2DXEA

Crystal structure of nucleoside diphosphate kinase in complex with gdp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
154
Chain Sequence
ETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFFKPEELFEYPRAADWFYKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nucleoside diphosphate kinase in complex with GDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 51
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2dxeA00
1BE4A 1MN9A 3VGUA 4W98A 3R9LA 1NB2A 3FCWA 3PJ9A 2DXDA 3BH7B 1F3FA 3ETMA 4WBFA 3WX8A 3ZTPA 3FBCA 1NDKA 2BX6A 1NDCA 3Q8YA 3Q86A 4ANCA 1BUXA 4CP5A 3Q83A 1EHWA 1NSPA 3EVOA 2HURA 2ZUAA 3EM1A 2AZ1A 4FKYA 3PRVA 1PAEX 1K44A 1HHQA 2BEFA 4O0NA 3DDIA 3FBFA 1LWXA 1NHKL 4KPCA 1W7WA 3B54A 3NGUA 3MPDA 1MN7A 1S59A 3BBCA 3BH6B 4FKXA 3EE3A 3L7UA 2B8PA 2DY9A 3VGTA 1NSKL 4UOGA 1ZS6A 1F6TA 2HVEA 3EVWA 3FBEA 2CWKA 5IOLA 3JS9A 3ZTQA 1NPKA 1U8WA 1NCLA 3NGSA 4UOFA 3EVMA 1HIYA 1NDPA 1NSQA 3ELHA 2VU5A 3ZTSA 3ENAA 4F4AA 4HR2A 3ZTOA 4S0MA 3Q89A 4DI6A 3EMTA 1WKLA 1HLWA 3FBBA 1UCNA 3FC9A 1S5ZA 3B6BA 3G2XA 3Q8UA 3Q8VA 5CAAA 5CABA 5BXIA 2HVDA 3BBBA 4UOHA 3FKBA 3GPAA 3EJMA 2AZ3A 1WKKA 3DKDA 5C7PA 4C6AA 3NGRA 1KDNA 2B8QA 3NGTA 3VGSA 3EICA 3GP9A 1NLKL 4F36A 2DXEA 1NUEA 4EK2A 1PKUA 1XIQA 1B4SA 3VVTA 2DXFA 2DYAA 1NDLA 1LEOA 3VGVA 3ZTRA 3BBFA 4DZ6A 1VYAA 1S57A 4ENOA 1BHNA 2NCKL 3FCVA 1XQIA 4ANDA 1B99A 4ANEA 1WKJA 4DUTA 1JXVA 3VVUA
chains in the Genus database with same CATH superfamily
3CDBA 4K4WA 2A2DA 2PMWA 3GFHA 1MWYA 2X1GA 2OSQA 3HHKA 4YB6A 4ETXA 3SV3A 3SCKE 3TARA 1NJWA 1C1BA 2ROGA 2NXJA 1RISA 3CCWA 3C6UA 1JLGB 3VZIA 3UW1A 2BA9A 5EGYA 4UOCA 5LT5A 2UXBF 3N5BA 4WPAA 5HO4A 2G2OA 2GO9A 4DLGA 1VQNS 1RZMA 2C3UA 1XMOF 3D67A 4J37A 1NKEA 4OJHA 3QLHA 2WBRA 4NRTA 4J9SA 1FNXH 1L3KA 4ELVA 2ZUAA 3C6UB 1R8BA 4ZVPB 4C8KA 1MMLA 2PA3A 2V8GA 1T05A 1JIHA 4L74A 3TWZA 4F02A 2FJXA 2C3MA 5KG2A 3BGRA 3MCSA 3IBCB 4Z7CA 3MUVP 1RTIA 3HZEA 1FRLA 2UV8A 4ZJOA 1RE1B 4LMZA 1QAXA 1S1WB 1WF2A 2G0CA 1LWEA 2O3DA 2C2EA 1N33F 4P7TA 4FBTA 4J9RA 1PILA 3AD8C 2D69A 5F0WA 1HR0F 1N5QA 2KM8C 2FDNA 2J5AA 4I2QB 5L38A 1SIZA 1C4AA 3LP2B 1QJHA 3GJRB 1TELA 4RR5A 4QWBA 4O4GB 1CG2A 3TA2A 1JLFB 1S59A 4CLFA 1T9VA 4NYZA 2APOA 3M7VA 2PMZD 3PFOA 4O3OA 1S1WA 5F9LA 1VK8A 3QYYA 3FSIA 4NLGA 4B17A 3SQGA 5DG8A 1NSKL 2ZWOA 1LWCB 1DURA 4MK7A 2OEKA 1J5EJ 2XWYA 2P2CB 1YQHA 1CJVA 1K0VA 1M0SA 2V4RA 4DV7F 1T3OA 2IM3A 1FKPB 2Z58B 1W25A 3E51A 2GGPB 4HT5A 2YNGB 5C42B 3GWCA 3D9BA 4W90B 3V6KA 5IQQA 3OSPA 1TL3A 4DUZJ 3SCIE 3J81j 3RTVA 4EEYA 1RT2B 1L3VA 2DD8S 4MYUA 2RRNA 4A4JA 2MZJA 4HR2A 1JNZB 3M2RA 1WC4A 3FSYA 4USKA 4F4AA 3Q0AA 2FJWA 2M0GB 2FVSA 2DTJA 2IC3B 2VONA 4TY9A 3J7AN 2KDOA 5L1KA 2WBMA 1Y0HA 1VR6A 2VBXA 1R8PA 1VC5A 4M1KA 3LP1A 5ETVA 2OO4A 1UMJA 4U8YA 1UA0A 4NL5A 1FEEA 3L09A 2W7OA 3M8PB 3JTOA 3DXSX 2FGOA 4Y65A 3BSCA 2AZ3A 5KFNA 3OTOJ 3HM9A 3PFEA 1VBYA 1RXOB 5C7PA 2YKAA 5ETSA 4A48A 4C48A 2HYIB 2HHQA 2V0NA 1RHUB 5L39A 4YHHF 2WONB 2J0QD 3NP5A 4PR6A 3OBIA 4EWTA 5LXYA 4Q0BA 1Q7YT 3CDEA 4K4SA 3DU6A 4B9NA 1UVMA 2CPFA 3M8QB 1HNIB 1NPRA 1VRUB 3T9ZA 1LWCA 1HWUA 5DLGA 4DMZA 1S9FA 1FD2A 4PQAA 4OYZA 5FDLA 1PYOB 4IDKB 3RBZA 2DEJA 4E2FB 1NJXA 1CQMA 1KHWA 1O6XA 1IKXB 2HFVA 2HPUA 3HSZA 2IY5B 1LEOA 3R27A 1SC6A 4KJIA 3M8QA 1B70B 1FWPA 1PJ6A 2B4OA 1VRUA 4LSNA 4Q2MA 1RWMB 3O5TB 2AYMA 1Y3JA 2AEJA 2O67A 3EZUA 1FRKA 4PG6A 4P2SA 2HHVA 3KJVA 4ECXA 4D3GA 2Z0GA 1ZM9A 3DI6A 4AL7A 1RP5A 4F50A 4M5GA 3OL9A 2HZAA 1SVDA 2JX2A 2PC6A 2I0XA 1O51A 2EFVA 4KH0B 2HMIB 1JX4A 3BDEA 3U1MA 2DXDA 3DHWC 4NZ7A 1R43A 2PGCA 3DRPA 4NLSA 3TI0A 3KKFA 5D77A 3JSMA 4ECVA 3T6BA 2NUUG 3VF0B 5J2QA 5KFGA 1V6HA 4FPIA 4TLQA 4ECWA 1VBKA 2P9EA 2ZVSA 2FY8A 4ID8A 3KK2B 3VAJA 4B3TF 4WK1A 3H90A 2YH1A 4CP5A 3TJ8A 4DDFA 2R7XA 1VJWA 5KFAA 2FLLA 1JLQB 1RTDA 1WHYA 3G82A 4D3HA 1M1KT 3WIUA 3FFIB 4HEA9 4O3RA 2L48A 2LEAA 4C97A 4F0HA 1NJYA 4OZ2A 1RWWB 2BYCA 2LQBA 3EUNA 1HHQA 4USVA 2E1RA 4UUXA 2GA7A 4TY8B 3H5YA 2HNDA 4DR4J 2ZOGA 1P6TA 5LSRA 4M5IA 2W9CB 4DX6A 4CLTA 5IT4A 4I69A 3ILLA 1CJKA 2FVCA 1ACMB 4LF6F 5D6GA 2J8AA 2K06A 2W4DA 5H1SV 3DGVA 4GKKJ 1YWXA 1ZAVA 4DV0F 2XGPA 1IVZA 1RDRA 1WOPA 4DR3J 4ZHRB 3FUYA 3I4PA 2DT9A 3R6LB 2G0IA 2J0XA 2W9AA 1FXLA 2GIQA 4O4GA 1IBMJ 4DFMA 2K3KA 2M70A 4RUAA 4F04B 1N34J 1TVRA 4NWBA 1NCLA 4JI8J 5CXTA 3DLEB 2KM8B 1J5EF 2DGWA 3EWGA 1S1VB 2RHQB 4FP9A 3RAMA 4IOCQ 1UJ6A 2BJ9A 2OSRA 1NSQA 2EI5A 2CYYA 4ID5A 2VPZB 2NLWA 1PGZA 2JEJA 4QIEA 4NA1A 2WVDA 1GK8A 2LECA 1MNEA 3X3UA 3NY0A 3EYZA 2UUTA 3CJ8A 2G9OA 3UVJB 2V2KA 7FDRA 4RNMA 2RS2A 1YJRA 3OJSA 1LFWA 3FBBA 3MCNA 4DX5A 2GCFA 4ICLB 3SMZA 4I7FA 4A8YA 3PO5A 2UV8G 4ZITA 2A6MA 3GYGA 4UOHA 5CD4H 2BE2A 3MM6A 1CJTB 3D6TB 4WYWA 4C4WA 1UWAA 2D7SA 3HSJA 2F3JA 5HJXA 4RW8B 2XMKA 4ZPWR 4OZ5A 3FZ2A 1BWEA 2DGQA 2EG2A 2H5IB 2KRRA 5B0DA 1NK4A 2HG4A 2XY7A 4C3LA 2E5LF 1WC3A 1NUEA 2B56A 2Q1LA 3H0PA 4DL4A 2X51A 5HP1B 3D3CJ 2MXYA 5CH7B 1R0AB 1KQKA 5BYSA 2VZ9A 1U1PA 1PKUA 4H54A 3MUMP 3TNVA 2C2DA 3N4WA 2ZH9A 1B4SA 5C42A 3MECB 1HHSA 4U7UK 1FF2A 3R5BA 2QLXA 4X4RA 3SV4A 3DHXA 5CHCB 3I0SA 4RJVA 1DTTA 2DH8A 1Q5VA 2W24A 1Q79A 2I1RA 4CO4A 4DBQA 1KEKA 1RLDA 2NZCA 4B9TA 1QVGR 2JVOA 2H3EB 1UZDA 1VDHA 1F9FA 2ZOMA 4K5SA 4MH8A 2HLUA 1Q82T 3K17A 3RB0A 2N3LA 1OY6A 3KLFB 2N4CA 1WDTA 3M2VA 2DVIA 3QGIA 2GQQA 3C2PA 2DGTA 3IMQJ 1SC4B 1F5BA 2CG8A 1FDBA 2GIFA 3DGPA 3DOLB 1T8EA 3M8PA 3PX4A 2OMLA 2HGMA 1F3FA 4QOTA 2GHPA 1WG4A 3PW4A 2AYBA 1N52B 4GO7X 5KG4A 5IQ6A 5ETQA 3R5CA 1TKZA 4CNZA 3FBCA 3OVBA 1NDKA 4FXWA 1VLOA 2C42A 3TQ1A 4GKKF 1K8AT 2L9DA 1T05B 4PG5A 2NPIA 4BC9A 1SL2A 3CJ5A 2B0GA 2RVJA 3D6HB 3K5OA 2B43A 3LTOA 4DU7A 3R2CJ 2RUGA 1FKOA 1WNEA 1KVIA 1OQ3A 1HD1A 3OLAA 4WU2A 4DR4F 3MM8A 4AXIA 2FHKA 4DV6J 3PW5A 2CQ3A 3KK3B 1WC1A 4NASA 5FDLB 2RMLA 5KT7A 4IO9Q 2R8JA 2EC0A 4GKJF 4WKRA 2XWXA 5GMKa 4NPOA 5KFRA 3KYLA 2YX4A 2DGSA 4LF5F 2WVEA 1PSDA 3S8SA 2XQCA 5A8KA 1ZZFA 2CUYA 3QJPA 1H2TZ 3W64A 2HVIA 1YJWS 3NAIA 1W7WA 2CXEA 2HNDB 2R3VA 3O6QA 3A12A 3MOJB 4HLBA 3HZGA 5GAEI 3ET6A 3PHEA 5K14B 2DY9A 2KVIA 1QAJA 2PD1A 1R6VA 1XWLA 4CDIA 3IWXA 2F9DA 1VQOS 4V19X 2O1PA 1Q0NA 1YX2A 3R7SB 1HWIA 2BVZA 1XR6A 1FVQA 1XEZA 1M5SA 9RUBA 2LQ9A 1REVA 4JYAJ 2J9DA 1RABB 1SH3A 2F5GA 1RTJA 4AQYF 1SC1B 1PAUB 1TZ0A 2L9NA 1ZPWX 1ZZNA 2VDHA 5KFIA 1F9HA 1LXNA 4UQGA 3ENAA 3T5LA 2QLJB 1KTQA 1UEVA 3GFXA 4RUHA 3U1LA 2ZH2A 1R8CA 2B7BB 2BJ1A 4Q8EA 2XCAA 2ZFHA 2RH3A 1WWHA 3CJQA 2QLWA 3WDOA 5IC4B 1A7GE 4N56A 4KHRA 1JB0C 3DCAA 3JAMY 4N77A 3F56A 3R2DJ 4EMDA 1HPZB 3ENVA 4X62J 5L9XA 4JI0J 3D54A 3DLHA 1Y11A 4NLXA 2DNPA 1QTMA 1EETA 1CJKB 1U02A 4ZVUB 4CQ1A 3LGHA 5DQHA 5IWAJ 2LLZA 3G96A 4YHHJ 2ATLA 4DSLA 2P6SA 4I7FB 1NK5A 4ZN1A 4WFNQ 2RU3A 3OTOF 5HQLA 3QFHA 2JHEA 2HFZA 2DO4A 1F1BB 2WK4A 3N6NA 3MR6A 2CJBA 3KDNA 4QZVB 3IRXB 3S01A 4JI5F 2DHSA 4HVZA 1P9YA 1S6OA 2WVBA 1FWKA 2VJVA 4L75A 1HWKA 4CO5A 4XO0A 4NA2A 5LMUJ 2ZITA 2CJ9A 4RU9A 3R1LA 1T11A 2MEWA 3BYPA 1EJ7L 3CW2C 4DV4F 4F3OA 5HVFA 1KVKA 3CD0A 4DL0C 3D66A 2KO1A 5K8MA 1LW2B 3OW2R 3LP2A 3D3BJ 3PM9A 1YIJS 3R5GA 2JEFA 3AOCA 3BR8A 2AV5A 1NJIT 2EKNA 1SJRA 1FJEB 4N8NA 3F41A 4JI2F 2YKQA 3D5MA 3T9NA 5EX3A 1FKAF 2DR5A 2QMUB 4NZ0A 2XLJA 5A8WA 3IP0A 3KLGA 1NB2A 1WC5A 3GJTB 3CT9A 4ZLNA 3ITHA 2V34A 2YWWA 1AA1B 3CNQP 3FRZA 5AXMA 3TR5A 3E01B 2YKNA 1HNVA 1IJFB 1FJCA 1DBDA 1WSRA 4TLRA 3JQKA 4B9UA 2NREA 1H2VZ 4WYLA 2HHSA 5HMWA 4DCJB 1M5VC 1NDCA 2HBYB 3POTB 4RW8A 1NH7A 4X4OA 5J2NA 5H9EJ 2DR6A 1U1RA 2HS4A 3Q8YA 3T19A 2NQPA 2CQ2A 2HKEA 3G4SS 1RBOB 2GVDA 3W2WA 4C8YA 4FYYB 1RADB 4DV2J 1SH2A 5J2PA 4OV1A 3GCXP 1N32F 4WFZA 4B3OB 4IFYA 2UXCJ 1YLXA 1KR4A 3M8WA 2HFNA 3V4IB 3UDCA 2I2YA 3TO8A 2HIQA 4EYIB 3MECA 2AEFA 3KLVA 1U1LA 1K44A 4KKOA 1I51B 4MIBA 3UCGA 2W2QP 1WC6A 1ZPVA 4ED2A 1FRHA 5SZTA 4MFBA 1S72S 2AGPA 5EN1A 1AXQA 5LM7E 3PEJA 3QWPA 4RWXA 3KK1A 1XMOJ 2VOOA 2JH3A 2HRYA 3D0IE 1TMJA 2CQIA 3MPDA 2R8GA 3V6HA 3CDUA 1CSJA 1WHWA 4Q0BB 4I1TA 4FKXA 3MEGB 4DN9A 3S1TA 2XG8A 3VWSA 1B64A 2KG0A 3TUPA 1RHRB 2FC8A 2Q43A 4WZMA 1RK8A 2CPHA 1F6TA 2R7OA 2OIHA 5GMDA 1AROP 1X4FA 4ZK7M 1TKDA 1FXRA 5ETLA 2B9EA 3CCJS 2G2ZA 2ZHBA 1WJ9A 3Q2TC 2AYGA 5C2CA 4YEAA 3H2LA 3FNNA 1J2VA 3TZXA 5KFJA 3KLHA 2MKJA 3TJAA 3KHLA 2XNQA 4LF9J 2B4UA 4DR6J 1VHIA 4WU3A 2E1PA 2G1HA 4K8RA 3R7BB 1UVIA 2VBZA 2VU5A 2QEXS 2XMMA 3CO0P 3LO3A 2HSEB 5BJRA 4F4ZA 1K9MT 3AY0A 3SCLE 3QGPA 1XNRF 3GYXB 2XI3A 2IPOB 1BQMB 2ZNYA 3O3LA 4MAKA 4MMOA 2ZE2A 4DLEA 3GONA 3N79A 3W2VB 2BQ3A 3HHLC 5HLFA 2WONA 1KQFB 3V4IA 1RT3A 1Q53A 4H4KA 1KSPA 4M5DB 1QM9A 1ITPA 1ICEB 2VG6A 3MM7A 4PXEA 2XMAA 2VBWA 5D4PA 4OHVA 2XO7A 4H4KC 4A8MP 5D3GA 1TUVA 1SV5B 5IXUA 3PW7A 2DR7A 2CA9A 3W5YA 4ZIWA 1FDAA 1SQGA 2YY3A 5GADU 2YWEA 3EPIA 1TK8A 3MR2A 3G82B 2F1FA 3GP9A 1BWVA 3SSQA 1LWFA 1NLKL 2NSCA 4M8LA 1UFWA 4P72A 2Y0SD 4TU7A 1CVJA 4BS2A 4ECUA 2KFZA 2Z4PA 3H4DA 3W8GA 4DF8A 1RT7A 1VIOA 2FC9A 1RT5B 1ZAWA 5LJ3Y 3HP6A 2AJQA 4TY8A 3AOAA 2VB6A 4ZLLA 5AXNA 2DR9A 4F26A 3VVTA 4LRCA 4R0JA 3T41A 3W63A 2MZ1A 2ZM6J 4M5MA 3K7RA 3P49B 2DNMA 1H3DA 4GMKA 2IHR1 2AF6A 1IR2A 2MY8A 3ZTRA 2RDJA 5HL7Q 1HARA 1H7XA 1HQUA 3BYRA 4OZLA 1I5OB 3MEEB 2QV6A 4DL3A 3G71S 2CNOB 2MY7A 2XI2A 1TR0A 1IJEB 5LOQA 1WKJA 2DNRA 4HTIA 1KFDA 4W4MA 3W66A 1LNQA 2UUBJ 2VG7B 3MR7A 3T1HF 2JEIA 2BQUA 3V5RA 5I3QA 2V2ZA 3PJ9A 2IA0A 3T1HJ 1FK9A 3IR6B 3MEEA 3OXFA 4OX9F 5KG7A 1LFPA 1S1VA 2B6AA 2CJXB 1LW0A 4L73A 3QSIA 2HHHF 2BX6A 2H54B 5D0EA 3DRXA 2LMIA 2FHOB 4NLWA 2R2UA 4JI2J 5BYQA 2ILYA 1N5SA 3H2VE 1CULB 5KFVA 3VV2B 2CKWA 1C0TA 3BF4A 4M94A 4YFUA 4NYPA 4USIA 3C8YA 1TMMA 2MLYA 5EWEA 4QIFA 2ZM6F 2OI2A 1J27A 4U6PA 4JI7F 2HVHA 1Q86T 3NGKA 3P4UB 3WHIA 4YDDB 4LF1A 2QRRA 3T5JA 1JLCA 4A8XA 1NK6A 1FJGF 2BANA 2DNLA 1RYSA 3MM6B 1IKYB 3O2IA 1GTHA 2CQCA 2RKIB 3JSYA 1RAHB 3VR1A 4G65A 4YS2A 1L3TA 2YNIB 1IBKF 3DOMA 1ZETA 4KPCA 4FVMA 1JXLA 3QJLA 3H59A 1LK7A 1NRKA 2L9WA 1FX4A 3A8IA 2ALZA 1P27B 3SSSA 1IBCB 5KT2A 3QIPA 1EB0A 4J9UE 4ZPDA 4MFBB 3BH6B 5DDPC 1WHXA 1N36J 4K50A 3ZZTA 1CJUA 2RRBA 3OQ2A 3Q2SC 1OQ6A 1NNDA 1Q8KA 3DOMB 3MTKA 4JBCA 1APSA 2YKPA 2QIFA 4FS2A 1KNZA 1V3RA 2IRUA 2CFXA 3BQ1A 1HW9A 4ED7A 2K8GA 1KTVA 1PBUA 2AEMA 2GIRA 3HT3A 2R2RA 4MIWA 5KFOA 3B4DA 3OUYB 3BQ2A 5J2NB 3CO9A 3F73A 4HHHA 4NZ6A 2HBRB 2FGCA 2FLNA 4YY3J 1YJUA 2VKZG 4WIIA 5J1EA 2CAJA 3HFZB 3QRRA 3DLLQ 4IRDA 2BDPA 3BKFA 3CIMA 4JI4F 1R6YA 2LU1A 4ZCIA 5ADZA 2H5EA 3OUYA 4K4XA 4ED0A 4X2BA 1MROB 4EUVA 2CZ9A 1XK8A 5I42B 3AXMA 4Z37A 2U2FA 2E5IA 3BBBA 5BXIA 2MQOA 4RNHA 1YBTA 1ZTWA 2XZDB 3KK1B 4NXNF 5HLFB 4TN2A 2OUGA 2AWZA 4ECTA 2X3DA 4IRCA 3ICLA 2D3OR 3M6WA 3I96A 3C16A 5AT1B 4RUBA 3KK2A 2CQDA 4I56A 3ILIA 3WZ0A 2CQ1A 2DGVA 2JOQA 2DRDA 3GU0A 3ONQA 3ZZUA 2VIHA 3ZZYA 1KBRA 1KLMB 3KK3A 1FA0A 1FT8A 4OZ0A 1U0SA 3H25A 1VISA 2PMHA 4K59A 4UQTA 3AB2B 3RJMB 4HKQA 3AA8A 3TAPA 1X5PA 1S6QB 1YJVA 3MXHP 1KC8T 5CCMA 1W2BR 1MG7A 1GEHA 3R8YA 4Q5VA 3IRWP 4N7TA 3PIOQ 4ECQA 1AUDA 3ZNUA 2ASDA 2VBYA 1NKBA 2UXBJ 1YZ6A 4DZ6A 2LQ5A 3C14A 3NCPA 1HWLA 3U1NA 4LF2A 4LF7J 1TL5A 4PXBA 5T7LA 4X64J 5K14A 4DR2F 3AH6A 1QLNA 4WP9A 5AJ3F 5HK4A 3HKZD 4PABA 3TP2A 2BOPA 5DS7A 1OYDA 1FHTA 2QL9B 2IYGA 1FFWB 1TTHB 4KQZA 2MGZA 2XS2A 3VAMA 2D3ZA 3MM9B 1X4DA 3JAMU 1BC6A 1U0HB 2YH0A 2QYGA 5A2QU 2ZHAA 3UD4P 1QY7A 2WVFA 3DOKB 5LL6d 3BDPA 2VDIA 4DPYA 2VG7A 4WBFA 3QNWB 4ZVSB 3RUBL 2ZWPA 1IKWB 2RD5C 2XZTB 1UW4A 3TZZA 5I4MA 1REGX 3G6VA 1I94F 2UVWA 1XNQJ 2ZBCA 2DITA 3H20A 1LOUA 2MJNA 3PJXA 5MAOA 3TYTA 2XMWA 1T7PA 4OL8A 1FVSA 5L1IA 3SYZA 1JLAA 2AIRB 4F0MA 2HNYB 4DQQA 3O8WA 4CCHA 4WFAQ 1NSPA 4NLDA 1IR1A 4MT1A 3KHHA 4IG3A 4K4VA 2V4QA 1HNWF 2FHJD 4IKAA 3SIPB 5KFHA 4F4XA 1P1TA 2ACYA 1IBLJ 4ZLJA 2KVQE 3MFHA 1CLFA 2DHAA 1VRTB 4NOHA 1T03B 1QUVA 3KG4A 5KFLA 4RNFA 4PPZA 2D74B 2C3YA 3NEKA 4I6WA 5KFDA 3PY8A 1LWXA 3SSRA 4K0KJ 2F40A 2GV1A 4O23A 2HS3A 5A76A 3HO1A 3U7JA 2BANB 3K89A 4J9NA 1XBWA 3QO9B 2W9BB 3K58A 2KFNA 4FF1A 3PEHA 3SXLA 2ZBRA 1WTFA 3H5UA 1VI7A 2WHOA 3JQMA 3KJVB 1IBKJ 1X31C 2ABYA 5CQGA 4USWA 5ETRA 2W2OP 3OVSA 3QQCD 2BJ7A 3LW5C 4UOGA 4B3SF 3EVWA 4FS1A 2BJDA 3FBEA 1S7HA 1E6YA 2JEGA 1URRA 3M05A 2CWKA 4OJ1A 2DRAA 2R8IA 1U7LA 1TK5A 3GG0A 3GCWP 5KFKA 2V94A 2HRUA 3GR0A 4F3MA 2YTCA 3O1LA 2HAFA 2KXHA 4OI0A 1TKTB 2BKOA 1AFIA 1NK8A 3NBPA 4WTOB 4TYAA 3E2EA 2JRSA 3TAQA 4RW4B 1HW8A 3Q8RB 1CULA 1YJ9S 1DLOB 3D6MB 4LBIA 1R0BG 4IR1A 2YX7A 1W26A 2JC0A 3DFEA 2MKSA 1ZM4A 3BM7A 6FDRA 1JXEA 1GMWD 5DDQC 4R0EA 2M52A 5THWA 3EMTA 4J9MA 3CJ0A 3TX0A 3M2VB 4QQBA 4AE5A 5I3PA 3E01A 3PJWA 2ZEJA 3B6BA 2UUAJ 4WTYA 2YVSA 5D4LA 5KT5A 3DGPB 1WOOA 3KDOA 3AD9C 5GAHU 3FJ2A 2DISA 1Q8IA 2RHSB 1Y3KA 4F7VA 3AB4B 3QSYB 1BXNA 1YBUA 2MDAA 3K5NA 2BBEA 3Q8QB 4P7VA 1KDNA 2QN6B 4WFYA 1L5UA 4OX8A 3LP1B 4NLRA 1FRJA 2OH2A 1GTEA 1PYSB 3DNCA 3PCOB 3TUJC 4LSZB 4CH0S 1QE1A 4DOZA 3I55S 4M5KA 1Y10A 3HHDA 5ETMA 3AODA 2N7CA 4WFXA 2J7KA 3WBZA 5A8RB 3IWNC 1PCAA 1RTHB 1SB6A 3DLGB 1RLCL 1RWVB 3ZNJ1 1B7FA 1G2EA 3N9UC 1RAGB 2DYAA 4ED5A 3DN9A 3ZZOA 2E29A 1RCOB 1NXIA 1PG5B 2CVIA 1NDLA 2JZ5A 2K3IA 4IH7A 2C22A 2WSEC 2P5VA 1UWBB 5AE2A 4GVBB 1GXLA 3LQVA 4NA3A 1D09B 5A8RA 1Y00A 3E3XA 4URSA 1VQPS 3BKTA 2IJNA 4HTJA 2FZGB 1KKHA 3T1AA 4MK8A 4LRAA 1JXVA 1H73A 1BE4A 3MMAA 4LFCF 4ILMA 5E3CA 3DC2A 5T7LB 2J6SA 2ZBIA 2V8DA 1CEZA 2QA4S 5A6WA 4ZA1A 3L4BC 1TAUA 3EGVA 4OZ3A 2O66A 2FVRA 2LEBA 4RW7B 2QLFB 4X4VA 3A8KA 3HJVA 4CYUA 8ATCB 4RBUA 4XTTA 3C16B 5F41A 3A13A 2Y8YA 4CH1A 2B3TB 2MQQA 2LXUA 1TQLA 3GLJA 4DHVA 5EDWA 1HNZJ 4ZVOB 2XO6A 1S6PA 1RGVA 2LVWA 2BE9B 2Z56B 1WI8A 5E3RA 5LJ5Y 2M8HA 1VC0A 2F4VF 1RUSA 1Q95G 4EYHB 1U24A 3HVWA 4C2MA 5DQIA 5JMNA 1DARA 5KFFA 3M9NB 1HI1A 4KC5A 2XLKA 3L3CA 5F0UA 4F2RA 2SXLA 4B3MJ 3GFZA 2FPHX 4XPEA 4OYPA 3GIIA 2DEIA 4PQUB 2R7TA 2N4DA 2V9WA 1N0UA 3MEDA 2L08A 3D0HE 3D1QA 3NGUA 3OXLA 2J0SD 3HHLD 3I9V9 2RF2B 3R5AA 4GO5X 4J9VA 2DK2A 3S7RA 3MR3A 1SL0A 4PWDA 2GQCA 4WJBA 5IV4A 1FFGB 1WTBA 4A8SA 1G4CA 2ATCB 2HGNA 4QCLA 1U2CA 1K47A 1RWUA 3QO9A 4E98A 1SI9A 2AJ1A 3HFKA 4ELUA 3CMAS 3M2UB 4KSEB 4PCQA 5GAEU 2EKYA 3BSAA 3DOLA 3GG1A 2UXCF 2MQPA 4PXDA 4UOFA 3SQGB 4DSIA 1IBLF 3NLCA 5B0GA 1E6VA 2B51A 3CMES 1S0VA 3NCRA 1J5OA 2HHXA 1UVLA 2AMCB 2WB4A 2OPSB 1LW2A 1NDPA 2XTJP 3M6UA 3OHBA 3GQCA 5E2QA 2KYZA 2ZUGA 1EKSA 5J2QB 2ERRA 4XK8C 3IG1A 5CYMB 2IM0A 3HLUA 3Q23A 4DUYF 1EQ0A 1X0PA 4ZP8A 1XN9A 2C2ZB 2N3OA 1S97A 4IG3B 1ZTTA 5H9FK 3KNGA 4HACA 4RBTA 1N54B 4JV2A 3OTCA 5H9EK 1H0HB 1B3TA 1VJQA 4YN3B 2KT5A 1N34F 2PI4A 2GMJA 2ZC3A 4RKUC 5B0FA 1YRUA 3PTWA 4ED4A 1C1CA 3OSNA 1NZ8A 1FFSB 4PPDA 2HVDA 4NRUA 4DS4A 3FKBA 1BD6A 2XY6A 3M32A 3V81A 1T9WA 2OGUA 5T14A 1WKKA 1X7VA 3MPYA 3D28A 5D0HA 2DB1A 4DG1A 2VQFJ 1U6FA 2PI5A 3DRSA 1GQEA 1FEHA 1UL3A 1U2RA 1UZHA 3BPSP 3D6FB 2A2CA 3OR2A 2AX0A 4CLLA 3HDSA 3CMQA 5ETOA 3CPWR 3QAEA 4ZVEA 2M88A 3AJDA 5FLXU 2UVRA 2PT0A 2PE8A 2C2NA 2HEKA 3HCXA 4LFBJ 4P2MA 3Q22A 2YNFB 2ADCA 1MU2B 4QR1A 3AOBA 2NR0A 1LXJA 3M30B 2L41A 4CT9A 4P9SA 1HL6A 4Y3CA 1KONA 2ZJPQ 3C14B 4X66J 3VAIA 1U4BA 1YBAA 3OR2B 3IO1A 1TK0A 5C24A 1EX8A 1RTJB 5K8OA 3NOGA 2VD3A 2ROPA 2F8HA 1SH0A 1KHVA 3G86A 1FERA 3HHLB 2YNFA 3QIPB 1R27B 4XPCA 4YB1P 5HP1A 4PEOA 4W92B 1KQSR 2H4YB 4Y6IA 2G2YA 3EPGA 3N01A 1PC4A 3K8VA 5KFMA 3MURP 4I68A 2XS5A 4X62F 1SBRA 2CQPA 4DUTA 3M8RA 1RI7A 4UUWA 3J81U 4ER8A 1I6JA 5IC6B 1UETA 4NXNJ 1RAFB 2BV3A 2RNEA 3QGGA 1HI0P 3RR8A 1S49A 2BJEA 2OPRB 2V8PA 2JLFA 5EHHA 5IFMA 4ED1A 3BGFA 3NMAA 2GMLA 1FJ7A 2B5JB 6FD1A 4XDDA 1F2HA 2XMJA 4OJ3A 1OJ4A 3TVYA 1F5CA 3V6DB 1JLAB 3P8BB 3WX8A 4PYAA 4EO6A 2DO0A 1HA1A 3KUHA 4QIGA 2CG4A 4Q7AA 1DQAA 3MPUB 2XMVA 4K2JA 4DR1F 3T5HA 3T3FA 4JI4J 1KQGB 4K4UA 3PW2A 4BDPA 2CVEA 4KY3A 4U7CA 2NPFA 3WIVA 3CXCR 5KFQA 3KNAA 4X4UA 3Q83A 1EHWA 2HURA 3MOZA 4ES1A 5DGBA 4J9PA 2EK6A 2PFDA 3PRBA 1SKRA 1SUQB 2XULA 2W4PA 3GFYA 3RG6A 2VG5B 3CJTA 2WAQD 3VCDA 4O3PA 3TAMB 2ZZMA 3TQEA 5JUMA 1IN0A 1FDNA 1UFKA 3CC4S 2VODA 1VLYA 2CJYB 2J7WA 3FFIA 4O0NA 3RBXA 3SI8A 1A0OB 3D2WA 1QSSA 2QMXA 1Y9OA 5E0OA 3AD7C 2VG6B 1UWBA 5I3UA 1SJ3P 4NMXA 2D41A 3PG9A 3OTBA 5EUHA 2XGQA 5HATA 3THTA 3GE9A 5A2QY 4QIVA 3NS7B 2CPXA 2LU2A 3PYDA 4OYOA 3VGTA 2MKKA 1TKXB 2EFOA 3QZ8A 3MMCB 1X0FA 5E33A 3VAKA 1VQ8S 2V8HA 2HBQB 4M63A 3THPA 3TJ9A 1RT7B 4K7QA 4C3MA 4F8RA 4UZBA 3DLKA 2EFNA 4XAKA 4RNNA 2Z30B 1RA6A 2W4CA 2G4BA 3CIZA 3MM5B 3NG8A 1RHQB 3CC2S 2VF3A 4UY85 5DETA 1EIYB 3UCZP 4LFBF 1SIWB 4O44A 5D4OA 4LF8F 2JFDA 1S9GA 3UO0A 3JYTA 5IT9U 4OHWA 3NGDA 2VQFF 5HROA 1UVNA 1XJWB 1FE4A 1TP7A 2RSQA 3EZOA 4LR7A 2Q6BA 2J76E 2KB2A 7AT1B 5DM6Q 4YR2A 4DUZF 1AZSA 4KYZA 1SJ1A 1HD0A 1JLEA 2EEYA 4L76A 5HANA 3UFCX 3W1YC 1WKLA 4Q45A 2UUAF 4R25A 3DLJA 4KPYA 1JLGA 2JLEA 4FDFA 1TL1B 2Y0BB 3MR5A 2B9YA 3DU5A 1P1LA 2J0WA 4KGMA 4P74A 3K59A 1TFYA 1TL7B 3SFGA 3M6VA 1WSVA 3UDLA 5C2GA 2Y8WA 4L72B 2LP4A 3KXDA 2X3GA 3FMWA 2IMWP 2UP1A 3RBDA 1R8HA 1PBAA 3UR3C 1DQ8A 2MQLA 3ISZA 3SQOP 4F0KA 1DJ0A 5HMXA 1U09A 4QW9A 2W2MP 4KFBB 1XMQJ 3OV7A 1S1XA 2M3DA 4ITSA 2RQMA 2HQ3A 5GADI 5JXSA 4R5PA 2ACMA 1G3OA 5DO2A 3WX4A 1ZM2A 3MMCA 1VHFA 2IDLA 3QT5A 2AJFE 4OYWA 1RWPB 3AAWB 1X9SA 5DDOC 3QJJA 1RT4B 2FVPA 1JJHA 1RCXB 3MM5A 1VYAA 2YXLA 1FI4A 5DRKA 5EWGA 4DL5A 1D9AA 1R7IA 3NL0A 3PDNA 3LP0A 2D1CA 1N5YB 2BRLA 2BABA 5SUHA 4NYOA 3C3LA 2WW8A 3MD1A 4B3MF 1FX2A 3I5CA 2GC8A 4P2FA 3VVUA 4HI1A 3QFWA 2VFVA 2UU9F 4UY8T 3R9LA 3JSMB 1AZSB 4RW7A 3GTYX 3FCWA 2ALYB 4UZCA 5KT6A 2F4VJ 2A3JA 3PRDA 2HVZA 4X84A 3DXBA 3ZTPA 5DGAA 3FGVA 4RW4A 1S7IA 3RU0A 1HNZF 2C28A 1JLBB 1UFLA 3JXOA 2CQGA 1S0OA 5KFSA 1PIEA 3HI9A 4C7QA 3PHTA 5E5NA 2AJ2A 2RQCA 4A46A 2WSCC 5J1EB 2EBGA 1N36F 2RAQA 4Q2LA 3OLBA 3C46A 2YKNB 1MU2A 2GJ2A 2QA2A 3CDWA 4OIXA 3VAHA 1L3UA 1H38A 3F0NA 4FKYA 2EFGA 3MAHA 3QWUA 3PRVA 2MKCA 3U02A 3I82A 2VHGA 2VASA 1B0TA 4DXLA 1T9UA 1ELOA 3KMQA 3C6TA 5C5JA 4WP3A 3MM8B 4DJBA 2E44A 1LQ9A 5HMZA 4DV0J 2EW9A 4QU6A 1FWLA 2MTLA 4DV3F 1Y4ZB 3JQJA 4DR7F 2Q79A 4N41A 1M5KC 1Q16B 5JVHQ 1SL1A 4OLPA 4CO1A 4LF6J 1ZH5A 3H40A 1OIAA 1MN7A 1V5IB 2VFUA 2J8SA 1QDUB 2K1RB 4A8OA 3OL6A 3KJQB 5B7WA 1UP1A 4LQ9A 4X65F 1RHMB 4AL5A 4EZ6A 2BM1A 4P2XA 8RUCA 2ZH4A 2OMOA 2DPJA 2IJFA 2OTJS 4Q44A 3CJRA 1NKCA 2E9TA 1SXLA 3M2RB 1C4CA 1ZOTA 3N5FA 4EGLA 4NCAA 1TFWA 3P6YC 2LDIA 3R1HA 4ID5B 1GMWA 4TQRA 4HDHA 2DH9A 4TXSA 2IDEA 4J9QA 1RBLA 2AJ0A 4YUDA 1U48A 5CA5A 4HACB 2KJWA 1ROFA 1NZAA 2IVFB 2IIHA 2IRYA 3GILA 2EBEA 5GAGI 2XYPB 3HHEA 3C15A 2V4JA 3KLIA 1FRMA 2C1EB 4O44B 1WF0A 4KHPF 1M1HA 3UI3A 5KT4A 1RHKB 3HD2A 3CCUS 3BPDA 3GJQB 5F8MA 5KG5A 4USMA 2LQJA 1F0XA 1TL4A 2E5JA 3PR4A 5IV3A 2H51B 3C15B 2XMUA 4OZNA 3KLIB 5KFYA 2X1BA 5G0RA 2DNHA 1O8BA 4RWWA 3PKMA 2LXIA 1RAEB 1TL1A 2R2SA 4DFKA 4YY3F 3W2VA 1U1QA 2B8QA 4LRDA 4YB5A 2JLGA 4QYRA 1YI2S 1S99A 4C8NA 2I38A 1S6PB 4N5SA 1M5PC 5JVGQ 1TV6B 3ZFVA 1TL7A 2M8DB 4KAIA 3EGZA 3IR7B 2DXEA 4DPWA 3IBFB 5F3ZA 4MKYA 2BE7D 2P8IA 3ETOA 3V6DA 1NK7A 1PC5A 2V2QA 3VAFA 2M7SA 3ISNC 2Y9HA 4HDGA 1NPPA 3DI6B 5LMUF 3UQSA 4ZVHA 2K2PA 1NMEB 1VMBA 2R7VA 1U1KA 2GAHC 2RF2A 5ETKA 2JFKA 2X1FA 3H5XA 5HROB 1RAJA 4ZMMA 1YITS 2Q3PA 4DZDA 3B8HA 1VQ9S 4I6YA 2I8EA 4IG0A 2LA4A 2E7VA 1RT4A 2FHJA 1N5TA 4CLYA 5E3AA 1BQNA 1KD1T 2MZTA 2IC3A 4P52A 1MROA 2OTLS 1LV5A 1Q1KA 3MD3A 3MDFA 1XTZA 3N6LA 5FJ4A 3SZ2A 2MSTA 2YNHB 4E8UA 3HVTA 3K5PA 1S1UB 4X4NA 1KOHA 3J80Y 2XHCA 4QR2A 1IM6A 3I56S 2IAJA 4A8FA 4LSNB 1RT1B 3LA0A 2FZCB 1RT3B 2P6TA 2F9JA 3OFHA 3R6GB 2BJ8A 3CJKB 2VH7A 3DM2A 3RYLA 3MF5A 5HJYA 4CIOA 1X4BA 5KG3A 5KAKA 3QZ7A 2RRAA 4M95A 1N33J 1U49A 4I67A 4YR3A 2BKNA 2IM1A 1SUQA 4QPXA 3HX9A 3BKUA 5FLXY 2V50A 4HH1A 4DSFA 4PRFA 2LKZA 1AFJA 2FZKB 1FK9B 2P9GA 1RT1A 2DY1A 1KOOA 3D7SB 3J81Y 2A0FB 3EZ5A 4AQYJ 1UEUA 1QSLA 2Q6CA 1X4HA 2ZNZA 1KP6A 4ICLA 5DQGA 5DDRC 3CC7S 3H98A 4DSEA 4JYAF 4PWDB 1RTZA 4HHJA 1H74A 2BKPA 3LPYA 1T95A 2BEFA 3M32B 2YWFA 3VQTA 1MW7A 2JVRA 2FHMA 2RILA 2ROEA 2LA6A 3OD2A 3OTEA 4K4TA 1HPZA 3B4MA 1HYSB 1GH8A 3DRRB 1EKRA 4ILRA 1JLQA 3ZZ0A 4URGA 1RAIB 2LXFA 1VBZA 1VQSA 1RTDB 1RJJA 3SFUA 4EBCA 2KHDA 2HHUA 2V63A 1K73T 2JJ4D 1HMVA 3I0RA 3TEGA 4NX9A 1HR0J 2PN6A 4MJKA 3BBCA 3OVAA 1H98A 1JLCB 3PX6A 1F3VA 4ZPVR 3UNYA 3PZPA 2A6OA 4O3NA 5KOWA 4OHXA 4ED6A 2FVQA 5RUBA 1WORA 2MHEA 3C19A 5DG7A 4NI2A 1C2PA 2HVEA 2OD4A 3HHNB 2HK2A 2W9CA 1WF1A 1ZAXA 4P6QA 4ECRA 4DL6A 2ZC4A 4LT6A 4CH7A 1U0HA 3FEZA 3M1VB 4U96A 1U8WA 1SKSA 4QIWD 4GKJJ 3KOAA 1SKUB 1NSAA 3RZAA 4GVLA 5D78A 2GNKA 4DV6F 1NBEB 4OZJA 4MKBA 4LRFA 4TVAB 3IAS9 5IT0A 3D4JA 4R8UB 2OELA 3MI7X 2AD9A 3ZTSA 2QX0A 1NK0A 1J5OB 4GVBA 1N88A 4JV0A 4CWBA 4FYDA 2BE2B 4YR0A 2FQQB 4DV3J 2XHWA 2OPRA 1V5VA 4EBEA 2DHGA 3DRSB 1HLWA 1D3WA 1UJ5A 3IM8A 5A8WB 1RKIA 2VFSA 2QG9B 4YP3A 2EWHA 1A6LA 1MLAA 2R4FA 2R42A 2E5HA 3H42A 1T94A 1NU4A 1O5JA 1GAOA 3PKYA 2GW8A 1RWKB 3AHPA 4HHUA 2QGFB 4C3KA 3DKDA 3KG0A 3NRBA 5CCLA 4O0IA 4AL6A 2WOMB 1JNRB 3DRRA 4ETZA 5HI7A 5HN0A 1YTYA 2AGQA 3MTJA 2XB2D 2XLIA 1EARA 3QAUA 4X4SA 4G6VB 1S79A 4DR6F 3F44A 3US5A 4C0HA 2R2TA 1KFSA 4RL1A 1D8YA 5C25B 1S4FA 2CDRB 4ZP6A 1R89A 1VC6A 1N5VA 2A18A 2HWHA 2R8KA 1OYEA 2F65A 3VHQA 3TA0A 2B4VA 3KFWX 3M4XA 2UZAA 4LQ3A 1I3OB 3NOCA 1TV6A 1LWFB 4F25A 4KR0B 5KFTA 4NLOA 1WD6A 1GNKA 1R0CB 1LK5A 1TVRB 3HPOA 2J6TA 4DFPA 5CYJA 1F60B 2YPZA 1KLMA 3W61A 4HI2A 1Q4RA 2IVYA 3A3NB 3UWTA 2KN4A 3LAMA 3MEDB 4ZCMA 1PO6A 2MHNA 2MSSA 4I2PA 4IQMA 2QL5B 2W7AA 2J7UA 4Y2KA 2FD2A 1DFDA 2VV5A 1IKXA 2L3MA 1C1BB 1X5TA 3PYFA 1B99A 2CNNB 3M9OB 2EC2A 3QT7A 4A8WA 4LFAJ 3FSXA 3FZBA 2H5JB 2CQ0A 4WXOA 4DV1J 1U1OA 1D8ZA 2CQBA 3DLKB 4ED8A 5DLFA 2YKOA 1OPZA 1B7YB 2HAIA 2NSBA 5CZXA 4I0WA 4I2PB 3UD3P 2VQEF 4DF4A 4ZOSA 3LGMA 1Q7LB 3PACA 2VPXB 2XSFA 4CLZA 5B0BA 1U8SA 4IFYB 3FDSA 3RGIA 5KFCA 4FF3A 3K2YA 2WOMA 4OHYA 4ZP9A 3BGRB 3H7HB 3PVXA 2FUG9 2HHHJ 5KFBA 1JLEB 4EZ9A 2DNZA 3MUTP 1HBNA 1K1QA 2BACA 3DOKA 3G6YA 3RB6A 2W8KA 3IR5B 2POKA 4OZ1A 2Z2YB 5C25A 4NE9C 2EVZA 4JI8F 4DS5A 2AW0A 5J2MA 1KRPA 2UUBF 5KT3A 2KHCA 4ELTA 3EGWB 2HQFA 1YK9A 3LANA 4RBVA 4JI3F 4MTPA 1HBNB 3W60A 4AYBD 4ECZA 5L8RC 4IQXA 1VQ5S 4ZVQB 1WI6A 2PIIA 4FPRA 5AJ3J 2DJWA 1DTTB 4O4RA 3MZIA 1CS4A 4UT4A 1HBMB 4TU8A 1BY9A 1YSJA 1UPMB 1IM4A 2COLA 5E3PA 4PKDB 3G8SA 2FJVA 3ZXWA 1AW0A 1WC0A 2JSXA 4LF8J 2LEPA 4CLKA 4F4YA 3E8OA 2BJ3A 3ZTQA 2XSJA 3MMBA 2ZHOA 4L3NA 3PV8A 3RB3A 2MGZB 3NAHA 3OFEA 1GT8A 1JJ2R 1HWJA 3WC2A 4NI2B 2JWNA 3DM2B 1S1TB 2W2NP 1BMQB 4BHQA 3ET6B 4JI5J 3OPKA 2J9EA 4CTAA 5F8IA 2QZ8A 4KH1B 1TKZB 2I5JA 1S9EA 4LR9A 4OQJA 3W9JA 2C2KB 4OI2A 3CSKA 3CCRS 3NNHA 4CI0B 2XSJB 3MMBB 4S0MA 1NAQA 3ZTOA 3MCMA 4MKVA 4N47A 4CRJA 3HVRA 2UXDF 3IA0A 1I94J 3Q8SB 3KLGB 1TKTA 1UPPA 1RAOA 2PEHA 4P10A 1U2FA 4QPTA 1WOSA 4IFVB 5H9FJ 1HNVB 1ZYQA 1RB0A 5FD1A 4H4MB 1LKZA 5KG0A 2OD6A 1R8AA 4PAAA 3I9ZA 1BLUA 5AE1A 5CABA 2B5JA 3CD7A 1DLOA 4I64A 5CZVA 2MKYA 4PQUA 2DPIA 2KL8A 2QFJA 4C8LA 3W9HA 4ZN3A 5KG1A 2GAGC 4OI1A 4ECSA 5A8KB 4WCEQ 3HVAA 1VK3A 4NLUA 3IN5A 3CDAA 2HNZA 3CB4A 4TQSA 4NLVA 1N48A 3NGTA 4IFVA 3EXYA 5ETTA 4DPXA 4LF9F 3LUYA 3OFGA 2XYHB 2GHWA 4J5OA 4NLYA 3W62A 1MWZA 3G6ES 3CCES 1S77D 4ZKAA 5A6PA 5HBMB 1C0TB 3M2UA 3BO2A 4KBIA 2V69A 2AKWB 5GMEA 2CNLB 2EPIA 4WWSA 3EDRB 3QT6A 2E1AA 3DLEA 2DXFA 2ZZNA 5D4NA 1K1SA 2IYIA 3IWLA 4JI1F 2GX8A 2LYVA 1NK9A 1VQ7S 5HVHA 4Y2AA 3K8WA 1S1TA 2E7XA 2QSFA 1UVJA 2OKQA 2VJUA 3R3TA 4IYQA 4PXCA 1YVFA 3HVTB 3M8YA 1IWAA 3UD5A 3W65A 2OFGX 4ANEA 2XCPA 3NXZA 5B0AA 1TUWA 1FNMA 3UNGC 3UVJA 1CC7A 2MQ8A 3P5BP 3RAXA 2DCUB 2ZKUA 2QJ3A 1FKPA 3CJKA 2QA1A 2X7IA 5ETNA 2Y3YA 4C8MA 1U6ZA 4L6V3 3SDEB 5KTQA 4X4TA 2XM3A 2IVMA 2J6UA 3THVA 1X5OA 2BMBA 5DJBA 3RRKA 4H4MA 4OYMA 2VC0A 3GZ7A 2DIUA 1RHJB 4RW6A 1QSYA 3MCOA 4B02A 4WKYA 3HT0A 4YMEA 2O5DA 3TW0A 4PG7A 3EVOA 3NWRA 3W8PA 2D3O1 2BW2A 2ZDOA 2WRMA 4RLEA 1H6KX 3EM1A 1R0AA 1HYSA 2ZH5A 4MK9A 2KXFA 2C3OA 4KV8B 4DCOB 3KTQA 3B78A 5KFPA 1PAEX 1Y5LB 2CPYA 1UEKA 2NS1B 3CTRA 2V2VA 3FVYA 3R97A 4LUBA 3GV8B 2AX1A 4BC7A 2QLBB 2HRTA 2CZVC 2HWTA 2IM2A 2O01C 3MGJA 2RT3A 1UAWA 2B4PA 5I42A 3OFFA 4AFFA 5J2PB 2ASJA 4A47A 2YQ0A 1SJ4P 3B54A 5LMNF 1X4CA 2GS8A 4CM0A 5MLCV 4DUYJ 2FJBB 1BQXA 3MAAA 4OHZA 5KFXA 2NYHA 2H48B 5IM0B 1WG1A 4C9DA 4JV1A 2LCWA 2VUGA 1DZ5A 1F2GA 2GVZB 2PA8D 5D0RA 4ERDA 3CWJA 4H4OA 2J9CA 3BB5A 4ZP7A 4NXMF 4TU9A 1ZA2B 4YB7A 2ZJQQ 4CZCA 1Y5IB 2W2PP 4R8UA 3DYAB 3HD1A 2UU9J 4B9VA 4DQRA 1VRQC 3GJSB 5D0GA 3HFVA 1Q81T 1GMVA 5KFWA 5IM0A 2HBZB 1YRXA 4DX8H 1AYEA 1QD1A 4IG0B 3TRGA 5LSLA 2R7QA 3G8QA 4ED3A 2B7CB 3UN5A 3MPWA 2CNKB 2BR0A 3DYAA 1ZA1B 1FTRA 3FQKA 4Y2IA 5GVQA 2VFTA 2N7YA 4JI0F 3Q89A 4WIQA 3I6PA 5U47A 3TZWA 3OJUA 2JC1A 2HMIA 4Y00A 2C2OB 1URNA 2PDAA 4FYWB 2DGXA 3GIJA 3G6XA 2ZDPA 4USHA 1YZ7A 2ZJRQ 4NXMJ 3Q8VA 1NO8A 1N8RT 3EJMA 1A9NB 1M5HA 4OI4A 3LALA 5J1NA 1RWOB 2ZH3A 2OP5A 1CS4B 4M5HA 4AD6A 4CO0A 4IDKA 1T02A 4EO8A 4QWDA 3QIDA 4Z2XA 3EICA 4NLQA 4DQPA 2DNYA 1YKWA 3JTNA 1KS2A 2UVUA 3RR7A 4F3QA 3TVKA 2E5LJ 4Y0FA 1FTCA 4DV5J 1H72C 5HAOA 3H4BA 5A0YA 4G1PA 1U26A 2Y1LB 4P71A 1XNQF 4FNIA 4B08A 3IS9A 4RZRA 1S6UA 4BBYA 1QE1B 4ZLPA 1REVB 3Q8PB 3ENQA 3CCMS 2NXUA 4DR3F 3MWBA 1DAXA 3LWLA 3FEXB 3UDVA 1B0VA 2GJFA 4OV6A 3KLHB 3I0RB 3T5KA 1NB7A 4DR2J 1H7WA 1SJQA 3RRGA 5HQMA 1RT5A 4UF4A 4Y2CA 4B3RF 3KWMA 5DZ7A 3FCVA 2H65B 2BXJA 1RKJA 2HIYA 1XR7A 1JLFA 5KOXA 4WZQA 5HMYA 4LF5J 3IFEA 5AE3A 4U9RA 2HZVA 1MN9A 2HK3A 4W98A 3MAQA 1BQMA 4ZJLA 3ILOA 3IM9A 1HQEB 2M4MA 4USUA 5IZHA 2LFVA 3GIMA 3P45B 4QYZK 1AUSL 3H8YA 1EP4A 3MPVA 4I6AA 1JKHB 4ZJQA 1OSDA 2F7VA 1OS5A 2BRKA 4OMFG 4C0BA 2HNYA 2DR8A 4M5DA 2FTRA 5K8NA 4LBPA 1HBUB 4G1QB 3UCUP 1TL3B 1S0MA 1YJ7A 1NM2A 2WVCA 4PG4A 1V3ZA 1CBKA 3ADAC 3LPEA 4ANCA 3I5BA 2HHTA 3IRXA 1M1GA 4QWAA 5BYRA 1GX5A 1FE0A 1OY9A 1PYTA 1WUUA 5IS2A 2OHDA 4R5PB 2QE5A 4DV7J 4JI1J 2AZ1A 2RS8A 2IMOA 2R7UA 2BUNA 1RAAB 2XZWA 3QRQA 1C0UB 2B9XA 2OPPA 2HW3A 2OFHX 4ZDNA 1MSWD 3LAKA 1CJUB 1XC9A 3IS9B 3M8ZA 4B3OA 1B0PA 4DPOA 1HQ2A 4FZVA 3AT1B 3HSGA 2M9KA 1WHVA 1WDDA 4KE5A 5JJBA 4QYZJ 5D8HB 4OYBA 2VPYB 4KKOB 3WC0A 1CQNA 3BN7A 4HT7A 4QWEA 3QT8A 4KGKA 4LSLB 2CJQA 4JV5J 3M9MB 2IFXA 3SEOA 3EE3A 2MKIA 1IKYA 4DSKA 2W25A 4G1IA 3KG1A 4NLTA 5M2PA 3UN2A 3CF5Q 2KG1A 2U1AA 3JS9A 1UVKA 2CPZA 2OEJA 3CGIA 4TKTA 3KLEA 1QTNB 3V2UC 2EXUA 3BJYA 1VFJA 2KRBA 1OWXA 4F67A 4OJGA 1SQEA 2LDYA 4ZS6A 1HBOB 1FXDA 1SC3B 3J7YU 2XBPA 3N6MA 3CUNA 3UDEA 3SCJE 3CEDA 2RUSA 4RW9B 4UW2A 3OL8A 4ZVTB 1DRZA 1E6VB 4OFZA 5L9NA 4IO1A 2J9DE 4B9LA 4DR5F 2YQ3A 1T9TA 3FQLA 4LJMA 2I6WA 5F9NA 1BGXT 3ENWA 4NCGB 5BR8F 2FY1A 4K0KF 4X66F 3R5DA 3MMAB 5F8GA 2KZMA 2CPJA 1FD8A 2YX1A 2D3UA 3BGUA 2V68A 2MZSA 3FMBA 4C11A 2Y1IA 5K5MA 4LIWA 4CO2A 2CPEA 1YJTA 3GSIA 3BN4A 3L7OA 4OI6A 3RB4A 1HNWJ 4DCPB 2Q66A 3VZHA 2RKIA 2LQ8A 3BO4A 4X64F 2HFUA 4C6AA 2JNJA 2PEBA 2V9KA 3LH2S 5F8LA 4IOAQ 3Q24A 4URQU 3N0VA 3PYGA 3J80U 2AJ4A 4OX6A 4ZPTR 5G4DA 4LVOP 5D3GB 3TZYA 2KYXA 3G87A 4EI2A 2DBBA 4JI3J 4IR9A 1CJVB 4RPFA 5M2UA 1QAIA 3A3PB 1VOMA 4N76A 4LIRA 1IBMF 2AU0A 2RQKA 3BQ0A 2AT1B 3C66A 3CULA 3W5XA 1U1MA 2AYEA 3GB0A 2VICA 4DWIA 3M30A 8AT1B 3IXQA 1M90T 3K5MA 1K0TA 1ULRA 4USJC 2E66A 4KFBA 3BBFA 3UE2A 5L46A 3J7Z5 1Z2ZA 2VPWB 2KZZA 3EGNA 1Q8LA 4ENOA 1BHNA 2NCKL 4ZCLA 4KGXB 2G13A 3P96A 1S9GB 3JYTB 1SPBP 4CLPA 4LVNP 4LF7F 3SDEA 3QRPA 4V1Ak 3ZC4A 4OYIA 3NNCA 3KUGA 5LSOA 3BV8A 2HWIA 1Z4UA 3GV5B 4J7CA 3VGUA 1U47A 1FRIA 2DCLA 1S48A 4K2XA 2AHOB 2K7KA 2HS0A 4AUKA 5BR8J 5KFUA 4C8ZA 1NEEA 3LP0B 3TANA 1N5YA 3I4HX 3ZO7A 1RT6A 4B9MA 4DV1F 3ETMA 5G0RB 3OR1B 3NMRA 2GVDB 4ZPAA 4ZVRB 3W2WB 3W3SA 4ZPBA 1FRXA 2OPSA 2RIJA 2MQNA 5CYQB 4O3QA 4FXDA 1CC8A 3BSOA 2OPQB 4B3TJ 2FJEB 3A8JA 3RW6A 1LW0B 2VL1A 5AXLA 4YDXA 4U7UD 4Z7YA 3FRYA 4FVCA 5EX0A 1T3NA 2DIVA 4JP8A 1HNIA 4MKAA 2I9SA 1HI8A 3CE8A 1RBAA 2E7WA 3NS6A 2FJAB 2PSZA 4K5RA 1GFWB 1JWWA 3TVZA 2KXNB 2V5HG 1V9OA 2ZH6A 2V67A 4RU2A 1Y5NB 3MEGA 3MMJA 4OLOA 1IKVA 4MIAA 4JOUA 1R3NA 2IA6A 4JV5F 1HQUB 1GX6A 4GRSA 2GVZA 4DN0A 5E7OB 4ZVGA 5B08A 1T0TV 4CNYA 1KWMA 1BQNB 4TNOA 1UA1A 3PNIA 4J9OA 3M6XA 5I3UB 2GZOA 1FO1A 4CT8A 1YG0A 1RTHA 3GMGA 3EDQB 1IKVB 2MZQA 3I87A 2XC9A 4DL7A 3TOQA 3AQOA 1N6QA 2ZH8A 3TEHB 1VCTA 4HH0A 5F3TA 4QBUA 4PWUA 3A8EA 1X9MA 1Y7PA 3QBCA 5LXRA 1RSCA 4XIUA 3IG1B 4ALZA 4PUOB 2FB0A 2ILZA 2KTQA 1VQLS 3EVMA 2JL9A 2FIUA 3QMQA 3HJFA 1HBUA 4G1QA 5C24B 3A4TA 1HIYA 3IGNA 5L1LA 4NEZA 1F9EB 3ELHA 3DLBA 2M2BA 1N6QB 2X1AA 3V6JA 3EXCX 1U1NA 3J7ZT 1SCJB 2OPQA 4ES2A 2FJDB 1W2IA 2XNRA 4M5NA 2UUCJ 4YOEA 2R7SA 3ITHB 1QAYA 4DI6A 3RRHA 1X4GA 5L1JA 2ZD1B 4DQSA 4QU7A 3OL7A 3KJFB 2QC3A 4P75A 4B9SA 1UCNA 3FC9A 2OJ3A 2HHWA 4WF9Q 3GYNA 5KG6A 1VS3A 5HVGA 2YNIA 2FLPA 1S4EA 2RJZA 2PO4A 2V4JB 5HBMA 1UW9A 3B82A 4C0OC 4CLWA 5T41A 4B3RJ 4V19J 3A1YG 3NCQA 4C11B 3GV7B 3ISND 1X9WA 4QJVA 5FIIA 2AP6A 1T9YA 2CQ4A 4K4YA 1DTQA 2W9BA 4LF4F 2D9PA 4WFBQ 4LFCJ 2MLZA 5IT9Y 2WZ1A 3AJ1A 3PR5B 4GC7A 4EK2A 2WB1D 3BZQA 2G0JA 3H5SA 1WEYA 5DG9A 2FLOA 1Q78A 1SQFA 4OX9J 3CD6S 4DV5F 4PWWA 2MLXA 3KMSA 4J9LA 2IBOA 1H2UX 4QWCA 2GO8A 1HBOA 4U67Q 1DTQB 3NNAA 2OAUA 2BM0A 3R5JB 1VQ6S 1DY3A 4FYVB 3DDKA 3DMJB 3KUEA 2N82B 2OLWA 3VAGA 4LF4J 2CJKA 2PFFB 3GSDA 1RT2A 2YKMA 1GMUA 3O44A 4ILLA 1X4EA 4ANDA 1GXUA 1PJ7A 4M5JA 4AT1B 4CYUB 3TUZC 4RW6B 4X4QA 4KT0C 4KHMA 1RQ0A 2H1YA 3S6EA 4IRKA 4KIAA 1VIXA 4J91A 2KU7A 1N56A 1L3SA 3RW7A 1G6BA 3HXMA 2MZRA 3BH7B 5KFZA 1ZBTA 3ZZPA 3JSRA 2CRLA 4FF4A 1CJTA 1D9FA 4B3SJ 2YBVA 3IBWA 2CDQA 2QFIA 2FYXA 1U6BA 4CTAB 1RWXB 3AJ2A 3BGOP 2CZ4A 3BR9A 1N0VC 2VA2A 3T1YJ 5ETPA 2M5YA 1IQZA 1BUXA 1C0UA 2KI2A 2VG5A 2ZE2B 4IH6A 4XDCA 2IAJB 4J9KA 1NJZA 1KN6A 2RU9A 3DRPB 5DZ6A 3L9ZA 1T9XA 2IRXA 2KT2A 2QT7A 3SBMA 2W8LA 2ZOFA 4LREA 2HLTA 2ZH1A 3I31A 1D1UA 1RA7A 3FEYB 3MAAB 3HMJG 2YQ1A 2HZCA 2EG1A 2GMHA 3CD5A 1I1GA 1QUPA 2MQMA 3DLGA 3MM7B 2MPUA 4FNHA 3N28A 4JUZA 4DG1B 3FBFA 3LWMA 2QSWA 2C3PA 1FESA 4H4OB 3K0JA 3GIKA 2Z2LA 5LMNJ 1FNOA 1MMNA 1VRTA 3DRYA 1T03A 1AB8A 1OY8A 2F8EX 3FK4A 2D9OA 4KRWA 2CPDA 3CVKA 4OYXA 1NH8A 2HNZB 1P8GA 7FD1A 3VALA 2XY5A 3RAQA 1S10A 1MWQA 4DU8A 3AQPA 2Z2MA 3L7UA 3KLFA 2B8PA 2JDJA 2YKMB 3LOUA 2ZH7A 1U45A 2CJAA 1ZS6A 3BO3A 1OMSA 2OEMA 3LGNA 1UKUA 2RDIA 2HQCA 3CJSA 3QATA 3ULHA 1JMTA 5CYMA 5E3QA 2QYCA 4O3SA 3H2UB 1VQKS 1R31A 1NPKA 4BWJA 2GQ2A 4C98A 1YGYA 3NGSA 3MFIA 3OTDA 2C2MB 3WQPA 2H4WB 2F63A 2MKHA 1IKWA 3DDNA 1P9QC 2H9ZA 2P9CA 3HHLA 2CIMA 5F8HA 2MB0B 4E0DA 1HKAA 2KKHA 4FXVA 4WXWA 4I4BA 2MJUA 2DHHA 5CYQA 1TUGB 4ATNA 1VBXA 2ZKTA 4NLPA 1EZZB 1UJ4A 2F4FA 2GGPA 6AT1B 1RU2A 2RE1A 3OHAA 2UVVA 2HQDA 4PG8A 1GXTA 3HF5A 4F4WA 4IUFA 3FCHA 3M1VA 4ECYA 2NXEA 4OX7A 3PW0A 3ILJA 3NBPB 1EQMA 4WE1B 4FN5A 5K9FA 1G1XA 2WSFC 1SV5A 4Y2MA 4ZCKA 5E41A 4JI6J 2V6AA 3IGVA 4QW8A 3ZZRA 2K7JA 2GHVC 1EP4B 3Q8UA 2V8VA 2QL7B 4LRBA 2B6AB 4WK3A 3TUIC 1DHMA 5CAAA 3P3DA 3X1LB 3AA9A 4ZPCA 2ZVIA 3BREA 3CJ4A 2A10A 3GPAA 3HULA 4DX7A 1N32J 4KGVB 2R9LA 3R7NB 2VOPA 3NWGA 3I5AA 3L7PA 4X65J 4DV2F 2DNQA 1D0EA 2GFFA 2VC1A 3W7BA 4HL9A 2MMYA 1HBMA 1Z2LA 1X8DA 5GAGU 2DGOA 1S76D 3NS5A 4DL2A 2ASLA 2F8MA 1VGYA 1XERA 1S6QA 1HMVB 3CCZA 3MHYA 3TA1A 3UN3A 3EX7B 3HK2A 4F36A 4DR7J 4L3KA 4DQIA 1V3SA 3HKWA 2NYIA 2HGLA 5CD4A 4Q43A 1JQGA 2DNGA 4Y34A 5KFEA 3CCVS 1IXKA 4KV8A 4PUOA 1RTIB 2NXCA 5GAHI 1JJCB 4RUCA 2ZZTA 5AXKA 4NCBA 1ZM3A 4TYBA 5B0EA 2HHPA 4LSLA 1OPIA 1WG5A 1S57A 5HSPA 1HQEA 4PYDA 2G1DA 4A8QA 1KVJA 4BLGA 2Z57B 4I2QA 4U95A 2AGOA 1FCAA 1NHUA 1XQIA 2E9ZA 3CCQS 4Q8FA 1IWGA 4F4KA 1VQ4S 3D1OA 4P73A 2AQ4A 1IQTA 1EAYC 2GJIA 2HFOA 2ZD1A 2YWKA 1MMDA 4CO3A 1HHTP 1HNXF 1O0PA 4WE1A 4BCAA 2W1BA 2B9WA 4J90A 4DV4J 2E9RX 4USTA 4FF2A 3NKYA 3UR0A 1TU0B 3RBEA 2QTWA 2DRBA 1UTAA 1EETB 1IUJA 4EU0A 2UXDJ 1C1CB 2NZ4A 4LR8A 3QLHB 4G3IA 1YRTA 4BWMA 3M8SA 3V81B 3GIRA 5F8JA 2OPPB 2DHXA 3PIPQ 2EK1A 3T1YF 2ASYA 3TAMA 3CJ3A 3T6JA 5B0CA 3KHRA 2ZBQA 4DR5J 3Q86A 2KT3A 3QGHA 2KH9A 1JJ4A 4C8OA 3LF0A 4NCGA 4OI3A 3VQSA 2HFSA 4UTGA 5IWAF 1YJNS 3J7YI 5J1PA 4FBUA 1LWEB 3JSBA 2QA4G 1FJGJ 4KTQA 1OSCA 2R7WA 3G8TA 3PX0A 3BGLA 1HNXJ 1U25A 3AXKA 4JI7J 2W7PA 1Q5YA 2EFPA 2YWGA 2WCXA 2E1MC 2K1RA 1TAQA 3DDIA 4RX6A 2CPIA 2XMTA 3JTPA 3W5ZA 4IOBA 1NHKL 3MEKA 3CCSS 1YHQS 1XMQF 3DMJA 1X60A 2XS7A 3PYEA 2VA3A 4GC6A 2RDDA 3KLEB 3I0SB 1PJ5A 1OO0B 3GR1A 2IJRA 2E1CA 1Z1ZA 3OXGA 5J2MB 3CCTA 2BOAA 1YDLA 3IC1A 4DFJA 4EBDA 2EFQA 3A3OB 2C2RA 1JK9B 2YNGA 2Z2ZA 4KO0B 3ZZZA 4RW9A 2ZBPA 5IOLA 5K8PA 4FYXB 3BSNA 3V4MA 5A0YB 3L95X 4A8KA 2NUHA 2DKOB 1VQMS 3UPFA 5DM7Q 2YWHA 4N8OA 4AXJA 2QO3A 4IH5A 4ZHRA 1N4LA 4DSJA 4Y28C 2CADA 2R8HA 2QMWA 4CLSA 4X4PA 4WP8A 4ES3A 3POTA 1KLNA 3U27A 5B09A 2R7RA 2CWXA 4NEYA 1WACA 2DNKA 1HFEL 2Z8QA 4DPTA 4NMLA 9ATCB 2RB7A 4KGZB 3TX8A 2XEXA 4QR0A 4JB8B 1IR0A 5HQ8A 5K20B 1RU1A 2WTFA 2VQEJ 1WELA 4MYTA 2UUWA 1RACB 1AT1B 1FKOB 3OT9A 4YQWA 1DQ9A 3CJ2A 4DEZA 3PXGa 3AFGA 5M2RA 1S5ZA 3G2XA 3HSDA 3OR1A 4JI6F 4KB7A 1SKWA 1S1UA 4LFAF 5F8NA 2DH7A 2MYFA 2E5GA 1F5AA 3BEGB 3JB9k 2BQRA 1M5OC 2UUCF 4KHPJ 1JKHA 4CLUA 2YPYA 1WEXA 2W01A 1X5SA 2XYGB 2ADBA 4RNOA 1Q8BA 2DNOA 3NGRA 1S12A 2A1BA 4OYAA 4CM2A 3VGSA 1G7CB 1RYRA 3KHGA 2IBKA 3J7A1 3PO4A 3P5TL 4DPUA 2Y1RI 1S0NA 1XR5A 2HQIA 4LBHA 2HQGA 2VFRA 3K57A 1WEZA 1RWNB 3I32A 3K5LA 1TKXA 2DNNA 1XIQA 3C6TB 4KO0A 1SJFA 1QVFR 4ZVFA 1D9DA 1VQYA 1CPZA 2KJVA 5D15A 3VTIA 2BZ2A 4PZVA 1XNRJ 3QPIA 4U8VA 4HYKA 4M5LA 4K4ZA 1FDDA 3VGVA 3D0GE 1S1XB 3D1HA 5EWFA 2Y1JA 3MM9A 3W9IA 2DGUA 2VKRA 5ITHA 3BS9A 2BW7A 2CQHA 2RQ4A 4ZIVA 1RT6B 2I5JB 1S9EB 4DR1J 2YNHA 2KFYA 3CCLS 1NHVA 3D68A 4RO0A 2NXNA 4EFAC 1E6YB 2WW4A 3IAM9 1XMBA 3G9CA 4F2SA 1X4AA 3KJNB 1JLBA
chains in the Genus database with same CATH topology
1BE4A 1MN9A 3VGUA 4W98A 3R9LA 1NB2A 3FCWA 3PJ9A 2DXDA 3BH7B 1F3FA 3ETMA 4WBFA 3WX8A 3ZTPA 3FBCA 1NDKA 2BX6A 1NDCA 3Q8YA 3Q86A 4ANCA 1BUXA 4CP5A 3Q83A 1EHWA 1NSPA 3EVOA 2HURA 2ZUAA 3EM1A 2AZ1A 4FKYA 3PRVA 1PAEX 1K44A 1HHQA 2BEFA 4O0NA 3DDIA 3FBFA 1LWXA 1NHKL 4KPCA 1W7WA 3B54A 3NGUA 3MPDA 1MN7A 1S59A 3BBCA 3BH6B 4FKXA 3EE3A 3L7UA 2B8PA 2DY9A 3VGTA 1NSKL 4UOGA 1ZS6A 1F6TA 2HVEA 3EVWA 3FBEA 2CWKA 5IOLA 3JS9A 3ZTQA 1NPKA 1U8WA 1NCLA 3NGSA 4UOFA 3EVMA 1HIYA 1NDPA 1NSQA 3ELHA 2VU5A 3ZTSA 3ENAA 4F4AA 4HR2A 3ZTOA 4S0MA 3Q89A 4DI6A 3EMTA 1WKLA 1HLWA 3FBBA 1UCNA 3FC9A 1S5ZA 3B6BA 3G2XA 3Q8UA 3Q8VA 5CAAA 5CABA 5BXIA 2HVDA 3BBBA 4UOHA 3FKBA 3GPAA 3EJMA 2AZ3A 1WKKA 3DKDA 5C7PA 4C6AA 3NGRA 1KDNA 2B8QA 3NGTA 3VGSA 3EICA 3GP9A 1NLKL 4F36A 2DXEA 1NUEA 4EK2A 1PKUA 1XIQA 1B4SA 3VVTA 2DXFA 2DYAA 1NDLA 1LEOA 3VGVA 3ZTRA 3BBFA 4DZ6A 1VYAA 1S57A 4ENOA 1BHNA 2NCKL 3FCVA 1XQIA 4ANDA 1B99A 4ANEA 1WKJA 4DUTA 1JXVA 3VVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE4 A;  1MN9 A;  3VGU A;  4W98 A;  3R9L A;  1NB2 A;  3FCW A;  3PJ9 A;  2DXD A;  3BH7 B;  1F3F A;  3ETM A;  4WBF A;  3WX8 A;  3ZTP A;  3FBC A;  1NDK A;  2BX6 A;  1NDC A;  3Q8Y A;  3Q86 A;  4ANC A;  1BUX A;  4CP5 A;  3Q83 A;  1EHW A;  1NSP A;  3EVO A;  2HUR A;  2ZUA A;  3EM1 A;  2AZ1 A;  4FKY A;  3PRV A;  1PAE X;  1K44 A;  1HHQ A;  2BEF A;  4O0N A;  3DDI A;  3FBF A;  1LWX A;  1NHK L;  4KPC A;  1W7W A;  3B54 A;  3NGU A;  3MPD A;  1MN7 A;  1S59 A;  3BBC A;  3BH6 B;  4FKX A;  3EE3 A;  3L7U A;  2B8P A;  2DY9 A;  3VGT A;  1NSK L;  4UOG A;  1ZS6 A;  1F6T A;  2HVE A;  3EVW A;  3FBE A;  2CWK A;  5IOL A;  3JS9 A;  3ZTQ A;  1NPK A;  1U8W A;  1NCL A;  3NGS A;  4UOF A;  3EVM A;  1HIY A;  1NDP A;  1NSQ A;  3ELH A;  2VU5 A;  3ZTS A;  3ENA A;  4F4A A;  4HR2 A;  3ZTO A;  4S0M A;  3Q89 A;  4DI6 A;  3EMT A;  1WKL A;  1HLW A;  3FBB A;  1UCN A;  3FC9 A;  1S5Z A;  3B6B A;  3G2X A;  3Q8U A;  3Q8V A;  5CAA A;  5CAB A;  5BXI A;  2HVD A;  3BBB A;  4UOH A;  3FKB A;  3GPA A;  3EJM A;  2AZ3 A;  1WKK A;  3DKD A;  5C7P A;  4C6A A;  3NGR A;  1KDN A;  2B8Q A;  3NGT A;  3VGS A;  3EIC A;  3GP9 A;  1NLK L;  4F36 A;  2DXE A;  1NUE A;  4EK2 A;  1PKU A;  1XIQ A;  1B4S A;  3VVT A;  2DXF A;  2DYA A;  1NDL A;  1LEO A;  3VGV A;  3ZTR A;  3BBF A;  4DZ6 A;  1VYA A;  1S57 A;  4ENO A;  1BHN A;  2NCK L;  3FCV A;  1XQI A;  4AND A;  1B99 A;  4ANE A;  1WKJ A;  4DUT A;  1JXV A;  3VVU A; 
#chains in the Genus database with same CATH topology
 3CDB A;  4K4W A;  2A2D A;  2PMW A;  3GFH A;  1MWY A;  2X1G A;  2OSQ A;  3HHK A;  4YB6 A;  4ETX A;  3SV3 A;  3SCK E;  3TAR A;  1NJW A;  1C1B A;  2ROG A;  2NXJ A;  1RIS A;  3CCW A;  3C6U A;  1JLG B;  3VZI A;  3UW1 A;  2BA9 A;  5EGY A;  4UOC A;  5LT5 A;  2UXB F;  3N5B A;  4WPA A;  5HO4 A;  2G2O A;  2GO9 A;  4DLG A;  1VQN S;  1RZM A;  2C3U A;  1XMO F;  3D67 A;  4J37 A;  1NKE A;  4OJH A;  3QLH A;  2WBR A;  4NRT A;  4J9S A;  1FNX H;  1L3K A;  4ELV A;  2ZUA A;  3C6U B;  1R8B A;  4ZVP B;  4C8K A;  1MML A;  2PA3 A;  2V8G A;  1T05 A;  1JIH A;  4L74 A;  3TWZ A;  4F02 A;  2FJX A;  2C3M A;  5KG2 A;  3BGR A;  3MCS A;  3IBC B;  4Z7C A;  3MUV P;  1RTI A;  3HZE A;  1FRL A;  2UV8 A;  4ZJO A;  1RE1 B;  4LMZ A;  1QAX A;  1S1W B;  1WF2 A;  2G0C A;  1LWE A;  2O3D A;  2C2E A;  1N33 F;  4P7T A;  4FBT A;  4J9R A;  1PIL A;  3AD8 C;  2D69 A;  5F0W A;  1HR0 F;  1N5Q A;  2KM8 C;  2FDN A;  2J5A A;  4I2Q B;  5L38 A;  1SIZ A;  1C4A A;  3LP2 B;  1QJH A;  3GJR B;  1TEL A;  4RR5 A;  4QWB A;  4O4G B;  1CG2 A;  3TA2 A;  1JLF B;  1S59 A;  4CLF A;  1T9V A;  4NYZ A;  2APO A;  3M7V A;  2PMZ D;  3PFO A;  4O3O A;  1S1W A;  5F9L A;  1VK8 A;  3QYY A;  3FSI A;  4NLG A;  4B17 A;  3SQG A;  5DG8 A;  1NSK L;  2ZWO A;  1LWC B;  1DUR A;  4MK7 A;  2OEK A;  1J5E J;  2XWY A;  2P2C B;  1YQH A;  1CJV A;  1K0V A;  1M0S A;  2V4R A;  4DV7 F;  1T3O A;  2IM3 A;  1FKP B;  2Z58 B;  1W25 A;  3E51 A;  2GGP B;  4HT5 A;  2YNG B;  5C42 B;  3GWC A;  3D9B A;  4W90 B;  3V6K A;  5IQQ A;  3OSP A;  1TL3 A;  4DUZ J;  3SCI E;  3J81 j;  3RTV A;  4EEY A;  1RT2 B;  1L3V A;  2DD8 S;  4MYU A;  2RRN A;  4A4J A;  2MZJ A;  4HR2 A;  1JNZ B;  3M2R A;  1WC4 A;  3FSY A;  4USK A;  4F4A A;  3Q0A A;  2FJW A;  2M0G B;  2FVS A;  2DTJ A;  2IC3 B;  2VON A;  4TY9 A;  3J7A N;  2KDO A;  5L1K A;  2WBM A;  1Y0H A;  1VR6 A;  2VBX A;  1R8P A;  1VC5 A;  4M1K A;  3LP1 A;  5ETV A;  2OO4 A;  1UMJ A;  4U8Y A;  1UA0 A;  4NL5 A;  1FEE A;  3L09 A;  2W7O A;  3M8P B;  3JTO A;  3DXS X;  2FGO A;  4Y65 A;  3BSC A;  2AZ3 A;  5KFN A;  3OTO J;  3HM9 A;  3PFE A;  1VBY A;  1RXO B;  5C7P A;  2YKA A;  5ETS A;  4A48 A;  4C48 A;  2HYI B;  2HHQ A;  2V0N A;  1RHU B;  5L39 A;  4YHH F;  2WON B;  2J0Q D;  3NP5 A;  4PR6 A;  3OBI A;  4EWT A;  5LXY A;  4Q0B A;  1Q7Y T;  3CDE A;  4K4S A;  3DU6 A;  4B9N A;  1UVM A;  2CPF A;  3M8Q B;  1HNI B;  1NPR A;  1VRU B;  3T9Z A;  1LWC A;  1HWU A;  5DLG A;  4DMZ A;  1S9F A;  1FD2 A;  4PQA A;  4OYZ A;  5FDL A;  1PYO B;  4IDK B;  3RBZ A;  2DEJ A;  4E2F B;  1NJX A;  1CQM A;  1KHW A;  1O6X A;  1IKX B;  2HFV A;  2HPU A;  3HSZ A;  2IY5 B;  1LEO A;  3R27 A;  1SC6 A;  4KJI A;  3M8Q A;  1B70 B;  1FWP A;  1PJ6 A;  2B4O A;  1VRU A;  4LSN A;  4Q2M A;  1RWM B;  3O5T B;  2AYM A;  1Y3J A;  2AEJ A;  2O67 A;  3EZU A;  1FRK A;  4PG6 A;  4P2S A;  2HHV A;  3KJV A;  4ECX A;  4D3G A;  2Z0G A;  1ZM9 A;  3DI6 A;  4AL7 A;  1RP5 A;  4F50 A;  4M5G A;  3OL9 A;  2HZA A;  1SVD A;  2JX2 A;  2PC6 A;  2I0X A;  1O51 A;  2EFV A;  4KH0 B;  2HMI B;  1JX4 A;  3BDE A;  3U1M A;  2DXD A;  3DHW C;  4NZ7 A;  1R43 A;  2PGC A;  3DRP A;  4NLS A;  3TI0 A;  3KKF A;  5D77 A;  3JSM A;  4ECV A;  3T6B A;  2NUU G;  3VF0 B;  5J2Q A;  5KFG A;  1V6H A;  4FPI A;  4TLQ A;  4ECW A;  1VBK A;  2P9E A;  2ZVS A;  2FY8 A;  4ID8 A;  3KK2 B;  3VAJ A;  4B3T F;  4WK1 A;  3H90 A;  2YH1 A;  4CP5 A;  3TJ8 A;  4DDF A;  2R7X A;  1VJW A;  5KFA A;  2FLL A;  1JLQ B;  1RTD A;  1WHY A;  3G82 A;  4D3H A;  1M1K T;  3WIU A;  3FFI B;  4HEA 9;  4O3R A;  2L48 A;  2LEA A;  4C97 A;  4F0H A;  1NJY A;  4OZ2 A;  1RWW B;  2BYC A;  2LQB A;  3EUN A;  1HHQ A;  4USV A;  2E1R A;  4UUX A;  2GA7 A;  4TY8 B;  3H5Y A;  2HND A;  4DR4 J;  2ZOG A;  1P6T A;  5LSR A;  4M5I A;  2W9C B;  4DX6 A;  4CLT A;  5IT4 A;  4I69 A;  3ILL A;  1CJK A;  2FVC A;  1ACM B;  4LF6 F;  5D6G A;  2J8A A;  2K06 A;  2W4D A;  5H1S V;  3DGV A;  4GKK J;  1YWX A;  1ZAV A;  4DV0 F;  2XGP A;  1IVZ A;  1RDR A;  1WOP A;  4DR3 J;  4ZHR B;  3FUY A;  3I4P A;  2DT9 A;  3R6L B;  2G0I A;  2J0X A;  2W9A A;  1FXL A;  2GIQ A;  4O4G A;  1IBM J;  4DFM A;  2K3K A;  2M70 A;  4RUA A;  4F04 B;  1N34 J;  1TVR A;  4NWB A;  1NCL A;  4JI8 J;  5CXT A;  3DLE B;  2KM8 B;  1J5E F;  2DGW A;  3EWG A;  1S1V B;  2RHQ B;  4FP9 A;  3RAM A;  4IOC Q;  1UJ6 A;  2BJ9 A;  2OSR A;  1NSQ A;  2EI5 A;  2CYY A;  4ID5 A;  2VPZ B;  2NLW A;  1PGZ A;  2JEJ A;  4QIE A;  4NA1 A;  2WVD A;  1GK8 A;  2LEC A;  1MNE A;  3X3U A;  3NY0 A;  3EYZ A;  2UUT A;  3CJ8 A;  2G9O A;  3UVJ B;  2V2K A;  7FDR A;  4RNM A;  2RS2 A;  1YJR A;  3OJS A;  1LFW A;  3FBB A;  3MCN A;  4DX5 A;  2GCF A;  4ICL B;  3SMZ A;  4I7F A;  4A8Y A;  3PO5 A;  2UV8 G;  4ZIT A;  2A6M A;  3GYG A;  4UOH A;  5CD4 H;  2BE2 A;  3MM6 A;  1CJT B;  3D6T B;  4WYW A;  4C4W A;  1UWA A;  2D7S A;  3HSJ A;  2F3J A;  5HJX A;  4RW8 B;  2XMK A;  4ZPW R;  4OZ5 A;  3FZ2 A;  1BWE A;  2DGQ A;  2EG2 A;  2H5I B;  2KRR A;  5B0D A;  1NK4 A;  2HG4 A;  2XY7 A;  4C3L A;  2E5L F;  1WC3 A;  1NUE A;  2B56 A;  2Q1L A;  3H0P A;  4DL4 A;  2X51 A;  5HP1 B;  3D3C J;  2MXY A;  5CH7 B;  1R0A B;  1KQK A;  5BYS A;  2VZ9 A;  1U1P A;  1PKU A;  4H54 A;  3MUM P;  3TNV A;  2C2D A;  3N4W A;  2ZH9 A;  1B4S A;  5C42 A;  3MEC B;  1HHS A;  4U7U K;  1FF2 A;  3R5B A;  2QLX A;  4X4R A;  3SV4 A;  3DHX A;  5CHC B;  3I0S A;  4RJV A;  1DTT A;  2DH8 A;  1Q5V A;  2W24 A;  1Q79 A;  2I1R A;  4CO4 A;  4DBQ A;  1KEK A;  1RLD A;  2NZC A;  4B9T A;  1QVG R;  2JVO A;  2H3E B;  1UZD A;  1VDH A;  1F9F A;  2ZOM A;  4K5S A;  4MH8 A;  2HLU A;  1Q82 T;  3K17 A;  3RB0 A;  2N3L A;  1OY6 A;  3KLF B;  2N4C A;  1WDT A;  3M2V A;  2DVI A;  3QGI A;  2GQQ A;  3C2P A;  2DGT A;  3IMQ J;  1SC4 B;  1F5B A;  2CG8 A;  1FDB A;  2GIF A;  3DGP A;  3DOL B;  1T8E A;  3M8P A;  3PX4 A;  2OML A;  2HGM A;  1F3F A;  4QOT A;  2GHP A;  1WG4 A;  3PW4 A;  2AYB A;  1N52 B;  4GO7 X;  5KG4 A;  5IQ6 A;  5ETQ A;  3R5C A;  1TKZ A;  4CNZ A;  3FBC A;  3OVB A;  1NDK A;  4FXW A;  1VLO A;  2C42 A;  3TQ1 A;  4GKK F;  1K8A T;  2L9D A;  1T05 B;  4PG5 A;  2NPI A;  4BC9 A;  1SL2 A;  3CJ5 A;  2B0G A;  2RVJ A;  3D6H B;  3K5O A;  2B43 A;  3LTO A;  4DU7 A;  3R2C J;  2RUG A;  1FKO A;  1WNE A;  1KVI A;  1OQ3 A;  1HD1 A;  3OLA A;  4WU2 A;  4DR4 F;  3MM8 A;  4AXI A;  2FHK A;  4DV6 J;  3PW5 A;  2CQ3 A;  3KK3 B;  1WC1 A;  4NAS A;  5FDL B;  2RML A;  5KT7 A;  4IO9 Q;  2R8J A;  2EC0 A;  4GKJ F;  4WKR A;  2XWX A;  5GMK a;  4NPO A;  5KFR A;  3KYL A;  2YX4 A;  2DGS A;  4LF5 F;  2WVE A;  1PSD A;  3S8S A;  2XQC A;  5A8K A;  1ZZF A;  2CUY A;  3QJP A;  1H2T Z;  3W64 A;  2HVI A;  1YJW S;  3NAI A;  1W7W A;  2CXE A;  2HND B;  2R3V A;  3O6Q A;  3A12 A;  3MOJ B;  4HLB A;  3HZG A;  5GAE I;  3ET6 A;  3PHE A;  5K14 B;  2DY9 A;  2KVI A;  1QAJ A;  2PD1 A;  1R6V A;  1XWL A;  4CDI A;  3IWX A;  2F9D A;  1VQO S;  4V19 X;  2O1P A;  1Q0N A;  1YX2 A;  3R7S B;  1HWI A;  2BVZ A;  1XR6 A;  1FVQ A;  1XEZ A;  1M5S A;  9RUB A;  2LQ9 A;  1REV A;  4JYA J;  2J9D A;  1RAB B;  1SH3 A;  2F5G A;  1RTJ A;  4AQY F;  1SC1 B;  1PAU B;  1TZ0 A;  2L9N A;  1ZPW X;  1ZZN A;  2VDH A;  5KFI A;  1F9H A;  1LXN A;  4UQG A;  3ENA A;  3T5L A;  2QLJ B;  1KTQ A;  1UEV A;  3GFX A;  4RUH A;  3U1L A;  2ZH2 A;  1R8C A;  2B7B B;  2BJ1 A;  4Q8E A;  2XCA A;  2ZFH A;  2RH3 A;  1WWH A;  3CJQ A;  2QLW A;  3WDO A;  5IC4 B;  1A7G E;  4N56 A;  4KHR A;  1JB0 C;  3DCA A;  3JAM Y;  4N77 A;  3F56 A;  3R2D J;  4EMD A;  1HPZ B;  3ENV A;  4X62 J;  5L9X A;  4JI0 J;  3D54 A;  3DLH A;  1Y11 A;  4NLX A;  2DNP A;  1QTM A;  1EET A;  1CJK B;  1U02 A;  4ZVU B;  4CQ1 A;  3LGH A;  5DQH A;  5IWA J;  2LLZ A;  3G96 A;  4YHH J;  2ATL A;  4DSL A;  2P6S A;  4I7F B;  1NK5 A;  4ZN1 A;  4WFN Q;  2RU3 A;  3OTO F;  5HQL A;  3QFH A;  2JHE A;  2HFZ A;  2DO4 A;  1F1B B;  2WK4 A;  3N6N A;  3MR6 A;  2CJB A;  3KDN A;  4QZV B;  3IRX B;  3S01 A;  4JI5 F;  2DHS A;  4HVZ A;  1P9Y A;  1S6O A;  2WVB A;  1FWK A;  2VJV A;  4L75 A;  1HWK A;  4CO5 A;  4XO0 A;  4NA2 A;  5LMU J;  2ZIT A;  2CJ9 A;  4RU9 A;  3R1L A;  1T11 A;  2MEW A;  3BYP A;  1EJ7 L;  3CW2 C;  4DV4 F;  4F3O A;  5HVF A;  1KVK A;  3CD0 A;  4DL0 C;  3D66 A;  2KO1 A;  5K8M A;  1LW2 B;  3OW2 R;  3LP2 A;  3D3B J;  3PM9 A;  1YIJ S;  3R5G A;  2JEF A;  3AOC A;  3BR8 A;  2AV5 A;  1NJI T;  2EKN A;  1SJR A;  1FJE B;  4N8N A;  3F41 A;  4JI2 F;  2YKQ A;  3D5M A;  3T9N A;  5EX3 A;  1FKA F;  2DR5 A;  2QMU B;  4NZ0 A;  2XLJ A;  5A8W A;  3IP0 A;  3KLG A;  1NB2 A;  1WC5 A;  3GJT B;  3CT9 A;  4ZLN A;  3ITH A;  2V34 A;  2YWW A;  1AA1 B;  3CNQ P;  3FRZ A;  5AXM A;  3TR5 A;  3E01 B;  2YKN A;  1HNV A;  1IJF B;  1FJC A;  1DBD A;  1WSR A;  4TLR A;  3JQK A;  4B9U A;  2NRE A;  1H2V Z;  4WYL A;  2HHS A;  5HMW A;  4DCJ B;  1M5V C;  1NDC A;  2HBY B;  3POT B;  4RW8 A;  1NH7 A;  4X4O A;  5J2N A;  5H9E J;  2DR6 A;  1U1R A;  2HS4 A;  3Q8Y A;  3T19 A;  2NQP A;  2CQ2 A;  2HKE A;  3G4S S;  1RBO B;  2GVD A;  3W2W A;  4C8Y A;  4FYY B;  1RAD B;  4DV2 J;  1SH2 A;  5J2P A;  4OV1 A;  3GCX P;  1N32 F;  4WFZ A;  4B3O B;  4IFY A;  2UXC J;  1YLX A;  1KR4 A;  3M8W A;  2HFN A;  3V4I B;  3UDC A;  2I2Y A;  3TO8 A;  2HIQ A;  4EYI B;  3MEC A;  2AEF A;  3KLV A;  1U1L A;  1K44 A;  4KKO A;  1I51 B;  4MIB A;  3UCG A;  2W2Q P;  1WC6 A;  1ZPV A;  4ED2 A;  1FRH A;  5SZT A;  4MFB A;  1S72 S;  2AGP A;  5EN1 A;  1AXQ A;  5LM7 E;  3PEJ A;  3QWP A;  4RWX A;  3KK1 A;  1XMO J;  2VOO A;  2JH3 A;  2HRY A;  3D0I E;  1TMJ A;  2CQI A;  3MPD A;  2R8G A;  3V6H A;  3CDU A;  1CSJ A;  1WHW A;  4Q0B B;  4I1T A;  4FKX A;  3MEG B;  4DN9 A;  3S1T A;  2XG8 A;  3VWS A;  1B64 A;  2KG0 A;  3TUP A;  1RHR B;  2FC8 A;  2Q43 A;  4WZM A;  1RK8 A;  2CPH A;  1F6T A;  2R7O A;  2OIH A;  5GMD A;  1ARO P;  1X4F A;  4ZK7 M;  1TKD A;  1FXR A;  5ETL A;  2B9E A;  3CCJ S;  2G2Z A;  2ZHB A;  1WJ9 A;  3Q2T C;  2AYG A;  5C2C A;  4YEA A;  3H2L A;  3FNN A;  1J2V A;  3TZX A;  5KFJ A;  3KLH A;  2MKJ A;  3TJA A;  3KHL A;  2XNQ A;  4LF9 J;  2B4U A;  4DR6 J;  1VHI A;  4WU3 A;  2E1P A;  2G1H A;  4K8R A;  3R7B B;  1UVI A;  2VBZ A;  2VU5 A;  2QEX S;  2XMM A;  3CO0 P;  3LO3 A;  2HSE B;  5BJR A;  4F4Z A;  1K9M T;  3AY0 A;  3SCL E;  3QGP A;  1XNR F;  3GYX B;  2XI3 A;  2IPO B;  1BQM B;  2ZNY A;  3O3L A;  4MAK A;  4MMO A;  2ZE2 A;  4DLE A;  3GON A;  3N79 A;  3W2V B;  2BQ3 A;  3HHL C;  5HLF A;  2WON A;  1KQF B;  3V4I A;  1RT3 A;  1Q53 A;  4H4K A;  1KSP A;  4M5D B;  1QM9 A;  1ITP A;  1ICE B;  2VG6 A;  3MM7 A;  4PXE A;  2XMA A;  2VBW A;  5D4P A;  4OHV A;  2XO7 A;  4H4K C;  4A8M P;  5D3G A;  1TUV A;  1SV5 B;  5IXU A;  3PW7 A;  2DR7 A;  2CA9 A;  3W5Y A;  4ZIW A;  1FDA A;  1SQG A;  2YY3 A;  5GAD U;  2YWE A;  3EPI A;  1TK8 A;  3MR2 A;  3G82 B;  2F1F A;  3GP9 A;  1BWV A;  3SSQ A;  1LWF A;  1NLK L;  2NSC A;  4M8L A;  1UFW A;  4P72 A;  2Y0S D;  4TU7 A;  1CVJ A;  4BS2 A;  4ECU A;  2KFZ A;  2Z4P A;  3H4D A;  3W8G A;  4DF8 A;  1RT7 A;  1VIO A;  2FC9 A;  1RT5 B;  1ZAW A;  5LJ3 Y;  3HP6 A;  2AJQ A;  4TY8 A;  3AOA A;  2VB6 A;  4ZLL A;  5AXN A;  2DR9 A;  4F26 A;  3VVT A;  4LRC A;  4R0J A;  3T41 A;  3W63 A;  2MZ1 A;  2ZM6 J;  4M5M A;  3K7R A;  3P49 B;  2DNM A;  1H3D A;  4GMK A;  2IHR 1;  2AF6 A;  1IR2 A;  2MY8 A;  3ZTR A;  2RDJ A;  5HL7 Q;  1HAR A;  1H7X A;  1HQU A;  3BYR A;  4OZL A;  1I5O B;  3MEE B;  2QV6 A;  4DL3 A;  3G71 S;  2CNO B;  2MY7 A;  2XI2 A;  1TR0 A;  1IJE B;  5LOQ A;  1WKJ A;  2DNR A;  4HTI A;  1KFD A;  4W4M A;  3W66 A;  1LNQ A;  2UUB J;  2VG7 B;  3MR7 A;  3T1H F;  2JEI A;  2BQU A;  3V5R A;  5I3Q A;  2V2Z A;  3PJ9 A;  2IA0 A;  3T1H J;  1FK9 A;  3IR6 B;  3MEE A;  3OXF A;  4OX9 F;  5KG7 A;  1LFP A;  1S1V A;  2B6A A;  2CJX B;  1LW0 A;  4L73 A;  3QSI A;  2HHH F;  2BX6 A;  2H54 B;  5D0E A;  3DRX A;  2LMI A;  2FHO B;  4NLW A;  2R2U A;  4JI2 J;  5BYQ A;  2ILY A;  1N5S A;  3H2V E;  1CUL B;  5KFV A;  3VV2 B;  2CKW A;  1C0T A;  3BF4 A;  4M94 A;  4YFU A;  4NYP A;  4USI A;  3C8Y A;  1TMM A;  2MLY A;  5EWE A;  4QIF A;  2ZM6 F;  2OI2 A;  1J27 A;  4U6P A;  4JI7 F;  2HVH A;  1Q86 T;  3NGK A;  3P4U B;  3WHI A;  4YDD B;  4LF1 A;  2QRR A;  3T5J A;  1JLC A;  4A8X A;  1NK6 A;  1FJG F;  2BAN A;  2DNL A;  1RYS A;  3MM6 B;  1IKY B;  3O2I A;  1GTH A;  2CQC A;  2RKI B;  3JSY A;  1RAH B;  3VR1 A;  4G65 A;  4YS2 A;  1L3T A;  2YNI B;  1IBK F;  3DOM A;  1ZET A;  4KPC A;  4FVM A;  1JXL A;  3QJL A;  3H59 A;  1LK7 A;  1NRK A;  2L9W A;  1FX4 A;  3A8I A;  2ALZ A;  1P27 B;  3SSS A;  1IBC B;  5KT2 A;  3QIP A;  1EB0 A;  4J9U E;  4ZPD A;  4MFB B;  3BH6 B;  5DDP C;  1WHX A;  1N36 J;  4K50 A;  3ZZT A;  1CJU A;  2RRB A;  3OQ2 A;  3Q2S C;  1OQ6 A;  1NND A;  1Q8K A;  3DOM B;  3MTK A;  4JBC A;  1APS A;  2YKP A;  2QIF A;  4FS2 A;  1KNZ A;  1V3R A;  2IRU A;  2CFX A;  3BQ1 A;  1HW9 A;  4ED7 A;  2K8G A;  1KTV A;  1PBU A;  2AEM A;  2GIR A;  3HT3 A;  2R2R A;  4MIW A;  5KFO A;  3B4D A;  3OUY B;  3BQ2 A;  5J2N B;  3CO9 A;  3F73 A;  4HHH A;  4NZ6 A;  2HBR B;  2FGC A;  2FLN A;  4YY3 J;  1YJU A;  2VKZ G;  4WII A;  5J1E A;  2CAJ A;  3HFZ B;  3QRR A;  3DLL Q;  4IRD A;  2BDP A;  3BKF A;  3CIM A;  4JI4 F;  1R6Y A;  2LU1 A;  4ZCI A;  5ADZ A;  2H5E A;  3OUY A;  4K4X A;  4ED0 A;  4X2B A;  1MRO B;  4EUV A;  2CZ9 A;  1XK8 A;  5I42 B;  3AXM A;  4Z37 A;  2U2F A;  2E5I A;  3BBB A;  5BXI A;  2MQO A;  4RNH A;  1YBT A;  1ZTW A;  2XZD B;  3KK1 B;  4NXN F;  5HLF B;  4TN2 A;  2OUG A;  2AWZ A;  4ECT A;  2X3D A;  4IRC A;  3ICL A;  2D3O R;  3M6W A;  3I96 A;  3C16 A;  5AT1 B;  4RUB A;  3KK2 A;  2CQD A;  4I56 A;  3ILI A;  3WZ0 A;  2CQ1 A;  2DGV A;  2JOQ A;  2DRD A;  3GU0 A;  3ONQ A;  3ZZU A;  2VIH A;  3ZZY A;  1KBR A;  1KLM B;  3KK3 A;  1FA0 A;  1FT8 A;  4OZ0 A;  1U0S A;  3H25 A;  1VIS A;  2PMH A;  4K59 A;  4UQT A;  3AB2 B;  3RJM B;  4HKQ A;  3AA8 A;  3TAP A;  1X5P A;  1S6Q B;  1YJV A;  3MXH P;  1KC8 T;  5CCM A;  1W2B R;  1MG7 A;  1GEH A;  3R8Y A;  4Q5V A;  3IRW P;  4N7T A;  3PIO Q;  4ECQ A;  1AUD A;  3ZNU A;  2ASD A;  2VBY A;  1NKB A;  2UXB J;  1YZ6 A;  4DZ6 A;  2LQ5 A;  3C14 A;  3NCP A;  1HWL A;  3U1N A;  4LF2 A;  4LF7 J;  1TL5 A;  4PXB A;  5T7L A;  4X64 J;  5K14 A;  4DR2 F;  3AH6 A;  1QLN A;  4WP9 A;  5AJ3 F;  5HK4 A;  3HKZ D;  4PAB A;  3TP2 A;  2BOP A;  5DS7 A;  1OYD A;  1FHT A;  2QL9 B;  2IYG A;  1FFW B;  1TTH B;  4KQZ A;  2MGZ A;  2XS2 A;  3VAM A;  2D3Z A;  3MM9 B;  1X4D A;  3JAM U;  1BC6 A;  1U0H B;  2YH0 A;  2QYG A;  5A2Q U;  2ZHA A;  3UD4 P;  1QY7 A;  2WVF A;  3DOK B;  5LL6 d;  3BDP A;  2VDI A;  4DPY A;  2VG7 A;  4WBF A;  3QNW B;  4ZVS B;  3RUB L;  2ZWP A;  1IKW B;  2RD5 C;  2XZT B;  1UW4 A;  3TZZ A;  5I4M A;  1REG X;  3G6V A;  1I94 F;  2UVW A;  1XNQ J;  2ZBC A;  2DIT A;  3H20 A;  1LOU A;  2MJN A;  3PJX A;  5MAO A;  3TYT A;  2XMW A;  1T7P A;  4OL8 A;  1FVS A;  5L1I A;  3SYZ A;  1JLA A;  2AIR B;  4F0M A;  2HNY B;  4DQQ A;  3O8W A;  4CCH A;  4WFA Q;  1NSP A;  4NLD A;  1IR1 A;  4MT1 A;  3KHH A;  4IG3 A;  4K4V A;  2V4Q A;  1HNW F;  2FHJ D;  4IKA A;  3SIP B;  5KFH A;  4F4X A;  1P1T A;  2ACY A;  1IBL J;  4ZLJ A;  2KVQ E;  3MFH A;  1CLF A;  2DHA A;  1VRT B;  4NOH A;  1T03 B;  1QUV A;  3KG4 A;  5KFL A;  4RNF A;  4PPZ A;  2D74 B;  2C3Y A;  3NEK A;  4I6W A;  5KFD A;  3PY8 A;  1LWX A;  3SSR A;  4K0K J;  2F40 A;  2GV1 A;  4O23 A;  2HS3 A;  5A76 A;  3HO1 A;  3U7J A;  2BAN B;  3K89 A;  4J9N A;  1XBW A;  3QO9 B;  2W9B B;  3K58 A;  2KFN A;  4FF1 A;  3PEH A;  3SXL A;  2ZBR A;  1WTF A;  3H5U A;  1VI7 A;  2WHO A;  3JQM A;  3KJV B;  1IBK J;  1X31 C;  2ABY A;  5CQG A;  4USW A;  5ETR A;  2W2O P;  3OVS A;  3QQC D;  2BJ7 A;  3LW5 C;  4UOG A;  4B3S F;  3EVW A;  4FS1 A;  2BJD A;  3FBE A;  1S7H A;  1E6Y A;  2JEG A;  1URR A;  3M05 A;  2CWK A;  4OJ1 A;  2DRA A;  2R8I A;  1U7L A;  1TK5 A;  3GG0 A;  3GCW P;  5KFK A;  2V94 A;  2HRU A;  3GR0 A;  4F3M A;  2YTC A;  3O1L A;  2HAF A;  2KXH A;  4OI0 A;  1TKT B;  2BKO A;  1AFI A;  1NK8 A;  3NBP A;  4WTO B;  4TYA A;  3E2E A;  2JRS A;  3TAQ A;  4RW4 B;  1HW8 A;  3Q8R B;  1CUL A;  1YJ9 S;  1DLO B;  3D6M B;  4LBI A;  1R0B G;  4IR1 A;  2YX7 A;  1W26 A;  2JC0 A;  3DFE A;  2MKS A;  1ZM4 A;  3BM7 A;  6FDR A;  1JXE A;  1GMW D;  5DDQ C;  4R0E A;  2M52 A;  5THW A;  3EMT A;  4J9M A;  3CJ0 A;  3TX0 A;  3M2V B;  4QQB A;  4AE5 A;  5I3P A;  3E01 A;  3PJW A;  2ZEJ A;  3B6B A;  2UUA J;  4WTY A;  2YVS A;  5D4L A;  5KT5 A;  3DGP B;  1WOO A;  3KDO A;  3AD9 C;  5GAH U;  3FJ2 A;  2DIS A;  1Q8I A;  2RHS B;  1Y3K A;  4F7V A;  3AB4 B;  3QSY B;  1BXN A;  1YBU A;  2MDA A;  3K5N A;  2BBE A;  3Q8Q B;  4P7V A;  1KDN A;  2QN6 B;  4WFY A;  1L5U A;  4OX8 A;  3LP1 B;  4NLR A;  1FRJ A;  2OH2 A;  1GTE A;  1PYS B;  3DNC A;  3PCO B;  3TUJ C;  4LSZ B;  4CH0 S;  1QE1 A;  4DOZ A;  3I55 S;  4M5K A;  1Y10 A;  3HHD A;  5ETM A;  3AOD A;  2N7C A;  4WFX A;  2J7K A;  3WBZ A;  5A8R B;  3IWN C;  1PCA A;  1RTH B;  1SB6 A;  3DLG B;  1RLC L;  1RWV B;  3ZNJ 1;  1B7F A;  1G2E A;  3N9U C;  1RAG B;  2DYA A;  4ED5 A;  3DN9 A;  3ZZO A;  2E29 A;  1RCO B;  1NXI A;  1PG5 B;  2CVI A;  1NDL A;  2JZ5 A;  2K3I A;  4IH7 A;  2C22 A;  2WSE C;  2P5V A;  1UWB B;  5AE2 A;  4GVB B;  1GXL A;  3LQV A;  4NA3 A;  1D09 B;  5A8R A;  1Y00 A;  3E3X A;  4URS A;  1VQP S;  3BKT A;  2IJN A;  4HTJ A;  2FZG B;  1KKH A;  3T1A A;  4MK8 A;  4LRA A;  1JXV A;  1H73 A;  1BE4 A;  3MMA A;  4LFC F;  4ILM A;  5E3C A;  3DC2 A;  5T7L B;  2J6S A;  2ZBI A;  2V8D A;  1CEZ A;  2QA4 S;  5A6W A;  4ZA1 A;  3L4B C;  1TAU A;  3EGV A;  4OZ3 A;  2O66 A;  2FVR A;  2LEB A;  4RW7 B;  2QLF B;  4X4V A;  3A8K A;  3HJV A;  4CYU A;  8ATC B;  4RBU A;  4XTT A;  3C16 B;  5F41 A;  3A13 A;  2Y8Y A;  4CH1 A;  2B3T B;  2MQQ A;  2LXU A;  1TQL A;  3GLJ A;  4DHV A;  5EDW A;  1HNZ J;  4ZVO B;  2XO6 A;  1S6P A;  1RGV A;  2LVW A;  2BE9 B;  2Z56 B;  1WI8 A;  5E3R A;  5LJ5 Y;  2M8H A;  1VC0 A;  2F4V F;  1RUS A;  1Q95 G;  4EYH B;  1U24 A;  3HVW A;  4C2M A;  5DQI A;  5JMN A;  1DAR A;  5KFF A;  3M9N B;  1HI1 A;  4KC5 A;  2XLK A;  3L3C A;  5F0U A;  4F2R A;  2SXL A;  4B3M J;  3GFZ A;  2FPH X;  4XPE A;  4OYP A;  3GII A;  2DEI A;  4PQU B;  2R7T A;  2N4D A;  2V9W A;  1N0U A;  3MED A;  2L08 A;  3D0H E;  3D1Q A;  3NGU A;  3OXL A;  2J0S D;  3HHL D;  3I9V 9;  2RF2 B;  3R5A A;  4GO5 X;  4J9V A;  2DK2 A;  3S7R A;  3MR3 A;  1SL0 A;  4PWD A;  2GQC A;  4WJB A;  5IV4 A;  1FFG B;  1WTB A;  4A8S A;  1G4C A;  2ATC B;  2HGN A;  4QCL A;  1U2C A;  1K47 A;  1RWU A;  3QO9 A;  4E98 A;  1SI9 A;  2AJ1 A;  3HFK A;  4ELU A;  3CMA S;  3M2U B;  4KSE B;  4PCQ A;  5GAE U;  2EKY A;  3BSA A;  3DOL A;  3GG1 A;  2UXC F;  2MQP A;  4PXD A;  4UOF A;  3SQG B;  4DSI A;  1IBL F;  3NLC A;  5B0G A;  1E6V A;  2B51 A;  3CME S;  1S0V A;  3NCR A;  1J5O A;  2HHX A;  1UVL A;  2AMC B;  2WB4 A;  2OPS B;  1LW2 A;  1NDP A;  2XTJ P;  3M6U A;  3OHB A;  3GQC A;  5E2Q A;  2KYZ A;  2ZUG A;  1EKS A;  5J2Q B;  2ERR A;  4XK8 C;  3IG1 A;  5CYM B;  2IM0 A;  3HLU A;  3Q23 A;  4DUY F;  1EQ0 A;  1X0P A;  4ZP8 A;  1XN9 A;  2C2Z B;  2N3O A;  1S97 A;  4IG3 B;  1ZTT A;  5H9F K;  3KNG A;  4HAC A;  4RBT A;  1N54 B;  4JV2 A;  3OTC A;  5H9E K;  1H0H B;  1B3T A;  1VJQ A;  4YN3 B;  2KT5 A;  1N34 F;  2PI4 A;  2GMJ A;  2ZC3 A;  4RKU C;  5B0F A;  1YRU A;  3PTW A;  4ED4 A;  1C1C A;  3OSN A;  1NZ8 A;  1FFS B;  4PPD A;  2HVD A;  4NRU A;  4DS4 A;  3FKB A;  1BD6 A;  2XY6 A;  3M32 A;  3V81 A;  1T9W A;  2OGU A;  5T14 A;  1WKK A;  1X7V A;  3MPY A;  3D28 A;  5D0H A;  2DB1 A;  4DG1 A;  2VQF J;  1U6F A;  2PI5 A;  3DRS A;  1GQE A;  1FEH A;  1UL3 A;  1U2R A;  1UZH A;  3BPS P;  3D6F B;  2A2C A;  3OR2 A;  2AX0 A;  4CLL A;  3HDS A;  3CMQ A;  5ETO A;  3CPW R;  3QAE A;  4ZVE A;  2M88 A;  3AJD A;  5FLX U;  2UVR A;  2PT0 A;  2PE8 A;  2C2N A;  2HEK A;  3HCX A;  4LFB J;  4P2M A;  3Q22 A;  2YNF B;  2ADC A;  1MU2 B;  4QR1 A;  3AOB A;  2NR0 A;  1LXJ A;  3M30 B;  2L41 A;  4CT9 A;  4P9S A;  1HL6 A;  4Y3C A;  1KON A;  2ZJP Q;  3C14 B;  4X66 J;  3VAI A;  1U4B A;  1YBA A;  3OR2 B;  3IO1 A;  1TK0 A;  5C24 A;  1EX8 A;  1RTJ B;  5K8O A;  3NOG A;  2VD3 A;  2ROP A;  2F8H A;  1SH0 A;  1KHV A;  3G86 A;  1FER A;  3HHL B;  2YNF A;  3QIP B;  1R27 B;  4XPC A;  4YB1 P;  5HP1 A;  4PEO A;  4W92 B;  1KQS R;  2H4Y B;  4Y6I A;  2G2Y A;  3EPG A;  3N01 A;  1PC4 A;  3K8V A;  5KFM A;  3MUR P;  4I68 A;  2XS5 A;  4X62 F;  1SBR A;  2CQP A;  4DUT A;  3M8R A;  1RI7 A;  4UUW A;  3J81 U;  4ER8 A;  1I6J A;  5IC6 B;  1UET A;  4NXN J;  1RAF B;  2BV3 A;  2RNE A;  3QGG A;  1HI0 P;  3RR8 A;  1S49 A;  2BJE A;  2OPR B;  2V8P A;  2JLF A;  5EHH A;  5IFM A;  4ED1 A;  3BGF A;  3NMA A;  2GML A;  1FJ7 A;  2B5J B;  6FD1 A;  4XDD A;  1F2H A;  2XMJ A;  4OJ3 A;  1OJ4 A;  3TVY A;  1F5C A;  3V6D B;  1JLA B;  3P8B B;  3WX8 A;  4PYA A;  4EO6 A;  2DO0 A;  1HA1 A;  3KUH A;  4QIG A;  2CG4 A;  4Q7A A;  1DQA A;  3MPU B;  2XMV A;  4K2J A;  4DR1 F;  3T5H A;  3T3F A;  4JI4 J;  1KQG B;  4K4U A;  3PW2 A;  4BDP A;  2CVE A;  4KY3 A;  4U7C A;  2NPF A;  3WIV A;  3CXC R;  5KFQ A;  3KNA A;  4X4U A;  3Q83 A;  1EHW A;  2HUR A;  3MOZ A;  4ES1 A;  5DGB A;  4J9P A;  2EK6 A;  2PFD A;  3PRB A;  1SKR A;  1SUQ B;  2XUL A;  2W4P A;  3GFY A;  3RG6 A;  2VG5 B;  3CJT A;  2WAQ D;  3VCD A;  4O3P A;  3TAM B;  2ZZM A;  3TQE A;  5JUM A;  1IN0 A;  1FDN A;  1UFK A;  3CC4 S;  2VOD A;  1VLY A;  2CJY B;  2J7W A;  3FFI A;  4O0N A;  3RBX A;  3SI8 A;  1A0O B;  3D2W A;  1QSS A;  2QMX A;  1Y9O A;  5E0O A;  3AD7 C;  2VG6 B;  1UWB A;  5I3U A;  1SJ3 P;  4NMX A;  2D41 A;  3PG9 A;  3OTB A;  5EUH A;  2XGQ A;  5HAT A;  3THT A;  3GE9 A;  5A2Q Y;  4QIV A;  3NS7 B;  2CPX A;  2LU2 A;  3PYD A;  4OYO A;  3VGT A;  2MKK A;  1TKX B;  2EFO A;  3QZ8 A;  3MMC B;  1X0F A;  5E33 A;  3VAK A;  1VQ8 S;  2V8H A;  2HBQ B;  4M63 A;  3THP A;  3TJ9 A;  1RT7 B;  4K7Q A;  4C3M A;  4F8R A;  4UZB A;  3DLK A;  2EFN A;  4XAK A;  4RNN A;  2Z30 B;  1RA6 A;  2W4C A;  2G4B A;  3CIZ A;  3MM5 B;  3NG8 A;  1RHQ B;  3CC2 S;  2VF3 A;  4UY8 5;  5DET A;  1EIY B;  3UCZ P;  4LFB F;  1SIW B;  4O44 A;  5D4O A;  4LF8 F;  2JFD A;  1S9G A;  3UO0 A;  3JYT A;  5IT9 U;  4OHW A;  3NGD A;  2VQF F;  5HRO A;  1UVN A;  1XJW B;  1FE4 A;  1TP7 A;  2RSQ A;  3EZO A;  4LR7 A;  2Q6B A;  2J76 E;  2KB2 A;  7AT1 B;  5DM6 Q;  4YR2 A;  4DUZ F;  1AZS A;  4KYZ A;  1SJ1 A;  1HD0 A;  1JLE A;  2EEY A;  4L76 A;  5HAN A;  3UFC X;  3W1Y C;  1WKL A;  4Q45 A;  2UUA F;  4R25 A;  3DLJ A;  4KPY A;  1JLG A;  2JLE A;  4FDF A;  1TL1 B;  2Y0B B;  3MR5 A;  2B9Y A;  3DU5 A;  1P1L A;  2J0W A;  4KGM A;  4P74 A;  3K59 A;  1TFY A;  1TL7 B;  3SFG A;  3M6V A;  1WSV A;  3UDL A;  5C2G A;  2Y8W A;  4L72 B;  2LP4 A;  3KXD A;  2X3G A;  3FMW A;  2IMW P;  2UP1 A;  3RBD A;  1R8H A;  1PBA A;  3UR3 C;  1DQ8 A;  2MQL A;  3ISZ A;  3SQO P;  4F0K A;  1DJ0 A;  5HMX A;  1U09 A;  4QW9 A;  2W2M P;  4KFB B;  1XMQ J;  3OV7 A;  1S1X A;  2M3D A;  4ITS A;  2RQM A;  2HQ3 A;  5GAD I;  5JXS A;  4R5P A;  2ACM A;  1G3O A;  5DO2 A;  3WX4 A;  1ZM2 A;  3MMC A;  1VHF A;  2IDL A;  3QT5 A;  2AJF E;  4OYW A;  1RWP B;  3AAW B;  1X9S A;  5DDO C;  3QJJ A;  1RT4 B;  2FVP A;  1JJH A;  1RCX B;  3MM5 A;  1VYA A;  2YXL A;  1FI4 A;  5DRK A;  5EWG A;  4DL5 A;  1D9A A;  1R7I A;  3NL0 A;  3PDN A;  3LP0 A;  2D1C A;  1N5Y B;  2BRL A;  2BAB A;  5SUH A;  4NYO A;  3C3L A;  2WW8 A;  3MD1 A;  4B3M F;  1FX2 A;  3I5C A;  2GC8 A;  4P2F A;  3VVU A;  4HI1 A;  3QFW A;  2VFV A;  2UU9 F;  4UY8 T;  3R9L A;  3JSM B;  1AZS B;  4RW7 A;  3GTY X;  3FCW A;  2ALY B;  4UZC A;  5KT6 A;  2F4V J;  2A3J A;  3PRD A;  2HVZ A;  4X84 A;  3DXB A;  3ZTP A;  5DGA A;  3FGV A;  4RW4 A;  1S7I A;  3RU0 A;  1HNZ F;  2C28 A;  1JLB B;  1UFL A;  3JXO A;  2CQG A;  1S0O A;  5KFS A;  1PIE A;  3HI9 A;  4C7Q A;  3PHT A;  5E5N A;  2AJ2 A;  2RQC A;  4A46 A;  2WSC C;  5J1E B;  2EBG A;  1N36 F;  2RAQ A;  4Q2L A;  3OLB A;  3C46 A;  2YKN B;  1MU2 A;  2GJ2 A;  2QA2 A;  3CDW A;  4OIX A;  3VAH A;  1L3U A;  1H38 A;  3F0N A;  4FKY A;  2EFG A;  3MAH A;  3QWU A;  3PRV A;  2MKC A;  3U02 A;  3I82 A;  2VHG A;  2VAS A;  1B0T A;  4DXL A;  1T9U A;  1ELO A;  3KMQ A;  3C6T A;  5C5J A;  4WP3 A;  3MM8 B;  4DJB A;  2E44 A;  1LQ9 A;  5HMZ A;  4DV0 J;  2EW9 A;  4QU6 A;  1FWL A;  2MTL A;  4DV3 F;  1Y4Z B;  3JQJ A;  4DR7 F;  2Q79 A;  4N41 A;  1M5K C;  1Q16 B;  5JVH Q;  1SL1 A;  4OLP A;  4CO1 A;  4LF6 J;  1ZH5 A;  3H40 A;  1OIA A;  1MN7 A;  1V5I B;  2VFU A;  2J8S A;  1QDU B;  2K1R B;  4A8O A;  3OL6 A;  3KJQ B;  5B7W A;  1UP1 A;  4LQ9 A;  4X65 F;  1RHM B;  4AL5 A;  4EZ6 A;  2BM1 A;  4P2X A;  8RUC A;  2ZH4 A;  2OMO A;  2DPJ A;  2IJF A;  2OTJ S;  4Q44 A;  3CJR A;  1NKC A;  2E9T A;  1SXL A;  3M2R B;  1C4C A;  1ZOT A;  3N5F A;  4EGL A;  4NCA A;  1TFW A;  3P6Y C;  2LDI A;  3R1H A;  4ID5 B;  1GMW A;  4TQR A;  4HDH A;  2DH9 A;  4TXS A;  2IDE A;  4J9Q A;  1RBL A;  2AJ0 A;  4YUD A;  1U48 A;  5CA5 A;  4HAC B;  2KJW A;  1ROF A;  1NZA A;  2IVF B;  2IIH A;  2IRY A;  3GIL A;  2EBE A;  5GAG I;  2XYP B;  3HHE A;  3C15 A;  2V4J A;  3KLI A;  1FRM A;  2C1E B;  4O44 B;  1WF0 A;  4KHP F;  1M1H A;  3UI3 A;  5KT4 A;  1RHK B;  3HD2 A;  3CCU S;  3BPD A;  3GJQ B;  5F8M A;  5KG5 A;  4USM A;  2LQJ A;  1F0X A;  1TL4 A;  2E5J A;  3PR4 A;  5IV3 A;  2H51 B;  3C15 B;  2XMU A;  4OZN A;  3KLI B;  5KFY A;  2X1B A;  5G0R A;  2DNH A;  1O8B A;  4RWW A;  3PKM A;  2LXI A;  1RAE B;  1TL1 A;  2R2S A;  4DFK A;  4YY3 F;  3W2V A;  1U1Q A;  2B8Q A;  4LRD A;  4YB5 A;  2JLG A;  4QYR A;  1YI2 S;  1S99 A;  4C8N A;  2I38 A;  1S6P B;  4N5S A;  1M5P C;  5JVG Q;  1TV6 B;  3ZFV A;  1TL7 A;  2M8D B;  4KAI A;  3EGZ A;  3IR7 B;  2DXE A;  4DPW A;  3IBF B;  5F3Z A;  4MKY A;  2BE7 D;  2P8I A;  3ETO A;  3V6D A;  1NK7 A;  1PC5 A;  2V2Q A;  3VAF A;  2M7S A;  3ISN C;  2Y9H A;  4HDG A;  1NPP A;  3DI6 B;  5LMU F;  3UQS A;  4ZVH A;  2K2P A;  1NME B;  1VMB A;  2R7V A;  1U1K A;  2GAH C;  2RF2 A;  5ETK A;  2JFK A;  2X1F A;  3H5X A;  5HRO B;  1RAJ A;  4ZMM A;  1YIT S;  2Q3P A;  4DZD A;  3B8H A;  1VQ9 S;  4I6Y A;  2I8E A;  4IG0 A;  2LA4 A;  2E7V A;  1RT4 A;  2FHJ A;  1N5T A;  4CLY A;  5E3A A;  1BQN A;  1KD1 T;  2MZT A;  2IC3 A;  4P52 A;  1MRO A;  2OTL S;  1LV5 A;  1Q1K A;  3MD3 A;  3MDF A;  1XTZ A;  3N6L A;  5FJ4 A;  3SZ2 A;  2MST A;  2YNH B;  4E8U A;  3HVT A;  3K5P A;  1S1U B;  4X4N A;  1KOH A;  3J80 Y;  2XHC A;  4QR2 A;  1IM6 A;  3I56 S;  2IAJ A;  4A8F A;  4LSN B;  1RT1 B;  3LA0 A;  2FZC B;  1RT3 B;  2P6T A;  2F9J A;  3OFH A;  3R6G B;  2BJ8 A;  3CJK B;  2VH7 A;  3DM2 A;  3RYL A;  3MF5 A;  5HJY A;  4CIO A;  1X4B A;  5KG3 A;  5KAK A;  3QZ7 A;  2RRA A;  4M95 A;  1N33 J;  1U49 A;  4I67 A;  4YR3 A;  2BKN A;  2IM1 A;  1SUQ A;  4QPX A;  3HX9 A;  3BKU A;  5FLX Y;  2V50 A;  4HH1 A;  4DSF A;  4PRF A;  2LKZ A;  1AFJ A;  2FZK B;  1FK9 B;  2P9G A;  1RT1 A;  2DY1 A;  1KOO A;  3D7S B;  3J81 Y;  2A0F B;  3EZ5 A;  4AQY J;  1UEU A;  1QSL A;  2Q6C A;  1X4H A;  2ZNZ A;  1KP6 A;  4ICL A;  5DQG A;  5DDR C;  3CC7 S;  3H98 A;  4DSE A;  4JYA F;  4PWD B;  1RTZ A;  4HHJ A;  1H74 A;  2BKP A;  3LPY A;  1T95 A;  2BEF A;  3M32 B;  2YWF A;  3VQT A;  1MW7 A;  2JVR A;  2FHM A;  2RIL A;  2ROE A;  2LA6 A;  3OD2 A;  3OTE A;  4K4T A;  1HPZ A;  3B4M A;  1HYS B;  1GH8 A;  3DRR B;  1EKR A;  4ILR A;  1JLQ A;  3ZZ0 A;  4URG A;  1RAI B;  2LXF A;  1VBZ A;  1VQS A;  1RTD B;  1RJJ A;  3SFU A;  4EBC A;  2KHD A;  2HHU A;  2V63 A;  1K73 T;  2JJ4 D;  1HMV A;  3I0R A;  3TEG A;  4NX9 A;  1HR0 J;  2PN6 A;  4MJK A;  3BBC A;  3OVA A;  1H98 A;  1JLC B;  3PX6 A;  1F3V A;  4ZPV R;  3UNY A;  3PZP A;  2A6O A;  4O3N A;  5KOW A;  4OHX A;  4ED6 A;  2FVQ A;  5RUB A;  1WOR A;  2MHE A;  3C19 A;  5DG7 A;  4NI2 A;  1C2P A;  2HVE A;  2OD4 A;  3HHN B;  2HK2 A;  2W9C A;  1WF1 A;  1ZAX A;  4P6Q A;  4ECR A;  4DL6 A;  2ZC4 A;  4LT6 A;  4CH7 A;  1U0H A;  3FEZ A;  3M1V B;  4U96 A;  1U8W A;  1SKS A;  4QIW D;  4GKJ J;  3KOA A;  1SKU B;  1NSA A;  3RZA A;  4GVL A;  5D78 A;  2GNK A;  4DV6 F;  1NBE B;  4OZJ A;  4MKB A;  4LRF A;  4TVA B;  3IAS 9;  5IT0 A;  3D4J A;  4R8U B;  2OEL A;  3MI7 X;  2AD9 A;  3ZTS A;  2QX0 A;  1NK0 A;  1J5O B;  4GVB A;  1N88 A;  4JV0 A;  4CWB A;  4FYD A;  2BE2 B;  4YR0 A;  2FQQ B;  4DV3 J;  2XHW A;  2OPR A;  1V5V A;  4EBE A;  2DHG A;  3DRS B;  1HLW A;  1D3W A;  1UJ5 A;  3IM8 A;  5A8W B;  1RKI A;  2VFS A;  2QG9 B;  4YP3 A;  2EWH A;  1A6L A;  1MLA A;  2R4F A;  2R42 A;  2E5H A;  3H42 A;  1T94 A;  1NU4 A;  1O5J A;  1GAO A;  3PKY A;  2GW8 A;  1RWK B;  3AHP A;  4HHU A;  2QGF B;  4C3K A;  3DKD A;  3KG0 A;  3NRB A;  5CCL A;  4O0I A;  4AL6 A;  2WOM B;  1JNR B;  3DRR A;  4ETZ A;  5HI7 A;  5HN0 A;  1YTY A;  2AGQ A;  3MTJ A;  2XB2 D;  2XLI A;  1EAR A;  3QAU A;  4X4S A;  4G6V B;  1S79 A;  4DR6 F;  3F44 A;  3US5 A;  4C0H A;  2R2T A;  1KFS A;  4RL1 A;  1D8Y A;  5C25 B;  1S4F A;  2CDR B;  4ZP6 A;  1R89 A;  1VC6 A;  1N5V A;  2A18 A;  2HWH A;  2R8K A;  1OYE A;  2F65 A;  3VHQ A;  3TA0 A;  2B4V A;  3KFW X;  3M4X A;  2UZA A;  4LQ3 A;  1I3O B;  3NOC A;  1TV6 A;  1LWF B;  4F25 A;  4KR0 B;  5KFT A;  4NLO A;  1WD6 A;  1GNK A;  1R0C B;  1LK5 A;  1TVR B;  3HPO A;  2J6T A;  4DFP A;  5CYJ A;  1F60 B;  2YPZ A;  1KLM A;  3W61 A;  4HI2 A;  1Q4R A;  2IVY A;  3A3N B;  3UWT A;  2KN4 A;  3LAM A;  3MED B;  4ZCM A;  1PO6 A;  2MHN A;  2MSS A;  4I2P A;  4IQM A;  2QL5 B;  2W7A A;  2J7U A;  4Y2K A;  2FD2 A;  1DFD A;  2VV5 A;  1IKX A;  2L3M A;  1C1B B;  1X5T A;  3PYF A;  1B99 A;  2CNN B;  3M9O B;  2EC2 A;  3QT7 A;  4A8W A;  4LFA J;  3FSX A;  3FZB A;  2H5J B;  2CQ0 A;  4WXO A;  4DV1 J;  1U1O A;  1D8Z A;  2CQB A;  3DLK B;  4ED8 A;  5DLF A;  2YKO A;  1OPZ A;  1B7Y B;  2HAI A;  2NSB A;  5CZX A;  4I0W A;  4I2P B;  3UD3 P;  2VQE F;  4DF4 A;  4ZOS A;  3LGM A;  1Q7L B;  3PAC A;  2VPX B;  2XSF A;  4CLZ A;  5B0B A;  1U8S A;  4IFY B;  3FDS A;  3RGI A;  5KFC A;  4FF3 A;  3K2Y A;  2WOM A;  4OHY A;  4ZP9 A;  3BGR B;  3H7H B;  3PVX A;  2FUG 9;  2HHH J;  5KFB A;  1JLE B;  4EZ9 A;  2DNZ A;  3MUT P;  1HBN A;  1K1Q A;  2BAC A;  3DOK A;  3G6Y A;  3RB6 A;  2W8K A;  3IR5 B;  2POK A;  4OZ1 A;  2Z2Y B;  5C25 A;  4NE9 C;  2EVZ A;  4JI8 F;  4DS5 A;  2AW0 A;  5J2M A;  1KRP A;  2UUB F;  5KT3 A;  2KHC A;  4ELT A;  3EGW B;  2HQF A;  1YK9 A;  3LAN A;  4RBV A;  4JI3 F;  4MTP A;  1HBN B;  3W60 A;  4AYB D;  4ECZ A;  5L8R C;  4IQX A;  1VQ5 S;  4ZVQ B;  1WI6 A;  2PII A;  4FPR A;  5AJ3 J;  2DJW A;  1DTT B;  4O4R A;  3MZI A;  1CS4 A;  4UT4 A;  1HBM B;  4TU8 A;  1BY9 A;  1YSJ A;  1UPM B;  1IM4 A;  2COL A;  5E3P A;  4PKD B;  3G8S A;  2FJV A;  3ZXW A;  1AW0 A;  1WC0 A;  2JSX A;  4LF8 J;  2LEP A;  4CLK A;  4F4Y A;  3E8O A;  2BJ3 A;  3ZTQ A;  2XSJ A;  3MMB A;  2ZHO A;  4L3N A;  3PV8 A;  3RB3 A;  2MGZ B;  3NAH A;  3OFE A;  1GT8 A;  1JJ2 R;  1HWJ A;  3WC2 A;  4NI2 B;  2JWN A;  3DM2 B;  1S1T B;  2W2N P;  1BMQ B;  4BHQ A;  3ET6 B;  4JI5 J;  3OPK A;  2J9E A;  4CTA A;  5F8I A;  2QZ8 A;  4KH1 B;  1TKZ B;  2I5J A;  1S9E A;  4LR9 A;  4OQJ A;  3W9J A;  2C2K B;  4OI2 A;  3CSK A;  3CCR S;  3NNH A;  4CI0 B;  2XSJ B;  3MMB B;  4S0M A;  1NAQ A;  3ZTO A;  3MCM A;  4MKV A;  4N47 A;  4CRJ A;  3HVR A;  2UXD F;  3IA0 A;  1I94 J;  3Q8S B;  3KLG B;  1TKT A;  1UPP A;  1RAO A;  2PEH A;  4P10 A;  1U2F A;  4QPT A;  1WOS A;  4IFV B;  5H9F J;  1HNV B;  1ZYQ A;  1RB0 A;  5FD1 A;  4H4M B;  1LKZ A;  5KG0 A;  2OD6 A;  1R8A A;  4PAA A;  3I9Z A;  1BLU A;  5AE1 A;  5CAB A;  2B5J A;  3CD7 A;  1DLO A;  4I64 A;  5CZV A;  2MKY A;  4PQU A;  2DPI A;  2KL8 A;  2QFJ A;  4C8L A;  3W9H A;  4ZN3 A;  5KG1 A;  2GAG C;  4OI1 A;  4ECS A;  5A8K B;  4WCE Q;  3HVA A;  1VK3 A;  4NLU A;  3IN5 A;  3CDA A;  2HNZ A;  3CB4 A;  4TQS A;  4NLV A;  1N48 A;  3NGT A;  4IFV A;  3EXY A;  5ETT A;  4DPX A;  4LF9 F;  3LUY A;  3OFG A;  2XYH B;  2GHW A;  4J5O A;  4NLY A;  3W62 A;  1MWZ A;  3G6E S;  3CCE S;  1S77 D;  4ZKA A;  5A6P A;  5HBM B;  1C0T B;  3M2U A;  3BO2 A;  4KBI A;  2V69 A;  2AKW B;  5GME A;  2CNL B;  2EPI A;  4WWS A;  3EDR B;  3QT6 A;  2E1A A;  3DLE A;  2DXF A;  2ZZN A;  5D4N A;  1K1S A;  2IYI A;  3IWL A;  4JI1 F;  2GX8 A;  2LYV A;  1NK9 A;  1VQ7 S;  5HVH A;  4Y2A A;  3K8W A;  1S1T A;  2E7X A;  2QSF A;  1UVJ A;  2OKQ A;  2VJU A;  3R3T A;  4IYQ A;  4PXC A;  1YVF A;  3HVT B;  3M8Y A;  1IWA A;  3UD5 A;  3W65 A;  2OFG X;  4ANE A;  2XCP A;  3NXZ A;  5B0A A;  1TUW A;  1FNM A;  3UNG C;  3UVJ A;  1CC7 A;  2MQ8 A;  3P5B P;  3RAX A;  2DCU B;  2ZKU A;  2QJ3 A;  1FKP A;  3CJK A;  2QA1 A;  2X7I A;  5ETN A;  2Y3Y A;  4C8M A;  1U6Z A;  4L6V 3;  3SDE B;  5KTQ A;  4X4T A;  2XM3 A;  2IVM A;  2J6U A;  3THV A;  1X5O A;  2BMB A;  5DJB A;  3RRK A;  4H4M A;  4OYM A;  2VC0 A;  3GZ7 A;  2DIU A;  1RHJ B;  4RW6 A;  1QSY A;  3MCO A;  4B02 A;  4WKY A;  3HT0 A;  4YME A;  2O5D A;  3TW0 A;  4PG7 A;  3EVO A;  3NWR A;  3W8P A;  2D3O 1;  2BW2 A;  2ZDO A;  2WRM A;  4RLE A;  1H6K X;  3EM1 A;  1R0A A;  1HYS A;  2ZH5 A;  4MK9 A;  2KXF A;  2C3O A;  4KV8 B;  4DCO B;  3KTQ A;  3B78 A;  5KFP A;  1PAE X;  1Y5L B;  2CPY A;  1UEK A;  2NS1 B;  3CTR A;  2V2V A;  3FVY A;  3R97 A;  4LUB A;  3GV8 B;  2AX1 A;  4BC7 A;  2QLB B;  2HRT A;  2CZV C;  2HWT A;  2IM2 A;  2O01 C;  3MGJ A;  2RT3 A;  1UAW A;  2B4P A;  5I42 A;  3OFF A;  4AFF A;  5J2P B;  2ASJ A;  4A47 A;  2YQ0 A;  1SJ4 P;  3B54 A;  5LMN F;  1X4C A;  2GS8 A;  4CM0 A;  5MLC V;  4DUY J;  2FJB B;  1BQX A;  3MAA A;  4OHZ A;  5KFX A;  2NYH A;  2H48 B;  5IM0 B;  1WG1 A;  4C9D A;  4JV1 A;  2LCW A;  2VUG A;  1DZ5 A;  1F2G A;  2GVZ B;  2PA8 D;  5D0R A;  4ERD A;  3CWJ A;  4H4O A;  2J9C A;  3BB5 A;  4ZP7 A;  4NXM F;  4TU9 A;  1ZA2 B;  4YB7 A;  2ZJQ Q;  4CZC A;  1Y5I B;  2W2P P;  4R8U A;  3DYA B;  3HD1 A;  2UU9 J;  4B9V A;  4DQR A;  1VRQ C;  3GJS B;  5D0G A;  3HFV A;  1Q81 T;  1GMV A;  5KFW A;  5IM0 A;  2HBZ B;  1YRX A;  4DX8 H;  1AYE A;  1QD1 A;  4IG0 B;  3TRG A;  5LSL A;  2R7Q A;  3G8Q A;  4ED3 A;  2B7C B;  3UN5 A;  3MPW A;  2CNK B;  2BR0 A;  3DYA A;  1ZA1 B;  1FTR A;  3FQK A;  4Y2I A;  5GVQ A;  2VFT A;  2N7Y A;  4JI0 F;  3Q89 A;  4WIQ A;  3I6P A;  5U47 A;  3TZW A;  3OJU A;  2JC1 A;  2HMI A;  4Y00 A;  2C2O B;  1URN A;  2PDA A;  4FYW B;  2DGX A;  3GIJ A;  3G6X A;  2ZDP A;  4USH A;  1YZ7 A;  2ZJR Q;  4NXM J;  3Q8V A;  1NO8 A;  1N8R T;  3EJM A;  1A9N B;  1M5H A;  4OI4 A;  3LAL A;  5J1N A;  1RWO B;  2ZH3 A;  2OP5 A;  1CS4 B;  4M5H A;  4AD6 A;  4CO0 A;  4IDK A;  1T02 A;  4EO8 A;  4QWD A;  3QID A;  4Z2X A;  3EIC A;  4NLQ A;  4DQP A;  2DNY A;  1YKW A;  3JTN A;  1KS2 A;  2UVU A;  3RR7 A;  4F3Q A;  3TVK A;  2E5L J;  4Y0F A;  1FTC A;  4DV5 J;  1H72 C;  5HAO A;  3H4B A;  5A0Y A;  4G1P A;  1U26 A;  2Y1L B;  4P71 A;  1XNQ F;  4FNI A;  4B08 A;  3IS9 A;  4RZR A;  1S6U A;  4BBY A;  1QE1 B;  4ZLP A;  1REV B;  3Q8P B;  3ENQ A;  3CCM S;  2NXU A;  4DR3 F;  3MWB A;  1DAX A;  3LWL A;  3FEX B;  3UDV A;  1B0V A;  2GJF A;  4OV6 A;  3KLH B;  3I0R B;  3T5K A;  1NB7 A;  4DR2 J;  1H7W A;  1SJQ A;  3RRG A;  5HQM A;  1RT5 A;  4UF4 A;  4Y2C A;  4B3R F;  3KWM A;  5DZ7 A;  3FCV A;  2H65 B;  2BXJ A;  1RKJ A;  2HIY A;  1XR7 A;  1JLF A;  5KOX A;  4WZQ A;  5HMY A;  4LF5 J;  3IFE A;  5AE3 A;  4U9R A;  2HZV A;  1MN9 A;  2HK3 A;  4W98 A;  3MAQ A;  1BQM A;  4ZJL A;  3ILO A;  3IM9 A;  1HQE B;  2M4M A;  4USU A;  5IZH A;  2LFV A;  3GIM A;  3P45 B;  4QYZ K;  1AUS L;  3H8Y A;  1EP4 A;  3MPV A;  4I6A A;  1JKH B;  4ZJQ A;  1OSD A;  2F7V A;  1OS5 A;  2BRK A;  4OMF G;  4C0B A;  2HNY A;  2DR8 A;  4M5D A;  2FTR A;  5K8N A;  4LBP A;  1HBU B;  4G1Q B;  3UCU P;  1TL3 B;  1S0M A;  1YJ7 A;  1NM2 A;  2WVC A;  4PG4 A;  1V3Z A;  1CBK A;  3ADA C;  3LPE A;  4ANC A;  3I5B A;  2HHT A;  3IRX A;  1M1G A;  4QWA A;  5BYR A;  1GX5 A;  1FE0 A;  1OY9 A;  1PYT A;  1WUU A;  5IS2 A;  2OHD A;  4R5P B;  2QE5 A;  4DV7 J;  4JI1 J;  2AZ1 A;  2RS8 A;  2IMO A;  2R7U A;  2BUN A;  1RAA B;  2XZW A;  3QRQ A;  1C0U B;  2B9X A;  2OPP A;  2HW3 A;  2OFH X;  4ZDN A;  1MSW D;  3LAK A;  1CJU B;  1XC9 A;  3IS9 B;  3M8Z A;  4B3O A;  1B0P A;  4DPO A;  1HQ2 A;  4FZV A;  3AT1 B;  3HSG A;  2M9K A;  1WHV A;  1WDD A;  4KE5 A;  5JJB A;  4QYZ J;  5D8H B;  4OYB A;  2VPY B;  4KKO B;  3WC0 A;  1CQN A;  3BN7 A;  4HT7 A;  4QWE A;  3QT8 A;  4KGK A;  4LSL B;  2CJQ A;  4JV5 J;  3M9M B;  2IFX A;  3SEO A;  3EE3 A;  2MKI A;  1IKY A;  4DSK A;  2W25 A;  4G1I A;  3KG1 A;  4NLT A;  5M2P A;  3UN2 A;  3CF5 Q;  2KG1 A;  2U1A A;  3JS9 A;  1UVK A;  2CPZ A;  2OEJ A;  3CGI A;  4TKT A;  3KLE A;  1QTN B;  3V2U C;  2EXU A;  3BJY A;  1VFJ A;  2KRB A;  1OWX A;  4F67 A;  4OJG A;  1SQE A;  2LDY A;  4ZS6 A;  1HBO B;  1FXD A;  1SC3 B;  3J7Y U;  2XBP A;  3N6M A;  3CUN A;  3UDE A;  3SCJ E;  3CED A;  2RUS A;  4RW9 B;  4UW2 A;  3OL8 A;  4ZVT B;  1DRZ A;  1E6V B;  4OFZ A;  5L9N A;  4IO1 A;  2J9D E;  4B9L A;  4DR5 F;  2YQ3 A;  1T9T A;  3FQL A;  4LJM A;  2I6W A;  5F9N A;  1BGX T;  3ENW A;  4NCG B;  5BR8 F;  2FY1 A;  4K0K F;  4X66 F;  3R5D A;  3MMA B;  5F8G A;  2KZM A;  2CPJ A;  1FD8 A;  2YX1 A;  2D3U A;  3BGU A;  2V68 A;  2MZS A;  3FMB A;  4C11 A;  2Y1I A;  5K5M A;  4LIW A;  4CO2 A;  2CPE A;  1YJT A;  3GSI A;  3BN4 A;  3L7O A;  4OI6 A;  3RB4 A;  1HNW J;  4DCP B;  2Q66 A;  3VZH A;  2RKI A;  2LQ8 A;  3BO4 A;  4X64 F;  2HFU A;  4C6A A;  2JNJ A;  2PEB A;  2V9K A;  3LH2 S;  5F8L A;  4IOA Q;  3Q24 A;  4URQ U;  3N0V A;  3PYG A;  3J80 U;  2AJ4 A;  4OX6 A;  4ZPT R;  5G4D A;  4LVO P;  5D3G B;  3TZY A;  2KYX A;  3G87 A;  4EI2 A;  2DBB A;  4JI3 J;  4IR9 A;  1CJV B;  4RPF A;  5M2U A;  1QAI A;  3A3P B;  1VOM A;  4N76 A;  4LIR A;  1IBM F;  2AU0 A;  2RQK A;  3BQ0 A;  2AT1 B;  3C66 A;  3CUL A;  3W5X A;  1U1M A;  2AYE A;  3GB0 A;  2VIC A;  4DWI A;  3M30 A;  8AT1 B;  3IXQ A;  1M90 T;  3K5M A;  1K0T A;  1ULR A;  4USJ C;  2E66 A;  4KFB A;  3BBF A;  3UE2 A;  5L46 A;  3J7Z 5;  1Z2Z A;  2VPW B;  2KZZ A;  3EGN A;  1Q8L A;  4ENO A;  1BHN A;  2NCK L;  4ZCL A;  4KGX B;  2G13 A;  3P96 A;  1S9G B;  3JYT B;  1SPB P;  4CLP A;  4LVN P;  4LF7 F;  3SDE A;  3QRP A;  4V1A k;  3ZC4 A;  4OYI A;  3NNC A;  3KUG A;  5LSO A;  3BV8 A;  2HWI A;  1Z4U A;  3GV5 B;  4J7C A;  3VGU A;  1U47 A;  1FRI A;  2DCL A;  1S48 A;  4K2X A;  2AHO B;  2K7K A;  2HS0 A;  4AUK A;  5BR8 J;  5KFU A;  4C8Z A;  1NEE A;  3LP0 B;  3TAN A;  1N5Y A;  3I4H X;  3ZO7 A;  1RT6 A;  4B9M A;  4DV1 F;  3ETM A;  5G0R B;  3OR1 B;  3NMR A;  2GVD B;  4ZPA A;  4ZVR B;  3W2W B;  3W3S A;  4ZPB A;  1FRX A;  2OPS A;  2RIJ A;  2MQN A;  5CYQ B;  4O3Q A;  4FXD A;  1CC8 A;  3BSO A;  2OPQ B;  4B3T J;  2FJE B;  3A8J A;  3RW6 A;  1LW0 B;  2VL1 A;  5AXL A;  4YDX A;  4U7U D;  4Z7Y A;  3FRY A;  4FVC A;  5EX0 A;  1T3N A;  2DIV A;  4JP8 A;  1HNI A;  4MKA A;  2I9S A;  1HI8 A;  3CE8 A;  1RBA A;  2E7W A;  3NS6 A;  2FJA B;  2PSZ A;  4K5R A;  1GFW B;  1JWW A;  3TVZ A;  2KXN B;  2V5H G;  1V9O A;  2ZH6 A;  2V67 A;  4RU2 A;  1Y5N B;  3MEG A;  3MMJ A;  4OLO A;  1IKV A;  4MIA A;  4JOU A;  1R3N A;  2IA6 A;  4JV5 F;  1HQU B;  1GX6 A;  4GRS A;  2GVZ A;  4DN0 A;  5E7O B;  4ZVG A;  5B08 A;  1T0T V;  4CNY A;  1KWM A;  1BQN B;  4TNO A;  1UA1 A;  3PNI A;  4J9O A;  3M6X A;  5I3U B;  2GZO A;  1FO1 A;  4CT8 A;  1YG0 A;  1RTH A;  3GMG A;  3EDQ B;  1IKV B;  2MZQ A;  3I87 A;  2XC9 A;  4DL7 A;  3TOQ A;  3AQO A;  1N6Q A;  2ZH8 A;  3TEH B;  1VCT A;  4HH0 A;  5F3T A;  4QBU A;  4PWU A;  3A8E A;  1X9M A;  1Y7P A;  3QBC A;  5LXR A;  1RSC A;  4XIU A;  3IG1 B;  4ALZ A;  4PUO B;  2FB0 A;  2ILZ A;  2KTQ A;  1VQL S;  3EVM A;  2JL9 A;  2FIU A;  3QMQ A;  3HJF A;  1HBU A;  4G1Q A;  5C24 B;  3A4T A;  1HIY A;  3IGN A;  5L1L A;  4NEZ A;  1F9E B;  3ELH A;  3DLB A;  2M2B A;  1N6Q B;  2X1A A;  3V6J A;  3EXC X;  1U1N A;  3J7Z T;  1SCJ B;  2OPQ A;  4ES2 A;  2FJD B;  1W2I A;  2XNR A;  4M5N A;  2UUC J;  4YOE A;  2R7S A;  3ITH B;  1QAY A;  4DI6 A;  3RRH A;  1X4G A;  5L1J A;  2ZD1 B;  4DQS A;  4QU7 A;  3OL7 A;  3KJF B;  2QC3 A;  4P75 A;  4B9S A;  1UCN A;  3FC9 A;  2OJ3 A;  2HHW A;  4WF9 Q;  3GYN A;  5KG6 A;  1VS3 A;  5HVG A;  2YNI A;  2FLP A;  1S4E A;  2RJZ A;  2PO4 A;  2V4J B;  5HBM A;  1UW9 A;  3B82 A;  4C0O C;  4CLW A;  5T41 A;  4B3R J;  4V19 J;  3A1Y G;  3NCQ A;  4C11 B;  3GV7 B;  3ISN D;  1X9W A;  4QJV A;  5FII A;  2AP6 A;  1T9Y A;  2CQ4 A;  4K4Y A;  1DTQ A;  2W9B A;  4LF4 F;  2D9P A;  4WFB Q;  4LFC J;  2MLZ A;  5IT9 Y;  2WZ1 A;  3AJ1 A;  3PR5 B;  4GC7 A;  4EK2 A;  2WB1 D;  3BZQ A;  2G0J A;  3H5S A;  1WEY A;  5DG9 A;  2FLO A;  1Q78 A;  1SQF A;  4OX9 J;  3CD6 S;  4DV5 F;  4PWW A;  2MLX A;  3KMS A;  4J9L A;  2IBO A;  1H2U X;  4QWC A;  2GO8 A;  1HBO A;  4U67 Q;  1DTQ B;  3NNA A;  2OAU A;  2BM0 A;  3R5J B;  1VQ6 S;  1DY3 A;  4FYV B;  3DDK A;  3DMJ B;  3KUE A;  2N82 B;  2OLW A;  3VAG A;  4LF4 J;  2CJK A;  2PFF B;  3GSD A;  1RT2 A;  2YKM A;  1GMU A;  3O44 A;  4ILL A;  1X4E A;  4AND A;  1GXU A;  1PJ7 A;  4M5J A;  4AT1 B;  4CYU B;  3TUZ C;  4RW6 B;  4X4Q A;  4KT0 C;  4KHM A;  1RQ0 A;  2H1Y A;  3S6E A;  4IRK A;  4KIA A;  1VIX A;  4J91 A;  2KU7 A;  1N56 A;  1L3S A;  3RW7 A;  1G6B A;  3HXM A;  2MZR A;  3BH7 B;  5KFZ A;  1ZBT A;  3ZZP A;  3JSR A;  2CRL A;  4FF4 A;  1CJT A;  1D9F A;  4B3S J;  2YBV A;  3IBW A;  2CDQ A;  2QFI A;  2FYX A;  1U6B A;  4CTA B;  1RWX B;  3AJ2 A;  3BGO P;  2CZ4 A;  3BR9 A;  1N0V C;  2VA2 A;  3T1Y J;  5ETP A;  2M5Y A;  1IQZ A;  1BUX A;  1C0U A;  2KI2 A;  2VG5 A;  2ZE2 B;  4IH6 A;  4XDC A;  2IAJ B;  4J9K A;  1NJZ A;  1KN6 A;  2RU9 A;  3DRP B;  5DZ6 A;  3L9Z A;  1T9X A;  2IRX A;  2KT2 A;  2QT7 A;  3SBM A;  2W8L A;  2ZOF A;  4LRE A;  2HLT A;  2ZH1 A;  3I31 A;  1D1U A;  1RA7 A;  3FEY B;  3MAA B;  3HMJ G;  2YQ1 A;  2HZC A;  2EG1 A;  2GMH A;  3CD5 A;  1I1G A;  1QUP A;  2MQM A;  3DLG A;  3MM7 B;  2MPU A;  4FNH A;  3N28 A;  4JUZ A;  4DG1 B;  3FBF A;  3LWM A;  2QSW A;  2C3P A;  1FES A;  4H4O B;  3K0J A;  3GIK A;  2Z2L A;  5LMN J;  1FNO A;  1MMN A;  1VRT A;  3DRY A;  1T03 A;  1AB8 A;  1OY8 A;  2F8E X;  3FK4 A;  2D9O A;  4KRW A;  2CPD A;  3CVK A;  4OYX A;  1NH8 A;  2HNZ B;  1P8G A;  7FD1 A;  3VAL A;  2XY5 A;  3RAQ A;  1S10 A;  1MWQ A;  4DU8 A;  3AQP A;  2Z2M A;  3L7U A;  3KLF A;  2B8P A;  2JDJ A;  2YKM B;  3LOU A;  2ZH7 A;  1U45 A;  2CJA A;  1ZS6 A;  3BO3 A;  1OMS A;  2OEM A;  3LGN A;  1UKU A;  2RDI A;  2HQC A;  3CJS A;  3QAT A;  3ULH A;  1JMT A;  5CYM A;  5E3Q A;  2QYC A;  4O3S A;  3H2U B;  1VQK S;  1R31 A;  1NPK A;  4BWJ A;  2GQ2 A;  4C98 A;  1YGY A;  3NGS A;  3MFI A;  3OTD A;  2C2M B;  3WQP A;  2H4W B;  2F63 A;  2MKH A;  1IKW A;  3DDN A;  1P9Q C;  2H9Z A;  2P9C A;  3HHL A;  2CIM A;  5F8H A;  2MB0 B;  4E0D A;  1HKA A;  2KKH A;  4FXV A;  4WXW A;  4I4B A;  2MJU A;  2DHH A;  5CYQ A;  1TUG B;  4ATN A;  1VBX A;  2ZKT A;  4NLP A;  1EZZ B;  1UJ4 A;  2F4F A;  2GGP A;  6AT1 B;  1RU2 A;  2RE1 A;  3OHA A;  2UVV A;  2HQD A;  4PG8 A;  1GXT A;  3HF5 A;  4F4W A;  4IUF A;  3FCH A;  3M1V A;  4ECY A;  2NXE A;  4OX7 A;  3PW0 A;  3ILJ A;  3NBP B;  1EQM A;  4WE1 B;  4FN5 A;  5K9F A;  1G1X A;  2WSF C;  1SV5 A;  4Y2M A;  4ZCK A;  5E41 A;  4JI6 J;  2V6A A;  3IGV A;  4QW8 A;  3ZZR A;  2K7J A;  2GHV C;  1EP4 B;  3Q8U A;  2V8V A;  2QL7 B;  4LRB A;  2B6A B;  4WK3 A;  3TUI C;  1DHM A;  5CAA A;  3P3D A;  3X1L B;  3AA9 A;  4ZPC A;  2ZVI A;  3BRE A;  3CJ4 A;  2A10 A;  3GPA A;  3HUL A;  4DX7 A;  1N32 J;  4KGV B;  2R9L A;  3R7N B;  2VOP A;  3NWG A;  3I5A A;  3L7P A;  4X65 J;  4DV2 F;  2DNQ A;  1D0E A;  2GFF A;  2VC1 A;  3W7B A;  4HL9 A;  2MMY A;  1HBM A;  1Z2L A;  1X8D A;  5GAG U;  2DGO A;  1S76 D;  3NS5 A;  4DL2 A;  2ASL A;  2F8M A;  1VGY A;  1XER A;  1S6Q A;  1HMV B;  3CCZ A;  3MHY A;  3TA1 A;  3UN3 A;  3EX7 B;  3HK2 A;  4F36 A;  4DR7 J;  4L3K A;  4DQI A;  1V3S A;  3HKW A;  2NYI A;  2HGL A;  5CD4 A;  4Q43 A;  1JQG A;  2DNG A;  4Y34 A;  5KFE A;  3CCV S;  1IXK A;  4KV8 A;  4PUO A;  1RTI B;  2NXC A;  5GAH I;  1JJC B;  4RUC A;  2ZZT A;  5AXK A;  4NCB A;  1ZM3 A;  4TYB A;  5B0E A;  2HHP A;  4LSL A;  1OPI A;  1WG5 A;  1S57 A;  5HSP A;  1HQE A;  4PYD A;  2G1D A;  4A8Q A;  1KVJ A;  4BLG A;  2Z57 B;  4I2Q A;  4U95 A;  2AGO A;  1FCA A;  1NHU A;  1XQI A;  2E9Z A;  3CCQ S;  4Q8F A;  1IWG A;  4F4K A;  1VQ4 S;  3D1O A;  4P73 A;  2AQ4 A;  1IQT A;  1EAY C;  2GJI A;  2HFO A;  2ZD1 A;  2YWK A;  1MMD A;  4CO3 A;  1HHT P;  1HNX F;  1O0P A;  4WE1 A;  4BCA A;  2W1B A;  2B9W A;  4J90 A;  4DV4 J;  2E9R X;  4UST A;  4FF2 A;  3NKY A;  3UR0 A;  1TU0 B;  3RBE A;  2QTW A;  2DRB A;  1UTA A;  1EET B;  1IUJ A;  4EU0 A;  2UXD J;  1C1C B;  2NZ4 A;  4LR8 A;  3QLH B;  4G3I A;  1YRT A;  4BWM A;  3M8S A;  3V81 B;  3GIR A;  5F8J A;  2OPP B;  2DHX A;  3PIP Q;  2EK1 A;  3T1Y F;  2ASY A;  3TAM A;  3CJ3 A;  3T6J A;  5B0C A;  3KHR A;  2ZBQ A;  4DR5 J;  3Q86 A;  2KT3 A;  3QGH A;  2KH9 A;  1JJ4 A;  4C8O A;  3LF0 A;  4NCG A;  4OI3 A;  3VQS A;  2HFS A;  4UTG A;  5IWA F;  1YJN S;  3J7Y I;  5J1P A;  4FBU A;  1LWE B;  3JSB A;  2QA4 G;  1FJG J;  4KTQ A;  1OSC A;  2R7W A;  3G8T A;  3PX0 A;  3BGL A;  1HNX J;  1U25 A;  3AXK A;  4JI7 J;  2W7P A;  1Q5Y A;  2EFP A;  2YWG A;  2WCX A;  2E1M C;  2K1R A;  1TAQ A;  3DDI A;  4RX6 A;  2CPI A;  2XMT A;  3JTP A;  3W5Z A;  4IOB A;  1NHK L;  3MEK A;  3CCS S;  1YHQ S;  1XMQ F;  3DMJ A;  1X60 A;  2XS7 A;  3PYE A;  2VA3 A;  4GC6 A;  2RDD A;  3KLE B;  3I0S B;  1PJ5 A;  1OO0 B;  3GR1 A;  2IJR A;  2E1C A;  1Z1Z A;  3OXG A;  5J2M B;  3CCT A;  2BOA A;  1YDL A;  3IC1 A;  4DFJ A;  4EBD A;  2EFQ A;  3A3O B;  2C2R A;  1JK9 B;  2YNG A;  2Z2Z A;  4KO0 B;  3ZZZ A;  4RW9 A;  2ZBP A;  5IOL A;  5K8P A;  4FYX B;  3BSN A;  3V4M A;  5A0Y B;  3L95 X;  4A8K A;  2NUH A;  2DKO B;  1VQM S;  3UPF A;  5DM7 Q;  2YWH A;  4N8O A;  4AXJ A;  2QO3 A;  4IH5 A;  4ZHR A;  1N4L A;  4DSJ A;  4Y28 C;  2CAD A;  2R8H A;  2QMW A;  4CLS A;  4X4P A;  4WP8 A;  4ES3 A;  3POT A;  1KLN A;  3U27 A;  5B09 A;  2R7R A;  2CWX A;  4NEY A;  1WAC A;  2DNK A;  1HFE L;  2Z8Q A;  4DPT A;  4NML A;  9ATC B;  2RB7 A;  4KGZ B;  3TX8 A;  2XEX A;  4QR0 A;  4JB8 B;  1IR0 A;  5HQ8 A;  5K20 B;  1RU1 A;  2WTF A;  2VQE J;  1WEL A;  4MYT A;  2UUW A;  1RAC B;  1AT1 B;  1FKO B;  3OT9 A;  4YQW A;  1DQ9 A;  3CJ2 A;  4DEZ A;  3PXG a;  3AFG A;  5M2R A;  1S5Z A;  3G2X A;  3HSD A;  3OR1 A;  4JI6 F;  4KB7 A;  1SKW A;  1S1U A;  4LFA F;  5F8N A;  2DH7 A;  2MYF A;  2E5G A;  1F5A A;  3BEG B;  3JB9 k;  2BQR A;  1M5O C;  2UUC F;  4KHP J;  1JKH A;  4CLU A;  2YPY A;  1WEX A;  2W01 A;  1X5S A;  2XYG B;  2ADB A;  4RNO A;  1Q8B A;  2DNO A;  3NGR A;  1S12 A;  2A1B A;  4OYA A;  4CM2 A;  3VGS A;  1G7C B;  1RYR A;  3KHG A;  2IBK A;  3J7A 1;  3PO4 A;  3P5T L;  4DPU A;  2Y1R I;  1S0N A;  1XR5 A;  2HQI A;  4LBH A;  2HQG A;  2VFR A;  3K57 A;  1WEZ A;  1RWN B;  3I32 A;  3K5L A;  1TKX A;  2DNN A;  1XIQ A;  3C6T B;  4KO0 A;  1SJF A;  1QVF R;  4ZVF A;  1D9D A;  1VQY A;  1CPZ A;  2KJV A;  5D15 A;  3VTI A;  2BZ2 A;  4PZV A;  1XNR J;  3QPI A;  4U8V A;  4HYK A;  4M5L A;  4K4Z A;  1FDD A;  3VGV A;  3D0G E;  1S1X B;  3D1H A;  5EWF A;  2Y1J A;  3MM9 A;  3W9I A;  2DGU A;  2VKR A;  5ITH A;  3BS9 A;  2BW7 A;  2CQH A;  2RQ4 A;  4ZIV A;  1RT6 B;  2I5J B;  1S9E B;  4DR1 J;  2YNH A;  2KFY A;  3CCL S;  1NHV A;  3D68 A;  4RO0 A;  2NXN A;  4EFA C;  1E6Y B;  2WW4 A;  3IAM 9;  1XMB A;  3G9C A;  4F2S A;  1X4A A;  3KJN B;  1JLB A; 
#chains in the Genus database with same CATH homology
 1BE4 A;  1MN9 A;  3VGU A;  4W98 A;  3R9L A;  1NB2 A;  3FCW A;  3PJ9 A;  2DXD A;  3BH7 B;  1F3F A;  3ETM A;  4WBF A;  3WX8 A;  3ZTP A;  3FBC A;  1NDK A;  2BX6 A;  1NDC A;  3Q8Y A;  3Q86 A;  4ANC A;  1BUX A;  4CP5 A;  3Q83 A;  1EHW A;  1NSP A;  3EVO A;  2HUR A;  2ZUA A;  3EM1 A;  2AZ1 A;  4FKY A;  3PRV A;  1PAE X;  1K44 A;  1HHQ A;  2BEF A;  4O0N A;  3DDI A;  3FBF A;  1LWX A;  1NHK L;  4KPC A;  1W7W A;  3B54 A;  3NGU A;  3MPD A;  1MN7 A;  1S59 A;  3BBC A;  3BH6 B;  4FKX A;  3EE3 A;  3L7U A;  2B8P A;  2DY9 A;  3VGT A;  1NSK L;  4UOG A;  1ZS6 A;  1F6T A;  2HVE A;  3EVW A;  3FBE A;  2CWK A;  5IOL A;  3JS9 A;  3ZTQ A;  1NPK A;  1U8W A;  1NCL A;  3NGS A;  4UOF A;  3EVM A;  1HIY A;  1NDP A;  1NSQ A;  3ELH A;  2VU5 A;  3ZTS A;  3ENA A;  4F4A A;  4HR2 A;  3ZTO A;  4S0M A;  3Q89 A;  4DI6 A;  3EMT A;  1WKL A;  1HLW A;  3FBB A;  1UCN A;  3FC9 A;  1S5Z A;  3B6B A;  3G2X A;  3Q8U A;  3Q8V A;  5CAA A;  5CAB A;  5BXI A;  2HVD A;  3BBB A;  4UOH A;  3FKB A;  3GPA A;  3EJM A;  2AZ3 A;  1WKK A;  3DKD A;  5C7P A;  4C6A A;  3NGR A;  1KDN A;  2B8Q A;  3NGT A;  3VGS A;  3EIC A;  3GP9 A;  1NLK L;  4F36 A;  2DXE A;  1NUE A;  4EK2 A;  1PKU A;  1XIQ A;  1B4S A;  3VVT A;  2DXF A;  2DYA A;  1NDL A;  1LEO A;  3VGV A;  3ZTR A;  3BBF A;  4DZ6 A;  1VYA A;  1S57 A;  4ENO A;  1BHN A;  2NCK L;  3FCV A;  1XQI A;  4AND A;  1B99 A;  4ANE A;  1WKJ A;  4DUT A;  1JXV A;  3VVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...