5CABA

Structure of leishmania nucleoside diphostate kinase mutant del5-cterm
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
139
structure length
139
Chain Sequence
MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of the C-terminus and Kpn loop in the quaternary structure stability of nucleoside diphosphate kinase from Leishmania parasites.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 41
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 5cabA00
3ENAA 1NB2A 2HVEA 3ZTPA 3GP9A 1B99A 1NSQA 5BXIA 4ANEA 1JXVA 1B4SA 4UOHA 1LWXA 1BE4A 1NSKL 1UCNA 2DXDA 4W98A 2AZ1A 3BH7B 2HURA 3VGTA 2DY9A 3ZTQA 3NGUA 1S57A 4HR2A 1NLKL 1NHKL 3BH6B 1MN7A 2BEFA 1WKKA 3EVWA 1BHNA 1U8WA 2DXEA 5CABA 3NGTA 1S5ZA 1NDPA 3NGSA 3R9LA 4F36A 3EICA 1ZS6A 2AZ3A 4DZ6A 3EVOA 5C7PA 2NCKL 1VYAA 4WBFA 3DKDA 3VVUA 1MN9A 4ANCA 3EVMA 1NDCA 3BBFA 1LEOA 4EK2A 1NCLA 1EHWA 3FC9A 1HIYA 1WKJA 3Q89A 4DI6A 5CAAA 1KDNA 1S59A 4ANDA 3VGUA 2B8PA 1K44A 2VU5A 3B54A 3DDIA 4DUTA 1NPKA 1W7WA 1PAEX 2DYAA 3EE3A 3EMTA 1HLWA 3ZTOA 3Q83A 3BBBA 3ELHA 3ETMA 1PKUA 3Q8YA 2CWKA 4FKYA 2B8QA 3VGSA 3Q8UA 1NUEA 3B6BA 3EJMA 3FBEA 1NDLA 3ZTRA 3JS9A 4ENOA 3VGVA 4O0NA 3FCWA 4UOGA 2DXFA 3FBFA 1WKLA 2ZUAA 3FBCA 4UOFA 3L7UA 4KPCA 1F6TA 3MPDA 1XQIA 3NGRA 3PJ9A 3FBBA 4CP5A 1NSPA 3G2XA 1F3FA 3EM1A 3ZTSA 4S0MA 1HHQA 1XIQA 3Q86A 5IOLA 3FKBA 2BX6A 3Q8VA 4C6AA 2HVDA 4F4AA 3BBCA 1BUXA 3FCVA 4FKXA 3PRVA 1NDKA 3GPAA 3VVTA 3WX8A
chains in the Genus database with same CATH superfamily
2KDOA 4WIIA 1VS3A 1VQPS 3RW7A 4J9OA 2ZE2B 4A46A 2MGZB 3U1MA 1C4AA 2HNYA 2FZCB 1JLAB 5KFVA 2HHQA 3CD0A 1YZ6A 4YY3F 1SVDA 4QR0A 4R25A 1VQNS 1WC0A 3AA9A 5D4OA 3G71S 2E5LJ 4RKUC 1YDLA 2HWTA 2CXEA 3B4DA 4X4TA 1HMVB 3CIMA 4H4MB 2OH2A 3OL9A 4OI2A 4CDIA 2UUBJ 1RHRB 2AJQA 4NYPA 2V8GA 1VGYA 2DXEA 2E9RX 3C6UA 3CEDA 1NJWA 1C4CA 1FNOA 2PE8A 2HWIA 2J0SD 1JLGB 1CJTB 2OD4A 1J27A 3CGIA 3IM8A 4RL1A 3ZZPA 3DU5A 4W90B 2AJ0A 1WJ9A 4ED5A 3ZZ0A 5KG1A 1VHFA 1GTEA 3DKDA 4K0KJ 4NLTA 2K3KA 1NEEA 1YRXA 2FHJA 4ZJLA 3WIVA 2DGTA 1U2RA 1W25A 4UW2A 3QT7A 4ZN3A 4RU9A 4TQRA 1N36F 2Q6CA 2HHWA 2YKNA 3AQPA 1HW8A 4K7QA 3KUGA 4ZVFA 5KFLA 2R2UA 2FVCA 1TUWA 2Z2ZA 2G9OA 1RLCL 2RVJA 1KFDA 2YH0A 4HVZA 5I3PA 4Z7CA 5KG7A 5C42B 3R5JB 2EC2A 1NKBA 1HIYA 1HNXJ 3ULHA 4JI2F 3DLGA 5CAAA 4LRFA 4DQQA 1WUUA 1JLCA 1E6YB 4I68A 1QD1A 5HVHA 1U09A 2H9ZA 3B54A 3PYGA 2EBGA 4G6VB 4I7FB 2M88A 3PXGa 4UOCA 1R8HA 1N48A 3M6UA 4JI8F 3UO0A 3BYRA 4DL0C 2EKNA 4F2SA 1FJGJ 1HQEA 4DFPA 4X4UA 1BWVA 1HLWA 1CSJA 2XYPB 4ZPTR 4CRJA 4DF4A 1EARA 2F63A 1V9OA 3BGRA 3OVBA 3IRXA 3G6YA 1VK3A 2CIMA 2QA4S 1IKWB 3ZZZA 4P52A 5A8KA 2MKKA 4E0DA 3FDSA 4RW4B 3NNHA 1PKUA 5KFCA 2C3MA 4R5PB 4EYHB 1LXJA 4F50A 4DR6J 3H20A 4PG4A 4ZK7M 2CPEA 4U67Q 1YI2S 2NYIA 1YJVA 2CZ4A 2UUBF 3QATA 2KN4A 1QTMA 5G0RB 4WZQA 3D3CJ 2ERRA 4V19J 2VONA 3FBEA 3FQLA 2IM1A 2CG8A 1X9WA 3J7AN 4FDFA 1WC4A 1S48A 1Q0NA 3M9OB 6FDRA 4USIA 2IMWP 1ELOA 3ILJA 4P6QA 3J7A1 3R97A 1AFIA 3FZ2A 3U1NA 4C3KA 2DHHA 4MIAA 1MW7A 3NGRA 2D9OA 3IAM9 4O3PA 1PJ5A 1TFWA 3G8SA 3MCOA 3DRYA 3SFGA 5A8RA 1NM2A 3N01A 1FESA 1TKXB 3QQCD 3QWUA 3HSJA 1N5YB 1GAOA 2J8SA 1WF2A 2QMWA 3HT3A 2GMLA 1P8GA 3AAWB 3GQCA 1L3VA 3MOZA 4DCJB 2HBYB 4E98A 4IRCA 2MSSA 4LFCF 3OVAA 4KT0C 3JAMU 3KTQA 3CW2C 2VOPA 2HYIB 1VBYA 5LMNJ 2HQDA 2BX6A 2ZOGA 5DQGA 2A18A 1Q5VA 4YP3A 3KMSA 4JI6J 4DLGA 3T5HA 4RNOA 2ZH3A 5ETQA 3V6KA 1R8PA 2DR7A 2ZJQQ 4NPOA 2IYIA 2HHVA 1SIZA 3HVAA 4CLKA 2I5JA 1Y10A 2VG7B 4QPXA 2OO4A 2ROEA 2DH9A 1RT5A 2XYGB 2Y0SD 3MZIA 4CIOA 3PW4A 2C2RA 2KTQA 1ZAVA 4QIFA 4Q45A 4EBDA 4OZ5A 3DXBA 3VZHA 1PJ7A 2P9GA 3QGIA 5HO4A 1TUVA 2GO8A 2W2QP 3KLHB 3D1HA 2AYEA 4NX9A 1GT8A 2ZZNA 1AFJA 3MD1A 2CJAA 4WE1A 2QFJA 2XB2D 1YBAA 3I0SB 2H54B 2ZBIA 1BE4A 1UCNA 2X1AA 1KTVA 1S9GA 3PDNA 2E7WA 4M5JA 2DNYA 3KUHA 4DJBA 2W9AA 2C22A 2RKIA 4AXIA 1T11A 4ID5A 3C46A 2OPSA 1ZTTA 1JIHA 3RAQA 1OY9A 5KFHA 2BACA 3SQGB 5J2NA 1RTZA 2NXCA 1PC4A 4AFFA 4NXMF 1U2FA 3BH6B 4M5HA 1S6PA 5LSLA 4KHRA 4PG5A 1CC8A 4OZLA 4IH7A 1T03B 4B3TF 1VLYA 3GIIA 1FKPA 1RT3B 4RW6A 3OLBA 3EVOA 4J9KA 2GV1A 2AD9A 3FMBA 4K4XA 2SXLA 1D9FA 1YTYA 3CCTA 3LGNA 2IM2A 1S1UA 2KRBA 3TANA 1UTAA 4WFNQ 2DNGA 3H0PA 2JOQA 1LW0A 1UP1A 1PBAA 1RXOB 2DR6A 4YB5A 1MWYA 1UEUA 2O1PA 2PGCA 3EVMA 3GV5B 1VQ7S 4F3OA 3MMCB 3P6YC 4FVMA 3W5XA 2E9TA 1O5JA 2KT5A 3IR5B 1EHWA 2B6AA 4OYXA 4R0JA 4DV0F 1NJZA 2R42A 3HZEA 1AUDA 2A10A 3PW7A 2ASDA 1WTBA 2L48A 3LPYA 1MU2B 2VFTA 3DRSA 1I6JA 2LQ5A 2B9XA 4IQXA 3KLVA 4A8WA 1SQEA 3AXMA 4I6WA 1NH8A 1D8YA 4NMXA 5L38A 4Y2KA 1L3TA 3ZZTA 1T03A 1M90T 3HDSA 3IO1A 1G7CB 1WDDA 2M52A 2ZNYA 2KG0A 2RQMA 2C2DA 1NK5A 2XMVA 3C66A 4HEA9 1RTJA 2GS8A 2H4YB 4B9UA 3QJPA 4RBTA 2DHGA 4WK1A 4K4SA 1ZM9A 4OIXA 4OJGA 1R8CA 4ECSA 3ZNJ1 4IG0B 2ZVIA 4OI0A 2GJFA 2C2MB 2LKZA 3RRGA 4ILLA 2GHWA 3EDRB 2JSXA 4D3HA 1JLBA 3VGSA 3HM9A 1QTNB 3W9JA 4LF6J 2HMIA 2DR5A 4Q8EA 4NMLA 3ZC4A 5I4MA 3OSNA 1CJTA 3PEJA 1NDLA 1FWKA 1IXKA 4O44A 5BYRA 1E6VA 2BM1A 4QCLA 5KFQA 1VBZA 1RAGB 4OI3A 5DZ6A 1VQ4S 1DRZA 1UW9A 1U8SA 4DEZA 4DV4J 2W2PP 3CC7S 3GSIA 3HO1A 1S6OA 3CCUS 3MUVP 3ILOA 1TZ0A 3BO3A 4PXBA 2YWGA 4DSKA 2EWHA 2R2RA 3SDEB 4N47A 4DS4A 1Z4UA 1I94J 1JLFA 2Y1LB 3G82A 1I51B 4C97A 1PG5B 1UVKA 4BLGA 4JI2J 3O5TB 3T5JA 2X1GA 2ZH5A 3C6UB 4PZVA 4PR6A 3SCIE 3EZ5A 3Q2TC 5F8JA 4G3IA 2XHCA 4HTJA 4TNOA 4WYWA 1OPZA 3B4MA 2OPPA 1RT6A 1T0TV 1FTCA 2YNFA 1YLXA 3J7YI 2F40A 3HLUA 3JSBA 5B0AA 3S1TA 4M5NA 4LF2A 2YWWA 4ZKAA 5F8LA 2R8JA 2MY7A 4J9SA 4ZOSA 2YKNB 2PD1A 3UDLA 1KEKA 3HKWA 5GMKa 2OTJS 4K4WA 1SIWB 2D3O1 4GVLA 4IYQA 2EFNA 5GAEU 4P2MA 2EFPA 3WBZA 4QYRA 5HLFB 1S0OA 4DHVA 4U7UD 1WTFA 4TY9A 3DOKB 4RW9A 2PDAA 4USMA 5G0RA 2YPZA 4EMDA 5L46A 1FRHA 4Q2MA 4XO0A 1NSQA 5F0UA 2MJNA 4KKOA 3OXFA 2W9CA 4UOHA 1K73T 2B9WA 3T3FA 2N3LA 3TR5A 4RW8B 4W98A 1TK5A 4K5SA 1QDUB 2QLJB 1EJ7L 3C14B 1KWMA 1S12A 2DY9A 2M70A 5LSRA 4QWAA 2XI3A 1OIAA 3HD1A 5A8KB 1TELA 2WRMA 4YFUA 4DUYJ 1UVLA 2YX1A 4KIAA 3IS9A 3RB0A 3DC2A 2QTWA 4IR9A 2PA8D 3AOCA 2KM8C 3WHIA 1N34J 5E3RA 2F8MA 4IOAQ 1RAAB 4KO0B 4URSA 1JXEA 1WEYA 3D0GE 2QLFB 5CQGA 2OI2A 1D3WA 4LBHA 2UXDF 3MCNA 3QAUA 4WXOA 1DZ5A 2EFVA 2JLFA 1EB0A 1T9TA 5BR8J 2DGSA 3I55S 3G6VA 4YDXA 2ZM6J 3BSCA 1NU4A 2AF6A 4Y3CA 4ECWA 2VHGA 5EX0A 1VQOS 1SL1A 3MM9B 4ZN1A 1U6BA 3QFHA 3BBFA 3TZXA 4X4QA 2BVZA 2BABA 3CJSA 1T9VA 2XZTB 4LVNP 1NKCA 5CYJA 2XULA 3UVJB 2R7TA 1RU1A 2AEJA 1TKXA 2E5HA 3AD7C 2FVQA 4B3MF 1YITS 3FSIA 2W25A 2CJBA 3GTYX 4RU2A 2I2YA 2OEMA 3PYDA 2OUGA 5DDRC 2ZEJA 5A2QU 2DRBA 2ILYA 1VOMA 2LMIA 2AQ4A 2CPDA 3PJWA 4M5LA 2H5EA 3VV2B 3BO2A 3HVRA 4Y2AA 2CNOB 1BY9A 1AYEA 2P9EA 3Q83A 4OX6A 1RYRA 2BE2B 2HQGA 3DMJB 3TRGA 5IWAJ 5T14A 4CH0S 3QSYB 4NWBA 3R8YA 2D74B 2O01C 1M5KC 3OHBA 4AXJA 2I5JB 2CPYA 3FQKA 1ZM2A 2B7BB 2XNQA 3SQGA 2M8DB 1T8EA 3VAMA 5HMYA 2NXEA 3ILLA 5C2GA 7FD1A 1XMBA 2V50A 3N0VA 1VQMS 1F0XA 1TL3B 1PSDA 2APOA 1N52B 2QYGA 2P6TA 2Z2YB 3D5MA 1B0VA 4LR8A 3RTVA 1NUEA 4LQ9A 5E3AA 1HHSA 2JWNA 2M4MA 3AB2B 2UVUA 4HDHA 4OYPA 2QLBB 3QLHA 2COLA 5CYQA 1S9FA 4X66F 1SBRA 3LGHA 3FBFA 1HNWF 1TMMA 2XMKA 3OL8A 2DO0A 2C2NA 9ATCB 3DLLQ 3W3SA 3M8SA 3N6NA 4PQUA 1HI0P 4RBUA 5JVGQ 2ILZA 1U26A 2BW2A 4NCGA 3TUZC 2DB1A 2ROGA 1YGYA 1YK9A 2HGNA 1VQLS 1SQGA 2RNEA 3FBBA 1FFGB 5EDWA 1S79A 1YJWS 1ZTWA 2CWXA 2RU9A 1YJ7A 2QL5B 2L08A 3QT5A 3VAGA 2RJZA 3CJ2A 2LA6A 4HH1A 4HT5A 1X5SA 1TUGB 1TV6A 1VBKA 2VG6A 1HNIB 1OMSA 1UJ5A 2KJVA 3R6GB 5KT7A 2W9BB 2FIUA 3CMES 5E41A 4G1QB 1BXNA 3HJFA 5U47A 1T05A 3P3DA 4JI7F 4AL6A 1RAIB 2CQHA 3MCMA 2OPQA 4RO0A 5ETOA 4URQU 2AV5A 4RUBA 4RWWA 1TL7B 1HWLA 3F56A 2F9JA 1OYDA 3I9ZA 1EQMA 3SFUA 2LXIA 3VQTA 5DLFA 2R7UA 1VCTA 3ISNC 1MMLA 4FYYB 2YBVA 1MU2A 1W2IA 3DRSB 4KB7A 1NK8A 4WP8A 1WC6A 4MKBA 2A2DA 4WPAA 2HMIB 1SC3B 4J7CA 1NB2A 1UWAA 2QLXA 1WSVA 4H54A 3VR1A 2AW0A 4USHA 2F4VF 2V9KA 2YKQA 1YKWA 3HHKA 5KT6A 4DR2J 3MPWA 5KG2A 4ZLPA 5FLXY 3BREA 1N56A 2AZ1A 3CE8A 3M8RA 1HARA 4JYAJ 3HPOA 1OY8A 4W4MA 5MLCV 4B9LA 2CRLA 2B9YA 3DLKA 4C8MA 1XMQF 3AFGA 1R6VA 1NLKL 4F0MA 2G4BA 4X62J 4DR1F 2HQ3A 4J37A 1HBMB 1JLBB 1W26A 2B43A 2W4PA 2VPXB 3F44A 3SEOA 2R8IA 1S5ZA 3DXSX 3NGSA 3PW5A 5L1IA 3EZOA 3JXOA 5FDLB 4A47A 1CQNA 3BB5A 2IBKA 3PO4A 4ZCIA 3NS6A 1SJQA 2VBYA 1B7FA 1E6VB 2L9DA 3MMAB 4RUCA 4I2QA 1FJ7A 2V4RA 1FRMA 5K20B 2RIJA 3MPVA 1XNQF 2GVDB 3MR6A 1N33F 3VVUA 5DDQC 2UZAA 3LQVA 4LRBA 4RUAA 2BDPA 4ELVA 2WSFC 4NI2A 2QN6B 2AMCB 3JAMY 3D6FB 4DV5J 2GVZA 1D9AA 4C8NA 1ICEB 1LEOA 3MD3A 4EK2A 1SJ4P 2VZ9A 2W2MP 3FC9A 5CA5A 2NLWA 5D0GA 5HLFA 4FYVB 3TUJC 4DX7A 2AHOB 3VGUA 3DOKA 5BYSA 2KZZA 3D7SB 3MDFA 4L76A 4U96A 2BJ8A 4PG6A 4AQYJ 3QRQA 1NHVA 2YNFB 4KKOB 3FEXB 3EE3A 1APSA 3BSOA 2WSCC 4KGMA 4ZVEA 4C48A 5I42B 3E01A 4PRFA 1QUVA 1U45A 1IKYB 2VKRA 2YKMA 2UV8A 4KBIA 4J91A 1C0UB 1X4EA 2QA1A 4Z2XA 4KAIA 1RI7A 4C8KA 4CNYA 2BQUA 1UPPA 2V9WA 5IQQA 4KFBA 3MM7B 4GVBB 1T9WA 5IC6B 2C3PA 4DF8A 2QRRA 2ZC3A 4DCPB 1GMVA 1FDAA 2HGLA 4QIEA 3DDKA 4DR3J 1Y5LB 1G6BA 1WD6A 2H5JB 4ZVOB 4DPOA 3JYTB 2NR0A 1AT1B 3MCSA 4LIWA 3PO5A 5KFKA 3DM2B 2VFSA 2DGUA 2OSRA 3NAHA 4V1Ak 4RUHA 2N82B 2JL9A 2AYBA 4Y65A 2HK3A 4DWIA 4G65A 2VBXA 1XMOJ 1FHTA 2IHR1 4OZ1A 2XYHB 4UT4A 3C14A 4KPCA 3N9UC 1HBOA 3ET6A 4JI4J 5FD1A 4DR2F 3R5CA 1RZMA 5D4PA 2F4VJ 4H4KA 4JI6F 1K8AT 2J5AA 5D0RA 5AXNA 2WVFA 2UVRA 2K3IA 2ZBPA 4LF7F 1UFKA 4I67A 2KYZA 2NUUG 2HQFA 4YS2A 3D0HE 4TXSA 1NPRA 4Y2MA 4OI6A 1IJEB 3THPA 5CD4H 2KYXA 4OX8A 1XWLA 5HN0A 2XO6A 4OYAA 5HVFA 2HVDA 3IN5A 5B0FA 4EZ6A 3CXCR 2JZ5A 3DYAB 3I82A 3AOBA 1RKJA 3CO9A 2CQ1A 2I9SA 4ED2A 2J7KA 1SKSA 3JQMA 4OJ3A 4DSLA 4LF5F 4ZPCA 4B3RJ 2DNLA 1H3DA 1PILA 3M1VB 1WG4A 4M5MA 4KGVB 2P9CA 4I6AA 4IFYA 3CCQS 3CO0P 1RTHB 1FX4A 3TQEA 1HPZB 5EWFA 3GIMA 4ZDNA 5GADU 1OPIA 2LQ9A 2XMTA 3AHPA 3A8IA 2N4DA 4WIQA 3TVKA 2NXJA 3NWGA 3PACA 3UCZP 5IT4A 1VDHA 1B99A 2XSJB 1VC0A 2HHHJ 3QAEA 2KH9A 3LGMA 2LYVA 4DR6F 4ZITA 1LWXA 1T9YA 3VAKA 2KL8A 3A8EA 3JQKA 2PO4A 3ZFVA 3BH7B 3LTOA 3M2UA 3G9CA 2ZJRQ 1OQ6A 3BQ0A 1U1RA 4I1TA 4OZNA 1KQKA 4UZCA 4RNNA 2QC3A 2C3UA 3BPDA 4CNZA 3LWMA 3V6DB 1FJGF 3CCWA 4K2XA 4ECVA 1KN6A 2QA4G 2KXNB 1TL3A 2AGQA 3IBFB 3L4BC 2QLWA 2M5YA 4W92B 1C0TA 1S9EA 3R1HA 4DZ6A 4X65J 1N6QB 4ZVGA 2BANA 1S7IA 1R6YA 1U6FA 3I4PA 2AGOA 2EFOA 5M2UA 3MAAB 4USWA 4ZVTB 5D6GA 2PFFB 1GH8A 5EUHA 3RZAA 4H4OB 1N5VA 3RBEA 1B64A 1U1KA 2WVDA 1B70B 3KHGA 1SKUB 3LP2B 4PQUB 2W1BA 2GJIA 4P7VA 1TKTB 3PX6A 1VQ5S 2WB1D 2B0GA 4WK3A 4NA1A 1HI1A 2MLXA 1ZZNA 1A6LA 3QZ7A 4DQSA 2K8GA 3EUNA 2KFYA 3D67A 3KLEB 1KDNA 2XO7A 1X0FA 3CCVS 2R7SA 3L3CA 2VU5A 1TV6B 4ZJOA 3M05A 3MECB 3PCOB 2VG6B 2A1BA 4J9MA 2BMBA 1AZSA 3TWZA 4DSFA 4B3OA 4GKKJ 2V6AA 1JLEA 2YQ0A 1NPKA 1CBKA 4JP8A 2B4VA 4LSLB 4DMZA 1TL4A 3L7PA 1NJYA 1RTIB 1KNZA 2ZM6F 1IVZA 1TMJA 2GIRA 3KJQB 4PAAA 2W8KA 1Z2ZA 3BBBA 5E2QA 1YIJS 5B7WA 3M4XA 3ETMA 4RLEA 3W5YA 1LFPA 1FVSA 1FXLA 3MWBA 2VIHA 1RB0A 2NPFA 4FXVA 2OGUA 2CJKA 3Q8YA 2HBQB 3IFEA 1A9NB 3G6ES 3QWPA 1FDNA 3NOGA 2YNHB 3UNGC 1N34F 2C2ZB 5E0OA 2FDNA 1TQLA 2FYXA 2R7OA 2XM3A 3C6TB 1FKAF 1H6KX 3EDQB 2HNYB 4LBIA 5CH7B 3M7VA 3TVZA 1NK4A 1VI7A 3FCWA 4UOGA 5HJXA 1URRA 2JNJA 2B7CB 1CG2A 4OX9J 3THVA 3IWXA 2GAHC 1FXDA 2IC3A 5HQ8A 1U25A 4P2FA 3IBCB 1P27B 2MZJA 4O4RA 2W4DA 4OQJA 2UUTA 3S7RA 1UFWA 3S8SA 1B3TA 1BQXA 4NEYA 3W66A 3BSNA 3MEGB 4K8RA 1RWXB 2Z56B 5JJBA 3PR4A 5EGYA 1JLGA 3OR1B 3G4SS 2YH1A 1FRXA 4C3LA 5ETNA 1DTTA 3A13A 1HNVA 2J9CA 4DS5A 4I2QB 4RW7B 4FYWB 4QWDA 2EPIA 2GVDA 4X4SA 5IT9U 5GAGU 4ECQA 4KQZA 4QOTA 2B4UA 3E01B 4LF1A 1D8ZA 3GIRA 1KHWA 2VB6A 4UF4A 3V4MA 4M95A 1JNRB 3MAHA 3T5KA 1RT4A 4LRDA 5ETKA 1TL1A 2M7SA 2CQ0A 3CF5Q 4GVBA 4PPDA 1PYTA 4NEZA 3DLGB 3KK1B 1T9UA 3WX8A 2ZH8A 2DD8S 4OYIA 3H5YA 1LWEB 3FSXA 1VJWA 2OHDA 1M1KT 1RA6A 2OPRA 2DHSA 1LNQA 2XMMA 3FK4A 2K06A 4N7TA 2LFVA 2VH7A 1M5VC 2XGQA 1ZAXA 1KLMB 4MFBB 4EZ9A 3DCAA 2Q3PA 3PHTA 5I42A 1Y3KA 3I87A 1RQ0A 2E5JA 4UZBA 1HA1A 4NLRA 2HLUA 3LP1A 3NGUA 4MKVA 3W62A 4XPEA 3MUTP 3EGWB 4HR2A 4FN5A 3M8PA 3LANA 2JEJA 1CEZA 1FXRA 2E66A 1DHMA 4ZHRA 3TEHB 5IT0A 4XDDA 3UR0A 3MOJB 1WKKA 2MZRA 2Q6BA 4ED8A 4UY8T 1NDPA 2KU7A 1HL6A 3R9LA 2HHXA 1FDDA 1K1SA 2E1AA 2AZ3A 3W8GA 3OFEA 5KFDA 2XCAA 2NZ4A 5IM0A 2XCPA 3OT9A 4JI1F 4ZPWR 4LRAA 3BSAA 3DN9A 4LREA 3OFFA 4ES1A 3PVXA 1MMNA 2B5JA 2DKOB 4O3QA 2MB0B 1S99A 3MTKA 5L9XA 3TNVA 1CQMA 2HHSA 2VV5A 4OLPA 4OYOA 3VAHA 1KVIA 3I5CA 4ANCA 5H9FK 4OFZA 4WFZA 4CLZA 2P2CB 1JX4A 1UETA 2IAJA 3F41A 5C24A 2KVQE 1NPPA 5J2PA 3PV8A 2J6TA 2C2KB 3CSKA 1H98A 2X1BA 4LUBA 4TYBA 3ISZA 1ZBTA 2CUYA 2ASYA 2YKOA 4DI6A 4O3NA 1HBNB 1GTHA 1HWIA 2HFOA 4C7QA 4DUZF 1TFYA 2DO4A 1LK7A 3TYTA 1BWEA 2XSJA 4LF7J 1GXTA 3K57A 5HSPA 1AB8A 4FZVA 1TAQA 2HHPA 4RWXA 3EMTA 1J2VA 3EPIA 4YOEA 1X5PA 4JV1A 2CG4A 2IM3A 2VD3A 1TU0B 4O0IA 3IC1A 4CTAA 2C2OB 3TAPA 4ZP6A 2E1PA 3PKYA 3M2UB 3UD3P 5GAGI 3ELHA 2EG2A 4OZJA 3P96A 4LRCA 2MZ1A 1XMOF 2PEBA 3M6XA 4R0EA 5ETLA 2ZOMA 3OHAA 3EGNA 2ZZMA 2W2OP 1VMBA 3A3PB 3LAMA 2V68A 2XWXA 2HWHA 3KJFB 4MYUA 4Y34A 4A8OA 5HMXA 5K8PA 4A8KA 3QJLA 1UL3A 4UQTA 2ABYA 5DDOC 3LH2S 1SC4B 3U02A 4C0HA 1Q95G 1S9EB 3EJMA 4DR3F 3POTA 4AE5A 4F04B 1N6QA 2Q66A 4QWBA 3PKMA 2FPHX 2EBEA 1WACA 4O0NA 3GYNA 1BQMA 5J1EB 2RKIB 3K2YA 3WQPA 3M8WA 5T7LB 1WG5A 1FD2A 3MM8A 3LP2A 4NA3A 3NNAA 3MAQA 1QAJA 1ZPVA 2FHJD 2VG5A 2A3JA 3H2UB 1FRLA 3N79A 3NOCA 4JOUA 5KFYA 2BRKA 1NH7A 1SH0A 2D3UA 3G2XA 4NLXA 2VQEJ 1SKWA 1V3RA 4DSIA 1LW2B 1H2UX 3PJXA 4ZVUB 4UQGA 2I8EA 2FLLA 3VAJA 4ES3A 3CCES 4QR2A 2BQRA 4JI0J 2Y1IA 4KTQA 1NZAA 3TUIC 3OFGA 4NZ7A 2E1RA 3L95X 1JQGA 3EYZA 2G0CA 3T9NA 3MAAA 1JLEB 4HYKA 1B0PA 4K2JA 3FKBA 4C2MA 1S1UB 3D3BJ 3F73A 3Q23A 2Z57B 4AYBD 1XC9A 1Q81T 4YB7A 5DS7A 3CTRA 1SV5A 1QJHA 4LF9F 2BJEA 5D78A 1IKVA 1JK9B 1R27B 3PY8A 4AL5A 1IN0A 5L1KA 1U0HA 4L75A 3NXZA 2H1YA 4MK8A 4DFKA 1L3KA 1R43A 3LPEA 4Y00A 2DEJA 3DOMA 4A8QA 5HI7A 4OHWA 2ZHOA 4JUZA 2DPIA 4CM0A 1SJFA 2MKYA 4M63A 5A6PA 1UVMA 1U4BA 2PMZD 3MHYA 4MYTA 4P10A 3ZTPA 3HMJG 1U1QA 1NZ8A 3C6TA 3ENWA 4HI2A 3DFEA 4I6YA 1XBWA 1YJNS 4B3OB 3W64A 2UUAJ 1OWXA 1EP4B 1Y11A 2I1RA 2MQMA 3UCGA 2OJ3A 1QAYA 1R0BG 4LVOP 4Q8FA 2A6MA 2OMLA 2EFGA 5KT2A 3OFHA 4NYZA 2UUAF 2MLYA 2CPZA 1S57A 3GJQB 2Q43A 2JEFA 4M5DA 1MG7A 2VKZG 5E3QA 4FF3A 3KLIB 4WCEQ 2WZ1A 1CJKA 1BD6A 2BEFA 2CA9A 4KHPF 2ZH2A 3EX7B 1KR4A 2MJUA 1IUJA 2YNHA 4PXEA 4CLUA 1KOOA 5D8HB 3S6EA 3JSMB 3FEYB 4LJMA 2V63A 1M1GA 4O44B 1DTTB 2IMOA 3GIJA 2FHOB 4ZIWA 2VA2A 4TU8A 1SL2A 1M5PC 4KPYA 5ETVA 4OYBA 1RWNB 1T02A 5L39A 4DV2J 2FLNA 2VJUA 4CI0B 4DV7J 1CJUB 1RAJA 2MXYA 1RTDB 4JI8J 1D09B 3H59A 2VBWA 2WVCA 2Y0BB 3BJYA 4FXDA 1KBRA 2WOMB 1RGVA 3D28A 2J0WA 3HFZB 2OFHX 2CYYA 5KOXA 4EGLA 4CT9A 2JEIA 3VF0B 1WHVA 2WONA 2XSFA 3LP0B 3PM9A 3KK1A 1NK6A 2XEXA 5DM7Q 3KJVB 2GAGC 3EXCX 2OPPB 4Z7YA 2XMAA 4WFXA 2OPRB 3CC2S 3QMQA 3CCLS 5F9NA 3KWMA 1VQ6S 3MM5A 2DR9A 2CPXA 4MFBA 2DGVA 4RR5A 1NHUA 3HKZD 2JFKA 1XR7A 2CJYB 5HANA 4MH8A 3WX4A 3D68A 2W24A 2YNGB 3AH6A 3I31A 1RT4B 1YVFA 3MR5A 1NMEB 4HHUA 2R7VA 2KVIA 4D3GA 2G1DA 3K8VA 3QNWB 3FJ2A 4J9RA 2NPIA 5HQLA 3TZYA 2V2VA 2A6OA 1EQ0A 4RW9B 4K4UA 1BLUA 4ECRA 1UWBB 3ITHA 2BV3A 1VR6A 5J2QB 3PNIA 5D0EA 1R89A 2WB4A 1KLMA 2W4CA 3M8ZA 1T94A 3L09A 3KFWX 4RW8A 5JVHQ 5J2MB 3DGPA 4DR4F 3LP1B 3TZZA 1CS4A 1Y3JA 2GJ2A 2Y8WA 4ITSA 3M6VA 5F8MA 2GCFA 2RF2A 3CVKA 2EK1A 2FJXA 4IUFA 4CT8A 4BC7A 3BQ2A 4DR7F 5H1SV 1F3FA 2NYHA 3ENQA 4KO0A 1EAYC 3ZTSA 1HBNA 4OX7A 2UVVA 1RAOA 3ZZUA 4DSEA 5J1NA 4LFBF 2ZZTA 1J5OB 1TP7A 4DG1A 1UZDA 4KSEB 4DV1J 2QEXS 2HBZB 1X4FA 3SBMA 3GFHA 2B5JB 3VHQA 3RR7A 1SH3A 3BM7A 4YHHJ 2U2FA 3B78A 2VFVA 3E3XA 3IXQA 4WXWA 4NLWA 3TX8A 4CTAB 1I3OB 2DCLA 1S6QA 1FI4A 1BUXA 1PJ6A 3MEDA 2AU0A 3ZZRA 2IAJB 4RJVA 1GMUA 2ZOFA 4C4WA 1F2GA 4B02A 4DFMA 1BC6A 3QPIA 3NCQA 2E1CA 1N32F 1SQFA 1N5SA 2LQBA 4ED1A 3V81B 2HGMA 2HBRB 1IQTA 4ZPAA 4ED6A 3PW2A 4WF9Q 2J7WA 1EX8A 2DNNA 3D66A 4CO1A 2CZ9A 2ATLA 5AJ3J 2VASA 1WHWA 2HZAA 4Y0FA 1SJRA 2VFUA 4HACB 1ACMB 5A0YB 4ZVSB 2ZFHA 3GYXB 1NSKL 1RWOB 2MKJA 5IV3A 2KM8B 1Q8IA 1UVNA 3OXGA 2GZOA 3D6TB 5DG7A 2KHDA 3OL6A 1G3OA 1PYOB 2IFXA 2BE2A 1P9YA 2OKQA 3DMJA 5T7LA 3W63A 2D9PA 1REVB 1IBMJ 1MWQA 2HHUA 2VPZB 4E8UA 3JTNA 1XN9A 2VDIA 2RMLA 2BJ1A 4M1KA 1H72C 4RNFA 5KT5A 2ZH7A 1MN7A 4KJIA 5CCMA 2V4QA 3BKTA 5CZVA 2R7RA 4ZLJA 5CABA 2FVSA 4PUOB 2LDIA 2IRUA 3MF5A 3SCJE 3CDAA 1QY7A 2K2PA 2JHEA 2V4JB 3GJRB 3T6JA 1RISA 2LXFA 3LUYA 5F0WA 2W7OA 4B9SA 5DM6Q 2OMOA 4K4TA 3RBDA 3HSZA 3QYYA 5ETTA 2IA6A 1CVJA 2NCKL 1VYAA 2RH3A 1U1OA 2FJDB 3KK2B 3UDVA 5DG8A 3T1AA 1XNRF 1S1TA 1WOOA 2WSEC 3MI7X 3UCUP 2X51A 1RWPB 4NLUA 2HVZA 2HNZA 5DRKA 3D6HB 4BWJA 2VQFF 2RRNA 1P1TA 1Q16B 3UE2A 4HHJA 4CO3A 5A76A 5J1PA 5D3GB 2CNLB 5K5MA 1SUQB 1FF2A 3R2CJ 5E33A 1IKXB 2BKNA 4OZ0A 3WZ0A 3KMQA 4O3OA 8ATCB 3K5LA 1ZOTA 3NCPA 2IJRA 4ZS6A 1CJVA 1QAXA 2L3MA 1Y9OA 4DUTA 1DQ8A 1RWMB 2IJFA 4G1QA 2NQPA 4DN0A 2DYAA 1EP4A 2EEYA 1I94F 2J9EA 2IDLA 3OR2B 3QT6A 2KT3A 3BN7A 4PCQA 2IIHA 2BKOA 3D1QA 5DETA 2LU2A 5C25A 1TL7A 2FGOA 3Q22A 4M5DB 1U0HB 4WU2A 3BYPA 4CO2A 4P75A 2DISA 4HDGA 2FLOA 3DOMB 3HI9A 4KV8A 4Y2IA 3M2VB 1LXNA 2CWKA 2KKHA 3NLCA 3QSIA 4P9SA 5HQMA 2OSQA 4IR1A 2KRRA 4LR9A 4PABA 3W65A 5D0HA 1U7LA 2O66A 4C0BA 3TI0A 1SL0A 2CQBA 1F9EB 1AA1B 3TOQA 3OUYA 2MGZA 3JSMA 3OJSA 1F60B 1PIEA 2V8DA 4DOZA 4LF4F 3I5BA 3MR7A 5KG5A 2MQPA 2QZ8A 1K1QA 2UU9F 2JC0A 4KHMA 2FJBB 1RTDA 3CCMS 4YHHF 1K0TA 1MROB 4KGKA 4NOHA 2XMWA 3DDNA 4H4MA 3P5TL 4F4YA 2DGWA 1K47A 4OZ3A 5HK4A 4JB8B 4FBUA 3QJJA 1RT1A 3VCDA 2MKSA 2LU1A 2YVSA 4AD6A 4DR7J 4CH7A 1HHQA 3UD5A 3I56S 2PN6A 1JJ4A 3B8HA 5IT9Y 1GK8A 3D2WA 1YHQS 1FVQA 3GCWP 1B0TA 3OTDA 3QO9A 3UR3C 3TJAA 2JX2A 3GFZA 4JI5F 3HHNB 2ZHBA 5F8HA 2HHTA 2M8HA 2Y1JA 3BDPA 3U27A 3F0NA 4OYWA 3AD8C 2RUGA 2PI4A 4DDFA 3ILIA 4IFVA 1IBKJ 2B51A 3GG0A 1M0SA 4KH1B 3VVTA 3UDEA 5M2RA 1QE1B 3IP0A 3SQOP 2YTCA 3GP9A 1FNXH 2ALYB 3M2RA 1IR0A 3I6PA 1X8DA 1XJWB 2GIQA 2Z30B 3AJ1A 1HYSB 1JXLA 3BGLA 2KFNA 2FJAB 3BGRB 4NXMJ 5LL6d 2BE9B 5J2MA 5L8RC 4F2RA 1U2CA 2F9DA 1R0AB 1C0UA 3B82A 2LXUA 1XTZA 4RW4A 3QIDA 2FTRA 2MDAA 1CC7A 2RB7A 2W7PA 4GC6A 2E9ZA 4A8YA 5DGBA 1R8BA 2CVIA 2DEIA 3PRDA 4MIBA 1M5OC 1VQKS 3PIPQ 2DR8A 4Q0BB 5F3TA 1D0EA 4QU7A 3JYTA 1RDRA 2QJ3A 1HQUB 4O3RA 1ZS6A 1WDTA 3DM2A 3R1LA 1YJ9S 4USVA 1BQNA 3DNCA 4DG1B 2KXFA 2NZCA 3P5BP 4DL4A 4KGXB 4O4GB 2IVMA 2DNKA 2O5DA 2FHMA 4Y28C 1XK8A 1NK9A 3OTOJ 2Z4PA 3RB3A 1HBOB 3ET6B 3GILA 2RF2B 2ZWPA 1AROP 3NL0A 2GMHA 2DH8A 4QIVA 1GXUA 2Z0GA 2D3OR 2WBRA 2FUG9 1RT2B 1WKJA 3K8WA 4QPTA 5HP1B 2C28A 4I0WA 4LBPA 4X4OA 2CJQA 1G4CA 3E51A 2V67A 5GAEI 4U8YA 3SXLA 3PHEA 1V5IB 2CJXB 2ZE2A 1WHYA 2E7VA 2DCUB 4JI4F 1AW0A 1C1CA 5KFPA 1J5EF 4GO7X 3MEDB 4NCAA 4NLOA 3MMBB 1X5OA 1RBAA 4A8SA 2IDEA 2ACYA 2UUWA 3DLHA 1IBLJ 2AGPA 1HMVA 3MFIA 3V81A 3RR8A 2RSQA 4WZMA 2E7XA 1N4LA 3C19A 4FKYA 4RPFA 3OLAA 2V2QA 2M3DA 3D0IE 2QL7B 3Q8UA 1N88A 4USKA 3H4DA 1Q53A 2MZQA 4FPIA 1VK8A 4HACA 5A0YA 2R8GA 3CDUA 3ZTRA 2XY7A 1HR0J 2HFVA 2QG9B 2WCXA 1S9GB 3NWRA 3QGPA 3V5RA 3N5FA 1SB6A 5DQHA 1AUSL 3FBCA 3M6WA 3L7UA 5ETRA 2OPSB 4EO6A 1H2TZ 1S1TB 5I3QA 1Q8BA 3ETOA 3QBCA 3GE9A 3TVYA 5DLGA 4ILMA 2HFZA 1X9SA 1VISA 1KLNA 3C2PA 4Z37A 4RNHA 3WC2A 3VALA 4X2BA 1NSPA 5CXTA 4DQRA 4QBUA 4C8ZA 1V3ZA 1DY3A 3E8OA 3J81U 1IBKF 2AX0A 1IKXA 2H65B 2HZCA 1QSYA 1C0TB 1RT3A 4RW6B 3CJTA 1FFWB 1GX6A 4GRSA 4DV5F 1CJVB 4OHVA 3Q86A 2BOAA 2EXUA 3EZUA 1X4HA 4NCBA 2RQ4A 1N33J 3AQOA 3H8YA 4IQMA 4C6AA 2W2NP 1UZHA 1YRTA 2J76E 3TZWA 1VRUB 3JTPA 1TKTA 2RHSB 3LW5C 3QGHA 1ZPWX 1KHVA 2OTLS 5CYMA 3CJ5A 3DLBA 1FA0A 1PCAA 4K0KF 3A8KA 4CLWA 1CULB 2V2KA 2VPWB 3M32B 2ATCB 3W61A 4KV8B 3FRYA 4R5PA 1RA7A 3CC4S 2LEPA 3KLEA 3M9NB 1YBTA 3DLEB 3UD4P 4K4VA 3BPSP 4OLOA 3Q8SB 2F7VA 5HATA 3LOUA 2HVEA 2HIYA 3ZO7A 1Q5YA 1NAQA 2K7JA 3P49B 4M5GA 1RADB 3T1HJ 1GMWA 1JXVA 2CKWA 3GR0A 3M8YA 3NEKA 3ONQA 3PYEA 1WC5A 4CO0A 5KAKA 2B9EA 3SV3A 2DXDA 1U1LA 3FEZA 3OR2A 4NXNJ 4NXNF 2J8AA 1Z2LA 3BKFA 1FT8A 1Y5IB 4ZPBA 4FF4A 4EEYA 2R2SA 4YY3J 1Q4RA 5D4LA 1M5HA 3H5SA 4BHQA 2BJDA 4C3MA 2CQIA 2GQCA 5KFNA 2AJ4A 1XERA 2AP6A 4OYZA 1N8RT 1CPZA 2KZMA 2QMXA 2XTJP 3LA0A 3I9V9 2V69A 3M8QB 4KY3A 2YWEA 5HBMA 1RT1B 2PI5A 5RUBA 2HQIA 3TA0A 2KJWA 1OSCA 4NLPA 1KQGB 4PG7A 2FLPA 1SJ3P 3HXMA 4A8MP 3UN5A 3ICLA 3PYFA 2G13A 1S1WB 5KG4A 2R9LA 4M5KA 1NKEA 2IC3B 2VBZA 1FJEB 1C2PA 1V3SA 4YR3A 5I3UA 1RWKB 3AXKA 1Q86T 3CJ0A 4K5RA 3MPUB 4ZCMA 1NCLA 2CDQA 2ACMA 4GC7A 4ELUA 3X1LB 3D4JA 2J9DA 1GEHA 2RDJA 4FS1A 3SIPB 3MEGA 4IFVB 3HFVA 4C9DA 3KJNB 2HFSA 4TKTA 5DJBA 3W5ZA 3OTBA 1WF1A 2JFDA 1F1BB 2EK6A 2GX8A 4HH0A 1TTHB 3MPYA 4XK8C 5KFUA 1U6ZA 3A8JA 3GWCA 5KOWA 3ZTOA 2VL1A 5JXSA 3QO9B 3CT9A 4YN3B 3NBPB 3HX9A 4J5OA 2R8KA 4OV6A 1ZM4A 4ID5B 3CCRS 4GKKF 4F4WA 2KXHA 2DIVA 3RAXA 1UA1A 2UXCF 4IDKA 4AT1B 5F8NA 1IM6A 3JQJA 3HT0A 1ZAWA 3NCRA 4N76A 5D15A 2YX7A 3H25A 3CWJA 2QV6A 3G8TA 3KDNA 3HSGA 2AEMA 2MKIA 4WYLA 3T1YF 2HEKA 1IBLF 1UKUA 2E29A 2XHWA 3SMZA 1HQUA 3M2RB 5AT1B 1EKRA 3BQ1A 2H48B 2AKWB 2UV8G 1BQNB 1PAUB 3GFYA 3S01A 1NBEB 3VGVA 2MKHA 1P6TA 1PO6A 2PA3A 2K7KA 2ZUAA 3R7BB 2OEJA 3MR3A 2UXCJ 3CJ4A 1HNZJ 2LQ8A 2KFZA 2X1FA 1RCXB 2DGOA 1T3NA 3MPDA 3M8PB 2HQCA 1XQIA 3IS9B 3CJ3A 2A2CA 2NXNA 2YNIA 3DLJA 3IR6B 4PWDA 4B3MJ 1WI6A 3K89A 2WVBA 3BEGB 1RT2A 3EM1A 5AXMA 4IG3B 3MEEB 5HP1A 3IMQJ 4Q0BA 4PXCA 3TJ8A 5K8MA 3RB4A 3DI6B 2FY1A 4JI3F 1JKHA 1JB0C 2KT2A 3SV4A 1QM9A 2NUHA 1XIQA 3H5UA 4O4GA 1FE0A 2BM0A 5IOLA 3RAMA 3HHLA 2G2ZA 4PKDB 2M9KA 2J6UA 1RTJB 2QSWA 2HFNA 1RWUA 4QU6A 2RRBA 2RS8A 3Q2SC 5C24B 4RZRA 4KGZB 4DSJA 2UXDJ 1CLFA 2JJ4D 2OAUA 4IG0A 3J81Y 2HFUA 4DPWA 4K50A 2RE1A 2EVZA 3R6LB 2QFIA 4B17A 4J9QA 1UJ6A 1NDKA 1GMWD 2FY8A 4GO5X 2CAJA 1F9HA 3D9BA 1JLQA 2X3DA 4DUYF 2Y8YA 4EFAC 2HRUA 1VQSA 3I32A 1QSLA 1C1CB 5G4DA 3GLJA 1QUPA 3ZNUA 4FNIA 3UN2A 1HD1A 4ID8A 3LALA 3D54A 3T19A 5KFRA 1VQYA 3EGVA 1RHJB 2MY8A 2VDHA 2BZ2A 4LFAF 1JNZB 2HURA 3H2LA 4I2PA 4Q44A 5L1LA 1RWWB 4FS2A 1RBOB 2P8IA 3R3TA 3PTWA 2HLTA 2HAIA 3RB6A 5H9EJ 2FD2A 4ZP9A 5KT3A 4B3SJ 5B0DA 1S76D 2V8PA 4GKJJ 3UW1A 2ALZA 1SXLA 4A48A 3BR8A 1VRTA 2BE7D 2L9WA 4JV2A 2UXBJ 2IY5B 1R7IA 3NGTA 2C1EB 3H5XA 3IWNC 3R5DA 3W2WA 3QRPA 3UI3A 1DQAA 4F3QA 3RGIA 1FDBA 2LP4A 2RRAA 1TVRB 3NS5A 3PEHA 3POTB 4JV5J 3GB0A 3QLHB 4K59A 1OO0B 1RT6B 5M2PA 1FRKA 2AYMA 4XPCA 3HVTB 4WBFA 4K4ZA 4WTYA 3VZIA 5J1EA 4N56A 2RU3A 7AT1B 2ASLA 2P5VA 1UFLA 1FO1A 2N4CA 3A3OB 4R8UB 2EG1A 4DLEA 1FNMA 1T95A 2XZDB 4KYZA 5FIIA 3DLEA 4AUKA 3DRPB 2DBBA 4CO4A 2VUGA 1GFWB 1RAFB 1A7GE 2BYCA 2Q1LA 1D9DA 4WU3A 1V5VA 2W9BA 2BUNA 3BDEA 4WFYA 2QA2A 5IQ6A 4DQPA 4CWBA 4DPXA 2DIUA 4KC5A 1U0SA 2W9CB 4GKJF 2BKPA 2UU9J 3CUNA 1HQ2A 5LMUF 2CDRB 4OI1A 2CQGA 5CYMB 3P45B 1RKIA 3BKUA 1FWLA 1CULA 3M32A 2DNOA 3SZ2A 1U1PA 1S77D 2VC0A 2FC8A 3CCZA 3GU0A 5BYQA 1DTQA 1HR0F 5EN1A 3PX0A 4NLVA 1U24A 4EWTA 3KK3B 3PX4A 4L3KA 1GQEA 4HHHA 3M8QA 1VC5A 2OLWA 1P9QC 3B6BA 3M30B 3IM9A 3T5LA 4OYMA 2R8HA 3BO4A 4EBEA 4MKYA 1JMTA 4ZCLA 1KRPA 4B3RF 3MTJA 4ERDA 1ZYQA 3IGNA 3W8PA 4UOFA 3QZ8A 2MSTA 4P72A 1S1WA 3K7RA 4ECTA 1UVIA 4NE9C 5JMNA 4J9UE 5DDPC 1KD1T 4PYDA 3D1OA 2CNKB 2D69A 3CJQA 2ASJA 2N3OA 5I3UB 1ZZFA 1N0UA 5FJ4A 5IFMA 1HBMA 3UVJA 2MHNA 2F8HA 3QIPB 2MZTA 4ILRA 4ZJQA 4JI3J 1H7XA 1WOPA 3AY0A 5D3GA 4DV0J 1OYEA 5FDLA 3QRRA 3R7NB 4HT7A 3MMJA 4DU8A 2C3YA 3CCSS 4NLQA 2VQFJ 3EGZA 4QYZJ 1XNRJ 2EC0A 2BJ9A 3C16B 1RT7A 1VC6A 3NBPA 8RUCA 4C8LA 2IRYA 2GW8A 2R4FA 1HNXF 1H74A 1JJHA 2L9NA 1DURA 4YR0A 2X7IA 4B3TJ 4MIWA 3VWSA 3NY0A 5A6WA 2D3ZA 2XS2A 1B7YB 2BOPA 1HD0A 1IBCB 5KFXA 2UUCF 1FCAA 2DNMA 4WFAQ 2B4OA 4LSNB 3OQ2A 4Q2LA 3CJKB 4CYUB 3KXDA 3Q8QB 2EW9A 3UPFA 2BR0A 1IBMF 3KHRA 1R0CB 1MWZA 4TYAA 5GVQA 2E5IA 5KG3A 3MM5B 2ZD1A 5KFIA 3R2DJ 2GA7A 1SH2A 4QYZK 3K17A 2ADCA 4PPZA 1WHXA 5D77A 1IKYA 5EX3A 2YKMB 4TU7A 3O6QA 3RU0A 5KG6A 2DNRA 4ECXA 1EIYB 1K0VA 4DV3F 5CZXA 4IDKB 4NLYA 5IV4A 4NCGB 1T3OA 2KB2A 2FZGB 2YNIB 3GONA 3ZXWA 2XC9A 2Y9HA 3A4TA 4DL7A 1VLOA 3JSYA 3CMAS 1BHNA 2B56A 3HSDA 1N32J 2LVWA 3I96A 3MEEA 4YEAA 4ZP8A 1TKDA 4X4NA 4U9RA 1UWBA 2V8HA 2MTLA 3DI6A 2IJNA 1KQFB 2J9DE 3X3UA 3DU6A 3GSDA 2VFRA 1S0NA 1O8BA 4IOBA 3ISND 1T05B 2GNKA 4DV6J 4WWSA 3RBZA 2YY3A 2DGXA 4JI5J 2B4PA 5IC4B 5E3CA 1ULRA 2FGCA 4LFCJ 4FF2A 1NDCA 5LM7E 4QZVB 1KFSA 3L9ZA 4TN2A 3NMAA 1C1BB 1RABB 4X4VA 2AJ2A 3H98A 4F8RA 2M2BA 2ZVSA 2F3JA 4ZVRB 3A1YG 2GIFA 3Q89A 4G1IA 1YJRA 4IG3A 2Y3YA 1RU2A 2HSEB 4MTPA 1KKHA 3PG9A 2HAFA 4NLDA 1UPMB 4MK7A 3GJTB 1RHKB 4ANDA 5F3ZA 1EETA 2F65A 3CDWA 1J5OA 4WKRA 3N28A 3U1LA 3OXLA 3SI8A 4A8FA 3HJVA 4C0OC 3TX0A 3VQSA 3AJDA 3SSSA 5HVGA 2ZH9A 3VAIA 1U02A 2IVYA 2CPIA 3N4WA 5KFWA 1XR6A 1NJIT 1EZZB 1WI8A 1LK5A 3NG8A 3BV8A 1Y4ZB 3CD5A 4I64A 4L6V3 1NNDA 1WOSA 5C2CA 3ADAC 4HTIA 1AXQA 1O6XA 4USJC 2Z2MA 3N5BA 4J9LA 2PT0A 5CD4A 2PMHA 4A4JA 2ZITA 1GXLA 2IRXA 1T9XA 3UNYA 2AT1B 3MUMP 3IGVA 3AA8A 1TVRA 4B9MA 3IWLA 1FK9A 4CLLA 3KLGA 2GHPA 4EYIB 4FXWA 2CPJA 4DV3J 2HS0A 2HZVA 1NRKA 2YPYA 1Q78A 2OFGX 1TAUA 3HVTA 4OJ1A 1IM4A 4EI2A 4JV5F 4N8OA 1IWAA 2IYGA 5KFSA 3T41A 2QMUB 2HNDA 4OI4A 3CPWR 4UTGA 2G2OA 2JRSA 4NI2B 4TQSA 1L3SA 2DRAA 4JI7J 1Y5NB 2GVZB 4TLRA 1LWFB 2CQPA 1Q79A 2YXLA 3W9HA 4ALZA 2BRLA 4MK9A 4CP5A 1OY6A 1VRTB 3C8YA 1S1XB 4TU9A 3CCJS 4PUOA 4F25A 2JLGA 2X3GA 2UUCJ 1V6HA 2V4JA 3CMQA 1X4GA 2LEBA 2VICA 3BR9A 2XMJA 1WC3A 5ITHA 3EPGA 1N36J 1KQSR 4DCOB 1KSPA 1X31C 3SCKE 1HQEB 4H4OA 1PYSB 4IH6A 3KK2A 5AXLA 4Q7AA 4AL7A 1TKZA 4JV0A 5GADI 3BBCA 3DOLA 2V2ZA 1YQHA 1BGXT 2XY6A 1VQ8S 1EKSA 3OTEA 3HULA 4X66J 4ZVPB 2R7QA 4KFBB 1F5CA 4UUWA 3KDOA 3RUBL 1OS5A 5KFTA 1YBUA 1SUQA 2RT3A 4ZPVR 2WK4A 5LXYA 1S72S 3Q24A 4J90A 3J7Z5 3DRPA 3KK3A 3ENAA 3BF4A 3DGVA 2E5LF 1P1LA 1LFWA 3J81j 1U1MA 2G0JA 4NZ6A 1B4SA 2ZH4A 2DRDA 1REGX 3HF5A 3VTIA 4U7CA 2HK2A 3TQ1A 4N5SA 4BCAA 2ZBCA 3OD2A 4L3NA 5IWAF 2F8EX 3FGVA 1RYSA 1KTQA 3AB4B 1WC1A 3EWGA 1J5EJ 4LF8F 2N7YA 5JUMA 3I0RB 5K14B 3TARA 2PC6A 4XTTA 2AX1A 4IOCQ 5F41A 4DX8H 1DTQB 1G2EA 1X4AA 5ETPA 2BJ3A 1NB7A 1S49A 3QIPA 5ETSA 1WEZA 2PSZA 2D1CA 2XBPA 2FB0A 1KS2A 4ZCKA 1RHMB 2E1MC 1RK8A 2MMYA 3EICA 3OUYB 3KYLA 3E2EA 2AJ1A 3A3NB 3H7HB 3NGDA 1F3VA 3H40A 4LF9J 1RJJA 2HS3A 4E2FB 4JI1J 4MT1A 3C16A 1JWWA 3FCHA 3FMWA 1N5YA 4F0HA 5DGAA 3DRRB 4ETZA 1MROA 2V5HG 3N6MA 1R3NA 2FHKA 4JI0F 1RT5B 1HBUB 3I5AA 3M1VA 3IR7B 5B0GA 4ZIVA 5F8GA 5B0BA 1K9MT 3FFIB 5B0EA 2JEGA 3TA2A 2VQEF 1RTHA 1UAWA 2JH3A 3KKFA 1S59A 1X5TA 3TEGA 4CYUA 2ZKUA 1YJTA 1D1UA 1YZ7A 3W7BA 4DL5A 1HNVB 3DDIA 1Q8LA 3I0SA 2NS1B 3KUEA 4NL5A 3UFCX 2HRYA 2VOOA 5K9FA 3JSRA 4IO1A 5EHHA 2F1FA 2HRTA 5MAOA 2FVPA 4DR4J 2QSFA 1DLOB 3A12A 3NGKA 2LA4A 2R3VA 4DBQA 9RUBA 1KVKA 3P8BB 4U95A 2CADA 4X65F 2MZSA 3TJ9A 2CQCA 1S6PB 2UXBF 4LSNA 4YB1P 4EUVA 1RWVB 1VRQC 1S97A 1QE1A 3H2VE 2XWYA 4LT6A 1LWEA 3OSPA 1QVFR 1KC8T 1FKPB 2VODA 2JVOA 3GMGA 4ES2A 5GMEA 5T41A 2BANB 4ZMMA 3SSRA 4K4YA 2ZD1B 4OHXA 1HYSA 7FDRA 2C3OA 4DX6A 4LFAJ 1F5BA 2DXFA 3LF0A 4DPTA 2OEKA 2CNNB 1SKRA 2POKA 2ZKTA 1ZETA 1WEXA 3AJ2A 1R0AA 2CQ4A 4I69A 4LIRA 3JTOA 4NLSA 3RRKA 2VPYB 4ETXA 3Q0AA 1VIOA 4ICLB 4F67A 5CHCB 3CULA 3PJ9A 4PYAA 4ZHRB 4MMOA 5LT5A 4NRUA 5D4NA 2B6AB 2CQ2A 2QO3A 4P74A 3TAQA 4Y6IA 1LWCA 1ZA2B 2MQNA 4NLGA 3IRWP 1H38A 2YQ1A 1EETB 2NSCA 2ZDOA 4P7TA 4OHZA 2R7WA 2F5GA 2FJWA 2VJVA 1ITPA 2IVFB 3Q8VA 2D7SA 3NKYA 4O23A 4OZ2A 2OP5A 2K1RA 1DQ9A 4QW8A 4F4AA 3PIOQ 3MURP 4ECUA 1Z1ZA 1FJCA 4DV7F 4CLSA 5J2PB 4OHYA 2VA3A 5E3PA 3G86A 3FCVA 4DV4F 4LSZB 4DV2F 2W01A 1C1BA 2C42A 4USTA 3THTA 4FVCA 1R31A 4M94A 4LF4J 1G1XA 2ZJPQ 3GYGA 1PC5A 2ZC4A 5A2QY 2GMJA 2PFDA 3J80U 3M9MB 2FZKB 1ZH5A 1SI9A 2DK2A 1VQ9S 4CCHA 3KLGB 4V19X 1S4FA 1S1VB 4ANEA 5HROB 4ECZA 2E5GA 1NJXA 5KTQA 1Q8KA 5E5NA 1HNZF 4J9VA 3R7SB 4U8VA 3RBXA 3FZBA 2HW3A 2VC1A 3CNQP 5KFFA 2U1AA 3MMBA 3HZGA 2HNDB 2WW8A 3ZTQA 2G0IA 1TK8A 2FJVA 2HKEA 1HHTP 2J0QD 4BS2A 4C11A 3SDEA 1LWFA 3PR5B 5GMDA 5A8WB 1N5TA 2CPFA 2YKAA 1JLFB 3EVWA 3G82B 1H2VZ 4GMKA 4BWMA 1S1XA 4L72B 3CJ8A 1QSSA 3PRBA 3WC0A 3V4IA 4F4ZA 3CDBA 1FWPA 4DU7A 3OR1A 1UJ4A 2ZDPA 1FK9B 1Q7LB 3V6HA 4YR2A 1WORA 4YMEA 2LCWA 4IH5A 4C8OA 4ATNA 3TAMA 4RW7A 3US5A 3QGGA 4XDCA 4OL8A 4P73A 3RYLA 4CLYA 3PW0A 1U48A 4L74A 2DITA 1FRIA 3BGFA 2RD5C 5KFBA 3RJMB 4YDDB 1RCOB 2I38A 3HVWA 3O8WA 4B9NA 4G1PA 1TL1B 4ED7A 1RHQB 3IBWA 3ZZOA 1MNEA 1LW2A 3HHLD 4WP9A 1LV5A 4N77A 5EWGA 2ZWOA 4QR1A 4XAKA 2LECA 2YWKA 1S6UA 4YB6A 2UP1A 1Q7YT 5DG9A 1W7WA 4FF1A 1TKZB 2J7UA 2RDIA 1RACB 2DY1A 1SV5B 3DOLB 4FNHA 1VRUA 2XLIA 2I6WA 2R2TA 5L1JA 1S0MA 2LQJA 1MMDA 3CIZA 4M5IA 3KLFA 3I0RA 4PWUA 2BA9A 4I56A 5LJ5Y 4CH1A 1M1HA 5HL7Q 3GV7B 4ZPDA 1HI8A 2WHOA 3D6MB 2J6SA 3OV7A 2NREA 5IXUA 4NASA 5AJ3F 3N6LA 4ECYA 1TR0A 4LMZA 5B09A 3W9IA 3UN3A 4X62F 2V8VA 4X84A 2DNZA 4QIGA 5CCLA 1H0HB 5IM0B 5KFMA 4X4RA 2L41A 4TY8A 3K5NA 3KNAA 2XG8A 2R7XA 1WKLA 3J7ZT 1KVJA 1Y7PA 3GV8B 3T9ZA 1RLDA 4DL6A 1F6TA 2GC8A 3DRRA 1WG1A 3O44A 4H4KC 5K14A 2BBEA 1FRJA 3KLIA 3MM9A 3TA1A 3MFHA 3T1HF 1CJKB 1IQZA 1X4BA 2V0NA 3Q8RB 2DVIA 2AYGA 3FVYA 4ZLNA 3W1YC 1HBUA 4DV1F 4UY85 3FFIA 3HHEA 2FJEB 4EU0A 3IG1A 1X9MA 4DUZJ 5GAHI 5HBMB 1MLAA 1XEZA 2XMUA 1N0VC 1H7WA 1YX2A 4LF6F 1ZA1B 4MJKA 3CJRA 3KHHA 1YRUA 1PBUA 3CB4A 4F3MA 5C5JA 3TUPA 3AOAA 2QGFB 1FD8A 3C3LA 3BS9A 2DH7A 2H4WB 2P6SA 2YX4A 5ETMA 3ZZYA 1RUSA 3P4UB 4OJHA 2RAQA 2WBMA 1HWKA 4DX5A 5K8NA 3MM6B 4DV6F 3PRVA 1JJ2R 2KG1A 5THWA 3KHLA 1NXIA 2FC9A 3HHDA 4CLTA 2AWZA 3OBIA 4KE5A 3ENVA 4J9NA 4HL9A 2CPHA 3J7YU 2XLJA 3KG0A 2H3EB 5BXIA 2ROPA 5KG0A 1SCJB 4YQWA 4IO9Q 1NK0A 2FQQB 1Y00A 2C2EA 5CYQB 1OQ3A 1NSAA 3UDCA 3KG1A 3K58A 2AEFA 1BQMB 3OJUA 5GAHU 1HNWJ 1RHUB 2E44A 2JVRA 2GQQA 3MM8B 1LQ9A 1DLOA 2YNGA 2HHHF 2XI2A 2DJWA 4ICLA 5AXKA 2VG5B 3NAIA 3R27A 4WKYA 5HAOA 5FLXU 4DQIA 2Q79A 1YSJA 2MKCA 1VJQA 4P71A 3OW2R 2IM0A 2MQLA 3H90A 3O2IA 1LWCB 4PWWA 1O0PA 4DN9A 3W2VA 4CZCA 5LSOA 1N5QA 4DFJA 1QVGR 1HWJA 3PFEA 4U7UK 3TP2A 1FKOA 3AD9C 5J2QA 2XNRA 4F4XA 1HNIA 5C7PA 3GIKA 3LAKA 4F26A 4X4PA 2YWHA 1X4CA 1WSRA 2WW4A 1PGZA 1X60A 4CQ1A 1T7PA 2YKPA 2JDJA 4KRWA 3BN4A 3VAFA 1IJFB 3GR1A 2CVEA 2Z8QA 4QQBA 2OPQB 4UUXA 4LR7A 1IKVB 2GO9A 3K5PA 3R5GA 4PWDB 1S10A 3GG1A 3G87A 4MAKA 4PG8A 1U1NA 2Z58B 5LJ3Y 5ADZA 4CLFA 1Q1KA 1OSDA 2RHQB 2MQQA 2XLKA 2JLEA 3MXHP 2B8PA 1IR2A 1K44A 3W60A 1JKHB 2DGQA 4PXDA 4QWCA 3H4BA 4O3SA 2GGPA 2PEHA 4FYDA 2CZVC 4Y2CA 4MKAA 4EBCA 4KHPJ 1S1VA 1WNEA 1PAEX 2CQDA 5H9FJ 1VHIA 2GHVC 1DARA 1TL5A 2CQ3A 3C15A 3HHLB 4WFBQ 3OTOF 3PZPA 2K1RB 3GJSB 4LF8J 4ZVHA 4URGA 1F2HA 3WIUA 3BGUA 3DLKB 3SSQA 1UW4A 4DL3A 5H9EK 3FRZA 1A0OB 4C11B 1RAEB 4OMFG 4BBYA 2DTJA 2G1HA 1L5UA 5A8WA 4FYXB 2ZBRA 5LXRA 2QYCA 3GFXA 5B0CA 2XGPA 2Z2LA 3EXYA 1UA0A 1QLNA 1YG0A 2B8QA 1YJUA 1FEEA 2KO1A 2ZHAA 1JLQB 4N41A 4DR5F 2EFQA 4FBTA 4FPRA 2WVEA 5DZ7A 3TO8A 5HMWA 5HROA 3OTCA 2MYFA 1FFSB 3HP6A 3MMAA 1Q82T 3PFOA 5KT4A 1JLAA 3HHLC 2HS4A 5KFJA 3G96A 3K59A 2QX0A 3SYZA 3H42A 4I2PB 3T6BA 4AQYF 4XIUA 2RILA 3RW6A 2B3TB 4X64F 1CJUA 4ED3A 4HKQA 3BZQA 3K5MA 1F5AA 2BQ3A 5LMUJ 1VIXA 2WOMA 5KFGA 2KHCA 2DNPA 1FEHA 3OPKA 2MPUA 2IPOB 4IKAA 2ZH1A 2AIRB 5C42A 3O1LA 2NSBA 3DHXA 4P2SA 6FD1A 2YWFA 1GNKA 1RE1B 2WONB 3LP0A 3W2WB 4C98A 1JLCB 3L7OA 5K8OA 2RQCA 1IR1A 3V4IB 5SZTA 1FE4A 4I7FA 4S0MA 3KJVA 2A0FB 3I4HX 4PQAA 1S7HA 3TAMB 4DL2A 2MHEA 4ELTA 3CD6S 1XR5A 3R5AA 4B9TA 2RDDA 2F4FA 2LDYA 2I0XA 2WAQD 3IRXB 5IS2A 2JC1A 5KFEA 2HNZB 2HVIA 4NRTA 2DPJA 2HG4A 3TW0A 1KP6A 2MLZA 1O51A 1R8AA 4R8UA 3GZ7A 4FKXA 2LLZA 4TLQA 5SUHA 5KFAA 3MM7A 4B08A 1SPBP 2FVRA 4IRKA 2DHAA 2QE5A 4A8XA 1GX5A 3GPAA 1E6YA 2G2YA 1F9FA 2W7AA 4HLBA 4ZP7A 3WDOA 4RNMA 1SC1B 3OL7A 4DR1J 1MSWD 5KFZA 1HWUA 3CD7A 3RG6A 6AT1B 3ITHB 4WTOB 1FERA 1XMQJ 4YUDA 2N7CA 5KFOA 4BDPA 3HCXA 4TY8B 3HK2A 3GCXP 2H51B 2H5IB 3AODA 3NMRA 3HD2A 2BXJA 4B3SF 8AT1B 3DGPB 5L9NA 3VGTA 5C25B 3FSYA 1IKWA 1NK7A 3KLFB 1CS4B 2DHXA 4CLPA 3G8QA 1NHKL 2XZWA 5DO2A 4F4KA 1N54B 3M2VA 4J9PA 2QT7A 3IA0A 4QJVA 4LQ3A 1OJ4A 5A8RB 1I5OB 1U8WA 2W8LA 2OIHA 3IG1B 4JBCA 1HW9A 2IA0A 2ZUGA 5E7OB 4F36A 1QAIA 3M30A 2O67A 1DBDA 1HKAA 4NYOA 4NZ0A 4DPYA 2UVWA 2GFFA 4B9VA 2VF3A 4LF5J 5HMZA 1MN9A 4ED0A 4F0KA 4KH0B 3KOAA 3NNCA 1S6QB 1U49A 3Q8PB 2EI5A 3DYAA 2ZBQA 1ROFA 3MR2A 2DNHA 3MM6A 4NA2A 4Q5VA 1S4EA 4I4BA 1BMQB 4PEOA 5AE1A 3FNNA 1LKZA 4ER8A 2CFXA 2LEAA 3NS7B 1KONA 3UQSA 5BJRA 1X4DA 4IFYB 4P2XA 5LOQA 5F9LA 1KOHA 2RS2A 1HPZA 3DHWC 4QWEA 4F02A 4RX6A 3SCLE 3OVSA 5AE2A 5F8IA 4CM2A 1RAHB 5DQIA 2MQOA 2BW7A 1DFDA 3J80Y 2IBOA 1LOUA 3BGOP 5HJYA 4C8YA 2PIIA 1NO8A 2RUSA 3RRHA 2HIQA 4WJBA 1RT7B 4ZLLA 2DNQA 3QFWA 1UEKA 3AT1B 3IAS9 3DRXA 1REVA 3CDEA 4QIWD 2VG7A 4F7VA 3V6DA 1I1GA 2OELA 2CJ9A 4DXLA 3LO3A 1ZM3A 4Q43A 2XS5A 3KLHA 2ADBA 2V34A 3G6XA 2XY5A 4WP3A 3CJKA 3W2VB 5AE3A 3U7JA 1FTRA 1U47A 1URNA 1IWGA 4WE1B 3T1YJ 2YQ3A 1FKOB 2XS7A 4M8LA 3LWLA 4U6PA 2NXUA 3HFKA 1Y0HA 3JS9A 4ENOA 2XQCA 2ZH6A 3O3LA 2AJFE 4DPUA 2V94A 2BJ7A 2ZNZA 3NRBA 5EWEA 2DT9A 4IRDA 3QT8A 4FP9A 1W2BR 1LW0B 1X0PA 5J2NB 1S0VA 4CO5A 1WWHA 1VFJA 3MMCA 1VBXA 4ED4A 2QIFA 1UVJA 2PMWA 2HPUA 4HI1A 4L73A 1JJCB 2GQ2A 1DJ0A 2QL9B 4DZDA 4ZA1A 3FUYA 1DAXA 3KG4A 3K5OA 2EKYA 4EO8A 1TK0A 2WTFA 3MECA 1RSCA 4BC9A 4KR0B 2GGPB 1AZSB 3MEKA 2Y1RI 4ZVQB 2KI2A 4OV1A 1HFEL 2MEWA 2MQ8A 2O3DA 1M5SA 2RQKA 3KNGA 5IZHA 4LSLA 1SJ1A 2J0XA 5BR8F 1RTIA 1RP5A 1WELA 3C15B 3R5BA 1YWXA 4USUA 4JYAF 4X64J 3NP5A 4TVAB 5LMNF 3V6JA 1RBLA 1L3UA 3UWTA 1H73A 1SC6A 1X7VA 2OD6A 4N8NA 4OX9F 2HVHA 1UEVA 4LFBJ 4QW9A 3JB9k 1XNQJ 4RBVA 3K0JA 2D41A 1UMJA 3V2UC 2M0GB 5B08A 4DR5J 1FX2A 3MGJA 1WF0A
chains in the Genus database with same CATH topology
3ENAA 1NB2A 2HVEA 3ZTPA 3GP9A 1B99A 1NSQA 5BXIA 4ANEA 1JXVA 1B4SA 4UOHA 1LWXA 1BE4A 1NSKL 1UCNA 2DXDA 4W98A 2AZ1A 3BH7B 2HURA 3VGTA 2DY9A 3ZTQA 3NGUA 1S57A 4HR2A 1NLKL 1NHKL 3BH6B 1MN7A 2BEFA 1WKKA 3EVWA 1BHNA 1U8WA 2DXEA 5CABA 3NGTA 1S5ZA 1NDPA 3NGSA 3R9LA 4F36A 3EICA 1ZS6A 2AZ3A 4DZ6A 3EVOA 5C7PA 2NCKL 1VYAA 4WBFA 3DKDA 3VVUA 1MN9A 4ANCA 3EVMA 1NDCA 3BBFA 1LEOA 4EK2A 1NCLA 1EHWA 3FC9A 1HIYA 1WKJA 3Q89A 4DI6A 5CAAA 1KDNA 1S59A 4ANDA 3VGUA 2B8PA 1K44A 2VU5A 3B54A 3DDIA 4DUTA 1NPKA 1W7WA 1PAEX 2DYAA 3EE3A 3EMTA 1HLWA 3ZTOA 3Q83A 3BBBA 3ELHA 3ETMA 1PKUA 3Q8YA 2CWKA 4FKYA 2B8QA 3VGSA 3Q8UA 1NUEA 3B6BA 3EJMA 3FBEA 1NDLA 3ZTRA 3JS9A 4ENOA 3VGVA 4O0NA 3FCWA 4UOGA 2DXFA 3FBFA 1WKLA 2ZUAA 3FBCA 4UOFA 3L7UA 4KPCA 1F6TA 3MPDA 1XQIA 3NGRA 3PJ9A 3FBBA 4CP5A 1NSPA 3G2XA 1F3FA 3EM1A 3ZTSA 4S0MA 1HHQA 1XIQA 3Q86A 5IOLA 3FKBA 2BX6A 3Q8VA 4C6AA 2HVDA 4F4AA 3BBCA 1BUXA 3FCVA 4FKXA 3PRVA 1NDKA 3GPAA 3VVTA 3WX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ENA A;  1NB2 A;  2HVE A;  3ZTP A;  3GP9 A;  1B99 A;  1NSQ A;  5BXI A;  4ANE A;  1JXV A;  1B4S A;  4UOH A;  1LWX A;  1BE4 A;  1NSK L;  1UCN A;  2DXD A;  4W98 A;  2AZ1 A;  3BH7 B;  2HUR A;  3VGT A;  2DY9 A;  3ZTQ A;  3NGU A;  1S57 A;  4HR2 A;  1NLK L;  1NHK L;  3BH6 B;  1MN7 A;  2BEF A;  1WKK A;  3EVW A;  1BHN A;  1U8W A;  2DXE A;  5CAB A;  3NGT A;  1S5Z A;  1NDP A;  3NGS A;  3R9L A;  4F36 A;  3EIC A;  1ZS6 A;  2AZ3 A;  4DZ6 A;  3EVO A;  5C7P A;  2NCK L;  1VYA A;  4WBF A;  3DKD A;  3VVU A;  1MN9 A;  4ANC A;  3EVM A;  1NDC A;  3BBF A;  1LEO A;  4EK2 A;  1NCL A;  1EHW A;  3FC9 A;  1HIY A;  1WKJ A;  3Q89 A;  4DI6 A;  5CAA A;  1KDN A;  1S59 A;  4AND A;  3VGU A;  2B8P A;  1K44 A;  2VU5 A;  3B54 A;  3DDI A;  4DUT A;  1NPK A;  1W7W A;  1PAE X;  2DYA A;  3EE3 A;  3EMT A;  1HLW A;  3ZTO A;  3Q83 A;  3BBB A;  3ELH A;  3ETM A;  1PKU A;  3Q8Y A;  2CWK A;  4FKY A;  2B8Q A;  3VGS A;  3Q8U A;  1NUE A;  3B6B A;  3EJM A;  3FBE A;  1NDL A;  3ZTR A;  3JS9 A;  4ENO A;  3VGV A;  4O0N A;  3FCW A;  4UOG A;  2DXF A;  3FBF A;  1WKL A;  2ZUA A;  3FBC A;  4UOF A;  3L7U A;  4KPC A;  1F6T A;  3MPD A;  1XQI A;  3NGR A;  3PJ9 A;  3FBB A;  4CP5 A;  1NSP A;  3G2X A;  1F3F A;  3EM1 A;  3ZTS A;  4S0M A;  1HHQ A;  1XIQ A;  3Q86 A;  5IOL A;  3FKB A;  2BX6 A;  3Q8V A;  4C6A A;  2HVD A;  4F4A A;  3BBC A;  1BUX A;  3FCV A;  4FKX A;  3PRV A;  1NDK A;  3GPA A;  3VVT A;  3WX8 A; 
#chains in the Genus database with same CATH topology
 2KDO A;  4WII A;  1VS3 A;  1VQP S;  3RW7 A;  4J9O A;  2ZE2 B;  4A46 A;  2MGZ B;  3U1M A;  1C4A A;  2HNY A;  2FZC B;  1JLA B;  5KFV A;  2HHQ A;  3CD0 A;  1YZ6 A;  4YY3 F;  1SVD A;  4QR0 A;  4R25 A;  1VQN S;  1WC0 A;  3AA9 A;  5D4O A;  3G71 S;  2E5L J;  4RKU C;  1YDL A;  2HWT A;  2CXE A;  3B4D A;  4X4T A;  1HMV B;  3CIM A;  4H4M B;  2OH2 A;  3OL9 A;  4OI2 A;  4CDI A;  2UUB J;  1RHR B;  2AJQ A;  4NYP A;  2V8G A;  1VGY A;  2DXE A;  2E9R X;  3C6U A;  3CED A;  1NJW A;  1C4C A;  1FNO A;  2PE8 A;  2HWI A;  2J0S D;  1JLG B;  1CJT B;  2OD4 A;  1J27 A;  3CGI A;  3IM8 A;  4RL1 A;  3ZZP A;  3DU5 A;  4W90 B;  2AJ0 A;  1WJ9 A;  4ED5 A;  3ZZ0 A;  5KG1 A;  1VHF A;  1GTE A;  3DKD A;  4K0K J;  4NLT A;  2K3K A;  1NEE A;  1YRX A;  2FHJ A;  4ZJL A;  3WIV A;  2DGT A;  1U2R A;  1W25 A;  4UW2 A;  3QT7 A;  4ZN3 A;  4RU9 A;  4TQR A;  1N36 F;  2Q6C A;  2HHW A;  2YKN A;  3AQP A;  1HW8 A;  4K7Q A;  3KUG A;  4ZVF A;  5KFL A;  2R2U A;  2FVC A;  1TUW A;  2Z2Z A;  2G9O A;  1RLC L;  2RVJ A;  1KFD A;  2YH0 A;  4HVZ A;  5I3P A;  4Z7C A;  5KG7 A;  5C42 B;  3R5J B;  2EC2 A;  1NKB A;  1HIY A;  1HNX J;  3ULH A;  4JI2 F;  3DLG A;  5CAA A;  4LRF A;  4DQQ A;  1WUU A;  1JLC A;  1E6Y B;  4I68 A;  1QD1 A;  5HVH A;  1U09 A;  2H9Z A;  3B54 A;  3PYG A;  2EBG A;  4G6V B;  4I7F B;  2M88 A;  3PXG a;  4UOC A;  1R8H A;  1N48 A;  3M6U A;  4JI8 F;  3UO0 A;  3BYR A;  4DL0 C;  2EKN A;  4F2S A;  1FJG J;  1HQE A;  4DFP A;  4X4U A;  1BWV A;  1HLW A;  1CSJ A;  2XYP B;  4ZPT R;  4CRJ A;  4DF4 A;  1EAR A;  2F63 A;  1V9O A;  3BGR A;  3OVB A;  3IRX A;  3G6Y A;  1VK3 A;  2CIM A;  2QA4 S;  1IKW B;  3ZZZ A;  4P52 A;  5A8K A;  2MKK A;  4E0D A;  3FDS A;  4RW4 B;  3NNH A;  1PKU A;  5KFC A;  2C3M A;  4R5P B;  4EYH B;  1LXJ A;  4F50 A;  4DR6 J;  3H20 A;  4PG4 A;  4ZK7 M;  2CPE A;  4U67 Q;  1YI2 S;  2NYI A;  1YJV A;  2CZ4 A;  2UUB F;  3QAT A;  2KN4 A;  1QTM A;  5G0R B;  4WZQ A;  3D3C J;  2ERR A;  4V19 J;  2VON A;  3FBE A;  3FQL A;  2IM1 A;  2CG8 A;  1X9W A;  3J7A N;  4FDF A;  1WC4 A;  1S48 A;  1Q0N A;  3M9O B;  6FDR A;  4USI A;  2IMW P;  1ELO A;  3ILJ A;  4P6Q A;  3J7A 1;  3R97 A;  1AFI A;  3FZ2 A;  3U1N A;  4C3K A;  2DHH A;  4MIA A;  1MW7 A;  3NGR A;  2D9O A;  3IAM 9;  4O3P A;  1PJ5 A;  1TFW A;  3G8S A;  3MCO A;  3DRY A;  3SFG A;  5A8R A;  1NM2 A;  3N01 A;  1FES A;  1TKX B;  3QQC D;  3QWU A;  3HSJ A;  1N5Y B;  1GAO A;  2J8S A;  1WF2 A;  2QMW A;  3HT3 A;  2GML A;  1P8G A;  3AAW B;  3GQC A;  1L3V A;  3MOZ A;  4DCJ B;  2HBY B;  4E98 A;  4IRC A;  2MSS A;  4LFC F;  3OVA A;  4KT0 C;  3JAM U;  3KTQ A;  3CW2 C;  2VOP A;  2HYI B;  1VBY A;  5LMN J;  2HQD A;  2BX6 A;  2ZOG A;  5DQG A;  2A18 A;  1Q5V A;  4YP3 A;  3KMS A;  4JI6 J;  4DLG A;  3T5H A;  4RNO A;  2ZH3 A;  5ETQ A;  3V6K A;  1R8P A;  2DR7 A;  2ZJQ Q;  4NPO A;  2IYI A;  2HHV A;  1SIZ A;  3HVA A;  4CLK A;  2I5J A;  1Y10 A;  2VG7 B;  4QPX A;  2OO4 A;  2ROE A;  2DH9 A;  1RT5 A;  2XYG B;  2Y0S D;  3MZI A;  4CIO A;  3PW4 A;  2C2R A;  2KTQ A;  1ZAV A;  4QIF A;  4Q45 A;  4EBD A;  4OZ5 A;  3DXB A;  3VZH A;  1PJ7 A;  2P9G A;  3QGI A;  5HO4 A;  1TUV A;  2GO8 A;  2W2Q P;  3KLH B;  3D1H A;  2AYE A;  4NX9 A;  1GT8 A;  2ZZN A;  1AFJ A;  3MD1 A;  2CJA A;  4WE1 A;  2QFJ A;  2XB2 D;  1YBA A;  3I0S B;  2H54 B;  2ZBI A;  1BE4 A;  1UCN A;  2X1A A;  1KTV A;  1S9G A;  3PDN A;  2E7W A;  4M5J A;  2DNY A;  3KUH A;  4DJB A;  2W9A A;  2C22 A;  2RKI A;  4AXI A;  1T11 A;  4ID5 A;  3C46 A;  2OPS A;  1ZTT A;  1JIH A;  3RAQ A;  1OY9 A;  5KFH A;  2BAC A;  3SQG B;  5J2N A;  1RTZ A;  2NXC A;  1PC4 A;  4AFF A;  4NXM F;  1U2F A;  3BH6 B;  4M5H A;  1S6P A;  5LSL A;  4KHR A;  4PG5 A;  1CC8 A;  4OZL A;  4IH7 A;  1T03 B;  4B3T F;  1VLY A;  3GII A;  1FKP A;  1RT3 B;  4RW6 A;  3OLB A;  3EVO A;  4J9K A;  2GV1 A;  2AD9 A;  3FMB A;  4K4X A;  2SXL A;  1D9F A;  1YTY A;  3CCT A;  3LGN A;  2IM2 A;  1S1U A;  2KRB A;  3TAN A;  1UTA A;  4WFN Q;  2DNG A;  3H0P A;  2JOQ A;  1LW0 A;  1UP1 A;  1PBA A;  1RXO B;  2DR6 A;  4YB5 A;  1MWY A;  1UEU A;  2O1P A;  2PGC A;  3EVM A;  3GV5 B;  1VQ7 S;  4F3O A;  3MMC B;  3P6Y C;  4FVM A;  3W5X A;  2E9T A;  1O5J A;  2KT5 A;  3IR5 B;  1EHW A;  2B6A A;  4OYX A;  4R0J A;  4DV0 F;  1NJZ A;  2R42 A;  3HZE A;  1AUD A;  2A10 A;  3PW7 A;  2ASD A;  1WTB A;  2L48 A;  3LPY A;  1MU2 B;  2VFT A;  3DRS A;  1I6J A;  2LQ5 A;  2B9X A;  4IQX A;  3KLV A;  4A8W A;  1SQE A;  3AXM A;  4I6W A;  1NH8 A;  1D8Y A;  4NMX A;  5L38 A;  4Y2K A;  1L3T A;  3ZZT A;  1T03 A;  1M90 T;  3HDS A;  3IO1 A;  1G7C B;  1WDD A;  2M52 A;  2ZNY A;  2KG0 A;  2RQM A;  2C2D A;  1NK5 A;  2XMV A;  3C66 A;  4HEA 9;  1RTJ A;  2GS8 A;  2H4Y B;  4B9U A;  3QJP A;  4RBT A;  2DHG A;  4WK1 A;  4K4S A;  1ZM9 A;  4OIX A;  4OJG A;  1R8C A;  4ECS A;  3ZNJ 1;  4IG0 B;  2ZVI A;  4OI0 A;  2GJF A;  2C2M B;  2LKZ A;  3RRG A;  4ILL A;  2GHW A;  3EDR B;  2JSX A;  4D3H A;  1JLB A;  3VGS A;  3HM9 A;  1QTN B;  3W9J A;  4LF6 J;  2HMI A;  2DR5 A;  4Q8E A;  4NML A;  3ZC4 A;  5I4M A;  3OSN A;  1CJT A;  3PEJ A;  1NDL A;  1FWK A;  1IXK A;  4O44 A;  5BYR A;  1E6V A;  2BM1 A;  4QCL A;  5KFQ A;  1VBZ A;  1RAG B;  4OI3 A;  5DZ6 A;  1VQ4 S;  1DRZ A;  1UW9 A;  1U8S A;  4DEZ A;  4DV4 J;  2W2P P;  3CC7 S;  3GSI A;  3HO1 A;  1S6O A;  3CCU S;  3MUV P;  3ILO A;  1TZ0 A;  3BO3 A;  4PXB A;  2YWG A;  4DSK A;  2EWH A;  2R2R A;  3SDE B;  4N47 A;  4DS4 A;  1Z4U A;  1I94 J;  1JLF A;  2Y1L B;  3G82 A;  1I51 B;  4C97 A;  1PG5 B;  1UVK A;  4BLG A;  4JI2 J;  3O5T B;  3T5J A;  2X1G A;  2ZH5 A;  3C6U B;  4PZV A;  4PR6 A;  3SCI E;  3EZ5 A;  3Q2T C;  5F8J A;  4G3I A;  2XHC A;  4HTJ A;  4TNO A;  4WYW A;  1OPZ A;  3B4M A;  2OPP A;  1RT6 A;  1T0T V;  1FTC A;  2YNF A;  1YLX A;  3J7Y I;  2F40 A;  3HLU A;  3JSB A;  5B0A A;  3S1T A;  4M5N A;  4LF2 A;  2YWW A;  4ZKA A;  5F8L A;  2R8J A;  2MY7 A;  4J9S A;  4ZOS A;  2YKN B;  2PD1 A;  3UDL A;  1KEK A;  3HKW A;  5GMK a;  2OTJ S;  4K4W A;  1SIW B;  2D3O 1;  4GVL A;  4IYQ A;  2EFN A;  5GAE U;  4P2M A;  2EFP A;  3WBZ A;  4QYR A;  5HLF B;  1S0O A;  4DHV A;  4U7U D;  1WTF A;  4TY9 A;  3DOK B;  4RW9 A;  2PDA A;  4USM A;  5G0R A;  2YPZ A;  4EMD A;  5L46 A;  1FRH A;  4Q2M A;  4XO0 A;  1NSQ A;  5F0U A;  2MJN A;  4KKO A;  3OXF A;  2W9C A;  4UOH A;  1K73 T;  2B9W A;  3T3F A;  2N3L A;  3TR5 A;  4RW8 B;  4W98 A;  1TK5 A;  4K5S A;  1QDU B;  2QLJ B;  1EJ7 L;  3C14 B;  1KWM A;  1S12 A;  2DY9 A;  2M70 A;  5LSR A;  4QWA A;  2XI3 A;  1OIA A;  3HD1 A;  5A8K B;  1TEL A;  2WRM A;  4YFU A;  4DUY J;  1UVL A;  2YX1 A;  4KIA A;  3IS9 A;  3RB0 A;  3DC2 A;  2QTW A;  4IR9 A;  2PA8 D;  3AOC A;  2KM8 C;  3WHI A;  1N34 J;  5E3R A;  2F8M A;  4IOA Q;  1RAA B;  4KO0 B;  4URS A;  1JXE A;  1WEY A;  3D0G E;  2QLF B;  5CQG A;  2OI2 A;  1D3W A;  4LBH A;  2UXD F;  3MCN A;  3QAU A;  4WXO A;  1DZ5 A;  2EFV A;  2JLF A;  1EB0 A;  1T9T A;  5BR8 J;  2DGS A;  3I55 S;  3G6V A;  4YDX A;  2ZM6 J;  3BSC A;  1NU4 A;  2AF6 A;  4Y3C A;  4ECW A;  2VHG A;  5EX0 A;  1VQO S;  1SL1 A;  3MM9 B;  4ZN1 A;  1U6B A;  3QFH A;  3BBF A;  3TZX A;  4X4Q A;  2BVZ A;  2BAB A;  3CJS A;  1T9V A;  2XZT B;  4LVN P;  1NKC A;  5CYJ A;  2XUL A;  3UVJ B;  2R7T A;  1RU1 A;  2AEJ A;  1TKX A;  2E5H A;  3AD7 C;  2FVQ A;  4B3M F;  1YIT S;  3FSI A;  2W25 A;  2CJB A;  3GTY X;  4RU2 A;  2I2Y A;  2OEM A;  3PYD A;  2OUG A;  5DDR C;  2ZEJ A;  5A2Q U;  2DRB A;  2ILY A;  1VOM A;  2LMI A;  2AQ4 A;  2CPD A;  3PJW A;  4M5L A;  2H5E A;  3VV2 B;  3BO2 A;  3HVR A;  4Y2A A;  2CNO B;  1BY9 A;  1AYE A;  2P9E A;  3Q83 A;  4OX6 A;  1RYR A;  2BE2 B;  2HQG A;  3DMJ B;  3TRG A;  5IWA J;  5T14 A;  4CH0 S;  3QSY B;  4NWB A;  3R8Y A;  2D74 B;  2O01 C;  1M5K C;  3OHB A;  4AXJ A;  2I5J B;  2CPY A;  3FQK A;  1ZM2 A;  2B7B B;  2XNQ A;  3SQG A;  2M8D B;  1T8E A;  3VAM A;  5HMY A;  2NXE A;  3ILL A;  5C2G A;  7FD1 A;  1XMB A;  2V50 A;  3N0V A;  1VQM S;  1F0X A;  1TL3 B;  1PSD A;  2APO A;  1N52 B;  2QYG A;  2P6T A;  2Z2Y B;  3D5M A;  1B0V A;  4LR8 A;  3RTV A;  1NUE A;  4LQ9 A;  5E3A A;  1HHS A;  2JWN A;  2M4M A;  3AB2 B;  2UVU A;  4HDH A;  4OYP A;  2QLB B;  3QLH A;  2COL A;  5CYQ A;  1S9F A;  4X66 F;  1SBR A;  3LGH A;  3FBF A;  1HNW F;  1TMM A;  2XMK A;  3OL8 A;  2DO0 A;  2C2N A;  9ATC B;  3DLL Q;  3W3S A;  3M8S A;  3N6N A;  4PQU A;  1HI0 P;  4RBU A;  5JVG Q;  2ILZ A;  1U26 A;  2BW2 A;  4NCG A;  3TUZ C;  2DB1 A;  2ROG A;  1YGY A;  1YK9 A;  2HGN A;  1VQL S;  1SQG A;  2RNE A;  3FBB A;  1FFG B;  5EDW A;  1S79 A;  1YJW S;  1ZTW A;  2CWX A;  2RU9 A;  1YJ7 A;  2QL5 B;  2L08 A;  3QT5 A;  3VAG A;  2RJZ A;  3CJ2 A;  2LA6 A;  4HH1 A;  4HT5 A;  1X5S A;  1TUG B;  1TV6 A;  1VBK A;  2VG6 A;  1HNI B;  1OMS A;  1UJ5 A;  2KJV A;  3R6G B;  5KT7 A;  2W9B B;  2FIU A;  3CME S;  5E41 A;  4G1Q B;  1BXN A;  3HJF A;  5U47 A;  1T05 A;  3P3D A;  4JI7 F;  4AL6 A;  1RAI B;  2CQH A;  3MCM A;  2OPQ A;  4RO0 A;  5ETO A;  4URQ U;  2AV5 A;  4RUB A;  4RWW A;  1TL7 B;  1HWL A;  3F56 A;  2F9J A;  1OYD A;  3I9Z A;  1EQM A;  3SFU A;  2LXI A;  3VQT A;  5DLF A;  2R7U A;  1VCT A;  3ISN C;  1MML A;  4FYY B;  2YBV A;  1MU2 A;  1W2I A;  3DRS B;  4KB7 A;  1NK8 A;  4WP8 A;  1WC6 A;  4MKB A;  2A2D A;  4WPA A;  2HMI B;  1SC3 B;  4J7C A;  1NB2 A;  1UWA A;  2QLX A;  1WSV A;  4H54 A;  3VR1 A;  2AW0 A;  4USH A;  2F4V F;  2V9K A;  2YKQ A;  1YKW A;  3HHK A;  5KT6 A;  4DR2 J;  3MPW A;  5KG2 A;  4ZLP A;  5FLX Y;  3BRE A;  1N56 A;  2AZ1 A;  3CE8 A;  3M8R A;  1HAR A;  4JYA J;  3HPO A;  1OY8 A;  4W4M A;  5MLC V;  4B9L A;  2CRL A;  2B9Y A;  3DLK A;  4C8M A;  1XMQ F;  3AFG A;  1R6V A;  1NLK L;  4F0M A;  2G4B A;  4X62 J;  4DR1 F;  2HQ3 A;  4J37 A;  1HBM B;  1JLB B;  1W26 A;  2B43 A;  2W4P A;  2VPX B;  3F44 A;  3SEO A;  2R8I A;  1S5Z A;  3DXS X;  3NGS A;  3PW5 A;  5L1I A;  3EZO A;  3JXO A;  5FDL B;  4A47 A;  1CQN A;  3BB5 A;  2IBK A;  3PO4 A;  4ZCI A;  3NS6 A;  1SJQ A;  2VBY A;  1B7F A;  1E6V B;  2L9D A;  3MMA B;  4RUC A;  4I2Q A;  1FJ7 A;  2V4R A;  1FRM A;  5K20 B;  2RIJ A;  3MPV A;  1XNQ F;  2GVD B;  3MR6 A;  1N33 F;  3VVU A;  5DDQ C;  2UZA A;  3LQV A;  4LRB A;  4RUA A;  2BDP A;  4ELV A;  2WSF C;  4NI2 A;  2QN6 B;  2AMC B;  3JAM Y;  3D6F B;  4DV5 J;  2GVZ A;  1D9A A;  4C8N A;  1ICE B;  1LEO A;  3MD3 A;  4EK2 A;  1SJ4 P;  2VZ9 A;  2W2M P;  3FC9 A;  5CA5 A;  2NLW A;  5D0G A;  5HLF A;  4FYV B;  3TUJ C;  4DX7 A;  2AHO B;  3VGU A;  3DOK A;  5BYS A;  2KZZ A;  3D7S B;  3MDF A;  4L76 A;  4U96 A;  2BJ8 A;  4PG6 A;  4AQY J;  3QRQ A;  1NHV A;  2YNF B;  4KKO B;  3FEX B;  3EE3 A;  1APS A;  3BSO A;  2WSC C;  4KGM A;  4ZVE A;  4C48 A;  5I42 B;  3E01 A;  4PRF A;  1QUV A;  1U45 A;  1IKY B;  2VKR A;  2YKM A;  2UV8 A;  4KBI A;  4J91 A;  1C0U B;  1X4E A;  2QA1 A;  4Z2X A;  4KAI A;  1RI7 A;  4C8K A;  4CNY A;  2BQU A;  1UPP A;  2V9W A;  5IQQ A;  4KFB A;  3MM7 B;  4GVB B;  1T9W A;  5IC6 B;  2C3P A;  4DF8 A;  2QRR A;  2ZC3 A;  4DCP B;  1GMV A;  1FDA A;  2HGL A;  4QIE A;  3DDK A;  4DR3 J;  1Y5L B;  1G6B A;  1WD6 A;  2H5J B;  4ZVO B;  4DPO A;  3JYT B;  2NR0 A;  1AT1 B;  3MCS A;  4LIW A;  3PO5 A;  5KFK A;  3DM2 B;  2VFS A;  2DGU A;  2OSR A;  3NAH A;  4V1A k;  4RUH A;  2N82 B;  2JL9 A;  2AYB A;  4Y65 A;  2HK3 A;  4DWI A;  4G65 A;  2VBX A;  1XMO J;  1FHT A;  2IHR 1;  4OZ1 A;  2XYH B;  4UT4 A;  3C14 A;  4KPC A;  3N9U C;  1HBO A;  3ET6 A;  4JI4 J;  5FD1 A;  4DR2 F;  3R5C A;  1RZM A;  5D4P A;  2F4V J;  4H4K A;  4JI6 F;  1K8A T;  2J5A A;  5D0R A;  5AXN A;  2WVF A;  2UVR A;  2K3I A;  2ZBP A;  4LF7 F;  1UFK A;  4I67 A;  2KYZ A;  2NUU G;  2HQF A;  4YS2 A;  3D0H E;  4TXS A;  1NPR A;  4Y2M A;  4OI6 A;  1IJE B;  3THP A;  5CD4 H;  2KYX A;  4OX8 A;  1XWL A;  5HN0 A;  2XO6 A;  4OYA A;  5HVF A;  2HVD A;  3IN5 A;  5B0F A;  4EZ6 A;  3CXC R;  2JZ5 A;  3DYA B;  3I82 A;  3AOB A;  1RKJ A;  3CO9 A;  2CQ1 A;  2I9S A;  4ED2 A;  2J7K A;  1SKS A;  3JQM A;  4OJ3 A;  4DSL A;  4LF5 F;  4ZPC A;  4B3R J;  2DNL A;  1H3D A;  1PIL A;  3M1V B;  1WG4 A;  4M5M A;  4KGV B;  2P9C A;  4I6A A;  4IFY A;  3CCQ S;  3CO0 P;  1RTH B;  1FX4 A;  3TQE A;  1HPZ B;  5EWF A;  3GIM A;  4ZDN A;  5GAD U;  1OPI A;  2LQ9 A;  2XMT A;  3AHP A;  3A8I A;  2N4D A;  4WIQ A;  3TVK A;  2NXJ A;  3NWG A;  3PAC A;  3UCZ P;  5IT4 A;  1VDH A;  1B99 A;  2XSJ B;  1VC0 A;  2HHH J;  3QAE A;  2KH9 A;  3LGM A;  2LYV A;  4DR6 F;  4ZIT A;  1LWX A;  1T9Y A;  3VAK A;  2KL8 A;  3A8E A;  3JQK A;  2PO4 A;  3ZFV A;  3BH7 B;  3LTO A;  3M2U A;  3G9C A;  2ZJR Q;  1OQ6 A;  3BQ0 A;  1U1R A;  4I1T A;  4OZN A;  1KQK A;  4UZC A;  4RNN A;  2QC3 A;  2C3U A;  3BPD A;  4CNZ A;  3LWM A;  3V6D B;  1FJG F;  3CCW A;  4K2X A;  4ECV A;  1KN6 A;  2QA4 G;  2KXN B;  1TL3 A;  2AGQ A;  3IBF B;  3L4B C;  2QLW A;  2M5Y A;  4W92 B;  1C0T A;  1S9E A;  3R1H A;  4DZ6 A;  4X65 J;  1N6Q B;  4ZVG A;  2BAN A;  1S7I A;  1R6Y A;  1U6F A;  3I4P A;  2AGO A;  2EFO A;  5M2U A;  3MAA B;  4USW A;  4ZVT B;  5D6G A;  2PFF B;  1GH8 A;  5EUH A;  3RZA A;  4H4O B;  1N5V A;  3RBE A;  1B64 A;  1U1K A;  2WVD A;  1B70 B;  3KHG A;  1SKU B;  3LP2 B;  4PQU B;  2W1B A;  2GJI A;  4P7V A;  1TKT B;  3PX6 A;  1VQ5 S;  2WB1 D;  2B0G A;  4WK3 A;  4NA1 A;  1HI1 A;  2MLX A;  1ZZN A;  1A6L A;  3QZ7 A;  4DQS A;  2K8G A;  3EUN A;  2KFY A;  3D67 A;  3KLE B;  1KDN A;  2XO7 A;  1X0F A;  3CCV S;  2R7S A;  3L3C A;  2VU5 A;  1TV6 B;  4ZJO A;  3M05 A;  3MEC B;  3PCO B;  2VG6 B;  2A1B A;  4J9M A;  2BMB A;  1AZS A;  3TWZ A;  4DSF A;  4B3O A;  4GKK J;  2V6A A;  1JLE A;  2YQ0 A;  1NPK A;  1CBK A;  4JP8 A;  2B4V A;  4LSL B;  4DMZ A;  1TL4 A;  3L7P A;  1NJY A;  1RTI B;  1KNZ A;  2ZM6 F;  1IVZ A;  1TMJ A;  2GIR A;  3KJQ B;  4PAA A;  2W8K A;  1Z2Z A;  3BBB A;  5E2Q A;  1YIJ S;  5B7W A;  3M4X A;  3ETM A;  4RLE A;  3W5Y A;  1LFP A;  1FVS A;  1FXL A;  3MWB A;  2VIH A;  1RB0 A;  2NPF A;  4FXV A;  2OGU A;  2CJK A;  3Q8Y A;  2HBQ B;  3IFE A;  1A9N B;  3G6E S;  3QWP A;  1FDN A;  3NOG A;  2YNH B;  3UNG C;  1N34 F;  2C2Z B;  5E0O A;  2FDN A;  1TQL A;  2FYX A;  2R7O A;  2XM3 A;  3C6T B;  1FKA F;  1H6K X;  3EDQ B;  2HNY B;  4LBI A;  5CH7 B;  3M7V A;  3TVZ A;  1NK4 A;  1VI7 A;  3FCW A;  4UOG A;  5HJX A;  1URR A;  2JNJ A;  2B7C B;  1CG2 A;  4OX9 J;  3THV A;  3IWX A;  2GAH C;  1FXD A;  2IC3 A;  5HQ8 A;  1U25 A;  4P2F A;  3IBC B;  1P27 B;  2MZJ A;  4O4R A;  2W4D A;  4OQJ A;  2UUT A;  3S7R A;  1UFW A;  3S8S A;  1B3T A;  1BQX A;  4NEY A;  3W66 A;  3BSN A;  3MEG B;  4K8R A;  1RWX B;  2Z56 B;  5JJB A;  3PR4 A;  5EGY A;  1JLG A;  3OR1 B;  3G4S S;  2YH1 A;  1FRX A;  4C3L A;  5ETN A;  1DTT A;  3A13 A;  1HNV A;  2J9C A;  4DS5 A;  4I2Q B;  4RW7 B;  4FYW B;  4QWD A;  2EPI A;  2GVD A;  4X4S A;  5IT9 U;  5GAG U;  4ECQ A;  4KQZ A;  4QOT A;  2B4U A;  3E01 B;  4LF1 A;  1D8Z A;  3GIR A;  1KHW A;  2VB6 A;  4UF4 A;  3V4M A;  4M95 A;  1JNR B;  3MAH A;  3T5K A;  1RT4 A;  4LRD A;  5ETK A;  1TL1 A;  2M7S A;  2CQ0 A;  3CF5 Q;  4GVB A;  4PPD A;  1PYT A;  4NEZ A;  3DLG B;  3KK1 B;  1T9U A;  3WX8 A;  2ZH8 A;  2DD8 S;  4OYI A;  3H5Y A;  1LWE B;  3FSX A;  1VJW A;  2OHD A;  1M1K T;  1RA6 A;  2OPR A;  2DHS A;  1LNQ A;  2XMM A;  3FK4 A;  2K06 A;  4N7T A;  2LFV A;  2VH7 A;  1M5V C;  2XGQ A;  1ZAX A;  1KLM B;  4MFB B;  4EZ9 A;  3DCA A;  2Q3P A;  3PHT A;  5I42 A;  1Y3K A;  3I87 A;  1RQ0 A;  2E5J A;  4UZB A;  1HA1 A;  4NLR A;  2HLU A;  3LP1 A;  3NGU A;  4MKV A;  3W62 A;  4XPE A;  3MUT P;  3EGW B;  4HR2 A;  4FN5 A;  3M8P A;  3LAN A;  2JEJ A;  1CEZ A;  1FXR A;  2E66 A;  1DHM A;  4ZHR A;  3TEH B;  5IT0 A;  4XDD A;  3UR0 A;  3MOJ B;  1WKK A;  2MZR A;  2Q6B A;  4ED8 A;  4UY8 T;  1NDP A;  2KU7 A;  1HL6 A;  3R9L A;  2HHX A;  1FDD A;  1K1S A;  2E1A A;  2AZ3 A;  3W8G A;  3OFE A;  5KFD A;  2XCA A;  2NZ4 A;  5IM0 A;  2XCP A;  3OT9 A;  4JI1 F;  4ZPW R;  4LRA A;  3BSA A;  3DN9 A;  4LRE A;  3OFF A;  4ES1 A;  3PVX A;  1MMN A;  2B5J A;  2DKO B;  4O3Q A;  2MB0 B;  1S99 A;  3MTK A;  5L9X A;  3TNV A;  1CQM A;  2HHS A;  2VV5 A;  4OLP A;  4OYO A;  3VAH A;  1KVI A;  3I5C A;  4ANC A;  5H9F K;  4OFZ A;  4WFZ A;  4CLZ A;  2P2C B;  1JX4 A;  1UET A;  2IAJ A;  3F41 A;  5C24 A;  2KVQ E;  1NPP A;  5J2P A;  3PV8 A;  2J6T A;  2C2K B;  3CSK A;  1H98 A;  2X1B A;  4LUB A;  4TYB A;  3ISZ A;  1ZBT A;  2CUY A;  2ASY A;  2YKO A;  4DI6 A;  4O3N A;  1HBN B;  1GTH A;  1HWI A;  2HFO A;  4C7Q A;  4DUZ F;  1TFY A;  2DO4 A;  1LK7 A;  3TYT A;  1BWE A;  2XSJ A;  4LF7 J;  1GXT A;  3K57 A;  5HSP A;  1AB8 A;  4FZV A;  1TAQ A;  2HHP A;  4RWX A;  3EMT A;  1J2V A;  3EPI A;  4YOE A;  1X5P A;  4JV1 A;  2CG4 A;  2IM3 A;  2VD3 A;  1TU0 B;  4O0I A;  3IC1 A;  4CTA A;  2C2O B;  3TAP A;  4ZP6 A;  2E1P A;  3PKY A;  3M2U B;  3UD3 P;  5GAG I;  3ELH A;  2EG2 A;  4OZJ A;  3P96 A;  4LRC A;  2MZ1 A;  1XMO F;  2PEB A;  3M6X A;  4R0E A;  5ETL A;  2ZOM A;  3OHA A;  3EGN A;  2ZZM A;  2W2O P;  1VMB A;  3A3P B;  3LAM A;  2V68 A;  2XWX A;  2HWH A;  3KJF B;  4MYU A;  4Y34 A;  4A8O A;  5HMX A;  5K8P A;  4A8K A;  3QJL A;  1UL3 A;  4UQT A;  2ABY A;  5DDO C;  3LH2 S;  1SC4 B;  3U02 A;  4C0H A;  1Q95 G;  1S9E B;  3EJM A;  4DR3 F;  3POT A;  4AE5 A;  4F04 B;  1N6Q A;  2Q66 A;  4QWB A;  3PKM A;  2FPH X;  2EBE A;  1WAC A;  4O0N A;  3GYN A;  1BQM A;  5J1E B;  2RKI B;  3K2Y A;  3WQP A;  3M8W A;  5T7L B;  1WG5 A;  1FD2 A;  3MM8 A;  3LP2 A;  4NA3 A;  3NNA A;  3MAQ A;  1QAJ A;  1ZPV A;  2FHJ D;  2VG5 A;  2A3J A;  3H2U B;  1FRL A;  3N79 A;  3NOC A;  4JOU A;  5KFY A;  2BRK A;  1NH7 A;  1SH0 A;  2D3U A;  3G2X A;  4NLX A;  2VQE J;  1SKW A;  1V3R A;  4DSI A;  1LW2 B;  1H2U X;  3PJX A;  4ZVU B;  4UQG A;  2I8E A;  2FLL A;  3VAJ A;  4ES3 A;  3CCE S;  4QR2 A;  2BQR A;  4JI0 J;  2Y1I A;  4KTQ A;  1NZA A;  3TUI C;  3OFG A;  4NZ7 A;  2E1R A;  3L95 X;  1JQG A;  3EYZ A;  2G0C A;  3T9N A;  3MAA A;  1JLE B;  4HYK A;  1B0P A;  4K2J A;  3FKB A;  4C2M A;  1S1U B;  3D3B J;  3F73 A;  3Q23 A;  2Z57 B;  4AYB D;  1XC9 A;  1Q81 T;  4YB7 A;  5DS7 A;  3CTR A;  1SV5 A;  1QJH A;  4LF9 F;  2BJE A;  5D78 A;  1IKV A;  1JK9 B;  1R27 B;  3PY8 A;  4AL5 A;  1IN0 A;  5L1K A;  1U0H A;  4L75 A;  3NXZ A;  2H1Y A;  4MK8 A;  4DFK A;  1L3K A;  1R43 A;  3LPE A;  4Y00 A;  2DEJ A;  3DOM A;  4A8Q A;  5HI7 A;  4OHW A;  2ZHO A;  4JUZ A;  2DPI A;  4CM0 A;  1SJF A;  2MKY A;  4M63 A;  5A6P A;  1UVM A;  1U4B A;  2PMZ D;  3MHY A;  4MYT A;  4P10 A;  3ZTP A;  3HMJ G;  1U1Q A;  1NZ8 A;  3C6T A;  3ENW A;  4HI2 A;  3DFE A;  4I6Y A;  1XBW A;  1YJN S;  4B3O B;  3W64 A;  2UUA J;  1OWX A;  1EP4 B;  1Y11 A;  2I1R A;  2MQM A;  3UCG A;  2OJ3 A;  1QAY A;  1R0B G;  4LVO P;  4Q8F A;  2A6M A;  2OML A;  2EFG A;  5KT2 A;  3OFH A;  4NYZ A;  2UUA F;  2MLY A;  2CPZ A;  1S57 A;  3GJQ B;  2Q43 A;  2JEF A;  4M5D A;  1MG7 A;  2VKZ G;  5E3Q A;  4FF3 A;  3KLI B;  4WCE Q;  2WZ1 A;  1CJK A;  1BD6 A;  2BEF A;  2CA9 A;  4KHP F;  2ZH2 A;  3EX7 B;  1KR4 A;  2MJU A;  1IUJ A;  2YNH A;  4PXE A;  4CLU A;  1KOO A;  5D8H B;  3S6E A;  3JSM B;  3FEY B;  4LJM A;  2V63 A;  1M1G A;  4O44 B;  1DTT B;  2IMO A;  3GIJ A;  2FHO B;  4ZIW A;  2VA2 A;  4TU8 A;  1SL2 A;  1M5P C;  4KPY A;  5ETV A;  4OYB A;  1RWN B;  1T02 A;  5L39 A;  4DV2 J;  2FLN A;  2VJU A;  4CI0 B;  4DV7 J;  1CJU B;  1RAJ A;  2MXY A;  1RTD B;  4JI8 J;  1D09 B;  3H59 A;  2VBW A;  2WVC A;  2Y0B B;  3BJY A;  4FXD A;  1KBR A;  2WOM B;  1RGV A;  3D28 A;  2J0W A;  3HFZ B;  2OFH X;  2CYY A;  5KOX A;  4EGL A;  4CT9 A;  2JEI A;  3VF0 B;  1WHV A;  2WON A;  2XSF A;  3LP0 B;  3PM9 A;  3KK1 A;  1NK6 A;  2XEX A;  5DM7 Q;  3KJV B;  2GAG C;  3EXC X;  2OPP B;  4Z7Y A;  2XMA A;  4WFX A;  2OPR B;  3CC2 S;  3QMQ A;  3CCL S;  5F9N A;  3KWM A;  1VQ6 S;  3MM5 A;  2DR9 A;  2CPX A;  4MFB A;  2DGV A;  4RR5 A;  1NHU A;  3HKZ D;  2JFK A;  1XR7 A;  2CJY B;  5HAN A;  4MH8 A;  3WX4 A;  3D68 A;  2W24 A;  2YNG B;  3AH6 A;  3I31 A;  1RT4 B;  1YVF A;  3MR5 A;  1NME B;  4HHU A;  2R7V A;  2KVI A;  4D3G A;  2G1D A;  3K8V A;  3QNW B;  3FJ2 A;  4J9R A;  2NPI A;  5HQL A;  3TZY A;  2V2V A;  2A6O A;  1EQ0 A;  4RW9 B;  4K4U A;  1BLU A;  4ECR A;  1UWB B;  3ITH A;  2BV3 A;  1VR6 A;  5J2Q B;  3PNI A;  5D0E A;  1R89 A;  2WB4 A;  1KLM A;  2W4C A;  3M8Z A;  1T94 A;  3L09 A;  3KFW X;  4RW8 A;  5JVH Q;  5J2M B;  3DGP A;  4DR4 F;  3LP1 B;  3TZZ A;  1CS4 A;  1Y3J A;  2GJ2 A;  2Y8W A;  4ITS A;  3M6V A;  5F8M A;  2GCF A;  2RF2 A;  3CVK A;  2EK1 A;  2FJX A;  4IUF A;  4CT8 A;  4BC7 A;  3BQ2 A;  4DR7 F;  5H1S V;  1F3F A;  2NYH A;  3ENQ A;  4KO0 A;  1EAY C;  3ZTS A;  1HBN A;  4OX7 A;  2UVV A;  1RAO A;  3ZZU A;  4DSE A;  5J1N A;  4LFB F;  2ZZT A;  1J5O B;  1TP7 A;  4DG1 A;  1UZD A;  4KSE B;  4DV1 J;  2QEX S;  2HBZ B;  1X4F A;  3SBM A;  3GFH A;  2B5J B;  3VHQ A;  3RR7 A;  1SH3 A;  3BM7 A;  4YHH J;  2U2F A;  3B78 A;  2VFV A;  3E3X A;  3IXQ A;  4WXW A;  4NLW A;  3TX8 A;  4CTA B;  1I3O B;  2DCL A;  1S6Q A;  1FI4 A;  1BUX A;  1PJ6 A;  3MED A;  2AU0 A;  3ZZR A;  2IAJ B;  4RJV A;  1GMU A;  2ZOF A;  4C4W A;  1F2G A;  4B02 A;  4DFM A;  1BC6 A;  3QPI A;  3NCQ A;  2E1C A;  1N32 F;  1SQF A;  1N5S A;  2LQB A;  4ED1 A;  3V81 B;  2HGM A;  2HBR B;  1IQT A;  4ZPA A;  4ED6 A;  3PW2 A;  4WF9 Q;  2J7W A;  1EX8 A;  2DNN A;  3D66 A;  4CO1 A;  2CZ9 A;  2ATL A;  5AJ3 J;  2VAS A;  1WHW A;  2HZA A;  4Y0F A;  1SJR A;  2VFU A;  4HAC B;  1ACM B;  5A0Y B;  4ZVS B;  2ZFH A;  3GYX B;  1NSK L;  1RWO B;  2MKJ A;  5IV3 A;  2KM8 B;  1Q8I A;  1UVN A;  3OXG A;  2GZO A;  3D6T B;  5DG7 A;  2KHD A;  3OL6 A;  1G3O A;  1PYO B;  2IFX A;  2BE2 A;  1P9Y A;  2OKQ A;  3DMJ A;  5T7L A;  3W63 A;  2D9P A;  1REV B;  1IBM J;  1MWQ A;  2HHU A;  2VPZ B;  4E8U A;  3JTN A;  1XN9 A;  2VDI A;  2RML A;  2BJ1 A;  4M1K A;  1H72 C;  4RNF A;  5KT5 A;  2ZH7 A;  1MN7 A;  4KJI A;  5CCM A;  2V4Q A;  3BKT A;  5CZV A;  2R7R A;  4ZLJ A;  5CAB A;  2FVS A;  4PUO B;  2LDI A;  2IRU A;  3MF5 A;  3SCJ E;  3CDA A;  1QY7 A;  2K2P A;  2JHE A;  2V4J B;  3GJR B;  3T6J A;  1RIS A;  2LXF A;  3LUY A;  5F0W A;  2W7O A;  4B9S A;  5DM6 Q;  2OMO A;  4K4T A;  3RBD A;  3HSZ A;  3QYY A;  5ETT A;  2IA6 A;  1CVJ A;  2NCK L;  1VYA A;  2RH3 A;  1U1O A;  2FJD B;  3KK2 B;  3UDV A;  5DG8 A;  3T1A A;  1XNR F;  1S1T A;  1WOO A;  2WSE C;  3MI7 X;  3UCU P;  2X51 A;  1RWP B;  4NLU A;  2HVZ A;  2HNZ A;  5DRK A;  3D6H B;  4BWJ A;  2VQF F;  2RRN A;  1P1T A;  1Q16 B;  3UE2 A;  4HHJ A;  4CO3 A;  5A76 A;  5J1P A;  5D3G B;  2CNL B;  5K5M A;  1SUQ B;  1FF2 A;  3R2C J;  5E33 A;  1IKX B;  2BKN A;  4OZ0 A;  3WZ0 A;  3KMQ A;  4O3O A;  8ATC B;  3K5L A;  1ZOT A;  3NCP A;  2IJR A;  4ZS6 A;  1CJV A;  1QAX A;  2L3M A;  1Y9O A;  4DUT A;  1DQ8 A;  1RWM B;  2IJF A;  4G1Q A;  2NQP A;  4DN0 A;  2DYA A;  1EP4 A;  2EEY A;  1I94 F;  2J9E A;  2IDL A;  3OR2 B;  3QT6 A;  2KT3 A;  3BN7 A;  4PCQ A;  2IIH A;  2BKO A;  3D1Q A;  5DET A;  2LU2 A;  5C25 A;  1TL7 A;  2FGO A;  3Q22 A;  4M5D B;  1U0H B;  4WU2 A;  3BYP A;  4CO2 A;  4P75 A;  2DIS A;  4HDG A;  2FLO A;  3DOM B;  3HI9 A;  4KV8 A;  4Y2I A;  3M2V B;  1LXN A;  2CWK A;  2KKH A;  3NLC A;  3QSI A;  4P9S A;  5HQM A;  2OSQ A;  4IR1 A;  2KRR A;  4LR9 A;  4PAB A;  3W65 A;  5D0H A;  1U7L A;  2O66 A;  4C0B A;  3TI0 A;  1SL0 A;  2CQB A;  1F9E B;  1AA1 B;  3TOQ A;  3OUY A;  2MGZ A;  3JSM A;  3OJS A;  1F60 B;  1PIE A;  2V8D A;  4DOZ A;  4LF4 F;  3I5B A;  3MR7 A;  5KG5 A;  2MQP A;  2QZ8 A;  1K1Q A;  2UU9 F;  2JC0 A;  4KHM A;  2FJB B;  1RTD A;  3CCM S;  4YHH F;  1K0T A;  1MRO B;  4KGK A;  4NOH A;  2XMW A;  3DDN A;  4H4M A;  3P5T L;  4F4Y A;  2DGW A;  1K47 A;  4OZ3 A;  5HK4 A;  4JB8 B;  4FBU A;  3QJJ A;  1RT1 A;  3VCD A;  2MKS A;  2LU1 A;  2YVS A;  4AD6 A;  4DR7 J;  4CH7 A;  1HHQ A;  3UD5 A;  3I56 S;  2PN6 A;  1JJ4 A;  3B8H A;  5IT9 Y;  1GK8 A;  3D2W A;  1YHQ S;  1FVQ A;  3GCW P;  1B0T A;  3OTD A;  3QO9 A;  3UR3 C;  3TJA A;  2JX2 A;  3GFZ A;  4JI5 F;  3HHN B;  2ZHB A;  5F8H A;  2HHT A;  2M8H A;  2Y1J A;  3BDP A;  3U27 A;  3F0N A;  4OYW A;  3AD8 C;  2RUG A;  2PI4 A;  4DDF A;  3ILI A;  4IFV A;  1IBK J;  2B51 A;  3GG0 A;  1M0S A;  4KH1 B;  3VVT A;  3UDE A;  5M2R A;  1QE1 B;  3IP0 A;  3SQO P;  2YTC A;  3GP9 A;  1FNX H;  2ALY B;  3M2R A;  1IR0 A;  3I6P A;  1X8D A;  1XJW B;  2GIQ A;  2Z30 B;  3AJ1 A;  1HYS B;  1JXL A;  3BGL A;  2KFN A;  2FJA B;  3BGR B;  4NXM J;  5LL6 d;  2BE9 B;  5J2M A;  5L8R C;  4F2R A;  1U2C A;  2F9D A;  1R0A B;  1C0U A;  3B82 A;  2LXU A;  1XTZ A;  4RW4 A;  3QID A;  2FTR A;  2MDA A;  1CC7 A;  2RB7 A;  2W7P A;  4GC6 A;  2E9Z A;  4A8Y A;  5DGB A;  1R8B A;  2CVI A;  2DEI A;  3PRD A;  4MIB A;  1M5O C;  1VQK S;  3PIP Q;  2DR8 A;  4Q0B B;  5F3T A;  1D0E A;  4QU7 A;  3JYT A;  1RDR A;  2QJ3 A;  1HQU B;  4O3R A;  1ZS6 A;  1WDT A;  3DM2 A;  3R1L A;  1YJ9 S;  4USV A;  1BQN A;  3DNC A;  4DG1 B;  2KXF A;  2NZC A;  3P5B P;  4DL4 A;  4KGX B;  4O4G B;  2IVM A;  2DNK A;  2O5D A;  2FHM A;  4Y28 C;  1XK8 A;  1NK9 A;  3OTO J;  2Z4P A;  3RB3 A;  1HBO B;  3ET6 B;  3GIL A;  2RF2 B;  2ZWP A;  1ARO P;  3NL0 A;  2GMH A;  2DH8 A;  4QIV A;  1GXU A;  2Z0G A;  2D3O R;  2WBR A;  2FUG 9;  1RT2 B;  1WKJ A;  3K8W A;  4QPT A;  5HP1 B;  2C28 A;  4I0W A;  4LBP A;  4X4O A;  2CJQ A;  1G4C A;  3E51 A;  2V67 A;  5GAE I;  4U8Y A;  3SXL A;  3PHE A;  1V5I B;  2CJX B;  2ZE2 A;  1WHY A;  2E7V A;  2DCU B;  4JI4 F;  1AW0 A;  1C1C A;  5KFP A;  1J5E F;  4GO7 X;  3MED B;  4NCA A;  4NLO A;  3MMB B;  1X5O A;  1RBA A;  4A8S A;  2IDE A;  2ACY A;  2UUW A;  3DLH A;  1IBL J;  2AGP A;  1HMV A;  3MFI A;  3V81 A;  3RR8 A;  2RSQ A;  4WZM A;  2E7X A;  1N4L A;  3C19 A;  4FKY A;  4RPF A;  3OLA A;  2V2Q A;  2M3D A;  3D0I E;  2QL7 B;  3Q8U A;  1N88 A;  4USK A;  3H4D A;  1Q53 A;  2MZQ A;  4FPI A;  1VK8 A;  4HAC A;  5A0Y A;  2R8G A;  3CDU A;  3ZTR A;  2XY7 A;  1HR0 J;  2HFV A;  2QG9 B;  2WCX A;  1S9G B;  3NWR A;  3QGP A;  3V5R A;  3N5F A;  1SB6 A;  5DQH A;  1AUS L;  3FBC A;  3M6W A;  3L7U A;  5ETR A;  2OPS B;  4EO6 A;  1H2T Z;  1S1T B;  5I3Q A;  1Q8B A;  3ETO A;  3QBC A;  3GE9 A;  3TVY A;  5DLG A;  4ILM A;  2HFZ A;  1X9S A;  1VIS A;  1KLN A;  3C2P A;  4Z37 A;  4RNH A;  3WC2 A;  3VAL A;  4X2B A;  1NSP A;  5CXT A;  4DQR A;  4QBU A;  4C8Z A;  1V3Z A;  1DY3 A;  3E8O A;  3J81 U;  1IBK F;  2AX0 A;  1IKX A;  2H65 B;  2HZC A;  1QSY A;  1C0T B;  1RT3 A;  4RW6 B;  3CJT A;  1FFW B;  1GX6 A;  4GRS A;  4DV5 F;  1CJV B;  4OHV A;  3Q86 A;  2BOA A;  2EXU A;  3EZU A;  1X4H A;  4NCB A;  2RQ4 A;  1N33 J;  3AQO A;  3H8Y A;  4IQM A;  4C6A A;  2W2N P;  1UZH A;  1YRT A;  2J76 E;  3TZW A;  1VRU B;  3JTP A;  1TKT A;  2RHS B;  3LW5 C;  3QGH A;  1ZPW X;  1KHV A;  2OTL S;  5CYM A;  3CJ5 A;  3DLB A;  1FA0 A;  1PCA A;  4K0K F;  3A8K A;  4CLW A;  1CUL B;  2V2K A;  2VPW B;  3M32 B;  2ATC B;  3W61 A;  4KV8 B;  3FRY A;  4R5P A;  1RA7 A;  3CC4 S;  2LEP A;  3KLE A;  3M9N B;  1YBT A;  3DLE B;  3UD4 P;  4K4V A;  3BPS P;  4OLO A;  3Q8S B;  2F7V A;  5HAT A;  3LOU A;  2HVE A;  2HIY A;  3ZO7 A;  1Q5Y A;  1NAQ A;  2K7J A;  3P49 B;  4M5G A;  1RAD B;  3T1H J;  1GMW A;  1JXV A;  2CKW A;  3GR0 A;  3M8Y A;  3NEK A;  3ONQ A;  3PYE A;  1WC5 A;  4CO0 A;  5KAK A;  2B9E A;  3SV3 A;  2DXD A;  1U1L A;  3FEZ A;  3OR2 A;  4NXN J;  4NXN F;  2J8A A;  1Z2L A;  3BKF A;  1FT8 A;  1Y5I B;  4ZPB A;  4FF4 A;  4EEY A;  2R2S A;  4YY3 J;  1Q4R A;  5D4L A;  1M5H A;  3H5S A;  4BHQ A;  2BJD A;  4C3M A;  2CQI A;  2GQC A;  5KFN A;  2AJ4 A;  1XER A;  2AP6 A;  4OYZ A;  1N8R T;  1CPZ A;  2KZM A;  2QMX A;  2XTJ P;  3LA0 A;  3I9V 9;  2V69 A;  3M8Q B;  4KY3 A;  2YWE A;  5HBM A;  1RT1 B;  2PI5 A;  5RUB A;  2HQI A;  3TA0 A;  2KJW A;  1OSC A;  4NLP A;  1KQG B;  4PG7 A;  2FLP A;  1SJ3 P;  3HXM A;  4A8M P;  3UN5 A;  3ICL A;  3PYF A;  2G13 A;  1S1W B;  5KG4 A;  2R9L A;  4M5K A;  1NKE A;  2IC3 B;  2VBZ A;  1FJE B;  1C2P A;  1V3S A;  4YR3 A;  5I3U A;  1RWK B;  3AXK A;  1Q86 T;  3CJ0 A;  4K5R A;  3MPU B;  4ZCM A;  1NCL A;  2CDQ A;  2ACM A;  4GC7 A;  4ELU A;  3X1L B;  3D4J A;  2J9D A;  1GEH A;  2RDJ A;  4FS1 A;  3SIP B;  3MEG A;  4IFV B;  3HFV A;  4C9D A;  3KJN B;  2HFS A;  4TKT A;  5DJB A;  3W5Z A;  3OTB A;  1WF1 A;  2JFD A;  1F1B B;  2EK6 A;  2GX8 A;  4HH0 A;  1TTH B;  3MPY A;  4XK8 C;  5KFU A;  1U6Z A;  3A8J A;  3GWC A;  5KOW A;  3ZTO A;  2VL1 A;  5JXS A;  3QO9 B;  3CT9 A;  4YN3 B;  3NBP B;  3HX9 A;  4J5O A;  2R8K A;  4OV6 A;  1ZM4 A;  4ID5 B;  3CCR S;  4GKK F;  4F4W A;  2KXH A;  2DIV A;  3RAX A;  1UA1 A;  2UXC F;  4IDK A;  4AT1 B;  5F8N A;  1IM6 A;  3JQJ A;  3HT0 A;  1ZAW A;  3NCR A;  4N76 A;  5D15 A;  2YX7 A;  3H25 A;  3CWJ A;  2QV6 A;  3G8T A;  3KDN A;  3HSG A;  2AEM A;  2MKI A;  4WYL A;  3T1Y F;  2HEK A;  1IBL F;  1UKU A;  2E29 A;  2XHW A;  3SMZ A;  1HQU A;  3M2R B;  5AT1 B;  1EKR A;  3BQ1 A;  2H48 B;  2AKW B;  2UV8 G;  1BQN B;  1PAU B;  3GFY A;  3S01 A;  1NBE B;  3VGV A;  2MKH A;  1P6T A;  1PO6 A;  2PA3 A;  2K7K A;  2ZUA A;  3R7B B;  2OEJ A;  3MR3 A;  2UXC J;  3CJ4 A;  1HNZ J;  2LQ8 A;  2KFZ A;  2X1F A;  1RCX B;  2DGO A;  1T3N A;  3MPD A;  3M8P B;  2HQC A;  1XQI A;  3IS9 B;  3CJ3 A;  2A2C A;  2NXN A;  2YNI A;  3DLJ A;  3IR6 B;  4PWD A;  4B3M J;  1WI6 A;  3K89 A;  2WVB A;  3BEG B;  1RT2 A;  3EM1 A;  5AXM A;  4IG3 B;  3MEE B;  5HP1 A;  3IMQ J;  4Q0B A;  4PXC A;  3TJ8 A;  5K8M A;  3RB4 A;  3DI6 B;  2FY1 A;  4JI3 F;  1JKH A;  1JB0 C;  2KT2 A;  3SV4 A;  1QM9 A;  2NUH A;  1XIQ A;  3H5U A;  4O4G A;  1FE0 A;  2BM0 A;  5IOL A;  3RAM A;  3HHL A;  2G2Z A;  4PKD B;  2M9K A;  2J6U A;  1RTJ B;  2QSW A;  2HFN A;  1RWU A;  4QU6 A;  2RRB A;  2RS8 A;  3Q2S C;  5C24 B;  4RZR A;  4KGZ B;  4DSJ A;  2UXD J;  1CLF A;  2JJ4 D;  2OAU A;  4IG0 A;  3J81 Y;  2HFU A;  4DPW A;  4K50 A;  2RE1 A;  2EVZ A;  3R6L B;  2QFI A;  4B17 A;  4J9Q A;  1UJ6 A;  1NDK A;  1GMW D;  2FY8 A;  4GO5 X;  2CAJ A;  1F9H A;  3D9B A;  1JLQ A;  2X3D A;  4DUY F;  2Y8Y A;  4EFA C;  2HRU A;  1VQS A;  3I32 A;  1QSL A;  1C1C B;  5G4D A;  3GLJ A;  1QUP A;  3ZNU A;  4FNI A;  3UN2 A;  1HD1 A;  4ID8 A;  3LAL A;  3D54 A;  3T19 A;  5KFR A;  1VQY A;  3EGV A;  1RHJ B;  2MY8 A;  2VDH A;  2BZ2 A;  4LFA F;  1JNZ B;  2HUR A;  3H2L A;  4I2P A;  4Q44 A;  5L1L A;  1RWW B;  4FS2 A;  1RBO B;  2P8I A;  3R3T A;  3PTW A;  2HLT A;  2HAI A;  3RB6 A;  5H9E J;  2FD2 A;  4ZP9 A;  5KT3 A;  4B3S J;  5B0D A;  1S76 D;  2V8P A;  4GKJ J;  3UW1 A;  2ALZ A;  1SXL A;  4A48 A;  3BR8 A;  1VRT A;  2BE7 D;  2L9W A;  4JV2 A;  2UXB J;  2IY5 B;  1R7I A;  3NGT A;  2C1E B;  3H5X A;  3IWN C;  3R5D A;  3W2W A;  3QRP A;  3UI3 A;  1DQA A;  4F3Q A;  3RGI A;  1FDB A;  2LP4 A;  2RRA A;  1TVR B;  3NS5 A;  3PEH A;  3POT B;  4JV5 J;  3GB0 A;  3QLH B;  4K59 A;  1OO0 B;  1RT6 B;  5M2P A;  1FRK A;  2AYM A;  4XPC A;  3HVT B;  4WBF A;  4K4Z A;  4WTY A;  3VZI A;  5J1E A;  4N56 A;  2RU3 A;  7AT1 B;  2ASL A;  2P5V A;  1UFL A;  1FO1 A;  2N4C A;  3A3O B;  4R8U B;  2EG1 A;  4DLE A;  1FNM A;  1T95 A;  2XZD B;  4KYZ A;  5FII A;  3DLE A;  4AUK A;  3DRP B;  2DBB A;  4CO4 A;  2VUG A;  1GFW B;  1RAF B;  1A7G E;  2BYC A;  2Q1L A;  1D9D A;  4WU3 A;  1V5V A;  2W9B A;  2BUN A;  3BDE A;  4WFY A;  2QA2 A;  5IQ6 A;  4DQP A;  4CWB A;  4DPX A;  2DIU A;  4KC5 A;  1U0S A;  2W9C B;  4GKJ F;  2BKP A;  2UU9 J;  3CUN A;  1HQ2 A;  5LMU F;  2CDR B;  4OI1 A;  2CQG A;  5CYM B;  3P45 B;  1RKI A;  3BKU A;  1FWL A;  1CUL A;  3M32 A;  2DNO A;  3SZ2 A;  1U1P A;  1S77 D;  2VC0 A;  2FC8 A;  3CCZ A;  3GU0 A;  5BYQ A;  1DTQ A;  1HR0 F;  5EN1 A;  3PX0 A;  4NLV A;  1U24 A;  4EWT A;  3KK3 B;  3PX4 A;  4L3K A;  1GQE A;  4HHH A;  3M8Q A;  1VC5 A;  2OLW A;  1P9Q C;  3B6B A;  3M30 B;  3IM9 A;  3T5L A;  4OYM A;  2R8H A;  3BO4 A;  4EBE A;  4MKY A;  1JMT A;  4ZCL A;  1KRP A;  4B3R F;  3MTJ A;  4ERD A;  1ZYQ A;  3IGN A;  3W8P A;  4UOF A;  3QZ8 A;  2MST A;  4P72 A;  1S1W A;  3K7R A;  4ECT A;  1UVI A;  4NE9 C;  5JMN A;  4J9U E;  5DDP C;  1KD1 T;  4PYD A;  3D1O A;  2CNK B;  2D69 A;  3CJQ A;  2ASJ A;  2N3O A;  5I3U B;  1ZZF A;  1N0U A;  5FJ4 A;  5IFM A;  1HBM A;  3UVJ A;  2MHN A;  2F8H A;  3QIP B;  2MZT A;  4ILR A;  4ZJQ A;  4JI3 J;  1H7X A;  1WOP A;  3AY0 A;  5D3G A;  4DV0 J;  1OYE A;  5FDL A;  3QRR A;  3R7N B;  4HT7 A;  3MMJ A;  4DU8 A;  2C3Y A;  3CCS S;  4NLQ A;  2VQF J;  3EGZ A;  4QYZ J;  1XNR J;  2EC0 A;  2BJ9 A;  3C16 B;  1RT7 A;  1VC6 A;  3NBP A;  8RUC A;  4C8L A;  2IRY A;  2GW8 A;  2R4F A;  1HNX F;  1H74 A;  1JJH A;  2L9N A;  1DUR A;  4YR0 A;  2X7I A;  4B3T J;  4MIW A;  3VWS A;  3NY0 A;  5A6W A;  2D3Z A;  2XS2 A;  1B7Y B;  2BOP A;  1HD0 A;  1IBC B;  5KFX A;  2UUC F;  1FCA A;  2DNM A;  4WFA Q;  2B4O A;  4LSN B;  3OQ2 A;  4Q2L A;  3CJK B;  4CYU B;  3KXD A;  3Q8Q B;  2EW9 A;  3UPF A;  2BR0 A;  1IBM F;  3KHR A;  1R0C B;  1MWZ A;  4TYA A;  5GVQ A;  2E5I A;  5KG3 A;  3MM5 B;  2ZD1 A;  5KFI A;  3R2D J;  2GA7 A;  1SH2 A;  4QYZ K;  3K17 A;  2ADC A;  4PPZ A;  1WHX A;  5D77 A;  1IKY A;  5EX3 A;  2YKM B;  4TU7 A;  3O6Q A;  3RU0 A;  5KG6 A;  2DNR A;  4ECX A;  1EIY B;  1K0V A;  4DV3 F;  5CZX A;  4IDK B;  4NLY A;  5IV4 A;  4NCG B;  1T3O A;  2KB2 A;  2FZG B;  2YNI B;  3GON A;  3ZXW A;  2XC9 A;  2Y9H A;  3A4T A;  4DL7 A;  1VLO A;  3JSY A;  3CMA S;  1BHN A;  2B56 A;  3HSD A;  1N32 J;  2LVW A;  3I96 A;  3MEE A;  4YEA A;  4ZP8 A;  1TKD A;  4X4N A;  4U9R A;  1UWB A;  2V8H A;  2MTL A;  3DI6 A;  2IJN A;  1KQF B;  2J9D E;  3X3U A;  3DU6 A;  3GSD A;  2VFR A;  1S0N A;  1O8B A;  4IOB A;  3ISN D;  1T05 B;  2GNK A;  4DV6 J;  4WWS A;  3RBZ A;  2YY3 A;  2DGX A;  4JI5 J;  2B4P A;  5IC4 B;  5E3C A;  1ULR A;  2FGC A;  4LFC J;  4FF2 A;  1NDC A;  5LM7 E;  4QZV B;  1KFS A;  3L9Z A;  4TN2 A;  3NMA A;  1C1B B;  1RAB B;  4X4V A;  2AJ2 A;  3H98 A;  4F8R A;  2M2B A;  2ZVS A;  2F3J A;  4ZVR B;  3A1Y G;  2GIF A;  3Q89 A;  4G1I A;  1YJR A;  4IG3 A;  2Y3Y A;  1RU2 A;  2HSE B;  4MTP A;  1KKH A;  3PG9 A;  2HAF A;  4NLD A;  1UPM B;  4MK7 A;  3GJT B;  1RHK B;  4AND A;  5F3Z A;  1EET A;  2F65 A;  3CDW A;  1J5O A;  4WKR A;  3N28 A;  3U1L A;  3OXL A;  3SI8 A;  4A8F A;  3HJV A;  4C0O C;  3TX0 A;  3VQS A;  3AJD A;  3SSS A;  5HVG A;  2ZH9 A;  3VAI A;  1U02 A;  2IVY A;  2CPI A;  3N4W A;  5KFW A;  1XR6 A;  1NJI T;  1EZZ B;  1WI8 A;  1LK5 A;  3NG8 A;  3BV8 A;  1Y4Z B;  3CD5 A;  4I64 A;  4L6V 3;  1NND A;  1WOS A;  5C2C A;  3ADA C;  4HTI A;  1AXQ A;  1O6X A;  4USJ C;  2Z2M A;  3N5B A;  4J9L A;  2PT0 A;  5CD4 A;  2PMH A;  4A4J A;  2ZIT A;  1GXL A;  2IRX A;  1T9X A;  3UNY A;  2AT1 B;  3MUM P;  3IGV A;  3AA8 A;  1TVR A;  4B9M A;  3IWL A;  1FK9 A;  4CLL A;  3KLG A;  2GHP A;  4EYI B;  4FXW A;  2CPJ A;  4DV3 J;  2HS0 A;  2HZV A;  1NRK A;  2YPY A;  1Q78 A;  2OFG X;  1TAU A;  3HVT A;  4OJ1 A;  1IM4 A;  4EI2 A;  4JV5 F;  4N8O A;  1IWA A;  2IYG A;  5KFS A;  3T41 A;  2QMU B;  2HND A;  4OI4 A;  3CPW R;  4UTG A;  2G2O A;  2JRS A;  4NI2 B;  4TQS A;  1L3S A;  2DRA A;  4JI7 J;  1Y5N B;  2GVZ B;  4TLR A;  1LWF B;  2CQP A;  1Q79 A;  2YXL A;  3W9H A;  4ALZ A;  2BRL A;  4MK9 A;  4CP5 A;  1OY6 A;  1VRT B;  3C8Y A;  1S1X B;  4TU9 A;  3CCJ S;  4PUO A;  4F25 A;  2JLG A;  2X3G A;  2UUC J;  1V6H A;  2V4J A;  3CMQ A;  1X4G A;  2LEB A;  2VIC A;  3BR9 A;  2XMJ A;  1WC3 A;  5ITH A;  3EPG A;  1N36 J;  1KQS R;  4DCO B;  1KSP A;  1X31 C;  3SCK E;  1HQE B;  4H4O A;  1PYS B;  4IH6 A;  3KK2 A;  5AXL A;  4Q7A A;  4AL7 A;  1TKZ A;  4JV0 A;  5GAD I;  3BBC A;  3DOL A;  2V2Z A;  1YQH A;  1BGX T;  2XY6 A;  1VQ8 S;  1EKS A;  3OTE A;  3HUL A;  4X66 J;  4ZVP B;  2R7Q A;  4KFB B;  1F5C A;  4UUW A;  3KDO A;  3RUB L;  1OS5 A;  5KFT A;  1YBU A;  1SUQ A;  2RT3 A;  4ZPV R;  2WK4 A;  5LXY A;  1S72 S;  3Q24 A;  4J90 A;  3J7Z 5;  3DRP A;  3KK3 A;  3ENA A;  3BF4 A;  3DGV A;  2E5L F;  1P1L A;  1LFW A;  3J81 j;  1U1M A;  2G0J A;  4NZ6 A;  1B4S A;  2ZH4 A;  2DRD A;  1REG X;  3HF5 A;  3VTI A;  4U7C A;  2HK2 A;  3TQ1 A;  4N5S A;  4BCA A;  2ZBC A;  3OD2 A;  4L3N A;  5IWA F;  2F8E X;  3FGV A;  1RYS A;  1KTQ A;  3AB4 B;  1WC1 A;  3EWG A;  1J5E J;  4LF8 F;  2N7Y A;  5JUM A;  3I0R B;  5K14 B;  3TAR A;  2PC6 A;  4XTT A;  2AX1 A;  4IOC Q;  5F41 A;  4DX8 H;  1DTQ B;  1G2E A;  1X4A A;  5ETP A;  2BJ3 A;  1NB7 A;  1S49 A;  3QIP A;  5ETS A;  1WEZ A;  2PSZ A;  2D1C A;  2XBP A;  2FB0 A;  1KS2 A;  4ZCK A;  1RHM B;  2E1M C;  1RK8 A;  2MMY A;  3EIC A;  3OUY B;  3KYL A;  3E2E A;  2AJ1 A;  3A3N B;  3H7H B;  3NGD A;  1F3V A;  3H40 A;  4LF9 J;  1RJJ A;  2HS3 A;  4E2F B;  4JI1 J;  4MT1 A;  3C16 A;  1JWW A;  3FCH A;  3FMW A;  1N5Y A;  4F0H A;  5DGA A;  3DRR B;  4ETZ A;  1MRO A;  2V5H G;  3N6M A;  1R3N A;  2FHK A;  4JI0 F;  1RT5 B;  1HBU B;  3I5A A;  3M1V A;  3IR7 B;  5B0G A;  4ZIV A;  5F8G A;  5B0B A;  1K9M T;  3FFI B;  5B0E A;  2JEG A;  3TA2 A;  2VQE F;  1RTH A;  1UAW A;  2JH3 A;  3KKF A;  1S59 A;  1X5T A;  3TEG A;  4CYU A;  2ZKU A;  1YJT A;  1D1U A;  1YZ7 A;  3W7B A;  4DL5 A;  1HNV B;  3DDI A;  1Q8L A;  3I0S A;  2NS1 B;  3KUE A;  4NL5 A;  3UFC X;  2HRY A;  2VOO A;  5K9F A;  3JSR A;  4IO1 A;  5EHH A;  2F1F A;  2HRT A;  5MAO A;  2FVP A;  4DR4 J;  2QSF A;  1DLO B;  3A12 A;  3NGK A;  2LA4 A;  2R3V A;  4DBQ A;  9RUB A;  1KVK A;  3P8B B;  4U95 A;  2CAD A;  4X65 F;  2MZS A;  3TJ9 A;  2CQC A;  1S6P B;  2UXB F;  4LSN A;  4YB1 P;  4EUV A;  1RWV B;  1VRQ C;  1S97 A;  1QE1 A;  3H2V E;  2XWY A;  4LT6 A;  1LWE A;  3OSP A;  1QVF R;  1KC8 T;  1FKP B;  2VOD A;  2JVO A;  3GMG A;  4ES2 A;  5GME A;  5T41 A;  2BAN B;  4ZMM A;  3SSR A;  4K4Y A;  2ZD1 B;  4OHX A;  1HYS A;  7FDR A;  2C3O A;  4DX6 A;  4LFA J;  1F5B A;  2DXF A;  3LF0 A;  4DPT A;  2OEK A;  2CNN B;  1SKR A;  2POK A;  2ZKT A;  1ZET A;  1WEX A;  3AJ2 A;  1R0A A;  2CQ4 A;  4I69 A;  4LIR A;  3JTO A;  4NLS A;  3RRK A;  2VPY B;  4ETX A;  3Q0A A;  1VIO A;  4ICL B;  4F67 A;  5CHC B;  3CUL A;  3PJ9 A;  4PYA A;  4ZHR B;  4MMO A;  5LT5 A;  4NRU A;  5D4N A;  2B6A B;  2CQ2 A;  2QO3 A;  4P74 A;  3TAQ A;  4Y6I A;  1LWC A;  1ZA2 B;  2MQN A;  4NLG A;  3IRW P;  1H38 A;  2YQ1 A;  1EET B;  2NSC A;  2ZDO A;  4P7T A;  4OHZ A;  2R7W A;  2F5G A;  2FJW A;  2VJV A;  1ITP A;  2IVF B;  3Q8V A;  2D7S A;  3NKY A;  4O23 A;  4OZ2 A;  2OP5 A;  2K1R A;  1DQ9 A;  4QW8 A;  4F4A A;  3PIO Q;  3MUR P;  4ECU A;  1Z1Z A;  1FJC A;  4DV7 F;  4CLS A;  5J2P B;  4OHY A;  2VA3 A;  5E3P A;  3G86 A;  3FCV A;  4DV4 F;  4LSZ B;  4DV2 F;  2W01 A;  1C1B A;  2C42 A;  4UST A;  3THT A;  4FVC A;  1R31 A;  4M94 A;  4LF4 J;  1G1X A;  2ZJP Q;  3GYG A;  1PC5 A;  2ZC4 A;  5A2Q Y;  2GMJ A;  2PFD A;  3J80 U;  3M9M B;  2FZK B;  1ZH5 A;  1SI9 A;  2DK2 A;  1VQ9 S;  4CCH A;  3KLG B;  4V19 X;  1S4F A;  1S1V B;  4ANE A;  5HRO B;  4ECZ A;  2E5G A;  1NJX A;  5KTQ A;  1Q8K A;  5E5N A;  1HNZ F;  4J9V A;  3R7S B;  4U8V A;  3RBX A;  3FZB A;  2HW3 A;  2VC1 A;  3CNQ P;  5KFF A;  2U1A A;  3MMB A;  3HZG A;  2HND B;  2WW8 A;  3ZTQ A;  2G0I A;  1TK8 A;  2FJV A;  2HKE A;  1HHT P;  2J0Q D;  4BS2 A;  4C11 A;  3SDE A;  1LWF A;  3PR5 B;  5GMD A;  5A8W B;  1N5T A;  2CPF A;  2YKA A;  1JLF B;  3EVW A;  3G82 B;  1H2V Z;  4GMK A;  4BWM A;  1S1X A;  4L72 B;  3CJ8 A;  1QSS A;  3PRB A;  3WC0 A;  3V4I A;  4F4Z A;  3CDB A;  1FWP A;  4DU7 A;  3OR1 A;  1UJ4 A;  2ZDP A;  1FK9 B;  1Q7L B;  3V6H A;  4YR2 A;  1WOR A;  4YME A;  2LCW A;  4IH5 A;  4C8O A;  4ATN A;  3TAM A;  4RW7 A;  3US5 A;  3QGG A;  4XDC A;  4OL8 A;  4P73 A;  3RYL A;  4CLY A;  3PW0 A;  1U48 A;  4L74 A;  2DIT A;  1FRI A;  3BGF A;  2RD5 C;  5KFB A;  3RJM B;  4YDD B;  1RCO B;  2I38 A;  3HVW A;  3O8W A;  4B9N A;  4G1P A;  1TL1 B;  4ED7 A;  1RHQ B;  3IBW A;  3ZZO A;  1MNE A;  1LW2 A;  3HHL D;  4WP9 A;  1LV5 A;  4N77 A;  5EWG A;  2ZWO A;  4QR1 A;  4XAK A;  2LEC A;  2YWK A;  1S6U A;  4YB6 A;  2UP1 A;  1Q7Y T;  5DG9 A;  1W7W A;  4FF1 A;  1TKZ B;  2J7U A;  2RDI A;  1RAC B;  2DY1 A;  1SV5 B;  3DOL B;  4FNH A;  1VRU A;  2XLI A;  2I6W A;  2R2T A;  5L1J A;  1S0M A;  2LQJ A;  1MMD A;  3CIZ A;  4M5I A;  3KLF A;  3I0R A;  4PWU A;  2BA9 A;  4I56 A;  5LJ5 Y;  4CH1 A;  1M1H A;  5HL7 Q;  3GV7 B;  4ZPD A;  1HI8 A;  2WHO A;  3D6M B;  2J6S A;  3OV7 A;  2NRE A;  5IXU A;  4NAS A;  5AJ3 F;  3N6L A;  4ECY A;  1TR0 A;  4LMZ A;  5B09 A;  3W9I A;  3UN3 A;  4X62 F;  2V8V A;  4X84 A;  2DNZ A;  4QIG A;  5CCL A;  1H0H B;  5IM0 B;  5KFM A;  4X4R A;  2L41 A;  4TY8 A;  3K5N A;  3KNA A;  2XG8 A;  2R7X A;  1WKL A;  3J7Z T;  1KVJ A;  1Y7P A;  3GV8 B;  3T9Z A;  1RLD A;  4DL6 A;  1F6T A;  2GC8 A;  3DRR A;  1WG1 A;  3O44 A;  4H4K C;  5K14 A;  2BBE A;  1FRJ A;  3KLI A;  3MM9 A;  3TA1 A;  3MFH A;  3T1H F;  1CJK B;  1IQZ A;  1X4B A;  2V0N A;  3Q8R B;  2DVI A;  2AYG A;  3FVY A;  4ZLN A;  3W1Y C;  1HBU A;  4DV1 F;  4UY8 5;  3FFI A;  3HHE A;  2FJE B;  4EU0 A;  3IG1 A;  1X9M A;  4DUZ J;  5GAH I;  5HBM B;  1MLA A;  1XEZ A;  2XMU A;  1N0V C;  1H7W A;  1YX2 A;  4LF6 F;  1ZA1 B;  4MJK A;  3CJR A;  3KHH A;  1YRU A;  1PBU A;  3CB4 A;  4F3M A;  5C5J A;  3TUP A;  3AOA A;  2QGF B;  1FD8 A;  3C3L A;  3BS9 A;  2DH7 A;  2H4W B;  2P6S A;  2YX4 A;  5ETM A;  3ZZY A;  1RUS A;  3P4U B;  4OJH A;  2RAQ A;  2WBM A;  1HWK A;  4DX5 A;  5K8N A;  3MM6 B;  4DV6 F;  3PRV A;  1JJ2 R;  2KG1 A;  5THW A;  3KHL A;  1NXI A;  2FC9 A;  3HHD A;  4CLT A;  2AWZ A;  3OBI A;  4KE5 A;  3ENV A;  4J9N A;  4HL9 A;  2CPH A;  3J7Y U;  2XLJ A;  3KG0 A;  2H3E B;  5BXI A;  2ROP A;  5KG0 A;  1SCJ B;  4YQW A;  4IO9 Q;  1NK0 A;  2FQQ B;  1Y00 A;  2C2E A;  5CYQ B;  1OQ3 A;  1NSA A;  3UDC A;  3KG1 A;  3K58 A;  2AEF A;  1BQM B;  3OJU A;  5GAH U;  1HNW J;  1RHU B;  2E44 A;  2JVR A;  2GQQ A;  3MM8 B;  1LQ9 A;  1DLO A;  2YNG A;  2HHH F;  2XI2 A;  2DJW A;  4ICL A;  5AXK A;  2VG5 B;  3NAI A;  3R27 A;  4WKY A;  5HAO A;  5FLX U;  4DQI A;  2Q79 A;  1YSJ A;  2MKC A;  1VJQ A;  4P71 A;  3OW2 R;  2IM0 A;  2MQL A;  3H90 A;  3O2I A;  1LWC B;  4PWW A;  1O0P A;  4DN9 A;  3W2V A;  4CZC A;  5LSO A;  1N5Q A;  4DFJ A;  1QVG R;  1HWJ A;  3PFE A;  4U7U K;  3TP2 A;  1FKO A;  3AD9 C;  5J2Q A;  2XNR A;  4F4X A;  1HNI A;  5C7P A;  3GIK A;  3LAK A;  4F26 A;  4X4P A;  2YWH A;  1X4C A;  1WSR A;  2WW4 A;  1PGZ A;  1X60 A;  4CQ1 A;  1T7P A;  2YKP A;  2JDJ A;  4KRW A;  3BN4 A;  3VAF A;  1IJF B;  3GR1 A;  2CVE A;  2Z8Q A;  4QQB A;  2OPQ B;  4UUX A;  4LR7 A;  1IKV B;  2GO9 A;  3K5P A;  3R5G A;  4PWD B;  1S10 A;  3GG1 A;  3G87 A;  4MAK A;  4PG8 A;  1U1N A;  2Z58 B;  5LJ3 Y;  5ADZ A;  4CLF A;  1Q1K A;  1OSD A;  2RHQ B;  2MQQ A;  2XLK A;  2JLE A;  3MXH P;  2B8P A;  1IR2 A;  1K44 A;  3W60 A;  1JKH B;  2DGQ A;  4PXD A;  4QWC A;  3H4B A;  4O3S A;  2GGP A;  2PEH A;  4FYD A;  2CZV C;  4Y2C A;  4MKA A;  4EBC A;  4KHP J;  1S1V A;  1WNE A;  1PAE X;  2CQD A;  5H9F J;  1VHI A;  2GHV C;  1DAR A;  1TL5 A;  2CQ3 A;  3C15 A;  3HHL B;  4WFB Q;  3OTO F;  3PZP A;  2K1R B;  3GJS B;  4LF8 J;  4ZVH A;  4URG A;  1F2H A;  3WIU A;  3BGU A;  3DLK B;  3SSQ A;  1UW4 A;  4DL3 A;  5H9E K;  3FRZ A;  1A0O B;  4C11 B;  1RAE B;  4OMF G;  4BBY A;  2DTJ A;  2G1H A;  1L5U A;  5A8W A;  4FYX B;  2ZBR A;  5LXR A;  2QYC A;  3GFX A;  5B0C A;  2XGP A;  2Z2L A;  3EXY A;  1UA0 A;  1QLN A;  1YG0 A;  2B8Q A;  1YJU A;  1FEE A;  2KO1 A;  2ZHA A;  1JLQ B;  4N41 A;  4DR5 F;  2EFQ A;  4FBT A;  4FPR A;  2WVE A;  5DZ7 A;  3TO8 A;  5HMW A;  5HRO A;  3OTC A;  2MYF A;  1FFS B;  3HP6 A;  3MMA A;  1Q82 T;  3PFO A;  5KT4 A;  1JLA A;  3HHL C;  2HS4 A;  5KFJ A;  3G96 A;  3K59 A;  2QX0 A;  3SYZ A;  3H42 A;  4I2P B;  3T6B A;  4AQY F;  4XIU A;  2RIL A;  3RW6 A;  2B3T B;  4X64 F;  1CJU A;  4ED3 A;  4HKQ A;  3BZQ A;  3K5M A;  1F5A A;  2BQ3 A;  5LMU J;  1VIX A;  2WOM A;  5KFG A;  2KHC A;  2DNP A;  1FEH A;  3OPK A;  2MPU A;  2IPO B;  4IKA A;  2ZH1 A;  2AIR B;  5C42 A;  3O1L A;  2NSB A;  3DHX A;  4P2S A;  6FD1 A;  2YWF A;  1GNK A;  1RE1 B;  2WON B;  3LP0 A;  3W2W B;  4C98 A;  1JLC B;  3L7O A;  5K8O A;  2RQC A;  1IR1 A;  3V4I B;  5SZT A;  1FE4 A;  4I7F A;  4S0M A;  3KJV A;  2A0F B;  3I4H X;  4PQA A;  1S7H A;  3TAM B;  4DL2 A;  2MHE A;  4ELT A;  3CD6 S;  1XR5 A;  3R5A A;  4B9T A;  2RDD A;  2F4F A;  2LDY A;  2I0X A;  2WAQ D;  3IRX B;  5IS2 A;  2JC1 A;  5KFE A;  2HNZ B;  2HVI A;  4NRT A;  2DPJ A;  2HG4 A;  3TW0 A;  1KP6 A;  2MLZ A;  1O51 A;  1R8A A;  4R8U A;  3GZ7 A;  4FKX A;  2LLZ A;  4TLQ A;  5SUH A;  5KFA A;  3MM7 A;  4B08 A;  1SPB P;  2FVR A;  4IRK A;  2DHA A;  2QE5 A;  4A8X A;  1GX5 A;  3GPA A;  1E6Y A;  2G2Y A;  1F9F A;  2W7A A;  4HLB A;  4ZP7 A;  3WDO A;  4RNM A;  1SC1 B;  3OL7 A;  4DR1 J;  1MSW D;  5KFZ A;  1HWU A;  3CD7 A;  3RG6 A;  6AT1 B;  3ITH B;  4WTO B;  1FER A;  1XMQ J;  4YUD A;  2N7C A;  5KFO A;  4BDP A;  3HCX A;  4TY8 B;  3HK2 A;  3GCX P;  2H51 B;  2H5I B;  3AOD A;  3NMR A;  3HD2 A;  2BXJ A;  4B3S F;  8AT1 B;  3DGP B;  5L9N A;  3VGT A;  5C25 B;  3FSY A;  1IKW A;  1NK7 A;  3KLF B;  1CS4 B;  2DHX A;  4CLP A;  3G8Q A;  1NHK L;  2XZW A;  5DO2 A;  4F4K A;  1N54 B;  3M2V A;  4J9P A;  2QT7 A;  3IA0 A;  4QJV A;  4LQ3 A;  1OJ4 A;  5A8R B;  1I5O B;  1U8W A;  2W8L A;  2OIH A;  3IG1 B;  4JBC A;  1HW9 A;  2IA0 A;  2ZUG A;  5E7O B;  4F36 A;  1QAI A;  3M30 A;  2O67 A;  1DBD A;  1HKA A;  4NYO A;  4NZ0 A;  4DPY A;  2UVW A;  2GFF A;  4B9V A;  2VF3 A;  4LF5 J;  5HMZ A;  1MN9 A;  4ED0 A;  4F0K A;  4KH0 B;  3KOA A;  3NNC A;  1S6Q B;  1U49 A;  3Q8P B;  2EI5 A;  3DYA A;  2ZBQ A;  1ROF A;  3MR2 A;  2DNH A;  3MM6 A;  4NA2 A;  4Q5V A;  1S4E A;  4I4B A;  1BMQ B;  4PEO A;  5AE1 A;  3FNN A;  1LKZ A;  4ER8 A;  2CFX A;  2LEA A;  3NS7 B;  1KON A;  3UQS A;  5BJR A;  1X4D A;  4IFY B;  4P2X A;  5LOQ A;  5F9L A;  1KOH A;  2RS2 A;  1HPZ A;  3DHW C;  4QWE A;  4F02 A;  4RX6 A;  3SCL E;  3OVS A;  5AE2 A;  5F8I A;  4CM2 A;  1RAH B;  5DQI A;  2MQO A;  2BW7 A;  1DFD A;  3J80 Y;  2IBO A;  1LOU A;  3BGO P;  5HJY A;  4C8Y A;  2PII A;  1NO8 A;  2RUS A;  3RRH A;  2HIQ A;  4WJB A;  1RT7 B;  4ZLL A;  2DNQ A;  3QFW A;  1UEK A;  3AT1 B;  3IAS 9;  3DRX A;  1REV A;  3CDE A;  4QIW D;  2VG7 A;  4F7V A;  3V6D A;  1I1G A;  2OEL A;  2CJ9 A;  4DXL A;  3LO3 A;  1ZM3 A;  4Q43 A;  2XS5 A;  3KLH A;  2ADB A;  2V34 A;  3G6X A;  2XY5 A;  4WP3 A;  3CJK A;  3W2V B;  5AE3 A;  3U7J A;  1FTR A;  1U47 A;  1URN A;  1IWG A;  4WE1 B;  3T1Y J;  2YQ3 A;  1FKO B;  2XS7 A;  4M8L A;  3LWL A;  4U6P A;  2NXU A;  3HFK A;  1Y0H A;  3JS9 A;  4ENO A;  2XQC A;  2ZH6 A;  3O3L A;  2AJF E;  4DPU A;  2V94 A;  2BJ7 A;  2ZNZ A;  3NRB A;  5EWE A;  2DT9 A;  4IRD A;  3QT8 A;  4FP9 A;  1W2B R;  1LW0 B;  1X0P A;  5J2N B;  1S0V A;  4CO5 A;  1WWH A;  1VFJ A;  3MMC A;  1VBX A;  4ED4 A;  2QIF A;  1UVJ A;  2PMW A;  2HPU A;  4HI1 A;  4L73 A;  1JJC B;  2GQ2 A;  1DJ0 A;  2QL9 B;  4DZD A;  4ZA1 A;  3FUY A;  1DAX A;  3KG4 A;  3K5O A;  2EKY A;  4EO8 A;  1TK0 A;  2WTF A;  3MEC A;  1RSC A;  4BC9 A;  4KR0 B;  2GGP B;  1AZS B;  3MEK A;  2Y1R I;  4ZVQ B;  2KI2 A;  4OV1 A;  1HFE L;  2MEW A;  2MQ8 A;  2O3D A;  1M5S A;  2RQK A;  3KNG A;  5IZH A;  4LSL A;  1SJ1 A;  2J0X A;  5BR8 F;  1RTI A;  1RP5 A;  1WEL A;  3C15 B;  3R5B A;  1YWX A;  4USU A;  4JYA F;  4X64 J;  3NP5 A;  4TVA B;  5LMN F;  3V6J A;  1RBL A;  1L3U A;  3UWT A;  1H73 A;  1SC6 A;  1X7V A;  2OD6 A;  4N8N A;  4OX9 F;  2HVH A;  1UEV A;  4LFB J;  4QW9 A;  3JB9 k;  1XNQ J;  4RBV A;  3K0J A;  2D41 A;  1UMJ A;  3V2U C;  2M0G B;  5B08 A;  4DR5 J;  1FX2 A;  3MGJ A;  1WF0 A; 
#chains in the Genus database with same CATH homology
 3ENA A;  1NB2 A;  2HVE A;  3ZTP A;  3GP9 A;  1B99 A;  1NSQ A;  5BXI A;  4ANE A;  1JXV A;  1B4S A;  4UOH A;  1LWX A;  1BE4 A;  1NSK L;  1UCN A;  2DXD A;  4W98 A;  2AZ1 A;  3BH7 B;  2HUR A;  3VGT A;  2DY9 A;  3ZTQ A;  3NGU A;  1S57 A;  4HR2 A;  1NLK L;  1NHK L;  3BH6 B;  1MN7 A;  2BEF A;  1WKK A;  3EVW A;  1BHN A;  1U8W A;  2DXE A;  5CAB A;  3NGT A;  1S5Z A;  1NDP A;  3NGS A;  3R9L A;  4F36 A;  3EIC A;  1ZS6 A;  2AZ3 A;  4DZ6 A;  3EVO A;  5C7P A;  2NCK L;  1VYA A;  4WBF A;  3DKD A;  3VVU A;  1MN9 A;  4ANC A;  3EVM A;  1NDC A;  3BBF A;  1LEO A;  4EK2 A;  1NCL A;  1EHW A;  3FC9 A;  1HIY A;  1WKJ A;  3Q89 A;  4DI6 A;  5CAA A;  1KDN A;  1S59 A;  4AND A;  3VGU A;  2B8P A;  1K44 A;  2VU5 A;  3B54 A;  3DDI A;  4DUT A;  1NPK A;  1W7W A;  1PAE X;  2DYA A;  3EE3 A;  3EMT A;  1HLW A;  3ZTO A;  3Q83 A;  3BBB A;  3ELH A;  3ETM A;  1PKU A;  3Q8Y A;  2CWK A;  4FKY A;  2B8Q A;  3VGS A;  3Q8U A;  1NUE A;  3B6B A;  3EJM A;  3FBE A;  1NDL A;  3ZTR A;  3JS9 A;  4ENO A;  3VGV A;  4O0N A;  3FCW A;  4UOG A;  2DXF A;  3FBF A;  1WKL A;  2ZUA A;  3FBC A;  4UOF A;  3L7U A;  4KPC A;  1F6T A;  3MPD A;  1XQI A;  3NGR A;  3PJ9 A;  3FBB A;  4CP5 A;  1NSP A;  3G2X A;  1F3F A;  3EM1 A;  3ZTS A;  4S0M A;  1HHQ A;  1XIQ A;  3Q86 A;  5IOL A;  3FKB A;  2BX6 A;  3Q8V A;  4C6A A;  2HVD A;  4F4A A;  3BBC A;  1BUX A;  3FCV A;  4FKX A;  3PRV A;  1NDK A;  3GPA A;  3VVT A;  3WX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...