5CABA

Structure of leishmania nucleoside diphostate kinase mutant del5-cterm
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
139
structure length
139
Chain Sequence
MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title The role of the C-terminus and Kpn loop in the quaternary structure stability of nucleoside diphosphate kinase from Leishmania parasites.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 41
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 5cabA00
1WKJA 1BUXA 4DZ6A 3EMTA 3FC9A 2BEFA 1F3FA 3FCWA 3EVMA 4EK2A 1EHWA 2B8QA 1WKLA 2ZUAA 1K44A 3FBBA 1NPKA 1BHNA 3MPDA 1NLKL 3DKDA 3EICA 4UOFA 2HURA 3Q8VA 3Q8UA 3ZTSA 1F6TA 3FBFA 4UOHA 3BBCA 4ANEA 5IOLA 4HR2A 3ETMA 3FBCA 3ENAA 3VVUA 1B99A 3JS9A 2DXEA 1HLWA 2AZ3A 4S0MA 4W98A 3Q89A 4CP5A 1LEOA 3R9LA 3Q83A 4ENOA 2DYAA 3FBEA 3FCVA 2DXFA 2DY9A 2CWKA 5BXIA 2B8PA 1NHKL 1NB2A 4WBFA 1NDPA 1S57A 4O0NA 5C7PA 1XQIA 1HIYA 3ZTQA 3BBFA 4F4AA 4ANCA 3VGVA 3G2XA 3NGRA 3EJMA 3Q8YA 1XIQA 1S5ZA 3VGUA 3DDIA 4ANDA 4C6AA 3NGTA 3Q86A 1MN9A 3NGSA 3B54A 5CAAA 2BX6A 1NUEA 3WX8A 1NSQA 3GP9A 2HVDA 3BH6B 2NCKL 4DUTA 3VGTA 3B6BA 4UOGA 1KDNA 1NDLA 1W7WA 3EM1A 3EE3A 5CABA 1JXVA 2DXDA 4FKYA 1VYAA 2HVEA 1NDCA 1B4SA 3VVTA 3BBBA 1UCNA 1NCLA 3L7UA 1NSKL 4FKXA 2AZ1A 3VGSA 1HHQA 1S59A 4DI6A 3EVWA 3ZTPA 1U8WA 3ELHA 1PAEX 1BE4A 3ZTRA 4F36A 1MN7A 1PKUA 3NGUA 1NDKA 1WKKA 1NSPA 3EVOA 2VU5A 1LWXA 3FKBA 3BH7B 3PRVA 3PJ9A 3ZTOA 3GPAA 4KPCA 1ZS6A
chains in the Genus database with same CATH superfamily
5CCMA 3MMCA 3H20A 4F2RA 2I5JA 1YQHA 3AJ1A 1FFGB 1O5JA 4KV8B 3DLGB 1VS3A 1KD1T 2XY6A 1LWEA 3MDFA 2ERRA 1RSCA 3CD5A 3MOZA 1SC3B 2XYPB 3C14B 3WX4A 3HDSA 1K73T 2X3GA 5M2UA 2DPJA 4I6YA 2O66A 1HQEB 4FNHA 3KNAA 2IVMA 3GYXB 2ZHBA 4NPOA 1XNQJ 1S7IA 2MY7A 4JBCA 2GVZA 2PI4A 2Y9HA 4F4ZA 5C24B 4CM2A 1OJ4A 2CPHA 1TL7B 3TVYA 2DEIA 1SB6A 3QT6A 4GO5X 3AH6A 1KHVA 3FK4A 1JXLA 4P7TA 1JB0C 3W9HA 4JYAJ 3NNAA 2D9PA 2XWYA 2R8HA 5BR8J 1SKWA 4HDGA 4X4VA 3RU0A 3TA2A 4DL0C 4GKJJ 1Q4RA 4A8OA 3HD1A 3GYNA 2OI2A 1REVA 3D1HA 1IWGA 5I42B 2M88A 2RRAA 2FLLA 4NLWA 3ILLA 4MIBA 3ZTSA 4ZITA 3POTB 5T14A 1J27A 2DJWA 2RVJA 2QLXA 3AOBA 4O3NA 2DGVA 5IM0A 1XMOJ 1VQMS 1REGX 1RT4A 4NYZA 5IQQA 1BC6A 1Q86T 3IBCB 2Q6BA 3DOMB 5A8KA 3G8SA 2WW8A 3PW5A 4OV1A 2C3MA 3D3BJ 2BXJA 1CJKB 2QRRA 4NLVA 2F4VF 3KK1A 4O3QA 2QMWA 3B54A 4B3RF 4ZLPA 2VA2A 4B3TJ 4PWDB 1U49A 2B4VA 4R8UA 5AJ3J 3HD2A 3AOCA 2DH9A 4DR2J 5KFLA 3JTOA 2LEBA 2HNYA 4OX7A 1PO6A 1FCAA 2KG1A 4BDPA 1Q81T 1R27B 3BO3A 4YY3F 1RTDB 4ZK7M 1F2HA 4IDKB 2DIVA 5DQGA 4XPEA 1SH2A 5D0EA 1PAUB 5LMNF 4RNOA 3H7HB 2YWGA 4EGLA 4ETXA 2XY5A 1WG4A 3PIPQ 3U1MA 4GKKF 1RU1A 1LWFB 4HLBA 2HKEA 3CSKA 4WE1B 5KFGA 2B8PA 1SV5B 3DRPA 1O6XA 3OFHA 4QJVA 1NJWA 1B7YB 3CDAA 1QTNB 1HMVB 4IG0A 3BGOP 3MAHA 2UXDJ 5JMNA 2MYFA 4K4ZA 4WU2A 4HYKA 1X60A 3KHGA 1S79A 1UW9A 2XZDB 4F8RA 4M5MA 2J7KA 5GAGI 4LBIA 3EXCX 1RQ0A 3GCXP 3E01B 4YB1P 4LF1A 1NSKL 4CDIA 3T6BA 5JUMA 3V6DB 3GU0A 2G1HA 4RUAA 2ILYA 2EFVA 1S1VB 5IZHA 1UEVA 2XM3A 4MYUA 4PYDA 3KLGB 1PJ5A 2XI2A 1RI7A 2K1RB 5L9XA 2RNEA 1YTYA 2YY3A 3DI6A 1T9WA 1FJGJ 3QNWB 2V63A 2HHUA 2FPHX 1X5TA 2HG4A 2BJ3A 5THWA 8AT1B 4J9VA 5KFKA 5HO4A 4FDFA 4GVBB 2ZBRA 2EW9A 2FJXA 4DQIA 3GCWP 3CD7A 3DC2A 4AT1B 3T1HF 4LRFA 1U1KA 2MZ1A 1YLXA 4P6QA 3JSMB 2G2ZA 5CHCB 5JJBA 3RZAA 2CPEA 2CNKB 2ZFHA 2CQPA 3IWXA 4ITSA 1NUEA 2KT5A 2FQQB 1JLBB 3SCIE 4DV7J 4ZCIA 4I7FB 3QGIA 4CH7A 3PHTA 4NRUA 2XBPA 4ZVRB 1RTJA 2XS2A 4RW6B 3W1YC 2XSJB 2DEJA 5KFBA 3PIOQ 1BE4A 4KY3A 3CIZA 2NUHA 1CLFA 4OHVA 2W8KA 2FY1A 3EVOA 1EARA 2IYIA 3CUNA 2ALZA 3NG8A 1T05B 4OYBA 3BKFA 2R2UA 5KFCA 3Q8VA 1QSYA 3QRQA 2MKJA 2XNQA 3M32A 2WBMA 5FJ4A 2BDPA 3DOKB 4IFVA 2OSQA 1JLCA 1TUVA 5I3QA 3ZXWA 3IBWA 2E1MC 1NKEA 1F9HA 4KFBA 1K0VA 3PO4A 5CD4A 3CNQP 3G6YA 4J91A 2LQ5A 1PJ7A 4DEZA 1S49A 3ISZA 1ZM2A 1EB0A 3LGHA 4HHJA 3D68A 1HKAA 1XMQJ 2BA9A 4J9OA 3A1YG 3QJLA 1FERA 3RUBL 1JLAB 3W2VB 4Y0FA 2HHSA 1HPZA 1U45A 1X31C 4CT8A 5F8MA 3L09A 2DXDA 1S77D 3O6QA 4FKXA 2AJ4A 4DR7J 1Q5YA 1AB8A 2F63A 4LF4F 5HI7A 3PO5A 1G1XA 4JI1F 1FFSB 3G71S 1Y3JA 1ZBTA 4NCAA 3MR3A 4OMFG 3FBBA 3OSPA 2Y0BB 3VAHA 4DN0A 4ED3A 2EWHA 2X51A 4F4YA 4JI8J 4RZRA 1RZMA 2N4DA 4BCAA 1UA0A 5KT3A 4ERDA 2AV5A 2O1PA 3JYTA 4PQUA 4B9NA 4C3MA 1WSVA 3IM8A 1R89A 5E3AA 3BGFA 2GGPA 4IQMA 4HHUA 3VAKA 4C8OA 1NKCA 1SBRA 1TK5A 4RLEA 1C1CB 3U1LA 2D1CA 1T94A 4LQ3A 5AE2A 3NGSA 3U02A 2BKOA 4OYAA 2CA9A 4Q8EA 5EX3A 1FDDA 4OJHA 4ZPDA 3HXMA 3BO4A 4FBUA 2MQ8A 2NXUA 3C46A 2KKHA 3AD7C 3TWZA 2RRNA 4WK3A 5F41A 2DT9A 3CO0P 2VFRA 2WOMA 1RUSA 3X1LB 5HVGA 2VDHA 5ITHA 2VQFF 1WKLA 2GHWA 3ENVA 3RRHA 2M70A 4DQRA 1H6KX 2CYYA 5I3UB 1TKXA 2ZOMA 4JV5J 2DXEA 3TA0A 2M9KA 4UUXA 2RU9A 4NLOA 2POKA 1FRKA 3ZZPA 3MEEB 1PYOB 5KFWA 4ZVHA 4A8MP 4I4BA 2ROEA 3L7PA 2W2PP 1QTMA 2QT7A 3M2RA 2G0CA 5F8JA 3NGRA 4OQJA 7FD1A 1LWCA 1YI2S 1IKYA 1N48A 3M6XA 1IKVA 4FN5A 2FLNA 2ZVSA 1QE1A 3MAAA 4DFMA 2FJVA 1JNRB 4DSKA 4QU6A 4M5DA 3FDSA 3FCHA 2Q43A 2ZKTA 5E3QA 3WC2A 4CQ1A 4J9NA 3W61A 1NPPA 4WFNQ 2COLA 2HGMA 3C6TB 1TMJA 1FRJA 4ELUA 3HPOA 4U8YA 4ECZA 5A8WB 4DL3A 2YPYA 4A8SA 1R0AA 2HFUA 2R8GA 1X4HA 1VCTA 5KG1A 2AZ3A 4ZCKA 1FDNA 3I87A 1FK9A 2NYHA 4CP5A 4ZA1A 2LP4A 2MJUA 3TX0A 4OZ0A 2DHSA 4ZLJA 3M8YA 3PEJA 3ZTQA 5GMEA 2FJWA 1RWPB 4PXCA 1DRZA 4ANDA 2LA4A 3SSRA 5JVHQ 2QSWA 4DN9A 3NS7B 4DR3F 4H54A 4HACA 4DFPA 2HVDA 3NAHA 4ES1A 4TVAB 4MJKA 1IBMJ 2QA2A 2KFYA 2J7UA 3G87A 3ILOA 1I94F 4CLZA 2PA3A 1DLOA 4LR7A 4DI6A 3EVWA 4RWWA 3TYTA 3UNGC 2MGZA 2MZRA 2IPOB 3W2WB 1S0OA 3DN9A 1HWKA 1IKXB 1HQUA 4ZLNA 1KLMB 3ZZTA 3P6YC 2HS3A 3I82A 3QWPA 2FVQA 2EC0A 1RP5A 5H9EJ 4C0OC 2MLZA 2IIHA 3NCPA 4WYWA 1KHWA 3C8YA 4ECXA 4QPTA 4G1QB 2IHR1 1U0HB 3CD0A 3QZ8A 2L3MA 5KG5A 2G13A 2DGUA 5HLFB 3X3UA 1VBXA 2RMLA 4NA3A 3PX6A 4QOTA 4Y2MA 3I0SA 2WSCC 3CVKA 2AYMA 2C2MB 3MMBB 4JOUA 3WX8A 2ZD1B 3VAJA 3RAXA 2FJAB 2LQBA 2VBZA 3K5NA 4J7CA 3ULHA 4E98A 4K4TA 2BQRA 3D4JA 4IRDA 3RYLA 4USTA 4FXWA 4TYAA 2MEWA 5E33A 3H8YA 3O44A 1LW0A 2BKPA 5F8NA 2H1YA 3DRXA 3HT3A 3H2LA 2OMOA 3PV8A 3W9IA 3TAQA 3AXKA 5DM7Q 1UP1A 1MROB 5K8PA 2V2KA 3A3NB 4BS2A 4NCGA 1RWMB 1T9UA 2Z30B 4KKOB 3RB0A 4F7VA 3J81Y 2QFIA 1S99A 2R8KA 3S1TA 3H59A 4DL5A 4LSNB 1VISA 4DV5F 4OZ2A 4WTOB 1V5IB 3MEDB 1SIZA 1S76D 2FZKB 4LFCJ 2YBVA 5HROB 3P3DA 4KT0C 4RW8B 1SKUB 4DV6J 2HZCA 3UI3A 2EVZA 3JQKA 4H4OB 4AXIA 4NLTA 2MSSA 4H4MB 2V8HA 1CSJA 1HYSA 4B9VA 2GIQA 5C42B 3H4DA 3JAMU 4Y2KA 4ZPBA 3K5OA 1YK9A 4O44A 1MW7A 3NGUA 4M5HA 2F9DA 3LUYA 2BACA 3JQJA 2HWHA 2NYIA 2BW2A 4ZJLA 5G0RB 1F6TA 3IGVA 4CIOA 2Z56B 4B9UA 1LQ9A 2ACYA 2UXBJ 3V4MA 2O67A 2RQ4A 2HAFA 2Z58B 3QGPA 4AQYJ 2WSEC 2FVPA 4M94A 5T7LB 2ZBIA 4EYIB 2Z2LA 3MUVP 4EO6A 4TNOA 4X64F 4CCHA 1WTFA 4JI4J 2JFKA 1MMLA 5KG4A 3JTNA 1S1TA 2ZJPQ 5D3GB 2BYCA 3QGGA 4DMZA 1QSLA 1X8DA 1N32J 3PR5B 1S4FA 2YKMB 4OLPA 1Z2LA 3KHLA 1Q1KA 2QIFA 2VL1A 4EO8A 3CCTA 4CNZA 1UAWA 3M8ZA 4FZVA 2A18A 2CJQA 2NPFA 3D66A 5EWFA 1U1LA 3UFCX 2Y1LB 5KFTA 2OO4A 4QWDA 1Q78A 1S9FA 1JXEA 2Y1IA 2FLPA 1UZDA 4UT4A 1Q95G 1U24A 4UF4A 3KKFA 2H4YB 4FYDA 2V69A 3GFHA 4FVCA 4X4UA 1C1BB 4UQGA 5IWAJ 3HHLC 2GMHA 4DCJB 1U47A 1HBOB 2FLOA 1VRUA 2YKNA 3A3OB 2XTJP 3FUYA 3A8KA 1VQ9S 3GV7B 2GNKA 1RT7B 1D9AA 5EWGA 4PUOB 1F1BB 2EG2A 1RTIA 2BM0A 2KM8C 2DH8A 4JI2J 3CMQA 2WVEA 2RF2B 3DLLQ 1PJ6A 2I2YA 1HR0F 5J2MB 2FJEB 4NEYA 2B6AB 1KS2A 3LPEA 2PC6A 3AFGA 5DLFA 3IP0A 2HNZA 4F02A 1HW9A 4DPYA 2A6OA 2WB1D 3FMBA 3GFZA 4CLTA 2E7XA 4MH8A 3NY0A 8ATCB 2ZH1A 3QGHA 1WD6A 3M1VB 4F3OA 2XZWA 1WC6A 2OPSB 1P9QC 4Q43A 5MLCV 3CW2C 3FRYA 2BABA 1VQ5S 3CDUA 2QE5A 4ZHRA 3NNCA 3NWRA 2AEJA 5D0GA 1V6HA 5K14B 3PW7A 4A8YA 4OL8A 3D6FB 5KFYA 2YX7A 3G82B 2AJ2A 2GFFA 2KT3A 3T5KA 4C98A 1ZOTA 4PYAA 2QJ3A 3QLHA 1KVKA 1XR7A 1H38A 2FB0A 4MFBB 2V4JB 3FKBA 2VPYB 2I9SA 3NMAA 3MM5B 4K8RA 4EZ9A 4ILLA 2VOOA 3MR7A 3FCWA 5GAEU 1P1TA 2M4MA 4DPXA 3PKMA 3OPKA 3HSJA 5ADZA 2HK3A 4USIA 5B09A 2RQCA 1WHVA 3V81A 2PEBA 4LF7F 3N28A 3E3XA 1NK9A 3KUGA 5F8GA 5CD4H 4YS2A 4JI3F 4B3TF 3BR9A 1X0PA 2EK6A 2YWKA 2EG1A 1TKZB 3R9LA 2D3UA 4DV3F 2JWNA 3DLEA 3ZO7A 1YVFA 2CJXB 4ELVA 2CQ1A 1E6YA 4G3IA 2GZOA 3UR3C 2B5JB 5A6WA 4LFBJ 2YKQA 3IAS9 1JJ2R 4QPXA 5AE1A 3IMQJ 1EQ0A 5HQLA 2LQ9A 4TXSA 1JK9B 5HMXA 2PA8D 1Y00A 5J2NA 4DV1J 5L1IA 1MN9A 4KHPJ 2DK2A 4C3KA 5FLXY 4PQAA 1NDCA 2QL5B 4GMKA 3VVTA 2G0IA 5JXSA 2M8HA 1N33F 2D9OA 1HA1A 4LF9F 2MZJA 4UY85 1WKKA 3D0GE 3MI7X 4KGMA 2VU5A 3LP1B 1TFWA 5J2PA 1VK8A 3H90A 1PYSB 4IH5A 5D0RA 1Y10A 3R7BB 3A8EA 1ZTWA 1R8CA 1Q16B 2H4WB 2OPRA 4USMA 3QFHA 3K5MA 3UPFA 1WI8A 3D28A 2XB2D 3TP2A 4QW8A 3BM7A 3SCJE 3C15A 2DNOA 1NB2A 1TAUA 2VPWB 1I6JA 2X7IA 3M30A 2K7JA 4DR1F 1QUPA 3HSDA 3ENQA 3NLCA 5HAOA 2QA4G 2HQCA 2JEFA 1UFLA 2NSBA 4LRBA 3CJKB 1EP4A 1T0TV 4G6VB 4X84A 2X1AA 1UPPA 1FJGF 1RT5A 4DCPB 4ZJQA 1G7CB 3H2VE 1UCNA 1X4GA 2A0FB 2EPIA 5C25B 2F8EX 1Q53A 1VOMA 2DHHA 1HNXF 2VB6A 3VAIA 2VC1A 2KVIA 2J5AA 1GMUA 3HFVA 4RNHA 4KYZA 2DNNA 3GILA 5J2QB 4O3OA 3BQ2A 1NB7A 3MPDA 3MF5A 3Q8UA 1QAIA 2OEKA 4X4PA 2VICA 1WTBA 1RWVB 4KB7A 1OQ6A 3BREA 4NLSA 3VVUA 2M0GB 4C3LA 5GAHI 4I0WA 4I2PA 3H40A 5HMYA 1U2FA 3GMGA 1T3OA 3KK3B 1PC5A 3WQPA 1URRA 1DFDA 1AZSA 1ZPWX 4PPZA 4ANCA 3EJMA 3IRXA 1S0MA 5KOWA 1URNA 4X4QA 3ZZZA 4CLPA 4RL1A 1CEZA 5FDLB 3Q86A 2AGOA 4FP9A 2BJEA 2L9NA 3LO3A 1HWUA 2BX6A 1FKPA 4C7QA 1VIOA 2VODA 3UWTA 1L3SA 1NAQA 5AE3A 4DSFA 1WNEA 1PC4A 2IMWP 2FHKA 2HQDA 1UFKA 1RT6B 4OYPA 1QJHA 4PEOA 4ZJOA 4HVZA 4ECYA 1BQMB 2JLEA 1GAOA 2CPXA 2W25A 4A8FA 3DYAB 5EGYA 3EICA 5JVGQ 2OD6A 5E41A 1H7WA 1GK8A 1Y4ZB 4OYXA 2DD8S 2P9GA 3Q8SB 3PYFA 5IOLA 1TL1B 1VHFA 1WF1A 3HJVA 1HW8A 2WZ1A 4URSA 3B8HA 4ZP8A 5L1JA 2QYCA 3NS5A 2JX2A 2OEMA 3FCVA 4B3MF 2DY9A 3GONA 2J6TA 2Q1LA 4DG1A 4TQRA 5EN1A 2OFHX 4W4MA 2B9WA 2RU3A 5CZXA 4N5SA 2E5IA 3OVSA 3SMZA 5D4NA 2X1BA 1KP6A 2DGQA 2IVYA 3M7VA 3IN5A 1U09A 5H1SV 1YJVA 5DM6Q 2NXNA 2LQ8A 3N79A 5J1PA 4A47A 1VK3A 4ILRA 3P5BP 4B3RJ 4ECTA 5CZVA 2HBRB 3KDNA 3UVJA 4ZDNA 4KO0A 2OUGA 1EKRA 2JLFA 3SV3A 4O3PA 2XCPA 3RB6A 3EGVA 2HPUA 2EBGA 4PWWA 2VG5A 1RLDA 2FHJD 4DX8H 1U2CA 3MZIA 1SIWB 1YWXA 4HTJA 1QSSA 2GHPA 3D0HE 1SXLA 3UCUP 3DLHA 5BYSA 4YY3J 4C4WA 2XYGB 3QMQA 3ET6B 4G65A 1RAEB 1FKOA 3TUZC 5LMNJ 5B0DA 4V19J 2HHTA 3CDWA 4IRCA 2B43A 2BE7D 1NJXA 5E0OA 2UUAF 3LALA 4DV4F 4KJIA 1YZ6A 4A46A 5KT2A 3KXDA 3CC2S 5KFOA 3I56S 3OV7A 1D1UA 4C11A 2BE2B 1Y7PA 4YR0A 4PXEA 1HNIB 2AJFE 3KDOA 3I32A 2RS2A 1UVJA 2OSRA 2YWWA 2D3ZA 4DX7A 1JKHB 2ZH7A 3QYYA 1H2TZ 4OZLA 2GS8A 5ETRA 1KOHA 1E6VB 3HI9A 3THTA 4LR8A 2XSFA 1U02A 5KT4A 1S12A 1OPIA 1U6ZA 2KYXA 2RT3A 4YR2A 2W7PA 5B0CA 1U1OA 1UZHA 1UWBB 3MM8B 4MK8A 2PI5A 2HBQB 1NHKL 3W5YA 1FTRA 3IWLA 3KJFB 1VBKA 3KOAA 2E5HA 2RHSB 2YNHA 4OLOA 1NK5A 4NA1A 4IOCQ 3PJXA 1HD0A 4NZ6A 3T1HJ 2H5EA 4M95A 2DR7A 3RR7A 1M5HA 2GQCA 2CQHA 3O2IA 1VQLS 2YNFB 4DR6J 2XWXA 2UXCF 1B64A 4MTPA 1BXNA 2DNMA 1GTEA 3H5YA 1CBKA 4EU0A 1S1WA 3IC1A 2D41A 2LECA 2H48B 1CG2A 3AT1B 3TA1A 3T9ZA 4X2BA 4I2QA 4ZLLA 4UOFA 2HQFA 2PMZD 1ZH5A 2W2NP 2VA3A 2XEXA 1OMSA 2V2QA 3M8QA 1FRMA 3M9NB 2XMAA 4KHRA 1CJVA 3OL7A 1CPZA 3AJ2A 3KLEA 2VFUA 1RT3A 3VAFA 1KFDA 5AXKA 3OD2A 2A3JA 1XK8A 3LP2B 3M6WA 3D6TB 3CWJA 2PIIA 2YKPA 3W63A 4ER8A 2PGCA 3SV4A 1VQ8S 3TI0A 2CQGA 4Q8FA 2N3LA 4AXJA 4USKA 3OLAA 1AUDA 1KOOA 3RAMA 3QT7A 2AZ1A 1VBZA 4OI0A 3RBDA 3DU5A 4RW7A 3T9NA 2HIYA 1RABB 2W9BB 3M8PB 3PZPA 3D54A 4EBEA 2XO7A 5HP1A 2R7TA 3FSYA 1EHWA 4LF4J 2R3VA 1JLQB 4OI1A 1JJ4A 1KONA 2W4CA 3W5ZA 4JI1J 2VG7B 4YR3A 4QCLA 4ED8A 3ETMA 4DX5A 3FEYB 1LOUA 1RU2A 3K89A 1RTHB 2XLIA 3NOCA 1UFWA 1HWIA 3HVWA 3KJVB 4RO0A 1ZM4A 3RBZA 3DGPB 3HVTA 3OFFA 3HLUA 4F2SA 4FF2A 2YNIA 1T11A 4ZCMA 2W8LA 2CZ9A 2ZC4A 3ITHA 1NSQA 1RAAB 2ILZA 1T03A 3EGWB 2FDNA 3FMWA 2EFPA 3AJDA 3J81j 1JNZB 4KH0B 3CJQA 3AA9A 3QO9A 1S6QA 4P71A 5DZ7A 1MN7A 5KFAA 2PD1A 1U4BA 1H73A 1IR1A 3CMES 3TAMB 3DLJA 2Z2ZA 1SQFA 4ZPCA 4L74A 5HBMA 2E1PA 4C2MA 5DGBA 3OTOF 4B3OA 1PGZA 3HMJG 1TVRB 3B4DA 2VQFJ 3HJFA 4WIIA 4R5PA 4C0BA 3J7Z5 3J81U 3TJ9A 1HWJA 2ZNYA 4DJBA 4W92B 1M90T 3F56A 2HW3A 3HHNB 1JLEA 2KI2A 4L3NA 2HHHF 1AFJA 4EEYA 3PEHA 4QYRA 4K4YA 1K47A 1DAXA 1VC0A 3LAMA 2G9OA 3B82A 3UN5A 3OTEA 2M8DB 2F8HA 2C3YA 3KLFA 1JJCB 2JC1A 1RJJA 4CT9A 2K7KA 2B0GA 1W2IA 4H4KA 3KG0A 1T7PA 3A8JA 1JXVA 5EX0A 4R25A 1S9GB 2RILA 4OI4A 2XY7A 3S01A 4LFAF 1F9FA 2YWFA 2Y1JA 4JB8B 3CB4A 2BQ3A 3OR1A 2BQUA 3H5XA 3M2UB 2YNGB 3C16B 2C2OB 1S1UA 2ADCA 4NWBA 4X4NA 4FS2A 2M7SA 1C0UB 3T6JA 3IA0A 2C2RA 4FVMA 2MLXA 4ED2A 1RA6A 5IC4B 3DRRB 1NJYA 2ZE2A 3PFEA 3UDVA 3MMAB 5L39A 3TJ8A 2VZ9A 1I3OB 1N32F 1FF2A 4YQWA 4XPCA 2G1DA 4K59A 4TY8A 1U8SA 2OPPA 1OSDA 2IC3A 1Q8LA 5DQHA 3U27A 4RW4B 2UU9J 4ZIWA 4NRTA 5CA5A 4I64A 4D3GA 3UDCA 1QUVA 2ZZTA 1RACB 2ATCB 4RUBA 2KHDA 1B0VA 3LPYA 3W9JA 2QA4S 4DR3J 1B7FA 2AYEA 1N6QA 1KQFB 4CLWA 2V2ZA 4DSJA 2HLTA 3E2EA 3PW0A 4U8VA 1N5YB 2GA7A 3LP0B 1WKJA 4F0KA 1CS4B 4U6PA 1NPKA 4QWCA 1YJ7A 3VWSA 5HMWA 2QMXA 3DLKA 1RWWB 4N8OA 4B3SF 2RKIB 3FJ2A 2AQ4A 1CC8A 2KJVA 2QLBB 3NBPA 2VQEF 4UOHA 2MLYA 3GJSB 3FVYA 1DTQB 3PX0A 4CLKA 4KE5A 1F2GA 2DYAA 2MZSA 3MCSA 4EFAC 3V4IA 1X9WA 4ATNA 4CWBA 5CYMA 3Q2TC 4K4SA 3CJTA 4JI0J 2W9CA 3DDIA 4M63A 3NNHA 3GIIA 3O3LA 1HFEL 4PXDA 3K59A 5KFJA 3KLIA 1MWZA 3JSBA 4Q7AA 3IBFB 3CC7S 1TL3A 3PDNA 5FIIA 4F3MA 3RR8A 3C6UB 2VFVA 5GMKa 1RCOB 2ZM6F 2PE8A 3PX4A 3RRGA 4M5LA 3K2YA 1MU2A 2E5LJ 1MMNA 4KH1B 1C0TA 1U1MA 3G8QA 3FSXA 3MMCB 5SZTA 5EWEA 4NLPA 2I5JB 4XDDA 1UA1A 3CIMA 1GX6A 4F4WA 2LFVA 5LL6d 4EBDA 2LXIA 1H3DA 1SJ4P 2DNZA 4WTYA 1BWEA 1LWEB 1A6LA 3W5XA 4WFYA 4B08A 3UW1A 5K8OA 1P1LA 3FBEA 2M2BA 4BWMA 4X62F 2XMTA 1R7IA 3DU6A 2J0QD 3D0IE 3LANA 1FE0A 3GJQB 2YTCA 1U1RA 1V3ZA 4DV5J 4M1KA 2AJ0A 2DR8A 2GVZB 3W60A 5DDRC 3GIMA 1RCXB 4OX6A 4EZ6A 5IQ6A 2YH0A 3BDPA 4LF6J 2BVZA 3MCOA 1RHUB 5IT0A 3GFYA 4G1IA 4OJ3A 2FVRA 2DKOB 2APOA 3GR0A 4Y2CA 2AT1B 4KGVB 1HBNA 3DRSA 3ONQA 4QR1A 2C2EA 3PCOB 4LUBA 1J5OA 4K0KJ 1NSPA 4QYZJ 1REVB 1IBCB 1FHTA 2EFNA 2PFFB 2YQ1A 3SXLA 3WC0A 1IR0A 3CCMS 2AGPA 3THVA 5ETLA 3PFOA 2XLKA 4IFYA 4F4XA 5F3ZA 3CCZA 1LW2A 5HATA 3MEGA 1UETA 3PTWA 4KHPF 4OIXA 4UOCA 1DURA 1G3OA 2GX8A 4FF4A 5KFZA 3HHEA 3MPVA 4ED5A 3GJRB 5IM0B 1IXKA 2U2FA 4DFJA 4DV0F 1RT4B 1TTHB 4ENOA 1VDHA 2IM0A 1SKRA 5I4MA 3EUNA 3CULA 4RKUC 2J9DE 5A8KB 4NEZA 4FXVA 2HK2A 3GIRA 3BGRA 4WF9Q 2WAQD 3HSZA 3DOLA 1XC9A 5DLGA 2NUUG 3JSRA 3KK1B 3J7YU 2EKYA 1UJ6A 2WVFA 1O8BA 2OFGX 5FLXU 3QJJA 5DRKA 2CNNB 4X64J 4DQPA 2W2QP 3MOJB 3KFWX 4YHHF 4JP8A 4OZ3A 4YFUA 4YB7A 3BZQA 3D6HB 1EAYC 1R8PA 2V67A 3H42A 4R8UB 1V3SA 1AFIA 4HT7A 1HHQA 4JI7F 3Q24A 4KTQA 3OHBA 4OFZA 4O0IA 4Q5VA 4NLDA 2HNYB 1VQ7S 1XN9A 1BUXA 1YJNS 1ULRA 5K9FA 4O4RA 4OX8A 5M2PA 1RTZA 4Z7CA 3DXSX 4L6V3 5ETPA 1WWHA 1BWVA 3BSNA 2MKCA 3SSQA 2N82B 3BBCA 4RW9A 3CCSS 5HANA 2WVCA 2W24A 2QMUB 4KPYA 4FYXB 5LM7E 2CQCA 1WC1A 1XBWA 5KTQA 4IG3A 2NSCA 3FGVA 5GMDA 5KFDA 2BOPA 3DRPB 2MPUA 1S9EA 2K3KA 2F4FA 2GV1A 3Q8YA 4IG0B 2LXFA 2IDLA 4MIWA 1A9NB 2ZNZA 5DZ6A 1NZAA 3RTVA 3HZGA 1XERA 3CT9A 2WK4A 3OW2R 1WC0A 5K20B 2RH3A 1WORA 3S8SA 3ZTPA 4GO7X 1T9XA 2F8MA 3MR5A 1ZETA 4HKQA 4K2XA 3C3LA 1AA1B 2RQKA 5EHHA 3FZ2A 1VJQA 4OI3A 4D3HA 1LK5A 4IOAQ 2LU1A 4LBPA 5A0YA 3A3PB 4FPRA 7FDRA 1HR0J 2GVDA 3DI6B 2AMCB 1WEYA 1FXRA 1JIHA 4MT1A 4FPIA 1UVKA 1SJFA 3MAQA 3PHEA 3QFWA 2VPZB 1TV6A 2D74B 3EDQB 3MM6A 4YP3A 3S7RA 2NXEA 2F9JA 2DGSA 3PVXA 5KFUA 2XMWA 5E5NA 3T5HA 4RNNA 3KUHA 1BQNA 5CAAA 5CYJA 2LCWA 2AJQA 4E8UA 4F25A 2MTLA 4HTIA 2I8EA 1UVIA 1WUUA 2GAGC 1RTJB 1FJ7A 1R0BG 3TZXA 3NOGA 1AYEA 1RHRB 2QX0A 1I1GA 2BEFA 3OJSA 3LTOA 4OYZA 5DO2A 2ZUAA 4ID8A 3H5UA 3W8GA 5CCLA 2EFGA 2JEIA 1SL0A 4CTAA 3QBCA 2C3PA 1DZ5A 2LQJA 2QN6B 3ZZUA 3M32B 1TELA 4RPFA 5KFNA 4CNYA 2F7VA 4IFVB 3TVZA 1ZZNA 4W98A 1JLCB 3UDEA 2V34A 4LF7J 4LR9A 4KFBB 4P75A 5KFEA 3QWUA 1F5BA 4JI3J 2WTFA 1CJTA 5ETKA 1HARA 5KT7A 4UW2A 4DR4J 2HHWA 4DV3J 2EXUA 2DH7A 1HBUA 3SDEA 1X5SA 2MKKA 1HPZB 2FYXA 2NCKL 4LSZB 2DO0A 3HFKA 2KTQA 1GXTA 1KDNA 1NDLA 2WSFC 2GQQA 4HT5A 3BSOA 3T1AA 3J7A1 1IQZA 1NJIT 1TL4A 1FX4A 3HULA 2R2SA 3ZTOA 2IM3A 4YB6A 2DITA 4X4TA 3G6VA 1FESA 1FRXA 1N33J 4USWA 3UCZP 2HHQA 2CDQA 3FEZA 3BB5A 1MNEA 2VBWA 3W3SA 4LF9J 1RB0A 4LT6A 2JLGA 4KR0B 3I0RA 2OH2A 4YB5A 4DPWA 4AL7A 1IWAA 4GVLA 2VOPA 3G96A 3L7OA 4ZP6A 1T95A 2JDJA 2ZUGA 3JYTB 4PQUB 2OGUA 4ZS6A 1YJUA 3UQSA 3QIDA 3AXMA 2GGPB 4ED0A 1FJCA 3IAM9 1C2PA 3ZNJ1 7AT1B 4QQBA 3SQGA 2CG8A 3P45B 2V94A 5LT5A 4ECSA 3BO2A 3GR1A 4DR1J 4IRKA 4OYOA 3PKYA 1Y5NB 4RBUA 3BJYA 4FKYA 3MGJA 1KN6A 1HI1A 3RJMB 2HIQA 1FRIA 4P7VA 1S6PA 3MURP 2MQLA 1HNVA 5KG3A 2KL8A 2WOMB 5HMZA 2NZCA 1K44A 1HNXJ 2ABYA 1WACA 2EFQA 2V8PA 1TK0A 2BANA 5H9FJ 4MKBA 1N5SA 2VF3A 1TKXB 1N88A 4X65F 1IM4A 2L48A 1NZ8A 4DS4A 4DR6F 1QD1A 1UL3A 3R7NB 2JRSA 1S1XA 2J9EA 1N5VA 3M2RB 1GMVA 2XMKA 1LWCB 2P8IA 3ZC4A 4F50A 2J8SA 2CPIA 5KOXA 4OHXA 1IKYB 3OL6A 1IKVB 3MECA 3KMQA 2MHEA 5E3RA 1ZA1B 1HBMA 4MKYA 1K8AT 4NLUA 3BYRA 5A8RA 4CLLA 2JEGA 4OHWA 2ZVIA 1QE1B 3MAAB 2RUSA 1XJWB 3I4HX 4URQU 4M5DB 2OTJS 1YDLA 5GVQA 2MQOA 5I3PA 1RWNB 1N34J 4W90B 2ZH4A 3UCGA 4DPOA 1X4BA 2AHOB 1Z1ZA 2QZ8A 4A8XA 2H54B 2V4RA 1M1HA 1SI9A 4CM0A 1R0AB 4BC9A 2MKIA 4KRWA 1MWYA 1FK9B 4DQSA 3EPIA 1HHTP 4HL9A 1EETA 1B0TA 3UO0A 2ATLA 1PBAA 3DM2A 3HKZD 3WHIA 3IR5B 3W7BA 9RUBA 4B3MJ 1IQTA 2DNQA 1VLYA 4OZNA 3HK2A 1FDBA 4JI6J 3JQMA 1AUSL 1Q79A 3DDNA 1OYEA 4TYBA 5DG7A 3GP9A 5IV3A 4HACB 2CQ0A 5GAGU 2I6WA 4U9RA 1IM6A 3FRZA 2DISA 1ZTTA 3KK2A 1S10A 3KYLA 4WFBQ 2JC0A 1DLOB 2R7QA 3EZUA 2MGZB 2FZGB 2VKRA 4DZ6A 3ILJA 3N0VA 2CQ2A 1KSPA 2VBXA 1HQUB 2YKOA 3DFEA 2RSQA 3OR2A 3JSYA 2OIHA 3OVBA 2KRRA 3THPA 2VD3A 1U0SA 5ETNA 3B78A 2Q66A 3QT5A 1R8BA 3CCJS 4USVA 1DQ9A 1KLNA 3K5LA 2R7XA 1OY8A 2AD9A 4ID5A 3BBFA 3BEGB 3G2XA 4N8NA 1SUQA 2QL7B 3UE2A 2HVZA 4QIFA 4CYUA 3I0SB 2R7RA 2L9WA 4QWEA 2KH9A 1S6OA 4TLQA 2UUAJ 4CI0B 5DETA 1SC4B 4ICLA 4DV4J 3TRGA 4KSEB 1X7VA 3MTKA 3VV2B 2FVCA 1VRTA 2XQCA 1VLOA 4OYWA 2RDIA 1TU0B 1L3TA 1KQKA 5IV4A 2DHGA 2HFOA 3CMAS 4DUYF 1TUGB 1LW0B 2ZBPA 3GWCA 4K7QA 2QC3A 4OZJA 3KWMA 3MM9A 3ZZOA 1TZ0A 1VGYA 4IH6A 4NCGB 1GFWB 4AFFA 4BWJA 4TN2A 3DNCA 3W62A 1Q5VA 3AA8A 5LJ5Y 3R5AA 3MHYA 4WKRA 1OPZA 4O0NA 1VHIA 1D8YA 3A13A 2CJYB 3ISNC 2ZJQQ 5H9EK 3CGIA 2FZCB 4USHA 2ZJRQ 1CC7A 1DQ8A 3OJUA 3K5PA 2Z2MA 1KNZA 5KFMA 4PKDB 3D2WA 1DQAA 4LIRA 4YUDA 5M2RA 4ELTA 3LWLA 1FVQA 3L4BC 1HYSB 1PILA 3V2UC 2HFZA 2HHVA 5J1EA 3GG0A 3RBEA 2KG0A 3RB3A 4B9LA 4DLGA 3IS9A 4O44B 1I51B 4CO3A 1NRKA 2HQ3A 2W4PA 3CJ8A 3H5SA 2HNDA 2UXCJ 1VQSA 3HHKA 1RHJB 3OTDA 3KLHA 3IG1A 5KFPA 2CNLB 3DCAA 4RWXA 2MQQA 3Q8PB 3TJAA 2UU9F 3D67A 2L08A 2E44A 1UEUA 1EZZB 2QYGA 5F0UA 1Z4UA 1WI6A 4OZ1A 2JFDA 3VAGA 2W2OP 1R0CB 2LEPA 4G1PA 2MQNA 2Z8QA 4B02A 3NGDA 2DHAA 1S57A 1OSCA 4Q0BA 2DNPA 5C5JA 3MD3A 4N56A 1U6FA 4P9SA 4WKYA 5CYQA 1PBUA 3NP5A 2B4PA 2DCLA 2OHDA 1S1TB 1AW0A 4CRJA 4F3QA 1M0SA 3IO1A 2RDJA 1FKAF 2R7SA 3SYZA 5KFIA 4CH1A 5GADI 1CQNA 4F36A 2VHGA 3L3CA 1OS5A 2JEJA 1JJHA 3HHLD 2D3OR 4NLRA 2E9ZA 1X9SA 1U1PA 2OPQA 5LMUF 3AD8C 4JI0F 3OUYA 1KFSA 2OAUA 1F5CA 9ATCB 2QA1A 2MQPA 2QSFA 1S48A 2LYVA 2E7VA 4YMEA 3BGUA 3TZWA 3HHLA 5LSOA 1B99A 1NNDA 2CQIA 4P2SA 3GJTB 4ZVQB 1FWLA 4J5OA 4R0JA 1CULA 2WVBA 3PYEA 4NZ7A 3ICLA 2IAJA 5KFVA 2CRLA 2N7YA 2E5LF 4QIGA 2W4DA 1VRUB 1YJRA 2YKNB 1NHUA 3P4UB 4Y3CA 5A76A 2D69A 1NO8A 1FRHA 1XMBA 5D8HB 4NXNF 1M5SA 3AHPA 4C8MA 5DJBA 1T8EA 3M6UA 4DSIA 2IBKA 3T41A 2ZBQA 3OL9A 3M4XA 1RTIB 2FC9A 1RWUA 3A8IA 4N76A 3QIPA 3KJNB 2LVWA 3BSCA 2XMJA 2Y8WA 3RW6A 2R2RA 3TEGA 4NI2A 3VZIA 2UV8G 3BS9A 1Q7LB 4NZ0A 1YG0A 3DXBA 2DRDA 2HNZB 4LF6F 2R42A 3NS6A 3OHAA 2YWEA 3OTOJ 4DV2F 1S7HA 4ZMMA 1VBYA 1NDPA 1NEEA 2DGWA 2X1FA 3HVRA 1QLNA 3PJWA 1WOSA 4K0KF 4MIAA 3BQ1A 5B0BA 6FD1A 3TOQA 3U1NA 1WOOA 3DMJA 2J6UA 4K4UA 1N56A 2HHHJ 2VPXB 1IUJA 4MYTA 2A2CA 4DHVA 4LSLA 4ZHRB 4C9DA 1FWKA 2RAQA 2E9RX 2AKWB 4L76A 4ZIVA 3LF0A 1IR2A 3VGTA 3BR8A 3TX8A 4HDHA 4PG7A 3K58A 2PFDA 1RT2A 3LAKA 3SI8A 3QLHB 4X66F 3BH7B 4O4GA 3SBMA 4LFAJ 4NMLA 3BPDA 2V0NA 3KNGA 5AXNA 1RHKB 3NAIA 2DNGA 2ZH9A 3Q23A 2IVFB 2C2DA 3QAEA 3V81B 4HR2A 3LW5C 3NWGA 1D8ZA 4DF4A 1KR4A 2BRLA 5KG2A 3M8SA 3DLEB 2UUTA 3RAQA 2HMIA 1IKWA 2VH7A 1E6YB 4F4AA 1RHQB 3NGKA 4CO1A 2O3DA 2ZWPA 2ASLA 3MFHA 1FI4A 2OJ3A 5J2NB 4DU7A 3EZ5A 1V9OA 4LREA 1YJ9S 1ELOA 2F40A 4KGKA 5CABA 1RAIB 2HVEA 4QZVB 1VI7A 2WONA 3OFEA 1N54B 3I4PA 3ZZ0A 4K4VA 4WU3A 3ZNUA 3VTIA 1N36F 1HI8A 1H72C 2Y8YA 4HEA9 4KPCA 1EJ7L 1VMBA 3R5GA 5J2PB 3GYGA 2H5IB 1WHYA 3LGMA 2VBYA 2J76E 2YPZA 5LXRA 2DPIA 3KJQB 1FTCA 1X4DA 1RT1A 1TUWA 5DDOC 4FNIA 1RAOA 4B17A 2OPRB 1DTTA 3OTCA 1BLUA 3QRPA 1AXQA 3TW0A 2D7SA 3EGZA 4B3SJ 3C15B 3SQOP 1WEZA 2VQEJ 1M5VC 3LA0A 3M30B 1F9EB 2BJ9A 2RIJA 1BY9A 3MM7A 2GJ2A 3R2CJ 1PG5B 5U47A 1CJUA 1EP4B 2AF6A 2MZQA 2DNRA 2BOAA 3B6BA 2IFXA 4RJVA 4X4SA 1RT5B 2ZDPA 1EKSA 3GE9A 2UUBF 3PXGa 4Z2XA 2QTWA 3LQVA 4TU9A 1J5EF 3PRVA 4KC5A 2K3IA 2ZM6J 3FFIA 1TKTA 4JV1A 4HI2A 2DGXA 2E5JA 3N6LA 2VG6A 2CXEA 2VJUA 3QJPA 1NHVA 3E8OA 1SPBP 3I5AA 2IM1A 1X4AA 1FEHA 1X4CA 1JLGA 4I2PB 3N6MA 5T41A 1BQXA 4YDXA 4WFZA 1AZSB 3K8WA 4DL4A 4ZPWR 3M2VA 4K4WA 3IRXB 4X62J 2DRBA 3BDEA 1S4EA 1UVMA 3K7RA 1JWWA 1FKPB 5KAKA 4DU8A 3BKUA 3T1YJ 2PN6A 3R27A 4AYBD 3AQPA 2RRBA 2CPZA 4BBYA 3O1LA 5KFHA 1JLFA 4DR5F 3MUTP 1Y9OA 4F26A 4K5SA 1B70B 4XO0A 3PNIA 4U7CA 3TARA 3GFXA 3PG9A 2V2VA 2IDEA 2CPDA 1ITPA 4DR4F 2DY1A 4KV8A 3HSGA 2DTJA 5LJ3Y 3DLGA 1V3RA 1NK6A 3MD1A 3N5FA 3PR4A 5SUHA 2NPIA 1RBLA 2FJBB 1HWLA 3LGNA 3C14A 2KXHA 4L73A 3N01A 1HQEA 4OV6A 5HL7Q 2QG9B 4QR2A 2V8VA 4DG1B 3G6XA 4F0MA 3I96A 5ETMA 4DV0J 3L95X 5AT1B 2W2MP 1OY6A 3TEHB 4OZ5A 5C24A 2C3OA 3V6KA 1TL7A 4Y28C 2B9YA 4IQXA 3NCRA 3WBZA 3AB2B 3FZBA 3HT0A 1FT8A 4DL7A 2X3DA 3CCLS 5RUBA 2P2CB 1U8WA 4NXMF 2RJZA 2NXJA 2NR0A 1K9MT 4FYWB 3UVJB 4MK7A 4KO0B 4YHHJ 3KHRA 1ZM9A 5I42A 2VG5B 4JI7J 2HRYA 2GHVC 1LXJA 1UW4A 1IBLF 1YSJA 3BGLA 2HBZB 3POTA 1A0OB 1K0TA 4NMXA 1X9MA 1LFPA 2AEFA 1Q0NA 3VAMA 3JXOA 2HHPA 1RYRA 3QQCD 4PG4A 1RWXB 2OEJA 4LJMA 4ECQA 5KG7A 4ETZA 1FKOB 2PSZA 3DOMA 4U7UD 3R97A 5IT9Y 5KT6A 3GLJA 1FVSA 2MHNA 1EIYB 2AEMA 1UJ4A 4TQSA 1CJKA 3WIVA 1NMEB 5HVHA 1Q8IA 4LRAA 5G4DA 5DDPC 4P2MA 1YX2A 4PWDA 1WC5A 2CZ4A 4CO2A 1NK8A 1KWMA 4C11B 1NCLA 4X4RA 2QLJB 1ZAXA 4Q2MA 1VFJA 3ELHA 2WHOA 3GTYX 2UVRA 1AT1B 4TY9A 1W2BR 1RTDA 3Q8QB 3R1LA 4IDKA 2ZH8A 1BHNA 1WOPA 1NBEB 2AYBA 4ED7A 1QY7A 2BRKA 3CTRA 2CG4A 2CIMA 1WEXA 2CPYA 4RU2A 1LWFA 3CJ2A 4WE1A 2CWKA 2BUNA 1SV5A 2ZHOA 1F5AA 3K57A 4ZN1A 2OMLA 3B4MA 4LF2A 1HMVA 2YNHB 3UD3P 2CUYA 1N34F 2V8DA 1RBAA 4RR5A 5KFQA 4ED4A 5E3PA 2RD5C 1D09B 3I5CA 2IRXA 4ZVOB 4UOGA 3UNYA 3E01A 1DARA 3L7UA 2DIUA 1NJZA 2KB2A 3V6DA 2C1EB 2GC8A 1HNZF 4CLSA 4MKAA 1IN0A 1PAEX 3L9ZA 1H74A 1S1VA 2F3JA 2HFNA 1Y0HA 1P27B 1M1GA 3TVKA 1P6TA 3KLGA 3O5TB 4WP9A 2AWZA 4YN3B 4NE9C 2J9CA 4U67Q 1S1WB 2K1RA 3NL0A 5LOQA 1QM9A 1SQEA 2J9DA 3TQEA 4I2QB 2DR5A 1KQGB 1WG1A 4JI6F 4LMZA 5ETTA 2DHXA 2V9KA 4RUCA 3HO1A 4LF8F 1MSWD 1UKUA 4GVBA 3M8QB 2Y0SD 4C48A 1CJVB 1FNMA 3KLEB 3VQSA 2MZTA 1RT3B 3FQLA 1XQIA 3GSDA 2IJNA 3JSMA 3RG6A 3T19A 4Y2IA 2B4OA 1SQGA 3VGVA 5L9NA 2Y1RI 4XK8C 3UR0A 2J0SD 1F0XA 1R43A 3VCDA 4NL5A 3BN7A 1JLBA 2IA6A 4DXLA 3LH2S 4I7FA 1Q82T 2NXCA 2DGOA 1S6UA 2KFZA 4HHHA 3EDRB 2Z2YB 2AX0A 4XIUA 3JB9k 1A7GE 2NLWA 4DFKA 4RW6A 1R31A 1L3VA 2XSJA 4A8KA 3QAUA 1OY9A 1FXLA 1OYDA 3DGVA 4MMOA 2CFXA 5BYRA 1RAJA 2VKZG 2MMYA 4RW7B 1LWXA 2XHCA 1C4AA 3N5BA 2G2YA 1T05A 3TAPA 5L8RC 4A8QA 5HP1B 2HVIA 3RGIA 4NASA 2W7AA 4PAAA 3AAWB 1IVZA 1D9FA 1Y5IB 3G6ES 3ADAC 1RLCL 1NK4A 3ZZRA 3DOKA 1VQKS 4Y00A 4Y34A 5D0HA 1T02A 2JNJA 3JS9A 3H0PA 2HHXA 4FYVB 5GAHU 4HI1A 4CO4A 2CPJA 1G4CA 2RUGA 2E1RA 2PO4A 4LQ9A 1M5KC 1HI0P 4K50A 4RBVA 1UTAA 2FGCA 4U96A 2KRBA 4FXDA 4O3RA 3CCVS 3HVTB 1VQ4S 5J1NA 4O3SA 3H2UB 3AQOA 2YNIB 3K8VA 1JLAA 3W2VA 3P5TL 3AB4B 3F44A 2H65B 1KKHA 3ITHB 1T03B 2J6SA 1VJWA 1APSA 3OVAA 4LF5J 2ROGA 2WB4A 3BPSP 3HM9A 3IXQA 1UVNA 5CH7B 3QO9B 1S6QB 3S6EA 5D6GA 2M5YA 3EVMA 2CWXA 5E7OB 2AJ1A 4AE5A 5HBMB 4FF1A 2F5GA 2GO8A 4B3OB 2KJWA 4A4JA 1HL6A 1F60B 3CPWR 2KHCA 2PEHA 1WSRA 4KGZB 4R5PB 8RUCA 1M1KT 2MKYA 2N7CA 1LEOA 2CKWA 3CJSA 1JLEB 2MY8A 4ECUA 4X65J 2XGPA 2ROPA 4NLQA 5DS7A 3UN3A 1FDAA 1C1CA 4CO0A 1NM2A 2Y3YA 2UUCF 2A1BA 3WDOA 1WF0A 3KLFB 1NSAA 4QW9A 2ZKUA 3IR6B 4UZCA 4RNMA 3R1HA 2XG8A 1U1QA 4PG5A 4QIEA 4J9PA 2XS7A 4QR0A 2B9EA 4GRSA 2B9XA 2XO6A 2ZOGA 1D0EA 2HBYB 2SXLA 3I6PA 3OR1B 2P9EA 4DUZJ 3TQ1A 2B3TB 1S1UB 3PJ9A 1KTQA 3Q22A 1T9YA 5L1KA 1NXIA 1XEZA 1GT8A 4ZPAA 2WRMA 2ASDA 2H9ZA 2ZWOA 4ZVUB 3CCES 4EI2A 4AL6A 1YRTA 4NOHA 5I3UA 5B7WA 2FY8A 2AIRB 2ZE2B 4JUZA 3CO9A 3W66A 3OBIA 5IS2A 3MEEA 4C0HA 4AL5A 5IT4A 1OIAA 1PIEA 1WHWA 3TUJC 2ZDOA 4TY8B 1TQLA 4BHQA 5B0GA 2EBEA 2OPPB 2IC3B 4KHMA 1FNXH 4DWIA 3RBXA 4P73A 2W01A 4L75A 3M9OB 3T3FA 6AT1B 1RHMB 1QVGR 1XNRF 5D4LA 4QWBA 3BH6B 4TU7A 3M05A 3R6GB 3EE3A 3GSIA 2UVUA 2EC2A 3CC4S 2CJ9A 2HFSA 2MB0B 4PCQA 2PMWA 4ZPVR 3HP6A 4KIAA 4FF3A 4UTGA 1N6QB 1YJTA 3VQTA 2GJFA 2CDRB 1BMQB 1RAHB 1TMMA 2HLUA 2OP5A 3C6TA 3EMTA 2ZZNA 2HS0A 4OX9F 1V5VA 4URGA 2CJKA 1SJRA 2NQPA 3DLKB 1UPMB 5A8WA 1LXNA 2H5JB 2XCAA 4CO5A 2DB1A 4O23A 3NBPB 4ZN3A 2OTLS 2DCUB 4CLFA 3DHXA 1QVFR 2GO9A 3G9CA 2R8JA 3O8WA 2YQ0A 3K17A 3V4IB 2JVOA 1XR5A 5CYMB 4Q44A 1GQEA 2NS1B 1SL1A 4WP3A 3D6MB 2ZITA 2IJRA 5DG9A 2W7OA 2X1GA 4R0EA 2W9CB 2XS5A 3OQ2A 4USJC 3D9BA 3GV8B 2XZTB 2DO4A 3BSAA 1DY3A 1YGYA 3CDEA 5HJYA 1FA0A 3KLIB 3M9MB 1HNWJ 1TL3B 1B4SA 3TANA 2GAHC 4ILMA 4P72A 2ASYA 3PM9A 3TNVA 2CQDA 1MU2B 1Q8KA 1C0TB 3W2WA 4IO1A 4N7TA 1IKXA 1FXDA 2WW4A 2YWHA 5GAEI 4ZVFA 2DGTA 4F04B 2U1AA 1KLMA 2YXLA 2BJ8A 2V68A 4DUYJ 2BKNA 1TK8A 5KG0A 3FSIA 1ZZFA 1N5QA 2RE1A 2HZAA 2CADA 1TKDA 1HLWA 4USUA 3WIUA 4G1QA 3MR6A 1U0HA 4YEAA 2XGQA 2V9WA 4MK9A 5HLFA 2ACMA 3PYGA 4ZVEA 2R7VA 2KXFA 4I1TA 2LDYA 2EI5A 3HVAA 4ECWA 4CZCA 3J80Y 3VGUA 3MMBA 3F73A 4ZP7A 4U95A 2QV6A 4B9MA 1KBRA 2ZD1A 4WP8A 5L1LA 1DHMA 3HZEA 1OQ3A 1WC3A 1WF2A 3MMJA 4KBIA 5L46A 2V5HG 1L3KA 2JJ4D 2UP1A 2LDIA 2HGNA 2YKAA 1HBNB 3DRSB 1RK8A 2KXNB 1J5OB 4ZOSA 2K8GA 4P74A 2DNHA 5CXTA 2Z0GA 4IR9A 5IFMA 3D3CJ 1LKZA 1R3NA 1RAGB 1SJQA 2CQ3A 4V1Ak 3EX7B 4IFYB 1MROA 2HWIA 5F0WA 1LW2B 3MEGB 4OI2A 3BN4A 1NH8A 4KKOA 4DL2A 1Q7YT 2DNYA 3HKWA 1TL5A 1XNQF 4AD6A 4LSNA 2FGOA 4WWSA 3OTBA 3UN2A 3MEDA 3IR7B 2J0WA 4OJ1A 2VIHA 5HROA 1H0HB 4RW8A 4WXWA 2O5DA 2VASA 1O0PA 3CCWA 3BGRB 4H4OA 4C97A 2NZ4A 3DOLB 4L72B 4ZPTR 4JYAF 4TU8A 1X5OA 4NCBA 5BR8F 2EKNA 4H4MA 2UVVA 4GKJF 2IBOA 2MKSA 4A48A 5D77A 2XLJA 5C42A 4WZMA 2CNOB 2C22A 4C8YA 2GQ2A 4KGXB 2CQBA 4UQTA 2DVIA 2UV8A 1VC5A 3PW2A 3DLBA 2QLFB 4EMDA 2C2NA 4NYOA 4I6WA 3MCMA 1KEKA 1KVIA 2H3EB 1XMOF 5G0RA 3SZ2A 5F9LA 2OKQA 3FNNA 2IMOA 4QIVA 3MCNA 1Y3KA 4RW9B 4QYZK 2GMLA 5LMUJ 3AOAA 5K8NA 4I56A 4S0MA 4WXOA 1RAFB 2XI3A 4PR6A 5T7LA 4HH0A 1M5PC 4Q2LA 4IG3B 3CCUS 2W9AA 2AP6A 2JZ5A 1S9EB 3ENWA 2GCFA 1VQ6S 2GIFA 4KAIA 1RISA 1GXUA 1SC1B 5AJ3F 5D3GA 1AROP 4ECVA 4DR2F 1IBKJ 4LBHA 2YKMA 5EDWA 2OLWA 1FX2A 2KFNA 4NXNJ 2R7UA 4Z37A 3R5BA 5A2QY 5HSPA 3PYDA 4ZP9A 2MSTA 1WDDA 1Z2ZA 2RS8A 5A0YB 1CVJA 4F67A 2GVDB 2FC8A 4JI5J 3OSNA 2R9LA 4P52A 5D15A 3W8PA 5KFRA 3T1YF 1HD1A 4E0DA 5MAOA 3N9UC 2M3DA 3QRRA 3I55S 1C1BA 2KN4A 1TV6B 2UXDF 3MM6B 3TUPA 1YKWA 1HBOA 3HCXA 1SKSA 2N3OA 2MKHA 4K5RA 4DV2J 4MKVA 4I69A 2J8AA 2E9TA 5DGAA 1P9YA 1RT7A 3RW7A 1BQNB 3KTQA 2HGLA 4PUOA 2P6SA 4IH7A 4M5IA 2RF2A 1FFWB 5ETQA 2KO1A 4DSEA 4Z7YA 3Q8RB 4NA2A 5ETSA 1N5TA 2KDOA 3PRBA 3V5RA 4BC7A 2IY5B 5J2MA 1UWAA 3LOUA 1WDTA 1K1QA 4M8LA 1XR6A 1U2RA 2VV5A 4RX6A 2B6AA 3CJ3A 1U1NA 2N4CA 4X66J 2RB7A 4CTAB 2IRUA 2QL9B 3PRDA 2HQIA 3T5LA 3R7SB 4BLGA 3GG1A 4IKAA 2V50A 1RWKB 4N77A 4QIWD 3V6JA 4DPTA 4NX9A 2LLZA 3MPUB 4WFAQ 4C8ZA 1X4EA 5K8MA 4DCOB 1CJTB 2ZEJA 2LMIA 3M1VA 2OPSA 2E7WA 1TAQA 1XIQA 3HX9A 4DV7F 3A12A 2GMJA 3BYPA 1HBUB 5K14A 3SDEB 3QT8A 4WJBA 1GH8A 3G82A 4DS5A 2BW7A 1YITS 1VRQC 2DBBA 5B0AA 2F1FA 1S0VA 4XAKA 4UUWA 4MFBA 2V4JA 3P96A 2MXYA 4QU7A 3MM5A 4JV0A 3VHQA 3SCLE 1NPRA 2BE9B 2K2PA 4X4OA 4ZVGA 4OI6A 2HQGA 1N36J 3KMSA 3EPGA 4RU9A 3H4BA 1XWLA 3I0RB 1EX8A 5DQIA 3VF0B 4ANEA 4K4XA 1T9TA 2Q79A 1VQPS 1NU4A 1Y11A 3UD4P 1QAYA 1TKZA 4ZVTB 1OWXA 4NLXA 1X5PA 5LXYA 1XMQF 3R5DA 5IT9U 5KFSA 2KZZA 2VFSA 2B5JA 1WELA 3SQGB 4YDDB 1MWQA 2WVDA 2AGQA 3R2DJ 2DNKA 2JOQA 1IJFB 3SCKE 4DDFA 2UVWA 4ECRA 1ZAVA 3GIJA 3DDKA 3MWBA 4ALZA 5E3CA 4DR7F 3PACA 1G2EA 4P2FA 5HQ8A 1R8HA 2HVHA 1LV5A 2IYGA 3I9ZA 1JMTA 1NKBA 1YBUA 4XTTA 1BD6A 1S6PB 3LP1A 2LKZA 2HZVA 1HNVB 4EBCA 4JI8F 3DRYA 2F4VJ 3M8WA 1HQ2A 2UUBJ 3F41A 4EK2A 3R8YA 4C8KA 4J9QA 2Q6CA 5HQMA 1J5EJ 2BZ2A 3MR2A 2HRUA 2C28A 2BANB 3FBFA 3QSIA 2LEAA 4B9SA 5B0EA 3W65A 2JL9A 2AYGA 3TUIC 5DDQC 2P5VA 3OXLA 5D78A 1R6VA 1FNOA 2DNLA 1N8RT 1JX4A 4F4KA 3F0NA 2JH3A 1S1XB 2CJAA 2FHJA 4PXBA 3CJKA 1S5ZA 2KT2A 2P6TA 3OFGA 2ZH2A 1YZ7A 4IUFA 3MECB 3G8TA 4TKTA 4GKKJ 1YBAA 3CCQS 3EWGA 4UY8T 3BBBA 1WJ9A 1HBMB 5A8RB 2LXUA 2XULA 5C25A 3KG1A 2C2KB 3DHWC 5HK4A 1PKUA 2HAIA 5A6PA 1RDRA 2VJVA 1SCJB 4B9TA 1U26A 1TP7A 3FC9A 3J7AN 1N0VC 2MDAA 4OJGA 2B8QA 4ZVSB 3NCQA 5J2QA 1FEEA 2EK1A 1FD2A 3BV8A 4JV5F 3D7SB 4DR5J 2C2ZB 4J9SA 3CJ0A 1EQMA 2FD2A 4ED6A 3EZOA 1GEHA 2QFJA 2XMVA 2QLWA 3Q89A 2FHOB 4Y6IA 1KVJA 4DX6A 2FJDB 3CF5Q 5IC6B 2BJ7A 4HH1A 1T3NA 3KK3A 4F0HA 1EETB 3V6HA 1IJEB 4Y65A 3DM2B 1VIXA 5H9FK 1NK0A 4K2JA 4NLYA 3FEXB 3P49B 5FDLA 2HYIB 2MJNA 3H98A 5DG8A 3SSSA 5C2GA 1FD8A 1U6BA 2G2OA 1DJ0A 3AD9C 2B51A 2BMBA 3EM1A 4ZVPB 4DBQA 3KK2B 2KVQE 1RT6A 5KG6A 3VR1A 1RADB 2L9DA 3QSYB 1LNQA 1BQMA 3D1OA 3IFEA 4PZVA 4J9UE 1F3FA 2P9CA 3Q0AA 4NXMJ 3DYAA 1NK7A 3DKDA 4DF8A 1QAJA 4GC6A 2WCXA 3OR2B 2W1BA 4PG8A 1H2UX 1SH3A 3G4SS 1U48A 4DOZA 1TL1A 4M5GA 5F3TA 2IA0A 2K06A 5C2CA 4LF5F 1IBLJ 1T9VA 2GJIA 3UD5A 1VC6A 1S72S 3K0JA 3CD6S 4YOEA 2L41A 4LVNP 2J7WA 1HIYA 4ID5B 2VFTA 1RE1B 4P10A 3T5JA 1IBMF 2ZOFA 3IGNA 1SUQB 1ZPVA 4Q45A 3D5MA 3C66A 4CYUB 3TZZA 2AU0A 2XC9A 2UUWA 4LIWA 1VYAA 4ICLB 2KU7A 1KQSR 1PCAA 3R6LB 1VRTB 3ETOA 1JQGA 3US5A 3D1QA 2BJDA 5F9NA 2R8IA 3ISND 2I38A 2RQMA 2ASJA 3Q2SC 3MM9B 1QDUB 2DR9A 1ACMB 4DQQA 2QO3A 1XTZA 4WPAA 2ZH3A 4JV2A 4WCEQ 3ET6A 1FE4A 5IXUA 2YX4A 5EUHA 2QEXS 4A8WA 3OT9A 1I5OB 4NLGA 2J0XA 2EEYA 4DUZF 1SH0A 2AW0A 2CVEA 4WZQA 1YBTA 4ZCLA 1ZAWA 1VQYA 3BQ0A 5B08A 5F8LA 3CCRS 2B4UA 4P2XA 4ES3A 2M52A 1ZA2B 2BE2A 1HNIA 3I5BA 3N6NA 4AUKA 2E1AA 5ETOA 4PABA 5J1EB 5KFXA 3IS9B 1JKHA 3GPAA 1RYSA 2HNDB 1W25A 2G4BA 1HNZJ 1E6VA 3MTJA 2HS4A 4DPUA 3KLHB 3IG1B 2BV3A 2FIUA 2HURA 2IRYA 3NMRA 3CJRA 4RNFA 2Q3PA 3VZHA 2HRTA 2HWTA 4LFCF 1D9DA 1R6YA 5D4PA 3OL8A 2E5GA 4V19X 4RUHA 4DV6F 1UWBA 1ZYQA 3MM8A 4ED1A 2VUGA 1L5UA 3CJ4A 3FQKA 3MEKA 1F3VA 2A10A 4OHYA 1M5OC 1SJ1A 1D3WA 1QAXA 3MUMP 4LF8J 4Q0BB 1B3TA 3EXYA 5CYQB 3AODA 1GMWD 2MQMA 1RBOB 3MXHP 3OXFA 2CAJA 1O51A 3CXCR 2B56A 2AX1A 1W7WA 4I6AA 4XDCA 2YNFA 3W64A 1GMWA 2ZH5A 1UJ5A 4EWTA 2C42A 1Y5LB 3ZTRA 3P8BB 2A6MA 2HSEB 4WYLA 1MMDA 2XMUA 1L3UA 2PMHA 4M5JA 4DSLA 2OPQB 3RB4A 2UXBF 3OUYB 2FVSA 4AQYF 2HEKA 2CQ4A 1GTHA 2UZAA 3EYZA 3FBCA 3HHLB 2JSXA 2GW8A 2FUG9 4PWUA 1OO0B 1HNWF 3NKYA 1SL2A 3M8RA 4JI4F 5BXIA 2ZZMA 1CULB 2R4FA 5HJXA 2IAJB 2A2DA 3VALA 3LP2A 1MLAA 1FRLA 1Q8BA 3CEDA 3R3TA 3RRKA 3GQCA 4GC7A 3LWMA 4J37A 4FS1A 2KM8B 3TR5A 3KG4A 1BGXT 5BJRA 4DUTA 2O01C 3BKTA 4ES2A 2PT0A 3KLVA 4L3KA 3JTPA 2ZC3A 4EUVA 1MG7A 4OHZA 3ZFVA 5ETVA 2W9BA 1UVLA 3QIPB 2EFOA 3M8PA 2BM1A 2IJFA 3MPYA 2IM2A 3M6VA 1JLQA 1RKIA 2HFVA 3ZZYA 3SFUA 4NI2B 2LA6A 2G0JA 3R5JB 2VG7A 2E29A 1B0PA 2JHEA 1KC8T 5IWAF 5E2QA 2JVRA 1I94J 1RTHA 4J9MA 5FD1A 3KJVA 3NEKA 3DGPA 2YX1A 4WFXA 2E66A 4I67A 4CLYA 1C4CA 1RA7A 3CJ5A 3J80U 4IR1A 3DMJB 3H25A 2RDDA 3SFGA 5F8IA 4JI2F 2C3UA 2KYZA 4FBTA 4LSLB 2Z57B 1GNKA 3J7YI 2LU2A 2I1RA 2RHQB 3EGNA 1KRPA 2UUCJ 2ZHAA 2E1CA 3HF5A 3A4TA 3SIPB 4N47A 4N41A 4DL6A 3IM9A 2BBEA 5D4OA 1RT2B 1N52B 1RKJA 1SC6A 4CH0S 5B0FA 1FJEB 1ZS6A 2R2TA 3TAMA 4O4GB 4I68A 2QGFB 1N0UA 3AY0A 3PW4A 2BR0A 4PG6A 2VDIA 2CZVC 1TVRA 1TFYA 5KFFA 3OLBA 1YRXA 4C8LA 3ENAA 4J9RA 3NRBA 3ILIA 1X0FA 1WG5A 2DXFA 1SJ3P 2HMIB 1IKWB 3IWNC 3I31A 1ROFA 1W26A 1VQOS 5AXLA 3CE8A 2ZBCA 4FYYB 4PRFA 4C6AA 3NGTA 3N4WA 3E51A 1LK7A 3QZ7A 2H51B 3QPIA 4IO9Q 1S9GA 1TR0A 5AXMA 4M5NA 3GB0A 4TLRA 1XNRJ 5HVFA 3JAMY 1X4FA 2WONB 4E2FB 3VGSA 2B7CB 3M2UA 1U25A 2YNGA 3C16A 3SEOA 4H4KC 4J9LA 3OXGA 2WBRA 1FWPA 4J90A 1PYTA 1RGVA 4RBTA 1SVDA 5KT5A 1GXLA 4NYPA 1C0UA 1GX5A 3I9V9 4CLUA 2DR6A 4LVOP 3J7ZT 2XYHB 1RT1B 1RXOB 3DRRA 2ALYB 1IBKF 3MMAA 4QBUA 4WIQA 2I0XA 1DTTB 2ZH6A 4OX9J 2DRAA 2CJBA 1YRUA 4LFBF 1ZM3A 1U7LA 2CPFA 1H98A 1VQNS 1UEKA 1S97A 3TO8A 2XHWA 1H7XA 4DV1F 5HN0A 3GZ7A 4MAKA 4WBFA 3WZ0A 1NH7A 3G86A 3MPWA 1R8AA 4RW4A 3U7JA 2F65A 1P8GA 2V4QA 3KHHA 1WHXA 3MM7B 4J9KA 2B7BB 2PDAA 5LSRA 1CJUB 4IYQA 3KUEA 2OELA 1G6BA 4JI5F 2R7OA 1PSDA 1LFWA 4LRDA 4IOBA 3CDBA 1S59A 1HHSA 5A2QU 2Z4PA 1N5YA 1NDKA 3LP0A 4M5KA 2V8GA 4UZBA 2YQ3A 3GIKA 5BYQA 4Y2AA 1CS4A 1VR6A 4QWAA 3TZYA 1J2VA 3NXZA 2FTRA 1NLKL 2RKIA 4EYHB 3FFIB 1TKTB 3C19A 1KTVA 2GIRA 2VG6B 3C2PA 2YVSA 3HHDA 2ADBA 2VC0A 5L38A 2VONA 4ZKAA 1DTQA 2BJ1A 4C8NA 2R7WA 3Q83A 1RWOB 2YH1A 1CQMA 1K1SA 5CQGA 4WK1A 6FDRA 1JLGB 1ICEB 3UDLA 5C7PA 2KZMA 4DZDA 3BF4A 2NREA 4LRCA 3R5CA 3M2VB 1N4LA 2CVIA 1H2VZ 1YJWS 1S0NA 1YIJS 4PPDA 2FHMA 1YHQS 2D3O1 5K5MA 3HFZB 3PY8A 3QATA 2OD4A 2XMMA 5F8HA 1WC4A 5LSLA 1UMJA 3C6UA 4DLEA 5GADU 2V6AA 3GV5B 4KQZA 4OYMA 1DBDA 4U7UK 3MFIA 2XNRA 4OYIA 1JLFB 3IRWP 1FO1A
chains in the Genus database with same CATH topology
1WKJA 1BUXA 4DZ6A 3EMTA 3FC9A 2BEFA 1F3FA 3FCWA 3EVMA 4EK2A 1EHWA 2B8QA 1WKLA 2ZUAA 1K44A 3FBBA 1NPKA 1BHNA 3MPDA 1NLKL 3DKDA 3EICA 4UOFA 2HURA 3Q8VA 3Q8UA 3ZTSA 1F6TA 3FBFA 4UOHA 3BBCA 4ANEA 5IOLA 4HR2A 3ETMA 3FBCA 3ENAA 3VVUA 1B99A 3JS9A 2DXEA 1HLWA 2AZ3A 4S0MA 4W98A 3Q89A 4CP5A 1LEOA 3R9LA 3Q83A 4ENOA 2DYAA 3FBEA 3FCVA 2DXFA 2DY9A 2CWKA 5BXIA 2B8PA 1NHKL 1NB2A 4WBFA 1NDPA 1S57A 4O0NA 5C7PA 1XQIA 1HIYA 3ZTQA 3BBFA 4F4AA 4ANCA 3VGVA 3G2XA 3NGRA 3EJMA 3Q8YA 1XIQA 1S5ZA 3VGUA 3DDIA 4ANDA 4C6AA 3NGTA 3Q86A 1MN9A 3NGSA 3B54A 5CAAA 2BX6A 1NUEA 3WX8A 1NSQA 3GP9A 2HVDA 3BH6B 2NCKL 4DUTA 3VGTA 3B6BA 4UOGA 1KDNA 1NDLA 1W7WA 3EM1A 3EE3A 5CABA 1JXVA 2DXDA 4FKYA 1VYAA 2HVEA 1NDCA 1B4SA 3VVTA 3BBBA 1UCNA 1NCLA 3L7UA 1NSKL 4FKXA 2AZ1A 3VGSA 1HHQA 1S59A 4DI6A 3EVWA 3ZTPA 1U8WA 3ELHA 1PAEX 1BE4A 3ZTRA 4F36A 1MN7A 1PKUA 3NGUA 1NDKA 1WKKA 1NSPA 3EVOA 2VU5A 1LWXA 3FKBA 3BH7B 3PRVA 3PJ9A 3ZTOA 3GPAA 4KPCA 1ZS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKJ A;  1BUX A;  4DZ6 A;  3EMT A;  3FC9 A;  2BEF A;  1F3F A;  3FCW A;  3EVM A;  4EK2 A;  1EHW A;  2B8Q A;  1WKL A;  2ZUA A;  1K44 A;  3FBB A;  1NPK A;  1BHN A;  3MPD A;  1NLK L;  3DKD A;  3EIC A;  4UOF A;  2HUR A;  3Q8V A;  3Q8U A;  3ZTS A;  1F6T A;  3FBF A;  4UOH A;  3BBC A;  4ANE A;  5IOL A;  4HR2 A;  3ETM A;  3FBC A;  3ENA A;  3VVU A;  1B99 A;  3JS9 A;  2DXE A;  1HLW A;  2AZ3 A;  4S0M A;  4W98 A;  3Q89 A;  4CP5 A;  1LEO A;  3R9L A;  3Q83 A;  4ENO A;  2DYA A;  3FBE A;  3FCV A;  2DXF A;  2DY9 A;  2CWK A;  5BXI A;  2B8P A;  1NHK L;  1NB2 A;  4WBF A;  1NDP A;  1S57 A;  4O0N A;  5C7P A;  1XQI A;  1HIY A;  3ZTQ A;  3BBF A;  4F4A A;  4ANC A;  3VGV A;  3G2X A;  3NGR A;  3EJM A;  3Q8Y A;  1XIQ A;  1S5Z A;  3VGU A;  3DDI A;  4AND A;  4C6A A;  3NGT A;  3Q86 A;  1MN9 A;  3NGS A;  3B54 A;  5CAA A;  2BX6 A;  1NUE A;  3WX8 A;  1NSQ A;  3GP9 A;  2HVD A;  3BH6 B;  2NCK L;  4DUT A;  3VGT A;  3B6B A;  4UOG A;  1KDN A;  1NDL A;  1W7W A;  3EM1 A;  3EE3 A;  5CAB A;  1JXV A;  2DXD A;  4FKY A;  1VYA A;  2HVE A;  1NDC A;  1B4S A;  3VVT A;  3BBB A;  1UCN A;  1NCL A;  3L7U A;  1NSK L;  4FKX A;  2AZ1 A;  3VGS A;  1HHQ A;  1S59 A;  4DI6 A;  3EVW A;  3ZTP A;  1U8W A;  3ELH A;  1PAE X;  1BE4 A;  3ZTR A;  4F36 A;  1MN7 A;  1PKU A;  3NGU A;  1NDK A;  1WKK A;  1NSP A;  3EVO A;  2VU5 A;  1LWX A;  3FKB A;  3BH7 B;  3PRV A;  3PJ9 A;  3ZTO A;  3GPA A;  4KPC A;  1ZS6 A; 
#chains in the Genus database with same CATH topology
 5CCM A;  3MMC A;  3H20 A;  4F2R A;  2I5J A;  1YQH A;  3AJ1 A;  1FFG B;  1O5J A;  4KV8 B;  3DLG B;  1VS3 A;  1KD1 T;  2XY6 A;  1LWE A;  3MDF A;  2ERR A;  1RSC A;  3CD5 A;  3MOZ A;  1SC3 B;  2XYP B;  3C14 B;  3WX4 A;  3HDS A;  1K73 T;  2X3G A;  5M2U A;  2DPJ A;  4I6Y A;  2O66 A;  1HQE B;  4FNH A;  3KNA A;  2IVM A;  3GYX B;  2ZHB A;  4NPO A;  1XNQ J;  1S7I A;  2MY7 A;  4JBC A;  2GVZ A;  2PI4 A;  2Y9H A;  4F4Z A;  5C24 B;  4CM2 A;  1OJ4 A;  2CPH A;  1TL7 B;  3TVY A;  2DEI A;  1SB6 A;  3QT6 A;  4GO5 X;  3AH6 A;  1KHV A;  3FK4 A;  1JXL A;  4P7T A;  1JB0 C;  3W9H A;  4JYA J;  3NNA A;  2D9P A;  2XWY A;  2R8H A;  5BR8 J;  1SKW A;  4HDG A;  4X4V A;  3RU0 A;  3TA2 A;  4DL0 C;  4GKJ J;  1Q4R A;  4A8O A;  3HD1 A;  3GYN A;  2OI2 A;  1REV A;  3D1H A;  1IWG A;  5I42 B;  2M88 A;  2RRA A;  2FLL A;  4NLW A;  3ILL A;  4MIB A;  3ZTS A;  4ZIT A;  3POT B;  5T14 A;  1J27 A;  2DJW A;  2RVJ A;  2QLX A;  3AOB A;  4O3N A;  2DGV A;  5IM0 A;  1XMO J;  1VQM S;  1REG X;  1RT4 A;  4NYZ A;  5IQQ A;  1BC6 A;  1Q86 T;  3IBC B;  2Q6B A;  3DOM B;  5A8K A;  3G8S A;  2WW8 A;  3PW5 A;  4OV1 A;  2C3M A;  3D3B J;  2BXJ A;  1CJK B;  2QRR A;  4NLV A;  2F4V F;  3KK1 A;  4O3Q A;  2QMW A;  3B54 A;  4B3R F;  4ZLP A;  2VA2 A;  4B3T J;  4PWD B;  1U49 A;  2B4V A;  4R8U A;  5AJ3 J;  3HD2 A;  3AOC A;  2DH9 A;  4DR2 J;  5KFL A;  3JTO A;  2LEB A;  2HNY A;  4OX7 A;  1PO6 A;  1FCA A;  2KG1 A;  4BDP A;  1Q81 T;  1R27 B;  3BO3 A;  4YY3 F;  1RTD B;  4ZK7 M;  1F2H A;  4IDK B;  2DIV A;  5DQG A;  4XPE A;  1SH2 A;  5D0E A;  1PAU B;  5LMN F;  4RNO A;  3H7H B;  2YWG A;  4EGL A;  4ETX A;  2XY5 A;  1WG4 A;  3PIP Q;  3U1M A;  4GKK F;  1RU1 A;  1LWF B;  4HLB A;  2HKE A;  3CSK A;  4WE1 B;  5KFG A;  2B8P A;  1SV5 B;  3DRP A;  1O6X A;  3OFH A;  4QJV A;  1NJW A;  1B7Y B;  3CDA A;  1QTN B;  1HMV B;  4IG0 A;  3BGO P;  3MAH A;  2UXD J;  5JMN A;  2MYF A;  4K4Z A;  4WU2 A;  4HYK A;  1X60 A;  3KHG A;  1S79 A;  1UW9 A;  2XZD B;  4F8R A;  4M5M A;  2J7K A;  5GAG I;  4LBI A;  3EXC X;  1RQ0 A;  3GCX P;  3E01 B;  4YB1 P;  4LF1 A;  1NSK L;  4CDI A;  3T6B A;  5JUM A;  3V6D B;  3GU0 A;  2G1H A;  4RUA A;  2ILY A;  2EFV A;  1S1V B;  5IZH A;  1UEV A;  2XM3 A;  4MYU A;  4PYD A;  3KLG B;  1PJ5 A;  2XI2 A;  1RI7 A;  2K1R B;  5L9X A;  2RNE A;  1YTY A;  2YY3 A;  3DI6 A;  1T9W A;  1FJG J;  3QNW B;  2V63 A;  2HHU A;  2FPH X;  1X5T A;  2HG4 A;  2BJ3 A;  5THW A;  8AT1 B;  4J9V A;  5KFK A;  5HO4 A;  4FDF A;  4GVB B;  2ZBR A;  2EW9 A;  2FJX A;  4DQI A;  3GCW P;  3CD7 A;  3DC2 A;  4AT1 B;  3T1H F;  4LRF A;  1U1K A;  2MZ1 A;  1YLX A;  4P6Q A;  3JSM B;  2G2Z A;  5CHC B;  5JJB A;  3RZA A;  2CPE A;  2CNK B;  2ZFH A;  2CQP A;  3IWX A;  4ITS A;  1NUE A;  2KT5 A;  2FQQ B;  1JLB B;  3SCI E;  4DV7 J;  4ZCI A;  4I7F B;  3QGI A;  4CH7 A;  3PHT A;  4NRU A;  2XBP A;  4ZVR B;  1RTJ A;  2XS2 A;  4RW6 B;  3W1Y C;  2XSJ B;  2DEJ A;  5KFB A;  3PIO Q;  1BE4 A;  4KY3 A;  3CIZ A;  2NUH A;  1CLF A;  4OHV A;  2W8K A;  2FY1 A;  3EVO A;  1EAR A;  2IYI A;  3CUN A;  2ALZ A;  3NG8 A;  1T05 B;  4OYB A;  3BKF A;  2R2U A;  5KFC A;  3Q8V A;  1QSY A;  3QRQ A;  2MKJ A;  2XNQ A;  3M32 A;  2WBM A;  5FJ4 A;  2BDP A;  3DOK B;  4IFV A;  2OSQ A;  1JLC A;  1TUV A;  5I3Q A;  3ZXW A;  3IBW A;  2E1M C;  1NKE A;  1F9H A;  4KFB A;  1K0V A;  3PO4 A;  5CD4 A;  3CNQ P;  3G6Y A;  4J91 A;  2LQ5 A;  1PJ7 A;  4DEZ A;  1S49 A;  3ISZ A;  1ZM2 A;  1EB0 A;  3LGH A;  4HHJ A;  3D68 A;  1HKA A;  1XMQ J;  2BA9 A;  4J9O A;  3A1Y G;  3QJL A;  1FER A;  3RUB L;  1JLA B;  3W2V B;  4Y0F A;  2HHS A;  1HPZ A;  1U45 A;  1X31 C;  4CT8 A;  5F8M A;  3L09 A;  2DXD A;  1S77 D;  3O6Q A;  4FKX A;  2AJ4 A;  4DR7 J;  1Q5Y A;  1AB8 A;  2F63 A;  4LF4 F;  5HI7 A;  3PO5 A;  1G1X A;  4JI1 F;  1FFS B;  3G71 S;  1Y3J A;  1ZBT A;  4NCA A;  3MR3 A;  4OMF G;  3FBB A;  3OSP A;  2Y0B B;  3VAH A;  4DN0 A;  4ED3 A;  2EWH A;  2X51 A;  4F4Y A;  4JI8 J;  4RZR A;  1RZM A;  2N4D A;  4BCA A;  1UA0 A;  5KT3 A;  4ERD A;  2AV5 A;  2O1P A;  3JYT A;  4PQU A;  4B9N A;  4C3M A;  1WSV A;  3IM8 A;  1R89 A;  5E3A A;  3BGF A;  2GGP A;  4IQM A;  4HHU A;  3VAK A;  4C8O A;  1NKC A;  1SBR A;  1TK5 A;  4RLE A;  1C1C B;  3U1L A;  2D1C A;  1T94 A;  4LQ3 A;  5AE2 A;  3NGS A;  3U02 A;  2BKO A;  4OYA A;  2CA9 A;  4Q8E A;  5EX3 A;  1FDD A;  4OJH A;  4ZPD A;  3HXM A;  3BO4 A;  4FBU A;  2MQ8 A;  2NXU A;  3C46 A;  2KKH A;  3AD7 C;  3TWZ A;  2RRN A;  4WK3 A;  5F41 A;  2DT9 A;  3CO0 P;  2VFR A;  2WOM A;  1RUS A;  3X1L B;  5HVG A;  2VDH A;  5ITH A;  2VQF F;  1WKL A;  2GHW A;  3ENV A;  3RRH A;  2M70 A;  4DQR A;  1H6K X;  2CYY A;  5I3U B;  1TKX A;  2ZOM A;  4JV5 J;  2DXE A;  3TA0 A;  2M9K A;  4UUX A;  2RU9 A;  4NLO A;  2POK A;  1FRK A;  3ZZP A;  3MEE B;  1PYO B;  5KFW A;  4ZVH A;  4A8M P;  4I4B A;  2ROE A;  3L7P A;  2W2P P;  1QTM A;  2QT7 A;  3M2R A;  2G0C A;  5F8J A;  3NGR A;  4OQJ A;  7FD1 A;  1LWC A;  1YI2 S;  1IKY A;  1N48 A;  3M6X A;  1IKV A;  4FN5 A;  2FLN A;  2ZVS A;  1QE1 A;  3MAA A;  4DFM A;  2FJV A;  1JNR B;  4DSK A;  4QU6 A;  4M5D A;  3FDS A;  3FCH A;  2Q43 A;  2ZKT A;  5E3Q A;  3WC2 A;  4CQ1 A;  4J9N A;  3W61 A;  1NPP A;  4WFN Q;  2COL A;  2HGM A;  3C6T B;  1TMJ A;  1FRJ A;  4ELU A;  3HPO A;  4U8Y A;  4ECZ A;  5A8W B;  4DL3 A;  2YPY A;  4A8S A;  1R0A A;  2HFU A;  2R8G A;  1X4H A;  1VCT A;  5KG1 A;  2AZ3 A;  4ZCK A;  1FDN A;  3I87 A;  1FK9 A;  2NYH A;  4CP5 A;  4ZA1 A;  2LP4 A;  2MJU A;  3TX0 A;  4OZ0 A;  2DHS A;  4ZLJ A;  3M8Y A;  3PEJ A;  3ZTQ A;  5GME A;  2FJW A;  1RWP B;  4PXC A;  1DRZ A;  4AND A;  2LA4 A;  3SSR A;  5JVH Q;  2QSW A;  4DN9 A;  3NS7 B;  4DR3 F;  4H54 A;  4HAC A;  4DFP A;  2HVD A;  3NAH A;  4ES1 A;  4TVA B;  4MJK A;  1IBM J;  2QA2 A;  2KFY A;  2J7U A;  3G87 A;  3ILO A;  1I94 F;  4CLZ A;  2PA3 A;  1DLO A;  4LR7 A;  4DI6 A;  3EVW A;  4RWW A;  3TYT A;  3UNG C;  2MGZ A;  2MZR A;  2IPO B;  3W2W B;  1S0O A;  3DN9 A;  1HWK A;  1IKX B;  1HQU A;  4ZLN A;  1KLM B;  3ZZT A;  3P6Y C;  2HS3 A;  3I82 A;  3QWP A;  2FVQ A;  2EC0 A;  1RP5 A;  5H9E J;  4C0O C;  2MLZ A;  2IIH A;  3NCP A;  4WYW A;  1KHW A;  3C8Y A;  4ECX A;  4QPT A;  4G1Q B;  2IHR 1;  1U0H B;  3CD0 A;  3QZ8 A;  2L3M A;  5KG5 A;  2G13 A;  2DGU A;  5HLF B;  3X3U A;  1VBX A;  2RML A;  4NA3 A;  3PX6 A;  4QOT A;  4Y2M A;  3I0S A;  2WSC C;  3CVK A;  2AYM A;  2C2M B;  3MMB B;  4JOU A;  3WX8 A;  2ZD1 B;  3VAJ A;  3RAX A;  2FJA B;  2LQB A;  2VBZ A;  3K5N A;  4J7C A;  3ULH A;  4E98 A;  4K4T A;  2BQR A;  3D4J A;  4IRD A;  3RYL A;  4UST A;  4FXW A;  4TYA A;  2MEW A;  5E33 A;  3H8Y A;  3O44 A;  1LW0 A;  2BKP A;  5F8N A;  2H1Y A;  3DRX A;  3HT3 A;  3H2L A;  2OMO A;  3PV8 A;  3W9I A;  3TAQ A;  3AXK A;  5DM7 Q;  1UP1 A;  1MRO B;  5K8P A;  2V2K A;  3A3N B;  4BS2 A;  4NCG A;  1RWM B;  1T9U A;  2Z30 B;  4KKO B;  3RB0 A;  4F7V A;  3J81 Y;  2QFI A;  1S99 A;  2R8K A;  3S1T A;  3H59 A;  4DL5 A;  4LSN B;  1VIS A;  4DV5 F;  4OZ2 A;  4WTO B;  1V5I B;  3MED B;  1SIZ A;  1S76 D;  2FZK B;  4LFC J;  2YBV A;  5HRO B;  3P3D A;  4KT0 C;  4RW8 B;  1SKU B;  4DV6 J;  2HZC A;  3UI3 A;  2EVZ A;  3JQK A;  4H4O B;  4AXI A;  4NLT A;  2MSS A;  4H4M B;  2V8H A;  1CSJ A;  1HYS A;  4B9V A;  2GIQ A;  5C42 B;  3H4D A;  3JAM U;  4Y2K A;  4ZPB A;  3K5O A;  1YK9 A;  4O44 A;  1MW7 A;  3NGU A;  4M5H A;  2F9D A;  3LUY A;  2BAC A;  3JQJ A;  2HWH A;  2NYI A;  2BW2 A;  4ZJL A;  5G0R B;  1F6T A;  3IGV A;  4CIO A;  2Z56 B;  4B9U A;  1LQ9 A;  2ACY A;  2UXB J;  3V4M A;  2O67 A;  2RQ4 A;  2HAF A;  2Z58 B;  3QGP A;  4AQY J;  2WSE C;  2FVP A;  4M94 A;  5T7L B;  2ZBI A;  4EYI B;  2Z2L A;  3MUV P;  4EO6 A;  4TNO A;  4X64 F;  4CCH A;  1WTF A;  4JI4 J;  2JFK A;  1MML A;  5KG4 A;  3JTN A;  1S1T A;  2ZJP Q;  5D3G B;  2BYC A;  3QGG A;  4DMZ A;  1QSL A;  1X8D A;  1N32 J;  3PR5 B;  1S4F A;  2YKM B;  4OLP A;  1Z2L A;  3KHL A;  1Q1K A;  2QIF A;  2VL1 A;  4EO8 A;  3CCT A;  4CNZ A;  1UAW A;  3M8Z A;  4FZV A;  2A18 A;  2CJQ A;  2NPF A;  3D66 A;  5EWF A;  1U1L A;  3UFC X;  2Y1L B;  5KFT A;  2OO4 A;  4QWD A;  1Q78 A;  1S9F A;  1JXE A;  2Y1I A;  2FLP A;  1UZD A;  4UT4 A;  1Q95 G;  1U24 A;  4UF4 A;  3KKF A;  2H4Y B;  4FYD A;  2V69 A;  3GFH A;  4FVC A;  4X4U A;  1C1B B;  4UQG A;  5IWA J;  3HHL C;  2GMH A;  4DCJ B;  1U47 A;  1HBO B;  2FLO A;  1VRU A;  2YKN A;  3A3O B;  2XTJ P;  3FUY A;  3A8K A;  1VQ9 S;  3GV7 B;  2GNK A;  1RT7 B;  1D9A A;  5EWG A;  4PUO B;  1F1B B;  2EG2 A;  1RTI A;  2BM0 A;  2KM8 C;  2DH8 A;  4JI2 J;  3CMQ A;  2WVE A;  2RF2 B;  3DLL Q;  1PJ6 A;  2I2Y A;  1HR0 F;  5J2M B;  2FJE B;  4NEY A;  2B6A B;  1KS2 A;  3LPE A;  2PC6 A;  3AFG A;  5DLF A;  3IP0 A;  2HNZ A;  4F02 A;  1HW9 A;  4DPY A;  2A6O A;  2WB1 D;  3FMB A;  3GFZ A;  4CLT A;  2E7X A;  4MH8 A;  3NY0 A;  8ATC B;  2ZH1 A;  3QGH A;  1WD6 A;  3M1V B;  4F3O A;  2XZW A;  1WC6 A;  2OPS B;  1P9Q C;  4Q43 A;  5MLC V;  3CW2 C;  3FRY A;  2BAB A;  1VQ5 S;  3CDU A;  2QE5 A;  4ZHR A;  3NNC A;  3NWR A;  2AEJ A;  5D0G A;  1V6H A;  5K14 B;  3PW7 A;  4A8Y A;  4OL8 A;  3D6F B;  5KFY A;  2YX7 A;  3G82 B;  2AJ2 A;  2GFF A;  2KT3 A;  3T5K A;  4C98 A;  1ZOT A;  4PYA A;  2QJ3 A;  3QLH A;  1KVK A;  1XR7 A;  1H38 A;  2FB0 A;  4MFB B;  2V4J B;  3FKB A;  2VPY B;  2I9S A;  3NMA A;  3MM5 B;  4K8R A;  4EZ9 A;  4ILL A;  2VOO A;  3MR7 A;  3FCW A;  5GAE U;  1P1T A;  2M4M A;  4DPX A;  3PKM A;  3OPK A;  3HSJ A;  5ADZ A;  2HK3 A;  4USI A;  5B09 A;  2RQC A;  1WHV A;  3V81 A;  2PEB A;  4LF7 F;  3N28 A;  3E3X A;  1NK9 A;  3KUG A;  5F8G A;  5CD4 H;  4YS2 A;  4JI3 F;  4B3T F;  3BR9 A;  1X0P A;  2EK6 A;  2YWK A;  2EG1 A;  1TKZ B;  3R9L A;  2D3U A;  4DV3 F;  2JWN A;  3DLE A;  3ZO7 A;  1YVF A;  2CJX B;  4ELV A;  2CQ1 A;  1E6Y A;  4G3I A;  2GZO A;  3UR3 C;  2B5J B;  5A6W A;  4LFB J;  2YKQ A;  3IAS 9;  1JJ2 R;  4QPX A;  5AE1 A;  3IMQ J;  1EQ0 A;  5HQL A;  2LQ9 A;  4TXS A;  1JK9 B;  5HMX A;  2PA8 D;  1Y00 A;  5J2N A;  4DV1 J;  5L1I A;  1MN9 A;  4KHP J;  2DK2 A;  4C3K A;  5FLX Y;  4PQA A;  1NDC A;  2QL5 B;  4GMK A;  3VVT A;  2G0I A;  5JXS A;  2M8H A;  1N33 F;  2D9O A;  1HA1 A;  4LF9 F;  2MZJ A;  4UY8 5;  1WKK A;  3D0G E;  3MI7 X;  4KGM A;  2VU5 A;  3LP1 B;  1TFW A;  5J2P A;  1VK8 A;  3H90 A;  1PYS B;  4IH5 A;  5D0R A;  1Y10 A;  3R7B B;  3A8E A;  1ZTW A;  1R8C A;  1Q16 B;  2H4W B;  2OPR A;  4USM A;  3QFH A;  3K5M A;  3UPF A;  1WI8 A;  3D28 A;  2XB2 D;  3TP2 A;  4QW8 A;  3BM7 A;  3SCJ E;  3C15 A;  2DNO A;  1NB2 A;  1TAU A;  2VPW B;  1I6J A;  2X7I A;  3M30 A;  2K7J A;  4DR1 F;  1QUP A;  3HSD A;  3ENQ A;  3NLC A;  5HAO A;  2QA4 G;  2HQC A;  2JEF A;  1UFL A;  2NSB A;  4LRB A;  3CJK B;  1EP4 A;  1T0T V;  4G6V B;  4X84 A;  2X1A A;  1UPP A;  1FJG F;  1RT5 A;  4DCP B;  4ZJQ A;  1G7C B;  3H2V E;  1UCN A;  1X4G A;  2A0F B;  2EPI A;  5C25 B;  2F8E X;  1Q53 A;  1VOM A;  2DHH A;  1HNX F;  2VB6 A;  3VAI A;  2VC1 A;  2KVI A;  2J5A A;  1GMU A;  3HFV A;  4RNH A;  4KYZ A;  2DNN A;  3GIL A;  5J2Q B;  4O3O A;  3BQ2 A;  1NB7 A;  3MPD A;  3MF5 A;  3Q8U A;  1QAI A;  2OEK A;  4X4P A;  2VIC A;  1WTB A;  1RWV B;  4KB7 A;  1OQ6 A;  3BRE A;  4NLS A;  3VVU A;  2M0G B;  4C3L A;  5GAH I;  4I0W A;  4I2P A;  3H40 A;  5HMY A;  1U2F A;  3GMG A;  1T3O A;  3KK3 B;  1PC5 A;  3WQP A;  1URR A;  1DFD A;  1AZS A;  1ZPW X;  4PPZ A;  4ANC A;  3EJM A;  3IRX A;  1S0M A;  5KOW A;  1URN A;  4X4Q A;  3ZZZ A;  4CLP A;  4RL1 A;  1CEZ A;  5FDL B;  3Q86 A;  2AGO A;  4FP9 A;  2BJE A;  2L9N A;  3LO3 A;  1HWU A;  2BX6 A;  1FKP A;  4C7Q A;  1VIO A;  2VOD A;  3UWT A;  1L3S A;  1NAQ A;  5AE3 A;  4DSF A;  1WNE A;  1PC4 A;  2IMW P;  2FHK A;  2HQD A;  1UFK A;  1RT6 B;  4OYP A;  1QJH A;  4PEO A;  4ZJO A;  4HVZ A;  4ECY A;  1BQM B;  2JLE A;  1GAO A;  2CPX A;  2W25 A;  4A8F A;  3DYA B;  5EGY A;  3EIC A;  5JVG Q;  2OD6 A;  5E41 A;  1H7W A;  1GK8 A;  1Y4Z B;  4OYX A;  2DD8 S;  2P9G A;  3Q8S B;  3PYF A;  5IOL A;  1TL1 B;  1VHF A;  1WF1 A;  3HJV A;  1HW8 A;  2WZ1 A;  4URS A;  3B8H A;  4ZP8 A;  5L1J A;  2QYC A;  3NS5 A;  2JX2 A;  2OEM A;  3FCV A;  4B3M F;  2DY9 A;  3GON A;  2J6T A;  2Q1L A;  4DG1 A;  4TQR A;  5EN1 A;  2OFH X;  4W4M A;  2B9W A;  2RU3 A;  5CZX A;  4N5S A;  2E5I A;  3OVS A;  3SMZ A;  5D4N A;  2X1B A;  1KP6 A;  2DGQ A;  2IVY A;  3M7V A;  3IN5 A;  1U09 A;  5H1S V;  1YJV A;  5DM6 Q;  2NXN A;  2LQ8 A;  3N79 A;  5J1P A;  4A47 A;  1VK3 A;  4ILR A;  3P5B P;  4B3R J;  4ECT A;  5CZV A;  2HBR B;  3KDN A;  3UVJ A;  4ZDN A;  4KO0 A;  2OUG A;  1EKR A;  2JLF A;  3SV3 A;  4O3P A;  2XCP A;  3RB6 A;  3EGV A;  2HPU A;  2EBG A;  4PWW A;  2VG5 A;  1RLD A;  2FHJ D;  4DX8 H;  1U2C A;  3MZI A;  1SIW B;  1YWX A;  4HTJ A;  1QSS A;  2GHP A;  3D0H E;  1SXL A;  3UCU P;  3DLH A;  5BYS A;  4YY3 J;  4C4W A;  2XYG B;  3QMQ A;  3ET6 B;  4G65 A;  1RAE B;  1FKO A;  3TUZ C;  5LMN J;  5B0D A;  4V19 J;  2HHT A;  3CDW A;  4IRC A;  2B43 A;  2BE7 D;  1NJX A;  5E0O A;  2UUA F;  3LAL A;  4DV4 F;  4KJI A;  1YZ6 A;  4A46 A;  5KT2 A;  3KXD A;  3CC2 S;  5KFO A;  3I56 S;  3OV7 A;  1D1U A;  4C11 A;  2BE2 B;  1Y7P A;  4YR0 A;  4PXE A;  1HNI B;  2AJF E;  3KDO A;  3I32 A;  2RS2 A;  1UVJ A;  2OSR A;  2YWW A;  2D3Z A;  4DX7 A;  1JKH B;  2ZH7 A;  3QYY A;  1H2T Z;  4OZL A;  2GS8 A;  5ETR A;  1KOH A;  1E6V B;  3HI9 A;  3THT A;  4LR8 A;  2XSF A;  1U02 A;  5KT4 A;  1S12 A;  1OPI A;  1U6Z A;  2KYX A;  2RT3 A;  4YR2 A;  2W7P A;  5B0C A;  1U1O A;  1UZH A;  1UWB B;  3MM8 B;  4MK8 A;  2PI5 A;  2HBQ B;  1NHK L;  3W5Y A;  1FTR A;  3IWL A;  3KJF B;  1VBK A;  3KOA A;  2E5H A;  2RHS B;  2YNH A;  4OLO A;  1NK5 A;  4NA1 A;  4IOC Q;  3PJX A;  1HD0 A;  4NZ6 A;  3T1H J;  2H5E A;  4M95 A;  2DR7 A;  3RR7 A;  1M5H A;  2GQC A;  2CQH A;  3O2I A;  1VQL S;  2YNF B;  4DR6 J;  2XWX A;  2UXC F;  1B64 A;  4MTP A;  1BXN A;  2DNM A;  1GTE A;  3H5Y A;  1CBK A;  4EU0 A;  1S1W A;  3IC1 A;  2D41 A;  2LEC A;  2H48 B;  1CG2 A;  3AT1 B;  3TA1 A;  3T9Z A;  4X2B A;  4I2Q A;  4ZLL A;  4UOF A;  2HQF A;  2PMZ D;  1ZH5 A;  2W2N P;  2VA3 A;  2XEX A;  1OMS A;  2V2Q A;  3M8Q A;  1FRM A;  3M9N B;  2XMA A;  4KHR A;  1CJV A;  3OL7 A;  1CPZ A;  3AJ2 A;  3KLE A;  2VFU A;  1RT3 A;  3VAF A;  1KFD A;  5AXK A;  3OD2 A;  2A3J A;  1XK8 A;  3LP2 B;  3M6W A;  3D6T B;  3CWJ A;  2PII A;  2YKP A;  3W63 A;  4ER8 A;  2PGC A;  3SV4 A;  1VQ8 S;  3TI0 A;  2CQG A;  4Q8F A;  2N3L A;  4AXJ A;  4USK A;  3OLA A;  1AUD A;  1KOO A;  3RAM A;  3QT7 A;  2AZ1 A;  1VBZ A;  4OI0 A;  3RBD A;  3DU5 A;  4RW7 A;  3T9N A;  2HIY A;  1RAB B;  2W9B B;  3M8P B;  3PZP A;  3D54 A;  4EBE A;  2XO7 A;  5HP1 A;  2R7T A;  3FSY A;  1EHW A;  4LF4 J;  2R3V A;  1JLQ B;  4OI1 A;  1JJ4 A;  1KON A;  2W4C A;  3W5Z A;  4JI1 J;  2VG7 B;  4YR3 A;  4QCL A;  4ED8 A;  3ETM A;  4DX5 A;  3FEY B;  1LOU A;  1RU2 A;  3K89 A;  1RTH B;  2XLI A;  3NOC A;  1UFW A;  1HWI A;  3HVW A;  3KJV B;  4RO0 A;  1ZM4 A;  3RBZ A;  3DGP B;  3HVT A;  3OFF A;  3HLU A;  4F2S A;  4FF2 A;  2YNI A;  1T11 A;  4ZCM A;  2W8L A;  2CZ9 A;  2ZC4 A;  3ITH A;  1NSQ A;  1RAA B;  2ILZ A;  1T03 A;  3EGW B;  2FDN A;  3FMW A;  2EFP A;  3AJD A;  3J81 j;  1JNZ B;  4KH0 B;  3CJQ A;  3AA9 A;  3QO9 A;  1S6Q A;  4P71 A;  5DZ7 A;  1MN7 A;  5KFA A;  2PD1 A;  1U4B A;  1H73 A;  1IR1 A;  3CME S;  3TAM B;  3DLJ A;  2Z2Z A;  1SQF A;  4ZPC A;  4L74 A;  5HBM A;  2E1P A;  4C2M A;  5DGB A;  3OTO F;  4B3O A;  1PGZ A;  3HMJ G;  1TVR B;  3B4D A;  2VQF J;  3HJF A;  4WII A;  4R5P A;  4C0B A;  3J7Z 5;  3J81 U;  3TJ9 A;  1HWJ A;  2ZNY A;  4DJB A;  4W92 B;  1M90 T;  3F56 A;  2HW3 A;  3HHN B;  1JLE A;  2KI2 A;  4L3N A;  2HHH F;  1AFJ A;  4EEY A;  3PEH A;  4QYR A;  4K4Y A;  1K47 A;  1DAX A;  1VC0 A;  3LAM A;  2G9O A;  3B82 A;  3UN5 A;  3OTE A;  2M8D B;  2F8H A;  2C3Y A;  3KLF A;  1JJC B;  2JC1 A;  1RJJ A;  4CT9 A;  2K7K A;  2B0G A;  1W2I A;  4H4K A;  3KG0 A;  1T7P A;  3A8J A;  1JXV A;  5EX0 A;  4R25 A;  1S9G B;  2RIL A;  4OI4 A;  2XY7 A;  3S01 A;  4LFA F;  1F9F A;  2YWF A;  2Y1J A;  4JB8 B;  3CB4 A;  2BQ3 A;  3OR1 A;  2BQU A;  3H5X A;  3M2U B;  2YNG B;  3C16 B;  2C2O B;  1S1U A;  2ADC A;  4NWB A;  4X4N A;  4FS2 A;  2M7S A;  1C0U B;  3T6J A;  3IA0 A;  2C2R A;  4FVM A;  2MLX A;  4ED2 A;  1RA6 A;  5IC4 B;  3DRR B;  1NJY A;  2ZE2 A;  3PFE A;  3UDV A;  3MMA B;  5L39 A;  3TJ8 A;  2VZ9 A;  1I3O B;  1N32 F;  1FF2 A;  4YQW A;  4XPC A;  2G1D A;  4K59 A;  4TY8 A;  1U8S A;  2OPP A;  1OSD A;  2IC3 A;  1Q8L A;  5DQH A;  3U27 A;  4RW4 B;  2UU9 J;  4ZIW A;  4NRT A;  5CA5 A;  4I64 A;  4D3G A;  3UDC A;  1QUV A;  2ZZT A;  1RAC B;  2ATC B;  4RUB A;  2KHD A;  1B0V A;  3LPY A;  3W9J A;  2QA4 S;  4DR3 J;  1B7F A;  2AYE A;  1N6Q A;  1KQF B;  4CLW A;  2V2Z A;  4DSJ A;  2HLT A;  3E2E A;  3PW0 A;  4U8V A;  1N5Y B;  2GA7 A;  3LP0 B;  1WKJ A;  4F0K A;  1CS4 B;  4U6P A;  1NPK A;  4QWC A;  1YJ7 A;  3VWS A;  5HMW A;  2QMX A;  3DLK A;  1RWW B;  4N8O A;  4B3S F;  2RKI B;  3FJ2 A;  2AQ4 A;  1CC8 A;  2KJV A;  2QLB B;  3NBP A;  2VQE F;  4UOH A;  2MLY A;  3GJS B;  3FVY A;  1DTQ B;  3PX0 A;  4CLK A;  4KE5 A;  1F2G A;  2DYA A;  2MZS A;  3MCS A;  4EFA C;  3V4I A;  1X9W A;  4ATN A;  4CWB A;  5CYM A;  3Q2T C;  4K4S A;  3CJT A;  4JI0 J;  2W9C A;  3DDI A;  4M63 A;  3NNH A;  3GII A;  3O3L A;  1HFE L;  4PXD A;  3K59 A;  5KFJ A;  3KLI A;  1MWZ A;  3JSB A;  4Q7A A;  3IBF B;  3CC7 S;  1TL3 A;  3PDN A;  5FII A;  4F3M A;  3RR8 A;  3C6U B;  2VFV A;  5GMK a;  1RCO B;  2ZM6 F;  2PE8 A;  3PX4 A;  3RRG A;  4M5L A;  3K2Y A;  1MU2 A;  2E5L J;  1MMN A;  4KH1 B;  1C0T A;  1U1M A;  3G8Q A;  3FSX A;  3MMC B;  5SZT A;  5EWE A;  4NLP A;  2I5J B;  4XDD A;  1UA1 A;  3CIM A;  1GX6 A;  4F4W A;  2LFV A;  5LL6 d;  4EBD A;  2LXI A;  1H3D A;  1SJ4 P;  2DNZ A;  4WTY A;  1BWE A;  1LWE B;  1A6L A;  3W5X A;  4WFY A;  4B08 A;  3UW1 A;  5K8O A;  1P1L A;  3FBE A;  2M2B A;  4BWM A;  4X62 F;  2XMT A;  1R7I A;  3DU6 A;  2J0Q D;  3D0I E;  3LAN A;  1FE0 A;  3GJQ B;  2YTC A;  1U1R A;  1V3Z A;  4DV5 J;  4M1K A;  2AJ0 A;  2DR8 A;  2GVZ B;  3W60 A;  5DDR C;  3GIM A;  1RCX B;  4OX6 A;  4EZ6 A;  5IQ6 A;  2YH0 A;  3BDP A;  4LF6 J;  2BVZ A;  3MCO A;  1RHU B;  5IT0 A;  3GFY A;  4G1I A;  4OJ3 A;  2FVR A;  2DKO B;  2APO A;  3GR0 A;  4Y2C A;  2AT1 B;  4KGV B;  1HBN A;  3DRS A;  3ONQ A;  4QR1 A;  2C2E A;  3PCO B;  4LUB A;  1J5O A;  4K0K J;  1NSP A;  4QYZ J;  1REV B;  1IBC B;  1FHT A;  2EFN A;  2PFF B;  2YQ1 A;  3SXL A;  3WC0 A;  1IR0 A;  3CCM S;  2AGP A;  3THV A;  5ETL A;  3PFO A;  2XLK A;  4IFY A;  4F4X A;  5F3Z A;  3CCZ A;  1LW2 A;  5HAT A;  3MEG A;  1UET A;  3PTW A;  4KHP F;  4OIX A;  4UOC A;  1DUR A;  1G3O A;  2GX8 A;  4FF4 A;  5KFZ A;  3HHE A;  3MPV A;  4ED5 A;  3GJR B;  5IM0 B;  1IXK A;  2U2F A;  4DFJ A;  4DV0 F;  1RT4 B;  1TTH B;  4ENO A;  1VDH A;  2IM0 A;  1SKR A;  5I4M A;  3EUN A;  3CUL A;  4RKU C;  2J9D E;  5A8K B;  4NEZ A;  4FXV A;  2HK2 A;  3GIR A;  3BGR A;  4WF9 Q;  2WAQ D;  3HSZ A;  3DOL A;  1XC9 A;  5DLG A;  2NUU G;  3JSR A;  3KK1 B;  3J7Y U;  2EKY A;  1UJ6 A;  2WVF A;  1O8B A;  2OFG X;  5FLX U;  3QJJ A;  5DRK A;  2CNN B;  4X64 J;  4DQP A;  2W2Q P;  3MOJ B;  3KFW X;  4YHH F;  4JP8 A;  4OZ3 A;  4YFU A;  4YB7 A;  3BZQ A;  3D6H B;  1EAY C;  1R8P A;  2V67 A;  3H42 A;  4R8U B;  1V3S A;  1AFI A;  4HT7 A;  1HHQ A;  4JI7 F;  3Q24 A;  4KTQ A;  3OHB A;  4OFZ A;  4O0I A;  4Q5V A;  4NLD A;  2HNY B;  1VQ7 S;  1XN9 A;  1BUX A;  1YJN S;  1ULR A;  5K9F A;  4O4R A;  4OX8 A;  5M2P A;  1RTZ A;  4Z7C A;  3DXS X;  4L6V 3;  5ETP A;  1WWH A;  1BWV A;  3BSN A;  2MKC A;  3SSQ A;  2N82 B;  3BBC A;  4RW9 A;  3CCS S;  5HAN A;  2WVC A;  2W24 A;  2QMU B;  4KPY A;  4FYX B;  5LM7 E;  2CQC A;  1WC1 A;  1XBW A;  5KTQ A;  4IG3 A;  2NSC A;  3FGV A;  5GMD A;  5KFD A;  2BOP A;  3DRP B;  2MPU A;  1S9E A;  2K3K A;  2F4F A;  2GV1 A;  3Q8Y A;  4IG0 B;  2LXF A;  2IDL A;  4MIW A;  1A9N B;  2ZNZ A;  5DZ6 A;  1NZA A;  3RTV A;  3HZG A;  1XER A;  3CT9 A;  2WK4 A;  3OW2 R;  1WC0 A;  5K20 B;  2RH3 A;  1WOR A;  3S8S A;  3ZTP A;  4GO7 X;  1T9X A;  2F8M A;  3MR5 A;  1ZET A;  4HKQ A;  4K2X A;  3C3L A;  1AA1 B;  2RQK A;  5EHH A;  3FZ2 A;  1VJQ A;  4OI3 A;  4D3H A;  1LK5 A;  4IOA Q;  2LU1 A;  4LBP A;  5A0Y A;  3A3P B;  4FPR A;  7FDR A;  1HR0 J;  2GVD A;  3DI6 B;  2AMC B;  1WEY A;  1FXR A;  1JIH A;  4MT1 A;  4FPI A;  1UVK A;  1SJF A;  3MAQ A;  3PHE A;  3QFW A;  2VPZ B;  1TV6 A;  2D74 B;  3EDQ B;  3MM6 A;  4YP3 A;  3S7R A;  2NXE A;  2F9J A;  2DGS A;  3PVX A;  5KFU A;  2XMW A;  5E5N A;  3T5H A;  4RNN A;  3KUH A;  1BQN A;  5CAA A;  5CYJ A;  2LCW A;  2AJQ A;  4E8U A;  4F25 A;  2MTL A;  4HTI A;  2I8E A;  1UVI A;  1WUU A;  2GAG C;  1RTJ B;  1FJ7 A;  1R0B G;  3TZX A;  3NOG A;  1AYE A;  1RHR B;  2QX0 A;  1I1G A;  2BEF A;  3OJS A;  3LTO A;  4OYZ A;  5DO2 A;  2ZUA A;  4ID8 A;  3H5U A;  3W8G A;  5CCL A;  2EFG A;  2JEI A;  1SL0 A;  4CTA A;  3QBC A;  2C3P A;  1DZ5 A;  2LQJ A;  2QN6 B;  3ZZU A;  3M32 B;  1TEL A;  4RPF A;  5KFN A;  4CNY A;  2F7V A;  4IFV B;  3TVZ A;  1ZZN A;  4W98 A;  1JLC B;  3UDE A;  2V34 A;  4LF7 J;  4LR9 A;  4KFB B;  4P75 A;  5KFE A;  3QWU A;  1F5B A;  4JI3 J;  2WTF A;  1CJT A;  5ETK A;  1HAR A;  5KT7 A;  4UW2 A;  4DR4 J;  2HHW A;  4DV3 J;  2EXU A;  2DH7 A;  1HBU A;  3SDE A;  1X5S A;  2MKK A;  1HPZ B;  2FYX A;  2NCK L;  4LSZ B;  2DO0 A;  3HFK A;  2KTQ A;  1GXT A;  1KDN A;  1NDL A;  2WSF C;  2GQQ A;  4HT5 A;  3BSO A;  3T1A A;  3J7A 1;  1IQZ A;  1NJI T;  1TL4 A;  1FX4 A;  3HUL A;  2R2S A;  3ZTO A;  2IM3 A;  4YB6 A;  2DIT A;  4X4T A;  3G6V A;  1FES A;  1FRX A;  1N33 J;  4USW A;  3UCZ P;  2HHQ A;  2CDQ A;  3FEZ A;  3BB5 A;  1MNE A;  2VBW A;  3W3S A;  4LF9 J;  1RB0 A;  4LT6 A;  2JLG A;  4KR0 B;  3I0R A;  2OH2 A;  4YB5 A;  4DPW A;  4AL7 A;  1IWA A;  4GVL A;  2VOP A;  3G96 A;  3L7O A;  4ZP6 A;  1T95 A;  2JDJ A;  2ZUG A;  3JYT B;  4PQU B;  2OGU A;  4ZS6 A;  1YJU A;  3UQS A;  3QID A;  3AXM A;  2GGP B;  4ED0 A;  1FJC A;  3IAM 9;  1C2P A;  3ZNJ 1;  7AT1 B;  4QQB A;  3SQG A;  2CG8 A;  3P45 B;  2V94 A;  5LT5 A;  4ECS A;  3BO2 A;  3GR1 A;  4DR1 J;  4IRK A;  4OYO A;  3PKY A;  1Y5N B;  4RBU A;  3BJY A;  4FKY A;  3MGJ A;  1KN6 A;  1HI1 A;  3RJM B;  2HIQ A;  1FRI A;  4P7V A;  1S6P A;  3MUR P;  2MQL A;  1HNV A;  5KG3 A;  2KL8 A;  2WOM B;  5HMZ A;  2NZC A;  1K44 A;  1HNX J;  2ABY A;  1WAC A;  2EFQ A;  2V8P A;  1TK0 A;  2BAN A;  5H9F J;  4MKB A;  1N5S A;  2VF3 A;  1TKX B;  1N88 A;  4X65 F;  1IM4 A;  2L48 A;  1NZ8 A;  4DS4 A;  4DR6 F;  1QD1 A;  1UL3 A;  3R7N B;  2JRS A;  1S1X A;  2J9E A;  1N5V A;  3M2R B;  1GMV A;  2XMK A;  1LWC B;  2P8I A;  3ZC4 A;  4F50 A;  2J8S A;  2CPI A;  5KOX A;  4OHX A;  1IKY B;  3OL6 A;  1IKV B;  3MEC A;  3KMQ A;  2MHE A;  5E3R A;  1ZA1 B;  1HBM A;  4MKY A;  1K8A T;  4NLU A;  3BYR A;  5A8R A;  4CLL A;  2JEG A;  4OHW A;  2ZVI A;  1QE1 B;  3MAA B;  2RUS A;  1XJW B;  3I4H X;  4URQ U;  4M5D B;  2OTJ S;  1YDL A;  5GVQ A;  2MQO A;  5I3P A;  1RWN B;  1N34 J;  4W90 B;  2ZH4 A;  3UCG A;  4DPO A;  1X4B A;  2AHO B;  1Z1Z A;  2QZ8 A;  4A8X A;  2H54 B;  2V4R A;  1M1H A;  1SI9 A;  4CM0 A;  1R0A B;  4BC9 A;  2MKI A;  4KRW A;  1MWY A;  1FK9 B;  4DQS A;  3EPI A;  1HHT P;  4HL9 A;  1EET A;  1B0T A;  3UO0 A;  2ATL A;  1PBA A;  3DM2 A;  3HKZ D;  3WHI A;  3IR5 B;  3W7B A;  9RUB A;  4B3M J;  1IQT A;  2DNQ A;  1VLY A;  4OZN A;  3HK2 A;  1FDB A;  4JI6 J;  3JQM A;  1AUS L;  1Q79 A;  3DDN A;  1OYE A;  4TYB A;  5DG7 A;  3GP9 A;  5IV3 A;  4HAC B;  2CQ0 A;  5GAG U;  2I6W A;  4U9R A;  1IM6 A;  3FRZ A;  2DIS A;  1ZTT A;  3KK2 A;  1S10 A;  3KYL A;  4WFB Q;  2JC0 A;  1DLO B;  2R7Q A;  3EZU A;  2MGZ B;  2FZG B;  2VKR A;  4DZ6 A;  3ILJ A;  3N0V A;  2CQ2 A;  1KSP A;  2VBX A;  1HQU B;  2YKO A;  3DFE A;  2RSQ A;  3OR2 A;  3JSY A;  2OIH A;  3OVB A;  2KRR A;  3THP A;  2VD3 A;  1U0S A;  5ETN A;  3B78 A;  2Q66 A;  3QT5 A;  1R8B A;  3CCJ S;  4USV A;  1DQ9 A;  1KLN A;  3K5L A;  2R7X A;  1OY8 A;  2AD9 A;  4ID5 A;  3BBF A;  3BEG B;  3G2X A;  4N8N A;  1SUQ A;  2QL7 B;  3UE2 A;  2HVZ A;  4QIF A;  4CYU A;  3I0S B;  2R7R A;  2L9W A;  4QWE A;  2KH9 A;  1S6O A;  4TLQ A;  2UUA J;  4CI0 B;  5DET A;  1SC4 B;  4ICL A;  4DV4 J;  3TRG A;  4KSE B;  1X7V A;  3MTK A;  3VV2 B;  2FVC A;  1VRT A;  2XQC A;  1VLO A;  4OYW A;  2RDI A;  1TU0 B;  1L3T A;  1KQK A;  5IV4 A;  2DHG A;  2HFO A;  3CMA S;  4DUY F;  1TUG B;  1LW0 B;  2ZBP A;  3GWC A;  4K7Q A;  2QC3 A;  4OZJ A;  3KWM A;  3MM9 A;  3ZZO A;  1TZ0 A;  1VGY A;  4IH6 A;  4NCG B;  1GFW B;  4AFF A;  4BWJ A;  4TN2 A;  3DNC A;  3W62 A;  1Q5V A;  3AA8 A;  5LJ5 Y;  3R5A A;  3MHY A;  4WKR A;  1OPZ A;  4O0N A;  1VHI A;  1D8Y A;  3A13 A;  2CJY B;  3ISN C;  2ZJQ Q;  5H9E K;  3CGI A;  2FZC B;  4USH A;  2ZJR Q;  1CC7 A;  1DQ8 A;  3OJU A;  3K5P A;  2Z2M A;  1KNZ A;  5KFM A;  4PKD B;  3D2W A;  1DQA A;  4LIR A;  4YUD A;  5M2R A;  4ELT A;  3LWL A;  1FVQ A;  3L4B C;  1HYS B;  1PIL A;  3V2U C;  2HFZ A;  2HHV A;  5J1E A;  3GG0 A;  3RBE A;  2KG0 A;  3RB3 A;  4B9L A;  4DLG A;  3IS9 A;  4O44 B;  1I51 B;  4CO3 A;  1NRK A;  2HQ3 A;  2W4P A;  3CJ8 A;  3H5S A;  2HND A;  2UXC J;  1VQS A;  3HHK A;  1RHJ B;  3OTD A;  3KLH A;  3IG1 A;  5KFP A;  2CNL B;  3DCA A;  4RWX A;  2MQQ A;  3Q8P B;  3TJA A;  2UU9 F;  3D67 A;  2L08 A;  2E44 A;  1UEU A;  1EZZ B;  2QYG A;  5F0U A;  1Z4U A;  1WI6 A;  4OZ1 A;  2JFD A;  3VAG A;  2W2O P;  1R0C B;  2LEP A;  4G1P A;  2MQN A;  2Z8Q A;  4B02 A;  3NGD A;  2DHA A;  1S57 A;  1OSC A;  4Q0B A;  2DNP A;  5C5J A;  3MD3 A;  4N56 A;  1U6F A;  4P9S A;  4WKY A;  5CYQ A;  1PBU A;  3NP5 A;  2B4P A;  2DCL A;  2OHD A;  1S1T B;  1AW0 A;  4CRJ A;  4F3Q A;  1M0S A;  3IO1 A;  2RDJ A;  1FKA F;  2R7S A;  3SYZ A;  5KFI A;  4CH1 A;  5GAD I;  1CQN A;  4F36 A;  2VHG A;  3L3C A;  1OS5 A;  2JEJ A;  1JJH A;  3HHL D;  2D3O R;  4NLR A;  2E9Z A;  1X9S A;  1U1P A;  2OPQ A;  5LMU F;  3AD8 C;  4JI0 F;  3OUY A;  1KFS A;  2OAU A;  1F5C A;  9ATC B;  2QA1 A;  2MQP A;  2QSF A;  1S48 A;  2LYV A;  2E7V A;  4YME A;  3BGU A;  3TZW A;  3HHL A;  5LSO A;  1B99 A;  1NND A;  2CQI A;  4P2S A;  3GJT B;  4ZVQ B;  1FWL A;  4J5O A;  4R0J A;  1CUL A;  2WVB A;  3PYE A;  4NZ7 A;  3ICL A;  2IAJ A;  5KFV A;  2CRL A;  2N7Y A;  2E5L F;  4QIG A;  2W4D A;  1VRU B;  1YJR A;  2YKN B;  1NHU A;  3P4U B;  4Y3C A;  5A76 A;  2D69 A;  1NO8 A;  1FRH A;  1XMB A;  5D8H B;  4NXN F;  1M5S A;  3AHP A;  4C8M A;  5DJB A;  1T8E A;  3M6U A;  4DSI A;  2IBK A;  3T41 A;  2ZBQ A;  3OL9 A;  3M4X A;  1RTI B;  2FC9 A;  1RWU A;  3A8I A;  4N76 A;  3QIP A;  3KJN B;  2LVW A;  3BSC A;  2XMJ A;  2Y8W A;  3RW6 A;  2R2R A;  3TEG A;  4NI2 A;  3VZI A;  2UV8 G;  3BS9 A;  1Q7L B;  4NZ0 A;  1YG0 A;  3DXB A;  2DRD A;  2HNZ B;  4LF6 F;  2R42 A;  3NS6 A;  3OHA A;  2YWE A;  3OTO J;  4DV2 F;  1S7H A;  4ZMM A;  1VBY A;  1NDP A;  1NEE A;  2DGW A;  2X1F A;  3HVR A;  1QLN A;  3PJW A;  1WOS A;  4K0K F;  4MIA A;  3BQ1 A;  5B0B A;  6FD1 A;  3TOQ A;  3U1N A;  1WOO A;  3DMJ A;  2J6U A;  4K4U A;  1N56 A;  2HHH J;  2VPX B;  1IUJ A;  4MYT A;  2A2C A;  4DHV A;  4LSL A;  4ZHR B;  4C9D A;  1FWK A;  2RAQ A;  2E9R X;  2AKW B;  4L76 A;  4ZIV A;  3LF0 A;  1IR2 A;  3VGT A;  3BR8 A;  3TX8 A;  4HDH A;  4PG7 A;  3K58 A;  2PFD A;  1RT2 A;  3LAK A;  3SI8 A;  3QLH B;  4X66 F;  3BH7 B;  4O4G A;  3SBM A;  4LFA J;  4NML A;  3BPD A;  2V0N A;  3KNG A;  5AXN A;  1RHK B;  3NAI A;  2DNG A;  2ZH9 A;  3Q23 A;  2IVF B;  2C2D A;  3QAE A;  3V81 B;  4HR2 A;  3LW5 C;  3NWG A;  1D8Z A;  4DF4 A;  1KR4 A;  2BRL A;  5KG2 A;  3M8S A;  3DLE B;  2UUT A;  3RAQ A;  2HMI A;  1IKW A;  2VH7 A;  1E6Y B;  4F4A A;  1RHQ B;  3NGK A;  4CO1 A;  2O3D A;  2ZWP A;  2ASL A;  3MFH A;  1FI4 A;  2OJ3 A;  5J2N B;  4DU7 A;  3EZ5 A;  1V9O A;  4LRE A;  1YJ9 S;  1ELO A;  2F40 A;  4KGK A;  5CAB A;  1RAI B;  2HVE A;  4QZV B;  1VI7 A;  2WON A;  3OFE A;  1N54 B;  3I4P A;  3ZZ0 A;  4K4V A;  4WU3 A;  3ZNU A;  3VTI A;  1N36 F;  1HI8 A;  1H72 C;  2Y8Y A;  4HEA 9;  4KPC A;  1EJ7 L;  1VMB A;  3R5G A;  5J2P B;  3GYG A;  2H5I B;  1WHY A;  3LGM A;  2VBY A;  2J76 E;  2YPZ A;  5LXR A;  2DPI A;  3KJQ B;  1FTC A;  1X4D A;  1RT1 A;  1TUW A;  5DDO C;  4FNI A;  1RAO A;  4B17 A;  2OPR B;  1DTT A;  3OTC A;  1BLU A;  3QRP A;  1AXQ A;  3TW0 A;  2D7S A;  3EGZ A;  4B3S J;  3C15 B;  3SQO P;  1WEZ A;  2VQE J;  1M5V C;  3LA0 A;  3M30 B;  1F9E B;  2BJ9 A;  2RIJ A;  1BY9 A;  3MM7 A;  2GJ2 A;  3R2C J;  1PG5 B;  5U47 A;  1CJU A;  1EP4 B;  2AF6 A;  2MZQ A;  2DNR A;  2BOA A;  3B6B A;  2IFX A;  4RJV A;  4X4S A;  1RT5 B;  2ZDP A;  1EKS A;  3GE9 A;  2UUB F;  3PXG a;  4Z2X A;  2QTW A;  3LQV A;  4TU9 A;  1J5E F;  3PRV A;  4KC5 A;  2K3I A;  2ZM6 J;  3FFI A;  1TKT A;  4JV1 A;  4HI2 A;  2DGX A;  2E5J A;  3N6L A;  2VG6 A;  2CXE A;  2VJU A;  3QJP A;  1NHV A;  3E8O A;  1SPB P;  3I5A A;  2IM1 A;  1X4A A;  1FEH A;  1X4C A;  1JLG A;  4I2P B;  3N6M A;  5T41 A;  1BQX A;  4YDX A;  4WFZ A;  1AZS B;  3K8W A;  4DL4 A;  4ZPW R;  3M2V A;  4K4W A;  3IRX B;  4X62 J;  2DRB A;  3BDE A;  1S4E A;  1UVM A;  3K7R A;  1JWW A;  1FKP B;  5KAK A;  4DU8 A;  3BKU A;  3T1Y J;  2PN6 A;  3R27 A;  4AYB D;  3AQP A;  2RRB A;  2CPZ A;  4BBY A;  3O1L A;  5KFH A;  1JLF A;  4DR5 F;  3MUT P;  1Y9O A;  4F26 A;  4K5S A;  1B70 B;  4XO0 A;  3PNI A;  4U7C A;  3TAR A;  3GFX A;  3PG9 A;  2V2V A;  2IDE A;  2CPD A;  1ITP A;  4DR4 F;  2DY1 A;  4KV8 A;  3HSG A;  2DTJ A;  5LJ3 Y;  3DLG A;  1V3R A;  1NK6 A;  3MD1 A;  3N5F A;  3PR4 A;  5SUH A;  2NPI A;  1RBL A;  2FJB B;  1HWL A;  3LGN A;  3C14 A;  2KXH A;  4L73 A;  3N01 A;  1HQE A;  4OV6 A;  5HL7 Q;  2QG9 B;  4QR2 A;  2V8V A;  4DG1 B;  3G6X A;  4F0M A;  3I96 A;  5ETM A;  4DV0 J;  3L95 X;  5AT1 B;  2W2M P;  1OY6 A;  3TEH B;  4OZ5 A;  5C24 A;  2C3O A;  3V6K A;  1TL7 A;  4Y28 C;  2B9Y A;  4IQX A;  3NCR A;  3WBZ A;  3AB2 B;  3FZB A;  3HT0 A;  1FT8 A;  4DL7 A;  2X3D A;  3CCL S;  5RUB A;  2P2C B;  1U8W A;  4NXM F;  2RJZ A;  2NXJ A;  2NR0 A;  1K9M T;  4FYW B;  3UVJ B;  4MK7 A;  4KO0 B;  4YHH J;  3KHR A;  1ZM9 A;  5I42 A;  2VG5 B;  4JI7 J;  2HRY A;  2GHV C;  1LXJ A;  1UW4 A;  1IBL F;  1YSJ A;  3BGL A;  2HBZ B;  3POT A;  1A0O B;  1K0T A;  4NMX A;  1X9M A;  1LFP A;  2AEF A;  1Q0N A;  3VAM A;  3JXO A;  2HHP A;  1RYR A;  3QQC D;  4PG4 A;  1RWX B;  2OEJ A;  4LJM A;  4ECQ A;  5KG7 A;  4ETZ A;  1FKO B;  2PSZ A;  3DOM A;  4U7U D;  3R97 A;  5IT9 Y;  5KT6 A;  3GLJ A;  1FVS A;  2MHN A;  1EIY B;  2AEM A;  1UJ4 A;  4TQS A;  1CJK A;  3WIV A;  1NME B;  5HVH A;  1Q8I A;  4LRA A;  5G4D A;  5DDP C;  4P2M A;  1YX2 A;  4PWD A;  1WC5 A;  2CZ4 A;  4CO2 A;  1NK8 A;  1KWM A;  4C11 B;  1NCL A;  4X4R A;  2QLJ B;  1ZAX A;  4Q2M A;  1VFJ A;  3ELH A;  2WHO A;  3GTY X;  2UVR A;  1AT1 B;  4TY9 A;  1W2B R;  1RTD A;  3Q8Q B;  3R1L A;  4IDK A;  2ZH8 A;  1BHN A;  1WOP A;  1NBE B;  2AYB A;  4ED7 A;  1QY7 A;  2BRK A;  3CTR A;  2CG4 A;  2CIM A;  1WEX A;  2CPY A;  4RU2 A;  1LWF A;  3CJ2 A;  4WE1 A;  2CWK A;  2BUN A;  1SV5 A;  2ZHO A;  1F5A A;  3K57 A;  4ZN1 A;  2OML A;  3B4M A;  4LF2 A;  1HMV A;  2YNH B;  3UD3 P;  2CUY A;  1N34 F;  2V8D A;  1RBA A;  4RR5 A;  5KFQ A;  4ED4 A;  5E3P A;  2RD5 C;  1D09 B;  3I5C A;  2IRX A;  4ZVO B;  4UOG A;  3UNY A;  3E01 A;  1DAR A;  3L7U A;  2DIU A;  1NJZ A;  2KB2 A;  3V6D A;  2C1E B;  2GC8 A;  1HNZ F;  4CLS A;  4MKA A;  1IN0 A;  1PAE X;  3L9Z A;  1H74 A;  1S1V A;  2F3J A;  2HFN A;  1Y0H A;  1P27 B;  1M1G A;  3TVK A;  1P6T A;  3KLG A;  3O5T B;  4WP9 A;  2AWZ A;  4YN3 B;  4NE9 C;  2J9C A;  4U67 Q;  1S1W B;  2K1R A;  3NL0 A;  5LOQ A;  1QM9 A;  1SQE A;  2J9D A;  3TQE A;  4I2Q B;  2DR5 A;  1KQG B;  1WG1 A;  4JI6 F;  4LMZ A;  5ETT A;  2DHX A;  2V9K A;  4RUC A;  3HO1 A;  4LF8 F;  1MSW D;  1UKU A;  4GVB A;  3M8Q B;  2Y0S D;  4C48 A;  1CJV B;  1FNM A;  3KLE B;  3VQS A;  2MZT A;  1RT3 B;  3FQL A;  1XQI A;  3GSD A;  2IJN A;  3JSM A;  3RG6 A;  3T19 A;  4Y2I A;  2B4O A;  1SQG A;  3VGV A;  5L9N A;  2Y1R I;  4XK8 C;  3UR0 A;  2J0S D;  1F0X A;  1R43 A;  3VCD A;  4NL5 A;  3BN7 A;  1JLB A;  2IA6 A;  4DXL A;  3LH2 S;  4I7F A;  1Q82 T;  2NXC A;  2DGO A;  1S6U A;  2KFZ A;  4HHH A;  3EDR B;  2Z2Y B;  2AX0 A;  4XIU A;  3JB9 k;  1A7G E;  2NLW A;  4DFK A;  4RW6 A;  1R31 A;  1L3V A;  2XSJ A;  4A8K A;  3QAU A;  1OY9 A;  1FXL A;  1OYD A;  3DGV A;  4MMO A;  2CFX A;  5BYR A;  1RAJ A;  2VKZ G;  2MMY A;  4RW7 B;  1LWX A;  2XHC A;  1C4A A;  3N5B A;  2G2Y A;  1T05 A;  3TAP A;  5L8R C;  4A8Q A;  5HP1 B;  2HVI A;  3RGI A;  4NAS A;  2W7A A;  4PAA A;  3AAW B;  1IVZ A;  1D9F A;  1Y5I B;  3G6E S;  3ADA C;  1RLC L;  1NK4 A;  3ZZR A;  3DOK A;  1VQK S;  4Y00 A;  4Y34 A;  5D0H A;  1T02 A;  2JNJ A;  3JS9 A;  3H0P A;  2HHX A;  4FYV B;  5GAH U;  4HI1 A;  4CO4 A;  2CPJ A;  1G4C A;  2RUG A;  2E1R A;  2PO4 A;  4LQ9 A;  1M5K C;  1HI0 P;  4K50 A;  4RBV A;  1UTA A;  2FGC A;  4U96 A;  2KRB A;  4FXD A;  4O3R A;  3CCV S;  3HVT B;  1VQ4 S;  5J1N A;  4O3S A;  3H2U B;  3AQO A;  2YNI B;  3K8V A;  1JLA A;  3W2V A;  3P5T L;  3AB4 B;  3F44 A;  2H65 B;  1KKH A;  3ITH B;  1T03 B;  2J6S A;  1VJW A;  1APS A;  3OVA A;  4LF5 J;  2ROG A;  2WB4 A;  3BPS P;  3HM9 A;  3IXQ A;  1UVN A;  5CH7 B;  3QO9 B;  1S6Q B;  3S6E A;  5D6G A;  2M5Y A;  3EVM A;  2CWX A;  5E7O B;  2AJ1 A;  4AE5 A;  5HBM B;  4FF1 A;  2F5G A;  2GO8 A;  4B3O B;  2KJW A;  4A4J A;  1HL6 A;  1F60 B;  3CPW R;  2KHC A;  2PEH A;  1WSR A;  4KGZ B;  4R5P B;  8RUC A;  1M1K T;  2MKY A;  2N7C A;  1LEO A;  2CKW A;  3CJS A;  1JLE B;  2MY8 A;  4ECU A;  4X65 J;  2XGP A;  2ROP A;  4NLQ A;  5DS7 A;  3UN3 A;  1FDA A;  1C1C A;  4CO0 A;  1NM2 A;  2Y3Y A;  2UUC F;  2A1B A;  3WDO A;  1WF0 A;  3KLF B;  1NSA A;  4QW9 A;  2ZKU A;  3IR6 B;  4UZC A;  4RNM A;  3R1H A;  2XG8 A;  1U1Q A;  4PG5 A;  4QIE A;  4J9P A;  2XS7 A;  4QR0 A;  2B9E A;  4GRS A;  2B9X A;  2XO6 A;  2ZOG A;  1D0E A;  2HBY B;  2SXL A;  3I6P A;  3OR1 B;  2P9E A;  4DUZ J;  3TQ1 A;  2B3T B;  1S1U B;  3PJ9 A;  1KTQ A;  3Q22 A;  1T9Y A;  5L1K A;  1NXI A;  1XEZ A;  1GT8 A;  4ZPA A;  2WRM A;  2ASD A;  2H9Z A;  2ZWO A;  4ZVU B;  3CCE S;  4EI2 A;  4AL6 A;  1YRT A;  4NOH A;  5I3U A;  5B7W A;  2FY8 A;  2AIR B;  2ZE2 B;  4JUZ A;  3CO9 A;  3W66 A;  3OBI A;  5IS2 A;  3MEE A;  4C0H A;  4AL5 A;  5IT4 A;  1OIA A;  1PIE A;  1WHW A;  3TUJ C;  2ZDO A;  4TY8 B;  1TQL A;  4BHQ A;  5B0G A;  2EBE A;  2OPP B;  2IC3 B;  4KHM A;  1FNX H;  4DWI A;  3RBX A;  4P73 A;  2W01 A;  4L75 A;  3M9O B;  3T3F A;  6AT1 B;  1RHM B;  1QVG R;  1XNR F;  5D4L A;  4QWB A;  3BH6 B;  4TU7 A;  3M05 A;  3R6G B;  3EE3 A;  3GSI A;  2UVU A;  2EC2 A;  3CC4 S;  2CJ9 A;  2HFS A;  2MB0 B;  4PCQ A;  2PMW A;  4ZPV R;  3HP6 A;  4KIA A;  4FF3 A;  4UTG A;  1N6Q B;  1YJT A;  3VQT A;  2GJF A;  2CDR B;  1BMQ B;  1RAH B;  1TMM A;  2HLU A;  2OP5 A;  3C6T A;  3EMT A;  2ZZN A;  2HS0 A;  4OX9 F;  1V5V A;  4URG A;  2CJK A;  1SJR A;  2NQP A;  3DLK B;  1UPM B;  5A8W A;  1LXN A;  2H5J B;  2XCA A;  4CO5 A;  2DB1 A;  4O23 A;  3NBP B;  4ZN3 A;  2OTL S;  2DCU B;  4CLF A;  3DHX A;  1QVF R;  2GO9 A;  3G9C A;  2R8J A;  3O8W A;  2YQ0 A;  3K17 A;  3V4I B;  2JVO A;  1XR5 A;  5CYM B;  4Q44 A;  1GQE A;  2NS1 B;  1SL1 A;  4WP3 A;  3D6M B;  2ZIT A;  2IJR A;  5DG9 A;  2W7O A;  2X1G A;  4R0E A;  2W9C B;  2XS5 A;  3OQ2 A;  4USJ C;  3D9B A;  3GV8 B;  2XZT B;  2DO4 A;  3BSA A;  1DY3 A;  1YGY A;  3CDE A;  5HJY A;  1FA0 A;  3KLI B;  3M9M B;  1HNW J;  1TL3 B;  1B4S A;  3TAN A;  2GAH C;  4ILM A;  4P72 A;  2ASY A;  3PM9 A;  3TNV A;  2CQD A;  1MU2 B;  1Q8K A;  1C0T B;  3W2W A;  4IO1 A;  4N7T A;  1IKX A;  1FXD A;  2WW4 A;  2YWH A;  5GAE I;  4ZVF A;  2DGT A;  4F04 B;  2U1A A;  1KLM A;  2YXL A;  2BJ8 A;  2V68 A;  4DUY J;  2BKN A;  1TK8 A;  5KG0 A;  3FSI A;  1ZZF A;  1N5Q A;  2RE1 A;  2HZA A;  2CAD A;  1TKD A;  1HLW A;  4USU A;  3WIU A;  4G1Q A;  3MR6 A;  1U0H A;  4YEA A;  2XGQ A;  2V9W A;  4MK9 A;  5HLF A;  2ACM A;  3PYG A;  4ZVE A;  2R7V A;  2KXF A;  4I1T A;  2LDY A;  2EI5 A;  3HVA A;  4ECW A;  4CZC A;  3J80 Y;  3VGU A;  3MMB A;  3F73 A;  4ZP7 A;  4U95 A;  2QV6 A;  4B9M A;  1KBR A;  2ZD1 A;  4WP8 A;  5L1L A;  1DHM A;  3HZE A;  1OQ3 A;  1WC3 A;  1WF2 A;  3MMJ A;  4KBI A;  5L46 A;  2V5H G;  1L3K A;  2JJ4 D;  2UP1 A;  2LDI A;  2HGN A;  2YKA A;  1HBN B;  3DRS B;  1RK8 A;  2KXN B;  1J5O B;  4ZOS A;  2K8G A;  4P74 A;  2DNH A;  5CXT A;  2Z0G A;  4IR9 A;  5IFM A;  3D3C J;  1LKZ A;  1R3N A;  1RAG B;  1SJQ A;  2CQ3 A;  4V1A k;  3EX7 B;  4IFY B;  1MRO A;  2HWI A;  5F0W A;  1LW2 B;  3MEG B;  4OI2 A;  3BN4 A;  1NH8 A;  4KKO A;  4DL2 A;  1Q7Y T;  2DNY A;  3HKW A;  1TL5 A;  1XNQ F;  4AD6 A;  4LSN A;  2FGO A;  4WWS A;  3OTB A;  3UN2 A;  3MED A;  3IR7 B;  2J0W A;  4OJ1 A;  2VIH A;  5HRO A;  1H0H B;  4RW8 A;  4WXW A;  2O5D A;  2VAS A;  1O0P A;  3CCW A;  3BGR B;  4H4O A;  4C97 A;  2NZ4 A;  3DOL B;  4L72 B;  4ZPT R;  4JYA F;  4TU8 A;  1X5O A;  4NCB A;  5BR8 F;  2EKN A;  4H4M A;  2UVV A;  4GKJ F;  2IBO A;  2MKS A;  4A48 A;  5D77 A;  2XLJ A;  5C42 A;  4WZM A;  2CNO B;  2C22 A;  4C8Y A;  2GQ2 A;  4KGX B;  2CQB A;  4UQT A;  2DVI A;  2UV8 A;  1VC5 A;  3PW2 A;  3DLB A;  2QLF B;  4EMD A;  2C2N A;  4NYO A;  4I6W A;  3MCM A;  1KEK A;  1KVI A;  2H3E B;  1XMO F;  5G0R A;  3SZ2 A;  5F9L A;  2OKQ A;  3FNN A;  2IMO A;  4QIV A;  3MCN A;  1Y3K A;  4RW9 B;  4QYZ K;  2GML A;  5LMU J;  3AOA A;  5K8N A;  4I56 A;  4S0M A;  4WXO A;  1RAF B;  2XI3 A;  4PR6 A;  5T7L A;  4HH0 A;  1M5P C;  4Q2L A;  4IG3 B;  3CCU S;  2W9A A;  2AP6 A;  2JZ5 A;  1S9E B;  3ENW A;  2GCF A;  1VQ6 S;  2GIF A;  4KAI A;  1RIS A;  1GXU A;  1SC1 B;  5AJ3 F;  5D3G A;  1ARO P;  4ECV A;  4DR2 F;  1IBK J;  4LBH A;  2YKM A;  5EDW A;  2OLW A;  1FX2 A;  2KFN A;  4NXN J;  2R7U A;  4Z37 A;  3R5B A;  5A2Q Y;  5HSP A;  3PYD A;  4ZP9 A;  2MST A;  1WDD A;  1Z2Z A;  2RS8 A;  5A0Y B;  1CVJ A;  4F67 A;  2GVD B;  2FC8 A;  4JI5 J;  3OSN A;  2R9L A;  4P52 A;  5D15 A;  3W8P A;  5KFR A;  3T1Y F;  1HD1 A;  4E0D A;  5MAO A;  3N9U C;  2M3D A;  3QRR A;  3I55 S;  1C1B A;  2KN4 A;  1TV6 B;  2UXD F;  3MM6 B;  3TUP A;  1YKW A;  1HBO A;  3HCX A;  1SKS A;  2N3O A;  2MKH A;  4K5R A;  4DV2 J;  4MKV A;  4I69 A;  2J8A A;  2E9T A;  5DGA A;  1P9Y A;  1RT7 A;  3RW7 A;  1BQN B;  3KTQ A;  2HGL A;  4PUO A;  2P6S A;  4IH7 A;  4M5I A;  2RF2 A;  1FFW B;  5ETQ A;  2KO1 A;  4DSE A;  4Z7Y A;  3Q8R B;  4NA2 A;  5ETS A;  1N5T A;  2KDO A;  3PRB A;  3V5R A;  4BC7 A;  2IY5 B;  5J2M A;  1UWA A;  3LOU A;  1WDT A;  1K1Q A;  4M8L A;  1XR6 A;  1U2R A;  2VV5 A;  4RX6 A;  2B6A A;  3CJ3 A;  1U1N A;  2N4C A;  4X66 J;  2RB7 A;  4CTA B;  2IRU A;  2QL9 B;  3PRD A;  2HQI A;  3T5L A;  3R7S B;  4BLG A;  3GG1 A;  4IKA A;  2V50 A;  1RWK B;  4N77 A;  4QIW D;  3V6J A;  4DPT A;  4NX9 A;  2LLZ A;  3MPU B;  4WFA Q;  4C8Z A;  1X4E A;  5K8M A;  4DCO B;  1CJT B;  2ZEJ A;  2LMI A;  3M1V A;  2OPS A;  2E7W A;  1TAQ A;  1XIQ A;  3HX9 A;  4DV7 F;  3A12 A;  2GMJ A;  3BYP A;  1HBU B;  5K14 A;  3SDE B;  3QT8 A;  4WJB A;  1GH8 A;  3G82 A;  4DS5 A;  2BW7 A;  1YIT S;  1VRQ C;  2DBB A;  5B0A A;  2F1F A;  1S0V A;  4XAK A;  4UUW A;  4MFB A;  2V4J A;  3P96 A;  2MXY A;  4QU7 A;  3MM5 A;  4JV0 A;  3VHQ A;  3SCL E;  1NPR A;  2BE9 B;  2K2P A;  4X4O A;  4ZVG A;  4OI6 A;  2HQG A;  1N36 J;  3KMS A;  3EPG A;  4RU9 A;  3H4B A;  1XWL A;  3I0R B;  1EX8 A;  5DQI A;  3VF0 B;  4ANE A;  4K4X A;  1T9T A;  2Q79 A;  1VQP S;  1NU4 A;  1Y11 A;  3UD4 P;  1QAY A;  1TKZ A;  4ZVT B;  1OWX A;  4NLX A;  1X5P A;  5LXY A;  1XMQ F;  3R5D A;  5IT9 U;  5KFS A;  2KZZ A;  2VFS A;  2B5J A;  1WEL A;  3SQG B;  4YDD B;  1MWQ A;  2WVD A;  2AGQ A;  3R2D J;  2DNK A;  2JOQ A;  1IJF B;  3SCK E;  4DDF A;  2UVW A;  4ECR A;  1ZAV A;  3GIJ A;  3DDK A;  3MWB A;  4ALZ A;  5E3C A;  4DR7 F;  3PAC A;  1G2E A;  4P2F A;  5HQ8 A;  1R8H A;  2HVH A;  1LV5 A;  2IYG A;  3I9Z A;  1JMT A;  1NKB A;  1YBU A;  4XTT A;  1BD6 A;  1S6P B;  3LP1 A;  2LKZ A;  2HZV A;  1HNV B;  4EBC A;  4JI8 F;  3DRY A;  2F4V J;  3M8W A;  1HQ2 A;  2UUB J;  3F41 A;  4EK2 A;  3R8Y A;  4C8K A;  4J9Q A;  2Q6C A;  5HQM A;  1J5E J;  2BZ2 A;  3MR2 A;  2HRU A;  2C28 A;  2BAN B;  3FBF A;  3QSI A;  2LEA A;  4B9S A;  5B0E A;  3W65 A;  2JL9 A;  2AYG A;  3TUI C;  5DDQ C;  2P5V A;  3OXL A;  5D78 A;  1R6V A;  1FNO A;  2DNL A;  1N8R T;  1JX4 A;  4F4K A;  3F0N A;  2JH3 A;  1S1X B;  2CJA A;  2FHJ A;  4PXB A;  3CJK A;  1S5Z A;  2KT2 A;  2P6T A;  3OFG A;  2ZH2 A;  1YZ7 A;  4IUF A;  3MEC B;  3G8T A;  4TKT A;  4GKK J;  1YBA A;  3CCQ S;  3EWG A;  4UY8 T;  3BBB A;  1WJ9 A;  1HBM B;  5A8R B;  2LXU A;  2XUL A;  5C25 A;  3KG1 A;  2C2K B;  3DHW C;  5HK4 A;  1PKU A;  2HAI A;  5A6P A;  1RDR A;  2VJV A;  1SCJ B;  4B9T A;  1U26 A;  1TP7 A;  3FC9 A;  3J7A N;  1N0V C;  2MDA A;  4OJG A;  2B8Q A;  4ZVS B;  3NCQ A;  5J2Q A;  1FEE A;  2EK1 A;  1FD2 A;  3BV8 A;  4JV5 F;  3D7S B;  4DR5 J;  2C2Z B;  4J9S A;  3CJ0 A;  1EQM A;  2FD2 A;  4ED6 A;  3EZO A;  1GEH A;  2QFJ A;  2XMV A;  2QLW A;  3Q89 A;  2FHO B;  4Y6I A;  1KVJ A;  4DX6 A;  2FJD B;  3CF5 Q;  5IC6 B;  2BJ7 A;  4HH1 A;  1T3N A;  3KK3 A;  4F0H A;  1EET B;  3V6H A;  1IJE B;  4Y65 A;  3DM2 B;  1VIX A;  5H9F K;  1NK0 A;  4K2J A;  4NLY A;  3FEX B;  3P49 B;  5FDL A;  2HYI B;  2MJN A;  3H98 A;  5DG8 A;  3SSS A;  5C2G A;  1FD8 A;  1U6B A;  2G2O A;  1DJ0 A;  3AD9 C;  2B51 A;  2BMB A;  3EM1 A;  4ZVP B;  4DBQ A;  3KK2 B;  2KVQ E;  1RT6 A;  5KG6 A;  3VR1 A;  1RAD B;  2L9D A;  3QSY B;  1LNQ A;  1BQM A;  3D1O A;  3IFE A;  4PZV A;  4J9U E;  1F3F A;  2P9C A;  3Q0A A;  4NXM J;  3DYA A;  1NK7 A;  3DKD A;  4DF8 A;  1QAJ A;  4GC6 A;  2WCX A;  3OR2 B;  2W1B A;  4PG8 A;  1H2U X;  1SH3 A;  3G4S S;  1U48 A;  4DOZ A;  1TL1 A;  4M5G A;  5F3T A;  2IA0 A;  2K06 A;  5C2C A;  4LF5 F;  1IBL J;  1T9V A;  2GJI A;  3UD5 A;  1VC6 A;  1S72 S;  3K0J A;  3CD6 S;  4YOE A;  2L41 A;  4LVN P;  2J7W A;  1HIY A;  4ID5 B;  2VFT A;  1RE1 B;  4P10 A;  3T5J A;  1IBM F;  2ZOF A;  3IGN A;  1SUQ B;  1ZPV A;  4Q45 A;  3D5M A;  3C66 A;  4CYU B;  3TZZ A;  2AU0 A;  2XC9 A;  2UUW A;  4LIW A;  1VYA A;  4ICL B;  2KU7 A;  1KQS R;  1PCA A;  3R6L B;  1VRT B;  3ETO A;  1JQG A;  3US5 A;  3D1Q A;  2BJD A;  5F9N A;  2R8I A;  3ISN D;  2I38 A;  2RQM A;  2ASJ A;  3Q2S C;  3MM9 B;  1QDU B;  2DR9 A;  1ACM B;  4DQQ A;  2QO3 A;  1XTZ A;  4WPA A;  2ZH3 A;  4JV2 A;  4WCE Q;  3ET6 A;  1FE4 A;  5IXU A;  2YX4 A;  5EUH A;  2QEX S;  4A8W A;  3OT9 A;  1I5O B;  4NLG A;  2J0X A;  2EEY A;  4DUZ F;  1SH0 A;  2AW0 A;  2CVE A;  4WZQ A;  1YBT A;  4ZCL A;  1ZAW A;  1VQY A;  3BQ0 A;  5B08 A;  5F8L A;  3CCR S;  2B4U A;  4P2X A;  4ES3 A;  2M52 A;  1ZA2 B;  2BE2 A;  1HNI A;  3I5B A;  3N6N A;  4AUK A;  2E1A A;  5ETO A;  4PAB A;  5J1E B;  5KFX A;  3IS9 B;  1JKH A;  3GPA A;  1RYS A;  2HND B;  1W25 A;  2G4B A;  1HNZ J;  1E6V A;  3MTJ A;  2HS4 A;  4DPU A;  3KLH B;  3IG1 B;  2BV3 A;  2FIU A;  2HUR A;  2IRY A;  3NMR A;  3CJR A;  4RNF A;  2Q3P A;  3VZH A;  2HRT A;  2HWT A;  4LFC F;  1D9D A;  1R6Y A;  5D4P A;  3OL8 A;  2E5G A;  4V19 X;  4RUH A;  4DV6 F;  1UWB A;  1ZYQ A;  3MM8 A;  4ED1 A;  2VUG A;  1L5U A;  3CJ4 A;  3FQK A;  3MEK A;  1F3V A;  2A10 A;  4OHY A;  1M5O C;  1SJ1 A;  1D3W A;  1QAX A;  3MUM P;  4LF8 J;  4Q0B B;  1B3T A;  3EXY A;  5CYQ B;  3AOD A;  1GMW D;  2MQM A;  1RBO B;  3MXH P;  3OXF A;  2CAJ A;  1O51 A;  3CXC R;  2B56 A;  2AX1 A;  1W7W A;  4I6A A;  4XDC A;  2YNF A;  3W64 A;  1GMW A;  2ZH5 A;  1UJ5 A;  4EWT A;  2C42 A;  1Y5L B;  3ZTR A;  3P8B B;  2A6M A;  2HSE B;  4WYL A;  1MMD A;  2XMU A;  1L3U A;  2PMH A;  4M5J A;  4DSL A;  2OPQ B;  3RB4 A;  2UXB F;  3OUY B;  2FVS A;  4AQY F;  2HEK A;  2CQ4 A;  1GTH A;  2UZA A;  3EYZ A;  3FBC A;  3HHL B;  2JSX A;  2GW8 A;  2FUG 9;  4PWU A;  1OO0 B;  1HNW F;  3NKY A;  1SL2 A;  3M8R A;  4JI4 F;  5BXI A;  2ZZM A;  1CUL B;  2R4F A;  5HJX A;  2IAJ B;  2A2D A;  3VAL A;  3LP2 A;  1MLA A;  1FRL A;  1Q8B A;  3CED A;  3R3T A;  3RRK A;  3GQC A;  4GC7 A;  3LWM A;  4J37 A;  4FS1 A;  2KM8 B;  3TR5 A;  3KG4 A;  1BGX T;  5BJR A;  4DUT A;  2O01 C;  3BKT A;  4ES2 A;  2PT0 A;  3KLV A;  4L3K A;  3JTP A;  2ZC3 A;  4EUV A;  1MG7 A;  4OHZ A;  3ZFV A;  5ETV A;  2W9B A;  1UVL A;  3QIP B;  2EFO A;  3M8P A;  2BM1 A;  2IJF A;  3MPY A;  2IM2 A;  3M6V A;  1JLQ A;  1RKI A;  2HFV A;  3ZZY A;  3SFU A;  4NI2 B;  2LA6 A;  2G0J A;  3R5J B;  2VG7 A;  2E29 A;  1B0P A;  2JHE A;  1KC8 T;  5IWA F;  5E2Q A;  2JVR A;  1I94 J;  1RTH A;  4J9M A;  5FD1 A;  3KJV A;  3NEK A;  3DGP A;  2YX1 A;  4WFX A;  2E66 A;  4I67 A;  4CLY A;  1C4C A;  1RA7 A;  3CJ5 A;  3J80 U;  4IR1 A;  3DMJ B;  3H25 A;  2RDD A;  3SFG A;  5F8I A;  4JI2 F;  2C3U A;  2KYZ A;  4FBT A;  4LSL B;  2Z57 B;  1GNK A;  3J7Y I;  2LU2 A;  2I1R A;  2RHQ B;  3EGN A;  1KRP A;  2UUC J;  2ZHA A;  2E1C A;  3HF5 A;  3A4T A;  3SIP B;  4N47 A;  4N41 A;  4DL6 A;  3IM9 A;  2BBE A;  5D4O A;  1RT2 B;  1N52 B;  1RKJ A;  1SC6 A;  4CH0 S;  5B0F A;  1FJE B;  1ZS6 A;  2R2T A;  3TAM A;  4O4G B;  4I68 A;  2QGF B;  1N0U A;  3AY0 A;  3PW4 A;  2BR0 A;  4PG6 A;  2VDI A;  2CZV C;  1TVR A;  1TFY A;  5KFF A;  3OLB A;  1YRX A;  4C8L A;  3ENA A;  4J9R A;  3NRB A;  3ILI A;  1X0F A;  1WG5 A;  2DXF A;  1SJ3 P;  2HMI B;  1IKW B;  3IWN C;  3I31 A;  1ROF A;  1W26 A;  1VQO S;  5AXL A;  3CE8 A;  2ZBC A;  4FYY B;  4PRF A;  4C6A A;  3NGT A;  3N4W A;  3E51 A;  1LK7 A;  3QZ7 A;  2H51 B;  3QPI A;  4IO9 Q;  1S9G A;  1TR0 A;  5AXM A;  4M5N A;  3GB0 A;  4TLR A;  1XNR J;  5HVF A;  3JAM Y;  1X4F A;  2WON B;  4E2F B;  3VGS A;  2B7C B;  3M2U A;  1U25 A;  2YNG A;  3C16 A;  3SEO A;  4H4K C;  4J9L A;  3OXG A;  2WBR A;  1FWP A;  4J90 A;  1PYT A;  1RGV A;  4RBT A;  1SVD A;  5KT5 A;  1GXL A;  4NYP A;  1C0U A;  1GX5 A;  3I9V 9;  4CLU A;  2DR6 A;  4LVO P;  3J7Z T;  2XYH B;  1RT1 B;  1RXO B;  3DRR A;  2ALY B;  1IBK F;  3MMA A;  4QBU A;  4WIQ A;  2I0X A;  1DTT B;  2ZH6 A;  4OX9 J;  2DRA A;  2CJB A;  1YRU A;  4LFB F;  1ZM3 A;  1U7L A;  2CPF A;  1H98 A;  1VQN S;  1UEK A;  1S97 A;  3TO8 A;  2XHW A;  1H7X A;  4DV1 F;  5HN0 A;  3GZ7 A;  4MAK A;  4WBF A;  3WZ0 A;  1NH7 A;  3G86 A;  3MPW A;  1R8A A;  4RW4 A;  3U7J A;  2F65 A;  1P8G A;  2V4Q A;  3KHH A;  1WHX A;  3MM7 B;  4J9K A;  2B7B B;  2PDA A;  5LSR A;  1CJU B;  4IYQ A;  3KUE A;  2OEL A;  1G6B A;  4JI5 F;  2R7O A;  1PSD A;  1LFW A;  4LRD A;  4IOB A;  3CDB A;  1S59 A;  1HHS A;  5A2Q U;  2Z4P A;  1N5Y A;  1NDK A;  3LP0 A;  4M5K A;  2V8G A;  4UZB A;  2YQ3 A;  3GIK A;  5BYQ A;  4Y2A A;  1CS4 A;  1VR6 A;  4QWA A;  3TZY A;  1J2V A;  3NXZ A;  2FTR A;  1NLK L;  2RKI A;  4EYH B;  3FFI B;  1TKT B;  3C19 A;  1KTV A;  2GIR A;  2VG6 B;  3C2P A;  2YVS A;  3HHD A;  2ADB A;  2VC0 A;  5L38 A;  2VON A;  4ZKA A;  1DTQ A;  2BJ1 A;  4C8N A;  2R7W A;  3Q83 A;  1RWO B;  2YH1 A;  1CQM A;  1K1S A;  5CQG A;  4WK1 A;  6FDR A;  1JLG B;  1ICE B;  3UDL A;  5C7P A;  2KZM A;  4DZD A;  3BF4 A;  2NRE A;  4LRC A;  3R5C A;  3M2V B;  1N4L A;  2CVI A;  1H2V Z;  1YJW S;  1S0N A;  1YIJ S;  4PPD A;  2FHM A;  1YHQ S;  2D3O 1;  5K5M A;  3HFZ B;  3PY8 A;  3QAT A;  2OD4 A;  2XMM A;  5F8H A;  1WC4 A;  5LSL A;  1UMJ A;  3C6U A;  4DLE A;  5GAD U;  2V6A A;  3GV5 B;  4KQZ A;  4OYM A;  1DBD A;  4U7U K;  3MFI A;  2XNR A;  4OYI A;  1JLF B;  3IRW P;  1FO1 A; 
#chains in the Genus database with same CATH homology
 1WKJ A;  1BUX A;  4DZ6 A;  3EMT A;  3FC9 A;  2BEF A;  1F3F A;  3FCW A;  3EVM A;  4EK2 A;  1EHW A;  2B8Q A;  1WKL A;  2ZUA A;  1K44 A;  3FBB A;  1NPK A;  1BHN A;  3MPD A;  1NLK L;  3DKD A;  3EIC A;  4UOF A;  2HUR A;  3Q8V A;  3Q8U A;  3ZTS A;  1F6T A;  3FBF A;  4UOH A;  3BBC A;  4ANE A;  5IOL A;  4HR2 A;  3ETM A;  3FBC A;  3ENA A;  3VVU A;  1B99 A;  3JS9 A;  2DXE A;  1HLW A;  2AZ3 A;  4S0M A;  4W98 A;  3Q89 A;  4CP5 A;  1LEO A;  3R9L A;  3Q83 A;  4ENO A;  2DYA A;  3FBE A;  3FCV A;  2DXF A;  2DY9 A;  2CWK A;  5BXI A;  2B8P A;  1NHK L;  1NB2 A;  4WBF A;  1NDP A;  1S57 A;  4O0N A;  5C7P A;  1XQI A;  1HIY A;  3ZTQ A;  3BBF A;  4F4A A;  4ANC A;  3VGV A;  3G2X A;  3NGR A;  3EJM A;  3Q8Y A;  1XIQ A;  1S5Z A;  3VGU A;  3DDI A;  4AND A;  4C6A A;  3NGT A;  3Q86 A;  1MN9 A;  3NGS A;  3B54 A;  5CAA A;  2BX6 A;  1NUE A;  3WX8 A;  1NSQ A;  3GP9 A;  2HVD A;  3BH6 B;  2NCK L;  4DUT A;  3VGT A;  3B6B A;  4UOG A;  1KDN A;  1NDL A;  1W7W A;  3EM1 A;  3EE3 A;  5CAB A;  1JXV A;  2DXD A;  4FKY A;  1VYA A;  2HVE A;  1NDC A;  1B4S A;  3VVT A;  3BBB A;  1UCN A;  1NCL A;  3L7U A;  1NSK L;  4FKX A;  2AZ1 A;  3VGS A;  1HHQ A;  1S59 A;  4DI6 A;  3EVW A;  3ZTP A;  1U8W A;  3ELH A;  1PAE X;  1BE4 A;  3ZTR A;  4F36 A;  1MN7 A;  1PKU A;  3NGU A;  1NDK A;  1WKK A;  1NSP A;  3EVO A;  2VU5 A;  1LWX A;  3FKB A;  3BH7 B;  3PRV A;  3PJ9 A;  3ZTO A;  3GPA A;  4KPC A;  1ZS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...