1V3ZA

Crystal structure of acylphosphatase from pyrococcus horikoshii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
b'AIVRAHLKIYGRVQGVGFRWSMQREARKLGVNGWVRNLPDGSVEAVLEGDEERVEALIGWAHQGPPLARVTRVEVKWEQPKGEKGFRIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
publication title Crystal structure of acylphosphatase from hyperthermophilic archaeon Pyrococcus horikoshii OT3
pubmed rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 24
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1v3zA00
1AFIA 3FGVA 2EW9A 3QMQA 1ULRA 1QUPA 4Q2LA 2ROPA 2G9OA 3E8OA 2OAUA 1FVSA 1OQ6A 2FTRA 4OJ3A 1YJRA 1VQSA 2W4PA 3FMBA 3BF4A 2K7KA 1CC8A 1Y3KA 4OIXA 2XMWA 2BUNA 2GFFA 1RJJA 2XMUA 2ZDOA 2N7YA 2XMJA 1FVQA 1P6TA 1TL4A 2GO8A 2KKHA 2XMTA 3HHLA 3IWXA 2HIQA 5IXUA 1Q4RA 2QYCA 2OP5A 2RSQA 4ZOSA 2BYCA 3WDOA 4A48A 3F44A 4F67A 5KAKA 2HFOA 1AW0A 5B0BA 1OQ3A 1IUJA 1X0PA 1X7VA 2RMLA 5B09A 2HLTA 1P8GA 1OPZA 3MCSA 1SQEA 1S6OA 2PD1A 1JWWA 5B0FA 2XMKA 1FD8A 1TZ0A 2GA7A 5T7LB 3FRYA 4Y2IA 2VH7A 5B0CA 5K9FA 2FHMA 2XMVA 1TUVA 1N5TA 2ACYA 2HQIA 1W2IA 5B0GA 4A47A 3BR8A 2OD6A 4OJHA 4DN9A 1MWYA 2LQ9A 2QLXA 4Y2KA 2HLUA 3UDCA 2BJDA 3KNGA 2FB0A 2ROGA 1N5VA 2RILA 3CJKB 1K0VA 1Q8LA 1Y0HA 2QIFA 2IYGA 2Q3PA 5A6WA 1YG0A 1OSDA 4HI2A 3I9ZA 1X8DA 2OMOA 3BM7A 2KT3A 3DCAA 2GV1A 3IWLA 4FNHA 1KVIA 1Q8BA 1U7LA 3K7RA 3HFKA 1URRA 1Y3JA 3LO3A 1GXTA 1YRXA 3HX9A 3BN7A 2PGCA 2LQBA 3LGMA 2W4CA 3QGPA 5A6PA 4DL0C 4HI1A 4OJ1A 3HHLC 2N4CA 3VTIA 2BJEA 2BBEA 4OJGA 1JK9B 2AW0A 1XBWA 4A4JA 4NPOA 1FE4A 2JDJA 1N5QA 2OFHX 3CJKA 1N5SA 2GCFA 4HL9A 3T9NA 1FE0A 2IFXA 1KQKA 1YJTA 1AFJA 2KYZA 2GGPB 2W4DA 2VV5A 2HFNA 3HF5A 2FIUA 3KKFA 2ASYA 4U9RA 1CC7A 3BDEA 1APSA 2ROEA 2K1RB 5B0DA 2CRLA 1WD6A 3TNVA 4A46A 1GXUA 5T7LA 5B0EA 4YEAA 1Q53A 5F0WA 1LQ9A 1YJUA 1YJVA 2RU9A 3BB5A 5B08A 2OKQA 1FESA 4YDXA 1TL5A 5B0AA 2QLWA 4NL5A 2K7JA 4ZA1A 3TRGA 1S6UA 3KG1A 4HH1A 2ZDPA 3BGUA 2KT2A 2OFGX 1CPZA 2IYIA 1Y9OA 2K2PA 4HH0A 1TR0A 2GGPA 5F0UA 3MZIA 3LGNA 2LXFA 1SB6A 3DXSX 4DPOA 1MWZA 2K1RA 2N4DA 3GZ7A 3HHLD 1R6YA 4Q2MA 1FEEA 2LDIA 2XMMA 3KG0A 1VQYA 3HHLB 2L3MA 3TOQA 1V3ZA 1SI9A 4QOTA 3HDSA 2AJ0A 2AP6A 4Y2MA 1KVJA 4EFAC 2AJ1A 2OD4A 4FNIA
chains in the Genus database with same CATH superfamily
1JX4A 2HFUA 3CW2C 3DOKA 4QZVB 1TKXA 1VS3A 3F0NA 2V9KA 3D68A 4BC9A 4FF4A 2OSRA 3T9ZA 2MXYA 2J9DA 1FD8A 2JZ5A 1R8BA 3AOCA 1RAAB 3EVWA 1R8PA 2M8HA 3EZUA 2C1EB 4DMZA 2JEGA 3ZZPA 1HMVA 4L72B 5C2CA 3V81A 2A2DA 4NLSA 2HFZA 1N5VA 2J76E 5LMNJ 3GV8B 2YX4A 1LWEB 3MTKA 3IRXB 4PXCA 2J7KA 3KJVB 2PA3A 3EDQB 2MQMA 4EI2A 3I55S 3CJRA 1T9VA 5KFRA 4M5MA 3PX0A 2DHXA 4WP3A 3MGJA 2L48A 2MQOA 2N4DA 4DQSA 1UPPA 2BRKA 4DPTA 1SQGA 1KEKA 3WIUA 3CDAA 4NCGB 3M8YA 2MYFA 2VA3A 5KFVA 3HHLA 4AUKA 2L9WA 2ALZA 2BYCA 2ZC3A 2UXCJ 1HKAA 1CULA 2J9DE 2AGQA 1OY8A 2MKIA 5E2QA 3M1VA 3PW5A 3MAQA 5LT5A 4QU6A 4A8YA 2J0QD 3RR7A 2HNDB 3MM8A 2CQPA 3J81Y 1ZBTA 2DPJA 2W9CA 3QIDA 4NXMJ 3CWJA 5JUMA 3Q0AA 4URGA 3J80Y 4WFBQ 2IMWP 1GH8A 2JOQA 2HMIA 2BXJA 3K5LA 4HEA9 5GMEA 3K89A 4C11A 4I0WA 3A8EA 1NPPA 4DV6J 1HBUB 2PT0A 3MMAA 4Q2MA 1QD1A 4DR3J 1T11A 4U6PA 2XGQA 2KM8C 2YWEA 4UY85 5K14B 4LF4F 1AROP 2QEXS 1HQUB 4DF4A 4IG3A 4DCJB 3F44A 1PAEX 4WJBA 3GIKA 1FNMA 1H98A 4NCAA 4DSKA 3SCJE 5D0RA 2DEIA 3V6DA 2FC9A 4YFUA 3ZNJ1 2W2MP 2W8KA 3DKDA 2ZBRA 4O44B 5KOWA 4TU7A 3D7SB 3CNQP 3PHTA 3NNHA 2B56A 2BJ7A 4ZP6A 3W8GA 5DQIA 4NLVA 5L1IA 1KQGB 1FWPA 2MKJA 2D74B 2DNKA 1NKBA 1HBNA 2DITA 1S1UB 4L73A 2GHVC 2YNHA 4ES2A 2Z4PA 3UDLA 1ICEB 2ZM6F 2OMLA 4L75A 4KO0A 3EX7B 3HLUA 1XWLA 4RU9A 4F3OA 1VC6A 4ECQA 3A4TA 2CQ4A 4P72A 2CG8A 4AYBD 1JLFB 4WYLA 2FUG9 2XY5A 1KLNA 5HANA 1WEZA 2KKHA 2ZJPQ 1VC5A 4A48A 1XERA 4O0IA 3ENVA 2KI2A 2WVFA 3NAIA 1VYAA 3W8PA 3HSZA 2WTFA 1I6JA 2UV8A 3BO4A 2DRBA 4JI6F 4YP3A 2DNLA 1F5BA 2Z30B 2OEMA 1RTIB 2YNGA 4MAKA 4Y0FA 4DZ6A 2MGZA 4KB7A 3T41A 3PYGA 4NYOA 3C6UB 5KFUA 3OTOJ 4QWAA 4K50A 5D4LA 4I2PA 3EDRB 2GQCA 4KGVB 4I4BA 3IC1A 3BGRA 1H74A 3PO4A 2HQGA 1GFWB 4MT1A 2ASYA 3FDSA 3CIMA 1YDLA 3LP0A 3TX0A 3KFWX 3OL7A 2DR7A 1EP4A 3HO1A 5K8NA 4QBUA 4IH5A 4ATNA 1B3TA 2H51B 3EE3A 2J8AA 3H4DA 1SH3A 4V19X 2QLFB 4LRAA 2V6AA 1YITS 4Q2LA 3NGKA 2HFVA 4HACB 4DN0A 2ZUGA 4WZQA 1VJWA 3BBCA 5FDLB 5HAOA 5CYJA 1TMJA 3VGUA 4LRCA 3M8RA 1KQSR 1OWXA 1BE4A 3CT9A 2KHCA 2UVUA 1LFWA 1RHMB 2DR6A 4DLEA 1JJ4A 1SBRA 4ECTA 3PM9A 5L9NA 3H59A 4QIWD 5HJXA 2RILA 1N6QB 3ENQA 4QPXA 1S0MA 3PIOQ 4ZVFA 3UD3P 1RCOB 3QGGA 4A8XA 2C2EA 2MQ8A 2BJEA 4DR5J 1RWNB 3BGOP 3QJLA 2KT5A 3AD9C 3QT5A 4QIGA 3KXDA 2KU7A 1FRLA 4ZVQB 2ALYB 4HKQA 2MY8A 5F8JA 3LF0A 4LFAF 9ATCB 1B70B 4TLRA 5DZ6A 4PG6A 5KT3A 4AE5A 1GQEA 1VMBA 1OMSA 3M8SA 4C3MA 2JEFA 4DSJA 1TL7B 4Q8FA 2K06A 5M2PA 4ID5B 1AA1B 1WTFA 4LRDA 3K5MA 1G3OA 1R0BG 8AT1B 1S1WB 4LMZA 2QMUB 4P2MA 2D69A 3N4WA 2CNOB 4PPZA 4KGXB 3CC7S 4M95A 4WF9Q 1P8GA 1XR6A 5L39A 3AAWB 3JQMA 4C98A 2FY1A 1NO8A 3CC2S 4OX9J 1RTZA 4TYBA 1FFSB 4DJBA 4D3GA 1R3NA 1RBOB 2OD6A 4H4KA 5F8GA 2U2FA 4LSLB 2IYGA 1OO0B 3ZNUA 3B6BA 1SUQA 2G1HA 4NLYA 4RNHA 2DXFA 1T0TV 4NMLA 2HFNA 1RAHB 2HK3A 4PRFA 4AFFA 1TL1A 2JLFA 1RE1B 3MEGA 1C0UB 2YWGA 3LWMA 3T1HF 2G0CA 2WZ1A 3QIPB 4MKBA 1AUSL 2X3DA 4ZP9A 1FNXH 1N48A 3FQKA 3EXCX 4EMDA 3QSIA 3BJYA 3JQKA 1X4HA 4I7FB 2V67A 2VFVA 2OD4A 1RAIB 3CJ0A 4FYYB 2CPFA 3WX4A 1WDDA 4B9UA 2IBOA 1QDUB 2ZEJA 3MAAB 3FMBA 4DV5J 3CD5A 1CJTB 3QRQA 1FKOA 1IN0A 4EZ9A 4OHVA 2AD9A 1XJWB 1T94A 4DG1A 1S1XB 2KG1A 1FJ7A 2ACYA 1YBTA 2YNIA 1C2PA 2HBQB 4DR4J 3OHAA 4K0KF 3Q8SB 5EN1A 1UJ5A 3SDEB 3HCXA 1PGZA 3SQGA 3BM7A 2BDPA 4USJC 2XYGB 3OTCA 4TKTA 3W60A 1TMMA 1FDNA 1RT1A 4K59A 3OQ2A 3OFHA 3W2WA 4DV0J 3J7YI 1VQ6S 5HK4A 1FK9B 3BO3A 3PO5A 3GIMA 4X62F 3I6PA 3IBCB 2RQ4A 2ZD1A 4KHPJ 4YB5A 1R6YA 4WYWA 1VISA 2Z2ZA 2H4YB 3CJ5A 4WTYA 3GWCA 2R2TA 2CQIA 1ZA1B 1FKAF 2DIVA 1O5JA 2Y1JA 2NPFA 2ZKUA 3NWGA 1ZTWA 3ZZRA 4CO3A 1N0VC 2M5YA 2G1DA 2JNJA 3EGZA 2VBZA 4USHA 3W9IA 1NZ8A 3IM9A 4HYKA 1GMWD 2W7AA 3PR4A 3GSDA 3OVBA 4KAIA 2BKPA 2HZCA 1X4DA 3HJFA 4JI5F 3CDWA 5LOQA 2ZE2B 1NNDA 4ZDNA 4WTOB 4D3HA 1WI8A 1GK8A 1CG2A 4WFAQ 2XB2D 5KFJA 1NPRA 1RTHA 1QE1B 4UF4A 3KG1A 5HQMA 3OXGA 1SC1B 2DNHA 3MPWA 3HHKA 4NZ7A 3I0RB 2MZTA 3KG0A 3GU0A 2PC6A 3M30B 2B9YA 4FXWA 4NWBA 4PQUA 2L9DA 4ZVPB 1S0NA 4JI2F 2HVEA 5C25A 1I51B 5F9LA 2B6AA 1N5YB 2W9BA 3QT6A 4WKYA 3DM2A 3RRGA 4UZCA 1JLCA 2Y8YA 1D9AA 4PABA 3C66A 3DYAA 2EFGA 3SZ2A 5A6WA 2IAJA 3CCRS 2J0XA 2EKYA 3KK3B 2ASJA 4K7QA 4KRWA 1WDTA 2PDAA 4C9DA 1HI8A 1RUSA 3VGSA 2HWIA 4ECVA 3IMQJ 2VFRA 4RX6A 4PCQA 3ZZ0A 2KTQA 5BR8J 1Q86T 1JLEB 3EVMA 2MB0B 1Q53A 2OKQA 2OPRA 4F4XA 1FT8A 4OYBA 2CUYA 1X5PA 3H90A 5I3UA 2VPWB 1UW4A 5LM7E 1VJQA 5GAEU 3PRBA 1EAYC 3MUTP 1VQYA 3HHLB 3RZAA 1AB8A 3TUIC 1VQOS 2IY5B 4DUTA 2DK2A 1NK8A 4KPYA 2F5GA 1YJRA 1KRPA 3SXLA 2F40A 3TI0A 3M1VB 5C2GA 2IC3A 2DNZA 3NP5A 3EUNA 3OTDA 3F41A 3UR3C 3LPEA 2E66A 4Y2IA 1QUVA 4USUA 3MM8B 3PCOB 3HP6A 2YQ3A 3QGIA 1NUEA 1X9SA 3MM6B 1OSDA 2QE5A 2AYGA 4WK3A 2HZAA 1NK5A 2HMIB 4C11B 2BBEA 1ELOA 1G2EA 3KK2B 2LEAA 3MPDA 2C22A 1SJRA 1UWAA 1VIXA 1QSSA 4XDCA 4DL6A 5EX3A 3KLIB 4ZA1A 4MIAA 2NPIA 1IQTA 4LF5F 1CPZA 2JL9A 3MTJA 1WC3A 1KTVA 5A8WA 4M8LA 4ZP8A 1TKZA 1G1XA 1NB2A 5K5MA 4B3TJ 1A9NB 4PYDA 1SJFA 1S99A 2EWHA 4AD6A 1VQKS 4ZPAA 1D3WA 1R0CB 4FXVA 4F02A 2BACA 1RISA 3KMQA 3H2VE 1UPMB 1KTQA 3V6DB 1SC6A 3HD2A 2L41A 4F25A 1NKCA 7FD1A 1S9FA 4LIRA 2J9CA 1R31A 5HROA 1RTJB 1BWVA 4A8WA 2F4VF 2MQLA 4OFZA 5HBMA 1PYOB 2N3OA 3KLVA 1CBKA 4RNMA 2VQFJ 4DEZA 3TO8A 2CJKA 3OXFA 3K57A 3T3FA 5L8RC 5E3CA 2H48B 3MWBA 2O1PA 2OPQA 2YNHB 1JXEA 4HHJA 1XNQF 5CZVA 4DR7J 1T3NA 1GXUA 4CLSA 2W8LA 4ICLA 2ZNZA 2AV5A 2EEYA 1TR0A 1RAJA 4PXBA 1VQ9S 2AQ4A 4X2BA 2AP6A 2FDNA 1VQPS 3PR5B 2G9OA 4Y3CA 1UTAA 2NXJA 3C14B 1F9HA 2N7YA 3QWPA 4ZHRB 2YNGB 3EPIA 1IUJA 2G2ZA 5F8IA 3SCLE 3VAFA 4ED3A 4J9QA 1MW7A 1NEEA 1IKVB 4I2PB 5F9NA 3WQPA 3CD7A 3BGRB 4FXDA 3R7BB 5LMUJ 3WHIA 4L76A 2R7RA 2AWZA 2CPXA 1FA0A 3FFIB 3G6VA 5D4OA 1FDAA 5EWGA 5IOLA 4I68A 2CZ9A 2HAIA 4NRTA 4LT6A 3TAMA 2V34A 4DZDA 1FDBA 4X66F 1TL3A 1PG5B 1SC4B 2ABYA 1PAUB 3BZQA 4Q5VA 1M5OC 3M9OB 1NK4A 1HNVA 1WG4A 2VQEF 2JJ4D 2LQ5A 2VICA 4FF1A 2MKKA 4QWDA 1PYTA 3HHLD 4X4UA 1CJUA 2XSJB 3M6XA 4ZITA 3CF5Q 2VU5A 3GR1A 1YJ7A 4OIXA 2E29A 2GIQA 3P3DA 3CDBA 1ZOTA 3RB0A 2NCKL 2K3IA 4QR1A 3IXQA 4J9NA 4DCPB 3TEGA 1ZM9A 3PYFA 2HQIA 1MMDA 4ZLLA 2FHJA 3TZXA 4ZKAA 5J2NA 2HS4A 2ZH2A 4N5SA 1U25A 3KUGA 4CCHA 2QMWA 4HVZA 5CAAA 1M90T 4HI1A 2COLA 4YR0A 1RB0A 4JUZA 1SQFA 3EM1A 3OBIA 5B0DA 5KFWA 1VQ4S 3TNVA 2A18A 1JLAA 4WXWA 2CQ2A 4AL5A 2EFPA 2VD3A 1U2CA 2J6UA 3K17A 1LWCB 5IM0B 5ITHA 2MTLA 1IKWA 2KVQE 1NKEA 2E5HA 1RGVA 4ED1A 1D8YA 1NH8A 3FK4A 2VFSA 1LNQA 4FBTA 5LMNF 2RKIB 3PVXA 3CUNA 4OYIA 1F5CA 2AMCB 3GJQB 1SUQB 3MR5A 4MKYA 2R7SA 2B8PA 3LGHA 3NCRA 2HLUA 1V3SA 3HZEA 3T6BA 1TL1B 3MEGB 1GXTA 2UUAJ 3IS9B 2WONA 1TV6A 2QLJB 3PJWA 2VJUA 2FJVA 1VRQC 3MDFA 1HD0A 1LKZA 4ECUA 5T7LA 3H25A 1IM6A 2B9XA 2VPYB 5EUHA 1VBZA 5B7WA 4CO0A 3TX8A 5E3QA 2GJ2A 1TKTA 5I4MA 2C2DA 1SB6A 2UXCF 1RACB 1IBLF 3AQPA 3BREA 1Y4ZB 2LU1A 1PO6A 2RJZA 4DG1B 2XS5A 4KJIA 5THWA 2MZRA 3BQ1A 2RMLA 4TXSA 3DMJA 2W2QP 3SQGB 5DJBA 4IDKA 1E6VB 1HNWJ 3NKYA 2SXLA 2OELA 3MOZA 1BQMA 2VBYA 1RT1B 3G8TA 2DYAA 3FRZA 4DV6F 3UNYA 3IR6B 2ADCA 3QT7A 3THPA 3UPFA 3OR2A 3D3CJ 3UO0A 3HULA 2HKEA 1ZS6A 5HL7Q 1H2UX 1LWXA 5KT2A 3R27A 5KFZA 3JB9k 5D0HA 4U9RA 3B54A 3KG4A 3NGSA 3D0GE 5KG5A 4C8MA 3JSYA 4PZVA 2KXFA 2V4JB 2GC8A 3W9HA 2ERRA 2FY8A 3KK1A 2YH0A 4UOFA 2F63A 1KFSA 1U8SA 3Q83A 1KD1T 5HO4A 2AJ4A 1J2VA 2HW3A 2Z57B 3M32A 2FC8A 5LXYA 1IBKJ 3IWXA 4YR3A 3M8PB 4F67A 2PI5A 1JJCB 1HBOA 3PG9A 4CLZA 2P9GA 3PXGa 4LF8F 1N5TA 3TUJC 4OZ5A 4EBCA 2HG4A 3U1LA 4UUXA 2WRMA 1XTZA 1KHWA 3ITHA 5HVGA 2HHPA 3T19A 2JHEA 4B3OA 2GHWA 4MH8A 2E1AA 3DN9A 2LQBA 1CS4A 2HBZB 2YKAA 1N88A 2WK4A 1E6YB 5F8HA 2RF2A 2RB7A 2FIUA 2R8GA 1UEKA 4JI8J 2ZHOA 4C6AA 4W4MA 4S0MA 2OO4A 1R27B 2B4VA 1QVFR 4YB7A 2OFGX 4IR9A 1Y9OA 4OI2A 4PQUB 5KFNA 2DGXA 3CJ3A 3SCKE 3ILLA 4J90A 2LEBA 4NE9C 5C25B 2B6AB 1HW9A 3HDSA 1ULRA 4K4XA 2YBVA 2ILZA 4LF4J 3DM2B 2VFUA 3TAPA 1JLCB 4DDFA 3R5DA 2WBMA 2ZDOA 2B8QA 1W7WA 1O51A 3GPAA 3DYAB 1PJ6A 4RJVA 5F8MA 2HHUA 3OTOF 5GAEI 4WIIA 2FHOB 3NXZA 4CT8A 2IAJB 3LPYA 3QZ8A 1FXRA 4C4WA 1R6VA 3OUYA 2R7UA 1T02A 1XR5A 4YB6A 2CA9A 5EX0A 1U24A 2OHDA 4R5PB 3R5GA 3TANA 1IQZA 3Q8VA 3DCAA 2UVRA 4FPIA 1IJEB 1WKLA 1MLAA 2V94A 3FBEA 4ED8A 2OPRB 2KM8B 4OJGA 4C97A 1GMUA 4LQ9A 1OYEA 3SSQA 2IDEA 1HHQA 1RABB 2BKNA 4JP8A 2Y8WA 2NYHA 2ZDPA 5KFQA 4UW2A 5AT1B 3H8YA 2KRRA 3W66A 2F8MA 3D6MB 3ZC4A 2VIHA 2LDIA 2RQCA 1RU2A 2IC3B 5AXNA 4CM0A 3EGNA 4ERDA 1HWJA 4GKKJ 4M5IA 2GFFA 3H2UB 5D4PA 2BJ1A 3I87A 3VQSA 1N0UA 1RT7A 2C3YA 1UVKA 2MZJA 5AE2A 4IFYA 4NLRA 3J7A1 4WFZA 5CYQA 2DNGA 3U1NA 1S9GA 4JI6J 3V6HA 3CCMS 2Q6BA 1NJXA 4LFBF 4A8KA 4I56A 1P9QC 3KWMA 3BKUA 4ED5A 4G1IA 3OTBA 5LSLA 2FQQB 3A13A 3PHEA 3FKBA 2W4DA 3GYNA 1M1GA 4OLOA 2GVDA 1PBAA 1HNZJ 5LJ3Y 1TKZB 1TL5A 1H2VZ 5HQ8A 3CJQA 4KTQA 2IJRA 5EWEA 3M9NB 5F0UA 4JI3J 4JI0J 3RB3A 5E7OB 4ZJQA 2HVZA 2DD8S 2E7VA 2K1RA 4M5GA 1N4LA 2HRTA 4TY8A 4OX9F 3V2UC 3MD1A 5M2RA 4URQU 2QN6B 4O4RA 4P7TA 2YKPA 5KFCA 1X31C 1P1LA 4JI1J 2J7UA 1JLBA 2W1BA 2ZHBA 4I6WA 1SC3B 1S57A 2X51A 2PMZD 4UOCA 2O01C 1LWFA 3BSNA 1V5IB 4A8SA 4NEZA 4J9OA 2OPQB 2AJQA 5CCMA 1IXKA 2WB1D 3NMAA 3IWLA 3FCVA 3HSGA 1FERA 3TVZA 1UJ4A 3DOMB 3BN7A 3PTWA 4DV3F 3MUVP 4NLOA 5F8NA 1F2HA 2OUGA 1SCJB 2KYZA 1S4FA 4P9SA 1HPZB 4R8UA 1WEYA 3I0SA 4AT1B 4E2FB 3TP2A 4ZN1A 3VZHA 4DV5F 1RWPB 1KN6A 5C7PA 2EG1A 2NUHA 1C0TB 2HNZA 1YBAA 2LXFA 1RT4B 2EBEA 1T7PA 4LFAJ 2DHAA 4RO0A 4ED7A 2F4FA 2BANA 5E3PA 3A3PB 3DGPA 3ZFVA 5KFAA 1T95A 2FYXA 3QPIA 1OS5A 4ZVOB 4C7QA 3HHNB 4DR4F 1NSPA 3TJ8A 3NEKA 4QPTA 1HA1A 2DT9A 4X64F 1N34J 1SL1A 1X4BA 1REVA 4LREA 4CZCA 4ILLA 2NSCA 4WFYA 1NRKA 3HSJA 2AEFA 2BRLA 4DV0F 2R8JA 3UE2A 2W24A 3CCUS 3TAMB 5DQHA 2O67A 2XEXA 1HD1A 4B9LA 4RWXA 1TL3B 4KHPF 2E5GA 2N82B 1HNVB 5MAOA 1RT5A 1BGXT 1NH7A 1A7GE 3PYEA 1SJ3P 1K1QA 4ZIWA 5B0AA 1CJUB 2FGOA 5HJYA 2G13A 4LSNB 3CXCR 3DLGA 2CNKB 2JX2A 2BW2A 4MJKA 4DUYJ 3TA2A 4X4PA 1NK0A 1K1SA 2QG9B 1OYDA 1NK9A 3KLEB 1BQNA 2VG6B 3K5PA 4HHUA 4OZ0A 1LW2A 5F3ZA 2GJIA 3J7AN 2V50A 2WB4A 3R97A 3FSXA 2FLNA 1KONA 1C4AA 5ETMA 2C2OB 4F7VA 1Z4UA 5KFKA 1F0XA 2NSBA 3ELHA 3A3OB 4LBIA 4KSEB 1HYSA 4DQQA 4FDFA 4RW9B 2Q43A 4MKVA 3V4IA 1UA1A 2AX0A 3G9CA 1NHUA 3TEHB 1VHFA 3UVJA 4K0KJ 2RRBA 2KL8A 3CMAS 2CQ1A 3CC4S 1BLUA 1JLAB 1X5OA 3FBBA 4EBEA 4WE1B 4LBPA 3NWRA 4RWWA 4ZVEA 2HHWA 3HF5A 1JB0C 1IM4A 1T9YA 2HFSA 2CRLA 1SVDA 1QAXA 3N28A 3OLBA 1IKWB 3OVSA 1YHQS 1HNIA 4OYAA 4P2FA 4M63A 5KFYA 3VAIA 4TNOA 4DR1F 4KE5A 1T9WA 2ZOMA 1NK7A 4X62J 2KZMA 2R7QA 3Q8UA 4CP5A 2IIHA 2BA9A 3D6FB 1RADB 2XMWA 3PW7A 1TVRB 1P6TA 1I94F 4Y00A 4GKJJ 2NXNA 4C48A 4RW8A 1H73A 1AYEA 3N01A 1TZ0A 1R8AA 3CCZA 4DX6A 3ZTPA 3UQSA 4YR2A 3TJ9A 3ZZTA 3BR8A 1NMEB 4IQMA 3TARA 2WONB 2YKMA 1VFJA 3G6XA 1S97A 3TVKA 5KG7A 4ELVA 4JI5J 4EK2A 5IT0A 2IVYA 3BQ0A 2DEJA 2ZZNA 1WELA 1SV5A 3C2PA 4HT7A 4FF2A 3NS7B 1TKTB 1PILA 4C8YA 4P71A 1UWBB 4ALZA 2QO3A 4QIFA 1T9XA 2CWXA 2BQUA 3JQJA 3RUBL 1ZPWX 4WP8A 1Q78A 1VRTA 4MK7A 4A8MP 4CI0B 4JV1A 3RW7A 3KYLA 3TUZC 3PACA 2FTRA 3DMJB 5KG1A 2WAQD 4OV6A 2HURA 2P2CB 3O8WA 4IDKB 2AF6A 2DRDA 4ILMA 4JI2J 3CCLS 3I5CA 2J7WA 1JLGA 1BQMB 1U1LA 3H5YA 3NMRA 1KFDA 3MEDA 2MKYA 2ZH7A 5CHCB 2VBWA 4MYTA 1V5VA 3D2WA 3DRPA 3QQCD 5I3PA 1MWQA 1SIWB 3OR2B 4B9TA 5LSOA 1FWKA 1KNZA 1K0VA 3CO0P 2MQQA 4KH0B 1RTDA 4ZCKA 4YS2A 3JYTA 2HHHJ 4TYAA 2LKZA 2MHNA 1PBUA 3HKZD 3LH2S 4EU0A 3DLJA 1IBMJ 4DV7F 3GE9A 4B9SA 2PEHA 3C16A 1CLFA 2WOMB 2VJVA 2D1CA 2GMJA 4G1QB 3Q22A 4V1Ak 4BWMA 1TK8A 1LXNA 1X4EA 5HATA 4ZJLA 1XC9A 2W7PA 1M5HA 3AY0A 2B4PA 1K44A 2E44A 2VHGA 1MNEA 3ILIA 4NRUA 4LR8A 4ZMMA 1VQ8S 2DGUA 4PWUA 2RRNA 4HR2A 2W4PA 2X3GA 3VQTA 3VHQA 1T9TA 4MYUA 2BQ3A 4DV2J 3QATA 1P1TA 2UU9F 4OHWA 5IC4B 3UWTA 1X60A 2QYCA 4XPEA 3AJ2A 1SQEA 4OI3A 4UY8T 3OVAA 4GC6A 2E1CA 4FPRA 4M5HA 3CJTA 4AL7A 2DH7A 2B5JA 1BXNA 2XMVA 5DGAA 3TYTA 2WVBA 3G4SS 4PWWA 1R89A 2DB1A 3ZZYA 4JI4J 5G4DA 2WW4A 2FVRA 2OPSA 2R7TA 1IWGA 5A8RB 4OYWA 1JXVA 2R7XA 1NJYA 2JLEA 4F4KA 2D3UA 3M05A 3ETMA 5AE3A 2YNFA 1U0HA 5ETPA 4CLKA 4PUOB 4ZLJA 1XMQF 1VQ7S 4RZRA 3PNIA 2NXUA 1F6TA 2WSFC 3HVRA 1MU2B 3UN2A 3BV8A 4LF5J 2ZHAA 3D1OA 2DRAA 3AFGA 1S49A 1HQEA 3MCNA 3R9LA 3NS5A 4F4ZA 2ILYA 2OH2A 1RA6A 3OUYB 1PIEA 4YUDA 4NLGA 2O5DA 1H0HB 2VB6A 3R5CA 1AW0A 3GYGA 2MSSA 4O3NA 5B09A 2B0GA 1N36J 2XM3A 2O3DA 2B7CB 2RH3A 4ANDA 4B3MJ 1DJ0A 3FCHA 4RU2A 3RBZA 3VWSA 3RG6A 4HHHA 1YJNS 4LR7A 3GR0A 3J81U 3MMCA 3PFEA 4NLXA 3UNGC 1FE0A 1T03A 1AFJA 1B0PA 3J80U 4EYIB 3P6YC 3AD8C 4RL1A 1JLQB 5KG3A 1LQ9A 4DX8H 1S48A 1A0OB 5ETQA 1R8HA 3RTVA 5L46A 5E33A 2MMYA 5F41A 2DHGA 1T9UA 2O66A 3RR8A 1Q7LB 3MOJB 2HQCA 1RAFB 2AJ1A 2WVCA 4ANCA 5IT4A 1WC0A 4A8OA 5KFXA 2NZ4A 1OQ6A 1QAIA 5IFMA 5A2QU 3H7HB 2G0JA 3FMWA 3KDOA 4CLTA 1T3OA 8RUCA 1DZ5A 1O0PA 2DCLA 3BSAA 2HLTA 3AHPA 1M5KC 5ETSA 3T1YJ 3OFEA 1U1RA 5K8PA 3L95X 2C3PA 3Q2SC 4MTPA 3DFEA 1F5AA 1RHKB 3GTYX 3ISND 1Q8LA 4IOCQ 3BBBA 4P73A 2GVDB 2WSCC 4LF9J 1U1PA 4C8OA 1S79A 2FVCA 4KY3A 4M5DB 3UN3A 3LA0A 1KVKA 4KKOA 2E1RA 2CQDA 2M7SA 3J7ZT 1ZTTA 3WX8A 2BVZA 3PIPQ 2X1BA 2K1RB 4DPXA 2ZH8A 2AEJA 2VKRA 2IBKA 2ZVSA 1VOMA 3BKTA 2HAFA 4H4MA 2HHXA 4L3KA 2Q6CA 1MWZA 2DGVA 2VQEJ 3LAKA 3UI3A 1AZSA 3DLHA 1GTEA 1L3TA 2FVPA 4DSLA 2KDOA 3NBPB 2OJ3A 1YBUA 3L7UA 3Q2TC 2PN6A 4W92B 1LWFB 1U4BA 4F26A 1CQNA 1UFWA 2KG0A 5J1EA 1X4FA 2UUAF 3PRDA 4Z7CA 3MEEB 1J5EJ 1EQMA 2JRSA 3N0VA 4PAAA 3U27A 4ECZA 5DGBA 1S0OA 3JXOA 1ZAXA 1EETA 3Q89A 2CDRB 4J9LA 4LF6J 2J9EA 2VDHA 3DI6A 1IJFB 4XTTA 3HX9A 1Q5VA 3I0SB 1RHJB 3M6WA 2KZZA 4NA1A 2B9WA 1TFYA 2HNZB 4RPFA 4C8LA 4M5KA 4NLDA 1SKSA 2BANB 1S9EB 1FRHA 2CPEA 4QWCA 2RQMA 5KFIA 3LWLA 1K73T 2N7CA 4DV4F 2HZVA 4IFVB 2VZ9A 1HNWF 1ZM4A 5HMZA 3TW0A 4OI4A 1U8WA 3KHLA 2FGCA 1YZ6A 2OP5A 3F56A 1Z2ZA 3DLLQ 2DGSA 4BHQA 3US5A 3KLHA 1X4AA 2QRRA 5H9EK 2HNYA 1KLMA 3K2YA 4B9MA 3OFFA 1UZDA 2ZH4A 2QLXA 4Q43A 4RW4A 4CNYA 3OHBA 1Y0HA 1Q81T 4ZPDA 4QR0A 1URRA 4BWJA 1DY3A 3NCPA 1EB0A 3ILJA 3VTIA 1LV5A 3CIZA 3IAM9 4RKUC 2ZZMA 1ROFA 2ZH1A 4Z2XA 3KLGA 3LP2A 4N76A 2DO4A 3LALA 3OTEA 4NL5A 3IWNC 2LVWA 3QRRA 3C3LA 1IBKF 1BQNB 2V2KA 1R8CA 3R7NB 3MMBA 1TFWA 1H7WA 3QYYA 2XCAA 1NSKL 4CLWA 3C15A 1IBLJ 4CTAB 2ZC4A 1B7FA 4UQTA 4CLPA 2KHDA 2L9NA 1L3UA 2RDJA 4ZLPA 1LOUA 1FVQA 1TL4A 1NDCA 2C3OA 1SKRA 2LQJA 5BYSA 1DFDA 3WDOA 3K8VA 2FJAB 3IBWA 2GMLA 4MMOA 2C2ZB 4RBTA 4O3PA 2E5IA 1U1KA 1U6FA 1W2IA 2NS1B 4OJHA 2NXCA 1BQXA 3TZZA 4JI8F 4KGMA 2QGFB 1RA7A 1D8ZA 2GQQA 1HNIB 5ETTA 4YY3F 2D3OR 3HSDA 3FNNA 4ZLNA 1RBLA 2HWTA 2JH3A 5MLCV 3SEOA 3BYRA 4USMA 4K4WA 2W2PP 1HFEL 5IWAF 3ENWA 5L1LA 2QV6A 5F0WA 1FESA 2MSTA 3TRGA 2RDIA 1HNXF 3MXHP 1RWOB 3MURP 1HWIA 2XMMA 3EVOA 3ZTOA 4RW8B 1FF2A 4YQWA 1V3RA 1VR6A 3SFGA 1YLXA 1QAJA 5HP1A 4J9MA 2ZFHA 3QLHA 1J5OA 1KWMA 1CJKB 2YKMB 3QT8A 2VPZB 4O3RA 1SH0A 4U8YA 1GX5A 4DUZJ 2I2YA 4H4OA 2XI2A 3LW5C 2IPOB 4LF8J 2D9OA 1WI6A 4J9PA 2QLBB 2EI5A 4KFBB 2R2UA 4DL2A 2LXUA 2LECA 4ELUA 5RUBA 3LO3A 2CZ4A 1K9MT 4F36A 3GIRA 4X4TA 2YH1A 3M8ZA 1RKIA 4NXNF 2C42A 3NG8A 2VC1A 3EICA 2UUBF 4GKKF 3UW1A 4KH1B 2QLWA 1QVGR 4RW6B 2RNEA 4IYQA 4QR2A 1X4GA 3G96A 3M2VA 1NBEB 3HFVA 3UFCX 1KSPA 3ETOA 1LWEA 1ZPVA 2R42A 4FNIA 5FD1A 5KG4A 3G82A 3G87A 2XZWA 3L7OA 5C42A 2VOOA 3DC2A 3GMGA 1I1GA 2GIFA 3T5KA 1RCXB 2HYIB 1XK8A 4ECYA 5CA5A 4F3QA 1JWWA 3JYTB 1U6BA 1XEZA 1C1BA 3IR5B 4JV2A 1JJ2R 4LRFA 1CEZA 2PMHA 4N8NA 1HNZF 5GMKa 2A1BA 3C16B 3M8QB 1GAOA 2QA1A 2GQ2A 1FFGB 4F3MA 4JI3F 1U26A 4JI0F 4NLQA 4NCGA 3A12A 4U7UD 2AJ2A 3MR3A 4L3NA 2HVHA 2FLOA 1TK0A 3MM7B 3N5FA 4O3SA 3F73A 8ATCB 4B17A 2XY6A 3OXLA 2OGUA 2PO4A 1WG5A 3GV7B 4P2XA 2WHOA 5CXTA 4JI1F 2ZITA 3IO1A 1JIHA 1S7HA 1F3VA 1H3DA 3U7JA 2DNYA 3IAS9 3T5JA 2OAUA 2CDQA 3J7Z5 1RLDA 5D77A 3L7PA 1UAWA 3DLKA 4HTJA 4Z37A 1U1MA 5GAHU 3ZZZA 3UCUP 3PW0A 4C8KA 3THTA 2XS7A 3D1HA 1MN9A 3FC9A 1HHSA 4Y6IA 4WBFA 1IBCB 3P5TL 2OPSB 3MCMA 1UEVA 4O4GB 4KR0B 4PQAA 4QW8A 5K14A 2W25A 2H54B 1TKDA 2PIIA 4LFBJ 2HQFA 1HBMA 1HQUA 1U02A 4LUBA 1DQ9A 3HHLC 2AW0A 1PJ5A 4Q0BA 2HGMA 4H54A 4KV8B 4OI1A 4DPWA 1EQ0A 2DNMA 4EUVA 2HHQA 1IVZA 3Q86A 4CLFA 3PJ9A 4ZVRB 4DPOA 2YQ0A 1N34F 2IRXA 3IR7B 1KVJA 3W62A 2DR5A 1FEHA 3FGVA 4MKAA 1UW9A 1FKPB 1U1QA 4DQIA 3DGVA 4AQYF 3D6TB 3K5NA 3VR1A 2XNQA 1T8EA 5KFBA 4N41A 1FFWB 2RSQA 5CD4A 1ACMB 3JSRA 3HT3A 4OYOA 2FVSA 1D1UA 1H7XA 4U67Q 3E2EA 5FJ4A 4BS2A 4I2QB 2RU3A 1T03B 1DTQA 2HQ3A 3R3TA 5DG7A 2DTJA 5T41A 1FXLA 3CEDA 1JLFA 2LYVA 3QGPA 2XQCA 4DUYF 3VAJA 4DV3J 2N3LA 4K2XA 2MZSA 1QM9A 1L3VA 2Q1LA 1UJ6A 3TA1A 2NR0A 3M2UB 4C0OC 5C5JA 2GMHA 2AX1A 1RU1A 2UUCJ 3UDVA 3J81j 2WVDA 3SSRA 2LCWA 4HH0A 5C24A 3W61A 2XI3A 2RVJA 2I0XA 2QYGA 1F9EB 4USWA 1U1OA 2BE2A 4B9NA 4OHXA 2LA4A 1WEXA 3GFZA 2R2SA 4MIWA 3P45B 2BM0A 5J2MA 3DNCA 1VHIA 2KXNB 4P10A 4C8NA 3MR6A 2AYBA 2CADA 1MROA 4M1KA 3WC2A 2CYYA 4CM2A 3RU0A 3CCJS 4G6VB 4X64J 2PA8D 4RW7A 4WCEQ 4DR2F 3DOLA 2AEMA 5JJBA 2LMIA 3GLJA 2M70A 4KKOB 4OI6A 1N54B 4HACA 3M7VA 3VGTA 4DFJA 1O6XA 5FDLA 1Y3JA 4B9VA 4R0JA 1NDKA 1FDDA 2HK2A 2GVZA 2FLPA 4RUCA 1UFLA 4H4MB 5G0RA 1FCAA 3AXKA 3UCZP 2QL7B 5B0EA 2I8EA 3VAGA 1YVFA 3GB0A 4EWTA 4GKJF 1EZZB 5CYMB 5EHHA 3CD6S 2IM3A 1G7CB 1GMWA 5H9EJ 1X9WA 3PW2A 1SI9A 2H9ZA 1AT1B 3E01B 1NSAA 3LP1A 5J1EB 5L9XA 3IGVA 2XLJA 3RB4A 3AA9A 2K7KA 1Y11A 5BJRA 2GO8A 1Q4RA 1TAUA 1Y5LB 1N32J 4EZ6A 1RT3A 2AKWB 4CO4A 1RDRA 1EETB 3MHYA 3UN5A 2CPJA 1HL6A 1YRTA 2RHQB 1B7YB 2EG2A 3H5SA 1K47A 2KFNA 1FTCA 4PG4A 2BJDA 2BV3A 3SV3A 2NXEA 2D41A 4ANEA 1TL7A 2ZWPA 1X8DA 3OSPA 2F65A 1OY6A 2LQ8A 5K8MA 4DSEA 3DOKB 4OJ1A 3L3CA 1FTRA 3PX4A 1TKXB 4F4YA 4K4SA 4K4ZA 2VC0A 3BH6B 3HHDA 2EC0A 5KFTA 4OYZA 1BUXA 4L74A 3MM9A 1YGYA 2RAQA 1S6PA 4DR1J 5M2UA 1HMVB 4OLPA 3B4DA 1RAGB 3V81B 2AJ0A 2ZH9A 4RNNA 1AFIA 3CMQA 4J5OA 3DHXA 1VLYA 2OPPA 3MFHA 5D78A 1ZM2A 1KOHA 1VLOA 3KLHB 1PKUA 3AB4B 2HHHF 2HNYB 1I94J 2F9JA 3B4MA 2D9PA 1S6OA 3AB2B 1IBMF 3QIPA 3CCVS 4ECRA 2DISA 4JI7J 2MEWA 5E5NA 2XWXA 4W90B 3GJRB 4I7FA 3GYXB 2ZJRQ 3NS6A 3MAAA 3FCWA 3K5OA 4U7CA 1CJTA 4B02A 4ZPWR 3HM9A 1KQKA 2BKOA 4ED0A 4AXIA 2IA0A 4ECWA 2G0IA 1LEOA 1S1XA 4YDXA 4PG8A 2EK1A 3M4XA 4DWIA 1HIYA 1UVJA 4DV2F 2M9KA 1CULB 4UOGA 4H4KC 1NPKA 2E1MC 2JC0A 4FP9A 5HLFA 3JSMA 7FDRA 2YVSA 2P8IA 4OYPA 1M5PC 1YIJS 4N47A 1WHWA 3ZTSA 1UZHA 4ETXA 1CC8A 2W9CB 5E3AA 4JI4F 3GIIA 1P9YA 1XNRJ 2AT1B 1H38A 2H1YA 1D0EA 3IGNA 4IOBA 3CULA 4RNOA 1RQ0A 1Q16B 3FUYA 5IZHA 1DARA 3X1LB 2DNPA 4DX7A 1YK9A 4X4VA 3TAQA 2BQRA 2FB0A 4IO1A 3MMAB 2XULA 1Y5IB 2W01A 1RI7A 4Y2CA 1U49A 2V4RA 2E9TA 3MEKA 4DCOB 4R25A 4NPOA 4IR1A 1QJHA 4DV7J 2ACMA 1WKKA 4IG3B 5A8KA 4E0DA 5E3RA 2D7SA 3N6LA 1KC8T 3C8YA 1KS2A 1HR0J 2PMWA 1FRXA 4XPCA 4DL4A 3MZIA 1UA0A 1FWLA 3DXSX 3R5JB 3HKWA 4G3IA 5H9FK 1N36F 2WBRA 4ILRA 4K4TA 4F0KA 3RBEA 5D3GA 2WVEA 1L3SA 1J5OB 4B3MF 3LTOA 2ZE2A 4ZPVR 2OTJS 4K5SA 2ZNYA 1C1CA 4FKXA 4ZPBA 2J6TA 2C3UA 1SL0A 5HVFA 2UU9J 1QE1A 4J91A 3TWZA 2Q79A 1SPBP 1HBNB 4IH6A 1RWXB 4LBHA 5CZXA 2BE9B 3I0RA 2H5EA 3TA0A 3M30A 4KO0B 1KVIA 1Q8BA 3EGVA 1NJWA 4CYUA 4NCBA 2J0WA 4BDPA 1ZH5A 1N5SA 3M2VB 4YOEA 2P6TA 1N5YA 3MECA 1APSA 2JEIA 3CB4A 1Q8KA 4KBIA 3P5BP 3WIVA 1XMQJ 3H5UA 5JVHQ 3G82B 2GGPA 2JWNA 5C42B 3MFIA 2UVWA 3UCGA 1S77D 3W3SA 4FS2A 3T1YF 3KK3A 3SIPB 4Z7YA 2MGZB 2V2QA 2RRAA 3SSSA 4WFXA 1C1BB 3H0PA 4RBVA 4P2SA 1JLEA 4OZ3A 4J9VA 2H5JB 4LF9F 5SZTA 1JXLA 2PD1A 4DPUA 2Q66A 2RE1A 3LP0B 2UUTA 2ZOGA 2YX7A 3I56S 2ZJQQ 1EP4B 1QSLA 2ROGA 2KFYA 3W7BA 3DLEA 2YKNA 3I9ZA 2YWWA 1Y7PA 5GAHI 4XAKA 5K20B 2I5JA 3AOAA 3DRXA 3P8BB 3RAMA 4I1TA 2C2MB 3S1TA 3T9NA 1JKHA 1KQFB 4BC7A 1IKYA 4GO7X 1FX2A 2RU9A 2M4MA 5FLXU 4NLTA 2CPZA 2HGNA 4O0NA 1RHQB 2A10A 3MM6A 2Y9HA 2D3ZA 2MY7A 3DLKB 2DNOA 3OPKA 1J5EF 3W5XA 4ZCMA 1HW8A 5IV3A 3H5XA 3KK2A 2CQHA 1UVMA 1TU0B 3N5BA 1K8AT 1ZAVA 4RLEA 2HPUA 2Z2MA 2Y0SD 3QRPA 1YRUA 4LF6F 3KLIA 2MDAA 1FJCA 1X7VA 1FHTA 2B4OA 5B0FA 2F7VA 2CJBA 5A2QY 1HBMB 2KB2A 5ETLA 3NGTA 3QJPA 3B8HA 3W64A 4EGLA 1XMBA 2BM1A 1U45A 3RBDA 4Q0BB 1S7IA 4E8UA 3LAMA 4IG0A 3WBZA 2W4CA 4ZPTR 3CMES 2E7XA 2DH9A 1BY9A 2JDJA 1YJTA 4DS5A 2CQBA 3FJ2A 4J37A 3S7RA 4DV1J 1L3KA 2VF3A 3GJSB 1RT2A 1RTJA 4V19J 4K4YA 2J6SA 1V6HA 5AJ3J 2NQPA 1MMNA 4K2JA 4DHVA 3IP0A 1JNRB 3C19A 4IO9Q 3W1YC 3P96A 4TN2A 2VBXA 4A8FA 2Y0BB 2C2KB 3NY0A 4ES1A 1TK5A 3X3UA 1VQSA 4QWEA 2CNLB 5I3QA 2MQPA 1RJJA 2FJXA 4XO0A 2EKNA 1CVJA 1HWLA 4NYPA 1MMLA 1DTQB 2EK6A 3O2IA 4FBUA 2OEJA 2XC9A 1WTBA 1KP6A 4X84A 2Q3PA 2BZ2A 1HWKA 1WOSA 3W2VA 3R7SB 1ZAWA 2HHSA 1U7LA 3C14A 3JAMY 3OL9A 3W5YA 2DH8A 2A2CA 2E5LJ 4ZHRA 5C24B 1AXQA 4GRSA 4DSFA 1EHWA 1H72C 1S4EA 2JVRA 2GO9A 1FKOB 2AGOA 3D5MA 4OI0A 2HRYA 1VI7A 1MG7A 2BE2B 1IKVA 4X65J 3M2RA 4CH7A 2YNIB 2ZBCA 3TR5A 5J2MB 4L6V3 2VG5A 1FRKA 2CPIA 3FFIA 1VRUA 1MROB 2XZDB 4DV4J 4USIA 3I31A 5KT5A 2VONA 4RW7B 2EFOA 2CJYB 2ZWOA 3DOLB 1VIOA 2UXBF 3HI9A 1R0AA 4ECXA 5IXUA 4EBDA 3AXMA 4OZLA 4UQGA 2XY7A 3W2WB 5IT9U 4F2SA 2V68A 4PXDA 2LP4A 1TUVA 4ZPCA 2YWKA 4IRKA 5ETKA 2W2OP 3G8SA 1LW0A 4O3OA 2GX8A 2XSJA 2ZD1B 2GVZB 2ZVIA 3OL6A 4C3LA 5DG9A 2HS3A 5G0RB 3NRBA 4WIQA 4ZVGA 2HIYA 2ZZTA 5A6PA 3NGRA 1Q95G 2BEFA 4X4SA 4JYAF 1WJ9A 2RDDA 2IMOA 1NDLA 3NGUA 4J9UE 3BDEA 3EGWB 5ETOA 4ES3A 3SMZA 2DGWA 4YEAA 3DU6A 2E9RX 1RHUB 2WW8A 2CXEA 3HXMA 2Y3YA 4WXOA 5CABA 3T5LA 3LP1B 3OLAA 2BMBA 1U2FA 1B0TA 1ITPA 4XIUA 2VG7A 2YPYA 4DUZF 2KJVA 3G86A 1B4SA 2HS0A 1RT3B 4DQPA 2G2OA 4HDGA 3O44A 3P49B 1WOOA 4ZOSA 1Q5YA 1RWUA 3GG1A 2IJFA 4M94A 3BSOA 1GX6A 3BH7B 2APOA 5DETA 5GMDA 1LWCA 1RTHB 2BX6A 5IM0A 1QLNA 2CPHA 4EEYA 4GMKA 1VQ5S 4USVA 4NYZA 4X4OA 5KFGA 4NZ0A 2E7WA 1NDPA 4A4JA 3R1HA 2RKIA 4ZN3A 2OFHX 4YY3J 3MM9B 1VK8A 1S6PB 4X4RA 5IWAJ 1RWMB 2W9BB 4BBYA 5DQGA 4R0EA 4QCLA 2B43A 6AT1B 1KHVA 2IRUA 1HNXJ 2OPPB 3KUEA 4OYMA 4MIBA 4FYDA 1CJVA 2F8EX 1NHKL 3POTA 1SIZA 2QSFA 4KHMA 2ATCB 2R8KA 1NLKL 2QA4S 1FXDA 1UL3A 3KDNA 9RUBA 1YSJA 2K3KA 2ADBA 4DL5A 5FIIA 3WZ0A 4LIWA 3ET6A 3IS9A 3V6KA 3Q23A 3MPVA 4CIOA 1RYSA 2XYHB 2Y1RI 2UXDF 2BE7D 4OX8A 2MKHA 4P74A 1RWWB 4RR5A 2B3TB 1WC6A 1RT6A 4F50A 5DM7Q 1F3FA 3A1YG 5D8HB 3QWUA 2EVZA 5I3UB 2CNNB 3GILA 5I42A 2OMOA 5H9FJ 1Z2LA 4WZMA 2C3MA 5D15A 2KYXA 3B78A 3PEJA 1FE4A 2YWHA 4I6YA 2V69A 2XZTB 4EO8A 3U02A 2DVIA 5IS2A 4N8OA 4NXNJ 2IM0A 3JSMB 5HLFB 3GFHA 4C8ZA 4UUWA 2UUBJ 1E6VA 1TP7A 2V8PA 4F0MA 3LGNA 2BJ3A 1VQLS 1YI2S 3AJ1A 2V63A 2V9WA 1MN7A 1Z1ZA 2HBYB 2QC3A 1OPIA 4OMFG 2YTCA 3OV7A 1I5OB 3VF0B 1WWHA 2X1AA 2UV8G 3N6MA 1Y00A 4XK8C 2ASDA 4OX7A 2POKA 5B0BA 4FS1A 1LFPA 3I82A 1IKXA 2V4JA 4ZVHA 1RWVB 2R4FA 2VUGA 3O1LA 2BJ8A 3UDCA 1Y5NB 4LF1A 5IC6B 3I4PA 5A8WB 4ED6A 2RD5C 5A8KB 3HFKA 4JV5J 3ULHA 3AJDA 4UZBA 1TQLA 4TLQA 1NZAA 3SFUA 3ZTQA 5KG6A 3M8PA 1R43A 2FLLA 3AQOA 1EKRA 4F4WA 3TUPA 5B08A 3EZOA 2K7JA 5E41A 5D3GB 1NU4A 3N9UC 2KT2A 5HROB 5KT7A 1S76D 2I38A 1C1CB 2B9EA 5HBMB 2XO7A 2CWKA 2G2YA 5DO2A 1QUPA 4ZK7M 3R5AA 3E8OA 4B3RF 4LSZB 1FRIA 3ISNC 1E6YA 3D3BJ 1QTMA 2QL9B 1DHMA 2FJDB 3JTPA 3PRVA 3PX6A 3CVKA 1DAXA 2CQCA 1OQ3A 5ETNA 4DF8A 2Y1LB 3KNAA 2JEJA 3HPOA 5GVQA 4K8RA 3VVTA 1RKJA 4ICLB 1GNKA 2FHMA 3MPYA 2A6OA 4CYUB 4Q45A 2XTJP 3ICLA 1HI0P 3BGFA 5DG8A 2IJNA 3ZXWA 5LXRA 2UUCF 1EJ7L 3MECB 2BOAA 2IVMA 4HLBA 3DXBA 5KFLA 2PE8A 3BO2A 3NCQA 2GGPB 3O3LA 1RZMA 3BS9A 5DLFA 4P75A 1S0VA 3QGHA 4Y2AA 4USKA 3S8SA 1YJVA 2VKZG 2XGPA 5CQGA 3D0IE 2XWYA 3G71S 2IYIA 2XMAA 3L4BC 4PKDB 1F2GA 4R5PA 3RRKA 3BPSP 3SV4A 5J2PA 2QL5B 1TUWA 3MF5A 1ZZFA 1UVIA 4I69A 2LLZA 2ZKTA 1P27B 4OV1A 3V4MA 5BXIA 4AQYJ 2V2ZA 2HIQA 3PV8A 1SJ1A 4OHYA 1RWKB 4NLWA 2DJWA 1WF0A 2GS8A 3R2CJ 2XSFA 3BR9A 3DLEB 2YKNB 3D1QA 4M5JA 1G6BA 4CDIA 3KHHA 3CD0A 5B0CA 3LOUA 1NXIA 2I5JB 1MWYA 3VVUA 1JNZB 1JKHB 4TU9A 4JV0A 4URSA 2RT3A 1IKYB 2E1PA 4TY9A 4LFCJ 3GSIA 4FVMA 4FVCA 1WC1A 4OZ2A 3KJNB 4F8RA 5KT6A 1WD6A 2JSXA 4A46A 1M1HA 2M0GB 3Q8QB 2DGOA 2WSEC 3FSYA 4HH1A 5HVHA 3BGUA 2DY1A 3IG1A 5J2NB 1N32F 4YB1P 4ED2A 3DRRA 4QOTA 4Y2MA 2V8VA 1R7IA 2ZBQA 1U47A 5JMNA 3BDPA 1FD2A 2DKOB 3LANA 3MMJA 2GIRA 5K8OA 3FSIA 5BYRA 3A8KA 3MD3A 2GAHC 4PEOA 4ZIVA 1N33F 1FNOA 4WU2A 1WOPA 1NAQA 3IA0A 5DDPC 2IM2A 2XS2A 4IG0B 4DR2J 4PYAA 2CJQA 4C3KA 3BN4A 2H4WB 2BOPA 4O23A 1A6LA 1B64A 4QIVA 2GNKA 2R3VA 2XCPA 5D4NA 3G2XA 1GTHA 1RT2B 1V9OA 3NLCA 3CJKA 3C6TA 1EKSA 2KRBA 1OSCA 5LSRA 3DRSA 3D4JA 1NM2A 1YJUA 2J8SA 3THVA 4TQRA 4WKRA 1VBXA 2IDLA 5DRKA 2EFVA 7AT1B 1W26A 1FJGF 1T05A 5SUHA 1W2BR 2HVDA 3MR7A 3JTOA 4PWDA 4NI2A 3DOMA 4JI7F 1XN9A 1HI1A 4PPDA 3K0JA 1Y3KA 3D9BA 2J0SD 1DTTA 3FQLA 3QFHA 4YHHJ 3ZZOA 4NA2A 1RAEB 4IQXA 1HPZA 1TV6B 3O6QA 3OJSA 1PSDA 2A6MA 3MR2A 1OPZA 2MJNA 4CO5A 4Q44A 5T7LB 3W2VB 3PW4A 3FVYA 4NOHA 1C0TA 2P9CA 1RT4A 5IQ6A 3FZBA 4NLUA 1DLOA 1FJEB 5AE1A 1RBAA 3GCWP 4NX9A 2M88A 1HLWA 3MUMP 4LF7J 4DL0C 2A0FB 3W63A 1J27A 2DNRA 2VFTA 3M2RB 3Q24A 2IVFB 3PJXA 1VC0A 1WHXA 3VAMA 2V5HG 5HMYA 3OL8A 5ADZA 1S12A 2VG5B 1DQ8A 3KLFA 2W7OA 1VRUB 1BMQB 2B4UA 2KO1A 2OI2A 3GV5B 1XNRF 1GEHA 1UMJA 2I9SA 4RUHA 5KFHA 3HMJG 2HHVA 1DRZA 2MZ1A 2IM1A 4KIAA 1R0AB 2HWHA 1QY7A 4OZ1A 2QA2A 4NEYA 1PCAA 2XMJA 4U96A 2QA4G 5HMWA 2JFKA 5KAKA 1NK6A 1LW0B 3FEXB 1UKUA 4OZNA 2XMKA 2YPZA 3KJFB 4TQSA 4LSNA 1LK7A 2KFZA 4A47A 1F60B 3GQCA 5D6GA 3KK1B 1HR0F 1CQMA 1FX4A 2FPHX 4P52A 3KLEA 4K4UA 2QJ3A 3QAUA 2VG6A 4OL8A 5KG2A 5J2QA 1Y10A 1RAOA 1TELA 5KTQA 3M32B 1BWEA 3OW2R 2HGLA 1YTYA 2AIRB 2ZH3A 2VG7B 1KDNA 3R5BA 2Z2LA 4WU3A 3QO9A 2RUSA 1HBOB 3TQ1A 2H3EB 2MPUA 4QYZK 3HFZB 4I64A 4RW9A 3V6JA 4C0BA 1ZETA 3OR1A 2FHJD 1SJ4P 3CCES 2AHOB 3M9MB 2L3MA 3VAKA 2VDIA 3ITHB 2M3DA 1XMOJ 2GW8A 4WE1A 3D6HB 5GAGU 2OLWA 1FVSA 4B3OB 1KKHA 4DR6J 1BC6A 3R8YA 2CVEA 1CS4B 4B3SJ 1WC4A 1D09B 2EBGA 2RF2B 3FBFA 4LRBA 4GVBA 2MLYA 3VV2B 1KOOA 4X4NA 3U1MA 3CCQS 2XYPB 3RRHA 3IFEA 5K9FA 3PDNA 1M5VC 4DSIA 1UEUA 2D3O1 4ELTA 4FKYA 1YKWA 4Y28C 1YG0A 3UD5A 2RQKA 2QT7A 1OY9A 2NUUG 2XHCA 1TVRA 3LQVA 3HD1A 1U6ZA 1UP1A 5EGYA 4G65A 2IA6A 1CJVB 1NSQA 3POTB 1HWUA 3BYPA 3CO9A 5JVGQ 1N8RT 4OZJA 2L08A 1VQNS 5EWFA 4F04B 4U8VA 5L38A 3ET6B 1SKUB 3BSCA 4DQRA 1U09A 1B0VA 2F8HA 2EW9A 2CVIA 3H4BA 2P9EA 2F9DA 2OIHA 1N52B 2BUNA 3A8JA 3CJ8A 3JS9A 4PG7A 1RT6B 4RNFA 2MZQA 4DOZA 1UWBA 3I5AA 1X0PA 2XNRA 1EARA 1ZA2B 2FD2A 1IR2A 3FRYA 5A76A 5I42B 2HBRB 5IV4A 1GT8A 2LQ9A 2Z58B 4Y2KA 3SCIE 3DDIA 4WK1A 3EYZA 2J5AA 4NXMF 2QFIA 2R7VA 4BCAA 4LF2A 3RW6A 2P5VA 1G4CA 3I4HX 3N79A 4QWBA 3D67A 1RT7B 4OYXA 1YQHA 5CH7B 2ZOFA 4FF3A 4IFYB 2LDYA 3QFWA 4N7TA 4DR3F 2UUWA 5CYQB 2U1AA 1S9GB 2CPDA 5KFOA 2RHSB 3TOQA 2KJWA 1M1KT 3QJJA 1IKXB 1WNEA 2WCXA 2I6WA 2ZBIA 2H5IB 2XMTA 3NL0A 1URNA 2WOMA 3QNWB 4G1QA 1BHNA 4I67A 3VAHA 4ITSA 4DPYA 2CIMA 3OD2A 1YX2A 2AGPA 1Q1KA 2V8HA 4DV1F 5L1KA 2XO6A 3QSYB 3GFXA 3I5BA 1H6KX 4J7CA 4QW9A 4DS4A 3I32A 2XHWA 4E98A 3V5RA 4TY8B 3K7RA 5AJ3F 3MI7X 1UFKA 4AL6A 1REGX 3K8WA 4G1PA 5AXKA 1BD6A 5ETVA 2CFXA 2JLGA 1JLBB 3SQOP 1JJHA 1WORA 1C4CA 1QTNB 4F4AA 4MFBA 2AZ1A 5E0OA 3I9V9 5BYQA 1V3ZA 2DGQA 3QMQA 4RUBA 5FLXY 5A8RA 1M5SA 4QJVA 2Z0GA 2X7IA 6FD1A 5A0YA 5KFPA 4Q8EA 2DR9A 1QSYA 1B99A 4GO5X 3EJMA 1OIAA 4PUOA 3RAQA 2M52A 2QSWA 3IM8A 2Z56B 4R8UB 2HSEB 2JC1A 4USTA 4KGZB 3VGVA 2E5LF 3BEGB 1MU2A 3RB6A 1SXLA 2CJAA 2CAJA 2R7OA 4OHZA 3R6GB 2CQGA 4PG5A 1Q79A 5D0EA 2E9ZA 3MAHA 4ZVSB 4X65F 3BGLA 3DGPB 2K8GA 2FHKA 1D9DA 3Q8RB 4DLGA 3WC0A 1JK9B 3EZ5A 4P7VA 4CLYA 2NYIA 3HVTA 2G4BA 3GIJA 2BJ9A 1S6QA 3UD4P 1OJ4A 2CJXB 5DM6Q 2GAGC 3LUYA 5GADU 5J2PB 2CQ0A 1REVB 3CGIA 4HT5A 2QMXA 1U2RA 4NMXA 2RIJA 1YWXA 2DNNA 2XBPA 1X5TA 2CPYA 4NZ6A 4PR6A 2VA2A 5U47A 3DHWC 3CDUA 4J9KA 1EIYB 5KOXA 4AXJA 1JLQA 1RT5B 2NREA 1QAYA 3E51A 4N77A 3MCSA 2ZM6J 4U95A 4N56A 4OX6A 3HVWA 1S1VA 2LU2A 1VK3A 3DLGB 1HARA 3IN5A 3KJQB 4FYXB 3HT0A 2KT3A 4GC7A 3ONQA 1LXJA 4K5RA 5CD4H 4DR5F 2R7WA 4ZVTB 2RS2A 3BQ2A 1K0TA 1WHYA 1LW2B 3IG1B 5LL6d 3DRRB 6FDRA 4LVNP 5L1JA 2Z8QA 4DU8A 4DU7A 1HYSB 4TVAB 4KQZA 3MPUB 3CCTA 3V4IB 1S5ZA 4U7UK 3UVJB 4M5DA 2V0NA 2FZCB 2DHHA 2MQNA 3CCSS 3TZWA 3HHEA 2X1GA 3CCWA 2XMUA 1RXOB 1S72S 2HHTA 1RP5A 2UXBJ 3EXYA 5HI7A 1WSRA 4ZCIA 3G6ES 4ETZA 3IRWP 3KHGA 2H65B 2MKSA 2EPIA 5B0GA 1VBKA 3EMTA 2VODA 3MM5A 3CJKB 3C6TB 5IT9Y 3GFYA 4W98A 3DRSB 2GV1A 3FZ2A 2NZCA 4Q7AA 2DPIA 3NBPA 2PGCA 1XBWA 2KN4A 2R9LA 2IFXA 3S01A 3D28A 4JYAJ 1CC7A 3OFGA 1T05B 4CO2A 3MEEA 2KVIA 4PWDB 3AA8A 3CJ4A 4NI2B 2BW7A 4O3QA 4X4QA 1SJQA 4BLGA 3TQEA 3Q8PB 1DTTB 2R2RA 4HTIA 2EXUA 1Q7YT 3A8IA 1WF2A 4IRDA 5DZ7A 4DXLA 4A8QA 2HVIA 4CH1A 4ZP7A 2LFVA 1SV5B 1S1TA 2JFDA 2C2NA 1FI4A 1DLOB 1NB7A 3T5HA 4WP9A 1S9EA 3Q8YA 2DIUA 3H2LA 2YKOA 2AU0A 4ZCLA 3T1AA 3OSNA 1IWAA 2A3JA 4QYZJ 1VRTB 3RJMB 3DLBA 4IFVA 2YWFA 3UDEA 2KH9A 4FN5A 5KFMA 2FJWA 3KLFB 2GHPA 1VDHA 2PFDA 3ZZUA 4LR9A 2YQ1A 2DR8A 2V8GA 4JB8B 3AD7C 2I1RA 3IRXA 3KJVA 1JLGB 4IUFA 3MEDB 4DBQA 1S6UA 1WHVA 1ZM3A 2JVOA 2F3JA 3G8QA 3DRPB 5ETRA 2OEKA 5D0GA 1RTDB 1X4CA 3PEHA 2DBBA 2V2VA 4LVOP 2W9AA 3T1HJ 1RSCA 4M5LA 3K58A 2FZGB 5HSPA 4C2MA 4FZVA 1PJ7A 2UXDJ 4JV5F 3RYLA 3P4UB 2GA7A 1HHTP 4DL3A 3ADAC 5GAGI 3H40A 4DN9A 2AYEA 1SH2A 2MLZA 5J2QB 1ZZNA 3FBCA 2CG4A 1AUDA 2QIFA 4HI2A 2XLIA 4CTAA 3N6NA 1L5UA 3QO9B 2PEBA 2F1FA 2ZBPA 4NLPA 4HL9A 1S59A 1ZYQA 2C28A 5AXMA 3OR1B 1TAQA 4YMEA 4YN3B 2HNDA 1XQIA 2BR0A 3GONA 2ROEA 4KYZA 1RK8A 2LA6A 1VBYA 4KC5A 3I96A 2B5JB 3JSBA 3GZ7A 2P6SA 3VZIA 3KMSA 1UVLA 3SBMA 4XDDA 4RBUA 2VPXB 4GVBB 1HBUA 1JQGA 2DO0A 2GZOA 3T6JA 3GJTB 4ZVUB 2HFOA 2YNFB 1U0HB 1SKWA 4ED4A 5KFEA 5AXLA 2ZUAA 3ISZA 2V8DA 2AYMA 1HQEB 1F9FA 4HDHA 3DDKA 3QZ7A 3LGMA 1YRXA 2MLXA 2HRUA 1I3OB 4M5NA 5DDQC 5BR8F 5H1SV 3ILOA 3KKFA 4DX5A 4O44A 4WWSA 2QFJA 1CJKA 3PYDA 3BB5A 2QTWA 1XR7A 1S10A 5CCLA 3SI8A 3M6VA 1FRMA 1SL2A 3HVAA 4KFBA 5T14A 3AH6A 5KFFA 4MK9A 2ZH5A 4PXEA 2RUGA 1S1UA 4OQJA 1LK5A 1YJ9S 2W2NP 3CJSA 3D0HE 3BF4A 1U1NA 4B3RJ 2R8IA 4ER8A 3MMCB 3NOGA 3W65A 3H20A 4I6AA 3M6UA 3QAEA 2B51A 4KT0C 3H42A 4LFCF 4RW6A 2QZ8A 3S6EA 2LEPA 2YY3A 1VQMS 1DQAA 5F8LA 1VCTA 1D9FA 4WFNQ 3C46A 1WF1A 4FYWB 2IHR1 3CJ2A 1FRJA 4UT4A 4B08A 1YJWS 1RTIA 3PFOA 5KFSA 1WC5A 4YDDB 2VV5A 5HQLA 3C6UA 1WSVA 4DI6A 2CKWA 2AJFE 3R6LB 2DXDA 3B82A 2B7BB 2M2BA 3EPGA 1RHRB 3CTRA 4B3TF 2EFNA 1RYRA 3M8QA 2PI4A 2ROPA 3SYZA 5EDWA 2UZAA 3MM7A 1XIQA 4GVLA 2Y1IA 1DBDA 4CH0S 1Q82T 5DLGA 1H2TZ 3RBXA 3ENAA 4MK8A 5HMXA 4ENOA 4LQ3A 2DY9A 4IOAQ 4J9RA 3KNGA 2VQFF 3NOCA 1AZSB 3D66A 3JTNA 1YZ7A 2MJUA 3TVYA 4FNHA 3BBFA 3ZTRA 2VL1A 2EC2A 2UVVA 4IH7A 1NCLA 1N6QA 4MFBB 4TU8A 4DR7F 1U48A 3BPDA 4CRJA 3PY8A 2EFQA 2PSZA 4RUAA 4YHHF 4O4GA 2CZVC 3KTQA 4CWBA 4KPCA 3CSKA 5DDRC 5A0YB 1IR0A 1FEEA 2X1FA 1RLCL 4CLUA 1MSWD 1UVNA 4EFAC 4CQ1A 2MHEA 2BABA 4OJ3A 3DI6B 1F1BB 4CT9A 3HJVA 4CNZA 1M0SA 4QYRA 5GADI 2FJEB 2IRYA 3GCXP 4KV8A 5DS7A 3TZYA 2CJ9A 4NASA 1NJIT 2YX1A 4QQBA 1KBRA 4ID5A 2C2RA 4LF7F 1S1WA 1N33J 3E3XA 1FO1A 3KOAA 2CQ3A 5LMUF 3NNAA 4DFKA 2R8HA 2GJFA 3HVTB 1S6QB 1FKPA 1U0SA 3ZO7A 2OTLS 4WPAA 1NJZA 2ATLA 2VOPA 4P6QA 1UETA 2OSQA 4LSLA 2F4VJ 4FYVB 4JOUA 5IQQA 3FEZA 1X5SA 4C0HA 3AODA 2FVQA 1X0FA 3DDNA 3KHRA 3DU5A 4IKAA 5KT4A 4I2QA 1KLMB 3H98A 3MCOA 1C0UA 1FJGJ 4RW4B 1XNQJ 4DL7A 3KUHA 3BKFA 1W25A 4DFMA 3NAHA 3EWGA 3W9JA 3G6YA 1PYSB 2DNQA 1S1VB 3M2UA 2AZ3A 2V4QA 1WUUA 3KLGB 3R1LA 3GG0A 2DCUB 2FZKB 3LP2B 1NHVA 1CSJA 2VH7A 3FEYB 2PFFB 5HN0A 5KG0A 4F0HA 2M8DB 2ASLA 3RGIA 4UOHA 3K59A 2E5JA 1IR1A 3MMBB 1O8BA 2DXEA 1EX8A 3HK2A 1TUGB 3RAXA 3C15B 5JXSA 3D54A 4K4VA 1DURA 1TTHB 3HZGA 5F3TA 2N4CA 3OJUA 1N5QA 3SDEA 5LJ5Y 3VALA 2HQDA 1Q0NA 1XMOF 1WKJA 4F2RA 3NGDA 3L9ZA 3PKMA 2RS8A 4DFPA 1GXLA 4DR6F 2MKCA 4B3SF 1N56A 3L09A 2QX0A 3W5ZA 1HQ2A 4ID8A 2YXLA 1UCNA 4QIEA 3DRYA 3M8WA 3O5TB 1FK9A 2Z2YB 1PC4A 4EO6A 4X66J 2DHSA 4JBCA 1JMTA 4Y65A 5DDOC 3R2DJ 2FJBB 2XLKA 1PC5A 3NNCA 4KGKA 3QBCA 1WACA 3CE8A 2LXIA 4ECSA 3MM5B 3IBFB 3PKYA 2NLWA 5CYMA 4IRCA 1WG1A 4ZS6A 3A3NB 4KHRA 3J7YU 4CLLA 2ZH6A 3E01A 2YKQA 2VASA 5KFDA 4J9SA 2HEKA 5J1NA 1Q8IA 3TJAA 3CPWR 3AT1B 1X9MA 3UR0A 3JAMU 4CO1A 5J1PA 3PZPA 2GCFA 4EYHB 5HP1B 4NA3A 4UTGA 3CDEA 3AOBA 1KR4A 3VCDA 2UP1A 3QLHB 4QU7A 3GP9A 1VGYA 1GMVA 2K2PA 4H4OB 4Y34A 2KXHA 4LJMA 4ZJOA 2DGTA 2XG8A 3OT9A 1S1TB
chains in the Genus database with same CATH topology
3JTOA 3FGVA 4MKAA 1JX4A 4PWDA 1ULRA 3DOMA 4JI7F 4K4XA 1XN9A 2ILZA 1HI1A 1FKPB 3DOKA 1U1QA 4PPDA 3K0JA 4DQIA 3DM2B 2VFUA 4QZVB 4AQYF 3TAPA 1Y3KA 1JLCB 4DDFA 1TKXA 3R5DA 2J0SD 3K5NA 2WBMA 1DTTA 2ZDOA 3FQLA 3VR1A 1VS3A 3ZZOA 4NA2A 2XNQA 1O51A 4IQXA 1HPZA 2V9KA 1T8EA 3DYAB 1TV6B 3O6QA 5KFBA 3OJSA 2RSQA 4N41A 5F8MA 2HHUA 1PSDA 4BC9A 4FF4A 2OSRA 3OTOF 5GAEI 3JSRA 4WIIA 3T9ZA 2FHOB 1OPZA 2MJNA 4CO5A 2MXYA 4Q44A 3MR2A 4CT8A 2IAJB 3LPYA 2J9DA 1FD8A 5T7LB 3QZ8A 1FXRA 3W2VB 3PW4A 4C4WA 3FVYA 2JZ5A 1R8BA 3OUYA 3HT3A 2R7UA 1T02A 1R8PA 1XR5A 4NOHA 1C0TA 2M8HA 3EZUA 2P9CA 4YB6A 1D1UA 4DMZA 1RT4A 5EX0A 2FVSA 1H7XA 2JEGA 5IQ6A 3ZZPA 1U24A 4U67Q 3E2EA 5FJ4A 1HMVA 4BS2A 4L72B 4I2QB 3V81A 2A2DA 2RU3A 4R5PB 3FZBA 4NLSA 2HFZA 1N5VA 4NLUA 2J76E 1DLOA 1T03B 3TANA 3GV8B 1FJEB 1IQZA 5AE1A 1DTQA 2HQ3A 2YX4A 3R3TA 5DG7A 2DTJA 3DCAA 1LWEB 5T41A 2UVRA 1FXLA 1IJEB 3MTKA 3CEDA 4NX9A 2M88A 1JLFA 2LYVA 2V94A 3QGPA 3IRXB 4PXCA 2J7KA 3MUMP 3KJVB 4ED8A 2PA3A 2OPRB 4DL0C 2MQMA 2KM8B 4DUYF 4OJGA 3I55S 3VAJA 2DNRA 2N3LA 2VFTA 4K2XA 4C97A 2MZSA 4LQ9A 1QM9A 1L3VA 3M2RB 3SSQA 3Q24A 2Q1LA 2IVFB 3PJXA 1UJ6A 1WHXA 3VAMA 1VC0A 2V5HG 3TA1A 5HMYA 5KFRA 3M2UB 4C0OC 3OL8A 5ADZA 2NR0A 5C5JA 3PX0A 2VG5B 2DHXA 1DQ8A 2GMHA 2AX1A 3KLFA 2W7OA 3MGJA 1VRUB 2B4UA 2L48A 2ZDPA 5KFQA 4UW2A 2KO1A 3GV5B 3SSRA 1XNRF 2LCWA 4HH0A 3H8YA 2KRRA 5C24A 1UMJA 2F8MA 2I9SA 2MQOA 4RUHA 2XI3A 5KFHA 3HMJG 2N4DA 3ZC4A 2HHVA 2RVJA 2I0XA 4DQSA 1DRZA 2MZ1A 2IM1A 2LDIA 2RQCA 4KIAA 1R0AB 2HWHA 1U1OA 2BE2A 4B9NA 2BRKA 1QY7A 4OHXA 2LA4A 2IC3B 5AXNA 4OZ1A 3EGNA 1WEXA 4ERDA 1HWJA 2QA2A 3GFZA 1KEKA 2R2SA 4MIWA 2BM0A 5J2MA 3DNCA 3CDAA 2GFFA 4NCGB 2XMJA 3H2UB 2MYFA 2VA3A 2KXNB 4C8NA 3MR6A 5KFVA 3HHLA 4AUKA 5D4PA 2QA4G 2AYBA 5HMWA 2L9WA 2ALZA 1MROA 2JFKA 2BYCA 4M1KA 3I87A 1LW0B 2CYYA 3FEXB 5KAKA 1NK6A 3WC2A 3VQSA 2ZC3A 3RU0A 1UKUA 3CCJS 1N0UA 1RT7A 4OZNA 2C3YA 4G6VB 2XMKA 2PA8D 1UVKA 2MZJA 4RW7A 5AE2A 4IFYA 4NLRA 4WCEQ 4TQSA 4DR2F 4LSNA 3DOLA 1LK7A 3J7A1 2KFZA 2J9DE 4WFZA 2AGQA 4A47A 5JJBA 2MKIA 1F60B 5CYQA 5E2QA 3M1VA 3PW5A 3MAQA 2LMIA 2DNGA 3U1NA 1S9GA 2M70A 4KKOB 3V6HA 3CCMS 2Q6BA 5LT5A 3GQCA 4OI6A 5D6GA 4A8YA 4QU6A 1N54B 3KK1B 1NJXA 2J0QD 3RR7A 4LFBF 1HR0F 4A8KA 1CQMA 2FPHX 3KLEA 4K4UA 2HNDB 4I56A 3MM8A 1P9QC 2CQPA 3KWMA 3J81Y 4DFJA 1ZBTA 3QAUA 1Y3JA 2VG6A 5FDLA 2DPJA 2W9CA 4ED5A 3QIDA 4OL8A 4G1IA 3CWJA 3OTBA 4B9VA 5KG2A 5J2QA 5JUMA 4R0JA 5LSLA 4URGA 3J80Y 3Q0AA 1FDDA 4WFBQ 5KTQA 3M32B 1BWEA 2FLPA 3PHEA 2IMWP 4RUCA 3OW2R 1UFLA 2W4DA 4H4MB 3GYNA 2HGLA 4OLOA 1YTYA 5G0RA 1FCAA 1GH8A 2ZH3A 3UCZP 2VG7B 3R5BA 1TKZB 2Z2LA 5B0EA 2JOQA 5LJ3Y 4WU3A 3QO9A 2HMIA 2BXJA 2I8EA 1TL5A 3K5LA 4HEA9 3VAGA 4C11A 1HBOB 3TQ1A 1YVFA 3GB0A 1H2VZ 5HQ8A 2MPUA 4I0WA 3A8EA 4EWTA 1HBUB 4GKJF 4I64A 4RW9A 4KTQA 3V6JA 4C0BA 5EWEA 3M9NB 1ZETA 5CYMB 3OR1A 5F0UA 5EHHA 3RB3A 2FHJD 1SJ4P 5E7OB 2HVZA 3CD6S 2DD8S 2IM3A 2PT0A 1G7CB 2K1RA 3CCES 5H9EJ 3MMAA 4Q2MA 3M9MB 1N4LA 1X9WA 2L3MA 4U6PA 3VAKA 3PW2A 1SI9A 2XGQA 2H9ZA 2KM8C 2YWEA 3ITHB 2M3DA 4TY8A 2GW8A 4UY85 5K14B 4LF4F 4OX9F 4WE1A 3E01B 3V2UC 1AROP 5GAGU 2OLWA 1FVSA 3LP1A 3MD1A 5J1EB 2QEXS 4B3OB 5L9XA 3IGVA 2XLJA 5M2RA 3RB4A 3AA9A 1HQUB 2K7KA 4URQU 1BC6A 2CVEA 5BJRA 4O4RA 4P7TA 4DF4A 2YKPA 5KFCA 2GO8A 4IG3A 1P1LA 1Q4RA 2J7UA 1JLBA 2ZHBA 2EBGA 2RF2B 3F44A 4WJBA 1TAUA 1Y5LB 3GIKA 1KOOA 4X4NA 1FNMA 4I6WA 1H98A 3U1MA 1RT3A 4EZ6A 4CO4A 3CCQS 1RDRA 1EETB 4NCAA 2X51A 3RRHA 3IFEA 2PMZD 4DSKA 5K9FA 3PDNA 4UOCA 3MHYA 2O01C 1M5VC 2CPJA 3SCJE 1HL6A 4DSIA 1YRTA 1LWFA 1UEUA 4ELTA 3BSNA 3V6DA 2EG2A 3H5SA 2KFNA 2FC9A 4YFUA 1FTCA 4PG4A 4A8SA 2BJDA 2BV3A 4J9OA 2OPQB 3SV3A 2AJQA 2D41A 4Y28C 1YG0A 2W8KA 5CCMA 1IXKA 4O44B 2WB1D 5KOWA 4TU7A 1X8DA 2RQKA 3OSPA 3NMAA 2QT7A 3IWLA 3NNHA 2B56A 5K8MA 1FERA 3TVZA 1UJ4A 4DSEA 2NUUG 3BN7A 4ZP6A 3DOKB 1TVRA 4DV3F 4OJ1A 3MUVP 4NLOA 3L3CA 1FTRA 3LQVA 5F8NA 5DQIA 4NLVA 3PX4A 1U6ZA 1UP1A 5L1IA 1KQGB 1TKXB 4F4YA 5EGYA 2KYZA 1S4FA 2MKJA 2IA6A 4K4SA 2D74B 1HPZB 4K4ZA 2DNKA 1NKBA 4R8UA 3POTB 1HWUA 2VC0A 1WEYA 1HBNA 3CO9A 5JVGQ 3HHDA 2DITA 3I0SA 1N8RT 2EC0A 1S1UB 4OZJA 2L08A 3TP2A 5KFTA 1VQNS 3VZHA 4DV5F 1KN6A 2GHVC 5EWFA 2YNHA 2EG1A 3MM9A 4ES2A 2Z4PA 3UDLA 1YGYA 2NUHA 1C0TB 2HNZA 1YBAA 5L38A 2LXFA 1RT4B 2EBEA 1T7PA 1S6PA 2DHAA 5M2UA 3BSCA 1HMVB 4OLPA 3B4DA 4ED7A 2ZM6F 4DQRA 2OMLA 3V81B 1U09A 2BANA 2AJ0A 4KO0A 2ZH9A 1B0VA 5E3PA 3EX7B 2F8HA 4RNNA 3HLUA 1AFIA 2EW9A 1XWLA 2CVIA 4J5OA 3DGPA 3ZFVA 3H4BA 2P9EA 5KFAA 1T95A 3DHXA 4RU9A 2F9DA 4F3OA 1VLYA 1N52B 2OPPA 2OIHA 3QPIA 1OS5A 1VC6A 3MFHA 5D78A 4ECQA 4C7QA 2CQ4A 4AYBD 1ZM2A 1JLFB 1KOHA 3HHNB 4DR4F 4WYLA 2BUNA 2FUG9 3KLHB 2XY5A 1KLNA 4PG7A 1RT6B 4RNFA 2MZQA 3AB4B 4DOZA 1WEZA 2KKHA 2ZJPQ 1VC5A 2HHHF 2HNYB 1UWBA 4A48A 4QPTA 1XERA 3I5AA 4O0IA 2F9JA 3ENVA 1HA1A 2KI2A 2DT9A 1X0PA 4X64F 3B4MA 2XNRA 2D9PA 1S6OA 2FD2A 3NAIA 3AB2B 1IBMF 3FRYA 3QIPA 3CCVS 1SL1A 5I42B 4ECRA 1X4BA 2DISA 1REVA 2WTFA 1I6JA 4CZCA 2UV8A 5E5NA 3BO4A 2DRBA 4ILLA 2NSCA 4WFYA 2DNLA 4JI6F 4YP3A 1F5BA 2XWXA 1GT8A 4W90B 1NRKA 2LQ9A 1RTIB 2YNGA 4MAKA 4Y2KA 4I7FA 2BRLA 3GYXB 4Y0FA 3UE2A 4DV0F 2W24A 2R8JA 2ZJRQ 3CCUS 3TAMB 3NS6A 3SCIE 5DQHA 2MGZA 2O67A 4KB7A 4NYOA 4WK1A 3C6UB 3EYZA 2J5AA 5KFUA 4NXMF 2XEXA 4QWAA 1HD1A 4B9LA 4K50A 5D4LA 2R7VA 4RWXA 4BCAA 4I2PA 1TL3B 3K5OA 2GQCA 3RW6A 4U7CA 4I4BA 4KHPF 3IC1A 3BGRA 2P5VA 2E5GA 4B02A 4ZPWR 3HM9A 2N82B 1KQKA 1HNVB 5MAOA 1RT5A 1BGXT 3PO4A 3I4HX 3N79A 4ED0A 2ASYA 1NH7A 2IA0A 4AXIA 4ECWA 4QWBA 3FDSA 1S1XA 1A7GE 3CIMA 1SJ3P 1K1QA 3LP0A 4YDXA 5B0AA 1RT7B 2FGOA 4PG8A 2EK1A 1YQHA 3M4XA 4DWIA 1UVJA 5CH7B 2ZOFA 2M9KA 3KFWX 4DV2F 4FF3A 4IFYB 3OL7A 2G13A 2LDYA 4LSNB 1EP4A 2DR7A 4H4KC 3CXCR 3HO1A 5K8NA 2E1MC 3DLGA 4QBUA 4IH5A 2JC0A 4ATNA 2JX2A 2BW2A 4MJKA 4DR3F 3TA2A 2UUWA 5CYQB 4X4PA 4FP9A 1NK0A 1K1SA 2U1AA 5HLFA 3JSMA 2J8AA 3H4DA 7FDRA 1S9GB 2CPDA 1SH3A 2YVSA 5KFOA 4V19X 3TOQA 2KJWA 1M5PC 1YIJS 1YITS 4N47A 1M1KT 4Q2LA 3NGKA 1NK9A 4DN0A 3QJJA 2ZUGA 3KLEB 4WZQA 1IKXB 1BQNA 1WNEA 1WHWA 2WCXA 2ZBIA 1VJWA 4ETXA 5FDLB 2VG6B 1CC8A 2W9CB 3K5PA 5CYJA 5E3AA 4JI4F 3GIIA 2XMTA 4OZ0A 3NL0A 1URNA 1LW2A 2WOMA 5F3ZA 2GJIA 4G1QA 2WB4A 3M8RA 4I67A 1H38A 3FSXA 2FLNA 1D0EA 3IGNA 1KONA 1C4AA 3VAHA 4ITSA 1KQSR 1OWXA 4IOBA 2CIMA 3CULA 4RNOA 1RQ0A 1Z4UA 1Q16B 3CT9A 5IZHA 2KHCA 2UVUA 5KFKA 1DARA 1F0XA 2NSBA 2AGPA 1Q1KA 3X1LB 1LFWA 2V8HA 2DNPA 4KSEB 4DLEA 1JJ4A 4DQQA 1SBRA 1HYSA 4DV1F 4ECTA 3PM9A 4RW9B 5L1KA 5L9NA 2Q43A 3H59A 4QIWD 4X4VA 3V4IA 3TAQA 2BQRA 2FB0A 3GFXA 2RILA 3I5BA 1UA1A 2AX0A 1H6KX 1NHUA 1N6QB 3G9CA 1VHFA 4IO1A 3MMAB 4QW9A 3ENQA 4DS4A 2RRBA 4QPXA 2XULA 1S0MA 1Y5IB 3I32A 1RI7A 2XHWA 3CMAS 2CQ1A 4E98A 3CC4S 1BLUA 4Y2CA 3V5RA 3PIOQ 4ZVFA 4TY8B 1U49A 3K7RA 5AJ3F 1JLAB 1X5OA 3MI7X 2V4RA 3UD3P 4EBEA 4WE1B 3QGGA 4A8XA 2E9TA 4RWWA 2C2EA 4ZVEA 3MEKA 2BJEA 4R25A 4NPOA 4AL6A 4IR1A 3QJLA 2HHWA 1QJHA 3K8WA 4G1PA 2KT5A 1BD6A 3HF5A 1JB0C 5AXKA 4IG3B 5A8KA 4E0DA 1IM4A 4QIGA 2CFXA 5E3RA 2D7SA 2JLGA 2CRLA 1JLBB 2KU7A 3N6LA 1FRLA 1QAXA 1JJHA 1KC8T 3N28A 3OLBA 3C8YA 1C4CA 1IKWB 3OVSA 1YHQS 1HNIA