4BHQA

Structure of the periplasmic domain of the piln type iv pilus biogenesis protein from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
AVPWSQYLAAFINQIPRAGGRLEVALRSVSARALSEEEAARLAQEGTYDGKRIRVEFALQGEALSREALVRFIRAFETSPRFGIEFQGASLDEGRGLYTFSARVGVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPETENCE PROTEIN PILN
publication title Structure and Assembly of an Inner Membrane Platform for Initiation of Type Iv Pilus Biogenesis
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Cell adhesion
total genus 30
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18222 PilN_bio_d PilN biogenesis protein dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2830 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4bhqA00
4BHQA
chains in the Genus database with same CATH superfamily
1RTDA 2WONB 1MMNA 1WNEA 2VU5A 2LEPA 4P52A 3FEZA 2MHEA 1IQTA 2V2KA 4HH1A 4KKOA 1MWQA 3FEXB 2F3JA 1PJ6A 2AJ2A 4IYQA 3G8QA 2DNGA 4K4XA 4ZVOB 5MAOA 3LQVA 2BJ9A 2DKOB 1IM4A 3ZZUA 5ETVA 3MPDA 4K0KJ 5HVHA 1Y11A 2AQ4A 1EQ0A 1XMOJ 5GADU 1QVGR 2UUAJ 1M0SA 3OLBA 3SXLA 1RUSA 3T9NA 1YI2S 1WKKA 4CRJA 4NLRA 1U45A 4C8LA 4UZCA 4UUWA 1OY8A 2GJ2A 1NK0A 4K8RA 4IO9Q 1VQ8S 2XULA 2GMHA 3FMBA 4WF9Q 4P73A 4KGKA 3EVWA 3Q8SB 3QLHA 4HDGA 5E41A 2QA2A 2P2CB 2CPXA 4DX6A 2OD4A 1SJRA 4JI2F 4NZ6A 3UDVA 3RTVA 2UVVA 4PXBA 2XHWA 5DDPC 2RSQA 4P2SA 2CJQA 1EJ7L 4YB5A 1R89A 3TUJC 4Y3CA 4OV1A 4PZVA 3BGRB 3HKWA 2B4VA 1RAFB 2RVJA 4AL6A 4W92B 2LFVA 2L48A 2HBYB 3JAMU 3KDNA 2XSJB 2V50A 1RE1B 1HBMA 2GV1A 3MECB 3LP2A 4BHQA 1ZBTA 5CD4A 5J2PB 1SXLA 2BEFA 1KEKA 3GWCA 1N5QA 4DR5F 3ET6B 1CJVA 1F3FA 3BGLA 2OPRA 2XCAA 2GHPA 2W1BA 3ZFVA 1NUEA 2A2DA 4UOFA 5J1EB 4XTTA 1RTIA 2EKYA 2PI4A 1WD6A 1FEEA 3DGVA 3Q22A 5EX0A 2VF3A 2C28A 3N5BA 2DH7A 4E98A 2K06A 4DS5A 3NLCA 1U25A 2DNMA 3MM5A 5KG0A 4LFAF 3WBZA 5K8NA 4ID8A 2ADCA 1OJ4A 4MK7A 5F41A 3BGFA 4MT1A 3VF0B 4RPFA 5HATA 4CLWA 2RU9A 2FPHX 2BKNA 4K4TA 2G13A 1FI4A 1S7HA 2AIRB 4OHYA 5F8NA 3DMJB 3UD5A 3K7RA 5A76A 4TKTA 2LQJA 2KRRA 4Y2KA 3PCOB 2KVQE 4OYIA 3GIIA 1GXUA 4L3KA 4X64J 1JQGA 4JV2A 2DYAA 2MMYA 3LF0A 4RU9A 4WU3A 5B0EA 2D69A 3UO0A 3NNHA 3T1YJ 4X4PA 4KH0B 4LSNB 3GYGA 1HLWA 1O51A 4DJBA 3R7NB 1Y5LB 5JJBA 5CABA 4RUHA 5E3QA 5CZVA 3AOCA 5KFNA 1EB0A 1EETA 1R43A 1SH3A 2G9OA 4M5MA 4ZPCA 5J1NA 1H2TZ 1E6VB 3KLGA 2YPZA 1OWXA 2IPOB 4F7VA 5ETOA 4GKJF 4LF7F 4OL8A 1JWWA 4QWDA 2J9CA 1SH2A 1U4BA 4F4YA 1QAYA 3VGVA 4ZN1A 3M8YA 5D0HA 4DR6F 3ELHA 4OHXA 4EUVA 1NHVA 5IC6B 2KI2A 1RHQB 3HPOA 4DL3A 3ILIA 1UVMA 4ZPTR 3HVTB 1VQ9S 1T05B 1S1TA 4S0MA 4ELUA 4DPYA 1KVJA 1S6OA 1FK9B 3L3CA 4RW9B 2XMKA 1VBYA 2CIMA 2V0NA 4WFZA 1B0TA 4P74A 1NMEB 2HK3A 2IHR1 2ZC3A 4F3QA 2VIHA 3MR3A 3CJKA 3OPKA 4RO0A 1SCJB 3CT9A 5A0YA 3H4BA 1S9EA 4ECUA 2XS5A 2I8EA 4B3OA 4ZVGA 1UWBB 1I6JA 1S1WB 3ZTPA 1X60A 2W4CA 1FJEB 2GGPB 1W26A 3M1VA 2B43A 2FGOA 1XTZA 2BZ2A 3HSDA 3G6XA 4Q5VA 3UDLA 4NI2A 1RWXB 1URRA 4RW8B 3UR0A 1L3TA 4UUXA 5D15A 4CNZA 3PIPQ 4IFVA 1VQ7S 4WE1B 3W2WA 4HKQA 4MIAA 1T03A 4RUAA 4GRSA 3VQTA 1FXLA 2KHDA 4ZDNA 1HNIA 3IMQJ 2QC3A 1WHXA 2HGNA 3I82A 4FDFA 1BE4A 2YH1A 4H4MA 3SCIE 2QLFB 4MK9A 3PACA 4QWCA 3VAFA 5A6PA 4DL4A 4F2SA 3BBBA 3C19A 2ZVIA 1WI6A 1HIYA 2M5YA 4LF4F 3C14B 4KHMA 1MWYA 2JWNA 4DG1B 2DNKA 4O3PA 4CM2A 3ILLA 1OY6A 4YY3J 3KG1A 3ENQA 3CDEA 4QYZK 1HQ2A 1N34F 4CT8A 1J5EF 3RU0A 3ADAC 3VV2B 5J2QA 5DM7Q 4V19J 1VBKA 3W61A 4YB1P 2I38A 4J9UE 1VJWA 3UVJB 3D28A 4DV2J 4FYWB 2ADBA 2DJWA 3E51A 1AT1B 2FLPA 1E6YA 4X2BA 4ZP9A 4N8NA 3MAAA 3EXYA 4AQYF 1KVIA 1LW2A 5A8WB 4IG3A 2C42A 2HS4A 3S8SA 1CULA 2DHHA 2WCXA 1KRPA 4ECRA 4E0DA 4JI1F 2PMWA 3IXQA 3HI9A 4QIVA 3DLKA 4IOBA 1T9TA 3DDKA 2MZQA 1RWPB 2CJKA 2X51A 4XO0A 4P2MA 4C48A 2E9TA 1WHVA 3MWBA 3RUBL 3V2UC 4PQUA 2EBGA 2YKAA 2DR5A 1FNMA 3FC9A 4KFBA 4E2FB 4DV0F 4DFKA 2YNGB 1S9GA 2CJBA 2CZ4A 3MOJB 2H65B 3OL7A 4R0JA 1N5YA 4JI8F 1JB0C 3CDBA 5DDQC 1MU2A 2B56A 1Q16B 1YG0A 4O4GB 5KFJA 1RT7B 3ENVA 2ASDA 2HRYA 3LO3A 2FIUA 4KV8B 4UZBA 1RCOB 4KSEB 2L08A 4IH6A 2Y0BB 4DV5J 4WFAQ 1MLAA 2A18A 1S1XB 1RAAB 1LXJA 2J8AA 4X4SA 1R6YA 1BWEA 2E1MC 1RT4A 1Q4RA 2FC8A 1UW9A 2N82B 5U47A 2EW9A 4MMOA 4U67Q 2W01A 3IGNA 4ZLNA 4B3MJ 1TUGB 1F6TA 5BR8F 4ATNA 2ACMA 4U8VA 5HBMB 3SSSA 2YX1A 2HFVA 2HVEA 3M6WA 3EE3A 3OVBA 3H20A 3SI8A 2Q43A 4QU7A 3PW2A 2H1YA 1S12A 1TKTA 4FXVA 3VCDA 3POTA 2GAGC 5KFXA 3TA0A 4DR7F 4JP8A 4X62F 1FDNA 1LFWA 1KTVA 1RWOB 4HL9A 3HVWA 2DGOA 3F44A 1NDCA 4LR9A 4CTAA 6AT1B 4C0HA 1VHIA 7AT1B 2ILZA 5KOXA 4ECQA 4NCAA 3CJ0A 1U09A 4RNMA 1KQKA 2C3MA 2O5DA 1FTCA 1B64A 5DGAA 4Y2AA 2WK4A 3MCOA 3BSCA 2RQ4A 4W90B 4OYAA 4LBHA 4C8YA 5DLGA 3ETOA 4G1QA 2H54B 1U2RA 3FNNA 5M2PA 2YWWA 4ES3A 4A8KA 5JUMA 1NJXA 3MEGB 4HTJA 2OAUA 2RDIA 3W62A 2MLYA 2V69A 2JFDA 3UN2A 1VIXA 4U96A 4GVBA 3Q2TC 2B0GA 2J0WA 4H54A 4DV4J 5C24A 4ED7A 4CQ1A 5L1KA 3PY8A 2QLWA 2XLKA 5LL6d 4ZPVR 4ID5A 2RNEA 1CJUA 1FDBA 4EK2A 1DFDA 2UP1A 2YQ3A 3HLUA 5HVFA 3HO1A 1RU2A 1RI7A 1X0PA 1LW0B 2ROPA 4RUCA 5KFLA 2QLJB 2HGLA 3MR2A 3VQSA 4O23A 4OYBA 5BYRA 2DGXA 5CCMA 1ZYQA 1SB6A 1DJ0A 3Q8UA 2M2BA 5DRKA 4F25A 2PT0A 1NB7A 2MLZA 3G9CA 3ZNJ1 1FNOA 4Y65A 4EYIB 4ES2A 1FERA 2VV5A 3U1LA 2UXBJ 3MD1A 1PO6A 4F4WA 4B9UA 2MGZA 2B5JB 4QQBA 3UCZP 2J5AA 2MZTA 4DV7J 2HNYB 1HNZJ 1HMVB 2JOQA 4DX5A 1V5IB 5F3ZA 5F8HA 1VMBA 1NK5A 1N6QB 1UAWA 3H90A 2CQ3A 4FNHA 3SQOP 3MMBA 3VZHA 2BA9A 3CPWR 4QIFA 3GTYX 1S49A 3IGVA 1QDUB 4LVNP 3FCVA 4KGMA 3KHHA 1T7PA 2OUGA 1M5VC 1T0TV 2WVDA 4QW9A 1VYAA 3AY0A 2FYXA 2K7KA 5IC4B 1KFSA 4C9DA 4FYXB 4LF8F 3K5LA 1Q8IA 3N6NA 2HGMA 2JEJA 3G8TA 1VK8A 4I67A 1WF0A 3TJAA 3VAHA 1U26A 4ED8A 1FFWB 4V19X 2WSFC 2HFNA 2YQ1A 1QSLA 2BM1A 4CLLA 3CJ3A 2KVIA 3PYFA 4A8WA 3JQJA 3W3SA 3KLEA 4DPOA 2ZOGA 4WWSA 5HSPA 3DRXA 1UZHA 4Z7CA 2FZCB 2FLNA 1BQNA 4Y2MA 4OI1A 1KNZA 5DZ6A 3JSYA 4ZVFA 1U1NA 2V5HG 1UZDA 2BACA 3JYTA 3IG1B 3DYAA 3CWJA 2ZNYA 3BQ1A 3ETMA 2J0QD 3G8SA 5D78A 3BV8A 2E7XA 4PYDA 3KK3B 3BO3A 2XYPB 3R5DA 3H40A 3OTBA 3TVKA 1IR2A 2FQQB 1JMTA 4CT9A 3BM7A 3SCKE 1JNZB 1Z2ZA 4KHPF 2VUGA 1U0SA 5I3UB 2R8KA 4J9OA 1VOMA 2ZFHA 4WCEQ 3L7PA 1YBTA 4FF4A 3D1OA 1OQ6A 2CQPA 4ZP7A 4DR4F 3DRPB 5LXRA 1DRZA 4WP9A 3VAJA 3ZZ0A 5CQGA 5T7LB 4UOHA 2HVDA 3ONQA 4PEOA 5A8RB 4DL2A 4GVLA 2FJVA 1JKHB 1ROFA 1KD1T 1MWZA 1FD8A 2X7IA 3D66A 1C1BB 4RW7B 2YWGA 4OJ1A 1VK3A 4JYAF 4LFBF 3LGMA 2J0XA 2UV8A 3FRYA 3C6UB 4C0BA 1JXVA 4DV6J 4URQU 4C0OC 9ATCB 2ILYA 1U6ZA 1D0EA 1GH8A 4YN3B 1FT8A 1WJ9A 1WUUA 4OZJA 2YKNB 1TL5A 2YKPA 5KFQA 4I4BA 4Q7AA 2DK2A 5L39A 3DFEA 2CPYA 3Q8VA 2ASYA 3QJPA 2LDYA 5C25B 3IRWP 1R8AA 2LU1A 1DTTB 2XY5A 1JLFB 1N56A 4JUZA 1HL6A 2NPIA 1WC1A 1KR4A 4QYZJ 3CCLS 2WRMA 3GB0A 3Q24A 2F40A 1SC1B 3KLVA 4HT5A 2H4YB 3D6TB 2OPQA 4UOGA 1WORA 2IRUA 2HK2A 1TL1A 1HNXF 3UFCX 3AJ1A 2HMIA 3PKMA 3H98A 2ZC4A 3K5MA 2J6SA 3W5XA 3QBCA 1R7IA 2CQ2A 3M30B 2M7SA 1P1LA 2OI2A 2MSSA 3AFGA 2H5EA 3J80Y 2LEBA 3CIMA 2UXCJ 1F9EB 1RHMB 2JLFA 2PIIA 1ZTWA 4K4ZA 4WIIA 2HBRB 1N4LA 2JVRA 2C3UA 2DH8A 1QAJA 2KM8B 3HVRA 2EBEA 1X5OA 3OTOF 1TV6A 2EKNA 2YWHA 1IKYA 3F73A 1NJZA 1PYTA 1RT2B 3PJ9A 3VAMA 2QFIA 3NCQA 3NGSA 2E5LJ 4ZA1A 4FBTA 4NYZA 4B3RJ 5LMNJ 4G6VB 4HHJA 1WKJA 3DRRB 4ZOSA 4LQ3A 4BWJA 2XS2A 2W2OP 3HF5A 5AXNA 4JV1A 2M3DA 1N36F 1HPZA 5I3PA 2MSTA 3M7VA 3DN9A 4PXCA 2GZOA 3BSAA 5DM6Q 4PUOB 2OPSA 1TMJA 1JLEB 3JSBA 4QR2A 4USIA 3JTNA 2LQBA 2C2OB 3G86A 4CH1A 5RUBA 5F8JA 1NSAA 2Q79A 3UR3C 3TX0A 1SJ4P 2QSFA 1ZZNA 2XS7A 5DLFA 5G4DA 5F8LA 1H2UX 2GVZB 2VL1A 1M5KC 4BC7A 2MKKA 1JJ4A 3WIUA 1RP5A 2MEWA 1YK9A 1GX5A 2UUBJ 5IZHA 1UJ4A 1SKUB 1VQSA 2RE1A 4ZJQA 1Q78A 1QY7A 1VC6A 5K14A 3JSMA 4NL5A 3IR7B 3M6XA 1RT1B 2D9PA 2ROEA 4AFFA 2AYGA 4IDKB 2ZJRQ 5B0BA 4O4RA 2Y1JA 2QL5B 4DUYF 3QIPB 4P10A 2VG7B 3IC1A 3DRSA 1CJKA 1ZH5A 2QYGA 1ZM2A 3FK4A 4K2XA 2DR6A 4C4WA 3OUYB 4ZVSB 2LXUA 5EWGA 3D67A 1HKAA 4RX6A 5AXLA 4FZVA 4I6AA 3B4DA 5KFIA 2DT9A 5FDLA 4DFMA 5D6GA 4IQMA 4YQWA 5IV4A 3J7A1 2XI2A 3RAXA 4JI2J 2AYBA 3IFEA 3QJLA 1S6QB 3O6QA 3QWUA 3NWGA 1MMLA 4BWMA 1WTFA 1J5OB 3OL6A 2ZKUA 1SI9A 2ZBRA 4RW6B 1NSKL 5K20B 4ECYA 3IR6B 3UD4P 2I2YA 1KOHA 1Q7LB 2AP6A 1SJQA 2VODA 1HQEB 3QGHA 4IFYA 1HWIA 7FDRA 4IH7A 1UL3A 5H9FJ 4OV6A 2VG6B 3AAWB 4DR5J 2B3TB 2H5IB 3I0SA 2VBWA 4RWXA 3R7BB 3ITHB 4PG8A 2K1RA 4U7UD 2Y8YA 2HEKA 1A6LA 3CCWA 3CCQS 1KN6A 4ZCKA 4G65A 3KKFA 4JI3J 2HWIA 1DQ8A 4FKYA 5LSLA 3UCUP 2G2ZA 3PO4A 1BUXA 3L7UA 1VQ4S 4Q8EA 2W24A 5C2CA 4ZP8A 3TYTA 3KLIB 3V81B 2GC8A 2XYHB 1P9QC 5ETNA 3WDOA 2R4FA 4OYOA 4J9SA 3QO9A 5A8KB 5GAEU 3KHLA 4MIBA 3EVOA 5HQMA 4RNFA 3IM9A 1IKVB 2P9CA 2HVHA 3B78A 2YTCA 2IAJA 1X4FA 1D8YA 1RT6B 1RKIA 1F60B 4U7UK 2M8HA 1R0BG 2KT2A 1JLAB 3GV5B 1UTAA 3L4BC 1PSDA 5CYQA 3FQLA 2PE8A 3G82B 4WU2A 1YZ7A 4BCAA 5K9FA 3BN4A 4FVMA 1IBCB 1RLCL 2IJRA 4LFCF 1FWKA 2WSCC 4WP8A 2O66A 1QM9A 2J9DA 4LRAA 3CF5Q 4AL7A 4QPTA 2JDJA 1NK7A 2V67A 3PHTA 1KOOA 3UN3A 4K4UA 2QT7A 1XR7A 3DM2A 3DOLB 2EG1A 1RT5B 3P3DA 2W9BB 3MEEA 1VR6A 4C8MA 1HBNB 2CNNB 4DR6J 4ETZA 2K7JA 5E2QA 3FUYA 3PJWA 1XIQA 3EDRB 2YWEA 3D1HA 2AHOB 4KAIA 1WEXA 3DDNA 4ZLJA 2DRAA 2AX0A 3W5ZA 3GV8B 1AZSB 4C8ZA 4WFYA 3CC7S 3CD7A 4O44B 1U6BA 4OQJA 4NRTA 1LFPA 2F8MA 1AUDA 3GSDA 4HLBA 2BQUA 3RR7A 4OJGA 1WG4A 4CYUB 3PNIA 3I6PA 4X4NA 4C7QA 2LKZA 1FJGJ 1RHKB 1RYRA 3OVSA 4I69A 2YWKA 4A4JA 3MMCA 4PXDA 1FO1A 2YX7A 3W8GA 2B8QA 3H4DA 4LVOP 3V4IB 4DV1J 1NDKA 2DGWA 3DOKA 1TFWA 2IC3A 2YPYA 1CEZA 1ULRA 4WFXA 3R6GB 2RF2A 2JEIA 2LXIA 1RCXB 4ECSA 2IA6A 1SQGA 2MKIA 2RMLA 4K7QA 2XSJA 5G0RA 4NLDA 2W4DA 3PZPA 4NZ0A 4PG4A 3TZXA 2HHVA 3VALA 1RAOA 3FZ2A 2NLWA 1WKLA 3EWGA 5HANA 2FTRA 3HJFA 2ALZA 4Q2MA 2O1PA 3EGVA 2DITA 4RW4A 2MQ8A 3DLHA 3ISNC 2Z58B 2FVPA 2L9WA 1M5PC 4GO7X 3C8YA 2H48B 2DGQA 3T6JA 2AKWB 2COLA 4I6YA 2V6AA 1NXIA 4ZHRB 4QR0A 3J81Y 1O0PA 2HS3A 4CLPA 3BEGB 4I6WA 2GQQA 1N34J 2CJYB 1J5EJ 4DX7A 2XMUA 4IOCQ 1V9OA 2OTJS 3ZZYA 3M8ZA 1TTHB 2JSXA 4DCOB 1KHWA 4ZJLA 2GIQA 9RUBA 1U0HA 2QIFA 4IG0B 1K73T 2BBEA 1FKPB 1RBAA 3NGUA 5J2NB 1TL7B 4EO6A 4OX9F 4ANDA 1C0TA 2B7BB 4JB8B 2E7VA 3DMJA 3QFWA 2AU0A 2NXUA 3H8YA 5D4OA 2RJZA 1VQNS 4O3NA 2C2RA 1V5VA 1XQIA 1R6VA 2YKQA 1G6BA 3CULA 2Q66A 3HHNB 2HHTA 3AJ2A 3IWLA 2W25A 5KFDA 1WEZA 3PRDA 2WOMA 3BKUA 2KG0A 4DV0J 1H38A 3V6KA 2NYHA 3U27A 2GVDA 1AA1B 2IRYA 1NZ8A 3AXMA 1O8BA 1KSPA 3ZNUA 1XERA 1S0MA 4JI8J 2QV6A 2PA8D 4DPTA 3N6MA 1YJTA 3CB4A 3TX8A 3NXZA 4KY3A 1R0AA 1TFYA 2ZHOA 5J2MB 3D9BA 4G1IA 4LR7A 2OTLS 1FNXH 2HBZB 1LXNA 3PW0A 3DI6A 2JL9A 2K8GA 4KO0B 3IBWA 4KE5A 2ZE2B 1FRKA 2XWXA 3N4WA 1OO0B 4KTQA 4RL1A 1BQXA 4NLTA 3O5TB 2CADA 1RJJA 2W2NP 3FGVA 2HFSA 3DC2A 4M5DB 4IRDA 1NJYA 4A8OA 2AEFA 3MM6B 2EK1A 2ZH5A 4I2PA 1FK9A 1KC8T 4RW9A 2Z2LA 1X8DA 3I0RB 3QGPA 3TR5A 4R8UA 3QJJA 4NLOA 1VRUB 1KLMA 5AE1A 2QSWA 2YXLA 1I1GA 4DR7J 2HW3A 2GNKA 1RTHA 3RR8A 4RNOA 4PQAA 3BDPA 1CJTA 4JI0F 4USUA 3BDEA 4K4VA 4KGXB 4OYWA 3I4HX 3CD5A 3OJSA 4DR2F 2R8GA 5H9EJ 3BO4A 1WC3A 4M5JA 1NJIT 3OXFA 4QPXA 1ICEB 3RBXA 3ZTSA 4A8YA 2KZMA 3TVZA 1YRTA 4ED3A 1O5JA 1S1UB 4TYAA 2V8DA 2BUNA 2ZBIA 1RT3A 3A4TA 4JI4F 1NLKL 2G0JA 4N76A 3C16B 2GS8A 4OI6A 4Z2XA 4OI2A 1NNDA 1N0UA 3EX7B 3GSIA 2ZBQA 2HHWA 1RADB 1R0CB 5F9NA 2PI5A 3MM7B 3SDEB 1X4BA 2VPWB 1VC5A 3VTIA 4NCGB 2B4PA 1XC9A 5IM0A 3US5A 1IBKF 4H4OB 4K5SA 1FESA 1IR1A 3LUYA 1U2FA 1V3ZA 2PO4A 1HHQA 2MKSA 2BE2A 4M5GA 1PBAA 1VFJA 3KOAA 1TL3B 5F0WA 3P96A 1CS4A 2P9GA 5D3GA 4X66J 1LWCA 1X4DA 1IKWB 2OLWA 4UQGA 4H4KA 4LIWA 4WYLA 4MH8A 3B82A 2BX6A 4OZNA 1VDHA 5KT2A 5AJ3J 2FJWA 3GQCA 2JVOA 5A8WA 4P9SA 4LSLB 1NHKL 5KFOA 2HG4A 4TY8B 4OX8A 3VGTA 4J9PA 4ECVA 4XDDA 4E8UA 1RTDB 2ZHAA 3HULA 1X9WA 1FVQA 3KMQA 4LRBA 3KG0A 3DXBA 2B6AA 2NS1B 3M6VA 2HVIA 1Q79A 2ROGA 4DN9A 3AODA 2KN4A 2GQCA 4OFZA 1N32F 3OSNA 3UPFA 4XPEA 1IBLF 4DCPB 4DPXA 3OT9A 4O3QA 2ZJPQ 4Y0FA 3Q8RB 3VAGA 5HQLA 4L74A 3OTCA 2C3OA 4KRWA 4FF3A 4ED2A 3HCXA 2VQEJ 1N5VA 1M5OC 5GMEA 2GMJA 3G4SS 4KR0B 1YDLA 3TZYA 4OX6A 2BQ3A 2CZVC 2BR0A 2MZJA 1NH8A 2QFJA 1NSQA 1X4EA 3QLHB 2CVEA 1S1XA 1TK5A 5F8GA 4DUTA 2XBPA 1HWKA 1A9NB 1REVA 3GP9A 4TU7A 1B70B 3WHIA 3NS6A 5C42A 3M8SA 2M52A 4DUZF 2LP4A 1Y0HA 2ASLA 3Q8YA 4JI5F 1HBMB 2YNHA 4KC5A 3LP2B 3EJMA 2DB1A 2C2DA 3DRYA 1VIOA 2EFGA 3TJ9A 5GAGI 4B3SJ 2B51A 1IBMF 1VQOS 3TZZA 2AX1A 1CQNA 1CJVB 3EZ5A 1G7CB 2OPRB 3CW2C 4ZVHA 2BDPA 1HFEL 2B9EA 5HMZA 3DLGA 3PTWA 3CCSS 1CQMA 3BR8A 4FYDA 3D4JA 1RTIB 4X4TA 3CXCR 1XMQJ 2J0SD 2VJVA 1EAYC 2BOPA 3R7SB 1HI1A 3QAEA 2V2QA 4V1Ak 5F9LA 4KHPJ 4EI2A 3MM5B 1ZM3A 2N4CA 2DHGA 2BANA 5HO4A 2RDJA 1DQAA 2DR8A 2RKIA 3PKYA 1EKRA 1V3RA 3LTOA 1FEHA 3ZZTA 5IV3A 3R5CA 4OI4A 2F5GA 4C6AA 3TJ8A 3JQMA 1CBKA 3DLJA 5ETLA 1N0VC 4GKKJ 3GIJA 2ZEJA 4CO5A 4HVZA 2FY1A 1F9FA 3H2LA 2IM1A 3I96A 4JYAJ 3T1HF 4LFBJ 5KT5A 4OZLA 5DG9A 5DO2A 2JHEA 4ITSA 2HZAA 2ZH2A 1WWHA 1K9MT 3A12A 4MFBA 3DLEA 2JC0A 3R1LA 5I4MA 4NXMF 1BMQB 3LP0A 2CPDA 3SYZA 3CCTA 1EETB 3L7OA 3K89A 5DETA 2YY3A 4XDCA 2CQCA 2QL9B 3PRVA 2Y0SD 3KLGB 4FVCA 2V4JA 2I5JB 2C2NA 1HWJA 3LP1A 3MAQA 3FJ2A 4ZS6A 4TQRA 3MM9A 3V4MA 2HNYA 2QX0A 1HQUA 1CC8A 2E1PA 4WXWA 1HNXJ 2H5JB 3KK2A 1N6QA 3HM9A 3UNYA 3QPIA 1Y10A 1PYSB 1YITS 4PG6A 4MKBA 5KFGA 1SVDA 1S1TB 2UUAF 1TVRA 1M1KT 4DR1J 1DARA 3CJKB 3A13A 4WZQA 2PMHA 2HHUA 1FXRA 5C5JA 1SJFA 5A0YB 1S9EB 3DOMA 5M2RA 4B3OB 4X4OA 4TVAB 2LA6A 2ZOFA 1T9YA 1IKXA 2Z2MA 1C4AA 1GT8A 1N88A 5IT4A 2B4UA 2RU3A 3M1VB 1ZOTA 3SCLE 3OHBA 3I4PA 1WF2A 1VLYA 4CLZA 2KYZA 3CJ5A 1UA1A 4ED5A 2CFXA 4WXOA 3M4XA 2XMMA 4NI2B 2AD9A 3GIMA 1ZM9A 4OLPA 2NXJA 1TKZA 4DSKA 2NSBA 3UWTA 4IFVB 3W2WB 1N36J 1XR6A 1T03B 5HK4A 3B8HA 4UT4A 2DVIA 2RAQA 1Y5IB 3CDUA 2OMLA 4EGLA 5HN0A 1HNIB 3PX6A 1Y9OA 3CJQA 2HQFA 2CPIA 2CVIA 4OYPA 2VQFF 4IOAQ 2QA4G 4MK8A 1H7XA 3A8IA 4F3OA 4H4MB 2IMWP 3ZXWA 3J80U 5ADZA 4P72A 3PV8A 3NEKA 2UUWA 1NM2A 3J7Z5 2R7TA 2I6WA 3IO1A 4NA3A 4ALZA 3KK3A 4BBYA 5L9NA 4YDXA 2PN6A 1O6XA 1YZ6A 4NLQA 3FMWA 2W4PA 5ETRA 4ILLA 1X9SA 2NXNA 2Z8QA 1N33J 3TEHB 1VQMS 5J2QB 1ZAVA 3VWSA 3LAMA 3KTQA 1E6YB 4DLEA 1JLBA 4B9NA 3D0IE 4DUYJ 3KJVA 2XY6A 2D1CA 2FD2A 1R3NA 3MAAB 1TKXA 4FYVB 4HACB 1LW2B 3I5AA 2CQDA 1ZTTA 4IG3B 5K8PA 1RZMA 1CULB 1JK9B 1BQMA 3AA8A 4DBQA 5AXKA 3CCRS 2OEKA 3C6TB 3B54A 3IP0A 1T11A 3P8BB 3R6LB 3W1YC 4C8KA 3DLKB 2NSCA 4J7CA 1RWWB 2ZH8A 2NQPA 1U8WA 2KFYA 1ZA2B 6FDRA 3WC0A 1QAXA 2LA4A 4EYHB 1QAIA 2KH9A 4PQUB 4CI0B 3FBEA 4DSEA 3T1YF 1PJ5A 2XC9A 3M8PA 3DU6A 1UPMB 2KKHA 2ZKTA 2VKRA 1VRTA 3N9UC 2KZZA 2GQ2A 1S9GB 1DZ5A 1S1VA 3R3TA 3ZZRA 4C3LA 4Q44A 1RWUA 2OPPA 5EN1A 3EGWB 5KFSA 1N5YB 3WX8A 2WZ1A 3GG0A 2XMJA 1MU2B 5IS2A 4ZVRB 2CDRB 1RK8A 2ZD1A 2HNDA 4F0KA 3IBCB 3GE9A 2J9EA 1U48A 2J7UA 3ZC4A 2BJ3A 1ACMB 3MEDA 1RWVB 1XNQF 3ZO7A 1EP4A 5KFPA 1RT4B 2OELA 2SXLA 2RUGA 1PJ7A 1DBDA 5CCLA 3N79A 1P8GA 2GMLA 3IBFB 3CO9A 4JV5F 4LJMA 3GLJA 2HHSA 1Y4ZB 4C98A 5KFRA 3NL0A 2FJAB 1TKTB 3OW2R 2B7CB 4F26A 5T14A 3POTB 3RB3A 2ZM6J 4PYAA 2HAIA 5IFMA 4CLKA 3W64A 4C11A 3DDIA 4RZRA 4WKRA 4TQSA 3SIPB 1BY9A 2G2YA 1WC0A 1R8BA 2CNLB 1FXDA 3QATA 3ZTQA 2POKA 3QT5A 1R8CA 3AJDA 4CTAB 2YWFA 1YVFA 2RIJA 1SIZA 1GXLA 3V6JA 5HQ8A 4DS4A 1IWGA 2VFRA 3J7YI 4X84A 1HBOA 1G2EA 4C2MA 1QTMA 3ILJA 5ETMA 1S79A 2VPXB 2A6OA 2MZSA 3NOGA 1SUQA 2R7XA 1FRIA 4FXDA 4G1QB 3PW5A 1S59A 2VG5A 1L3SA 1WSRA 3HD1A 4KQZA 3D2WA 4DV3F 2RRAA 3Q86A 4ED0A 4GVBB 1H98A 1HD0A 4GMKA 1ELOA 3PYEA 4LFCJ 3TNVA 2E9RX 1UEUA 4WFBQ 3QRQA 4MKAA 1B0VA 5C24B 4NLPA 1RA6A 1NSPA 3N6LA 3THPA 4ID5B 2NCKL 1CSJA 3PFOA 1CJUB 5EX3A 2IYGA 5KT6A 4YY3F 1MN9A 4ELTA 3W2VA 2X3GA 2OKQA 1RHRB 1TQLA 3M2VA 3M8QA 4IR9A 3U1MA 2CQGA 3RBZA 1OS5A 1Q95G 4M1KA 2HRUA 2W8KA 3SEOA 4H4KC 3G96A 1RXOB 2GIFA 3UN5A 2W7AA 2XO7A 1UW4A 1Z2LA 4KGZB 2DEJA 1RAIB 4FXWA 2KJWA 2V4QA 5LT5A 2UU9J 3TQ1A 2WBMA 3CJRA 4K5RA 4HR2A 3B4MA 3TOQA 3AA9A 2FZKB 3GZ7A 1WI8A 1JJHA 2FHOB 4DPWA 2MGZB 2UXDF 2HRTA 2QMXA 3CGIA 1RU1A 1GMUA 1DQ9A 3G6VA 2KO1A 2BJ7A 1FFSB 4K4YA 4JOUA 3T5HA 1NPKA 2CAJA 4YHHF 1W2BR 3KLFA 2DHXA 1AW0A 1SC3B 2FZGB 2RB7A 1HR0F 4U8YA 3LWMA 3KJNB 2E5JA 4QWAA 4FBUA 5KFVA 3MMBB 4P7VA 3U02A 3VAKA 5E33A 2HHPA 1LWEA 4QWEA 3BYPA 4ZPBA 4F4XA 5HJYA 1B3TA 2EI5A 2PSZA 2LXFA 4R5PB 4QBUA 5KFZA 2VZ9A 3W65A 1IQZA 2CKWA 2CNOB 4JBCA 4QWBA 1UA0A 3KWMA 5B7WA 2XG8A 1UFWA 5AE2A 4J5OA 2XM3A 1A0OB 3MMJA 3S1TA 1Y5NB 4NA1A 3HP6A 4LF9F 1TAQA 4UF4A 2J7WA 2OEMA 3H5SA 1T3NA 2VC0A 2ZVSA 2KXFA 4P75A 2FJXA 1Q53A 4QIWD 2RHSB 5T41A 3NP5A 3KLEB 1SC4B 4A8XA 4TXSA 2FHJD 2E9ZA 1KP6A 1UVJA 1BQNB 1U1PA 1F2GA 1OSCA 3F41A 2Y8WA 1WOPA 5LXYA 2P5VA 1DLOA 5D8HB 4KIAA 3MURP 1VS3A 2W2QP 2XWYA 1DTQB 3JYTB 3DYAB 2MDAA 2HS0A 4OX9J 1YX2A 1SH0A 3ILOA 3OFHA 3JTPA 5KG3A 4A8MP 3FBFA 5I42B 3C15A 1KQSR 3SCJE 1EZZB 3T5JA 3SMZA 2X1FA 4K4WA 4PKDB 2Z2YB 4I2QA 4LRDA 3KUGA 4PRFA 2R7UA 1YIJS 2LEAA 3J81U 3LGHA 3K5PA 3OJUA 4NRUA 2VFTA 2VASA 1FTRA 3IN5A 2XZWA 2YQ0A 4ICLA 3OL9A 3KNAA 4ZVTB 4DV4F 3G6ES 3JTOA 4ZVUB 2W8LA 2VB6A 2ZUAA 5EHHA 2R7OA 3LPEA 2D3O1 5CYMA 1KHVA 3SQGA 1MNEA 1RAJA 2YNFA 4I0WA 4ZCIA 2AGPA 3CDAA 3HX9A 2MKCA 2A1BA 2MQLA 1BC6A 3P4UB 2W9BA 1SV5A 3FFIA 3PG9A 4MKVA 1WSVA 3GIRA 2OSRA 3A1YG 2R8IA 2DPIA 1YRUA 1PBUA 2ATCB 3W66A 2WVCA 2RQCA 3TA1A 5KFHA 4X65F 1B7YB 5KFCA 5IQ6A 2V8VA 5HROA 1C1CA 4FP9A 2E66A 2PMZD 2QMWA 5LMUF 1FWLA 2OHDA 4JI6F 3AQPA 3HFZB 1APSA 3GCXP 3M2UA 2UXBF 3PW7A 3NS5A 3V6HA 3G71S 5HLFA 2QG9B 3CE8A 4DV7F 3EVMA 4RNNA 4YR3A 4DXLA 2A0FB 4JI0J 2AJFE 2OPQB 1HNZF 2HNZA 1X4HA 1TL1B 2DHAA 1RHJB 4PWWA 2HMIB 1UKUA 2DXEA 4M5KA 4ZPAA 3MHYA 3K59A 3M6UA 4J9LA 4BLGA 3ISZA 4U7CA 2F8EX 2QLBB 4ILRA 4JI4J 3UDEA 4X4UA 2HZCA 4NXNF 5KFAA 1S0VA 1CLFA 3O44A 4DR3J 2CQIA 2D74B 4AE5A 4DZ6A 2FVRA 3BR9A 2KT5A 3W7BA 2KDOA 3R8YA 2UV8G 2J9DE 4ED4A 3X1LB 2C2EA 1D9AA 2LYVA 4U9RA 1TV6B 1NH7A 1IKYB 3FQKA 1IBKJ 4N7TA 4CLYA 1U02A 3RB0A 3LAKA 4P6QA 2IMOA 1ZM4A 4KPYA 2A6MA 3EYZA 1JXLA 1F0XA 3BO2A 3R5AA 3CO0P 1RISA 3JQKA 2DNHA 1UP1A 2OPSB 2PEHA 4PWDA 5KFEA 1HYSA 2CQ0A 2GA7A 4DQRA 3KUHA 2K2PA 4CCHA 2HLUA 3CEDA 1X5SA 5IQQA 2HWTA 2HPUA 4KHRA 4DQSA 3RB4A 4NLUA 2JX2A 3RBEA 1Y3JA 4PPDA 1OSDA 2BJEA 1EX8A 5KG1A 1J27A 1PAEX 2ERRA 3KJFB 3KLHA 2FHJA 4CLUA 5K14B 3JSMB 3NGKA 3HHLD 2WBRA 3OR2A 3KG4A 2HZVA 2M9KA 4CZCA 4I1TA 4A8SA 4AYBD 2Z0GA 1S4FA 1OYEA 3BYRA 1RACB 3QZ8A 3E01A 4NEYA 1N32J 3K0JA 1GXTA 4ZIWA 2IYIA 2AZ1A 2W2PP 3E3XA 3HMJG 2BMBA 3DRSB 5H9FK 4K50A 1RSCA 1CJKB 4YDDB 2L9DA 3X3UA 3UNGC 3PR4A 3HXMA 1S10A 1REGX 2CQBA 4ZVEA 2CWKA 2VBXA 3OR1A 2VHGA 1SBRA 3R5JB 3MMAA 1TK0A 1ZZFA 3BGOP 4DQIA 2CPFA 1M1HA 5FDLB 1PC5A 4U6PA 2F8HA 2DNQA 3J7ZT 4DV6F 2HIYA 1LNQA 2B9XA 1F5AA 5AE3A 4ECXA 2VDHA 3BS9A 1K0VA 4HHHA 5B0DA 2RILA 3D68A 3GFXA 3FCHA 2BW2A 3CCZA 1UVNA 1H0HB 2HIQA 4A46A 4G1PA 4NLSA 4YB6A 1V6HA 2VC1A 4M5DA 3BSNA 1H74A 1T9XA 8AT1B 2M4MA 3NBPA 4URGA 2CYYA 4PR6A 2O67A 3WC2A 1N5TA 1RABB 4B02A 2IVYA 4DUZJ 4OZ3A 4MYUA 3OV7A 2EFNA 3OD2A 4IFYB 1KWMA 1NEEA 3M32A 3BPDA 1IBMJ 1LWFA 3MFHA 4HT7A 4USVA 3I0SB 4JV0A 5JXSA 3MCNA 5E3AA 4ZVQB 4BDPA 5KG5A 3U7JA 3BN7A 1HNVA 3RW7A 3KYLA 2EK6A 2K1RB 2ZH9A 4HEA9 5ETTA 3PX0A 1UVIA 4TU9A 1P9YA 2CUYA 3NOCA 5KTQA 3NY0A 3LW5C 5KG4A 3P45B 1M1GA 2F65A 3CCJS 1EKSA 2APOA 1KDNA 3AD7C 3KK1A 3R9LA 3MM8A 2ZZTA 1NRKA 4OHVA 4LIRA 4O3RA 3W60A 3QO9B 4LF5F 3HSJA 4USKA 1QUPA 2F4VJ 2IDLA 5BYQA 2DNYA 4ILMA 3ULHA 2E5LF 2Y1LB 3H5UA 4ANCA 1SQFA 3BSOA 2IAJB 2AMCB 3M2RA 1FDDA 1FKOA 2D3UA 2HURA 3K8VA 3QSIA 2Y9HA 1UFLA 4CLFA 3QFHA 3T1HJ 2OP5A 1A7GE 1S6PA 5KFTA 2GFFA 1T95A 5D0GA 1HBUB 5CYQB 4CDIA 3OTDA 3V5RA 1U24A 3RRKA 3SSRA 2Z2ZA 4NXMJ 3ICLA 1PIEA 4OYZA 4EZ9A 3HKZD 1WACA 3QT8A 3W9IA 5K8MA 2I1RA 2F7VA 4USTA 1LV5A 2UUBF 2CZ9A 5GADI 1YBUA 3P49B 1D3WA 2CJXB 2DIVA 5B0FA 1C2PA 3KFWX 4B17A 4X4VA 2QMUB 4P2XA 4X4RA 2HHHJ 2DHSA 4J9QA 3CDWA 3DM2B 2WVBA 3MEEB 4F04B 2WVEA 2V8HA 4CM0A 1YGYA 2V9KA 3K58A 2FVQA 5KG2A 5F3TA 3EGNA 4DL7A 1P27B 3CC4S 3DGPA 2DRBA 4UOCA 3HHLA 1YJ9S 2HBQB 3QRRA 2ZZNA 2BJ1A 1RB0A 2KJVA 3L95X 4RBUA 2JJ4D 3UCGA 4CO3A 3PJXA 4ED6A 1KVKA 1OQ3A 4OHZA 3BKFA 2D7SA 4NMXA 1FVSA 2AZ3A 2WTFA 3CIZA 4B3TF 3AD9C 3IS9A 1XNRF 4YMEA 3MMCB 1UCNA 4Y2CA 1GTHA 1TU0B 1AROP 1F5BA 4Q43A 2BXJA 5IT0A 3DOKB 2IC3B 3UW1A 1QE1A 2OIHA 3H2VE 4OIXA 2RF2B 4ERDA 4WIQA 3Q83A 1S7IA 4NX9A 4A48A 4Q0BA 2FB0A 2EFQA 3QNWB 3VZIA 1FRLA 2R7QA 5G0RB 4EO8A 5D0EA 5KFWA 2VQFJ 3D3BJ 2MB0B 1J2VA 4O3OA 2HQIA 5GMKa 3SSQA 4NOHA 1B4SA 3PYDA 3QIDA 2DY1A 4RW4B 3MR5A 1Q81T 2OO4A 4DU7A 3CCMS 4B9TA 3RGIA 2E1AA 4ZVPB 1H7WA 2JC1A 1PGZA 4HDHA 5B08A 1VC0A 3I9ZA 1KTQA 4QJVA 5KAKA 5K5MA 2BVZA 4JI3F 2HWHA 1NU4A 3TWZA 5HMXA 1NO8A 4MKYA 1I51B 2D3ZA 2VOOA 2LMIA 2DISA 1U1MA 2GW8A 3MAHA 1U0HB 1I94J 4URSA 3I56S 4EWTA 3WZ0A 3OFGA 2V63A 2N4DA 4NWBA 1Z4UA 2DCUB 1GX6A 3RAMA 1C0TB 2BYCA 3PRBA 1JLQA 4ZITA 3SFUA 4A47A 5A6WA 2FLLA 1C0UA 3EZUA 3THTA 3CCVS 2HVZA 1HWLA 1RA7A 1RTJA 4DLGA 3H25A 1U1KA 4WZMA 3UQSA 1NHUA 5CH7B 3OFFA 3CD6S 2I9SA 3RYLA 2WOMB 1YSJA 2AYEA 1JLCA 1XN9A 2P8IA 2DGTA 3V6DA 4B9MA 2MZ1A 2GVDB 4RWWA 2Z57B 3MUVP 2G4BA 3NAHA 5H9EK 3OXGA 2I5JA 3P6YC 2ZH7A 1F3VA 1R0AB 2BKOA 4BC9A 4FN5A 3K57A 2AW0A 3MPVA 3DU5A 4I64A 1NPPA 3DI6B 3E8OA 1FA0A 1N8RT 3D1QA 3TI0A 1XNQJ 1D9FA 3NGDA 2MPUA 1MROA 5KG7A 4TU8A 3BBFA 1WDTA 5DQGA 2YNIA 3UE2A 4HHUA 5L1JA 4Q45A 4CNYA 1MW7A 2ZBCA 1R31A 2CNKB 4JV5J 4I2PB 1WC5A 1YTYA 3KHRA 5IT9Y 1AB8A 4CH0S 1SKSA 1BD6A 1HW9A 3TAMA 1AFIA 4OJHA 4D3GA 3UDCA 4R8UB 2IFXA 2W2MP 4ZLLA 4Y34A 4BS2A 2FDNA 3OL8A 1KLMB 1MMDA 2I0XA 1RTHB 4Y6IA 1ZETA 1CJTB 3DKDA 3R5BA 1FJGF 3MR7A 3GPAA 4CIOA 1M90T 1UETA 1VHFA 1OY9A 3RJMB 2MQMA 3EM1A 3GV7B 3EMTA 1KQFB 1FE0A 2V2ZA 4L3NA 2M8DB 2Y1RI 1N5SA 4WK1A 3VAIA 4KBIA 3R2CJ 1LKZA 4DV1F 1FDAA 3MEKA 4YB7A 1RT3B 5KFFA 2RRNA 4XPCA 2MY8A 1WC6A 4AXIA 5DDOC 2OJ3A 1CPZA 3C3LA 5BYSA 1L3UA 1AYEA 1S57A 2EC2A 1L3KA 2VA3A 4DV3J 5BXIA 4LFAJ 4K2JA 3PO5A 1SL1A 1BGXT 2X1GA 5E7OB 4PG5A 1HNWF 2XZTB 5A2QY 1FKAF 1YJVA 2KT3A 1FX4A 1U47A 5IM0B 1B7FA 4RBVA 3TP2A 5E3PA 4I7FA 1FF2A 2P9EA 3BH7B 5CYJA 4EBCA 2HFUA 2KFNA 1W2IA 4AL5A 2G1HA 1P1TA 2BE2B 2YKMA 3JSRA 3M9NB 1UWAA 4DCJB 1CS4B 3IM8A 3QWPA 2LECA 2XZDB 5D3GB 1LWCB 3QGGA 3KDOA 1FD2A 2XY7A 1GQEA 2VD3A 4M5LA 3D6HB 3FVYA 2W9CA 2GCFA 3BH6B 1JLGA 3A3OB 1KKHA 3IAS9 8RUCA 3UI3A 4HACA 3IRXA 3N01A 2NXCA 5IOLA 3S7RA 5HAOA 3ZTOA 2IRXA 4F67A 3C6TA 1IM6A 3IAM9 1NB2A 1K47A 1RWNB 5HP1A 1EHWA 3MUTP 1T3OA 2UXDJ 2HLTA 2EFOA 5DG7A 4GKJJ 2B6AB 4LF7J 2WONA 2ZBPA 4L75A 4O0IA 4YHHJ 2EWHA 1U1RA 1N52B 3ISND 2UZAA 2FJEB 2M70A 1VBXA 1HR0J 1YJNS 4FF1A 4DSJA 1MG7A 2QO3A 2VONA 2QYCA 4DSFA 1X4AA 3LGNA 3LALA 1JIHA 1S77D 3W9HA 1NZAA 3PDNA 4TYBA 3HZGA 1JJCB 1U1LA 2KTQA 1FHTA 2HQ3A 2QTWA 2NZCA 4F0HA 1TL4A 2XMAA 2H51B 4CWBA 2LQ5A 2B8PA 1REVB 3CUNA 4LF9J 4F2RA 4DEZA 2R2SA 1FRHA 3R97A 3T19A 4DWIA 3SBMA 1S0NA 1P6TA 4KGVB 2YVSA 5C42B 2DO4A 3BGRA 6FD1A 1YRXA 1TAUA 3H42A 5KT7A 1PC4A 3TO8A 2YNHB 3LWLA 3DCAA 1UJ6A 1XWLA 3MECA 4LF6F 4FF2A 1UMJA 1QTNB 4N5SA 2DRDA 5J2PA 1LOUA 2LDIA 2XNQA 4FS1A 3HHDA 2PFFB 5FJ4A 3IWXA 4C8NA 1YKWA 3RZAA 4KT0C 1HI0P 1Y7PA 1HHSA 2MTLA 3ET6A 4NLWA 1S97A 3DLGB 3EUNA 1SJ3P 5J1EA 5KFKA 1U1OA 4J9KA 2JRSA 4LF4J 2M0GB 4W4MA 2J76E 3SV4A 3NCPA 2R7SA 3TZWA 3WQPA 2B9WA 2OSQA 3T6BA 2QRRA 2PEBA 1UEVA 2BANB 2V4RA 5FIIA 1K0TA 3BREA 5F8MA 2RKIB 4QIGA 3HJVA 4K4SA 4DL0C 2AJQA 4NYPA 7FD1A 1S6UA 2YH0A 1HA1A 2E44A 2XSFA 4F4KA 4AQYJ 4RLEA 3EZOA 3FCWA 1HHTP 1U8SA 3RB6A 3MF5A 4JI1J 2PC6A 2VDIA 2ZDOA 2OFGX 1Q8KA 5KT4A 3E2EA 5KG6A 4ED1A 5ETPA 2FGCA 4X66F 2EVZA 3W9JA 3OBIA 3OLAA 4MFBB 2DIUA 3DLEB 2ZH6A 5AJ3F 3A3NB 2DR9A 1CC7A 4LSNA 3PIOQ 4A8FA 4F8RA 4X65J 3PR5B 5LM7E 2HQCA 3LP0B 2DH9A 3NG8A 4ZCMA 1QSSA 2R2RA 3O3LA 1YBAA 5LMUJ 2V4JB 4JI6J 1PCAA 1V3SA 2WSEC 1VBZA 1E6VA 3LP1B 4O3SA 2ZWOA 2WB1D 3S01A 2DGVA 4PG7A 4USWA 2D41A 2E1RA 3MM9B 4DL6A 2ZJQQ 2HQGA 3QT7A 3TAPA 4DSIA 5DG8A 1HQUB 3M05A 4M8LA 3AB4B 4F50A 3G2XA 3DLBA 2RUSA 4J37A 4CO1A 2XYGB 5B0CA 4J9RA 1UEKA 4XAKA 5F8IA 3KK2B 5IWAF 3QT6A 4N8OA 5DQIA 3MCSA 2N3OA 1TVRB 3HVTA 2C2ZB 3Q8PB 2VQEF 3VVUA 4AD6A 1GTEA 1T05A 2H4WB 2O01C 5BR8J 3PEHA 2K3KA 3HHLC 4NXNJ 4MAKA 4DN0A 4OZ0A 3VVTA 4R5PA 1Y3KA 2V9WA 3DOMB 4HH0A 1UFKA 3GMGA 3QZ7A 4FKXA 1IKXB 3LANA 1JJ2R 1U7LA 2R7VA 3BQ2A 1UWBA 4X62J 3M9OB 1S1WA 1TR0A 2Y1IA 3WX4A 2QGFB 2GGPA 1HI8A 2V2VA 4IH5A 3BB5A 2AYMA 2P6SA 3ZZPA 3ENWA 3CMQA 1TKZB 1QD1A 4RW8A 5FLXY 1Q8BA 4F3MA 2XNRA 2CXEA 2X1AA 3H59A 4WE1A 2GO8A 2YX4A 3D3CJ 1M5SA 2R7WA 2U1AA 2PDAA 2BJ8A 4ZLPA 1VLOA 4ZPWR 2F9JA 1I5OB 1RLDA 2B9YA 4B3SF 4NCBA 1RYSA 1WG5A 1DTQA 1PG5B 2DNRA 1AUSL 2X1BA 1VQ5S 2RH3A 3G6YA 3BGUA 1H72C 2GX8A 2J6TA 1XMQF 1WEYA 3CCUS 2CPJA 1H6KX 3C14A 5I42A 2BW7A 3HZEA 4DG1A 3CTRA 5EUHA 4EEYA 2QE5A 3FZBA 5C2GA 3TW0A 1K44A 4RKUC 3HSGA 2Z4PA 3P5TL 3D7SB 4UTGA 4LUBA 3VHQA 2HHQA 3GONA 2E5GA 2MY7A 1IN0A 1JLBB 3HHKA 1T02A 2DBBA 3UVJA 3KJVB 3OQ2A 2MJNA 3W5YA 1TKXB 4D3HA 2IJFA 4B08A 2FJDB 2UUCF 4AUKA 1BQMB 2DNLA 3T5LA 4JI7F 1D1UA 3GU0A 4NEZA 4IRKA 1Y00A 2HFZA 3QQCD 4GKKF 1HARA 4CO0A 4IQXA 2CPZA 2OFHX 1RDRA 3MDFA 3FKBA 3T41A 4L73A 2DPJA 2J8SA 2ASJA 5LSOA 2RDDA 3D5MA 3GFYA 5D4LA 1X0FA 3MR6A 3N0VA 3M8PB 4KKOB 4WJBA 2VBYA 1VRTB 3MOZA 1S99A 2EXUA 1S1VB 1NBEB 1YQHA 4R25A 4ER8A 2YNGA 2F63A 2OPPB 4TN2A 3AQOA 1DAXA 2RHQB 3MPYA 2KXNB 5B09A 1G3OA 2AJ1A 1LEOA 2ZD1B 2HNDB 2QEXS 3DHXA 1F2HA 5J1PA 1TELA 4O4GA 1NCLA 1RT7A 1VRQC 4KV8A 2MHNA 3MEDB 1HW8A 1R8PA 1EP4B 3SV3A 3MCMA 3MGJA 4PAAA 4DDFA 4LF8J 4DPUA 2K3IA 3JB9k 4WTOB 1OPIA 2IIHA 3HHEA 4NLVA 5CZXA 4NLXA 3DXSX 3TUIC 1DY3A 4XIUA 5HBMA 2R3VA 4DR1F 5ETKA 2MJUA 3TUZC 4Y28C 2GO9A 2MKHA 5EGYA 3QSYB 3OVAA 3KHGA 4KJIA 2OH2A 4C11B 3AD8C 2IM3A 4EFAC 2ZWPA 4F36A 1WOOA 3I9V9 4LSZB 3K5OA 3IA0A 3FBBA 3UD3P 3RBDA 3K8WA 4LF5J 3OXLA 1LWXA 2D3OR 1AXQA 3MTKA 3PM9A 4OZ2A 1GFWB 1IJEB 2VKZG 2LVWA 1HBOB 4CO2A 1SL0A 1U6FA 3CJ4A 2NPFA 4B9SA 5CA5A 3VGSA 2E5IA 3MPUB 2XB2D 4OX7A 1SUQB 2QJ3A 1D9DA 3AXKA 1VI7A 2VG5B 3IWNC 4QR1A 2Q1LA 5GAGU 2L3MA 2ACYA 5CXTA 2HKEA 3MEGA 2YKOA 5I3QA 4TLQA 3HDSA 2AT1B 4WPAA 1JNRB 5D4PA 3EDQB 1NKEA 4DR4J 3LA0A 4N41A 2C22A 5B0GA 1T94A 1FJ7A 2OGUA 3CMES 3H5YA 3QMQA 3JS9A 1EARA 3W2VB 2FVSA 2EPIA 1N33F 3M2VB 3M8QB 1TMMA 2VPZB 2FY8A 2PA3A 1LW0A 1VJQA 2X3DA 1G4CA 2UUTA 5CHCB 2ZH4A 3PHEA 4P7TA 1GMVA 1ZS6A 3PVXA 4CH7A 4DFPA 2VICA 3A8JA 4LRFA 2CDQA 4M5IA 3CMAS 1QJHA 3DNCA 3MD3A 2GHVC 3HSZA 1N54B 4WFNQ 2C3YA 2A3JA 2XEXA 2B5JA 2CG8A 1NK9A 3T9ZA 3JXOA 2ZH3A 4EU0A 5B0AA 2J6UA 1LQ9A 1HMVA 4B3TJ 4MJKA 4ECWA 1XNRJ 3KLFB 5DGBA 5SZTA 3NKYA 3JAMY 4KYZA 4ANEA 3GFZA 4NMLA 2EFVA 3WIVA 1YJUA 4DOZA 2XO6A 4K0KF 2DEIA 3FRZA 2JLGA 1XMOF 1TZ0A 1NAQA 1LWEB 2XQCA 2W7OA 4ZIVA 3C66A 1S48A 3NNCA 5L38A 1NK6A 3CD0A 1NK8A 4F0MA 3GIKA 3I55S 5DQHA 1ZPWX 1SIWB 5DDRC 2IJNA 3Q89A 1UPPA 4P2FA 1SKWA 3LOUA 2MQNA 3HK2A 3GCWP 5E3RA 2HFOA 1WG1A 3OTOJ 5CD4H 2G2OA 3MI7X 5GAEI 1S4EA 4CP5A 2CPEA 4LF1A 1G1XA 4NA2A 1HWUA 2KYXA 2OMOA 5E3CA 2CWXA 1WF1A 1EQMA 2RRBA 4TLRA 4WKYA 2O3DA 3RRHA 1Q7YT 2ZM6F 1Q5YA 5LSRA 4YOEA 2FJBB 2E1CA 3CVKA 1SJ1A 1DLOB 4MIWA 1I3OB 4DF8A 5BJRA 2RD5C 1WOSA 2HQDA 2AGQA 3NGRA 4OLOA 2BM0A 1ZPVA 2CA9A 3IG1A 3C46A 2R2TA 2VFUA 3PFEA 1KLNA 3AT1B 1BLUA 1F5CA 4QZVB 4KPCA 2H9ZA 2UVWA 5ITHA 1S72S 4EZ6A 4ZMMA 3C15B 2JNJA 2MQPA 4B9VA 2MZRA 1RBLA 1VQPS 5JMNA 1HBUA 1RGVA 4I2QB 1TP7A 5KFYA 4DU8A 1GNKA 5I3UA 4CLSA 2RS8A 2WB4A 2XLJA 2AGOA 1RAGB 3H0PA 2VJUA 1WELA 2PFDA 4ICLB 1VQLS 4UY85 2VOPA 2XI3A 3DRPA 3LPYA 3FSYA 2NUUG 4L6V3 3SFGA 1JXEA 5T7LA 3HFKA 5A8RA 2E7WA 3CJ8A 1JKHA 3QGIA 3A8EA 1SQEA 5CYMB 5L8RC 3Q23A 3L09A 3SQGB 1C1BA 2YNFB 4RW7A 2LU2A 2BV3A 4P71A 4X64F 3THVA 2VPYB 4QOTA 1SV5B 5GVQA 3ENAA 3FFIB 5SUHA 3BPSP 5KFBA 4RBTA 1ZAXA 1B0PA 3C6UA 3PXGa 3NS7B 1VCTA 4C8OA 3CJ2A 3BF4A 1H73A 4L76A 1NJWA 3W8PA 4KFBB 4RU2A 2MKJA 5HROB 1ZAWA 2YKNA 1OYDA 1C1CB 1TKDA 2E29A 5AT1B 2UU9F 4GO5X 2F9DA 2R9LA 1K1SA 3M2UB 2KXHA 5C25A 4DF4A 3Q2SC 2IVMA 1DTTA 3N5FA 1JLFA 2KB2A 3HT3A 1T9WA 5HLFB 4LMZA 1KONA 5C7PA 1CG2A 5LJ3Y 3QYYA 2CJAA 2XMTA 1QVFR 3I31A 2HNZB 3NCRA 2RQKA 3NMRA 2E5HA 1C4CA 2KL8A 2XGPA 1MN7A 2MLXA 1D09B 3I87A 1IVZA 2NREA 2GHWA 5D4NA 5LJ5Y 5LOQA 2HSEB 3BZQA 2CQ1A 1FWPA 3PW4A 2DNZA 4DZDA 1XMBA 3KUEA 1YWXA 3M30A 5EWFA 3F56A 4DSLA 1FCAA 2BRKA 2QLXA 5L1IA 4IKAA 3AOAA 4Z37A 1FFGB 2NUHA 2GIRA 1D8ZA 2YBVA 4USHA 5IT9U 2VFSA 2LCWA 1HNWJ 2AJ0A 2LLZA 4OZ5A 2JLEA 2G1DA 1PILA 4HI2A 5MLCV 4FNIA 3RW6A 4PWUA 4YR0A 1RT2A 4LF2A 3DLLQ 3KMSA 5L46A 1YJ7A 3NNAA 5IXUA 3DRRA 3FBCA 2LQ8A 4OHWA 3FEYB 3KJQB 2D9OA 4PWDB 2QA4S 4C3KA 1HYSB 4PUOA 1JLEA 2IDEA 3K2YA 3S6EA 3CJSA 5L1LA 1WHYA 2LQ9A 2DNPA 1ITPA 2ZH1A 3O1LA 2A2CA 1VQYA 4OI0A 1BWVA 1U49A 2CPHA 5HL7Q 4FPRA 2FUG9 4IUFA 1PKUA 1OMSA 3BJYA 1X4CA 4YUDA 1FX2A 3L9ZA 2GVZA 3J7YU 2EG2A 3KLHB 3NAIA 3W63A 2V8GA 3SZ2A 1QUVA 1DURA 2AJ4A 3OR2B 4OI3A 5A2QU 2CG4A 4QU6A 2NZ4A 4M5NA 1L3VA 1YHQS 2CRLA 3TUPA 1RT1A 3RG6A 4TNOA 3E01B 4IDKA 3GYNA 1PYOB 1IJFB 3FSIA 2L41A 3GJSB 4C3MA 4DV2F 3D54A 1NDLA 2C2KB 3GFHA 2ZNZA 2UVRA 3QIPA 2VG7A 2FC9A 2C1EB 2F1FA 3GILA 2XMWA 2B4OA 3OUYA 3B6BA 3OR1B 2DXFA 3MMAB 1Q1KA 1RBOB 1RKJA 5GAHI 4LT6A 3D0HE 4PABA 1H2VZ 2IY5B 1TUVA 3MPWA 2IM2A 2V8PA 3AHPA 3MZIA 3PEJA 1KS2A 4U95A 3ZZZA 4WK3A 1IWAA 1F9HA 1N48A 3MFIA 3AH6A 5HVGA 1S6QA 1SKRA 4IR1A 4J9MA 3NBPB 2BOAA 4ZK7M 5HMWA 2KU7A 2XLIA 3QAUA 1J5OA 4RUBA 4I56A 4Z7YA 2R7RA 2GJIA 4NPOA 5GAHU 2MKYA 3D0GE 4RW6A 2KFZA 4NZ7A 2ZITA 1RQ0A 5KFUA 4LF6J 4EMDA 3M32B 1HQEA 1K8AT 1LWFB 5EWEA 3MXHP 1IR0A 1NK4A 3F0NA 2JZ5A 5THWA 5K8OA 4DV5F 2C3PA 4WTYA 2VG6A 4DHVA 1KFDA 3HVAA 4OJ3A 1HNVB 4LRCA 3IR5B 2CJ9A 3J7AN 3ITHA 4QW8A 3CC2S 2XTJP 2XGQA 5KOWA 2BABA 4B3MF 4J9NA 4LBIA 3C2PA 2N7CA 4DR3F 3TQEA 1YJWS 2J7KA 2W7PA 3KK1B 1CVJA 3MM8B 2R8HA 3KLIA 3V81A 1YLXA 3O8WA 3I5BA 3R5GA 1W25A 3M8WA 5A8KA 2EFPA 3O2IA 1SL2A 4TY9A 2PD1A 3H5XA 4ETXA 2IVFB 2NR0A 1IKVA 1L5UA 2BE7D 3M2RB 3AB2B 1FKOB 2FHKA 5HI7A 1IUJA 3GJRB 2GJFA 2DGSA 2VFVA 1S0OA 4N56A 1X7VA 4NE9C 1S6PB 1B99A 3MTJA 1RT6A 5HMYA 1FRMA 2MXYA 4DI6A 2Q6BA 2RT3A 1JLAA 1GMWD 3G82A 3H7HB 2XMVA 2HYIB 1LK7A 4CO4A 4ZJOA 4HYKA 4L72B 5D0RA 1RAHB 4DMZA 1RWMB 2DGUA 1U2CA 4LR8A 1Q8LA 4OYMA 2DO0A 4F02A 5DZ7A 2WHOA 3PX4A 4RNHA 3I32A 1HD1A 1YJRA 1SPBP 4R0EA 4MTPA 4Y2IA 4F4AA 4N47A 4LQ9A 4PCQA 3VR1A 4HTIA 1WHWA 2Q6CA 4IO1A 4ZKAA 4K59A 3TAQA 3NRBA 2BRLA 4OMFG 2AEJA 2KG1A 3RAQA 2DCLA 3DOLA 2F4FA 1RT5A 2Y3YA 1HBNA 1EIYB 5IWAJ 1GAOA 2WVFA 2AF6A 3CCES 3DGPB 2CQHA 3HHLB 4J91A 4J90A 4YEAA 1AZSA 2MYFA 2L9NA 4AT1B 3R2DJ 3HD2A 3NMAA 4KB7A 4O44A 4LBPA 3TRGA 5AXMA 2ZDPA 3G87A 5D77A 2AWZA 2IBKA 4DQQA 1AFJA 2W9AA 1T8EA 1H3DA 3ZZOA 3NGTA 1BHNA 4GC6A 2NYIA 2NXEA 1VGYA 5DS7A 4CYUA 4ZN3A 3D6FB 3TVYA 5F0UA 2FHMA 4USJC 2IM0A 1FE4A 4WP3A 3IS9B 4Q2LA 4NLGA 2C2MB 4DR2J 2BE9B 2BJDA 3CJTA 4AXJA 2N3LA 3CNQP 1KBRA 1LK5A 1WC4A 4EBDA 4QCLA 1QE1B 2JFKA 3K5NA 2R8JA 2XHCA 3V4IA 1QLNA 4Q0BB 3P5BP 2DY9A 4F4ZA 4NYOA 2DXDA 2Z56B 2V68A 4X4QA 4XK8C 2BQRA 3EPGA 2QL7B 4OYXA 2DR7A 2KRBA 4USMA 1GK8A 1S9FA 5E0OA 3EICA 2JH3A 1NKCA 3EPIA 4ELVA 1WDDA 1PAUB 3VGUA 1Q86T 3OHAA 5E5NA 3TA2A 4I68A 1XEZA 2FVCA 1S5ZA 2VA2A 2V34A 3R1HA 3DHWC 3OTEA 4C97A 2DNOA 2AV5A 1R8HA 1VQKS 4M95A 4ZHRA 2IA0A 1HPZB 3CSKA 3K17A 1FRJA 1QSYA 2DNNA 3HFVA 1XR5A 4ES1A 2ATLA 1IXKA 4YFUA 2M88A 1RWKB 5FLXU 3OSPA 3EGZA 3GYXB 5HJXA 4ECZA 2HAFA 1BXNA 3BQ0A 1W7WA 2ZUGA 2F4VF 4IG0A 4IRCA 1K1QA 2UUCJ 1FKPA 4EBEA 5ETSA 4JI7J 2AEMA 4RJVA 5J2NA 1TL7A 3H2UB 4W98A 1UVLA 1JLQB 3TANA 1C0UB 5H1SV 4ZCLA 1X5PA 2QN6B 3EXCX 1VQ6S 1TUWA 1F1BB 1FJCA 1RTJB 3KXDA 2EEYA 4DL5A 4O0NA 4UQTA 4DX8H 4NASA 5L9XA 2PGCA 3LH2S 2MQQA 4GC7A 2ZZMA 3A8KA 2GAHC 3GR1A 1JLCB 2XCPA 3V6DB 4UW2A 1RAEB 1IBLJ 2R2UA 3BBCA 4YS2A 3ZTRA 4ZPDA 1T9UA 1JX4A 3Q8QB 4DFJA 1X4GA 3HT0A 1Q0NA 4HI1A 3Q0AA 1MSWD 1Q5VA 3KNGA 2ZOMA 2HHHF 3TARA 3RRGA 1GMWA 5J2MA 8ATCB 4M63A 4B9LA 3FDSA 4FYYB 5EDWA 2P6TA 4RR5A 2BKPA 2Q3PA 3AOBA 2V94A 4WBFA 4G3IA 1MROB 1M5HA 1X5TA 2RQMA 4KO0A 2QA1A 4MYTA 4M94A 4WYWA 2YNIB 2ZE2A 4PXEA 2VH7A 1Q82T 4QYRA 3GR0A 2JEGA 1GEHA 2ABYA 3MM6A 3TAMB 4A8QA 4QIEA 1RTZA 4KH1B 2G0IA 3I0RA 2OD6A 5GMDA 1KQGB 3M8RA 1TK8A 5KFMA 4PPZA 1VRUA 4JI5J 4J9VA 2FLOA 2ALYB 4UY8T 1U1QA 2WAQD 4M5HA 1NDPA 3MUMP 1T9VA 1UJ5A 2WW4A 4NLYA 2VBZA 3U1NA 3R27A 4DQPA 3NWRA 3T1AA 4CLTA 3TEGA 4ZP6A 1X31C 3GJQB 1S1UA 1NKBA 5KT3A 1RHUB 1UVKA 3BKTA 3A3PB 5ETQA 3I5CA 4OZ1A 2UXCF 2H3EB 2U2FA 3GG1A 1XBWA 3C16A 1FRXA 3PYGA 5JVGQ 1OIAA 2CQ4A 2WW8A 4YR2A 5DJBA 1OPZA 4ECTA 2UVUA 2DTJA 2QZ8A 3M9MB 2N7YA 3MM7A 1XJWB 2EC0A 1XK8A 3SDEA 2KM8C 4N77A 3QRPA 2A10A 4NCGA 1VISA 2G0CA 4I7FB 4H4OA 1X9MA 4ENOA 2KHCA 3D6MB 4B3RF 5LMNF 2HHXA 2OEJA 3N28A 4FPIA 4Y00A 2YKMB 3OFEA 3J81j 2ZHBA 3GJTB 1TL3A 2DD8S 5M2UA 1NPRA 2W9CB 1DHMA 1I94F 3T5KA 4YP3A 5JVHQ 1JLGB 1WTBA 1IKWA 1SC6A 1URNA 2IBOA 3IRXB 3FSXA 2Z30B 2RS2A 1S76D 5CAAA 4Q8FA 2R42A 4FS2A 3T3FA 4LSLA 4LREA 5FD1A 1Z1ZA 5HP1B 2JEFA 1R27B 2MQOA 4TY8A 1ZA1B
chains in the Genus database with same CATH topology
4AL7A 3MDFA 4QPTA 2R7OA 5CYMA 2JDJA 1NK7A 1KHVA 1RTDA 3SQGA 1MNEA 2DPJA 1RAJA 2YNFA 2WONB 4I0WA 1MMNA 4ZCIA 1KOOA 2AGPA 1WNEA 2ASJA 2LEPA 3CDAA 5LSOA 3HX9A 3FEZA 2MKCA 2A1BA 2MHEA 2MQLA 2QT7A 2V2KA 3D5MA 1XR7A 3GFYA 5D4LA 4K4UA 1X0FA 1IQTA 1BC6A 3MR6A 2W9BA 1SV5A 3DM2A 3DOLB 3FFIA 4HH1A 2EG1A 3M8PB 3N0VA 4KKOA 1RT5B 3P3DA 2W9BB 3MEEA 4C8MA 1HBNB 2OSRA 3FEXB 4KKOB 3A1YG 2R8IA 2F3JA 4WJBA 2DPIA 1YRUA 4ETZA 2VBYA 1VRTB 4IYQA 3G8QA 2K7JA 5E2QA 3PJWA 2DNGA 4K4XA 3MOZA 1S99A 2RQCA 3TA1A 5KFHA 5MAOA 3LQVA 4X65F 1S1VB 2YWEA 3D1HA 1YQHA 5KFCA 4R25A 5IQ6A 4KAIA 1WEXA 2V8VA 3DDNA 2DRAA 2YNGA 1IM4A 3ZZUA 5HROA 2OPPB 2AX0A 1C1CA 4TN2A 3GV8B 3AQOA 2AQ4A 4FP9A 5GADU 1QVGR 2E66A 2PMZD 1DAXA 2QMWA 3MPYA 4C8ZA 5LMUF 1M0SA 3OLBA 4JI6F 2KXNB 4WFYA 3SXLA 3CC7S 3T9NA 3AQPA 3CD7A 1G3OA 5B09A 1YI2S 1APSA 3M2UA 4O44B 1U6BA 2AJ1A 2UXBF 2ZD1B 3PW7A 2HNDB 4OQJA 3NS5A 4NRTA 1LFPA 3V6HA 4NLRA 2QEXS 3DHXA 1U45A 3G71S 2F8MA 4C8LA 5J1PA 5HLFA 1AUDA 4O4GA 4UUWA 3GSDA 4HLBA 2BQUA 2GJ2A 1NK0A 1RT7A 3CE8A 4DV7F 4RNNA 3RR7A 4YR3A 4IO9Q 1VQ8S 4KV8A 4OJGA 1WG4A 2MHNA 3PNIA 2XULA 2GMHA 2AJFE 2OPQB 3FMBA 3I6PA 1HNZF 2HNZA 4WF9Q 4X4NA 3MEDB 1HW8A 1X4HA 4C7QA 4KGKA 2LKZA 1TL1B 2DHAA 1R8PA 1EP4B 3Q8SB 3SV3A 3QLHA 4HDGA 1RYRA 5E41A 2QA2A 3OVSA 2HMIB 1UKUA 2CPXA 3MGJA 4DDFA 4I69A 2YWKA 2K3IA 3JB9k 2OD4A 4ZPAA 1SJRA 4A4JA 4JI2F 3MMCA 4NZ6A 1OPIA 3RTVA 2UVVA 4PXBA 4PXDA 3MHYA 1FO1A 2YX7A 2XHWA 3HHEA 5DDPC 3M6UA 3K59A 4J9LA 4NLVA 2RSQA 5CZXA 4P2SA 2CJQA 4YB5A 3ISZA 1R89A 3H4DA 4LVOP 4U7CA 4NLXA 3DXSX 3TUJC 3V4IB 2F8EX 2DGWA 3DOKA 3TUIC 4Y3CA 2IC3A 1TFWA 4OV1A 1CEZA 1ULRA 3BGRB 3HKWA 4ILRA 4WFXA 4XIUA 5HBMA 2RF2A 2B4VA 2JEIA 2LXIA 4DR1F 2RVJA 4AL6A 4W92B 4X4UA 2HZCA 4NXNF 5KFAA 1S0VA 1CLFA 3O44A 4ECSA 2MJUA 2L48A 2IA6A 2MKIA 2CQIA 3TUZC 2D74B 2RMLA 2XSJA 4Y28C 2GO9A 2MKHA 5G0RA 4NLDA 5EGYA 3OVAA 3KHGA 2XSJB 4AE5A 2FVRA 4KJIA 3BR9A 1HBMA 2GV1A 2W4DA 3PZPA 2KT5A 2OH2A 4C11B 3MECB 3W7BA 4NZ0A 3LP2A 4PG4A 2IM3A 4BHQA 4EFAC 3VALA 2HHVA 3I9V9 3FZ2A 3K5OA 1ZBTA 2NLWA 2KDOA 3IA0A 5J2PB 1SXLA 2UV8G 2FTRA 2J9DE 3X1LB 3UD3P 2C2EA 1D9AA 2LYVA 4U9RA 3RBDA 3K8WA 1KEKA 3HJFA 3GWCA 1TV6B 1NH7A 2ALZA 1IKYB 1N5QA 4Q2MA 2O1PA 2DITA 3OXLA 4DR5F 4RW4A 2D3OR 1AXQA 3MTKA 3DLHA 3FQKA 3ISNC 3PM9A 3BGLA 2FVPA 2L9WA 2OPRA 1IJEB 1M5PC 2XCAA 2GHPA 4GO7X 2VKZG 3RB0A 3ZFVA 2LVWA 3C8YA 2A2DA 3LAKA 4P6QA 1HBOB 1ZM4A 2IMOA 5J1EB 2DGQA 4KPYA 4CO2A 3EYZA 1SL0A 1U6FA 3CJ4A 1JXLA 3T6JA 2NPFA 1F0XA 2COLA 5CA5A 1RTIA 2EKYA 4I6YA 3BO2A 2PI4A 4B9SA 1WD6A 1FEEA 4ZHRB 3Q22A 4QR0A 3J81Y 2E5IA 5EX0A 1O0PA 2XB2D 2C28A 2HS3A 3N5BA 3R5AA 2DH7A 1RISA 4E98A 4OX7A 1SUQB 3BEGB 4I6WA 2GQQA 2DNHA 1UP1A 2OPSB 2PEHA 4DS5A 1D9DA 4PWDA 5KFEA 1VI7A 2XMUA 2VG5B 1HYSA 3NLCA 1U25A 1V9OA 2DNMA 4IOCQ 2CQ0A 2GA7A 4DQRA 2OTJS 3MM5A 5KG0A 3ZZYA 3IWNC 4LFAF 3WBZA 4QR1A 2K2PA 4CCHA 2HLUA 2Q1LA 2JSXA 5GAGU 3CEDA 1KHWA 1X5SA 2ACYA 2GIQA 2L3MA 5IQQA 5K8NA 5CXTA 2HWTA 4ID8A 2ADCA 3MEGA 4MK7A 2HPUA 4KHRA 2QIFA 2YKOA 5I3QA 4DQSA 5F41A 3RB4A 3BGFA 4IG0B 1K73T 4TLQA 3HDSA 2BBEA 4NLUA 3VF0B 2JX2A 1FKPB 1JNRB 5D4PA 3RBEA 1Y3JA 4PPDA 1NKEA 1OSDA 2BJEA 5J2NB 2RU9A 2FPHX 4EO6A 4OX9F 4K4TA 1C0TA 5KG1A 2B7BB 2G13A 2C22A 4N41A 3DMJA 2AU0A 2NXUA 1S7HA 2ERRA 5B0GA 4OHYA 5F8NA 3KLHA 3DMJB 3H8YA 2FHJA 3K7RA 5D4OA 5K14B 1T94A 2RJZA 4TKTA 3JSMB 1VQNS 2LQJA 2KRRA 4Y2KA 4O3NA 2C2RA 3CMES 3NGKA 3HHLD 2WBRA 3OR2A 3H5YA 3QMQA 3KG4A 3GIIA 3W2VB 2FVSA 2M9KA 1GXUA 2EPIA 2YKQA 4CZCA 1G6BA 4I1TA 4A8SA 3CULA 2Q66A 3HHNB 1N33F 4JV2A 3M2VB 2MMYA 3LF0A 3M8QB 4RU9A 2HHTA 3AJ2A 4AYBD 2Z0GA 3IWLA 1S4FA 4WU3A 5B0EA 2W25A 5KFDA 3QZ8A 3E01A 1WEZA 3PRDA 2VPZB 2PA3A 3NNHA 2WOMA 3K0JA 1LW0A 1GXTA 4X4PA 4LSNB 2IYIA 1O51A 4DJBA 1Y5LB 5JJBA 2KG0A 3E3XA 1H38A 3V6KA 3HMJG 4RUHA 2UUTA 3DRSB 5CHCB 3U27A 5E3QA 2ZH4A 4K50A 3PHEA 4P7TA 5CZVA 4YDDB 2L9DA 2IRYA 3X3UA 1O8BA 3UNGC 3PR4A 1KSPA 5KFNA 3HXMA 1XERA 1EETA 1S0MA 1R43A 1S10A 3PVXA 1SH3A 4CH7A 2QV6A 2G9OA 4ZPCA 2PA8D 5J1NA 4DFPA 3N6MA 1H2TZ 1E6VB 1YJTA 3CB4A 3KLGA 3TX8A 2CDQA 2CQBA 4ZVEA 3CMAS 1R0AA 1TFYA 1QJHA 3DNCA 2VBXA 1OWXA 3OR1A 2ZHOA 3MD3A 1SBRA 2GHVC 5J2MB 4G1IA 4GKJF 2OTLS 4LF7F 4OL8A 3MMAA 1TK0A 1ZZFA 4QWDA 1JWWA 1FNXH 1N54B 2J9CA 4WFNQ 2C3YA 1SH2A 2A3JA 2XEXA 1U4BA 2B5JA 1LXNA 4F4YA 1NK9A 4DQIA 2CPFA 1QAYA 5FDLB 3T9ZA 3PW0A 1PC5A 2ZH3A 3DI6A 2JL9A 4U6PA 2F8HA 4EU0A 2DNQA 5B0AA 3J7ZT 4DV6F 2K8GA 2J6UA 4KO0B 3IBWA 2B9XA 4KE5A 1F5AA 1LQ9A 1HMVA 2ZE2B 5AE3A 4MJKA 1FRKA 4ECXA 2XWXA 3BS9A 3N4WA 4ECWA 1K0VA 4DR6F 3KLFB 5B0DA 5DGBA 2RILA 4OHXA 4EUVA 1NHVA 1OO0B 4KTQA 3GFXA 2KI2A 3FCHA 1BQXA 2BW2A 3CCZA 4NLTA 5SZTA 3NKYA 3O5TB 1UVNA 3JAMY 1H0HB 2HIQA 4A46A 3HPOA 1RJJA 3FGVA 3GFZA 4G1PA 4NMLA 1V6HA 2VC1A 4NLSA 4M5DA 4YB6A 3DC2A 2EFVA 3BSNA 1UVMA 4ZPTR 3HVTB 1VQ9S 4M5DB 4IRDA 1NJYA 4A8OA 1YJUA 4DOZA 3MM6B 4K0KF 2M4MA 2EK1A 3NBPA 2ZH5A 4I2PA 1T05B 3FRZA 1S1TA 1FK9A 2JLGA 1KC8T 1XMOF 4RW9A 1TZ0A 4URGA 1NAQA 2CYYA 4PR6A 1LWEB 2W7OA 2Z2LA 4ELUA 1KVJA 1S6OA 1FK9B 2O67A 3C66A 3L3CA 4RW9B 3WC2A 2XMKA 1VBYA 1X8DA 2CIMA 3I0RB 1N5TA 2V0NA 4WFZA 4B02A 1S48A 2IVYA 3NNCA 3QGPA 1B0TA 5L38A 3TR5A 4MYUA 3CD0A 4R8UA 1NK6A 3OV7A 1NK8A 2EFNA 2IHR1 2ZC3A 4F3QA 3GIKA 3MR3A 3QJJA 4NLOA 3CJKA 3I55S 3OPKA 1VRUB 5DQHA 1ZPWX 1KLMA 5AE1A 1SIWB 2QSWA 1I1GA 5DDRC 3CT9A 2HW3A 5A0YA 3H4BA 1S9EA 2GNKA 2IJNA 4ECUA 1RTHA 4IFYB 3RR8A 2XS5A 4RNOA 4PQAA 3BDPA 1NEEA 2I8EA 1SKWA 4JI0F 3M32A 4ZVGA 1UWBB 4B3OA 1I6JA 3LOUA 2MQNA 1S1WB 3BDEA 4K4VA 1LWFA 3MFHA 2W4CA 4HT7A 1FJEB 3I4HX 3CD5A 2GGPB 3HK2A 5E3RA 3I0SB 3M1VA 2B43A 3OJSA 2HFOA 4JV0A 1WG1A 4DR2F 2FGOA 5JXSA 2R8GA 5E3AA 1XTZA 5CD4H 5H9EJ 2BZ2A 3MI7X 3BO4A 5GAEI 4BDPA 5KG5A 3U7JA 3BN7A 1HNVA 3RW7A 3KYLA 3G6XA 2EK6A 4Q5VA 3UDLA 2CPEA 2K1RB 1URRA 4RW8B 1NJIT 3OXFA 3UR0A 4QPXA 4A8YA 1L3TA 1G1XA 4NA2A 2KZMA 4UUXA 3TVZA 4CNZA 1HWUA 1YRTA 2KYXA 3PIPQ 4HEA9 2ZH9A 4ED3A 1O5JA 1S1UB 2OMOA 4IFVA 1VQ7S 4TYAA 5E3CA 2V8DA 2BUNA 4WE1B 3W2WA 1WF1A 4HKQA 4MIAA 2ZBIA 3PX0A 1RT3A 1UVIA 2RRBA 4TLRA 4JI4F 4WKYA 4TU9A 1T03A 4RUAA 2O3DA 3RRHA 5KTQA 3VQTA 4N76A 1Q7YT 3LW5C 2ZM6F 5KG4A 1FXLA 5LSRA 4YOEA 2FJBB 2KHDA 4ZDNA 2E1CA 3CCJS 1HNIA 3CVKA 4OI6A 2APOA 4OI2A 4Z2XA 1NNDA 1SJ1A 1WHXA 3KK1A 1N0UA 2HGNA 1DLOB 4MIWA 3EX7B 3I82A 2HHWA 3MM8A 4DF8A 4OHVA 1NRKA 5BJRA 2YH1A 2RD5C 5F9NA 2PI5A 4LIRA 3MM7B 4H4MA 4O3RA 3SCIE 3QO9B 2AGQA 3SDEB 4OLOA 4LF5F 1X4BA 2BM0A 4MK9A 1ZPVA 1QUPA 2VPWB 3PACA 4QWCA 1VC5A 3VTIA 4NCGB 2B4PA 5BYQA 1XC9A 3IG1A 3C46A 3VAFA 5IM0A 3US5A 5A6PA 1IBKF 2DNYA 4ILMA 4DL4A 4F2SA 4H4OB 4K5SA 1FESA 2VFUA 3ULHA 2R2TA 3PFEA 1KLNA 2E5LF 3H5UA 1BLUA 1WI6A 1F5CA 3LUYA 3BSOA 2IAJB 4QZVB 2M5YA 4LF4F 3M2RA 2H9ZA 1FDDA 4KHMA 2UVWA 1FKOA 2D3UA 5ITHA 1MWYA 3K8VA 1S72S 4EZ6A 1U2FA 4ZMMA 1UFLA 1V3ZA 2JWNA 4DG1B 2PO4A 2MQPA 2DNKA 4B9VA 2MZRA 4O3PA 2MKSA 2OP5A 2BE2A 1VQPS 1A7GE 1S6PA 1VFJA 3KOAA 5KFTA 1TL3B 3KG1A 3ENQA 3CDEA 1HBUA 1RGVA 5F0WA 3P96A 1N34F 2GFFA 4I2QB 2P9GA 4CT8A 1TP7A 1T95A 5KFYA 1HBUB 3RU0A 1J5EF 5CYQB 5J2QA 5DM7Q 4V19J 5D3GA 3OTDA 1GNKA 5I3UA 1LWCA 1X4DA 3V5RA 4YB1P 1IKWB 2RS8A 2WB4A 1U24A 2I38A 2OLWA 2XLJA 4UQGA 1VJWA 4H4KA 4LIWA 4WYLA 2AGOA 3D28A 3RRKA 4MH8A 2ADBA 3SSRA 2DJWA 3B82A 3E51A 3ICLA 4OZNA 5KT2A 2FLPA 1E6YA 2FJWA 3GQCA 2JVOA 4EZ9A 1WELA 4X2BA 3HKZD 1WACA 4ICLB 4ZP9A 4N8NA 1VQLS 3EXYA 4AQYF 5A8WA 4UY85 2VOPA 2XI3A 3DRPA 1KVIA 5K8MA 1LW2A 4LSLB 2I1RA 2F7VA 3LPYA 5A8WB 4IG3A 2C42A 2HS4A 3FSYA 2NUUG 1LV5A 3S8SA 2UUBF 4L6V3 3SFGA 5GADI 1JXEA 2WCXA 1KRPA 5T7LA 3HFKA 4ECRA 3P49B 1D3WA 5A8RA 2HG4A 4TY8B 2E7WA 5KFOA 2DIVA 4E0DA 4JI1F 4OX8A 5B0FA 1C2PA 1JKHA 3IXQA 4J9PA 3KFWX 4B17A 3QGIA 4ECVA 3A8EA 1SQEA 3HI9A 4QIVA 4XDDA 3DLKA 5CYMB 5L8RC 3L09A 4IOBA 4E8UA 3Q23A 4X4VA 1RTDB 3SQGB 1C1BA 2ZHAA 2YNFB 4RW7A 1X9WA 2LU2A 4X4RA 1FVQA 2BV3A 2DHSA 3DDKA 3KMQA 2MZQA 3KG0A 4X64F 2CJKA 2X51A 3THVA 3DXBA 4XO0A 2VPYB 2B6AA 2NS1B 4J9QA 2E9TA 3CDWA 4QOTA 1SV5B 3DM2B 3FFIB 3M6VA 1WHVA 5GVQA 3MWBA 3MEEB 5SUHA 2HVIA 1Q79A 2ROGA 4DN9A 5KFBA 4RBTA 1ZAXA 2V8HA 3V2UC 1YGYA 2KN4A 1B0PA 2V9KA 4PQUA 2GQCA 3C6UA 3PXGa 4OFZA 1N32F 2EBGA 3OSNA 2YKAA 3UPFA 2DR5A 1FNMA 4XPEA 3K58A 4C8OA 3CJ2A 1IBLF 3BF4A 4KFBA 1NJWA 4DV0F 4DFKA 2FVQA 2YNGB 4KFBB 4O3QA 5KG2A 2ZJPQ 1S9GA 4RU2A 2MKJA 2CJBA 2CZ4A 4Y0FA 3Q8RB 5F3TA 5HROB 3MOJB 3EGNA 1ZAWA 2YKNA 3VAGA 1C1CB 1P27B 4DL7A 1TKDA 3CC4S 2E29A 3DGPA 2DRBA 3OL7A 4UOCA 2UU9F 3HHLA 1YJ9S 3OTCA 2C3OA 4KRWA 4FF3A 4ED2A 4GO5X 2F9DA 2R9LA 4R0JA 1N5YA 1N5VA 1K1SA 1JB0C 4JI8F 3M2UB 2ZZNA 2KXHA 1M5OC 5C25A 4DF4A 3CDBA 3Q2SC 2IVMA 2GMJA 5DDQC 1DTTA 3N5FA 1MU2A 2B56A 3G4SS 1Q16B 2KJVA 1JLFA 2KB2A 3HT3A 1YG0A 4KR0B 5HLFB 4LMZA 4O4GB 4OX6A 1KONA 3L95X 4RBUA 2CZVC 5KFJA 2BQ3A 2BR0A 1RT7B 1CG2A