1FRMA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCAPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frmA00
2FDNA 1JNRB 1A6LA 2VPWB 1FRIA 2C3MA 2UZAA 2C3UA 1GAOA 2C3YA 2GMHA 1FDDA 3MMCB 7FDRA 3MMBB 1K0TA 2V4JA 2Z8QA 1XERA 2VPYB 1C4AA 1SJ1A 3MM5A 1BD6A 4CI0B 5FD1A 4RKUC 2PA8D 5BYQA 4KT0C 1RGVA 2C42A 1DURA 3MM8A 1FDAA 1BWEA 1SIZA 3MM5B 1H0HB 3MMAA 1AXQA 1JNZB 3MMBA 1GT8A 2VKRA 5BYSA 5E7OB 1FDBA 1IQZA 1FRHA 4Y28C 1FEHA 2Y0SD 2FJDB 1FTCA 3HKZD 4DHVA 1HFEL 1JB0C 4L6V3 1FRXA 1FRJA 3GYXB 3OR1B 1R27B 3MM7A 2WAQD 2WSFC 1KEKA 3IR6B 1DAXA 1FXDA 2PDAA 2WB1D 3OR2A 4XK8C 3MMCA 1F5CA 1Q16B 1VJWA 3MM9B 1KQFB 4XDCA 5CH7B 2WSEC 1Y5IB 3MM8B 1FRKA 1BLUA 2XSJB 3OR1A 3MMAB 1B0VA 2C3OA 3PNIA 1DFDA 1FRMA 1KQGB 3IR5B 3EGWB 4OV1A 1FD2A 2FJEB 2V4JB 2FGOA 3OR2B 1PC4A 2FJAB 1H7WA 1FDNA 2O01C 1IR0A 2C3PA 1PC5A 1BQXA 6FD1A 3EUNA 3MM6B 1B0PA 1ROFA 1C4CA 2VPXB 4YDDB 1Y5NB 2ZVSA 2FD2A 4ID8A 3MM6A 1B0TA 2FJBB 2V2KA 4AYBD 3MM9A 5BYRA 1Y4ZB 1D3WA 4XDDA 1SIWB 1H7XA 1FERA 1FCAA 1G6BA 5L8RC 6FDRA 3LW5C 1FRLA 2VPZB 2IVFB 1F5BA 1WTFA 2PMZD 2GMJA 1CLFA 5CHCB 7FD1A 1BC6A 3MM7B 1G3OA 3EXYA 2WSCC 4OMFG 1FF2A 1Y5LB 2XSJA 1FXRA 1GTEA 1GTHA 3IR7B 1H98A 3C8YA 1F2GA
chains in the Genus database with same CATH superfamily
5CZXA 4Y2CA 5DZ7A 4UOGA 5DJBA 2ZH3A 2EG1A 2VQFJ 2VA3A 5CYMA 1E6VB 5K14B 2XNRA 2CWXA 1NRKA 3AD8C 3JSBA 2ZVIA 3W9JA 4TNOA 3H5UA 5KFYA 2Y8WA 4CNYA 5DS7A 4MTPA 4QWEA 3QT8A 5KFLA 2CPHA 3NRBA 2BE2A 5A2QY 3KWMA 4ETZA 4JOUA 4KJIA 4NL5A 1RGVA 1EJ7L 3DRPB 3ITHB 3I9V9 3UCZP 1FDAA 1M1GA 1VGYA 3ZTSA 2NXUA 1U48A 1R8BA 3CC4S 3KOAA 2HHXA 1M0SA 3V81B 3CMAS 2CPDA 4URQU 2Z30B 5GMEA 1P27B 2RU9A 5ETMA 2WRMA 2JEIA 2KZMA 5A76A 3NEKA 2CG8A 2ZH2A 3OXGA 3IWXA 2Q1LA 1HBUA 2CQ4A 1K9MT 1GNKA 2DRBA 2AT1B 3LP2B 4IFVB 4QWCA 3KK1B 1EIYB 5M2RA 5C25B 3DFEA 3BKTA 3HVWA 2HKEA 5KG1A 1TUGB 3RB3A 1NU4A 5JJBA 3TA1A 1ZYQA 1Y0HA 3LTOA 1UJ6A 3DI6B 4AD6A 2VFUA 2UVUA 3PYGA 2W2QP 3VR1A 4DCPB 2AJ1A 3MCMA 1WTBA 1VQLS 2L48A 1TQLA 4B9LA 1CJKB 2WAQD 2H3EB 4IFYA 4ZVFA 2EC0A 4HHUA 2BE7D 4A8MP 3LQVA 1VHIA 3LF0A 4UOFA 1UZDA 3C16A 4CZCA 4DUZF 3UD3P 4B3OB 4DG1B 2HFNA 3VAFA 1KQFB 2DH9A 3K5OA 3IGNA 2JHEA 2MHEA 5D78A 1REVA 4X4PA 1RJJA 1DBDA 1R31A 1GXTA 4DV7J 3SQGB 1UW9A 3BH7B 3HHKA 4ECVA 1UVMA 1BQMA 4BDPA 3HKWA 4DR4F 3T5JA 4EWTA 1WF1A 2BRKA 3UVJA 5CD4H 2F4VJ 4ID5B 4FBUA 1U49A 2D3OR 2O5DA 3LPEA 2DK2A 3MAAB 3KLGB 2M9KA 3EYZA 2EXUA 1VBYA 4PYDA 2C3PA 3KLHA 1K73T 3Q8PB 3O8WA 4PRFA 1YJTA 4QW9A 4WBFA 4ECRA 3B82A 2OTJS 2V2ZA 5IC6B 2DEIA 3J81Y 1Y7PA 1XN9A 3PJWA 4OZ3A 4KY3A 1MLAA 1PAEX 1TMMA 4ZVHA 4BWMA 3VAMA 3R5BA 4OZ5A 2FD2A 5L39A 2BJ8A 4E98A 2UUAF 3DRYA 3I6PA 3BBFA 3MR7A 4UW2A 2OELA 4ICLB 2XYGB 3GJRB 1S7HA 1XC9A 4LF6F 4YS2A 2DY9A 3OV7A 4IR9A 4JI4J 1CJUA 2U1AA 4NCGB 4NX9A 4WFNQ 3C2PA 4LF4J 4FF1A 4WE1B 2HGNA 3CXCR 5J2PA 1X9SA 1S97A 4K4VA 1TUVA 3HHDA 1YZ7A 4NEZA 3X1LB 4WU2A 1QD1A 1ZZFA 4Q2MA 4DSFA 2UU9J 2OEJA 2AGPA 4OYIA 5HQLA 3CEDA 3KHRA 4QU7A 2C1EB 3EZ5A 4MK8A 4RBVA 4JV2A 2RF2B 1SC3B 3QPIA 3ADAC 1E6YA 4PG4A 1KSPA 3T19A 2R8HA 3EXYA 4F2SA 3KLIB 2YNHB 1FF2A 1T9TA 2HFOA 2HQIA 2GMLA 4RNFA 4EYHB 4PWUA 2CNNB 2MY7A 2PIIA 5LJ5Y 4IQXA 4CYUA 4DR6F 4B3TF 2QLXA 3N4WA 2IDEA 3HVAA 1RKJA 5HI7A 1RZMA 5C7PA 2OAUA 3P5BP 4ZPBA 4DMZA 1JKHB 1MROB 2AX1A 2XY6A 2C3MA 3UE2A 3CJTA 1GMUA 4PEOA 2OD4A 3C15B 3DRXA 4JV5F 2V68A 4G1PA 5GMKa 1ZTWA 2V8DA 4YB5A 3VAHA 4KKOB 1RT3B 3FCWA 4NI2A 5K5MA 2HMIA 4LFCF 1RT1B 2WONB 5T14A 3N5BA 4LFAF 1YBTA 4PQAA 1BD6A 1S1UB 2F40A 4AE5A 4KH0B 1REVB 3M8RA 1IBMJ 1HPZA 2D69A 1RWNB 1ZOTA 2RNEA 3OTBA 5EWGA 4H4KC 4DSEA 2NYHA 3GJTB 4NLDA 4RW4A 3ZXWA 3KK2B 3NWRA 2IVYA 5BYSA 4KPYA 4YOEA 4WKRA 4UQGA 3HHLC 4ZHRB 1JLAB 4JI6F 2J0SD 5LXYA 1N33J 4HTIA 2XS7A 3VQTA 3JQJA 1IQZA 4A8KA 2F8EX 2XLKA 3A8KA 2FZKB 4DL7A 5KFZA 4B9UA 3O2IA 2XWYA 2AYGA 3W7BA 4O3QA 3G2XA 3P49B 2APOA 2UXDF 2W2OP 4F04B 3DLGB 1BGXT 1WSRA 2UXBJ 4USJC 1RUSA 1TL7A 3UR3C 2QZ8A 5KFNA 1CSJA 3G82B 3LP0A 4AL6A 3QLHA 3TAMA 1R8HA 3T6JA 3PRVA 4BBYA 3DC2A 3MTJA 4ED6A 4YFUA 2EW9A 1IR2A 4NZ0A 4Y6IA 5J2NB 3BO2A 2GO9A 2OHDA 2L41A 1WACA 1V3RA 3QYYA 3TZWA 4P75A 1WUUA 2XS2A 3BDPA 3QO9B 5GAHI 3G71S 2HHTA 3K5MA 2C2MB 3QAEA 1WHWA 1B70B 3PKMA 3QRPA 1P8GA 2QLBB 3M8WA 3M8PA 4H54A 4MYTA 4WFYA 2FJVA 1LXJA 1RWVB 5KFJA 4LRAA 3PV8A 3FBEA 2LU2A 3AA8A 4OV1A 2CJKA 2KZZA 2R8JA 1RB0A 2AW0A 2HQGA 1E6VA 2V4JB 3KXDA 2DEJA 4Z7CA 3NWGA 1WDDA 1H7WA 1A9NB 1BXNA 4Y2AA 1LK5A 1FDNA 3NOGA 1IR0A 4DOZA 4X4RA 3OW2R 1M5PC 1QAYA 2EK1A 2DO0A 2IAJB 2HWTA 4NYOA 3MEGA 1VDHA 1RT2A 4EFAC 2GCFA 1Z2LA 5H9FK 4PWWA 1HI0P 2WW4A 4ED2A 3POTA 3R5CA 3NL0A 2ROGA 4J91A 4CLUA 1CC8A 1LWFA 3DGPB 4IG0A 1F60B 3V6DA 4E0DA 2IC3B 1HBNA 2I8EA 1RHJB 1DQ9A 3LP1B 3CCSS 3T3FA 2YKQA 1FFSB 2YNIA 4L75A 1C1BA 1LW2B 2RQ4A 5HMYA 3H5YA 5EUHA 2AMCB 2CIMA 4CT8A 2V9WA 5KFDA 4JI7J 2KTQA 4QZVB 1ZA1B 2OLWA 3NCRA 2R7WA 2D9OA 3LAKA 1CEZA 2YNIB 5IZHA 1OQ3A 1FRLA 1WTFA 3LP1A 4R5PA 5L46A 2OFGX 1K0VA 2XGPA 3CCLS 4I2QA 5CCLA 2RE1A 5IXUA 3BBBA 3HSDA 3OJSA 1AZSA 3GFHA 4Y2IA 3NGRA 5HAOA 2EK6A 3IR7B 2FZGB 3BGLA 3ZZUA 1S0VA 1JLCB 1D09B 2OPSA 2J9DE 2DNYA 2X3DA 1N0UA 1F5AA 3D1OA 4TU9A 4DV7F 3GILA 5B0AA 4RNMA 3I5BA 3L09A 5KT3A 2C3YA 2VFSA 2B4PA 2DNKA 1R0AA 3QAUA 1C0UB 5A6PA 3Q23A 4I1TA 2VDIA 4LQ9A 2V4JA 4RW8B 4NYZA 3W8GA 3SDEB 1R7IA 4OYBA 1N54B 3A3PB 3BN7A 5JXSA 2OO4A 2DNPA 4K4YA 2ASDA 2UXCJ 1AFJA 5K8NA 1GH8A 1LWXA 4EBDA 4U7CA 4CO3A 2AGQA 5HO4A 2KFZA 2G13A 2KI2A 2LQJA 1TKTA 3QIDA 5BR8J 3Q8YA 1RTIB 1TVRA 1T3OA 3PKYA 3UD4P 3QFHA 2Y1IA 2OPQB 3QQCD 5HROA 4DSKA 1JNZB 1N0VC 3BKUA 4F26A 5I42B 2OEMA 4P6QA 4Y3CA 2YWEA 3VAIA 3MZIA 2ZZMA 1FDBA 4YB6A 2AHOB 3EGVA 2HLUA 4LFAJ 1VQ5S 2RDDA 3F56A 4YQWA 2HVZA 3H2UB 3WBZA 1NNDA 5B0GA 3SSRA 5EGYA 5DG8A 2JX2A 4J9RA 1M1HA 4WIQA 2HEKA 4R0JA 2GHWA 5IM0B 4DZDA 5B0FA 4DUYJ 3TARA 5J2MB 2I9SA 2V69A 3DDKA 4OHWA 4L6V3 1OY8A 3RYLA 4CDIA 2DGQA 1J2VA 4ZLJA 2DNQA 4ED0A 5ETNA 2Y0BB 5E3AA 1FEEA 3M2RB 2N82B 4K4WA 2IIHA 5L38A 2YWHA 3BF4A 2ZD1B 1SCJB 5F8IA 4TXSA 1F2HA 1P1LA 2BA9A 1U6BA 3OBIA 3ZTQA 3JB9k 1J5EF 2ZKUA 1WD6A 1PBAA 2QMWA 1Q16B 4LF4F 1UFWA 3UDCA 3VQSA 2QFJA 4QIEA 2DGSA 4A46A 5CCMA 4KPCA 4RNNA 2OPQA 5HROB 3A1YG 4E8UA 2CQBA 1NK9A 2FLPA 2GHPA 3DOKA 1RCXB 3JTOA 2JLGA 4I64A 2QYGA 2E5LJ 3CDAA 3I5AA 4ES3A 2N4CA 1FWLA 4B9NA 2KVIA 3HSJA 3HMJG 1MG7A 2FC8A 2ZBCA 2QA1A 1JLGB 3ZTRA 2DHGA 3MPVA 2ZKTA 5KFQA 1TL5A 4MMOA 1SJ4P 5KAKA 2EVZA 3AY0A 4L3KA 4OJ1A 1XR7A 4PQUB 1FKOA 1IBKJ 1NJWA 4QU6A 5SZTA 4CO0A 1OYDA 2E9ZA 1VQPS 1N5QA 1RWOB 5T7LA 5KFAA 2SXLA 1JKHA 1UW4A 1R8CA 3G4SS 2QEXS 3IRXB 3O1LA 2VICA 4CLKA 2ZHOA 1VI7A 3IN5A 3KLVA 5LOQA 3I4PA 3IWNC 1RYRA 4LFBF 1T9UA 2B4UA 2DT9A 3I0RB 3HZGA 1XQIA 4B17A 3OTOF 3MUMP 4DV2J 3NCPA 1NHVA 2XULA 3O44A 1UA1A 2ZH8A 1KLMA 1HD1A 1RU1A 3MD1A 4HH0A 1S1VA 1NKBA 1U2CA 4TY8B 4ZN3A 2NXJA 4X65J 4V19X 2KXFA 1GMWA 4YY3J 3C6UA 2FVQA 2JEJA 2E44A 2F8MA 4F36A 1DZ5A 1X4FA 5DDQC 4J9SA 2AYBA 3PO5A 1JLFB 6AT1B 2HNDA 3EE3A 3OL8A 4LIWA 2DNRA 3Q8SB 2YKNB 1QSYA 2IC3A 1HBNB 1FKPB 3L95X 1FESA 4J9KA 2LQBA 1DQAA 3U1LA 3RB0A 2RKIB 1WC0A 1S1WB 3M9MB 1T8EA 4USTA 4ILLA 2CDRB 2Y1RI 3SEOA 4G1QA 4C8OA 1HNXJ 4Q2LA 1HQEA 4PYAA 3TUIC 1SQGA 5H1SV 3CC2S 4ZVPB 2BM0A 4IH6A 1JNRB 1S0NA 4LF8F 1UVIA 4K7QA 4J5OA 4ZPAA 1B7YB 2OSRA 2E1MC 3MMBB 3T1YJ 2EEYA 3TANA 3S1TA 1XERA 1QUPA 3TJ9A 2ROEA 4DX8H 4DX7A 3VTIA 5L9XA 2NXNA 4I7FA 3BQ0A 2PA8D 2V2VA 4KT0C 1U1RA 2BRLA 4DR7J 2DRDA 4A47A 3K58A 3HULA 2XLJA 4Y0FA 2WW8A 4Q8FA 1HMVA 4WF9Q 2IRXA 3HX9A 4GVBB 2LEBA 2X1GA 3MMBA 4DSIA 2M7SA 1CBKA 3M1VB 2OUGA 3OQ2A 2E1PA 1RU2A 3KDOA 1HNIA 3I5CA 2DPIA 2YNFB 2KRBA 1B3TA 2JOQA 2HFVA 1O6XA 1F6TA 2V63A 1AW0A 3HFVA 4KSEB 1B4SA 3K0JA 3CD7A 5CZVA 4JV5J 3H98A 4ANDA 2Y0SD 4KO0A 3IAS9 1AZSB 4ZP9A 3G82A 3LP0B 1AFIA 2P6TA 1JQGA 2QO3A 4PPZA 1FRJA 1KQSR 4RWWA 3QWUA 4R5PB 1AUDA 3RTVA 2IFXA 4Q8EA 2HS0A 2Q6CA 4IH5A 1FK9A 2OPRA 2VA2A 2DIUA 5C25A 2CZ9A 3GIKA 4USHA 4ZK7M 2D3O1 3IG1B 2OJ3A 4N5SA 1URNA 1FX4A 3SFUA 4OYAA 3IR6B 2CAJA 5DG7A 4MK7A 3EGNA 3KTQA 1M5KC 1WF2A 2FLOA 2HQFA 4KYZA 4M5KA 4O3SA 1WHYA 2ALYB 2FVCA 2QYCA 2Z58B 1ELOA 4HT7A 3KYLA 1X4HA 2GAHC 2IYIA 3FMWA 3L7UA 4WXOA 1Y5IB 4DQPA 3D7SB 1X4AA 2OIHA 2EFVA 2UP1A 1MMNA 1PJ7A 2BJDA 1LOUA 2MTLA 1Q86T 1NK7A 5B09A 2C2NA 3GYNA 5FIIA 2MQPA 2HZAA 5H9EK 3WZ0A 2UVRA 5A8RA 1JK9B 3RGIA 4LRDA 2VJUA 2DGOA 4A8QA 3ZNJ1 3CF5Q 3DKDA 1YWXA 1N5VA 1IBCB 2NPIA 4LVNP 3OFGA 3W64A 4OYWA 5G0RA 1DJ0A 4K4ZA 3ENWA 3GTYX 1FNXH 1IBMF 2PE8A 1JXLA 4EO6A 4WP3A 3P3DA 2AGOA 2K3IA 4DPYA 1WHVA 3P6YC 1BMQB 2CPJA 9RUBA 3CCJS 2D3UA 1F9EB 2H65B 4I7FB 2R42A 4HACB 1I6JA 1X4DA 1LWCB 3EM1A 3Q8UA 3MM6A 1B0TA 1RWPB 1XMBA 2NCKL 2NS1B 2V2KA 4ETXA 4XIUA 1ZA2B 1ZTTA 1EQ0A 2CJ9A 2OMOA 4MIWA 4WU3A 1TL1B 2NXEA 5CYQB 2XTJP 2HRTA 1Y4ZB 4O3PA 2VUGA 1JLEA 2YX7A 4RZRA 2V5HG 2HIYA 3PIOQ 3JSMA 3BSNA 4LF5J 2B9EA 2OEKA 4MT1A 3N6LA 2DIVA 2G4BA 3QZ8A 2QSFA 3UN3A 1WG4A 4UQTA 1WKKA 2DJWA 3IA0A 5IOLA 2CJBA 4EBEA 2X1FA 4NCBA 2DHHA 2HHPA 4U95A 3T1AA 4CO5A 5CA5A 1CG2A 5K8MA 5LMUJ 1U8SA 2JJ4D 4NLVA 4M95A 3LUYA 4LRBA 4DEZA 3ILOA 2LVWA 3HCXA 4PXEA 1GK8A 5E41A 1NHUA 4NEYA 2KFNA 5KT6A 1YKWA 4OI3A 4C2MA 3TZXA 4B9VA 2HFSA 1TV6B 4OX6A 4N77A 1A6LA 1FA0A 3TOQA 3WDOA 4HDGA 3M8YA 3D6MB 4KH1B 1JLAA 4NPOA 2NREA 1HBOB 3MMCB 3QMQA 5I42A 4C11B 2HW3A 3ZO7A 5DGBA 2YH1A 4NMXA 2RJZA 2DH7A 2Z8QA 1Y00A 2F4VF 2VG5B 1UFLA 1QE1A 5D77A 5HANA 5ETLA 1TK8A 3QRQA 3CW2C 4YR3A 2Q3PA 1TFWA 3V4MA 3DOLB 3J81j 4J37A 1I94F 1DURA 1UA0A 1SIZA 2VHGA 4B3RF 3W66A 1H72C 2NXCA 4DPTA 2V4RA 2BE9B 3CJ5A 4P71A 2ZUGA 2YXLA 1S1XA 1ZH5A 2UUBJ 4J9VA 2GVZA 1WOOA 3DXSX 3BREA 3RU0A 3R7SB 2W24A 2XNQA 2XLIA 2HVHA 3OFFA 2JFKA 3U27A 1S49A 2FY8A 4LSLB 3GWCA 2WCXA 5KG2A 2RU3A 2GO8A 4LSZB 4Y28C 1PIEA 3CC7S 3M2VA 4EZ9A 3U7JA 2HGMA 3MCOA 1FTCA 4HI1A 1KFDA 2MEWA 2QE5A 5IQQA 1SXLA 1HD0A 2B7CB 4CNZA 2DPJA 2CNLB 3CMES 2KJWA 3D3BJ 4DL4A 1D8ZA 1WG1A 1APSA 3MEEA 3M6UA 1UVNA 3OTOJ 1ULRA 1WKJA 2MZ1A 3H59A 2JVOA 3EGZA 4MIBA 3MHYA 5F8GA 4LF9F 5B0EA 4NLTA 5G4DA 1C1BB 2JWNA 1HARA 2E5HA 2GX8A 2PDAA 2PC6A 3EVOA 3I55S 4FS1A 4UOCA 2W4CA 1NSQA 3ENVA 2KG1A 3PX4A 3ONQA 2R8KA 3K59A 1TTHB 4ICLA 3VZHA 2V4QA 1ZPWX 3PO4A 1UEVA 2QGFB 3P8BB 4B02A 2ASJA 4QIWD 4YR2A 4ZJQA 1T9VA 4ZVOB 4DLEA 1CJVB 2IRYA 2M52A 5A0YA 4WCEQ 1RT2B 5KFKA 2HK3A 4ZCIA 1DFDA 2CRLA 1X8DA 5KT5A 1TU0B 4USIA 3KDNA 4DR2F 2AJQA 1T0TV 3E01A 3IR5B 2YKPA 4ZOSA 5D3GA 2LXFA 2KB2A 2QX0A 1T95A 2W25A 3FJ2A 4FNHA 4C6AA 3DLKA 3JTNA 5F41A 2B3TB 1KTVA 4ZITA 4TQSA 2R8IA 1VRUA 4L3NA 2VBZA 3OTEA 2Q6BA 4JBCA 1N5YA 1BQXA 2DHSA 2UUCJ 3T6BA 2ZM6F 3CMQA 3EX7B 1D9FA 1WWHA 5HLFA 3Q86A 4ECTA 1FKAF 1BQMB 2CJYB 3BGRA 3C14B 4RU2A 1SQFA 1S0OA 4G1IA 4FYWB 4QQBA 3DGVA 4YR0A 2ZHAA 2CKWA 1HLWA 1YRTA 2NR0A 1I5OB 3M2UB 2VG7A 3FMBA 3W2VB 1FWPA 4DL3A 1U1NA 1MNEA 1RTHA 4J90A 4B3SF 1QVFR 5LMNJ 3ILLA 4OZLA 4AL7A 2OPSB 3JAMU 1Z4UA 1WNEA 1W25A 1UPPA 2R7TA 4DQIA 3UN2A 1BY9A 2NYIA 5L8RC 4UTGA 4ECQA 3K2YA 4H4MA 4RPFA 4RUCA 2HNYA 3RAQA 4NLOA 1ZBTA 1EETA 1MN7A 3OTCA 1RBAA 1R89A 5GAGU 3OSNA 4B9MA 1RT4B 2VQEF 4CO2A 4DSLA 1OSCA 1TELA 3HHLA 5EX3A 3SZ2A 3H4BA 1ICEB 3PYDA 1YDLA 2CPEA 1ZAWA 4YDXA 2KJVA 4IOAQ 3NCQA 3GIMA 2C3UA 2P2CB 2Y8YA 1LEOA 4HTJA 1YK9A 3AHPA 5FDLA 5KFBA 1VMBA 2AYMA 3KK2A 3DM2B 2DR8A 1N52B 4FXDA 1RTZA 3JYTA 4PPDA 5SUHA 1SJQA 2PGCA 5JUMA 2DXEA 1RACB 1SJ1A 2RIJA 2GNKA 1TL3B 1NJIT 4KFBB 2MMYA 3MXHP 3VAKA 1N36J 3P5TL 1X4GA 4PCQA 2HZVA 3DLBA 2C42A 4MAKA 2AJ2A 1RT1A 2WONA 4PABA 2DVIA 2H4WB 1M5HA 1LW0B 2JZ5A 3NLCA 3T1YF 4J9NA 2F65A 4USVA 4ANEA 2JNJA 4F4AA 3RAXA 2YQ1A 3KMSA 3A13A 3D0IE 3PRDA 2HQDA 1AA1B 5IWAF 3ZNUA 1XJWB 4CYUB 3J7A1 4U7UD 3F0NA 4QWBA 1HR0J 2W8KA 1PYSB 2DR7A 2MZTA 2PMWA 3NNHA 1N56A 4QCLA 4ZPTR 3CT9A 1XK8A 1F0XA 4NA2A 5F3TA 2O3DA 4TU8A 4KE5A 4OI6A 3IGVA 2BANA 4IDKB 4DPOA 5LT5A 1PBUA 3JSYA 2HURA 3B54A 5D4OA 3QJLA 2AEJA 1NKEA 3JYTB 1RAIB 2VBXA 1CQNA 2VD3A 4ZCKA 1DTQB 1O0PA 1UMJA 2KN4A 3MEDA 3NAHA 2AZ3A 4OLPA 5KT7A 4WE1A 3F44A 4P9SA 3L3CA 1FD8A 3AQOA 3HJFA 3EICA 3OL7A 1UVLA 4N76A 1RYSA 2J0WA 1DTQA 3U1NA 3MURP 4ED8A 1VQ8S 2B51A 4N56A 3ZTPA 3C6UB 1RTDA 2GA7A 1HL6A 1PSDA 4ECXA 4ECYA 1XMOJ 4PWDB 1W26A 2W9BB 4IDKA 4ZIVA 5EN1A 4DFMA 1Q53A 4XPEA 2HAFA 4TN2A 2YVSA 1EETB 4Y34A 4ZPDA 1J5EJ 3G6XA 2MQ8A 3VGVA 2OP5A 2GQ2A 3I31A 4NLWA 1KTQA 3RR7A 2CJQA 5HMZA 4FF3A 4OZ1A 4CP5A 2E5JA 5E3CA 4NRTA 3KLHB 5L1LA 2UXDJ 1FD2A 4X62F 1REGX 2RHSB 5A6WA 1QLNA 3UR0A 3Q2TC 2W9AA 2FJAB 3A12A 4CO1A 1GXUA 4CH7A 1HNZJ 3BEGB 3I87A 2GVZB 2Z2MA 4FYVB 1XEZA 4O0IA 1N48A 4ZIWA 4YMEA 5M2UA 1V5VA 2GIRA 4NLXA 1NAQA 1VS3A 2DNOA 4N47A 3OLAA 2VPXB 1RWMB 1MWYA 4FBTA 5IT0A 2J9CA 4R0EA 2KDOA 4U8YA 3D6HB 1QE1B 2CVIA 4C0OC 3CUNA 1D3WA 3R9LA 1Q95G 4LT6A 2KU7A 4WIIA 2OFHX 5BJRA 3MFIA 5I4MA 1EKRA 1HNVA 5DGAA 4UUWA 2Z57B 5F3ZA 3CJKB 4BS2A 1HBMA 4DV4J 3ZZYA 4JYAF 1U26A 2ZEJA 2I5JA 3H25A 3J7ZT 2CZ4A 2YNHA 4UY85 4QR1A 2D41A 4OQJA 4DQRA 2MHNA 2VKZG 2WSCC 4OMFG 4USKA 1Y5LB 2D9PA 2F5GA 1U7LA 4F0MA 2W9BA 4PG5A 3LP2A 4LREA 2RD5C 4H4MB 1L3TA 3NP5A 4EI2A 5E5NA 5J2MA 4DV1F 1PKUA 2L9NA 3MPUB 4BC9A 1L3SA 4FYDA 3CCVS 1RABB 4DDFA 3OXFA 1FDDA 3FFIB 3QGGA 1NB7A 4G65A 4ED5A 1HI1A 4OX7A 1SH0A 2RUGA 1SH2A 1WORA 2HWIA 2XZWA 1OIAA 4EBCA 5HK4A 3W2WA 3W2VA 4W90B 2ZE2B 4ZVRB 1CVJA 4GKJJ 3PG9A 2U2FA 3HJVA 3IAM9 4KGMA 3OTDA 1RBOB 5KG3A 4OX9F 1SJFA 1IUJA 1SL1A 4OI2A 3AJDA 3BGRB 3JS9A 2VL1A 3MOJB 1W2BR 1BWEA 1W2IA 4NOHA 1X0FA 1L3UA 5L1KA 3UN5A 2O1PA 3MAAA 3KLGA 4NXNF 1L3KA 1M1KT 3MOZA 3DLEA 4RLEA 1PG5B 2DNGA 3MD3A 2IHR1 3SFGA 1HWLA 4DR2J 3CD5A 1S1TA 2QL9B 2JC1A 2KT2A 3AXMA 3DLKB 2N7CA 4DF4A 1U09A 2BQRA 2ACYA 1S1XB 2H1YA 2LA4A 4PR6A 2V9KA 1NBEB 3E01B 4Y65A 3PIPQ 4OZJA 2HNZB 5GADU 4LF9J 1WOPA 1RWXB 2GJ2A 4DHVA 2RILA 2ZM6J 3TYTA 5GADI 2H4YB 2A18A 2MKSA 5THWA 1HIYA 4F4ZA 2KYZA 1QAIA 1OJ4A 2E29A 3PR5B 1S57A 5EX0A 3Q8RB 4A8FA 3C66A 4URSA 2RT3A 5H9FJ 4NA1A 5FDLB 4CH0S 2AWZA 4RNHA 4C11A 1BQNB 3A3NB 1UCNA 2GC8A 4TLQA 2JSXA 3NGTA 1FXDA 1S9EB 2NUHA 4XK8C 5AXKA 4ZLLA 4IFYB 5IT4A 2GVDB 1YGYA 1F5CA 5A0YB 3WX8A 1RHQB 4F0HA 1TFYA 3IG1A 2RDIA 1LW2A 1FVQA 3SCIE 4O0NA 3TO8A 1XNRF 3FDSA 4YN3B 1BLUA 2E7WA 2C3OA 3UWTA 4WTOB 2EPIA 3MTKA 2QN6B 3ZZRA 1RT5A 4OJHA 4USWA 2HNYB 1WEZA 3POTB 3GONA 1OPZA 1T11A 4M5MA 2MQLA 1HBUB 2G2ZA 4HT5A 3RG6A 1ZPVA 2BYCA 4PG6A 5D15A 3VCDA 2F1FA 1VCTA 4QBUA 1VC5A 1AB8A 4DQQA 1UPMB 2Q43A 3AQPA 5GMDA 1YJWS 2QL5B 1ZS6A 1IM4A 2V8GA 2YNFA 3D6FB 2HWHA 4EYIB 4KC5A 2W7PA 2UUWA 4HL9A 1UJ5A 1KOHA 3PVXA 1NEEA 2HVEA 5KFXA 1UZHA 2AJFE 2M8DB 4ILMA 3TP2A 1VQMS 2C2RA 3Q89A 1HHSA 3CCRS 1BWVA 4K8RA 3VAGA 1HI8A 3DOLA 3LANA 2JVRA 5RUBA 1HNWF 4WWSA 4P2XA 3SXLA 3KMQA 2CJAA 2XG8A 1ZAXA 3SQOP 4M5DA 4OYOA 2B6AA 4AYBD 1H2TZ 5IWAJ 1P9YA 2C22A 3QJJA 4LBHA 3QO9A 2CDQA 2M2BA 3LA0A 4W98A 2PI4A 3QIPA 1I51B 3MECA 4WXWA 1IWAA 4WFZA 4XDDA 2B9YA 2YKMA 5CYMB 5K14A 5IFMA 4J9OA 4X4NA 5B0CA 2MQQA 1HHQA 3AODA 3PFEA 1Q7LB 1Z2ZA 2EKYA 1G6BA 2MY8A 1CC7A 3CTRA 3W1YC 2VFVA 5A2QU 3LW5C 2IVFB 2YTCA 5FLXY 2GMJA 1Q8IA 3M9OB 1OY9A 2W2PP 5LM7E 2ZJRQ 1TAUA 3CB4A 2A2DA 3QLHB 1MMDA 1G3OA 2QJ3A 4KGVB 5F8LA 1JJHA 2QA2A 5F8JA 3KFWX 2JLFA 3DDIA 2BUNA 4ECSA 1HHTP 3Q0AA 1V3SA 1G7CB 2I2YA 1VFJA 4K5SA 5KG4A 2Y1LB 5T41A 1M5SA 2B9XA 1GAOA 4Y2KA 2R7XA 4AQYF 2MSSA 1FXLA 1KVJA 1KDNA 3BB5A 1TUWA 2JC0A 1TK5A 5LSLA 4M1KA 3IMQJ 2BOPA 4ZHRA 1FK9B 1WEXA 4OLOA 2LMIA 2RB7A 2ZBIA 4CTAB 1RQ0A 2ZFHA 1J5OB 1JLQB 4RW4B 5E33A 4C0HA 4R8UB 2BKNA 2ZITA 1A0OB 3QT7A 5FD1A 4Q44A 3KK3A 3TAQA 2BQUA 4UZBA 4CWBA 1TKXB 5AE2A 1EX8A 1SL0A 1FNOA 1MW7A 2RQCA 2MDAA 1H0HB 4A8WA 1HBMB 1R43A 3UPFA 4DL5A 1NK8A 2E7XA 1VQKS 4N7TA 4RO0A 4JI1F 3SSSA 1HNVB 2PA3A 1S76D 1N32J 1VC0A 3FSYA 3MR6A 3W5XA 4C3MA 2ADCA 5L1JA 2FLNA 4GKJF 2H48B 4MKVA 4OFZA 2FHMA 1WEYA 1FKOB 4PAAA 2C2DA 1SJRA 2R3VA 4FPIA 3AOCA 4DN9A 3PX0A 5LMNF 3ZC4A 1KHVA 1R0BG 3S7RA 1Y3KA 5F8MA 2MLZA 1H74A 5IT9U 2RS8A 4LMZA 3GYXB 3QSIA 1JXEA 2WVCA 3H5SA 3S01A 3BPSP 3RBDA 5I3UB 4K0KJ 3OD2A 4O4RA 1VLYA 3GJSB 9ATCB 4F4KA 4OI0A 3M6WA 3M7VA 2ZWPA 1B99A 3NOCA 1DTTA 3CCES 3QJPA 4NXMJ 2B4OA 4HHHA 2C2ZB 1FX2A 3CJSA 3OR2A 3SIPB 5BR8F 2IM0A 4F4XA 5KFVA 3FQKA 2KFYA 1NJYA 5C42A 4U7UK 1M90T 2HK2A 3A8IA 4C3LA 3C6TA 1YHQS 4ED4A 3H20A 2MKKA 1N33F 2FHKA 2DGWA 3DRSA 4G1QB 3TZZA 3MCSA 3V4IB 2HHHF 2BOAA 2RKIA 3JQKA 1IM6A 1RHMB 1IKYA 4BCAA 1D9AA 2L3MA 2K2PA 2DCLA 3D5MA 4DR3F 4YP3A 3D0HE 5KT4A 3T9NA 2FVSA 3EGWB 4C8ZA 3SBMA 3MEDB 3EJMA 1AROP 1NDPA 3MR5A 2FJEB 4JV1A 1OYEA 1B64A 1RA6A 4EU0A 4K4SA 3RW6A 4IOBA 3THVA 2CUYA 2B56A 2KHDA 3BV8A 3ENAA 4TY8A 2BANB 3QGIA 4AXJA 3MECB 3TQ1A 1S9FA 1U1LA 4YUDA 3UDVA 2K8GA 3A4TA 3CJ3A 1XR5A 3MM6B 3MPWA 3TUPA 1HMVB 3KJNB 4ZVGA 2GGPA 4F50A 1QUVA 2AYEA 2B8PA 2WVFA 3R5AA 4J7CA 5HP1B 3B8HA 2FJBB 1SPBP 1Q8KA 3OT9A 1PILA 3AH6A 5DQIA 4DFPA 2MLYA 4QYRA 1KLNA 2DHXA 4OYMA 5LL6d 4KBIA 2V8PA 3HDSA 3NGDA 1S4FA 2L9DA 2AP6A 2ZBPA 2YWWA 1RDRA 2BABA 1LFPA 1CULA 1R8AA 1N5TA 3ISZA 4Q0BA 4P72A 3DNCA 4BWJA 2FGCA 2VPZB 4CLWA 1V9OA 2DD8S 4IO9Q 3JXOA 4HVZA 4LIRA 1SI9A 2P9EA 1TKXA 4KV8A 3TEGA 3DOKB 2LU1A 3PEJA 1GTEA 2B0GA 2WBRA 2DR6A 1SQEA 3BS9A 1XNRJ 4C48A 3D1QA 5KOWA 2UZAA 5AE3A 3HHLB 3W8PA 3AJ2A 1DRZA 1QY7A 1RT7B 3C3LA 2YWFA 2OD6A 3W62A 4AL5A 2W01A 1RXOB 1KLMB 1XWLA 3HLUA 2QA4G 5D4LA 1WSVA 5FLXU 2G0CA 3VVUA 2IA0A 1UP1A 3DU5A 4DZ6A 5H9EJ 2XMUA 3PYEA 1IJFB 3BM7A 3M9NB 1HNZF 4F2RA 3MM8A 4KO0B 3SI8A 3HK2A 2R2UA 4RWXA 3SYZA 3MMAA 4D3HA 2E5LF 2XB2D 2HLTA 4HLBA 4QPTA 4DCOB 3I56S 3G96A 3P45B 2ZDPA 3LWMA 5HVHA 4F4WA 5J2QA 2FVPA 4LFCJ 5T7LB 1RTHB 2QA4S 5K20B 2UXCF 1HNXF 2DGXA 2FTRA 3T1HF 1SB6A 2ROPA 3GG1A 4ZPWR 2N7YA 1IBLJ 1S59A 1FEHA 3G6VA 4KHPJ 2R7VA 1YJ7A 4FKYA 5EWEA 3HZEA 4HHJA 3LPYA 2R7SA 3SCJE 3PW7A 4B3MF 4LF7J 4NZ7A 3GFYA 3CD6S 2DXDA 5HMXA 2GQCA 3FNNA 2M5YA 3WHIA 3F73A 3BO4A 2IBOA 1QVGR 2DCUB 3K89A 5KTQA 1I1GA 5F8NA 1RWKB 1TR0A 1YJ9S 1D1UA 2DO4A 3KLEB 4DUYF 1C0UA 2YKAA 1XNQF 2CNOB 1KEKA 3LGHA 2LLZA 1R0AB 1IKWA 2MLXA 2HYIB 3FFIA 3KHGA 2K3KA 2IPOB 3D3CJ 1X7VA 1NZAA 2ASYA 1VQSA 3BGFA 4BC7A 3FQLA 1SJ3P 1EP4B 4KHRA 3NBPB 3M2RA 3HHEA 1RTJB 3MM8B 3FUYA 5AXNA 4TQRA 3QT6A 2KT5A 1KVIA 4ITSA 4I6WA 2FB0A 3CPWR 3AB4B 1N5SA 3AXKA 2L9WA 2J6SA 4DQSA 5E3QA 2YKNA 1TAQA 2P8IA 4FS2A 2YQ0A 1NK4A 4DL6A 1XMOF 5C42B 1N36F 3N6MA 4X66F 4RX6A 2RQMA 3OXLA 3OR2B 2BR0A 4V1Ak 4DV5J 2HFZA 3A3OB 2ERRA 1UWBB 2DGVA 2ILZA 2ADBA 3V6DB 1U0SA 3J7Z5 1HWJA 3GR1A 5MLCV 1U1KA 3FRZA 3C19A 3GFZA 2XWXA 2YKOA 3K57A 4O3RA 3L7PA 1GX6A 5KG6A 5EDWA 1FJ7A 4PZVA 4OJ3A 3TVYA 2ZDOA 4R25A 4X84A 4WKYA 1U2FA 1IKXA 3A8EA 2OH2A 1ACMB 5GAEU 3BR8A 2O67A 3OVBA 4LVOP 1MU2B 2ZOMA 2QIFA 3EZOA 2JEFA 4LR8A 1SIWB 1X4CA 3FCHA 4IKAA 1VRQC 4LF7F 1OMSA 1HNWJ 1FCAA 2LCWA 3TVKA 2JLEA 3V5RA 2R2SA 4DU7A 1K8AT 4K0KF 2XMTA 4MK9A 1KN6A 2ZJQQ 1R0CB 1ZM3A 5IQ6A 2XYHB 2CPYA 1HWKA 1RHKB 1UAWA 2VF3A 2VG5A 3BSCA 3BQ1A 4PUOB 1Q82T 2FYXA 2R4FA 2RF2A 4CO4A 4M5GA 4DV4F 3T5LA 1X5OA 2ZE2A 4YHHJ 2QG9B 3D9BA 3H40A 2GIQA 4M94A 4LFBJ 4P10A 3R5GA 4EUVA 4RUHA 5KFEA 3W5ZA 2M4MA 3RUBL 3BJYA 3GV8B 4M5JA 4H4KA 1IQTA 4FVCA 4ANCA 4CQ1A 4Q43A 4RBTA 2H5IB 5AXMA 3Q8QB 2AIRB 2CPFA 2V34A 3U02A 2ZH7A 2AU0A 1GFWB 4IG0B 5DZ6A 1NK5A 1WKLA 4Z7YA 4O3NA 3M6VA 4FXVA 1ZZNA 1I3OB 2A0FB 2GV1A 5BYQA 2KXNB 4DS4A 4AFFA 3PW4A 2CQ2A 4NLYA 4A8OA 5DDRC 4NE9C 3DRSB 4ZJLA 5EHHA 3MEGB 3MM5B 1QAXA 3AD7C 3C6TB 4WP9A 2HS3A 2QL7B 5LMUF 4ZLPA 2I5JB 1RAOA 1EARA 3O5TB 2UVVA 4JI0F 3CIZA 4IRKA 4KTQA 3K5LA 1PCAA 3HD1A 2V2QA 4UT4A 2LQ5A 1DTTB 1R8PA 2A6MA 2YKMB 2ZOFA 1GEHA 5CYQA 2VG6B 2WB4A 3GPAA 4H4OA 5KFMA 3D67A 2XZTB 3ILIA 4YB7A 3T9ZA 2VQFF 4PUOA 1PGZA 2WVEA 1VIOA 2V8HA 1RISA 1KP6A 2FJDB 3MI7X 2YX4A 4UUXA 1SC1B 4OZNA 1LW0A 5KG5A 1VBZA 4B3SJ 4DR7F 5DQHA 3CJ4A 3SQGA 2UUBF 3VV2B 1YBAA 1RAAB 1XR6A 4GKKF 1KR4A 4OX8A 2W4PA 1R27B 2G9OA 5KFRA 8AT1B 3HO1A 1N34J 2VODA 4FVMA 4JI7F 3KUEA 1U6FA 3ISND 2G0JA 2GZOA 5C2CA 1XMQF 5CYJA 2AZ1A 3HHNB 4NZ6A 1G1XA 4ZVEA 2CQDA 2W7AA 4DJBA 4DR5F 2XCAA 2RS2A 4KB7A 5CH7B 2WSEC 4X64J 2FIUA 3EVMA 2BV3A 1C1CA 4O4GA 4OV6A 2ZH4A 3PTWA 4JI3F 3LALA 4I0WA 2R7QA 2EFNA 3DI6A 1NPRA 2IM1A 1U6ZA 4R8UA 3R1LA 2AEFA 1WG5A 2AEMA 1T9XA 2P6SA 3DMJA 3TA0A 2C2EA 3KK1A 2G2OA 3M8QA 3W65A 5J1EA 4WZMA 2G0IA 1S9EA 3Q83A 5J2PB 5KFFA 5I3QA 2MYFA 1X9MA 2J0QD 1PC5A 3KG4A 3I0SB 3O3LA 2GJFA 1U24A 4WK1A 2NPFA 1LWFB 2MKCA 3DGPA 5U47A 3OHBA 4ZA1A 4FF4A 2WK4A 2IY5B 2H54B 3V6HA 3TWZA 1B0PA 3MR3A 1LFWA 3QT5A 4PG7A 4OHZA 1Y10A 4RBUA 3ITHA 3UD5A 5HQ8A 2GIFA 2UU9F 4Q0BB 1FVSA 2D1CA 4KGKA 1IBLF 1RT3A 1FO1A 2LXUA 1UVKA 1NB2A 2C2OB 5BYRA 1RT6B 4X4QA 3J7YU 1RLDA 3ILJA 3KG1A 3NXZA 4HDHA 1S9GA 3VHQA 1QAJA 3HVRA 4DWIA 3RR8A 2MPUA 4F7VA 1H7XA 2CQPA 1LK7A 7AT1B 4J9PA 5M2PA 3DLEB 4FPRA 5D0HA 4UY8T 1VQ4S 4M5DB 2MSTA 1MWZA 5D0GA 2OPPA 4CLZA 1RT6A 1N34F 2MKYA 1NM2A 4O3OA 1FFGB 3MMJA 4CLYA 7FD1A 1XNQJ 1S6QB 3IO1A 3IP0A 3MM7B 4M5LA 2UUCF 3F41A 3ZZOA 2BZ2A 2A3JA 3W60A 1OY6A 4QYZJ 4KFBA 3ZZTA 4I6AA 3D54A 1RAEB 3W2WB 4Q7AA 3R2DJ 1H98A 1SV5B 3IC1A 1SKWA 4P2MA 2DRAA 3AD9C 2GS8A 2UUAJ 4Y00A 3OJUA 4RNOA 4QJVA 1KQKA 3AT1B 3QGHA 4PXCA 3OVSA 3MR2A 2W7OA 2HHSA 4W4MA 1YJVA 2C28A 4L76A 1S10A 4LF2A 4E2FB 2QRRA 1DHMA 2OKQA 2Y9HA 3MPDA 5DM7Q 3ET6A 5DG9A 4LF8J 3CSKA 3CJ8A 4A8XA 3BGUA 3PYFA 5HSPA 2RRBA 1FTRA 5ETRA 2CXEA 4DPUA 3CCQS 3R8YA 4M5IA 4EMDA 4RUBA 1AUSL 1P9QC 2HNDB 3CDUA 3PX6A 4A4JA 4IFVA 1IWGA 1KHWA 2W1BA 2QV6A 4MKYA 2VKRA 3B78A 1WC5A 3CJKA 1HQUA 3DOMB 1CJTB 1GXLA 1JJCB 3QGPA 5DM6Q 4DR6J 3TR5A 5KG7A 2GFFA 4OI1A 2BKPA 3NMRA 4Q45A 3TI0A 3R97A 3THPA 3LOUA 4CIOA 3V81A 2VDHA 2YWGA 4Z2XA 5F0UA 5CAAA 2IMOA 1S72S 1HA1A 4S0MA 1VQNS 1UKUA 4XAKA 4U67Q 1FNMA 2PMHA 2RH3A 1JB0C 2ZZTA 3D68A 2IJFA 3HI9A 2VFRA 2PEBA 3HVTA 3IRXA 3P4UB 2V8VA 4K5RA 4HEA9 2HNZA 3TZYA 5IS2A 3K5PA 4J9LA 4HR2A 2XBPA 1HWUA 2BJEA 2KL8A 4ECWA 2WOMB 3BH6B 2Z2YB 5EWFA 1O51A 1TKZB 2WSFC 2R2RA 4WJBA 4PQUA 2W4DA 2L08A 2XEXA 1Q7YT 1D8YA 3AOBA 2IDLA 2BEFA 2MZQA 1HBOA 3MMCA 4H4OB 2V67A 3VZIA 2BJ7A 2Q79A 3CVKA 5LSRA 1JLGA 4BLGA 2A6OA 4TLRA 2V6AA 3PFOA 4B9SA 1KNZA 2J9EA 1YVFA 3FEYB 1YJUA 2WBMA 1RP5A 2A2CA 3NS7B 5D3GB 5KFTA 2HHVA 1YBUA 1VQ6S 4GC7A 2G1DA 3DLLQ 3KK3B 2P5VA 2VOOA 3GV5B 2MZRA 4TKTA 4ZN1A 1H73A 2VBWA 3RW7A 1C0TA 1U8WA 1J5OA 4TYBA 1QTMA 1KQGB 3DLHA 1JLBB 2D74B 2O66A 4WK3A 1D9DA 3TJ8A 4FKXA 1IXKA 2OGUA 4KIAA 4JUZA 2HGLA 4P7TA 4XO0A 1UL3A 1N8RT 5AE1A 3GP9A 3D28A 3OUYB 2UV8A 3QFWA 3ENQA 3EZUA 3T5KA 4ELTA 1GMVA 1RWUA 3CJRA 3QBCA 4NYPA 3DRRA 1YJNS 3C46A 2HBZB 4DR4J 2HBRB 3L7OA 3JSMB 4DR3J 1KBRA 3M8ZA 3MEEB 1IR1A 4ZPVR 3GV7B 3E8OA 2FHJA 3OPKA 4K4TA 1S77D 1C4CA 1QJHA 2E7VA 2WHOA 3R7BB 4YDDB 2NSCA 5HQMA 1HW8A 5IM0A 2BQ3A 2ZVSA 3IBFB 4A8YA 1S48A 1RWWB 3MM9A 4F25A 1P6TA 3D4JA 3UW1A 3GFXA 3D66A 5KFGA 3JTPA 1Q5YA 4X4UA 4I69A 2WTFA 4JI0J 4DR1J 2A10A 4ELUA 3FBFA 1FHTA 1TKTB 4JP8A 1S9GB 3W9HA 1MU2A 1WC3A 1J27A 4L73A 1IN0A 4C7QA 4ZMMA 5B08A 1IKXB 1S6UA 1TP7A 2QMUB 1T94A 3IM8A 1VOMA 2DHAA 4IO1A 2PMZD 4HYKA 1BC6A 2BW7A 4C98A 4C4WA 2E9RX 4LBPA 3KNAA 4DFJA 1X60A 2EFQA 2DBBA 3I4HX 3K8VA 1NDLA 2XSJA 4OHVA 1TL3A 4TY9A 1HKAA 5CD4A 1SL2A 2JEGA 1YLXA 4FYXB 4P52A 4DV0F 3SV3A 2FDNA 2PD1A 2KXHA 3C16B 3IS9B 3I0SA 2IRUA 1FRIA 2VPWB 2YH0A 2XMAA 1CJTA 3OFEA 1HR0F 1JLCA 2XI3A 3WQPA 4LF6J 3W3SA 1RADB 3LWLA 1WI6A 4NA3A 1XMQJ 2N3OA 3I32A 2BACA 2H51B 3MF5A 4UZCA 5HVGA 5DLFA 2UVWA 4DXLA 2LXIA 1LWEA 5AJ3J 4EEYA 1RT4A 1YX2A 4OHXA 5IV3A 4C8MA 4X4VA 2KT3A 1UTAA 2MKHA 2F9DA 4ELVA 1PYTA 2PEHA 4RR5A 3H5XA 2XZDB 5KFPA 1C1CB 4JI3J 1BUXA 1RTDB 2EKNA 2CQ3A 1QSSA 4FYYB 4N8OA 4ZVSB 4N41A 1JXVA 1VQOS 5D0RA 4JI2F 3PHTA 4PG8A 1XTZA 1VBKA 1KS2A 4K4XA 3Q8VA 1UFKA 1RA7A 3GCXP 5CQGA 1RAFB 4DV1J 5AT1B 2VOPA 3FZBA 3D6TB 1UVJA 4C8LA 1RCOB 3HKZD 3HT0A 3V2UC 3VVTA 2YPZA 2IAJA 2KM8C 3HXMA 1B7FA 3C14A 4LBIA 3NKYA 2DH8A 1QDUB 4J9QA 3TAPA 5IT9Y 1RAHB 4K50A 1T3NA 3EVWA 3Q24A 5D4PA 2E5IA 4I4BA 1NO8A 1SC4B 4GVLA 5MAOA 2QLJB 3BZQA 1DAXA 1SC6A 2DGUA 2VG6A 2DGTA 3US5A 2X1AA 2P9GA 1CQMA 2XMKA 4IG3A 4KGXB 2DB1A 5D0EA 5F9LA 2HQCA 1H2VZ 4QIGA 2KYXA 3CE8A 3MM9B 3MWBA 2M88A 1CS4B 2C2KB 4QYZK 1JIHA 3EWGA 4OJGA 3DCAA 3OR1A 5KFSA 2VC0A 5A8RB 1B0VA 4F8RA 3WC0A 1PO6A 2MJUA 2BW2A 2PN6A 4ZLNA 2CPIA 3SSQA 2XY5A 2E1AA 4WYLA 3CGIA 5GAEI 4USMA 2PFFB 4DV3J 1JJ4A 3R27A 4ER8A 2XI2A 5HMWA 4KRWA 2D7SA 3QSYB 3GU0A 4GO7X 2YPYA 3CJQA 2CVEA 4ZVTB 4CLSA 4JI5F 2RSQA 3PM9A 3R1HA 1NJZA 4DCJB 1VC6A 6FD1A 2KM8B 3HHLD 5HVFA 3DLGA 1Q8BA 2OPRB 4F3OA 2J7WA 1C0TB 3CWJA 4DV6J 4CM2A 2HHQA 4B3TJ 1OQ6A 3IRWP 3ETOA 4QIVA 2HIQA 3T41A 3UDEA 3PZPA 3LAMA 4I68A 4KV8B 3ICLA 4NLPA 3UNGC 3V6JA 3JQMA 2YNGB 2F3JA 1Y3JA 3KUHA 1N4LA 4KHPF 4ED3A 1H6KX 4UF4A 2OTLS 1FE4A 3B6BA 2VB6A 2FQQB 3U1MA 4JI8J 1FFWB 1SUQB 3J81U 3N01A 4B3MJ 1KRPA 2ZJPQ 1ZM4A 1YQHA 3IXQA 3BN4A 1V3ZA 4NWBA 2BJ1A 1TL4A 1TKZA 1UWAA 4DN0A 5J1NA 3BPDA 3G9CA 3CCMS 3QATA 2IM3A 2M8HA 6FDRA 4MKAA 4ED7A 3TJAA 1IBKF 4ZCLA 3BO3A 1T03A 2AD9A 1L3VA 4KHMA 4BHQA 2ZC3A 3N5FA 4RW9A 2MGZB 1Y11A 1YG0A 3DHXA 3GR0A 3TX8A 4QOTA 2HAIA 1KOOA 1GTHA 3M8SA 2XO7A 2F7VA 3B4DA 4K59A 4DR1F 3DYAB 2FHOB 1VRUB 3FSXA 3ULHA 2FC9A 3LGMA 2FHJD 3MGJA 4GMKA 3WIVA 4M5NA 4ILRA 3VGSA 4P2FA 2JRSA 4WFBQ 2A1BA 2OMLA 4CM0A 2QLWA 3DDNA 2VJVA 3RB4A 1ITPA 2BJ3A 3JAMY 1K0TA 3RZAA 1SBRA 3DLJA 2DY1A 2ZBRA 4F02A 3FBBA 4EO8A 3K7RA 3PHEA 5A8WA 2H9ZA 2VV5A 5BXIA 2W2NP 3N9UC 3MM5A 4JI6J 4ED1A 5B7WA 2GJIA 2VBYA 3B4MA 4RW7A 2FLLA 1HYSA 4P7VA 2Z2LA 2X51A 3HSZA 3S8SA 1IKYB 4PWDA 3ET6B 2XHWA 5ETPA 3IFEA 2YQ3A 3G6YA 4RW7B 1HYSB 3G8TA 3EPIA 4FZVA 2ZNYA 2VFTA 2RDJA 1ZETA 1IKVB 4DL0C 1EQMA 3PR4A 4GC6A 2UXBF 3O6QA 2LQ9A 1EHWA 2HG4A 1IKWB 3IWLA 3BSOA 2FPHX 1K1QA 2HBQB 1JLEB 2J6UA 1JLBA 1VISA 3TUZC 2M70A 1DQ8A 2LEAA 3G8QA 3UCGA 4C97A 3GYGA 2KKHA 2XHCA 4N8NA 4X4SA 1VQ7S 3RBXA 5I3UA 2AV5A 1HFEL 2LYVA 3FEXB 5LXRA 2LECA 1LV5A 2HVDA 1W7WA 3PW2A 4P73A 2F8HA 1JMTA 2BXJA 2RQKA 1Q0NA 4RW9B 2V94A 4MFBB 3S6EA 2HFUA 2WVBA 4F3QA 3PACA 1U1OA 3R2CJ 5LSOA 1KC8T 1NZ8A 5KOXA 4RW8A 4C3KA 1VRTB 2GQQA 2G1HA 5IV4A 2WB1D 3MUTP 2GW8A 3ZZPA 5L1IA 1UJ4A 3NS6A 5KFCA 1VQYA 3HPOA 2ZNZA 3KJQB 2CQ1A 2W9CB 3FVYA 2MJNA 2I6WA 3MMAB 4OYZA 3PNIA 2MQMA 1T05B 3FSIA 4O23A 2ZH1A 1S79A 2AX0A 3HM9A 1UEUA 2B8QA 2M3DA 3Q2SC 4OZ2A 2DR5A 5E2QA 4Y2MA 2XMVA 5DETA 2DR9A 1X5PA 3GLJA 3CCWA 3D2WA 3K8WA 2DNNA 1GMWD 1SH3A 2J8SA 4ALZA 2JFDA 3GQCA 1NKCA 1K44A 1YRXA 2FGOA 3OHAA 1H38A 3GMGA 3IBWA 2ATCB 2O01C 3CCTA 2HVIA 4DUTA 1WC1A 2ZHBA 1KKHA 1PAUB 3UQSA 4AQYJ 2XMWA 5HBMB 1TKDA 2CYYA 4X62J 3WC2A 2CQGA 1Y5NB 1HW9A 2HRUA 4PKDB 2CJXB 1F9FA 4ECZA 1VBXA 4ZP7A 3J7YI 2HPUA 1Q8LA 4GO5X 3OL6A 2ATLA 1FJCA 2E5GA 4K4UA 1NK6A 1IJEB 5A8KA 3NBPA 2E9TA 4WPAA 3CCZA 1BHNA 1WELA 5KFUA 4USUA 1CULB 5E0OA 1FJEB 1HNIB 2IJNA 3EXCX 1RI7A 4B08A 1SV5A 3T5HA 1FERA 3M1VA 1YITS 1EZZB 4MH8A 4OX9J 1LKZA 2VG7B 2CG4A 2MZSA 3FZ2A 2J7KA 3NGUA 3QIPB 4GVBA 3DU6A 4NMLA 3CIMA 4ZS6A 3Q22A 4DFKA 4C0BA 4OL8A 1JWWA 2RAQA 3AAWB 2Y3YA 3VWSA 4DV6F 2BE2B 1CLFA 1SKUB 3WX4A 3IM9A 2CQIA 2FUG9 4HACA 1S4EA 5ETSA 4RL1A 3ZZ0A 5HP1A 4OI4A 4AUKA 2IMWP 1N32F 5GVQA 1S6PB 1FXRA 4OZ0A 1DARA 5KT2A 3OSPA 2MKJA 5GAGI 1RHRB 4ZP6A 3W63A 4QWDA 3E51A 1S12A 1RE1B 2ZH5A 2KVQE 4NLSA 5G0RB 4K2JA 2K7JA 1F3FA 2GMHA 1P1TA 7FDRA 3NGKA 2ASLA 4IOCQ 2BBEA 4NXMF 2LA6A 5J2QB 2VPYB 3HSGA 1XBWA 3P96A 4U96A 3NNCA 2ACMA 2ZOGA 2XGQA 4CI0B 4DV0J 2D3ZA 2MQNA 1CJVA 2WZ1A 2J6TA 1NPPA 1S1WA 4PXDA 4I2QB 3RRKA 4HKQA 1R6VA 1RT5B 2BX6A 2P9CA 4YB1P 3ZTOA 3BDEA 4DX5A 4ECUA 1PJ5A 3MDFA 1U4BA 2HHHJ 2DNLA 2NZCA 1VR6A 4YY3F 1G2EA 1PJ6A 1LWEB 1JLFA 2B5JA 4CLTA 3NAIA 3LGNA 3AFGA 2ZH6A 2VASA 4DV3F 1QSLA 2MGZA 8RUCA 5JVGQ 4FDFA 2XCPA 2QTWA 1EB0A 1X5TA 4DX6A 5GAHU 2YBVA 2F63A 1C2PA 3AJ1A 1UEKA 1UETA 2HSEB 3FCVA 1NH7A 2GAGC 3UI3A 2EFOA 5K8OA 4NXNJ 2LEPA 3VF0B 5ETKA 4O4GB 5CABA 3MAQA 1YI2S 4AXIA 4ERDA 4LR9A 2UUTA 3R7NB 4DUZJ 4JI2J 5LJ3Y 2XO6A 2GHVC 1U2RA 1YZ6A 3KJVA 4YEAA 4G3IA 2PFDA 2W9CA 4CLFA 2NLWA 4ATNA 3UCUP 1X9WA 3W5YA 2HMIB 4IRCA 4J9MA 2VZ9A 1KONA 5C24A 2ZZNA 4B3RJ 2KO1A 2AJ4A 3LO3A 3C15A 2X7IA 2EBEA 2RVJA 2RHQB 3PEHA 1VJWA 1X0PA 4PXBA 1WC6A 2BJ9A 4UOHA 2XC9A 4DV2F 3FC9A 4M5HA 2V0NA 1NH8A 1N6QA 1S6PA 2N4DA 3GG0A 4TYAA 4HH1A 1O8BA 1X4BA 3E3XA 3EPGA 3BKFA 3A8JA 4QR0A 3KLIA 2CQCA 2DNHA 4ZPCA 3CO9A 5KG0A 4XTTA 3KHHA 1NCLA 5L9NA 1GQEA 3PXGa 3CD0A 1UWBA 2I38A 4Z37A 2HS4A 4ZVUB 2DYAA 3PY8A 4KGZB 2I0XA 3RBEA 1PC4A 4C8YA 2YX1A 1K1SA 5K9FA 1TV6A 2QT7A 4DPWA 4A8SA 2QMXA 2VC1A 2B5JB 4FP9A 5KFIA 1MSWD 2EFGA 1HQEB 1YRUA 4RW6A 2LFVA 3TQEA 3TAMB 4RU9A 2PSZA 2KG0A 4I56A 1R3NA 2J8AA 3AOAA 3OFHA 3FKBA 2XS5A 4NRUA 2B9WA 3EMTA 4F0KA 2MZJA 1V5IB 1Q78A 2YWKA 2G2YA 2IJRA 3GZ7A 3MEKA 4ID8A 3E2EA 4A48A 3KHLA 3HP6A 5CXTA 3I82A 1AYEA 4RW6B 2DNMA 2M0GB 2AJ0A 1NDCA 3DN9A 4GRSA 3SCLE 4DI6A 2XM3A 2CQ0A 1D0EA 4CCHA 2K1RA 1WOSA 3KG0A 4O44A 2EC2A 3PRBA 3N6NA 4OYPA 5J1PA 1JJ2R 1F1BB 3I9ZA 1TL1A 3KLEA 2XMMA 1WDTA 2VIHA 5JVHQ 3RAMA 2V50A 3M6XA 4FF2A 1U47A 4X66J 3DYAA 1F5BA 3W61A 4X4OA 1MWQA 3I0RA 3D1HA 2J9DA 3UVJB 1ZAVA 2JH3A 4JI1J 2R7OA 3HFKA 2MQOA 4OHYA 1RSCA 3N28A 1N6QB 3RRGA 1FWKA 1R6YA 1S1UA 3PJXA 3NY0A 1RLCL 3SDEA 1DLOB 1XIQA 4C9DA 4CRJA 2R7UA 1AT1B 2B7BB 2HZCA 4LF1A 4DG1A 1WF0A 5C24B 1T9YA 1X31C 2HBYB 4NCAA 1Q81T 4U6PA 1L5UA 1RBLA 4L72B 3EDQB 3PCOB 5HATA 2BDPA 3ZZZA 3FRYA 3L4BC 4F3MA 2HHUA 1HQUB 3DOMA 2XQCA 5A8KB 3TX0A 2DKOB 1C4AA 1SVDA 3N0VA 2LP4A 2F4FA 2YNGA 4ZCMA 4IQMA 3KLFA 3AB2B 5JMNA 4OYXA 3FK4A 1NHKL 4NLUA 3UO0A 1H2UX 4Q5VA 2ALZA 4LF5F 3V6KA 4CTAA 4F4YA 2R2TA 1NK0A 2Y1JA 1URRA 1RT7A 3GB0A 4DU8A 5ETOA 2E1CA 2HHWA 2HRYA 4C8NA 3G6ES 2J0XA 3H7HB 2ZD1A 4CT9A 2DISA 4DF8A 1IKVA 1FJGJ 1BQNA 1ZM2A 3GCWP 1FRHA 1Q79A 4IYQA 5AXLA 1VJQA 5ETQA 1QTNB 2DNZA 3CDBA 3CCUS 3J7AN 3GSIA 3NNAA 1T05A 1FRXA 2AF6A 1YTYA 1MN9A 1ZM9A 2H5EA 1TZ0A 1U0HB 3KUGA 3NGSA 4RUAA 1VIXA 2CPXA 5D6GA 1S6QA 3MM7A 5F8HA 1S5ZA 3H4DA 1KFSA 3QWPA 2XSFA 1FE0A 4LSNB 2BM1A 2RRNA 3PW0A 1K47A 4U8VA 4WYWA 4TU7A 4ES1A 2NUUG 1Q4RA 1CPZA 2JL9A 3IBCB 2DTJA 3G87A 4KAIA 2VU5A 4DLGA 1RTIA 1TVRB 1LQ9A 1WJ9A 1YSJA 3BGOP 4MFBA 5KFOA 3T1HJ 1I94J 3H2VE 2X3GA 1JX4A 3BBCA 1EAYC 3I96A 3SMZA 4MKBA 4WZQA 4C8KA 2EBGA 2KH9A 2E66A 3R3TA 4QR2A 2COLA 1F9HA 1FRMA 3UNYA 3VGTA 1NJXA 5F9NA 1RK8A 2KHCA 3ZFVA 4ZDNA 5AJ3F 1KWMA 2K06A 3CULA 2IA6A 5J2NA 1VHFA 4LSNA 4B3OA 2DITA 1Y9OA 2FVRA 2Z4PA 2MKIA 2LDYA 3PDNA 1WHXA 3VALA 1M5OC 1SUQA 5DO2A 1A7GE 1U0HA 4U9RA 2ZC4A 4CLLA 3H42A 4ZKAA 5ITHA 2LKZA 2Z56B 3CNQP 2ZWOA 3M8QB 5J1EB 4CH1A 1NUEA 3MAHA 1Q5VA 3DMJB 4JV0A 2FJWA 2ZUAA 3MUVP 3L9ZA 3DXBA 1FKPA 4L74A 1HQ2A 1WI8A 2NSBA 5HBMA 4DPXA 3GIJA 3DHWC 5A8WB 4V19J 1S0MA 4MIAA 3TUJC 3HD2A 1F3VA 4I67A 4DL2A 3NMAA 3H90A 4WP8A 3M4XA 3OVAA 3BYRA 4JI8F 1OS5A 4LR7A 1NSPA 1S1VB 4EGLA 1U1MA 2XMJA 3CDEA 2ILYA 3QZ7A 3R6GB 1FJGF 1NSAA 2EI5A 2H5JB 1TK0A 3GSDA 1SKSA 1BE4A 2IYGA 1S6OA 4ZP8A 5K8PA 3G8SA 3KLFB 3R5JB 4M63A 2HQ3A 2B4VA 3CJ2A 1TMJA 4QW8A 2I1RA 4P2SA 3DRPA 3HT3A 3M30B 2ABYA 2ZBQA 2CFXA 5C2GA 3MFHA 2W8LA 1VQ9S 5ETTA 3QNWB 4KKOA 4NI2B 4ENOA 1OWXA 3C8YA 1DY3A 2VH7A 5HLFB 1PYOB 3KKFA 4IG3B 3H0PA 5DDPC 1N5YB 2POKA 1VRTA 3R5DA 3TVZA 2F9JA 1GX5A 1S1TB 5ADZA 1DLOA 2E1RA 5DQGA 1NXIA 2RMLA 2XY7A 3M8PB 4YHHF 4JI4F 2AQ4A 5HJXA 2GGPB 4RKUC 3UDLA 5KFHA 2CWKA 5B0DA 5HJYA 2QSWA 3GIIA 4JI5J 2BVZA 4X64F 4JYAJ 1NPKA 1JLQA 2PO4A 3BQ2A 4LUBA 4IR1A 2JDJA 1AXQA 3M05A 3HFZB 4KR0B 1IVZA 1FI4A 3EDRB 4OIXA 4QWAA 5HN0A 4LQ3A 2X1BA 1NSKL 1GT8A 4NLRA 2K1RB 4O44B 2RUSA 1OPIA 1X5SA 5E7OB 4WFXA 1T7PA 2J7UA 1RAJA 5I3PA 4DSJA 1RKIA 2PI5A 5DLGA 1CJUB 1YJRA 3HF5A 1Z1ZA 3M32B 3H8YA 3JSRA 4I2PB 4NCGA 3RJMB 3ELHA 1RAGB 2LQ8A 3TA2A 1H3DA 1TL7B 5FJ4A 2K7KA 4NASA 4F67A 2ZH9A 2XYPB 5F0WA 2W2MP 2N3LA 2VQEJ 1OO0B 3V4IA 4X65F 4LRFA 3WIUA 1KD1T 3RRHA 1T9WA 3CJ0A 8ATCB 3OR1B 4KQZA 1T02A 4MJKA 3UFCX 5C5JA 3K5NA 4LJMA 1KVKA 2IM2A 3KJFB 1CS4A 4DV5F 3R6LB 2RRAA 3MCNA 1QM9A 3M2VB 2Z2ZA 4FNIA 2KRRA 3GJQB 3LH2S 4CLPA 2QFIA 3TNVA 2EG2A 2OI2A 3J80Y 4JB8B 4IRDA 5D8HB 4LSLA 4HI2A 2FJXA 2VONA 2CPZA 3G86A 3IS9A 3MPYA 4ID5A 4QIFA 4URGA 1LNQA 3TRGA 2B6AB 3VAJA 2R8GA 4GKKJ 4WTYA 4XDCA 2WOMA 2MXYA 3GIRA 2AKWB 2FZCB 2QLFB 1HPZB 3CO0P 1FRKA 3H2LA 2XSJB 3ISNC 5KFWA 1S7IA 1OSDA 2Z0GA 3RB6A 1YIJS 3QRRA 2MB0B 1X4EA 1VK3A 3HVTB 2OSQA 1FT8A 3GE9A 3M30A 2UV8G 1T03B 5D4NA 4RJVA 2R9LA 3D0GE 3W9IA 4K2XA 2IBKA 2CADA 3KNGA 2J76E 2CNKB 5ETVA 1VLOA 5IC4B 2BKOA 4FN5A 3VGUA 3DM2A 1MROA 4TVAB 4WFAQ 1U25A 1SKRA 4W92B 3OL9A 4EK2A 2CZVC 4J9UE 1NDKA 2CA9A 3KJVB 1U1QA 2Q66A 4DS5A 1NLKL 3EUNA 4NLGA 1CJKA 3N79A 3AA9A 4ZJOA 1U1PA 1ROFA 3NG8A 4I6YA 4LRCA 4DR5J 1E6YB 1MMLA 1S99A 1RHUB 3BSAA 2LDIA 3PJ9A 3ETMA 3FBCA 2R7RA 5E3PA 4IUFA 4NLQA 2BMBA 4X2BA 1NMEB 1U02A 3OLBA 4P74A 1HWIA 2DXFA 2PT0A 3PW5A 2CQHA 2QC3A 4DBQA 4FXWA 3K17A 2GVDA 1RTJA 3BYPA 3DRRB 3FEZA 1V6HA 5E3RA 3M32A 4I2PA 1Q1KA 3SCKE 1M5VC 2B43A 1EP4A 2EFPA 3BR9A 3CDWA 5DDOC 3OUYA 3TW0A 3NS5A 4IH7A 4ZVQB 4XPCA 2J5AA 5B0BA 2WVDA 1VYAA 2YY3A 2EWHA 4G6VB 5HL7Q 1G4CA 4MYUA 5DRKA 1N88A 3M2UA 1EKSA 5CHCB 3RBZA 3J80U 3THTA 4D3GA 4B9TA 2NZ4A 2IVMA 1O5JA 3SV4A 1LWCA 1VK8A 3X3UA 3FGVA 4M8LA 4ES2A 4EZ6A 3TEHB 1LXNA 1WC4A 4AT1B 4X4TA 2FY1A 2NQPA 1U45A 2OPPB 4QPXA 1F2GA
chains in the Genus database with same CATH topology
5CZXA 4Y2CA 2ZH3A 1KVIA 5DJBA 2EG1A 2VA3A 5CYMA 1E6VB 5K14B 2XNRA 1NRKA 3JSBA 4TNOA 3H5UA 5KFYA 4CNYA 5DS7A 4MTPA 4QWEA 5KFLA 2CPHA 3NRBA 2BE2A 5A2QY 3KWMA 4ETZA 4JOUA 4KJIA 4NL5A 1RGVA 3DRPB 3ITHB 3I9V9 3UCZP 1FDAA 1VGYA 2NXUA 1U48A 1R8BA 3CC4S 3KOAA 2HHXA 1M0SA 3V81B 3CMAS 2CPDA 4URQU 1P27B 2RU9A 2WRMA 2JEIA 2KZMA 2ZH2A 3OXGA 3IWXA 2Q1LA 1HBUA 2CQ4A 1K9MT 1GNKA 2DRBA 3LP2B 4QWCA 4IFVB 3KK1B 5M2RA 5C25B 3DFEA 3HVWA 5KG1A 3RB3A 1NU4A 5JJBA 3TA1A 1ZYQA 1Y0HA 1UJ6A 3DI6B 2VFUA 2UVUA 3VR1A 2AJ1A 1WTBA 1VQLS 2L48A 1TQLA 4B9LA 2WAQD 4IFYA 4ZVFA 2EC0A 4A8MP 3LQVA 3LF0A 4DUZF 4CZCA 3UD3P 4B3OB 4DG1B 2HFNA 3VAFA 1KQFB 2DH9A 3K5OA 3IGNA 2JHEA 2MHEA 5D78A 1REVA 4X4PA 1RJJA 1DBDA 1R31A 1GXTA 3SQGB 3HHKA 4ECVA 1BQMA 4BDPA 3HKWA 4DR4F 3T5JA 4EWTA 1WF1A 2BRKA 5CD4H 4ID5B 4FBUA 1U49A 2D3OR 2O5DA 2DK2A 3KLGB 3EYZA 2M9KA 1VBYA 3KLHA 2C3PA 1K73T 3Q8PB 3O8WA 4PRFA 1YJTA 4QW9A 4ECRA 3B82A 2OTJS 3J81Y 1Y7PA 1XN9A 3PJWA 4EU0A 3VAMA 4ZVHA 4BWMA 3R5BA 4OZ5A 2FD2A 5L39A 4E98A 2UUAF 3DRYA 3I6PA 4UW2A 4ICLB 4LF6F 1S7HA 1XC9A 3OV7A 4IR9A 1UVMA 1KVJA 2U1AA 4NCGB 4NX9A 4WFNQ 3C2PA 4FF1A 4WE1B 2HGNA 3CXCR 5J2PA 1X9SA 1S97A 1TUVA 3HHDA 3X1LB 4WU2A 1ZZFA 4Q2MA 4DSFA 2AGPA 3CEDA 3KHRA 4QU7A 3EZ5A 4MK8A 4RBVA 4JV2A 2RF2B 3QPIA 1E6YA 4PG4A 1KSPA 3T19A 2R8HA 3EXYA 4F2SA 3KLIB 2YNHB 1FF2A 2GMLA 2HFOA 2HQIA 4RNFA 4EYHB 4DR6F 4PWUA 2MY7A 2PIIA 5LJ5Y 4IQXA 4B3TF 2QLXA 3N4WA 3HVAA 1RKJA 5HI7A 2OAUA 4ZPBA 4DMZA 1JKHB 1MROB 2AX1A 2XY6A 2C3MA 3UE2A 2OD4A 3DRXA 4G1PA 1ZTWA 5GMKa 2V8DA 4YB5A 3VAHA 4KKOB 1RT3B 4LFCF 5K5MA 2HMIA 1RT1B 2WONB 5T14A 3N5BA 4LFAF 4PQAA 4AE5A 1BD6A 1S1UB 2F40A 1REVB 3M8RA 1HPZA 2RNEA 1ZOTA 3OTBA 4DSEA 5EWGA 4H4KC 4NLDA 3KK2B 4RW4A 4KPYA 4YOEA 5BYSA 2IVYA 4WKRA 4UQGA 3HHLC 4ZHRB 1JLAB 4JI6F 2J0SD 5LXYA 4HTIA 2XS7A 3VQTA 1IQZA 4A8KA 2F8EX 2XLKA 4DL7A 5KFZA 4B9UA 3O2IA 2XWYA 2AYGA 3W7BA 4O3QA 3P49B 2APOA 2UXDF 3DLGB 1BGXT 4USJC 3UR3C 5KFNA 2QZ8A 1CSJA 3LP0A 4AL6A 3QLHA 3TAMA 1R8HA 3T6JA 4BBYA 3DC2A 3MTJA 4ED6A 4YFUA 2EW9A 4NZ0A 4Y6IA 5J2NB 3BO2A 2GO9A 2L41A 1WACA 1V3RA 3QYYA 3BDPA 3QO9B 5GAHI 3G71S 2HHTA 3K5MA 3QAEA 1WHWA 3PKMA 1P8GA 3M8PA 4H54A 4MYTA 4WFYA 2FJVA 1LXJA 5KFJA 3PV8A 2LU2A 3AA8A 4OV1A 2CJKA 2KZZA 2R8JA 2AW0A 1E6VA 2V4JB 3NWGA 1H7WA 1A9NB 4Y2AA 1LK5A 1FDNA 1IR0A 4DOZA 4X4RA 3OW2R 1M5PC 1QAYA 2EK1A 2DO0A 2IAJB 2HWTA 4NYOA 3MEGA 1RT2A 4EFAC 2GCFA 1Z2LA 1HI0P 4ED2A 3POTA 3R5CA 3NL0A 2ROGA 1CC8A 1LWFA 4IG0A 1F60B 3V6DA 2XS2A 1HBNA 2IC3B 2I8EA 3LP1B 1DQ9A 3CCSS 3T3FA 2YKQA 2YNIA 1C1BA 1LW2B 2RQ4A 5HMYA 3H5YA 5EUHA 2CIMA 2V9WA 4CT8A 5KFDA 2KTQA 4QZVB 2OLWA 3NCRA 2R7WA 2D9OA 3LAKA 1CEZA 2YNIB 5IZHA 1OQ3A 1FRLA 1WTFA 3LP1A 4R5PA 2OFGX 1K0VA 2XGPA 3CCLS 4I2QA 5CCLA 2RE1A 5IXUA 3OJSA 3GFHA 4Y2IA 2EK6A 3IR7B 1S0VA 3BGLA 3ZZUA 1JLCB 2OPSA 2J9DE 2DNYA 1N0UA 1F5AA 3D1OA 4TU9A 4DV7F 3GILA 5B0AA 4RNMA 3I5BA 3L09A 5KT3A 2C3YA 2VFSA 2B4PA 2DNKA 1R0AA 3QAUA 1C0UB 5A6PA 3Q23A 4I1TA 4LQ9A 2V4JA 4RW8B 4NYZA 3SDEB 1R7IA 1N54B 4K4YA 3BN7A 5JXSA 2OO4A 2DNPA 2ASDA 1AFJA 1GH8A 5K8NA 4EBDA 4U7CA 4CO3A 2AGQA 5HO4A 2KFZA 2G13A 2KI2A 2LQJA 1TKTA 3QIDA 3PKYA 3UD4P 1RTIB 1TVRA 1T3OA 2Y1IA 4DSKA 2NZ4A 2OPQB 5HROA 1JNZB 1N0VC 5I42B 4F26A 4Y3CA 4P6QA 3VAIA 2YWEA 3MZIA 2ZZMA 1FDBA 4YB6A 1VQ5S 2HLUA 3F56A 4YQWA 2HVZA 3H2UB 3WBZA 1NNDA 5B0GA 3SSRA 5EGYA 5DG8A 2JX2A 4J9RA 3TARA 4R0JA 2GHWA 5IM0B 5B0FA 5J2MB 2I9SA 3DDKA 4OHWA 4L6V3 3RYLA 2DGQA 1J2VA 2DNQA 4ED0A 5E3AA 1FEEA 3M2RB 2N82B 4K4WA 5L38A 2YWHA 3BF4A 2ZD1B 5F8IA 4TXSA 1P1LA 2BA9A 3OBIA 3JB9k 1J5EF 2ZKUA 1WD6A 2QMWA 1Q16B 4LF4F 1UFWA 3UDCA 3VQSA 2QFJA 4QIEA 2DGSA 4A46A 5CCMA 4RNNA 2OPQA 5HROB 3A1YG 4E8UA 2CQBA 1NK9A 2FLPA 2GHPA 3DOKA 2JLGA 3JTOA 4I64A 3CDAA 3I5AA 4ES3A 2N4CA 4B9NA 2KVIA 3HMJG 2FC8A 2ZBCA 2QA1A 1JLGB 2DHGA 3MPVA 2ZKTA 5KFQA 1TL5A 4MMOA 1SJ4P 5KAKA 2EVZA 3AY0A 4OJ1A 1XR7A 4PQUB 1FKOA 4QU6A 1NJWA 5SZTA 4CO0A 2E9ZA 1VQPS 1N5QA 5T7LA 5KFAA 2SXLA 1JKHA 1UW4A 1R8CA 3G4SS 2QEXS 3IRXB 3O1LA 2ZHOA 1VI7A 3IN5A 3KLVA 3I4PA 3IWNC 1RYRA 4LFBF 2B4UA 2DT9A 3I0RB 3OTOF 3HZGA 4B17A 3MUMP 3NCPA 1NHVA 2XULA 3O44A 1HD1A 2ZH8A 1KLMA 3MD1A 4HH0A 1S1VA 1NKBA 4TY8B 4V19X 2KXFA 3C6UA 2FVQA 2JEJA 2E44A 2F8MA 1DZ5A 3PO5A 1X4FA 5DDQC 4J9SA 2AYBA 1JLFB 3OL8A 2HNDA 4LIWA 2DNRA 3Q8SB 2YKNB 1QSYA 1HBNB 2IC3A 1FKPB 3L95X 1FESA 4J9KA 2LQBA 1DQAA 3U1LA 3RB0A 2RKIB 1S1WB 3M9MB 1T8EA 4ILLA 2Y1RI 3SEOA 4G1QA 4C8OA 4Q2LA 1HQEA 3TUIC 5H1SV 1S0NA 3CC2S 4LF8F 2BM0A 4IH6A 1JNRB 1UVIA 4J5OA 4ZPAA 2OSRA 2E1MC 3MMBB 3TANA 3S1TA 1XERA 1QUPA 2ROEA 4DX8H 3VTIA 5L9XA 4I7FA 3BQ0A 2PA8D 4KT0C 1U1RA 2BRLA 4A47A 3K58A 2XLJA 4Y0FA 2WW8A 4Q8FA 1HMVA 4WF9Q 2IRXA 3HX9A 2LEBA 2X1GA 3MMBA 4DSIA 2M7SA 3M1VB 3OQ2A 1HNIA 3I5CA 2DPIA 2YNFB 2KRBA 1AW0A 2JOQA 4KSEB 3K0JA 3CD7A 5CZVA 3H98A 2Y0SD 4KO0A 3IAS9 4ZP9A 3LP0B 1AFIA 2P6TA 2QO3A 4PPZA 1FRJA 1KQSR 4RWWA 3QWUA 4R5PB 1AUDA 3RTVA 2IFXA 4Q8EA 2HS0A 2Q6CA 4IH5A 1FK9A 2OPRA 2VA2A 2DIUA 5C25A 3GIKA 4USHA 4ZK7M 2OJ3A 3IG1B 4N5SA 1URNA 3SFUA 1M5KC 3IR6B 5DG7A 3KTQA 4MK7A 3EGNA 1WF2A 2FLOA 4O3SA 1WHYA 2FVCA 2QYCA 1ELOA 4HT7A 3KYLA 1X4HA 2IYIA 3FMWA 4WXOA 1Y5IB 4DQPA 1X4AA 2OIHA 2EFVA 2UP1A 1MMNA 2BJDA 1LOUA 1Q86T 1NK7A 5B09A 3GYNA 5FIIA 2MQPA 2R7TA 2UVRA 3WZ0A 5A8RA 1JK9B 2DGOA 4A8QA 3CF5Q 1YWXA 1N5VA 2NPIA 4LVNP 3OFGA 5G0RA 4K4ZA 1DJ0A 3ENWA 1IBMF 1FNXH 2PE8A 1JXLA 4EO6A 3P3DA 2AGOA 2K3IA 3P6YC 1WHVA 3CCJS 2CPJA 2D3UA 4I7FB 1I6JA 1X4DA 1LWCB 4ETXA 3MM6A 1B0TA 1XMBA 2NS1B 2V2KA 1ZTTA 4XIUA 2CJ9A 2OMOA 4MIWA 4WU3A 1TL1B 5CYQB 1Y4ZB 4O3PA 2VUGA 1JLEA 2YX7A 4RZRA 2V5HG 3PIOQ 3JSMA 3BSNA 3N6LA 2DIVA 2G4BA 3QZ8A 2QSFA 1WG4A 4UQTA 2DJWA 3IA0A 2CJBA 4EBEA 2X1FA 4NCBA 2HHPA 3T1AA 4CO5A 5CA5A 1CG2A 5K8MA 1U8SA 2JJ4D 4NLVA 4M95A 3LUYA 4DEZA 4PXEA 2LVWA 5E41A 2KFNA 1NHUA 5KT6A 4OI3A 4C2MA 4B9VA 1TV6B 4OX6A 4N77A 1A6LA 1FA0A 3TOQA 3WDOA 4HDGA 1JLAA 4NPOA 2NREA 1HBOB 3MMCB 3QMQA 5I42A 4C11B 2HW3A 5DGBA 2YH1A 2RJZA 2DH7A 2Z8QA 1Y00A 2F4VF 2VG5B 1UFLA 1QE1A 5D77A 1TK8A 4YR3A 2Q3PA 1TFWA 3V4MA 3DOLB 4J37A 1I94F 1DURA 1UA0A 1SIZA 4B3RF 2V4RA 3CJ5A 2ZUGA 1S1XA 1ZH5A 3DXSX 3BREA 3RU0A 2W24A 2XNQA 2XLIA 2HVHA 3OFFA 2JFKA 3U27A 1S49A 4LSLB 3GWCA 2WCXA 5KG2A 2RU3A 2GO8A 4Y28C 3CC7S 3M2VA 4EZ9A 3U7JA 2HGMA 1FTCA 4HI1A 1KFDA 2QE5A 5IQQA 1SXLA 1HD0A 2B7CB 4CNZA 2DPJA 3CMES 2KJWA 4DL4A 1D8ZA 1WG1A 1APSA 3MEEA 3M6UA 1UVNA 1ULRA 2MZ1A 3H59A 2JVOA 3EGZA 4MIBA 3MHYA 5F8GA 5B0EA 4NLTA 5G4DA 1C1BB 2JWNA 1HARA 2E5HA 2GX8A 2PDAA 2PC6A 3I55S 4FS1A 4UOCA 2W4CA 2KG1A 3ENVA 3PX4A 2R8KA 3ONQA 3PO4A 3K59A 3VZHA 4ICLA 2V4QA 1ZPWX 1UEVA 4B02A 4QIWD 4YR2A 4DLEA 2IRYA 2M52A 4WCEQ 1RT2B 5KFKA 4ZCIA 1DFDA 2CRLA 1X8DA 5KT5A 4USIA 4DR2F 3IR5B 3E01A 2YKPA 4ZOSA 5D3GA 2LXFA 2KB2A 3FJ2A 1T95A 2W25A 4FNHA 3KHLA 2R8IA 3DLKA 3JTNA 5F41A 2B3TB 1KTVA 4TQSA 1VRUA 4L3NA 2VBZA 3OTEA 2Q6BA 4JBCA 1N5YA 1BQXA 2DHSA 3T6BA 2ZM6F 3EX7B 1D9FA 1WWHA 5HLFA 4ECTA 1FKAF 1BQMB 3BGRA 4RU2A 1S0OA 4G1IA 4QQBA 4YR0A 2ZHAA 2CKWA 2NR0A 1YRTA 3M2UB 2VG7A 3FMBA 3W2VB 4DL3A 1U1NA 1MNEA 1RTHA 1QVFR 4OZLA 4AL7A 2OPSB 1WNEA 1Z4UA 1W25A 4DQIA 1BY9A 2NYIA 5L8RC 4ECQA 3K2YA 4H4MA 4RUCA 2HNYA 3RAQA 4NLOA 1ZBTA 1EETA 3OTCA 1R89A 5GAGU 3OSNA 4B9MA 1RT4B 2VQEF 4CO2A 4DSLA 1OSCA 3HHLA 5EX3A 3SZ2A 3H4BA 2CPEA 4YDXA 1ZAWA 2KJVA 4IOAQ 3NCQA 3GIMA 2C3UA 4HTJA 3AHPA 5FDLA 5KFBA 1VMBA 2AYMA 3KK2A 3DM2B 2DR8A 1N52B 4FXDA 3JYTA 4PPDA 5SUHA 1SJQA 2PGCA 5JUMA 1SJ1A 2RIJA 2GNKA 1TL3B 1NJIT 4KFBB 2MMYA 3MXHP 3VAKA 3DLBA 3P5TL 1X4GA 4PCQA 2C42A 4MAKA 1RT1A 2WONA 2DVIA 1M5HA 1LW0B 2JZ5A 3NLCA 3T1YF 4J9NA 3RAXA 3KMSA 3D0IE 3PRDA 5IWAF 3J7A1 4QWBA 2W8KA 2DR7A 2MZTA 3NNHA 1N56A 4QCLA 4ZPTR