4BHQA

Structure of the periplasmic domain of the piln type iv pilus biogenesis protein from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
AVPWSQYLAAFINQIPRAGGRLEVALRSVSARALSEEEAARLAQEGTYDGKRIRVEFALQGEALSREALVRFIRAFETSPRFGIEFQGASLDEGRGLYTFSARVGVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords COMPETENCE PROTEIN PILN
publication title Structure and Assembly of an Inner Membrane Platform for Initiation of Type Iv Pilus Biogenesis
pubmed doi rcsb
source organism Thermus thermophilus
total genus 30
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18222 PilN_bio_d PilN biogenesis protein dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2830 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4bhqA00
4BHQA
chains in the Genus database with same CATH superfamily
4F4KA 3M2UA 2MKJA 4J9LA 1JMTA 3UCZP 1RHQB 1NK4A 4GO7X 3FK4A 2BE7D 2J8AA 1XERA 4F0KA 1FRJA 3LALA 1N36J 1U1NA 4NA3A 4DL3A 4LF4J 1OY8A 2V9KA 4IH6A 4EYHB 4L74A 3QATA 4C3KA 2AYGA 1HMVA 2N7YA 1F9EB 4JI5J 4TNOA 4ED0A 1R8CA 4F8RA 2NYHA 5KFOA 4QWCA 4ECQA 2EXUA 1N48A 2F5GA 4DG1A 2B9EA 4WKRA 2ATCB 1M1HA 2APOA 1YJ9S 2ZZNA 2YH1A 2V8VA 2VODA 4ZHRB 4B3RF 5ETMA 4LREA 3FBFA 1OQ6A 2DHXA 4USIA 1NZ8A 1HNWJ 1XTZA 2XWYA 5A8RA 2VBXA 3TEHB 2R2RA 4B17A 1RAEB 2XHWA 3RTVA 3CC7S 2JSXA 3OUYA 1KLNA 4DUZJ 3DOLB 1EHWA 1YZ6A 2H1YA 3DGPB 2H5IB 5F9NA 2R9LA 1KHVA 1YJUA 2V4QA 1NDPA 1XEZA 5HI7A 2LECA 3EZUA 4WTOB 4Y0FA 2P5VA 1G6BA 1KS2A 3W63A 3IR6B 2E9ZA 4IRDA 3EMTA 1PJ7A 4JBCA 1X4AA 2LEPA 4YEAA 1T9XA 3G96A 1S97A 4ATNA 3J7ZT 3AJ2A 2XZTB 4DR7F 3RUBL 1IBLF 1O6XA 3MDFA 2GGPB 2CA9A 2ZBQA 3PYFA 3PRVA 4XPEA 2VFVA 3CDAA 2YX1A 4OI3A 5L1JA 4X4UA 3E3XA 1HD0A 3TW0A 1LKZA 3VAFA 3RG6A 2IVMA 3W5XA 2JFKA 2NSCA 5F0UA 1FXDA 3N01A 3RB6A 4KHMA 3P45B 3R2CJ 3NAIA 5H9FJ 3DLKB 4D3HA 1HPZA 4QIEA 1TAUA 4Q8EA 1ZH5A 5C42B 1KBRA 5GAHU 3GU0A 4DF4A 3DRPB 3HVWA 3QLHB 4UT4A 1PYOB 1SJ1A 1B0VA 2PT0A 3UNGC 2E29A 2CQPA 4CM2A 5F8LA 2DGSA 1UVIA 1C1CA 2CWXA 1YG0A 4NZ7A 3FZBA 1MWZA 1TELA 3QGGA 1CULB 2CJYB 5HANA 2YWWA 1NK6A 3I87A 1QSSA 4I69A 1FJCA 1LXJA 3OLBA 2YWKA 2Z8QA 1TUVA 5IC6B 3WZ0A 3IO1A 3IFEA 4EBDA 3FFIA 5KFAA 2HNDB 4G1IA 3SCLE 2W8LA 4FS1A 3LGNA 1QE1B 4ZVHA 3CJ3A 1SKUB 3AD9C 4R8UA 4O44A 3BBFA 5KFEA 2YQ0A 2KT5A 1FEHA 1VJQA 2JWNA 2ZJQQ 2R2SA 2HGMA 3KDOA 2PEHA 1VISA 4MFBA 4EEYA 3TYTA 4OYIA 4N8OA 3GYGA 2JVRA 2VFUA 4Y2KA 1IKYB 3J7A1 5LMUF 1UKUA 4HTJA 3DLGA 3QAUA 2VG6A 3TZYA 6FDRA 4TYAA 2EWHA 2C2KB 3CDBA 1ZOTA 1BQMB 4Y3CA 2KJVA 2CG4A 2ASJA 1E6YB 2DRAA 4DSEA 5A76A 2CNKB 2UZAA 1G1XA 1MNEA 3MAQA 4FVCA 3V4MA 3VZHA 2F9DA 5J2PA 2L9DA 2X3DA 1Y3JA 5T41A 5KFPA 4CNYA 2VPYB 4C0OC 4X66F 2QZ8A 3FQKA 3UE2A 5EX3A 3I5AA 3MM6B 4L3NA 5GAGI 3FUYA 1WTFA 2OTJS 5F8NA 4GO5X 3RAMA 3OJUA 4KY3A 1WHVA 3M1VA 1EARA 3AODA 2N4DA 1XMOF 1UVNA 2PMWA 1Y3KA 1QY7A 2UXBF 3A8KA 5D4OA 2V5HG 2EFPA 3R5CA 2R3VA 4HHUA 1ZBTA 4Y65A 1APSA 3IWXA 2EI5A 1QLNA 2B9WA 1HARA 3W2VA 2LCWA 1WI8A 2V6AA 1YBAA 2VPZB 5EHHA 3NL0A 1N6QB 2RNEA 2XS2A 5CYMA 4B3MJ 5DO2A 4ZJOA 4WFAQ 3PNIA 1ZA2B 1TMJA 3KWMA 2HHPA 2O67A 1FRXA 4PWDB 4AE5A 3GP9A 3W9HA 5T14A 4KGXB 2ZC3A 3CC4S 5CD4H 2OD4A 4JI8F 2FHKA 4TU9A 1W2IA 3EDRB 2W7PA 1FERA 2XMJA 2N82B 3TX0A 1XQIA 3OTOJ 3P6YC 2ADCA 1V3SA 2BANA 3TZZA 4N76A 1DRZA 1WEZA 5L1KA 3KLIB 1EETB 3C19A 4H54A 1CEZA 1P6TA 2HIYA 2V2QA 1NSPA 3HXMA 2DY1A 2XMTA 2W4PA 3M9OB 4ER8A 1S72S 1VYAA 3VWSA 2C3YA 2ZFHA 3MECA 3CCWA 2GX8A 2ZKTA 4YQWA 2WBMA 1FJEB 4O3SA 4CO1A 2MZTA 2MY8A 1ZTWA 5RUBA 1FE4A 5HATA 2R8GA 1UW9A 4YB1P 1LWCA 4OZJA 4ZCLA 5DLFA 3PEJA 2K2PA 3OBIA 3SQGA 3HT3A 1HNVB 3MPVA 2XCPA 2GMJA 3OLAA 2LA4A 1SC6A 2OIHA 1WSRA 4J9NA 4JYAJ 1FNMA 2M9KA 1FRMA 3BO3A 5FDLB 2DO4A 2XMUA 1BXNA 3BN7A 2HBRB 1PBUA 3ENQA 2AKWB 1FD8A 4N47A 2YKMB 2MDAA 1RTJA 1RAAB 2CJQA 3LP1A 5KFVA 4FPRA 3T1HF 1TL7A 4HLBA 1HNXF 1TP7A 3TA1A 3ILLA 3LAMA 3QFHA 2XYHB 1U0HA 1XWLA 2B5JA 4CO5A 4I6WA 4GC6A 1VRQC 3DOMA 4C4WA 1AFJA 3F56A 4NCAA 4HVZA 3OR2B 4HT7A 4Y28C 1JLFA 2QYCA 1XMBA 3K17A 3Q8PB 3AFGA 4K4VA 5AXNA 1AB8A 1NJZA 3FQLA 1B3TA 5E7OB 4UQGA 2R7WA 3RB3A 5ETOA 3QT5A 4K7QA 1R0CB 1QAJA 1VLYA 3SFUA 2B6AA 4WXOA 4TKTA 4OLOA 3C6TA 4EO8A 3K5MA 2IAJA 5G4DA 2QLXA 4AFFA 3PXGa 2VJVA 3HFKA 2XI2A 2C28A 2OPSA 4FYXB 1LWFA 4G6VB 3KJNB 1K1SA 2P9GA 3NOCA 4DS5A 3VV2B 1D09B 3QT6A 3W61A 3DXBA 4RNHA 1C0TB 4ANCA 5KFQA 1NB7A 2FIUA 1RDRA 4MJKA 4QIWD 4A8WA 1HWUA 2C2NA 3LP2B 1TKTB 2DCLA 4AD6A 4GVLA 4M5GA 1WC1A 2Y9HA 9RUBA 4FF4A 1OY6A 4NWBA 3N79A 3HULA 3M8SA 1RT5A 3MXHP 3EYZA 4Q7AA 4DR7J 3Q89A 3O3LA 1IBLJ 3OFFA 4WZQA 5JJBA 2MB0B 4KKOB 3IC1A 4CLWA 5HLFA 5KFUA 4K4XA 1YVFA 1WG1A 1X9WA 1MU2B 4HI1A 1WKKA 1CJUA 4DX5A 2IMWP 3OJSA 1GX5A 2ZZMA 4GVBB 3DRRA 5KFDA 2ZJRQ 2VONA 1UVKA 1OO0B 1BY9A 3N6LA 4IDKB 3HHEA 3LPYA 1TV6B 4ELTA 1QSLA 4N77A 3TUZC 3QNWB 4R0JA 3IMQJ 3IWLA 2L3MA 4DR5F 5GVQA 4ZIVA 3H2LA 3HF5A 3K58A 1M5VC 2DGXA 2L08A 3K57A 4FYYB 1FEEA 3QWUA 1G2EA 1D9FA 2Y0BB 4C6AA 4O3OA 4NCGB 3I0RA 2GVZA 3EJMA 4I4BA 2GIFA 4HACB 1NPRA 4OHVA 5CZXA 1NPKA 3JB9k 3C8YA 2JHEA 2ZC4A 1VQ8S 4M95A 2DO0A 2BJ8A 4WWSA 1G3OA 2Q43A 3MM5A 2RMLA 4I2PA 1RUSA 4I0WA 1Q82T 4WXWA 4X4NA 1GMWA 2NREA 2LVWA 1RT4A 4KHPJ 4K0KF 2C3PA 2OPRA 5A6WA 2JVOA 1RKJA 2OPPB 1HYSA 3SSQA 3GFHA 3G6XA 1ACMB 1FKAF 2H9ZA 1FWPA 1PJ6A 3GIIA 3NBPB 2J9CA 1FCAA 2F3JA 3MM8B 1U1KA 2BRLA 4ZPVR 4EBCA 1T9VA 3CD6S 1TQLA 4FXVA 2GZOA 4TLRA 1ZETA 3UNYA 5EGYA 3HSGA 1NHVA 3DYAB 4CLKA 1TL3A 3L7UA 3HVTB 5KTQA 2M52A 4H4OB 5E3QA 1IBMJ 2BQ3A 4E0DA 1UWAA 3PW0A 1NSKL 3BZQA 1O0PA 1FDDA 2IJRA 3V2UC 1Z1ZA 1ZAVA 1YRTA 3P49B 1WC0A 4YFUA 2QA2A 2HRTA 3HZGA 1UWBB 2HHQA 2QJ3A 1D1UA 4ILLA 4RW8A 1H6KX 2IDLA 4JI6J 2UV8G 1PG5B 3HSJA 3KG0A 3C16B 3KKFA 2X3GA 3CO9A 2HVIA 3TVZA 3R7NB 3ISND 3CJ5A 3U1MA 4FF3A 4RW6B 2WW8A 3BPSP 4KH0B 4ZPDA 3NKYA 4OHZA 2FJBB 4ENOA 3K2YA 5L38A 4NZ6A 1RHKB 5D15A 4DPUA 4RL1A 5ETSA 1S1TB 1FA0A 4CO0A 4USJC 3H4DA 4UQTA 5K14B 2G9OA 4ES3A 3RRGA 3THTA 4RBTA 1X5SA 2D7SA 3CJKA 3IXQA 3KLEB 3A8IA 2IJNA 4RU9A 2P2CB 6AT1B 2FC8A 2Z58B 3P8BB 5ETLA 3F41A 4TY8B 5CABA 1CJVB 4MIBA 3ZO7A 1AYEA 5DG7A 3G9CA 2GMHA 3CMES 2V68A 5DQGA 3TARA 1YRUA 3W8GA 2A18A 1F2HA 1T02A 4JOUA 2JJ4D 1NK7A 1HNZF 3H25A 8ATCB 2CZ4A 2KM8B 2ZH1A 1HL6A 3FCHA 3O8WA 2NYIA 1X7VA 1TFWA 1X4CA 2AEJA 3PM9A 1Y7PA 2JX2A 4JI2J 2YNGA 3PHEA 4O4RA 3CCMS 3KLGB 4OHWA 2DNQA 4B9UA 5CZVA 1WHWA 3SFGA 5KG4A 3LW5C 4U8VA 4OYZA 3T9ZA 2XCAA 2HK2A 2CZ9A 2J9DE 4ECTA 3RW7A 3VCDA 2IHR1 4NMXA 2WRMA 3TANA 1FNOA 4Z7CA 2MLXA 1NDCA 1T03A 5DRKA 4H4KA 2PMHA 1IVZA 2B3TB 5LSOA 1U6FA 3O44A 1HKAA 4ZPWR 3H5UA 2NUHA 1MG7A 2IC3A 4AQYF 1ROFA 2W2OP 4ICLA 2K7JA 3D67A 4C0BA 2AHOB 2DNOA 2ZD1B 2F1FA 3NG8A 2QA1A 3PVXA 2VL1A 2JZ5A 2LLZA 2RT3A 2LQJA 2DB1A 4L76A 2CPJA 4B3OB 4X4RA 2ROEA 2R8JA 4K2XA 1IN0A 3UCUP 2AJQA 1JIHA 1IR2A 2D3UA 1KVKA 2P9EA 2AU0A 3UD4P 1N5QA 2LA6A 4LR8A 2HLTA 2FHJD 1DLOA 1RHUB 4NRUA 2GC8A 4BHQA 1HIYA 4HR2A 2D9OA 2XSFA 2YKPA 8RUCA 4AL6A 1YX2A 1U1LA 2O5DA 1F6TA 2H51B 2UUBF 1NJXA 3T41A 2E44A 3M32A 3SCKE 2AJFE 1BE4A 3LP0A 4KGKA 1FXRA 2OSRA 3K0JA 4DV4F 2KG0A 2LQ8A 2XMKA 3CF5Q 2OMLA 4ELUA 1EQMA 4H4MA 4B9SA 4EGLA 2IY5B 3NMRA 2I9SA 4R25A 1WI6A 1Q8KA 1V3ZA 4LQ9A 2YPZA 5B0DA 2I38A 2QMUB 3KMSA 3AB2B 4ZP8A 3AOBA 3I96A 1SI9A 2YWFA 4M5DB 2B8QA 1S1XA 5KFIA 5HAOA 2OJ3A 2LDYA 3JTOA 1B0TA 2ASYA 4BC9A 1SL0A 1XN9A 1TK0A 2CYYA 3PIOQ 4ZCMA 1OYEA 1RT6B 1RSCA 3H0PA 4CIOA 3KJFB 3QT8A 5C2CA 4DCJB 3TAMB 5E3CA 5IOLA 2JLGA 2CDQA 3GV7B 4OX9J 2XMVA 1FTRA 1ZS6A 3T1YJ 4PEOA 4BS2A 5DDPC 5HSPA 3KXDA 5GMDA 1VC5A 1WHXA 4CLPA 3QO9A 5KT6A 1WEXA 2FZKB 3D6TB 3R6LB 3ZTRA 1TR0A 2WVEA 3O2IA 1W26A 4PG5A 3CJ8A 1HW8A 4Q0BB 2ZH9A 3OVBA 1EJ7L 2LEAA 5F8MA 2Z2YB 3T6JA 2I1RA 3EGWB 3EZ5A 4Y2MA 1ICEB 4ZP6A 5J1NA 3DOKA 2M88A 1GT8A 2BXJA 2DR5A 1OIAA 1EP4A 1XJWB 1C1BA 4DPOA 2V0NA 3VQTA 4WFYA 3IS9B 1X4EA 1YLXA 4IQXA 3HKWA 1X9SA 1RTZA 1QSYA 2IVFB 3RBXA 2XSJA 3ZXWA 2QV6A 2YWEA 4QR2A 4AL7A 1O51A 4WFZA 3W64A 5H1SV 1H73A 1IKXB 2QC3A 1XR5A 3DMJB 3OL8A 2F40A 3HD1A 2EK1A 4K59A 3MM9A 1MMLA 3X1LB 3A12A 4UOHA 2K1RB 2B4VA 3EE3A 3I55S 4PUOA 1U24A 2PC6A 3QWPA 3HSZA 5F8IA 3N5FA 2IPOB 4U95A 1QVFR 1RWOB 3NCPA 1HBNB 2X1AA 2RUGA 4LT6A 1ZPWX 1VQPS 3G2XA 3HHLD 4XDDA 2GQ2A 5KFHA 1T94A 1U8SA 3DLEA 2MYFA 4JI7F 1FNXH 3MTJA 1Y5LB 2GQCA 3EXYA 3SI8A 3UDCA 1DTQA 2HHSA 5E5NA 2Y1JA 2J6UA 2HEKA 2CXEA 3LPEA 3OR1A 3U1NA 3KK3B 3V4IB 4QWAA 4NYPA 2BYCA 1WORA 4M63A 2XI3A 4DV1F 1IWAA 3EPIA 4KO0B 4DL2A 4DBQA 3G6YA 2OSQA 5L9NA 5HQ8A 3Q2SC 3RBDA 4O4GB 2GAGC 4DPTA 1N32F 1WEYA 4OLPA 3FEYB 2AYBA 3MMAB 3CDUA 4FP9A 4NYZA 4MAKA 2OEKA 2DISA 1TL5A 4EFAC 1A6LA 3LH2S 2L41A 3E01B 3DI6B 2BE2A 1NSQA 3VAHA 1LK7A 4F3QA 4ZK7M 1WUUA 2ZITA 4WP8A 2MZRA 4TXSA 4DR1F 1FDBA 4NX9A 4DWIA 3V81A 2GO8A 5I4MA 3AY0A 2ACMA 2G13A 1MWQA 3D5MA 2PN6A 4C8YA 3H5YA 1S6PB 4URGA 3DU6A 3DLLQ 5LOQA 2FHOB 3GCWP 3M8ZA 2J7UA 1U0SA 2HRUA 3QGPA 1QAXA 5GAEU 2AV5A 3ONQA 2YBVA 3TI0A 2DRDA 5B0BA 4UUXA 2VZ9A 3KDNA 2VQFF 5KFXA 2NZCA 5IT9U 5F41A 1RT2A 3KUHA 2WHOA 2W9CB 1FKPB 1M0SA 1JLEA 4M5MA 2B56A 4G1PA 3THPA 3BH7B 2QL7B 1U1OA 2A10A 5KT7A 4MKVA 1UZHA 2L9NA 4DUTA 1S6QA 2DH8A 1Q4RA 2JRSA 3KJVB 1SXLA 4A8FA 4V19X 1RT3A 2VA3A 2KZMA 1H2TZ 2QIFA 1NH7A 1LW2B 1QAYA 4OYOA 1V9OA 2E1RA 4X65J 1RAOA 3DDIA 2YWHA 1LW0A 1QD1A 4FS2A 1QDUB 1NJWA 2FJVA 3SV4A 2HYIB 2VDHA 2C2EA 2UUTA 4LRDA 2KFYA 2LKZA 5G0RB 4KTQA 4C8ZA 3M2VB 4ZVFA 1S4EA 5AE3A 1JLCA 1Y00A 4DQIA 4DR3J 2VFSA 5BYRA 1IQTA 1N56A 4MYTA 1L3TA 5AXKA 1H7XA 1Q5VA 4NLYA 1SC4B 5D3GB 3HVAA 3EICA 4N5SA 3LGHA 3VGSA 2YKNB 2POKA 5HN0A 4OZ1A 3CVKA 4F3MA 3IM8A 3M6WA 2RQCA 3CJSA 2OD6A 4ECXA 2WCXA 4ILRA 1AFIA 2V8GA 2JH3A 2F4VJ 1S7IA 1R0AB 4YMEA 2MHNA 2E1AA 3MPUB 4BWJA 1NPPA 3QJLA 1NK0A 2FJWA 1IKVB 3ZNJ1 4LFCF 3ITHB 1S1VB 3IRWP 4FNIA 3R1HA 1IJFB 4RW7B 2J0WA 1RT7B 4AQYJ 2L48A 2BW2A 1F5BA 4FBUA 1KFDA 2IBKA 4Y2CA 2VQEF 5D0GA 3PJWA 2NXEA 2KYZA 5IXUA 4A8OA 1QUPA 2H48B 3Q83A 1GNKA 3P96A 3MFHA 1ULRA 3G82A 1MMDA 1S1UA 2XG8A 5E3PA 4TN2A 1U6BA 1ZAXA 2B51A 1WTBA 3M8PB 2RDIA 3KLFB 3LA0A 4USVA 1AROP 2BJDA 4WK3A 3G4SS 4ED1A 3D6HB 3WHIA 3MEGB 4DX6A 2D9PA 3CCZA 3W9JA 1VBKA 1VJWA 3HSDA 4WZMA 1HQEB 3UN5A 4AUKA 2V4JB 4OI4A 4Q5VA 1KDNA 1LK5A 4ZHRA 2FB0A 3MR2A 3NMAA 1RYSA 2EC0A 4G65A 4DV4J 3C6UB 1YI2S 2VOOA 3GG0A 1QAIA 2B4PA 4NI2B 1X4HA 2IYIA 2XO7A 2BJ1A 4BC7A 3F44A 1TKXB 3E2EA 1VBZA 2PA8D 3GSIA 1B99A 3CPWR 5KT3A 2IYGA 1DQ9A 1MN9A 2DR9A 2MPUA 3DGPA 4HI2A 1RTDB 4EYIB 5F8JA 2YNHA 3DCAA 1RBAA 4ZVEA 1IKWB 4OHXA 2WVDA 5LMNF 1DTTA 1P9YA 3K5NA 4RNNA 2HW3A 3DRSA 2HNYA 5HJYA 1FFWB 2ALZA 4CLSA 4F4YA 1NMEB 1WD6A 2BKPA 3V6JA 1JKHB 2W9BB 4LJMA 2A1BA 5HVHA 2XLJA 1B64A 4A8QA 4EU0A 2IVYA 1VCTA 4ZP7A 4HEA9 4FXDA 2WVFA 4ECZA 4CH1A 3WIUA 1RHMB 2YNIB 3GV5B 2HS0A 5KFWA 3Q2TC 5KG3A 4ECUA 2NPIA 4B9TA 3FNNA 2AYMA 2JEFA 4I56A 3B4DA 2VH7A 3ILIA 2DITA 2CJKA 4X2BA 5KFKA 4U7CA 3SYZA 4RNMA 3TVYA 2JL9A 1SB6A 3KOAA 1HMVB 3AXKA 1RZMA 2OEJA 2A2DA 2GFFA 3J81j 3VF0B 2ZNZA 3P4UB 3FSYA 2RIJA 5L9XA 5D8HB 5HO4A 3HHKA 3CB4A 1REGX 1NSAA 1HBMB 2LMIA 1EAYC 3QLHA 1WOSA 3SSRA 4LF6F 3W8PA 3GIMA 2KB2A 2HVHA 1VRUA 2KO1A 4LR7A 5LXYA 4NYOA 3POTB 1CULA 2KN4A 2Z2LA 2HHWA 2UUCJ 3OVAA 3KUEA 4CRJA 3OHAA 1L3VA 4LRBA 3OUYB 1GTEA 1IXKA 2HNDA 2HFUA 5BJRA 4RO0A 4CLFA 4NA1A 2ZVSA 3WIVA 3CJTA 3PJ9A 2F8HA 2G4BA 4LSNB 3CD5A 5I3UB 4G1QB 2ZH6A 4PCQA 1CG2A 1FESA 4JI7J 4DZDA 2OAUA 4DN0A 2X1BA 2VD3A 2IA6A 2KRBA 4I2QB 1WG5A 4X62F 2UVRA 2GCFA 2KXFA 1CBKA 1NAQA 1GQEA 1R8PA 4MKBA 2G2OA 1WACA 2MTLA 2LXIA 4Q44A 3JYTA 1N32J 1LOUA 2DR7A 1YDLA 3W65A 3PFOA 1BQMA 2U2FA 3CSKA 3R9LA 3R2DJ 5MAOA 5IC4B 4NXMF 1RYRA 2G0CA 2WVBA 1TVRA 2B9YA 4DQSA 5I42B 1HPZB 4WP3A 5K8PA 2HWTA 3PKYA 4OZNA 2ABYA 3M4XA 3D3CJ 2CWKA 3MM6A 2CPFA 4Q45A 5IT4A 1WF2A 2E1CA 4OI0A 2DH9A 3TNVA 4P2FA 2XYPB 4MK9A 3M7VA 2HFZA 3O6QA 2DGUA 3GIKA 4H4KC 2IRUA 2W2MP 5ETNA 4ID5B 2AGQA 4LVOP 3FFIB 2OP5A 4DV5J 4FKXA 1SCJB 1S1WA 3HT0A 3SDEB 5IM0A 4R8UB 1UFLA 2IIHA 1Q95G 1WWHA 4J9MA 5AXMA 2M8DB 5C5JA 1S79A 2RQKA 2AYEA 4P2XA 2NR0A 4MFBB 2W24A 2IRXA 5D0HA 3Q8SB 1HD1A 2BA9A 3R7SB 3SIPB 1N34J 1IR1A 3Q8UA 4PG4A 1XNRJ 4DV0F 1FFSB 4YR0A 4DR4J 5C24A 1RAJA 2AIRB 4I67A 3JQKA 4IFVB 1SBRA 4DR2J 1AT1B 3BREA 4ZKAA 4ILMA 4TU8A 2B4UA 3MOJB 2VG6B 5B0CA 1EQ0A 4OFZA 1S12A 2DY9A 3RR7A 1VRTB 1WNEA 4A8XA 3DU5A 2UXDF 5LJ5Y 2NCKL 2G0IA 3EVOA 3AQOA 4X4SA 3FSIA 1K8AT 3MCSA 5IQQA 2CPYA 3HVRA 1VK3A 1YK9A 2MEWA 5J1EA 5AE1A 4OX6A 4JV5J 2BZ2A 3RZAA 2KXNB 2ZWPA 1FT8A 2GJ2A 2N3LA 1BC6A 2MZJA 3OTEA 1KQKA 1YHQS 5IWAJ 4P9SA 1KNZA 3L09A 3BM7A 2ASDA 3IBWA 4NLSA 1HNVA 4MKYA 4RU2A 4K4YA 1WC5A 3PZPA 2V63A 2M7SA 3M6UA 4C8OA 3M1VB 5ETPA 5ETTA 4NXNF 5KG0A 5FDLA 3Q8RB 2R2UA 3C46A 3A3NB 1FVSA 3R1LA 1XNQJ 2R8HA 4QW9A 2HFOA 2YKMA 3VTIA 2HBYB 2Q79A 1HQUA 4ZVSB 4P74A 1S5ZA 2BBEA 2UUWA 3D68A 2ILYA 2CJBA 2YPYA 3BV8A 4JI4J 2G2ZA 3NXZA 3DHXA 4NLTA 4DPXA 3IG1A 2YQ3A 2MQMA 5BR8F 3BKTA 3X3UA 3BDEA 5B0GA 5CYMB 5J2NA 4LF2A 3HZEA 3CC2S 4OX8A 1FRKA 4DUYF 4C2MA 4NLXA 2HZCA 1TTHB 3OPKA 3NCQA 3BJYA 1JJCB 3ZTSA 3M8YA 3GJSB 4USKA 3N9UC 1D9AA 3UDEA 1QTMA 3B78A 1Q16B 3S01A 1HR0F 2VFTA 1YITS 4M5HA 1WOPA 4IOBA 2BANB 3K59A 3TX8A 1DJ0A 3MUTP 4NL5A 2UV8A 4U96A 3PYGA 2Y8YA 4LF9J 3FRZA 4LF8J 2CQ1A 2OO4A 3LWMA 1BQNB 1B7FA 3EGVA 4RX6A 3CULA 2J5AA 4RUCA 2KT2A 5AE2A 4EK2A 5GMKa 2PGCA 2QFJA 3PACA 1B0PA 2CKWA 3TVKA 4DFJA 4R5PA 1UEKA 1J27A 3ILJA 4WFXA 1F60B 4Q43A 1NRKA 2BJ7A 1RT1A 4B3TJ 1JJHA 3NGUA 1K73T 2PE8A 1LWCB 2ZOGA 2A3JA 2XGPA 1C0TA 2VPWB 2A2CA 2KDOA 2E7XA 1OS5A 2DGWA 1GMWD 3R3TA 4PYDA 4ECYA 3NCRA 1KKHA 1SIZA 3CTRA 3TOQA 3LP2A 4K4UA 4RUAA 1TKTA 3C14B 2DPIA 1JXEA 3EX7B 2KU7A 3OXLA 1X0FA 3LUYA 3AD8C 1N33F 1XR6A 1T9WA 1IBKF 1U4BA 5IT0A 2EBEA 1RWKB 2BQRA 2VF3A 3N28A 2ZM6F 1RTJB 3LP1B 1R27B 3SXLA 2M2BA 2CDRB 3KK1B 3ZFVA 2GW8A 1R6YA 4KKOA 1KQGB 3I6PA 4FYVB 4J9OA 3OXGA 2ADBA 2RAQA 1U0HB 4DQPA 2B5JB 4UY8T 3C2PA 4GVBA 4WCEQ 3JAMU 1AA1B 2CQBA 3BGRA 1CSJA 4IDKA 5IS2A 3BN4A 4ES1A 1TV6A 3DOMB 4ED4A 1BMQB 1VQSA 2R7RA 3IRXB 2EKNA 1JLFB 3LTOA 3LWLA 2MKIA 2YTCA 3CW2C 4ERDA 1KRPA 5F3ZA 2EG1A 2YWGA 2Z57B 3MAHA 3MGJA 3CCLS 3K5OA 1H0HB 1M5SA 2CPZA 3JQMA 2Z56B 5T7LA 5D0RA 3PEHA 2B6AB 4A8SA 5HQLA 1VQ4S 2YX7A 3ET6A 3MMCA 3C6TB 9ATCB 5GAEI 1VBYA 2MMYA 3D0HE 2IAJB 4YR2A 3EZOA 1AUDA 1EKSA 2B7CB 2OPSB 3PFEA 4J9PA 1LWFB 2UU9F 4PQUA 2YY3A 4KHRA 2WSFC 2OMOA 4LRFA 1TAQA 1W25A 4TY9A 5DETA 4ZCIA 1HHSA 5HMYA 2E5LJ 2FGOA 2OPPA 2PI5A 2CZVC 4KAIA 2J7KA 1VQLS 5D0EA 2HMIA 5IZHA 4DL6A 1RWXB 1HNIB 3T9NA 3NBPA 1D9DA 4A8KA 3MM8A 2A0FB 4OI2A 2MLZA 2IMOA 2RDDA 3KLHB 3UVJA 4X62J 3K89A 1R89A 3DYAA 1T7PA 3M30A 1EIYB 4K5SA 3BSOA 3HVTA 4KT0C 2C22A 3BO4A 4KRWA 5KG2A 2W2PP 3ZZTA 4ES2A 2FJEB 3MUVP 1CJUB 4CYUB 1RP5A 2ZDPA 2VG5A 3EM1A 1NZAA 3OVSA 5FJ4A 4TQSA 4QW8A 4CM0A 2Z30B 1D3WA 4RNFA 3DN9A 2R42A 4ZVRB 3GZ7A 1RABB 1S6OA 4F4AA 2EEYA 2E7VA 4ZITA 2VU5A 5F0WA 3KG4A 3I0RB 5AJ3F 2IJFA 1JLAB 2GVZB 3N4WA 3IP0A 3SEOA 3T5LA 2CPHA 4JI3F 3VAGA 2OPQB 3IBCB 1RTHA 3J7AN 4B02A 4N56A 2CPXA 4GKKJ 1ZM4A 4KJIA 1F3VA 3KLEA 2WTFA 4V1Ak 3GB0A 4WJBA 1ZTTA 3MM5B 1TL1A 4I2PB 1XMQJ 3CGIA 2F4FA 5E3AA 4LFBJ 4Z37A 1HBUA 4TY8A 1E6VB 3I5CA 1CJVA 2RKIB 2VA2A 4U9RA 2Y1LB 1RT4B 4NRTA 2GMLA 2U1AA 1DAXA 2QSFA 1Y5NB 1I94J 1UVJA 1FWKA 1RU1A 2QG9B 2YVSA 1ZYQA 2EC2A 3C15A 2DKOB 2EPIA 3BQ2A 1Q8BA 4JI1J 5F9LA 4YDXA 1RTIB 2VUGA 4DMZA 1SV5A 3PIPQ 1FJGJ 2UVUA 3H8YA 1P27B 4ZLJA 3A8EA 2HBZB 1NJIT 2NXCA 4CH7A 2RD5C 3TA0A 2MQ8A 1N8RT 2KG1A 3MFIA 1HBOB 2I2YA 3UQSA 5EDWA 4A8MP 4KB7A 5BXIA 3WC2A 2WONB 1U2RA 2B9XA 3WQPA 2KT3A 5CAAA 2NSBA 1R8BA 2ZD1A 4PXEA 4QQBA 1I5OB 1PIEA 1RQ0A 2KTQA 4L72B 2W9AA 2X1GA 2HK3A 2VPXB 4EBEA 1FRIA 2QLWA 1T05B 3R5GA 3FEXB 2I6WA 1U6ZA 5GMEA 2GIRA 2Y0SD 5A6PA 3I56S 3W5YA 3U27A 5KOWA 3OSPA 2IFXA 3BEGB 3I31A 3QRRA 2NLWA 4DV3J 3CO0P 3LAKA 4F50A 4PWWA 3GTYX 4YB6A 1Q8LA 1PYTA 4MT1A 2MZSA 2PO4A 4CLUA 1TKZB 1DZ5A 2IM0A 2XQCA 2R7VA 4YS2A 2EKYA 4N7TA 4LFAF 1IBCB 4J9VA 2KI2A 2HRYA 1RU2A 4KPCA 2EVZA 2DEIA 2UXCF 3HDSA 3M6VA 2AJ2A 4J5OA 3V6DA 4O3RA 2HFSA 3MR5A 4L73A 2PA3A 3EVMA 4LF7F 2PD1A 2YNGB 1KLMB 2LP4A 3OFEA 2AZ1A 1NK8A 1SH2A 1RT6A 3P5BP 5D4LA 1CQNA 2BJEA 5GAGU 1TKDA 1L3SA 2D3O1 2MQLA 2BOPA 3T19A 3QSYB 2GIQA 2FJXA 2VDIA 3ZTQA 3UR3C 2NQPA 3CMAS 3GFYA 3D0GE 3IWNC 2DGTA 4J37A 1T03B 2F9JA 1SL1A 1S57A 4B3SF 4ZJLA 2IC3B 4USHA 3QFWA 2P9CA 4ICLB 4M94A 1GTHA 1F9HA 4Q0BA 3TUIC 4KFBA 1N36F 1S77D 4CLLA 1NU4A 1NDLA 4ETZA 1FI4A 5K8OA 4LF4F 5J1PA 4QR1A 3V5RA 4RZRA 4U6PA 2Z4PA 1M5PC 2QRRA 1ZA1B 3MD3A 4JI5F 3LGMA 4YHHJ 3AXMA 4QPTA 3OV7A 1DLOB 1RK8A 3R8YA 3GIJA 3IS9A 2MKSA 2O1PA 1VQ9S 3KG1A 2V50A 4K4WA 3FGVA 1P9QC 1N33J 1JB0C 5LXRA 2MQPA 2HHTA 4BBYA 4JV0A 3LP0B 1FXLA 1DURA 3DMJA 2FTRA 1BUXA 5DG8A 1QTNB 1N52B 1Y0HA 1HNWF 1JJ4A 4H4MB 3TEGA 4LF1A 3T5JA 1RWNB 2LDIA 1T3OA 4P75A 3FEZA 3HP6A 1RWVB 3Q24A 4JB8B 4OI1A 2DYAA 5KFTA 3VVTA 2DR6A 2ZUAA 2D69A 1KHWA 1S1XB 2RDJA 4RWXA 2KH9A 2V2KA 3ZZ0A 4K4ZA 3PX0A 1KOHA 1FKOA 3R97A 2MSTA 3ELHA 2Q6CA 3MMBA 4PPDA 4OYWA 5IV3A 5EWGA 3GG1A 1CJKA 2KHDA 2BE9B 1VR6A 1KD1T 4PRFA 1EZZB 5E41A 4F25A 3PO4A 2HLUA 5H9EK 2ZDOA 1YBUA 3V4IA 3KK3A 3MTKA 2KFNA 3GE9A 1NHKL 2A6OA 4W90B 4C11B 5KFFA 3MURP 4DS4A 4OIXA 2WOMB 4FF2A 1KTQA 1PSDA 7FD1A 1HHTP 3MD1A 3VQSA 3DC2A 2R7UA 4OJGA 3DOKB 1D8YA 2HS3A 1WC4A 4F0HA 5LT5A 1Q86T 3U02A 2HGLA 4DOZA 1BHNA 1EP4B 1KP6A 3E01A 3FBCA 3DI6A 2F7VA 2XY5A 2UUAF 1MW7A 3QIDA 4UTGA 5IQ6A 4QBUA 1YSJA 4WFNQ 2IM1A 3RYLA 2QN6B 2OFHX 4QIGA 4XTTA 1ZM2A 1YQHA 1RA7A 2ZHBA 4RW9B 2XSJB 3UD3P 3OL7A 2YNFA 1UA1A 7FDRA 4JV2A 1S6PA 4B3RJ 4Z7YA 4KPYA 3G8SA 3H40A 1VHFA 3MM9B 2XY7A 3KHGA 3HKZD 5CQGA 3RAQA 2E7WA 5A8KB 3EVWA 3RBZA 3UCGA 3NLCA 3C3LA 1ITPA 2MGZB 1JWWA 3KJQB 3M8QA 1H38A 1GEHA 5LSLA 4UZCA 4PG8A 1NDKA 2DXDA 1CVJA 4PG6A 2W9CA 1WSVA 2VC1A 3T5KA 3G8TA 3PO5A 2RH3A 3BBCA 3R5JB 1FTCA 3FCWA 3ENAA 4QPXA 2R8KA 3M8WA 3NY0A 4DV7F 1JLBA 2JEIA 2P6SA 1TU0B 2FLPA 1Q81T 5KFYA 3G8QA 1S9GA 2IM3A 2W25A 1U8WA 2E9RX 4IG3A 2CFXA 3GYXB 1JLGB 2IM2A 4RJVA 3IBFB 3GYNA 3UR0A 1VFJA 4GMKA 2KXHA 2RILA 3UN3A 2HKEA 1NBEB 3A3OB 3M2VA 4ZP9A 1JLQB 4ANDA 5DZ7A 3I4PA 3MMJA 5B09A 2LU2A 1U47A 1Q7LB 4CZCA 2FD2A 2GJIA 3LQVA 4YDDB 3KHHA 2DPJA 2BE2B 1RCXB 4Y2AA 2WB1D 3QZ7A 1VQNS 1SQGA 4OL8A 4K8RA 2XTJP 3UWTA 3D1QA 2YH0A 3V81B 1T8EA 1UVLA 4ZIWA 3FSXA 3NGDA 2J8SA 4LVNP 4TU7A 2ZBPA 2HVDA 2X51A 1X4BA 1IWGA 3I32A 2XLIA 1SL2A 1R8HA 3BDPA 2W7OA 2GHPA 5DM6Q 1LQ9A 2IDEA 1MN7A 3UD5A 1VQ5S 3MCNA 4NLQA 2OI2A 5DM7Q 1LNQA 1KR4A 2FVPA 2DT9A 2V8DA 2CQDA 2MXYA 4KGMA 3CEDA 2DEJA 4ZDNA 4J9KA 3TZWA 3JAMY 4A48A 4ZLLA 4WU2A 4M1KA 1JLEB 2RQMA 2H4YB 1U48A 3HO1A 3PDNA 1HI8A 3HLUA 2I8EA 4OZLA 1S6QB 4JP8A 1U45A 2HG4A 3M8PA 2BQUA 4LMZA 3KLFA 3DHWC 4IR1A 2LQ9A 2D41A 2BMBA 1U1MA 3TO8A 3NNCA 4OJ3A 3QPIA 5KFZA 4X4OA 3GR1A 3PRDA 5L8RC 3QIPB 4UY85 1JNZB 2Z2ZA 4ZOSA 3OTOF 5D78A 2FHMA 2V4JA 1LW0B 2DBBA 1WF0A 1OMSA 2R7XA 1VI7A 4NE9C 5LMUJ 3S6EA 3QJPA 2AQ4A 1JLCB 3KNAA 2ZHAA 4WK1A 5CHCB 4DCOB 3MEEB 4LFAJ 5SZTA 1M5HA 2P8IA 3BQ1A 1YZ7A 3EPGA 1KFSA 3AQPA 4K4TA 2E66A 3MAAA 1M1GA 1K0TA 4XAKA 5K20B 4M5LA 1X5OA 2CQIA 1VGYA 3OT9A 3M05A 3ZZRA 2VBYA 2M70A 3RW6A 1RTDA 2ATLA 3BGLA 3EUNA 3Q8VA 1IKWA 1JJ2R 4NLPA 3SV3A 2R7QA 5KFNA 2DVIA 4X66J 2QA4G 3T6BA 2CJAA 6FD1A 4JYAF 3JSMA 3WX8A 4CNZA 2FLLA 4IO1A 1TMMA 2KKHA 3DGVA 3GIRA 1WF1A 2G0JA 4C3MA 1XMOJ 5DLGA 4FYWB 2JLEA 4URSA 2UXBJ 2JEJA 1S49A 2AX1A 1S48A 3FRYA 4J91A 2YNIA 4DF8A 3M2RB 1LWEB 3QRQA 3CJRA 1S6UA 4LSZB 3LOUA 4CO2A 3SQOP 2M4MA 3UO0A 1OSCA 2E1PA 3CNQP 3HJFA 3G82B 4Y34A 1S1UB 2AWZA 2DHHA 4NASA 4DL5A 2XNQA 4OYXA 1NKEA 2MKHA 3BQ0A 1JQGA 3JSRA 1UVMA 4NOHA 3OL6A 3EDQB 5IV4A 2WZ1A 2GVDA 1KQSR 4C8NA 1REVA 1F2GA 4U7UD 1SKWA 2ZZTA 2XMWA 1N5YA 2ZVIA 2LU1A 4JI8J 1CJTA 1SC3B 1HBMA 4ED3A 1U1QA 4X4PA 3VVUA 2HSEB 3NGSA 5L1IA 1SKRA 1B70B 1RA6A 2CVIA 3R5BA 2VIHA 4ZPAA 5BYQA 3W2WB 2ZJPQ 3POTA 5KT4A 2UVVA 4QWDA 1C2PA 3D9BA 2DNGA 2YQ1A 4PPZA 3RRKA 2GS8A 2ZH3A 1S9EA 4JI0F 1Y5IB 5HP1B 1V6HA 3UI3A 5HMXA 5GADU 1HFEL 2YNHB 2Y3YA 3CJQA 1RADB 2X7IA 4LSNA 5I3UA 1DTTB 3OTCA 4G1QA 4YB7A 1MLAA 3IGNA 1J5OB 3A4TA 3DRSB 4XPCA 2HNYB 2CNLB 1U2FA 3NWRA 1DQ8A 2X1FA 3IN5A 1Q0NA 4Z2XA 4I2QA 2BACA 2NPFA 4OQJA 2QLJB 1T11A 4C3LA 1Z2LA 2PDAA 4OYAA 1FHTA 1AZSA 1MMNA 1RLCL 5HBMB 1TUGB 2DNYA 1YJNS 5CYQB 5CXTA 3GSDA 3F73A 3I9V9 1FRLA 2DNNA 3T1HJ 1UP1A 1V3RA 2PIIA 3AB4B 2RQ4A 2F8MA 3CJ4A 1N0VC 3AJ1A 2DNMA 1HNXJ 2RF2B 4ID8A 3VAIA 3R6GB 2KFZA 3RB4A 4K4SA 1KN6A 4LIWA 3KHRA 2RE1A 2R7OA 3FKBA 3VZIA 4IG0B 2CQ4A 2KM8C 2BKNA 2UUAJ 1RAGB 3PW5A 3L3CA 5I42A 1KEKA 1UA0A 5KFSA 3QGHA 3NAHA 1NKBA 3ENWA 1H72C 3D54A 4P7VA 2MZQA 1RISA 3BSAA 3VGTA 1HWJA 4K50A 2R7TA 5GAHI 3PR4A 2XY6A 3B8HA 3T5HA 4W92B 1Y11A 1PBAA 3GJRB 4LBHA 1L3UA 3H4BA 1VRUB 2QSWA 5KG7A 1Q78A 4WKYA 2V8HA 4NCBA 1J2VA 2NS1B 3R5DA 2HWHA 2I5JA 1FK9B 1LXNA 3VGVA 4J9SA 3L7OA 5KFMA 2KVIA 4ID5A 2DHSA 2PFDA 2VKZG 2XWXA 4KHPF 2FQQB 5E33A 1NO8A 3SDEA 2C1EB 5KG5A 2WW4A 1PAEX 4AXJA 3M8RA 4ED8A 3H90A 2DNHA 3MCOA 1RWWB 4DFMA 1DY3A 4ZVGA 4DV7J 1FJ7A 4KGZB 4WE1B 4QU6A 2HNZB 4AL5A 3CCQS 4CCHA 3UPFA 1SH0A 2H5JB 5H9FK 1S0VA 2M5YA 4ZVOB 4YB5A 4WBFA 1EB0A 4HT5A 3OFGA 3D1OA 3BS9A 4ETXA 3N0VA 1HWIA 4IFVA 4KYZA 1IBMF 4CLTA 3Q8YA 3DXSX 2VKRA 2HHUA 2BM1A 5DG9A 2NXJA 4OYBA 1OWXA 1VRTA 5LM7E 3JYTB 2J6TA 1IQZA 4DSFA 3HHDA 2O01C 4M5JA 3QQCD 3HHNB 1RWMB 3MF5A 4KC5A 4OV1A 4WU3A 2Q6BA 4NPOA 1M5OC 3A8JA 5F8GA 4JI6F 1YGYA 2QO3A 5KT5A 1TVRB 1SJFA 3PV8A 2FLNA 4KIAA 4OYMA 1JNRB 3JTPA 2M0GB 3OTBA 1TFYA 3WBZA 4IFYA 4DR5J 3L95X 4OJHA 3GFXA 4CTAA 5J2QA 4E2FB 1RWUA 5ETQA 2HQGA 1UFKA 1NK5A 1K44A 3A3PB 3ENVA 3BYRA 4WF9Q 2MKCA 3ISNC 4MK7A 1X8DA 1G4CA 4MMOA 3SCJE 3TR5A 3P5TL 4LBIA 5JVGQ 1SUQA 2DR8A 2JOQA 2BX6A 3TJ8A 3MM7A 4LSLB 4E98A 4OZ5A 4ECSA 1NHUA 1YBTA 1S1WB 2C2MB 3QAEA 4C7QA 1X4FA 8AT1B 4K0KJ 1X5PA 4RUBA 5IM0B 2L9WA 3AAWB 1RCOB 3FMBA 1HW9A 3J80Y 5A2QU 3ISZA 2ZWOA 4ZCKA 1Y9OA 4EMDA 3BGUA 5C7PA 1KTVA 2XMMA 4DX7A 3TA2A 2DNLA 3D28A 4CI0B 1HWKA 4JI2F 1S59A 1UAWA 1WKJA 2H3EB 2C3OA 1RWPB 2W1BA 1K0VA 3GJTB 4I64A 2DRBA 1B4SA 2ZOMA 5C24B 1S10A 4NA2A 2W4CA 1U49A 3OQ2A 2FUG9 4PYAA 3VHQA 5A8WA 4P71A 1CS4A 1DARA 5FIIA 4ZMMA 1BQNA 1NB2A 4IYQA 4IUFA 4LUBA 3MUMP 3DM2B 4F4ZA 1MROA 1XR7A 2H65B 2G1HA 1JX4A 4ED2A 1SJ4P 5J1EB 3BSNA 1O5JA 3MCMA 3JTNA 2GV1A 1T0TV 1Y10A 3D66A 1V5IB 3W66A 3CDEA 3HPOA 1HI0P 3E8OA 1W7WA 1UEVA 1BWEA 1WG4A 3HK2A 2EBGA 4KV8B 3BSCA 4YUDA 4DFPA 1C0UA 2NZ4A 4MKAA 3D1HA 2VBWA 3PG9A 4B9NA 4DDFA 3MEDA 3C14A 2E5JA 5B7WA 2C3UA 2E1MC 4C48A 4I7FA 3BKUA 1T95A 1GXUA 1RHJB 5MLCV 5E0OA 2DD8S 3H20A 2DHAA 4DLGA 4FNHA 2VG7B 4MYUA 3BKFA 1HQUB 2DH7A 1AW0A 3KK1A 3PCOB 1AXQA 3KUGA 2RU3A 1OSDA 2QLBB 1KSPA 3EGZA 3IG1B 4LRCA 5A0YB 3NWGA 4UOFA 5J2NB 1WC3A 2J6SA 2RU9A 2XYGB 3N6MA 2FY1A 2BJ9A 4HDGA 1HNZJ 4NZ0A 3NNAA 3CCUS 3IRXA 4ZVUB 2RSQA 1EX8A 4FPIA 2R2TA 3PYEA 3D3BJ 3I0SA 3OSNA 3KTQA 4E8UA 3G6ES 1SC1B 4OZ3A 3MZIA 1X31C 2O66A 3UFCX 3S7RA 2AF6A 2OFGX 3L9ZA 2RS2A 4OX9F 2HURA 1NM2A 1DFDA 4OX7A 4PKDB 4RR5A 5BYSA 3T1YF 5DZ6A 3B54A 1BLUA 5HROB 4DL0C 3ZZOA 4QCLA 4I68A 2WAQD 4TQRA 2CIMA 1URNA 3HHLB 5E3RA 5AXLA 4R5PB 2CPEA 4F7VA 4L3KA 5B08A 1T9UA 2OLWA 1VQYA 5KG6A 4J9RA 4X64F 4JI0J 1RT1B 1BWVA 5KFJA 1Q5YA 2EFVA 3GCXP 4Y2IA 4B9VA 4PQAA 1Z2ZA 1UJ6A 4ZN1A 4HTIA 1RI7A 5HK4A 1HNIA 3MR3A 4D3GA 2ERRA 2FY8A 2OTLS 5J2MB 5FLXU 1BGXT 3OFHA 3KLHA 5KG1A 4PXDA 4DV2F 2W7AA 1YKWA 4CP5A 3H59A 1BD6A 4KR0B 4NLWA 4WIIA 4DZ6A 3BBBA 4UOGA 4M5NA 1U2CA 2UUBJ 2ZHOA 2NUUG 3V6HA 4DSJA 2KHCA 2BR0A 1AUSL 1RXOB 4CYUA 1WKLA 4GRSA 3DFEA 2H54B 3TJAA 4C97A 1MSWD 3NGKA 1RE1B 3Q22A 2ZE2B 3BGRB 2FGCA 3IAM9 4MTPA 1Q79A 3S1TA 4RW4B 5C25B 2AD9A 3UDVA 1S99A 1PKUA 2V67A 3DOLA 3DNCA 4WP9A 2AZ3A 2K7KA 2HQCA 4OI6A 3Q23A 4B08A 3AJDA 3UDLA 1JLAA 2XGQA 2B4OA 5D77A 1N5VA 5T7LB 2OPQA 3KK2B 2XO6A 4ZVQB 3ET6B 3MMCB 2ROPA 4QOTA 4WYWA 2K3IA 4UOCA 2EW9A 3HHLC 1PILA 1ZPVA 4PQUB 1E6VA 1X4GA 2RKIA 3LANA 1R6VA 3M2UB 4DU7A 2FVCA 2HQDA 3K5LA 3RBEA 1GX6A 2XB2D 2GGPA 5KT2A 1LV5A 1SJQA 1Q8IA 1FWLA 4X84A 4W4MA 2ROGA 4OZ0A 3V6KA 2V9WA 4P73A 2RRNA 1PGZA 2VFRA 2HMIB 1VQKS 4DSLA 2SXLA 4Q2MA 3CCRS 2CNNB 4PAAA 1RTIA 1BQXA 1SKSA 1RLDA 3DLKA 1S76D 2HAIA 4MIAA 3FJ2A 4CQ1A 3UVJB 5HMZA 4S0MA 1QUVA 3TUPA 3ZTPA 3M30B 5C42A 2BABA 2D1CA 3ZZUA 2AP6A 2BRKA 5CCMA 4DG1B 2ACYA 1NXIA 2MKKA 3DRPA 3HCXA 1YJWS 1HBOA 1VBXA 2RRAA 3O5TB 4I6YA 2NXUA 4IKAA 1X9MA 1A7GE 5I3QA 4O3PA 2WONA 2VG5B 4DR6F 5A8RB 3CD0A 2E5GA 2MJNA 1TL4A 3CCJS 1XBWA 4HHHA 1U26A 3J81U 2PFFB 4FVMA 4J9UE 4MK8A 2PMZD 1ELOA 2ZNYA 2ALYB 3AA9A 5EWFA 4LR9A 3IR5B 3HM9A 3BH6B 1T05A 1QE1A 2BV3A 3A1YG 2XULA 3D6MB 3SCIE 5L39A 4NEZA 3KLVA 4DLEA 1CC7A 2J0XA 3L7PA 2OEMA 3GQCA 3TAQA 2FVQA 3CCSS 1RTHB 3R5AA 4ELVA 3GILA 4X4QA 1R31A 3PW2A 2Q3PA 3T1AA 4ZLNA 3OTDA 2HGNA 4AT1B 3W1YC 1TL1B 4PG7A 1GH8A 2LQ5A 4X65F 1OY9A 1HBUB 4DV1J 1I51B 4QIFA 1IKYA 2N3OA 1TKZA 3QMQA 2CQHA 1DHMA 3BPDA 4DR3F 3H2VE 2DCUB 4BWMA 2ZH4A 3QJJA 1K1QA 2QX0A 3C15B 4P7TA 2QA4S 4ECWA 5EWEA 3RB0A 1RAIB 4GC7A 1E6YA 1M90T 1SV5B 1WC6A 5EUHA 2ASLA 2Q1LA 1UPMB 3R27A 1FF2A 1WELA 4DSKA 3TUJC 3GFZA 1X5TA 1KLMA 1VK8A 5K8MA 4DR1J 2OHDA 1I1GA 2AMCB 3J7YU 3OHBA 5EN1A 1EKRA 4PABA 1YTYA 3G86A 3U7JA 2XZWA 1NJYA 3CMQA 2F4VF 1T9TA 2LXFA 3H5SA 2DHGA 2CQ3A 1H7WA 4RKUC 1XC9A 3AA8A 4ECVA 3HI9A 3CCVS 3G71S 1C1CB 2DTJA 2QLFB 4U8YA 1RJJA 4DPYA 4XIUA 2HFNA 3IR7B 4EI2A 2CVEA 1CLFA 3VAKA 3HD2A 1PC4A 3GR0A 3H7HB 3U1LA 3PX6A 2VQFJ 4F3OA 3MWBA 5GADI 2GNKA 1K9MT 4DCPB 1FVQA 3PRBA 2CPDA 3RRHA 3J7Z5 4O44B 4M5KA 1N6QA 2B8PA 2YKQA 1VHIA 3ZC4A 2DIVA 2BDPA 2I0XA 5HVGA 3QT7A 4G3IA 5ETKA 1FX4A 1YWXA 3W60A 3FBEA 3HJVA 5CA5A 4PWDA 2XHCA 1YJTA 2CQGA 2PI4A 4U67Q 2RHQB 4Y00A 3BGFA 5I3PA 2C42A 4A4JA 3LO3A 3I5BA 3D0IE 4FN5A 2GO9A 2NXNA 3BR8A 3R7BB 2LYVA 3T3FA 5M2RA 1LFWA 4DQRA 2BVZA 3DLGB 3MOZA 2QEXS 2VC0A 2E5IA 3ZZZA 4QYZJ 4J7CA 3KLIA 2AX0A 2HQ3A 1ZM3A 1EETA 4M5IA 1MWYA 3MEKA 4RLEA 1OJ4A 5DQIA 4DV6F 2QL5B 3PW7A 2UP1A 3V6DB 1JXVA 2KRRA 4DJBA 5L1LA 1B7YB 3K8WA 4LRAA 4IH5A 5J2PB 1HA1A 4ALZA 5JMNA 5CD4A 3DRYA 1U02A 1VC6A 2BJ3A 2UVWA 1H3DA 2MJUA 1J5EF 5LSRA 4B9LA 1I6JA 5HVFA 3D6FB 2EFGA 4P52A 3W9IA 4C11A 1F9FA 2EFNA 4LIRA 4LFCJ 2EG2A 2BW7A 5ITHA 1VDHA 2ZKUA 3PR5B 2E9TA 3PKMA 1FDNA 2FYXA 4Q8FA 4CLZA 1K47A 2WOMA 1RGVA 4KFBB 3N5BA 2HHVA 3Q8QB 2GHWA 4X64J 2VQEJ 4USTA 2C2DA 2QL9B 4CH0S 1SQFA 3W2VB 4CT9A 4OV6A 2YKOA 4QYZK 2E5HA 2XLKA 3VGUA 2HFVA 4YOEA 3C66A 3ILOA 1R7IA 1F0XA 2XC9A 3K5PA 4P6QA 2JLFA 3OR2A 4ZPBA 4CLYA 4DV2J 4K2JA 4RW9A 3ULHA 4QYRA 4W98A 5HL7Q 1C4CA 3K7RA 5DJBA 2GAHC 2OKQA 4ANEA 1N4LA 2W01A 3NEKA 2N7CA 3ADAC 3HFZB 4EWTA 2YXLA 1O8BA 3QBCA 3JS9A 3CXCR 4C9DA 5A8KA 4CWBA 2XZDB 2BUNA 3MHYA 1I3OB 3AOCA 3DKDA 2MGZA 3PW4A 2UUCF 3GLJA 3PX4A 2DXEA 3JSBA 4L6V3 2ZH8A 2HHHF 5A2QY 2FDNA 1FKOB 3KHLA 3MECB 4USWA 1UFWA 5B0AA 3MMBB 2CJXB 3OXFA 1FE0A 2W4DA 3NGRA 1CJKB 4U7UK 3F0NA 4FBTA 5DQHA 4P10A 4A46A 3SQGB 4L75A 1S0MA 2PSZA 5LMNJ 2R8IA 3NRBA 3KFWX 3NS5A 2QGFB 1WOOA 1JLGA 1IM6A 3FZ2A 3EGNA 3B82A 3OD2A 4RWWA 1PJ5A 3B6BA 1NUEA 5B0FA 3CD7A 4NLGA 1L5UA 2M8HA 3DDNA 3MR6A 3B4MA 3G87A 3RU0A 5KFRA 1TL7B 1JLQA 2BKOA 1N88A 2CNOB 2F63A 1KQFB 1MU2A 3RGIA 3AHPA 1FFGB 1R43A 2N4CA 1GFWB 3UN2A 3NP5A 1S0OA 1LEOA 3VR1A 1QM9A 2W8KA 1N54B 3EXCX 1ZZFA 2CAJA 3AT1B 3ICLA 1RKIA 2B43A 4Y6IA 3G6VA 1RBOB 3FC9A 5SUHA 1NNDA 4DEZA 5CH7B 4WTYA 2YNFB 1ZM9A 1IUJA 3BGOP 3W7BA 3TQEA 4NCGA 3JXOA 2ZUGA 2BM0A 4LF6J 4HACA 1HLWA 1RAFB 3QRPA 3M6XA 1A0OB 4O3QA 3N6NA 1HHQA 3ZNUA 4LBPA 1R3NA 3BO2A 1NH8A 4DR6J 4O0NA 4EZ9A 3M8QB 1F5CA 3CUNA 3ETMA 4TLQA 4DV5F 2QMXA 2HIQA 1Q1KA 4DL7A 3SBMA 2LEBA 5IFMA 4TVAB 1WHYA 2D74B 2W2QP 1FX2A 1PYSB 4FZVA 4WPAA 4C98A 2XM3A 4K5RA 5KFGA 4XO0A 1JLBB 1P8GA 4A47A 2Y1IA 1R8AA 5K9FA 1N34F 3ZTOA 4RNOA 2V69A 1S9GB 4IG3B 1XNRF 4DR4F 3GV8B 1SPBP 5B0EA 3QIPA 4OZ2A 3D2WA 1FO1A 4QU7A 4GKJF 4DL4A 2WSCC 4DR2F 3CJ0A 5EX0A 1RT5B 2AJ0A 4NLVA 2F65A 2V2ZA 3GMGA 2ILZA 4P2MA 4H4OA 4AXIA 3QYYA 4QZVB 1V5VA 3SMZA 2PEBA 4HKQA 1XIQA 5HLFB 4FKYA 1U09A 4HH0A 3MEEA 1PO6A 1SVDA 2OH2A 1NLKL 3K8VA 2CUYA 3E51A 3DRRB 5D6GA 3FDSA 1UWBA 2DGVA 2J7WA 4JV5F 2J0SD 4NMLA 4NXMJ 2H5EA 3C16A 2C3MA 4MIWA 4RW6A 4N41A 1NKCA 3JQJA 3GJQB 5IWAF 4O3NA 1X4DA 5FLXY 1Q7YT 3WDOA 4IOCQ 1S1TA 2QE5A 4YY3F 1URRA 2FC9A 2BEFA 2Y1RI 5K14A 2ZH2A 2HAFA 4UUWA 1XNQF 5LL6d 2BOAA 2QTWA 1F1BB 3VALA 1N5SA 4PR6A 2V2VA 3L4BC 1UL3A 4BLGA 3M2RA 1YJ7A 1LWEA 4BCAA 4TYBA 2VV5A 3AH6A 4JI4F 4DSIA 4PXCA 2OPRB 4F2SA 1RBLA 4F04B 3ETOA 2GJFA 2XEXA 4IH7A 1HYSB 1NEEA 2CQ2A 4I6AA 4OJ1A 3CIMA 4F2RA 4PWUA 2F8EX 4IRCA 1UPPA 3MPYA 4M8LA 4OHYA 1UETA 2AEFA 1H74A 1CC8A 1UEUA 3I4HX 2FVSA 4QJVA 1N5TA 4DHVA 1VQOS 3D4JA 3MR7A 4URQU 1GAOA 4DV0J 4C0HA 3KLGA 1GMVA 1KWMA 1TL3B 3IGVA 2HZVA 4HH1A 1IR0A 4LF9F 4LF8F 2ZBRA 1OPZA 1D8ZA 1U1RA 4WYLA 2MZ1A 1WDTA 2YKAA 2OGUA 4QIVA 4FYDA 4HL9A 3W2WA 2UXDJ 2COLA 3D7SB 2Z2MA 4DI6A 3OW2R 1P1TA 3MAAB 1H2UX 4EUVA 4USUA 4RW8B 4DV6J 4UZBA 2RS8A 1U25A 1PC5A 4F4XA 5HP1A 5F8HA 4B3TF 3UW1A 2JC1A 5M2UA 1ZZNA 4B3OA 3NNHA 4RUHA 1RAHB 1J5OA 3RAXA 5HQMA 1J5EJ 4O23A 3JSMB 4ED6A 2ZH5A 3IA0A 2B0GA 4NLRA 1X0PA 4ZS6A 1UMJA 2VICA 4NXNJ 3CJKB 1X60A 3AOAA 3H98A 1HWLA 4USMA 2K3KA 3TZXA 1VLOA 1IJEB 3O1LA 4QWEA 1JXLA 2KYXA 1GXTA 4MH8A 5HBMA 5CYQA 1WDDA 3M9MB 2CQ0A 3J81Y 3PHTA 2V8PA 2KL8A 2M3DA 3FVYA 2CPIA 2DNKA 3TAPA 2RF2A 2DNZA 5E2QA 2HQFA 4ZA1A 2C2ZB 4KSEB 4FXWA 5BR8J 4IG0A 2GVDB 1RB0A 1REVB 2JDJA 4M5DA 4DUYJ 2J76E 4LF5F 1P1LA 1GK8A 4Q2LA 3NGTA 1VQ7S 4RBUA 5D4PA 1N5YB 1Q53A 4KBIA 1TZ0A 2C2RA 1CJTB 3KYLA 2HBQB 4ZPCA 3WC0A 1HR0J 2QYGA 4AYBD 3NS7B 2LQBA 3TAMA 2ZBCA 2WBRA 2QFIA 1H2VZ 2XNRA 1CPZA 2GQQA 4EO6A 5DS7A 1FK9A 2FJDB 1PAUB 1N0UA 5LJ3Y 3IM9A 5F3TA 3BB5A 2ZBIA 2V4RA 3CCTA 3TRGA 2HHHJ 4UF4A 1Z4UA 1S9EB 3OL9A 5ETVA 3VAMA 2E5LF 1LFPA 4IQMA 1HQ2A 5K8NA 4FF1A 3MPWA 3CT9A 2W2NP 3KMQA 2R4FA 2G2YA 4NEYA 5DGBA 4WE1A 2HNZA 5H9EJ 4J9QA 2DNPA 1T3NA 1S7HA 4OYPA 4ZVTB 3DLJA 3A13A 3SSSA 5KFCA 4F36A 3H5XA 1SH3A 3CIZA 5DDOC 4IRKA 2FVRA 3HFVA 4DX8H 4KE5A 1IBKJ 2MQQA 2EFOA 2FPHX 1D0EA 1AZSB 4X4VA 5DGAA 2WK4A 2O3DA 2ZM6J 3H2UB 3M32B 4C8KA 2JEGA 2VJUA 1IKXA 3US5A 2B7BB 1UJ5A 3DRXA 2K1RA 2QT7A 3BYPA 2EK6A 1WJ9A 3Q86A 3W62A 3THVA 2DK2A 3BF4A 4N8NA 3DLBA 4UW2A 4DUZF 2R7SA 4NLOA 3J80U 3KNGA 1UCNA 1HBNA 1PCAA 2V94A 1JK9B 3RJMB 3J7YI 5JVHQ 2MLYA 4R0EA 1QJHA 7AT1B 3I9ZA 1SJRA 1UZDA 4P2SA 1VIOA 4GKKF 2XS5A 2AEMA 3HX9A 5AT1B 5KAKA 2I5JB 4HHJA 1U7LA 1XMQF 3QO9B 2WB4A 4LFBF 4LSLA 3SZ2A 4KO0A 4NLUA 3WX4A 2RRBA 3LF0A 2YX4A 4DQQA 2UU9J 4EZ6A 2HQIA 2HHXA 1TK8A 2GHVC 3CJ2A 1I94F 2JFDA 4O4GA 2RUSA 2FHJA 4V19J 1FD2A 1GXLA 4ED7A 2V34A 1F3FA 3MMAA 5DDRC 4JI1F 1YRXA 5L46A 2KVQE 4J90A 1NK9A 5CCLA 1FJGF 3QZ8A 4F02A 1C1BB 3NOGA 1QVGR 2J9EA 2FZGB 4A8YA 5KOXA 1C4AA 2CJ9A 1KVIA 3TJ9A 2DGOA 4FDFA 4DU8A 1KONA 4GKJJ 1KVJA 1RACB 2AGOA 1FDAA 3DDKA 2KJWA 2QMWA 1H98A 3EWGA 3FCVA 1HI1A 5CYJA 3DM2A 1M1KT 2DXFA 2IRYA 3JSYA 3MPDA 4PUOB 3IAS9 2ZH7A 4CO4A 2XS7A 3FBBA 4OMFG 2VB6A 4KQZA 1CQMA 4PXBA 1FKPA 2CQCA 4CO3A 3ZZPA 2DGQA 4YR3A 4HDHA 4IFYB 4KV8A 1VS3A 2IA0A 5K5MA 3I82A 4CTAB 5J2QB 2P6TA 3DLEB 5KFLA 4WIQA 4YP3A 4C8LA 2ZEJA 4YY3J 5AJ3J 2CRLA 3CE8A 4ECRA 4CDIA 3KJVA 1DTQB 4JI3J 4ZPTR 4DV3F 4ITSA 3OR1B 2K06A 1SUQB 1YJRA 3MM7B 2RHSB 3M9NB 1LW2A 2VG7A 4XDCA 1KC8T 1OYDA 2MKYA 3CWJA 4ED5A 5HJXA 1LWXA 3BR9A 5G0RA 1VMBA 5A0YA 1VQMS 1SQEA 2LFVA 5FD1A 3AD7C 2HVZA 2MSSA 2J9DA 1RHRB 1UW4A 3CDWA 1R0BG 2RVJA 2HVEA 2OUGA 2Q66A 5D3GA 2JNJA 5JXSA 5U47A 2YKNA 2AJ1A 2JC0A 2DJWA 3QGIA 3MI7X 3FMWA 3GONA 1GMUA 3H42A 3W3SA 4KH1B 2OELA 2MQNA 5THWA 5HMWA 4NLDA 3RR8A 3PTWA 4O0IA 1ZAWA 2FZCB 1U1PA 2HZAA 5A8WB 1S0NA 4JUZA 1CS4B 1OQ3A 1YJVA 1R0AA 2AJ4A 2DIUA 5HROA 1MROB 1IKVA 3ITHA 1S1VA 3GWCA 3QSIA 1YIJS 3HHLA 4RW7A 4QWBA 4X4TA 1SIWB 2G1DA 1RT7A 4ZN3A 5JUMA 2AW0A 4LQ3A 5C2GA 1M5KC 1DQAA 4ZVPB 2MQOA 3DLHA 1RT2B 4RBVA 2WVCA 4C8MA 1S9FA 1VIXA 2EFQA 5M2PA 4DXLA 2MHEA 4KGVB 2GA7A 3TWZA 1VQ6S 2Y8WA 4I1TA 2KZZA 1C0UB 1W2BR 4YN3B 3ZZYA 4B3MF 4YHHF 1UJ4A 3MEDB 2DNRA 4ZLPA 2FLOA 2RB7A 4ZJQA 3TQ1A 2WSEC 2AGPA 4B9MA 5J2MA 2D3OR 4I7FB 2HS4A 3MEGA 1RT3B 3PY8A 4F26A 1XK8A 3VAJA 2ZOFA 2IBOA 3P3DA 1HQEA 2HWIA 2FJAB 4PZVA 2D3ZA 5D4NA 4F67A 1Y4ZB 1SJ3P 5IT9Y 3NS6A 2K8GA 3C6UA 3GPAA 2CADA 2H4WB 2VHGA 4NI2A 1FRHA 2LXUA 2ZE2A 1VC0A 1L3KA 4HYKA 4IO9Q 1S4FA 1TKXA 2CG8A 1T9YA 2UXCJ 4RPFA 1TK5A 4XK8C 1TUWA 4RW4A 4DN9A 5DDQC 1DBDA 3PYDA 5C25A 1UTAA 4LF5J 1F5AA 4BDPA 5ETRA 2XMAA 3I0SB 4LF7J 2HPUA 1KOOA 4F0MA 1A9NB 2C2OB 2VASA 1VOMA 3PJXA 2XBPA 4WFBQ 2MY7A 4CT8A 2Z0GA 2AT1B 4P72A 1OPIA 2RJZA 4QR0A 3Q0AA 1IM4A 3KK2A 4DPWA 3W5ZA 1NCLA 3HMJG 2VOPA 4JV1A 2J0QD 3CCES 4F4WA 1JKHA 4IR9A 2W9BA 3TP2A 2VBZA 4DFKA 2A6MA 3S8SA 4B3SJ 5KFBA 1G7CB 4IOAQ 5ADZA
chains in the Genus database with same CATH topology
3T5JA 4F4KA 3TI0A 3M2UA 4DR3F 3H2VE 2MKJA 4J9LA 2LDIA 1JMTA 3UCZP 1T3OA 2DCUB 5B0BA 4UUXA 3FEZA 2VZ9A 4BWMA 3HP6A 2ZH4A 1NK4A 3QJJA 2VQFF 4GO7X 3Q24A 5KFXA 4OI1A 1K1QA 2J8AA 5KFTA 1XERA 5F41A 1FRJA 1RT2A 3LALA 1U1NA 4P7TA 4NA3A 2WHOA 2QA4S 2W9CB 4ECWA 5EWEA 4DL3A 1KHWA 1FKPB 1S1XB 1M0SA 4RWXA 2RDJA 3RB0A 2KH9A 2V2KA 3ZZ0A 1JLEA 4K4ZA 2B56A 3PX0A 1KOHA 4G1PA 1FKOA 2V9KA 4GC7A 1E6YA 1M90T 4IH6A 3THPA 1SV5B 5EUHA 4EYHB 2Q1LA 2ASLA 3R27A 1FF2A 1U1OA 2MSTA 1WELA 2A10A 5KT7A 2Q6CA 4DSKA 4C3KA 3MMBA 4PPDA 3TUJC 1HMVA 2N7YA 3GFZA 2L9NA 2AYGA 4TNOA 1X5TA 3GG1A 5EWGA 1KLMA 1S6QA 2DH8A 4ED0A 1R8CA 4F8RA 1VK8A 5KFOA 5K8MA 1Q4RA 4QWCA 2KHDA 2JRSA 3KJVB 1I1GA 1SXLA 4A8FA 1KD1T 3J7YU 3OHBA 4ECQA 4PRFA 5EN1A 5E41A 4V19X 4F25A 1HYSB 3PO4A 2HLUA 1N48A 1RT3A 1YTYA 4DG1A 2VA3A 2ZDOA 3G86A 3U7JA 2XZWA 1NJYA 4WKRA 2F4VF 2KZMA 2LXFA 1H2TZ 2QIFA 2APOA 3H5SA 3V4IA 1NH7A 1LW2B 3KK3A 2DHGA 1YJ9S 1QAYA 2ZZNA 2CQ3A 1H7WA 3MTKA 2KFNA 2YH1A 4RKUC 2V8VA 3GE9A 2VODA 1V9OA 4ZHRB 4B3RF 1XC9A 3AA8A 4ECVA 3HI9A 3CCVS 4W90B 2E1RA 4C11B 3G71S 1C1CB 2DTJA 2YWHA 1RJJA 1LW0A 5KFFA 4FS2A 1NJWA 3MURP 2FJVA 3SV4A 4XIUA 2HYIB 1OQ6A 2HFNA 2DHXA 4OIXA 3IR7B 4DS4A 4USIA 2CVEA 2C2EA 2WOMB 2UUTA 2KFYA 1CLFA 2LKZA 4FF2A 1XTZA 5G0RB 4KTQA 2XWYA 4C8ZA 3M2VB 4ZVFA 1KTQA 5A8RA 1PSDA 5AE3A 2VBXA 7FD1A 3VAKA 1JLCA 1Y00A 1HHTP 4DQIA 1PC4A 3GR0A 2VFSA 3U1LA 5BYRA 1IQTA 1N56A 3PX6A 3MD1A 2R2RA 4F3OA 4MYTA 4B17A 1L3TA 3VQSA 3DC2A 3MWBA 5AXKA 1H7XA 5GADI 2GNKA 2XHWA 3RTVA 1K9MT 3CC7S 2R7UA 4NLYA 4OJGA 2JSXA 3DOKB 1D8YA 3OUYA 2HS3A 1KLNA 5D3GB 1FVQA 5LT5A 3HVAA 3DOLB 3PRBA 1Q86T 4N5SA 2CPDA 3RRHA 3U02A 2HGLA 2YKNB 3J7Z5 4DOZA 1EP4B 4O44B 3E01A 2POKA 3DI6A 2F7VA 5HN0A 5F9NA 4OZ1A 3CVKA 2XY5A 1N6QA 2UUAF 1MW7A 2R9LA 1KHVA 1YJUA 2V4QA 3QIDA 2YKQA 5IQ6A 4QBUA 4F3MA 1YSJA 3ZC4A 1XEZA 2DIVA 5HI7A 2LECA 4WFNQ 2BDPA 3M6WA 2RQCA 2OD6A 2IM1A 3RYLA 2I0XA 3EZUA 2OFHX 4QIGA 4G3IA 4ECXA 1ZM2A 2WCXA 1YWXA 4Y0FA 4ILRA 1YQHA 1RA7A 2P5VA 2ZHBA 5CA5A 4RW9B 4PWDA 2XSJB 1G6BA 1YJTA 1KS2A 2CQGA 3UD3P 2PI4A 4U67Q 3OL7A 2YNFA 3IR6B 2E9ZA 4Y00A 1UA1A 4IRDA 4JBCA 1AFIA 2V8GA 2JH3A 7FDRA 3BGFA 5I3PA 2C42A 4A4JA 3LO3A 1X4AA 2LEPA 3I5BA 3D0IE 1R0AB 4YEAA 4YMEA 4FN5A 2MHNA 2E1AA 4JV2A 1S6PA 2GO9A 4BWJA 3BR8A 3QJLA 1NK0A 2LYVA 2FJWA 3G96A 3T3FA 1IKVB 1S97A 5M2RA 4LFCF 3ITHB 1LFWA 4KPYA 1S1VB 4ATNA 4DQRA 3IRWP 3J7ZT 3G8SA 2BVZA 4FNIA 3H40A 3R1HA 1IJFB 3AJ2A 3DLGB 1VHFA 4RW7B 3MM9B 3MOZA 2XY7A 2QEXS 2J0WA 4K4UA 3KHGA 2VC0A 3HKZD 2E5IA 5CQGA 3RAQA 4DR7F 2E7WA 5A8KB 1IBLF 3MDFA 3ZZZA 1RT7B 2GGPB 3UCGA 2L48A 3NLCA 4QYZJ 3C3LA 2BW2A 2MGZB 1F5BA 4FBUA 1JWWA 3M8QA 1H38A 3KLIA 1KFDA 2AX0A 2HQ3A 4XPEA 2IBKA 1ZM3A 1EETA 2VFVA 1MWYA 4Y2CA 3CDAA 2VQEF 3PJWA 5LSLA 3MEKA 2YX1A 4OI3A 5L1JA 4X4UA 2KYZA 5IXUA 4A8OA 1QUPA 1HD0A 3E3XA 4PG8A 3TW0A 1LKZA 4RLEA 1GNKA 5DQIA 4DV6F 1CVJA 3VAFA 4PG6A 2W9CA 3P96A 3PW7A 2UP1A 2VC1A 3V6DB 2KRRA 2IVMA 3MFHA 2JFKA 1ULRA 1MMDA 2NSCA 5F0UA 1FXDA 1S1UA 3N01A 3RB6A 4KHMA 3T5KA 4DJBA 2XG8A 5E3PA 3G8TA 3PO5A 4TN2A 2RH3A 5L1LA 3K8WA 4IH5A 3NAIA 5J2PB 1U6BA 1ZAXA 1HA1A 3DLKB 5H9FJ 2B51A 4D3HA 4ALZA 1WTBA 1FTCA 3M8PB 1HPZA 4QPXA 2R8KA 2RDIA 3DRYA 4QIEA 3KLFB 4DV7F 1VC6A 1TAUA 1JLBA 4Q8EA 1ZH5A 1AROP 2UVWA 2BJDA 2JEIA 4WK3A 5C42B 2P6SA 3G4SS 1H3DA 4ED1A 2FLPA 3MEGB 1Q81T 2D9PA 2MJUA 5KFYA 1J5EF 5GAHU 3CCZA 3G8QA 5LSRA 1S9GA 4DF4A 3DRPB 3HVWA 2IM3A 2W25A 4B9LA 2E9RX 1VJWA 3QLHB 4IG3A 4WZMA 1HQEB 1I6JA 2CFXA 3GYXB 1JLGB 4AUKA 1SJ1A 1B0VA 2IM2A 2PT0A 3UNGC 2V4JB 4OI4A 4Q5VA 2E29A 2CQPA 1LK5A 2EFGA 4ZHRA 5F8LA 2DGSA 2FB0A 3MR2A 1UVIA 4C11A 1C1CA 3GYNA 1F9FA 2EFNA 3UR0A 4LIRA 3NMAA 2EG2A 1RYSA 5ITHA 2EC0A 1VFJA 2ZKUA 3PR5B 1YG0A 4GMKA 2KXHA 4NZ7A 2E9TA 1FDNA 3FZBA 4Q8FA 1MWZA 3PKMA 2RILA 3C6UB 3QGGA 1YI2S 2WOMA 3GG0A 2VOOA 1QAIA 2B4PA 1NK6A 1RGVA 3I87A 3M2VA 4ZP9A 1QSSA 4I69A 1JLQB 1X4HA 2IYIA 4KFBB 1FJCA 1LXJA 3N5BA 2XO7A 3OLBA 2YWKA 3I4PA 2Z8QA 2HHVA 1TUVA 4BC7A 3F44A 3Q8QB 3MMJA 1TKXB 2GHWA 3E2EA 1VBZA 3WZ0A 5B09A 3IO1A 2LU2A 3IFEA 2PA8D 4EBDA 1U47A 1Q7LB 2C2DA 3FFIA 4CZCA 2FD2A 5KFAA 4CH0S 2GJIA 2HNDB 4G1IA 3LQVA 3W2VB 4CT9A 4YDDB 3CPWR 5KT3A 3KHHA 3SCLE 2YKOA 2IYGA 2W8LA 4FS1A 2DPJA 2BE2B 3LGNA 1QE1B 4ZVHA 1DQ9A 3CJ3A 2E5HA 2XLKA 2DR9A 4Y2AA 4R8UA 4O44A 2MPUA 3DGPA 4HI2A 1RTDB 5KFEA 2WB1D 4EYIB 4YOEA 5F8JA 2YNHA 3QZ7A 1VQNS 3C66A 4OL8A 2KT5A 1FEHA 1R7IA 2JWNA 3DCAA 4ZVEA 1IKWB 3D1QA 3UWTA 1F0XA 4OHXA 2ZJQQ 2XC9A 2R2SA 2YH0A 3K5PA 4P6QA 3V81B 2HGMA 5LMNF 1T8EA 1UVLA 2JLFA 2PEHA 1DTTA 3OR2A 4ZPBA 4MFBA 3FSXA 3NGDA 3K5NA 4LVNP 4RNNA 4EEYA 2HW3A 3DRSA 2HNYA 4TU7A 3TYTA 4N8OA 4RW9A 2X51A 3ULHA 1X4BA 4QYRA 2JVRA 2ALZA 5HL7Q 3I32A 2XLIA 1C4CA 3K7RA 4F4YA 5DJBA 1SL2A 2VFUA 1WD6A 1R8HA 3BDPA 2W7OA 2GHPA 3V6JA 1JKHB 2OKQA 5DM6Q 2W9BB 1LQ9A 4LJMA 2A1BA 4Y2KA 1N4LA 1IKYB 2XLJA 3J7A1 2N7CA 1VQ5S 1B64A 4A8QA 4NLQA 4EU0A 5LMUF 2IVYA 1UKUA 4EWTA 5DM7Q 4HTJA 1O8BA 4ZP7A 3DLGA 3QAUA 1KR4A 4HEA9 3CXCR 4FXDA 2VG6A 2FVPA 4C9DA 6FDRA 4ECZA 4CH1A 5A8KA 2DT9A 4TYAA 2YNIB 2BUNA 2EWHA 3GV5B 2V8DA 3MHYA 2HS0A 5KFWA 3Q2TC 2CQDA 2MGZA 2MXYA 5KG3A 3PW4A 3CDBA 4ECUA 1ZOTA 2NPIA 4KGMA 2UUCF 4B9TA 3FNNA 3PX4A 2AYMA 3CEDA 2JEFA 4ZDNA 1BQMB 4J9KA 4I56A 3B4DA 3JSBA 4L6V3 2VH7A 3JAMY 4A48A 4Y3CA 2ZH8A 2HHHF 2KJVA 4WU2A 2DITA 2CJKA 4X2BA 4M1KA 2CG4A 5KFKA 5A2QY 2ASJA 1JLEB 2FDNA 4U7CA 2RQMA 1FKOB 3KHLA 1E6YB 3SYZA 1U48A 2DRAA 4RNMA 3HO1A 3MECB 4DSEA 2UZAA 3TVYA 3PDNA 1UFWA 2JL9A 1SB6A 5B0AA 1HI8A 3HLUA 3KOAA 1G1XA 1MNEA 3MMBB 1HMVB 3OXFA 2I8EA 1FE0A 3MAQA 2W4DA 4OZLA 4FVCA 1S6QB 3V4MA 3VZHA 2F9DA 5J2PA 2L9DA 1U45A 4U7UK 2HG4A 1Y3JA 5T41A 5KFPA 4CNYA 3M8PA 2BQUA 2A2DA 5DQHA 4FBTA 4LMZA 2GFFA 4A46A 2VPYB 3VF0B 3KLFA 2ZNZA 3DHWC 3SQGB 1S0MA 2PSZA 4C0OC 4X66F 4IR1A 2LQ9A 2QZ8A 3FSYA 2D41A 2R8IA 3FQKA 3UE2A 3NRBA 3KFWX 2RIJA 3I5AA 5EX3A 3TO8A 1U1MA 3NNCA 3MM6B 4L3NA 4OJ3A 5GAGI 3QPIA 5KFZA 5L9XA 5D8HB 5HO4A 3HHKA 4X4OA 3CB4A 3GR1A 3PRDA 5L8RC 3QIPB 1WTFA 4UY85 3NS5A 1HBMB 2LMIA 2OTJS 3QLHA 1JNZB 4ZOSA 3OTOF 3SSRA 4LF6F 5F8NA 1JLGA 4GO5X 3RAMA 5D78A 3OJUA 1WHVA 2FHMA 3EGNA 3FZ2A 2V4JA 3M1VA 1LW0B 3B82A 2DBBA 4RWWA 2N4DA 3GIMA 1XMOF 1UVNA 1WF0A 2KB2A 2HVHA 1VRUA 3CD7A 1Y3KA 5B0FA 2R7XA 1VI7A 4NLGA 1QY7A 2UXBF 2KO1A 1L5UA 3S6EA 2M8HA 3DDNA 3QJPA 2AQ4A 3MR6A 3B4MA 5LXYA 4NYOA 3POTB 1JLCB 3RU0A 3KNAA 5KFRA 2ZHAA 4WK1A 5CHCB 2KN4A 3MEEB 5D4OA 5SZTA 2Z2LA 1JLQA 1N88A 2HHWA 1M5HA 3BQ1A 3OVAA 2V5HG 1KQFB 2EFPA 3OHAA 3R5CA 3EPGA 1L3VA 1KFSA 1MU2A 1ZBTA 3AQPA 4Y65A 4K4TA 3OUYB 2E66A 1APSA 3AHPA 1GTEA 3IWXA 1IXKA 2EI5A 1QLNA 1K0TA 2B9WA 1HARA 2HNDA 4XAKA 1R43A 3W2VA 2LCWA 1WI8A 5BJRA 1YBAA 1X5OA 2N4CA 2CQIA 1VGYA 3M05A 4NA1A 2VPZB 5EHHA 2ZVSA 3NL0A 3ZZRA 1N6QB 2RNEA 2XS2A 2VBYA 3NP5A 5CYMA 2M70A 1S0OA 3RW6A 3VR1A 2F8HA 2G4BA 4LSNB 1QM9A 5DO2A 4WFAQ 2W8KA 3BGLA 1N54B 2ATLA 3CD5A 1RTDA 3EUNA 5I3UB 3EXCX 1ZZFA 3PNIA 4G1QB 2ZH6A 1IKWA 4PCQA 1CG2A 3ICLA 1FESA 1JJ2R 1RKIA 2B43A 4Y6IA 3G6VA 4NLPA 3KWMA 3SV3A 2HHPA 2O67A 2R7QA 5KFNA 2DVIA 1FRXA 5SUHA 4PWDB 1NNDA 4AE5A 2OAUA 4DEZA 5CH7B 4DN0A 2X1BA 2QA4G 4WTYA 5T14A 2YNFB 3T6BA 2VD3A 2CJAA 2ZC3A 1ZM9A 5CD4H 1IUJA 3CC4S 2OD4A 4JI8F 3W7BA 2KRBA 2IA6A 4I2QB 2FHKA 4TU9A 1W2IA 6FD1A 4JYAF 1WG5A 3JSMA 2W7PA 1FERA 4NCGA 4CNZA 2XMJA 4X62F 2FLLA 2UVRA 2ZUGA 2N82B 2GCFA 4IO1A 2BM0A 3P6YC 2KXFA 2KKHA 2ADCA 1V3SA 2BANA 1NAQA 1WF1A 3M6XA 1GQEA 4C3MA 4N76A 1R8PA 1DRZA 5DLGA 2JLEA 1WEZA 4URSA 4O3QA 5L1KA 2JEJA 3N6NA 1S49A 4MKBA 1R3NA 3BO2A 1NH8A 2AX1A 4EZ9A 1S48A 1WACA 3M8QB 1F5CA 3KLIB 3FRYA 2LXIA 2YNIA 1EETB 4Q44A 3CUNA 3JYTA 4H54A 1CEZA 1P6TA 4DF8A 1LOUA 3M2RB 1LWEB 2DR7A 4TLQA 4DV5F 1S6UA 2QMXA 3PFOA 3LOUA 4CO2A 2HIQA 1BQMA 2U2FA 3CSKA 2M4MA 3HXMA 1OSCA 1Q1KA 2XMTA 4DL7A 2W4PA 3M9OB 5MAOA 1S72S 3HJFA 4Y34A 1S1UB 2LEBA 2AWZA 4DL5A 3VWSA 4NXMF 5IFMA 2C3YA 2ZFHA 3MECA 1WHYA 2G0CA 2GX8A 2XNQA 2ZKTA 2WBMA 3CCWA 4YQWA 1RYRA 1FJEB 4O3SA 2D74B 1NKEA 4CO1A 2MZTA 2MY8A 1TVRA 2B9YA 1ZTWA 2MKHA 3BQ0A 4FZVA 4DQSA 3JSRA 1UVMA 5I42B 4C98A 4NOHA 3OL6A 1FE4A 1HPZB 4K5RA 5KFGA 2R8GA 4XO0A 5K8PA 1JLBB 2HWTA 1KQSR 4YB1P 1LWCA 4OZJA 4OZNA 4C8NA 1P8GA 1REVA 4A47A 3PKYA 4ZCLA 1F2GA 2Y1IA 5DLFA 3PEJA 2ABYA 2K2PA 3OBIA 3M4XA 1SKWA 1R8AA 5K9FA 3SQGA 3HT3A 1N34F 2XMWA 4RNOA 1HNVB 3MPVA 1N5YA 2XCPA 1S9GB 2XNRA 3MM6A 2CPFA 4IG3B 1XNRF 2LU1A 4Q45A 2GMJA 4DR4F 3GV8B 3OLAA 5IT4A 2LA4A 5B0EA 1SC6A 3QIPA 2OIHA 1WF2A 4J9NA 1HBMA 3D2WA 1FNMA 2E1CA 2M9KA 1FRMA 1FO1A 4OI0A 3BO3A 2DH9A 5FDLB 3TNVA 4QU7A 4GKJF 4DL4A 4ED3A 2DO4A 2WSCC 2XMUA 4DR2F 3BN7A 1U1QA 3CJ0A 5EX0A 1RT5B 2AJ0A 4X4PA 3ENQA 4NLVA 3GMGA 2ILZA 1FD8A 4N47A 4MK9A 2HFZA 4H4OA 3O6QA 4AXIA 1SKRA 5L1IA 2YKMB 2DGUA 2MDAA 1RTJA 3QYYA 4H4KC 4QZVB 2IRUA 1RA6A 3GIKA