4CP5A

Ndpk in complex with (rp)-spmpapp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
KVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE, CYTOSOLIC
publication title Enzymatic Synthesis of Acyclic Nucleoside Thiophosphonate Diphosphates: Effect of the Alpha-Phosphorus Configuration on HIV-1 RT Activity.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4cp5A00
1VYAA 4C6AA 5CABA 3G2XA 4O0NA 4ANCA 4DUTA 1S59A 2NCKL 3EMTA 3EE3A 3BH7B 1NSQA 1HHQA 3VGTA 4HR2A 1MN9A 3NGTA 3ETMA 3FBCA 3ZTRA 1WKJA 1BUXA 1UCNA 2AZ1A 1W7WA 3BBCA 3EICA 3EVMA 4WBFA 1S5ZA 3EJMA 1NPKA 3MPDA 1WKKA 3ZTQA 2BEFA 2B8PA 3GPAA 3DKDA 3JS9A 1U8WA 3VGVA 3NGUA 1EHWA 3Q8YA 1XQIA 3VVUA 2HVEA 3ELHA 3B6BA 2BX6A 5IOLA 2B8QA 3FKBA 4FKXA 2CWKA 2HVDA 1KDNA 2DYAA 2DY9A 3Q8VA 1NDCA 3BH6B 4S0MA 3Q86A 1BE4A 3PRVA 1LWXA 4ANDA 2AZ3A 3L7UA 3ZTOA 4ENOA 2HURA 3EM1A 1MN7A 3GP9A 3DDIA 3BBFA 3FBBA 1NSKL 1K44A 4ANEA 4DZ6A 4KPCA 2DXDA 4UOHA 2ZUAA 1HIYA 3R9LA 1F6TA 1HLWA 3FBFA 4CP5A 1NSPA 1B99A 3NGSA 1XIQA 1NDKA 4FKYA 3ZTSA 1PKUA 3VGUA 3VGSA 1NHKL 4F36A 1S57A 1NDLA 3Q89A 4DI6A 3EVWA 3FC9A 3ENAA 3FBEA 5C7PA 1JXVA 4UOGA 4UOFA 1NB2A 3WX8A 2DXFA 1WKLA 1LEOA 3Q8UA 1NLKL 3BBBA 1B4SA 3NGRA 3EVOA 2DXEA 1PAEX 4F4AA 1ZS6A 4W98A 3Q83A 1NCLA 2VU5A 1F3FA 3FCVA 1NUEA 5CAAA 4EK2A 3VVTA 3ZTPA 3FCWA 1NDPA 3PJ9A 3B54A 5BXIA 1BHNA
chains in the Genus database with same CATH superfamily
1OMSA 4WU3A 4FXWA 1GT8A 2ZC4A 2RU9A 3NGTA 5E2QA 3N5BA 2YY3A 3H2LA 2VFRA 3KYLA 3NKYA 3PYEA 4R25A 1U48A 2V6AA 1SIWB 5DM7Q 1S1WB 5IS2A 4DSEA 2KT3A 5T14A 2C3OA 2AT1B 4IR1A 3MD3A 4CO0A 1NSAA 2B5JB 4URGA 1NK7A 2BABA 2NXUA 4ERDA 3L7UA 3KHRA 4GVLA 3LP2A 4YN3B 4KR0B 1NK5A 2RDIA 1C2PA 1VRUA 3QRQA 2Z2MA 3M2VA 4A8MP 4LF7J 3TANA 2C3PA 5IT9Y 4OYPA 3RB3A 1JXLA 4B3TJ 3AB4B 1JJHA 1TUGB 3BBBA 1PC5A 1S1XB 3NGDA 2XC9A 2CPFA 2V67A 3B54A 1BHNA 3O6QA 1SC1B 2GV1A 5D8HB 3DOKA 4PWDB 2IDLA 2F4VF 2VIHA 3HHDA 4PWUA 2BKNA 1M5PC 2W9AA 1RT2B 5M2UA 4JI3F 4DLGA 4QZVB 3RR8A 4QWDA 3NNAA 1RT5A 5K5MA 5KT7A 5HL7Q 1XEZA 4JP8A 3QO9B 2HZCA 4USIA 1VBKA 5L8RC 2CWKA 3IAS9 3TAPA 2OD6A 3Q8VA 8RUCA 2J6TA 2UXDJ 3KNAA 2VG6A 2ZUAA 1S6QB 2YWGA 3TP2A 1FEHA 1KRPA 1V3ZA 5K14A 5J1NA 3MAAA 3ZC4A 2Y1LB 1S1UB 1MLAA 2KN4A 1B4SA 3ILLA 5I3PA 4DSJA 4H4OB 4BWMA 2YNIA 2D9PA 4X4SA 1D8YA 1UTAA 4C9DA 4ZPAA 4B3MJ 2MLXA 3VAJA 2RRNA 2UUAF 3OUYB 2HBQB 1OQ6A 2I9SA 1RAGB 1KQSR 1S48A 1G7CB 2C1EB 2XI3A 3LW5C 4M5KA 4ECSA 4MFBA 3KJVA 3SYZA 4DCJB 2DTJA 3MOZA 2QZ8A 3OV7A 2VJVA 2IC3A 2GMJA 3HKWA 4ZCLA 5HBMA 3TR5A 1IKXA 3VHQA 1Q95G 4NLWA 2FC8A 2HNZB 3OTDA 2BR0A 2E9TA 1MWYA 3MM5A 5THWA 2VQEJ 2YKMB 3NLCA 3MPYA 2WOMB 1TUVA 2VBXA 3BGRB 1NB7A 3PXGa 3KJNB 3KK2A 3MUMP 1F5AA 3D4JA 3DNCA 4B3SF 3FC9A 2A10A 4CQ1A 1GX6A 3OTCA 2FHMA 3THTA 4HHUA 5DGBA 5LMUF 2HRTA 3PX0A 4NCGA 3V4IA 2NYHA 1Q16B 1N5YB 4LF9F 3M05A 2FJBB 4HI2A 2XMUA 1KQGB 4FYYB 2W7PA 3W3SA 3GJRB 2LXIA 2ZC3A 4CLZA 3N6NA 1NPRA 1HWIA 2BRKA 3I82A 4A8KA 3H2VE 3EX7B 3O8WA 3U7JA 1N33F 4WFBQ 2W24A 3PYFA 3DLHA 1HWLA 2H54B 1X9WA 2AJ0A 5KFRA 2GJ2A 4BHQA 4WP9A 4DR5F 2IM1A 1IM6A 4JI8J 2XG8A 2ZE2B 1X4GA 2YQ0A 1U45A 4TYBA 1I6JA 3P5TL 1K1QA 2VBZA 2HKEA 4B3OA 1FCAA 4MH8A 4JI5F 2BANA 3DLKB 2IMWP 3LP1A 1WEZA 4OYMA 4U9RA 1KLNA 3HD2A 3KWMA 1CJTB 2I6WA 3QATA 2CYYA 5J1EA 5CAAA 1Q5VA 4JYAF 1ZAWA 4GVBB 2GS8A 2Q43A 3BGOP 3TI0A 4NOHA 3GTYX 2FTRA 2WONA 3JYTB 2C2NA 1DQ9A 3KXDA 4WFAQ 2ZZNA 3BBCA 2W4CA 1HBMA 2DNOA 3D67A 3WIVA 2RRAA 4QIEA 2UUBJ 2D74B 4ED0A 1HI0P 1S7IA 1SVDA 3LGHA 3IR7B 1P1LA 3FSXA 2JL9A 2LA6A 3FKBA 4C8NA 1UPMB 5E0OA 3Q86A 3BV8A 4IO1A 4P74A 5K8MA 2I1RA 4MAKA 5A6PA 2VPXB 2MTLA 2MEWA 2V2QA 1O6XA 4P2FA 1Q7YT 1C1BA 5J2MB 3MM6A 3US5A 1KEKA 1HPZB 1NB2A 1RP5A 4O4RA 3NGRA 3MEEB 3K17A 3T1YJ 3HHLC 1Y10A 3VTIA 3V6KA 1XMOF 1NUEA 1SH2A 2G2OA 2VOPA 3IWNC 4OX9J 2RNEA 4P72A 1V5IB 5C42A 1NJIT 1M90T 3ITHA 4TLQA 1FJEB 4RPFA 3THPA 4AXJA 2HSEB 2H9ZA 1GH8A 3JB9k 2HGNA 3C6UB 1NPKA 2OI2A 4FNHA 4Q2MA 3NS6A 3C3LA 5B0EA 4WF9Q 4OJ1A 4DV0J 3H90A 3QLHA 1UEVA 3BEGB 4CO3A 1IBKJ 2G1DA 3R97A 3WZ0A 4P10A 4MK8A 1VIOA 2GO8A 3PRVA 4DV4F 4IFVA 2J8SA 4E0DA 2LKZA 1N36J 2BUNA 5AE1A 3SQOP 1UVLA 3A3NB 3CCTA 2YPYA 4CP5A 3G6YA 4TN2A 4F0MA 3PNIA 4YUDA 1LW2B 3M9NB 1XC9A 5GMKa 1JJCB 5KFAA 4B3TF 4OI6A 2YWKA 2AEJA 5DS7A 3CCLS 4ZJQA 3C16B 1U0HA 5H1SV 3P49B 1OSDA 3HO1A 5GAEU 4CDIA 3AAWB 2WTFA 2X1GA 1KHWA 1RT6A 5DRKA 2DNZA 5CYMA 2LEAA 4A8WA 3HSZA 1JLFA 1DHMA 2ILZA 4C8MA 4PQUA 2B8PA 4ECYA 2DR8A 2DNLA 1IXKA 4R5PA 1ZA1B 5KG3A 5BJRA 2D3UA 2YX4A 3Q8QB 4FKXA 4F0HA 3J80U 1TKZB 2F1FA 1R0AA 1UPPA 3TA2A 1UZDA 1XWLA 1BLUA 3MCMA 4Y2CA 5I3QA 2XYHB 3DHWC 3EM1A 2E1MC 5CZXA 1PAUB 4K0KJ 5ADZA 2F7VA 1WORA 2V8HA 3UD4P 3R1HA 3DDNA 2OD4A 2PI5A 1PKUA 5C24B 4PKDB 1KVIA 3GYNA 5D0EA 5KT3A 2R7WA 4OX8A 2KXHA 3HP6A 1C4AA 3Q8UA 3GJTB 3EGZA 4QYZK 1ULRA 5J2QB 3MEDA 2WVDA 2CAJA 5D0HA 4ZMMA 4ZVHA 4F67A 1VYAA 1RTHB 2W2MP 4FPRA 3GFHA 4CLKA 3CD7A 2V69A 3DRXA 2BQUA 4OJ3A 3E01B 4FYWB 4LBIA 1U1RA 4Z37A 1PBUA 3DU5A 3TZWA 3BN4A 4W90B 3IA0A 4ED4A 4CIOA 5DZ6A 2ZZMA 1RWOB 5D15A 2XS7A 1J5OB 2IJNA 1IKYA 3EWGA 1QAJA 2BVZA 4C8LA 3K89A 1GMWD 1NH7A 4V1Ak 2WVEA 3CIMA 3KLFB 2OPQA 3TQEA 3W65A 1U1PA 1RXOB 4B9MA 3SIPB 3LTOA 4RLEA 4DSIA 4XPEA 4ED7A 1G4CA 1KQFB 2XZWA 1HWUA 3GV5B 3NBPB 3PJ9A 4P6QA 4GKJF 1N6QA 3RUBL 2ASYA 2PC6A 3IAM9 3W2WB 4CRJA 2W7OA 4YDDB 1NK9A 4CO5A 4MTPA 2DHXA 3VGTA 2J76E 4Y3CA 5KT6A 3J81j 2JFDA 4ILMA 4M95A 3R2DJ 3JQMA 4GC7A 2BE2B 4CO4A 3OL7A 1K9MT 4Q8EA 3D5MA 3K5NA 4LFBJ 2B8QA 2VF3A 1RHMB 3IS9A 1FDBA 1T0TV 2CJAA 4DUYF 2IVMA 1VGYA 1NDCA 4KB7A 1FFGB 1LWXA 3I0RA 1UWBA 1T7PA 2OPSB 5DDOC 4U67Q 3DI6A 4JI8F 2ZBPA 1V3RA 1LWEA 1JJ2R 3ZZOA 3KK1A 3S1TA 4DV1J 2HBRB 1KFSA 3QIPA 2WBRA 5CCMA 2LXUA 1NHKL 5KFCA 1Q4RA 4XAKA 1CG2A 1WSRA 4DL7A 3FNNA 5KFYA 1URNA 4IDKB 3C19A 2WB1D 5EGYA 2UV8G 3IN5A 1B0PA 1IR2A 1VR6A 3HVTA 4RBTA 4C3MA 4DR6F 2AGPA 1R3NA 2N7YA 4DX7A 2UUBF 4KHPF 5C25A 4ILRA 1RU2A 3CD5A 2HAFA 2HWHA 3UE2A 4Y6IA 3ICLA 1EETA 4DMZA 8AT1B 3GIIA 2J8AA 2NLWA 4FYXB 4LF4F 2F40A 2HLUA 3JXOA 1H7XA 4DL2A 1NAQA 1FK9B 4QU7A 3GYGA 3W5XA 2L9NA 2OFGX 3PACA 2EK6A 2RT3A 1SPBP 3CJ4A 3C6TA 4UQTA 2VC0A 1ZZFA 1WG1A 3WX8A 2CIMA 3T1YF 4U7CA 3H0PA 3CSKA 1VDHA 4KTQA 2P9EA 4WXOA 1ROFA 1S1UA 1FKOB 4OX9F 4FBUA 4UZCA 2ZVSA 6FD1A 1U0SA 4NLRA 4PPDA 1NHUA 2ZH7A 1ICEB 4O0NA 4QYRA 2CJKA 1RACB 2XO6A 5B0AA 2X1FA 2LQBA 2G0JA 1AXQA 1S5ZA 3RB6A 5DDRC 4K8RA 2ADCA 4I67A 2AYEA 4Q2LA 2AF6A 4OYAA 4UW2A 1MROA 4DZDA 3A3PB 5F9NA 2MZ1A 4LBHA 2ZH8A 2EXUA 3A8IA 2HGMA 3QIDA 1IBKF 4OZLA 2XHWA 3M1VA 2AZ3A 1LFWA 1N36F 2HNZA 2MJUA 4PWWA 2ROGA 2ASDA 2RHSB 4PG4A 2QEXS 2ZBQA 4DL0C 2C2MB 5KTQA 5EX0A 1SB6A 2R2TA 2PMHA 2QLBB 1FJCA 3IO1A 2FJXA 3V81A 1I3OB 5HMYA 3EVOA 1WEYA 3QAUA 2N82B 1UA0A 4Z2XA 1UVJA 5KFJA 4H4MB 3MPVA 1NDPA 1CQNA 1WG4A 2R7OA 3QWUA 4G1QA 3LPYA 1VISA 2ATLA 1FWKA 3NCRA 1K0VA 1OQ3A 2ZD1A 3KHGA 2V63A 2VG5B 2MZJA 2KZZA 3CC2S 1FWPA 1YGYA 3U1NA 2W7AA 5JXSA 4M63A 4DF4A 2FHJD 5HROB 3RB0A 4RNMA 1TV6B 3RB4A 4OZ5A 3CCWA 3M6WA 4FF2A 2EKYA 3D6TB 1URRA 3CDUA 1GEHA 4JI4J 1U4BA 2PGCA 2RS2A 1VJQA 4NPOA 4K0KF 3BPSP 3TEHB 4CLWA 1RE1B 1B0TA 1F60B 5KG6A 3ISZA 1GK8A 1HNZJ 1P9QC 3QFHA 4I1TA 1B99A 2LECA 2MGZB 1Y11A 4NMLA 2IA0A 3AD7C 4EBCA 1MNEA 3MM7B 5ETRA 3HVAA 1WACA 3TAQA 5IQ6A 3ZZPA 1HQ2A 2OIHA 1D9AA 1T02A 2YWHA 1TKTA 4ZLNA 1T94A 1WI6A 4WFXA 1DFDA 3K8VA 1VQYA 1JLAA 4IH5A 1HNIA 4GVBA 1IM4A 1IJEB 4WU2A 2EFOA 3G87A 1RU1A 4LSLB 3JYTA 4O23A 1FT8A 2MXYA 5E33A 2C2ZB 3VGVA 2CQ2A 2MQMA 3PY8A 5EHHA 4B9UA 4FBTA 4USJC 4N56A 4D3GA 2KO1A 3PVXA 4PG5A 4P7VA 3PO4A 1KDNA 4RUBA 5AJ3J 5AXMA 5DG7A 4IO9Q 4TY8A 2IHR1 2R7UA 2XQCA 4PZVA 3KHLA 2X3GA 7AT1B 3KLGB 4LSNA 4CM0A 2E7XA 2FGOA 3VF0B 2KFZA 3BO4A 2V2ZA 4PR6A 4ZKAA 1GQEA 1HA1A 4N8OA 2YKPA 3FZBA 4W92B 1NK8A 4QIGA 3K5PA 2KG1A 1RLDA 4TXSA 2MKJA 3UO0A 1WHVA 2FLLA 3EXCX 3F44A 1P1TA 2HVZA 2XWXA 2R8IA 3V4MA 2E5JA 5ETNA 3G2XA 3PYGA 2RU3A 3BN7A 1VQ5S 3C8YA 4ETZA 3R5DA 2NQPA 2FQQB 1RTIA 1QY7A 3BR8A 2C3MA 1S0MA 3BJYA 3MPDA 3PKYA 4NA1A 1CVJA 3UD5A 4F26A 2FHKA 2RRBA 2EG2A 2BACA 4KBIA 2BX6A 1SUQA 1YKWA 4DU7A 4J9LA 1VBZA 2J9DE 4WYLA 3HJFA 3H5UA 4USUA 2JNJA 2FHJA 1DLOA 2HMIA 4L73A 3V6DA 1SJ3P 4URSA 2RIJA 4DFKA 2X7IA 1CQMA 4NXMJ 1CJUA 2Z0GA 1RTZA 1W26A 4ZHRB 1VQMS 3DXSX 2XYPB 2UXBF 1RLCL 1QSSA 4ELTA 3OTEA 2DXEA 1I5OB 1VMBA 5A2QU 3CCJS 3G71S 3I0SA 3M6UA 4Z7CA 4EK2A 2OLWA 3TJAA 4ZJOA 4HVZA 4DJBA 3D6FB 5A8WA 2W1BA 5HVHA 1X9SA 5ETVA 3R5JB 3ZZ0A 2B9EA 1REVA 1S79A 3W1YC 3TZXA 1R7IA 1S1TA 1FXRA 1MMLA 2OUGA 4ZOSA 1QM9A 2AYMA 3QWPA 1FD8A 3G4SS 4I2QA 3GIJA 4LIRA 2HNDB 4ZK7M 3AJDA 1TKXB 5EX3A 1RBLA 4KQZA 2ZITA 2CWXA 1HYSA 2MSSA 3UPFA 3FRZA 3RRKA 2OFHX 2OPRA 1AROP 3CW2C 3IMQJ 3P4UB 3AOCA 1X5PA 3PJWA 3JSMB 3ENQA 4ER8A 3OL9A 2QYCA 3L3CA 4Y2IA 1QSLA 2XSJB 2KRRA 2DGSA 5KFZA 4ECZA 3PM9A 1VS3A 4RW9B 4CT9A 3C14B 5J2QA 2GCFA 3TAMA 1H2VZ 3GSIA 2Z56B 3MGJA 3H5SA 2P9GA 1MN9A 2CZVC 4GO7X 2BJDA 3PR4A 1U26A 2YH1A 4WBFA 4RU9A 2RKIA 2YKQA 3SQGB 3HVRA 1K1SA 1LWFA 2BE7D 1WSVA 1RKIA 3KOAA 6AT1B 2AEFA 4KYZA 2XCPA 1IR0A 4KFBB 2I5JB 4OHVA 4CYUB 4DN9A 4CH7A 2UVUA 4J37A 2C22A 2VKRA 2GVDA 4DZ6A 5HAOA 1RT4B 2NXCA 4QCLA 4LF6J 2OJ3A 4ZDNA 4EYIB 2CQCA 3L95X 4BS2A 4EO8A 5J2NB 2BJ8A 3KK3A 2Q6CA 4L6V3 4NLPA 1S57A 4X4VA 5DG9A 4HH1A 2B0GA 3KLIA 3FEXB 3R6LB 1S9GB 2V5HG 4JI7J 1JMTA 5FDLB 5HP1A 4X66J 3NEKA 3BM7A 2CNNB 5MLCV 1IWAA 1TZ0A 2GZOA 2R2UA 1F3FA 3KJQB 4XO0A 3OT9A 2BJ7A 1HNWF 1ZPWX 1UJ4A 4OZNA 2CDRB 3G8QA 3H8YA 5KOXA 3QJPA 4CT8A 2APOA 4MKAA 4DR4J 3W2WA 4PYDA 4ECTA 4KAIA 4NLSA 4DR3J 1LV5A 3T1HF 3HI9A 2V9KA 1T9XA 4CTAA 1LXJA 2HW3A 1RQ0A 4ELVA 3W9JA 3FMWA 4G3IA 5MAOA 3VZHA 4C11B 4JI4F 5KG5A 4Y0FA 3W9IA 4JI1J 3WC0A 3RZAA 2RUSA 2Y0BB 2JFKA 1TK8A 1HNZF 2HHUA 4BC7A 3ZNUA 3P96A 1BQNA 1CULA 3ET6B 3FBEA 2DHGA 1RK8A 1JLBB 2AP6A 1BWEA 3MFIA 2W9BA 2VG7A 1SC6A 3VVTA 3OR2A 2W2QP 2DBBA 3V5RA 1OYDA 1QTNB 4L3NA 3H59A 3I9ZA 4YB5A 4LJMA 4O44B 2C3UA 1HNVB 4JBCA 2IRUA 2NXEA 5T7LA 4NYOA 1KVKA 1KONA 4DN0A 2HRYA 1RABB 4ES2A 2EVZA 3SSSA 5IT9U 5LJ3Y 4YMEA 3X3UA 1VBYA 2NPIA 1TAQA 4DLEA 3LUYA 1HQEB 1OY6A 3PYDA 1NMEB 4LRCA 2Y3YA 3V6HA 2HWTA 3DRYA 3BKUA 1SV5B 5AJ3F 3ISNC 1HR0J 2DJWA 4OYWA 3Q22A 4WFZA 2FLOA 3TJ8A 4DSFA 5HMXA 5H9FK 1IWGA 1FRXA 3CJ2A 5L1KA 2HZVA 1W2BR 4NLGA 2ZOFA 2HLTA 1Z1ZA 2K3IA 4ITSA 3D0GE 4C97A 3DLGA 3QYYA 3OFFA 2V8DA 2GJFA 3IWXA 1VHFA 1NK0A 3GG0A 3D7SB 3UVJB 4J9MA 5AT1B 3TW0A 5A8KB 3JAMY 3PKMA 4IRDA 1FKOA 1Q53A 1O8BA 3GLJA 3CJKB 2G13A 1YTYA 3W7BA 1IBMJ 1OJ4A 2ALZA 1MU2A 1TL7B 2PSZA 3BSOA 5IM0A 4IKAA 3RGIA 4LF1A 4M5LA 3FFIA 2CG4A 3L09A 2UUWA 3K2YA 2IFXA 3MECB 2K7KA 5U47A 2W01A 2NR0A 4ED6A 3GSDA 4CLLA 3EZUA 3MDFA 3NG8A 4P73A 2XMTA 3DOMA 1QAIA 1DAXA 3DFEA 3BBFA 4WFYA 4DFJA 1WC6A 1OYEA 1EP4A 1N5VA 3VAFA 1HWJA 1U2FA 4RNHA 3GZ7A 3IR6B 3V2UC 4B08A 2F5GA 1X5SA 1FTRA 4NXMF 3H7HB 3H25A 1GXLA 3CCUS 3H42A 3G82A 4QPXA 2C3YA 5LL6d 1G2EA 4M5NA 5KG0A 5K9FA 3FZ2A 1EX8A 5HVGA 4CWBA 1KFDA 2A18A 4DV2J 1U24A 3DLJA 1U1OA 4C6AA 3MFHA 2DNYA 1S4FA 4NRTA 1Y0HA 2RB7A 4DOZA 2OO4A 4B9TA 2VICA 4IFYA 3RBZA 3EICA 1V6HA 5KFSA 4J9KA 5IWAF 3LAKA 2IJFA 4WIIA 4A8YA 3P3DA 2DRAA 3RBEA 1DTQA 2ZH4A 4RW7A 3DLBA 5DZ7A 2Q79A 4F2SA 4ID8A 2WRMA 4K59A 1QAXA 1FERA 2R8GA 4YY3F 4IG3B 2R7QA 1Q8LA 2RH3A 2RF2A 1IBLF 3O2IA 1VQLS 1NZ8A 1C0UB 2CXEA 4DR1J 4K2JA 2EI5A 5EWFA 2W2OP 1XMQJ 2CQDA 4EGLA 3M2RA 3GIMA 1CLFA 2ZH1A 1JIHA 3HFZB 2Z4PA 3GMGA 1L5UA 3VCDA 4E8UA 2HYIB 5KFDA 3CGIA 4X62J 2HQIA 1LW0B 3T19A 2R8HA 4OLOA 2CQ4A 3EGWB 4C3LA 1NBEB 4EZ9A 4LVOP 1OY8A 2R7TA 3M2UB 3JSRA 2MQLA 3M8QA 1N56A 2WSCC 1JKHB 3FQLA 1RYRA 1IJFB 3DGVA 2QFIA 1SKWA 4DX5A 5IXUA 2NREA 4XDDA 4NYPA 1HD0A 1BGXT 1NH8A 3DRSA 4ENOA 3GP9A 1FNXH 4ALZA 1AUSL 4F8RA 4NCAA 1CS4A 1TKDA 1CJKB 3D1HA 4N7TA 4KGZB 2J9DA 1LNQA 2AX1A 1FXDA 2Q6BA 1JLGA 4ZP7A 3OW2R 3MM8B 2KJWA 4JI7F 1NJYA 3W5ZA 4X66F 4X4TA 1A6LA 5AXLA 2HFUA 3D2WA 1F5CA 1E6YB 3DLEB 5IC6B 1HBUA 3GB0A 2KVIA 2K1RB 4QWEA 3OTOF 1VRTB 3QGPA 2VC1A 2EKNA 3VALA 4AT1B 2ZM6J 5HANA 1RAAB 2KG0A 1FF2A 2J0QD 2NZ4A 4DR4F 1UEKA 4MT1A 2HS0A 2ZNYA 4ZP8A 4A8OA 1H2UX 5JMNA 2PMWA 1B7FA 4LT6A 3OFEA 5KFGA 1B0VA 4DR3F 3K57A 4KHRA 1S0VA 6FDRA 1PIEA 2O1PA 3NP5A 2QG9B 1YJWS 2HVDA 2BM0A 2V4QA 3QT7A 3W60A 1C0TB 3HSJA 3AD9C 3GFZA 4JI1F 2GHVC 1ITPA 4A4JA 1DBDA 4DPYA 3CT9A 3W8PA 3TZYA 2OEJA 2M8HA 4DFPA 3MOJB 2ADBA 4TU8A 1T03A 2W4DA 2IAJB 4QW8A 1VBXA 3DM2A 1KBRA 2DR5A 4A47A 1H38A 2V2VA 1AUDA 3EYZA 4KV8B 2LP4A 3KG0A 2GO9A 2AGOA 1RWXB 4DFMA 3HVWA 1TR0A 3S8SA 1RUSA 2EW9A 3IM8A 2K3KA 1M5SA 2EK1A 2E1RA 4B9VA 2V4JB 3LWMA 1RBAA 4YR2A 1VQPS 1WOPA 2CADA 3KUEA 4F3QA 3R8YA 3GIKA 3E51A 4FVMA 3G8TA 1OWXA 1FRMA 4RWXA 1HBOB 1EB0A 1R0CB 4CH0S 3M6VA 3VAHA 2K8GA 2AMCB 2DYAA 5D3GB 5LT5A 1ZTWA 1XK8A 4KO0A 2ZEJA 2XYGB 3OSNA 2HNDA 4YOEA 2BZ2A 5F8LA 1HLWA 1SI9A 1RAHB 2G1HA 3OSPA 3GONA 5H9EJ 4U7UD 3OL8A 3OVBA 1XJWB 2Z2LA 3TUIC 1WDTA 2WB4A 4Q45A 2JLEA 2XSJA 2RAQA 1RB0A 2IY5B 3TO8A 5FJ4A 1M5OC 5J2PA 3C14A 2XMAA 4WKRA 1AT1B 3OLAA 4HR2A 2DGOA 5B0DA 1IBMF 2RVJA 4K4ZA 2V4RA 1UVIA 4DF8A 3UW1A 5E5NA 2KT2A 2K7JA 2Q66A 1S1VB 2YKOA 3RBXA 1SBRA 4DV7J 3MF5A 4DX6A 1VK8A 1TL1A 3OFGA 4NMXA 5ETKA 5E41A 3KLHB 2HURA 1JLQA 3AQOA 5HQMA 5CCLA 2MHEA 4U6PA 1T05B 2OPPB 3I4HX 3OHBA 1Y5NB 5I42B 1YHQS 1RT4A 1TK0A 1S6OA 1W25A 4U8VA 2JC0A 3CDBA 2XY7A 4IG0A 5E3RA 4X84A 3QGHA 2GFFA 2FD2A 4NEZA 3KDOA 1KP6A 5ETPA 1NK4A 2WW8A 4DV2F 1RT3B 3HX9A 4QU6A 1X4AA 2QX0A 4QPTA 2YNGA 4DUTA 3QFWA 2VQFF 4X65F 3D1QA 3OR1A 2VFUA 1I51B 2HHQA 1JLCA 2AKWB 5HATA 4FZVA 4MK9A 4I7FB 4ZN1A 2N3LA 1TFYA 5EDWA 1KS2A 1R8HA 4MK7A 4O3OA 4PCQA 5F3TA 4CO2A 1Q82T 4B3SJ 3X1LB 2L3MA 1YWXA 3MMCA 1PYOB 4NASA 4NI2B 1LWCB 1HI1A 4DSLA 4P2XA 2DXDA 2E44A 3QAEA 4RW4A 3L7OA 2DR7A 1NSPA 1WI8A 2SXLA 3OFHA 4DR1F 3OJUA 1FI4A 3N6MA 3H5XA 2XMKA 3IRXB 2J9EA 2DHAA 3CJ5A 2QA4G 1SCJB 2MKCA 2W9CB 1K8AT 2OTJS 1TL3B 3H4BA 1D8ZA 4CLUA 2B4OA 4HLBA 2MQPA 1KNZA 4K5SA 3M8PB 4X64J 4Y2MA 4ZVQB 2ZH6A 2XY6A 2AZ1A 1U6ZA 3EVMA 1X5TA 3ZTQA 4DG1A 1WHWA 3DKDA 3SCLE 3AFGA 3GJSB 2GMLA 1EHWA 5HQ8A 3V6JA 3SDEA 2W25A 2ZJRQ 2H4YB 4MKVA 4MMOA 2XHCA 1R6VA 3OL6A 3DMJB 3MCSA 2P6TA 3OTBA 4JI5J 1C1CA 2E5IA 2KKHA 2CPXA 1X9MA 3IM9A 4ZJLA 2AHOB 2C28A 2NPFA 2Z2YB 4USWA 3H20A 2H3EB 4RW8B 1RT1A 4AXIA 4CH1A 4M8LA 3Q89A 3RR7A 2HIQA 1U6BA 1NU4A 5ETLA 3DYAB 3BGFA 3BSCA 3DRPB 1WC5A 5K8OA 2Y8WA 1FE4A 1NCLA 1S6PB 5A0YA 2C2RA 4NA3A 3PV8A 2BV3A 1U02A 3GCWP 3G6XA 1WTBA 1T11A 4FPIA 1TAUA 4C8KA 4NX9A 2JSXA 3MUTP 4F4ZA 1KSPA 2ZM6F 4OZ3A 2OTLS 5A8KA 2AJ2A 1HMVB 3FVYA 2KM8C 3AJ2A 4DU8A 2U1AA 3H98A 5G0RA 1JLEA 1YITS 3UQSA 4UF4A 3RAQA 1JWWA 3DU6A 3M30A 2QE5A 3GYXB 3CDEA 3PHTA 4HKQA 4J9OA 3MR2A 2B9YA 4RZRA 4OYZA 5KT2A 3Q23A 4O3SA 1E6VA 4FXVA 4F4XA 3DDIA 1H73A 4DPXA 1CJVB 3VQSA 5JVHQ 2LQJA 2AX0A 3HHLB 1XMOJ 2OMLA 3T3FA 2ILYA 4NLTA 4LQ9A 3KG4A 1YVFA 4OHXA 4HTIA 3A8KA 1IR1A 5EUHA 4C4WA 2BM1A 2GAGC 1Y4ZB 2GHPA 5KFLA 1HQUB 5GADI 2DGTA 2X3DA 2RQ4A 1V5VA 3MMAB 3KLEB 3ZTPA 3QZ8A 3FMBA 3CJ0A 3EZOA 1GNKA 1TELA 2E1PA 2D69A 3IG1B 4MIBA 4FVCA 1U1QA 5IQQA 3PW7A 2ZDOA 2UP1A 3POTA 2V50A 4WWSA 3CC4S 2CRLA 1EQ0A 2FY1A 3IGNA 4DV4J 4K4VA 4L3KA 2J6SA 2HQ3A 4ED5A 4JI2F 3PFEA 2L9DA 3NAHA 3UN3A 1UEUA 5ETTA 4M5DB 2BXJA 5IV3A 1TMMA 4CNYA 4UY85 4ECVA 3FCHA 4K4YA 2JEIA 3CF5Q 1P9YA 5JUMA 2QGFB 4OI4A 2QIFA 4EO6A 4R8UA 1HBNB 1FO1A 2CJ9A 4K4TA 4C8YA 3M6XA 2Y1JA 1JXVA 2ASJA 4UOGA 2B7CB 3TUPA 4ID5A 4GO5X 3NS5A 1M5KC 2MY7A 1S9EA 3MEGB 3ZZUA 2XLIA 1GX5A 3TUZC 1PYSB 2VJUA 1TUWA 3I96A 3NAIA 3BH7B 2M70A 4G1PA 2HFVA 3D68A 2VHGA 4PRFA 1T95A 2YBVA 2VDIA 4ILLA 1FKPA 5BR8J 1QVFR 4DV7F 4B17A 1YBAA 1O51A 1QUPA 1RDRA 5I3UB 4K7QA 2W2NP 2YWEA 1JKHA 4Q0BA 3QRPA 3CDWA 1BWVA 3FBBA 4AL7A 1WHYA 2XNQA 3NWGA 4TY9A 4ECWA 1SQEA 2V68A 1IBCB 2D7SA 2D3OR 3LO3A 2H65B 1ZM4A 2FUG9 5KOWA 2PA3A 1CJKA 3N5FA 5D6GA 1PCAA 3PIOQ 4NLOA 1SJRA 2DH7A 4KY3A 2CNKB 2RMLA 4L76A 2GIRA 4EMDA 2B9WA 1UFWA 4ANCA 1XMBA 1S59A 1VCTA 4WE1B 2A6OA 3ZNJ1 5KG4A 4TNOA 4ZLPA 3NMAA 1SC3B 4G1IA 2BJ3A 4ED1A 3CTRA 1N4LA 3SZ2A 2IM2A 1TFWA 4KRWA 1K0TA 1WDDA 2W8KA 3JTOA 4NRUA 2RD5C 3LP0A 1VQKS 4I6YA 4Y2AA 4ANDA 1B70B 5LSLA 4QR2A 4NZ7A 5SZTA 5B0FA 1TVRA 2CPZA 8ATCB 1YJ7A 4NZ6A 3LP2B 1Q78A 1ZETA 4GKJJ 2EC0A 1VRUB 2VASA 4R0JA 1IQZA 3M2VB 2J9CA 4KH1B 3K5LA 2CUYA 1P8GA 3ZZYA 1UFLA 3HSDA 2CZ4A 4RUCA 2BDPA 2VDHA 1DTTB 2GVZA 4YP3A 1TK5A 4R0EA 3TX8A 4X64F 1RTDA 1ELOA 2Z2ZA 3GR0A 4DUYJ 3DOKB 3EJMA 3KTQA 4ZCKA 4P71A 4DDFA 3K7RA 3Q8YA 3DOLA 1AFJA 5IOLA 1FHTA 1RT5B 1B3TA 3DGPA 2DY9A 2F8EX 3HM9A 1EIYB 5AXKA 3R5BA 1FNOA 2N4DA 2R42A 4DUZJ 2F63A 4WJBA 2VA2A 2HHWA 4K2XA 1CSJA 4RNNA 1Y5LB 2VG6B 3A12A 2KDOA 1QLNA 2W8LA 4PXBA 5IC4B 4A46A 4F4AA 3CE8A 3L9ZA 4DR6J 4ZVEA 5K14B 3MAAB 1WEXA 3T9ZA 3QNWB 4KHPJ 3Q8RB 5L46A 4F2RA 1N8RT 2YNIB 5DETA 1UKUA 4ZVOB 4JV2A 3NGKA 4Q7AA 4NXNF 2E7WA 3KKFA 3ETMA 4YB1P 3C2PA 4WZQA 2B6AA 4LF4J 2BJ1A 2O3DA 2KYZA 1YJTA 3OXGA 3CC7S 3ZXWA 4MIWA 3IWLA 4J7CA 3RU0A 3FRYA 1OO0B 3KJVB 2C2DA 1QAYA 4KKOA 2JEFA 1F2GA 3I5AA 1WTFA 1YRXA 3E2EA 1HW9A 2IC3B 1SL0A 4L74A 2FJWA 5HBMB 2DRDA 1IKXB 2AW0A 4RX6A 3U02A 4M5JA 5D4PA 3CCES 2HRUA 3MM5B 2CNLB 4PQAA 1UVMA 5D4LA 3GFXA 2AU0A 4MKYA 2DK2A 4LRDA 1IKWA 3MPUB 3SV3A 5IT4A 1H74A 2NXJA 1RHKB 3HPOA 4BWJA 5BYSA 1C4CA 1YJ9S 4EZ6A 4DV3J 3MMBA 2WCXA 4DCOB 2DGUA 2FPHX 1YZ6A 1ZYQA 3OVAA 5CA5A 3V4IB 1IKVB 1RT3A 2VV5A 4WFNQ 5EN1A 1RHJB 1YJVA 3HCXA 5JVGQ 2CNOB 2B4UA 1HHTP 1Q8KA 3IBCB 2MMYA 2ALYB 2KJVA 3BDEA 2XWYA 3UDLA 5LOQA 4CZCA 2WZ1A 4O0IA 2HHPA 2HEKA 3W63A 1RT7B 4LBPA 3HHLD 1FDDA 1RWMB 1ZA2B 3MAQA 4JI6J 5T41A 2DNHA 3SV4A 5FLXU 4USHA 3VGUA 5CD4H 4HT5A 2QFJA 4RL1A 2YNFA 3NRBA 1EKSA 4DPOA 3FJ2A 4ZVRB 4LRFA 4B3OB 4M94A 1SH3A 4OJGA 4ES1A 2BANB 2JX2A 3AA8A 3LP1B 5M2RA 2BOPA 2DHSA 1OSCA 3DXBA 4YEAA 3VZIA 4QW9A 1UZHA 1TP7A 4TLRA 3MZIA 4PUOA 2P6SA 5KFPA 4QQBA 3SFUA 5J1EB 2QL9B 1TL3A 1RAJA 3NNCA 3BO2A 3L7PA 2YKNA 4X4QA 5F8HA 2A6MA 4LR9A 5KFVA 2WONB 1X4FA 3RAMA 1IQTA 1X0FA 4X4UA 4N5SA 2QYGA 2DD8S 2MLZA 2M88A 3VAGA 1HBMB 1FRJA 3W66A 3ELHA 3CNQP 2FJDB 5BR8F 4ZS6A 1WOSA 3J81Y 2IM3A 3MR6A 2M0GB 3KNGA 2IPOB 1UL3A 3UR0A 2LDYA 3CWJA 1V3SA 4ICLA 3J7YI 3HKZD 1NKEA 3GFYA 4DQQA 4N41A 1K44A 2ABYA 2EBGA 3PW2A 2ATCB 5ETQA 3NGSA 3Q8SB 3ZTSA 4B3RJ 2MQ8A 1OPZA 4H4KC 1GMVA 3EXYA 1C1BB 3MUVP 3UI3A 1FKAF 2GNKA 1JXEA 3MM6B 2MDAA 3MAHA 3MM9A 3FGVA 1ZTTA 3EGVA 4I0WA 1H72C 1RHRB 3DRPA 4KH0B 2X1AA 4UY8T 4QWCA 2HFNA 1S6PA 2ZWOA 3E3XA 2X51A 2R7RA 4ZPDA 3PTWA 1RADB 4DV6J 2C2KB 5C42B 3NY0A 3M8RA 4O4GA 3ITHB 3N28A 1KQKA 3AH6A 1VHIA 2IIHA 2V8VA 4RW6A 1PJ6A 2VZ9A 2GGPA 4HHHA 1MWQA 2QL5B 1BQMA 3HK2A 1UW9A 3K0JA 4ZPVR 5B0CA 3CPWR 3A13A 3JAMU 2PFFB 3BZQA 2ZVIA 4JV5F 3QLHB 1RHQB 3T6BA 2ZJQQ 1YQHA 4OI1A 2VFTA 2XULA 2OSRA 1N48A 3MCOA 2I8EA 2CJBA 2MKHA 2LA4A 4RKUC 5CYQA 4DQPA 4ED3A 1QE1B 3N4WA 2PIIA 4P2SA 2ZHBA 4TU9A 2GQCA 2MHNA 4M5IA 2DIVA 4FF1A 5H9EK 2I38A 1S0OA 2H51B 1WF0A 4KC5A 2B9XA 3WIUA 5B08A 3JQKA 2EFPA 3SSQA 4DR7J 1U0HB 4M1KA 2Y0SD 1S1WA 5K20B 1R8AA 4B9SA 2E5HA 5HSPA 1RYSA 1RT6B 5CYMB 2B5JA 3QMQA 4JB8B 3PZPA 5KFHA 1JLFB 3UDCA 5AXNA 4PQUB 2GHWA 4R5PB 1K73T 1T9YA 1SJ4P 2DITA 4LQ3A 2E5GA 5I4MA 2DGWA 2YX7A 3K58A 2WHOA 2QMUB 2XBPA 2DNQA 5L9NA 2UXBJ 1R0AB 2Z58B 4M5DA 1MWZA 5B0GA 3R6GB 3G8SA 4DUZF 2FJAB 2IA6A 2PEHA 1AZSB 2BA9A 1S1XA 4BCAA 3QZ7A 1T9VA 4IOBA 2CVEA 3D28A 4PWDA 1RWVB 1F9EB 4X2BA 1U2RA 4OHYA 3I4PA 2MSTA 1BD6A 1RT2A 3MEDB 4DXLA 4ZVTB 3C46A 2KB2A 2LQ8A 3CULA 4BBYA 3AXMA 1RCXB 1H0HB 1RAFB 2PA8D 4JOUA 3GQCA 4F04B 2QO3A 3HT0A 3QO9A 1HNXF 3VAMA 3D3BJ 1VJWA 1XNRF 2V8PA 1HL6A 3FEZA 3R27A 4ETXA 4UT4A 4I2PB 2G2YA 2H1YA 4OHZA 3GV8B 4Q8FA 4YB6A 2UUCJ 1U1KA 1GMWA 3IBFB 1IKYB 1S6QA 1LK7A 2RDJA 2BJEA 3D54A 1F6TA 1GXTA 4ZP6A 4DPTA 5KT4A 2BKPA 1A0OB 1R0BG 4DV5F 5GAHU 2E1AA 2OPQB 4H4OA 4UTGA 1NRKA 1R31A 2BOAA 1FEEA 3I6PA 1VQ8S 3MR7A 3VQTA 4DV3F 4O3QA 3O44A 3OUYA 4QIFA 1QUVA 3W62A 3DLLQ 4USMA 2GIFA 4EYHB 3D9BA 1KC8T 2DGVA 2BQ3A 2DISA 3OQ2A 3PW4A 2BE9B 4WYWA 3AOBA 1N6QB 2MKYA 1JNZB 3OPKA 2CFXA 4IYQA 5E7OB 2DGQA 2KFYA 1YJRA 4KGKA 3THVA 1H98A 3LPEA 3NOCA 4WKYA 2GMHA 1MG7A 2OP5A 2MY8A 2YKMA 3G9CA 5GAGU 2WOMA 2YNHB 3E8OA 1FX2A 3ZO7A 1SH0A 5HO4A 1CBKA 3BGRA 3MR3A 3NL0A 5DLGA 1NSKL 1R43A 3IS9B 4ZP9A 3NCPA 4JI6F 4JUZA 3PO5A 1J27A 3I5BA 2HHSA 1FRHA 2M7SA 4RO0A 3I0RB 1MW7A 1UWBB 1JJ4A 3DI6B 3G86A 1HNWJ 1YDLA 1LWEB 3I5CA 3EPGA 3HJVA 3TZZA 4DL5A 3KK1B 1I1GA 1N5YA 2DB1A 4I69A 1M1HA 3BQ0A 2IBKA 4ED8A 2QA1A 3QIPB 1ZBTA 3LAMA 1SJQA 3HT3A 3C15B 2YQ1A 5CQGA 2O01C 1O0PA 3FDSA 3T1HJ 1NEEA 2HFOA 2PD1A 4DQSA 3VWSA 4UUXA 1DTTA 3I56S 4DPWA 3TVKA 2KZMA 2OMOA 1KLMB 1UWAA 3HVTB 2OH2A 5EWEA 3NGUA 1CC8A 3AD8C 2HVIA 2EG1A 2XB2D 4CLSA 4RR5A 5F8NA 5A6WA 5C25B 3MR5A 2ZE2A 5F0WA 3CMAS 3O1LA 2PN6A 3KLVA 1F2HA 4Q5VA 1VQ9S 1EETB 2FVPA 4IRKA 4I6AA 4OX6A 3ENVA 3PIPQ 3DLKA 3CCRS 1JX4A 3NMRA 3B4MA 3S6EA 2ZFHA 4UOCA 1U49A 4OZ1A 2HGLA 1D0EA 3B4DA 4B3RF 1CJTA 2UXCF 2YWWA 2WVBA 4RBUA 1RSCA 1AFIA 2N7CA 1HARA 5DLFA 4X4PA 3I9V9 2R9LA 1FVSA 2HK2A 2D41A 2MKSA 3C6TB 1KTVA 5BXIA 4ES3A 2A1BA 3M9OB 4OZJA 4AQYF 1PYTA 2F9DA 2UZAA 5HVFA 4BC9A 3W61A 3VAKA 4X4NA 2BJ9A 4ZPCA 4DV6F 2DHHA 4QR0A 2JDJA 2HVEA 3A8JA 2XSFA 1Q7LB 1MROB 4P75A 2VBYA 3R7NB 3AHPA 5ETSA 2F65A 5J2MA 1X4BA 1Q0NA 2HNYB 3D3CJ 3M1VB 1HPZA 3TVYA 5L9XA 2R3VA 1ZH5A 3MEEA 2E5LJ 4LMZA 4NZ0A 3GWCA 3AJ1A 2O66A 1X4DA 2CQGA 2E7VA 2QLXA 4K4UA 3M8SA 2MZRA 2HHTA 3BGUA 2EC2A 2WVCA 2DY1A 3LH2S 4ECQA 3BSNA 2YKAA 3V81B 3SMZA 5GVQA 3JQJA 5HMWA 3EDQB 1X31C 1N88A 2Q3PA 3C6UA 3BPDA 2CQ1A 4WIQA 4Y00A 3J7ZT 2GA7A 4DR7F 3JTPA 1XNQF 1YI2S 3T41A 2PDAA 2MQQA 3M8ZA 2FC9A 3VAIA 1IKVA 4Y65A 4IOCQ 1T8EA 3A1YG 2DVIA 1FRKA 4EI2A 4G1QB 4F4YA 3D0IE 5KG2A 2HZAA 2DO4A 1W2IA 2R2SA 3BREA 2XLKA 1IN0A 2ZD1B 4Y28C 2F8MA 1R6YA 4PG7A 1WOOA 2DGXA 3KHHA 2DR6A 3K8WA 4KSEB 2GQQA 2OKQA 1LW2A 1RT7A 3OJSA 2JH3A 1NXIA 4P9SA 1X60A 3WC2A 4DHVA 4G6VB 4RWWA 1FRLA 3C16A 1NLKL 3N9UC 2JEGA 4KE5A 4P7TA 4LR8A 4ZVUB 2FDNA 5KFQA 3FCWA 1M5HA 3QT8A 4OIXA 2LQ5A 1HI8A 5IWAJ 3TQ1A 3P8BB 4EWTA 3SI8A 1A7GE 1TKTB 2MZSA 2XMJA 3GV7B 3A4TA 1F5BA 2Z30B 2HBZB 5EWGA 1AA1B 2XZDB 1JLAB 4C8OA 2CZ9A 1HNIB 2FYXA 3IGVA 4YY3J 2AWZA 4J9VA 1TKZA 3D66A 3BYPA 5KFEA 2AD9A 1IBLJ 5BYRA 2J0SD 3PX4A 3VR1A 3DDKA 1K47A 2UUCF 1H6KX 3KMSA 4F4WA 4AL5A 3PRDA 5KG1A 5C24A 2XI2A 4FS1A 1JQGA 2D3O1 4OX7A 2FB0A 3CD0A 3BYRA 9ATCB 4TY8B 3L4BC 4DR2F 5B09A 5RUBA 1R8BA 5FIIA 4LSNB 3PCOB 2M5YA 1Q8IA 1VQ6S 4ZLLA 1RTHA 3LQVA 2WW4A 4EUVA 4FXDA 2VFVA 4K50A 2QA4S 5SUHA 3E01A 3FUYA 2YX1A 3J7AN 2E29A 1RJJA 1SJ1A 4JI0J 5D4OA 3ENWA 1APSA 4ECRA 4U96A 3H2UB 1J5OA 1YJNS 4LF8F 1F0XA 5AE2A 3PEJA 2XM3A 1UETA 3CVKA 1RTIB 1YG0A 2GX8A 3KLFA 2CJXB 2NZCA 3H5YA 1H7WA 2RS8A 1S4EA 2BMBA 4DX8H 2YH0A 2DNGA 1SUQB 2N3OA 4OZ2A 5KT5A 5H9FJ 3MXHP 4DL4A 1Q86T 4DQRA 2HPUA 4J9QA 5B0BA 1B7YB 2ZHAA 4CNZA 2FVQA 3OTOJ 3NBPA 1DLOB 1PGZA 2HMIB 2BRLA 3V6DB 2OHDA 4H54A 3CJ8A 1CJUB 1QE1A 5FLXY 4DWIA 4LF7F 3UFCX 3DRRB 2XGPA 2P2CB 3I0SB 1MSWD 1QTMA 4LUBA 2O67A 1N34J 4JV0A 2BE2A 3LANA 5A8WB 1PO6A 3GPAA 3RBDA 5D77A 1D9DA 5IFMA 1FE0A 4G65A 2P8IA 5DO2A 1REVB 5L1JA 2EWHA 1RA6A 4QR1A 1S1TB 2OPSA 2V8GA 4WCEQ 4I2QB 4L75A 3PW0A 1U7LA 4PG8A 1PJ7A 3AY0A 1DJ0A 1UP1A 4U95A 1N5QA 2YWFA 1HYSB 4X4RA 1PBAA 1NJWA 2G0IA 4FKYA 3VV2B 1KWMA 5GADU 4YR3A 2OPRB 3IP0A 1YRTA 4IDKA 3OLBA 5LSOA 1O5JA 4AD6A 1ZAXA 5DDPC 2UXDF 1AZSA 2HK3A 1ZS6A 3ILIA 1BQXA 4YS2A 5CZVA 1RA7A 3TA0A 2J6UA 1HHQA 1F1BB 2VD3A 2H5JB 3KMQA 3B78A 3TAMB 1D1UA 3QPIA 4N76A 3T5KA 1RWNB 4B3MF 2CKWA 4A48A 4TQSA 4WPAA 3CEDA 4N47A 4Y34A 2RKIB 4Z7YA 1TL4A 1FK9A 1LWFB 4QOTA 5BYQA 3R2CJ 3AB2B 1IUJA 4I2PA 1RZMA 2W2PP 2H5IB 2Y1IA 5KFKA 3GR1A 1FNMA 1GTHA 2XCAA 4A8SA 3QT6A 5KFFA 3DCAA 1D09B 2VPWB 3EZ5A 1UVNA 2GVDB 2E5LF 3UWTA 2VQEF 2VONA 3KK3B 1WKLA 4ATNA 4J9SA 3LA0A 4ECUA 2UU9J 3F0NA 3KLIB 1QD1A 3R5AA 5HP1B 1L3SA 4P52A 1UJ6A 4EBEA 2ZOMA 1QSYA 3ISND 1UMJA 1L3TA 3T6JA 2V0NA 2KH9A 1Q8BA 3W5YA 5AE3A 1WKKA 5KFOA 4LFCJ 3WBZA 1JK9B 2QLFB 2HFZA 5L1LA 3QJLA 3ILJA 4MYTA 1Q5YA 1S77D 4BDPA 4CTAB 1T3NA 2CDQA 3R7BB 5KG7A 2YNHA 2HAIA 1GFWB 2JLGA 3A3OB 5DDQC 4USVA 2KL8A 3OBIA 4WK3A 3OD2A 3CXCR 4YQWA 2I2YA 3LWLA 1NKBA 4F7VA 3TOQA 1VQOS 3CB4A 4H4MA 2WSFC 2IDEA 2A3JA 1KR4A 2VA3A 2VQFJ 4K4WA 4X65J 1FXLA 4Q43A 2NUUG 3HLUA 3Q83A 1BQNB 1CULB 5M2PA 1N5TA 4QWBA 2CPEA 2JRSA 5CD4A 3TWZA 1NNDA 1KN6A 2W9BB 1PG5B 2XGQA 1X4HA 2VG7B 4QBUA 3C15A 3OR2B 2VG5A 1YIJS 3Q2TC 2GQ2A 3CJ3A 3MEKA 1SQFA 4YR0A 3U1LA 5HROA 1TV6A 3RW7A 2HQCA 5T7LB 4M5GA 4A8XA 3TA1A 1X5OA 3TRGA 5HN0A 2C2OB 4F02A 1KLMA 4Y2KA 2NS1B 4J90A 4KGVB 2CPDA 4NA2A 2H5EA 4HHJA 1VC6A 3HMJG 2MGZA 3PRBA 1L3UA 1MN7A 1R27B 5GAHI 1WWHA 2F3JA 1HHSA 3MM7A 3J7A1 3UN5A 3SCKE 2AIRB 1Q81T 2OELA 4FF3A 4LREA 2E9RX 4KT0C 2RE1A 4OV1A 2CPHA 1NDLA 4DEZA 4C3KA 1P6TA 4UQGA 4LSZB 3BF4A 3HSGA 2D9OA 2ZOGA 2JEJA 4HH0A 1RCOB 3DLGB 1EAYC 2QT7A 2C42A 4LSLA 2F4FA 1NZAA 4JI0F 4C2MA 3PFOA 4MKBA 3IR5B 1BUXA 3R5CA 2WSEC 2FLPA 2BEFA 2B4VA 2RHQB 5KAKA 5GAGI 2I0XA 4KJIA 2DNNA 3M32B 1MU2B 4FYDA 2UVWA 5IM0B 4F3OA 1LQ9A 1T3OA 4EFAC 2P9CA 3BH6B 3TYTA 3FFIB 3KLGA 1S9FA 5HJXA 4HDGA 1SXLA 3QBCA 3OXFA 4DV0F 3DOMB 1XIQA 1EP4B 2OGUA 2J0WA 4NLXA 2HNYA 3N0VA 4NEYA 3H40A 1LEOA 5DG8A 5KFWA 4FDFA 3IXQA 2R7XA 1FWLA 2E66A 1WC3A 2RJZA 2VU5A 1TQLA 2KM8B 3G82B 2G4BA 3UNGC 4XPCA 2PMZD 1Y5IB 5D78A 2HHXA 1KHVA 4HTJA 5L39A 1OY9A 1N34F 2LLZA 1QJHA 3NXZA 4QJVA 4NCBA 2FZGB 3ZFVA 1CC7A 2HHHJ 4HDHA 5JJBA 1U6FA 4IFYB 5D0RA 1R8CA 2J5AA 3R1LA 3OVSA 1N0VC 1SKUB 2F8HA 1J5EJ 1ZM3A 3FK4A 1RWUA 4TU7A 1BE4A 1B64A 3HZGA 2DH8A 3BKTA 4OV6A 1DTQB 4A8FA 2Y9HA 4RW7B 3CDAA 4OMFG 1R89A 4ZHRA 3CUNA 3SCIE 1F9HA 2MJNA 3RAXA 2AJQA 1NO8A 2DRBA 2RF2B 4AFFA 3FQKA 1T9UA 4V19J 3Q24A 5A8RB 4W98A 4CM2A 3UCUP 2XNRA 1OIAA 3M2RB 1KKHA 2L48A 1S0NA 4ELUA 4JV1A 2QJ3A 3RRHA 2VKZG 3TARA 4JI2J 4CLTA 3I55S 2HIYA 2WAQD 4ZVSB 2K06A 4YB7A 4BLGA 2Q1LA 4RNFA 2JWNA 4ZCIA 2JLFA 4DS4A 4WTYA 1U1NA 4V19X 2G2ZA 1RI7A 1TKXA 2KYXA 1WC0A 1N54B 3LGNA 2K2PA 4TVAB 3RYLA 2DKOB 1KOHA 2NYIA 1I94J 3M8QB 2LXFA 2ZH2A 5K8NA 4ANEA 1PC4A 3JSMA 1U8SA 3DRSB 2HG4A 3C66A 3UNYA 2R8JA 1N0UA 3TNVA 1CS4B 2KTQA 2OAUA 4RW9A 2RQCA 2W4PA 3WDOA 3J81U 2CG8A 1Z2LA 1JLGB 3MCNA 2C2EA 2UU9F 2XMVA 3HD1A 5E3AA 1D9FA 1MMDA 3U1MA 4F50A 1VRQC 5K8PA 3EUNA 3SQGA 3P45B 4KGXB 2UVVA 1HBUB 2N4CA 5CXTA 4OI2A 2XS5A 3MI7X 1S49A 4LFCF 2CPJA 1Y3JA 2NSCA 4KFBA 1YK9A 2I5JA 3FEYB 4CYUA 4I64A 4QIVA 2ZKTA 3MD1A 1AW0A 1DQAA 3J7YU 2IVYA 1WJ9A 2FHOB 3WX4A 3T5HA 5J2NA 3T1AA 5C2GA 4GC6A 2L08A 3ILOA 5F3ZA 5E3QA 4LFBF 3R9LA 2MQOA 3SXLA 1PJ5A 1S9GA 4J9RA 5FDLA 4IH7A 4WXWA 4ZIWA 2E1CA 2DNRA 3BGLA 2L41A 2IYGA 1T03B 4YHHJ 4DBQA 2POKA 2J7KA 1LFPA 2R2RA 3DM2B 2IRXA 3ETOA 2KU7A 4OJHA 4WZMA 4ZVGA 4DV1F 2ZH9A 3I31A 4ZN3A 2UVRA 4C0OC 3PR5B 5HI7A 3Q0AA 2QV6A 3HHKA 2EEYA 2FVCA 3DRRA 3ONQA 2YPZA 3MURP 2J7WA 4ZIVA 1WD6A 2CPIA 4HEA9 3CJQA 4PABA 3IRWP 4DL3A 2BW7A 2DT9A 2IJRA 1YBUA 3PW5A 4C11A 3K59A 1VLYA 4FP9A 4ZCMA 3BR9A 1Y9OA 1VQ4S 3BB5A 4C48A 2OEKA 2NSBA 4FF4A 2VOOA 1X4EA 2QMXA 4OYOA 2MZQA 3ET6A 1TU0B 4KO0B 5D4NA 3TUJC 1JLBA 2MQNA 2M9KA 1REGX 4F36A 4ZA1A 4DI6A 2G0CA 3LALA 2LU2A 2ZBRA 1FTCA 3N6LA 4IOAQ 4C0BA 1F9FA 4MYUA 4O44A 3QGIA 1HNVA 4HL9A 3S01A 2Z57B 4M5HA 4QIWD 2EFNA 1VQNS 3W9HA 3I87A 2A2CA 4I68A 2R7VA 1XTZA 4GRSA 1HQEA 1WKJA 4ECXA 2YVSA 2ZH3A 2VBWA 2GC8A 4LIWA 5F0UA 5J2PB 1FFWB 4O3NA 1SV5A 1D3WA 2AGQA 4UZBA 5HLFB 3CMES 4IQXA 3O3LA 1LK5A 4IUFA 2CJYB 4AL6A 1X7VA 2PT0A 3PG9A 1N32J 3HULA 4LRAA 3ZTOA 1IVZA 1X0PA 2LQ9A 1TL1B 4KPCA 3TJ9A 2HS3A 1TTHB 4F0KA 3HHEA 2ZBCA 1JLQB 1XR6A 2B4PA 2IVFB 1M5VC 3MTJA 2MYFA 3CCQS 3D0HE 3CO0P 2QSWA 3UVJA 4NXNJ 4HI1A 3GCXP 4ZITA 2MB0B 2CQ3A 4K4SA 1RWWB 2FVRA 3A8EA 2AV5A 4XK8C 4IG0B 1ZOTA 2CA9A 2BKOA 3CJKA 3GILA 4KIAA 1SIZA 1YZ7A 2DR9A 1TL7A 3RJMB 5GAEI 4OYBA 2KI2A 2MKIA 2YNGB 2HHHF 4OI3A 2HS4A 3CO9A 4KHMA 3MECA 1L3VA 3OR1B 2X1BA 4D3HA 3B6BA 4NL5A 2BW2A 1JLCB 5LXRA 4TKTA 1XERA 2L9WA 1J5EF 2WK4A 5DQIA 5E3PA 1SC4B 2UV8A 2PFDA 1NHVA 3MMCB 4ZPBA 5CYJA 4RUAA 2ZKUA 3JSBA 4U8YA 2ZJPQ 3QSYB 3M7VA 3M4XA 2XY5A 4RW4B 4C7QA 2DCLA 7FDRA 2DXFA 2KT5A 1U1MA 2ASLA 1WUUA 5DQHA 5DM6Q 3SBMA 3G6VA 4NLYA 3UDEA 3Q8PB 3J80Y 1DY3A 4LFAJ 1UJ5A 1RTJB 4RUHA 1EZZB 1VQSA 3EDRB 3D6MB 1VI7A 3JSYA 5F9LA 2DPIA 2LDIA 5LJ5Y 3ADAC 1BXNA 2DCUB 3N79A 5B7WA 4K4XA 1DQ8A 4P2MA 4PYAA 3W64A 2KXFA 3UR3C 1RHUB 5DJBA 3WHIA 1XQIA 5ETOA 3GG1A 4EU0A 4IG3A 4DG1B 4ZPWR 1UVKA 2PO4A 5FD1A 2D1CA 2HBYB 4TYAA 3SDEB 3TVZA 1SKSA 1I94F 1GXUA 3UCGA 4B9LA 2MZTA 2ZDPA 2QSFA 2WVFA 3CCZA 1C0UA 2RSQA 1Z2ZA 4ED2A 4LVNP 5DGAA 2FJEB 1C1CB 3BQ1A 3N01A 2VUGA 3W2VB 2VPYB 4IQMA 5J1PA 4GKKJ 3MWBA 3PEHA 2CQ0A 2QLJB 2ACYA 3HDSA 1T9WA 1WF2A 1RT1B 1G3OA 2HQFA 4C98A 3PDNA 3BO3A 2QTWA 3OHAA 3KUGA 2LCWA 3ZZRA 1LW0A 1WF1A 5A0YB 1DARA 1JNRB 2IYIA 1Y7PA 2QRRA 3QQCD 1NK6A 3M2UA 1T9TA 2YQ3A 3EGNA 1HKAA 3JS9A 4F3MA 4XIUA 1S6UA 4PAAA 4MIAA 3VVUA 4PXEA 4WK1A 4WP3A 3CIZA 3FSYA 5G0RB 1JLEB 3BKFA 1FDNA 2JC1A 2KRBA 4ZVFA 3BDPA 3M32A 2FVSA 1WG5A 3M30B 2ERRA 2VB6A 2DPJA 1FJGJ 1S76D 5ITHA 4RJVA 3CJTA 4J9PA 2EBEA 1OPIA 3NCQA 2UUTA 3MM8A 3FBFA 2XLJA 3R7SB 1E6VB 4HACB 2CQHA 4NLQA 4OHWA 4ZVPB 3MMJA 1SKRA 1E6YA 4QWAA 3DLEA 4YHHF 4DS5A 3IBWA 4I6WA 2K1RA 3P6YC 1GAOA 4E2FB 4EEYA 2R8KA 1VRTA 3U27A 1BMQB 1RBOB 1SJFA 3WQPA 2M3DA 1GTEA 1J2VA 5F8IA 2NCKL 4I4BA 2BYCA 3NOGA 2ZBIA 2QN6B 1W7WA 4OQJA 2MLYA 2AYBA 3SEOA 1U8WA 4JV5J 5LMNJ 2EFGA 2XS2A 1ZAVA 3POTB 1C0TA 3MTKA 5KFXA 2FGCA 1XR5A 4DSKA 1ZPVA 4NLUA 2VODA 1ZM2A 5L38A 3RW6A 3CJRA 3QT5A 5KFTA 5IT0A 4WP8A 2JOQA 2LEPA 4OI0A 2NXNA 2IAJA 3F41A 4PXDA 3ZZTA 4XDCA 1FVQA 2GW8A 1NM2A 3AQPA 4N77A 4O3RA 3AODA 1BY9A 4KV8A 2DEJA 1UFKA 3G96A 3DC2A 2XMWA 1R8PA 2GJIA 3QSIA 4R8UB 4NYZA 4W4MA 2V4JA 3NS7B 5IZHA 1KOOA 4ID5B 5A8RA 4LF5J 4LF2A 3M8YA 1AB8A 1EARA 1VC0A 3RRGA 3HHNB 2B7BB 1S9EB 2M4MA 3KUHA 4MJKA 1RAEB 2Y8YA 2FZKB 4PG6A 2FY8A 1HBOA 3BQ2A 1HWKA 2WBMA 2V2KA 2F9JA 4OFZA 1FDAA 3TX0A 5D3GA 4AYBD 1S72S 2ROPA 2O5DA 2CVIA 3QRRA 1ACMB 3BS9A 2D3ZA 1N32F 1BC6A 1U09A 1FKPB 3B8HA 2XO7A 3F73A 4F4KA 1WC1A 4KGMA 2RDDA 4HYKA 2NUHA 1NJXA 4YFUA 2ROEA 4TQRA 3M8WA 1HIYA 4Q0BB 2DNPA 3DHXA 1VK3A 5C5JA 2JJ4D 1WNEA 1ZZNA 2V9WA 2JZ5A 1TL5A 3HXMA 3R5GA 4IH6A 5DQGA 1S12A 2V34A 4LF6F 4ZPTR 3D6HB 4J91A 4UUWA 3T5JA 1KVJA 1HNXJ 1S10A 5C2CA 2OEMA 3CMQA 1EQMA 1XNRJ 2J0XA 2IMOA 3P5BP 2XTJP 3HFKA 4MFBB 1Z4UA 1S1VA 1RKJA 3HFVA 3BSAA 3SCJE 5KFMA 1S7HA 5F8GA 4CLFA 5CH7B 2COLA 3KLHA 4DV5J 3KG1A 5KFNA 4AUKA 1Q1KA 1VOMA 5F8JA 1T05A 2OPPA 4E98A 3EPIA 5I42A 4EBDA 2HVHA 2FIUA 2IRYA 2OSQA 4QYZJ 3KK2B 1QVGR 1Y3KA 2PI4A 2HHVA 3LP0B 4URQU 1RAOA 2HQDA 1UAWA 2V94A 3MHYA 1TVRB 2KVQE 2YTCA 2KHDA 1TMJA 4NCGB 2AJFE 4DQIA 3HF5A 3NNHA 2A0FB 2M2BA 5ETMA 3MPWA 4LFAF 4RNOA 2G9OA 1SQGA 2J7UA 1MMNA 3SFGA 2AQ4A 3QJJA 2B51A 1CPZA 4I7FA 2RUGA 3ULHA 3ZTRA 3R3TA 1UCNA 5E3CA 2GVZB 1YX2A 3LF0A 1VFJA 1XBWA 3UDVA 9RUBA 2KHCA 2BQRA 3PJXA 1RTDB 4GMKA 2VH7A 4PEOA 2KFNA 5KFUA 2GAHC 4NI2A 4J5OA 1LWCA 3AA9A 4N8NA 1FX4A 2B3TB 5KFIA 3DOLB 3G6ES 1V9OA 1FESA 3S7RA 4DL6A 3DGPB 3AT1B 1FJ7A 5A76A 4LR7A 5KFBA 5HJYA 4CCHA 4GKKF 2DEIA 4J9UE 3IRXA 1NDKA 1YBTA 1HR0F 1YJUA 4LRBA 3EVWA 4F25A 2VPZB 1EKRA 2W9CA 5LSRA 4U7UK 1VLOA 5D0GA 1H2TZ 2QA2A 3T5LA 3M8PA 2ACMA 2GIQA 1WELA 4ZLJA 1PSDA 2FZCB 3EMTA 2F4VJ 3UN2A 1EJ7L 2LU1A 2KXNB 3GU0A 4NWBA 1YLXA 4USTA 3HZEA 4JI3J 1RISA 2XEXA 1HFEL 2QMWA 1X8DA 3CCMS 3DMJA 1M1KT 4L72B 3OXLA 2B56A 2B6AB 3CD6S 2RQKA 4CI0B 4FS2A 5IV4A 3J7Z5 4X4OA 5HLFA 5LM7E 2IBOA 2MKKA 2UXCJ 4NE9C 2R7SA 1FJGF 2CQBA 4RW8A 2QL7B 1NJZA 2DNMA 1M0SA 2M8DB 3QGGA 4KKOB 1U1LA 1HD1A 5L1IA 1KTQA 2DIUA 2IM0A 4NLVA 2VFSA 3DYAA 3KJFB 3IC1A 3K5MA 3GE9A 5GMDA 2HWIA 1ZM9A 4AQYJ 3PX6A 3ENAA 5C7PA 2ZH5A 2LEBA 4UOFA 3CCVS 1LXNA 1GMUA 4AE5A 1IKWB 3FCVA 1DZ5A 1Q79A 1YSJA 1QDUB 3RG6A 2LVWA 1HMVA 2UUAJ 2M52A 1N5SA 4WTOB 2ZZTA 3MMBB 2FJVA 4RU2A 1SL2A 2DO0A 4K5RA 3CJSA 2CPYA 1RAIB 2H4WB 5LMNF 4NLDA 2EFQA 2B43A 3Q2SC 1NKCA 1G6BA 4IFVB 5A2QY 1CJVA 1WC4A 4USKA 4RBVA 1RWPB 4M5MA 2JHEA 3HHLA 4OL8A 2EPIA 1HW8A 4J9NA 4CLYA 1A9NB 3O5TB 3T9NA 1VC5A 5G4DA 3IFEA 2DNKA 4HT7A 1HQUA 2FLNA 1UW4A 2EFVA 2VL1A 4A8QA 3MMAA 3KLEA 4DCPB 3JTNA 3CCSS 3PHEA 3NWRA 2AJ4A 5LMUJ 2YNFB 1XNQJ 2CQIA 3D1OA 2R4FA 2ZWPA 1JB0C 2PE8A 3IG1A 4LF9J 2AEMA 4LF5F 1XMQF 2ZHOA 1DURA 1X4CA 1RTJA 3EE3A 3SSRA 1F3VA 3TEGA 4PPZA 4PUOB 2PEBA 3H4DA 1M1GA 5GMEA 1NPPA 3F56A 3K5OA 2A2DA 1N33J 2YKNB 1KD1T 1WHXA 1U47A 5F41A 2LFVA 3DN9A 3RTVA 3M9MB 3LOUA 2LYVA 1RWKB 4X62F 1OS5A 1DRZA 4OLPA 4S0MA 4DR5J 3W8GA 5HK4A 2ZNZA 1G1XA 4OYIA 3LGMA 3FSIA 1HBNA 2BBEA 4PXCA 1VQ7S 3KDNA 2JVOA 4ICLB 4IRCA 5HQLA 4DPUA 5LXYA 1FD2A 1S99A 2QLWA 3W2VA 3MEGA 4OYXA 1U25A 1U2CA 4OZ0A 4C8ZA 2HQGA 1PAEX 2CJQA 4JYAJ 1PILA 4Q44A 2DH9A 3MM9B 5CABA 1N52B 2U2FA 1S97A 2E9ZA 1YRUA 4B02A 1NSQA 5HMZA 2CQPA 3FBCA 1VIXA 2MPUA 1XN9A 3B82A 4FN5A 3AXKA 2JVRA 2LMIA 3I32A 2P5VA 2AYGA 5I3UA 4IR9A 2XMMA 4XTTA 2YXLA 2HFSA 2Y1RI 1L3KA 2RILA 1FRIA 4O4GB 1CEZA 4CO1A 1UA1A 3KFWX 1LOUA 2H48B 4FYVB 3UCZP 3UD3P 4RW6B 4DR2J 4O3PA 2ZUGA 1P27B 7FD1A 4I56A 1FFSB 2GGPB 1FA0A 1BQMB 3ZZZA 2RQMA 4FNIA 4UOHA 1SL1A 2XZTB 2Z8QA 4H4KA 2QC3A 3VGSA 2AJ1A 4C0HA 4HACA 1Y00A 4YDXA 3GIRA 1AYEA 1RGVA 5CHCB 3AOAA 5CYQB 1LKZA 4CLPA 5F8MA 4B9NA 1H3DA 1XR7A 3GJQB 4WE1A 4KPYA 4LF8J
chains in the Genus database with same CATH topology
1VYAA 4C6AA 5CABA 3G2XA 4O0NA 4ANCA 4DUTA 1S59A 2NCKL 3EMTA 3EE3A 3BH7B 1NSQA 1HHQA 3VGTA 4HR2A 1MN9A 3NGTA 3ETMA 3FBCA 3ZTRA 1WKJA 1BUXA 1UCNA 2AZ1A 1W7WA 3BBCA 3EICA 3EVMA 4WBFA 1S5ZA 3EJMA 1NPKA 3MPDA 1WKKA 3ZTQA 2BEFA 2B8PA 3GPAA 3DKDA 3JS9A 1U8WA 3VGVA 3NGUA 1EHWA 3Q8YA 1XQIA 3VVUA 2HVEA 3ELHA 3B6BA 2BX6A 5IOLA 2B8QA 3FKBA 4FKXA 2CWKA 2HVDA 1KDNA 2DYAA 2DY9A 3Q8VA 1NDCA 3BH6B 4S0MA 3Q86A 1BE4A 3PRVA 1LWXA 4ANDA 2AZ3A 3L7UA 3ZTOA 4ENOA 2HURA 3EM1A 1MN7A 3GP9A 3DDIA 3BBFA 3FBBA 1NSKL 1K44A 4ANEA 4DZ6A 4KPCA 2DXDA 4UOHA 2ZUAA 1HIYA 3R9LA 1F6TA 1HLWA 3FBFA 4CP5A 1NSPA 1B99A 3NGSA 1XIQA 1NDKA 4FKYA 3ZTSA 1PKUA 3VGUA 3VGSA 1NHKL 4F36A 1S57A 1NDLA 3Q89A 4DI6A 3EVWA 3FC9A 3ENAA 3FBEA 5C7PA 1JXVA 4UOGA 4UOFA 1NB2A 3WX8A 2DXFA 1WKLA 1LEOA 3Q8UA 1NLKL 3BBBA 1B4SA 3NGRA 3EVOA 2DXEA 1PAEX 4F4AA 1ZS6A 4W98A 3Q83A 1NCLA 2VU5A 1F3FA 3FCVA 1NUEA 5CAAA 4EK2A 3VVTA 3ZTPA 3FCWA 1NDPA 3PJ9A 3B54A 5BXIA 1BHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYA A;  4C6A A;  5CAB A;  3G2X A;  4O0N A;  4ANC A;  4DUT A;  1S59 A;  2NCK L;  3EMT A;  3EE3 A;  3BH7 B;  1NSQ A;  1HHQ A;  3VGT A;  4HR2 A;  1MN9 A;  3NGT A;  3ETM A;  3FBC A;  3ZTR A;  1WKJ A;  1BUX A;  1UCN A;  2AZ1 A;  1W7W A;  3BBC A;  3EIC A;  3EVM A;  4WBF A;  1S5Z A;  3EJM A;  1NPK A;  3MPD A;  1WKK A;  3ZTQ A;  2BEF A;  2B8P A;  3GPA A;  3DKD A;  3JS9 A;  1U8W A;  3VGV A;  3NGU A;  1EHW A;  3Q8Y A;  1XQI A;  3VVU A;  2HVE A;  3ELH A;  3B6B A;  2BX6 A;  5IOL A;  2B8Q A;  3FKB A;  4FKX A;  2CWK A;  2HVD A;  1KDN A;  2DYA A;  2DY9 A;  3Q8V A;  1NDC A;  3BH6 B;  4S0M A;  3Q86 A;  1BE4 A;  3PRV A;  1LWX A;  4AND A;  2AZ3 A;  3L7U A;  3ZTO A;  4ENO A;  2HUR A;  3EM1 A;  1MN7 A;  3GP9 A;  3DDI A;  3BBF A;  3FBB A;  1NSK L;  1K44 A;  4ANE A;  4DZ6 A;  4KPC A;  2DXD A;  4UOH A;  2ZUA A;  1HIY A;  3R9L A;  1F6T A;  1HLW A;  3FBF A;  4CP5 A;  1NSP A;  1B99 A;  3NGS A;  1XIQ A;  1NDK A;  4FKY A;  3ZTS A;  1PKU A;  3VGU A;  3VGS A;  1NHK L;  4F36 A;  1S57 A;  1NDL A;  3Q89 A;  4DI6 A;  3EVW A;  3FC9 A;  3ENA A;  3FBE A;  5C7P A;  1JXV A;  4UOG A;  4UOF A;  1NB2 A;  3WX8 A;  2DXF A;  1WKL A;  1LEO A;  3Q8U A;  1NLK L;  3BBB A;  1B4S A;  3NGR A;  3EVO A;  2DXE A;  1PAE X;  4F4A A;  1ZS6 A;  4W98 A;  3Q83 A;  1NCL A;  2VU5 A;  1F3F A;  3FCV A;  1NUE A;  5CAA A;  4EK2 A;  3VVT A;  3ZTP A;  3FCW A;  1NDP A;  3PJ9 A;  3B54 A;  5BXI A;  1BHN A; 
#chains in the Genus database with same CATH topology
 1OMS A;  4WU3 A;  4FXW A;  1GT8 A;  2ZC4 A;  2RU9 A;  3NGT A;  5E2Q A;  3N5B A;  2YY3 A;  3H2L A;  2VFR A;  3KYL A;  3NKY A;  3PYE A;  4R25 A;  1U48 A;  2V6A A;  1SIW B;  5DM7 Q;  1S1W B;  5IS2 A;  4DSE A;  2KT3 A;  5T14 A;  2C3O A;  2AT1 B;  4IR1 A;  3MD3 A;  4CO0 A;  1NSA A;  2B5J B;  4URG A;  1NK7 A;  2BAB A;  2NXU A;  4ERD A;  3L7U A;  3KHR A;  4GVL A;  3LP2 A;  4YN3 B;  4KR0 B;  1NK5 A;  2RDI A;  1C2P A;  1VRU A;  3QRQ A;  2Z2M A;  3M2V A;  4A8M P;  4LF7 J;  3TAN A;  2C3P A;  5IT9 Y;  4OYP A;  3RB3 A;  1JXL A;  4B3T J;  3AB4 B;  1JJH A;  1TUG B;  3BBB A;  1PC5 A;  1S1X B;  3NGD A;  2XC9 A;  2CPF A;  2V67 A;  3B54 A;  1BHN A;  3O6Q A;  1SC1 B;  2GV1 A;  5D8H B;  3DOK A;  4PWD B;  2IDL A;  2F4V F;  2VIH A;  3HHD A;  4PWU A;  2BKN A;  1M5P C;  2W9A A;  1RT2 B;  5M2U A;  4JI3 F;  4DLG A;  4QZV B;  3RR8 A;  4QWD A;  3NNA A;  1RT5 A;  5K5M A;  5KT7 A;  5HL7 Q;  1XEZ A;  4JP8 A;  3QO9 B;  2HZC A;  4USI A;  1VBK A;  5L8R C;  2CWK A;  3IAS 9;  3TAP A;  2OD6 A;  3Q8V A;  8RUC A;  2J6T A;  2UXD J;  3KNA A;  2VG6 A;  2ZUA A;  1S6Q B;  2YWG A;  3TP2 A;  1FEH A;  1KRP A;  1V3Z A;  5K14 A;  5J1N A;  3MAA A;  3ZC4 A;  2Y1L B;  1S1U B;  1MLA A;  2KN4 A;  1B4S A;  3ILL A;  5I3P A;  4DSJ A;  4H4O B;  4BWM A;  2YNI A;  2D9P A;  4X4S A;  1D8Y A;  1UTA A;  4C9D A;  4ZPA A;  4B3M J;  2MLX A;  3VAJ A;  2RRN A;  2UUA F;  3OUY B;  2HBQ B;  1OQ6 A;  2I9S A;  1RAG B;  1KQS R;  1S48 A;  1G7C B;  2C1E B;  2XI3 A;  3LW5 C;  4M5K A;  4ECS A;  4MFB A;  3KJV A;  3SYZ A;  4DCJ B;  2DTJ A;  3MOZ A;  2QZ8 A;  3OV7 A;  2VJV A;  2IC3 A;  2GMJ A;  3HKW A;  4ZCL A;  5HBM A;  3TR5 A;  1IKX A;  3VHQ A;  1Q95 G;  4NLW A;  2FC8 A;  2HNZ B;  3OTD A;  2BR0 A;  2E9T A;  1MWY A;  3MM5 A;  5THW A;  2VQE J;  2YKM B;  3NLC A;  3MPY A;  2WOM B;  1TUV A;  2VBX A;  3BGR B;  1NB7 A;  3PXG a;  3KJN B;  3KK2 A;  3MUM P;  1F5A A;  3D4J A;  3DNC A;  4B3S F;  3FC9 A;  2A10 A;  4CQ1 A;  1GX6 A;  3OTC A;  2FHM A;  3THT A;  4HHU A;  5DGB A;  5LMU F;  2HRT A;  3PX0 A;  4NCG A;  3V4I A;  2NYH A;  1Q16 B;  1N5Y B;  4LF9 F;  3M05 A;  2FJB B;  4HI2 A;  2XMU A;  1KQG B;  4FYY B;  2W7P A;  3W3S A;  3GJR B;  2LXI A;  2ZC3 A;  4CLZ A;  3N6N A;  1NPR A;  1HWI A;  2BRK A;  3I82 A;  4A8K A;  3H2V E;  3EX7 B;  3O8W A;  3U7J A;  1N33 F;  4WFB Q;  2W24 A;  3PYF A;  3DLH A;  1HWL A;  2H54 B;  1X9W A;  2AJ0 A;  5KFR A;  2GJ2 A;  4BHQ A;  4WP9 A;  4DR5 F;  2IM1 A;  1IM6 A;  4JI8 J;  2XG8 A;  2ZE2 B;  1X4G A;  2YQ0 A;  1U45 A;  4TYB A;  1I6J A;  3P5T L;  1K1Q A;  2VBZ A;  2HKE A;  4B3O A;  1FCA A;  4MH8 A;  4JI5 F;  2BAN A;  3DLK B;  2IMW P;  3LP1 A;  1WEZ A;  4OYM A;  4U9R A;  1KLN A;  3HD2 A;  3KWM A;  1CJT B;  2I6W A;  3QAT A;  2CYY A;  5J1E A;  5CAA A;  1Q5V A;  4JYA F;  1ZAW A;  4GVB B;  2GS8 A;  2Q43 A;  3BGO P;  3TI0 A;  4NOH A;  3GTY X;  2FTR A;  2WON A;  3JYT B;  2C2N A;  1DQ9 A;  3KXD A;  4WFA Q;  2ZZN A;  3BBC A;  2W4C A;  1HBM A;  2DNO A;  3D67 A;  3WIV A;  2RRA A;  4QIE A;  2UUB J;  2D74 B;  4ED0 A;  1HI0 P;  1S7I A;  1SVD A;  3LGH A;  3IR7 B;  1P1L A;  3FSX A;  2JL9 A;  2LA6 A;  3FKB A;  4C8N A;  1UPM B;  5E0O A;  3Q86 A;  3BV8 A;  4IO1 A;  4P74 A;  5K8M A;  2I1R A;  4MAK A;  5A6P A;  2VPX B;  2MTL A;  2MEW A;  2V2Q A;  1O6X A;  4P2F A;  1Q7Y T;  1C1B A;  5J2M B;  3MM6 A;  3US5 A;  1KEK A;  1HPZ B;  1NB2 A;  1RP5 A;  4O4R A;  3NGR A;  3MEE B;  3K17 A;  3T1Y J;  3HHL C;  1Y10 A;  3VTI A;  3V6K A;  1XMO F;  1NUE A;  1SH2 A;  2G2O A;  2VOP A;  3IWN C;  4OX9 J;  2RNE A;  4P72 A;  1V5I B;  5C42 A;  1NJI T;  1M90 T;  3ITH A;  4TLQ A;  1FJE B;  4RPF A;  3THP A;  4AXJ A;  2HSE B;  2H9Z A;  1GH8 A;  3JB9 k;  2HGN A;  3C6U B;  1NPK A;  2OI2 A;  4FNH A;  4Q2M A;  3NS6 A;  3C3L A;  5B0E A;  4WF9 Q;  4OJ1 A;  4DV0 J;  3H90 A;  3QLH A;  1UEV A;  3BEG B;  4CO3 A;  1IBK J;  2G1D A;  3R97 A;  3WZ0 A;  4P10 A;  4MK8 A;  1VIO A;  2GO8 A;  3PRV A;  4DV4 F;  4IFV A;  2J8S A;  4E0D A;  2LKZ A;  1N36 J;  2BUN A;  5AE1 A;  3SQO P;  1UVL A;  3A3N B;  3CCT A;  2YPY A;  4CP5 A;  3G6Y A;  4TN2 A;  4F0M A;  3PNI A;  4YUD A;  1LW2 B;  3M9N B;  1XC9 A;  5GMK a;  1JJC B;  5KFA A;  4B3T F;  4OI6 A;  2YWK A;  2AEJ A;  5DS7 A;  3CCL S;  4ZJQ A;  3C16 B;  1U0H A;  5H1S V;  3P49 B;  1OSD A;  3HO1 A;  5GAE U;  4CDI A;  3AAW B;  2WTF A;  2X1G A;  1KHW A;  1RT6 A;  5DRK A;  2DNZ A;  5CYM A;  2LEA A;  4A8W A;  3HSZ A;  1JLF A;  1DHM A;  2ILZ A;  4C8M A;  4PQU A;  2B8P A;  4ECY A;  2DR8 A;  2DNL A;  1IXK A;  4R5P A;  1ZA1 B;  5KG3 A;  5BJR A;  2D3U A;  2YX4 A;  3Q8Q B;  4FKX A;  4F0H A;  3J80 U;  1TKZ B;  2F1F A;  1R0A A;  1UPP A;  3TA2 A;  1UZD A;  1XWL A;  1BLU A;  3MCM A;  4Y2C A;  5I3Q A;  2XYH B;  3DHW C;  3EM1 A;  2E1M C;  5CZX A;  1PAU B;  4K0K J;  5ADZ A;  2F7V A;  1WOR A;  2V8H A;  3UD4 P;  3R1H A;  3DDN A;  2OD4 A;  2PI5 A;  1PKU A;  5C24 B;  4PKD B;  1KVI A;  3GYN A;  5D0E A;  5KT3 A;  2R7W A;  4OX8 A;  2KXH A;  3HP6 A;  1C4A A;  3Q8U A;  3GJT B;  3EGZ A;  4QYZ K;  1ULR A;  5J2Q B;  3MED A;  2WVD A;  2CAJ A;  5D0H A;  4ZMM A;  4ZVH A;  4F67 A;  1VYA A;  1RTH B;  2W2M P;  4FPR A;  3GFH A;  4CLK A;  3CD7 A;  2V69 A;  3DRX A;  2BQU A;  4OJ3 A;  3E01 B;  4FYW B;  4LBI A;  1U1R A;  4Z37 A;  1PBU A;  3DU5 A;  3TZW A;  3BN4 A;  4W90 B;  3IA0 A;  4ED4 A;  4CIO A;  5DZ6 A;  2ZZM A;  1RWO B;  5D15 A;  2XS7 A;  1J5O B;  2IJN A;  1IKY A;  3EWG A;  1QAJ A;  2BVZ A;  4C8L A;  3K89 A;  1GMW D;  1NH7 A;  4V1A k;  2WVE A;  3CIM A;  3KLF B;  2OPQ A;  3TQE A;  3W65 A;  1U1P A;  1RXO B;  4B9M A;  3SIP B;  3LTO A;  4RLE A;  4DSI A;  4XPE A;  4ED7 A;  1G4C A;  1KQF B;  2XZW A;  1HWU A;  3GV5 B;  3NBP B;  3PJ9 A;  4P6Q A;  4GKJ F;  1N6Q A;  3RUB L;  2ASY A;  2PC6 A;  3IAM 9;  3W2W B;  4CRJ A;  2W7O A;  4YDD B;  1NK9 A;  4CO5 A;  4MTP A;  2DHX A;  3VGT A;  2J76 E;  4Y3C A;  5KT6 A;  3J81 j;  2JFD A;  4ILM A;  4M95 A;  3R2D J;  3JQM A;  4GC7 A;  2BE2 B;  4CO4 A;  3OL7 A;  1K9M T;  4Q8E A;  3D5M A;  3K5N A;  4LFB J;  2B8Q A;  2VF3 A;  1RHM B;  3IS9 A;  1FDB A;  1T0T V;  2CJA A;  4DUY F;  2IVM A;  1VGY A;  1NDC A;  4KB7 A;  1FFG B;  1LWX A;  3I0R A;  1UWB A;  1T7P A;  2OPS B;  5DDO C;  4U67 Q;  3DI6 A;  4JI8 F;  2ZBP A;  1V3R A;  1LWE A;  1JJ2 R;  3ZZO A;  3KK1 A;  3S1T A;  4DV1 J;  2HBR B;  1KFS A;  3QIP A;  2WBR A;  5CCM A;  2LXU A;  1NHK L;  5KFC A;  1Q4R A;  4XAK A;  1CG2 A;  1WSR A;  4DL7 A;  3FNN A;  5KFY A;  1URN A;  4IDK B;  3C19 A;  2WB1 D;  5EGY A;  2UV8 G;  3IN5 A;  1B0P A;  1IR2 A;  1VR6 A;  3HVT A;  4RBT A;  4C3M A;  4DR6 F;  2AGP A;  1R3N A;  2N7Y A;  4DX7 A;  2UUB F;  4KHP F;  5C25 A;  4ILR A;  1RU2 A;  3CD5 A;  2HAF A;  2HWH A;  3UE2 A;  4Y6I A;  3ICL A;  1EET A;  4DMZ A;  8AT1 B;  3GII A;  2J8A A;  2NLW A;  4FYX B;  4LF4 F;  2F40 A;  2HLU A;  3JXO A;  1H7X A;  4DL2 A;  1NAQ A;  1FK9 B;  4QU7 A;  3GYG A;  3W5X A;  2L9N A;  2OFG X;  3PAC A;  2EK6 A;  2RT3 A;  1SPB P;  3CJ4 A;  3C6T A;  4UQT A;  2VC0 A;  1ZZF A;  1WG1 A;  3WX8 A;  2CIM A;  3T1Y F;  4U7C A;  3H0P A;  3CSK A;  1VDH A;  4KTQ A;  2P9E A;  4WXO A;  1ROF A;  1S1U A;  1FKO B;  4OX9 F;  4FBU A;  4UZC A;  2ZVS A;  6FD1 A;  1U0S A;  4NLR A;  4PPD A;  1NHU A;  2ZH7 A;  1ICE B;  4O0N A;  4QYR A;  2CJK A;  1RAC B;  2XO6 A;  5B0A A;  2X1F A;  2LQB A;  2G0J A;  1AXQ A;  1S5Z A;  3RB6 A;  5DDR C;  4K8R A;  2ADC A;  4I67 A;  2AYE A;  4Q2L A;  2AF6 A;  4OYA A;  4UW2 A;  1MRO A;  4DZD A;  3A3P B;  5F9N A;  2MZ1 A;  4LBH A;  2ZH8 A;  2EXU A;  3A8I A;  2HGM A;  3QID A;  1IBK F;  4OZL A;  2XHW A;  3M1V A;  2AZ3 A;  1LFW A;  1N36 F;  2HNZ A;  2MJU A;  4PWW A;  2ROG A;  2ASD A;  2RHS B;  4PG4 A;  2QEX S;  2ZBQ A;  4DL0 C;  2C2M B;  5KTQ A;  5EX0 A;  1SB6 A;  2R2T A;  2PMH A;  2QLB B;  1FJC A;  3IO1 A;  2FJX A;  3V81 A;  1I3O B;  5HMY A;  3EVO A;  1WEY A;  3QAU A;  2N82 B;  1UA0 A;  4Z2X A;  1UVJ A;  5KFJ A;  4H4M B;  3MPV A;  1NDP A;  1CQN A;  1WG4 A;  2R7O A;  3QWU A;  4G1Q A;  3LPY A;  1VIS A;  2ATL A;  1FWK A;  3NCR A;  1K0V A;  1OQ3 A;  2ZD1 A;  3KHG A;  2V63 A;  2VG5 B;  2MZJ A;  2KZZ A;  3CC2 S;  1FWP A;  1YGY A;  3U1N A;  2W7A A;  5JXS A;  4M63 A;  4DF4 A;  2FHJ D;  5HRO B;  3RB0 A;  4RNM A;  1TV6 B;  3RB4 A;  4OZ5 A;  3CCW A;  3M6W A;  4FF2 A;  2EKY A;  3D6T B;  1URR A;  3CDU A;  1GEH A;  4JI4 J;  1U4B A;  2PGC A;  2RS2 A;  1VJQ A;  4NPO A;  4K0K F;  3BPS P;  3TEH B;  4CLW A;  1RE1 B;  1B0T A;  1F60 B;  5KG6 A;  3ISZ A;  1GK8 A;  1HNZ J;  1P9Q C;  3QFH A;  4I1T A;  1B99 A;  2LEC A;  2MGZ B;  1Y11 A;  4NML A;  2IA0 A;  3AD7 C;  4EBC A;  1MNE A;  3MM7 B;  5ETR A;  3HVA A;  1WAC A;  3TAQ A;  5IQ6 A;  3ZZP A;  1HQ2 A;  2OIH A;  1D9A A;  1T02 A;  2YWH A;  1TKT A;  4ZLN A;  1T94 A;  1WI6 A;  4WFX A;  1DFD A;  3K8V A;  1VQY A;  1JLA A;  4IH5 A;  1HNI A;  4GVB A;  1IM4 A;  1IJE B;  4WU2 A;  2EFO A;  3G87 A;  1RU1 A;  4LSL B;  3JYT A;  4O23 A;  1FT8 A;  2MXY A;  5E33 A;  2C2Z B;  3VGV A;  2CQ2 A;  2MQM A;  3PY8 A;  5EHH A;  4B9U A;  4FBT A;  4USJ C;  4N56 A;  4D3G A;  2KO1 A;  3PVX A;  4PG5 A;  4P7V A;  3PO4 A;  1KDN A;  4RUB A;  5AJ3 J;  5AXM A;  5DG7 A;  4IO9 Q;  4TY8 A;  2IHR 1;  2R7U A;  2XQC A;  4PZV A;  3KHL A;  2X3G A;  7AT1 B;  3KLG B;  4LSN A;  4CM0 A;  2E7X A;  2FGO A;  3VF0 B;  2KFZ A;  3BO4 A;  2V2Z A;  4PR6 A;  4ZKA A;  1GQE A;  1HA1 A;  4N8O A;  2YKP A;  3FZB A;  4W92 B;  1NK8 A;  4QIG A;  3K5P A;  2KG1 A;  1RLD A;  4TXS A;  2MKJ A;  3UO0 A;  1WHV A;  2FLL A;  3EXC X;  3F44 A;  1P1T A;  2HVZ A;  2XWX A;  2R8I A;  3V4M A;  2E5J A;  5ETN A;  3G2X A;  3PYG A;  2RU3 A;  3BN7 A;  1VQ5 S;  3C8Y A;  4ETZ A;  3R5D A;  2NQP A;  2FQQ B;  1RTI A;  1QY7 A;  3BR8 A;  2C3M A;  1S0M A;  3BJY A;  3MPD A;  3PKY A;  4NA1 A;  1CVJ A;  3UD5 A;  4F26 A;  2FHK A;  2RRB A;  2EG2 A;  2BAC A;  4KBI A;  2BX6 A;  1SUQ A;  1YKW A;  4DU7 A;  4J9L A;  1VBZ A;  2J9D E;  4WYL A;  3HJF A;  3H5U A;  4USU A;  2JNJ A;  2FHJ A;  1DLO A;  2HMI A;  4L73 A;  3V6D A;  1SJ3 P;  4URS A;  2RIJ A;  4DFK A;  2X7I A;  1CQM A;  4NXM J;  1CJU A;  2Z0G A;  1RTZ A;  1W26 A;  4ZHR B;  1VQM S;  3DXS X;  2XYP B;  2UXB F;  1RLC L;  1QSS A;  4ELT A;  3OTE A;  2DXE A;  1I5O B;  1VMB A;  5A2Q U;  3CCJ S;  3G71 S;  3I0S A;  3M6U A;  4Z7C A;  4EK2 A;  2OLW A;  3TJA A;  4ZJO A;  4HVZ A;  4DJB A;  3D6F B;  5A8W A;  2W1B A;  5HVH A;  1X9S A;  5ETV A;  3R5J B;  3ZZ0 A;  2B9E A;  1REV A;  1S79 A;  3W1Y C;  3TZX A;  1R7I A;  1S1T A;  1FXR A;  1MML A;  2OUG A;  4ZOS A;  1QM9 A;  2AYM A;  3QWP A;  1FD8 A;  3G4S S;  4I2Q A;  3GIJ A;  4LIR A;  2HND B;  4ZK7 M;  3AJD A;  1TKX B;  5EX3 A;  1RBL A;  4KQZ A;  2ZIT A;  2CWX A;  1HYS A;  2MSS A;  3UPF A;  3FRZ A;  3RRK A;  2OFH X;  2OPR A;  1ARO P;  3CW2 C;  3IMQ J;  3P4U B;  3AOC A;  1X5P A;  3PJW A;  3JSM B;  3ENQ A;  4ER8 A;  3OL9 A;  2QYC A;  3L3C A;  4Y2I A;  1QSL A;  2XSJ B;  2KRR A;  2DGS A;  5KFZ A;  4ECZ A;  3PM9 A;  1VS3 A;  4RW9 B;  4CT9 A;  3C14 B;  5J2Q A;  2GCF A;  3TAM A;  1H2V Z;  3GSI A;  2Z56 B;  3MGJ A;  3H5S A;  2P9G A;  1MN9 A;  2CZV C;  4GO7 X;  2BJD A;  3PR4 A;  1U26 A;  2YH1 A;  4WBF A;  4RU9 A;  2RKI A;  2YKQ A;  3SQG B;  3HVR A;  1K1S A;  1LWF A;  2BE7 D;  1WSV A;  1RKI A;  3KOA A;  6AT1 B;  2AEF A;  4KYZ A;  2XCP A;  1IR0 A;  4KFB B;  2I5J B;  4OHV A;  4CYU B;  4DN9 A;  4CH7 A;  2UVU A;  4J37 A;  2C22 A;  2VKR A;  2GVD A;  4DZ6 A;  5HAO A;  1RT4 B;  2NXC A;  4QCL A;  4LF6 J;  2OJ3 A;  4ZDN A;  4EYI B;  2CQC A;  3L95 X;  4BS2 A;  4EO8 A;  5J2N B;  2BJ8 A;  3KK3 A;  2Q6C A;  4L6V 3;  4NLP A;  1S57 A;  4X4V A;  5DG9 A;  4HH1 A;  2B0G A;  3KLI A;  3FEX B;  3R6L B;  1S9G B;  2V5H G;  4JI7 J;  1JMT A;  5FDL B;  5HP1 A;  4X66 J;  3NEK A;  3BM7 A;  2CNN B;  5MLC V;  1IWA A;  1TZ0 A;  2GZO A;  2R2U A;  1F3F A;  3KJQ B;  4XO0 A;  3OT9 A;  2BJ7 A;  1HNW F;  1ZPW X;  1UJ4 A;  4OZN A;  2CDR B;  3G8Q A;  3H8Y A;  5KOX A;  3QJP A;  4CT8 A;  2APO A;  4MKA A;  4DR4 J;  3W2W A;  4PYD A;  4ECT A;  4KAI A;  4NLS A;  4DR3 J;  1LV5 A;  3T1H F;  3HI9 A;  2V9K A;  1T9X A;  4CTA A;  1LXJ A;  2HW3 A;  1RQ0 A;  4ELV A;  3W9J A;  3FMW A;  4G3I A;  5MAO A;  3VZH A;  4C11 B;  4JI4 F;  5KG5 A;  4Y0F A;  3W9I A;  4JI1 J;  3WC0 A;  3RZA A;  2RUS A;  2Y0B B;  2JFK A;  1TK8 A;  1HNZ F;  2HHU A;  4BC7 A;  3ZNU A;  3P96 A;  1BQN A;  1CUL A;  3ET6 B;  3FBE A;  2DHG A;  1RK8 A;  1JLB B;  2AP6 A;  1BWE A;  3MFI A;  2W9B A;  2VG7 A;  1SC6 A;  3VVT A;  3OR2 A;  2W2Q P;  2DBB A;  3V5R A;  1OYD A;  1QTN B;  4L3N A;  3H59 A;  3I9Z A;  4YB5 A;  4LJM A;  4O44 B;  2C3U A;  1HNV B;  4JBC A;  2IRU A;  2NXE A;  5T7L A;  4NYO A;  1KVK A;  1KON A;  4DN0 A;  2HRY A;  1RAB B;  4ES2 A;  2EVZ A;  3SSS A;  5IT9 U;  5LJ3 Y;  4YME A;  3X3U A;  1VBY A;  2NPI A;  1TAQ A;  4DLE A;  3LUY A;  1HQE B;  1OY6 A;  3PYD A;  1NME B;  4LRC A;  2Y3Y A;  3V6H A;  2HWT A;  3DRY A;  3BKU A;  1SV5 B;  5AJ3 F;  3ISN C;  1HR0 J;  2DJW A;  4OYW A;  3Q22 A;  4WFZ A;  2FLO A;  3TJ8 A;  4DSF A;  5HMX A;  5H9F K;  1IWG A;  1FRX A;  3CJ2 A;  5L1K A;  2HZV A;  1W2B R;  4NLG A;  2ZOF A;  2HLT A;  1Z1Z A;  2K3I A;  4ITS A;  3D0G E;  4C97 A;  3DLG A;  3QYY A;  3OFF A;  2V8D A;  2GJF A;  3IWX A;  1VHF A;  1NK0 A;  3GG0 A;  3D7S B;  3UVJ B;  4J9M A;  5AT1 B;  3TW0 A;  5A8K B;  3JAM Y;  3PKM A;  4IRD A;  1FKO A;  1Q53 A;  1O8B A;  3GLJ A;  3CJK B;  2G13 A;  1YTY A;  3W7B A;  1IBM J;  1OJ4 A;  2ALZ A;  1MU2 A;  1TL7 B;  2PSZ A;  3BSO A;  5IM0 A;  4IKA A;  3RGI A;  4LF1 A;  4M5L A;  3FFI A;  2CG4 A;  3L09 A;  2UUW A;  3K2Y A;  2IFX A;  3MEC B;  2K7K A;  5U47 A;  2W01 A;  2NR0 A;  4ED6 A;  3GSD A;  4CLL A;  3EZU A;  3MDF A;  3NG8 A;  4P73 A;  2XMT A;  3DOM A;  1QAI A;  1DAX A;  3DFE A;  3BBF A;  4WFY A;  4DFJ A;  1WC6 A;  1OYE A;  1EP4 A;  1N5V A;  3VAF A;  1HWJ A;  1U2F A;  4RNH A;  3GZ7 A;  3IR6 B;  3V2U C;  4B08 A;  2F5G A;  1X5S A;  1FTR A;  4NXM F;  3H7H B;  3H25 A;  1GXL A;  3CCU S;  3H42 A;  3G82 A;  4QPX A;  2C3Y A;  5LL6 d;  1G2E A;  4M5N A;  5KG0 A;  5K9F A;  3FZ2 A;  1EX8 A;  5HVG A;  4CWB A;  1KFD A;  2A18 A;  4DV2 J;  1U24 A;  3DLJ A;  1U1O A;  4C6A A;  3MFH A;  2DNY A;  1S4F A;  4NRT A;  1Y0H A;  2RB7 A;  4DOZ A;  2OO4 A;  4B9T A;  2VIC A;  4IFY A;  3RBZ A;  3EIC A;  1V6H A;  5KFS A;  4J9K A;  5IWA F;  3LAK A;  2IJF A;  4WII A;  4A8Y A;  3P3D A;  2DRA A;  3RBE A;  1DTQ A;  2ZH4 A;  4RW7 A;  3DLB A;  5DZ7 A;  2Q79 A;  4F2S A;  4ID8 A;  2WRM A;  4K59 A;  1QAX A;  1FER A;  2R8G A;  4YY3 F;  4IG3 B;  2R7Q A;  1Q8L A;  2RH3 A;  2RF2 A;  1IBL F;  3O2I A;  1VQL S;  1NZ8 A;  1C0U B;  2CXE A;  4DR1 J;  4K2J A;  2EI5 A;  5EWF A;  2W2O P;  1XMQ J;  2CQD A;  4EGL A;  3M2R A;  3GIM A;  1CLF A;  2ZH1 A;  1JIH A;  3HFZ B;  2Z4P A;  3GMG A;  1L5U A;  3VCD A;  4E8U A;  2HYI B;  5KFD A;  3CGI A;  4X62 J;  2HQI A;  1LW0 B;  3T19 A;  2R8H A;  4OLO A;  2CQ4 A;  3EGW B;  4C3L A;  1NBE B;  4EZ9 A;  4LVO P;  1OY8 A;  2R7T A;  3M2U B;  3JSR A;  2MQL A;  3M8Q A;  1N56 A;  2WSC C;  1JKH B;  3FQL A;  1RYR A;  1IJF B;  3DGV A;  2QFI A;  1SKW A;  4DX5 A;  5IXU A;  2NRE A;  4XDD A;  4NYP A;  1HD0 A;  1BGX T;  1NH8 A;  3DRS A;  4ENO A;  3GP9 A;  1FNX H;  4ALZ A;  1AUS L;  4F8R A;  4NCA A;  1CS4 A;  1TKD A;  1CJK B;  3D1H A;  4N7T A;  4KGZ B;  2J9D A;  1LNQ A;  2AX1 A;  1FXD A;  2Q6B A;  1JLG A;  4ZP7 A;  3OW2 R;  3MM8 B;  2KJW A;  4JI7 F;  1NJY A;  3W5Z A;  4X66 F;  4X4T A;  1A6L A;  5AXL A;  2HFU A;  3D2W A;  1F5C A;  1E6Y B;  3DLE B;  5IC6 B;  1HBU A;  3GB0 A;  2KVI A;  2K1R B;  4QWE A;  3OTO F;  1VRT B;  3QGP A;  2VC1 A;  2EKN A;  3VAL A;  4AT1 B;  2ZM6 J;  5HAN A;  1RAA B;  2KG0 A;  1FF2 A;  2J0Q D;  2NZ4 A;  4DR4 F;  1UEK A;  4MT1 A;  2HS0 A;  2ZNY A;  4ZP8 A;  4A8O A;  1H2U X;  5JMN A;  2PMW A;  1B7F A;  4LT6 A;  3OFE A;  5KFG A;  1B0V A;  4DR3 F;  3K57 A;  4KHR A;  1S0V A;  6FDR A;  1PIE A;  2O1P A;  3NP5 A;  2QG9 B;  1YJW S;  2HVD A;  2BM0 A;  2V4Q A;  3QT7 A;  3W60 A;  1C0T B;  3HSJ A;  3AD9 C;  3GFZ A;  4JI1 F;  2GHV C;  1ITP A;  4A4J A;  1DBD A;  4DPY A;  3CT9 A;  3W8P A;  3TZY A;  2OEJ A;  2M8H A;  4DFP A;  3MOJ B;  2ADB A;  4TU8 A;  1T03 A;  2W4D A;  2IAJ B;  4QW8 A;  1VBX A;  3DM2 A;  1KBR A;  2DR5 A;  4A47 A;  1H38 A;  2V2V A;  1AUD A;  3EYZ A;  4KV8 B;  2LP4 A;  3KG0 A;  2GO9 A;  2AGO A;  1RWX B;  4DFM A;  3HVW A;  1TR0 A;  3S8S A;  1RUS A;  2EW9 A;  3IM8 A;  2K3K A;  1M5S A;  2EK1 A;  2E1R A;  4B9V A;  2V4J B;  3LWM A;  1RBA A;  4YR2 A;  1VQP S;  1WOP A;  2CAD A;  3KUE A;  4F3Q A;  3R8Y A;  3GIK A;  3E51 A;  4FVM A;  3G8T A;  1OWX A;  1FRM A;  4RWX A;  1HBO B;  1EB0 A;  1R0C B;  4CH0 S;  3M6V A;  3VAH A;  2K8G A;  2AMC B;  2DYA A;  5D3G B;  5LT5 A;  1ZTW A;  1XK8 A;  4KO0 A;  2ZEJ A;  2XYG B;  3OSN A;  2HND A;  4YOE A;  2BZ2 A;  5F8L A;  1HLW A;  1SI9 A;  1RAH B;  2G1H A;  3OSP A;  3GON A;  5H9E J;  4U7U D;  3OL8 A;  3OVB A;  1XJW B;  2Z2L A;  3TUI C;  1WDT A;  2WB4 A;  4Q45 A;  2JLE A;  2XSJ A;  2RAQ A;  1RB0 A;  2IY5 B;  3TO8 A;  5FJ4 A;  1M5O C;  5J2P A;  3C14 A;  2XMA A;  4WKR A;  1AT1 B;  3OLA A;  4HR2 A;  2DGO A;  5B0D A;  1IBM F;  2RVJ A;  4K4Z A;  2V4R A;  1UVI A;  4DF8 A;  3UW1 A;  5E5N A;  2KT2 A;  2K7J A;  2Q66 A;  1S1V B;  2YKO A;  3RBX A;  1SBR A;  4DV7 J;  3MF5 A;  4DX6 A;  1VK8 A;  1TL1 A;  3OFG A;  4NMX A;  5ETK A;  5E41 A;  3KLH B;  2HUR A;  1JLQ A;  3AQO A;  5HQM A;  5CCL A;  2MHE A;  4U6P A;  1T05 B;  2OPP B;  3I4H X;  3OHB A;  1Y5N B;  5I42 B;  1YHQ S;  1RT4 A;  1TK0 A;  1S6O A;  1W25 A;  4U8V A;  2JC0 A;  3CDB A;  2XY7 A;  4IG0 A;  5E3R A;  4X84 A;  3QGH A;  2GFF A;  2FD2 A;  4NEZ A;  3KDO A;  1KP6 A;  5ETP A;  1NK4 A;  2WW8 A;  4DV2 F;  1RT3 B;  3HX9 A;  4QU6 A;  1X4A A;  2QX0 A;  4QPT A;  2YNG A;  4DUT A;  3QFW A;  2VQF F;  4X65 F;  3D1Q A;  3OR1 A;  2VFU A;  1I51 B;  2HHQ A;  1JLC A;  2AKW B;  5HAT A;  4FZV A;  4MK9 A;  4I7F B;  4ZN1 A;  2N3L A;  1TFY A;  5EDW A;  1KS2 A;  1R8H A;  4MK7 A;  4O3O A;  4PCQ A;  5F3T A;  4CO2 A;  1Q82 T;  4B3S J;  3X1L B;  2L3M A;  1YWX A;  3MMC A;  1PYO B;  4NAS A;  4NI2 B;  1LWC B;  1HI1 A;  4DSL A;  4P2X A;  2DXD A;  2E44 A;  3QAE A;  4RW4 A;  3L7O A;  2DR7 A;  1NSP A;  1WI8 A;  2SXL A;  3OFH A;  4DR1 F;  3OJU A;  1FI4 A;  3N6M A;  3H5X A;  2XMK A;  3IRX B;  2J9E A;  2DHA A;  3CJ5 A;  2QA4 G;  1SCJ B;  2MKC A;  2W9C B;  1K8A T;  2OTJ S;  1TL3 B;  3H4B A;  1D8Z A;  4CLU A;  2B4O A;  4HLB A;  2MQP A;  1KNZ A;  4K5S A;  3M8P B;  4X64 J;  4Y2M A;  4ZVQ B;  2ZH6 A;  2XY6 A;  2AZ1 A;  1U6Z A;  3EVM A;  1X5T A;  3ZTQ A;  4DG1 A;  1WHW A;  3DKD A;  3SCL E;  3AFG A;  3GJS B;  2GML A;  1EHW A;  5HQ8 A;  3V6J A;  3SDE A;  2W25 A;  2ZJR Q;  2H4Y B;  4MKV A;  4MMO A;  2XHC A;  1R6V A;  3OL6 A;  3DMJ B;  3MCS A;  2P6T A;  3OTB A;  4JI5 J;  1C1C A;  2E5I A;  2KKH A;  2CPX A;  1X9M A;  3IM9 A;  4ZJL A;  2AHO B;  2C28 A;  2NPF A;  2Z2Y B;  4USW A;  3H20 A;  2H3E B;  4RW8 B;  1RT1 A;  4AXI A;  4CH1 A;  4M8L A;  3Q89 A;  3RR7 A;  2HIQ A;  1U6B A;  1NU4 A;  5ETL A;  3DYA B;  3BGF A;  3BSC A;  3DRP B;  1WC5 A;  5K8O A;  2Y8W A;  1FE4 A;  1NCL A;  1S6P B;  5A0Y A;  2C2R A;  4NA3 A;  3PV8 A;  2BV3 A;  1U02 A;  3GCW P;  3G6X A;  1WTB A;  1T11 A;  4FPI A;  1TAU A;  4C8K A;  4NX9 A;  2JSX A;  3MUT P;  4F4Z A;  1KSP A;  2ZM6 F;  4OZ3 A;  2OTL S;  5A8K A;  2AJ2 A;  1HMV B;  3FVY A;  2KM8 C;  3AJ2 A;  4DU8 A;  2U1A A;  3H98 A;  5G0R A;  1JLE A;  1YIT S;  3UQS A;  4UF4 A;  3RAQ A;  1JWW A;  3DU6 A;  3M30 A;  2QE5 A;  3GYX B;  3CDE A;  3PHT A;  4HKQ A;  4J9O A;  3MR2 A;  2B9Y A;  4RZR A;  4OYZ A;  5KT2 A;  3Q23 A;  4O3S A;  1E6V A;  4FXV A;  4F4X A;  3DDI A;  1H73 A;  4DPX A;  1CJV B;  3VQS A;  5JVH Q;  2LQJ A;  2AX0 A;  3HHL B;  1XMO J;  2OML A;  3T3F A;  2ILY A;  4NLT A;  4LQ9 A;  3KG4 A;  1YVF A;  4OHX A;  4HTI A;  3A8K A;  1IR1 A;  5EUH A;  4C4W A;  2BM1 A;  2GAG C;  1Y4Z B;  2GHP A;  5KFL A;  1HQU B;  5GAD I;  2DGT A;  2X3D A;  2RQ4 A;  1V5V A;  3MMA B;  3KLE B;  3ZTP A;  3QZ8 A;  3FMB A;  3CJ0 A;  3EZO A;  1GNK A;  1TEL A;  2E1P A;  2D69 A;  3IG1 B;  4MIB A;  4FVC A;  1U1Q A;  5IQQ A;  3PW7 A;  2ZDO A;  2UP1 A;  3POT A;  2V50 A;  4WWS A;  3CC4 S;  2CRL A;  1EQ0 A;  2FY1 A;  3IGN A;  4DV4 J;  4K4V A;  4L3K A;  2J6S A;  2HQ3 A;  4ED5 A;  4JI2 F;  3PFE A;  2L9D A;  3NAH A;  3UN3 A;  1UEU A;  5ETT A;  4M5D B;  2BXJ A;  5IV3 A;  1TMM A;  4CNY A;  4UY8 5;  4ECV A;  3FCH A;  4K4Y A;  2JEI A;  3CF5 Q;  1P9Y A;  5JUM A;  2QGF B;  4OI4 A;  2QIF A;  4EO6 A;  4R8U A;  1HBN B;  1FO1 A;  2CJ9 A;  4K4T A;  4C8Y A;  3M6X A;  2Y1J A;  1JXV A;  2ASJ A;  4UOG A;  2B7C B;  3TUP A;  4ID5 A;  4GO5 X;  3NS5 A;  1M5K C;  2MY7 A;  1S9E A;  3MEG B;  3ZZU A;  2XLI A;  1GX5 A;  3TUZ C;  1PYS B;  2VJU A;  1TUW A;  3I96 A;  3NAI A;  3BH7 B;  2M70 A;  4G1P A;  2HFV A;  3D68 A;  2VHG A;  4PRF A;  1T95 A;  2YBV A;  2VDI A;  4ILL A;  1FKP A;  5BR8 J;  1QVF R;  4DV7 F;  4B17 A;  1YBA A;  1O51 A;  1QUP A;  1RDR A;  5I3U B;  4K7Q A;  2W2N P;  2YWE A;  1JKH A;  4Q0B A;  3QRP A;  3CDW A;  1BWV A;  3FBB A;  4AL7 A;  1WHY A;  2XNQ A;  3NWG A;  4TY9 A;  4ECW A;  1SQE A;  2V68 A;  1IBC B;  2D7S A;  2D3O R;  3LO3 A;  2H65 B;  1ZM4 A;  2FUG 9;  5KOW A;  2PA3 A;  1CJK A;  3N5F A;  5D6G A;  1PCA A;  3PIO Q;  4NLO A;  1SJR A;  2DH7 A;  4KY3 A;  2CNK B;  2RML A;  4L76 A;  2GIR A;  4EMD A;  2B9W A;  1UFW A;  4ANC A;  1XMB A;  1S59 A;  1VCT A;  4WE1 B;  2A6O A;  3ZNJ 1;  5KG4 A;  4TNO A;  4ZLP A;  3NMA A;  1SC3 B;  4G1I A;  2BJ3 A;  4ED1 A;  3CTR A;  1N4L A;  3SZ2 A;  2IM2 A;  1TFW A;  4KRW A;  1K0T A;  1WDD A;  2W8K A;  3JTO A;  4NRU A;  2RD5 C;  3LP0 A;  1VQK S;  4I6Y A;  4Y2A A;  4AND A;  1B70 B;  5LSL A;  4QR2 A;  4NZ7 A;  5SZT A;  5B0F A;  1TVR A;  2CPZ A;  8ATC B;  1YJ7 A;  4NZ6 A;  3LP2 B;  1Q78 A;  1ZET A;  4GKJ J;  2EC0 A;  1VRU B;  2VAS A;  4R0J A;  1IQZ A;  3M2V B;  2J9C A;  4KH1 B;  3K5L A;  2CUY A;  1P8G A;  3ZZY A;  1UFL A;  3HSD A;  2CZ4 A;  4RUC A;  2BDP A;  2VDH A;  1DTT B;  2GVZ A;  4YP3 A;  1TK5 A;  4R0E A;  3TX8 A;  4X64 F;  1RTD A;  1ELO A;  2Z2Z A;  3GR0 A;  4DUY J;  3DOK B;  3EJM A;  3KTQ A;  4ZCK A;  4P71 A;  4DDF A;  3K7R A;  3Q8Y A;  3DOL A;  1AFJ A;  5IOL A;  1FHT A;  1RT5 B;  1B3T A;  3DGP A;  2DY9 A;  2F8E X;  3HM9 A;  1EIY B;  5AXK A;  3R5B A;  1FNO A;  2N4D A;  2R42 A;  4DUZ J;  2F63 A;  4WJB A;  2VA2 A;  2HHW A;  4K2X A;  1CSJ A;  4RNN A;  1Y5L B;  2VG6 B;  3A12 A;  2KDO A;  1QLN A;  2W8L A;  4PXB A;  5IC4 B;  4A46 A;  4F4A A;  3CE8 A;  3L9Z A;  4DR6 J;  4ZVE A;  5K14 B;  3MAA B;  1WEX A;  3T9Z A;  3QNW B;  4KHP J;  3Q8R B;  5L46 A;  4F2R A;  1N8R T;  2YNI B;  5DET A;  1UKU A;  4ZVO B;  4JV2 A;  3NGK A;  4Q7A A;  4NXN F;  2E7W A;  3KKF A;  3ETM A;  4YB1 P;  3C2P A;  4WZQ A;  2B6A A;  4LF4 J;  2BJ1 A;  2O3D A;  2KYZ A;  1YJT A;  3OXG A;  3CC7 S;  3ZXW A;  4MIW A;  3IWL A;  4J7C A;  3RU0 A;  3FRY A;  1OO0 B;  3KJV B;  2C2D A;  1QAY A;  4KKO A;  2JEF A;  1F2G A;  3I5A A;  1WTF A;  1YRX A;  3E2E A;  1HW9 A;  2IC3 B;  1SL0 A;  4L74 A;  2FJW A;  5HBM B;  2DRD A;  1IKX B;  2AW0 A;  4RX6 A;  3U02 A;  4M5J A;  5D4P A;  3CCE S;  2HRU A;  3MM5 B;  2CNL B;  4PQA A;  1UVM A;  5D4L A;  3GFX A;  2AU0 A;  4MKY A;  2DK2 A;  4LRD A;  1IKW A;  3MPU B;  3SV3 A;  5IT4 A;  1H74 A;  2NXJ A;  1RHK B;  3HPO A;  4BWJ A;  5BYS A;  1C4C A;  1YJ9 S;  4EZ6 A;  4DV3 J;  3MMB A;  2WCX A;  4DCO B;  2DGU A;  2FPH X;  1YZ6 A;  1ZYQ A;  3OVA A;  5CA5 A;  3V4I B;  1IKV B;  1RT3 A;  2VV5 A;  4WFN Q;  5EN1 A;  1RHJ B;  1YJV A;  3HCX A;  5JVG Q;  2CNO B;  2B4U A;  1HHT P;  1Q8K A;  3IBC B;  2MMY A;  2ALY B;  2KJV A;  3BDE A;  2XWY A;  3UDL A;  5LOQ A;  4CZC A;  2WZ1 A;  4O0I A;  2HHP A;  2HEK A;  3W63 A;  1RT7 B;  4LBP A;  3HHL D;  1FDD A;  1RWM B;  1ZA2 B;  3MAQ A;  4JI6 J;  5T41 A;  2DNH A;  3SV4 A;  5FLX U;  4USH A;  3VGU A;  5CD4 H;  4HT5 A;  2QFJ A;  4RL1 A;  2YNF A;  3NRB A;  1EKS A;  4DPO A;  3FJ2 A;  4ZVR B;  4LRF A;  4B3O B;  4M94 A;  1SH3 A;  4OJG A;  4ES1 A;  2BAN B;  2JX2 A;  3AA8 A;  3LP1 B;  5M2R A;  2BOP A;  2DHS A;  1OSC A;  3DXB A;  4YEA A;  3VZI A;  4QW9 A;  1UZH A;  1TP7 A;  4TLR A;  3MZI A;  4PUO A;  2P6S A;  5KFP A;  4QQB A;  3SFU A;  5J1E B;  2QL9 B;  1TL3 A;  1RAJ A;  3NNC A;  3BO2 A;  3L7P A;  2YKN A;  4X4Q A;  5F8H A;  2A6M A;  4LR9 A;  5KFV A;  2WON B;  1X4F A;  3RAM A;  1IQT A;  1X0F A;  4X4U A;  4N5S A;  2QYG A;  2DD8 S;  2MLZ A;  2M88 A;  3VAG A;  1HBM B;  1FRJ A;  3W66 A;  3ELH A;  3CNQ P;  2FJD B;  5BR8 F;  4ZS6 A;  1WOS A;  3J81 Y;  2IM3 A;  3MR6 A;  2M0G B;  3KNG A;  2IPO B;  1UL3 A;  3UR0 A;  2LDY A;  3CWJ A;  1V3S A;  4ICL A;  3J7Y I;  3HKZ D;  1NKE A;  3GFY A;  4DQQ A;  4N41 A;  1K44 A;  2ABY A;  2EBG A;  3PW2 A;  2ATC B;  5ETQ A;  3NGS A;  3Q8S B;  3ZTS A;  4B3R J;  2MQ8 A;  1OPZ A;  4H4K C;  1GMV A;  3EXY A;  1C1B B;  3MUV P;  3UI3 A;  1FKA F;  2GNK A;  1JXE A;  3MM6 B;  2MDA A;  3MAH A;  3MM9 A;  3FGV A;  1ZTT A;  3EGV A;  4I0W A;  1H72 C;  1RHR B;  3DRP A;  4KH0 B;  2X1A A;  4UY8 T;  4QWC A;  2HFN A;  1S6P A;  2ZWO A;  3E3X A;  2X51 A;  2R7R A;  4ZPD A;  3PTW A;  1RAD B;  4DV6 J;  2C2K B;  5C42 B;  3NY0 A;  3M8R A;  4O4G A;  3ITH B;  3N28 A;  1KQK A;  3AH6 A;  1VHI A;  2IIH A;  2V8V A;  4RW6 A;  1PJ6 A;  2VZ9 A;  2GGP A;  4HHH A;  1MWQ A;  2QL5 B;  1BQM A;  3HK2 A;  1UW9 A;  3K0J A;  4ZPV R;  5B0C A;  3CPW R;  3A13 A;  3JAM U;  2PFF B;  3BZQ A;  2ZVI A;  4JV5 F;  3QLH B;  1RHQ B;  3T6B A;  2ZJQ Q;  1YQH A;  4OI1 A;  2VFT A;  2XUL A;  2OSR A;  1N48 A;  3MCO A;  2I8E A;  2CJB A;  2MKH A;  2LA4 A;  4RKU C;  5CYQ A;  4DQP A;  4ED3 A;  1QE1 B;  3N4W A;  2PII A;  4P2S A;  2ZHB A;  4TU9 A;  2GQC A;  2MHN A;  4M5I A;  2DIV A;  4FF1 A;  5H9E K;  2I38 A;  1S0O A;  2H51 B;  1WF0 A;  4KC5 A;  2B9X A;  3WIU A;  5B08 A;  3JQK A;  2EFP A;  3SSQ A;  4DR7 J;  1U0H B;  4M1K A;  2Y0S D;  1S1W A;  5K20 B;  1R8A A;  4B9S A;  2E5H A;  5HSP A;  1RYS A;  1RT6 B;  5CYM B;  2B5J A;  3QMQ A;  4JB8 B;  3PZP A;  5KFH A;  1JLF B;  3UDC A;  5AXN A;  4PQU B;  2GHW A;  4R5P B;  1K73 T;  1T9Y A;  1SJ4 P;  2DIT A;  4LQ3 A;  2E5G A;  5I4M A;  2DGW A;  2YX7 A;  3K58 A;  2WHO A;  2QMU B;  2XBP A;  2DNQ A;  5L9N A;  2UXB J;  1R0A B;  2Z58 B;  4M5D A;  1MWZ A;  5B0G A;  3R6G B;  3G8S A;  4DUZ F;  2FJA B;  2IA6 A;  2PEH A;  1AZS B;  2BA9 A;  1S1X A;  4BCA A;  3QZ7 A;  1T9V A;  4IOB A;  2CVE A;  3D28 A;  4PWD A;  1RWV B;  1F9E B;  4X2B A;  1U2R A;  4OHY A;  3I4P A;  2MST A;  1BD6 A;  1RT2 A;  3MED B;  4DXL A;  4ZVT B;  3C46 A;  2KB2 A;  2LQ8 A;  3CUL A;  4BBY A;  3AXM A;  1RCX B;  1H0H B;  1RAF B;  2PA8 D;  4JOU A;  3GQC A;  4F04 B;  2QO3 A;  3HT0 A;  3QO9 A;  1HNX F;  3VAM A;  3D3B J;  1VJW A;  1XNR F;  2V8P A;  1HL6 A;  3FEZ A;  3R27 A;  4ETX A;  4UT4 A;  4I2P B;  2G2Y A;  2H1Y A;  4OHZ A;  3GV8 B;  4Q8F A;  4YB6 A;  2UUC J;  1U1K A;  1GMW A;  3IBF B;  1IKY B;  1S6Q A;  1LK7 A;  2RDJ A;  2BJE A;  3D54 A;  1F6T A;  1GXT A;  4ZP6 A;  4DPT A;  5KT4 A;  2BKP A;  1A0O B;  1R0B G;  4DV5 F;  5GAH U;  2E1A A;  2OPQ B;  4H4O A;  4UTG A;  1NRK A;  1R31 A;  2BOA A;  1FEE A;  3I6P A;  1VQ8 S;  3MR7 A;  3VQT A;  4DV3 F;  4O3Q A;  3O44 A;  3OUY A;  4QIF A;  1QUV A;  3W62 A;  3DLL Q;  4USM A;  2GIF A;  4EYH B;  3D9B A;  1KC8 T;  2DGV A;  2BQ3 A;  2DIS A;  3OQ2 A;  3PW4 A;  2BE9 B;  4WYW A;  3AOB A;  1N6Q B;  2MKY A;  1JNZ B;  3OPK A;  2CFX A;  4IYQ A;  5E7O B;  2DGQ A;  2KFY A;  1YJR A;  4KGK A;  3THV A;  1H98 A;  3LPE A;  3NOC A;  4WKY A;  2GMH A;  1MG7 A;  2OP5 A;  2MY8 A;  2YKM A;  3G9C A;  5GAG U;  2WOM A;  2YNH B;  3E8O A;  1FX2 A;  3ZO7 A;  1SH0 A;  5HO4 A;  1CBK A;  3BGR A;  3MR3 A;  3NL0 A;  5DLG A;  1NSK L;  1R43 A;  3IS9 B;  4ZP9 A;  3NCP A;  4JI6 F;  4JUZ A;  3PO5 A;  1J27 A;  3I5B A;  2HHS A;  1FRH A;  2M7S A;  4RO0 A;  3I0R B;  1MW7 A;  1UWB B;  1JJ4 A;  3DI6 B;  3G86 A;  1HNW J;  1YDL A;  1LWE B;  3I5C A;  3EPG A;  3HJV A;  3TZZ A;  4DL5 A;  3KK1 B;  1I1G A;  1N5Y A;  2DB1 A;  4I69 A;  1M1H A;  3BQ0 A;  2IBK A;  4ED8 A;  2QA1 A;  3QIP B;  1ZBT A;  3LAM A;  1SJQ A;  3HT3 A;  3C15 B;  2YQ1 A;  5CQG A;  2O01 C;  1O0P A;  3FDS A;  3T1H J;  1NEE A;  2HFO A;  2PD1 A;  4DQS A;  3VWS A;  4UUX A;  1DTT A;  3I56 S;  4DPW A;  3TVK A;  2KZM A;  2OMO A;  1KLM B;  1UWA A;  3HVT B;  2OH2 A;  5EWE A;  3NGU A;  1CC8 A;  3AD8 C;  2HVI A;  2EG1 A;  2XB2 D;  4CLS A;  4RR5 A;  5F8N A;  5A6W A;  5C25 B;  3MR5 A;  2ZE2 A;  5F0W A;  3CMA S;  3O1L A;  2PN6 A;  3KLV A;  1F2H A;  4Q5V A;  1VQ9 S;  1EET B;  2FVP A;  4IRK A;  4I6A A;  4OX6 A;  3ENV A;  3PIP Q;  3DLK A;  3CCR S;  1JX4 A;  3NMR A;  3B4M A;  3S6E A;  2ZFH A;  4UOC A;  1U49 A;  4OZ1 A;  2HGL A;  1D0E A;  3B4D A;  4B3R F;  1CJT A;  2UXC F;  2YWW A;  2WVB A;  4RBU A;  1RSC A;  1AFI A;  2N7C A;  1HAR A;  5DLF A;  4X4P A;  3I9V 9;  2R9L A;  1FVS A;  2HK2 A;  2D41 A;  2MKS A;  3C6T B;  1KTV A;  5BXI A;  4ES3 A;  2A1B A;  3M9O B;  4OZJ A;  4AQY F;  1PYT A;  2F9D A;  2UZA A;  5HVF A;  4BC9 A;  3W61 A;  3VAK A;  4X4N A;  2BJ9 A;  4ZPC A;  4DV6 F;  2DHH A;  4QR0 A;  2JDJ A;  2HVE A;  3A8J A;  2XSF A;  1Q7L B;  1MRO B;  4P75 A;  2VBY A;  3R7N B;  3AHP A;  5ETS A;  2F65 A;  5J2M A;  1X4B A;  1Q0N A;  2HNY B;  3D3C J;  3M1V B;  1HPZ A;  3TVY A;  5L9X A;  2R3V A;  1ZH5 A;  3MEE A;  2E5L J;  4LMZ A;  4NZ0 A;  3GWC A;  3AJ1 A;  2O66 A;  1X4D A;  2CQG A;  2E7V A;  2QLX A;  4K4U A;  3M8S A;  2MZR A;  2HHT A;  3BGU A;  2EC2 A;  2WVC A;  2DY1 A;  3LH2 S;  4ECQ A;  3BSN A;  2YKA A;  3V81 B;  3SMZ A;  5GVQ A;  3JQJ A;  5HMW A;  3EDQ B;  1X31 C;  1N88 A;  2Q3P A;  3C6U A;  3BPD A;  2CQ1 A;  4WIQ A;  4Y00 A;  3J7Z T;  2GA7 A;  4DR7 F;  3JTP A;  1XNQ F;  1YI2 S;  3T41 A;  2PDA A;  2MQQ A;  3M8Z A;  2FC9 A;  3VAI A;  1IKV A;  4Y65 A;  4IOC Q;  1T8E A;  3A1Y G;  2DVI A;  1FRK A;  4EI2 A;  4G1Q B;  4F4Y A;  3D0I E;  5KG2 A;  2HZA A;  2DO4 A;  1W2I A;  2R2S A;  3BRE A;  2XLK A;  1IN0 A;  2ZD1 B;  4Y28 C;  2F8M A;  1R6Y A;  4PG7 A;  1WOO A;  2DGX A;  3KHH A;  2DR6 A;  3K8W A;  4KSE B;  2GQQ A;  2OKQ A;  1LW2 A;  1RT7 A;  3OJS A;  2JH3 A;  1NXI A;  4P9S A;  1X60 A;  3WC2 A;  4DHV A;  4G6V B;  4RWW A;  1FRL A;  3C16 A;  1NLK L;  3N9U C;  2JEG A;  4KE5 A;  4P7T A;  4LR8 A;  4ZVU B;  2FDN A;  5KFQ A;  3FCW A;  1M5H A;  3QT8 A;  4OIX A;  2LQ5 A;  1HI8 A;  5IWA J;  3TQ1 A;  3P8B B;  4EWT A;  3SI8 A;  1A7G E;  1TKT B;  2MZS A;  2XMJ A;  3GV7 B;  3A4T A;  1F5B A;  2Z30 B;  2HBZ B;  5EWG A;  1AA1 B;  2XZD B;  1JLA B;  4C8O A;  2CZ9 A;  1HNI B;  2FYX A;  3IGV A;  4YY3 J;  2AWZ A;  4J9V A;  1TKZ A;  3D66 A;  3BYP A;  5KFE A;  2AD9 A;  1IBL J;  5BYR A;  2J0S D;  3PX4 A;  3VR1 A;  3DDK A;  1K47 A;  2UUC F;  1H6K X;  3KMS A;  4F4W A;  4AL5 A;  3PRD A;  5KG1 A;  5C24 A;  2XI2 A;  4FS1 A;  1JQG A;  2D3O 1;  4OX7 A;  2FB0 A;  3CD0 A;  3BYR A;  9ATC B;  4TY8 B;  3L4B C;  4DR2 F;  5B09 A;  5RUB A;  1R8B A;  5FII A;  4LSN B;  3PCO B;  2M5Y A;  1Q8I A;  1VQ6 S;  4ZLL A;  1RTH A;  3LQV A;  2WW4 A;  4EUV A;  4FXD A;  2VFV A;  4K50 A;  2QA4 S;  5SUH A;  3E01 A;  3FUY A;  2YX1 A;  3J7A N;  2E29 A;  1RJJ A;  1SJ1 A;  4JI0 J;  5D4O A;  3ENW A;  1APS A;  4ECR A;  4U96 A;  3H2U B;  1J5O A;  1YJN S;  4LF8 F;  1F0X A;  5AE2 A;  3PEJ A;  2XM3 A;  1UET A;  3CVK A;  1RTI B;  1YG0 A;  2GX8 A;  3KLF A;  2CJX B;  2NZC A;  3H5Y A;  1H7W A;  2RS8 A;  1S4E A;  2BMB A;  4DX8 H;  2YH0 A;  2DNG A;  1SUQ B;  2N3O A;  4OZ2 A;  5KT5 A;  5H9F J;  3MXH P;  4DL4 A;  1Q86 T;  4DQR A;  2HPU A;  4J9Q A;  5B0B A;  1B7Y B;  2ZHA A;  4CNZ A;  2FVQ A;  3OTO J;  3NBP A;  1DLO B;  1PGZ A;  2HMI B;  2BRL A;  3V6D B;  2OHD A;  4H54 A;  3CJ8 A;  1CJU B;  1QE1 A;  5FLX Y;  4DWI A;  4LF7 F;  3UFC X;  3DRR B;  2XGP A;  2P2C B;  3I0S B;  1MSW D;  1QTM A;  4LUB A;  2O67 A;  1N34 J;  4JV0 A;  2BE2 A;  3LAN A;  5A8W B;  1PO6 A;  3GPA A;  3RBD A;  5D77 A;  1D9D A;  5IFM A;  1FE0 A;  4G65 A;  2P8I A;  5DO2 A;  1REV B;  5L1J A;  2EWH A;  1RA6 A;  4QR1 A;  1S1T B;  2OPS A;  2V8G A;  4WCE Q;  4I2Q B;  4L75 A;  3PW0 A;  1U7L A;  4PG8 A;  1PJ7 A;  3AY0 A;  1DJ0 A;  1UP1 A;  4U95 A;  1N5Q A;  2YWF A;  1HYS B;  4X4R A;  1PBA A;  1NJW A;  2G0I A;  4FKY A;  3VV2 B;  1KWM A;  5GAD U;  4YR3 A;  2OPR B;  3IP0 A;  1YRT A;  4IDK A;  3OLB A;  5LSO A;  1O5J A;  4AD6 A;  1ZAX A;  5DDP C;  2UXD F;  1AZS A;  2HK3 A;  1ZS6 A;  3ILI A;  1BQX A;  4YS2 A;  5CZV A;  1RA7 A;  3TA0 A;  2J6U A;  1HHQ A;  1F1B B;  2VD3 A;  2H5J B;  3KMQ A;  3B78 A;  3TAM B;  1D1U A;  3QPI A;  4N76 A;  3T5K A;  1RWN B;  4B3M F;  2CKW A;  4A48 A;  4TQS A;  4WPA A;  3CED A;  4N47 A;  4Y34 A;  2RKI B;  4Z7Y A;  1TL4 A;  1FK9 A;  1LWF B;  4QOT A;  5BYQ A;  3R2C J;  3AB2 B;  1IUJ A;  4I2P A;  1RZM A;  2W2P P;  2H5I B;  2Y1I A;  5KFK A;  3GR1 A;  1FNM A;  1GTH A;  2XCA A;  4A8S A;  3QT6 A;  5KFF A;  3DCA A;  1D09 B;  2VPW B;  3EZ5 A;  1UVN A;  2GVD B;  2E5L F;  3UWT A;  2VQE F;  2VON A;  3KK3 B;  1WKL A;  4ATN A;  4J9S A;  3LA0 A;  4ECU A;  2UU9 J;  3F0N A;  3KLI B;  1QD1 A;  3R5A A;  5HP1 B;  1L3S A;  4P52 A;  1UJ6 A;  4EBE A;  2ZOM A;  1QSY A;  3ISN D;  1UMJ A;  1L3T A;  3T6J A;  2V0N A;  2KH9 A;  1Q8B A;  3W5Y A;  5AE3 A;  1WKK A;  5KFO A;  4LFC J;  3WBZ A;  1JK9 B;  2QLF B;  2HFZ A;  5L1L A;  3QJL A;  3ILJ A;  4MYT A;  1Q5Y A;  1S77 D;  4BDP A;  4CTA B;  1T3N A;  2CDQ A;  3R7B B;  5KG7 A;  2YNH A;  2HAI A;  1GFW B;  2JLG A;  3A3O B;  5DDQ C;  4USV A;  2KL8 A;  3OBI A;  4WK3 A;  3OD2 A;  3CXC R;  4YQW A;  2I2Y A;  3LWL A;  1NKB A;  4F7V A;  3TOQ A;  1VQO S;  3CB4 A;  4H4M A;  2WSF C;  2IDE A;  2A3J A;  1KR4 A;  2VA3 A;  2VQF J;  4K4W A;  4X65 J;  1FXL A;  4Q43 A;  2NUU G;  3HLU A;  3Q83 A;  1BQN B;  1CUL B;  5M2P A;  1N5T A;  4QWB A;  2CPE A;  2JRS A;  5CD4 A;  3TWZ A;  1NND A;  1KN6 A;  2W9B B;  1PG5 B;  2XGQ A;  1X4H A;  2VG7 B;  4QBU A;  3C15 A;  3OR2 B;  2VG5 A;  1YIJ S;  3Q2T C;  2GQ2 A;  3CJ3 A;  3MEK A;  1SQF A;  4YR0 A;  3U1L A;  5HRO A;  1TV6 A;  3RW7 A;  2HQC A;  5T7L B;  4M5G A;  4A8X A;  3TA1 A;  1X5O A;  3TRG A;  5HN0 A;  2C2O B;  4F02 A;  1KLM A;  4Y2K A;  2NS1 B;  4J90 A;  4KGV B;  2CPD A;  4NA2 A;  2H5E A;  4HHJ A;  1VC6 A;  3HMJ G;  2MGZ A;  3PRB A;  1L3U A;  1MN7 A;  1R27 B;  5GAH I;  1WWH A;  2F3J A;  1HHS A;  3MM7 A;  3J7A 1;  3UN5 A;  3SCK E;  2AIR B;  1Q81 T;  2OEL A;  4FF3 A;  4LRE A;  2E9R X;  4KT0 C;  2RE1 A;  4OV1 A;  2CPH A;  1NDL A;  4DEZ A;  4C3K A;  1P6T A;  4UQG A;  4LSZ B;  3BF4 A;  3HSG A;  2D9O A;  2ZOG A;  2JEJ A;  4HH0 A;  1RCO B;  3DLG B;  1EAY C;  2QT7 A;  2C42 A;  4LSL A;  2F4F A;  1NZA A;  4JI0 F;  4C2M A;  3PFO A;  4MKB A;  3IR5 B;  1BUX A;  3R5C A;  2WSE C;  2FLP A;  2BEF A;  2B4V A;  2RHQ B;  5KAK A;  5GAG I;  2I0X A;  4KJI A;  2DNN A;  3M32 B;  1MU2 B;  4FYD A;  2UVW A;  5IM0 B;  4F3O A;  1LQ9 A;  1T3O A;  4EFA C;  2P9C A;  3BH6 B;  3TYT A;  3FFI B;  3KLG A;  1S9F A;  5HJX A;  4HDG A;  1SXL A;  3QBC A;  3OXF A;  4DV0 F;  3DOM B;  1XIQ A;  1EP4 B;  2OGU A;  2J0W A;  4NLX A;  2HNY A;  3N0V A;  4NEY A;  3H40 A;  1LEO A;  5DG8 A;  5KFW A;  4FDF A;  3IXQ A;  2R7X A;  1FWL A;  2E66 A;  1WC3 A;  2RJZ A;  2VU5 A;  1TQL A;  2KM8 B;  3G82 B;  2G4B A;  3UNG C;  4XPC A;  2PMZ D;  1Y5I B;  5D78 A;  2HHX A;  1KHV A;  4HTJ A;  5L39 A;  1OY9 A;  1N34 F;  2LLZ A;  1QJH A;  3NXZ A;  4QJV A;  4NCB A;  2FZG B;  3ZFV A;  1CC7 A;  2HHH J;  4HDH A;  5JJB A;  1U6F A;  4IFY B;  5D0R A;  1R8C A;  2J5A A;  3R1L A;  3OVS A;  1N0V C;  1SKU B;  2F8H A;  1J5E J;  1ZM3 A;  3FK4 A;  1RWU A;  4TU7 A;  1BE4 A;  1B64 A;  3HZG A;  2DH8 A;  3BKT A;  4OV6 A;  1DTQ B;  4A8F A;  2Y9H A;  4RW7 B;  3CDA A;  4OMF G;  1R89 A;  4ZHR A;  3CUN A;  3SCI E;  1F9H A;  2MJN A;  3RAX A;  2AJQ A;  1NO8 A;  2DRB A;  2RF2 B;  4AFF A;  3FQK A;  1T9U A;  4V19 J;  3Q24 A;  5A8R B;  4W98 A;  4CM2 A;  3UCU P;  2XNR A;  1OIA A;  3M2R B;  1KKH A;  2L48 A;  1S0N A;  4ELU A;  4JV1 A;  2QJ3 A;  3RRH A;  2VKZ G;  3TAR A;  4JI2 J;  4CLT A;  3I55 S;  2HIY A;  2WAQ D;  4ZVS B;  2K06 A;  4YB7 A;  4BLG A;  2Q1L A;  4RNF A;  2JWN A;  4ZCI A;  2JLF A;  4DS4 A;  4WTY A;  1U1N A;  4V19 X;  2G2Z A;  1RI7 A;  1TKX A;  2KYX A;  1WC0 A;  1N54 B;  3LGN A;  2K2P A;  4TVA B;  3RYL A;  2DKO B;  1KOH A;  2NYI A;  1I94 J;  3M8Q B;  2LXF A;  2ZH2 A;  5K8N A;  4ANE A;  1PC4 A;  3JSM A;  1U8S A;  3DRS B;  2HG4 A;  3C66 A;  3UNY A;  2R8J A;  1N0U A;  3TNV A;  1CS4 B;  2KTQ A;  2OAU A;  4RW9 A;  2RQC A;  2W4P A;  3WDO A;  3J81 U;  2CG8 A;  1Z2L A;  1JLG B;  3MCN A;  2C2E A;  2UU9 F;  2XMV A;  3HD1 A;  5E3A A;  1D9F A;  1MMD A;  3U1M A;  4F50 A;  1VRQ C;  5K8P A;  3EUN A;  3SQG A;  3P45 B;  4KGX B;  2UVV A;  1HBU B;  2N4C A;  5CXT A;  4OI2 A;  2XS5 A;  3MI7 X;  1S49 A;  4LFC F;  2CPJ A;  1Y3J A;  2NSC A;  4KFB A;  1YK9 A;  2I5J A;  3FEY B;  4CYU A;  4I64 A;  4QIV A;  2ZKT A;  3MD1 A;  1AW0 A;  1DQA A;  3J7Y U;  2IVY A;  1WJ9 A;  2FHO B;  3WX4 A;  3T5H A;  5J2N A;  3T1A A;  5C2G A;  4GC6 A;  2L08 A;  3ILO A;  5F3Z A;  5E3Q A;  4LFB F;  3R9L A;  2MQO A;  3SXL A;  1PJ5 A;  1S9G A;  4J9R A;  5FDL A;  4IH7 A;  4WXW A;  4ZIW A;  2E1C A;  2DNR A;  3BGL A;  2L41 A;  2IYG A;  1T03 B;  4YHH J;  4DBQ A;  2POK A;  2J7K A;  1LFP A;  2R2R A;  3DM2 B;  2IRX A;  3ETO A;  2KU7 A;  4OJH A;  4WZM A;  4ZVG A;  4DV1 F;  2ZH9 A;  3I31 A;  4ZN3 A;  2UVR A;  4C0O C;  3PR5 B;  5HI7 A;  3Q0A A;  2QV6 A;  3HHK A;  2EEY A;  2FVC A;  3DRR A;  3ONQ A;  2YPZ A;  3MUR P;  2J7W A;  4ZIV A;  1WD6 A;  2CPI A;  4HEA 9;  3CJQ A;  4PAB A;  3IRW P;  4DL3 A;  2BW7 A;  2DT9 A;  2IJR A;  1YBU A;  3PW5 A;  4C11 A;  3K59 A;  1VLY A;  4FP9 A;  4ZCM A;  3BR9 A;  1Y9O A;  1VQ4 S;  3BB5 A;  4C48 A;  2OEK A;  2NSB A;  4FF4 A;  2VOO A;  1X4E A;  2QMX A;  4OYO A;  2MZQ A;  3ET6 A;  1TU0 B;  4KO0 B;  5D4N A;  3TUJ C;  1JLB A;  2MQN A;  2M9K A;  1REG X;  4F36 A;  4ZA1 A;  4DI6 A;  2G0C A;  3LAL A;  2LU2 A;  2ZBR A;  1FTC A;  3N6L A;  4IOA Q;  4C0B A;  1F9F A;  4MYU A;  4O44 A;  3QGI A;  1HNV A;  4HL9 A;  3S01 A;  2Z57 B;  4M5H A;  4QIW D;  2EFN A;  1VQN S;  3W9H A;  3I87 A;  2A2C A;  4I68 A;  2R7V A;  1XTZ A;  4GRS A;  1HQE A;  1WKJ A;  4ECX A;  2YVS A;  2ZH3 A;  2VBW A;  2GC8 A;  4LIW A;  5F0U A;  5J2P B;  1FFW B;  4O3N A;  1SV5 A;  1D3W A;  2AGQ A;  4UZB A;  5HLF B;  3CME S;  4IQX A;  3O3L A;  1LK5 A;  4IUF A;  2CJY B;  4AL6 A;  1X7V A;  2PT0 A;  3PG9 A;  1N32 J;  3HUL A;  4LRA A;  3ZTO A;  1IVZ A;  1X0P A;  2LQ9 A;  1TL1 B;  4KPC A;  3TJ9 A;  2HS3 A;  1TTH B;  4F0K A;  3HHE A;  2ZBC A;  1JLQ B;  1XR6 A;  2B4P A;  2IVF B;  1M5V C;  3MTJ A;  2MYF A;  3CCQ S;  3D0H E;  3CO0 P;  2QSW A;  3UVJ A;  4NXN J;  4HI1 A;  3GCX P;  4ZIT A;  2MB0 B;  2CQ3 A;  4K4S A;  1RWW B;  2FVR A;  3A8E A;  2AV5 A;  4XK8 C;  4IG0 B;  1ZOT A;  2CA9 A;  2BKO A;  3CJK A;  3GIL A;  4KIA A;  1SIZ A;  1YZ7 A;  2DR9 A;  1TL7 A;  3RJM B;  5GAE I;  4OYB A;  2KI2 A;  2MKI A;  2YNG B;  2HHH F;  4OI3 A;  2HS4 A;  3CO9 A;  4KHM A;  3MEC A;  1L3V A;  3OR1 B;  2X1B A;  4D3H A;  3B6B A;  4NL5 A;  2BW2 A;  1JLC B;  5LXR A;  4TKT A;  1XER A;  2L9W A;  1J5E F;  2WK4 A;  5DQI A;  5E3P A;  1SC4 B;  2UV8 A;  2PFD A;  1NHV A;  3MMC B;  4ZPB A;  5CYJ A;  4RUA A;  2ZKU A;  3JSB A;  4U8Y A;  2ZJP Q;  3QSY B;  3M7V A;  3M4X A;  2XY5 A;  4RW4 B;  4C7Q A;  2DCL A;  7FDR A;  2DXF A;  2KT5 A;  1U1M A;  2ASL A;  1WUU A;  5DQH A;  5DM6 Q;  3SBM A;  3G6V A;  4NLY A;  3UDE A;  3Q8P B;  3J80 Y;  1DY3 A;  4LFA J;  1UJ5 A;  1RTJ B;  4RUH A;  1EZZ B;  1VQS A;  3EDR B;  3D6M B;  1VI7 A;  3JSY A;  5F9L A;  2DPI A;  2LDI A;  5LJ5 Y;  3ADA C;  1BXN A;  2DCU B;  3N79 A;  5B7W A;  4K4X A;  1DQ8 A;  4P2M A;  4PYA A;  3W64 A;  2KXF A;  3UR3 C;  1RHU B;  5DJB A;  3WHI A;  1XQI A;  5ETO A;  3GG1 A;  4EU0 A;  4IG3 A;  4DG1 B;  4ZPW R;  1UVK A;  2PO4 A;  5FD1 A;  2D1C A;  2HBY B;  4TYA A;  3SDE B;  3TVZ A;  1SKS A;  1I94 F;  1GXU A;  3UCG A;  4B9L A;  2MZT A;  2ZDP A;  2QSF A;  2WVF A;  3CCZ A;  1C0U A;  2RSQ A;  1Z2Z A;  4ED2 A;  4LVN P;  5DGA A;  2FJE B;  1C1C B;  3BQ1 A;  3N01 A;  2VUG A;  3W2V B;  2VPY B;  4IQM A;  5J1P A;  4GKK J;  3MWB A;  3PEH A;  2CQ0 A;  2QLJ B;  2ACY A;  3HDS A;  1T9W A;  1WF2 A;  1RT1 B;  1G3O A;  2HQF A;  4C98 A;  3PDN A;  3BO3 A;  2QTW A;  3OHA A;  3KUG A;  2LCW A;  3ZZR A;  1LW0 A;  1WF1 A;  5A0Y B;  1DAR A;  1JNR B;  2IYI A;  1Y7P A;  2QRR A;  3QQC D;  1NK6 A;  3M2U A;  1T9T A;  2YQ3 A;  3EGN A;  1HKA A;  3JS9 A;  4F3M A;  4XIU A;  1S6U A;  4PAA A;  4MIA A;  3VVU A;  4PXE A;  4WK1 A;  4WP3 A;  3CIZ A;  3FSY A;  5G0R B;  1JLE B;  3BKF A;  1FDN A;  2JC1 A;  2KRB A;  4ZVF A;  3BDP A;  3M32 A;  2FVS A;  1WG5 A;  3M30 B;  2ERR A;  2VB6 A;  2DPJ A;  1FJG J;  1S76 D;  5ITH A;  4RJV A;  3CJT A;  4J9P A;  2EBE A;  1OPI A;  3NCQ A;  2UUT A;  3MM8 A;  3FBF A;  2XLJ A;  3R7S B;  1E6V B;  4HAC B;  2CQH A;  4NLQ A;  4OHW A;  4ZVP B;  3MMJ A;  1SKR A;  1E6Y A;  4QWA A;  3DLE A;  4YHH F;  4DS5 A;  3IBW A;  4I6W A;  2K1R A;  3P6Y C;  1GAO A;  4E2F B;  4EEY A;  2R8K A;  1VRT A;  3U27 A;  1BMQ B;  1RBO B;  1SJF A;  3WQP A;  2M3D A;  1GTE A;  1J2V A;  5F8I A;  2NCK L;  4I4B A;  2BYC A;  3NOG A;  2ZBI A;  2QN6 B;  1W7W A;  4OQJ A;  2MLY A;  2AYB A;  3SEO A;  1U8W A;  4JV5 J;  5LMN J;  2EFG A;  2XS2 A;  1ZAV A;  3POT B;  1C0T A;  3MTK A;  5KFX A;  2FGC A;  1XR5 A;  4DSK A;  1ZPV A;  4NLU A;  2VOD A;  1ZM2 A;  5L38 A;  3RW6 A;  3CJR A;  3QT5 A;  5KFT A;  5IT0 A;  4WP8 A;  2JOQ A;  2LEP A;  4OI0 A;  2NXN A;  2IAJ A;  3F41 A;  4PXD A;  3ZZT A;  4XDC A;  1FVQ A;  2GW8 A;  1NM2 A;  3AQP A;  4N77 A;  4O3R A;  3AOD A;  1BY9 A;  4KV8 A;  2DEJ A;  1UFK A;  3G96 A;  3DC2 A;  2XMW A;  1R8P A;  2GJI A;  3QSI A;  4R8U B;  4NYZ A;  4W4M A;  2V4J A;  3NS7 B;  5IZH A;  1KOO A;  4ID5 B;  5A8R A;  4LF5 J;  4LF2 A;  3M8Y A;  1AB8 A;  1EAR A;  1VC0 A;  3RRG A;  3HHN B;  2B7B B;  1S9E B;  2M4M A;  3KUH A;  4MJK A;  1RAE B;  2Y8Y A;  2FZK B;  4PG6 A;  2FY8 A;  1HBO A;  3BQ2 A;  1HWK A;  2WBM A;  2V2K A;  2F9J A;  4OFZ A;  1FDA A;  3TX0 A;  5D3G A;  4AYB D;  1S72 S;  2ROP A;  2O5D A;  2CVI A;  3QRR A;  1ACM B;  3BS9 A;  2D3Z A;  1N32 F;  1BC6 A;  1U09 A;  1FKP B;  3B8H A;  2XO7 A;  3F73 A;  4F4K A;  1WC1 A;  4KGM A;  2RDD A;  4HYK A;  2NUH A;  1NJX A;  4YFU A;  2ROE A;  4TQR A;  3M8W A;  1HIY A;  4Q0B B;  2DNP A;  3DHX A;  1VK3 A;  5C5J A;  2JJ4 D;  1WNE A;  1ZZN A;  2V9W A;  2JZ5 A;  1TL5 A;  3HXM A;  3R5G A;  4IH6 A;  5DQG A;  1S12 A;  2V34 A;  4LF6 F;  4ZPT R;  3D6H B;  4J91 A;  4UUW A;  3T5J A;  1KVJ A;  1HNX J;  1S10 A;  5C2C A;  2OEM A;  3CMQ A;  1EQM A;  1XNR J;  2J0X A;  2IMO A;  3P5B P;  2XTJ P;  3HFK A;  4MFB B;  1Z4U A;  1S1V A;  1RKJ A;  3HFV A;  3BSA A;  3SCJ E;  5KFM A;  1S7H A;  5F8G A;  4CLF A;  5CH7 B;  2COL A;  3KLH A;  4DV5 J;  3KG1 A;  5KFN A;  4AUK A;  1Q1K A;  1VOM A;  5F8J A;  1T05 A;  2OPP A;  4E98 A;  3EPI A;  5I42 A;  4EBD A;  2HVH A;  2FIU A;  2IRY A;  2OSQ A;  4QYZ J;  3KK2 B;  1QVG R;  1Y3K A;  2PI4 A;  2HHV A;  3LP0 B;  4URQ U;  1RAO A;  2HQD A;  1UAW A;  2V94 A;  3MHY A;  1TVR B;  2KVQ E;  2YTC A;  2KHD A;  1TMJ A;  4NCG B;  2AJF E;  4DQI A;  3HF5 A;  3NNH A;  2A0F B;  2M2B A;  5ETM A;  3MPW A;  4LFA F;  4RNO A;  2G9O A;  1SQG A;  2J7U A;  1MMN A;  3SFG A;  2AQ4 A;  3QJJ A;  2B51 A;  1CPZ A;  4I7F A;  2RUG A;  3ULH A;  3ZTR A;  3R3T A;  1UCN A;  5E3C A;  2GVZ B;  1YX2 A;  3LF0 A;  1VFJ A;  1XBW A;  3UDV A;  9RUB A;  2KHC A;  2BQR A;  3PJX A;  1RTD B;  4GMK A;  2VH7 A;  4PEO A;  2KFN A;  5KFU A;  2GAH C;  4NI2 A;  4J5O A;  1LWC A;  3AA9 A;  4N8N A;  1FX4 A;  2B3T B;  5KFI A;  3DOL B;  3G6E S;  1V9O A;  1FES A;  3S7R A;  4DL6 A;  3DGP B;  3AT1 B;  1FJ7 A;  5A76 A;  4LR7 A;  5KFB A;  5HJY A;  4CCH A;  4GKK F;  2DEI A;  4J9U E;  3IRX A;  1NDK A;  1YBT A;  1HR0 F;  1YJU A;  4LRB A;  3EVW A;  4F25 A;  2VPZ B;  1EKR A;  2W9C A;  5LSR A;  4U7U K;  1VLO A;  5D0G A;  1H2T Z;  2QA2 A;  3T5L A;  3M8P A;  2ACM A;  2GIQ A;  1WEL A;  4ZLJ A;  1PSD A;  2FZC B;  3EMT A;  2F4V J;  3UN2 A;  1EJ7 L;  2LU1 A;  2KXN B;  3GU0 A;  4NWB A;  1YLX A;  4UST A;  3HZE A;  4JI3 J;  1RIS A;  2XEX A;  1HFE L;  2QMW A;  1X8D A;  3CCM S;  3DMJ A;  1M1K T;  4L72 B;  3OXL A;  2B56 A;  2B6A B;  3CD6 S;  2RQK A;  4CI0 B;  4FS2 A;  5IV4 A;  3J7Z 5;  4X4O A;  5HLF A;  5LM7 E;  2IBO A;  2MKK A;  2UXC J;  4NE9 C;  2R7S A;  1FJG F;  2CQB A;  4RW8 A;  2QL7 B;  1NJZ A;  2DNM A;  1M0S A;  2M8D B;  3QGG A;  4KKO B;  1U1L A;  1HD1 A;  5L1I A;  1KTQ A;  2DIU A;  2IM0 A;  4NLV A;  2VFS A;  3DYA A;  3KJF B;  3IC1 A;  3K5M A;  3GE9 A;  5GMD A;  2HWI A;  1ZM9 A;  4AQY J;  3PX6 A;  3ENA A;  5C7P A;  2ZH5 A;  2LEB A;  4UOF A;  3CCV S;  1LXN A;  1GMU A;  4AE5 A;  1IKW B;  3FCV A;  1DZ5 A;  1Q79 A;  1YSJ A;  1QDU B;  3RG6 A;  2LVW A;  1HMV A;  2UUA J;  2M52 A;  1N5S A;  4WTO B;  2ZZT A;  3MMB B;  2FJV A;  4RU2 A;  1SL2 A;  2DO0 A;  4K5R A;  3CJS A;  2CPY A;  1RAI B;  2H4W B;  5LMN F;  4NLD A;  2EFQ A;  2B43 A;  3Q2S C;  1NKC A;  1G6B A;  4IFV B;  5A2Q Y;  1CJV A;  1WC4 A;  4USK A;  4RBV A;  1RWP B;  4M5M A;  2JHE A;  3HHL A;  4OL8 A;  2EPI A;  1HW8 A;  4J9N A;  4CLY A;  1A9N B;  3O5T B;  3T9N A;  1VC5 A;  5G4D A;  3IFE A;  2DNK A;  4HT7 A;  1HQU A;  2FLN A;  1UW4 A;  2EFV A;  2VL1 A;  4A8Q A;  3MMA A;  3KLE A;  4DCP B;  3JTN A;  3CCS S;  3PHE A;  3NWR A;  2AJ4 A;  5LMU J;  2YNF B;  1XNQ J;  2CQI A;  3D1O A;  2R4F A;  2ZWP A;  1JB0 C;  2PE8 A;  3IG1 A;  4LF9 J;  2AEM A;  4LF5 F;  1XMQ F;  2ZHO A;  1DUR A;  1X4C A;  1RTJ A;  3EE3 A;  3SSR A;  1F3V A;  3TEG A;  4PPZ A;  4PUO B;  2PEB A;  3H4D A;  1M1G A;  5GME A;  1NPP A;  3F56 A;  3K5O A;  2A2D A;  1N33 J;  2YKN B;  1KD1 T;  1WHX A;  1U47 A;  5F41 A;  2LFV A;  3DN9 A;  3RTV A;  3M9M B;  3LOU A;  2LYV A;  1RWK B;  4X62 F;  1OS5 A;  1DRZ A;  4OLP A;  4S0M A;  4DR5 J;  3W8G A;  5HK4 A;  2ZNZ A;  1G1X A;  4OYI A;  3LGM A;  3FSI A;  1HBN A;  2BBE A;  4PXC A;  1VQ7 S;  3KDN A;  2JVO A;  4ICL B;  4IRC A;  5HQL A;  4DPU A;  5LXY A;  1FD2 A;  1S99 A;  2QLW A;  3W2V A;  3MEG A;  4OYX A;  1U25 A;  1U2C A;  4OZ0 A;  4C8Z A;  2HQG A;  1PAE X;  2CJQ A;  4JYA J;  1PIL A;  4Q44 A;  2DH9 A;  3MM9 B;  5CAB A;  1N52 B;  2U2F A;  1S97 A;  2E9Z A;  1YRU A;  4B02 A;  1NSQ A;  5HMZ A;  2CQP A;  3FBC A;  1VIX A;  2MPU A;  1XN9 A;  3B82 A;  4FN5 A;  3AXK A;  2JVR A;  2LMI A;  3I32 A;  2P5V A;  2AYG A;  5I3U A;  4IR9 A;  2XMM A;  4XTT A;  2YXL A;  2HFS A;  2Y1R I;  1L3K A;  2RIL A;  1FRI A;  4O4G B;  1CEZ A;  4CO1 A;  1UA1 A;  3KFW X;  1LOU A;  2H48 B;  4FYV B;  3UCZ P;  3UD3 P;  4RW6 B;  4DR2 J;  4O3P A;  2ZUG A;  1P27 B;  7FD1 A;  4I56 A;  1FFS B;  2GGP B;  1FA0 A;  1BQM B;  3ZZZ A;  2RQM A;  4FNI A;  4UOH A;  1SL1 A;  2XZT B;  2Z8Q A;  4H4K A;  2QC3 A;  3VGS A;  2AJ1 A;  4C0H A;  4HAC A;  1Y00 A;  4YDX A;  3GIR A;  1AYE A;  1RGV A;  5CHC B;  3AOA A;  5CYQ B;  1LKZ A;  4CLP A;  5F8M A;  4B9N A;  1H3D A;  1XR7 A;  3GJQ B;  4WE1 A;  4KPY A;  4LF8 J; 
#chains in the Genus database with same CATH homology
 1VYA A;  4C6A A;  5CAB A;  3G2X A;  4O0N A;  4ANC A;  4DUT A;  1S59 A;  2NCK L;  3EMT A;  3EE3 A;  3BH7 B;  1NSQ A;  1HHQ A;  3VGT A;  4HR2 A;  1MN9 A;  3NGT A;  3ETM A;  3FBC A;  3ZTR A;  1WKJ A;  1BUX A;  1UCN A;  2AZ1 A;  1W7W A;  3BBC A;  3EIC A;  3EVM A;  4WBF A;  1S5Z A;  3EJM A;  1NPK A;  3MPD A;  1WKK A;  3ZTQ A;  2BEF A;  2B8P A;  3GPA A;  3DKD A;  3JS9 A;  1U8W A;  3VGV A;  3NGU A;  1EHW A;  3Q8Y A;  1XQI A;  3VVU A;  2HVE A;  3ELH A;  3B6B A;  2BX6 A;  5IOL A;  2B8Q A;  3FKB A;  4FKX A;  2CWK A;  2HVD A;  1KDN A;  2DYA A;  2DY9 A;  3Q8V A;  1NDC A;  3BH6 B;  4S0M A;  3Q86 A;  1BE4 A;  3PRV A;  1LWX A;  4AND A;  2AZ3 A;  3L7U A;  3ZTO A;  4ENO A;  2HUR A;  3EM1 A;  1MN7 A;  3GP9 A;  3DDI A;  3BBF A;  3FBB A;  1NSK L;  1K44 A;  4ANE A;  4DZ6 A;  4KPC A;  2DXD A;  4UOH A;  2ZUA A;  1HIY A;  3R9L A;  1F6T A;  1HLW A;  3FBF A;  4CP5 A;  1NSP A;  1B99 A;  3NGS A;  1XIQ A;  1NDK A;  4FKY A;  3ZTS A;  1PKU A;  3VGU A;  3VGS A;  1NHK L;  4F36 A;  1S57 A;  1NDL A;  3Q89 A;  4DI6 A;  3EVW A;  3FC9 A;  3ENA A;  3FBE A;  5C7P A;  1JXV A;  4UOG A;  4UOF A;  1NB2 A;  3WX8 A;  2DXF A;  1WKL A;  1LEO A;  3Q8U A;  1NLK L;  3BBB A;  1B4S A;  3NGR A;  3EVO A;  2DXE A;  1PAE X;  4F4A A;  1ZS6 A;  4W98 A;  3Q83 A;  1NCL A;  2VU5 A;  1F3F A;  3FCV A;  1NUE A;  5CAA A;  4EK2 A;  3VVT A;  3ZTP A;  3FCW A;  1NDP A;  3PJ9 A;  3B54 A;  5BXI A;  1BHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...