2DXEA

Crystal structure of nucleoside diphosphate kinase in complex with gdp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
154
Chain Sequence
ETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFFKPEELFEYPRAADWFYKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of nucleoside diphosphate kinase in complex with GDP
rcsb
source organism Pyrococcus horikoshii
total genus 51
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2dxeA00
1BHNA 2BEFA 2HVDA 1UCNA 3Q89A 3B6BA 3FCVA 3ZTPA 3EMTA 2DXFA 1NDLA 3MPDA 3EM1A 1PAEX 4DZ6A 1NPKA 4O0NA 2VU5A 1W7WA 4ANDA 1LWXA 1MN7A 4F36A 1NCLA 1S5ZA 3VGVA 1BE4A 1NB2A 4UOGA 2DYAA 3BH6B 1NSQA 1S57A 3FBCA 3PRVA 5CAAA 4UOHA 2DXDA 2NCKL 1WKKA 1NLKL 1XIQA 4ANCA 3VGSA 1HHQA 3BBBA 3ZTOA 2CWKA 1F6TA 3L7UA 1WKLA 3R9LA 1HLWA 3FBBA 5BXIA 2BX6A 4HR2A 1S59A 1KDNA 4WBFA 4DI6A 1NHKL 3VGTA 3WX8A 1PKUA 1HIYA 4C6AA 3DKDA 1U8WA 3ETMA 4UOFA 1B99A 3NGSA 3BBFA 1F3FA 3PJ9A 4FKYA 2HURA 1XQIA 5CABA 1ZS6A 2DY9A 1NDCA 1MN9A 3EJMA 3FBFA 3NGUA 3VGUA 1NUEA 3G2XA 3ELHA 3Q86A 3Q8VA 2AZ1A 3EVMA 1B4SA 1NSPA 3JS9A 1EHWA 3GPAA 3FBEA 4F4AA 2HVEA 3ENAA 3ZTQA 4EK2A 3EICA 3NGRA 3Q8YA 4S0MA 4W98A 1K44A 3FCWA 3DDIA 3Q8UA 2ZUAA 4KPCA 3EVWA 5IOLA 1LEOA 4ENOA 3VVUA 1NDPA 3EVOA 3FKBA 3ZTRA 1NDKA 2B8QA 1BUXA 4ANEA 3FC9A 3GP9A 5C7PA 3BBCA 1JXVA 4DUTA 3BH7B 3ZTSA 3Q83A 1VYAA 2B8PA 3NGTA 3EE3A 2DXEA 1NSKL 3B54A 4CP5A 4FKXA 3VVTA 1WKJA 2AZ3A
chains in the Genus database with same CATH superfamily
1RTHA 3TAPA 4O3SA 2EPIA 2AJQA 5CYMB 5HQ8A 2YQ1A 4RW8B 1R3NA 5KFSA 2QIFA 2C22A 3NG8A 5FD1A 3W62A 2YKNB 2F7VA 1DTTB 4DS4A 4QW9A 1N36J 4NE9C 1KNZA 3FFIA 2XTJP 1WELA 2WOMA 1DQ8A 1NK6A 3EJMA 2ASJA 3DMJB 3KLIB 4X4RA 2VPZB 1RBAA 2KM8C 4U67Q 5KFGA 2GJFA 2H3EB 4AQYJ 4QWCA 4Q2LA 3Q8YA 1FA0A 2LEAA 2X3GA 2IC3B 3DDIA 2IM2A 1YRTA 5J2MA 5BJRA 1RWMB 2GV1A 1FHTA 2YWGA 4M5DA 4I6WA 4BC9A 3EZUA 4F4YA 4QU7A 1U49A 2AW0A 4ID5A 3GCWP 1GX6A 3BGLA 3DOKB 4JI4J 4U7UD 4WE1B 1ZOTA 4CLKA 1VOMA 3F44A 5BYQA 4ANDA 1NCLA 1SC3B 1JLAB 2OGUA 2QGFB 2ZNYA 1FO1A 3A12A 2IDEA 2DITA 4HYKA 1SPBP 3MMAB 3V6JA 4URQU 3IAM9 4HEA9 4CI0B 1N5YA 1FRJA 1K0TA 3VGTA 4UW2A 4PWWA 3NS6A 2GIFA 2XMWA 4O4RA 2CADA 2FC8A 3A13A 4X62J 1RAGB 2FGCA 1P9QC 1KQKA 3AD7C 3MEGA 3BQ2A 4MT1A 4OZ5A 3CMES 4ELTA 3Q2SC 1HI1A 2YVSA 3CNQP 5KFZA 4X4SA 4HH0A 2DTJA 4DWIA 4WZQA 2G1HA 2OPRA 3R1LA 1HNIB 5C42B 1YIJS 2LQ8A 2ADCA 1LKZA 3A1YG 2HFUA 5CYQB 1RT1A 4DV4F 2D7SA 1SH3A 1MU2A 4GC6A 1HPZB 1KLMB 4DV5J 4QWAA 1YK9A 3ET6B 2ZHAA 2R8IA 3MFIA 2HK3A 2QMWA 1YZ6A 3VAGA 4DV3F 3AB4B 3MM7B 2DIUA 4AYBD 1VQ8S 2HFOA 2H4YB 4ILLA 8AT1B 1U7LA 5B0FA 3QO9B 3D28A 1YDLA 3AXKA 2LA6A 2O67A 3B8HA 4O0IA 4X4VA 2IIHA 1HWJA 5IQ6A 3HJFA 3HHLB 2VPYB 1NK8A 4DL4A 1YRXA 2V2ZA 2KRRA 1WJ9A 2B9YA 3US5A 1XC9A 5CZVA 1C0UB 3FMBA 2ZD1A 2HQ3A 2HS0A 2VQEF 1FRMA 4FN5A 5BR8J 4CO1A 2V6AA 2UUBF 3IA0A 3CCUS 2EC0A 2C3PA 1K9MT 4UY8T 1SQEA 4IR1A 4Y2CA 2BM1A 3F0NA 1TP7A 3FZ2A 3M1VB 4OFZA 3AT1B 3KJQB 4C8KA 2DGWA 5KG7A 1IBMF 3LP2A 3JYTB 4C3MA 1FDBA 2I1RA 2BJ3A 4P72A 2E7XA 5BYSA 2YWEA 4JI0J 5HBMB 1F5AA 2QX0A 2WK4A 2DNQA 3S8SA 4LF6F 3VAHA 2M7SA 2BR0A 2B4PA 2NCKL 5J2NB 1X0PA 2HWHA 1QSLA 4I0WA 2DT9A 2GJIA 4F0HA 3I96A 2KN4A 1L3TA 1T3OA 2DBBA 4EO6A 4OI0A 2BUNA 4OIXA 3PXGa 2FD2A 5K14B 2KVIA 1Z2ZA 2XZTB 3H42A 1EHWA 2AV5A 2XQCA 4WYLA 4NLGA 4DR2J 4NWBA 1ZZNA 2C3YA 5IOLA 1C1CB 3NCRA 5J2PA 5KFWA 2QZ8A 4DL2A 1DQAA 4NLYA 2YNIA 2C2ZB 1R89A 3MCNA 4NCBA 2W2NP 2RF2A 1B64A 5HANA 2PMHA 5LM7E 4AL6A 2HVHA 3GFXA 3CCSS 3SEOA 2XMVA 2XMAA 3O6QA 4DR3F 1NK5A 2CQ0A 1FK9B 3T1AA 1HL6A 1N33F 3VHQA 1MSWD 1XNQJ 4KBIA 3Q8QB 1JJCB 2V4QA 2ROEA 4BC7A 4HKQA 1YKWA 4N47A 4J9VA 5ETSA 2D3O1 1TVRB 4RUBA 4DOZA 4BBYA 2DKOB 3D6TB 2A10A 1SC1B 4NA2A 3BZQA 3SCJE 1ZYQA 1B7YB 3R97A 3MM6B 1J5EF 2W25A 2MLYA 3PW4A 2IMWP 2UXBF 2IMOA 1FEHA 2YQ3A 3CCQS 2ASLA 5AE2A 3PJWA 4C0BA 3V6KA 3ITHB 3UQSA 3SQGA 3CCZA 1LWEA 3C6TB 4O4GB 3MHYA 1RKIA 4CCHA 1Q81T 1DARA 4V19X 3W65A 3N6NA 2NXJA 2NUUG 4C8MA 4XDCA 2VG6B 4RU9A 1T05B 5C25B 4KPYA 1RHQB 1YGYA 3PDNA 1SQFA 3G8TA 4MYUA 3SCIE 4LSNA 1RTDA 4RW4A 1JLFA 3ZZTA 2VPXB 2QYGA 3GR0A 4I2PA 2RKIB 2L48A 4IOAQ 2BV3A 2UXCJ 4NEYA 4ECZA 1RT2B 4ZPBA 2UUTA 4JP8A 2VOOA 2OH2A 1SIZA 2RIJA 2GO8A 3J7YI 3WQPA 1IR2A 2HVIA 4PUOA 1EZZB 3D9BA 3PACA 2FVPA 1M5KC 2HZAA 3EX7B 3GB0A 3CUNA 5JVGQ 3AFGA 1WHXA 3ZTRA 4QIWD 2AQ4A 3IG1B 3RBDA 2A6OA 5KFOA 1CJVB 1S9GB 2XYGB 2KVQE 3GJRB 3V6HA 5B0BA 4HTJA 2BQ3A 3GZ7A 2BQUA 4DV0F 2KL8A 2MJUA 3R3TA 4HL9A 1DAXA 4K5RA 1HMVA 3D1HA 3ZZZA 1F2HA 1YBTA 1U45A 1T8EA 4QCLA 1U2FA 4TXSA 3ISNC 3UD3P 2YKPA 1HA1A 4J9SA 2HHWA 5CAAA 1N34F 4KIAA 3F41A 4JI2F 4ER8A 2MZQA 4NLRA 2OEKA 4PQUA 3HLUA 3QYYA 2HRUA 1RHUB 1ZPVA 1NNDA 3KLVA 4QPXA 3LGMA 5KFPA 4X4OA 1Q5YA 1OO0B 1X9WA 1AUDA 4I2QA 4F4XA 5D3GA 2JH3A 3FBEA 4LBPA 1PC4A 2GNKA 4ECUA 1N5SA 1T7PA 3BKTA 2DGSA 3JQKA 1UVMA 2I6WA 1LEOA 4ETXA 4C9DA 1IR1A 2VG5B 3TX0A 3AQPA 2HW3A 4M5NA 2XS5A 3TZWA 4CLSA 4OJ3A 3M2VA 2V9WA 2LEPA 3DI6A 4CH7A 5GAHU 2CJAA 3HSZA 2E5GA 1JLEA 5HMXA 3VVTA 4MYTA 1PILA 1DLOA 4NYOA 3NOCA 4JV5F 4LRCA 1LWXA 1BXNA 4YR2A 1YBAA 4QYRA 4X64F 4EZ9A 5K5MA 1UEUA 3K17A 3IRXA 3HHDA 2V69A 4UY85 2Y1LB 2FLNA 2F8HA 3TZYA 4ZOSA 1WF1A 1U26A 4L76A 4WFBQ 2QL9B 4ZCKA 1Y7PA 4UOFA 3POTB 1Q86T 2YNHA 2YKOA 6FDRA 3OUYB 3QT6A 3HPOA 4LF5J 2E44A 1P1TA 3HSGA 2WW8A 5J1PA 1G7CB 2AYEA 1AZSA 3LANA 4RW9A 3GSDA 2AKWB 5BYRA 1EP4A 3D0IE 2EEYA 2BBEA 4WU2A 2ZEJA 1U2CA 3H5YA 1B3TA 2BQRA 4ZVUB 1SB6A 1TKTB 3RJMB 1T0TV 3DM2A 2YNFB 3ISZA 1U4BA 1BHNA 2BDPA 4DR4J 5A6WA 2V4JB 1JJ4A 3NKYA 3U7JA 3GYNA 1BWEA 4LF7F 3CULA 3OSNA 5DM7Q 4C8LA 3DDKA 4LR7A 3M8ZA 4KHPJ 2CKWA 1W2IA 2QL7B 3TEHB 2HK2A 2BZ2A 4DDFA 1A7GE 1RT3A 4LFBJ 5HMWA 3BBBA 4U6PA 2HVZA 3RGIA 3IWXA 4NASA 3KLFB 3UW1A 4YEAA 4RL1A 3M2RB 4C6AA 5DDQC 4JI8F 4CO4A 3AJ2A 4LJMA 1RACB 3R6LB 4CM0A 4LFCJ 3VAIA 2ZH4A 2UZAA 4IYQA 1M1KT 2G2OA 3HHEA 3AA8A 4JV1A 4W98A 4TYAA 2R7TA 3K59A 1S48A 3AH6A 3OTEA 5T14A 2OPQB 3TJ8A 2ATLA 5EN1A 5LSOA 2F4VJ 1T9VA 4O3RA 2DHAA 4NLTA 5L9XA 1VCTA 4KH1B 1D8ZA 1HWIA 1T9XA 4IO1A 3C19A 2UVUA 1FD8A 1QE1B 1D09B 3MPDA 3MR2A 2KU7A 1OJ4A 4OHVA 1IXKA 1TKXA 4TQRA 3PYEA 2VQFJ 3NCQA 2DNGA 1WC1A 1Q95G 4WP8A 2W9CB 5L39A 2DHSA 4ZJOA 1QVGR 1VHIA 3MFHA 3DRPA 1LNQA 4H4MA 1VISA 3RU0A 3JSMB 4KGKA 4MFBB 5F3TA 3I32A 5A76A 4LRDA 2HBYB 2DPIA 3R7NB 2IA6A 2I38A 3QIDA 2NPFA 1X4AA 1T95A 2DGVA 1T03B 4B3RF 4USUA 5LSLA 4C48A 4LMZA 2DHHA 3DYAB 2F3JA 2QYCA 3E51A 2ADBA 2K7JA 1IR0A 3TNVA 3DLLQ 4NLUA 1APSA 3HHLD 4JOUA 4OYMA 2HBQB 5DG7A 5H1SV 3MM8B 5ETVA 2XSJA 3CB4A 4Q5VA 2GJ2A 2RJZA 4KV8A 4EWTA 4P6QA 1QD1A 5IT9Y 1HHSA 4G1QA 2E5LF 5SZTA 2DEIA 5HP1B 1KP6A 4KKOB 1JXEA 1MW7A 1FXRA 1ELOA 4D3GA 2PC6A 3PFOA 2QA1A 2NPIA 5I3UB 1IBLF 3BPSP 1BY9A 3D3CJ 3TVYA 3L4BC 1X4BA 1RWUA 1JX4A 2O5DA 5H9EJ 1I94J 2CNNB 3PYFA 4R8UB 3W3SA 2QFIA 4DPXA 1Z2LA 4W90B 1HWLA 1CG2A 3NOGA 3W61A 2Z8QA 4XO0A 4J7CA 4LF8F 2VKZG 1GFWB 1D8YA 2RH3A 1S6QB 4XDDA 3VVUA 4NZ0A 3EVOA 3M32A 3DLEA 4PWDB 4AT1B 3TW0A 1LW0B 3RRHA 2J6UA 3FMWA 1HI8A 5I3PA 2NUHA 4DJBA 1S9EB 2C2MB 5GAEI 4FXDA 1VMBA 1PBUA 2J9CA 2R2UA 4ZDNA 3QNWB 1RHRB 2ZOFA 3CW2C 2F9JA 5DDOC 4ED2A 1REVB 2WVEA 3HVTB 3IBFB 3D6HB 2W24A 2R3VA 3H25A 1EARA 1TQLA 4NCGB 3J81Y 2FJAB 1SJ3P 3THVA 3HJVA 2IYIA 3MWBA 1R0CB 2RQ4A 5L8RC 4USMA 2XB2D 2HURA 3FNNA 1IKXA 3VF0B 2XMJA 1JNRB 4JV2A 2VPWB 4B3OB 4ZVEA 2C2RA 3PRDA 2QSFA 2YKQA 5KT4A 4PR6A 4ERDA 5E3AA 1YRUA 3H5XA 2VBXA 4TU9A 3QZ8A 2VG7B 5DS7A 1TK0A 4E2FB 5M2RA 3DGVA 1X5PA 2WRMA 1FT8A 5KFTA 9RUBA 2R7RA 4AD6A 2CPEA 4ZN3A 4OX7A 1U1QA 2J6SA 1FKPB 4I6AA 2R8HA 2P9EA 1Q8LA 2JSXA 1WDDA 2MZRA 1N52B 3L95X 2XM3A 1HQUA 3O44A 4QWBA 3D4JA 1H2VZ 1JWWA 1QLNA 4QBUA 1NK7A 1MROB 1WG5A 2B7BB 4HI1A 5DQIA 2CJQA 3MAAA 5ETQA 2FY8A 1HQEB 3OFGA 1QUVA 2DR8A 1IBKJ 2GS8A 4KGXB 1RT4A 3N28A 2D69A 1RWOB 1HNVA 5KT7A 1IUJA 5DDPC 2H4WB 3MR5A 2GQQA 4WFZA 3FCWA 3N6MA 1S72S 4KPCA 1B7FA 5IZHA 1JMTA 1OS5A 3GMGA 4RR5A 2Q66A 3UN5A 3QIPB 2Y1IA 2FC9A 3MPUB 4WCEQ 3K58A 2LP4A 2A3JA 4JI1J 3RAXA 3MM5B 4P74A 1X31C 3GFYA 3E2EA 3M6XA 2QA4G 4PABA 2R8KA 1TKDA 5B0CA 1EIYB 3CO0P 3TJAA 3VZHA 4OX9F 3M8QB 4DBQA 2QSWA 1GTHA 3KK1B 3SCKE 4XIUA 2PE8A 2QRRA 1LXNA 3TQ1A 1JJ2R 1WOSA 4DV7J 4CLLA 2HLTA 1YWXA 3FBBA 1F3VA 4JBCA 1GMWA 2RDDA 1JLGB 2DGUA 1UP1A 2DCUB 2QLJB 2MQLA 1JNZB 3K8VA 1KVKA 5KAKA 2H5IB 3DNCA 5F8MA 3SYZA 4A8WA 4OJ1A 4DV2J 3S01A 3SDEB 5HN0A 2RSQA 3E01A 3WBZA 4B9UA 3D2WA 2AYMA 3D1OA 2XLKA 2V8GA 2V63A 3N4WA 1RT6B 2GIQA 4EZ6A 5LL6d 2CPZA 3UD4P 2EBEA 3OR2B 3W2WB 1RTJA 3LO3A 2V67A 5AXKA 1DQ9A 2RHSB 1UVJA 5AXMA 1F9EB 4W92B 2ZH3A 1MNEA 4WIIA 3OVSA 2K06A 3J7A1 1S57A 1C0TB 3K5LA 4X65F 3LF0A 4F3MA 2OEJA 3VR1A 4RNFA 2GMLA 1KLNA 5B0DA 1KDNA 1SH0A 4Y2AA 3MCSA 2DNMA 5KG5A 3LAMA 1E6VA 2X3DA 5AXNA 2XLJA 4OYBA 4LUBA 1OSDA 3BGFA 4CH0S 3NY0A 3NMAA 1KN6A 1EETA 2QT7A 4A8SA 1UMJA 2E5IA 3TAMA 2C2EA 4LREA 3CJRA 2XNRA 4K4YA 3G6VA 4I6YA 1S1UA 1VRUB 4ZP9A 1JLQA 1VYAA 4YB6A 3OTOF 4R25A 4DUYJ 4NXMJ 2CQ4A 2WAQD 2ZWOA 4MK9A 2GAGC 5HI7A 2ZITA 4OV6A 3I9V9 1VQ9S 3PJXA 4YDXA 4QIFA 4N7TA 4LIRA 2KZZA 3J81U 5L1IA 2JX2A 4GKKF 2R42A 3PEJA 1K8AT 5IFMA 4YS2A 3VCDA 2EG2A 3CJKA 3LP0A 1VBYA 1RTIA 3H4BA 1HLWA 2ZH7A 4ZHRA 3DXBA 1WOOA 4DCJB 1K1QA 2BJ8A 2ZZMA 3C6UB 4YR0A 1F0XA 4GVLA 2PI4A 2RDIA 3WIVA 4EYHB 4M1KA 2UUAJ 3WHIA 1S1XA 3KLEB 3Q8SB 3EGZA 4MJKA 4K4TA 4ED4A 1IM6A 1ROFA 2RHQB 1UFLA 3EVWA 5L1JA 3CD5A 4AQYF 1NDPA 1ZTTA 3OXGA 1NMEB 4KHRA 3UNGC 3K7RA 3MEKA 1HR0F 3R1HA 3BBCA 3CD6S 2B4UA 2M3DA 5DM6Q 4YY3J 2V4RA 1P8GA 1CJTB 3H7HB 3KHRA 2HFSA 3PCOB 2HWIA 1NBEB 4X84A 4NA1A 3PM9A 4K4VA 2A2DA 2XMTA 2G0IA 4EBCA 2BXJA 2CJYB 1N5TA 2CG8A 3PHEA 1N6QB 1HFEL 2W8KA 3PX6A 4U8VA 5KTQA 4NRTA 2FJBB 3M8YA 2DO0A 2YH1A 3GV5B 4MKVA 5L46A 2ILZA 1C1BB 2WVBA 2VC0A 3QJPA 1F9HA 1RWVB 4NI2A 2I5JA 4ZLPA 2DD8S 1SV5A 2G9OA 2HNYB 3DDNA 5KFDA 3BKUA 1UWBA 2LLZA 2Y1RI 1XQIA 3IM9A 1FXDA 1S1VB 1MN9A 3C14B 2HMIA 1FJGJ 1PJ5A 3PR4A 3AY0A 4I68A 1VQNS 4DMZA 3PKMA 2FTRA 5A8KB 5KT6A 4LQ3A 1VQYA 5DDRC 3VQSA 3THPA 1M5HA 3KFWX 5IQQA 2EFNA 2W1BA 3EDRB 2W01A 2LA4A 5E5NA 1RABB 2Q6BA 3Q83A 4PQAA 4CLUA 5KT5A 1KFDA 4P2FA 3IBCB 5CHCB 1S4EA 4JI7J 4NX9A 1DZ5A 3QFWA 4J9PA 2H48B 4JYAF 2WOMB 3MEEA 2XY5A 1KONA 3KHHA 4YOEA 3NEKA 1H7WA 4N8OA 3W5YA 3KHLA 3JSRA 2MYFA 3C16B 2UUWA 1ZM3A 3KHGA 4RWXA 1NHKL 2WCXA 3WX8A 2R7SA 1CQMA 5H9EK 3NNHA 5ETNA 1W25A 3PG9A 1V5VA 5ETTA 3Q23A 1Y00A 1S49A 3PX4A 2I2YA 3QLHA 4QR2A 1NHVA 4M5GA 4PXBA 1YJNS 5JMNA 2DNOA 1CC7A 3P3DA 3GP9A 3TX8A 5GADU 1X9MA 2R7XA 2XY6A 2FB0A 5LXRA 2F8MA 1M1HA 4ES2A 1UEKA 1WI6A 1FERA 1S10A 1Q7LB 2ZDOA 2WBRA 4UOGA 4Q45A 3R5JB 2Z4PA 4NXNJ 4UOHA 2BKNA 3DOMB 3SMZA 2LYVA 4JI0F 2LEBA 3I6PA 4NLVA 3OL9A 2HHSA 1U0HA 1TV6B 3J80Y 2N3OA 4MIAA 1IJFB 2OKQA 4TYBA 3X3UA 2OMLA 3ILLA 4FKYA 3NBPB 3OBIA 1O0PA 4B9NA 3ELHA 5GAGU 2UU9J 4LR9A 5KFAA 5JUMA 1RYRA 4DSJA 3GYXB 2C3MA 1RT1B 1RWWB 1GXLA 2ZE2A 4ZP8A 1MU2B 3IO1A 4NZ7A 3DRRA 3VWSA 2ALZA 1WOPA 3NLCA 4A48A 4DR2F 1E6YB 2HIQA 1JXVA 4QR1A 4EO8A 2ZM6F 2E1PA 3M8PA 3MXHP 2W2OP 2AZ3A 3RBEA 2BEFA 4Q7AA 2V2VA 5FDLA 4QPTA 3HZGA 4DLEA 3ZZ0A 5L38A 3DLKB 1X8DA 4KO0A 3VGVA 2V9KA 3OL7A 1WG4A 4WTYA 3JSBA 1WKKA 5DGBA 1P1LA 3M30A 1RU2A 3G87A 4B3SF 3ZZUA 4FS2A 2B6AA 3GV8B 1X4GA 3QGHA 4B9LA 2B9EA 1MLAA 4N77A 4DG1B 4ECQA 2E7WA 4YFUA 1NJXA 5F8NA 3OL8A 1XMBA 5DLFA 2CDQA 5LJ5Y 2GFFA 4P7VA 3LP2B 3FEYB 2YWWA 2WTFA 4OHWA 1Y5NB 1S6PA 3CXCR 2NZCA 4YMEA 2D41A 2XGPA 1RAEB 1ULRA 3D0GE 5DQGA 5SUHA 2W9BB 2AJFE 3MCMA 3IP0A 2CQIA 4LFAJ 4B3MF 1N32J 1M0SA 2YPYA 3IC1A 4N5SA 3CCRS 2LFVA 5HROA 1EKRA 3K8WA 1FCAA 4C2MA 2KTQA 1F60B 1NH8A 1N4LA 1L3SA 2CVIA 5IXUA 1U0SA 2PA8D 4TN2A 5LMUJ 3KUGA 3MD3A 2E7VA 4DEZA 4UTGA 3KMQA 2HFNA 3R9LA 4PG5A 4QIEA 3PRBA 2R8GA 4ZKAA 3KG1A 5IM0A 3SSRA 2CPIA 1KR4A 1NUEA 1AT1B 2OEMA 2YNIB 5D8HB 2UXCF 1B4SA 2EFPA 2RRNA 4A8MP 3UN3A 1QAJA 1TL1A 2RF2B 4WFNQ 2W2MP 5M2PA 3CCJS 4RW8A 3PR5B 3WDOA 2KYZA 4ZVTB 1N54B 2RMLA 2YKNA 2J8SA 3MAHA 1WUUA 1DTTA 2XGQA 2JVRA 3BO3A 1S4FA 4R5PA 3T41A 3EE3A 3MUTP 3D1QA 2BW2A 1V3ZA 2KRBA 5KFRA 1Y5IB 1W2BR 2FHOB 3HULA 4EU0A 3DMJA 5DLGA 3K5PA 5B7WA 3KLIA 1LFWA 1TELA 3NNCA 2B43A 4ETZA 1BE4A 5CQGA 4I1TA 4IRDA 3CVKA 2UV8G 4F8RA 1PSDA 3O1LA 3PY8A 4TY8A 4C3KA 2D3OR 2QLFB 1OSCA 1GMVA 1FFSB 4KJIA 3FQLA 1ACMB 1KWMA 2XYPB 2KI2A 3CJ2A 3DOKA 1U25A 3W66A 4RWWA 3SQGB 4WE1A 1D9DA 3U1MA 2JLEA 1YLXA 2CJXB 2KXFA 4OYPA 2UV8A 4DSLA 4OZ0A 2P8IA 5GMKa 1JLAA 3GV7B 4O44B 1FWPA 1I1GA 2V2QA 2ZH8A 1S79A 1T3NA 4A8FA 1YQHA 1BUXA 5FLXY 3OTBA 3MMAA 2A2CA 1OWXA 1NM2A 3O3LA 1XMQJ 1OMSA 2G2YA 4NLWA 4U95A 1GK8A 3G6ES 4IR9A 1VBXA 4ICLA 4ZVHA 1RTDB 2MQNA 2KYXA 4I2PB 1BD6A 3J80U 2ZH6A 2CWXA 2UVWA 1ZBTA 4FF4A 4OZ3A 1F5CA 3PX0A 2R7OA 5JVHQ 2LVWA 3TWZA 2ABYA 4ALZA 1RGVA 5C42A 1U2RA 1PJ6A 4CLFA 4K4ZA 1M5SA 1SL0A 2BOAA 1J5OB 5IC6B 3HVWA 4Y00A 5EX0A 2MQOA 2YH0A 4I4BA 2WB4A 4M5HA 5F8JA 4IFYB 1ZS6A 1OIAA 2LMIA 2ZH9A 3K2YA 4U8YA 1HPZA 1KLMA 2HQFA 5B0EA 3ET6A 1NHUA 2YKMB 3DRSB 2CDRB 3IXQA 1HWKA 4LR8A 4ED1A 2J0QD 5K20B 2F65A 1UPMB 2GW8A 3QO9A 3K89A 1FKAF 1KBRA 1N56A 1R0BG 4ZPTR 5KFYA 1FDAA 3W9JA 2BOPA 2AIRB 1TUGB 3HHLA 3CDUA 1R31A 4PQUB 3W60A 1PGZA 4N8NA 3G86A 4WP9A 2P5VA 3RBXA 3AJDA 1C0UA 3V6DB 1YITS 2VFTA 2WW4A 4MTPA 2B3TB 3CDEA 2PT0A 3VAJA 2GCFA 4HACB 5D3GB 4KHPF 4PG6A 3KK2A 3M1VA 2DNKA 2DNRA 2J76E 5AJ3J 4XAKA 4K8RA 5DO2A 5GVQA 1U6FA 3SCLE 2BA9A 4P2MA 1AXQA 2HHUA 3TUZC 2YNGB 3SBMA 1JLEB 5HBMA 2C3UA 4H4OB 1W26A 2EK6A 1EKSA 5D4OA 2RQCA 1P6TA 3R5CA 3D6FB 3BQ0A 1JLBA 1X0FA 2JL9A 1RWKB 4WIQA 4CP5A 2D1CA 4DQRA 2XNQA 3IRXB 2HRTA 3TP2A 4K4WA 1T9WA 3FEZA 2LQ9A 4ZLLA 3GG1A 4I56A 3CEDA 2C2KB 2AF6A 5K14A 2IRYA 3BDPA 4FNIA 4CIOA 1VQPS 2WBMA 4MK8A 2YNHB 3CF5Q 1BQMB 4QJVA 4V19J 2VQFF 1C1CA 4DV6F 4DV3J 3DRYA 3PW0A 1V5IB 3JTNA 4UZCA 5E41A 1YJVA 2XWYA 1HD1A 4RW9B 2HAFA 1VJWA 2RQMA 3HHLC 5CYJA 2FY1A 2MZTA 3V81B 2KDOA 3ZZRA 5AT1B 4F26A 3A8JA 3OSPA 1L3VA 4OL8A 4DQIA 3GPAA 1Q1KA 3CE8A 5LJ3Y 4DL7A 3IWNC 4M95A 4PKDB 2UUBJ 2FVSA 5C7PA 1L3KA 2QLXA 1VS3A 2C42A 4I7FB 1IBMJ 3I31A 4NLXA 2ASYA 4YHHF 1RTZA 1RHMB 3AOAA 4IFVA 4DN9A 4FP9A 1OQ3A 1WTBA 1Q4RA 4A8KA 1XR6A 2ZBIA 3R5DA 2R2SA 2L08A 2R8JA 4LF6J 2UVVA 1TL3A 4L3NA 4O3PA 2GMJA 1SJFA 4ED8A 4PG4A 3C6TA 4DU8A 4YP3A 4PG8A 4UF4A 4CLYA 1NKBA 3O5TB 2Z2YB 5FLXU 3ZC4A 1V6HA 1I94F 2IVYA 4ZVRB 3TUIC 1WD6A 4J37A 4QZVB 2H9ZA 1X4FA 5EWEA 2XSFA 2WONB 4KRWA 3N0VA 2HHPA 2DR5A 1JKHB 2ZBRA 3BR9A 3N79A 3UNYA 3RB3A 4UUXA 4C4WA 2RKIA 2ZVSA 3NAIA 1UCNA 4L73A 2ZOMA 2EKNA 4P71A 4ED6A 2DNNA 1C4CA 2IPOB 1RT2A 4K2JA 4H4MB 2JEIA 4ID8A 1X60A 4DSKA 3HXMA 8ATCB 4URGA 2CQHA 4WWSA 2XBPA 1R8PA 2RQKA 1I6JA 4XPCA 4LBHA 4J9QA 4F0MA 4RNOA 4CT9A 1N33J 2IAJB 1X7VA 2YX1A 2AD9A 1IKVB 1CJVA 3UO0A 3ETMA 1MWQA 3C15A 2B4OA 1JJHA 5GMDA 4F2SA 3M8RA 3ETOA 3FSYA 3FCHA 2EFQA 2LQJA 2XCPA 3CGIA 1VRQC 3I4HX 1CJKB 1UVLA 3D6MB 2XYHB 4NZ6A 3FKBA 5AXLA 4I67A 1ITPA 2A6MA 1FDNA 4OI1A 1KVIA 3L09A 4N76A 2PMWA 2CAJA 5J2QB 3A3NB 2Z30B 1O5JA 2L3MA 1VQOS 2V8PA 4X2BA 3ZNUA 1GMWD 2POKA 1HNWF 1RLCL 3RBZA 3OVBA 2PEBA 1NZ8A 4F36A 1H7XA 4B08A 1YG0A 3BDEA 3IGNA 4CO0A 4OHYA 2WZ1A 2FGOA 4RW6A 2KZMA 3C46A 1TR0A 1Q8KA 3NAHA 3NRBA 1V9OA 2W4CA 2VG5A 3VZIA 2AP6A 1SKSA 3R7SB 1D3WA 1R7IA 3IS9B 4B9VA 5DQHA 5HQMA 1XWLA 5JJBA 4ZJLA 2HNDB 3KLGB 2IFXA 3M32B 2D3ZA 1FFGB 3NL0A 4WPAA 3KMSA 3DLEB 4LF1A 4CTAB 3Q86A 4JV0A 2F63A 1NK9A 3DOLB 1K44A 3R5BA 3QAEA 1NKEA 5DZ7A 3R5GA 2DCLA 1Q0NA 5B0AA 2HWTA 4OI4A 4EBEA 1BC6A 4FF1A 3ZTSA 2DPJA 2VL1A 1VC5A 1NJIT 2R2TA 2O01C 5F8LA 2LQ5A 2GVDB 5EWGA 1SKRA 2MXYA 3POTA 4JI1F 4FYWB 1KQSR 1PAEX 2IM0A 3W5XA 4DV0J 3OLAA 3OUYA 4YB1P 1KHWA 2E1RA 3V5RA 3GFHA 4OLOA 3EDQB 2K3IA 2RILA 1S5ZA 4V1Ak 3UDEA 3BSCA 1UETA 3QSYB 3A8KA 3MTKA 3PFEA 4JI2J 4ATNA 2RVJA 5KOWA 2ZHBA 4DV7F 1TKTA 4DSEA 3I0SB 1CSJA 5G0RB 1RWNB 4WZMA 3NGUA 2V4JA 4QWEA 1GEHA 3FSXA 5LT5A 2R7WA 4DR6J 4Q43A 4ZP7A 3GIJA 3LPEA 3CJ8A 4DV2F 4PRFA 4PPZA 1HQUB 1A9NB 2J7KA 3OR1B 3NNAA 4IH7A 5IS2A 3N01A 3CPWR 1YBUA 4LRAA 2PN6A 4OZ2A 3B6BA 2FZKB 3LP1A 2QLBB 5I4MA 1CS4B 4F3OA 4ZVPB 1RADB 4DZ6A 1Q79A 4ZVQB 2Z56B 2PDAA 4DR1J 3AA9A 3UE2A 2ASDA 1KEKA 1CULA 3Q22A 4JV5J 2CJBA 1SCJB 3FEXB 1XIQA 2SXLA 3T5KA 1VC6A 3KWMA 4HDHA 2BJDA 1HNVB 2F5GA 2P6SA 3I56S 5E2QA 2N3LA 4NCAA 2OPQA 4U9RA 4RUCA 5KFHA 1ZA2B 4DI6A 2EG1A 4F2RA 1DURA 3LGHA 3PJ9A 4AE5A 2AJ0A 3GFZA 1H2UX 3MM9A 3P6YC 3A8EA 2NSBA 1VQLS 3JS9A 4FS1A 4CZCA 4YR3A 5HSPA 2X1GA 4USTA 4IOCQ 2QLWA 4ZCLA 1QUPA 2W9CA 2QN6B 5FJ4A 1Y5LB 1FJCA 1UVKA 1WC4A 2HQCA 2V0NA 3JSMA 2M52A 2WVFA 3MMCB 1HNZJ 4P75A 4RNHA 4DUYF 1RB0A 2QE5A 2B51A 1AFJA 3D0HE 2LECA 3DLGA 5KFMA 3BH6B 3DYAA 2YWHA 4MKBA 3PEHA 5K8PA 2N4DA 3OD2A 2MKIA 4MIWA 3OTDA 1KVJA 4ES1A 3G8QA 3J7YU 4BS2A 2MKJA 2GHVC 1IQZA 3FDSA 3MM8A 4FDFA 3TUJC 1VK3A 3E01B 2CXEA 3B82A 2FJXA 1NDCA 1SJ1A 2BJ7A 4UZBA 1RTJB 1L3UA 4F7VA 2WSCC 1G3OA 1OPIA 3CIMA 3M6WA 1NZAA 5HP1A 3MMJA 1WEZA 3BEGB 4CLWA 1RDRA 2DB1A 3P96A 2QEXS 4BHQA 2F8EX 3W7BA 5D0RA 2J7UA 5F9LA 4IG3B 2DHGA 4R8UA 1IKWB 3JAMY 2MLXA 4OJHA 4GO5X 2C2DA 1H0HB 4ZN1A 3HM9A 3H5SA 4BWJA 1VGYA 4KC5A 3PW5A 4B9MA 3OXLA 4ES3A 1FRKA 2E1CA 4PWDA 5HVFA 4OI6A 1SKWA 2MKHA 2W8LA 2CQGA 5HQLA 2HFZA 4CO2A 3HHNB 3UWTA 2RUGA 5C2GA 2BABA 3HSDA 1YI2S 1S9EA 2NXNA 3GIIA 2I8EA 2L9NA 4M63A 2HPUA 2WB1D 1JLQB 3MECA 3HX9A 1G6BA 2K1RB 4USIA 2AYGA 1R8HA 3GONA 4G65A 3T3FA 4B3RJ 2OFHX 1FJGF 3PNIA 4DX8H 4TKTA 2MJNA 4FF2A 1YZ7A 2ZH5A 2R7QA 1REVA 3HVTA 1RAFB 4X66F 2RT3A 2W4PA 3BYRA 4Y2MA 1RISA 3BQ1A 2K8GA 4NCGA 1S12A 2LXIA 4XK8C 1MWYA 4OHXA 5CA5A 2FVCA 5IWAF 3OV7A 1EX8A 3LP0B 3HKZD 1FE0A 1XR5A 4B3OA 1TAQA 4HH1A 1JIHA 4ZHRB 1OY9A 5ETKA 3QRQA 2OI2A 2FHJD 2OO4A 2NR0A 1BQNB 4ECXA 7AT1B 4JI7F 3RB6A 2E5LJ 1Z4UA 3TVKA 4QIGA 4B17A 3QT5A 4EUVA 4CLZA 2AEJA 2DJWA 1O6XA 4LF9F 2PMZD 1NK4A 5KFKA 3P45B 4PXDA 4DR5F 1RHJB 4FF3A 4C97A 1IBLJ 1FKPA 2FYXA 1TKZB 3T1HF 3KKFA 4LSLB 1BLUA 4K50A 4O23A 4ZVFA 4YUDA 2YX4A 3VAKA 2HNZA 4K4SA 3VAMA 4PEOA 3GIRA 5D15A 4TQSA 1S99A 1URRA 3ILOA 2Y8WA 2RDJA 4OMFG 4ZPDA 1MROA 1S1WA 4YN3B 2J7WA 1QSYA 2OPPB 1N0VC 3MR3A 4B3TJ 4A8QA 4IDKB 2Z57B 4HVZA 4KGZB 4ZA1A 2GAHC 4KY3A 1DTQA 2BJ1A 3PYDA 1PJ7A 1UWBB 1Y11A 5A0YA 3TZXA 3BPDA 4FPIA 3Q8PB 1HHQA 1VJQA 5DETA 4GKJF 2DH8A 3N5BA 5C24B 4WFAQ 4USJC 4FBTA 4NXNF 3QIPA 2I0XA 4ZPWR 4OYAA 3MR7A 2OLWA 3D67A 4M5LA 3RB4A 3ILIA 1DFDA 4WFYA 2FPHX 4IKAA 1IBCB 1VBKA 3IN5A 2OFGX 2D9PA 2YWKA 1Q8IA 4PZVA 2KXHA 4S0MA 3KK1A 2EI5A 3QRRA 4Y65A 2XY7A 2UU9F 4KFBB 1HYSB 2X1BA 3CC4S 4LBIA 2AEMA 2P9GA 1T02A 3WIUA 1V3RA 3UFCX 3TA1A 1X4HA 4ZLJA 2CG4A 3HD2A 1NEEA 3MEEB 1FNMA 2PD1A 3CJQA 2YTCA 4Y28C 2GA7A 2DGOA 1JLGA 3AD9C 3Q89A 2PO4A 2W9AA 2G4BA 1MG7A 1F2GA 2KXNB 2VU5A 3L7OA 4ZVOB 2A1BA 4KB7A 1FDDA 5T41A 5I3QA 2M4MA 4ILRA 1VRTA 2MZSA 3T6BA 3LWLA 4DSFA 2MKYA 3OVAA 2IJNA 4OYXA 3SDEA 2LU1A 5A8WB 3MAQA 2EFVA 2Q79A 1S77D 4ILMA 4KTQA 3QLHB 4JI5F 5BXIA 3M9MB 1RT6A 4PAAA 3LPYA 3KJVB 4DFJA 3OR2A 3GE9A 3W2WA 1TL7A 5I42B 2HQIA 3KLHA 3BBFA 3H0PA 1LXJA 1U6BA 2E29A 2AJ2A 4FNHA 1HW9A 2X51A 4IOBA 4X4PA 1CPZA 4MIBA 3QGGA 5HATA 4NLDA 1PYOB 3CJ4A 5HMZA 1DJ0A 1S76D 2NQPA 4JUZA 1C0TA 5K8OA 2OELA 1BQXA 2FJDB 3SFGA 1RYSA 4UQGA 2HZVA 4LRBA 2GHPA 2ATCB 3L3CA 4ED7A 4DR7J 4GVBA 1RK8A 1NDLA 4Y2IA 4DL6A 2HHHF 4O0NA 1U0HB 3VQTA 4LFAF 2EBGA 3HKWA 4DPUA 4Q0BB 3FJ2A 4RNNA 3U1LA 3L9ZA 3UDCA 3NS7B 2IM1A 3SSQA 1VRUA 5LMUF 4WBFA 2HGNA 1ZAXA 3MI7X 3MMBA 2ZE2B 3Q0AA 4NLQA 4RJVA 1RHKB 3W5ZA 3HFVA 2M70A 2MY8A 1RCOB 1A0OB 3UDLA 2ZKTA 3ULHA 1CJUA 2HEKA 2HBZB 4ZK7M 2JHEA 3D66A 1AA1B 2YPZA 2IVFB 2B4VA 3IAS9 8RUCA 2CQ2A 2B8QA 2KG1A 2ZC4A 1FRIA 3OLBA 4BDPA 5GAEU 3TI0A 4KO0B 4WXOA 4EFAC 4P2SA 1GNKA 3GIMA 3EUNA 3M30B 1HBOA 3C6UA 1TK5A 3D54A 1FXLA 5KFNA 3H5UA 3CO9A 4DV1J 3OQ2A 2RS8A 4WJBA 1S9FA 2V34A 1JQGA 4AFFA 3VTIA 3LUYA 2LCWA 2RS2A 2CWKA 2GGPB 1M5PC 4F0KA 3M05A 4AXIA 5K8NA 4ZITA 4X65J 2ZJRQ 1CJTA 3K5OA 1XNRJ 3ZZOA 2M88A 4QIVA 1SH2A 3VGUA 3CIZA 3HZEA 3W63A 1QTMA 1SUQB 1RT7A 1FVSA 3TVZA 4R0EA 2OPSB 1N6QA 2YY3A 1N5QA 3MOJB 1Q16B 1GX5A 1Q78A 3PW7A 4M8LA 2XHCA 1ICEB 1C1BA 1MWZA 1FF2A 2XEXA 4DLGA 1RAAB 2RNEA 1WF0A 2HNYA 3CT9A 3P5BP 1H98A 4KGMA 2MSTA 5KG2A 2FVRA 2XZWA 3KG4A 3OTOJ 2DGXA 3N6LA 1FNOA 1NPKA 3C14A 4PWUA 3OXFA 4IH5A 2ROGA 2DYAA 4RW7B 5IM0B 3W9IA 2DXDA 3I55S 1DBDA 5A8KA 3IMQJ 2BMBA 2V8HA 2DY1A 1S6UA 3RYLA 2UUCF 3EXYA 2W7PA 4DUZJ 4RBUA 6FD1A 3H4DA 3S7RA 2MZ1A 1TL1B 1GT8A 4GKKJ 1S0MA 3ZO7A 2VBYA 1B0TA 4QOTA 1WHYA 4JI3F 4ECVA 2H5EA 1KFSA 2DR9A 1RA7A 3IM8A 1FX4A 1D9FA 4C8NA 4OZJA 2MGZB 2DR7A 4R5PB 2FJWA 1HNXF 2RE1A 1RAOA 2ACYA 4KT0C 3G4SS 4A8XA 4HHUA 2M8DB 3QQCD 4CO5A 2GQ2A 1OY8A 3C16A 3CWJA 2FHKA 3GU0A 5KFCA 1HR0J 2BANB 4TY8B 2HBRB 1O51A 1SXLA 5IT4A 1RAIB 5HLFB 4J9LA 2HLUA 3BGRA 1OQ6A 1YJ7A 1RLDA 2OP5A 3HFZB 1T9YA 3W2VB 4R0JA 1LWFB 3O2IA 4Y3CA 5E3QA 3TA2A 3M6UA 3DLHA 1X9SA 1S1TB 4A8OA 4KH0B 2N4CA 3AAWB 1G4CA 4TY9A 1JXLA 2OAUA 3F56A 3RB0A 2J6TA 1S0NA 1U48A 3L7PA 1LW2A 2CQ3A 3QGIA 5D0EA 3I87A 5AJ3F 4YQWA 5JXSA 3K5NA 2V5HG 4I64A 4Q2MA 2JC0A 1BGXT 4Q44A 4KQZA 2PGCA 5KG4A 1TL4A 1XMOJ 1URNA 3ZZYA 3DOMA 4ICLB 2LXUA 2W7OA 1VIOA 1RCXB 2MB0B 3FK4A 1WF2A 3JTOA 2HHVA 1X4DA 1TV6A 3S6EA 2NXUA 4A47A 3NBPA 2XS2A 2EFGA 1U1LA 5E3CA 2Z2ZA 4QWDA 2HHQA 3GJSB 1SQGA 1NSQA 2MQ8A 1FJ7A 4OX8A 1UVNA 4O3NA 3OW2R 1TZ0A 1OYEA 3QGPA 3T1YF 3K5MA 4JYAJ 3L7UA 1KHVA 1E6YA 2A0FB 4ZCIA 4DCPB 3V4IA 1RKJA 5KFBA 2JZ5A 5KG1A 3OTCA 1VLOA 3DN9A 1FFWB 1FRLA 2QA4S 3G96A 1U1NA 4M94A 4NLOA 3DLKA 3GJQB 5LMNF 1ZAWA 2ZOGA 2XLIA 1CLFA 2VFSA 1VQ6S 3KK3B 4LF4F 1VDHA 4OYZA 2VFUA 1TMJA 1PO6A 2Z58B 3BO4A 1HHTP 1NK0A 4KR0B 3PHTA 1K1SA 4DG1A 2L9WA 1QDUB 3EMTA 3A3PB 2VUGA 3WC0A 1YHQS 2NYHA 1HBNB 3KK2B 1WHWA 1W7WA 3CCLS 3H40A 3KG0A 4YB5A 1XTZA 2E9ZA 2W7AA 1WTFA 3CD7A 1X4CA 3T5HA 5KFEA 2OUGA 2B5JA 1FWKA 2GHWA 3DLJA 3UN2A 1N0UA 5L1LA 5F0WA 1FVQA 4CYUB 2W9BA 2RU9A 1VHFA 3HF5A 3QWPA 3MCOA 4DF4A 4QQBA 1UJ4A 2CPXA 4OQJA 3K57A 4H4KA 1RQ0A 3EZOA 5IT9U 3GCXP 2PSZA 4W4MA 1JLBB 2NLWA 3NGKA 4FBUA 5H9FJ 4IH6A 1O8BA 5IC4B 4ECSA 4B02A 2GO9A 1REGX 2UP1A 4WK1A 3PV8A 3I4PA 1VBZA 1WACA 1CC8A 3EPIA 2E9TA 1GXUA 6AT1B 3BN7A 2KJWA 4QYZJ 4WYWA 5KG6A 3QRPA 3DGPA 4JI6F 1FTCA 1XJWB 4F4ZA 2MSSA 4WP3A 1YSJA 3B78A 2ZM6J 4DFKA 2Z2LA 1FE4A 1VIXA 3H2UB 1ZTWA 2HHTA 4RO0A 2CJKA 2FLLA 1IKYA 4PYAA 3UCGA 1F9FA 1LQ9A 1NU4A 4IG0B 2A18A 4CLPA 2DRDA 2W4DA 3T5JA 1J2VA 4B3SJ 1KTVA 4PYDA 3RRGA 3CCES 3EGNA 2NSCA 3MEDB 1H72C 2ILYA 3AODA 3G82A 4G1IA 5RUBA 2BKPA 2D3UA 3GILA 3ENQA 1QAIA 3N9UC 5CCLA 4UT4A 3UVJA 1FRHA 5A8RA 3M8WA 3DU5A 4IFVB 4OHZA 4GMKA 4URSA 3SI8A 2QV6A 2DIVA 4H4KC 3RTVA 2VZ9A 2DXFA 1HBMB 3LAKA 5HO4A 3EM1A 5ETMA 2LKZA 2V2KA 5D0GA 1TL3B 2D9OA 1YVFA 4ZPCA 1A6LA 1KC8T 4B3MJ 1RE1B 4EBDA 5T7LB 4ITSA 5LXYA 1N36F 3GQCA 4DPWA 4FYVB 3Q8RB 4O44A 3NMRA 4ZVGA 2H54B 4N56A 3QJLA 1H74A 1R0AA 1U8SA 4C8OA 1Y0HA 5J1EA 1QAYA 4DN0A 2B56A 2OD6A 1RBOB 1IWAA 2KM8B 1RT5A 3RR8A 1IM4A 3NGRA 4PPDA 3G6XA 4XPEA 1X5SA 3M2UA 1U1RA 3MTJA 2VICA 2IJRA 4JI4F 3RUBL 2D74B 3BGUA 1PIEA 1S7HA 4MKYA 2KB2A 1J5OA 4I69A 3ILJA 4MMOA 3R27A 4IFYA 5ETOA 3QT8A 3DFEA 2IDLA 5CZXA 3BO2A 5K9FA 1U1KA 2YKMA 2EXUA 2CPJA 3DRSA 1TK8A 3C15B 4AXJA 2AJ4A 1FKOB 4L6V3 5L1KA 1PAUB 3M4XA 4HR2A 2Y9HA 4KE5A 1RTHB 4X62F 2RRBA 1YTYA 3R2DJ 2JLGA 5AE3A 3M8SA 2EWHA 4QR0A 4K0KJ 3TOQA 1CQNA 2PIIA 3CDWA 3TARA 4L72B 3V6DA 1U1OA 3FVYA 2AWZA 4C11A 4HACA 4DR6F 3WC2A 3H59A 3R8YA 4Y34A 3AXMA 3FFIB 2CA9A 4DV5F 5CH7B 4RW6B 3M9OB 3NCPA 1ZAVA 1MMNA 1RAJA 2VJUA 2COLA 5KFUA 3X1LB 4USWA 2HQDA 1UFKA 2YNGA 1VQSA 2BACA 5E3RA 3UR0A 3BM7A 4H4OA 5J2MB 3PVXA 1RSCA 4DR1F 2FQQB 4M5DB 1DHMA 2IA0A 4CQ1A 4ID5B 2DNPA 2OSQA 4DX7A 2MHEA 4G6VB 3BF4A 4ECWA 3LA0A 3MPVA 3CJ5A 5BR8F 5F8HA 2IRXA 4FXVA 2H1YA 2W2QP 3TA0A 3PIPQ 2KT3A 1BMQB 4WTOB 3HVRA 3PKYA 4J9NA 2VBZA 3H2LA 1M90T 5HJYA 1VQMS 1BQMA 1PCAA 1NDKA 3LOUA 1N5YB 2CUYA 2XMMA 3A4TA 3TAQA 4G1PA 2BE7D 1RXOB 2YXLA 2DXEA 2DK2A 3CD0A 4USVA 4L3KA 2QC3A 2HGLA 2FJVA 4AL5A 3V81A 3AD8C 2IYGA 1N5VA 3CCWA 4LIWA 3MEGB 2ZWPA 3MUVP 1HNZF 1R8AA 3I0RA 1T11A 1QTNB 4UQTA 2VJVA 4HHJA 1UKUA 4OYOA 2ZBQA 1MMLA 3QPIA 4ZIVA 1NLKL 2OPRB 5KFIA 2R7UA 2C2NA 4OZLA 1LWCA 2FHJA 1Q53A 5HVGA 4CT8A 3I9ZA 2C3OA 1U8WA 3PYGA 3NGSA 1SIWB 4N41A 2CRLA 1RWPB 4I7FA 4ECTA 2BM0A 1U02A 3EXCX 4Z7YA 2VD3A 1KSPA 1HBUA 3LP1B 3BN4A 3HT3A 2UXDJ 1R8BA 1FEEA 2MY7A 3SV3A 3DCAA 1U24A 3QAUA 1JLCA 1Z1ZA 3EGWB 4J91A 1CULB 2NREA 1HI0P 1WI8A 1UPPA 2XULA 2ZD1B 1XNQF 1WC3A 3QATA 1R8CA 5GAHI 5GMEA 3GJTB 1VQ5S 3TZZA 4FYDA 2M8HA 4F02A 3MM9B 2BYCA 4X4TA 3CJ3A 4ZPAA 2WONA 2DGQA 3VALA 1JKHA 1WSRA 2GVZA 2OSRA 1S59A 1YJWS 2DEJA 4DV6J 4UUWA 2MQQA 1B99A 3RAQA 5A2QY 2VBWA 5B0GA 1D1UA 4J9OA 2G2ZA 3BREA 2KO1A 5HAOA 3OHBA 4HTIA 4Q8EA 1AROP 1UZDA 5ETLA 4A46A 1KQGB 2BE2A 2C28A 3A8IA 1NJYA 5FIIA 2MQPA 4KAIA 2CQDA 1FRXA 2GQCA 3O8WA 2XCAA 2YQ0A 3DLGB 3BH7B 2IAJA 7FD1A 4HT5A 1PYSB 1IKVA 3KYLA 3J7AN 1WDTA 1X5TA 2CIMA 1IQTA 2L9DA 3HO1A 4Y6IA 4QW8A 1NB7A 5KFVA 2EKYA 3SFUA 3AOCA 1VLYA 4DCOB 3JTPA 2J9DA 2RD5C 4YHHJ 4NA3A 5J2PB 1CJKA 2HIYA 3DXSX 3PZPA 4WXWA 1IN0A 4DX5A 1T9UA 5CYMA 3CCVS 3H98A 4HDGA 2QMXA 4LRFA 3ENVA 3DLBA 3UCUP 5J2QA 2AX1A 1ZM9A 3NP5A 3SZ2A 3DRXA 3UR3C 4IUFA 4OZNA 3EVMA 2AMCB 1YJRA 1SJ4P 5H9FK 5AE1A 5LSRA 1GH8A 4AUKA 1B0PA 3WZ0A 4C0OC 1WNEA 3MUMP 1TFYA 4QYZK 2XG8A 3QWUA 1UWAA 3IS9A 2IHR1 3GTYX 2IC3A 3FZBA 3HSJA 2HNDA 3KLGA 2IBKA 2CNOB 2F1FA 4CTAA 1UAWA 1MN7A 4B3TF 1H73A 3DOLA 1TU0B 2EFOA 4NLPA 4ED5A 4M5MA 3HI9A 2JEJA 1NRKA 4NRUA 1LWEB 3MECB 3RZAA 2K7KA 2Z0GA 1NKCA 3JQMA 1U09A 3I5BA 4HI2A 2GC8A 1GQEA 4O3QA 2DY9A 2GVDA 2U2FA 4LVNP 2JWNA 4PCQA 4LSZB 1N88A 4C98A 2ZDPA 3V4MA 3KNAA 2NYIA 2QJ3A 1QSSA 2APOA 3FRZA 4LSNB 4RW4B 1JLFB 4YB7A 2HAIA 3H2VE 3KXDA 3JXOA 2G0CA 3HMJG 3HCXA 3I0SA 1C4AA 3ZTPA 4X4UA 1XEZA 2ZUGA 3TYTA 5G0RA 2KH9A 3SQOP 1S6OA 2JRSA 1FWLA 1HNIA 4PUOB 3OFHA 1HNWJ 1S0VA 1XERA 1UZHA 5CYQA 4B9SA 4FXWA 4K5SA 2XO6A 3D3BJ 2ERRA 4NOHA 3T5LA 4DQSA 1F6TA 1YX2A 2HNZB 1WKLA 3G8SA 4CRJA 1GAOA 4GRSA 5MLCV 2M0GB 1PKUA 3F73A 5THWA 1VQKS 4LF5F 3OR1A 1HMVB 4OYWA 2CQ1A 4DX6A 2DRAA 3EGVA 3MM7A 2KT2A 2WSEC 1S1WB 2ZFHA 1VQ7S 2HG4A 4PG7A 1CS4A 5F9NA 4LQ9A 1U47A 3S1TA 2QG9B 3VAFA 3M6VA 3IBWA 1DTQB 1DY3A 3TQEA 2XWXA 4C8YA 4WKRA 4DR4F 4KYZA 2B9XA 5KFFA 1RU1A 2J9DE 5A0YB 4ZLNA 3W64A 1UL3A 4I2QB 1AUSL 2MLZA 4OYIA 1LK5A 2G13A 2XC9A 3MURP 1EQMA 4DXLA 3JQJA 1PC5A 2M9KA 3DHXA 4LFBF 3C8YA 4DR7F 1U6ZA 3HP6A 1ZM2A 3HHKA 3G71S 1BWVA 5A2QU 3RW7A 4RZRA 3FUYA 3JYTA 2MDAA 3MPYA 2G0JA 3M2VB 2CQBA 5HMYA 4DQPA 1R43A 4AL7A 2VHGA 3DI6B 4LFCF 1Q5VA 1AYEA 1IVZA 2V8VA 1DLOB 2MKKA 2UVRA 5LOQA 3QMQA 4YDDB 4RPFA 3TO8A 5J2NA 3FBFA 3MMCA 3CC7S 2HYIB 3SV4A 1UJ6A 4E0DA 2WHOA 1B70B 1EB0A 2F4VF 4DFPA 2QO3A 3OJSA 2AGQA 1YJUA 4ANEA 4GO7X 1SJRA 4DV4J 1N48A 3EYZA 3GSIA 1VRTB 1NSKL 2DNYA 5DG9A 4IRKA 4K59A 5G4DA 2EVZA 1XR7A 3CMQA 3T19A 1TL7B 1AZSB 3KLHB 3C3LA 2E5HA 2KT5A 1EP4B 3FBCA 4L74A 1IWGA 3W8GA 4DV1F 1GXTA 2X1AA 4KSEB 3P49B 3PTWA 3NWGA 2HKEA 4DS5A 3DM2B 1FK9A 1SC4B 4LF2A 4DL0C 3AJ1A 4NMXA 4F3QA 3CJ0A 3NS5A 3CMAS 2VQEJ 1EAYC 4USKA 4IG3A 2VODA 4NMLA 1XNRF 1IKWA 1KOHA 5EGYA 3UCZP 3UPFA 3ZFVA 2LU2A 4TLRA 4OX6A 1TVRA 4CNZA 1RJJA 4CO3A 2ZUAA 1RT3B 4GVBB 3UDVA 1AW0A 4Q8FA 1KOOA 3IGVA 3MM6A 1SC6A 4WKYA 2WSFC 2JFKA 2I9SA 4ELVA 3HT0A 2ZC3A 2EW9A 2V94A 3CDAA 4ECRA 2OJ3A 4OI3A 3ZXWA 4DU7A 3OJUA 2VC1A 2IJFA 3ITHA 3B4MA 4DPTA 5D77A 3ZZPA 7FDRA 3GLJA 2EC2A 2K1RA 3MMBB 4O4GA 2HS3A 3R7BB 3CCTA 1QJHA 1CJUB 1AB8A 4MKAA 2VG6A 5M2UA 1T05A 2BW7A 5C25A 4DUZF 4F25A 2BE9B 2JJ4D 5D6GA 2CNLB 4K4UA 1TKXB 3GWCA 1NJWA 3VV2B 2ZBPA 5B08A 5DZ6A 4NYZA 5KG0A 3Q8UA 4D3HA 1BQNA 1HBOB 4DL3A 3CCMS 3DRPB 2HZCA 4K2XA 2BRKA 1NSAA 4DUTA 2NXEA 3ENWA 2GIRA 4Y2KA 2Q43A 4WU3A 3G6YA 4DR3J 3QJJA 1EQ0A 2DR6A 1TKZA 5HK4A 2HHXA 4C0HA 4LSLA 3IG1A 1NAQA 5E33A 2LDYA 2N7YA 3RR7A 2J8AA 1S9GA 5ITHA 1HW8A 1TUVA 2DNZA 4JB8B 1R6VA 2GX8A 2J0XA 2JOQA 3EZ5A 1VI7A 5EX3A 5KOXA 1RT7B 2B0GA 2VOPA 1J5EJ 1NPPA 2XSJB 2OHDA 2IY5B 4P9SA 3LTOA 2OPPA 2MHNA 1Y3JA 2BKOA 4KV8B 2FIUA 4CH1A 2O66A 2UXBJ 4RUHA 4IDKA 3LGNA 4G1QB 5CXTA 1X5OA 4OLPA 2CPDA 1I3OB 5KFJA 2Z2MA 1S0OA 4BWMA 4IO9Q 3ZTQA 4TNOA 2MZJA 4ZVSB 3DHWC 2X1FA 5B09A 4J9UE 2H65B 1TFWA 2YBVA 2CZVC 4ZIWA 4KGVB 3OT9A 5C24A 4WK3A 4B9TA 1XMOF 2J5AA 4P7TA 2CFXA 1FESA 2AJ1A 2Y3YA 4G3IA 2DH9A 5DRKA 1RI7A 4F67A 2Y8YA 4EEYA 5D0HA 4X66J 2K2PA 3A3OB 4DHVA 2BRLA 4BCAA 1HD0A 3ZNJ1 2HFVA 4TU8A 4HLBA 2IM3A 2BVZA 5IWAJ 4LVOP 2YWFA 2JEGA 3RW6A 3LALA 4Z7CA 2ZJPQ 1WEXA 4USHA 4PXCA 3CSKA 4KFBA 1HYSA 3MOZA 3W8PA 4ZS6A 1CVJA 4DPOA 3R2CJ 3MDFA 1IBKF 1IJEB 4ZJQA 3P4UB 1K0VA 1FI4A 2ZNZA 2FLPA 4LF9J 2IRUA 1OPZA 3GR1A 3P8BB 3UI3A 4DR5J 2BJEA 3OHAA 3LH2S 3BKFA 3T1HJ 1WC0A 2F9DA 3ONQA 3V2UC 5L9NA 2GZOA 1HQ2A 1M1GA 2GMHA 3AB2B 2KFYA 1QM9A 2AHOB 4CWBA 2E1MC 3FSIA 2ZZTA 5A8WA 3M9NB 3NXZA 2AU0A 5D4PA 1ZZFA 2HS4A 2H5JB 3BGRB 2OIHA 4OZ1A 1VR6A 1ZM4A 3BR8A 3KJVA 3FGVA 3W1YC 2H51B 4FKXA 4MAKA 5KT3A 1KKHA 1WKJA 1IKXB 3TJ9A 5I42A 3N5FA 4M5JA 4XTTA 1SL1A 1R6YA 2U1AA 4DQQA 3AHPA 4K4XA 1N34J 3C66A 3D7SB 3CJTA 4X4QA 5KFLA 3WX4A 2R9LA 1NH7A 3H20A 2YNFA 1LW2B 2KFNA 3VGSA 2B9WA 2E66A 2CVEA 1J27A 2QMUB 5DG8A 1KRPA 3MF5A 1P9YA 4HT7A 4GKJJ 2QFJA 1H6KX 3QT7A 4RBVA 5F8IA 3KTQA 4L75A 1RUSA 3ISND 3PW2A 1T94A 3ICLA 3OPKA 2E5JA 2XI3A 1WC5A 3QBCA 1UVIA 4E8UA 5E0OA 4Y0FA 2C2OB 3KLFA 1D9AA 1SBRA 2IVMA 4Q0BA 3M2RA 3K0JA 5ETPA 1V3SA 1HKAA 5ADZA 2R2RA 3MAAB 2P9CA 2R7VA 4U7CA 2FZCB 2JLFA 4ZP6A 1F1BB 1RT4B 3Q2TC 4X4NA 2J9EA 4X64J 3NGDA 2MEWA 1UW4A 3V4IB 1TMMA 4J9MA 3MD1A 5CD4H 1EJ7L 2MKSA 2ZZNA 1JK9B 2XHWA 1QE1A 3LW5C 1M5OC 4ZCMA 4CM2A 1TL5A 2KHDA 2FVQA 2O1PA 5D4LA 2RB7A 3U1NA 1TAUA 5HL7Q 4JI5J 3DU6A 1RWXB 4P10A 2AZ1A 4DZDA 2NS1B 2CYYA 4TLQA 3I82A 2HVEA 1KS2A 3DC2A 5U47A 4MFBA 2VIHA 3IWLA 2RU3A 3CDBA 4UOCA 4NXMF 4OI2A 2VFVA 1T03A 2GGPA 4J90A 2OTLS 4P2XA 3NGTA 2CZ9A 2FUG9 2CNKB 1UA1A 2HVDA 2G1DA 4LF7J 2B5JB 2AGOA 3JSYA 5GADI 4C8ZA 2DNHA 1G2EA 1LV5A 4P73A 1SUQA 1WC6A 1XN9A 2HHHJ 2OPSA 1AFIA 5F0UA 3W9HA 2KFZA 5EDWA 4ANCA 1WHVA 1KQFB 1VQ4S 4TU7A 1VC0A 4ECYA 2XI2A 4JI8J 1GTEA 3IR7B 5EHHA 1CBKA 4MH8A 1JB0C 3Q24A 4A4JA 1NXIA 2UUAF 5HJXA 4KKOA 1Y3KA 4PXEA 3TRGA 2CQPA 2Y0BB 2FJEB 2RUSA 3OL6A 1Y4ZB 5I3UA 3TANA 4C7QA 1RP5A 2ROPA 3DGPB 4DSIA 2HGMA 4FYYB 4RW7A 4YY3F 2PA3A 2FZGB 4RBTA 5GAGI 2OMOA 2C1EB 5D78A 2B8PA 1E6VB 1WG1A 1IKYB 3MPWA 2E1AA 3JB9k 1R27B 1S6QA 3TEGA 5DGAA 1EETB 3TAMB 3E8OA 3M7VA 1QY7A 1FD2A 1LW0A 2MGZA 4M5IA 3D5MA 2VH7A 2CPYA 3BSOA 4F4KA 2VKRA 1S1UB 4EGLA 3KUEA 3KDNA 3AQOA 2KHCA 4NYPA 1HWUA 4Z2XA 2LQBA 3G82B 1UEVA 1SL2A 4IRCA 2EK1A 3RRKA 3E3XA 3QZ7A 4K7QA 1LFPA 2BANA 4A8YA 3MZIA 3UVJB 3ADAC 5A8RB 1CEZA 3IR5B 5DJBA 4DF8A 5HLFA 1MMDA 2O3DA 4ED0A 2WVDA 1WWHA 4RX6A 3W2VA 4K0KF 2CQCA 3CJKB 1LWFA 4RUAA 1T9TA 4EI2A 1RTIB 1WEYA 4EMDA 1S1TA 2VB6A 2AGPA 1UW9A 3T9ZA 1SI9A 3IFEA 3R6GB 3BSAA 2VG7A 3J7ZT 2ZVIA 1RA6A 3FCVA 2QL5B 4FPRA 2NZ4A 1UTAA 2XO7A 1S1XB 4J9RA 1TTHB 2JDJA 2W2PP 3D68A 1U1PA 1PYTA 4QU6A 1R0AB 3QSIA 2R4FA 5KFXA 1ZH5A 3PRVA 3NWRA 5J1EB 2OD4A 1SVDA 2V68A 5F8GA 2XMUA 1RT5B 4RNMA 3TUPA 5D4NA 1SKUB 1FTRA 3TR5A 3KJNB 1P27B 2UUCJ 1Q8BA 2DHXA 5KFQA 1F3FA 1RBLA 1FX2A 3OFEA 1RZMA 3M2UB 3RG6A 4LF8J 2DGTA 1YJTA 3KDOA 1YJ9S 4JI3J 4IQXA 4F4AA 3ENAA 3EICA 5HVHA 1C2PA 3H90A 3MR6A 1UA0A 1N8RT 1HQEA 2Y0SD 3HFKA 5MAOA 1B0VA 1HNXJ 3FC9A 4NI2B 2PEHA 2I5JB 3LWMA 1Y10A 1SV5B 1K73T 3OFFA 4H54A 1Q7YT 2HSEB 1WSVA 1UFWA 4RU2A 2HMIB 5C2CA 2CZ4A 2ZBCA 2J0SD 1H38A 3HDSA 5IV3A 1D0EA 3IRWP 2MQMA 4NPOA 4CLTA 2YKAA 3RAMA 2MPUA 3MM5A 2P2CB 3HK2A 4F50A 1M5VC 2F4FA 3HD1A 3FQKA 3KK3A 3PIOQ 3M8QA 4FZVA 3I5CA 5J1NA 1HIYA 2DISA 3DKDA 3CTRA 2VDIA 3EWGA 2LXFA 1S7IA 4C11B 4DFMA 1L5UA 4CDIA 4OV1A 2CPFA 4BLGA 4ED3A 2XS7A 2LDIA 3Q8VA 2V50A 2PI5A 2RAQA 1OY6A 1HBNA 2FHMA 4P52A 2PFFB 2ZH1A 2ZHOA 4ENOA 5CCMA 3EPGA 1QVFR 4IQMA 2VDHA 2AT1B 4U7UK 1GMUA 2J0WA 2QTWA 2UXDF 2FDNA 2DO4A 1I51B 3BJYA 4CYUA 3C2PA 3I5AA 4HHHA 5E7OB 1XBWA 4E98A 5A6PA 1ZPWX 1KD1T 2YX7A 3HVAA 1Q82T 2E9RX 4O3OA 2IBOA 5F41A 2JFDA 3SXLA 1LK7A 3CC2S 5F3ZA 3ZTOA 2Q6CA 4Z37A 2KJVA 1NO8A 3T1YJ 2JNJA 1QAXA 3BB5A 1S97A 5EUHA 3GG0A 5C5JA 2N82B 4KHMA 2RRAA 3JAMU 1VK8A 2QA2A 1TUWA 2X7IA 1NSPA 2VONA 4OJGA 1U1MA 1H3DA 4ZPVR 3U27A 1SJQA 9ATCB 4CNYA 3R5AA 1FNXH 1HARA 2CJ9A 4WF9Q 3QFHA 4FVCA 4IG0A 5LMNJ 2VA2A 3I0RB 1N32F 2NXCA 3J81j 1VFJA 4LF4J 2CPHA 2AX0A 4FVMA 2VV5A 3MGJA 5IV4A 2ZKUA 4OX9J 2L41A 3G9CA 1LWCB 3BS9A 1UJ5A 2K3KA 3B4DA 4J9KA 1NB2A 3MEDA 2Y1JA 3T6JA 4GC7A 3DRRB 2M2BA 5KT2A 4EYIB 2B7CB 2M5YA 2MMYA 5K8MA 2Q1LA 3GIKA 5E3PA 1KTQA 2DRBA 3BGOP 1RAHB 2PFDA 2DVIA 1I5OB 2KKHA 3M8PB 3PO5A 1HBUB 2Q3PA 3BSNA 2ZH2A 2DNLA 5FDLB 2MKCA 2HQGA 1HBMA 1Y9OA 1JLCB 1F5BA 3THTA 2DH7A 2KG0A 1X4EA 4EK2A 2VF3A 2HRYA 5T7LA 3KJFB 4F4WA 2JVOA 1XK8A 3BV8A 3KOAA 2JC1A 2VASA 2B6AB 2OTJS 4WFXA 3PO4A 1NPRA 3KLEA 1LOUA 1FJEB 4RLEA 2P6TA 2V8DA 3P5TL 3LQVA 4RKUC 3SSSA 3CJSA 4J5OA 3H8YA 2MTLA 3T9NA 4F04B 3KNGA 4DL5A 5KG3A 2XMKA 2GVZB 4ELUA 3KUHA 1ZA1B 5ETRA 4JI6J 4LT6A 4M5KA 1S6PB 4MK7A 1WORA 2FLOA 1PG5B 3IR6B 4TVAB 2F40A 4C3LA 4FYXB 2VA3A 1H2TZ 1NJZA 1ZETA 2WVCA 1PBAA 2BX6A 2BJ9A 2VFRA 3GYGA 5IT0A 1K47A 2BE2B 3UD5A 3J7Z5 3SIPB 5CABA 3AOBA 3G2XA 5EWFA 5HROB 2ACMA 1G1XA 3BYPA 2ZJQQ 2ALYB 5CD4A 4NEZA 4DPYA 2N7CA 4U96A 2AEFA 3FRYA 3U02A 1XMQF 2AYBA 1DRZA 1S1VA 4ZMMA 2JEFA 2XZDB 4NLSA 1FKOA 4NL5A 1OYDA 3B54A
chains in the Genus database with same CATH topology
1BHNA 2BEFA 2HVDA 1UCNA 3Q89A 3B6BA 3FCVA 3ZTPA 3EMTA 2DXFA 1NDLA 3MPDA 3EM1A 1PAEX 4DZ6A 1NPKA 4O0NA 2VU5A 1W7WA 4ANDA 1LWXA 1MN7A 4F36A 1NCLA 1S5ZA 3VGVA 1BE4A 1NB2A 4UOGA 2DYAA 3BH6B 1NSQA 1S57A 3FBCA 3PRVA 5CAAA 4UOHA 2DXDA 2NCKL 1WKKA 1NLKL 1XIQA 4ANCA 3VGSA 1HHQA 3BBBA 3ZTOA 2CWKA 1F6TA 3L7UA 1WKLA 3R9LA 1HLWA 3FBBA 5BXIA 2BX6A 4HR2A 1S59A 1KDNA 4WBFA 4DI6A 1NHKL 3VGTA 3WX8A 1PKUA 1HIYA 4C6AA 3DKDA 1U8WA 3ETMA 4UOFA 1B99A 3NGSA 3BBFA 1F3FA 3PJ9A 4FKYA 2HURA 1XQIA 5CABA 1ZS6A 2DY9A 1NDCA 1MN9A 3EJMA 3FBFA 3NGUA 3VGUA 1NUEA 3G2XA 3ELHA 3Q86A 3Q8VA 2AZ1A 3EVMA 1B4SA 1NSPA 3JS9A 1EHWA 3GPAA 3FBEA 4F4AA 2HVEA 3ENAA 3ZTQA 4EK2A 3EICA 3NGRA 3Q8YA 4S0MA 4W98A 1K44A 3FCWA 3DDIA 3Q8UA 2ZUAA 4KPCA 3EVWA 5IOLA 1LEOA 4ENOA 3VVUA 1NDPA 3EVOA 3FKBA 3ZTRA 1NDKA 2B8QA 1BUXA 4ANEA 3FC9A 3GP9A 5C7PA 3BBCA 1JXVA 4DUTA 3BH7B 3ZTSA 3Q83A 1VYAA 2B8PA 3NGTA 3EE3A 2DXEA 1NSKL 3B54A 4CP5A 4FKXA 3VVTA 1WKJA 2AZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHN A;  2BEF A;  2HVD A;  1UCN A;  3Q89 A;  3B6B A;  3FCV A;  3ZTP A;  3EMT A;  2DXF A;  1NDL A;  3MPD A;  3EM1 A;  1PAE X;  4DZ6 A;  1NPK A;  4O0N A;  2VU5 A;  1W7W A;  4AND A;  1LWX A;  1MN7 A;  4F36 A;  1NCL A;  1S5Z A;  3VGV A;  1BE4 A;  1NB2 A;  4UOG A;  2DYA A;  3BH6 B;  1NSQ A;  1S57 A;  3FBC A;  3PRV A;  5CAA A;  4UOH A;  2DXD A;  2NCK L;  1WKK A;  1NLK L;  1XIQ A;  4ANC A;  3VGS A;  1HHQ A;  3BBB A;  3ZTO A;  2CWK A;  1F6T A;  3L7U A;  1WKL A;  3R9L A;  1HLW A;  3FBB A;  5BXI A;  2BX6 A;  4HR2 A;  1S59 A;  1KDN A;  4WBF A;  4DI6 A;  1NHK L;  3VGT A;  3WX8 A;  1PKU A;  1HIY A;  4C6A A;  3DKD A;  1U8W A;  3ETM A;  4UOF A;  1B99 A;  3NGS A;  3BBF A;  1F3F A;  3PJ9 A;  4FKY A;  2HUR A;  1XQI A;  5CAB A;  1ZS6 A;  2DY9 A;  1NDC A;  1MN9 A;  3EJM A;  3FBF A;  3NGU A;  3VGU A;  1NUE A;  3G2X A;  3ELH A;  3Q86 A;  3Q8V A;  2AZ1 A;  3EVM A;  1B4S A;  1NSP A;  3JS9 A;  1EHW A;  3GPA A;  3FBE A;  4F4A A;  2HVE A;  3ENA A;  3ZTQ A;  4EK2 A;  3EIC A;  3NGR A;  3Q8Y A;  4S0M A;  4W98 A;  1K44 A;  3FCW A;  3DDI A;  3Q8U A;  2ZUA A;  4KPC A;  3EVW A;  5IOL A;  1LEO A;  4ENO A;  3VVU A;  1NDP A;  3EVO A;  3FKB A;  3ZTR A;  1NDK A;  2B8Q A;  1BUX A;  4ANE A;  3FC9 A;  3GP9 A;  5C7P A;  3BBC A;  1JXV A;  4DUT A;  3BH7 B;  3ZTS A;  3Q83 A;  1VYA A;  2B8P A;  3NGT A;  3EE3 A;  2DXE A;  1NSK L;  3B54 A;  4CP5 A;  4FKX A;  3VVT A;  1WKJ A;  2AZ3 A; 
#chains in the Genus database with same CATH topology
 1RTH A;  3TAP A;  4O3S A;  2EPI A;  2AJQ A;  5CYM B;  5HQ8 A;  2YQ1 A;  4RW8 B;  1R3N A;  5KFS A;  2QIF A;  2C22 A;  3NG8 A;  5FD1 A;  3W62 A;  2YKN B;  2F7V A;  1DTT B;  4DS4 A;  4QW9 A;  1N36 J;  4NE9 C;  1KNZ A;  3FFI A;  2XTJ P;  1WEL A;  2WOM A;  1DQ8 A;  1NK6 A;  3EJM A;  2ASJ A;  3DMJ B;  3KLI B;  4X4R A;  2VPZ B;  1RBA A;  2KM8 C;  4U67 Q;  5KFG A;  2GJF A;  2H3E B;  4AQY J;  4QWC A;  4Q2L A;  3Q8Y A;  1FA0 A;  2LEA A;  2X3G A;  2IC3 B;  3DDI A;  2IM2 A;  1YRT A;  5J2M A;  5BJR A;  1RWM B;  2GV1 A;  1FHT A;  2YWG A;  4M5D A;  4I6W A;  4BC9 A;  3EZU A;  4F4Y A;  4QU7 A;  1U49 A;  2AW0 A;  4ID5 A;  3GCW P;  1GX6 A;  3BGL A;  3DOK B;  4JI4 J;  4U7U D;  4WE1 B;  1ZOT A;  4CLK A;  1VOM A;  3F44 A;  5BYQ A;  4AND A;  1NCL A;  1SC3 B;  1JLA B;  2OGU A;  2QGF B;  2ZNY A;  1FO1 A;  3A12 A;  2IDE A;  2DIT A;  4HYK A;  1SPB P;  3MMA B;  3V6J A;  4URQ U;  3IAM 9;  4HEA 9;  4CI0 B;  1N5Y A;  1FRJ A;  1K0T A;  3VGT A;  4UW2 A;  4PWW A;  3NS6 A;  2GIF A;  2XMW A;  4O4R A;  2CAD A;  2FC8 A;  3A13 A;  4X62 J;  1RAG B;  2FGC A;  1P9Q C;  1KQK A;  3AD7 C;  3MEG A;  3BQ2 A;  4MT1 A;  4OZ5 A;  3CME S;  4ELT A;  3Q2S C;  1HI1 A;  2YVS A;  3CNQ P;  5KFZ A;  4X4S A;  4HH0 A;  2DTJ A;  4DWI A;  4WZQ A;  2G1H A;  2OPR A;  3R1L A;  1HNI B;  5C42 B;  1YIJ S;  2LQ8 A;  2ADC A;  1LKZ A;  3A1Y G;  2HFU A;  5CYQ B;  1RT1 A;  4DV4 F;  2D7S A;  1SH3 A;  1MU2 A;  4GC6 A;  1HPZ B;  1KLM B;  4DV5 J;  4QWA A;  1YK9 A;  3ET6 B;  2ZHA A;  2R8I A;  3MFI A;  2HK3 A;  2QMW A;  1YZ6 A;  3VAG A;  4DV3 F;  3AB4 B;  3MM7 B;  2DIU A;  4AYB D;  1VQ8 S;  2HFO A;  2H4Y B;  4ILL A;  8AT1 B;  1U7L A;  5B0F A;  3QO9 B;  3D28 A;  1YDL A;  3AXK A;  2LA6 A;  2O67 A;  3B8H A;  4O0I A;  4X4V A;  2IIH A;  1HWJ A;  5IQ6 A;  3HJF A;  3HHL B;  2VPY B;  1NK8 A;  4DL4 A;  1YRX A;  2V2Z A;  2KRR A;  1WJ9 A;  2B9Y A;  3US5 A;  1XC9 A;  5CZV A;  1C0U B;  3FMB A;  2ZD1 A;  2HQ3 A;  2HS0 A;  2VQE F;  1FRM A;  4FN5 A;  5BR8 J;  4CO1 A;  2V6A A;  2UUB F;  3IA0 A;  3CCU S;  2EC0 A;  2C3P A;  1K9M T;  4UY8 T;  1SQE A;  4IR1 A;  4Y2C A;  2BM1 A;  3F0N A;  1TP7 A;  3FZ2 A;  3M1V B;  4OFZ A;  3AT1 B;  3KJQ B;  4C8K A;  2DGW A;  5KG7 A;  1IBM F;  3LP2 A;  3JYT B;  4C3M A;  1FDB A;  2I1R A;  2BJ3 A;  4P72 A;  2E7X A;  5BYS A;  2YWE A;  4JI0 J;  5HBM B;  1F5A A;  2QX0 A;  2WK4 A;  2DNQ A;  3S8S A;  4LF6 F;  3VAH A;  2M7S A;  2BR0 A;  2B4P A;  2NCK L;  5J2N B;  1X0P A;  2HWH A;  1QSL A;  4I0W A;  2DT9 A;  2GJI A;  4F0H A;  3I96 A;  2KN4 A;  1L3T A;  1T3O A;  2DBB A;  4EO6 A;  4OI0 A;  2BUN A;  4OIX A;  3PXG a;  2FD2 A;  5K14 B;  2KVI A;  1Z2Z A;  2XZT B;  3H42 A;  1EHW A;  2AV5 A;  2XQC A;  4WYL A;  4NLG A;  4DR2 J;  4NWB A;  1ZZN A;  2C3Y A;  5IOL A;  1C1C B;  3NCR A;  5J2P A;  5KFW A;  2QZ8 A;  4DL2 A;  1DQA A;  4NLY A;  2YNI A;  2C2Z B;  1R89 A;  3MCN A;  4NCB A;  2W2N P;  2RF2 A;  1B64 A;  5HAN A;  2PMH A;  5LM7 E;  4AL6 A;  2HVH A;  3GFX A;  3CCS S;  3SEO A;  2XMV A;  2XMA A;  3O6Q A;  4DR3 F;  1NK5 A;  2CQ0 A;  1FK9 B;  3T1A A;  1HL6 A;  1N33 F;  3VHQ A;  1MSW D;  1XNQ J;  4KBI A;  3Q8Q B;  1JJC B;  2V4Q A;  2ROE A;  4BC7 A;  4HKQ A;  1YKW A;  4N47 A;  4J9V A;  5ETS A;  2D3O 1;  1TVR B;  4RUB A;  4DOZ A;  4BBY A;  2DKO B;  3D6T B;  2A10 A;  1SC1 B;  4NA2 A;  3BZQ A;  3SCJ E;  1ZYQ A;  1B7Y B;  3R97 A;  3MM6 B;  1J5E F;  2W25 A;  2MLY A;  3PW4 A;  2IMW P;  2UXB F;  2IMO A;  1FEH A;  2YQ3 A;  3CCQ S;  2ASL A;  5AE2 A;  3PJW A;  4C0B A;  3V6K A;  3ITH B;  3UQS A;  3SQG A;  3CCZ A;  1LWE A;  3C6T B;  4O4G B;  3MHY A;  1RKI A;  4CCH A;  1Q81 T;  1DAR A;  4V19 X;  3W65 A;  3N6N A;  2NXJ A;  2NUU G;  4C8M A;  4XDC A;  2VG6 B;  4RU9 A;  1T05 B;  5C25 B;  4KPY A;  1RHQ B;  1YGY A;  3PDN A;  1SQF A;  3G8T A;  4MYU A;  3SCI E;  4LSN A;  1RTD A;  4RW4 A;  1JLF A;  3ZZT A;  2VPX B;  2QYG A;  3GR0 A;  4I2P A;  2RKI B;  2L48 A;  4IOA Q;  2BV3 A;  2UXC J;  4NEY A;  4ECZ A;  1RT2 B;  4ZPB A;  2UUT A;  4JP8 A;  2VOO A;  2OH2 A;  1SIZ A;  2RIJ A;  2GO8 A;  3J7Y I;  3WQP A;  1IR2 A;  2HVI A;  4PUO A;  1EZZ B;  3D9B A;  3PAC A;  2FVP A;  1M5K C;  2HZA A;  3EX7 B;  3GB0 A;  3CUN A;  5JVG Q;  3AFG A;  1WHX A;  3ZTR A;  4QIW D;  2AQ4 A;  3IG1 B;  3RBD A;  2A6O A;  5KFO A;  1CJV B;  1S9G B;  2XYG B;  2KVQ E;  3GJR B;  3V6H A;  5B0B A;  4HTJ A;  2BQ3 A;  3GZ7 A;  2BQU A;  4DV0 F;  2KL8 A;  2MJU A;  3R3T A;  4HL9 A;  1DAX A;  4K5R A;  1HMV A;  3D1H A;  3ZZZ A;  1F2H A;  1YBT A;  1U45 A;  1T8E A;  4QCL A;  1U2F A;  4TXS A;  3ISN C;  3UD3 P;  2YKP A;  1HA1 A;  4J9S A;  2HHW A;  5CAA A;  1N34 F;  4KIA A;  3F41 A;  4JI2 F;  4ER8 A;  2MZQ A;  4NLR A;  2OEK A;  4PQU A;  3HLU A;  3QYY A;  2HRU A;  1RHU B;  1ZPV A;  1NND A;  3KLV A;  4QPX A;  3LGM A;  5KFP A;  4X4O A;  1Q5Y A;  1OO0 B;  1X9W A;  1AUD A;  4I2Q A;  4F4X A;  5D3G A;  2JH3 A;  3FBE A;  4LBP A;  1PC4 A;  2GNK A;  4ECU A;  1N5S A;  1T7P A;  3BKT A;  2DGS A;  3JQK A;  1UVM A;  2I6W A;  1LEO A;  4ETX A;  4C9D A;  1IR1 A;  2VG5 B;  3TX0 A;  3AQP A;  2HW3 A;  4M5N A;  2XS5 A;  3TZW A;  4CLS A;  4OJ3 A;  3M2V A;  2V9W A;  2LEP A;  3DI6 A;  4CH7 A;  5GAH U;  2CJA A;  3HSZ A;  2E5G A;  1JLE A;  5HMX A;  3VVT A;  4MYT A;  1PIL A;  1DLO A;  4NYO A;  3NOC A;  4JV5 F;  4LRC A;  1LWX A;  1BXN A;  4YR2 A;  1YBA A;  4QYR A;  4X64 F;  4EZ9 A;  5K5M A;  1UEU A;  3K17 A;  3IRX A;  3HHD A;  2V69 A;  4UY8 5;  2Y1L B;  2FLN A;  2F8H A;  3TZY A;  4ZOS A;  1WF1 A;  1U26 A;  4L76 A;  4WFB Q;  2QL9 B;  4ZCK A;  1Y7P A;  4UOF A;  3POT B;  1Q86 T;  2YNH A;  2YKO A;  6FDR A;  3OUY B;  3QT6 A;  3HPO A;  4LF5 J;  2E44 A;  1P1T A;  3HSG A;  2WW8 A;  5J1P A;  1G7C B;  2AYE A;  1AZS A;  3LAN A;  4RW9 A;  3GSD A;  2AKW B;  5BYR A;  1EP4 A;  3D0I E;  2EEY A;  2BBE A;  4WU2 A;  2ZEJ A;  1U2C A;  3H5Y A;  1B3T A;  2BQR A;  4ZVU B;  1SB6 A;  1TKT B;  3RJM B;  1T0T V;  3DM2 A;  2YNF B;  3ISZ A;  1U4B A;  1BHN A;  2BDP A;  4DR4 J;  5A6W A;  2V4J B;  1JJ4 A;  3NKY A;  3U7J A;  3GYN A;  1BWE A;  4LF7 F;  3CUL A;  3OSN A;  5DM7 Q;  4C8L A;  3DDK A;  4LR7 A;  3M8Z A;  4KHP J;  2CKW A;  1W2I A;  2QL7 B;  3TEH B;  2HK2 A;  2BZ2 A;  4DDF A;  1A7G E;  1RT3 A;  4LFB J;  5HMW A;  3BBB A;  4U6P A;  2HVZ A;  3RGI A;  3IWX A;  4NAS A;  3KLF B;  3UW1 A;  4YEA A;  4RL1 A;  3M2R B;  4C6A A;  5DDQ C;  4JI8 F;  4CO4 A;  3AJ2 A;  4LJM A;  1RAC B;  3R6L B;  4CM0 A;  4LFC J;  3VAI A;  2ZH4 A;  2UZA A;  4IYQ A;  1M1K T;  2G2O A;  3HHE A;  3AA8 A;  4JV1 A;  4W98 A;  4TYA A;  2R7T A;  3K59 A;  1S48 A;  3AH6 A;  3OTE A;  5T14 A;  2OPQ B;  3TJ8 A;  2ATL A;  5EN1 A;  5LSO A;  2F4V J;  1T9V A;  4O3R A;  2DHA A;  4NLT A;  5L9X A;  1VCT A;  4KH1 B;  1D8Z A;  1HWI A;  1T9X A;  4IO1 A;  3C19 A;  2UVU A;  1FD8 A;  1QE1 B;  1D09 B;  3MPD A;  3MR2 A;  2KU7 A;  1OJ4 A;  4OHV A;  1IXK A;  1TKX A;  4TQR A;  3PYE A;  2VQF J;  3NCQ A;  2DNG A;  1WC1 A;  1Q95 G;  4WP8 A;  2W9C B;  5L39 A;  2DHS A;  4ZJO A;  1QVG R;  1VHI A;  3MFH A;  3DRP A;  1LNQ A;  4H4M A;  1VIS A;  3RU0 A;  3JSM B;  4KGK A;  4MFB B;  5F3T A;  3I32 A;  5A76 A;  4LRD A;  2HBY B;  2DPI A;  3R7N B;  2IA6 A;  2I38 A;  3QID A;  2NPF A;  1X4A A;  1T95 A;  2DGV A;  1T03 B;  4B3R F;  4USU A;  5LSL A;  4C48 A;  4LMZ A;  2DHH A;  3DYA B;  2F3J A;  2QYC A;  3E51 A;  2ADB A;  2K7J A;  1IR0 A;  3TNV A;  3DLL Q;  4NLU A;  1APS A;  3HHL D;  4JOU A;  4OYM A;  2HBQ B;  5DG7 A;  5H1S V;  3MM8 B;  5ETV A;  2XSJ A;  3CB4 A;  4Q5V A;  2GJ2 A;  2RJZ A;  4KV8 A;  4EWT A;  4P6Q A;  1QD1 A;  5IT9 Y;  1HHS A;  4G1Q A;  2E5L F;  5SZT A;  2DEI A;  5HP1 B;  1KP6 A;  4KKO B;  1JXE A;  1MW7 A;  1FXR A;  1ELO A;  4D3G A;  2PC6 A;  3PFO A;  2QA1 A;  2NPI A;  5I3U B;  1IBL F;  3BPS P;  1BY9 A;  3D3C J;  3TVY A;  3L4B C;  1X4B A;  1RWU A;  1JX4 A;  2O5D A;  5H9E J;  1I94 J;  2CNN B;  3PYF A;  4R8U B;  3W3S A;  2QFI A;  4DPX A;  1Z2L A;  4W90 B;  1HWL A;  1CG2 A;  3NOG A;  3W61 A;  2Z8Q A;  4XO0 A;  4J7C A;  4LF8 F;  2VKZ G;  1GFW B;  1D8Y A;  2RH3 A;  1S6Q B;  4XDD A;  3VVU A;  4NZ0 A;  3EVO A;  3M32 A;  3DLE A;  4PWD B;  4AT1 B;  3TW0 A;  1LW0 B;  3RRH A;  2J6U A;  3FMW A;  1HI8 A;  5I3P A;  2NUH A;  4DJB A;  1S9E B;  2C2M B;  5GAE I;  4FXD A;  1VMB A;  1PBU A;  2J9C A;  2R2U A;  4ZDN A;  3QNW B;  1RHR B;  2ZOF A;  3CW2 C;  2F9J A;  5DDO C;  4ED2 A;  1REV B;  2WVE A;  3HVT B;  3IBF B;  3D6H B;  2W24 A;  2R3V A;  3H25 A;  1EAR A;  1TQL A;  4NCG B;  3J81 Y;  2FJA B;  1SJ3 P;  3THV A;  3HJV A;  2IYI A;  3MWB A;  1R0C B;  2RQ4 A;  5L8R C;  4USM A;  2XB2 D;  2HUR A;  3FNN A;  1IKX A;  3VF0 B;  2XMJ A;  1JNR B;  4JV2 A;  2VPW B;  4B3O B;  4ZVE A;  2C2R A;  3PRD A;  2QSF A;  2YKQ A;  5KT4 A;  4PR6 A;  4ERD A;  5E3A A;  1YRU A;  3H5X A;  2VBX A;  4TU9 A;  3QZ8 A;  2VG7 B;  5DS7 A;  1TK0 A;  4E2F B;  5M2R A;  3DGV A;  1X5P A;  2WRM A;  1FT8 A;  5KFT A;  9RUB A;  2R7R A;  4AD6 A;  2CPE A;  4ZN3 A;  4OX7 A;  1U1Q A;  2J6S A;  1FKP B;  4I6A A;  2R8H A;  2P9E A;  1Q8L A;  2JSX A;  1WDD A;  2MZR A;  1N52 B;  3L95 X;  2XM3 A;  1HQU A;  3O44 A;  4QWB A;  3D4J A;  1H2V Z;  1JWW A;  1QLN A;  4QBU A;  1NK7 A;  1MRO B;  1WG5 A;  2B7B B;  4HI1 A;  5DQI A;  2CJQ A;  3MAA A;  5ETQ A;  2FY8 A;  1HQE B;  3OFG A;  1QUV A;  2DR8 A;  1IBK J;  2GS8 A;  4KGX B;  1RT4 A;  3N28 A;  2D69 A;  1RWO B;  1HNV A;  5KT7 A;  1IUJ A;  5DDP C;  2H4W B;  3MR5 A;  2GQQ A;  4WFZ A;  3FCW A;  3N6M A;  1S72 S;  4KPC A;  1B7F A;  5IZH A;  1JMT A;  1OS5 A;  3GMG A;  4RR5 A;  2Q66 A;  3UN5 A;  3QIP B;  2Y1I A;  2FC9 A;  3MPU B;  4WCE Q;  3K58 A;  2LP4 A;  2A3J A;  4JI1 J;  3RAX A;  3MM5 B;  4P74 A;  1X31 C;  3GFY A;  3E2E A;  3M6X A;  2QA4 G;  4PAB A;  2R8K A;  1TKD A;  5B0C A;  1EIY B;  3CO0 P;  3TJA A;  3VZH A;  4OX9 F;  3M8Q B;  4DBQ A;  2QSW A;  1GTH A;  3KK1 B;  3SCK E;  4XIU A;  2PE8 A;  2QRR A;  1LXN A;  3TQ1 A;  1JJ2 R;  1WOS A;  4DV7 J;  4CLL A;  2HLT A;  1YWX A;  3FBB A;  1F3V A;  4JBC A;  1GMW A;  2RDD A;  1JLG B;  2DGU A;  1UP1 A;  2DCU B;  2QLJ B;  2MQL A;  1JNZ B;  3K8V A;  1KVK A;  5KAK A;  2H5I B;  3DNC A;  5F8M A;  3SYZ A;  4A8W A;  4OJ1 A;  4DV2 J;  3S01 A;  3SDE B;  5HN0 A;  2RSQ A;  3E01 A;  3WBZ A;  4B9U A;  3D2W A;  2AYM A;  3D1O A;  2XLK A;  2V8G A;  2V63 A;  3N4W A;  1RT6 B;  2GIQ A;  4EZ6 A;  5LL6 d;  2CPZ A;  3UD4 P;  2EBE A;  3OR2 B;  3W2W B;  1RTJ A;  3LO3 A;  2V67 A;  5AXK A;  1DQ9 A;  2RHS B;  1UVJ A;  5AXM A;  1F9E B;  4W92 B;  2ZH3 A;  1MNE A;  4WII A;  3OVS A;  2K06 A;  3J7A 1;  1S57 A;  1C0T B;  3K5L A;  4X65 F;  3LF0 A;  4F3M A;  2OEJ A;  3VR1 A;  4RNF A;  2GML A;  1KLN A;  5B0D A;  1KDN A;  1SH0 A;  4Y2A A;  3MCS A;  2DNM A;  5KG5 A;  3LAM A;  1E6V A;  2X3D A;  5AXN A;  2XLJ A;  4OYB A;  4LUB A;  1OSD A;  3BGF A;  4CH0 S;  3NY0 A;  3NMA A;  1KN6 A;  1EET A;  2QT7 A;  4A8S A;  1UMJ A;  2E5I A;  3TAM A;  2C2E A;  4LRE A;  3CJR A;  2XNR A;  4K4Y A;  3G6V A;  4I6Y A;  1S1U A;  1VRU B;  4ZP9 A;  1JLQ A;  1VYA A;  4YB6 A;  3OTO F;  4R25 A;  4DUY J;  4NXM J;  2CQ4 A;  2WAQ D;  2ZWO A;  4MK9 A;  2GAG C;  5HI7 A;  2ZIT A;  4OV6 A;  3I9V 9;  1VQ9 S;  3PJX A;  4YDX A;  4QIF A;  4N7T A;  4LIR A;  2KZZ A;  3J81 U;  5L1I A;  2JX2 A;  4GKK F;  2R42 A;  3PEJ A;  1K8A T;  5IFM A;  4YS2 A;  3VCD A;  2EG2 A;  3CJK A;  3LP0 A;  1VBY A;  1RTI A;  3H4B A;  1HLW A;  2ZH7 A;  4ZHR A;  3DXB A;  1WOO A;  4DCJ B;  1K1Q A;  2BJ8 A;  2ZZM A;  3C6U B;  4YR0 A;  1F0X A;  4GVL A;  2PI4 A;  2RDI A;  3WIV A;  4EYH B;  4M1K A;  2UUA J;  3WHI A;  1S1X A;  3KLE B;  3Q8S B;  3EGZ A;  4MJK A;  4K4T A;  4ED4 A;  1IM6 A;  1ROF A;  2RHQ B;  1UFL A;  3EVW A;  5L1J A;  3CD5 A;  4AQY F;  1NDP A;  1ZTT A;  3OXG A;  1NME B;  4KHR A;  3UNG C;  3K7R A;  3MEK A;  1HR0 F;  3R1H A;  3BBC A;  3CD6 S;  2B4U A;  2M3D A;  5DM6 Q;  4YY3 J;  2V4R A;  1P8G A;  1CJT B;  3H7H B;  3KHR A;  2HFS A;  3PCO B;  2HWI A;  1NBE B;  4X84 A;  4NA1 A;  3PM9 A;  4K4V A;  2A2D A;  2XMT A;  2G0I A;  4EBC A;  2BXJ A;  2CJY B;  1N5T A;  2CG8 A;  3PHE A;  1N6Q B;  1HFE L;  2W8K A;  3PX6 A;  4U8V A;  5KTQ A;  4NRT A;  2FJB B;  3M8Y A;  2DO0 A;  2YH1 A;  3GV5 B;  4MKV A;  5L46 A;  2ILZ A;  1C1B B;  2WVB A;  2VC0 A;  3QJP A;  1F9H A;  1RWV B;  4NI2 A;  2I5J A;  4ZLP A;  2DD8 S;  1SV5 A;  2G9O A;  2HNY B;  3DDN A;  5KFD A;  3BKU A;  1UWB A;  2LLZ A;  2Y1R I;  1XQI A;  3IM9 A;  1FXD A;  1S1V B;  1MN9 A;  3C14 B;  2HMI A;  1FJG J;  1PJ5 A;  3PR4 A;  3AY0 A;  4I68 A;  1VQN S;  4DMZ A;  3PKM A;  2FTR A;  5A8K B;  5KT6 A;  4LQ3 A;  1VQY A;  5DDR C;  3VQS A;  3THP A;  1M5H A;  3KFW X;  5IQQ A;  2EFN A;  2W1B A;  3EDR B;  2W01 A;  2LA4 A;  5E5N A;  1RAB B;  2Q6B A;  3Q83 A;  4PQA A;  4CLU A;  5KT5 A;  1KFD A;  4P2F A;  3IBC B;  5CHC B;  1S4E A;  4JI7 J;  4NX9 A;  1DZ5 A;  3QFW A;  4J9P A;  2H48 B;  4JYA F;  2WOM B;  3MEE A;  2XY5 A;  1KON A;  3KHH A;  4YOE A;  3NEK A;  1H7W A;  4N8O A;  3W5Y A;  3KHL A;  3JSR A;  2MYF A;  3C16 B;  2UUW A;  1ZM3 A;  3KHG A;  4RWX A;  1NHK L;  2WCX A;  3WX8 A;  2R7S A;  1CQM A;  5H9E K;  3NNH A;  5ETN A;  1W25 A;  3PG9 A;  1V5V A;  5ETT A;  3Q23 A;  1Y00 A;  1S49 A;  3PX4 A;  2I2Y A;  3QLH A;  4QR2 A;  1NHV A;  4M5G A;  4PXB A;  1YJN S;  5JMN A;  2DNO A;  1CC7 A;  3P3D A;  3GP9 A;  3TX8 A;  5GAD U;  1X9M A;  2R7X A;  2XY6 A;  2FB0 A;  5LXR A;  2F8M A;  1M1H A;  4ES2 A;  1UEK A;  1WI6 A;  1FER A;  1S10 A;  1Q7L B;  2ZDO A;  2WBR A;  4UOG A;  4Q45 A;  3R5J B;  2Z4P A;  4NXN J;  4UOH A;  2BKN A;  3DOM B;  3SMZ A;  2LYV A;  4JI0 F;  2LEB A;  3I6P A;  4NLV A;  3OL9 A;  2HHS A;  1U0H A;  1TV6 B;  3J80 Y;  2N3O A;  4MIA A;  1IJF B;  2OKQ A;  4TYB A;  3X3U A;  2OML A;  3ILL A;  4FKY A;  3NBP B;  3OBI A;  1O0P A;  4B9N A;  3ELH A;  5GAG U;  2UU9 J;  4LR9 A;  5KFA A;  5JUM A;  1RYR A;  4DSJ A;  3GYX B;  2C3M A;  1RT1 B;  1RWW B;  1GXL A;  2ZE2 A;  4ZP8 A;  1MU2 B;  3IO1 A;  4NZ7 A;  3DRR A;  3VWS A;  2ALZ A;  1WOP A;  3NLC A;  4A48 A;  4DR2 F;  1E6Y B;  2HIQ A;  1JXV A;  4QR1 A;  4EO8 A;  2ZM6 F;  2E1P A;  3M8P A;  3MXH P;  2W2O P;  2AZ3 A;  3RBE A;  2BEF A;  4Q7A A;  2V2V A;  5FDL A;  4QPT A;  3HZG A;  4DLE A;  3ZZ0 A;  5L38 A;  3DLK B;  1X8D A;  4KO0 A;  3VGV A;  2V9K A;  3OL7 A;  1WG4 A;  4WTY A;  3JSB A;  1WKK A;  5DGB A;  1P1L A;  3M30 A;  1RU2 A;  3G87 A;  4B3S F;  3ZZU A;  4FS2 A;  2B6A A;  3GV8 B;  1X4G A;  3QGH A;  4B9L A;  2B9E A;  1MLA A;  4N77 A;  4DG1 B;  4ECQ A;  2E7W A;  4YFU A;  1NJX A;  5F8N A;  3OL8 A;  1XMB A;  5DLF A;  2CDQ A;  5LJ5 Y;  2GFF A;  4P7V A;  3LP2 B;  3FEY B;  2YWW A;  2WTF A;  4OHW A;  1Y5N B;  1S6P A;  3CXC R;  2NZC A;  4YME A;  2D41 A;  2XGP A;  1RAE B;  1ULR A;  3D0G E;  5DQG A;  5SUH A;  2W9B B;  2AJF E;  3MCM A;  3IP0 A;  2CQI A;  4LFA J;  4B3M F;  1N32 J;  1M0S A;  2YPY A;  3IC1 A;  4N5S A;  3CCR S;  2LFV A;  5HRO A;  1EKR A;  3K8W A;  1FCA A;  4C2M A;  2KTQ A;  1F60 B;  1NH8 A;  1N4L A;  1L3S A;  2CVI A;  5IXU A;  1U0S A;  2PA8 D;  4TN2 A;  5LMU J;  3KUG A;  3MD3 A;  2E7V A;  4DEZ A;  4UTG A;  3KMQ A;  2HFN A;  3R9L A;  4PG5 A;  4QIE A;  3PRB A;  2R8G A;  4ZKA A;  3KG1 A;  5IM0 A;  3SSR A;  2CPI A;  1KR4 A;  1NUE A;  1AT1 B;  2OEM A;  2YNI B;  5D8H B;  2UXC F;  1B4S A;  2EFP A;  2RRN A;  4A8M P;  3UN3 A;  1QAJ A;  1TL1 A;  2RF2 B;  4WFN Q;  2W2M P;  5M2P A;  3CCJ S;  4RW8 A;  3PR5 B;  3WDO A;  2KYZ A;  4ZVT B;  1N54 B;  2RML A;  2YKN A;  2J8S A;  3MAH A;  1WUU A;  1DTT A;  2XGQ A;  2JVR A;  3BO3 A;  1S4F A;  4R5P A;  3T41 A;  3EE3 A;  3MUT P;  3D1Q A;  2BW2 A;  1V3Z A;  2KRB A;  5KFR A;  1Y5I B;  1W2B R;  2FHO B;  3HUL A;  4EU0 A;  3DMJ A;  5DLG A;  3K5P A;  5B7W A;  3KLI A;  1LFW A;  1TEL A;  3NNC A;  2B43 A;  4ETZ A;  1BE4 A;  5CQG A;  4I1T A;  4IRD A;  3CVK A;  2UV8 G;  4F8R A;  1PSD A;  3O1L A;  3PY8 A;  4TY8 A;  4C3K A;  2D3O R;  2QLF B;  1OSC A;  1GMV A;  1FFS B;  4KJI A;  3FQL A;  1ACM B;  1KWM A;  2XYP B;  2KI2 A;  3CJ2 A;  3DOK A;  1U25 A;  3W66 A;  4RWW A;  3SQG B;  4WE1 A;  1D9D A;  3U1M A;  2JLE A;  1YLX A;  2CJX B;  2KXF A;  4OYP A;  2UV8 A;  4DSL A;  4OZ0 A;  2P8I A;  5GMK a;  1JLA A;  3GV7 B;  4O44 B;  1FWP A;  1I1G A;  2V2Q A;  2ZH8 A;  1S79 A;  1T3N A;  4A8F A;  1YQH A;  1BUX A;  5FLX Y;  3OTB A;  3MMA A;  2A2C A;  1OWX A;  1NM2 A;  3O3L A;  1XMQ J;  1OMS A;  2G2Y A;  4NLW A;  4U95 A;  1GK8 A;  3G6E S;  4IR9 A;  1VBX A;  4ICL A;  4ZVH A;  1RTD B;  2MQN A;  2KYX A;  4I2P B;  1BD6 A;  3J80 U;  2ZH6 A;  2CWX A;  2UVW A;  1ZBT A;  4FF4 A;  4OZ3 A;  1F5C A;  3PX0 A;  2R7O A;  5JVH Q;  2LVW A;  3TWZ A;  2ABY A;  4ALZ A;  1RGV A;  5C42 A;  1U2R A;  1PJ6 A;  4CLF A;  4K4Z A;  1M5S A;  1SL0 A;  2BOA A;  1J5O B;  5IC6 B;  3HVW A;  4Y00 A;  5EX0 A;  2MQO A;  2YH0 A;  4I4B A;  2WB4 A;  4M5H A;  5F8J A;  4IFY B;  1ZS6 A;  1OIA A;  2LMI A;  2ZH9 A;  3K2Y A;  4U8Y A;  1HPZ A;  1KLM A;  2HQF A;  5B0E A;  3ET6 A;  1NHU A;  2YKM B;  3DRS B;  2CDR B;  3IXQ A;  1HWK A;  4LR8 A;  4ED1 A;  2J0Q D;  5K20 B;  2F65 A;  1UPM B;  2GW8 A;  3QO9 A;  3K89 A;  1FKA F;  1KBR A;  1N56 A;  1R0B G;  4ZPT R;  5KFY A;  1FDA A;  3W9J A;  2BOP A;  2AIR B;  1TUG B;  3HHL A;  3CDU A;  1R31 A;  4PQU B;  3W60 A;  1PGZ A;  4N8N A;  3G86 A;  4WP9 A;  2P5V A;  3RBX A;  3AJD A;  1C0U A;  3V6D B;  1YIT S;  2VFT A;  2WW4 A;  4MTP A;  2B3T B;  3CDE A;  2PT0 A;  3VAJ A;  2GCF A;  4HAC B;  5D3G B;  4KHP F;  4PG6 A;  3KK2 A;  3M1V A;  2DNK A;  2DNR A;  2J76 E;  5AJ3 J;  4XAK A;  4K8R A;  5DO2 A;  5GVQ A;  1U6F A;  3SCL E;  2BA9 A;  4P2M A;  1AXQ A;  2HHU A;  3TUZ C;  2YNG B;  3SBM A;  1JLE B;  5HBM A;  2C3U A;  4H4O B;  1W26 A;  2EK6 A;  1EKS A;  5D4O A;  2RQC A;  1P6T A;  3R5C A;  3D6F B;  3BQ0 A;  1JLB A;  1X0F A;  2JL9 A;  1RWK B;  4WIQ A;  4CP5 A;  2D1C A;  4DQR A;  2XNQ A;  3IRX B;  2HRT A;  3TP2 A;  4K4W A;  1T9W A;  3FEZ A;  2LQ9 A;  4ZLL A;  3GG1 A;  4I56 A;  3CED A;  2C2K B;  2AF6 A;  5K14 A;  2IRY A;  3BDP A;  4FNI A;  4CIO A;  1VQP S;  2WBM A;  4MK8 A;  2YNH B;  3CF5 Q;  1BQM B;  4QJV A;  4V19 J;  2VQF F;  1C1C A;  4DV6 F;  4DV3 J;  3DRY A;  3PW0 A;  1V5I B;  3JTN A;  4UZC A;  5E41 A;  1YJV A;  2XWY A;  1HD1 A;  4RW9 B;  2HAF A;  1VJW A;  2RQM A;  3HHL C;  5CYJ A;  2FY1 A;  2MZT A;  3V81 B;  2KDO A;  3ZZR A;  5AT1 B;  4F26 A;  3A8J A;  3OSP A;  1L3V A;  4OL8 A;  4DQI A;  3GPA A;  1Q1K A;  3CE8 A;  5LJ3 Y;  4DL7 A;  3IWN C;  4M95 A;  4PKD B;  2UUB J;  2FVS A;  5C7P A;  1L3K A;  2QLX A;  1VS3 A;  2C42 A;  4I7F B;  1IBM J;  3I31 A;  4NLX A;  2ASY A;  4YHH F;  1RTZ A;  1RHM B;  3AOA A;  4IFV A;  4DN9 A;  4FP9 A;  1OQ3 A;  1WTB A;  1Q4R A;  4A8K A;  1XR6 A;  2ZBI A;  3R5D A;  2R2S A;  2L08 A;  2R8J A;  4LF6 J;  2UVV A;  1TL3 A;  4L3N A;  4O3P A;  2GMJ A;  1SJF A;  4ED8 A;  4PG4 A;  3C6T A;  4DU8 A;  4YP3 A;  4PG8 A;  4UF4 A;  4CLY A;  1NKB A;  3O5T B;  2Z2Y B;  5FLX U;  3ZC4 A;  1V6H A;  1I94 F;  2IVY A;  4ZVR B;  3TUI C;  1WD6 A;  4J37 A;  4QZV B;  2H9Z A;  1X4F A;  5EWE A;  2XSF A;  2WON B;  4KRW A;  3N0V A;  2HHP A;  2DR5 A;  1JKH B;  2ZBR A;  3BR9 A;  3N79 A;  3UNY A;  3RB3 A;  4UUX A;  4C4W A;  2RKI A;  2ZVS A;  3NAI A;  1UCN A;  4L73 A;  2ZOM A;  2EKN A;  4P71 A;  4ED6 A;  2DNN A;  1C4C A;  2IPO B;  1RT2 A;  4K2J A;  4H4M B;  2JEI A;  4ID8 A;  1X60 A;  4DSK A;  3HXM A;  8ATC B;  4URG A;  2CQH A;  4WWS A;  2XBP A;  1R8P A;  2RQK A;  1I6J A;  4XPC A;  4LBH A;  4J9Q A;  4F0M A;  4RNO A;  4CT9 A;  1N33 J;  2IAJ B;  1X7V A;  2YX1 A;  2AD9 A;  1IKV B;  1CJV A;  3UO0 A;  3ETM A;  1MWQ A;  3C15 A;  2B4O A;  1JJH A;  5GMD A;  4F2S A;  3M8R A;  3ETO A;  3FSY A;  3FCH A;  2EFQ A;  2LQJ A;  2XCP A;  3CGI A;  1VRQ C;  3I4H X;  1CJK B;  1UVL A;  3D6M B;  2XYH B;  4NZ6 A;  3FKB A;  5AXL A;  4I67 A;  1ITP A;  2A6M A;  1FDN A;  4OI1 A;  1KVI A;  3L09 A;  4N76 A;  2PMW A;  2CAJ A;  5J2Q B;  3A3N B;  2Z30 B;  1O5J A;  2L3M A;  1VQO S;  2V8P A;  4X2B A;  3ZNU A;  1GMW D;  2POK A;  1HNW F;  1RLC L;  3RBZ A;  3OVB A;  2PEB A;  1NZ8 A;  4F36 A;  1H7X A;  4B08 A;  1YG0 A;  3BDE A;  3IGN A;  4CO0 A;  4OHY A;  2WZ1 A;  2FGO A;  4RW6 A;  2KZM A;  3C46 A;  1TR0 A;  1Q8K A;  3NAH A;  3NRB A;  1V9O A;  2W4C A;  2VG5 A;  3VZI A;  2AP6 A;  1SKS A;  3R7S B;  1D3W A;  1R7I A;  3IS9 B;  4B9V A;  5DQH A;  5HQM A;  1XWL A;  5JJB A;  4ZJL A;  2HND B;  3KLG B;  2IFX A;  3M32 B;  2D3Z A;  1FFG B;  3NL0 A;  4WPA A;  3KMS A;  3DLE B;  4LF1 A;  4CTA B;  3Q86 A;  4JV0 A;  2F63 A;  1NK9 A;  3DOL B;  1K44 A;  3R5B A;  3QAE A;  1NKE A;  5DZ7 A;  3R5G A;  2DCL A;  1Q0N A;  5B0A A;  2HWT A;  4OI4 A;  4EBE A;  1BC6 A;  4FF1 A;  3ZTS A;  2DPJ A;  2VL1 A;  1VC5 A;  1NJI T;  2R2T A;  2O01 C;  5F8L A;  2LQ5 A;  2GVD B;  5EWG A;  1SKR A;  2MXY A;  3POT A;  4JI1 F;  4FYW B;  1KQS R;  1PAE X;  2IM0 A;  3W5X A;  4DV0 J;  3OLA A;  3OUY A;  4YB1 P;  1KHW A;  2E1R A;  3V5R A;  3GFH A;  4OLO A;  3EDQ B;  2K3I A;  2RIL A;  1S5Z A;  4V1A k;  3UDE A;  3BSC A;  1UET A;  3QSY B;  3A8K A;  3MTK A;  3PFE A;  4JI2 J;  4ATN A;  2RVJ A;  5KOW A;  2ZHB A;  4DV7 F;  1TKT A;  4DSE A;  3I0S B;  1CSJ A;  5G0R B;  1RWN B;  4WZM A;  3NGU A;  2V4J A;  4QWE A;  1GEH A;  3FSX A;  5LT5 A;  2R7W A;  4DR6 J;  4Q43 A;  4ZP7 A;  3GIJ A;  3LPE A;  3CJ8 A;  4DV2 F;  4PRF A;  4PPZ A;  1HQU B;  1A9N B;  2J7K A;  3OR1 B;  3NNA A;  4IH7 A;  5IS2 A;  3N01 A;  3CPW R;  1YBU A;  4LRA A;  2PN6 A;  4OZ2 A;  3B6B A;  2FZK B;  3LP1 A;  2QLB B;  5I4M A;  1CS4 B;  4F3O A;  4ZVP B;  1RAD B;  4DZ6 A;  1Q79 A;  4ZVQ B;  2Z56 B;  2PDA A;  4DR1 J;  3AA9 A;  3UE2 A;  2ASD A;  1KEK A;  1CUL A;  3Q22 A;  4JV5 J;  2CJB A;  1SCJ B;  3FEX B;  1XIQ A;  2SXL A;  3T5K A;  1VC6 A;  3KWM A;  4HDH A;  2BJD A;  1HNV B;  2F5G A;  2P6S A;  3I56 S;  5E2Q A;  2N3L A;  4NCA A;  2OPQ A;  4U9R A;  4RUC A;  5KFH A;  1ZA2 B;  4DI6 A;  2EG1 A;  4F2R A;  1DUR A;  3LGH A;  3PJ9 A;  4AE5 A;  2AJ0 A;  3GFZ A;  1H2U X;  3MM9 A;  3P6Y C;  3A8E A;  2NSB A;  1VQL S;  3JS9 A;  4FS1 A;  4CZC A;  4YR3 A;  5HSP A;  2X1G A;  4UST A;  4IOC Q;  2QLW A;  4ZCL A;  1QUP A;  2W9C A;  2QN6 B;  5FJ4 A;  1Y5L B;  1FJC A;  1UVK A;  1WC4 A;  2HQC A;  2V0N A;  3JSM A;  2M52 A;  2WVF A;  3MMC B;  1HNZ J;  4P75 A;  4RNH A;  4DUY F;  1RB0 A;  2QE5 A;  2B51 A;  1AFJ A;  3D0H E;  2LEC A;  3DLG A;  5KFM A;  3BH6 B;  3DYA A;  2YWH A;  4MKB A;  3PEH A;  5K8P A;  2N4D A;  3OD2 A;  2MKI A;  4MIW A;  3OTD A;  1KVJ A;  4ES1 A;  3G8Q A;  3J7Y U;  4BS2 A;  2MKJ A;  2GHV C;  1IQZ A;  3FDS A;  3MM8 A;  4FDF A;  3TUJ C;  1VK3 A;  3E01 B;  2CXE A;  3B82 A;  2FJX A;  1NDC A;  1SJ1 A;  2BJ7 A;  4UZB A;  1RTJ B;  1L3U A;  4F7V A;  2WSC C;  1G3O A;  1OPI A;  3CIM A;  3M6W A;  1NZA A;  5HP1 A;  3MMJ A;  1WEZ A;  3BEG B;  4CLW A;  1RDR A;  2DB1 A;  3P96 A;  2QEX S;  4BHQ A;  2F8E X;  3W7B A;  5D0R A;  2J7U A;  5F9L A;  4IG3 B;  2DHG A;  4R8U A;  1IKW B;  3JAM Y;  2MLX A;  4OJH A;  4GO5 X;  2C2D A;  1H0H B;  4ZN1 A;  3HM9 A;  3H5S A;  4BWJ A;  1VGY A;  4KC5 A;  3PW5 A;  4B9M A;  3OXL A;  4ES3 A;  1FRK A;  2E1C A;  4PWD A;  5HVF A;  4OI6 A;  1SKW A;  2MKH A;  2W8L A;  2CQG A;  5HQL A;  2HFZ A;  4CO2 A;  3HHN B;  3UWT A;  2RUG A;  5C2G A;  2BAB A;  3HSD A;  1YI2 S;  1S9E A;  2NXN A;  3GII A;  2I8E A;  2L9N A;  4M63 A;  2HPU A;  2WB1 D;  1JLQ B;  3MEC A;  3HX9 A;  1G6B A;  2K1R B;  4USI A;  2AYG A;  1R8H A;  3GON A;  4G65 A;  3T3F A;  4B3R J;  2OFH X;  1FJG F;  3PNI A;  4DX8 H;  4TKT A;  2MJN A;  4FF2 A;  1YZ7 A;  2ZH5 A;  2R7Q A;  1REV A;  3HVT A;  1RAF B;  4X66 F;  2RT3 A;  2W4P A;  3BYR A;  4Y2M A;  1RIS A;  3BQ1 A;  2K8G A;  4NCG A;  1S12 A;  2LXI A;  4XK8 C;  1MWY A;  4OHX A;  5CA5 A;  2FVC A;  5IWA F;  3OV7 A;  1EX8 A;  3LP0 B;  3HKZ D;  1FE0 A;  1XR5 A;  4B3O A;  1TAQ A;  4HH1 A;  1JIH A;  4ZHR B;  1OY9 A;  5ETK A;  3QRQ A;  2OI2 A;  2FHJ D;  2OO4 A;  2NR0 A;  1BQN B;  4ECX A;  7AT1 B;  4JI7 F;  3RB6 A;  2E5L J;  1Z4U A;  3TVK A;  4QIG A;  4B17 A;  3QT5 A;  4EUV A;  4CLZ A;  2AEJ A;  2DJW A;  1O6X A;  4LF9 F;  2PMZ D;  1NK4 A;  5KFK A;  3P45 B;  4PXD A;  4DR5 F;  1RHJ B;  4FF3 A;  4C97 A;  1IBL J;  1FKP A;  2FYX A;  1TKZ B;  3T1H F;  3KKF A;  4LSL B;  1BLU A;  4K50 A;  4O23 A;  4ZVF A;  4YUD A;  2YX4 A;  3VAK A;  2HNZ A;  4K4S A;  3VAM A;  4PEO A;  3GIR A;  5D15 A;  4TQS A;  1S99 A;  1URR A;  3ILO A;  2Y8W A;  2RDJ A;  4OMF G;  4ZPD A;  1MRO A;  1S1W A;  4YN3 B;  2J7W A;  1QSY A;  2OPP B;  1N0V C;  3MR3 A;  4B3T J;  4A8Q A;  4IDK B;  2Z57 B;  4HVZ A;  4KGZ B;  4ZA1 A;  2GAH C;  4KY3 A;  1DTQ A;  2BJ1 A;  3PYD A;  1PJ7 A;  1UWB B;  1Y11 A;  5A0Y A;  3TZX A;  3BPD A;  4FPI A;  3Q8P B;  1HHQ A;  1VJQ A;  5DET A;  4GKJ F;  2DH8 A;  3N5B A;  5C24 B;  4WFA Q;  4USJ C;  4FBT A;  4NXN F;  3QIP A;  2I0X A;  4ZPW R;  4OYA A;  3MR7 A;  2OLW A;  3D67 A;  4M5L A;  3RB4 A;  3ILI A;  1DFD A;  4WFY A;  2FPH X;  4IKA A;  1IBC B;  1VBK A;  3IN5 A;  2OFG X;  2D9P A;  2YWK A;  1Q8I A;  4PZV A;  2KXH A;  4S0M A;  3KK1 A;  2EI5 A;  3QRR A;  4Y65 A;  2XY7 A;  2UU9 F;  4KFB B;  1HYS B;  2X1B A;  3CC4 S;  4LBI A;  2AEM A;  2P9G A;  1T02 A;  3WIU A;  1V3R A;  3UFC X;  3TA1 A;  1X4H A;  4ZLJ A;  2CG4 A;  3HD2 A;  1NEE A;  3MEE B;  1FNM A;  2PD1 A;  3CJQ A;  2YTC A;  4Y28 C;  2GA7 A;  2DGO A;  1JLG A;  3AD9 C;  3Q89 A;  2PO4 A;  2W9A A;  2G4B A;  1MG7 A;  1F2G A;  2KXN B;  2VU5 A;  3L7O A;  4ZVO B;  2A1B A;  4KB7 A;  1FDD A;  5T41 A;  5I3Q A;  2M4M A;  4ILR A;  1VRT A;  2MZS A;  3T6B A;  3LWL A;  4DSF A;  2MKY A;  3OVA A;  2IJN A;  4OYX A;  3SDE A;  2LU1 A;  5A8W B;  3MAQ A;  2EFV A;  2Q79 A;  1S77 D;  4ILM A;  4KTQ A;  3QLH B;  4JI5 F;  5BXI A;  3M9M B;  1RT6 A;  4PAA A;  3LPY A;  3KJV B;  4DFJ A;  3OR2 A;  3GE9 A;  3W2W A;  1TL7 A;  5I42 B;  2HQI A;  3KLH A;  3BBF A;  3H0P A;  1LXJ A;  1U6B A;  2E29 A;  2AJ2 A;  4FNH A;  1HW9 A;  2X51 A;  4IOB A;  4X4P A;  1CPZ A;  4MIB A;  3QGG A;  5HAT A;  4NLD A;  1PYO B;  3CJ4 A;  5HMZ A;  1DJ0 A;  1S76 D;  2NQP A;  4JUZ A;  1C0T A;  5K8O A;  2OEL A;  1BQX A;  2FJD B;  3SFG A;  1RYS A;  4UQG A;  2HZV A;  4LRB A;  2GHP A;  2ATC B;  3L3C A;  4ED7 A;  4DR7 J;  4GVB A;  1RK8 A;  1NDL A;  4Y2I A;  4DL6 A;  2HHH F;  4O0N A;  1U0H B;  3VQT A;  4LFA F;  2EBG A;  3HKW A;  4DPU A;  4Q0B B;  3FJ2 A;  4RNN A;  3U1L A;  3L9Z A;  3UDC A;  3NS7 B;  2IM1 A;  3SSQ A;  1VRU A;  5LMU F;  4WBF A;  2HGN A;  1ZAX A;  3MI7 X;  3MMB A;  2ZE2 B;  3Q0A A;  4NLQ A;  4RJV A;  1RHK B;  3W5Z A;  3HFV A;  2M70 A;  2MY8 A;  1RCO B;  1A0O B;  3UDL A;  2ZKT A;  3ULH A;  1CJU A;  2HEK A;  2HBZ B;  4ZK7 M;  2JHE A;  3D66 A;  1AA1 B;  2YPZ A;  2IVF B;  2B4V A;  3IAS 9;  8RUC A;  2CQ2 A;  2B8Q A;  2KG1 A;  2ZC4 A;  1FRI A;  3OLB A;  4BDP A;  5GAE U;  3TI0 A;  4KO0 B;  4WXO A;  4EFA C;  4P2S A;  1GNK A;  3GIM A;  3EUN A;  3M30 B;  1HBO A;  3C6U A;  1TK5 A;  3D54 A;  1FXL A;  5KFN A;  3H5U A;  3CO9 A;  4DV1 J;  3OQ2 A;  2RS8 A;  4WJB A;  1S9F A;  2V34 A;  1JQG A;  4AFF A;  3VTI A;  3LUY A;  2LCW A;  2RS2 A;  2CWK A;  2GGP B;  1M5P C;  4F0K A;  3M05 A;  4AXI A;  5K8N A;  4ZIT A;  4X65 J;  2ZJR Q;  1CJT A;  3K5O A;  1XNR J;  3ZZO A;  2M88 A;  4QIV A;  1SH2 A;  3VGU A;  3CIZ A;  3HZE A;  3W63 A;  1QTM A;  1SUQ B;  1RT7 A;  1FVS A;  3TVZ A;  4R0E A;  2OPS B;  1N6Q A;  2YY3 A;  1N5Q A;  3MOJ B;  1Q16 B;  1GX5 A;  1Q78 A;  3PW7 A;  4M8L A;  2XHC A;  1ICE B;  1C1B A;  1MWZ A;  1FF2 A;  2XEX A;  4DLG A;  1RAA B;  2RNE A;  1WF0 A;  2HNY A;  3CT9 A;  3P5B P;  1H98 A;  4KGM A;  2MST A;  5KG2 A;  2FVR A;  2XZW A;  3KG4 A;  3OTO J;  2DGX A;  3N6L A;  1FNO A;  1NPK A;  3C14 A;  4PWU A;  3OXF A;  4IH5 A;  2ROG A;  2DYA A;  4RW7 B;  5IM0 B;  3W9I A;  2DXD A;  3I55 S;  1DBD A;  5A8K A;  3IMQ J;  2BMB A;  2V8H A;  2DY1 A;  1S6U A;  3RYL A;  2UUC F;  3EXY A;  2W7P A;  4DUZ J;  4RBU A;  6FD1 A;  3H4D A;  3S7R A;  2MZ1 A;  1TL1 B;  1GT8 A;  4GKK J;  1S0M A;  3ZO7 A;  2VBY A;  1B0T A;  4QOT A;  1WHY A;  4JI3 F;  4ECV A;  2H5E A;  1KFS A;  2DR9 A;  1RA7 A;  3IM8 A;  1FX4 A;  1D9F A;  4C8N A;  4OZJ A;  2MGZ B;  2DR7 A;  4R5P B;  2FJW A;  1HNX F;  2RE1 A;  1RAO A;  2ACY A;  4KT0 C;  3G4S S;  4A8X A;  4HHU A;  2M8D B;  3QQC D;  4CO5 A;  2GQ2 A;  1OY8 A;  3C16 A;  3CWJ A;  2FHK A;  3GU0 A;  5KFC A;  1HR0 J;  2BAN B;  4TY8 B;  2HBR B;  1O51 A;  1SXL A;  5IT4 A;  1RAI B;  5HLF B;  4J9L A;  2HLU A;  3BGR A;  1OQ6 A;  1YJ7 A;  1RLD A;  2OP5 A;  3HFZ B;  1T9Y A;  3W2V B;  4R0J A;  1LWF B;  3O2I A;  4Y3C A;  5E3Q A;  3TA2 A;  3M6U A;  3DLH A;  1X9S A;  1S1T B;  4A8O A;  4KH0 B;  2N4C A;  3AAW B;  1G4C A;  4TY9 A;  1JXL A;  2OAU A;  3F56 A;  3RB0 A;  2J6T A;  1S0N A;  1U48 A;  3L7P A;  1LW2 A;  2CQ3 A;  3QGI A;  5D0E A;  3I87 A;  5AJ3 F;  4YQW A;  5JXS A;  3K5N A;  2V5H G;  4I64 A;  4Q2M A;  2JC0 A;  1BGX T;  4Q44 A;  4KQZ A;  2PGC A;  5KG4 A;  1TL4 A;  1XMO J;  1URN A;  3ZZY A;  3DOM A;  4ICL B;  2LXU A;  2W7O A;  1VIO A;  1RCX B;  2MB0 B;  3FK4 A;  1WF2 A;  3JTO A;  2HHV A;  1X4D A;  1TV6 A;  3S6E A;  2NXU A;  4A47 A;  3NBP A;  2XS2 A;  2EFG A;  1U1L A;  5E3C A;  2Z2Z A;  4QWD A;  2HHQ A;  3GJS B;  1SQG A;  1NSQ A;  2MQ8 A;  1FJ7 A;  4OX8 A;  1UVN A;  4O3N A;  3OW2 R;  1TZ0 A;  1OYE A;  3QGP A;  3T1Y F;  3K5M A;  4JYA J;  3L7U A;  1KHV A;  1E6Y A;  2A0F B;  4ZCI A;  4DCP B;  3V4I A;  1RKJ A;  5KFB A;  2JZ5 A;  5KG1 A;  3OTC A;  1VLO A;  3DN9 A;  1FFW B;  1FRL A;  2QA4 S;  3G96 A;  1U1N A;  4M94 A;  4NLO A;  3DLK A;  3GJQ B;  5LMN F;  1ZAW A;  2ZOG A;  2XLI A;  1CLF A;  2VFS A;  1VQ6 S;  3KK3 B;  4LF4 F;  1VDH A;  4OYZ A;  2VFU A;  1TMJ A;  1PO6 A;  2Z58 B;  3BO4 A;  1HHT P;  1NK0 A;  4KR0 B;  3PHT A;  1K1S A;  4DG1 A;  2L9W A;  1QDU B;  3EMT A;  3A3P B;  2VUG A;  3WC0 A;  1YHQ S;  2NYH A;  1HBN B;  3KK2 B;  1WHW A;  1W7W A;  3CCL S;  3H40 A;  3KG0 A;  4YB5 A;  1XTZ A;  2E9Z A;  2W7A A;  1WTF A;  3CD7 A;  1X4C A;  3T5H A;  5KFE A;  2OUG A;  2B5J A;  1FWK A;  2GHW A;  3DLJ A;  3UN2 A;  1N0U A;  5L1L A;  5F0W A;  1FVQ A;  4CYU B;  2W9B A;  2RU9 A;  1VHF A;  3HF5 A;  3QWP A;  3MCO A;  4DF4 A;  4QQB A;  1UJ4 A;  2CPX A;  4OQJ A;  3K57 A;  4H4K A;  1RQ0 A;  3EZO A;  5IT9 U;  3GCX P;  2PSZ A;  4W4M A;  1JLB B;  2NLW A;  3NGK A;  4FBU A;  5H9F J;  4IH6 A;  1O8B A;  5IC4 B;  4ECS A;  4B02 A;  2GO9 A;  1REG X;  2UP1 A;  4WK1 A;  3PV8 A;  3I4P A;  1VBZ A;  1WAC A;  1CC8 A;  3EPI A;  2E9T A;  1GXU A;  6AT1 B;  3BN7 A;  2KJW A;  4QYZ J;  4WYW A;  5KG6 A;  3QRP A;  3DGP A;  4JI6 F;  1FTC A;  1XJW B;  4F4Z A;  2MSS A;  4WP3 A;  1YSJ A;  3B78 A;  2ZM6 J;  4DFK A;  2Z2L A;  1FE4 A;  1VIX A;  3H2U B;  1ZTW A;  2HHT A;  4RO0 A;  2CJK A;  2FLL A;  1IKY A;  4PYA A;  3UCG A;  1F9F A;  1LQ9 A;  1NU4 A;  4IG0 B;  2A18 A;  4CLP A;  2DRD A;  2W4D A;  3T5J A;  1J2V A;  4B3S J;  1KTV A;  4PYD A;  3RRG A;  3CCE S;  3EGN A;  2NSC A;  3MED B;  1H72 C;  2ILY A;  3AOD A;  3G82 A;  4G1I A;  5RUB A;  2BKP A;  2D3U A;  3GIL A;  3ENQ A;  1QAI A;  3N9U C;  5CCL A;  4UT4 A;  3UVJ A;  1FRH A;  5A8R A;  3M8W A;  3DU5 A;  4IFV B;  4OHZ A;  4GMK A;  4URS A;  3SI8 A;  2QV6 A;  2DIV A;  4H4K C;  3RTV A;  2VZ9 A;  2DXF A;  1HBM B;  3LAK A;  5HO4 A;  3EM1 A;  5ETM A;  2LKZ A;  2V2K A;  5D0G A;  1TL3 B;  2D9O A;  1YVF A;  4ZPC A;  1A6L A;  1KC8 T;  4B3M J;  1RE1 B;  4EBD A;  5T7L B;  4ITS A;  5LXY A;  1N36 F;  3GQC A;  4DPW A;  4FYV B;  3Q8R B;  4O44 A;  3NMR A;  4ZVG A;  2H54 B;  4N56 A;  3QJL A;  1H74 A;  1R0A A;  1U8S A;  4C8O A;  1Y0H A;  5J1E A;  1QAY A;  4DN0 A;  2B56 A;  2OD6 A;  1RBO B;  1IWA A;  2KM8 B;  1RT5 A;  3RR8 A;  1IM4 A;  3NGR A;  4PPD A;  3G6X A;  4XPE A;  1X5S A;  3M2U A;  1U1R A;  3MTJ A;  2VIC A;  2IJR A;  4JI4 F;  3RUB L;  2D74 B;  3BGU A;  1PIE A;  1S7H A;  4MKY A;  2KB2 A;  1J5O A;  4I69 A;  3ILJ A;  4MMO A;  3R27 A;  4IFY A;  5ETO A;  3QT8 A;  3DFE A;  2IDL A;  5CZX A;  3BO2 A;  5K9F A;  1U1K A;  2YKM A;  2EXU A;  2CPJ A;  3DRS A;  1TK8 A;  3C15 B;  4AXJ A;  2AJ4 A;  1FKO B;  4L6V 3;  5L1K A;  1PAU B;  3M4X A;  4HR2 A;  2Y9H A;  4KE5 A;  1RTH B;  4X62 F;  2RRB A;  1YTY A;  3R2D J;  2JLG A;  5AE3 A;  3M8S A;  2EWH A;  4QR0 A;  4K0K J;  3TOQ A;  1CQN A;  2PII A;  3CDW A;  3TAR A;  4L72 B;  3V6D A;  1U1O A;  3FVY A;  2AWZ A;  4C11 A;  4HAC A;  4DR6 F;  3WC2 A;  3H59 A;  3R8Y A;  4Y34 A;  3AXM A;  3FFI B;  2CA9 A;  4DV5 F;  5CH7 B;  4RW6 B;  3M9O B;  3NCP A;  1ZAV A;  1MMN A;  1RAJ A;  2VJU A;  2COL A;  5KFU A;  3X1L B;  4USW A;  2HQD A;  1UFK A;  2YNG A;  1VQS A;  2BAC A;  5E3R A;  3UR0 A;  3BM7 A;  4H4O A;  5J2M B;  3PVX A;  1RSC A;  4DR1 F;  2FQQ B;  4M5D B;  1DHM A;  2IA0 A;  4CQ1 A;  4ID5 B;  2DNP A;  2OSQ A;  4DX7 A;  2MHE A;  4G6V B;  3BF4 A;  4ECW A;  3LA0 A;  3MPV A;  3CJ5 A;  5BR8 F;  5F8H A;  2IRX A;  4FXV A;  2H1Y A;  2W2Q P;  3TA0 A;  3PIP Q;  2KT3 A;  1BMQ B;  4WTO B;  3HVR A;  3PKY A;  4J9N A;  2VBZ A;  3H2L A;  1M90 T;  5HJY A;  1VQM S;  1BQM A;  1PCA A;  1NDK A;  3LOU A;  1N5Y B;  2CUY A;  2XMM A;  3A4T A;  3TAQ A;  4G1P A;  2BE7 D;  1RXO B;  2YXL A;  2DXE A;  2DK2 A;  3CD0 A;  4USV A;  4L3K A;  2QC3 A;  2HGL A;  2FJV A;  4AL5 A;  3V81 A;  3AD8 C;  2IYG A;  1N5V A;  3CCW A;  4LIW A;  3MEG B;  2ZWP A;  3MUV P;  1HNZ F;  1R8A A;  3I0R A;  1T11 A;  1QTN B;  4UQT A;  2VJV A;  4HHJ A;  1UKU A;  4OYO A;  2ZBQ A;  1MML A;  3QPI A;  4ZIV A;  1NLK L;  2OPR B;  5KFI A;  2R7U A;  2C2N A;  4OZL A;  1LWC A;  2FHJ A;  1Q53 A;  5HVG A;  4CT8 A;  3I9Z A;  2C3O A;  1U8W A;  3PYG A;  3NGS A;  1SIW B;  4N41 A;  2CRL A;  1RWP B;  4I7F A;  4ECT A;  2BM0 A;  1U02 A;  3EXC X;  4Z7Y A;  2VD3 A;  1KSP A;  1HBU A;  3LP1 B;  3BN4 A;  3HT3 A;  2UXD J;  1R8B A;  1FEE A;  2MY7 A;  3SV3 A;  3DCA A;  1U24 A;  3QAU A;  1JLC A;  1Z1Z A;  3EGW B;  4J91 A;  1CUL B;  2NRE A;  1HI0 P;  1WI8 A;  1UPP A;  2XUL A;  2ZD1 B;  1XNQ F;  1WC3 A;  3QAT A;  1R8C A;  5GAH I;  5GME A;  3GJT B;  1VQ5 S;  3TZZ A;  4FYD A;  2M8H A;  4F02 A;  3MM9 B;  2BYC A;  4X4T A;  3CJ3 A;  4ZPA A;  2WON A;  2DGQ A;  3VAL A;  1JKH A;  1WSR A;  2GVZ A;  2OSR A;  1S59 A;  1YJW S;  2DEJ A;  4DV6 J;  4UUW A;  2MQQ A;  1B99 A;  3RAQ A;  5A2Q Y;  2VBW A;  5B0G A;  1D1U A;  4J9O A;  2G2Z A;  3BRE A;  2KO1 A;  5HAO A;  3OHB A;  4HTI A;  4Q8E A;  1ARO P;  1UZD A;  5ETL A;  4A46 A;  1KQG B;  2BE2 A;  2C28 A;  3A8I A;  1NJY A;  5FII A;  2MQP A;  4KAI A;  2CQD A;  1FRX A;  2GQC A;  3O8W A;  2XCA A;  2YQ0 A;  3DLG B;  3BH7 B;  2IAJ A;  7FD1 A;  4HT5 A;  1PYS B;  1IKV A;  3KYL A;  3J7A N;  1WDT A;  1X5T A;  2CIM A;  1IQT A;  2L9D A;  3HO1 A;  4Y6I A;  4QW8 A;  1NB7 A;  5KFV A;  2EKY A;  3SFU A;  3AOC A;  1VLY A;  4DCO B;  3JTP A;  2J9D A;  2RD5 C;  4YHH J;  4NA3 A;  5J2P B;  1CJK A;  2HIY A;  3DXS X;  3PZP A;  4WXW A;  1IN0 A;  4DX5 A;  1T9U A;  5CYM A;  3CCV S;  3H98 A;  4HDG A;  2QMX A;  4LRF A;  3ENV A;  3DLB A;  3UCU P;  5J2Q A;  2AX1 A;  1ZM9 A;  3NP5 A;  3SZ2 A;  3DRX A;  3UR3 C;  4IUF A;  4OZN A;  3EVM A;  2AMC B;  1YJR A;  1SJ4 P;  5H9F K;  5AE1 A;  5LSR A;  1GH8 A;  4AUK A;  1B0P A;  3WZ0 A;  4C0O C;  1WNE A;  3MUM P;  1TFY A;  4QYZ K;  2XG8 A;  3QWU A;  1UWA A;  3IS9 A;  2IHR 1;  3GTY X;  2IC3 A;  3FZB A;  3HSJ A;  2HND A;  3KLG A;  2IBK A;  2CNO B;  2F1F A;  4CTA A;  1UAW A;  1MN7 A;  4B3T F;  1H73 A;  3DOL A;  1TU0 B;  2EFO A;  4NLP A;  4ED5 A;  4M5M A;  3HI9 A;  2JEJ A;  1NRK A;  4NRU A;  1LWE B;  3MEC B;  3RZA A;  2K7K A;  2Z0G A;  1NKC A;  3JQM A;  1U09 A;  3I5B A;  4HI2 A;  2GC8 A;  1GQE A;  4O3Q A;  2DY9 A;  2GVD A;  2U2F A;  4LVN P;  2JWN A;  4PCQ A;  4LSZ B;  1N88 A;  4C98 A;  2ZDP A;  3V4M A;  3KNA A;  2NYI A;  2QJ3 A;  1QSS A;  2APO A;  3FRZ A;  4LSN B;  4RW4 B;  1JLF B;  4YB7 A;  2HAI A;  3H2V E;  3KXD A;  3JXO A;  2G0C A;  3HMJ G;  3HCX A;  3I0S A;  1C4A A;  3ZTP A;  4X4U A;  1XEZ A;  2ZUG A;  3TYT A;  5G0R A;  2KH9 A;  3SQO P;  1S6O A;  2JRS A;  1FWL A;  1HNI A;  4PUO B;  3OFH A;  1HNW J;  1S0V A;  1XER A;  1UZH A;  5CYQ A;  4B9S A;  4FXW A;  4K5S A;  2XO6 A;  3D3B J;  2ERR A;  4NOH A;  3T5L A;  4DQS A;  1F6T A;  1YX2 A;  2HNZ B;  1WKL A;  3G8S A;  4CRJ A;  1GAO A;  4GRS A;  5MLC V;  2M0G B;  1PKU A;  3F73 A;  5THW A;  1VQK S;  4LF5 F;  3OR1 A;  1HMV B;  4OYW A;  2CQ1 A;  4DX6 A;  2DRA A;  3EGV A;  3MM7 A;  2KT2 A;  2WSE C;  1S1W B;  2ZFH A;  1VQ7 S;  2HG4 A;  4PG7 A;  1CS4 A;  5F9N A;  4LQ9 A;  1U47 A;  3S1T A;  2QG9 B;  3VAF A;  3M6V A;  3IBW A;  1DTQ B;  1DY3 A;  3TQE A;  2XWX A;  4C8Y A;  4WKR A;  4DR4 F;  4KYZ A;  2B9X A;  5KFF A;  1RU1 A;  2J9D E;  5A0Y B;  4ZLN A;  3W64 A;  1UL3 A;  4I2Q B;  1AUS L;  2MLZ A;  4OYI A;  1LK5 A;  2G13 A;  2XC9 A;  3MUR P;  1EQM A;  4DXL A;  3JQJ A;  1PC5 A;  2M9K A;  3DHX A;  4LFB F;  3C8Y A;  4DR7 F;  1U6Z A;  3HP6 A;  1ZM2 A;  3HHK A;  3G71 S;  1BWV A;  5A2Q U;  3RW7 A;  4RZR A;  3FUY A;  3JYT A;  2MDA A;  3MPY A;  2G0J A;  3M2V B;  2CQB A;  5HMY A;  4DQP A;  1R43 A;  4AL7 A;  2VHG A;  3DI6 B;  4LFC F;  1Q5V A;  1AYE A;  1IVZ A;  2V8V A;  1DLO B;  2MKK A;  2UVR A;  5LOQ A;  3QMQ A;  4YDD B;  4RPF A;  3TO8 A;  5J2N A;  3FBF A;  3MMC A;  3CC7 S;  2HYI B;  3SV4 A;  1UJ6 A;  4E0D A;  2WHO A;  1B70 B;  1EB0 A;  2F4V F;  4DFP A;  2QO3 A;  3OJS A;  2AGQ A;  1YJU A;  4ANE A;  4GO7 X;  1SJR A;  4DV4 J;  1N48 A;  3EYZ A;  3GSI A;  1VRT B;  1NSK L;  2DNY A;  5DG9 A;  4IRK A;  4K59 A;  5G4D A;  2EVZ A;  1XR7 A;  3CMQ A;  3T19 A;  1TL7 B;  1AZS B;  3KLH B;  3C3L A;  2E5H A;  2KT5 A;  1EP4 B;  3FBC A;  4L74 A;  1IWG A;  3W8G A;  4DV1 F;  1GXT A;  2X1A A;  4KSE B;  3P49 B;  3PTW A;  3NWG A;  2HKE A;  4DS5 A;  3DM2 B;  1FK9 A;  1SC4 B;  4LF2 A;  4DL0 C;  3AJ1 A;  4NMX A;  4F3Q A;  3CJ0 A;  3NS5 A;  3CMA S;  2VQE J;  1EAY C;  4USK A;  4IG3 A;  2VOD A;  4NML A;  1XNR F;  1IKW A;  1KOH A;  5EGY A;  3UCZ P;  3UPF A;  3ZFV A;  2LU2 A;  4TLR A;  4OX6 A;  1TVR A;  4CNZ A;  1RJJ A;  4CO3 A;  2ZUA A;  1RT3 B;  4GVB B;  3UDV A;  1AW0 A;  4Q8F A;  1KOO A;  3IGV A;  3MM6 A;  1SC6 A;  4WKY A;  2WSF C;  2JFK A;  2I9S A;  4ELV A;  3HT0 A;  2ZC3 A;  2EW9 A;  2V94 A;  3CDA A;  4ECR A;  2OJ3 A;  4OI3 A;  3ZXW A;  4DU7 A;  3OJU A;  2VC1 A;  2IJF A;  3ITH A;  3B4M A;  4DPT A;  5D77 A;  3ZZP A;  7FDR A;  3GLJ A;  2EC2 A;  2K1R A;  3MMB B;  4O4G A;  2HS3 A;  3R7B B;  3CCT A;  1QJH A;  1CJU B;  1AB8 A;  4MKA A;  2VG6 A;  5M2U A;  1T05 A;  2BW7 A;  5C25 A;  4DUZ F;  4F25 A;  2BE9 B;  2JJ4 D;  5D6G A;  2CNL B;  4K4U A;  1TKX B;  3GWC A;  1NJW A;  3VV2 B;  2ZBP A;  5B08 A;  5DZ6 A;  4NYZ A;  5KG0 A;  3Q8U A;  4D3H A;  1BQN A;  1HBO B;  4DL3 A;  3CCM S;  3DRP B;  2HZC A;  4K2X A;  2BRK A;  1NSA A;  4DUT A;  2NXE A;  3ENW A;  2GIR A;  4Y2K A;  2Q43 A;  4WU3 A;  3G6Y A;  4DR3 J;  3QJJ A;  1EQ0 A;  2DR6 A;  1TKZ A;  5HK4 A;  2HHX A;  4C0H A;  4LSL A;  3IG1 A;  1NAQ A;  5E33 A;  2LDY A;  2N7Y A;  3RR7 A;  2J8A A;  1S9G A;  5ITH A;  1HW8 A;  1TUV A;  2DNZ A;  4JB8 B;  1R6V A;  2GX8 A;  2J0X A;  2JOQ A;  3EZ5 A;  1VI7 A;  5EX3 A;  5KOX A;  1RT7 B;  2B0G A;  2VOP A;  1J5E J;  1NPP A;  2XSJ B;  2OHD A;  2IY5 B;  4P9S A;  3LTO A;  2OPP A;  2MHN A;  1Y3J A;  2BKO A;  4KV8 B;  2FIU A;  4CH1 A;  2O66 A;  2UXB J;  4RUH A;  4IDK A;  3LGN A;  4G1Q B;  5CXT A;  1X5O A;  4OLP A;  2CPD A;  1I3O B;  5KFJ A;  2Z2M A;  1S0O A;  4BWM A;  4IO9 Q;  3ZTQ A;  4TNO A;  2MZJ A;  4ZVS B;  3DHW C;  2X1F A;  5B09 A;  4J9U E;  2H65 B;  1TFW A;  2YBV A;  2CZV C;  4ZIW A;  4KGV B;  3OT9 A;  5C24 A;  4WK3 A;  4B9T A;  1XMO F;  2J5A A;  4P7T A;  2CFX A;  1FES A;  2AJ1 A;  2Y3Y A;  4G3I A;  2DH9 A;  5DRK A;  1RI7 A;  4F67 A;  2Y8Y A;  4EEY A;  5D0H A;  4X66 J;  2K2P A;  3A3O B;  4DHV A;  2BRL A;  4BCA A;  1HD0 A;  3ZNJ 1;  2HFV A;  4TU8 A;  4HLB A;  2IM3 A;  2BVZ A;  5IWA J;  4LVO P;  2YWF A;  2JEG A;  3RW6 A;  3LAL A;  4Z7C A;  2ZJP Q;  1WEX A;  4USH A;  4PXC A;  3CSK A;  4KFB A;  1HYS A;  3MOZ A;  3W8P A;  4ZS6 A;  1CVJ A;  4DPO A;  3R2C J;  3MDF A;  1IBK F;  1IJE B;  4ZJQ A;  3P4U B;  1K0V A;  1FI4 A;  2ZNZ A;  2FLP A;  4LF9 J;  2IRU A;  1OPZ A;  3GR1 A;  3P8B B;  3UI3 A;  4DR5 J;  2BJE A;  3OHA A;  3LH2 S;  3BKF A;  3T1H J;  1WC0 A;  2F9D A;  3ONQ A;  3V2U C;  5L9N A;  2GZO A;  1HQ2 A;  1M1G A;  2GMH A;  3AB2 B;  2KFY A;  1QM9 A;  2AHO B;  4CWB A;  2E1M C;  3FSI A;  2ZZT A;  5A8W A;  3M9N B;  3NXZ A;  2AU0 A;  5D4P A;  1ZZF A;  2HS4 A;  2H5J B;  3BGR B;  2OIH A;  4OZ1 A;  1VR6 A;  1ZM4 A;  3BR8 A;  3KJV A;  3FGV A;  3W1Y C;  2H51 B;  4FKX A;  4MAK A;  5KT3 A;  1KKH A;  1WKJ A;  1IKX B;  3TJ9 A;  5I42 A;  3N5F A;  4M5J A;  4XTT A;  1SL1 A;  1R6Y A;  2U1A A;  4DQQ A;  3AHP A;  4K4X A;  1N34 J;  3C66 A;  3D7S B;  3CJT A;  4X4Q A;  5KFL A;  3WX4 A;  2R9L A;  1NH7 A;  3H20 A;  2YNF A;  1LW2 B;  2KFN A;  3VGS A;  2B9W A;  2E66 A;  2CVE A;  1J27 A;  2QMU B;  5DG8 A;  1KRP A;  3MF5 A;  1P9Y A;  4HT7 A;  4GKJ J;  2QFJ A;  1H6K X;  3QT7 A;  4RBV A;  5F8I A;  3KTQ A;  4L75 A;  1RUS A;  3ISN D;  3PW2 A;  1T94 A;  3ICL A;  3OPK A;  2E5J A;  2XI3 A;  1WC5 A;  3QBC A;  1UVI A;  4E8U A;  5E0O A;  4Y0F A;  2C2O B;  3KLF A;  1D9A A;  1SBR A;  2IVM A;  4Q0B A;  3M2R A;  3K0J A;  5ETP A;  1V3S A;  1HKA A;  5ADZ A;  2R2R A;  3MAA B;  2P9C A;  2R7V A;  4U7C A;  2FZC B;  2JLF A;  4ZP6 A;  1F1B B;  1RT4 B;  3Q2T C;  4X4N A;  2J9E A;  4X64 J;  3NGD A;  2MEW A;  1UW4 A;  3V4I B;  1TMM A;  4J9M A;  3MD1 A;  5CD4 H;  1EJ7 L;  2MKS A;  2ZZN A;  1JK9 B;  2XHW A;  1QE1 A;  3LW5 C;  1M5O C;  4ZCM A;  4CM2 A;  1TL5 A;  2KHD A;  2FVQ A;  2O1P A;  5D4L A;  2RB7 A;  3U1N A;  1TAU A;  5HL7 Q;  4JI5 J;  3DU6 A;  1RWX B;  4P10 A;  2AZ1 A;  4DZD A;  2NS1 B;  2CYY A;  4TLQ A;  3I82 A;  2HVE A;  1KS2 A;  3DC2 A;  5U47 A;  4MFB A;  2VIH A;  3IWL A;  2RU3 A;  3CDB A;  4UOC A;  4NXM F;  4OI2 A;  2VFV A;  1T03 A;  2GGP A;  4J90 A;  2OTL S;  4P2X A;  3NGT A;  2CZ9 A;  2FUG 9;  2CNK B;  1UA1 A;  2HVD A;  2G1D A;  4LF7 J;  2B5J B;  2AGO A;  3JSY A;  5GAD I;  4C8Z A;  2DNH A;  1G2E A;  1LV5 A;  4P73 A;  1SUQ A;  1WC6 A;  1XN9 A;  2HHH J;  2OPS A;  1AFI A;  5F0U A;  3W9H A;  2KFZ A;  5EDW A;  4ANC A;  1WHV A;  1KQF B;  1VQ4 S;  4TU7 A;  1VC0 A;  4ECY A;  2XI2 A;  4JI8 J;  1GTE A;  3IR7 B;  5EHH A;  1CBK A;  4MH8 A;  1JB0 C;  3Q24 A;  4A4J A;  1NXI A;  2UUA F;  5HJX A;  4KKO A;  1Y3K A;  4PXE A;  3TRG A;  2CQP A;  2Y0B B;  2FJE B;  2RUS A;  3OL6 A;  1Y4Z B;  5I3U A;  3TAN A;  4C7Q A;  1RP5 A;  2ROP A;  3DGP B;  4DSI A;  2HGM A;  4FYY B;  4RW7 A;  4YY3 F;  2PA3 A;  2FZG B;  4RBT A;  5GAG I;  2OMO A;  2C1E B;  5D78 A;  2B8P A;  1E6V B;  1WG1 A;  1IKY B;  3MPW A;  2E1A A;  3JB9 k;  1R27 B;  1S6Q A;  3TEG A;  5DGA A;  1EET B;  3TAM B;  3E8O A;  3M7V A;  1QY7 A;  1FD2 A;  1LW0 A;  2MGZ A;  4M5I A;  3D5M A;  2VH7 A;  2CPY A;  3BSO A;  4F4K A;  2VKR A;  1S1U B;  4EGL A;  3KUE A;  3KDN A;  3AQO A;  2KHC A;  4NYP A;  1HWU A;  4Z2X A;  2LQB A;  3G82 B;  1UEV A;  1SL2 A;  4IRC A;  2EK1 A;  3RRK A;  3E3X A;  3QZ7 A;  4K7Q A;  1LFP A;  2BAN A;  4A8Y A;  3MZI A;  3UVJ B;  3ADA C;  5A8R B;  1CEZ A;  3IR5 B;  5DJB A;  4DF8 A;  5HLF A;  1MMD A;  2O3D A;  4ED0 A;  2WVD A;  1WWH A;  4RX6 A;  3W2V A;  4K0K F;  2CQC A;  3CJK B;  1LWF A;  4RUA A;  1T9T A;  4EI2 A;  1RTI B;  1WEY A;  4EMD A;  1S1T A;  2VB6 A;  2AGP A;  1UW9 A;  3T9Z A;  1SI9 A;  3IFE A;  3R6G B;  3BSA A;  2VG7 A;  3J7Z T;  2ZVI A;  1RA6 A;  3FCV A;  2QL5 B;  4FPR A;  2NZ4 A;  1UTA A;  2XO7 A;  1S1X B;  4J9R A;  1TTH B;  2JDJ A;  2W2P P;  3D68 A;  1U1P A;  1PYT A;  4QU6 A;  1R0A B;  3QSI A;  2R4F A;  5KFX A;  1ZH5 A;  3PRV A;  3NWR A;  5J1E B;  2OD4 A;  1SVD A;  2V68 A;  5F8G A;  2XMU A;  1RT5 B;  4RNM A;  3TUP A;  5D4N A;  1SKU B;  1FTR A;  3TR5 A;  3KJN B;  1P27 B;  2UUC J;  1Q8B A;  2DHX A;  5KFQ A;  1F3F A;  1RBL A;  1FX2 A;  3OFE A;  1RZM A;  3M2U B;  3RG6 A;  4LF8 J;  2DGT A;  1YJT A;  3KDO A;  1YJ9 S;  4JI3 J;  4IQX A;  4F4A A;  3ENA A;  3EIC A;  5HVH A;  1C2P A;  3H90 A;  3MR6 A;  1UA0 A;  1N8R T;  1HQE A;  2Y0S D;  3HFK A;  5MAO A;  1B0V A;  1HNX J;  3FC9 A;  4NI2 B;  2PEH A;  2I5J B;  3LWM A;  1Y10 A;  1SV5 B;  1K73 T;  3OFF A;  4H54 A;  1Q7Y T;  2HSE B;  1WSV A;  1UFW A;  4RU2 A;  2HMI B;  5C2C A;  2CZ4 A;  2ZBC A;  2J0S D;  1H38 A;  3HDS A;  5IV3 A;  1D0E A;  3IRW P;  2MQM A;  4NPO A;  4CLT A;  2YKA A;  3RAM A;  2MPU A;  3MM5 A;  2P2C B;  3HK2 A;  4F50 A;  1M5V C;  2F4F A;  3HD1 A;  3FQK A;  3KK3 A;  3PIO Q;  3M8Q A;  4FZV A;  3I5C A;  5J1N A;  1HIY A;  2DIS A;  3DKD A;  3CTR A;  2VDI A;  3EWG A;  2LXF A;  1S7I A;  4C11 B;  4DFM A;  1L5U A;  4CDI A;  4OV1 A;  2CPF A;  4BLG A;  4ED3 A;  2XS7 A;  2LDI A;  3Q8V A;  2V50 A;  2PI5 A;  2RAQ A;  1OY6 A;  1HBN A;  2FHM A;  4P52 A;  2PFF B;  2ZH1 A;  2ZHO A;  4ENO A;  5CCM A;  3EPG A;  1QVF R;  4IQM A;  2VDH A;  2AT1 B;  4U7U K;  1GMU A;  2J0W A;  2QTW A;  2UXD F;  2FDN A;  2DO4 A;  1I51 B;  3BJY A;  4CYU A;  3C2P A;  3I5A A;  4HHH A;  5E7O B;  1XBW A;  4E98 A;  5A6P A;  1ZPW X;  1KD1 T;  2YX7 A;  3HVA A;  1Q82 T;  2E9R X;  4O3O A;  2IBO A;  5F41 A;  2JFD A;  3SXL A;  1LK7 A;  3CC2 S;  5F3Z A;  3ZTO A;  2Q6C A;  4Z37 A;  2KJV A;  1NO8 A;  3T1Y J;  2JNJ A;  1QAX A;  3BB5 A;  1S97 A;  5EUH A;  3GG0 A;  5C5J A;  2N82 B;  4KHM A;  2RRA A;  3JAM U;  1VK8 A;  2QA2 A;  1TUW A;  2X7I A;  1NSP A;  2VON A;  4OJG A;  1U1M A;  1H3D A;  4ZPV R;  3U27 A;  1SJQ A;  9ATC B;  4CNY A;  3R5A A;  1FNX H;  1HAR A;  2CJ9 A;  4WF9 Q;  3QFH A;  4FVC A;  4IG0 A;  5LMN J;  2VA2 A;  3I0R B;  1N32 F;  2NXC A;  3J81 j;  1VFJ A;  4LF4 J;  2CPH A;  2AX0 A;  4FVM A;  2VV5 A;  3MGJ A;  5IV4 A;  2ZKU A;  4OX9 J;  2L41 A;  3G9C A;  1LWC B;  3BS9 A;  1UJ5 A;  2K3K A;  3B4D A;  4J9K A;  1NB2 A;  3MED A;  2Y1J A;  3T6J A;  4GC7 A;  3DRR B;  2M2B A;  5KT2 A;  4EYI B;  2B7C B;  2M5Y A;  2MMY A;  5K8M A;  2Q1L A;  3GIK A;  5E3P A;  1KTQ A;  2DRB A;  3BGO P;  1RAH B;  2PFD A;  2DVI A;  1I5O B;  2KKH A;  3M8P B;  3PO5 A;  1HBU B;  2Q3P A;  3BSN A;  2ZH2 A;  2DNL A;  5FDL B;  2MKC A;  2HQG A;  1HBM A;  1Y9O A;  1JLC B;  1F5B A;  3THT A;  2DH7 A;  2KG0 A;  1X4E A;  4EK2 A;  2VF3 A;  2HRY A;  5T7L A;  3KJF B;  4F4W A;  2JVO A;  1XK8 A;  3BV8 A;  3KOA A;  2JC1 A;  2VAS A;  2B6A B;  2OTJ S;  4WFX A;  3PO4 A;  1NPR A;  3KLE A;  1LOU A;  1FJE B;  4RLE A;  2P6T A;  2V8D A;  3P5T L;  3LQV A;  4RKU C;  3SSS A;  3CJS A;  4J5O A;  3H8Y A;  2MTL A;  3T9N A;  4F04 B;  3KNG A;  4DL5 A;  5KG3 A;  2XMK A;  2GVZ B;  4ELU A;  3KUH A;  1ZA1 B;  5ETR A;  4JI6 J;  4LT6 A;  4M5K A;  1S6P B;  4MK7 A;  1WOR A;  2FLO A;  1PG5 B;  3IR6 B;  4TVA B;  2F40 A;  4C3L A;  4FYX B;  2VA3 A;  1H2T Z;  1NJZ A;  1ZET A;  2WVC A;  1PBA A;  2BX6 A;  2BJ9 A;  2VFR A;  3GYG A;  5IT0 A;  1K47 A;  2BE2 B;  3UD5 A;  3J7Z 5;  3SIP B;  5CAB A;  3AOB A;  3G2X A;  5EWF A;  5HRO B;  2ACM A;  1G1X A;  3BYP A;  2ZJQ Q;  2ALY B;  5CD4 A;  4NEZ A;  4DPY A;  2N7C A;  4U96 A;  2AEF A;  3FRY A;  3U02 A;  1XMQ F;  2AYB A;  1DRZ A;  1S1V A;  4ZMM A;  2JEF A;  2XZD B;  4NLS A;  1FKO A;  4NL5 A;  1OYD A;  3B54 A; 
#chains in the Genus database with same CATH homology
 1BHN A;  2BEF A;  2HVD A;  1UCN A;  3Q89 A;  3B6B A;  3FCV A;  3ZTP A;  3EMT A;  2DXF A;  1NDL A;  3MPD A;  3EM1 A;  1PAE X;  4DZ6 A;  1NPK A;  4O0N A;  2VU5 A;  1W7W A;  4AND A;  1LWX A;  1MN7 A;  4F36 A;  1NCL A;  1S5Z A;  3VGV A;  1BE4 A;  1NB2 A;  4UOG A;  2DYA A;  3BH6 B;  1NSQ A;  1S57 A;  3FBC A;  3PRV A;  5CAA A;  4UOH A;  2DXD A;  2NCK L;  1WKK A;  1NLK L;  1XIQ A;  4ANC A;  3VGS A;  1HHQ A;  3BBB A;  3ZTO A;  2CWK A;  1F6T A;  3L7U A;  1WKL A;  3R9L A;  1HLW A;  3FBB A;  5BXI A;  2BX6 A;  4HR2 A;  1S59 A;  1KDN A;  4WBF A;  4DI6 A;  1NHK L;  3VGT A;  3WX8 A;  1PKU A;  1HIY A;  4C6A A;  3DKD A;  1U8W A;  3ETM A;  4UOF A;  1B99 A;  3NGS A;  3BBF A;  1F3F A;  3PJ9 A;  4FKY A;  2HUR A;  1XQI A;  5CAB A;  1ZS6 A;  2DY9 A;  1NDC A;  1MN9 A;  3EJM A;  3FBF A;  3NGU A;  3VGU A;  1NUE A;  3G2X A;  3ELH A;  3Q86 A;  3Q8V A;  2AZ1 A;  3EVM A;  1B4S A;  1NSP A;  3JS9 A;  1EHW A;  3GPA A;  3FBE A;  4F4A A;  2HVE A;  3ENA A;  3ZTQ A;  4EK2 A;  3EIC A;  3NGR A;  3Q8Y A;  4S0M A;  4W98 A;  1K44 A;  3FCW A;  3DDI A;  3Q8U A;  2ZUA A;  4KPC A;  3EVW A;  5IOL A;  1LEO A;  4ENO A;  3VVU A;  1NDP A;  3EVO A;  3FKB A;  3ZTR A;  1NDK A;  2B8Q A;  1BUX A;  4ANE A;  3FC9 A;  3GP9 A;  5C7P A;  3BBC A;  1JXV A;  4DUT A;  3BH7 B;  3ZTS A;  3Q83 A;  1VYA A;  2B8P A;  3NGT A;  3EE3 A;  2DXE A;  1NSK L;  3B54 A;  4CP5 A;  4FKX A;  3VVT A;  1WKJ A;  2AZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...