOA Q;  4L73 A;  1UJ4 A;  2MB0 B;  4LFB J;  1NK7 A;  4JI6 J;  1R8A A;  1FRX A;  1HBO B;  3R5J B;  2FLL A;  2HIQ A;  1RHM B;  1WG4 A;  3C19 A;  5J1N A;  5KTQ A;  4KBI A;  3DOL B;  1SVD A;  4P74 A;  3P45 B;  3LP0 B;  5DZ6 A;  1CJT B;  3MDF A;  2J6T A;  2XCP A;  4ECW A;  4C3M A;  4LF2 A;  3M8R A;  3P3D A;  2HUR A;  4MKV A;  4QWC A;  2ABY A;  2R7V A;  2DXD A;  2YQ0 A;  2C3Y A;  3D1Q A;  4ZK7 M;  2BJ3 A;  4HI2 A;  4L75 A;  1D1U A;  1KHV A;  5FII A;  4G1I A;  2HYI B;  5AJ3 J;  3PX0 A;  5KG0 A;  4EYI B;  3NXZ A;  2W2Q P;  4PG8 A;  2RUS A;  1OQ6 A;  2PA8 D;  5AE3 A;  2MZQ A;  4JV1 A;  4DL0 C;  4R8U A;  5D0R A;  4DR2 F;  1DFD A;  3PZP A;  3BQ1 A;  2VD3 A;  4FBT A;  1LW2 B;  5KG4 A;  1SJ1 A;  1RT1 B;  1CS4 B;  3TA1 A;  3RB0 A;  2KYZ A;  2E5G A;  4FDF A;  3H2L A;  5M2P A;  2CDR B;  1K9M T;  2N7C A;  3I0R B;  4X66 F;  3TEH B;  3CTR A;  2J8S A;  2AJF E;  5D0E A;  2KZZ A;  2A6M A;  4OHZ A;  7AT1 B;  1SC6 A;  2FJX A;  2GVZ B;  5L38 A;  2U1A A;  2MQ8 A;  1SH3 A;  3J81 Y;  2HHV A;  4NZ6 A;  2DGS A;  4LQ3 A;  3ISN C;  1ZET A;  4K8R A;  4OV1 A;  1E6Y B;  2IA6 A;  2L9D A;  5IT9 U;  1R6Y A;  3CD7 A;  4ES1 A;  2AJ2 A;  1JQG A;  5A8W B;  1FWP A;  1VDH A;  2A6O A;  1T11 A;  4KIA A;  2J0X A;  3D6F B;  5GAE I;  2AJQ A;  1PAE X;  4USK A;  2YNF B;  3Q8P B;  2ZZM A;  5D4O A;  5A8R B;  3T1Y J;  1NM2 A;  3IAS 9;  1I6J A;  2QC3 A;  3B6B A;  4ECX A;  1HQE B;  3N6L A;  7FDR A;  3V6J A;  3IS9 A;  2J6U A;  2XYH B;  1M5S A;  1JK9 B;  2OPP B;  3QLH A;  4KGX B;  4Q8F A;  1JKH A;  1AZS B;  3MEG B;  3BF4 A;  4YR3 A;  5K20 B;  2XNQ A;  1WKJ A;  4LBH A;  4KRW A;  4DV5 F;  3MR2 A;  3MEC B;  2OPR A;  1RT5 A;  2AJ1 A;  3PRB A;  1RYR A;  2HFN A;  5HN0 A;  2DR6 A;  3H2V E;  4K4T A;  4Y2I A;  2VBZ A;  1YX2 A;  2R42 A;  3BO2 A;  2HFU A;  3MFI A;  5I3Q A;  3V6D B;  1HBU A;  2FZC B;  2RE1 A;  1IKV A;  2UVW A;  4DS4 A;  1J5E F;  2F4F A;  2XWX A;  4OZ1 A;  4TQR A;  4JBC A;  2XTJ P;  1NHV A;  3OJS A;  1ZZF A;  2DY1 A;  4PUO B;  1VBK A;  4NCG B;  4KHP J;  2AW0 A;  2OPS B;  3T5K A;  3MI7 X;  2J9D E;  1FTC A;  3KYL A;  1S79 A;  4CZC A;  4PEO A;  3Q8U A;  1UZH A;  1JLA B;  4LF7 F;  5CYM B;  3HLU A;  4Y2M A;  1WHY A;  5CYJ A;  2MST A;  1FF2 A;  4KHR A;  3RRH A;  1R8P A;  2I5J B;  4DV1 J;  1JJ4 A;  3CF5 Q;  1HBN B;  2DRB A;  2WTF A;  2IM0 A;  3VQS A;  1VLY A;  1S6O A;  3C16 B;  1Y0H A;  4F2S A;  2V2K A;  1GXT A;  4X62 F;  2M8H A;  4K0K J;  3N6M A;  3RW6 A;  2I0X A;  3AAW B;  1AFJ A;  1AA1 B;  1DY3 A;  1R8B A;  2MQO A;  3M2U A;  2MKC A;  3US5 A;  4EBD A;  4OHX A;  2RHQ B;  1Q8K A;  4IFY A;  4X4O A;  1Z4U A;  5AXN A;  1S9E B;  4OX8 A;  3RZA A;  3MCM A;  2GQC A;  2X1A A;  3CCM S;  2MJU A;  1LWF B;  1LQ9 A;  4PR6 A;  2RHS B;  3IXQ A;  3P8B B;  2L9W A;  1U8W A;  3BYR A;  1NK5 A;  3QGI A;  1ZAV A;  1F2H A;  1HI8 A;  1HNI A;  3PJ9 A;  4ED0 A;  3EWG A;  1SJ4 P;  2V50 A;  3MUM P;  4DZ6 A;  1HR0 F;  4RX6 A;  4LFA F;  1R89 A;  1C1C B;  1X0F A;  3MF5 A;  1D3W A;  2LXI A;  3HJV A;  1LFP A;  1CJK A;  4P2M A;  4F4Y A;  1TU0 B;  1SKU B;  1DLO A;  2QE5 A;  3IG1 A;  1MRO B;  2AX0 A;  1S1X B;  5ITH A;  4URG A;  1IWG A;  2XS5 A;  3OJU A;  1ZM2 A;  5HVG A;  9ATC B;  1N33 J;  2ROP A;  4YN3 B;  3HHD A;  4DEZ A;  3AD8 C;  2PDA A;  2IC3 A;  2HWT A;  4F67 A;  1NDK A;  3V6H A;  1T0T V;  2DY9 A;  4FXD A;  1KS2 A;  3HD1 A;  1C0U B;  1VQM S;  1DAX A;  3BN7 A;  4LFB F;  3ELH A;  2NLW A;  4JI6 F;  3BSO A;  3TVK A;  2N4C A;  5AT1 B;  4C8K A;  3DU5 A;  2MLZ A;  3H90 A;  3PW7 A;  4FXV A;  2DIS A;  3KHR A;  4D3G A;  1OY6 A;  4W90 B;  4KB7 A;  2NUH A;  1HBO A;  3D6M B;  2ZOM A;  5LJ5 Y;  1S7I A;  3SSS A;  1NLK L;  5IC4 B;  4RJV A;  4NPO A;  4C8M A;  3DOL A;  4CT9 A;  4ZP8 A;  2F5G A;  2HSE B;  3LP0 A;  5AJ3 F;  4GRS A;  1CJT A;  2GCF A;  4BLG A;  4DG1 B;  2XNR A;  4DPO A;  2R2U A;  1S77 D;  1NKE A;  3NNA A;  1HD1 A;  4PWU A;  4OMF G;  2V2V A;  2JC0 A;  3IM9 A;  4QPT A;  4M63 A;  4YFU A;  1H73 A;  4NXN J;  1HNV B;  4XK8 C;  3U7J A;  4O3P A;  2GVD B;  3VGV A;  4URQ U;  2Z2L A;  2DIV A;  3KDO A;  2B4P A;  4EK2 A;  1JLF B;  3TAR A;  2GIF A;  4I2P B;  4J9U E;  4CYU A;  3OTB A;  1Z2L A;  3A13 A;  4AYB D;  3TUP A;  5H9F J;  2QTW A;  4RW6 B;  1Q5Y A;  5HVF A;  1BWV A;  2DGO A;  4DS5 A;  3HSJ A;  1BQN B;  4O4G B;  1LW2 A;  1S97 A;  3RBZ A;  5SZT A;  1RT1 A;  1FXR A;  3IP0 A;  2MPU A;  4ZN1 A;  4CO0 A;  2O01 C;  3I0R A;  5KFW A;  3KLG B;  3FEZ A;  2XEX A;  3OHB A;  2ASD A;  4A47 A;  2ZJQ Q;  2ZH1 A;  2GVZ A;  2YH0 A;  4A8M P;  4F36 A;  3PCO B;  1I1G A;  3MUR P;  3QT8 A;  2HZA A;  2J9E A;  1U47 A;  3D3B J;  4YME A;  3HT3 A;  3GSI A;  3HCX A;  2N7Y A;  1NJW A;  4QYR A;  2OMO A;  3Q86 A;  3RBE A;  2D3O R;  3K57 A;  3TAM B;  3M1V B;  4DR7 J;  2Q1L A;  1E6Y A;  3RB6 A;  1VHI A;  3OLB A;  3PAC A;  1EKS A;  1KKH A;  1PSD A;  4ZJO A;  2VAS A;  2VBW A;  4WFA Q;  3GV7 B;  2CPE A;  1SXL A;  3IC1 A;  3E01 B;  1SBR A;  3NGR A;  2YNF A;  4FPR A;  5IXU A;  5A8R A;  3BH6 B;  5F8J A;  2EK6 A;  2XY7 A;  2CNO B;  3BSA A;  1PJ6 A;  2IHR 1;  1C2P A;  4OYX A;  1XNQ J;  1JNR B;  1VQ5 S;  2OPP A;  2CQD A;  2E9R X;  1X7V A;  1AZS A;  2HQI A;  3MEG A;  1SC4 B;  4Q2M A;  1DRZ A;  3MFH A;  2IYG A;  5L9X A;  1KRP A;  4C8O A;  1SV5 B;  5T14 A;  3MEC A;  4QOT A;  3SYZ A;  2CJK A;  2FDN A;  8RUC A;  2HNY B;  4DV4 J;  3GG0 A;  3BKF A;  2DGT A;  4KHP F;  4RL1 A;  4CLL A;  2VBX A;  2CJA A;  3QSY B;  5KFT A;  1DQA A;  2ZWP A;  5H9E J;  4MYU A;  1OS5 A;  5LT5 A;  3GJS B;  1RCO B;  4NOH A;  3H20 A;  4PPD A;  3CCS S;  3EPI A;  2OHD A;  2MXY A;  1UW4 A;  4HEA 9;  4PUO A;  4NCG A;  2ZKT A;  3BGF A;  2OPS A;  3ZO7 A;  3Q2T C;  4FS1 A;  1PC4 A;  2ZE2 B;  2OO4 A;  3M30 B;  2CQP A;  1S57 A;  4I0W A;  2CVI A;  4CH1 A;  3BO4 A;  2IRU A;  4FS2 A;  3GQC A;  4DV1 F;  4JYA J;  1VC5 A;  4ZCK A;  2XYP B;  3R2D J;  1JLA A;  1U7L A;  2NRE A;  5CYM A;  2JC1 A;  3B8H A;  2DGU A;  3TA0 A;  5E5N A;  4K0K F;  2I5J A;  1TAU A;  4OZJ A;  1HBN A;  4MT1 A;  4DUY J;  3SSR A;  5LOQ A;  4RUC A;  3EVO A;  3QJP A;  2XMW A;  2X1B A;  2C22 A;  2DNY A;  3C16 A;  1GX5 A;  4F4X A;  4LF1 A;  4USV A;  2QLX A;  2ZH8 A;  1CBK A;  3UE2 A;  3FRZ A;  3AA9 A;  5MLC V;  3PJX A;  2W7A A;  1URR A;  4UUX A;  4L3N A;  1Z2Z A;  4UUW A;  2XZW A;  4OZ0 A;  4F26 A;  3NWG A;  1S9E A;  2VQE J;  4RKU C;  2EK1 A;  4USI A;  1NZA A;  3R3T A;  3AJ1 A;  5CD4 A;  4K4U A;  2OML A;  2VL1 A;  3NGT A;  1R0C B;  2YH1 A;  2C2E A;  4CLF A;  4ZVG A;  2K06 A;  1WAC A;  2XO6 A;  2ZOF A;  2MGZ B;  4HT5 A;  2FHM A;  1KDN A;  2GHP A;  4IO9 Q;  2BA9 A;  3IN5 A;  2Y3Y A;  1F3F A;  4KO0 B;  3UW1 A;  4J5O A;  3W5X A;  1KOH A;  5HLF B;  1DQ8 A;  3A1Y G;  4EMD A;  1VI7 A;  3HFV A;  3QGH A;  2IY5 B;  2DHH A;  2DK2 A;  5GMD A;  3T9Z A;  4IRD A;  4F50 A;  1RCX B;  3OL6 A;  3FJ2 A;  1QDU B;  1N33 F;  2FHK A;  5E3Q A;  3AQO A;  1IJE B;  1MRO A;  1S1X A;  3CDU A;  2IJR A;  2AMC B;  4WFB Q;  4F4W A;  3CJ4 A;  4NRT A;  1N48 A;  1QAY A;  4DZD A;  4NLT A;  5L1L A;  5J2Q B;  1BXN A;  1H3D A;  3RR7 A;  3I4P A;  2IVM A;  4U7U K;  2I1R A;  2YX4 A;  1NK4 A;  4FPI A;  2IVF B;  4DR6 J;  3C15 B;  2HRY A;  1C0U A;  2B9W A;  4OHW A;  4C0H A;  1GQE A;  3S7R A;  1J5O B;  1FKO B;  1LFW A;  3HM9 A;  4OZN A;  1Y7P A;  1X0P A;  5G4D A;  1AW0 A;  3L7U A;  1X4C A;  4F25 A;  4ETX A;  2MDA A;  4DV3 F;  3ICL A;  3GSD A;  4N7T A;  3V5R A;  4OYP A;  3PG9 A;  2QLF B;  1ZOT A;  4LF5 F;  4NXN F;  3VWS A;  2R7T A;  1T9V A;  4B17 A;  1M5H A;  5KFX A;  4PPZ A;  2XGQ A;  1LNQ A;  3QFW A;  4RUH A;  3FSY A;  1RWX B;  3E3X A;  1U49 A;  3DRS B;  4DG1 A;  2RU9 A;  4JB8 B;  2JEF A;  1N54 B;  2LA4 A;  2LEA A;  1JWW A;  5KG2 A;  1WEL A;  1RWK B;  5LSR A;  1D8Y A;  2M7S A;  2AEJ A;  1HNV A;  1IXK A;  1F60 B;  4WK1 A;  1GXU A;  1H74 A;  1SQE A;  2YWG A;  3AQP A;  1QAJ A;  2GVD A;  3UD4 P;  2LP4 A;  4DCO B;  1H38 A;  1JLF A;  1XBW A;  4IOB A;  4U8Y A;  1T3N A;  2HFZ A;  5E3A A;  1NH7 A;  4P2X A;  3VVT A;  1JB0 C;  3O2I A;  4QR2 A;  4RW6 A;  1N5T A;  2GJ2 A;  3OT9 A;  3THV A;  2QL7 B;  1LXN A;  4OI1 A;  1NPR A;  3ENQ A;  4XPE A;  1BQN A;  4XDC A;  4O4G A;  4CTA B;  1RHJ B;  1LWE B;  3GMG A;  3RTV A;  2BRL A;  4OYM A;  2LQ9 A;  1MWQ A;  2P6T A;  1VMB A;  4ZP7 A;  3FNN A;  3KLG A;  4DR7 F;  1RIS A;  2BAC A;  1SIW B;  1FRM A;  4WFX A;  2WOM B;  4EWT A;  1W26 A;  1GNK A;  4FVM A;  4NYP A;  3QWU A;  3K5M A;  1TAQ A;  1VQN S;  3T19 A;  2L48 A;  3PHT A;  2I8E A;  4UZB A;  1H98 A;  3MPV A;  4YS2 A;  4C48 A;  4RBT A;  3TAM A;  1H6K X;  3M1V A;  1PG5 B;  1XR7 A;  5KFY A;  3THP A;  2QL9 B;  4C4W A;  4I6W A;  4U95 A;  3BGR B;  1QJH A;  1Y11 A;  4NI2 B;  3ZZR A;  4KQZ A;  2XC9 A;  1V9O A;  1CC7 A;  1O0P A;  3NS5 A;  1HWK A;  3W9I A;  1Q7L B;  1XNQ F;  3E01 A;  3WIU A;  3HHE A;  5ADZ A;  4JI3 J;  3VAI A;  2AKW B;  2YKO A;  2XI3 A;  3WZ0 A;  2WBM A;  4PYA A;  2B0G A;  2JLG A;  4M95 A;  1VYA A;  3KFW X;  3NGD A;  2EBG A;  4WF9 Q;  3B78 A;  1K1S A;  3A8I A;  4P73 A;  4DV4 F;  3CCR S;  1RU1 A;  3I55 S;  2JL9 A;  4DSE A;  4EO6 A;  5GAD U;  3QT5 A;  2VG7 B;  1OSD A;  1T9T A;  4TLR A;  5C2G A;  2QO3 A;  3LTO A;  4OI4 A;  2W9B B;  3RRK A;  3T1H J;  5HI7 A;  2QYG A;  1FFS B;  1S6Q A;  1TL1 B;  2CNL B;  2FIU A;  1SV5 A;  3SCL E;  2I9S A;  1QD1 A;  2HNY A;  4NCA A;  1T95 A;  3CIZ A;  5DO2 A;  2XMU A;  2DNK A;  1ZPW X;  1WDD A;  4CLZ A;  1NJX A;  5DG7 A;  3TJ9 A;  2UXC J;  1RAE B;  4JYA F;  4DQR A;  2C2K B;  1S0V A;  3R5G A;  3CJ2 A;  2XLI A;  2LCW A;  4OX9 J;  2J9C A;  2KHD A;  3RR8 A;  3A3N B;  2DPI A;  4K5S A;  4J9K A;  1WC4 A;  2QX0 A;  2NXJ A;  3UCG A;  4GVB B;  1KQF B;  3KG4 A;  2ZE2 A;  3QT6 A;  3M30 A;  1X60 A;  4ZVR B;  2VB6 A;  4USH A;  4DUY F;  4H4M B;  1UWA A;  3HT0 A;  2VZ9 A;  2QV6 A;  1ULR A;  3TUI C;  3EX7 B;  1XN9 A;  3R7N B;  2R7U A;  3S8S A;  1VJW A;  4RBU A;  4NZ0 A;  5ETK A;  1V5I B;  3MUT P;  5A0Y B;  3IAM 9;  5IT9 Y;  4WKY A;  4OZ5 A;  1H0H B;  3TNV A;  3CJ0 A;  5A8K B;  1HNW J;  4QWB A;  4P72 A;  4RBV A;  2LDI A;  1UET A;  2OTJ S;  1TFW A;  2VQE F;  2JLF A;  4DPU A;  4KGK A;  1QUP A;  2BV3 A;  1LV5 A;  3LO3 A;  2QJ3 A;  2K7K A;  4ZVH A;  2BQ3 A;  5IQ6 A;  2AV5 A;  3KTQ A;  5GAG I;  5H1S V;  2K1R B;  3IGN A;  3DI6 B;  3H98 A;  1CQM A;  2XCA A;  1S0M A;  3HZE A;  3DC2 A;  2DRD A;  4OLP A;  2GX8 A;  2ATL A;  2K8G A;  2EG1 A;  2Y1J A;  3HZG A;  2MGZ A;  2OD4 A;  4ZVS B;  2F8M A;  4ZLP A;  2XM3 A;  4KO0 A;  1U6Z A;  4AND A;  5HLF A;  3W61 A;  1Y4Z B;  3KHG A;  2JHE A;  4RNO A;  1SUQ B;  4BCA A;  5CYQ B;  2A0F B;  5THW A;  4ITS A;  1UVL A;  1QM9 A;  4C7Q A;  1FO1 A;  2APO A;  4ILL A;  4DQQ A;  2HLU A;  3AJD A;  1HHQ A;  4DR6 F;  3J7Z T;  2Y0B B;  1M0S A;  3KLI A;  2KDO A;  3PW5 A;  5CZV A;  1TK8 A;  2VG6 B;  4PXE A;  5J2Q A;  4YEA A;  4CWB A;  4DV2 J;  3HVA A;  3H4B A;  3W5Y A;  3PKY A;  3PX6 A;  1LK5 A;  4RO0 A;  1S7H A;  4NLW A;  2YWH A;  3C15 A;  2CIM A;  1HQ2 A;  2BKN A;  2EI5 A;  4N56 A;  1HFE L;  3OQ2 A;  3TOQ A;  3WC2 A;  2CA9 A;  1DQ9 A;  3H5U A;  2D9O A;  5DRK A;  2HBR B;  3D6T B;  1U09 A;  1RI7 A;  1J5O A;  2YTC A;  1FKO A;  2LQ5 A;  1KBR A;  3F44 A;  4NLS A;  4Y0F A;  4WKR A;  1SC1 B;  5A2Q U;  1F5C A;  2B7B B;  2FVQ A;  2ZBQ A;  3DRY A;  2DNN A;  5L46 A;  3ZZU A;  3CJS A;  3W2V B;  5HBM B;  3KWM A;  2QA4 S;  3L95 X;  4WZQ A;  4Y3C A;  1N5Q A;  3QIP B;  4ZVF A;  4DDF A;  3LAK A;  2BAB A;  2V8G A;  1Q95 G;  2UU9 J;  1X8D A;  2HK3 A;  1U1R A;  2GO8 A;  5EN1 A;  1WNE A;  4C8N A;  4Q45 A;  1VRT A;  3BGL A;  3CNQ P;  4ZPB A;  1K1Q A;  3H8Y A;  2B9X A;  2DPJ A;  2QLW A;  2FHJ D;  5E3P A;  3O1L A;  3TZZ A;  2D3Z A;  4DUT A;  1QAX A;  1FD8 A;  3ZZ0 A;  4NZ7 A;  2OI2 A;  3W60 A;  2L3M A;  2V69 A;  5KFB A;  1NSK L;  1F9F A;  4TY8 B;  2DR8 A;  5T7L B;  2CZV C;  5ETT A;  2ALY B;  4CTA A;  4IUF A;  2MLY A;  1LWE A;  4QWE A;  3OFE A;  4CRJ A;  3BM7 A;  2J5A A;  3VR1 A;  3BN4 A;  4OYA A;  5KFD A;  3DMJ B;  2H1Y A;  1FWK A;  4UY8 5;  2WOM A;  2RS8 A;  2HS3 A;  2OUG A;  5DZ7 A;  2XO7 A;  3TR5 A;  2HBZ B;  4RUA A;  4JI1 J;  2YKN B;  1APS A;  4JI3 F;  4NE9 C;  3CC2 S;  2HHT A;  4MK9 A;  3BGR A;  2D41 A;  4NYO A;  4NI2 A;  2AP6 A;  2E1C A;  1XMQ J;  1REG X;  1RKI A;  1X4D A;  3HFZ B;  3T1H F;  2LXF A;  5GVQ A;  1IVZ A;  2WB1 D;  1XR6 A;  1UFL A;  3RUB L;  5BYQ A;  2U2F A;  4ECR A;  2RVJ A;  4A8F A;  3HXM A;  2YBV A;  2C2D A;  3D2W A;  2BJ1 A;  4Z7C A;  5A6P A;  1EIY B;  4AFF A;  1VQO S;  4DPY A;  2JVR A;  2VG7 A;  4ID5 A;  3AD9 C;  4YDX A;  1O6X A;  2KO1 A;  2W9B A;  2R2T A;  4M5M A;  4OJ3 A;  3MM6 B;  1TL1 A;  2UXC F;  2NCK L;  2WZ1 A;  2HHP A;  2Z30 B;  2M2B A;  4X4T A;  2CG8 A;  5E7O B;  4OX9 F;  5KG7 A;  3DU6 A;  3NCP A;  1ZYQ A;  4H54 A;  4KGV B;  2F40 A;  4CM2 A;  2F63 A;  5LSL A;  4DJB A;  3HVR A;  2B3T B;  4C3K A;  1RTJ B;  2FPH X;  2BDP A;  1UZD A;  1B0T A;  3G86 A;  4CNZ A;  2ZD1 B;  1S10 A;  5ETL A;  3HKZ D;  3CCE S;  4HTI A;  2JH3 A;  2GV1 A;  4GVB A;  5HRO B;  1X4F A;  1EAY C;  3G8T A;  2HBY B;  2OAU A;  4RNH A;  4Z7Y A;  2AGQ A;  1WEY A;  4JOU A;  4NLV A;  1RYS A;  3HHL B;  1U02 A;  1DBD A;  1H2T Z;  4ZLJ A;  4I6Y A;  4ELU A;  2AQ4 A;  3DNC A;  3OR2 B;  5A0Y A;  4UW2 A;  2AWZ A;  5D8H B;  1IBL F;  4L74 A;  3JQJ A;  5A8K A;  4DLG A;  3CMA S;  4I4B A;  4DU7 A;  3MM7 B;  4B3O B;  2L9N A;  1VQ9 S;  4JI4 J;  4BS2 A;  1RWP B;  2QA1 A;  1YHQ S;  2VFV A;  3DYA B;  2QYC A;  5CH7 B;  4AQY J;  3C6U B;  2C2M B;  3HJF A;  3HSD A;  2K1R A;  3EMT A;  2ZH6 A;  3FUY A;  3CCU S;  1BHN A;  3DI6 A;  2O66 A;  2H4Y B;  4ECQ A;  1S49 A;  2DGQ A;  4OZL A;  2CPH A;  1FRH A;  1P1L A;  2NPF A;  3R8Y A;  3EGV A;  1SL0 A;  2W2O P;  2MKJ A;  3FVY A;  3GJR B;  3SEO A;  5M2R A;  4WCE Q;  4TLQ A;  4N8O A;  3MTK A;  2M8D B;  4HHU A;  2QMW A;  2OH2 A;  2ZZT A;  2ZJP Q;  1U2C A;  3C14 B;  3GB0 A;  3FDS A;  2HFS A;  2PA3 A;  1UCN A;  2V67 A;  1SUQ A;  4ZP9 A;  5J2P A;  3ZZO A;  3PKM A;  4NML A;  3TQ1 A;  1VC0 A;  2LQJ A;  4ZPD A;  4DV2 F;  2VPW B;  3MD3 A;  1JXE A;  1KNZ A;  3S01 A;  3W63 A;  1M5P C;  5DQI A;  2RIJ A;  4GO5 X;  4DV6 J;  5HSP A;  2VG6 A;  4MKB A;  2AT1 B;  1HAR A;  4DN9 A;  1U1N A;  2P9E A;  3BSC A;  1FT8 A;  3CO0 P;  5H9F K;  5F3Z A;  2GW8 A;  2HPU A;  1VCT A;  2BZ2 A;  3PO4 A;  2GAH C;  2YWF A;  2B8Q A;  1FD2 A;  3TZY A;  1TL3 B;  4TNO A;  3V4I B;  5B0B A;  4N77 A;  1FVS A;  1RBA A;  4HL9 A;  1KEK A;  3BKU A;  5F8L A;  2RKI A;  2KG1 A;  1RT6 A;  1DJ0 A;  2PMW A;  2UU9 F;  4P10 A;  4F04 B;  5LMN F;  3W2V A;  1RSC A;  5HBM A;  2N4D A;  1TVR B;  1R0B G;  4WP3 A;  1MW7 A;  2RDD A;  3ILO A;  3QIP A;  3IA0 A;  1RWU A;  5LM7 E;  2HFV A;  2CYY A;  1LWC B;  2XY5 A;  2R8G A;  4BDP A;  2M3D A;  1Q16 B;  2YNH B;  4KV8 B;  2KJV A;  3DOK A;  3QRQ A;  2FLP A;  4WXO A;  1YZ7 A;  2GIQ A;  1HYS B;  2HBQ B;  2XUL A;  3GR1 A;  2C2O B;  1FVQ A;  4O3N A;  2MKY A;  4ECY A;  3BO3 A;  4DLE A;  4BHQ A;  2DIT A;  5K8P A;  3ZNJ 1;  3D0I E;  2DXF A;  1CQN A;  4CO5 A;  1X5P A;  2K3I A;  3O3L A;  1B64 A;  3QID A;  4V19 J;  4IOC Q;  2CQ4 A;  3TRG A;  4A8S A;  4TY8 A;  4IFV B;  2RUG A;  4IRC A;  2M4M A;  2G2O A;  4B3T J;  1UJ5 A;  3PEH A;  2FTR A;  1VQS A;  3LWM A;  1AT1 B;  2CVE A;  4O0I A;  2F3J A;  2CNN B;  1UEK A;  2Z57 B;  4DWI A;  2GHV C;  3DMJ A;  4JI1 F;  3VCD A;  4NLU A;  4YB1 P;  2A3J A;  2W4D A;  3W9H A;  5H9E K;  1NU4 A;  5LMU J;  5JJB A;  2HEK A;  4PXB A;  2XZD B;  4GKJ J;  3UNG C;  4V19 X;  1FDB A;  2RRA A;  3EGW B;  4CNY A;  1FNX H;  4QYZ J;  1WOP A;  1XMQ F;  4DCJ B;  2YKN A;  2QN6 B;  4NX9 A;  4KTQ A;  1NJZ A;  3S6E A;  2XLK A;  2J7W A;  4DR5 J;  1B0V A;  4DV0 J;  5SUH A;  3M2R B;  3CCJ S;  4L3K A;  2PI4 A;  2QA2 A;  3L9Z A;  3MR3 A;  4FF3 A;  2HVI A;  3BQ2 A;  4DL6 A;  2FHO B;  1K44 A;  1YRU A;  4C8L A;  1UKU A;  4MMO A;  5G0R B;  1JIH A;  1RB0 A;  4ED8 A;  4DI6 A;  2B6A B;  3D1O A;  4ZJQ A;  1RJJ A;  1B0P A;  4MKY A;  1TUV A;  3CE8 A;  2C3P A;  1EKR A;  2MQP A;  2VPX B;  4NLX A;  5KFM A;  3ADA C;  4DSL A;  5KFQ A;  4UOG A;  4DQS A;  3PXG a;  1H2U X;  4KYZ A;  1BQM B;  1FKP A;  3MM6 A;  1LEO A;  3ZXW A;  2RS2 A;  4FF4 A;  2IM2 A;  4KJI A;  2E7W A;  2R7O A;  3UVJ B;  3RU0 A;  2Y8Y A;  1KVJ A;  2OSQ A;  2PMZ D;  3K89 A;  4ANE A;  4PG7 A;  1PBA A;  4I2Q B;  1BY9 A;  4HR2 A;  5AXM A;  2HZV A;  1MN7 A;  4ANC A;  1RTJ A;  3U02 A;  1EHW A;  4KAI A;  4LVN P;  4GKK J;  2C2R A;  1NBE B;  2YX7 A;  3MAA B;  1R8C A;  2ZD1 A;  2WRM A;  4C97 A;  4LRE A;  5T41 A;  4HDH A;  4QCL A;  1SI9 A;  2HVH A;  5HRO A;  1TL7 B;  4OLO A;  2VBY A;  2AYM A;  1RE1 B;  1RTD B;  3QMQ A;  4Q43 A;  2E7X A;  3M8Z A;  3HHL A;  4IH6 A;  1I3O B;  3B54 A;  3NCQ A;  1CVJ A;  1WI6 A;  4FP9 A;  3H5S A;  5JXS A;  5J2M B;  3OR2 A;  2E29 A;  4AQY F;  1FJ7 A;  2AZ3 A;  1Q5V A;  3BDP A;  3JYT B;  5IV3 A;  1T05 B;  5CAB A;  3CSK A;  4B3O A;  3MM7 A;  1QSY A;  3Q8V A;  1ICE B;  1T7P A;  4O4R A;  3MZI A;  2BKP A;  2N3L A;  1L3T A;  4J9P A;  2XMA A;  3DYA A;  3JSB A;  2ILZ A;  5CHC B;  1QAI A;  2M0G B;  2CQG A;  2B9E A;  1UVM A;  1SC3 B;  3C6U A;  3CMQ A;  2E5I A;  4U67 Q;  2VKZ G;  1LK7 A;  4KFB B;  5D4N A;  3Q2S C;  2DEI A;  1YJ7 A;  3MM5 B;  3ENA A;  1D9D A;  3TZW A;  4AL7 A;  5EWG A;  3VAG A;  5KFG A;  5HQM A;  4ERD A;  3SQO P;  3HSZ A;  2PEH A;  1VQ6 S;  2OKQ A;  2HMI B;  4EI2 A;  4FYD A;  3EPG A;  2HAF A;  3GON A;  3AJ2 A;  4ED4 A;  4WK3 A;  4KGZ B;  2RD5 C;  3PDN A;  5KT7 A;  3NS7 B;  3FGV A;  2OFG X;  3M8Y A;  4JI2 J;  4X4R A;  3FQK A;  4CLT A;  1UWB A;  1VQ7 S;  1C1B B;  3ENV A;  2LEP A;  2DR5 A;  1YI2 S;  1D09 B;  1FDN A;  2J0S D;  1RTH B;  1HWJ A;  3TYT A;  1M5K C;  4JI7 J;  4WTO B;  5IWA J;  3JTO A;  3ETM A;  2XMJ A;  2QA4 G;  2BE9 B;  4P6Q A;  4TQS A;  4TXS A;  3QZ7 A;  4KC5 A;  5F3T A;  2HGL A;  1GXL A;  4EO8 A;  1S9G B;  4AUK A;  4QJV A;  2NXU A;  3UCZ P;  2PII A;  1PYO B;  1TL3 A;  4RLE A;  2R7Q A;  2BR0 A;  2MLX A;  1WC5 A;  4ZPW R;  1RP5 A;  3V4I A;  5DJB A;  3NY0 A;  4JI5 J;  4DV7 J;  4QW8 A;  1S6P A;  3MR6 A;  2RML A;  1TL4 A;  1GFW B;  3FC9 A;  3T41 A;  4OI0 A;  2V8V A;  3HD2 A;  2F7V A;  3Q24 A;  2GAG C;  4ER8 A;  2ASL A;  5K5M A;  1YIT S;  3PHE A;  1U8S A;  2R7W A;  3EDR B;  1EQ0 A;  3DGV A;  1K73 T;  3B4D A;  4J9L A;  2VFS A;  5DQG A;  1TVR A;  4R25 A;  1WF2 A;  2DGV A;  5HK4 A;  1YZ6 A;  1JJ2 R;  3KOA A;  3MCO A;  1WI8 A;  1YJU A;  3LF0 A;  4O23 A;  1X5O A;  1ZPV A;  1LWC A;  3Q23 A;  5I3U B;  2QL5 B;  5BYS A;  2YNH A;  4KV8 A;  2VPY B;  1UFK A;  2Z2Z A;  1HYS A;  3ISZ A;  4CDI A;  3R6G B;  4IO1 A;  1Q0N A;  2O5D A;  3CD6 S;  1U48 A;  4RW7 B;  4B3T F;  1YKW A;  3IM8 A;  1WC0 A;  2DNH A;  3CGI A;  4K4X A;  1V3Z A;  3NNC A;  2RIL A;  2LDY A;  3PO5 A;  1G7C B;  3M7V A;  3CD0 A;  3R5A A;  4IFV A;  4LF7 J;  1B70 B;  2UUW A;  2EBE A;  5LXR A;  5LMU F;  3EZO A;  3H0P A;  3A12 A;  3PFE A;  4WZM A;  1WG1 A;  1RK8 A;  3MMA B;  4EBC A;  1VRU B;  2UV8 A;  4ZLL A;  1B7F A;  2UUC F;  4OYZ A;  3OHA A;  1SL1 A;  1X4H A;  1TK0 A;  2EPI A;  3K59 A;  3BYP A;  1CJV B;  2W8L A;  3HDS A;  3RJM B;  2J0Q D;  3TWZ A;  4J9Q A;  4DR5 F;  5IQQ A;  4P52 A;  3MOZ A;  2B4O A;  4FXW A;  3K5O A;  4ECV A;  1R31 A;  2RQC A;  2DO0 A;  5IT0 A;  3K7R A;  4ED3 A;  4ILR A;  2MKS A;  3VVU A;  1U45 A;  4HHJ A;  1KVK A;  4U7U D;  3M2R A;  2KXH A;  2FLO A;  2B43 A;  1X5S A;  2LMI A;  1OIA A;  1S1T B;  3VZH A;  1XTZ A;  3A8E A;  2W01 A;  5HJY A;  2NXE A;  2DCL A;  4LUB A;  4WFN Q;  2EWH A;  5KFV A;  1QVF R;  3O5T B;  3D3C J;  5G0R A;  3NOC A;  3FBF A;  2QG9 B;  2ROG A;  1U1O A;  2XSJ B;  3N4W A;  1VFJ A;  2B6A A;  2HK2 A;  2HW3 A;  4UOF A;  1R0A B;  5IZH A;  3DLE B;  2FLN A;  1HPZ B;  1TV6 B;  3WX8 A;  3TVY A;  1HR0 J;  3QFH A;  4YB6 A;  3PJW A;  3ENW A;  1VJQ A;  1BQM A;  2R8J A;  4EBE A;  3ONQ A;  3K58 A;  4O3R A;  1VHF A;  2FJW A;  1RA7 A;  4TYB A;  4GKK F;  3UVJ A;  3G87 A;  1U0S A;  4BWM A;  3FRY A;  4GC6 A;  2VKR A;  4I2Q A;  2RH3 A;  1NUE A;  4G1P A;  2UXD J;  2C28 A;  2CQ3 A;  4EZ9 A;  4Q44 A;  5DGA A;  4WTY A;  4NYZ A;  1WEZ A;  3MAA A;  4DN0 A;  4UQG A;  3V2U C;  1NK9 A;  3KLE B;  3FBE A;  3ZZY A;  1F2G A;  2CAJ A;  2UUT A;  4NAS A;  1TL7 A;  4WIQ A;  3RB3 A;  1AFI A;  4Q2L A;  1U24 A;  1WC3 A;  1EET A;  2YX1 A;  4E98 A;  1LW0 B;  3DFE A;  1RTD A;  3F73 A;  1XR5 A;  3D1H A;  2BM0 A;  4WJB A;  4YP3 A;  1JLB B;  1P9Q C;  2M70 A;  5KFH A;  5J2M A;  3D68 A;  2GGP B;  4DXL A;  5B09 A;  2MMY A;  2UVR A;  3HF5 A;  4J7C A;  4TN2 A;  1T9Y A;  1SH2 A;  2ACY A;  4ED2 A;  1M5V C;  1TL5 A;  4ICL B;  2Z2M A;  4CLS A;  3SDE B;  1PKU A;  1MWZ A;  5D4P A;  4DMZ A;  1KR4 A;  2XS2 A;  1UW9 A;  4FKY A;  1KQS R;  4Y28 C;  3OUY A;  2VG5 B;  2FC9 A;  3OTO J;  1IM6 A;  1JLG B;  1OSC A;  1VBX A;  4KFB A;  2VIC A;  3LAL A;  1YGY A;  2FVC A;  4B3S J;  1X31 C;  3GCW P;  1HWI A;  3O8W A;  1LXJ A;  4ELV A;  3LAM A;  5DDP C;  4JI2 F;  1URN A;  1BMQ B;  2HMI A;  3IRX B;  2C42 A;  5ETM A;  1I94 J;  4X2B A;  1EX8 A;  4PG5 A;  2MJN A;  5KT5 A;  3CDE A;  3CT9 A;  1VIO A;  3ZZP A;  2XBP A;  2JEG A;  4DQI A;  1MSW D;  1ROF A;  1GTE A;  5DLG A;  3JXO A;  4JI7 F;  4A8W A;  5IWA F;  3KJQ B;  1B99 A;  4CLP A;  3CC7 S;  4M1K A;  2RJZ A;  4DSK A;  3PRD A;  1C1B A;  3V4M A;  7FD1 A;  1OPI A;  2QFI A;  3I0S B;  1RTH A;  1BUX A;  5JVG Q;  2Z58 B;  3R27 A;  2CJX B;  1S6U A;  2VPZ B;  1T8E A;  1XER A;  2G1D A;  3UI3 A;  3PIP Q;  1KOO A;  4JI5 F;  4DV7 F;  3AB2 B;  1VRQ C;  1S9G A;  4ZP6 A;  3RBX A;  1AYE A;  1TEL A;  1WC1 A;  5D0H A;  4I69 A;  2BM1 A;  4I68 A;  2LLZ A;  5EGY A;  1QSL A;  1AUS L;  3DLJ A;  3CUN A;  1RWV B;  2KTQ A;  4F0H A;  4I1T A;  3M8W A;  4KH1 B;  4F3M A;  3MGJ A;  2CZ9 A;  3PR4 A;  1OY9 A;  2B4V A;  1FHT A;  3D28 A;  2KU7 A;  2C3U A;  2WVE A;  5BXI A;  4HYK A;  4EU0 A;  4ZCI A;  2ACM A;  3QAU A;  5I3U A;  3LW5 C;  4F0M A;  2YNI B;  4OJ1 A;  2C3M A;  4LQ9 A;  3KUE A;  2HHW A;  2F8E X;  1XMO J;  2IPO B;  5BR8 F;  3R2C J;  5IS2 A;  1WOO A;  2EFG A;  4G1Q B;  4RW7 A;  2EFO A;  2V68 A;  5IOL A;  2Q43 A;  5CA5 A;  4WP9 A;  3CCQ S;  4OFZ A;  4G6V B;  1DZ5 A;  4NEY A;  5F9L A;  4Y2K A;  4Y34 A;  3M8P B;  1FXD A;  2KYX A;  4F4Z A;  5GAD I;  5IM0 B;  9RUB A;  3KJV B;  3G9C A;  3W9J A;  2CQC A;  1YRX A;  5HJX A;  4RU9 A;  3MMA A;  4X4S A;  3OTD A;  1MN9 A;  2KH9 A;  1YIJ S;  3CC4 S;  3I96 A;  3QRR A;  4A48 A;  1CJV A;  4ZJL A;  1T9W A;  4USW A;  2V8D A;  4N76 A;  2MZJ A;  4ED7 A;  1RAD B;  2G0J A;  2CPY A;  2HNZ B;  5RUB A;  2RNE A;  1VQY A;  3KKF A;  4ID8 A;  2UZA A;  3EUN A;  5L39 A;  3FZ2 A;  5CCM A;  1ZA1 B;  3D5M A;  2X3G A;  4KH0 B;  3J7Y U;  4LRB A;  4PZV A;  3SIP B;  2NR0 A;  4ZLN A;  3W62 A;  3CWJ A;  2V94 A;  2KFZ A;  4F2R A;  2RU3 A;  5L1I A;  3K8V A;  3K5P A;  3DLL Q;  1S1T A;  1R7I A;  2XZT B;  3OSP A;  1CUL A;  2EFQ A;  1SJR A;  4HHH A;  2G1H A;  4ECU A;  2VH7 A;  3HKW A;  4LFC J;  4J91 A;  5B0A A;  3QWP A;  3Q22 A;  2XSJ A;  3LGM A;  4TU8 A;  2KHC A;  5F8I A;  3W3S A;  1R0A A;  1JX4 A;  3DLE A;  2WVF A;  1XIQ A;  1U1L A;  1HPZ A;  2NXC A;  3R1H A;  1RHK B;  3VF0 B;  3BQ0 A;  5LXY A;  2HWH A;  1FE4 A;  4NLD A;  5BJR A;  2ATC B;  2UXD F;  1YVF A;  5J1P A;  4OI6 A;  5E3R A;  2NXN A;  1IQT A;  2E1P A;  2E5L J;  3BPD A;  2JVO A;  3BEG B;  3AB4 B;  3H5X A;  2NPI A;  2ROE A;  4ELT A;  2GQQ A;  4M5K A;  3IMQ J;  4IG0 A;  2X51 A;  4LR9 A;  4C3L A;  4MIW A;  3POT B;  4I6A A;  2OP5 A;  4FYY B;  4KSE B;  4WU2 A;  5JVH Q;  4I56 A;  2BAN B;  3KLE A;  2VON A;  4Q8E A;  4BC9 A;  3EZU A;  5B0G A;  5D3G B;  2D1C A;  1FER A;  3QBC A;  1HBM B;  4EFA C;  1JMT A;  2BJ8 A;  1U4B A;  2J0W A;  3FK4 A;  2V5H G;  1SKR A;  3K5N A;  3C6T B;  4DL4 A;  1I5O B;  2LU1 A;  3M8Q B;  1EB0 A;  4OL8 A;  1LW0 A;  3IFE A;  2JWN A;  1BC6 A;  1U0H B;  2V4Q A;  2R2S A;  1JLB A;  3EZ5 A;  1S76 D;  2DH8 A;  3TQE A;  2GGP A;  4K5R A;  5MAO A;  3QT7 A;  4DV3 J;  1CG2 A;  2CJB A;  3ZZT A;  2EFV A;  2JLE A;  3JAM U;  3UDC A;  3OTO F;  1A7G E;  5C25 B;  3Q8Q B;  1VC6 A;  4LF5 J;  2BYC A;  3MPY A;  4B3S F;  2EXU A;  2DT9 A;  3GLJ A;  1MML A;  4ICL A;  2MHE A;  3JTN A;  4P7V A;  4A46 A;  2VG5 A;  3KNG A;  3MPU B;  1Z1Z A;  2HRU A;  1FNO A;  3CUL A;  3AXK A;  1JLG A;  1SIZ A;  3G82 B;  2CQI A;  3GE9 A;  3UDE A;  1WSV A;  3KLF B;  3CDW A;  4QQB A;  2DVI A;  3R7S B;  3MWB A;  5JUM A;  3W64 A;  1QLN A;  3HFK A;  1I94 F;  1Q86 T;  3K17 A;  3U1M A;  2HHQ A;  3BGO P;  3LUY A;  3Q89 A;  4X84 A;  3H42 A;  1CS4 A;  4X4P A;  4IR1 A;  2DGX A;  3QZ8 A;  5C5J A;  3F56 A;  3IRX A;  3WQP A;  1F9E B;  5GMK a;  3NGK A;  1WDT A;  1N0V C;  2CQ0 A;  3EJM A;  1F1B B;  2ERR A;  4NLG A;  1XC9 A;  1KLN A;  1NME B;  4ZVT B;  4CO2 A;  3TO8 A;  4Y65 A;  1HNX J;  3LGH A;  4WPA A;  3LPY A;  2OD6 A;  1RBL A;  4WXW A;  3R97 A;  2H3E B;  1PGZ A;  1A6L A;  4Y00 A;  3Q8Y A;  4QWA A;  2A1B A;  3O44 A;  2HGM A;  4ZPA A;  2BQR A;  5J1E B;  2EKN A;  3UWT A;  3I0S A;  2E5J A;  5A8W A;  5K9F A;  4NL5 A;  3IWN C;  3UNY A;  2JX2 A;  1EP4 B;  2NUU G;  4DL2 A;  2FGO A;  2IA0 A;  1YBT A;  4ZS6 A;  5FD1 A;  2FB0 A;  5KFA A;  3BSN A;  3ILJ A;  1YRT A;  1V3R A;  3JQK A;  2YXL A;  1WD6 A;  3R5B A;  1P9Y A;  3IR6 B;  3BRE A;  2V4R A;  1HQE A;  1S1W B;  4LRC A;  3GYN A;  2P5V A;  1U25 A;  3R5D A;  2ZBR A;  4UST A;  4DFM A;  3UFC X;  4ES3 A;  2MKH A;  2G0C A;  3BH7 B;  1Q53 A;  4WYL A;  3KLV A;  5KFU A;  4H4K C;  1EAR A;  4RW9 B;  1NDC A;  3UN2 A;  5KFF A;  3MMC B;  2HQC A;  2KM8 C;  2HRT A;  1UPP A;  4FF1 A;  3THT A;  1M1H A;  3V6D A;  1PBU A;  4EUV A;  2H65 B;  3VAL A;  3G8S A;  1NND A;  1XMO F;  3V6K A;  4IH5 A;  1X9M A;  3MPW A;  2XHC A;  2JOQ A;  3DGP B;  2A2C A;  4M5G A;  2DNM A;  4KPY A;  4G1Q A;  2E66 A;  2HQD A;  3GFH A;  4Y2A A;  3SCK E;  2CDQ A;  1H7X A;  3VAK A;  2QSW A;  2MZR A;  2PFF B;  1IQZ A;  3M8P A;  2K3K A;  3H2U B;  3X3U A;  1HW8 A;  4FVC A;  4H4K A;  4DSF A;  4MH8 A;  5IM0 A;  2Y8W A;  5E3C A;  5D0G A;  5HO4 A;  3KUG A;  2DHX A;  2WSE C;  3KXD A;  2XLJ A;  4W98 A;  2H48 B;  3H4D A;  1FRL A;  3OFG A;  1WOS A;  2BRK A;  3RGI A;  2AU0 A;  1HQU B;  1UL3 A;  1PO6 A;  2HNZ A;  2JRS A;  1SJ3 P;  1TKD A;  2OEM A;  1LWF A;  2UP1 A;  1FNM A;  3X1L B;  2CKW A;  2NS1 B;  4LFC F;  4B08 A;  4A8X A;  3GJT B;  4M94 A;  2OEJ A;  2V6A A;  3MR5 A;  3TI0 A;  3T1A A;  1LWX A;  1ZTT A;  4V1A k;  2JEI A;  3M05 A;  3FCH A;  4KY3 A;  2L41 A;  4LF6 J;  4LJM A;  2WSF C;  5HAO A;  4KR0 B;  2ADB A;  2V9W A;  2IBO A;  1HWU A;  1L3S A;  3OSN A;  1C1C A;  4LF9 J;  3OBI A;  1FK9 B;  1FDA A;  4PXC A;  4UTG A;  5D4L A;  1RAI B;  2H5J B;  4NEZ A;  2E5L F;  4HH1 A;  5LL6 d;  4ZKA A;  3CJ8 A;  3ZTS A;  3W8P A;  2LXU A;  3A4T A;  4LSZ B;  2PEB A;  2EC2 A;  1CJU B;  1NB2 A;  1DUR A;  2ZDO A;  1X4A A;  3DCA A;  3VV2 B;  1K8A T;  4DX5 A;  1M1G A;  5CZX A;  1A0O B;  2YWK A;  1N8R T;  1HNI B;  3U1N A;  4LR7 A;  2BBE A;  1YJN S;  1PJ5 A;  3POT A;  1F6T A;  1IN0 A;  4CO1 A;  2XS7 A;  2LQ8 A;  2BAN A;  4K4V A;  2MZ1 A;  4USU A;  1YJR A;  2HHH J;  5LJ3 Y;  4K2X A;  2WW8 A;  5D3G A;  2Y0S D;  2R2R A;  1HBM A;  2NQP A;  1Q7Y T;  3C6T A;  1W25 A;  4JUZ A;  1MG7 A;  3M8Q A;  3PW2 A;  1BWE A;  1QVG R;  2MYF A;  2ZH3 A;  1GK8 A;  3EVM A;  4KKO B;  4B9L A;  1W2I A;  4OI2 A;  1GMW A;  4FBU A;  2GMJ A;  1NPK A;  2CWX A;  2AIR B;  3MD1 A;  1C4C A;  2EFP A;  4OYO A;  4F02 A;  5C25 A;  5AXK A;  3GFX A;  4X65 J;  2Y1I A;  3OTE A;  3N01 A;  4NWB A;  1TUW A;  3IRW P;  2BEF A;  1UP1 A;  5K8O A;  2FVP A;  4E0D A;  2HND B;  3PX4 A;  2PT0 A;  2PC6 A;  3MEE B;  1X9S A;  1G4C A;  1R3N A;  1ZA2 B;  4I2P A;  3TVZ A;  2DNZ A;  1T3O A;  3P5B P;  4X4N A;  2FJV A;  3G82 A;  2GQ2 A;  3JB9 k;  1ZBT A;  2Q6C A;  6FD1 A;  1XMB A;  1HLW A;  1N88 A;  1S5Z A;  3S1T A;  4EYH B;  5KT3 A;  1IBM J;  2W9C B;  2KXF A;  4WII A;  4XAK A;  1HNX F;  2QGF B;  4DR3 J;  3NMR A;  5E41 A;  2ZBI A;  2E7V A;  1RT3 B;  3TX0 A;  4DR4 F;  2ZKU A;  3HVT B;  4N8N A;  2HQ3 A;  2DTJ A;  5IC6 B;  1YJ9 S;  3UR0 A;  3HMJ G;  3H40 A;  2KFN A;  1OJ4 A;  1PCA A;  2BE7 D;  2CFX A;  3OFF A;  4FYW B;  1TMJ A;  5J1E A;  4CYU B;  2E44 A;  1KLM B;  3IBW A;  3IWL A;  1EP4 A;  4IQX A;  5KG3 A;  1A9N B;  2E1M C;  4MFB B;  3D4J A;  2VOD A;  3HVW A;  3P96 A;  4OYW A;  1S1W A;  2M9K A;  1HI0 P;  2CNK B;  1N5S A;  1RDR A;  3SSQ A;  2H9Z A;  3PYG A;  2KL8 A;  4ZIT A;  3N0V A;  4RW9 A;  3UD5 A;  3FFI B;  3JSY A;  1O51 A;  3MMC A;  1H72 C;  3G96 A;  4QZV B;  3Q8R B;  3L7P A;  1SCJ B;  3UN5 A;  3LPE A;  1K0T A;  2BOA A;  2YY3 A;  4U6P A;  3LP1 B;  3M8S A;  4K4Y A;  3T5J A;  4OI3 A;  5HMW A;  4FF2 A;  1XJW B;  4ETZ A;  3OPK A;  3BBB A;  1RU2 A;  4C9D A;  1FKA F;  1TMM A;  1IKW B;  3H59 A;  1N34 J;  1KSP A;  4N5S A;  1YWX A;  2OPQ B;  3PRV A;  2VC1 A;  3DGP A;  2ZHB A;  3HP6 A;  2NZ4 A;  5FLX U;  4A8Q A;  2YQ3 A;  2ZNY A;  4RNM A;  2LEC A;  3G4S S;  1FRJ A;  4ZVO B;  4K4S A;  1SJQ A;  2HG4 A;  2R8H A;  3ILI A;  2XQC A;  5BYR A;  3I56 S;  2HVD A;  1JXL A;  3HI9 A;  2D3U A;  3BS9 A;  2BW2 A;  3AD7 C;  2JFK A;  1MLA A;  2E9T A;  1IBL J;  3M6X A;  2VDI A;  4R0J A;  5KT4 A;  2AD9 A;  2ZM6 J;  1Y10 A;  2EVZ A;  3C8Y A;  3UO0 A;  1HQU A;  2FJD B;  4B9S A;  3NKY A;  2DNG A;  3GII A;  5FJ4 A;  2FQQ B;  3PV8 A;  1T02 A;  3I5C A;  4DFK A;  2CQB A;  2WK4 A;  2B4U A;  5DQH A;  2VJV A;  4LF6 F;  2R3V A;  2G2Z A;  5HMZ A;  3TAN A;  1TTH B;  4NRU A;  4LIW A;  1MMD A;  1IR2 A;  3R7B B;  4HT7 A;  3NL0 A;  4U8V A;  5HP1 B;  2RQK A;  4LF9 F;  3TUZ C;  3DRX A;  2ZZN A;  4M5H A;  4O44 B;  2COL A;  1C0T B;  1VQ4 S;  3ZTQ A;  3GIJ A;  1V6H A;  1FCA A;  3CPW R;  1KHW A;  1IR0 A;  3DXS X;  3MMB B;  5AE2 A;  5FDL B;  3AA8 A;  4DUZ F;  4J9S A;  2PI5 A;  3KG1 A;  1RLD A;  1W7W A;  1JJH A;  2OFH X;  1FK9 A;  3VGT A;  4QIV A;  2VA2 A;  4MYT A;  3J81 j;  3MM9 B;  2J7K A;  2GO9 A;  3QRP A;  2D3O 1;  2AHO B;  3E8O A;  3SV4 A;  4PWW A;  1NKB A;  1OY8 A;  3OVS A;  3KK1 B;  1OMS A;  1QSS A;  4L76 A;  4RW4 B;  4D3H A;  4QIE A;  2DH9 A;  3P5T L;  1CJU A;  3LP2 B;  1RT7 B;  2I38 A;  3DDK A;  3IGV A;  4W92 B;  1HNZ F;  2F1F A;  2XYG B;  1NCL A;  2MTL A;  2BMB A;  2B9Y A;  3O6Q A;  2B51 A;  2HAI A;  1F5B A;  2HHH F;  4TU9 A;  1SKW A;  4ZVE A;  5HQL A;  1ITP A;  4DBQ A;  1RWW B;  3LAN A;  4QR0 A;  2GJF A;  1R43 A;  2PMH A;  2Q66 A;  3SFU A;  4XO0 A;  1UA1 A;  3OXG A;  4LSL B;  2HQF A;  8AT1 B;  5DG9 A;  2VOP A;  2DRA A;  2BJ9 A;  4OHV A;  3CJ5 A;  4B3R J;  3NS6 A;  4RNN A;  3AOD A;  1UAW A;  3CCW A;  2HQG A;  3GG1 A;  3TEG A;  2VIH A;  1KC8 T;  4HKQ A;  4KKO A;  2IVY A;  4X65 F;  3CO9 A;  4X4U A;  3KK3 B;  1WKK A;  3D67 A;  2DJW A;  3EGN A;  2JSX A;  1UVN A;  4ZOS A;  3DRS A;  2EKY A;  4YB7 A;  3CJK B;  2OEK A;  1GMV A;  5LMN J;  2ALZ A;  1OQ3 A;  3JTP A;  4QPX A;  3PVX A;  3DM2 B;  4C0B A;  4C0O C;  4RW8 B;  1Y5I B;  1QUV A;  2PFD A;  2HND A;  3KHL A;  3MEE A;  5B0D A;  1WHX A;  3QAE A;  4PG4 A;  1PIL A;  1D9A A;  3K2Y A;  3J80 U;  1YQH A;  3EDQ B;  1IBM F;  2IDE A;  4NLP A;  4I67 A;  1N5V A;  1UVK A;  3OTC A;  4DR3 F;  3L09 A;  1VLO A;  3J7Z 5;  2HS4 A;  2GS8 A;  2P8I A;  4LMZ A;  1VIX A;  4WYW A;  2VDH A;  3U27 A;  3UR3 C;  2W9C A;  2BXJ A;  3JSM B;  3ZTO A;  3OL7 A;  3R5C A;  1T03 B;  4F4A A;  3NP5 A;  3OVA A;  4RU2 A;  4TY9 A;  2WCX A;  3FZB A;  1TKT B;  3LWL A;  2G0I A;  2IBK A;  4HDG A;  1UTA A;  3IWX A;  1RT3 A;  4Q0B B;  2V2Q A;  3HVT A;  5E2Q A;  3RAX A;  3ZFV A;  4Q7A A;  3GYX B;  3I6P A;  4E8U A;  2ZJR Q;  4O3Q A;  2IAJ B;  4HAC B;  1NXI A;  1OWX A;  1KLM A;  2VOO A;  1ZM3 A;  3PYD A;  1NO8 A;  4CH0 S;  3FMW A;  2R4F A;  2FZK B;  4MFB A;  1BD6 A;  1S72 S;  3OR1 B;  3ZTP A;  2VHG A;  5J2N B;  3VAM A;  4BBY A;  2CJY B;  1FFG B;  4NLQ A;  2BOP A;  3G6X A;  1G3O A;  2GML A;  3KLH B;  3JAM Y;  1NSQ A;  4YY3 J;  3QAT A;  2NSB A;  4Z37 A;  2OIH A;  3DRP B;  3FQL A;  1BGX T;  1TK5 A;  4ALZ A;  2OLW A;  2J8A A;  2PN6 A;  3FFI A;  4O0N A;  4YHH J;  4DOZ A;  3I31 A;  3VTI A;  1NZ8 A;  1CPZ A;  4DPT A;  1K0V A;  3DHX A;  3I9Z A;  2UUA J;  4AXI A;  2QZ8 A;  1Y00 A;  2QLB B;  1C4A A;  3D0H E;  4NA3 A;  2CAD A;  5M2U A;  1N34 F;  4PQU B;  4OQJ A;  2W2M P;  3LP1 A;  3T1Y F;  3GFY A;  5E0O A;  4XDD A;  2B5J B;  3BBF A;  3NAI A;  1GMW D;  2JNJ A;  3SQG B;  1PAU B;  4MAK A;  1U6B A;  2VA3 A;  2YNG B;  3AOC A;  1Y3K A;  1IKW A;  4FN5 A;  5B0F A;  3OW2 R;  4PAA A;  2UXB J;  2OPQ A;  5KG6 A;  4ZN3 A;  2Z2Y B;  3HHK A;  3M32 B;  3G6V A;  4H4M A;  1PC5 A;  1Q81 T;  4DPW A;  4ZMM A;  3PW0 A;  5HAT A;  1YDL A;  3H7H B;  4RNF A;  1NEE A;  1S6Q B;  5B08 A;  3FCV A;  2KRR A;  3IBC B;  4ZIV A;  1VQ8 S;  1CSJ A;  3CJ3 A;  4DHV A;  2ZM6 F;  3NAH A;  3ZTR A;  1RHQ B;  4URS A;  1VQP S;  1U26 A;  2FJA B;  2CPJ A;  1RAG B;  5C2C A;  4IYQ A;  3MOJ B;  3AT1 B;  2ZUG A;  4JI8 J;  2MQN A;  3IBF B;  1S9F A;  1RBO B;  4J9M A;  3MAQ A;  3VZI A;  2CG4 A;  1X4E A;  2JEJ A;  1W2B R;  1HL6 A;  1NB7 A;  4RZR A;  3T6J A;  2FVS A;  5K8N A;  5HP1 A;  2UUB J;  5KFI A;  4CLU A;  1EJ7 L;  5EWF A;  4UOC A;  4P7T A;  3VQT A;  5HVH A;  4O44 A;  3GWC A;  5KOW A;  1HHT P;  1C0T A;  4AD6 A;  2DGW A;  4R0E A;  5KT6 A;  2ZHO A;  3NCR A;  2IM1 A;  4ED1 A;  2EW9 A;  2ZH5 A;  4PQA A;  3TW0 A;  3UCU P;  1D8Z A;  1H7W A;  3MMB A;  2DB1 A;  5FDL A;  3TAP A;  2YVS A;  2POK A;  4C8Y A;  5CYQ A;  4QU7 A;  2AGO A;  5HMY A;  3GYG A;  4TKT A;  4B9N A;  2BQU A;  3PW4 A;  3MM9 A;  1XWL A;  4IR9 A;  2FHJ A;  1F5A A;  3W65 A;  4RR5 A;  3WC0 A;  2DNP A;  5F8H A;  2ZVS A;  2G9O A;  2K7J A;  3KK1 A;  2ZEJ A;  1D0E A;  4RW4 A;  4WE1 B;  4YR0 A;  2C2Z B;  1RAO A;  3LP2 A;  1RT7 A;  4ZVU B;  3DHW C;  4IKA A;  1IBC B;  3RAQ A;  3GR0 A;  2C1E B;  4PAB A;  4MTP A;  2WW4 A;  5A6W A;  4KE5 A;  3LH2 S;  2PE8 A;  3DLK B;  4B3R F;  4B9T A;  1WF0 A;  3EYZ A;  1FI4 A;  2WVD A;  5GME A;  3T5H A;  3C2P A;  4LSL A;  4CO3 A;  5F8G A;  2HIY A;  4IG3 B;  2QEX S;  3GV8 B;  2YKQ A;  3WDO A;  1RAA B;  5KOX A;  4X64 J;  4ZIW A;  1WSR A;  4U96 A;  1NK6 A;  2BUN A;  2XWY A;  1GTH A;  5DDO C;  4ECS A;  3KK3 A;  3KLI B;  2DR7 A;  3PY8 A;  1T94 A;  2NYH A;  3CJK A;  2IYI A;  2UV8 G;  2E1R A;  3IO1 A;  4K50 A;  4M5N A;  3V81 B;  1RT4 B;  3KJF B;  3H25 A;  1GT8 A;  3RBD A;  3Q0A A;  2HLT A;  2Y9H A;  3DM2 A;  4RW8 A;  2ZC3 A;  4R5P B;  3E2E A;  2WBR A;  5D15 A;  5CQG A;  5EX0 A;  4WU3 A;  1ZZN A;  1Q82 T;  2DNO A;  2GC8 A;  3VAF A;  1TKX B;  2LYV A;  2R8I A;  5T7L A;  1XK8 A;  2MY7 A;  4LBI A;  4BWJ A;  2KKH A;  5I42 B;  3CJR A;  3I9V 9;  1N36 J;  1WHW A;  1GEH A;  2IMO A;  2IFX A;  4E2F B;  1OO0 B;  6AT1 B;  3JSM A;  2FJE B;  1NHU A;  1T03 A;  1X4G A;  5A76 A;  3C66 A;  1MU2 B;  4DFP A;  4F0K A;  3M6U A;  2CPX A;  1TKT A;  1FTR A;  3R1L A;  1REV B;  4M5J A;  2DBB A;  1N5Y B;  4Q0B A;  2UUC J;  1VQL S;  3LQV A;  1VRT B;  3L3C A;  2EEY A;  1FJG J;  5GAE U;  2ZC4 A;  4M5D B;  2QFJ A;  3A3P B;  4LSN B;  3C3L A;  2IAJ A;  4OJH A;  2F65 A;  4HAC A;  2KJW A;  1UVI A;  2AX1 A;  4JV0 A;  2NYI A;  5DM7 Q;  4YY3 F;  5F0U A;  4HTJ A;  2P9C A;  2QSF A;  4TVA B;  2WB4 A;  3W7B A;  1OPZ A;  2XHW A;  2Q6B A;  1AUD A;  2F9D A;  1TP7 A;  3HHN B;  3OR1 A;  3LGN A;  5J2N A;  5KG5 A;  4XPC A;  1IKX B;  3GPA A;  2JZ5 A;  2SXL A;  4YHH F;  3CJQ A;  3I32 A;  2RF2 B;  1QTN B;  3AY0 A;  3KLH A;  3EXY A;  4DX6 A;  1IM4 A;  4L6V 3;  4ZPT R;  2UUA F;  5ETV A;  4K4W A;  1N56 A;  1WUU A;  3DRP A;  3BBC A;  2RAQ A;  1TFY A;  5K14 B;  4ZCL A;  2IRX A;  3AH6 A;  1YJW S;  4O3O A;  3EXC X;  2V8H A;  2RDJ A;  5EUH A;  2W7O A;  4H4O B;  4S0M A;  4PWD B;  1YG0 A;  2W7P A;  4LIR A;  2W2P P;  1S0N A;  4PQU A;  4NA2 A;  2ASJ A;  1ZTW A;  1X9W A;  3FEX B;  2D69 A;  2UXB F;  4PXD A;  1N32 J;  1VIS A;  2B5J A;  3EIC A;  4KT0 C;  1TR0 A;  3SQG A;  2YKP A;  1FXL A;  2YNG A;  2XMK A;  4ED6 A;  1CEZ A;  3J7Y I;  3MCN A;  1UVJ A;  2HHU A;  4DX8 H;  4P71 A;  4C98 A;  4A8O A;  1NDP A;  3RAM A;  1JLQ B;  1RA6 A;  3I82 A;  1RAF B;  2D9P A;  3M32 A;  3MMJ A;  2JJ4 D;  1YJV A;  1S1V B;  4NLR A;  3SCI E;  4GO7 X;  4ID5 B;  2GIR A;  1HA1 A;  2DHS A;  1JLE B;  4C11 B;  3NBP B;  4O3S A;  4ZHR B;  4JI8 F;  3SCJ E;  2N3O A;  2N82 B;  2GA7 A;  4TYA A;  4M5L A;  3MTJ A;  1G1X A;  2KVQ E;  3OXL A;  5C24 B;  5KFJ A;  4K2J A;  3ILL A;  4KHM A;  3CME S;  4DCP B;  4NLO A;  5KFR A;  1G6B A;  1RWO B;  2UUB F;  1QTM A;  5KFK A;  3EE3 A;  3HUL A;  2O67 A;  2V8P A;  1B4S A;  3SMZ A;  3PFO A;  3JS9 A;  3DOM B;  3CCV S;  2MHN A;  3DRR B;  2HKE A;  2A10 A;  3GV5 B;  2CPD A;  4QIF A;  2AEM A;  2E1A A;  1RAB B;  4G65 A;  2KRB A;  3FSX A;  3CDB A;  3KJN B;  1L5U A;  3TJ8 A;  3C14 A;  2ZUA A;  3CDA A;  2K2P A; 
#chains in the Genus database with same CATH homology
 4WBF A;  1BHN A;  4UOF A;  1K44 A;  3NGS A;  2BEF A;  5C7P A;  3ZTP A;  2DXF A;  3BBC A;  1MN9 A;  1XQI A;  1S59 A;  2B8Q A;  3EVW A;  3PRV A;  3WX8 A;  1NLK L;  4F36 A;  4FKX A;  3Q8Y A;  3DKD A;  3Q83 A;  4DI6 A;  1WKJ A;  3FC9 A;  3FCW A;  1NDL A;  1NSQ A;  3NGU A;  4DUT A;  1B99 A;  3ZTQ A;  3B54 A;  1NHK L;  4C6A A;  4S0M A;  3FBC A;  3Q86 A;  3FCV A;  2VU5 A;  1F6T A;  3G2X A;  4UOG A;  5BXI A;  3ZTO A;  1NSP A;  2DYA A;  3FKB A;  1HLW A;  1LWX A;  1NSK L;  4O0N A;  1S5Z A;  4F4A A;  3ZTR A;  1BUX A;  2AZ3 A;  1LEO A;  1W7W A;  1UCN A;  3VGT A;  3DDI A;  1PKU A;  3NGT A;  3VVT A;  5CAB A;  4FKY A;  3EE3 A;  2HUR A;  3VGV A;  2DXD A;  1WKL A;  1B4S A;  1NUE A;  3EIC A;  1JXV A;  4AND A;  2HVD A;  1WKK A;  1S57 A;  4EK2 A;  3Q8V A;  1NDK A;  1VYA A;  1KDN A;  2DY9 A;  4ANE A;  3NGR A;  2HVE A;  3MPD A;  3VVU A;  1ZS6 A;  1BE4 A;  2B8P A;  3JS9 A;  3Q89 A;  4KPC A;  4UOH A;  3EVM A;  2BX6 A;  4HR2 A;  2NCK L;  3ETM A;  3BH7 B;  1F3F A;  3ELH A;  1U8W A;  3BH6 B;  3BBF A;  5IOL A;  1NDP A;  1MN7 A;  5CAA A;  1NDC A;  4CP5 A;  1NPK A;  3FBE A;  3L7U A;  1PAE X;  4ANC A;  2AZ1 A;  3ZTS A;  3FBB A;  1EHW A;  3EM1 A;  3PJ9 A;  1NCL A;  3GP9 A;  3Q8U A;  2CWK A;  3VGS A;  3R9L A;  3VGU A;  3ENA A;  1HHQ A;  1HIY A;  1XIQ A;  3EJM A;  3B6B A;  2DXE A;  3BBB A;  4DZ6 A;  3GPA A;  3FBF A;  4ENO A;  1NB2 A;  3EMT A;  2ZUA A;  4W98 A;  3EVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...