1FHTA

Rna-binding domain of the u1a spliceosomal protein u1a117, nmr, 43 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
116
structure length
116
Chain Sequence
AVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal RNP domain of U1A protein: the role of C-terminal residues in structure stability and RNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribonucleoprotein
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
total genus 11
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1996-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fhtA00
1OIAA 1X5PA 3OW2R 2YH0A 2FC9A 2K8GA 1VQ8S 5LSLA 4UQTA 2OTLS 1YI2S 2CPYA 2RT3A 4OZ0A 2MZSA 2CPZA 1QVFR 4QPTA 1NJIT 1IQTA 3BEGB 3MI7X 1ZH5A 5D78A 2DNOA 3VAGA 1W2BR 2ZJPQ 1N8RT 4ZKAA 2DHSA 3P6YC 3MD1A 2FC8A 2M2BA 2DIVA 1SJQA 5IM0B 2KM8B 4OZ1A 1X5OA 1JJHA 3CCRS 2EVZA 4A8XA 2L9WA 1Q82T 2DGOA 4QQBA 2ZJRQ 3R1HA 1DZ5A 1FT8A 3NS6A 2YH1A 1YIJS 3VF0B 4FXWA 5IFMA 3UCUP 1G2EA 1O0PA 2FHOB 2LA4A 2CQHA 2JVRA 4WF9Q 4EGLA 2I38A 1SJRA 3P5TL 2CQPA 2E5HA 4M5DB 2E5GA 1D8ZA 4WFNQ 5LXYA 1X4GA 5DM6Q 2DNRA 2KM8C 2DIUA 1FHTA 4FXVA 2KG0A 1WG5A 2LKZA 2M0GB 5LXRA 5JVHQ 2DHAA 4U67Q 2VOPA 1U1MA 4C4WA 1JJ2R 3CCJS 2GHPA 2VODA 3N9UC 2VOOA 2MQNA 1KOOA 3BO2A 1WHXA 3VAFA 1N52B 3BO4A 2MKJA 5IQQA 1X4DA 3TYTA 2AD9A 2HGLA 1M5OC 3IRWP 2DNPA 1Q86T 2XNQA 2CQDA 2XS5A 2CQ4A 3MURP 2DGQA 2MKHA 1VC0A 2RQ4A 2GO9A 3FEXB 2RU3A 1KD1T 1M5VC 4LIRA 1QVGR 1N54B 3MUVP 1JMTA 2EK6A 3G96A 2G0CA 2N82B 3Q2TC 2MZRA 2E44A 3IWNC 1U2FA 1M1KT 1BY9A 3TP2A 2CQ2A 2KT5A 2MKIA 3MXHP 3CCVS 2RRBA 2EK1A 3US5A 3J7YU 3CPWR 2LEBA 3B4MA 2DNNA 2MSSA 1VBZA 3UE2A 5CA5A 1VQNS 3SMZA 3Q2SC 4WCEQ 2D3OR 5DM7Q 1VQ5S 4TU7A 2MQOA 2CQ0A 4CQ1A 2JVOA 5EN1A 2MQLA 4PKDB 3G8TA 1UW4A 3THPA 2YTCA 4BS2A 5IM0A 2DB1A 4F25A 1CVJA 1WI6A 2LEAA 1SJ3P 3G71S 2NLWA 3CMES 3NMRA 1FO1A 2KI2A 5LSOA 5GMKa 2LECA 5GVQA 3U1LA 4IO9Q 2DO0A 1KQSR 3PIPQ 2HGNA 2M52A 2MZ1A 1WEZA 4CIOA 2DGSA 2CQ1A 1X5TA 1WF1A 1WHYA 1WHWA 3CD6S 3CCMS 1YJ9S 4WKRA 3NNHA 2FPHX 2AYMA 2CPHA 3BO3A 4TU9A 1L3KA 1WEXA 2X1BA 2ADBA 2CPFA 3ZZYA 3JB9k 4W92B 2MY8A 3CCES 5LJ5Y 1HL6A 2MXYA 2KHCA 4QU6A 2KRBA 1YITS 2CPXA 3ZZZA 3ULHA 3V4MA 2MKSA 1RK8A 1XN9A 1VQ6S 1ZZFA 2X1FA 5FJ4A 3I56S 2OIHA 3UD3P 2I2YA 2MZJA 4PRFA 2G4BA 2SXLA 2MQPA 2DGWA 3H2UB 1OO0B 2MHNA 4WFAQ 1PGZA 3THTA 1P27B 1YJNS 1U1PA 2MY7A 4UY8T 3R27A 5DETA 2DGVA 5GADU 1H6KX 4TLQA 3CUNA 2HVZA 2ERRA 2FY1A 1VBXA 2J0QD 2KRRA 3R1LA 2M8DB 2CJKA 5JVGQ 1VQOS 2CQ3A 1R8PA 1JJ4A 2XS7A 2RNEA 2DH8A 1YHQS 2XNRA 2HZCA 1U1QA 1SJFA 2AYGA 1WI8A 2ZJQQ 3G4SS 3L3CA 1A9NB 3CC2S 5BJRA 5CYJA 2LA6A 2MGZA 2DH7A 2U2FA 5MLCV 5CXTA 2RVJA 3NS5A 2QFJA 3EGZA 2CQGA 1WG4A 4C7QA 2LQ5A 1UFWA 2DNKA 4F26A 1HD1A 1U1KA 4WIIA 1DBDA 1VQ4S 2Q79A 1VQMS 2F9DA 2RQCA 2X1AA 2JWNA 1FJ7A 1X4FA 4YOEA 2M88A 1DRZA 5DDOC 4CH1A 2LYVA 2NZ4A 2RUGA 2LXUA 1VC6A 2D9OA 2CQIA 4QU7A 3B4DA 2XSFA 2CQCA 4YUDA 3CXCR 4Y0FA 2M7SA 2ADCA 4ERDA 2RRAA 4LMZA 1P1TA 5LJ3Y 2L41A 1VQ7S 3LPYA 2F3JA 2A3JA 1M90T 2XS2A 3CC4S 2WBRA 1M5KC 3CMAS 3S8SA 3P3DA 2G1DA 2KVIA 3LQVA 3CULA 3P49B 1M5PC 2BZ2A 2DGTA 2M8HA 1VQPS 2DNQA 3S6EA 2MSTA 2MKKA 2DHXA 2E5JA 5GAEU 2DNZA 1H2VZ 1WF2A 1KC8T 2UP1A 1B7FA 1U1LA 1SJ4P 3EX7B 1U1OA 4W90B 1OPIA 2E5IA 1AUDA 3HHNB 3H2VE 1X0FA 2MB0B 1F9FA 1WWHA 2D9PA 4J5OA 3SDEB 4WFBQ 3UCZP 1Q81T 2DNHA 2JRSA 2M9KA 2DHGA 3DLLQ 4IOAQ 2V94A 2PEHA 3NNAA 2LMIA 3CF5Q 1U6BA 2HYIB 2J76E 5GAHU 4C0OC 2N7CA 1FXLA 4TU8A 5DDQC 1HA1A 1WHVA 2DK2A 2LCWA 1H2UX 1VC5A 5GAGU 2YKAA 2DNMA 2MJNA 1QM9A 3VAIA 1X4BA 2OTJS 1SXLA 2DNLA 1X4EA 3MOJB 1S79A 2DO4A 1VQKS 2CPDA 3U1MA 3VAMA 2DGUA 1URNA 3FEYB 2KN4A 4IOCQ 4CH0S 2QEXS 2DGXA 2KFYA 1K73T 2DH9A 2MMYA 2RS8A 1X4HA 2KU7A 2L08A 5DDRC 3PIOQ 2DNYA 3TO8A 1Q7YT 2B0GA 5D77A 4V19X 2CPIA 1FJEB 3EGNA 2LXIA 1YTYA 2MJUA 1YWXA 3VAJA 4IUFA 1DHMA 2KG1A 2AYEA 1H2TZ 2F9JA 1VQ9S 2KXNB 3MDFA 2DITA 1RKJA 4P6QA 3D2WA 2OJ3A 1VQLS 1X4AA 2KH9A 2QA4S 3HI9A 3MD3A 2KYXA 1PO6A 2M70A 4ED5A 1UP1A 3S01A 5ITHA 5DDPC 1WELA 3CCUS 1ZZNA 2MQQA 3G8SA 2MPUA 2XB2D 4Z2XA 1N88A 2RS2A 3VAKA 1S72S 1VBYA 1K9MT 1WTBA 3DXBA 2MYFA 1HD0A 1FNXH 2CQBA 2YWKA 1OWXA 2AYBA 3RW7A 4RU2A 1U1RA 1NU4A 3SDEA 2DISA 5H1SV 2X1GA 2O3DA 3BS9A 4PR6A 2K3KA 2BOPA 2CPEA 1R8HA 5HL7Q 4Y00A 1U1NA 5HO4A 2OSQA 1U6FA 1WEYA 1D9AA 3CCSS 3G6ES 3UD4P 1A7GE 2J8AA 2OSRA 3CTRA 3S7RA 3VALA 2MQMA 3NNCA 1WG1A 3G9CA 3CC7S 2M4MA 2MKCA 3UWTA 2HGMA 2N3LA 2MGZB 2JX2A 2N3OA 2MZTA 4F02A 3J7ZT 1WF0A 3SXLA 1YJWS 3RW6A 2U1AA 1FJCA 4LJMA 1NO8A 1KOHA 1X5SA 3K0JA 3UCGA 1UAWA 2CPJA 2MZQA 3MUTP 3I55S 4YB1P 3CCLS 3MUMP 2PE8A 2J0SD 2VONA 3CCQS 2DNGA 2KXHA 2KXFA 1X4CA 1K8AT 3VAHA
chains in the Genus database with same CATH superfamily
4ZVPB 4ECXA 3A3NB 4JI2J 2GQ2A 2IBKA 1NK0A 2FC9A 2K8GA 1QE1A 4WFYA 2VASA 2WW4A 3DN9A 5HP1A 2ZBIA 3DHWC 2W4DA 2RT3A 3W65A 3NWGA 5DGBA 1QVFR 3KHLA 3G82A 1EIYB 3NKYA 4JB8B 2BDPA 3ENQA 4FF3A 4OQJA 5EWFA 3OL8A 5F41A 2DNOA 3C6UA 3VAGA 1N8RT 4DUYF 2IVYA 1RI7A 3A13A 4HDGA 4ZVOB 5HQLA 3ET6B 3M8RA 4KV8B 2KKHA 2LLZA 3IS9B 3WDOA 4I64A 2OEJA 5HJYA 2YKQA 3MEEA 4LRDA 5FLXU 2DIVA 2HNDA 2C2RA 2YQ0A 3HLUA 4L3NA 5IM0B 4NYPA 4LF1A 3I0RA 1GTHA 3CCRS 4P2XA 1NCLA 1S49A 2L9WA 2V69A 1TKXB 2BMBA 3H8YA 4A8XA 3G6YA 1S0VA 4IFVA 2YPYA 3IR7B 2KO1A 2MEWA 3NCPA 3H20A 4MAKA 2ZJRQ 1DZ5A 3JQJA 3OXGA 4U7UD 2YH1A 1HW9A 4R0EA 2B9EA 3MM8A 4G1PA 3VF0B 3ZTRA 3DLBA 1VRTA 3POTA 1G2EA 2GJFA 4IYQA 1TMMA 5IC6B 4DUTA 1HWLA 2G0JA 4X4NA 2LA4A 4XTTA 2O1PA 1IWGA 2V9WA 4RW4B 3PFEA 1GAOA 1SJRA 3BN4A 1VYAA 2YNGB 4R0JA 2VG5A 3HHLD 3JAMU 2ILZA 4Q5VA 1YBUA 2ZBCA 4M5DB 2E5GA 4MIAA 1N0VC 4H4OA 4WFNQ 5DM6Q 2NREA 3CIZA 4J9KA 4M5NA 4IFYB 2RSQA 1FHTA 4AQYJ 3PY8A 1HKAA 2V9KA 4OYMA 2KG0A 2FVRA 1XBWA 2LKZA 3PG9A 2DR7A 5LXRA 5A8RA 1TFWA 4ZIVA 5JVHQ 1FK9A 2D3UA 5DGAA 2VH7A 2GIQA 2ZVIA 4C4WA 4X62J 1JJ2R 1HMVB 1NZ8A 3TNVA 2QLJB 4FS1A 2NXNA 2HNZA 1CJKA 2MQNA 5AE1A 1NDLA 5H9EJ 4KFBB 3VAFA 2BRKA 1QUVA 5D0RA 1YRUA 2H3EB 2LU2A 4OZ3A 4KHPF 4Y2CA 1NKEA 3D7SB 2XZDB 3W2VB 2OPSA 2AD9A 1KBRA 4LFCJ 1M5OC 2MTLA 2N4DA 2RDJA 1EQ0A 1HBUB 2ZH7A 1T9VA 3HD1A 3PJXA 2W8LA 1UA0A 1L3TA 4J9UE 3TVKA 2NXEA 2PDAA 1NK4A 5KFFA 4JI7F 4F7VA 5ETNA 2Q6CA 3HULA 5CZVA 2D3O1 4LF5J 1MLAA 3ENWA 5A8WA 3OR2A 2OPQA 2ILYA 1M1HA 2ROGA 2YWGA 3FEXB 1FDBA 4I56A 4DLGA 3LAMA 4PWDB 2RJZA 1NHVA 4WBFA 5ETRA 4CLFA 5BXIA 1U02A 2HLTA 1YGYA 2YNIB 4H4MA 4PWWA 2LP4A 6FD1A 3MUVP 4GKKJ 2EK6A 1R0CB 1XR5A 2A6MA 3M05A 4WP9A 2DR5A 3G8QA 5HI7A 2XEXA 2B4PA 3OR1B 4ECRA 3PV8A 1RADB 2MZRA 3W9JA 4FVCA 4F8RA 2FLNA 1DY3A 1U2FA 1M1KT 1IKXB 3IMQJ 3TP2A 2J9DA 1TAUA 1R6YA 3DLKB 5E3RA 2CQ2A 2A1BA 1X31C 2XTJP 3UFCX 3LP0B 3D1OA 4P2MA 2FLPA 4HACA 2Y9HA 3J81j 3SFGA 3VQSA 4K2JA 2DNNA 2ZHAA 1MWYA 3R8YA 1KHVA 2PMHA 3O44A 4OYAA 3UE2A 2B5JB 2W25A 4UUXA 3QIPA 2Y1IA 5A8WB 3Q2SC 1TP7A 5AXKA 2B4VA 2YXLA 4CO2A 4NXNF 2FTRA 4ZVFA 3DMJA 2HBYB 1T03A 3R5GA 2MQOA 4CQ1A 4HACB 2MQLA 4PKDB 1UW4A 3THPA 4BS2A 3T5HA 1N4LA 4PG5A 2RF2A 4JI8J 5F0UA 1CVJA 4ICLB 4ECTA 4URQU 3MMCA 1RBOB 1GMWA 1RTJA 3G71S 4ECVA 1SJ3P 3CMES 3QRRA 3FZ2A 3TZXA 3GE9A 3FVYA 2KI2A 1PBAA 3I87A 2DBBA 1NXIA 1U6ZA 3CJTA 5T7LA 3TEHB 3FFIB 3CDWA 2EKNA 3R6LB 1Q79A 2HHVA 2YNIA 1K0VA 1TUGB 4GO7X 1T9YA 1NJWA 1O6XA 3RAXA 1NMEB 1P9YA 1PBUA 4DV6F 2M52A 1SL0A 4LVOP 3I4HX 1WHYA 4R5PB 1S97A 3CD6S 4WU3A 4WKRA 1VR6A 3DU5A 3J7A1 3LP2A 2FPHX 4DV1J 3SSRA 3BV8A 4DZDA 4KO0A 1SI9A 4RJVA 2YKMB 4TU9A 3GIJA 4KPYA 5DQGA 3WQPA 2AJQA 4P74A 4QR0A 1RTJB 4KAIA 2QL9B 4M5MA 2MY8A 3MM7B 4OX8A 4CYUA 2X7IA 4RW6A 1K0TA 2C3MA 2EFNA 5LJ5Y 3UI3A 3CJ2A 5CYMB 4ZCLA 2KHCA 3Q22A 2HHHF 4LF4J 1FRMA 4QU6A 2VPZB 3MM5A 5HJXA 4MK8A 4ZK7M 1N5YA 4B9NA 4KHMA 2KFZA 3K5MA 4ZCIA 2Z2LA 2C3PA 2W2MP 1XN9A 3D68A 3D6MB 4LFAJ 1KQFB 3KHGA 3GJRB 1ZZFA 2WK4A 1EETA 2HVDA 1Q16B 1A0OB 3AT1B 2X1FA 3W1YC 2BX6A 2EG1A 3EXCX 2OPPB 3AQOA 4IFYA 1UVMA 1ZS6A 3RZAA 1R27B 3GV5B 3VGVA 2I2YA 4PRFA 4NLOA 2WB1D 2OFHX 2QZ8A 1QAYA 2EC2A 1WDDA 4OJ3A 2SXLA 2VFRA 1KONA 5DQIA 3JXOA 1V3ZA 4B3OA 3B6BA 3MM6B 4DCJB 3MEKA 2GC8A 3S1TA 3T1YJ 1N6QB 5K8PA 1YBTA 2QYCA 1P27B 1RCXB 1UWBA 1I51B 3BSOA 1U1PA 1F6TA 1HYSB 1HNWF 2MY7A 3GIMA 1TKZB 4UY8T 2I1RA 5J1NA 5GADU 2WVCA 4IG3B 2K7JA 5A2QY 3CUNA 3B8HA 2VPYB 3ICLA 4OZ5A 4F50A 2J0QD 2BUNA 5F8MA 4ZS6A 4DPUA 4L73A 5JJBA 5CABA 3DGVA 3OV7A 1VQOS 1XNQF 4F2SA 4UOGA 1N5YB 4ELUA 1U8WA 3SIPB 1OJ4A 3H59A 2AJ2A 4L75A 5HVFA 3F41A 1JJ4A 4RBUA 1T9WA 4NYZA 2XS7A 3NMAA 1DTQA 1WC3A 2UVVA 3MHYA 2VHGA 3HD2A 4DPXA 4KHPJ 2IM3A 4LR9A 1H7XA 4ER8A 1S4FA 2HZCA 2HK3A 4WFXA 3VGUA 2CJXB 1U1QA 1SJFA 5BR8F 2R7UA 1FNMA 2QL5B 4CM2A 4YHHJ 3G4SS 4AUKA 2HNYA 3L3CA 3R2DJ 4IQMA 2ZDOA 4KO0B 3O5TB 4I6AA 4RUCA 5BJRA 1T8EA 1AB8A 1SH3A 3KHRA 2V8DA 3AD7C 2EW9A 4MK7A 2LA6A 1N33F 2AHOB 3R7NB 1EKSA 2DH7A 2PMZD 3OFFA 2XMJA 4Q45A 2VFVA 1Y5LB 2DEIA 3BGLA 3QT6A 2VFTA 3NS5A 2XLKA 2E5LJ 1JLQA 2WSFC 4E8UA 5EUHA 1WG4A 2Z8QA 1DJ0A 1SV5A 2WB4A 4DL0C 1M5SA 3OTOF 2RHSB 3DDKA 3PM9A 4NMXA 5ETKA 5KG0A 5IOLA 1TL7B 2XZWA 3TX0A 5L8RC 4L6V3 1IR1A 3D0IE 3M8QA 4EUVA 2F8EX 4FVMA 4BC9A 4EBEA 3UNGC 4LF7J 2HFOA 3MMAA 4EMDA 2UUAJ 3PR4A 2XO7A 2GJIA 5HQMA 3M8PB 3RU0A 5IV4A 4DV4J 2F9DA 2JWNA 3KK3A 3D4JA 4URGA 4YOEA 2LFVA 5EX3A 3MR3A 3D66A 3IRXB 2UV8A 3UDLA 5IZHA 2MDAA 2DRBA 4IO1A 2NZ4A 1CJVB 2LQ8A 2Y0SD 4ID8A 2BJ9A 2EFQA 3JTNA 5KT2A 2AX1A 3KG1A 4QU7A 1BLUA 2BANA 2XSFA 4QYZJ 4C11A 1WC4A 1ZAWA 4ATNA 3CXCR 5KAKA 4NRUA 1S77D 4LMZA 1P1TA 5HSPA 1IBMJ 3MEDB 3H4BA 1HR0J 2L9NA 3LPYA 2CYYA 2AGPA 1RAJA 1NK6A 4IFVB 2FJWA 3BQ2A 4DQIA 4P75A 4O44B 1OYDA 2ZEJA 2C3OA 3AD9C 4ZP8A 4ZPAA 4DR4F 4NCGB 3QO9A 2RRNA 2IHR1 1JLBB 2F4FA 2LCWA 2Y1RI 2Z57B 4H54A 1YLXA 5K9FA 3VZIA 4U7CA 1KNZA 4ECSA 4G1IA 3VWSA 2CWXA 1RAHB 1UVKA 4X4PA 2JDJA 2EI5A 3VHQA 1RAGB 2OD6A 3R7BB 3GILA 3CMAS 1HBMA 5CYQB 2HAFA 3P3DA 1REVB 4CI0B 4EYIB 5D6GA 2BZ2A 4M5KA 2DGTA 1F5AA 1ZAXA 4EBCA 3VR1A 3DU6A 3RBDA 5T14A 3TZZA 2HHUA 3SQGB 4RNOA 3BYRA 1U24A 4RW8A 4FDFA 3T1HF 2DHXA 1T3OA 5DG7A 1VQSA 1SIWB 1PIEA 3W66A 3LOUA 1IXKA 1S76D 2YX4A 4O44A 5GADI 4JI7J 1XERA 5GAGI 4QWEA 2BKOA 3DRPA 4X64F 1N5TA 4KBIA 1MROB 2UU9J 3CDAA 1N32J 3QJPA 1SJ4P 3EX7B 5J2NB 2XYHB 3CJKA 1DURA 2B9WA 2W1BA 3M30B 4CLWA 5L46A 3LWLA 1VDHA 1JLFA 4W90B 4LFCF 5HMWA 4UF4A 1PJ5A 4Q7AA 1CJKB 4NWBA 5C7PA 3NAHA 3H2VE 1X0FA 2MB0B 4K5RA 4WFBQ 2IIHA 3V4IB 3UCZP 4WZMA 1L3SA 1SCJB 5IC4B 2VIHA 2M9KA 3OT9A 3QYYA 1TKTB 4IOAQ 3R3TA 2PEHA 1S9EB 1CQNA 3I32A 2FB0A 2R8IA 3CF5Q 4DR3F 3GTYX 5D3GB 2H48B 3N5BA 2UU9F 1RTDB 5GAHU 1MU2B 3IBFB 3TR5A 1JNZB 1TKXA 4NLXA 4ZLJA 2ASYA 4DL7A 1CS4A 2RAQA 3I0RB 5KT7A 4HYKA 2OKQA 1QDUB 4OHVA 3DLKA 2DR8A 4NRTA 3EYZA 2HNDB 2MJNA 3QAEA 3R2CJ 4B9SA 4NCAA 1SXLA 2B43A 3Q8VA 5B7WA 2B3TB 3AJ1A 1QSSA 3L7UA 1KFDA 3VGTA 4DPYA 2FYXA 1VCTA 3FBCA 3N79A 1NSQA 4C3MA 1L3VA 3QFWA 1O5JA 5DG9A 2HQFA 3DLGB 3NBPA 4LSNA 5AXNA 3MCNA 2ZUGA 2OO4A 3B54A 3ISND 3OSPA 2VA3A 3VAMA 3GIRA 4EI2A 5C42B 3FEYB 1U4BA 1U7LA 4CH0S 1F1BB 4OZJA 4XPEA 4RNMA 4WPAA 1K73T 2D41A 4USJC 1X4HA 4HH0A 3HXMA 2BABA 1RWNB 5LMNF 4DV6J 4A8SA 5J2NA 3GP9A 4WXWA 4AQYF 1TVRA 2AEJA 3EPIA 2R7RA 4ITSA 4C0HA 3CGIA 4DPOA 3MMBA 2LXIA 1AT1B 1YTYA 3M2UA 1U49A 4I4BA 3VAJA 2R8KA 1XWLA 1VHFA 1ZTTA 3N01A 4CM0A 2KG1A 1X60A 4QW8A 3QZ7A 1SH2A 1QY7A 2BJ3A 8ATCB 1H2TZ 3M8WA 1ZTWA 2F9JA 4A46A 3NGTA 5DLFA 5GMDA 3PYGA 2VBYA 2WSCC 1FXRA 3U02A 1LW2A 3D2WA 2ZWPA 1VQLS 2KH9A 1J5OA 5B0BA 1N5SA 1S1UB 1FKOB 2KYXA 2PT0A 3D6TB 5K8MA 3E2EA 4X2BA 1B64A 4B3RF 4E2FB 2H1YA 2DR6A 2JZ5A 2YKNB 5BYRA 1U2CA 4PG6A 1N6QA 2FZKB 4PUOB 3CDUA 4DCPB 4M95A 1N88A 4OI1A 1VBYA 3HF5A 1K9MT 4LBHA 5HROA 4OHWA 2VBXA 4U7UK 1WTBA 4G3IA 3EWGA 2CQBA 5IWAJ 1WDTA 4LF4F 3DRSB 3O1LA 5EGYA 2BANB 2EPIA 2P6TA 3SDEA 3CWJA 1V9OA 4O0IA 1DLOB 3HP6A 3PO4A 2CVEA 2CADA 3BS9A 2PEBA 3I6PA 1RA6A 2IM1A 1DTTB 1S6PB 1YBAA 2XMWA 3PEHA 2J8SA 3MEGA 1LK7A 4OFZA 3GG1A 4F4KA 1IBCB 1EZZB 1U6FA 3FK4A 2PN6A 4L72B 5L39A 3RR8A 2XHCA 2B4UA 5KFAA 4HR2A 1IR2A 1F3VA 4DR1J 2J8AA 3M8ZA 5HROB 1S99A 1IBLF 4YQWA 3NNCA 2VL1A 3DOMB 4LQ9A 3BBFA 3KMQA 1YRTA 5KG6A 4ZLLA 2R9LA 2IA0A 3H7HB 3R6GB 1BWVA 1FKOA 2MKCA 4NLGA 1W26A 4I2QA 1FRJA 1HHSA 1ZPVA 3GJTB 3ZO7A 2V8VA 1B70B 2BR0A 1REVA 4NZ6A 1LWEB 1P1LA 2FVCA 4A8WA 4MKVA 3MPUB 3LW5C 4DG1A 3IWLA 2JOQA 2QLBB 4L76A 2WRMA 2RILA 3J7ZT 3TANA 1M5HA 1FJCA 3SCLE 2PGCA 3HM9A 3PX6A 1T0TV 2HW3A 3N6LA 3LH2S 4ZJQA 1FKPB 2OP5A 2ZHBA 1IBLJ 2E9RX 4JI0J 4GVBB 2D3ZA 3BH6B 3NOGA 5KFVA 3Q8PB 3KMSA 1HNZJ 1HPZB 3PRVA 1UKUA 4F0KA 4CP5A 2HQGA 3QSYB 1SBRA 1BGXT 3OFEA 3BQ1A 2VA2A 2W4CA 2GZOA 1UEUA 3DOLB 3BBBA 3EVMA 3D3BJ 3D6FB 4YMEA 1BMQB 3J81U 2XGPA 1S0NA 4LF9J 2KXHA 4NXMF 1X4CA 2BQ3A 3MAQA 2HG4A 3ENVA 1LWCB 1UVIA 1CJVA 1X5PA 4OJ1A 3PKYA 2ASDA 3OW2R 2GIRA 2IJNA 3CEDA 5D8HB 1Y3JA 2J7KA 3FDSA 1IKWB 2ACMA 1JQGA 3B82A 2D69A 5KFWA 4ZITA 4DV3J 1S1TA 5CD4H 1YI2S 3M2RB 1Q7LB 3QGPA 2MZSA 4PQUB 3JSMA 3MMAB 1RGVA 3AQPA 3C3LA 3D9BA 1PJ6A 4M5GA 4IKAA 1CBKA 1PKUA 1NJIT 5KFCA 3PO5A 1IQTA 3BEGB 3MI7X 4I2PB 1D8YA 5D78A 3N4WA 3OTOJ 1TL3B 2E1MC 3RG6A 4I67A 4KQZA 2X51A 4LVNP 4OZ2A 4ZKAA 1SV5B 1CG2A 4QOTA 3P6YC 4DR2F 3GSIA 1XNQJ 4ZVGA 3A8JA 5L9XA 3GZ7A 4DUZF 4JI2F 4OYBA 5J2PA 2RDDA 3RAMA 4KGZB 4FYYB 2NSBA 1L3UA 1WJ9A 1OY9A 3DLHA 4LFAF 2UXBJ 2I6WA 1TL1A 2KM8B 2H65B 4OZ1A 3SSQA 2XI3A 4C8MA 4OV1A 4JOUA 4DR5J 1KLMB 3NCRA 2HS4A 5KOXA 1FD2A 2WTFA 3KK1B 4CLZA 4F4WA 3MECB 1UJ4A 4QQBA 2LQBA 1RTIB 3L7PA 2V0NA 3M30A 2BJ8A 1SKRA 4DZ6A 4FPIA 5FDLB 3IGNA 1FT8A 4Q44A 2GS8A 4K4ZA 2HKEA 1I5OB 1G3OA 4QR1A 1QJHA 1RLCL 4FXWA 2BOAA 5IFMA 1NHKL 3QJLA 1KTVA 4N7TA 4IQXA 3QWPA 5A8KA 1S1VB 4DUZJ 3NCQA 1EP4B 3LA0A 3HK2A 1HNIA 1QD1A 2CQHA 2COLA 5M2UA 2XY6A 2GQCA 1IR0A 4JI6F 2I38A 3TQ1A 4UQGA 1KWMA 3Q0AA 4RNNA 3AXMA 5EDWA 2Q43A 2B4OA 4IG3A 3W61A 1JKHB 2C3UA 3M2VB 1N36J 4MKBA 2DCLA 3RBEA 2XCPA 1Z2ZA 1KVJA 3IR6B 3OVSA 5BYSA 1XNRJ 4DR7F 5T7LB 2BQRA 5JMNA 4Y2MA 2YWEA 1WG5A 4DEZA 1AFIA 3OXLA 2ZM6F 1P6TA 4MT1A 1XMOJ 1TTHB 4XDDA 5F9LA 4CWBA 3V81B 1KVIA 3OPKA 2DHAA 4EO6A 1TL5A 3C19A 3LO3A 4U67Q 2VOPA 3TVYA 1MWQA 2VODA 5B0AA 4ZN1A 2FJVA 3ITHA 1BQNA 5ETQA 3J80Y 1RWWB 1KOOA 5KFIA 3TRGA 1EX8A 4WYWA 4DN0A 1HNVB 3M1VB 4CO4A 4JV0A 4OX9J 2B51A 3AJ2A 6AT1B 3DM2A 1SC3B 1T05B 1OSDA 2E7WA 1OQ3A 2CXEA 2KB2A 1RB0A 3TYTA 2BA9A 1TFYA 1XR6A 3MM5B 4LFBF 1G6BA 3MCOA 4GMKA 2DNPA 3AY0A 2XNQA 5IV3A 3GIKA 2ZM6J 4HH1A 4DFJA 4FXDA 2XS5A 3M6VA 4LF8J 2J9EA 2CJ9A 2CQ4A 3MURP 3J7Z5 2E66A 5KG4A 3FJ2A 4O23A 3VVUA 4ANEA 2MKHA 5HVHA 2RQ4A 2GO9A 2VDIA 3H42A 1S6QA 4YN3B 1BUXA 4LIRA 5C24B 1MN7A 1T94A 2AZ1A 2AQ4A 2V50A 2QX0A 3HFKA 1SVDA 3KDNA 3HHLB 4DX6A 5AJ3F 2VQFJ 4R8UA 2G0CA 2IRXA 4NLSA 5CAAA 2XY7A 2Z30B 1NK7A 4H4KC 1NPKA 4HDHA 4ES1A 3TA2A 1V5IB 4RUBA 3IWNC 3ZFVA 3MTKA 3KXDA 3HT3A 5DJBA 2ZFHA 3GLJA 1HBUA 4Y2KA 2AP6A 2RRBA 5HMZA 3CCVS 2IYGA 1YJVA 2EK1A 3US5A 2QJ3A 3HJFA 1FRXA 3J7YU 4EFAC 3B4MA 2MSSA 3W2VA 4PYAA 4ZOSA 5D0HA 3SV3A 1ZBTA 2AMCB 4FYXB 3UVJB 2XMMA 1AFJA 2H4WB 4EZ6A 1Y5NB 1PYSB 2Q6BA 1DQ9A 2ZH3A 4GKJJ 2XLIA 3PKMA 2R2SA 1CQMA 3LP1B 5DM7Q 5B0EA 5BYQA 2ZH1A 4EZ9A 3KG0A 1IM4A 1ELOA 2CQ0A 2DVIA 2KZMA 3CMQA 4P7TA 3A3OB 5KG1A 2UXDJ 1EB0A 2KJVA 4RBVA 2P9CA 4G1QA 4F0HA 5B0DA 1WI6A 2W01A 2IFXA 3GONA 4WP8A 4TYAA 5I3PA 3QLHB 4IDKA 2G2YA 1OS5A 1FO1A 4TY9A 4DOZA 3CDBA 1XTZA 1NSPA 3EGWB 3IG1A 4BWMA 3U1LA 1TL3A 5DLGA 4IO9Q 1UEKA 2IRUA 2LDIA 2ZVSA 4UOHA 3I31A 4K4VA 2BVZA 4EK2A 4GC7A 1FNOA 3MM9B 3DDNA 4ZCMA 2AEFA 2RB7A 2DGSA 4CIOA 2CQ1A 5E5NA 2J5AA 2K3IA 3ZZTA 5AE2A 3KK3B 3C46A 2QMWA 3KLIA 2XMUA 2BM0A 3ZZPA 5BR8J 4ILMA 4N76A 4TY8B 3E3XA 3NNHA 2RD5C 3M6UA 3Q8UA 2CPHA 1WC0A 3BO3A 4RZRA 1IJEB 3M7VA 2ZOGA 4KPCA 1L3KA 3GB0A 5E41A 3M9MB 4DQSA 1TL4A 1WD6A 1WEXA 1NJYA 2UXBF 3QLHA 2ADBA 4X4UA 3ZZYA 3HHLC 1FFGB 3JQMA 3NLCA 3CCES 1SQFA 2R8HA 1HL6A 2LXFA 4WK3A 4ED1A 1SKSA 2E9ZA 3ZTPA 4ID5A 1YITS 2HHXA 1CJUA 3G6VA 3TJ8A 3V4IA 1K1QA 3HZEA 2YX7A 2GGPB 3WC2A 3V4MA 3SI8A 2MKSA 7FDRA 4NLTA 4Q8EA 4A8QA 4RW6B 4JI8F 2EWHA 2R3VA 2VC0A 2YKMA 5FJ4A 3UN3A 5I42A 3SYZA 3I56S 2F7VA 4QWBA 1GH8A 3UD3P 3SCIE 2R42A 3OXFA 2MZJA 4NI2A 1CJUB 4TNOA 4LUBA 3R97A 5KG3A 5E3QA 1PC4A 1YJRA 2QE5A 2YBVA 2G4BA 4I2QB 1FF2A 4X65F 3JSRA 1V6HA 3M2VA 3QBCA 4Q43A 3IP0A 4FNHA 2MHNA 1KRPA 4PG4A 4I0WA 3MAAB 4JI1J 1LK5A 2AJ4A 2GV1A 2VG7A 2V2KA 4FKXA 2XMAA 2R7SA 5DETA 1S1VA 2DGVA 2NYIA 1NK8A 4TLQA 4CO1A 3H25A 4B9UA 4F67A 2FY1A 1RT7B 2I9SA 5CYQA 1GFWB 1UWBB 1VRUB 2FY8A 1ZM2A 3GFYA 3MMCB 4YP3A 4WU2A 2CQ3A 1NJZA 1AZSB 3C15A 2GIFA 4USWA 3KLHB 3ETMA 1VIOA 3HDSA 2VZ9A 3PR5B 1WNEA 1L5UA 4U9RA 4ZVTB 2R7VA 3EMTA 1G4CA 2RNEA 5EX0A 4K4UA 1YHQS 4L74A 2XNRA 3DM2B 5B08A 2VQEF 3HJVA 1VRTB 1WI8A 3POTB 1FX4A 3QSIA 4N56A 2ZJQQ 1HWUA 4B9VA 3RBZA 1A9NB 3KK2B 4FNIA 2DCUB 1PC5A 5KFZA 3I9V9 4X84A 2R4FA 2ZWOA 4HHUA 4K4TA 2MGZA 5K14B 2NPFA 4D3GA 2Y3YA 2FVPA 1GXLA 2U2FA 3RJMB 2IPOB 3KJVA 5MLCV 2DRDA 2CIMA 2RH3A 5THWA 2QFJA 1AZSA 3GJSB 4CYUB 1Y0HA 4C7QA 3GQCA 1S59A 3VV2B 4JYAF 3P4UB 2MLZA 2I8EA 4DV3F 4ZJOA 5KFRA 1JXLA 1LXJA 2HWTA 1AYEA 4JV1A 2VF3A 1ZAVA 1DBDA 2PMWA 2IA6A 5ETSA 3NGKA 2EFOA 1FDDA 1JIHA 2DR9A 1HARA 2EXUA 4QYRA 4O4GB 3UR3C 1KEKA 1X4FA 4ZVSB 2XQCA 3C6TA 5HN0A 4D3HA 4QIVA 4DR2J 2M88A 2DXEA 4FF2A 1YK9A 2OAUA 1KN6A 5JXSA 1GQEA 3DOMA 4CLLA 2HFUA 2VQEJ 1EP4A 4P71A 4FYVB 2HBRB 2HFVA 4MKAA 3T19A 1RHRB 1IBKJ 2CQCA 4NLUA 4DS4A 1TMJA 4X65J 1RWMB 2M7SA 3GSDA 4Z7CA 4KHRA 2ZH6A 1VQ7S 4J9VA 2RF2B 1I1GA 3RB0A 4B9LA 1RTIA 4QYZK 4LSLA 4P10A 4DQPA 4BBYA 3R5BA 1X0PA 2A3JA 5GMEA 3V6DA 1WUUA 4NMLA 5I3QA 2ZH8A 2A6OA 1RWOB 1M90T 4X4VA 3KOAA 1RQ0A 2HBQB 3FEZA 1YJTA 4DMZA 1SKUB 1VFJA 2BV3A 2WBRA 3BPDA 2IM0A 1U0SA 1TUWA 4JI5J 3PYFA 1R89A 2ZH4A 2WOMB 2OMOA 4J9MA 1X9SA 3I5AA 3S8SA 1M5KC 4K50A 1N34F 2H54B 5C24A 3AAWB 3C66A 3EDRB 5M2PA 2L48A 2C2OB 3CNQP 4OLPA 5EHHA 4ED3A 2AWZA 3A12A 2NXUA 3AOBA 5KT4A 2JEGA 3HO1A 4DU7A 5K8NA 2DNQA 2EBGA 2X3DA 5SUHA 5HANA 2FZCB 1TZ0A 1IKXA 2MSTA 3S6EA 3KLFB 1XMOF 2MKKA 3PVXA 3FUYA 4GRSA 4LRBA 1VK3A 4PABA 3PXGa 5C25B 5CD4A 4NLVA 3KLEA 3GYXB 1AROP 4F36A 3V6JA 3PW7A 3OL6A 3KFWX 4XK8C 1HHTP 1H2VZ 3V6DB 1NK9A 1R6VA 4K2XA 3VVTA 3ZZUA 3Q8SB 2DPJA 2HWHA 2KL8A 4RW9A 3NRBA 2BE7D 2JC0A 3IFEA 4OZLA 2DY9A 5F0WA 2VOOA 1U1OA 4PXEA 3I82A 4DV7F 3DRXA 4LSZB 4OMFG 5D0GA 3T6JA 1S57A 3F56A 3HHNB 4NA3A 3W7BA 1ZOTA 1F9FA 3R5DA 4C97A 1R0AB 5LMNJ 4NOHA 2AZ3A 1LWFB 2C2MB 3BSCA 3FC9A 1Q81T 2JRSA 1UFLA 1J2VA 2JEFA 3IS9A 3DLLQ 2R7XA 3HVTB 3WIVA 3LWMA 2HEKA 5FLXY 2J76E 1FA0A 1RTHA 2YKOA 4M8LA 4C0OC 1FJGF 2N7CA 3NXZA 1S1UA 3GJQB 4DSKA 3W2WA 2QYGA 2FJBB 2HNZB 2NXCA 5DDQC 1VOMA 2ZNYA 4DV2J 2C2EA 2HQDA 1VC5A 4O0NA 3Q83A 5GAGU 3HSGA 4C9DA 2DNMA 3NWRA 4ZCKA 1H98A 1OY8A 1QM9A 2JLEA 1X4BA 3CJ4A 2GVDB 4K59A 4LR7A 1FVSA 3MOJB 4OYIA 1S79A 2C2KB 4R8UB 5A0YA 2W9AA 1TK5A 4W98A 1VQKS 4JI6J 4J9NA 2XBPA 3CCZA 1VBKA 1RWKB 1HWKA 2V4JA 3A8KA 3CCWA 2EC0A 5FDLA 2DGUA 5L1JA 2WVDA 1URNA 4B9TA 4BDPA 2QEXS 1RABB 4FBUA 3BYPA 3IGVA 5D3GA 3MTJA 1RHQB 2B8QA 1QTMA 2AIRB 1JLEB 2V68A 1FX2A 3TO8A 5DDRC 5D77A 3PIOQ 2VBWA 4GKJF 4OYZA 2XC9A 3NAIA 4C3LA 3FSYA 1S9GB 1YQHA 3FQLA 1YWXA 2X3GA 3JS9A 4J9LA 1UVJA 5L1IA 3KLEB 1FDAA 4LF7F 4IUFA 2O01C 3OUYB 4Y34A 4DV1F 3HVWA 5ETOA 4X62F 1ZM4A 4IG0B 5KFTA 3CC4S 1VQ9S 1OSCA 2DKOB 2AGQA 3MDFA 4HI2A 1S0OA 3OBIA 2DITA 2LU1A 4I2PA 4XDCA 1RKJA 2OJ3A 4RR5A 1MROA 1X4AA 2JJ4D 4OV6A 5B09A 2NPIA 5DQHA 4AL5A 4DHVA 3E8OA 4Q8FA 4HT7A 1IBMF 1S1TB 5A0YB 4OHYA 1IVZA 1UP1A 2IC3B 2QMUB 4JV5J 2CRLA 2YNFA 4KT0C 1IM6A 3CCUS 3BQ0A 4JV2A 2MQQA 1CJTA 2MPUA 3DDIA 4KYZA 4EU0A 1P9QC 4J9OA 2JEIA 4DX7A 2GVDA 3G2XA 4DG1B 4RW8B 1BE4A 3EE3A 3NY0A 5CQGA 4ANDA 3C6UB 2QIFA 4F4YA 1T3NA 3KYLA 4DL2A 1J5OB 5J2QA 2FZGB 5KG2A 3SCJE 3AJDA 1GMWD 2A18A 2OPQB 1HD0A 1Y9OA 3QGGA 1HNXJ 2YWKA 1OWXA 4DR4J 2BRLA 1C1BB 1WSVA 4XIUA 5IT9Y 4RU2A 3M2UB 2GGPA 5IT9U 5J2MB 2JH3A 3KG4A 2DISA 2ZNZA 1RT6A 2MLXA 1JLBA 3F44A 5H1SV 2PSZA 2O3DA 2F4VF 3MOZA 2OLWA 2K3KA 4PQAA 4DJBA 2E7VA 4KGKA 4LF6F 2BOPA 3EDQB 3M32A 5HBMB 1FTRA 2VKZG 3ZZ0A 3CJRA 3A3PB 4HVZA 1UWAA 2V4QA 4ZP7A 3T1HJ 1XR7A 1U0HB 3LTOA 4YDDB 2VBZA 4A48A 5DG8A 5HLFA 4NLRA 4UT4A 4FP9A 4CT8A 2W9CB 2CJAA 2HBZB 3VALA 2DRAA 1MNEA 3IAS9 1CJTB 1Z1ZA 4WP3A 5KFUA 2MQMA 5C2GA 3FNNA 3TUPA 3AB2B 3OTCA 1REGX 3G86A 4N47A 1MG7A 2P2CB 2BJEA 5KG5A 5EWEA 3DRSA 1WG1A 2L9DA 5MAOA 2W7PA 4B3MF 5HVGA 3G9CA 4ED4A 5C25A 1U26A 4B3SF 4CCHA 2WAQD 1OMSA 1U2RA 2HRYA 2MQ8A 2IC3A 3UN5A 5KFHA 2PA3A 1UW9A 3KLFA 2PI4A 2MGZB 4QIFA 4CNZA 1MU2A 2JX2A 4NLYA 4P9SA 4QWCA 2HFNA 2WW8A 3EUNA 3KLVA 2DD8S 4DR3J 1RAFB 1MMNA 1TL7A 3TUZC 4F02A 2FGCA 1ZM3A 4IDKB 1XIQA 1K1SA 4CLSA 2RDIA 1DTTA 1Q8IA 1KOHA 3UR0A 3NGUA 5LMUJ 4OI2A 4G1QB 4JP8A 4EBDA 4KJIA 3KDOA 1AW0A 3MCSA 2CDRB 3M6WA 3MUTP 3THVA 1HLWA 1LW2B 2FJAB 1SIZA 3H4DA 3CCLS 1ITPA 1HQ2A 2HPUA 5CYMA 1R8AA 1T02A 2NS1B 4KRWA 3H40A 3PW4A 1LOUA 2VU5A 2QRRA 4ZVRB 4G6VB 3GV7B 3NS7B 2J6UA 4CO0A 4USHA 1K8AT 2JFKA 2WVFA 1HHQA 3IXQA 3VAHA 1IQZA 1DQAA 1JJCB 1SH0A 2WVEA 3I0SA 8AT1B 2KT2A 1HPZA 4O3QA 2VC1A 3ETOA 3ZTQA 2H51B 4AYBD 2OH2A 5J2MA 2YKNA 5LSLA 2Z56B 2EKYA 3PX4A 3FGVA 2CPYA 3J7AN 4WTOB 4OZ0A 2CPZA 3TZWA 3CVKA 4ECUA 2DXFA 3ET6A 3IAM9 1PAEX 4RBTA 1FWPA 1QSYA 4I1TA 3GV8B 1HBOB 2ZJPQ 2DHSA 2UUTA 3O2IA 4PZVA 4U6PA 1TKZA 1RHKB 3EM1A 4DUYJ 4WWSA 3DLEA 2WSEC 2FC8A 2M2BA 3AXKA 3DGPB 3EVOA 3NOCA 4ILRA 5IXUA 1ZETA 3T5JA 3TAPA 1HBNA 3J80U 1IKVA 3NP5A 1JXEA 3EJMA 3RRKA 1B0TA 2QA1A 2DGOA 2E1AA 3K5OA 4P52A 2Q1LA 4DQRA 1RTZA 1RISA 2IAJA 1XJWB 3DLJA 5GAHI 1TAQA 3RB6A 2WVBA 3NS6A 2IDEA 4YR3A 1YIJS 2R8GA 2XM3A 3X3UA 3NG8A 3UCUP 1ZA2B 3MCMA 2NUUG 4UY85 1GMVA 2V8HA 4WE1A 3G6XA 1OQ6A 1X9MA 2O66A 2B9XA 3HHDA 2FHOB 2B6AA 4U95A 4IH7A 5G0RB 3C15B 3PCOB 4WF9Q 2RKIA 3JSYA 2UUCF 2W8KA 3KJFB 4ZPBA 5DS7A 3OHAA 1URRA 3BPSP 1FRIA 1RZMA 2HURA 3P5TL 3QFHA 4QW9A 2XHWA 3JTOA 2CQPA 2WONA 1RU1A 1N32F 1WACA 2E5HA 4TQSA 4ECZA 4DI6A 4B9MA 5LOQA 3LAKA 1VQYA 2DNRA 2ATLA 2HS0A 2G2OA 2AV5A 4ZP6A 4M1KA 4NXNJ 5DRKA 5K8OA 2DIUA 1D0EA 3W60A 3T5LA 1WC1A 3GCWP 3MR2A 2ZITA 1TK8A 2ZKTA 1S9EA 4AL6A 4TYBA 3DNCA 4F4XA 3CO9A 1UA1A 3M9NB 1J5EJ 4USUA 4R5PA 2UVWA 1SC4B 2YNHB 4OHZA 3OLAA 3HPOA 4NL5A 1QAIA 2GHPA 1EAYC 2VB6A 3TOQA 5HMXA 1FTCA 4B3TJ 1FJGJ 3VQTA 4OJHA 1WHXA 3LP1A 4B17A 4ZN3A 4HHHA 2NZCA 3MM7A 4K4XA 2ASJA 1N56A 1N52B 1RHMB 3G87A 2GNKA 4RNHA 1UETA 1X4DA 5IQQA 4DF8A 5KFLA 3L4BC 1C1CA 4MKYA 5A6PA 4UOCA 4B02A 4ES3A 1KVKA 1SC1B 3C14A 4ID5B 2ZH2A 2UUAF 3IRWP 2AU0A 1CULA 2B7CB 2P9GA 1S6OA 1Q86T 2CQDA 4OI6A 2A10A 4ELTA 3UNYA 4UOFA 3WIUA 2DGQA 3P96A 1C1BA 3O6QA 3UQSA 3HSDA 4PXBA 2FHKA 3ISZA 3Q8QB 1KD1T 2XMTA 2M3DA 4I68A 1M5VC 2VQFF 4B3MJ 2QFIA 5A76A 1Y3KA 1VI7A 3G96A 1HI1A 5I3UA 4TY8A 2Z58B 4ED8A 1S0MA 9ATCB 3TAQA 4U8YA 2E44A 5L1LA 2C2DA 3BJYA 5G0RA 4OX6A 2F8MA 2KT5A 2AEMA 4ELVA 4IOBA 5KFPA 3DYAB 4ZPTR 1GXTA 3O3LA 1IKYA 2GA7A 3JQKA 3MM8B 3W62A 2QL7B 2OGUA 1KQKA 2W4PA 3N6MA 1FKAF 1VQNS 2RUSA 3DI6B 2VD3A 4WCEQ 1AUSL 1PYTA 5I4MA 1EHWA 2YQ3A 3OTDA 2HHPA 5AJ3J 2D3OR 2ZZNA 1CC7A 4BCAA 4YFUA 2LEPA 2JVOA 3PX0A 4USVA 3F73A 4LSLB 4DXLA 3Q23A 2YTCA 5IM0A 1S1WA 2DB1A 1Y4ZB 2DY1A 2BACA 5KTQA 2LEAA 2CDQA 2CJQA 3TEGA 3K7RA 2NLWA 5H9FK 3E01A 3KLGB 4J9PA 2KTQA 1H3DA 3D6HB 4BWJA 1SKWA 2K06A 5GMKa 1NBEB 1RT3B 4O3NA 2IMWP 2FGOA 2ROEA 3SCKE 3MAAA 4CLPA 2VJUA 2HGNA 3LP2B 2MZ1A 1WEZA 4C8YA 1H72C 3FQKA 4X4TA 1X5TA 1RXOB 1VRQC 4ZA1A 4TQRA 3EGZA 1WHWA 2FJDB 2XMVA 3CCMS 1YJ9S 2HMIB 4JI1F 1WC5A 4J9RA 1RT3A 1RWUA 2AYMA 4MH8A 3H5YA 3LPEA 1TV6B 4J90A 1HQUA 2O5DA 2VFSA 3CJ8A 4NZ7A 2VPXB 1Z4UA 3SEOA 4HTJA 3JB9k 1QSLA 2UZAA 2A2CA 4J9SA 4LF2A 2VKRA 4S0MA 5EWGA 4DV2F 4CZCA 4A8MP 3PACA 4PXCA 3HVTA 4ENOA 2BW2A 2GMHA 4NCGA 2MXYA 3HMJG 2RKIB 4F04B 1FE0A 1CC8A 3HX9A 2BBEA 3V5RA 4LF9F 4NXMJ 3RAQA 1NHUA 2OPPA 3LUYA 4OI3A 3VZHA 2CA9A 1RWVB 3BF4A 4Y2AA 2VG6A 3D28A 1N5QA 5F3TA 4LF6J 1VQ6S 1T95A 3QRPA 3GR1A 2J0SD 3MR7A 1LWXA 4C11B 1QAXA 5FIIA 5AXMA 4ECWA 4ED6A 2AF6A 4DFMA 2OIHA 4DR6J 3ONQA 3U7JA 2C28A 2NQPA 1FFSB 2RHQB 2GO8A 3O8WA 4NA2A 2MQPA 2DGWA 2H5JB 2QSFA 1JLGB 3PRBA 3DKDA 3H2UB 3NGRA 2PIIA 4K5SA 3M2RA 4I6YA 3THTA 1GTEA 5HQ8A 3K58A 3J81Y 4GKKF 2YQ1A 1B3TA 1YJNS 5D4LA 4ZHRA 4JYAJ 1PSDA 2Y1LB 2JLFA 1RP5A 3R27A 2E1CA 1UFKA 4LF8F 5CCLA 1LW0A 3OR2B 1F9HA 2HVZA 1F5BA 2ZDPA 5J1PA 2ERRA 4KGVB 1NM2A 2M8DB 4OLOA 3QQCD 2QG9B 4CTAB 4O3RA 4FZVA 1SUQB 5ETLA 4BC7A 2L3MA 1R8PA 2HQIA 2W7AA 3R7SB 1EARA 3DC2A 1F5CA 1JLAA 2B56A 4GVLA 4CLTA 1HBNB 2LQJA 3TAMB 4JI5F 1TVRB 2DH8A 4NI2B 4PYDA 4C6AA 3K8VA 2D1CA 4KH1B 3TA1A 4AXIA 1ZPWX 2EBEA 3KNAA 3CO0P 4LRCA 3C14B 1D1UA 1B99A 4YEAA 2ACYA 2P9EA 3GCXP 2UVRA 3CC2S 2W2PP 5J2QB 2C22A 3W8GA 2PFDA 1FXDA 1UTAA 2ATCB 3CJQA 3M9OB 5E33A 3FKBA 1FK9B 1H74A 4OI4A 4OX7A 4PAAA 1PG5B 1PYOB 2JSXA 2Z4PA 3DMJB 2JLGA 1T03B 1RBLA 1KS2A 2PO4A 4NYOA 5J2PB 2R7QA 2Z0GA 4RUAA 1VHIA 2OUGA 3P45B 4Y2IA 2LQ5A 1UFWA 3NL0A 1RA7A 2ZC4A 1PCAA 4UZCA 4PG7A 2XCAA 2Y8WA 4QJVA 5KFGA 3L9ZA 4WIIA 4IRCA 3RB3A 2KHDA 4P2FA 5ETTA 4A4JA 4PG8A 1U25A 4K4WA 3W9IA 2Q79A 3F0NA 3DRYA 1KKHA 3ZTOA 4DL5A 2NCKL 5A2QU 1VQMS 4RW4A 5D0EA 4HHJA 1IUJA 2WONB 4Q2MA 4DU8A 2RU9A 4TKTA 2ZBRA 4YB5A 1DRZA 2BJ1A 2LYVA 2FIUA 1HIYA 2YX1A 3PHEA 4ZVHA 1SB6A 3KJVB 2RUGA 2LXUA 2P6SA 2D9OA 1DLOA 1IKWA 2YPZA 3PJWA 2B6AB 3BB5A 5B0GA 3OFGA 2VICA 1Y5IB 1F0XA 4YUDA 2UV8G 2JL9A 4ILLA 1HNVA 2QT7A 1V3RA 4F0MA 2ADCA 3FCVA 1ZM9A 1U45A 1Q8KA 2ZH9A 2L41A 4Y3CA 1T05A 3ITHB 2V4JB 4ZP9A 2J7UA 4KSEB 3FCHA 3CCTA 5DZ6A 3DRPB 4QBUA 4J91A 3PFOA 2Q66A 1KP6A 4QWDA 4K0KJ 3V81A 4FKYA 2HRUA 2ZBQA 4TXSA 4NE9C 1XQIA 2HK2A 1K47A 4JBCA 4KV8A 1W25A 2XS2A 2B7BB 2HAIA 1S5ZA 3N28A 1NJXA 1YZ6A 2B8PA 2V2QA 3WHIA 2N7YA 2GW8A 3LQVA 2V6AA 3CULA 1M5PC 1NNDA 1S48A 5IT4A 2BEFA 3LGHA 2J6SA 2J9DE 1H0HB 4AFFA 2HMIA 1C2PA 3PTWA 1J5EF 1QAJA 2MLYA 2C1EB 2HVHA 2E5JA 2QMXA 4CO3A 4WKYA 5GAEU 5AE3A 4Q2LA 4M5JA 3QAUA 4DR1F 3QO9B 3T41A 1K44A 2EFVA 5A8KB 5F8IA 3I0SB 3GFZA 4DWIA 1XEZA 1WF2A 4ES2A 1KC8T 2UP1A 1B7FA 1C1CB 4AT1B 4WZQA 4HEA9 4P2SA 4ALZA 2HHTA 1U1LA 1Y00A 2V8GA 4MYUA 2JHEA 4HLBA 3K5NA 1LFWA 4ZMMA 1AUDA 3BH7B 1HI8A 3JSBA 4WJBA 2BQUA 1RYSA 2PI5A 2XWYA 3KUEA 3LALA 3MFIA 3HVRA 1HMVA 2NR0A 3SDEB 1VGYA 1NRKA 5KT3A 1S6PA 5FD1A 4L3KA 2E7XA 1FEHA 2KYZA 1FWKA 3NNAA 1Q53A 1RT5B 1WKLA 2LMIA 2QLWA 3DI6A 3EZOA 3H5UA 1N36F 1U6BA 1FEEA 4TLRA 2B5JA 2CAJA 5LSRA 2XY5A 1F3FA 4NLDA 1FXLA 3U1NA 1FVQA 2E5LF 1WHVA 3ILIA 4Z7YA 4ED0A 2QO3A 1DFDA 3PW2A 1GX5A 3MFHA 1HR0F 3ZNUA 3H0PA 2LQ9A 3VAIA 3C16B 2E1RA 1F60B 1OYEA 2V2ZA 2V8PA 3VCDA 4FYDA 1JLQB 2PC6A 1X4EA 3FSIA 2ABYA 4DX8H 4DS5A 1YVFA 1UCNA 1BQMA 2DO4A 1EQMA 1C4AA 4RWWA 4B3TF 1GT8A 2IJFA 4H4MB 4IRDA 2IVFB 1Q5YA 1FWLA 3HKZD 3U1MA 1JLCB 3IWXA 1M1GA 1GEHA 1RT4A 3TJAA 3K5LA 2FVSA 4PWDA 2OTJS 4JI4F 2PFFB 1RDRA 4K8RA 1LWCA 2GX8A 4KR0B 4U8VA 2W7OA 4MJKA 2GHWA 4IOCQ 1RTHB 2DGXA 2C3YA 1MW7A 2R2RA 2YWWA 2MMYA 2RS8A 2ZHOA 5KFYA 1TUVA 2KU7A 1S6UA 1MN9A 1MWZA 1N5VA 4OX9F 1N0UA 2XSJB 3BSNA 1DTQB 2CPIA 2CG8A 4GVBA 3EICA 4IH5A 4IH6A 4K7QA 4XAKA 1FJEB 2FVQA 1E6YA 1UZHA 2MJUA 3BGUA 2HQ3A 3HFVA 4TN2A 3ZNJ1 3QJJA 4OYXA 3P5BP 4AXJA 1DHMA 1NZAA 5LSOA 1PILA 2ZD1A 1SUQA 2AYEA 4OHXA 4Y65A 3OVBA 1MSWD 2KXNB 1KDNA 2KZZA 1B0PA 3W5YA 2BKNA 4LR8A 3DFEA 4P6QA 2AJ1A 2VFUA 2I5JA 2J0WA 4RW9B 3DRRB 4C8NA 4QPXA 3DLGA 4FN5A 4M5IA 3W63A 1HBMB 1PO6A 4JV5F 2GAHC 2G2ZA 2M70A 2GCFA 2GFFA 2YNHA 2DJWA 3Q89A 4CLKA 3S01A 4CRJA 5DDPC 5HP1B 3RRHA 3EPGA 2GQQA 1E6VA 2Y8YA 4ZVEA 2FDNA 4Z2XA 4X4RA 2ZBPA 1UPPA 1RU2A 3M8SA 3CIMA 4R25A 1LEOA 2BYCA 1Q78A 3IBWA 3LGMA 3DXBA 2EFPA 3MWBA 4M5DA 4CNYA 2XI2A 3PDNA 1FNXH 3BGFA 3MZIA 5KFDA 1FE4A 2AYBA 1R8CA 3N0VA 2GMLA 3ELHA 1S12A 4DV0J 1NU4A 4KH0B 2BKPA 2CZ4A 2X1GA 2H5IB 4PR6A 5E3CA 1HI0P 1FESA 3UPFA 3IRXA 3KLHA 4FS2A 4P7VA 4PEOA 2CPEA 1R8HA 1YRXA 4Y00A 1U1NA 2WBMA 5HO4A 3OHBA 2N4CA 2OSQA 1I94J 1WEYA 3AA9A 1ICEB 3UDVA 1NUEA 1RT7A 3ZXWA 1S4EA 3GG0A 1M0SA 1UMJA 2GVZA 3KWMA 5JUMA 3G6ES 3UD4P 1A7GE 2OSRA 3MPWA 3I96A 1AA1B 3K5PA 1SQGA 3OTEA 2V67A 4ZVQB 1E6VB 2V5HG 4RX6A 3ZTSA 4FBTA 2DT9A 1RT2A 3DXSX 4CH7A 1RKIA 1NPPA 5F8HA 3UN2A 3GR0A 1T11A 2IJRA 3AOCA 4QR2A 3JTPA 2UXDF 1SL1A 2IM2A 2G13A 2N3LA 2HHSA 5J1EB 5AXLA 3FSXA 3PRDA 3BKUA 2P8IA 1KQGB 2ZZTA 2N3OA 1RAAB 2IDLA 3CD5A 3L09A 2R7OA 2MZTA 3W2WB 2IY5B 4C2MA 1UZDA 3M32B 5HBMA 2U1AA 3E01B 1YJWS 4DV4F 3RW6A 1JNRB 4LJMA 1NO8A 3TVZA 1X5SA 2BXJA 1S1WB 2GJ2A 2KVQE 3UCGA 2CPJA 3K89A 3QT7A 1RT6B 3LGNA 4LRFA 5E3AA 4QIWD 4YB1P 3I55S 4X4OA 4P73A 2F1FA 2FD2A 3QMQA 1C4CA 1LKZA 5F9NA 1UVLA 3TUJC 2OFGX 4XO0A 1I94F 3QRQA 3C6TB 2V34A 4IG0A 4ETXA 2CUYA 2DNGA 2DYAA 3QGHA 4J9QA 4KGXB 4UTGA 1RSCA 2LVWA 3SQOP 3OJUA 5CHCB 2KT3A 4ETZA 3M8YA 1OIAA 2M5YA 2YH0A 3CD0A 1C0TA 3I4PA 4RKUC 2OPRB 1CSJA 2BE2B 3D3CJ 4F4ZA 1VQ8S 1TU0B 4Z37A 1TL1B 2F8HA 3AD8C 1S1XB 4FF4A 1RE1B 4UQTA 1UVNA 2OTLS 1MMDA 3QPIA 4B3OB 4QPTA 2FHJD 3BKFA 1FCAA 1F9EB 1VRUA 3FBFA 1ZH5A 1IWAA 2KDOA 1NEEA 3ZZOA 1RLDA 5D4NA 1W2BR 5HK4A 1RTDA 4LFBJ 4AE5A 1NDKA 5K20B 5F8LA 4HI1A 1Z2LA 1DAXA 1RT5A 1V5VA 3MXHP 2VG6B 2YWHA 4BLGA 2FHMA 3MD1A 3WC0A 3OSNA 4RNFA 4DFPA 4PPDA 3TW0A 1U47A 4PUOA 3PNIA 1N33J 1F2GA 1SJQA 1HNXF 1GNKA 3FBBA 4KTQA 1X5OA 1WTFA 1JJHA 2ZH5A 2W9CA 4KKOA 1H7WA 2EVZA 3T9ZA 3P8BB 2XWXA 3CT9A 1Q82T 3A4TA 3R1HA 1VIXA 1YX2A 2NYHA 1VC0A 3OJSA 1CPZA 3T3FA 3RB4A 1HWIA 2CJBA 3AOAA 3L7OA 2ZOFA 4KFBA 5D4OA 3TX8A 5ADZA 4K0KF 2PD1A 3CJKB 4DL4A 5HMYA 5F8NA 1ACMB 3MMBB 4QIGA 2UUBJ 1O0PA 4RLEA 3MPYA 3JYTA 3C2PA 2F63A 4C98A 1R31A 2JVRA 3EZ5A 3PEJA 4EGLA 4WYLA 4DV5J 4C8LA 4LT6A 5KFOA 2I0XA 3IA0A 2K1RB 3UW1A 4E98A 2Q3PA 3ISNC 1W7WA 4O4GA 1D8ZA 2KJWA 1C0UA 1X4GA 2FHJA 4U96A 5LXYA 2KM8C 1FERA 2J6TA 2XO6A 4YB6A 1HYSA 1LW0B 2YY3A 3OFHA 1Y11A 2Z2MA 5D4PA 4FXVA 3IO1A 4ZDNA 5B0CA 4YY3F 4DL3A 1S7IA 1NK5A 2V63A 3H5SA 4M5LA 2E1PA 2A2DA 2M0GB 3BSAA 3MF5A 4DSEA 2B9YA 5K14A 1TQLA 1R43A 4EEYA 3RRGA 1U1MA 3MM9A 5B0FA 4K4YA 3CCJS 3HSJA 1XMBA 1NKCA 5DO2A 4WE1B 3N9UC 3T1AA 2QGFB 4RO0A 2YKPA 4ZPCA 4DN9A 3KK2A 1LV5A 1EETB 3EXYA 5L9NA 4HL9A 3BO2A 3HVAA 3VGSA 1RBAA 4UW2A 1HNZF 1JXVA 4UUWA 2XGQA 3BO4A 1D9DA 2MKJA 1BHNA 2ZE2B 8RUCA 2VUGA 3MEDA 4EWTA 2WZ1A 4NASA 4HTIA 4H4KA 4AL7A 4B3RJ 4FPRA 2HGLA 4TVAB 2V4RA 1X8DA 2ZUAA 1YJUA 3LP0A 2XZTB 5E0OA 2Y0BB 2HHQA 3MEEB 4DL6A 1GXUA 2HWIA 1NSKL 2F5GA 2JC1A 1YSJA 1KHWA 1JLFB 1KLNA 4GO5X 3BDEA 1D09B 4N77A 1ZA1B 5KFEA 2OELA 3BREA 4O3SA 4OZNA 4V19J 4F3MA 2RU3A 3UVJA 1QVGR 5F3ZA 3V6HA 1QTNB 2H5EA 5LMUF 1B4SA 1N54B 1JMTA 1TELA 2WOMA 1FRLA 1NH8A 3NEKA 1RACB 2H4YB 1RUSA 5DZ7A 2N82B 3J7YI 1BXNA 3Q2TC 4CT9A 3IBCB 5H9EK 4A8OA 2CNOB 4F2RA 3WBZA 3AFGA 3KHHA 2GMJA 5GAEI 5IS2A 2BE9B 1NKBA 1BY9A 3SQGA 4CO5A 4X4SA 3GIIA 1U48A 4C48A 1D9FA 2MKIA 3CJ0A 2I5JB 3GWCA 1QUPA 1HFEL 4MFBA 3A8EA 1CEZA 4GC6A 4F3QA 3CPWR 5H9FJ 2HNYB 4MYTA 2LEBA 1VBZA 4A47A 4WK1A 2BW7A 1RAIB 4DR5F 5CA5A 4USTA 4NLWA 3SMZA 4DF4A 3I5CA 4QZVB 1RAOA 4ZJLA 4C0BA 4XPCA 4QWAA 1UPMB 3VTIA 4DR7J 1T9XA 1VQ5S 4TU7A 2W9BA 1JX4A 5EN1A 4MFBB 1KLMA 2P5VA 3G8TA 4RU9A 1TK0A 3GFXA 2XLJA 2W2OP 1YZ7A 4F25A 4O3OA 4DQQA 4LBIA 1JLAB 4LF5F 1Q0NA 2NSCA 3PJ9A 4M63A 5KFJA 4O4RA 2IBOA 3NMRA 5G4DA 1VMBA 2HSEB 2LECA 5LL6d 3R9LA 1Q1KA 4CTAA 5GVQA 2IRYA 3KNGA 3NBPB 2DO0A 3HSZA 1KQSR 3P49B 4DBQA 1DQ8A 5E7OB 5HAOA 3PIPQ 1UL3A 2HHHJ 3PW5A 4ZPDA 2VPWB 4LBPA 3UO0A 4ED2A 2W2QP 4ZLPA 3MM6A 3QT5A 5I3UB 3FCWA 3OTBA 3RYLA 1FI4A 1WF1A 3GYGA 5SZTA 5L1KA 1LXNA 1DARA 4ZLNA 2DEJA 2OHDA 1C0TB 2W24A 5ETMA 3TJ9A 4FF1A 2ZKUA 3RGIA 3BBCA 4DV5F 1VK8A 1U0HA 2X1BA 1B7YB 2CPFA 4J7CA 3PYDA 3FRZA 4W92B 2PA8D 1JK9B 3PHTA 4NEZA 3JAMY 4KGMA 4UZBA 2ASLA 1HW8A 2F40A 4ECQA 3MR6A 2KRBA 1VLOA 9RUBA 2CPXA 1X9WA 2QA2A 4DSIA 3CSKA 1TR0A 2OMLA 3ZZZA 4MMOA 1HNWJ 3ULHA 2W9BB 3BZQA 1RK8A 3H98A 3BN7A 4P72A 3MPVA 5CZXA 5ETVA 3ZZRA 1Q95G 4N41A 1YG0A 3C8YA 2VONA 1GX6A 3OD2A 2J0XA 3KUHA 2FLOA 2HIYA 2DPIA 3W3SA 3BR8A 1QLNA 4ZPWR 5LT5A 5J1EA 5F8JA 1HQEA 1HQUB 2JNJA 3V2UC 4YS2A 1XMQF 4WFZA 4X66J 2CKWA 3HZGA 4YB7A 4WFAQ 1OO0B 1PGZA 3AA8A 3PYEA 5IQ6A 5A8RB 3HHLA 1WSRA 1BQXA 2IMOA 2AJ0A 1WKJA 1HNIB 2OD4A 2QLXA 3HHEA 4KE5A 5LM7E 3IM9A 1I6JA 4JI3F 4OL8A 5A6WA 3HT0A 1H6KX 5D15A 4F3OA 1I3OB 1VBXA 1PJ7A 2KRRA 4NX9A 3R1LA 4H4OB 3SV4A 2CJKA 3FFIA 2E9TA 5JVGQ 2DTJA 3MPDA 2JFDA 4DDFA 2VG5B 4PQUA 3X1LB 1AXQA 2NXJA 3MECA 4QIEA 4CLYA 4LRAA 5IWAF 3L95X 4OYPA 3LF0A 1J27A 1NAQA 1U8SA 4NA1A 3LANA 4MTPA 5F8GA 4JI3J 1Y7PA 2IAJB 3H90A 2RQKA 5KFQA 2C42A 2POKA 3EGVA 2RIJA 3R5JB 4W4MA 2AYGA 1IKYB 1BQNB 1T9UA 3BGRB 3I5BA 1FD8A 3WX4A 1IJFB 3TWZA 5CYJA 2E29A 5KFSA 1H73A 1SJ1A 1R8BA 3OL7A 1XMQJ 2RMLA 3PZPA 3BGOP 3AHPA 3DGPA 3KLIB 1IKVB 4MK9A 3T9NA 3OLBA 3V6KA 1XC9A 1SL2A 4QCLA 1T7PA 1VJWA 5CXTA 2RVJA 2AX0A 3OR1A 4PWUA 2NUHA 2CQGA 1SPBP 3DCAA 4OYWA 3E51A 5K5MA 5U47A 3EVWA 2DNKA 4F26A 1R7IA 5KOWA 2XYGB 4C8OA 2ZZMA 3M8PA 3NGSA 1U1KA 2QN6B 4M94A 2A0FB 1VLYA 3QGIA 4CLUA 1HD1A 5AT1B 1C0UB 2CJYB 3IG1B 4C8ZA 2HQCA 1TV6A 2KFNA 4HKQA 1VQ4S 4DSFA 1XNRF 4FYWB 3QZ8A 2ZC3A 2QSWA 4N8OA 1FRHA 2RQCA 1O51A 2X1AA 1V3SA 3MR5A 3QNWB 6FDRA 4A8FA 2K1RA 1FJ7A 3MGJA 4DPTA 1O8BA 1QE1B 1S9FA 1Q5VA 3A1YG 3B78A 5KG7A 5DDOC 4CH1A 2UUWA 3ENAA 1RT2B 1VC6A 4DSLA 3IC1A 1KTQA 1NDPA 1VS3A 2CQIA 1NLKL 3BKTA 3BR9A 2HRTA 3JYTB 1S6QB 3B4DA 3ILLA 4USKA 5I42B 4B3SJ 1BC6A 1JWWA 4DSJA 2GVZB 4V1Ak 4X66F 4Y0FA 4ERDA 1WOPA 2RRAA 1SC6A 1WKKA 3KJNB 2G9OA 3D5MA 5KFNA 1D3WA 1UJ6A 4PXDA 5LJ3Y 3T1YF 1B0VA 4I69A 1RT4B 2CVIA 4RL1A 2XMKA 3W5XA 2F3JA 3MEGB 1APSA 2J7WA 3ZC4A 3W5ZA 2CG4A 3HCXA 3RR7A 4KY3A 1BQMB 2RE1A 2R2TA 1NPRA 2QC3A 3EZUA 1RYRA 1MMLA 1LFPA 4DR6F 2JEJA 2AW0A 1EKRA 2LDYA 2YNFB 2ZE2A 3QIPB 1OY6A 4WIQA 3M1VA 2FJEB 3R5AA 1N34J 1BWEA 4LREA 3AODA 2G1DA 2KVIA 1Q8LA 4DX5A 1CS4B 3M4XA 2Y1JA 5KT6A 3TARA 4LIWA 2M8HA 2CNLB 2VV5A 2HS3A 2OI2A 1VQPS 4EO8A 4ZHRB 2G0IA 3HKWA 4IR1A 4IR9A 2HFSA 3K57A 3CJSA 1RCOB 4E0DA 3K17A 2DNZA 1JLGA 4HT5A 3HHKA 4ECYA 3KTQA 5C5JA 3U27A 1S1XA 3Q86A 1RHJB 3CW2C 3KKFA 3TUIC 3WZ0A 1FRKA 1CLFA 4USIA 4X64J 2CNKB 3MAHA 3D54A 3R5CA 3SZ2A 3DOKB 4KC5A 1OPIA 2E5IA 2FJXA 2F4VJ 3W64A 2R2UA 3OVAA 2D9PA 1WWHA 3DOLA 2K2PA 3TA0A 4J5OA 1NH7A 4OJGA 5KFKA 3MMJA 1Q4RA 2DNHA 3QWUA 1FKPA 2DHGA 2O67A 1GK8A 3CD7A 3GU0A 2V94A 2V2VA 3D67A 3UD5A 4YR2A 3N5FA 1R0BG 3ILOA 1NSAA 1NDCA 4JI0F 2HYIB 4K4SA 3W9HA 1TKDA 2R7TA 2XG8A 2ALZA 5C42A 4TU8A 3IM8A 2FLLA 4RWXA 4OI0A 2DK2A 1HA1A 1RHUB 2C2ZB 1WC6A 1H2UX 2GAGC 1EJ7L 1JKHA 2CNNB 2G1HA 3G82B 4KKOB 3KJQB 3RUBL 1KR4A 2YKAA 4USMA 4YY3J 2APOA 2HVIA 1ROFA 4NLPA 4Q0BB 2DNLA 2OEMA 5KFXA 2BJ7A 3D0GE 5T41A 2Z2YB 3QATA 5RUBA 1F2HA 1KSPA 3CE8A 3DHXA 4MIWA 5L38A 4RW7A 4NLQA 2CPDA 2QLFB 2VDHA 1YJ7A 1RT1A 2WCXA 1PAUB 1XK8A 1YKWA 2OEKA 3SSSA 3OQ2A 4RPFA 2KN4A 1Y10A 3DOKA 2YNGA 2FUG9 4RUHA 3CJ5A 4PPZA 4ZIWA 3KLGA 2KFYA 1RJJA 2DH9A 3K8WA 4N8NA 2HFZA 3FRYA 4ICLA 1G1XA 2L08A 1JLCA 4J37A 2DNYA 2K7KA 3UDEA 2B0GA 5C2CA 2CFXA 1Q7YT 4LQ3A 5CH7B 4V19X 2OPRA 3EGNA 2DHHA 3GYNA 3SFUA 4YHHF 4DFKA 4C8KA 4F4AA 1T9TA 2WHOA 4B08A 1NB7A 3ILJA 5HATA 3W8PA 2UVUA 3FZBA 1HWJA 7FD1A 1JLEA 5KFMA 4OYOA 3RTVA 2D74B 1IN0A 1G7CB 2F65A 3N6NA 4IRKA 3BM7A 3H2LA 2CZ9A 4RW7B 1FFWB 4NZ0A 4EYHB 4ANCA 2AGOA 4NCBA 3DYAA 3M8QB 2W2NP 2HZVA 1RT1B 2ZOMA 4ED7A 3CJ3A 3SBMA 2QA4S 3HI9A 3MD3A 3WX8A 2HVEA 2VG7B 4ZVUB 4ED5A 5ITHA 4A8KA 1WELA 3DLEB 3KUGA 1ZZNA 1VISA 4G65A 1UEVA 2BE2A 3G8SA 2AKWB 3GFHA 2XB2D 2ALYB 5ETPA 2VJVA 1TKTA 1H38A 4Q0BA 5HLFB 5M2RA 1NB2A 1HQEB 1SQEA 2EG2A 2GHVC 4KIAA 1LWEA 2RS2A 3VAKA 1S72S 1HBOA 2RQMA 3DRRA 3ADAC 2UUCJ 2CZVC 2Z2ZA 3AH6A 4DCOB 4DV7J 2MYFA 3QT8A 4WTYA 2ZD1B 3M6XA 4DPWA 4X4QA 4WXOA 4DV0F 4NEYA 3RBXA 1R3NA 2XYPB 3GMGA 4ZPVR 3RW7A 5CCMA 2H9ZA 1U1RA 1ZYQA 2IYIA 4AD6A 1P8GA 2MHEA 3TI0A 3QIDA 1LWFA 1YDLA 2XSJA 4CDIA 3Q8YA 3TAMA 1CULB 1GMUA 3H5XA 1JB0C 1E6YB 4NPOA 4OIXA 5KFBA 4N5SA 1VJQA 2OPSB 2YVSA 5HL7Q 1WORA 1R0AA 2IVMA 1ULRA 2QV6A 2XULA 4URSA 3K59A 4YR0A 2HZAA 4Y6IA 4JUZA 1KFSA 3BDPA 4LSNB 1D9AA 1WOOA 1RWXB 3CCSS 3HFZB 1X7VA 2QTWA 2C2NA 3NGDA 1S7HA 2ROPA 3CTRA 2J9CA 4M5HA 4YDXA 3S7RA 3KK1A 3TQEA 3IN5A 1RWPB 2YWFA 2UXCJ 2EEYA 2FQQB 3TZYA 3PW0A 3Q8RB 2BJDA 4I7FA 5IT0A 3CC7S 2M4MA 1IBKF 1LQ9A 1RAEB 4I6WA 1LNQA 3FBEA 1WOSA 3UWTA 2HGMA 3D1QA 3C16A 3UDCA 3CB4A 4A8YA 4KB7A 2AT1B 3T6BA 3D1HA 2AJFE 2HIQA 2BM1A 4DLEA 3BGRA 3GPAA 3D0HE 5KT5A 1A6LA 2HHWA 1FDNA 1OPZA 2D7SA 1WF0A 5E2QA 3SXLA 3OUYA 3JSMB 2UUBF 4I7FB 2R8JA 1S9GA 2QA4G 2UXCF 3K0JA 4PCQA 4JI4J 1UAWA 2MZQA 3Q24A 3K2YA 1N48A 5E3PA 4MIBA 2CWKA 2PE8A 3MUMP 2HLUA 2R7WA 3CDEA 2MKYA 3A8IA 3FMBA 3FMWA 4O3PA 3IR5B 4BHQA 7AT1B 1W2IA 1U09A 3CCQS 2DXDA 1S10A 1BD6A 4Y28C 3OL9A 1Q8BA 3I9ZA 2KXFA 3AB4B 2EFGA 4C3KA 1UJ5A 3T5KA
chains in the Genus database with same CATH topology
4ECXA 2GQ2A 2IBKA 1NK0A 2FC9A 2K8GA 1QE1A 4WFYA 2VASA 3DN9A 5HP1A 2ZBIA 3DHWC 2W4DA 2RT3A 3NWGA 5DGBA 1QVFR 3KHLA 3NKYA 2BDPA 3ENQA 4FF3A 4OQJA 5EWFA 3OL8A 5F41A 2DNOA 3C6UA 3VAGA 1N8RT 4DUYF 2IVYA 1RI7A 4HDGA 3M8RA 4KV8B 2KKHA 2LLZA 3IS9B 3WDOA 4I64A 2YKQA 3MEEA 2C2RA 2DIVA 2HNDA 5IM0B 3HLUA 4L3NA 4NYPA 3I0RA 1GTHA 3CCRS 1S49A 3H8YA 2L9WA 4A8XA 1TKXB 3G6YA 1S0VA 4IFVA 3IR7B 4MAKA 2KO1A 3NCPA 2ZJRQ 3H20A 1DZ5A 4IR1A 3OXGA 2YH1A 1HW9A 4R0EA 4G1PA 3MM8A 3VF0B 3DLBA 1G2EA 1VRTA 3POTA 4IYQA 1HWLA 4X4NA 2LA4A 2O1PA 2V9WA 4RW4B 3PFEA 1GAOA 1SJRA 3BN4A 2YNGB 4R0JA 2VG5A 3HHLD 2ILZA 4Q5VA 2ZBCA 4M5DB 2E5GA 4MIAA 1N0VC 4H4OA 4WFNQ 5DM6Q 2NREA 3CIZA 4J9KA 4IFYB 2RSQA 1FHTA 3PY8A 2V9KA 2KG0A 2FVRA 1XBWA 2LKZA 2DR7A 5LXRA 5A8RA 1TFWA 5JVHQ 1FK9A 2D3UA 5DGAA 2VH7A 2GIQA 4C4WA 1JJ2R 1HMVB 3TNVA 4FS1A 5AE1A 2HNZA 5H9EJ 2MQNA 4KFBB 3VAFA 2BRKA 1QUVA 1YRUA 2LU2A 4KHPF 4Y2CA 1NKEA 3W2VB 2OPSA 2AD9A 1M5OC 2N4DA 2RDJA 1HBUB 2ZH7A 3PJXA 2W8LA 1UA0A 1L3TA 3TVKA 2PDAA 1NK4A 5KFFA 4JI7F 2Q6CA 5CZVA 3ENWA 5A8WA 3OR2A 2OPQA 2ILYA 2ROGA 2YWGA 3FEXB 1VC0A 1FDBA 4I56A 4DLGA 3LAMA 4PWDB 2RJZA 1NHVA 2HLTA 2YNIB 1YGYA 4H4MA 3MUVP 6FD1A 2EK6A 1XR5A 3M05A 2DR5A 3G8QA 5HI7A 2XEXA 2B4PA 3OR1B 4ECRA 3PV8A 2MZRA 4F8RA 4FVCA 2FLNA 1U2FA 1M1KT 1TAUA 1IKXB 3TP2A 2J9DA 1R6YA 3DLKB 5E3RA 2CQ2A 2A1BA 2FLPA 3UFCX 3LP0B 3D1OA 3SFGA 3VQSA 2DNNA 2ZHAA 1MWYA 1KHVA 2PMHA 3O44A 3UE2A 2B5JB 2W25A 4UUXA 3QIPA 2Y1IA 5A8WB 3Q2SC 1TP7A 5AXKA 2B4VA 4CO2A 4NXNF 2FTRA 4ZVFA 3DMJA 1T03A 2MQOA 4CQ1A 2MQLA 4PKDB 1UW4A 3THPA 4BS2A 3T5HA 1N4LA 4PG5A 2RF2A 5F0UA 1CVJA 4ICLB 4ECTA 4URQU 3MMCA 1SJ3P 1RTJA 3G71S 4ECVA 3CMES 3FZ2A 3GE9A 3FVYA 2KI2A 3I87A 5LSOA 2DBBA 1U6ZA 5T7LA 3KMQA 3FFIB 3CDWA 1Q79A 2HHVA 2YNIA 4GO7X 1NJWA 3RAXA 4DV6F 2M52A 1SL0A 4LVOP 3I4HX 1WHYA 4R5PB 1S97A 3CD6S 4WU3A 4WKRA 3DU5A 3J7A1 3LP2A 2FPHX 3SSRA 4KO0A 1SI9A 4KPYA 2YKMB 4TU9A 3GIJA 5DQGA 4QR0A 1RTJB 4KAIA 2MY8A 3MM7B 4OX8A 4RW6A 2C3MA 2EFNA 5LJ5Y 3UI3A 3CJ2A 5CYMB 4ZCLA 2KHCA 3Q22A 2HHHF 4QU6A 1FRMA 2VPZB 3MM5A 4MK8A 4ZK7M 1N5YA 4B9NA 4KHMA 2KFZA 3K5MA 4ZCIA 2Z2LA 2C3PA 1XN9A 1KQFB 3KHGA 1ZZFA 2WK4A 1EETA 2X1FA 1Q16B 2EG1A 3EXCX 2OPPB 3AQOA 4IFYA 1UVMA 3RZAA 1R27B 3GV5B 2I2YA 4PRFA 4NLOA 2WB1D 2OFHX 2QZ8A 1QAYA 4OJ3A 2SXLA 2VFRA 1KONA 5DQIA 4B3OA 1V3ZA 3MM6B 3MEKA 2GC8A 3S1TA 1N6QB 5K8PA 2QYCA 3BSOA 1P27B 1HYSB 1UWBA 1U1PA 1HNWF 2MY7A 3GIMA 1TKZB 4UY8T 2I1RA 5J1NA 5GADU 4IG3B 2K7JA 5A2QY 3CUNA 3B8HA 2VPYB 3ICLA 4OZ5A 4F50A 2J0QD 2BUNA 5F8MA 4ZS6A 5JJBA 3OV7A 1VQOS 1XNQF 4F2SA 1N5YB 4ELUA 3H59A 3F41A 1JJ4A 4RBUA 3NMAA 4NYZA 2XS7A 1DTQA 2UVVA 3MHYA 2IM3A 1H7XA 1S4FA 2HZCA 4WFXA 1U1QA 1SJFA 2R7UA 5BR8F 1FNMA 3G4SS 4AUKA 2HNYA 3L3CA 4IQMA 2ZDOA 4KO0B 3O5TB 4I6AA 4RUCA 5BJRA 1T8EA 1SH3A 3KHRA 2V8DA 4MK7A 2EW9A 2LA6A 1N33F 2DH7A 2PMZD 3OFFA 2XMJA 4Q45A 2VFVA 1Y5LB 3BGLA 2VFTA 3NS5A 2XLKA 1JLQA 2WSFC 4E8UA 5EUHA 1WG4A 2Z8QA 1DJ0A 1SV5A 2WB4A 4DL0C 1M5SA 3OTOF 3DDKA 3PM9A 5KG0A 2XZWA 5L8RC 4L6V3 3D0IE 4EUVA 3M8QA 2F8EX 4FVMA 4BC9A 4EBEA 3UNGC 2HFOA 3MMAA 3PR4A 2XO7A 2GJIA 3M8PB 3RU0A 2F9DA 2JWNA 3KK3A 4URGA 4YOEA 5EX3A 3MR3A 3IRXB 2UV8A 3UDLA 5IZHA 2MDAA 2DRBA 4IO1A 2NZ4A 2Y0SD 4ID8A 2EFQA 3JTNA 5KT2A 2AX1A 3KG1A 4QU7A 1BLUA 2BANA 2XSFA 4QYZJ 4C11A 1ZAWA 4ATNA 3CXCR 5KAKA 4NRUA 1S77D 4LMZA 1P1TA 3MEDB 3H4BA 2L9NA 3LPYA 2CYYA 2AGPA 1RAJA 1NK6A 4IFVB 2FJWA 3BQ2A 4DQIA 4O44B 2C3OA 4ZP8A 4ZPAA 4DR4F 4NCGB 3QO9A 2RRNA 2IHR1 1JLBB 5K9FA 2Y1RI 4H54A 3VZIA 1KNZA 4U7CA 4G1IA 3VWSA 1UVKA 4X4PA 2JDJA 2EI5A 3GILA 2OD6A 3CMAS 1HBMA 5CYQB 3P3DA 1REVB 4CI0B 4EYIB 5D6GA 2BZ2A 4EBCA 2DGTA 1F5AA 1ZAXA 3VR1A 3DU6A 3RBDA 5T14A 2HHUA 3SQGB 4RNOA 1U24A 4RW8A 3T1HF 5DG7A 2DHXA 1T3OA 1VQSA 1SIWB 3LOUA 1IXKA 1S76D 2YX4A 4O44A 5GADI 1XERA 5GAGI 4QWEA 3DRPA 4X64F 1N5TA 4KBIA 1MROB 3CDAA 3QJPA 1SJ4P 3EX7B 5J2NB 3CJKA 1DURA 2B9WA 3M30B 3LWLA 4W90B 1JLFA 4LFCF 5HMWA 4Q7AA 4NWBA 3NAHA 3H2VE 1X0FA 2MB0B 4K5RA 4WFBQ 3V4IB 3UCZP 1L3SA 2M9KA 3QYYA 1TKTB 4IOAQ 3R3TA 2PEHA 1S9EB 1CQNA 3I32A 2FB0A 2R8IA 3CF5Q 4DR3F 5D3GB 3N5BA 2UU9F 1RTDB 5GAHU 1MU2B 3TR5A 1JNZB 1TKXA 4NLXA 2ASYA 4DL7A 3I0RB 5KT7A 2OKQA 4OHVA 3DLKA 2DR8A 4NRTA 3EYZA 2HNDB 2MJNA 3QAEA 4B9SA 4NCAA 1SXLA 2B43A 5B7WA 2B3TB 3AJ1A 1QSSA 1KFDA 3N79A 4C3MA 1O5JA 5DG9A 3DLGB 3NBPA 4LSNA 5AXNA 2ZUGA 2OO4A 3ISND 3OSPA 2VA3A 3VAMA 5C42B 3FEYB 1U4BA 1U7LA 4CH0S 4XPEA 4OZJA 1K73T 4RNMA 2D41A 4USJC 1X4HA 4HH0A 3HXMA 2BABA 5LMNF 4A8SA 5J2NA 4WXWA 4AQYF 1TVRA 3EPIA 2R7RA 4ITSA 4C0HA 3CGIA 4DPOA 3MMBA 2LXIA 1YTYA 3M2UA 1U49A 4I4BA 3VAJA 2R8KA 1XWLA 1VHFA 1ZTTA 3N01A 2KG1A 4QW8A 3QZ7A 1SH2A 1QY7A 1H2TZ 1ZTWA 2F9JA 4A46A 5DLFA 2VBYA 2WSCC 1FXRA 3U02A 1LW2A