5CABA

Structure of leishmania nucleoside diphostate kinase mutant del5-cterm
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
139
structure length
139
Chain Sequence
MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title The role of the C-terminus and Kpn loop in the quaternary structure stability of nucleoside diphosphate kinase from Leishmania parasites.
pubmed doi rcsb
source organism Leishmania major
total genus 41
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 5cabA00
2DXEA 4DZ6A 3NGTA 3Q86A 1LWXA 3ZTRA 1EHWA 3EICA 3PJ9A 2HVDA 3EVWA 3NGRA 1WKJA 4KPCA 1S5ZA 1ZS6A 2AZ1A 4DI6A 3ZTQA 3ZTSA 1S59A 3FBEA 3FBBA 4EK2A 4HR2A 3EJMA 3ETMA 1BHNA 1XIQA 4UOFA 3VGTA 4S0MA 4F36A 1S57A 3FBCA 3EVOA 1WKKA 2DYAA 3EVMA 3BH6B 1XQIA 1F3FA 4WBFA 2NCKL 2CWKA 3B6BA 3BBFA 4ANEA 3FCVA 1LEOA 1WKLA 3ZTOA 5CAAA 1B99A 3ENAA 1VYAA 1MN7A 1NDLA 4ENOA 1BUXA 4C6AA 4CP5A 4FKYA 3L7UA 1PKUA 2B8QA 3EE3A 2BX6A 3GPAA 3NGUA 2DY9A 3EMTA 1HHQA 5CABA 2AZ3A 2B8PA 1MN9A 3ZTPA 4ANCA 3BBBA 3Q89A 3Q8UA 1NDKA 3FC9A 3VVUA 3EM1A 1NSKL 2BEFA 1U8WA 3ELHA 1NDCA 1HLWA 1W7WA 3NGSA 1NLKL 1JXVA 3VGUA 3VVTA 3R9LA 2DXFA 5C7PA 3DDIA 3Q83A 3VGVA 3FCWA 3G2XA 5BXIA 1NPKA 2HVEA 1UCNA 3Q8VA 4W98A 1NHKL 1BE4A 1NDPA 3MPDA 1NCLA 1NSQA 1NUEA 3FKBA 1K44A 3B54A 3BBCA 1B4SA 3WX8A 1NSPA 3FBFA 3Q8YA 1PAEX 1F6TA 4UOGA 2DXDA 4DUTA 4FKXA 3GP9A 2VU5A 3DKDA 4ANDA 4UOHA 5IOLA 1HIYA 4F4AA 3BH7B 4O0NA 1NB2A 3PRVA 2ZUAA 1KDNA 3JS9A 2HURA 3VGSA
chains in the Genus database with same CATH superfamily
1U0HB 2PMWA 4P75A 3HP6A 2D3O1 1UW4A 4DV4J 1J27A 1JXLA 4P52A 3Q2TC 2B7CB 4WZQA 4DR7J 4GC7A 2GJFA 1HD1A 3LALA 2QLXA 3LPYA 2XMWA 1CVJA 2WVDA 4NMLA 3OJSA 3K59A 2COLA 2QN6B 2MDAA 4JI0F 3GJRB 4DJBA 2FJWA 4XDCA 2G0JA 4LRAA 4QIEA 3ET6B 5F9LA 3A3PB 3H0PA 2B9EA 1Y7PA 1NSKL 3UR3C 1RHRB 2CDQA 4HHUA 4D3HA 1T3NA 2Q3PA 4F4WA 3BYRA 2BRKA 2LXFA 2OMOA 3GFXA 2HS0A 3H20A 3IRXA 4AL7A 5D4PA 5EWEA 2CQGA 2HVEA 4FF2A 2V68A 2V50A 4NLVA 2VG5B 3OL6A 4WFZA 2H54B 3L95X 1I51B 2YX4A 3POTA 4N8OA 1JLEB 2QSWA 1LW2B 1IWGA 4PG6A 3BGFA 3KLEB 4I6AA 4DQSA 4M5HA 2G2ZA 2HURA 1DQ9A 1LWXA 4RBTA 3MEGB 2RDDA 2HNDA 3ZTSA 2FHKA 3GLJA 1JIHA 5C25B 1DLOA 4N7TA 2QLBB 8ATCB 2UXDF 1FKOA 2HQCA 3GR0A 3W64A 3OFHA 5DG8A 3EVMA 5KT3A 2JVOA 1NMEB 2RDJA 2KXFA 1KNZA 2KVQE 2AGQA 1TAQA 4JV5J 5EGYA 3OW2R 3J81j 4B9TA 1X0PA 1PCAA 1C0TB 5F8IA 1UEVA 5LJ3Y 1WC4A 5KFJA 2R8HA 1I6JA 2E5LJ 3KKFA 1GMVA 3P96A 4URSA 4NCGA 2WW8A 1FRJA 3IBFB 1YJNS 1KEKA 1RYSA 2XMMA 4EI2A 1ZPVA 2DD8S 1WC5A 2VBWA 2KYZA 1B70B 4Y65A 1IVZA 1FEEA 4X64F 3IBCB 1HI8A 1V9OA 3A4TA 2DNZA 4B9VA 3JSMA 2G0CA 3V6KA 1P27B 1EKRA 1FI4A 1OIAA 3BS9A 2YH1A 1C1CB 4MYTA 2XMKA 2YKNA 2HGMA 4RU9A 4DZDA 4ELVA 4C4WA 1KS2A 1TL7A 1RWXB 2RIJA 2FB0A 1WTFA 4DV4F 4OI1A 2E7XA 4C6AA 4P7TA 3Q2SC 2CZ4A 5T7LA 1YRXA 4OJHA 3KK3A 4ZVFA 2YKMA 2KJVA 3HFKA 1I94J 3BSNA 3ZC4A 5A8KB 4NLWA 1RT5A 5BR8F 2B6AA 1RHMB 4CRJA 5L1LA 2WAQD 1TVRB 3QT6A 1N0VC 1K8AT 2DHGA 5G0RB 3IN5A 3D1OA 4RW7A 2C2KB 1NDPA 1VQYA 3G86A 3PHTA 4ZPBA 3FKBA 3RZAA 3JQJA 2QA4G 3Q8YA 3IWNC 5E3RA 4RW8B 2K2PA 3QMQA 4WFYA 3TRGA 1JLAA 1WORA 3MAQA 1H2VZ 2DIUA 5IT9U 3E8OA 3SDEB 1NKEA 4UUXA 1Y5NB 3VGSA 3BQ0A 4MT1A 1LFWA 2CPDA 5F0UA 2W9BB 1YHQS 4CTAA 5DZ6A 2RRBA 5D6GA 1LV5A 2OTLS 4M5LA 5L38A 2MPUA 1WKKA 1SH0A 5SUHA 1F2HA 3DN9A 3N4WA 3CULA 1IKXB 2N82B 3E2EA 2B9YA 3AXMA 5F0WA 3DRSA 2ACYA 1AROP 1N52B 1N88A 1RLDA 2KYXA 2KFZA 1X31C 2CNOB 4WP9A 4JV5F 3TUZC 3KK1B 2DNYA 3SCKE 1NK8A 3SI8A 1T03B 3TZXA 1FTRA 3I55S 1IR0A 2LKZA 2RDIA 3QZ8A 1B64A 1XMQF 3MR6A 3MCMA 4HTIA 4YQWA 3Q24A 2E5LF 1EQ0A 2VU5A 3WIVA 1QY7A 3CMAS 3H25A 3LGHA 4MMOA 4KO0B 4DR4J 5H1SV 2PT0A 1N33J 3I4HX 2R2TA 2XG8A 3EDRB 1HI0P 2R2RA 4DQQA 1B0TA 1X5TA 1IUJA 3OL9A 4CZCA 1HNWJ 3SQGB 2QGFB 3WQPA 4HHJA 3R8YA 4QR0A 3NCPA 3U27A 2OSQA 3M6VA 2KN4A 5KFDA 4U67Q 2C3MA 2QIFA 1WHXA 2YKAA 1YRTA 4B9LA 2E5HA 3UN5A 3J80Y 3BM7A 2ZZNA 3VZHA 4CLTA 3OTDA 4ZCIA 2W4CA 3KLIA 3KXDA 3BGUA 1S1VA 5EX3A 2V8DA 3MMJA 1QAJA 1SQGA 2BANB 4XO0A 3CD0A 4URGA 3D1QA 3DOLA 3M4XA 3TJ9A 3M8WA 1Y4ZB 1DFDA 1R0CB 5F8NA 2F8MA 2E5GA 4YUDA 3T41A 3CJRA 2W2QP 1JLQA 3I0RB 4KTQA 4B3TF 3UN2A 4CO1A 4FF4A 3BREA 2KFNA 5E5NA 4B3RF 1TKXB 1CSJA 1SKRA 2DISA 4WP8A 1QTNB 2HG4A 3UCZP 6FD1A 2GHWA 3DOKA 2CXEA 4J5OA 1JNRB 2QL5B 4WU2A 3OVBA 3GJSB 1WG5A 3CSKA 4PQUA 3IWXA 5KFHA 2JNJA 4DR3J 5ETSA 3FRZA 2DB1A 1RWKB 1H6KX 1JLCB 2EBGA 4TQSA 4BS2A 2LVWA 4G6VB 3DFEA 4N5SA 4LBPA 2GAHC 1PJ6A 2YNIA 1ZZFA 4LFCJ 2VPYB 2HW3A 4X4SA 5D8HB 3D2WA 2QTWA 2X51A 4QW8A 1VRTB 2JEFA 3FNNA 2QMUB 1FVQA 1HARA 1KQGB 4UY85 2ZOFA 5B0EA 4F0HA 4YMEA 2PN6A 2J0QD 2ZWPA 2ADCA 3KLFA 2DXEA 3EICA 1K47A 2LQ9A 2GGPB 1KOHA 4L3NA 1QE1B 2EEYA 4OI0A 2HHHJ 5L1IA 1QUVA 1IBLJ 3J81Y 4ZVSB 3TEHB 1D1UA 3QJJA 5CAAA 2M0GB 4GMKA 4NRUA 1K1SA 4ZHRB 2EFVA 4PPZA 1SCJB 4X4RA 1DTQA 4Y2CA 2E1AA 1FRHA 3PW0A 1U2FA 2J8AA 3HFVA 1N34J 2DRBA 3VQSA 1HNVA 1IBMJ 2V9WA 4ZIVA 3HULA 4IOAQ 4OX7A 2NXEA 1GXUA 1YBTA 3Q83A 4HI1A 2J7UA 3U1NA 1RTHA 4C3LA 1QVGR 5KFVA 2PEHA 1MROB 2NXNA 1KONA 3D6MB 4G1IA 1VQNS 2UVWA 3AJ2A 4F4ZA 2P8IA 1QSLA 4HDGA 5A8WA 4Y3CA 4J9OA 3FCHA 3SSRA 3BH7B 5KFTA 1HR0F 2FLLA 3NWRA 5D4LA 1JMTA 3W2VA 4O0IA 5GAEI 2HZCA 1JX4A 2GC8A 2FGCA 1LNQA 1GEHA 3HKZD 2HK3A 4WFBQ 3BBFA 3B6BA 1CJVB 4WWSA 2HBQB 4PUOA 2IRUA 1MMDA 1AFJA 2QJ3A 4IFYB 2HFSA 3G82B 2B8PA 4OL8A 1DARA 4PAAA 3CPWR 3FQKA 1Q95G 2XWYA 1SQFA 4GKKF 4I2QA 3GG0A 4USKA 3BPSP 1LOUA 3GMGA 4CNZA 1OJ4A 4CLSA 1NAQA 1UW9A 1U1PA 3KK2B 1KTVA 2ASJA 3DKDA 4F04B 5F8LA 3PNIA 5HO4A 2GQCA 3AA9A 2XGPA 4CYUA 5KFIA 4OZ3A 3P4UB 1G7CB 1CG2A 1WJ9A 1VBXA 3UNYA 2WVFA 4DUZJ 5HP1A 1S97A 3D5MA 4ED1A 3K89A 3MUVP 4RW4A 2Q6BA 1RP5A 5EHHA 1FHTA 2RRNA 1S9GA 3ZNJ1 5A76A 4DV0F 1X9SA 4CT9A 2R7XA 3OSNA 1B99A 2F40A 1VS3A 3ZXWA 3W2WB 4C8OA 3C15B 1HNZJ 4TU9A 2D7SA 1RAIB 2MLZA 1IBLF 1MU2A 4HHHA 2ZHOA 3N6NA 3MFIA 2WVCA 2BQ3A 3L7OA 3A8JA 5FLXY 2A0FB 2XHCA 4HL9A 2AEJA 1UVKA 2FY1A 2WBRA 2HNYA 4ILRA 3V4MA 3RRKA 3GJTB 3DLKA 5HI7A 2DGSA 1CJTB 1X4AA 1B7FA 2VPWB 2IHR1 2WVEA 4MKYA 4PYDA 2AHOB 3A12A 2UUBJ 2DRAA 5KFBA 4F4KA 1NZAA 1RT6A 4OX8A 2VBZA 4DX8H 2DR8A 2HSEB 4HLBA 4U7UD 1XK8A 3OR2B 3FBCA 3OTEA 2O67A 3LPEA 3CT9A 3N6MA 3WDOA 2CQ4A 4ZP7A 5LXRA 1RJJA 1Q8LA 4QZVB 4WFXA 1M0SA 2NS1B 2FHOB 2CJ9A 4IUFA 3MEDA 3AD9C 1M5SA 3R27A 1VQMS 4NI2A 2DR9A 2XSFA 3ILLA 4EYHB 4ECSA 3DNCA 3KJFB 3VGVA 1D09B 2DGTA 1MG7A 2XB2D 3OR1B 1PSDA 4RL1A 1NH8A 4PXBA 1RWOB 3UN3A 3MTJA 1TTHB 5AT1B 4TN2A 4LF6J 3BKTA 2AIRB 4IH6A 3T5LA 2XI3A 3M8SA 1QSYA 3NAHA 1YZ7A 2B7BB 2OEKA 3OD2A 3TUJC 1WF1A 3ENQA 3POTB 5I3UA 3QGHA 4QWDA 2F4VJ 1ELOA 3IR7B 4DV6J 4LRBA 2R4FA 4DUZF 1VYAA 2LQJA 2HNDB 1UVNA 3VAIA 1Y0HA 1HA1A 1DLOB 2HYIB 4WYWA 1FKOB 5E3QA 1S1UA 1OPZA 4ANCA 1UWAA 3Q89A 1FXRA 2CQPA 1U1OA 1K0VA 2G1DA 3AOCA 2MZRA 3CC7S 3TX0A 3MM5A 1F0XA 4P10A 3I32A 2M88A 4ZK7M 1U25A 5CXTA 2HGNA 2DXDA 4NCGB 2RILA 4DFPA 2NUHA 1RHUB 2BV3A 2AX1A 3CB4A 3SFUA 4IOBA 4ITSA 1N4LA 3OLBA 2CZ9A 5AE2A 3UI3A 2AJ1A 1EETA 3JSMB 3OHAA 2NXCA 1FEHA 3C8YA 3PRDA 1TFWA 1QAXA 4WBFA 2UUBF 1L3UA 1UL3A 2ALYB 4DR6F 5IM0A 2DRDA 3BSAA 3QATA 2IBKA 1FDBA 2FJBB 1NHVA 1ZBTA 2HQ3A 2ZHAA 2PMHA 3O8WA 3LF0A 4NLQA 1K0TA 2BKNA 3WC2A 3GTYX 1IBCB 1XBWA 5T7LB 1R89A 1S12A 1H7WA 1NHUA 3RUBL 3T5HA 4NL5A 2YKMB 3PKYA 3MURP 2RQMA 3CDWA 2GFFA 3PR5B 1F3VA 2C2EA 4KAIA 2B6AB 4LMZA 4PG8A 1U47A 1H3DA 1SL2A 3PY8A 3ZZOA 3ITHA 2ZBCA 4DV3J 4RW7B 1FNMA 1LKZA 5DRKA 3KLVA 3OFGA 2XMJA 2A18A 4EWTA 4KPCA 4KFBA 2Y1RI 4WZMA 2XYGB 2CQCA 1JLAB 5D0GA 1XIQA 1N5SA 4UOFA 1XTZA 3MI7X 1FA0A 3KOAA 2L48A 2Z8QA 2QX0A 3BN4A 3TYTA 3AAWB 4CTAB 1K9MT 4K4UA 3OVSA 3DRPA 4MH8A 3BGOP 4LQ9A 1NK0A 1BLUA 5CABA 1KP6A 4NEYA 4WFNQ 1E6VA 1IBKJ 5CYMA 2XLJA 3MZIA 4DF4A 1M5PC 4DL6A 1ZZNA 4RUAA 4LBIA 1Q1KA 2C2MB 2JZ5A 3R6LB 5BXIA 2RHSB 2VJUA 2IMWP 1VIXA 4XK8C 1PC4A 2VDIA 4CCHA 4X62J 1JLGA 2GNKA 2HIYA 3EXYA 3GCWP 2B3TB 2XZTB 2FHMA 1RDRA 2NZ4A 1Q5VA 3TW0A 4A8FA 3H5YA 4NWBA 4QIWD 3EVWA 1JLBA 3W9JA 4F7VA 2CVEA 5CCMA 1VC0A 1H73A 2DR5A 1FO1A 2KZZA 4UTGA 3HX9A 3RR8A 3OFFA 4NA1A 3ZZPA 4EZ9A 1EKSA 1TKDA 4OI4A 4RWXA 2HFOA 1B0PA 4NPOA 1JJ2R 4ECQA 2BACA 5A2QY 4F3MA 1AA1B 2R2UA 3LGMA 3PVXA 2CPHA 4C8YA 2J76E 1YZ6A 3A1YG 2C2DA 5LSLA 3UWTA 2HPUA 5KFSA 5I3PA 2J0WA 2CNNB 2G2YA 3ETOA 1KLNA 3PO4A 2AW0A 4Q44A 2AYMA 4WJBA 4ZCKA 3VWSA 5F8JA 3KLIB 3QGGA 1HBOA 2A2CA 1VJQA 3CUNA 3NGKA 2U1AA 2VZ9A 4DSLA 1VHIA 1V3SA 1KRPA 2GMLA 3D67A 2LU2A 3MMCA 1KDNA 2L41A 4D3GA 5KT7A 3LWLA 2XZDB 3T1YJ 1F5CA 3H4DA 1L3KA 4I0WA 3DOLB 4YY3J 3K5LA 2MLXA 4M5KA 4B9UA 2MTLA 2ASDA 2MB0B 4DV3F 5GAGU 1KC8T 1JXEA 2Y1LB 1VBYA 3LUYA 4I6WA 3QYYA 2ILYA 4ZPVR 1XR7A 1JLQB 1RBOB 2KG1A 3R7BB 2CQ0A 1AUDA 1RTZA 1RBLA 1U09A 1PKUA 3D28A 2BJ8A 2V69A 2UXBF 3BBBA 3HM9A 2BEFA 3I87A 3TP2A 3DOKB 2VG7A 2VV5A 3MPUB 2IA0A 1S1TA 4X4TA 4X4NA 3MM9B 1O0PA 4PQUB 3M6UA 1IKVA 2QL9B 4A8OA 3LP2A 3THVA 3RR7A 1DAXA 1F5BA 3PJWA 2RJZA 4DEZA 1DRZA 4KHPJ 1YK9A 2O5DA 2IBOA 4K8RA 4QR2A 2AQ4A 2OO4A 3M2RB 1TZ0A 1ZH5A 3MEKA 4NYPA 1Q7LB 1JJCB 2XY5A 4KGKA 2DNKA 5JMNA 1XEZA 4RLEA 2CIMA 4X62F 3PJXA 3VAMA 4Z2XA 2MQQA 2ZH4A 1CJUA 2ZVIA 3M2VA 3CCVS 2KKHA 2H3EB 3EZ5A 2XS2A 3BDEA 2NCKL 2XHWA 4HDHA 2DY1A 2HLUA 3TJAA 3M2UA 3Q22A 3ILIA 1RE1B 2MMYA 3IC1A 3PYFA 1T9YA 2R8GA 2B4OA 5DJBA 4DV2F 2KL8A 3MWBA 2ZH6A 1DTQB 1QJHA 2DXFA 1IJEB 4LFBJ 4JB8B 1FE0A 5D77A 3IFEA 5ETLA 1NUEA 3M8QA 3X3UA 1HNVB 1B0VA 1TV6A 4OI3A 1JQGA 1RTHB 3HVAA 3DDNA 2FZGB 3V6HA 4BDPA 3S8SA 1T05A 2B4PA 2EC0A 5LM7E 1ZAXA 4TQRA 2QV6A 1R8CA 3I0SA 3V2UC 1PYSB 1N5QA 3CIMA 4ZOSA 3W2VB 3RBEA 1HYSB 2Y9HA 3UD5A 4CLZA 2YNGB 1RWUA 4YY3F 3U1MA 3UVJA 2J7KA 3GPAA 4DV7J 4P74A 2B9XA 3DMJA 2VD3A 5J2MA 2OPRA 2X1GA 3VQTA 1YSJA 2VQFF 3OFEA 1GK8A 1P9YA 5CYQA 3M05A 3TO8A 4RNFA 4DX6A 3HLUA 2AJFE 1CJKA 1I3OB 2JFKA 4A8MP 1OPIA 2Z2LA 3RRHA 3KMQA 3FVYA 1N36J 4I2QB 4PXCA 1NNDA 3CJ8A 2OPPA 2HEKA 1J5OA 2EG1A 5IQ6A 2UVRA 2RU9A 4QPXA 2IC3A 5HROA 3PM9A 4U8VA 3GYXB 3NOCA 1S1WB 2L08A 3IXQA 4N56A 4QWBA 3UDCA 2MGZA 2BQRA 3VZIA 3TAQA 3J7YU 2BJ1A 2K7KA 1GMUA 1DZ5A 4FVMA 4KBIA 3PW5A 2AWZA 3L7PA 2LU1A 1SIWB 4B9SA 4RW4B 2K1RA 1N8RT 2GVDA 4OYMA 2KM8C 5LMNJ 2Y1JA 4WP3A 3AB2B 3SCJE 2Z0GA 1A7GE 2ZVSA 1FTCA 3K0JA 4CO4A 3G87A 2PO4A 2OIHA 1LWCA 2OLWA 2QO3A 5DQHA 1Q4RA 2JFDA 3MR5A 1XNQJ 3K5OA 3HDSA 3FBFA 4X65J 2LXIA 4YDDB 1Q8KA 1CQNA 1PGZA 4M94A 5E41A 4HYKA 2B56A 1JNZB 2JDJA 4G1PA 3D68A 4OX9J 1SIZA 2KM8B 4DFJA 2BJ7A 5J1NA 2HNYB 3DLKB 3J80U 3LGNA 3W62A 4FF3A 3CCUS 1FRMA 4OYXA 3CJKA 5DG9A 4DUYJ 3TR5A 2KXHA 3LTOA 2VG5A 1IQZA 3N6LA 3W5ZA 1QVFR 1LEOA 4DPYA 3VAKA 1RT6B 4NA2A 5J2QB 1H38A 3HFZB 1JLEA 2LECA 1LW2A 1P8GA 3DLBA 3HD2A 2P2CB 1S79A 3GB0A 2FUG9 3FMBA 3EM1A 5GAGI 2WSEC 5BJRA 4TY8A 1M1HA 2Z56B 2XYHB 1ZM3A 5KG4A 4N41A 1NLKL 3AOBA 2IJRA 3HSDA 4U9RA 2ZD1B 1CULA 5C25A 6FDRA 4RO0A 4ECRA 4DV7F 2NLWA 4EGLA 3MD3A 4PEOA 4M1KA 2N7YA 4CNYA 2RF2A 3D3BJ 2HS4A 3MEDB 1D8YA 2V4RA 1S7HA 4IRKA 4NI2B 3VV2B 4TYBA 3E01A 4DR5F 3DGVA 3T1HF 1PC5A 1VQOS 2FD2A 1HWKA 2UV8G 3TVYA 4OYPA 3KG1A 3OSPA 1YDLA 3SIPB 1YJTA 3ETMA 2Q43A 1TK8A 1F3FA 4NYOA 4A8QA 1VK8A 4FBUA 3S6EA 5I3UB 2V9KA 3OHBA 4AD6A 2AJ2A 2Z58B 3UDEA 3HVWA 1O6XA 4K59A 5IXUA 3OLAA 1VC5A 2JX2A 2AU0A 1O5JA 3M8YA 4DR1J 4E0DA 1B7YB 1URNA 1U02A 2UU9J 3ELHA 4LF4F 3BKFA 3LAKA 1KBRA 3IG1A 3DI6A 2AV5A 3GYNA 4OX6A 4OYZA 4NXMF 2BJ9A 2C2RA 1S0NA 1S1UB 3D1HA 2YBVA 4NLUA 2R8JA 1HPZB 3GFHA 4JI8J 1SBRA 2IDEA 4RW9A 5LMNF 4FPRA 2AYEA 3QGIA 1HHTP 3J81U 1HNXF 4AQYJ 5IOLA 2YQ3A 3MM5B 4G1QA 3FGVA 4Q5VA 3WZ0A 5HN0A 3CMES 1H98A 1RYRA 3AFGA 5A8KA 2XNRA 2HBRB 2OTJS 4UUWA 2MQOA 4LF7J 4O3RA 3CJSA 1QM9A 5K8PA 2ZJRQ 5AXNA 2DK2A 4I1TA 4OX9F 5G0RA 1RBAA 3EVOA 5H9EJ 5D0RA 4NZ0A 2W7OA 3EYZA 3K8VA 1MWYA 2DGWA 2OELA 2R9LA 2AX0A 3UCGA 4DUYF 1HFEL 1OY9A 4Y34A 3HZEA 5T14A 3T5KA 2FC8A 1WNEA 1Y10A 1D9DA 2FGOA 4IH7A 3TVZA 4EBEA 1YIJS 2W9BA 2RQCA 3BV8A 4W90B 2DGXA 1NPKA 2OFGX 4EO6A 1NSQA 1J5EJ 1YJRA 2KT3A 3RGIA 3U7JA 1M5KC 1T11A 3P5BP 2MSTA 4DLGA 3HPOA 3HHLB 4QIVA 4J9RA 3TARA 2WBMA 1VCTA 4LF2A 4ZVOB 3LQVA 2Y0BB 1RAAB 4J9QA 3ZZYA 3KK1A 1KVIA 1ZM2A 4CLYA 1VQ4S 3FMWA 3ITHB 2I0XA 4OYWA 2MXYA 1YGYA 2CQ3A 5LMUF 2OP5A 1RWMB 2DYAA 3R5AA 2W7PA 4RBVA 4PQAA 2W2PP 3NGDA 3SSSA 1FJGF 2KRRA 4KFBB 1CLFA 2FYXA 2XY7A 2N7CA 5CZXA 5CD4H 1X5OA 4DL5A 4YR0A 1RTIB 1NK4A 2CFXA 3JTPA 3K2YA 3J7YI 4ECZA 2GZOA 3AODA 3RAMA 2DNMA 5HSPA 3NNCA 1EB0A 3DRPB 4C8NA 1MNEA 4O23A 2K3IA 4W98A 1E6VB 5CYMB 2UU9F 1SKUB 2ZM6J 2XMTA 5K8NA 2J7WA 3N01A 3C6UA 1AUSL 1WDDA 5HVHA 2QYGA 2EG2A 1JLGB 2M3DA 2CJAA 1SKWA 3GQCA 2L9DA 3RB4A 4RJVA 5FLXU 2K3KA 1D9FA 2PEBA 1JLBB 1HQUB 2UXCJ 2ZJPQ 1E6YA 2X7IA 3TEGA 8AT1B 2DO0A 2ZOMA 3UDLA 2E66A 3H2LA 1TMMA 4YOEA 4DOZA 3I0RA 1NO8A 1YBUA 3KFWX 2MHNA 2YQ1A 3HI9A 2E7WA 2BW2A 2IYGA 1SC6A 4FYVB 3N79A 3ZZTA 1S4FA 2IM3A 5L8RC 3V4IA 3I5BA 4FN5A 3UCUP 1HKAA 4ZVRB 1RLCL 2RAQA 2XMUA 2J9DE 1UVIA 2V5HG 4RU2A 2XULA 2Q6CA 1FWKA 5ETPA 1LW0A 5FIIA 4KYZA 4Q7AA 4LUBA 1JLCA 4E2FB 1HBOB 4LSLA 2BQUA 1U6ZA 2CG4A 1UTAA 4JI1J 4W92B 1EQMA 3QFHA 1FXDA 4TKTA 3FEZA 2PIIA 3QZ7A 4P2XA 3PYEA 3IA0A 3DXSX 5ETTA 1VRTA 2MQ8A 2MY8A 3R3TA 1U24A 2V0NA 3VALA 5IC6B 2BE9B 1YQHA 2QMXA 1HQ2A 4YHHF 3ADAC 4DL4A 2IIHA 5J1PA 4A4JA 3NGSA 1S6QA 2JEGA 2YWKA 2FVRA 5DM7Q 4FYDA 3KYLA 3JB9k 2KZMA 5KG6A 1NSPA 3KHGA 3BF4A 2VG7B 1SQEA 4F25A 1XMOJ 1SV5A 4E98A 4ZHRA 3ZZRA 1S1TB 2Z4PA 1IKVB 4K4TA 4I69A 3LP2B 4N77A 1T9UA 1ZYQA 3LP1A 4IRCA 5BYQA 5D78A 2JHEA 4HH1A 2E9RX 3RBXA 3OJUA 2DGOA 2Y3YA 1WDTA 1EZZB 3DU6A 2B4UA 4NLTA 4USIA 1M5HA 2RU3A 3M6WA 3NEKA 3D6FB 1YWXA 4MIAA 4U6PA 1KFDA 3C2PA 3KUGA 3P6YC 1WOOA 3KMSA 3M2VB 1U7LA 1H0HB 1FWLA 3W7BA 2IM0A 2V8HA 3V5RA 5H9FJ 1Y11A 1NH7A 4WXOA 2W01A 4CLUA 2JC0A 2M52A 1HLWA 2VFVA 4ZCLA 2FHJA 1FT8A 2YH0A 3GIJA 4X66F 4ZS6A 2HZAA 3EDQB 3NS5A 1YTYA 4PR6A 3FSXA 2XI2A 3QWPA 3GJQB 4JI5J 3G82A 4PYAA 3M8QB 2E7VA 3AB4B 4RNHA 3QAUA 2EKYA 1RSCA 3O1LA 2HVDA 4MK7A 2RKIB 3V6DB 1TV6B 1ZPWX 5HMZA 4X4OA 2ZEJA 4PCQA 3FFIB 3HT3A 4OZJA 3KHLA 1UFWA 1G4CA 1RACB 1T05B 2WSFC 1UJ5A 4DHVA 3I0SB 2C2ZB 2CPFA 5E0OA 4FKYA 5IS2A 4AXIA 4JI7J 4IG0B 4DV1J 2XY6A 4JI1F 1QD1A 3Q0AA 3BR8A 2OPSB 1GX5A 3G71S 1LWFB 4F50A 1W26A 4H4KA 3MHYA 4DX5A 1R0BG 4P2SA 1NJYA 2F8HA 2IDLA 1X0FA 2Y0SD 3DMJB 3BB5A 5J2MB 2OPRB 3CIZA 2DGQA 2ROGA 3HMJG 2ZUGA 2GIQA 3NMAA 2M9KA 5CYQB 2Z2YB 3TUIC 3W2WA 2GIRA 3HHKA 3PFOA 1KN6A 1N0UA 1CJKB 4ILLA 3GFZA 3FZ2A 1X4DA 3FUYA 2B0GA 1U0SA 4NE9C 4UY8T 5HJYA 2Z2MA 1S0VA 5KFFA 4RUBA 5F8HA 2UUCJ 4JBCA 1J5OB 3I4PA 1RT1A 4F36A 4F3QA 5ETQA 4DPOA 1X9MA 3FSIA 2NSCA 4FVCA 4A8KA 4J7CA 2M7SA 1RKIA 1UVMA 3R5BA 3OV7A 5G4DA 1FRXA 3DRXA 1R6YA 3P5TL 2MZJA 1URRA 4O3QA 4QJVA 3C16A 3OXFA 2BW7A 2JOQA 4B3MF 2CJYB 4QQBA 4ZVPB 3IRWP 2QE5A 4C9DA 3DDIA 1Q8IA 2GVDB 3CC4S 2CPYA 2L3MA 1KWMA 3JSYA 1XR5A 4OZ5A 4B3SJ 1PAEX 3MAHA 2IJFA 1CC7A 2OUGA 1DJ0A 2OEJA 3T5JA 2FVPA 4QWAA 1KFSA 1NK5A 1LWCB 4NCBA 5A2QU 4PG4A 2DH9A 3US5A 4P2MA 2R7OA 2Y8WA 3R5CA 4ZN3A 3BZQA 4J9KA 1JK9B 2F4FA 2HMIB 4MK9A 2AZ1A 2RUGA 2FHJD 2AEMA 4ED5A 4J9NA 2BBEA 1G1XA 4GVBA 3W1YC 1FK9A 3LP0A 4MFBA 2CQHA 4J9UE 5KFYA 3QJPA 1GTHA 2E9TA 2DHAA 3OR1A 2ATCB 2RNEA 1WSVA 2XS5A 1VBKA 5KFQA 2CVIA 2DGVA 1Q16B 3CJKB 3NWGA 1XNRJ 3CNQP 4NLXA 1PIEA 4WF9Q 1NDKA 4ZJLA 1S0MA 1OSDA 1DY3A 3VHQA 3PX6A 2R8IA 4KH0B 3NP5A 4PWDB 3W9HA 3D0IE 2QA1A 2ZOGA 2BM0A 4O44A 4TY8B 4WFAQ 4OZ0A 1FD8A 5F8MA 3ZZ0A 4C7QA 3KLGA 4R5PB 1CULB 3Q23A 1VR6A 3I5CA 1NKCA 2DEIA 3CDEA 3THPA 1D3WA 2CJBA 2ZNYA 2R7TA 2RF2B 3ZO7A 4BWMA 4FS2A 3N5FA 1IXKA 3PYDA 4IO9Q 1R43A 2NSBA 5GADU 1T9TA 5HVFA 2LDYA 1K73T 3E01B 5I4MA 2AMCB 2L9WA 4HT7A 3NRBA 3JXOA 2V34A 4Q0BA 4KGZB 3M9OB 5D0EA 2HHUA 5J2PA 3L4BC 4USVA 1NK7A 4AL6A 4BLGA 2BX6A 2VG6A 4LF9J 2ATLA 2D69A 2VF3A 4LF8J 1SJQA 2WB1D 2P5VA 4AE5A 4GKJJ 4OV6A 3EPIA 2V63A 3W60A 2YPYA 5EUHA 3J7AN 2JLEA 4DS5A 3M32A 1UCNA 4KGXB 2J9EA 2JLFA 4PRFA 4NLPA 4LF5F 2ZJQQ 3IG1B 3DI6B 4X2BA 3QRRA 1Q78A 1S1XB 3GG1A 1H2UX 4K7QA 5L39A 5T41A 1V5IB 2DNPA 3UFCX 4EMDA 3ZTRA 4RW9B 5KT4A 2VFUA 3CD6S 3PJ9A 4I6YA 3ZTQA 1W2IA 1S59A 2BA9A 4DR7F 4Q2LA 5KFOA 4G1QB 2KHDA 4CLWA 2W8KA 3K8WA 3GIMA 3UQSA 1AFIA 1CQMA 3D54A 1S9FA 3KHHA 4CI0B 2RQ4A 3EGZA 2LA4A 3RBZA 4DQIA 5LSRA 4KIAA 2XCPA 1HHSA 3QJLA 2RMLA 1S7IA 4F4XA 3AY0A 4KV8A 1SC1B 1CC8A 1R8HA 3JTNA 3G6YA 4OZ1A 1H7XA 1RTJB 3ISNC 2ERRA 4C11A 2VQEJ 1HL6A 3ICLA 3AJ1A 2A2DA 4QPTA 2W4DA 3GU0A 3UR0A 4P73A 3I5AA 2G9OA 2BZ2A 2IVFB 4GC6A 2CPIA 1LQ9A 1X4HA 1U1MA 1SKSA 2G0IA 4MJKA 3H40A 1U1QA 3CCMS 1NU4A 4JI3J 4DG1A 4B02A 4YFUA 4R0EA 2FVCA 2CQBA 2QFIA 4C2MA 1IM6A 1REVA 2DR7A 2EW9A 3QQCD 4ETXA 1JJHA 3UD4P 2P6SA 2VJVA 3DRRB 2E1RA 3QWUA 3H59A 4XPEA 2NREA 2LQ8A 3K58A 2H4WB 2IM1A 3CWJA 4AYBD 2ZDOA 2Q66A 2QC3A 3UW1A 3PACA 1U1RA 1HMVA 1FKPA 3I96A 2LLZA 2AP6A 4EUVA 2WTFA 4Y28C 1R6VA 3R9LA 1RHJB 5H9FK 4YB1P 2OJ3A 4NLDA 4CM2A 1QUPA 1RXOB 2V6AA 3TJ8A 4ZN1A 2RRAA 2VICA 1ITPA 2EPIA 4RBUA 3CO9A 3G9CA 5B0GA 1UPMB 4DCOB 1OY8A 1FKAF 3FEYB 1F2GA 3H5XA 1VQLS 1O51A 1FNXH 2CQIA 4I7FB 3C6UB 2NPIA 2VFSA 2MQMA 3EGVA 2MZSA 3FQLA 2VOOA 2KFYA 4JI2J 5B7WA 2YNFB 4ECXA 1RT7B 2D1CA 3UE2A 4KY3A 4RX6A 3W65A 2CYYA 2H51B 3OXLA 1UWBB 1TR0A 1FX4A 2EFQA 3PXGa 1RHQB 4H54A 1I94F 2XO7A 5K5MA 4WU3A 4UT4A 5FJ4A 2MKYA 4ERDA 1E6YB 3KLHA 4LFAJ 3R2DJ 5ETVA 2I5JA 4IKAA 4C3KA 1VFJA 4FNHA 3THTA 1C1BA 5KFUA 3B4DA 2BE2A 1PILA 1U26A 4ZPCA 2VONA 1WACA 2RE1A 2NXUA 1UJ4A 1S4EA 3V4IB 4CM0A 1HNIB 3G6ES 3MCSA 1SC3B 2O1PA 1SJ4P 3KNAA 2IRXA 2VPZB 3MM9A 4B3OA 2LEBA 1LW0B 4JV2A 2HRTA 4JI3F 4AUKA 4I64A 1MWZA 4QIFA 4ZVQB 2ZZTA 4F26A 4TY9A 3ENAA 4LSLB 2X1BA 2CQDA 3M2RA 3QIPA 3A13A 4ZIWA 1GX6A 3SZ2A 5GADI 3DLEA 1MN9A 4JI6J 3VTIA 5I3QA 4MAKA 2DPIA 3PIOQ 3DYAA 1JXVA 5K8OA 3WBZA 3PEHA 1D9AA 5JVHQ 3DU5A 4FS1A 4TXSA 4K5SA 1F5AA 1S6QB 2BKPA 4YDXA 4CLFA 5IFMA 5D4NA 1Y3JA 2DCUB 4DR4F 3R5JB 1RU2A 3X1LB 2FZKB 1N33F 2AJQA 3FZBA 5KFKA 2V8GA 2XTJP 2YKQA 2YVSA 1UAWA 2GVZA 3NBPA 2GJ2A 1SPBP 1SV5B 1O8BA 4JYAJ 2A6OA 1HBUA 2Y1IA 1HNWF 5DS7A 4O3PA 5AXMA 4UW2A 4ALZA 1ZM9A 1N56A 1VOMA 4I68A 4IRDA 2PA3A 4FXDA 4RWWA 3LP1B 2AGOA 2I9SA 1WI6A 2B8QA 3EMTA 2X1AA 5U47A 4EFAC 3BDPA 4IR9A 1VQ6S 3OVAA 4JI2F 1FWPA 1S76D 1TMJA 2YXLA 1XJWB 2DIVA 4MKBA 2XYPB 4LSZB 1U1NA 5DETA 2VHGA 1HWIA 2IRYA 2ROPA 3AQOA 2J6UA 2GO9A 1JWWA 1RAFB 1HYSA 3WX8A 1VRUB 4DSFA 1OYDA 1Q81T 1TAUA 2OEMA 5B09A 4DUTA 2YNGA 4Y2AA 2A10A 5F3ZA 4J9SA 3TQ1A 4V19X 4UQGA 2X3DA 3KDOA 1YITS 5GVQA 3CVKA 3NGTA 4RW6A 1EHWA 3H5SA 1CS4A 2CWXA 2GIFA 2CPEA 4FZVA 2D41A 4BHQA 1VK3A 4C8MA 2PMZD 3MPWA 3U02A 2J0SD 1N5YB 1WC0A 4C8KA 2XWXA 4Y00A 2LQBA 3GIIA 2VH7A 1KHVA 4H4KC 2MJUA 2P6TA 4DR3F 1QTMA 3IM8A 1ACMB 1S1WA 3O44A 3TZZA 3KTQA 2D3UA 3G96A 1F9EB 2RS8A 1S6PB 3W5XA 4Y0FA 1RCOB 3HKWA 2GQQA 1PBAA 1F60B 4ELUA 2DCLA 4CO0A 4LFCF 4JI6F 3OXGA 2KH9A 5MLCV 2GJIA 3B8HA 3CCTA 1EX8A 2R7RA 8RUCA 1VJWA 5J2NA 2BRLA 2BABA 1HW9A 3I31A 4X4VA 3NS6A 4I56A 3BO3A 4ZVGA 2W24A 2IA6A 4USHA 2DNLA 2ZHBA 2HWIA 2ZKUA 3D0GE 1JJ4A 1C4AA 3RYLA 4A8SA 3DM2B 2H1YA 3OPKA 2HHHF 3PW2A 1JB0C 4DFMA 3CTRA 1XQIA 2W7AA 1Y00A 1XN9A 4V1Ak 1WEXA 4MKVA 2B43A 1NJZA 3DHWC 2XCAA 4K4ZA 4ICLA 1HWJA 4ED4A 1RT1B 3M8RA 3C3LA 4G65A 1N34F 2FJAB 1L5UA 5GMKa 4OV1A 3V81B 3B82A 3IGVA 1IBMF 4OLOA 4KE5A 2HHSA 4CIOA 3VVTA 3GSIA 2J5AA 3RAXA 2JWNA 3Q8VA 3Q8QB 3CJ2A 3JQMA 1NSAA 2XBPA 3C16B 5J2QA 1D8ZA 5CHCB 4O4RA 3ONQA 2F63A 1ZOTA 1XC9A 4FP9A 5CCLA 1K1QA 4DQRA 3J7Z5 4M8LA 1SJ3P 2H48B 2FVQA 2R3VA 2RHQB 2MYFA 2ZD1A 4JI4J 2IY5B 3MR3A 3NAIA 2HS3A 1NK6A 3ZNUA 3C66A 2UXDJ 4OZNA 2P9EA 3C14A 4KPYA 5KG3A 3LA0A 4ZP9A 2U2FA 4DSIA 4TU8A 1C0UA 4GVBB 1FK9B 3LP0B 4DU7A 4MFBB 2HFZA 2IVMA 4ES2A 1WI8A 2F1FA 4NMXA 1LFPA 1U6BA 3H8YA 2WHOA 1S9EA 3SEOA 2V94A 1U1LA 1KTQA 2E1CA 4YB7A 3ILJA 3OBIA 1GFWB 5KFMA 4DSKA 3HCXA 1Y5LB 3GIKA 2EFPA 2ZH1A 3T1AA 4X64J 3FJ2A 2MZ1A 1L3SA 4B08A 3HSGA 4AFFA 1X7VA 4C0BA 2OFHX 4PG5A 1SVDA 2BDPA 2O01C 2ZWOA 4O44B 3F44A 2VUGA 3KLGB 3M30B 3NOGA 1Q5YA 1APSA 5HATA 5L9XA 1HPZA 3BSCA 4ED2A 2F3JA 2H65B 4JV0A 3R5DA 3HK2A 2RB7A 1Y3KA 3MCNA 2DBBA 1U2CA 1A9NB 2UV8A 2WVBA 1HNZF 3NGUA 1KLMA 3QAEA 1YLXA 2C1EB 4UZCA 3RW6A 1Q8BA 4Q0BB 2D74B 2C3PA 2PE8A 2JLGA 1Y5IB 1NDCA 5J2PB 2JSXA 4DR2J 5BR8J 1XWLA 2ZH7A 3MXHP 5HQ8A 3VGUA 3OUYB 2VG6B 4L72B 1X60A 3CCLS 3TI0A 3ZZZA 5DDOC 2CUYA 2HWTA 1N32J 2F8EX 2EK6A 5CH7B 1WHYA 3H98A 2CADA 1PJ5A 1FFGB 3O2IA 2OKQA 1BD6A 1TK0A 1LWEA 2A3JA 4K0KJ 2W1BA 3AD8C 3O5TB 5JVGQ 3ILOA 3M32B 4IQMA 1LK5A 2HNZA 4N76A 2DJWA 3PZPA 2R7WA 1WHWA 5L1JA 1U6FA 3HJVA 1S99A 2WSCC 1S72S 1X5SA 2DITA 3A8EA 3GILA 1DTTB 4G3IA 2R8KA 2FC9A 4ZCMA 2V8VA 1S6UA 1IM4A 1EAYC 1GMWA 2K7JA 4B9MA 4JI4F 1WSRA 3HHLA 3QFWA 4DCPB 2HK2A 1WC3A 3IS9B 1FFWB 1T02A 2DNGA 2YKPA 5KFAA 1U8WA 4ZLJA 2HHQA 2CG8A 3AOAA 2F5GA 1RAHB 5AXLA 3W9IA 1HQEB 2WONB 3CW2C 2IVYA 5CA5A 1U2RA 5DLFA 1VIOA 4EYIB 1W25A 1PJ7A 4KV8B 2ASLA 3NNHA 4CDIA 1XMQJ 1ZAVA 2FTRA 4IDKA 1WTBA 4DL3A 2NYIA 2RQKA 2BMBA 2BE7D 1BQXA 2IFXA 5C42A 1T9VA 2N4CA 2K06A 1TL4A 2HBYB 2ZDPA 3W63A 4C11B 3MUMP 3A3NB 2V67A 1WELA 2HFUA 2BR0A 1FJCA 1NB2A 5KG2A 4LF6F 4P71A 4Y2IA 4A48A 1RTIA 3W8GA 1X5PA 4OZ2A 3NCQA 5HMXA 3CD7A 2D9PA 5A0YB 1UJ6A 3H5UA 5K9FA 3I9ZA 3UPFA 3O3LA 2JJ4D 2F4VF 2DPJA 4X4UA 4ZP8A 4RPFA 4DG1B 4ZVUB 4DV6F 4LREA 4WKRA 1YI2S 1VMBA 2AEFA 3L7UA 1WD6A 1REVB 4ZMMA 3TOQA 3DLJA 3K17A 2CNLB 4ZPAA 1VDHA 3KUHA 3Q8UA 3VVUA 1IKWB 2DNHA 1RT2A 4LVNP 3HO1A 2Q1LA 4NCAA 1OY6A 4TVAB 1RZMA 3MM6B 1V3ZA 1P1LA 4C3MA 2ZNZA 2B51A 1HMVB 3D66A 5HVGA 1FKPB 3CGIA 5EN1A 5KAKA 1HQUA 2XEXA 4DR2F 4HACB 2KI2A 4J37A 3PYGA 4NX9A 4BWJA 3N0VA 7AT1B 5GAEU 4H4MB 4OMFG 1N32F 3MEEA 2YWHA 2KRBA 2FZCB 1S5ZA 2CQ1A 4B3TJ 4FYWB 2W2MP 4K0KF 1YG0A 1FDDA 4W4MA 4B3RJ 4DPTA 3OTOJ 3M6XA 3JSBA 4PWWA 3CCES 3T19A 3MMAA 4USWA 2JVRA 2GX8A 4Q45A 1R0AB 4KJIA 5KFWA 2MJNA 2W9CA 3M1VA 2PGCA 4DSEA 1A0OB 5THWA 2HRYA 3D6TB 1FF2A 2HQIA 4JP8A 2ZH3A 2YPZA 1N6QB 2ILZA 1B3TA 1SB6A 2O3DA 4I67A 1Y9OA 3C6TB 3UNGC 1BC6A 2EBEA 1UA1A 1XMBA 4PPDA 1F6TA 4M5NA 3QT8A 1RWWB 3KLHB 1GMWD 4LIWA 1ZM4A 2XC9A 4QBUA 2I5JB 3HHLD 5HJXA 4DN0A 2FJXA 1L3TA 3O6QA 5HAOA 4DPWA 3LO3A 3EXCX 1C1BB 4ID5B 2UVVA 4LR7A 4UF4A 3TNVA 1UMJA 4ZVEA 2BE2B 1RKJA 1WWHA 4DL0C 4RKUC 5KFCA 1P9QC 3KJQB 3EJMA 3W8PA 4HH0A 1VQSA 1WEYA 2I1RA 3AD7C 4K2JA 2J0XA 4C8ZA 1G3OA 7FD1A 1SJ1A 4WIQA 3CCJS 1VISA 3W66A 4B3OB 1VLYA 3H90A 5LJ5Y 3I6PA 2ZBQA 1IBKF 1GXTA 2Q79A 2N3LA 4ZVTB 3BKUA 3RW7A 3DGPA 3VAJA 5KFRA 1BQMA 3QIPB 3RJMB 2CKWA 2FLPA 3DLEB 2ALZA 3ZFVA 1NHKL 1DURA 4M5GA 4DSJA 3QNWB 2CAJA 3DYAB 1S49A 3MECA 3IGNA 1RT3A 5A8RA 5K14A 1TUVA 4F4AA 3CDAA 4OHWA 5D3GA 1VQ9S 2HGLA 2C3YA 1HR0J 1EP4B 3PKMA 4IYQA 1Z1ZA 4DZ6A 1YRUA 2ZH8A 2HQFA 9ATCB 1XR6A 2C22A 4NZ7A 2IM2A 5KFNA 1C2PA 2CJXB 1FFSB 1FRLA 3IR5B 3TANA 1U1KA 3I82A 2ASYA 3CCZA 3KNGA 1CBKA 2GVZB 3NBPB 4OYIA 2M2BA 3BQ1A 4QYRA 2AGPA 4OFZA 1HBUB 4HKQA 4DS4A 2HHPA 4Z7CA 2OH2A 1UVJA 4CLKA 4URQU 1T8EA 2JRSA 1HBMA 2FPHX 2MQPA 4ECVA 2HVHA 2RKIA 2EWHA 5DDRC 3V6DA 3OTOF 5B0BA 3P45B 3HHEA 4GKKJ 3AH6A 3T6JA 2IJNA 3FFIA 4RNMA 3A8IA 4V19J 2WCXA 3QLHA 3VAGA 3DCAA 4L3KA 2D9OA 1T3OA 2BOPA 3SCLE 2IPOB 4IG0A 1RADB 4X84A 5HK4A 3ISZA 2OPQB 4R8UB 2VA3A 1QSSA 4ZVHA 5ETKA 2OPSA 3T1YF 3CDBA 3IMQJ 3JYTB 2G1HA 5A6PA 1SUQA 4HVZA 1LWFA 4KGMA 1WOSA 4EK2A 3ENWA 4EO8A 2PSZA 1HW8A 4UQTA 5B0CA 1D0EA 4M95A 4QU7A 3T9NA 4DV0J 4RW6B 5AXKA 4Q43A 4AXJA 5HQMA 2N4DA 1CS4B 3IO1A 2LXUA 4PKDB 2W8LA 2DY9A 3MR7A 1ZTWA 2CPZA 4IO1A 3SYZA 5IC4B 1RGVA 3IBWA 2LP4A 2ZH2A 1TELA 2MY7A 2YTCA 4QWEA 1S6OA 1NZ8A 4KGVB 2XGQA 2Z57B 2AJ4A 2HHVA 1R31A 4ECWA 2E9ZA 4CQ1A 2VKZG 1AZSA 4DWIA 5D15A 3CEDA 4M5IA 1K44A 4KHPF 3BGRB 2V4QA 4YR3A 4LBHA 4MKAA 3KJVB 9RUBA 3PR4A 4PZVA 2P9GA 2EXUA 2I2YA 4B9NA 4E8UA 1G2EA 4K4SA 4F2RA 1GTEA 5F8GA 3SMZA 4RUCA 1R8PA 5J2NB 2GCFA 2K8GA 4S0MA 5IV3A 5B08A 1GQEA 4F2SA 4HEA9 1R27B 1RAJA 1RISA 2CA9A 1SH2A 2YY3A 2HHXA 3CE8A 2DH8A 1DQ8A 1TP7A 3CJQA 3EE3A 3MGJA 2HRUA 4GRSA 3GONA 5E3AA 4ZJOA 2A1BA 1RT4A 1F9FA 3N5BA 1RA7A 3BYPA 2R7SA 2HMIA 3AXKA 1IR2A 1HWLA 4ICLB 1Z2ZA 4OHXA 4LFBF 2B4VA 4QW9A 3F56A 3M8ZA 1J2VA 3JSRA 5KOXA 3OTCA 3KG4A 3BO2A 4LSNB 3HF5A 1N5TA 3PRBA 3G4SS 4IG3A 1OQ6A 4I2PB 2POKA 3OT9A 2I8EA 5C24B 2LMIA 5HLFB 5HL7Q 2I6WA 4BCAA 1YJWS 5ETMA 4N47A 4ER8A 1U4BA 4PWDA 2JC1A 1VBZA 3MTKA 4YEAA 5CZVA 2VKRA 4K4YA 4MIBA 1S77D 4HTJA 2VIHA 1FERA 4P7VA 4R5PA 2DR6A 3JQKA 1I1GA 4MIWA 2ZBPA 3I56S 1KSPA 2KJWA 3C14B 3CCWA 2XS7A 2GMJA 1WG4A 3FC9A 3JTOA 5FDLA 3WX4A 4CLPA 3SV4A 1C0UB 3DDKA 3FRYA 4USJC 1RWPB 2R2SA 3KJNB 1AW0A 2D3OR 4ECTA 2HKEA 1RQ0A 5F41A 3TA1A 3L9ZA 2JEJA 2IAJA 1BY9A 4Z37A 2CDRB 2FLNA 1S9EB 1N36F 3DLGA 2AF6A 2XLIA 2QLWA 3F73A 2ZH5A 2JL9A 1VQKS 3CJ4A 4OQJA 4UZBA 2VPXB 1YJ9S 2YWWA 3J7A1 3TQEA 3GIRA 4PWUA 4ED7A 2ZE2B 4Q2MA 2NXJA 1QLNA 3NGRA 3CJ0A 4DI6A 3SFGA 1CPZA 1PYOB 3MM8B 2LQ5A 2MKHA 3VGTA 1GXLA 3EUNA 4O4GA 2XMAA 5ITHA 4RZRA 4ES1A 2ZFHA 1MN7A 4DR6J 1VQ5S 1S1XA 4OIXA 4WK1A 5KT2A 1A6LA 3K5NA 3CCQS 2WRMA 4XTTA 1RTDA 2J6TA 3HSJA 3R1LA 3L3CA 1G6BA 3D9BA 1KLMB 2CNKB 2PFFB 3G2XA 2YKOA 4RNOA 1FCAA 3AQPA 3M9NB 3BBCA 1XNQF 4X65F 4NLSA 1VQ8S 3RRGA 3TVKA 4C8LA 4QCLA 2CRLA 1C4CA 3MD1A 4M63A 3RAQA 2NQPA 1ZTTA 5KFEA 2MKKA 2PC6A 3S1TA 3IM9A 4O3OA 2GMHA 2M8HA 2IYIA 4NXNJ 2MKIA 3TA0A 4L75A 2F9DA 1LWEB 3OL8A 3G8SA 1RTJA 3DC2A 2R7VA 2G4BA 3IRXB 4CWBA 3HHLC 1RAGB 3GR1A 4JV1A 3SXLA 2HNZB 4OLPA 2VBYA 1U49A 3BSOA 4U7UK 4KC5A 4N8NA 1VC6A 4U96A 2MKJA 3QGPA 4Y2MA 2FJDB 4TU7A 2NZCA 1GAOA 3BO4A 4A8YA 1UKUA 1NBEB 3GWCA 1XERA 1W7WA 2CJQA 4GO7X 4P2FA 2QEXS 3H2UB 3K5MA 3RB3A 3DHXA 4JOUA 1KVKA 1BE4A 1NK9A 3MPDA 4LR9A 5GAHU 3DRRA 1NM2A 2OGUA 4C48A 1UEUA 1OMSA 1H74A 4OHZA 2HQGA 1FE4A 3D7SB 4IDKB 3JAMY 4FXVA 4A47A 2V4JA 5C42B 2GA7A 4NLYA 5DGBA 3P3DA 4L76A 2YNHA 3D0HE 4QU6A 3QRPA 2E44A 2RVJA 5AJ3J 1SJFA 3AT1B 2F65A 5ADZA 4XDDA 4DR1F 2W4PA 3ZTPA 5KG7A 4ED3A 2LA6A 4PXEA 1TU0B 1YVFA 3G6XA 4M5JA 1DHMA 2YKNB 3D3CJ 2BM1A 4BBYA 4DFKA 4I7FA 3TAMA 3W61A 3T9ZA 1WF2A 4JI8F 1TL7B 3DOMA 2YNFA 1RT2B 1RT7A 5HBMA 1FDAA 5DDPC 2UP1A 2BJEA 4AQYF 1UZHA 1OWXA 1UWBA 3KK3B 3PFEA 2GS8A 3MPYA 1HWUA 4DQPA 3L09A 1X4BA 1WKJA 5HMWA 4LF7F 1RT5B 4YP3A 4Y6IA 3Q8PB 2J6SA 5KG0A 4IOCQ 2CQ2A 2PFDA 3BH6B 5KG1A 3MEEB 1UEKA 3GV5B 1WKLA 4PG7A 2MHEA 3K57A 1T9WA 2M5YA 4NXNF 4EU0A 4NYZA 5E7OB 2APOA 2UXBJ 4FPIA 3N9UC 2H5IB 1N54B 4WK3A 4DBQA 1QAYA 2L9NA 1HNIA 4FXWA 4J9PA 1TUGB 4FYYB 3MMAB 4K4WA 1SJRA 1FDNA 3HVTA 5AE1A 3B4MA 2W9CB 3M1VB 1J5EF 1NRKA 1B4SA 3MDFA 1KQKA 2FIUA 1R3NA 3DRSB 4KKOA 1AB8A 4ANDA 3W5YA 4DXLA 3LWMA 4UOHA 4ZPTR 4U7CA 1FNOA 3WHIA 3JS9A 2V8PA 1YBAA 1TL1A 4ZJQA 2AJ0A 3R7SB 3PO5A 1JLFA 2ABYA 1WG1A 3A8KA 3DXBA 2AKWB 3ISND 2YWEA 3RBDA 5J1EA 5LXYA 5I42A 4YR2A 3WC0A 1ZETA 1V6HA 2PI4A 5DGAA 4K4VA 3MM7A 3PEJA 1DBDA 3KG0A 3KUEA 4OJ3A 4OJ1A 3NMRA 2E1MC 4WCEQ 2H5JB 1OQ3A 3FDSA 3NG8A 5HQLA 1RCXB 1BWVA 2BVZA 4ZDNA 3Q8RB 4MYUA 5JXSA 3NCRA 1FJ7A 2D3ZA 4DV2J 5AJ3F 2W2NP 1TFYA 2F9JA 1BXNA 3EX7B 2HVIA 1M90T 2ZM6F 1TKZA 2C3UA 3IAS9 3DGPB 1BQMB 3GP9A 1FD2A 2NYHA 5KFXA 1P1TA 1X8DA 1NEEA 4LVOP 3QBCA 1ZA1B 2M70A 3C19A 2DNOA 4J90A 3MECB 1X4GA 1Q86T 1RT3B 3MFHA 1X9WA 5A8RB 1S1VB 4C0HA 2MZTA 5K14B 2BUNA 3C46A 5D3GB 2XLKA 4DLEA 2JEIA 3UD3P 2XSJA 5DLGA 3MOZA 1S48A 2EKNA 5IZHA 1RABB 4ANEA 3QO9A 4ETZA 1VRUA 2YQ0A 1NDLA 4KB7A 5A6WA 2UXCF 1DQAA 2KO1A 2MSSA 4J9LA 4P9SA 1YX2A 3QIDA 2VQFJ 3MMBA 3TA2A 5HANA 4F3OA 2UUWA 2KXNB 3GFYA 2MQLA 2V2QA 5DQGA 4OHYA 3BQ2A 2QFJA 1NJIT 4NLOA 1NPRA 1S0OA 2OHDA 1HBMB 1NCLA 2G2OA 5BYRA 1Q7YT 2FJVA 2CZVC 4QWCA 4WE1A 1N5YA 1FRIA 1X4EA 3QT5A 1AT1B 1NXIA 5F9NA 3QLHB 2UUAJ 2B5JA 1OS5A 2VB6A 3FSYA 1HD0A 2QRRA 2QLJB 5GAHI 1R7IA 1ZS6A 1SH3A 1S6PA 1MLAA 3QSYB 4IFVA 1JKHA 2HLTA 2BJDA 2YNIB 4ZITA 3RU0A 2XM3A 2HZVA 2RS2A 7FDRA 5DG7A 1EJ7L 1SUQB 4IR1A 4A8XA 2VL1A 4YN3B 3GE9A 4M5MA 4AT1B 5C2CA 4OJGA 4I4BA 2W25A 4Z7YA 5KTQA 3KLFB 2P9CA 4KH1B 3R2CJ 4L74A 1KHWA 4CH1A 3TAPA 3H42A 1M1KT 4OHVA 4FDFA 1BQNA 2X1FA 4C98A 3DM2A 3FCWA 3QT7A 1YKWA 1OSCA 3RB6A 4CO5A 4ZLPA 2OD6A 4M5DA 1T7PA 1XMOF 2UUTA 5E3PA 3HHDA 5EDWA 2ACMA 1IKYA 5ETOA 3H4BA 3ZZUA 1HBNA 1AZSB 2WZ1A 3GSDA 2EFNA 5EWFA 5K20B 2RD5C 2VFTA 4F67A 3V81A 3MCOA 2H5EA 2BOAA 3FBEA 1X4CA 3F41A 3DLHA 1KKHA 1WF0A 3SCIE 4JUZA 3V6JA 3PCOB 4OI2A 4F0KA 2CWKA 3P49B 5H9EK 2HFNA 4Q8EA 2BKOA 2ADBA 3LW5C 5IT9Y 4ZLLA 2DHSA 5A8WB 4FBTA 2DHHA 4DPXA 1MSWD 4XPCA 1R8AA 1V3RA 3CC2S 3T3FA 1RUSA 2QG9B 2E5IA 1TL3A 1M1GA 2QA2A 2EFOA 1NJXA 4F8RA 4MTPA 4NLRA 3K5PA 1UA0A 1BWEA 5C2GA 1RT4B 1TUWA 2Z30B 4PUOB 5L46A 2UVUA 4JI5F 5M2PA 4FF1A 4EZ6A 4GVLA 4FYXB 2GW8A 2BJ3A 4O0NA 4RR5A 3M8PA 4DR5J 1WC1A 4NASA 1P6TA 3T1HJ 1FRKA 2HWHA 4FNIA 1NPPA 4ECYA 4IG3B 4ILMA 1KD1T 4CT8A 4J91A 3CJTA 1QAIA 2HFVA 2UUAF 1ZAWA 1YJUA 2VBXA 2OI2A 4RNNA 2FVSA 4XIUA 2KG0A 1PAUB 4H4OA 5C5JA 1M5OC 4O3SA 3D4JA 4JI7F 4DV1F 1U48A 4L6V3 2XO6A 2C28A 3MAAA 2KB2A 1RU1A 5IT0A 4CYUB 1MW7A 5KFPA 4TLRA 1TQLA 4LF4J 2WOMA 5HP1B 5KFLA 1R8BA 3AA8A 3VF0B 2KHCA 3M30A 3QPIA 2CJKA 4NXMJ 1TKTA 4KQZA 1HI1A 2HVZA 1U0HA 1S9GB 2HAIA 3R5GA 5B0DA 2MKCA 5FDLB 3MPVA 1HNXJ 3BEGB 1IWAA 2SXLA 3I9V9 3GCXP 4DU8A 5JJBA 2IAJB 1MU2B 1V5VA 1TK5A 2JH3A 1SL0A 3DLGB 1IQTA 4QYZJ 1H72C 2RUSA 4CH7A 4RUHA 2UUCF 3OUYA 4NOHA 5CQGA 3ET6A 3BJYA 4EBDA 3BN7A 2VODA 2MQNA 3CCRS 5IWAJ 2MEWA 3R7NB 2KDOA 4EBCA 4GO5X 1RWVB 1EIYB 2J8SA 4BC7A 1ICEB 4QOTA 2DO4A 4P72A 1HHQA 5DO2A 4O4GB 1Q0NA 4ZA1A 1LXNA 4YB5A 2ZBRA 1REGX 4NZ6A 1PO6A 1DTTA 5D0HA 3TUPA 3FEXB 3KLEA 3KWMA 4ED8A 1RTDB 5F3TA 4B3SF 3MEGA 3LOUA 4DN9A 3QSIA 3IS9A 4KHMA 1L3VA 5IQQA 3GYGA 3UO0A 1KOOA 1T94A 3BGLA 1SI9A 5EX0A 2RT3A 1AXQA 1SXLA 4CO3A 1FX2A 3J7ZT 2C2NA 1HQEA 4TLQA 2WONA 5E2QA 4WYLA 2DT9A 1BMQB 2CPJA 5LMUJ 4OYOA 1C0TA 4ES3A 2UZAA 1ULRA 1OYEA 2WK4A 4ELTA 4ZPDA 4A46A 4F02A 1FJGJ 3OL7A 1BUXA 4OZLA 4B17A 5KT5A 2LDIA 1XNRF 3M7VA 4DDFA 3CMQA 4KSEB 2AYBA 2RH3A 4P6QA 2FJEB 5SZTA 5CYJA 2R7UA 5A0YA 2QSFA 3KDNA 2KT2A 2FLOA 5FD1A 2DNNA 3QRQA 4R25A 4LF1A 1WOPA 3LAMA 5DQIA 2QZ8A 3B54A 1OO0B 2C42A 5ETNA 2PI5A 2PD1A 4NEZA 1VQ7S 1C1CA 2DNQA 4NLGA 2EFGA 2N3OA 4PXDA 2VDHA 3EGNA 4USMA 3D6HB 4ZPWR 3Q86A 5IT4A 1IKWA 3VAHA 3G6VA 3HT0A 4DF8A 3HSZA 4WPAA 1MMLA 3N28A 3PTWA 3CJ5A 1VRQC 1FVSA 3MM6A 2KVIA 1S57A 1F9HA 2B9WA 1TL5A 3HVRA 2ZH9A 2V4JB 4HACA 3DRYA 3TZWA 1W2BR 2HBZB 1TVRA 4LF9F 2YNHB 2EVZA 4NRTA 4LF8F 4WKYA 4H4MA 5IWAF 4BC9A 3LH2S 4DL2A 4GKJF 1EETB 2LCWA 2C2OB 1U45A 4OYAA 4RW8A 3CDUA 3R1HA 1N48A 1MWQA 2R42A 2QYCA 3SDEA 2YWGA 3SSQA 4J9MA 1WUUA 4C97A 4K4XA 3VR1A 3VAFA 5IM0B 2HHTA 2QMWA 2RSQA 3H2VE 1F1BB 1RWNB 2HQDA 3MF5A 2ZZMA 3TAMB 4WTOB 4OYBA 2G13A 1R0AA 3NL0A 3MR2A 3NNAA 1RK8A 4O3NA 3BPDA 3DOMB 2HAFA 1IKXA 5HBMB 2FDNA 1N6QA 2O66A 4HR2A 1BHNA 1UZDA 2YX1A 3C6TA 2HIQA 1EARA 3ZTOA 5M2RA 2MZQA 3F0NA 3EPGA 4K2XA 2MLYA 2V2VA 3PX4A 3PX0A 1T03A 1WHVA 2QLFB 3H7HB 4YHHJ 4LIRA 3LANA 3TZYA 4ID5A 2VA2A 5CD4A 2H4YB 3WIUA 3CO0P 1GT8A 2VC0A 2VQEF 4DX7A 4ID8A 1M5VC 2F7VA 3A3OB 4KO0A 2VC1A 2H9ZA 1NKBA 5K8MA 2KU7A 3Q8SB 2YWFA 4LQ3A 1YJVA 2ROEA 2A6MA 2EC2A 3HVTB 2FQQB 3SQGA 2DH7A 4WTYA 1UETA 1SL1A 2V2KA 2LEAA 3DLLQ 2XMVA 4KKOB 4DMZA 1IN0A 3FBBA 4K50A 4LJMA 1TL1B 3IWLA 1JLFB 5L1KA 3G8TA 2WW4A 3RTVA 4ENOA 1VGYA 3FK4A 3M9MB 5J1EB 2W9AA 2WB4A 5I42B 3MUTP 1EP4A 2BANA 1Q53A 2E5JA 3MM7B 1VLOA 3HHNB 5L9NA 2C3OA 5E3CA 2AYGA 2J9CA 3GV7B 5GMDA 3SV3A 5E33A 2GV1A 4X66J 4KRWA 2CPXA 4ECUA 3CXCR 1UVLA 3ENVA 4LR8A 1VHFA 5LL6d 4ZP6A 1TKXA 4Q8FA 2ZUAA 4CO2A 2MKSA 1Q82T 4TYAA 4U8YA 1ROFA 4QIGA 1RB0A 1TKZB 2VFRA 1RA6A 3GV8B 2EI5A 3RB0A 1T9XA 5IV4A 4DV5J 3S7RA 4A8WA 4KR0B 4K5RA 4CLLA 4CH0S 3E3XA 2X3GA 2XZWA 4C0OC 3IR6B 2BYCA 2AT1B 1H2TZ 3NKYA 2OPQA 1YJ7A 4R8UA 3TX8A 2XQCA 2XSJB 3R6GB 3MMCB 4DL7A 3IP0A 3HXMA 3QO9B 4ZLNA 2Z2ZA 3JYTA 2XNQA 2ZC3A 2GAGC 3HD1A 4ED6A 2NPFA 4LFAF 3K7RA 5KFZA 1VI7A 2HHWA 1MMNA 4U95A 2ZKTA 2GO8A 3MOJB 2W2OP 1FJEB 4IH5A 3MMBB 2M4MA 2GGPA 2KTQA 2DKOB 4X4PA 1UPPA 4LRFA 1QE1A 2V2ZA 4USUA 3W3SA 2LYVA 1UFLA 3ULHA 4WE1B 3PW7A 1SC4B 2DEJA 5GMEA 2GHVC 3G8QA 4X4QA 2B5JB 4UOCA 3PG9A 2GHPA 4J9VA 4NA3A 3FCVA 5B0FA 3S01A 3BGRA 4LT6A 4Y2KA 4HT5A 3KJVA 2VOPA 4CP5A 4PABA 5AE3A 4QYZK 4IFVB 1JKHB 1NB7A 5RUBA 3EWGA 3OQ2A 1IJFB 5KT6A 1MROA 2OD4A 4HI2A 4F4YA 4B3MJ 2I38A 1KQSR 2QT7A 1LK7A 1CJUB 3JAMU 1Q79A 5C7PA 3EGWB 2ZC4A 1VQPS 4KHRA 3AHPA 3GZ7A 1Z2LA 3KHRA 1T0TV 5BYSA 5D4OA 1WC6A 4FKXA 1BQNB 3M2UB 4LRDA 1GH8A 3B78A 3VCDA 1FXLA 1HIYA 2DHXA 3SQOP 3PRVA 2LFVA 3E51A 1NJWA 4M5DB 1CJVA 4LRCA 1LXJA 3CJ3A 2DNRA 4JI0J 5DDQC 4JYAF 2M8DB 3NS7B 3PIPQ 2OSRA 1IKYB 4IFYA 2J9DA 1PG5B 4IQXA 1HBNB 1BGXT 4WXWA 2FY8A 5JUMA 3RG6A 4AL5A 3OTBA 1AYEA 4LSNA 2OAUA 2IMOA 5HMYA 2DGUA 2ZITA 2E29A 2QL7B 2R7QA 4WIIA 4DV5F 4I2PA 3TWZA 1KR4A 2AZ3A 5C24A 5HLFA 2BXJA 3PHEA 3R97A 4ATNA 4DPUA 2DVIA 2KT5A 3KK2A 3IAM9 3UDVA 4KT0C 2NUUG 2Y8YA 5LSOA 1N5VA 1RAEB 1CEZA 1PYTA 4XAKA 4ED0A 5KG5A 3NY0A 4USTA 3AJDA 3P8BB 2PA8D 4L73A 1TL3B 4UOGA 5DM6Q 3PV8A 1ZA2B 1UFKA 1PBUA 3UVJB 3NLCA 1RI7A 5MAOA 3SBMA 1KQFB 1IR1A 1GNKA 2E1PA 2ZBIA 3HJFA 3C15A 3BR9A 1KVJA 2YX7A 2NR0A 3M8PB 4OI6A 3CD5A 2OMLA 2GQ2A 5ETRA 2LEPA 5EWGA 1I5OB 5M2UA 2PDAA 1UP1A 4EEYA 2OPPB 3EZOA 4R0JA 2DTJA 3T6BA 1WEZA 2IC3B 5HROB 1RAOA 2QA4S 2ZE2A 2VASA 4H4OB 4QR1A 4YB6A 3CCSS 1T95A 4TNOA 2AD9A 3CF5Q 1CJTA 1Z4UA 3MAAB 2EK1A 2MGZB 3MM8A 4F0MA 1QDUB 3NXZA 1RHKB 5B0AA 5LT5A 1X4FA 5DZ7A 6AT1B 5KOWA 4LF5J 3HZGA 4DCJB 2WOMB 3EZUA 1S10A 1FESA 4YS2A 3U1LA 4MK8A 5KFGA 5LOQA 3OR2A 1U8SA 1TKTB 2K1RB 3PDNA 4ZKAA 3PW4A
chains in the Genus database with same CATH topology
2DXEA 4DZ6A 3NGTA 3Q86A 1LWXA 3ZTRA 1EHWA 3EICA 3PJ9A 2HVDA 3EVWA 3NGRA 1WKJA 4KPCA 1S5ZA 1ZS6A 2AZ1A 4DI6A 3ZTQA 3ZTSA 1S59A 3FBEA 3FBBA 4EK2A 4HR2A 3EJMA 3ETMA 1BHNA 1XIQA 4UOFA 3VGTA 4S0MA 4F36A 1S57A 3FBCA 3EVOA 1WKKA 2DYAA 3EVMA 3BH6B 1XQIA 1F3FA 4WBFA 2NCKL 2CWKA 3B6BA 3BBFA 4ANEA 3FCVA 1LEOA 1WKLA 3ZTOA 5CAAA 1B99A 3ENAA 1VYAA 1MN7A 1NDLA 4ENOA 1BUXA 4C6AA 4CP5A 4FKYA 3L7UA 1PKUA 2B8QA 3EE3A 2BX6A 3GPAA 3NGUA 2DY9A 3EMTA 1HHQA 5CABA 2AZ3A 2B8PA 1MN9A 3ZTPA 4ANCA 3BBBA 3Q89A 3Q8UA 1NDKA 3FC9A 3VVUA 3EM1A 1NSKL 2BEFA 1U8WA 3ELHA 1NDCA 1HLWA 1W7WA 3NGSA 1NLKL 1JXVA 3VGUA 3VVTA 3R9LA 2DXFA 5C7PA 3DDIA 3Q83A 3VGVA 3FCWA 3G2XA 5BXIA 1NPKA 2HVEA 1UCNA 3Q8VA 4W98A 1NHKL 1BE4A 1NDPA 3MPDA 1NCLA 1NSQA 1NUEA 3FKBA 1K44A 3B54A 3BBCA 1B4SA 3WX8A 1NSPA 3FBFA 3Q8YA 1PAEX 1F6TA 4UOGA 2DXDA 4DUTA 4FKXA 3GP9A 2VU5A 3DKDA 4ANDA 4UOHA 5IOLA 1HIYA 4F4AA 3BH7B 4O0NA 1NB2A 3PRVA 2ZUAA 1KDNA 3JS9A 2HURA 3VGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXE A;  4DZ6 A;  3NGT A;  3Q86 A;  1LWX A;  3ZTR A;  1EHW A;  3EIC A;  3PJ9 A;  2HVD A;  3EVW A;  3NGR A;  1WKJ A;  4KPC A;  1S5Z A;  1ZS6 A;  2AZ1 A;  4DI6 A;  3ZTQ A;  3ZTS A;  1S59 A;  3FBE A;  3FBB A;  4EK2 A;  4HR2 A;  3EJM A;  3ETM A;  1BHN A;  1XIQ A;  4UOF A;  3VGT A;  4S0M A;  4F36 A;  1S57 A;  3FBC A;  3EVO A;  1WKK A;  2DYA A;  3EVM A;  3BH6 B;  1XQI A;  1F3F A;  4WBF A;  2NCK L;  2CWK A;  3B6B A;  3BBF A;  4ANE A;  3FCV A;  1LEO A;  1WKL A;  3ZTO A;  5CAA A;  1B99 A;  3ENA A;  1VYA A;  1MN7 A;  1NDL A;  4ENO A;  1BUX A;  4C6A A;  4CP5 A;  4FKY A;  3L7U A;  1PKU A;  2B8Q A;  3EE3 A;  2BX6 A;  3GPA A;  3NGU A;  2DY9 A;  3EMT A;  1HHQ A;  5CAB A;  2AZ3 A;  2B8P A;  1MN9 A;  3ZTP A;  4ANC A;  3BBB A;  3Q89 A;  3Q8U A;  1NDK A;  3FC9 A;  3VVU A;  3EM1 A;  1NSK L;  2BEF A;  1U8W A;  3ELH A;  1NDC A;  1HLW A;  1W7W A;  3NGS A;  1NLK L;  1JXV A;  3VGU A;  3VVT A;  3R9L A;  2DXF A;  5C7P A;  3DDI A;  3Q83 A;  3VGV A;  3FCW A;  3G2X A;  5BXI A;  1NPK A;  2HVE A;  1UCN A;  3Q8V A;  4W98 A;  1NHK L;  1BE4 A;  1NDP A;  3MPD A;  1NCL A;  1NSQ A;  1NUE A;  3FKB A;  1K44 A;  3B54 A;  3BBC A;  1B4S A;  3WX8 A;  1NSP A;  3FBF A;  3Q8Y A;  1PAE X;  1F6T A;  4UOG A;  2DXD A;  4DUT A;  4FKX A;  3GP9 A;  2VU5 A;  3DKD A;  4AND A;  4UOH A;  5IOL A;  1HIY A;  4F4A A;  3BH7 B;  4O0N A;  1NB2 A;  3PRV A;  2ZUA A;  1KDN A;  3JS9 A;  2HUR A;  3VGS A; 
#chains in the Genus database with same CATH topology
 1U0H B;  2PMW A;  4P75 A;  3HP6 A;  2D3O 1;  1UW4 A;  4DV4 J;  1J27 A;  1JXL A;  4P52 A;  3Q2T C;  2B7C B;  4WZQ A;  4DR7 J;  4GC7 A;  2GJF A;  1HD1 A;  3LAL A;  2QLX A;  3LPY A;  2XMW A;  1CVJ A;  2WVD A;  4NML A;  3OJS A;  3K59 A;  2COL A;  2QN6 B;  2MDA A;  4JI0 F;  3GJR B;  4DJB A;  2FJW A;  4XDC A;  2G0J A;  4LRA A;  4QIE A;  3ET6 B;  5F9L A;  3A3P B;  3H0P A;  2B9E A;  1Y7P A;  1NSK L;  3UR3 C;  1RHR B;  2CDQ A;  4HHU A;  4D3H A;  1T3N A;  2Q3P A;  4F4W A;  3BYR A;  2BRK A;  2LXF A;  2OMO A;  3GFX A;  2HS0 A;  3H20 A;  3IRX A;  4AL7 A;  5D4P A;  5EWE A;  2CQG A;  2HVE A;  4FF2 A;  2V68 A;  2V50 A;  4NLV A;  2VG5 B;  3OL6 A;  4WFZ A;  2H54 B;  3L95 X;  1I51 B;  2YX4 A;  3POT A;  4N8O A;  1JLE B;  2QSW A;  1LW2 B;  1IWG A;  4PG6 A;  3BGF A;  3KLE B;  4I6A A;  4DQS A;  4M5H A;  2G2Z A;  2HUR A;  1DQ9 A;  1LWX A;  4RBT A;  3MEG B;  2RDD A;  2HND A;  3ZTS A;  2FHK A;  3GLJ A;  1JIH A;  5C25 B;  1DLO A;  4N7T A;  2QLB B;  8ATC B;  2UXD F;  1FKO A;  2HQC A;  3GR0 A;  3W64 A;  3OFH A;  5DG8 A;  3EVM A;  5KT3 A;  2JVO A;  1NME B;  2RDJ A;  2KXF A;  1KNZ A;  2KVQ E;  2AGQ A;  1TAQ A;  4JV5 J;  5EGY A;  3OW2 R;  3J81 j;  4B9T A;  1X0P A;  1PCA A;  1C0T B;  5F8I A;  1UEV A;  5LJ3 Y;  1WC4 A;  5KFJ A;  2R8H A;  1I6J A;  2E5L J;  3KKF A;  1GMV A;  3P96 A;  4URS A;  4NCG A;  2WW8 A;  1FRJ A;  3IBF B;  1YJN S;  1KEK A;  1RYS A;  2XMM A;  4EI2 A;  1ZPV A;  2DD8 S;  1WC5 A;  2VBW A;  2KYZ A;  1B70 B;  4Y65 A;  1IVZ A;  1FEE A;  4X64 F;  3IBC B;  1HI8 A;  1V9O A;  3A4T A;  2DNZ A;  4B9V A;  3JSM A;  2G0C A;  3V6K A;  1P27 B;  1EKR A;  1FI4 A;  1OIA A;  3BS9 A;  2YH1 A;  1C1C B;  4MYT A;  2XMK A;  2YKN A;  2HGM A;  4RU9 A;  4DZD A;  4ELV A;  4C4W A;  1KS2 A;  1TL7 A;  1RWX B;  2RIJ A;  2FB0 A;  1WTF A;  4DV4 F;  4OI1 A;  2E7X A;  4C6A A;  4P7T A;  3Q2S C;  2CZ4 A;  5T7L A;  1YRX A;  4OJH A;  3KK3 A;  4ZVF A;  2YKM A;  2KJV A;  3HFK A;  1I94 J;  3BSN A;  3ZC4 A;  5A8K B;  4NLW A;  1RT5 A;  5BR8 F;  2B6A A;  1RHM B;  4CRJ A;  5L1L A;  2WAQ D;  1TVR B;  3QT6 A;  1N0V C;  1K8A T;  2DHG A;  5G0R B;  3IN5 A;  3D1O A;  4RW7 A;  2C2K B;  1NDP A;  1VQY A;  3G86 A;  3PHT A;  4ZPB A;  3FKB A;  3RZA A;  3JQJ A;  2QA4 G;  3Q8Y A;  3IWN C;  5E3R A;  4RW8 B;  2K2P A;  3QMQ A;  4WFY A;  3TRG A;  1JLA A;  1WOR A;  3MAQ A;  1H2V Z;  2DIU A;  5IT9 U;  3E8O A;  3SDE B;  1NKE A;  4UUX A;  1Y5N B;  3VGS A;  3BQ0 A;  4MT1 A;  1LFW A;  2CPD A;  5F0U A;  2W9B B;  1YHQ S;  4CTA A;  5DZ6 A;  2RRB A;  5D6G A;  1LV5 A;  2OTL S;  4M5L A;  5L38 A;  2MPU A;  1WKK A;  1SH0 A;  5SUH A;  1F2H A;  3DN9 A;  3N4W A;  3CUL A;  1IKX B;  2N82 B;  3E2E A;  2B9Y A;  3AXM A;  5F0W A;  3DRS A;  2ACY A;  1ARO P;  1N52 B;  1N88 A;  1RLD A;  2KYX A;  2KFZ A;  1X31 C;  2CNO B;  4WP9 A;  4JV5 F;  3TUZ C;  3KK1 B;  2DNY A;  3SCK E;  1NK8 A;  3SI8 A;  1T03 B;  3TZX A;  1FTR A;  3I55 S;  1IR0 A;  2LKZ A;  2RDI A;  3QZ8 A;  1B64 A;  1XMQ F;  3MR6 A;  3MCM A;  4HTI A;  4YQW A;  3Q24 A;  2E5L F;  1EQ0 A;  2VU5 A;  3WIV A;  1QY7 A;  3CMA S;  3H25 A;  3LGH A;  4MMO A;  4KO0 B;  4DR4 J;  5H1S V;  2PT0 A;  1N33 J;  3I4H X;  2R2T A;  2XG8 A;  3EDR B;  1HI0 P;  2R2R A;  4DQQ A;  1B0T A;  1X5T A;  1IUJ A;  3OL9 A;  4CZC A;  1HNW J;  3SQG B;  2QGF B;  3WQP A;  4HHJ A;  3R8Y A;  4QR0 A;  3NCP A;  3U27 A;  2OSQ A;  3M6V A;  2KN4 A;  5KFD A;  4U67 Q;  2C3M A;  2QIF A;  1WHX A;  2YKA A;  1YRT A;  4B9L A;  2E5H A;  3UN5 A;  3J80 Y;  3BM7 A;  2ZZN A;  3VZH A;  4CLT A;  3OTD A;  4ZCI A;  2W4C A;  3KLI A;  3KXD A;  3BGU A;  1S1V A;  5EX3 A;  2V8D A;  3MMJ A;  1QAJ A;  1SQG A;  2BAN B;  4XO0 A;  3CD0 A;  4URG A;  3D1Q A;  3DOL A;  3M4X A;  3TJ9 A;  3M8W A;  1Y4Z B;  1DFD A;  1R0C B;  5F8N A;  2F8M A;  2E5G A;  4YUD A;  3T41 A;  3CJR A;  2W2Q P;  1JLQ A;  3I0R B;  4KTQ A;  4B3T F;  3UN2 A;  4CO1 A;  4FF4 A;  3BRE A;  2KFN A;  5E5N A;  4B3R F;  1TKX B;  1CSJ A;  1SKR A;  2DIS A;  4WP8 A;  1QTN B;  2HG4 A;  3UCZ P;  6FD1 A;  2GHW A;  3DOK A;  2CXE A;  4J5O A;  1JNR B;  2QL5 B;  4WU2 A;  3OVB A;  3GJS B;  1WG5 A;  3CSK A;  4PQU A;  3IWX A;  5KFH A;  2JNJ A;  4DR3 J;  5ETS A;  3FRZ A;  2DB1 A;  1RWK B;  1H6K X;  1JLC B;  2EBG A;  4TQS A;  4BS2 A;  2LVW A;  4G6V B;  3DFE A;  4N5S A;  4LBP A;  2GAH C;  1PJ6 A;  2YNI A;  1ZZF A;  4LFC J;  2VPY B;  2HW3 A;  4X4S A;  5D8H B;  3D2W A;  2QTW A;  2X51 A;  4QW8 A;  1VRT B;  2JEF A;  3FNN A;  2QMU B;  1FVQ A;  1HAR A;  1KQG B;  4UY8 5;  2ZOF A;  5B0E A;  4F0H A;  4YME A;  2PN6 A;  2J0Q D;  2ZWP A;  2ADC A;  3KLF A;  2DXE A;  3EIC A;  1K47 A;  2LQ9 A;  2GGP B;  1KOH A;  4L3N A;  1QE1 B;  2EEY A;  4OI0 A;  2HHH J;  5L1I A;  1QUV A;  1IBL J;  3J81 Y;  4ZVS B;  3TEH B;  1D1U A;  3QJJ A;  5CAA A;  2M0G B;  4GMK A;  4NRU A;  1K1S A;  4ZHR B;  2EFV A;  4PPZ A;  1SCJ B;  4X4R A;  1DTQ A;  4Y2C A;  2E1A A;  1FRH A;  3PW0 A;  1U2F A;  2J8A A;  3HFV A;  1N34 J;  2DRB A;  3VQS A;  1HNV A;  1IBM J;  2V9W A;  4ZIV A;  3HUL A;  4IOA Q;  4OX7 A;  2NXE A;  1GXU A;  1YBT A;  3Q83 A;  4HI1 A;  2J7U A;  3U1N A;  1RTH A;  4C3L A;  1QVG R;  5KFV A;  2PEH A;  1MRO B;  2NXN A;  1KON A;  3D6M B;  4G1I A;  1VQN S;  2UVW A;  3AJ2 A;  4F4Z A;  2P8I A;  1QSL A;  4HDG A;  5A8W A;  4Y3C A;  4J9O A;  3FCH A;  3SSR A;  3BH7 B;  5KFT A;  1HR0 F;  2FLL A;  3NWR A;  5D4L A;  1JMT A;  3W2V A;  4O0I A;  5GAE I;  2HZC A;  1JX4 A;  2GC8 A;  2FGC A;  1LNQ A;  1GEH A;  3HKZ D;  2HK3 A;  4WFB Q;  3BBF A;  3B6B A;  1CJV B;  4WWS A;  2HBQ B;  4PUO A;  2IRU A;  1MMD A;  1AFJ A;  2QJ3 A;  4IFY B;  2HFS A;  3G82 B;  2B8P A;  4OL8 A;  1DAR A;  4PAA A;  3CPW R;  3FQK A;  1Q95 G;  2XWY A;  1SQF A;  4GKK F;  4I2Q A;  3GG0 A;  4USK A;  3BPS P;  1LOU A;  3GMG A;  4CNZ A;  1OJ4 A;  4CLS A;  1NAQ A;  1UW9 A;  1U1P A;  3KK2 B;  1KTV A;  2ASJ A;  3DKD A;  4F04 B;  5F8L A;  3PNI A;  5HO4 A;  2GQC A;  3AA9 A;  2XGP A;  4CYU A;  5KFI A;  4OZ3 A;  3P4U B;  1G7C B;  1CG2 A;  1WJ9 A;  1VBX A;  3UNY A;  2WVF A;  4DUZ J;  5HP1 A;  1S97 A;  3D5M A;  4ED1 A;  3K89 A;  3MUV P;  4RW4 A;  2Q6B A;  1RP5 A;  5EHH A;  1FHT A;  2RRN A;  1S9G A;  3ZNJ 1;  5A76 A;  4DV0 F;  1X9S A;  4CT9 A;  2R7X A;  3OSN A;  1B99 A;  2F40 A;  1VS3 A;  3ZXW A;  3W2W B;  4C8O A;  3C15 B;  1HNZ J;  4TU9 A;  2D7S A;  1RAI B;  2MLZ A;  1IBL F;  1MU2 A;  4HHH A;  2ZHO A;  3N6N A;  3MFI A;  2WVC A;  2BQ3 A;  3L7O A;  3A8J A;  5FLX Y;  2A0F B;  2XHC A;  4HL9 A;  2AEJ A;  1UVK A;  2FY1 A;  2WBR A;  2HNY A;  4ILR A;  3V4M A;  3RRK A;  3GJT B;  3DLK A;  5HI7 A;  2DGS A;  1CJT B;  1X4A A;  1B7F A;  2VPW B;  2IHR 1;  2WVE A;  4MKY A;  4PYD A;  2AHO B;  3A12 A;  2UUB J;  2DRA A;  5KFB A;  4F4K A;  1NZA A;  1RT6 A;  4OX8 A;  2VBZ A;  4DX8 H;  2DR8 A;  2HSE B;  4HLB A;  4U7U D;  1XK8 A;  3OR2 B;  3FBC A;  3OTE A;  2O67 A;  3LPE A;  3CT9 A;  3N6M A;  3WDO A;  2CQ4 A;  4ZP7 A;  5LXR A;  1RJJ A;  1Q8L A;  4QZV B;  4WFX A;  1M0S A;  2NS1 B;  2FHO B;  2CJ9 A;  4IUF A;  3MED A;  3AD9 C;  1M5S A;  3R27 A;  1VQM S;  4NI2 A;  2DR9 A;  2XSF A;  3ILL A;  4EYH B;  4ECS A;  3DNC A;  3KJF B;  3VGV A;  1D09 B;  2DGT A;  1MG7 A;  2XB2 D;  3OR1 B;  1PSD A;  4RL1 A;  1NH8 A;  4PXB A;  1RWO B;  3UN3 A;  3MTJ A;  1TTH B;  5AT1 B;  4TN2 A;  4LF6 J;  3BKT A;  2AIR B;  4IH6 A;  3T5L A;  2XI3 A;  3M8S A;  1QSY A;  3NAH A;  1YZ7 A;  2B7B B;  2OEK A;  3OD2 A;  3TUJ C;  1WF1 A;  3ENQ A;  3POT B;  5I3U A;  3QGH A;  4QWD A;  2F4V J;  1ELO A;  3IR7 B;  4DV6 J;  4LRB A;  2R4F A;  4DUZ F;  1VYA A;  2LQJ A;  2HND B;  1UVN A;  3VAI A;  1Y0H A;  1HA1 A;  1DLO B;  2HYI B;  4WYW A;  1FKO B;  5E3Q A;  1S1U A;  1OPZ A;  4ANC A;  1UWA A;  3Q89 A;  1FXR A;  2CQP A;  1U1O A;  1K0V A;  2G1D A;  3AOC A;  2MZR A;  3CC7 S;  3TX0 A;  3MM5 A;  1F0X A;  4P10 A;  3I32 A;  2M88 A;  4ZK7 M;  1U25 A;  5CXT A;  2HGN A;  2DXD A;  4NCG B;  2RIL A;  4DFP A;  2NUH A;  1RHU B;  2BV3 A;  2AX1 A;  3CB4 A;  3SFU A;  4IOB A;  4ITS A;  1N4L A;  3OLB A;  2CZ9 A;  5AE2 A;  3UI3 A;  2AJ1 A;  1EET A;  3JSM B;  3OHA A;  2NXC A;  1FEH A;  3C8Y A;  3PRD A;  1TFW A;  1QAX A;  4WBF A;  2UUB F;  1L3U A;  1UL3 A;  2ALY B;  4DR6 F;  5IM0 A;  2DRD A;  3BSA A;  3QAT A;  2IBK A;  1FDB A;  2FJB B;  1NHV A;  1ZBT A;  2HQ3 A;  2ZHA A;  2PMH A;  3O8W A;  3LF0 A;  4NLQ A;  1K0T A;  2BKN A;  3WC2 A;  3GTY X;  1IBC B;  1XBW A;  5T7L B;  1R89 A;  1S12 A;  1H7W A;  1NHU A;  3RUB L;  3T5H A;  4NL5 A;  2YKM B;  3PKY A;  3MUR P;  2RQM A;  3CDW A;  2GFF A;  3PR5 B;  1F3V A;  2C2E A;  4KAI A;  2B6A B;  4LMZ A;  4PG8 A;  1U47 A;  1H3D A;  1SL2 A;  3PY8 A;  3ZZO A;  3ITH A;  2ZBC A;  4DV3 J;  4RW7 B;  1FNM A;  1LKZ A;  5DRK A;  3KLV A;  3OFG A;  2XMJ A;  2A18 A;  4EWT A;  4KPC A;  4KFB A;  2Y1R I;  4WZM A;  2XYG B;  2CQC A;  1JLA B;  5D0G A;  1XIQ A;  1N5S A;  4UOF A;  1XTZ A;  3MI7 X;  1FA0 A;  3KOA A;  2L48 A;  2Z8Q A;  2QX0 A;  3BN4 A;  3TYT A;  3AAW B;  4CTA B;  1K9M T;  4K4U A;  3OVS A;  3DRP A;  4MH8 A;  3BGO P;  4LQ9 A;  1NK0 A;  1BLU A;  5CAB A;  1KP6 A;  4NEY A;  4WFN Q;  1E6V A;  1IBK J;  5CYM A;  2XLJ A;  3MZI A;  4DF4 A;  1M5P C;  4DL6 A;  1ZZN A;  4RUA A;  4LBI A;  1Q1K A;  2C2M B;  2JZ5 A;  3R6L B;  5BXI A;  2RHS B;  2VJU A;  2IMW P;  1VIX A;  4XK8 C;  1PC4 A;  2VDI A;  4CCH A;  4X62 J;  1JLG A;  2GNK A;  2HIY A;  3EXY A;  3GCW P;  2B3T B;  2XZT B;  2FHM A;  1RDR A;  2NZ4 A;  1Q5V A;  3TW0 A;  4A8F A;  3H5Y A;  4NWB A;  4QIW D;  3EVW A;  1JLB A;  3W9J A;  4F7V A;  2CVE A;  5CCM A;  1VC0 A;  1H73 A;  2DR5 A;  1FO1 A;  2KZZ A;  4UTG A;  3HX9 A;  3RR8 A;  3OFF A;  4NA1 A;  3ZZP A;  4EZ9 A;  1EKS A;  1TKD A;  4OI4 A;  4RWX A;  2HFO A;  1B0P A;  4NPO A;  1JJ2 R;  4ECQ A;  2BAC A;  5A2Q Y;  4F3M A;  1AA1 B;  2R2U A;  3LGM A;  3PVX A;  2CPH A;  4C8Y A;  2J76 E;  1YZ6 A;  3A1Y G;  2C2D A;  5LSL A;  3UWT A;  2HPU A;  5KFS A;  5I3P A;  2J0W A;  2CNN B;  2G2Y A;  3ETO A;  1KLN A;  3PO4 A;  2AW0 A;  4Q44 A;  2AYM A;  4WJB A;  4ZCK A;  3VWS A;  5F8J A;  3KLI B;  3QGG A;  1HBO A;  2A2C A;  1VJQ A;  3CUN A;  3NGK A;  2U1A A;  2VZ9 A;  4DSL A;  1VHI A;  1V3S A;  1KRP A;  2GML A;  3D67 A;  2LU2 A;  3MMC A;  1KDN A;  2L41 A;  4D3G A;  5KT7 A;  3LWL A;  2XZD B;  3T1Y J;  1F5C A;  3H4D A;  1L3K A;  4I0W A;  3DOL B;  4YY3 J;  3K5L A;  2MLX A;  4M5K A;  4B9U A;  2MTL A;  2ASD A;  2MB0 B;  4DV3 F;  5GAG U;  1KC8 T;  1JXE A;  2Y1L B;  1VBY A;  3LUY A;  4I6W A;  3QYY A;  2ILY A;  4ZPV R;  1XR7 A;  1JLQ B;  1RBO B;  2KG1 A;  3R7B B;  2CQ0 A;  1AUD A;  1RTZ A;  1RBL A;  1U09 A;  1PKU A;  3D28 A;  2BJ8 A;  2V69 A;  2UXB F;  3BBB A;  3HM9 A;  2BEF A;  3I87 A;  3TP2 A;  3DOK B;  2VG7 A;  2VV5 A;  3MPU B;  2IA0 A;  1S1T A;  4X4T A;  4X4N A;  3MM9 B;  1O0P A;  4PQU B;  3M6U A;  1IKV A;  2QL9 B;  4A8O A;  3LP2 A;  3THV A;  3RR7 A;  1DAX A;  1F5B A;  3PJW A;  2RJZ A;  4DEZ A;  1DRZ A;  4KHP J;  1YK9 A;  2O5D A;  2IBO A;  4K8R A;  4QR2 A;  2AQ4 A;  2OO4 A;  3M2R B;  1TZ0 A;  1ZH5 A;  3MEK A;  4NYP A;  1Q7L B;  1JJC B;  2XY5 A;  4KGK A;  2DNK A;  5JMN A;  1XEZ A;  4RLE A;  2CIM A;  4X62 F;  3PJX A;  3VAM A;  4Z2X A;  2MQQ A;  2ZH4 A;  1CJU A;  2ZVI A;  3M2V A;  3CCV S;  2KKH A;  2H3E B;  3EZ5 A;  2XS2 A;  3BDE A;  2NCK L;  2XHW A;  4HDH A;  2DY1 A;  2HLU A;  3TJA A;  3M2U A;  3Q22 A;  3ILI A;  1RE1 B;  2MMY A;  3IC1 A;  3PYF A;  1T9Y A;  2R8G A;  2B4O A;  5DJB A;  4DV2 F;  2KL8 A;  3MWB A;  2ZH6 A;  1DTQ B;  1QJH A;  2DXF A;  1IJE B;  4LFB J;  4JB8 B;  1FE0 A;  5D77 A;  3IFE A;  5ETL A;  1NUE A;  3M8Q A;  3X3U A;  1HNV B;  1B0V A;  1TV6 A;  4OI3 A;  1JQG A;  1RTH B;  3HVA A;  3DDN A;  2FZG B;  3V6H A;  4BDP A;  3S8S A;  1T05 A;  2B4P A;  2EC0 A;  5LM7 E;  1ZAX A;  4TQR A;  2QV6 A;  1R8C A;  3I0S A;  3V2U C;  1PYS B;  1N5Q A;  3CIM A;  4ZOS A;  3W2V B;  3RBE A;  1HYS B;  2Y9H A;  3UD5 A;  4CLZ A;  2YNG B;  1RWU A;  4YY3 F;  3U1M A;  3UVJ A;  2J7K A;  3GPA A;  4DV7 J;  4P74 A;  2B9X A;  3DMJ A;  2VD3 A;  5J2M A;  2OPR A;  2X1G A;  3VQT A;  1YSJ A;  2VQF F;  3OFE A;  1GK8 A;  1P9Y A;  5CYQ A;  3M05 A;  3TO8 A;  4RNF A;  4DX6 A;  3HLU A;  2AJF E;  1CJK A;  1I3O B;  2JFK A;  4A8M P;  1OPI A;  2Z2L A;  3RRH A;  3KMQ A;  3FVY A;  1N36 J;  4I2Q B;  4PXC A;  1NND A;  3CJ8 A;  2OPP A;  2HEK A;  1J5O A;  2EG1 A;  5IQ6 A;  2UVR A;  2RU9 A;  4QPX A;  2IC3 A;  5HRO A;  3PM9 A;  4U8V A;  3GYX B;  3NOC A;  1S1W B;  2L08 A;  3IXQ A;  4N56 A;  4QWB A;  3UDC A;  2MGZ A;  2BQR A;  3VZI A;  3TAQ A;  3J7Y U;  2BJ1 A;  2K7K A;  1GMU A;  1DZ5 A;  4FVM A;  4KBI A;  3PW5 A;  2AWZ A;  3L7P A;  2LU1 A;  1SIW B;  4B9S A;  4RW4 B;  2K1R A;  1N8R T;  2GVD A;  4OYM A;  2KM8 C;  5LMN J;  2Y1J A;  4WP3 A;  3AB2 B;  3SCJ E;  2Z0G A;  1A7G E;  2ZVS A;  1FTC A;  3K0J A;  4CO4 A;  3G87 A;  2PO4 A;  2OIH A;  1LWC A;  2OLW A;  2QO3 A;  5DQH A;  1Q4R A;  2JFD A;  3MR5 A;  1XNQ J;  3K5O A;  3HDS A;  3FBF A;  4X65 J;  2LXI A;  4YDD B;  1Q8K A;  1CQN A;  1PGZ A;  4M94 A;  5E41 A;  4HYK A;  2B56 A;  1JNZ B;  2JDJ A;  4G1P A;  3D68 A;  4OX9 J;  1SIZ A;  2KM8 B;  4DFJ A;  2BJ7 A;  5J1N A;  2HNY B;  3DLK B;  3J80 U;  3LGN A;  3W62 A;  4FF3 A;  3CCU S;  1FRM A;  4OYX A;  3CJK A;  5DG9 A;  4DUY J;  3TR5 A;  2KXH A;  3LTO A;  2VG5 A;  1IQZ A;  3N6L A;  3W5Z A;  1QVF R;  1LEO A;  4DPY A;  3VAK A;  1RT6 B;  4NA2 A;  5J2Q B;  1H38 A;  3HFZ B;  1JLE A;  2LEC A;  1LW2 A;  1P8G A;  3DLB A;  3HD2 A;  2P2C B;  1S79 A;  3GB0 A;  2FUG 9;  3FMB A;  3EM1 A;  5GAG I;  2WSE C;  5BJR A;  4TY8 A;  1M1H A;  2Z56 B;  2XYH B;  1ZM3 A;  5KG4 A;  4N41 A;  1NLK L;  3AOB A;  2IJR A;  3HSD A;  4U9R A;  2ZD1 B;  1CUL A;  5C25 A;  6FDR A;  4RO0 A;  4ECR A;  4DV7 F;  2NLW A;  4EGL A;  3MD3 A;  4PEO A;  4M1K A;  2N7Y A;  4CNY A;  2RF2 A;  3D3B J;  2HS4 A;  3MED B;  1D8Y A;  2V4R A;  1S7H A;  4IRK A;  4NI2 B;  3VV2 B;  4TYB A;  3E01 A;  4DR5 F;  3DGV A;  3T1H F;  1PC5 A;  1VQO S;  2FD2 A;  1HWK A;  2UV8 G;  3TVY A;  4OYP A;  3KG1 A;  3OSP A;  1YDL A;  3SIP B;  1YJT A;  3ETM A;  2Q43 A;  1TK8 A;  1F3F A;  4NYO A;  4A8Q A;  1VK8 A;  4FBU A;  3S6E A;  5I3U B;  2V9K A;  3OHB A;  4AD6 A;  2AJ2 A;  2Z58 B;  3UDE A;  3HVW A;  1O6X A;  4K59 A;  5IXU A;  3OLA A;  1VC5 A;  2JX2 A;  2AU0 A;  1O5J A;  3M8Y A;  4DR1 J;  4E0D A;  1B7Y B;  1URN A;  1U02 A;  2UU9 J;  3ELH A;  4LF4 F;  3BKF A;  3LAK A;  1KBR A;  3IG1 A;  3DI6 A;  2AV5 A;  3GYN A;  4OX6 A;  4OYZ A;  4NXM F;  2BJ9 A;  2C2R A;  1S0N A;  1S1U B;  3D1H A;  2YBV A;  4NLU A;  2R8J A;  1HPZ B;  3GFH A;  4JI8 J;  1SBR A;  2IDE A;  4RW9 A;  5LMN F;  4FPR A;  2AYE A;  3QGI A;  1HHT P;  3J81 U;  1HNX F;  4AQY J;  5IOL A;  2YQ3 A;  3MM5 B;  4G1Q A;  3FGV A;  4Q5V A;  3WZ0 A;  5HN0 A;  3CME S;  1H98 A;  1RYR A;  3AFG A;  5A8K A;  2XNR A;  2HBR B;  2OTJ S;  4UUW A;  2MQO A;  4LF7 J;  4O3R A;  3CJS A;  1QM9 A;  5K8P A;  2ZJR Q;  5AXN A;  2DK2 A;  4I1T A;  4OX9 F;  5G0R A;  1RBA A;  3EVO A;  5H9E J;  5D0R A;  4NZ0 A;  2W7O A;  3EYZ A;  3K8V A;  1MWY A;  2DGW A;  2OEL A;  2R9L A;  2AX0 A;  3UCG A;  4DUY F;  1HFE L;  1OY9 A;  4Y34 A;  3HZE A;  5T14 A;  3T5K A;  2FC8 A;  1WNE A;  1Y10 A;  1D9D A;  2FGO A;  4IH7 A;  3TVZ A;  4EBE A;  1YIJ S;  2W9B A;  2RQC A;  3BV8 A;  4W90 B;  2DGX A;  1NPK A;  2OFG X;  4EO6 A;  1NSQ A;  1J5E J;  1YJR A;  2KT3 A;  3RGI A;  3U7J A;  1M5K C;  1T11 A;  3P5B P;  2MST A;  4DLG A;  3HPO A;  3HHL B;  4QIV A;  4J9R A;  3TAR A;  2WBM A;  1VCT A;  4LF2 A;  4ZVO B;  3LQV A;  2Y0B B;  1RAA B;  4J9Q A;  3ZZY A;  3KK1 A;  1KVI A;  1ZM2 A;  4CLY A;  1VQ4 S;  3FMW A;  3ITH B;  2I0X A;  4OYW A;  2MXY A;  1YGY A;  2CQ3 A;  5LMU F;  2OP5 A;  1RWM B;  2DYA A;  3R5A A;  2W7P A;  4RBV A;  4PQA A;  2W2P P;  3NGD A;  3SSS A;  1FJG F;  2KRR A;  4KFB B;  1CLF A;  2FYX A;  2XY7 A;  2N7C A;  5CZX A;  5CD4 H;  1X5O A;  4DL5 A;  4YR0 A;  1RTI B;  1NK4 A;  2CFX A;  3JTP A;  3K2Y A;  3J7Y I;  4ECZ A;  2GZO A;  3AOD A;  3RAM A;  2DNM A;  5HSP A;  3NNC A;  1EB0 A;  3DRP B;  4C8N A;  1MNE A;  4O23 A;  2K3I A;  4W98 A;  1E6V B;  5CYM B;  2UU9 F;  1SKU B;  2ZM6 J;  2XMT A;  5K8N A;  2J7W A;  3N01 A;  3C6U A;  1AUS L;  1WDD A;  5HVH A;  2QYG A;  2EG2 A;  1JLG B;  2M3D A;  2CJA A;  1SKW A;  3GQC A;  2L9D A;  3RB4 A;  4RJV A;  5FLX U;  2K3K A;  1D9F A;  2PEB A;  1JLB B;  1HQU B;  2UXC J;  2ZJP Q;  1E6Y A;  2X7I A;  3TEG A;  8AT1 B;  2DO0 A;  2ZOM A;  3UDL A;  2E66 A;  3H2L A;  1TMM A;  4YOE A;  4DOZ A;  3I0R A;  1NO8 A;  1YBU A;  3KFW X;  2MHN A;  2YQ1 A;  3HI9 A;  2E7W A;  2BW2 A;  2IYG A;  1SC6 A;  4FYV B;  3N79 A;  3ZZT A;  1S4F A;  2IM3 A;  5L8R C;  3V4I A;  3I5B A;  4FN5 A;  3UCU P;  1HKA A;  4ZVR B;  1RLC L;  2RAQ A;  2XMU A;  2J9D E;  1UVI A;  2V5H G;  4RU2 A;  2XUL A;  2Q6C A;  1FWK A;  5ETP A;  1LW0 A;  5FII A;  4KYZ A;  4Q7A A;  4LUB A;  1JLC A;  4E2F B;  1HBO B;  4LSL A;  2BQU A;  1U6Z A;  2CG4 A;  1UTA A;  4JI1 J;  4W92 B;  1EQM A;  3QFH A;  1FXD A;  4TKT A;  3FEZ A;  2PII A;  3QZ7 A;  4P2X A;  3PYE A;  3IA0 A;  3DXS X;  5ETT A;  1VRT A;  2MQ8 A;  2MY8 A;  3R3T A;  1U24 A;  2V0N A;  3VAL A;  5IC6 B;  2BE9 B;  1YQH A;  2QMX A;  1HQ2 A;  4YHH F;  3ADA C;  4DL4 A;  2IIH A;  5J1P A;  4A4J A;  3NGS A;  1S6Q A;  2JEG A;  2YWK A;  2FVR A;  5DM7 Q;  4FYD A;  3KYL A;  3JB9 k;  2KZM A;  5KG6 A;  1NSP A;  3KHG A;  3BF4 A;  2VG7 B;  1SQE A;  4F25 A;  1XMO J;  1SV5 A;  4E98 A;  4ZHR A;  3ZZR A;  1S1T B;  2Z4P A;  1IKV B;  4K4T A;  4I69 A;  3LP2 B;  4N77 A;  1T9U A;  1ZYQ A;  3LP1 A;  4IRC A;  5BYQ A;  5D78 A;  2JHE A;  4HH1 A;  2E9R X;  3RBX A;  3OJU A;  2DGO A;  2Y3Y A;  1WDT A;  1EZZ B;  3DU6 A;  2B4U A;  4NLT A;  4USI A;  1M5H A;  2RU3 A;  3M6W A;  3NEK A;  3D6F B;  1YWX A;  4MIA A;  4U6P A;  1KFD A;  3C2P A;  3KUG A;  3P6Y C;  1WOO A;  3KMS A;  3M2V B;  1U7L A;  1H0H B;  1FWL A;  3W7B A;  2IM0 A;  2V8H A;  3V5R A;  5H9F J;  1Y11 A;  1NH7 A;  4WXO A;  2W01 A;  4CLU A;  2JC0 A;  2M52 A;  1HLW A;  2VFV A;  4ZCL A;  2FHJ A;  1FT8 A;  2YH0 A;  3GIJ A;  4X66 F;  4ZS6 A;  2HZA A;  3EDQ B;  3NS5 A;  1YTY A;  4PR6 A;  3FSX A;  2XI2 A;  3QWP A;  3GJQ B;  4JI5 J;  3G82 A;  4PYA A;  3M8Q B;  2E7V A;  3AB4 B;  4RNH A;  3QAU A;  2EKY A;  1RSC A;  3O1L A;  2HVD A;  4MK7 A;  2RKI B;  3V6D B;  1TV6 B;  1ZPW X;  5HMZ A;  4X4O A;  2ZEJ A;  4PCQ A;  3FFI B;  3HT3 A;  4OZJ A;  3KHL A;  1UFW A;  1G4C A;  1RAC B;  1T05 B;  2WSF C;  1UJ5 A;  4DHV A;  3I0S B;  2C2Z B;  2CPF A;  5E0O A;  4FKY A;  5IS2 A;  4AXI A;  4JI7 J;  4IG0 B;  4DV1 J;  2XY6 A;  4JI1 F;  1QD1 A;  3Q0A A;  3BR8 A;  2OPS B;  1GX5 A;  3G71 S;  1LWF B;  4F50 A;  1W26 A;  4H4K A;  3MHY A;  4DX5 A;  1R0B G;  4P2S A;  1NJY A;  2F8H A;  2IDL A;  1X0F A;  2Y0S D;  3DMJ B;  3BB5 A;  5J2M B;  2OPR B;  3CIZ A;  2DGQ A;  2ROG A;  3HMJ G;  2ZUG A;  2GIQ A;  3NMA A;  2M9K A;  5CYQ B;  2Z2Y B;  3TUI C;  3W2W A;  2GIR A;  3HHK A;  3PFO A;  1KN6 A;  1N0U A;  1CJK B;  4ILL A;  3GFZ A;  3FZ2 A;  1X4D A;  3FUY A;  2B0G A;  1U0S A;  4NE9 C;  4UY8 T;  5HJY A;  2Z2M A;  1S0V A;  5KFF A;  4RUB A;  5F8H A;  2UUC J;  4JBC A;  1J5O B;  3I4P A;  1RT1 A;  4F36 A;  4F3Q A;  5ETQ A;  4DPO A;  1X9M A;  3FSI A;  2NSC A;  4FVC A;  4A8K A;  4J7C A;  2M7S A;  1RKI A;  1UVM A;  3R5B A;  3OV7 A;  5G4D A;  1FRX A;  3DRX A;  1R6Y A;  3P5T L;  2MZJ A;  1URR A;  4O3Q A;  4QJV A;  3C16 A;  3OXF A;  2BW7 A;  2JOQ A;  4B3M F;  2CJY B;  4QQB A;  4ZVP B;  3IRW P;  2QE5 A;  4C9D A;  3DDI A;  1Q8I A;  2GVD B;  3CC4 S;  2CPY A;  2L3M A;  1KWM A;  3JSY A;  1XR5 A;  4OZ5 A;  4B3S J;  1PAE X;  3MAH A;  2IJF A;  1CC7 A;  2OUG A;  1DJ0 A;  2OEJ A;  3T5J A;  2FVP A;  4QWA A;  1KFS A;  1NK5 A;  1LWC B;  4NCB A;  5A2Q U;  4PG4 A;  2DH9 A;  3US5 A;  4P2M A;  2R7O A;  2Y8W A;  3R5C A;  4ZN3 A;  3BZQ A;  4J9K A;  1JK9 B;  2F4F A;  2HMI B;  4MK9 A;  2AZ1 A;  2RUG A;  2FHJ D;  2AEM A;  4ED5 A;  4J9N A;  2BBE A;  1G1X A;  4GVB A;  3W1Y C;  1FK9 A;  3LP0 A;  4MFB A;  2CQH A;  4J9U E;  5KFY A;  3QJP A;  1GTH A;  2E9T A;  2DHA A;  3OR1 A;  2ATC B;  2RNE A;  1WSV A;  2XS5 A;  1VBK A;  5KFQ A;  2CVI A;  2DGV A;  1Q16 B;  3CJK B;  3NWG A;  1XNR J;  3CNQ P;  4NLX A;  1PIE A;  4WF9 Q;  1NDK A;  4ZJL A;  1S0M A;  1OSD A;  1DY3 A;  3VHQ A;  3PX6 A;  2R8I A;  4KH0 B;  3NP5 A;  4PWD B;  3W9H A;  3D0I E;  2QA1 A;  2ZOG A;  2BM0 A;  4O44 A;  4TY8 B;  4WFA Q;  4OZ0 A;  1FD8 A;  5F8M A;  3ZZ0 A;  4C7Q A;  3KLG A;  4R5P B;  1CUL B;  3Q23 A;  1VR6 A;  3I5C A;  1NKC A;  2DEI A;  3CDE A;  3THP A;  1D3W A;  2CJB A;  2ZNY A;  2R7T A;  2RF2 B;  3ZO7 A;  4BWM A;  4FS2 A;  3N5F A;  1IXK A;  3PYD A;  4IO9 Q;  1R43 A;  2NSB A;  5GAD U;  1T9T A;  5HVF A;  2LDY A;  1K73 T;  3E01 B;  5I4M A;  2AMC B;  2L9W A;  4HT7 A;  3NRB A;  3JXO A;  2V34 A;  4Q0B A;  4KGZ B;  3M9O B;  5D0E A;  2HHU A;  5J2P A;  3L4B C;  4USV A;  1NK7 A;  4AL6 A;  4BLG A;  2BX6 A;  2VG6 A;  4LF9 J;  2ATL A;  2D69 A;  2VF3 A;  4LF8 J;  1SJQ A;  2WB1 D;  2P5V A;  4AE5 A;  4GKJ J;  4OV6 A;  3EPI A;  2V63 A;  3W60 A;  2YPY A;  5EUH A;  3J7A N;  2JLE A;  4DS5 A;  3M32 A;  1UCN A;  4KGX B;  2J9E A;  2JLF A;  4PRF A;  4NLP A;  4LF5 F;  2ZJQ Q;  3IG1 B;  3DI6 B;  4X2B A;  3QRR A;  1Q78 A;  1S1X B;  3GG1 A;  1H2U X;  4K7Q A;  5L39 A;  5T41 A;  1V5I B;  2DNP A;  3UFC X;  4EMD A;  3ZTR A;  4RW9 B;  5KT4 A;  2VFU A;  3CD6 S;  3PJ9 A;  4I6Y A;  3ZTQ A;  1W2I A;  1S59 A;  2BA9 A;  4DR7 F;  4Q2L A;  5KFO A;  4G1Q B;  2KHD A;  4CLW A;  2W8K A;  3K8W A;  3GIM A;  3UQS A;  1AFI A;  1CQM A;  3D54 A;  1S9F A;  3KHH A;  4CI0 B;  2RQ4 A;  3EGZ A;  2LA4 A;  3RBZ A;  4DQI A;  5LSR A;  4KIA A;  2XCP A;  1HHS A;  3QJL A;  2RML A;  1S7I A;  4F4X A;  3AY0 A;  4KV8 A;  1SC1 B;  1CC8 A;  1R8H A;  3JTN A;  3G6Y A;  4OZ1 A;  1H7X A;  1RTJ B;  3ISN C;  2ERR A;  4C11 A;  2VQE J;  1HL6 A;  3ICL A;  3AJ1 A;  2A2D A;  4QPT A;  2W4D A;  3GU0 A;  3UR0 A;  4P73 A;  3I5A A;  2G9O A;  2BZ2 A;  2IVF B;  4GC6 A;  2CPI A;  1LQ9 A;  1X4H A;  1U1M A;  1SKS A;  2G0I A;  4MJK A;  3H40 A;  1U1Q A;  3CCM S;  1NU4 A;  4JI3 J;  4DG1 A;  4B02 A;  4YFU A;  4R0E A;  2FVC A;  2CQB A;  2QFI A;  4C2M A;  1IM6 A;  1REV A;  2DR7 A;  2EW9 A;  3QQC D;  4ETX A;  1JJH A;  3UD4 P;  2P6S A;  2VJV A;  3DRR B;  2E1R A;  3QWU A;  3H59 A;  4XPE A;  2NRE A;  2LQ8 A;  3K58 A;  2H4W B;  2IM1 A;  3CWJ A;  4AYB D;  2ZDO A;  2Q66 A;  2QC3 A;  3UW1 A;  3PAC A;  1U1R A;  1HMV A;  1FKP A;  3I96 A;  2LLZ A;  2AP6 A;  4EUV A;  2WTF A;  4Y28 C;  1R6V A;  3R9L A;  1RHJ B;  5H9F K;  4YB1 P;  2OJ3 A;  4NLD A;  4CM2 A;  1QUP A;  1RXO B;  2V6A A;  3TJ8 A;  4ZN1 A;  2RRA A;  2VIC A;  1ITP A;  2EPI A;  4RBU A;  3CO9 A;  3G9C A;  5B0G A;  1UPM B;  4DCO B;  1OY8 A;  1FKA F;  3FEY B;  1F2G A;  3H5X A;  1VQL S;  1O51 A;  1FNX H;  2CQI A;  4I7F B;  3C6U B;  2NPI A;  2VFS A;  2MQM A;  3EGV A;  2MZS A;  3FQL A;  2VOO A;  2KFY A;  4JI2 J;  5B7W A;  2YNF B;  4ECX A;  1RT7 B;  2D1C A;  3UE2 A;  4KY3 A;  4RX6 A;  3W65 A;  2CYY A;  2H51 B;  3OXL A;  1UWB B;  1TR0 A;  1FX4 A;  2EFQ A;  3PXG a;  1RHQ B;  4H54 A;  1I94 F;  2XO7 A;  5K5M A;  4WU3 A;  4UT4 A;  5FJ4 A;  2MKY A;  4ERD A;  1E6Y B;  3KLH A;  4LFA J;  3R2D J;  5ETV A;  2I5J A;  4IKA A;  4C3K A;  1VFJ A;  4FNH A;  3THT A;  1C1B A;  5KFU A;  3B4D A;  2BE2 A;  1PIL A;  1U26 A;  4ZPC A;  2VON A;  1WAC A;  2RE1 A;  2NXU A;  1UJ4 A;  1S4E A;  3V4I B;  4CM0 A;  1HNI B;  3G6E S;  3MCS A;  1SC3 B;  2O1P A;  1SJ4 P;  3KNA A;  2IRX A;  2VPZ B;  3MM9 A;  4B3O A;  2LEB A;  1LW0 B;  4JV2 A;  2HRT A;  4JI3 F;  4AUK A;  4I64 A;  1MWZ A;  4QIF A;  4ZVQ B;  2ZZT A;  4F26 A;  4TY9 A;  3ENA A;  4LSL B;  2X1B A;  2CQD A;  3M2R A;  3QIP A;  3A13 A;  4ZIW A;  1GX6 A;  3SZ2 A;  5GAD I;  3DLE A;  1MN9 A;  4JI6 J;  3VTI A;  5I3Q A;  4MAK A;  2DPI A;  3PIO Q;  3DYA A;  1JXV A;  5K8O A;  3WBZ A;  3PEH A;  1D9A A;  5JVH Q;  3DU5 A;  4FS1 A;  4TXS A;  4K5S A;  1F5A A;  1S6Q B;  2BKP A;  4YDX A;  4CLF A;  5IFM A;  5D4N A;  1Y3J A;  2DCU B;  4DR4 F;  3R5J B;  1RU2 A;  3X1L B;  2FZK B;  1N33 F;  2AJQ A;  3FZB A;  5KFK A;  2V8G A;  2XTJ P;  2YKQ A;  2YVS A;  1UAW A;  2GVZ A;  3NBP A;  2GJ2 A;  1SPB P;  1SV5 B;  1O8B A;  4JYA J;  2A6O A;  1HBU A;  2Y1I A;  1HNW F;  5DS7 A;  4O3P A;  5AXM A;  4UW2 A;  4ALZ A;  1ZM9 A;  1N56 A;  1VOM A;  4I68 A;  4IRD A;  2PA3 A;  4FXD A;  4RWW A;  3LP1 B;  2AGO A;  2I9S A;  1WI6 A;  2B8Q A;  3EMT A;  2X1A A;  5U47 A;  4EFA C;  3BDP A;  4IR9 A;  1VQ6 S;  3OVA A;  4JI2 F;  1FWP A;  1S76 D;  1TMJ A;  2YXL A;  1XJW B;  2DIV A;  4MKB A;  2XYP B;  4LSZ B;  1U1N A;  5DET A;  2VHG A;  1HWI A;  2IRY A;  2ROP A;  3AQO A;  2J6U A;  2GO9 A;  1JWW A;  1RAF B;  1HYS A;  3WX8 A;  1VRU B;  4DSF A;  1OYD A;  1Q81 T;  1TAU A;  2OEM A;  5B09 A;  4DUT A;  2YNG A;  4Y2A A;  2A10 A;  5F3Z A;  4J9S A;  3TQ1 A;  4V19 X;  4UQG A;  2X3D A;  3KDO A;  1YIT S;  5GVQ A;  3CVK A;  3NGT A;  4RW6 A;  1EHW A;  3H5S A;  1CS4 A;  2CWX A;  2GIF A;  2CPE A;  4FZV A;  2D41 A;  4BHQ A;  1VK3 A;  4C8M A;  2PMZ D;  3MPW A;  3U02 A;  2J0S D;  1N5Y B;  1WC0 A;  4C8K A;  2XWX A;  4Y00 A;  2LQB A;  3GII A;  2VH7 A;  1KHV A;  4H4K C;  2MJU A;  2P6T A;  4DR3 F;  1QTM A;  3IM8 A;  1ACM B;  1S1W A;  3O44 A;  3TZZ A;  3KTQ A;  2D3U A;  3G96 A;  1F9E B;  2RS8 A;  1S6P B;  3W5X A;  4Y0F A;  1RCO B;  3HKW A;  2GQQ A;  1PBA A;  1F60 B;  4ELU A;  2DCL A;  4CO0 A;  4LFC F;  4JI6 F;  3OXG A;  2KH9 A;  5MLC V;  2GJI A;  3B8H A;  3CCT A;  1EX8 A;  2R7R A;  8RUC A;  1VJW A;  5J2N A;  2BRL A;  2BAB A;  1HW9 A;  3I31 A;  4X4V A;  3NS6 A;  4I56 A;  3BO3 A;  4ZVG A;  2W24 A;  2IA6 A;  4USH A;  2DNL A;  2ZHB A;  2HWI A;  2ZKU A;  3D0G E;  1JJ4 A;  1C4A A;  3RYL A;  4A8S A;  3DM2 B;  2H1Y A;  3OPK A;  2HHH F;  3PW2 A;  1JB0 C;  4DFM A;  3CTR A;  1XQI A;  2W7A A;  1Y00 A;  1XN9 A;  4V1A k;  1WEX A;  4MKV A;  2B43 A;  1NJZ A;  3DHW C;  2XCA A;  4K4Z A;  4ICL A;  1HWJ A;  4ED4 A;  1RT1 B;  3M8R A;  3C3L A;  4G65 A;  1N34 F;  2FJA B;  1L5U A;  5GMK a;  4OV1 A;  3V81 B;  3B82 A;  3IGV A;  1IBM F;  4OLO A;  4KE5 A;  2HHS A;  4CIO A;  3VVT A;  3GSI A;  2J5A A;  3RAX A;  2JWN A;  3Q8V A;  3Q8Q B;  3CJ2 A;  3JQM A;  1NSA A;  2XBP A;  3C16 B;  5J2Q A;  1D8Z A;  5CHC B;  4O4R A;  3ONQ A;  2F63 A;  1ZOT A;  1XC9 A;  4FP9 A;  5CCL A;  1K1Q A;  4DQR A;  3J7Z 5;  4M8L A;  1SJ3 P;  2H48 B;  2FVQ A;  2R3V A;  2RHQ B;  2MYF A;  2ZD1 A;  4JI4 J;  2IY5 B;  3MR3 A;  3NAI A;  2HS3 A;  1NK6 A;  3ZNU A;  3C66 A;  2UXD J;  4OZN A;  2P9E A;  3C14 A;  4KPY A;  5KG3 A;  3LA0 A;  4ZP9 A;  2U2F A;  4DSI A;  4TU8 A;  1C0U A;  4GVB B;  1FK9 B;  3LP0 B;  4DU7 A;  4MFB B;  2HFZ A;  2IVM A;  4ES2 A;  1WI8 A;  2F1F A;  4NMX A;  1LFP A;  1U6B A;  3H8Y A;  2WHO A;  1S9E A;  3SEO A;  2V94 A;  1U1L A;  1KTQ A;  2E1C A;  4YB7 A;  3ILJ A;  3OBI A;  1GFW B;  5KFM A;  4DSK A;  3HCX A;  1Y5L B;  3GIK A;  2EFP A;  2ZH1 A;  3T1A A;  4X64 J;  3FJ2 A;  2MZ1 A;  1L3S A;  4B08 A;  3HSG A;  4AFF A;  1X7V A;  4C0B A;  2OFH X;  4PG5 A;  1SVD A;  2BDP A;  2O01 C;  2ZWO A;  4O44 B;  3F44 A;  2VUG A;  3KLG B;  3M30 B;  3NOG A;  1Q5Y A;  1APS A;  5HAT A;  5L9X A;  1HPZ A;  3BSC A;  4ED2 A;  2F3J A;  2H65 B;  4JV0 A;  3R5D A;  3HK2 A;  2RB7 A;  1Y3K A;  3MCN A;  2DBB A;  1U2C A;  1A9N B;  2UV8 A;  2WVB A;  1HNZ F;  3NGU A;  1KLM A;  3QAE A;  1YLX A;  2C1E B;  4UZC A;  3RW6 A;  1Q8B A;  4Q0B B;  2D74 B;  2C3P A;  2PE8 A;  2JLG A;  1Y5I B;  1NDC A;  5J2P B;  2JSX A;  4DR2 J;  5BR8 J;  1XWL A;  2ZH7 A;  3MXH P;  5HQ8 A;  3VGU A;  3OUY B;  2VG6 B;  4L72 B;  1X60 A;  3CCL S;  3TI0 A;  3ZZZ A;  5DDO C;  2CUY A;  2HWT A;  1N32 J;  2F8E X;  2EK6 A;  5CH7 B;  1WHY A;  3H98 A;  2CAD A;  1PJ5 A;  1FFG B;  3O2I A;  2OKQ A;  1BD6 A;  1TK0 A;  1LWE A;  2A3J A;  4K0K J;  2W1B A;  3AD8 C;  3O5T B;  5JVG Q;  3ILO A;  3M32 B;  4IQM A;  1LK5 A;  2HNZ A;  4N76 A;  2DJW A;  3PZP A;  2R7W A;  1WHW A;  5L1J A;  1U6F A;  3HJV A;  1S99 A;  2WSC C;  1S72 S;  1X5S A;  2DIT A;  3A8E A;  3GIL A;  1DTT B;  4G3I A;  2R8K A;  2FC9 A;  4ZCM A;  2V8V A;  1S6U A;  1IM4 A;  1EAY C;  1GMW A;  2K7J A;  4B9M A;  4JI4 F;  1WSR A;  3HHL A;  3QFW A;  4DCP B;  2HK2 A;  1WC3 A;  3IS9 B;  1FFW B;  1T02 A;  2DNG A;  2YKP A;  5KFA A;  1U8W A;  4ZLJ A;  2HHQ A;  2CG8 A;  3AOA A;  2F5G A;  1RAH B;  5AXL A;  3W9I A;  1HQE B;  2WON B;  3CW2 C;  2IVY A;  5CA5 A;  1U2R A;  5DLF A;  1VIO A;  4EYI B;  1W25 A;  1PJ7 A;  4KV8 B;  2ASL A;  3NNH A;  4CDI A;  1XMQ J;  1ZAV A;  2FTR A;  4IDK A;  1WTB A;  4DL3 A;  2NYI A;  2RQK A;  2BMB A;  2BE7 D;  1BQX A;  2IFX A;  5C42 A;  1T9V A;  2N4C A;  2K06 A;  1TL4 A;  2HBY B;  2ZDP A;  3W63 A;  4C11 B;  3MUM P;  3A3N B;  2V67 A;  1WEL A;  2HFU A;  2BR0 A;  1FJC A;  1NB2 A;  5KG2 A;  4LF6 F;  4P71 A;  4Y2I A;  4A48 A;  1RTI A;  3W8G A;  1X5P A;  4OZ2 A;  3NCQ A;  5HMX A;  3CD7 A;  2D9P A;  5A0Y B;  1UJ6 A;  3H5U A;  5K9F A;  3I9Z A;  3UPF A;  3O3L A;  2JJ4 D;  2F4V F;  2DPJ A;  4X4U A;  4ZP8 A;  4RPF A;  4DG1 B;  4ZVU B;  4DV6 F;  4LRE A;  4WKR A;  1YI2 S;  1VMB A;  2AEF A;  3L7U A;  1WD6 A;  1REV B;  4ZMM A;  3TOQ A;  3DLJ A;  3K17 A;  2CNL B;  4ZPA A;  1VDH A;  3KUH A;  3Q8U A;  3VVU A;  1IKW B;  2DNH A;  1RT2 A;  4LVN P;  3HO1 A;  2Q1L A;  4NCA A;  1OY6 A;  4TVA B;  1RZM A;  3MM6 B;  1V3Z A;  1P1L A;  4C3M A;  2ZNZ A;  2B51 A;  1HMV B;  3D66 A;  5HVG A;  1FKP B;  3CGI A;  5EN1 A;  5KAK A;  1HQU A;  2XEX A;  4DR2 F;  4HAC B;  2KI2 A;  4J37 A;  3PYG A;  4NX9 A;  4BWJ A;  3N0V A;  7AT1 B;  5GAE U;  4H4M B;  4OMF G;  1N32 F;  3MEE A;  2YWH A;  2KRB A;  2FZC B;  1S5Z A;  2CQ1 A;  4B3T J;  4FYW B;  2W2M P;  4K0K F;  1YG0 A;  1FDD A;  4W4M A;  4B3R J;  4DPT A;  3OTO J;  3M6X A;  3JSB A;  4PWW A;  3CCE S;  3T19 A;  3MMA A;  4USW A;  2JVR A;  2GX8 A;  4Q45 A;  1R0A B;  4KJI A;  5KFW A;  2MJN A;  2W9C A;  3M1V A;  2PGC A;  4DSE A;  1A0O B;  5THW A;  2HRY A;  3D6T B;  1FF2 A;  2HQI A;  4JP8 A;  2ZH3 A;  2YPZ A;  1N6Q B;  2ILZ A;  1B3T A;  1SB6 A;  2O3D A;  4I67 A;  1Y9O A;  3C6T B;  3UNG C;  1BC6 A;  2EBE A;  1UA1 A;  1XMB A;  4PPD A;  1F6T A;  4M5N A;  3QT8 A;  1RWW B;  3KLH B;  1GMW D;  4LIW A;  1ZM4 A;  2XC9 A;  4QBU A;  2I5J B;  3HHL D;  5HJX A;  4DN0 A;  2FJX A;  1L3T A;  3O6Q A;  5HAO A;  4DPW A;  3LO3 A;  3EXC X;  1C1B B;  4ID5 B;  2UVV A;  4LR7 A;  4UF4 A;  3TNV A;  1UMJ A;  4ZVE A;  2BE2 B;  1RKJ A;  1WWH A;  4DL0 C;  4RKU C;  5KFC A;  1P9Q C;  3KJQ B;  3EJM A;  3W8P A;  4HH0 A;  1VQS A;  1WEY A;  2I1R A;  3AD7 C;  4K2J A;  2J0X A;  4C8Z A;  1G3O A;  7FD1 A;  1SJ1 A;  4WIQ A;  3CCJ S;  1VIS A;  3W66 A;  4B3O B;  1VLY A;  3H90 A;  5LJ5 Y;  3I6P A;  2ZBQ A;  1IBK F;  1GXT A;  2Q79 A;  2N3L A;  4ZVT B;  3BKU A;  3RW7 A;  3DGP A;  3VAJ A;  5KFR A;  1BQM A;  3QIP B;  3RJM B;  2CKW A;  2FLP A;  3DLE B;  2ALZ A;  3ZFV A;  1NHK L;  1DUR A;  4M5G A;  4DSJ A;  3QNW B;  2CAJ A;  3DYA B;  1S49 A;  3MEC A;  3IGN A;  1RT3 A;  5A8R A;  5K14 A;  1TUV A;  4F4A A;  3CDA A;  4OHW A;  5D3G A;  1VQ9 S;  2HGL A;  2C3Y A;  1HR0 J;  1EP4 B;  3PKM A;  4IYQ A;  1Z1Z A;  4DZ6 A;  1YRU A;  2ZH8 A;  2HQF A;  9ATC B;  1XR6 A;  2C22 A;  4NZ7 A;  2IM2 A;  5KFN A;  1C2P A;  2CJX B;  1FFS B;  1FRL A;  3IR5 B;  3TAN A;  1U1K A;  3I82 A;  2ASY A;  3CCZ A;  3KNG A;  1CBK A;  2GVZ B;  3NBP B;  4OYI A;  2M2B A;  3BQ1 A;  4QYR A;  2AGP A;  4OFZ A;  1HBU B;  4HKQ A;  4DS4 A;  2HHP A;  4Z7C A;  2OH2 A;  1UVJ A;  4CLK A;  4URQ U;  1T8E A;  2JRS A;  1HBM A;  2FPH X;  2MQP A;  4ECV A;  2HVH A;  2RKI A;  2EWH A;  5DDR C;  3V6D A;  3OTO F;  5B0B A;  3P45 B;  3HHE A;  4GKK J;  3AH6 A;  3T6J A;  2IJN A;  3FFI A;  4RNM A;  3A8I A;  4V19 J;  2WCX A;  3QLH A;  3VAG A;  3DCA A;  4L3K A;  2D9O A;  1T3O A;  2BOP A;  3SCL E;  2IPO B;  4IG0 A;  1RAD B;  4X84 A;  5HK4 A;  3ISZ A;  2OPQ B;  4R8U B;  2VA3 A;  1QSS A;  4ZVH A;  5ETK A;  2OPS A;  3T1Y F;  3CDB A;  3IMQ J;  3JYT B;  2G1H A;  5A6P A;  1SUQ A;  4HVZ A;  1LWF A;  4KGM A;  1WOS A;  4EK2 A;  3ENW A;  4EO8 A;  2PSZ A;  1HW8 A;  4UQT A;  5B0C A;  1D0E A;  4M95 A;  4QU7 A;  3T9N A;  4DV0 J;  4RW6 B;  5AXK A;  4Q43 A;  4AXJ A;  5HQM A;  2N4D A;  1CS4 B;  3IO1 A;  2LXU A;  4PKD B;  2W8L A;  2DY9 A;  3MR7 A;  1ZTW A;  2CPZ A;  4IO1 A;  3SYZ A;  5IC4 B;  1RGV A;  3IBW A;  2LP4 A;  2ZH2 A;  1TEL A;  2MY7 A;  2YTC A;  4QWE A;  1S6O A;  1NZ8 A;  4KGV B;  2XGQ A;  2Z57 B;  2AJ4 A;  2HHV A;  1R31 A;  4ECW A;  2E9Z A;  4CQ1 A;  2VKZ G;  1AZS A;  4DWI A;  5D15 A;  3CED A;  4M5I A;  1K44 A;  4KHP F;  3BGR B;  2V4Q A;  4YR3 A;  4LBH A;  4MKA A;  3KJV B;  9RUB A;  3PR4 A;  4PZV A;  2P9G A;  2EXU A;  2I2Y A;  4B9N A;  4E8U A;  1G2E A;  4K4S A;  4F2R A;  1GTE A;  5F8G A;  3SMZ A;  4RUC A;  1R8P A;  5J2N B;  2GCF A;  2K8G A;  4S0M A;  5IV3 A;  5B08 A;  1GQE A;  4F2S A;  4HEA 9;  1R27 B;  1RAJ A;  1RIS A;  2CA9 A;  1SH2 A;  2YY3 A;  2HHX A;  3CE8 A;  2DH8 A;  1DQ8 A;  1TP7 A;  3CJQ A;  3EE3 A;  3MGJ A;  2HRU A;  4GRS A;  3GON A;  5E3A A;  4ZJO A;  2A1B A;  1RT4 A;  1F9F A;  3N5B A;  1RA7 A;  3BYP A;  2R7S A;  2HMI A;  3AXK A;  1IR2 A;  1HWL A;  4ICL B;  1Z2Z A;  4OHX A;  4LFB F;  2B4V A;  4QW9 A;  3F56 A;  3M8Z A;  1J2V A;  3JSR A;  5KOX A;  3OTC A;  3KG4 A;  3BO2 A;  4LSN B;  3HF5 A;  1N5T A;  3PRB A;  3G4S S;  4IG3 A;  1OQ6 A;  4I2P B;  2POK A;  3OT9 A;  2I8E A;  5C24 B;  2LMI A;  5HLF B;  5HL7 Q;  2I6W A;  4BCA A;  1YJW S;  5ETM A;  4N47 A;  4ER8 A;  1U4B A;  4PWD A;  2JC1 A;  1VBZ A;  3MTK A;  4YEA A;  5CZV A;  2VKR A;  4K4Y A;  4MIB A;  1S77 D;  4HTJ A;  2VIH A;  1FER A;  4P7V A;  4R5P A;  2DR6 A;  3JQK A;  1I1G A;  4MIW A;  2ZBP A;  3I56 S;  1KSP A;  2KJW A;  3C14 B;  3CCW A;  2XS7 A;  2GMJ A;  1WG4 A;  3FC9 A;  3JTO A;  5FDL A;  3WX4 A;  4CLP A;  3SV4 A;  1C0U B;  3DDK A;  3FRY A;  4USJ C;  1RWP B;  2R2S A;  3KJN B;  1AW0 A;  2D3O R;  4ECT A;  2HKE A;  1RQ0 A;  5F41 A;  3TA1 A;  3L9Z A;  2JEJ A;  2IAJ A;  1BY9 A;  4Z37 A;  2CDR B;  2FLN A;  1S9E B;  1N36 F;  3DLG A;  2AF6 A;  2XLI A;  2QLW A;  3F73 A;  2ZH5 A;  2JL9 A;  1VQK S;  3CJ4 A;  4OQJ A;  4UZB A;  2VPX B;  1YJ9 S;  2YWW A;  3J7A 1;  3TQE A;  3GIR A;  4PWU A;  4ED7 A;  2ZE2 B;  4Q2M A;  2NXJ A;  1QLN A;  3NGR A;  3CJ0 A;  4DI6 A;  3SFG A;  1CPZ A;  1PYO B;  3MM8 B;  2LQ5 A;  2MKH A;  3VGT A;  1GXL A;  3EUN A;  4O4G A;  2XMA A;  5ITH A;  4RZR A;  4ES1 A;  2ZFH A;  1MN7 A;  4DR6 J;  1VQ5 S;  1S1X A;  4OIX A;  4WK1 A;  5KT2 A;  1A6L A;  3K5N A;  3CCQ S;  2WRM A;  4XTT A;  1RTD A;  2J6T A;  3HSJ A;  3R1L A;  3L3C A;  1G6B A;  3D9B A;  1KLM B;  2CNK B;  2PFF B;  3G2X A;  2YKO A;  4RNO A;  1FCA A;  3AQP A;  3M9N B;  3BBC A;  1XNQ F;  4X65 F;  4NLS A;  1VQ8 S;  3RRG A;  3TVK A;  4C8L A;  4QCL A;  2CRL A;  1C4C A;  3MD1 A;  4M63 A;  3RAQ A;  2NQP A;  1ZTT A;  5KFE A;  2MKK A;  2PC6 A;  3S1T A;  3IM9 A;  4O3O A;  2GMH A;  2M8H A;  2IYI A;  4NXN J;  2MKI A;  3TA0 A;  4L75 A;  2F9D A;  1LWE B;  3OL8 A;  3G8S A;  1RTJ A;  3DC2 A;  2R7V A;  2G4B A;  3IRX B;  4CWB A;  3HHL C;  1RAG B;  3GR1 A;  4JV1 A;  3SXL A;  2HNZ B;  4OLP A;  2VBY A;  1U49 A;  3BSO A;  4U7U K;  4KC5 A;  4N8N A;  1VC6 A;  4U96 A;  2MKJ A;  3QGP A;  4Y2M A;  2FJD B;  4TU7 A;  2NZC A;  1GAO A;  3BO4 A;  4A8Y A;  1UKU A;  1NBE B;  3GWC A;  1XER A;  1W7W A;  2CJQ A;  4GO7 X;  4P2F A;  2QEX S;  3H2U B;  3K5M A;  3RB3 A;  3DHX A;  4JOU A;  1KVK A;  1BE4 A;  1NK9 A;  3MPD A;  4LR9 A;  5GAH U;  3DRR A;  1NM2 A;  2OGU A;  4C48 A;  1UEU A;  1OMS A;  1H74 A;  4OHZ A;  2HQG A;  1FE4 A;  3D7S B;  4IDK B;  3JAM Y;  4FXV A;  4A47 A;  2V4J A;  5C42 B;  2GA7 A;  4NLY A;  5DGB A;  3P3D A;  4L76 A;  2YNH A;  3D0H E;  4QU6 A;  3QRP A;  2E44 A;  2RVJ A;  5AJ3 J;  1SJF A;  3AT1 B;  2F65 A;  5ADZ A;  4XDD A;  4DR1 F;  2W4P A;  3ZTP A;  5KG7 A;  4ED3 A;  2LA6 A;  4PXE A;  1TU0 B;  1YVF A;  3G6X A;  4M5J A;  1DHM A;  2YKN B;  3D3C J;  2BM1 A;  4BBY A;  4DFK A;  4I7F A;  3TAM A;  3W61 A;  3T9Z A;  1WF2 A;  4JI8 F;  1TL7 B;  3DOM A;  2YNF A;  1RT2 B;  1RT7 A;  5HBM A;  1FDA A;  5DDP C;  2UP1 A;  2BJE A;  4AQY F;  1UZH A;  1OWX A;  1UWB A;  3KK3 B;  3PFE A;  2GS8 A;  3MPY A;  1HWU A;  4DQP A;  3L09 A;  1X4B A;  1WKJ A;  5HMW A;  4LF7 F;  1RT5 B;  4YP3 A;  4Y6I A;  3Q8P B;  2J6S A;  5KG0 A;  4IOC Q;  2CQ2 A;  2PFD A;  3BH6 B;  5KG1 A;  3MEE B;  1UEK A;  3GV5 B;  1WKL A;  4PG7 A;  2MHE A;  3K57 A;  1T9W A;  2M5Y A;  4NXN F;  4EU0 A;  4NYZ A;  5E7O B;  2APO A;  2UXB J;  4FPI A;  3N9U C;  2H5I B;  1N54 B;  4WK3 A;  4DBQ A;  1QAY A;  2L9N A;  1HNI A;  4FXW A;  4J9P A;  1TUG B;  4FYY B;  3MMA B;  4K4W A;  1SJR A;  1FDN A;  3HVT A;  5AE1 A;  3B4M A;  2W9C B;  3M1V B;  1J5E F;  1NRK A;  1B4S A;  3MDF A;  1KQK A;  2FIU A;  1R3N A;  3DRS B;  4KKO A;  1AB8 A;  4AND A;  3W5Y A;  4DXL A;  3LWM A;  4UOH A;  4ZPT R;  4U7C A;  1FNO A;  3WHI A;  3JS9 A;  2V8P A;  1YBA A;  1TL1 A;  4ZJQ A;  2AJ0 A;  3R7S B;  3PO5 A;  1JLF A;  2ABY A;  1WG1 A;  3A8K A;  3DXB A;  2AKW B;  3ISN D;  2YWE A;  3RBD A;  5J1E A;  5LXY A;  5I42 A;  4YR2 A;  3WC0 A;  1ZET A;  1V6H A;  2PI4 A;  5DGA A;  4K4V A;  3MM7 A;  3PEJ A;  1DBD A;  3KG0 A;  3KUE A;  4OJ3 A;  4OJ1 A;  3NMR A;  2E1M C;  4WCE Q;  2H5J B;  1OQ3 A;  3FDS A;  3NG8 A;  5HQL A;  1RCX B;  1BWV A;  2BVZ A;  4ZDN A;  3Q8R B;  4MYU A;  5JXS A;  3NCR A;  1FJ7 A;  2D3Z A;  4DV2 J;  5AJ3 F;  2W2N P;  1TFY A;  2F9J A;  1BXN A;  3EX7 B;  2HVI A;  1M90 T;  2ZM6 F;  1TKZ A;  2C3U A;  3IAS 9;  3DGP B;  1BQM B;  3GP9 A;  1FD2 A;  2NYH A;  5KFX A;  1P1T A;  1X8D A;  1NEE A;  4LVO P;  3QBC A;  1ZA1 B;  2M70 A;  3C19 A;  2DNO A;  4J90 A;  3MEC B;  1X4G A;  1Q86 T;  1RT3 B;  3MFH A;  1X9W A;  5A8R B;  1S1V B;  4C0H A;  2MZT A;  5K14 B;  2BUN A;  3C46 A;  5D3G B;  2XLK A;  4DLE A;  2JEI A;  3UD3 P;  2XSJ A;  5DLG A;  3MOZ A;  1S48 A;  2EKN A;  5IZH A;  1RAB B;  4ANE A;  3QO9 A;  4ETZ A;  1VRU A;  2YQ0 A;  1NDL A;  4KB7 A;  5A6W A;  2UXC F;  1DQA A;  2KO1 A;  2MSS A;  4J9L A;  4P9S A;  1YX2 A;  3QID A;  2VQF J;  3MMB A;  3TA2 A;  5HAN A;  4F3O A;  2UUW A;  2KXN B;  3GFY A;  2MQL A;  2V2Q A;  5DQG A;  4OHY A;  3BQ2 A;  2QFJ A;  1NJI T;  4NLO A;  1NPR A;  1S0O A;  2OHD A;  1HBM B;  1NCL A;  2G2O A;  5BYR A;  1Q7Y T;  2FJV A;  2CZV C;  4QWC A;  4WE1 A;  1N5Y A;  1FRI A;  1X4E A;  3QT5 A;  1AT1 B;  1NXI A;  5F9N A;  3QLH B;  2UUA J;  2B5J A;  1OS5 A;  2VB6 A;  3FSY A;  1HD0 A;  2QRR A;  2QLJ B;  5GAH I;  1R7I A;  1ZS6 A;  1SH3 A;  1S6P A;  1MLA A;  3QSY B;  4IFV A;  1JKH A;  2HLT A;  2BJD A;  2YNI B;  4ZIT A;  3RU0 A;  2XM3 A;  2HZV A;  2RS2 A;  7FDR A;  5DG7 A;  1EJ7 L;  1SUQ B;  4IR1 A;  4A8X A;  2VL1 A;  4YN3 B;  3GE9 A;  4M5M A;  4AT1 B;  5C2C A;  4OJG A;  4I4B A;  2W25 A;  4Z7Y A;  5KTQ A;  3KLF B;  2P9C A;  4KH1 B;  3R2C J;  4L74 A;  1KHW A;  4CH1 A;  3TAP A;  3H42 A;  1M1K T;  4OHV A;  4FDF A;  1BQN A;  2X1F A;  4C98 A;  3DM2 A;  3FCW A;  3QT7 A;  1YKW A;  1OSC A;  3RB6 A;  4CO5 A;  4ZLP A;  2OD6 A;  4M5D A;  1T7P A;  1XMO F;  2UUT A;  5E3P A;  3HHD A;  5EDW A;  2ACM A;  1IKY A;  5ETO A;  3H4B A;  3ZZU A;  1HBN A;  1AZS B;  2WZ1 A;  3GSD A;  2EFN A;  5EWF A;  5K20 B;  2RD5 C;  2VFT A;  4F67 A;  3V81 A;  3MCO A;  2H5E A;  2BOA A;  3FBE A;  1X4C A;  3F41 A;  3DLH A;  1KKH A;  1WF0 A;  3SCI E;  4JUZ A;  3V6J A;  3PCO B;  4OI2 A;  4F0K A;  2CWK A;  3P49 B;  5H9E K;  2HFN A;  4Q8E A;  2BKO A;  2ADB A;  3LW5 C;  5IT9 Y;  4ZLL A;  2DHS A;  5A8W B;  4FBT A;  2DHH A;  4DPX A;  1MSW D;  4XPC A;  1R8A A;  1V3R A;  3CC2 S;  3T3F A;  1RUS A;  2QG9 B;  2E5I A;  1TL3 A;  1M1G A;  2QA2 A;  2EFO A;  1NJX A;  4F8R A;  4MTP A;  4NLR A;  3K5P A;  1UA0 A;  1BWE A;  5C2G A;  1RT4 B;  1TUW A;  2Z30 B;  4PUO B;  5L46 A;  2UVU A;  4JI5 F;  5M2P A;  4FF1 A;  4EZ6 A;  4GVL A;  4FYX B;  2GW8 A;  2BJ3 A;  4O0N A;  4RR5 A;  3M8P A;  4DR5 J;  1WC1 A;  4NAS A;  1P6T A;  3T1H J;  1FRK A;  2HWH A;  4FNI A;  1NPP A;  4ECY A;  4IG3 B;  4ILM A;  1KD1 T;  4CT8 A;  4J91 A;  3CJT A;  1QAI A;  2HFV A;  2UUA F;  1ZAW A;  1YJU A;  2VBX A;  2OI2 A;  4RNN A;  2FVS A;  4XIU A;  2KG0 A;  1PAU B;  4H4O A;  5C5J A;  1M5O C;  4O3S A;  3D4J A;  4JI7 F;  4DV1 F;  1U48 A;  4L6V 3;  2XO6 A;  2C28 A;  3MAA A;  2KB2 A;  1RU1 A;  5IT0 A;  4CYU B;  1MW7 A;  5KFP A;  4TLR A;  1TQL A;  4LF4 J;  2WOM A;  5HP1 B;  5KFL A;  1R8B A;  3AA8 A;  3VF0 B;  2KHC A;  3M30 A;  3QPI A;  2CJK A;  4NXM J;  1TKT A;  4KQZ A;  1HI1 A;  2HVZ A;  1U0H A;  1S9G B;  2HAI A;  3R5G A;  5B0D A;  2MKC A;  5FDL B;  3MPV A;  1HNX J;  3BEG B;  1IWA A;  2SXL A;  3I9V 9;  3GCX P;  4DU8 A;  5JJB A;  2IAJ B;  1MU2 B;  1V5V A;  1TK5 A;  2JH3 A;  1SL0 A;  3DLG B;  1IQT A;  4QYZ J;  1H72 C;  2RUS A;  4CH7 A;  4RUH A;  2UUC F;  3OUY A;  4NOH A;  5CQG A;  3ET6 A;  3BJY A;  4EBD A;  3BN7 A;  2VOD A;  2MQN A;  3CCR S;  5IWA J;  2MEW A;  3R7N B;  2KDO A;  4EBC A;  4GO5 X;  1RWV B;  1EIY B;  2J8S A;  4BC7 A;  1ICE B;  4QOT A;  2DO4 A;  4P72 A;  1HHQ A;  5DO2 A;  4O4G B;  1Q0N A;  4ZA1 A;  1LXN A;  4YB5 A;  2ZBR A;  1REG X;  4NZ6 A;  1PO6 A;  1DTT A;  5D0H A;  3TUP A;  3FEX B;  3KLE A;  3KWM A;  4ED8 A;  1RTD B;  5F3T A;  4B3S F;  3MEG A;  3LOU A;  4DN9 A;  3QSI A;  3IS9 A;  4KHM A;  1L3V A;  5IQQ A;  3GYG A;  3UO0 A;  1KOO A;  1T94 A;  3BGL A;  1SI9 A;  5EX0 A;  2RT3 A;  1AXQ A;  1SXL A;  4CO3 A;  1FX2 A;  3J7Z T;  2C2N A;  1HQE A;  4TLQ A;  2WON A;  5E2Q A;  4WYL A;  2DT9 A;  1BMQ B;  2CPJ A;  5LMU J;  4OYO A;  1C0T A;  4ES3 A;  2UZA A;  1ULR A;  1OYE A;  2WK4 A;  4ELT A;  4ZPD A;  4A46 A;  4F02 A;  1FJG J;  3OL7 A;  1BUX A;  4OZL A;  4B17 A;  5KT5 A;  2LDI A;  1XNR F;  3M7V A;  4DDF A;  3CMQ A;  4KSE B;  2AYB A;  2RH3 A;  4P6Q A;  2FJE B;  5SZT A;  5CYJ A;  2R7U A;  5A0Y A;  2QSF A;  3KDN A;  2KT2 A;  2FLO A;  5FD1 A;  2DNN A;  3QRQ A;  4R25 A;  4LF1 A;  1WOP A;  3LAM A;  5DQI A;  2QZ8 A;  3B54 A;  1OO0 B;  2C42 A;  5ETN A;  2PI5 A;  2PD1 A;  4NEZ A;  1VQ7 S;  1C1C A;  2DNQ A;  4NLG A;  2EFG A;  2N3O A;  4PXD A;  2VDH A;  3EGN A;  4USM A;  3D6H B;  4ZPW R;  3Q86 A;  5IT4 A;  1IKW A;  3VAH A;  3G6V A;  3HT0 A;  4DF8 A;  3HSZ A;  4WPA A;  1MML A;  3N28 A;  3PTW A;  3CJ5 A;  1VRQ C;  1FVS A;  3MM6 A;  2KVI A;  1S57 A;  1F9H A;  2B9W A;  1TL5 A;  3HVR A;  2ZH9 A;  2V4J B;  4HAC A;  3DRY A;  3TZW A;  1W2B R;  2HBZ B;  1TVR A;  4LF9 F;  2YNH B;  2EVZ A;  4NRT A;  4LF8 F;  4WKY A;  4H4M A;  5IWA F;  4BC9 A;  3LH2 S;  4DL2 A;  4GKJ F;  1EET B;  2LCW A;  2C2O B;  1U45 A;  4OYA A;  4RW8 A;  3CDU A;  3R1H A;  1N48 A;  1MWQ A;  2R42 A;  2QYC A;  3SDE A;  2YWG A;  3SSQ A;  4J9M A;  1WUU A;  4C97 A;  4K4X A;  3VR1 A;  3VAF A;  5IM0 B;  2HHT A;  2QMW A;  2RSQ A;  3H2V E;  1F1B B;  1RWN B;  2HQD A;  3MF5 A;  2ZZM A;  3TAM B;  4WTO B;  4OYB A;  2G13 A;  1R0A A;  3NL0 A;  3MR2 A;  3NNA A;  1RK8 A;  4O3N A;  3BPD A;  3DOM B;  2HAF A;  1IKX A;  5HBM B;  2FDN A;  1N6Q A;  2O66 A;  4HR2 A;  1BHN A;  1UZD A;  2YX1 A;  3C6T A;  2HIQ A;  1EAR A;  3ZTO A;  5M2R A;  2MZQ A;  3F0N A;  3EPG A;  4K2X A;  2MLY A;  2V2V A;  3PX4 A;  3PX0 A;  1T03 A;  1WHV A;  2QLF B;  3H7H B;  4YHH J;  4LIR A;  3LAN A;  3TZY A;  4ID5 A;  2VA2 A;  5CD4 A;  2H4Y B;  3WIU A;  3CO0 P;  1GT8 A;  2VC0 A;  2VQE F;  4DX7 A;  4ID8 A;  1M5V C;  2F7V A;  3A3O B;  4KO0 A;  2VC1 A;  2H9Z A;  1NKB A;  5K8M A;  2KU7 A;  3Q8S B;  2YWF A;  4LQ3 A;  1YJV A;  2ROE A;  2A6M A;  2EC2 A;  3HVT B;  2FQQ B;  3SQG A;  2DH7 A;  4WTY A;  1UET A;  1SL1 A;  2V2K A;  2LEA A;  3DLL Q;  2XMV A;  4KKO B;  4DMZ A;  1IN0 A;  3FBB A;  4K50 A;  4LJM A;  1TL1 B;  3IWL A;  1JLF B;  5L1K A;  3G8T A;  2WW4 A;  3RTV A;  4ENO A;  1VGY A;  3FK4 A;  3M9M B;  5J1E B;  2W9A A;  2WB4 A;  5I42 B;  3MUT P;  1EP4 A;  2BAN A;  1Q53 A;  2E5J A;  3MM7 B;  1VLO A;  3HHN B;  5L9N A;  2C3O A;  5E3C A;  2AYG A;  2J9C A;  3GV7 B;  5GMD A;  3SV3 A;  5E33 A;  2GV1 A;  4X66 J;  4KRW A;  2CPX A;  4ECU A;  3CXC R;  1UVL A;  3ENV A;  4LR8 A;  1VHF A;  5LL6 d;  4ZP6 A;  1TKX A;  4Q8F A;  2ZUA A;  4CO2 A;  2MKS A;  1Q82 T;  4TYA A;  4U8Y A;  1ROF A;  4QIG A;  1RB0 A;  1TKZ B;  2VFR A;  1RA6 A;  3GV8 B;  2EI5 A;  3RB0 A;  1T9X A;  5IV4 A;  4DV5 J;  3S7R A;  4A8W A;  4KR0 B;  4K5R A;  4CLL A;  4CH0 S;  3E3X A;  2X3G A;  2XZW A;  4C0O C;  3IR6 B;  2BYC A;  2AT1 B;  1H2T Z;  3NKY A;  2OPQ A;  1YJ7 A;  4R8U A;  3TX8 A;  2XQC A;  2XSJ B;  3R6G B;  3MMC B;  4DL7 A;  3IP0 A;  3HXM A;  3QO9 B;  4ZLN A;  2Z2Z A;  3JYT A;  2XNQ A;  2ZC3 A;  2GAG C;  3HD1 A;  4ED6 A;  2NPF A;  4LFA F;  3K7R A;  5KFZ A;  1VI7 A;  2HHW A;  1MMN A;  4U95 A;  2ZKT A;  2GO8 A;  3MOJ B;  2W2O P;  1FJE B;  4IH5 A;  3MMB B;  2M4M A;  2GGP A;  2KTQ A;  2DKO B;  4X4P A;  1UPP A;  4LRF A;  1QE1 A;  2V2Z A;  4USU A;  3W3S A;  2LYV A;  1UFL A;  3ULH A;  4WE1 B;  3PW7 A;  1SC4 B;  2DEJ A;  5GME A;  2GHV C;  3G8Q A;  4X4Q A;  2B5J B;  4UOC A;  3PG9 A;  2GHP A;  4J9V A;  4NA3 A;  3FCV A;  5B0F A;  3S01 A;  3BGR A;  4LT6 A;  4Y2K A;  4HT5 A;  3KJV A;  2VOP A;  4CP5 A;  4PAB A;  5AE3 A;  4QYZ K;  4IFV B;  1JKH B;  1NB7 A;  5RUB A;  3EWG A;  3OQ2 A;  1IJF B;  5KT6 A;  1MRO A;  2OD4 A;  4HI2 A;  4F4Y A;  4B3M J;  2I38 A;  1KQS R;  2QT7 A;  1LK7 A;  1CJU B;  3JAM U;  1Q79 A;  5C7P A;  3EGW B;  2ZC4 A;  1VQP S;  4KHR A;  3AHP A;  3GZ7 A;  1Z2L A;  3KHR A;  1T0T V;  5BYS A;  5D4O A;  1WC6 A;  4FKX A;  1BQN B;  3M2U B;  4LRD A;  1GH8 A;  3B78 A;  3VCD A;  1FXL A;  1HIY A;  2DHX A;  3SQO P;  3PRV A;  2LFV A;  3E51 A;  1NJW A;  4M5D B;  1CJV A;  4LRC A;  1LXJ A;  3CJ3 A;  2DNR A;  4JI0 J;  5DDQ C;  4JYA F;  2M8D B;  3NS7 B;  3PIP Q;  2OSR A;  1IKY B;  4IFY A;  2J9D A;  1PG5 B;  4IQX A;  1HBN B;  1BGX T;  4WXW A;  2FY8 A;  5JUM A;  3RG6 A;  4AL5 A;  3OTB A;  1AYE A;  4LSN A;  2OAU A;  2IMO A;  5HMY A;  2DGU A;  2ZIT A;  2E29 A;  2QL7 B;  2R7Q A;  4WII A;  4DV5 F;  4I2P A;  3TWZ A;  1KR4 A;  2AZ3 A;  5C24 A;  5HLF A;  2BXJ A;  3PHE A;  3R97 A;  4ATN A;  4DPU A;  2DVI A;  2KT5 A;  3KK2 A;  3IAM 9;  3UDV A;  4KT0 C;  2NUU G;  2Y8Y A;  5LSO A;  1N5V A;  1RAE B;  1CEZ A;  1PYT A;  4XAK A;  4ED0 A;  5KG5 A;  3NY0 A;  4UST A;  3AJD A;  3P8B B;  2PA8 D;  4L73 A;  1TL3 B;  4UOG A;  5DM6 Q;  3PV8 A;  1ZA2 B;  1UFK A;  1PBU A;  3UVJ B;  3NLC A;  1RI7 A;  5MAO A;  3SBM A;  1KQF B;  1IR1 A;  1GNK A;  2E1P A;  2ZBI A;  3HJF A;  3C15 A;  3BR9 A;  1KVJ A;  2YX7 A;  2NR0 A;  3M8P B;  4OI6 A;  3CD5 A;  2OML A;  2GQ2 A;  5ETR A;  2LEP A;  5EWG A;  1I5O B;  5M2U A;  2PDA A;  1UP1 A;  4EEY A;  2OPP B;  3EZO A;  4R0J A;  2DTJ A;  3T6B A;  1WEZ A;  2IC3 B;  5HRO B;  1RAO A;  2QA4 S;  2ZE2 A;  2VAS A;  4H4O B;  4QR1 A;  4YB6 A;  3CCS S;  1T95 A;  4TNO A;  2AD9 A;  3CF5 Q;  1CJT A;  1Z4U A;  3MAA B;  2EK1 A;  2MGZ B;  3MM8 A;  4F0M A;  1QDU B;  3NXZ A;  1RHK B;  5B0A A;  5LT5 A;  1X4F A;  5DZ7 A;  6AT1 B;  5KOW A;  4LF5 J;  3HZG A;  4DCJ B;  2WOM B;  3EZU A;  1S10 A;  1FES A;  4YS2 A;  3U1L A;  4MK8 A;  5KFG A;  5LOQ A;  3OR2 A;  1U8S A;  1TKT B;  2K1R B;  3PDN A;  4ZKA A;  3PW4 A; 
#chains in the Genus database with same CATH homology
 2DXE A;  4DZ6 A;  3NGT A;  3Q86 A;  1LWX A;  3ZTR A;  1EHW A;  3EIC A;  3PJ9 A;  2HVD A;  3EVW A;  3NGR A;  1WKJ A;  4KPC A;  1S5Z A;  1ZS6 A;  2AZ1 A;  4DI6 A;  3ZTQ A;  3ZTS A;  1S59 A;  3FBE A;  3FBB A;  4EK2 A;  4HR2 A;  3EJM A;  3ETM A;  1BHN A;  1XIQ A;  4UOF A;  3VGT A;  4S0M A;  4F36 A;  1S57 A;  3FBC A;  3EVO A;  1WKK A;  2DYA A;  3EVM A;  3BH6 B;  1XQI A;  1F3F A;  4WBF A;  2NCK L;  2CWK A;  3B6B A;  3BBF A;  4ANE A;  3FCV A;  1LEO A;  1WKL A;  3ZTO A;  5CAA A;  1B99 A;  3ENA A;  1VYA A;  1MN7 A;  1NDL A;  4ENO A;  1BUX A;  4C6A A;  4CP5 A;  4FKY A;  3L7U A;  1PKU A;  2B8Q A;  3EE3 A;  2BX6 A;  3GPA A;  3NGU A;  2DY9 A;  3EMT A;  1HHQ A;  5CAB A;  2AZ3 A;  2B8P A;  1MN9 A;  3ZTP A;  4ANC A;  3BBB A;  3Q89 A;  3Q8U A;  1NDK A;  3FC9 A;  3VVU A;  3EM1 A;  1NSK L;  2BEF A;  1U8W A;  3ELH A;  1NDC A;  1HLW A;  1W7W A;  3NGS A;  1NLK L;  1JXV A;  3VGU A;  3VVT A;  3R9L A;  2DXF A;  5C7P A;  3DDI A;  3Q83 A;  3VGV A;  3FCW A;  3G2X A;  5BXI A;  1NPK A;  2HVE A;  1UCN A;  3Q8V A;  4W98 A;  1NHK L;  1BE4 A;  1NDP A;  3MPD A;  1NCL A;  1NSQ A;  1NUE A;  3FKB A;  1K44 A;  3B54 A;  3BBC A;  1B4S A;  3WX8 A;  1NSP A;  3FBF A;  3Q8Y A;  1PAE X;  1F6T A;  4UOG A;  2DXD A;  4DUT A;  4FKX A;  3GP9 A;  2VU5 A;  3DKD A;  4AND A;  4UOH A;  5IOL A;  1HIY A;  4F4A A;  3BH7 B;  4O0N A;  1NB2 A;  3PRV A;  2ZUA A;  1KDN A;  3JS9 A;  2HUR A;  3VGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...