5CABA

Structure of leishmania nucleoside diphostate kinase mutant del5-cterm
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
139
structure length
139
Chain Sequence
b'MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title The role of the C-terminus and Kpn loop in the quaternary structure stability of nucleoside diphosphate kinase from Leishmania parasites.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 41
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 5cabA00
2DY9A 3PJ9A 3BBFA 2B8PA 2HVEA 1WKJA 3BBBA 3Q8VA 1XQIA 3BH6B 1B99A 3ZTSA 1JXVA 3B54A 4DI6A 5CABA 1S57A 5BXIA 1XIQA 1VYAA 2NCKL 3ZTRA 4UOGA 2BEFA 3R9LA 3ELHA 1NHKL 1BHNA 1NDCA 2AZ1A 4ENOA 1NB2A 1KDNA 2DYAA 3FCWA 4ANCA 3GP9A 3EVMA 1MN9A 3ZTOA 1HIYA 3ZTPA 3FKBA 3VVTA 3EICA 3EVOA 1B4SA 3VGUA 3FBFA 4CP5A 3VGTA 1BUXA 3FBBA 3Q8UA 4S0MA 1ZS6A 1NDLA 5CAAA 3NGSA 4WBFA 4FKXA 2DXEA 1EHWA 4W98A 1U8WA 2ZUAA 3Q89A 4FKYA 3ETMA 5IOLA 1LWXA 1NCLA 5C7PA 1BE4A 1NSQA 1NDKA 3BH7B 3PRVA 3VGSA 1WKKA 3DKDA 3FC9A 1HHQA 4UOFA 1S5ZA 3B6BA 3EJMA 1NPKA 1WKLA 1S59A 3JS9A 2BX6A 4ANEA 1NDPA 2DXFA 3Q8YA 3BBCA 3EMTA 3VGVA 1LEOA 4F4AA 4F36A 3EVWA 4ANDA 3FCVA 4UOHA 3NGUA 1PKUA 3Q83A 3WX8A 1MN7A 3FBEA 1NSPA 2AZ3A 3FBCA 3ENAA 3Q86A 3L7UA 2CWKA 3NGRA 2HVDA 1PAEX 1UCNA 2HURA 4HR2A 3VVUA 1HLWA 1F6TA 1F3FA 3NGTA 2DXDA 1NSKL 4C6AA 1NUEA 1K44A 3EM1A 3DDIA 3G2XA 1W7WA 1NLKL 3GPAA 4KPCA 4DZ6A 3ZTQA 4DUTA 2VU5A 2B8QA 4EK2A 4O0NA 3MPDA 3EE3A
chains in the Genus database with same CATH superfamily
4Q43A 1JLFA 4LF9F 1C1CB 5IT9U 1EZZB 1D8YA 2OPQB 3M8YA 5C24B 1Q78A 2YH1A 3CD6S 4CYUB 2MJNA 2DJWA 3DRPB 2HWTA 4G1QB 5DDQC 3ZZ0A 2KJWA 1R7IA 1R6YA 1EB0A 2FZKB 1S1TB 4CWBA 4QR0A 3E51A 5C42B 2WHOA 1U48A 2GV1A 2DGWA 3M6WA 5E33A 3NAHA 4X4UA 3CC2S 2CNLB 3PFOA 3ETOA 3PZPA 4C3MA 3AD9C 4GVLA 2MZSA 3MM7B 1IKWB 4RNFA 5A2QU 2RE1A 2GX8A 5KFUA 4ZVQB 5DO2A 3JSMA 4EUVA 2O5DA 3NWGA 1HARA 2Q43A 1XTZA 5ETMA 3N79A 3J7YU 1KEKA 2F5GA 1M5HA 1P1LA 4IUFA 2OJ3A 1RHKB 2CQ2A 4W90B 1XN9A 2VV5A 2BQUA 1NXIA 1N32F 1QE1A 3JQKA 1DAXA 4WZQA 3UDVA 2H1YA 1FA0A 3MEGB 5IM0B 1Q8KA 2VONA 4QWDA 1VQ9S 1T3NA 2UXBJ 3OD2A 1WC0A 1N8RT 1R89A 2D69A 3HKZD 2N3OA 4CTAB 3NAIA 2UUBJ 4WBFA 4X4RA 1GX6A 3H2LA 3K5OA 3L7OA 1T94A 3R1LA 1FF2A 2HBYB 1WEZA 5HVFA 3BQ0A 3HP6A 3NP5A 1J5EJ 2BRLA 5L1IA 4DV2J 5K5MA 1FFGB 3RB0A 2KVQE 4F4AA 2R7UA 3N6MA 4ECRA 2EC2A 1EETA 3TUIC 3MPWA 3W2WA 1ZA1B 1Y5IB 3DM2B 4K59A 4ED4A 1SCJB 5CA5A 2ZHOA 5EHHA 5KOXA 4PXCA 1JLFB 1YJNS 2B8QA 3J7AN 3EE3A 1FE4A 2VG7A 2EG1A 5EUHA 1FRLA 1ZBTA 2C2KB 4KT0C 2AZ1A 4ITSA 1NAQA 1Q79A 1IR0A 2HBQB 4I2PA 4ID8A 2R2UA 4OHVA 1H2VZ 5HMWA 3VCDA 2V4QA 4JV5J 2CZVC 5LJ3Y 2JEIA 2XYGB 4ZCKA 3CJSA 4DL6A 3MTKA 2NSBA 2B3TB 5B0AA 4O3RA 3ZZRA 4PG7A 1MMDA 2C2RA 1VC0A 2IC3A 3FCVA 2I5JA 4CLUA 3OSNA 1NSPA 1GXLA 2EFGA 1PAUB 3JSMB 2W2NP 2JOQA 4RWWA 5KFSA 1S1WA 3PDNA 4I7FA 1HI0P 2CUYA 1NB7A 4TQRA 1PIEA 4I6AA 1VQKS 3NOGA 5HQLA 1AXQA 1WDDA 3HHNB 2BYCA 3BN4A 1UWBA 4NPOA 5KFYA 4QW8A 4ZK7M 1X0PA 2R2SA 1ZPWX 2XULA 1QE1B 4BC7A 4NXMJ 2J76E 2AIRB 1TV6A 1AB8A 2YTCA 3CEDA 3LP0A 4NYOA 3QATA 1IWAA 3ZTPA 3NS7B 3VVTA 1MU2A 2OLWA 2BVZA 1FXRA 4OYPA 2KZMA 1QM9A 2ERRA 2ROGA 3PCOB 2W9CA 3CF5Q 2IM0A 1O51A 3W7BA 1BQNA 2L9NA 3B6BA 5E3CA 5HK4A 2ZBCA 3Q23A 3CCVS 5IT0A 4ECXA 1FJGF 3VF0B 2WK4A 1SL2A 1FKAF 4O3QA 1EETB 5ETSA 4DR6F 3W2WB 4FNHA 2DGQA 2HNDA 4NZ0A 3OFFA 3QWUA 1FJEB 3JSRA 1RZMA 2OAUA 3ZFVA 1PC4A 1RWKB 2Y1JA 2VG7B 3TNVA 3BYPA 2VU5A 1RT4A 1ICEB 4DS4A 3G9CA 2V2QA 2CQCA 1JJ4A 3GCXP 2MSSA 2LXIA 3W60A 1RTDA 1FRKA 1P8GA 1VK8A 4I2PB 1QDUB 2R7OA 2MPUA 5KT2A 4Q2MA 1RWUA 4PXBA 2IA0A 2HG4A 2FZCB 2L3MA 2HFZA 2JVOA 4ECUA 1JKHA 2DXEA 4LFCF 5AXNA 2JWNA 2YNFA 4URQU 4MFBA 4AL7A 1NHVA 1LW0A 4LQ9A 3AFGA 1X4DA 1KTVA 4DL3A 5RUBA 3GYXB 1Z1ZA 2IC3B 3O3LA 4I4BA 4WWSA 3QSIA 4BS2A 4WFAQ 3HZGA 2I5JB 3PHEA 4YB1P 2WONA 5KFNA 1S1WB 2RDIA 4I7FB 5H1SV 4M5NA 4QJVA 3V6HA 2YPZA 1AFIA 4ZJOA 1UWBB 3I0RA 3JSBA 1RWVB 1RI7A 1NZ8A 2LA4A 5KFXA 1CC8A 3DXSX 3M8RA 1TV6B 3MZIA 1RTIA 4ZP8A 4TKTA 4JI8F 3LP0B 3POTA 4EWTA 2DR8A 2VQEJ 3T5KA 1MU2B 1LFPA 3IO1A 4WIIA 3TEHB 1D9AA 7FDRA 2W9CB 2BJ1A 3NG8A 1H98A 2G13A 1P6TA 2LDYA 1QY7A 1BQNB 2JRSA 3JSYA 1X4HA 4NA3A 4JI4F 3VR1A 1TQLA 2BOAA 4DR5J 1Q95G 3PIOQ 4M5HA 4FBUA 3DFEA 1PJ5A 1IR2A 1RU2A 2MTLA 1HR0J 4RW9A 2HNDB 4DX5A 2XWXA 2KHCA 2GZOA 4AFFA 2KB2A 3QBCA 2VJVA 4PEOA 3TARA 1RT4B 4OI0A 1JNRB 2BV3A 2V2VA 2YX1A 3BGRA 2HLUA 3UI3A 4DR7J 3TAPA 3JB9k 3JTOA 3HM9A 2ASDA 1RTDB 1XNRF 3CJ5A 1VYAA 3NCPA 3R9LA 5KFWA 4JI3J 3RTVA 1XNQJ 4Z7CA 2JLGA 4B9NA 2YKQA 3WDOA 4LFAF 2IDEA 3HCXA 3CGIA 1U2FA 4PQAA 4Q44A 3IXQA 2FZGB 1JKHB 4USJC 5ETKA 3BJYA 2YNFB 3A4TA 1C0TA 4MFBB 1LW0B 1V5IB 5DDPC 2RQKA 1NCLA 3TZYA 5EGYA 4CDIA 3A1YG 3ITHA 3PX4A 3H5XA 2BJDA 4OZLA 2M70A 1Q1KA 1RT1A 2UV8G 2XQCA 2WONB 3QJPA 1GK8A 3LWLA 4K4ZA 1UZDA 2MZ1A 1MMLA 3IM9A 2DVIA 4X2BA 4DR4F 1PAEX 2MQLA 3HFKA 2W4PA 3I0RB 3DOMA 2Z8QA 1SH2A 3H5YA 3MR2A 4CO5A 1RACB 3ZTQA 2RU9A 3M8ZA 3R5GA 2Y1LB 5K8PA 4OZNA 1HYSA 1S1XA 1RTIB 4MK8A 1HPZB 3H25A 3POTB 3LAMA 2QG9B 4H4KA 1RWOB 4HTIA 1M5OC 1B4SA 3VGUA 4ZP6A 1GTEA 1SQGA 1WF0A 4CIOA 2WRMA 2LFVA 4F8RA 2VA2A 2MHEA 4ZN3A 1RJJA 2GW8A 2GJIA 4DFJA 4KSEB 4FKYA 2MLZA 3BN7A 5F0WA 3HXMA 3CJ4A 4Z7YA 1U6BA 2M8DB 2KRRA 1HBUA 3L95X 3HPOA 4PWUA 4Y2IA 5CYJA 5IQQA 1WD6A 5U47A 4JI1F 4DV1J 4MKVA 3KLFA 4I67A 2AJ4A 2KL8A 3LTOA 5F8MA 3QYYA 4RW9B 3P5BP 2O67A 5I42A 1TR0A 4HI2A 4I2QA 1WHVA 2XEXA 3SCIE 1KLMA 3RW6A 2IVFB 3BGRB 2YPYA 3UVJB 6AT1B 1O6XA 2ZC3A 2YKPA 4ZVOB 2KFZA 3DOLA 5CD4A 4DV7J 1OY9A 4P74A 1SC3B 4LF6F 4NLGA 5HI7A 4LBPA 2Z30B 4IH7A 2VG5A 3OL7A 4JV2A 1HA1A 1PYSB 1C0TB 2XNQA 1N36J 5FIIA 2RDJA 1S0NA 1CLFA 3DU5A 1UEUA 4KHRA 1B3TA 1WKKA 3SXLA 4IO1A 5EWFA 3VV2B 3ILJA 4QR2A 2XMTA 1G1XA 3NS6A 2XMAA 2IJRA 3VQTA 3W9HA 4ZP7A 2KYXA 5CZXA 1FK9A 2AT1B 3UR0A 4ECSA 2C3UA 5T41A 2ZDOA 3DOMB 4F0MA 1S77D 3F73A 2DXDA 4C6AA 2EFPA 5IV4A 1FTRA 4A4JA 4KO0A 4JV1A 4ELUA 1N5VA 1HYSB 1UL3A 4DSJA 1S1XB 1U1LA 3GE9A 2UXDF 1T05A 2XZTB 4ZA1A 1FD2A 4ZLLA 3KHGA 3GSIA 4PXDA 2FC8A 5D3GA 2JEGA 3A8JA 2UU9F 1Q53A 4ZLPA 3V5RA 2XGQA 2ZBIA 3EGZA 3I0SA 3J7ZT 3RG6A 1HFEL 2RB7A 1HBUB 4Y65A 5SZTA 2ZOMA 4X66F 2R2RA 4FPRA 2Y9HA 3DKDA 2OD4A 3GFXA 3RR8A 1QAYA 1X9MA 4CH7A 2V6AA 1YWXA 3BPDA 4WJBA 1JLGA 5AE3A 3KLFB 3SQOP 2CQ3A 1GAOA 3V6JA 4N7TA 2J9EA 3BO4A 3IAS9 4XO0A 2HIYA 3QLHA 3HVTA 5I42B 1TKXA 2ROEA 1X7VA 1F5BA 1Z4UA 4I2QB 1V3ZA 3N5FA 2CQ4A 5HQMA 4WTOB 2F65A 3BV8A 3E3XA 1RHQB 1KLMB 2C2ZB 2PMWA 2JFDA 2GGPA 2FJVA 1VHFA 2XMMA 2B8PA 1X5TA 2GFFA 2FB0A 3DOLB 2MXYA 2BACA 2W25A 2DGOA 4DUZJ 2VG5B 1ZM3A 4LR7A 1B0TA 1B0PA 4NA1A 2KT3A 2O01C 1FDBA 2MQQA 2W2OP 3BQ1A 1NK8A 3SFGA 1PG5B 1GEHA 5CAAA 1KQKA 5GAHU 3KJVA 5GADU 4X62J 2J0SD 3PO4A 3CW2C 4GKJF 4HH1A 2QLBB 2XMWA 1CQNA 2LEBA 3GIMA 3ISZA 1M5KC 3I82A 2LQBA 4E98A 4YR0A 4ZPVR 4NLUA 2Y8YA 4IOBA 2R8JA 3P45B 3CD7A 1FK9B 1IKXA 2JL9A 3TZXA 5E3PA 4C3LA 1RWMB 4ZITA 3UD4P 2W1BA 4KO0B 1HNZJ 1VHIA 2CQGA 3UCZP 4KBIA 1T05B 4L76A 3Q8RB 1U25A 4H54A 2JVRA 2FVQA 1S57A 5IS2A 5D3GB 4MIAA 1AZSA 4DV3J 3BO2A 5KFFA 1OQ6A 1Q5YA 1DQ9A 1QVGR 3M9MB 3I0SB 3OXLA 4DX8H 2UXCF 4FVMA 3UQSA 4ZVGA 4DMZA 5A8RA 1UFWA 2X51A 4WFYA 6FDRA 2OSRA 3HD1A 2FJWA 1FHTA 1V3RA 1S5ZA 2ATLA 4PCQA 1AFJA 1WNEA 3IA0A 1VQ5S 4FF2A 2XLJA 4ED2A 2RQMA 2Z2YB 2R42A 3H7HB 4OZ3A 4P71A 3QLHB 1RYSA 3HVTB 1TKXB 1YDLA 3Q8SB 2VQFJ 2C2NA 2ZKTA 2E5GA 2RRBA 1JNZB 3I87A 4USWA 2A0FB 2FGOA 1CJKA 4LIRA 2GGPB 1TTHB 2G0JA 4TY8A 1SC6A 4RUBA 4DEZA 1HNWJ 5LMUJ 4LMZA 1Q7LB 2J7WA 3RAQA 3GMGA 1Q16B 5K20B 3KMSA 3CJ8A 1I6JA 2R7WA 1KFDA 1RT2A 2CKWA 4NLWA 3C19A 2KTQA 4F04B 3I32A 4KH1B 3PKYA 4UZCA 1RKJA 3KJVB 1N33F 1UVMA 1F2GA 1RK8A 1S12A 4QWBA 1DBDA 3GJTB 5KT4A 5IFMA 1RWXB 4OJHA 2NXEA 3ZO7A 1L5UA 3FRYA 1EARA 1QTMA 4PQUA 2F4VF 1UJ4A 2DR7A 2OI2A 4J91A 2BANA 1IKXB 4RNMA 4LJMA 3KWMA 1S6QA 3I5CA 5F8GA 2UUAJ 3EM1A 4B3RJ 3NMAA 4J9MA 2BE9B 2CJXB 5D4NA 3LGHA 3FFIA 3AJDA 1VQNS 4TXSA 1UW4A 3CCQS 1AZSB 2RQCA 2FIUA 3OTCA 2X7IA 2HKEA 2R7SA 2U2FA 2EFQA 2P9GA 3HO1A 4OZ5A 3TUPA 4ED8A 1B7FA 2O3DA 2KT5A 5AE1A 2XY6A 4J9VA 4XTTA 1TAQA 3M1VA 5A8RB 2J5AA 3UDLA 1IBMF 2N7CA 3G6VA 2J7KA 2HPUA 5KG0A 4N56A 2XSFA 3LA0A 1R8CA 4F25A 2BA9A 1WACA 5AXMA 4DQQA 1HI8A 4F0HA 2FYXA 3EVWA 2DHHA 4USHA 2B0GA 3A8IA 3FBEA 3W5ZA 2J9DE 1YQHA 2ZZMA 3OUYA 5CHCB 1CJKB 2HFVA 3SCLE 4IQXA 4TY8B 1M5SA 3G71S 2EC0A 2C2DA 4PYDA 1KS2A 3LUYA 1K1QA 4U7UD 5GAGI 1RT2B 1L3SA 1RDRA 3TJ9A 5HP1A 1N54B 2FHOB 3U1LA 3CJKA 2YH0A 3MGJA 2Q3PA 4NMXA 2BM0A 3ILLA 2A6OA 1JK9B 3OSPA 3FQKA 3A13A 2IJFA 3Q89A 2CIMA 3AH6A 5KTQA 3R2DJ 4YB7A 2O1PA 3PRDA 2QO3A 2IPOB 4PQUB 4C7QA 5FD1A 4ANEA 1ZA2B 5KFGA 1LV5A 2BANB 3TZZA 2XHWA 5BR8J 3IN5A 1WOOA 5JXSA 3THTA 1S6QB 1T9XA 3CCWA 2O66A 2IIHA 3AA8A 4N8OA 3K0JA 4ALZA 5HATA 4Q5VA 4KHPF 4UZBA 2GAGC 4HEA9 3B4DA 1RYRA 2FUG9 1CULA 3KHHA 1P9YA 1FT8A 1X4GA 3FFIB 4NYZA 1RB0A 2M52A 2DY9A 2BZ2A 4M5LA 1XR6A 2NUHA 3IS9A 4J9UE 1L3UA 1WJ9A 4JP8A 2HHWA 4PKDB 4CLPA 3TVKA 3LO3A 4ETZA 2EXUA 1MWZA 4C8NA 3SMZA 5DZ6A 3M1VB 1S4FA 5IC6B 5A8WA 2CJKA 2AF6A 4ZP9A 3CDWA 5H9FK 4F4XA 4ELVA 3G6YA 4ZVEA 5J2PA 3TAQA 1RCOB 3KLGA 1VQOS 4HKQA 4JI5F 2R8GA 3PV8A 4X65F 2G1DA 3FRZA 5DDOC 5HMZA 3NGDA 1SQFA 1FESA 4TN2A 2AQ4A 4U7CA 1WEXA 1IQZA 1JWWA 3UE2A 3G87A 2PD1A 3MECA 2XI2A 2CPEA 4CNYA 1F5CA 3MTJA 5L1JA 3RBXA 4RJVA 3OUYB 2ZM6F 4HR2A 1NJWA 2AWZA 3JQJA 3H2UB 3L4BC 4P7VA 1Y4ZB 5GMDA 3MM5A 2AEMA 3CT9A 4AQYJ 1REVA 1JLAA 3W8PA 1IBLJ 3G4SS 1WUUA 2GO9A 2LKZA 3CCMS 1SUQA 2VC0A 1XIQA 1RP5A 2JC1A 2B5JA 5HP1B 2YY3A 4ANCA 1GMVA 1LFWA 3CJKB 1L3VA 1X5SA 2DO4A 1RKIA 1A0OB 2LA6A 1WOSA 1Z2LA 1JLEA 1U1RA 4UUWA 4RU2A 5A6PA 1WDTA 3ENQA 1UA0A 2OHDA 2CZ9A 4P52A 1ZH5A 5CXTA 4FNIA 3CE8A 3P3DA 4N47A 1UTAA 3CCLS 3KNGA 3H0PA 4RUAA 1RADB 1NDPA 3EMTA 4LRBA 4OYZA 5FJ4A 3MMAA 5HJXA 1QD1A 1WF1A 1IVZA 4AXIA 3MR5A 1U1QA 1WC3A 3OTBA 3TWZA 3BGLA 3PW7A 3VTIA 3CJ3A 2B6AA 1NMEB 3PHTA 1CULB 3JAMY 3D0GE 4DUYJ 2VFUA 2Q79A 4CI0B 2NXNA 3BBFA 5IWAF 4ZIVA 1RHJB 3IS9B 4XK8C 1YRTA 2BKPA 2BMBA 2DKOB 1OWXA 1YG0A 2RD5C 1ZPVA 1WC5A 3MFIA 3WC0A 1QAXA 1RWPB 4FYWB 3JTNA 5A8WB 1KN6A 5AE2A 4USUA 3D9BA 1DURA 2J9CA 4MIBA 2AHOB 4USIA 5J2PB 1BWEA 3KLGB 1Y7PA 2Y8WA 2VHGA 5DGBA 2FJEB 3BH7B 3QGPA 4DWIA 3GLJA 2HS3A 2HAFA 1T0TV 4D3GA 2ZH5A 2Z58B 1CEZA 2DNYA 5KFVA 3MECB 1J2VA 2HIQA 3KTQA 4TY9A 1UMJA 3TQ1A 2DR9A 3M8PA 4RU9A 1MWQA 1ZM4A 4UQTA 4N41A 3M7VA 2ZKUA 5IT4A 1RTHA 3M30A 3MM5B 5KG5A 1YGYA 3D0HE 3D54A 2BE2A 4RLEA 1REVB 3R1HA 1JLAB 1VI7A 3UN5A 4XIUA 3SDEA 2FLPA 1U2RA 4C97A 1SUQB 3TEGA 4WF9Q 2B5JB 1HI1A 3ZTRA 4DHVA 2DPIA 2GMJA 2NUUG 4OJ3A 2DB1A 2MQOA 3CDEA 3GFZA 4HVZA 5HMXA 4DV4J 1AT1B 1JLEB 2W8KA 3ZZZA 4DCJB 4OI3A 1KSPA 4F0KA 3KG0A 3RAMA 2VFVA 2H5JB 3PO5A 4QR1A 4Q0BA 3UN3A 3CO9A 2IA6A 2B56A 3D67A 4CLKA 1IBCB 3P5TL 4EMDA 3A12A 3ZZTA 2FVPA 2CXEA 4U8VA 2L41A 1IKVA 1FKOA 2E9TA 4HT5A 4NE9C 4XAKA 4NEYA 3MMAB 2D3UA 4J9NA 4R8UA 2YNGA 2UXBF 2HW3A 2H65B 4RW4A 1R8AA 3HULA 3IBFB 4NXNJ 1EX8A 5K8MA 4ED0A 2IVYA 2AJ2A 2UUBF 2B6AB 4B9SA 4ID5A 4FN5A 1H74A 3KDOA 4OV6A 4X4PA 4C11A 1H7WA 1SQEA 1FX4A 1U0SA 4J9PA 3TA1A 1J5EF 1WELA 3IMQJ 4CO2A 1X4CA 4KKOA 4DV2F 1M0SA 2E1MC 1N34J 1SJ3P 2DGVA 3CC7S 2LU1A 3T6BA 3T9NA 4ENOA 4ZCLA 5D0GA 3T1HJ 4WK3A 2WOMA 4CLSA 1VFJA 5DLFA 5I4MA 1D1UA 1APSA 1R27B 2ZZTA 3ZZUA 2GQCA 4J9OA 5F9NA 4B9LA 2VPYB 4LRCA 1YJWS 1NDKA 2J6SA 3VGSA 2LQ9A 3KLHA 2Z2MA 3GJRB 1VC5A 3R7NB 4DV0J 2OD6A 3EJMA 3LGNA 2M4MA 4F4ZA 1FDDA 2XSJA 1IWGA 1KP6A 3M8PB 1YX2A 4JV5F 2M0GB 1YJTA 5KFRA 1RTHB 4KQZA 1RUSA 2F1FA 3M30B 3DDNA 2BE2B 3NNCA 4DR1J 3SDEB 1VQPS 3MCSA 2R9LA 2OELA 1DZ5A 4WFNQ 4J9RA 2Z57B 3PRBA 3M2VA 1S7HA 3W61A 2AKWB 3FCWA 3IGVA 4NZ7A 3EVMA 4R25A 2RT3A 2YX4A 1KWMA 4Q0BB 2A2DA 1NK6A 1JLBA 4DCPB 3H90A 1B64A 2EPIA 3OXFA 1S1VA 4KIAA 1SL1A 1IKVB 3LGMA 2E1PA 1FKOB 4U96A 4NLXA 4NXMF 2GNKA 4DX7A 3TUJC 3CCZA 4KJIA 4C0OC 4R8UB 3KXDA 2ZH7A 3BGUA 2YNGB 3TA0A 3W5XA 3HHEA 3OQ2A 4U8YA 2QIFA 2XZWA 3ZNJ1 1RHUB 3QGGA 4ID5B 4C11B 1L3KA 2ZH3A 4QYZK 1NJXA 2QZ8A 4JI6J 4WKRA 4KKOB 2WSFC 3IRXA 5LL6d 1Q8BA 3Q8VA 4M5DB 2CYYA 2JLFA 2RHQB 2ZBRA 1Q7YT 2B9YA 5EX0A 1KVKA 1X9WA 2MGZA 2WOMB 2HLTA 1KDNA 1RU1A 3G8SA 4F4KA 1MN9A 3W65A 1HIYA 2MQPA 2FJXA 1VMBA 3GCWP 4V1Ak 1RQ0A 2NPFA 5E41A 4O0IA 3C46A 3OVBA 4DG1A 3P4UB 4J9KA 1EQ0A 2M2BA 3KLHB 2HHXA 1HNXJ 5AJ3J 4KH0B 4DSKA 5GMEA 5B0CA 3R27A 3TQEA 4KR0B 2FLOA 2HAIA 3SSRA 3GTYX 1I51B 4DR2J 2XSJB 5C5JA 5F8IA 4PWDA 1K9MT 3DGPA 4NCGB 4CLFA 3E2EA 2C2MB 3WX8A 2DY1A 1NZAA 1WG1A 1BGXT 2BOPA 4Y2AA 5HJYA 1QLNA 1M1GA 2PC6A 4C8KA 4DL7A 1K47A 1QSSA 4OL8A 4ZCIA 1I5OB 2IVMA 4GO5X 3M2VB 2Y3YA 1ROFA 1V5VA 3TRGA 1Q8IA 1EP4A 3CMES 4ES2A 4DOZA 5DJBA 3CSKA 4YHHJ 3MUMP 3C8YA 1ZZNA 1U1PA 3DLBA 2VDHA 1VLYA 1JLBB 4QBUA 2GC8A 5G4DA 1KONA 2DBBA 3FSIA 1S1VB 3GG0A 4U7UK 4ECWA 5D4OA 2H48B 3AOAA 2AV5A 2ZH2A 2VQEF 5GAEI 5E0OA 1SC4B 5GVQA 3K58A 4DLEA 2FD2A 3M2UA 3VWSA 3LP1B 1YVFA 1W25A 2DEIA 1F60B 4CZCA 2EVZA 4C8YA 3H2VE 4ED6A 1NPRA 3GYGA 3K7RA 3TW0A 2VFRA 1WG4A 2NZ4A 4DR5F 3IRXB 2GAHC 1SKSA 1D9DA 3K8WA 5B0FA 2MGZB 3AB2B 1T9YA 3WIUA 1HR0F 3DLEA 2NPIA 1I3OB 3UD3P 4ZVUB 2GCFA 2B7CB 2ILZA 4L72B 2UVWA 5FLXY 2H4WB 1U0HA 2SXLA 1IXKA 3OV7A 2WCXA 2B43A 4QQBA 4DG1B 3FJ2A 3K5MA 2C28A 4I6WA 3V6DA 4EYIB 3ETMA 1FO1A 3TX0A 3AXKA 2ALZA 3KUEA 4DR7F 1AUDA 2EK1A 4RUCA 2ZEJA 4ZKAA 3H8YA 5BJRA 4JI3F 1UPMB 2APOA 1XNQF 4PWDB 3MAQA 3DGPB 4OHXA 3G6XA 5KFAA 4IDKA 1VQ6S 3CC4S 2RS2A 2RRNA 1WORA 3M8SA 2ZJQQ 2BJEA 5ETLA 2E29A 1R8BA 4J90A 1LKZA 1YK9A 2KXFA 2RHSB 3CJTA 3PYFA 5H9EJ 3OHBA 1NLKL 4DZ6A 2YNIA 2CQDA 2WVFA 1MMNA 2BABA 1XMOJ 3MCNA 2W24A 3EGNA 3NY0A 3W9IA 3MUTP 1U7LA 3F56A 2IAJA 4L75A 4CO3A 3D6TB 3ET6A 3QWPA 1OPZA 4TVAB 3K5NA 1EJ7L 2BBEA 4LFCJ 1SKRA 4JBCA 1KQSR 1LQ9A 4TYBA 3D68A 3M9OB 1HL6A 3K2YA 1CG2A 5KFCA 4Y2MA 4B9UA 1YITS 3CJ2A 2HK2A 2BW2A 3LPYA 4AXJA 2QEXS 3HDSA 2R7RA 4ED5A 1NJYA 4QIGA 3MAAA 3M2UB 3I6PA 4LSLA 2ZC4A 3PVXA 1MNEA 2G1HA 3PYEA 4A8XA 3MPUB 2DIVA 1VQ7S 1P9QC 1VBKA 4RW6A 4KHMA 5LSRA 3GIIA 3W8GA 3OL6A 3S8SA 3WQPA 5C24A 2G2YA 2Q6BA 4DUTA 3HZEA 4MKAA 4DV1F 4DU8A 2PFDA 3PW2A 2DNOA 4MK9A 2MKJA 3IWLA 4ZVSB 2XHCA 3FEYB 5CABA 1U1NA 4HYKA 1BC6A 3DLEB 2V4RA 4WYLA 2A1BA 2QL9B 3GV5B 4L74A 1U0HB 2VODA 3IM8A 3CCUS 2PO4A 2EEYA 1LXJA 1TUVA 1FNMA 3V6DB 4X64J 2DNRA 5I3QA 1FE0A 5E7OB 2DIUA 2LP4A 2C2OB 3HSDA 4EBCA 1FWPA 2EKYA 2RAQA 3UR3C 1UVIA 3FC9A 4ZPCA 2R7QA 4AL5A 3RYLA 3PW5A 4CM0A 4DV7F 1D8ZA 1UJ6A 4IDKB 4IRKA 4KRWA 2RF2A 2ADBA 2K7JA 1OYEA 3HMJG 1TKZA 4DZDA 3FSXA 3L7UA 2XLIA 4V19J 1E6YA 1YIJS 1N36F 3PXGa 2NR0A 1G3OA 1Y3JA 3U02A 4I6YA 3RBZA 2YNIB 1WSVA 2G0CA 1TK5A 1TMJA 2KHDA 2V8PA 3ZNUA 1RT7A 2IAJB 4BBYA 3ET6B 2HS4A 1VRUA 5M2PA 4DS5A 4CO1A 1S6PA 4RBTA 2KXHA 5B0GA 5KT7A 3EVOA 2A6MA 4OMFG 2V69A 2VOOA 2HRUA 1N5QA 2ZH1A 1DTTA 1X60A 1NJZA 4NLYA 2M7SA 5KFDA 1TL1B 4DQRA 1M1HA 2C42A 3HHLD 2QA4G 2V8GA 1SJ1A 3J7Z5 4DR3J 1FKPA 4P7TA 4PG5A 3U27A 3MAAB 4K8RA 5HAOA 4F3MA 4OYIA 3HKWA 3QIDA 4LSLB 1ZYQA 1AYEA 5HMYA 4I1TA 4UQGA 2E1CA 3V81B 4LVNP 1MN7A 2F3JA 2FHKA 4RW6B 1OSDA 4RO0A 1R31A 1S1UA 3LOUA 2HQDA 4K4XA 5MLCV 1C0UA 2DCLA 1Z2ZA 4P2FA 1LK7A 4ED7A 4UW2A 1EQMA 3KK3A 2YWGA 4G6VB 3B82A 2MYFA 3D6HB 2WB1D 3FK4A 1TL4A 3BS9A 4WE1A 5J2NA 2LDIA 5KFLA 2N82B 2OTJS 1Q81T 3GU0A 2L08A 2B9XA 2XGPA 1VGYA 3C3LA 3VAJA 2OIHA 4WXOA 5KFJA 2UUWA 1WC1A 1KHWA 4UOCA 3DOKB 2NS1B 2PE8A 2DRDA 2RF2B 1T11A 3N01A 4DUZF 1X4EA 3FSYA 2YKAA 3BBCA 4J5OA 4G1IA 1NK7A 2WVEA 1TKZB 1KHVA 3CB4A 1OJ4A 1E6YB 1Y11A 1F6TA 4JYAJ 3W64A 4X62F 2WAQD 1U09A 3DCAA 1OYDA 1S0OA 2E44A 1FEEA 4A8OA 2GIFA 3J81Y 1RT7B 1S49A 3R7SB 2FC9A 3CCES 1VRUB 4TU9A 4EBDA 3WC2A 1UAWA 2JFKA 3M8QA 5LT5A 3O5TB 1S6PB 3BSAA 4ZVRB 3J7YI 2XB2D 2XYPB 1WTBA 3J81j 2RIJA 4WKYA 1DTTB 1F0XA 3VAFA 4GVBA 1HNZF 3D4JA 1YLXA 2FPHX 3PJWA 5IXUA 3MR6A 1YSJA 2C3PA 4W98A 1T9UA 2NZCA 4YEAA 3P6YC 4LQ3A 4R0EA 1FKPB 4KGXB 4LFBJ 2IM2A 2HHHJ 2HHTA 1DARA 1I94J 4Q8FA 4DV3F 3H5UA 2DD8S 1SI9A 5F41A 4FBTA 2Z2ZA 1YHQS 4EYHB 2F40A 3UW1A 5IC4B 3I5AA 2DGUA 2OUGA 3IR5B 2C3YA 1H2UX 1S1UB 3J80U 1IBKJ 4NA2A 1C0UB 2AW0A 4OYWA 4RR5A 1CJVA 4CLWA 3GPAA 2ASYA 3KK3B 3EGWB 4AD6A 4GRSA 5BXIA 4K50A 4DV6J 2MKCA 1GNKA 2VQFF 2BKOA 3TUZC 4WE1B 5J2NB 4E8UA 4CQ1A 2I8EA 3VAIA 3FKBA 5IT9Y 3EICA 4DPXA 2HZCA 1N48A 3MXHP 1HMVA 2QX0A 2VPXB 4F3OA 5CH7B 2E5LJ 3U1MA 1W2IA 2RKIB 2E7VA 4KGVB 2OPSA 3KUHA 1NK0A 4P73A 4C3KA 3KKFA 2KZZA 1QSYA 3HT3A 1HNWF 5LMUF 1Y3KA 3A3PB 2IBKA 4DSIA 4ECZA 1KRPA 1HWLA 2W2MP 2FJAB 4ES1A 2N4DA 4QWAA 2KG0A 4C48A 2ALYB 2K3IA 1EKSA 2MZJA 3NMRA 2DNMA 3PTWA 3VZHA 3DLKA 4MMOA 2CWKA 1UCNA 1WF2A 3G96A 4B17A 5D0EA 4F3QA 3W63A 2CPJA 2HMIA 5A2QY 2LVWA 3MR7A 2C1EB 1RSCA 3FUYA 1RTJA 4ZCMA 3TA2A 3M8QB 3OJSA 4KAIA 5C2CA 4ZIWA 3DLJA 4GVBB 4YUDA 3GV7B 4YB5A 3FEXB 2UUAF 2KFNA 4A48A 4B3RF 1IR1A 3CCJS 1VLOA 1VBXA 2G2ZA 4HH0A 1S6OA 4DQSA 4ICLA 3LP2A 1PBAA 1X5OA 2HZAA 3F44A 4AT1B 5HVGA 5L1KA 2PA3A 2VJUA 3K89A 4B3TJ 4OQJA 1K8AT 3KG4A 1TUWA 2XC9A 4J9QA 4EEYA 1DQ8A 2CPIA 1LWFA 3D66A 1FCAA 5E3AA 4O23A 4PG8A 1M1KT 3MD3A 2MDAA 3KK2A 4N77A 2EFVA 1M5VC 1CJVB 4NLDA 2H5IB 3M8WA 4IFYA 3AT1B 3HHLA 3LAKA 4XDCA 2DR6A 2G0IA 4O3OA 1FEHA 3ENWA 1KQGB 3BEGB 5JUMA 2CPFA 4MYTA 1R0BG 1TELA 2XTJP 4TNOA 2LXUA 4ZPDA 1YJUA 5D4PA 5JJBA 2PIIA 2QLFB 2WSEC 2Y1IA 2IM1A 5CCMA 3BKTA 2RUSA 2W7PA 1JXEA 1HMVB 2HS0A 2KU7A 2OPSB 3H4DA 1EHWA 1GXUA 4P9SA 3A3NB 3QNWB 4M95A 4P72A 1YJ9S 3DMJB 2EWHA 2J8AA 3JTPA 1S48A 4DFKA 1S9FA 4NRTA 5J1PA 4DV5J 2GVDA 3DLKB 1YRUA 3SCJE 2GO8A 1NK5A 4R0JA 1ZAWA 2AZ3A 4Q45A 4ELTA 5KG1A 2Y0SD 4KYZA 2V0NA 1HPZA 2HMIB 2ZD1A 2Q1LA 2DCUB 2QMWA 1KR4A 4YR3A 3EYZA 2VUGA 4KE5A 1RTJB 2XBPA 1CQMA 5D0RA 2IMOA 4M63A 2UUCJ 5BR8F 2UP1A 1UPPA 2MZQA 5LSOA 4RPFA 3KYLA 3DRXA 2DHXA 3D6MB 1S7IA 2AGQA 1UP1A 2VDIA 4X4TA 1VR6A 2BXJA 2Y0BB 4PG6A 2OO4A 3MR3A 4C2MA 5A0YA 3KHLA 4ICLB 3LP2B 3SQGA 1J27A 1V3SA 2OTLS 2IRYA 3DXBA 3M4XA 8RUCA 3EDRB 2KM8C 3R5AA 1LWFB 5K8OA 5E3QA 2RDDA 1B7YB 2EI5A 2VBZA 4UOHA 4ECYA 3KK2B 4YP3A 1WG5A 3UVJA 2V8DA 4IFYB 1FJ7A 3CD5A 4QIFA 3HHLB 4FYVB 2KVIA 4TLRA 4K2XA 3GYNA 2QRRA 4QPTA 3IRWP 1QTNB 5B08A 1DY3A 1U45A 1QSLA 2ZVIA 4KB7A 4FF1A 3PNIA 1BQMA 4ED1A 4PABA 2YNHB 1NHKL 1RAJA 2ZOGA 5KFBA 5KG7A 1RAGB 2YX7A 3VQSA 2FJDB 1NKCA 4K4VA 1T95A 1VC6A 3PW4A 1UETA 4LF8J 1NDLA 5D6GA 3B8HA 2DNNA 3TI0A 4AQYF 1IBLF 1LWXA 2HQGA 1JLCA 4CH1A 1FFWB 2RS8A 3NNAA 4PWWA 1FXDA 4OZ2A 4IR9A 4PPZA 1UVNA 2R8IA 3GR1A 5HQ8A 1YTYA 4YOEA 4EFAC 3V6KA 5HVHA 3CJRA 1BD6A 2GVDB 2RH3A 3ADAC 1VQ8S 3QO9A 5B0EA 2DTJA 1M5PC 2HURA 2VKRA 2CJQA 2ZD1B 4C8LA 4DFPA 4WIQA 3TAMA 3I96A 5J1EB 2ZWPA 4MTPA 4C8ZA 2GHPA 3TR5A 5KFEA 2MQ8A 2HEKA 2DO0A 1T02A 2AU0A 3FVYA 4FYXB 2XO7A 3LALA 4JI7J 3M6UA 3RR7A 2GQ2A 2HQIA 3CCTA 5HO4A 4A8SA 4LBHA 2LQJA 3R2CJ 3I4HX 5A0YB 1SL0A 1VIXA 5LMNJ 2H54B 4DUYF 3MFHA 3NGSA 5CYQA 3SQGB 4KV8A 3BR9A 3HHDA 1FVQA 3PKMA 2DNKA 2R8HA 3G8TA 3D28A 3OLAA 2B4VA 3V2UC 4QIVA 3CUNA 1U8SA 2BRKA 3GJSB 2GA7A 2N3LA 3C2PA 3US5A 4FXDA 3X1LB 4FF3A 1XWLA 4JV0A 3B4MA 2HNZA 3RRHA 2IM3A 2IYIA 3TVYA 1FRHA 1LOUA 4CLYA 4ZN1A 3PX6A 4LREA 3AOCA 2HVEA 5F8JA 4EO8A 1BQMB 2HFSA 4CLLA 5L9XA 2HHQA 4OI6A 4FS1A 1RWNB 3I9ZA 1LW2A 2Z0GA 2XO6A 3TZWA 4X4QA 4PUOA 1N5SA 1RAAB 4OYXA 3SSSA 2HBZB 1HKAA 4IO9Q 1SB6A 1DQAA 3SV4A 3IBWA 3PEHA 5HL7Q 1FWKA 2GS8A 3BF4A 4Y2KA 2L9WA 1JLCB 3N9UC 1H7XA 3HJFA 4TQSA 6FD1A 3NL0A 3TJ8A 1UKUA 3MHYA 2HFUA 3S01A 2DGTA 3QO9B 2JNJA 4DV4F 1RT3A 4CNZA 3RGIA 1VBZA 3KLIA 4XDDA 2AEJA 2RQ4A 4ECTA 1AROP 1YKWA 2DPJA 3RBDA 3IAM9 1TKTB 2HVIA 3HHKA 5D0HA 4WXWA 3TAMB 3NGTA 1GQEA 3WZ0A 1GT8A 1D3WA 4K4YA 3K5PA 1RAIB 4ZPTR 5B0BA 1T9TA 4HDGA 3IGNA 4A46A 3B78A 2ADCA 4NXNF 3GR0A 1UA1A 4IH5A 1D09B 3FMBA 1WC6A 4NCAA 1UFKA 5CYQB 2P8IA 3EPGA 4KV8B 5D77A 3NCRA 5F3TA 2CVEA 3SI8A 4P2XA 4B3MJ 3EDQB 1U02A 3K17A 4DQIA 3I56S 5K14A 3UNYA 3RB4A 4LF5J 3UPFA 5J2QA 1N34F 2YWWA 1WKLA 1U26A 4HHUA 1UVJA 3T1HF 3UD5A 2ZBPA 2MZTA 4ANDA 1U1MA 1KVIA 2WW4A 2W2QP 3OHAA 3KOAA 4C0BA 2BKNA 3DC2A 2HNZB 1SC1B 4HDHA 1PC5A 3MOJB 1PO6A 2PEHA 4USKA 4K4UA 1U2CA 1PJ7A 4IR1A 4DV0F 2DT9A 2D9PA 3FZ2A 2KO1A 1B99A 4K4TA 4IQMA 1LW2B 4ER8A 4UTGA 2AX1A 4PUOB 3H59A 2VOPA 3BQ2A 1IJEB 2PMHA 2YKOA 2JDJA 3MD1A 4ZVHA 1CVJA 4O44A 5IZHA 4L3KA 1N6QA 1WEYA 2FTRA 3MM8B 1XERA 2P9EA 1U24A 4P6QA 4ILLA 4DR1F 3W62A 3M9NB 4FP9A 3HVAA 4IH6A 2UVVA 1DFDA 1MROA 3AJ1A 3QT7A 1NJIT 4M5JA 2MMYA 3P8BB 1RT3B 4N8NA 2R7TA 5GAHI 3KLIB 5GADI 4F4WA 2LYVA 3QT5A 4CLTA 3KDNA 4BLGA 5KFPA 4ES3A 2W7AA 3RUBL 3ZZYA 2F8EX 2X3DA 1ACMB 4EBEA 4K5RA 2EFNA 1RABB 1XMQJ 2GJ2A 1Q82T 3CCSS 2BJ8A 1XBWA 3OL8A 3DGVA 2PN6A 3UNGC 1SIZA 5IV3A 4IFVA 3OJUA 1JLQA 4O0NA 4IOAQ 2ZH8A 3LQVA 4DPUA 5A8KA 5ETNA 2CJAA 1SH0A 4FZVA 1RHRB 4OJ1A 1RHMB 5F8NA 2AYBA 1X4AA 3UN2A 3R5JB 4A8QA 4NL5A 2BUNA 2KI2A 5LSLA 2WBRA 5A76A 3MURP 1ZS6A 9ATCB 1UEVA 4JI6F 4YY3J 2RRAA 1UFLA 2MQNA 3ISNC 2D3OR 1E6VA 1VK3A 5K14B 1FD8A 5J2QB 4DPWA 4X4OA 4F4YA 3DU6A 5KG4A 4NLPA 3JS9A 3MI7X 3C16A 4Y34A 4UY8T 3IG1A 1SKWA 1FI4A 1UW9A 2NQPA 3T5JA 2UZAA 1ZZFA 4JI0J 4K4SA 1VRTB 4JI2J 1XR5A 2HVHA 2E5JA 4FYYB 3DDIA 1HNXF 3BDEA 5AJ3F 2C3MA 5DM7Q 1AUSL 3HVRA 1S9EA 5DM6Q 4Y0FA 2BQ3A 2YQ1A 2NLWA 1CPZA 4DR2F 3ZTSA 2ZJRQ 4I69A 2LQ5A 4KGMA 4URSA 2YWKA 1EIYB 3RZAA 1B0VA 5KT6A 1YZ6A 4O44B 1Y5LB 2E66A 5J1NA 1N6QB 3FBFA 4LF2A 3N4WA 3R7BB 3R6LB 2UV8A 4LSZB 4YS2A 5L1LA 4QZVB 1RBAA 2M5YA 1MROB 1N5YA 1NPPA 2XI3A 1EAYC 2B4UA 2E5HA 2WZ1A 2DNPA 4YDXA 4K2JA 4B02A 1FDNA 3P49B 1GXTA 5E3RA 3BO3A 4YHHF 1XC9A 3EXYA 3S6EA 3MMCA 1SPBP 2QYCA 2JZ5A 4YQWA 2KH9A 3GG1A 1BY9A 1JJCB 4J37A 1OSCA 4MKBA 1TK8A 2W8LA 1VIOA 2IJNA 3C6TA 4IFVB 5BYRA 4ILRA 3TP2A 1JLQB 2ZITA 3OL9A 2B9EA 3MPDA 3HX9A 5A8KB 3CXCR 4F26A 1WKJA 2CQBA 5KG3A 3FMWA 4O4GA 3C6UA 4QYRA 5HBMA 4EI2A 4Y00A 2FLNA 1D0EA 2YWEA 1JMTA 1LWEA 2AGPA 2OPRA 4ATNA 3EZUA 4USVA 1E6VB 3C14A 4M8LA 1VCTA 2J0XA 3I5BA 3PRVA 1FXLA 1OIAA 3C16B 3IG1B 3CULA 2QTWA 4DL0C 2FDNA 2FVRA 4I56A 2CJYB 1HW9A 3CDUA 2ASJA 1CSJA 4URGA 2BM1A 3AD7C 1SH3A 1CJTA 3OXGA 1WHWA 1ZETA 3Q8QB 1W7WA 3DDKA 1S9EB 2VIHA 2G2OA 3N6NA 3KHRA 5EX3A 2HRYA 3RJMB 3JXOA 2W9AA 4G3IA 2OPPA 3PJXA 4RW8A 1BLUA 1JXLA 4DI6A 1YJ7A 1TKDA 4JB8B 5G0RA 2VG6A 1BMQB 1FDAA 3PIPQ 2C3OA 2ZBQA 2XMUA 2ROPA 1U47A 2BDPA 2K1RA 4RNOA 1U6ZA 1PGZA 1IQTA 4J9LA 1S4EA 1XMOF 1N5YB 4RZRA 3CIZA 4YFUA 2OFGX 4UOFA 3IWNC 3QFHA 2XMVA 2P9CA 2CPHA 1OPIA 3BGOP 3GV8B 3MMCB 1X4BA 3D1HA 1ZM2A 4CCHA 2OEMA 4C8OA 1K0TA 1NSAA 1R0CB 5L39A 3C6TB 2VFSA 2PFFB 4WP9A 4LT6A 3V4IA 3T1YJ 4AUKA 3CIMA 4C9DA 2DH8A 2IFXA 2IRUA 4O4GB 1KVJA 3C6UB 4RW7A 5HBMB 3LW5C 2KG1A 1Y10A 3OFHA 1KNZA 4LR9A 3ELHA 3HSGA 4B9MA 1WOPA 2YQ3A 5D4LA 5KT3A 4NZ6A 1LWEB 1R43A 2JX2A 2OPRB 1HHTP 1ULRA 1UWAA 2WVDA 3NGKA 3BM7A 1K73T 5J2MA 2XG8A 4OHWA 4IKAA 4ZPBA 2KYZA 3C14B 1RT5A 3M6VA 4ZJLA 4DQPA 2L9DA 3THVA 4RBVA 1NK4A 2EFOA 4AE5A 4HACA 3SSQA 2DGSA 1FFSB 2CPZA 3HLUA 3DN9A 4O3NA 3OTOJ 1WC4A 2W7OA 2ZNZA 4D3HA 5ETRA 4W92B 2OFHX 4X64F 1GMWD 1CJTB 4OLOA 4TU7A 2HBRB 2ZVSA 3MCOA 1QVFR 1HQUA 5KFIA 2EKNA 4RX6A 3WX4A 2DRBA 1X4FA 3CPWR 1GFWB 1ZOTA 2N7YA 1UVKA 2OPPB 3DYAA 4RW8B 5DZ7A 2UUTA 5G0RB 5T7LA 3MM6A 2VG6B 1Y0HA 3QQCD 4DF4A 2RJZA 5HLFA 2DYAA 1HBOA 2D3O1 4MJKA 1FERA 1VQLS 2K1RB 1N52B 4LF7J 2F8MA 2W01A 4DFMA 1K0VA 2HSEB 1U1KA 5A6WA 2K06A 2V50A 3MEKA 4QWCA 2BR0A 1I1GA 3OLBA 2EBEA 3A8EA 3IP0A 1HBNA 4FDFA 2AMCB 2Y1RI 2AEFA 1F1BB 2VF3A 4LUBA 2C22A 2F7VA 8AT1B 2GHVC 4OX9J 5I3UA 3R97A 4IRCA 2ASLA 4C98A 2OH2A 3PY8A 3NBPA 3Q86A 3T5LA 4NRUA 1HLWA 3V4IB 4OZJA 2CNOB 1H38A 5AXKA 4E2FB 4DR3F 2GIRA 2LXFA 4DSFA 4RW7B 4BWJA 4A8FA 1HD1A 3L3CA 1QJHA 4L73A 1T9WA 1NB2A 2ZOFA 3CWJA 3AJ2A 1FX2A 1JJ2R 3MPVA 5J2MB 4AYBD 2PDAA 1S10A 4RNNA 1RT5B 1ZAXA 1A6LA 2PA8D 3D3CJ 3UFCX 4AL6A 3FCHA 2HQ3A 4NEZA 5HROA 2AYMA 3ISND 3PFEA 2B4OA 4CO0A 1MW7A 4QU7A 2IBOA 3DHXA 4FXVA 1CJUA 3D7SB 1NPKA 3H5SA 4HACB 2XS2A 4TLQA 2VBWA 1JB0C 3QRQA 2D74B 2K3KA 2E9RX 4XPCA 3VAHA 3N6LA 1O5JA 1TAUA 4TYAA 1GTHA 2XNRA 2J9DA 1NH7A 4NOHA 1HQUB 4WFBQ 2Z56B 1AW0A 5M2UA 4HHJA 3OFEA 3Q24A 3D0IE 3DYAB 1RAEB 4U6PA 3LF0A 2PT0A 2IMWP 5T7LB 2CAJA 3GONA 3MM6B 2COLA 2KM8B 3BH6B 1HNIA 2RMLA 4F67A 3FNNA 1SJQA 5HLFB 1HBOB 2DHAA 3CJQA 4USMA 4FPIA 3CD0A 4LF4J 1RLDA 4ETXA 4JYAF 2HQCA 2LU2A 3VGTA 2YXLA 3G82A 2V8HA 1S79A 1UVLA 4NLTA 4FKXA 1HBNB 3EZ5A 3M32A 2RILA 2F9DA 1YJVA 4DL5A 1DTQA 4NLRA 3JYTA 3AXMA 2DK2A 3MMBA 1J5OA 2P6SA 3I4PA 1WHXA 4DPTA 5I3UB 1VQSA 2K2PA 4GKKJ 4CLZA 5DGAA 3ITHB 3RBEA 3NBPB 5EDWA 2BW7A 2FVSA 1T8EA 1RT1B 2ZFHA 2ABYA 4NLOA 4M5DA 4EO6A 3BYRA 3QSYB 4ZLNA 3MEDA 4LFBF 1ZTWA 5I3PA 2HHHF 2F63A 1I94F 1NM2A 4KGZB 3QZ7A 3VAGA 4B3SJ 2BJ3A 3GFHA 2CVIA 4DCOB 5GMKa 3PACA 4DPYA 7AT1B 3BR8A 2HRTA 1S0MA 3R5BA 5CYMA 2J6TA 1LK5A 2HHPA 2D1CA 2MSTA 3HJVA 1IBKF 1HNVA 5HROB 3M2RA 2QE5A 3IBCB 4K0KJ 4H4MA 2H3EB 3CMAS 4C8MA 4NCGA 3R5CA 1RA7A 1CJUB 4DV6F 2PGCA 1REGX 3L09A 3OW2R 4LF9J 2WBMA 2BE7D 1A9NB 3E8OA 4Y2CA 4K4WA 3SEOA 1HWKA 3K5LA 2DNQA 4U67Q 2HHSA 1SBRA 4XPEA 2E5LF 2MZRA 2LEAA 2WVBA 2RNEA 3VVUA 2DH9A 2XYHB 3HVWA 2ZHAA 2WTFA 1EKRA 4ZOSA 3QPIA 2LQ8A 1HNIB 1SJRA 4P2SA 1PILA 1Y5NB 2E1RA 2V4JA 4Q7AA 3EPIA 1T7PA 1R8HA 2VPZB 1NDCA 4P75A 3BB5A 1R8PA 2B4PA 1GMWA 3G82B 2R4FA 2I1RA 3MF5A 1SKUB 4ZPAA 3H42A 3M32B 1DTQB 5C7PA 2YKMA 2VASA 2V34A 3SFUA 3JYTB 2QLWA 4Q2LA 1C4AA 1X5PA 3LP1A 1H3DA 1YBUA 2VB6A 3MMBB 1J5OB 3NNHA 1F5AA 3N5BA 4DSLA 3FQLA 4M5MA 1WI6A 1N32J 2P6TA 2X3GA 4MK7A 2AJ1A 5E2QA 2VKZG 4MIWA 2KN4A 2CADA 3MEDB 2QMUB 1URNA 5C25A 1YI2S 2AJQA 1LWCA 3BDPA 2AJFE 4IYQA 4B3TF 3DRRA 3GIJA 5LXYA 1GX5A 1RE1B 4EGLA 4ECVA 4ZDNA 5KFKA 2CFXA 5F8LA 1HBMA 2XY5A 3AY0A 5CYMB 3GP9A 2XLKA 1SJ4P 2WVCA 3BSNA 3KG1A 2AYEA 2V9WA 1HNVB 1U6FA 4WFXA 3K59A 1F9FA 2CA9A 3M2RB 4H4MB 3BKFA 1V6HA 2YWHA 4KTQA 2ILYA 2CDQA 2ZJPQ 2DNLA 5JVGQ 3QIPA 3NLCA 5AT1B 3OVAA 2XWYA 1S99A 1H6KX 5KFZA 2G9OA 2NXCA 3T3FA 2R7VA 2XS5A 3AD8C 4WP8A 4DN9A 3CVKA 1JLGB 3OT9A 4ZHRA 1S0VA 3SZ2A 1F3FA 1VS3A 4GMKA 2QFIA 2MB0B 2ZWOA 1JX4A 2MY7A 5H9EK 1CS4A 2V4JB 1PJ6A 3CO0P 3HFZB 2CWXA 4DV5F 3G86A 4UOGA 4NCBA 2DHGA 2M8HA 3Q22A 5D8HB 4OZ1A 2OGUA 2DGXA 2GQQA 3PG9A 2Z2LA 3FBBA 2MKKA 3GILA 2CPYA 4HTJA 3QGIA 2CJ9A 4F02A 4YDDB 3U1NA 1T3OA 3BREA 4M5KA 3W2VA 3MWBA 3FZBA 1UEKA 3MM9A 5IOLA 3RU0A 4WPAA 2YKMB 3DRYA 4QOTA 2MKHA 3QAUA 1KKHA 4WCEQ 3HSJA 3KFWX 2UUCF 3ZC4A 5DLGA 2QN6B 4QPXA 1PYOB 4EZ6A 4RL1A 2V2KA 3NOCA 3OTEA 2P2CB 2JJ4D 1T03A 4YMEA 4OJGA 1XMBA 2FHMA 2Q66A 2JC0A 2K8GA 5C25B 3JQMA 1LWCB 2FLLA 1N88A 3M6XA 2DITA 2V63A 3H40A 2GHWA 3QGHA 5F0UA 2QJ3A 3DRRB 1W26A 1OMSA 2UVUA 3VHQA 2LEPA 2QSFA 1HBMB 1N5TA 2V5HG 2NYIA 5C2GA 2VD3A 1VISA 2NCKL 1XR7A 2AX0A 2EG2A 3D6FB 2HGMA 3AAWB 3QJLA 4Y28C 1TP7A 3DRSA 5KT5A 4CO4A 1FJGJ 4G65A 4PZVA 3Q8PB 2ACYA 4DR6J 2XZDB 2W9BA 1YRXA 4M1KA 5CZVA 1N56A 5E5NA 4LIWA 3CJ0A 4A8YA 4FS2A 3U7JA 3QIPB 1NKEA 1KOHA 4NX9A 3HK2A 1RBLA 5M2RA 5KFTA 1JIHA 4OYOA 5JMNA 2DNGA 4O4RA 4ZHRB 4LF8F 1FRJA 3GWCA 3MOZA 4H4OA 3NGRA 5D78A 2DEJA 1NH8A 1NUEA 4WU2A 2CDRB 5GAGU 2G4BA 3HFVA 2CZ4A 1P1TA 3ZXWA 1CS4B 1KOOA 3GFYA 1GMUA 4PAAA 3QT6A 1FWLA 4HL9A 1LXNA 1TL1A 1HW8A 1MG7A 4LRAA 4L3NA 3DLLQ 1SJFA 1RXOB 2J7UA 2UVRA 3CDBA 3W2VB 3C66A 1NO8A 3MM9B 2DISA 3UWTA 1Q4RA 4JI7F 1KC8T 3V81A 4OX6A 3AQPA 2J0WA 3HF5A 3LPEA 3KJFB 1T03B 2QL7B 4BDPA 2H4YB 5FDLA 4JI8J 1YBAA 3CMQA 2YVSA 3JAMU 5LMNF 2J6UA 3TVZA 2OMOA 4DLGA 4V19X 3KK1A 2A18A 2HGLA 2VBXA 1F9HA 2C2EA 4U9RA 2N4CA 5ITHA 3H4BA 4Z37A 2EW9A 4ZJQA 4K7QA 1G7CB 4JI4J 3BBBA 1XQIA 1TFWA 3DI6A 4PG4A 1PCAA 1JXVA 2YWFA 1S72S 1TMMA 2XS7A 1SXLA 3DRSB 5DQHA 2I0XA 4HHHA 3MMJA 1L3TA 3DOKA 2W9BB 1TL7A 3R5DA 4RKUC 4BC9A 2YKNA 2RVJA 3MAHA 2XCPA 3F41A 4NASA 4PR6A 4NLQA 4OHZA 1NBEB 3EGVA 1Y00A 1PBUA 1NSQA 3A8KA 1YZ7A 3OVSA 2LLZA 5LOQA 4WTYA 2JLEA 3ILIA 4OI4A 3GIRA 1NNDA 1U1OA 1WSRA 1XNRJ 4DN0A 1BXNA 3QFWA 4K5SA 3QT8A 2NXJA 2OEKA 3Q2SC 4H4OB 2GMLA 1TL5A 4LFAJ 2YBVA 4UF4A 2CJBA 2RU3A 2AYGA 4ZMMA 4MAKA 3B54A 3TYTA 1NHUA 2CQHA 2HHVA 2I6WA 3SCKE 5HANA 1X0FA 4CRJA 1VJQA 4OYBA 4B3OA 3E01A 1RGVA 3T1AA 4CT9A 4LBIA 2HGNA 1LNQA 4DR4J 4J9SA 2QA4S 4J7CA 2ZUGA 1HHSA 3T6JA 2M9KA 4CT8A 3W3SA 1VDHA 3RB6A 2FHJD 2R3VA 5DQIA 1S59A 4ZVPB 5FDLB 4OYAA 1D9FA 5LM7E 1DLOA 3D5MA 4A8KA 4F2RA 3KK1B 1Q0NA 3VAKA 3ENAA 2VPWB 4RBUA 4PXEA 5KFOA 4B3MF 2V94A 1HWJA 1NSKL 3G2XA 3QJJA 1K44A 3NWRA 4DDFA 1SV5A 4LF5F 3RW7A 3IWXA 1FJCA 1R6VA 2HQFA 1H73A 3DI6B 2P5VA 4DU7A 4NWBA 2NREA 1URRA 1QUVA 4EZ9A 4JI1J 3WIVA 2RKIA 4NI2A 1RCXB 2F8HA 1TL7B 5ETTA 5H9FJ 3KMQA 2YKNB 1BWVA 1BUXA 1BQXA 4FVCA 2NYHA 2U1AA 2NSCA 3AQOA 3AODA 3PYDA 3L7PA 3TOQA 2MEWA 4O3SA 3WHIA 2ZUAA 3W66A 1TUGB 1ZAVA 1OY6A 4GC6A 3QAEA 4WK1A 2IYGA 2HVZA 3BPSP 2BX6A 2D41A 5MAOA 2IY5B 2CNKB 2V2ZA 5KG2A 1RTZA 1OO0B 2QFJA 5SUHA 1TZ0A 3G8QA 2GIQA 4LF6J 3HI9A 4FXWA 2RUGA 2CPDA 4IG0A 2QV6A 5DG9A 2X1FA 5KAKA 4NYPA 4N76A 2B9WA 2VL1A 2AJ0A 4DXLA 1VOMA 2MKSA 1KD1T 4OFZA 1OS5A 1QAJA 2X1BA 2KFYA 3T9ZA 2F4FA 4B3OB 1DJ0A 8ATCB 3E01B 1KLNA 1CC7A 5DG7A 3G6ES 1XMQF 4LRFA 1DHMA 2KRBA 1XK8A 2VBYA 3TO8A 2EK6A 2DRAA 1N0VC 5DQGA 3OTDA 4KGKA 3NRBA 1X9SA 5KG6A 3O1LA 1V9OA 4X4NA 2NXUA 3DNCA 4CM2A 2FY8A 1N0UA 5EWGA 3MDFA 2E1AA 2R8KA 4BHQA 2OEJA 1S76D 4B08A 2UXDJ 3I9V9 1WWHA 1DLOB 2CQ0A 2JHEA 3PM9A 3T41A 1QAIA 1G4CA 3QRRA 3OR2A 2MY8A 4WFZA 2HNYA 4UY85 1RAOA 2HFOA 2L48A 2V67A 1FRXA 1DRZA 4YY3F 3T19A 2UU9J 2VFTA 1SV5B 4RNHA 3OR1A 1PYTA 5DG8A 3AHPA 4R5PA 1RT6A 2XMJA 2HHUA 4M5IA 4X66J 3IR6B 4NI2B 2X1GA 2XM3A 3DLGA 4JI0F 1NU4A 1UZHA 4JI2F 4DSEA 3AB4B 2HK3A 1VJWA 4KPYA 1WI8A 1R3NA 3W5YA 1RBOB 2CQPA 3C15A 3DMJA 1K1SA 2JH3A 1T9VA 4ED3A 1FNOA 1C4CA 2H9ZA 3CDAA 1F3VA 3IC1A 4KFBA 4KY3A 4DBQA 1LEOA 4C4WA 3RRGA 1IUJA 2WB4A 2E9ZA 4OX8A 4I0WA 2K7KA 1XEZA 3MUVP 3TANA 3GZ7A 2DH7A 4WZMA 3RAXA 4IG0B 2X1AA 2J8SA 5F9LA 3PYGA 1Y9OA 3I31A 2QYGA 2CPXA 3ZZPA 1ITPA 1VQ4S 2BQRA 3HSZA 3NKYA 4GKJJ 2R2TA 4IOCQ 3PEJA 4Y6IA 4ZLJA 4QCLA 2ZH6A 4PPDA 2JEFA 4OI1A 4OZ0A 5ETQA 2CG4A 1GH8A 2B51A 4JOUA 4IRDA 2CG8A 2IHR1 5EWEA 5ETOA 4U95A 2KJVA 3T5HA 3WBZA 1NKBA 4PYAA 3CTRA 1RWWB 3HT0A 1NK9A 2E7XA 4ZVTB 4GO7X 2CQIA 2IDLA 2QLJB 1HQEA 1KBRA 2A2CA 4YB6A 4QU6A 3NXZA 2EBGA 2VZ9A 1HHQA 2VICA 4OHYA 4E0DA 3F0NA 3OR2B 3HHLC 2HNYB 3M05A 3HD2A 1PKUA 5DETA 5KFMA 1OQ3A 1U4BA 3W9JA 3UO0A 5D15A 2QA1A 4HT7A 3OR1B 1IM4A 3TJAA 3D2WA 4RW4B 2YNHA 5B09A 4R5PB 2UXCJ 1RT6B 2H51B 4QIWD 2FY1A 1S6UA 3J80Y 2FHJA 2E5IA 4IG3A 2WSCC 1C1BA 4RUHA 5FLXU 1X8DA 4M5GA 3DLGB 1NEEA 1S9GA 2ZE2A 1KQFB 5HSPA 1BHNA 5KFHA 2ZH9A 1IKYA 1W2BR 3PR4A 2QGFB 2KXNB 3EWGA 4S0MA 1R0AA 3C15B 1WHYA 3D1OA 3KUGA 1VQMS 1O0PA 2A3JA 3CCRS 3GJQB 1WTFA 4LR8A 1FVSA 4KFBB 3AA9A 4W4MA 1VQYA 2HWHA 3GQCA 3L9ZA 2DXFA 3GIKA 3UCUP 3NGUA 3GB0A 3OBIA 2VA3A 5J1EA 1B70B 2V68A 4ZVFA 3QZ8A 3OPKA 4X84A 2KDOA 4F50A 1RAFB 1SIWB 4JUZA 5JVHQ 2BJ7A 1N33J 2KKHA 3Q2TC 1NRKA 3Q0AA 3R8YA 2GVZA 9RUBA 1TU0B 2BEFA 2W4DA 1QUPA 3NS5A 3NCQA 1KTQA 1Q5VA 3ZTOA 4HI1A 2F4VJ 4P10A 4CP5A 2F9JA 2AP6A 4UUXA 5LJ5Y 3T1YF 2D7SA 2MKIA 1N4LA 1G2EA 2ZHBA 3SIPB 1H2TZ 5GAEU 1HQEB 1U49A 2QA2A 4OYMA 2QMXA 2I2YA 2J0QD 2VH7A 1SVDA 1O8BA 3K8VA 2BJ9A 1XJWB 1X31C 3ULHA 3VGVA 4G1PA 1TL3A 5F8HA 4MKYA 4B9VA 5K8NA 3ILOA 1MSWD 2FGCA 4DPOA 4TU8A 4EU0A 4QYZJ 1UJ5A 2HZVA 1HQ2A 1H0HB 3BSOA 3NEKA 4CH0S 4DX6A 5DRKA 4NLSA 2HYIB 1IBMJ 4M94A 2RSQA 4IG3B 3A3OB 1C1BB 4F2SA 3PX0A 4B9TA 2I9SA 2JSXA 1S9GB 2W4CA 2ZE2B 4Y3CA 5DDRC 2KT2A 4DL4A 1IKYB 3OTOF 1MWYA 1TVRA 4MYUA 4OI2A 4ZS6A 2A10A 4X4VA 2Z4PA 3GSDA 2Q6CA 1R0AB 1HWUA 5L38A 3BSCA 4ILMA 4LF1A 3LH2S 3PR5B 5BYSA 1ZM9A 2OP5A 2QL5B 3KLEA 3D1QA 3UDCA 2I38A 1Q8LA 2M88A 4QWEA 3H20A 4LRDA 5THWA 2PI5A 4LSNA 4X4SA 1TKTA 2MKYA 5T14A 4P2MA 4DJBA 4WP3A 2POKA 4H4KC 4LVOP 1JJHA 4LF7F 3Q83A 1H72C 3O6QA 2MJUA 2PSZA 3VZIA 4BWMA 4O3PA 3BKUA 2PMZD 3S1TA 1MLAA 3BZQA 2GJFA 4EK2A 2H5EA 3VALA 2GVZB 3W1YC 1IJFB 2HWIA 4OX9F 2MLYA 3EX7B 1RA6A 1FNXH 5ETVA 4YN3B 5AXLA 2FQQB 1VBYA 4FF4A 4MH8A 3MEEA 1C2PA 5ADZA 4GC7A 4OV1A 1G6BA 4WU3A 4A47A 1EP4B 1M90T 3UCGA 3DLHA 3X3UA 3I55S 2DR5A 2PEBA 1RAHB 4NMLA 3DHWC 3R6GB 4KHPJ 5L46A 1BE4A 3N0VA 1A7GE 3RRKA 2VC1A 1TFYA 2LCWA 3TX8A 2V9KA 2CRLA 4ZPWR 4Z2XA 1TL3B 1RLCL 2DNHA 4OX7A 5KFQA 1PSDA 5EN1A 1F2HA 3EZOA 4PRFA 4C0HA 4MT1A 5LXRA 4HLBA 3FBCA 1YJRA 3IR7B 3MPYA 2HVDA 3O8WA 2IRXA 3SYZA 4N5SA 4FYDA 3FGVA 2AGOA 3N28A 3IFEA 3SBMA 2CQ1A 2W2PP 4KC5A 4F7VA 4JI5J 5K9FA 4X65J 1C1CA 3AOBA 4ERDA 1KFSA 1TVRB 3MM8A 4Q8EA 2OPQA 2JEJA 4QIEA 2DHSA 1AA1B 1CBKA 5F3ZA 3KLVA 2LMIA 4CYUA 3QMQA 3O44A 3DRPA 2B7BB 3MCMA 4G1QA 4I68A 3THPA 1Q86T 1S97A 2ATCB 1FRIA 3BGFA 2QT7A 3KLEB 2D9OA 1U8WA 2ZM6J 5KOWA 1TK0A 2M3DA 1S1TA 1F9EB 1FRMA 2MLXA 5C42A 2LECA 4OLPA 4LSNB 3V4MA 4ECQA 4USTA 3ONQA 5DS7A 7FD1A 1P27B 3S7RA 3RB3A 3EUNA 4LF4F 2DNZA 4L6V3 2OSQA 4UT4A 4F36A 2OMLA 2OKQA 2HFNA 4QW9A 1VRQC 3MM7A 5B0DA 3KNAA 5IQ6A 1FTCA 1IKWA 3J81U 2FVCA 3FDSA 3EXCX 4NLVA 3UDEA 2ACMA 1ELOA 2WW8A 3LANA 3R3TA 3PJ9A 2V8VA 1IN0A 4GKKF 4DF8A 5ETPA 4OIXA 2ZZNA 2QLXA 3SV3A 2PI4A 4RWXA 1ZTTA 2E7WA 3MEEB 3MEGA 3H98A 5L9NA 5IM0A 3FEZA 4WYWA 2YQ0A 3ZZOA 1RISA 2XY7A 3Q8UA 3OFGA 2QC3A 2AD9A 5HN0A 2ZNYA 1YBTA 4CTAA 4A8WA 3KJNB 4B3SF 2MQMA 3KJQB 2CNNB 3QRPA 5CCLA 5B7WA 2FJBB 5L8RC 1JQGA 2XCAA 3D3BJ 1VRTA 1IM6A 4A8MP 5IWAJ 3J7A1 3Q8YA 4YR2A 3VAMA 5CD4H 5CQGA 3O2IA 2R7XA 1HD0A 3P96A 2GMHA 2QSWA 3ENVA 2MHNA 4K0KF 4I64A 2ZH4A 1HWIA 1OY8A 3K57A 3PW0A 2XMKA 3DM2A 3LWMA 4BCAA 4DL2A 3ICLA 4KPCA 3CNQP 5BYQA 2D3ZA 2ZDPA
chains in the Genus database with same CATH topology
2DY9A 3PJ9A 3BBFA 2B8PA 2HVEA 1WKJA 3BBBA 3Q8VA 1XQIA 3BH6B 1B99A 3ZTSA 1JXVA 3B54A 4DI6A 5CABA 1S57A 5BXIA 1XIQA 1VYAA 2NCKL 3ZTRA 4UOGA 2BEFA 3R9LA 3ELHA 1NHKL 1BHNA 1NDCA 2AZ1A 4ENOA 1NB2A 1KDNA 2DYAA 3FCWA 4ANCA 3GP9A 3EVMA 1MN9A 3ZTOA 1HIYA 3ZTPA 3FKBA 3VVTA 3EICA 3EVOA 1B4SA 3VGUA 3FBFA 4CP5A 3VGTA 1BUXA 3FBBA 3Q8UA 4S0MA 1ZS6A 1NDLA 5CAAA 3NGSA 4WBFA 4FKXA 2DXEA 1EHWA 4W98A 1U8WA 2ZUAA 3Q89A 4FKYA 3ETMA 5IOLA 1LWXA 1NCLA 5C7PA 1BE4A 1NSQA 1NDKA 3BH7B 3PRVA 3VGSA 1WKKA 3DKDA 3FC9A 1HHQA 4UOFA 1S5ZA 3B6BA 3EJMA 1NPKA 1WKLA 1S59A 3JS9A 2BX6A 4ANEA 1NDPA 2DXFA 3Q8YA 3BBCA 3EMTA 3VGVA 1LEOA 4F4AA 4F36A 3EVWA 4ANDA 3FCVA 4UOHA 3NGUA 1PKUA 3Q83A 3WX8A 1MN7A 3FBEA 1NSPA 2AZ3A 3FBCA 3ENAA 3Q86A 3L7UA 2CWKA 3NGRA 2HVDA 1PAEX 1UCNA 2HURA 4HR2A 3VVUA 1HLWA 1F6TA 1F3FA 3NGTA 2DXDA 1NSKL 4C6AA 1NUEA 1K44A 3EM1A 3DDIA 3G2XA 1W7WA 1NLKL 3GPAA 4KPCA 4DZ6A 3ZTQA 4DUTA 2VU5A 2B8QA 4EK2A 4O0NA 3MPDA 3EE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DY9 A;  3PJ9 A;  3BBF A;  2B8P A;  2HVE A;  1WKJ A;  3BBB A;  3Q8V A;  1XQI A;  3BH6 B;  1B99 A;  3ZTS A;  1JXV A;  3B54 A;  4DI6 A;  5CAB A;  1S57 A;  5BXI A;  1XIQ A;  1VYA A;  2NCK L;  3ZTR A;  4UOG A;  2BEF A;  3R9L A;  3ELH A;  1NHK L;  1BHN A;  1NDC A;  2AZ1 A;  4ENO A;  1NB2 A;  1KDN A;  2DYA A;  3FCW A;  4ANC A;  3GP9 A;  3EVM A;  1MN9 A;  3ZTO A;  1HIY A;  3ZTP A;  3FKB A;  3VVT A;  3EIC A;  3EVO A;  1B4S A;  3VGU A;  3FBF A;  4CP5 A;  3VGT A;  1BUX A;  3FBB A;  3Q8U A;  4S0M A;  1ZS6 A;  1NDL A;  5CAA A;  3NGS A;  4WBF A;  4FKX A;  2DXE A;  1EHW A;  4W98 A;  1U8W A;  2ZUA A;  3Q89 A;  4FKY A;  3ETM A;  5IOL A;  1LWX A;  1NCL A;  5C7P A;  1BE4 A;  1NSQ A;  1NDK A;  3BH7 B;  3PRV A;  3VGS A;  1WKK A;  3DKD A;  3FC9 A;  1HHQ A;  4UOF A;  1S5Z A;  3B6B A;  3EJM A;  1NPK A;  1WKL A;  1S59 A;  3JS9 A;  2BX6 A;  4ANE A;  1NDP A;  2DXF A;  3Q8Y A;  3BBC A;  3EMT A;  3VGV A;  1LEO A;  4F4A A;  4F36 A;  3EVW A;  4AND A;  3FCV A;  4UOH A;  3NGU A;  1PKU A;  3Q83 A;  3WX8 A;  1MN7 A;  3FBE A;  1NSP A;  2AZ3 A;  3FBC A;  3ENA A;  3Q86 A;  3L7U A;  2CWK A;  3NGR A;  2HVD A;  1PAE X;  1UCN A;  2HUR A;  4HR2 A;  3VVU A;  1HLW A;  1F6T A;  1F3F A;  3NGT A;  2DXD A;  1NSK L;  4C6A A;  1NUE A;  1K44 A;  3EM1 A;  3DDI A;  3G2X A;  1W7W A;  1NLK L;  3GPA A;  4KPC A;  4DZ6 A;  3ZTQ A;  4DUT A;  2VU5 A;  2B8Q A;  4EK2 A;  4O0N A;  3MPD A;  3EE3 A; 
#chains in the Genus database with same CATH topology
 4Q43 A;  1JLF A;  4LF9 F;  1C1C B;  5IT9 U;  1EZZ B;  1D8Y A;  2OPQ B;  3M8Y A;  5C24 B;  1Q78 A;  2YH1 A;  3CD6 S;  4CYU B;  2MJN A;  2DJW A;  3DRP B;  2HWT A;  4G1Q B;  5DDQ C;  3ZZ0 A;  2KJW A;  1R7I A;  1R6Y A;  1EB0 A;  2FZK B;  1S1T B;  4CWB A;  4QR0 A;  3E51 A;  5C42 B;  2WHO A;  1U48 A;  2GV1 A;  2DGW A;  3M6W A;  5E33 A;  3NAH A;  4X4U A;  3CC2 S;  2CNL B;  3PFO A;  3ETO A;  3PZP A;  4C3M A;  3AD9 C;  4GVL A;  2MZS A;  3MM7 B;  1IKW B;  4RNF A;  5A2Q U;  2RE1 A;  2GX8 A;  5KFU A;  4ZVQ B;  5DO2 A;  3JSM A;  4EUV A;  2O5D A;  3NWG A;  1HAR A;  2Q43 A;  1XTZ A;  5ETM A;  3N79 A;  3J7Y U;  1KEK A;  2F5G A;  1M5H A;  1P1L A;  4IUF A;  2OJ3 A;  1RHK B;  2CQ2 A;  4W90 B;  1XN9 A;  2VV5 A;  2BQU A;  1NXI A;  1N32 F;  1QE1 A;  3JQK A;  1DAX A;  4WZQ A;  3UDV A;  2H1Y A;  1FA0 A;  3MEG B;  5IM0 B;  1Q8K A;  2VON A;  4QWD A;  1VQ9 S;  1T3N A;  2UXB J;  3OD2 A;  1WC0 A;  1N8R T;  1R89 A;  2D69 A;  3HKZ D;  2N3O A;  4CTA B;  3NAI A;  2UUB J;  4WBF A;  4X4R A;  1GX6 A;  3H2L A;  3K5O A;  3L7O A;  1T94 A;  3R1L A;  1FF2 A;  2HBY B;  1WEZ A;  5HVF A;  3BQ0 A;  3HP6 A;  3NP5 A;  1J5E J;  2BRL A;  5L1I A;  4DV2 J;  5K5M A;  1FFG B;  3RB0 A;  2KVQ E;  4F4A A;  2R7U A;  3N6M A;  4ECR A;  2EC2 A;  1EET A;  3TUI C;  3MPW A;  3W2W A;  1ZA1 B;  1Y5I B;  3DM2 B;  4K59 A;  4ED4 A;  1SCJ B;  5CA5 A;  2ZHO A;  5EHH A;  5KOX A;  4PXC A;  1JLF B;  1YJN S;  2B8Q A;  3J7A N;  3EE3 A;  1FE4 A;  2VG7 A;  2EG1 A;  5EUH A;  1FRL A;  1ZBT A;  2C2K B;  4KT0 C;  2AZ1 A;  4ITS A;  1NAQ A;  1Q79 A;  1IR0 A;  2HBQ B;  4I2P A;  4ID8 A;  2R2U A;  4OHV A;  1H2V Z;  5HMW A;  3VCD A;  2V4Q A;  4JV5 J;  2CZV C;  5LJ3 Y;  2JEI A;  2XYG B;  4ZCK A;  3CJS A;  4DL6 A;  3MTK A;  2NSB A;  2B3T B;  5B0A A;  4O3R A;  3ZZR A;  4PG7 A;  1MMD A;  2C2R A;  1VC0 A;  2IC3 A;  3FCV A;  2I5J A;  4CLU A;  3OSN A;  1NSP A;  1GXL A;  2EFG A;  1PAU B;  3JSM B;  2W2N P;  2JOQ A;  4RWW A;  5KFS A;  1S1W A;  3PDN A;  4I7F A;  1HI0 P;  2CUY A;  1NB7 A;  4TQR A;  1PIE A;  4I6A A;  1VQK S;  3NOG A;  5HQL A;  1AXQ A;  1WDD A;  3HHN B;  2BYC A;  3BN4 A;  1UWB A;  4NPO A;  5KFY A;  4QW8 A;  4ZK7 M;  1X0P A;  2R2S A;  1ZPW X;  2XUL A;  1QE1 B;  4BC7 A;  4NXM J;  2J76 E;  2AIR B;  1TV6 A;  1AB8 A;  2YTC A;  3CED A;  3LP0 A;  4NYO A;  3QAT A;  1IWA A;  3ZTP A;  3NS7 B;  3VVT A;  1MU2 A;  2OLW A;  2BVZ A;  1FXR A;  4OYP A;  2KZM A;  1QM9 A;  2ERR A;  2ROG A;  3PCO B;  2W9C A;  3CF5 Q;  2IM0 A;  1O51 A;  3W7B A;  1BQN A;  2L9N A;  3B6B A;  5E3C A;  5HK4 A;  2ZBC A;  3Q23 A;  3CCV S;  5IT0 A;  4ECX A;  1FJG F;  3VF0 B;  2WK4 A;  1SL2 A;  1FKA F;  4O3Q A;  1EET B;  5ETS A;  4DR6 F;  3W2W B;  4FNH A;  2DGQ A;  2HND A;  4NZ0 A;  3OFF A;  3QWU A;  1FJE B;  3JSR A;  1RZM A;  2OAU A;  3ZFV A;  1PC4 A;  1RWK B;  2Y1J A;  2VG7 B;  3TNV A;  3BYP A;  2VU5 A;  1RT4 A;  1ICE B;  4DS4 A;  3G9C A;  2V2Q A;  2CQC A;  1JJ4 A;  3GCX P;  2MSS A;  2LXI A;  3W60 A;  1RTD A;  1FRK A;  1P8G A;  1VK8 A;  4I2P B;  1QDU B;  2R7O A;  2MPU A;  5KT2 A;  4Q2M A;  1RWU A;  4PXB A;  2IA0 A;  2HG4 A;  2FZC B;  2L3M A;  2HFZ A;  2JVO A;  4ECU A;  1JKH A;  2DXE A;  4LFC F;  5AXN A;  2JWN A;  2YNF A;  4URQ U;  4MFB A;  4AL7 A;  1NHV A;  1LW0 A;  4LQ9 A;  3AFG A;  1X4D A;  1KTV A;  4DL3 A;  5RUB A;  3GYX B;  1Z1Z A;  2IC3 B;  3O3L A;  4I4B A;  4WWS A;  3QSI A;  4BS2 A;  4WFA Q;  3HZG A;  2I5J B;  3PHE A;  4YB1 P;  2WON A;  5KFN A;  1S1W B;  2RDI A;  4I7F B;  5H1S V;  4M5N A;  4QJV A;  3V6H A;  2YPZ A;  1AFI A;  4ZJO A;  1UWB B;  3I0R A;  3JSB A;  1RWV B;  1RI7 A;  1NZ8 A;  2LA4 A;  5KFX A;  1CC8 A;  3DXS X;  3M8R A;  1TV6 B;  3MZI A;  1RTI A;  4ZP8 A;  4TKT A;  4JI8 F;  3LP0 B;  3POT A;  4EWT A;  2DR8 A;  2VQE J;  3T5K A;  1MU2 B;  1LFP A;  3IO1 A;  4WII A;  3TEH B;  1D9A A;  7FDR A;  2W9C B;  2BJ1 A;  3NG8 A;  1H98 A;  2G13 A;  1P6T A;  2LDY A;  1QY7 A;  1BQN B;  2JRS A;  3JSY A;  1X4H A;  4NA3 A;  4JI4 F;  3VR1 A;  1TQL A;  2BOA A;  4DR5 J;  1Q95 G;  3PIO Q;  4M5H A;  4FBU A;  3DFE A;  1PJ5 A;  1IR2 A;  1RU2 A;  2MTL A;  1HR0 J;  4RW9 A;  2HND B;  4DX5 A;  2XWX A;  2KHC A;  2GZO A;  4AFF A;  2KB2 A;  3QBC A;  2VJV A;  4PEO A;  3TAR A;  1RT4 B;  4OI0 A;  1JNR B;  2BV3 A;  2V2V A;  2YX1 A;  3BGR A;  2HLU A;  3UI3 A;  4DR7 J;  3TAP A;  3JB9 k;  3JTO A;  3HM9 A;  2ASD A;  1RTD B;  1XNR F;  3CJ5 A;  1VYA A;  3NCP A;  3R9L A;  5KFW A;  4JI3 J;  3RTV A;  1XNQ J;  4Z7C A;  2JLG A;  4B9N A;  2YKQ A;  3WDO A;  4LFA F;  2IDE A;  3HCX A;  3CGI A;  1U2F A;  4PQA A;  4Q44 A;  3IXQ A;  2FZG B;  1JKH B;  4USJ C;  5ETK A;  3BJY A;  2YNF B;  3A4T A;  1C0T A;  4MFB B;  1LW0 B;  1V5I B;  5DDP C;  2RQK A;  1NCL A;  3TZY A;  5EGY A;  4CDI A;  3A1Y G;  3ITH A;  3PX4 A;  3H5X A;  2BJD A;  4OZL A;  2M70 A;  1Q1K A;  1RT1 A;  2UV8 G;  2XQC A;  2WON B;  3QJP A;  1GK8 A;  3LWL A;  4K4Z A;  1UZD A;  2MZ1 A;  1MML A;  3IM9 A;  2DVI A;  4X2B A;  4DR4 F;  1PAE X;  2MQL A;  3HFK A;  2W4P A;  3I0R B;  3DOM A;  2Z8Q A;  1SH2 A;  3H5Y A;  3MR2 A;  4CO5 A;  1RAC B;  3ZTQ A;  2RU9 A;  3M8Z A;  3R5G A;  2Y1L B;  5K8P A;  4OZN A;  1HYS A;  1S1X A;  1RTI B;  4MK8 A;  1HPZ B;  3H25 A;  3POT B;  3LAM A;  2QG9 B;  4H4K A;  1RWO B;  4HTI A;  1M5O C;  1B4S A;  3VGU A;  4ZP6 A;  1GTE A;  1SQG A;  1WF0 A;  4CIO A;  2WRM A;  2LFV A;  4F8R A;  2VA2 A;  2MHE A;  4ZN3 A;  1RJJ A;  2GW8 A;  2GJI A;  4DFJ A;  4KSE B;  4FKY A;  2MLZ A;  3BN7 A;  5F0W A;  3HXM A;  3CJ4 A;  4Z7Y A;  1U6B A;  2M8D B;  2KRR A;  1HBU A;  3L95 X;  3HPO A;  4PWU A;  4Y2I A;  5CYJ A;  5IQQ A;  1WD6 A;  5U47 A;  4JI1 F;  4DV1 J;  4MKV A;  3KLF A;  4I67 A;  2AJ4 A;  2KL8 A;  3LTO A;  5F8M A;  3QYY A;  4RW9 B;  3P5B P;  2O67 A;  5I42 A;  1TR0 A;  4HI2 A;  4I2Q A;  1WHV A;  2XEX A;  3SCI E;  1KLM A;  3RW6 A;  2IVF B;  3BGR B;  2YPY A;  3UVJ B;  6AT1 B;  1O6X A;  2ZC3 A;  2YKP A;  4ZVO B;  2KFZ A;  3DOL A;  5CD4 A;  4DV7 J;  1OY9 A;  4P74 A;  1SC3 B;  4LF6 F;  4NLG A;  5HI7 A;  4LBP A;  2Z30 B;  4IH7 A;  2VG5 A;  3OL7 A;  4JV2 A;  1HA1 A;  1PYS B;  1C0T B;  2XNQ A;  1N36 J;  5FII A;  2RDJ A;  1S0N A;  1CLF A;  3DU5 A;  1UEU A;  4KHR A;  1B3T A;  1WKK A;  3SXL A;  4IO1 A;  5EWF A;  3VV2 B;  3ILJ A;  4QR2 A;  2XMT A;  1G1X A;  3NS6 A;  2XMA A;  2IJR A;  3VQT A;  3W9H A;  4ZP7 A;  2KYX A;  5CZX A;  1FK9 A;  2AT1 B;  3UR0 A;  4ECS A;  2C3U A;  5T41 A;  2ZDO A;  3DOM B;  4F0M A;  1S77 D;  3F73 A;  2DXD A;  4C6A A;  2EFP A;  5IV4 A;  1FTR A;  4A4J A;  4KO0 A;  4JV1 A;  4ELU A;  1N5V A;  1HYS B;  1UL3 A;  4DSJ A;  1S1X B;  1U1L A;  3GE9 A;  2UXD F;  1T05 A;  2XZT B;  4ZA1 A;  1FD2 A;  4ZLL A;  3KHG A;  3GSI A;  4PXD A;  2FC8 A;  5D3G A;  2JEG A;  3A8J A;  2UU9 F;  1Q53 A;  4ZLP A;  3V5R A;  2XGQ A;  2ZBI A;  3EGZ A;  3I0S A;  3J7Z T;  3RG6 A;  1HFE L;  2RB7 A;  1HBU B;  4Y65 A;  5SZT A;  2ZOM A;  4X66 F;  2R2R A;  4FPR A;  2Y9H A;  3DKD A;  2OD4 A;  3GFX A;  3RR8 A;  1QAY A;  1X9M A;  4CH7 A;  2V6A A;  1YWX A;  3BPD A;  4WJB A;  1JLG A;  5AE3 A;  3KLF B;  3SQO P;  2CQ3 A;  1GAO A;  3V6J A;  4N7T A;  2J9E A;  3BO4 A;  3IAS 9;  4XO0 A;  2HIY A;  3QLH A;  3HVT A;  5I42 B;  1TKX A;  2ROE A;  1X7V A;  1F5B A;  1Z4U A;  4I2Q B;  1V3Z A;  3N5F A;  2CQ4 A;  5HQM A;  4WTO B;  2F65 A;  3BV8 A;  3E3X A;  1RHQ B;  1KLM B;  2C2Z B;  2PMW A;  2JFD A;  2GGP A;  2FJV A;  1VHF A;  2XMM A;  2B8P A;  1X5T A;  2GFF A;  2FB0 A;  3DOL B;  2MXY A;  2BAC A;  2W25 A;  2DGO A;  4DUZ J;  2VG5 B;  1ZM3 A;  4LR7 A;  1B0T A;  1B0P A;  4NA1 A;  2KT3 A;  2O01 C;  1FDB A;  2MQQ A;  2W2O P;  3BQ1 A;  1NK8 A;  3SFG A;  1PG5 B;  1GEH A;  5CAA A;  1KQK A;  5GAH U;  3KJV A;  5GAD U;  4X62 J;  2J0S D;  3PO4 A;  3CW2 C;  4GKJ F;  4HH1 A;  2QLB B;  2XMW A;  1CQN A;  2LEB A;  3GIM A;  3ISZ A;  1M5K C;  3I82 A;  2LQB A;  4E98 A;  4YR0 A;  4ZPV R;  4NLU A;  2Y8Y A;  4IOB A;  2R8J A;  3P45 B;  3CD7 A;  1FK9 B;  1IKX A;  2JL9 A;  3TZX A;  5E3P A;  4C3L A;  1RWM B;  4ZIT A;  3UD4 P;  2W1B A;  4KO0 B;  1HNZ J;  1VHI A;  2CQG A;  3UCZ P;  4KBI A;  1T05 B;  4L76 A;  3Q8R B;  1U25 A;  4H54 A;  2JVR A;  2FVQ A;  1S57 A;  5IS2 A;  5D3G B;  4MIA A;  1AZS A;  4DV3 J;  3BO2 A;  5KFF A;  1OQ6 A;  1Q5Y A;  1DQ9 A;  1QVG R;  3M9M B;  3I0S B;  3OXL A;  4DX8 H;  2UXC F;  4FVM A;  3UQS A;  4ZVG A;  4DMZ A;  5A8R A;  1UFW A;  2X51 A;  4WFY A;  6FDR A;  2OSR A;  3HD1 A;  2FJW A;  1FHT A;  1V3R A;  1S5Z A;  2ATL A;  4PCQ A;  1AFJ A;  1WNE A;  3IA0 A;  1VQ5 S;  4FF2 A;  2XLJ A;  4ED2 A;  2RQM A;  2Z2Y B;  2R42 A;  3H7H B;  4OZ3 A;  4P71 A;  3QLH B;  1RYS A;  3HVT B;  1TKX B;  1YDL A;  3Q8S B;  2VQF J;  2C2N A;  2ZKT A;  2E5G A;  2RRB A;  1JNZ B;  3I87 A;  4USW A;  2A0F B;  2FGO A;  1CJK A;  4LIR A;  2GGP B;  1TTH B;  2G0J A;  4TY8 A;  1SC6 A;  4RUB A;  4DEZ A;  1HNW J;  5LMU J;  4LMZ A;  1Q7L B;  2J7W A;  3RAQ A;  3GMG A;  1Q16 B;  5K20 B;  3KMS A;  3CJ8 A;  1I6J A;  2R7W A;  1KFD A;  1RT2 A;  2CKW A;  4NLW A;  3C19 A;  2KTQ A;  4F04 B;  3I32 A;  4KH1 B;  3PKY A;  4UZC A;  1RKJ A;  3KJV B;  1N33 F;  1UVM A;  1F2G A;  1RK8 A;  1S12 A;  4QWB A;  1DBD A;  3GJT B;  5KT4 A;  5IFM A;  1RWX B;  4OJH A;  2NXE A;  3ZO7 A;  1L5U A;  3FRY A;  1EAR A;  1QTM A;  4PQU A;  2F4V F;  1UJ4 A;  2DR7 A;  2OI2 A;  4J91 A;  2BAN A;  1IKX B;  4RNM A;  4LJM A;  3KWM A;  1S6Q A;  3I5C A;  5F8G A;  2UUA J;  3EM1 A;  4B3R J;  3NMA A;  4J9M A;  2BE9 B;  2CJX B;  5D4N A;  3LGH A;  3FFI A;  3AJD A;  1VQN S;  4TXS A;  1UW4 A;  3CCQ S;  1AZS B;  2RQC A;  2FIU A;  3OTC A;  2X7I A;  2HKE A;  2R7S A;  2U2F A;  2EFQ A;  2P9G A;  3HO1 A;  4OZ5 A;  3TUP A;  4ED8 A;  1B7F A;  2O3D A;  2KT5 A;  5AE1 A;  2XY6 A;  4J9V A;  4XTT A;  1TAQ A;  3M1V A;  5A8R B;  2J5A A;  3UDL A;  1IBM F;  2N7C A;  3G6V A;  2J7K A;  2HPU A;  5KG0 A;  4N56 A;  2XSF A;  3LA0 A;  1R8C A;  4F25 A;  2BA9 A;  1WAC A;  5AXM A;  4DQQ A;  1HI8 A;  4F0H A;  2FYX A;  3EVW A;  2DHH A;  4USH A;  2B0G A;  3A8I A;  3FBE A;  3W5Z A;  2J9D E;  1YQH A;  2ZZM A;  3OUY A;  5CHC B;  1CJK B;  2HFV A;  3SCL E;  4IQX A;  4TY8 B;  1M5S A;  3G71 S;  2EC0 A;  2C2D A;  4PYD A;  1KS2 A;  3LUY A;  1K1Q A;  4U7U D;  5GAG I;  1RT2 B;  1L3S A;  1RDR A;  3TJ9 A;  5HP1 A;  1N54 B;  2FHO B;  3U1L A;  3CJK A;  2YH0 A;  3MGJ A;  2Q3P A;  4NMX A;  2BM0 A;  3ILL A;  2A6O A;  1JK9 B;  3OSP A;  3FQK A;  3A13 A;  2IJF A;  3Q89 A;  2CIM A;  3AH6 A;  5KTQ A;  3R2D J;  4YB7 A;  2O1P A;  3PRD A;  2QO3 A;  2IPO B;  4PQU B;  4C7Q A;  5FD1 A;  4ANE A;  1ZA2 B;  5KFG A;  1LV5 A;  2BAN B;  3TZZ A;  2XHW A;  5BR8 J;  3IN5 A;  1WOO A;  5JXS A;  3THT A;  1S6Q B;  1T9X A;  3CCW A;  2O66 A;  2IIH A;  3AA8 A;  4N8O A;  3K0J A;  4ALZ A;  5HAT A;  4Q5V A;  4KHP F;  4UZB A;  2GAG C;  4HEA 9;  3B4D A;  1RYR A;  2FUG 9;  1CUL A;  3KHH A;  1P9Y A;  1FT8 A;  1X4G A;  3FFI B;  4NYZ A;  1RB0 A;  2M52 A;  2DY9 A;  2BZ2 A;  4M5L A;  1XR6 A;  2NUH A;  3IS9 A;  4J9U E;  1L3U A;  1WJ9 A;  4JP8 A;  2HHW A;  4PKD B;  4CLP A;  3TVK A;  3LO3 A;  4ETZ A;  2EXU A;  1MWZ A;  4C8N A;  3SMZ A;  5DZ6 A;  3M1V B;  1S4F A;  5IC6 B;  5A8W A;  2CJK A;  2AF6 A;  4ZP9 A;  3CDW A;  5H9F K;  4F4X A;  4ELV A;  3G6Y A;  4ZVE A;  5J2P A;  3TAQ A;  1RCO B;  3KLG A;  1VQO S;  4HKQ A;  4JI5 F;  2R8G A;  3PV8 A;  4X65 F;  2G1D A;  3FRZ A;  5DDO C;  5HMZ A;  3NGD A;  1SQF A;  1FES A;  4TN2 A;  2AQ4 A;  4U7C A;  1WEX A;  1IQZ A;  1JWW A;  3UE2 A;  3G87 A;  2PD1 A;  3MEC A;  2XI2 A;  2CPE A;  4CNY A;  1F5C A;  3MTJ A;  5L1J A;  3RBX A;  4RJV A;  3OUY B;  2ZM6 F;  4HR2 A;  1NJW A;  2AWZ A;  3JQJ A;  3H2U B;  3L4B C;  4P7V A;  1Y4Z B;  5GMD A;  3MM5 A;  2AEM A;  3CT9 A;  4AQY J;  1REV A;  1JLA A;  3W8P A;  1IBL J;  3G4S S;  1WUU A;  2GO9 A;  2LKZ A;  3CCM S;  1SUQ A;  2VC0 A;  1XIQ A;  1RP5 A;  2JC1 A;  2B5J A;  5HP1 B;  2YY3 A;  4ANC A;  1GMV A;  1LFW A;  3CJK B;  1L3V A;  1X5S A;  2DO4 A;  1RKI A;  1A0O B;  2LA6 A;  1WOS A;  1Z2L A;  1JLE A;  1U1R A;  4UUW A;  4RU2 A;  5A6P A;  1WDT A;  3ENQ A;  1UA0 A;  2OHD A;  2CZ9 A;  4P52 A;  1ZH5 A;  5CXT A;  4FNI A;  3CE8 A;  3P3D A;  4N47 A;  1UTA A;  3CCL S;  3KNG A;  3H0P A;  4RUA A;  1RAD B;  1NDP A;  3EMT A;  4LRB A;  4OYZ A;  5FJ4 A;  3MMA A;  5HJX A;  1QD1 A;  1WF1 A;  1IVZ A;  4AXI A;  3MR5 A;  1U1Q A;  1WC3 A;  3OTB A;  3TWZ A;  3BGL A;  3PW7 A;  3VTI A;  3CJ3 A;  2B6A A;  1NME B;  3PHT A;  1CUL B;  3JAM Y;  3D0G E;  4DUY J;  2VFU A;  2Q79 A;  4CI0 B;  2NXN A;  3BBF A;  5IWA F;  4ZIV A;  1RHJ B;  3IS9 B;  4XK8 C;  1YRT A;  2BKP A;  2BMB A;  2DKO B;  1OWX A;  1YG0 A;  2RD5 C;  1ZPV A;  1WC5 A;  3MFI A;  3WC0 A;  1QAX A;  1RWP B;  4FYW B;  3JTN A;  5A8W B;  1KN6 A;  5AE2 A;  4USU A;  3D9B A;  1DUR A;  2J9C A;  4MIB A;  2AHO B;  4USI A;  5J2P B;  1BWE A;  3KLG B;  1Y7P A;  2Y8W A;  2VHG A;  5DGB A;  2FJE B;  3BH7 B;  3QGP A;  4DWI A;  3GLJ A;  2HS3 A;  2HAF A;  1T0T V;  4D3G A;  2ZH5 A;  2Z58 B;  1CEZ A;  2DNY A;  5KFV A;  3MEC B;  1J2V A;  2HIQ A;  3KTQ A;  4TY9 A;  1UMJ A;  3TQ1 A;  2DR9 A;  3M8P A;  4RU9 A;  1MWQ A;  1ZM4 A;  4UQT A;  4N41 A;  3M7V A;  2ZKU A;  5IT4 A;  1RTH A;  3M30 A;  3MM5 B;  5KG5 A;  1YGY A;  3D0H E;  3D54 A;  2BE2 A;  4RLE A;  1REV B;  3R1H A;  1JLA B;  1VI7 A;  3UN5 A;  4XIU A;  3SDE A;  2FLP A;  1U2R A;  4C97 A;  1SUQ B;  3TEG A;  4WF9 Q;  2B5J B;  1HI1 A;  3ZTR A;  4DHV A;  2DPI A;  2GMJ A;  2NUU G;  4OJ3 A;  2DB1 A;  2MQO A;  3CDE A;  3GFZ A;  4HVZ A;  5HMX A;  4DV4 J;  1AT1 B;  1JLE B;  2W8K A;  3ZZZ A;  4DCJ B;  4OI3 A;  1KSP A;  4F0K A;  3KG0 A;  3RAM A;  2VFV A;  2H5J B;  3PO5 A;  4QR1 A;  4Q0B A;  3UN3 A;  3CO9 A;  2IA6 A;  2B56 A;  3D67 A;  4CLK A;  1IBC B;  3P5T L;  4EMD A;  3A12 A;  3ZZT A;  2FVP A;  2CXE A;  4U8V A;  2L41 A;  1IKV A;  1FKO A;  2E9T A;  4HT5 A;  4NE9 C;  4XAK A;  4NEY A;  3MMA B;  2D3U A;  4J9N A;  4R8U A;  2YNG A;  2UXB F;  2HW3 A;  2H65 B;  4RW4 A;  1R8A A;  3HUL A;  3IBF B;  4NXN J;  1EX8 A;  5K8M A;  4ED0 A;  2IVY A;  2AJ2 A;  2UUB F;  2B6A B;  4B9S A;  4ID5 A;  4FN5 A;  1H74 A;  3KDO A;  4OV6 A;  4X4P A;  4C11 A;  1H7W A;  1SQE A;  1FX4 A;  1U0S A;  4J9P A;  3TA1 A;  1J5E F;  1WEL A;  3IMQ J;  4CO2 A;  1X4C A;  4KKO A;  4DV2 F;  1M0S A;  2E1M C;  1N34 J;  1SJ3 P;  2DGV A;  3CC7 S;  2LU1 A;  3T6B A;  3T9N A;  4ENO A;  4ZCL A;  5D0G A;  3T1H J;  4WK3 A;  2WOM A;  4CLS A;  1VFJ A;  5DLF A;  5I4M A;  1D1U A;  1APS A;  1R27 B;  2ZZT A;  3ZZU A;  2GQC A;  4J9O A;  5F9N A;  4B9L A;  2VPY B;  4LRC A;  1YJW S;  1NDK A;  2J6S A;  3VGS A;  2LQ9 A;  3KLH A;  2Z2M A;  3GJR B;  1VC5 A;  3R7N B;  4DV0 J;  2OD6 A;  3EJM A;  3LGN A;  2M4M A;  4F4Z A;  1FDD A;  2XSJ A;  1IWG A;  1KP6 A;  3M8P B;  1YX2 A;  4JV5 F;  2M0G B;  1YJT A;  5KFR A;  1RTH B;  4KQZ A;  1RUS A;  2F1F A;  3M30 B;  3DDN A;  2BE2 B;  3NNC A;  4DR1 J;  3SDE B;  1VQP S;  3MCS A;  2R9L A;  2OEL A;  1DZ5 A;  4WFN Q;  4J9R A;  2Z57 B;  3PRB A;  3M2V A;  1S7H A;  3W61 A;  2AKW B;  3FCW A;  3IGV A;  4NZ7 A;  3EVM A;  4R25 A;  2RT3 A;  2YX4 A;  1KWM A;  4Q0B B;  2A2D A;  1NK6 A;  1JLB A;  4DCP B;  3H90 A;  1B64 A;  2EPI A;  3OXF A;  1S1V A;  4KIA A;  1SL1 A;  1IKV B;  3LGM A;  2E1P A;  1FKO B;  4U96 A;  4NLX A;  4NXM F;  2GNK A;  4DX7 A;  3TUJ C;  3CCZ A;  4KJI A;  4C0O C;  4R8U B;  3KXD A;  2ZH7 A;  3BGU A;  2YNG B;  3TA0 A;  3W5X A;  3HHE A;  3OQ2 A;  4U8Y A;  2QIF A;  2XZW A;  3ZNJ 1;  1RHU B;  3QGG A;  4ID5 B;  4C11 B;  1L3K A;  2ZH3 A;  4QYZ K;  1NJX A;  2QZ8 A;  4JI6 J;  4WKR A;  4KKO B;  2WSF C;  3IRX A;  5LL6 d;  1Q8B A;  3Q8V A;  4M5D B;  2CYY A;  2JLF A;  2RHQ B;  2ZBR A;  1Q7Y T;  2B9Y A;  5EX0 A;  1KVK A;  1X9W A;  2MGZ A;  2WOM B;  2HLT A;  1KDN A;  1RU1 A;  3G8S A;  4F4K A;  1MN9 A;  3W65 A;  1HIY A;  2MQP A;  2FJX A;  1VMB A;  3GCW P;  4V1A k;  1RQ0 A;  2NPF A;  5E41 A;  4O0I A;  3C46 A;  3OVB A;  4DG1 A;  3P4U B;  4J9K A;  1EQ0 A;  2M2B A;  3KLH B;  2HHX A;  1HNX J;  5AJ3 J;  4KH0 B;  4DSK A;  5GME A;  5B0C A;  3R27 A;  3TQE A;  4KR0 B;  2FLO A;  2HAI A;  3SSR A;  3GTY X;  1I51 B;  4DR2 J;  2XSJ B;  5C5J A;  5F8I A;  4PWD A;  1K9M T;  3DGP A;  4NCG B;  4CLF A;  3E2E A;  2C2M B;  3WX8 A;  2DY1 A;  1NZA A;  1WG1 A;  1BGX T;  2BOP A;  4Y2A A;  5HJY A;  1QLN A;  1M1G A;  2PC6 A;  4C8K A;  4DL7 A;  1K47 A;  1QSS A;  4OL8 A;  4ZCI A;  1I5O B;  2IVM A;  4GO5 X;  3M2V B;  2Y3Y A;  1ROF A;  1V5V A;  3TRG A;  1Q8I A;  1EP4 A;  3CME S;  4ES2 A;  4DOZ A;  5DJB A;  3CSK A;  4YHH J;  3MUM P;  3C8Y A;  1ZZN A;  1U1P A;  3DLB A;  2VDH A;  1VLY A;  1JLB B;  4QBU A;  2GC8 A;  5G4D A;  1KON A;  2DBB A;  3FSI A;  1S1V B;  3GG0 A;  4U7U K;  4ECW A;  5D4O A;  2H48 B;  3AOA A;  2AV5 A;  2ZH2 A;  2VQE F;  5GAE I;  5E0O A;  1SC4 B;  5GVQ A;  3K58 A;  4DLE A;  2FD2 A;  3M2U A;  3VWS A;  3LP1 B;  1YVF A;  1W25 A;  2DEI A;  1F60 B;  4CZC A;  2EVZ A;  4C8Y A;  3H2V E;  4ED6 A;  1NPR A;  3GYG A;  3K7R A;  3TW0 A;  2VFR A;  1WG4 A;  2NZ4 A;  4DR5 F;  3IRX B;  2GAH C;  1SKS A;  1D9D A;  3K8W A;  5B0F A;  2MGZ B;  3AB2 B;  1T9Y A;  3WIU A;  1HR0 F;  3DLE A;  2NPI A;  1I3O B;  3UD3 P;  4ZVU B;  2GCF A;  2B7C B;  2ILZ A;  4L72 B;  2UVW A;  5FLX Y;  2H4W B;  1U0H A;  2SXL A;  1IXK A;  3OV7 A;  2WCX A;  2B43 A;  4QQB A;  4DG1 B;  3FJ2 A;  3K5M A;  2C28 A;  4I6W A;  3V6D A;  4EYI B;  3ETM A;  1FO1 A;  3TX0 A;  3AXK A;  2ALZ A;  3KUE A;  4DR7 F;  1AUD A;  2EK1 A;  4RUC A;  2ZEJ A;  4ZKA A;  3H8Y A;  5BJR A;  4JI3 F;  1UPM B;  2APO A;  1XNQ F;  4PWD B;  3MAQ A;  3DGP B;  4OHX A;  3G6X A;  5KFA A;  4IDK A;  1VQ6 S;  3CC4 S;  2RS2 A;  2RRN A;  1WOR A;  3M8S A;  2ZJQ Q;  2BJE A;  5ETL A;  2E29 A;  1R8B A;  4J90 A;  1LKZ A;  1YK9 A;  2KXF A;  2RHS B;  3CJT A;  3PYF A;  5H9E J;  3OHB A;  1NLK L;  4DZ6 A;  2YNI A;  2CQD A;  2WVF A;  1MMN A;  2BAB A;  1XMO J;  3MCN A;  2W24 A;  3EGN A;  3NY0 A;  3W9I A;  3MUT P;  1U7L A;  3F56 A;  2IAJ A;  4L75 A;  4CO3 A;  3D6T B;  3ET6 A;  3QWP A;  1OPZ A;  4TVA B;  3K5N A;  1EJ7 L;  2BBE A;  4LFC J;  1SKR A;  4JBC A;  1KQS R;  1LQ9 A;  4TYB A;  3D68 A;  3M9O B;  1HL6 A;  3K2Y A;  1CG2 A;  5KFC A;  4Y2M A;  4B9U A;  1YIT S;  3CJ2 A;  2HK2 A;  2BW2 A;  3LPY A;  4AXJ A;  2QEX S;  3HDS A;  2R7R A;  4ED5 A;  1NJY A;  4QIG A;  3MAA A;  3M2U B;  3I6P A;  4LSL A;  2ZC4 A;  3PVX A;  1MNE A;  2G1H A;  3PYE A;  4A8X A;  3MPU B;  2DIV A;  1VQ7 S;  1P9Q C;  1VBK A;  4RW6 A;  4KHM A;  5LSR A;  3GII A;  3W8G A;  3OL6 A;  3S8S A;  3WQP A;  5C24 A;  2G2Y A;  2Q6B A;  4DUT A;  3HZE A;  4MKA A;  4DV1 F;  4DU8 A;  2PFD A;  3PW2 A;  2DNO A;  4MK9 A;  2MKJ A;  3IWL A;  4ZVS B;  2XHC A;  3FEY B;  5CAB A;  1U1N A;  4HYK A;  1BC6 A;  3DLE B;  2V4R A;  4WYL A;  2A1B A;  2QL9 B;  3GV5 B;  4L74 A;  1U0H B;  2VOD A;  3IM8 A;  3CCU S;  2PO4 A;  2EEY A;  1LXJ A;  1TUV A;  1FNM A;  3V6D B;  4X64 J;  2DNR A;  5I3Q A;  1FE0 A;  5E7O B;  2DIU A;  2LP4 A;  2C2O B;  3HSD A;  4EBC A;  1FWP A;  2EKY A;  2RAQ A;  3UR3 C;  1UVI A;  3FC9 A;  4ZPC A;  2R7Q A;  4AL5 A;  3RYL A;  3PW5 A;  4CM0 A;  4DV7 F;  1D8Z A;  1UJ6 A;  4IDK B;  4IRK A;  4KRW A;  2RF2 A;  2ADB A;  2K7J A;  1OYE A;  3HMJ G;  1TKZ A;  4DZD A;  3FSX A;  3L7U A;  2XLI A;  4V19 J;  1E6Y A;  1YIJ S;  1N36 F;  3PXG a;  2NR0 A;  1G3O A;  1Y3J A;  3U02 A;  4I6Y A;  3RBZ A;  2YNI B;  1WSV A;  2G0C A;  1TK5 A;  1TMJ A;  2KHD A;  2V8P A;  3ZNU A;  1RT7 A;  2IAJ B;  4BBY A;  3ET6 B;  2HS4 A;  1VRU A;  5M2P A;  4DS5 A;  4CO1 A;  1S6P A;  4RBT A;  2KXH A;  5B0G A;  5KT7 A;  3EVO A;  2A6M A;  4OMF G;  2V69 A;  2VOO A;  2HRU A;  1N5Q A;  2ZH1 A;  1DTT A;  1X60 A;  1NJZ A;  4NLY A;  2M7S A;  5KFD A;  1TL1 B;  4DQR A;  1M1H A;  2C42 A;  3HHL D;  2QA4 G;  2V8G A;  1SJ1 A;  3J7Z 5;  4DR3 J;  1FKP A;  4P7T A;  4PG5 A;  3U27 A;  3MAA B;  4K8R A;  5HAO A;  4F3M A;  4OYI A;  3HKW A;  3QID A;  4LSL B;  1ZYQ A;  1AYE A;  5HMY A;  4I1T A;  4UQG A;  2E1C A;  3V81 B;  4LVN P;  1MN7 A;  2F3J A;  2FHK A;  4RW6 B;  1OSD A;  4RO0 A;  1R31 A;  1S1U A;  3LOU A;  2HQD A;  4K4X A;  5MLC V;  1C0U A;  2DCL A;  1Z2Z A;  4P2F A;  1LK7 A;  4ED7 A;  4UW2 A;  1EQM A;  3KK3 A;  2YWG A;  4G6V B;  3B82 A;  2MYF A;  3D6H B;  2WB1 D;  3FK4 A;  1TL4 A;  3BS9 A;  4WE1 A;  5J2N A;  2LDI A;  5KFL A;  2N82 B;  2OTJ S;  1Q81 T;  3GU0 A;  2L08 A;  2B9X A;  2XGP A;  1VGY A;  3C3L A;  3VAJ A;  2OIH A;  4WXO A;  5KFJ A;  2UUW A;  1WC1 A;  1KHW A;  4UOC A;  3DOK B;  2NS1 B;  2PE8 A;  2DRD A;  2RF2 B;  1T11 A;  3N01 A;  4DUZ F;  1X4E A;  3FSY A;  2YKA A;  3BBC A;  4J5O A;  4G1I A;  1NK7 A;  2WVE A;  1TKZ B;  1KHV A;  3CB4 A;  1OJ4 A;  1E6Y B;  1Y11 A;  1F6T A;  4JYA J;  3W64 A;  4X62 F;  2WAQ D;  1U09 A;  3DCA A;  1OYD A;  1S0O A;  2E44 A;  1FEE A;  4A8O A;  2GIF A;  3J81 Y;  1RT7 B;  1S49 A;  3R7S B;  2FC9 A;  3CCE S;  1VRU B;  4TU9 A;  4EBD A;  3WC2 A;  1UAW A;  2JFK A;  3M8Q A;  5LT5 A;  3O5T B;  1S6P B;  3BSA A;  4ZVR B;  3J7Y I;  2XB2 D;  2XYP B;  1WTB A;  3J81 j;  2RIJ A;  4WKY A;  1DTT B;  1F0X A;  3VAF A;  4GVB A;  1HNZ F;  3D4J A;  1YLX A;  2FPH X;  3PJW A;  5IXU A;  3MR6 A;  1YSJ A;  2C3P A;  4W98 A;  1T9U A;  2NZC A;  4YEA A;  3P6Y C;  4LQ3 A;  4R0E A;  1FKP B;  4KGX B;  4LFB J;  2IM2 A;  2HHH J;  2HHT A;  1DAR A;  1I94 J;  4Q8F A;  4DV3 F;  3H5U A;  2DD8 S;  1SI9 A;  5F41 A;  4FBT A;  2Z2Z A;  1YHQ S;  4EYH B;  2F40 A;  3UW1 A;  5IC4 B;  3I5A A;  2DGU A;  2OUG A;  3IR5 B;  2C3Y A;  1H2U X;  1S1U B;  3J80 U;  1IBK J;  4NA2 A;  1C0U B;  2AW0 A;  4OYW A;  4RR5 A;  1CJV A;  4CLW A;  3GPA A;  2ASY A;  3KK3 B;  3EGW B;  4AD6 A;  4GRS A;  5BXI A;  4K50 A;  4DV6 J;  2MKC A;  1GNK A;  2VQF F;  2BKO A;  3TUZ C;  4WE1 B;  5J2N B;  4E8U A;  4CQ1 A;  2I8E A;  3VAI A;  3FKB A;  5IT9 Y;  3EIC A;  4DPX A;  2HZC A;  1N48 A;  3MXH P;  1HMV A;  2QX0 A;  2VPX B;  4F3O A;  5CH7 B;  2E5L J;  3U1M A;  1W2I A;  2RKI B;  2E7V A;  4KGV B;  2OPS A;  3KUH A;  1NK0 A;  4P73 A;  4C3K A;  3KKF A;  2KZZ A;  1QSY A;  3HT3 A;  1HNW F;  5LMU F;  1Y3K A;  3A3P B;  2IBK A;  4DSI A;  4ECZ A;  1KRP A;  1HWL A;  2W2M P;  2FJA B;  4ES1 A;  2N4D A;  4QWA A;  2KG0 A;  4C48 A;  2ALY B;  2K3I A;  1EKS A;  2MZJ A;  3NMR A;  2DNM A;  3PTW A;  3VZH A;  3DLK A;  4MMO A;  2CWK A;  1UCN A;  1WF2 A;  3G96 A;  4B17 A;  5D0E A;  4F3Q A;  3W63 A;  2CPJ A;  2HMI A;  5A2Q Y;  2LVW A;  3MR7 A;  2C1E B;  1RSC A;  3FUY A;  1RTJ A;  4ZCM A;  3TA2 A;  3M8Q B;  3OJS A;  4KAI A;  5C2C A;  4ZIW A;  3DLJ A;  4GVB B;  4YUD A;  3GV7 B;  4YB5 A;  3FEX B;  2UUA F;  2KFN A;  4A48 A;  4B3R F;  1IR1 A;  3CCJ S;  1VLO A;  1VBX A;  2G2Z A;  4HH0 A;  1S6O A;  4DQS A;  4ICL A;  3LP2 A;  1PBA A;  1X5O A;  2HZA A;  3F44 A;  4AT1 B;  5HVG A;  5L1K A;  2PA3 A;  2VJU A;  3K89 A;  4B3T J;  4OQJ A;  1K8A T;  3KG4 A;  1TUW A;  2XC9 A;  4J9Q A;  4EEY A;  1DQ8 A;  2CPI A;  1LWF A;  3D66 A;  1FCA A;  5E3A A;  4O23 A;  4PG8 A;  1M1K T;  3MD3 A;  2MDA A;  3KK2 A;  4N77 A;  2EFV A;  1M5V C;  1CJV B;  4NLD A;  2H5I B;  3M8W A;  4IFY A;  3AT1 B;  3HHL A;  3LAK A;  4XDC A;  2DR6 A;  2G0I A;  4O3O A;  1FEH A;  3ENW A;  1KQG B;  3BEG B;  5JUM A;  2CPF A;  4MYT A;  1R0B G;  1TEL A;  2XTJ P;  4TNO A;  2LXU A;  4ZPD A;  1YJU A;  5D4P A;  5JJB A;  2PII A;  2QLF B;  2WSE C;  2Y1I A;  2IM1 A;  5CCM A;  3BKT A;  2RUS A;  2W7P A;  1JXE A;  1HMV B;  2HS0 A;  2KU7 A;  2OPS B;  3H4D A;  1EHW A;  1GXU A;  4P9S A;  3A3N B;  3QNW B;  4M95 A;  4P72 A;  1YJ9 S;  3DMJ B;  2EWH A;  2J8A A;  3JTP A;  1S48 A;  4DFK A;  1S9F A;  4NRT A;  5J1P A;  4DV5 J;  2GVD A;  3DLK B;  1YRU A;  3SCJ E;  2GO8 A;  1NK5 A;  4R0J A;  1ZAW A;  2AZ3 A;  4Q45 A;  4ELT A;  5KG1 A;  2Y0S D;  4KYZ A;  2V0N A;  1HPZ A;  2HMI B;  2ZD1 A;  2Q1L A;  2DCU B;  2QMW A;  1KR4 A;  4YR3 A;  3EYZ A;  2VUG A;  4KE5 A;  1RTJ B;  2XBP A;  1CQM A;  5D0R A;  2IMO A;  4M63 A;  2UUC J;  5BR8 F;  2UP1 A;  1UPP A;  2MZQ A;  5LSO A;  4RPF A;  3KYL A;  3DRX A;  2DHX A;  3D6M B;  1S7I A;  2AGQ A;  1UP1 A;  2VDI A;  4X4T A;  1VR6 A;  2BXJ A;  2Y0B B;  4PG6 A;  2OO4 A;  3MR3 A;  4C2M A;  5A0Y A;  3KHL A;  4ICL B;  3LP2 B;  3SQG A;  1J27 A;  1V3S A;  2OTL S;  2IRY A;  3DXB A;  3M4X A;  8RUC A;  3EDR B;  2KM8 C;  3R5A A;  1LWF B;  5K8O A;  5E3Q A;  2RDD A;  1B7Y B;  2EI5 A;  2VBZ A;  4UOH A;  4ECY A;  3KK2 B;  4YP3 A;  1WG5 A;  3UVJ A;  2V8D A;  4IFY B;  1FJ7 A;  3CD5 A;  4QIF A;  3HHL B;  4FYV B;  2KVI A;  4TLR A;  4K2X A;  3GYN A;  2QRR A;  4QPT A;  3IRW P;  1QTN B;  5B08 A;  1DY3 A;  1U45 A;  1QSL A;  2ZVI A;  4KB7 A;  4FF1 A;  3PNI A;  1BQM A;  4ED1 A;  4PAB A;  2YNH B;  1NHK L;  1RAJ A;  2ZOG A;  5KFB A;  5KG7 A;  1RAG B;  2YX7 A;  3VQS A;  2FJD B;  1NKC A;  4K4V A;  1T95 A;  1VC6 A;  3PW4 A;  1UET A;  4LF8 J;  1NDL A;  5D6G A;  3B8H A;  2DNN A;  3TI0 A;  4AQY F;  1IBL F;  1LWX A;  2HQG A;  1JLC A;  4CH1 A;  1FFW B;  2RS8 A;  3NNA A;  4PWW A;  1FXD A;  4OZ2 A;  4IR9 A;  4PPZ A;  1UVN A;  2R8I A;  3GR1 A;  5HQ8 A;  1YTY A;  4YOE A;  4EFA C;  3V6K A;  5HVH A;  3CJR A;  1BD6 A;  2GVD B;  2RH3 A;  3ADA C;  1VQ8 S;  3QO9 A;  5B0E A;  2DTJ A;  1M5P C;  2HUR A;  2VKR A;  2CJQ A;  2ZD1 B;  4C8L A;  4DFP A;  4WIQ A;  3TAM A;  3I96 A;  5J1E B;  2ZWP A;  4MTP A;  4C8Z A;  2GHP A;  3TR5 A;  5KFE A;  2MQ8 A;  2HEK A;  2DO0 A;  1T02 A;  2AU0 A;  3FVY A;  4FYX B;  2XO7 A;  3LAL A;  4JI7 J;  3M6U A;  3RR7 A;  2GQ2 A;  2HQI A;  3CCT A;  5HO4 A;  4A8S A;  4LBH A;  2LQJ A;  3R2C J;  3I4H X;  5A0Y B;  1SL0 A;  1VIX A;  5LMN J;  2H54 B;  4DUY F;  3MFH A;  3NGS A;  5CYQ A;  3SQG B;  4KV8 A;  3BR9 A;  3HHD A;  1FVQ A;  3PKM A;  2DNK A;  2R8H A;  3G8T A;  3D28 A;  3OLA A;  2B4V A;  3V2U C;  4QIV A;  3CUN A;  1U8S A;  2BRK A;  3GJS B;  2GA7 A;  2N3L A;  3C2P A;  3US5 A;  4FXD A;  3X1L B;  4FF3 A;  1XWL A;  4JV0 A;  3B4M A;  2HNZ A;  3RRH A;  2IM3 A;  2IYI A;  3TVY A;  1FRH A;  1LOU A;  4CLY A;  4ZN1 A;  3PX6 A;  4LRE A;  3AOC A;  2HVE A;  5F8J A;  4EO8 A;  1BQM B;  2HFS A;  4CLL A;  5L9X A;  2HHQ A;  4OI6 A;  4FS1 A;  1RWN B;  3I9Z A;  1LW2 A;  2Z0G A;  2XO6 A;  3TZW A;  4X4Q A;  4PUO A;  1N5S A;  1RAA B;  4OYX A;  3SSS A;  2HBZ B;  1HKA A;  4IO9 Q;  1SB6 A;  1DQA A;  3SV4 A;  3IBW A;  3PEH A;  5HL7 Q;  1FWK A;  2GS8 A;  3BF4 A;  4Y2K A;  2L9W A;  1JLC B;  3N9U C;  1H7X A;  3HJF A;  4TQS A;  6FD1 A;  3NL0 A;  3TJ8 A;  1UKU A;  3MHY A;  2HFU A;  3S01 A;  2DGT A;  3QO9 B;  2JNJ A;  4DV4 F;  1RT3 A;  4CNZ A;  3RGI A;  1VBZ A;  3KLI A;  4XDD A;  2AEJ A;  2RQ4 A;  4ECT A;  1ARO P;  1YKW A;  2DPJ A;  3RBD A;  3IAM 9;  1TKT B;  2HVI A;  3HHK A;  5D0H A;  4WXW A;  3TAM B;  3NGT A;  1GQE A;  3WZ0 A;  1GT8 A;  1D3W A;  4K4Y A;  3K5P A;  1RAI B;  4ZPT R;  5B0B A;  1T9T A;  4HDG A;  3IGN A;  4A46 A;  3B78 A;  2ADC A;  4NXN F;  3GR0 A;  1UA1 A;  4IH5 A;  1D09 B;  3FMB A;  1WC6 A;  4NCA A;  1UFK A;  5CYQ B;  2P8I A;  3EPG A;  4KV8 B;  5D77 A;  3NCR A;  5F3T A;  2CVE A;  3SI8 A;  4P2X A;  4B3M J;  3EDQ B;  1U02 A;  3K17 A;  4DQI A;  3I56 S;  5K14 A;  3UNY A;  3RB4 A;  4LF5 J;  3UPF A;  5J2Q A;  1N34 F;  2YWW A;  1WKL A;  1U26 A;  4HHU A;  1UVJ A;  3T1H F;  3UD5 A;  2ZBP A;  2MZT A;  4AND A;  1U1M A;  1KVI A;  2WW4 A;  2W2Q P;  3OHA A;  3KOA A;  4C0B A;  2BKN A;  3DC2 A;  2HNZ B;  1SC1 B;  4HDH A;  1PC5 A;  3MOJ B;  1PO6 A;  2PEH A;  4USK A;  4K4U A;  1U2C A;  1PJ7 A;  4IR1 A;  4DV0 F;  2DT9 A;  2D9P A;  3FZ2 A;  2KO1 A;  1B99 A;  4K4T A;  4IQM A;  1LW2 B;  4ER8 A;  4UTG A;  2AX1 A;  4PUO B;  3H59 A;  2VOP A;  3BQ2 A;  1IJE B;  2PMH A;  2YKO A;  2JDJ A;  3MD1 A;  4ZVH A;  1CVJ A;  4O44 A;  5IZH A;  4L3K A;  1N6Q A;  1WEY A;  2FTR A;  3MM8 B;  1XER A;  2P9E A;  1U24 A;  4P6Q A;  4ILL A;  4DR1 F;  3W62 A;  3M9N B;  4FP9 A;  3HVA A;  4IH6 A;  2UVV A;  1DFD A;  1MRO A;  3AJ1 A;  3QT7 A;  1NJI T;  4M5J A;  2MMY A;  3P8B B;  1RT3 B;  4N8N A;  2R7T A;  5GAH I;  3KLI B;  5GAD I;  4F4W A;  2LYV A;  3QT5 A;  4CLT A;  3KDN A;  4BLG A;  5KFP A;  4ES3 A;  2W7A A;  3RUB L;  3ZZY A;  2F8E X;  2X3D A;  1ACM B;  4EBE A;  4K5R A;  2EFN A;  1RAB B;  1XMQ J;  2GJ2 A;  1Q82 T;  3CCS S;  2BJ8 A;  1XBW A;  3OL8 A;  3DGV A;  2PN6 A;  3UNG C;  1SIZ A;  5IV3 A;  4IFV A;  3OJU A;  1JLQ A;  4O0N A;  4IOA Q;  2ZH8 A;  3LQV A;  4DPU A;  5A8K A;  5ETN A;  2CJA A;  1SH0 A;  4FZV A;  1RHR B;  4OJ1 A;  1RHM B;  5F8N A;  2AYB A;  1X4A A;  3UN2 A;  3R5J B;  4A8Q A;  4NL5 A;  2BUN A;  2KI2 A;  5LSL A;  2WBR A;  5A76 A;  3MUR P;  1ZS6 A;  9ATC B;  1UEV A;  4JI6 F;  4YY3 J;  2RRA A;  1UFL A;  2MQN A;  3ISN C;  2D3O R;  1E6V A;  1VK3 A;  5K14 B;  1FD8 A;  5J2Q B;  4DPW A;  4X4O A;  4F4Y A;  3DU6 A;  5KG4 A;  4NLP A;  3JS9 A;  3MI7 X;  3C16 A;  4Y34 A;  4UY8 T;  3IG1 A;  1SKW A;  1FI4 A;  1UW9 A;  2NQP A;  3T5J A;  2UZA A;  1ZZF A;  4JI0 J;  4K4S A;  1VRT B;  4JI2 J;  1XR5 A;  2HVH A;  2E5J A;  4FYY B;  3DDI A;  1HNX F;  3BDE A;  5AJ3 F;  2C3M A;  5DM7 Q;  1AUS L;  3HVR A;  1S9E A;  5DM6 Q;  4Y0F A;  2BQ3 A;  2YQ1 A;  2NLW A;  1CPZ A;  4DR2 F;  3ZTS A;  2ZJR Q;  4I69 A;  2LQ5 A;  4KGM A;  4URS A;  2YWK A;  1EIY B;  3RZA A;  1B0V A;  5KT6 A;  1YZ6 A;  4O44 B;  1Y5L B;  2E66 A;  5J1N A;  1N6Q B;  3FBF A;  4LF2 A;  3N4W A;  3R7B B;  3R6L B;  2UV8 A;  4LSZ B;  4YS2 A;  5L1L A;  4QZV B;  1RBA A;  2M5Y A;  1MRO B;  1N5Y A;  1NPP A;  2XI3 A;  1EAY C;  2B4U A;  2E5H A;  2WZ1 A;  2DNP A;  4YDX A;  4K2J A;  4B02 A;  1FDN A;  3P49 B;  1GXT A;  5E3R A;  3BO3 A;  4YHH F;  1XC9 A;  3EXY A;  3S6E A;  3MMC A;  1SPB P;  2QYC A;  2JZ5 A;  4YQW A;  2KH9 A;  3GG1 A;  1BY9 A;  1JJC B;  4J37 A;  1OSC A;  4MKB A;  1TK8 A;  2W8L A;  1VIO A;  2IJN A;  3C6T A;  4IFV B;  5BYR A;  4ILR A;  3TP2 A;  1JLQ B;  2ZIT A;  3OL9 A;  2B9E A;  3MPD A;  3HX9 A;  5A8K B;  3CXC R;  4F26 A;  1WKJ A;  2CQB A;  5KG3 A;  3FMW A;  4O4G A;  3C6U A;  4QYR A;  5HBM A;  4EI2 A;  4Y00 A;  2FLN A;  1D0E A;  2YWE A;  1JMT A;  1LWE A;  2AGP A;  2OPR A;  4ATN A;  3EZU A;  4USV A;  1E6V B;  3C14 A;  4M8L A;  1VCT A;  2J0X A;  3I5B A;  3PRV A;  1FXL A;  1OIA A;  3C16 B;  3IG1 B;  3CUL A;  2QTW A;  4DL0 C;  2FDN A;  2FVR A;  4I56 A;  2CJY B;  1HW9 A;  3CDU A;  2ASJ A;  1CSJ A;  4URG A;  2BM1 A;  3AD7 C;  1SH3 A;  1CJT A;  3OXG A;  1WHW A;  1ZET A;  3Q8Q B;  1W7W A;  3DDK A;  1S9E B;  2VIH A;  2G2O A;  3N6N A;  3KHR A;  5EX3 A;  2HRY A;  3RJM B;  3JXO A;  2W9A A;  4G3I A;  2OPP A;  3PJX A;  4RW8 A;  1BLU A;  1JXL A;  4DI6 A;  1YJ7 A;  1TKD A;  4JB8 B;  5G0R A;  2VG6 A;  1BMQ B;  1FDA A;  3PIP Q;  2C3O A;  2ZBQ A;  2XMU A;  2ROP A;  1U47 A;  2BDP A;  2K1R A;  4RNO A;  1U6Z A;  1PGZ A;  1IQT A;  4J9L A;  1S4E A;  1XMO F;  1N5Y B;  4RZR A;  3CIZ A;  4YFU A;  2OFG X;  4UOF A;  3IWN C;  3QFH A;  2XMV A;  2P9C A;  2CPH A;  1OPI A;  3BGO P;  3GV8 B;  3MMC B;  1X4B A;  3D1H A;  1ZM2 A;  4CCH A;  2OEM A;  4C8O A;  1K0T A;  1NSA A;  1R0C B;  5L39 A;  3C6T B;  2VFS A;  2PFF B;  4WP9 A;  4LT6 A;  3V4I A;  3T1Y J;  4AUK A;  3CIM A;  4C9D A;  2DH8 A;  2IFX A;  2IRU A;  4O4G B;  1KVJ A;  3C6U B;  4RW7 A;  5HBM B;  3LW5 C;  2KG1 A;  1Y10 A;  3OFH A;  1KNZ A;  4LR9 A;  3ELH A;  3HSG A;  4B9M A;  1WOP A;  2YQ3 A;  5D4L A;  5KT3 A;  4NZ6 A;  1LWE B;  1R43 A;  2JX2 A;  2OPR B;  1HHT P;  1ULR A;  1UWA A;  2WVD A;  3NGK A;  3BM7 A;  1K73 T;  5J2M A;  2XG8 A;  4OHW A;  4IKA A;  4ZPB A;  2KYZ A;  3C14 B;  1RT5 A;  3M6V A;  4ZJL A;  4DQP A;  2L9D A;  3THV A;  4RBV A;  1NK4 A;  2EFO A;  4AE5 A;  4HAC A;  3SSQ A;  2DGS A;  1FFS B;  2CPZ A;  3HLU A;  3DN9 A;  4O3N A;  3OTO J;  1WC4 A;  2W7O A;  2ZNZ A;  4D3H A;  5ETR A;  4W92 B;  2OFH X;  4X64 F;  1GMW D;  1CJT B;  4OLO A;  4TU7 A;  2HBR B;  2ZVS A;  3MCO A;  1QVF R;  1HQU A;  5KFI A;  2EKN A;  4RX6 A;  3WX4 A;  2DRB A;  1X4F A;  3CPW R;  1GFW B;  1ZOT A;  2N7Y A;  1UVK A;  2OPP B;  3DYA A;  4RW8 B;  5DZ7 A;  2UUT A;  5G0R B;  5T7L A;  3MM6 A;  2VG6 B;  1Y0H A;  3QQC D;  4DF4 A;  2RJZ A;  5HLF A;  2DYA A;  1HBO A;  2D3O 1;  4MJK A;  1FER A;  1VQL S;  2K1R B;  1N52 B;  4LF7 J;  2F8M A;  2W01 A;  4DFM A;  1K0V A;  2HSE B;  1U1K A;  5A6W A;  2K06 A;  2V50 A;  3MEK A;  4QWC A;  2BR0 A;  1I1G A;  3OLB A;  2EBE A;  3A8E A;  3IP0 A;  1HBN A;  4FDF A;  2AMC B;  2Y1R I;  2AEF A;  1F1B B;  2VF3 A;  4LUB A;  2C22 A;  2F7V A;  8AT1 B;  2GHV C;  4OX9 J;  5I3U A;  3R97 A;  4IRC A;  2ASL A;  4C98 A;  2OH2 A;  3PY8 A;  3NBP A;  3Q86 A;  3T5L A;  4NRU A;  1HLW A;  3V4I B;  4OZJ A;  2CNO B;  1H38 A;  5AXK A;  4E2F B;  4DR3 F;  2GIR A;  2LXF A;  4DSF A;  4RW7 B;  4BWJ A;  4A8F A;  1HD1 A;  3L3C A;  1QJH A;  4L73 A;  1T9W A;  1NB2 A;  2ZOF A;  3CWJ A;  3AJ2 A;  1FX2 A;  1JJ2 R;  3MPV A;  5J2M B;  4AYB D;  2PDA A;  1S10 A;  4RNN A;  1RT5 B;  1ZAX A;  1A6L A;  2PA8 D;  3D3C J;  3UFC X;  4AL6 A;  3FCH A;  2HQ3 A;  4NEZ A;  5HRO A;  2AYM A;  3ISN D;  3PFE A;  2B4O A;  4CO0 A;  1MW7 A;  4QU7 A;  2IBO A;  3DHX A;  4FXV A;  1CJU A;  3D7S B;  1NPK A;  3H5S A;  4HAC B;  2XS2 A;  4TLQ A;  2VBW A;  1JB0 C;  3QRQ A;  2D74 B;  2K3K A;  2E9R X;  4XPC A;  3VAH A;  3N6L A;  1O5J A;  1TAU A;  4TYA A;  1GTH A;  2XNR A;  2J9D A;  1NH7 A;  4NOH A;  1HQU B;  4WFB Q;  2Z56 B;  1AW0 A;  5M2U A;  4HHJ A;  3OFE A;  3Q24 A;  3D0I E;  3DYA B;  1RAE B;  4U6P A;  3LF0 A;  2PT0 A;  2IMW P;  5T7L B;  2CAJ A;  3GON A;  3MM6 B;  2COL A;  2KM8 B;  3BH6 B;  1HNI A;  2RML A;  4F67 A;  3FNN A;  1SJQ A;  5HLF B;  1HBO B;  2DHA A;  3CJQ A;  4USM A;  4FPI A;  3CD0 A;  4LF4 J;  1RLD A;  4ETX A;  4JYA F;  2HQC A;  2LU2 A;  3VGT A;  2YXL A;  3G82 A;  2V8H A;  1S79 A;  1UVL A;  4NLT A;  4FKX A;  1HBN B;  3EZ5 A;  3M32 A;  2RIL A;  2F9D A;  1YJV A;  4DL5 A;  1DTQ A;  4NLR A;  3JYT A;  3AXM A;  2DK2 A;  3MMB A;  1J5O A;  2P6S A;  3I4P A;  1WHX A;  4DPT A;  5I3U B;  1VQS A;  2K2P A;  4GKK J;  4CLZ A;  5DGA A;  3ITH B;  3RBE A;  3NBP B;  5EDW A;  2BW7 A;  2FVS A;  1T8E A;  1RT1 B;  2ZFH A;  2ABY A;  4NLO A;  4M5D A;  4EO6 A;  3BYR A;  3QSY B;  4ZLN A;  3MED A;  4LFB F;  1ZTW A;  5I3P A;  2HHH F;  2F63 A;  1I94 F;  1NM2 A;  4KGZ B;  3QZ7 A;  3VAG A;  4B3S J;  2BJ3 A;  3GFH A;  2CVI A;  4DCO B;  5GMK a;  3PAC A;  4DPY A;  7AT1 B;  3BR8 A;  2HRT A;  1S0M A;  3R5B A;  5CYM A;  2J6T A;  1LK5 A;  2HHP A;  2D1C A;  2MST A;  3HJV A;  1IBK F;  1HNV A;  5HRO B;  3M2R A;  2QE5 A;  3IBC B;  4K0K J;  4H4M A;  2H3E B;  3CMA S;  4C8M A;  4NCG A;  3R5C A;  1RA7 A;  1CJU B;  4DV6 F;  2PGC A;  1REG X;  3L09 A;  3OW2 R;  4LF9 J;  2WBM A;  2BE7 D;  1A9N B;  3E8O A;  4Y2C A;  4K4W A;  3SEO A;  1HWK A;  3K5L A;  2DNQ A;  4U67 Q;  2HHS A;  1SBR A;  4XPE A;  2E5L F;  2MZR A;  2LEA A;  2WVB A;  2RNE A;  3VVU A;  2DH9 A;  2XYH B;  3HVW A;  2ZHA A;  2WTF A;  1EKR A;  4ZOS A;  3QPI A;  2LQ8 A;  1HNI B;  1SJR A;  4P2S A;  1PIL A;  1Y5N B;  2E1R A;  2V4J A;  4Q7A A;  3EPI A;  1T7P A;  1R8H A;  2VPZ B;  1NDC A;  4P75 A;  3BB5 A;  1R8P A;  2B4P A;  1GMW A;  3G82 B;  2R4F A;  2I1R A;  3MF5 A;  1SKU B;  4ZPA A;  3H42 A;  3M32 B;  1DTQ B;  5C7P A;  2YKM A;  2VAS A;  2V34 A;  3SFU A;  3JYT B;  2QLW A;  4Q2L A;  1C4A A;  1X5P A;  3LP1 A;  1H3D A;  1YBU A;  2VB6 A;  3MMB B;  1J5O B;  3NNH A;  1F5A A;  3N5B A;  4DSL A;  3FQL A;  4M5M A;  1WI6 A;  1N32 J;  2P6T A;  2X3G A;  4MK7 A;  2AJ1 A;  5E2Q A;  2VKZ G;  4MIW A;  2KN4 A;  2CAD A;  3MED B;  2QMU B;  1URN A;  5C25 A;  1YI2 S;  2AJQ A;  1LWC A;  3BDP A;  2AJF E;  4IYQ A;  4B3T F;  3DRR A;  3GIJ A;  5LXY A;  1GX5 A;  1RE1 B;  4EGL A;  4ECV A;  4ZDN A;  5KFK A;  2CFX A;  5F8L A;  1HBM A;  2XY5 A;  3AY0 A;  5CYM B;  3GP9 A;  2XLK A;  1SJ4 P;  2WVC A;  3BSN A;  3KG1 A;  2AYE A;  2V9W A;  1HNV B;  1U6F A;  4WFX A;  3K59 A;  1F9F A;  2CA9 A;  3M2R B;  4H4M B;  3BKF A;  1V6H A;  2YWH A;  4KTQ A;  2ILY A;  2CDQ A;  2ZJP Q;  2DNL A;  5JVG Q;  3QIP A;  3NLC A;  5AT1 B;  3OVA A;  2XWY A;  1S99 A;  1H6K X;  5KFZ A;  2G9O A;  2NXC A;  3T3F A;  2R7V A;  2XS5 A;  3AD8 C;  4WP8 A;  4DN9 A;  3CVK A;  1JLG B;  3OT9 A;  4ZHR A;  1S0V A;  3SZ2 A;  1F3F A;  1VS3 A;  4GMK A;  2QFI A;  2MB0 B;  2ZWO A;  1JX4 A;  2MY7 A;  5H9E K;  1CS4 A;  2V4J B;  1PJ6 A;  3CO0 P;  3HFZ B;  2CWX A;  4DV5 F;  3G86 A;  4UOG A;  4NCB A;  2DHG A;  2M8H A;  3Q22 A;  5D8H B;  4OZ1 A;  2OGU A;  2DGX A;  2GQQ A;  3PG9 A;  2Z2L A;  3FBB A;  2MKK A;  3GIL A;  2CPY A;  4HTJ A;  3QGI A;  2CJ9 A;  4F02 A;  4YDD B;  3U1N A;  1T3O A;  3BRE A;  4M5K A;  3W2V A;  3MWB A;  3FZB A;  1UEK A;  3MM9 A;  5IOL A;  3RU0 A;  4WPA A;  2YKM B;  3DRY A;  4QOT A;  2MKH A;  3QAU A;  1KKH A;  4WCE Q;  3HSJ A;  3KFW X;  2UUC F;  3ZC4 A;  5DLG A;  2QN6 B;  4QPX A;  1PYO B;  4EZ6 A;  4RL1 A;  2V2K A;  3NOC A;  3OTE A;  2P2C B;  2JJ4 D;  1T03 A;  4YME A;  4OJG A;  1XMB A;  2FHM A;  2Q66 A;  2JC0 A;  2K8G A;  5C25 B;  3JQM A;  1LWC B;  2FLL A;  1N88 A;  3M6X A;  2DIT A;  2V63 A;  3H40 A;  2GHW A;  3QGH A;  5F0U A;  2QJ3 A;  3DRR B;  1W26 A;  1OMS A;  2UVU A;  3VHQ A;  2LEP A;  2QSF A;  1HBM B;  1N5T A;  2V5H G;  2NYI A;  5C2G A;  2VD3 A;  1VIS A;  2NCK L;  1XR7 A;  2AX0 A;  2EG2 A;  3D6F B;  2HGM A;  3AAW B;  3QJL A;  4Y28 C;  1TP7 A;  3DRS A;  5KT5 A;  4CO4 A;  1FJG J;  4G65 A;  4PZV A;  3Q8P B;  2ACY A;  4DR6 J;  2XZD B;  2W9B A;  1YRX A;  4M1K A;  5CZV A;  1N56 A;  5E5N A;  4LIW A;  3CJ0 A;  4A8Y A;  4FS2 A;  3U7J A;  3QIP B;  1NKE A;  1KOH A;  4NX9 A;  3HK2 A;  1RBL A;  5M2R A;  5KFT A;  1JIH A;  4OYO A;  5JMN A;  2DNG A;  4O4R A;  4ZHR B;  4LF8 F;  1FRJ A;  3GWC A;  3MOZ A;  4H4O A;  3NGR A;  5D78 A;  2DEJ A;  1NH8 A;  1NUE A;  4WU2 A;  2CDR B;  5GAG U;  2G4B A;  3HFV A;  2CZ4 A;  1P1T A;  3ZXW A;  1CS4 B;  1KOO A;  3GFY A;  1GMU A;  4PAA A;  3QT6 A;  1FWL A;  4HL9 A;  1LXN A;  1TL1 A;  1HW8 A;  1MG7 A;  4LRA A;  4L3N A;  3DLL Q;  1SJF A;  1RXO B;  2J7U A;  2UVR A;  3CDB A;  3W2V B;  3C66 A;  1NO8 A;  3MM9 B;  2DIS A;  3UWT A;  1Q4R A;  4JI7 F;  1KC8 T;  3V81 A;  4OX6 A;  3AQP A;  2J0W A;  3HF5 A;  3LPE A;  3KJF B;  1T03 B;  2QL7 B;  4BDP A;  2H4Y B;  5FDL A;  4JI8 J;  1YBA A;  3CMQ A;  2YVS A;  3JAM U;  5LMN F;  2J6U A;  3TVZ A;  2OMO A;  4DLG A;  4V19 X;  3KK1 A;  2A18 A;  2HGL A;  2VBX A;  1F9H A;  2C2E A;  4U9R A;  2N4C A;  5ITH A;  3H4B A;  4Z37 A;  2EW9 A;  4ZJQ A;  4K7Q A;  1G7C B;  4JI4 J;  3BBB A;  1XQI A;  1TFW A;  3DI6 A;  4PG4 A;  1PCA A;  1JXV A;  2YWF A;  1S72 S;  1TMM A;  2XS7 A;  1SXL A;  3DRS B;  5DQH A;  2I0X A;  4HHH A;  3MMJ A;  1L3T A;  3DOK A;  2W9B B;  1TL7 A;  3R5D A;  4RKU C;  4BC9 A;  2YKN A;  2RVJ A;  3MAH A;  2XCP A;  3F41 A;  4NAS A;  4PR6 A;  4NLQ A;  4OHZ A;  1NBE B;  3EGV A;  1Y00 A;  1PBU A;  1NSQ A;  3A8K A;  1YZ7 A;  3OVS A;  2LLZ A;  5LOQ A;  4WTY A;  2JLE A;  3ILI A;  4OI4 A;  3GIR A;  1NND A;  1U1O A;  1WSR A;  1XNR J;  4DN0 A;  1BXN A;  3QFW A;  4K5S A;  3QT8 A;  2NXJ A;  2OEK A;  3Q2S C;  4H4O B;  2GML A;  1TL5 A;  4LFA J;  2YBV A;  4UF4 A;  2CJB A;  2RU3 A;  2AYG A;  4ZMM A;  4MAK A;  3B54 A;  3TYT A;  1NHU A;  2CQH A;  2HHV A;  2I6W A;  3SCK E;  5HAN A;  1X0F A;  4CRJ A;  1VJQ A;  4OYB A;  4B3O A;  3E01 A;  1RGV A;  3T1A A;  4CT9 A;  4LBI A;  2HGN A;  1LNQ A;  4DR4 J;  4J9S A;  2QA4 S;  4J7C A;  2ZUG A;  1HHS A;  3T6J A;  2M9K A;  4CT8 A;  3W3S A;  1VDH A;  3RB6 A;  2FHJ D;  2R3V A;  5DQI A;  1S59 A;  4ZVP B;  5FDL B;  4OYA A;  1D9F A;  5LM7 E;  1DLO A;  3D5M A;  4A8K A;  4F2R A;  3KK1 B;  1Q0N A;  3VAK A;  3ENA A;  2VPW B;  4RBU A;  4PXE A;  5KFO A;  4B3M F;  2V94 A;  1HWJ A;  1NSK L;  3G2X A;  3QJJ A;  1K44 A;  3NWR A;  4DDF A;  1SV5 A;  4LF5 F;  3RW7 A;  3IWX A;  1FJC A;  1R6V A;  2HQF A;  1H73 A;  3DI6 B;  2P5V A;  4DU7 A;  4NWB A;  2NRE A;  1URR A;  1QUV A;  4EZ9 A;  4JI1 J;  3WIV A;  2RKI A;  4NI2 A;  1RCX B;  2F8H A;  1TL7 B;  5ETT A;  5H9F J;  3KMQ A;  2YKN B;  1BWV A;  1BUX A;  1BQX A;  4FVC A;  2NYH A;  2U1A A;  2NSC A;  3AQO A;  3AOD A;  3PYD A;  3L7P A;  3TOQ A;  2MEW A;  4O3S A;  3WHI A;  2ZUA A;  3W66 A;  1TUG B;  1ZAV A;  1OY6 A;  4GC6 A;  3QAE A;  4WK1 A;  2IYG A;  2HVZ A;  3BPS P;  2BX6 A;  2D41 A;  5MAO A;  2IY5 B;  2CNK B;  2V2Z A;  5KG2 A;  1RTZ A;  1OO0 B;  2QFJ A;  5SUH A;  1TZ0 A;  3G8Q A;  2GIQ A;  4LF6 J;  3HI9 A;  4FXW A;  2RUG A;  2CPD A;  4IG0 A;  2QV6 A;  5DG9 A;  2X1F A;  5KAK A;  4NYP A;  4N76 A;  2B9W A;  2VL1 A;  2AJ0 A;  4DXL A;  1VOM A;  2MKS A;  1KD1 T;  4OFZ A;  1OS5 A;  1QAJ A;  2X1B A;  2KFY A;  3T9Z A;  2F4F A;  4B3O B;  1DJ0 A;  8ATC B;  3E01 B;  1KLN A;  1CC7 A;  5DG7 A;  3G6E S;  1XMQ F;  4LRF A;  1DHM A;  2KRB A;  1XK8 A;  2VBY A;  3TO8 A;  2EK6 A;  2DRA A;  1N0V C;  5DQG A;  3OTD A;  4KGK A;  3NRB A;  1X9S A;  5KG6 A;  3O1L A;  1V9O A;  4X4N A;  2NXU A;  3DNC A;  4CM2 A;  2FY8 A;  1N0U A;  5EWG A;  3MDF A;  2E1A A;  2R8K A;  4BHQ A;  2OEJ A;  1S76 D;  4B08 A;  2UXD J;  3I9V 9;  1WWH A;  1DLO B;  2CQ0 A;  2JHE A;  3PM9 A;  3T41 A;  1QAI A;  1G4C A;  3QRR A;  3OR2 A;  2MY8 A;  4WFZ A;  2HNY A;  4UY8 5;  1RAO A;  2HFO A;  2L48 A;  2V67 A;  1FRX A;  1DRZ A;  4YY3 F;  3T19 A;  2UU9 J;  2VFT A;  1SV5 B;  4RNH A;  3OR1 A;  1PYT A;  5DG8 A;  3AHP A;  4R5P A;  1RT6 A;  2XMJ A;  2HHU A;  4M5I A;  4X66 J;  3IR6 B;  4NI2 B;  2X1G A;  2XM3 A;  3DLG A;  4JI0 F;  1NU4 A;  1UZH A;  4JI2 F;  4DSE A;  3AB4 B;  2HK3 A;  1VJW A;  4KPY A;  1WI8 A;  1R3N A;  3W5Y A;  1RBO B;  2CQP A;  3C15 A;  3DMJ A;  1K1S A;  2JH3 A;  1T9V A;  4ED3 A;  1FNO A;  1C4C A;  2H9Z A;  3CDA A;  1F3V A;  3IC1 A;  4KFB A;  4KY3 A;  4DBQ A;  1LEO A;  4C4W A;  3RRG A;  1IUJ A;  2WB4 A;  2E9Z A;  4OX8 A;  4I0W A;  2K7K A;  1XEZ A;  3MUV P;  3TAN A;  3GZ7 A;  2DH7 A;  4WZM A;  3RAX A;  4IG0 B;  2X1A A;  2J8S A;  5F9L A;  3PYG A;  1Y9O A;  3I31 A;  2QYG A;  2CPX A;  3ZZP A;  1ITP A;  1VQ4 S;  2BQR A;  3HSZ A;  3NKY A;  4GKJ J;  2R2T A;  4IOC Q;  3PEJ A;  4Y6I A;  4ZLJ A;  4QCL A;  2ZH6 A;  4PPD A;  2JEF A;  4OI1 A;  4OZ0 A;  5ETQ A;  2CG4 A;  1GH8 A;  2B51 A;  4JOU A;  4IRD A;  2CG8 A;  2IHR 1;  5EWE A;  5ETO A;  4U95 A;  2KJV A;  3T5H A;  3WBZ A;  1NKB A;  4PYA A;  3CTR A;  1RWW B;  3HT0 A;  1NK9 A;  2E7X A;  4ZVT B;  4GO7 X;  2CQI A;  2IDL A;  2QLJ B;  1HQE A;  1KBR A;  2A2C A;  4YB6 A;  4QU6 A;  3NXZ A;  2EBG A;  2VZ9 A;  1HHQ A;  2VIC A;  4OHY A;  4E0D A;  3F0N A;  3OR2 B;  3HHL C;  2HNY B;  3M05 A;  3HD2 A;  1PKU A;  5DET A;  5KFM A;  1OQ3 A;  1U4B A;  3W9J A;  3UO0 A;  5D15 A;  2QA1 A;  4HT7 A;  3OR1 B;  1IM4 A;  3TJA A;  3D2W A;  4RW4 B;  2YNH A;  5B09 A;  4R5P B;  2UXC J;  1RT6 B;  2H51 B;  4QIW D;  2FY1 A;  1S6U A;  3J80 Y;  2FHJ A;  2E5I A;  4IG3 A;  2WSC C;  1C1B A;  4RUH A;  5FLX U;  1X8D A;  4M5G A;  3DLG B;  1NEE A;  1S9G A;  2ZE2 A;  1KQF B;  5HSP A;  1BHN A;  5KFH A;  2ZH9 A;  1IKY A;  1W2B R;  3PR4 A;  2QGF B;  2KXN B;  3EWG A;  4S0M A;  1R0A A;  3C15 B;  1WHY A;  3D1O A;  3KUG A;  1VQM S;  1O0P A;  2A3J A;  3CCR S;  3GJQ B;  1WTF A;  4LR8 A;  1FVS A;  4KFB B;  3AA9 A;  4W4M A;  1VQY A;  2HWH A;  3GQC A;  3L9Z A;  2DXF A;  3GIK A;  3UCU P;  3NGU A;  3GB0 A;  3OBI A;  2VA3 A;  5J1E A;  1B70 B;  2V68 A;  4ZVF A;  3QZ8 A;  3OPK A;  4X84 A;  2KDO A;  4F50 A;  1RAF B;  1SIW B;  4JUZ A;  5JVH Q;  2BJ7 A;  1N33 J;  2KKH A;  3Q2T C;  1NRK A;  3Q0A A;  3R8Y A;  2GVZ A;  9RUB A;  1TU0 B;  2BEF A;  2W4D A;  1QUP A;  3NS5 A;  3NCQ A;  1KTQ A;  1Q5V A;  3ZTO A;  4HI1 A;  2F4V J;  4P10 A;  4CP5 A;  2F9J A;  2AP6 A;  4UUX A;  5LJ5 Y;  3T1Y F;  2D7S A;  2MKI A;  1N4L A;  1G2E A;  2ZHB A;  3SIP B;  1H2T Z;  5GAE U;  1HQE B;  1U49 A;  2QA2 A;  4OYM A;  2QMX A;  2I2Y A;  2J0Q D;  2VH7 A;  1SVD A;  1O8B A;  3K8V A;  2BJ9 A;  1XJW B;  1X31 C;  3ULH A;  3VGV A;  4G1P A;  1TL3 A;  5F8H A;  4MKY A;  4B9V A;  5K8N A;  3ILO A;  1MSW D;  2FGC A;  4DPO A;  4TU8 A;  4EU0 A;  4QYZ J;  1UJ5 A;  2HZV A;  1HQ2 A;  1H0H B;  3BSO A;  3NEK A;  4CH0 S;  4DX6 A;  5DRK A;  4NLS A;  2HYI B;  1IBM J;  4M94 A;  2RSQ A;  4IG3 B;  3A3O B;  1C1B B;  4F2S A;  3PX0 A;  4B9T A;  2I9S A;  2JSX A;  1S9G B;  2W4C A;  2ZE2 B;  4Y3C A;  5DDR C;  2KT2 A;  4DL4 A;  1IKY B;  3OTO F;  1MWY A;  1TVR A;  4MYU A;  4OI2 A;  4ZS6 A;  2A10 A;  4X4V A;  2Z4P A;  3GSD A;  2Q6C A;  1R0A B;  1HWU A;  5L38 A;  3BSC A;  4ILM A;  4LF1 A;  3LH2 S;  3PR5 B;  5BYS A;  1ZM9 A;  2OP5 A;  2QL5 B;  3KLE A;  3D1Q A;  3UDC A;  2I38 A;  1Q8L A;  2M88 A;  4QWE A;  3H20 A;  4LRD A;  5THW A;  2PI5 A;  4LSN A;  4X4S A;  1TKT A;  2MKY A;  5T14 A;  4P2M A;  4DJB A;  4WP3 A;  2POK A;  4H4K C;  4LVO P;  1JJH A;  4LF7 F;  3Q83 A;  1H72 C;  3O6Q A;  2MJU A;  2PSZ A;  3VZI A;  4BWM A;  4O3P A;  3BKU A;  2PMZ D;  3S1T A;  1MLA A;  3BZQ A;  2GJF A;  4EK2 A;  2H5E A;  3VAL A;  2GVZ B;  3W1Y C;  1IJF B;  2HWI A;  4OX9 F;  2MLY A;  3EX7 B;  1RA6 A;  1FNX H;  5ETV A;  4YN3 B;  5AXL A;  2FQQ B;  1VBY A;  4FF4 A;  4MH8 A;  3MEE A;  1C2P A;  5ADZ A;  4GC7 A;  4OV1 A;  1G6B A;  4WU3 A;  4A47 A;  1EP4 B;  1M90 T;  3UCG A;  3DLH A;  3X3U A;  3I55 S;  2DR5 A;  2PEB A;  1RAH B;  4NML A;  3DHW C;  3R6G B;  4KHP J;  5L46 A;  1BE4 A;  3N0V A;  1A7G E;  3RRK A;  2VC1 A;  1TFY A;  2LCW A;  3TX8 A;  2V9K A;  2CRL A;  4ZPW R;  4Z2X A;  1TL3 B;  1RLC L;  2DNH A;  4OX7 A;  5KFQ A;  1PSD A;  5EN1 A;  1F2H A;  3EZO A;  4PRF A;  4C0H A;  4MT1 A;  5LXR A;  4HLB A;  3FBC A;  1YJR A;  3IR7 B;  3MPY A;  2HVD A;  3O8W A;  2IRX A;  3SYZ A;  4N5S A;  4FYD A;  3FGV A;  2AGO A;  3N28 A;  3IFE A;  3SBM A;  2CQ1 A;  2W2P P;  4KC5 A;  4F7V A;  4JI5 J;  5K9F A;  4X65 J;  1C1C A;  3AOB A;  4ERD A;  1KFS A;  1TVR B;  3MM8 A;  4Q8E A;  2OPQ A;  2JEJ A;  4QIE A;  2DHS A;  1AA1 B;  1CBK A;  5F3Z A;  3KLV A;  2LMI A;  4CYU A;  3QMQ A;  3O44 A;  3DRP A;  2B7B B;  3MCM A;  4G1Q A;  4I68 A;  3THP A;  1Q86 T;  1S97 A;  2ATC B;  1FRI A;  3BGF A;  2QT7 A;  3KLE B;  2D9O A;  1U8W A;  2ZM6 J;  5KOW A;  1TK0 A;  2M3D A;  1S1T A;  1F9E B;  1FRM A;  2MLX A;  5C42 A;  2LEC A;  4OLP A;  4LSN B;  3V4M A;  4ECQ A;  4UST A;  3ONQ A;  5DS7 A;  7FD1 A;  1P27 B;  3S7R A;  3RB3 A;  3EUN A;  4LF4 F;  2DNZ A;  4L6V 3;  2OSQ A;  4UT4 A;  4F36 A;  2OML A;  2OKQ A;  2HFN A;  4QW9 A;  1VRQ C;  3MM7 A;  5B0D A;  3KNA A;  5IQ6 A;  1FTC A;  1IKW A;  3J81 U;  2FVC A;  3FDS A;  3EXC X;  4NLV A;  3UDE A;  2ACM A;  1ELO A;  2WW8 A;  3LAN A;  3R3T A;  3PJ9 A;  2V8V A;  1IN0 A;  4GKK F;  4DF8 A;  5ETP A;  4OIX A;  2ZZN A;  2QLX A;  3SV3 A;  2PI4 A;  4RWX A;  1ZTT A;  2E7W A;  3MEE B;  3MEG A;  3H98 A;  5L9N A;  5IM0 A;  3FEZ A;  4WYW A;  2YQ0 A;  3ZZO A;  1RIS A;  2XY7 A;  3Q8U A;  3OFG A;  2QC3 A;  2AD9 A;  5HN0 A;  2ZNY A;  1YBT A;  4CTA A;  4A8W A;  3KJN B;  4B3S F;  2MQM A;  3KJQ B;  2CNN B;  3QRP A;  5CCL A;  5B7W A;  2FJB B;  5L8R C;  1JQG A;  2XCA A;  3D3B J;  1VRT A;  1IM6 A;  4A8M P;  5IWA J;  3J7A 1;  3Q8Y A;  4YR2 A;  3VAM A;  5CD4 H;  5CQG A;  3O2I A;  2R7X A;  1HD0 A;  3P96 A;  2GMH A;  2QSW A;  3ENV A;  2MHN A;  4K0K F;  4I64 A;  2ZH4 A;  1HWI A;  1OY8 A;  3K57 A;  3PW0 A;  2XMK A;  3DM2 A;  3LWM A;  4BCA A;  4DL2 A;  3ICL A;  4KPC A;  3CNQ P;  5BYQ A;  2D3Z A;  2ZDP A; 
#chains in the Genus database with same CATH homology
 2DY9 A;  3PJ9 A;  3BBF A;  2B8P A;  2HVE A;  1WKJ A;  3BBB A;  3Q8V A;  1XQI A;  3BH6 B;  1B99 A;  3ZTS A;  1JXV A;  3B54 A;  4DI6 A;  5CAB A;  1S57 A;  5BXI A;  1XIQ A;  1VYA A;  2NCK L;  3ZTR A;  4UOG A;  2BEF A;  3R9L A;  3ELH A;  1NHK L;  1BHN A;  1NDC A;  2AZ1 A;  4ENO A;  1NB2 A;  1KDN A;  2DYA A;  3FCW A;  4ANC A;  3GP9 A;  3EVM A;  1MN9 A;  3ZTO A;  1HIY A;  3ZTP A;  3FKB A;  3VVT A;  3EIC A;  3EVO A;  1B4S A;  3VGU A;  3FBF A;  4CP5 A;  3VGT A;  1BUX A;  3FBB A;  3Q8U A;  4S0M A;  1ZS6 A;  1NDL A;  5CAA A;  3NGS A;  4WBF A;  4FKX A;  2DXE A;  1EHW A;  4W98 A;  1U8W A;  2ZUA A;  3Q89 A;  4FKY A;  3ETM A;  5IOL A;  1LWX A;  1NCL A;  5C7P A;  1BE4 A;  1NSQ A;  1NDK A;  3BH7 B;  3PRV A;  3VGS A;  1WKK A;  3DKD A;  3FC9 A;  1HHQ A;  4UOF A;  1S5Z A;  3B6B A;  3EJM A;  1NPK A;  1WKL A;  1S59 A;  3JS9 A;  2BX6 A;  4ANE A;  1NDP A;  2DXF A;  3Q8Y A;  3BBC A;  3EMT A;  3VGV A;  1LEO A;  4F4A A;  4F36 A;  3EVW A;  4AND A;  3FCV A;  4UOH A;  3NGU A;  1PKU A;  3Q83 A;  3WX8 A;  1MN7 A;  3FBE A;  1NSP A;  2AZ3 A;  3FBC A;  3ENA A;  3Q86 A;  3L7U A;  2CWK A;  3NGR A;  2HVD A;  1PAE X;  1UCN A;  2HUR A;  4HR2 A;  3VVU A;  1HLW A;  1F6T A;  1F3F A;  3NGT A;  2DXD A;  1NSK L;  4C6A A;  1NUE A;  1K44 A;  3EM1 A;  3DDI A;  3G2X A;  1W7W A;  1NLK L;  3GPA A;  4KPC A;  4DZ6 A;  3ZTQ A;  4DUT A;  2VU5 A;  2B8Q A;  4EK2 A;  4O0N A;  3MPD A;  3EE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...