2DXEA

Crystal structure of nucleoside diphosphate kinase in complex with gdp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
154
Chain Sequence
b'ETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFFKPEELFEYPRAADWFYKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of nucleoside diphosphate kinase in complex with GDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 51
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2dxeA00
1LWXA 3JS9A 2BX6A 5CAAA 1EHWA 3FKBA 2AZ1A 4FKXA 1WKJA 1WKKA 1LEOA 3PJ9A 5BXIA 3NGRA 1MN9A 3L7UA 3EMTA 4UOGA 3Q8VA 3B6BA 1W7WA 3EVWA 1B4SA 1HLWA 1B99A 1NSKL 3BBCA 4ANCA 4DZ6A 1F3FA 3FCWA 3BH6B 1S57A 4UOHA 2HURA 3VGVA 4F4AA 1ZS6A 3ZTSA 3Q8UA 5C7PA 1NSPA 1UCNA 2DYAA 3ZTOA 2B8PA 2B8QA 2AZ3A 3FBFA 2ZUAA 2DXFA 1F6TA 3NGUA 3EVOA 2DY9A 3FCVA 3PRVA 3VGUA 1NDKA 4ENOA 4DUTA 4CP5A 1BE4A 1NDPA 3ENAA 1S59A 2HVEA 1NLKL 3BBFA 3FBBA 3VVUA 5CABA 3EE3A 1WKLA 3G2XA 2CWKA 4EK2A 4ANEA 2DXDA 3NGSA 3Q89A 1PAEX 1XIQA 1NPKA 1S5ZA 1NDCA 4DI6A 3ELHA 4S0MA 3BH7B 3ZTQA 3DDIA 4UOFA 1K44A 4WBFA 1NHKL 2VU5A 3Q83A 2BEFA 1BUXA 2NCKL 3BBBA 3EJMA 3FC9A 3FBEA 3GP9A 3VGTA 3VGSA 4FKYA 3FBCA 3EICA 3EVMA 3WX8A 3EM1A 1NB2A 3Q8YA 2DXEA 5IOLA 1NUEA 1XQIA 3MPDA 4O0NA 4ANDA 3ZTRA 1BHNA 3ZTPA 1PKUA 1JXVA 1U8WA 1HIYA 3NGTA 3ETMA 1NCLA 1HHQA 2HVDA 4HR2A 3DKDA 3R9LA 4F36A 3GPAA 1KDNA 4C6AA 1MN7A 4KPCA 3B54A 3VVTA 1NDLA 1NSQA 1VYAA 3Q86A 4W98A
chains in the Genus database with same CATH superfamily
4HH0A 1D8ZA 4WPAA 4OYBA 3GV8B 1HQEB 1NAQA 3JSMA 1GAOA 3W7BA 3AOCA 2HQFA 1IJFB 3KHRA 1I1GA 3UN3A 1BQNB 2FY1A 1DLOB 4U8VA 3RG6A 1JXLA 3CJTA 1JLGA 3CDUA 4C8ZA 5K20B 3DDKA 5C25A 1RWMB 3FBBA 2LDYA 5F8HA 3C16B 2VA3A 3TAMB 3R1LA 2VB6A 3O1LA 3LP2B 1OY9A 3ILOA 3MEGA 3OJSA 4NYPA 3ZC4A 2YKAA 2CYYA 1HKAA 2LU1A 4RW6B 4LF6F 3D6TB 1ZAXA 4IOBA 1HNWF 1VQLS 1B0PA 3ETMA 3EXYA 3KJFB 3CJQA 2Q3PA 2CAJA 2M9KA 2FVSA 2X1AA 3BPDA 4IO9Q 1XR5A 3DOKA 1N5SA 2V8DA 1KBRA 3G6VA 5E3PA 3EPIA 2K1RB 3U02A 2X1GA 1RQ0A 1DJ0A 3QBCA 3G86A 1S57A 4Y2AA 3CMQA 3SMZA 3QATA 4NX9A 4CO1A 2HGNA 3EZOA 4HT7A 2M8DB 4C3LA 1FFGB 4ETXA 4ZMMA 3J80U 3QZ7A 4CQ1A 1XNRF 2IBOA 4YUDA 2GHVC 3QNWB 5DS7A 4B9UA 3RW6A 2AMCB 3BQ2A 1NDPA 2HWTA 2A2CA 5E3QA 4W92B 2P6SA 2GVZA 5M2UA 1AB8A 4I64A 4DV1J 3ZTQA 2BOPA 1RCXB 2XYGB 3DLLQ 4LF4F 1T9VA 5CCLA 3QGIA 1KLMA 4Q2MA 3RU0A 2I5JA 1REVB 3NRBA 1U2RA 4CLYA 2ILYA 3VR1A 1S6PA 5KG5A 2XBPA 3OXLA 2QL7B 3HFKA 4DG1A 5H9FJ 2HMIB 3HHLC 3SBMA 3GQCA 1BQXA 2KYXA 1R0AA 2R7TA 2F63A 3CCTA 3TR5A 2DGUA 4DL3A 3MGJA 2CUYA 1M1KT 3BH6B 2EXUA 1UVJA 1JLEA 3J7AN 4TY8B 1HBNA 3C6UB 1OMSA 1S1TA 3U1LA 1S10A 4G1IA 2MPUA 2B9EA 3RJMB 2CQ0A 3HLUA 3QAEA 4ICLB 3LWLA 2CXEA 3PKYA 2CZVC 1U0HB 1HNXF 3D0IE 5CD4H 3QRQA 5DLGA 2HQ3A 4CLSA 3HVTB 4RL1A 1JJ2R 4PUOB 4FXDA 1JLCB 3MOJB 2HEKA 2OPSB 1XR6A 1RTIB 5KT4A 2PGCA 1SKSA 1UVKA 2Z4PA 2OAUA 1KKHA 3IA0A 3GFZA 2XC9A 3MM8B 1IKVA 3A3NB 1MMNA 4DR3J 5CAAA 3MF5A 4UZCA 3GV7B 5HQLA 5LXRA 4DR1J 4NA1A 2B4PA 2I9SA 3IBFB 5DDRC 2O01C 1S9GA 2QA2A 1ELOA 3OL9A 5IC4B 3KJNB 1VLYA 3HVRA 3THPA 3RB3A 2PEBA 2ZHBA 4QJVA 1B70B 1KNZA 1HNZF 4Q8FA 3V4IB 1KQGB 2RQ4A 4RLEA 4TU9A 6FD1A 4DFKA 3UQSA 1RYRA 4N7TA 3IAM9 2JEFA 2HHPA 1SH2A 1NKBA 3GZ7A 2H5EA 1FWLA 1HQEA 3D1QA 3I0SB 3KG4A 1YZ6A 2NCKL 5CYMB 4KR0B 1S6UA 2VPWB 2ZH3A 4CLTA 2XMWA 1BQNA 1DLOA 3QSIA 2JEGA 4JI6J 2Z58B 3ZNUA 4W4MA 1HR0F 4HI1A 4WXOA 2DR8A 1WC1A 3C16A 3GIMA 3CO0P 3TAMA 2EFGA 3LGHA 3NGRA 4HT5A 4ZN1A 1FXLA 3CUNA 1YRXA 3LP2A 4J90A 3UNYA 1R8AA 4CNZA 1Y0HA 1VBYA 2IDLA 1M1GA 5KFGA 2C3MA 2QMUB 4RW6A 2PE8A 1S1WA 4F7VA 2GQCA 3LF0A 4KBIA 2O1PA 4ZCKA 3RAMA 2CPFA 2GHPA 1VJWA 4DV7J 3MWBA 1NK0A 4EZ6A 3QPIA 3QO9B 2ZBRA 2ZKUA 2DGQA 3LGMA 4ATNA 2PN6A 2K1RA 3I56S 2EFPA 2BW2A 3DDNA 2IJNA 1TKDA 1G1XA 5D78A 1FDNA 4DQPA 3MZIA 4UT4A 2DRBA 4OI3A 4AXJA 4EEYA 1NKEA 4F3QA 1I51B 1WC0A 1NK7A 3QAUA 4ZJLA 2LLZA 4QBUA 1XMQJ 5KFQA 2G0JA 3E51A 3VAGA 4YY3F 5IT9Y 1UA1A 3D3CJ 4EO6A 4ERDA 3R7BB 5B0FA 5J2MB 1REVA 5MLCV 2A6OA 2JOQA 1XJWB 4RUAA 2XSFA 2BMBA 2CNKB 4CP5A 1KFDA 2OI2A 1FO1A 3HF5A 3LALA 4DXLA 2V4QA 2HMIA 1SC1B 3Q8SB 2UUCJ 3G4SS 2UU9F 5I3UB 3GSIA 1X4AA 2B4OA 2LXFA 3W5YA 4BC7A 5HJYA 2RQMA 2D9PA 3F44A 1QAIA 3NXZA 2CQCA 2VPZB 2DCUB 4TY8A 2AWZA 3C6UA 1EKRA 3OSPA 4C8OA 2PFDA 1RUSA 1VQKS 4C7QA 4ICLA 4CLLA 1U0HA 2DO4A 1NZ8A 5DG7A 2AW0A 5FLXY 1YJUA 2FJEB 3Q8VA 3HVTA 4PUOA 1H7XA 4B9SA 4K4UA 4WYWA 3LWMA 1JLCA 4WCEQ 4EU0A 4DV3F 2OPSA 1RTIA 1Q1KA 3UCGA 4LF8J 1U09A 4I0WA 3OHAA 1IBLF 3PY8A 2HNDB 2XY7A 4FS2A 3LAMA 1HPZB 5IV4A 5J1EB 3DHWC 2Q43A 3MM8A 1S79A 2OP5A 4DN9A 3PX6A 2WTFA 1UL3A 2KHDA 1H0HB 3NGSA 2WBRA 2V9WA 1O6XA 2BOAA 4L75A 3FC9A 2DEJA 4XTTA 4TLRA 3SXLA 3B78A 3H25A 3DU6A 1U49A 2DIVA 4DCOB 2GVDB 1VQPS 2ILZA 2KZZA 4ZVEA 2C22A 4I7FB 2F9DA 2J9DA 1KLNA 3NWRA 4KYZA 3V4IA 5CYQB 2MKKA 1RHUB 3KLGB 4XPCA 2V6AA 3DC2A 2HS0A 4P2FA 4LRAA 4ELUA 3LP1B 3ZNJ1 4NEYA 3H7HB 2QZ8A 3I0SA 2FVCA 5CYMA 1QVFR 2UUAF 3QJJA 4ED3A 1V9OA 4DLEA 3IR5B 5BYQA 3SQGB 1WG4A 1O8BA 3DLGB 3CCUS 5IWAJ 3PNIA 2IM1A 4G6VB 4UY8T 2A6MA 3TANA 4M5NA 1Y3JA 4PG8A 4MKVA 4DL6A 1U6FA 3OPKA 4LUBA 2EKYA 5HQMA 1WHWA 3HJVA 2EFOA 3T5HA 1NB7A 5KFRA 4DF4A 2XGQA 4DPXA 2MHEA 5DJBA 2HHWA 3EX7B 1YJRA 3CULA 3W2WB 3UE2A 4KTQA 1O0PA 2LEAA 2ZJQQ 4KHMA 5DG8A 3NS5A 3M6XA 3H5SA 1B0TA 1C0UB 4LRCA 9RUBA 4QR0A 3QO9A 3LPYA 5HATA 5AE3A 4UOHA 1L3VA 1ZH5A 1HD1A 3FRZA 1HNVA 2QYGA 3PO5A 1S49A 5B09A 4C8YA 1U24A 1V3RA 5E3CA 1RXOB 4WIQA 3ITHB 3UR0A 1Y7PA 4CH0S 4DN0A 7FDRA 4IR1A 2DK2A 2M8HA 2B9WA 5J2NB 3VAIA 2XS5A 3LOUA 1XBWA 3K58A 2WVCA 3EGNA 2QMXA 3S6EA 3HULA 3JQMA 4WU2A 3UDCA 3VGSA 5AXLA 2ZBCA 2EG1A 4J9RA 5HN0A 2DIUA 3UD3P 4ILRA 2HRUA 3PRDA 3PACA 2DPJA 4JI1J 5KG1A 5J2MA 3NBPB 5F8MA 4TU8A 3V6HA 4ZVOB 4UZBA 2ZDOA 1R89A 1TL5A 1F3VA 2C2ZB 2FTRA 1TMJA 2IDEA 2CNOB 5I3UA 1SKWA 4OHXA 5KFDA 2E1PA 4JI7F 4RNNA 1AZSB 4H4KA 2R7VA 3KNGA 4H4OB 2CJAA 2OLWA 1L3SA 4P10A 1RJJA 4OI4A 2NXEA 5HMYA 3N4WA 3NCQA 2C1EB 1TZ0A 4YFUA 1Q95G 3E8OA 4MK9A 3OBIA 2AGPA 4LREA 1HNIB 3NMRA 1N54B 4LF1A 1NPKA 3KDOA 2F9JA 4UOFA 2KT5A 3OL7A 4N41A 1SL2A 3DYAB 1CLFA 4PWUA 2DXEA 2HNDA 4OZJA 1HPZA 1AW0A 5J1EA 1EJ7L 2DHHA 2NPIA 4MH8A 2E1MC 1T3NA 3KG1A 1YKWA 5BR8J 4Y2CA 4YB1P 3MR2A 1ZBTA 2VPXB 4IH6A 4LR9A 5KT3A 5I4MA 4LVOP 2IVMA 1CSJA 2XCPA 2Z2YB 1KQKA 2WAQD 2QN6B 2BE9B 1RT7B 1WC5A 2AYEA 3VZHA 2V63A 4PCQA 3NGUA 2GVDA 4USUA 2ZKTA 2RJZA 5KG3A 4I7FA 1YRTA 3HHNB 1QVGR 5CYQA 4LIRA 3KLGA 2OHDA 1N56A 4EK2A 4IH7A 4QOTA 2WVFA 5KFIA 2CVEA 1RZMA 4YR2A 3JQKA 3LP1A 4NEZA 4UUWA 5KT5A 2V2ZA 1MWYA 4WZQA 3J81j 1URRA 3EM1A 3KK1B 1E6YB 2RDJA 4LJMA 3SQGA 1OSDA 1TK8A 2UVRA 4NZ6A 3VAFA 3CD6S 3DLGA 2CZ4A 3G6XA 1RLDA 2MTLA 4QPXA 4DU7A 3WIUA 3Q22A 3FKBA 1M0SA 3H2VE 3AJ2A 1F5CA 2Z2LA 2IRUA 1GX6A 3D0HE 2VBZA 1VGYA 2QJ3A 4I4BA 2J6TA 2A0FB 1NSKL 2CPXA 4IKAA 2Y1RI 2W2MP 5F3ZA 1SIZA 5KT2A 4J9SA 3K5MA 1VQ5S 5HBMB 1BD6A 2ZH8A 2HHQA 1N5QA 2QLXA 1H7WA 3CF5Q 2RNEA 2KO1A 3VAKA 1VS3A 3SFGA 1RAJA 3OVSA 2J7KA 3TJ8A 2HVEA 5KFHA 2KRBA 2XZDB 1C0UA 1IKWB 4DI6A 2J0WA 1VIXA 5K14B 3F56A 1H38A 3EJMA 3QLHB 2R7XA 1URNA 1PG5B 3MFIA 1T8EA 1GFWB 4IYQA 2G13A 4P2XA 3R2CJ 1WOOA 3SQOP 3BEGB 4JI2J 2DNPA 2V34A 3KYLA 1C2PA 1FRJA 3ITHA 3R5JB 4DV0J 2ZE2B 2MKIA 3NNAA 5EGYA 3FZBA 1IVZA 1PGZA 4DUZJ 3UD4P 5J2NA 1YHQS 1YITS 3HT0A 5GAEI 4DPTA 4FNIA 2C3OA 3FGVA 2ABYA 1RK8A 4FF3A 4ELVA 4RW4B 2F7VA 1VQ7S 3NY0A 2B8QA 3UCZP 4JB8B 1UFKA 1UEVA 1WC3A 1R31A 2CQGA 1BE4A 2GO9A 1Q8LA 1RT3B 3TAPA 1ULRA 3K2YA 2J8SA 4A48A 4EYHB 2HBRB 2CQBA 4PYAA 2X7IA 2GW8A 3TARA 2F4FA 1AZSA 4H4OA 4ZLLA 3A13A 4TN2A 1HBMB 4X4RA 3VV2B 2CKWA 4CT9A 1SJRA 5ETRA 1NCLA 2BZ2A 1IQZA 3R5CA 2JC1A 4ZCIA 2HHUA 5F8JA 1DQ8A 1S0OA 3MI7X 2FHOB 1NDLA 1QUPA 1RWVB 1HNIA 2V8GA 3G82B 2KZMA 2R2RA 4DR5F 5KFOA 4LSLB 3HHLA 4MYUA 4IRDA 2UXCF 1AYEA 1ZTTA 4DR7F 4KB7A 2MZJA 3P96A 5LSRA 2MZ1A 3RBZA 1K0TA 3QZ8A 3DYAA 4F2RA 4K5RA 1X4CA 3KK3B 4DL7A 1UVMA 2GJFA 1S1XB 1UCNA 4PG7A 1U1OA 1TUGB 4V19J 5GAHI 4I6YA 3SZ2A 4ZLNA 1UPMB 4Q45A 4NLUA 4QW9A 1J5OB 2Z30B 5EX3A 1RWUA 2R3VA 1R3NA 3CCMS 1S99A 1E6VB 3PYGA 1X9MA 1UZDA 2HGMA 4CO3A 2GMHA 1RT7A 4LSNB 4CLWA 3I9ZA 3DRRB 2RHQB 3U7JA 2KRRA 4RNHA 5KFNA 3OUYB 3IWLA 1FXRA 1NSAA 2YPYA 2PMHA 2CJKA 3VALA 2FZKB 4KHPJ 4JI0F 2LVWA 4F25A 2QX0A 3FQLA 5ADZA 1NJZA 3FEZA 3DRYA 4DSFA 3ENQA 1HLWA 2KL8A 4NXNJ 2MZRA 3N6MA 2M0GB 2WSFC 2FY8A 1WDDA 3LUYA 1E6YA 3KK1A 3MEEB 3KHGA 4PWDB 4Y28C 3ZZPA 4RBVA 3DRXA 4ED0A 2JWNA 1TKTB 1AT1B 2ZOMA 1RE1B 4WP3A 1BLUA 2YWEA 5D3GB 2CQIA 2LDIA 3M2RB 2RF2B 3HPOA 1RAEB 3PO4A 1QD1A 3RRGA 1K8AT 4X65F 3HO1A 2DO0A 3J80Y 3FEXB 4RNFA 3VQSA 2M7SA 1NMEB 1UW9A 5HBMA 1N5VA 1KHVA 1QE1B 2AT1B 3H5YA 4FZVA 3PIOQ 5JVHQ 5GMKa 2CDRB 3NGTA 3L09A 3G8TA 1F1BB 5F8LA 4DPUA 2KFZA 4NMXA 4F36A 3D2WA 1IR2A 1RAAB 2AJFE 3TZXA 1JKHB 1OPIA 2MKHA 1EHWA 3TUZC 2ACMA 1S12A 1IKWA 1WOPA 4FYYB 2FLLA 2G1DA 2WSCC 4C3KA 1FHTA 3S8SA 1D9DA 1RU2A 5K14A 3QLHA 3PCOB 2W2NP 4P7VA 1TP7A 4B3TJ 2H4YB 3W5XA 2J9EA 3W60A 3US5A 2X51A 2ZOFA 4NCBA 3UPFA 1G2EA 4OX7A 1JK9B 2ZE2A 4NLTA 2R7QA 3BKFA 3R5BA 1U02A 1TMMA 4OMFG 2JLFA 2V94A 1L3TA 3GP9A 3M9MB 1YX2A 4A46A 3CTRA 3MPWA 1JIHA 4GKKJ 4RW4A 3BR9A 4FYDA 3BSOA 2DH7A 1IR0A 2AKWB 3UO0A 1U1MA 4JI4F 3AY0A 4ECTA 1XNQJ 1RT3A 1C1BB 4ZPVR 2JRSA 2WBMA 4HHJA 1YWXA 3RBEA 2HVHA 3OXFA 3L7UA 2W4DA 2EBEA 4P74A 1I6JA 5LMUF 1F5BA 1KVKA 3OR1B 4P7TA 3VQTA 1IBCB 2R9LA 4F02A 2E7XA 1U1NA 2NXNA 5IV3A 3ZTOA 1HBMA 3HKZD 2DCLA 2CPDA 2C2KB 4UTGA 2F8EX 5KT6A 2V2KA 2MDAA 1JJCB 4LT6A 3GJRB 2DITA 1YQHA 3KG0A 3G82A 5KFSA 4LSLA 4USTA 1QSYA 4FNHA 2XNRA 3L9ZA 1NPPA 3ELHA 4S0MA 3DM2B 1WACA 5LSLA 3CO9A 3EVMA 2HS3A 3BYRA 1TL4A 3KK3A 1S1XA 3CCVS 4OLPA 4ZVGA 2FJBB 3NCPA 3KHHA 3L3CA 2ZM6J 3POTB 4DQSA 4DX7A 1U45A 5EUHA 4B3MF 1K1SA 3TA2A 4DWIA 3IXQA 1LWXA 4ID5A 3PKMA 2FJAB 2E5LJ 2L9NA 1J5OA 1FWPA 1H2UX 3K89A 5HI7A 2HLTA 2RS2A 4TYAA 4F4YA 4ZPWR 1Q0NA 3OFHA 2WB4A 1YZ7A 1SI9A 3K17A 1E6VA 4PXCA 3CCRS 1JJHA 4I56A 4LSNA 1K9MT 4K4SA 3DRRA 1L3KA 2VC0A 1UVIA 3EZUA 3OUYA 2GMJA 1RWOB 2V9KA 1GMVA 2JX2A 4F26A 1U1PA 1R27B 5KFKA 1RBLA 2CWKA 4JBCA 3NL0A 3HI9A 1FK9B 2YNFB 1NDCA 2VODA 3RUBL 3SYZA 4YS2A 1Y11A 3LH2S 4TVAB 2RS8A 2WVEA 3JSRA 3T41A 4DPWA 3MFHA 4ED7A 4ZPCA 2AHOB 3HSZA 2VZ9A 3I87A 2DD8S 3AAWB 3MEEA 4PWDA 4AXIA 4NASA 2I8EA 1VMBA 2DBBA 2XY5A 2VD3A 1TKTA 4C6AA 4O23A 4UQGA 3KOAA 2YTCA 1DZ5A 5D3GA 1F9EB 1JLQB 1LNQA 5KFYA 3UN5A 5CD4A 3RB0A 3M2RA 2RF2A 1G3OA 1NPRA 2VUGA 5BYSA 1QLNA 3BBCA 5L38A 4BC9A 3IR6B 3QWUA 2MSSA 1TQLA 1SJFA 4DV6F 1B7YB 2XQCA 1QE1A 2XYPB 4NYZA 4LR8A 3KFWX 2VBXA 3PEJA 2J76E 4LR7A 4E8UA 2IJFA 2W01A 1S59A 3Q8RB 1RHQB 1N34F 1U25A 1LKZA 1JKHA 4DV4J 1U47A 4DMZA 2JFDA 4PKDB 2G2ZA 2J0SD 3LPEA 3A12A 3TVZA 3AD8C 2DNQA 1BQMB 5J1NA 3KMSA 3MCSA 2V5HG 1XERA 2ZWOA 1R6VA 4OQJA 1SPBP 3TOQA 5E41A 2CQ2A 2OPRB 1M5OC 1SJ1A 4G65A 1FJ7A 1RYSA 4YR0A 2CJQA 1R0BG 1UMJA 4ZVTB 2A2DA 5BXIA 3DXSX 2LKZA 4X62J 2DNZA 3H20A 2ZHOA 3TUPA 2FDNA 1OS5A 2MKCA 1CVJA 2HKEA 3TJ9A 2Z8QA 3RBXA 3HHEA 1GXTA 2WSEC 5I42B 4U7UK 2H1YA 4Q44A 4LF7F 3U1MA 4OFZA 1FXDA 4NRUA 4D3GA 3UDEA 4A8MP 1RWXB 4YHHF 3SCLE 4F2SA 4DQRA 4UQTA 3NLCA 4RNMA 1C1BA 1FEHA 1DURA 3I5CA 2FJDB 2V8HA 2ZVIA 3OLAA 2YH0A 4JV0A 2ZBPA 5D0GA 3BBBA 2P9GA 2LQJA 4NLSA 3OR1A 1HWUA 3DCAA 4BCAA 1RAIB 3P5BP 1JXVA 4FS1A 5G0RB 2GQQA 4YB5A 3E2EA 2NR0A 4AQYJ 3GR0A 3MUMP 5J2QB 2WVBA 1RT6B 3P49B 3PIPQ 4J9UE 1K73T 3R2DJ 3D1HA 5HMWA 1SC3B 2FJWA 1WHXA 3U27A 4IG3B 2D74B 2QSFA 2OEKA 3DM2A 5DETA 2ZZNA 1AA1B 5EN1A 2E44A 2QV6A 5IXUA 4KHRA 1TL3B 1GEHA 2J8AA 2J0QD 1O51A 1Y5LB 4LFAJ 1PO6A 3POTA 2VICA 5F9LA 5A0YB 5KFAA 3IS9B 3JAMU 3CDBA 2VJVA 3D54A 3EPGA 2MY8A 2VV5A 4DHVA 2W2OP 1PAEX 2HFOA 4JI8F 3Q83A 4P9SA 4XK8C 4Y0FA 3R7NB 3PHEA 2VA2A 3TQ1A 3ZTRA 5H9FK 3I55S 3HVWA 1X4FA 2IM3A 2D69A 4B17A 3QGHA 4RW9B 4F3OA 5H9EJ 4ZOSA 2XO6A 4ZVSB 1NHUA 2ZUGA 4C8KA 3A4TA 5GMEA 3FFIB 5HROB 1FK9A 2YNFA 4J9OA 5D0HA 2ZJRQ 2FYXA 5F8NA 1F9HA 2XMTA 3BSCA 4DPYA 2H5IB 4EO8A 4DFMA 4EBCA 1DQAA 3ISZA 2VFRA 2EPIA 4LRFA 3OQ2A 4X84A 1R0CB 3AHPA 1D3WA 3HHKA 1RI7A 1VRQC 2ZOGA 2DRAA 1JLQA 4DV2F 1RDRA 4WBFA 4IFYB 5ETVA 5C2CA 2AEJA 1MW7A 5IOLA 1SB6A 2J7WA 4FXWA 2HG4A 1HMVB 4LF9F 3CIMA 4QQBA 4USMA 3CDEA 1T02A 2F4VJ 4ZITA 4MIAA 5HMXA 4CWBA 4NLQA 1SH3A 2MZTA 2YWFA 2NQPA 3PJ9A 2UUBJ 3G9CA 3N0VA 1BQMA 1UFWA 2IRYA 2DGSA 5DLFA 3TO8A 1VQ4S 2BRKA 4F04B 1MNEA 2C3PA 3CGIA 1YJWS 2AV5A 3M1VB 2R7OA 2JC0A 2YQ0A 2UXBF 5KOWA 5C42B 5L46A 3IBCB 3KDNA 2J9DE 1ZAWA 1F5AA 3LP0B 2DVIA 2OPRA 1TTHB 1FKPB 1Q7YT 5KT7A 4DR2F 1GXUA 2ZDPA 2BW7A 2YWGA 2UP1A 2VQEJ 1IBMF 5KG2A 3DDIA 4B3SF 3HFZB 4USKA 1UJ6A 4JV5F 4RUBA 3GYNA 5I42A 4URQU 4JV1A 1HHSA 5L1LA 2W9CB 4BHQA 3H4DA 2XY6A 3OV7A 2CJ9A 4UW2A 4QYZJ 2OFHX 3THTA 3IWXA 1MN7A 2EEYA 2HZVA 3LW5C 1NO8A 5A8KB 1T9YA 3D3BJ 2KFYA 1S7IA 1FRMA 2AYMA 4OZ2A 1YBAA 3I4HX 4F4AA 1LK7A 4H54A 2BXJA 1G6BA 5KFEA 4O0IA 4L74A 3D4JA 2RUGA 3M32B 2AD9A 2DJWA 4X64F 1VQ6S 1HNWJ 1P6TA 5G0RA 4ELTA 2BA9A 2FJVA 3VGUA 2BE2B 4ED4A 3NS6A 5J2QA 1NK9A 1RT6A 3T6BA 2YKNB 2KVQE 4AE5A 2BM0A 1U26A 4GMKA 3FUYA 2H3EB 4DL2A 2DHSA 3J7ZT 2SXLA 1K44A 4DS4A 5DO2A 3DGPB 4KKOB 4IG3A 1YGYA 4GC6A 2CQ1A 2DGWA 2IY5B 1N52B 1TL3A 3SIPB 4YB6A 5HAOA 5B0GA 2LQ9A 2D3ZA 4QIFA 4MT1A 1YIJS 1XNRJ 5M2RA 3GE9A 2L41A 2OPPB 3CJSA 4O4GB 1NK6A 2AJQA 3FDSA 5A0YA 3IS9A 4UUXA 4IR9A 3M8WA 5A8WB 1CQNA 4NZ0A 3V6DB 2L3MA 4QIEA 4B9TA 4ZLPA 2B7BB 4ZCLA 1N5YB 2QLBB 3CCLS 1FJEB 3R8YA 2ERRA 4ZCMA 3QT6A 4U95A 1ZZFA 3JB9k 1LXNA 2E7WA 2QSWA 2AJ1A 4DS5A 4Q43A 3DN9A 3GONA 4ZKAA 4YMEA 3PJXA 2GCFA 4CYUB 2QA4S 2BQRA 2DYAA 2W8LA 1VQYA 2XLJA 3RR7A 1RT2A 4RW9A 3BGLA 4Z7CA 3OW2R 4U7CA 1TL1B 4G3IA 1VK3A 3UI3A 3FFIA 5HROA 2BJ1A 3PJWA 1JLFB 1UWAA 4K4VA 4DDFA 4M95A 2GIFA 4DU8A 3P45B 4FKYA 2Z0GA 1SH0A 3EWGA 1VK8A 1VR6A 3FZ2A 2N7YA 4HDHA 1RACB 4OYPA 3AD7C 3GIKA 3M05A 5KFLA 1VQSA 2DNYA 2I5JB 2LQBA 3U1NA 1NH7A 3MMBB 1HNXJ 2EFQA 4NLRA 4UOCA 3QGPA 4M1KA 3HFVA 1I5OB 2FUG9 4IFYA 3HD2A 4NOHA 2KH9A 4B3OB 1W2BR 3ZTSA 2IMWP 2FVRA 1NSPA 2IVYA 4JI5F 1S77D 2XYHB 2B8PA 2BKOA 2N3LA 1HMVA 3W65A 4NYOA 3OL6A 1N4LA 3X3UA 4HH1A 5GAEU 1XR7A 2M5YA 1Q4RA 1ZM3A 4A8FA 2FC8A 3CB4A 1AUDA 1IN0A 3K5OA 2IIHA 5KFBA 3T1YF 2DR7A 2F40A 3FBEA 3CIZA 1OQ3A 3M8YA 2LFVA 3M1VA 3WZ0A 1FNOA 1YBTA 2H9ZA 2D3O1 5KG6A 4R0JA 4OYIA 4NLDA 3QJLA 3LA0A 4ITSA 5C42A 4EFAC 4FF2A 1ZA2B 2OMOA 4EBEA 3PYDA 2YXLA 3LP0A 3FSIA 1PCAA 4OJHA 1FKPA 4F8RA 4OX9F 1HNZJ 3RR8A 3KMQA 3IWNC 2DHXA 4Y00A 4ED5A 4USWA 4X4NA 1JWWA 2XLKA 2IHR1 4B9NA 1QTNB 3NAIA 1ZETA 2DR9A 3QGGA 3PR4A 3TZWA 3ZXWA 3TJAA 1N32F 2BUNA 1UWBB 2CDQA 2W9CA 1KTQA 1M5SA 3OSNA 5AXMA 3O5TB 3W66A 1SQGA 5D0RA 4LQ9A 4NE9C 2ATLA 1HR0J 1PC5A 4F4WA 5A8KA 2CIMA 2RMLA 1WEXA 3BH7B 2CFXA 3DLHA 3HJFA 3ZZZA 4MAKA 2B9XA 3QYYA 4OYWA 3WX8A 1T0TV 5GAHU 4K2XA 1HBOB 3Q8YA 4NI2B 2U2FA 3M4XA 3OJUA 2DGTA 3M32A 4QR2A 2KB2A 3DU5A 2AEMA 2L9WA 3PG9A 3HHDA 2BE2A 4UY85 1YDLA 2BACA 1WC6A 1FRXA 1NSQA 2YKNA 4OZ0A 2HVZA 2OUGA 1Y00A 2NXJA 1HI8A 3KXDA 3EGWB 4WU3A 1S9EB 4J7CA 3DGPA 4KKOA 4KGVB 2XMAA 1VQ8S 3GWCA 3GMGA 2UVVA 4DBQA 4PG5A 3EVOA 4QWDA 1U8SA 3MR3A 2OPPA 4O4GA 3R6GB 3H4BA 5A8WA 1S1WB 3GYGA 4WP8A 5SZTA 1D0EA 3HDSA 3RBDA 1OJ4A 2FC9A 1WWHA 3V6DA 1N0VC 1N5YA 4KAIA 2NUHA 2Y3YA 5DQGA 2MKYA 3TZYA 2OEMA 4JYAF 4GVLA 4K7QA 2MY7A 4HACB 4NLXA 3MUVP 4YY3J 4CYUA 3ZTPA 2ZH4A 2VL1A 4DQIA 4ZHRB 2HNZB 2BQ3A 5DDPC 2ZFHA 1KDNA 3N28A 1KP6A 2KU7A 3ZZRA 1TL1A 1H6KX 3VF0B 5IFMA 2EI5A 1K0VA 2UU9J 2IPOB 4OHZA 5CH7B 1JLFA 3IGVA 7AT1B 1OO0B 1Z2ZA 1NNDA 5B08A 2GC8A 3IGNA 3CSKA 4J9KA 2R7SA 2D7SA 2Y8WA 2J5AA 2E5IA 5K8MA 3BF4A 1N5TA 2JH3A 3EDRB 3MMBA 4ES3A 3ZZOA 4QPTA 3IFEA 3WC2A 1NM2A 5KAKA 3JTOA 2W4PA 4FVMA 3A3OB 2Y8YA 1UEKA 4FPIA 2YWWA 1S0VA 1KS2A 2V4JB 2E5JA 3MEKA 2Y1JA 4B3OA 1JB0C 4DV3J 2AJ2A 4ZP9A 1IBLJ 2CQ3A 5IM0B 5DM6Q 3L95X 3DKDA 4ED6A 1HI1A 5B0DA 2GJIA 2OO4A 4E2FB 4RNOA 1RKIA 1HW8A 5IZHA 1T9TA 1S6OA 1NZAA 2XMVA 4ZP6A 2VPYB 4PYDA 5IT9U 4C4WA 1FD8A 2PMWA 2RD5C 1YBUA 2ASYA 2YKOA 2MZQA 3AQPA 2IYIA 2ZUAA 4K50A 3K8VA 2IJRA 1RHMB 4M5IA 3FCHA 4CM0A 4N8OA 2PI5A 1RWPB 1KRPA 1SJ3P 2IMOA 1X9WA 4A47A 1WTFA 2DY1A 1ACMB 1HFEL 1X5OA 1ZM2A 3KWMA 1TELA 1RISA 3K57A 1FKOB 3GYXB 2NPFA 2UUAJ 1Q8BA 1WDTA 3MPDA 1BHNA 3ADAC 4GO5X 2O3DA 1UWBA 4PPDA 1S7HA 3W62A 5DZ6A 4CT8A 1X9SA 2AEFA 5FLXU 4LFBF 1WHYA 2BKPA 1JJ4A 2KTQA 1FDDA 4J9PA 3EVWA 3UNGC 1SCJB 1GMWD 3B8HA 4NA3A 1EQ0A 3GFXA 2OPQB 1HBOA 2Q1LA 1JLBB 4NI2A 3IP0A 3CJ8A 4A8XA 1FI4A 2KM8C 4DL0C 4DJBA 3K0JA 5CQGA 5LT5A 2O67A 2GIRA 2Z2MA 3IMQJ 4LBHA 3UDLA 4DUYF 1FX4A 1PAUB 4NZ7A 2LEBA 4OYOA 1S9EA 1MU2B 1QTMA 5L8RC 4DR6F 3FBCA 4RUCA 4LQ3A 3MMJA 4TKTA 4KQZA 2LU2A 4L72B 3UDVA 3G96A 3WX4A 4DV5F 3MTKA 1C0TB 2Z56B 4MJKA 1U6ZA 3MAHA 5EX0A 3EGZA 5K5MA 2FD2A 2EK6A 4YDXA 9ATCB 1LK5A 4HACA 2A10A 4NLPA 4DCPB 1VIOA 1R8PA 4ZHRA 3QFHA 2HNZA 3DRSB 4P72A 3MECB 3E3XA 1H98A 3HSGA 1HNVB 1UTAA 3DNCA 1RWKB 1HBUB 1S9FA 3M2UB 4MIWA 1XIQA 4PABA 5F0UA 3GG0A 3T19A 3B82A 1YG0A 3PZPA 2CA9A 1FJGF 2HVIA 4KRWA 4JI7J 4DFJA 1HWLA 1DAXA 2OEJA 3P6YC 3NNHA 3BN4A 1TK5A 3W64A 1HW9A 1WSVA 4PG6A 3SSQA 2LEPA 3UN2A 4P2SA 2DHGA 4RBUA 3MOZA 4DX6A 1OIAA 3ICLA 4KPCA 8RUCA 1Q79A 1T94A 4IQMA 4PG4A 4FKXA 3VAHA 4ZPDA 1U1LA 4DLGA 3HD1A 1IWGA 1LWFA 1ZYQA 3M7VA 2HHTA 2QYCA 1JNRB 1ZS6A 2V4JA 2VOOA 1OQ6A 3MCOA 5ETKA 3D68A 4YEAA 5C24B 2WCXA 4M5GA 3TAQA 5IQQA 3RTVA 4PQUB 2FZGB 5IM0A 2GZOA 3WHIA 2OTLS 3R5DA 2ZC4A 5D6GA 3TUIC 1NLKL 4OV1A 2UXDF 3WQPA 2XTJP 2XSJB 2VF3A 4K5SA 2XULA 1RBOB 1IKXB 5CYJA 2V2QA 1T9XA 2G1HA 2PD1A 1NHKL 2QLFB 3JXOA 5CHCB 3EICA 4RPFA 1X60A 4IOAQ 2V8VA 4IOCQ 1G4CA 1P8GA 5D4OA 4FP9A 3MMCA 1LWEB 5THWA 3KLEB 4KJIA 3PFOA 4ZK7M 1CC7A 2OJ3A 4DX5A 3K7RA 1MROB 1APSA 1XWLA 4IH5A 1SV5A 4NRTA 1VJQA 3OTOF 3AOBA 4OHVA 5AJ3F 4J37A 1T3OA 4E98A 2DGVA 1EARA 4X2BA 1J2VA 1XN9A 3BGRB 2QL9B 1VHFA 4KV8B 1HQ2A 1FKOA 2ROGA 3PEHA 5HVGA 2AGQA 4G1QB 4B3RF 1P27B 4IUFA 2ZVSA 3BS9A 2RHSB 1FESA 2J0XA 2MHNA 4WJBA 3T1HF 1CJTB 1HWKA 2Z57B 2C2MB 3OL8A 3W2VB 1S4FA 1WI6A 2J6SA 3GJTB 4JUZA 3CT9A 2R2SA 1VC0A 4V19X 1Y5IB 2U1AA 2OPQA 3TEGA 1U1RA 1JLBA 2HK3A 1V5IB 4CZCA 2RKIB 3JAMY 1ROFA 4WK1A 2JLEA 2RRBA 1QAJA 2MGZB 2BX6A 1EKSA 1C4CA 2GMLA 1PC4A 4CCHA 2GHWA 3DI6B 3TUJC 2BR0A 1WJ9A 2VQFF 1RHJB 1GMUA 1MU2A 1PSDA 3FCWA 2V69A 4F4ZA 1PJ5A 4FVCA 3N79A 2LQ8A 2XMUA 2NYIA 3EGVA 3AD9C 3N5BA 2CZ9A 1IQTA 3JSYA 1KVIA 1HQUB 1F2GA 3I5AA 2J7UA 2F1FA 4U8YA 2AX1A 3MCNA 2GNKA 3TVYA 2KKHA 1C0TA 3GTYX 4TQRA 2NXCA 4F4KA 2B56A 1CJVB 2N3OA 4NCGB 3PR5B 4Q5VA 2N7CA 2E7VA 2IVFB 4N56A 1KN6A 3BSAA 3OVAA 2X3GA 2AF6A 2GX8A 4H4MB 2A1BA 1KVJA 5KFVA 1KFSA 1Y5NB 4K2JA 2NSBA 1Q78A 3T5JA 1V3SA 3DRSA 3IRWP 2GAHC 3ZFVA 2HK2A 3MECA 3KHLA 1U0SA 3E01B 1UA0A 1NRKA 2EWHA 5JJBA 1WORA 1LWCB 3GJQB 4M5KA 3CDAA 1U4BA 1HBUA 3M2UA 1I94F 5A8RB 1W25A 2ZH7A 2Q79A 2HFNA 2E9RX 1X4BA 3H2LA 3D67A 2C2OB 1FRIA 3OR2B 2NUUG 4TLQA 4M5JA 3J81U 1EZZB 4WKYA 1Q53A 4L6V3 2L48A 2GO8A 1RT4B 1YJNS 1W2IA 1KQFB 3TA1A 4ED8A 3CW2C 2K7JA 3H8YA 1CQMA 4JV2A 1FJCA 4QWEA 4A8WA 2BBEA 4DR5J 2UXCJ 2HW3A 4DR7J 4LIWA 4WFBQ 4M5MA 3RRHA 2W24A 2RE1A 3T3FA 5LL6d 3QIDA 1M5VC 1X4GA 1XQIA 5C24A 4ANDA 1NH8A 3W1YC 1WI8A 4PQUA 3LANA 1SKUB 5F8GA 4BWJA 1P1TA 4MKYA 3VAJA 3MPYA 2XLIA 1VYAA 1DHMA 2XSJA 2VDIA 4KH1B 4X66F 4CI0B 1OPZA 2B6AB 4DSIA 1U1KA 1IKXA 1PBUA 4USHA 1NEEA 2NS1B 2CPHA 2VKZG 2H65B 1RU1A 1TL7B 4OLOA 2HQCA 1GK8A 1UJ4A 3HHLB 2IBKA 3N6LA 1WSRA 4U6PA 3NG8A 2XMMA 1LWEA 4ENOA 2M2BA 3KLEA 3W9HA 2DH8A 3SDEB 2BANB 5FIIA 1QM9A 4QWBA 4RKUC 3WBZA 3H98A 4JI0J 1MROA 2XHWA 1XEZA 5KFTA 1H72C 4K4XA 3SCKE 1N33F 4GKJF 2W7OA 2IC3B 3A8EA 4K0KF 3IO1A 3BM7A 3BGRA 4KV8A 5RUBA 3ZO7A 1RTZA 4G1QA 1KQSR 2PT0A 2HBZB 2J6UA 4LF5F 1REGX 2P9EA 4NWBA 4C0HA 4RU2A 4HL9A 4O3NA 3UD5A 1CJTA 1NJXA 2AJ4A 5AXNA 2YX7A 3TP2A 4KE5A 4BBYA 2C42A 3WC0A 3W2VA 3B4MA 5EDWA 4P75A 2EKNA 3FSXA 3MR6A 4HTIA 3PFEA 2A18A 2D3UA 1FFWB 4PXDA 2BV3A 3I9V9 5L1JA 1RGVA 4X65J 1U1QA 1EP4B 1FTCA 2H4WB 2CPZA 4F0KA 4CH1A 2HGLA 4QU7A 2RKIA 4O3SA 1XMBA 1D1UA 1X7VA 2KDOA 1RCOB 2EC2A 1FKAF 1X8DA 1A9NB 2QGFB 3QMQA 4PAAA 2W7AA 3G2XA 2KXFA 5GADI 2MGZA 1X5SA 1M5HA 2EK1A 2BQUA 4QW8A 3DI6A 5CXTA 1CG2A 2R7WA 4OYZA 3O3LA 1YJVA 4YDDB 4OI6A 3BQ0A 3TW0A 4ES2A 4YB7A 1D9FA 3GILA 3MCMA 4OX6A 1X31C 4XAKA 3MR5A 2WK4A 1HQUA 3M8RA 3Q2SC 4Y2KA 2QE5A 3G8QA 4RO0A 3K8WA 2KM8B 2RSQA 2H51B 1NK4A 3MDFA 2NSCA 1KHWA 2NLWA 2C3YA 1RP5A 4U9RA 1MN9A 3Q24A 1CJVA 4NCGA 3VAMA 3ILIA 1LQ9A 4MIBA 2CG4A 4X4UA 1T11A 4OIXA 2JNJA 3MHYA 4H4MA 2QMWA 1ZPVA 2DNNA 1VCTA 2E5HA 1BWVA 3MM5B 2NYHA 3CPWR 1VBKA 3K59A 4LFCF 2GQ2A 2BKNA 1SBRA 4C8NA 3R7SB 3E01A 4JI4J 4HHHA 1WEYA 2RAQA 1UPPA 1LWCA 4ZVUB 3SV4A 4NXMF 2ASJA 3KUHA 2OSQA 3HMJG 1X4HA 1HA1A 3QRPA 5A8RA 4KGKA 1SL1A 2BEFA 4O4RA 4ALZA 3VHQA 4RX6A 5LMUJ 3OR2A 4CLZA 5EWFA 2IRXA 2ZH9A 3GFYA 3HP6A 1OYDA 2M4MA 4ZIWA 3C2PA 1RT4A 5K9FA 3BZQA 5L39A 2MQLA 1S76D 5FD1A 4ZVHA 4J9LA 2R2TA 3DLKB 2ALYB 2YKMB 1AXQA 5CZVA 1B4SA 2BE7D 1J5EF 4DZ6A 1Q8KA 2G2OA 4HDGA 5CA5A 3H42A 1IM4A 4AL7A 1MMLA 2DXFA 2MLYA 4FYVB 4QIWD 2OGUA 2XMKA 3GCXP 2Q66A 5A76A 5HLFB 2HFVA 4B3MJ 1DBDA 2X1FA 4PR6A 2B6AA 1UEUA 2WW8A 1XMOF 5I3PA 3V2UC 5IQ6A 4LSZB 1HARA 3DLEB 5A2QU 2W1BA 3HSJA 1TL7A 4C11B 3D1OA 1H3DA 5H9EK 4M5LA 4WE1B 2AJ0A 1X5TA 5M2PA 4XDDA 2ZH1A 5KG4A 3CD5A 4C98A 4CLUA 3M6WA 3FRYA 4I2QB 4HVZA 2Y1LB 5ETQA 4NLWA 1OYEA 1WF1A 2CRLA 3SDEA 2BANA 4CRJA 2WVDA 2R8IA 2IC3A 2AP6A 4M94A 2A3JA 3HZGA 4ID5B 4IRKA 3QT5A 2HIYA 5ETSA 4FF1A 1YJTA 1FNMA 5LSOA 2H54B 3W8GA 1T9UA 1H73A 1H74A 1KWMA 3CCZA 4AYBD 2JEIA 2JDJA 3GV5B 5E0OA 3RW7A 3V5RA 3CMES 1KOOA 1N36F 4R25A 2GFFA 4IG0B 2XG8A 2KFNA 1RB0A 2KVIA 3CCJS 2XGPA 4D3HA 4C2MA 3AA8A 4DR4F 3VGTA 4HTJA 4FDFA 2KT3A 1IBKJ 2EW9A 4DSEA 1EP4A 1WHVA 1WELA 4C0BA 5IT4A 4JI3F 4DV6J 4ECVA 1QSSA 2JSXA 2QT7A 2DNKA 1T03B 2R7RA 2HS4A 3CDWA 2XI2A 2B5JB 2FHJA 3KLIB 5T7LB 2M88A 4RU9A 5T41A 2D1CA 1N34J 5ETNA 3MAAB 1TAQA 3FMWA 2VDHA 3SEOA 8AT1B 3SSSA 4Q8EA 3RAXA 3KLHB 3BKTA 2ZC3A 5CCMA 2OKQA 1CJUB 2K3IA 1WOSA 1YI2S 3ZZTA 2FLPA 2HHHF 4ID8A 3G71S 4PQAA 2DY9A 2GAGC 2CPEA 4DUTA 2HWHA 3P4UB 2C3UA 4WTYA 4N47A 5CABA 2AU0A 2HFSA 2DNLA 3TWZA 5C5JA 5HO4A 1Q86T 5KFJA 4IRCA 1S5ZA 3CCQS 2Y0BB 1VFJA 3ILJA 4C8MA 1DFDA 2KJWA 4I2PB 1WF2A 2JVOA 2W9AA 2W2QP 4CLPA 1WUUA 1EAYC 4QYZK 1EX8A 3ENWA 2K06A 2EFVA 2VFVA 1ICEB 2B3TB 3CJKB 5KFWA 4HLBA 3FSYA 3MM5A 3MM9B 4LF7J 2K3KA 1TKZB 4YHHJ 3OTBA 1RADB 2MYFA 2MB0B 3I0RB 3N6NA 5A6WA 4X4TA 1FE4A 3CMAS 3GIJA 3QJPA 1WC4A 2OH2A 1B7FA 3NGDA 2BYCA 2LCWA 1VBZA 4NLYA 1WG5A 1QJHA 4QU6A 4AD6A 3I4PA 2P5VA 2YX4A 2VFSA 3O6QA 4YOEA 3P8BB 2UUTA 2M52A 1KR4A 2L08A 1FD2A 5GMDA 3SI8A 2GIQA 1WKLA 5DGAA 1YJ7A 4X4SA 3DLKA 2VG7B 1V3ZA 2QIFA 1VC6A 2FGCA 2YKMA 2ZITA 1TUWA 3DGVA 3MD3A 3C6TB 2VH7A 4ZDNA 5JUMA 1AFJA 4XPEA 1VQMS 3LO3A 1ITPA 4PEOA 1RAOA 2NZCA 2BJ9A 2DNMA 1IM6A 4MTPA 2HFZA 4R8UB 1RA6A 5CZXA 4CO2A 2QFIA 2HVDA 4DCJB 4NLGA 5FDLB 1HWJA 4C3MA 2CPIA 1EB0A 4CIOA 5HLFA 5HL7Q 2PA8D 2DRDA 4DV1F 3T6JA 2WZ1A 4Z7YA 1SJ4P 3J7Z5 4X4OA 2COLA 2XM3A 4JI8J 2FVQA 3DLEA 5HK4A 5U47A 4A8KA 2G0CA 3D6MB 4C11A 2VBWA 2YKQA 4F4XA 4IO1A 4WE1A 2JJ4D 2QRRA 3MM6B 1GX5A 3Q8PB 2PC6A 3RB4A 1T05B 2QG9B 4I2QA 5A6PA 1FEEA 5JMNA 1OSCA 2ZH6A 1D09B 3FMBA 3M2VB 2VG5B 1R7IA 1TV6B 4JP8A 2RB7A 4KC5A 3HVAA 2EBGA 5ETPA 4R5PB 2OD6A 3FNNA 2CJBA 4ZA1A 4CO5A 4WK3A 3A3PB 3ISND 1WNEA 1S4EA 2AQ4A 2ASDA 2FLOA 4CO4A 1GTEA 4J9QA 4A8YA 5ETLA 1SQEA 3GB0A 1YRUA 2PSZA 1ZA1B 5D77A 7FD1A 4B9VA 4K8RA 2VHGA 1FA0A 4ZJQA 4IG0A 5HMZA 4OZ3A 1RKJA 5KTQA 1TAUA 3BB5A 4WF9Q 2O66A 2G0IA 4N5SA 2NREA 1JQGA 2RU9A 1D8YA 4USJC 2P6TA 4DV2J 2K7KA 1VOMA 2DISA 2HFUA 4OI2A 2DNRA 2V8PA 4FN5A 2XZTB 2B43A 4MFBB 3JQJA 1T03A 4DR3F 2K8GA 3V6KA 4LF9J 4B08A 2B5JA 3KLIA 5T7LA 4USIA 3GLJA 1NHVA 1PYTA 4ZN3A 3MAAA 2QC3A 4Z37A 2W2PP 2QO3A 4DR1F 3S7RA 1VQOS 3HXMA 3C14B 2E9ZA 3KLHA 3NAHA 2PMZD 1QY7A 1CJUA 4CTAB 2IA6A 2DR5A 2X3DA 5B7WA 2X1BA 5BJRA 4OI0A 4Q2LA 1HHQA 2QL5B 2O5DA 3HT3A 2UXBJ 1M90T 2RILA 4FBTA 2MEWA 4W98A 1RTHB 4AL6A 1TU0B 4E0DA 4EGLA 1KD1T 3M8QB 5LXYA 4DR2J 3NOCA 2GGPB 2RUSA 1U2FA 3R27A 1IBMJ 2KXHA 4I2PA 4B3SJ 3VGVA 1EQMA 1QAYA 2E1AA 3W5ZA 3KLFB 2G4BA 2QTWA 2F8HA 2HAIA 5DGBA 4ZVRB 2HQGA 4JV5J 4JI6F 4DOZA 3CJKA 3Q0AA 3CCSS 1BC6A 1R8CA 3FCVA 3MM9A 2VFTA 1TKZA 5AXKA 2MLZA 4ZP7A 3I0RA 1K1QA 3KLVA 2I38A 5F3TA 5KOXA 4DX8H 1GMWA 2LXIA 4WFXA 3AODA 4RJVA 5E7OB 2FHMA 2VU5A 3HKWA 4RBTA 4KFBB 2ZZMA 3GJSB 2VASA 4DV7F 3OTEA 4N76A 4YP3A 2ZZTA 2JFKA 3P3DA 2KI2A 4X64J 4WTOB 2ZH2A 4GC7A 2EC0A 2F5GA 5G4DA 2VOPA 3H0PA 3G8SA 1PILA 4EUVA 1RAHB 3RZAA 2VG7A 4EWTA 1N0UA 2KT2A 1FTRA 2W4CA 3B6BA 3C6TA 1F9FA 3M9NB 2N82B 1PYOB 4ZIVA 2PIIA 5J2PB 1BXNA 5E5NA 4N8NA 1BGXT 4R8UA 3NKYA 3FBFA 2Y9HA 2V0NA 2CG8A 4Y65A 1FVSA 3EYZA 3OFGA 3ET6B 4K59A 2DGOA 3ETOA 5FDLA 3MUTP 3OFFA 3A8JA 4O3PA 5KFMA 3UW1A 5LJ5Y 1XMQF 1L3UA 4CLFA 4OYXA 4AL5A 1QUVA 2NXUA 3PTWA 2YX1A 2V4RA 3RYLA 2R7UA 4NLOA 3MM6A 2CJYB 2VKRA 3PW5A 3EZ5A 5K8NA 3GR1A 1T05A 5AE2A 2RVJA 2UUCF 3H40A 3JS9A 3M2VA 2VG5A 4TY9A 2B9YA 1TV6A 3DRPB 3O8WA 3EMTA 4R5PA 2DGXA 3ULHA 1GTHA 3G87A 3GFHA 1BMQB 1DTTB 3R5GA 1PBAA 2MLXA 3UCUP 4XDCA 2FHKA 4FYWB 1KSPA 3PV8A 4MKBA 2BJ3A 4Y6IA 1NDKA 4CDIA 1Q82T 1MWZA 1SL0A 4PXBA 2W8KA 1WD6A 4GO7X 1AFIA 1VLOA 2V68A 2E66A 1H2VZ 3H90A 4DSKA 3CEDA 2WHOA 1RT2B 1RABB 3H5UA 2CADA 1TKXB 2RQKA 4LF8F 2POKA 1K47A 2B51A 4TXSA 1VRTB 1KC8T 1YLXA 2GA7A 2V50A 2ACYA 3W63A 2FB0A 4JI5J 2QLWA 2BM1A 4MFBA 2LQ5A 4QYRA 2CPJA 1IR1A 5LMNJ 2H5JB 1J27A 3ISNC 3UVJB 3A1YG 2DPIA 2FIUA 3DLJA 4J9MA 3QIPB 2PA3A 3C14A 3T1YJ 2MQ8A 4AT1B 2VONA 1S1VB 1UVLA 2E1CA 4CTAA 2RT3A 2YH1A 3EUNA 3BGUA 3N5FA 3OVBA 3ENVA 1FF2A 4C0OC 4PRFA 1R6YA 4OI1A 3C46A 3PW7A 4ER8A 2Y0SD 3D66A 3TX8A 1RTHA 3TX0A 1CPZA 1YJ9S 4OX9J 3M8QA 3LQVA 3AFGA 2GGPA 3Q23A 2KHCA 3W2WA 3J81Y 2HHVA 3W3SA 2G9OA 4EZ9A 4CLKA 3BGOP 3KLFA 4NMLA 1FERA 2P2CB 5IWAF 1WG1A 4RWXA 1N32J 1C1CB 2LYVA 2EFNA 4U96A 5J1PA 2MJNA 1VQNS 4ECZA 3MD1A 4OZ1A 2KXNB 1CULB 1VHIA 2XS2A 2KN4A 4OZNA 1VI7A 4L76A 3SCIE 5KFUA 1LEOA 4I69A 1UKUA 3LTOA 3QWPA 1LXJA 1YSJA 2HQDA 2D41A 3GU0A 3L7PA 2HBYB 2HBQB 1BY9A 2PO4A 4FBUA 2JEJA 3T1AA 5L9XA 3C66A 4KFBA 3D28A 6FDRA 3ZZUA 5F41A 2GJ2A 4UF4A 2HRYA 4Y2IA 1SQFA 3DMJB 3PRVA 5HJXA 1Q5YA 1S0NA 1CC8A 1KTVA 3VVUA 3TRGA 1IXKA 4PXEA 3JSBA 3LGNA 2YQ1A 5FJ4A 2I6WA 3I82A 3SV3A 3NBPA 5GAGU 1SKRA 2G2YA 1TFWA 4RW8B 6AT1B 3F73A 2F8MA 3TA0A 2HZAA 3V4MA 5J2PA 1Z4UA 3UWTA 1IJEB 3IM8A 1UJ5A 4GRSA 4HR2A 3KJQB 3ET6A 2FJXA 4MKAA 4M5DB 2HPUA 4CNYA 4P52A 2ZBQA 5EHHA 4LF6J 1Z1ZA 2IFXA 4MK7A 4YQWA 2UVWA 1FFSB 2OFGX 4WWSA 2RU3A 5MAOA 5EWGA 1B64A 4JI1F 2ADCA 4JYAJ 5C7PA 3CWJA 3IAS9 2WRMA 3KK2B 3H59A 1S48A 2MJUA 5D0EA 1Z2LA 2UUWA 4YN3B 4ECXA 3L7OA 2D3OR 3DLBA 4AUKA 1RSCA 5T14A 2OSRA 2ZH5A 3A8KA 4L73A 3J7YI 5F9NA 3DRPA 1GXLA 2C28A 2LMIA 1AUSL 1RTDB 3PYEA 5DQHA 2XNQA 5D8HB 3CD0A 3TZZA 2XMJA 2YNIB 3KUGA 3PVXA 3PDNA 3GSDA 1DTTA 3IR7B 4LF2A 1WF0A 2VC1A 5GADU 2CWXA 2HHXA 1ZTWA 4QWAA 1GQEA 3X1LB 2YNHB 4A8SA 2AIRB 3UFCX 4RZRA 4HYKA 4LF4J 3PM9A 3IRXB 4DQQA 4WKRA 2HRTA 3VWSA 3CVKA 5D15A 1UETA 4BWMA 2FLNA 3CNQP 3C15B 1A6LA 1TKXA 1FDBA 4TNOA 3F0NA 4MMOA 1VRTA 4TU7A 3NGKA 3KJVB 5KFPA 4P6QA 4F0MA 1V6HA 3BQ1A 5BR8F 1S97A 5SUHA 2IA0A 1FWKA 3JTPA 2JLGA 2HZCA 2NZ4A 3UVJA 1G7CB 4NA2A 2ZHAA 1LFWA 2CNNB 2IM2A 2W9BB 3CC2S 1RAGB 4K4TA 2HAFA 3AXKA 3QIPA 1W26A 4KH0B 1S1VA 1F60B 5AE1A 4ZVPB 1VC5A 2LA4A 2DR6A 2PFFB 3PW2A 2KJVA 3TEHB 2QA1A 3HX9A 2GV1A 3Q86A 3M8PB 4QIVA 4WP9A 2MKSA 1R8HA 1S72S 1NU4A 4MK8A 1EIYB 2MQQA 3CJ3A 1Q8IA 2QA4G 4MYTA 1JMTA 4CH7A 1GT8A 2RIJA 3HZEA 2OTJS 1PIEA 1C1CA 4HHUA 4ECWA 4DL4A 2DH9A 3PRBA 3P5TL 3WDOA 2KG0A 1EETB 1CULA 1VQ9S 2XO7A 3M6UA 5EWEA 5L1IA 1OWXA 3I96A 2ZD1B 2CPYA 2AGOA 4LFBJ 3M9OB 2ZNYA 3BDEA 1Q81T 1F0XA 1ZOTA 4FXVA 4AFFA 3D9BA 4WFZA 1ZM9A 2I0XA 4EMDA 3RAQA 1LW2B 5E3AA 1FT8A 3HCXA 4ECYA 1F2HA 3DMJA 1NJYA 4JOUA 2AYGA 1GNKA 2YNGB 4C48A 3NOGA 3GG1A 2B4VA 2RDDA 2EG2A 2J9CA 3JYTB 2H48B 3PW0A 4WYLA 1A7GE 1RT1B 5A2QY 5LOQA 4DUYJ 4RW8A 4J5OA 1LFPA 4LRBA 4XIUA 4JI2F 3UR3C 5JXSA 4F0HA 4DR6J 2ASLA 2XWYA 2AZ3A 3I5BA 4DV0F 4OJ1A 1TUVA 1FX2A 5HP1B 4DV5J 1DRZA 4DUZF 3EE3A 1XK8A 3C19A 1O5JA 4FPRA 4M5DA 2ZBIA 2VFUA 4OZLA 2Q6CA 3ZZ0A 1CBKA 5B0EA 4LVNP 1U7LA 3OT9A 3DHXA 2DB1A 1HL6A 4I68A 5DQIA 3CC4S 4IDKB 2QEXS 1T7PA 3KK2A 3BKUA 2LA6A 1MWQA 4ZLJA 2CQHA 3GPAA 3T9NA 3QFWA 5KFFA 5L1KA 3BV8A 1B3TA 4PZVA 1QSLA 1HWIA 3D7SB 3G6ES 2YBVA 1DARA 2E29A 1T95A 2WOMB 1VISA 2PEHA 1RTDA 4K4WA 3CC7S 2V2VA 2EVZA 5IT0A 3D6HB 2YNIA 1FJGJ 2DHAA 2UZAA 2HIQA 1SIWB 2MMYA 2ALZA 4BS2A 4ILMA 4C9DA 3QT8A 2YNHA 3HSDA 5I3QA 1SJQA 5KFCA 2MQOA 1BWEA 1TK0A 3IRXA 3OXGA 3LAKA 1NJWA 5L9NA 1AROP 3AA9A 3C15A 1RA7A 3TNVA 2HHSA 3NP5A 3KJVA 3CJ4A 4I67A 1C4AA 4ECSA 1HIYA 1NKCA 3MAQA 4OX8A 2RH3A 3ILLA 3QSYB 3BPSP 2B0GA 1X0FA 5KG0A 3OLBA 3MURP 3V81B 5B0BA 2UXDJ 4U7UD 2FZCB 2QFJA 2ZJPQ 2MKJA 1M5KC 1S1UB 2W9BA 2WB1D 2HQIA 1TVRB 2HURA 2I1RA 3OFEA 3CJRA 3FJ2A 3ONQA 4TQSA 5DDQC 2MQPA 4B9MA 1LWFB 3RRKA 4KHPF 3PHTA 2ZWPA 3PX0A 1IBKF 3S1TA 3ENAA 3MXHP 3AJDA 1ZZNA 2CQ4A 2XS7A 3VCDA 3M8PA 1P1LA 2BRLA 2N4DA 1MLAA 1NJIT 4NXNF 4DPOA 3HK2A 3QRRA 1BUXA 2HSEB 2HYIB 3OTOJ 4URSA 5AJ3J 3G6YA 1N88A 2RRAA 4O3OA 4OHWA 1NB2A 3IBWA 2LXUA 4Z2XA 1RLCL 4KGZB 2AX0A 1X0PA 1R43A 2WONB 4ZP8A 3MPUB 4B3RJ 4DEZA 4B9LA 1S6QB 2JHEA 3MTJA 4DZDA 1FVQA 5ITHA 4ZVQB 2XI3A 4ZPBA 1EETA 3BSNA 3T1HJ 2E1RA 1CS4B 2W25A 4ILLA 5HVHA 3RGIA 2ZD1A 4NLVA 2APOA 3R3TA 2BABA 3MMCB 1OY6A 2CNLB 2YQ3A 4WIIA 3MR7A 2CQDA 1LW2A 4ZS6A 1Q16B 3SCJE 2IYGA 1L5UA 2F3JA 5HANA 1QAXA 1SV5B 4WFNQ 3J7A1 3DOMB 4ED2A 1CJKB 1Y10A 2YNGA 2YWHA 3KTQA 4R0EA 1IUJA 1N48A 4PPZA 3R5AA 3JYTA 1PJ6A 2BDPA 3BDPA 3AB2B 2C2NA 5ETOA 4GVBB 1RT1A 5E3RA 2YY3A 4Y34A 1ZPWX 4RR5A 2R4FA 4B3TF 2VQFJ 4F67A 4KO0B 2M3DA 1UP1A 1PKUA 3T9ZA 1FRHA 3NNCA 3QQCD 3RB6A 4KSEB 3CD7A 5HP1A 1QDUB 2FGOA 5E33A 1RWNB 5ETTA 2UVUA 4LBIA 2AZ1A 2IAJB 2QLJB 4K4YA 1B99A 3AQOA 2YKPA 4ANCA 4K4ZA 4P71A 2Y1IA 2WW4A 4GKKF 5DG9A 5IS2A 2FQQB 3PYFA 3A8IA 5GVQA 4O3RA 4IDKA 2W7PA 3MMAB 2XCAA 2DTJA 3NS7B 3AOAA 3CJ5A 1XNQF 5F8IA 4QWCA 3VTIA 3GCWP 2C2DA 3DOLB 1RBAA 3CE8A 4WXWA 4O44B 2MXYA 2PI4A 4OHYA 5HQ8A 1B0VA 2VBYA 3VZIA 2WOMA 4OL8A 4ZPTR 1S0MA 1LV5A 1I94J 3K5LA 2LECA 1SC4B 3AB4B 2Z2ZA 4IFVB 1ZM4A 3OHBA 4L3KA 3DXBA 4I6WA 5AT1B 4F3MA 2BVZA 2HWIA 2HNYB 2I2YA 1LW0B 3VVTA 3IN5A 5D4NA 4DSJA 1SUQB 4OYMA 4HI2A 1WKKA 2YPZA 5KG7A 2YVSA 3EXCX 3MM7B 2F65A 4OJ3A 1VBXA 2OMLA 1I3OB 1SXLA 3BJYA 3W61A 5B0CA 4TYBA 2ZM6F 4A8QA 1DQ9A 4QR1A 1N6QB 1Q5VA 4KY3A 2VIHA 3H5XA 4C97A 2E5LF 4KPYA 2E9TA 5D4PA 4ANEA 3V81A 1HYSB 4HKQA 3Q89A 4X66J 4P2MA 1S1UA 1NK8A 3AXMA 1TVRA 4ZJOA 3BO4A 1YK9A 1NXIA 3N01A 1D9AA 4M8LA 2R42A 4U67Q 4X4VA 1DY3A 2RDIA 3GIRA 3R9LA 2XHCA 1RTJB 1UAWA 1IWAA 1IKYB 2MSTA 2B7CB 3R6LB 4RW7B 4O3QA 3BO3A 1DTQB 1VRUB 3SSRA 3KUEA 3K5NA 3TYTA 2BJEA 4HEA9 1N33J 4GKJJ 1U48A 5HSPA 3NCRA 4K0KJ 2D9OA 1KOHA 3Q8UA 2R8JA 4Q0BB 2FPHX 5LJ3Y 3D5MA 4YR3A 3FVYA 4QIGA 5HVFA 2WONA 4LF5J 1S6QA 5LM7E 3MEDB 4G1PA 4EI2A 3W9JA 4FF4A 3I6PA 2KYZA 1MMDA 2OELA 1CS4A 2DNGA 1JX4A 2Q6BA 1A0OB 3TQEA 3R1HA 2M70A 4B02A 4QCLA 1FRLA 1MG7A 3C3LA 5BYRA 4QZVB 4URGA 2DT9A 1VDHA 1U6BA 1U8WA 5H1SV 3OTDA 5IC6B 3DOMA 3M30B 1CJKA 2JL9A 4DV4F 2JVRA 3CCES 1R8BA 3IG1B 3MPVA 4ZPAA 1ZAVA 4DSLA 1UZHA 4KT0C 4GVBA 4ECQA 3K5PA 3ZZYA 1F3FA 2AYBA 5KFZA 5KFXA 1FCAA 2ZNZA 3T5KA 3W9IA 4WZMA 4KO0A 2OIHA 1MSWD 3BR8A 1RT5B 4V1Ak 3M6VA 5JVGQ 4OJGA 1JLAB 2R8HA 1F6TA 2V67A 1RHKB 3FK4A 1Y3KA 5F0WA 3Q8QB 3PW4A 1X5PA 3BBFA 3O2IA 2VG6B 5D4LA 4X62F 2CQPA 4L3NA 3GIIA 2IAJA 4PWWA 3JSMB 4OYAA 2ROEA 3F41A 2BJDA 2MQNA 2BJ7A 4P73A 1P9YA 4A8OA 5B0AA 4M5HA 3N9UC 2ADBA 3BREA 3MMAA 1JLGB 4EBDA 2K2PA 5C25B 3HM9A 2IM0A 5K8OA 3DOLA 4LFCJ 4OZ5A 4O44A 2DKOB 2GS8A 2CVIA 4NXMJ 2RRNA 1W7WA 4BLGA 4A4JA 3MEGB 1WTBA 3I31A 4WFAQ 2JZ5A 4IFVA 1PJ7A 4CO0A 4ECRA 4CM2A 4X4PA 2ZEJA 4XO0A 2R8GA 3BGFA 4AQYF 1Y4ZB 2XZWA 2HNYA 4RUHA 4LMZA 3QT7A 1RHRB 2R8KA 4J9VA 4M63A 1LW0A 5DRKA 4Y2MA 3DFEA 3M8ZA 2DXDA 1SUQA 2HLUA 1YTYA 3DOKB 3IC1A 4OV6A 1Q7LB 3HHLD 3H2UB 1FRKA 3MM7A 3W8PA 3I32A 1CEZA 1V5VA 2E5GA 1U2CA 1J5EJ 4NL5A 4LFAF 3KKFA 2LP4A 2P8IA 4KGXB 1N6QA 3IM9A 2YWKA 4W90B 3M8SA 1N8RT 2MZSA 2UV8A 3V6JA 2R2UA 3TVKA 3B54A 1UW4A 1RWWB 1UVNA 4X4QA 4I6AA 4J91A 2C2RA 2GVZB 1HYSA 1WKJA 1HHTP 3PX4A 4IQXA 4UOGA 2C2EA 1NK5A 1H2TZ 3L4BC 4H4KC 3OD2A 1JXEA 1KONA 2XWXA 4ES1A 1XMOJ 1M5PC 2RQCA 1SC6A 1KLMB 5E2QA 3BO2A 4ETZA 4DFPA 1PYSB 2XEXA 1S6PB 4ED1A 4DG1B 1WEZA 1RTJA 3Q2TC 5DDOC 4Y3CA 1IKYA 2UV8G 1OY8A 4RW7A 4Q7AA 1UFLA 3WIVA 1KEKA 1FDAA 1R0AB 2B4UA 1DTQA 5DZ7A 1VRUA 2N4CA 4ECUA 4N77A 4KIAA 2DEIA 5LMNF 4EYIB 3B4DA 5K8PA 3S01A 2VJUA 1JLEB 3TI0A 5DM7Q 1FE0A 4RWWA 1XC9A 1M1HA 1NUEA 4O0NA 2FHJD 1HBNB 4Q0BA 1S1TB 3D0GE 3FEYB 1TR0A 1SVDA 3THVA 2MQMA 3JTNA 3FQKA 2CJXB 3MEDA 3BYPA 3EDQB 3AJ1A 3T5LA 8ATCB 4DF8A 1Y9OA 5GAGI 1TFYA 1X4EA 4LRDA 1N36J 4ZVFA 3CCWA 3OTCA 2DNOA 4KGMA 3AH6A 4F50A 3NWGA 2ATCB 2PDAA 1HD0A 4WFYA 3CJ2A 1XTZA 4J9NA 4DR4J 4BDPA 2BJ8A 4FYXB 1YVFA 2XB2D 2ROPA 4JI3J 1T9WA 2KG1A 2F4VF 1RAFB 1IKVB 1GH8A 3M30A 2P9CA 4USVA 1FNXH 3CJ0A 3IG1A 2UUBF 4NCAA 2OD4A 4LBPA 3C8YA 3R97A 3NEKA 5C2GA 4DL5A 2L9DA 3PXGa 2FVPA 1S9GB 4I1TA 1P9QC 5ETMA 3CXCR 4C8LA 4NPOA 1RT5A 3KNAA 2DNHA 3D6FB 3O44A 1NBEB 3AT1B 1JLAA 1JNZB 3J7YU 1X4DA 2HHHJ 3BN7A 1HI0P 3NMAA 3SFUA 1LOUA 2VQEF 2VG6A
chains in the Genus database with same CATH topology
1LWXA 3JS9A 2BX6A 5CAAA 1EHWA 3FKBA 2AZ1A 4FKXA 1WKJA 1WKKA 1LEOA 3PJ9A 5BXIA 3NGRA 1MN9A 3L7UA 3EMTA 4UOGA 3Q8VA 3B6BA 1W7WA 3EVWA 1B4SA 1HLWA 1B99A 1NSKL 3BBCA 4ANCA 4DZ6A 1F3FA 3FCWA 3BH6B 1S57A 4UOHA 2HURA 3VGVA 4F4AA 1ZS6A 3ZTSA 3Q8UA 5C7PA 1NSPA 1UCNA 2DYAA 3ZTOA 2B8PA 2B8QA 2AZ3A 3FBFA 2ZUAA 2DXFA 1F6TA 3NGUA 3EVOA 2DY9A 3FCVA 3PRVA 3VGUA 1NDKA 4ENOA 4DUTA 4CP5A 1BE4A 1NDPA 3ENAA 1S59A 2HVEA 1NLKL 3BBFA 3FBBA 3VVUA 5CABA 3EE3A 1WKLA 3G2XA 2CWKA 4EK2A 4ANEA 2DXDA 3NGSA 3Q89A 1PAEX 1XIQA 1NPKA 1S5ZA 1NDCA 4DI6A 3ELHA 4S0MA 3BH7B 3ZTQA 3DDIA 4UOFA 1K44A 4WBFA 1NHKL 2VU5A 3Q83A 2BEFA 1BUXA 2NCKL 3BBBA 3EJMA 3FC9A 3FBEA 3GP9A 3VGTA 3VGSA 4FKYA 3FBCA 3EICA 3EVMA 3WX8A 3EM1A 1NB2A 3Q8YA 2DXEA 5IOLA 1NUEA 1XQIA 3MPDA 4O0NA 4ANDA 3ZTRA 1BHNA 3ZTPA 1PKUA 1JXVA 1U8WA 1HIYA 3NGTA 3ETMA 1NCLA 1HHQA 2HVDA 4HR2A 3DKDA 3R9LA 4F36A 3GPAA 1KDNA 4C6AA 1MN7A 4KPCA 3B54A 3VVTA 1NDLA 1NSQA 1VYAA 3Q86A 4W98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWX A;  3JS9 A;  2BX6 A;  5CAA A;  1EHW A;  3FKB A;  2AZ1 A;  4FKX A;  1WKJ A;  1WKK A;  1LEO A;  3PJ9 A;  5BXI A;  3NGR A;  1MN9 A;  3L7U A;  3EMT A;  4UOG A;  3Q8V A;  3B6B A;  1W7W A;  3EVW A;  1B4S A;  1HLW A;  1B99 A;  1NSK L;  3BBC A;  4ANC A;  4DZ6 A;  1F3F A;  3FCW A;  3BH6 B;  1S57 A;  4UOH A;  2HUR A;  3VGV A;  4F4A A;  1ZS6 A;  3ZTS A;  3Q8U A;  5C7P A;  1NSP A;  1UCN A;  2DYA A;  3ZTO A;  2B8P A;  2B8Q A;  2AZ3 A;  3FBF A;  2ZUA A;  2DXF A;  1F6T A;  3NGU A;  3EVO A;  2DY9 A;  3FCV A;  3PRV A;  3VGU A;  1NDK A;  4ENO A;  4DUT A;  4CP5 A;  1BE4 A;  1NDP A;  3ENA A;  1S59 A;  2HVE A;  1NLK L;  3BBF A;  3FBB A;  3VVU A;  5CAB A;  3EE3 A;  1WKL A;  3G2X A;  2CWK A;  4EK2 A;  4ANE A;  2DXD A;  3NGS A;  3Q89 A;  1PAE X;  1XIQ A;  1NPK A;  1S5Z A;  1NDC A;  4DI6 A;  3ELH A;  4S0M A;  3BH7 B;  3ZTQ A;  3DDI A;  4UOF A;  1K44 A;  4WBF A;  1NHK L;  2VU5 A;  3Q83 A;  2BEF A;  1BUX A;  2NCK L;  3BBB A;  3EJM A;  3FC9 A;  3FBE A;  3GP9 A;  3VGT A;  3VGS A;  4FKY A;  3FBC A;  3EIC A;  3EVM A;  3WX8 A;  3EM1 A;  1NB2 A;  3Q8Y A;  2DXE A;  5IOL A;  1NUE A;  1XQI A;  3MPD A;  4O0N A;  4AND A;  3ZTR A;  1BHN A;  3ZTP A;  1PKU A;  1JXV A;  1U8W A;  1HIY A;  3NGT A;  3ETM A;  1NCL A;  1HHQ A;  2HVD A;  4HR2 A;  3DKD A;  3R9L A;  4F36 A;  3GPA A;  1KDN A;  4C6A A;  1MN7 A;  4KPC A;  3B54 A;  3VVT A;  1NDL A;  1NSQ A;  1VYA A;  3Q86 A;  4W98 A; 
#chains in the Genus database with same CATH topology
 4HH0 A;  1D8Z A;  4WPA A;  4OYB A;  3GV8 B;  1HQE B;  1NAQ A;  3JSM A;  1GAO A;  3W7B A;  3AOC A;  2HQF A;  1IJF B;  3KHR A;  1I1G A;  3UN3 A;  1BQN B;  2FY1 A;  1DLO B;  4U8V A;  3RG6 A;  1JXL A;  3CJT A;  1JLG A;  3CDU A;  4C8Z A;  5K20 B;  3DDK A;  5C25 A;  1RWM B;  3FBB A;  2LDY A;  5F8H A;  3C16 B;  2VA3 A;  3TAM B;  3R1L A;  2VB6 A;  3O1L A;  3LP2 B;  1OY9 A;  3ILO A;  3MEG A;  3OJS A;  4NYP A;  3ZC4 A;  2YKA A;  2CYY A;  1HKA A;  2LU1 A;  4RW6 B;  4LF6 F;  3D6T B;  1ZAX A;  4IOB A;  1HNW F;  1VQL S;  1B0P A;  3ETM A;  3EXY A;  3KJF B;  3CJQ A;  2Q3P A;  2CAJ A;  2M9K A;  2FVS A;  2X1A A;  3BPD A;  4IO9 Q;  1XR5 A;  3DOK A;  1N5S A;  2V8D A;  1KBR A;  3G6V A;  5E3P A;  3EPI A;  2K1R B;  3U02 A;  2X1G A;  1RQ0 A;  1DJ0 A;  3QBC A;  3G86 A;  1S57 A;  4Y2A A;  3CMQ A;  3SMZ A;  3QAT A;  4NX9 A;  4CO1 A;  2HGN A;  3EZO A;  4HT7 A;  2M8D B;  4C3L A;  1FFG B;  4ETX A;  4ZMM A;  3J80 U;  3QZ7 A;  4CQ1 A;  1XNR F;  2IBO A;  4YUD A;  2GHV C;  3QNW B;  5DS7 A;  4B9U A;  3RW6 A;  2AMC B;  3BQ2 A;  1NDP A;  2HWT A;  2A2C A;  5E3Q A;  4W92 B;  2P6S A;  2GVZ A;  5M2U A;  1AB8 A;  4I64 A;  4DV1 J;  3ZTQ A;  2BOP A;  1RCX B;  2XYG B;  3DLL Q;  4LF4 F;  1T9V A;  5CCL A;  3QGI A;  1KLM A;  4Q2M A;  3RU0 A;  2I5J A;  1REV B;  3NRB A;  1U2R A;  4CLY A;  2ILY A;  3VR1 A;  1S6P A;  5KG5 A;  2XBP A;  3OXL A;  2QL7 B;  3HFK A;  4DG1 A;  5H9F J;  2HMI B;  3HHL C;  3SBM A;  3GQC A;  1BQX A;  2KYX A;  1R0A A;  2R7T A;  2F63 A;  3CCT A;  3TR5 A;  2DGU A;  4DL3 A;  3MGJ A;  2CUY A;  1M1K T;  3BH6 B;  2EXU A;  1UVJ A;  1JLE A;  3J7A N;  4TY8 B;  1HBN A;  3C6U B;  1OMS A;  1S1T A;  3U1L A;  1S10 A;  4G1I A;  2MPU A;  2B9E A;  3RJM B;  2CQ0 A;  3HLU A;  3QAE A;  4ICL B;  3LWL A;  2CXE A;  3PKY A;  2CZV C;  1U0H B;  1HNX F;  3D0I E;  5CD4 H;  3QRQ A;  5DLG A;  2HQ3 A;  4CLS A;  3HVT B;  4RL1 A;  1JJ2 R;  4PUO B;  4FXD A;  1JLC B;  3MOJ B;  2HEK A;  2OPS B;  1XR6 A;  1RTI B;  5KT4 A;  2PGC A;  1SKS A;  1UVK A;  2Z4P A;  2OAU A;  1KKH A;  3IA0 A;  3GFZ A;  2XC9 A;  3MM8 B;  1IKV A;  3A3N B;  1MMN A;  4DR3 J;  5CAA A;  3MF5 A;  4UZC A;  3GV7 B;  5HQL A;  5LXR A;  4DR1 J;  4NA1 A;  2B4P A;  2I9S A;  3IBF B;  5DDR C;  2O01 C;  1S9G A;  2QA2 A;  1ELO A;  3OL9 A;  5IC4 B;  3KJN B;  1VLY A;  3HVR A;  3THP A;  3RB3 A;  2PEB A;  2ZHB A;  4QJV A;  1B70 B;  1KNZ A;  1HNZ F;  4Q8F A;  3V4I B;  1KQG B;  2RQ4 A;  4RLE A;  4TU9 A;  6FD1 A;  4DFK A;  3UQS A;  1RYR A;  4N7T A;  3IAM 9;  2JEF A;  2HHP A;  1SH2 A;  1NKB A;  3GZ7 A;  2H5E A;  1FWL A;  1HQE A;  3D1Q A;  3I0S B;  3KG4 A;  1YZ6 A;  2NCK L;  5CYM B;  4KR0 B;  1S6U A;  2VPW B;  2ZH3 A;  4CLT A;  2XMW A;  1BQN A;  1DLO A;  3QSI A;  2JEG A;  4JI6 J;  2Z58 B;  3ZNU A;  4W4M A;  1HR0 F;  4HI1 A;  4WXO A;  2DR8 A;  1WC1 A;  3C16 A;  3GIM A;  3CO0 P;  3TAM A;  2EFG A;  3LGH A;  3NGR A;  4HT5 A;  4ZN1 A;  1FXL A;  3CUN A;  1YRX A;  3LP2 A;  4J90 A;  3UNY A;  1R8A A;  4CNZ A;  1Y0H A;  1VBY A;  2IDL A;  1M1G A;  5KFG A;  2C3M A;  2QMU B;  4RW6 A;  2PE8 A;  1S1W A;  4F7V A;  2GQC A;  3LF0 A;  4KBI A;  2O1P A;  4ZCK A;  3RAM A;  2CPF A;  2GHP A;  1VJW A;  4DV7 J;  3MWB A;  1NK0 A;  4EZ6 A;  3QPI A;  3QO9 B;  2ZBR A;  2ZKU A;  2DGQ A;  3LGM A;  4ATN A;  2PN6 A;  2K1R A;  3I56 S;  2EFP A;  2BW2 A;  3DDN A;  2IJN A;  1TKD A;  1G1X A;  5D78 A;  1FDN A;  4DQP A;  3MZI A;  4UT4 A;  2DRB A;  4OI3 A;  4AXJ A;  4EEY A;  1NKE A;  4F3Q A;  1I51 B;  1WC0 A;  1NK7 A;  3QAU A;  4ZJL A;  2LLZ A;  4QBU A;  1XMQ J;  5KFQ A;  2G0J A;  3E51 A;  3VAG A;  4YY3 F;  5IT9 Y;  1UA1 A;  3D3C J;  4EO6 A;  4ERD A;  3R7B B;  5B0F A;  5J2M B;  1REV A;  5MLC V;  2A6O A;  2JOQ A;  1XJW B;  4RUA A;  2XSF A;  2BMB A;  2CNK B;  4CP5 A;  1KFD A;  2OI2 A;  1FO1 A;  3HF5 A;  3LAL A;  4DXL A;  2V4Q A;  2HMI A;  1SC1 B;  3Q8S B;  2UUC J;  3G4S S;  2UU9 F;  5I3U B;  3GSI A;  1X4A A;  2B4O A;  2LXF A;  3W5Y A;  4BC7 A;  5HJY A;  2RQM A;  2D9P A;  3F44 A;  1QAI A;  3NXZ A;  2CQC A;  2VPZ B;  2DCU B;  4TY8 A;  2AWZ A;  3C6U A;  1EKR A;  3OSP A;  4C8O A;  2PFD A;  1RUS A;  1VQK S;  4C7Q A;  4ICL A;  4CLL A;  1U0H A;  2DO4 A;  1NZ8 A;  5DG7 A;  2AW0 A;  5FLX Y;  1YJU A;  2FJE B;  3Q8V A;  3HVT A;  4PUO A;  1H7X A;  4B9S A;  4K4U A;  4WYW A;  3LWM A;  1JLC A;  4WCE Q;  4EU0 A;  4DV3 F;  2OPS A;  1RTI A;  1Q1K A;  3UCG A;  4LF8 J;  1U09 A;  4I0W A;  3OHA A;  1IBL F;  3PY8 A;  2HND B;  2XY7 A;  4FS2 A;  3LAM A;  1HPZ B;  5IV4 A;  5J1E B;  3DHW C;  2Q43 A;  3MM8 A;  1S79 A;  2OP5 A;  4DN9 A;  3PX6 A;  2WTF A;  1UL3 A;  2KHD A;  1H0H B;  3NGS A;  2WBR A;  2V9W A;  1O6X A;  2BOA A;  4L75 A;  3FC9 A;  2DEJ A;  4XTT A;  4TLR A;  3SXL A;  3B78 A;  3H25 A;  3DU6 A;  1U49 A;  2DIV A;  4DCO B;  2GVD B;  1VQP S;  2ILZ A;  2KZZ A;  4ZVE A;  2C22 A;  4I7F B;  2F9D A;  2J9D A;  1KLN A;  3NWR A;  4KYZ A;  3V4I A;  5CYQ B;  2MKK A;  1RHU B;  3KLG B;  4XPC A;  2V6A A;  3DC2 A;  2HS0 A;  4P2F A;  4LRA A;  4ELU A;  3LP1 B;  3ZNJ 1;  4NEY A;  3H7H B;  2QZ8 A;  3I0S A;  2FVC A;  5CYM A;  1QVF R;  2UUA F;  3QJJ A;  4ED3 A;  1V9O A;  4DLE A;  3IR5 B;  5BYQ A;  3SQG B;  1WG4 A;  1O8B A;  3DLG B;  3CCU S;  5IWA J;  3PNI A;  2IM1 A;  4G6V B;  4UY8 T;  2A6M A;  3TAN A;  4M5N A;  1Y3J A;  4PG8 A;  4MKV A;  4DL6 A;  1U6F A;  3OPK A;  4LUB A;  2EKY A;  5HQM A;  1WHW A;  3HJV A;  2EFO A;  3T5H A;  1NB7 A;  5KFR A;  4DF4 A;  2XGQ A;  4DPX A;  2MHE A;  5DJB A;  2HHW A;  3EX7 B;  1YJR A;  3CUL A;  3W2W B;  3UE2 A;  4KTQ A;  1O0P A;  2LEA A;  2ZJQ Q;  4KHM A;  5DG8 A;  3NS5 A;  3M6X A;  3H5S A;  1B0T A;  1C0U B;  4LRC A;  9RUB A;  4QR0 A;  3QO9 A;  3LPY A;  5HAT A;  5AE3 A;  4UOH A;  1L3V A;  1ZH5 A;  1HD1 A;  3FRZ A;  1HNV A;  2QYG A;  3PO5 A;  1S49 A;  5B09 A;  4C8Y A;  1U24 A;  1V3R A;  5E3C A;  1RXO B;  4WIQ A;  3ITH B;  3UR0 A;  1Y7P A;  4CH0 S;  4DN0 A;  7FDR A;  4IR1 A;  2DK2 A;  2M8H A;  2B9W A;  5J2N B;  3VAI A;  2XS5 A;  3LOU A;  1XBW A;  3K58 A;  2WVC A;  3EGN A;  2QMX A;  3S6E A;  3HUL A;  3JQM A;  4WU2 A;  3UDC A;  3VGS A;  5AXL A;  2ZBC A;  2EG1 A;  4J9R A;  5HN0 A;  2DIU A;  3UD3 P;  4ILR A;  2HRU A;  3PRD A;  3PAC A;  2DPJ A;  4JI1 J;  5KG1 A;  5J2M A;  3NBP B;  5F8M A;  4TU8 A;  3V6H A;  4ZVO B;  4UZB A;  2ZDO A;  1R89 A;  1TL5 A;  1F3V A;  2C2Z B;  2FTR A;  1TMJ A;  2IDE A;  2CNO B;  5I3U A;  1SKW A;  4OHX A;  5KFD A;  2E1P A;  4JI7 F;  4RNN A;  1AZS B;  4H4K A;  2R7V A;  3KNG A;  4H4O B;  2CJA A;  2OLW A;  1L3S A;  4P10 A;  1RJJ A;  4OI4 A;  2NXE A;  5HMY A;  3N4W A;  3NCQ A;  2C1E B;  1TZ0 A;  4YFU A;  1Q95 G;  3E8O A;  4MK9 A;  3OBI A;  2AGP A;  4LRE A;  1HNI B;  3NMR A;  1N54 B;  4LF1 A;  1NPK A;  3KDO A;  2F9J A;  4UOF A;  2KT5 A;  3OL7 A;  4N41 A;  1SL2 A;  3DYA B;  1CLF A;  4PWU A;  2DXE A;  2HND A;  4OZJ A;  1HPZ A;  1AW0 A;  5J1E A;  1EJ7 L;  2DHH A;  2NPI A;  4MH8 A;  2E1M C;  1T3N A;  3KG1 A;  1YKW A;  5BR8 J;  4Y2C A;  4YB1 P;  3MR2 A;  1ZBT A;  2VPX B;  4IH6 A;  4LR9 A;  5KT3 A;  5I4M A;  4LVO P;  2IVM A;  1CSJ A;  2XCP A;  2Z2Y B;  1KQK A;  2WAQ D;  2QN6 B;  2BE9 B;  1RT7 B;  1WC5 A;  2AYE A;  3VZH A;  2V63 A;  4PCQ A;  3NGU A;  2GVD A;  4USU A;  2ZKT A;  2RJZ A;  5KG3 A;  4I7F A;  1YRT A;  3HHN B;  1QVG R;  5CYQ A;  4LIR A;  3KLG A;  2OHD A;  1N56 A;  4EK2 A;  4IH7 A;  4QOT A;  2WVF A;  5KFI A;  2CVE A;  1RZM A;  4YR2 A;  3JQK A;  3LP1 A;  4NEZ A;  4UUW A;  5KT5 A;  2V2Z A;  1MWY A;  4WZQ A;  3J81 j;  1URR A;  3EM1 A;  3KK1 B;  1E6Y B;  2RDJ A;  4LJM A;  3SQG A;  1OSD A;  1TK8 A;  2UVR A;  4NZ6 A;  3VAF A;  3CD6 S;  3DLG A;  2CZ4 A;  3G6X A;  1RLD A;  2MTL A;  4QPX A;  4DU7 A;  3WIU A;  3Q22 A;  3FKB A;  1M0S A;  3H2V E;  3AJ2 A;  1F5C A;  2Z2L A;  2IRU A;  1GX6 A;  3D0H E;  2VBZ A;  1VGY A;  2QJ3 A;  4I4B A;  2J6T A;  2A0F B;  1NSK L;  2CPX A;  4IKA A;  2Y1R I;  2W2M P;  5F3Z A;  1SIZ A;  5KT2 A;  4J9S A;  3K5M A;  1VQ5 S;  5HBM B;  1BD6 A;  2ZH8 A;  2HHQ A;  1N5Q A;  2QLX A;  1H7W A;  3CF5 Q;  2RNE A;  2KO1 A;  3VAK A;  1VS3 A;  3SFG A;  1RAJ A;  3OVS A;  2J7K A;  3TJ8 A;  2HVE A;  5KFH A;  2KRB A;  2XZD B;  1C0U A;  1IKW B;  4DI6 A;  2J0W A;  1VIX A;  5K14 B;  3F56 A;  1H38 A;  3EJM A;  3QLH B;  2R7X A;  1URN A;  1PG5 B;  3MFI A;  1T8E A;  1GFW B;  4IYQ A;  2G13 A;  4P2X A;  3R2C J;  1WOO A;  3SQO P;  3BEG B;  4JI2 J;  2DNP A;  2V34 A;  3KYL A;  1C2P A;  1FRJ A;  3ITH A;  3R5J B;  4DV0 J;  2ZE2 B;  2MKI A;  3NNA A;  5EGY A;  3FZB A;  1IVZ A;  1PGZ A;  4DUZ J;  3UD4 P;  5J2N A;  1YHQ S;  1YIT S;  3HT0 A;  5GAE I;  4DPT A;  4FNI A;  2C3O A;  3FGV A;  2ABY A;  1RK8 A;  4FF3 A;  4ELV A;  4RW4 B;  2F7V A;  1VQ7 S;  3NY0 A;  2B8Q A;  3UCZ P;  4JB8 B;  1UFK A;  1UEV A;  1WC3 A;  1R31 A;  2CQG A;  1BE4 A;  2GO9 A;  1Q8L A;  1RT3 B;  3TAP A;  1ULR A;  3K2Y A;  2J8S A;  4A48 A;  4EYH B;  2HBR B;  2CQB A;  4PYA A;  2X7I A;  2GW8 A;  3TAR A;  2F4F A;  1AZS A;  4H4O A;  4ZLL A;  3A13 A;  4TN2 A;  1HBM B;  4X4R A;  3VV2 B;  2CKW A;  4CT9 A;  1SJR A;  5ETR A;  1NCL A;  2BZ2 A;  1IQZ A;  3R5C A;  2JC1 A;  4ZCI A;  2HHU A;  5F8J A;  1DQ8 A;  1S0O A;  3MI7 X;  2FHO B;  1NDL A;  1QUP A;  1RWV B;  1HNI A;  2V8G A;  3G82 B;  2KZM A;  2R2R A;  4DR5 F;  5KFO A;  4LSL B;  3HHL A;  4MYU A;  4IRD A;  2UXC F;  1AYE A;  1ZTT A;  4DR7 F;  4KB7 A;  2MZJ A;  3P96 A;  5LSR A;  2MZ1 A;  3RBZ A;  1K0T A;  3QZ8 A;  3DYA A;  4F2R A;  4K5R A;  1X4C A;  3KK3 B;  4DL7 A;  1UVM A;  2GJF A;  1S1X B;  1UCN A;  4PG7 A;  1U1O A;  1TUG B;  4V19 J;  5GAH I;  4I6Y A;  3SZ2 A;  4ZLN A;  1UPM B;  4Q45 A;  4NLU A;  4QW9 A;  1J5O B;  2Z30 B;  5EX3 A;  1RWU A;  2R3V A;  1R3N A;  3CCM S;  1S99 A;  1E6V B;  3PYG A;  1X9M A;  1UZD A;  2HGM A;  4CO3 A;  2GMH A;  1RT7 A;  4LSN B;  4CLW A;  3I9Z A;  3DRR B;  2RHQ B;  3U7J A;  2KRR A;  4RNH A;  5KFN A;  3OUY B;  3IWL A;  1FXR A;  1NSA A;  2YPY A;  2PMH A;  2CJK A;  3VAL A;  2FZK B;  4KHP J;  4JI0 F;  2LVW A;  4F25 A;  2QX0 A;  3FQL A;  5ADZ A;  1NJZ A;  3FEZ A;  3DRY A;  4DSF A;  3ENQ A;  1HLW A;  2KL8 A;  4NXN J;  2MZR A;  3N6M A;  2M0G B;  2WSF C;  2FY8 A;  1WDD A;  3LUY A;  1E6Y A;  3KK1 A;  3MEE B;  3KHG A;  4PWD B;  4Y28 C;  3ZZP A;  4RBV A;  3DRX A;  4ED0 A;  2JWN A;  1TKT B;  1AT1 B;  2ZOM A;  1RE1 B;  4WP3 A;  1BLU A;  2YWE A;  5D3G B;  2CQI A;  2LDI A;  3M2R B;  2RF2 B;  3HPO A;  1RAE B;  3PO4 A;  1QD1 A;  3RRG A;  1K8A T;  4X65 F;  3HO1 A;  2DO0 A;  3J80 Y;  3FEX B;  4RNF A;  3VQS A;  2M7S A;  1NME B;  1UW9 A;  5HBM A;  1N5V A;  1KHV A;  1QE1 B;  2AT1 B;  3H5Y A;  4FZV A;  3PIO Q;  5JVH Q;  5GMK a;  2CDR B;  3NGT A;  3L09 A;  3G8T A;  1F1B B;  5F8L A;  4DPU A;  2KFZ A;  4NMX A;  4F36 A;  3D2W A;  1IR2 A;  1RAA B;  2AJF E;  3TZX A;  1JKH B;  1OPI A;  2MKH A;  1EHW A;  3TUZ C;  2ACM A;  1S12 A;  1IKW A;  1WOP A;  4FYY B;  2FLL A;  2G1D A;  2WSC C;  4C3K A;  1FHT A;  3S8S A;  1D9D A;  1RU2 A;  5K14 A;  3QLH A;  3PCO B;  2W2N P;  4P7V A;  1TP7 A;  4B3T J;  2H4Y B;  3W5X A;  2J9E A;  3W60 A;  3US5 A;  2X51 A;  2ZOF A;  4NCB A;  3UPF A;  1G2E A;  4OX7 A;  1JK9 B;  2ZE2 A;  4NLT A;  2R7Q A;  3BKF A;  3R5B A;  1U02 A;  1TMM A;  4OMF G;  2JLF A;  2V94 A;  1L3T A;  3GP9 A;  3M9M B;  1YX2 A;  4A46 A;  3CTR A;  3MPW A;  1JIH A;  4GKK J;  4RW4 A;  3BR9 A;  4FYD A;  3BSO A;  2DH7 A;  1IR0 A;  2AKW B;  3UO0 A;  1U1M A;  4JI4 F;  3AY0 A;  4ECT A;  1XNQ J;  1RT3 A;  1C1B B;  4ZPV R;  2JRS A;  2WBM A;  4HHJ A;  1YWX A;  3RBE A;  2HVH A;  3OXF A;  3L7U A;  2W4D A;  2EBE A;  4P74 A;  1I6J A;  5LMU F;  1F5B A;  1KVK A;  3OR1 B;  4P7T A;  3VQT A;  1IBC B;  2R9L A;  4F02 A;  2E7X A;  1U1N A;  2NXN A;  5IV3 A;  3ZTO A;  1HBM A;  3HKZ D;  2DCL A;  2CPD A;  2C2K B;  4UTG A;  2F8E X;  5KT6 A;  2V2K A;  2MDA A;  1JJC B;  4LT6 A;  3GJR B;  2DIT A;  1YQH A;  3KG0 A;  3G82 A;  5KFS A;  4LSL A;  4UST A;  1QSY A;  4FNH A;  2XNR A;  3L9Z A;  1NPP A;  3ELH A;  4S0M A;  3DM2 B;  1WAC A;  5LSL A;  3CO9 A;  3EVM A;  2HS3 A;  3BYR A;  1TL4 A;  3KK3 A;  1S1X A;  3CCV S;  4OLP A;  4ZVG A;  2FJB B;  3NCP A;  3KHH A;  3L3C A;  2ZM6 J;  3POT B;  4DQS A;  4DX7 A;  1U45 A;  5EUH A;  4B3M F;  1K1S A;  3TA2 A;  4DWI A;  3IXQ A;  1LWX A;  4ID5 A;  3PKM A;  2FJA B;  2E5L J;  2L9N A;  1J5O A;  1FWP A;  1H2U X;  3K89 A;  5HI7 A;  2HLT A;  2RS2 A;  4TYA A;  4F4Y A;  4ZPW R;  1Q0N A;  3OFH A;  2WB4 A;  1YZ7 A;  1SI9 A;  3K17 A;  1E6V A;  4PXC A;  3CCR S;  1JJH A;  4I56 A;  4LSN A;  1K9M T;  4K4S A;  3DRR A;  1L3K A;  2VC0 A;  1UVI A;  3EZU A;  3OUY A;  2GMJ A;  1RWO B;  2V9K A;  1GMV A;  2JX2 A;  4F26 A;  1U1P A;  1R27 B;  5KFK A;  1RBL A;  2CWK A;  4JBC A;  3NL0 A;  3HI9 A;  1FK9 B;  2YNF B;  1NDC A;  2VOD A;  3RUB L;  3SYZ A;  4YS2 A;  1Y11 A;  3LH2 S;  4TVA B;  2RS8 A;  2WVE A;  3JSR A;  3T41 A;  4DPW A;  3MFH A;  4ED7 A;  4ZPC A;  2AHO B;  3HSZ A;  2VZ9 A;  3I87 A;  2DD8 S;  3AAW B;  3MEE A;  4PWD A;  4AXI A;  4NAS A;  2I8E A;  1VMB A;  2DBB A;  2XY5 A;  2VD3 A;  1TKT A;  4C6A A;  4O23 A;  4UQG A;  3KOA A;  2YTC A;  1DZ5 A;  5D3G A;  1F9E B;  1JLQ B;  1LNQ A;  5KFY A;  3UN5 A;  5CD4 A;  3RB0 A;  3M2R A;  2RF2 A;  1G3O A;  1NPR A;  2VUG A;  5BYS A;  1QLN A;  3BBC A;  5L38 A;  4BC9 A;  3IR6 B;  3QWU A;  2MSS A;  1TQL A;  1SJF A;  4DV6 F;  1B7Y B;  2XQC A;  1QE1 A;  2XYP B;  4NYZ A;  4LR8 A;  3KFW X;  2VBX A;  3PEJ A;  2J76 E;  4LR7 A;  4E8U A;  2IJF A;  2W01 A;  1S59 A;  3Q8R B;  1RHQ B;  1N34 F;  1U25 A;  1LKZ A;  1JKH A;  4DV4 J;  1U47 A;  4DMZ A;  2JFD A;  4PKD B;  2G2Z A;  2J0S D;  3LPE A;  3A12 A;  3TVZ A;  3AD8 C;  2DNQ A;  1BQM B;  5J1N A;  3KMS A;  3MCS A;  2V5H G;  1XER A;  2ZWO A;  1R6V A;  4OQJ A;  1SPB P;  3TOQ A;  5E41 A;  2CQ2 A;  2OPR B;  1M5O C;  1SJ1 A;  4G65 A;  1FJ7 A;  1RYS A;  4YR0 A;  2CJQ A;  1R0B G;  1UMJ A;  4ZVT B;  2A2D A;  5BXI A;  3DXS X;  2LKZ A;  4X62 J;  2DNZ A;  3H20 A;  2ZHO A;  3TUP A;  2FDN A;  1OS5 A;  2MKC A;  1CVJ A;  2HKE A;  3TJ9 A;  2Z8Q A;  3RBX A;  3HHE A;  1GXT A;  2WSE C;  5I42 B;  4U7U K;  2H1Y A;  4Q44 A;  4LF7 F;  3U1M A;  4OFZ A;  1FXD A;  4NRU A;  4D3G A;  3UDE A;  4A8M P;  1RWX B;  4YHH F;  3SCL E;  4F2S A;  4DQR A;  4UQT A;  3NLC A;  4RNM A;  1C1B A;  1FEH A;  1DUR A;  3I5C A;  2FJD B;  2V8H A;  2ZVI A;  3OLA A;  2YH0 A;  4JV0 A;  2ZBP A;  5D0G A;  3BBB A;  2P9G A;  2LQJ A;  4NLS A;  3OR1 A;  1HWU A;  3DCA A;  4BCA A;  1RAI B;  3P5B P;  1JXV A;  4FS1 A;  5G0R B;  2GQQ A;  4YB5 A;  3E2E A;  2NR0 A;  4AQY J;  3GR0 A;  3MUM P;  5J2Q B;  2WVB A;  1RT6 B;  3P49 B;  3PIP Q;  4J9U E;  1K73 T;  3R2D J;  3D1H A;  5HMW A;  1SC3 B;  2FJW A;  1WHX A;  3U27 A;  4IG3 B;  2D74 B;  2QSF A;  2OEK A;  3DM2 A;  5DET A;  2ZZN A;  1AA1 B;  5EN1 A;  2E44 A;  2QV6 A;  5IXU A;  4KHR A;  1TL3 B;  1GEH A;  2J8A A;  2J0Q D;  1O51 A;  1Y5L B;  4LFA J;  1PO6 A;  3POT A;  2VIC A;  5F9L A;  5A0Y B;  5KFA A;  3IS9 B;  3JAM U;  3CDB A;  2VJV A;  3D54 A;  3EPG A;  2MY8 A;  2VV5 A;  4DHV A;  2W2O P;  1PAE X;  2HFO A;  4JI8 F;  3Q83 A;  4P9S A;  4XK8 C;  4Y0F A;  3R7N B;  3PHE A;  2VA2 A;  3TQ1 A;  3ZTR A;  5H9F K;  3I55 S;  3HVW A;  1X4F A;  2IM3 A;  2D69 A;  4B17 A;  3QGH A;  4RW9 B;  4F3O A;  5H9E J;  4ZOS A;  2XO6 A;  4ZVS B;  1NHU A;  2ZUG A;  4C8K A;  3A4T A;  5GME A;  3FFI B;  5HRO B;  1FK9 A;  2YNF A;  4J9O A;  5D0H A;  2ZJR Q;  2FYX A;  5F8N A;  1F9H A;  2XMT A;  3BSC A;  4DPY A;  2H5I B;  4EO8 A;  4DFM A;  4EBC A;  1DQA A;  3ISZ A;  2VFR A;  2EPI A;  4LRF A;  3OQ2 A;  4X84 A;  1R0C B;  3AHP A;  1D3W A;  3HHK A;  1RI7 A;  1VRQ C;  2ZOG A;  2DRA A;  1JLQ A;  4DV2 F;  1RDR A;  4WBF A;  4IFY B;  5ETV A;  5C2C A;  2AEJ A;  1MW7 A;  5IOL A;  1SB6 A;  2J7W A;  4FXW A;  2HG4 A;  1HMV B;  4LF9 F;  3CIM A;  4QQB A;  4USM A;  3CDE A;  1T02 A;  2F4V J;  4ZIT A;  4MIA A;  5HMX A;  4CWB A;  4NLQ A;  1SH3 A;  2MZT A;  2YWF A;  2NQP A;  3PJ9 A;  2UUB J;  3G9C A;  3N0V A;  1BQM A;  1UFW A;  2IRY A;  2DGS A;  5DLF A;  3TO8 A;  1VQ4 S;  2BRK A;  4F04 B;  1MNE A;  2C3P A;  3CGI A;  1YJW S;  2AV5 A;  3M1V B;  2R7O A;  2JC0 A;  2YQ0 A;  2UXB F;  5KOW A;  5C42 B;  5L46 A;  3IBC B;  3KDN A;  2J9D E;  1ZAW A;  1F5A A;  3LP0 B;  2DVI A;  2OPR A;  1TTH B;  1FKP B;  1Q7Y T;  5KT7 A;  4DR2 F;  1GXU A;  2ZDP A;  2BW7 A;  2YWG A;  2UP1 A;  2VQE J;  1IBM F;  5KG2 A;  3DDI A;  4B3S F;  3HFZ B;  4USK A;  1UJ6 A;  4JV5 F;  4RUB A;  3GYN A;  5I42 A;  4URQ U;  4JV1 A;  1HHS A;  5L1L A;  2W9C B;  4BHQ A;  3H4D A;  2XY6 A;  3OV7 A;  2CJ9 A;  4UW2 A;  4QYZ J;  2OFH X;  3THT A;  3IWX A;  1MN7 A;  2EEY A;  2HZV A;  3LW5 C;  1NO8 A;  5A8K B;  1T9Y A;  3D3B J;  2KFY A;  1S7I A;  1FRM A;  2AYM A;  4OZ2 A;  1YBA A;  3I4H X;  4F4A A;  1LK7 A;  4H54 A;  2BXJ A;  1G6B A;  5KFE A;  4O0I A;  4L74 A;  3D4J A;  2RUG A;  3M32 B;  2AD9 A;  2DJW A;  4X64 F;  1VQ6 S;  1HNW J;  1P6T A;  5G0R A;  4ELT A;  2BA9 A;  2FJV A;  3VGU A;  2BE2 B;  4ED4 A;  3NS6 A;  5J2Q A;  1NK9 A;  1RT6 A;  3T6B A;  2YKN B;  2KVQ E;  4AE5 A;  2BM0 A;  1U26 A;  4GMK A;  3FUY A;  2H3E B;  4DL2 A;  2DHS A;  3J7Z T;  2SXL A;  1K44 A;  4DS4 A;  5DO2 A;  3DGP B;  4KKO B;  4IG3 A;  1YGY A;  4GC6 A;  2CQ1 A;  2DGW A;  2IY5 B;  1N52 B;  1TL3 A;  3SIP B;  4YB6 A;  5HAO A;  5B0G A;  2LQ9 A;  2D3Z A;  4QIF A;  4MT1 A;  1YIJ S;  1XNR J;  5M2R A;  3GE9 A;  2L41 A;  2OPP B;  3CJS A;  4O4G B;  1NK6 A;  2AJQ A;  3FDS A;  5A0Y A;  3IS9 A;  4UUX A;  4IR9 A;  3M8W A;  5A8W B;  1CQN A;  4NZ0 A;  3V6D B;  2L3M A;  4QIE A;  4B9T A;  4ZLP A;  2B7B B;  4ZCL A;  1N5Y B;  2QLB B;  3CCL S;  1FJE B;  3R8Y A;  2ERR A;  4ZCM A;  3QT6 A;  4U95 A;  1ZZF A;  3JB9 k;  1LXN A;  2E7W A;  2QSW A;  2AJ1 A;  4DS5 A;  4Q43 A;  3DN9 A;  3GON A;  4ZKA A;  4YME A;  3PJX A;  2GCF A;  4CYU B;  2QA4 S;  2BQR A;  2DYA A;  2W8L A;  1VQY A;  2XLJ A;  3RR7 A;  1RT2 A;  4RW9 A;  3BGL A;  4Z7C A;  3OW2 R;  4U7C A;  1TL1 B;  4G3I A;  1VK3 A;  3UI3 A;  3FFI A;  5HRO A;  2BJ1 A;  3PJW A;  1JLF B;  1UWA A;  4K4V A;  4DDF A;  4M95 A;  2GIF A;  4DU8 A;  3P45 B;  4FKY A;  2Z0G A;  1SH0 A;  3EWG A;  1VK8 A;  1VR6 A;  3FZ2 A;  2N7Y A;  4HDH A;  1RAC B;  4OYP A;  3AD7 C;  3GIK A;  3M05 A;  5KFL A;  1VQS A;  2DNY A;  2I5J B;  2LQB A;  3U1N A;  1NH7 A;  3MMB B;  1HNX J;  2EFQ A;  4NLR A;  4UOC A;  3QGP A;  4M1K A;  3HFV A;  1I5O B;  2FUG 9;  4IFY A;  3HD2 A;  4NOH A;  2KH9 A;  4B3O B;  1W2B R;  3ZTS A;  2IMW P;  2FVR A;  1NSP A;  2IVY A;  4JI5 F;  1S77 D;  2XYH B;  2B8P A;  2BKO A;  2N3L A;  1HMV A;  3W65 A;  4NYO A;  3OL6 A;  1N4L A;  3X3U A;  4HH1 A;  5GAE U;  1XR7 A;  2M5Y A;  1Q4R A;  1ZM3 A;  4A8F A;  2FC8 A;  3CB4 A;  1AUD A;  1IN0 A;  3K5O A;  2IIH A;  5KFB A;  3T1Y F;  2DR7 A;  2F40 A;  3FBE A;  3CIZ A;  1OQ3 A;  3M8Y A;  2LFV A;  3M1V A;  3WZ0 A;  1FNO A;  1YBT A;  2H9Z A;  2D3O 1;  5KG6 A;  4R0J A;  4OYI A;  4NLD A;  3QJL A;  3LA0 A;  4ITS A;  5C42 A;  4EFA C;  4FF2 A;  1ZA2 B;  2OMO A;  4EBE A;  3PYD A;  2YXL A;  3LP0 A;  3FSI A;  1PCA A;  4OJH A;  1FKP A;  4F8R A;  4OX9 F;  1HNZ J;  3RR8 A;  3KMQ A;  3IWN C;  2DHX A;  4Y00 A;  4ED5 A;  4USW A;  4X4N A;  1JWW A;  2XLK A;  2IHR 1;  4B9N A;  1QTN B;  3NAI A;  1ZET A;  2DR9 A;  3QGG A;  3PR4 A;  3TZW A;  3ZXW A;  3TJA A;  1N32 F;  2BUN A;  1UWB B;  2CDQ A;  2W9C A;  1KTQ A;  1M5S A;  3OSN A;  5AXM A;  3O5T B;  3W66 A;  1SQG A;  5D0R A;  4LQ9 A;  4NE9 C;  2ATL A;  1HR0 J;  1PC5 A;  4F4W A;  5A8K A;  2CIM A;  2RML A;  1WEX A;  3BH7 B;  2CFX A;  3DLH A;  3HJF A;  3ZZZ A;  4MAK A;  2B9X A;  3QYY A;  4OYW A;  3WX8 A;  1T0T V;  5GAH U;  4K2X A;  1HBO B;  3Q8Y A;  4NI2 B;  2U2F A;  3M4X A;  3OJU A;  2DGT A;  3M32 A;  4QR2 A;  2KB2 A;  3DU5 A;  2AEM A;  2L9W A;  3PG9 A;  3HHD A;  2BE2 A;  4UY8 5;  1YDL A;  2BAC A;  1WC6 A;  1FRX A;  1NSQ A;  2YKN A;  4OZ0 A;  2HVZ A;  2OUG A;  1Y00 A;  2NXJ A;  1HI8 A;  3KXD A;  3EGW B;  4WU3 A;  1S9E B;  4J7C A;  3DGP A;  4KKO A;  4KGV B;  2XMA A;  1VQ8 S;  3GWC A;  3GMG A;  2UVV A;  4DBQ A;  4PG5 A;  3EVO A;  4QWD A;  1U8S A;  3MR3 A;  2OPP A;  4O4G A;  3R6G B;  3H4B A;  5A8W A;  1S1W B;  3GYG A;  4WP8 A;  5SZT A;  1D0E A;  3HDS A;  3RBD A;  1OJ4 A;  2FC9 A;  1WWH A;  3V6D A;  1N0V C;  1N5Y A;  4KAI A;  2NUH A;  2Y3Y A;  5DQG A;  2MKY A;  3TZY A;  2OEM A;  4JYA F;  4GVL A;  4K7Q A;  2MY7 A;  4HAC B;  4NLX A;  3MUV P;  4YY3 J;  4CYU A;  3ZTP A;  2ZH4 A;  2VL1 A;  4DQI A;  4ZHR B;  2HNZ B;  2BQ3 A;  5DDP C;  2ZFH A;  1KDN A;  3N28 A;  1KP6 A;  2KU7 A;  3ZZR A;  1TL1 A;  1H6K X;  3VF0 B;  5IFM A;  2EI5 A;  1K0V A;  2UU9 J;  2IPO B;  4OHZ A;  5CH7 B;  1JLF A;  3IGV A;  7AT1 B;  1OO0 B;  1Z2Z A;  1NND A;  5B08 A;  2GC8 A;  3IGN A;  3CSK A;  4J9K A;  2R7S A;  2D7S A;  2Y8W A;  2J5A A;  2E5I A;  5K8M A;  3BF4 A;  1N5T A;  2JH3 A;  3EDR B;  3MMB A;  4ES3 A;  3ZZO A;  4QPT A;  3IFE A;  3WC2 A;  1NM2 A;  5KAK A;  3JTO A;  2W4P A;  4FVM A;  3A3O B;  2Y8Y A;  1UEK A;  4FPI A;  2YWW A;  1S0V A;  1KS2 A;  2V4J B;  2E5J A;  3MEK A;  2Y1J A;  4B3O A;  1JB0 C;  4DV3 J;  2AJ2 A;  4ZP9 A;  1IBL J;  2CQ3 A;  5IM0 B;  5DM6 Q;  3L95 X;  3DKD A;  4ED6 A;  1HI1 A;  5B0D A;  2GJI A;  2OO4 A;  4E2F B;  4RNO A;  1RKI A;  1HW8 A;  5IZH A;  1T9T A;  1S6O A;  1NZA A;  2XMV A;  4ZP6 A;  2VPY B;  4PYD A;  5IT9 U;  4C4W A;  1FD8 A;  2PMW A;  2RD5 C;  1YBU A;  2ASY A;  2YKO A;  2MZQ A;  3AQP A;  2IYI A;  2ZUA A;  4K50 A;  3K8V A;  2IJR A;  1RHM B;  4M5I A;  3FCH A;  4CM0 A;  4N8O A;  2PI5 A;  1RWP B;  1KRP A;  1SJ3 P;  2IMO A;  1X9W A;  4A47 A;  1WTF A;  2DY1 A;  1ACM B;  1HFE L;  1X5O A;  1ZM2 A;  3KWM A;  1TEL A;  1RIS A;  3K57 A;  1FKO B;  3GYX B;  2NPF A;  2UUA J;  1Q8B A;  1WDT A;  3MPD A;  1BHN A;  3ADA C;  4GO5 X;  2O3D A;  1UWB A;  4PPD A;  1S7H A;  3W62 A;  5DZ6 A;  4CT8 A;  1X9S A;  2AEF A;  5FLX U;  4LFB F;  1WHY A;  2BKP A;  1JJ4 A;  2KTQ A;  1FDD A;  4J9P A;  3EVW A;  3UNG C;  1SCJ B;  1GMW D;  3B8H A;  4NA3 A;  1EQ0 A;  3GFX A;  2OPQ B;  1HBO A;  2Q1L A;  1JLB B;  4NI2 A;  3IP0 A;  3CJ8 A;  4A8X A;  1FI4 A;  2KM8 C;  4DL0 C;  4DJB A;  3K0J A;  5CQG A;  5LT5 A;  2O67 A;  2GIR A;  2Z2M A;  3IMQ J;  4LBH A;  3UDL A;  4DUY F;  1FX4 A;  1PAU B;  4NZ7 A;  2LEB A;  4OYO A;  1S9E A;  1MU2 B;  1QTM A;  5L8R C;  4DR6 F;  3FBC A;  4RUC A;  4LQ3 A;  3MMJ A;  4TKT A;  4KQZ A;  2LU2 A;  4L72 B;  3UDV A;  3G96 A;  3WX4 A;  4DV5 F;  3MTK A;  1C0T B;  2Z56 B;  4MJK A;  1U6Z A;  3MAH A;  5EX0 A;  3EGZ A;  5K5M A;  2FD2 A;  2EK6 A;  4YDX A;  9ATC B;  1LK5 A;  4HAC A;  2A10 A;  4NLP A;  4DCP B;  1VIO A;  1R8P A;  4ZHR A;  3QFH A;  2HNZ A;  3DRS B;  4P72 A;  3MEC B;  3E3X A;  1H98 A;  3HSG A;  1HNV B;  1UTA A;  3DNC A;  1RWK B;  1HBU B;  1S9F A;  3M2U B;  4MIW A;  1XIQ A;  4PAB A;  5F0U A;  3GG0 A;  3T19 A;  3B82 A;  1YG0 A;  3PZP A;  2CA9 A;  1FJG F;  2HVI A;  4KRW A;  4JI7 J;  4DFJ A;  1HWL A;  1DAX A;  2OEJ A;  3P6Y C;  3NNH A;  3BN4 A;  1TK5 A;  3W64 A;  1HW9 A;  1WSV A;  4PG6 A;  3SSQ A;  2LEP A;  3UN2 A;  4P2S A;  2DHG A;  4RBU A;  3MOZ A;  4DX6 A;  1OIA A;  3ICL A;  4KPC A;  8RUC A;  1Q79 A;  1T94 A;  4IQM A;  4PG4 A;  4FKX A;  3VAH A;  4ZPD A;  1U1L A;  4DLG A;  3HD1 A;  1IWG A;  1LWF A;  1ZYQ A;  3M7V A;  2HHT A;  2QYC A;  1JNR B;  1ZS6 A;  2V4J A;  2VOO A;  1OQ6 A;  3MCO A;  5ETK A;  3D68 A;  4YEA A;  5C24 B;  2WCX A;  4M5G A;  3TAQ A;  5IQQ A;  3RTV A;  4PQU B;  2FZG B;  5IM0 A;  2GZO A;  3WHI A;  2OTL S;  3R5D A;  2ZC4 A;  5D6G A;  3TUI C;  1NLK L;  4OV1 A;  2UXD F;  3WQP A;  2XTJ P;  2XSJ B;  2VF3 A;  4K5S A;  2XUL A;  1RBO B;  1IKX B;  5CYJ A;  2V2Q A;  1T9X A;  2G1H A;  2PD1 A;  1NHK L;  2QLF B;  3JXO A;  5CHC B;  3EIC A;  4RPF A;  1X60 A;  4IOA Q;  2V8V A;  4IOC Q;  1G4C A;  1P8G A;  5D4O A;  4FP9 A;  3MMC A;  1LWE B;  5THW A;  3KLE B;  4KJI A;  3PFO A;  4ZK7 M;  1CC7 A;  2OJ3 A;  4DX5 A;  3K7R A;  1MRO B;  1APS A;  1XWL A;  4IH5 A;  1SV5 A;  4NRT A;  1VJQ A;  3OTO F;  3AOB A;  4OHV A;  5AJ3 F;  4J37 A;  1T3O A;  4E98 A;  2DGV A;  1EAR A;  4X2B A;  1J2V A;  1XN9 A;  3BGR B;  2QL9 B;  1VHF A;  4KV8 B;  1HQ2 A;  1FKO A;  2ROG A;  3PEH A;  5HVG A;  2AGQ A;  4G1Q B;  4B3R F;  1P27 B;  4IUF A;  2ZVS A;  3BS9 A;  2RHS B;  1FES A;  2J0X A;  2MHN A;  4WJB A;  3T1H F;  1CJT B;  1HWK A;  2Z57 B;  2C2M B;  3OL8 A;  3W2V B;  1S4F A;  1WI6 A;  2J6S A;  3GJT B;  4JUZ A;  3CT9 A;  2R2S A;  1VC0 A;  4V19 X;  1Y5I B;  2U1A A;  2OPQ A;  3TEG A;  1U1R A;  1JLB A;  2HK3 A;  1V5I B;  4CZC A;  2RKI B;  3JAM Y;  1ROF A;  4WK1 A;  2JLE A;  2RRB A;  1QAJ A;  2MGZ B;  2BX6 A;  1EKS A;  1C4C A;  2GML A;  1PC4 A;  4CCH A;  2GHW A;  3DI6 B;  3TUJ C;  2BR0 A;  1WJ9 A;  2VQF F;  1RHJ B;  1GMU A;  1MU2 A;  1PSD A;  3FCW A;  2V69 A;  4F4Z A;  1PJ5 A;  4FVC A;  3N79 A;  2LQ8 A;  2XMU A;  2NYI A;  3EGV A;  3AD9 C;  3N5B A;  2CZ9 A;  1IQT A;  3JSY A;  1KVI A;  1HQU B;  1F2G A;  3I5A A;  2J7U A;  2F1F A;  4U8Y A;  2AX1 A;  3MCN A;  2GNK A;  3TVY A;  2KKH A;  1C0T A;  3GTY X;  4TQR A;  2NXC A;  4F4K A;  2B56 A;  1CJV B;  2N3O A;  4NCG B;  3PR5 B;  4Q5V A;  2N7C A;  2E7V A;  2IVF B;  4N56 A;  1KN6 A;  3BSA A;  3OVA A;  2X3G A;  2AF6 A;  2GX8 A;  4H4M B;  2A1B A;  1KVJ A;  5KFV A;  1KFS A;  1Y5N B;  4K2J A;  2NSB A;  1Q78 A;  3T5J A;  1V3S A;  3DRS A;  3IRW P;  2GAH C;  3ZFV A;  2HK2 A;  3MEC A;  3KHL A;  1U0S A;  3E01 B;  1UA0 A;  1NRK A;  2EWH A;  5JJB A;  1WOR A;  1LWC B;  3GJQ B;  4M5K A;  3CDA A;  1U4B A;  1HBU A;  3M2U A;  1I94 F;  5A8R B;  1W25 A;  2ZH7 A;  2Q79 A;  2HFN A;  2E9R X;  1X4B A;  3H2L A;  3D67 A;  2C2O B;  1FRI A;  3OR2 B;  2NUU G;  4TLQ A;  4M5J A;  3J81 U;  1EZZ B;  4WKY A;  1Q53 A;  4L6V 3;  2L48 A;  2GO8 A;  1RT4 B;  1YJN S;  1W2I A;  1KQF B;  3TA1 A;  4ED8 A;  3CW2 C;  2K7J A;  3H8Y A;  1CQM A;  4JV2 A;  1FJC A;  4QWE A;  4A8W A;  2BBE A;  4DR5 J;  2UXC J;  2HW3 A;  4DR7 J;  4LIW A;  4WFB Q;  4M5M A;  3RRH A;  2W24 A;  2RE1 A;  3T3F A;  5LL6 d;  3QID A;  1M5V C;  1X4G A;  1XQI A;  5C24 A;  4AND A;  1NH8 A;  3W1Y C;  1WI8 A;  4PQU A;  3LAN A;  1SKU B;  5F8G A;  4BWJ A;  1P1T A;  4MKY A;  3VAJ A;  3MPY A;  2XLI A;  1VYA A;  1DHM A;  2XSJ A;  2VDI A;  4KH1 B;  4X66 F;  4CI0 B;  1OPZ A;  2B6A B;  4DSI A;  1U1K A;  1IKX A;  1PBU A;  4USH A;  1NEE A;  2NS1 B;  2CPH A;  2VKZ G;  2H65 B;  1RU1 A;  1TL7 B;  4OLO A;  2HQC A;  1GK8 A;  1UJ4 A;  3HHL B;  2IBK A;  3N6L A;  1WSR A;  4U6P A;  3NG8 A;  2XMM A;  1LWE A;  4ENO A;  2M2B A;  3KLE A;  3W9H A;  2DH8 A;  3SDE B;  2BAN B;  5FII A;  1QM9 A;  4QWB A;  4RKU C;  3WBZ A;  3H98 A;  4JI0 J;  1MRO A;  2XHW A;  1XEZ A;  5KFT A;  1H72 C;  4K4X A;  3SCK E;  1N33 F;  4GKJ F;  2W7O A;  2IC3 B;  3A8E A;  4K0K F;  3IO1 A;  3BM7 A;  3BGR A;  4KV8 A;  5RUB A;  3ZO7 A;  1RTZ A;  4G1Q A;  1KQS R;  2PT0 A;  2HBZ B;  2J6U A;  4LF5 F;  1REG X;  2P9E A;  4NWB A;  4C0H A;  4RU2 A;  4HL9 A;  4O3N A;  3UD5 A;  1CJT A;  1NJX A;  2AJ4 A;  5AXN A;  2YX7 A;  3TP2 A;  4KE5 A;  4BBY A;  2C42 A;  3WC0 A;  3W2V A;  3B4M A;  5EDW A;  4P75 A;  2EKN A;  3FSX A;  3MR6 A;  4HTI A;  3PFE A;  2A18 A;  2D3U A;  1FFW B;  4PXD A;  2BV3 A;  3I9V 9;  5L1J A;  1RGV A;  4X65 J;  1U1Q A;  1EP4 B;  1FTC A;  2H4W B;  2CPZ A;  4F0K A;  4CH1 A;  2HGL A;  4QU7 A;  2RKI A;  4O3S A;  1XMB A;  1D1U A;  1X7V A;  2KDO A;  1RCO B;  2EC2 A;  1FKA F;  1X8D A;  1A9N B;  2QGF B;  3QMQ A;  4PAA A;  2W7A A;  3G2X A;  2KXF A;  5GAD I;  2MGZ A;  1X5S A;  1M5H A;  2EK1 A;  2BQU A;  4QW8 A;  3DI6 A;  5CXT A;  1CG2 A;  2R7W A;  4OYZ A;  3O3L A;  1YJV A;  4YDD B;  4OI6 A;  3BQ0 A;  3TW0 A;  4ES2 A;  4YB7 A;  1D9F A;  3GIL A;  3MCM A;  4OX6 A;  1X31 C;  4XAK A;  3MR5 A;  2WK4 A;  1HQU A;  3M8R A;  3Q2S C;  4Y2K A;  2QE5 A;  3G8Q A;  4RO0 A;  3K8W A;  2KM8 B;  2RSQ A;  2H51 B;  1NK4 A;  3MDF A;  2NSC A;  1KHW A;  2NLW A;  2C3Y A;  1RP5 A;  4U9R A;  1MN9 A;  3Q24 A;  1CJV A;  4NCG A;  3VAM A;  3ILI A;  1LQ9 A;  4MIB A;  2CG4 A;  4X4U A;  1T11 A;  4OIX A;  2JNJ A;  3MHY A;  4H4M A;  2QMW A;  1ZPV A;  2DNN A;  1VCT A;  2E5H A;  1BWV A;  3MM5 B;  2NYH A;  3CPW R;  1VBK A;  3K59 A;  4LFC F;  2GQ2 A;  2BKN A;  1SBR A;  4C8N A;  3R7S B;  3E01 A;  4JI4 J;  4HHH A;  1WEY A;  2RAQ A;  1UPP A;  1LWC A;  4ZVU B;  3SV4 A;  4NXM F;  2ASJ A;  3KUH A;  2OSQ A;  3HMJ G;  1X4H A;  1HA1 A;  3QRP A;  5A8R A;  4KGK A;  1SL1 A;  2BEF A;  4O4R A;  4ALZ A;  3VHQ A;  4RX6 A;  5LMU J;  3OR2 A;  4CLZ A;  5EWF A;  2IRX A;  2ZH9 A;  3GFY A;  3HP6 A;  1OYD A;  2M4M A;  4ZIW A;  3C2P A;  1RT4 A;  5K9F A;  3BZQ A;  5L39 A;  2MQL A;  1S76 D;  5FD1 A;  4ZVH A;  4J9L A;  2R2T A;  3DLK B;  2ALY B;  2YKM B;  1AXQ A;  5CZV A;  1B4S A;  2BE7 D;  1J5E F;  4DZ6 A;  1Q8K A;  2G2O A;  4HDG A;  5CA5 A;  3H42 A;  1IM4 A;  4AL7 A;  1MML A;  2DXF A;  2MLY A;  4FYV B;  4QIW D;  2OGU A;  2XMK A;  3GCX P;  2Q66 A;  5A76 A;  5HLF B;  2HFV A;  4B3M J;  1DBD A;  2X1F A;  4PR6 A;  2B6A A;  1UEU A;  2WW8 A;  1XMO F;  5I3P A;  3V2U C;  5IQ6 A;  4LSZ B;  1HAR A;  3DLE B;  5A2Q U;  2W1B A;  3HSJ A;  1TL7 A;  4C11 B;  3D1O A;  1H3D A;  5H9E K;  4M5L A;  4WE1 B;  2AJ0 A;  1X5T A;  5M2P A;  4XDD A;  2ZH1 A;  5KG4 A;  3CD5 A;  4C98 A;  4CLU A;  3M6W A;  3FRY A;  4I2Q B;  4HVZ A;  2Y1L B;  5ETQ A;  4NLW A;  1OYE A;  1WF1 A;  2CRL A;  3SDE A;  2BAN A;  4CRJ A;  2WVD A;  2R8I A;  2IC3 A;  2AP6 A;  4M94 A;  2A3J A;  3HZG A;  4ID5 B;  4IRK A;  3QT5 A;  2HIY A;  5ETS A;  4FF1 A;  1YJT A;  1FNM A;  5LSO A;  2H54 B;  3W8G A;  1T9U A;  1H73 A;  1H74 A;  1KWM A;  3CCZ A;  4AYB D;  2JEI A;  2JDJ A;  3GV5 B;  5E0O A;  3RW7 A;  3V5R A;  3CME S;  1KOO A;  1N36 F;  4R25 A;  2GFF A;  4IG0 B;  2XG8 A;  2KFN A;  1RB0 A;  2KVI A;  3CCJ S;  2XGP A;  4D3H A;  4C2M A;  3AA8 A;  4DR4 F;  3VGT A;  4HTJ A;  4FDF A;  2KT3 A;  1IBK J;  2EW9 A;  4DSE A;  1EP4 A;  1WHV A;  1WEL A;  4C0B A;  5IT4 A;  4JI3 F;  4DV6 J;  4ECV A;  1QSS A;  2JSX A;  2QT7 A;  2DNK A;  1T03 B;  2R7R A;  2HS4 A;  3CDW A;  2XI2 A;  2B5J B;  2FHJ A;  3KLI B;  5T7L B;  2M88 A;  4RU9 A;  5T41 A;  2D1C A;  1N34 J;  5ETN A;  3MAA B;  1TAQ A;  3FMW A;  2VDH A;  3SEO A;  8AT1 B;  3SSS A;  4Q8E A;  3RAX A;  3KLH B;  3BKT A;  2ZC3 A;  5CCM A;  2OKQ A;  1CJU B;  2K3I A;  1WOS A;  1YI2 S;  3ZZT A;  2FLP A;  2HHH F;  4ID8 A;  3G71 S;  4PQA A;  2DY9 A;  2GAG C;  2CPE A;  4DUT A;  2HWH A;  3P4U B;  2C3U A;  4WTY A;  4N47 A;  5CAB A;  2AU0 A;  2HFS A;  2DNL A;  3TWZ A;  5C5J A;  5HO4 A;  1Q86 T;  5KFJ A;  4IRC A;  1S5Z A;  3CCQ S;  2Y0B B;  1VFJ A;  3ILJ A;  4C8M A;  1DFD A;  2KJW A;  4I2P B;  1WF2 A;  2JVO A;  2W9A A;  2W2Q P;  4CLP A;  1WUU A;  1EAY C;  4QYZ K;  1EX8 A;  3ENW A;  2K06 A;  2EFV A;  2VFV A;  1ICE B;  2B3T B;  3CJK B;  5KFW A;  4HLB A;  3FSY A;  3MM5 A;  3MM9 B;  4LF7 J;  2K3K A;  1TKZ B;  4YHH J;  3OTB A;  1RAD B;  2MYF A;  2MB0 B;  3I0R B;  3N6N A;  5A6W A;  4X4T A;  1FE4 A;  3CMA S;  3GIJ A;  3QJP A;  1WC4 A;  2OH2 A;  1B7F A;  3NGD A;  2BYC A;  2LCW A;  1VBZ A;  4NLY A;  1WG5 A;  1QJH A;  4QU6 A;  4AD6 A;  3I4P A;  2P5V A;  2YX4 A;  2VFS A;  3O6Q A;  4YOE A;  3P8B B;  2UUT A;  2M52 A;  1KR4 A;  2L08 A;  1FD2 A;  5GMD A;  3SI8 A;  2GIQ A;  1WKL A;  5DGA A;  1YJ7 A;  4X4S A;  3DLK A;  2VG7 B;  1V3Z A;  2QIF A;  1VC6 A;  2FGC A;  2YKM A;  2ZIT A;  1TUW A;  3DGV A;  3MD3 A;  3C6T B;  2VH7 A;  4ZDN A;  5JUM A;  1AFJ A;  4XPE A;  1VQM S;  3LO3 A;  1ITP A;  4PEO A;  1RAO A;  2NZC A;  2BJ9 A;  2DNM A;  1IM6 A;  4MTP A;  2HFZ A;  4R8U B;  1RA6 A;  5CZX A;  4CO2 A;  2QFI A;  2HVD A;  4DCJ B;  4NLG A;  5FDL B;  1HWJ A;  4C3M A;  2CPI A;  1EB0 A;  4CIO A;  5HLF A;  5HL7 Q;  2PA8 D;  2DRD A;  4DV1 F;  3T6J A;  2WZ1 A;  4Z7Y A;  1SJ4 P;  3J7Z 5;  4X4O A;  2COL A;  2XM3 A;  4JI8 J;  2FVQ A;  3DLE A;  5HK4 A;  5U47 A;  4A8K A;  2G0C A;  3D6M B;  4C11 A;  2VBW A;  2YKQ A;  4F4X A;  4IO1 A;  4WE1 A;  2JJ4 D;  2QRR A;  3MM6 B;  1GX5 A;  3Q8P B;  2PC6 A;  3RB4 A;  1T05 B;  2QG9 B;  4I2Q A;  5A6P A;  1FEE A;  5JMN A;  1OSC A;  2ZH6 A;  1D09 B;  3FMB A;  3M2V B;  2VG5 B;  1R7I A;  1TV6 B;  4JP8 A;  2RB7 A;  4KC5 A;  3HVA A;  2EBG A;  5ETP A;  4R5P B;  2OD6 A;  3FNN A;  2CJB A;  4ZA1 A;  4CO5 A;  4WK3 A;  3A3P B;  3ISN D;  1WNE A;  1S4E A;  2AQ4 A;  2ASD A;  2FLO A;  4CO4 A;  1GTE A;  4J9Q A;  4A8Y A;  5ETL A;  1SQE A;  3GB0 A;  1YRU A;  2PSZ A;  1ZA1 B;  5D77 A;  7FD1 A;  4B9V A;  4K8R A;  2VHG A;  1FA0 A;  4ZJQ A;  4IG0 A;  5HMZ A;  4OZ3 A;  1RKJ A;  5KTQ A;  1TAU A;  3BB5 A;  4WF9 Q;  2O66 A;  2G0I A;  4N5S A;  2NRE A;  1JQG A;  2RU9 A;  1D8Y A;  4USJ C;  2P6T A;  4DV2 J;  2K7K A;  1VOM A;  2DIS A;  2HFU A;  4OI2 A;  2DNR A;  2V8P A;  4FN5 A;  2XZT B;  2B43 A;  4MFB B;  3JQJ A;  1T03 A;  4DR3 F;  2K8G A;  3V6K A;  4LF9 J;  4B08 A;  2B5J A;  3KLI A;  5T7L A;  4USI A;  3GLJ A;  1NHV A;  1PYT A;  4ZN3 A;  3MAA A;  2QC3 A;  4Z37 A;  2W2P P;  2QO3 A;  4DR1 F;  3S7R A;  1VQO S;  3HXM A;  3C14 B;  2E9Z A;  3KLH A;  3NAH A;  2PMZ D;  1QY7 A;  1CJU A;  4CTA B;  2IA6 A;  2DR5 A;  2X3D A;  5B7W A;  2X1B A;  5BJR A;  4OI0 A;  4Q2L A;  1HHQ A;  2QL5 B;  2O5D A;  3HT3 A;  2UXB J;  1M90 T;  2RIL A;  4FBT A;  2MEW A;  4W98 A;  1RTH B;  4AL6 A;  1TU0 B;  4E0D A;  4EGL A;  1KD1 T;  3M8Q B;  5LXY A;  4DR2 J;  3NOC A;  2GGP B;  2RUS A;  1U2F A;  3R27 A;  1IBM J;  2KXH A;  4I2P A;  4B3S J;  3VGV A;  1EQM A;  1QAY A;  2E1A A;  3W5Z A;  3KLF B;  2G4B A;  2QTW A;  2F8H A;  2HAI A;  5DGB A;  4ZVR B;  2HQG A;  4JV5 J;  4JI6 F;  4DOZ A;  3CJK A;  3Q0A A;  3CCS S;  1BC6 A;  1R8C A;  3FCV A;  3MM9 A;  2VFT A;  1TKZ A;  5AXK A;  2MLZ A;  4ZP7 A;  3I0R A;  1K1Q A;  3KLV A;  2I38 A;  5F3T A;  5KOX A;  4DX8 H;  1GMW A;  2LXI A;  4WFX A;  3AOD A;  4RJV A;  5E7O B;  2FHM A;  2VU5 A;  3HKW A;  4RBT A;  4KFB B;  2ZZM A;  3GJS B;  2VAS A;  4DV7 F;  3OTE A;  4N76 A;  4YP3 A;  2ZZT A;  2JFK A;  3P3D A;  2KI2 A;  4X64 J;  4WTO B;  2ZH2 A;  4GC7 A;  2EC0 A;  2F5G A;  5G4D A;  2VOP A;  3H0P A;  3G8S A;  1PIL A;  4EUV A;  1RAH B;  3RZA A;  2VG7 A;  4EWT A;  1N0U A;  2KT2 A;  1FTR A;  2W4C A;  3B6B A;  3C6T A;  1F9F A;  3M9N B;  2N82 B;  1PYO B;  4ZIV A;  2PII A;  5J2P B;  1BXN A;  5E5N A;  4N8N A;  1BGX T;  4R8U A;  3NKY A;  3FBF A;  2Y9H A;  2V0N A;  2CG8 A;  4Y65 A;  1FVS A;  3EYZ A;  3OFG A;  3ET6 B;  4K59 A;  2DGO A;  3ETO A;  5FDL A;  3MUT P;  3OFF A;  3A8J A;  4O3P A;  5KFM A;  3UW1 A;  5LJ5 Y;  1XMQ F;  1L3U A;  4CLF A;  4OYX A;  4AL5 A;  1QUV A;  2NXU A;  3PTW A;  2YX1 A;  2V4R A;  3RYL A;  2R7U A;  4NLO A;  3MM6 A;  2CJY B;  2VKR A;  3PW5 A;  3EZ5 A;  5K8N A;  3GR1 A;  1T05 A;  5AE2 A;  2RVJ A;  2UUC F;  3H40 A;  3JS9 A;  3M2V A;  2VG5 A;  4TY9 A;  2B9Y A;  1TV6 A;  3DRP B;  3O8W A;  3EMT A;  4R5P A;  2DGX A;  3ULH A;  1GTH A;  3G87 A;  3GFH A;  1BMQ B;  1DTT B;  3R5G A;  1PBA A;  2MLX A;  3UCU P;  4XDC A;  2FHK A;  4FYW B;  1KSP A;  3PV8 A;  4MKB A;  2BJ3 A;  4Y6I A;  1NDK A;  4CDI A;  1Q82 T;  1MWZ A;  1SL0 A;  4PXB A;  2W8K A;  1WD6 A;  4GO7 X;  1AFI A;  1VLO A;  2V68 A;  2E66 A;  1H2V Z;  3H90 A;  4DSK A;  3CED A;  2WHO A;  1RT2 B;  1RAB B;  3H5U A;  2CAD A;  1TKX B;  2RQK A;  4LF8 F;  2POK A;  1K47 A;  2B51 A;  4TXS A;  1VRT B;  1KC8 T;  1YLX A;  2GA7 A;  2V50 A;  2ACY A;  3W63 A;  2FB0 A;  4JI5 J;  2QLW A;  2BM1 A;  4MFB A;  2LQ5 A;  4QYR A;  2CPJ A;  1IR1 A;  5LMN J;  2H5J B;  1J27 A;  3ISN C;  3UVJ B;  3A1Y G;  2DPI A;  2FIU A;  3DLJ A;  4J9M A;  3QIP B;  2PA3 A;  3C14 A;  3T1Y J;  2MQ8 A;  4AT1 B;  2VON A;  1S1V B;  1UVL A;  2E1C A;  4CTA A;  2RT3 A;  2YH1 A;  3EUN A;  3BGU A;  3N5F A;  3OVB A;  3ENV A;  1FF2 A;  4C0O C;  4PRF A;  1R6Y A;  4OI1 A;  3C46 A;  3PW7 A;  4ER8 A;  2Y0S D;  3D66 A;  3TX8 A;  1RTH A;  3TX0 A;  1CPZ A;  1YJ9 S;  4OX9 J;  3M8Q A;  3LQV A;  3AFG A;  2GGP A;  3Q23 A;  2KHC A;  3W2W A;  3J81 Y;  2HHV A;  3W3S A;  2G9O A;  4EZ9 A;  4CLK A;  3BGO P;  3KLF A;  4NML A;  1FER A;  2P2C B;  5IWA F;  1WG1 A;  4RWX A;  1N32 J;  1C1C B;  2LYV A;  2EFN A;  4U96 A;  5J1P A;  2MJN A;  1VQN S;  4ECZ A;  3MD1 A;  4OZ1 A;  2KXN B;  1CUL B;  1VHI A;  2XS2 A;  2KN4 A;  4OZN A;  1VI7 A;  4L76 A;  3SCI E;  5KFU A;  1LEO A;  4I69 A;  1UKU A;  3LTO A;  3QWP A;  1LXJ A;  1YSJ A;  2HQD A;  2D41 A;  3GU0 A;  3L7P A;  2HBY B;  2HBQ B;  1BY9 A;  2PO4 A;  4FBU A;  2JEJ A;  3T1A A;  5L9X A;  3C66 A;  4KFB A;  3D28 A;  6FDR A;  3ZZU A;  5F41 A;  2GJ2 A;  4UF4 A;  2HRY A;  4Y2I A;  1SQF A;  3DMJ B;  3PRV A;  5HJX A;  1Q5Y A;  1S0N A;  1CC8 A;  1KTV A;  3VVU A;  3TRG A;  1IXK A;  4PXE A;  3JSB A;  3LGN A;  2YQ1 A;  5FJ4 A;  2I6W A;  3I82 A;  3SV3 A;  3NBP A;  5GAG U;  1SKR A;  2G2Y A;  1TFW A;  4RW8 B;  6AT1 B;  3F73 A;  2F8M A;  3TA0 A;  2HZA A;  3V4M A;  5J2P A;  1Z4U A;  3UWT A;  1IJE B;  3IM8 A;  1UJ5 A;  4GRS A;  4HR2 A;  3KJQ B;  3ET6 A;  2FJX A;  4MKA A;  4M5D B;  2HPU A;  4CNY A;  4P52 A;  2ZBQ A;  5EHH A;  4LF6 J;  1Z1Z A;  2IFX A;  4MK7 A;  4YQW A;  2UVW A;  1FFS B;  2OFG X;  4WWS A;  2RU3 A;  5MAO A;  5EWG A;  1B64 A;  4JI1 F;  2ADC A;  4JYA J;  5C7P A;  3CWJ A;  3IAS 9;  2WRM A;  3KK2 B;  3H59 A;  1S48 A;  2MJU A;  5D0E A;  1Z2L A;  2UUW A;  4YN3 B;  4ECX A;  3L7O A;  2D3O R;  3DLB A;  4AUK A;  1RSC A;  5T14 A;  2OSR A;  2ZH5 A;  3A8K A;  4L73 A;  3J7Y I;  5F9N A;  3DRP A;  1GXL A;  2C28 A;  2LMI A;  1AUS L;  1RTD B;  3PYE A;  5DQH A;  2XNQ A;  5D8H B;  3CD0 A;  3TZZ A;  2XMJ A;  2YNI B;  3KUG A;  3PVX A;  3PDN A;  3GSD A;  1DTT A;  3IR7 B;  4LF2 A;  1WF0 A;  2VC1 A;  5GAD U;  2CWX A;  2HHX A;  1ZTW A;  4QWA A;  1GQE A;  3X1L B;  2YNH B;  4A8S A;  2AIR B;  3UFC X;  4RZR A;  4HYK A;  4LF4 J;  3PM9 A;  3IRX B;  4DQQ A;  4WKR A;  2HRT A;  3VWS A;  3CVK A;  5D15 A;  1UET A;  4BWM A;  2FLN A;  3CNQ P;  3C15 B;  1A6L A;  1TKX A;  1FDB A;  4TNO A;  3F0N A;  4MMO A;  1VRT A;  4TU7 A;  3NGK A;  3KJV B;  5KFP A;  4P6Q A;  4F0M A;  1V6H A;  3BQ1 A;  5BR8 F;  1S97 A;  5SUH A;  2IA0 A;  1FWK A;  3JTP A;  2JLG A;  2HZC A;  2NZ4 A;  3UVJ A;  1G7C B;  4NA2 A;  2ZHA A;  1LFW A;  2CNN B;  2IM2 A;  2W9B B;  3CC2 S;  1RAG B;  4K4T A;  2HAF A;  3AXK A;  3QIP A;  1W26 A;  4KH0 B;  1S1V A;  1F60 B;  5AE1 A;  4ZVP B;  1VC5 A;  2LA4 A;  2DR6 A;  2PFF B;  3PW2 A;  2KJV A;  3TEH B;  2QA1 A;  3HX9 A;  2GV1 A;  3Q86 A;  3M8P B;  4QIV A;  4WP9 A;  2MKS A;  1R8H A;  1S72 S;  1NU4 A;  4MK8 A;  1EIY B;  2MQQ A;  3CJ3 A;  1Q8I A;  2QA4 G;  4MYT A;  1JMT A;  4CH7 A;  1GT8 A;  2RIJ A;  3HZE A;  2OTJ S;  1PIE A;  1C1C A;  4HHU A;  4ECW A;  4DL4 A;  2DH9 A;  3PRB A;  3P5T L;  3WDO A;  2KG0 A;  1EET B;  1CUL A;  1VQ9 S;  2XO7 A;  3M6U A;  5EWE A;  5L1I A;  1OWX A;  3I96 A;  2ZD1 B;  2CPY A;  2AGO A;  4LFB J;  3M9O B;  2ZNY A;  3BDE A;  1Q81 T;  1F0X A;  1ZOT A;  4FXV A;  4AFF A;  3D9B A;  4WFZ A;  1ZM9 A;  2I0X A;  4EMD A;  3RAQ A;  1LW2 B;  5E3A A;  1FT8 A;  3HCX A;  4ECY A;  1F2H A;  3DMJ A;  1NJY A;  4JOU A;  2AYG A;  1GNK A;  2YNG B;  4C48 A;  3NOG A;  3GG1 A;  2B4V A;  2RDD A;  2EG2 A;  2J9C A;  3JYT B;  2H48 B;  3PW0 A;  4WYL A;  1A7G E;  1RT1 B;  5A2Q Y;  5LOQ A;  4DUY J;  4RW8 A;  4J5O A;  1LFP A;  4LRB A;  4XIU A;  4JI2 F;  3UR3 C;  5JXS A;  4F0H A;  4DR6 J;  2ASL A;  2XWY A;  2AZ3 A;  3I5B A;  4DV0 F;  4OJ1 A;  1TUV A;  1FX2 A;  5HP1 B;  4DV5 J;  1DRZ A;  4DUZ F;  3EE3 A;  1XK8 A;  3C19 A;  1O5J A;  4FPR A;  4M5D A;  2ZBI A;  2VFU A;  4OZL A;  2Q6C A;  3ZZ0 A;  1CBK A;  5B0E A;  4LVN P;  1U7L A;  3OT9 A;  3DHX A;  2DB1 A;  1HL6 A;  4I68 A;  5DQI A;  3CC4 S;  4IDK B;  2QEX S;  1T7P A;  3KK2 A;  3BKU A;  2LA6 A;  1MWQ A;  4ZLJ A;  2CQH A;  3GPA A;  3T9N A;  3QFW A;  5KFF A;  5L1K A;  3BV8 A;  1B3T A;  4PZV A;  1QSL A;  1HWI A;  3D7S B;  3G6E S;  2YBV A;  1DAR A;  2E29 A;  1T95 A;  2WOM B;  1VIS A;  2PEH A;  1RTD A;  4K4W A;  3CC7 S;  2V2V A;  2EVZ A;  5IT0 A;  3D6H B;  2YNI A;  1FJG J;  2DHA A;  2UZA A;  2HIQ A;  1SIW B;  2MMY A;  2ALZ A;  4BS2 A;  4ILM A;  4C9D A;  3QT8 A;  2YNH A;  3HSD A;  5I3Q A;  1SJQ A;  5KFC A;  2MQO A;  1BWE A;  1TK0 A;  3IRX A;  3OXG A;  3LAK A;  1NJW A;  5L9N A;  1ARO P;  3AA9 A;  3C15 A;  1RA7 A;  3TNV A;  2HHS A;  3NP5 A;  3KJV A;  3CJ4 A;  4I67 A;  1C4A A;  4ECS A;  1HIY A;  1NKC A;  3MAQ A;  4OX8 A;  2RH3 A;  3ILL A;  3QSY B;  3BPS P;  2B0G A;  1X0F A;  5KG0 A;  3OLB A;  3MUR P;  3V81 B;  5B0B A;  2UXD J;  4U7U D;  2FZC B;  2QFJ A;  2ZJP Q;  2MKJ A;  1M5K C;  1S1U B;  2W9B A;  2WB1 D;  2HQI A;  1TVR B;  2HUR A;  2I1R A;  3OFE A;  3CJR A;  3FJ2 A;  3ONQ A;  4TQS A;  5DDQ C;  2MQP A;  4B9M A;  1LWF B;  3RRK A;  4KHP F;  3PHT A;  2ZWP A;  3PX0 A;  1IBK F;  3S1T A;  3ENA A;  3MXH P;  3AJD A;  1ZZN A;  2CQ4 A;  2XS7 A;  3VCD A;  3M8P A;  1P1L A;  2BRL A;  2N4D A;  1MLA A;  1NJI T;  4NXN F;  4DPO A;  3HK2 A;  3QRR A;  1BUX A;  2HSE B;  2HYI B;  3OTO J;  4URS A;  5AJ3 J;  3G6Y A;  1N88 A;  2RRA A;  4O3O A;  4OHW A;  1NB2 A;  3IBW A;  2LXU A;  4Z2X A;  1RLC L;  4KGZ B;  2AX0 A;  1X0P A;  1R43 A;  2WON B;  4ZP8 A;  3MPU B;  4B3R J;  4DEZ A;  4B9L A;  1S6Q B;  2JHE A;  3MTJ A;  4DZD A;  1FVQ A;  5ITH A;  4ZVQ B;  2XI3 A;  4ZPB A;  1EET A;  3BSN A;  3T1H J;  2E1R A;  1CS4 B;  2W25 A;  4ILL A;  5HVH A;  3RGI A;  2ZD1 A;  4NLV A;  2APO A;  3R3T A;  2BAB A;  3MMC B;  1OY6 A;  2CNL B;  2YQ3 A;  4WII A;  3MR7 A;  2CQD A;  1LW2 A;  4ZS6 A;  1Q16 B;  3SCJ E;  2IYG A;  1L5U A;  2F3J A;  5HAN A;  1QAX A;  1SV5 B;  4WFN Q;  3J7A 1;  3DOM B;  4ED2 A;  1CJK B;  1Y10 A;  2YNG A;  2YWH A;  3KTQ A;  4R0E A;  1IUJ A;  1N48 A;  4PPZ A;  3R5A A;  3JYT A;  1PJ6 A;  2BDP A;  3BDP A;  3AB2 B;  2C2N A;  5ETO A;  4GVB B;  1RT1 A;  5E3R A;  2YY3 A;  4Y34 A;  1ZPW X;  4RR5 A;  2R4F A;  4B3T F;  2VQF J;  4F67 A;  4KO0 B;  2M3D A;  1UP1 A;  1PKU A;  3T9Z A;  1FRH A;  3NNC A;  3QQC D;  3RB6 A;  4KSE B;  3CD7 A;  5HP1 A;  1QDU B;  2FGO A;  5E33 A;  1RWN B;  5ETT A;  2UVU A;  4LBI A;  2AZ1 A;  2IAJ B;  2QLJ B;  4K4Y A;  1B99 A;  3AQO A;  2YKP A;  4ANC A;  4K4Z A;  4P71 A;  2Y1I A;  2WW4 A;  4GKK F;  5DG9 A;  5IS2 A;  2FQQ B;  3PYF A;  3A8I A;  5GVQ A;  4O3R A;  4IDK A;  2W7P A;  3MMA B;  2XCA A;  2DTJ A;  3NS7 B;  3AOA A;  3CJ5 A;  1XNQ F;  5F8I A;  4QWC A;  3VTI A;  3GCW P;  2C2D A;  3DOL B;  1RBA A;  3CE8 A;  4WXW A;  4O44 B;  2MXY A;  2PI4 A;  4OHY A;  5HQ8 A;  1B0V A;  2VBY A;  3VZI A;  2WOM A;  4OL8 A;  4ZPT R;  1S0M A;  1LV5 A;  1I94 J;  3K5L A;  2LEC A;  1SC4 B;  3AB4 B;  2Z2Z A;  4IFV B;  1ZM4 A;  3OHB A;  4L3K A;  3DXB A;  4I6W A;  5AT1 B;  4F3M A;  2BVZ A;  2HWI A;  2HNY B;  2I2Y A;  1LW0 B;  3VVT A;  3IN5 A;  5D4N A;  4DSJ A;  1SUQ B;  4OYM A;  4HI2 A;  1WKK A;  2YPZ A;  5KG7 A;  2YVS A;  3EXC X;  3MM7 B;  2F65 A;  4OJ3 A;  1VBX A;  2OML A;  1I3O B;  1SXL A;  3BJY A;  3W61 A;  5B0C A;  4TYB A;  2ZM6 F;  4A8Q A;  1DQ9 A;  4QR1 A;  1N6Q B;  1Q5V A;  4KY3 A;  2VIH A;  3H5X A;  4C97 A;  2E5L F;  4KPY A;  2E9T A;  5D4P A;  4ANE A;  3V81 A;  1HYS B;  4HKQ A;  3Q89 A;  4X66 J;  4P2M A;  1S1U A;  1NK8 A;  3AXM A;  1TVR A;  4ZJO A;  3BO4 A;  1YK9 A;  1NXI A;  3N01 A;  1D9A A;  4M8L A;  2R42 A;  4U67 Q;  4X4V A;  1DY3 A;  2RDI A;  3GIR A;  3R9L A;  2XHC A;  1RTJ B;  1UAW A;  1IWA A;  1IKY B;  2MST A;  2B7C B;  3R6L B;  4RW7 B;  4O3Q A;  3BO3 A;  1DTQ B;  1VRU B;  3SSR A;  3KUE A;  3K5N A;  3TYT A;  2BJE A;  4HEA 9;  1N33 J;  4GKJ J;  1U48 A;  5HSP A;  3NCR A;  4K0K J;  2D9O A;  1KOH A;  3Q8U A;  2R8J A;  4Q0B B;  2FPH X;  5LJ3 Y;  3D5M A;  4YR3 A;  3FVY A;  4QIG A;  5HVF A;  2WON A;  4LF5 J;  1S6Q A;  5LM7 E;  3MED B;  4G1P A;  4EI2 A;  3W9J A;  4FF4 A;  3I6P A;  2KYZ A;  1MMD A;  2OEL A;  1CS4 A;  2DNG A;  1JX4 A;  2Q6B A;  1A0O B;  3TQE A;  3R1H A;  2M70 A;  4B02 A;  4QCL A;  1FRL A;  1MG7 A;  3C3L A;  5BYR A;  4QZV B;  4URG A;  2DT9 A;  1VDH A;  1U6B A;  1U8W A;  5H1S V;  3OTD A;  5IC6 B;  3DOM A;  3M30 B;  1CJK A;  2JL9 A;  4DV4 F;  2JVR A;  3CCE S;  1R8B A;  3IG1 B;  3MPV A;  4ZPA A;  1ZAV A;  4DSL A;  1UZH A;  4KT0 C;  4GVB A;  4ECQ A;  3K5P A;  3ZZY A;  1F3F A;  2AYB A;  5KFZ A;  5KFX A;  1FCA A;  2ZNZ A;  3T5K A;  3W9I A;  4WZM A;  4KO0 A;  2OIH A;  1MSW D;  3BR8 A;  1RT5 B;  4V1A k;  3M6V A;  5JVG Q;  4OJG A;  1JLA B;  2R8H A;  1F6T A;  2V67 A;  1RHK B;  3FK4 A;  1Y3K A;  5F0W A;  3Q8Q B;  3PW4 A;  1X5P A;  3BBF A;  3O2I A;  2VG6 B;  5D4L A;  4X62 F;  2CQP A;  4L3N A;  3GII A;  2IAJ A;  4PWW A;  3JSM B;  4OYA A;  2ROE A;  3F41 A;  2BJD A;  2MQN A;  2BJ7 A;  4P73 A;  1P9Y A;  4A8O A;  5B0A A;  4M5H A;  3N9U C;  2ADB A;  3BRE A;  3MMA A;  1JLG B;  4EBD A;  2K2P A;  5C25 B;  3HM9 A;  2IM0 A;  5K8O A;  3DOL A;  4LFC J;  4OZ5 A;  4O44 A;  2DKO B;  2GS8 A;  2CVI A;  4NXM J;  2RRN A;  1W7W A;  4BLG A;  4A4J A;  3MEG B;  1WTB A;  3I31 A;  4WFA Q;  2JZ5 A;  4IFV A;  1PJ7 A;  4CO0 A;  4ECR A;  4CM2 A;  4X4P A;  2ZEJ A;  4XO0 A;  2R8G A;  3BGF A;  4AQY F;  1Y4Z B;  2XZW A;  2HNY A;  4RUH A;  4LMZ A;  3QT7 A;  1RHR B;  2R8K A;  4J9V A;  4M63 A;  1LW0 A;  5DRK A;  4Y2M A;  3DFE A;  3M8Z A;  2DXD A;  1SUQ A;  2HLU A;  1YTY A;  3DOK B;  3IC1 A;  4OV6 A;  1Q7L B;  3HHL D;  3H2U B;  1FRK A;  3MM7 A;  3W8P A;  3I32 A;  1CEZ A;  1V5V A;  2E5G A;  1U2C A;  1J5E J;  4NL5 A;  4LFA F;  3KKF A;  2LP4 A;  2P8I A;  4KGX B;  1N6Q A;  3IM9 A;  2YWK A;  4W90 B;  3M8S A;  1N8R T;  2MZS A;  2UV8 A;  3V6J A;  2R2U A;  3TVK A;  3B54 A;  1UW4 A;  1RWW B;  1UVN A;  4X4Q A;  4I6A A;  4J91 A;  2C2R A;  2GVZ B;  1HYS A;  1WKJ A;  1HHT P;  3PX4 A;  4IQX A;  4UOG A;  2C2E A;  1NK5 A;  1H2T Z;  3L4B C;  4H4K C;  3OD2 A;  1JXE A;  1KON A;  2XWX A;  4ES1 A;  1XMO J;  1M5P C;  2RQC A;  1SC6 A;  1KLM B;  5E2Q A;  3BO2 A;  4ETZ A;  4DFP A;  1PYS B;  2XEX A;  1S6P B;  4ED1 A;  4DG1 B;  1WEZ A;  1RTJ A;  3Q2T C;  5DDO C;  4Y3C A;  1IKY A;  2UV8 G;  1OY8 A;  4RW7 A;  4Q7A A;  1UFL A;  3WIV A;  1KEK A;  1FDA A;  1R0A B;  2B4U A;  1DTQ A;  5DZ7 A;  1VRU A;  2N4C A;  4ECU A;  4N77 A;  4KIA A;  2DEI A;  5LMN F;  4EYI B;  3B4D A;  5K8P A;  3S01 A;  2VJU A;  1JLE B;  3TI0 A;  5DM7 Q;  1FE0 A;  4RWW A;  1XC9 A;  1M1H A;  1NUE A;  4O0N A;  2FHJ D;  1HBN B;  4Q0B A;  1S1T B;  3D0G E;  3FEY B;  1TR0 A;  1SVD A;  3THV A;  2MQM A;  3JTN A;  3FQK A;  2CJX B;  3MED A;  3BYP A;  3EDQ B;  3AJ1 A;  3T5L A;  8ATC B;  4DF8 A;  1Y9O A;  5GAG I;  1TFY A;  1X4E A;  4LRD A;  1N36 J;  4ZVF A;  3CCW A;  3OTC A;  2DNO A;  4KGM A;  3AH6 A;  4F50 A;  3NWG A;  2ATC B;  2PDA A;  1HD0 A;  4WFY A;  3CJ2 A;  1XTZ A;  4J9N A;  4DR4 J;  4BDP A;  2BJ8 A;  4FYX B;  1YVF A;  2XB2 D;  2ROP A;  4JI3 J;  1T9W A;  2KG1 A;  2F4V F;  1RAF B;  1IKV B;  1GH8 A;  3M30 A;  2P9C A;  4USV A;  1FNX H;  3CJ0 A;  3IG1 A;  2UUB F;  4NCA A;  2OD4 A;  4LBP A;  3C8Y A;  3R97 A;  3NEK A;  5C2G A;  4DL5 A;  2L9D A;  3PXG a;  2FVP A;  1S9G B;  4I1T A;  1P9Q C;  5ETM A;  3CXC R;  4C8L A;  4NPO A;  1RT5 A;  3KNA A;  2DNH A;  3D6F B;  3O44 A;  1NBE B;  3AT1 B;  1JLA A;  1JNZ B;  3J7Y U;  1X4D A;  2HHH J;  3BN7 A;  1HI0 P;  3NMA A;  3SFU A;  1LOU A;  2VQE F;  2VG6 A; 
#chains in the Genus database with same CATH homology
 1LWX A;  3JS9 A;  2BX6 A;  5CAA A;  1EHW A;  3FKB A;  2AZ1 A;  4FKX A;  1WKJ A;  1WKK A;  1LEO A;  3PJ9 A;  5BXI A;  3NGR A;  1MN9 A;  3L7U A;  3EMT A;  4UOG A;  3Q8V A;  3B6B A;  1W7W A;  3EVW A;  1B4S A;  1HLW A;  1B99 A;  1NSK L;  3BBC A;  4ANC A;  4DZ6 A;  1F3F A;  3FCW A;  3BH6 B;  1S57 A;  4UOH A;  2HUR A;  3VGV A;  4F4A A;  1ZS6 A;  3ZTS A;  3Q8U A;  5C7P A;  1NSP A;  1UCN A;  2DYA A;  3ZTO A;  2B8P A;  2B8Q A;  2AZ3 A;  3FBF A;  2ZUA A;  2DXF A;  1F6T A;  3NGU A;  3EVO A;  2DY9 A;  3FCV A;  3PRV A;  3VGU A;  1NDK A;  4ENO A;  4DUT A;  4CP5 A;  1BE4 A;  1NDP A;  3ENA A;  1S59 A;  2HVE A;  1NLK L;  3BBF A;  3FBB A;  3VVU A;  5CAB A;  3EE3 A;  1WKL A;  3G2X A;  2CWK A;  4EK2 A;  4ANE A;  2DXD A;  3NGS A;  3Q89 A;  1PAE X;  1XIQ A;  1NPK A;  1S5Z A;  1NDC A;  4DI6 A;  3ELH A;  4S0M A;  3BH7 B;  3ZTQ A;  3DDI A;  4UOF A;  1K44 A;  4WBF A;  1NHK L;  2VU5 A;  3Q83 A;  2BEF A;  1BUX A;  2NCK L;  3BBB A;  3EJM A;  3FC9 A;  3FBE A;  3GP9 A;  3VGT A;  3VGS A;  4FKY A;  3FBC A;  3EIC A;  3EVM A;  3WX8 A;  3EM1 A;  1NB2 A;  3Q8Y A;  2DXE A;  5IOL A;  1NUE A;  1XQI A;  3MPD A;  4O0N A;  4AND A;  3ZTR A;  1BHN A;  3ZTP A;  1PKU A;  1JXV A;  1U8W A;  1HIY A;  3NGT A;  3ETM A;  1NCL A;  1HHQ A;  2HVD A;  4HR2 A;  3DKD A;  3R9L A;  4F36 A;  3GPA A;  1KDN A;  4C6A A;  1MN7 A;  4KPC A;  3B54 A;  3VVT A;  1NDL A;  1NSQ A;  1VYA A;  3Q86 A;  4W98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...