2DXEA

Crystal structure of nucleoside diphosphate kinase in complex with gdp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
154
Chain Sequence
ETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFFKPEELFEYPRAADWFYKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nucleoside diphosphate kinase in complex with GDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 51
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2dxeA00
4EK2A 2DY9A 3EICA 5C7PA 2BX6A 1NPKA 1UCNA 3Q8YA 3BBCA 1MN7A 2CWKA 2DXEA 4FKYA 4O0NA 4S0MA 3VGVA 3EVMA 4UOFA 1NLKL 1XIQA 2B8QA 4F4AA 1NB2A 4DZ6A 4F36A 1WKKA 5CABA 1B4SA 3EE3A 1F6TA 5IOLA 1F3FA 1NHKL 3PRVA 3NGSA 3VGTA 1S59A 3JS9A 1U8WA 1HIYA 2HURA 4KPCA 3B6BA 3NGUA 4WBFA 2B8PA 4ANEA 3DKDA 3VGSA 1PKUA 2DXDA 2DYAA 1KDNA 5CAAA 1S57A 3EMTA 1NUEA 3Q8UA 4ENOA 1HHQA 3GP9A 3L7UA 3DDIA 1JXVA 1NCLA 3ELHA 1EHWA 1ZS6A 1BUXA 1NDLA 1PAEX 2HVDA 3ZTRA 1MN9A 3NGRA 3EVWA 3EM1A 3PJ9A 3WX8A 3ZTPA 3GPAA 1LEOA 3FBCA 3ZTOA 3Q8VA 4FKXA 1B99A 3BBBA 3BH7B 1XQIA 3ZTQA 1NSQA 3BBFA 1BHNA 1HLWA 1LWXA 3Q89A 3FCWA 3MPDA 4DUTA 3FBFA 4C6AA 1VYAA 3FBBA 3VVUA 3VVTA 4UOGA 3VGUA 1NDKA 2AZ3A 4UOHA 3B54A 4W98A 4ANCA 3Q83A 2AZ1A 2BEFA 3EJMA 4HR2A 1WKLA 5BXIA 3FCVA 2HVEA 3FBEA 3ETMA 3Q86A 4CP5A 3BH6B 1NSPA 1WKJA 3FKBA 1NSKL 3EVOA 3ENAA 3G2XA 2DXFA 1NDCA 1BE4A 1K44A 4ANDA 3ZTSA 2ZUAA 1S5ZA 1W7WA 3R9LA 1NDPA 4DI6A 3FC9A 2VU5A 3NGTA 2NCKL
chains in the Genus database with same CATH superfamily
4C97A 3BF4A 4DV5J 2DNNA 2FGOA 4O44B 4PWWA 5A8RB 5B7WA 1LK7A 1EQ0A 3RBDA 1E6YA 3BBCA 5J1EA 3N5BA 4FBUA 2D3ZA 1NJWA 5FDLB 2WTFA 6AT1B 4PR6A 2FUG9 2AGQA 4FF2A 3VAHA 2N7YA 5GAEI 2IIHA 2QE5A 2B8QA 3M2RB 1NB2A 4ECQA 3IWLA 4EI2A 2K3IA 2X7IA 3CDAA 4P75A 1S12A 4QU7A 2F40A 2FHOB 3KKFA 2VKZG 2Y0SD 4O3PA 2VFUA 3L7PA 1HQUB 4J9KA 3CO0P 1LFPA 3M6XA 5GAEU 1VBXA 2ZDOA 1HD1A 1F1BB 2XZTB 3AD9C 3MMCB 1Y11A 2EK6A 2G2OA 3I32A 2QA4S 4OX9J 1U09A 3NGSA 3EZ5A 2VQFJ 1S59A 4B9SA 1RU1A 1GH8A 3MM7B 2F5GA 3CJ2A 1BC6A 2MKKA 2BJDA 2GMJA 1WDDA 5KT3A 1X31C 3SI8A 1M5SA 2WONB 3JSMB 1TZ0A 1UTAA 2W2QP 3I0RA 4OI3A 3PO4A 5B0AA 1H74A 1J5OB 3KK2A 2E1RA 3C16A 2K2PA 2LA6A 3VQTA 3OFFA 5KT6A 3OLAA 2QSWA 4QW9A 1T7PA 5L1LA 5KFPA 3OD2A 3M8PA 4D3HA 4USJC 3N5FA 3T5HA 2D9PA 3LUYA 3M1VA 5IT9U 4HHJA 4RNMA 3DLKB 3GFZA 3CIZA 4ZCIA 3R6LB 1S9FA 1JXVA 1FFGB 3ILLA 1ZBTA 2KB2A 2RF2A 4GVBB 3A1YG 3OTOF 2GNKA 3FZBA 1C0TA 4DR6J 2EEYA 1SH2A 4RR5A 4I6WA 2PT0A 4WE1B 5D4LA 2ZEJA 4DXLA 1T9TA 4YDDB 2MGZA 2G1HA 4ZPTR 2VODA 3OFGA 4QPXA 2OSQA 3FNNA 4ZVSB 3ET6B 1WF2A 3IGVA 2W8LA 4MIWA 4O0IA 1NXIA 4CLWA 2XCPA 3GQCA 2IMWP 2V5HG 5ETVA 1U26A 4DLEA 2WSCC 4KYZA 3Q8VA 4DPWA 4NCGB 4D3GA 1RBLA 3HO1A 1B99A 1HA1A 3AH6A 2PMWA 4G1IA 1XQIA 4FNIA 1IKWB 2E1CA 3AA9A 2NYHA 4DL7A 1HD0A 3HPOA 4ECZA 4QIEA 4NZ7A 3ZZRA 4B9VA 1BHNA 5KFVA 4URSA 5GMDA 2V34A 2R3VA 3DI6A 5A0YA 1T9UA 3D68A 4U9RA 4C3KA 3FBFA 3MEEB 2V4JB 4L6V3 2I5JB 3OFHA 3M32A 4RL1A 1DTQB 1JLGA 3DRXA 4WP8A 3WHIA 3PR4A 3OL7A 1QTMA 1WELA 2VDHA 3RW7A 3RYLA 1EETB 5A8WA 3MR6A 2PC6A 4RNHA 4USIA 3Q0AA 1N4LA 4CO3A 4DFJA 3FFIA 4OX6A 2DISA 4RKUC 4USVA 1RU2A 4O44A 3UR0A 3BPDA 4ZLNA 2R7UA 1Q8BA 3CT9A 5KFSA 2ZH7A 2IVFB 2P5VA 2V2VA 3NCPA 4ZP6A 3A4TA 2XY6A 2NSBA 4TNOA 3T6BA 1RA7A 3KLEA 3T1HF 5K5MA 5HANA 4DMZA 4X4PA 2QSFA 3CJ5A 3PJXA 2QLXA 4NEYA 3T1YF 4HKQA 2CJAA 4H4KA 3ENAA 3CULA 1BE4A 3AOCA 2FLNA 1EQMA 1HWKA 3BKFA 4OX7A 3UVJA 3DDKA 4DJBA 4ID8A 3H42A 4WE1A 4RNOA 4R5PB 3KUGA 3IG1B 5CZVA 2Q6BA 3N0VA 3PFOA 3OSNA 4JI2J 1NDPA 4PPDA 5J1NA 3UW1A 2C3YA 4F50A 2PFDA 4DV3J 5F3TA 2GMHA 4F25A 1ZAVA 2QN6B 3HHKA 4NLYA 4GC6A 4LT6A 2H1YA 1UPMB 2WVBA 3J80Y 4I6AA 4LR8A 4OZ1A 4EK2A 4FNHA 5C7PA 4EBEA 3CDBA 2BJ1A 1N5YA 1CSJA 1ZZFA 3A8KA 5E7OB 3Q8YA 2BE9B 3ENVA 5L1KA 1YJWS 4J9RA 4NXMJ 2QYGA 2ZNYA 2VJVA 2O3DA 1BGXT 4PUOA 1X7VA 3UNGC 1L5UA 2H65B 4DQRA 4NLSA 3W64A 2AGPA 4UOFA 2OHDA 1VQKS 2GCFA 4DSLA 3MCOA 2CQHA 4F67A 5CYMA 1IM4A 3TVZA 1KS2A 1FXRA 1TL3B 5K9FA 4J90A 1B4SA 1Q16B 1TL5A 4X4QA 3QWUA 3Q22A 1NK0A 2O1PA 1R89A 2XI3A 3ZNJ1 5HLFB 4J9MA 4RPFA 2JEGA 4QWDA 3CSKA 2Y1IA 4DX5A 1MLAA 2ZBQA 2CPZA 3PRVA 2FC9A 4PXDA 2LXUA 3OBIA 3VGTA 3J81Y 1U8WA 3A8JA 1LWFB 5I3QA 5F8MA 3MUVP 1R8HA 2AJ2A 3M2VA 4DR5F 4BDPA 4OHXA 4FYYB 2Z8QA 1QAXA 1C2PA 5CYMB 3T19A 4C7QA 1TL1A 1ZM4A 3IRXA 2ASDA 3CUNA 1VRUB 2LQBA 3DKDA 4ZHRA 1GX5A 5EHHA 2UUAF 2Z2YB 4WP3A 4DV2J 4OJGA 4OHYA 3TAPA 3H0PA 4TKTA 2QZ8A 4YEAA 1CULA 4AQYJ 1IBLJ 2UUCF 4F3QA 2DH7A 2K8GA 2ZD1B 3OTCA 4L3KA 2CZVC 2C1EB 1IXKA 5HROB 4WF9Q 1RWUA 1HWJA 4I69A 2DR9A 3ZZUA 1U1MA 1UFWA 1MMNA 2HLTA 3DM2B 3JSYA 4PXEA 1NKCA 4PPZA 3GG1A 1E6VB 2VDIA 3H20A 4NZ0A 2KVQE 2UVVA 3K7RA 4ZVPB 4Q8EA 3GSIA 3IBWA 2FVCA 3D1QA 2J8SA 1TAQA 1C4AA 3TOQA 3KG0A 1SJ3P 3C46A 3RW6A 3ZTPA 4OYWA 4J9UE 1XWLA 4ZCMA 2MQPA 1C0UB 2RSQA 2R2TA 2OJ3A 2N4DA 5ETPA 3F73A 3NOCA 2EPIA 3DYAB 5F0UA 2OKQA 5T7LB 1DTTB 4CLYA 2ZC4A 3HVTB 2Q1LA 4KGMA 4PG5A 4U95A 1ZOTA 4HACB 4M5KA 5F9NA 1WI6A 4M5NA 3TQ1A 2ABYA 4RU9A 1QSLA 2R8KA 1FD8A 4LF2A 1JLAB 2U2FA 3D0HE 1YSJA 2AP6A 2RKIB 3BBFA 4LUBA 1EIYB 2WHOA 3Q89A 2RRNA 3I9V9 5AXLA 2HQIA 4M8LA 4I64A 1RSCA 4C6AA 4CH7A 4Y0FA 1RT3B 1IQTA 2KVIA 4OYMA 3FQLA 3H98A 3VGUA 4KH0B 2I5JA 3W9IA 1LWFA 4HTJA 4OI1A 4UOHA 3I0SA 4Q8FA 1FO1A 1UETA 3BPSP 3LGHA 5J2NB 4ANCA 3DC2A 2B9WA 3OV7A 4DL4A 2ZBIA 5E3AA 4DV5F 2OPQA 3QFWA 1YG0A 3PW4A 1JXLA 3SSQA 2AEFA 4WZQA 1VQSA 2JLEA 4ZOSA 9RUBA 2XLKA 2P9EA 3L7OA 1S0MA 2A3JA 1Y5IB 1RUSA 1HFEL 2MLZA 4HDHA 4YN3B 3AB4B 4KGKA 5J2MA 4Y65A 3DLEA 3D6FB 4ZVQB 5E3PA 3CJKB 1TFWA 3QZ7A 2BV3A 4LVOP 1QJHA 2DIUA 4Y6IA 5KFQA 4WFNQ 1HBUA 3HJVA 2B4PA 3IM9A 1SKRA 1CQMA 4FF1A 1XK8A 1T95A 4WU2A 5F9LA 2Q6CA 2AV5A 3P45B 1RCXB 2YKQA 2E7VA 2KJVA 3PIOQ 3LW5C 4JV5J 4HHHA 4X4UA 1UL3A 3T41A 1OWXA 3DOKB 5LXRA 1TL7B 4ED8A 1MN7A 1RAIB 4JP8A 3THVA 2ZH5A 4C11A 4DOZA 2ALYB 4DG1A 5I3UA 1L3SA 1PAUB 1URRA 3A8EA 5ETTA 4DZ6A 4N7TA 4ZVTB 3HKZD 1AW0A 2DNQA 2ZVSA 3FRYA 4CLZA 5H1SV 3V4MA 2VPXB 5KFUA 2HS4A 3KUHA 4B08A 1M5PC 4ED5A 2EG2A 1U1QA 4JI6J 2KN4A 5IT4A 1F9EB 1S1XB 1YJ9S 4DR6F 2FVSA 3HD1A 1CS4B 3MD3A 1DLOB 2XI2A 3WX4A 3G6VA 1K8AT 1H98A 3TAQA 2HIQA 2X3GA 4CH0S 2FY8A 1MWQA 3W9JA 3NS5A 3FQKA 2Y1JA 1EAYC 1FE0A 2NPIA 1PC4A 2CNKB 2G2ZA 3QAEA 1N5VA 3D54A 4IH7A 4X2BA 2YXLA 3QJLA 2G2YA 1UA0A 3RBXA 2PA8D 3KFWX 1KNZA 3I96A 5C25B 1YJUA 3IWXA 2ZOFA 3F41A 3LQVA 1YI2S 1Y0HA 5DS7A 1S1WA 2IDEA 3IS9A 3GU0A 2KT5A 3R5AA 1O8BA 4PRFA 2R7XA 3CD0A 2VV5A 3UQSA 1BY9A 1YJTA 4USWA 3UD3P 4LREA 5IM0B 2DTJA 2ZOMA 5CYJA 3L09A 1NEEA 1L3KA 3GJSB 1ZS6A 3IFEA 3BGFA 2YH1A 2KFNA 2WOMB 3PW0A 1BQMA 2BE2B 4MKBA 5C25A 2KFYA 3MDFA 3ZTRA 1T8EA 2M9KA 2DGQA 3AAWB 4EO8A 2DCLA 3EM1A 3MECB 3QNWB 3H59A 3I5CA 1DQ9A 4OJ3A 1LEOA 3RBEA 2XSJA 2B5JB 3W60A 4CO2A 4KJIA 2I8EA 2KO1A 2VC1A 1HARA 3CE8A 1YGYA 1NAQA 2L9WA 4RWWA 2CJYB 1RYRA 1IBMJ 5B0EA 2VPZB 3V81B 3UN2A 3T1HJ 2E29A 4KO0A 4TU9A 3OLBA 3V6HA 2XCAA 1T03B 3CD6S 2MY8A 2IYIA 1WF1A 1I94J 5F41A 4JI0F 4JYAF 1RCOB 1TVRB 2D3UA 2C2ZB 2UUBF 4IR9A 3U1NA 3EGZA 5LSOA 4UOGA 1UMJA 2G0CA 2Y8WA 2ZBPA 5LMNJ 2ROPA 3P5TL 1VIOA 3RB3A 3H2VE 1T05A 4B3RJ 4C9DA 2G1DA 3T6JA 4RNNA 4ZIVA 5EUHA 1KQKA 1M5OC 5KG1A 1X0PA 3HK2A 2FB0A 1KLNA 2YNIA 1RBAA 4IOBA 3HSDA 1LWEB 2YQ3A 3NP5A 5ETMA 3IWNC 1FWKA 5DJBA 3CCSS 2B6AA 2C22A 3W2WB 3J80U 5C42A 3M9NB 4QYRA 5IQ6A 1KVJA 2EC0A 1NSPA 3AODA 4HLBA 4LFAJ 3THPA 1X5PA 3TP2A 1ZM2A 3WDOA 3W1YC 2DEJA 2B43A 1QUPA 4QBUA 1DTQA 2WCXA 1NDCA 4DPTA 2DR8A 4WXWA 3MEEA 2V2QA 2XHCA 3C8YA 1FTRA 1PJ5A 2UXBF 3R97A 2HHSA 1BQMB 2BE2A 2XULA 1RWKB 5HO4A 3B4MA 2DD8S 3CGIA 4LBIA 3R9LA 3BGLA 4FXVA 3UNYA 1G3OA 2CQIA 2WAQD 1OSCA 3S7RA 1H73A 4WCEQ 2DR5A 4B3SJ 3HVTA 3I87A 3MMAB 4LF1A 4CYUB 1P8GA 1TK8A 1WOPA 1FJGJ 1TFYA 3CJSA 2LQJA 2PE8A 3PCOB 4ECYA 3VTIA 2UUAJ 4MYTA 4AL7A 1RADB 1JKHB 1UJ5A 3ULHA 2BACA 4F04B 2MKIA 4NYPA 3J7Z5 3SIPB 3TO8A 1U45A 3PYFA 1GTEA 1IN0A 1NLKL 1O51A 1WD6A 1XIQA 4O4RA 4F4AA 1HMVA 2XYGB 1FK9A 5IV3A 8ATCB 4YMEA 4N5SA 4ECRA 2BE7D 2OFHX 1DAXA 1YK9A 2V69A 4DX6A 5CABA 1RTIB 1P6TA 1PJ7A 2DITA 4OZNA 2DGVA 4LF7J 1RAHB 3CXCR 1X9MA 4OHWA 4JI2F 4KV8B 4WYLA 1WORA 1ELOA 1TTHB 5T7LA 2CJKA 1HI8A 5AE1A 2JEIA 1NBEB 3IC1A 5L46A 3L9ZA 2A10A 3TJ9A 2EVZA 1Q5VA 1V3RA 3C16B 2W1BA 4BC9A 2NXJA 4YS2A 4RNFA 2OD6A 4RUCA 2XG8A 4B9UA 4OI6A 7AT1B 4A48A 2AKWB 1PKUA 3AJ1A 1KN6A 1UFLA 2YTCA 2NR0A 3Q8SB 4NLUA 2ATLA 2O66A 4ED3A 2WSEC 4WKRA 3DU6A 2CPFA 1CJUA 2J9DA 4H4KC 1U1PA 4EU0A 3D1HA 5IM0A 2KZZA 1K73T 1SIWB 4K7QA 1SVDA 2OEJA 2LXIA 3EDRB 2XTJP 2HRTA 2YKMB 3D7SB 3W2VA 3RR8A 5ETKA 1LWCA 2BRKA 3QO9A 1LXJA 1M1HA 1FX2A 2Z58B 3FCHA 4WFAQ 1Q82T 1XR5A 2XMVA 1VQ8S 2GJIA 3MCSA 2C3MA 2QC3A 3ISNC 2GQCA 2VG5A 3LP0B 4DR7J 4OQJA 1R0BG 3M2RA 4KH1B 1FJ7A 3VCDA 1VHIA 1VRUA 2YKNB 2MKYA 3RG6A 1U1OA 1FEEA 4E98A 3W9HA 1F5BA 1S9EB 4B3OA 3AOBA 3D1OA 2AYGA 3GLJA 1S97A 1PBUA 4QWBA 4CO4A 4ES2A 4DV2F 1RTDA 2DIVA 2ASJA 1LWCB 5KFRA 3W2WA 5BR8J 4Y2CA 1SXLA 2ILYA 2P6SA 5F0WA 5HQMA 3IBCB 4NMLA 2MHNA 2HZVA 1OQ6A 4HEA9 3GWCA 4P2SA 1NSQA 4JV1A 3R2DJ 5KT7A 3MR3A 1EX8A 3R8YA 2E66A 2B0GA 4DSFA 3QGPA 1UP1A 2BOAA 2VPYB 5K20B 1JMTA 2EKYA 4LRFA 3LP1B 2WONA 2D9OA 2YQ1A 1JLCB 3D28A 3ONQA 2BYCA 4XK8C 1RTZA 3FEXB 3TVKA 1NDKA 3FMWA 5KOXA 4YB1P 1VQNS 3VALA 3SYZA 4MYUA 4WFYA 2ZBRA 3H90A 3G82B 3M6WA 4Q2MA 4Q2LA 4DF4A 2ZZMA 4X62J 3UCZP 3G87A 4C8KA 1UWBB 1HYSA 3AXMA 1BD6A 4TY9A 3UI3A 1X5TA 4A4JA 1IVZA 4B17A 1CJKA 4J37A 2UVUA 2XB2D 3KLGA 2VFVA 4F0HA 4IKAA 1IWGA 2RMLA 1D9DA 3BH6B 4N77A 4AFFA 5KT4A 3DLJA 5LSRA 1Y00A 2RH3A 2QIFA 1KTVA 3G2XA 5LL6d 3CC2S 1XNRF 3QWPA 5DDRC 2I6WA 4LIWA 1VQ9S 3ZZOA 2G0JA 2ZH3A 1NK6A 2MHEA 1OY9A 1YX2A 4IO9Q 4OYIA 4ED4A 4ED1A 4NLRA 3BGRB 4WFXA 2CQCA 3E2EA 1IKWA 5C24A 4N76A 1UFKA 3PHEA 3PEHA 4LRDA 5ETOA 3R5DA 4NLTA 2J6SA 2GGPB 5FIIA 3WIVA 3DLGA 2UXDJ 1UVLA 2E5GA 4NZ6A 2HHVA 1VLYA 2RUSA 2QRRA 2V4QA 3CDWA 5JXSA 3BDEA 4P52A 5IWAF 3MURP 1NKEA 2HMIA 4O0NA 1TAUA 4QQBA 3R7BB 3PV8A 4UY85 2ZDPA 3H8YA 3EXCX 3OPKA 3M8RA 4MTPA 2J0XA 1RHRB 4NA3A 4WP9A 4U8VA 4DSKA 1D9FA 4QW8A 3ITHB 3EE3A 4L3NA 4OI4A 1KTQA 4JV0A 2M8DB 1Y3JA 3IAS9 2J8AA 3O6QA 4F4XA 3RR7A 3IO1A 2YNIB 3I6PA 3UWTA 1XC9A 4TXSA 4V19X 2GV1A 4TVAB 2FY1A 2MQNA 2XNRA 1HBNA 2F8MA 5T14A 1SV5B 4RBTA 3DYAA 2B9YA 4F4YA 4QU6A 3TUJC 2WRMA 2B56A 2DRDA 4R8UB 3E01B 4DV1F 2Z2MA 4QPTA 2HGMA 3KLVA 1LQ9A 1XTZA 1S0VA 1RWVB 4Q45A 4TQSA 2VZ9A 5KFXA 1LOUA 2UVWA 4ED6A 3J81j 2BXJA 4J7CA 1FHTA 1WEZA 4ECXA 2N3LA 3POTB 2J76E 1AZSB 1T02A 1U0HB 2AYMA 4EUVA 1VC5A 3MWBA 2G13A 4TLRA 4ED0A 1XMQF 1HBNB 2C3PA 2EFPA 2VIHA 1M1GA 3HM9A 2FHKA 1B70B 1WJ9A 1ZM3A 2BA9A 1KP6A 3L7UA 3N6NA 3SMZA 4CDIA 3RAXA 1F5CA 5F8JA 2ZOGA 1ZETA 1RKJA 2Z0GA 4JI5F 4LMZA 1SCJB 1DURA 1CG2A 1FI4A 2HNDB 2ZH8A 1NDLA 2GVZA 3EVWA 1H7XA 3EZOA 4ETXA 2B4UA 2JFKA 3B82A 5J2MB 1UA1A 1N34J 4WK3A 2BZ2A 3WC2A 3BN7A 5L1JA 4LF6J 2H51B 3CTRA 3FBCA 4P6QA 5DZ7A 3SCLE 2W24A 3MM5B 1WI8A 2FHMA 3C15B 1OMSA 4FKXA 2XMAA 4LF5F 4ZVFA 2APOA 2HNYB 3MM6B 3NLCA 3V4IB 2MKSA 3PZPA 5IQQA 2CQ0A 4FPIA 4V1Ak 2RU3A 4DV0J 4E0DA 3ITHA 3MEDB 4K5SA 1IKYA 4Y2IA 2HGLA 2RB7A 1SUQB 1YDLA 2K06A 1YQHA 2GZOA 3VVUA 4DX8H 4X65J 2IDLA 2BJ9A 1VC6A 2R7RA 1UEUA 2AZ3A 3MXHP 4YHHJ 3ISZA 3ILOA 3NCRA 3J7YI 5KFMA 4O3NA 3RRHA 3Q2TC 5H9EJ 4B3SF 4K4WA 3DXBA 3UCGA 4ELTA 4BBYA 2X3DA 4X64J 2JSXA 4PWUA 5J2PB 1X4DA 2V67A 1XNQJ 1L3UA 3NAIA 3V4IA 4LFCF 2EK1A 2R9LA 1FRKA 5EX0A 2BANA 3MM8A 4CP5A 4B3MF 2HNZB 2HQFA 4DDFA 5DQGA 3H4BA 2V6AA 4ECVA 3AD8C 3MAAB 5HMZA 2RIJA 1RT5B 4X84A 3W61A 1VBYA 2R8GA 1C0UA 4ZJOA 4NXNJ 5KG2A 1T9YA 2VG6B 4ZS6A 1RISA 3H5SA 4KC5A 2Y8YA 5K8MA 3THTA 1HPZA 2HSEB 1Z1ZA 4RW8B 1D1UA 5G0RB 5KT2A 5AXNA 4LF7F 2FC8A 1MMDA 5EWEA 2KRRA 1U49A 2XO6A 4EGLA 4O3QA 1RT1B 1UW9A 3E51A 4DX7A 3BGUA 2FLPA 3SQOP 4FBTA 2NREA 2FYXA 3R6GB 5KFIA 2BX6A 1UCNA 4K59A 1X0FA 3ISND 4H54A 3P49B 2Z30B 3R2CJ 1DQ8A 1YKWA 1RHUB 3CCZA 3TA0A 1AZSA 1U0HA 2W7OA 2LEAA 2W25A 3CEDA 2WVFA 5D4NA 1FXDA 3HF5A 3JQMA 5IT0A 2N4CA 3MECA 5DDOC 3BO3A 4A8SA 4K4TA 4Q44A 3RTVA 1K9MT 1M0SA 3D3CJ 1IR2A 2DGUA 2QLBB 4G65A 2WOMA 4QZVB 5KAKA 2X1AA 3M2VB 3IN5A 4LF9J 3BM7A 4ZVEA 2Q3PA 1NK9A 2CNNB 3FK4A 4ELUA 1M5VC 2GVDA 2IAJA 2CG8A 4PG8A 1I3OB 2BBEA 1FRXA 2VBYA 4R0EA 4RW6B 1CJTB 4C8OA 1YBAA 2HNYA 3I5AA 3MM6A 4N8OA 3TZYA 3KWMA 4BC7A 4NLQA 5B0CA 2GIQA 2G4BA 1AYEA 2OELA 2JLFA 2P9GA 2HS3A 2MMYA 3CW2C 4BS2A 2XS2A 3RRGA 2LLZA 2X1FA 1KVIA 4AE5A 2E7XA 1OY8A 5DETA 4XO0A 1R31A 3TUPA 4CO0A 1G1XA 5FD1A 3HVWA 3LWMA 3T9NA 4KRWA 3DOLA 4RW7B 4FDFA 3CD5A 4U96A 2KI2A 4CIOA 2R7SA 1S57A 1NZAA 3EMTA 3LP2A 3MPYA 3HHEA 4AT1B 1N6QA 5E5NA 1XMBA 2L08A 4MKVA 4NASA 3CB4A 1SJRA 1NMEB 5K8OA 2V94A 3PG9A 2R8JA 2GGPA 4WIIA 5A8KB 2AWZA 2ZZTA 3HFZB 3ELHA 2OD4A 4FS1A 1UWAA 1S6UA 5CYQA 1RACB 3CIMA 3NGRA 4DG1B 3ETOA 5I3UB 1G7CB 5HP1B 3TQEA 2YNFA 4OHVA 1NH7A 8AT1B 4YR0A 4DL3A 2PI4A 3FEYB 1TL7A 4X66J 3TANA 4YY3F 4F0MA 1VC0A 2FTRA 3HHNB 1WHYA 2YWEA 1Y4ZB 4YB7A 4J9SA 2XZWA 2P2CB 3MEKA 3MMCA 4LQ9A 3R3TA 1U24A 2MKCA 2ZZNA 3CJTA 2VKRA 3J81U 1XNQF 3RAMA 4GKKF 1RWWB 3CJ3A 3M30B 3KLFB 3G6XA 1Q53A 4EMDA 4JI7J 2R2UA 4I2QA 5DG9A 2KTQA 1NH8A 3MR7A 2EBGA 2BW7A 2E5LF 1N5TA 3KK1B 2ZE2B 3B8HA 1ZAXA 5HVGA 3GIRA 4OZ2A 4ZITA 4K4XA 2HHTA 4WYWA 2RQ4A 2YX7A 4CQ1A 1RQ0A 3K89A 2P9CA 3CMQA 2QO3A 4H4MA 2E7WA 2XS7A 2PEBA 2PGCA 2PSZA 2UUTA 4CWBA 2MQOA 2FPHX 5HMWA 5D3GB 3BSAA 2I2YA 3CC4S 4JI3F 3QRQA 2A2CA 2OMOA 2IYGA 2NYIA 2J6UA 3BQ1A 3GIMA 2VL1A 5HN0A 3QSIA 1JLFA 3NKYA 3ET6A 2HHHJ 2BUNA 5GAGU 5EDWA 3NBPA 2BR0A 1S10A 2J9DE 1IKVA 1X4FA 3G71S 2GQ2A 2MQMA 4LRAA 3ZC4A 4ECUA 4KGXB 1N32J 3DGPB 4ID5B 5IXUA 2N3OA 2ZUAA 4QIVA 3P5BP 4CNZA 1C0TB 3L4BC 5L8RC 4KO0B 4MKAA 2BW2A 2GIFA 3QIPB 4JB8B 3MCMA 5E3QA 2DNZA 1UWBA 1Z4UA 1Q7LB 4G6VB 1TV6A 2CNOB 4AXJA 1FNXH 4QWEA 3OUYA 1X4HA 2LEPA 1A7GE 1B0VA 1EKRA 1X4EA 2XY7A 3GR0A 1V6HA 3EUNA 2L48A 5B0FA 2XLIA 3IBFB 3KK2B 2UU9F 3U1LA 2RD5C 4FYVB 3IGNA 3M2UB 3EVMA 1QE1B 2HFUA 4U6PA 1B0PA 3L3CA 4F3OA 3QATA 1NB7A 1KWMA 1HWLA 4NLDA 3GJRB 2KG1A 3N6MA 5HJYA 4JI8J 3AHPA 1T9VA 4Q0BB 1FDNA 1UEKA 2WZ1A 3OVBA 2DHGA 4HTIA 3K57A 4NA1A 4U7UK 5F8HA 1RK8A 4IFVA 2XM3A 1YRUA 2C2DA 4A8WA 2ASYA 4YR3A 3QJJA 3T5KA 1F3FA 2OH2A 2KM8B 2FJAB 4TLQA 3MMJA 1S1WB 2A6MA 3GB0A 3IS9B 3NGKA 1M90T 2MY7A 2W01A 4MKYA 2QA1A 4JI1F 5A6WA 1KVKA 3K5MA 1FE4A 1FEHA 1FRLA 4DR7F 1FVSA 4KHMA 5D8HB 1MSWD 4P73A 1SB6A 2DXDA 2HWIA 3IR6B 3JAMU 2CPJA 3ZO7A 1Q5YA 5DLFA 2A1BA 3OFEA 1HNWJ 1RAGB 4ENOA 4G1QA 2MZQA 3DGVA 1U25A 4PQUA 2KT3A 2IMOA 2OSRA 3M8ZA 3MMAA 4ES1A 2DNLA 1EARA 3CCRS 2GVDB 2IAJB 4M5GA 4BWJA 2MSSA 1G4CA 1S48A 3VWSA 1RAJA 4N8NA 1L3VA 4X65F 5JVGQ 4ZPBA 5DG7A 1SPBP 2YNFB 4USTA 1VISA 1W25A 2HVHA 3KMSA 5CH7B 3SQGB 1RT6B 3SCIE 2IC3B 2XSFA 3C6UA 3WX8A 4DV1J 1S0OA 1I5OB 1A6LA 4DBQA 2OPPA 1SKWA 2MQQA 1JQGA 4A8KA 3WC0A 2EFOA 2CA9A 2FZCB 4J91A 3TUIC 2LP4A 2YWWA 2AX0A 1N5YB 2ZWOA 3CCES 1G6BA 4EBCA 5HVHA 2PO4A 1I6JA 4ZLLA 2A2DA 5HROA 4YR2A 1S77D 4NI2B 3NMAA 1YJNS 3BR8A 4GKJF 1OQ3A 3D67A 4F8RA 1AT1B 3G82A 4L76A 4CLKA 1S6QB 1YZ6A 3UCUP 1WG1A 1XJWB 4C0OC 2DNYA 3A3NB 2E9TA 1RI7A 3H25A 3W65A 2E5IA 3G86A 5LOQA 1BQNA 2HK2A 4ZVRB 3M4XA 4IR1A 1JXEA 4CH1A 2KDOA 2V8GA 3OUYB 2V9WA 1RHMB 2OUGA 4F26A 3NL0A 4NI2A 3KTQA 4K4ZA 5SZTA 3JTNA 1T03A 2Y3YA 2HAFA 3KK3B 1Z2ZA 4KE5A 1HQUA 1HI0P 5B09A 4LF5J 4ZPCA 1FJCA 2H4WB 5HQLA 2MB0B 3DCAA 3FBEA 3V2UC 3GCXP 3KLHA 3NNHA 1VMBA 4FXDA 1HNXF 2L9DA 4AYBD 1IKVB 5ITHA 1TL4A 4HH0A 1S9EA 2QTWA 3TJ8A 2QMWA 3GV5B 1K44A 2V4JA 2W4CA 1SUQA 4ANDA 4E2FB 2D7SA 2OTLS 1CBKA 1WHVA 2H5IB 5EX3A 2NLWA 2RNEA 3QGHA 3TEHB 5LMUJ 4FF4A 4RO0A 1B64A 4XIUA 3HHLC 1JLAA 1LW2A 2B3TB 4AL6A 5D77A 1YRTA 2FHJD 4ZKAA 2JH3A 1U7LA 4IFYB 4OV1A 3W5ZA 4IH6A 4I6YA 3BSNA 2DY9A 4CLPA 3KLIA 3PACA 5MAOA 1IBKF 4E8UA 3VF0B 4KSEB 2HVIA 4Y3CA 1IJFB 2BKOA 2KYZA 2YY3A 4DCJB 1VRQC 4MK9A 5LXYA 4PCQA 1SI9A 5KFYA 2QFIA 4EFAC 3O5TB 2OO4A 1DRZA 1KKHA 3H5YA 1KHVA 4P7TA 3V6DB 1W2IA 2RHQB 4QJVA 1NNDA 5EWFA 2E9RX 1B7FA 1QTNB 4JI6F 1QAIA 3K17A 3O3LA 3R5JB 4I7FA 3OXFA 1NKBA 1REVB 5F8IA 1FFSB 3CJ4A 4J9LA 3HLUA 3SFUA 2R2SA 3G8SA 4RUBA 1WSVA 3QT7A 1U2RA 3MM9B 2UZAA 5HK4A 4ANEA 3CJRA 4OHZA 1J27A 4HHUA 4PXBA 1HBOA 3PYDA 5BYRA 3HKWA 3PR5B 4P2XA 2PIIA 2CQGA 1S6OA 2C2NA 2D41A 2X1BA 4URQU 2M7SA 1NUEA 3EDQB 1QD1A 3UN3A 5CCLA 5F3ZA 3MUTP 1R27B 3G4SS 1WACA 2XY5A 5A8KA 3EPGA 1CJTA 1MWYA 4J9VA 4TYBA 3QIPA 4B3OB 2VA2A 5EN1A 4ZCLA 1RTDB 3G6YA 3DRSA 4NYZA 2LU1A 1ZM9A 3I5BA 4Y34A 2P8IA 4M5DB 2AX1A 1W2BR 4UZBA 1Y7PA 3KMQA 3GIJA 5GAHU 2DCUB 2XMKA 3OQ2A 4NOHA 2GMLA 4DV4J 1WTBA 3MHYA 1N8RT 2AYBA 5CD4A 3JSMA 4B9MA 2FJDB 1X5SA 3PYGA 4M5MA 5SUHA 1E6YB 3CDUA 4URGA 5KFFA 4DWIA 2D1CA 3F0NA 3PJWA 3O44A 5DO2A 1RA6A 3LPYA 5C2GA 5GADU 2MKHA 2YKMA 3W2VB 4U67Q 3VAFA 1H38A 1JJHA 4KHRA 1RT1A 4NLOA 9ATCB 1QVFR 1RT4B 4OMFG 3JTOA 3AJDA 4PQAA 2OPQB 3UO0A 4Q5VA 2C28A 1Q86T 1HNIA 2FVRA 1D9AA 2HZAA 4DUYF 1RTJA 2DGWA 4Q0BA 1J5EJ 1FRIA 5K14A 1I94F 5KFGA 4DUZJ 1RE1B 1PBAA 2ROEA 1BQNB 2WK4A 3WQPA 1D8YA 2FJWA 2F65A 4JI0J 4JYAJ 2XS5A 1TUVA 5BJRA 4EEYA 2BJ3A 1VFJA 1RJJA 1N56A 1FKAF 3LAKA 3ILJA 4YQWA 4DCOB 2F8HA 2HNZA 1HHTP 5FLXU 1CLFA 1MROA 2JHEA 4I7FB 1S7HA 1DJ0A 2R42A 1G2EA 3B78A 4KV8A 4BHQA 4X66F 2VG7B 4Y28C 2ZHAA 4HYKA 2RVJA 2QL5B 2E9ZA 2M3DA 3CVKA 4FPRA 1RTIA 1JWWA 5E33A 4A8MP 2DR7A 1RT2B 2BKNA 4Q7AA 5G0RA 4LR7A 4O3RA 3DMJB 1GK8A 1RHKB 1RHJB 3N28A 4OIXA 4BLGA 2BJ7A 2FZKB 4ZPDA 2KG0A 3HULA 2COLA 1VQMS 5AJ3F 4C3LA 1RT6A 4WK1A 2L9NA 3HI9A 2E5LJ 2XGQA 2GAGC 2XMTA 2DVIA 1RAAB 3KLEB 3J7A1 2Y0BB 4Q43A 1VQPS 2F3JA 2GAHC 5E3RA 3JB9k 2W2PP 2IA6A 2BDPA 3GYNA 1VQYA 3UN5A 1TKXA 1JLBB 4W90B 1RLDA 1T0TV 3D6MB 4PYDA 5GVQA 2MQLA 4JI1J 1C1BB 3GYGA 5ADZA 2UXCJ 5J2NA 3R1LA 2EBEA 3PW7A 3LWLA 4QCLA 3MCNA 1KFSA 3TARA 3N01A 2YWFA 3UDVA 3K2YA 4KY3A 4CNYA 3I55S 3H40A 1AUDA 2J6TA 4F4ZA 1RBOB 3K58A 2J5AA 2O5DA 3PIPQ 4DR3F 1PO6A 3K5LA 3TUZC 1VBZA 3TWZA 4OYZA 1FF2A 2RAQA 2YWKA 3UD5A 3BQ0A 1FJEB 4IH5A 2R7VA 5IOLA 3KK3A 5LM7E 5I42A 4C8LA 3BGOP 2CADA 1NHKL 2HKEA 3MZIA 4ZK7M 3PX6A 1JLQB 2AW0A 1JK9B 2R2RA 1IBCB 1MMLA 4ZVOB 1NK5A 2AJQA 2QEXS 4B3RF 1SC4B 1VGYA 2M2BA 1HBOB 3G8QA 3GMGA 1X5OA 3KNGA 4L73A 3R7SB 3GIKA 1FWLA 3VGSA 3U7JA 1QM9A 2DY1A 4C8MA 4ZN3A 1TUWA 4AQYF 4PUOB 2AHOB 2JOQA 4LSLA 1SQEA 2HNDA 1SJ4P 2DGOA 2U1AA 4ERDA 3DOKA 1HNIB 3M8YA 2GFFA 5M2PA 4K4VA 3KJQB 4HDGA 5D78A 2NXNA 1S4FA 4I2PB 4PKDB 3QLHB 2ZC3A 4O4GB 1NSAA 3I9ZA 1VS3A 3FUYA 2M8HA 1B7YB 4NYOA 1VQ6S 3OR1B 1KQFB 1GEHA 1ROFA 1SC6A 3OXLA 3TA1A 1EHWA 4MIBA 3CO9A 3KDNA 1FXLA 1TR0A 1VBKA 3IG1A 4GO5X 4KPYA 1PAEX 1HMVB 2HVDA 1K0TA 3GV7B 4KGVB 4HH1A 3E8OA 4ZP7A 2QV6A 5C2CA 5HL7Q 4ECWA 3MF5A 2J9CA 2NXUA 4ATNA 1U47A 4FN5A 4ILMA 5JJBA 4P10A 2PA3A 3KLIB 1LV5A 2A18A 3BN4A 4O3OA 4Y2MA 2VQEJ 2ILZA 2JVOA 1LW0B 4JBCA 2BQUA 1WWHA 2LCWA 4ZLPA 5KFWA 1S99A 4RW6A 2DHHA 1DHMA 2CRLA 1R0CB 1IR0A 2HLUA 3GCWP 2VASA 1T11A 3BGRA 1CJUB 3FZ2A 4NRUA 4ZP9A 2RQKA 1NJYA 5CA5A 4DS5A 1JJ4A 3T3FA 5K8NA 4ALZA 1X4AA 3AQPA 1F2HA 1YBTA 1FDBA 1GMUA 4DN9A 1ACMB 4M5IA 3MM9A 3OL8A 3G96A 2ZNZA 2PI5A 2ZE2A 3VZHA 1V5VA 3M32B 4DR4F 5RUBA 3U1MA 2UVRA 1N33F 4WTYA 1WHXA 5J1EB 3TX8A 1IKYB 1VQOS 1KQGB 3Q83A 4PAAA 4CZCA 3PRDA 3R1HA 3D9BA 2MEWA 3R7NB 1EZZB 1CPZA 3M8WA 2C2OB 4HR2A 1W26A 4W4MA 3ZZZA 3HHLA 1S72S 1IBKJ 4K0KJ 1KD1T 1LW0A 1Q0NA 1DY3A 4NCGA 4N41A 4ZPVR 4JI4J 1IR1A 2W9CB 3DLLQ 3ENQA 3PY8A 4TY8B 3NS7B 1KEKA 4A47A 5K8PA 3KDOA 2CPEA 2L41A 1J2VA 1UJ6A 2OPSA 2CPXA 2HPUA 2JWNA 4PG7A 2FD2A 3VAJA 1Q8LA 2NXEA 1AFJA 2ZVIA 4CO1A 1HI1A 4P7VA 4Y2KA 1Q78A 3D3BJ 3RB0A 2LU2A 2QMUB 4O3SA 1UVNA 3HT0A 2LVWA 3TJAA 4ICLB 3LO3A 1HWIA 4JV5F 4O4GA 1IWAA 3SDEB 3MMBB 3H5UA 3IRWP 4GRSA 1NPKA 2LMIA 3RGIA 3M8PB 4GC7A 3RB6A 1TK0A 3MEGA 2B5JA 1TKTA 4CLLA 3M6VA 5FJ4A 4OYXA 1J5OA 3VGVA 2Y1LB 4U7UD 4K4UA 3C6UB 4UT4A 2QL9B 3ZXWA 4I0WA 4LF6F 4UF4A 4M5DA 2M5YA 2V8DA 3DHWC 4IG0B 3K8VA 4EO6A 2HWHA 2UP1A 3EGVA 2V0NA 2QA2A 5I3PA 4DFPA 1YJRA 1KFDA 1H7WA 2HVZA 2I38A 1RDRA 2CPIA 3DRPA 3A8IA 5THWA 3RUBL 3DLHA 3ZTOA 3BSOA 5KFHA 2VQFF 2QX0A 2IRUA 3HHDA 3P8BB 3LA0A 1SJ1A 4DL6A 3ILIA 4IG0A 4WBFA 4K2XA 5ETRA 3IAM9 4UTGA 1UVKA 2IHR1 3FSXA 5AE3A 2JDJA 1N5QA 3D2WA 2DYAA 4A8FA 4NCAA 2HMIB 1IUJA 4EWTA 3DU5A 3HJFA 5E3CA 1V3SA 1FWPA 3TR5A 2FDNA 3OR1A 1KHWA 3GJTB 1XMQJ 4GVLA 3T1AA 2VA3A 2OEMA 1OJ4A 2P6TA 4DUYJ 2LA4A 2EFNA 4CCHA 2V2KA 4KAIA 1URNA 2R7QA 4ZDNA 4NLWA 3S1TA 1S79A 4F3MA 5EGYA 2RDJA 4JI5J 4CM0A 4CLTA 3PJ9A 4NWBA 4M63A 3B4DA 2AJ4A 4ZA1A 3PVXA 4KHPJ 2W4PA 1Q8KA 2DNRA 4RJVA 1HQ2A 3PM9A 3SV3A 1QSYA 1HW9A 4B9NA 2DRAA 4DPXA 2W7PA 2GJFA 3IXQA 3NNAA 3A12A 2XC9A 4CYUA 2HBRB 1F3VA 1IBMF 3BH7B 2HWTA 2E1MC 1U1NA 4YDXA 2DHXA 4LVNP 2JJ4D 5G4DA 4IRKA 1F9FA 1EB0A 2CQ2A 2E1AA 2QLJB 4WJBA 1RT7B 4XPEA 4ID5A 2AU0A 4QYZK 2DH8A 3VHQA 4DZDA 1FRMA 3JYTB 5AJ3J 2DEIA 3DOLB 4C98A 4DUTA 3I4HX 4ZVHA 5A8WB 2DJWA 2ZHOA 2IM3A 3S01A 2QGFB 1JLGB 2VBWA 5U47A 1HNZF 4IYQA 5B0GA 1Q1KA 2HFNA 3LH2S 1RAOA 1PYOB 1HBMB 3HSZA 1CVJA 4W98A 3G8TA 3K5NA 4J5OA 3MEDA 1WNEA 1S1VA 2AZ1A 2KXFA 3T9ZA 1SC3B 2FVPA 2IRXA 3GG0A 1VQLS 5HLFA 2F9DA 1HR0J 4X64F 4DR1F 5C24B 2RT3A 1RYSA 1KONA 2Z4PA 4DL5A 4UQGA 3C15A 4ZLJA 2O67A 3ETMA 2RRBA 3W63A 3LOUA 1V3ZA 2EFGA 3A13A 1WKJA 3NWGA 4OI2A 1IKXB 5D0GA 4B3MJ 4KIAA 3EVOA 3OJSA 2CFXA 4C11B 2RDDA 1RT3A 1NK7A 4NXNF 4KFBA 4G1PA 1VJWA 2IRYA 3KG1A 1TVRA 1YJ7A 2B4OA 3LF0A 2F1FA 1KLMA 3GTYX 4V19J 4RBUA 1NK4A 3QAUA 1S5ZA 4K4SA 1ZA2B 3UDEA 1KBRA 4WIQA 1FKPB 3ZFVA 3D4JA 4C3MA 2VU5A 3R5GA 4RUHA 3KLGB 2ZM6F 5B0BA 2C2EA 4PWDA 1VJQA 3C19A 3KHRA 2MJNA 4IQXA 1HYSB 5HMYA 2IJRA 3VAGA 4OZ3A 4I2PA 2LECA 4USHA 1ZYQA 4KGZB 1DFDA 2YNGA 2VBXA 4RW8A 2CQDA 2QYCA 3LPEA 2GS8A 3DFEA 1MWZA 3FEZA 2YWGA 2V9KA 2D74B 4ZJLA 3CCUS 3LGMA 4TY8A 1SL0A 1IKXA 1AFIA 1FTCA 2EKNA 4OYOA 4CT9A 2GX8A 4AXIA 2EFVA 1RXOB 1CJVB 1RZMA 4RX6A 3TRGA 1D09B 4U7CA 2JLGA 3N4WA 2XWYA 1BXNA 3I31A 4WXOA 2OI2A 3BYPA 3UE2A 1VCTA 4CRJA 2RRAA 4EZ6A 1V5IB 3NY0A 4HI1A 2WW8A 2DKOB 3GZ7A 4KR0B 4ZVUB 1GXTA 4HVZA 2ZD1A 4TU7A 4KKOA 2GO9A 2XSJB 1SIZA 1K47A 3DXSX 5KG6A 3MAQA 2D69A 1S9GA 5IV4A 1IJEB 2J0QD 1SQGA 3DHXA 2XWXA 2JC1A 2CQPA 3M8QB 5KG0A 5KFEA 2H9ZA 3M7VA 1LK5A 2HEKA 3AY0A 2UUWA 5KFKA 1HW8A 3DRSB 4XTTA 3P6YC 3QT5A 1OPIA 1R8PA 3N79A 3RBZA 3NMRA 1EKSA 2YNHA 4QR2A 3GP9A 2CJ9A 4RBVA 1GMWD 2V50A 3DDIA 3K0JA 3MM5A 1MU2B 1T94A 4M1KA 3PW5A 1XMOF 2HHWA 3FGVA 5DZ6A 3UDCA 4I68A 4CO5A 4NRTA 5D0HA 5BYQA 1R8BA 2VB6A 3C2PA 1YHQS 4AUKA 5ETNA 4MT1A 1S6PB 5DQIA 1ZAWA 1GAOA 3CD7A 3LGNA 3MPUB 5JVHQ 4Z37A 2JEFA 2AMCB 5HATA 1S9GB 1XEZA 2JL9A 4M5JA 1U4BA 3E3XA 2VPWB 5BR8F 2RF2B 1XR6A 5C42B 3SV4A 4K0KF 5H9FK 3OVSA 1RTHB 2HFZA 1KR4A 1P1LA 3BZQA 3QLHA 1FKOB 5CZXA 3W5YA 3O2IA 5D6GA 1N0UA 3EGNA 3UPFA 2RQCA 1UPPA 2CZ4A 2ZUGA 3JQKA 2W8KA 4B3TJ 1CJVA 4RLEA 1H2UX 4R5PA 1RWOB 4JI7F 1KLMB 2XEXA 1N36F 1U48A 1HPZB 2MJUA 1OYDA 2AJFE 4IO1A 2MZTA 2HHXA 1F2GA 3HZEA 2MLXA 1AXQA 3KG4A 3O1LA 1M1KT 1Y10A 3LP1A 3MAAA 4F0KA 2AQ4A 3QGGA 2XZDB 1SV5A 4YUDA 3EX7B 3DRRB 4ER8A 2D3OR 3GIIA 4A8XA 2JEJA 2AYEA 2BEFA 3EGWB 4WKYA 2OFGX 5I42B 4NLGA 2VONA 4ZJQA 3QRPA 2DNGA 2VQEF 2HRYA 1U6BA 1SKSA 1WKLA 1FKOA 4WZMA 1LW2B 2G9OA 1PIEA 2CIMA 4FVCA 1X4CA 1RWNB 2CXEA 2OPRA 2HFSA 3CDEA 1XR7A 1GMVA 4JV2A 4WU3A 1EETA 1MG7A 1BWEA 2CQ4A 3DLEB 4P9SA 2IFXA 4QR0A 2DR6A 1PG5B 1RKIA 1CQNA 4XDCA 1VDHA 4A8YA 3KOAA 4KBIA 2X51A 2KXHA 3MPVA 5AXKA 2V2ZA 3DI6B 5A0YB 2R7WA 2V4RA 2ZJRQ 3AB2B 4WFZA 3KLHB 2KU7A 1C1BA 4OZLA 1S1TA 3MTJA 2IY5B 3KLFA 2ACYA 1JNZB 1MU2A 2GHWA 3NGTA 4ICLA 3AQOA 4PEOA 5E0OA 1LWEA 5IZHA 1VK3A 2VICA 1QLNA 2UXDF 5HBMB 2ZWPA 5KG5A 4N47A 2RILA 2X1GA 4XAKA 3R27A 3GSDA 3NAHA 5KFOA 2E1PA 2K3KA 5DM7Q 2RE1A 1X9WA 2CWKA 2ZJPQ 3X1LB 3OTBA 4FKYA 4ILLA 3GJQB 2BM0A 3PNIA 3R5CA 5ETSA 1RT5A 1R7IA 3JQJA 4FZVA 4OZJA 1S4EA 2YWHA 2VHGA 4DPYA 1UJ4A 2M52A 2OP5A 4WWSA 3US5A 2YVSA 4JI8F 1Q8IA 5LSLA 4XDDA 1JLEB 2QL7B 3DOMB 1KOOA 5BYSA 2ZJQQ 2FJVA 1CS4A 2BM1A 1VI7A 1TK5A 1TQLA 2FVQA 1S1XA 5KFAA 4I4BA 2IM0A 2OGUA 1KQSR 5HVFA 4IFVB 4C0BA 4B9LA 4C8NA 4DS4A 4ZCKA 1SKUB 2ZFHA 3M9OB 4KPCA 3NGUA 5KG7A 4H4OB 4KHPF 2WB1D 2XGPA 2PEHA 1GQEA 3W8PA 3TA2A 2MKJA 4LJMA 4W92B 4O23A 3NS6A 1JB0C 1UAWA 1RTJB 3P96A 4MH8A 4R8UA 1JX4A 1TKZB 2K7KA 2POKA 1SBRA 1RT4A 1PCAA 2SXLA 3C6TB 3CWJA 2N82B 3W8GA 4DPUA 2BOPA 2HHQA 2C3UA 3IR5B 1NCLA 2NXCA 4G1QB 4WPAA 2M70A 5KFJA 4IUFA 1OY6A 2AGOA 4NX9A 1T9WA 1BUXA 2ZKTA 3OTEA 1YVFA 3RRKA 1HQEA 2CJXB 2YKNA 2BJ8A 2IM2A 1K1QA 3PXGa 1FESA 1HWUA 5LJ5Y 3OT9A 1C1CA 5J1PA 3D6HB 5HAOA 1FERA 1U2CA 4IRDA 4OI0A 1R6YA 3ADAC 1WDTA 2IBKA 2EI5A 1ZPWX 2DNOA 3TX0A 2RS8A 1Y3KA 1NRKA 2MLYA 3V6KA 2ZITA 3CCTA 1CC7A 3ZTQA 3C6TA 1FNMA 4P72A 5GMEA 2ALZA 1SL1A 3OL9A 3N6LA 1N88A 2I1RA 4IOCQ 2CPHA 4H4MB 1KSPA 2HQDA 2KHCA 2VFTA 4AD6A 2ERRA 2F4VJ 3OSPA 2VBZA 2DK2A 3ZZ0A 4UY8T 2D3O1 1A0OB 4PYAA 2XYHB 3FBBA 3VVTA 2OLWA 5L1IA 2VD3A 2GHPA 2DH9A 1NJZA 4LSNB 2EXUA 2FZGB 4MAKA 2UV8A 2ZBCA 5AT1B 1R3NA 3FSYA 5H9EK 1APSA 1RHQB 2CG4A 2DT9A 1OPZA 2QMXA 4MFBA 5MLCV 1RT7A 3DNCA 1ZZNA 1FX4A 1NK8A 1CJKB 1RAEB 3CJ0A 4CTAA 4P74A 3DOMA 5J2PA 1NJIT 4LFCJ 2KHDA 4MMOA 4A8OA 3CMAS 4ZP8A 2Q66A 3IR7B 1RTHA 4QR1A 1DTTA 3BJYA 3AFGA 3QT8A 4ED7A 1NSKL 2HRUA 3OW2R 2VH7A 1WTFA 4FS2A 2XMJA 1GT8A 2OPPB 1JLCA 4K4YA 4F2RA 1S6PA 2VJUA 4NPOA 3T5JA 2UXBJ 4WTOB 1LFWA 2GJ2A 4PG6A 3U27A 5KFNA 3GV8B 1N48A 2PD1A 3SXLA 1HNZJ 3SCJE 1O6XA 3ZTSA 5LJ3Y 1YRXA 4QOTA 5AXMA 2KJWA 2EG1A 6FDRA 3Q23A 1VOMA 3GILA 2NCKL 3QZ8A 1NHVA 5L39A 2XQCA 3BO2A 1FDDA 1LNQA 5GADI 1UVIA 2W2NP 2AEMA 3PX4A 3HSGA 5KFCA 2ZH6A 4DR1J 5CHCB 3NNCA 2BQRA 1D3WA 4HI2A 2Z57B 1VK8A 2DXEA 2HS0A 4LF4F 2NS1B 3MGJA 2PFFB 1PILA 2Y1RI 2R4FA 2LEBA 4FYXB 2BVZA 2AJ1A 2MGZB 4B9TA 1ITPA 4F7VA 2CJQA 3ZZYA 3PKYA 2RUGA 3WIUA 4C48A 2DGTA 1R0AB 1L3TA 1WKKA 2FQQB 3BYRA 2YKAA 1F6TA 2CUYA 3M30A 3AXKA 3QO9B 1ZPVA 3AT1B 4MIAA 4RW9B 1H6KX 2H4YB 3BQ2A 3CF5Q 4FF3A 2NUHA 2ZM6J 2W4DA 1CEZA 4DQQA 4M95A 3OL6A 3F56A 2XHWA 4M5HA 3QT6A 2BQ3A 1NZ8A 4DR5J 1SL2A 2HURA 3HZGA 3P4UB 3MAHA 2K1RB 3B6BA 2B8PA 3D0GE 3IM8A 3PYEA 4UZCA 3D0IE 1ZTWA 1GXUA 4LQ3A 3GR1A 3QMQA 4Z2XA 5F8LA 2CKWA 2QG9B 1N33J 4OLOA 2JVRA 2J7KA 4DR2F 2A6OA 1CC8A 4DV6J 4LBHA 2ADCA 1SH3A 1X4GA 3QYYA 3SDEA 4B3TF 4RW9A 3H7HB 3QJPA 1TMMA 3N9UC 1JLEA 3GFHA 4KB7A 3EPIA 3AOAA 3V6DA 3MOZA 1JJ2R 4F4KA 2Y9HA 3JTPA 3LP2B 5D0EA 1FD2A 1RWXB 3DGPA 1C1CB 2EC2A 1VRTB 4DPOA 2PMZD 2YPYA 1HQEB 2CAJA 1JNRB 2FGCA 3IMQJ 3I56S 3CCLS 1JLFB 2RS2A 3I4PA 1QY7A 5IT9Y 3S8SA 2E5HA 3FJ2A 4ZMMA 3MM7A 4IRCA 5HI7A 2HK3A 3Q8PB 2BANB 3MM8B 2WB4A 1XERA 3BB5A 1AUSL 2C2KB 2F7VA 3M6UA 3QPIA 4KT0C 2XYPB 1R8CA 3BS9A 1O5JA 3HX9A 4OZ5A 4ECTA 3LTOA 1VQ7S 2RJZA 2XO7A 1X60A 2V63A 1WEYA 3S6EA 3UFCX 5I4MA 5FLXY 3VAKA 3V6JA 3MFHA 3OR2A 2XMUA 2QFJA 2ZHBA 4DSEA 4USMA 1TU0B 1XMOJ 3FCWA 4UW2A 2J7UA 5A6PA 2BABA 4DUZF 1K0VA 5KOWA 3HSJA 4R0JA 1XN9A 2YX4A 4IG3A 5HSPA 1B3TA 1LKZA 3JSBA 1H3DA 5FDLA 2CJBA 3HMJG 1BLUA 2XNQA 3SBMA 3W5XA 2MXYA 4OYAA 1REVA 2ZH1A 1S0NA 1D0EA 4DQIA 2RKIA 4X4VA 4J9PA 2JFDA 1WC5A 1WC3A 4DCPB 5KG4A 3CCWA 1I51B 1QAYA 3DN9A 3EWGA 4QYZJ 3TYTA 1TELA 5D0RA 2YQ0A 4ZPAA 4JI3J 1VQ5S 1MW7A 1GNKA 2LDIA 5IFMA 1EP4B 3D5MA 3BREA 4Y00A 3H2LA 1N52B 5CQGA 1PGZA 2HHHF 1T3OA 1S76D 2QLWA 1WG4A 2ROGA 1JKHA 1R8AA 4TQRA 1XNRJ 1SC1B 1EJ7L 2CQ3A 3DMJA 4CM2A 2LFVA 3C14B 5K14B 3KNAA 1P1TA 4LFBF 2FJXA 4DSIA 2DNHA 3RU0A 1UVJA 2HQGA 2M0GB 2FJBB 1MNEA 1S7IA 2VC0A 3TZWA 3FSIA 4C0HA 2G0IA 4OZ0A 5KFLA 3PTWA 3MUMP 3OXGA 2KXNB 3EYZA 3M1VB 3U02A 2W9AA 4DSJA 2WVEA 1HKAA 1MROB 2J7WA 1SJQA 1VQ4S 1OO0B 2MDAA 5JUMA 1OS5A 3FFIB 3NWRA 1VR6A 2BRLA 2VF3A 3CCQS 2UXCF 2UU9J 4AL5A 2DGXA 2LQ5A 3KUEA 5IWAJ 3POTA 5KFZA 1NPRA 2HHPA 4A8QA 4UUXA 4JUZA 3SQGA 3BKTA 3TAMB 4DF8A 4BWMA 4I67A 2LKZA 1FRHA 3E01A 3NEKA 6FD1A 3HVAA 3CC7S 4C2MA 3HHLD 1V9OA 2DNMA 1S49A 1REGX 4PABA 1WEXA 5KG3A 1HL6A 4K8RA 1PYSB 4L74A 5L9NA 2GQQA 4M94A 4CI0B 3QFHA 2OMLA 1HBMA 2MZJA 4YB6A 3VQSA 4DL0C 4DFMA 5F8NA 1UKUA 2HBZB 2JNJA 3KHHA 2J9EA 5GMKa 2NQPA 1GX6A 3PDNA 3VR1A 3IP0A 3M8QA 1AROP 3CJ8A 4DLGA 1OIAA 3QIDA 2FIUA 4ETZA 2CVIA 2DHSA 3G9CA 1VLOA 2H5JB 2HYIB 4FVMA 1PJ6A 2R7OA 4NEZA 4RW4B 4RUAA 3T5LA 2KL8A 3C66A 1WUUA 2IVMA 4DV7F 2NZ4A 1BWVA 1AA1B 2WVCA 3DLKA 5E2QA 5GAHI 7FD1A 2ASLA 4ELVA 2F4VF 1F9HA 3PO5A 2KM8C 3HDSA 1H72C 1VIXA 4ZIWA 2NPFA 3DDNA 4J9OA 5JMNA 3KHGA 4LSLB 3HD2A 2KFZA 4IQMA 4YOEA 1PSDA 1X4BA 1P9YA 1B0TA 1H0HB 2L3MA 4OV6A 2OPSB 1NM2A 1QE1A 4P71A 1Y5LB 4B02A 3VAIA 1TUGB 2HW3A 2I0XA 4ED2A 2K1RA 1Q81T 2CZ9A 2V8VA 2HQCA 3SCKE 2PMHA 4C8YA 2E44A 1U2FA 4OJHA 3BKUA 2H3EB 2IVYA 5IC4B 3M9MB 4K2JA 1RT2A 3BBBA 4CLSA 4F02A 1P27B 2KKHA 1BQXA 3DRYA 3UR3C 1NU4A 3NGDA 1HNVB 5H9FJ 2QA4G 1U1RA 5KFDA 2HFVA 2K7JA 2FJEB 1FCAA 4RW4A 2NUUG 3BV8A 1N6QB 4DFKA 3Q2SC 1F60B 1S1TB 4IOAQ 1LWXA 4MFBB 2CQ1A 3HFVA 2R7TA 2LYVA 4BCAA 1U0SA 2IBOA 1DZ5A 3Q8QB 2UUBJ 1YWXA 4IDKB 1Q7YT 4LSNA 3CCJS 2NZCA 3K5PA 2RU9A 5LMNF 4QIFA 4LBPA 1FDAA 1S1UB 2YH0A 4UOCA 2LQ9A 3EZUA 4LRCA 3B54A 1WSRA 5D4PA 2OPRB 4TU8A 1WF0A 3VAMA 3MR2A 5M2UA 1UZHA 3L95X 5L38A 4QWAA 3DRPB 3SSRA 4NLPA 2DPJA 3W7BA 2H5EA 2IJFA 1IQZA 4LF8F 3JXOA 1YLXA 3DRRA 3MD1A 4KQZA 3ZZPA 3PW2A 4I1TA 4LF4J 4LFAF 3OHBA 3HT3A 5DM6Q 1F0XA 2H48B 5CCMA 3G6ES 2W9BA 2ZH4A 2V68A 2DBBA 3M2UA 3KK1A 4C4WA 2FLOA 4HT7A 4IDKA 1VRTA 2QJ3A 1S6QA 3MEGB 5LMUF 2YNGB 4QIWD 2ACMA 2VG5B 1WC0A 2AJ0A 3CCMS 1U6FA 3GONA 2B6AB 4NLXA 4PG4A 1KOHA 4OX9F 4NL5A 5LT5A 1RB0A 2HIYA 2M88A 2VFRA 3I82A 4OJ1A 4CTAB 4RU2A 2CVEA 3PKMA 2DHAA 2VG7A 2OTJS 2MTLA 2VUGA 5A2QY 1FJGF 2HAIA 3EICA 2GW8A 4DU8A 1SH0A 4DL2A 2VFSA 4NLVA 1T05B 4KFBB 2N7CA 2F8EX 1KRPA 3J7AN 5HP1A 4ILRA 3I0RB 3NXZA 4PXCA 4NMXA 2GHVC 4I56A 1RGVA 1IM6A 5L9XA 3SSSA 1Y9OA 5CYQB 3X3UA 4F36A 4ZN1A 2W9CA 2DPIA 1UW4A 2Z2LA 1LXNA 4ITSA 4LF9F 5EWGA 1PC5A 3HHLB 3IA0A 2IM1A 3QGIA 5CXTA 1RWPB 3OTOJ 3RAQA 2GC8A 1N54B 1WC6A 2OEKA 2MYFA 1GTHA 3A3OB 3KJVA 4EYHB 1ZTTA 1UVMA 1I1GA 2F4FA 4K50A 2H54B 3MR5A 1HIYA 1CULB 1S1UA 3HFKA 1OSDA 4DN0A 3TEGA 4RW7A 2QT7A 4EYIB 3QBCA 2AIRB 3TNVA 1U02A 1WOSA 2IC3A 2HFOA 4ZHRB 2ZH9A 3D6TB 4P2MA 3LP0A 5DDQC 5CAAA 4KKOB 5M2RA 2CPDA 3ICLA 3Q8UA 2F9JA 4CLUA 1M5KC 1DLOA 2B7CB 2LQ8A 1WC4A 1HHQA 2WBMA 4YB5A 2O01C 1U1KA 3FRZA 4IFYA 1C4CA 2YBVA 4PQUB 4EBDA 4CLFA 2XMWA 3ZNUA 4LR9A 1QDUB 1TKZA 5B08A 1T3NA 3H5XA 1DBDA 1T9XA 8RUCA 3OVAA 3FVYA 2RQMA 4F4WA 3SZ2A 1FNOA 1MN9A 3JSRA 3LANA 4ECSA 3KJFB 1FT8A 1QUVA 4DV4F 1TP7A 2UV8G 2XLJA 1QSSA 3GPAA 2JX2A 1N5SA 3RB4A 1YITS 4DQPA 4X4RA 4YY3J 3CNQP 5HMXA 3QRRA 1N0VC 3K8WA 2KRBA 3NG8A 1WOOA 5HQ8A 3HP6A 2W2MP 1YIJS 1VHFA 3KXDA 2GIRA 5A76A 3KYLA 4DR2J 3W3SA 4DV6F 1JJCB 2XBPA 3DLBA 1Z2LA 2ATCB 5A2QU 1FKPA 1ZH5A 4GKKJ 3WBZA 2HBQB 4MJKA 2BMBA 1J5EF 2DGSA 3PRBA 5DGBA 2V8HA 4X4NA 3GFYA 1GMWA 2RHSB 2I9SA 3JAMY 2HHUA 3UVJB 2WBRA 1VYAA 2C2MB 3TZXA 2R8HA 4Y2AA 5DDPC 2HGNA 1RP5A 1QVGR 1TMJA 4DV3F 2CNLB 1EP4A 1JLQA 4X62F 4LRBA 2ADBA 3OTDA 4L75A 4DEZA 1H2TZ 4J9NA 1TV6B 2Q43A 2HQ3A 5DQHA 5HBMA 1OYEA 1SJFA 3ZZTA 4USKA 3W66A 3H4DA 1UZDA 2VOOA 4X4TA 4RZRA 2CDQA 4Z7CA 3BEGB 5BXIA 1HR0F 5IC6B 4NXMF 2KT2A 2DNKA 2C42A 2HVEA 1O0PA 2W7AA 1FRJA 3Q86A 4OFZA 3TAMA 5DLGA 4UUWA 3FKBA 2NSCA 3CJKA 2GO8A 3A3PB 2YX1A 3NBPB 4X4OA 4N56A 5GAGI 3QSYB 1QAJA 1R43A 2DXFA 4IG3B 3W62A 2W9BB 1TKTB 2W2OP 4TYAA 3JYTA 1RAFB 2HG4A 3F44A 1N32F 5AE2A 2DO0A 3DLGB 4OLPA 2Q79A 5DG8A 5T41A 5KT5A 1NPPA 1JIHA 1JLBA 1TKXB 4A46A 4OL8A 4HACA 2PN6A 2EWHA 4LSZB 5J2QA 2YNHB 1X8DA 5D4OA 3UD4P 1HNXJ 5KTQA 3GYXB 4CT8A 3LALA 3I0SB 4FYWB 1Y5NB 4TN2A 2VG6A 4LIRA 4S0MA 3M8SA 1IBLF 1GXLA 2FHJA 3FDSA 1RABB 2GVZB 2JC0A 3BO4A 3T1YJ 4DR3J 3EXYA 2IA0A 4H4OA 3VZIA 4UQTA 3J7ZT 4I2QB 4U8YA 2EFQA 2KH9A 4DV7J 2MZ1A 2GA7A 1DARA 2AD9A 4P2FA 5E41A 4GVBA 1ZA1B 2B4VA 1FVQA 3PHTA 4JOUA 3RJMB 3SEOA 3KJVB 4LFBJ 3V81A 3DM2A 2WSFC 3CCVS 2Z56B 2M4MA 5HJXA 2CDRB 2BKPA 4DQSA 1F5AA 2ZH2A 3JS9A 5ETQA 4EZ9A 2CQBA 5C5JA 1X9SA 2AEJA 2PDAA 4USUA 1FK9B 2V8PA 4QIGA 4R25A 3UDLA 4QWCA 1NHUA 1TL1B 2LXFA 2ZKUA 1RLCL 3IRXB 2Z2ZA 4ES3A 2OAUA 3PEJA 3RZAA 4K5RA 3OR2B 1KDNA 1HHSA 2CPYA 3CJQA 3HCXA 4ZVGA 3MFIA 3HVRA 4Z7YA 4NCBA 4OYBA 2KZMA 2XMMA 2CWXA 4M5LA 5DGAA 1HNWF 2DNPA 2JRSA 3J7YU 4FP9A 2B51A 3AD7C 2IPOB 3AJ2A 4GMKA 3BDPA 2QLFB 2RDIA 3PFEA 1TL3A 4WFBQ 1U8SA 4DU7A 3MOJB 3QQCD 1U1LA 1FFWB 1PYTA 3OJUA 4OYPA 3K5OA 3PX0A 1H2VZ 3GE9A 4C8ZA 1R6VA 1U6ZA 1N34F 4G3IA 3NOGA 4YFUA 4OX8A 2JZ5A 1WHWA 2EW9A 2R8IA 1Q4RA 2E5JA 1M5HA 1ICEB 1AB8A 2BJEA 1NO8A 2MSTA 3BSCA 3KJNB 4NE9C 5A8RA 3MMBA 3VV2B 5F8GA 2DO4A 2UUCJ 3NCQA 4LF8J 3MTKA 3H2UB 3HXMA 1RWMB 2B9XA 3FMBA 1GFWB 1Q95G 3Q24A 4DV0F 3P3DA 2IJNA 1S1VB 3ENWA 3Q8RB 1YTYA 3TZZA 4DHVA 2C2RA 1HLWA 4HT5A 1UEVA 1KC8T 4GKJJ 4MK7A 5ETLA 1K1SA 1XBWA 3MPDA 1N36J 5B0DA 3C3LA 5DRKA 4DR4J 3OHAA 1FA0A 2DB1A 2J0WA 4RWXA 3TVYA 3CPWR 2CYYA 4YHHF 2MPUA 1D8ZA 4L72B 4XPCA 2YKPA 5D15A 2B9EA 3MPWA 4YP3A 3K59A 4J9QA 2FLLA 2LDYA 3TI0A 3GFXA 2AT1B 2AF6A 3V5RA 2J0SD 3R5BA 2WVDA 3M05A 2WW4A 3EJMA 2YKOA 2OIHA 4FYDA 1HNVA 4KTQA 4NA2A 3TW0A 4PWDB 3CMES 3FCVA 2B7BB 4X4SA 1HBUB 1SQFA 1R0AA 4JI4F 4HL9A 3KHLA 4F2SA 3LAMA 3C14A 5KFBA 3MI7X 1WC1A 1NJXA 3AA8A 2MZRA 1BMQB 1A9NB 1WG5A 2DRBA 2KYXA 1Q79A 3O8WA 1ULRA 1YJVA 2MQ8A 4ZPWR 2F63A 3D66A 3NRBA 1TKDA 5CD4H 2VOPA 7FDRA 2YPZA 1YBUA 2A0FB 5IS2A 1P9QC 1YZ7A 1W7WA 2HBYB 4DI6A 2HZCA 1DQAA 5J2QB 5D3GA 4PZVA 3FC9A 2MZSA 4MK8A 3SFGA 1E6VA 3BR9A 4FXWA 2C3OA 4GO7X 5KFTA 3WZ0A
chains in the Genus database with same CATH topology
4EK2A 2DY9A 3EICA 5C7PA 2BX6A 1NPKA 1UCNA 3Q8YA 3BBCA 1MN7A 2CWKA 2DXEA 4FKYA 4O0NA 4S0MA 3VGVA 3EVMA 4UOFA 1NLKL 1XIQA 2B8QA 4F4AA 1NB2A 4DZ6A 4F36A 1WKKA 5CABA 1B4SA 3EE3A 1F6TA 5IOLA 1F3FA 1NHKL 3PRVA 3NGSA 3VGTA 1S59A 3JS9A 1U8WA 1HIYA 2HURA 4KPCA 3B6BA 3NGUA 4WBFA 2B8PA 4ANEA 3DKDA 3VGSA 1PKUA 2DXDA 2DYAA 1KDNA 5CAAA 1S57A 3EMTA 1NUEA 3Q8UA 4ENOA 1HHQA 3GP9A 3L7UA 3DDIA 1JXVA 1NCLA 3ELHA 1EHWA 1ZS6A 1BUXA 1NDLA 1PAEX 2HVDA 3ZTRA 1MN9A 3NGRA 3EVWA 3EM1A 3PJ9A 3WX8A 3ZTPA 3GPAA 1LEOA 3FBCA 3ZTOA 3Q8VA 4FKXA 1B99A 3BBBA 3BH7B 1XQIA 3ZTQA 1NSQA 3BBFA 1BHNA 1HLWA 1LWXA 3Q89A 3FCWA 3MPDA 4DUTA 3FBFA 4C6AA 1VYAA 3FBBA 3VVUA 3VVTA 4UOGA 3VGUA 1NDKA 2AZ3A 4UOHA 3B54A 4W98A 4ANCA 3Q83A 2AZ1A 2BEFA 3EJMA 4HR2A 1WKLA 5BXIA 3FCVA 2HVEA 3FBEA 3ETMA 3Q86A 4CP5A 3BH6B 1NSPA 1WKJA 3FKBA 1NSKL 3EVOA 3ENAA 3G2XA 2DXFA 1NDCA 1BE4A 1K44A 4ANDA 3ZTSA 2ZUAA 1S5ZA 1W7WA 3R9LA 1NDPA 4DI6A 3FC9A 2VU5A 3NGTA 2NCKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EK2 A;  2DY9 A;  3EIC A;  5C7P A;  2BX6 A;  1NPK A;  1UCN A;  3Q8Y A;  3BBC A;  1MN7 A;  2CWK A;  2DXE A;  4FKY A;  4O0N A;  4S0M A;  3VGV A;  3EVM A;  4UOF A;  1NLK L;  1XIQ A;  2B8Q A;  4F4A A;  1NB2 A;  4DZ6 A;  4F36 A;  1WKK A;  5CAB A;  1B4S A;  3EE3 A;  1F6T A;  5IOL A;  1F3F A;  1NHK L;  3PRV A;  3NGS A;  3VGT A;  1S59 A;  3JS9 A;  1U8W A;  1HIY A;  2HUR A;  4KPC A;  3B6B A;  3NGU A;  4WBF A;  2B8P A;  4ANE A;  3DKD A;  3VGS A;  1PKU A;  2DXD A;  2DYA A;  1KDN A;  5CAA A;  1S57 A;  3EMT A;  1NUE A;  3Q8U A;  4ENO A;  1HHQ A;  3GP9 A;  3L7U A;  3DDI A;  1JXV A;  1NCL A;  3ELH A;  1EHW A;  1ZS6 A;  1BUX A;  1NDL A;  1PAE X;  2HVD A;  3ZTR A;  1MN9 A;  3NGR A;  3EVW A;  3EM1 A;  3PJ9 A;  3WX8 A;  3ZTP A;  3GPA A;  1LEO A;  3FBC A;  3ZTO A;  3Q8V A;  4FKX A;  1B99 A;  3BBB A;  3BH7 B;  1XQI A;  3ZTQ A;  1NSQ A;  3BBF A;  1BHN A;  1HLW A;  1LWX A;  3Q89 A;  3FCW A;  3MPD A;  4DUT A;  3FBF A;  4C6A A;  1VYA A;  3FBB A;  3VVU A;  3VVT A;  4UOG A;  3VGU A;  1NDK A;  2AZ3 A;  4UOH A;  3B54 A;  4W98 A;  4ANC A;  3Q83 A;  2AZ1 A;  2BEF A;  3EJM A;  4HR2 A;  1WKL A;  5BXI A;  3FCV A;  2HVE A;  3FBE A;  3ETM A;  3Q86 A;  4CP5 A;  3BH6 B;  1NSP A;  1WKJ A;  3FKB A;  1NSK L;  3EVO A;  3ENA A;  3G2X A;  2DXF A;  1NDC A;  1BE4 A;  1K44 A;  4AND A;  3ZTS A;  2ZUA A;  1S5Z A;  1W7W A;  3R9L A;  1NDP A;  4DI6 A;  3FC9 A;  2VU5 A;  3NGT A;  2NCK L; 
#chains in the Genus database with same CATH topology
 4C97 A;  3BF4 A;  4DV5 J;  2DNN A;  2FGO A;  4O44 B;  4PWW A;  5A8R B;  5B7W A;  1LK7 A;  1EQ0 A;  3RBD A;  1E6Y A;  3BBC A;  5J1E A;  3N5B A;  4FBU A;  2D3Z A;  1NJW A;  5FDL B;  2WTF A;  6AT1 B;  4PR6 A;  2FUG 9;  2AGQ A;  4FF2 A;  3VAH A;  2N7Y A;  5GAE I;  2IIH A;  2QE5 A;  2B8Q A;  3M2R B;  1NB2 A;  4ECQ A;  3IWL A;  4EI2 A;  2K3I A;  2X7I A;  3CDA A;  4P75 A;  1S12 A;  4QU7 A;  2F40 A;  2FHO B;  3KKF A;  2VKZ G;  2Y0S D;  4O3P A;  2VFU A;  3L7P A;  1HQU B;  4J9K A;  3CO0 P;  1LFP A;  3M6X A;  5GAE U;  1VBX A;  2ZDO A;  1HD1 A;  1F1B B;  2XZT B;  3AD9 C;  3MMC B;  1Y11 A;  2EK6 A;  2G2O A;  3I32 A;  2QA4 S;  4OX9 J;  1U09 A;  3NGS A;  3EZ5 A;  2VQF J;  1S59 A;  4B9S A;  1RU1 A;  1GH8 A;  3MM7 B;  2F5G A;  3CJ2 A;  1BC6 A;  2MKK A;  2BJD A;  2GMJ A;  1WDD A;  5KT3 A;  1X31 C;  3SI8 A;  1M5S A;  2WON B;  3JSM B;  1TZ0 A;  1UTA A;  2W2Q P;  3I0R A;  4OI3 A;  3PO4 A;  5B0A A;  1H74 A;  1J5O B;  3KK2 A;  2E1R A;  3C16 A;  2K2P A;  2LA6 A;  3VQT A;  3OFF A;  5KT6 A;  3OLA A;  2QSW A;  4QW9 A;  1T7P A;  5L1L A;  5KFP A;  3OD2 A;  3M8P A;  4D3H A;  4USJ C;  3N5F A;  3T5H A;  2D9P A;  3LUY A;  3M1V A;  5IT9 U;  4HHJ A;  4RNM A;  3DLK B;  3GFZ A;  3CIZ A;  4ZCI A;  3R6L B;  1S9F A;  1JXV A;  1FFG B;  3ILL A;  1ZBT A;  2KB2 A;  2RF2 A;  4GVB B;  3A1Y G;  3OTO F;  2GNK A;  3FZB A;  1C0T A;  4DR6 J;  2EEY A;  1SH2 A;  4RR5 A;  4I6W A;  2PT0 A;  4WE1 B;  5D4L A;  2ZEJ A;  4DXL A;  1T9T A;  4YDD B;  2MGZ A;  2G1H A;  4ZPT R;  2VOD A;  3OFG A;  4QPX A;  2OSQ A;  3FNN A;  4ZVS B;  3ET6 B;  1WF2 A;  3IGV A;  2W8L A;  4MIW A;  4O0I A;  1NXI A;  4CLW A;  2XCP A;  3GQC A;  2IMW P;  2V5H G;  5ETV A;  1U26 A;  4DLE A;  2WSC C;  4KYZ A;  3Q8V A;  4DPW A;  4NCG B;  4D3G A;  1RBL A;  3HO1 A;  1B99 A;  1HA1 A;  3AH6 A;  2PMW A;  4G1I A;  1XQI A;  4FNI A;  1IKW B;  2E1C A;  3AA9 A;  2NYH A;  4DL7 A;  1HD0 A;  3HPO A;  4ECZ A;  4QIE A;  4NZ7 A;  3ZZR A;  4B9V A;  1BHN A;  5KFV A;  4URS A;  5GMD A;  2V34 A;  2R3V A;  3DI6 A;  5A0Y A;  1T9U A;  3D68 A;  4U9R A;  4C3K A;  3FBF A;  3MEE B;  2V4J B;  4L6V 3;  2I5J B;  3OFH A;  3M32 A;  4RL1 A;  1DTQ B;  1JLG A;  3DRX A;  4WP8 A;  3WHI A;  3PR4 A;  3OL7 A;  1QTM A;  1WEL A;  2VDH A;  3RW7 A;  3RYL A;  1EET B;  5A8W A;  3MR6 A;  2PC6 A;  4RNH A;  4USI A;  3Q0A A;  1N4L A;  4CO3 A;  4DFJ A;  3FFI A;  4OX6 A;  2DIS A;  4RKU C;  4USV A;  1RU2 A;  4O44 A;  3UR0 A;  3BPD A;  4ZLN A;  2R7U A;  1Q8B A;  3CT9 A;  5KFS A;  2ZH7 A;  2IVF B;  2P5V A;  2V2V A;  3NCP A;  4ZP6 A;  3A4T A;  2XY6 A;  2NSB A;  4TNO A;  3T6B A;  1RA7 A;  3KLE A;  3T1H F;  5K5M A;  5HAN A;  4DMZ A;  4X4P A;  2QSF A;  3CJ5 A;  3PJX A;  2QLX A;  4NEY A;  3T1Y F;  4HKQ A;  2CJA A;  4H4K A;  3ENA A;  3CUL A;  1BE4 A;  3AOC A;  2FLN A;  1EQM A;  1HWK A;  3BKF A;  4OX7 A;  3UVJ A;  3DDK A;  4DJB A;  4ID8 A;  3H42 A;  4WE1 A;  4RNO A;  4R5P B;  3KUG A;  3IG1 B;  5CZV A;  2Q6B A;  3N0V A;  3PFO A;  3OSN A;  4JI2 J;  1NDP A;  4PPD A;  5J1N A;  3UW1 A;  2C3Y A;  4F50 A;  2PFD A;  4DV3 J;  5F3T A;  2GMH A;  4F25 A;  1ZAV A;  2QN6 B;  3HHK A;  4NLY A;  4GC6 A;  4LT6 A;  2H1Y A;  1UPM B;  2WVB A;  3J80 Y;  4I6A A;  4LR8 A;  4OZ1 A;  4EK2 A;  4FNH A;  5C7P A;  4EBE A;  3CDB A;  2BJ1 A;  1N5Y A;  1CSJ A;  1ZZF A;  3A8K A;  5E7O B;  3Q8Y A;  2BE9 B;  3ENV A;  5L1K A;  1YJW S;  4J9R A;  4NXM J;  2QYG A;  2ZNY A;  2VJV A;  2O3D A;  1BGX T;  4PUO A;  1X7V A;  3UNG C;  1L5U A;  2H65 B;  4DQR A;  4NLS A;  3W64 A;  2AGP A;  4UOF A;  2OHD A;  1VQK S;  2GCF A;  4DSL A;  3MCO A;  2CQH A;  4F67 A;  5CYM A;  1IM4 A;  3TVZ A;  1KS2 A;  1FXR A;  1TL3 B;  5K9F A;  4J90 A;  1B4S A;  1Q16 B;  1TL5 A;  4X4Q A;  3QWU A;  3Q22 A;  1NK0 A;  2O1P A;  1R89 A;  2XI3 A;  3ZNJ 1;  5HLF B;  4J9M A;  4RPF A;  2JEG A;  4QWD A;  3CSK A;  2Y1I A;  4DX5 A;  1MLA A;  2ZBQ A;  2CPZ A;  3PRV A;  2FC9 A;  4PXD A;  2LXU A;  3OBI A;  3VGT A;  3J81 Y;  1U8W A;  3A8J A;  1LWF B;  5I3Q A;  5F8M A;  3MUV P;  1R8H A;  2AJ2 A;  3M2V A;  4DR5 F;  4BDP A;  4OHX A;  4FYY B;  2Z8Q A;  1QAX A;  1C2P A;  5CYM B;  3T19 A;  4C7Q A;  1TL1 A;  1ZM4 A;  3IRX A;  2ASD A;  3CUN A;  1VRU B;  2LQB A;  3DKD A;  4ZHR A;  1GX5 A;  5EHH A;  2UUA F;  2Z2Y B;  4WP3 A;  4DV2 J;  4OJG A;  4OHY A;  3TAP A;  3H0P A;  4TKT A;  2QZ8 A;  4YEA A;  1CUL A;  4AQY J;  1IBL J;  2UUC F;  4F3Q A;  2DH7 A;  2K8G A;  2ZD1 B;  3OTC A;  4L3K A;  2CZV C;  2C1E B;  1IXK A;  5HRO B;  4WF9 Q;  1RWU A;  1HWJ A;  4I69 A;  2DR9 A;  3ZZU A;  1U1M A;  1UFW A;  1MMN A;  2HLT A;  3DM2 B;  3JSY A;  4PXE A;  1NKC A;  4PPZ A;  3GG1 A;  1E6V B;  2VDI A;  3H20 A;  4NZ0 A;  2KVQ E;  2UVV A;  3K7R A;  4ZVP B;  4Q8E A;  3GSI A;  3IBW A;  2FVC A;  3D1Q A;  2J8S A;  1TAQ A;  1C4A A;  3TOQ A;  3KG0 A;  1SJ3 P;  3C46 A;  3RW6 A;  3ZTP A;  4OYW A;  4J9U E;  1XWL A;  4ZCM A;  2MQP A;  1C0U B;  2RSQ A;  2R2T A;  2OJ3 A;  2N4D A;  5ETP A;  3F73 A;  3NOC A;  2EPI A;  3DYA B;  5F0U A;  2OKQ A;  5T7L B;  1DTT B;  4CLY A;  2ZC4 A;  3HVT B;  2Q1L A;  4KGM A;  4PG5 A;  4U95 A;  1ZOT A;  4HAC B;  4M5K A;  5F9N A;  1WI6 A;  4M5N A;  3TQ1 A;  2ABY A;  4RU9 A;  1QSL A;  2R8K A;  1FD8 A;  4LF2 A;  1JLA B;  2U2F A;  3D0H E;  1YSJ A;  2AP6 A;  2RKI B;  3BBF A;  4LUB A;  1EIY B;  2WHO A;  3Q89 A;  2RRN A;  3I9V 9;  5AXL A;  2HQI A;  4M8L A;  4I64 A;  1RSC A;  4C6A A;  4CH7 A;  4Y0F A;  1RT3 B;  1IQT A;  2KVI A;  4OYM A;  3FQL A;  3H98 A;  3VGU A;  4KH0 B;  2I5J A;  3W9I A;  1LWF A;  4HTJ A;  4OI1 A;  4UOH A;  3I0S A;  4Q8F A;  1FO1 A;  1UET A;  3BPS P;  3LGH A;  5J2N B;  4ANC A;  3DC2 A;  2B9W A;  3OV7 A;  4DL4 A;  2ZBI A;  5E3A A;  4DV5 F;  2OPQ A;  3QFW A;  1YG0 A;  3PW4 A;  1JXL A;  3SSQ A;  2AEF A;  4WZQ A;  1VQS A;  2JLE A;  4ZOS A;  9RUB A;  2XLK A;  2P9E A;  3L7O A;  1S0M A;  2A3J A;  1Y5I B;  1RUS A;  1HFE L;  2MLZ A;  4HDH A;  4YN3 B;  3AB4 B;  4KGK A;  5J2M A;  4Y65 A;  3DLE A;  3D6F B;  4ZVQ B;  5E3P A;  3CJK B;  1TFW A;  3QZ7 A;  2BV3 A;  4LVO P;  1QJH A;  2DIU A;  4Y6I A;  5KFQ A;  4WFN Q;  1HBU A;  3HJV A;  2B4P A;  3IM9 A;  1SKR A;  1CQM A;  4FF1 A;  1XK8 A;  1T95 A;  4WU2 A;  5F9L A;  2Q6C A;  2AV5 A;  3P45 B;  1RCX B;  2YKQ A;  2E7V A;  2KJV A;  3PIO Q;  3LW5 C;  4JV5 J;  4HHH A;  4X4U A;  1UL3 A;  3T41 A;  1OWX A;  3DOK B;  5LXR A;  1TL7 B;  4ED8 A;  1MN7 A;  1RAI B;  4JP8 A;  3THV A;  2ZH5 A;  4C11 A;  4DOZ A;  2ALY B;  4DG1 A;  5I3U A;  1L3S A;  1PAU B;  1URR A;  3A8E A;  5ETT A;  4DZ6 A;  4N7T A;  4ZVT B;  3HKZ D;  1AW0 A;  2DNQ A;  2ZVS A;  3FRY A;  4CLZ A;  5H1S V;  3V4M A;  2VPX B;  5KFU A;  2HS4 A;  3KUH A;  4B08 A;  1M5P C;  4ED5 A;  2EG2 A;  1U1Q A;  4JI6 J;  2KN4 A;  5IT4 A;  1F9E B;  1S1X B;  1YJ9 S;  4DR6 F;  2FVS A;  3HD1 A;  1CS4 B;  3MD3 A;  1DLO B;  2XI2 A;  3WX4 A;  3G6V A;  1K8A T;  1H98 A;  3TAQ A;  2HIQ A;  2X3G A;  4CH0 S;  2FY8 A;  1MWQ A;  3W9J A;  3NS5 A;  3FQK A;  2Y1J A;  1EAY C;  1FE0 A;  2NPI A;  1PC4 A;  2CNK B;  2G2Z A;  3QAE A;  1N5V A;  3D54 A;  4IH7 A;  4X2B A;  2YXL A;  3QJL A;  2G2Y A;  1UA0 A;  3RBX A;  2PA8 D;  3KFW X;  1KNZ A;  3I96 A;  5C25 B;  1YJU A;  3IWX A;  2ZOF A;  3F41 A;  3LQV A;  1YI2 S;  1Y0H A;  5DS7 A;  1S1W A;  2IDE A;  3IS9 A;  3GU0 A;  2KT5 A;  3R5A A;  1O8B A;  4PRF A;  2R7X A;  3CD0 A;  2VV5 A;  3UQS A;  1BY9 A;  1YJT A;  4USW A;  3UD3 P;  4LRE A;  5IM0 B;  2DTJ A;  2ZOM A;  5CYJ A;  3L09 A;  1NEE A;  1L3K A;  3GJS B;  1ZS6 A;  3IFE A;  3BGF A;  2YH1 A;  2KFN A;  2WOM B;  3PW0 A;  1BQM A;  2BE2 B;  4MKB A;  5C25 A;  2KFY A;  3MDF A;  3ZTR A;  1T8E A;  2M9K A;  2DGQ A;  3AAW B;  4EO8 A;  2DCL A;  3EM1 A;  3MEC B;  3QNW B;  3H59 A;  3I5C A;  1DQ9 A;  4OJ3 A;  1LEO A;  3RBE A;  2XSJ A;  2B5J B;  3W60 A;  4CO2 A;  4KJI A;  2I8E A;  2KO1 A;  2VC1 A;  1HAR A;  3CE8 A;  1YGY A;  1NAQ A;  2L9W A;  4RWW A;  2CJY B;  1RYR A;  1IBM J;  5B0E A;  2VPZ B;  3V81 B;  3UN2 A;  3T1H J;  2E29 A;  4KO0 A;  4TU9 A;  3OLB A;  3V6H A;  2XCA A;  1T03 B;  3CD6 S;  2MY8 A;  2IYI A;  1WF1 A;  1I94 J;  5F41 A;  4JI0 F;  4JYA F;  1RCO B;  1TVR B;  2D3U A;  2C2Z B;  2UUB F;  4IR9 A;  3U1N A;  3EGZ A;  5LSO A;  4UOG A;  1UMJ A;  2G0C A;  2Y8W A;  2ZBP A;  5LMN J;  2ROP A;  3P5T L;  1VIO A;  3RB3 A;  3H2V E;  1T05 A;  4B3R J;  4C9D A;  2G1D A;  3T6J A;  4RNN A;  4ZIV A;  5EUH A;  1KQK A;  1M5O C;  5KG1 A;  1X0P A;  3HK2 A;  2FB0 A;  1KLN A;  2YNI A;  1RBA A;  4IOB A;  3HSD A;  1LWE B;  2YQ3 A;  3NP5 A;  5ETM A;  3IWN C;  1FWK A;  5DJB A;  3CCS S;  2B6A A;  2C22 A;  3W2W B;  3J80 U;  5C42 A;  3M9N B;  4QYR A;  5IQ6 A;  1KVJ A;  2EC0 A;  1NSP A;  3AOD A;  4HLB A;  4LFA J;  3THP A;  1X5P A;  3TP2 A;  1ZM2 A;  3WDO A;  3W1Y C;  2DEJ A;  2B43 A;  1QUP A;  4QBU A;  1DTQ A;  2WCX A;  1NDC A;  4DPT A;  2DR8 A;  4WXW A;  3MEE A;  2V2Q A;  2XHC A;  3C8Y A;  1FTR A;  1PJ5 A;  2UXB F;  3R97 A;  2HHS A;  1BQM B;  2BE2 A;  2XUL A;  1RWK B;  5HO4 A;  3B4M A;  2DD8 S;  3CGI A;  4LBI A;  3R9L A;  3BGL A;  4FXV A;  3UNY A;  1G3O A;  2CQI A;  2WAQ D;  1OSC A;  3S7R A;  1H73 A;  4WCE Q;  2DR5 A;  4B3S J;  3HVT A;  3I87 A;  3MMA B;  4LF1 A;  4CYU B;  1P8G A;  1TK8 A;  1WOP A;  1FJG J;  1TFY A;  3CJS A;  2LQJ A;  2PE8 A;  3PCO B;  4ECY A;  3VTI A;  2UUA J;  4MYT A;  4AL7 A;  1RAD B;  1JKH B;  1UJ5 A;  3ULH A;  2BAC A;  4F04 B;  2MKI A;  4NYP A;  3J7Z 5;  3SIP B;  3TO8 A;  1U45 A;  3PYF A;  1GTE A;  1IN0 A;  1NLK L;  1O51 A;  1WD6 A;  1XIQ A;  4O4R A;  4F4A A;  1HMV A;  2XYG B;  1FK9 A;  5IV3 A;  8ATC B;  4YME A;  4N5S A;  4ECR A;  2BE7 D;  2OFH X;  1DAX A;  1YK9 A;  2V69 A;  4DX6 A;  5CAB A;  1RTI B;  1P6T A;  1PJ7 A;  2DIT A;  4OZN A;  2DGV A;  4LF7 J;  1RAH B;  3CXC R;  1X9M A;  4OHW A;  4JI2 F;  4KV8 B;  4WYL A;  1WOR A;  1ELO A;  1TTH B;  5T7L A;  2CJK A;  1HI8 A;  5AE1 A;  2JEI A;  1NBE B;  3IC1 A;  5L46 A;  3L9Z A;  2A10 A;  3TJ9 A;  2EVZ A;  1Q5V A;  1V3R A;  3C16 B;  2W1B A;  4BC9 A;  2NXJ A;  4YS2 A;  4RNF A;  2OD6 A;  4RUC A;  2XG8 A;  4B9U A;  4OI6 A;  7AT1 B;  4A48 A;  2AKW B;  1PKU A;  3AJ1 A;  1KN6 A;  1UFL A;  2YTC A;  2NR0 A;  3Q8S B;  4NLU A;  2ATL A;  2O66 A;  4ED3 A;  2WSE C;  4WKR A;  3DU6 A;  2CPF A;  1CJU A;  2J9D A;  4H4K C;  1U1P A;  4EU0 A;  3D1H A;  5IM0 A;  2KZZ A;  1K73 T;  1SIW B;  4K7Q A;  1SVD A;  2OEJ A;  2LXI A;  3EDR B;  2XTJ P;  2HRT A;  2YKM B;  3D7S B;  3W2V A;  3RR8 A;  5ETK A;  1LWC A;  2BRK A;  3QO9 A;  1LXJ A;  1M1H A;  1FX2 A;  2Z58 B;  3FCH A;  4WFA Q;  1Q82 T;  1XR5 A;  2XMV A;  1VQ8 S;  2GJI A;  3MCS A;  2C3M A;  2QC3 A;  3ISN C;  2GQC A;  2VG5 A;  3LP0 B;  4DR7 J;  4OQJ A;  1R0B G;  3M2R A;  4KH1 B;  1FJ7 A;  3VCD A;  1VHI A;  1VRU A;  2YKN B;  2MKY A;  3RG6 A;  1U1O A;  1FEE A;  4E98 A;  3W9H A;  1F5B A;  1S9E B;  4B3O A;  3AOB A;  3D1O A;  2AYG A;  3GLJ A;  1S97 A;  1PBU A;  4QWB A;  4CO4 A;  4ES2 A;  4DV2 F;  1RTD A;  2DIV A;  2ASJ A;  1LWC B;  5KFR A;  3W2W A;  5BR8 J;  4Y2C A;  1SXL A;  2ILY A;  2P6S A;  5F0W A;  5HQM A;  3IBC B;  4NML A;  2MHN A;  2HZV A;  1OQ6 A;  4HEA 9;  3GWC A;  4P2S A;  1NSQ A;  4JV1 A;  3R2D J;  5KT7 A;  3MR3 A;  1EX8 A;  3R8Y A;  2E66 A;  2B0G A;  4DSF A;  3QGP A;  1UP1 A;  2BOA A;  2VPY B;  5K20 B;  1JMT A;  2EKY A;  4LRF A;  3LP1 B;  2WON A;  2D9O A;  2YQ1 A;  1JLC B;  3D28 A;  3ONQ A;  2BYC A;  4XK8 C;  1RTZ A;  3FEX B;  3TVK A;  1NDK A;  3FMW A;  5KOX A;  4YB1 P;  1VQN S;  3VAL A;  3SYZ A;  4MYU A;  4WFY A;  2ZBR A;  3H90 A;  3G82 B;  3M6W A;  4Q2M A;  4Q2L A;  4DF4 A;  2ZZM A;  4X62 J;  3UCZ P;  3G87 A;  4C8K A;  1UWB B;  1HYS A;  3AXM A;  1BD6 A;  4TY9 A;  3UI3 A;  1X5T A;  4A4J A;  1IVZ A;  4B17 A;  1CJK A;  4J37 A;  2UVU A;  2XB2 D;  3KLG A;  2VFV A;  4F0H A;  4IKA A;  1IWG A;  2RML A;  1D9D A;  3BH6 B;  4N77 A;  4AFF A;  5KT4 A;  3DLJ A;  5LSR A;  1Y00 A;  2RH3 A;  2QIF A;  1KTV A;  3G2X A;  5LL6 d;  3CC2 S;  1XNR F;  3QWP A;  5DDR C;  2I6W A;  4LIW A;  1VQ9 S;  3ZZO A;  2G0J A;  2ZH3 A;  1NK6 A;  2MHE A;  1OY9 A;  1YX2 A;  4IO9 Q;  4OYI A;  4ED4 A;  4ED1 A;  4NLR A;  3BGR B;  4WFX A;  2CQC A;  3E2E A;  1IKW A;  5C24 A;  4N76 A;  1UFK A;  3PHE A;  3PEH A;  4LRD A;  5ETO A;  3R5D A;  4NLT A;  2J6S A;  2GGP B;  5FII A;  3WIV A;  3DLG A;  2UXD J;  1UVL A;  2E5G A;  4NZ6 A;  2HHV A;  1VLY A;  2RUS A;  2QRR A;  2V4Q A;  3CDW A;  5JXS A;  3BDE A;  4P52 A;  5IWA F;  3MUR P;  1NKE A;  2HMI A;  4O0N A;  1TAU A;  4QQB A;  3R7B B;  3PV8 A;  4UY8 5;  2ZDP A;  3H8Y A;  3EXC X;  3OPK A;  3M8R A;  4MTP A;  2J0X A;  1RHR B;  4NA3 A;  4WP9 A;  4U8V A;  4DSK A;  1D9F A;  4QW8 A;  3ITH B;  3EE3 A;  4L3N A;  4OI4 A;  1KTQ A;  4JV0 A;  2M8D B;  1Y3J A;  3IAS 9;  2J8A A;  3O6Q A;  4F4X A;  3RR7 A;  3IO1 A;  2YNI B;  3I6P A;  3UWT A;  1XC9 A;  4TXS A;  4V19 X;  2GV1 A;  4TVA B;  2FY1 A;  2MQN A;  2XNR A;  1HBN A;  2F8M A;  5T14 A;  1SV5 B;  4RBT A;  3DYA A;  2B9Y A;  4F4Y A;  4QU6 A;  3TUJ C;  2WRM A;  2B56 A;  2DRD A;  4R8U B;  3E01 B;  4DV1 F;  2Z2M A;  4QPT A;  2HGM A;  3KLV A;  1LQ9 A;  1XTZ A;  1S0V A;  1RWV B;  4Q45 A;  4TQS A;  2VZ9 A;  5KFX A;  1LOU A;  2UVW A;  4ED6 A;  3J81 j;  2BXJ A;  4J7C A;  1FHT A;  1WEZ A;  4ECX A;  2N3L A;  3POT B;  2J76 E;  1AZS B;  1T02 A;  1U0H B;  2AYM A;  4EUV A;  1VC5 A;  3MWB A;  2G13 A;  4TLR A;  4ED0 A;  1XMQ F;  1HBN B;  2C3P A;  2EFP A;  2VIH A;  1M1G A;  3HM9 A;  2FHK A;  1B70 B;  1WJ9 A;  1ZM3 A;  2BA9 A;  1KP6 A;  3L7U A;  3N6N A;  3SMZ A;  4CDI A;  3RAX A;  1F5C A;  5F8J A;  2ZOG A;  1ZET A;  1RKJ A;  2Z0G A;  4JI5 F;  4LMZ A;  1SCJ B;  1DUR A;  1CG2 A;  1FI4 A;  2HND B;  2ZH8 A;  1NDL A;  2GVZ A;  3EVW A;  1H7X A;  3EZO A;  4ETX A;  2B4U A;  2JFK A;  3B82 A;  5J2M B;  1UA1 A;  1N34 J;  4WK3 A;  2BZ2 A;  3WC2 A;  3BN7 A;  5L1J A;  4LF6 J;  2H51 B;  3CTR A;  3FBC A;  4P6Q A;  5DZ7 A;  3SCL E;  2W24 A;  3MM5 B;  1WI8 A;  2FHM A;  3C15 B;  1OMS A;  4FKX A;  2XMA A;  4LF5 F;  4ZVF A;  2APO A;  2HNY B;  3MM6 B;  3NLC A;  3V4I B;  2MKS A;  3PZP A;  5IQQ A;  2CQ0 A;  4FPI A;  4V1A k;  2RU3 A;  4DV0 J;  4E0D A;  3ITH A;  3MED B;  4K5S A;  1IKY A;  4Y2I A;  2HGL A;  2RB7 A;  1SUQ B;  1YDL A;  2K06 A;  1YQH A;  2GZO A;  3VVU A;  4DX8 H;  4X65 J;  2IDL A;  2BJ9 A;  1VC6 A;  2R7R A;  1UEU A;  2AZ3 A;  3MXH P;  4YHH J;  3ISZ A;  3ILO A;  3NCR A;  3J7Y I;  5KFM A;  4O3N A;  3RRH A;  3Q2T C;  5H9E J;  4B3S F;  4K4W A;  3DXB A;  3UCG A;  4ELT A;  4BBY A;  2X3D A;  4X64 J;  2JSX A;  4PWU A;  5J2P B;  1X4D A;  2V67 A;  1XNQ J;  1L3U A;  3NAI A;  3V4I A;  4LFC F;  2EK1 A;  2R9L A;  1FRK A;  5EX0 A;  2BAN A;  3MM8 A;  4CP5 A;  4B3M F;  2HNZ B;  2HQF A;  4DDF A;  5DQG A;  3H4B A;  2V6A A;  4ECV A;  3AD8 C;  3MAA B;  5HMZ A;  2RIJ A;  1RT5 B;  4X84 A;  3W61 A;  1VBY A;  2R8G A;  1C0U A;  4ZJO A;  4NXN J;  5KG2 A;  1T9Y A;  2VG6 B;  4ZS6 A;  1RIS A;  3H5S A;  4KC5 A;  2Y8Y A;  5K8M A;  3THT A;  1HPZ A;  2HSE B;  1Z1Z A;  4RW8 B;  1D1U A;  5G0R B;  5KT2 A;  5AXN A;  4LF7 F;  2FC8 A;  1MMD A;  5EWE A;  2KRR A;  1U49 A;  2XO6 A;  4EGL A;  4O3Q A;  1RT1 B;  1UW9 A;  3E51 A;  4DX7 A;  3BGU A;  2FLP A;  3SQO P;  4FBT A;  2NRE A;  2FYX A;  3R6G B;  5KFI A;  2BX6 A;  1UCN A;  4K59 A;  1X0F A;  3ISN D;  4H54 A;  3P49 B;  2Z30 B;  3R2C J;  1DQ8 A;  1YKW A;  1RHU B;  3CCZ A;  3TA0 A;  1AZS A;  1U0H A;  2W7O A;  2LEA A;  2W25 A;  3CED A;  2WVF A;  5D4N A;  1FXD A;  3HF5 A;  3JQM A;  5IT0 A;  2N4C A;  3MEC A;  5DDO C;  3BO3 A;  4A8S A;  4K4T A;  4Q44 A;  3RTV A;  1K9M T;  1M0S A;  3D3C J;  1IR2 A;  2DGU A;  2QLB B;  4G65 A;  2WOM A;  4QZV B;  5KAK A;  2X1A A;  3M2V B;  3IN5 A;  4LF9 J;  3BM7 A;  4ZVE A;  2Q3P A;  1NK9 A;  2CNN B;  3FK4 A;  4ELU A;  1M5V C;  2GVD A;  2IAJ A;  2CG8 A;  4PG8 A;  1I3O B;  2BBE A;  1FRX A;  2VBY A;  4R0E A;  4RW6 B;  1CJT B;  4C8O A;  1YBA A;  2HNY A;  3I5A A;  3MM6 A;  4N8O A;  3TZY A;  3KWM A;  4BC7 A;  4NLQ A;  5B0C A;  2GIQ A;  2G4B A;  1AYE A;  2OEL A;  2JLF A;  2P9G A;  2HS3 A;  2MMY A;  3CW2 C;  4BS2 A;  2XS2 A;  3RRG A;  2LLZ A;  2X1F A;  1KVI A;  4AE5 A;  2E7X A;  1OY8 A;  5DET A;  4XO0 A;  1R31 A;  3TUP A;  4CO0 A;  1G1X A;  5FD1 A;  3HVW A;  3LWM A;  3T9N A;  4KRW A;  3DOL A;  4RW7 B;  4FDF A;  3CD5 A;  4U96 A;  2KI2 A;  4CIO A;  2R7S A;  1S57 A;  1NZA A;  3EMT A;  3LP2 A;  3MPY A;  3HHE A;  4AT1 B;  1N6Q A;  5E5N A;  1XMB A;  2L08 A;  4MKV A;  4NAS A;  3CB4 A;  1SJR A;  1NME B;  5K8O A;  2V94 A;  3PG9 A;  2R8J A;  2GGP A;  4WII A;  5A8K B;  2AWZ A;  2ZZT A;  3HFZ B;  3ELH A;  2OD4 A;  4FS1 A;  1UWA A;  1S6U A;  5CYQ A;  1RAC B;  3CIM A;  3NGR A;  4DG1 B;  3ETO A;  5I3U B;  1G7C B;  5HP1 B;  3TQE A;  2YNF A;  4OHV A;  1NH7 A;  8AT1 B;  4YR0 A;  4DL3 A;  2PI4 A;  3FEY B;  1TL7 A;  4X66 J;  3TAN A;  4YY3 F;  4F0M A;  1VC0 A;  2FTR A;  3HHN B;  1WHY A;  2YWE A;  1Y4Z B;  4YB7 A;  4J9S A;  2XZW A;  2P2C B;  3MEK A;  3MMC A;  4LQ9 A;  3R3T A;  1U24 A;  2MKC A;  2ZZN A;  3CJT A;  2VKR A;  3J81 U;  1XNQ F;  3RAM A;  4GKK F;  1RWW B;  3CJ3 A;  3M30 B;  3KLF B;  3G6X A;  1Q53 A;  4EMD A;  4JI7 J;  2R2U A;  4I2Q A;  5DG9 A;  2KTQ A;  1NH8 A;  3MR7 A;  2EBG A;  2BW7 A;  2E5L F;  1N5T A;  3KK1 B;  2ZE2 B;  3B8H A;  1ZAX A;  5HVG A;  3GIR A;  4OZ2 A;  4ZIT A;  4K4X A;  2HHT A;  4WYW A;  2RQ4 A;  2YX7 A;  4CQ1 A;  1RQ0 A;  3K89 A;  2P9C A;  3CMQ A;  2QO3 A;  4H4M A;  2E7W A;  2XS7 A;  2PEB A;  2PGC A;  2PSZ A;  2UUT A;  4CWB A;  2MQO A;  2FPH X;  5HMW A;  5D3G B;  3BSA A;  2I2Y A;  3CC4 S;  4JI3 F;  3QRQ A;  2A2C A;  2OMO A;  2IYG A;  2NYI A;  2J6U A;  3BQ1 A;  3GIM A;  2VL1 A;  5HN0 A;  3QSI A;  1JLF A;  3NKY A;  3ET6 A;  2HHH J;  2BUN A;  5GAG U;  5EDW A;  3NBP A;  2BR0 A;  1S10 A;  2J9D E;  1IKV A;  1X4F A;  3G71 S;  2GQ2 A;  2MQM A;  4LRA A;  3ZC4 A;  4ECU A;  4KGX B;  1N32 J;  3DGP B;  4ID5 B;  5IXU A;  2N3O A;  2ZUA A;  4QIV A;  3P5B P;  4CNZ A;  1C0T B;  3L4B C;  5L8R C;  4KO0 B;  4MKA A;  2BW2 A;  2GIF A;  3QIP B;  4JB8 B;  3MCM A;  5E3Q A;  2DNZ A;  1UWB A;  1Z4U A;  1Q7L B;  4G6V B;  1TV6 A;  2CNO B;  4AXJ A;  1FNX H;  4QWE A;  3OUY A;  1X4H A;  2LEP A;  1A7G E;  1B0V A;  1EKR A;  1X4E A;  2XY7 A;  3GR0 A;  1V6H A;  3EUN A;  2L48 A;  5B0F A;  2XLI A;  3IBF B;  3KK2 B;  2UU9 F;  3U1L A;  2RD5 C;  4FYV B;  3IGN A;  3M2U B;  3EVM A;  1QE1 B;  2HFU A;  4U6P A;  1B0P A;  3L3C A;  4F3O A;  3QAT A;  1NB7 A;  1KWM A;  1HWL A;  4NLD A;  3GJR B;  2KG1 A;  3N6M A;  5HJY A;  4JI8 J;  3AHP A;  1T9V A;  4Q0B B;  1FDN A;  1UEK A;  2WZ1 A;  3OVB A;  2DHG A;  4HTI A;  3K57 A;  4NA1 A;  4U7U K;  5F8H A;  1RK8 A;  4IFV A;  2XM3 A;  1YRU A;  2C2D A;  4A8W A;  2ASY A;  4YR3 A;  3QJJ A;  3T5K A;  1F3F A;  2OH2 A;  2KM8 B;  2FJA B;  4TLQ A;  3MMJ A;  1S1W B;  2A6M A;  3GB0 A;  3IS9 B;  3NGK A;  1M90 T;  2MY7 A;  2W01 A;  4MKY A;  2QA1 A;  4JI1 F;  5A6W A;  1KVK A;  3K5M A;  1FE4 A;  1FEH A;  1FRL A;  4DR7 F;  1FVS A;  4KHM A;  5D8H B;  1MSW D;  4P73 A;  1SB6 A;  2DXD A;  2HWI A;  3IR6 B;  3JAM U;  2CPJ A;  3ZO7 A;  1Q5Y A;  5DLF A;  2A1B A;  3OFE A;  1HNW J;  1RAG B;  4ENO A;  4G1Q A;  2MZQ A;  3DGV A;  1U25 A;  4PQU A;  2KT3 A;  2IMO A;  2OSR A;  3M8Z A;  3MMA A;  4ES1 A;  2DNL A;  1EAR A;  3CCR S;  2GVD B;  2IAJ B;  4M5G A;  4BWJ A;  2MSS A;  1G4C A;  1S48 A;  3VWS A;  1RAJ A;  4N8N A;  1L3V A;  4X65 F;  5JVG Q;  4ZPB A;  5DG7 A;  1SPB P;  2YNF B;  4UST A;  1VIS A;  1W25 A;  2HVH A;  3KMS A;  5CH7 B;  3SQG B;  1RT6 B;  3SCI E;  2IC3 B;  2XSF A;  3C6U A;  3WX8 A;  4DV1 J;  1S0O A;  1I5O B;  1A6L A;  4DBQ A;  2OPP A;  1SKW A;  2MQQ A;  1JQG A;  4A8K A;  3WC0 A;  2EFO A;  2CA9 A;  2FZC B;  4J91 A;  3TUI C;  2LP4 A;  2YWW A;  2AX0 A;  1N5Y B;  2ZWO A;  3CCE S;  1G6B A;  4EBC A;  5HVH A;  2PO4 A;  1I6J A;  4ZLL A;  2A2D A;  5HRO A;  4YR2 A;  1S77 D;  4NI2 B;  3NMA A;  1YJN S;  3BR8 A;  4GKJ F;  1OQ3 A;  3D67 A;  4F8R A;  1AT1 B;  3G82 A;  4L76 A;  4CLK A;  1S6Q B;  1YZ6 A;  3UCU P;  1WG1 A;  1XJW B;  4C0O C;  2DNY A;  3A3N B;  2E9T A;  1RI7 A;  3H25 A;  3W65 A;  2E5I A;  3G86 A;  5LOQ A;  1BQN A;  2HK2 A;  4ZVR B;  3M4X A;  4IR1 A;  1JXE A;  4CH1 A;  2KDO A;  2V8G A;  3OUY B;  2V9W A;  1RHM B;  2OUG A;  4F26 A;  3NL0 A;  4NI2 A;  3KTQ A;  4K4Z A;  5SZT A;  3JTN A;  1T03 A;  2Y3Y A;  2HAF A;  3KK3 B;  1Z2Z A;  4KE5 A;  1HQU A;  1HI0 P;  5B09 A;  4LF5 J;  4ZPC A;  1FJC A;  2H4W B;  5HQL A;  2MB0 B;  3DCA A;  3FBE A;  3V2U C;  3GCX P;  3KLH A;  3NNH A;  1VMB A;  4FXD A;  1HNX F;  2L9D A;  4AYB D;  1IKV B;  5ITH A;  1TL4 A;  4HH0 A;  1S9E A;  2QTW A;  3TJ8 A;  2QMW A;  3GV5 B;  1K44 A;  2V4J A;  2W4C A;  1SUQ A;  4AND A;  4E2F B;  2D7S A;  2OTL S;  1CBK A;  1WHV A;  2H5I B;  5EX3 A;  2NLW A;  2RNE A;  3QGH A;  3TEH B;  5LMU J;  4FF4 A;  4RO0 A;  1B64 A;  4XIU A;  3HHL C;  1JLA A;  1LW2 A;  2B3T B;  4AL6 A;  5D77 A;  1YRT A;  2FHJ D;  4ZKA A;  2JH3 A;  1U7L A;  4IFY B;  4OV1 A;  3W5Z A;  4IH6 A;  4I6Y A;  3BSN A;  2DY9 A;  4CLP A;  3KLI A;  3PAC A;  5MAO A;  1IBK F;  4E8U A;  3VF0 B;  4KSE B;  2HVI A;  4Y3C A;  1IJF B;  2BKO A;  2KYZ A;  2YY3 A;  4DCJ B;  1VRQ C;  4MK9 A;  5LXY A;  4PCQ A;  1SI9 A;  5KFY A;  2QFI A;  4EFA C;  3O5T B;  2OO4 A;  1DRZ A;  1KKH A;  3H5Y A;  1KHV A;  4P7T A;  3V6D B;  1W2I A;  2RHQ B;  4QJV A;  1NND A;  5EWF A;  2E9R X;  1B7F A;  1QTN B;  4JI6 F;  1QAI A;  3K17 A;  3O3L A;  3R5J B;  4I7F A;  3OXF A;  1NKB A;  1REV B;  5F8I A;  1FFS B;  3CJ4 A;  4J9L A;  3HLU A;  3SFU A;  2R2S A;  3G8S A;  4RUB A;  1WSV A;  3QT7 A;  1U2R A;  3MM9 B;  2UZA A;  5HK4 A;  4ANE A;  3CJR A;  4OHZ A;  1J27 A;  4HHU A;  4PXB A;  1HBO A;  3PYD A;  5BYR A;  3HKW A;  3PR5 B;  4P2X A;  2PII A;  2CQG A;  1S6O A;  2C2N A;  2D41 A;  2X1B A;  4URQ U;  2M7S A;  1NUE A;  3EDQ B;  1QD1 A;  3UN3 A;  5CCL A;  5F3Z A;  3MUT P;  1R27 B;  3G4S S;  1WAC A;  2XY5 A;  5A8K A;  3EPG A;  1CJT A;  1MWY A;  4J9V A;  4TYB A;  3QIP A;  4B3O B;  2VA2 A;  5EN1 A;  4ZCL A;  1RTD B;  3G6Y A;  3DRS A;  4NYZ A;  2LU1 A;  1ZM9 A;  3I5B A;  4Y34 A;  2P8I A;  4M5D B;  2AX1 A;  1W2B R;  4UZB A;  1Y7P A;  3KMQ A;  3GIJ A;  5GAH U;  2DCU B;  2XMK A;  3OQ2 A;  4NOH A;  2GML A;  4DV4 J;  1WTB A;  3MHY A;  1N8R T;  2AYB A;  5CD4 A;  3JSM A;  4B9M A;  2FJD B;  1X5S A;  3PYG A;  4M5M A;  5SUH A;  1E6Y B;  3CDU A;  4URG A;  5KFF A;  4DWI A;  2D1C A;  3F0N A;  3PJW A;  3O44 A;  5DO2 A;  1RA6 A;  3LPY A;  5C2G A;  5GAD U;  2MKH A;  2YKM A;  3W2V B;  4U67 Q;  3VAF A;  1H38 A;  1JJH A;  4KHR A;  1RT1 A;  4NLO A;  9ATC B;  1QVF R;  1RT4 B;  4OMF G;  3JTO A;  3AJD A;  4PQA A;  2OPQ B;  3UO0 A;  4Q5V A;  2C28 A;  1Q86 T;  1HNI A;  2FVR A;  1D9A A;  2HZA A;  4DUY F;  1RTJ A;  2DGW A;  4Q0B A;  1J5E J;  1FRI A;  5K14 A;  1I94 F;  5KFG A;  4DUZ J;  1RE1 B;  1PBA A;  2ROE A;  1BQN B;  2WK4 A;  3WQP A;  1D8Y A;  2FJW A;  2F65 A;  4JI0 J;  4JYA J;  2XS5 A;  1TUV A;  5BJR A;  4EEY A;  2BJ3 A;  1VFJ A;  1RJJ A;  1N56 A;  1FKA F;  3LAK A;  3ILJ A;  4YQW A;  4DCO B;  2F8H A;  2HNZ A;  1HHT P;  5FLX U;  1CLF A;  1MRO A;  2JHE A;  4I7F B;  1S7H A;  1DJ0 A;  2R42 A;  1G2E A;  3B78 A;  4KV8 A;  4BHQ A;  4X66 F;  2VG7 B;  4Y28 C;  2ZHA A;  4HYK A;  2RVJ A;  2QL5 B;  2E9Z A;  2M3D A;  3CVK A;  4FPR A;  1RTI A;  1JWW A;  5E33 A;  4A8M P;  2DR7 A;  1RT2 B;  2BKN A;  4Q7A A;  5G0R A;  4LR7 A;  4O3R A;  3DMJ B;  1GK8 A;  1RHK B;  1RHJ B;  3N28 A;  4OIX A;  4BLG A;  2BJ7 A;  2FZK B;  4ZPD A;  2KG0 A;  3HUL A;  2COL A;  1VQM S;  5AJ3 F;  4C3L A;  1RT6 A;  4WK1 A;  2L9N A;  3HI9 A;  2E5L J;  2XGQ A;  2GAG C;  2XMT A;  2DVI A;  1RAA B;  3KLE B;  3J7A 1;  2Y0B B;  4Q43 A;  1VQP S;  2F3J A;  2GAH C;  5E3R A;  3JB9 k;  2W2P P;  2IA6 A;  2BDP A;  3GYN A;  1VQY A;  3UN5 A;  1TKX A;  1JLB B;  4W90 B;  1RLD A;  1T0T V;  3D6M B;  4PYD A;  5GVQ A;  2MQL A;  4JI1 J;  1C1B B;  3GYG A;  5ADZ A;  2UXC J;  5J2N A;  3R1L A;  2EBE A;  3PW7 A;  3LWL A;  4QCL A;  3MCN A;  1KFS A;  3TAR A;  3N01 A;  2YWF A;  3UDV A;  3K2Y A;  4KY3 A;  4CNY A;  3I55 S;  3H40 A;  1AUD A;  2J6T A;  4F4Z A;  1RBO B;  3K58 A;  2J5A A;  2O5D A;  3PIP Q;  4DR3 F;  1PO6 A;  3K5L A;  3TUZ C;  1VBZ A;  3TWZ A;  4OYZ A;  1FF2 A;  2RAQ A;  2YWK A;  3UD5 A;  3BQ0 A;  1FJE B;  4IH5 A;  2R7V A;  5IOL A;  3KK3 A;  5LM7 E;  5I42 A;  4C8L A;  3BGO P;  2CAD A;  1NHK L;  2HKE A;  3MZI A;  4ZK7 M;  3PX6 A;  1JLQ B;  2AW0 A;  1JK9 B;  2R2R A;  1IBC B;  1MML A;  4ZVO B;  1NK5 A;  2AJQ A;  2QEX S;  4B3R F;  1SC4 B;  1VGY A;  2M2B A;  1HBO B;  3G8Q A;  3GMG A;  1X5O A;  3KNG A;  4L73 A;  3R7S B;  3GIK A;  1FWL A;  3VGS A;  3U7J A;  1QM9 A;  2DY1 A;  4C8M A;  4ZN3 A;  1TUW A;  4AQY F;  4PUO B;  2AHO B;  2JOQ A;  4LSL A;  1SQE A;  2HND A;  1SJ4 P;  2DGO A;  2U1A A;  4ERD A;  3DOK A;  1HNI B;  3M8Y A;  2GFF A;  5M2P A;  4K4V A;  3KJQ B;  4HDG A;  5D78 A;  2NXN A;  1S4F A;  4I2P B;  4PKD B;  3QLH B;  2ZC3 A;  4O4G B;  1NSA A;  3I9Z A;  1VS3 A;  3FUY A;  2M8H A;  1B7Y B;  4NYO A;  1VQ6 S;  3OR1 B;  1KQF B;  1GEH A;  1ROF A;  1SC6 A;  3OXL A;  3TA1 A;  1EHW A;  4MIB A;  3CO9 A;  3KDN A;  1FXL A;  1TR0 A;  1VBK A;  3IG1 A;  4GO5 X;  4KPY A;  1PAE X;  1HMV B;  2HVD A;  1K0T A;  3GV7 B;  4KGV B;  4HH1 A;  3E8O A;  4ZP7 A;  2QV6 A;  5C2C A;  5HL7 Q;  4ECW A;  3MF5 A;  2J9C A;  2NXU A;  4ATN A;  1U47 A;  4FN5 A;  4ILM A;  5JJB A;  4P10 A;  2PA3 A;  3KLI B;  1LV5 A;  2A18 A;  3BN4 A;  4O3O A;  4Y2M A;  2VQE J;  2ILZ A;  2JVO A;  1LW0 B;  4JBC A;  2BQU A;  1WWH A;  2LCW A;  4ZLP A;  5KFW A;  1S99 A;  4RW6 A;  2DHH A;  1DHM A;  2CRL A;  1R0C B;  1IR0 A;  2HLU A;  3GCW P;  2VAS A;  1T11 A;  3BGR A;  1CJU B;  3FZ2 A;  4NRU A;  4ZP9 A;  2RQK A;  1NJY A;  5CA5 A;  4DS5 A;  1JJ4 A;  3T3F A;  5K8N A;  4ALZ A;  1X4A A;  3AQP A;  1F2H A;  1YBT A;  1FDB A;  1GMU A;  4DN9 A;  1ACM B;  4M5I A;  3MM9 A;  3OL8 A;  3G96 A;  2ZNZ A;  2PI5 A;  2ZE2 A;  3VZH A;  1V5V A;  3M32 B;  4DR4 F;  5RUB A;  3U1M A;  2UVR A;  1N33 F;  4WTY A;  1WHX A;  5J1E B;  3TX8 A;  1IKY B;  1VQO S;  1KQG B;  3Q83 A;  4PAA A;  4CZC A;  3PRD A;  3R1H A;  3D9B A;  2MEW A;  3R7N B;  1EZZ B;  1CPZ A;  3M8W A;  2C2O B;  4HR2 A;  1W26 A;  4W4M A;  3ZZZ A;  3HHL A;  1S72 S;  1IBK J;  4K0K J;  1KD1 T;  1LW0 A;  1Q0N A;  1DY3 A;  4NCG A;  4N41 A;  4ZPV R;  4JI4 J;  1IR1 A;  2W9C B;  3DLL Q;  3ENQ A;  3PY8 A;  4TY8 B;  3NS7 B;  1KEK A;  4A47 A;  5K8P A;  3KDO A;  2CPE A;  2L41 A;  1J2V A;  1UJ6 A;  2OPS A;  2CPX A;  2HPU A;  2JWN A;  4PG7 A;  2FD2 A;  3VAJ A;  1Q8L A;  2NXE A;  1AFJ A;  2ZVI A;  4CO1 A;  1HI1 A;  4P7V A;  4Y2K A;  1Q78 A;  3D3B J;  3RB0 A;  2LU2 A;  2QMU B;  4O3S A;  1UVN A;  3HT0 A;  2LVW A;  3TJA A;  4ICL B;  3LO3 A;  1HWI A;  4JV5 F;  4O4G A;  1IWA A;  3SDE B;  3MMB B;  3H5U A;  3IRW P;  4GRS A;  1NPK A;  2LMI A;  3RGI A;  3M8P B;  4GC7 A;  3RB6 A;  1TK0 A;  3MEG A;  2B5J A;  1TKT A;  4CLL A;  3M6V A;  5FJ4 A;  4OYX A;  1J5O A;  3VGV A;  2Y1L B;  4U7U D;  4K4U A;  3C6U B;  4UT4 A;  2QL9 B;  3ZXW A;  4I0W A;  4LF6 F;  4UF4 A;  4M5D A;  2M5Y A;  2V8D A;  3DHW C;  4IG0 B;  3K8V A;  4EO6 A;  2HWH A;  2UP1 A;  3EGV A;  2V0N A;  2QA2 A;  5I3P A;  4DFP A;  1YJR A;  1KFD A;  1H7W A;  2HVZ A;  2I38 A;  1RDR A;  2CPI A;  3DRP A;  3A8I A;  5THW A;  3RUB L;  3DLH A;  3ZTO A;  3BSO A;  5KFH A;  2VQF F;  2QX0 A;  2IRU A;  3HHD A;  3P8B B;  3LA0 A;  1SJ1 A;  4DL6 A;  3ILI A;  4IG0 A;  4WBF A;  4K2X A;  5ETR A;  3IAM 9;  4UTG A;  1UVK A;  2IHR 1;  3FSX A;  5AE3 A;  2JDJ A;  1N5Q A;  3D2W A;  2DYA A;  4A8F A;  4NCA A;  2HMI B;  1IUJ A;  4EWT A;  3DU5 A;  3HJF A;  5E3C A;  1V3S A;  1FWP A;  3TR5 A;  2FDN A;  3OR1 A;  1KHW A;  3GJT B;  1XMQ J;  4GVL A;  3T1A A;  2VA3 A;  2OEM A;  1OJ4 A;  2P6T A;  4DUY J;  2LA4 A;  2EFN A;  4CCH A;  2V2K A;  4KAI A;  1URN A;  2R7Q A;  4ZDN A;  4NLW A;  3S1T A;  1S79 A;  4F3M A;  5EGY A;  2RDJ A;  4JI5 J;  4CM0 A;  4CLT A;  3PJ9 A;  4NWB A;  4M63 A;  3B4D A;  2AJ4 A;  4ZA1 A;  3PVX A;  4KHP J;  2W4P A;  1Q8K A;  2DNR A;  4RJV A;  1HQ2 A;  3PM9 A;  3SV3 A;  1QSY A;  1HW9 A;  4B9N A;  2DRA A;  4DPX A;  2W7P A;  2GJF A;  3IXQ A;  3NNA A;  3A12 A;  2XC9 A;  4CYU A;  2HBR B;  1F3V A;  1IBM F;  3BH7 B;  2HWT A;  2E1M C;  1U1N A;  4YDX A;  2DHX A;  4LVN P;  2JJ4 D;  5G4D A;  4IRK A;  1F9F A;  1EB0 A;  2CQ2 A;  2E1A A;  2QLJ B;  4WJB A;  1RT7 B;  4XPE A;  4ID5 A;  2AU0 A;  4QYZ K;  2DH8 A;  3VHQ A;  4DZD A;  1FRM A;  3JYT B;  5AJ3 J;  2DEI A;  3DOL B;  4C98 A;  4DUT A;  3I4H X;  4ZVH A;  5A8W B;  2DJW A;  2ZHO A;  2IM3 A;  3S01 A;  2QGF B;  1JLG B;  2VBW A;  5U47 A;  1HNZ F;  4IYQ A;  5B0G A;  1Q1K A;  2HFN A;  3LH2 S;  1RAO A;  1PYO B;  1HBM B;  3HSZ A;  1CVJ A;  4W98 A;  3G8T A;  3K5N A;  4J5O A;  3MED A;  1WNE A;  1S1V A;  2AZ1 A;  2KXF A;  3T9Z A;  1SC3 B;  2FVP A;  2IRX A;  3GG0 A;  1VQL S;  5HLF A;  2F9D A;  1HR0 J;  4X64 F;  4DR1 F;  5C24 B;  2RT3 A;  1RYS A;  1KON A;  2Z4P A;  4DL5 A;  4UQG A;  3C15 A;  4ZLJ A;  2O67 A;  3ETM A;  2RRB A;  3W63 A;  3LOU A;  1V3Z A;  2EFG A;  3A13 A;  1WKJ A;  3NWG A;  4OI2 A;  1IKX B;  5D0G A;  4B3M J;  4KIA A;  3EVO A;  3OJS A;  2CFX A;  4C11 B;  2RDD A;  1RT3 A;  1NK7 A;  4NXN F;  4KFB A;  4G1P A;  1VJW A;  2IRY A;  3KG1 A;  1TVR A;  1YJ7 A;  2B4O A;  3LF0 A;  2F1F A;  1KLM A;  3GTY X;  4V19 J;  4RBU A;  1NK4 A;  3QAU A;  1S5Z A;  4K4S A;  1ZA2 B;  3UDE A;  1KBR A;  4WIQ A;  1FKP B;  3ZFV A;  3D4J A;  4C3M A;  2VU5 A;  3R5G A;  4RUH A;  3KLG B;  2ZM6 F;  5B0B A;  2C2E A;  4PWD A;  1VJQ A;  3C19 A;  3KHR A;  2MJN A;  4IQX A;  1HYS B;  5HMY A;  2IJR A;  3VAG A;  4OZ3 A;  4I2P A;  2LEC A;  4USH A;  1ZYQ A;  4KGZ B;  1DFD A;  2YNG A;  2VBX A;  4RW8 A;  2CQD A;  2QYC A;  3LPE A;  2GS8 A;  3DFE A;  1MWZ A;  3FEZ A;  2YWG A;  2V9K A;  2D74 B;  4ZJL A;  3CCU S;  3LGM A;  4TY8 A;  1SL0 A;  1IKX A;  1AFI A;  1FTC A;  2EKN A;  4OYO A;  4CT9 A;  2GX8 A;  4AXI A;  2EFV A;  1RXO B;  1CJV B;  1RZM A;  4RX6 A;  3TRG A;  1D09 B;  4U7C A;  2JLG A;  3N4W A;  2XWY A;  1BXN A;  3I31 A;  4WXO A;  2OI2 A;  3BYP A;  3UE2 A;  1VCT A;  4CRJ A;  2RRA A;  4EZ6 A;  1V5I B;  3NY0 A;  4HI1 A;  2WW8 A;  2DKO B;  3GZ7 A;  4KR0 B;  4ZVU B;  1GXT A;  4HVZ A;  2ZD1 A;  4TU7 A;  4KKO A;  2GO9 A;  2XSJ B;  1SIZ A;  1K47 A;  3DXS X;  5KG6 A;  3MAQ A;  2D69 A;  1S9G A;  5IV4 A;  1IJE B;  2J0Q D;  1SQG A;  3DHX A;  2XWX A;  2JC1 A;  2CQP A;  3M8Q B;  5KG0 A;  5KFE A;  2H9Z A;  3M7V A;  1LK5 A;  2HEK A;  3AY0 A;  2UUW A;  5KFK A;  1HW8 A;  3DRS B;  4XTT A;  3P6Y C;  3QT5 A;  1OPI A;  1R8P A;  3N79 A;  3RBZ A;  3NMR A;  1EKS A;  2YNH A;  4QR2 A;  3GP9 A;  2CJ9 A;  4RBV A;  1GMW D;  2V50 A;  3DDI A;  3K0J A;  3MM5 A;  1MU2 B;  1T94 A;  4M1K A;  3PW5 A;  1XMO F;  2HHW A;  3FGV A;  5DZ6 A;  3UDC A;  4I68 A;  4CO5 A;  4NRT A;  5D0H A;  5BYQ A;  1R8B A;  2VB6 A;  3C2P A;  1YHQ S;  4AUK A;  5ETN A;  4MT1 A;  1S6P B;  5DQI A;  1ZAW A;  1GAO A;  3CD7 A;  3LGN A;  3MPU B;  5JVH Q;  4Z37 A;  2JEF A;  2AMC B;  5HAT A;  1S9G B;  1XEZ A;  2JL9 A;  4M5J A;  1U4B A;  3E3X A;  2VPW B;  5BR8 F;  2RF2 B;  1XR6 A;  5C42 B;  3SV4 A;  4K0K F;  5H9F K;  3OVS A;  1RTH B;  2HFZ A;  1KR4 A;  1P1L A;  3BZQ A;  3QLH A;  1FKO B;  5CZX A;  3W5Y A;  3O2I A;  5D6G A;  1N0U A;  3EGN A;  3UPF A;  2RQC A;  1UPP A;  2CZ4 A;  2ZUG A;  3JQK A;  2W8K A;  4B3T J;  1CJV A;  4RLE A;  1H2U X;  4R5P A;  1RWO B;  4JI7 F;  1KLM B;  2XEX A;  1N36 F;  1U48 A;  1HPZ B;  2MJU A;  1OYD A;  2AJF E;  4IO1 A;  2MZT A;  2HHX A;  1F2G A;  3HZE A;  2MLX A;  1AXQ A;  3KG4 A;  3O1L A;  1M1K T;  1Y10 A;  3LP1 A;  3MAA A;  4F0K A;  2AQ4 A;  3QGG A;  2XZD B;  1SV5 A;  4YUD A;  3EX7 B;  3DRR B;  4ER8 A;  2D3O R;  3GII A;  4A8X A;  2JEJ A;  2AYE A;  2BEF A;  3EGW B;  4WKY A;  2OFG X;  5I42 B;  4NLG A;  2VON A;  4ZJQ A;  3QRP A;  2DNG A;  2VQE F;  2HRY A;  1U6B A;  1SKS A;  1WKL A;  1FKO A;  4WZM A;  1LW2 B;  2G9O A;  1PIE A;  2CIM A;  4FVC A;  1X4C A;  1RWN B;  2CXE A;  2OPR A;  2HFS A;  3CDE A;  1XR7 A;  1GMV A;  4JV2 A;  4WU3 A;  1EET A;  1MG7 A;  1BWE A;  2CQ4 A;  3DLE B;  4P9S A;  2IFX A;  4QR0 A;  2DR6 A;  1PG5 B;  1RKI A;  1CQN A;  4XDC A;  1VDH A;  4A8Y A;  3KOA A;  4KBI A;  2X51 A;  2KXH A;  3MPV A;  5AXK A;  2V2Z A;  3DI6 B;  5A0Y B;  2R7W A;  2V4R A;  2ZJR Q;  3AB2 B;  4WFZ A;  3KLH B;  2KU7 A;  1C1B A;  4OZL A;  1S1T A;  3MTJ A;  2IY5 B;  3KLF A;  2ACY A;  1JNZ B;  1MU2 A;  2GHW A;  3NGT A;  4ICL A;  3AQO A;  4PEO A;  5E0O A;  1LWE A;  5IZH A;  1VK3 A;  2VIC A;  1QLN A;  2UXD F;  5HBM B;  2ZWP A;  5KG5 A;  4N47 A;  2RIL A;  2X1G A;  4XAK A;  3R27 A;  3GSD A;  3NAH A;  5KFO A;  2E1P A;  2K3K A;  5DM7 Q;  2RE1 A;  1X9W A;  2CWK A;  2ZJP Q;  3X1L B;  3OTB A;  4FKY A;  4ILL A;  3GJQ B;  2BM0 A;  3PNI A;  3R5C A;  5ETS A;  1RT5 A;  1R7I A;  3JQJ A;  4FZV A;  4OZJ A;  1S4E A;  2YWH A;  2VHG A;  4DPY A;  1UJ4 A;  2M52 A;  2OP5 A;  4WWS A;  3US5 A;  2YVS A;  4JI8 F;  1Q8I A;  5LSL A;  4XDD A;  1JLE B;  2QL7 B;  3DOM B;  1KOO A;  5BYS A;  2ZJQ Q;  2FJV A;  1CS4 A;  2BM1 A;  1VI7 A;  1TK5 A;  1TQL A;  2FVQ A;  1S1X A;  5KFA A;  4I4B A;  2IM0 A;  2OGU A;  1KQS R;  5HVF A;  4IFV B;  4C0B A;  4B9L A;  4C8N A;  4DS4 A;  4ZCK A;  1SKU B;  2ZFH A;  3M9O B;  4KPC A;  3NGU A;  5KG7 A;  4H4O B;  4KHP F;  2WB1 D;  2XGP A;  2PEH A;  1GQE A;  3W8P A;  3TA2 A;  2MKJ A;  4LJM A;  4W92 B;  4O23 A;  3NS6 A;  1JB0 C;  1UAW A;  1RTJ B;  3P96 A;  4MH8 A;  4R8U A;  1JX4 A;  1TKZ B;  2K7K A;  2POK A;  1SBR A;  1RT4 A;  1PCA A;  2SXL A;  3C6T B;  3CWJ A;  2N82 B;  3W8G A;  4DPU A;  2BOP A;  2HHQ A;  2C3U A;  3IR5 B;  1NCL A;  2NXC A;  4G1Q B;  4WPA A;  2M70 A;  5KFJ A;  4IUF A;  1OY6 A;  2AGO A;  4NX9 A;  1T9W A;  1BUX A;  2ZKT A;  3OTE A;  1YVF A;  3RRK A;  1HQE A;  2CJX B;  2YKN A;  2BJ8 A;  2IM2 A;  1K1Q A;  3PXG a;  1FES A;  1HWU A;  5LJ5 Y;  3OT9 A;  1C1C A;  5J1P A;  3D6H B;  5HAO A;  1FER A;  1U2C A;  4IRD A;  4OI0 A;  1R6Y A;  3ADA C;  1WDT A;  2IBK A;  2EI5 A;  1ZPW X;  2DNO A;  3TX0 A;  2RS8 A;  1Y3K A;  1NRK A;  2MLY A;  3V6K A;  2ZIT A;  3CCT A;  1CC7 A;  3ZTQ A;  3C6T A;  1FNM A;  4P72 A;  5GME A;  2ALZ A;  1SL1 A;  3OL9 A;  3N6L A;  1N88 A;  2I1R A;  4IOC Q;  2CPH A;  4H4M B;  1KSP A;  2HQD A;  2KHC A;  2VFT A;  4AD6 A;  2ERR A;  2F4V J;  3OSP A;  2VBZ A;  2DK2 A;  3ZZ0 A;  4UY8 T;  2D3O 1;  1A0O B;  4PYA A;  2XYH B;  3FBB A;  3VVT A;  2OLW A;  5L1I A;  2VD3 A;  2GHP A;  2DH9 A;  1NJZ A;  4LSN B;  2EXU A;  2FZG B;  4MAK A;  2UV8 A;  2ZBC A;  5AT1 B;  1R3N A;  3FSY A;  5H9E K;  1APS A;  1RHQ B;  2CG4 A;  2DT9 A;  1OPZ A;  2QMX A;  4MFB A;  5MLC V;  1RT7 A;  3DNC A;  1ZZN A;  1FX4 A;  1NK8 A;  1CJK B;  1RAE B;  3CJ0 A;  4CTA A;  4P74 A;  3DOM A;  5J2P A;  1NJI T;  4LFC J;  2KHD A;  4MMO A;  4A8O A;  3CMA S;  4ZP8 A;  2Q66 A;  3IR7 B;  1RTH A;  4QR1 A;  1DTT A;  3BJY A;  3AFG A;  3QT8 A;  4ED7 A;  1NSK L;  2HRU A;  3OW2 R;  2VH7 A;  1WTF A;  4FS2 A;  2XMJ A;  1GT8 A;  2OPP B;  1JLC A;  4K4Y A;  4F2R A;  1S6P A;  2VJU A;  4NPO A;  3T5J A;  2UXB J;  4WTO B;  1LFW A;  2GJ2 A;  4PG6 A;  3U27 A;  5KFN A;  3GV8 B;  1N48 A;  2PD1 A;  3SXL A;  1HNZ J;  3SCJ E;  1O6X A;  3ZTS A;  5LJ3 Y;  1YRX A;  4QOT A;  5AXM A;  2KJW A;  2EG1 A;  6FDR A;  3Q23 A;  1VOM A;  3GIL A;  2NCK L;  3QZ8 A;  1NHV A;  5L39 A;  2XQC A;  3BO2 A;  1FDD A;  1LNQ A;  5GAD I;  1UVI A;  2W2N P;  2AEM A;  3PX4 A;  3HSG A;  5KFC A;  2ZH6 A;  4DR1 J;  5CHC B;  3NNC A;  2BQR A;  1D3W A;  4HI2 A;  2Z57 B;  1VK8 A;  2DXE A;  2HS0 A;  4LF4 F;  2NS1 B;  3MGJ A;  2PFF B;  1PIL A;  2Y1R I;  2R4F A;  2LEB A;  4FYX B;  2BVZ A;  2AJ1 A;  2MGZ B;  4B9T A;  1ITP A;  4F7V A;  2CJQ A;  3ZZY A;  3PKY A;  2RUG A;  3WIU A;  4C48 A;  2DGT A;  1R0A B;  1L3T A;  1WKK A;  2FQQ B;  3BYR A;  2YKA A;  1F6T A;  2CUY A;  3M30 A;  3AXK A;  3QO9 B;  1ZPV A;  3AT1 B;  4MIA A;  4RW9 B;  1H6K X;  2H4Y B;  3BQ2 A;  3CF5 Q;  4FF3 A;  2NUH A;  2ZM6 J;  2W4D A;  1CEZ A;  4DQQ A;  4M95 A;  3OL6 A;  3F56 A;  2XHW A;  4M5H A;  3QT6 A;  2BQ3 A;  1NZ8 A;  4DR5 J;  1SL2 A;  2HUR A;  3HZG A;  3P4U B;  3MAH A;  2K1R B;  3B6B A;  2B8P A;  3D0G E;  3IM8 A;  3PYE A;  4UZC A;  3D0I E;  1ZTW A;  1GXU A;  4LQ3 A;  3GR1 A;  3QMQ A;  4Z2X A;  5F8L A;  2CKW A;  2QG9 B;  1N33 J;  4OLO A;  2JVR A;  2J7K A;  4DR2 F;  2A6O A;  1CC8 A;  4DV6 J;  4LBH A;  2ADC A;  1SH3 A;  1X4G A;  3QYY A;  3SDE A;  4B3T F;  4RW9 A;  3H7H B;  3QJP A;  1TMM A;  3N9U C;  1JLE A;  3GFH A;  4KB7 A;  3EPI A;  3AOA A;  3V6D A;  3MOZ A;  1JJ2 R;  4F4K A;  2Y9H A;  3JTP A;  3LP2 B;  5D0E A;  1FD2 A;  1RWX B;  3DGP A;  1C1C B;  2EC2 A;  1VRT B;  4DPO A;  2PMZ D;  2YPY A;  1HQE B;  2CAJ A;  1JNR B;  2FGC A;  3IMQ J;  3I56 S;  3CCL S;  1JLF B;  2RS2 A;  3I4P A;  1QY7 A;  5IT9 Y;  3S8S A;  2E5H A;  3FJ2 A;  4ZMM A;  3MM7 A;  4IRC A;  5HI7 A;  2HK3 A;  3Q8P B;  2BAN B;  3MM8 B;  2WB4 A;  1XER A;  3BB5 A;  1AUS L;  2C2K B;  2F7V A;  3M6U A;  3QPI A;  4KT0 C;  2XYP B;  1R8C A;  3BS9 A;  1O5J A;  3HX9 A;  4OZ5 A;  4ECT A;  3LTO A;  1VQ7 S;  2RJZ A;  2XO7 A;  1X60 A;  2V63 A;  1WEY A;  3S6E A;  3UFC X;  5I4M A;  5FLX Y;  3VAK A;  3V6J A;  3MFH A;  3OR2 A;  2XMU A;  2QFJ A;  2ZHB A;  4DSE A;  4USM A;  1TU0 B;  1XMO J;  3FCW A;  4UW2 A;  2J7U A;  5A6P A;  2BAB A;  4DUZ F;  1K0V A;  5KOW A;  3HSJ A;  4R0J A;  1XN9 A;  2YX4 A;  4IG3 A;  5HSP A;  1B3T A;  1LKZ A;  3JSB A;  1H3D A;  5FDL A;  2CJB A;  3HMJ G;  1BLU A;  2XNQ A;  3SBM A;  3W5X A;  2MXY A;  4OYA A;  1REV A;  2ZH1 A;  1S0N A;  1D0E A;  4DQI A;  2RKI A;  4X4V A;  4J9P A;  2JFD A;  1WC5 A;  1WC3 A;  4DCP B;  5KG4 A;  3CCW A;  1I51 B;  1QAY A;  3DN9 A;  3EWG A;  4QYZ J;  3TYT A;  1TEL A;  5D0R A;  2YQ0 A;  4ZPA A;  4JI3 J;  1VQ5 S;  1MW7 A;  1GNK A;  2LDI A;  5IFM A;  1EP4 B;  3D5M A;  3BRE A;  4Y00 A;  3H2L A;  1N52 B;  5CQG A;  1PGZ A;  2HHH F;  1T3O A;  1S76 D;  2QLW A;  1WG4 A;  2ROG A;  1JKH A;  1R8A A;  4TQR A;  1XNR J;  1SC1 B;  1EJ7 L;  2CQ3 A;  3DMJ A;  4CM2 A;  2LFV A;  3C14 B;  5K14 B;  3KNA A;  1P1T A;  4LFB F;  2FJX A;  4DSI A;  2DNH A;  3RU0 A;  1UVJ A;  2HQG A;  2M0G B;  2FJB B;  1MNE A;  1S7I A;  2VC0 A;  3TZW A;  3FSI A;  4C0H A;  2G0I A;  4OZ0 A;  5KFL A;  3PTW A;  3MUM P;  3OXG A;  2KXN B;  3EYZ A;  3M1V B;  3U02 A;  2W9A A;  4DSJ A;  2WVE A;  1HKA A;  1MRO B;  2J7W A;  1SJQ A;  1VQ4 S;  1OO0 B;  2MDA A;  5JUM A;  1OS5 A;  3FFI B;  3NWR A;  1VR6 A;  2BRL A;  2VF3 A;  3CCQ S;  2UXC F;  2UU9 J;  4AL5 A;  2DGX A;  2LQ5 A;  3KUE A;  5IWA J;  3POT A;  5KFZ A;  1NPR A;  2HHP A;  4A8Q A;  4UUX A;  4JUZ A;  3SQG A;  3BKT A;  3TAM B;  4DF8 A;  4BWM A;  4I67 A;  2LKZ A;  1FRH A;  3E01 A;  3NEK A;  6FD1 A;  3HVA A;  3CC7 S;  4C2M A;  3HHL D;  1V9O A;  2DNM A;  1S49 A;  1REG X;  4PAB A;  1WEX A;  5KG3 A;  1HL6 A;  4K8R A;  1PYS B;  4L74 A;  5L9N A;  2GQQ A;  4M94 A;  4CI0 B;  3QFH A;  2OML A;  1HBM A;  2MZJ A;  4YB6 A;  3VQS A;  4DL0 C;  4DFM A;  5F8N A;  1UKU A;  2HBZ B;  2JNJ A;  3KHH A;  2J9E A;  5GMK a;  2NQP A;  1GX6 A;  3PDN A;  3VR1 A;  3IP0 A;  3M8Q A;  1ARO P;  3CJ8 A;  4DLG A;  1OIA A;  3QID A;  2FIU A;  4ETZ A;  2CVI A;  2DHS A;  3G9C A;  1VLO A;  2H5J B;  2HYI B;  4FVM A;  1PJ6 A;  2R7O A;  4NEZ A;  4RW4 B;  4RUA A;  3T5L A;  2KL8 A;  3C66 A;  1WUU A;  2IVM A;  4DV7 F;  2NZ4 A;  1BWV A;  1AA1 B;  2WVC A;  3DLK A;  5E2Q A;  5GAH I;  7FD1 A;  2ASL A;  4ELV A;  2F4V F;  1F9H A;  3PO5 A;  2KM8 C;  3HDS A;  1H72 C;  1VIX A;  4ZIW A;  2NPF A;  3DDN A;  4J9O A;  5JMN A;  3KHG A;  4LSL B;  3HD2 A;  2KFZ A;  4IQM A;  4YOE A;  1PSD A;  1X4B A;  1P9Y A;  1B0T A;  1H0H B;  2L3M A;  4OV6 A;  2OPS B;  1NM2 A;  1QE1 A;  4P71 A;  1Y5L B;  4B02 A;  3VAI A;  1TUG B;  2HW3 A;  2I0X A;  4ED2 A;  2K1R A;  1Q81 T;  2CZ9 A;  2V8V A;  2HQC A;  3SCK E;  2PMH A;  4C8Y A;  2E44 A;  1U2F A;  4OJH A;  3BKU A;  2H3E B;  2IVY A;  5IC4 B;  3M9M B;  4K2J A;  1RT2 A;  3BBB A;  4CLS A;  4F02 A;  1P27 B;  2KKH A;  1BQX A;  3DRY A;  3UR3 C;  1NU4 A;  3NGD A;  1HNV B;  5H9F J;  2QA4 G;  1U1R A;  5KFD A;  2HFV A;  2K7J A;  2FJE B;  1FCA A;  4RW4 A;  2NUU G;  3BV8 A;  1N6Q B;  4DFK A;  3Q2S C;  1F60 B;  1S1T B;  4IOA Q;  1LWX A;  4MFB B;  2CQ1 A;  3HFV A;  2R7T A;  2LYV A;  4BCA A;  1U0S A;  2IBO A;  1DZ5 A;  3Q8Q B;  2UUB J;  1YWX A;  4IDK B;  1Q7Y T;  4LSN A;  3CCJ S;  2NZC A;  3K5P A;  2RU9 A;  5LMN F;  4QIF A;  4LBP A;  1FDA A;  1S1U B;  2YH0 A;  4UOC A;  2LQ9 A;  3EZU A;  4LRC A;  3B54 A;  1WSR A;  5D4P A;  2OPR B;  4TU8 A;  1WF0 A;  3VAM A;  3MR2 A;  5M2U A;  1UZH A;  3L95 X;  5L38 A;  4QWA A;  3DRP B;  3SSR A;  4NLP A;  2DPJ A;  3W7B A;  2H5E A;  2IJF A;  1IQZ A;  4LF8 F;  3JXO A;  1YLX A;  3DRR A;  3MD1 A;  4KQZ A;  3ZZP A;  3PW2 A;  4I1T A;  4LF4 J;  4LFA F;  3OHB A;  3HT3 A;  5DM6 Q;  1F0X A;  2H48 B;  5CCM A;  3G6E S;  2W9B A;  2ZH4 A;  2V68 A;  2DBB A;  3M2U A;  3KK1 A;  4C4W A;  2FLO A;  4HT7 A;  4IDK A;  1VRT A;  2QJ3 A;  1S6Q A;  3MEG B;  5LMU F;  2YNG B;  4QIW D;  2ACM A;  2VG5 B;  1WC0 A;  2AJ0 A;  3CCM S;  1U6F A;  3GON A;  2B6A B;  4NLX A;  4PG4 A;  1KOH A;  4OX9 F;  4NL5 A;  5LT5 A;  1RB0 A;  2HIY A;  2M88 A;  2VFR A;  3I82 A;  4OJ1 A;  4CTA B;  4RU2 A;  2CVE A;  3PKM A;  2DHA A;  2VG7 A;  2OTJ S;  2MTL A;  2VUG A;  5A2Q Y;  1FJG F;  2HAI A;  3EIC A;  2GW8 A;  4DU8 A;  1SH0 A;  4DL2 A;  2VFS A;  4NLV A;  1T05 B;  4KFB B;  2N7C A;  2F8E X;  1KRP A;  3J7A N;  5HP1 A;  4ILR A;  3I0R B;  3NXZ A;  4PXC A;  4NMX A;  2GHV C;  4I56 A;  1RGV A;  1IM6 A;  5L9X A;  3SSS A;  1Y9O A;  5CYQ B;  3X3U A;  4F36 A;  4ZN1 A;  2W9C A;  2DPI A;  1UW4 A;  2Z2L A;  1LXN A;  4ITS A;  4LF9 F;  5EWG A;  1PC5 A;  3HHL B;  3IA0 A;  2IM1 A;  3QGI A;  5CXT A;  1RWP B;  3OTO J;  3RAQ A;  2GC8 A;  1N54 B;  1WC6 A;  2OEK A;  2MYF A;  1GTH A;  3A3O B;  3KJV A;  4EYH B;  1ZTT A;  1UVM A;  1I1G A;  2F4F A;  4K50 A;  2H54 B;  3MR5 A;  1HIY A;  1CUL B;  1S1U A;  3HFK A;  1OSD A;  4DN0 A;  3TEG A;  4RW7 A;  2QT7 A;  4EYI B;  3QBC A;  2AIR B;  3TNV A;  1U02 A;  1WOS A;  2IC3 A;  2HFO A;  4ZHR B;  2ZH9 A;  3D6T B;  4P2M A;  3LP0 A;  5DDQ C;  5CAA A;  4KKO B;  5M2R A;  2CPD A;  3ICL A;  3Q8U A;  2F9J A;  4CLU A;  1M5K C;  1DLO A;  2B7C B;  2LQ8 A;  1WC4 A;  1HHQ A;  2WBM A;  4YB5 A;  2O01 C;  1U1K A;  3FRZ A;  4IFY A;  1C4C A;  2YBV A;  4PQU B;  4EBD A;  4CLF A;  2XMW A;  3ZNU A;  4LR9 A;  1QDU B;  1TKZ A;  5B08 A;  1T3N A;  3H5X A;  1DBD A;  1T9X A;  8RUC A;  3OVA A;  3FVY A;  2RQM A;  4F4W A;  3SZ2 A;  1FNO A;  1MN9 A;  3JSR A;  3LAN A;  4ECS A;  3KJF B;  1FT8 A;  1QUV A;  4DV4 F;  1TP7 A;  2UV8 G;  2XLJ A;  1QSS A;  3GPA A;  2JX2 A;  1N5S A;  3RB4 A;  1YIT S;  4DQP A;  4X4R A;  4YY3 J;  3CNQ P;  5HMX A;  3QRR A;  1N0V C;  3K8W A;  2KRB A;  3NG8 A;  1WOO A;  5HQ8 A;  3HP6 A;  2W2M P;  1YIJ S;  1VHF A;  3KXD A;  2GIR A;  5A76 A;  3KYL A;  4DR2 J;  3W3S A;  4DV6 F;  1JJC B;  2XBP A;  3DLB A;  1Z2L A;  2ATC B;  5A2Q U;  1FKP A;  1ZH5 A;  4GKK J;  3WBZ A;  2HBQ B;  4MJK A;  2BMB A;  1J5E F;  2DGS A;  3PRB A;  5DGB A;  2V8H A;  4X4N A;  3GFY A;  1GMW A;  2RHS B;  2I9S A;  3JAM Y;  2HHU A;  3UVJ B;  2WBR A;  1VYA A;  2C2M B;  3TZX A;  2R8H A;  4Y2A A;  5DDP C;  2HGN A;  1RP5 A;  1QVG R;  1TMJ A;  4DV3 F;  2CNL B;  1EP4 A;  1JLQ A;  4X62 F;  4LRB A;  2ADB A;  3OTD A;  4L75 A;  4DEZ A;  1H2T Z;  4J9N A;  1TV6 B;  2Q43 A;  2HQ3 A;  5DQH A;  5HBM A;  1OYE A;  1SJF A;  3ZZT A;  4USK A;  3W66 A;  3H4D A;  1UZD A;  2VOO A;  4X4T A;  4RZR A;  2CDQ A;  4Z7C A;  3BEG B;  5BXI A;  1HR0 F;  5IC6 B;  4NXM F;  2KT2 A;  2DNK A;  2C42 A;  2HVE A;  1O0P A;  2W7A A;  1FRJ A;  3Q86 A;  4OFZ A;  3TAM A;  5DLG A;  4UUW A;  3FKB A;  2NSC A;  3CJK A;  2GO8 A;  3A3P B;  2YX1 A;  3NBP B;  4X4O A;  4N56 A;  5GAG I;  3QSY B;  1QAJ A;  1R43 A;  2DXF A;  4IG3 B;  3W62 A;  2W9B B;  1TKT B;  2W2O P;  4TYA A;  3JYT A;  1RAF B;  2HG4 A;  3F44 A;  1N32 F;  5AE2 A;  2DO0 A;  3DLG B;  4OLP A;  2Q79 A;  5DG8 A;  5T41 A;  5KT5 A;  1NPP A;  1JIH A;  1JLB A;  1TKX B;  4A46 A;  4OL8 A;  4HAC A;  2PN6 A;  2EWH A;  4LSZ B;  5J2Q A;  2YNH B;  1X8D A;  5D4O A;  3UD4 P;  1HNX J;  5KTQ A;  3GYX B;  4CT8 A;  3LAL A;  3I0S B;  4FYW B;  1Y5N B;  4TN2 A;  2VG6 A;  4LIR A;  4S0M A;  3M8S A;  1IBL F;  1GXL A;  2FHJ A;  3FDS A;  1RAB B;  2GVZ B;  2JC0 A;  3BO4 A;  3T1Y J;  4DR3 J;  3EXY A;  2IA0 A;  4H4O A;  3VZI A;  4UQT A;  3J7Z T;  4I2Q B;  4U8Y A;  2EFQ A;  2KH9 A;  4DV7 J;  2MZ1 A;  2GA7 A;  1DAR A;  2AD9 A;  4P2F A;  5E41 A;  4GVB A;  1ZA1 B;  2B4V A;  1FVQ A;  3PHT A;  4JOU A;  3RJM B;  3SEO A;  3KJV B;  4LFB J;  3V81 A;  3DM2 A;  2WSF C;  3CCV S;  2Z56 B;  2M4M A;  5HJX A;  2CDR B;  2BKP A;  4DQS A;  1F5A A;  2ZH2 A;  3JS9 A;  5ETQ A;  4EZ9 A;  2CQB A;  5C5J A;  1X9S A;  2AEJ A;  2PDA A;  4USU A;  1FK9 B;  2V8P A;  4QIG A;  4R25 A;  3UDL A;  4QWC A;  1NHU A;  1TL1 B;  2LXF A;  2ZKU A;  1RLC L;  3IRX B;  2Z2Z A;  4ES3 A;  2OAU A;  3PEJ A;  3RZA A;  4K5R A;  3OR2 B;  1KDN A;  1HHS A;  2CPY A;  3CJQ A;  3HCX A;  4ZVG A;  3MFI A;  3HVR A;  4Z7Y A;  4NCB A;  4OYB A;  2KZM A;  2XMM A;  2CWX A;  4M5L A;  5DGA A;  1HNW F;  2DNP A;  2JRS A;  3J7Y U;  4FP9 A;  2B51 A;  3AD7 C;  2IPO B;  3AJ2 A;  4GMK A;  3BDP A;  2QLF B;  2RDI A;  3PFE A;  1TL3 A;  4WFB Q;  1U8S A;  4DU7 A;  3MOJ B;  3QQC D;  1U1L A;  1FFW B;  1PYT A;  3OJU A;  4OYP A;  3K5O A;  3PX0 A;  1H2V Z;  3GE9 A;  4C8Z A;  1R6V A;  1U6Z A;  1N34 F;  4G3I A;  3NOG A;  4YFU A;  4OX8 A;  2JZ5 A;  1WHW A;  2EW9 A;  2R8I A;  1Q4R A;  2E5J A;  1M5H A;  1ICE B;  1AB8 A;  2BJE A;  1NO8 A;  2MST A;  3BSC A;  3KJN B;  4NE9 C;  5A8R A;  3MMB A;  3VV2 B;  5F8G A;  2DO4 A;  2UUC J;  3NCQ A;  4LF8 J;  3MTK A;  3H2U B;  3HXM A;  1RWM B;  2B9X A;  3FMB A;  1GFW B;  1Q95 G;  3Q24 A;  4DV0 F;  3P3D A;  2IJN A;  1S1V B;  3ENW A;  3Q8R B;  1YTY A;  3TZZ A;  4DHV A;  2C2R A;  1HLW A;  4HT5 A;  1UEV A;  1KC8 T;  4GKJ J;  4MK7 A;  5ETL A;  1K1S A;  1XBW A;  3MPD A;  1N36 J;  5B0D A;  3C3L A;  5DRK A;  4DR4 J;  3OHA A;  1FA0 A;  2DB1 A;  2J0W A;  4RWX A;  3TVY A;  3CPW R;  2CYY A;  4YHH F;  2MPU A;  1D8Z A;  4L72 B;  4XPC A;  2YKP A;  5D15 A;  2B9E A;  3MPW A;  4YP3 A;  3K59 A;  4J9Q A;  2FLL A;  2LDY A;  3TI0 A;  3GFX A;  2AT1 B;  2AF6 A;  3V5R A;  2J0S D;  3R5B A;  2WVD A;  3M05 A;  2WW4 A;  3EJM A;  2YKO A;  2OIH A;  4FYD A;  1HNV A;  4KTQ A;  4NA2 A;  3TW0 A;  4PWD B;  3CME S;  3FCV A;  2B7B B;  4X4S A;  1HBU B;  1SQF A;  1R0A A;  4JI4 F;  4HL9 A;  3KHL A;  4F2S A;  3LAM A;  3C14 A;  5KFB A;  3MI7 X;  1WC1 A;  1NJX A;  3AA8 A;  2MZR A;  1BMQ B;  1A9N B;  1WG5 A;  2DRB A;  2KYX A;  1Q79 A;  3O8W A;  1ULR A;  1YJV A;  2MQ8 A;  4ZPW R;  2F63 A;  3D66 A;  3NRB A;  1TKD A;  5CD4 H;  2VOP A;  7FDR A;  2YPZ A;  1YBU A;  2A0F B;  5IS2 A;  1P9Q C;  1YZ7 A;  1W7W A;  2HBY B;  4DI6 A;  2HZC A;  1DQA A;  5J2Q B;  5D3G A;  4PZV A;  3FC9 A;  2MZS A;  4MK8 A;  3SFG A;  1E6V A;  3BR9 A;  4FXW A;  2C3O A;  4GO7 X;  5KFT A;  3WZ0 A; 
#chains in the Genus database with same CATH homology
 4EK2 A;  2DY9 A;  3EIC A;  5C7P A;  2BX6 A;  1NPK A;  1UCN A;  3Q8Y A;  3BBC A;  1MN7 A;  2CWK A;  2DXE A;  4FKY A;  4O0N A;  4S0M A;  3VGV A;  3EVM A;  4UOF A;  1NLK L;  1XIQ A;  2B8Q A;  4F4A A;  1NB2 A;  4DZ6 A;  4F36 A;  1WKK A;  5CAB A;  1B4S A;  3EE3 A;  1F6T A;  5IOL A;  1F3F A;  1NHK L;  3PRV A;  3NGS A;  3VGT A;  1S59 A;  3JS9 A;  1U8W A;  1HIY A;  2HUR A;  4KPC A;  3B6B A;  3NGU A;  4WBF A;  2B8P A;  4ANE A;  3DKD A;  3VGS A;  1PKU A;  2DXD A;  2DYA A;  1KDN A;  5CAA A;  1S57 A;  3EMT A;  1NUE A;  3Q8U A;  4ENO A;  1HHQ A;  3GP9 A;  3L7U A;  3DDI A;  1JXV A;  1NCL A;  3ELH A;  1EHW A;  1ZS6 A;  1BUX A;  1NDL A;  1PAE X;  2HVD A;  3ZTR A;  1MN9 A;  3NGR A;  3EVW A;  3EM1 A;  3PJ9 A;  3WX8 A;  3ZTP A;  3GPA A;  1LEO A;  3FBC A;  3ZTO A;  3Q8V A;  4FKX A;  1B99 A;  3BBB A;  3BH7 B;  1XQI A;  3ZTQ A;  1NSQ A;  3BBF A;  1BHN A;  1HLW A;  1LWX A;  3Q89 A;  3FCW A;  3MPD A;  4DUT A;  3FBF A;  4C6A A;  1VYA A;  3FBB A;  3VVU A;  3VVT A;  4UOG A;  3VGU A;  1NDK A;  2AZ3 A;  4UOH A;  3B54 A;  4W98 A;  4ANC A;  3Q83 A;  2AZ1 A;  2BEF A;  3EJM A;  4HR2 A;  1WKL A;  5BXI A;  3FCV A;  2HVE A;  3FBE A;  3ETM A;  3Q86 A;  4CP5 A;  3BH6 B;  1NSP A;  1WKJ A;  3FKB A;  1NSK L;  3EVO A;  3ENA A;  3G2X A;  2DXF A;  1NDC A;  1BE4 A;  1K44 A;  4AND A;  3ZTS A;  2ZUA A;  1S5Z A;  1W7W A;  3R9L A;  1NDP A;  4DI6 A;  3FC9 A;  2VU5 A;  3NGT A;  2NCK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...