1FRMA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCAPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frmA00
1FRJA 4XDDA 3MMCA 4YDDB 2Z8QA 1G3OA 4XDCA 1F5CA 3EXYA 2VPXB 3MM8B 1CLFA 1BD6A 1JB0C 3MM8A 3LW5C 3OR1A 2C42A 1PC4A 4L6V3 1D3WA 1FTCA 2C3PA 1Y4ZB 3MM6A 2C3UA 1SIZA 1FDDA 2FJDB 2C3OA 2FJAB 2PDAA 1C4CA 2VPWB 5BYQA 3MMBA 4AYBD 1Y5LB 3HKZD 1H7XA 1BQXA 1FDBA 2V4JB 1DFDA 1BWEA 1K0TA 2PA8D 4ID8A 1SJ1A 2WSFC 4OV1A 1Y5NB 1SIWB 1DAXA 1BLUA 7FDRA 1FRXA 3IR5B 1DURA 1XERA 1FXDA 4CI0B 1FD2A 1G6BA 5CHCB 3C8YA 3GYXB 1FRIA 3MM7A 3EUNA 1KQFB 1FDNA 1B0TA 2GMHA 3MMAA 2XSJA 1R27B 1RGVA 2ZVSA 5CH7B 5BYSA 3MM9B 1B0PA 3OR2B 1FF2A 2C3MA 2IVFB 2WSCC 1GTHA 2VPYB 1KQGB 2FDNA 3IR7B 1C4AA 1JNRB 3MM5B 2PMZD 2WB1D 2FD2A 3MM5A 2O01C 1HFEL 1B0VA 2FJBB 3OR2A 1H98A 1VJWA 4Y28C 4DHVA 2XSJB 1Q16B 3MMAB 3MM9A 1H0HB 6FD1A 1BC6A 2V2KA 2VKRA 1WTFA 1FRMA 1IQZA 1FEHA 4RKUC 2V4JA 2VPZB 1GAOA 3EGWB 2Y0SD 4OMFG 6FDRA 3MM7B 1PC5A 3MMBB 3PNIA 5L8RC 1KEKA 1FRHA 2WSEC 7FD1A 2FGOA 3MM6B 1F2GA 1FRLA 1FERA 1GT8A 1FXRA 4XK8C 5BYRA 2UZAA 1H7WA 1ROFA 2GMJA 1AXQA 1FDAA 3OR1B 1Y5IB 1FRKA 1GTEA 1A6LA 2FJEB 5E7OB 5FD1A 1JNZB 2WAQD 2C3YA 1FCAA 4KT0C 1F5BA 3MMCB 3IR6B 1IR0A
chains in the Genus database with same CATH superfamily
2HZVA 5HJXA 1X0FA 1V9OA 1Q0NA 3BS9A 4DZDA 2MQOA 1LK7A 3QYYA 3HSGA 1JLBB 1VOMA 4DF4A 1UVLA 4OX9F 2WVCA 3DKDA 2MZSA 2JHEA 2BANA 4LVOP 5IXUA 1JB0C 3G87A 4NEYA 1Q8KA 2CWKA 4M8LA 5I3PA 4DSJA 1JKHB 2MZRA 2Y0BB 1U47A 3C6TB 5HP1B 2IAJB 3I5BA 2MLXA 4DQPA 1S4EA 3K5LA 3TQ1A 1HR0J 2X1GA 4RPFA 4AQYF 1N34F 4OV6A 3NAHA 4RUBA 3D2WA 1NPKA 1WUUA 4ZLNA 1Q78A 2C2EA 2OTJS 3O6QA 4JI3J 3O2IA 5DZ6A 1KRPA 3AB2B 1FTRA 1KLMB 3OFHA 4M5DB 3VGSA 3FSIA 3Q8UA 1JKHA 1YRXA 4C0OC 3HO1A 3Q83A 3R6GB 3R97A 3MR7A 3A3OB 4ED2A 1U1PA 2XMTA 5IFMA 2KT5A 1MMNA 1JX4A 3KK2A 2ZE2B 3NBPB 1U8SA 4KGVB 4NLXA 3SFUA 3X3UA 4O3RA 2RQ4A 4QPTA 4ZKAA 2DH7A 3QLHB 1NZ8A 3K2YA 2LXFA 1N5SA 3MR6A 2O67A 1U45A 3X1LB 3Q2SC 4L74A 1NHKL 2HIQA 5KFIA 2KKHA 4UOCA 1UJ5A 4KE5A 2UUBF 4G3IA 1HLWA 1S1TB 5HATA 4TXSA 1HBNA 3CE8A 2AYBA 5RUBA 4JV5F 1DHMA 2B0GA 4GMKA 4UW2A 1JMTA 4ZJOA 1WEYA 3MMAA 4YY3F 2OH2A 3P4UB 1RLDA 3TUZC 2ZD1B 3DLKA 1HMVB 2HQGA 5LMUF 2RS2A 1NK8A 3PVXA 3IWNC 2IM1A 1JLCB 4HYKA 2DNMA 4P9SA 4I7FB 4OI6A 4UY85 5KAKA 2XO6A 1FI4A 3W9HA 3MM5B 3DRPB 3TEHB 3U02A 2EXUA 4L3NA 1S76D 3HHLA 2HHWA 1SH0A 1QE1A 3G96A 5B0EA 7AT1B 4DR2F 1L3UA 4DPWA 2V9WA 4O44A 2UXBF 2UV8G 1BHNA 3VAHA 5C25A 4ZVQB 2GHPA 3RR7A 2ALZA 3DDIA 4EZ9A 2KB2A 3OVAA 3PRBA 2FGCA 2VKRA 4F3MA 2KG1A 1JLAA 2D69A 2EKNA 3D0HE 2EBEA 3D3CJ 1HNVA 3MZIA 3OFFA 4M5DA 4U96A 1RI7A 5KFLA 4DMZA 4WFAQ 4RNMA 3RAQA 5BXIA 2Y0SD 4J9SA 4C8KA 4GKKJ 2R7VA 4C11B 5HVGA 2V63A 1WC6A 5A0YB 2OJ3A 3FBBA 3UDVA 1XJWB 1XR6A 2CG4A 2GW8A 3OTBA 1URNA 1X4HA 1XNRF 2GIFA 4ZLPA 4IO1A 2HWTA 2CZ4A 2IAJA 2VG7B 2CIMA 2UZAA 1CJUB 4YS2A 2VJVA 2WONA 1RSCA 2W7AA 4M5HA 3CULA 2UUAF 3D6HB 4DL2A 1RISA 2BR0A 4CO4A 5JVGQ 2UVUA 2B7BB 2CA9A 4RLEA 1U6BA 3OVBA 3RU0A 1YI2S 4PG5A 2X1AA 4NZ0A 3OFEA 4DSFA 3RBEA 2E5IA 1NJWA 4IRKA 2B7CB 1F5BA 4J37A 3W61A 5KTQA 1S9GA 3FMWA 2N7YA 3BN7A 2H4YB 3ICLA 4EYIB 1FWPA 1EB0A 4Q2MA 4A8KA 1FRJA 1VC5A 4YN3B 1T7PA 3DRYA 3PW7A 2GV1A 1KFDA 3HVAA 3EDQB 3CEDA 3IG1A 3PYEA 4CTAA 5IV4A 1S79A 2LCWA 3BBCA 3HP6A 4I2PA 4ZVPB 3S8SA 3FCVA 3MM8B 2E7WA 2OP5A 4DI6A 3NG8A 3SDEB 1FHTA 1QSLA 4I4BA 5LOQA 3PV8A 4NOHA 1M1KT 3CCLS 1SC4B 2HNYB 2R7TA 1RTZA 4YB5A 5CYJA 4L6V3 1U26A 3ENQA 5HO4A 5KT3A 4WYWA 5EX0A 3JQJA 2OPSA 4KO0B 5KFDA 3OLBA 1KTQA 1RCXB 2H1YA 1M5HA 2NXEA 2QSFA 2VBXA 2ZFHA 3O3LA 4DV4F 4ECQA 4LFCF 2QE5A 3M1VA 2ATLA 1AFIA 1S1VA 3LP2A 3ONQA 4YHHJ 2W8KA 1F5AA 1R0AA 4F7VA 1HPZB 2J0SD 2PE8A 4NLYA 1TL4A 4RX6A 1Y5LB 2XI2A 4EYHB 4X84A 1WC5A 3M6WA 5F8MA 5J2PB 2E1MC 4NE9C 4X4VA 4QW9A 2DNRA 1DFDA 1DQAA 4Q44A 5D0RA 1NHUA 2QG9B 4NXMJ 8AT1B 5M2RA 4UQTA 1ZTWA 1X5PA 4WJBA 4ZPDA 4QWEA 4NCAA 4QU7A 1L3VA 2OO4A 3G6ES 3GZ7A 5K14A 5ETPA 4MYUA 1QUPA 4GC6A 1NK6A 2NXNA 1U7LA 3DMJB 4CYUB 1NKCA 2QMXA 5E33A 2DGWA 2MHEA 5A6WA 3ILLA 3H2LA 1KVIA 2AJ0A 4HT7A 4NCGA 2HQ3A 4WE1A 5T7LA 2NSCA 2YY3A 2HFSA 1TVRB 2W4DA 4QWBA 4OYMA 3WBZA 5F3ZA 2DPIA 3H5SA 3B4DA 3BGOP 3NMAA 2YNFB 5EWGA 4JV5J 3DYAA 4TNOA 1K1QA 3M05A 2AMCB 2C3MA 3DOKB 4DU8A 1P27B 2ZNZA 5IM0B 2ROEA 5LXRA 5LJ5Y 4XO0A 1OY8A 2RT3A 5LMNJ 4FYDA 2VBZA 1S6PA 3H5UA 2YNGA 2B8PA 4RW9B 3CC2S 2D3OR 2PMZD 4ICLB 1X4DA 1T94A 4OHWA 2EFOA 1H3DA 5BJRA 2CNLB 3F41A 2XGQA 1IUJA 4Y2AA 2Y9HA 1SV5B 1IN0A 1T3OA 2YKAA 4IKAA 5DS7A 1FESA 3UVJA 4YUDA 2XY6A 2J0QD 4DQSA 1TV6A 3CD7A 1H0HB 2RMLA 3M9MB 4LR8A 2AYMA 2YVSA 4LJMA 3OD2A 1FJGJ 1H2UX 2GGPB 1XN9A 3E01A 2MZ1A 2KVQE 2XYGB 2OEKA 2J6TA 1U0SA 3A3NB 3NOGA 3ITHA 1UETA 2M5YA 2ZBCA 4FKYA 5HBMB 4YQWA 1YRUA 5BR8J 3BKUA 2XZTB 3EE3A 3DOLB 4A8QA 4ATNA 1WEXA 1J2VA 3B6BA 5EHHA 1T9VA 3AOCA 2KM8C 1LXJA 4BLGA 1SKWA 2XCPA 2ZM6F 4JI3F 2EG1A 1H7WA 3ZZTA 5EWFA 3HJFA 3QO9B 2RHQB 2VL1A 3PCOB 1GTEA 4DPUA 3OPKA 4YP3A 4F8RA 1N33J 1JXVA 3EJMA 2LQJA 2OPQB 2ZBQA 4Y2CA 1RBOB 1HWJA 1HBUB 2HNDA 2QV6A 3IGVA 2RJZA 1RWMB 4GVBB 3S6EA 1WG1A 4ZLLA 4X64J 4PG4A 4W90B 5DGBA 2GQ2A 3A8KA 4LSNB 1SJFA 5ETRA 3IR6B 1ZA2B 1Z4UA 2IDLA 4O3QA 3W2VB 4WFNQ 4Q43A 1IVZA 2M7SA 1CQMA 4LUBA 4DDFA 4ZIWA 3FEXB 4RBUA 2BOPA 1TUGB 1T9YA 2BW7A 3EZOA 2L9NA 3LANA 5DDQC 2G0CA 3MPVA 3ILOA 4EBCA 1VC0A 3FZBA 2FZKB 3DN9A 4KRWA 5ETTA 4DOZA 1BD6A 5GADI 2K2PA 3PACA 3LW5C 2XGPA 2HHPA 4AFFA 3CJ8A 5E3RA 2ROPA 1HKAA 3WQPA 3CDWA 3DOMA 1JLFB 2UVVA 3M8YA 3HK2A 2RRBA 1HBOB 3UNGC 4G1QA 1FKPA 3C16A 1NCLA 4DUYF 4LF5F 2F9DA 4K4XA 1T8EA 3UD4P 1MROA 4ZMMA 3DU6A 1RHKB 2JFKA 4HH0A 1JJCB 3HFVA 4X4QA 3F73A 4FBUA 1AT1B 1YJ7A 3HKZD 3KUEA 2DNOA 3UDCA 2CPJA 3IP0A 3KG1A 3RAXA 3FC9A 4FXDA 2E29A 1F3FA 4OJGA 3RUBL 2ZZNA 1VBZA 1IBLF 1HNIA 4CLPA 4DCOB 1NSQA 1E6YB 1FNOA 4NWBA 4ZN3A 1VIXA 2BVZA 3CCSS 1V3SA 3VZIA 4ECRA 1HNWF 4HHHA 3SYZA 2GVZA 5DDRC 2Q3PA 1GQEA 3BSCA 3H42A 4PWDA 2FLPA 3BGRB 3D1HA 3UR3C 4JI2J 3R5JB 4NYZA 5IC6B 4O4GA 3AQOA 3MR3A 3TANA 1QAIA 3JSMB 2UVRA 4N8OA 3GWCA 1N4LA 1G6BA 4OJ1A 4FF2A 2YKOA 3P6YC 1NDCA 4M1KA 3ILJA 2ZDPA 3GTYX 2HNDB 5KT7A 3GV5B 1B0TA 5CCMA 3DCAA 2OPQA 5B0BA 1UVMA 3OTEA 3P8BB 4W98A 3VTIA 3DXSX 1C0TA 2LDIA 3JTNA 4OFZA 2Y1JA 4QPXA 4W92B 1ZA1B 2IYGA 5DQGA 1S57A 2W25A 1J27A 1GTHA 3HJVA 3O44A 4KYZA 4Y00A 2GO9A 2MQPA 3W9JA 2QL9B 3DOLA 4LIRA 1UMJA 2K7KA 4B08A 2KL8A 3ZTPA 2J5AA 4ED4A 4K7QA 3KK3A 1K47A 3VCDA 3TUJC 5CCLA 3M8PA 2J6SA 1UEUA 2VONA 2COLA 2AKWB 3DHXA 3CJKA 3VZHA 4EO6A 2HHTA 5HN0A 4DHVA 2OKQA 4QYZK 3PW5A 1AZSA 4X65J 5KFFA 3PX6A 3CCUS 3CO0P 4I2QA 1CJTA 2L41A 1EETA 1C1CA 2J0XA 4F3QA 3HSJA 1URRA 1CSJA 1GXUA 5AXNA 1VYAA 3IN5A 1Q5VA 3C6UA 3HD2A 5F9NA 4BDPA 1D8ZA 3HDSA 2B6AB 3AFGA 3CW2C 3LALA 4ZS6A 3SEOA 2KHDA 5EWEA 2Y3YA 3OL8A 2MLYA 1DRZA 4RW4A 1MROB 5GMDA 1R43A 2B9YA 1PILA 8ATCB 5EX3A 1KLNA 4RW9A 1S6PB 5HQ8A 1LWFA 1TL7A 1FERA 3L7UA 2LA4A 1JLFA 3DGVA 3TP2A 2DO0A 3DOMB 2M52A 1SQFA 2VQFJ 1D1UA 3DOKA 4ZVUB 2F8HA 2BJEA 3BGUA 1O6XA 4RUAA 3J80U 2V2VA 4CO0A 5KT5A 1VIOA 1MG7A 1DTTB 1NPRA 2FJEB 3ENAA 3K5NA 1UA0A 3BR9A 2HRUA 4NCGB 2R42A 2RSQA 3M8RA 3AOAA 2K3IA 3CJ3A 1LWXA 3TEGA 5K8PA 3KNAA 1S1XB 4WYLA 5D0GA 3M30A 3D9BA 5A8WA 3UPFA 2ZM6J 3TZYA 4PEOA 1ZBTA 4DR2J 2E44A 2R2SA 1NRKA 3GG1A 2HHSA 1V6HA 4CLLA 1M5OC 2CKWA 2WBRA 1WC4A 2DGVA 2Z2ZA 3N01A 5D77A 2H51B 3ETOA 3PFOA 4NL5A 1KQKA 1FT8A 1HBUA 3T1AA 3EXYA 2R2UA 1X5OA 2QMWA 1LNQA 2YXLA 3NY0A 2IYIA 5T41A 2QT7A 3PIOQ 3NNHA 3QJJA 2OMOA 4J9QA 2GX8A 1XMQF 4DV7F 2CQDA 4GVLA 4WK1A 2J7WA 1BQMB 3LP0B 2FZCB 4PWWA 5E3AA 1L3SA 3NGSA 2KJWA 4DV1J 4FF4A 1Y00A 2R2TA 2ZH6A 1WWHA 3JTOA 1VQ9S 1TFYA 4AL5A 2PMWA 3JSYA 1HPZA 3GSIA 1FDDA 1VRUA 3SCIE 4DCPB 3MPWA 3H0PA 1N0VC 2B9XA 4WP8A 3WZ0A 1OPIA 3BV8A 3CJ0A 4ECZA 2QLWA 2BOAA 5L1KA 1T05B 2F3JA 2ASLA 1SC1B 3VHQA 5F0UA 5HQMA 4KO0A 4DL5A 2C2DA 1XNQF 4PQUB 2A0FB 1JLGB 1FA0A 2LQBA 2VH7A 3E01B 2VBWA 3AJ2A 4L3KA 3W60A 1MN7A 4DL0C 5AE3A 2MKIA 4NYOA 3G6VA 1KQSR 4FS1A 2MMYA 4OZ1A 4DV0F 2EC2A 3GE9A 1SIWB 4JUZA 3SDEA 4KH0B 1HNXF 2CDQA 2IA6A 4KB7A 5D78A 3UVJB 2GAGC 4B3RF 2K3KA 4NZ6A 4CTAB 3TRGA 2AX0A 4URQU 4ES2A 2ADCA 3ZZ0A 4CWBA 1OPZA 2LU1A 4K2XA 3G4SS 3RTVA 4ZCMA 2RU9A 2ZOGA 3RBDA 2G4BA 1WDDA 2FUG9 3KUGA 2LEBA 3N4WA 3GYXB 3UN3A 4WBFA 1FRIA 1T0TV 4R5PA 3FBCA 4PR6A 1DQ9A 4P74A 4A46A 3TWZA 1J5EJ 1FWKA 1REVA 2MKHA 1FDNA 3MUVP 1KC8T 3CJRA 3OV7A 4NI2B 4ZVFA 3J81j 3GR0A 4CLUA 2ABYA 3W2WA 3Q89A 1B7YB 3HHEA 1C1BA 4KIAA 3FSYA 5KG7A 1HBMB 3TVKA 2UXBJ 2YNIA 2HKEA 1A9NB 1MWQA 2P9GA 4LBPA 3IM8A 3MFIA 3TZXA 4B3OB 4HACA 4WWSA 2DGSA 1R0CB 5CXTA 4PPZA 2RF2A 1JLEA 1SCJB 1X7VA 2B9EA 3SBMA 4C0BA 1MMDA 1NJYA 3KLGA 1RT2B 2RDDA 3QWPA 2DTJA 3N79A 4CT9A 3FK4A 1UZHA 2NZ4A 1ZTTA 1NJXA 2DJWA 3FFIB 2OMLA 1OQ3A 2VG5B 3J80Y 5C25B 1APSA 3L9ZA 2QJ3A 3NCRA 2DNHA 2D3ZA 2Z56B 3HPOA 2DNQA 2WHOA 2CJBA 3R5GA 5AE2A 1S77D 5DJBA 3PNIA 1RT7B 2GVDB 2OTLS 3HFZB 3MI7X 7FD1A 2FGOA 3NL0A 4K0KF 4G65A 4DV3J 2J9CA 4QWDA 2PN6A 3MTKA 2W8LA 3LAKA 3M2VA 4KGMA 5DG8A 4LF6F 1P8GA 5H1SV 4DR6F 4MIAA 1QAJA 4LF7J 4F4XA 3W9IA 1KP6A 1T95A 1ZM3A 3OR1B 4ITSA 1RAAB 3LWMA 1PGZA 1KHWA 3W66A 3KG0A 2ERRA 2HQFA 1JLGA 1JNZB 4ZPCA 5FDLA 3C66A 4GKJJ 2JVOA 4PQUA 2HG4A 3K5MA 4M95A 5KFWA 2CJXB 2X3GA 4WIIA 3TR5A 1BXNA 4DXLA 5GAHI 1H6KX 2XMMA 2CQCA 1BE4A 2EFVA 1VRUB 1ZM2A 3AD8C 2ZKUA 1MU2B 1U0HA 2M3DA 3AJ1A 2Z8QA 2Z2YB 5H9FJ 1ZZNA 2G1DA 4J5OA 1BQNB 1NK0A 2W9CA 3V6DB 3B54A 1WHVA 2BYCA 1FVSA 2OFGX 2IPOB 3FCWA 2MQNA 3SIPB 3BEGB 3V6KA 2LECA 5J1EA 4OYXA 1CJUA 2XS2A 2EC0A 1N88A 2HURA 4U7CA 4P73A 2DHAA 3JXOA 4FNHA 3TZWA 4KGXB 1R6YA 3KJVA 2A6MA 2I6WA 1W25A 5K8OA 4H4KC 4ILLA 2HHQA 2ZH3A 1HHQA 3CNQP 1S0NA 2JSXA 4C11A 3LQVA 1RT1B 2AZ1A 1S59A 2AGQA 4KGKA 2ZH2A 1N36J 2DRBA 3GONA 4I56A 2LKZA 1IBMJ 2G2OA 4DUYJ 2QFIA 4EMDA 1VQMS 4QR2A 3PKYA 1D9DA 2PD1A 3THTA 2BANB 4EWTA 2IDEA 1DAXA 4B3TJ 5KT2A 4N7TA 4O44B 1HL6A 1U49A 1LWFB 2M0GB 1KBRA 4KPCA 1RT6B 2V2QA 4KJIA 3K0JA 1NUEA 4DPYA 1IBLJ 3TJ8A 5KFEA 2MKCA 5JMNA 1FD2A 2CFXA 3AA9A 1S6QA 2V8HA 3R6LB 4KC5A 5KOXA 2HFUA 1Q8BA 3T5HA 2AW0A 2MJUA 4FS2A 4Z37A 4U7UD 1WEZA 3ZZRA 4DSKA 3QRQA 2QYGA 1WI8A 3MEEA 3MM7A 1C0UA 3QGIA 3ILIA 5C7PA 1RYRA 2PI4A 2R7SA 1R0BG 4CQ1A 3K58A 3U7JA 3S1TA 1LWCB 1RGVA 2Y8YA 1HWKA 2KFNA 2FYXA 3K89A 4BHQA 4USWA 4TQSA 4DL6A 1TFWA 3ZXWA 4OX7A 1EQ0A 4ZPTR 3NEKA 5ETMA 5KG0A 2CNNB 2EVZA 4Z2XA 1FNXH 2EKYA 5A76A 5B0CA 5DDPC 4P2XA 2DNZA 5KFRA 4DG1A 4JI7J 1M1GA 2LFVA 2E9RX 4PG7A 3FQKA 4LRAA 3R2DJ 2KG0A 1VQSA 4KHPJ 1HFEL 2BMBA 2D74B 2KHCA 3FSXA 1VISA 4QCLA 3OR2A 1SKSA 3SZ2A 1HNZJ 4BCAA 2ZE2A 4CZCA 1U4BA 3M6UA 1HWLA 2E5LF 2WOMA 1UVIA 2GQQA 4PXCA 1X4BA 5BR8F 2DY9A 2FIUA 2H5IB 3OXLA 3ZZUA 2DNKA 2F40A 2VFTA 4K0KJ 2RNEA 4M5IA 4Q2LA 2DVIA 2ZBPA 1UJ4A 1ZZFA 3ISNC 2ZH5A 1XEZA 2NZCA 2CQPA 3C15B 2HHUA 3OQ2A 2MXYA 1WHYA 2ZH1A 4FXWA 1JXLA 4O4GB 2KI2A 5LXYA 3OLAA 4NPOA 3H2VE 4OYPA 3T1HF 4B9VA 2B4UA 1U1NA 3TA2A 4JBCA 1CULA 3UN5A 4F3OA 2ZH9A 2DO4A 2HPUA 4TLRA 2CPYA 1RAFB 3QGGA 2HMIA 1SBRA 2CNKB 2M9KA 2HHXA 3NP5A 5LMUJ 1F9EB 3Q8QB 1HI8A 1XNRJ 2IRYA 2ASYA 3KYLA 3T6JA 1VBYA 4QIWD 4X4OA 2BJDA 1YHQS 4H4MA 1XMBA 2VA3A 5J2QB 1M5SA 4QW8A 3NOCA 1ICEB 3KUHA 4RU2A 4Y2KA 3QPIA 4WIQA 1KOHA 1FKPB 2DIVA 3C16B 4G1QB 1F9HA 3MEDA 2DHGA 1HBOA 1D0EA 1Q79A 1OYDA 2HFOA 3PEHA 2ZVIA 2UV8A 4CH0S 3WC0A 2H65B 3DLEB 3MAHA 1RTIB 2VPXB 2BKPA 5E3PA 4TU7A 1S1UB 1FJGF 2MLZA 4C8ZA 3UQSA 1X4GA 1YQHA 1QLNA 5GAEU 2RD5C 3DRRB 2IJFA 1IJFB 2RUGA 2UUWA 1P9YA 3GJTB 3MCOA 4E0DA 3SQGA 2ZZMA 1X0PA 1LFPA 2XC9A 2SXLA 1Y4ZB 2AGPA 4B9NA 1QD1A 1RAGB 3TI0A 2O3DA 1HNXJ 2PDAA 2L08A 3P96A 2ILZA 3BO4A 1QDUB 1YVFA 1UP1A 3MR5A 1FE0A 5JVHQ 1HQEB 1NNDA 1BQXA 1S6UA 1SQEA 2QRRA 4IFVB 3TVZA 4F04B 2OSQA 2E7VA 1D9AA 2ZH7A 4ECSA 4K4UA 4XTTA 1YG0A 1SJ1A 2WSFC 5CD4H 3N28A 3LA0A 2VJUA 4A8OA 1W26A 4U67Q 4HHUA 4ED6A 2XM3A 2BQ3A 4IG0B 4LRCA 2BUNA 2DR7A 3R7BB 1EJ7L 1N54B 2HAFA 3CCTA 1J5OA 4C8OA 1J5EF 4USMA 4B3SF 2PT0A 5F9LA 2ZJRQ 4R0JA 1P1LA 4J9VA 4BBYA 5K9FA 3W65A 3CD0A 3OL9A 1S97A 5D6GA 4OX9J 1NK9A 2VFSA 4OI3A 1NXIA 5D4LA 3UCZP 3S01A 3AD9C 3NGTA 2YKMA 4CIOA 2DGXA 1VQ5S 2HAIA 2VG6A 1FJEB 3V4IA 1S48A 4RW7B 5A6PA 3J81Y 2QA4S 1ITPA 1TKTB 2QC3A 5DZ7A 1LWEA 2BE2A 4GO7X 3I9ZA 2HS0A 3KK1B 4FF3A 1EZZB 3GFXA 2FC9A 3A13A 4J7CA 4Q8EA 3TX8A 1JNRB 5AXKA 4X65F 2P9EA 5A8RA 3G82B 3Q24A 1WC0A 4BC7A 4IR1A 2MSSA 3QZ7A 1HD0A 5KFCA 2VFUA 3DFEA 3VAGA 4DF8A 4RUHA 2DGUA 2WZ1A 2HHHF 3ZFVA 4ETXA 2FB0A 2KYZA 3G8TA 4DL4A 3QATA 3BB5A 5E41A 4ED8A 2VDIA 4JV0A 1MN9A 2FZGB 5T7LB 5DETA 5I42B 2B3TB 1SVDA 2CADA 2VG6B 1H72C 1LV5A 2V4JA 2YKMB 1UVJA 3IRXA 4QYRA 3VGTA 5HROB 4HEA9 1NB7A 4F0HA 4OI0A 5I4MA 1B3TA 4K50A 4A48A 3N5FA 3BSOA 3CJTA 2KM8B 4LR7A 4DV4J 4CH1A 2LQ5A 4V19X 2C2ZB 1YBUA 4QIFA 1VQ4S 3T41A 4ECWA 3UR0A 1F6TA 3V2UC 3LPEA 3RB6A 4USUA 4MKVA 2HLTA 2RE1A 2YQ0A 3NGUA 3ZC4A 1ZH5A 5C42A 1Y5IB 2PFFB 4P2SA 2VOPA 2J8AA 4QWAA 2QL7B 3PEJA 2NR0A 1RT5B 2XY7A 2IC3B 3MEGB 4LSZB 1WHXA 1R3NA 5ETSA 5KG4A 2RUSA 4DV2F 1R0AB 3MCNA 2CJAA 3P5TL 2DNLA 3PR4A 1CQNA 3BKTA 1R8CA 1UWAA 2EI5A 2O1PA 3SI8A 4UT4A 4JI8F 2HRYA 2HEKA 4CT8A 3OXGA 4LF4J 2CQGA 3QWUA 4RW8A 1QJHA 1IKVA 1HQUA 1RUSA 2HBZB 3THPA 4DR1J 1VC6A 2LMIA 2EG2A 1F5CA 5B0AA 4FVCA 2HNYA 3LP1A 1KDNA 4U95A 1VQ7S 4M5KA 4LF5J 1KVKA 2YWFA 5C24B 3TA0A 5J1EB 5L38A 4DFKA 4I2PB 1EARA 2MSTA 4KY3A 2AJQA 3RRKA 2DHXA 4DJBA 1NDLA 2KT3A 1A0OB 2IVMA 1Y0HA 2LVWA 3KLIA 4ZVOB 4WCEQ 1D3WA 5I3UB 2CG8A 1MMLA 5D4PA 2W9CB 5B09A 4ERDA 4N76A 4IFYA 3RG6A 3LGHA 1KKHA 4DLEA 4USHA 2CPZA 2BJ1A 5KOWA 3OTDA 3CCJS 1MU2A 3CDBA 4ZP9A 4I64A 2V8VA 4DV0J 1SL0A 4OHYA 2ZEJA 1UZDA 1CPZA 2LLZA 3MUTP 1NSKL 9RUBA 5KG2A 1RB0A 2RU3A 5H9EJ 4F2RA 2ZBIA 3KJQB 3HT3A 3CO9A 3RW6A 4U7UK 1K0TA 1RTHA 4IH6A 3OJUA 4DR5F 1UWBB 4NLRA 4PPDA 2U1AA 4AL6A 3MF5A 2BRLA 2GIQA 2BQRA 2HMIB 1YZ7A 3K5OA 3GCWP 1SPBP 3N6MA 4MIBA 4E2FB 3G6YA 4J9MA 4MKAA 4ED7A 3CC4S 1PYOB 2B5JA 4DSIA 4JI1J 2CQ2A 2H9ZA 4K2JA 2V8PA 3D1QA 3UCGA 1FO1A 2I38A 3BYRA 3QIPB 1YLXA 2L48A 1FXDA 3AH6A 2EEYA 1CJVB 3THVA 3CGIA 5G0RA 3EWGA 3CUNA 2DCUB 3IGNA 1I3OB 1XWLA 2Q1LA 4ILMA 2MEWA 3BQ0A 1L3KA 4HKQA 4UF4A 1KS2A 4LRFA 3KFWX 1IWAA 1P9QC 5B0GA 2HWHA 4CDIA 3H20A 1N8RT 4JI7F 1NPPA 4F26A 4DN9A 1QUVA 3T1YF 2L9WA 5BYSA 2XZWA 4TKTA 3OR2B 4O23A 4PUOB 4H54A 4LT6A 1N32F 3BREA 4DFPA 1O8BA 3NLCA 3Q8VA 1JLEB 1VFJA 1KR4A 3MECA 3KLVA 2A2CA 5CAAA 3DM2B 3QJLA 2DNYA 2LEPA 4B3OA 2C28A 4F25A 2MQLA 5KG5A 1DJ0A 3H4DA 1RQ0A 3Q86A 2VUGA 2JNJA 1RWPB 1HMVA 2DD8S 2OEMA 1LWCA 4KKOA 4M5NA 4MK8A 3VVTA 1U1OA 1Q7YT 4OHVA 2MKSA 2N3OA 1C1BB 4YR3A 4B3TF 2ZWOA 3P3DA 6FD1A 4PYAA 3I96A 1FRMA 2H3EB 5GMKa 1IQTA 1P6TA 3MOZA 4NI2A 3A8IA 1BY9A 1JLQB 1GAOA 3O5TB 1BGXT 3EGWB 3NGRA 2BABA 6FDRA 1F0XA 5D15A 4ZP6A 4WZQA 2HK3A 1AB8A 2J7KA 3QRRA 2AX1A 4ED0A 1LW2B 1RBLA 3BDPA 2HBRB 3NKYA 1FRHA 1K0VA 1RWOB 4DR3J 3PM9A 1GX5A 1TMMA 3JQMA 3EYZA 4F4YA 3J7Z5 1SUQB 2YKNA 3J7YI 4A8YA 1MNEA 5GAGU 3CF5Q 1IKYA 4J9LA 3MAAA 2FJXA 4ZP8A 3D0GE 3MXHP 1SL2A 4X64F 4V1Ak 2BE9B 1S9EB 1ROFA 2MZQA 4FYVB 2VU5A 1XBWA 3C14A 1UVKA 1VCTA 5KFYA 3V81A 3I9V9 4ANDA 1W2BR 2QX0A 2FHKA 3TO8A 2A18A 4GRSA 1KLMA 1SC6A 5DM6Q 1JJ4A 2E9ZA 1RT1A 4ECVA 2W4PA 2E1RA 2JVRA 2XY5A 3K59A 2UP1A 3RR8A 4JI0J 4W4MA 2W7PA 5EN1A 1RYSA 3PO5A 4KSEB 2FJVA 5D0HA 1I5OB 3EPIA 3SCLE 4TYAA 1HW8A 4RNFA 2C2RA 4WFYA 5KFOA 4RNHA 3OTOF 3EVMA 3IC1A 3MMCA 2H48B 4DZ6A 3C6TA 2JDJA 4IOCQ 5HP1A 1XMOF 2D41A 1NLKL 2CQ4A 2NPIA 5GAGI 3TJ9A 3Q8SB 3KMSA 2VQEJ 4OYBA 3M2UA 2CQ1A 1GMWA 1UL3A 2RKIA 2MGZA 2CPDA 1BQNA 4K4YA 4OZ5A 3PFEA 2MGZB 1JLBA 3MFHA 2R8HA 3J7YU 1TL1B 4J9RA 2IVYA 4DEZA 2MKKA 5LSLA 2MHNA 4LSLB 4MKYA 2IMOA 2XHCA 1FK9A 1U0HB 1SI9A 2DXEA 4JP8A 4ZVHA 4CNYA 2QGFB 2C3UA 3CMQA 3W63A 2CNOB 4PXDA 2FJDB 2D7SA 2X1BA 3QT5A 5FIIA 2RQMA 3G2XA 2YH1A 1RAIB 2YQ3A 1C4CA 1VK8A 2GZOA 2RB7A 4P75A 3VAJA 4NZ7A 2V50A 1YJNS 3FEZA 1TK8A 2DR6A 5ETNA 3MMJA 4G6VB 1YJ9S 4OZ0A 1S1XA 3CD5A 2IA0A 2A2DA 2GCFA 2V69A 4PXEA 4WTYA 4OZ3A 4LFBJ 5M2UA 3J7A1 4UOFA 4OL8A 1TU0B 2X7IA 1JXEA 1GH8A 2WVFA 2XMVA 1DTTA 1IKXB 3M2VB 2NUHA 1L3TA 1NM2A 4U9RA 3BPDA 1RACB 1H73A 1WSRA 1S1WA 2EW9A 3FMBA 3HCXA 4DFMA 3TAPA 4EU0A 4ZN1A 3FUYA 1ZOTA 1I51B 2C1EB 2YKNB 3HZGA 2V6AA 4OX8A 5KFBA 3R2CJ 3RJMB 2KRBA 2LU2A 2AEMA 1RWNB 2CJQA 4G1PA 4TY9A 4C98A 2BX6A 2D9PA 3NMRA 3QT6A 4RWXA 3MCMA 1N5TA 2AJ1A 3C6UB 3FFIA 3DI6A 4C3KA 4TY8A 2WCXA 4IUFA 2N4DA 2X3DA 2XSJA 3LGNA 4USVA 3A8EA 3GJSB 4YDXA 2ZVSA 4CO3A 3M7VA 3KLGB 4I2QB 2ZHBA 2VODA 3R7SB 4DR6J 2HHHJ 1AZSB 3HLUA 4ZLJA 2FVQA 2OPPB 3RYLA 1DQ8A 2CZ9A 4B3MJ 1I94F 2Y1LB 1R7IA 2QA4G 5MLCV 4JI6J 3PTWA 2X51A 4DR4F 5T14A 3FJ2A 4NLWA 3VF0B 4MFBB 5IOLA 3KK3B 4OQJA 1DARA 1D8YA 1RWVB 4PABA 2WB4A 2DR9A 2XS7A 3WDOA 2O01C 1B0VA 4ZDNA 5AJ3J 2BA9A 4WP9A 1RHUB 3UWTA 5GADU 4LQ3A 1H98A 4LFBF 2Q6BA 1X4AA 3W2WB 1VHFA 3ADAC 3PDNA 2DXDA 1Q16B 5DLGA 3DC2A 5HVHA 5IWAF 3SSSA 4ECUA 4I68A 4EFAC 3AXMA 3IBFB 3PW4A 1KD1T 2JEIA 1IQZA 1PAUB 1EX8A 4ETZA 1IXKA 4JI2F 2RS8A 5J2MB 4B02A 4JI4J 1LW0A 2I9SA 3CVKA 4NEZA 3ULHA 3N6NA 3UCUP 4O3OA 2AV5A 4A47A 3NWRA 5E3CA 3PRVA 5KT4A 1R8BA 3PKMA 5D8HB 2GFFA 4C2MA 4U6PA 2W9BA 4DBQA 1YJVA 3I32A 4XPEA 2YKPA 3JSMA 4PAAA 4ENOA 1XMOJ 2IJRA 3HF5A 2XLKA 1S99A 1M5KC 3QJPA 4OYWA 5DRKA 5KG3A 4PWDB 4ZJLA 2Z58B 2KT2A 4FP9A 2R9LA 4WP3A 3ENVA 4OHXA 5JJBA 3D3BJ 1VQ8S 3CT9A 4DR3F 1U1KA 3DHWC 3H98A 4YFUA 4DLGA 1Q81T 4Z7YA 4C8LA 1SQGA 2V2ZA 2MKJA 3KHGA 3CDUA 3POTB 3VAMA 2PIIA 1Y10A 4ER8A 2XQCA 4O0IA 3FCHA 4IYQA 2VF3A 1KFSA 4IRDA 1RTJB 1HWIA 5ETLA 5ETKA 4ALZA 1XMQJ 4KBIA 1VRQC 2LP4A 5GAHU 4LFAF 2AZ3A 2DITA 1KNZA 3I82A 1IM6A 1U09A 3MD1A 3LGMA 1HR0F 1BQMA 1TKZB 3LP0A 4X4UA 1G2EA 3MTJA 2ZWPA 3KLIB 4DFJA 3PJXA 2UUBJ 3FEYB 2Q66A 3EX7B 5DGAA 1NH7A 2BJ8A 2JX2A 2VICA 3CCQS 4FBTA 2F8EX 2QZ8A 3CCRS 4RL1A 5IT4A 1PC4A 1YJUA 3DGPB 4DSLA 1FTCA 1RA6A 1OS5A 1RT4A 3LP1B 5DLFA 2KXFA 2HWIA 2ZJQQ 4JI5J 5HROA 3F44A 4RW8B 3TAMB 4HDHA 2EPIA 1UPMB 2BV3A 3CDEA 2WW4A 4PG6A 3HSZA 5A8WB 2VZ9A 4DUTA 4MKBA 4DV1F 4CLSA 1TL3A 4Q5VA 1N5YA 1FDBA 1QSSA 1JK9B 1JQGA 2G2ZA 4NLTA 5AJ3F 3GSDA 1V3RA 1EHWA 2RAQA 2XWYA 3IAM9 4YHHF 1PJ6A 4KPYA 1O5JA 1VI7A 2E1AA 3LPYA 4P10A 4K5RA 1HI0P 5C42B 4B9UA 3C46A 1YK9A 4NLUA 3EPGA 1X9WA 1TL7B 4K4WA 3IR5B 1DURA 3P45B 2M4MA 2VV5A 1OO0B 1RAOA 4DR1F 4K4SA 3PYGA 4AD6A 1CJKA 1GEHA 4YOEA 4EBEA 4WK3A 3G71S 4OX6A 4HR2A 4IRCA 1ZM4A 5HBMA 3MOJB 5E0OA 3HT0A 3POTA 2OUGA 1G1XA 3HM9A 4L75A 1TKXA 2B4PA 3QFWA 5J2NA 1CJTB 4LF2A 2MZJA 2P6SA 3BBFA 3QMQA 2NYHA 2OI2A 3VV2B 1TKXB 1VS3A 5LSRA 2BKOA 4QOTA 1Y7PA 4ED1A 3M8PB 1N48A 4B9LA 2IVFB 4OLPA 1R8AA 1I6JA 4IH5A 3GR1A 1SL1A 3QNWB 1CJKB 2W9BB 3NNCA 3H25A 4ZVSB 5A8RB 2IRXA 2QTWA 4KFBB 4UUXA 2Z2MA 3A12A 3MURP 1C0TB 2FPHX 2ZHAA 2RRAA 3OTOJ 1VR6A 5C2GA 4CM2A 4RWWA 4ECYA 2V2KA 4DPXA 3T9NA 3NS7B 1NJIT 2EFQA 1R89A 4RW7A 5C5JA 2VPZB 2HHVA 2ZUGA 2BM0A 2PEHA 4DL3A 2A1BA 2JC0A 2E5LJ 1GX6A 5CD4A 4L76A 4EBDA 1FKOB 1PG5B 5LM7E 3K8WA 2CDRB 1JJ2R 2A10A 3TAMA 2UUCF 1FFGB 1IBKJ 4CLKA 3AQPA 1WDTA 4H4KA 4AT1B 2V34A 1FRLA 3W64A 2MQQA 5F8NA 3NGDA 3L7PA 3V6DA 4LBIA 3DGPA 2HQIA 3AXKA 3DU5A 4CLYA 1WACA 4C9DA 1E6YA 2L3MA 4ANEA 3I0RA 4JYAF 2MTLA 5IT9Y 1NU4A 2QLFB 5A2QU 3SV3A 3CMES 1WNEA 2O66A 4WXOA 1DBDA 3DI6B 2WAQD 2IFXA 1QAYA 2LEAA 4JI6F 1FCAA 3W5ZA 4DQRA 2XNRA 1AYEA 1CC7A 2XMAA 4KTQA 2F4VF 3I0SB 4KT0C 2MQMA 4EO8A 2F4FA 3BO2A 1Q4RA 3VQTA 3BZQA 3VGVA 4DX6A 3Q8RB 2XCAA 4ELVA 5U47A 4B9SA 2ZNYA 4LF1A 1SH3A 2KZZA 3CCVS 1R31A 3B8HA 1FEEA 1X5TA 3TUPA 3ZNJ1 3HHDA 3W8PA 3K7RA 3K57A 3BQ2A 2OD6A 3D67A 1NBEB 1WOSA 2G9OA 1Z2LA 3E51A 1KWMA 4ZVTB 3WC2A 2HLUA 3ET6A 4URSA 3UDEA 1RAJA 4IOAQ 1S1UA 5AXMA 1RTIA 2DGOA 3DLEA 3FRYA 2DYAA 2GO8A 3EXCX 1XK8A 3W2VA 2HBYB 4M5MA 4WFXA 2CUYA 1E6VB 2K1RA 3MEDB 2RQCA 1ULRA 4RZRA 4GVBA 2LXIA 2HGLA 2K7JA 3L4BC 4B3RJ 1S9GB 3I6PA 1NAQA 4N5SA 4R8UA 1BWEA 4H4MB 3HVTB 2KJVA 4JB8B 2ZC3A 2XG8A 3D68A 4N8NA 2FY8A 2R8JA 3QO9A 1IM4A 4L72B 2W9AA 2VC1A 1H74A 3JYTB 1RLCL 4Y0FA 5FJ4A 1FD8A 2AQ4A 3A1YG 1EKRA 2HQCA 3IM9A 3BSNA 4C8YA 3M8QB 4J9NA 2R2RA 4PKDB 3MPDA 2HBQB 3LH2S 1OSDA 1UJ6A 1RHRB 2JH3A 3QGPA 4MFBA 4RO0A 1EIYB 2FVRA 1Z1ZA 3T1YJ 4L73A 4BC9A 4TQRA 3W7BA 1ZS6A 4MH8A 2DBBA 2KH9A 5A8KA 5A2QY 4A8WA 2F5GA 1S72S 2BM1A 1WI6A 3T9ZA 2QL5B 4F67A 4CLTA 1CBKA 3RZAA 3QGHA 4ES3A 3OUYB 4NLGA 1OQ6A 2GMHA 3M32B 4KH1B 3KMQA 1TV6B 4LVNP 4UOHA 1CS4B 1R27B 4AL7A 2I0XA 3C14B 1V3ZA 2B56A 4P2MA 1AROP 1AA1B 2Z2LA 1X5SA 1S6OA 2J0WA 4ICLA 5KFUA 4I0WA 2PI5A 2E7XA 1GMUA 3ELHA 3MHYA 2FLNA 2CPHA 3AY0A 1IR1A 3C19A 5AT1B 5EUHA 4CO5A 3MM5A 3LWLA 3RB4A 4Y2MA 1S9FA 2V94A 1X60A 4CO1A 2DR8A 3N9UC 2JEJA 2PMHA 2FHJD 4Y28C 4F0MA 2UXDJ 1GFWB 3GFZA 5HANA 1JLQA 2V5HG 1TVRA 2J8SA 1Y11A 5IT0A 2AHOB 1MSWD 1O0PA 2QSWA 2ADBA 3I55S 4PRFA 2X1FA 5D3GA 1ZYQA 4WZMA 1T9WA 1M90T 2VFRA 3D5MA 2P9CA 1WF2A 2XEXA 3DRSA 3MEEB 3FQLA 3MMBB 1RA7A 3MM7B 4WXWA 3VAIA 1S1TA 1WD6A 2KDOA 1VQNS 2M88A 1WOPA 2MDAA 3DM2A 4EZ6A 1TTHB 3LOUA 4X4SA 3L3CA 3T3FA 3MECB 2C2KB 2OIHA 1NH8A 1GXLA 2IRUA 3J81U 1ELOA 2RILA 1TL1A 4Q0BA 1R8PA 3T6BA 3Q8YA 2FJWA 3NBPA 1FX2A 3ETMA 2RKIB 4FNIA 1Q82T 3M2UB 2PC6A 4LF4F 5J2PA 4ZPVR 1DTQA 3CWJA 2KYXA 2P8IA 1B7FA 4P6QA 2Y1RI 1RU1A 2XMJA 2ZUAA 3FBEA 3MMCB 3SQOP 3HHLD 1KTVA 1OIAA 1S1VB 2HVDA 1NO8A 5G0RB 1FXLA 2R7WA 4UZBA 1F2HA 1VRTB 1ZAXA 3HFKA 2HIYA 3GV7B 4GC7A 5D4NA 3I4HX 3IO1A 3TAQA 3QIPA 2K8GA 2BE7D 4NRUA 1X31C 4I6AA 3KXDA 4R0EA 5CYQA 3RBXA 2XSFA 2WTFA 4K4VA 3KHLA 2WVBA 4YB1P 3BJYA 1JJHA 4X4NA 2GJIA 1RAHB 3MM8A 4WKYA 8RUCA 2R8IA 2B4VA 1EP4B 1HYSA 2ZC4A 3SMZA 2OSRA 1ACMB 2CYYA 1PSDA 4QZVB 5KFXA 3JTPA 2GA7A 1PCAA 3GG0A 4NLOA 4JV2A 1IKYB 4HT5A 3JAMU 1NJZA 3MM6A 1M1HA 2W01A 1SIZA 2W2QP 4RU9A 4JV1A 3CXCR 4DQQA 3C3LA 1SB6A 3HX9A 2VPWB 3QSYB 5J2QA 2DPJA 1W7WA 3UDLA 1JWWA 1RU2A 5I3UA 1S5ZA 2YX1A 3D28A 1RHMB 3GFHA 3QT8A 4S0MA 1VBXA 1OSCA 2E1PA 2HGNA 3BGLA 1WF1A 4ANCA 2KFYA 4ID8A 2AYGA 1EP4A 3OSNA 2CPEA 1VQ6S 4QQBA 4P2FA 4H4OA 3KJNB 2R4FA 3CIZA 3P5BP 4C0HA 2V4RA 4KKOB 3L95X 3UO0A 1NDKA 2Z30B 4EUVA 3KLEA 2QLXA 2DT9A 3QT7A 5ETQA 3PHTA 3OTCA 4NMXA 3MUMP 4KHMA 3GP9A 4FYWB 1UCNA 2BXJA 3PX0A 1OY6A 1VRTA 3H8YA 3KKFA 2VQFF 2CJKA 2UXCJ 2YPZA 4HI2A 1UW4A 3IAS9 4DX5A 2F1FA 3NGKA 3J7AN 2YQ1A 3OL6A 4JI1F 4PUOA 4TU8A 1HNVB 4LF9F 1Q7LB 1KQFB 1I94J 3T1HJ 4I69A 4DR4J 2IC3A 3MEGA 1DTQB 3HVWA 2W4CA 4IDKA 3CJ4A 5DQIA 4O3NA 2KN4A 3EVOA 2NREA 4K59A 3QZ8A 2DGQA 5ADZA 3MM9B 2DRAA 1U2FA 4URGA 4Q0BB 2UXDF 2WSCC 1RT2A 4CP5A 4P72A 3DDNA 2YX4A 3FGVA 1HD1A 2G13A 2QLBB 3RAMA 2IBOA 1CJVA 4DS5A 1WKLA 1X8DA 5HQLA 4ECXA 2RF2B 2F4VJ 2EFPA 3E8OA 1FJ7A 1FE4A 4DX7A 4OZLA 1VQYA 2DY1A 3KLEB 2FJBB 3R1HA 3KNGA 3D1OA 5MAOA 3GIIA 1VJWA 2YNIB 2W7OA 1YDLA 2CPXA 2ZD1A 3DLKB 2GJFA 4CLWA 5K8MA 3IRXB 3T5KA 3PIPQ 3MMAB 4HH1A 4ZJQA 5LT5A 4DN0A 4P7VA 2DCLA 4ZK7M 5D3GB 2FQQB 2H5EA 4NXNJ 4QYZJ 1N52B 5HI7A 1DZ5A 4YB7A 5KFVA 1KHVA 4J91A 3VGUA 5KFJA 3CCMS 1Q95G 4WF9Q 2V8DA 3TW0A 1REVB 2AWZA 2V8GA 2CPFA 3ZTSA 2UXCF 3W1YC 1KEKA 2UUAJ 1RZMA 2JLFA 2WK4A 2VBYA 3BO3A 4CCHA 3QLHA 4J9OA 3BN4A 2WSEC 2LQ8A 1WF0A 2OAUA 2XLJA 1KONA 3CMAS 3GB0A 3MM6B 3HHNB 5H9FK 5CYMA 1N0UA 2AEJA 3CIMA 2HFNA 4DV2J 1SC3B 3KK2B 5K8NA 2RHSB 3QRPA 2W2OP 4ED5A 4UQGA 5GAEI 2JOQA 1AXQA 3G9CA 2R3VA 2RQKA 1HYSB 2JJ4D 3OHAA 3QIDA 3M32A 2PA3A 2E5HA 4F50A 4ZHRA 5IZHA 2VD3A 3KDOA 5CYQB 3ZZPA 2GQCA 2H4WB 3QAUA 2VHGA 3AB4B 1IKVB 1HQUB 3MWBA 4UUWA 4OI2A 2I5JB 3GIRA 3H59A 3U1MA 3L7OA 2VQEF 1W2IA 5I3QA 4ED3A 1CEZA 1PBUA 4B17A 4PWUA 2DNGA 5KFHA 2YWGA 4UY8T 3BGFA 2CRLA 4IR9A 1P1TA 2VB6A 4YDDB 1G3OA 1QY7A 2GC8A 3OL7A 1RCOB 1J5OB 2CAJA 4DL7A 2YWWA 5HAOA 1D09B 2H5JB 2ZOFA 1HW9A 5M2PA 2BJ3A 4XAKA 4I6YA 3Q0AA 2AIRB 2NSBA 4M5LA 4CO2A 3VQSA 1Y3JA 2RIJA 1HQEA 3TQEA 1OJ4A 2C3PA 5ITHA 4ELTA 2Q43A 2K06A 3HXMA 4WFZA 4QWCA 3UFCX 3JB9k 2XYPB 2DISA 3DLJA 1Q8LA 1GXTA 3EM1A 2DR5A 3MDFA 3MGJA 4IQMA 5BYQA 5KFQA 1GMVA 3MMBA 4AYBD 4XIUA 3CPWR 2G2YA 1SJRA 2ILYA 1RTDB 4U8VA 5CZXA 2AF6A 3I31A 3M30B 3SQGB 5F8LA 5L1IA 5E3QA 3LUYA 2LXUA 1S10A 1M5VC 3US5A 3PJ9A 1Q5YA 3NNAA 2KTQA 4OV1A 3DDKA 5I42A 1YIJS 4FZVA 2QFJA 2LDYA 5E2QA 3SCJE 4DWIA 1Y9OA 1UEKA 1L5UA 4FXVA 4PXBA 1UVNA 5F8IA 1FNMA 4N47A 3PZPA 1NDPA 2C22A 1BLUA 5FLXY 2HNZA 4OYZA 1I1GA 4MK9A 3ZO7A 1U6ZA 1IKWB 5D4OA 2HVEA 5HMWA 1CVJA 1XERA 2VOOA 1VDHA 3MEKA 4YY3J 2Y8WA 2BDPA 2AJ4A 3PYDA 1SJQA 4NA1A 2FVSA 5CHCB 4UOGA 3CCWA 3C8YA 4RW4B 3SXLA 3A3PB 3KLFB 2B6AA 2Q6CA 2YWEA 3R5DA 4OZNA 3SFGA 2WRMA 3W5YA 3OVSA 4C8NA 1KSPA 1CS4A 1WORA 4Y6IA 3M4XA 2IIHA 1NB2A 3MPYA 2KO1A 3Q23A 1C1CB 1REGX 5F41A 3GIKA 4F02A 4FN5A 4M5GA 3OUYA 1RKIA 1CG2A 1B0PA 2NXUA 2JLEA 1NKBA 1FKAF 1KVJA 1HNZF 3KLHA 3EGNA 4DSEA 3CJKB 2KVIA 5ETOA 2BACA 3QSIA 5KFSA 1S49A 5HL7Q 4LQ9A 1S0VA 4WKRA 4LRDA 1WKJA 3CB4A 4Y65A 2WB1D 4F0KA 1EAYC 1HQ2A 2FLOA 1QTNB 2UU9F 3ZTQA 1FKOA 2E5JA 2BEFA 3I5AA 2ZKTA 3H4BA 4ELUA 3U1LA 4IH7A 3HMJG 4MAKA 4K4TA 4QIEA 4BS2A 2F9JA 5IS2A 2FHJA 4BWMA 2JWNA 1BC6A 1RBAA 2Z0GA 3HVTA 3KWMA 2DGTA 3GMGA 2EFNA 4R8UB 4X4PA 3T5LA 2POKA 3KLFA 3NS6A 1ZPWX 3RRGA 1N5QA 4OMFG 1EQMA 2OPRB 4RNNA 1RWXB 3DXBA 2NXCA 2RRNA 4MT1A 1F3VA 1TR0A 2K1RB 5HMXA 3TYTA 1U1LA 2GJ2A 2EK6A 3A4TA 5KFAA 3I5CA 2HNZB 1F2GA 3M6VA 4ZVRB 1TL5A 3BGRA 4HL9A 4M63A 3DLGA 2AD9A 2UVWA 3WIVA 2N82B 2ALYB 2GVZB 3ZNUA 3ZTOA 1VHIA 3R5CA 4USTA 1FRKA 1A6LA 2ACYA 5L9XA 2MQ8A 1B70B 2QA2A 1WSVA 2W2MP 1U1RA 1XC9A 1WG5A 1RTDA 1FX4A 1ZAWA 1WG4A 3NS5A 3CJ5A 1NSPA 5LJ3Y 2XTJP 1N6QA 1YRTA 2CQHA 1LKZA 2ROGA 1YTYA 2C2NA 5CABA 3NRBA 4OYIA 2YX7A 3HKWA 1U24A 5D0EA 5G4DA 3PJWA 4HTJA 3D66A 4OI4A 4A8FA 3LF0A 2BZ2A 4CM0A 1TELA 1WJ9A 4NXNF 2LQ9A 2MZTA 4MK7A 4A8MP 2YH0A 3F56A 3K8VA 2R7UA 2CQ0A 2ASJA 1C2PA 1RWUA 3QFHA 2B8QA 5KG1A 1A7GE 1M5PC 4KV8A 2CQ3A 4D3HA 5IQQA 1N5YB 3GV8B 1CULB 1TL3B 1EKSA 1YGYA 2P2CB 2JC1A 2CVEA 2XMUA 3VALA 4DV3F 2YWHA 4A8XA 5JUMA 4ES1A 4KR0B 2C3OA 4EEYA 5FLXU 4DV7J 5F8HA 4N41A 2I5JA 4DV6F 2RH3A 3GLJA 5DDOC 4PG8A 3A8JA 3O1LA 1AUSL 5KFGA 4LBHA 1U1MA 4F2SA 4JYAJ 4HI1A 3KJVB 5F8JA 2KZMA 4ZHRB 1RT4B 3DNCA 2PGCA 3FKBA 4FYYB 5H9EK 2JL9A 4OZ2A 3FVYA 1HARA 4GKJF 4B9TA 3OSPA 4WPAA 4HLBA 1Y5NB 2NCKL 1K9MT 2HS4A 4RUCA 3KJFB 2YTCA 4YR0A 2EFGA 2W2NP 3QBCA 1VBKA 1WOOA 2AJFE 7FDRA 3CSKA 3R27A 1TUWA 1Z2ZA 3PHEA 4CI0B 4FF1A 3HHLC 4DG1B 4K8RA 1Q8IA 1VLYA 1UKUA 2I8EA 1QVGR 3UE2A 1KN6A 1FVQA 2WW8A 4KQZA 4ZPBA 2LYVA 2FHOB 4OHZA 2HVIA 3E3XA 3ITHB 4RBVA 2G0IA 2A6OA 2XMKA 4NYPA 3FRZA 3AD7C 1V5VA 1O51A 4IG3B 3IMQJ 4USIA 3ZZOA 4G1IA 2R8KA 3UN2A 2NQPA 1T03A 3MD3A 3CJSA 1QAXA 1C0UB 5IV3A 4D3GA 1FF2A 4NLVA 3BPSP 5KFZA 3V4MA 4TU9A 4F4ZA 2J6UA 4P52A 1SV5A 4UTGA 1WC1A 1WC3A 1XQIA 3PG9A 3V6HA 1FFWB 4O0NA 3D6FB 3JQKA 3OBIA 4OJ3A 2APOA 3TOQA 4ZPAA 2ZH8A 1RT6A 3H90A 2DK2A 1IJEB 4ZVGA 4CNZA 1ZETA 2I1RA 1T3NA 4F4WA 3IS9A 3GJQB 4ZVEA 3VR1A 2M8HA 2GAHC 4K4ZA 3K5PA 3G6XA 5IM0A 4RBTA 1LW0B 2GS8A 3GIJA 2HYIB 1HNWJ 3DYAB 2A3JA 4IDKB 2YNFA 5F0WA 2DNPA 4Q7AA 2OHDA 3GIMA 4RKUC 3GILA 3CCES 4B3SJ 4OYOA 1UAWA 4ZCKA 5KFNA 2CXEA 1VMBA 1NHVA 2CJ9A 1JIHA 1V5IB 2G0JA 2G1HA 2Q79A 2OFHX 1B4SA 4RW6A 3BH6B 4E8UA 1WKKA 1DLOB 4FPIA 3IWXA 2VASA 4PCQA 5GVQA 4KAIA 4LF8F 2DRDA 2C2OB 4NA3A 4DV5J 1AFJA 1YBAA 4A8SA 4TVAB 4ZCLA 2V0NA 2J9DA 3NCPA 1HBMA 2KXHA 1MWZA 2OPPA 3LO3A 2HVHA 1HHSA 1AW0A 2JEFA 3M8WA 1U6FA 1OWXA 2AEFA 1UTAA 1U8WA 3H7HB 5E7OB 4TY8B 4LF8J 1F9FA 1TKZA 1IBMF 1X4FA 1X9MA 1T02A 2D3O1 3FBFA 3LTOA 1LQ9A 4U8YA 4X2BA 5DG9A 3EGVA 3TA1A 1PJ7A 1TAQA 1RP5A 1MW7A 4HVZA 3SSRA 2V4QA 1X9SA 3LAMA 3W3SA 3BF4A 1RTJA 1PJ5A 2DEJA 3IWLA 3LP2B 4XDDA 2HQDA 2YPYA 3NCQA 4ID5A 2NPFA 4XDCA 1S1WB 4CRJA 3B78A 5SZTA 1NZAA 3OXFA 3ISND 2OPSB 3L09A 3WX8A 2HZAA 5FDLB 3AHPA 4K5SA 2V68A 1OYEA 5LSOA 2XZDB 4X4TA 1D9FA 3RRHA 1YKWA 4M94A 3AOBA 2XHWA 3OR1A 4PQAA 3WHIA 3CCZA 3UD5A 2YNHB 2CQIA 2XWXA 3UI3A 2B9WA 2AGOA 3TARA 4IQXA 2IM2A 2HW3A 2OLWA 2H54B 3N0VA 1RABB 3RB3A 1T05A 1IBCB 1YSJA 4KGZB 1FJCA 5B0FA 4P71A 3DRXA 2JLGA 3R3TA 2FJAB 2Y1IA 4QJVA 1K8AT 4AXIA 3OJSA 2GVDA 1RT7A 3Q2TC 4Z7CA 3HULA 3H2UB 4AXJA 3EMTA 2ACMA 4LSLA 4X62J 2VG5A 1VJQA 3HZEA 3PY8A 1YWXA 5THWA 1TKDA 4JOUA 1TMJA 1VK3A 4FDFA 4QR0A 3VAKA 3JSRA 3V6JA 4F4KA 5F3TA 2NS1B 2DH8A 2HS3A 2PFDA 2RVJA 3M9OB 2BKNA 3M8ZA 1YX2A 3ZZZA 1H38A 4P7TA 4I67A 1WHWA 1K1SA 1RAEB 2VG7A 4NLSA 4QBUA 3U1NA 4JI4F 2N3LA 4HACB 2YKQA 4NXMF 2DNNA 2E66A 3DRSB 5J1NA 1DLOA 2AJ2A 3PXGa 4OIXA 4RW6B 4QIVA 5AE1A 4NLPA 3KG4A 1RDRA 1NK7A 3BSAA 2VDHA 3EICA 1R8HA 5L46A 4YR2A 3M8SA 4C4WA 1XIQA 2QEXS 4JI5F 3PO4A 4EI2A 1S9EA 4R5PB 2VPYB 4NASA 5L1JA 1XR5A 1T11A 2FDNA 5L1LA 3IR7B 1XR7A 3IS9B 1QE1B 1SUQA 3GPAA 3HHLB 2J9EA 1N36F 1BUXA 2OEJA 2FD2A 2IJNA 3W8GA 5DG7A 4MYTA 2E1CA 5IQ6A 4I7FA 2GHVC 4M5JA 2JEGA 3OT9A 1N32J 3KDNA 1IKXA 5HSPA 3B4MA 2WVEA 3AA8A 1NK5A 1RJJA 1RE1B 4EGLA 1FEHA 1RK8A 2P6TA 3PYFA 4PYDA 3TUIC 3FZ2A 2BJ9A 4USKA 4DUZF 3DLLQ 5A8KB 1HBNB 2FTRA 1MLAA 4WU2A 2D3UA 3AODA 4ZOSA 4NX9A 1PAEX 4FPRA 3TX0A 2XNQA 4C48A 3WX4A 5IWAJ 3D6TB 3R9LA 4LF9J 3M8QA 2MKYA 1TZ0A 4LFCJ 1FK9B 3G8SA 4ZITA 1Q53A 4XK8C 3DLBA 4WU3A 3JYTA 4JI0F 5DQHA 3IFEA 3RB0A 3BYPA 3HI9A 3TNVA 3SCKE 2ZOMA 5HK4A 1TAUA 2W1BA 2ZZTA 4C3MA 2C3YA 1WTBA 1Q1KA 3BR8A 3PRDA 4HHJA 2B51A 1OMSA 2Z57B 3D4JA 1X4EA 4TN2A 4ZIVA 3M9NB 2DB1A 2MB0B 3C2PA 1YJWS 1B99A 1E6VA 2HSEB 2OGUA 5J1PA 4LF7F 1ZPVA 2QYCA 1S7IA 1UPPA 2ATCB 3J7ZT 3IA0A 4I1TA 1N33F 3IBCB 2AYEA 4HDGA 1Q86T 1SKRA 1H2TZ 1PO6A 2XS5A 9ATCB 5IT9U 2F63A 4MIWA 4C3LA 2M2BA 3F0NA 1KOOA 2MY7A 1SXLA 3ET6B 2YNHA 5KFTA 4AE5A 1H2VZ 2MJNA 4DPOA 2VIHA 1CLFA 3H40A 5HJYA 4O3PA 2R8GA 3V81B 3PW2A 3AJDA 4DV6J 1PIEA 1HNIB 3CC7S 1UFKA 1VLOA 5KFKA 2C42A 1RTHB 1U1QA 2D1CA 3UD3P 1U2RA 1UEVA 4ID5B 2U2FA 4IO9Q 3MAAB 3D0IE 4ILRA 5F8GA 2GHWA 4I6WA 2F65A 3R7NB 4AUKA 2XB2D 2IMWP 2PO4A 2CVIA 3D54A 4R25A 1LW2A 2HFZA 2RDJA 3I0SA 4FVMA 1SJ3P 2FLLA 4DR7F 1H7XA 1GMWD 4N77A 2MPUA 5HMZA 4YB6A 1WELA 2J7UA 3GYGA 1EETB 2PA8D 4RJVA 2GIRA 3IXQA 3UNYA 3I0RB 4DS4A 2NUUG 4C7QA 3EVWA 2R7RA 5K20B 5AXLA 2F7VA 4F4AA 4DR7J 3SSQA 3B82A 3NAIA 2QA1A 3DLGB 3CDAA 4MTPA 4DU7A 3EGZA 4YMEA 2DKOB 2XMWA 4NMLA 2UUTA 4KHRA 2JFDA 2NXJA 2KRRA 4YEAA 1S12A 5B08A 4WFBQ 5EDWA 1TK5A 1NKEA 3Q8PB 1IWGA 4USJC 2ASDA 4DV5F 4QU6A 5HVFA 1RWWB 2GMLA 2DEIA 4NLDA 1U2CA 5HLFB 1NK4A 4C97A 2JZ5A 2IM3A 3JAMY 1R6VA 5CH7B 4UZCA 2J76E 2B4OA 1QVFR 2AU0A 1TP7A 2P5VA 4KFBA 3ZZYA 4Q45A 1RT3B 4XPCA 1KQGB 1C4AA 2XYHB 4GO5X 3PX4A 4OJHA 3T19A 1BMQB 3FDSA 3GJRB 4Q8FA 5KFPA 3BH7B 1S7HA 1XNQJ 3IBWA 4DCJB 3R5BA 3GU0A 4X62F 1QM9A 5CA5A 2B5JB 1BWVA 2CPIA 1SKUB 2ZBRA 4PZVA 3KLHB 2M70A 3G86A 4LFAJ 3BQ1A 1T03B 2BW2A 1NMEB 3KTQA 2KU7A 4IG3A 4LR9A 4C6AA 1UWBA 2IM0A 3MPUB 1Y3KA 3TZZA 3M2RA 5J2NB 4DX8H 4KHPF 3P49B 4J90A 3H5YA 3VWSA 4C8MA 3PW0A 4ECTA 2R7QA 1PC5A 2HGMA 1U02A 4IOBA 1LEOA 2R7XA 2ZDOA 2BBEA 1HHTP 3NWGA 1CC8A 2XULA 2YBVA 4IFYB 5GMEA 2QMUB 5E5NA 4J9KA 4LRBA 4AQYJ 1GT8A 1VQOS 1FXRA 1N34J 4Y2IA 2MY8A 2VFVA 3CJQA 5K5MA 2N7CA 1S0OA 3BM7A 3KK1A 3E2EA 2HK2A 3UW1A 3JSBA 3DLHA 1LOUA 2Z4PA 2R7OA 2KXNB 4F36A 4JI8J 1N5VA 5C24A 4B3MF 5FD1A 3V4IB 3ZTRA 1TQLA 1RXOB 4LIWA 1YBTA 5L9NA 4O3SA 4B9MA 4V19J 3QAEA 3S7RA 1K44A 4FYXB 4CYUA 4WTOB 4TLQA 3DMJA 1TUVA 2EK1A 3BKFA 3I87A 4LSNA 2WBMA 3IRWP 3R8YA 4J9UE 2DHHA 4NA2A 4X4RA 3TJAA 2LA6A 2NLWA 2FVCA 5K14B 1PYSB 2D9OA 2DHSA 4KV8B 5EGYA 1RT5A 2CJYB 2CZVC 2EBGA 2V67A 3EZUA 3FNNA 3D7SB 4ZA1A 4RNOA 4IG0A 3EDRB 1VQLS 1RHQB 3NXZA 3GCXP 3HVRA 2B43A 3AT1B 4ZP7A 2F8MA 3H5XA 1MWYA 4FKXA 4IFVA 2FVPA 1ZAVA 2BRKA 2HFVA 3HD1A 5CZVA 1IBKF 1IR2A 3CTRA 4DQIA 1HIYA 3U27A 4DR5J 3KOAA 2NYIA 1HI1A 2AT1B 1N6QB 2VKZG 3HHKA 3EZ5A 2C2MB 1XTZA 2DH9A 2GNKA 3M1VB 2W24A 3ISZA 3KHRA 5LMNF 3OHBA 2XLIA 3GYNA 1ZM9A 5KFMA 3SV4A 3WIUA 1VGYA 1LXNA 3OFGA 2N4CA 2V4JB 5DO2A 2GGPA 4ZCIA 2IY5B 3DRRA 1PKUA 1SH2A 1VQKS 6AT1B 4OI1A 2HRTA 2IBKA 3I56S 3O8WA 4MMOA 4Y3CA 1M0SA 1T9TA 2FC8A 4MJKA 3R5AA 2XI3A 1AUDA 5CQGA 1FRXA 1VQPS 3AAWB 3HSDA 4O4RA 4TYBA 1FWLA 5CYMB 4BWJA 2QLJB 4DUZJ 3T5JA 3G82A 2YNGB 2PSZA 2OPRA 1YZ6A 1T9XA 2UUCJ 1F1BB 1HA1A 3MAQA 2ZJPQ 5J2MA 1FFSB 1LWEB 2BE2B 3EUNA 4CH7A 1TKTA 2J9DE 2DXFA 4ZPWR 5KT6A 3ENWA 1K73T 4WE1B 4OLOA 3JS9A 2FHMA 3M2RB 1QTMA 2MYFA 4A4JA 5LL6d 2WONB 2AP6A 2WVDA 5B7WA 3R1LA 1RHJB 3Q22A 5KG6A 2VC0A 2I2YA 1DY3A 2OELA 3RBZA 3GQCA 4CLFA 1YITS 1B64A 4NLQA 2E5GA 1LFWA 4QIGA 5A0YA 2ZITA 4RR5A 3N5BA 5IC4B 4EK2A 5C2CA 1G7CB 1RT3A 3C15A 1U25A 1UFLA 1T9UA 1X4CA 2PEBA 1RWKB 2V9KA 1G4CA 2XSJB 2YWKA 2O5DA 3MM9A 4Y34A 1JLAB 3RGIA 5HMYA 3VAFA 2M8DB 2CQBA 1WTFA 3D6MB 3KHHA 2EWHA 3M6XA 4OYAA 5SUHA 3W5XA 2WOMB 1S4FA 3GFYA 5HLFA 2RDIA 1TK0A 1RADB 4DPTA 2QO3A 2IHR1 3BDEA 3MCSA 4LF6J 5L8RC 2XO7A 5JXSA 1QSYA 1GK8A 2BJ7A 4LREA 5ETVA 3VVUA 4X66F 3DRPA 2BQUA 2E9TA 1IKWA 1RKJA 2HZCA 3TVYA 3BBBA 1OY9A 2QN6B 2L9DA 3K17A 2ZH4A 3OW2R 4LMZA 4GKKF 1NEEA 1JLCA 4OZJA 3CD6S 2DIUA 3QQCD 5BYRA 2VA2A 3CJ2A 3MR2A 4NCBA 5DM7Q 2KFZA 2GMJA 2ZHOA 3N6LA 4CLZA 1N56A 4HTIA 1FDAA 2QIFA 1PYTA 1U48A 3W62A 4X66J 2CWXA 4QR1A 2JRSA 3I4PA 4H4OB 1UA1A 1UFWA 2FY1A 1GNKA 4NRTA 1YJTA 5B0DA 1NSAA 2W2PP 1LK5A 3IG1B 1S0MA 3PR5B 3V5RA 1SJ4P 2HVZA 2OD4A 1YJRA 2XBPA 3RW7A 1PBAA 4E98A 4N56A 4J9PA 1HWUA 1S6QB 2UU9J 3G8QA 1F60B 1UW9A 1IR0A 5L39A
chains in the Genus database with same CATH topology
1X0FA 1V9OA 3BS9A 2MQOA 1LK7A 3QYYA 1JLBB 1VOMA 4DF4A 1UVLA 4OX9F 2MZSA 2JHEA 2BANA 4LVOP 5IXUA 1JB0C 4M8LA 5I3PA 4DSJA 1JKHB 2MZRA 1U47A 3C6TB 5HP1B 2IAJB 3I5BA 4DQPA 3K5LA 3TQ1A 2X1GA 4AQYF 1N34F 3NAHA 3D2WA 2C2EA 2OTJS 1Q78A 3O6QA 3O2IA 1KRPA 3AB2B 1FTRA 1KLMB 3OFHA 4M5DB 3FSIA 1JKHA 1YRXA 4C0OC 3HO1A 1U1PA 4ED2A 2XMTA 5IFMA 2KT5A 1MMNA 1JX4A 3KK2A 2ZE2B 3NBPB 1U8SA 3SFUA 4NLXA 3X3UA 4O3RA 2RQ4A 4QPTA 4ZKAA 2DH7A 3QLHB 3K2YA 2LXFA 1N5SA 3MR6A 2O67A 1U45A 3X1LB 3Q2SC 2HIQA 5KFIA 2KKHA 4UOCA 1UJ5A 4KE5A 2UUBF 4G3IA 1S1TB 4TXSA 1HBNA 3CE8A 2AYBA 1DHMA 2B0GA 4GMKA 4UW2A 1JMTA 1WEYA 3MMAA 4YY3F 2OH2A 3TUZC 2ZD1B 3DLKA 1HMVB 5LMUF 2RS2A 1NK8A 3PVXA 3IWNC 2IM1A 1JLCB 4HYKA 2DNMA 4I7FB 4OI6A 4UY85 5KAKA 3MM5B 3DRPB 3U02A 4L3NA 1S76D 3HHLA 2HHWA 1SH0A 1QE1A 3G96A 5B0EA 4DR2F 1L3UA 2V9WA 4O44A 2UXBF 2UV8G 3VAHA 5C25A 2GHPA 3RR7A 2ALZA 4EZ9A 2KB2A 3OVAA 3PRBA 2FGCA 2VKRA 4F3MA 2KG1A 1JLAA 3D0HE 3MZIA 5EWGA 2EBEA 4M5DA 1HNVA 3OFFA 4WFAQ 5KFLA 5L1JA 1RI7A 4DMZA 4RNMA 3RAQA 4C8KA 2Y0SD 4J9SA 2R7VA 4C11B 5A0YB 2OJ3A 1XR6A 2CG4A 2GW8A 3OTBA 1URNA 1X4HA 1XNRF 4ZLPA 4IO1A 2HWTA 2CZ4A 2IAJA 2VG7B 2CIMA 2UZAA 2WONA 2W7AA 2UUAF 4DL2A 1RISA 2BR0A 4CO4A 5JVGQ 2UVUA 2B7BB 4RLEA 1U6BA 3OVBA 3RU0A 1YI2S 4PG5A 2X1AA 4NZ0A 3OFEA 4DSFA 3RBEA 2E5IA 1NJWA 4IRKA 2B7CB 1F5BA 4J37A 5KTQA 1S9GA 3FMWA 2N7YA 3BN7A 3ICLA 4EYIB 4A8KA 4Q2MA 1VC5A 1FRJA 1T7PA 3DRYA 3PW7A 2GV1A 1KFDA 3HVAA 3IG1A 3CEDA 4CTAA 2HHQA 1S79A 2LCWA 3HP6A 4I2PA 3S8SA 1FHTA 3MM8B 2E7WA 2OP5A 3NG8A 3SDEB 1QSLA 4I4BA 3PV8A 4NOHA 1M1KT 3CCLS 2HNYB 2R7TA 5CYJA 4YB5A 4L6V3 1U26A 3ENQA 5HO4A 5KT3A 4WYWA 5EX0A 4KO0B 2OPSA 5KFDA 3OLBA 1VQNS 1KTQA 2QSFA 4DV4F 1M5HA 2VBXA 3O3LA 4LFCF 2ZFHA 4ECQA 2QE5A 3M1VA 2ATLA 1AFIA 1S1VA 3LP2A 3ONQA 2W8KA 1F5AA 1R0AA 2J0SD 1HPZB 2PE8A 4NLYA 1TL4A 4RX6A 1Y5LB 2XI2A 4EYHB 4X84A 3M6WA 5F8MA 5J2PB 2E1MC 4X4VA 4QW9A 2DNRA 1DFDA 1DQAA 4Q44A 1NHUA 5M2RA 4UQTA 1ZTWA 1X5PA 4WJBA 4ZPDA 4QWEA 4NCAA 4QU7A 1L3VA 2OO4A 3G6ES 3GZ7A 5K14A 4MYUA 1QUPA 4GC6A 1NK6A 1U7LA 3DMJB 1NKCA 2QMXA 5E33A 2DGWA 2MHEA 5A6WA 3H2LA 1KVIA 2AJ0A 4HT7A 4NCGA 2HQ3A 4WE1A 5T7LA 2NSCA 2YY3A 1TVRB 2W4DA 4QWBA 3WBZA 5F3ZA 2DPIA 3H5SA 3B4DA 3NMAA 2YNFB 3DYAA 4TNOA 1K1QA 3M05A 2C3MA 3DOKB 2ZNZA 1P27B 5IM0B 2ROEA 5LXRA 5LJ5Y 4XO0A 2RT3A 4FYDA 2VBZA 1S6PA 3H5UA 2YNGA 4RW9B 3CC2S 2D3OR 2PMZD 4ICLB 1X4DA 1T94A 4OHWA 2EFOA 1H3DA 5BJRA 3F41A 2XGQA 1IUJA 4Y2AA 1SV5B 1IN0A 1T3OA 2YKAA 4IKAA 5DS7A 1FESA 4YUDA 2XY6A 2J0QD 4DQSA 1TV6A 3CD7A 1H0HB 2RMLA 3M9MB 2AYMA 2YVSA 4LJMA 1H2UX 2GGPB 1XN9A 3E01A 2MZ1A 2J6TA 3ITHA 1UETA 2M5YA 2ZBCA 5HBMB 4YQWA 1YRUA 3DOLB 4A8QA 4ATNA 1WEXA 1J2VA 5EHHA 1SKWA 2KM8C 1LXJA 2XCPA 2ZM6F 4JI3F 2EG1A 1H7WA 3ZZTA 5EWFA 3HJFA 3QO9B 2VL1A 1GTEA 3OPKA 4YP3A 4F8RA 2LQJA 2OPQB 4Y2CA 1HWJA 1HBUB 2HNDA 2QV6A 3IGVA 2RJZA 3S6EA 4W90B 1WG1A 4PG4A 5DGBA 2GQ2A 4LSNB 1SJFA 3IR6B 4O3QA 1Z4UA 3W2VB 4WFNQ 4Q43A 2M7SA 1CQMA 4LUBA 4DDFA 3FEXB 4RBUA 2BOPA 2L9NA 3LANA 5DDQC 2G0CA 3MPVA 1VC0A 4EBCA 3FZBA 3DN9A 4KRWA 4DOZA 1BD6A 5GADI 2K2PA 3PACA 3LW5C 2XGPA 2HHPA 4AFFA 5E3RA 2ROPA 3CDWA 3DOMA 1JLFB 2UVVA 3HK2A 2RRBA 1HBOB 3UNGC 4G1QA 1FKPA 4DUYF 4LF5F 2F9DA 4K4XA 1T8EA 3UD4P 1MROA 4ZMMA 3DU6A 2JFKA 4HH0A 4FBUA 3HKZD 2DNOA 3UDCA 2CPJA 3KG1A 3RAXA 4FXDA 2E29A 4OJGA 2ZZNA 1VBZA 1IBLF 1HNIA 1E6YB 1FNOA 4NWBA 1VIXA 2BVZA 3CCSS 1V3SA 3VZIA 4ECRA 1HNWF 3SYZA 5DDRC 2Q3PA 1GQEA 3BSCA 4PWDA 3BGRB 3D1HA 3UR3C 4NYZA 3MR3A 4O4GA 3AQOA 1QAIA 3TANA 2UVRA 3JSMB 4N8OA 3GWCA 1N4LA 1G6BA 4OJ1A 4FF2A 2YKOA 3P6YC 4M1KA 2ZDPA 5KT7A 2HNDB 3GV5B 1B0TA 5CCMA 3DCAA 2OPQA 5B0BA 1UVMA 3OTEA 3VTIA 3DXSX 1C0TA 2LDIA 3JTNA 4OFZA 2Y1JA 4QPXA 4W92B 2IYGA 5DQGA 2W25A 1GTHA 3O44A 4Y00A 2GO9A 2MQPA 3DOLA 4LIRA 1UMJA 2K7KA 4B08A 2J5AA 3KK3A 3VCDA 3TUJC 5CCLA 3M8PA 2J6SA 1UEUA 2VONA 2COLA 3VZHA 3DHXA 3CJKA 2HHTA 4EO6A 5HN0A 4DHVA 2OKQA 3PW5A 5KFFA 3PX6A 3CCUS 4I2QA 2L41A 1EETA 1C1CA 2J0XA 4F3QA 5AXNA 1URRA 1CSJA 1GXUA 3IN5A 3C6UA 5F9NA 4BDPA 1D8ZA 3HDSA 2B6AB 3LALA 4ZS6A 3SEOA 5EWEA 3J7YI 2KHDA 1DRZA 4RW4A 1MROB 1R43A 2B9YA 1PILA 1KLNA 5EX3A 4RW9A 1S6PB 5HQ8A 1LWFA 1FERA 2LA4A 1JLFA 3TP2A 1D1UA 2DO0A 2M52A 3DOKA 2F8HA 2BJEA 3BGUA 4RUAA 4CO0A 5KT5A 1VIOA 1DTTB 2FJEB 3K5NA 1UA0A 3BR9A 2HRUA 4NCGB 2RSQA 3M8RA 2K3IA 3CJ3A 5K8PA 3KNAA 1S1XB 4WYLA 5A8WA 3M30A 3UPFA 1ZBTA 2E44A 2R2SA 1NRKA 3GG1A 2HHSA 1V6HA 1M5OC 2CKWA 2WBRA 5D77A 2DGVA 3N01A 1KQKA 3T1AA 3ETOA 5K8OA 3PFOA 4NL5A 4X4QA 1FT8A 1HBUA 3F73A 3EXYA 2R2UA 1X5OA 2QMWA 5T41A 2IYIA 3PIOQ 2QT7A 3NNHA 3QJJA 2OMOA 4J9QA 2GX8A 1XMQF 4DV7F 2CQDA 4WK1A 2J7WA 1BQMB 3LP0B 5E3AA 1L3SA 2KJWA 4FF4A 1Y00A 2R2TA 2ZH6A 1WWHA 3JTOA 1VQ9S 1TFYA 4AL5A 3JSYA 1HPZA 1FDDA 1VRUA 3SCIE 3MPWA 1N0VC 2B9XA 3WZ0A 4ECZA 1OPIA 3CJ0A 2QLWA 5L1KA 1T05B 2F3JA 2ASLA 4DL5A 5F0UA 4PQUB 4KO0A 2C2DA 1XNQF 1JLGB 1FA0A 2LQBA 2VH7A 3E01B 2VBWA 3AJ2A 4DL0C 5AE3A 2MKIA 3G6VA 1KQSR 4NYOA 4FS1A 2MMYA 4OZ1A 4DV0F 4JUZA 3GE9A 1SIWB 3SDEA 1HNXF 2CDQA 2IA6A 4KB7A 5D78A 4B3RF 2K3KA 4NZ6A 4CTAB 3TRGA 2AX0A 4URQU 4ES2A 2ADCA 3ZZ0A 1OPZA 2LU1A 4K2XA 3G4SS 3RTVA 4ZCMA 2RU9A 2ZOGA 3RBDA 2G4BA 2FUG9 2LEBA 3N4WA 3GYXB 1FRIA 4R5PA 4PR6A 1DQ9A 4A46A 1REVA 2MKHA 1FDNA 3MUVP 1KC8T 3OV7A 4ZVFA 3GR0A 2ABYA 3W2WA 3HHEA 1C1BA 4KIAA 3FSYA 5KG7A 1HBMB 3TVKA 2YNIA 1A9NB 2P9GA 3MFIA 4B3OB 2DGSA 5CXTA 4PPZA 2RF2A 1JLEA 1X7VA 4C0BA 1MMDA 1NJYA 3KLGA 1RT2B 3QWPA 2DTJA 3N79A 4CT9A 2NZ4A 1ZTTA 1NJXA 2DJWA 3FFIB 2OMLA 1OQ3A 2VG5B 3J80Y 5C25B 1APSA 3NCRA 2DNHA 2D3ZA 3HPOA 2DNQA 2WHOA 2CJBA 5AE2A 1S77D 5DJBA 3PNIA 1RT7B 2OTLS 3MI7X 7FD1A 2FGOA 3NL0A 4K0KF 2J9CA 4QWDA 2PN6A 3MTKA 2W8LA 3LAKA 3M2VA 4KGMA 5DG8A 4LF6F 1P8GA 5H1SV 4DR6F 4MIAA 1QAJA 4F4XA 4JV5F 1T95A 1ZM3A 3OR1B 4ITSA 3LWMA 1PGZA 1KHWA 3KG0A 2ERRA 1JLGA 1JNZB 4ZPCA 5FDLA 3C66A 2JVOA 4PQUA 2HG4A 3K5MA 4M95A 5KFWA 2X3GA 4WIIA 3TR5A 5GAHI 1H6KX 2XMMA 2CQCA 2EFVA 1VRUB 1ZM2A 2ZKUA 1MU2B 2M3DA 3AJ1A 2Z8QA 5H9FJ 1ZZNA 2G1DA 4J5OA 1BQNB 1NK0A 2W9CA 3V6DB 1WHVA 2BYCA 1FVSA 2OFGX 2MQNA 3BEGB 3V6KA 2LECA 5J1EA 2XS2A 2EC0A 1N88A 4U7CA 2DHAA 4FNHA 1R6YA 3KJVA 1W25A 4H4KC 4ILLA 2ZH3A 1S0NA 2JSXA 4C11A 3LQVA 1RT1B 2AGQA 4KGKA 2ZH2A 2DRBA 4I56A 2LKZA 1VQMS 4QR2A 3PKYA 1D9DA 2PD1A 3THTA 2BANB 4EWTA 1DAXA 5KT2A 4O44B 1HL6A 1U49A 1LWFB 2M0GB 1RT6B 4KJIA 3K0JA 5KFEA 2MKCA 1FD2A 2CFXA 3AA9A 1S6QA 2V8HA 4KC5A 5KOXA 3T5HA 1Q8BA 2AW0A 2MJUA 4FS2A 4Z37A 1WEZA 3ZZRA 4DSKA 3QGIA 1WI8A 3MEEA 3MM7A 1C0UA 1RYRA 2PI4A 2R7SA 4CQ1A 3K58A 3U7JA 3S1TA 1LWCB 1RGVA 2KFNA 1HWKA 4BHQA 1TFWA 4TQSA 4OX7A 4ZPTR 5KG0A 2EVZA 4Z2XA 1FNXH 2EKYA 5B0CA 5DDPC 2DNZA 5KFRA 4DG1A 2E9RX 4PG7A 3FQKA 2KG0A 1VQSA 1HFEL 2D74B 2KHCA 3FSXA 4QCLA 3OR2A 1SKSA 3SZ2A 4BCAA 2ZE2A 4CZCA 1U4BA 3M6UA 1HWLA 2E5LF 2WOMA 1UVIA 2GQQA 4PXCA 1X4BA 5BR8F 2FIUA 3ZZUA 3OXLA 2DNKA 2F40A 2VFTA 2RNEA 4Q2LA 2DVIA 2ZH5A 1UJ4A 1ZZFA 3ISNC 1XEZA 2CQPA 2HHUA 3OQ2A 2MXYA 1WHYA 2ZH1A 4FXWA 1JXLA 4O4GB 2KI2A 5LXYA 3OLAA 4NPOA 3H2VE 3T1HF 4B9VA 2B4UA 1U1NA 3TA2A 4JBCA 4F3OA 2ZH9A 2DO4A 2HPUA 4TLRA 2CPYA 3QGGA 2HMIA 1SBRA 2M9KA 2HHXA 3NP5A 3Q8QB 1HI8A 2IRYA 2ASYA 3KYLA 3T6JA 1VBYA 4QIWD 4X4OA 2BJDA 1YHQS 4H4MA 1XMBA 2VA3A 5J2QB 1M5SA 4QW8A 4RU2A 4Y2KA 3QPIA 1KOHA 1FKPB 2DIVA 4G1QB 3MEDA 2DHGA 1HBOA 1D0EA 1Q79A 2HFOA 3PEHA 2UV8A 4CH0S 3WC0A 3DLEB 3MAHA 5E3PA 1RTIB 2VPXB 4TU7A 1FJGF 1S1UB 4C8ZA 3UQSA 1X4GA 1YQHA 1QLNA 5GAEU 2RD5C 3DRRB 2IJFA 1IJFB 2RUGA 2UUWA 4E0DA 3SQGA 2ZZMA 1X0PA 1LFPA 2XC9A 2SXLA 1Y4ZB 2AGPA 4B9NA 3TI0A 2O3DA 2PDAA 2L08A 3P96A 2ILZA 3BO4A 1YVFA 1UP1A 3MR5A 1FE0A 5JVHQ 1HQEB 1NNDA 1BQXA 1S6UA 1SQEA 2QRRA 4IFVB 3TVZA 2ZH7A 2OSQA 4ECSA 1D9AA