1FRMA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCAPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frmA00
1AXQA 3OR2B 2PDAA 5BYRA 2WSEC 1PC4A 3MMCA 1SJ1A 1JNZB 1FRHA 6FDRA 2WSFC 1F5BA 2UZAA 3OR1B 2C42A 4DHVA 2PMZD 1GAOA 1BLUA 3MMAB 1FDNA 3MM7A 3MM6B 1B0TA 2XSJA 1WTFA 1H0HB 3MM5A 1HFEL 3MM8B 1K0TA 2FGOA 1Y4ZB 2Z8QA 2WAQD 2FJEB 1Y5LB 1Q16B 1XERA 2FDNA 4OV1A 5BYQA 1SIZA 1ROFA 1G6BA 4L6V3 1FDBA 3EXYA 3OR1A 2PA8D 2C3YA 1C4AA 2FJDB 1KEKA 1FCAA 1G3OA 7FD1A 2C3UA 1GT8A 1DURA 1JB0C 2C3OA 3HKZD 4Y28C 1KQFB 5CH7B 4XDCA 1FRKA 1FTCA 1FXDA 6FD1A 5FD1A 1FD2A 4XDDA 3MM6A 4CI0B 3MMBB 7FDRA 2FJBB 3MM9B 1FRJA 1JNRB 1RGVA 1IR0A 2FJAB 5E7OB 3OR2A 1FRMA 2FD2A 2Y0SD 2IVFB 1GTEA 1C4CA 1F5CA 1FRXA 4AYBD 1CLFA 1H7XA 5L8RC 1FEHA 3GYXB 1BWEA 1FDAA 1DAXA 3MMAA 2VPWB 3MMCB 1BQXA 2C3PA 3C8YA 1VJWA 1D3WA 3EUNA 1FF2A 2VKRA 3MMBA 2VPXB 3MM8A 1FRIA 4OMFG 3MM7B 2XSJB 3IR7B 3MM5B 2WB1D 2V4JB 1Y5IB 1B0VA 1KQGB 3IR5B 3LW5C 2VPZB 4RKUC 1R27B 1Y5NB 2GMHA 1FDDA 2O01C 1GTHA 3IR6B 1FXRA 4YDDB 3PNIA 1H98A 1IQZA 5BYSA 2WSCC 2GMJA 2ZVSA 1PC5A 1A6LA 4ID8A 3MM9A 2C3MA 2V4JA 5CHCB 3EGWB 1DFDA 1BC6A 1FERA 1SIWB 4KT0C 1F2GA 1FRLA 1H7WA 2VPYB 2V2KA 4XK8C 1B0PA 1BD6A
chains in the Genus database with same CATH superfamily
1UA1A 5EWEA 4P2XA 1I94F 3BEGB 4DR5F 3B4DA 1YSJA 1ZPVA 1FDNA 1NK5A 3UN5A 3OD2A 1IKYA 1DTQB 1MMDA 2XYHB 3M2RA 2XZTB 3BYRA 1S6UA 3R1HA 1KBRA 5KT5A 3GFXA 4OYWA 4NXNF 2GQQA 1TFYA 4XDCA 3RAQA 4EBEA 1HD0A 1UKUA 3J81Y 3CIZA 2FJAB 1R8BA 3F44A 1WF1A 3WC0A 2W2NP 3W9HA 4LSLB 3AB2B 3C46A 3BB5A 4C0BA 3UQSA 2CNOB 1X5TA 3VVTA 4O44A 3W2WB 1FRIA 1FWLA 2LQBA 2KXNB 1IBKF 5CYMA 5FIIA 3FKBA 1VK3A 1JLBB 1IBLF 2AGOA 5D77A 2V4JA 4CYUA 1UFKA 5D0HA 2PN6A 2H3EB 2V2KA 2ZZMA 3B82A 1GEHA 3MCNA 2QA4S 4DLGA 1N5YB 3R2CJ 4TN2A 1C0TA 2IY5B 4LBPA 4ZDNA 1QAJA 1B7FA 4NLVA 1U0HA 4PEOA 2MQPA 2L9WA 2NXNA 4M5IA 3NLCA 2G0CA 5JXSA 2MZTA 4Z2XA 3RBEA 3G87A 4Y3CA 2HZCA 4PPZA 2RDJA 2RDDA 1RAGB 3WZ0A 3PY8A 2LLZA 3C2PA 3IBCB 1T7PA 4LT6A 3EXCX 4MKVA 4RW7A 2ZDPA 2HFUA 3E01B 1U6BA 2BE2A 4LF9F 3DOLA 4J9MA 1X4AA 1CJKA 1SKRA 4GKKJ 3UDLA 5LMUF 4QWDA 5IFMA 4DCJB 1B3TA 3OT9A 3Q8YA 2BM0A 2JRSA 1E6YB 1G2EA 5KFWA 5E0OA 1FI4A 2E5JA 2PE8A 2DR8A 5KG6A 3DI6B 2YWWA 2HQCA 3HHLA 1NDCA 1MMLA 3A3OB 1RAAB 4PKDB 5CD4H 2KYXA 3LUYA 1T9XA 3M1VA 3GG1A 4K8RA 3GPAA 2NXJA 1C0UA 2FY1A 3TP2A 2W1BA 3RB3A 3D3CJ 3HVAA 5KFEA 3NS5A 3KK1B 3JTOA 4DG1A 4KO0A 4MKYA 4CLUA 3ZC4A 1RTZA 3U1MA 2ZWPA 1NDPA 1JJHA 2D9PA 4JI8J 2AJFE 4ZS6A 4DL6A 2YNGB 2WZ1A 4ANEA 5IM0B 1WC6A 2OSQA 4ZKAA 1YBAA 4G3IA 5DLFA 4FF4A 3G8QA 5HMXA 4I67A 3PX0A 1QJHA 5ETMA 2FVQA 2HBQB 2HVDA 4XTTA 3SCLE 2IHR1 4KB7A 1Y11A 2H48B 3DRPB 3CO9A 1HIYA 4K59A 2FZKB 5KFUA 3I0RB 2DH9A 2D69A 1EP4B 4CTAA 1YIJS 3TZWA 3KDNA 4X4NA 2OD4A 5KFHA 2UUTA 3PYEA 3FZBA 4ZVPB 3NNAA 2CJKA 2V8PA 3EGWB 3IA0A 3OUYA 1URRA 2F1FA 2HNDA 4TLRA 1BQMB 1T0TV 1N32F 1U4BA 4V19X 3ZXWA 4QWCA 2RU9A 2DHSA 3CC7S 4M5HA 3O1LA 2NXCA 4C3KA 1YJNS 4B9NA 1UWBB 2IC3A 1WOPA 1HWJA 4ZVQB 1LEOA 2MQNA 5A0YB 3KG4A 5E3QA 3G8TA 1KLMB 4Q2LA 2RUGA 2R3VA 3QATA 5ETQA 3W62A 1A7GE 4OLOA 4HDHA 2Z30B 4R0EA 3GYXB 1FVSA 1YJRA 5GMEA 3OTEA 3T9ZA 5GAEI 2V4QA 4J9PA 3VHQA 3GV7B 5EN1A 2XNQA 5K9FA 2HNYA 4Q45A 1RU2A 2L3MA 4F4WA 1UL3A 2MQQA 3AQPA 2IRUA 1T9WA 4QWEA 1JLCA 3GJSB 2VF3A 3D66A 4G65A 2GJ2A 4IG0B 5L39A 4CT8A 2NUUG 2POKA 1NLKL 4CLFA 1TAQA 2KJWA 2ZBRA 3EGZA 4IRCA 5D3GA 4Z37A 4JI6F 2DO0A 5B0CA 1AT1B 2MZJA 3KLIA 5HQLA 4DHVA 1VBKA 4DPUA 2QTWA 3ELHA 2UUWA 1HFEL 3KFWX 3MOZA 4LF6F 2ZKUA 2VL1A 3LALA 2RHQB 1NKBA 3CCRS 4O4GA 4FNIA 3KUEA 2C2DA 2V67A 4LSNA 4FYDA 2D3ZA 4CRJA 4EYIB 5GAGI 1VI7A 2W8KA 2HQGA 5CH7B 1UFWA 2A6OA 4B9MA 4PRFA 1SQFA 4LF1A 3O3LA 5A8WB 2XYGB 1RAIB 2CNLB 1M5KC 2DH8A 4DUTA 1LWFA 4DFMA 2KL8A 2AU0A 5AE3A 1ZM3A 4ED2A 3DN9A 3M30B 1F2HA 1RT3A 2EC2A 1HQ2A 2RE1A 3W2VA 5K14B 4LFAJ 1U02A 1S7HA 1DZ5A 1FEEA 3H5XA 1K0VA 3V4MA 2HHTA 2VG6A 3TA0A 1OY6A 1XIQA 4C4WA 3MPWA 4LSZB 4FZVA 1FNOA 2B43A 4ZPVR 5DJBA 1M5HA 2V8VA 4NLSA 2QFJA 1IKYB 3ISZA 2RB7A 3NMRA 4LF4F 3Q24A 4X4SA 2XSFA 5D4OA 2GCFA 2LFVA 2BDPA 1Q78A 1NKEA 4R5PB 5D78A 2OGUA 4YB1P 5DQIA 4K7QA 1HLWA 4XO0A 1FDBA 1S49A 4ZLLA 3HVTA 1KOHA 3D5MA 1N54B 4CLLA 5LJ5Y 4DR2F 1M5VC 4AL7A 1EQMA 2KN4A 3D6TB 1HBMB 4QYZJ 4P75A 3BSAA 3TANA 1UVNA 2HHVA 4DUZJ 2IMOA 4OFZA 2NSCA 1RTDB 2L41A 3FVYA 3OVBA 1N4LA 2V4JB 4ZPAA 3M8YA 4HL9A 4BWJA 4KKOB 1HNXJ 2A6MA 2L08A 1RT7B 1UA0A 1M0SA 4CLWA 1F60B 1Y3KA 2LQ8A 2P6TA 3TVKA 3VALA 4DS4A 3UFCX 3DRSB 2B5JA 2Y8WA 3GTYX 3DOMA 3KHHA 2LP4A 5K8NA 2J6UA 4F4AA 4RUHA 2HZAA 3KJFB 2D41A 1SIZA 2NYHA 2EXUA 5IT9U 3QFHA 1U8SA 2MPUA 4BS2A 2ZM6J 1HQUB 1ZOTA 5CZXA 2AZ1A 3BV8A 5L1KA 4F4XA 3T5JA 2CPZA 2XMAA 3CD5A 1PCAA 2ZITA 2HQFA 2PI5A 2R7TA 1F5CA 4HT7A 5F9LA 4E8UA 1X7VA 2RILA 3EZ5A 1H38A 3DDKA 4B3MF 4ANDA 4NLPA 1RHKB 2XTJP 3PVXA 1BQNA 3ILLA 4K0KJ 1PBUA 4IOBA 2NPFA 3R5JB 3V81A 2FY8A 1S9GB 2ZE2A 2IVMA 3BKTA 4QIGA 4W90B 4JB8B 4HDGA 4WZQA 2C2EA 4OHVA 1DLOB 2VUGA 3VAHA 3MM6B 3R6GB 2QLBB 3M9NB 2PO4A 2QYGA 4AFFA 1AFJA 4NX9A 4CQ1A 2YKAA 2VA2A 4IFVA 3LANA 4HLBA 3IWLA 1OIAA 3DLEB 3NCRA 2PMWA 1HNVA 3BH6B 2KHCA 4F50A 1Y00A 3QO9B 3LAKA 2D74B 2GNKA 1WF0A 1GFWB 4M5NA 1RWWB 2DGUA 4JOUA 2JSXA 3ONQA 1JNRB 2GW8A 1TUGB 4DL4A 2MKHA 2LQJA 3CJ0A 4FDFA 4CLSA 4CT9A 2C2OB 4DV6F 1QE1B 1BUXA 3OUYB 3HSJA 4JI1F 1SKUB 4Z7CA 5KFCA 5G4DA 1V5VA 3PNIA 3TX0A 1KONA 1IR1A 1W26A 4ID8A 2CPHA 3VAIA 1RT1A 1JLAB 3BR9A 2PA3A 1BD6A 3NAIA 2VFTA 3T41A 3DGVA 1C1CA 2IC3B 1UJ4A 4GVBA 1RHMB 3OL8A 3GB0A 1REVB 2YH0A 4QCLA 5C2GA 5CYQA 3JSMB 3Q89A 1UW4A 4CIOA 4URSA 1EARA 1C1BB 1UTAA 3THTA 1S59A 5KTQA 3MF5A 3VR1A 1Q1KA 1RWKB 5HK4A 4J9VA 1HBOA 3M6UA 3OTCA 2LEAA 4LF8J 4R8UA 3DU6A 3RAMA 3CGIA 2Y3YA 3PYDA 1J27A 5IC4B 2UVUA 4KBIA 1VQ5S 3MEGA 4MYUA 2GC8A 4MK9A 2VH7A 4ZPCA 3V6HA 1BGXT 4CO5A 4K4YA 2VOOA 3HD1A 1Q0NA 2OH2A 1IR2A 3EDQB 3W9JA 3HHDA 4EGLA 3V4IA 2MKJA 4O4GB 4A8MP 4YB7A 1DARA 5K8OA 4RUAA 1I3OB 3J7A1 5I3PA 4P7VA 3CWJA 3B78A 2GZOA 1MU2A 4USKA 4USIA 4ZJQA 1VDHA 1LWFB 3QMQA 5L9XA 4NCGB 1GK8A 3KUGA 2J7KA 3VCDA 4WP8A 1RHRB 3A8KA 4PQAA 4C8OA 1ZM9A 2OP5A 1S0VA 2VG6B 4NA3A 2ZUAA 4ECXA 1NEEA 3L7PA 2YX4A 4ES1A 4PXBA 3L7UA 2Y0BB 2ZHOA 4UF4A 1R27B 1KHVA 2IFXA 3M8RA 4DR4J 5KFTA 5CQGA 5T14A 2CJXB 2QT7A 2XO7A 2QFIA 1NU4A 3SDEB 3D9BA 1HHQA 1QVGR 3W9IA 3RR7A 2MLXA 1IXKA 1OMSA 4TY9A 5EWGA 3QJJA 4JV2A 2RMLA 3J81U 4ZCKA 1QDUB 2IM0A 5CCMA 3PRVA 3KG1A 3SEOA 2V9WA 4ECWA 2UXBF 2VD3A 4RBVA 2GHWA 2V69A 4AQYF 4YR3A 4NLRA 1GT8A 4I7FA 2VKZG 3CCJS 4QU7A 1OY8A 4JI2J 4RPFA 3ULHA 4PWWA 1L3TA 5I3QA 3UNGC 3QT6A 4FS2A 2ABYA 2AJ1A 2A3JA 1M5SA 3SFGA 4CH7A 3H0PA 4OV6A 4A8FA 2QEXS 1Z2LA 3NAHA 3MAAB 2B4UA 1VJQA 2DISA 2VPZB 2MJUA 4DSJA 5MLCV 2OAUA 4P2MA 2BUNA 4DPYA 1ULRA 3IS9B 1T05A 2OUGA 1H2UX 3M8ZA 4K4ZA 2RKIB 1YG0A 4A8XA 2QV6A 3JAMY 1S48A 1NH7A 4CNYA 1MROB 3DOMB 1BC6A 4PWUA 5B0DA 1F2GA 3LA0A 2XYPB 5DGBA 3DLJA 4PUOB 2D3UA 3R6LB 2ROPA 1OO0B 3E2EA 4ED0A 4TNOA 2KG0A 3CCES 3MMAB 1XNRF 3G9CA 3F73A 2XMUA 2ZNYA 3CUNA 1SH2A 3VGUA 1FXLA 1VBXA 3H40A 2B8QA 4F8RA 4DR7F 2E1PA 1P6TA 4JI7J 3GWCA 3OW2R 2R7UA 2DB1A 3ENAA 2CJQA 1S0MA 1BQNB 1S0OA 5ITHA 1D09B 4CO3A 1N34J 2LEBA 2RVJA 3ILOA 2MHNA 3OL9A 1F9EB 4EYHB 4ECRA 2BJEA 2B7CB 3B54A 2XEXA 1OY9A 1VRQC 2NREA 2HHQA 4KGMA 4KC5A 3HP6A 2YVSA 3JSBA 3CT9A 2O01C 4ILRA 3QGPA 2E5LF 5BYSA 4LRAA 3FGVA 1GMVA 1FK9B 4IR1A 4OJHA 3ZTRA 3M8PA 1MMNA 2W24A 3CO0P 1ZS6A 1F9FA 2B51A 4ZVSB 2FVSA 3D0IE 4MJKA 4OZ0A 4J7CA 1U0SA 3OL7A 4DX6A 1CC7A 4WF9Q 3IAM9 2ZD1A 1VIXA 1BE4A 1VQPS 5M2RA 4HKQA 3SQGB 4CM0A 3LOUA 2QA4G 1SVDA 1YJUA 1TKXB 4DCOB 4KH0B 1HBNA 2HNZB 3PO5A 1FJEB 1N33J 2HZVA 1CPZA 3QWUA 2DNNA 4UT4A 4J9OA 3HVRA 1Q8LA 3HFKA 3TO8A 2CJAA 2J0SD 2LECA 3A4TA 4PQUB 5B09A 3AD9C 2DR6A 1N48A 5FLXY 5F8NA 3PDNA 1XMQJ 4NOHA 2DIUA 2CAJA 1H73A 2XWXA 2MZRA 1C1CB 4GVBB 4DPOA 3CD6S 4LREA 2EWHA 2DPIA 1YTYA 3TVYA 1KKHA 1S1VB 4KJIA 2VU5A 1RT4A 4GO7X 1KHWA 5IQQA 5KFQA 3UWTA 1T95A 1HQEA 3KK2B 3CC2S 1FHTA 2YWFA 3KG0A 1FKOA 1D9DA 1FJGF 3KWMA 2DYAA 1NH8A 2QJ3A 2F65A 2VZ9A 2G2OA 3H5SA 2CNKB 3N79A 3B8HA 2CQHA 2RQMA 1PKUA 5DLGA 1HBOB 5KFDA 2XS5A 2IRYA 1H7XA 3EE3A 4ID5A 4PG7A 2KYZA 2DHHA 1FE4A 1VBYA 1KFSA 2HEKA 3U27A 3W5ZA 5J2MB 2WB1D 4A8WA 2AKWB 4I2PA 3UNYA 3W63A 5KG0A 4ZP6A 3IR6B 3BF4A 3IBWA 4BC9A 1R0AA 1NNDA 2RH3A 3KJNB 4X62F 4ENOA 4DQSA 3AHPA 3LPEA 1XK8A 3N6MA 1RSCA 4I6WA 1FFSB 1MU2B 1YI2S 2V8DA 4D3HA 4B3TJ 2BZ2A 4ZHRA 3I55S 1JLEA 3TVZA 3BGOP 5KT3A 2HVZA 1RWNB 1H2TZ 1U2FA 2XCAA 1X0FA 4RWWA 3G8SA 2FYXA 3DRRA 3M8SA 1UETA 1B70B 3VWSA 1FRKA 1PILA 1TVRB 1VOMA 5LM7E 2ZUGA 3LP2B 4J90A 3S01A 1QM9A 2Q66A 1SKSA 1CLFA 1TKTA 4I2QA 2HRYA 2ILYA 1Y9OA 2HG4A 2VODA 2LU1A 2RT3A 3MEDA 4E2FB 3BDPA 1O5JA 4DUYF 4ETZA 2OPRB 4C8KA 2DNRA 1B0VA 1SV5A 3IR5B 2FQQB 4ZPWR 4FKXA 4U7CA 2Q3PA 3PR4A 1QSYA 4NEZA 1RWXB 1EAYC 2K3KA 4DV7F 1QAXA 1XMOJ 2BANB 4X64J 2WSEC 1JLQB 3IFEA 1RKIA 5GADU 3V6DB 4DV1J 1GNKA 2V2VA 4DBQA 4J9NA 1HWIA 4PXCA 4I7FB 2ZZTA 1SH3A 4LFCJ 5IV4A 1MN9A 1FTRA 1YBTA 4JI0F 2VQEF 4R0JA 4I56A 4OYBA 1K47A 3CDEA 4J9RA 1N5SA 3CMQA 5E41A 4CLPA 4TKTA 2JX2A 1XR5A 2H1YA 4A8SA 2FVPA 2QMXA 2AJ4A 1RWUA 2R9LA 2W2QP 5KG1A 2ZFHA 5ETRA 3EVOA 2ZC3A 5LSLA 5KFKA 3BO4A 3R5GA 2YWKA 3G82B 1FKPB 4CLKA 4CO2A 2G13A 4O3RA 1PYOB 4CLZA 3VAFA 4L3KA 3DHXA 2MKIA 1UEKA 4FBTA 4Y2KA 3K2YA 1J5OA 1RTHB 1A0OB 1X4FA 4G1QA 2I38A 2IRXA 1W25A 1T02A 3ETOA 4F02A 5MAOA 3H98A 1MWQA 1JQGA 4QWAA 2BQRA 4EMDA 1O8BA 3GCWP 1UEUA 1QUVA 1ACMB 2HURA 4NWBA 2X1AA 5HAOA 4EEYA 4OJ1A 4BHQA 2L48A 3HCXA 3U7JA 1IJFB 1QVFR 5K8MA 4F04B 1IJEB 4J9KA 4HACA 3QLHA 5C25B 3FMWA 2FDNA 5KG4A 3A8IA 2BVZA 1IBCB 4L74A 3H20A 4DV5J 2OPPA 4N77A 1J5EJ 2KI2A 5FDLA 5FD1A 3Q8UA 1RTIB 1EETA 4A8KA 2BX6A 9ATCB 4M63A 4RNHA 2RRNA 2YNHA 3FZ2A 2HBZB 2EG2A 1VRUA 4IH7A 2YNIA 5LOQA 4GKJF 4JYAJ 3DLLQ 2AX1A 5DGAA 4OI4A 3MWBA 2WTFA 3QIPA 3CJSA 2V34A 2VOPA 3GLJA 2VPYB 2HHHF 5IS2A 4Y65A 3FBEA 4I69A 4NYZA 2F4VF 3BGRA 2X51A 3KJVB 1NHVA 1HR0F 3QFWA 2DD8S 1XC9A 4OI2A 1GXLA 4UQGA 3I4PA 2MSSA 2L9DA 1G3OA 7FD1A 4CDIA 3DLKB 3I5BA 5KFJA 3TJAA 1IKVB 1S9FA 2Q6CA 3L3CA 1VRTA 4IG3B 3W64A 5DG7A 4LF7F 4OI0A 1HI8A 1RUSA 4RWXA 3POTA 1Q95G 4H4KC 2IIHA 1AZSA 2EKYA 1NK4A 1ZYQA 2CZ9A 3EVWA 1OSDA 3TR5A 4U7UD 2ZVSA 2K06A 4OYPA 4GO5X 3LH2S 2YQ0A 3HVWA 4BCAA 4KT0C 3DKDA 5JUMA 1WWHA 1SUQB 3AFGA 1YJVA 3K8WA 3OJSA 2UP1A 1LK5A 1RYRA 1I94J 1VHFA 4DR5J 1T9VA 5AE1A 2RJZA 3FMBA 5I3UA 1RHUB 1JK9B 2GFFA 5IWAJ 1GQEA 4YP3A 2J9CA 2WBMA 4ID5B 1PYSB 3ETMA 1HNWJ 1FXDA 3TNVA 3M9MB 4C8MA 4LF5F 5KFYA 2V4RA 2A2CA 3PW2A 1HNIB 3IWXA 1WSRA 4GRSA 2M0GB 5G0RB 1G7CB 3L09A 1FEHA 1TK8A 2PD1A 1BXNA 4ZN1A 4NE9C 5HVFA 2W25A 1PYTA 1R0AB 2OFHX 4USJC 4O3PA 2XS7A 3MR7A 1IBKJ 3MECA 2IA0A 3WHIA 3KTQA 2RQKA 5HI7A 3KDOA 2OHDA 4OZNA 1IBLJ 2DK2A 5F41A 2UV8G 2ROGA 5B0BA 4AD6A 2YWHA 4ZN3A 1VLOA 1VR6A 4Q7AA 3DLGB 3CPWR 1APSA 1S12A 2G2YA 3MZIA 2C22A 2M4MA 2FGCA 1RB0A 1KD1T 3UI3A 2EEYA 3T6JA 1U6FA 2E29A 4DV0F 3OTBA 2HWHA 1TKTB 1OSCA 4OLPA 2BEFA 4Q0BA 5ETLA 3KLFB 4RU9A 3MEDB 2EK6A 2W9AA 1UPMB 1S1XB 1LFPA 3CJ5A 4LF9J 2NLWA 4F2SA 2ZH8A 1ZTTA 5LMUJ 2RNEA 1CQNA 2MYFA 3JQMA 2AIRB 3NGSA 3HO1A 2BYCA 4NXMF 4R25A 1KOOA 1WC0A 2DKOB 2QSWA 1CJUA 4ED4A 2UUBF 4ED5A 4LQ3A 2BXJA 4YFUA 1YRXA 2HSEB 3I32A 4EK2A 3LTOA 4NMLA 2E7XA 3GZ7A 1XR6A 1ITPA 3P5BP 2E1AA 3SYZA 4FVCA 3A8EA 5HANA 2D1CA 3OBIA 1SKWA 2WRMA 3F41A 4QU6A 4WIQA 3LGMA 4HTIA 1SQGA 2IAJA 2R2RA 2CQ0A 5KT2A 1VYAA 2R42A 2OEKA 2FGOA 1NJXA 1WC3A 1U2CA 1DTTA 3C6TB 3LAMA 2CQBA 2EI5A 2R2SA 3QGGA 1P9YA 3MCSA 1S99A 2KG1A 1DY3A 4BDPA 2M88A 3HFZB 1RBLA 1U1MA 3OLBA 1N52B 3HDSA 1RWVB 1RU1A 1V9OA 4RW9A 3MMCB 2R7QA 3JAMU 1RLDA 2C3PA 1CULA 4AL6A 4C6AA 4H4MA 1S77D 4U95A 4DV2F 5F3TA 1UEVA 1M1GA 4RNNA 2R7XA 5JJBA 4RW6A 2GMHA 4USTA 1ZAVA 1NCLA 3JYTA 5HSPA 1A6LA 4O0IA 3HHEA 3AB4B 1N32J 2GO9A 1JXLA 1UMJA 3V2UC 1P8GA 5U47A 2FVRA 4L75A 3IP0A 3RZAA 2JEGA 2C42A 1VS3A 3I5CA 4KHMA 1JXEA 4DFPA 5DDPC 1T11A 4A48A 3DCAA 2OPPB 2O66A 1AFIA 2XZDB 2BM1A 2JOQA 1RT6A 2FJDB 2E5HA 1K8AT 3M6VA 2KB2A 4EI2A 2MEWA 3LQVA 3L7OA 4JI4F 3PW4A 3MEKA 1VRUB 3WC2A 1T9UA 1WHYA 2AW0A 2XS2A 2IDEA 1QTNB 2O67A 2F8EX 1X4CA 2KZZA 3V6JA 2CWXA 1S1UA 2LXUA 4HHJA 5D15A 3IM9A 2CG8A 1UJ5A 1X4BA 4M1KA 4QIWD 3ZZOA 4IO1A 1JKHB 3OV7A 2RQ4A 4EFAC 3KNAA 1FRLA 1RBOB 3H25A 4EU0A 3HKWA 2M8HA 2EFNA 2PMHA 3L4BC 2W8LA 2N7YA 4JI6J 3SCJE 4ECQA 4H4OA 2XY5A 3EM1A 3MUVP 2LMIA 2CFXA 1YJWS 2Z8QA 2WAQD 2ADCA 3U1NA 4BLGA 1ROFA 3CJ3A 1VRTB 2LXFA 1QLNA 4D3GA 4QR0A 3DGPB 5BR8J 1IM6A 2WONB 2QL9B 4KHPF 2F5GA 3IG1A 4Y28C 1QSSA 2YKNB 2ZOFA 4HTJA 5FLXU 3VZIA 1RT5A 3OHBA 4LUBA 2JHEA 4X65J 2W4PA 1L3SA 3IC1A 3HX9A 1AZSB 2GA7A 3FUYA 3ZZTA 4ICLB 3HT3A 2R8GA 3MM8A 3PJ9A 3L95X 5H9FK 2HAFA 2N7CA 4OYZA 4IFYA 3QZ7A 3KK3B 2VG5B 3T5LA 3BZQA 3FFIA 1R43A 4XPCA 2XWYA 3US5A 2EBGA 4KGXB 1L3UA 4LF4J 3M2UB 3HSDA 2HRTA 3CJRA 3HSZA 4ZIWA 4NA1A 4N76A 4ZCMA 4DSIA 4X4QA 4WE1A 1YKWA 2QL5B 3LP1A 4Y2IA 5HMYA 2QO3A 3D6MB 4OV1A 3KLVA 3ITHB 3P4UB 2GJFA 2GJIA 2VFUA 1XBWA 1RTJB 1D8ZA 3EX7B 5GAEU 4LF2A 2E44A 4DR2J 2HGNA 2LA6A 2UVRA 2HS3A 2QA1A 3TA2A 1P9QC 3KLHB 1FA0A 2F9DA 3R5CA 5HL7Q 4DV3F 3FK4A 2WW8A 1UCNA 1GH8A 3DXBA 1JJ4A 4TY8A 1SL1A 5LSOA 4WKRA 1HMVA 3IR7B 4PG5A 1R31A 3TJ8A 1Y5IB 1K44A 2XGQA 3JSYA 2E9ZA 5E33A 1Y5NB 3NBPA 2CQ1A 2G0JA 2GGPB 2QIFA 1NK7A 3JQJA 2HWTA 4FF2A 2XZWA 4C8YA 3HM9A 2VFRA 4RW8A 5K8PA 1CJTA 5KG5A 1BLUA 3T1HJ 2XB2D 3P45B 1R8PA 4WTYA 5GAGU 5KOXA 2I5JA 2Z2ZA 1K1QA 2LXIA 1NZ8A 2HW3A 1JJ2R 1ZZFA 4PXEA 3C6UB 4YR0A 4DS5A 2RHSB 5DETA 1RLCL 2YKOA 1TK5A 1ZTWA 3W3SA 2CQCA 1X4EA 2N3LA 2JLFA 3HMJG 4YB5A 1FTCA 3AOBA 3K89A 1HARA 3NNCA 3MUTP 4TU9A 4E0DA 4HR2A 4BWMA 3D7SB 2C2NA 3TAPA 2FZGB 2YH1A 4B3MJ 4RW4B 4FXDA 3PIPQ 1RADB 1NPPA 5C42A 4YDDB 1JLFA 3BQ2A 4QR1A 1D9FA 1XMBA 3Q8VA 4YUDA 4LR8A 3MMJA 1CS4A 3THPA 1EJ7L 1UAWA 2OI2A 1ZBTA 3JTPA 1KS2A 1RAJA 3BBBA 2GVDB 4EO8A 3MM5A 3D2WA 5SZTA 3TUJC 3QBCA 3H2LA 3KKFA 2W7AA 3H5UA 1RK8A 1RHJB 1UZHA 4N8NA 2BJ1A 1NM2A 2J8AA 2KRRA 5DQGA 1X5SA 1YX2A 2LEPA 4DN9A 2HQDA 5I42A 3TZYA 4AYBD 4HVZA 5GAHI 1NO8A 5KG7A 2DRAA 3NCQA 4RW6B 2IMWP 1N5QA 2V8GA 3WIVA 2KKHA 3BN7A 2CZ4A 2AF6A 4DV6J 4PG4A 4CH1A 3SFUA 3CB4A 5C24B 5D4NA 4X2BA 3VGSA 4JI1J 2UUCF 2XBPA 2W9CA 4KY3A 1WKLA 2ACMA 2F7VA 4OI1A 2G4BA 4PAAA 4K0KF 2XLKA 4IH5A 5E3PA 1IKWB 5A2QY 3G96A 3NKYA 5IV3A 1X5PA 1RT6B 1HBUB 1UVLA 2BQUA 5F8JA 3S8SA 1ZA1B 2D3O1 2XMVA 1L3KA 2NXUA 3IGVA 2XO6A 5KT4A 2XLJA 4NLQA 1YLXA 2UU9F 4NLDA 1WNEA 1RWPB 1WKJA 5ETNA 4PPDA 1X5OA 1GMWA 2RSQA 1XQIA 5HROB 3SCKE 4I0WA 1S1UB 3K0JA 4OJ3A 4MTPA 1LWEB 3B6BA 5AE2A 1U6ZA 4DSFA 3KOAA 2WVBA 4DEZA 1X31C 2DHXA 3M2VA 1PJ6A 2VPXB 3DM2A 4ED1A 3C14A 3R7BB 2DPJA 1FNXH 4A4JA 3I87A 4ZPBA 2Y1IA 4QW8A 1OJ4A 1GTHA 3W65A 3B4MA 3MEEA 5JVGQ 5J2QB 4CLYA 1U1QA 2HLUA 1YJ9S 3MM9A 4K2JA 3QAEA 2OLWA 2J7UA 1YZ6A 2PDAA 4FF1A 4KHRA 4MK7A 5DQHA 2YXLA 3BSNA 8AT1B 1NK6A 1R6VA 1H0HB 1YBUA 1U1KA 5KFLA 2A10A 4EZ9A 1IBMF 3HJVA 2W9BA 1SJ4P 1RT5B 4ECVA 1FO1A 4QOTA 3MURP 5HP1A 1UFLA 1JB0C 2KT2A 2M70A 2BJ7A 2VDIA 2ZBIA 2FHMA 3FBFA 3AOAA 1NHUA 1IR0A 3OR2A 4N47A 1AYEA 4A8OA 3C8YA 1D1UA 3LWMA 4DQIA 1ZA2B 1E6VA 2ZBPA 3N4WA 4DI6A 1TL5A 4Q44A 3AT1B 2PGCA 4DSLA 2ZC4A 2CPFA 3R1LA 3T5HA 3OXGA 5EUHA 4NI2B 3BREA 2V2ZA 4C3MA 1UVIA 4KE5A 3CNQP 4LF8F 1V5IB 1VQKS 3ILIA 1T9TA 2ALYB 3NG8A 3GV8B 3DYAA 4WBFA 4OHXA 2CXEA 1VQMS 2VJUA 3C15A 5DZ7A 1TL7B 2WHOA 1M1KT 1FJCA 5KFSA 2JC1A 4DR1J 4DWIA 1VC0A 4AQYJ 1EX8A 2QE5A 2C3OA 2DNMA 1VQ4S 4RBUA 4M8LA 4F3QA 2V63A 2JNJA 7FDRA 3EVMA 3CCLS 5E7OB 1VLYA 1FFGB 1EKSA 3ZTSA 3PX6A 3IN5A 3NBPB 4NYOA 4C2MA 3J7ZT 1FVQA 3DMJA 1PAUB 3MM7B 1L5UA 1X9MA 4Y2MA 1S10A 2R7RA 1KVIA 1TMJA 4DR6J 4EZ6A 3PW0A 1G1XA 4Y00A 3BPDA 3PW5A 3A3PB 3CJ4A 3QSIA 4LIWA 4ATNA 4DL5A 1CJTB 1JLGA 1SL2A 3HXMA 4WZMA 1LKZA 2I5JB 4LBHA 2HGMA 3BBCA 3N5BA 1HYSB 2AYGA 5E3CA 1LK7A 4DR4F 3ZO7A 3ENQA 1HHTP 1JX4A 3EMTA 1SJ3P 2ZHAA 1Q8IA 4KQZA 2B6AB 1XNRJ 4HH0A 5AJ3F 2JL9A 5EWFA 3GR1A 2D9OA 2O1PA 3DLBA 2JJ4D 2JZ5A 2AYEA 1LWCB 2NCKL 2UVWA 3ZZZA 2A0FB 3I0SB 4NZ0A 3M32A 3QGHA 5D0GA 4KH1B 3GMGA 4RNMA 2YPYA 4J5OA 3AJDA 4JI3F 4B3OB 1BWEA 4KRWA 1X9SA 1JLFB 2DR7A 3S1TA 1OS5A 1FD8A 5B0FA 3PHTA 1NK9A 4J9SA 4L72B 2YKQA 1TMMA 4OYAA 1U7LA 3WBZA 2AX0A 3N5FA 1TV6B 2E5LJ 2DEIA 3ENWA 3MTJA 2BRLA 3MD3A 1TKZA 1AXQA 3LP0B 2GVZA 1N0VC 3RBDA 2HPUA 3BGLA 3M05A 2J6TA 4LRBA 1WUUA 4LRFA 5GVQA 1Q7YT 1RHQB 2UXCF 2OPQB 3H4DA 2H54B 3NGKA 2R8KA 3ZFVA 1NZAA 4K4XA 2KXHA 3EXYA 5I42B 3OTDA 1C4AA 2FHJD 2X1FA 1MN7A 3QT7A 2UV8A 2P9EA 1DURA 5HLFA 5T7LA 2HMIA 2OSRA 2RS8A 3GIIA 1WG4A 6FD1A 2GQ2A 1OYEA 2ASYA 3QIDA 4YB6A 2WOMB 2OPSA 2GIFA 4USHA 1CBKA 3ET6B 1FWKA 2BOAA 4NRUA 4E98A 3W5XA 1ICEB 2MLZA 2E1CA 3EUNA 2W9CB 3AOCA 4M5GA 4WPAA 4OHWA 3ICLA 4QJVA 1F6TA 1KRPA 3DDNA 1KLNA 4P73A 5KFBA 3GE9A 3RB4A 2CQPA 1S7IA 4KV8A 1N34F 3DXSX 2DJWA 4F0HA 1M1HA 3BS9A 2DGQA 2IA6A 3JQKA 4IQMA 5KFZA 1H6KX 3EGNA 3D1HA 4DL3A 2B0GA 5ETSA 2ZH1A 2XSJA 4FYYB 4TU7A 3FNNA 5B0GA 1N0UA 1PG5B 3SQOP 1YQHA 4JI5J 1O51A 2ZH9A 1RABB 2DTJA 2ERRA 1FCAA 5F8MA 3TJ9A 1VK8A 4KFBB 4TQRA 3M2VB 3TWZA 2PIIA 4YHHF 3F56A 2JC0A 4YS2A 4NPOA 4NASA 1N6QA 1UP1A 1H2VZ 4NZ7A 4W98A 4JV5F 1BQXA 1F3FA 3D3BJ 1U1RA 3MEEB 3BQ1A 1NJZA 2VG7A 2WVEA 1OQ3A 4J91A 1RA7A 3M2RB 2GAHC 3H7HB 3HFVA 2CVEA 4MK8A 4DPWA 3KNGA 5ETOA 5HQ8A 2DY9A 2XULA 1LW2A 4NMXA 2U2FA 3D0GE 4OX9F 3KHRA 1FFWB 4X62J 3G6YA 2RF2A 5A6WA 3PFEA 2BJ3A 3UD5A 2W9BB 1Q8BA 3BDEA 1SJ1A 3ENVA 3DRYA 1X0PA 2HVIA 5EX3A 2YQ3A 1GXUA 2H5JB 1PAEX 4O44B 4USUA 3K7RA 3TUPA 5HBMA 3WIUA 5BXIA 3UN3A 2QN6B 1S1WA 1WC1A 2PA8D 2AQ4A 4B9UA 3VQSA 5CYMB 1LWXA 1V3ZA 1PJ7A 5KOWA 1TELA 4O3SA 4O3QA 4MKAA 1U47A 3OFFA 2NPIA 4CYUB 3MR5A 3HZEA 1E6VB 4K4SA 2JEJA 5AXMA 4I6YA 3MPVA 4WP3A 4ZLPA 2M8DB 1VJWA 2P5VA 1C0TB 1TL4A 1DTQA 4OI3A 3CCMS 1U0HB 2X7IA 2HGLA 1Z1ZA 3QPIA 3O5TB 4IYQA 3SZ2A 4CLTA 4FS1A 3PEJA 4WFNQ 3R9LA 3RB0A 1YHQS 4G6VB 1PC5A 1UVMA 3GYGA 4LFBF 1SIWB 2KDOA 5IC6B 5HVHA 4DV7J 4RW7B 2ATCB 3CD0A 4LSLA 2BE2B 3DOLB 3C15B 1XNQF 1CJKB 3HHNB 2BQ3A 3QJLA 1RA6A 3W2WA 2V9KA 5IT4A 3BKFA 2DRDA 1EKRA 4MYTA 2ZZNA 3PEHA 2FJEB 4N8OA 3FEYB 2BACA 2VQEJ 1NBEB 1JLBA 4DL2A 4LVOP 3BO2A 2K3IA 3HHLB 2Q79A 5LMNF 1GTEA 1MLAA 2ZH5A 1SC1B 2CQGA 3HZGA 4I68A 4Y2AA 1TTHB 4BC7A 3M1VB 2PFDA 4XIUA 4ZVGA 2P8IA 1C0UB 4C48A 3KLEA 1NK0A 5ETTA 3UDCA 1FE0A 4HH1A 2ASJA 2K8GA 3CULA 1NRKA 4DG1B 4KO0B 2JVRA 2M9KA 1SB6A 3GFZA 1FESA 4V19J 4UOGA 1P1LA 2ALZA 1HNZJ 2C3MA 3E01A 2IJNA 3MR6A 4LRCA 1U26A 1S6OA 5BYRA 4P2FA 4DU8A 2ACYA 2HFZA 1FRHA 3SV4A 3ZZYA 3K17A 2QZ8A 1V6HA 3C19A 3D68A 3SSQA 3PX4A 4RNFA 3M32B 4U96A 1U1LA 4P6QA 1WC4A 3R2DJ 3DI6A 4X64F 2FLPA 4CTAB 2QGFB 1VHIA 1VQOS 1NSPA 4C0OC 1VBZA 4X4UA 2NSBA 2B4VA 1KQFB 3M6XA 3MGJA 4QYRA 1PSDA 3IGNA 1SC3B 3ZZPA 5GMDA 2HNDB 4F3OA 3QYYA 4K5SA 4ECZA 5DM6Q 1WEYA 2Y8YA 1LOUA 3KK1A 2PSZA 2DXDA 4GKJJ 1Q82T 2MKYA 1RISA 4U7UK 2LDYA 4NLTA 2LKZA 5H1SV 3QRQA 2P6SA 2YNGA 5IM0A 1OQ6A 4PG8A 4M95A 2OTJS 1QTMA 1IN0A 2BMBA 2DIVA 2UVVA 5T41A 2RD5C 2VB6A 5E3RA 4UZCA 3I0RA 1S72S 3DFEA 3W5YA 2F4VJ 2VV5A 5T7LB 1TKDA 1EP4A 3ZTOA 1DQ9A 1HR0J 2K7JA 4DX7A 2YWGA 2J7WA 4K5RA 2HNYB 3P8BB 2KJVA 2GMLA 4A8YA 3BJYA 1SBRA 1JLCB 2X3DA 4H4KA 1Q7LB 2HYIB 3O2IA 2BRKA 5DRKA 2B4OA 2HHSA 3Q22A 2H65B 4LF7J 4P72A 5D3GB 3CD7A 4UW2A 5J2PA 2AJ0A 2XMTA 2VBWA 3KLIB 3GIMA 3N6LA 1NDLA 3H4BA 2KM8B 2XC9A 3R7SB 4MAKA 1UWBA 3FC9A 5A2QU 3TI0A 2K1RA 1HWUA 4WP9A 2CJYB 2IBKA 5A0YA 1RWOB 3PR5B 3P96A 5KFGA 1QUPA 4LSNB 1KLMA 4GC7A 1GX5A 2CPIA 3Q86A 4CO0A 3OLAA 2IM3A 2JVOA 3IO1A 3SBMA 5EDWA 3MI7X 3BSCA 2XM3A 2J0QD 3WDOA 4KPYA 1RT3B 2BE9B 4KIAA 3W2VB 4OZ1A 3NY0A 5L1LA 4Z7YA 2VC0A 4UY8T 3J80Y 2R2TA 4IG0A 2Y1LB 1KTQA 3UD4P 3TUZC 1R0CB 2IDLA 2YKMA 1W7WA 3ZZUA 3J7YU 1WKKA 4IO9Q 1Q79A 3UD3P 5LL6d 4O4RA 1KFDA 2WVFA 2EFVA 4DQQA 2ZWOA 1U2RA 4RKUC 2P9CA 4P10A 3EYZA 4DN0A 1ZPWX 3H42A 3HVTB 1Y7PA 2HFOA 1NJYA 5D0RA 2GHPA 2MY8A 2FIUA 3T6BA 1XTZA 3A13A 1T94A 2O3DA 3M30A 2ZJPQ 4HEA9 3OJUA 2F4FA 2F8HA 3AY0A 5K14A 5F8LA 3PKYA 4ECYA 3AD7C 1S57A 2R7VA 4N41A 4H54A 4MH8A 3WQPA 2MKSA 4PZVA 4HHUA 3RU0A 4DV0J 4QPTA 5DM7Q 5LXYA 3TUIC 2R8IA 4NL5A 3VTIA 1SPBP 3GSIA 2LVWA 2NXEA 1ZAWA 1Z4UA 5IWAF 5CD4A 4RU2A 2MMYA 4ZMMA 4TYBA 1KSPA 2B5JB 2V2QA 1RACB 4R5PA 1HNWF 4RLEA 2BV3A 1TZ0A 1B7YB 4IDKA 2DNGA 4NXMJ 1VQ9S 3RBZA 1P1TA 4DPXA 4DF8A 2UUBJ 4C8LA 1TUWA 3RTVA 3UVJA 4PYAA 1YRUA 3PTWA 1HBMA 4HT5A 5D6GA 2IPOB 4F25A 3NL0A 3KHLA 3JXOA 2GIQA 3TW0A 1RTDA 2Y1JA 2PC6A 2JFDA 4C98A 1Y5LB 4NLXA 4GMKA 4KKOA 2F63A 1ZAXA 2C3YA 4IRKA 2Z4PA 5AXNA 1RT7A 3V81B 3AXMA 2ZE2B 3OTOF 3TRGA 2RRAA 4CI0B 2LYVA 3GFHA 3GJTB 4FF3A 3DRSA 3CJ2A 3KLEB 4AT1B 4S0MA 2KFYA 4QPXA 3N01A 1M90T 2FJWA 4GC6A 1KNZA 2B9EA 4O3OA 4L3NA 2J6SA 3PFOA 1CQMA 4LQ9A 4NYPA 4IFVB 3EZOA 5KFMA 4PXDA 3MPYA 3G6XA 4DV2J 3H2UB 5KG3A 2CPJA 1HNVB 2O5DA 2ZOGA 4OX6A 3TA1A 1NPRA 1HQUA 5KG2A 2C28A 2M7SA 4JV1A 4IKAA 3G6ES 3I31A 1KQSR 3LF0A 4J9UE 3X3UA 3A8JA 3T3FA 4B3SF 6AT1B 3H8YA 2CDQA 4OZ3A 2VICA 3KXDA 1VQ8S 1DBDA 2HQIA 1J2VA 1EQ0A 4MIAA 1RAFB 1S9GA 4L76A 2J9DA 2ZH3A 3QRRA 2YPZA 1DLOA 4JI4J 4YMEA 3TAMA 3MM6A 5H9EK 1RT1B 1WI6A 3CCTA 2IVFB 4OIXA 2E7WA 3DLEA 4FYXB 5A6PA 2CNNB 1Q5VA 4NLOA 4OI6A 3CCVS 4P9SA 5CYQB 3QO9A 5CAAA 2MZQA 4HHHA 4ZJLA 5FJ4A 2PT0A 1R89A 2PI4A 4FPIA 4LBIA 2ASLA 3FJ2A 3O8WA 4LVNP 4F4ZA 1WHWA 2CPDA 1WOSA 1KN6A 2JDJA 2WSFC 1X9WA 3D54A 3UW1A 4RO0A 1D8YA 5KAKA 1M5PC 1B0TA 3FBBA 4UOFA 2DNLA 1QE1A 2XY6A 4P2SA 1Y4ZB 1TQLA 4R8UB 4KYZA 2ZOMA 4ZIVA 2GAGC 4O23A 4CWBA 1U49A 2KRBA 1WG5A 5J2PB 4KHPJ 5D4PA 1JLAA 3MEGB 1RGVA 2M2BA 3FBCA 1YGYA 4F0KA 2QG9B 2K1RB 2CYYA 4J9QA 3Q8PB 3GIJA 2G0IA 1REVA 4DFJA 3R5DA 3V4IB 3HT0A 1S4EA 1HW8A 3MCMA 3TOQA 3JSMA 3BN4A 4IR9A 2CVIA 5D4LA 3SXLA 3T1YF 1S79A 4X4VA 3VGTA 1C1BA 2F8MA 2FLOA 2ZKTA 3D67A 3I4HX 3P49B 2Q6BA 1ZM2A 3NWGA 2H9ZA 4MIBA 3M7VA 2UXDF 4F4YA 2VC1A 2BKNA 2VIHA 4URQU 1B0PA 5CXTA 2GV1A 2OFGX 3BR8A 1VQLS 4CP5A 4EBCA 1JNZB 4YN3B 1F5BA 3UPFA 4C3LA 4A47A 4DR3F 3I5AA 4P7TA 1B99A 4FKYA 3MCOA 5IT0A 2DHGA 2IVYA 3VAJA 5F8GA 2XLIA 2YKMB 2P2CB 4F3MA 4B02A 2MZSA 4JP8A 1Z2ZA 4HI2A 4K4UA 2V5HG 2I0XA 2VQFJ 3TQEA 4IRDA 1GMWD 1Y10A 4OYOA 3I96A 2Y0SD 1WC5A 4DV3J 1O0PA 1XJWB 5BR8F 4N56A 3DOKA 2HFNA 4KAIA 2AP6A 2XHCA 2R8JA 2YWEA 4X65F 2CWKA 4CH0S 1WD6A 4NA2A 2P9GA 4OX8A 4DV4F 3EDRB 4LMZA 4NEYA 3MFIA 4U8YA 4NCGA 2BKOA 4ZA1A 3Q23A 3OVAA 2I2YA 1QY7A 3RJMB 5CYJA 5AXLA 1AROP 2H4YB 3GYNA 3NMAA 5KFIA 1S9EA 2MSTA 5LSRA 3T5KA 5J1NA 3D0HE 3W8PA 1D9AA 2MQMA 1YWXA 3SDEA 1T05B 4OYMA 5KT6A 3FRYA 3OXFA 4IDKB 5CCLA 3UCZP 5DG9A 5F8IA 2OJ3A 1AB8A 1DAXA 2ILZA 2GHVC 1U1OA 2IYIA 3UVJB 2N4CA 3RG6A 4A46A 3HF5A 1LV5A 1FJ7A 5D0EA 5DG8A 4OZJA 2DNKA 3M8QA 2QC3A 4FXVA 1EIYB 2LU2A 3FEZA 1M5OC 1Q8KA 1N8RT 3CSKA 2MGZA 2MXYA 2BE7D 2DGXA 3FQKA 5KFFA 2XHWA 3PZPA 2VBXA 1S5ZA 3QJPA 1KP6A 1UPPA 3H90A 3MAAA 3CXCR 2UUAF 2EFPA 4L6V3 4X66F 3IS9A 3S6EA 2BA9A 2RKIA 4PABA 3T1HF 3QT5A 1MROA 1R8AA 3QNWB 4NLGA 2DT9A 3QGIA 2ASDA 2X1GA 3M8PB 4PUOA 2WK4A 1LFWA 1SJFA 3Q0AA 1IWGA 3MMAA 4ZPDA 2CADA 2KFNA 4WFZA 3HHLD 2N3OA 1N36F 4B3RF 1WEXA 4PYDA 5E3AA 1HW9A 2ZD1B 4OZLA 4PCQA 3CCQS 4YY3J 4ED6A 4OZ5A 1EB0A 3BGUA 2UUCJ 2B4PA 4I6AA 2M5YA 1HBNB 1TK0A 4CNZA 2L9NA 1T8EA 2XQCA 1S6QA 3W8GA 4C8ZA 2NYIA 3MFHA 3VAKA 4ZITA 4ZK7M 2ZBQA 2CQIA 2IJFA 3TZZA 1IKXA 2DRBA 3PRDA 2UZAA 2C2KB 5E5NA 1SC4B 4LJMA 2GQCA 1ZETA 3NOCA 1SL0A 3CJTA 5SUHA 3V5RA 3TAMB 5C5JA 3EICA 2HVEA 3W60A 2KT5A 5F3ZA 2UU9J 1FK9A 4ZPTR 3NGDA 1WHVA 4ZVTB 2DGSA 3AH6A 3OVSA 3BSOA 1I5OB 1YJ7A 3RUBL 2Z57B 4C8NA 2KVIA 3NGUA 4ECSA 4IQXA 3RB6A 4WCEQ 2DXFA 2DNYA 4ZLJA 2DY1A 2VFVA 5L38A 2NZ4A 1FDAA 2VPWB 4WK1A 3I82A 4W92B 2H51B 1RT4B 2XI2A 4Q2MA 1HQEB 3SQGA 3QQCD 9RUBA 2VHGA 1I6JA 1NB7A 2YX7A 1FKOB 2ZEJA 1TKXA 1S76D 3W7BA 2HNZA 1Q4RA 2QLWA 2MQLA 4ZVEA 2EK1A 3TEHB 3J81j 4M5KA 1DHMA 3E51A 1SJQA 1BWVA 1KQKA 2R4FA 3BBFA 4X4OA 3SI8A 3M9OB 2A18A 1VFJA 5DO2A 4NXNJ 4PQUA 2CQ3A 1CEZA 3GIRA 2SXLA 4N5SA 1UJ6A 3HSGA 1IBMJ 2CKWA 3K59A 2GX8A 4I2PB 5GAHU 1WDTA 3WX4A 1IM4A 3K5MA 1HI0P 4Y0FA 4WFYA 3KMQA 2V0NA 3IMQJ 2NQPA 4F67A 1NSKL 1S1VA 2QRRA 1C4CA 5C7PA 5KFOA 4NLUA 2EFOA 4KGZB 3HPOA 2MHEA 1D3WA 1FF2A 3KK2A 1HWLA 2AJ2A 3M4XA 1EZZB 4ZHRB 1JLEB 4JBCA 3LPYA 1NXIA 2DHAA 2VASA 3GIKA 3W61A 3DRRB 3QWPA 4DU7A 4AUKA 4KGKA 4DQPA 2N4DA 4B9SA 1HHSA 3N28A 2W2MP 2VDHA 4Y6IA 1UZDA 3NWRA 1NHKL 3HKZD 2WVCA 3PYFA 2E5GA 3J80U 3Q8SB 2E1MC 1JXVA 4I2QB 3MPUB 1DJ0A 5J2MA 1RP5A 1VGYA 4WYLA 1TR0A 5A76A 2CQ2A 2A1BA 1YDLA 1SV5B 3RAXA 3FQLA 3VZHA 4Q43A 4DSEA 3JTNA 2E66A 4WU2A 2DNHA 3Q8QB 3DOKB 4WFAQ 2XMWA 3UCUP 1TL1A 2W2PP 1FRXA 3BGFA 5L9NA 2MB0B 3CDWA 1U48A 1FWPA 2VKRA 4USVA 3PYGA 3C3LA 4KPCA 1CVJA 2RRBA 3JSRA 4TU8A 1SI9A 4ECTA 2KHDA 5HN0A 1RCOB 1U8WA 2DITA 4WXWA 1IQZA 1TVRA 2J9EA 3LP2A 1RYSA 1HL6A 5HQMA 5CHCB 1DFDA 5HJXA 4P71A 2ZNZA 4C11A 3R27A 2BKPA 3GCXP 3CMAS 1CJVA 3CEDA 1S9EB 3SV3A 4WWSA 2NUHA 2Y1RI 3SSSA 2OPRA 5HVGA 1XERA 3MTKA 1LQ9A 5B08A 5AJ3J 1Q81T 3FCVA 2M52A 3DU5A 4ZP8A 1J5OB 3VV2B 4G1QB 3VAGA 4LR7A 3KJQB 4FYVB 2KZMA 2R7WA 5H9EJ 2YY3A 2ZH6A 2FJBB 2BANA 4LRDA 3DNCA 1JLQA 4GKKF 1MWYA 3V6DA 1UVKA 2JFKA 4JI3J 4DR1F 1ZH5A 3M8QB 1TP7A 2W7PA 2W2OP 1AW0A 4CM2A 1RZMA 2MTLA 4HACB 3QLHB 4WXOA 2MGZB 4K4VA 3L9ZA 3T19A 2FC8A 5B7WA 1WJ9A 4DCPB 4HI1A 2EC0A 1HA1A 3KMSA 2C1EB 2B9YA 5FDLB 1FERA 2MLYA 4WTOB 1FKAF 1EETB 1PIEA 2HFVA 4K2XA 2OELA 1HKAA 3G82A 1FKPA 5BJRA 1KTVA 1YJTA 5L1IA 3OHAA 4DR6F 3O44A 2BBEA 2DR5A 2YNHB 1V3SA 2DGTA 1XR7A 4K4WA 2V8HA 1WDDA 3CCUS 2CJ9A 3HHLC 2UXCJ 4AXIA 2YNIB 5K20B 3R97A 1RTHA 2CPXA 1RE1B 2DNPA 3SIPB 4DFKA 2J8SA 4JI8F 3OSPA 2FC9A 3EGVA 1MWZA 3QIPB 2FD2A 3EZUA 1D0EA 2R7SA 3NNHA 1WOOA 2AEFA 2OD6A 3VF0B 4DZ6A 3LGHA 5C25A 3BGRB 1Y3JA 4QIFA 4X4RA 3FEXB 1S6QB 4DDFA 3PG9A 2XI3A 3DC2A 3G6VA 2E9RX 1IKXB 1RTIA 4L73A 2XMMA 4ITSA 1XN9A 4LF6J 1NSQA 1NUEA 3H2VE 1S1TA 2VBZA 4UOHA 2DGOA 3Q2SC 4RBTA 2R8HA 4XPEA 5ADZA 4EBDA 1XEZA 1S6PA 5ETKA 2G9OA 3CCZA 4PWDA 2FVCA 3K58A 3POTB 3P3DA 2ZBCA 5BYQA 3N0VA 2W4CA 4KGVB 5ETVA 1U25A 1WELA 1R0BG 4WK3A 1MW7A 2EPIA 4EO6A 4I64A 1WG1A 3AJ1A 2Y9HA 4YHHJ 2CA9A 4DZDA 2YX1A 5KFPA 2GS8A 4JV5J 3UCGA 2ZH2A 1DQAA 2VJVA 3KJVA 3CDUA 4UTGA 3BQ0A 2HHUA 5I3UB 5F8HA 3LW5C 2ROEA 4JV0A 4ZVFA 3MR3A 1LW0A 3DLKA 1K9MT 2HBRB 1IKVA 4IG3A 5KFNA 2YQ1A 4WFBQ 3ILJA 4OX9J 3NS7B 2HIYA 2Z58B 3QRPA 5E2QA 4LR9A 4ED7A 4ANCA 2CRLA 4CO4A 1YITS 3GONA 3MECB 3PM9A 2C3UA 2LA4A 1CG2A 3GILA 2I8EA 3FCHA 1HWKA 1KR4A 3CTRA 4ZVHA 1R8CA 1SUQA 2KM8C 3DRXA 1TU0B 4ER8A 4JI5F 2HHPA 1UW9A 1U24A 1RJJA 2PEBA 4RZRA 4UUWA 3D28A 1YRTA 3P6YC 1SJRA 2Z2YB 4AE5A 4WFXA 2ZH7A 4ALZA 4U9RA 4LFAF 1KDNA 2AHOB 3G86A 4ZLNA 3PJXA 2FHKA 3EWGA 2DNQA 2AEJA 2GO8A 4RUCA 2DCLA 3TX8A 1RAHB 4Q0BB 4LIRA 3Q2TC 4LFBJ 1HNIA 2VA3A 4XK8C 5G0RA 1ZZNA 1VISA 1XNQJ 5M2UA 3HULA 1R6YA 2G1DA 5A8KA 4B9VA 2I6WA 3I9V9 1WF2A 4DQRA 4CZCA 1VQSA 3NCPA 1IWAA 1TL1B 1CJUB 3ZTQA 5LXRA 1H72C 5KFAA 3CMES 4XDDA 3C16A 4WKYA 4AXJA 5LMNJ 5L8RC 2VBYA 3DLGA 4DUZF 3OQ2A 3J7Z5 2DGWA 3GQCA 3G2XA 1KVKA 4KSEB 4Q5VA 1RI7A 3AA8A 2JEIA 2IAJB 1I51B 3K5OA 1QSLA 2IBOA 4EWTA 4ELUA 4C11B 4EUVA 4F2RA 4B08A 4ECUA 7AT1B 5KFXA 1CJVB 1DTTB 2J76E 1HNXF 4ELTA 3KLFA 1N5VA 2WCXA 4M5DA 3UN2A 4RJVA 4I1TA 2ZJQQ 1P27B 1S1XA 1TL3A 3VQTA 1R7IA 2HQ3A 2E5IA 2DH7A 4F4KA 2W7OA 3IRXA 2C2RA 4RW9B 2AYBA 2KO1A 1CULB 1RT2A 4AL5A 2KVQE 3LWLA 4H4MB 3K8VA 2YTCA 2ZVIA 1NKCA 1T03A 1KWMA 2DR9A 1CSJA 2ZM6F 1WHXA 4TLQA 2AV5A 3N6NA 4ED3A 2JLGA 1S4FA 3MOJB 5B0AA 2CZVC 3JYTB 2B3TB 2MZ1A 2FPHX 4GVLA 1REGX 2B9WA 2ZHBA 5EGYA 4HYKA 2FHJA 2OMLA 1NAQA 4OL8A 2MKCA 3PW7A 2JEFA 3I9ZA 3TZXA 4ETXA 3BH7B 1FX2A 2HBYB 2XMJA 3C6TA 2FJXA 4OYIA 2PEHA 4MFBA 3Q8RB 2R2UA 3CF5Q 2QX0A 2CG4A 2BW2A 1H7WA 4F26A 2R7OA 2DXEA 2QMWA 2N82B 1PC4A 3MMCA 4XAKA 4FYWB 2FJVA 1T3OA 2VFSA 5ETPA 1HNZF 4NZ6A 2HKEA 2XG8A 1YVFA 4ES3A 4P74A 4TQSA 1FT8A 3CCWA 1TUVA 2YNFA 4TYAA 1VCTA 3FCWA 4V1Ak 2EFQA 3S7RA 3EPIA 2QSFA 2DO4A 2MJNA 3Q83A 3A12A 2J5AA 1UWAA 4ELVA 4H4OB 2IM1A 2YKPA 3DHWC 1UVJA 1KVJA 3CC4S 4DXLA 1H74A 1S1TB 1NJIT 4B9LA 1QAIA 1X4DA 2MDAA 3U02A 3FRZA 3IG1B 3GR0A 4U6PA 2C2MB 2XCPA 2WW4A 5A8RA 1V3RA 3J7YI 5JMNA 1S6PB 2AGQA 4PWDB 3TQ1A 1FX4A 4W4MA 4DJBA 2Q43A 2FB0A 2RUSA 3MM8B 2PFFB 5CZVA 1Q16B 1JKHA 1AUDA 1NDKA 2CQDA 2DGVA 4IFYB 2FLLA 4N7TA 2AYMA 2EVZA 3IRWP 4C7QA 3FFIB 3RYLA 2AGPA 4OZ2A 3ZTPA 1VQYA 1WEZA 1SCJB 1U1NA 4U67Q 3KHGA 1LXJA 3X1LB 2G2ZA 2FZCB 4UUXA 1LW0B 1F3VA 4TVAB 1B4SA 4X4TA 4WE1B 3LP1B 1KQGB 2G1HA 1HI1A 3DGPA 2WONA 4FP9A 3R7NB 1OYDA 1RWMB 2FHOB 3CDAA 2YKNA 1NPKA 2J0XA 2H5EA 4ZCLA 1JIHA 3HLUA 4QIVA 3HHKA 3CW2C 3QZ8A 2UXBJ 3IXQA 3M6WA 3PHEA 4ICLA 6FDRA 1N56A 5KFRA 4C97A 4FVMA 4ILMA 1VQNS 3AAWB 4TY8B 3PIOQ 1HMVB 5LJ3Y 2XGPA 1RAOA 2EBEA 2VONA 1SXLA 3R8YA 1G6BA 3KK3A 2VG5A 1N5TA 3RBXA 4M94A 1F9HA 2AT1B 1NB2A 3MXHP 1I1GA 4FPRA 4YR2A 4OX7A 2EKNA 5RUBA 1MG7A 2OEMA 4M5MA 4CCHA 2H4WB 1LNQA 2YBVA 4Y2CA 2D3OR 1WI8A 3M2UA 2B9XA 2J0WA 4OQJA 2QA2A 5J1EA 1GX6A 5HATA 4RW8B 3MD1A 2QYCA 4ZVOB 3G71S 1X8DA 3MMBA 3KUHA 4C9DA 3U1LA 2LDIA 3NGTA 3VVUA 8RUCA 3GP9A 3ITHA 5IQ6A 4KTQA 1K73T 4M5JA 1RTJA 3UR3C 2NS1B 4QIEA 2KXFA 1R3NA 2U1AA 3KLHA 1K1SA 3OFGA 4WU3A 2JWNA 5A8KB 3SCIE 2CPYA 5HJYA 1LXNA 3IBFB 4YDXA 4X4PA 2ZJRQ 2BJDA 2DCUB 2F40A 1WORA 1HPZA 2LQ5A 3QT8A 1TFWA 4DR7J 3UO0A 4FN5A 4ZJOA 1TAUA 3NOGA 2Q1LA 2XNRA 5B0EA 4Q8EA 2V50A 3OFHA 3C16B 1S0NA 4ZVUB 2GGPA 5C42B 4JI2F 2QLXA 3OTOJ 1FD2A 3BPSP 3OSNA 4YQWA 4NCBA 1N88A 1CS4B 3AQOA 4ILLA 4QQBA 1NK8A 4U8VA 4PG6A 4G1IA 5GMKa 1F5AA 5AXKA 4OJGA 3CCSS 2ADBA 3BKUA 2KFZA 2CIMA 4M5DB 2HIQA 3CE8A 1ZM4A 3RGIA 3MM5B 3C6UA 3IAS9 1C2PA 5L46A 1TL3B 5EX0A 3AJ2A 3IRXB 3BM7A 4CO1A 3HK2A 1RT2B 5IZHA 2DEJA 2RU3A 1WACA 3J7AN 5C2CA 4IOCQ 1YK9A 4B3SJ 4QWBA 1T03B 3R5AA 4F7VA 3ZNJ1 2AD9A 3NXZA 4M5LA 3IWNC 4RW4A 3FSIA 1EHWA 1SQEA 5I4MA 2IJRA 5KT7A 1XWLA 4A8QA 2DNOA 2Z56B 2CPEA 2OO4A 2Z2MA 5CA5A 4RR5A 4DL7A 5H9FJ 4JI7F 1IQTA 3RW7A 3E3XA 4J9LA 4I4BA 1PBAA 2FLNA 4DOZA 3ISND 3LO3A 3N9UC 3NP5A 3SSRA 2GVDA 2HWIA 3IM8A 4MFBB 4OMFG 3HJFA 1KC8T 4DLEA 3G4SS 2KTQA 4ZOSA 1FDDA 3GFYA 5F9NA 3CDBA 3ADAC 3F0NA 2WSCC 4Y34A 3DDIA 3BO3A 3I56S 1RKJA 3R3TA 4PR6A 2Z2LA 4YOEA 3O6QA 3VAMA 4ZCIA 2WBRA 2FUG9 1FJGJ 3QAUA 2RDIA 3PV8A 3K5LA 2YNFB 3MUMP 2WB4A 2HHWA 2HVHA 1K0TA 4ZP7A 3DM2B 2QLJB 3C14B 2V68A 5CABA 5C24A 1WSVA 1W2BR 3OR1A 2B8PA 3CVKA 5DDRC 3CJKA 1Q5YA 4QZVB 1N33F 4IH6A 2CJBA 1FNMA 3OPKA 1GXTA 3MM9B 2QMUB 1FRJA 5F0WA 1RAEB 4QW9A 3TARA 3FSYA 1IKWA 2D7SA 2JH3A 5HMZA 1HBUA 1RBAA 3KLGA 4WYWA 4ZVRB 3V6KA 4Q8FA 2DBBA 5J1PA 2OKQA 1X4HA 1S97A 3M8WA 3T1YJ 1RDRA 4FXWA 5A8RB 5J2NA 3RRGA 1XMQF 3KYLA 4X84A 4RX6A 5K5MA 1H98A 5HP1B 2GMJA 3E8OA 5HROA 3UR0A 4WJBA 3T9NA 2UXDJ 1LWEA 2C2ZB 3THVA 2HAIA 3OFEA 1BMQB 3OR2B 3I6PA 3D6HB 4IUFA 3A3NB 2COLA 4DR3J 1WTFA 2V6AA 2Z0GA 2X1BA 4MT1A 2ZH4A 4UY85 3OL6A 1Y0HA 5GADI 5M2PA 1VC6A 3ZZRA 5J2QA 2RIJA 4DSKA 2BW7A 2AJQA 1B64A 4DUYJ 2I1RA 3MAQA 2CQ4A 1PJ5A 4MMOA 3PACA 2ZDOA 2OTLS 1T3NA 2EW9A 1O6XA 1DQ8A 3DYAB 3HI9A 3W66A 1JWWA 2MQ8A 3JS9A 3W1YC 1PO6A 4DV4J 5LT5A 3UE2A 1MSWD 3K5PA 4DL0C 1X60A 4TXSA 3RR8A 1Q86T 4JI0J 2XY7A 1IUJA 4DF4A 3MDFA 2W4DA 2B56A 1ELOA 3GJQB 4B17A 2PMZD 4B3TF 1URNA 2V94A 2LQ9A 1AA1B 4F36A 1OPZA 2DVIA 3DMJB 1JJCB 2AZ3A 4USMA 1N5YA 2RQCA 4ZP9A 3SMZA 4NI2A 2IM2A 5J1EB 2OMOA 3NGRA 3CIMA 1X4GA 3JB9k 1JLGB 3MMBB 1JMTA 5L1JA 4WIIA 1RCXB 1VQ6S 4NRTA 3OXLA 3EPGA 5IT9Y 2JLEA 4RUBA 3K5NA 3FDSA 2HLTA 2VQFF 2HHXA 4JUZA 4MIWA 2HS4A 2A2DA 3GU0A 3P5TL 3RRKA 3ZZ0A 4B9TA 4G1PA 1TL7A 2EG1A 2DNZA 4MKBA 1R8HA 3D1QA 1U09A 5DDQC 1NJWA 1FXRA 3FSXA 1E6YA 2K7KA 1HPZB 2BR0A 1U1PA 3DLHA 3T1AA 3RRHA 2NR0A 3HD2A 1XMOF 3GJRB 2BOPA 4IOAQ 3TEGA 2IYGA 4DV1F 3AA9A 3MAHA 3MM7A 3PJWA 2ATLA 4LFCF 1G4CA 2K2PA 3TAQA 2AMCB 2UUAJ 3PCOB 2B7BB 3AODA 4DPTA 3A1YG 3PXGa 4RNOA 2X3GA 4X66J 4OYXA 4ED8A 1RXOB 2RAQA 1W2IA 1QAYA 8ATCB 1IVZA 2FTRA 4UOCA 1TKZB 1HYSA 4QYZK 2OEJA 2GVZB 1OPIA 2XMKA 2GIRA 2QLFB 3GG0A 5AT1B 3GV5B 2B6AA 4QR2A 1MNEA 3D4JA 1N36J 4B3RJ 5THWA 3CJQA 4QBUA 1AUSL 2CDRB 2MY7A 3CJ8A 4UZBA 2HHHJ 1LWCA 2M3DA 3K57A 3DRPA 2BJ9A 4O0NA 3BYPA 2CUYA 3GSDA 3I0SA 2HK3A 3AD8C 5HLFB 1A9NB 2HMIB 3EJMA 4P52A 5IOLA 2W01A 4DX8H 1OWXA 2HFSA 2HS0A 3PKMA 3NEKA 4ES2A 4B3OA 3ISNC 1F0XA 2OPSB 4UQTA 3MHYA 2MKKA 1BQMA 3PRBA 3ZNUA 2LCWA 1KEKA 4DV5F 2RS2A 1TV6A 2F9JA 5HMWA 1J5EF 3C66A 3D1OA 1L3VA 5DZ6A 4FBUA 4KV8B 4K50A 5HO4A 1HD1A 3LP0A 1FRMA 5IXUA 5D8HB 3H59A 4ERDA 4NCAA 3MPDA 1H3DA 2HK2A 5JVHQ 2KT3A 1YZ7A 3QSYB 2OPQA 1VIOA 4RL1A 2XSJB 1CC8A 4JYAF 1RQ0A 3TYTA 5F0UA 1NMEB 3R5BA 2I9SA 1QD1A 2E1RA 2AEMA 4USWA 4C0HA 2APOA 5DS7A 4DX5A 2WOMA 4OHZA 2J9DE 3ET6A 4YY3F 1NSAA 1N6QB 3PO4A 3VGVA 3OR1B 3D6FB 1GAOA 1Q53A 4DMZA 3UDVA 3CJKB 1BY9A 4LF5J 2KU7A 4FNHA 4BBYA 2WVDA 1SH0A 2VG7B 5DDOC 1VC5A 1GMUA 2H5IB 2F3JA 4NLYA 3UDEA 1U45A 3MR2A 4J37A 4KR0B 3KLGB 2EFGA 3H5YA 1LW2B 2E7VA 5EHHA 3RW6A 1SC6A 4K4TA 2BJ8A 2RF2B 3AXKA 1F1BB 5J2NB 2AWZA 2QL7B 4F0MA 2OIHA 4O3NA 2BABA 2KH9A 5A8WA 3NS6A 2E9TA 5HBMB 5KFVA 2NZCA 1T9YA 1PGZA 3NRBA 4OHYA 3WX8A 4URGA 4KFBA 1S1WB 1WTBA 2MQOA 1DRZA 2HRUA 1BHNA 1VMBA 4NLWA 4YEAA 1VQ7S 3LGNA
chains in the Genus database with same CATH topology
3G6YA 4K2XA 1UA1A 1UEUA 1FKPA 2RF2A 5BJRA 1KTVA 1YJTA 5L1IA 3OHAA 5A6WA 4DR6F 1QUVA 4NWBA 3PFEA 2W9BB 5EWEA 1Q8BA 3O44A 3BDEA 1SJ1A 3ENVA 2BBEA 1I94F 3DRYA 2X1AA 2DR5A 2YNHB 1V3SA 3BEGB 4DR5F 4EEYA 1X0PA 4OJ1A 2HVIA 4BHQA 3B4DA 1YSJA 1ZPVA 2L48A 2DGTA 5EX3A 1XR7A 3U7JA 2YQ3A 1IJFB 1FDNA 1GXUA 4K4WA 2V8HA 1NK5A 1QVFR 3CCUS 5K8MA 1IJEB 2CJ9A 3HHLC 1IKYA 1DTQB 4O44B 4J9KA 1MMDA 3K7RA 4AXIA 2YNIB 5HBMA 3QLHA 5C25B 3FMWA 3M2RA 2FDNA 1RTHA 5KG4A 2CPXA 1S6UA 3R1HA 1S1WA 2PA8D 2BVZA 2DNPA 2AQ4A 4B9UA 3VQSA 5CYMB 4DFKA 3H20A 5KT5A 4JI8F 1V3ZA 3GFXA 3OSPA 2OPPA 4N77A 4NXNF 2KI2A 5KOWA 4O3SA 2FC9A 5FDLA 2GQQA 1TFYA 4XDCA 3RAQA 4EBEA 1HD0A 5FD1A 1UKUA 1RTIB 4O3QA 1EETA 4MKAA 4A8KA 1U47A 3J81Y 1MWZA 2FJAB 3CIZA 3OFFA 2NPIA 3MR5A 1R8BA 3F44A 1E6VB 3HZEA 3QIPB 2FD2A 4K4SA 1WF1A 2JEJA 3WC0A 3EZUA 4M63A 4RNHA 5AXMA 1D0EA 4LSLB 2RRNA 2YNHA 3AB2B 2R7SA 3FZ2A 3C46A 4I6YA 3BB5A 3MPVA 4C0BA 4ZLPA 2EG2A 2M8DB 3UQSA 1VJWA 2P5VA 1C0TB 1TL4A 1X5TA 1VRUA 4O44A 1DTQA 3NNHA 3W2WB 1FRIA 2OD6A 4IH7A 4OI3A 3VF0B 3CCMS 2YNIA 2HGLA 5C25A 3BGRB 2LQBA 1Z1ZA 3QPIA 2KXNB 1Y3JA 4GKJF 4QIFA 3O5TB 4X4RA 3FEXB 1S6QB 4DDFA 3DLLQ 4IYQA 2AX1A 1IBKF 5CYMA 5FIIA 3SZ2A 1VK3A 4FS1A 2XI3A 3DC2A 1JLBB 3PEJA 5DGAA 1IBLF 3G6VA 2E9RX 1IKXB 4WFNQ 1YHQS 3RB0A 2AGOA 4G6VB 1PC5A 4OI4A 1UVMA 1RTIA 5D77A 2XMMA 4LFBF 4ITSA 2V4JA 3MWBA 1XN9A 2WTFA 2PN6A 3QIPA 1SIWB 2KDOA 2VOPA 4RW7B 2VPYB 2V2KA 2ZZMA 3B82A 3CD0A 4LSLA 2HHHF 3H2VE 5IS2A 2BE2B 3DOLB 1S1TA 2VBZA 1XNQF 2QA4S 4DLGA 1N5YB 3HHNB 2DGOA 4TN2A 1C0TA 2BQ3A 3Q2SC 4RBTA 4Y65A 4ZDNA 1QAJA 1B7FA 3QJLA 1RA6A 3W2WA 4I69A 2V9KA 4NLVA 4NYZA 5IT4A 2R8HA 4XPEA 2F4VF 5ADZA 3BGRA 4EBDA 2X51A 3KJVB 2MQPA 1NHVA 1XEZA 1S6PA 2L9WA 2G9OA 3CCZA 4PWDA 2FVCA 3NLCA 4MYTA 1HR0F 3K58A 2ZZNA 3PEHA 2FJEB 3POTB 2DD8S 2G0CA 5JXSA 2MZTA 3P3DA 1XC9A 4Z2XA 4N8OA 2ZBCA 4OI2A 3FEYB 5BYQA 3RBEA 1GXLA 4Y3CA 4UQGA 2HZCA 2BACA 3I4PA 3N0VA 4PPZA 2W4CA 2RDJA 2MSSA 1JLBA 2L9DA 4DL2A 1U25A 1G3OA 4LVOP 2K3IA 3BO2A 1WELA 7FD1A 3WZ0A 3PY8A 4WK3A 2LLZA 3HHLB 2Q79A 1MW7A 3C2PA 2EPIA 4EO6A 1T7PA 3DLKB 4LT6A 3EXCX 4I64A 1WG1A 4RW7A 2ZDPA 3I5BA 5KFJA 3AJ1A 1IKVB 3E01B 1S9FA 1U6BA 2Q6CA 3L3CA 1VRTA 4IG3B 2BE2A 4LF9F 3DOLA 4J9MA 5DG7A 5LMNF 1GTEA 1X4AA 4LF7F 4OI0A 2ZH5A 1SKRA 2CQGA 3UDLA 2YX1A 1HI8A 3HZGA 5KFPA 5LMUF 4QWDA 4I68A 4Y2AA 4BC7A 5IFMA 3M1VB 3UCGA 2ZH2A 4XIUA 1DQAA 3KJVA 4ZVGA 4RWXA 2BM0A 3CDUA 1C0UB 2JRSA 1E6YB 3POTA 3KLEA 1NK0A 3UDCA 1G2EA 1FE0A 3BQ0A 4HH1A 2ASJA 2HHUA 5KFWA 4H4KC 5E0OA 5I3UB 5F8HA 2K8GA 3LW5C 3CULA 1NRKA 4DG1B 4KO0B 2EKYA 2E5JA 2PE8A 2ROEA 2DR8A 1NK4A 5KG6A 3DI6B 4JV0A 2JVRA 1ZYQA 2M9KA 1SB6A 3HHLA 3GFZA 1FESA 4ZVFA 3MR3A 1OSDA 1LW0A 3TR5A 4V19J 2ZVSA 1MMLA 3DLKA 4GO5X 1P1LA 2ALZA 1K9MT 3LH2S 2C3MA 1IKVA 3E01A 3HVWA 4IG3A 4BCAA 4KT0C 5KFNA 2IJNA 4WFBQ 5JUMA 3MR6A 4PKDB 5CD4H 1WWHA 1SUQB 1U26A 1S6OA 5BYRA 1YJVA 2KYXA 3LUYA 5E2QA 3K8WA 3OJSA 2ACYA 2HFZA 3M1VA 3GG1A 1FRHA 3SV4A 2UP1A 1LK5A 1RYRA 3ZZYA 1VHFA 2QZ8A 1C0UA 1V6HA 2FY1A 3TP2A 5AE1A 3RB3A 3SSQA 3PX4A 2RJZA 4ED7A 3HVAA 5KFEA 4RNFA 3FMBA 3NS5A 5I3UA 3M32B 3KK1B 2CRLA 3JTOA 1U1LA 4P6QA 4DG1A 4CO4A 1YITS 4KO0A 4MKYA 3DI6A 1JK9B 2GFFA 4X64F 1GQEA 4YP3A 2FLPA 4CTAB 3ZC4A 2J9CA 3U1MA 4DSJA 1VQOS 1VBZA 4C0OC 2WBMA 4X4UA 3MECB 3PM9A 4ID5B 2NSBA 1JJHA 2C3UA 2LA4A 1CG2A 3GILA 2D9PA 2I8EA 1HWKA 1KR4A 2AJFE 2B4VA 3FCHA 4ZS6A 4DL6A 3CTRA 4ZVHA 1KQFB 1FXDA 3M6XA 2YNGB 3TNVA 3M9MB 4C8MA 1R8CA 4LF5F 5IM0B 2OSQA 3MGJA 4ZKAA 1SUQA 1YBAA 4QYRA 5KFYA 1PSDA 2V4RA 4G3IA 2KM8C 5DLFA 4FF4A 2A2CA 3PW2A 1HNIB 3DRXA 3G8QA 3IGNA 3ZZPA 5HMXA 4I67A 2HNDB 3IWXA 3QYYA 4F3OA 2M0GB 3PX0A 1QJHA 4K5SA 4JI5F 2HHPA 2FVQA 5G0RB 4ECZA 1G7CB 5DM6Q 3L09A 1FEHA 1TK8A 2PD1A 1U24A 1RJJA 1WEYA 4RZRA 4UUWA 3D28A 3SCLE 2IHR1 4KB7A 3DRPB 1YRTA 3CO9A 4K59A 3P6YC 1SJRA 2W25A 4AE5A 1LOUA 4WFXA 2ZH7A 3KK1A 5KFUA 4ALZA 4U9RA 4LFAF 2PSZA 3I0RB 1R0AB 2OFHX 3G86A 2DH9A 1EP4B 3PJXA 4USJC 2FHKA 4CTAA 1YIJS 2DNQA 4O3PA 2XS7A 4X4NA 2GO8A 2OD4A 4RUCA 3MECA 1Q82T 1RISA 2DCLA 2UUTA 2IA0A 4U7UK 3FZBA 5KFHA 3KTQA 3TX8A 2LDYA 4NLTA 2RQKA 2LKZA 5HI7A 5H1SV 2P6SA 4OZNA 2YNGA 2DK2A 3NNAA 2CJKA 5IM0A 1OQ6A 5F41A 4PG8A 2UV8G 4LIRA 4Q0BB 3EGWB 3IA0A 3Q2TC 3OUYA 2ROGA 1HNIA 1URRA 2F1FA 2VA3A 4M95A 2OTJS 2HNDA 4TLRA 4XK8C 1BQMB 5B0BA 1QTMA 5G0RA 1N32F 2YWHA 1IN0A 1ZZNA 1U4BA 4V19X 4QWCA 2RU9A 2DIVA 2UVVA 5T41A 2RD5C 4Q7AA 3DLGB 5M2UA 3CPWR 2VB6A 1R6YA 1APSA 2G1DA 2DHSA 5E3RA 5A8KA 3CC7S 3I0RA 3MZIA 1S72S 3DFEA 4B9VA 2C22A 2M4MA 2FGCA 2VV5A 3O1LA 5T7LB 4C3KA 3I9V9 1YJNS 1KD1T 1TKDA 1WF2A 1EP4A 1DQ9A 3UI3A 4DQRA 4B9NA 4CZCA 2K7JA 1VQSA 2J7WA 2YWGA 4K5RA 2HNYB 3T6JA 1U6FA 1UWBB 2E29A 2IC3A 4DV0F 3NCPA 1TL1B 3OTBA 1HWJA 2KJVA 2HWHA 1TKTB 1OSCA 2GMLA 4OLPA 5LXRA 4A8YA 3BJYA 2MQNA 5A0YB 1SBRA 3KG4A 5E3QA 5KFAA 1JLCB 3KLFB 3G8TA 4Q0BA 4H4KA 3CMES 4RU9A 1KLMB 3MEDB 4Q2LA 2EK6A 1Q7LB 2RUGA 4XDDA 2HYIB 2W9AA 3O2IA 2BRKA 4WKYA 5DRKA 2B4OA 2HHSA 1A7GE 1S1XB 1LFPA 3CJ5A 4OLOA 4AXJA 2NLWA 4HDHA 3Q22A 5L8RC 2VBYA 4R0EA 5D3GB 4F2SA 3DLGA 2ZH8A 3GYXB 3CD7A 1FVSA 4UW2A 1YJRA 4DUZF 5J2PA 3OTEA 1ZTTA 2AJ0A 3OQ2A 3J7Z5 2DGWA 3T9ZA 3GQCA 2RNEA 5GAEI 2V4QA 2XMTA 1CQNA 2VBWA 2MYFA 3KLIB 4KSEB 3N6LA 4Q5VA 3GIMA 4J9PA 3H4BA 1RI7A 3AA8A 3GV7B 2JEIA 2KM8B 2IAJB 5EN1A 2XNQA 3HO1A 2BYCA 4NXMF 4R25A 1KOOA 5K9FA 2HNYA 4Q45A 2XC9A 3K5OA 1QSLA 4MAKA 1UWBA 2IBOA 4EWTA 3TI0A 2K1RA 2QSWA 2L3MA 4ELUA 4F4WA 1UL3A 1HWUA 4C11B 2MQQA 4EUVA 3AQPA 4F2RA 4B08A 4ECUA 2UUBF 5KFXA 2IRUA 2J76E 1DTTB 1HNXF 2IBKA 4ED5A 4LQ3A 5A0YA 4QWEA 4ELTA 3PR5B 2BXJA 4YFUA 3P96A 1YRXA 1JLCA 3KLFA 5KFGA 1QUPA 4LSNB 1N5VA 1KLMA 2WCXA 3I32A 4M5DA 2GJ2A 4IG0B 4NMLA 4GC7A 5L39A 2E7XA 3GZ7A 1GX5A 4CT8A 4I1TA 1XR6A 2NUUG 2POKA 2ZJQQ 1P27B 2CPIA 1TAQA 1S1XA 2KJWA 3EGZA 2E1AA 4IRCA 1TL3A 4CO0A 3VQTA 3SYZA 4FVCA 3A8EA 5D3GA 1R7IA 2HQ3A 2D1CA 4Z37A 3OLAA 3OBIA 2E5IA 4JI6F 2DH7A 2DO0A 1SKWA 5B0CA 4F4KA 2W7OA 2WRMA 3F41A 3IRXA 2MZJA 2IM3A 2C2RA 3KLIA 2JVOA 4QU6A 4DHVA 4RW9B 3IO1A 3LGMA 5EDWA 2AYBA 4HTIA 2KO1A 3MI7X 2IAJA 3BSCA 4AL5A 1RT2A 2R2RA 2CQ0A 5KT2A 2J0QD 3WDOA 2UUWA 1HFEL 3KFWX 3MOZA 4KPYA 2ZKUA 2FGOA 1RT3B 4LF6F 3LWLA 4H4MB 2VL1A 3LALA 1NJXA 4KIAA 3W2VB 1NKBA 3K8VA 2YTCA 1NKCA 4OZ1A 1DTTA 1T03A 3CCRS 2DR9A 4O4GA 3C6TB 3LAMA 2CQBA 1CSJA 2EI5A 4FNIA 5L1LA 2VC0A 2C2DA 4UY8T 2ZM6F 4LSNA 3J80Y 2R2SA 3QGGA 1WHXA 4TLQA 2AV5A 2D3ZA 3N6NA 2R2TA 4FYDA 4EYIB 4IG0A 5GAGI 2JLGA 1S4FA 1VI7A 2W8KA 4ED3A 3MOJB 5B0AA 3MCSA 1S99A 2CZVC 1KTQA 5CH7B 2KG1A 2B3TB 3TUZC 2MZ1A 3JYTB 2FPHX 3UD4P 4BDPA 1UFWA 2YKMA 2M88A 4B9MA 4PRFA 2B9WA 3ZZUA 2ZHBA 1U1MA 3OLBA 3O3LA 1N52B 3J7YU 5A8WB 5EGYA 3HDSA 4IO9Q 4HYKA 2FHJA 2OMLA 1NAQA 4OL8A 1M5KC 2MKCA 1V9OA 4RW9A 2DH8A 3PW7A 2JEFA 1Q79A 3I9ZA 1LWFA 2R7QA 3MMCB 2C3PA 4DFMA 3UD3P 2AU0A 5AE3A 4ETXA 1ZM3A 4ED2A 3DN9A 3M30B 4AL6A 1RT3A 5LL6d 4H4MA 1S77D 2RE1A 3W2VA 4O4RA 5K14B 4DV2F 1KFDA 1S7HA 5F3TA 1DZ5A 1FEEA 2XMJA 2EFVA 3C6TA 4DQQA 1UEVA 4RNNA 1U2RA 2FJXA 2R7XA 3H5XA 1K0VA 3V4MA 4RKUC 2PEHA 2HHTA 5JJBA 2VG6A 2P9CA 4RW6A 2GMHA 3TA0A 3EYZA 4MFBA 4DN0A 1ZAVA 1ZPWX 3Q8RB 3HVTB 3JYTA 4C4WA 3MPWA 1Y7PA 2HFOA 2R2UA 4FZVA 1NJYA 2GHPA 1FNOA 1A6LA 2MY8A 2B43A 3CF5Q 4ZPVR 2FIUA 4O0IA 2CG4A 5DJBA 1M5HA 2BW2A 2V8VA 4NLSA 1H7WA 3HHEA 3T6BA 2QFJA 1IKYB 3ISZA 2RB7A 1XTZA 4F26A 3AB4B 2R7OA 2GO9A 1JXLA 3NMRA 1UMJA 3V2UC 4LF4F 2QMWA 1P8GA 1T94A 2N82B 3Q24A 1PC4A 3MMCA 5U47A 2FVRA 2O3DA 4X4SA 3RZAA 4XAKA 2XSFA 2JEGA 3M30A 5D4OA 2C42A 2GCFA 2FJVA 1VS3A 3I5CA 4KHMA 2ZJPQ 1JXEA 2BDPA 4HEA9 1T3OA 2VFSA 3OJUA 4DFPA 5DDPC 1HNZF 4A48A 4NZ6A 3DCAA 2F8HA 2OPPB 1Q78A 2XG8A 3AY0A 5K14A 5F8LA 3PKYA 1NKEA 4R5PB