2RRBA

Refinement of rna binding domain in human tra2 beta protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
GPLGSRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the dual RNA-recognition modes of human Tra2-beta RRM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords cDNA FLJ40872 fis, clone TUTER2000283, highly similar to Hom
total genus 24
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rrbA01
2MKSA 3G8TA 2M70A 2DNOA 2LCWA 4C7QA 2M8DB 2MQNA 2PE8A 2MXYA 2Q79A 1YITS 2MKHA 2DNGA 3NNAA 1VQPS 3FEXB 1HD1A 3MDFA 2VOOA 2MQMA 4P6QA 1U1OA 1VC5A 2MKCA 2BOPA 1U1LA 5IFMA 1N88A 3H2VE 1X5SA 2CPYA 1JMTA 5JVGQ 1DRZA 1X4CA 3RW7A 3IRWP 4CIOA 5IM0B 2DGXA 2G1DA 4BS2A 2MQQA 2KHCA 4YB1P 2L9WA 4ED5A 3EX7B 2CQBA 5IM0A 3DXBA 2MKKA 2XB2D 2XS7A 4QPTA 4F02A 2CQIA 2M4MA 4WKRA 2MZJA 2OSRA 1FJCA 3G6ES 1X5PA 4EGLA 4YOEA 1FNXH 4WF9Q 4WFAQ 3HI9A 3VAGA 3N9UC 2CPDA 2HGLA 1P1TA 2HVZA 2ZJQQ 4Z2XA 3CMES 2N7CA 2F9DA 2KFYA 1G2EA 2I38A 1PO6A 2KYXA 2WBRA 2F9JA 4CH1A 3P49B 2MQPA 1D8ZA 5JVHQ 3L3CA 3B4MA 4PRFA 1SJFA 1VQ8S 1WHVA 1X4FA 3OW2R 3UD3P 2CQHA 2AYGA 1VQNS 2JWNA 3CCVS 2LA6A 1KQSR 3MURP 1VQ9S 2J0SD 3CCRS 2J8AA 1H2VZ 2CPHA 2M7SA 2MQLA 1X4DA 2CQ3A 2KVIA 2M52A 2LXIA 5GADU 3SDEB 1OO0B 1S79A 1WI8A 1WG1A 2LQ5A 5GVQA 3V4MA 1RKJA 3BS9A 2LA4A 3CTRA 1U1MA 2UP1A 3J7YU 3CC2S 2FPHX 1SXLA 4RU2A 2HYIB 2DGWA 4TU7A 5GAEU 5EN1A 2DNHA 1SJ3P 3H2UB 5DDRC 5CYJA 5GMKa 1YJWS 2OIHA 3R27A 5DDPC 1VC0A 2E5JA 1A7GE 2FC8A 1OIAA 2FC9A 1A9NB 2SXLA 3UWTA 1OPIA 3J7ZT 2RUGA 3VAMA 2AD9A 2VOPA 1IQTA 2QA4S 1WTBA 2LEBA 2MMYA 2DH7A 1WHXA 2MKIA 2VONA 5DETA 1QM9A 3U1LA 1Q82T 2N3LA 2JVRA 2E5GA 1WHWA 3US5A 4C4WA 3NS5A 4WFNQ 2J76E 1WF2A 2MY8A 1DHMA 4TLQA 4WFBQ 3CUNA 3D2WA 1HD0A 1U1RA 1D9AA 2DNKA 5HO4A 1ZZFA 2MGZA 1X4BA 5CXTA 4UQTA 2KRRA 1M1KT 1VQKS 3PIOQ 2U1AA 1N54B 1OWXA 1WELA 2DHXA 2MY7A 2B0GA 5LSLA 3CCMS 1K8AT 3MOJB 2BZ2A 3TO8A 2MKJA 1H2TZ 2FY1A 2CJKA 2CPEA 5DDOC 4IO9Q 1WF0A 2CPJA 3CMAS 2MPUA 2CQ0A 3NS6A 1SJ4P 1B7FA 2DO0A 2G0CA 2KRBA 2LXUA 2DNYA 2MZRA 3S8SA 5HL7Q 2LMIA 1ZH5A 2E5IA 2MGZB 1WHYA 2DHSA 1O0PA 5BJRA 2MB0B 1R8PA 3BO4A 3VAFA 2HZCA 2YH0A 2DNPA 2RVJA 2RQCA 3FEYB 1N8RT 2M0GB 1VBXA 5DM6Q 3NNHA 2MZTA 1U1KA 1DZ5A 2KI2A 3CXCR 2DNRA 3MD1A 1L3KA 2D9PA 4PR6A 2LECA 1YI2S 1UP1A 2EVZA 2CQ4A 3Q2SC 2ZJPQ 1UFWA 3S7RA 4TU9A 2CPIA 2L08A 1NJIT 2E5HA 2CPZA 2DISA 2I2YA 1SJRA 5H1SV 2ERRA 2JRSA 5FJ4A 4IOAQ 1YJNS 2KG1A 2RRAA 3P3DA 1HL6A 3Q2TC 2F3JA 1DBDA 2RQ4A 2DB1A 2KM8B 2CQ1A 2HGNA 1H2UX 1VBYA 5LXRA 5LXYA 4C0OC 3I56S 3ULHA 4TU8A 5CA5A 2DH8A 3SDEA 2LKZA 4LIRA 4M5DB 3BO3A 3RW6A 1X4AA 2OJ3A 1FHTA 2MZ1A 5IQQA 2CQGA 3R1LA 3IWNC 2RU3A 3G8SA 1NU4A 1XN9A 2M8HA 3UCUP 4OZ1A 1WG5A 1X4GA 2MYFA 2E44A 2XSFA 1X5TA 2CPFA 3MUTP 2XNRA 2DIUA 2YKAA 1BY9A 4Y0FA 2NZ4A 3VF0B 1KD1T 3SMZA 2AYMA 1YWXA 1UAWA 3G96A 2QFJA 2DNLA 2CQPA 3CCQS 3ZZYA 1HA1A 3UD4P 1U6BA 3SXLA 4A8XA 3CCUS 1WEZA 2J0QD 1U2FA 1FT8A 2K3KA 5GAHU 1Q7YT 2AYBA 3PIPQ 5D77A 3HHNB 1FJ7A 2DGVA 5LJ5Y 2KG0A 1CVJA 1QVGR 2GHPA 5MLCV 1H6KX 3CD6S 2MQOA 3UCGA 3G4SS 2G4BA 1M90T 2U2FA 4IUFA 2DIVA 4ERDA 1YIJS 5LSOA 3S6EA 3THTA 3P6YC 2DNMA 2DO4A 2PEHA 4WCEQ 2ADCA 1SJQA 2RT3A 2DGTA 2HGMA 2AYEA 3TYTA 1FJEB 2DGOA 1K9MT 2MHNA 3K0JA 2XS5A 4LMZA 2DH9A 2M2BA 2DGUA 5ITHA 4PKDB 4QU7A 2O3DA 3THPA 3CCLS 2YTCA 2KH9A 1X0FA 4J5OA 2QEXS 4ZKAA 2KXFA 1P27B 1W2BR 2N3OA 2X1AA 1K73T 2RS8A 3VAHA 1WWHA 1VC6A 1VQ5S 3VAKA 2XNQA 2DNZA 3BEGB 3CC4S 1URNA 4YUDA 3G9CA 1JJ2R 1YJ9S 2RNEA 2MJUA 1WG4A 3LQVA 3EGZA 4U67Q 1X5OA 2L41A 2V94A 1U6FA 2RRBA 2NLWA 3VAJA 2DK2A 3CCSS 4V19X 1VBZA 2X1GA 5DDQC 4W92B 3CCES 2KU7A 3MD3A 1FXLA 5D78A 1KC8T 3MXHP 2ADBA 3CULA 1X4HA 2ZJRQ 2LYVA 4Y00A 1WEYA 1Q86T 1WI6A 2OTLS 3NMRA 3B4DA 4OZ0A 2EK6A 2DGSA 1ZZNA 1WEXA 1YTYA 1U1NA 3MI7X 3CC7S 2D9OA 4QQBA 3UCZP 1R8HA 4W90B 1VQ4S 1S72S 3CCJS 3CF5Q 2DITA 1NO8A 4UY8T 4IOCQ 1RK8A 2CQDA 1JJHA 3JB9k 3LPYA 2YWKA 3BO2A 1PGZA 1KOOA 3EGNA 2MZSA 1JJ4A 1FO1A 2A3JA 3NNCA 3S01A 1VQMS 2JVOA 3MUMP 2CQCA 5GAGU 1KOHA 2KM8C 1AUDA 4CH0S 2D3OR 2GO9A 3VAIA 2M9KA 2JX2A 2XS2A 4FXVA 3UE2A 5DM7Q 1M5VC 2DHAA 1M5OC 2N82B 1N52B 1U1PA 3TP2A 4QU6A 1WF1A 3MUVP 2DNQA 3VALA 4LJMA 2KXHA 2CQ2A 3P5TL 1YHQS 3U1MA 2DNNA 1M5PC 2YH1A 2MSSA 2OTJS 2KN4A 2M88A 2MJNA 4FXWA 3I55S 1X4EA 5LJ3Y 1Q81T 2CPXA 4F26A 1VQ6S 3R1HA 2LEAA 1VQ7S 2MSTA 3ZZZA 2X1FA 2VODA 4WIIA 2DGQA 2DHGA 1U1QA 1F9FA 1VQLS 2EK1A 2FHOB 2K8GA 2X1BA 1UW4A 2OSQA 2RS2A 4F25A 1M5KC 1QVFR 3DLLQ 2KXNB 3CPWR 3G71S 4CQ1A 1VQOS 2KT5A 2MZQA
chains in the Genus database with same CATH superfamily
3P8BB 2M70A 4LF9J 2DNOA 2LCWA 4X66F 3D0GE 2ZH4A 2DRBA 2M8DB 3FRYA 2MXYA 2R8KA 3UN2A 3RRGA 1F5BA 2FZCB 2DNGA 4H4MB 4F0MA 2R7RA 2V8HA 3ENQA 3H2LA 4L6V3 4M5KA 4USTA 1S99A 5D0GA 1WOSA 2IVMA 2B8QA 4R5PA 3UQSA 4IRCA 1Y4ZB 4WE1B 4PQAA 4CLFA 2MKCA 4DR5F 2Z58B 1JLQA 1SQGA 3I4HX 3M6WA 5IFMA 3PRVA 4J9KA 1YBUA 1F3VA 1SQEA 3HHLD 3O3LA 1VYAA 2ZC4A 3G82A 4B9VA 1X4CA 2VFSA 5KG2A 3TWZA 3IRXA 3D1QA 5KFOA 4CIOA 1PJ5A 1FDNA 2RF2A 3JSBA 3H20A 2Z57B 2DGXA 4UUWA 3MECA 3TX0A 4FPRA 4A8QA 4AQYJ 3RAQA 2YPZA 4B3TJ 3QRRA 4GO5X 4YB1P 2H4YB 1CJTB 2G2ZA 2L9WA 3T9NA 5GAGI 4ED5A 2CQBA 4RW4B 1XIQA 3KFWX 2MKKA 3W8PA 2JDJA 2M4MA 4WKRA 2MZJA 1S4FA 1NM2A 2VU5A 1FI4A 1TAQA 2AHOB 2HHXA 1HBNB 1X5PA 4K2JA 4EGLA 2QMUB 5CYMB 1KLMA 4NLUA 1UEUA 1UWBA 3DNCA 2HHSA 4WF9Q 2DRAA 1EP4B 2QO3A 3C2PA 4HACA 2QGFB 1TKZB 2HVZA 2VDIA 3L7UA 4HHUA 4USUA 4EI2A 1HWIA 2KFNA 1JWWA 4LF8F 2UUAJ 2E5LF 3HDSA 3HHLC 2YXLA 3NG8A 1NDCA 1LWCB 4NLWA 1OYDA 1VQSA 3BPDA 4ZP9A 1KONA 2PGCA 2XHWA 5U47A 1I1GA 1QAYA 4ZDNA 1CC8A 2HHWA 5CYMA 1Q4RA 1A0OB 4CH1A 3MWBA 2GQ2A 2UU9J 5JVHQ 1HR0J 3L3CA 2HHUA 3B4MA 4D3GA 3V6DB 4PRFA 2NXNA 4PWWA 4ES3A 4UY85 3IM9A 1VQ8S 3H90A 3UD3P 1RAJA 3DLJA 3VVTA 2DR9A 1N5SA 1B0TA 5FLXY 4DCPB 2IM3A 3GV7B 4ED8A 5IT9U 2B4OA 3PY8A 2VBZA 4ZVGA 3GP9A 3ISND 3ADAC 4PZVA 2LA6A 4OHWA 6FD1A 2WAQD 4MK7A 2BW7A 2GIFA 3WBZA 1RT6B 3BH6B 4QIWD 1S49A 1WDTA 2HK3A 1HNXF 3TEHB 4X64F 2OELA 1FTRA 2J8AA 3GYXB 3QMQA 4HEA9 1F9EB 2ZZTA 4P7VA 4DL4A 4JOUA 3BGFA 4LRFA 3MPDA 4K0KF 3AB4B 1HKAA 2FJWA 3V6KA 1N34J 4R5PB 3J80Y 1HQUA 3OSNA 2BX6A 4FYWB 5C2CA 1EZZB 1ZM3A 3M8RA 3MEGB 2FJEB 4J9QA 5HQ8A 1JB0C 2IDLA 2LQ5A 3I0RB 4G1PA 1RABB 4ELTA 4OYMA 3BS9A 3DRXA 3CTRA 4JI0J 1DQ8A 1I94F 4LF4J 1WOOA 2WZ1A 5KFWA 2R2RA 2V69A 4RUAA 3J7YU 1EIYB 3CSKA 4F67A 1SIWB 2O67A 2J8SA 1TK5A 1RYSA 1H0HB 2HYIB 5KT5A 2CUYA 2X3GA 5C2GA 4OZ2A 3EUNA 2JHEA 2LVWA 4PQUA 4B3TF 2A6MA 1FRIA 2BE2A 3NY0A 2GO8A 1AFIA 1EP4A 2KJWA 3RU0A 4DQPA 1YQHA 5T7LA 2IM2A 3OHBA 2RILA 2Y9HA 1LOUA 1VC0A 1RT5B 2WSCC 1N5TA 1A7GE 4L76A 2RU9A 2FC9A 4P74A 1A9NB 4DV4F 3W3SA 3ICLA 2I6WA 5DGBA 2VOPA 1IQTA 3NS7B 3PACA 4OYAA 4P2SA 1RHJB 4LSZB 4NMXA 4DSJA 1Y11A 3TJ8A 4DPXA 1HNVB 1Y00A 4OJ1A 4U8YA 4Q7AA 5ETNA 5DETA 4ED2A 3M8WA 4A8FA 4DV0J 2P9EA 5F8HA 1D8YA 2UUAF 4RU9A 3QGPA 3IAM9 3EDQB 1GMWA 1V3RA 2QMWA 1HQEA 4RW9B 4WWSA 4Y3CA 3T5LA 3H5UA 4WBFA 5K5MA 3R9LA 3NS5A 4C4WA 3QGIA 2VL1A 4PWUA 1S1XA 2R8GA 2RHQB 1HBMA 3GJTB 3HT0A 4K8RA 4K5SA 4MK8A 4Z7YA 3SQOP 3MMBB 3DDIA 2R9LA 1B7YB 1VCTA 3MAHA 3AA9A 3PRBA 3Q86A 3K8WA 5B0DA 1PBUA 5KTQA 2E66A 1ZZFA 4OI2A 5KFHA 1IUJA 1U8SA 2XYHB 3HD2A 4TY8A 3RUBL 4NOHA 3PNIA 4LFBJ 3W9IA 4JI7F 3KJQB 2C3YA 3JYTB 4Y2KA 1OYEA 3EZUA 3HZEA 3K89A 1SIZA 5A8KB 3LOUA 1N54B 3IXQA 4P10A 4RL1A 1GMVA 2B0GA 2XMWA 3KK3B 1T9UA 1JNZB 3W2VB 2VFRA 4FF1A 3KJFB 1HHSA 4B3OB 1LV5A 5T41A 3TAQA 3PTWA 1YBTA 2CPEA 4CTAA 4FXDA 3CDBA 3H8YA 3AQPA 2OLWA 4F4WA 3TX8A 4DR3F 2HG4A 2R3VA 1S4EA 2P2CB 3W8GA 3W63A 4XPEA 3QJJA 2EW9A 4ZPBA 4KGZB 3HFZB 3OFEA 3PKYA 4RW7B 3C6UA 3NCRA 4NCGA 1MG7A 1JXVA 2JJ4D 3DRRA 3TUJC 1IKYB 3ZTRA 3VGTA 1X0PA 2BV3A 3LGMA 2DNYA 2ZZNA 2YQ0A 4PABA 2CRLA 3IS9A 2RQMA 1JK9B 4U8VA 2LMIA 3P45B 3Q0AA 3QRQA 1NPPA 3DM2B 4ED1A 4UOCA 3CGIA 4J9OA 4DLEA 3TANA 4PWDA 4YMEA 3M8YA 2IFXA 2VFTA 2W2PP 1RCOB 3LW5C 3KK1B 2E5LJ 5HN0A 4LBIA 1XR5A 4O3NA 3KMSA 2PSZA 2FYXA 2FZGB 1T02A 2CVEA 4RX6A 2DNPA 2GVZA 3ISZA 4WFYA 2PI5A 2RQCA 3UNGC 3KLHB 2Z2ZA 3ET6B 4EWTA 5DM6Q 1VBXA 1SCJB 3OTCA 4LF5F 2R7QA 3RBEA 3NNHA 4Y2MA 2XM3A 1OSCA 2VG5B 2K06A 1FXDA 4MMOA 4USMA 1DZ5A 3D67A 1TR0A 4C9DA 5KT2A 2IYIA 2Z0GA 3CVKA 3MEEA 5AE3A 3CXCR 3DLGB 3K2YA 2ZZMA 1U7LA 2LECA 3KUHA 2C22A 3TZYA 4ZCKA 3OVAA 1EETB 2CQ4A 4X64J 1O51A 1H72C 5KFYA 4AT1B 1R7IA 4B3MJ 1S1TA 2CPIA 2VD3A 1RAOA 2CJAA 4J90A 4OJHA 3OVBA 2OMLA 1S1UB 2CG8A 1NJIT 2V8VA 2CPZA 1SBRA 2CJYB 2FHMA 2IIHA 3H5YA 4X4VA 3A3OB 2YX1A 1YJNS 4IOAQ 3OR2B 3O8WA 1HL6A 1Z2LA 1N34F 1BD6A 4CLWA 2F3JA 2EC0A 1JXEA 2CYYA 4YB7A 3X3UA 4YHHF 2XQCA 1XTZA 1NSKL 2XMJA 1WKKA 2BKOA 3PDNA 4FNHA 1RT4B 3TJ9A 4Q44A 1Q79A 4ECSA 1B0VA 1PAUB 2IM0A 2VQEF 4PUOA 1JLAA 2NCKL 4USJC 3GR1A 4IG3B 2AMCB 3CE8A 2HS0A 2ACMA 3I56S 4FS2A 4TU8A 3PHTA 3PM9A 5C42B 8RUCA 2FDNA 2D1CA 3GIKA 4M5DB 4F0HA 2HMIA 1SQFA 1RAHB 2K2PA 2OPPB 1TV6A 3CWJA 4U7UK 1S97A 4EEYA 4M5HA 2OJ3A 2PD1A 3W2WB 2WVCA 1R0BG 3NAHA 3D6HB 3TEGA 1I3OB 5M2UA 4O3OA 4DV7F 3HM9A 4KO0A 1C1BA 2BJ3A 2HFZA 1NSQA 3W64A 3G8SA 3T1YJ 1ULRA 1TFYA 2M8HA 3UCUP 1S48A 1ZPVA 4Y6IA 5AXLA 5KFKA 4DSIA 1X4GA 4ZOSA 3GPAA 2BJEA 5A8RA 2E7XA 1IBLJ 4F4KA 3OQ2A 1X5TA 3SV4A 2IHR1 3BPSP 3DMJB 2YKAA 2W25A 3CJSA 5L1LA 2HVDA 3H5SA 2EXUA 4PPDA 2GJ2A 3AD9C 3IAS9 4W98A 2HFNA 4U95A 1KD1T 2J6UA 3LF0A 1SJ1A 4RJVA 4OX8A 4OYBA 1UJ4A 4KH0B 2OHDA 2HFOA 1HHTP 4LRDA 1VRUA 2HQDA 5E2QA 4CYUA 6FDRA 4URSA 5AJ3J 1RWNB 2CQPA 4OYIA 5A6WA 2BQUA 2UVUA 3DLBA 1RWPB 2HPUA 4MK9A 1UVLA 2VHGA 3FEZA 2QG9B 2ILYA 3THVA 2Y0SD 5G0RA 2OD4A 1N4LA 3CCUS 2V9WA 1S6QA 2J0QD 1FT8A 2CDQA 5GAHU 2BQ3A 2FVRA 1VHIA 1S1TB 2WVBA 3M1VA 4BCAA 2ZM6F 4DCJB 4KGKA 3D0HE 3R5CA 5D77A 2OH2A 2DGVA 2VC1A 4B3SJ 4ETZA 1UPPA 3FKBA 2GMHA 2CZVC 1QVGR 1IBKF 4LR7A 4LREA 4CM0A 1RHUB 4USKA 3OSPA 1QE1B 2GW8A 1WTFA 4QIEA 3BN7A 4ZVRB 1U47A 5FLXU 4F4YA 3K57A 2VG7A 1M90T 1V9OA 2JC1A 4JBCA 2GGPA 4X4PA 4WTOB 3MM5B 2DNMA 1RISA 5D0RA 3VGUA 3RAXA 1QY7A 3BYPA 2VPWB 4ZCIA 2XSJB 1LW0B 2RT3A 4KC5A 3OR1B 4QYRA 3MM5A 1RCXB 2AYEA 4RW6B 5J2NB 4Q8EA 3OL6A 5D8HB 4I6YA 4UOFA 3ENWA 1XK8A 2DGOA 4KV8B 5KT6A 1DJ0A 2ZWOA 1FXRA 3ZC4A 1JLCB 1P9QC 4QBUA 3OFFA 1VK8A 3JQJA 2XS5A 1YSJA 4I6AA 3KHGA 5J2QA 2AGPA 4CNYA 1NK0A 5EWEA 1VIOA 2VUGA 5IWAF 1S0NA 1FX2A 4PKDB 2DR8A 5J2QB 4DUYJ 4F04B 2FJAB 4QU7A 1FJGF 3MM6A 3ZZ0A 1P9YA 4QJVA 4U7CA 3OL8A 3CCLS 2PDAA 1FFSB 2YTCA 1GXTA 3UO0A 1Z1ZA 2RAQA 2B5JB 4ZKAA 4DV7J 5KFFA 1LNQA 4J9MA 1HNWJ 1DFDA 1BWVA 1UMJA 2DXFA 4OYOA 1W2BR 2CAJA 2VICA 1APSA 2N3OA 1YG0A 1SKRA 2EFVA 3IM8A 1FWKA 1VOMA 2X1AA 3KMQA 3X1LB 1VS3A 3V4IB 4QWBA 3VAHA 1QTMA 4B3OA 1WWHA 3OXFA 1X60A 2VIHA 1KLNA 5GMDA 3BEGB 4BWMA 2WTFA 3ENAA 4YUDA 1XWLA 1VJWA 3UVJA 2ZE2B 2CNKB 3MR3A 3K59A 1NK5A 2ZFHA 5E3PA 1AB8A 3CJ8A 2E1CA 4FF2A 2B6AB 2IDEA 1WG4A 5F3ZA 5AT1B 4DQRA 3EGZA 1W26A 4QWAA 4GO7X 1X5OA 3U7JA 3MMCB 1S10A 1GX5A 1P1LA 2DK2A 4V19X 3GFHA 4I68A 4KV8A 1C0TA 2XGPA 1T03B 1R31A 2HKEA 1B4SA 1FXLA 5D78A 1KC8T 3CJ2A 1D3WA 3EVMA 4QWEA 1NKCA 2KYZA 3A8IA 2UVRA 3BDPA 2UV8A 5FDLB 1ROFA 1YBAA 2OTLS 1Q86T 2UUBF 3OLBA 3L95X 2KZZA 1U25A 1LW2A 1WC6A 2GGPB 3MEKA 3K58A 4DS5A 3T5HA 4OZ0A 1HNIB 1SH3A 2E1MC 3BM7A 1ZZNA 3UFCX 4ZVUB 4LF8J 4JI1F 3MI7X 2D9OA 3AT1B 3LP2B 4QQBA 3I5AA 3KJVA 2A18A 2RB7A 1R8HA 3C14B 3HJVA 1VQPS 4OIXA 1VQ4S 4KPYA 4Y2AA 4W90B 4BLGA 1MNEA 1GAOA 2DITA 3JXOA 3R6LB 5ETTA 3V6DA 1FA0A 4NCBA 4UY8T 3CO9A 2GZOA 1RT5A 1K0VA 2CQDA 5D15A 4AL7A 4K7QA 2PFFB 4J37A 5HMXA 1KS2A 4HT5A 5SZTA 4ED0A 3GJSB 1T9VA 4K4WA 2C3PA 2XMUA 2VA2A 4IDKB 3K5PA 2MZSA 1XNQF 4BC7A 2L9NA 2W9BA 1ACMB 1CSJA 2AEMA 1F0XA 1FO1A 1RBAA 2WVFA 4CLZA 5J1PA 4A8YA 1VQMS 2HBRB 2UUCF 3NNCA 4EUVA 1X7VA 1BUXA 2GO9A 3CO0P 2A1BA 3FGVA 2F4FA 4YDXA 2XS2A 2R7VA 4FXVA 5DM7Q 3Q23A 4WP8A 3C15B 3JTNA 1PC4A 1QTNB 1N52B 2QLFB 5D3GB 3O1LA 4LF7J 2WOMB 5EX3A 1DTTA 2XI3A 3MCMA 3SI8A 1DQ9A 2K1RA 3BN4A 1WC5A 1K1QA 2C2ZB 3RZAA 3W9HA 3GU0A 5AE2A 2H5EA 4HH0A 3KHRA 4E0DA 2IAJB 2DY1A 2ALZA 1LXNA 2E29A 3OFHA 5HATA 2BQRA 4F0KA 2GJIA 3K5OA 1KWMA 2ZBCA 2V50A 3I55S 3DCAA 2ZM6J 5LL6d 3NKYA 5IT0A 5GADI 4ID5A 5MAOA 3R1HA 4ZJOA 2OPQB 3C16A 3GE9A 2X1FA 4ZPWR 3GONA 4PEOA 2HIYA 2HNZA 4BBYA 1XMOF 3O6QA 2AJFE 1U1QA 1XMQJ 4MKYA 4DR7F 2N4CA 3UDVA 4TQSA 4FBTA 3GCXP 3SIPB 3N28A 3NGUA 5HVHA 3RB3A 3H42A 4DOZA 3H5XA 2PN6A 4H4MA 3M6XA 1RT4A 1UW4A 2OSQA 2R4FA 3IO1A 3DOLB 4DX5A 3J80U 2C2RA 4DXLA 3L9ZA 3H7HB 2W8KA 4F8RA 1FWPA 4DUTA 1TL5A 4OHXA 4DG1B 2FD2A 3DXSX 3KJVB 2V63A 1BC6A 3I0SB 4C2MA 3MOZA 1M5OC 4PG6A 3HO1A 2Z56B 3M2RA 3MPVA 4OX7A 1AW0A 2MQNA 2PE8A 3MPUB 4A8MP 2H4WB 4RLEA 1V5VA 3W2VA 1FX4A 2J9CA 1KTQA 4HTJA 4NXMJ 4IRKA 1XR7A 8ATCB 3HK2A 2GV1A 3MAAB 3QO9B 3NNAA 2ABYA 3MDFA 1FVSA 4ZPCA 5FDLA 5IC4B 1U1OA 1CJKB 4M63A 3NGKA 3EZ5A 1NH7A 3MR2A 1GMWD 1HARA 1U1LA 3FRZA 3DRSA 1X5SA 1HBNA 1JMTA 3A1YG 4OFZA 5I3QA 4K4UA 2UV8G 5H9EK 1D0EA 2WCXA 3DRRB 2XY5A 3HKZD 4NLOA 3MMBA 1M5HA 2ZVIA 3C14A 2VKRA 1YDLA 2C42A 4W4MA 4HH1A 4JV2A 2Q43A 2KHCA 1TL4A 2UU9F 3PKMA 1RYRA 2F5GA 4RW9A 4F2RA 3L7OA 3OTOF 1XC9A 2B9XA 2VDHA 4P2MA 2XB2D 1FE4A 4NYOA 3MF5A 4WU2A 5DJBA 3VTIA 4F36A 1T95A 1Y3JA 1GX6A 2OSRA 1RT1A 2HK2A 3CIMA 3R5GA 3TNVA 4ICLA 2AJ4A 3AODA 1FF2A 3L09A 4KSEB 1S1WB 3ZZUA 5A8WA 1LFWA 4LF7F 4YOEA 1FNXH 3QWPA 3TVKA 2ZOMA 1BQNB 4WFAQ 4WPAA 2ZH1A 1FWLA 2FY8A 1RLCL 3GLJA 3NXZA 3QFWA 4XAKA 5F3TA 4Q0BA 1TVRB 1TMJA 1P1TA 5FD1A 1IKYA 2ZJQQ 3PW4A 2W7PA 3QRPA 5E3RA 3KK2A 1QLNA 3CMES 3C6UB 1BHNA 2N7CA 5JJBA 2F9DA 4ITSA 4RWXA 1G2EA 1AFJA 1TVRA 2VBYA 2YKOA 4RNMA 4O44A 5B0GA 2ZE2A 2QYGA 4D3HA 2KYXA 1LWFA 1RT3A 5IS2A 2QL7B 3M32A 3AH6A 4U9RA 5ETSA 1N5YB 4PYAA 4ZIVA 2HNDA 2AEJA 2WB4A 3M9OB 2BE7D 2HZVA 2POKA 3W62A 2Y8YA 2LDIA 3M2UB 2YKNB 1HQEB 1N0UA 2HURA 2HNDB 3W5ZA 1WHVA 1X4FA 2DCLA 1EQ0A 3DYAB 5EDWA 1HIYA 3RRHA 1RI7A 1BLUA 1TUVA 5HQLA 4JI1J 1SL1A 2AYGA 1VQNS 1OSDA 3CCVS 2O01C 4IH5A 1U0HB 4IQXA 3CT9A 3MURP 5C25B 1GFWB 3CMQA 2K7JA 4QR2A 2V67A 4P2FA 3D3BJ 3KLVA 4WYLA 2ASYA 1CJVA 1FD2A 3BKTA 3MCNA 4OYPA 2W2OP 3D6TB 4MIBA 2ROGA 4FS1A 1UA0A 1HR0F 4EZ9A 1H2VZ 5C25A 4O0IA 1TUGB 2CPHA 2GJFA 1YRUA 3VGVA 3J7A1 1XJWB 4G1IA 3BSOA 1CJKA 3MTKA 2CQ3A 4HVZA 2FUG9 1TL3B 4KHMA 2KVIA 2HHTA 3QGHA 1QUPA 1T7PA 4DX8H 2LXIA 3A8EA 1JLGB 1NLKL 2H5IB 1RWUA 4NA3A 4U96A 3SDEB 1OO0B 3VQSA 5CD4A 3KLIA 4PXDA 3V4MA 3FZBA 3I82A 4X66J 4DL2A 4KIAA 5BYRA 4P72A 2C2NA 5EUHA 3RR7A 4JI3F 1U1MA 4NXNF 2V2ZA 2MDAA 5KOWA 1TZ0A 3M32B 3O2IA 3CC2S 3UI3A 4ILMA 2DCUB 2FPHX 4A4JA 4DG1A 4RBVA 4RU2A 5HP1A 5M2RA 1TKTB 3QPIA 2G1HA 3SFUA 2ATCB 2EI5A 2P6SA 3OBIA 5EN1A 1HPZA 4URGA 3PO4A 4WXWA 5HJYA 3JSRA 5CYJA 2VH7A 3SZ2A 4ZVEA 1DLOA 2QLJB 1AROP 3WDOA 3M8PA 4CH7A 3R27A 3DU6A 5DDPC 5KFLA 2I8EA 1RAGB 4N76A 2P9CA 1OIAA 2J6SA 2BW2A 1OPIA 3VHQA 4Y2IA 2RUGA 3VAMA 5G0RB 1C1BB 1R27B 1UFLA 2OGUA 2QA4S 1WTBA 1QJHA 1GXLA 3RB4A 3BF4A 1IR1A 4ZPTR 2MKIA 2JEFA 2VONA 4WTYA 4B08A 3PYFA 1X8DA 3ETOA 1TV6B 1FESA 3AHPA 2GIRA 3T1AA 1GQEA 1RT2B 3NCPA 3PCOB 2JVRA 3K5MA 1Y9OA 2WONA 2YX7A 4G65A 1S12A 2AV5A 4NLXA 2BKNA 3D4JA 3QWUA 2J9DE 1FKPA 4ZVQB 3L4BC 4WFNQ 2J76E 1WF2A 2MY8A 3DMJA 2V9KA 4DV4J 1O8BA 1RWXB 5KFIA 1JIHA 1KKHA 1S0VA 4O4GA 3CUNA 2DR5A 1B99A 5BR8J 4USHA 1U1RA 4X4NA 4L73A 1XNQJ 3IMQJ 2HQIA 3QT8A 4DR4J 1AYEA 4ZHRB 2OUGA 3PEJA 1CLFA 4J9RA 1ZPWX 3MR5A 3KTQA 3UW1A 4DV6F 1U8WA 1UA1A 1UL3A 2NQPA 4X2BA 1FRHA 3TW0A 4EBEA 2DHXA 1WELA 2MY7A 3B78A 3WZ0A 1D09B 3H40A 3MR6A 4USIA 1WKLA 3W9JA 5KG7A 3CCMS 3HLUA 2BZ2A 5K9FA 3TO8A 4MH8A 2CJ9A 2QE5A 2YX4A 3NGTA 5KT3A 4I2QA 3CDWA 4DV3J 1UTAA 2E9RX 1D9DA 3B6BA 2GQQA 3N6NA 5JUMA 3VV2B 3PW5A 2H51B 2CKWA 1GH8A 2LFVA 3TQ1A 1BQMB 1U4BA 3CMAS 4QWDA 5HJXA 1QSYA 1MN7A 2CQ0A 1SJ4P 4A8WA 2XBPA 3MEDA 3JSMA 3CEDA 4I56A 2LXUA 2C2KB 2ACYA 2LP4A 1KDNA 5KFJA 4JI3J 2BANA 3K5LA 1TL3A 3Q8PB 4F3OA 2MZRA 3ITHB 4KAIA 5LMNJ 1G4CA 1Q0NA 5B7WA 1ZH5A 4JYAJ 3TZXA 1KN6A 1HHQA 2E5IA 5HK4A 1H7WA 1WHYA 3HSJA 4MIAA 1KVKA 4K4ZA 4S0MA 4Q43A 1S5ZA 3LP2A 1DTQB 2HZCA 1FEHA 2RVJA 2YNFB 1RTIB 3FEYB 4XDDA 4IFYB 1N8RT 2M0GB 2V34A 4FP9A 4ECQA 4DR3J 4ECVA 4C8ZA 3DYAA 1T9TA 2RF2B 1LWEB 3VZIA 3IG1A 3TAPA 1U1KA 3OVSA 1TAUA 2RDDA 5E3CA 3TAMB 1KFSA 2W7AA 3M2VB 1CJUB 2YKMA 3A3PB 4HDHA 3Q22A 2DNRA 2GMLA 2YWWA 4P9SA 1VIXA 5M2PA 1L3KA 2D9PA 2AJ0A 2V8PA 3GB0A 1JKHA 1KNZA 1RT3B 2DBBA 3EXYA 4RNOA 3B8HA 1R8CA 3V5RA 1UFWA 4C0BA 4DR2J 5H9EJ 4IFVA 2CFXA 4NI2A 1WSVA 1WC4A 2PA8D 3SV3A 1HBUB 2GFFA 4M5JA 2HHHF 2E5HA 2HAFA 4DX6A 2B6AA 2ZH6A 4ELVA 4NE9C 4KHPJ 2I2YA 1NXIA 5J1EA 3LPEA 2JRSA 4ZP7A 2ERRA 2D3UA 5FJ4A 1BQNA 2KG1A 2BJ1A 2OD6A 3P3DA 5KT7A 4C3KA 3HVRA 2ZNYA 3PX0A 2V4JB 1RTJA 4IFVB 3EZOA 1VGYA 4NWBA 3GQCA 3VCDA 3NL0A 1U6ZA 2CQ1A 2G9OA 3MUMP 5D4LA 1LEOA 3CDEA 3I5BA 2KHDA 2XSJA 4C8MA 2VBWA 3OR1A 4JI6F 5LXYA 4Q5VA 4AL5A 1CPZA 3OTBA 1FK9A 2B56A 4OZ5A 3ULHA 4DZDA 1AXQA 4C8YA 1RLDA 1LWEA 4CT8A 1N6QB 2LKZA 3SDEA 5LM7E 1SV5A 5AXNA 2QMXA 3HFKA 2Y0BB 4TN2A 3AOBA 3LGNA 2GIQA 3BSCA 5G4DA 5IV4A 3UDCA 4CM2A 1KEKA 3BO3A 1HNZJ 4M94A 2DEJA 1RU2A 3MMCA 1LFPA 4OYWA 3WIVA 2KT3A 2RKIB 4WJBA 2JSXA 1FRMA 3AY0A 3R1LA 1NU4A 3NMAA 2ZUGA 1HMVB 1XN9A 3LTOA 1TKDA 2VG6B 1V5IB 2DR7A 1SV5B 2FJDB 1WG5A 3N0VA 1Q5YA 5F0UA 5KFUA 3A12A 2LQJA 4IOBA 3AD7C 4GRSA 5F8GA 2Z2MA 3M30B 5JMNA 3A3NB 3GR0A 1PYTA 4RZRA 2I0XA 3MTJA 8AT1B 3HJFA 4NEYA 4I6WA 3TUZC 1RBOB 2C28A 3SMZA 3PR4A 1UWAA 3IBWA 4DUZF 3M2VA 4LVOP 2ZITA 2WBMA 2V4JA 3BQ2A 3BBFA 5L46A 2V2VA 3CJTA 2JEGA 4I67A 4MIWA 5D4OA 4Q8FA 3R97A 1CC7A 2DKOB 5L8RC 3ZTSA 4PYDA 1O6XA 3ZZOA 1NMEB 4A8SA 3UD4P 5I42A 3SXLA 4QWCA 1X9MA 1S1VA 4V19J 4QIFA 1Y5LB 2FLOA 2BYCA 4NPOA 5BR8F 1NJXA 1LKZA 3PW7A 4NI2B 3DOMB 4N7TA 4C11B 3N5BA 4DR4F 1HQUB 1IKVA 2G2YA 5LJ5Y 4YR0A 4ID5B 3EGVA 5ETOA 3Q8QB 3MCSA 3A8JA 1WOPA 3W61A 4CYUB 5MLCV 2MQOA 3AJ2A 5GMEA 3G4SS 3M4XA 3GCWP 4Q45A 2YKMB 2WSEC 3DRPB 4FVMA 3ZFVA 3KLFA 3PX4A 1NB7A 2AF6A 2DIVA 2RQKA 4F3QA 4X4RA 5I3UA 3S6EA 5KFAA 3THTA 5DQIA 1YIJS 1S57A 4LBHA 1NKEA 1IKXA 2NSBA 5HMYA 1FJCA 2PEHA 3M9MB 5IQ6A 1C4CA 4Y34A 4P52A 4G6VB 1SJQA 1U6BA 4TVAB 1HNVA 5L1JA 5D3GA 2R2TA 1GMUA 1FJEB 4B9SA 1HI8A 2XTJP 3DRPA 4HR2A 1JLBA 3H0PA 3I9V9 1CULA 4NA2A 5CQGA 3KLFB 1FKAF 1K9MT 1UVMA 3K0JA 4OZ3A 1F3FA 4PCQA 3TRGA 4X4QA 2DH9A 2NSCA 3WHIA 4F4XA 3PVXA 1X9SA 2XLKA 4C6AA 3LO3A 1SPBP 2HIQA 4KT0C 5KFMA 3EYZA 4ED6A 2W9BB 4DSEA 1L3TA 5I4MA 5ITHA 3BGOP 2F8MA 2JEJA 3MGJA 4NLDA 3TR5A 4FYDA 3THPA 3DLEA 3EPIA 2ZKUA 1YGYA 4DFPA 3MEDB 3DRYA 1LK7A 2IY5B 3PW2A 3EDRB 4ZHRA 1X0FA 3BYRA 1X31C 2BACA 2B8PA 3M2RB 3C66A 2QEXS 3GSIA 1T9XA 5J2MB 2CIMA 3H98A 3POTA 3KLEB 1SKSA 2H54B 5F8LA 1YJRA 2OEMA 2AKWB 3PYDA 4K4VA 5D4PA 3PFEA 5CHCB 1A6LA 2RS8A 3I5CA 3Q8YA 2QV6A 3TQEA 4ZLLA 5CAAA 2D74B 4RR5A 3TZZA 2IJNA 2W9AA 3GSDA 2RNEA 3FC9A 3KLHA 5DG8A 3KHLA 4DL7A 4OI0A 3CD7A 4U67Q 1U6FA 5CYQB 2NLWA 3T41A 2AZ3A 4ZITA 3VAJA 4DDFA 3SSRA 2X1GA 5DDQC 4OI6A 1VBZA 2BM1A 4BHQA 2P8IA 3MD3A 1M1HA 2XCAA 3HHLA 4FF4A 3EM1A 1UWBB 3MXHP 1ZM9A 2ADBA 4YFUA 3DLGA 1EAYC 4CLLA 3HXMA 2N7YA 2H5JB 1MMLA 2LYVA 4Y00A 4DPWA 5J2PB 4FNIA 1CJVB 1REVA 1WI6A 4MJKA 3D1OA 2JEIA 2HNYB 2VBXA 3ZXWA 3NMRA 1F1BB 1HPZB 3OXGA 4UUXA 2EK6A 2DGSA 2FHJD 2WSFC 1YZ6A 3DN9A 4EU0A 2X3DA 1YTYA 1T9WA 4I0WA 1OQ3A 2C2DA 4I64A 5RUBA 2F8HA 2ASDA 1YJVA 1VMBA 4H4KA 3FCHA 4IG0A 3RGIA 1HW8A 1URRA 3NWRA 2ILZA 2PMZD 3W66A 3VVUA 1NO8A 3M2UA 3O44A 4X62F 1T05B 3AOAA 3NBPB 3KLIB 3ZZRA 1JJHA 5KFBA 3JB9k 4LF6J 2YWKA 3BO2A 4C3MA 1KOOA 3QYYA 4JI5F 2CWKA 2ZEJA 4OMFG 4J7CA 1I51B 4DU8A 2VFVA 3N6LA 2JLFA 3LWLA 3JYTA 2B4VA 1EARA 5A8KA 7AT1B 1MROB 3S01A 4NYPA 2JVOA 1KOHA 2CVIA 5HBMB 3D66A 4U6PA 1AUDA 1KLMB 3Q8RB 4ILLA 4WZQA 2UUBJ 1XMOJ 3SYZA 2ZHOA 5A6PA 2JX2A 2XEXA 1XMQF 4H54A 1S6PA 1TQLA 3UE2A 2YNGA 4NYZA 1N6QA 2C2EA 5IXUA 1ZETA 1RGVA 3H4BA 4LRCA 3HSGA 3F73A 4QU6A 2VZ9A 4DR2F 1RWWB 1CJUA 2RUSA 5B0AA 3MUVP 4WK3A 3BZQA 3FQKA 3DHXA 2DNQA 3T19A 4ZN1A 1G6BA 2C3MA 3HT3A 2V2QA 2KXHA 4OJ3A 5KFQA 2RE1A 1YHQS 5F8NA 2DNNA 1M5PC 2GA7A 2YH1A 1MN9A 1R0AB 2EWHA 4CLSA 2XHCA 4FXWA 2LQ8A 1WKJA 3KXDA 1BE4A 3MMJA 1Q81T 3GMGA 2MLZA 2D41A 4HLBA 2GVDB 3RRKA 1MU2B 2LEAA 1HWJA 3I4PA 4G1QB 4MTPA 4PXCA 3D6MB 1PYOB 4LSNA 4ECZA 1W7WA 3F0NA 3W5YA 4AYBD 5KFNA 4IR1A 1MSWD 2DGQA 1KVJA 1ZAXA 1R0CB 2I5JB 1S7IA 1TL7B 5HQMA 4QYZK 1F9FA 3PRDA 1V3ZA 1XERA 2B51A 1HQ2A 3DC2A 2EK1A 2NYIA 2WVEA 3HULA 1AZSB 2FHOB 2DPIA 2ROPA 2A10A 2WW4A 2H65B 4P71A 2J5AA 2BE2B 3DI6B 4HHHA 2ALYB 3M8ZA 5AXMA 3RR8A 2YKNA 2ZKTA 4XDCA 4UTGA 3WIUA 4DN9A 4E98A 3CPWR 1NK6A 4YP3A 3UN3A 1F5CA 4KFBA 3N01A 2V5HG 1IWGA 4LRBA 1VRQC 3DU5A 3IGNA 3SCLE 3G71S 1VQOS 2VFUA 5IT4A 2MZQA 5KG6A 2MKSA 1NBEB 2YNGB 1AZSA 2FVPA 2JH3A 1YK9A 1IVZA 2WVDA 4YR3A 5IOLA 2Q79A 1YITS 1F5AA 3G6VA 1IBMJ 5DQGA 4QW9A 1VLOA 3HVTB 4I7FA 4CDIA 1HD1A 3C46A 4DL6A 2VOOA 2MQMA 4E8UA 5CABA 2R8HA 4P6QA 4TLRA 5CZVA 4KB7A 4DR7J 2BOPA 4FF3A 1HBOA 3IBFB 3H2VE 5IZHA 1UKUA 4DUZJ 1NJZA 1QUVA 2CPYA 4DCOB 1D9FA 1U45A 4BDPA 1PSDA 2VPXB 1UZDA 4LSLA 3TAMA 7FD1A 3RW7A 2IRYA 1NZAA 1IM4A 2JFKA 2M3DA 2OEJA 2CXEA 2QTWA 3DKDA 4O4GB 4ZVTB 1ZYQA 5C42A 3Q83A 5KAKA 3CD0A 1F2GA 3J7YI 2R7OA 1BGXT 4FKXA 5EGYA 5F8MA 3CJ5A 2BEFA 2MQQA 2ZD1A 3EX7B 5IM0A 2OMOA 5AXKA 2JLGA 1V3SA 2NXCA 3DXBA 2J9DA 4L3KA 5E7OB 4FKYA 5HVGA 3PZPA 4F02A 4JV1A 2PMHA 5K20B 2ZHAA 3UNYA 2PC6A 1KHWA 1PYSB 1GTEA 3AB2B 3EWGA 4CO2A 1FFWB 3G6ES 3KNGA 4NXMF 5HBMA 5KG1A 1S9EB 2V68A 2W1BA 1NCLA 1FRJA 1CBKA 2CPDA 2BKPA 2D69A 2J7UA 2IRXA 2FQQB 1WDDA 2BANB 3QSIA 4KQZA 5HMWA 1RDRA 2W8LA 4J9SA 2ATLA 2Q66A 2DEIA 4Z2XA 5CCLA 2KJVA 3FCWA 1NJYA 2I38A 1NK4A 4UF4A 4DR1F 1PO6A 1S59A 1S9EA 4Q2MA 2IC3B 5D6GA 1RJJA 4N77A 4DR6F 2PO4A 1RAEB 2F9JA 1FNOA 3C19A 2IMOA 2UZAA 2YKPA 4NZ7A 2MQPA 3P49B 1GT8A 2BJ9A 4R0JA 2ZNZA 3C6TB 3WC0A 2ZH8A 3HHEA 2IJRA 3W60A 1RUSA 2B7BB 3KG4A 1SJFA 2WONB 1RZMA 1WORA 3HZGA 4CLUA 1J5EJ 3DLHA 1RHKB 3NRBA 3POTB 3BKFA 2CQHA 5L1KA 2ZD1B 4KJIA 4LFBF 2VJVA 2BRKA 4RKUC 2NYHA 1LWCA 4QW8A 3MHYA 3MFHA 2W2MP 4OX9F 1R6YA 3HVAA 1UVNA 4J9VA 4LFCJ 2HZAA 3GJRB 4FYYB 1VQ9S 2CNOB 3QZ7A 1KR4A 5BYSA 4QYZJ 4QPXA 5KFCA 4DZ6A 1JLQB 3IC1A 2WK4A 4EBDA 4LF6F 4JV5J 2M7SA 3MM7A 4WE1A 2MQLA 5DG9A 1AT1B 5A0YA 2UXBF 3JTPA 3HPOA 4LMZA 1AA1B 2M52A 3FZ2A 5E33A 4A48A 4EO6A 1T03A 5KFZA 4B3SF 3EPGA 1S9GA 2OI2A 3DOKA 1BWEA 1WI8A 5GVQA 3OTEA 4RO0A 2Y3YA 1SC4B 4CLYA 1RKJA 3BV8A 2R8JA 3FDSA 3IBCB 2LA4A 1RU1A 5HP1B 3AFGA 2IA0A 4USVA 5HSPA 4YHHJ 2ASLA 1Q8LA 3H4DA 2UP1A 2H48B 2R7WA 1BMQB 4CTAB 2DJWA 3GILA 2MEWA 1Q95G 1SH0A 3W65A 2MKYA 5D4NA 4TU7A 4XO0A 3HHKA 2Q3PA 4A8OA 2PEBA 1RTDB 1Q16B 4MFBB 2W4DA 2DNHA 5DZ6A 2F7VA 3WC2A 1X9WA 5DDRC 1KBRA 1RTDA 3QBCA 3WX4A 5GMKa 3FSIA 1JLFA 1TTHB 4YY3J 3IFEA 1TK0A 3TUPA 4M5MA 1B3TA 3PJWA 5A2QU 2E5JA 2HQCA 5GAEI 4LF5J 3BSAA 1RTZA 1JX4A 4C48A 3SBMA 2FJBB 3J7ZT 4B3RJ 7FDRA 4FZVA 2XMMA 2AD9A 5BYQA 3VR1A 4HYKA 3SSQA 2DH7A 3G2XA 1FDAA 1RKIA 1R8AA 3WQPA 3GV8B 1R0AA 4ICLB 2EKNA 2VF3A 5A8WB 4NXNJ 2HS4A 2GHWA 2W9CB 1HNIA 1U26A 4BC9A 1Q82T 1HNXJ 4DL5A 3CJKA 1TFWA 1NPKA 4N56A 3OTDA 4EMDA 5J2NA 3R2DJ 1FFGB 3CCZA 3PX6A 2PT0A 3LAKA 4L74A 4OZNA 2W7OA 4TLQA 2CWXA 4YB5A 1C1CA 2J9EA 2E1AA 1GK8A 1TL7A 1NDPA 2CDRB 2P6TA 1HD0A 4ATNA 3R7BB 5L9XA 2NS1B 2VG7B 4JV0A 2KTQA 3KYLA 2V8GA 4DV1J 1QE1A 2MGZA 2QC3A 3BGRA 4C8LA 5CXTA 3DGPB 4LRAA 4OHVA 1FEEA 3HCXA 3MM6B 4UQTA 3G86A 5HANA 2KRRA 3AD8C 3D9BA 1VQKS 2CZ9A 1ZTWA 4DQQA 2AJQA 2ZVSA 2R8IA 1ZAWA 1H2TZ 5IT9Y 5F9LA 4LFAF 2DRDA 5ETVA 4O3QA 1Q5VA 3NLCA 2E9ZA 3DFEA 4AL6A 3GIMA 3GFYA 4C8NA 5KFRA 2W2NP 4AFFA 1OMSA 5DDOC 4IO9Q 2CPJA 4WYWA 4ZPAA 4JI8F 1I6JA 4O3SA 2BVZA 4JI2F 2MPUA 3CJRA 2QA1A 4JB8B 4N47A 4ZLNA 3ZTQA 3K8VA 2DO0A 4Y65A 4C3LA 1T11A 3SFGA 2FGOA 2BOAA 4MAKA 3OHAA 4IH7A 5DLGA 1TK8A 1I94J 4ELUA 1KSPA 4DV2J 3Q89A 2ZWPA 4OI1A 3S8SA 5HL7Q 2GAGC 2VPYB 4CZCA 4YN3B 4N8NA 2HNZB 2RKIA 3J7AN 3R5JB 1JLCA 2MGZB 4OQJA 2HW3A 4N5SA 1TUWA 5GAHI 1O0PA 4KHPF 1G3OA 1IXKA 3PHEA 2DD8S 1R8PA 4B9MA 4LIWA 3BO4A 1N33F 3N4WA 3NOCA 1Q8BA 2GNKA 4C0HA 2YH0A 3VAFA 1HYSA 4V1Ak 4DR1J 4X65F 1RAAB 3FBEA 3R5BA 4PXEA 2C2MB 4DR6J 1NPRA 3AA8A 1RHQB 3GJQB 3P4UB 1HLWA 3QATA 3QAUA 3UR0A 5LMNF 3CJKB 2FVSA 1QDUB 3LH2S 4LF9F 1IR0A 1ICEB 4J91A 3MD1A 1NJWA 1IKWB 3GG1A 4O23A 4PR6A 1YI2S 1U48A 5KFPA 1UP1A 2IC3A 1ZS6A 4FBUA 4WP9A 4R25A 5DGAA 1JJCB 3Q2SC 2ZJPQ 2EFPA 4CO4A 1RHRB 2OPSA 2V4RA 3JS9A 2RMLA 3M1VB 3J7Z5 1YLXA 3ILLA 4EK2A 3BH7B 1S0OA 2EFGA 3C16B 2XC9A 3V81B 4H4OA 1SJRA 2I9SA 2B4PA 4MKAA 2QFIA 4CWBA 4C97A 2LU2A 3Q2TC 4L3NA 1Q8KA 4DPOA 1RT7B 2Z2YB 2LXFA 3JSYA 4LQ9A 4AXIA 1SL0A 4U7UD 2IAJA 4ZMMA 4YR2A 2V8DA 3L7PA 2DB1A 3QJLA 1B64A 3DOLA 2HGNA 1NHUA 1SVDA 4USWA 3S1TA 4J9NA 2HNYA 1XMBA 3V6JA 1T3NA 1VBYA 1REVB 3JQMA 1CJTA 5ETKA 4C0OC 3LANA 4FYXB 3GV5B 3DLKA 1T0TV 3RBXA 2CJQA 1K44A 3HHLB 3QAEA 2YWGA 1LW2B 3G8QA 2DH8A 2AX0A 1Q7LB 5AE1A 3LWMA 4HHJA 4OZLA 4ZP8A 3VQTA 3RG6A 2OPQA 1FKOA 1S6UA 4GVBB 3RJMB 1LWXA 4OI4A 1XQIA 2I1RA 2KL8A 3O5TB 1RWMB 3QLHA 3U27A 2HRTA 5IQQA 1HWKA 2YKQA 2J0WA 2MZ1A 2CQGA 2JLEA 4ZS6A 3KLGA 3PO5A 2RU3A 1FKOB 2F1FA 3IWNC 2APOA 3OJUA 3PW0A 1NUEA 2F40A 1SB6A 3RBDA 2FLNA 2IA6A 1RT6A 4WFXA 4RNNA 5KFSA 4DU7A 2XSFA 2MYFA 4UOGA 4HDGA 4Z37A 4YQWA 1XBWA 2HWTA 2OPSB 3EMTA 2CPFA 2Q6BA 1PJ7A 1S1VB 4NASA 1N32F 1IBCB 3ISNC 3MMAA 3Q8SB 3I96A 1NB2A 4WU3A 4JI6J 4NX9A 4R8UA 4LFCF 3CB4A 5HROB 2IVYA 1U0SA 2AYMA 1IWAA 2HQFA 3IGVA 4NMLA 1YWXA 1FVQA 3HHDA 1PAEX 2Z4PA 4KRWA 4I2PB 3BQ0A 2QFJA 1RT7A 2YY3A 4QIGA 4JYAF 1T3OA 3UN5A 4OX9J 4I1TA 4LBPA 4NLTA 3ZZYA 2FVQA 4YB6A 4OHYA 2ZH5A 3M8QB 5DQHA 2KO1A 4UZBA 3G6XA 4G3IA 3QIPB 5L38A 2DR6A 5T14A 2XLJA 4F4AA 1RADB 1R43A 4JI7J 4JV5F 4ES2A 3RBZA 1C0TB 1B7FA 1KTVA 1KVIA 1DLOB 1FJ7A 4KBIA 4DQSA 2LU1A 2GVDA 2R2SA 2VC0A 1ZA1B 3ZNJ1 3ZZPA 2E9TA 3DGVA 3CW2C 4QZVB 2HLTA 2BJ7A 3BBBA 3UCGA 4EFAC 1EX8A 4K4XA 3GFZA 3T1HF 2XCPA 2VG5A 2U2FA 4O4RA 3D7SB 5LSOA 4NCGB 4AUKA 2BR0A 2E7VA 1U0HA 1U09A 2HQ3A 3RB0A 4ZP6A 2DO4A 2VV5A 5K14B 4A8KA 3HSZA 3CD5A 2LDYA 5DZ7A 4K50A 3NGSA 3ZZTA 4ZVHA 2NUHA 3KK1A 1XEZA 3UD5A 4YS2A 2AT1B 4K4YA 4DL3A 2C3OA 1PC5A 4GKJF 1EKSA 2O66A 4ED3A 1RXOB 2XWYA 1RTJB 1VQYA 4DV5J 4OJGA 1VRTB 2YNHB 5KFEA 4K5RA 4NLPA 1MROA 2DGUA 4O44B 3QNWB 4DJBA 1EB0A 5I42B 1H7XA 3GIIA 4CLTA 2XYPB 2YNHA 2QL5B 2FB0A 4DI6A 1JXLA 4NLGA 2OFGX 4OYXA 3BGRB 3QIPA 3LAMA 2HBQB 2RDJA 5T7LB 2IJFA 4J5OA 5B0BA 5SUHA 5E41A 4E2FB 1QAIA 3G87A 3I6PA 2P5VA 3MM8A 4IG0B 4KE5A 4F50A 1N33J 2R42A 1P27B 1R6VA 3QJPA 4OX6A 4KFBB 4X65J 1PBAA 3B82A 2QRRA 2OP5A 2OPRB 2DXEA 4KR0B 1UPMB 2PMWA 1K73T 3W1YC 5LT5A 1VC6A 3VAKA 1VQ5S 4F2SA 1URNA 1N0VC 3G9CA 3TZWA 1JJ2R 2AWZA 3E01B 3FFIA 2VKZG 3R5AA 3NWGA 4ANCA 3GIRA 5F8IA 1DTQA 3LQVA 3HX9A 2E1PA 5A8RB 3IR7B 2X51A 1T8EA 2EFNA 4TQRA 2QT7A 4X62J 2L41A 2V94A 2GMJA 2ZH9A 1WC1A 2RRBA 1CG2A 2J7WA 1W2IA 2ZBQA 5I3PA 3TOQA 4LFAJ 3CCSS 4G1QA 5CZXA 4B3MF 1MU2A 4J9UE 1SC6A 2KU7A 3KJNB 1M5SA 3LUYA 1JKHB 3D68A 4MT1A 4CLKA 3OL7A 3KOAA 3ITHA 2FIUA 3KUEA 2HVHA 1B70B 3F41A 4CNZA 3MAAA 2VQEJ 4JI5J 1VLYA 3K7RA 4JUZA 1VRUB 1FDBA 3I9ZA 3DLKB 1WEXA 2YNFA 5C5JA 1E6YB 5C24A 4DF4A 2PA3A 1IBKJ 3UR3C 3CC7S 3K5NA 3I0SA 1NSPA 4ED4A 1BQMA 4ECXA 3KLEA 1N5YA 3UCZP 2IBKA 2IM1A 4NLRA 3VGSA 2XO6A 5J2MA 4I2QB 3KNAA 1I5OB 2N4DA 3B54A 4GMKA 3T9ZA 4WZMA 1FRXA 2BJ8A 3KUGA 3SCKE 3UDLA 2V2KA 3PEHA 4ZK7M 1RK8A 1Y3KA 2W24A 1IN0A 4X84A 4IOCQ 1N48A 1DARA 2XULA 2LLZA 2QZ8A 3GZ7A 3MEGA 4O0NA 5ETPA 1PGZA 3EGNA 4M5GA 2YNIA 2FHKA 2COLA 4RBUA 3BKUA 1RWVB 2A6OA 2Z30B 1NZ8A 1YX2A 3CDUA 4NL5A 4ID8A 5ADZA 1DY3A 4DHVA 1S1UA 2CQCA 3CNQP 4MFBA 4X4TA 3AOCA 2F65A 2D3OR 2R7UA 3OJSA 3VAIA 3D54A 2OPPA 3ILIA 2FVCA 2BABA 1N36F 4PQUB 4DL0C 1VJQA 4M5DA 2HMIB 1M5VC 4DSKA 3SEOA 5LSRA 2ZH2A 1IBLF 4O3PA 1KFDA 1E6VA 1YZ7A 4RPFA 1PCAA 1U1PA 1RTIA 1RB0A 1WF1A 3KDOA 3OPKA 1FE0A 4KKOB 3EVWA 3F44A 1HI0P 5THWA 4OV6A 2W4PA 2GHVC 2CQ2A 3P5TL 1WD6A 2JL9A 4KGXB 3U1MA 3ELHA 1NK9A 2BM0A 2MSSA 1Y0HA 4KKOA 2PFDA 2O5DA 3AJ1A 4TKTA 2KN4A 1SKUB 2MJNA 4DV3F 3FVYA 1RP5A 2AP6A 5KG0A 1E6VB 2CNLB 2NXJA 3BQ1A 4ED7A 1YRTA 2CPXA 1H38A 4F26A 1RAFB 2MLYA 2FGCA 3IRXB 1EJ7L 1S76D 1Q78A 1VQ7S 1TKXA 3G82B 3ZZZA 1S6OA 2VODA 4WIIA 4WKYA 1V6HA 2H3EB 3EICA 4UQGA 1RWOB 4URQU 2KFZA 1ZOTA 2C3UA 4RW8A 3J81U 3M8PB 4ECTA 4IDKA 2HRUA 5ETLA 5LMUJ 3DDNA 1M0SA 2GX8A 2K8GA 2XZTB 2DPJA 4IO1A 1YJTA 2D7SA 2V0NA 4F25A 1M5KC 3PJXA 3M7VA 3C6TA 4PG7A 1QVFR 3TUIC 2HSEB 1MLAA 1NNDA 1WUUA 1J5OA 5D0EA 3IA0A 3AXMA 3TVZA 3V6HA 4DX7A 1NAQA 4DFMA 1VDHA 4CQ1A 1K1SA 4XK8C 2YVSA 2FJXA 2OFHX 3G8TA 4CO3A 4PXBA 1SC1B 3OLAA 4PG4A 4C7QA 2IYGA 3C8YA 5K8PA 4I4BA 3OD2A 1NKBA 2AGOA 2W01A 2MKHA 2CG4A 2NPIA 2CADA 1HYSB 4DS4A 3FEXB 3QT5A 2ROEA 4Y2CA 1U49A 2XYGB 4EZ6A 3IR6B 1RBLA 1XNRF 4PWDB 2BBEA 1VC5A 1B0PA 4JP8A 5HLFB 3DGPA 5KFTA 1N88A 4NZ6A 4OZJA 4ZVPB 5JVGQ 1DURA 5EX0A 1LXJA 2L48A 1DRZA 4GC7A 3MM9A 1MWQA 4YY3F 3R3TA 4NEZA 4DV6J 3U1NA 4RW7A 2XMAA 4K4SA 5IM0B 3GTYX 2G1DA 4RUHA 3J81Y 1GXUA 4CO0A 3BB5A 4F3MA 1YJUA 4BS2A 2UXCF 4B3RF 1MW7A 2GCFA 3F56A 1L3SA 2W4CA 3ETMA 3FBFA 2K7KA 1TELA 3MECB 4DBQA 3A4TA 2XS7A 3MR7A 5CH7B 4QPTA 4LF1A 2CQIA 3MZIA 3KKFA 3N6MA 2W9CA 4EYIB 4IKAA 4LVNP 2WB1D 2DXDA 4DSFA 3VZHA 3ZNUA 4AD6A 2G0JA 2XO7A 3HI9A 3VAGA 3N9UC 1SUQB 5J1EB 2RH3A 3CJ3A 3EXCX 1MMDA 2HGLA 3DOMA 2ZBIA 1YVFA 3NGRA 4NRTA 4C11A 1S0MA 2M5YA 3OFGA 1J27A 3K17A 1HWLA 2KFYA 1CS4A 2XLIA 5HI7A 1OQ6A 1VFJA 4CCHA 2D3ZA 2EEYA 4KGMA 1NRKA 3ZO7A 2IBOA 1K47A 2ZBPA 3U02A 3UVJB 2WBRA 1H74A 6AT1B 2JFDA 5HAOA 2F8EX 1D8ZA 1S1WA 4IQMA 1E6YA 1UEVA 5C24B 3M8SA 3E2EA 1ITPA 4GKJJ 1S7HA 3EE3A 5D0HA 2V6AA 4ZVOB 4ANDA 2ZHBA 4DV5F 4ZLPA 3QQCD 1QSSA 2BA9A 3OW2R 4Q2LA 5CD4H 4HL9A 1QAJA 4RBTA 1Q8IA 1DQAA 4F7VA 4UT4A 1N5QA 2JWNA 2XY7A 5DLFA 2I5JA 3HD1A 1U2CA 4TYAA 1KQSR 4IRDA 3IP0A 4AE5A 1S9GB 4RNFA 1UVJA 4JI0F 1U02A 3LALA 2ZH3A 2J0SD 2H9ZA 1HMVA 4DEZA 2XGQA 1RA7A 1BQXA 3HVWA 3CCRS 3IRWP 1IR2A 2EKYA 4ECWA 4UZCA 3DRSB 3R8YA 5HLFA 2HS3A 2IVFB 9RUBA 4X4SA 1FJGJ 3FUYA 1X4DA 3LA0A 4ZN3A 3AQOA 4OLOA 4ZJLA 4I69A 2XY6A 5GADU 1C4AA 4ALZA 2KKHA 1S79A 2B9WA 1WG1A 3M05A 3CDAA 4DN0A 4DPYA 1F2HA 3Q24A 3GG0A 3OUYA 1C0UA 2OPRA 3PG9A 5K8NA 2J6TA 3WX8A 1FNMA 2UXDJ 2NXUA 1QAXA 3VWSA 1S9FA 1LWFB 2XMVA 1OY9A 1SXLA 2R2UA 2YWHA 3BREA 1SC3B 2B5JA 2XWXA 1PG5B 2DGWA 1F60B 5GAEU 5KFXA 2DVIA 4HI2A 3W5XA 4HTIA 4TNOA 1SJ3P 4DFJA 3TI0A 3H2UB 3C3LA 2QIFA 2HAIA 3MMAB 2BE9B 1SUQA 4DF8A 1W25A 1OS5A 1F9HA 1G7CB 1KHVA 1YJWS 4UW2A 4Y28C 1SKWA 2OIHA 5K14A 4UOHA 2EC2A 2XMKA 2AZ1A 1PILA 1NK7A 3DLEB 5F0WA 2FC8A 2NXEA 3NBPA 2O1PA 4MKVA 5EWFA 2SXLA 3UWTA 4YDDB 2YBVA 3GIJA 1NSAA 4GKKJ 3KLGB 3FNNA 1UW9A 4QOTA 5E5NA 3PXGa 2MMYA 2LEBA 1F6TA 1WHXA 2RD5C 1LW0A 1QM9A 5L1IA 4LF4F 1H73A 4NLYA 1J5OB 3OL9A 3BGUA 4K2XA 3U1LA 2N3LA 3I0RA 3IG1B 2E5GA 3HSDA 1WHWA 3DOKB 3P5BP 3US5A 2CZ4A 3OT9A 2W2QP 1ELOA 4QIVA 5J2PA 2F63A 2K1RB 4WFBQ 1DHMA 1UFKA 1DTTB 1MMNA 2ZOGA 1YKWA 3CJQA 3KG1A 1VHFA 2Y1JA 4RW8B 1K0TA 3D2WA 3IR5B 1Y7PA 1ZBTA 3PJ9A 4ILRA 3SQGB 3JAMY 5B0CA 1D9AA 3M6UA 2DNKA 3E3XA 4ZJQA 5HO4A 1RWKB 2HQGA 4WFZA 3NOGA 1UETA 1TL1A 4HI1A 1X4BA 2DHHA 3ZTPA 1NDLA 5CYQA 1U24A 3BDEA 3HFVA 5KG4A 4C98A 5EHHA 4WP3A 3UPFA 3A13A 2HHVA 1M1KT 1XNRJ 4FVCA 1NHKL 2CJBA 1O5JA 3T5JA 2FLLA 3PIOQ 2U1AA 1OWXA 2HFUA 2Y1RI 4OLPA 5B09A 3AJDA 5LSLA 1K8AT 4LQ3A 3MOJB 4M8LA 2MKJA 3Q8VA 4M5LA 2FY1A 3D28A 2ZDOA 1XR6A 1FTCA 2CJXB 4CRJA 1CULB 5CCMA 2CJKA 1YJ7A 2WOMA 1EETA 1WACA 5HROA 1FERA 2LQBA 3NEKA 3PYGA 3C15A 4J9PA 2EBGA 4IH6A 4ZPVR 3IWLA 2NR0A 1SL2A 1PIEA 1WF0A 5B0EA 3FBBA 4KTQA 3CJ4A 3CJ0A 1CQNA 1RHMB 3NS6A 5A76A 2PI4A 1N32J 4JI4J 4MYTA 2WW8A 3GFXA 1IKXB 1Z2ZA 1HFEL 2B43A 4ETXA 3R2CJ 2G0CA 5H9FK 2KRBA 2UXBJ 1IQZA 4LSLB 1H98A 3ET6A 3OR2A 2WHOA 2UXDF 2FLPA 4HACB 1TKXB 2WRMA 4A47A 4LR9A 5F8JA 4HKQA 3R6GB 4H4OB 1LQ9A 3DHWC 2FTRA 4MKBA 4J9LA 1WJ9A 2AJ1A 4DPUA 4HT7A 3MFIA 2MLXA 4IR9A 1RTHB 2XI2A 2ZBRA 3HVTA 4B9UA 2DHSA 2NUUG 2Y8WA 4JI8J 5BJRA 5K8MA 4GC6A 3SQGA 4ZVFA 2MB0B 1VBKA 5DRKA 4TYBA 2ZH7A 4NZ0A 3NAIA 4QR1A 3ILJA 1IKWA 4M5IA 3FJ2A 2A2DA 4IG3A 4P75A 4YEAA 5LOQA 2E1RA 1RACB 4B17A 2FZKB 3EVOA 3T6BA 1LK5A 2XZWA 4DSLA 2EBEA 2NZCA 3BBCA 4OHZA 2EG1A 2VASA 5KFVA 1FDDA 2MZTA 3D5MA 1N56A 2BRLA 2IRUA 2JZ5A 2KI2A 4TY9A 5ETRA 4RUCA 2Z8QA 4XPCA 2R7XA 3DI6A 1T94A 1SI9A 1Y5NB 3P96A 1NK8A 1KQFB 3D6FB 4NLQA 2EVZA 5B0FA 4F4ZA 2RSQA 1ZTTA 3NCQA 1R89A 3S7RA 5L9NA 4TU9A 3V81A 2K3IA 4DQIA 4A46A 1L3UA 3LP1B 1KRPA 4K59A 1QD1A 1ZM4A 2LEPA 4FN5A 4ES1A 1P8GA 2L08A 3M9NB 4DWIA 2R7TA 2DISA 3ONQA 2QA2A 2XZDB 2EFQA 4C8OA 3IS9B 2MTLA 4NLVA 5H1SV 3FFIB 3J81j 1ZAVA 4JI4F 1NHVA 3I31A 2RRAA 2Q1LA 4N8OA 3R7NB 1EQMA 4QCLA 4NA1A 2Y1IA 5J1NA 4R0EA 2OO4A 3CCWA 1JLEA 1L5UA 1DBDA 1L3VA 2AQ4A 2R7SA 2UXCJ 2RQ4A 4M1KA 2KM8B 1H3DA 2ZOFA 4C8KA 3R5DA 2YQ3A 1H2UX 2HWHA 3TA0A 4PPZA 4P2XA 5LXRA 4NRUA 5LMUF 5CA5A 4H4KC 2QSFA 2J7KA 4LIRA 5AJ3F 2Q6CA 1JLGA 4PAAA 1U2RA 3QIDA 4LSNB 2HRYA 3R7SB 4XIUA 3RW6A 2PIIA 1X4AA 2VPZB 5IC6B 3BGLA 1FHTA 1DAXA 1RQ0A 3DM2A 2HFSA 1VRTA 2A0FB 3Q8UA 3IN5A 4OYZA 3M6VA 4RNHA 3E01A 3KG0A 2ZUAA 4KHRA 3JAMU 3PYEA 5ETMA 3BR8A 1S77D 2DYAA 3HMJG 4B9TA 4OZ1A 3D0IE 2CA9A 4EBCA 3KWMA 2E44A 2YQ1A 2G0IA 1S6QB 5DO2A 3FSXA 3MUTP 2AGQA 2XNRA 2DIUA 4GKKF 2HWIA 1BY9A 3M8QA 3QFHA 4Y0FA 4ZCLA 2VA3A 2NZ4A 3T1HJ 1EHWA 2X7IA 2F4VF 3MM8B 4FDFA 4FPIA 3VF0B 3SCJE 2HBYB 1OY6A 1VI7A 1Y10A 1JLEB 1UAWA 5DS7A 2OKQA 4ENOA 4B9NA 2HHQA 3T1YF 4X4OA 2DNLA 1PJ6A 3FMWA 3CCQS 2B9EA 2AJ2A 2BXJA 2YWEA 3EGWB 3KK3A 2BDPA 1ZA2B 3AXKA 1HA1A 3QGGA 1HI1A 2KVQE 5B08A 1UZHA 2RIJA 4A8XA 4ZA1A 1WEZA 1HNWF 2IPOB 1U2FA 2XG8A 2K3KA 1Q7YT 2AYBA 3KK2B 3FK4A 3PIPQ 3MAQA 1T05A 4X4UA 5K8OA 1J2VA 2G2OA 2QL9B 3TJAA 4Q0BB 1SH2A 3HHNB 1RSCA 2C2OB 2MQ8A 1RTHA 2KDOA 3A8KA 3QZ8A 2KG0A 4ECRA 1CVJA 4KO0B 3QLHB 2UVWA 2G13A 2GHPA 5A2QY 2YWFA 3MPYA 3ILOA 4GVBA 2QX0A 2RJZA 4I2PA 1H6KX 3HKWA 5C7PA 5E0OA 3T3FA 4NCAA 2G4BA 3CD6S 5KOXA 1M1GA 4AXJA 5KG3A 2KB2A 4IUFA 3HP6A 4ERDA 3IWXA 1UJ6A 2QLBB 3JSMB 2UUCJ 4TXSA 2VQFJ 3P6YC 3FQLA 5IWAJ 1REGX 2B7CB 4ZCMA 2AIRB 4KH1B 3FBCA 5EWGA 1GTHA 3PV8A 4WCEQ 2H1YA 1JLAB 2KT2A 2ADCA 1MWZA 1P6TA 2DGTA 1WC0A 2HGMA 3QSYB 4WK1A 2DTJA 1AUSL 5KT4A 3TYTA 2MHEA 3GYGA 1J5EF 2NREA 3BSNA 3GWCA 2AU0A 5KG5A 4DLGA 1JQGA 2EFOA 2GQCA 2UVVA 4ANEA 2KZMA 5FIIA 2MHNA 5JXSA 4EYHB 2HEKA 2BJDA 4B02A 5H9FJ 3D3CJ 2M2BA 3MM7B 1NH8A 1UCNA 4XTTA 3W2WA 2B3TB 4KY3A 3MCOA 3BJYA 2BMBA 2YNIB 2E7WA 3RAMA 1GEHA 2O3DA 3FMBA 4WIQA 3H25A 1TL1B 2KH9A 4DR5J 2IMWP 2QLXA 5ETQA 2AX1A 2RDIA 3GYNA 1Z4UA 2QSWA 2KXFA 4M5NA 2LQ9A 4ZVSB 1TU0B 3PR5B 1C2PA 4KGVB 4DFKA 4B9LA 4RUBA 4PG8A 2HBZB 4MYUA 2HLUA 3E51A 1IJEB 2XNQA 2DNZA 5I3UB 3OV7A 3CC4S 4DUYF 1RT2A 1YJ9S 2FJVA 2MJUA 3FSYA 3QT7A 2QLWA 5A0YB 2BUNA 2D3O1 4QR0A 1OJ4A 2VG6A 3CCTA 4NLSA 1KQKA 1FCAA 4K4TA 5HVFA 1G1XA 1JLBB 4W92B 4LUBA 3CCES 1PKUA 3SSSA 1TMMA 4CI0B 2B9YA 1JNRB 2V4QA 1UJ5A 3CULA 1X4HA 3KHHA 2JOQA 1R3NA 1FRLA 3MEEB 4P7TA 2ZJRQ 1MWYA 2DT9A 3TVYA 4CT9A 1WEYA 4ECUA 4O3RA 4PUOB 1IJFB 1FKPB 1Q53A 1WC3A 2AW0A 3T6JA 1EKRA 4KPCA 4LT6A 1UVIA 1RE1B 3G96A 3NP5A 3B4DA 1FK9B 1TP7A 1HWUA 4RW4A 2GAHC 3FCVA 4PG5A 1RA6A 2C1EB 2YPYA 1U1NA 1IBMF 2GVZB 2ZDPA 3MPWA 3LP0B 3N5FA 3I87A 3TARA 1GNKA 2VJUA 1S72S 1IKVB 2AEFA 3M30A 3CCJS 3CF5Q 3KDNA 1KQGB 3BR9A 2GC8A 4L75A 5F41A 2HFVA 5L39A 3DDKA 4CO5A 4DV0F 4FYVB 3QT6A 2QN6B 3LPYA 4LF2A 1NDKA 1VR6A 4L72B 3TA1A 3OTOJ 4GVLA 1TKZA 3CIZA 1UEKA 2RHSB 4KYZA 3V2UC 4DV1F 3D1HA 3T5KA 1HNZF 1OPZA 2A2CA 1JJ4A 4CLPA 4AQYF 3G6YA 4I7FB 2A3JA 4BWJA 5E3QA 5F9NA 4ER8A 1ZM2A 3E8OA 1HBUA 3H59A 3LGHA 4TY8B 1KP6A 5GAGU 3I32A 5HMZA 2KM8C 2B4UA 3LP1A 4CH0S 2UUWA 4WXOA 1D1UA 1TKTA 2M9KA 3ENVA 3OXLA 2F4VJ 4OI3A 2CNNB 2DHAA 1HW9A 4RW6A 2UUTA 3RYLA 2N82B 5DG7A 1HBMB 3TP2A 2JNJA 1T9YA 2GS8A 2HHPA 1WSRA 2OEKA 3UDEA 5IV3A 2ZC3A 2J0XA 1C0UB 1YRXA 2ASJA 3OUYB 2EPIA 2L3MA 2L9DA 3VALA 4LJMA 2HHHJ 3JTOA 2HVIA 4P73A 3RB6A 1Y5IB 2JC0A 3AAWB 4IFYA 4LR8A 3ZTOA 1CQMA 2Y1LB 4CO1A 4ZIWA 1WNEA 2OTJS 2M88A 1X4EA 2QA4G 4ECYA 1HBOB 4ZLJA 1N5VA 5LJ3Y 3N79A 2FHJA 1VQ6S 3TA2A 1S6PB 4DV2F 2MSTA 3MM9B 5BXIA 2P9GA 4DPTA 2QJ3A 4JI2J 1CS4B 3EJMA 3JQKA 4Z7CA 1UVKA 1BXNA 2DHGA 3HF5A 3NGDA 2OAUA 4DMZA 9ATCB 5KFDA 1N36J 4OL8A 1C1CB 1VQLS 1OY8A 1NEEA 1S1XB 2QYCA 5KFGA 4M95A 1RAIB 1JLFB 1FRKA 3PFOA 4CP5A 1VK3A 2DY9A 2HVEA 3QO9A 2VQFF 2NPFA 3W7BA 1FD8A 2X1BA 1QSLA 1CEZA 2RS2A 2XMTA 3V4IA 1IM6A 2RRNA 3RTVA 1RT1B 2KXNB 4EO8A 4RWWA 4OV1A 3SCIE 3DLLQ 4K0KJ 5E3AA 4ZPDA 1R8BA 2VB6A 2Z2LA 4R8UB 4N41A 4IYQA 2EG2A 1Q1KA 2KT5A 1VISA 3LP0A
chains in the Genus database with same CATH topology
2M70A 2DNOA 2LCWA 4X66F 3D0GE 2ZH4A 2DRBA 2M8DB 3FRYA 2MXYA 2R8KA 3RRGA 1F5BA 2DNGA 4H4MB 2R7RA 2V8HA 3ENQA 3H2LA 4L6V3 1VQPS 1S99A 2IVMA 4R5PA 3UQSA 4IRCA 1Y4ZB 4WE1B 4PQAA 2MKCA 4DR5F 1JLQA 3I4HX 5IFMA 3M6WA 4J9KA 3O3LA 1SQEA 3HHLD 2ZC4A 4B9VA 1X4CA 2VFSA 5KG2A 3IRXA 3D1QA 5KFOA 4CIOA 1FDNA 2RF2A 3JSBA 3H20A 4UUWA 2DGXA 1L3VA 3MECA 4FPRA 4A8QA 3RAQA 4GO5X 4YB1P 2L9WA 3T9NA 5GAGI 4ED5A 2CQBA 4RW4B 3KFWX 2MKKA 2JDJA 2M4MA 4WKRA 2MZJA 1S4FA 1TAQA 1HBNB 1X5PA 4EGLA 5CYMB 1KLMA 4NLUA 1UEUA 1UWBA 3DNCA 2HHSA 4WF9Q 2DRAA 1EP4B 2QO3A 3C2PA 1TKZB 2HVZA 1HWIA 2KFNA 1JWWA 4LF8F 2E5LF 3HDSA 3HHLC 3NG8A 4NLWA 5K14B 1LWCB 1VQSA 4ZP9A 1KONA 2PGCA 2XHWA 5U47A 1I1GA 1QAYA 4ZDNA 1CC8A 2HHWA 5CYMA 1Q4RA 4CH1A 3MWBA 2GQ2A 5JVHQ 3L3CA 2HHUA 3B4MA 4D3GA 3V6DB 4PRFA 4ES3A 1VQ8S 3UD3P 1RAJA 3DLJA 2DR9A 1N5SA 1B0TA 5FLXY 2IM3A 3GV7B 4ED8A 2B4OA 3PY8A 2VBZA 4ZVGA 3ISND 2LA6A 4OHWA 6FD1A 2WAQD 4MK7A 3WBZA 1HNXF 1RT6B 4QIWD 1S49A 4X64F 1FTRA 2J8AA 3GYXB 3QMQA 4HEA9 4DL4A 4K0KF 4P7VA 4JOUA 3BGFA 3AB4B 2FJWA 3V6KA 4R5PB 3J80Y 1HQUA 3OSNA 1ZM3A 3M8RA 3MEGB 2FJEB 4J9QA 5HQ8A 1JB0C 2LQ5A 4G1PA 3I0RB 4ELTA 3BS9A 3DRXA 3CTRA 1DQ8A 1I94F 2R2RA 5KFWA 4RUAA 3J7YU 3CSKA 4F67A 1SIWB 2O67A 1TK5A 1RYSA 1H0HB 2HYIB 5KT5A 2X3GA 3EUNA 2JHEA 2LVWA 4PQUA 4B3TF 1FRIA 2BE2A 2GO8A 1AFIA 1EP4A 2KJWA 3RU0A 4DQPA 1YQHA 5T7LA 2IM2A 3OHBA 2RILA 1LOUA 1VC0A 1RT5B 2WSCC 1N5TA 1A7GE 2RU9A 2FC9A 1A9NB 4DV4F 3W3SA 3ICLA 5DGBA 2VOPA 1IQTA 3PACA 4P2SA 4DSJA 1HNVB 1Y00A 4OJ1A 5DETA 4Q7AA 4ED2A 2P9EA 5F8HA 1D8YA 2UUAF 4RU9A 3QGPA 3IAM9 1V3RA 2QMWA 1HQEA 4RW9B 4Y3CA 2EC0A 3T5LA 3H5UA 4C4WA 3NS5A 3QGIA 2VL1A 4PWUA 1S1XA 2R8GA 1HBMA 4K5SA 4MK8A 2R9LA 3MMBB 3MAHA 3AA9A 3PRBA 5B0DA 3K8WA 5KTQA 2E66A 1ZZFA 4OI2A 5KFHA 1IUJA 1U8SA 4TY8A 4NOHA 3PNIA 4JI7F 2C3YA 3JYTB 4Y2KA 3EZUA 3HZEA 5A8KB 1SIZA 3LOUA 1N54B 3IXQA 2B0GA 2XMWA 3KK3B 1JNZB 3W2VB 2VFRA 4FF1A 4B3OB 1HHSA 1LV5A 5T41A 3TAQA 4FXDA 2CPEA 4CTAA 3CDBA 3H8YA 3AQPA 2OLWA 4F4WA 3TX8A 4DR3F 2HG4A 4XPEA 3QJJA 2EW9A 4ZPBA 3OFEA 3PKYA 4RW7B 3C6UA 3NCRA 4NCGA 3DRRA 3TUJC 2JJ4D 1IKYB 1X0PA 2BV3A 3LGMA 2DNYA 2ZZNA 2CRLA 3IS9A 2RQMA 1JK9B 2LMIA 3DM2B 4ED1A 4UOCA 3CGIA 4J9OA 4DLEA 3TANA 4PWDA 4YMEA 2IFXA 2VFTA 3LW5C 3KK1B 5HN0A 4O3NA 1XR5A 3KMSA 2PSZA 4AUKA 1T02A 2CVEA 4RX6A 2DNPA 3ISZA 4WFYA 2PI5A 2RQCA 3UNGC 3KLHB 4EWTA 1VBXA 5DM6Q 4LF5F 3OTCA 3NNHA 2R7QA 3RBEA 4Y2MA 1OSCA 2VG5B 4MMOA 1FXDA 1DZ5A 1TR0A 4C9DA 5KT2A 2IYIA 2Z0GA 3CVKA 3MEEA 5AE3A 3CXCR 3DLGB 3K2YA 1U7LA 2LECA 2C22A 4ZCKA 3OVAA 1EETB 2CQ4A 1O51A 5KFYA 1R7IA 1S1TA 2CPIA 2VD3A 2CJAA 4OJHA 2OMLA 1S1UB 1NJIT 2V8VA 2CPZA 1SBRA 2FHMA 3H5YA 4X4VA 2YX1A 1YJNS 4IOAQ 3OR2B 3O8WA 1HL6A 1Z2LA 1N34F 1BD6A 2F3JA 1JXEA 2CYYA 4YB7A 3X3UA 4YHHF 1XTZA 2XMJA 3PDNA 4Q44A 4FNHA 1RT4B 4ECSA 1Q79A 1B0VA 2IM0A 2VQEF 4PUOA 1JLAA 4USJC 3GR1A 4IG3B 3CE8A 2HS0A 4FS2A 3I56S 4TU8A 3PM9A 5C42B 2FDNA 2D1CA 3GIKA 4M5DB 2HMIA 2K2PA 2OPPB 1TV6A 3CWJA 4U7UK 1S97A 4EEYA 2OJ3A 2PD1A 3W2WB 3NAHA 5M2UA 4DV7F 2HHXA 4O3OA 3HM9A 4KO0A 1C1BA 2HFZA 3G8SA 1TFYA 1ULRA 2M8HA 3UCUP 1S48A 1ZPVA 4Y6IA 5AXLA 5KFKA 4DSIA 1X4GA 4ZOSA 2BJEA 5A8RA 2E7XA 4F4KA 3OQ2A 1X5TA 3SV4A 2IHR1 3DMJB 2YKAA 2W25A 5L1LA 3H5SA 4PPDA 2GJ2A 3IAS9 2HFNA 1KD1T 2J6UA 3LF0A 1SJ1A 4OX8A 1UJ4A 2HFOA 1HHTP 1VRUA 5E2QA 6FDRA 3G96A 2BQUA 4URSA 2ZZMA 2CQPA 2UVUA 5A6WA 3DLBA 1UVLA 4MK9A 2HPUA 3FEZA 2ILYA 3THVA 2Y0SD 5G0RA 2OD4A 1N4LA 3CCUS 2V9WA 1S6QA 2J0QD 1FT8A 2CDQA 5GAHU 2BQ3A 2FVRA 3M1VA 1S1TB 4BCAA 2ZM6F 4KGKA 3D0HE 3R5CA 5D77A 2OH2A 2DGVA 2VC1A 4ETZA 2GMHA 2CZVC 1QVGR 1IBKF 3OSPA 1QE1B 2GW8A 1WTFA 4QIEA 3BN7A 1U47A 1M90T 4F4YA 3K57A 2VG7A 1V9OA 2JC1A 4JBCA 2GGPA 4X4PA 3MM5B 2DNMA 1RISA 3RAXA 1QY7A 2VPWB 4ZCIA 2XSJB 1LW0B 2RT3A 4KC5A 3OR1B 4QYRA 3MM5A 4RW6B 2AYEA 5J2NB 4Q8EA 3OL6A 5D8HB 4I6YA 3ENWA 1XK8A 2DGOA 4KV8B 5KT6A 1DJ0A 1FXRA 3ZC4A 1JLCB 1P9QC 4QBUA 3OFFA 1VK8A 2XS5A 4LMZA 1YSJA 4I6AA 3KHGA 5J2QA 2AGPA 4CNYA 1NK0A 5EWEA 1VIOA 2VUGA 5IWAF 1S0NA 4PKDB 2DR8A 5J2QB 4QU7A 2FJAB 1FJGF 3MM6A 3ZZ0A 3OL8A 4QJVA 4U7CA 3CCLS 2PDAA 2YTCA 1GXTA 1Z1ZA 2B5JB 4ZKAA 5KFFA 4J9MA 1UMJA 1W2BR 1APSA 2N3OA 1YG0A 1SKRA 2EFVA 1VOMA 2X1AA 3KMQA 3X1LB 1VS3A 3V4IB 4QWBA 3VAHA 1QTMA 4B3OA 1WWHA 3OXFA 1KLNA 3BEGB 4BWMA 4YUDA 1XWLA 1VJWA 2ZE2B 3MR3A 3K59A 2E1CA 1NK5A 2ZFHA 5E3PA 4FF2A 2B6AB 1WG4A 5F3ZA 3EGZA 4QWAA 4GO7X 1X5OA 3U7JA 3MMCB 1S10A 1GX5A 1P1LA 2DK2A 4V19X 3GFHA 4I68A 4KV8A 1C0TA 2XGPA 1T03B 1R31A 1FXLA 5D78A 1KC8T 3CJ2A 1D3WA 4QWEA 1NKCA 2KYZA 2UVRA 3BDPA 2UV8A 5FDLB 1ROFA 1YBAA 2OTLS 1Q86T 2UUBF 3OLBA 3L95X 2KZZA 1U25A 1LW2A 3K58A 2GGPB 3MEKA 4DS5A 3T5HA 4OZ0A 3BM7A 1HNIB 1SH3A 2E1MC 1ZZNA 3UFCX 4JI1F 3MI7X 2D9OA 3LP2B 4QQBA 3I5AA 3KJVA 2A18A 2RB7A 1R8HA 4W90B 1VQ4S 4KPYA 4OIXA 4Y2AA 1MNEA 1GAOA