1FHTA

Rna-binding domain of the u1a spliceosomal protein u1a117, nmr, 43 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
116
structure length
116
Chain Sequence
AVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Solution structure of the N-terminal RNP domain of U1A protein: the role of C-terminal residues in structure stability and RNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribonucleoprotein
total genus 11
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1996-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fhtA00
5IQQA 1JJHA 3TP2A 3B4MA 2DO4A 2DNQA 2MSSA 3UCGA 3NNCA 2LQ5A 1O0PA 2EK1A 3BS9A 3MOJB 1WHVA 2JWNA 4IOCQ 2OSRA 4TU7A 2J8AA 3SDEA 1XN9A 1X0FA 2HYIB 2DGWA 3VAMA 3Q2SC 5GADU 1WHXA 2CQBA 5LXYA 1M90T 3CF5Q 3UWTA 4Y0FA 1OPIA 1AUDA 3N9UC 5D78A 3MURP 2QA4S 1VQOS 2X1GA 1X5TA 3CCJS 2VONA 4A8XA 3VAIA 2BZ2A 3CCMS 1QVGR 5FJ4A 1X4GA 5IFMA 1B7FA 2K8GA 1R8HA 1HA1A 1JJ4A 2UP1A 1VQPS 1WHWA 1WEXA 2M7SA 3EGNA 1HD1A 2HGMA 2M0GB 1VBZA 2KM8C 3G96A 5JVGQ 1WEZA 3G4SS 3P5TL 2DGVA 2E5IA 1Q7YT 3VF0B 2N3OA 2HZCA 3NNAA 2FY1A 2MYFA 3J7YU 2KU7A 4Y00A 2MHNA 4ZKAA 5DETA 2VOPA 1VQ9S 4LMZA 5HO4A 3CCES 2PEHA 4FXWA 2DGUA 2EK6A 2SXLA 4M5DB 1CVJA 2KXHA 4Z2XA 1WG1A 1JMTA 2DIVA 2LEAA 2J76E 3B4DA 3CMAS 3HI9A 1FXLA 2XS7A 3V4MA 1N52B 2KHCA 2DH9A 2MQOA 3MD3A 5LXRA 2OTJS 2ZJRQ 2CPYA 1PGZA 2FC9A 2DGQA 2CPEA 1X4DA 1SXLA 3CUNA 2G1DA 2F9DA 4QU7A 2GHPA 4UY8T 2LA6A 2CQPA 2AYEA 2WBRA 3MI7X 2KM8B 4BS2A 2KI2A 2MKIA 1X4CA 5GVQA 3CCRS 2Q79A 2RS2A 1YJ9S 1KC8T 2CQ2A 3CTRA 4WFAQ 3PIOQ 2YKAA 5DDPC 1WI6A 1W2BR 2L9WA 5D77A 2KG0A 3VAGA 1KD1T 1H2VZ 2M8DB 3P6YC 3NMRA 3H2VE 2MQNA 1U6FA 3CULA 2DITA 3S7RA 3CMES 1H2UX 1KOHA 1U2FA 2KFYA 2DNOA 2MMYA 3TO8A 2DNKA 4CH1A 1U1OA 1UFWA 2ADBA 1RK8A 3P3DA 1X4FA 2EVZA 1ZZNA 2MKKA 2LXIA 2RRAA 2U1AA 1URNA 2PE8A 2DHAA 1P1TA 5DDRC 2CQGA 1FO1A 1WWHA 2MB0B 1YWXA 1X5PA 2KXFA 3CC7S 1SJQA 1HD0A 1HL6A 5DDQC 1K8AT 3P49B 2NLWA 4U67Q 1SJ3P 4ERDA 3U1LA 1FHTA 1X4HA 2HGNA 3MDFA 2AYBA 2M9KA 2ZJPQ 2G0CA 2LMIA 2A3JA 3FEXB 1VQ4S 2XS2A 1YITS 2F9JA 1N88A 2CPFA 2AYMA 1PO6A 2MKCA 2NZ4A 3VAHA 1WF1A 1UP1A 2MZRA 1WF0A 2DNGA 2L41A 1VQMS 2OIHA 2MGZA 2OTLS 3RW6A 2MY7A 2HGLA 4CH0S 4PKDB 5IM0A 2DGOA 1YJNS 1KOOA 3UE2A 3R1HA 1WG4A 1Q82T 4WF9Q 3CCVS 1ZZFA 2KXNB 4IOAQ 3US5A 3SDEB 2M8HA 2DHXA 2N3LA 2MJUA 2CPHA 2AD9A 2JVOA 3THPA 1FJEB 1VQ7S 2D3OR 2JVRA 2LCWA 3H2UB 1QM9A 1VC5A 3CCLS 4OZ0A 1N8RT 1UAWA 3NNHA 3NS6A 5LSLA 3FEYB 1OO0B 2I2YA 1JJ2R 2M52A 2RNEA 5LSOA 2XSFA 3S01A 3BO3A 4F02A 5CYJA 4WIIA 2CQCA 2D9OA 2LYVA 3UCZP 3K0JA 1M5VC 1Q81T 2MQLA 1Q86T 2RVJA 2M4MA 1VBYA 4W92B 1OIAA 2B0GA 3CXCR 2MPUA 1U1LA 1L3KA 1WF2A 4F26A 3I56S 1G2EA 3UD4P 5DM7Q 2DH8A 2V94A 4RU2A 2CJKA 2CPJA 1M1KT 2N82B 2DB1A 2KVIA 2M88A 2J0SD 1BY9A 1FJ7A 3CC2S 2ZJQQ 2K3KA 4YB1P 1DRZA 3EGZA 1M5PC 1X5SA 2XB2D 4J5OA 2N7CA 5DM6Q 2KH9A 2MJNA 1A9NB 1KQSR 1VQNS 5DDOC 4C7QA 1FNXH 2DNMA 2YWKA 1SJFA 1YIJS 2FC8A 2FPHX 1S79A 5GMKa 3I55S 4YOEA 2CQHA 1YHQS 2M2BA 1D8ZA 2E5JA 2RU3A 1U1KA 1FT8A 1YJWS 2AYGA 1A7GE 4TU8A 3L3CA 3CCUS 4IO9Q 1VC6A 1IQTA 3UCUP 2DNLA 3MUTP 2QFJA 2DHSA 1NJIT 3R27A 5LJ3Y 2CPXA 2LA4A 4ED5A 1U1NA 3MUMP 2E5HA 4W90B 2KRBA 2RT3A 2X1FA 4LJMA 3S8SA 2LECA 3BO4A 4QPTA 2OSQA 4FXVA 1S72S 1WG5A 3S6EA 3G71S 1U1QA 5H1SV 1WEYA 1U1MA 4C4WA 4IUFA 3SMZA 5GAEU 2YTCA 1M5KC 1K73T 3MD1A 2M70A 3NS5A 3R1LA 5CA5A 3D2WA 4WCEQ 2RS8A 3EX7B 1VQKS 1DBDA 3HHNB 2DNPA 4C0OC 2JX2A 4P6QA 3DLLQ 1R8PA 1VQ6S 1YI2S 2HVZA 2CQDA 3MUVP 3BO2A 5CXTA 2DIUA 5GAGU 2DNZA 1K9MT 2CPIA 5JVHQ 1WTBA 2O3DA 1U1RA 5MLCV 4TU9A 3VAJA 2KG1A 4EGLA 2DO0A 1WELA 3VALA 2RQCA 2CQIA 2OJ3A 1U6BA 2X1AA 2MKJA 1OWXA 2MKSA 2ERRA 1NO8A 2GO9A 2L08A 2MGZB 2G4BA 2FHOB 2DISA 5IM0B 3G8TA 2KN4A 2CQ4A 2MZJA 5GAHU 2J0QD 3G9CA 1DHMA 2U2FA 3THTA 2DNHA 2DNYA 4UQTA 3G6ES 1SJ4P 3SXLA 2DNRA 1SJRA 2MKHA 2MZSA 4WFBQ 2DNNA 3IRWP 3CCQS 5ITHA 2DHGA 3CD6S 4WFNQ 1UW4A 4QQBA 2RRBA 1U1PA 2YH1A 3BEGB 2MY8A 3G8SA 3J7ZT 2D9PA 3CPWR 4TLQA 2E5GA 2MQMA 4F25A 3VAFA 1VQLS 2MZTA 2MZQA 2KT5A 4PRFA 1VQ5S 1X4EA 1X5OA 3MXHP 1NU4A 2MZ1A 3IWNC 4OZ1A 3LPYA 1FJCA 4CQ1A 3ZZYA 2MQQA 2CPDA 3U1MA 4WKRA 2CQ3A 1P27B 5HL7Q 2I38A 1D9AA 3TYTA 2RQ4A 2DK2A 3ULHA 2VOOA 1N54B 2F3JA 2LKZA 4LIRA 3PIPQ 3CCSS 1H6KX 4V19X 5LJ5Y 2MQPA 3JB9k 1X4BA 2KYXA 5BJRA 2E44A 1M5OC 1ZH5A 2VODA 1RKJA 2DGTA 2XNRA 3OW2R 3LQVA 3ZZZA 2LEBA 2YH0A 2ADCA 2KRRA 4CIOA 2QEXS 1F9FA 2CPZA 2MSTA 1DZ5A 3UD3P 3VAKA 1X4AA 2X1BA 2JRSA 1QVFR 4PR6A 2CQ1A 3CC4S 3Q2TC 1YTYA 2DH7A 1VBXA 1WHYA 2XS5A 2MXYA 1H2TZ 4YUDA 1VC0A 3DXBA 2CQ0A 4QU6A 2RUGA 1VQ8S 1WI8A 2XNQA 2LXUA 2DGXA 2BOPA 5EN1A 3RW7A 2DGSA
chains in the Genus database with same CATH superfamily
1XQIA 4YY3F 3NNCA 4LF8F 4DV2F 1U02A 2YNGB 2OPQA 2ZUGA 1WHXA 3OFHA 2PA3A 2D3UA 4YDXA 4YEAA 5HQ8A 4YFUA 2HHHF 1RWMB 1U24A 5F8HA 1HQUA 4CLTA 1UEVA 3K17A 3MR5A 3R5BA 1ZAVA 3CNQP 3MR6A 4LSNB 5JJBA 2BANB 4Z2XA 1IBCB 3W9IA 2GO8A 1T95A 4DSIA 3A3OB 2VG7B 1T9TA 2XS7A 1Q4RA 1HPZB 1N52B 4CO1A 4G1PA 3KDOA 2CPEA 1SXLA 3DOKA 1NPKA 1KEKA 1AROP 3RAXA 1PIEA 2HFNA 1KD1T 2NREA 5D0EA 4DX6A 3HKWA 3QLHA 5BYSA 3GLJA 4FPRA 2EKNA 4F04B 4PCQA 2EVZA 1VFJA 3POTB 2VDIA 5D6GA 4ER8A 1SJQA 4RW7A 1ZA1B 2H51B 2A2DA 1RSCA 4LF7J 4I2PB 1RACB 3V4IA 1WF0A 3P96A 4NWBA 1FDBA 2WW8A 4OQJA 2KXNB 2UV8A 4NPOA 4WP3A 4J9RA 2D3OR 1JLGB 2QLWA 3BH6B 4YR3A 3WIVA 1KR4A 3FEZA 4KGKA 2HNZA 2RNEA 2ZEJA 1TVRB 3KHLA 3UCZP 3Q86A 1UJ4A 3Q83A 4MFBA 2VH7A 3RRHA 3DU5A 1RCOB 3K5LA 1BY9A 3JXOA 1K44A 1NB7A 4ILLA 3O8WA 4CLPA 5CQGA 1FNXH 4C97A 3ILLA 3DOMB 1QUPA 4DR5F 4CLUA 2R8HA 1NSAA 1CLFA 3A8IA 4X4RA 4EBEA 4JYAF 1TUGB 4YHHJ 5HMXA 2ACMA 2DNLA 4LF9F 5BXIA 1RWPB 1F60B 3PO4A 3FK4A 3OTDA 4USHA 2KRBA 4PUOA 1ROFA 4LJMA 3ZNUA 1LXJA 4KRWA 4C4WA 2VFUA 2KHDA 4QZVB 2FJEB 3KNAA 4FNHA 2OMOA 2O1PA 4E98A 2YNGA 1N34J 4ZPAA 1VQ6S 1V5IB 4X4OA 3ZZUA 3MUVP 1NPRA 5GAGU 1NK7A 1OMSA 4FF4A 5KTQA 1XMOF 4M5JA 1BE4A 2DPIA 1WNEA 3KLGB 1S6OA 4FKYA 1HW8A 3PNIA 4J9QA 4GVLA 2A6OA 2B51A 2OUGA 2U2FA 4LSNA 5KFHA 4LRDA 5DLFA 2W9BB 2BANA 4KQZA 1KQFB 2VG7A 1HPZA 1RHRB 4KT0C 3WC0A 5GAGI 3MXHP 3IWNC 2IBOA 3U7JA 3OTOF 1YJRA 3OTEA 2RQMA 4CLLA 2PFDA 4NCGB 1VDHA 4F2SA 3EVOA 3HSZA 1UZHA 2QRRA 4ZVOB 3NGSA 4CH7A 1RYRA 1GTHA 3POTA 4EBDA 1F9FA 1FWPA 4ZOSA 1RQ0A 1UW9A 3DLBA 2DR9A 5E3PA 2ALZA 4HHUA 3CWJA 3R8YA 3ZZPA 4I2PA 4ZJLA 4RW4B 4ELUA 4EBCA 1X31C 4FYDA 2Z4PA 4J7CA 1FDAA 4LRFA 2IM1A 2HVIA 1VJWA 1N4LA 1X0FA 3M8YA 2OMLA 1RABB 1NK9A 1VLOA 3JQMA 4ZK7M 2A1BA 1JLGA 2FHJD 3K5NA 3R5CA 3OXGA 2ASDA 4UUXA 2K8GA 1TVRA 1JJ4A 4ZVHA 2PI4A 3NGUA 1F9HA 4IR1A 1C1BB 1SPBP 2R2TA 4ZCKA 3DFEA 4GC6A 1UA0A 2KU7A 1XWLA 4O3NA 4ZVSB 4Q44A 4WE1B 2W1BA 1IVZA 2PEHA 1B0PA 1OSDA 1GFWB 1K1QA 3PTWA 1G4CA 1S7HA 1YSJA 1IKYB 3V4MA 4JI0J 3ELHA 3DOMA 5GMEA 3ZTQA 5ETMA 1G3OA 3N6NA 4EYHB 4QU7A 3AB4B 4ZCLA 1DTQB 3A13A 4DCJB 4TY9A 4OI0A 5HK4A 2JC0A 2Q79A 2RS2A 3A4TA 1NM2A 2HS3A 2ZM6J 1U45A 1TU0B 2MQNA 3AAWB 3PDNA 2FVQA 1H2UX 3KXDA 2YNHB 1JK9B 1Q7LB 4QIVA 1QAJA 5DDRC 1MU2B 1T9XA 1T8EA 4NLWA 5K8OA 2ZJPQ 5F0WA 4WK1A 1R6YA 2HRYA 3KLGA 3MF5A 2R7TA 1ZBTA 2NZ4A 4UOGA 2YWFA 1TL4A 4B9VA 2PIIA 4U7UK 4WYLA 2E1CA 1UVLA 4LREA 1EARA 1XTZA 2GX8A 2YX7A 4CTAB 1ZZFA 3HDSA 2W9BA 2ASYA 1RTHB 3QSIA 3NEKA 2LCWA 3H2UB 1IBKF 3KUGA 2HLUA 4NXMF 3IXQA 2Z2ZA 2VBWA 3EVMA 5J1EB 2LYVA 1T9WA 1JB0C 3AQPA 3RGIA 3D67A 4BC9A 4NCGA 4LF4J 4A47A 2ZDOA 4YB1P 1U8WA 4DHVA 4OYBA 3ILIA 3MMJA 4JB8B 2DNMA 5GMKa 2AF6A 1VRUB 2H5JB 1YX2A 1FT8A 4R0JA 2F4VF 2KTQA 1VC6A 1ZTWA 4HYKA 2XGPA 3MUTP 4OZJA 7FD1A 2E5HA 2WB1D 3AQOA 4RW4A 2FZGB 3HZEA 3NBPB 4CO5A 3OL7A 3G71S 1U1MA 2OFGX 4OJHA 1KKHA 3NS5A 2EWHA 3D6FB 3R1LA 5E3RA 1DBDA 3KTQA 3ICLA 4P6QA 3WQPA 1NPPA 1VLYA 4ZVQB 2AU0A 2AIRB 4LFAJ 4JI3F 4K7QA 1Z4UA 4RUBA 2AHOB 1WJ9A 2FHMA 4X4UA 2YNIB 2JLEA 3KK1B 7AT1B 2YWGA 2IMWP 2OJ3A 1C1BA 2VZ9A 5EGYA 3C66A 4YS2A 3H4BA 3KLEB 3V2UC 4KC5A 4N77A 4WE1A 1S0NA 3VR1A 1SH3A 1D09B 3IRWP 3IRXB 4GKKF 3IAM9 4DOZA 1QAXA 2DHGA 1YRTA 4WU2A 1TR0A 2OKQA 3ETMA 2VL1A 2V8GA 1X9WA 1IKYA 2AEJA 4J9PA 4X2BA 3LH2S 3FZBA 3FVYA 4O3RA 1N33J 3BQ0A 2MZ1A 3B82A 1U7LA 4DFKA 1DTQA 4QW9A 5D4PA 2CQ3A 1P27B 2DXEA 4V19J 2AJFE 1IBMJ 3OLBA 4LSZB 3GCXP 4V19X 2VPZB 1X4BA 2D41A 9ATCB 1ELOA 4LR9A 2YNHA 3R3TA 2DGTA 2X51A 4P74A 3H7HB 2DEIA 2JJ4D 2FJWA 1MU2A 2R8GA 3KLIB 1B0TA 3K7RA 2X1BA 3IR6B 2XULA 3Q8YA 2RHSB 3BPSP 1AZSB 3I82A 5C2GA 5IC4B 5D3GB 4DPUA 1NDKA 2XZDB 3TEHB 4G65A 5KFDA 3PX4A 2DO4A 3M6UA 2AQ4A 4F4AA 4CTAA 2EK1A 3BS9A 1YJVA 5KFIA 2OSRA 3VZIA 3BDEA 4F0HA 1RTHA 2YX4A 2DRBA 1ZETA 5ETSA 3FRZA 3KUHA 3FBEA 2CQBA 4ZN1A 5LXYA 3GG1A 1PYTA 1DY3A 4RUCA 1RE1B 5J1EA 2XG8A 3HSJA 3GSIA 1R8HA 1WHWA 2AV5A 3M8SA 3SCJE 1SC1B 2G0JA 1RAIB 1KONA 2PA8D 4OI6A 1RTZA 1K47A 1OSCA 2G1HA 1YK9A 2NXNA 3PRVA 2F8MA 1P6TA 1P1LA 3SSQA 1KQKA 3V5RA 2VICA 2Y8YA 1VRUA 2BRKA 4C9DA 5HJYA 4KGZB 1GX6A 3KJNB 4DL4A 3OPKA 4KPYA 4ELTA 3IA0A 1RU1A 3JAMY 1SKWA 4CLWA 3T1HJ 2OFHX 2B6AB 5C25B 4IFVB 4KHPJ 4OYZA 4USMA 4ECTA 1DQAA 3PIOQ 3THVA 3UD5A 5D77A 1W2IA 3NBPA 1L3VA 4LRCA 3PHTA 2RAQA 1AT1B 4UZBA 5IWAJ 4AL5A 1NH7A 3DKDA 1CQNA 2R7QA 5L39A 2LXIA 3EMTA 1U0SA 4AYBD 2QYGA 1WWHA 1VRQC 1HHTP 4ZVFA 1YBUA 2H9ZA 1KHVA 3HHLD 1P9QC 2HGNA 3T1YJ 2M9KA 4Y3CA 2YNIA 2CZ9A 4NE9C 3KK1A 1OYDA 4TKTA 2HHQA 1VHFA 2MY7A 3KLEA 1HQEB 2BOAA 3CCVS 4IOAQ 4X65J 1RTIB 3IBCB 4A8KA 2K7JA 1PG5B 3IRXA 4X4PA 4AQYF 2XBPA 2JEJA 4QR1A 1PCAA 4LIWA 3NNHA 4MKYA 3PW4A 2M52A 5D4LA 2BXJA 4Y28C 4I6WA 2RVJA 2VQFF 3DLJA 2QMWA 3OFGA 1U1LA 4USJC 1B7YB 1WUUA 2XHCA 2VG6B 5LSRA 2JFKA 1R0CB 1W25A 3GJRB 4LQ9A 4D3GA 2M88A 4X66F 4J5OA 4WWSA 2OEJA 4H4MB 2B56A 2AJ4A 1GMUA 2FQQB 2BW7A 3GTYX 3MAHA 2FZKB 3KLIA 3JS9A 1ZM3A 4IO9Q 1HNXF 1OY6A 4IO1A 2DT9A 2UUAF 3UN3A 4DV4J 5LJ3Y 4ED5A 1SH2A 5KFJA 1AZSA 4Z7YA 1JLBB 1SC4B 2UVWA 2OSQA 2RF2B 3ZTOA 4OL8A 5H1SV 5D3GA 2BJDA 5IQ6A 3MPYA 3BYPA 3HLUA 2YY3A 3EX7B 4ZDNA 2AGQA 3UDVA 2XI3A 4YB5A 1S0MA 3ZNJ1 1D9FA 1H3DA 1RTJB 5LL6d 3C8YA 1VQSA 4M95A 1TUVA 4H4KA 4F50A 1NK8A 1U1RA 4B3MJ 1R89A 1WELA 1U6BA 2GMLA 1NLKL 3C3LA 4XO0A 1RDRA 1YBTA 2ERRA 1NO8A 2UUTA 2FHOB 5CD4A 2DXFA 5J2QB 2VQEF 1YQHA 3G9CA 1HR0F 2QZ8A 3D9BA 4DV0F 1IR0A 2KL8A 1S9FA 3BEGB 4DL6A 1AA1B 4DL0C 1S9EB 2YWHA 2DHHA 2ZH4A 3J7A1 2MQQA 5KFVA 4DPYA 5DJBA 2B6AA 5C25A 4IFVA 4L76A 4JI6J 4M5MA 3IFEA 4ATNA 4CRJA 3LTOA 4B9MA 4D3HA 4LIRA 2MLYA 1JLCB 3HD1A 2XLIA 3JB9k 3RG6A 5F8IA 2B4VA 4PYAA 2ATLA 2L3MA 1IWGA 1RBLA 4UTGA 2NXJA 1RP5A 5C5JA 1DZ5A 3I5BA 2JRSA 4JOUA 2DPJA 3MOZA 5A76A 1FX2A 3M8PB 1TAQA 2XNQA 1LWEB 4DEZA 3TP2A 2WSFC 2VB6A 2FDNA 1HQEA 2F8EX 2VPYB 3DYAB 4TU7A 1SKSA 1S1XB 1RTIA 1FRKA 3EZUA 1NNDA 3VAMA 3KJFB 3T5JA 3OVBA 2FJAB 3C16B 1B70B 1FRMA 1IR1A 4Y0FA 1ZS6A 2O01C 3MURP 5A0YB 1S1TB 4NCBA 3NCRA 2XMJA 1RJJA 4K4VA 2B8PA 2NS1B 2FLNA 2FHKA 3L09A 4ED1A 4LT6A 2C2KB 2HWHA 3R7NB 4A8WA 2DGVA 4WPAA 1Q7YT 2IVFB 3R9LA 3MEEB 1N32J 2VG6A 4B3SJ 3L7OA 4BCAA 2UUCJ 3KUEA 1HQ2A 3CCES 4DV6F 3MZIA 1X0PA 3GIIA 4LBHA 2DGUA 3Q8PB 3ENAA 3HSGA 4H4MA 1DFDA 2KHCA 1R3NA 2MQOA 3VZHA 2OTJS 3W5YA 1DAXA 2FC9A 4ZMMA 1Y5IB 3IGNA 5DS7A 1MW7A 2I8EA 1HWKA 4NEYA 1K0VA 1JLBA 4UOFA 4WFAQ 2RF2A 1TTHB 1RYSA 2HNDB 1BLUA 4TQSA 1FK9B 1CJTB 2RRAA 3JQKA 5LMNF 3KLHB 3UR0A 4NASA 4NZ0A 1X5PA 3KMSA 1RTJA 3P49B 5E33A 3SQGB 2E5LJ 2AYBA 2GQCA 4C8KA 4J37A 4CYUB 4CLFA 2AYMA 1Q1KA 3X1LB 4IDKB 5KFRA 1VYAA 1MN7A 4ETXA 4ES2A 1IM4A 1FRJA 4CH0S 3H42A 5J2QA 3FDSA 1T02A 5KT2A 5HN0A 5EX0A 1VMBA 3O2IA 4N8NA 5K14B 5E2QA 1QM9A 5KFYA 2IM3A 4M94A 3TX8A 3W2WB 3GILA 1F5BA 4OHYA 2B4UA 5IV4A 1S9EA 1UPPA 2B0GA 4F26A 4NA3A 1S0OA 2EEYA 2W2OP 2DR8A 2H48B 2KVIA 3IM9A 3J81Y 1RUSA 2ZJQQ 1JLCA 1RA6A 5M2UA 2H65B 2DRAA 5DM6Q 2KH9A 1A9NB 1KQSR 3TI0A 1S79A 1PC4A 1WDDA 2FIUA 3TZXA 3EZOA 8AT1B 4I64A 1FWLA 5LT5A 1HNZJ 3Q8SB 5KFKA 1K1SA 2G2OA 4W98A 1Y10A 2DHSA 1Y4ZB 4KPCA 3M8PA 4MTPA 1LWEA 4QBUA 1K73T 4KY3A 2ZZTA 1XNQJ 3DYAA 4DV5F 1S1XA 2OLWA 2CJYB 3HHNB 3C16A 3RRGA 4B9UA 2DIUA 1H7XA 5A0YA 1S1TA 4CO3A 1U2CA 4TU9A 2GIQA 3Q0AA 1WC0A 2KJVA 2KZZA 2L08A 2D1CA 2Z58B 3MEEA 5ADZA 5ETVA 1XC9A 2MHEA 2JL9A 1RBAA 1HNWJ 4NLVA 3HHKA 4ZP8A 3G6ES 2EXUA 2ZH7A 1NK4A 2PC6A 4EU0A 4OYXA 1RA7A 4M63A 2E7VA 4K2XA 4R5PB 4LF5F 3G6VA 2FVRA 4RU9A 2GQ2A 5HLFB 1BWVA 2HFSA 3G86A 4O23A 3X3UA 2GMHA 1Q8BA 4A8MP 3PW0A 5L1KA 4Y6IA 3PIPQ 3CCSS 2PSZA 5KT4A 2HNDA 4HI1A 1FK9A 1NSKL 1CJTA 4DN9A 1RKJA 4BLGA 2XNRA 3IBFB 4DUZF 5DG7A 3KLHA 3R7SB 1F5CA 2Y1IA 3VAKA 3MM6B 5I4MA 3SQGA 1LWXA 4O3QA 3K5OA 4CYUA 3AOAA 2RUGA 3IP0A 3EM1A 2LXUA 4IDKA 4HI2A 3I87A 2BOPA 2OAUA 3CJSA 5IQQA 2IYIA 2V8PA 2LQ5A 1SB6A 4NRTA 3MEDB 3BDPA 1JXEA 1XN9A 2Z8QA 2HQGA 3D5MA 2OPSB 4NRUA 2ZH5A 5KFCA 3N6MA 5K14A 1SQFA 4Q43A 4DUYJ 5KT5A 4WP9A 3DRRB 1XIQA 1FD2A 1X5TA 3DRXA 4LRBA 3W2WA 1NKBA 2LEPA 1KBRA 3W9HA 1VBZA 2Q66A 2IDLA 3QWPA 5F3TA 4IRCA 2CNLB 4L6V3 2EFOA 2AWZA 1BC6A 2V4JB 3MEKA 4U6PA 3QAUA 2BM0A 4J9LA 3GP9A 5KAKA 3DHWC 4CZCA 4K4WA 2ZD1B 1OS5A 1S99A 4AUKA 2DRDA 2K1RB 1PGZA 1F0XA 5D0GA 5GMDA 1Z2LA 1FKOB 3LP1B 2IRUA 4OYIA 1UEKA 1HFEL 2RDDA 3QIDA 4C3KA 4JI2F 3CCRS 4ZITA 1YJ9S 4ZP7A 3NGTA 5T7LB 3BR8A 2HK3A 4AL6A 3A8JA 3ISZA 2C1EB 1B3TA 3E51A 4F8RA 1HBMB 1GMWA 2HHPA 1KOHA 4PPZA 3N5BA 3OL8A 2W2QP 2RB7A 3M6VA 1CEZA 2WONB 2KDOA 2BJ9A 1JLQB 4EEYA 3IC1A 2A18A 4HACB 4WBFA 5SUHA 4U7UD 2AJ0A 1XJWB 3P4UB 3WBZA 4OX8A 4QCLA 1DJ0A 3H4DA 2O67A 2JEFA 5CZXA 2CPFA 2FJBB 3AJ1A 2MZRA 1HW9A 7FDRA 1VQMS 1IM6A 2V2ZA 4U8VA 2RUSA 3R1HA 4C0BA 1WG4A 4WF9Q 2YQ3A 3CDEA 3NS7B 2CPHA 3LWLA 1XMQJ 3PW2A 2ZH9A 1UAWA 1SL1A 2I2YA 1CS4B 4R5PA 2C3PA 1LK5A 5LSOA 4F02A 1H0HB 2LDYA 2CNOB 2CQCA 2G13A 2D9OA 1XMBA 2VG5B 1Q81T 4DV3F 1R0AB 1HWJA 1VCTA 1BUXA 4HVZA 4RR5A 5HLFA 4DQQA 4U95A 3GIRA 4B3RJ 5KG4A 2CPJA 3QJLA 3C6TB 2X3DA 1CJVB 4DL7A 1D3WA 4QR2A 1VGYA 2EC2A 3JAMU 2AX1A 2FPHX 2F4FA 2YVSA 1H72C 2W7PA 1UKUA 1A7GE 3M6WA 3MM6A 5L1LA 3QRPA 3PRBA 2XZWA 2W2PP 2DR6A 1IQZA 4UUWA 1WEYA 2E9RX 1PJ6A 5RUBA 2J6UA 4YMEA 3MEDA 3M05A 4X4NA 5M2RA 2R7WA 2OPSA 5CAAA 3DRRA 1L5UA 3R5AA 4JI7F 3U02A 2BM1A 3L4BC 1B4SA 3C19A 3NG8A 4JI5J 4M8LA 5L46A 1IJFB 1R0BG 2CNKB 1FEHA 2CQIA 2A10A 4P7VA 2PFFB 2FD2A 2CQ4A 3CE8A 4IYQA 5GAHU 2W2MP 4RUAA 1MLAA 3VQSA 4Q2MA 1PC5A 3HT3A 2V4JA 3TVYA 2XCAA 3DI6B 5BYQA 3I96A 2CFXA 2YH1A 2ZD1A 1RT4B 3B8HA 2M5YA 3TJAA 4ZLLA 2MZQA 3MR3A 1X5OA 2K1RA 3LO3A 2E29A 1FKOA 3BSCA 3LP1A 4ZS6A 3PACA 2UXDJ 2MQ8A 3GMGA 1WOSA 2QIFA 5T7LA 3HHEA 2VOOA 1JNRB 4ED2A 2YKPA 1HBMA 1H6KX 3QFHA 4RL1A 2E9TA 2KYXA 4WU3A 4NZ7A 4UOCA 2WONA 1CQMA 2YH0A 5HSPA 2ADCA 1JLQA 4HACA 5KG2A 2UUBJ 3D6HB 2EFGA 5ETLA 5LOQA 4U7CA 2LQBA 3OLAA 3OBIA 3QFWA 2CQ1A 3CC4S 2DYAA 1YTYA 3AD9C 4CLSA 1RHJB 2O5DA 5KT7A 2Y8WA 4I6YA 1FFGB 1H2TZ 3DXBA 5KG3A 2UU9J 2GIFA 3MPUB 4PG5A 4Q8FA 2DNQA 3VHQA 2WB4A 1UVMA 4P2SA 1LXNA 5DQGA 3V6HA 3D0IE 1RADB 4DR3J 1S1UB 2V2VA 3CJRA 3M9OB 2GGPB 1CS4A 1DARA 3JTNA 2J5AA 2Y9HA 2VG5A 1R0AA 3CCTA 3SQOP 3G96A 1Z1ZA 1MNEA 1FRLA 1GK8A 3DC2A 4YR0A 3HVTB 4DU7A 1NH8A 1FVQA 3AA8A 2CXEA 4PWUA 3C6TA 4DU8A 3BQ2A 1CJVA 2HFVA 3HMJG 3B4DA 4DR1J 3R2CJ 3C14B 4DS4A 2G0IA 4I2QB 1TZ0A 4LRAA 2H5IB 4F4XA 3OXFA 2VPXB 2ZJRQ 2NCKL 1YJUA 1T0TV 2Q6CA 5A6WA 4UY8T 1BQNB 2BQRA 2V8HA 1HBNB 5ETNA 1LV5A 4K4XA 4OIXA 3BGUA 5AJ3J 1WI6A 4ECQA 1UVJA 2KG0A 2M8DB 2XWXA 1U6FA 5G4DA 1WKLA 4X4SA 4DN0A 4CO0A 1UFLA 1LFPA 2E1RA 3EUNA 3D1OA 4RZRA 3TX0A 4DR6F 1RT2B 3CC7S 3M8ZA 2OEMA 5J2PB 2P9GA 3HF5A 3KG1A 3W66A 1S1WB 1FFWB 3FEXB 2XS2A 4ZPBA 3TARA 4QR0A 4WYWA 1YJ7A 1PO6A 3KLVA 1UP1A 2QT7A 1EP4B 2L41A 3QT7A 1UFKA 2HGLA 3EPIA 1YJNS 1U6ZA 2B7CB 2WOMB 5CYMB 2JVOA 3DI6A 2NPFA 1FJEB 1JLAB 2VFTA 3N79A 4DSEA 1I94J 4XIUA 3ITHB 4YY3J 1RT4A 4LF8J 4DV2J 3SSRA 4WIIA 1FKAF 1M5VC 2VA3A 1OIAA 1NK0A 3MPWA 3NMAA 3E8OA 4WK3A 2DH8A 2HHHJ 4HR2A 3PJXA 1S59A 2JSXA 1X8DA 3FSIA 3PKMA 3QBCA 1SJFA 1YHQS 4DX7A 4JV2A 4LUBA 2JLGA 2ABYA 5LMUF 1PAEX 3MFHA 4MIWA 1VQYA 1WOOA 3B6BA 4NYPA 4DDFA 2R8IA 3J81j 2JOQA 2IJRA 4N5SA 4OZ5A 2HBYB 3UNGC 2PMZD 2YKNB 3ILJA 1JXLA 1CSJA 1NCLA 4C0OC 4NYZA 2FTRA 4P2XA 1S1UA 3CIZA 4MK8A 2HVZA 4TYAA 2JZ5A 2GGPA 3ZTPA 4I4BA 5JMNA 2COLA 1F1BB 2O66A 2KG1A 2FVSA 2ASJA 3RUBL 4DCOB 3HCXA 4WFYA 2D74B 2KVQE 1RHUB 2W25A 3HVTA 4UZCA 2UXBF 2DNHA 2MZSA 3CD6S 1F3FA 4QQBA 1U1PA 3CJ5A 3TA1A 4J9UE 3C14A 4I0WA 4I2QA 2EBEA 5JXSA 4RKUC 2MQMA 1VQLS 1XK8A 1NRKA 2GV1A 1KSPA 3J81U 4C11B 5KG6A 1BQNA 3D3CJ 1HBNA 3M2VB 1M5SA 5HVGA 4N47A 4GKJF 2I38A 3HFKA 3TYTA 1RAFB 3T1AA 1FXDA 3W62A 5BYRA 3RR7A 3WHIA 1Q0NA 4L72B 2F3JA 2LKZA 5CD4H 2MKYA 1QSSA 4C8NA 4WZQA 1OQ3A 2LEBA 1UPMB 2BBEA 3J7YI 3UVJB 1RT2A 1RT7B 5J2PA 1N56A 1QY7A 1S1WA 2D7SA 1I51B 4YQWA 4DR5J 2V9WA 4IOBA 5ETTA 3L7PA 2DGXA 4RNHA 1EP4A 1EZZB 3TEGA 4JYAJ 3D4JA 2K2PA 4LF9J 5AT1B 3TWZA 3UCGA 4RUHA 2WOMA 2IM2A 5I42B 1T3NA 3ZZRA 5CYMA 1HWLA 1JLAA 3TR5A 2G2YA 4ED0A 1M90T 5I3PA 2I6WA 3ITHA 2XMVA 2VIHA 2EC0A 2QA4S 4QWBA 3D3BJ 4K4ZA 2IDEA 3W8GA 3K89A 1XR7A 2W2NP 3B54A 5EWGA 2WVDA 5K5MA 1HA1A 1WEXA 2HGMA 3QJPA 2LVWA 5C7PA 1EIYB 4OJGA 3VF0B 2N3OA 2ZVIA 2MYFA 4Y00A 1XMOJ 5ETQA 2XI2A 3DGPB 2PGCA 4NX9A 2GZOA 3UDCA 5CHCB 4HHHA 2JLFA 3CO9A 3K58A 2FLLA 1QDUB 4DL3A 3QIPB 3MD3A 1Y3KA 2QLBB 4KTQA 2P9CA 1GAOA 3PYEA 4LSLB 2F9DA 4J9KA 4WXWA 1CC7A 1GNKA 4RWXA 3QQCD 4TYBA 3TZYA 4A8FA 1V3ZA 1UJ6A 3MCMA 1LK7A 1RTDB 3OTOJ 3CULA 3RBDA 2GVZB 4ES3A 3AJDA 2YKNA 1U2FA 2QE5A 3LOUA 1UFWA 1V5VA 3T5LA 4DR7F 5KOWA 1MWYA 2PE8A 4ED8A 1IJEB 5KFQA 3R2DJ 1I5OB 5HJXA 3V6DB 2QL5B 5DRKA 4PZVA 5F9NA 3HHDA 2QX0A 2A3JA 5B0EA 2RMLA 2CNNB 1N88A 4M1KA 4C8LA 3PHEA 3N28A 3Q8UA 4Q45A 2DNGA 1P8GA 4LF6F 2RRNA 2XQCA 3KHHA 2DJWA 3SDEB 3GFHA 2HIYA 5HQMA 4DMZA 1FRIA 4OJ3A 1UCNA 4DF4A 4ZPTR 3DHXA 3T9NA 4MT1A 1S9GB 2Q43A 2BQUA 5LSLA 6FD1A 4Q5VA 4WTOB 2F63A 1JJ2R 3H5SA 3JSRA 2XSFA 4C11A 1YZ6A 2M4MA 4W92B 3M2VA 3GFXA 3FJ2A 1KVIA 1NZ8A 3QT6A 4FVCA 3NXZA 1IKVB 4NXNF 3EGZA 4FF1A 2XB2D 4F0MA 4KO0B 2M3DA 2YWKA 1P9YA 3MAQA 3NGDA 3PXGa 3NRBA 5A8KB 3UVJA 4RNFA 1IBLF 4H54A 1RT7A 3F0NA 4LFCF 4TVAB 1AFIA 1TL3B 2I5JB 4W90B 4CLYA 2CADA 1S72S 4DF8A 5GAEU 2LQ9A 3SSSA 3CJQA 1TKXB 1E6VB 2M70A 2RS8A 1HIYA 5I42A 4ETZA 3VGVA 5F8JA 1YI2S 2HVHA 3EXCX 5CXTA 1G6BA 1I3OB 3IWLA 5JVHQ 4RX6A 2C3MA 4I68A 5J1PA 5KT3A 1S0VA 4FBUA 3KK2B 1FKPB 4RNNA 2HVEA 2HFZA 3UFCX 2YPYA 2GO9A 4C8ZA 2LQ8A 1S5ZA 1J5OB 1DHMA 2ZBPA 2BVZA 1SJ4P 3DGPA 4OX6A 2AGPA 5D15A 2W24A 1WOPA 4DV7F 3QIPA 5HROB 3VAFA 5B0DA 1TFWA 3D54A 2DKOB 1X4EA 2R42A 4LSLA 5E7OB 3PX6A 4TXSA 1FJCA 5IT9U 2CPDA 1RBOB 1IBKJ 4WKRA 3G87A 5IC6B 4RJVA 2W8KA 1RTDA 3KK3B 2GVZA 3PR4A 1BMQB 4CI0B 1XNRF 1V9OA 1T3OA 4A8QA 3HFVA 4JV5F 4FNIA 5C24B 4F4ZA 2BKPA 2CPZA 3V6DA 3BGFA 3PO5A 2DR5A 1WHYA 3QATA 1VC0A 5KFMA 4QU6A 2PMWA 2RDIA 2F4VJ 1B0VA 4JUZA 3RW7A 2N7YA 2QC3A 3B4MA 5K8PA 3MOJB 3ZZTA 1WTFA 3SDEA 2HYIB 4DQPA 4FBTA 1NSPA 4UQGA 5BR8F 2FVPA 2Y0SD 3GONA 1XEZA 2BYCA 3T6BA 1S9GA 1AUDA 4CDIA 1C1CB 3OUYB 2X1GA 3AH6A 2IPOB 2KYZA 2CJAA 2GVDB 2HMIB 2P6TA 2CA9A 5FJ4A 4A4JA 3SBMA 2PT0A 2YX1A 2KM8C 4JI3J 5JVGQ 2ACYA 1WEZA 3P5TL 1SQEA 3BBFA 4Y65A 4NLRA 2HZCA 1JWWA 5ETOA 2B4PA 2CVIA 2ZKUA 2ZNZA 2AEFA 1GXUA 1IKVA 5DETA 3IGVA 4WP8A 4MK7A 3TQEA 1JMTA 1X9SA 2HS4A 4KO0A 2D3O1 2HHXA 3C6UB 4DSKA 5F0UA 2Y1JA 5A8KA 3I0SB 3MM9B 1WACA 3CUNA 2GAGC 4P2MA 4R8UB 3NAIA 2H5EA 4X62F 1TL3A 2I5JA 3PV8A 1QLNA 4KGXB 2L9WA 3VAGA 1HARA 2DR7A 1R27B 3D6TB 4AD6A 3H5XA 2XWYA 3OV7A 5DQHA 1R8CA 4QW8A 2DNOA 1TKXA 1E6VA 1YJTA 2OI2A 3TO8A 3UDEA 3V81B 2FHJA 2U1AA 1H38A 1M0SA 1TELA 1P1TA 2CQGA 2R7VA 3PW5A 5H9EJ 2KT2A 1MWZA 4KH1B 2NLWA 1ZAXA 1SJ3P 5ETRA 2VFSA 3QGGA 1NJYA 3KK2A 5DGBA 1NJXA 1WF1A 1FKPA 2YNFB 3KFWX 4P75A 1GMWD 1T7PA 5KFBA 4KHRA 4DX5A 3RRKA 1NZAA 3US5A 1J5OA 3ZTSA 3HO1A 4PG4A 4PWDB 4Q0BB 4V1Ak 2ZBRA 4FZVA 2V6AA 2RDJA 2XYHB 2QSFA 1EETB 5HROA 3S01A 3QRRA 2CRLA 2IRYA 4NMXA 3NCQA 1H7WA 4L75A 3V6JA 5CH7B 1S97A 4QWCA 2YKMB 2RU9A 3BB5A 2HW3A 4UY85 2J0SD 1TAUA 4ZPCA 2OHDA 3KK3A 1X5SA 1PBUA 2V5HG 2NXUA 3SFUA 4ECXA 3FBFA 2HIQA 5C24A 1AW0A 3MHYA 2BDPA 3M2RB 1S4FA 3PEHA 4C8OA 1AYEA 1FNMA 3JSBA 5KFSA 4DV1F 5M2PA 3F73A 4QPTA 1WG5A 4ZP6A 3S6EA 1HLWA 4KV8B 1R7IA 5KFPA 1GXTA 1ZM9A 2EFNA 4NLSA 4GVBB 4ITSA 2V8VA 3HJFA 1H74A 4CWBA 1BQMB 2JX2A 4QIWD 1VBKA 2QLFB 3WX8A 5E5NA 3DDIA 1C1CA 3OUYA 1O6XA 3OD2A 1RAAB 2GVDA 2HMIA 5T41A 3GV7B 4I1TA 1TMMA 4FN5A 2QL9B 2NYIA 1LQ9A 1RWUA 1Q5YA 1YZ7A 3ET6B 1JNZB 1SL2A 1JJCB 3N4WA 2DNNA 4QWDA 4B9NA 1BQXA 2QMUB 2H54B 2J0XA 3C6UA 5KOXA 4KFBB 3GV8B 4TLQA 1NUEA 3BJYA 3UDLA 3I0SA 1NDCA 2F40A 3DN9A 3MM9A 4ZVTB 1NB2A 4AQYJ 2EG2A 4X64F 3ZFVA 5K9FA 3GZ7A 4R8UA 4IRKA 1X7VA 3D6MB 4KBIA 1FXRA 2DTJA 5KFNA 3Q24A 2IJFA 2DXDA 2HQDA 2VQFJ 1N36J 5E3CA 3V81A 1EKSA 3DGVA 3GJSB 4XPEA 3OW2R 5DG9A 5I3UB 2NSCA 2C2OB 4X66J 4JI4F 2POKA 1D8YA 1JIHA 2HQFA 2ASLA 1VQ8S 2YNFA 3AD8C 4ANCA 4M5GA 1ZAWA 1HNXJ 5FLXY 4ZJQA 2UUAJ 2J7WA 3MTJA 2JWNA 5CABA 2J8AA 4PWDA 4Q0BA 5HQLA 3JSMB 1XBWA 3AD7C 5GADU 2FVCA 3HX9A 2J9DE 1T05B 4F7VA 1OPIA 1EETA 4DL2A 2IYGA 3CCMS 4F4WA 1QVGR 4L73A 3OSNA 4G3IA 3I4PA 3D1HA 4ZP9A 2YKMA 1MMLA 2BE9B 2VOPA 4EZ6A 3W7BA 4LMZA 4DSJA 3CD7A 5CZVA 2SXLA 3K59A 1BGXT 4NI2B 3LF0A 4FXDA 4DX8H 3HI9A 5IT0A 2DH9A 2VQEJ 3HSDA 1BD6A 4WZMA 2MDAA 3O6QA 1HR0J 2B3TB 5LXRA 4DV0J 4KKOB 3M2RA 3SCIE 1X4DA 3U1NA 3TVKA 2HRTA 1S76D 2WBRA 1Q8KA 4BS2A 5KFXA 2NR0A 4ZN3A 1W2BR 2IM0A 3Q89A 3BM7A 4KV8A 2ZC3A 2XHWA 1HBOB 2J0WA 3W5ZA 6AT1B 2KFYA 2EW9A 4GVBA 1OPZA 2V68A 3T19A 3OHBA 2MKKA 2BACA 3E3XA 2LP4A 1BQMA 3MECB 2HQIA 3IO1A 6FDRA 4NEZA 4AE5A 3PG9A 1TFYA 2VFVA 4NL5A 1X4HA 2W4CA 5EUHA 2LMIA 4QWEA 3IR5B 4ED7A 3EWGA 3CB4A 3VV2B 2MKCA 1VIOA 1HNIB 2OTLS 2W9CB 2J8SA 1FNOA 4YN3B 3CDAA 2BQ3A 1Q82T 3ET6A 1KP6A 5HMZA 4RNMA 4URSA 1J5EF 3NP5A 3W61A 2AD9A 3M30B 1M1HA 4RBUA 3RR8A 1HBUB 3M8RA 2C3YA 2B8QA 4KFBA 4BWJA 4DQSA 3MM8B 1RU2A 5DLGA 5F3ZA 2P5VA 2XMTA 2R4FA 5B7WA 3PFOA 2DBBA 3MEGB 3GIMA 4QOTA 2V94A 2NSBA 4E8UA 2GJFA 4BDPA 3CDWA 2NPIA 1RHKB 3QYYA 2Z57B 1UTAA 3I32A 1UJ5A 2JFDA 1ZPVA 2PMHA 2MJNA 4C48A 3BSOA 3ZXWA 2BX6A 4XPCA 2CQHA 2M2BA 2E5JA 3UW1A 4NLPA 2R2UA 5I3UA 4LF2A 4DV6J 2HWIA 3MM5B 3UCUP 4EYIB 3FSXA 1HMVB 5LM7E 3BBCA 3R27A 4BC7A 5FDLB 4ECVA 1QJHA 4HT5A 1N0UA 3PYFA 1EQ0A 2H4YB 3MUMP 3CD0A 3S8SA 4K4SA 2GA7A 4ZHRB 4DR4F 2PEBA 3SZ2A 3F44A 3JSMA 3DLLQ 2N4CA 2X7IA 5CYQB 3KWMA 3CEDA 1T05A 2XGQA 3BO2A 5FD1A 2B9XA 5AXLA 4IKAA 4FVMA 3WX4A 4CCHA 5MLCV 1ZA2B 3W8PA 4PXDA 5LMNJ 1WSVA 1L3UA 1UMJA 3BN4A 5IZHA 3HZGA 2MGZB 1NKEA 1N5VA 4MMOA 1O51A 2KN4A 1RZMA 1E6YB 2XC9A 4M5KA 2DEJA 5HATA 1DQ9A 3SXLA 3I0RB 2MKHA 2XMWA 1R8AA 4NI2A 3CO0P 2V2QA 2ZDPA 5EWFA 1YRUA 3CPWR 3G2XA 1RWWB 1RAGB 1VJQA 4K0KF 3R5GA 2ZBCA 4KKOA 1NEEA 1MMNA 3LPYA 5MAOA 2R3VA 4MIAA 2HBZB 1RWKB 3IAS9 4FS1A 2ZWPA 4R25A 5DQIA 5KFOA 3I9V9 4DR2F 3CVKA 4M5NA 2F65A 2HS0A 1HBOA 2AGOA 2MQPA 4G1QB 3BV8A 3MMCB 1ZH5A 1U48A 4B02A 4NOHA 3MECA 3W60A 5KFLA 3GG0A 4QWAA 4EK2A 4CIOA 2ZZMA 1HHQA 4ZPDA 4J9MA 2MSTA 4C3MA 1S6PB 4OI4A 3M32B 2J6TA 1J2VA 2BA9A 4WFXA 3E01B 3LALA 1S4EA 3Q2TC 1W7WA 2GQQA 2XS5A 1H73A 4ALZA 3IG1B 2HLTA 1TL1B 3CIMA 1NSQA 1HNIA 3MMBB 3DLHA 2W9CA 3RTVA 1PJ7A 5KFEA 5IOLA 3M30A 2B9YA 4M5LA 1Y5NB 3PCOB 3QGPA 2HPUA 1OQ6A 1HBUA 3TJ9A 2NXEA 4DR1F 3HD2A 5D78A 4DV5J 3LAKA 3QGIA 1RT5B 3MM8A 1SC6A 4IQMA 2FJDB 2M7SA 2M0GB 2J7KA 1RLDA 1VK8A 1Y9OA 3LGNA 3MEGA 4JBCA 4URQU 3GJQB 3A12A 4C3LA 3LPEA 2XMUA 3I4HX 4CLZA 2IVYA 4MIBA 2EK6A 4ELVA 2HHTA 2XCPA 1FXLA 1KVJA 3MCOA 4FYYB 3QZ7A 1WC1A 3FRYA 1UA1A 4HDHA 2KFZA 1RHQB 4N56A 3W9JA 2UXCF 2ZFHA 3FMBA 5AE1A 1WC4A 3MM5A 1HMVA 2QTWA 4TQRA 4ZVEA 1TKDA 2R7RA 2KI2A 1AUSL 5GVQA 4LFBF 2GJ2A 5FDLA 4DPWA 4LF5J 1KC8T 2CQ2A 2ZWOA 3VVTA 1PJ5A 1CJUA 3H2VE 1TMJA 4ZHRA 2MMYA 4C8YA 4CH1A 2D69A 2VU5A 1C0UB 3TA0A 1ZZNA 1UZDA 1PAUB 2ROEA 3CJKB 2HVDA 4DSLA 4WJBA 1F9EB 2CDQA 5CYQA 1DTTB 1HL6A 1K8AT 4IG0B 1FVSA 4U67Q 4PEOA 2LXFA 2G0CA 4CNYA 4DUZJ 2ZUAA 3AOCA 4K5RA 2H3EB 3OVSA 4MH8A 4F0KA 1N48A 4CNZA 2W9AA 2MGZA 2J9EA 1E6YA 2CWKA 2Y0BB 3I0RA 1UWBB 3IN5A 1KWMA 2A6MA 5ETKA 3PM9A 4JV0A 3B78A 2JVRA 1VC5A 1R43A 4KE5A 2HAFA 3HVRA 4RBTA 1WD6A 2CZ4A 2QGFB 4FYVB 2MQLA 4NMLA 3HHLC 1UVIA 3R5DA 2RILA 3AJ2A 1G2EA 4OHZA 4OLPA 4NA2A 2CJKA 2DB1A 4ZVGA 3PVXA 5A8WB 1RAJA 2YKQA 3TUIC 1SJ1A 3MR2A 2N7CA 4G1QA 3MMCA 3K8WA 5DDOC 1FESA 2XO7A 4YOEA 4ID8A 4OZ2A 2V67A 1U1KA 2OPPB 3SI8A 2P2CB 1S6PA 3L3CA 5G0RB 3M32A 1U47A 3Q8VA 3E01A 2CPXA 1U1NA 3W1YC 4FXVA 3G6XA 4DFJA 3IG1A 2AW0A 1TL1A 4NLOA 3MMBA 2YTCA 1M5KC 2V34A 5B0CA 2NUUG 3MD1A 2ZE2B 2ZNYA 4JI2J 5KFFA 2NUHA 2JDJA 1R8PA 1NDPA 3D1QA 3O44A 4RW8B 4WFZA 2YQ1A 1FJGF 4ECYA 1RT5A 4ZVUB 1RWOB 4B3TF 4HT7A 2CJBA 1BWEA 2QJ3A 1LEOA 2X1AA 3Q8RB 2Y3YA 2MLXA 5L9XA 3G8TA 4FF2A 1KTVA 1JKHB 4E0DA 4MK9A 4WXOA 1MWQA 1KNZA 3N0VA 3OHAA 3RB0A 1TKTB 3G8SA 1KRPA 3CJTA 4U9RA 4F25A 2MZTA 3UPFA 3HFZB 2IY5B 2QA2A 2ZHAA 3W5XA 3SEOA 3EYZA 4ID5B 3ENWA 4KJIA 3ADAC 1D1UA 4B17A 1TP7A 4DV3J 2XY7A 3WZ0A 4A48A 1C0UA 4OX9F 3LQVA 4RW9B 3CJKA 1N5YB 3RAQA 5DZ6A 3QAEA 2QEXS 5HVHA 1DTTA 1VK3A 4DWIA 4IG0A 4ZA1A 2RQKA 2R7OA 1QVFR 2V4RA 1VBXA 4MKVA 3GJTB 4RBVA 1V6HA 1HI0P 3UN5A 2F8HA 1GTEA 2MSSA 2HFUA 3PFEA 4M5HA 3OR1B 4AFFA 3H98A 3WIUA 1UWBA 3AT1B 1N5SA 3SIPB 1U49A 1M5HA 1C4AA 3CJ0A 4C2MA 1S1VB 2BRLA 1PYOB 2FJXA 5IFMA 1UL3A 3VWSA 1NJZA 5L38A 4FP9A 4JI7J 1Y5LB 1PYSB 1PILA 4ZKAA 5F41A 2F1FA 2R2SA 1VQ9S 4P2FA 5A8WA 2NZCA 4FXWA 2KXHA 2OO4A 1ICEB 2BJEA 2MEWA 2ZKTA 4LR8A 3SV3A 2XZTB 3FC9A 2OPPA 4OYPA 2DGQA 2HEKA 5G0RA 5KG0A 2GHPA 1WORA 4Q7AA 5IT4A 4F3OA 3D0GE 2R8KA 3QSYB 2F7VA 1LWFB 3TOQA 4RNOA 3QNWB 4LR7A 4DFPA 1F3VA 1FRXA 2C2RA 3PYDA 2ADBA 2AMCB 4JI1F 2ZE2A 1X4FA 5DZ7A 2Y1LB 2OELA 1FO1A 3I31A 3BN7A 4S0MA 2KXFA 3A8KA 4RW8A 3EJMA 2CJXB 5FLXU 1T94A 4O4GB 4ERDA 1VQ4S 1U2RA 1N5QA 3VGUA 1RWVB 5T14A 3AFGA 4XDCA 4A8OA 2ZHBA 2LU1A 4OV1A 4CLKA 4MKBA 1JKHA 1O5JA 2Q3PA 2EI5A 4J91A 1JLEB 3L95X 3QGHA 1RT1B 1S49A 1QE1B 2BE7D 3OTBA 5F8LA 1TKTA 3TQ1A 3NKYA 3DLEB 3T6JA 3A1YG 4QYZJ 4QYZK 3M8QB 2GC8A 3NOGA 3H2LA 2W7AA 5B08A 5KT6A 3OXLA 4ID5A 3DDKA 1ZYQA 1L3KA 8ATCB 2PO4A 1Q5VA 3HP6A 4XAKA 1FJ7A 2N4DA 3GYXB 3TAPA 2YKOA 4IG3B 3S1TA 4EZ9A 4KYZA 3DLGB 4RW9A 4JI8F 1N5YA 1FTCA 5KG7A 3T5HA 3IS9B 5HP1B 2DVIA 4Q8EA 4OZNA 2C3UA 2IIHA 4USKA 4OMFG 5AXKA 3BREA 2RT3A 2X1FA 2XM3A 4LBPA 4W4MA 3TJ8A 3FNNA 4DZDA 2ZOMA 3OR1A 4K4YA 4GC7A 2IHR1 2WHOA 4MYTA 4K8RA 2B9WA 4B3OB 4AXJA 2KO1A 4J9SA 4X4QA 3K57A 4HLBA 2DNZA 1S1VA 1FFSB 4K5SA 3R6LB 1FDDA 3VALA 3QZ8A 3M9NB 4DR6J 2MKJA 3OL6A 3GIJA 2H1YA 4O44B 5IM0B 4N41A 3TVZA 4H4OB 3THTA 1LFWA 2BJ1A 1F6TA 5B09A 3BR9A 2QL7B 3KLFB 2EG1A 4RO0A 2HHVA 4FF3A 3C15B 3J7ZT 1Q79A 2E66A 2HRUA 1WC6A 3BPDA 3SCLE 3OSPA 4USUA 2QA1A 3Q23A 2FLPA 4P73A 4ZPWR 4QYRA 1LWFA 2RQ4A 5E3AA 5F9LA 2YWEA 3OR2B 2HG4A 5B0BA 3BYRA 5KFUA 4LF7F 1S12A 3NY0A 1KVKA 1RAEB 3T3FA 3MWBA 3K2YA 4F36A 4O4GA 2E7WA 4PR6A 5IXUA 3TUPA 3T41A 4HTIA 3HULA 1RHMB 4ZVRB 3UQSA 2GIRA 1Y00A 4O0IA 5EWEA 2ZITA 5LMUJ 1T03B 4OHVA 5EN1A 4F67A 3MCNA 3IMQJ 2KKHA 4I6AA 5F8MA 1O0PA 1JLEA 1MSWD 3LP2B 1RT1A 1RWXB 1QE1A 5K8NA 2BMBA 2HBRB 3N9UC 3DLEA 1S6QB 1SI9A 1X4GA 4K4UA 2WK4A 3M8QA 3CD5A 2Z56B 3EGNA 1HD1A 1Y0HA 3G4SS 2NXCA 1QAYA 5K8MA 3NWRA 4DQIA 4HTJA 4Z7CA 1QAIA 3ZTRA 3DRSB 2VV5A 4IG3A 4YHHF 2LEAA 1D0EA 3TAQA 3DLGA 3ONQA 2VA2A 4NLUA 4J9NA 2UXBJ 3KKFA 4L3KA 3VGSA 3IS9A 5HP1A 2G1DA 2LA6A 1TL5A 1Q95G 4DLGA 5A2QY 3C2PA 2GHWA 3DMJB 2YKAA 1N34F 3NMRA 1H2VZ 2CVEA 5CCLA 1KN6A 3N01A 3S7RA 3CMES 4ZLJA 4ECUA 2DY1A 4ES1A 3BBBA 1GH8A 4GKJJ 1RK8A 2JC1A 1EX8A 2MB0B 2CJQA 4B3OA 1BXNA 1LNQA 2VC0A 1G1XA 2F9JA 2IA6A 4OYMA 5AXNA 3VTIA 2ZH6A 5A8RB 2W8LA 3VAHA 4USWA 2OP5A 4USVA 2WTFA 4WIQA 1L3SA 3RW6A 4O44A 2CG4A 4JP8A 4ANEA 5IM0A 4DLEA 4O3OA 2OH2A 3JTOA 2ZZNA 2V8DA 2ZHOA 4H4OA 2ILYA 2IFXA 3H59A 2DHXA 4HHJA 3KLFA 1AXQA 1RXOB 3C15A 1NK6A 3CCLS 4O4RA 3NS6A 3FCHA 3UN2A 1KLNA 3MCSA 3P5BP 3QT8A 3KHGA 5HMYA 3K0JA 4L3NA 2BJ3A 1XR6A 3EDRB 1Q86T 5HANA 1Y11A 2ZVSA 1NKCA 2W7OA 5DM7Q 4MKAA 1UEUA 5D4NA 2HK2A 2HFOA 2A0FB 2CDRB 3NL0A 1SUQB 3JTPA 3OR2A 4I67A 3TZZA 4C7QA 3HVWA 2VDHA 1D8ZA 1S7IA 5GAHI 1MROB 4ZJOA 5EX3A 4PG6A 1NJIT 4DFMA 5D4OA 3NGRA 3R6GB 2BJ8A 3BO4A 1T03A 2PN6A 4QIGA 5IV3A 3BF4A 2XYGB 2KB2A 3CJ3A 2W4DA 2XYPB 1WKJA 3LP2A 3T5KA 5KG5A 3FBBA 1H98A 1Q8LA 2VUGA 1S6QA 4ECWA 4DR7J 3OJSA 2CWXA 2VKZG 4C0HA 1APSA 2OD4A 3MTKA 1WDTA 2LDIA 2IMOA 3H40A 4B9TA 1I1GA 3LGHA 4PYDA 4JI0F 3UO0A 3W65A 2V50A 2DNYA 3AHPA 3DRSA 1SBRA 2FJVA 2VBXA 3M1VB 1UW4A 1N36F 4LF6J 1F5AA 3EZ5A 2JEGA 2E9ZA 2E5GA 4DPTA 2ZM6F 3O1LA 3BH7B 1NMEB 2B9EA 3MM7B 4PXBA 3GFZA 4X4VA 2DCUB 2VJUA 4OZ3A 2ZOGA 3SCKE 3EVWA 3DMJA 3ETOA 3L7UA 2HBQB 4PG8A 2HAIA 4DXLA 5JUMA 3I9ZA 5LJ5Y 4LVNP 3EXYA 2VODA 1M5OC 3TAMB 2V4QA 3U27A 4NXNJ 2VF3A 3N5FA 4MYUA 2FUG9 4BBYA 4MJKA 1FDNA 3OL9A 1GT8A 1HI1A 1KDNA 2DH7A 1IWAA 3M6XA 1VS3A 4YUDA 4ZLPA 1T9YA 5A8RA 1IBLJ 2I0XA 4TN2A 4LFCJ 2CIMA 2GFFA 4BWMA 1WHVA 4NZ6A 3QRQA 5C2CA 2FZCB 2HQ3A 2BABA 3NLCA 1RISA 3CF5Q 3J80Y 5IS2A 3PW7A 1VQOS 2B43A 1FTRA 2VONA 2RJZA 3GU0A 4LF4F 3D28A 3T9ZA 1VQPS 2B7BB 3GYGA 3R5JB 3CMQA 1FWKA 3A3NB 2UUWA 4U8YA 3NNAA 2YWWA 1GEHA 4R0EA 4DPOA 4OYWA 1X60A 4FS2A 2C2MB 3AXMA 4NYOA 1SUQA 2AX0A 1CVJA 2IJNA 1WG1A 2QG9B 4A8YA 2DIVA 5E41A 5KFZA 2J76E 4KH0B 5D0HA 4C6AA 4DBQA 3BSNA 2BKOA 2CPYA 1FE4A 1MROA 5KFWA 3KHRA 3M4XA 3HT0A 2AYEA 3F41A 2KM8B 3LGMA 1N6QB 4KR0B 1X4CA 4DCPB 2JNJA 4DV7J 2AZ3A 1REVB 3MPVA 4NLYA 1A0OB 4HL9A 5DDPC 3GQCA 2V0NA 4LFAF 3CCWA 3ILOA 4UF4A 5DG8A 2VC1A 1U1OA 1KQGB 3FSYA 1HD0A 5DDQC 1IXKA 2X3GA 3ZZ0A 1FHTA 3MDFA 3ENQA 4XTTA 5DO2A 1XNRJ 3DM2B 4OHWA 1YITS 4JV5J 2QA4G 1T9UA 4GO5X 3PKYA 4ENOA 5F8GA 2CAJA 3RYLA 4NLDA 4NLQA 3UE2A 3HK2A 2VBZA 2ROGA 1SCJB 4EUVA 4UW2A 1N33F 4G6VB 2LFVA 2M8HA 2N3LA 1UVKA 3M8WA 3M1VA 1N8RT 2XY5A 2FB0A 1NDLA 1B64A 2JEIA 2XTJP 3M7VA 4FYWB 1IBMF 4WTYA 2BEFA 5J2MB 5BR8J 4F3MA 1Q8IA 4F4KA 3MM7A 2CUYA 5B0FA 3AODA 1FE0A 1J27A 2HSEB 2K3IA 4P71A 5A6PA 3IWXA 1DRZA 3W64A 3KJQB 1RT3B 1KHWA 2FC8A 3TAMA 3GIKA 3FFIB 1FRHA 1WSRA 2AJ2A 3G6YA 1FA0A 5L1IA 2R7SA 1KLMB 2YBVA 3TRGA 2WRMA 1QTNB 3CGIA 2IRXA 3QPIA 1MG7A 3VCDA 4YP3A 3ISND 1U1QA 3VVUA 3R97A 3CJ4A 4PAAA 5ETPA 1S10A 3RBXA 4OLOA 4X62J 1ULRA 4F2RA 1PBAA 4EO6A 3N6LA 3D7SB 2EBGA 4TY8B 2EKYA 3A3PB 3G8QA 3IM8A 1XR5A 4OI3A 3VAJA 4UT4A 3GSDA 4AXIA 2XLJA 2DO0A 2CKWA 3DNCA 2GS8A 4DL5A 3TUZC 3IBWA 3FGVA 1CG2A 2MZJA 4O0NA 2QSWA 2EFQA 4N76A 2R7UA 3GFYA 2QMXA 2PD1A 3UR3C 1VI7A 4EO8A 2MY8A 1CJKB 3C46A 1HYSB 3T1HF 1QD1A 4KHPF 2ILZA 2I1RA 4PRFA 1IR2A 4IR9A 3LWMA 4CQ1A 1SC3B 3HKZD 1EQMA 5IWAF 4Y2CA 4OV6A 1N6QA 2HHUA 2DY9A 3K8VA 4F4YA 1REVA 2J9DA 1EB0A 4QJVA 2WSEC 2UVVA 2AEMA 2CJ9A 1W26A 3T1YF 3W2VB 2DCLA 3ZO7A 2KRRA 4I69A 4I7FB 4H4KC 4Y2AA 2BW2A 4OFZA 1IKXB 4K50A 3DM2A 2P8IA 4X65F 1NHVA 1VIXA 5U47A 2K7KA 1HI8A 2RD5C 1RAOA 2DGSA 3SYZA 1JJHA 1YBAA 4EI2A 1VR6A 2JHEA 2ZC4A 2IBKA 4P9SA 4DV1J 4ED3A 3PJ9A 4G1IA 3QMQA 2XSJB 1GXLA 1CC8A 1SH0A 3QWUA 1TK5A 2C22A 3HJVA 1U25A 5DGAA 3ISNC 3FZ2A 2QN6B 5J2MA 1SIWB 1N0VC 3J7Z5 1ZM2A 2WVEA 3ENVA 3H20A 1UVNA 4HDGA 5F8NA 3OFFA 1TKZB 3GPAA 2KFNA 3MR7A 4M5DB 4ZLNA 1REGX 1RT3A 3FQLA 4DV4F 4OI1A 3EE3A 1NBEB 3FFIA 1IN0A 2B4OA 2OPRB 3MPDA 2EPIA 3M2UB 1NHUA 2IA0A 1KLMA 3KDNA 4IQXA 2BJ7A 4EWTA 2J7UA 1HHSA 3GV5B 3RBEA 2FY1A 2RSQA 1OY9A 2AKWB 4X64J 2RIJA 4ICLB 2ZH1A 1SKUB 4OX7A 2GJIA 1Q53A 2JH3A 4K2JA 1URNA 4B3MF 4HH1A 1FERA 3MMAB 2ALYB 2FLOA 2YPZA 4WKYA 4TY8A 2Z2MA 5HI7A 5AE2A 2OD6A 1PSDA 1QSYA 3PY8A 4KB7A 3QT5A 2V63A 2WVBA 5EHHA 1KFDA 2OIHA 1GMVA 4JI4J 1F2HA 3FBCA 1HWIA 1U8SA 2MJUA 1R8BA 1LW2B 3H5UA 1CJKA 3QO9B 4C8MA 1HYSA 1BHNA 2E7XA 2VJVA 2DD8S 4JI6F 5GAEI 2C42A 1S48A 2IVMA 4ILRA 1NAQA 2UZAA 1FF2A 3RAMA 5J2NB 2QV6A 2F5GA 4HKQA 2AT1B 3GB0A 4RU2A 1IKWB 1JLFB 1M1KT 3TA2A 1RGVA 4DJBA 3CC2S 4B08A 1DURA 3HVAA 3P8BB 4YR2A 1VHIA 2GHVC 3CSKA 1KTQA 1YIJS 3W2VA 3I55S 2WCXA 2VD3A 4NXMJ 5A2QU 3H25A 1YDLA 4NLXA 1G7CB 4I7FA 3PEJA 1U26A 3CJ8A 4ED6A 4ZIWA 4TU8A 2XLKA 2J6SA 4IH7A 1IKXA 2QFJA 2RH3A 5SZTA 4YDDB 1ACMB 2LECA 4ZCIA 3H90A 3NOCA 4FKXA 1RLCL 3SMZA 1R6VA 4ZIVA 1MMDA 1A6LA 2LLZA 2E1PA 2XSJA 2DNPA 2C2ZB 4U96A 2QLXA 1U4BA 2R2RA 1OJ4A 1URRA 2IAJB 4GMKA 4RW6B 3PJWA 1N32F 1K9MT 1YLXA 5E3QA 4C98A 1WTBA 4B3SF 2C3OA 2UUCF 4EGLA 4Z37A 3QJJA 2RQCA 1VISA 2ZH2A 1OWXA 2MKSA 3RB6A 1O8BA 4P72A 3OJUA 5FIIA 3DU6A 2DISA 2NQPA 3LA0A 2Y1RI 1TKZA 3MAAB 4PQUB 4IH5A 4A8SA 2HWTA 4M5DA 1EKRA 2P6SA 4WFNQ 2RRBA 4L74A 3KMQA 3PYGA 3DLKB 3GYNA 2MTLA 1S6UA 2A2CA 2KT5A 1J5EJ 1NU4A 2OPRA 5IT9Y 3ZZYA 1VRTB 2I9SA 4TLRA 3BQ1A 3LAMA 3M2UA 3U1MA 1TQLA 1D9AA 5L8RC 2VBYA 3TUJC 4N7TA 4Q2LA 4QPXA 4GKKJ 4DZ6A 9RUBA 4ICLA 2XY6A 5KG1A 3I6PA 2HQCA 2WW4A 5B0GA 4MAKA 4PWWA 2E5LF 2HURA 4IFYB 2OEKA 3ZZZA 4K4TA 3CDBA 3MMAA 1HWUA 1X4AA 4PQAA 4CM2A 2XEXA 2G9OA 2CQ0A 2KT3A 1WI8A 5H9EK 2WVCA 2C2EA 3SFGA 4XK8C 4IOCQ 4ZPVR 1Y7PA 3DOLB 3RB4A 4K59A 1NHKL 1LW2A 2CYYA 4DR4J 3QO9A 2HHWA 4J9VA 2K06A 4YB7A 3CCJS 1RKIA 2BZ2A 3D0HE 1B7FA 1WC3A 4EMDA 2UP1A 4LBIA 3TNVA 2B5JB 3D66A 2UVUA 2AJ1A 5J2NA 4XDDA 2E5IA 4CT8A 4E2FB 4KHMA 3DRPB 1IKWA 1JLFA 1HKAA 5HO4A 2UV8G 1HNZF 1EJ7L 2LU2A 2Z0GA 2P9EA 3FCVA 4IH6A 1YKWA 4P52A 3D68A 3PR5B 3CMAS 3VQTA 2R8JA 3FKBA 1CBKA 1DLOB 1ZM4A 3P45B 2XMKA 3JSYA 4ANDA 2ZBIA 2CQPA 2MKIA 1XNQF 1LOUA 4Y34A 4HEA9 2W01A 4K0KJ 3P6YC 3PZPA 1JQGA 2HZVA 5HMWA 3TZWA 3Q8QB 3P3DA 1Y3JA 3OFEA 3W63A 2L9DA 2DHAA 4ED4A 1RB0A 4DR2J 1YWXA 1LW0B 3CJ2A 2IAJA 4RW6A 4X84A 2Q6BA 3U1LA 2ZH3A 3GE9A 1X9MA 3TANA 1HNWF 2AP6A 3RU0A 4P10A 1KS2A 3O3LA 8RUCA 4PKDB 1KOOA 2RE1A 4X4TA 3J80U 5THWA 3MAAA 4PXEA 1JXVA 1LWCB 4PQUA 1SKRA 4O3PA 3FUYA 4ZCMA 1VQ7S 2Z2YB 4OZ0A 1QTMA 2AZ1A 3FEYB 3DLKA 1OO0B 1TK8A 4ILMA 3JYTB 1S77D 4ECSA 1QSLA 1VRTA 5CCMA 3LANA 3Q22A 3CXCR 5HBMB 1WF2A 3I56S 3FCWA 3UD4P 3BKFA 2N82B 1XERA 3KYLA 2K3KA 1M5PC 4B9SA 3EDQB 2YXLA 1NK5A 2WBMA 4IFYA 3LP0B 3HXMA 2W4PA 3BGOP 3EGVA 5I3QA 1SIZA 2AYGA 1IQTA 2IC3B 1WKKA 3F56A 4JV1A 2YQ0A 3RZAA 1U0HB 2HZAA 2LA4A 3HHLB 4RLEA 2UVRA 4ZVPB 5K20B 2R7XA 2XMAA 3OTCA 2UXCJ 1CULB 4IUFA 4DUYF 4USTA 1NJWA 5CA5A 4LFBJ 2GW8A 4DS5A 3DOLA 1VQKS 2D3ZA 2GCFA 2KZMA 3NWGA 1CPZA 2ROPA 4F3QA 2RHQB 1TV6B 1N5TA 1SV5B 2WAQD 5AXMA 3ZC4A 2VASA 4DI6A 3EICA 4CP5A 1RAHB 2B5JA 4LVOP 4PPDA 2G4BA 3DRPA 1GQEA 4AL7A 3GR1A 3KOAA 2FGCA 4PABA 4A46A 3A8EA 3WDOA 4WFBQ 1EAYC 3BKTA 4DQRA 1ZOTA 2XO6A 3BKUA 5C42B 4KIAA 2AJQA 4HH0A 3G82B 2Z2LA 1DLOA 1VQ5S 3KG4A 3TW0A 2PDAA 1RT6B 3CDUA 2Q1LA 2WSCC 3DRYA 2QYCA 1B99A 1V3SA 1I6JA 2QFIA 5GADI 2GMJA 2HNYB 2DK2A 3AA9A 2FYXA 3KJVB 2L9NA 1HNVB 5HAOA 2ATCB 2C2DA 4B9LA 3H0PA 3HM9A 5J1NA 1LW0A 3UD3P 3NCPA 4Y2KA 3OQ2A 3MFIA 4DG1B 1XMQF 3HPOA 1YGYA 3CW2C 4GO7X 4KSEB 2EFPA 3RBZA 1LWCA 2DGWA 3LUYA 1T9VA 3Q2SC 2VHGA 1SVDA 1FEEA 3UWTA 2C2NA 4B3RF 2GNKA 4A8XA 3VAIA 3JYTA 1WC5A 2BR0A 5HBMA 2HHSA 2GAHC 1FJGJ 3J7YU 1SL0A 2MHNA 2CZVC 4OZLA 4B3TJ 5KFTA 4O3SA 4FDFA 2PI5A 3AXKA 2XMMA 4NLGA 4URGA 2V69A 3KG0A 2BE2B 2CG8A 3LP0A 1RI7A 3RJMB 3BGRB 2IC3A 5D0RA 1FI4A 3MI7X 3O5TB 1U0HA 1PKUA 1FX4A 4N8OA 3HHLA 4KGMA 4ECZA 2C28A 2G2ZA 4RPFA 1TUWA 3CTRA 5D8HB 3GWCA 1CULA 3VGTA 2DITA 4LQ3A 1R31A 2OGUA 1JX4A 2DNKA 1OY8A 3H5YA 4JI5F 4QIEA 1C0TB 4DSFA 2ZOFA 2RKIB 4PXCA 4J9OA 4KAIA 4J90A 1CJUB 1LKZA 4GRSA 2FY8A 1TV6A 3R7BB 1TL7B 4OYAA 3KNGA 1SV5A 4OX9J 4EFAC 3K5MA 2BKNA 3MGJA 3NGKA 1VOMA 3PX0A 4M5IA 4BHQA 3M9MB 1NXIA 3BZQA 2E1MC 1ZPWX 2DGOA 3CT9A 1IUJA 2WZ1A 2OPQB 3THPA 3AB2B 4OJ1A 1MN9A 4CO4A 2UXDF 5C42A 4IRDA 3BO3A 4OHXA 2VPWB 3G82A 5CYJA 5HVFA 1U09A 1Q78A 1RT6A 1HQUB 2WVFA 1VBYA 1YRXA 2MPUA 1AB8A 3UI3A 1D9DA 3LW5C 4NA1A 2MLZA 2HNYA 3IR7B 3FQKA 2UUBF 3EPGA 3AOBA 3KJVA 1F2GA 4YB6A 2J9CA 4LF1A 1VQNS 1HNVA 1GX5A 1V3RA 1RCXB 2RU3A 2UU9F 2QLJB 4I56A 1YJWS 3CCZA 3GCWP 3CCUS 2LQJA 3DOKB 5E0OA 1RWNB 1UWAA 1FCAA 2H4WB 4DUTA 3DCAA 2V2KA 1L3TA 4DG1A 4OI2A 2QO3A 4DR3F 3OVAA 1EHWA 3QLHB 4NCAA 4FYXB 2HKEA 4OYOA 4Y2IA 5L1JA 4ECRA 3GR0A 3D2WA 4WCEQ 1S57A 1OYEA 2R9LA 1M1GA 3UNYA 4RWWA 1ITPA 3ZZOA 2CQDA 4RW7B 3NAHA 3RB3A 2ZH8A 3EGWB 4JI1J 3I5CA 2CPIA 2O3DA 3E2EA 3BSAA 2ZBQA 1UETA 3V4IB 1C4CA 5B0AA 3DDNA 2J0QD 2VKRA 1C2PA 4UQTA 2EFVA 3I5AA 3J7AN 2DNRA 1SJRA 5KFAA 3CCQS 5ITHA 4QIFA 1FD8A 3H8YA 4NLTA 2D9PA 3OT9A 2BE2A 2HNZB 4CO2A 5AJ3F 3BGRA 4OZ1A 3JQJA 2L48A 1Z2ZA 1KFSA 2KJWA 4MFBB 4AT1B 1AFJA 3W3SA 1TK0A 5HL7Q 4USIA 2E1AA 4P7TA 3DXSX 1YG0A 3ULHA 2V9KA 1N54B 4PG7A 1Q16B 1YVFA 3V6KA 3SV4A 5EDWA 4UOHA 4CM0A 5BJRA 2E44A 2BUNA 1C0TA 5L9NA 1ZTTA 2RKIA 3BGLA 3K5PA 5AE3A 2FGOA 4DPXA 3WC2A 2Z30B 3AY0A 1K0TA 4KGVB 4TNOA 1TL7A 2APOA 3L9ZA 1QUVA 2BV3A 5KFGA 4JI8J 2VFRA 1DQ8A 2NYHA 1SQGA 2MXYA 4PUOB 4FPIA 4CT9A 3FMWA 4Y2MA 5H9FJ 1T11A 5H9FK 3PRDA 1I94F
chains in the Genus database with same CATH topology
5IQQA 2IYIA 2GFFA 4BWMA 4IR1A 4YY3F 3NNCA 2J7WA 2LQ5A 1SB6A 4LF8F 3MTJA 1WHVA 2JWNA 4NRTA 4DV2F 4NZ6A 3MEDB 3BDPA 1JXEA 2J8AA 1XN9A 4PWDA 2Z8QA 4Q0BA 2YNGB 3D5MA 2OPQA 3JSMB 1XBWA 2ZUGA 2HQ3A 2OPSB 4NRUA 5GADU 5KFCA 2ZH5A 2FVCA 1WHXA 3N6MA 3HX9A 5K14A 4Q43A 2J9DE 2BABA 3NLCA 5KT5A 1T05B 1RISA 3OFHA 2PA3A 3CF5Q 2D3UA 3J80Y 3DRRB 1OPIA 5IS2A 3PW7A 1FD2A 1VQOS 1EETA 4YDXA 4DL2A 1X5TA 2B43A 4YEAA 1FTRA 3DRXA 2VONA 2IYGA 5HQ8A 3W2WA 2RJZA 4YFUA 3CCMS 4F4WA 1NKBA 1QVGR 2HHHF 1U24A 4LF4F 2LEPA 3D28A 3T9ZA 1VQPS 5F8HA 3OSNA 2B7BB 4G3IA 1VBZA 2Q66A 1HQUA 3QWPA 3I4PA 3D1HA 2UUWA 5F3TA 4ZP9A 2YKMA 4IRCA 3NNAA 1MMLA 1UEVA 3MR5A 4L6V3 4R0EA 2EFOA 4DPOA 3R5BA 1ZAVA 2VOPA 4EZ6A 4FS2A 3W7BA 4LMZA 2AWZA 3MR6A 2V4JB 4DSJA 4LSNB 1BC6A 3CD7A 3MEKA 4NYOA 5CZVA 4U6PA 1SUQA 5JJBA 2SXLA 3QAUA 2AX0A 2BM0A 4J9LA 3K59A 1CVJA 2BANB 4Z2XA 2GO8A 2IJNA 1T95A 4DSIA 1WG1A 1BGXT 4A8YA 5KAKA 2DIVA 5E41A 3LF0A 5KFZA 3DHWC 2VG7B 2J76E 4DX8H 4CZCA 4K4WA 4FXDA 2ZD1B 3HI9A 2XS7A 4DBQA 1Q4RA 1OS5A 5IT0A 1HPZB 1N52B 2DH9A 3BSNA 1BD6A 4WZMA 4CO1A 1S99A 2MDAA 3O6QA 2B3TB 5LXRA 4AUKA 2CPYA 2K1RB 4KKOB 1PGZA 1FE4A 1F0XA 3M2RA 4G1PA 1MROA 1Z2LA 3SCIE 1FKOB 1X4DA 1SXLA 2CPEA 3DOKA 3U1NA 5KFWA 3KHRA 3TVKA 3M4XA 1KEKA 2R7VA 1S76D 2AYEA 2WBRA 3LP1B 2IRUA 3F41A 2KM8B 3LGMA 4BS2A 1HFEL 1N6QB 4KR0B 1AROP 1X4CA 3QIDA 4C3KA 4JI2F 3CCRS 1YJ9S 4ZP7A 5KFXA 3RAXA 1REVB 3MPVA 2HFNA 5T7LB 2NR0A 4NLYA 1W2BR 4HL9A 5DDPC 2IM0A 3GQCA 1KD1T 3BR8A 3BM7A 4AL6A 2V0NA 4KV8A 4LFAF 2ZC3A 2XHWA 3ISZA 3CCWA 2NREA 3E51A 1HBOB 2J0WA 3HKWA 3QLHA 5BYSA 1HBMB 4F8RA 2HHPA 5DG8A 1KOHA 4FPRA 2KFYA 4PPZA 3N5BA 3OL8A 2EW9A 2VC1A 1OPZA 1U1OA 4PCQA 2RB7A 3M6VA 3T19A 3OHBA 1KQGB 1CEZA 2EVZA 2WONB 2MKKA 2BACA 1VFJA 2KDOA 3E3XA 3POTB 1JLQB 4EEYA 3IC1A 2A18A 5SUHA 1BQMA 3MECB 2HQIA 5D6GA 2AJ0A 3IO1A 3FSYA 1SJQA 6FDRA 1HD0A 3WBZA 5DDQC 1IXKA 4RW7A 4AE5A 2X3GA 4OX8A 4QCLA 1TFYA 2VFVA 3ZZ0A 1DJ0A 4NL5A 1FHTA 1X4HA 3H4DA 3MDFA 2W4CA 3ENQA 2A2DA 5EUHA 2LMIA 5DO2A 4QWEA 3IR5B 4ED7A 3DM2B 4OHWA 1YITS 2O67A 3CB4A 4I2PB 2JEFA 2QA4G 5CZXA 2CPFA 2FJBB 3AJ1A 2MKCA 1VIOA 4GO5X 3PKYA 2MZRA 5F8GA 1HW9A 3V4IA 3RYLA 7FDRA 1WF0A 1VQMS 1HNIB 2OTLS 3P96A 4NWBA 4NLDA 4NLQA 2W9CB 3UE2A 3HK2A 1FNOA 2VBZA 3R1HA 1FDBA 2WW8A 2ROGA 1WG4A 3CDAA 4C0BA 4OQJA 2YQ3A 2BQ3A 1Q82T 4WF9Q 2KXNB 2UV8A 4EUVA 5HMZA 3CDEA 4RNMA 4UW2A 1N33F 4G6VB 2M8HA 4URSA 2N3LA 3NP5A 1J5EF 2CPHA 2AD9A 3M30B 3LWLA 4RBUA 1UVKA 4NPOA 3M1VA 4J9RA 3PW2A 1JLGB 2D3OR 3RR8A 2QLWA 1HBUB 3M8RA 4YR3A 1N8RT 2XY5A 2ZH9A 1UAWA 2C3YA 1SL1A 1KR4A 2FB0A 4KFBA 4BWJA 2I2YA 3FEZA 1B64A 4R5PA 4DQSA 2C3PA 2JEIA 4KGKA 2HNZA 1LK5A 2RNEA 5LSOA 4F02A 3MM8B 1H0HB 1IBMF 2LDYA 5DLGA 2CQCA 2G13A 4WTYA 5F3ZA 2D9OA 1XMBA 2VG5B 1TVRB 3KHLA 3UCZP 1UJ4A 2P5VA 2XMTA 1Q81T 4DV3F 1R0AB 5J2MB 1HWJA 2R4FA 4F3MA 5B7WA 3PFOA 4MFBA 2DBBA 1Q8IA 2VH7A 3MEGB 4HVZA 3MM7A 3GIMA 3RRHA 5HLFA 4F4KA 4DQQA 3DU5A 5B0FA 1FE0A 4QOTA 5KG4A 2V94A 2K3IA 2NSBA 3K5LA 4E8UA 2CPJA 4BDPA 3CDWA 2NPIA 1BY9A 5A6PA 3QJLA 3IWXA 3C6TB 3QYYA 1DRZA 1NB7A 4ILLA 3I32A 4DL7A 3O8WA 1D3WA 1UJ5A 2JFDA 1ZPVA 2PMHA 2MJNA 5CQGA 4QR2A 1VGYA 1RT3B 3BSOA 1KHWA 1FNXH 2AX1A 2FC8A 3TAMA 2FPHX 4XPCA 2CQHA 4C97A 3GIKA 2M2BA 2E5JA 2YVSA 3UW1A 3FFIB 1QUPA 4DR5F 4NLPA 2R2UA 5I3UA 1FRHA 2W7PA 2R8HA 1CLFA 2HWIA 1UKUA 4X4RA 4EBEA 1A7GE 3M6WA 4JYAF 3G6YA 3MM5B 3UCUP 5HMXA 2DNLA 3MM6A 3FSXA 1HMVB 4EYIB 4LF9F 1FA0A 5L1LA 3PRBA 5L1IA 2R7SA 1F60B 3PO4A 3R27A 1KLMB 2XZWA 4BC7A 5FDLB 4ECVA 1QJHA 3OTDA 4HT5A 1N0UA 3TRGA 2WRMA 3MUMP 4USHA 2KRBA 3CD0A 1ROFA 3CGIA 2IRXA 3QPIA 3VCDA 4PUOA 4LJMA 3S8SA 4YP3A 4K4SA 1IQZA 1LXJA 3ISND 4KRWA 1U1QA 4UUWA 1WEYA 2E9RX 4C4WA 2VFUA 2GA7A 3CJ4A 4ZHRB 2J6UA 4DR4F 2KHDA 4QZVB 2FJEB 1S10A 4YMEA 4OLOA 3KNAA 3SZ2A 3MEDA 4FNHA 3F44A 2OMOA 2O1PA 1ULRA 4E98A 4F2RA 3M05A 4X4NA 2YNGA 5M2RA 3JSMA 2R7WA 2OPSA 3DLLQ 4EO6A 2N4CA 4ZPAA 1VQ6S 3N6LA 5CYQB 3KWMA 4X4OA 3CEDA 3ZZUA 1T05A 3MUVP 2XGQA 3BO2A 5FD1A 3DRRA 1L5UA 3R5AA 5GAGU 1NK7A 4JI7F 3U02A 2EBGA 4FF4A 4TY8B 5KTQA 2BM1A 2EKYA 2B9XA 1XMOF 3NG8A 3G8QA 5AXLA 4IKAA 4M8LA 4FVMA 1XR5A 3WX4A 5MLCV 2DPIA 4CCHA 1WNEA 4OI3A 4PXDA 3KLGB 3VAJA 1IJFB 3GSDA 1S6OA 4AXIA 2DO0A 2XLJA 2CKWA 1FEHA 2CQIA 1L3UA 1UMJA 2A10A 3DNCA 4P7VA 3BN4A 5IZHA 3HZGA 1HW8A 3PNIA 2MGZB 4J9QA 4DL5A 2PFFB 2FD2A 3TUZC 1NKEA 1N5VA 1O51A 2KN4A 2CQ4A 3IBWA 3CE8A 3FGVA 4IYQA 4MMOA 1E6YB 1CG2A 2B51A 2MZJA 5GAHU 2XC9A 4RUAA 2QSWA 3VQSA 4Q2MA 2EFQA 4N76A 2U2FA 1PC5A 3HT3A 1DQ9A 2V4JA 4LSNA 3SXLA 3I0RB 2R7UA 3GFYA 3TVYA 5KFHA 2XCAA 5DLFA 2MKHA 2QMXA 2W9BB 3DI6B 2XMWA 2BANA 2PD1A 4KQZA 3UR3C 1KQFB 1VI7A 5BYQA 3I96A 1R8AA 2CFXA 2VG7A 4EO8A 2YH1A 2ZD1A 2MY8A 2ZDPA 5EWFA 3C46A 1HYSB 1YRUA