2RRBA

Refinement of rna binding domain in human tra2 beta protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
GPLGSRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cDNA FLJ40872 fis, clone TUTER2000283, highly similar to Hom
publication title Structural basis for the dual RNA-recognition modes of human Tra2-beta RRM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 24
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rrbA01
3NNCA 2CJKA 1JJ2R 1A9NB 1H2TZ 1URNA 3Q2TC 2RUGA 3H2VE 3B4DA 1VQ9S 1HD0A 5EN1A 2CPEA 2DGSA 1ZZNA 3UE2A 1ZH5A 2DH9A 3FEXB 3ULHA 2KM8C 2M0GB 5GAHU 3VAIA 2DGTA 3JB9k 4C0OC 2KXNB 2M52A 4WFBQ 3UD3P 5MLCV 2DNYA 2DNZA 2XB2D 2CPYA 2M7SA 1YJNS 2MQQA 2FHOB 1DRZA 5GADU 4WFNQ 2DHAA 2YH1A 3ZZYA 2MZRA 2DNGA 3UWTA 2MHNA 2MY7A 2CQ1A 5BJRA 1H2VZ 4CH1A 2KVIA 3G71S 1SJFA 2RRAA 1S72S 2JWNA 2VOOA 4U67Q 2DHSA 3S6EA 2CQ3A 2J8AA 2AYBA 1YTYA 4QQBA 3MOJB 2LKZA 3P5TL 2DHGA 5FJ4A 3BO4A 3G96A 2XNQA 2YKAA 2MJUA 1VQ4S 2J76E 5LXYA 5LJ3Y 2EK6A 3NS6A 1WI8A 1A7GE 2RNEA 1X5TA 1X4HA 3CMAS 3PIPQ 1WG5A 5IQQA 3MDFA 1M90T 2MZJA 1WHWA 2DNQA 2N7CA 2MPUA 2Q79A 1H2UX 3US5A 2I38A 2RS2A 1R8HA 2OTJS 2DNMA 1YI2S 1U1KA 3THTA 2FC8A 3CCJS 4YB1P 2KM8B 2MQLA 2M2BA 1K9MT 1FT8A 2OSQA 5GAEU 1WEXA 2XS5A 2X1BA 2FC9A 3CULA 5HL7Q 1U1QA 1RK8A 2X1FA 2LA6A 1HD1A 4YUDA 2B0GA 2CPIA 2DITA 3G8SA 1SJ4P 2MZQA 2FY1A 2CQ2A 2KRBA 2OSRA 3LPYA 3VAKA 2MGZB 3CCVS 1X4FA 2KXHA 5ITHA 4W90B 1WHXA 1VQMS 1FXLA 2BOPA 1X4AA 2JX2A 2MZ1A 3RW7A 2DO0A 4Z2XA 2KG0A 4UQTA 3CD6S 2D9OA 2DNKA 1RKJA 2GO9A 3S01A 2EVZA 1R8PA 3NS5A 4WKRA 4YOEA 1X0FA 3NMRA 3VAHA 2MYFA 2MGZA 3EGNA 2VONA 2CQBA 2OTLS 5GMKa 1VC6A 5H1SV 3MXHP 5GVQA 3CCUS 1SJ3P 1IQTA 2AD9A 1P27B 3ZZZA 2N3OA 3CC4S 1S79A 2OIHA 2XSFA 1G2EA 2LEBA 2MKHA 3G6ES 5JVGQ 4EGLA 4WIIA 2VOPA 3CMES 3CUNA 2MKCA 3P6YC 2MQOA 4C7QA 2ZJQQ 2LQ5A 3EX7B 1DHMA 1QVFR 2XS7A 1N88A 2KI2A 2D3OR 5CXTA 3CCSS 3DXBA 2YTCA 3BEGB 5LXRA 2HGLA 4UY8T 2HZCA 2LYVA 2D9PA 4BS2A 3I55S 1SJQA 3MUTP 3CCES 3VAMA 2HGNA 3CXCR 1CVJA 2ZJPQ 2F9DA 2RVJA 1VBZA 2LXUA 2KXFA 4PRFA 2YWKA 3BS9A 3TP2A 5LSLA 1VQOS 1M5VC 2DH7A 2RU3A 2DGXA 1D8ZA 1WI6A 3G8TA 2NZ4A 2CQCA 1D9AA 2KT5A 2M4MA 2PE8A 2MKSA 4WCEQ 2A3JA 1X4EA 1X5SA 3CF5Q 2KH9A 3FEYB 1FHTA 2L41A 1NO8A 1OPIA 1DZ5A 4IOAQ 3R27A 4CH0S 4FXWA 3R1HA 2ERRA 3SMZA 1VQ5S 1Q81T 4PR6A 2MQMA 2MB0B 1Q7YT 1UW4A 1YITS 1WF1A 1L3KA 1YIJS 3CCQS 2CPZA 2DIVA 1PGZA 4CIOA 4WF9Q 3CTRA 1AUDA 2E5HA 2EK1A 2JRSA 1U1NA 4ED5A 2AYMA 1VQ7S 2VODA 2RRBA 4IOCQ 2U1AA 1UFWA 1X4DA 2O3DA 1NJIT 2HYIB 1VQ6S 3RW6A 1M5KC 3IWNC 2CPJA 3K0JA 2NLWA 4ZKAA 2DHXA 3P49B 1HL6A 2CQDA 2LXIA 4RU2A 1FO1A 1WHVA 4QU7A 4F02A 3DLLQ 4LMZA 2OJ3A 2DGOA 5GAGU 4M5DB 3OW2R 2M8DB 2RQCA 2RS8A 5DM6Q 2GHPA 2DGVA 1SXLA 1VQPS 2DK2A 3UCZP 2MY8A 1FJEB 1UP1A 3J7ZT 1KQSR 1VQ8S 1OWXA 1WEYA 2DO4A 1DBDA 2X1AA 1U1MA 3CCLS 4J5OA 4LJMA 2F9JA 1FJ7A 2SXLA 4PKDB 4QPTA 1QM9A 4LIRA 4TU7A 1WEZA 2JVOA 1BY9A 1VC5A 2QFJA 5D78A 3CC7S 5IFMA 2PEHA 2G4BA 2N3LA 1JJ4A 2L9WA 5LSOA 2L08A 2ZJRQ 2BZ2A 2DNNA 1KD1T 1Q86T 4W92B 2CQHA 3HI9A 3R1LA 5DDOC 3MD3A 1U1OA 2F3JA 2G1DA 4P6QA 3U1MA 4Y00A 5DETA 3NNAA 1W2BR 3H2UB 3N9UC 2X1GA 2KHCA 3MURP 2U2FA 2KFYA 3SDEB 3THPA 1N54B 1K73T 1M5OC 3B4MA 1KC8T 1VQKS 2M70A 3I56S 1YWXA 1VQNS 2XNRA 2ADCA 3MUMP 1P1TA 2QEXS 3BO2A 3SXLA 4OZ0A 3VAGA 1N52B 2MZSA 4TU9A 2KG1A 1N8RT 1X4CA 2MMYA 2M8HA 1FJCA 2HVZA 2LCWA 5D77A 3MI7X 1UAWA 2CPFA 3D2WA 1YJWS 2AYEA 5DDPC 2DGWA 2MJNA 2XS2A 2DGUA 2MQNA 1U6FA 3SDEA 1U2FA 2CQ0A 4F26A 5DDQC 1NU4A 2MKKA 4A8XA 1X5PA 1KOOA 2MKIA 1M5PC 2KYXA 3VF0B 2RT3A 2YH0A 2MSSA 4WFAQ 5IM0B 4FXVA 1Q82T 4OZ1A 2CQIA 1U6BA 2CQGA 3TO8A 2M88A 3J7YU 1H6KX 2G0CA 3TYTA 3UCUP 3S7RA 2DNPA 2DNRA 2KN4A 3VAFA 1WHYA 4TLQA 4ERDA 4QU6A 2AYGA 1JMTA 2E5GA 2K3KA 1WTBA 1QVGR 3NNHA 3S8SA 3G4SS 2LMIA 5IM0A 3L3CA 4CQ1A 3MD1A 2DNHA 3VAJA 4V19X 2DGQA 3LQVA 4TU8A 3Q2SC 1ZZFA 3BO3A 2DB1A 2V94A 3CCRS 2CQ4A 4F25A 3UCGA 2KRRA 3G9CA 2DISA 2UP1A 3CCMS 1WF2A 1WF0A 3PIOQ 1JJHA 2J0SD 2DH8A 2LEAA 1WWHA 2LECA 1X4BA 2MXYA 4C4WA 3VALA 3CPWR 4IO9Q 1U1PA 2HGMA 5DM7Q 1WG4A 2DIUA 1M1KT 1F9FA 2M9KA 1X4GA 3EGZA 4Y0FA 1OIAA 2K8GA 1VBYA 1XN9A 2JVRA 1KOHA 2MZTA 1FNXH 1YHQS 2RQ4A 3CC2S 2ADBA 2J0QD 2E5JA 2I2YA 1VC0A 1OO0B 1B7FA 3UD4P 5HO4A 2E44A 2CQPA 3P3DA 1K8AT 5LJ5Y 1SJRA 5CYJA 2LA4A 1PO6A 1HA1A 3U1LA 1VQLS 2DNLA 2E5IA 2FPHX 4IUFA 1YJ9S 3V4MA 1O0PA 2CPHA 1U1LA 1VBXA 2MSTA 2CPDA 2QA4S 2MKJA 2DNOA 2CPXA 2N82B 1WG1A 1U1RA 3IRWP 2MQPA 2KU7A 1X5OA 1WELA 5CA5A 3HHNB 2WBRA 5JVHQ 3MUVP 5DDRC
chains in the Genus database with same CATH superfamily
4B17A 5SUHA 2HNYB 2DXEA 1XNRJ 3J7Z5 4X64J 2ZWOA 5I3UB 1N0VC 5CH7B 3Q23A 1D0EA 4PWDA 1CULB 4HACA 1ZPVA 3MEGB 2DNYA 4XO0A 2CPYA 4Q2LA 4OJ3A 4WKYA 4FF2A 4URQU 3T6JA 4LF7F 3QAUA 1U47A 4TQSA 5B09A 4ZS6A 2GVZB 3S6EA 4DR7F 3PYGA 1FJGF 4ZP7A 3DKDA 3HVTA 3VVTA 4K2XA 2RILA 1X5TA 5LT5A 4O3RA 1K0TA 2XLIA 3BDPA 2MHEA 3MPWA 1YSJA 3K5LA 2WW4A 5HSPA 2WB1D 1YI2S 1U1KA 4P73A 3D6MB 5DLFA 4ZPWR 1S9FA 2ZKTA 2YNFB 1RP5A 1LW2A 2Y1LB 3KHHA 1UWBB 4EBEA 1U0HB 2OPRB 1SJ4P 3OXLA 3F56A 1S1WA 2JC0A 4RW7A 5ETTA 4NL5A 1UPMB 1SL1A 3TJAA 1XNQJ 5J1PA 2HFUA 4HYKA 3CD6S 3S01A 3NS5A 5KG5A 3GYNA 4ZDNA 2MGZA 5T7LB 3T1YF 1OJ4A 3QO9B 1MU2B 4ZK7M 4J9UE 1WDDA 4ANEA 4PZVA 2A2DA 4IQMA 3PR5B 5BYQA 3HT3A 3GV8B 3CUNA 2E7WA 3HM9A 4BCAA 3W60A 2IMOA 4ZPCA 1JLGA 4KGMA 1QE1A 3M32B 4EU0A 4K2JA 5G4DA 3I55S 4ZN1A 3DOMA 3TJ8A 1VQOS 2H1YA 2K2PA 4TXSA 3SSRA 1DQ8A 2R7TA 1D9AA 2FJDB 3M2RA 1X4EA 1JKHA 2ZOGA 3GJRB 4MMOA 3FBFA 4PCQA 1FF2A 4Y2MA 2CUYA 5F8LA 2GCFA 1M1GA 5K8PA 1UZHA 3MAAB 2H51B 1I51B 4F2SA 1R6YA 4HL9A 4GC7A 2BJ7A 4R0EA 1YIJS 2C2KB 2DIVA 4BHQA 4OV1A 2M3DA 2L9NA 2QO3A 1RTJB 1BQMA 3AOBA 4YQWA 4PXCA 4CO3A 1NSQA 3RW6A 1KLNA 2JJ4D 1UJ6A 4RNNA 2BBEA 1RDRA 2KZMA 2V5HG 1WHVA 3KLIB 5A8RA 1TTHB 2WVDA 4OZNA 1SQEA 3IGVA 3SI8A 3QLHB 2DO4A 4FKYA 2FYXA 4U8YA 1WEZA 1FERA 5D78A 3L7PA 1SUQA 2PMHA 2F65A 3VQSA 4ES3A 5DDOC 4P6QA 5A6WA 4NI2A 4O0IA 5IWAJ 4KPCA 1D9FA 3SDEB 3B4MA 1XMBA 3HHLB 4EYHB 1YWXA 3MCNA 1X4CA 5H9EJ 1LWEB 1TU0B 2C1EB 2K7KA 1TR0A 3MI7X 2YNIB 3HHEA 3W62A 4MAKA 4RWXA 2HWIA 4EFAC 2DRBA 3FGVA 3W2WA 1J5EJ 2ROPA 2XHCA 5AE3A 2XI3A 2ZBRA 1DTQB 2QMUB 2F1FA 1H72C 5E41A 4ZIWA 4F4ZA 2Q66A 4OYOA 3QZ8A 4M63A 4L3NA 2GZOA 3V81A 1JK9B 5IM0A 4DMZA 2QSWA 2L48A 2E7XA 4J37A 5KFSA 2CQ4A 4F25A 2ZH2A 3KKFA 2LEAA 4C4WA 2VICA 3VALA 1E6YA 3F0NA 1OSCA 3X3UA 2RKIA 3GE9A 2KTQA 1P8GA 3A3PB 1UETA 4DHVA 3UVJA 1RTDA 1GMUA 4WP8A 4CNZA 1ZM4A 2GS8A 2XWYA 2KVQE 4F36A 4IUFA 4DV1J 5KG6A 2IJNA 4L72B 3GJTB 4OL8A 2E29A 4M5JA 2E5LJ 5SZTA 3MUVP 4TYAA 3MR7A 4PG8A 4G1IA 4PYAA 2CVIA 5D0HA 2W1BA 1UJ4A 3RR8A 1J2VA 3UDEA 1VRTB 3IC1A 4X4SA 2ZOMA 2V8VA 1S1TB 4QBUA 5HJXA 1RAEB 4ZVUB 3R7NB 5KT7A 4DR2J 1FWKA 3UD3P 4ES1A 5LM7E 3M8PA 5KFPA 3IS9A 3LH2S 4C8LA 1DQAA 4URSA 3NS7B 2O66A 3OTOF 4MKYA 2EK6A 3O5TB 3FFIA 4DV7F 3Q8VA 1X4HA 2HVDA 1UVKA 2EXUA 4QIEA 2MZJA 3R7SB 2JFKA 2R2TA 2N7CA 1KEKA 1S5ZA 1WEXA 3BGLA 1T9WA 2OPQB 3BBCA 4IFYA 4KE5A 1S97A 3ZZOA 1MW7A 2OEKA 1HNXJ 4F04B 4LF5J 3HD1A 4IOBA 5A0YB 3GMGA 2BOPA 2OEJA 1IBCB 4ED6A 1VHFA 2CG8A 3CJQA 1NKBA 3EGNA 4FS1A 4X84A 4ZVRB 5GVQA 1RWOB 4B9MA 1B99A 2N3OA 1NXIA 1S79A 4DR3J 2FGCA 1VIOA 4MYTA 1X0PA 1QJHA 3P6YC 2R3VA 2ZZTA 4ZLPA 4NXMJ 4V19J 1UVJA 3U7JA 4F3OA 5G0RB 4KHPF 3MUTP 2J9CA 2R7OA 5CD4H 3D1OA 3CXCR 2ZJPQ 3NRBA 2NQPA 3BS9A 3IR5B 1RWXB 3TZXA 1TUWA 3MGJA 2KT5A 1RCXB 2A3JA 1FK9B 2EI5A 1PIEA 3HZGA 3BBFA 2OFHX 2VIHA 1RWUA 4CH0S 2X51A 3PKMA 4KIAA 5A2QU 2K1RB 1Q7YT 4A4JA 1QAXA 1RE1B 3TQEA 3OUYA 2FVSA 4NXNF 3CDUA 4DSIA 3D66A 2QT7A 3AXKA 1JLQB 1YJUA 4LF6J 3QFHA 4RX6A 2DHXA 5ETOA 4L73A 4N5SA 2I8EA 2E1RA 3RZAA 1I94F 3OW2R 4G3IA 3MPVA 2M8DB 4GO7X 3NGSA 1VLOA 3UR0A 3D3CJ 4NCAA 2W2OP 2F5GA 2I9SA 3DOKA 3C19A 2NXCA 3H8YA 3A8JA 4WFZA 4TU7A 4M5DA 3DU6A 3CC7S 2N3LA 5ETPA 5F41A 2BACA 3HI9A 5DZ6A 1T9XA 3HVWA 3NNAA 3FMBA 3MURP 1L5UA 4ECVA 4B9LA 1JIHA 4TU9A 1V9OA 1D09B 1U4BA 2LDYA 2H65B 4PXBA 4QWBA 4NASA 1RXOB 3RB0A 4HTJA 4RBTA 2HZAA 4DR7J 3VTIA 3RGIA 3P8BB 3A8KA 2KYXA 1FJGJ 5HMXA 1YJTA 4H4OB 2XBPA 3A3OB 3NBPB 5J1EB 3J81j 1WHYA 1RAGB 4RL1A 2PEBA 1XR5A 1K1SA 4GMKA 4LFCF 2IYGA 3BO3A 3AQOA 1WWHA 1X4BA 2B9EA 2VBZA 3C14A 3MEKA 2IY5B 1DLOB 5EHHA 3RYLA 4NLOA 2F4FA 4K0KF 4DL0C 3SCIE 4O23A 1UZDA 4CZCA 5FLXU 3QBCA 3F41A 3HK2A 3TI0A 3DOLA 3K57A 3TAMA 1VC0A 1NMEB 2K06A 4O44A 5HO4A 3T1YJ 3LOUA 4U95A 4OIXA 5KG7A 3U1LA 2XY7A 2VHGA 3PJ9A 4U8VA 2KO1A 5J2NA 1IR1A 2JSXA 2FJEB 2IHR1 4PWDB 4HHJA 4HACB 5HLFA 3CD5A 2DBBA 4NYZA 2P9CA 2CPEA 4UF4A 5IC4B 1KHWA 1KVIA 3FRYA 3R9LA 4DV6J 3AQPA 1ZTTA 2J9DE 4C0OC 1UCNA 4DF8A 5KG1A 9ATCB 1CQNA 2FHOB 3HVTB 1ZAWA 1ULRA 2JEIA 5BJRA 2KVIA 3HKZD 4ELVA 4Q2MA 5KFBA 5CZXA 2W2NP 2KZZA 3OTBA 2Y1IA 3NS6A 1LW2B 1N32J 3K17A 3CDEA 2C2ZB 1FTRA 1TL3A 2YQ3A 3JAMU 3M2UA 3R7BB 4LRBA 4DV2F 3US5A 1S1WB 4F0KA 4HEA9 4XPCA 1Z1ZA 3D1QA 1B7YB 3QATA 2ATLA 3CULA 2B6AA 4NLPA 1FVSA 1PG5B 4YUDA 1R8BA 4K5SA 2MGZB 3G8QA 2KKHA 1FNOA 3C8YA 4W90B 1TAQA 2LU1A 1SC3B 4RBVA 1UMJA 4YN3B 2DO0A 1RHKB 1BHNA 3PHTA 2BW2A 3TQ1A 2HNDA 1RT2A 1FNMA 2ZWPA 3VAHA 3I96A 4F4KA 2ALZA 2IRUA 2VONA 6FD1A 1JLGB 3JYTA 1QE1B 2UXDJ 3RBXA 2QLBB 3BR9A 1VK3A 4ED4A 3DOMB 1HLWA 4UUWA 3K5MA 2YPYA 1U45A 1QVFR 3M2RB 1JKHB 4UY8T 4RW8A 5FLXY 1HNVA 4OQJA 1CPZA 3VAMA 5K5MA 5IXUA 4NLTA 1U02A 3TRGA 2JL9A 3BYPA 3W65A 4DV0F 3G2XA 3PY8A 4EO8A 1IM6A 4R5PA 4OI4A 2V4QA 4DN9A 4FXWA 4B02A 2W7AA 5KFIA 4YB7A 3MR3A 1WD6A 3LWMA 5IT0A 3CJKB 3RBZA 5LMUF 3EXCX 4IRDA 3UD5A 1FRXA 5LMNF 1LW0B 5A8RB 3ZFVA 3GCXP 2JLEA 3QRRA 2HWTA 3VV2B 4ZKAA 2HFZA 4QYRA 1CG2A 1FO1A 2H5IB 1RAJA 1NRKA 3CD0A 5DGBA 4P9SA 4QW8A 1SUQB 4K8RA 3VGTA 1Y5LB 2X1AA 2HRYA 1XC9A 1SCJB 4NI2B 4DR1F 3IAM9 4C97A 1FWPA 1GMVA 1MWYA 3U02A 3PW7A 3HSZA 3M8YA 3JAMY 3MPYA 4NLSA 3ZZTA 3R1LA 3TWZA 3FBCA 3HKWA 4P7TA 3EZUA 1BLUA 3TZZA 2HS3A 2BVZA 2ZEJA 4P75A 1K73T 1M5OC 4UOFA 5K8NA 2YWFA 2M8HA 1EZZB 5IC6B 1NJWA 3UN5A 1IR0A 3OXGA 1HNWF 3PXGa 2KFZA 2BEFA 3PX0A 1RU2A 3EVMA 3OTOJ 1VISA 2XMVA 2CADA 3V81B 5IM0B 3MOZA 4OZ1A 4S0MA 2CQIA 3V6HA 4DV7J 1ICEB 1TUGB 3FQLA 1FKOA 4R25A 2C3PA 4JV0A 2X7IA 1JMTA 2K3KA 5KAKA 2GHWA 2HKEA 1E6YB 4CQ1A 1OY6A 5H9EK 2AZ1A 3UVJB 1RTDB 1TK0A 2AV5A 3NAHA 3ZZUA 1C1BA 2B43A 5FIIA 4V1Ak 2UV8A 1KOHA 2MZTA 5T41A 5E2QA 4XDCA 1GX6A 5KT3A 4LF8F 3QRPA 2CPHA 1U1LA 1VBXA 2MSTA 5A8WA 2NXUA 1QAJA 3BKFA 4B3TJ 3IRWP 2MQPA 1RB0A 2FHJD 3DGPA 2R9LA 3NGRA 5DG7A 2IYIA 4KHRA 2WSEC 3M8PB 3QJPA 3IS9B 5DRKA 3NXZA 4LBPA 4KHPJ 1RWPB 4X4TA 5DGAA 5F0UA 2FZKB 3UE2A 1TUVA 1A6LA 3ULHA 3CJ5A 4E98A 3PACA 1R3NA 2V34A 4AL7A 4DLGA 5AXNA 1YJNS 4E8UA 3ICLA 2DHAA 2GA7A 3FFIB 4FYDA 4CWBA 2ZDOA 4MJKA 3CSKA 2UVVA 1GNKA 2Z2MA 3T1HF 1S0VA 3JQKA 1KTQA 4ILLA 1Q8BA 2CZVC 3GFYA 3CJSA 4NXNJ 2PT0A 1MG7A 3EVOA 4O3PA 5L46A 1WG5A 2MKYA 1TP7A 2DY1A 3RRKA 3OL7A 4QW9A 2EBEA 5GAEU 1I94J 2Y8YA 5AXKA 1SL2A 2HMIA 2VUGA 2AHOB 2YWGA 3Q8QB 4L74A 1UA1A 4FBTA 3N5BA 2MZ1A 1R31A 3NOCA 4O0NA 4P10A 4PXDA 2KG0A 2F8MA 1RKJA 3KK2B 3HX9A 3M8RA 4OZLA 2RD5C 8AT1B 3PJWA 5CYMA 4KQZA 1CJVA 1UJ5A 3N4WA 3BZQA 1RHRB 3QSYB 2LQ5A 2CJ9A 3AA8A 2KI2A 2D3ZA 4CLWA 3CCSS 1M5HA 3OLAA 3KUEA 4BS2A 2LYVA 4YEAA 4J9PA 1LFWA 3CCES 1CVJA 2VFUA 2MLXA 3N6MA 3M9OB 5KFVA 1KQFB 2FD2A 4DQQA 3FEYB 3OUYB 1Q8LA 3CJ3A 3OJSA 2GNKA 1Q8IA 2ERRA 4ZPBA 3O6QA 1MN9A 1AUSL 4LFCJ 3B78A 3MPDA 2AMCB 1P9QC 4KTQA 4JUZA 2BDPA 1H0HB 2ALYB 5GMDA 4PQUA 3DCAA 4K0KJ 4C2MA 4DL6A 3K0JA 2JNJA 1ZBTA 1HYSA 3FNNA 2VASA 3P49B 4O4GA 2ZHBA 3QMQA 3K5PA 3RG6A 1U2RA 4M5DB 2ZUAA 3J81U 5DM6Q 4TY8A 3MR6A 1UL3A 3DMJB 2GIRA 1F0XA 3GIJA 3HT0A 1FJEB 1UP1A 3J7AN 1WEYA 2Q3PA 1RZMA 5F8IA 1U1MA 2E9ZA 4LF2A 5EUHA 2A6OA 4MT1A 3KLVA 2VQEF 2BR0A 1HQ2A 3UPFA 1Y3KA 1RHQB 3NL0A 2M70A 1VQNS 4OLPA 4QYZJ 1O8BA 2G1HA 2XCPA 3DRRA 1FJCA 3UN3A 2MQNA 3GSDA 4K4XA 2QLJB 1X5PA 4M95A 3GIRA 3A1YG 1TL7A 4B3SF 3I5AA 2GAHC 4RUAA 3LAKA 4ZPTR 2DNRA 5E3PA 1N36F 5DLGA 1Y00A 4DV2J 4YHHF 1SC1B 2FJXA 3D6HB 3NY0A 2E5GA 4UY85 3C14B 7AT1B 4KJIA 1QVGR 2ZH8A 2V8GA 1WUUA 1XWLA 3MZIA 5B7WA 1RTHA 1T3OA 3CCRS 1Q95G 3UCGA 2G13A 4FNHA 2UU9F 3LA0A 4HKQA 1WF2A 3HMJG 3DOLB 3TAMB 4MYUA 2DH8A 2HRUA 3MPUB 1HARA 4O44B 2WVEA 4L6V3 2V2KA 1M1KT 5KT2A 4USMA 1F9FA 1HWLA 3K8VA 4KH0B 1VBYA 5J2NB 2W24A 4OZ2A 3CC2S 4KT0C 1VI7A 1OO0B 1WSRA 5HLFB 2AWZA 1JLAA 1TQLA 3B82A 3HFKA 2YNGA 1RBAA 3B8HA 3ENAA 2EG2A 3HHNB 1UEKA 2HFSA 3Q2TC 4N56A 1PBAA 3FEXB 3R2DJ 2KM8C 3E2EA 4I69A 3OTDA 3J81Y 2M52A 5MLCV 4PPZA 4K4VA 4DPXA 2XI2A 2VA2A 2XEXA 3C3LA 2G0JA 2MZRA 2MHNA 1GEHA 3VR1A 2VG6A 1TL3B 3M2UB 4MIBA 2KYZA 2RDJA 3M9MB 4ENOA 2F8HA 5LMUJ 2M5YA 4ECYA 4NE9C 1Q16B 3CCWA 5CYQA 2WB4A 5LMNJ 2B6AB 2GFFA 2IJRA 3H5XA 3EXYA 4AXJA 3T5KA 5B0BA 2B9WA 1R8HA 2BE2A 5KFEA 3CCJS 2VBXA 5ETRA 2ASYA 2QJ3A 5CQGA 1KRPA 1VJWA 4PWUA 2Y0BB 2YX7A 2FVRA 2DITA 4YR0A 3LWLA 2MZQA 2HNDB 1RT2B 3MEEA 2C3UA 4LREA 3BR8A 2WW8A 4DR1J 5ITHA 4KYZA 1Q1KA 4K4TA 1N33F 4DL2A 2JX2A 2JHEA 2D9OA 3NKYA 3JTNA 5KFZA 2AJQA 2MLZA 3RBEA 4JI6F 4PQAA 2CXEA 5C25A 2LEBA 2VPYB 4RW8B 1HNVB 2E9TA 3Q8SB 4J9SA 2ZZMA 2H5EA 2PMZD 4XTTA 5E3CA 4CDIA 2OEMA 2WVFA 5CZVA 2V67A 4BBYA 3DGVA 1IJFB 4B3RF 1HNWJ 4R5PB 3BF4A 2NPFA 3TX8A 2RVJA 5A6PA 4X4QA 5KOXA 2YWKA 3TP2A 1WOSA 2CJAA 3AB4B 2NZ4A 1FDBA 2CQCA 2M4MA 6AT1B 1LKZA 1U49A 2NCKL 2R7QA 2EG1A 1HQEA 4JOUA 5EX3A 1JJCB 5K20B 3LW5C 2YWEA 3TZYA 1BGXT 1U24A 3KK3A 2EPIA 3HVAA 4QOTA 1FFSB 3LF0A 3DRPA 4OI3A 4KSEB 1KLMA 1M5KC 2O67A 2B9YA 1RHUB 5KFRA 2C2RA 3GLJA 2QLWA 1UEUA 4GKKF 2NXJA 1HPZA 4QU7A 1H73A 2BKOA 3PRBA 1CS4A 1SKSA 1F2HA 2CKWA 2I1RA 1CLFA 1WKJA 2QN6B 1MSWD 4LF8J 5HI7A 4PAAA 5DQIA 3PEJA 2KB2A 2YKMA 2G2ZA 2V2VA 1S1VA 1SBRA 3PHEA 2IDEA 2G4BA 2KT2A 2OHDA 2VFRA 2J6TA 5DJBA 2YX4A 1HKAA 2LP4A 5FD1A 1N54B 3FBEA 1KVKA 2XNRA 1NPKA 1N52B 1R0CB 3T41A 4C3KA 1ZM2A 3SFGA 1OQ3A 1S99A 5L38A 2LQ9A 2BJ1A 4F0HA 1J5OA 3IGNA 3OTEA 4MK7A 1NEEA 1FKOB 4C0BA 2HHWA 1SPBP 4J9MA 2V50A 3T1HJ 1H7WA 4DCJB 1M5PC 2YH0A 8RUCA 3VWSA 2W4DA 2RSQA 5EDWA 3PVXA 3G82A 4UQGA 3I4PA 3FJ2A 4NRTA 3I87A 2HHTA 1SKWA 2HZVA 3NNHA 3G4SS 2LMIA 4W4MA 4LFAF 5B0AA 1VS3A 3DLKA 1C1BB 4MTPA 2GVZA 1NAQA 4I1TA 2UP1A 5EWFA 4G1PA 4C6AA 1X31C 3LUYA 2GW8A 2MXYA 2RQMA 2QFIA 5B0DA 3IAS9 4X4PA 2J7KA 3TARA 5A8WB 4PUOA 5IV4A 2JVRA 3BKTA 3NCRA 2PI5A 3DGPB 5LJ5Y 2XYHB 1O0PA 2IA6A 3PTWA 4X4RA 1F3VA 1XR7A 4IRCA 4IDKA 1DFDA 4ZP9A 1VMBA 2RHSB 3OHAA 1JJ2R 5CCLA 4U7UK 3KG1A 2HHHF 4KKOA 3C16A 3K59A 1NCLA 4DX8H 4C48A 5JUMA 3VAIA 5M2RA 3CD7A 1CC8A 2LU2A 1T03B 3MM8A 4QR2A 2PIIA 2MDAA 2DNGA 3UWTA 4OI1A 4WXWA 1YRTA 3RAMA 3P96A 1QUPA 4OYIA 2CQ3A 5GAEI 9RUBA 3ET6A 4AD6A 2AYBA 3H4BA 3MOJB 3P5TL 4ZJOA 1HWJA 1PYTA 2EKYA 1VQSA 2V9KA 1TMMA 3SV3A 1E6VA 2AU0A 4RW9B 4NZ6A 2XMMA 1H2UX 3IBFB 4DI6A 3W63A 4YB1P 3M8QA 2AF6A 3MECA 2DYAA 2HS4A 2EFVA 3DYAA 5KFTA 4ZHRA 2CPIA 2NXEA 3H42A 4C3MA 1T9YA 4HHHA 3CCVS 2KXHA 3KK1A 2WCXA 1RT1A 3GU0A 3M1VA 2VQEJ 5D0RA 2DRDA 2IPOB 3EWGA 5F8MA 3KLIA 2IAJB 1YGYA 4F8RA 3DRXA 4WIIA 2HK3A 2LFVA 3BSOA 3SQOP 3BYRA 3VHQA 4L75A 4M5GA 2I6WA 3TOQA 1N88A 2MEWA 3R5DA 4CT8A 3GYXB 1ZA1B 3T5LA 3UDCA 1EJ7L 2HGNA 1AA1B 4U9RA 4P71A 1FDNA 2HK2A 3HDSA 2LXUA 2OD4A 4CLPA 4B3SJ 2DGXA 5J2QA 4HH0A 3V6DA 2RQKA 2DEIA 4LUBA 4QWEA 3TJ9A 4WYWA 1U2CA 2IM0A 4YHHJ 5K14A 2QTWA 4TN2A 3KNGA 3SMZA 2Y8WA 3P4UB 2L9DA 2QMWA 4PR6A 1JLFA 1NKCA 1TELA 5DZ7A 3TA1A 1HYSB 2HRTA 2F4VF 2UU9J 2QZ8A 2J6UA 1GFWB 4MKBA 4DPWA 3PW0A 4TY8B 2O3DA 1NJIT 1BUXA 4IR1A 2PI4A 4C8NA 1NHUA 4NMLA 4N47A 3E3XA 4K5RA 4P2MA 2AW0A 4QR1A 4RU2A 2XZTB 3K5OA 3BPSP 1T3NA 3N0VA 3W66A 1PAEX 4I64A 2CYYA 4F3QA 2DK2A 1SIZA 3C6UA 3CW2C 3QWUA 5KFLA 1ZM3A 1UEVA 1S4FA 2JVOA 2H48B 2ZITA 2PEHA 5LSOA 1GH8A 4ZOSA 3DRRB 3MD3A 3D4JA 1X8DA 3GG0A 5K8MA 3T6BA 4A46A 2KHCA 2KFYA 4ELTA 1SQGA 3AB2B 4FS2A 1WC1A 4DL4A 4Y65A 3D0HE 4AUKA 2GQQA 3QT6A 1TL7B 3IR6B 1S0NA 1GQEA 1MMNA 2QA4G 2MJNA 4LR7A 4OZ5A 2CQ0A 2B4PA 2DTJA 2HQ3A 4PXEA 2J7UA 4GVLA 2BRKA 4I6AA 3TO8A 2JH3A 1OMSA 1RTHB 3L95X 1WDTA 3DU5A 1W2IA 3PYEA 2R8IA 2EFNA 1I1GA 3JXOA 5E3RA 2ZH9A 1FXRA 1GXLA 1LWCA 4QYZK 1U8SA 2JOQA 3Q2SC 1FEEA 3O44A 3ITHA 3CJ0A 3MFHA 3LP0B 3SSSA 1L3TA 1RBLA 3WIUA 1ELOA 3DM2A 3NLCA 1GMWA 1RJJA 1JLAB 1N33J 1YBUA 1OIAA 3EZOA 3E01A 1LV5A 1DTTB 2RQ4A 1PAUB 4JI6J 2FJAB 3QT8A 4ZN3A 5CYJA 2FJVA 1FRHA 3WX4A 3GYGA 1XEZA 2DNOA 1F60B 3R5CA 1WG1A 2Q6BA 1WELA 3I6PA 4P7VA 4B3RJ 1NK5A 2YXLA 2VG6B 2ABYA 2M0GB 1WC0A 4OMFG 4WE1A 3FSIA 4IG3A 4DR6F 3BSNA 3T9ZA 2EFPA 4DCOB 2B8QA 1TVRA 3ZXWA 1Q0NA 2PDAA 5MAOA 4K4YA 2FZCB 4KV8A 2OD6A 1SJFA 3GQCA 4OI6A 2DHSA 3N6LA 1AW0A 2QLXA 4OYZA 4LF4F 2B4UA 2BE2B 5FJ4A 3FZ2A 2WBMA 1JXEA 4B9NA 3C6TA 3W64A 2GJFA 1A7GE 2RNEA 2OUGA 5C24A 1TKZA 3I82A 1M5SA 3MEEB 1FK9A 2RS2A 2VG7A 3I31A 3TA0A 2ILZA 3C2PA 1MWZA 2OMOA 2BJDA 1RK8A 2FY1A 1TKXA 3HFVA 4KC5A 4ID5A 1RLCL 4TYBA 3OTCA 3GWCA 2FVQA 3WBZA 2GO9A 5IOLA 3GV5B 1R8PA 3QIPA 3OD2A 2XY6A 3G6ES 4J9LA 4CO2A 2VPXB 3OFFA 3RAQA 4NPOA 2VL1A 1UW9A 2D3OR 3N5FA 5LXRA 3ONQA 1FE0A 1YK9A 4GVBB 4ZLLA 1NDCA 4MIAA 4QWDA 1YRUA 2RF2A 1HQEB 2EEYA 2UXCF 1WSVA 1OY8A 2KH9A 2AP6A 1RAFB 3KK3B 1D9DA 4KPYA 3CWJA 4F4YA 3DRPB 5C2CA 1KLMB 4K4SA 2VQFJ 5D3GB 3CO0P 5F8JA 2CPZA 2CWKA 2YWWA 2HVEA 3CTRA 3GV7B 1S7IA 2B8PA 3IFEA 1DARA 3V6JA 1UFWA 3A8EA 4QIVA 2IC3A 2CQDA 2YKMB 2HAIA 2FJWA 3VGVA 4R0JA 1IBLF 3V6KA 3TUJC 1OWXA 2HBZB 4DFPA 5KT5A 5KFXA 3CCLS 1TV6B 1FJ7A 1YG0A 1N48A 1VC5A 2VFVA 3THVA 4AYBD 2DNNA 1U7LA 1LWXA 3MCOA 3V4IA 3OL9A 3MWBA 1KDNA 3POTA 3O8WA 2J0XA 2D74B 4USWA 1J5OB 2QL5B 1HMVA 2U2FA 3ZTOA 2R7WA 1FRJA 3DDIA 1ZS6A 2UVUA 3CVKA 4XPEA 2W8LA 3BM7A 1UAWA 3G82B 3MMCA 1XERA 4RW6A 2AYEA 2UVRA 2CA9A 1NUEA 1U6FA 3DFEA 3NP5A 2EKNA 4DSKA 3H5SA 4ZCMA 4WPAA 3HCXA 2RT3A 1N34F 3HSDA 2GO8A 2UXBF 3EPIA 4Y2CA 3Q8UA 3DLKB 3VAFA 3RR7A 4JB8B 5J2MA 1HBNA 4OX9F 5I42A 3AT1B 5F0WA 4ICLA 3LTOA 2W9BA 4PUOB 4JI1F 1AZSB 2AEJA 3HLUA 4M8LA 3BH7B 2ZZNA 3MMBA 2DT9A 2UZAA 3ZZRA 3EGZA 1HNZF 3SEOA 1R27B 2Z2LA 2IBOA 2E5JA 2HLTA 4IDKB 5D4LA 4O3OA 4WZMA 3KDOA 2FPHX 3CE8A 2H3EB 4KKOB 3C16B 1PYOB 1UFKA 2BX6A 4D3HA 4GC6A 2E1MC 3QGIA 1WNEA 2CVEA 3NNCA 1A9NB 1H2TZ 4IQXA 3LGMA 1IWAA 3MM8B 2DH9A 3N79A 5DS7A 2DGTA 2OMLA 5B0GA 4IG0A 3ET6B 3WIVA 4I6WA 4JI5F 4J9RA 1R8AA 5BYRA 3PKYA 1IBMJ 5GADU 3R8YA 4JYAF 2CQ1A 4J9QA 4CYUA 1N56A 1E6VB 3G71S 2RDDA 3MEDA 3IBCB 4RBUA 3DI6A 4ECUA 1N4LA 3HD2A 2F4VJ 3M8QB 3MECB 2VBYA 3IWXA 4ZCLA 2BKNA 1TKDA 3DYAB 4ED0A 4ZHRB 2AX0A 2C2OB 1VJQA 1WHWA 3IRXA 2ACYA 3G86A 3H98A 2MPUA 2I38A 2QA2A 1Y3JA 2J9DA 2YQ1A 1K9MT 4NLQA 3KK1B 5HL7Q 1RT1B 3M1VB 2GIFA 1BQXA 3CJKA 3RUBL 4DV3F 2NR0A 2GJIA 2W9AA 3VAKA 1IWGA 2APOA 1Z2LA 1N5SA 2DKOB 5JMNA 4LSLA 1LW0A 3TEHB 5C5JA 2DCUB 2IRXA 1VQMS 5T14A 1F5BA 1HR0J 5ETSA 3BPDA 2HHVA 4ATNA 2ZNZA 3HPOA 4OYPA 2V4JA 4RNFA 2UUWA 2P6SA 1XTZA 4X66F 3ZZZA 3KJFB 5IQ6A 4WFYA 4IRKA 3HHLD 2W25A 3MFIA 2XSFA 3CIMA 3W7BA 5D8HB 2LXFA 4C7QA 2EC2A 5J2QB 3OVBA 1UTAA 2XS7A 2JLGA 4ECRA 3V6DB 4NZ0A 2B4OA 2YTCA 4JI8F 3U1NA 3ADAC 2YBVA 1YQHA 1Q5YA 1BXNA 2VV5A 5K14B 4Q7AA 4L3KA 2JDJA 5LSLA 1JLFB 3AJ2A 4YR3A 4OI0A 4IO1A 5HVFA 3S1TA 4AE5A 3R5JB 1NO8A 1AT1B 5ETNA 1KFDA 1S9GA 1Q81T 1ZA2B 1NZ8A 1NSPA 3IXQA 2FHMA 5E7OB 1AUDA 1CBKA 1T11A 2XQCA 2OPPA 3B6BA 1X4DA 4B3MF 3GPAA 4A8SA 1VCTA 1RYRA 4X4OA 2VFTA 3HHLC 3C6UB 3EVWA 4U6PA 2LVWA 4M5NA 4LBIA 1VQYA 3UFCX 3Q0AA 1NK0A 4OI2A 1V3SA 3EYZA 5D4NA 5E0OA 2C42A 1TZ0A 3UO0A 3UI3A 4QIWD 4DLEA 3MM6A 5B0FA 5H9FJ 2HQFA 4QPTA 3SV4A 4DUTA 4J9KA 4ZITA 2QFJA 3R5GA 4RNHA 3QNWB 2HFOA 4XAKA 3HZEA 4UZCA 1U48A 1R43A 4FNIA 4OHWA 3M6WA 1H74A 4KBIA 3GR1A 1XIQA 1VQKS 2QEXS 1WJ9A 3GZ7A 3N01A 5HMYA 2GQCA 5A8KA 2HVZA 5D77A 3VGUA 1R89A 3C15A 3T19A 3LPEA 4ER8A 4LF4J 2KFNA 1Q82T 1RCOB 5KFWA 1N5TA 1LWCB 3J7YU 2RRNA 3VCDA 3UCUP 1FI4A 1PC4A 2KN4A 4DL7A 3H20A 3ITHB 4ECQA 2JZ5A 3OBIA 1FRKA 4KR0B 1D3WA 1IM4A 3FMWA 3DM2B 3FRZA 2R7VA 4DFJA 3SFUA 1R0AA 3MD1A 2XMJA 3FC9A 3DRSA 2DGQA 3LQVA 5IT9U 1ZZFA 1KBRA 3E01B 1HNIA 4MH8A 1FESA 4C0HA 3D0GE 2J0SD 4PG7A 1QTNB 1S1UA 2FLOA 4IO9Q 2HGMA 5DM7Q 4F4WA 2Y9HA 2ROGA 2G0IA 2M9KA 1X4GA 2D3UA 3LGNA 4F2RA 1XN9A 1BQNA 4F7VA 4Y3CA 4DZDA 3R97A 5ETQA 3IM9A 3DLJA 5KG0A 1HHQA 4IH5A 3MTKA 3H5UA 4ED7A 4WE1B 2B4VA 2FVPA 2GC8A 4WU3A 4IG3B 5EWGA 4OYMA 1NDKA 1CC7A 3H2VE 3B4DA 1AFIA 1LK7A 3M6VA 1TVRB 2VU5A 1NB7A 3KK2A 1EAYC 3TVZA 3G6YA 1ZZNA 4KV8B 1WORA 2AEMA 3DLBA 4FZVA 4XIUA 2IIHA 1L3UA 4JI0F 3ENWA 1NM2A 1HFEL 2UXCJ 3KLFA 2P8IA 3DC2A 3RB6A 3CJ8A 3DLGA 3C6TB 4I56A 5C24B 4JI3F 1TKZB 1YZ7A 3B54A 1YTYA 4OV6A 5ADZA 2DHGA 2VG7B 3KYLA 1JLCA 2IJFA 3PO4A 2J76E 5LJ3Y 4LQ3A 4UZBA 3CMAS 1M90T 2EWHA 4HT5A 1TKXB 1ITPA 2KDOA 4ID5B 1G1XA 1HWIA 2XS5A 3A8IA 1UA0A 5D6GA 2PGCA 3TUZC 1LNQA 2X1FA 1IN0A 1IBLJ 1NH7A 1FX4A 5HAOA 3QIPB 2OSRA 1KP6A 3G87A 2BANA 3T5HA 4DQPA 4F50A 4Q43A 2V2QA 1IBKJ 2EFGA 2WRMA 4IH7A 2BQ3A 4RLEA 3M6UA 4URGA 2PC6A 1SB6A 3A13A 4YOEA 3NMRA 2MYFA 4KGZB 3NOGA 2XGQA 2BUNA 3OVAA 3CCUS 4DR5F 1C2PA 4I4BA 1Y11A 3DMJA 2OIHA 2R2SA 4HHUA 2P9EA 3D5MA 2BJEA 3OR1A 2RF2B 3T1AA 3DXBA 2HGLA 1MMDA 1VK8A 3IA0A 2AX1A 5AJ3F 4X4UA 2GX8A 2F9DA 1NDPA 5KFGA 4NLWA 1N34J 2R8JA 2UXBJ 3RRHA 4LF7J 1J5EF 5HQLA 4OYWA 1SKUB 4OX9J 2PA3A 3CIZA 1Y7PA 4Z7CA 2IC3B 4JI1J 3K7RA 3HP6A 4RWWA 4IOCQ 2U1AA 2HVHA 3SQGA 3TA2A 1VFJA 4ZLNA 3NAIA 1X60A 3WDOA 4OHXA 1HNZJ 3Q24A 2XMAA 2XGPA 2ASLA 2NS1B 2DPIA 2R4FA 4DXLA 1XK8A 1K47A 2RB7A 1T8EA 5L9NA 2ZC4A 4N41A 4IFVB 5F8GA 3V4IB 3F44A 3POTB 1DBDA 2ZH1A 2YKQA 3K89A 2VA3A 3R5AA 3HULA 1HMVB 4ECZA 3D9BA 5A2QY 1REGX 2R7UA 4ELUA 4R8UA 3OL8A 1X7VA 3SCKE 2IRYA 4NMXA 1YJRA 1FD2A 2DRAA 5BYSA 2ZJRQ 2LEPA 1PC5A 3MM5B 4W92B 4JV2A 2NUHA 2POKA 4CLYA 2Q6CA 5HQ8A 3MMCB 5IZHA 5DETA 4RW6B 4OX7A 1RHJB 1U6ZA 4DU8A 3THPA 3MMJA 3R3TA 4LRAA 3PRVA 2ZBPA 2F63A 3MUMP 3W1YC 4JI5J 3T5JA 4G65A 2MZSA 1RA7A 5HANA 4JYAJ 1PCAA 1CJUA 4HI2A 4NLGA 5J2MB 3W2VA 5DQGA 4CTAA 1UVNA 1RU1A 1HBNB 5I42B 3VF0B 4WFAQ 3UNYA 4DPOA 2IVYA 3CJRA 4ICLB 4KH1B 3JQJA 2W9BB 1G3OA 2E1AA 3W9HA 1EP4A 4HI1A 4CLTA 1YVFA 4OHYA 3MMBB 4WTYA 4DV4F 3EM1A 1C4AA 4PEOA 2A18A 2KRRA 2J7WA 4DV3J 3KUGA 5C7PA 3CGIA 5F3ZA 3CPWR 1CJKA 2DIUA 2DR5A 1QSLA 3I9V9 4ALZA 1I5OB 1FNXH 2CWXA 4KRWA 3QGHA 4DX7A 2HBYB 1PBUA 2LA4A 1PO6A 1EQMA 4X66J 3G6XA 1IKXA 2VD3A 2BJ3A 4DN0A 1Q8KA 2MKJA 2ZBQA 4RUCA 1K1QA 1N5YA 3M30A 5GADI 1N5QA 4LSNA 4IG0B 2WBRA 2ASDA 5DDRC 4DR3F 5D4OA 4JI8J 1QSYA 4M5KA 1VQ9S 2Z56B 3HSGA 1ZH5A 4CYUB 3D7SB 1GTHA 2J9EA 3MEDB 3DI6B 4NXMF 2OFGX 2KXNB 4WFBQ 3KTQA 1FKPA 2HQGA 2C28A 3PFEA 2ZH5A 3PYFA 3DNCA 2XMKA 5JJBA 4USKA 2JWNA 3IRXB 4M5MA 3ZTQA 3RB4A 3QAEA 4PABA 1V6HA 2XTJP 4AL5A 3O2IA 2B7CB 2B56A 4B3MJ 1KQGB 2V2ZA 1B0PA 2QC3A 2Q79A 1CJTA 5KFAA 1JNZB 2YKOA 1F2GA 3HJFA 2M2BA 4LSLB 2W2QP 1FT8A 4Q8FA 2OSQA 3TVYA 2CJBA 2F8EX 2ZBIA 2B0GA 5KT4A 4G1QA 2ZVSA 2H4WB 2CRLA 2C22A 2IM2A 1FKAF 1TAUA 3UDLA 1PJ6A 3BBBA 2V4JB 2D41A 2BJ9A 1O51A 1DURA 2EVZA 3P45B 3W8GA 3BQ0A 1F9HA 2FTRA 2CQBA 3MM9A 1Y0HA 1VC6A 5HP1A 5H1SV 4OHVA 3KHLA 2C3YA 2ZVIA 2EW9A 2CG4A 1SH0A 1WC6A 1RGVA 4I67A 3SZ2A 1DHMA 4UUXA 5DG8A 3JTPA 3O3LA 3A4TA 4WFXA 2NREA 2D9PA 1S12A 1I6JA 5M2PA 1S9GB 4GO5X 2WAQD 1M5VC 3CJ4A 4A8QA 4NLVA 1X5SA 4ZPDA 2Z57B 1NK4A 2W7OA 2OGUA 2OPPB 4MIWA 3V2UC 3CJTA 2GGPB 4DX5A 3JSYA 2MQMA 4YR2A 3KMQA 3CCQS 4CIOA 1L3SA 4F3MA 2EK1A 4WXOA 4ED5A 3EZ5A 1SKRA 4DWIA 5KFCA 3OV7A 3RTVA 3KLEA 4L76A 3M8WA 5KG2A 2FUG9 3MM6B 4DL5A 2OJ3A 2DGOA 2V4RA 3KDNA 1D1UA 2AJ0A 3NEKA 5AE2A 2Z2YB 3BGOP 4FP9A 4J5OA 2SXLA 4OYBA 3ILOA 1NHKL 2RU9A 2R7SA 1XMQF 1KD1T 1P1LA 4U7UD 5A8KB 4OHZA 2D1CA 5L1LA 3C15B 4DCPB 4OFZA 4NLXA 4LFBF 4JI0J 3SCLE 2YVSA 4QR0A 3M05A 3J7YI 4YY3F 3SXLA 1RACB 3K5NA 1NH8A 4DV6F 1HW9A 1T9TA 3BV8A 4RNOA 1S76D 1KTVA 4JI3J 1OS5A 1KOOA 5H9FK 3NG8A 5AXLA 1UFLA 2WSFC 3IBWA 1G7CB 3BREA 1R0AB 3DRSB 2ZOFA 2ZH6A 2GMJA 3JSMA 1HNIB 3KJNB 5IT4A 2W2PP 4WTOB 1VIXA 1GXUA 4D3GA 4DX6A 1WTBA 1S1UB 2Q1LA 3S8SA 2C2EA 1T03A 3OSNA 1N32F 2HPUA 3DXSX 5HVGA 2JEFA 2C2DA 1BQNB 4NA3A 3G9CA 4DU7A 4PWWA 4HLBA 1EARA 4RW9A 2HFNA 2PFFB 4Y2KA 2QYCA 2ADBA 1RT7A 4FF4A 3M8SA 1S0MA 1FWLA 3FUYA 2RE1A 4DR5J 3V4MA 2WZ1A 3NGTA 8ATCB 3KG4A 4RKUC 1GTEA 3DHWC 4WJBA 3EPGA 4C8MA 4QZVB 4DQSA 2XO7A 2KU7A 1X5OA 2Y1RI 5JVHQ 2R2RA 2UXDF 1V3ZA 1URNA 2Z8QA 3KLFB 3DLEB 4C9DA 2J8SA 3DLGB 1S9EB 1P6TA 5AJ3J 3I9ZA 2NSCA 1IR2A 2Y0SD 3MM7A 4DS4A 1FD8A 3BN7A 1VRUB 3PRDA 2IAJA 3D0IE 3EUNA 1JLCB 2E7VA 1MWQA 3D28A 2WVBA 4NCBA 2MY7A 5HBMA 5KFNA 2JEGA 1HWUA 4J9OA 4DFKA 1XR6A 4KB7A 2AGPA 4A8MP 4M5IA 4M5LA 5HQMA 1WI8A 3FCWA 1F5CA 1XJWB 3KJVA 5I3QA 2GVDA 5AT1B 1WKLA 2BANB 2OTJS 4WZQA 4B9UA 2X1BA 4B9VA 3IMQJ 4USVA 4ZVHA 1FCAA 2ZD1A 4KO0A 3PX6A 1B0TA 1BD6A 7FD1A 4LBHA 3P5BP 2OP5A 2ZM6F 3W8PA 2RJZA 3DHXA 1QTMA 4FXDA 1NB2A 1IKYA 1LWFA 4TQRA 4ILMA 2HS0A 2HEKA 2AQ4A 3OR1B 4PG4A 4HH1A 1IQTA 2H5JB 5AXMA 2HW3A 3QGGA 1G2EA 4DZ6A 2ZH4A 1W26A 2VOPA 2HHQA 4A8YA 3M2VB 4CM0A 2KL8A 4XK8C 1IJEB 4OX6A 3OL6A 4WWSA 1SQFA 3OFHA 4RJVA 1AXQA 4PRFA 1FDDA 2AKWB 4A48A 2DH7A 1U8WA 2FHJA 1HWKA 4DUYF 4EBDA 4XDDA 1FRIA 4C98A 2F40A 3GTYX 4ZIVA 4AQYF 2L41A 4DUZF 2UUCF 3X1LB 1KS2A 3R27A 2DHHA 1VQ5S 3SQGB 1KKHA 3UDVA 2EBGA 3PW2A 4DV4J 2C3MA 4WK3A 4CLZA 2AYMA 1VQ7S 2I5JB 3GFXA 1K44A 2ZH3A 5DO2A 3AAWB 2NLWA 4PG6A 3BJYA 4LIWA 2W4PA 2RUSA 4Q5VA 2XULA 4R8UB 4O3NA 3KXDA 1WOPA 1VQ8S 4NRUA 3LP0A 4YP3A 1OY9A 2XZWA 1RWNB 2W2MP 4LJMA 1S6OA 2GQ2A 3FKBA 1SJ1A 2O5DA 1BY9A 3IG1A 4CM2A 2NUUG 1BWVA 2L9WA 2L08A 5HROA 5ETVA 2XLKA 2CQHA 1C4CA 4B3TF 1DTTA 3N28A 1CJUB 1GT8A 3N9UC 2QE5A 4Q45A 2AGQA 3I56S 3W2VB 4RO0A 3GJSB 4H4MA 4CTAB 1B4SA 2VB6A 1QDUB 2MMYA 2IVFB 1EP4B 4OLOA 2W7PA 3JTOA 4DV0J 3MF5A 3TW0A 1F1BB 2NYIA 4OJGA 4FXVA 3KWMA 3TUIC 2MQ8A 1H6KX 1S6PB 3S7RA 2DNPA 1LK5A 2CZ4A 4DV5F 3QQCD 3R2CJ 2ZHOA 1YBAA 4ED8A 4I2PA 4DDFA 1CJKB 2QSFA 2PO4A 2AJ2A 2WONA 5ETKA 3K58A 3RU0A 1PJ5A 2V94A 5KFDA 1T94A 1XQIA 2UUBF 3AJDA 4HDHA 4EI2A 2BV3A 1H3DA 4QCLA 1U1PA 1W7WA 3GB0A 2IM3A 4O3SA 1IKXB 3ZC4A 4CLSA 3ILIA 4DS5A 4FVMA 5DQHA 1EQ0A 1JB0C 4KGKA 2VKZG 2I2YA 1N5YB 3M30B 1B7FA 4LSNB 4ZP8A 4ID8A 3Q86A 3BB5A 2E5IA 4RW4A 1NKEA 2CPDA 1OQ6A 2QA4S 1HI8A 1PSDA 2V63A 1REVA 1WOOA 2VJUA 2Z4PA 4NLYA 5L8RC 1FKPB 2CJKA 2VPZB 5EN1A 1RADB 1M0SA 1N0UA 2ZC3A 3D3BJ 2D7SA 1PILA 4LVOP 1VR6A 5J1NA 3AY0A 2DXDA 5GAHU 1TL1A 2CAJA 1MNEA 3MR2A 2XLJA 3ZTRA 3ZZYA 4KFBA 2JEJA 1YDLA 2Z0GA 4USIA 1F6TA 3IWLA 4NLDA 1S72S 2VOOA 2GHVC 1CJTB 2MLYA 1C1CA 4A8WA 2IMWP 4DPYA 1OYEA 4ECWA 4ZVTB 1VQ4S 4GVBA 5LXYA 4FBUA 2V8PA 4ZVFA 4LF9F 5HJYA 3PIPQ 3MMAA 2DXFA 3MDFA 2DNQA 5KFKA 4G1QB 3JSBA 3PV8A 4H4KA 4P74A 3SSQA 3UN2A 2DNMA 2UUAF 1M1HA 2PD1A 3I32A 4LT6A 1FRLA 2MQLA 2DCLA 4HT7A 1U1QA 5F8NA 2ZDPA 5D3GA 1TKTA 2HIYA 2V9WA 2VFSA 2YNHA 3V5RA 4EZ6A 3MM9B 3KLHA 5HP1B 1GAOA 1Y9OA 1KN6A 1AROP 2FGOA 4EUVA 1RWMB 1X4AA 2QMXA 3ELHA 4UQTA 1XMQJ 4WKRA 2HVIA 2KHDA 3QZ7A 3LP2A 2X3GA 1RT3A 4M1KA 5KTQA 3AHPA 4DR4F 3RJMB 1EETA 4LFBJ 4YY3J 2J6SA 3CMES 1KQKA 2XY5A 3CT9A 4K4ZA 1TV6A 4ZVPB 5FDLA 4NCGA 1QSSA 2LLZA 3PM9A 2V6AA 2CDRB 2W01A 1OSDA 4NLRA 4EWTA 3FK4A 2HZCA 1FE4A 1S49A 4NYPA 1RAHB 2CJYB 3H59A 4FPIA 2PSZA 1D8ZA 3G8TA 3AA9A 2P9GA 2HHPA 4CT9A 2CNLB 4KGVB 2MKSA 3I4HX 4P72A 1FHTA 2BE7D 2BQRA 3I0RA 2HQIA 1DZ5A 4USHA 5L9XA 4CLUA 1RI7A 3C66A 1ZOTA 3SYZA 2W9CA 5AE1A 1EX8A 3KLEB 1L3KA 2HSEB 1B3TA 1QY7A 4E0DA 3GILA 4DG1A 3AD8C 4RW7B 1QUVA 1U1NA 4CO0A 2P2CB 2ZFHA 4IKAA 3W5ZA 3H25A 5J2PA 2CPJA 3RAXA 2RIJA 4HVZA 2B5JA 5CCMA 2LQJA 1NSKL 4ZVQB 2FQQB 2LXIA 3L4BC 4B08A 1T0TV 3VGSA 4ZCIA 4LMZA 1LFPA 4E2FB 3R6LB 1SI9A 1VLYA 1SXLA 5F9NA 1CEZA 2WVCA 1BC6A 1T05A 1IUJA 1S4EA 1AZSA 1MROA 3FCVA 4J9NA 2CNOB 1FX2A 3PEHA 4LIRA 1A0OB 3J7A1 1UVLA 2E1PA 2HBRB 2OKQA 3TANA 3OLBA 3LGHA 1JJ4A 1S10A 4Y00A 2XSJA 1RT6A 2PFDA 2I0XA 3H2UB 2ASJA 1L3VA 5CHCB 3K2YA 3AJ1A 3FSXA 5KFMA 2ADCA 1NNDA 4YS2A 1JLBA 3E8OA 4ETZA 3D2WA 3ISND 1YJWS 4PPDA 3HFZB 2FHKA 4DL3A 4ZP6A 1LXNA 2XS2A 1O6XA 3JSMB 1GK8A 4A8XA 1YRXA 3ETOA 4F0MA 3GFZA 1H7XA 2OH2A 1SL0A 1BQMB 5I3PA 3CDAA 3MAQA 1U6BA 2M88A 2W8KA 1WACA 3D67A 5KFQA 1SH2A 4TLQA 4ERDA 1BE4A 5E33A 3VAJA 5KFYA 3MR5A 4IR9A 4X65F 1UWAA 5F8HA 4QIFA 2X3DA 2H4YB 1FFGB 4AXIA 1RA6A 3CCMS 2RH3A 1RT7B 4HDGA 3PIOQ 3E51A 4I7FA 2ZM6J 3NGUA 2A6MA 2OLWA 3DDNA 1U09A 4DF4A 1JQGA 3NGDA 3IP0A 1RLDA 4FPRA 4ZLJA 4Q8EA 3Q8YA 4QWCA 4DQRA 3ISNC 4N7TA 4C3LA 2AJFE 4GKJF 4DOZA 1D8YA 2E1CA 3TAQA 2CPXA 5IV3A 5KFFA 3KLGA 3MM7B 4ZJQA 2GMLA 3ZO7A 2B7BB 4X2BA 1LEOA 5HVHA 1UPPA 3W2WB 3WC2A 4I2QA 3I0SA 2DGSA 2QG9B 3PCOB 1FFWB 5HATA 1VGYA 4FYWB 2XCAA 5HBMB 3JB9k 2W4CA 3PDNA 4DUYJ 2YY3A 2MQQA 4UOHA 1SV5A 4AQYJ 2A10A 4U7CA 4DUZJ 2UUCJ 3M4XA 3OT9A 4C8OA 3KJVB 4ETXA 4C8ZA 2GVDB 2ZE2A 1N36J 2HAFA 2ZBCA 1LXJA 3FDSA 2AT1B 5D15A 5RUBA 5THWA 3G96A 1ZAVA 3AD9C 2XNQA 2YKAA 3MHYA 4N76A 1RAOA 2ZNYA 2A2CA 2ZD1B 4KO0B 2RKIB 3HSJA 3PX4A 1RT4A 2ATCB 2OAUA 2DJWA 4NX9A 3KHGA 5F9LA 1IKYB 2CZ9A 1LWFB 2HLUA 4J91A 1FTCA 2CQ2A 2KRBA 3LPYA 2E9RX 1G6BA 3D6FB 2DPJA 4ZVOB 1LOUA 3M7VA 4OZJA 3UQSA 5K8OA 2AIRB 2XM3A 3RW7A 4Z2XA 4K59A 4I6YA 4DPUA 1Y5IB 1C0TA 4DFMA 2FIUA 1JNRB 5L39A 4JI2F 2HHSA 1LQ9A 1SJ3P 1EHWA 1P27B 2ZHAA 2DR7A 3KFWX 4B9TA 3CEDA 5KFUA 1SVDA 4JP8A 2ZJQQ 2NZCA 1NJXA 1Q79A 1B70B 4ED3A 3BEGB 2IBKA 1SJQA 3EDRB 4Y6IA 5U47A 4JBCA 4ZCKA 3EICA 2RU3A 2G9OA 1WI6A 2VH7A 4YMEA 3CMQA 2G2YA 2PE8A 3AXMA 1IKVA 4DV5J 4QJVA 4CRJA 4N77A 1S6QA 1OPIA 3AOAA 5B0EA 3NWRA 4IOAQ 1GX5A 4ES2A 4TY9A 1KNZA 3GIKA 4IFYB 2WOMA 4A8OA 3TVKA 1RBOB 2NPIA 5I4MA 5CD4A 1UW4A 1WF1A 2AEFA 1PGZA 7FDRA 3RB3A 2QL7B 2JRSA 2UUBJ 3M6XA 5KFHA 3IWNC 1Y10A 1C0UA 4FN5A 3BGRA 1X9WA 4Y34A 1XMOF 5B08A 1N6QA 1HL6A 4F02A 4DSFA 3OHBA 3IG1B 2FZGB 3UR3C 2RQCA 2RS8A 4BC7A 5C42A 3D54A 5HROB 2MY8A 4NWBA 2XMTA 5ETLA 1Q53A 2HQCA 1MLAA 2BXJA 4PKDB 1QM9A 1X9MA 1APSA 3RBDA 2WSCC 4H4MB 1HI0P 1Q86T 1V5VA 1Q5VA 3BGFA 1VOMA 2FY8A 5B0CA 3UNGC 1RWWB 1RISA 2IM1A 4ECTA 4FYVB 4TKTA 4C8YA 1RTIA 4EBCA 1B64A 3GFHA 2DY9A 4TVAB 4AFFA 3W5YA 4ITSA 5L1IA 4F26A 2MKKA 1YJVA 1FA0A 4Z37A 2MKIA 4WU2A 4I2PB 1RYSA 4P2SA 2VG5A 1F5AA 2WONB 2D69A 4LF9J 3PFOA 5E3AA 2PN6A 1ZYQA 1H98A 4ZVEA 4JV5F 3BH6B 2AYGA 2A0FB 1VHIA 2UUAJ 4QPXA 3L3CA 2WHOA 4V19X 2QV6A 4YB6A 2GJ2A 4Q0BA 1S6UA 1TFYA 3DOKB 3PJXA 1HBUA 2DR6A 4LR9A 2LECA 4GKKJ 2XYPB 3AODA 5ETMA 4AL6A 4RW4B 2EC0A 2P5VA 3BSCA 3EDQB 4Y28C 3GIIA 3FVYA 4LSZB 2J0QD 2YWHA 1REVB 3UD4P 2E44A 3P3DA 2ZH7A 1NK6A 2NSBA 1VQLS 1Y4ZB 1UVIA 4DR4J 2WTFA 2HURA 4YB5A 5GAHI 2R8GA 1U0SA 4FVCA 1NPPA 3OVSA 4HR2A 4ZMMA 5A76A 3H40A 1TL1B 1VBZA 1NJYA 4KFBB 3DDKA 4BWMA 4LQ9A 1HQUA 3OXFA 1MMLA 1Z2ZA 1S48A 3IO1A 1AFJA 2AZ3A 4GRSA 1C1CB 1K0VA 2DNZA 3CNQP 1DRZA 3ILLA 4IH6A 2Z2ZA 2Q43A 3MMAB 2RRAA 4U67Q 2YPZA 4LVNP 4UT4A 1O5JA 2MJUA 3W9IA 4ZA1A 2EFOA 3CDBA 4LFAJ 5IQQA 1NDLA 1G4CA 1TKTB 5LOQA 3IN5A 2BJ8A 2YNHB 2BMBA 2BOAA 3H7HB 1S1XA 3KLHB 2KM8B 4ILRA 2FC9A 2CJQA 4CLFA 4LR8A 4OZ3A 3LP1A 1Y5NB 2R7XA 3G8SA 2HG4A 3QSIA 3W61A 2C2MB 3D68A 3LP2B 1OPZA 2YKNA 1RT3B 2A1BA 4ED1A 3ETMA 1WHXA 1EIYB 1EETB 2BABA 1QD1A 4C11A 4G6VB 1S7HA 3AFGA 1KWMA 4H4KC 1SIWB 1X0FA 3TZWA 2AJ1A 3WZ0A 2QRRA 5FDLB 4NCGB 3MXHP 2QGFB 3OFGA 2Y1JA 2HHXA 4CO4A 3NGKA 2MKHA 2XZDB 4P2XA 4IFVA 4EGLA 3BGUA 3HXMA 1NK7A 4PG5A 2MKCA 4UOGA 5IS2A 3M9NB 2HHHJ 1KR4A 5CXTA 1FVQA 2IVMA 3I0RB 3MM5A 1YX2A 2CNKB 4B3OA 2N4CA 2W9CB 4FKXA 3KMSA 2YQ0A 3EGVA 1R6VA 1V5IB 4DG1B 4F4AA 4RR5A 2BKPA 3D6TB 4EK2A 5J2PB 4RZRA 1R7IA 5C2GA 2B5JB 4X65J 4NOHA 2BM1A 4WF9Q 1FEHA 2E5HA 3EMTA 3Q83A 3DRYA 2VODA 2RRBA 2QL9B 2DVIA 2HYIB 1VQ6S 2NYHA 4K7QA 1CSJA 3EE3A 2QLFB 1T05B 2OPSA 3K8WA 1MROB 2CDQA 1KVJA 5GAGU 3PW4A 3JYTB 2FB0A 2HFVA 3KNAA 2DGVA 3UCZP 5BR8F 2HQDA 2LDIA 4GKJJ 4Y2AA 1ZPWX 2XSJB 1RT6B 4CNYA 5E3QA 1NJZA 1RT5A 2XMWA 4WYLA 4B9SA 1VYAA 1JLBB 2BZ2A 2V69A 1U1OA 2F3JA 4LF1A 3TNVA 2ROEA 1QAIA 2IFXA 3ZNUA 2ZUGA 3OR2A 3ZZ0A 2N7YA 2F7VA 1P1TA 3D1HA 3BO2A 4OZ0A 3ILJA 3VAGA 4A8KA 2FJBB 2LCWA 4K4UA 1U2FA 5DDQC 3HHKA 3VZIA 1RAIB 2R7RA 3HJVA 2KT3A 2CQGA 3A3NB 3TYTA 1IKWA 4QU6A 3NCPA 5D0GA 3R5BA 2R2UA 4I7FB 1R0BG 3OFEA 2IA0A 1NHVA 3TAPA 4MFBA 2XG8A 4J9VA 2QX0A 2PMWA 3JQMA 2GIQA 5E5NA 2CFXA 3PR4A 3WQPA 3L09A 4FYYB 1WG4A 1H38A 4Y0FA 4USTA 3W3SA 3SBMA 1VBKA 1IXKA 3KLGB 3FQKA 4ZVSB 2FLPA 1TMJA 1K8AT 4JI2J 3C46A 1Q78A 4I2QB 1HBOA 2DEJA 4A47A 3CDWA 3I0SB 4QWAA 1HW8A 5L1JA 4C8KA 3TUPA 6FDRA 1RAAB 3OSPA 1U1RA 1JLEA 2B3TB 2FLNA 2RUGA 1SV5B 1HD0A 1TL4A 2P6TA 3H2LA 3ZNJ1 1HBMA 4OYXA 4I0WA 2KJVA 3AH6A 4NZ7A 2ZE2B 2HNZA 2M7SA 4P52A 1NBEB 2HNYA 4WFNQ 1JX4A 2XYGB 1CQMA 2O01C 3EGWB 5I3UA 3OPKA 3J80U 4BDPA 2OO4A 1CULA 1RT4B 2J8AA 4J7CA 3MEGA 4QQBA 3GCWP 1EB0A 2LKZA 3BO4A 3ZTSA 4OJ1A 2VQFF 3RRGA 5KG4A 2LQ8A 3FBBA 1S0OA 4BLGA 2XO6A 1ZETA 1XMOJ 5LSRA 4WP3A 2FC8A 3PYDA 3QJJA 3FZBA 1KONA 2XWXA 3ZZPA 2GGPA 2BW7A 1HD1A 2Z30B 4JI7F 2V8HA 4UTGA 4KAIA 4LRFA 2H9ZA 1S59A 4K4WA 1C0TB 4EMDA 4IYQA 2HWHA 1TK8A 4MK9A 1X4FA 2YNFA 2XMUA 4X62F 4EYIB 1WTFA 1T95A 1UWBA 1U0HA 2OPRA 3SIPB 4ZPAA 1YBTA 1S77D 3TR5A 2HHUA 3HHDA 4DBQA 4ANDA 4DSLA 2O1PA 2OELA 2JLFA 2UV8G 3TEGA 4N8NA 3CC4S 4JI4F 3GP9A 2MTLA 4WIQA 5T7LA 3DLHA 2PA8D 2GV1A 3EX7B 1NLKL 3QO9A 1BWEA 1MU2A 2VF3A 3QIDA 1IKVB 2BM0A 1S6QB 4DR6J 1XNRF 1Z4UA 4X64F 4RU9A 4YDDB 2WOMB 2KXFA 3KUHA 3QJLA 1NK9A 2XB2D 4WCEQ 3HO1A 3CF5Q 1TL5A 3LALA 3M32A 3WX8A 3T9NA 1J27A 4JV5J 1NZAA 3ENVA 3CO9A 1YZ6A 5EGYA 3R1HA 5D0EA 1JXLA 3KHRA 1C0UB 1GMWD 3BGRB 4NEYA 1YITS 4M5HA 2HMIB 1N6QB 2Y3YA 4Q44A 2COLA 2B9XA 4OYAA 1RQ0A 3H0PA 3MAAA 2XC9A 5C42B 1S57A 1R8CA 1B0VA 3H90A 1T9UA 5CYMB 1KHVA 1RTJA 4RUBA 3VZHA 1CJVB 3J80Y 3Q8RB 3MTJA 3F73A 2AGOA 2K7JA 3J7ZT 1TFWA 3L9ZA 4NA1A 4BWJA 3AOCA 5LL6d 2F9JA 3PO5A 4NA2A 4HTIA 5K9FA 1XNQF 2DR8A 5F3TA 4RPFA 3Q89A 5IFMA 2Z58B 4FYXB 1RTIB 3NWGA 3QLHA 4WP9A 2G1DA 3U1MA 2CIMA 4P2FA 3DN9A 1BMQB 4RUHA 4H54A 1AYEA 1KC8T 4LRCA 3NMAA 1URRA 2ACMA 2QIFA 3N6NA 4DQIA 2KG1A 1JXVA 2KJWA 4X4NA 2VG5B 3ISZA 5DDPC 2DGWA 3R6GB 2JFDA 3SDEA 1NU4A 3HHLA 2N4DA 1IBMF 3DLEA 2MSSA 1S9EA 1LWEA 2VDIA 2YNIA 1KFSA 4PQUB 1VRUA 4Q0BB 1U25A 4LRDA 1DQ9A 1IQZA 4O4GB 4EZ9A 1HBUB 5HMZA 1DAXA 1SC6A 1F3FA 1DTQA 1T9VA 4O3QA 1RHMB 3W9JA 1KSPA 3L7OA 4CCHA 2DISA 2OI2A 3BSAA 3BKUA 1JJHA 3KG0A 3EJMA 1UKUA 3LAMA 4FF1A 4MKVA 4ANCA 3FSYA 3FCHA 2BRLA 3W5XA 2VZ9A 3G6VA 3GONA 2K8GA 2DR9A 4F4XA 1YHQS 1PYSB 3CCTA 5JXSA 4RNMA 2VJVA 2RDIA 2HIQA 2BYCA 1HA1A 3GSIA 2FVCA 1HR0F 2DNLA 2WK4A 4OJHA 5D4PA 3ENQA 1HQUB 3UW1A 5KFJA 1U26A 2N82B 3KOAA 4CH7A 2E66A 5CA5A 5IT9Y 2G2OA 1WC4A 1RABB 5HN0A 3OJUA 4A8FA 3QYYA 2LQBA 2H54B 1ACMB 1HI1A 5IWAF 2CJXB 5KOWA 2JC1A 3CB4A 3PG9A 2RMLA 4X4VA 2YH1A 3M2VA 1VRTA 1H2VZ 4CH1A 3HVRA 4USUA 1S1TA 2CNNB 4DJBA 4YFUA 1S1XB 1DJ0A 1IVZA 2GMHA 4CLLA 3Q8PB 3LP1B 2J5AA 1NPRA 3KJQB 1WC3A 3QWPA 3VQTA 3THTA 3LO3A 2YKNB 2BA9A 2HBQB 4PYDA 4C11B 3QRQA 3HF5A 2LA6A 1RSCA 5BR8J 2YNGB 3JSRA 1NK8A 3MCMA 2I5JA 4TNOA 3PNIA 2VDHA 2OPQA 3GR0A 4MKAA 1FXLA 4WBFA 3GIMA 1MN7A 2QA1A 3I5CA 2DNKA 4DSJA 4DSEA 2V8DA 3FEZA 4EEYA 5DG9A 2IDLA 1QLNA 1YJ7A 4NLUA 4CLKA 3QPIA 2OTLS 5GMKa 1P9YA 1Q7LB 5A0YA 4BC9A 5L1KA 4DV1F 2AD9A 2J0WA 5JVGQ 4MK8A 4B3OB 2FLLA 2QYGA 1GXTA 3MAHA 1EKRA 2ZKUA 2GAGC 1TK5A 2MQOA 2V0NA 2E5LF 1F9EB 3MCSA 1T7PA 3TX0A 2RHQB 2EFQA 2YKPA 4I68A 1WC5A 5CYQB 1UVMA 4ZVGA 1WKKA 3M8ZA 1ZTWA 4DR2F 4K50A 3H5YA 4YDXA 4KHMA 2R8KA 4CI0B 2VPWB 1RTZA 1PKUA 4Z7YA 3IR7B 5G0RA 1HIYA 1FXDA 3CCZA 3I5BA 5EX0A 2MB0B 1HHSA 4DPTA 2DD8S 3H4DA 2V68A 5GAGI 2OPSB 2C3OA 4ZJLA 4FF3A 5KFOA 3GG1A 4F67A 5HMWA 4ED2A 2VC1A 1AB8A 2K1RA 1X9SA 1S6PA 2VC0A 4TLRA 2VKRA 4NYOA 2RAQA 2R42A 4J90A 2VBWA 1RUSA 2UUTA 3DLLQ 4AT1B 1ZAXA 1RT5B 5C25B 2GHPA 1JLQA 1VQPS 4O4RA 5EWEA 3T3FA 4UOCA 1KQSR 1HNXF 4LF5F 2D3O1 1NSAA 5BXIA 1VRQC 4EO6A 5KG3A 3BN4A 1HHTP 3OR2B 3BQ1A 3VVUA 3L7UA 5GMEA 1YLXA 2L3MA 2BE9B 1ZM9A 1RKIA 1W2BR 2BQUA 1RWVB 3CJ2A 2X1GA 4Y2IA 1QAYA 1PJ7A 4CP5A 3SCJE 3WC0A 1Q4RA 3NCQA 1XBWA 3PZPA 1N8RT 4UW2A 2B51A 3WHIA 2CPFA 3IM8A 4FDFA 3QT7A 2DGUA 1IKWB 4N8OA 1SH3A 3LANA 1W25A 4CO5A 3Q22A 1SC4B 5CABA 3BDEA 4MFBB 2G0CA 1VDHA 3JS9A 5CAAA 4JV1A 3GJQB 5KT6A 4DEZA 3QGPA 1T02A 1HPZB 5M2UA 4CO1A 1CS4B 4H4OA 4KGXB 2DNHA 4USJC 4TU8A 1DY3A 1RWKB 2DB1A 4WK1A 3NBPA 5J1EA 2XHWA 3QFWA 4ECSA 4JI7J 1WF0A 5HK4A 4NEZA 1S1VB 4U96A 1V3RA 1ROFA 2K3IA 2YX1A 1FDAA 4LF6F 1HBOB 4ECXA 4X62J 2FDNA 3QT5A 4M94A 2R8HA 2C2NA 2AJ4A 1JWWA 1IBKF 4OX8A 1N5VA 1OYDA 3O1LA 1DLOA 2CQPA 1JLEB 1SJRA 3U27A 3AD7C 4ZPVR 1YJ9S 3OQ2A 4KY3A 2NXNA 4JI4J 1I3OB 3A12A 1YKWA 1FRMA 4QIGA 3ZTPA 1HBMB 4W98A 1EKSA 2ILYA 3PW5A 2UVWA 3BQ2A 2HNZB
chains in the Genus database with same CATH topology
3W2WB 3WC2A 4IG3B 5EWGA 4B17A 3Q2TC 5SUHA 1CC7A 3H2VE 3B4DA 2HNYB 4I2QA 1AFIA 1LK7A 3M6VA 1TVRB 1NB7A 3KK2A 3I0SA 4N56A 3TVZA 3G6YA 2DGSA 1ZZNA 3J7Z5 4KV8B 5I3UB 1N0VC 3DLBA 3FEXB 5CH7B 4FZVA 2KM8C 3Q23A 1VGYA 1D0EA 2XCAA 5HBMB 4XIUA 3E2EA 3JB9k 1L3UA 4JI0F 2W4CA 4PWDA 3PDNA 3ENWA 4I69A 3OTDA 3J81Y 1ZPVA 2M52A 3MEGB 5MLCV 4PPZA 2DNYA 1HFEL 4XO0A 2CPYA 4K4VA 4Q2LA 2YY3A 4OJ3A 3KLFA 2MQQA 1SV5A 3DC2A 4WKYA 2A10A 3RB6A 4U7CA 2XI2A 2VA2A 2XEXA 3C3LA 3DLGA 3M4XA 3C6TB 2MZRA 4FF2A 2MHNA 3VR1A 4URQU 2VG6A 3T6JA 4C8OA 3KJVB 1TL3B 4I56A 4LF7F 3QAUA 1U47A 5C24B 4JI3F 4ETXA 4C8ZA 3M2UB 5B09A 1TKZB 4MIBA 4ZS6A 4TQSA 2KYZA 3S6EA 2ZE2A 2RDJA 3M9MB 4DR7F 1YTYA 2F8HA 2M5YA 2ZBCA 1LXJA 3FDSA 4ECYA 5ADZA 1FJGF 2DHGA 2VG7B 4ZP7A 5THWA 3KYLA 1Q16B 1JLCA 3G96A 1ZAVA 2XNQA 2YKAA 3MHYA 2IJFA 3HVTA 3CCWA 3PO4A 4N76A 2J76E 2WB4A 5CYQA 5LJ3Y 4LQ3A 4K2XA 2RILA 2B6AB 2GFFA 2ZNYA 1X5TA 5LT5A 4O3RA 1K0TA 3CMAS 2A2CA 2ZD1B 4KO0B 2RKIB 2XLIA 3BDPA 2MHEA 3MPWA 1M90T 3PX4A 3H5XA 2EWHA 3EXYA 1RT4A 4AXJA 3T5KA 4HT5A 1TKXB 5B0BA 1YSJA 2B9WA 3K5LA 1R8HA 2BE2A 2OAUA 5KFEA 2KDOA 2WB1D 1YI2S 1U1KA 4ID5B 3CCJS 2VBXA 2DJWA 5DLFA 4ZPWR 2ASYA 1S9FA 2ZKTA 1G1XA 1HWIA 2XS5A 1UA0A 5CQGA 1KRPA 4NX9A 3KHGA 2YNFB 5D6GA 1RP5A 2PGCA 1VJWA 1LW2A 5F9LA 3TUZC 4PWUA 1IKYB 1LWFB 2X1FA 2YX7A 3KHHA 1IN0A 1UWBB 2HLUA 2FVRA 4EBEA 2DITA 4YR0A 2OPRB 1NH7A 3LWLA 1SJ4P 1FTCA 2MZQA 2HNDB 3OXLA 2CQ2A 1RT2B 2KRBA 3F56A 3MEEA 3QIPB 2OSRA 1S1WA 3LPYA 2C3UA 2E9RX 2BANA 2JC0A 4RW7A 3T5HA 1G6BA 3BR8A 4DQPA 4NL5A 2WW8A 2DPJA 4F50A 5ITHA 4Q43A 1LOUA 1SL1A 2EFGA 2WRMA 4IH7A 4OZJA 3UQSA 5K8OA 2BQ3A 1Q1KA 4K4TA 1N33F 4RLEA 4DL2A 3M6UA 4URGA 5J1PA 2JX2A 4HYKA 3RW7A 2PC6A 4K59A 4Z2XA 4I6YA 1SB6A 2JHEA 3CD6S 2D9OA 3NKYA 3JTNA 5KFZA 2AJQA 3S01A 1Y5IB 3NS5A 3RBEA 1C0TA 4YOEA 5KG5A 3NMRA 4JI6F 3GYNA 2MYFA 4ZDNA 2MGZA 4DFMA 5T7LB 2FIUA 1JNRB 4PQAA 5L39A 3T1YF 4JI2F 2XGQA 2HHSA 3QO9B 1LQ9A 1MU2B 2BUNA 3OVAA 3CCUS 4DR5F 1SJ3P 1C2PA 4ZK7M 1P27B 4I4BA 5C25A 2ZHAA 2DR7A 3KFWX 3DMJA 2OIHA 2LEBA 2VPYB 4B9TA 2A2DA 4RW8B 4IQMA 2R2SA 1HNVB 2P9EA 3PR5B 5BYQA 3HT3A 3CEDA 5KFUA 2E9TA 3Q8SB 4J9SA 3GV8B 3CUNA 2E7WA 3HM9A 2ZZMA 2H5EA 2PMZD 3D5MA 5E3CA 2BJEA 2ZJQQ 3OR1A 2RF2B 4BCAA 5CZVA 1NJXA 1Q79A 2IMOA 3T1AA 4ZPCA 1JLGA 4KGMA 4ED3A 3DXBA 4BBYA 1IJFB 4B3RF 1QE1A 3BEGB 3M32B 2HGLA 1MMDA 4EU0A 4R5PB 3BF4A 2NPFA 1VK8A 3IA0A 2AX1A 2IBKA 5AJ3F 5G4DA 1SJQA 2GX8A 3I55S 4X4UA 2F9DA 3TX8A 2RVJA 4Y6IA 5U47A 5A6PA 5KFGA 4X4QA 3DOMA 4JBCA 5KOXA 4NLWA 4ZCKA 2YWKA 3TP2A 1VQOS 2K2PA 2CJAA 2RU3A 2R8JA 2G9OA 4TXSA 3SSRA 1WI6A 3AB4B 1DQ8A 3RRHA 2NZ4A 2VH7A 4YMEA 2R7TA 1FDBA 2CQCA 1D9AA 1J5EF 2FJDB 2M4MA 2PE8A 3M2RA 1X4EA 1JKHA 2ZOGA 1IKVA 4MMOA 1LKZA 4QJVA 4N77A 1S6QA 1FF2A 1OPIA 4PCQA 4Y2MA 1U49A 5F8LA 2GCFA 5B0EA 5K8PA 4IOAQ 1GX5A 4ES2A 4TY9A 1KNZA 3GIKA 4IFYB 2PA3A 2R7QA 2WOMA 3TVKA 4A8OA 4F2SA 1R6YA 2NPIA 4HL9A 4GC7A 5I4MA 3CIZA 1Y7PA 2EG1A 1HQEA 1UW4A 4JOUA 4R0EA 5EX3A 1WF1A 1YIJS 1PGZA 2DIVA 7FDRA 4BHQA 3RB3A 2IC3B 3LW5C 4OV1A 2YWEA 2M3DA 3K7RA 2L9NA 3HP6A 2JRSA 2QO3A 1BGXT 1U24A 3KK3A 4RWWA 3M6XA 4IOCQ 1RTJB 1BQMA 2U1AA 2EPIA 3HVAA 2HVHA 4QOTA 4YQWA 4PXCA 5KFHA 3SQGA 3TA2A 1VFJA 4CO3A 3LF0A 3DRPA 4OI3A 4KSEB 3RW6A 1KLNA 1KLMA 1M5KC 3IWNC 1C0UA 2JJ4D 2O67A 4FN5A 3BGRA 1UJ6A 1X9WA 3NAIA 4Y34A 4RNNA 1XMOF 2BBEA 2B9YA 5KFRA 5B08A 3WDOA 2C2RA 1RDRA 2KZMA 4OHXA 1N6QA 1HL6A 3Q24A 2QLWA 1UEUA 4GKKF 2V5HG 1WHVA 1HPZA 2XGPA 4QU7A 4F02A 3PRBA 2ASLA 1SKSA 4DSFA 2NS1B 3KLIB 2CKWA 2DPIA 5A8RA 3OHBA 2I1RA 2R4FA 3IG1B 4OZNA 3UR3C 2RQCA 2RS8A 1CLFA 4BC7A 1XK8A 5C42A 2RB7A 3D54A 1T8EA 5HROB 2MY8A 4NWBA 5L9NA 2ZC4A 4N41A 1MSWD 1SQEA 4IFVB 3IGVA 5F8GA 3SI8A 3V4IB 3QLHB 5HI7A 3F44A 2DO4A 5DQIA 3POTB 1DBDA 2XMTA 2YKQA 2ZH1A 3PEJA 2KB2A 1Q53A 2YKMA 2VA3A 3R5AA 2BXJA 1HMVB 4ECZA 4PKDB 1QM9A 1X9MA 5A2QY 1APSA 2R7UA 4ELUA 1S1VA 1WEZA 4R8UA 3OL8A 1FERA 1X7VA 3RBDA 3SCKE 2WSCC 2IRYA 5D78A 1YJRA 1SBRA 4H4MB 3PHEA 1HI0P 1FD2A 2G4BA 2KT2A 3L7PA 2DRAA 5BYSA 2ZJRQ 1SUQA 1PC5A 2LEPA 3MM5B 2VFRA 2J6TA 1Q86T 5DJBA 4W92B 3BGFA 4JV2A 2PMHA 3VQSA 4ES3A 5DDOC 2NUHA 2YX4A 2POKA 4P6QA 1VOMA 2Q6CA 5HQ8A 3MMCB 5A6WA 5IZHA 5DETA 4RW6B 4OX7A 1U6ZA 5FD1A 5B0CA 4O0IA 1D9FA 3SDEB 3THPA 3MMJA 1N54B 3B4MA 3R3TA 1XMBA 3HHLB 3UNGC 4EYHB 1YWXA 1RISA 2IM1A 4ECTA 2XNRA 3MUMP 4TKTA 3T5JA 1N52B 4C8YA 2MZSA 4C3KA 1ZM2A 1RTIA 1X4CA 3SFGA 1LWEB 5H9EJ 2K7KA 1OQ3A 1RA7A 4EBCA 1TR0A 1S99A 3MI7X 2YNIB 3HHEA 5L38A 1B64A 3GFHA 4MAKA 4RWXA 2LQ9A 2HWIA 1J5OA 3IGNA 3OTEA 4AFFA 4MK7A 4HI2A 4EFAC 1NEEA 4ITSA 5L1IA 1FKOB 4F26A 2DRBA 4C0BA 3FGVA 4NLGA 2HHWA 5J2MB 3W2WA 1YJVA 1FA0A 2MKKA 4J9MA 3W2VA 2ROPA 4Z37A 5DQGA 4CTAA 1H7WA 5AE3A 1UVNA 2MKIA 4WU2A 1HBNB 2XI3A 4I2PB 5I42B 1M5PC 1DTQB 3VF0B 1RYSA 2YH0A 4WFAQ 4DPOA 2IVYA 3VWSA 4ICLB