1FHTA

Rna-binding domain of the u1a spliceosomal protein u1a117, nmr, 43 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
116
structure length
116
Chain Sequence
AVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribonucleoprotein
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Solution structure of the N-terminal RNP domain of U1A protein: the role of C-terminal residues in structure stability and RNA binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1996-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fhtA00
2FC9A 3CCQS 2DK2A 3R1LA 1U1RA 2XS2A 2VOOA 1FJCA 2HVZA 2EK6A 5GVQA 4TU9A 2LECA 2AD9A 1H2TZ 1DBDA 2JVOA 2DIVA 2KU7A 3UD3P 3CC7S 2ZJPQ 2RU3A 3B4MA 2ERRA 1YI2S 1F9FA 2MKCA 1X4BA 1X4FA 2RRBA 4J5OA 1FJEB 4WFAQ 2M2BA 2HZCA 3BO2A 5LXYA 2MY8A 4PR6A 1UFWA 3DXBA 2LEAA 2KM8C 2MB0B 1R8HA 4YOEA 2YTCA 2VONA 3CCRS 2LA6A 2MQOA 2MQMA 3G71S 1U1QA 1RK8A 3V4MA 3CCUS 2DNYA 5DDRC 1M5PC 1X4CA 2WBRA 2LQ5A 4PKDB 3G6ES 2KM8B 2RNEA 1M5VC 2DGTA 1U1NA 1FHTA 1WHWA 2DITA 1L3KA 2MQNA 2DNNA 3ULHA 1X4HA 2DIUA 2I2YA 3IRWP 4C7QA 2CQ0A 5LJ5Y 1FNXH 5D77A 2CPHA 2DHSA 2DH9A 3CPWR 1YJ9S 2AYBA 2OSQA 2CQ3A 2EVZA 3N9UC 4Z2XA 4CQ1A 5DDOC 5GAHU 1VQ9S 2CPIA 2Q79A 1B7FA 1H6KX 2RRAA 3VAHA 1R8PA 2EK1A 2ADCA 1VQNS 4M5DB 2M8DB 5H1SV 4BS2A 2A3JA 3BS9A 4CH0S 3CCES 1VQPS 1NU4A 3P5TL 2GO9A 2J8AA 1X5OA 1DHMA 4IUFA 1VQKS 1G2EA 1WF1A 2YWKA 1YWXA 3DLLQ 5ITHA 1OO0B 4IOAQ 2KVIA 1S79A 2DHXA 2JX2A 3MDFA 2RT3A 1X5PA 3MUTP 5D78A 4WF9Q 1VQ7S 1VC6A 3P49B 1IQTA 2DNHA 3MD1A 2YKAA 3L3CA 4UQTA 1FJ7A 4YUDA 4FXVA 2MKSA 2L41A 5CXTA 3VAKA 1W2BR 4IOCQ 2DH7A 2SXLA 1D8ZA 2JRSA 1JMTA 4QU7A 2LXUA 4WCEQ 4QQBA 4PRFA 3UCUP 3I56S 3S7RA 5DDPC 1YJNS 1VQ6S 2MZTA 3P3DA 2FY1A 1X0FA 2FPHX 5HL7Q 2AYGA 1KOOA 2MMYA 1JJ4A 2KRRA 2XB2D 2CPXA 2O3DA 1A9NB 1U1LA 2MQPA 4TLQA 1VBZA 5IFMA 1HL6A 1OIAA 4WFBQ 2D9OA 3FEXB 1NJIT 5GAGU 1N88A 2DNGA 5IM0A 3PIPQ 2CQHA 3JB9k 2MJNA 2MKJA 3CC4S 2VODA 5CA5A 1U6FA 4LIRA 1ZH5A 4W90B 2E5HA 1SXLA 3K0JA 1D9AA 2M7SA 4CH1A 1FT8A 4CIOA 2MQQA 3VAFA 2KH9A 2CQBA 2HGLA 2MKIA 3H2VE 2HYIB 3CCJS 2E5IA 5DDQC 1WWHA 1U2FA 3MUVP 1U1OA 1AUDA 2HGNA 2M4MA 2DNPA 5HO4A 2MYFA 2F3JA 1KD1T 1SJ4P 3CCSS 3CF5Q 1QM9A 2X1AA 2DGVA 1WF0A 2CPEA 3RW7A 2DO0A 5GMKa 2KYXA 3EGZA 2V94A 2F9DA 1WEZA 3S01A 3VAMA 2G0CA 4TU8A 2CQGA 4ERDA 1O0PA 1FO1A 3VAJA 2X1BA 1M1KT 5LJ3Y 2MGZA 5DETA 2PE8A 2D9PA 2KHCA 2MZJA 2J0QD 1U1PA 1M5OC 4OZ0A 1YITS 1WELA 2DNMA 2MSTA 1U1KA 2CPZA 5JVGQ 1WG5A 2CPYA 2RQ4A 2MY7A 1SJFA 3UWTA 2L08A 3CMES 1WI8A 2OTJS 2J0SD 3H2UB 2E5GA 3CCMS 2AYMA 1VQMS 2BZ2A 2ZJRQ 2DHGA 2CPDA 3UE2A 2OTLS 3NS6A 2KT5A 2MPUA 3CC2S 2OIHA 3IWNC 4Y00A 1KOHA 3MUMP 2U2FA 1Q86T 3S6EA 3R1HA 5LSOA 1YIJS 1URNA 2CQ2A 3CD6S 1M90T 3G9CA 5EN1A 3TO8A 1HA1A 2YH1A 1Q82T 2G4BA 2E5JA 1K73T 2KFYA 2DNQA 5JVHQ 1X5TA 3PIOQ 4WKRA 4ED5A 2MJUA 3TYTA 2NLWA 5CYJA 1WG4A 5GADU 2J76E 2LA4A 2KG1A 2X1FA 3CCLS 2CQPA 2I38A 2KRBA 1CVJA 2CPJA 1UP1A 3MURP 2DB1A 2MZSA 2QA4S 2GHPA 1P1TA 2PEHA 2X1GA 2U1AA 2N3LA 2DGQA 2MKKA 1DRZA 2CQDA 3TP2A 5IM0B 4F26A 2DGXA 5IQQA 2DH8A 5LSLA 1YHQS 2MHNA 1VQ4S 3Q2SC 2CQ4A 2G1DA 1H2UX 3D2WA 3U1MA 1WHYA 3VF0B 2N3OA 2MQLA 2F9JA 3G4SS 3G8SA 2KN4A 5GAEU 2RQCA 1NO8A 1UW4A 1XN9A 3ZZYA 3I55S 1WI6A 3R27A 4ZKAA 3CUNA 2ADBA 1YTYA 4WIIA 2CQIA 3US5A 3SXLA 1JJ2R 4OZ1A 2M9KA 2L9WA 3CXCR 3P6YC 1OWXA 1K8AT 3BEGB 3SDEA 5FJ4A 3BO3A 3G8TA 2BOPA 2LYVA 3EGNA 2N82B 4IO9Q 4C4WA 1WHXA 2ZJQQ 3U1LA 2MZQA 4U67Q 2QEXS 5MLCV 1X4DA 1KQSR 2QFJA 2XS5A 2MGZB 3HI9A 2KG0A 1VBYA 2NZ4A 3G96A 2LXIA 3NMRA 1HD1A 1VQLS 2YH0A 2DNKA 1KC8T 2M52A 1VBXA 3BO4A 1SJ3P 4Y0FA 1U1MA 3NNAA 2M88A 1VQ5S 2JVRA 1X4AA 2XNQA 3J7ZT 1YJWS 3NNHA 2KXFA 3NNCA 2RUGA 2K3KA 2KXHA 1SJRA 3ZZZA 1VQ8S 3UCZP 1ZZNA 2FC8A 2XSFA 2JWNA 3J7YU 2E44A 3LPYA 1Q7YT 2LEBA 4W92B 1WG1A 1U6BA 1X5SA 3LQVA 3CMAS 3FEYB 4YB1P 2MXYA 3HHNB 2DGUA 1S72S 1HD0A 2N7CA 2DGWA 4P6QA 3THTA 2FHOB 4FXWA 4WFNQ 2LMIA 2M8HA 5LXRA 1N52B 1K9MT 2XS7A 3VAIA 1JJHA 4LJMA 1P27B 2OSRA 3VALA 2DGSA 4EGLA 1WEYA 2OJ3A 4RU2A 3CTRA 2LCWA 4C0OC 4A8XA 2DHAA 2K8GA 2M70A 1M5KC 4V19X 5BJRA 2DNOA 1QVFR 1PGZA 2CQCA 3NS5A 1SJQA 2LKZA 3OW2R 2CJKA 2MZ1A 3MXHP 1WTBA 3RW6A 2B0GA 2RVJA 3CCVS 1DZ5A 1UAWA 1WF2A 5DM6Q 3CULA 4LMZA 4TU7A 4F02A 1Q81T 1QVGR 2VOPA 2DNLA 4QPTA 2MKHA 4UY8T 3SMZA 2M0GB 1FXLA 3MD3A 2RS2A 3MI7X 2DNRA 2AYEA 1WHVA 3UD4P 1BY9A 2DO4A 2XNRA 3SDEB 1VQOS 2HGMA 1WEXA 2DNZA 1VC5A 3S8SA 3B4DA 2UP1A 4QU6A 3UCGA 1PO6A 3VAGA 2RS8A 1X4GA 4F25A 2MZRA 1H2VZ 1A7GE 1OPIA 2CPFA 1VC0A 2MSSA 2CQ1A 1N54B 2DISA 2D3OR 3Q2TC 1X4EA 3THPA 5DM7Q 3EX7B 3MOJB 1N8RT 2DGOA 1ZZFA 2KI2A 1RKJA 2KXNB
chains in the Genus database with same CATH superfamily
2IHR1 5T14A 1WDTA 2KU7A 1G1XA 3BKUA 4OHZA 1SL1A 4Y2KA 2EFOA 3G82A 1IR0A 2ZDOA 3FCWA 2MY8A 3OTEA 3TAMB 3NAIA 4I7FA 7FD1A 4NMLA 3PCOB 1M5PC 2W7PA 1X4CA 3F41A 4X66J 1RAEB 4P52A 1NJZA 2DR8A 4ZOSA 4UUWA 3GLJA 3T1HJ 1FX4A 2BABA 3I5CA 4FF4A 4LBHA 2R42A 5B0AA 2VFSA 1H6KX 2E66A 3JSBA 4XDDA 2M8DB 2V9KA 4BS2A 2I8EA 4NLYA 2RB7A 3GJRB 5F8GA 3ILJA 3P5TL 3DOKB 1RT6A 4DL2A 1MN7A 1S79A 3MUTP 5KFKA 1RAFB 1T94A 2AGPA 1C2PA 3AAWB 4ILMA 5HBMB 4QIWD 2NYHA 1ZM3A 4PRFA 5IV4A 1YG0A 1ZYQA 4H4OA 3S7RA 4B9UA 3FUYA 4CLKA 3GG1A 3MM9A 2FPHX 3GYGA 1JJ4A 2R7TA 2F7VA 3AXMA 4B3SF 4OI0A 2C3PA 2FZGB 2VJVA 4LQ3A 2R8KA 4ES1A 3GONA 1X60A 2WZ1A 2GJFA 1MN9A 4HACA 3JB9k 3JTNA 1RKIA 1TK0A 2OUGA 3K0JA 3I4PA 1FT8A 4JI0F 3K8VA 2KH9A 3TZXA 4HTJA 3MAAA 1XERA 2DNPA 4IDKB 3D3BJ 4NCGB 2DO0A 2QN6B 4DG1A 1HR0F 3QRPA 5F9LA 3R97A 2OPQB 3RBZA 1KFDA 2E5LJ 4K4UA 1SKUB 3EUNA 5DJBA 3NRBA 2HQIA 5IOLA 2KJVA 3TVKA 1YITS 4A8MP 1I51B 3KHRA 4GC7A 2V9WA 5KFHA 2L08A 4DOZA 2OIHA 1FD8A 2ASYA 3SSRA 1ZETA 1KOHA 3TA1A 3VQTA 2U2FA 1T3NA 2PT0A 3MMBA 1SVDA 3T9ZA 3C66A 2AWZA 3TO8A 4CLYA 1BWEA 4GKKJ 1TL7A 2KFYA 1X5TA 2B4PA 4WKRA 2XYGB 2KYZA 5HVGA 1RTDA 4ZVSB 1Q8LA 2BE2B 2XMWA 3DRYA 4ES3A 5JMNA 4DV3J 1FRJA 1HQEB 3TQEA 1VHFA 2Y0SD 2X1GA 2WAQD 2ZUAA 4ZPTR 1KRPA 4F26A 3MHYA 1N36J 4OI6A 4JI4J 3PFEA 3IS9B 2F9JA 2BDPA 3M6WA 2P6SA 3CDBA 1J27A 3MECA 2AJQA 2ZOMA 2ASLA 1X0PA 4N7TA 3SV4A 4RW6B 3BO3A 3G8TA 2BOPA 3SYZA 1X9SA 2C28A 3H4DA 1WHXA 2YKMA 4KR0B 4U67Q 2KZMA 5MLCV 1KQSR 2VKZG 2MGZB 4O44B 1TKDA 1M0SA 4IR1A 1LWEA 2RHSB 2DNKA 2QA2A 1VBXA 2M88A 1PYSB 2JVRA 4OYAA 1J5EJ 4DV2F 2C2NA 1VRUB 4NI2A 3E51A 3QLHA 1EB0A 4FKXA 3M1VB 3LQVA 3RB6A 4YB1P 1HI0P 1EIYB 5K14A 4F0HA 2W4PA 3BGOP 2Q43A 4K4YA 1VISA 1N52B 3JSMA 1JJHA 3PW2A 1VR6A 3VALA 2RDJA 4DR3F 3CJ3A 3CGIA 4DQSA 5J1EA 3TANA 1NSKL 2I9SA 3AOAA 1F3VA 2ZBRA 2PMZD 3HKWA 3M05A 2A0FB 4LSNB 2CJQA 1NKCA 1S6OA 3HXMA 3PX6A 1VK3A 4KH0B 1NDKA 1Q0NA 4V19J 3CJTA 2VA2A 4GRSA 2DEJA 1H2VZ 2YKPA 1VC0A 4MT1A 4J9QA 1B7YB 3KLHB 2RU9A 5F0UA 1GTHA 1KVKA 3MOJB 2UUAJ 4DV5J 1KONA 1UVIA 4FZVA 1LXNA 1UETA 3D54A 4V1Ak 2XMAA 1F9FA 2N7YA 2RRBA 3AQOA 2A1BA 3NBPA 5LXYA 1UFWA 3DXBA 3H5UA 4NLSA 2ILZA 2LA6A 1WSVA 3JAMU 4PKDB 3PX4A 5ETTA 2XMUA 1R0AA 1X4HA 2DIUA 4G6VB 5JJBA 1VOMA 2CQ3A 3UD5A 1VQ9S 1TKTA 2QX0A 1CC7A 4JUZA 4DN9A 4G1PA 3O44A 3AJDA 1YQHA 2D3O1 4I69A 2GO8A 2YWKA 2JC1A 2FUG9 4QWBA 4WU3A 1IKVA 3P49B 4IG0A 3MM7A 3GIJA 4OYIA 4YUDA 3HJVA 5B0EA 4G1QB 3BGLA 3CO9A 1W2BR 4XIUA 2DH7A 2SXLA 5D6GA 1REGX 1FERA 3J7YI 1JMTA 3HFKA 3I56S 2V8GA 2BOAA 3KHHA 1TTHB 2KRRA 3EDRB 2BX6A 4F50A 1QTNB 2BVZA 4QWDA 2ZC3A 3VHQA 2UXCJ 1HNVA 1BQNB 1QE1B 3PFOA 5IWAJ 4LIRA 3VCDA 1VBKA 2PMHA 2A2CA 1HNWJ 4KH1B 4I6AA 4O4GA 4I1TA 2BR0A 2F8HA 2MQQA 3RRGA 2EG2A 1HMVB 2QLXA 2W2OP 1WWHA 4OZ3A 3ET6B 3N4WA 3SQOP 1VGYA 1AUDA 3JTPA 1S1XA 4Z37A 2J8SA 3CCSS 4FNHA 1Q4RA 5AXNA 1ZOTA 3RW7A 1Z4UA 2FLLA 2CQGA 1KHVA 1FO1A 3K5PA 5KFGA 1J5OA 4URGA 2EKYA 4A8QA 1HWKA 2Y1LB 2HW3A 1PKUA 4YFUA 4EZ6A 2HWTA 5GAGI 5C2CA 3D6TB 3BGFA 1DAXA 1NJXA 3UE2A 2IVMA 2ZOFA 2RJZA 2ZH6A 5DZ7A 5KT4A 4OJ3A 1NHKL 1EQ0A 2V8VA 4UOHA 1OYEA 4BWMA 4FS1A 4FF2A 3NMAA 1RHUB 2YKNA 3M9OB 2HVHA 4DFMA 4NEZA 4G65A 2GHWA 2ZWPA 2MJUA 1RHJB 5CYQA 1YZ6A 2KG1A 3RYLA 2XY5A 4Y3CA 2C3OA 4IQMA 1KLMA 1R6YA 3M4XA 3DRRA 2AF6A 4FYDA 3MEEA 1CPZA 5IQQA 3GPAA 4ZJQA 3G86A 3DI6B 2HWIA 5GAHI 3KHLA 2XM3A 2B9EA 3TOQA 5FDLA 1S1WB 3GCXP 1REVB 3V2UC 1U09A 2J7KA 2IDLA 1YJVA 1VCTA 2YX1A 1ZM9A 1GXTA 2E7XA 3QRQA 1NBEB 4B3RF 3GSDA 4PG4A 4XDCA 1LXJA 1N5SA 1QAIA 1U2CA 1RT1A 5BYSA 1B4SA 2OO4A 2FLNA 5KG3A 1HWLA 4I68A 2JWNA 4NE9C 1N33J 4LFCJ 5SUHA 4I2PB 3HHKA 4C0HA 4P73A 4KHPJ 3I82A 3DLGB 4LF7F 3ISND 4X4SA 3AY0A 3K5OA 4QIGA 4K4TA 4J7CA 4ZPBA 2FZCB 3WC2A 4NASA 1QVFR 1VIXA 2CQCA 1SJQA 4M5DA 4LVNP 2MZ1A 4UW2A 1WKLA 3CEDA 5DO2A 1X7VA 1S48A 4DSFA 3CULA 4OJ1A 1BHNA 5K8NA 2WSCC 2DNLA 4M1KA 1S10A 3BV8A 1D8YA 2YWHA 2HHPA 3DRSB 5BYQA 3SCKE 3AD9C 2JZ5A 2DO4A 4C8MA 4USHA 2NREA 1QJHA 2PMWA 1BD6A 3QJJA 3DRXA 3KUGA 1FK9B 5J1NA 4AUKA 1C4AA 3OVBA 4R25A 1V5VA 3IR6B 2KXNB 3CCQS 4HTIA 2HVZA 1U2RA 1CJTA 3P4UB 4DS4A 2YNGB 1AZSB 1X4BA 3HHLC 1HHTP 1MWQA 1S59A 4J9VA 1S4EA 2BANB 4PR6A 2OPPB 5A8KA 3CCRS 2GIQA 3BBCA 4ED7A 2AQ4A 1QAYA 1SKWA 2QFIA 1N5QA 2OI2A 2Q66A 3OLAA 2HHTA 1S9EA 1KVJA 5T7LA 1FA0A 2LQ8A 3H2LA 2I0XA 2WSFC 4FBUA 5FD1A 4F4YA 5LSRA 1RWNB 2Y0BB 4WP8A 3AA9A 1JLCB 3BS9A 2VQEF 1LNQA 2LFVA 1FXRA 3LAKA 1VC6A 1ZBTA 1IVZA 1KFSA 3A8JA 1S1UB 2HHSA 1H73A 2LQBA 3LP2B 2VH7A 2LXUA 3EPGA 2RHQB 1DLOB 3BBBA 2OMLA 4IKAA 1IKYB 5I42B 5D4PA 2XY7A 2XGPA 1RA7A 4E2FB 1B3TA 4LF5F 1IWAA 5IM0A 4KV8A 1SI9A 2COLA 2GQCA 2MHEA 2QZ8A 3D6HB 1SL2A 2FQQB 2CVEA 2XULA 1OMSA 4LF4F 2R2SA 2M4MA 4H4MA 5F41A 4P7VA 3AJ1A 4X62J 4CT9A 5KFOA 2ZH5A 4ZPDA 3S01A 2AV5A 1M1KT 4OYPA 1F60B 1FKOA 1C4CA 4WP9A 1Q16B 4OZ0A 2MSTA 4TYBA 1NSPA 1WI8A 3D6MB 1KTQA 3CCMS 1VK8A 3E3XA 3PR4A 2RQMA 5B08A 3MUMP 3LPEA 4DCOB 1KEKA 2OEJA 1C0UB 3R1HA 3Q8YA 4ZPWR 2C3UA 1GNKA 5CYMA 2UVVA 3R5BA 5EN1A 1IKXA 1RAAB 3G6VA 2DKOB 1RXOB 2NLWA 2OEMA 1HNZJ 4RW4B 2VU5A 3O3LA 3CJKB 2CQPA 1X9WA 2VG7B 4U8VA 2QA4S 2GHPA 3IA0A 2HQCA 1ZS6A 2CADA 1B0VA 2BJ3A 2GQQA 2NQPA 5LSLA 1TKZB 3FFIB 3TUPA 2OELA 4PQUB 2EKNA 3GILA 2HAFA 1LWCB 4DX6A 3W2WB 4EK2A 3CMQA 3C6TB 3DM2B 4J9PA 2UXBJ 3CJ8A 1HYSA 3PW5A 3WX4A 3KJQB 3I31A 1GAOA 1X4DA 3CDUA 1R0BG 1R8BA 2ILYA 2VFRA 1Y00A 1WC0A 3TA2A 4QWAA 4M5JA 4DFJA 1CC8A 4PWDA 3NNCA 1TL3A 4C8LA 1NPRA 1VS3A 3UCZP 1XR5A 2W25A 2NYIA 3TR5A 1HNXF 1WDDA 2ROPA 2RAQA 3LPYA 3PHTA 3O6QA 1NK5A 4FVCA 2UV8G 1OQ6A 4YHHF 3DMJB 1S72S 3QIPB 2GW8A 3RR8A 2M8HA 1S97A 4HI1A 2HRTA 3ZNJ1 2OSRA 4LBIA 3UPFA 2HHUA 1EP4B 4A46A 3NS5A 4X4VA 1NKEA 2KB2A 2XMMA 4MKBA 2HZAA 4J9LA 1UVKA 1HNIA 5E3RA 3PRDA 1XMQF 3KK3B 2M0GB 1X31C 2AGQA 4NLOA 2PI4A 2DT9A 1IBLJ 4CYUB 3OUYA 1RSCA 3BR9A 1OY9A 3M6VA 3WDOA 4C0BA 3MTJA 3K5MA 3DYAB 2P9EA 5HROA 3G2XA 1R43A 1RDRA 1M5SA 1LWFB 1O5JA 1RKJA 5L1JA 1B0PA 1CQMA 2VOOA 2X3DA 1MMLA 4K4XA 3NGKA 2AP6A 3W8GA 1YI2S 2EFGA 5KFNA 2V67A 3IG1B 4QOTA 4NLTA 1D1UA 3R5JB 2KZZA 3KMQA 1HBUB 3N28A 1S1TB 2JOQA 4Y34A 4X66F 3PYFA 2LQ5A 2HNYA 1QAXA 1YSJA 2KL8A 4RW7A 2DNNA 3T1HF 3KJVA 4ZCMA 2JLGA 2WVDA 4P2XA 4A8YA 3QO9A 4Z2XA 2L3MA 2CPIA 1BQMB 3V6HA 2EK1A 2YY3A 3W3SA 4FPIA 2A3JA 3SZ2A 2ALYB 3BKFA 4HI2A 1KS2A 1R27B 5ITHA 5BYRA 3RRHA 5CCLA 1TL4A 4PPDA 4EUVA 2IA6A 2YWEA 5KFPA 1Q1KA 4LFBJ 1VI7A 4UQGA 3ZTPA 4XAKA 2X3GA 3EXCX 2HNZA 4JI2J 4A8WA 1RU2A 1KTVA 3FRZA 3UNGC 3RU0A 3M8PA 7FDRA 2FY1A 2GIFA 1CJKB 5J2NB 2MMYA 4P2SA 4OHVA 3E01B 1SC3B 4X4TA 4NXNJ 2W2QP 4OJHA 3FEXB 2XLJA 2PI5A 4RWWA 3LGHA 2HS0A 4OLPA 4ZK7M 4DV1J 4W90B 3OFEA 1KN6A 2WW4A 1S49A 4PCQA 2M7SA 4CH1A 1XNQJ 4GVBB 4N8OA 2E1MC 5H9FJ 4IH7A 2C2OB 3SBMA 1U1OA 2HGNA 3ILOA 1F9EB 4YR2A 3C15B 3DLKB 1CS4A 1JXEA 1QM9A 3M9MB 5D3GA 3ENWA 4CT8A 4ECWA 3R5CA 2AEFA 4LF9J 3G87A 3IRXB 2E5LF 3Q8PB 2PE8A 2KHCA 4YY3J 3D9BA 2R8HA 4Q0BA 4CO1A 1HPZB 1X8DA 1RTIA 3VGTA 5U47A 2HIYA 1UJ4A 2CPDA 2W9CB 1PJ5A 3CC2S 2HG4A 3M32A 1BGXT 2D69A 1UVLA 2HFOA 1IN0A 3UR0A 5E5NA 4QWEA 4F4XA 1URNA 2K7KA 3MM8B 5C5JA 4Q2LA 4GKKF 3U02A 2E5JA 3R6GB 4L76A 5HJXA 5CYJA 4B3TJ 1JLQA 4IRDA 1FDNA 2EXUA 2BKOA 4P2FA 2I38A 4F2RA 5ETQA 2KFNA 3MURP 4DV3F 2GMHA 3PACA 4LF2A 1KSPA 2DGQA 3AXKA 1D9FA 1N36F 2LVWA 1CJVB 4JI4F 3FNNA 2EEYA 4U95A 1S1VB 4DV4F 4O3NA 1VHIA 4WE1A 2B7BB 3HX9A 1O6XA 5I3PA 2K2PA 5BXIA 1K8AT 3PO5A 3SDEA 2Y8YA 4OLOA 1Q78A 1Y4ZB 2N82B 2AU0A 2HAIA 4ZJLA 2FD2A 4KT0C 3B8HA 2CNNB 2Z8QA 3EVOA 3OR1A 2HPUA 4ZN1A 4EO6A 2YNIA 5G4DA 1PBAA 2RUGA 1SJRA 1RT5B 2NS1B 3ENAA 1TR0A 1EETB 3POTA 2XZTB 2AJ1A 5FLXU 5ETOA 2DRDA 3JS9A 5ETPA 3KTQA 2VG5B 3D1QA 5L1LA 5ETLA 4FKYA 3SCIE 4L3KA 3F56A 1PG5B 4X4UA 5HAOA 4L73A 4RX6A 3I0SB 3OW2R 1NPKA 1RT7A 1L3TA 5A2QY 2HVIA 2ZE2B 2RVJA 2UUTA 4CLLA 4ZPVR 1WF2A 3K8WA 3RUBL 1K47A 3M8QA 3H25A 3SMZA 1Q7LB 1QD1A 3OL7A 5IV3A 3LOUA 5J2PB 4DUTA 4ZP8A 3PEHA 1RHRB 4YR0A 1VC5A 2I5JA 2VQFJ 3B4DA 4A8SA 2PSZA 1TKXB 3W65A 4I4BA 1GT8A 3AQPA 2UUWA 1N54B 4PWUA 4TY8B 3L9ZA 4K4WA 5DM7Q 2YNFB 1DURA 4MFBB 2UUAF 4DV5F 5A8WB 1U1RA 1FJCA 1Q95G 1R3NA 5HMWA 4ECRA 1BWVA 4KFBA 1DBDA 3RTVA 3AOCA 2QLJB 2LQJA 1LOUA 4J5OA 3KG0A 2M2BA 3T6JA 3QPIA 3MM5A 2XO6A 3IBCB 1UL3A 4C8NA 2K3IA 4YQWA 1NDCA 2YQ3A 2MTLA 2POKA 4PQAA 2BJ9A 2V4QA 2DITA 1IUJA 5CHCB 3AFGA 1T3OA 2Z2ZA 1LV5A 1YJ9S 3LWMA 2OSQA 3WBZA 5DDOC 1MG7A 3MMAA 3MM6A 1PIEA 3CCES 2CJBA 3GU0A 3KLGB 2HQFA 5HLFB 2Q3PA 4KQZA 1L3UA 3LH2S 4WWSA 4NWBA 1RTHA 2AX0A 3MAHA 3HCXA 3PYGA 1BE4A 3UN2A 1W7WA 4WCEQ 2BJ1A 1UCNA 5J2MB 1HHQA 2BW7A 4KPYA 1W2IA 3C19A 4XPCA 3J7A1 4AQYJ 2IC3B 1KKHA 3FEZA 2PGCA 1JKHA 2UXCF 1O8BA 1TL1B 2IIHA 5ETVA 2AGOA 3QBCA 4ES2A 5IWAF 3CT9A 3FMBA 4NLXA 1NXIA 1U0SA 1S57A 1HNWF 5LT5A 1RI7A 1SC4B 3PW7A 3IXQA 2GVDB 3CE8A 3K58A 3I6PA 2G13A 3H2VE 5I3UA 2ZHBA 3RR7A 3TWZA 3L7UA 2GZOA 1FD2A 2HS4A 2PDAA 2MYFA 2K1RA 1FRXA 3GE9A 4MIWA 4GKJJ 3DLEB 1U1PA 3V81B 4DHVA 1VLYA 3ILIA 4IG3A 3CD5A 4OX8A 2FB0A 2HBRB 1MU2A 5EDWA 3QT5A 1R6VA 2ZBCA 3A13A 3TZYA 2H65B 3KJFB 5DG8A 3S6EA 5D4LA 3V6DB 2BYCA 1HWUA 3BSNA 5KFWA 1P1LA 5ETRA 4DUZJ 1HHSA 1ELOA 1LQ9A 5F8NA 2HHHJ 2UVWA 4F8RA 4HT5A 1V5IB 4O23A 1RA6A 2ZBPA 2FVCA 2HFNA 5GADU 2LA4A 2IM1A 1JXLA 3PRVA 2U1AA 3GQCA 3LP0A 2WONA 4DR2J 1DRZA 2B5JA 4CWBA 1WHYA 2JLFA 2MQLA 2ZUGA 5C24B 1HBOB 2XWXA 2BJDA 2KN4A 2C2DA 3G82B 3R27A 4HEA9 2WRMA 2YNHA 1KNZA 2YQ0A 2BXJA 1ZM2A 4RBTA 2BRLA 4PG5A 2V2KA 4TY9A 1EKSA 2QFJA 4KGVB 4FYYB 2LXIA 4IFYA 3W2VA 1A6LA 3CDEA 1IR2A 2XYPB 3HVTA 5J2QB 1V6HA 3NGSA 4F36A 3IAS9 1K44A 1N33F 4LFCF 2IRYA 2XEXA 4EFAC 3OFHA 1OYDA 3TAMA 5J1PA 1RCOB 4KHPF 4ZVQB 5KFTA 4CO2A 1K0VA 2PFDA 3THTA 2H48B 3RJMB 3OVSA 2R7UA 4K7QA 4EZ9A 4EYIB 3T41A 4UT4A 5EWFA 2VZ9A 3IGNA 4DL5A 2K8GA 5BJRA 2PO4A 3UN5A 1HBMB 5L9XA 2FJEB 3DOKA 2QIFA 4ZLLA 1NCLA 1FKAF 2CWKA 2NPFA 5HBMA 4PWWA 2EFVA 4Q44A 4KAIA 3MAAB 2LXFA 2HBZB 4AE5A 4DCPB 5EGYA 2D3OR 4RPFA 1XWLA 3THPA 3HLUA 2AJ2A 2XHWA 2HVDA 5IQ6A 3KYLA 4WZMA 4USUA 1C1CB 4HKQA 2VBXA 1YVFA 4DFKA 1FJEB 1FKPB 1I1GA 1D09B 2HZCA 3V6KA 5E0OA 3PY8A 3V4MA 1ZA2B 1UVJA 5CCMA 2VFUA 2DXDA 1HIYA 3MMBB 2RNEA 4IDKA 1M5VC 3M8YA 3FSXA 4B3MJ 1TL5A 3HD2A 2Y8WA 1QTMA 2HK2A 1HW9A 3D28A 5KG5A 2RDIA 4NCBA 2OPQA 4A8OA 3KWMA 4ELUA 1RTDB 3FZ2A 4TNOA 3BSOA 4RWXA 3HO1A 2ADCA 5H1SV 3KG1A 2UUBJ 3FJ2A 2H4YB 1VQKS 2RQKA 2XI2A 3D3CJ 1SC1B 3F44A 1RJJA 2DNHA 4JI1F 3J80U 2OKQA 1RWKB 4LQ9A 1GMVA 1OY6A 3ZZOA 4K8RA 3GIKA 2H5JB 4IR9A 3RBXA 1GFWB 4AT1B 5M2RA 2BE2A 4AL5A 2Q6BA 5IFMA 4XPEA 2IPOB 2MDAA 4NLVA 1ROFA 1LWEB 3R5AA 3L09A 2XMTA 5SZTA 2V63A 2VODA 1F5BA 3OR2A 1U6FA 3PZPA 4ZVGA 2FJVA 1JIHA 2OD6A 3DU5A 4Q45A 2ZH7A 3GG0A 1HW8A 1VRTB 4B17A 3QLHB 3KLFA 2QV6A 3N01A 3HSZA 3VWSA 1RWOB 1HFEL 1SJ4P 2DXEA 4RW6A 3MR2A 1WF0A 2V94A 2G0CA 1R8AA 4ED1A 4ZCLA 2CZ9A 2FTRA 3HKZD 2MGZA 4O44A 3JSMB 1WELA 3VR1A 2ZNZA 2RKIB 3BYPA 3GV8B 5J1EB 2DPJA 3JSRA 2E7WA 3T19A 1LFWA 4OI3A 4BCAA 4ZMMA 3M1VA 3CWJA 3OJSA 2G0JA 2HFVA 3HFVA 2V6AA 2I6WA 4DR5J 1SUQA 3DDIA 4ECYA 2IM2A 2AT1B 2DNQA 3PIOQ 1HNZF 3CJ4A 4Y2IA 1AFIA 3R3TA 1FFGB 2X1FA 4B08A 3H5YA 3FQKA 3PW4A 1C0TA 3QGIA 2MZSA 3N0VA 7AT1B 4NLPA 1S9GA 3WQPA 3AA8A 1FI4A 3Q2SC 3VF0B 1TQLA 3ITHB 3SEOA 1JLBB 3EGWB 3R8YA 3G4SS 4OHWA 3ILLA 4X2BA 3FSYA 1NO8A 3I55S 4OYMA 3NBPB 2ADBA 1YTYA 2OHDA 3OTCA 2K06A 2ZM6J 2FVSA 4J9UE 5F8MA 4QJVA 2UXBF 3H90A 3HK2A 4FF3A 3TX0A 4KPCA 2PD1A 2PC6A 3NEKA 2XWYA 2HBYB 1EQMA 3K5NA 3B6BA 5AJ3J 4U6PA 3UDVA 5EWGA 2GQ2A 3BH6B 5HP1A 2C3YA 3DOLB 2J7UA 3UDLA 3PYDA 3W7BA 1S0VA 3EJMA 3IBFB 4ZHRB 1YK9A 4IG0B 3T1YJ 1X9MA 1U8WA 1OQ3A 3CB4A 1NNDA 4XTTA 4FXWA 2LMIA 3GFXA 1A0OB 1B70B 3W1YC 4ALZA 1K9MT 2XS7A 2JL9A 5HQMA 4NXMJ 1T11A 3QGGA 3RAQA 4EGLA 1JLFA 4WKYA 2QL9B 3FBFA 4DBQA 3M2VB 1TP7A 2LU1A 2ABYA 1WOPA 1RT3A 3VZIA 4TQRA 2E29A 3BREA 4DSLA 1N5YA 4N5SA 5DQHA 1RYRA 4OFZA 3L4BC 2NSBA 2AX1A 4J9OA 3IR5B 4DL3A 2HHXA 4O4GB 1OY8A 4RL1A 2QSFA 4G1QA 1IBLF 4ECQA 2O66A 3W9HA 3UCGA 3MFIA 3MMJA 4DXLA 4OYOA 1E6VB 1UVMA 2LQ9A 4QR0A 5E33A 1Z2LA 2XGQA 1S1XB 3KLEB 4A47A 4OHXA 2BM0A 4QW8A 3AB2B 5BR8J 4K0KJ 1J5OB 1BQNA 1SB6A 1QE1A 2NZCA 5D0RA 5ETKA 2AJ4A 4HLBA 4I0WA 1M5HA 1JLEA 4R8UB 1MWZA 2BKPA 4J90A 5KG1A 1R8HA 1RAOA 2FZKB 4ZLNA 2R4FA 2MQMA 1U1QA 1HMVA 4AFFA 2DNYA 3OHBA 4DV7J 3PTWA 3R7BB 3C6UB 3DHWC 1FHTA 2YKNB 4C8OA 1S6QB 2FY8A 2OPSB 2I2YA 4MKYA 5F8IA 4Q43A 3TZWA 2DHSA 4B9VA 2XTJP 1C1BB 1APSA 3UFCX 1KLMB 4OI1A 2JJ4D 2XQCA 4C11A 3I32A 3Q89A 1NU4A 3MEEB 1WF1A 3K7RA 1OO0B 3ZFVA 4CO0A 5AXKA 4DZDA 3THVA 5L38A 3MD1A 4H54A 2YKAA 4LFBF 1U25A 1RBAA 1KWMA 3MFHA 3T9NA 4JI2F 3LAMA 1U45A 1D8ZA 1UZDA 3MR7A 3EDQB 2CDRB 1NK6A 4ANCA 1IXKA 4RZRA 2MQPA 3AB4B 4QPXA 4NXNF 3KMSA 4K2JA 3ZZPA 1OIAA 2JH3A 3WC0A 1ZAVA 2DNGA 1RWMB 2HLUA 2RILA 3ISNC 4DV1F 2X51A 5T41A 2ROGA 2ZH3A 1RT1B 1XNQF 3QAUA 4HVZA 3NOGA 5L1IA 1VFJA 4MH8A 2BACA 5D0GA 2GCFA 2PIIA 1REVA 3PNIA 5HVFA 3IO1A 1DQAA 4JV5F 1WEZA 3UO0A 1SKRA 5E3AA 1B99A 2X7IA 4LF9F 3LP1B 2GMJA 4ZLJA 5LJ3Y 4RUAA 4YY3F 2AKWB 3OL9A 1NZ8A 1FWLA 2RRNA 4LSZB 4F3QA 1NH8A 3KUHA 1G4CA 2OTLS 1SIZA 2QLWA 4I2PA 3PHEA 5KFMA 3LGMA 3CD6S 3GTYX 1H0HB 3W5XA 3DLGA 5KT7A 4TN2A 4P75A 5HN0A 4B3TF 2O01C 2VD3A 1YRTA 3GYNA 4J37A 2K7JA 1WACA 2DXFA 3TQ1A 1P1TA 3OT9A 2WSEC 5KFYA 2DH8A 4I6YA 4RU9A 5C7PA 5A76A 3R9LA 4DFPA 3FSIA 1V9OA 4K5SA 4M5MA 3K5LA 1NJWA 1FVSA 3DRSA 3D68A 2VDHA 1W25A 4A48A 1OWXA 1TU0B 5EX3A 4QYZK 4WYWA 5LMUJ 2WOMB 3N6MA 4J9MA 1TAQA 3PKMA 2LDYA 4XO0A 1U1MA 5LL6d 1XMOJ 4ZP6A 3NNAA 2FVRA 4J9NA 2IAJB 3CO0P 1FRKA 3DC2A 4KGKA 3HMJG 2YNGA 1NZAA 1GXLA 1Q5YA 1JJCB 3OHAA 2BANA 2LEBA 3RB3A 3LALA 4DLEA 2HBQB 4DPXA 4EBCA 4NYOA 3HPOA 4R0EA 3HZEA 4GMKA 1TFYA 3LF0A 4WP3A 1Z1ZA 3HULA 3HJFA 4J9KA 5B0BA 2FVQA 2GJIA 4A8XA 4L72B 2YWFA 3KK2A 2B4UA 2LKZA 2C42A 3KDNA 2L48A 1Y3KA 3RW6A 4ZN3A 3J80Y 4ECZA 4WXOA 1UAWA 4JI7J 3HVAA 2ZH8A 4KV8B 3BDPA 2VFTA 4C8ZA 2AJ0A 1IBCB 3EPIA 4PUOB 2DNRA 3UD4P 1LK5A 2MLXA 2VQFF 3OTBA 2XMJA 4O3RA 4F25A 2R3VA 4H4MB 4WIQA 4ZP7A 8RUCA 1DY3A 4WU2A 5E7OB 2E1CA 2DR5A 5DG9A 1OS5A 4WBFA 5I42A 1I3OB 2AD9A 1DFDA 1FKOB 3I4HX 1EARA 1R7IA 3CJQA 3AODA 4WFZA 3WHIA 4OX9J 2A6OA 1S12A 2B9WA 2VONA 4U96A 3CCUS 5DDRC 4QYRA 1WOSA 2CNLB 3QFHA 2D3ZA 3N6LA 2KT3A 3IR7B 1U1NA 2ZZMA 1UFKA 2XI3A 4DF4A 1NUEA 2AEMA 1T7PA 5HQLA 5EUHA 5H9EK 4H4KA 3FGVA 4OHYA 2RRAA 2DYAA 2NXCA 3P5BP 5E3QA 3ICLA 3OTOF 1Y0HA 3CVKA 3F0NA 1DHMA 3EYZA 2B3TB 2H5EA 4I56A 2KTQA 1FX2A 3MMCB 2RDDA 2QA1A 1DTTB 2IYGA 1RWUA 4U9RA 2AZ3A 1UEVA 2WVCA 4QCLA 3FBBA 3DOMB 2L41A 1DQ8A 3VAKA 3W61A 1N4LA 3HSGA 1KVIA 4EEYA 3D67A 3PYEA 5DDPC 4DU8A 5KG7A 4TXSA 4KO0B 5HVHA 4RW4A 1NLKL 4AQYF 4RUBA 3CJKA 4W98A 4X84A 3R5DA 1NK7A 3CJSA 2ASDA 4I67A 4L74A 4WFBQ 4A8FA 5GAGU 3CIMA 2EI5A 4DV4J 4DSEA 3CC4S 2BMBA 1TKZA 3FFIA 4CIOA 2CQBA 1LFPA 4PQUA 3NLCA 1LWCA 1WC6A 1R89A 4IQXA 4K4SA 1FDDA 3C6TA 4YN3B 3DM2A 4DLGA 3EGZA 2F9DA 2OLWA 2EW9A 2VHGA 3FMWA 4RUCA 4GKJF 5FIIA 1P8GA 2MZJA 2BUNA 1M5OC 4B9MA 1NK8A 3HHEA 1HBNB 2CKWA 2OTJS 2AYMA 2GHVC 3BJYA 1HNIB 1SH3A 1RAGB 3D66A 4DUZF 2ACMA 3EICA 3DMJA 2HHHF 4HL9A 3BPDA 2G4BA 2E1PA 1RU1A 5JVHQ 2DRBA 5KFSA 3M8RA 4X4OA 1WG4A 4NX9A 1KLNA 4C3KA 1H38A 1S6PA 3BB5A 2WVEA 3F73A 4PABA 1TK8A 4ELTA 1AA1B 4PZVA 5K8MA 5HROB 4DR2F 4J91A 4DWIA 4M95A 2CJAA 3P96A 4C48A 1PAUB 4LF1A 1PAEX 1JLGA 2HK3A 3JTOA 3GZ7A 3P8BB 4R0JA 4Q2MA 3KK3A 4MK9A 3US5A 2OMOA 2PFFB 2M9KA 4WTYA 2IJNA 3P6YC 1N6QB 5KT5A 4CYUA 2IM0A 4QZVB 3C16B 5ETNA 2CA9A 1JLAB 3DYAA 4KGXB 2CG4A 5GMEA 2M52A 1LWFA 4F4AA 4Y0FA 1RWVB 2VG6B 3NNHA 5A0YB 3GFHA 3IG1A 2ZHAA 3BBFA 4LSLB 5E2QA 2R7XA 1YJ7A 2W9AA 1X5SA 4ECXA 2ZH1A 1HBUA 1UPPA 4PAAA 1YLXA 2P6TA 5D8HB 1ZAXA 1FF2A 2B9XA 2YXLA 3GJSB 2R9LA 4RBVA 1DJ0A 4BHQA 4F0KA 2W9BB 3Q8VA 2HNZB 5F3ZA 1Y5LB 3DN9A 3M8PB 4MMOA 2VPXB 4C0OC 2M70A 1U02A 1BQMA 2J6UA 2OFHX 2R7RA 3NAHA 2CJKA 4UZBA 1VJWA 2FJAB 2XZDB 5B0GA 1BUXA 2F8EX 1AYEA 3HDSA 2VF3A 4F02A 4HDGA 2XBPA 3GCWP 3GV5B 5F3TA 1WTFA 2CIMA 2MKHA 3H40A 3D4JA 4Z7CA 5IC4B 2OPRB 3MD3A 3MI7X 1HARA 3I5BA 1QLNA 3LANA 2EG1A 1MW7A 1U0HB 2CQ1A 5GMDA 1CS4B 1CJKA 1CULB 2LU2A 4FDFA 1L5UA 2MKYA 5D3GB 1N8RT 3K57A 1NSQA 3AD7C 3W9IA 1S7HA 2CWXA 2J9CA 1EZZB 2H1YA 1IBKJ 1VYAA 2HRUA 2XHCA 4F4KA 2C2MB 4Q0BB 2MKCA 3Q0AA 1Y5IB 3HP6A 2DCLA 3QAEA 1YRXA 1NJYA 4USWA 3Q8UA 2LEAA 4NA3A 4DUYJ 3V5RA 1RB0A 2B6AB 1KP6A 4ANEA 2FYXA 3M32B 4ED6A 1RWPB 2ZVSA 4B3MF 3C15A 3DLKA 3DDNA 1RE1B 2A6MA 2MQNA 3J7AN 5KFEA 3GV7B 5IT9U 3SQGB 4YMEA 3ZNUA 4I6WA 5DLFA 2CNKB 2HMIB 1RBLA 3I0RB 2UUBF 1Q8KA 4CH0S 4O3SA 4PG7A 1VQPS 4B9LA 2GO9A 1X5OA 3M2RB 1G2EA 2ZEJA 1NHUA 5KFZA 2RT3A 1X5PA 3TUJC 5AE2A 3MTKA 1IQTA 2GJ2A 2NCKL 2AEJA 4UQTA 4DV6J 2MKSA 3SIPB 3H7HB 5KT6A 2JRSA 4RNNA 2AZ1A 3MM8A 4WE1B 3DCAA 4AXJA 2MLZA 3P3DA 4ID5B 4P9SA 1X0FA 1XBWA 4MAKA 2CPXA 1U1LA 2FHKA 2DR7A 1RISA 3CJ2A 4NCAA 2KT2A 2CQHA 4CH7A 2H5IB 1ZH5A 1GK8A 4YR3A 2CJYB 1D9AA 3ISZA 3OJUA 2R2TA 5DDQC 4DV0J 2ASJA 2GV1A 5A8RA 3O5TB 1G6BA 1RT4A 1FDBA 5D4NA 2DGVA 4DSKA 4LFAJ 3Q23A 3LUYA 1T05B 2F4FA 2X1BA 2HRYA 1FEHA 2OH2A 1CG2A 1N5TA 2A10A 4FVMA 2M5YA 1S0MA 8ATCB 2UU9J 2ZJRQ 1V3SA 4FS2A 2UXDJ 1RT7B 1EETA 4LIWA 2DBBA 2XSJB 4B9SA 1H98A 2RD5C 2UV8A 4DR5F 2VB6A 4DR6J 1RP5A 1SPBP 4B9TA 4HR2A 2GVZA 5C2GA 1FWPA 3TYTA 1Q8IA 2XMVA 2I5JB 4F67A 4NZ6A 3CCLS 1XIQA 2E9ZA 2DB1A 3GFZA 2FGOA 3ELHA 3UVJA 3M2UA 1TV6B 3I87A 3LTOA 3TP2A 5DLGA 4ZCKA 3Q22A 3KXDA 3I0SA 4HH1A 4J9RA 2VC1A 3D2WA 1EKRA 4KFBB 3J7Z5 1ZPVA 3FZBA 1T03B 1KQFB 1LWXA 2CQIA 2NSCA 2ZM6F 2HHVA 2CDQA 2ZH2A 3MEKA 2VFVA 5J2PA 1VDHA 3IM9A 5FJ4A 2D3UA 3TX8A 4RJVA 2W1BA 2MZQA 4BLGA 5AJ3F 2NZ4A 4TY8A 1CSJA 1FWKA 3OSNA 3H5XA 4LVOP 2YNFA 4ZIVA 4MFBA 3GMGA 4R5PB 1WSRA 5A8WA 3H20A 1R31A 4DN0A 2V5HG 2KXFA 2VBZA 3JYTB 3MMAB 4MJKA 3RBDA 3HHLB 1QSYA 5HJYA 2XLKA 1WG1A 1U6BA 1LK7A 2GS8A 4KTQA 4IH5A 1FESA 2EFNA 3T1YF 1XJWB 3HHNB 1RWXB 4WYLA 1Z2ZA 5KFJA 5KFUA 4CLWA 4Q5VA 3N79A 2R8JA 4NXMF 1RBOB 1P27B 2OJ3A 4QBUA 3CTRA 2LCWA 3ETMA 3PO4A 4NPOA 5ADZA 3DGPB 4P74A 1JKHB 3UN3A 1IJEB 5A2QU 3JQKA 4JI1J 1WUUA 4YP3A 1IBMJ 1WOOA 3CCTA 3ZZ0A 3PJ9A 2E1AA 4E0DA 3MCOA 2XNRA 2NXJA 1WEXA 4YEAA 1UJ5A 3Q86A 4YB7A 3I5AA 2MZRA 4IFVB 2CPFA 4ICLB 3T6BA 3Q2TC 3K89A 5IZHA 4CTAB 2Z2MA 2ALZA 2IC3A 2EK6A 5BR8F 4K0KF 2FJDB 2DHHA 4CLFA 2DIVA 4FBTA 3UD3P 2WCXA 2Y1IA 2ERRA 4MK7A 2W8LA 3BO2A 2VICA 4OYZA 1MU2B 4DZ6A 2KM8C 1RUSA 1UVNA 2YTCA 2MQOA 4DV7F 2KM8B 4B3OA 1FJGF 3FKBA 4F3OA 2UVRA 1FTCA 3SSSA 2CQ0A 5KOWA 1TMJA 3CPWR 2AYBA 4F0MA 1RLDA 3DLEA 2WVFA 1VQYA 4JI3J 3V81A 3OV7A 2A18A 3O8WA 5CZXA 3DXSX 2ZD1B 4RW9B 1GMUA 3L7PA 2QYCA 3V6DA 5CXTA 1NH7A 3H4BA 4Z7YA 4RKUC 2EBEA 1VLOA 3RB0A 5KG0A 1HWJA 3MEDA 1ULRA 2XG8A 8AT1B 5KT2A 1HL6A 5DGAA 4IFYB 1N88A 2AIRB 3HVTB 2V4JA 3EWGA 1S0OA 1O51A 4X4PA 1AW0A 1T9YA 2V0NA 5F8HA 4DS5A 3TAPA 4FPRA 1RHQB 5K8PA 2Q6CA 5C24A 1HBOA 3V4IA 2MLYA 2ZBQA 5DQGA 3VV2B 3IC1A 4AXIA 1SH2A 1U2FA 2LLZA 4M5LA 5HO4A 2F3JA 5HQ8A 4Q8FA 4DR1F 2XMKA 1YBTA 1KR4A 1IR1A 1O0PA 3IN5A 2IYIA 3MR3A 9RUBA 1KHWA 5E41A 4EO8A 3VVUA 3DRPB 3QZ8A 1U1KA 5J2QA 3VGSA 3UNYA 4ZVTB 3UWTA 3M8WA 4NYZA 1KDNA 1SV5B 2DHGA 3A8IA 4ECUA 4KB7A 4ZPAA 3FRYA 4PYDA 4LRAA 4ECVA 1T0TV 1Q79A 1HA1A 2YH1A 3UDCA 1UTAA 3GIIA 5CQGA 2R2UA 2CYYA 4LF8J 4LF6J 3LGNA 5G0RB 1GX6A 4JP8A 2MKKA 3PDNA 1H3DA 2DGXA 4KHRA 1TVRA 5KTQA 1VQ4S 3MCNA 1CQNA 1HBMA 2L9NA 1UZHA 3G8SA 3Q8SB 4I2QA 4HHJA 1UWBA 3ZZYA 1NHVA 4Y28C 3BGRA 1RTJB 5C42B 2HSEB 3R5GA 1UWAA 1EJ7L 4C4WA 1BC6A 5LMUF 4HDHA 4Q8EA 4C3MA 1YKWA 5B0CA 3G96A 4HT7A 3FCHA 3OD2A 2R8GA 1XMOF 3BO4A 4RW8B 3U27A 1X4AA 1NEEA 3C14B 1Q8BA 2K3KA 1C1CA 2WVBA 1VQ8S 1F5CA 2CG8A 1FKPA 4OJGA 4ZVPB 4DF8A 2CAJA 4LRCA 2ROEA 4IO1A 4ID8A 1IKWA 2J9DE 3CMAS 3B54A 4JI6F 2YBVA 2E9TA 2HURA 5IT9Y 2FLPA 2FHOB 2Y1RI 1U26A 5IT0A 4DPUA 3SCJE 2JEJA 4E8UA 4RU2A 1Y3JA 2F40A 3UR3C 4O3OA 5KFCA 3PJWA 3D6FB 1VRQC 3KUEA 1PGZA 2Z2YB 4M5GA 1Q5VA 3DHXA 3WZ0A 2W4CA 1E6YA 4JI7F 4LT6A 1UA1A 2Z0GA 1RZMA 3OR2B 2VOPA 4BBYA 3TI0A 5LM7E 4UY8T 3C2PA 3GYXB 3TZZA 4YS2A 4F4ZA 4K5RA 2RS2A 1IJFB 1S5ZA 2BE9B 5B0DA 3D7SB 5CD4H 3NOCA 4QU6A 3VAGA 3KLFB 3VQSA 2DISA 4ELVA 1S7IA 4DR7J 2GGPB 3RB4A 2DK2A 5F8JA 2P9GA 2AW0A 1RT2A 2LECA 4OYBA 2NXEA 1H2TZ 2IM3A 1LW0A 4WFXA 4DL0C 1RAJA 4OX9F 5L39A 1UA0A 3NGDA 1I5OB 3G6XA 1TUWA 2V2QA 2DCUB 1VRTA 3QGPA 3NP5A 4GO7X 2WBRA 3M8ZA 2IBKA 4JV5J 3M6UA 5KFXA 4JOUA 5DQIA 3KOAA 4FP9A 1WHWA 2W2PP 1SUQB 1U8SA 3D1OA 4QIFA 5D77A 2LEPA 4U7UD 4DPYA 2DH9A 1B7FA 1NDLA 1C0TB 1VQNS 2BQUA 2RKIA 1M1GA 4IUFA 1S9GB 3PKYA 4WTOB 2FJBB 3MDFA 1WJ9A 2W7OA 4X65J 3SFUA 1SCJB 3DKDA 2ZH4A 3EM1A 3Q8QB 4USMA 4BWJA 4QQBA 3K2YA 2F63A 3KFWX 3VGUA 1U49A 2VPZB 1SQFA 3W5ZA 2XB2D 1Y7PA 3G8QA 2HKEA 4EYHB 4CLSA 3UW1A 3PG9A 1MROB 4LUBA 5KG6A 4WFYA 3BYRA 1Y9OA 4TQSA 3ITHA 1JLBA 4X4NA 2FDNA 1XR6A 4M5NA 4OZ5A 1ZPWX 3GJTB 4UF4A 1LEOA 2BE7D 4DPWA 2HGLA 5HP1B 2F4VJ 1FFWB 1R8CA 2LDIA 4BC9A 2YWGA 4DQIA 1D9DA 2CPEA 4ZVHA 5M2UA 2ZFHA 4ERDA 1D3WA 2Z30B 4C8KA 3E8OA 4MTPA 2H51B 5D0EA 2P9CA 5DETA 3SCLE 4DQPA 4PEOA 2GFFA 2RF2B 1JLFB 5JVGQ 2CPYA 3VGVA 2MY7A 1SJFA 2VL1A 4C3LA 5K20B 2E5GA 1VQMS 4CLUA 4JI5J 2HWHA 2DY9A 2BQRA 1RT3B 1UPMB 3DOLA 5KFIA 4QW9A 4FN5A 1N5YB 1Y11A 4O0IA 4ZHRA 1TFWA 2QC3A 3KK1B 1PYTA 3NGUA 4WXWA 3D0GE 5KFRA 1CVJA 2CPJA 1FXDA 3M9NB 3GB0A 4KGMA 3BPSP 1PJ7A 3Q8RB 3M2VA 1XNRJ 2H4WB 2CQ4A 2F5GA 2NUHA 2HNDB 5GAEU 2JHEA 1F1BB 1IWGA 1K1QA 3KNGA 4ZDNA 1JLEB 2V50A 4ZVRB 1N34J 2ZZTA 3I9ZA 1WKJA 3EGNA 3QSYB 2HHWA 3PM9A 2ZOGA 1E6VA 3U1LA 2ZZNA 3HI9A 3KLEA 1VBYA 1V3ZA 3NMRA 1LW2B 4LRBA 3CCZA 3J7ZT 2QGFB 2IDEA 4C11B 1G3OA 3X1LB 3GIRA 2YPZA 3B82A 5D0HA 4R8UA 2PN6A 4PG6A 2VBYA 3OFGA 3D0IE 5K5MA 4CZCA 5DG7A 2ATCB 2Z2LA 1N32J 2DGWA 1F0XA 3C6UA 2QT7A 2XCPA 1PSDA 4ED2A 1S6QA 3EZOA 2OPSA 2HLTA 2V8PA 5EWEA 5RUBA 4U7CA 3OTOJ 1C1BA 3K17A 1SQEA 3CDAA 3OL8A 2WTFA 4LMZA 2XO7A 2V34A 2EBGA 2V69A 2JEIA 2P2CB 1NK0A 2VA3A 5CZVA 1BMQB 4N47A 4E98A 4N41A 5LMNJ 2UP1A 1PO6A 1LKZA 2RS8A 1X4GA 2C22A 2G9OA 3A12A 3A3NB 2CJ9A 4OV1A 4LR7A 4X64J 2DGOA 2KI2A 2FC9A 4ZA1A 3A3PB 4TU9A 1CBKA 1IBKF 1CJUB 2JVOA 1HQUB 3Q83A 4ITSA 4CDIA 3ZTOA 4FNIA 4WFAQ 3LA0A 4DUYF 1DTQB 4KSEB 4YOEA 2Y1JA 4KJIA 2ZITA 1BXNA 1PC4A 2V8DA 1S76D 4CLPA 1PJ6A 3G6ES 2R7VA 4RNFA 4K4VA 1NAQA 3MPYA 2YQ1A 3LP1A 2VV5A 1FRIA 2QSWA 3OQ2A 3N9UC 3R6LB 2Q79A 3QZ7A 5KFBA 3VAHA 1XR7A 4WK3A 2UVUA 3DFEA 4P10A 2B43A 3M30B 1N0VC 3BM7A 1VJQA 2UUCJ 2JX2A 3MPWA 1ZA1B 4KKOB 1VQ7S 2XYHB 1HQ2A 3QJPA 4DV6F 1KBRA 3QJLA 2HFZA 2BW2A 4PXDA 3MEGA 2BEFA 2J7WA 3OSPA 3K59A 2GMLA 1XK8A 1OSDA 2CZ4A 3KLIB 3OVAA 4TLQA 2FHJA 2KHDA 2D9OA 4OX6A 2WBMA 4KIAA 4DR4J 5CA5A 2IBOA 1SXLA 3NCRA 3BGUA 4I7FB 4OZJA 5B7WA 2FHJD 3AHPA 4DV0F 4QR1A 5C25A 1FVQA 5F8LA 1U47A 2KYXA 4LFAF 4USJC 3DNCA 5AE1A 4EBDA 4G1IA 2PA3A 2WOMA 5JXSA 3W64A 4MYTA 4JV0A 3RZAA 3PR5B 4CO4A 4NA1A 4EWTA 3SSQA 4USIA 1SJ1A 2HQ3A 2V2VA 2Q1LA 4Y6IA 2UU9F 1RT6B 2IAJA 3H2UB 3KK2B 2UXDF 3NS6A 3I9V9 2NUUG 4DR6F 1GTEA 3OXGA 4H4OB 1YJTA 3MM9B 3HD1A 4U8YA 4F4WA 3TNVA 1QAJA 1NB7A 4CP5A 3JXOA 1TMMA 1URRA 3FQLA 2PEHA 3BDEA 1QSSA 4WJBA 2ATLA 2WB4A 1S0NA 4HACB 1EHWA 4LBPA 1YHQS 2MHNA 1N0UA 4ZS6A 4LRDA 1S77D 3QIDA 1KQKA 4PUOA 3CXCR 1HWIA 3BEGB 1CEZA 4K2XA 2W7AA 3FCVA 4DG1B 2ZJQQ 1EAYC 2J9EA 4NEYA 1FFSB 4ZVUB 5KFQA 1AB8A 4H4KC 3HHDA 1T9VA 4NL5A 3W63A 2O1PA 2HIQA 3TJ9A 2DVIA 3MCMA 1AROP 3BQ2A 4YB5A 1Q7YT 3RRKA 5AT1B 1MMDA 3QGHA 3FEYB 2MXYA 4NCGA 1HD0A 2LP4A 4P6QA 4Y2AA 1TL7B 4WFNQ 1PC5A 2IVFB 3OTDA 2DGSA 2J0WA 3C46A 4LR8A 5DRKA 2G2ZA 3NCQA 1WTBA 4Y2CA 4DPOA 4C2MA 4DI6A 5DM6Q 4TU7A 1IBMF 1Q81T 3MMCA 1QVGR 5AE3A 2XC9A 2OFGX 1DTTA 3MECB 1OSCA 2KFZA 1WHVA 1XMBA 4IOBA 3DOMA 2DNZA 3VVTA 5HANA 2GX8A 2DTJA 4QR2A 3OBIA 2KO1A 2DR6A 2YKMB 4OL8A 3QT7A 4ED4A 4IRKA 1HQEA 2QRRA 4KO0A 1P6TA 3EX7B 4OYXA 4ZJOA 5MAOA 4M8LA 3NY0A 2FLOA 3IS9A 3CC7S 2B8PA 3ZTQA 5CD4A 4NI2B 4AL6A 2BQ3A 1SH0A 2EWHA 1RTZA 1RK8A 4JV1A 2IMOA 3JAMY 1NB2A 5K14B 3R7SB 1FRHA 3OFFA 5KG4A 2DGTA 1L3KA 1S99A 3AOBA 4W4MA 4D3HA 1I94J 3UQSA 3IRWP 4M94A 2KJWA 2DEIA 2MEWA 2YWWA 4OIXA 2C2KB 1S6PB 2O67A 4JI3F 3AT1B 2ZVIA 3OL6A 1HBNA 3A3OB 1VRUA 5CAAA 3PEJA 1H7XA 4TVAB 4YDXA 4ECSA 3TARA 4WF9Q 3O2IA 1JLGB 5JUMA 3L3CA 4NA2A 5L1KA 3ZXWA 4PPZA 4A4JA 2C1EB 4C6AA 3UCUP 2VDIA 1S9FA 2JFKA 4MKAA 3QRRA 1YJNS 1NK9A 2MZTA 2H3EB 2JFDA 1YJRA 2AYGA 1V3RA 5EHHA 3LWLA 4N76A 5L46A 1VBZA 4K4ZA 3Q24A 4LSNA 1N56A 3QT8A 1YGYA 3BQ1A 2QL5B 2W24A 3TRGA 1WC1A 5KFAA 5HMZA 5CABA 4RLEA 3HVWA 3NG8A 2RSQA 4DL6A 1ICEB 2OD4A 4JI8J 3MUVP 4ZP9A 2VBWA 3V6JA 3M6XA 2PA8D 1N6QA 3IMQJ 1YX2A 3KLHA 1R0AB 5GMKa 3IFEA 5L9NA 3VAMA 4OMFG 3C16A 3BQ0A 1JLAA 4NRUA 4OX7A 1TKTB 2IA0A 3T5HA 3ZZUA 2CPZA 1WG5A 3UI3A 2N4DA 5DS7A 5KT3A 2VG6A 4N77A 1NDPA 2GNKA 2KT5A 1IKVB 5A0YA 3MM7B 3CCWA 3IWNC 4LSLA 4QYZJ 4O3PA 2D7SA 2CQ2A 2NR0A 3G9CA 4JB8B 1MSWD 2J6SA 4FYVB 1TK5A 2B9YA 2W9BA 2G2OA 4LF6F 4LF8F 1B64A 2BBEA 4LR9A 3IAM9 1BQXA 4F2SA 2RH3A 2BRKA 3MZIA 1HNVB 3GR1A 5IS2A 5HMYA 1NRKA 2G1DA 1MWYA 4HH0A 3DDKA 2DD8S 2BJ7A 2L9DA 4CNYA 3CUNA 1AT1B 2OPRA 2G2YA 4CM0A 3T5KA 3TVYA 2DRAA 4IO9Q 1U0HA 1ZTTA 3EMTA 4AL7A 2KG0A 1CULA 3T1AA 3HSDA 2YH0A 4Y2MA 3D0HE 4ETXA 1RWWB 3JQMA 2D74B 2CVIA 1SJ3P 2CUYA 3FBEA 3J81U 1PILA 1FE4A 2FGCA 4X4QA 2C2ZB 2YX7A 4ILLA 2BKNA 3ET6A 4PXCA 1FEEA 2W2NP 2B6AA 1FCAA 4PXBA 3FDSA 1FJGJ 4FYXB 2HEKA 3BZQA 2ZDPA 4ENOA 5CYQB 4ETZA 3A1YG 1U24A 1RGVA 2R7OA 3SQGA 3DRRB 2ZHOA 2VASA 1NMEB 2OGUA 4MIBA 4NLQA 4ZITA 2DNOA 2HMIA 3I0RA 2B4OA 2CZVC 5F9NA 1S4FA 4CNZA 1DZ5A 3M2RA 4TLRA 3IWLA 3M8SA 5FDLB 5IC6B 1FXLA 3EXYA 3AJ2A 2Y9HA 4JYAJ 1NSAA 4RBUA 2XY6A 5H9EJ 3KJNB 2MSSA 4ID5A 5A8RB 2IJRA 5IXUA 1VMBA 1RT4B 1X4EA 4DR7F 3W62A 5KFDA 4HHHA 1ZAWA 3DI6A 4DCJB 3MR5A 1GEHA 2JEFA 4PXEA 3TEGA 3IGVA 1M1HA 1YZ7A 2APOA 4I64A 4C9DA 4UOFA 3E2EA 1S1WA 3DLJA 1FRMA 4YDDB 4OYWA 2FJWA 3KNAA 5I4MA 1J5EF 3SFGA 1PYOB 2DPIA 3DU6A 3ENVA 4ZVOB 4DR1J 4MK8A 4X4RA 4N56A 3QNWB 1UW9A 3L95X 3ULHA 3TW0A 2GVZB 4C7QA 5LJ5Y 3GR0A 4UZCA 1T05A 3QWUA 4CQ1A 1GMWA 3S1TA 3GJQB 5THWA 3GIMA 2J0XA 3TUIC 3MWBA 4M5DB 4QIVA 3U7JA 3UVJB 3JSYA 3M2UB 2ACYA 4GVLA 3A8KA 3BR8A 1FNOA 1QUPA 2J6TA 1HLWA 2VPWB 1YWXA 3VTIA 2QMWA 4IOAQ 2FJXA 2N4CA 1K0TA 5D78A 4X65F 4N8NA 2XSJA 1GMWD 3KKFA 4TYAA 1FTRA 3NCPA 4ZVFA 5E3CA 3C3LA 3ETOA 4RO0A 1H74A 1VQ6S 4DL4A 1JQGA 5ETSA 4NZ7A 4B3SJ 2CRLA 2Z58B 2BA9A 3U1NA 1CJTB 1UKUA 3WIUA 1TV6A 1S6UA 1L3VA 2QG9B 2MJNA 3OLBA 3QQCD 1T9XA 5KG2A 4OQJA 1F2HA 5A8KB 5DGBA 3TJAA 3VAFA 1T03A 4JI0J 3LW5C 2F4VF 9ATCB 1N5VA 1RADB 3R2DJ 1KD1T 3BN4A 2IFXA 2IJFA 4J9SA 1FK9A 2C3MA 3CF5Q 1ITPA 3QSIA 5HMXA 1S9EB 5T7LB 1HR0J 2OAUA 2V68A 1TUVA 1N48A 2M3DA 4ZVEA 4CCHA 2YKQA 3M7VA 4RR5A 3MGJA 4AYBD 1JK9B 5KFFA 1AZSA 4R5PA 2AHOB 1I6JA 4JV2A 1SC6A 2OPPA 1DQ9A 2J0SD 2GA7A 4JI5F 3JYTA 2MPUA 2ZWOA 4CO3A 3HHLA 4JI6J 5D15A 1Q86T 2HVEA 4ER8A 1YIJS 2KVQE 3N5FA 2HQGA 3KHGA 1M90T 1UEUA 2V8HA 2D41A 1K73T 1ACMB 3UDEA 5H9FK 2IY5B 4NOHA 2GAGC 1IQZA 3HHLD 2OEKA 4OI4A 1ZM4A 3IBWA 1HI1A 3JQJA 1UP1A 4MKVA 1XC9A 1JLCA 3HSJA 2CQDA 5IM0B 2ZNYA 1XNRF 3CNQP 3DGPA 3U1MA 2B51A 2EFPA 1S1UA 1JB0C 3HFZB 3LP2A 1SQGA 3N6NA 4OZ1A 4TKTA 1N34F 1VQSA 1DLOA 4DJBA 4JBCA 4P7TA 2LYVA 2B7CB 2ZKUA 1IKYA 4IFVA 2QEXS 4ICLA 2FIUA 3RG6A 4B3OB 1VQLS 4CTAA 6AT1B 2B4VA 4KYZA 1VQ5S 4KRWA 3PW0A 1AXQA 3H5SA 4NLUA 3ZZZA 2FC8A 1YRUA 3QATA 4EMDA 2XSFA 3MOZA 3B78A 2YPYA 4DV2J 3J7YU 2E44A 3HZGA 5CYMB 3TAQA 4NZ0A 1IKXB 1N32F 1RLCL 4WK1A 1SKSA 3KLVA 4QIEA 3QYYA 2JC0A 2MQ8A 3NWGA 3AH6A 3VAIA 4LJMA 3RGIA 2QL7B 2QYGA 4KBIA 4DR3J 2Z56B 2RE1A 4WZQA 4NLDA 3CJ5A 1M5KC 3MEDB 1UEKA 1F5AA 4PYAA 4DMZA 3MXHP 1QY7A 2XZWA 4ZIWA 2DY1A 3CCVS 5I3QA 1C0UA 1P9YA 2BJEA 2V4JB 3PJXA 4C97A 3H42A 2ZD1A 3FC9A 2EFQA 3HT0A 4RW9A 2AYEA 1BY9A 3V4IB 2J9DA 5LMNF 1VQOS 2HGMA 4C8YA 1HKAA 1HYSB 2JSXA 1RHMB 1PBUA 3EZUA 2VG7A 3ZZTA 4QWCA 4X64F 3DLHA 1U7LA 3R1LA 2XS2A 2UZAA 1YBAA 4OI2A 4P71A 4PWDB 1TL3B 2B56A 3SV3A 2RU3A 1L3SA 3G6YA 1W26A 1WD6A 1AFJA 4K59A 2MB0B 2XCAA 3W2WA 2GIRA 3IWXA 3G71S 4DX5A 3MF5A 2IRXA 2QMXA 2BV3A 4U7UK 4RNMA 5GAEI 4IYQA 1CLFA 3ZO7A 3MAQA 5IT4A 1QDUB 1XQIA 2NPIA 3C8YA 3BH7B 2QE5A 2H54B 3BSCA 5GAHU 4L75A 4G3IA 3DRPA 4URSA 2I1RA 3IM8A 2C2RA 3CIZA 4NLGA 2J8AA 2UUCF 1GH8A 3IP0A 2KVIA 5HK4A 1SV5A 5D4OA 4CI0B 1TVRB 2R7QA 2RUSA 3FVYA 3X3UA 3QIPA 1FJ7A 4FXVA 3A8EA 2B8QA 4M63A 4I2QB 3RAXA 1UWBB 3OUYB 2V4RA 4QU7A 3NXZA 4DX8H 3ENQA 4NYPA 4F3MA 3MR6A 3BGRB 4HHUA 2BM1A 1KOOA 1EP4A 3GWCA 3OXLA 2O3DA 1A9NB 4RNHA 1NM2A 4EU0A 1MMNA 5G0RA 1G7CB 5CH7B 1P9QC 4YB6A 4DR4F 4S0MA 3NGTA 2MKJA 3TEHB 3PX0A 1XEZA 2MKIA 4LRFA 2HYIB 3CCJS 2E5IA 2HFSA 2VIHA 1T9WA 2HNYB 3GP9A 3O1LA 1RTJA 2QO3A 1TUGB 5C42A 1IKWB 4RW7B 4ZPCA 5K9FA 2OP5A 3HVRA 3KJVB 4EI2A 4TU8A 3J81Y 4OV6A 3QO9B 2D9PA 3H0PA 2J0QD 3CD7A 2DNMA 4RW8A 3C14A 5B09A 3GSIA 3W60A 2QLFB 4CLTA 1SBRA 1T02A 1RAIB 4OZNA 1S1TA 4UY85 3OPKA 1E6YB 4Y00A 2HHQA 5LOQA 2QMUB 5LSOA 4F7VA 4CM2A 2EC2A 1Q82T 2WK4A 1SIWB 2J76E 2KRBA 1WNEA 4DQQA 4LREA 2HZVA 2N3LA 3L7OA 4OZLA 4C98A 1Q53A 3QT6A 1TAUA 1RT2B 2N3OA 2W4DA 1LW0B 2WHOA 2VJUA 2G0IA 1JWWA 3TA0A 1F2GA 2G1HA 2R7SA 1FE0A 4WIIA 3EVMA 3KG4A 4RUHA 2RIJA 3CDWA 2CFXA 1GX5A 2W2MP 4OZ2A 3TVZA 5J2NA 2YX4A 3QFWA 3E01A 3TUZC 1NPPA 3PRBA 3HM9A 4CRJA 4X62F 4B3RJ 5GADI 4HYKA 5DZ6A 4DX7A 4Y65A 2GGPA 4L3NA 4DSIA 1RTIB 4AD6A 4IH6A 2XNQA 4NRTA 1YJWS 1SL0A 4GC6A 1UMJA 4P72A 4GVBA 3D1HA 1ZZNA 2QTWA 1MLAA 3A4TA 3FBCA 1WORA 5HI7A 4W92B 2PEBA 3H59A 1Y5NB 3NWRA 4MYUA 2DGUA 4P2MA 2N7CA 5FLXY 1XTZA 2E9RX 2WW8A 3IRXA 4LF7J 1JLQB 5A6WA 1WEYA 4NLRA 1HPZA 1RABB 3CSKA 3QMQA 1H7WA 3BN7A 4V19X 4ILRA 1MNEA 3VZHA 2W9CA 5KFLA 1EX8A 4O4RA 2HFUA 2B0GA 4Q7AA 5KOXA 2EPIA 2NXUA 2CXEA 2NXNA 4DU7A 1QSLA 3WIVA 2YVSA 3SDEB 3RBEA 3W5YA 3FK4A 4A8KA 2W8KA 4UUXA 4UOGA 5K8OA 3CW2C 1A7GE 2IVYA 1OPIA 4FYWB 1FNMA 4MIAA 3T5JA 3OR1B 4KY3A 1ZZFA 4F04B 1CJVA 4RNOA 4GO5X 2P8IA 5GVQA 2YNIB 3EGVA 2FHMA 1WC3A 2ZJPQ 1MROA 1S1VA 3B4MA 1X4FA 3MCSA 3NKYA 3NL0A 4M5KA 2V2ZA 1F3FA 1F6TA 3POTB 4ED3A 2DJWA 1FRLA 1YJUA 5ETMA 2D1CA 2O5DA 4PG8A 5E3PA 2W01A 2FVPA 3N5BA 2E1RA 4DEZA 1U4BA 1U48A 1I94F 1JNRB 6FDRA 1JX4A 1TZ0A 4DPTA 1FNXH 2ZBIA 2CPHA 5HATA 1RACB 2Z4PA 3ZC4A 2EVZA 3PV8A 1RT5A 3P45B 1R8PA 2RF2A 4KHMA 1RYSA 1K1SA 4ATNA 2VQEJ 3DLLQ 3M8QB 2DHXA 2RMLA 1NK4A 3HF5A 2VC0A 6FD1A 4IOCQ 3BSAA 2AMCB 4L6V3 2VG5A 2R7WA 2VPYB 3KK1A 2VUGA 3BF4A 2DR9A 5HL7Q 3NS7B 2F8MA 1OPZA 4URQU 2KDOA 4D3GA 1YBUA 2VKRA 2IMWP 2YKOA 2AJFE 2ZE2A 3D5MA 3ONQA 1NJIT 3PIPQ 2QLBB 4LF5J 3RAMA 4DSJA 2E5HA 3W8PA 3EZ5A 1UJ6A 3MM5B 1T9UA 2HNDA 1JXVA 3DLBA 4O3QA 3H8YA 4JI8F 4KGZB 1IM6A 1TKXA 3MPVA 4LF4J 1VIOA 2ZC4A 3R7NB 2X1AA 1D0EA 4IRCA 2CNOB 2GC8A 3MPUB 2CJXB 3VAJA 4KE5A 4BC7A 2J5AA 1DARA 4B9NA 1FDAA 4ANDA 4WPAA 2HS3A 1YDLA 3MM6B 1LW2A 2RQ4A 1KQGB 3GFYA 3CD0A 2KKHA 3CMES 2BZ2A 1IM4A 5M2PA 3H98A 3I96A 1BLUA 2F65A 5A6PA 2C2EA 4ED8A 1RTHB 4UTGA 4UOCA 3EVWA 4DDFA 4DQRA 3BKTA 2H9ZA 1QUVA 4USTA 5B0FA 5EX0A 4ED5A 3CJRA 4FXDA 3T5LA 2JLEA 3W9JA 2QA4G 4M5HA 1T8EA 2E7VA 3T3FA 3KLGA 2WB1D 5HLFA 1OJ4A 5F0WA 1F9HA 5AXLA 4KC5A 2ZKTA 3HT3A 1HI8A 1H2UX 3ZTSA 4ZLPA 1PCAA 4ZCIA 1ZTWA 2IRUA 2EC0A 4FF1A 1RHKB 2RQCA 1UW4A 1H72C 1XN9A 5I3UB 1WI6A 4ZKAA 2JNJA 3SXLA 1JJ2R 5J2MA 2L9WA 4CO5A 3SI8A 3WX8A 3LO3A 2K1RB 2JEGA 2A2DA 1NKBA 1B0TA 3AD8C 3ZTRA 4B02A 1WC5A 1GQEA 5KAKA 3ADAC 2Y3YA 3ZZRA 2XS5A 1TL1A 4K50A 1RAHB 1HD1A 1KC8T 3EE3A 2BJ8A 4O0NA 4IG3B 2HQDA 1WC4A 1CJUA 2KXHA 1TELA 1HQUA 2GVDA 2P5VA 5AXMA 2GAHC 3PVXA 1HNXJ 4BDPA 4ED0A 4USVA 1DTQA 4EBEA 3TJ8A 2QJ3A 4ECTA 2R8IA 4YHHJ 1T9TA 2R2RA 3MEGB 5LXRA 3DGVA 3CJ0A 3OXFA 4CLZA 3KDOA 3R2CJ 3W66A 1UFLA 1RCXB 3LP0B 2WONB 2DHAA 5HSPA 2B5JB 4DL7A 1T95A 1JNZB 3M30A 4NLWA 1R0CB 4XK8C 1WKKA 1RQ0A 4QPTA 1XMQJ 4KKOA 4M5IA 1J2VA 2Z57B 1U6ZA 2YNHB 5KFVA 4JYAF 4USKA 2F1FA 3PXGa 3S8SA 3QWPA 4NMXA 2JDJA 1AUSL 1Y10A 5L8RC 2ZH9A 5C25B 3MPDA 1GXUA 2XLIA 3W2VB 3NGRA 3J81j 3KLIA
chains in the Genus database with same CATH topology
1U1RA 2IHR1 1FJCA 1S7HA 2FLOA 1R3NA 5T14A 5HMWA 3IS9A 2J9CA 4ECRA 4KFBA 1DBDA 3RTVA 2KU7A 1G1XA 3CC7S 2HRUA 4OHZA 1SL1A 4Y2KA 4F4KA 2EFOA 2LQJA 4Q0BB 2MKCA 3Q0AA 1Y5IB 1LOUA 2DCLA 4J5OA 3HP6A 1IR0A 3KG0A 2M2BA 2ZDOA 3QAEA 1YRXA 3T6JA 3QPIA 1NJYA 2MY8A 4AL6A 2LEAA 4NA3A 3MM5A 3V5RA 2BQ3A 3OTEA 3TAMB 1SH0A 3NAIA 2B6AB 4I7FA 7FD1A 1UL3A 4NMLA 2K3IA 4C8NA 3M32B 4YQWA 2EWHA 1RK8A 4JV1A 2YQ3A 1M5PC 2W7PA 1X4CA 2IMOA 3JAMY 2POKA 4PQAA 3F41A 4ED6A 5K14B 1FRHA 2ZVSA 4B3MF 3OFFA 5KG4A 1NJZA 2V4QA 4ZOSA 2DR8A 2DGTA 3DLKA 4O3SA 3DDNA 2DITA 1L3KA 1S99A 4D3HA 1IUJA 2MQNA 5CHCB 4UUWA 3UQSA 5KFEA 3GV7B 1T3OA 3SQGB 3IRWP 4M94A 2KJWA 2BABA 3I5CA 4FF4A 1LV5A 4YMEA 1YJ9S 4OIXA 3LWMA 2OSQA 3WBZA 5DDOC 4I6WA 5B0AA 2VFSA 5DLFA 1S6PB 1H6KX 2O67A 2E66A 3JSBA 4XDDA 4JI3F 2HMIB 3MMAA 3I0RB 2M8DB 2V9KA 3MM6A 2UUBF 3OL6A 4BS2A 2I8EA 4NLYA 1HBNA 2RB7A 2CJBA 4CH0S 1VRUA 4PG7A 5F8GA 3KLGB 3CCES 1VQPS 4B9LA 3P5TL 2GO9A 2Q3PA 1X5OA 3DOKB 4KQZA 3M2RB 5HLFB 1RT6A 1G2EA 3PEJA 1L3UA 4DL2A 1NHUA 1S79A 5KFZA 1H7XA 4YDXA 2RT3A 1X5PA 3LH2S 3TUJC 5AE2A 3MUTP 4ECSA 3TARA 4WF9Q 3O2IA 1JLGB 5KFKA 3MTKA 1T94A 1IQTA 2GJ2A 2AGPA 4NWBA 5JUMA 1RTHA 1C2PA 2AX0A 3AAWB 3MAHA 3L3CA 4ILMA 4UQTA 4NA2A 5L1KA 5HBMB 2MKSA 4QIWD 1ZM3A 4PPZA 4A4JA 5KT6A 2JRSA 4RNNA 3MM8A 4WE1B 3DCAA 4AXJA 4WCEQ 4PRFA 3UCUP 1YG0A 5J2MB 1S9FA 1ZYQA 2JFKA 4MKAA 4H4OA 3S7RA 1YJNS 4B9UA 1NK9A 2MZTA 4KPYA 3P3DA 4ID5B 2JFDA 1YJRA 1W2IA 3GG1A 1X0FA 3MM9A 2FPHX 2AYGA 1V3RA 1XBWA 4XPCA 4MAKA 1JJ4A 2R7TA 3J7A1 2F7VA 2CPXA 5EHHA 3LWLA 2C3PA 4B3SF 1U1LA 2FHKA 2DR7A 4OI0A 1RISA 2IC3B 4N76A 3CJ2A 1VBZA 4K4ZA 4LQ3A 3FEZA 3Q24A 2PGCA 1JKHA 2UXCF 2R8KA 1O8BA 1TL1B 4ES1A 4NCAA 2KT2A 2AGOA 4LSNA 1N56A 4ES2A 2CQHA 5IWAF 4CH7A 3JB9k 3CT9A 3JTNA 3FMBA 1YGYA 4NLXA 3BQ1A 2W24A 3TRGA 1RKIA 1ZH5A 1TK0A 5KFAA 1HNWF 5HMZA 1RI7A 5LT5A 4RLEA 4YR3A 3PW7A 3K0JA 1D9AA 3I4PA 3ISZA 3IXQA 1FT8A 4JI0F 3HVWA 3CE8A 3K8VA 3NG8A 2KH9A 3K58A 2RSQA 3I6PA 4HTJA 2G13A 3OJUA 4DL6A 3H2VE 5I3UA 2R2TA 2OD4A 5DDQC 2ZHBA 3MUVP 3RR7A 2ASJA 1XERA 4ZP9A 2VBWA 2DNPA 1FD2A 2HS4A 2PDAA 4IDKB 2MYFA 3V6JA 2GV1A 3M6XA 2K1RA 5A8RA 2PA8D 3O5TB 1N6QA 1G6BA 1RT4A 1FDBA 3KLHA 5D4NA 2DGVA 1R0AB 4NCGB 2DO0A 5GMKa 3IFEA 4DSKA 5L9NA 4DG1A 1HR0F 3VAMA 3Q23A 3LUYA 5F9LA 4OMFG 1T05B 2OPQB 1FRXA 2X1BA 2HRYA 3BQ0A 1JLAA 3GE9A 1KFDA 4NRUA 1FEHA 2OH2A 1CG2A 1N5TA 4K4UA 3EUNA 4MIWA 1TKTB 4OX7A 5DJBA 2IA0A 2A10A 4FVMA 2M5YA 3NRBA 2HQIA 3DLEB 1S0MA 1U1PA 3T5HA 3ZZUA 2KJVA 3TVKA 1YITS 4A8MP 3KHRA 4GC7A 4DHVA 3V81B 1VLYA 2CPZA 1WG5A 3UI3A 2N4DA 4IG3A 2V9WA 3CD5A 4OX8A 5DS7A 5KFHA 2FB0A 5KT3A 2L08A 1MU2A 2VG6A 4N77A 4DOZA 5EDWA 2GNKA 2ZJRQ 1V3SA 2ZBCA 2KT5A 2OIHA 1FD8A 1IKVB 5A0YA 4FS2A 1RT7B 2ASYA 1EETA 3MM7B 2DBBA 4LIWA 3CCWA 2XSJB 3SSRA 4LSLA 5DG8A 4B9SA 1ZETA 3IWNC 1KOHA 3TA1A 3VQTA 2U2FA 1T3NA 1H98A 4QYZJ 2RD5C 4O3PA 2PT0A 3MMBA 2UV8A 3S6EA 5D4LA 3V6DB 2BYCA 2D7SA 1HWUA 4DR5F 2CQ2A 2VB6A 1RP5A 3T9ZA 2NR0A 3C66A 3G9CA 1MSWD 4B9TA 2AWZA 3BSNA 2J6SA 5KFWA 1P1LA 3TO8A 1HHSA 1ELOA 1LQ9A 5F8NA 1BWEA 1TK5A 2UVWA 2KFYA 4F8RA 4HT5A 1X5TA 2B4PA 4WKRA 4O23A 2KYZA 3TYTA 1RA6A 2B9YA 2W9BA 1Q8IA 2FVCA 2XMVA 2I5JB 1RTDA 4LF8F 4LF6F 4F67A 2HFNA 5GADU 1Q8LA 2LA4A 4NZ6A 2BBEA 1B64A 3CCLS 2BE2B 2XMWA 3DRYA 4ES3A 2IM1A 2E9ZA 2DB1A 3IAM9 1BQXA 2FGOA 1FRJA 2RH3A 3GFZA 1JXLA 4F2SA 1HQEB 2BRKA 3MZIA 1VHFA 2Y0SD 2X1GA 3M2UA 2WAQD 2U1AA 1HNVB 1TV6B 3GR1A 5IS2A 3I87A 2WONA 3LP0A 3GQCA 4ZPTR 1DRZA 3TP2A 1KRPA 5DLGA 4ZCKA 4F26A 2B5JA 5HMYA 3Q22A 3MHYA 3I0SA 4HH1A 1NRKA 4J9RA 4OI6A 2VC1A 2G1DA 3PFEA 3D2WA 1WHYA 2JLFA 2MQLA 3IS9B 2F9JA 4KFBB 1MWYA 4HH0A 2BDPA 2ZUGA 5C24B 3DDKA 3J7Z5 1HBOB 2DD8S 1ZPVA 2L9DA 4CNYA 2XWXA 2BJDA 3FZBA 3M6WA 2KN4A 1KQFB 1T03B 2C2DA 2P6SA 3R27A 3CUNA 4HEA9 3CDBA 2CQIA 3MECA 2NSCA 2WRMA 2ZM6F 2HHVA 2AJQA 2CDQA 2ZH2A 2OPRA 2ZOMA 2VFVA 3MEKA 2ASLA 1X0PA 5J2PA 2YNHA 3SV4A 3T5KA 4RW6B 1KNZA 5FJ4A 3BO3A 3TVYA 2BXJA 3G8TA 2BOPA 1ZM2A 2D3UA 3SYZA 2DRAA 3TX8A 4IO9Q 4RBTA 1X9SA 2C28A 3H4DA 1WHXA 2YKMA 2MZQA 2BRLA 4KR0B 4U67Q 2KZMA 5MLCV 4PG5A 1KQSR 2V2KA 4TY9A 5AJ3F 2QFJA 2VKZG 1ZTTA 2MGZB 4AL7A 4O44B 1TKDA 2KG0A 2NZ4A 4TY8A 1CSJA 1M0SA 2LXIA 3OSNA 4IFYA 4IR1A 4LVOP 3W2VA 3T1AA 1LWEA 3H5XA 2YH0A 2YNFA 4Y2MA 1A6LA 2DNKA 2QA2A 3CDEA 3D0HE 4MFBA 4ETXA 3GMGA 2D74B 4R5PB 5A8WA 3HVTA 5J2QB 2CVIA 3H20A 1VBXA 1SJ3P 1R31A 1V6HA 2M88A 2JVRA 4DN0A 1PILA 2V5HG 1FE4A 2KXFA 2FGCA 2VBZA 3IAS9 3JYTB 4X4QA 3MMAB 4MJKA 3RBDA 3HHLB 4DV2F 1QSYA 1N33F 4LFCF 2IRYA 2YX7A 2XEXA 1VRUB 4ILLA 3E51A 4PXCA 3QLHA 2XLKA 3M1VB 1FEEA 4EFAC 1WG1A 1U6BA 1LK7A 3OFHA 4KTQA 4IH5A 3TAMA 1FESA 2B6AA 3LQVA 5J1PA 3RB6A 1FCAA 2EFNA 3T1YF 4PXBA 4YB1P 4KHPF 3HHNB 5KFTA 4CO2A 1HI0P