5CABA

Structure of leishmania nucleoside diphostate kinase mutant del5-cterm
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
139
structure length
139
Chain Sequence
MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title The role of the C-terminus and Kpn loop in the quaternary structure stability of nucleoside diphosphate kinase from Leishmania parasites.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 41
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 5cabA00
3NGRA 1NHKL 1UCNA 2AZ1A 3B6BA 3DKDA 1NDKA 1ZS6A 3FBFA 3BBFA 4F4AA 1NPKA 1PKUA 3EM1A 5IOLA 1HLWA 3Q83A 3Q86A 2DYAA 1BUXA 1KDNA 2HVEA 3L7UA 3NGSA 3EJMA 2HVDA 4ANEA 3R9LA 1NSKL 3VGTA 3Q8YA 3ZTQA 4EK2A 3EVMA 4HR2A 1MN7A 1B99A 2DXFA 2ZUAA 2HURA 2BX6A 4UOGA 4F36A 1XQIA 1NSPA 1NLKL 3VVTA 3VGSA 1NCLA 1PAEX 2AZ3A 4FKXA 1WKKA 3EMTA 1HHQA 4W98A 4UOHA 3GPAA 1BE4A 1MN9A 3ZTOA 3VGVA 1NDCA 3MPDA 1S57A 2DY9A 4O0NA 2B8PA 3EICA 3Q8VA 2BEFA 2NCKL 1BHNA 1XIQA 2CWKA 3NGTA 1F6TA 2VU5A 3FC9A 5C7PA 3BBBA 4DI6A 3B54A 3ZTRA 1NDPA 1WKLA 4ANCA 3BBCA 3Q89A 3FBBA 1LWXA 4FKYA 1W7WA 3VGUA 1NB2A 3PJ9A 3FCWA 1EHWA 4DUTA 3Q8UA 4CP5A 4ANDA 1S59A 2B8QA 3ELHA 3ETMA 1HIYA 4UOFA 3ENAA 3G2XA 3BH7B 3FBEA 3BH6B 4KPCA 3WX8A 3EVOA 3FCVA 1LEOA 1NSQA 1VYAA 3EVWA 1B4SA 3FKBA 3ZTSA 3FBCA 1WKJA 1JXVA 4DZ6A 3PRVA 2DXEA 1K44A 3NGUA 4S0MA 4WBFA 3GP9A 4ENOA 1NUEA 5BXIA 1S5ZA 2DXDA 3JS9A 3ZTPA 1NDLA 1F3FA 5CABA 4C6AA 1U8WA 3DDIA 5CAAA 3EE3A 3VVUA
chains in the Genus database with same CATH superfamily
3RZAA 5KOXA 4USHA 4H4KA 4F8RA 2D7SA 4NLSA 1RT3A 5KG6A 1EX8A 1GTEA 5CA5A 4ZN1A 3FRZA 4RBVA 3K89A 3G82B 4JI8J 2ZBRA 1N6QA 4I6AA 4EK2A 2UVVA 1C0UA 1VS3A 4IFYA 3D3BJ 3RRGA 3KG4A 2GJIA 2PA8D 3I82A 4MH8A 2DO4A 1SV5B 4K50A 4DFPA 4AFFA 1U1LA 2B9YA 4XDDA 5F8MA 3OSNA 3BGFA 3Q2SC 1D9DA 2XMVA 2XZWA 1VBXA 4R8UB 1G1XA 1CJTB 2DHXA 2PFFB 2ACYA 3QJJA 4ZPVR 5HAOA 3B4MA 4UOFA 3I0SB 1X9WA 3DOLB 5HK4A 2EXUA 5HSPA 3FSYA 2E44A 2BYCA 2GO9A 2XS5A 3W60A 3HO1A 2GGPA 4IR1A 4PUOB 4P7TA 1PIEA 5CZVA 2CPEA 4MK7A 2LMIA 1N0UA 1UA0A 5CHCB 2KN4A 2FJAB 5A6WA 2AMCB 2YKQA 1T95A 2HVEA 3V6DB 3NOGA 3I87A 4Q8EA 1UL3A 2CG4A 4OV1A 1LNQA 4URSA 4WIIA 5F41A 1C1BB 1Q79A 2JEGA 5DDPC 1LV5A 4ZLNA 1S1TB 1RTJA 2XY5A 1YJ9S 3BR9A 2R7XA 3SV3A 4A47A 5LMNF 1SC4B 2YX4A 2XYPB 1FDAA 4KKOA 4M63A 3WX8A 1P9YA 1QAXA 4Q7AA 4KBIA 3Q8SB 4DQIA 5FDLA 4RNHA 2GAHC 2Q6CA 3HVWA 5HQ8A 3HT0A 2OD4A 1S1XA 5KFEA 1FNXH 4DG1B 2WSFC 2Q1LA 2BJ9A 2H4YB 5LMUJ 4RZRA 4LF7J 4YP3A 4YY3J 2XCPA 2IPOB 3MAQA 4DR5F 2OP5A 5DQGA 2XMKA 3BR8A 4QPXA 1GMWD 2VBWA 2XCAA 1QTMA 1C1CB 3N5BA 1LOUA 1SUQB 3C14B 5DDQC 2CNOB 3HHEA 3IG1A 3KUEA 4NE9C 2CPFA 4Q43A 2E5LF 2LEAA 1L3TA 4USWA 3DLKA 4TU9A 3DLEB 1FKOA 4QR2A 4QPTA 4R5PB 1PJ5A 5D0RA 2PDAA 5IM0A 3UN5A 1U2CA 2DK2A 1CJVB 3NXZA 3ENAA 3A13A 4O0IA 4F4KA 4WBFA 4DFMA 2YPZA 1H98A 3OJUA 1J5EF 1R0AA 3QJLA 3KHHA 3NGRA 3HP6A 1OY8A 4Y65A 3KJVA 5CYJA 1NO8A 1U2FA 4MYTA 4IH7A 1JIHA 1KONA 2ZKTA 5A2QU 4K2XA 3QYYA 4RLEA 4OYMA 3NGSA 2UXBJ 3CT9A 3MUVP 1TL7B 1NRKA 3G8SA 3G8QA 4LFCF 5F3TA 1O6XA 4RW6B 4J9NA 2VB6A 4RNOA 2W9CB 2DY9A 1NM2A 4CH7A 4Q44A 2HGMA 2MPUA 2PMZD 2XB2D 3TJAA 4J9UE 8RUCA 4X84A 3LA0A 3PX4A 2CJAA 2GIFA 1EETB 4DLEA 2XYHB 4N8NA 2AJFE 4BC7A 2IM0A 2LP4A 3M2UB 1S0MA 1S59A 1WUUA 3T5LA 1Y5LB 2LDIA 2OGUA 4QIWD 1O0PA 3MCNA 4ZJLA 2K1RB 1EQMA 4DV1F 2EFVA 2VBXA 1W2BR 2BOPA 2Q66A 2ZOMA 3FMWA 2JEFA 2V68A 2BQRA 1RTDA 3CJQA 3L95X 1TL3A 5JXSA 3CD5A 3CJTA 2LCWA 4H4MB 2YWHA 4NOHA 4DV0F 2OFGX 4DEZA 3UDLA 5ETVA 2DO0A 2F8HA 2HVDA 2OPPB 1XTZA 3OR2A 1F5AA 2C2MB 2HVIA 3DGPB 1IKWB 3D0HE 3EZ5A 2VPWB 1S0OA 3TAQA 3MM5B 2W24A 3I9ZA 1VQ4S 2XHCA 3HZGA 2HW3A 1IKXA 3CCRS 3TVKA 4JI4J 1FRXA 2RD5C 3AQPA 3PX0A 1QSLA 3R7BB 2WCXA 3BBCA 2ERRA 3WIUA 3BDPA 2HWIA 2E9TA 1KFSA 1MG7A 2UUBF 3B82A 2AQ4A 4Y2CA 3KOAA 3ZO7A 3TX0A 3KUHA 4ILRA 1XN9A 1ZM2A 4PWWA 2JVRA 3L9ZA 5F8GA 3UD5A 1U8WA 3MM6A 5DO2A 2EI5A 1Q53A 3DRRB 3FBFA 2MKYA 2KDOA 1FD8A 3JTPA 2HQGA 1R8CA 4CM2A 1Q5YA 3L7UA 2Q3PA 2CNNB 1C0TA 1DHMA 3HSGA 1W26A 4QW8A 4A8MP 1S6QA 2YKNA 2AJ1A 1M5KC 1FXRA 3C19A 3B8HA 2BDPA 2K7KA 3MM9A 3RRHA 1MWQA 1ZTTA 4RW7B 1Q78A 5JVHQ 3CF5Q 1SL1A 4OI2A 2BBEA 2L9WA 4TLRA 5LMNJ 2E1MC 1GH8A 4KSEB 4X64F 3N79A 5J2QB 1B64A 4V19X 2R8KA 2FLNA 3A8IA 3CJ4A 1FHTA 5HVFA 2NPFA 2X3GA 3UNGC 5ETMA 1RWXB 1FNOA 1YWXA 4GKKJ 2CPXA 5KFLA 2D1CA 1N0VC 4A46A 4YDDB 2CQ2A 3AD7C 3K58A 4CI0B 5GMDA 4QYRA 4F04B 5AE3A 2ZH2A 3EXYA 4MKVA 1WC0A 4F4ZA 1X60A 3RB0A 1MU2A 1LQ9A 1WKKA 2QFJA 5A0YA 2DTJA 3QZ8A 3ULHA 2QLBB 2YPYA 4H4KC 4NLTA 5ETTA 2E5LJ 4DPWA 1SKUB 4QZVB 2CPIA 5KFOA 2QIFA 3GR0A 2BM1A 2DNOA 3M8QB 4IDKA 3LH2S 1N4LA 2CZ9A 1UPPA 4B3OA 4PWDB 2V2KA 5B08A 3BPSP 2YNIB 4C97A 4OYOA 2RF2A 3QAEA 1S6PA 4WJBA 4KHPJ 4ER8A 2W4CA 4DN0A 1CBKA 1X9MA 3M6XA 2R7RA 2EG1A 4ZVRB 3QGPA 3HVTA 3QFHA 3VVUA 1UVKA 3KHRA 1F0XA 1VMBA 4LR8A 1RCXB 1HBMA 1T9VA 5AXLA 1MLAA 3DOMB 5DG9A 3LP0B 5IT9U 1DQ8A 5IFMA 4L72B 2F3JA 2D74B 2N3LA 4G6VB 3SIPB 4C7QA 4USIA 1T03B 1D9FA 1RWPB 2AJQA 4ZDNA 2QZ8A 4FVMA 4CYUB 1VLYA 2J0XA 2RUGA 3D54A 2IJFA 4ED7A 1XERA 1YJNS 2CIMA 1TUVA 4M94A 4K7QA 1B0TA 2RQ4A 1S1VA 3T5JA 1YJWS 3HMJG 2M0GB 3KWMA 3TUJC 3PJWA 1WTBA 3BYPA 5D4NA 3JSBA 1RA7A 4I6YA 1PBUA 4N76A 3LP2A 4GVLA 1XWLA 3UCUP 1FE0A 4GKJJ 1IBMF 4F2RA 3EPIA 4CO3A 1RHJB 4OYPA 5C42B 1VQ5S 5D77A 1XNQF 1IBLJ 2IDLA 4HDHA 1JKHB 4I7FB 2FDNA 2WW4A 1Y3KA 1HW9A 2CKWA 2YTCA 3DU6A 3V6HA 1AFIA 1VC0A 1JLAB 2FUG9 4IOCQ 3C16A 3K57A 1YK9A 3C46A 5K14B 3D3CJ 2MZTA 3H42A 1UVIA 3L7PA 4A8OA 4WFAQ 4WK1A 2DR5A 4JUZA 1HNZJ 2G1HA 2GMJA 1ZZFA 1NB2A 2DNQA 1G4CA 4ZP9A 2UUBJ 3Q8UA 4YHHJ 1APSA 2IVMA 2J9DA 2DH8A 4WP8A 5HROB 3DMJB 4RW8A 3PYFA 3KLHB 3THTA 3IMQJ 5J1PA 2MJNA 3EZOA 3BN7A 4AYBD 4AD6A 4F25A 3ISZA 2ZKUA 2OEKA 3VAIA 3UI3A 1S76D 4CLUA 3M9MB 5EX3A 1WHYA 3W61A 3QJPA 3EDQB 2C3UA 2B6AA 2W2QP 4CM0A 3ONQA 2PN6A 4DSJA 3Q86A 3JAMY 4WE1A 1KTQA 3OUYB 2H1YA 5A8KA 3MCSA 3PW2A 2KT5A 3MR3A 2DNYA 3W5ZA 1N5YB 3M2RA 5ITHA 3GFHA 4OZ2A 3T3FA 3KLIA 3MM7A 4P52A 3OLBA 2PO4A 3DI6B 4DLGA 3RB6A 1F9HA 2YBVA 2HWTA 3AA8A 1IUJA 2JOQA 4DR4F 2D69A 3OTEA 4YS2A 2AGOA 5H9EJ 3H4BA 2RKIA 3D4JA 2OEMA 2FZGB 2YKAA 2XLJA 1D0EA 1WHXA 3FCWA 2UUTA 4O44A 3PCOB 4CTAB 2RT3A 4NZ7A 1U24A 1R8AA 3KFWX 3W7BA 5K9FA 4P73A 3CEDA 1LEOA 1XMBA 1VRTA 3TAMB 4ZMMA 1WC5A 1YBTA 3QWPA 1UWBA 1YVFA 1CC8A 4Y2AA 4LFAF 1GMVA 2HHVA 1PKUA 1WACA 4ZPDA 3C15B 2JLGA 1UW9A 2BKOA 4FZVA 1U48A 3CDAA 2DXFA 2AYBA 3W2VA 4ZCKA 3CDWA 1IR0A 1TELA 1RDRA 1SJFA 4OX9F 5CYQB 3O3LA 1KP6A 2C42A 1QAYA 2MQPA 1WC6A 4ED6A 2B0GA 2R7TA 5F0WA 2R2SA 2YY3A 3OFHA 4M5LA 3TEGA 2CQ3A 2J6UA 5LSOA 4MK8A 2MKCA 2H48B 4KYZA 1RB0A 2MQOA 1LWCA 5E3PA 3A1YG 4QWEA 1S99A 2VOPA 4M1KA 2HQDA 3R97A 3KUGA 1U1PA 1RT6A 4J90A 2P8IA 5AE2A 1S1WA 2IC3A 4CO4A 2PE8A 3FJ2A 5I3QA 4U8YA 3GIIA 1LFWA 2VG7B 1F3FA 3UDEA 1ZA2B 3BQ2A 4J37A 3HVRA 4CDIA 4DL2A 5EHHA 4NLOA 2IY5B 4QJVA 4TLQA 3MPWA 4ANEA 1FESA 1E6VA 3MMJA 5C2CA 1AROP 5I3UA 5CZXA 1KNZA 3NS6A 2M8HA 4QYZJ 2IJNA 4LBHA 1KTVA 1XIQA 4F7VA 1IVZA 3RAXA 1FI4A 4OZ0A 4DJBA 1NJYA 2YWKA 5B0CA 2CPZA 4C3KA 5B09A 3DLGB 4RO0A 2LU2A 3M30A 1HIYA 2IAJB 2B4PA 5KG0A 2A6MA 5AJ3F 4W4MA 4ELTA 1DZ5A 2VASA 1S0NA 3NCQA 2BVZA 3IM8A 4HL9A 4J9VA 2QT7A 1UJ5A 3TANA 3KDOA 3VWSA 2A3JA 1IM4A 3DDKA 1HNWJ 5SUHA 3DRXA 3PACA 2VPYB 2A2CA 3SXLA 2P9GA 5ETSA 2RDJA 4M95A 1XNQJ 3AJ1A 2IRUA 2G13A 2YH1A 3I5CA 1TV6A 1X4AA 3K5OA 2IA6A 5HO4A 5J2MA 1JLBB 5F8HA 3D6TB 3TOQA 4DR3F 1X4EA 2H65B 2V9WA 1HA1A 1RKIA 5KFXA 3J81Y 1S6UA 2RH3A 4J9KA 1P8GA 5BJRA 3MMAA 2DGWA 2XM3A 2Y0SD 1NB7A 3N9UC 2LYVA 4JV5F 2G4BA 1S9FA 5RUBA 4NXNJ 2G0CA 3ETMA 1B70B 4ZPAA 1UTAA 4C98A 2NXCA 5KFFA 3FCVA 1ZM3A 1R6VA 2MHEA 1WG1A 3C8YA 3T9NA 3DFEA 2VICA 2R42A 1CPZA 4DR1F 2I0XA 1H0HB 4A8SA 1ZAVA 1GTHA 4DMZA 1QDUB 2OPQA 1M5PC 1QY7A 1HKAA 4K4SA 4DV6F 3A3OB 3CCWA 4IO9Q 1V3ZA 4K4VA 1FERA 2Z2LA 1JX4A 1VBKA 2GQ2A 4JYAJ 2ASJA 1D3WA 3NMAA 5KFJA 2K2PA 4AQYF 3SCIE 3CCMS 4OI0A 4OHXA 1RT1B 4ED4A 3OLAA 5LM7E 2IA0A 2KM8B 1VI7A 2ASYA 4FBTA 1S1UA 4P72A 3GLJA 3ZZYA 3FC9A 2KFNA 2VODA 2VKRA 1NMEB 2YKMB 1V6HA 4EBDA 3HHNB 3TA1A 2HNYA 1S72S 2UP1A 2GHWA 5D3GA 3RGIA 1F5BA 3OXFA 5EDWA 1RBLA 2HHSA 3AB4B 5KG3A 4HH1A 3A4TA 3MECA 3M32B 1LW2A 3JSMB 1IQZA 2DR7A 4ID5B 5J2NB 1RWNB 1NK0A 2VC0A 2KT3A 4X65J 4X4VA 4I56A 5CABA 1EAYC 4RPFA 4H54A 1N52B 1CJUB 3EUNA 1NDKA 4TNOA 5K8OA 2ZHBA 2W4PA 2ZH8A 2J0QD 1UMJA 2JDJA 3IGVA 2YX7A 2MZ1A 3U1MA 2KYXA 2CJ9A 3SFGA 3J7ZT 4N56A 4OX9J 3AOBA 4WU2A 3HM9A 1HPZB 2DCLA 1NDCA 3KMSA 1RWMB 1RHKB 1YDLA 3MDFA 3KLEB 2FVRA 4TYAA 5KFNA 2OFHX 4ETXA 1DLOA 1TKDA 1HYSB 4WWSA 4UUXA 4UT4A 2E66A 5HMWA 3D5MA 1RUSA 4ZVFA 3MR7A 3GCWP 3GU0A 3DRSB 2QV6A 3C3LA 4PG8A 1QAJA 2OAUA 2HMIB 1J5OA 2HLUA 4URQU 1SI9A 1SV5A 4HKQA 3H7HB 2RRBA 2ZE2B 4HHHA 4M5JA 1NK4A 2ZZMA 5L9NA 1TR0A 4HACB 5KOWA 2APOA 2HIYA 1SKRA 1CS4B 2QX0A 4PG5A 1T05A 1FDBA 3P49B 4WU3A 3TNVA 1Z4UA 1NPKA 1RT7B 4Y6IA 1RAIB 2M88A 1SVDA 1HD0A 3DOLA 3KYLA 2BQUA 4YR2A 3CJ0A 4HLBA 1RT5B 1F9FA 3NOCA 4LBPA 2ZH5A 4DU7A 2I9SA 2WVEA 5KT7A 1TVRB 4M5DA 1RK8A 4LF5J 1T9XA 4ZPTR 1FT8A 2RHSB 4KB7A 3Q8VA 4ZHRA 2VA3A 4DR6F 3JXOA 1OPIA 1KHWA 3PJ9A 2L3MA 1HHTP 4FXVA 4UW2A 2PD1A 3ISND 4EI2A 1F2HA 2J6TA 2Q43A 4O4GA 1KQGB 1C1BA 4JP8A 3H8YA 2HK3A 4QIVA 1EIYB 1S1TA 1RSCA 2KFZA 1N36J 3H40A 5I3PA 1GXUA 4JV2A 1KOHA 3BV8A 3ZZRA 1H3DA 3K5MA 2ZC3A 4H4OA 2QSWA 5LJ3Y 2HEKA 2DNGA 5L1KA 1FO1A 1RAHB 5D0HA 1SJQA 1H74A 4JOUA 1S7IA 2PIIA 1JLGB 3GG1A 1E6YB 1ZA1B 4DPYA 3HFKA 4XPCA 2FVSA 4PCQA 2YH0A 1QAIA 3SMZA 4CLFA 3T5HA 1FRKA 2QGFB 4E2FB 3QSYB 1GEHA 2ZOGA 2CDQA 3GSDA 4J7CA 1B0PA 2MYFA 1EP4A 2FLPA 4KR0B 2O67A 3LF0A 2ZD1B 3MWBA 3SSQA 1SUQA 3KK1B 4Q0BB 2XGQA 3QIDA 2RIJA 1GXLA 4RBTA 4IFVA 4DR1J 4C6AA 4R5PA 4ED8A 5CAAA 2Z57B 3RR7A 4X4NA 1FWKA 3Q24A 4DV6J 2AF6A 4ZVOB 1K9MT 3LGHA 2R8GA 2DYAA 5KFPA 3HHLB 5IQQA 1GNKA 4OQJA 2UXCF 3LP1A 5J2PB 4DHVA 4DUZJ 4ICLB 1EKSA 3D67A 2VF3A 4ECYA 4O3OA 2ZUAA 4AQYJ 3W9HA 2VC1A 1M1KT 3G8TA 3HF5A 4K4UA 2UZAA 3PW5A 5A76A 3HSJA 4MKYA 3H59A 1N48A 2K8GA 4N41A 1ZPWX 2J9DE 3MEEA 2GIRA 3E2EA 2DEIA 3OTOF 3HJFA 3ZNJ1 1R8PA 1S9GB 4DR2F 3HSZA 3ETOA 3CMQA 4DL6A 3MEKA 1R3NA 1HBUB 4ECQA 2CJYB 1JB0C 4RUAA 4CIOA 2GJ2A 2UUWA 2GCFA 5DQIA 4C3MA 3TZXA 1ZH5A 1VIXA 5ETPA 3RAQA 5T7LA 2DIUA 4F67A 2LQ8A 5HVGA 1I3OB 5KT4A 1R27B 4RNFA 5K8MA 3E01A 1RYSA 3QT6A 4PQAA 3UCGA 3H5UA 2C2NA 2K1RA 1IWGA 1JWWA 2N3OA 3EMTA 1RLCL 4HYKA 1BQMB 5DJBA 4DR7F 4QWBA 4H4MA 2ROPA 3NGTA 1FJGF 2G0IA 4CO0A 1FK9A 1U0SA 4FKYA 3GFXA 2W9BB 1RT4B 1CJKA 1RAJA 3DGPA 5SZTA 1IKWA 2QLWA 4P7VA 2LDYA 2B7CB 2B5JB 2EFNA 3M2VB 2XI3A 4QR0A 2FHKA 5GAHI 3UN2A 1FVQA 4OFZA 1NJZA 2X1AA 1MROB 3U02A 1MWZA 1RISA 3J7AN 2UXDJ 3BQ1A 4CZCA 4MAKA 2LXIA 3D9BA 3HXMA 4PYDA 2P5VA 4I64A 3FEXB 3CXCR 2HRUA 3LO3A 1L3UA 2HHHF 5KFQA 1NLKL 3M4XA 2DRAA 3QIPA 2ZEJA 3ZTOA 4ZPWR 3IR7B 3BGUA 4Z37A 4DV3J 1V9OA 2HZAA 4XTTA 4OLPA 2CAJA 1KWMA 2DHSA 3T5KA 4DL3A 2Z8QA 1SC6A 5BYQA 1ZM4A 2V4RA 3IS9A 2FJDB 1RAFB 5HBMA 3NMRA 5A6PA 4ZN3A 3CMAS 1VQLS 3L7OA 4O3NA 3LQVA 2G2OA 2V8PA 1HBOB 3IAS9 3T6BA 2IFXA 1RTHB 4RW9B 3ZZPA 1L3KA 1IR1A 5AE1A 4KFBA 5GVQA 4RW7A 5HMZA 2IYGA 2AEMA 1LXNA 5AXNA 3KK2B 2V9KA 2NZCA 2B3TB 3PDNA 1JLQB 4HVZA 3BBFA 3J7A1 3CDBA 2K3IA 1NK5A 1PC4A 2WHOA 3KHLA 2BKNA 4NEYA 2EC2A 2HFVA 2ASDA 2GVZB 1B0VA 2DRBA 4FKXA 5LT5A 4PPZA 5G4DA 4K4XA 5ADZA 4JBCA 1ZYQA 1BGXT 5E33A 3EX7B 2IM2A 1NK9A 4JI7J 3O2IA 3DHXA 2KH9A 4OYWA 2C2EA 4ECVA 3OXLA 3D7SB 4PG6A 3E51A 4P74A 2HWHA 2ZH9A 3IRXB 3KNGA 1F1BB 3HDSA 2KI2A 1FRHA 4F4YA 1LFPA 3TO8A 3GV8B 1OPZA 2UV8A 1WHVA 2WVDA 1KRPA 2KZZA 2RDDA 3OFFA 3F73A 1NU4A 2MZJA 3QATA 3UCZP 3MR2A 3S6EA 4P6QA 1H6KX 1VQ9S 4PWDA 5D78A 1PJ6A 4D3GA 8AT1B 1PBAA 4K0KJ 7FD1A 1BQNB 1WC1A 2UXCJ 1RTZA 2XEXA 3V5RA 1KD1T 3JAMU 4RU9A 5KFSA 1WOOA 5ETNA 2XLKA 1Q7LB 4Z7YA 5T14A 3Q8YA 4OHVA 4X66J 4IG3A 1EQ0A 2JLFA 5M2UA 4OZNA 4ZKAA 4QU7A 1KVIA 4B9NA 3VGVA 4NZ0A 1LWFA 1UP1A 3EGZA 2PGCA 2ROGA 3FDSA 2NCKL 2U1AA 2VD3A 4NI2A 4WFYA 1F6TA 3GONA 4MMOA 1VHIA 3TARA 2OTLS 2V8DA 4OZ1A 3K5PA 1RA6A 1QVFR 3DOMA 3PTWA 1B7FA 2MDAA 2QJ3A 3VQSA 1P9QC 4AUKA 2C22A 3J80Y 4EZ9A 4UZCA 2IVFB 2WTFA 2CQGA 5LJ5Y 2V2QA 3LGNA 1FJCA 1T0TV 4ZITA 5HJYA 2HS4A 3RW7A 1KS2A 1CEZA 2V4JB 3JS9A 5E0OA 1HWKA 2IJRA 3AD8C 2DGSA 4PRFA 4KAIA 1IJFB 3O5TB 1UCNA 2AZ1A 2BJDA 2OELA 3R5DA 5DGBA 5B0BA 4ED3A 2NUHA 2CG8A 5GAGI 2QMWA 1U8SA 1HQUB 1QE1B 1PYTA 4KE5A 5HQMA 4LR7A 1U1RA 2BABA 1PSDA 2VFSA 4LSLB 2P6SA 2UU9J 4ITSA 4DUYJ 3QO9A 2HQFA 4CO2A 1FD2A 3POTB 3ZFVA 1HNVB 6FDRA 3AHPA 5D4OA 4U7UK 1X5OA 4KH0B 3PJXA 1TQLA 1TMMA 4FF3A 2HHWA 1RACB 1TK5A 3ZZTA 4Q2MA 3DLJA 4X4UA 3BH7B 1FXDA 5E3CA 1OO0B 1N5QA 4AXIA 2VG6A 2RU3A 3IA0A 2POKA 4JI2F 4J9SA 1HW8A 3DU5A 4JI5F 1OQ6A 5DQHA 3OFEA 4DX8H 2YWFA 2LQJA 1TTHB 1UZDA 4FPRA 4OL8A 4IO1A 5BR8F 2HS3A 5HROA 4ZA1A 4DN9A 3KLHA 3U1NA 5IZHA 4IFYB 1RKJA 4J9PA 3UVJA 4LVNP 1L5UA 4ZJQA 1CLFA 2JEIA 4USKA 2HHHJ 3MEGA 5G0RB 1ZAXA 1FJEB 2J8AA 4B3MF 5JUMA 4HI1A 2MLYA 3SI8A 2E7VA 4MFBA 5F9LA 4JI1J 2MHNA 4BDPA 3GSIA 1QD1A 2CRLA 4ED0A 2J5AA 3SCJE 2AYGA 1C4CA 1WEZA 2CQPA 2HKEA 4TYBA 1N5TA 3RUBL 2J0WA 3FZ2A 3K8WA 4X62J 4AXJA 1VQ8S 2WONB 2V67A 5D6GA 3MM8B 2DNHA 4OZJA 2HQ3A 4DZ6A 2GGPB 4WTOB 3PHEA 4IH6A 1SJRA 3KKFA 5CCLA 1LK7A 3DXSX 2VA2A 2BE2A 1FFWB 2K7JA 3M8PA 5KFTA 4NLWA 1NSAA 2VQFF 4KY3A 2ZH1A 2C28A 2KRRA 4FS1A 5IOLA 4MYUA 2QO3A 3AA9A 5MAOA 2ZM6F 2VJVA 3OJSA 4M5IA 3R8YA 1VGYA 2PI4A 1U25A 2NYHA 1GQEA 2AX1A 2XLIA 2HURA 3NWGA 1REGX 3PX6A 1EKRA 1CVJA 2QA4G 4DWIA 3GG0A 1PO6A 1RTJB 4DS5A 2XY6A 2M52A 1FKPA 2RVJA 4WFNQ 3EICA 2KG1A 4KHMA 1CQNA 2KB2A 4Y3CA 2ZNZA 1FRIA 3J81U 1DTQA 3LOUA 4P2XA 2W2MP 1L3SA 3CIMA 3DNCA 1GX6A 1RHRB 2KXFA 2CNKB 4KKOB 3VZIA 2FGCA 2XULA 4IRDA 1VQNS 3ELHA 5CYQA 2C2ZB 3O6QA 4TQRA 3MTJA 2IRXA 1VIOA 5LXYA 1K44A 1YZ6A 4LRBA 4DX7A 1Y00A 2LQ5A 4NA1A 4QIEA 1NDLA 2MEWA 3CIZA 3QAUA 2KO1A 2KHDA 4EEYA 3PW7A 2HNZB 4I1TA 2FC9A 1IR2A 1RLDA 1WF2A 4PXBA 1UFKA 2P2CB 1TKZA 1EB0A 5E41A 2BANA 2EBGA 2X1BA 2IVYA 4MKAA 3D68A 2R7QA 3PW0A 3NBPA 4UOGA 2J9EA 3IG1B 1FFGB 1PCAA 2AZ3A 3IC1A 3DLKB 4LF1A 3SYZA 1FKOB 1S77D 3P6YC 1IKYA 2VL1A 2JWNA 1Q0NA 1WSVA 4LRDA 3Q0AA 3VTIA 2FJEB 2J6SA 2QLFB 2QFIA 3FZBA 3KMQA 3CCJS 4X4PA 1S6OA 1TKXB 2FQQB 2VQEJ 4P71A 3Q23A 3S8SA 1JK9B 1YGYA 1RTIA 4EYIB 1NKBA 4DV4J 1HWLA 2DHAA 4DQSA 4PXDA 2E9ZA 4FNIA 3ZTPA 4XPEA 3DRPA 3GYXB 4ZJOA 3TX8A 3GFZA 2V69A 1KQFB 2NR0A 4B3RJ 3MGJA 3DLGA 4ZS6A 1HWIA 4DV2F 4MTPA 2IAJA 1TP7A 3M8SA 3T1YF 4ALZA 1Q5VA 1KSPA 2QMXA 4LSNB 2MZRA 2WOMA 2ZJRQ 3FMBA 2OMLA 4JI3J 1NCLA 3CE8A 3AXMA 2EK1A 1RADB 3MCOA 3GIJA 5HMXA 3UDCA 1SQGA 2ZH7A 2KTQA 1G6BA 3KK3A 1K8AT 1FRLA 4CQ1A 4KV8A 4C8YA 2DH7A 1LXJA 3MAHA 2RSQA 1NAQA 2WK4A 1JLBA 1W2IA 3I96A 1NNDA 4JI6F 4NX9A 5FLXY 1KVKA 1RTDB 1S9EB 4FF2A 1TL3B 2OTJS 2W2NP 3F0NA 2KJVA 3W64A 4MIAA 3J7YI 4J9LA 1DARA 1OJ4A 5KT3A 3PFOA 2Y9HA 4ZPCA 1OY9A 1X8DA 4DPTA 2OI2A 1HL6A 3OR2B 5D0GA 4RUCA 1KDNA 1RWVB 4DBQA 4I67A 3KDNA 3LTOA 3W9JA 3AQOA 3T41A 3OVAA 4NEZA 3CTRA 3BEGB 3MFHA 2R7WA 1QSYA 3SDEA 1DY3A 1TUWA 2O5DA 1G3OA 2CQDA 3DOKB 1BY9A 4GC6A 4WYWA 3HFVA 2V50A 5F3ZA 3SV4A 2ZITA 4ED2A 1OY6A 3IRWP 4K4ZA 4ELUA 2IRYA 2RNEA 1H72C 1RWUA 4AE5A 6FD1A 4P2FA 2WZ1A 3GJRB 4D3HA 3MM6B 3ISNC 2F65A 5L8RC 3GZ7A 2DGOA 4DZDA 1SKSA 2W9AA 2JC0A 1Q81T 3P45B 3MEDB 1UPMB 2VQFJ 3GCXP 4PYAA 3EM1A 5KG2A 3RG6A 4Z2XA 5GADI 4FYYB 2MGZB 1S6QB 3KNAA 4ECUA 5FD1A 3VR1A 4O3SA 2MKIA 2XMTA 4ZIVA 3NCPA 1N34F 2XZDB 1SIZA 3MM9B 3AJ2A 2OPRA 3UO0A 3AY0A 4DQQA 1RBAA 3W5YA 2HZVA 1UEVA 1M1HA 2HNDA 3G71S 5F8IA 2WB4A 3R6LB 3WIVA 2GFFA 3KHGA 1IWAA 2J8SA 1ELOA 4NZ6A 4IG0B 2Z2MA 1PJ7A 3G2XA 2Y1JA 1HPZA 1U6BA 1ZAWA 2VOOA 3E8OA 2V0NA 2ZJQQ 3TJ8A 4DV5J 1V3RA 2F1FA 3MR6A 2ZBIA 1MMNA 1H2VZ 4EUVA 5HN0A 2I6WA 1HYSA 1P27B 2D3ZA 1YI2S 5HQLA 4LREA 4WF9Q 1S4EA 4LJMA 2YNGA 4RR5A 2HFZA 2D9PA 2XSFA 4NYPA 4WFZA 3IBFB 2D9OA 1D09B 2LVWA 3Q8PB 2JHEA 2J9CA 4HACA 3OTDA 3M8RA 3W1YC 3OD2A 4UOHA 4NRUA 1HI0P 1NXIA 4DF8A 3IO1A 2Z0GA 3G6XA 4B3OB 4PR6A 1RT7A 3GMGA 4R25A 1NDPA 3PG9A 2F63A 1FE4A 4IQXA 1K1QA 1S6PB 1WF0A 1WHWA 2B9EA 3D6FB 1RT5A 1R7IA 1U02A 3D0GE 2WSCC 3KJNB 1TVRA 3I4HX 3TAPA 2ABYA 3QT5A 1GX5A 1HHSA 2WVCA 5LL6d 3HVTB 4F2SA 5A8WA 4C0HA 1C4AA 2DXDA 1RT2B 2GVDA 2AX0A 4TY9A 4C8ZA 5HMYA 5J1EA 1VLOA 1BUXA 1UFLA 1HR0F 4C0BA 1ZETA 4CH0S 3KLVA 1Y0HA 4LT6A 1U1NA 1VFJA 3ZXWA 4L6V3 3GIMA 3MAAB 1FRMA 3SQOP 2C1EB 3RYLA 4RW4B 3AAWB 2ZH6A 4G3IA 4OJ3A 2MKHA 3IWLA 4NMLA 4NASA 5J1NA 3M9NB 3PO4A 1K1SA 2BUNA 3I4PA 2FZKB 1HNXF 2YNFA 4ANCA 3M7VA 1E6YA 1S1VB 4TQSA 2DH9A 1CG2A 3H20A 5L1IA 3TA2A 3ITHA 3NGKA 4RNNA 2CDRB 1M1GA 2KRBA 4CT9A 2HHUA 2MQ8A 1NSQA 3ZTSA 1NKCA 4P75A 5DG8A 1D9AA 1JJHA 4LF9F 4M5GA 4WP9A 5B7WA 2IHR1 5U47A 1AUSL 4CWBA 3CO9A 1R43A 5D15A 5EN1A 4CNYA 1WD6A 3DC2A 4HDGA 4RNMA 2CPHA 4RUBA 1J27A 2ZD1A 5EGYA 3BSOA 1JLCA 1FWLA 5EWGA 4Q0BA 3C16B 3X1LB 3BYRA 4PG7A 4F36A 5I42B 2FPHX 3UN3A 3ZZZA 4OV6A 1LW0A 5KFDA 2H51B 4BC9A 2I5JA 4KPYA 1RABB 1X4FA 3IAM9 4Q45A 3FSXA 4MIBA 4NXMF 5HANA 3HHLA 5KFUA 4J9OA 5J2PA 2Y8YA 2F4VF 2VFRA 3HKWA 2XNQA 2GA7A 2XTJP 2I1RA 2DKOB 5KFZA 4ZVGA 3E3XA 3EGVA 3B78A 2B6AB 2YWGA 1SL2A 2LEPA 2VDIA 3L4BC 3NLCA 1KLMA 3MI7X 5IWAF 1S9GA 3UFCX 2QLJB 5A8KB 3H2UB 4QIFA 2DPIA 3K8VA 1Y5IB 3LANA 1AZSA 5KFHA 4R0EA 3M2RB 2FHJA 5C24A 4DF4A 3KLIB 3MM7B 1NSKL 4NPOA 4A8FA 3PKMA 4K8RA 1Q95G 1JLEA 4YB7A 2EK6A 3HD1A 3GPAA 3OPKA 2AD9A 3CO0P 2RKIB 4PXCA 1J2VA 1I5OB 4LF8F 4MIWA 2XGPA 1CC7A 2ADCA 1RAEB 2GHPA 1LWEA 7AT1B 4LF4F 3PYDA 3DGVA 3H2VE 3JQMA 5DDOC 4Y0FA 2B8QA 1VRTB 2FJBB 2VG5B 3V4IA 2NSCA 3BQ0A 5GAEU 4NMXA 3KG1A 1UWBB 3M8WA 4TN2A 4A8KA 3CCLS 3GFYA 2PEHA 2R2UA 4DR5J 4JI0F 4CO5A 4LF6F 3W65A 2V8GA 5JJBA 5ETOA 1YITS 1I6JA 5K8NA 2W9BA 2R8IA 6AT1B 3FFIA 4OYAA 3LAKA 1UVNA 1TFWA 3TW0A 3C6UA 3W62A 2AP6A 3G87A 4B3TF 4IH5A 3OVBA 1WDTA 3GQCA 4AL5A 2QSFA 3JYTA 5AT1B 4O3QA 3J7YU 1S57A 4OX6A 2QL5B 2Z2ZA 4MJKA 4PQUA 2DGQA 4JI8F 1LWCB 4OX7A 1J5EJ 4YMEA 1RT6B 3FEZA 4ZLLA 3D1HA 4X4OA 2ZOFA 1U1OA 1S1WB 2CJQA 3G6ES 2B7BB 3J80U 1B4SA 2MZQA 1SH0A 3P4UB 2ASLA 1XK8A 4DPOA 2XMMA 1M90T 1S5ZA 1UJ6A 5IS2A 2AW0A 3OL6A 4F02A 4LFCJ 3SEOA 2MB0B 3CGIA 2Z58B 3BSAA 1FCAA 2OSQA 1E6VB 3D6MB 3L3CA 2BE7D 1FXLA 1HBOA 2B51A 3KXDA 1T94A 3FGVA 3M1VA 2AV5A 5I3UB 5L39A 3DHWC 2KM8C 2VFUA 1XR6A 5MLCV 1JNZB 2M8DB 4I2QA 2EKNA 1HHQA 2FYXA 5KT5A 4P2SA 4GVBA 3KK2A 4GC7A 1JLQA 4RJVA 3EDRB 3UWTA 2VU5A 1X4BA 3CJ8A 3IBCB 3WQPA 3M30B 1PAUB 4DV1J 2F9JA 2ZBQA 1HQ2A 4ANDA 3N5FA 4AT1B 4ES1A 2J7WA 2GVZA 2BW2A 1GMWA 3I31A 4CLYA 2BW7A 4QOTA 2JC1A 2OD6A 3BKUA 1RCOB 2DVIA 4FYVB 4YN3B 4U7CA 3FKBA 5CYMB 4DV0J 4LF9J 3BGLA 5KFVA 2JNJA 4KGMA 5DZ7A 2YXLA 1X9SA 2FB0A 4ECSA 2HYIB 2ATCB 1O5JA 3ZC4A 1M5SA 4C48A 2MKSA 3WC0A 3HT3A 8ATCB 2EC0A 1H2TZ 2LECA 1RU1A 2EVZA 3NNAA 4MT1A 3U27A 1TV6B 3NEKA 3R5JB 4KH1B 3ZTQA 5J2MB 5LMUF 3W5XA 1F3VA 4LF7F 3LW5C 3PNIA 4KJIA 5EWFA 5THWA 1SH3A 1U6FA 2CADA 2DHHA 4YY3F 4I68A 3JQJA 1F9EB 1BQNA 4OI1A 2QYGA 2IIHA 3W3SA 2O66A 3NNCA 4E98A 5HP1A 2XNRA 2U2FA 2RB7A 2RQKA 2DIVA 1PG5B 2KFYA 1DTTA 4Q5VA 1Z2ZA 4NCGA 2OPQB 1XEZA 2NPIA 1YBUA 4DOZA 2HRTA 3D66A 3TUIC 2AGQA 2C3YA 3BJYA 2IDEA 1X4HA 4DL0C 3OVSA 1ZPVA 1NH8A 3BO2A 4EMDA 4BWJA 3H90A 2NXJA 2CPDA 5KFYA 1RHQB 4F4AA 3DXBA 2FVPA 4USVA 3GTYX 4UTGA 2DR9A 4PKDB 4F50A 2CA9A 2KHCA 3MFIA 1KFDA 4PAAA 2WBRA 2EFQA 3LPYA 2V4JA 3KLGB 1T9YA 4A8XA 4X64J 4HT7A 1SB6A 1VDHA 2UXBF 2ZWPA 2IBKA 3BGRB 2QTWA 5D3GB 1VBYA 3GYGA 1EHWA 4ILMA 3CMES 3NRBA 2CJKA 3B4DA 3NGDA 4NLXA 1TL1B 3ILOA 5KFKA 1Y5NB 3EVOA 4K4YA 3BPDA 1VYAA 1FWPA 3CC4S 1SH2A 1JXVA 4ZK7M 4QW9A 2V2ZA 3POTA 2OPSA 1FDDA 1P1TA 2QA2A 3KLFB 1L3VA 4LF6J 3I56S 4UY8T 2HLTA 4ZCMA 1TK0A 3PW4A 7FDRA 2X3DA 1VQOS 2YX1A 3PXGa 3HLUA 2GHVC 1ZS6A 1CULA 3Q8RB 3BF4A 3GJQB 2DCUB 1Q8KA 4RKUC 4U95A 3I9V9 4B3TJ 1M5HA 1XQIA 1IBCB 1XR7A 3T19A 5KFGA 4LRFA 4W98A 2RRNA 2CVIA 3MPDA 3OTBA 2CZ4A 5K20B 5C25A 4FBUA 1DLOB 3QZ7A 2VV5A 5E3RA 1VRQC 2CYYA 1GK8A 2N82B 1HQEA 1S49A 3N28A 2CZVC 2AEJA 1J5OB 2EW9A 1FVSA 3JTNA 1NJIT 1H38A 2H54B 4YB6A 5G0RA 2KU7A 2R4FA 4WXWA 3FSIA 4ECTA 1YX2A 1REVA 4JI4F 2F7VA 1SJ1A 2V34A 4HT5A 3EVWA 3G6YA 1LK5A 2W2PP 3ILJA 5H9FJ 1T05B 3HHLC 3IFEA 2VONA 4ED5A 2DITA 3CW2C 1UVJA 4F26A 2HAFA 1UETA 1UFWA 1V5VA 4KO0B 2AT1B 3QPIA 3EZUA 2WONA 4XIUA 4ZVHA 3K0JA 3MM8A 3VAKA 1XNRF 3EVMA 1HBNB 2VKZG 4M5DB 3MD1A 4LIRA 1YIJS 2DNKA 2XS2A 2KKHA 2E1AA 3Q8QB 2I2YA 3VGSA 4ZHRB 1IKVB 3MMBA 1C2PA 1Z1ZA 2XMAA 1X5TA 4EO8A 3DYAA 1JLFB 4ZP6A 2ALYB 3VAHA 3IWXA 3W8GA 1R0BG 4OI3A 1TKTA 2HBRB 2N7YA 2JSXA 3B54A 1RJJA 4FYXB 1KC8T 1GMUA 4O4GB 3HSDA 3ENVA 1T02A 4G1QA 2DHGA 2ZBCA 1IBMJ 2MQNA 5K5MA 2ACMA 4IYQA 4CT8A 2XC9A 1N32F 3MMCB 1WKJA 2C3MA 4IOAQ 2RS8A 2FVCA 4J5OA 4H4OB 5FLXU 2R8JA 1W25A 1VHFA 1OIAA 3DDIA 1OYDA 3D1OA 2DR8A 3NWRA 2YQ3A 2H3EB 1SIWB 4P2MA 4GKKF 5LSLA 5E3AA 1VQSA 2PI5A 5H9FK 3H98A 5DS7A 1ROFA 3AOAA 2KL8A 3PVXA 1P1LA 5F9NA 2ZZNA 3I0RA 3LPEA 1SJ4P 3QLHA 2LA4A 1PYSB 2HNZA 3EGNA 3EWGA 2HAIA 4C0OC 4ECXA 1RXOB 3EYZA 1EP4B 1B7YB 4C11A 3RRKA 2XMUA 4OZLA 3N4WA 2XSJA 2UUAF 4OMFG 1UVMA 5D4PA 1H7XA 4O23A 4UQGA 4XAKA 4IFVB 5F0UA 2B9WA 3TP2A 3GJSB 1YZ7A 2HFSA 3RBZA 2DXEA 3DM2A 4NWBA 2B4UA 1AT1B 1R8HA 2VUGA 2YKOA 4I2PA 5BXIA 1RAGB 3AFGA 3ZZUA 2EFPA 1DURA 4C3LA 2JZ5A 4KRWA 3LP1B 1VK8A 4KHPF 1NHKL 1EARA 1S0VA 2DNMA 2UVWA 1FEEA 5EX0A 2R7UA 4OJGA 1TKXA 2V5HG 1VISA 3P8BB 4DR4J 4UF4A 1KHVA 1TU0B 2Z2YB 5BYRA 3LUYA 1AUDA 2BV3A 2LA6A 1RU2A 3ET6A 2CWXA 2F8EX 2XMJA 3F44A 3MEEB 3GIKA 4A8WA 3H2LA 3CJKA 1I94F 4DX5A 4UOCA 2ZZTA 1WEYA 1FA0A 2P6TA 3FK4A 3AT1B 1UA1A 2XHWA 3BREA 2XMWA 1NPRA 2O1PA 3NL0A 3PEHA 3GB0A 2CQCA 4KQZA 2ZJPQ 1YSJA 2QE5A 4LSNA 4IRKA 4CP5A 3HD2A 5GMKa 3CWJA 4B9LA 1EZZB 2PC6A 2VPZB 2WVBA 1NEEA 4LFAJ 2R7VA 5T7LB 1X5PA 2FZCB 4QU6A 4ZVUB 1TL5A 2VBYA 4EGLA 3PEJA 1YKWA 3E01B 3RW6A 4TY8A 4K4WA 3M6WA 3NAHA 1QM9A 2QLXA 1SXLA 4FYWB 4LBIA 2R7OA 1H7WA 1FNMA 3MUTP 4OYIA 4N47A 4GKJF 1S9EA 2VJUA 3G6VA 3G82A 1ZM9A 4IUFA 5KAKA 1QSSA 2J0SD 1FK9B 1IBLF 1CQMA 1RE1B 3WC2A 4I6WA 1CJKB 2I8EA 2NYIA 1HD1A 1U0HB 4DU8A 2GMHA 4FXDA 4ECWA 4KGVB 3R2CJ 2G2YA 4LSZB 1Y9OA 4R8UA 2F40A 3MXHP 4LRAA 2IM1A 1CJTA 3N0VA 1F2GA 2PA3A 3QQCD 1KN6A 3DOKA 3GV7B 2V2VA 1HNZF 1HNIB 2CQIA 3I0SA 1WI8A 4YHHF 4L76A 2XYGB 5F8NA 1IN0A 3GV5B 2FY8A 2N4DA 4Y28C 5HI7A 4AL6A 3TQ1A 4EWTA 4PUOA 1YLXA 3QIPB 2ZDOA 4FP9A 1XNRJ 4CLLA 2PMHA 5A8RB 3VGTA 3CPWR 1VK3A 2CPYA 2AYMA 2Y8WA 3V6DA 3FNNA 5B0GA 4HHJA 3MEDA 5CXTA 4Y2IA 1IJEB 4QBUA 5AJ3J 3IS9B 2M70A 5HBMB 1V5IB 1XR5A 3QGGA 2P9CA 3BGOP 2MXYA 2UVUA 2C2KB 2MGZA 2ROEA 2LQBA 4DQPA 1W7WA 4BBYA 3CDUA 3QGHA 4USMA 4M5HA 2A1BA 3UNYA 5ETRA 1VR6A 3N01A 3SCKE 3US5A 4EFAC 4ID8A 1WG4A 3D1QA 1D1UA 4KFBB 2MQMA 1N32J 3PRDA 2MY7A 1VC5A 1AB8A 3RJMB 4CLPA 4ECZA 3NGUA 2C2DA 4M5NA 1YQHA 2ATLA 4RX6A 4RU2A 3LAMA 4U6PA 3F56A 3BM7A 2HHQA 1RWKB 4NLUA 3HHDA 2AJ2A 2JFDA 3MOZA 3V81B 4V1Ak 4IG0A 1FDNA 5T41A 4DG1A 4MK9A 2NXUA 2MQQA 4DR3J 1HARA 1IBKF 2IMOA 2HK2A 4U8VA 4CLWA 2A6OA 4KIAA 5KFWA 4NRTA 4K5RA 3ZZOA 5IV4A 1U26A 1ZTWA 2Z4PA 1Q8IA 4JV5J 1C1CA 3N6NA 5LXRA 2R7SA 1BD6A 2VPXB 1VRUB 3C14A 2HFUA 3PV8A 4C2MA 4DV7F 3OSPA 2UUAJ 1U1MA 2RE1A 2AIRB 4YOEA 3DLEA 2RJZA 1K0VA 4OX8A 4IR9A 1TL4A 4WP3A 4FN5A 5CCMA 1T8EA 2E5JA 2AKWB 5B0EA 1PYOB 3R6GB 3CCUS 1CJVA 2QEXS 3FVYA 2BKPA 3PR4A 4OHWA 4AL7A 3MURP 5KT2A 1JNRB 1I1GA 3SQGB 1O8BA 5ETQA 4E0DA 2CNLB 2J7KA 4IG3B 4K4TA 5D4LA 4CLSA 2HHTA 2NXNA 4WZMA 3K2YA 3UD4P 1WWHA 5BYSA 5KFIA 1LWFB 1DJ0A 3IR5B 2M3DA 1BWVA 1RT2A 2IMWP 1TL7A 4NI2B 1HMVB 1I94J 5ETKA 2NSBA 4HHUA 4RW6A 2C3OA 4LIWA 2W9CA 2KVIA 1Q86T 1VQKS 3TRGA 3MAAA 1UZHA 4U67Q 3CSKA 1HI8A 2CUYA 3CVKA 1YJ7A 3CDEA 1K47A 1DRZA 4RW4A 3DLBA 1EETA 2A18A 4C8LA 3M2UA 3PRVA 4LFBF 5B0AA 5DM6Q 3VAMA 2R8HA 2HPUA 1NK7A 2KJWA 4F0KA 1WC3A 3BS9A 2EPIA 2E5IA 2B9XA 1FTRA 3Q83A 4ELVA 2AJ0A 1KBRA 3WZ0A 1S4FA 2K06A 2BR0A 3ENWA 9RUBA 3EXCX 3UE2A 1HNWF 3QO9B 2BX6A 1RYRA 3CC7S 2FJXA 2OPPA 1BE4A 1VCTA 3EGWB 1NHVA 1X0FA 3SSSA 4YR3A 2D41A 3MM5A 3W2WB 3THPA 2M2BA 4DQRA 5GMEA 1NHUA 1WKLA 2HBQB 3Q89A 3NAIA 4DSLA 3OXGA 5I42A 3NNHA 2VG6B 3HFZB 1T9WA 3OQ2A 4F3OA 3SBMA 4TXSA 4ZVSB 2VH7A 1NJWA 4J9QA 1GT8A 2QA4S 4NXNF 5KTQA 1X0PA 1MMLA 4XDCA 1UAWA 1S7HA 2R3VA 2HFNA 2VIHA 3OR1B 3UVJB 2JVOA 4QR1A 4LQ3A 4FVCA 2ZUGA 4HEA9 4OIXA 1XJWB 3S7RA 3MEGB 3AODA 2GS8A 1KQKA 3DRRA 3GWCA 4RBUA 4MFBB 3P5BP 2OUGA 1H73A 2B4OA 1MW7A 1MMDA 2YNHB 4DR6J 5HLFB 2QL9B 2BJ8A 2KG0A 4ES2A 4FNHA 3I6PA 3RB3A 1ITPA 1FF2A 2MJUA 4EBEA 2LXFA 4JYAF 3Q2TC 2ILYA 4UQTA 3TJ9A 1JJ2R 2HS0A 1N33F 2IM3A 2QN6B 2KXNB 2GNKA 1Q7YT 1XBWA 2HHPA 1RWWB 2YVSA 3WDOA 4DPUA 3AOCA 4KC5A 2BE2B 3IBWA 3M8PB 3TA0A 5J2QA 3KTQA 3QWUA 3S1TA 1HWUA 1MWYA 3C6TB 1S79A 4ERDA 1YHQS 3TUPA 2M4MA 3CCQS 1SPBP 3PZPA 3B6BA 4WIQA 2HBYB 3VV2B 4E8UA 4F4WA 3RB4A 3ENQA 4FPIA 3K17A 2VG5A 1IBKJ 1Q16B 4B9SA 5IT4A 2EFOA 4C8MA 2MZSA 4X65F 3DDNA 2RUSA 4X2BA 3ICLA 1TFYA 4HR2A 4ZCIA 1MN7A 1FKPB 1NZAA 3MR5A 1MN9A 1DTQB 2OH2A 2GW8A 4DX6A 3PIPQ 4CH1A 3PY8A 2W8KA 4J9RA 4I4BA 1S12A 4A4JA 3RBDA 3N6MA 4DV7J 2EG2A 5AXKA 2C2OB 4O3PA 3NCRA 2OMOA 3VGUA 2EFGA 2PFDA 3NS7B 3M8QA 5DG7A 1DQ9A 1N5SA 3T9ZA 1FEHA 4CLTA 5KFCA 3HI9A 4OZ3A 1U45A 1PC5A 2YNIA 1U47A 2UVRA 3FEYB 5L1JA 4ECRA 1MNEA 1VQ7S 1VQ6S 1K0TA 1TZ0A 1U09A 3OFGA 3ILIA 2BM0A 3OV7A 5E3QA 1U2RA 1TKZB 3DKDA 2BANB 1KQSR 2YKPA 4FXWA 2HVZA 3NBPB 5H9EK 2FHMA 3GR1A 1RZMA 4OYXA 4KHRA 3VQTA 3FUYA 1NPPA 2O3DA 3OTOJ 4ZLPA 2DNZA 4DDFA 1DFDA 2CQBA 1PILA 2H4WB 1IKYB 4DR2J 3RU0A 3R1LA 2DPJA 3LP0A 3V2UC 1ZOTA 2R2RA 2BEFA 2ZHOA 1X4CA 3FCHA 2W7OA 2RHQB 3ZTRA 1SBRA 1JQGA 4NCBA 4CCHA 1T03A 1VJWA 1GAOA 4W90B 1WORA 3A8KA 2H9ZA 3KJQB 4LF5F 4CYUA 3UD3P 2ALZA 3GILA 3BKTA 2HBZB 1RTIB 1TUGB 2OIHA 4IQMA 4ZLJA 2KXHA 3DRPB 2COLA 4LFBJ 2CJXB 2LXUA 2BACA 4CNZA 2JL9A 5DM7Q 2Y0BB 1FKAF 2FVQA 4KTQA 2V4QA 1SCJB 4ZVEA 4A48A 2D3O1 5E2QA 1BC6A 2D3OR 2R2TA 1WG5A 3LALA 2WOMB 4GRSA 2HVHA 4DR7J 1N36F 2DRDA 1X4GA 2MKJA 3RAMA 5CYMA 1KKHA 3H4DA 1FJGJ 1VBZA 5C42A 4L74A 4U96A 2W4DA 3K7RA 1JKHA 2DNLA 4I7FA 5K8PA 4PPDA 1X5SA 3KK3B 3PRBA 1AFJA 4G65A 4WKYA 4GO7X 4PG4A 1RQ0A 3A3NB 2BXJA 3AD9C 4LMZA 2PT0A 4KV8B 1JLAA 4ILLA 1N54B 4K5SA 5EUHA 2HZCA 3I55S 2BRLA 3QNWB 3WHIA 2JH3A 5K14A 3QSIA 4K2JA 4WTYA 3JSRA 2VBZA 3CULA 4N8OA 3CCZA 4BCAA 1RT3B 3M8ZA 2UUCF 1NKEA 1OSDA 1KEKA 4B9MA 3R1HA 2BE9B 1N6QB 3SFUA 2F5GA 4M5KA 3DMJA 4ZIWA 1C0UB 2AU0A 4X4RA 4U7UD 1G2EA 2OLWA 3TYTA 2FD2A 4M8LA 4FYDA 3HJVA 3P96A 4I69A 1RP5A 2B43A 4QYZK 3BKFA 4BHQA 1FRJA 3V4MA 1U6ZA 1NH7A 3TWZA 2DGXA 3W8PA 4CO1A 1ZBTA 2DNPA 2I38A 2KYZA 4DL5A 3D0IE 3SDEB 2NZ4A 4DSIA 3OUYA 1NZ8A 1HFEL 3PR5B 1PAEX 3I5BA 3M9OB 1N5YA 5C2GA 1FTCA 4DUZF 5IQ6A 4YEAA 3HX9A 3CJ3A 4YQWA 2GO8A 3GJTB 4ZCLA 3DI6A 1N33J 5C7PA 3V6JA 4TU7A 2AJ4A 3VHQA 4EBCA 4RUHA 5ETLA 1UKUA 2H5IB 4BWMA 4KGKA 3KLGA 2NLWA 4G1IA 4CTAA 2ADBA 1YRUA 2CQ1A 3UQSA 1M5VC 3CCSS 3THVA 4LUBA 4YDXA 3QGIA 3TAMA 3O1LA 3BGRA 3V6KA 1Y3JA 1PGZA 2VFTA 3CB4A 2F9DA 3A8EA 4ZVQB 3K5NA 2QC3A 1TL1A 1VQYA 4YR0A 4IRCA 3C15A 5CQGA 2OPRB 2XS7A 2MLZA 3MPUB 3H5SA 2N4CA 3KLFA 5JVGQ 1YG0A 3T6JA 2HNDB 2GIQA 5FDLB 4X4QA 1I51B 2OHDA 3IN5A 1O51A 3T1AA 4USUA 1S1XB 4U9RA 3PFEA 4LRCA 2AWZA 4WCEQ 5C5JA 5CD4H 1R6YA 2F4FA 3PM9A 5B0DA 4QQBA 3UR3C 4B9TA 3LGMA 2WSEC 4EO6A 1R31A 2E7XA 3MCMA 3BDEA 2OSRA 4ES3A 2YNGB 1WC4A 1RAOA 5GAHU 3KG0A 4Y00A 5L9XA 3BO3A 2VG7A 1HLWA 2FHOB 4KT0C 2PEBA 2V8HA 4F4XA 2D3UA 5IM0B 2MKKA 3OL9A 2LLZA 4QWAA 3VVTA 2UXDF 5IC6B 4O4RA 1QUVA 4L3KA 2BOAA 2WRMA 2VDHA 1OQ3A 4RWXA 1GFWB 4KO0A 4EZ6A 2CWKA 1JJ4A 4YB1P 1Q1KA 3MZIA 2L48A 1R0CB 2ZFHA 5KT6A 3OBIA 1N88A 1R0AB 1NBEB 1HBNA 5F8LA 3P5TL 3KJVB 3LWLA 2XY7A 1Q4RA 2VFVA 2GZOA 2FLLA 4DCPB 3HVAA 3IXQA 1IKVA 3CD0A 4DV3F 5A8WB 3A12A 4C4WA 5DETA 3QMQA 4GMKA 3VAFA 2RRAA 4PEOA 1JLFA 3CC2S 2GVDB 1VJQA 3TQEA 5L38A 5J1EB 2RQCA 3EE3A 1SL0A 4K59A 2CPJA 2XI2A 3R5AA 4C8KA 3QT7A 2HQIA 2FLOA 2RQMA 3TEHB 2Y1RI 3EJMA 3MMCA 3H25A 1FFSB 2W25A 2SXLA 1X31C 2A2DA 2E29A 2BQ3A 5KG7A 2MSTA 4X4SA 3IGNA 1TMJA 1U4BA 1FJ7A 2GQQA 2YNFB 3TZWA 2KT2A 2ZWOA 1YJVA 2IBOA 3MPVA 2DB1A 4DSKA 3ITHB 3IR6B 4JI2J 2YQ0A 4JI5J 2HQCA 3U1LA 3IWNC 3TR5A 5H1SV 2UUCJ 1G7CB 5BR8J 2QRRA 4Y34A 2CXEA 3HZEA 3OL8A 3ZNUA 3FBCA 1B3TA 1UVLA 4JI7F 3R3TA 4OYZA 1Q8BA 5DLGA 2A0FB 4CLZA 3M6UA 3UW1A 2DY1A 1ACMB 2E9RX 2G1DA 1BMQB 1IKXB 3W9IA 4B3MJ 1HWJA 2L9DA 4N77A 2E1CA 2QL7B 1JLCB 1ZZNA 2GC8A 2AYEA 1D8YA 5DLFA 1WI6A 4NLRA 2PSZA 1LW0B 1X7VA 4C8OA 4O3RA 2J76E 2I5JB 4DFKA 2GJFA 1F5CA 2L08A 4K0KF 4ETZA 3TUZC 4Y2KA 5E7OB 3SZ2A 2G9OA 2V6AA 1RT1A 1BQXA 4X66F 3BBBA 1VQMS 4NLGA 1KOOA 3R27A 2Y3YA 2WW8A 1WDDA 1T3OA 5L46A 2X1GA 1KVJA 2YKMA 1Z2LA 3NS5A 4KPCA 2KZMA 1C0TB 2JEJA 4NLDA 1KLMB 2ZM6J 1T9UA 5IV3A 4B3SF 3N6LA 2YKNB 4RWWA 4FDFA 4OZ5A 1AZSB 4L3NA 4UY85 3M32A 3CCES 3JSMA 4ID5A 5J2NA 1VQPS 5C24B 4NA2A 2LFVA 5A2QY 1D8ZA 3BB5A 1RI7A 1CJUA 1JLEB 3EPGA 2Y1LB 4TVAB 2RU9A 5DZ6A 3MTKA 2DNNA 4ZOSA 3OHAA 5GAGU 4NLYA 3R2DJ 1LWEB 2BJEA 2RAQA 2GAGC 3TZYA 2BJ1A 1Q8LA 4IKAA 2GMLA 2EKYA 4Q8FA 4JB8B 3CJSA 3V4IB 4CRJA 3I32A 4BLGA 3TI0A 3DLHA 2UU9F 3KLEA 4DUYF 4P10A 3VALA 4DS4A 1NK8A 3PYEA 2RDIA 3AJDA 3VZHA 4V19J 4ZP7A 3DRSA 2FGOA 1XMQF 5B0FA 2HMIA 1MU2B 3FFIB 5A0YB 2ZE2A 3C2PA 2G0JA 4HI2A 4ZPBA 1JXEA 1U0HA 4DCJB 3C6UB 3CD6S 3G4SS 2BMBA 4HTIA 4GO5X 4I0WA 1CS4A 4IDKB 3DN9A 1DBDA 4OI4A 3JYTB 1HNIA 4NL5A 2C3PA 5KG4A 3U7JA 2DJWA 4PQUB 1AW0A 2RF2B 1MSWD 4NYOA 2V63A 4B17A 1YJTA 2BA9A 2XBPA 3K5LA 3R5CA 4HH0A 2XZTB 2H5EA 1Y4ZB 2F8MA 1N8RT 5KG1A 2O01C 4DSFA 4WPAA 5A8RA 3CCVS 4USTA 4F0HA 4JI1F 4DSEA 3O44A 1WEXA 1HBMB 4G1PA 3MUMP 2GX8A 3HPOA 4B02A 2N7CA 3DLLQ 1QJHA 2QYCA 3OHBA 1U1QA 2JFKA 4DV2J 3WX4A 3T1YJ 2BRKA 3DRYA 1NUEA 2QA1A 3VCDA 1BLUA 4X62F 4MKBA 2BJ3A 1HI1A 4JV0A 1WF1A 2J7UA 2MLXA 2HHXA 3M1VB 3F41A 4ED1A 3H0PA 4RL1A 2CQ0A 4I2QB 1XMOF 4WK3A 2XO6A 1SC1B 1YBAA 2DEJA 2YQ1A 2CFXA 2E1PA 1BXNA 4GVBB 2EBEA 1JLGA 3CUNA 2XG8A 2YWEA 3TZZA 4QCLA 1JJCB 3V81A 4LR9A 1N5VA 3TVZA 3MF5A 2MSSA 1U49A 4F3MA 4JI6J 3LP2B 1RBOB 2AEFA 1LWXA 3GYNA 2KVQE 1URRA 2JLEA 1RWOB 3FBEA 4NA3A 1YJUA 4WKRA 1X4DA 1Y11A 2IYIA 2W2OP 3GP9A 1VRUA 3KK1A 5KFRA 4QWCA 5LOQA 9ATCB 1WJ9A 4FF1A 2M7SA 2B4VA 4DL4A 2CJBA 2X51A 3SSRA 3OL7A 4YFUA 3QRQA 2VZ9A 3I5AA 1N56A 2E5GA 4DFJA 3R9LA 2R9LA 5HJXA 5HVHA 3AH6A 2V8VA 2OKQA 4Y2MA 3VAJA 4LF2A 2HGNA 5KFBA 4ICLA 4XK8C 2WVFA 3PKYA 2E7WA 2ZBPA 1RGVA 3W66A 1QTNB 3VF0B 1IXKA 3PHTA 4RW8B 4WFBQ 2HGLA 2DGVA 5I4MA 4NYZA 3PIOQ 3LWMA 5AXMA 3BSNA 3SQGA 1OS5A 5HP1B 1RHUB 1OSCA 3G86A 4NCAA 3RBEA 4B08A 5E5NA 4A8QA 2W1BA 2BZ2A 1AYEA 3OW2R 1DTTB 1IQTA 3OT9A 4J91A 2MY8A 3G96A 3NKYA 2XWXA 4NLQA 3R5BA 3T1HF 4C9DA 2HIQA 4NCGB 4UZBA 2VHGA 4WE1B 2DT9A 1YJRA 1HMVA 1YRXA 5CH7B 4PWUA 1UEKA 2DGTA 1T11A 3MD3A 1HBUA 4PXEA 2PMWA 1DQAA 4KGXB 4OI6A 1UEUA 4B3SJ 3JB9k 3H5YA 2CQ4A 1CSJA 2FTRA 4JV1A 3BN4A 3J7Z5 1VOMA 2MTLA 2VQEF 4FF4A 1N34J 2EEYA 3MOJB 1K73T 2RS2A 4YB5A 5KG5A 3KJFB 5IC4B 2OO4A 3S01A 1VC6A 1UWAA 5KFMA 2ZVIA 4OLOA 2ZH3A 4DV4F 1YRTA 4QWDA 1QVGR 3HULA 4O44B 3L09A 1URNA 2A10A 5IT9Y 3IM9A 3O8WA 3PO5A 4B3RF 3Q22A 2Z30B 1H2UX 2B56A 3OTCA 4OYBA 1UJ4A 2NQPA 1WELA 2HSEB 1EJ7L 1BQMA 1P6TA 4JI3F 3HHKA 1NJXA 3FBBA 1WOSA 1OMSA 3AB2B 2LU1A 2OPSB 2DD8S 3BH6B 1RT4A 3H5XA 2LEBA 2Q6BA 2M9KA 2NUUG 3W2WA 1XMQJ 3W2VB 3ZZ0A 2B5JA 1F60B 2JX2A 3M2VA 1CULB 3M6VA 5LSRA 5L1LA 4QIGA 1MROA 2DR6A 3ADAC 1AXQA 2RMLA 1OWXA 3CJ5A 4OJ1A 1GXTA 4YUDA 4DL7A 4ZVTB 1SJ3P 5C25B 4OHYA 3JQKA 1FX2A 4URGA 3MPYA 2EWHA 2UV8G 1HQEB 2IC3B 2NREA 3OR1A 3D28A 1M0SA 2RILA 2P9EA 1T3NA 1REVB 1T7PA 4OJHA 3VAGA 2FC8A 2YNHA 1KLNA 1S10A 5HLFA 4A8YA 2E1RA 2M5YA 2DGUA 5CD4A 3QRPA 5FIIA 4S0MA 1HR0J 3J81j 2OEJA 3CD7A 4WFXA 5DRKA 3AXKA 4ATNA 1RTHA 4Z7CA 5D0EA 3QT8A 4UUWA 4RW9A 1SQEA 1ULRA 5KFAA 5DGAA 2W7AA 2GV1A 3D2WA 1A7GE 4FS2A 4TKTA 1XMOJ 1AA1B 2X7IA 3MMBB 2ZHAA 4DCOB 1B99A 2WAQD 4DPXA 1JMTA 3HK2A 3DYAB 1NSPA 1HNXJ 3M05A 5GADU 3PYGA 4OHZA 2ZC4A 3GIRA 3JSYA 3C6TA 4CLKA 1TKTB 1Y10A 4O0NA 1QUPA 1U7LA 2B8PA 2AHOB 1YTYA 1ICEB 2LKZA 3UDVA 1BHNA 3RR8A 1SKWA 4NLVA 4WXOA 1TK8A 5DDRC 4DI6A 2L41A 3BSCA 4G1QB 2Y1IA 4NLPA 2ZH4A 2DBBA 3WBZA 3NG8A 4W92B 3FQLA 1SQFA 3HKZD 5JMNA 5IT0A 4J9MA 4F3QA 3QBCA 2QG9B 2QMUB 1RAAB 2FIUA 3UPFA 3MHYA 2WB1D 4C8NA 1BWEA 3G9CA 3SCLE 2GQCA 1Q82T 3IRXA 2AGPA 2HFOA 3NP5A 4R0JA 2MMYA 2HG4A 2NXEA 1OYEA 4P9SA 3R7SB 1V3SA 1QLNA 2DNRA 4WYLA 3A8JA 2G2ZA 3MMAB 2NS1B 1S48A 4DV5F 1WNEA 2C2RA 4NXMJ 5EWEA 4IOBA 2BJ7A 3I0RB 3M8YA 3QFWA 2XO7A 1UW4A 3QLHB 5F8JA 3D6HB 1WTFA 2ZNYA 2F4VJ 4ZVPB 1KR4A 3NY0A 3R5GA 4Q2LA 4L73A 1DAXA 4LVOP 2W8LA 4M5MA 4C11B 1R89A 4XO0A 2H5JB 4N5SA 1XC9A 2XSJB 2HRYA 3ILLA 3CJ2A 1IM6A 4LQ9A 2CVEA 2FJWA 3HCXA 2E5HA 4DUTA 3K59A 3T1HJ 2W7PA 5IWAJ 3DM2B 2YWWA 1JXLA 2X1FA 2W01A 4I2PB 4BS2A 2ILZA 2XWYA 3CCTA 3BZQA 2V94A 1WOPA 5M2RA 1SC3B 1WSRA 4ENOA 2Z56B 2FY1A 3HHLD 1A6LA 1LKZA 3IP0A 1S97A 2ZVSA 3QRRA 2OJ3A 1R8BA 3DCAA 1RHMB 4B9UA 1S1UB 2ZDPA 1FX4A 2L9NA 3W63A 3FQKA 1TAUA 3CJRA 3ET6B 3BO4A 4LF8J 3GE9A 3X3UA 2K3KA 3CJKB 5D8HB 1A9NB 2HNYB 3JTOA 3TVYA 4X4TA 5IXUA 4N7TA 5M2PA 4LF4J 3FRYA 3RBXA 1HQUA 1QE1A 1TAQA 3MECB 3RTVA 4LSLA 1LW2B 2XQCA 5GAEI 4DXLA 5HATA 2FJVA 1M5OC 2FHJD 4PABA 1HNVA 5HL7Q 2WBMA 2DISA 4JI0J 4F0MA 2Q79A 4USJC 5FJ4A 2JRSA 3UR0A 4EU0A 4B9VA 3R7NB 4TU8A 2JJ4D 4HTJA 3P3DA 1Y7PA 1A0OB 4WZQA 4TY8B 4L75A 1NK6A 3C66A 3CNQP 2MQLA 3A3PB 4KGZB 4PZVA 2LQ9A 4EYHB 1T9TA 2CQHA 4ZP8A 1U1KA
chains in the Genus database with same CATH topology
3NGRA 1NHKL 1UCNA 2AZ1A 3B6BA 3DKDA 1NDKA 1ZS6A 3FBFA 3BBFA 4F4AA 1NPKA 1PKUA 3EM1A 5IOLA 1HLWA 3Q83A 3Q86A 2DYAA 1BUXA 1KDNA 2HVEA 3L7UA 3NGSA 3EJMA 2HVDA 4ANEA 3R9LA 1NSKL 3VGTA 3Q8YA 3ZTQA 4EK2A 3EVMA 4HR2A 1MN7A 1B99A 2DXFA 2ZUAA 2HURA 2BX6A 4UOGA 4F36A 1XQIA 1NSPA 1NLKL 3VVTA 3VGSA 1NCLA 1PAEX 2AZ3A 4FKXA 1WKKA 3EMTA 1HHQA 4W98A 4UOHA 3GPAA 1BE4A 1MN9A 3ZTOA 3VGVA 1NDCA 3MPDA 1S57A 2DY9A 4O0NA 2B8PA 3EICA 3Q8VA 2BEFA 2NCKL 1BHNA 1XIQA 2CWKA 3NGTA 1F6TA 2VU5A 3FC9A 5C7PA 3BBBA 4DI6A 3B54A 3ZTRA 1NDPA 1WKLA 4ANCA 3BBCA 3Q89A 3FBBA 1LWXA 4FKYA 1W7WA 3VGUA 1NB2A 3PJ9A 3FCWA 1EHWA 4DUTA 3Q8UA 4CP5A 4ANDA 1S59A 2B8QA 3ELHA 3ETMA 1HIYA 4UOFA 3ENAA 3G2XA 3BH7B 3FBEA 3BH6B 4KPCA 3WX8A 3EVOA 3FCVA 1LEOA 1NSQA 1VYAA 3EVWA 1B4SA 3FKBA 3ZTSA 3FBCA 1WKJA 1JXVA 4DZ6A 3PRVA 2DXEA 1K44A 3NGUA 4S0MA 4WBFA 3GP9A 4ENOA 1NUEA 5BXIA 1S5ZA 2DXDA 3JS9A 3ZTPA 1NDLA 1F3FA 5CABA 4C6AA 1U8WA 3DDIA 5CAAA 3EE3A 3VVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGR A;  1NHK L;  1UCN A;  2AZ1 A;  3B6B A;  3DKD A;  1NDK A;  1ZS6 A;  3FBF A;  3BBF A;  4F4A A;  1NPK A;  1PKU A;  3EM1 A;  5IOL A;  1HLW A;  3Q83 A;  3Q86 A;  2DYA A;  1BUX A;  1KDN A;  2HVE A;  3L7U A;  3NGS A;  3EJM A;  2HVD A;  4ANE A;  3R9L A;  1NSK L;  3VGT A;  3Q8Y A;  3ZTQ A;  4EK2 A;  3EVM A;  4HR2 A;  1MN7 A;  1B99 A;  2DXF A;  2ZUA A;  2HUR A;  2BX6 A;  4UOG A;  4F36 A;  1XQI A;  1NSP A;  1NLK L;  3VVT A;  3VGS A;  1NCL A;  1PAE X;  2AZ3 A;  4FKX A;  1WKK A;  3EMT A;  1HHQ A;  4W98 A;  4UOH A;  3GPA A;  1BE4 A;  1MN9 A;  3ZTO A;  3VGV A;  1NDC A;  3MPD A;  1S57 A;  2DY9 A;  4O0N A;  2B8P A;  3EIC A;  3Q8V A;  2BEF A;  2NCK L;  1BHN A;  1XIQ A;  2CWK A;  3NGT A;  1F6T A;  2VU5 A;  3FC9 A;  5C7P A;  3BBB A;  4DI6 A;  3B54 A;  3ZTR A;  1NDP A;  1WKL A;  4ANC A;  3BBC A;  3Q89 A;  3FBB A;  1LWX A;  4FKY A;  1W7W A;  3VGU A;  1NB2 A;  3PJ9 A;  3FCW A;  1EHW A;  4DUT A;  3Q8U A;  4CP5 A;  4AND A;  1S59 A;  2B8Q A;  3ELH A;  3ETM A;  1HIY A;  4UOF A;  3ENA A;  3G2X A;  3BH7 B;  3FBE A;  3BH6 B;  4KPC A;  3WX8 A;  3EVO A;  3FCV A;  1LEO A;  1NSQ A;  1VYA A;  3EVW A;  1B4S A;  3FKB A;  3ZTS A;  3FBC A;  1WKJ A;  1JXV A;  4DZ6 A;  3PRV A;  2DXE A;  1K44 A;  3NGU A;  4S0M A;  4WBF A;  3GP9 A;  4ENO A;  1NUE A;  5BXI A;  1S5Z A;  2DXD A;  3JS9 A;  3ZTP A;  1NDL A;  1F3F A;  5CAB A;  4C6A A;  1U8W A;  3DDI A;  5CAA A;  3EE3 A;  3VVU A; 
#chains in the Genus database with same CATH topology
 3RZA A;  5KOX A;  4USH A;  4H4K A;  4F8R A;  2D7S A;  4NLS A;  1RT3 A;  5KG6 A;  1EX8 A;  1GTE A;  5CA5 A;  4ZN1 A;  3FRZ A;  4RBV A;  3K89 A;  3G82 B;  4JI8 J;  2ZBR A;  1N6Q A;  4I6A A;  4EK2 A;  2UVV A;  1C0U A;  1VS3 A;  4IFY A;  3D3B J;  3RRG A;  3KG4 A;  2GJI A;  2PA8 D;  3I82 A;  4MH8 A;  2DO4 A;  1SV5 B;  4K50 A;  4DFP A;  4AFF A;  1U1L A;  2B9Y A;  4XDD A;  5F8M A;  3OSN A;  3BGF A;  3Q2S C;  1D9D A;  2XMV A;  2XZW A;  1VBX A;  4R8U B;  1G1X A;  1CJT B;  2DHX A;  2PFF B;  2ACY A;  3QJJ A;  4ZPV R;  5HAO A;  3B4M A;  4UOF A;  3I0S B;  1X9W A;  3DOL B;  5HK4 A;  2EXU A;  5HSP A;  3FSY A;  2E44 A;  2BYC A;  2GO9 A;  2XS5 A;  3W60 A;  3HO1 A;  2GGP A;  4IR1 A;  4PUO B;  4P7T A;  1PIE A;  5CZV A;  2CPE A;  4MK7 A;  2LMI A;  1N0U A;  1UA0 A;  5CHC B;  2KN4 A;  2FJA B;  5A6W A;  2AMC B;  2YKQ A;  1T95 A;  2HVE A;  3V6D B;  3NOG A;  3I87 A;  4Q8E A;  1UL3 A;  2CG4 A;  4OV1 A;  1LNQ A;  4URS A;  4WII A;  5F41 A;  1C1B B;  1Q79 A;  2JEG A;  5DDP C;  1LV5 A;  4ZLN A;  1S1T B;  1RTJ A;  2XY5 A;  1YJ9 S;  3BR9 A;  2R7X A;  3SV3 A;  4A47 A;  5LMN F;  1SC4 B;  2YX4 A;  2XYP B;  1FDA A;  4KKO A;  4M63 A;  3WX8 A;  1P9Y A;  1QAX A;  4Q7A A;  4KBI A;  3Q8S B;  4DQI A;  5FDL A;  4RNH A;  2GAH C;  2Q6C A;  3HVW A;  5HQ8 A;  3HT0 A;  2OD4 A;  1S1X A;  5KFE A;  1FNX H;  4DG1 B;  2WSF C;  2Q1L A;  2BJ9 A;  2H4Y B;  5LMU J;  4RZR A;  4LF7 J;  4YP3 A;  4YY3 J;  2XCP A;  2IPO B;  3MAQ A;  4DR5 F;  2OP5 A;  5DQG A;  2XMK A;  3BR8 A;  4QPX A;  1GMW D;  2VBW A;  2XCA A;  1QTM A;  1C1C B;  3N5B A;  1LOU A;  1SUQ B;  3C14 B;  5DDQ C;  2CNO B;  3HHE A;  3IG1 A;  3KUE A;  4NE9 C;  2CPF A;  4Q43 A;  2E5L F;  2LEA A;  1L3T A;  4USW A;  3DLK A;  4TU9 A;  3DLE B;  1FKO A;  4QR2 A;  4QPT A;  4R5P B;  1PJ5 A;  5D0R A;  2PDA A;  5IM0 A;  3UN5 A;  1U2C A;  2DK2 A;  1CJV B;  3NXZ A;  3ENA A;  3A13 A;  4O0I A;  4F4K A;  4WBF A;  4DFM A;  2YPZ A;  1H98 A;  3OJU A;  1J5E F;  1R0A A;  3QJL A;  3KHH A;  3NGR A;  3HP6 A;  1OY8 A;  4Y65 A;  3KJV A;  5CYJ A;  1NO8 A;  1U2F A;  4MYT A;  4IH7 A;  1JIH A;  1KON A;  2ZKT A;  5A2Q U;  4K2X A;  3QYY A;  4RLE A;  4OYM A;  3NGS A;  2UXB J;  3CT9 A;  3MUV P;  1TL7 B;  1NRK A;  3G8S A;  3G8Q A;  4LFC F;  5F3T A;  1O6X A;  4RW6 B;  4J9N A;  2VB6 A;  4RNO A;  2W9C B;  2DY9 A;  1NM2 A;  4CH7 A;  4Q44 A;  2HGM A;  2MPU A;  2PMZ D;  2XB2 D;  3TJA A;  4J9U E;  8RUC A;  4X84 A;  3LA0 A;  3PX4 A;  2CJA A;  2GIF A;  1EET B;  4DLE A;  2XYH B;  4N8N A;  2AJF E;  4BC7 A;  2IM0 A;  2LP4 A;  3M2U B;  1S0M A;  1S59 A;  1WUU A;  3T5L A;  1Y5L B;  2LDI A;  2OGU A;  4QIW D;  1O0P A;  3MCN A;  4ZJL A;  2K1R B;  1EQM A;  4DV1 F;  2EFV A;  2VBX A;  1W2B R;  2BOP A;  2Q66 A;  2ZOM A;  3FMW A;  2JEF A;  2V68 A;  2BQR A;  1RTD A;  3CJQ A;  3L95 X;  1TL3 A;  5JXS A;  3CD5 A;  3CJT A;  2LCW A;  4H4M B;  2YWH A;  4NOH A;  4DV0 F;  2OFG X;  4DEZ A;  3UDL A;  5ETV A;  2DO0 A;  2F8H A;  2HVD A;  2OPP B;  1XTZ A;  3OR2 A;  1F5A A;  2C2M B;  2HVI A;  3DGP B;  1IKW B;  3D0H E;  3EZ5 A;  2VPW B;  1S0O A;  3TAQ A;  3MM5 B;  2W24 A;  3I9Z A;  1VQ4 S;  2XHC A;  3HZG A;  2HW3 A;  1IKX A;  3CCR S;  3TVK A;  4JI4 J;  1FRX A;  2RD5 C;  3AQP A;  3PX0 A;  1QSL A;  3R7B B;  2WCX A;  3BBC A;  2ERR A;  3WIU A;  3BDP A;  2HWI A;  2E9T A;  1KFS A;  1MG7 A;  2UUB F;  3B82 A;  2AQ4 A;  4Y2C A;  3KOA A;  3ZO7 A;  3TX0 A;  3KUH A;  4ILR A;  1XN9 A;  1ZM2 A;  4PWW A;  2JVR A;  3L9Z A;  5F8G A;  3UD5 A;  1U8W A;  3MM6 A;  5DO2 A;  2EI5 A;  1Q53 A;  3DRR B;  3FBF A;  2MKY A;  2KDO A;  1FD8 A;  3JTP A;  2HQG A;  1R8C A;  4CM2 A;  1Q5Y A;  3L7U A;  2Q3P A;  2CNN B;  1C0T A;  1DHM A;  3HSG A;  1W26 A;  4QW8 A;  4A8M P;  1S6Q A;  2YKN A;  2AJ1 A;  1M5K C;  1FXR A;  3C19 A;  3B8H A;  2BDP A;  2K7K A;  3MM9 A;  3RRH A;  1MWQ A;  1ZTT A;  4RW7 B;  1Q78 A;  5JVH Q;  3CF5 Q;  1SL1 A;  4OI2 A;  2BBE A;  2L9W A;  4TLR A;  5LMN J;  2E1M C;  1GH8 A;  4KSE B;  4X64 F;  3N79 A;  5J2Q B;  1B64 A;  4V19 X;  2R8K A;  2FLN A;  3A8I A;  3CJ4 A;  1FHT A;  5HVF A;  2NPF A;  2X3G A;  3UNG C;  5ETM A;  1RWX B;  1FNO A;  1YWX A;  4GKK J;  2CPX A;  5KFL A;  2D1C A;  1N0V C;  4A46 A;  4YDD B;  2CQ2 A;  3AD7 C;  3K58 A;  4CI0 B;  5GMD A;  4QYR A;  4F04 B;  5AE3 A;  2ZH2 A;  3EXY A;  4MKV A;  1WC0 A;  4F4Z A;  1X60 A;  3RB0 A;  1MU2 A;  1LQ9 A;  1WKK A;  2QFJ A;  5A0Y A;  2DTJ A;  3QZ8 A;  3ULH A;  2QLB B;  2YPY A;  4H4K C;  4NLT A;  5ETT A;  2E5L J;  4DPW A;  1SKU B;  4QZV B;  2CPI A;  5KFO A;  2QIF A;  3GR0 A;  2BM1 A;  2DNO A;  3M8Q B;  4IDK A;  3LH2 S;  1N4L A;  2CZ9 A;  1UPP A;  4B3O A;  4PWD B;  2V2K A;  5B08 A;  3BPS P;  2YNI B;  4C97 A;  4OYO A;  2RF2 A;  3QAE A;  1S6P A;  4WJB A;  4KHP J;  4ER8 A;  2W4C A;  4DN0 A;  1CBK A;  1X9M A;  3M6X A;  2R7R A;  2EG1 A;  4ZVR B;  3QGP A;  3HVT A;  3QFH A;  3VVU A;  1UVK A;  3KHR A;  1F0X A;  1VMB A;  4LR8 A;  1RCX B;  1HBM A;  1T9V A;  5AXL A;  1MLA A;  3DOM B;  5DG9 A;  3LP0 B;  5IT9 U;  1DQ8 A;  5IFM A;  4L72 B;  2F3J A;  2D74 B;  2N3L A;  4G6V B;  3SIP B;  4C7Q A;  4USI A;  1T03 B;  1D9F A;  1RWP B;  2AJQ A;  4ZDN A;  2QZ8 A;  4FVM A;  4CYU B;  1VLY A;  2J0X A;  2RUG A;  3D54 A;  2IJF A;  4ED7 A;  1XER A;  1YJN S;  2CIM A;  1TUV A;  4M94 A;  4K7Q A;  1B0T A;  2RQ4 A;  1S1V A;  3T5J A;  1YJW S;  3HMJ G;  2M0G B;  3KWM A;  3TUJ C;  3PJW A;  1WTB A;  3BYP A;  5D4N A;  3JSB A;  1RA7 A;  4I6Y A;  1PBU A;  4N76 A;  3LP2 A;  4GVL A;  1XWL A;  3UCU P;  1FE0 A;  4GKJ J;  1IBM F;  4F2R A;  3EPI A;  4CO3 A;  1RHJ B;  4OYP A;  5C42 B;  1VQ5 S;  5D77 A;  1XNQ F;  1IBL J;  2IDL A;  4HDH A;  1JKH B;  4I7F B;  2FDN A;  2WW4 A;  1Y3K A;  1HW9 A;  2CKW A;  2YTC A;  3DU6 A;  3V6H A;  1AFI A;  1VC0 A;  1JLA B;  2FUG 9;  4IOC Q;  3C16 A;  3K57 A;  1YK9 A;  3C46 A;  5K14 B;  3D3C J;  2MZT A;  3H42 A;  1UVI A;  3L7P A;  4A8O A;  4WFA Q;  4WK1 A;  2DR5 A;  4JUZ A;  1HNZ J;  2G1H A;  2GMJ A;  1ZZF A;  1NB2 A;  2DNQ A;  1G4C A;  4ZP9 A;  2UUB J;  3Q8U A;  4YHH J;  1APS A;  2IVM A;  2J9D A;  2DH8 A;  4WP8 A;  5HRO B;  3DMJ B;  4RW8 A;  3PYF A;  3KLH B;  3THT A;  3IMQ J;  5J1P A;  2MJN A;  3EZO A;  3BN7 A;  4AYB D;  4AD6 A;  4F25 A;  3ISZ A;  2ZKU A;  2OEK A;  3VAI A;  3UI3 A;  1S76 D;  4CLU A;  3M9M B;  5EX3 A;  1WHY A;  3W61 A;  3QJP A;  3EDQ B;  2C3U A;  2B6A A;  2W2Q P;  4CM0 A;  3ONQ A;  2PN6 A;  4DSJ A;  3Q86 A;  3JAM Y;  4WE1 A;  1KTQ A;  3OUY B;  2H1Y A;  5A8K A;  3MCS A;  3PW2 A;  2KT5 A;  3MR3 A;  2DNY A;  3W5Z A;  1N5Y B;  3M2R A;  5ITH A;  3GFH A;  4OZ2 A;  3T3F A;  3KLI A;  3MM7 A;  4P52 A;  3OLB A;  2PO4 A;  3DI6 B;  4DLG A;  3RB6 A;  1F9H A;  2YBV A;  2HWT A;  3AA8 A;  1IUJ A;  2JOQ A;  4DR4 F;  2D69 A;  3OTE A;  4YS2 A;  2AGO A;  5H9E J;  3H4B A;  2RKI A;  3D4J A;  2OEM A;  2FZG B;  2YKA A;  2XLJ A;  1D0E A;  1WHX A;  3FCW A;  2UUT A;  4O44 A;  3PCO B;  4CTA B;  2RT3 A;  4NZ7 A;  1U24 A;  1R8A A;  3KFW X;  3W7B A;  5K9F A;  4P73 A;  3CED A;  1LEO A;  1XMB A;  1VRT A;  3TAM B;  4ZMM A;  1WC5 A;  1YBT A;  3QWP A;  1UWB A;  1YVF A;  1CC8 A;  4Y2A A;  4LFA F;  1GMV A;  2HHV A;  1PKU A;  1WAC A;  4ZPD A;  3C15 B;  2JLG A;  1UW9 A;  2BKO A;  4FZV A;  1U48 A;  3CDA A;  2DXF A;  2AYB A;  3W2V A;  4ZCK A;  3CDW A;  1IR0 A;  1TEL A;  1RDR A;  1SJF A;  4OX9 F;  5CYQ B;  3O3L A;  1KP6 A;  2C42 A;  1QAY A;  2MQP A;  1WC6 A;  4ED6 A;  2B0G A;  2R7T A;  5F0W A;  2R2S A;  2YY3 A;  3OFH A;  4M5L A;  3TEG A;  2CQ3 A;  2J6U A;  5LSO A;  4MK8 A;  2MKC A;  2H48 B;  4KYZ A;  1RB0 A;  2MQO A;  1LWC A;  5E3P A;  3A1Y G;  4QWE A;  1S99 A;  2VOP A;  4M1K A;  2HQD A;  3R97 A;  3KUG A;  1U1P A;  1RT6 A;  4J90 A;  2P8I A;  5AE2 A;  1S1W A;  2IC3 A;  4CO4 A;  2PE8 A;  3FJ2 A;  5I3Q A;  4U8Y A;  3GII A;  1LFW A;  2VG7 B;  1F3F A;  3UDE A;  1ZA2 B;  3BQ2 A;  4J37 A;  3HVR A;  4CDI A;  4DL2 A;  5EHH A;  4NLO A;  2IY5 B;  4QJV A;  4TLQ A;  3MPW A;  4ANE A;  1FES A;  1E6V A;  3MMJ A;  5C2C A;  1ARO P;  5I3U A;  5CZX A;  1KNZ A;  3NS6 A;  2M8H A;  4QYZ J;  2IJN A;  4LBH A;  1KTV A;  1XIQ A;  4F7V A;  1IVZ A;  3RAX A;  1FI4 A;  4OZ0 A;  4DJB A;  1NJY A;  2YWK A;  5B0C A;  2CPZ A;  4C3K A;  5B09 A;  3DLG B;  4RO0 A;  2LU2 A;  3M30 A;  1HIY A;  2IAJ B;  2B4P A;  5KG0 A;  2A6M A;  5AJ3 F;  4W4M A;  4ELT A;  1DZ5 A;  2VAS A;  1S0N A;  3NCQ A;  2BVZ A;  3IM8 A;  4HL9 A;  4J9V A;  2QT7 A;  1UJ5 A;  3TAN A;  3KDO A;  3VWS A;  2A3J A;  1IM4 A;  3DDK A;  1HNW J;  5SUH A;  3DRX A;  3PAC A;  2VPY B;  2A2C A;  3SXL A;  2P9G A;  5ETS A;  2RDJ A;  4M95 A;  1XNQ J;  3AJ1 A;  2IRU A;  2G13 A;  2YH1 A;  3I5C A;  1TV6 A;  1X4A A;  3K5O A;  2IA6 A;  5HO4 A;  5J2M A;  1JLB B;  5F8H A;  3D6T B;  3TOQ A;  4DR3 F;  1X4E A;  2H65 B;  2V9W A;  1HA1 A;  1RKI A;  5KFX A;  3J81 Y;  1S6U A;  2RH3 A;  4J9K A;  1P8G A;  5BJR A;  3MMA A;  2DGW A;  2XM3 A;  2Y0S D;  1NB7 A;  3N9U C;  2LYV A;  4JV5 F;  2G4B A;  1S9F A;  5RUB A;  4NXN J;  2G0C A;  3ETM A;  1B70 B;  4ZPA A;  1UTA A;  4C98 A;  2NXC A;  5KFF A;  3FCV A;  1ZM3 A;  1R6V A;  2MHE A;  1WG1 A;  3C8Y A;  3T9N A;  3DFE A;  2VIC A;  2R42 A;  1CPZ A;  4DR1 F;  2I0X A;  1H0H B;  4A8S A;  1ZAV A;  1GTH A;  4DMZ A;  1QDU B;  2OPQ A;  1M5P C;  1QY7 A;  1HKA A;  4K4S A;  4DV6 F;  3A3O B;  3CCW A;  4IO9 Q;  1V3Z A;  4K4V A;  1FER A;  2Z2L A;  1JX4 A;  1VBK A;  2GQ2 A;  4JYA J;  2ASJ A;  1D3W A;  3NMA A;  5KFJ A;  2K2P A;  4AQY F;  3SCI E;  3CCM S;  4OI0 A;  4OHX A;  1RT1 B;  4ED4 A;  3OLA A;  5LM7 E;  2IA0 A;  2KM8 B;  1VI7 A;  2ASY A;  4FBT A;  1S1U A;  4P72 A;  3GLJ A;  3ZZY A;  3FC9 A;  2KFN A;  2VOD A;  2VKR A;  1NME B;  2YKM B;  1V6H A;  4EBD A;  3HHN B;  3TA1 A;  2HNY A;  1S72 S;  2UP1 A;  2GHW A;  5D3G A;  3RGI A;  1F5B A;  3OXF A;  5EDW A;  1RBL A;  2HHS A;  3AB4 B;  5KG3 A;  4HH1 A;  3A4T A;  3MEC A;  3M32 B;  1LW2 A;  3JSM B;  1IQZ A;  2DR7 A;  4ID5 B;  5J2N B;  1RWN B;  1NK0 A;  2VC0 A;  2KT3 A;  4X65 J;  4X4V A;  4I56 A;  5CAB A;  1EAY C;  4RPF A;  4H54 A;  1N52 B;  1CJU B;  3EUN A;  1NDK A;  4TNO A;  5K8O A;  2ZHB A;  2W4P A;  2ZH8 A;  2J0Q D;  1UMJ A;  2JDJ A;  3IGV A;  2YX7 A;  2MZ1 A;  3U1M A;  2KYX A;  2CJ9 A;  3SFG A;  3J7Z T;  4N56 A;  4OX9 J;  3AOB A;  4WU2 A;  3HM9 A;  1HPZ B;  2DCL A;  1NDC A;  3KMS A;  1RWM B;  1RHK B;  1YDL A;  3MDF A;  3KLE B;  2FVR A;  4TYA A;  5KFN A;  2OFH X;  4ETX A;  1DLO A;  1TKD A;  1HYS B;  4WWS A;  4UUX A;  4UT4 A;  2E66 A;  5HMW A;  3D5M A;  1RUS A;  4ZVF A;  3MR7 A;  3GCW P;  3GU0 A;  3DRS B;  2QV6 A;  3C3L A;  4PG8 A;  1QAJ A;  2OAU A;  2HMI B;  1J5O A;  2HLU A;  4URQ U;  1SI9 A;  1SV5 A;  4HKQ A;  3H7H B;  2RRB A;  2ZE2 B;  4HHH A;  4M5J A;  1NK4 A;  2ZZM A;  5L9N A;  1TR0 A;  4HAC B;  5KOW A;  2APO A;  2HIY A;  1SKR A;  1CS4 B;  2QX0 A;  4PG5 A;  1T05 A;  1FDB A;  3P49 B;  4WU3 A;  3TNV A;  1Z4U A;  1NPK A;  1RT7 B;  4Y6I A;  1RAI B;  2M88 A;  1SVD A;  1HD0 A;  3DOL A;  3KYL A;  2BQU A;  4YR2 A;  3CJ0 A;  4HLB A;  1RT5 B;  1F9F A;  3NOC A;  4LBP A;  2ZH5 A;  4DU7 A;  2I9S A;  2WVE A;  5KT7 A;  1TVR B;  4M5D A;  1RK8 A;  4LF5 J;  1T9X A;  4ZPT R;  1FT8 A;  2RHS B;  4KB7 A;  3Q8V A;  4ZHR A;  2VA3 A;  4DR6 F;  3JXO A;  1OPI A;  1KHW A;  3PJ9 A;  2L3M A;  1HHT P;  4FXV A;  4UW2 A;  2PD1 A;  3ISN D;  4EI2 A;  1F2H A;  2J6T A;  2Q43 A;  4O4G A;  1KQG B;  1C1B A;  4JP8 A;  3H8Y A;  2HK3 A;  4QIV A;  1EIY B;  1S1T A;  1RSC A;  2KFZ A;  1N36 J;  3H40 A;  5I3P A;  1GXU A;  4JV2 A;  1KOH A;  3BV8 A;  3ZZR A;  1H3D A;  3K5M A;  2ZC3 A;  4H4O A;  2QSW A;  5LJ3 Y;  2HEK A;  2DNG A;  5L1K A;  1FO1 A;  1RAH B;  5D0H A;  1SJQ A;  1H74 A;  4JOU A;  1S7I A;  2PII A;  1JLG B;  3GG1 A;  1E6Y B;  1ZA1 B;  4DPY A;  3HFK A;  4XPC A;  2FVS A;  4PCQ A;  2YH0 A;  1QAI A;  3SMZ A;  4CLF A;  3T5H A;  1FRK A;  2QGF B;  4E2F B;  3QSY B;  1GEH A;  2ZOG A;  2CDQ A;  3GSD A;  4J7C A;  1B0P A;  2MYF A;  1EP4 A;  2FLP A;  4KR0 B;  2O67 A;  3LF0 A;  2ZD1 B;  3MWB A;  3SSQ A;  1SUQ A;  3KK1 B;  4Q0B B;  2XGQ A;  3QID A;  2RIJ A;  1GXL A;  4RBT A;  4IFV A;  4DR1 J;  4C6A A;  4R5P A;  4ED8 A;  5CAA A;  2Z57 B;  3RR7 A;  4X4N A;  1FWK A;  3Q24 A;  4DV6 J;  2AF6 A;  4ZVO B;  1K9M T;  3LGH A;  2R8G A;  2DYA A;  5KFP A;  3HHL B;  5IQQ A;  1GNK A;  4OQJ A;  2UXC F;  3LP1 A;  5J2P B;  4DHV A;  4DUZ J;  4ICL B;  1EKS A;  3D67 A;  2VF3 A;  4ECY A;  4O3O A;  2ZUA A;  4AQY J;  3W9H A;  2VC1 A;  1M1K T;  3G8T A;  3HF5 A;  4K4U A;  2UZA A;  3PW5 A;  5A76 A;  3HSJ A;  4MKY A;  3H59 A;  1N48 A;  2K8G A;  4N41 A;  1ZPW X;  2J9D E;  3MEE A;  2GIR A;  3E2E A;  2DEI A;  3OTO F;  3HJF A;  3ZNJ 1;  1R8P A;  1S9G B;  4DR2 F;  3HSZ A;  3ETO A;  3CMQ A;  4DL6 A;  3MEK A;  1R3N A;  1HBU B;  4ECQ A;  2CJY B;  1JB0 C;  4RUA A;  4CIO A;  2GJ2 A;  2UUW A;  2GCF A;  5DQI A;  4C3M A;  3TZX A;  1ZH5 A;  1VIX A;  5ETP A;  3RAQ A;  5T7L A;  2DIU A;  4F67 A;  2LQ8 A;  5HVG A;  1I3O B;  5KT4 A;  1R27 B;  4RNF A;  5K8M A;  3E01 A;  1RYS A;  3QT6 A;  4PQA A;  3UCG A;  3H5U A;  2C2N A;  2K1R A;  1IWG A;  1JWW A;  2N3O A;  3EMT A;  1RLC L;  4HYK A;  1BQM B;  5DJB A;  4DR7 F;  4QWB A;  4H4M A;  2ROP A;  3NGT A;  1FJG F;  2G0I A;  4CO0 A;  1FK9 A;  1U0S A;  4FKY A;  3GFX A;  2W9B B;  1RT4 B;  1CJK A;  1RAJ A;  3DGP A;  5SZT A;  1IKW A;  2QLW A;  4P7V A;  2LDY A;  2B7C B;  2B5J B;  2EFN A;  3M2V B;  2XI3 A;  4QR0 A;  2FHK A;  5GAH I;  3UN2 A;  1FVQ A;  4OFZ A;  1NJZ A;  2X1A A;  1MRO B;  3U02 A;  1MWZ A;  1RIS A;  3J7A N;  2UXD J;  3BQ1 A;  4CZC A;  4MAK A;  2LXI A;  3D9B A;  3HXM A;  4PYD A;  2P5V A;  4I64 A;  3FEX B;  3CXC R;  2HRU A;  3LO3 A;  1L3U A;  2HHH F;  5KFQ A;  1NLK L;  3M4X A;  2DRA A;  3QIP A;  2ZEJ A;  3ZTO A;  4ZPW R;  3IR7 B;  3BGU A;  4Z37 A;  4DV3 J;  1V9O A;  2HZA A;  4XTT A;  4OLP A;  2CAJ A;  1KWM A;  2DHS A;  3T5K A;  4DL3 A;  2Z8Q A;  1SC6 A;  5BYQ A;  1ZM4 A;  2V4R A;  3IS9 A;  2FJD B;  1RAF B;  5HBM A;  3NMR A;  5A6P A;  4ZN3 A;  3CMA S;  1VQL S;  3L7O A;  4O3N A;  3LQV A;  2G2O A;  2V8P A;  1HBO B;  3IAS 9;  3T6B A;  2IFX A;  1RTH B;  4RW9 B;  3ZZP A;  1L3K A;  1IR1 A;  5AE1 A;  4KFB A;  5GVQ A;  4RW7 A;  5HMZ A;  2IYG A;  2AEM A;  1LXN A;  5AXN A;  3KK2 B;  2V9K A;  2NZC A;  2B3T B;  3PDN A;  1JLQ B;  4HVZ A;  3BBF A;  3J7A 1;  3CDB A;  2K3I A;  1NK5 A;  1PC4 A;  2WHO A;  3KHL A;  2BKN A;  4NEY A;  2EC2 A;  2HFV A;  2ASD A;  2GVZ B;  1B0V A;  2DRB A;  4FKX A;  5LT5 A;  4PPZ A;  5G4D A;  4K4X A;  5ADZ A;  4JBC A;  1ZYQ A;  1BGX T;  5E33 A;  3EX7 B;  2IM2 A;  1NK9 A;  4JI7 J;  3O2I A;  3DHX A;  2KH9 A;  4OYW A;  2C2E A;  4ECV A;  3OXL A;  3D7S B;  4PG6 A;  3E51 A;  4P74 A;  2HWH A;  2ZH9 A;  3IRX B;  3KNG A;  1F1B B;  3HDS A;  2KI2 A;  1FRH A;  4F4Y A;  1LFP A;  3TO8 A;  3GV8 B;  1OPZ A;  2UV8 A;  1WHV A;  2WVD A;  1KRP A;  2KZZ A;  2RDD A;  3OFF A;  3F73 A;  1NU4 A;  2MZJ A;  3QAT A;  3UCZ P;  3MR2 A;  3S6E A;  4P6Q A;  1H6K X;  1VQ9 S;  4PWD A;  5D78 A;  1PJ6 A;  4D3G A;  8AT1 B;  1PBA A;  4K0K J;  7FD1 A;  1BQN B;  1WC1 A;  2UXC J;  1RTZ A;  2XEX A;  3V5R A;  1KD1 T;  3JAM U;  4RU9 A;  5KFS A;  1WOO A;  5ETN A;  2XLK A;  1Q7L B;  4Z7Y A;  5T14 A;  3Q8Y A;  4OHV A;  4X66 J;  4IG3 A;  1EQ0 A;  2JLF A;  5M2U A;  4OZN A;  4ZKA A;  4QU7 A;  1KVI A;  4B9N A;  3VGV A;  4NZ0 A;  1LWF A;  1UP1 A;  3EGZ A;  2PGC A;  2ROG A;  3FDS A;  2NCK L;  2U1A A;  2VD3 A;  4NI2 A;  4WFY A;  1F6T A;  3GON A;  4MMO A;  1VHI A;  3TAR A;  2OTL S;  2V8D A;  4OZ1 A;  3K5P A;  1RA6 A;  1QVF R;  3DOM A;  3PTW A;  1B7F A;  2MDA A;  2QJ3 A;  3VQS A;  1P9Q C;  4AUK A;  2C22 A;  3J80 Y;  4EZ9 A;  4UZC A;  2IVF B;  2WTF A;  2CQG A;  5LJ5 Y;  2V2Q A;  3LGN A;  1FJC A;  1T0T V;  4ZIT A;  5HJY A;  2HS4 A;  3RW7 A;  1KS2 A;  1CEZ A;  2V4J B;  3JS9 A;  5E0O A;  1HWK A;  2IJR A;  3AD8 C;  2DGS A;  4PRF A;  4KAI A;  1IJF B;  3O5T B;  1UCN A;  2AZ1 A;  2BJD A;  2OEL A;  3R5D A;  5DGB A;  5B0B A;  4ED3 A;  2NUH A;  2CG8 A;  5GAG I;  2QMW A;  1U8S A;  1HQU B;  1QE1 B;  1PYT A;  4KE5 A;  5HQM A;  4LR7 A;  1U1R A;  2BAB A;  1PSD A;  2VFS A;  4LSL B;  2P6S A;  2UU9 J;  4ITS A;  4DUY J;  3QO9 A;  2HQF A;  4CO2 A;  1FD2 A;  3POT B;  3ZFV A;  1HNV B;  6FDR A;  3AHP A;  5D4O A;  4U7U K;  1X5O A;  4KH0 B;  3PJX A;  1TQL A;  1TMM A;  4FF3 A;  2HHW A;  1RAC B;  1TK5 A;  3ZZT A;  4Q2M A;  3DLJ A;  4X4U A;  3BH7 B;  1FXD A;  5E3C A;  1OO0 B;  1N5Q A;  4AXI A;  2VG6 A;  2RU3 A;  3IA0 A;  2POK A;  4JI2 F;  4J9S A;  1HW8 A;  3DU5 A;  4JI5 F;  1OQ6 A;  5DQH A;  3OFE A;  4DX8 H;  2YWF A;  2LQJ A;  1TTH B;  1UZD A;  4FPR A;  4OL8 A;  4IO1 A;  5BR8 F;  2HS3 A;  5HRO A;  4ZA1 A;  4DN9 A;  3KLH A;  3U1N A;  5IZH A;  4IFY B;  1RKJ A;  4J9P A;  3UVJ A;  4LVN P;  1L5U A;  4ZJQ A;  1CLF A;  2JEI A;  4USK A;  2HHH J;  3MEG A;  5G0R B;  1ZAX A;  1FJE B;  2J8A A;  4B3M F;  5JUM A;  4HI1 A;  2MLY A;  3SI8 A;  2E7V A;  4MFB A;  5F9L A;  4JI1 J;  2MHN A;  4BDP A;  3GSI A;  1QD1 A;  2CRL A;  4ED0 A;  2J5A A;  3SCJ E;  2AYG A;  1C4C A;  1WEZ A;  2CQP A;  2HKE A;  4TYB A;  1N5T A;  3RUB L;  2J0W A;  3FZ2 A;  3K8W A;  4X62 J;  4AXJ A;  1VQ8 S;  2WON B;  2V67 A;  5D6G A;  3MM8 B;  2DNH A;  4OZJ A;  2HQ3 A;  4DZ6 A;  2GGP B;  4WTO B;  3PHE A;  4IH6 A;  1SJR A;  3KKF A;  5CCL A;  1LK7 A;  3DXS X;  2VA2 A;  2BE2 A;  1FFW B;  2K7J A;  3M8P A;  5KFT A;  4NLW A;  1NSA A;  2VQF F;  4KY3 A;  2ZH1 A;  2C28 A;  2KRR A;  4FS1 A;  5IOL A;  4MYU A;  2QO3 A;  3AA9 A;  5MAO A;  2ZM6 F;  2VJV A;  3OJS A;  4M5I A;  3R8Y A;  1VGY A;  2PI4 A;  1U25 A;  2NYH A;  1GQE A;  2AX1 A;  2XLI A;  2HUR A;  3NWG A;  1REG X;  3PX6 A;  1EKR A;  1CVJ A;  2QA4 G;  4DWI A;  3GG0 A;  1PO6 A;  1RTJ B;  4DS5 A;  2XY6 A;  2M52 A;  1FKP A;  2RVJ A;  4WFN Q;  3EIC A;  2KG1 A;  4KHM A;  1CQN A;  2KB2 A;  4Y3C A;  2ZNZ A;  1FRI A;  3J81 U;  1DTQ A;  3LOU A;  4P2X A;  2W2M P;  1L3S A;  3CIM A;  3DNC A;  1GX6 A;  1RHR B;  2KXF A;  2CNK B;  4KKO B;  3VZI A;  2FGC A;  2XUL A;  4IRD A;  1VQN S;  3ELH A;  5CYQ A;  2C2Z B;  3O6Q A;  4TQR A;  3MTJ A;  2IRX A;  1VIO A;  5LXY A;  1K44 A;  1YZ6 A;  4LRB A;  4DX7 A;  1Y00 A;  2LQ5 A;  4NA1 A;  4QIE A;  1NDL A;  2MEW A;  3CIZ A;  3QAU A;  2KO1 A;  2KHD A;  4EEY A;  3PW7 A;  2HNZ B;  4I1T A;  2FC9 A;  1IR2 A;  1RLD A;  1WF2 A;  4PXB A;  1UFK A;  2P2C B;  1TKZ A;  1EB0 A;  5E41 A;  2BAN A;  2EBG A;  2X1B A;  2IVY A;  4MKA A;  3D68 A;  2R7Q A;  3PW0 A;  3NBP A;  4UOG A;  2J9E A;  3IG1 B;  1FFG B;  1PCA A;  2AZ3 A;  3IC1 A;  3DLK B;  4LF1 A;  3SYZ A;  1FKO B;  1S77 D;  3P6Y C;  1IKY A;  2VL1 A;  2JWN A;  1Q0N A;  1WSV A;  4LRD A;  3Q0A A;  3VTI A;  2FJE B;  2J6S A;  2QLF B;  2QFI A;  3FZB A;  3KMQ A;  3CCJ S;  4X4P A;  1S6O A;  1TKX B;  2FQQ B;  2VQE J;  4P71 A;  3Q23 A;  3S8S A;  1JK9 B;  1YGY A;  1RTI A;  4EYI B;  1NKB A;  4DV4 J;  1HWL A;  2DHA A;  4DQS A;  4PXD A;  2E9Z A;  4FNI A;  3ZTP A;  4XPE A;  3DRP A;  3GYX B;  4ZJO A;  3TX8 A;  3GFZ A;  2V69 A;  1KQF B;  2NR0 A;  4B3R J;  3MGJ A;  3DLG A;  4ZS6 A;  1HWI A;  4DV2 F;  4MTP A;  2IAJ A;  1TP7 A;  3M8S A;  3T1Y F;  4ALZ A;  1Q5V A;  1KSP A;  2QMX A;  4LSN B;  2MZR A;  2WOM A;  2ZJR Q;  3FMB A;  2OML A;  4JI3 J;  1NCL A;  3CE8 A;  3AXM A;  2EK1 A;  1RAD B;  3MCO A;  3GIJ A;  5HMX A;  3UDC A;  1SQG A;  2ZH7 A;  2KTQ A;  1G6B A;  3KK3 A;  1K8A T;  1FRL A;  4CQ1 A;  4KV8 A;  4C8Y A;  2DH7 A;  1LXJ A;  3MAH A;  2RSQ A;  1NAQ A;  2WK4 A;  1JLB A;  1W2I A;  3I96 A;  1NND A;  4JI6 F;  4NX9 A;  5FLX Y;  1KVK A;  1RTD B;  1S9E B;  4FF2 A;  1TL3 B;  2OTJ S;  2W2N P;  3F0N A;  2KJV A;  3W64 A;  4MIA A;  3J7Y I;  4J9L A;  1DAR A;  1OJ4 A;  5KT3 A;  3PFO A;  2Y9H A;  4ZPC A;  1OY9 A;  1X8D A;  4DPT A;  2OI2 A;  1HL6 A;  3OR2 B;  5D0G A;  4RUC A;  1KDN A;  1RWV B;  4DBQ A;  4I67 A;  3KDN A;  3LTO A;  3W9J A;  3AQO A;  3T41 A;  3OVA A;  4NEZ A;  3CTR A;  3BEG B;  3MFH A;  2R7W A;  1QSY A;  3SDE A;  1DY3 A;  1TUW A;  2O5D A;  1G3O A;  2CQD A;  3DOK B;  1BY9 A;  4GC6 A;  4WYW A;  3HFV A;  2V50 A;  5F3Z A;  3SV4 A;  2ZIT A;  4ED2 A;  1OY6 A;  3IRW P;  4K4Z A;  4ELU A;  2IRY A;  2RNE A;  1H72 C;  1RWU A;  4AE5 A;  6FD1 A;  4P2F A;  2WZ1 A;  3GJR B;  4D3H A;  3MM6 B;  3ISN C;  2F65 A;  5L8R C;  3GZ7 A;  2DGO A;  4DZD A;  1SKS A;  2W9A A;  2JC0 A;  1Q81 T;  3P45 B;  3MED B;  1UPM B;  2VQF J;  3GCX P;  4PYA A;  3EM1 A;  5KG2 A;  3RG6 A;  4Z2X A;  5GAD I;  4FYY B;  2MGZ B;  1S6Q B;  3KNA A;  4ECU A;  5FD1 A;  3VR1 A;  4O3S A;  2MKI A;  2XMT A;  4ZIV A;  3NCP A;  1N34 F;  2XZD B;  1SIZ A;  3MM9 B;  3AJ2 A;  2OPR A;  3UO0 A;  3AY0 A;  4DQQ A;  1RBA A;  3W5Y A;  2HZV A;  1UEV A;  1M1H A;  2HND A;  3G71 S;  5F8I A;  2WB4 A;  3R6L B;  3WIV A;  2GFF A;  3KHG A;  1IWA A;  2J8S A;  1ELO A;  4NZ6 A;  4IG0 B;  2Z2M A;  1PJ7 A;  3G2X A;  2Y1J A;  1HPZ A;  1U6B A;  1ZAW A;  2VOO A;  3E8O A;  2V0N A;  2ZJQ Q;  3TJ8 A;  4DV5 J;  1V3R A;  2F1F A;  3MR6 A;  2ZBI A;  1MMN A;  1H2V Z;  4EUV A;  5HN0 A;  2I6W A;  1HYS A;  1P27 B;  2D3Z A;  1YI2 S;  5HQL A;  4LRE A;  4WF9 Q;  1S4E A;  4LJM A;  2YNG A;  4RR5 A;  2HFZ A;  2D9P A;  2XSF A;  4NYP A;  4WFZ A;  3IBF B;  2D9O A;  1D09 B;  2LVW A;  3Q8P B;  2JHE A;  2J9C A;  4HAC A;  3OTD A;  3M8R A;  3W1Y C;  3OD2 A;  4UOH A;  4NRU A;  1HI0 P;  1NXI A;  4DF8 A;  3IO1 A;  2Z0G A;  3G6X A;  4B3O B;  4PR6 A;  1RT7 A;  3GMG A;  4R25 A;  1NDP A;  3PG9 A;  2F63 A;  1FE4 A;  4IQX A;  1K1Q A;  1S6P B;  1WF0 A;  1WHW A;  2B9E A;  3D6F B;  1RT5 A;  1R7I A;  1U02 A;  3D0G E;  2WSC C;  3KJN B;  1TVR A;  3I4H X;  3TAP A;  2ABY A;  3QT5 A;  1GX5 A;  1HHS A;  2WVC A;  5LL6 d;  3HVT B;  4F2S A;  5A8W A;  4C0H A;  1C4A A;  2DXD A;  1RT2 B;  2GVD A;  2AX0 A;  4TY9 A;  4C8Z A;  5HMY A;  5J1E A;  1VLO A;  1BUX A;  1UFL A;  1HR0 F;  4C0B A;  1ZET A;  4CH0 S;  3KLV A;  1Y0H A;  4LT6 A;  1U1N A;  1VFJ A;  3ZXW A;  4L6V 3;  3GIM A;  3MAA B;  1FRM A;  3SQO P;  2C1E B;  3RYL A;  4RW4 B;  3AAW B;  2ZH6 A;  4G3I A;  4OJ3 A;  2MKH A;  3IWL A;  4NML A;  4NAS A;  5J1N A;  3M9N B;  3PO4 A;  1K1S A;  2BUN A;  3I4P A;  2FZK B;  1HNX F;  2YNF A;  4ANC A;  3M7V A;  1E6Y A;  1S1V B;  4TQS A;  2DH9 A;  1CG2 A;  3H20 A;  5L1I A;  3TA2 A;  3ITH A;  3NGK A;  4RNN A;  2CDR B;  1M1G A;  2KRB A;  4CT9 A;  2HHU A;  2MQ8 A;  1NSQ A;  3ZTS A;  1NKC A;  4P75 A;  5DG8 A;  1D9A A;  1JJH A;  4LF9 F;  4M5G A;  4WP9 A;  5B7W A;  2IHR 1;  5U47 A;  1AUS L;  4CWB A;  3CO9 A;  1R43 A;  5D15 A;  5EN1 A;  4CNY A;  1WD6 A;  3DC2 A;  4HDG A;  4RNM A;  2CPH A;  4RUB A;  1J27 A;  2ZD1 A;  5EGY A;  3BSO A;  1JLC A;  1FWL A;  5EWG A;  4Q0B A;  3C16 B;  3X1L B;  3BYR A;  4PG7 A;  4F36 A;  5I42 B;  2FPH X;  3UN3 A;  3ZZZ A;  4OV6 A;  1LW0 A;  5KFD A;  2H51 B;  4BC9 A;  2I5J A;  4KPY A;  1RAB B;  1X4F A;  3IAM 9;  4Q45 A;  3FSX A;  4MIB A;  4NXM F;  5HAN A;  3HHL A;  5KFU A;  4J9O A;  5J2P A;  2Y8Y A;  2F4V F;  2VFR A;  3HKW A;  2XNQ A;  2GA7 A;  2XTJ P;  2I1R A;  2DKO B;  5KFZ A;  4ZVG A;  3E3X A;  3EGV A;  3B78 A;  2B6A B;  2YWG A;  1SL2 A;  2LEP A;  2VDI A;  3L4B C;  3NLC A;  1KLM A;  3MI7 X;  5IWA F;  1S9G A;  3UFC X;  2QLJ B;  5A8K B;  3H2U B;  4QIF A;  2DPI A;  3K8V A;  1Y5I B;  3LAN A;  1AZS A;  5KFH A;  4R0E A;  3M2R B;  2FHJ A;  5C24 A;  4DF4 A;  3KLI B;  3MM7 B;  1NSK L;  4NPO A;  4A8F A;  3PKM A;  4K8R A;  1Q95 G;  1JLE A;  4YB7 A;  2EK6 A;  3HD1 A;  3GPA A;  3OPK A;  2AD9 A;  3CO0 P;  2RKI B;  4PXC A;  1J2V A;  1I5O B;  4LF8 F;  4MIW A;  2XGP A;  1CC7 A;  2ADC A;  1RAE B;  2GHP A;  1LWE A;  7AT1 B;  4LF4 F;  3PYD A;  3DGV A;  3H2V E;  3JQM A;  5DDO C;  4Y0F A;  2B8Q A;  1VRT B;  2FJB B;  2VG5 B;  3V4I A;  2NSC A;  3BQ0 A;  5GAE U;  4NMX A;  3KG1 A;  1UWB B;  3M8W A;  4TN2 A;  4A8K A;  3CCL S;  3GFY A;  2PEH A;  2R2U A;  4DR5 J;  4JI0 F;  4CO5 A;  4LF6 F;  3W65 A;  2V8G A;  5JJB A;  5ETO A;  1YIT S;  1I6J A;  5K8N A;  2W9B A;  2R8I A;  6AT1 B;  3FFI A;  4OYA A;  3LAK A;  1UVN A;  1TFW A;  3TW0 A;  3C6U A;  3W62 A;  2AP6 A;  3G87 A;  4B3T F;  4IH5 A;  3OVB A;  1WDT A;  3GQC A;  4AL5 A;  2QSF A;  3JYT A;  5AT1 B;  4O3Q A;  3J7Y U;  1S57 A;  4OX6 A;  2QL5 B;  2Z2Z A;  4MJK A;  4PQU A;  2DGQ A;  4JI8 F;  1LWC B;  4OX7 A;  1J5E J;  4YME A;  1RT6 B;  3FEZ A;  4ZLL A;  3D1H A;  4X4O A;  2ZOF A;  1U1O A;  1S1W B;  2CJQ A;  3G6E S;  2B7B B;  3J80 U;  1B4S A;  2MZQ A;  1SH0 A;  3P4U B;  2ASL A;  1XK8 A;  4DPO A;  2XMM A;  1M90 T;  1S5Z A;  1UJ6 A;  5IS2 A;  2AW0 A;  3OL6 A;  4F02 A;  4LFC J;  3SEO A;  2MB0 B;  3CGI A;  2Z58 B;  3BSA A;  1FCA A;  2OSQ A;  1E6V B;  3D6M B;  3L3C A;  2BE7 D;  1FXL A;  1HBO A;  2B51 A;  3KXD A;  1T94 A;  3FGV A;  3M1V A;  2AV5 A;  5I3U B;  5L39 A;  3DHW C;  2KM8 C;  2VFU A;  1XR6 A;  5MLC V;  1JNZ B;  2M8D B;  4I2Q A;  2EKN A;  1HHQ A;  2FYX A;  5KT5 A;  4P2S A;  4GVB A;  3KK2 A;  4GC7 A;  1JLQ A;  4RJV A;  3EDR B;  3UWT A;  2VU5 A;  1X4B A;  3CJ8 A;  3IBC B;  3WQP A;  3M30 B;  1PAU B;  4DV1 J;  2F9J A;  2ZBQ A;  1HQ2 A;  4AND A;  3N5F A;  4AT1 B;  4ES1 A;  2J7W A;  2GVZ A;  2BW2 A;  1GMW A;  3I31 A;  4CLY A;  2BW7 A;  4QOT A;  2JC1 A;  2OD6 A;  3BKU A;  1RCO B;  2DVI A;  4FYV B;  4YN3 B;  4U7C A;  3FKB A;  5CYM B;  4DV0 J;  4LF9 J;  3BGL A;  5KFV A;  2JNJ A;  4KGM A;  5DZ7 A;  2YXL A;  1X9S A;  2FB0 A;  4ECS A;  2HYI B;  2ATC B;  1O5J A;  3ZC4 A;  1M5S A;  4C48 A;  2MKS A;  3WC0 A;  3HT3 A;  8ATC B;  2EC0 A;  1H2T Z;  2LEC A;  1RU1 A;  2EVZ A;  3NNA A;  4MT1 A;  3U27 A;  1TV6 B;  3NEK A;  3R5J B;  4KH1 B;  3ZTQ A;  5J2M B;  5LMU F;  3W5X A;  1F3V A;  4LF7 F;  3LW5 C;  3PNI A;  4KJI A;  5EWF A;  5THW A;  1SH3 A;  1U6F A;  2CAD A;  2DHH A;  4YY3 F;  4I68 A;  3JQJ A;  1F9E B;  1BQN A;  4OI1 A;  2QYG A;  2IIH A;  3W3S A;  2O66 A;  3NNC A;  4E98 A;  5HP1 A;  2XNR A;  2U2F A;  2RB7 A;  2RQK A;  2DIV A;  1PG5 B;  2KFY A;  1DTT A;  4Q5V A;  1Z2Z A;  4NCG A;  2OPQ B;  1XEZ A;  2NPI A;  1YBU A;  4DOZ A;  2HRT A;  3D66 A;  3TUI C;  2AGQ A;  2C3Y A;  3BJY A;  2IDE A;  1X4H A;  4DL0 C;  3OVS A;  1ZPV A;  1NH8 A;  3BO2 A;  4EMD A;  4BWJ A;  3H90 A;  2NXJ A;  2CPD A;  5KFY A;  1RHQ B;  4F4A A;  3DXB A;  2FVP A;  4USV A;  3GTY X;  4UTG A;  2DR9 A;  4PKD B;  4F50 A;  2CA9 A;  2KHC A;  3MFI A;  1KFD A;  4PAA A;  2WBR A;  2EFQ A;  3LPY A;  2V4J A;  3KLG B;  1T9Y A;  4A8X A;  4X64 J;  4HT7 A;  1SB6 A;  1VDH A;  2UXB F;  2ZWP A;  2IBK A;  3BGR B;  2QTW A;  5D3G B;  1VBY A;  3GYG A;  1EHW A;  4ILM A;  3CME S;  3NRB A;  2CJK A;  3B4D A;  3NGD A;  4NLX A;  1TL1 B;  3ILO A;  5KFK A;  1Y5N B;  3EVO A;  4K4Y A;  3BPD A;  1VYA A;  1FWP A;  3CC4 S;  1SH2 A;  1JXV A;  4ZK7 M;  4QW9 A;  2V2Z A;  3POT A;  2OPS A;  1FDD A;  1P1T A;  2QA2 A;  3KLF B;  1L3V A;  4LF6 J;  3I56 S;  4UY8 T;  2HLT A;  4ZCM A;  1TK0 A;  3PW4 A;  7FDR A;  2X3D A;  1VQO S;  2YX1 A;  3PXG a;  3HLU A;  2GHV C;  1ZS6 A;  1CUL A;  3Q8R B;  3BF4 A;  3GJQ B;  2DCU B;  1Q8K A;  4RKU C;  4U95 A;  3I9V 9;  4B3T J;  1M5H A;  1XQI A;  1IBC B;  1XR7 A;  3T19 A;  5KFG A;  4LRF A;  4W98 A;  2RRN A;  2CVI A;  3MPD A;  3OTB A;  2CZ4 A;  5K20 B;  5C25 A;  4FBU A;  1DLO B;  3QZ7 A;  2VV5 A;  5E3R A;  1VRQ C;  2CYY A;  1GK8 A;  2N82 B;  1HQE A;  1S49 A;  3N28 A;  2CZV C;  2AEJ A;  1J5O B;  2EW9 A;  1FVS A;  3JTN A;  1NJI T;  1H38 A;  2H54 B;  4YB6 A;  5G0R A;  2KU7 A;  2R4F A;  4WXW A;  3FSI A;  4ECT A;  1YX2 A;  1REV A;  4JI4 F;  2F7V A;  1SJ1 A;  2V34 A;  4HT5 A;  3EVW A;  3G6Y A;  1LK5 A;  2W2P P;  3ILJ A;  5H9F J;  1T05 B;  3HHL C;  3IFE A;  2VON A;  4ED5 A;  2DIT A;  3CW2 C;  1UVJ A;  4F26 A;  2HAF A;  1UET A;  1UFW A;  1V5V A;  4KO0 B;  2AT1 B;  3QPI A;  3EZU A;  2WON A;  4XIU A;  4ZVH A;  3K0J A;  3MM8 A;  3VAK A;  1XNR F;  3EVM A;  1HBN B;  2VKZ G;  4M5D B;  3MD1 A;  4LIR A;  1YIJ S;  2DNK A;  2XS2 A;  2KKH A;  2E1A A;  3Q8Q B;  2I2Y A;  3VGS A;  4ZHR B;  1IKV B;  3MMB A;  1C2P A;  1Z1Z A;  2XMA A;  1X5T A;  4EO8 A;  3DYA A;  1JLF B;  4ZP6 A;  2ALY B;  3VAH A;  3IWX A;  3W8G A;  1R0B G;  4OI3 A;  1TKT A;  2HBR B;  2N7Y A;  2JSX A;  3B54 A;  1RJJ A;  4FYX B;  1KC8 T;  1GMU A;  4O4G B;  3HSD A;  3ENV A;  1T02 A;  4G1Q A;  2DHG A;  2ZBC A;  1IBM J;  2MQN A;  5K5M A;  2ACM A;  4IYQ A;  4CT8 A;  2XC9 A;  1N32 F;  3MMC B;  1WKJ A;  2C3M A;  4IOA Q;  2RS8 A;  2FVC A;  4J5O A;  4H4O B;  5FLX U;  2R8J A;  1W25 A;  1VHF A;  1OIA A;  3DDI A;  1OYD A;  3D1O A;  2DR8 A;  3NWR A;  2YQ3 A;  2H3E B;  1SIW B;  4P2M A;  4GKK F;  5LSL A;  5E3A A;  1VQS A;  2PI5 A;  5H9F K;  3H98 A;  5DS7 A;  1ROF A;  3AOA A;  2KL8 A;  3PVX A;  1P1L A;  5F9N A;  2ZZN A;  3I0R A;  3LPE A;  1SJ4 P;  3QLH A;  2LA4 A;  1PYS B;  2HNZ A;  3EGN A;  3EWG A;  2HAI A;  4C0O C;  4ECX A;  1RXO B;  3EYZ A;  1EP4 B;  1B7Y B;  4C11 A;  3RRK A;  2XMU A;  4OZL A;  3N4W A;  2XSJ A;  2UUA F;  4OMF G;  1UVM A;  5D4P A;  1H7X A;  4O23 A;  4UQG A;  4XAK A;  4IFV B;  5F0U A;  2B9W A;  3TP2 A;  3GJS B;  1YZ7 A;  2HFS A;  3RBZ A;  2DXE A;  3DM2 A;  4NWB A;  2B4U A;  1AT1 B;  1R8H A;  2VUG A;  2YKO A;  4I2P A;  5BXI A;  1RAG B;  3AFG A;  3ZZU A;  2EFP A;  1DUR A;  4C3L A;  2JZ5 A;  4KRW A;  3LP1 B;  1VK8 A;  4KHP F;  1NHK L;  1EAR A;  1S0V A;  2DNM A;  2UVW A;  1FEE A;  5EX0 A;  2R7U A;  4OJG A;  1TKX A;  2V5H G;  1VIS A;  3P8B B;  4DR4 J;  4UF4 A;  1KHV A;  1TU0 B;  2Z2Y B;  5BYR A;  3LUY A;  1AUD A;  2BV3 A;  2LA6 A;  1RU2 A;  3ET6 A;  2CWX A;  2F8E X;  2XMJ A;  3F44 A;  3MEE B;  3GIK A;  4A8W A;  3H2L A;  3CJK A;  1I94 F;  4DX5 A;  4UOC A;  2ZZT A;  1WEY A;  1FA0 A;  2P6T A;  3FK4 A;  3AT1 B;  1UA1 A;  2XHW A;  3BRE A;  2XMW A;  1NPR A;  2O1P A;  3NL0 A;  3PEH A;  3GB0 A;  2CQC A;  4KQZ A;  2ZJP Q;  1YSJ A;  2QE5 A;  4LSN A;  4IRK A;  4CP5 A;  3HD2 A;  5GMK a;  3CWJ A;  4B9L A;  1EZZ B;  2PC6 A;  2VPZ B;  2WVB A;  1NEE A;  4LFA J;  2R7V A;  5T7L B;  1X5P A;  2FZC B;  4QU6 A;  4ZVU B;  1TL5 A;  2VBY A;  4EGL A;  3PEJ A;  1YKW A;  3E01 B;  3RW6 A;  4TY8 A;  4K4W A;  3M6W A;  3NAH A;  1QM9 A;  2QLX A;  1SXL A;  4FYW B;  4LBI A;  2R7O A;  1H7W A;  1FNM A;  3MUT P;  4OYI A;  4N47 A;  4GKJ F;  1S9E A;  2VJU A;  3G6V A;  3G82 A;  1ZM9 A;  4IUF A;  5KAK A;  1QSS A;  2J0S D;  1FK9 B;  1IBL F;  1CQM A;  1RE1 B;  3WC2 A;  4I6W A;  1CJK B;  2I8E A;  2NYI A;  1HD1 A;  1U0H B;  4DU8 A;  2GMH A;  4FXD A;  4ECW A;  4KGV B;  3R2C J;  2G2Y A;  4LSZ B;  1Y9O A;  4R8U A;  2F40 A;  3MXH P;  4LRA A;  2IM1 A;  1CJT A;  3N0V A;  1F2G A;  2PA3 A;  3QQC D;  1KN6 A;  3DOK A;  3GV7 B;  2V2V A;  1HNZ F;  1HNI B;  2CQI A;  3I0S A;  1WI8 A;  4YHH F;  4L76 A;  2XYG B;  5F8N A;  1IN0 A;  3GV5 B;  2FY8 A;  2N4D A;  4Y28 C;  5HI7 A;  4AL6 A;  3TQ1 A;  4EWT A;  4PUO A;  1YLX A;  3QIP B;  2ZDO A;  4FP9 A;  1XNR J;  4CLL A;  2PMH A;  5A8R B;  3VGT A;  3CPW R;  1VK3 A;  2CPY A;  2AYM A;  2Y8W A;  3V6D A;  3FNN A;  5B0G A;  4HHJ A;  3MED A;  5CXT A;  4Y2I A;  1IJE B;  4QBU A;  5AJ3 J;  3IS9 B;  2M70 A;  5HBM B;  1V5I B;  1XR5 A;  3QGG A;  2P9C A;  3BGO P;  2MXY A;  2UVU A;  2C2K B;  2MGZ A;  2ROE A;  2LQB A;  4DQP A;  1W7W A;  4BBY A;  3CDU A;  3QGH A;  4USM A;  4M5H A;  2A1B A;  3UNY A;  5ETR A;  1VR6 A;  3N01 A;  3SCK E;  3US5 A;  4EFA C;  4ID8 A;  1WG4 A;  3D1Q A;  1D1U A;  4KFB B;  2MQM A;  1N32 J;  3PRD A;  2MY7 A;  1VC5 A;  1AB8 A;  3RJM B;  4CLP A;  4ECZ A;  3NGU A;  2C2D A;  4M5N A;  1YQH A;  2ATL A;  4RX6 A;  4RU2 A;  3LAM A;  4U6P A;  3F56 A;  3BM7 A;  2HHQ A;  1RWK B;  4NLU A;  3HHD A;  2AJ2 A;  2JFD A;  3MOZ A;  3V81 B;  4V1A k;  4IG0 A;  1FDN A;  5T41 A;  4DG1 A;  4MK9 A;  2NXU A;  2MQQ A;  4DR3 J;  1HAR A;  1IBK F;  2IMO A;  2HK2 A;  4U8V A;  4CLW A;  2A6O A;  4KIA A;  5KFW A;  4NRT A;  4K5R A;  3ZZO A;  5IV4 A;  1U26 A;  1ZTW A;  2Z4P A;  1Q8I A;  4JV5 J;  1C1C A;  3N6N A;  5LXR A;  2R7S A;  1BD6 A;  2VPX B;  1VRU B;  3C14 A;  2HFU A;  3PV8 A;  4C2M A;  4DV7 F;  3OSP A;  2UUA J;  1U1M A;  2RE1 A;  2AIR B;  4YOE A;  3DLE A;  2RJZ A;  1K0V A;  4OX8 A;  4IR9 A;  1TL4 A;  4WP3 A;  4FN5 A;  5CCM A;  1T8E A;  2E5J A;  2AKW B;  5B0E A;  1PYO B;  3R6G B;  3CCU S;  1CJV A;  2QEX S;  3FVY A;  2BKP A;  3PR4 A;  4OHW A;  4AL7 A;  3MUR P;  5KT2 A;  1JNR B;  1I1G A;  3SQG B;  1O8B A;  5ETQ A;  4E0D A;  2CNL B;  2J7K A;  4IG3 B;  4K4T A;  5D4L A;  4CLS A;  2HHT A;  2NXN A;  4WZM A;  3K2Y A;  3UD4 P;  1WWH A;  5BYS A;  5KFI A;  1LWF B;  1DJ0 A;  3IR5 B;  2M3D A;  1BWV A;  1RT2 A;  2IMW P;  1TL7 A;  4NI2 B;  1HMV B;  1I94 J;  5ETK A;  2NSB A;  4HHU A;  4RW6 A;  2C3O A;  4LIW A;  2W9C A;  2KVI A;  1Q86 T;  1VQK S;  3TRG A;  3MAA A;  1UZH A;  4U67 Q;  3CSK A;  1HI8 A;  2CUY A;  3CVK A;  1YJ7 A;  3CDE A;  1K47 A;  1DRZ A;  4RW4 A;  3DLB A;  1EET A;  2A18 A;  4C8L A;  3M2U A;  3PRV A;  4LFB F;  5B0A A;  5DM6 Q;  3VAM A;  2R8H A;  2HPU A;  1NK7 A;  2KJW A;  4F0K A;  1WC3 A;  3BS9 A;  2EPI A;  2E5I A;  2B9X A;  1FTR A;  3Q83 A;  4ELV A;  2AJ0 A;  1KBR A;  3WZ0 A;  1S4F A;  2K06 A;  2BR0 A;  3ENW A;  9RUB A;  3EXC X;  3UE2 A;  1HNW F;  3QO9 B;  2BX6 A;  1RYR A;  3CC7 S;  2FJX A;  2OPP A;  1BE4 A;  1VCT A;  3EGW B;  1NHV A;  1X0F A;  3SSS A;  4YR3 A;  2D41 A;  3MM5 A;  3W2W B;  3THP A;  2M2B A;  4DQR A;  5GME A;  1NHU A;  1WKL A;  2HBQ B;  3Q89 A;  3NAI A;  4DSL A;  3OXG A;  5I42 A;  3NNH A;  2VG6 B;  3HFZ B;  1T9W A;  3OQ2 A;  4F3O A;  3SBM A;  4TXS A;  4ZVS B;  2VH7 A;  1NJW A;  4J9Q A;  1GT8 A;  2QA4 S;  4NXN F;  5KTQ A;  1X0P A;  1MML A;  4XDC A;  1UAW A;  1S7H A;  2R3V A;  2HFN A;  2VIH A;  3OR1 B;  3UVJ B;  2JVO A;  4QR1 A;  4LQ3 A;  4FVC A;  2ZUG A;  4HEA 9;  4OIX A;  1XJW B;  3S7R A;  3MEG B;  3AOD A;  2GS8 A;  1KQK A;  3DRR A;  3GWC A;  4RBU A;  4MFB B;  3P5B P;  2OUG A;  1H73 A;  2B4O A;  1MW7 A;  1MMD A;  2YNH B;  4DR6 J;  5HLF B;  2QL9 B;  2BJ8 A;  2KG0 A;  4ES2 A;  4FNH A;  3I6P A;  3RB3 A;  1ITP A;  1FF2 A;  2MJU A;  4EBE A;  2LXF A;  4JYA F;  3Q2T C;  2ILY A;  4UQT A;  3TJ9 A;  1JJ2 R;  2HS0 A;  1N33 F;  2IM3 A;  2QN6 B;  2KXN B;  2GNK A;  1Q7Y T;  1XBW A;  2HHP A;  1RWW B;  2YVS A;  3WDO A;  4DPU A;  3AOC A;  4KC5 A;  2BE2 B;  3IBW A;  3M8P B;  3TA0 A;  5J2Q A;  3KTQ A;  3QWU A;  3S1T A;  1HWU A;  1MWY A;  3C6T B;  1S79 A;  4ERD A;  1YHQ S;  3TUP A;  2M4M A;  3CCQ S;  1SPB P;  3PZP A;  3B6B A;  4WIQ A;  2HBY B;  3VV2 B;  4E8U A;  4F4W A;  3RB4 A;  3ENQ A;  4FPI A;  3K17 A;  2VG5 A;  1IBK J;  1Q16 B;  4B9S A;  5IT4 A;  2EFO A;  4C8M A;  2MZS A;  4X65 F;  3DDN A;  2RUS A;  4X2B A;  3ICL A;  1TFY A;  4HR2 A;  4ZCI A;  1MN7 A;  1FKP B;  1NZA A;  3MR5 A;  1MN9 A;  1DTQ B;  2OH2 A;  2GW8 A;  4DX6 A;  3PIP Q;  4CH1 A;  3PY8 A;  2W8K A;  4J9R A;  4I4B A;  1S12 A;  4A4J A;  3RBD A;  3N6M A;  4DV7 J;  2EG2 A;  5AXK A;  2C2O B;  4O3P A;  3NCR A;  2OMO A;  3VGU A;  2EFG A;  2PFD A;  3NS7 B;  3M8Q A;  5DG7 A;  1DQ9 A;  1N5S A;  3T9Z A;  1FEH A;  4CLT A;  5KFC A;  3HI9 A;  4OZ3 A;  1U45 A;  1PC5 A;  2YNI A;  1U47 A;  2UVR A;  3FEY B;  5L1J A;  4ECR A;  1MNE A;  1VQ7 S;  1VQ6 S;  1K0T A;  1TZ0 A;  1U09 A;  3OFG A;  3ILI A;  2BM0 A;  3OV7 A;  5E3Q A;  1U2R A;  1TKZ B;  3DKD A;  2BAN B;  1KQS R;  2YKP A;  4FXW A;  2HVZ A;  3NBP B;  5H9E K;  2FHM A;  3GR1 A;  1RZM A;  4OYX A;  4KHR A;  3VQT A;  3FUY A;  1NPP A;  2O3D A;  3OTO J;  4ZLP A;  2DNZ A;  4DDF A;  1DFD A;  2CQB A;  1PIL A;  2H4W B;  1IKY B;  4DR2 J;  3RU0 A;  3R1L A;  2DPJ A;  3LP0 A;  3V2U C;  1ZOT A;  2R2R A;  2BEF A;  2ZHO A;  1X4C A;  3FCH A;  2W7O A;  2RHQ B;  3ZTR A;  1SBR A;  1JQG A;  4NCB A;  4CCH A;  1T03 A;  1VJW A;  1GAO A;  4W90 B;  1WOR A;  3A8K A;  2H9Z A;  3KJQ B;  4LF5 F;  4CYU A;  3UD3 P;  2ALZ A;  3GIL A;  3BKT A;  2HBZ B;  1RTI B;  1TUG B;  2OIH A;  4IQM A;  4ZLJ A;  2KXH A;  3DRP B;  2COL A;  4LFB J;  2CJX B;  2LXU A;  2BAC A;  4CNZ A;  2JL9 A;  5DM7 Q;  2Y0B B;  1FKA F;  2FVQ A;  4KTQ A;  2V4Q A;  1SCJ B;  4ZVE A;  4A48 A;  2D3O 1;  5E2Q A;  1BC6 A;  2D3O R;  2R2T A;  1WG5 A;  3LAL A;  2WOM B;  4GRS A;  2HVH A;  4DR7 J;  1N36 F;  2DRD A;  1X4G A;  2MKJ A;  3RAM A;  5CYM A;  1KKH A;  3H4D A;  1FJG J;  1VBZ A;  5C42 A;  4L74 A;  4U96 A;  2W4D A;  3K7R A;  1JKH A;  2DNL A;  4I7F A;  5K8P A;  4PPD A;  1X5S A;  3KK3 B;  3PRB A;  1AFJ A;  4G65 A;  4WKY A;  4GO7 X;  4PG4 A;  1RQ0 A;  3A3N B;  2BXJ A;  3AD9 C;  4LMZ A;  2PT0 A;  4KV8 B;  1JLA A;  4ILL A;  1N54 B;  4K5S A;  5EUH A;  2HZC A;  3I55 S;  2BRL A;  3QNW B;  3WHI A;  2JH3 A;  5K14 A;  3QSI A;  4K2J A;  4WTY A;  3JSR A;  2VBZ A;  3CUL A;  4N8O A;  3CCZ A;  4BCA A;  1RT3 B;  3M8Z A;  2UUC F;  1NKE A;  1OSD A;  1KEK A;  4B9M A;  3R1H A;  2BE9 B;  1N6Q B;  3SFU A;  2F5G A;  4M5K A;  3DMJ A;  4ZIW A;  1C0U B;  2AU0 A;  4X4R A;  4U7U D;  1G2E A;  2OLW A;  3TYT A;  2FD2 A;  4M8L A;  4FYD A;  3HJV A;  3P96 A;  4I69 A;  1RP5 A;  2B43 A;  4QYZ K;  3BKF A;  4BHQ A;  1FRJ A;  3V4M A;  1U6Z A;  1NH7 A;  3TWZ A;  2DGX A;  3W8P A;  4CO1 A;  1ZBT A;  2DNP A;  2I38 A;  2KYZ A;  4DL5 A;  3D0I E;  3SDE B;  2NZ4 A;  4DSI A;  3OUY A;  1NZ8 A;  1HFE L;  3PR5 B;  1PAE X;  3I5B A;  3M9O B;  1N5Y A;  5C2G A;  1FTC A;  4DUZ F;  5IQ6 A;  4YEA A;  3HX9 A;  3CJ3 A;  4YQW A;  2GO8 A;  3GJT B;  4ZCL A;  3DI6 A;  1N33 J;  5C7P A;  3V6J A;  4TU7 A;  2AJ4 A;  3VHQ A;  4EBC A;  4RUH A;  5ETL A;  1UKU A;  2H5I B;  4BWM A;  4KGK A;  3KLG A;  2NLW A;  4G1I A;  4CTA A;  2ADB A;  1YRU A;  2CQ1 A;  3UQS A;  1M5V C;  3CCS S;  3THV A;  4LUB A;  4YDX A;  3QGI A;  3TAM A;  3O1L A;  3BGR A;  3V6K A;  1Y3J A;  1PGZ A;  2VFT A;  3CB4 A;  2F9D A;  3A8E A;  4ZVQ B;  3K5N A;  2QC3 A;  1TL1 A;  1VQY A;  4YR0 A;  4IRC A;  3C15 A;  5CQG A;  2OPR B;  2XS7 A;  2MLZ A;  3MPU B;  3H5S A;  2N4C A;  3KLF A;  5JVG Q;  1YG0 A;  3T6J A;  2HND B;  2GIQ A;  5FDL B;  4X4Q A;  1I51 B;  2OHD A;  3IN5 A;  1O51 A;  3T1A A;  4USU A;  1S1X B;  4U9R A;  3PFE A;  4LRC A;  2AWZ A;  4WCE Q;  5C5J A;  5CD4 H;  1R6Y A;  2F4F A;  3PM9 A;  5B0D A;  4QQB A;  3UR3 C;  4B9T A;  3LGM A;  2WSE C;  4EO6 A;  1R31 A;  2E7X A;  3MCM A;  3BDE A;  2OSR A;  4ES3 A;  2YNG B;  1WC4 A;  1RAO A;  5GAH U;  3KG0 A;  4Y00 A;  5L9X A;  3BO3 A;  2VG7 A;  1HLW A;  2FHO B;  4KT0 C;  2PEB A;  2V8H A;  4F4X A;  2D3U A;  5IM0 B;  2MKK A;  3OL9 A;  2LLZ A;  4QWA A;  3VVT A;  2UXD F;  5IC6 B;  4O4R A;  1QUV A;  4L3K A;  2BOA A;  2WRM A;  2VDH A;  1OQ3 A;  4RWX A;  1GFW B;  4KO0 A;  4EZ6 A;  2CWK A;  1JJ4 A;  4YB1 P;  1Q1K A;  3MZI A;  2L48 A;  1R0C B;  2ZFH A;  5KT6 A;  3OBI A;  1N88 A;  1R0A B;  1NBE B;  1HBN A;  5F8L A;  3P5T L;  3KJV B;  3LWL A;  2XY7 A;  1Q4R A;  2VFV A;  2GZO A;  2FLL A;  4DCP B;  3HVA A;  3IXQ A;  1IKV A;  3CD0 A;  4DV3 F;  5A8W B;  3A12 A;  4C4W A;  5DET A;  3QMQ A;  4GMK A;  3VAF A;  2RRA A;  4PEO A;  1JLF A;  3CC2 S;  2GVD B;  1VJQ A;  3TQE A;  5L38 A;  5J1E B;  2RQC A;  3EE3 A;  1SL0 A;  4K59 A;  2CPJ A;  2XI2 A;  3R5A A;  4C8K A;  3QT7 A;  2HQI A;  2FLO A;  2RQM A;  3TEH B;  2Y1R I;  3EJM A;  3MMC A;  3H25 A;  1FFS B;  2W25 A;  2SXL A;  1X31 C;  2A2D A;  2E29 A;  2BQ3 A;  5KG7 A;  2MST A;  4X4S A;  3IGN A;  1TMJ A;  1U4B A;  1FJ7 A;  2GQQ A;  2YNF B;  3TZW A;  2KT2 A;  2ZWO A;  1YJV A;  2IBO A;  3MPV A;  2DB1 A;  4DSK A;  3ITH B;  3IR6 B;  4JI2 J;  2YQ0 A;  4JI5 J;  2HQC A;  3U1L A;  3IWN C;  3TR5 A;  5H1S V;  2UUC J;  1G7C B;  5BR8 J;  2QRR A;  4Y34 A;  2CXE A;  3HZE A;  3OL8 A;  3ZNU A;  3FBC A;  1B3T A;  1UVL A;  4JI7 F;  3R3T A;  4OYZ A;  1Q8B A;  5DLG A;  2A0F B;  4CLZ A;  3M6U A;  3UW1 A;  2DY1 A;  1ACM B;  2E9R X;  2G1D A;  1BMQ B;  1IKX B;  3W9I A;  4B3M J;  1HWJ A;  2L9D A;  4N77 A;  2E1C A;  2QL7 B;  1JLC B;  1ZZN A;  2GC8 A;  2AYE A;  1D8Y A;  5DLF A;  1WI6 A;  4NLR A;  2PSZ A;  1LW0 B;  1X7V A;  4C8O A;  4O3R A;  2J76 E;  2I5J B;  4DFK A;  2GJF A;  1F5C A;  2L08 A;  4K0K F;  4ETZ A;  3TUZ C;  4Y2K A;  5E7O B;  3SZ2 A;  2G9O A;  2V6A A;  1RT1 A;  1BQX A;  4X66 F;  3BBB A;  1VQM S;  4NLG A;  1KOO A;  3R27 A;  2Y3Y A;  2WW8 A;  1WDD A;  1T3O A;  5L46 A;  2X1G A;  1KVJ A;  2YKM A;  1Z2L A;  3NS5 A;  4KPC A;  2KZM A;  1C0T B;  2JEJ A;  4NLD A;  1KLM B;  2ZM6 J;  1T9U A;  5IV3 A;  4B3S F;  3N6L A;  2YKN B;  4RWW A;  4FDF A;  4OZ5 A;  1AZS B;  4L3N A;  4UY8 5;  3M32 A;  3CCE S;  3JSM A;  4ID5 A;  5J2N A;  1VQP S;  5C24 B;  4NA2 A;  2LFV A;  5A2Q Y;  1D8Z A;  3BB5 A;  1RI7 A;  1CJU A;  1JLE B;  3EPG A;  2Y1L B;  4TVA B;  2RU9 A;  5DZ6 A;  3MTK A;  2DNN A;  4ZOS A;  3OHA A;  5GAG U;  4NLY A;  3R2D J;  1LWE B;  2BJE A;  2RAQ A;  2GAG C;  3TZY A;  2BJ1 A;  1Q8L A;  4IKA A;  2GML A;  2EKY A;  4Q8F A;  4JB8 B;  3CJS A;  3V4I B;  4CRJ A;  3I32 A;  4BLG A;  3TI0 A;  3DLH A;  2UU9 F;  3KLE A;  4DUY F;  4P10 A;  3VAL A;  4DS4 A;  1NK8 A;  3PYE A;  2RDI A;  3AJD A;  3VZH A;  4V19 J;  4ZP7 A;  3DRS A;  2FGO A;  1XMQ F;  5B0F A;  2HMI A;  1MU2 B;  3FFI B;  5A0Y B;  2ZE2 A;  3C2P A;  2G0J A;  4HI2 A;  4ZPB A;  1JXE A;  1U0H A;  4DCJ B;  3C6U B;  3CD6 S;  3G4S S;  2BMB A;  4HTI A;  4GO5 X;  4I0W A;  1CS4 A;  4IDK B;  3DN9 A;  1DBD A;  4OI4 A;  3JYT B;  1HNI A;  4NL5 A;  2C3P A;  5KG4 A;  3U7J A;  2DJW A;  4PQU B;  1AW0 A;  2RF2 B;  1MSW D;  4NYO A;  2V63 A;  4B17 A;  1YJT A;  2BA9 A;  2XBP A;  3K5L A;  3R5C A;  4HH0 A;  2XZT B;  2H5E A;  1Y4Z B;  2F8M A;  1N8R T;  5KG1 A;  2O01 C;  4DSF A;  4WPA A;  5A8R A;  3CCV S;  4UST A;  4F0H A;  4JI1 F;  4DSE A;  3O44 A;  1WEX A;  1HBM B;  4G1P A;  3MUM P;  2GX8 A;  3HPO A;  4B02 A;  2N7C A;  3DLL Q;  1QJH A;  2QYC A;  3OHB A;  1U1Q A;  2JFK A;  4DV2 J;  3WX4 A;  3T1Y J;  2BRK A;  3DRY A;  1NUE A;  2QA1 A;  3VCD A;  1BLU A;  4X62 F;  4MKB A;  2BJ3 A;  1HI1 A;  4JV0 A;  1WF1 A;  2J7U A;  2MLX A;  2HHX A;  3M1V B;  3F41 A;  4ED1 A;  3H0P A;  4RL1 A;  2CQ0 A;  4I2Q B;  1XMO F;  4WK3 A;  2XO6 A;  1SC1 B;  1YBA A;  2DEJ A;  2YQ1 A;  2CFX A;  2E1P A;  1BXN A;  4GVB B;  2EBE A;  1JLG A;  3CUN A;  2XG8 A;  2YWE A;  3TZZ A;  4QCL A;  1JJC B;  3V81 A;  4LR9 A;  1N5V A;  3TVZ A;  3MF5 A;  2MSS A;  1U49 A;  4F3M A;  4JI6 J;  3LP2 B;  1RBO B;  2AEF A;  1LWX A;  3GYN A;  2KVQ E;  1URR A;  2JLE A;  1RWO B;  3FBE A;  4NA3 A;  1YJU A;  4WKR A;  1X4D A;  1Y11 A;  2IYI A;  2W2O P;  3GP9 A;  1VRU A;  3KK1 A;  5KFR A;  4QWC A;  5LOQ A;  9ATC B;  1WJ9 A;  4FF1 A;  2M7S A;  2B4V A;  4DL4 A;  2CJB A;  2X51 A;  3SSR A;  3OL7 A;  4YFU A;  3QRQ A;  2VZ9 A;  3I5A A;  1N56 A;  2E5G A;  4DFJ A;  3R9L A;  2R9L A;  5HJX A;  5HVH A;  3AH6 A;  2V8V A;  2OKQ A;  4Y2M A;  3VAJ A;  4LF2 A;  2HGN A;  5KFB A;  4ICL A;  4XK8 C;  2WVF A;  3PKY A;  2E7W A;  2ZBP A;  1RGV A;  3W66 A;  1QTN B;  3VF0 B;  1IXK A;  3PHT A;  4RW8 B;  4WFB Q;  2HGL A;  2DGV A;  5I4M A;  4NYZ A;  3PIO Q;  3LWM A;  5AXM A;  3BSN A;  3SQG A;  1OS5 A;  5HP1 B;  1RHU B;  1OSC A;  3G86 A;  4NCA A;  3RBE A;  4B08 A;  5E5N A;  4A8Q A;  2W1B A;  2BZ2 A;  1AYE A;  3OW2 R;  1DTT B;  1IQT A;  3OT9 A;  4J91 A;  2MY8 A;  3G96 A;  3NKY A;  2XWX A;  4NLQ A;  3R5B A;  3T1H F;  4C9D A;  2HIQ A;  4NCG B;  4UZB A;  2VHG A;  4WE1 B;  2DT9 A;  1YJR A;  1HMV A;  1YRX A;  5CH7 B;  4PWU A;  1UEK A;  2DGT A;  1T11 A;  3MD3 A;  1HBU A;  4PXE A;  2PMW A;  1DQA A;  4KGX B;  4OI6 A;  1UEU A;  4B3S J;  3JB9 k;  3H5Y A;  2CQ4 A;  1CSJ A;  2FTR A;  4JV1 A;  3BN4 A;  3J7Z 5;  1VOM A;  2MTL A;  2VQE F;  4FF4 A;  1N34 J;  2EEY A;  3MOJ B;  1K73 T;  2RS2 A;  4YB5 A;  5KG5 A;  3KJF B;  5IC4 B;  2OO4 A;  3S01 A;  1VC6 A;  1UWA A;  5KFM A;  2ZVI A;  4OLO A;  2ZH3 A;  4DV4 F;  1YRT A;  4QWD A;  1QVG R;  3HUL A;  4O44 B;  3L09 A;  1URN A;  2A10 A;  5IT9 Y;  3IM9 A;  3O8W A;  3PO5 A;  4B3R F;  3Q22 A;  2Z30 B;  1H2U X;  2B56 A;  3OTC A;  4OYB A;  1UJ4 A;  2NQP A;  1WEL A;  2HSE B;  1EJ7 L;  1BQM A;  1P6T A;  4JI3 F;  3HHK A;  1NJX A;  3FBB A;  1WOS A;  1OMS A;  3AB2 B;  2LU1 A;  2OPS B;  2DD8 S;  3BH6 B;  1RT4 A;  3H5X A;  2LEB A;  2Q6B A;  2M9K A;  2NUU G;  3W2W A;  1XMQ J;  3W2V B;  3ZZ0 A;  2B5J A;  1F60 B;  2JX2 A;  3M2V A;  1CUL B;  3M6V A;  5LSR A;  5L1L A;  4QIG A;  1MRO A;  2DR6 A;  3ADA C;  1AXQ A;  2RML A;  1OWX A;  3CJ5 A;  4OJ1 A;  1GXT A;  4YUD A;  4DL7 A;  4ZVT B;  1SJ3 P;  5C25 B;  4OHY A;  3JQK A;  1FX2 A;  4URG A;  3MPY A;  2EWH A;  2UV8 G;  1HQE B;  2IC3 B;  2NRE A;  3OR1 A;  3D28 A;  1M0S A;  2RIL A;  2P9E A;  1T3N A;  1REV B;  1T7P A;  4OJH A;  3VAG A;  2FC8 A;  2YNH A;  1KLN A;  1S10 A;  5HLF A;  4A8Y A;  2E1R A;  2M5Y A;  2DGU A;  5CD4 A;  3QRP A;  5FII A;  4S0M A;  1HR0 J;  3J81 j;  2OEJ A;  3CD7 A;  4WFX A;  5DRK A;  3AXK A;  4ATN A;  1RTH A;  4Z7C A;  5D0E A;  3QT8 A;  4UUW A;  4RW9 A;  1SQE A;  1ULR A;  5KFA A;  5DGA A;  2W7A A;  2GV1 A;  3D2W A;  1A7G E;  4FS2 A;  4TKT A;  1XMO J;  1AA1 B;  2X7I A;  3MMB B;  2ZHA A;  4DCO B;  1B99 A;  2WAQ D;  4DPX A;  1JMT A;  3HK2 A;  3DYA B;  1NSP A;  1HNX J;  3M05 A;  5GAD U;  3PYG A;  4OHZ A;  2ZC4 A;  3GIR A;  3JSY A;  3C6T A;  4CLK A;  1TKT B;  1Y10 A;  4O0N A;  1QUP A;  1U7L A;  2B8P A;  2AHO B;  1YTY A;  1ICE B;  2LKZ A;  3UDV A;  1BHN A;  3RR8 A;  1SKW A;  4NLV A;  4WXO A;  1TK8 A;  5DDR C;  4DI6 A;  2L41 A;  3BSC A;  4G1Q B;  2Y1I A;  4NLP A;  2ZH4 A;  2DBB A;  3WBZ A;  3NG8 A;  4W92 B;  3FQL A;  1SQF A;  3HKZ D;  5JMN A;  5IT0 A;  4J9M A;  4F3Q A;  3QBC A;  2QG9 B;  2QMU B;  1RAA B;  2FIU A;  3UPF A;  3MHY A;  2WB1 D;  4C8N A;  1BWE A;  3G9C A;  3SCL E;  2GQC A;  1Q82 T;  3IRX A;  2AGP A;  2HFO A;  3NP5 A;  4R0J A;  2MMY A;  2HG4 A;  2NXE A;  1OYE A;  4P9S A;  3R7S B;  1V3S A;  1QLN A;  2DNR A;  4WYL A;  3A8J A;  2G2Z A;  3MMA B;  2NS1 B;  1S48 A;  4DV5 F;  1WNE A;  2C2R A;  4NXM J;  5EWE A;  4IOB A;  2BJ7 A;  3I0R B;  3M8Y A;  3QFW A;  2XO7 A;  1UW4 A;  3QLH B;  5F8J A;  3D6H B;  1WTF A;  2ZNY A;  2F4V J;  4ZVP B;  1KR4 A;  3NY0 A;  3R5G A;  4Q2L A;  4L73 A;  1DAX A;  4LVO P;  2W8L A;  4M5M A;  4C11 B;  1R89 A;  4XO0 A;  2H5J B;  4N5S A;  1XC9 A;  2XSJ B;  2HRY A;  3ILL A;  3CJ2 A;  1IM6 A;  4LQ9 A;  2CVE A;  2FJW A;  3HCX A;  2E5H A;  4DUT A;  3K59 A;  3T1H J;  2W7P A;  5IWA J;  3DM2 B;  2YWW A;  1JXL A;  2X1F A;  2W01 A;  4I2P B;  4BS2 A;  2ILZ A;  2XWY A;  3CCT A;  3BZQ A;  2V94 A;  1WOP A;  5M2R A;  1SC3 B;  1WSR A;  4ENO A;  2Z56 B;  2FY1 A;  3HHL D;  1A6L A;  1LKZ A;  3IP0 A;  1S97 A;  2ZVS A;  3QRR A;  2OJ3 A;  1R8B A;  3DCA A;  1RHM B;  4B9U A;  1S1U B;  2ZDP A;  1FX4 A;  2L9N A;  3W63 A;  3FQK A;  1TAU A;  3CJR A;  3ET6 B;  3BO4 A;  4LF8 J;  3GE9 A;  3X3U A;  2K3K A;  3CJK B;  5D8H B;  1A9N B;  2HNY B;  3JTO A;  3TVY A;  4X4T A;  5IXU A;  4N7T A;  5M2P A;  4LF4 J;  3FRY A;  3RBX A;  1HQU A;  1QE1 A;  1TAQ A;  3MEC B;  3RTV A;  4LSL A;  1LW2 B;  2XQC A;  5GAE I;  4DXL A;  5HAT A;  2FJV A;  1M5O C;  2FHJ D;  4PAB A;  1HNV A;  5HL7 Q;  2WBM A;  2DIS A;  4JI0 J;  4F0M A;  2Q79 A;  4USJ C;  5FJ4 A;  2JRS A;  3UR0 A;  4EU0 A;  4B9V A;  3R7N B;  4TU8 A;  2JJ4 D;  4HTJ A;  3P3D A;  1Y7P A;  1A0O B;  4WZQ A;  4TY8 B;  4L75 A;  1NK6 A;  3C66 A;  3CNQ P;  2MQL A;  3A3P B;  4KGZ B;  4PZV A;  2LQ9 A;  4EYH B;  1T9T A;  2CQH A;  4ZP8 A;  1U1K A; 
#chains in the Genus database with same CATH homology
 3NGR A;  1NHK L;  1UCN A;  2AZ1 A;  3B6B A;  3DKD A;  1NDK A;  1ZS6 A;  3FBF A;  3BBF A;  4F4A A;  1NPK A;  1PKU A;  3EM1 A;  5IOL A;  1HLW A;  3Q83 A;  3Q86 A;  2DYA A;  1BUX A;  1KDN A;  2HVE A;  3L7U A;  3NGS A;  3EJM A;  2HVD A;  4ANE A;  3R9L A;  1NSK L;  3VGT A;  3Q8Y A;  3ZTQ A;  4EK2 A;  3EVM A;  4HR2 A;  1MN7 A;  1B99 A;  2DXF A;  2ZUA A;  2HUR A;  2BX6 A;  4UOG A;  4F36 A;  1XQI A;  1NSP A;  1NLK L;  3VVT A;  3VGS A;  1NCL A;  1PAE X;  2AZ3 A;  4FKX A;  1WKK A;  3EMT A;  1HHQ A;  4W98 A;  4UOH A;  3GPA A;  1BE4 A;  1MN9 A;  3ZTO A;  3VGV A;  1NDC A;  3MPD A;  1S57 A;  2DY9 A;  4O0N A;  2B8P A;  3EIC A;  3Q8V A;  2BEF A;  2NCK L;  1BHN A;  1XIQ A;  2CWK A;  3NGT A;  1F6T A;  2VU5 A;  3FC9 A;  5C7P A;  3BBB A;  4DI6 A;  3B54 A;  3ZTR A;  1NDP A;  1WKL A;  4ANC A;  3BBC A;  3Q89 A;  3FBB A;  1LWX A;  4FKY A;  1W7W A;  3VGU A;  1NB2 A;  3PJ9 A;  3FCW A;  1EHW A;  4DUT A;  3Q8U A;  4CP5 A;  4AND A;  1S59 A;  2B8Q A;  3ELH A;  3ETM A;  1HIY A;  4UOF A;  3ENA A;  3G2X A;  3BH7 B;  3FBE A;  3BH6 B;  4KPC A;  3WX8 A;  3EVO A;  3FCV A;  1LEO A;  1NSQ A;  1VYA A;  3EVW A;  1B4S A;  3FKB A;  3ZTS A;  3FBC A;  1WKJ A;  1JXV A;  4DZ6 A;  3PRV A;  2DXE A;  1K44 A;  3NGU A;  4S0M A;  4WBF A;  3GP9 A;  4ENO A;  1NUE A;  5BXI A;  1S5Z A;  2DXD A;  3JS9 A;  3ZTP A;  1NDL A;  1F3F A;  5CAB A;  4C6A A;  1U8W A;  3DDI A;  5CAA A;  3EE3 A;  3VVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...