2RRBA

Refinement of rna binding domain in human tra2 beta protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
GPLGSRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords cDNA FLJ40872 fis, clone TUTER2000283, highly similar to Hom
publication title Structural basis for the dual RNA-recognition modes of human Tra2-beta RRM.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rrbA01
4QPTA 2A3JA 5GADU 4LMZA 1UP1A 1RKJA 5CXTA 4F02A 2SXLA 2MSSA 4OZ0A 2MKIA 1KC8T 2RNEA 3CD6S 3BO3A 2DNLA 2M70A 2DISA 1HL6A 2CPYA 1YHQS 1X5TA 2XSFA 2YTCA 3UCUP 1VQ6S 2E5JA 3S7RA 1Q7YT 1OO0B 3IWNC 2HGLA 1YIJS 3VAGA 1HA1A 3VAHA 2DGTA 4WKRA 2OTLS 1NO8A 1SJRA 2G4BA 1X4GA 2DNRA 3VAIA 2E5GA 1X4AA 2DH8A 2HYIB 1WF2A 2E5IA 2HGMA 4C0OC 1WF1A 4QQBA 2N82B 3CCSS 1VC5A 1IQTA 1SJ3P 3EGZA 1SXLA 3NS6A 2EK6A 5D77A 1H6KX 2CQCA 2DH7A 2QA4S 4BS2A 2M88A 3G6ES 1VQNS 3BS9A 3MUVP 2DHSA 1X4FA 2E44A 2MY8A 2PEHA 3K0JA 2AYBA 2KG0A 3CCLS 2RRBA 3VAMA 1G2EA 1KQSR 2PE8A 5D78A 2J0QD 2DNKA 2MYFA 3CCES 3CULA 3ZZZA 5LSOA 1U1RA 3U1MA 1DHMA 1S79A 2MQPA 1HD0A 2ZJRQ 1WHXA 4CQ1A 1CVJA 1VQLS 2DHAA 2I38A 4ED5A 2N7CA 2MXYA 4PRFA 1VQKS 1L3KA 4TU7A 1U6BA 1H2VZ 3MI7X 2F9JA 1U1LA 5CA5A 2N3OA 2J76E 1Q81T 1XN9A 1R8PA 2YKAA 5EN1A 1JMTA 5GAGU 1OPIA 2MPUA 1QVFR 2AYEA 3CC7S 3UCZP 2AD9A 1DBDA 2KI2A 3CCRS 2CPZA 3MOJB 1VBXA 1DRZA 2O3DA 1WG1A 2DNZA 2MKSA 2KN4A 2KXNB 2ZJQQ 2DH9A 2LQ5A 5DM7Q 3G9CA 3CTRA 3G71S 2JRSA 1U1OA 4ERDA 2DGSA 2DO4A 1Q82T 1M5VC 4IOCQ 2U1AA 2MQLA 2RQCA 1UAWA 1FO1A 5DETA 3R1HA 4WFAQ 4TLQA 3UWTA 1QVGR 2DNHA 1X4CA 4UQTA 1M5PC 3MD1A 1VQPS 2M8DB 1U1KA 2OTJS 1U1NA 3SXLA 2CQIA 2DNGA 1D9AA 3P5TL 1A7GE 2YH0A 2X1BA 2M8HA 2KHCA 2Q79A 1YI2S 1P1TA 3P3DA 1Q86T 5GAHU 2J8AA 2DGUA 2M4MA 2L41A 5DM6Q 5HL7Q 3CXCR 5DDRC 1U2FA 2XS2A 3MXHP 2CPFA 1WHYA 2LXIA 2LYVA 2DNQA 3SDEA 1ZH5A 4EGLA 2XS5A 2FY1A 3MDFA 4YOEA 3HI9A 2DB1A 3NS5A 3CUNA 3Q2TC 2M52A 2KVIA 1NU4A 2JVRA 5H1SV 3TYTA 2D9PA 3VF0B 1VQ9S 3G8SA 2KT5A 2DNOA 2MJNA 4WF9Q 3VAFA 1ZZNA 2VODA 3ZZYA 2V94A 1ZZFA 2VOPA 2KH9A 2XNRA 2RQ4A 1H2UX 1WEYA 2DGOA 2MGZB 3CF5Q 5HO4A 1B7FA 3CC4S 2LA4A 4LJMA 5FJ4A 2VONA 1WI8A 2OJ3A 2X1FA 3TP2A 4TU9A 2KYXA 2MMYA 3PIPQ 2MJUA 3S8SA 5IFMA 2K8GA 2EVZA 3CCJS 2M0GB 3N9UC 2I2YA 2CQBA 2MGZA 4W90B 1RK8A 4WFNQ 1WWHA 1SJ4P 4WIIA 5BJRA 5GVQA 3TO8A 5ITHA 4YUDA 1YJWS 2MB0B 2YWKA 4IO9Q 1OIAA 1FJ7A 3J7ZT 2JX2A 1X5PA 2DHXA 5LJ5Y 3G96A 2NLWA 3B4MA 1YITS 1SJFA 4QU6A 2MQOA 4CH1A 2CQ0A 2JVOA 1UFWA 1FXLA 2NZ4A 4J5OA 2XS7A 2XNQA 5IM0A 1SJQA 2MKJA 1F9FA 2CQ3A 3DLLQ 4FXVA 5DDPC 2LEBA 4Y00A 2M9KA 3UCGA 4M5DB 1N52B 1NJIT 1FJCA 1X0FA 2CQPA 2EK1A 1X4BA 4A8XA 1JJ2R 4C4WA 1N8RT 2LEAA 1WI6A 2DGVA 3UE2A 3P6YC 2ADCA 3NNAA 2U2FA 4IOAQ 2CPHA 4ZKAA 2AYMA 2QEXS 2MZQA 3B4DA 2X1GA 2CQ4A 2FPHX 4WCEQ 2CQDA 2M2BA 2G0CA 2OSRA 3HHNB 2B0GA 2CPIA 2BZ2A 4Y0FA 1M5OC 2DO0A 1VQ5S 3CPWR 4IUFA 2L9WA 2RUGA 4YB1P 1YTYA 2DGQA 2ERRA 2VOOA 1X4EA 1KOHA 4LIRA 1YJ9S 3SDEB 2AYGA 3LPYA 3LQVA 3UD4P 2RS2A 1WEXA 2KG1A 5JVGQ 1H2TZ 1JJ4A 3PIOQ 3Q2SC 3V4MA 1WG5A 2GO9A 2LCWA 2HZCA 3MURP 4RU2A 2MZJA 2UP1A 1W2BR 1U1MA 3H2UB 1FT8A 2CQ1A 4F26A 2HGNA 2KRBA 5DDOC 2J0SD 1K73T 5GMKa 2CPXA 3CCMS 2MZSA 4CIOA 5LSLA 3CCVS 2F3JA 1U1QA 2MSTA 2ADBA 2G1DA 4OZ1A 5DDQC 5IQQA 4PKDB 1BY9A 3BO4A 3NNCA 2M7SA 1VQ8S 1K9MT 2OSQA 2ZJPQ 2D9OA 1X4HA 2CQHA 5CYJA 2RRAA 1DZ5A 4FXWA 2DK2A 2KM8C 3CC2S 3G4SS 2KRRA 3RW6A 1M1KT 2DHGA 3FEYB 2KXHA 5LJ3Y 4V19X 3NMRA 2MZ1A 3US5A 4QU7A 3IRWP 1HD1A 1X5OA 4P6QA 1VQ7S 2MKHA 3VAJA 2MKCA 2CPDA 1WF0A 1FJEB 3THTA 3MD3A 1K8AT 2FHOB 1R8HA 2KXFA 2XB2D 5IM0B 3DXBA 2YH1A 2N3LA 1O0PA 1P27B 4Z2XA 3THPA 2LMIA 1M90T 5LXYA 5LXRA 1URNA 3VALA 2MQQA 2MY7A 1S72S 2HVZA 1FNXH 1X5SA 2KM8B 3ULHA 1AUDA 1U1PA 1VC0A 2OIHA 4F25A 2LXUA 2L08A 2X1AA 2JWNA 2CPEA 2MKKA 2MQNA 2CQGA 1WTBA 4CH0S 4TU8A 1VBZA 1WHWA 1UW4A 4WFBQ 3VAKA 1M5KC 2DNYA 1YWXA 1PO6A 2GHPA 3CCUS 3R27A 2BOPA 1VC6A 1X4DA 2KU7A 3RW7A 2MZRA 1JJHA 2DGXA 2DNPA 2WBRA 3CCQS 4PR6A 1FHTA 1N54B 5GAEU 1QM9A 1WEZA 3P49B 1PGZA 2F9DA 1VQMS 4C7QA 3L3CA 3R1LA 5JVHQ 1YJNS 3CMAS 1VBYA 3EX7B 4UY8T 3S01A 3UD3P 2DITA 3MUMP 1KD1T 1VQ4S 2DGWA 3JB9k 2DNNA 2K3KA 1KOOA 3J7YU 2CQ2A 1WHVA 2CPJA 2RVJA 2DIVA 2D3OR 3G8TA 1U6FA 2QFJA 3U1LA 3S6EA 1D8ZA 3I55S 2MHNA 3H2VE 4U67Q 3NNHA 3D2WA 4W92B 3CMES 3OW2R 2MZTA 2LECA 2KFYA 2FC9A 2MQMA 2RS8A 3SMZA 1WELA 2FC8A 3BEGB 1OWXA 3BO2A 1A9NB 2DIUA 2CJKA 5MLCV 3FEXB 1WG4A 3MUTP 2DNMA 2E5HA 2LA6A 3I56S 2LKZA 2RT3A 1VQOS 2RU3A 1N88A 3EGNA
chains in the Genus database with same CATH superfamily
3EYZA 3OFHA 1UP1A 3ISND 3MCNA 2RNEA 5B0AA 2DRBA 4DZDA 2Z2MA 4FBUA 4ZPVR 2H4YB 3IWNC 2ROGA 5K8NA 4Q7AA 1NO8A 3TVZA 1Q79A 2DTJA 4IH5A 4U95A 2YQ3A 4DV0J 1IWAA 2WB4A 3KG0A 1R7IA 1JLBB 5E3QA 1WKKA 2O67A 4P10A 3EICA 3G6ES 1TVRA 1RKIA 2CJQA 4EMDA 3HT3A 2V2ZA 2J6UA 3U1MA 1JLFA 1T9UA 1MROB 2YKQA 1U8SA 5GAGI 1DTTA 4USIA 1H2VZ 1HYSA 2HHWA 3BKTA 1YKWA 4NXMJ 5T7LA 1WDTA 5GAGU 4P7VA 3CCRS 2ROEA 3BBBA 1L3VA 3SCJE 4E8UA 2B9WA 4X65F 4G1QB 3KHRA 3ILIA 3DU5A 1APSA 2E5LJ 4HH1A 2X3GA 1O5JA 4IG0B 2N4CA 3Q89A 1SPBP 5IWAJ 4RUCA 4LF7J 2ZVIA 4KQZA 3M2VB 1KONA 4NLRA 1N5VA 2V4QA 3RB6A 4UOFA 3NBPB 4H4MA 2XY6A 3AXKA 1IBLJ 2B9EA 3DRSB 2MDAA 1UVJA 4I2QB 1EP4A 1U2FA 4DPXA 1DLOA 5HJXA 4ZVQB 3EZOA 2GGPA 2DNQA 4EU0A 2Z8QA 4DS5A 2QMWA 5DGBA 5IT0A 2Z58B 2PFFB 1JNRB 3FC9A 2E66A 4NYPA 3VAFA 3K17A 2KHDA 4K50A 3ISZA 4LVOP 2MGZB 4KE5A 3CGIA 1H98A 4O0NA 4FPRA 2ZOFA 1DFDA 1T0TV 2EVZA 1LWCB 3T9NA 2I2YA 5SUHA 4DV0F 1I94J 1PC4A 1HBUA 1RADB 1JNZB 3LALA 4RKUC 1FRXA 3MEDB 2LXFA 1HR0J 2V2VA 2XS7A 3RU0A 5E3AA 1IKYA 3WIVA 2F8EX 3THVA 1ZAWA 3SQGA 3H0PA 3OV7A 2RQKA 2GHVC 3EUNA 2HHTA 5J2NA 4E98A 1NXIA 2KFZA 1VRQC 2H51B 3J80Y 1C4AA 5J1EB 4N56A 2DXFA 4NXMF 4MK8A 4B3OB 4Q45A 1JJ4A 1H2TZ 1Y3KA 1RT6A 1XMBA 2BRLA 3RR8A 2FGCA 3PJWA 1WOOA 2WRMA 2E5LF 2OEJA 5DDOC 4M94A 5IWAF 4LF7F 4MYTA 2YNIA 2F65A 3KLGA 2BXJA 1UJ6A 2E1CA 3BZQA 2AWZA 3TZWA 1IBLF 1EIYB 4IFYB 2W7AA 2F8HA 2CKWA 2PT0A 2ZZMA 3IGVA 2ZBRA 2VFTA 2QN6B 2ZH3A 3H98A 4OJHA 3TZYA 3FEZA 4M5IA 3CDEA 2W01A 2RU9A 3HSJA 3KLHB 3LF0A 4Z2XA 2RMLA 4IR9A 2OPSB 1Z4UA 3LP2A 1IUJA 1SL1A 3HZGA 1ZETA 2GIFA 3ENAA 3D5MA 1NH7A 3CCTA 2WVDA 4X4PA 2LXUA 2JWNA 3QAUA 3R5GA 2IY5B 3B8HA 1NCLA 1BQNB 2KTQA 2DNYA 1IKVA 1I94F 4UOHA 2D7SA 4ICLB 3MEEA 5H9FK 4X4RA 1FHTA 2NUUG 3HMJG 1RTIB 1HR0F 1S1VA 3S01A 4HYKA 1FKPB 3DHXA 3FMBA 3TVYA 3PM9A 2W7PA 2HLUA 4DCOB 1F60B 2GNKA 4DX5A 1VK3A 4C98A 3T5JA 5F9LA 2MQMA 2R2SA 4ZP6A 1E6VA 1IM6A 1R0BG 4DS4A 2D41A 3HXMA 4WZMA 4X64J 2D74B 3LWMA 1S1WB 4C11B 4H4OA 2ZUAA 4Y28C 1VRTB 4DR5J 4E0DA 4NL5A 2F4FA 4O4GA 1SBRA 5HROA 2OPQA 3SSSA 5L9NA 2AZ1A 2OELA 2ZC3A 1YBTA 2E5IA 4WU2A 1YDLA 4OLPA 4C0HA 2AJ0A 3NGDA 2DRDA 3D0GE 3GB0A 1H6KX 3MUVP 2GS8A 1KQSR 1V6HA 5D78A 2I5JA 4A4JA 3C6UA 4NI2B 4OMFG 2W2PP 3T5HA 1IQZA 2CVIA 5FDLA 4TU7A 1U6BA 2XWYA 2V63A 4PG8A 2XMTA 2GO8A 1KTVA 3T1YJ 4USMA 4KHRA 3C8YA 3LP1B 2UUWA 4RUHA 1DRZA 1TV6A 3UDVA 2MKSA 4X4UA 2KXNB 3UN5A 2HFNA 2JRSA 3HFZB 2VA3A 3JTOA 4IR1A 1SV5A 2QZ8A 1LK5A 4KO0A 3LAMA 3C16B 1XMQJ 4ZPWR 4R5PB 4WFAQ 3T41A 3HJVA 3ZTPA 1HBMA 1NHKL 3GTYX 1U1KA 1RCXB 1U1NA 3QWUA 1RT4A 4K4ZA 5KFQA 2APOA 2M5YA 4IQXA 2K3IA 2J8AA 3OXLA 3QIDA 4USHA 2GVDB 4DSIA 2IC3B 3R5BA 1EB0A 2XS5A 4LSLA 1S49A 5IZHA 2JVRA 4X64F 2MJNA 4NLXA 4DOZA 1RBOB 1E6YA 2VOPA 4DR5F 2NSBA 4J9LA 4J90A 2ZBQA 1RAOA 2W2OP 1VOMA 1R43A 3FBBA 3QT7A 2L3MA 5ETRA 3RUBL 5KFNA 1RB0A 4X84A 2V8PA 3T5KA 1TK5A 5GVQA 1IKWA 1H7WA 1N34J 3BSNA 3RG6A 2HHXA 1FJ7A 5HP1B 4NLDA 1XR5A 4B02A 6FD1A 3QBCA 1FESA 3DLLQ 2LEBA 5HQ8A 2VB6A 3KLEA 1NJIT 2HMIB 1FJCA 4WYWA 2QX0A 2VD3A 2XSJA 1JLCA 4QPXA 4DV6J 2YNHB 1S1TA 4DPUA 5LMUJ 3PY8A 4CYUB 4WK3A 2C2OB 5KFCA 5LOQA 1EAYC 3TEHB 2OD6A 2V2KA 3T1YF 4EYHB 1R0AB 4RW6A 1TL7A 2W9BA 3AA9A 1HI0P 3NG8A 5DS7A 4DZ6A 5JVGQ 3NAIA 3OPKA 3HPOA 4ED3A 4A8KA 1ZM4A 3QT6A 1JQGA 4FF1A 4ANDA 2BE2A 1FVQA 2Z2ZA 1XMQF 1UPMB 4F4XA 3DRRB 3AODA 2AEFA 2MLXA 2XLKA 4Y2KA 3BO4A 4FBTA 2YQ1A 4ELTA 1K9MT 4LF5J 2HHQA 1YJ7A 1NRKA 3Q8UA 1X9WA 3G4SS 2EI5A 2PA8D 2IVFB 4K0KJ 4ZVUB 1VQ7S 1TL1A 2YH1A 1BXNA 2Q1LA 1S1XB 2OFGX 1RTJA 1MWQA 3MEKA 1GQEA 1VC0A 1RT1B 2CUYA 4DSFA 2VL1A 1N34F 1NKCA 2GHPA 1EZZB 2IM1A 4KFBA 3TWZA 5H9EK 2YWWA 1U0HA 4ED6A 4I7FA 3ZTQA 3MR5A 3PZPA 3A4TA 2GAHC 3NY0A 3PTWA 1WHVA 5KFFA 3BH7B 3IBCB 2VC0A 2OPPB 4DV6F 4E2FB 2WSFC 2HVIA 5LMUF 3OVAA 1WG4A 4J9VA 3CIMA 2XWXA 5J1PA 4HLBA 3HHKA 1RT2A 2LKZA 5I3QA 1HNZJ 2K7KA 3EGNA 4NLVA 3TJ8A 2DR7A 2E9RX 1K47A 2A3JA 5ETNA 2SXLA 2COLA 2MSSA 4OZ0A 1EETA 4KV8A 2MKIA 4RW8A 4OX8A 5G0RA 3OXGA 4IKAA 2F1FA 3HZEA 2FJEB 2W2NP 1S9GA 1JLAA 3QLHB 2MLYA 2LQBA 3FQLA 1Y4ZB 1SQFA 2P9GA 2RH3A 4XDCA 4OX7A 2DH7A 3OXFA 1RHMB 4LF5F 3HVWA 1REVA 2A6OA 2HZVA 1X4FA 3QGGA 1N56A 4K0KF 4F4KA 3M1VB 5J2QB 1Q8KA 1AT1B 3N01A 1SC1B 2FY8A 5G4DA 4JI8J 1GFWB 4DR7J 1RHKB 1AZSB 5E3PA 4JB8B 2J76E 1Y0HA 2EFVA 1RGVA 5EN1A 3H90A 1RT3B 4DSJA 3CC7S 3A8KA 2RIJA 1EKSA 3W64A 2RAQA 2NYIA 4H4MB 4QOTA 2RKIB 1HKAA 4TLQA 3CO9A 3CJ2A 4UQTA 3PXGa 3RB4A 1EP4B 5GAHI 2XY7A 1BE4A 3SCKE 4YS2A 2GGPB 2HNYB 4DWIA 3QPIA 3VCDA 3AT1B 1UWBB 3NOGA 3P3DA 1EQMA 5GAHU 5HMXA 3I0RA 2K2PA 3MAAA 2L41A 5DLGA 5B0BA 3X3UA 2VBYA 2LXIA 4C8NA 2ZHAA 2VFRA 3Q8VA 2Q6BA 2ABYA 1LV5A 2FY1A 4KBIA 1IR1A 3PYFA 4V1Ak 2PO4A 1HNZF 4B9UA 2OP5A 3D0HE 2VH7A 2BJ7A 3PYDA 2IMWP 3L95X 1WEYA 4S0MA 1WKLA 1XJWB 5DQGA 4X4OA 1F5BA 4LJMA 2QLJB 5C42B 1NSAA 1YSJA 5KFRA 3CDBA 1FKOA 3K5LA 1IKYB 3J7ZT 1GK8A 4ZCMA 3W66A 5CAAA 2R8JA 3IBWA 2NLWA 4RNNA 1D9DA 3KJFB 4NLSA 1HMVA 4OYZA 1TFYA 4KC5A 4JI7J 2XTJP 4BWJA 3TX0A 3GR0A 4D3HA 1LWEA 4Y00A 4RW9B 3UCGA 1U25A 4TQSA 2OH2A 5DJBA 2EK1A 5ETLA 3T19A 5D4OA 4PQUB 4WE1A 1JJ2R 5KFPA 5KFOA 2W1BA 3BYPA 4JI8F 4QYZJ 4DR7F 1FERA 4EZ6A 4RW7B 3UNYA 4KPCA 2L9WA 4YB1P 1NDPA 4CLPA 3H40A 5HVHA 4CRJA 2YNIB 3BGLA 3KLGB 4P2SA 1GT8A 2LCWA 3QRRA 1F0XA 3EXYA 1WKJA 1BHNA 4MK7A 2GAGC 2CVEA 3OTBA 1ZA2B 2ZH5A 1IWGA 4CT9A 3SFGA 2R8GA 3D54A 1VQ8S 4UQGA 2D9OA 2C28A 3PYEA 3GJRB 4ES2A 2AKWB 4ECYA 3KJVB 2HNZA 2XQCA 4P52A 4CLUA 2CPDA 3AA8A 3OHAA 2XLJA 3QGHA 2KXFA 1QTNB 1UJ4A 2NXUA 2IBKA 2E1AA 1P27B 4K4TA 1VQYA 1M90T 3VALA 2GJFA 1XEZA 1IKVB 3D6TB 4RZRA 1QAJA 1AUDA 2BDPA 4ED4A 4RLEA 3DI6B 1VBZA 4TU8A 4O44A 3ET6A 4WFBQ 1OS5A 1NK7A 3KUEA 5I4MA 2W2QP 3J7YI 2FHJD 1J27A 4JV0A 1Y5LB 3P49B 5JVHQ 1PAEX 3CMQA 2EKNA 1RWKB 2DGWA 2Z4PA 3J7YU 2DJWA 1B4SA 2CPJA 2PGCA 3FZ2A 3K5MA 3U1LA 4U67Q 3T6BA 2XLIA 2BJEA 3GFYA 1KDNA 3A13A 1FTCA 1WELA 5L1LA 3PKMA 2FYXA 1R6VA 3GV5B 3DLHA 2E5HA 2V8GA 2BANA 3CEDA 3D6MB 3OR1A 4O4GB 2CJYB 4DU7A 1VI7A 3M8ZA 1RAAB 1RKJA 3EMTA 2OPQB 1G1XA 5IT9Y 2FZGB 1ZM3A 4IRDA 1YHQS 1GX6A 3PR4A 1JLQB 3FVYA 3QGPA 2CXEA 2QLXA 2KYZA 2E5GA 2DH8A 1RWNB 3HHLB 3C6TB 2QG9B 2QV6A 1NDKA 5D0RA 1RHJB 5I3UA 2WVBA 2JSXA 1GNKA 3HDSA 4C8KA 3AOAA 3RR7A 1VQSA 2HNDA 2BJDA 2UZAA 5K8MA 2PEHA 4EO6A 2AYBA 1M5HA 3CCLS 3VAMA 2GMJA 4L6V3 2G2ZA 3MM7A 1VLYA 1FEHA 2WBMA 5KG7A 5BXIA 3ILOA 2WAQD 4CT8A 2FJAB 2HBQB 2ALZA 3NCPA 4JBCA 1WORA 1R8PA 2Q3PA 4KO0B 1RBLA 4C8OA 5E5NA 3VV2B 1Q53A 4ZCIA 4K5RA 4P72A 4UZBA 3DGPB 3MF5A 5B09A 5EGYA 1BWVA 2DBBA 3PO4A 4FS2A 4LBHA 5L1IA 5KG2A 2YPYA 3UWTA 3HD1A 3SV4A 1C0TA 1CJTA 2HVDA 1FNMA 2OTJS 5HMYA 1Q8BA 2OAUA 1Y9OA 2M8HA 2LLZA 5CHCB 1TL3A 2KL8A 1M1GA 3MMAA 5F8JA 3PHEA 3U7JA 2H5JB 1N4LA 3RRKA 3U02A 1GMVA 2ZWOA 3MCSA 4JI6J 3QO9B 2XG8A 1NU4A 4A47A 3MM8B 4DX7A 3U27A 3O8WA 4YDDB 2I1RA 3AJ1A 3ZZRA 3D67A 2RQ4A 2NXCA 5HO4A 1Y3JA 2W9AA 2NPIA 2KZMA 3MCMA 1NJYA 2MMYA 4M5JA 2K7JA 4DFMA 2CZVC 3QJPA 1JX4A 4A8FA 3D6HB 3AJ2A 3GCXP 4C3MA 3BBFA 4YR2A 1SJFA 3UPFA 3FFIA 3SQOP 4LREA 1JLCB 3B6BA 1Q16B 5ETOA 4CLYA 3CJ5A 1UVLA 2MKJA 2CQ3A 1GAOA 3QSIA 5GMEA 2Z0GA 3BSOA 4PWWA 4B3SJ 2DR6A 3TNVA 2BR0A 4RW6B 2YNGA 3NNAA 5HLFB 1KFSA 2W9BB 2NXNA 2R8KA 2BQ3A 2BZ2A 3G82B 4MJKA 5D6GA 2BE2B 3KK3A 1WTFA 3DU6A 4PG4A 2F7VA 3AD9C 4NOHA 1WG5A 1AFIA 3M8PA 3VWSA 2CJ9A 1FT8A 3MECB 2ALYB 2YWFA 1XC9A 5GMKa 1VMBA 3CCVS 4CTAA 1LK7A 2ADBA 1Y00A 1KQKA 1JKHB 1HQUB 1RA6A 2QTWA 3M32B 3NNCA 1S7HA 3S1TA 1KLMA 3V81A 1R6YA 4ZDNA 1TP7A 4MFBA 2ZFHA 2YKNA 3GR1A 5F3ZA 1PBUA 4F2SA 3L09A 3IWLA 5KOWA 1HD1A 4JI6F 5KT2A 1NZAA 1RTJB 1WF0A 1FJEB 3TUPA 3WQPA 5IM0B 4C0BA 2FUG9 1Z1ZA 2IYGA 1TKTA 4WP8A 4LRBA 3O5TB 3Q86A 1V3RA 3ULHA 5E3CA 4DG1A 5K8OA 4QZVB 1HQEA 3KWMA 2CQGA 1TKDA 1MMDA 1DURA 4I7FB 2AQ4A 3R27A 2BOPA 3RW7A 1HW9A 3PEHA 4URSA 3OL8A 1VQMS 3HVRA 3C14A 1IBKJ 1S57A 5KFXA 3OHBA 4QWBA 1TMJA 2R7SA 3DLKA 4F4ZA 2MHNA 4B3SF 3IM8A 4R8UA 4W92B 3UR3C 3OW2R 3HP6A 3LPEA 2XYGB 1EETB 2DXDA 4KV8B 3TUIC 3ZNUA 4DL2A 4RW8B 2QLBB 3T5LA 4PAAA 2QE5A 5EWGA 5DQHA 4OI0A 4BHQA 4ATNA 2L9NA 1PBAA 5D3GB 2WHOA 5IV3A 1G7CB 3TEGA 3PV8A 4OZ2A 2OGUA 4ECQA 3BO3A 2VHGA 3E51A 2XC9A 1X5TA 2E5JA 2NZCA 3VAHA 1FD2A 3NKYA 1PG5B 3J7A1 2Y1RI 1WSVA 4ZA1A 3H4DA 4IRKA 2HFSA 1URRA 5T14A 1MU2B 1WF1A 4K7QA 2ZZNA 2IAJA 1RHRB 2FJXA 1VQNS 1YZ7A 2LVWA 2Z57B 4Q2LA 4EYIB 5D4NA 4WZQA 5DO2A 3JSMB 5KT5A 3R2DJ 1HD0A 1KR4A 4PRFA 4FVMA 1HFEL 3GWCA 4TXSA 3P8BB 5A8WB 1XK8A 3I96A 1TKXB 4ZJOA 2MPUA 2JEIA 3MOJB 1VBXA 3NLCA 4C48A 1R3NA 4I69A 5M2PA 2R7OA 1FRMA 2CWKA 1QAYA 5KG0A 1Q82T 4M5DA 3O3LA 1L5UA 3I4PA 3RBDA 2B43A 4CM2A 1OPZA 5K8PA 4QIVA 3MD1A 1IBKF 4NZ7A 1U26A 1PYSB 3CJ3A 3M8WA 5L39A 3K5NA 3PHTA 3HULA 1MSWD 3CXCR 4IDKA 2KKHA 2YWHA 3D1HA 3PJXA 3PW4A 3C15A 3SDEA 4OV6A 4PXCA 8RUCA 4CCHA 2VU5A 1RYRA 1Q5VA 3IO1A 2Y0SD 2D9PA 3TW0A 2IA0A 3RGIA 4EBDA 5HMWA 4OI1A 3BGFA 5E3RA 1C1BB 1W26A 3IM9A 3CCJS 1Y7PA 5HI7A 5E0OA 4HVZA 3Q83A 4G1IA 1UA0A 4WIIA 3TO8A 3GONA 3ILLA 3V4IA 4IO9Q 1CEZA 4DCPB 5D15A 5IC6B 3A8IA 4D3GA 4NE9C 2DCUB 1RWUA 2ZC4A 1FRJA 1UMJA 3ISNC 4L75A 5DDPC 3KMQA 3V6DB 4YFUA 2G13A 3FUYA 1JJCB 3OUYB 4A8XA 1HNWJ 1BGXT 3CW2C 2LEAA 3OR2A 4X4NA 2EG2A 2YX7A 2MLZA 4IOAQ 5J2PA 4DXLA 3VHQA 5ETPA 2X1GA 4I64A 1BQXA 2JZ5A 2OSRA 3MR6A 1ZS6A 3ITHB 1YTYA 4OYWA 4OLOA 1MG7A 1X4EA 2EXUA 2IYIA 3HVTA 3MFHA 4JUZA 2RS2A 2H1YA 1XWLA 3M2RA 4X4QA 4RU2A 1W2BR 1R89A 1U1MA 3MZIA 1WC3A 4C9DA 3MMCB 4YEAA 1RAFB 5DDQC 3PCOB 2RRNA 4CI0B 2M7SA 4ZP7A 3H8YA 4DFJA 2CNLB 2IJFA 1UVKA 4TNOA 1DZ5A 2VG6A 4ZOSA 1SL2A 1M1KT 4ALZA 5LJ3Y 1NK8A 3M30A 2NXEA 1X60A 3DRPB 1T8EA 4ECUA 3H20A 4GC6A 1MN7A 5A8RA 1O0PA 3THPA 1LXNA 1URNA 3AJDA 3ET6B 4O44B 2ILYA 2EBGA 4ILLA 1KQGB 2B4UA 2GIQA 1JLBA 1S77D 4OV1A 3DLEB 3MM9B 2H9ZA 1S12A 2X1AA 2C3UA 2MKKA 1P6TA 2LU2A 3GSIA 1FXDA 1UW4A 2FDNA 2QL5B 1YWXA 2YX1A 3JQJA 4TLRA 1LQ9A 4JI2J 3UD5A 2IRXA 2XYPB 1U0SA 3TA2A 3UDEA 3KHHA 5E2QA 2DITA 4M95A 1NPKA 4HTIA 2B6AA 1KOOA 4MKVA 1VLOA 3QIPB 3W63A 3KYLA 2BANB 2H5EA 2BUNA 2AGPA 1HNWF 4AL6A 3W2VA 5BYQA 5IC4B 1RISA 2XULA 1V3SA 2VBZA 3ADAC 1XMOJ 4IG0A 5KG1A 2A2CA 1CC7A 2IMOA 5H9EJ 3JSBA 2M70A 3UCUP 4RBVA 5KFTA 2VA2A 1RT7B 3VAGA 1YIJS 3GG1A 1Z2LA 2DGTA 1Q8LA 2CWXA 1X9SA 4I2QA 1YJTA 2HNDB 1T05B 2XMVA 3CCSS 4Z7YA 2VJUA 3NS6A 1SL0A 5D77A 2EC2A 2Y9HA 2CQCA 2QA4S 3M8QB 4DV3J 4YMEA 2RQMA 3NOCA 2DHSA 2DVIA 2HFUA 3A3PB 1G2EA 2HPUA 5K14B 3SYZA 2BRKA 3GSDA 3CCES 3ZZZA 5LMNJ 9RUBA 1FE0A 3HM9A 4RU9A 2GQ2A 3T3FA 3DDNA 1U45A 4N77A 3UVJA 4P71A 2UV8G 2VFUA 1YX2A 3BDEA 1QVFR 5B0FA 3MEDA 1RDRA 4P2MA 2AJ2A 5DM7Q 4NASA 3R7BB 4WWSA 4ECVA 3G6XA 2DGSA 1FKAF 2BQUA 2HURA 3TUZC 4KGZB 4ZVSB 5LT5A 4JI2F 2RF2B 1RI7A 3O6QA 1FK9A 2JDJA 5F8MA 4DR3J 3BM7A 4O3QA 5CCLA 1SH3A 5FIIA 4CO4A 2PDAA 2PEBA 5J1EA 3FJ2A 2M4MA 4JV2A 4ELUA 4B3OA 4P74A 1ZH5A 3P5BP 4EGLA 3EM1A 2RJZA 5K5MA 2XO6A 3EZUA 5A8KA 1T9TA 2R7VA 3Q2TC 3ENWA 3M6VA 1XMOF 1ZZNA 3D66A 3ONQA 4DL4A 3PFEA 5L9XA 3MHYA 4G65A 1HPZB 2UU9J 3KLIA 2M0GB 4ECZA 5F8HA 2V68A 1RK8A 1TTHB 3FSXA 5B08A 4PXBA 1I1GA 4CH1A 2F5GA 1Q5YA 4GKKF 4DV3F 3OLBA 2ZH8A 1NBEB 4QWDA 1CQNA 3KLHA 2HFOA 3QJJA 2YNGB 4DV7J 2OPSA 3HFVA 5L1KA 4C8LA 4OHYA 3IS9A 4NRUA 4NLPA 3LH2S 1JB0C 2HIQA 4LR8A 5LMNF 1NSKL 2MEWA 4OI3A 3Q23A 2U2FA 3E3XA 2PMZD 2HK2A 1BQNA 1QDUB 4NEZA 4ICLA 4K2JA 5KFVA 1RTIA 4Q2MA 1R0CB 1RWVB 2O1PA 4FYDA 3UD4P 4ECWA 4CLKA 4WXOA 1UFKA 3MURP 2HEKA 2YVSA 2HRTA 2YWGA 3GIKA 2B9YA 2J0SD 2ZEJA 4KH1B 2IM2A 1FCAA 1C0UB 4CIOA 4XK8C 2JFDA 3ZTSA 2O5DA 4MFBB 1MMNA 2GCFA 4DR3F 4PKDB 2AT1B 1EHWA 1ULRA 5F0WA 1Y10A 2A1BA 4DJBA 1SQEA 5CYQB 3F0NA 1S1WA 1FRIA 3SEOA 5DG8A 1VRTA 3AHPA 1VJQA 3TX8A 1JLEB 2Z2LA 1X5OA 3DRXA 4CO1A 5KFUA 2AJ4A 5HBMB 2FHOB 1Y5IB 1HQEB 1X8DA 4DF8A 3KDOA 2YX4A 2UU9F 1HIYA 3BR8A 3C14B 2DXEA 2KVQE 3KJQB 1HWUA 2I0XA 3CCQS 2ASJA 3PFOA 1QM9A 2WW4A 1P9YA 3WX8A 2OI2A 4NI2A 3UD3P 3MUMP 3ZZOA 2K3KA 1FDAA 2LP4A 4K4UA 5E7OB 2CQ2A 4CNYA 4DV7F 2D3OR 3PW2A 2EFNA 2CYYA 2P2CB 3H2VE 3CMES 2P8IA 4Q8FA 4PG5A 4ZCLA 5MLCV 1R8BA 4DL0C 2IRUA 1S6PA 3TAMA 4OYMA 3C16A 4R5PA 1RWPB 1YZ6A 1QAIA 2HGLA 3TZXA 3W3SA 2IAJB 5SZTA 4OYBA 1FDBA 1FRKA 2JLGA 2G4BA 3MMJA 2A6MA 2GVDA 2IC3A 1VC5A 4Z37A 2ATCB 3W8GA 2YKPA 3GQCA 1HWIA 4C8MA 2QL7B 4DV2J 4QYZK 3DM2B 5JJBA 2PC6A 5HSPA 2RRBA 5IQ6A 3JTNA 2OD4A 2VASA 3CULA 1U1RA 1ZYQA 2IVYA 2C3YA 1Q0NA 2IRYA 2FVRA 5HP1A 2N3OA 3NEKA 1SQGA 2AJQA 1XN9A 2DPJA 1SKRA 2QT7A 1NHUA 1CG2A 3I4HX 2QA1A 3DNCA 3R6GB 2ZH6A 2GV1A 4CLLA 1RCOB 4FZVA 1KHVA 5HVGA 2MQLA 3D1QA 5D4LA 4O3PA 2RD5C 3IN5A 3NGUA 1QVGR 3KLVA 3CIZA 4RPFA 2YNHA 1TK8A 3KHLA 4KAIA 3C19A 1VYAA 2YH0A 3J7AN 3C15B 3V6KA 2KHCA 3A8EA 1YI2S 2PMWA 5HMZA 4MKAA 4N41A 4KGVB 2H54B 5HL7Q 1R0AA 2C2ZB 2XS2A 4ED2A 5EUHA 1UEVA 4I68A 4ZPAA 2RHSB 4FXDA 2E7VA 3MPWA 1D8YA 4O0IA 2W2MP 2XZWA 3HF5A 3I0SA 1H74A 5DRKA 3H5SA 3HLUA 2GW8A 2ZH2A 2KH9A 3DRRA 5KFJA 4KGKA 2Y8YA 3V4IB 3JSYA 2VONA 2YQ0A 3S8SA 2DPIA 2FVCA 5J2MB 2G0JA 5B0GA 2F8MA 1WWHA 4KTQA 2MB0B 4EUVA 4ETZA 2JX2A 1NUEA 1UW9A 2LEPA 4J5OA 4RWXA 1ZTTA 3OR2B 3IR7B 1S1XA 1RLCL 3VVTA 1NKEA 2PA3A 3SSRA 2RE1A 4C4WA 5EHHA 4NLGA 1G6BA 1M1HA 2FPHX 5F8IA 5KFWA 3DOMB 3M2RB 4F0MA 4AE5A 4I67A 1KOHA 1YK9A 1NJZA 3VQTA 4ZLNA 2C2MB 2KT3A 1Q4RA 2OPPA 2V8HA 3DYAB 2HVHA 1KEKA 3FRYA 4YB6A 5LSLA 2V50A 2VG6B 2EWHA 2GMLA 3AOCA 3W2WB 3M30B 1QUVA 2CQHA 3RAMA 2R7QA 1IXKA 3GYNA 3HK2A 5A8RB 3CC2S 1XERA 2KRRA 3H42A 4WTOB 2Y3YA 2KXHA 4R0JA 1U47A 3KG1A 3IRWP 3VAJA 3AOBA 2DRAA 3PG9A 2ZNZA 1VBKA 2P6TA 4PG6A 3DXBA 3QLHA 1JXEA 4ID5A 1C1CB 2D3UA 5LXRA 4ZHRA 5DGAA 2NREA 1FNXH 3Q8RB 1PYTA 4K59A 1U1PA 1EJ7L 1SUQA 5LL6d 4FF3A 2CPEA 1B0PA 3EVWA 3RRGA 4J7CA 4GO5X 2QSFA 4L73A 2B6AB 2K1RB 2DGXA 3M1VA 4NEYA 1N54B 5J2QA 3AD7C 2HW3A 1YLXA 1OY8A 4USUA 5D4PA 2QIFA 1VBYA 3KUGA 3AQPA 3WBZA 3W2VB 3MPUB 2DIVA 1AZSA 2Y0BB 3DOLA 3CJRA 1SJ1A 3MPVA 5C5JA 1S9FA 3NNHA 2VC1A 4KB7A 4BDPA 1RT3A 2CJBA 1U4BA 2MZTA 2R2UA 2FC9A 2EBEA 2V6AA 2FJVA 2XMUA 4RUBA 3F41A 1RTHB 1J5EJ 1NPRA 4DR6J 2O01C 2UVRA 2Y8WA 4K4VA 1RWMB 2RKIA 4DLGA 4OYAA 3CDWA 3LWLA 1B70B 5IT4A 3HO1A 1TK0A 2E9ZA 4PABA 2B7CB 3S7RA 2HNYA 1NZ8A 3EZ5A 4DPOA 2VICA 1UWBA 3HFKA 3HHEA 3DN9A 4GVBA 2HHVA 3VAIA 2QLWA 3QZ7A 2R7WA 3A12A 4QQBA 4KPYA 3EGZA 3QT5A 1FD8A 4L76A 4DR1J 3GU0A 4ZIWA 3WZ0A 1VFJA 3SBMA 4ZVTB 5EWEA 3K89A 5JXSA 3P96A 5ADZA 5L1JA 5KG6A 3UVJB 3SFUA 1H7XA 3BQ2A 5C42A 4LF9J 4GMKA 4O23A 1VQLS 2D69A 3PW7A 3GFHA 1RXOB 1UETA 2IIHA 1U1LA 1RAGB 2ATLA 2YKAA 1JMTA 3RZAA 1HNIB 1H3DA 2KI2A 2CPZA 4XTTA 1WG1A 2CA9A 2W8LA 2LQ5A 2DR5A 4ED1A 1FK9B 3KOAA 1AYEA 4RW9A 3OQ2A 4QBUA 4PWDB 4I4BA 4ER8A 2HS0A 4Y65A 1CJVB 2VV5A 4PQUA 2DEJA 5DQIA 3OFGA 4ECSA 2ZD1B 1RHUB 1F5AA 2Q79A 5A8KB 4RW7A 3BSCA 4PPZA 3LP0B 4JOUA 3V5RA 4K8RA 2KZZA 5DDRC 1WHYA 4KSEB 2QSWA 2W4CA 1J5EF 2B51A 4DR6F 2VG5A 4WF9Q 1DQ9A 3KLIB 2FGOA 1T9YA 1ZZFA 4C97A 3CF5Q 1H2UX 2FIUA 3R5CA 2OPRB 4P73A 3PIPQ 2K8GA 1LFPA 2HQIA 1S0OA 1F6TA 1GMWA 3GIIA 2ZE2A 4WP3A 3KJVA 1AB8A 3CJ0A 3IS9B 3BGOP 4DR1F 5IS2A 3CO0P 4NA1A 2ZDOA 5L46A 4ZLJA 4TYAA 1X9MA 1ZTWA 8ATCB 3M8RA 1CSJA 4LF9F 3P6YC 3DI6A 3JAMU 2W4DA 3NL0A 2AX1A 4ED8A 4XAKA 4IUFA 5CH7B 1WEXA 4HDHA 3Q2SC 4HT7A 3BYRA 1AA1B 4DQSA 2KO1A 2UP1A 5KT3A 1FJGJ 3FSYA 1K73T 3NXZA 4NLTA 3ICLA 2F3JA 2L48A 1D1UA 4CLSA 4RO0A 5IT9U 3GG0A 4B08A 3CJSA 1ITPA 4ILMA 3CWJA 4I1TA 1IJEB 1O8BA 1KWMA 2ZJPQ 3W5ZA 5CYJA 5E41A 1YGYA 1QSSA 4OZ5A 1OYDA 3H2LA 5D0GA 2Y1LB 4AD6A 3NMRA 3US5A 3RAXA 4QU7A 1H72C 1JLQA 1YRXA 3UDLA 4AYBD 3THTA 3NS7B 1U48A 4ZVOB 3F56A 3LW5C 2MY7A 3LOUA 3HHLA 1NDLA 1NNDA 5KFBA 1S72S 3C6TA 2DD8S 2DEIA 2KJVA 5HATA 1EARA 4M8LA 4PYDA 2W7OA 3WC0A 3Q24A 1YBUA 7FD1A 1O6XA 1TZ0A 4TN2A 4PR6A 3WIUA 3RBXA 1KTQA 1OJ4A 1K0TA 4UY8T 2CRLA 4Y2AA 2CDQA 3BR9A 5F8LA 2IBOA 4DSEA 4OHVA 1B7YB 2QFJA 2XMJA 1S6PB 3TAMB 4J91A 2EW9A 1U49A 2RS8A 4MTPA 3BBCA 3DLJA 3DGPA 1T7PA 2ACYA 5HVFA 2CNNB 1FXRA 1ZM2A 2HSEB 4QWEA 2NXJA 3UDCA 1KC8T 2ZM6J 1W25A 4OHXA 2VKRA 2QYCA 4K4YA 2ZKTA 1Q1KA 3CDAA 3BQ1A 4O3OA 1FJGF 1SC4B 5KOXA 3UW1A 2YPZA 4L3KA 2KFNA 1F9HA 2JEFA 2WVFA 4N7TA 1B64A 1EQ0A 1VIXA 3BJYA 3FCVA 4OI4A 3QO9A 3MM8A 1UFLA 2VIHA 2J8SA 3PRDA 3K0JA 3B82A 2KG0A 3PVXA 5HAOA 1DHMA 1TUGB 3R3TA 3C66A 1CVJA 3IG1B 4JI4J 4TY8A 2R7RA 2QA4G 1NK6A 4USVA 2HHHF 4KY3A 4B3RJ 3MI7X 3W9JA 2ZWPA 3LGNA 1OPIA 1LW2B 2BV3A 1FE4A 4B17A 4JV1A 4CLWA 3DFEA 2PSZA 4X62J 3K57A 1WC6A 4CO0A 3G71S 1K1QA 4AXIA 3TJAA 3C3LA 2J9EA 3UQSA 2UXCJ 5KFMA 1PSDA 1X31C 3RAQA 1RZMA 5C25B 2UVWA 3D3CJ 1REGX 5HLFA 1NEEA 4M1KA 1IN0A 1UVNA 4YB5A 1S0MA 4K4WA 3CCZA 3G82A 3ZZ0A 3NGTA 2CPFA 2J5AA 3I0SB 2LYVA 5T41A 1VCTA 5KTQA 1N32J 1ZPVA 2DB1A 3TYTA 3MMBA 1RA7A 1QLNA 2KT5A 4J9MA 3MECA 2QLFB 4NMXA 3R5DA 2DGOA 4BC7A 2ZM6F 4LR9A 1JKHA 1HQUA 3OSNA 3M32A 4UUWA 1T9XA 6AT1B 1RLDA 2BVZA 2CNKB 1QUPA 1S0VA 2YWKA 3V2UC 4RL1A 2OMOA 2HHSA 5LJ5Y 3G96A 1FNOA 2HIYA 4QU6A 4QW8A 4A8OA 2I6WA 5IM0A 3MCOA 1F9FA 2M9KA 1N52B 3CJQA 2W24A 4KT0C 3KFWX 2FZKB 4L74A 2DR8A 1X4BA 4JYAJ 2JC0A 2DR9A 4JI4F 2E9TA 4C3LA 2BX6A 3G8QA 4OZ3A 1N36J 1RAIB 2DYAA 2EPIA 4P2XA 2IM3A 4B3RF 1FX4A 2G0CA 4O4RA 4RUAA 3E01B 3PR5B 2XZTB 1VRUA 4X62F 4F4WA 2XHCA 4J9KA 2AGOA 2EC0A 2UXBJ 2UXDJ 2MZJA 4Y6IA 3H2UB 3IC1A 2UXCF 1C2PA 2MZSA 1B0TA 4NRTA 2G1DA 5IQQA 2J6TA 5A0YB 2FVPA 2VUGA 1WSRA 4U7UK 3LA0A 3G2XA 5D3GA 1GXTA 2Q43A 2KM8C 4ID5B 4F67A 3OL7A 4C8ZA 3UR0A 4ZHRB 1N32F 1T03B 3DRYA 2XY5A 3EDQB 2NR0A 3VR1A 3QRQA 5KAKA 1RU1A 2GC8A 3IP0A 1SUQB 4ID8A 2LMIA 1ICEB 1CLFA 3T6JA 5F9NA 3MM5A 1MU2A 4XDDA 4DQPA 1CJKB 1N33J 1HW8A 2OHDA 1M5KC 4FP9A 3IXQA 3QQCD 2HAIA 3JSMA 2ZHBA 2WBRA 3DOLB 4NCGB 2JEJA 2IA6A 1YJNS 4W98A 2FVQA 3U1NA 4LFCJ 2R3VA 4MIWA 2J0XA 3DLGB 2BABA 4FKYA 4KYZA 5A8WA 1QD1A 2BE9B 4EEYA 3D9BA 3Q22A 1KBRA 1TKXA 2X3DA 4JYAF 5C24B 4WKYA 4FVCA 2RILA 4ZPTR 5CCMA 4ZIVA 2FC8A 1N36F 3BEGB 3I9ZA 4DDFA 1VQOS 2HBZB 2ZHOA 4USJC 4QPTA 3N28A 4F4YA 4HTJA 2LQ9A 2IVMA 5CQGA 4AQYJ 4GVBB 1KS2A 4YN3B 1B99A 4MIAA 2UXBF 2UXDF 5IOLA 3B78A 2A0FB 3H5YA 1UEUA 2BJ8A 1SJRA 1LWXA 1X4GA 1WF2A 1OY6A 3V6JA 3KUHA 4Y34A 1SJ3P 1OSCA 1TELA 1SXLA 1XBWA 2LQJA 4KGXB 4BS2A 1ZAVA 2MY8A 3JQKA 4ZVFA 3MAHA 1A0OB 1C1BA 2E1RA 2BA9A 4LFBJ 1LW0B 3RRHA 3TJ9A 2UUAJ 3BQ0A 2AJFE 3W5XA 1UJ5A 3FKBA 1KVJA 1XTZA 3W1YC 1R27B 1N33F 1HBNB 3ENVA 5L38A 2VZ9A 1VR6A 2I8EA 2GX8A 4IOCQ 2U1AA 1RJJA 1FO1A 3V6DA 3HT0A 3OUYA 1ZBTA 2LDYA 1M5PC 4LFCF 4ECXA 4HHUA 2UUBJ 1JLGB 1S76D 5IV4A 1SH2A 2GVZA 4X2BA 3GLJA 3RB3A 5HN0A 2Z56B 2VG5B 1TAQA 1AROP 4YP3A 3ITHA 4ED7A 2J9CA 3VZHA 2VPWB 3O44A 4ZPDA 5KFSA 4X66J 1MWZA 3A8JA 2VKZG 1U24A 3L4BC 2J6SA 4LF4J 1TQLA 3HKWA 2AEMA 2LFVA 1FA0A 2C2NA 4AQYF 3FNNA 3MMCA 1MW7A 1TMMA 4WU3A 2X1FA 2ZE2B 3OD2A 5CYMB 1KSPA 4Q8EA 2NQPA 1DTQB 4W90B 4OJGA 1YJRA 2KB2A 4O3NA 3J81U 4A8MP 4YUDA 1YJWS 2WSEC 1W2IA 2IFXA 1S97A 4IFVA 1WACA 3HHLD 1AXQA 4IOBA 4PXEA 2C2EA 2BW7A 2WOMB 3DRPA 4M5GA 2V4JA 2XI3A 4OX9J 4HHJA 4FF2A 2W25A 2E7XA 3OTCA 1KN6A 1NH8A 2HBYB 3M8SA 4WBFA 4LFBF 3DLEA 3MM9A 3CSKA 4JP8A 4LVNP 2WCXA 2V9KA 2FVSA 4NZ0A 1WC4A 2YY3A 5KG4A 1N8RT 2UUAF 1SCJB 4DF4A 4JI1J 4OHZA 4WCEQ 3LUYA 3JAMY 4ZLPA 3CD5A 2B0GA 1VQ5S 1T3OA 2ERRA 1S59A 2YNFB 1PJ6A 3M7VA 2ZH1A 1N5SA 2CIMA 3QT8A 5GMDA 3QIPA 2JLEA 1UA1A 4UZCA 3F44A 2HGNA 2AF6A 3CCMS 4LQ9A 4CM0A 2UUBF 1KVIA 3PRVA 2G2YA 4B9LA 2D3O1 2VBWA 2XM3A 1G4CA 1X4HA 4PYAA 3AH6A 4NA3A 4I2PB 3ZXWA 2DHGA 4X66F 3FEYB 4FS1A 2XMMA 4P6QA 2VPZB 2MKHA 4URQU 4LF4F 1RHQB 4K4SA 1RT7A 2WZ1A 1P1LA 1PKUA 4B9TA 3POTB 3I31A 4FYWB 1T05A 3W9HA 3NGRA 3NRBA 4WFYA 3M2UA 3GMGA 2OIHA 3M8QA 3CJ4A 4CH0S 3M6UA 1KVKA 1AW0A 4ZN3A 1D3WA 3H25A 5K14A 3DCAA 4DQIA 2IPOB 2C1EB 4X4SA 4L72B 2R7TA 2QMXA 2HZAA 4DEZA 2UUCJ 4F50A 2DNNA 4OX9F 3L9ZA 1BQMA 4LFAJ 3I82A 3D2WA 4W4MA 2LECA 2YXLA 2YWEA 5GADI 1S6QA 5AE2A 4F3MA 3TANA 4JI1F 4QR2A 2B5JB 4F3QA 3GE9A 1UKUA 5GADU 2RF2A 2XEXA 2XO7A 3FGVA 1WC5A 2XSFA 2YTCA 3AXMA 1RACB 1OO0B 3BKUA 1NKBA 1FEEA 3H4BA 2C42A 3BH6B 3EXCX 3V6HA 3J81j 3NCRA 4C3KA 3IGNA 3BF4A 4OFZA 1SKWA 4C2MA 5F3TA 3ZTOA 2C3PA 1HWJA 2M88A 3TOQA 4OZNA 1QTMA 1IVZA 1D0EA 3MGJA 4ZN1A 2E44A 4MIBA 4DSKA 2EFGA 4A8WA 1AUSL 4TY8B 5HANA 2J0QD 1T9WA 1RU2A 2G2OA 3KMSA 1S79A 2ZJRQ 2MQ8A 1HPZA 2I38A 1T94A 1PIEA 4QJVA 2EFOA 1NK5A 3R7NB 5ETTA 2LDIA 4LBIA 2GFFA 2XCAA 2XI2A 3EJMA 4P9SA 4RR5A 1MLAA 5KFIA 2O3DA 3KHGA 1H0HB 3UO0A 4FNHA 2ZJQQ 1QSLA 3NGSA 3TI0A 1Y5NB 4RNMA 4P7TA 5A76A 1BC6A 3D0IE 2DO4A 1FI4A 4DL7A 3R5JB 1F3FA 1RAHB 2WONA 4LQ3A 3UNGC 3DMJA 3GPAA 2DCLA 3DOKA 3L7OA 2UUCF 3TQEA 4RW4A 2QYGA 4HEA9 1N5TA 4LFAF 1K0VA 2ASDA 2DGUA 2E7WA 2IDLA 5DM6Q 3MMBB 3TUJC 4IG3B 1SKSA 1M0SA 1WUUA 4OX6A 3J7Z5 3BSAA 1TL5A 3PNIA 3OTEA 4MH8A 4I0WA 2F4VJ 2QRRA 4UOGA 1C0UA 3PW0A 4NLUA 3TP2A 5EX0A 4OJ1A 2EKYA 5BR8J 4N47A 3W5YA 5CYQA 1S99A 2JC1A 4KR0B 2V0NA 1NAQA 1YJVA 1JLEA 2B4VA 3GYXB 4FNIA 3KK2A 1YITS 1KHWA 1HBOB 2JVOA 2NCKL 1UFWA 3AAWB 1L3UA 3MR7A 5HBMA 4Y2IA 3PX6A 1SJQA 2FHJA 1SKUB 1RWWB 2BBEA 1N6QA 5KFLA 1RTDB 3MM6B 3ETMA 1JIHA 2V8VA 2AEJA 1VRUB 5AJ3J 2PI5A 2CG4A 4AUKA 3B4DA 4C8YA 7FDRA 3CJ8A 4DX6A 2Q66A 1CS4B 4CWBA 3NWGA 1LWFB 3NCQA 1CULA 2O66A 2AMCB 3LQVA 4AXJA 3PIOQ 2G1HA 1KQFB 1QSYA 3KLFB 2BOAA 3EPGA 4QIEA 4CLTA 2QFIA 1YJUA 3W8PA 5CABA 2I9SA 4NYOA 3Q8QB 5DZ6A 2UV8A 1NDCA 3HJFA 1BY9A 3MAQA 2POKA 2HK3A 4M63A 5DZ7A 2OSQA 1NK9A 4TYBA 4J9QA 2JJ4D 3RYLA 2FD2A 1CC8A 4LRAA 3RJMB 5A2QY 4F8RA 3EPIA 3D28A 3N6MA 3BREA 1RAJA 3MM5B 5KG3A 1NSPA 1CPZA 2BM1A 3PRBA 2R42A 1K8AT 1CQMA 1K44A 1R8HA 2XB2D 4LSZB 2F4VF 4UW2A 3DDKA 2BW2A 2MQQA 1M5SA 1DJ0A 5I42A 1S5ZA 4LRDA 5BR8F 2MQNA 3QAEA 1HNVB 3DM2A 5ETVA 1O51A 2PMHA 2DNPA 1BMQB 3UN2A 4F0HA 3RBEA 1HHQA 4BCAA 1SVDA 4C7QA 3OT9A 3VZIA 3CMAS 2GJ2A 1BUXA 4Q43A 4H4KC 2C22A 1HHTP 4HI2A 2D3ZA 3OVBA 4MKBA 2MKYA 1TUVA 3FZBA 1S4FA 4ELVA 3CD7A 1A9NB 3BO2A 1IKXA 3FEXB 5AJ3F 3NP5A 2Y1IA 4LF6J 2N4DA 2HRYA 4IH7A 2ILZA 1JWWA 1HI8A 4NYZA 4QR1A 3IA0A 5ETMA 4LR7A 2DISA 1HL6A 4WYLA 2FZCB 4M5MA 1Q7YT 3ELHA 1S6OA 2Q6CA 2GZOA 1BD6A 2AX0A 3OJUA 3PDNA 4M5KA 4DX8H 4Y2MA 1DQ8A 1Y11A 1I6JA 3FBCA 2HVEA 3OFEA 4RWWA 5ETQA 4U7CA 2LU1A 2GA7A 4OHWA 2FJWA 2ZH9A 3OL9A 1HNXJ 1FTRA 1UZHA 2W9CB 4CH7A 3GP9A 2FLOA 1WOSA 4PUOB 4DI6A 3PX4A 4LSNB 1LOUA 2HKEA 2ZOMA 4CQ1A 1N5YA 4ED5A 3G86A 5J2MA 3QFHA 3CCWA 1N48A 4WJBA 4FDFA 3BGRB 4Q5VA 1LNQA 1QE1B 2RHQB 4B9NA 1P8GA 2AD9A 1DBDA 2ZKUA 2PI4A 2DNZA 3IRXB 2KN4A 4B3MJ 4O3SA 3EVOA 1V3ZA 1ZA1B 2HHUA 3CTRA 2J7WA 3VQSA 4C6AA 2L9DA 3PKYA 5DETA 2GVZB 1PJ5A 2RDIA 2DNHA 2DY9A 2PIIA 1PYOB 3W62A 3VGSA 3LGMA 2CQIA 2HRUA 2ZZTA 2X1BA 3D68A 4A8SA 4HT5A 2HBRB 5AXNA 2BJ1A 3CJKA 4FKXA 1Q86T 3DOMA 4WFZA 4UF4A 2G0IA 2CJXB 3EGWB 4NCBA 4F2RA 1SC3B 4WIQA 2ZDPA 4LF6F 5C2CA 1KP6A 3WX4A 1U7LA 3H5UA 4DR4J 1TVRB 2V69A 3GILA 5CZVA 3DYAA 5THWA 1VHFA 2R8HA 3L7PA 3ZZYA 2E1MC 2QO3A 4ITSA 1Q95G 1IBMJ 2ZBPA 1WI8A 3DDIA 1JLFB 3W2WA 1WD6A 4IFVB 4QCLA 3H59A 1TKZA 1DTTB 1HYSB 2QA2A 1OIAA 2V4JB 3J81Y 4UUXA 5T7LB 4I6WA 3K58A 2MQOA 2NZ4A 2H5IB 1PJ7A 4QIWD 1HNXF 4OQJA 1C1CA 3CDUA 1X0FA 1CJUA 5A6PA 3PACA 1VHIA 3E8OA 4HI1A 3UE2A 2R7UA 1L3TA 2RDDA 2CADA 2RSQA 5AXLA 2AYMA 2MZQA 4EFAC 2CQ4A 1PILA 4CP5A 4NMLA 2K1RA 3DLBA 2DO0A 3HX9A 4GRSA 1DLOB 4B3MF 2KG1A 1S9EA 5CD4H 1XNQJ 5F8GA 2CAJA 3HKZD 1GEHA 2Z2YB 4YQWA 2EFPA 2OEKA 3IFEA 3GFZA 2DHHA 2ZNYA 2VPXB 5KFDA 5KFEA 4ES3A 4OZ1A 3QJLA 4NA2A 2B8PA 1RTHA 3MFIA 3SCIE 4FYXB 2W4PA 4MT1A 5IXUA 2XGPA 1S10A 3N0VA 4K2XA 4HACA 4AL5A 3R2CJ 1AFJA 3OTOJ 1HBUB 4V19X 2MZ1A 2FLNA 4RNOA 2H65B 3ZC4A 1FVSA 2WW8A 1R31A 4DR4F 3M2UB 3JQMA 5DLFA 3SQGB 4GKKJ 1FFWB 3H7HB 4DPWA 2LQ8A 1IBMF 3TA1A 3N5FA 4ECRA 3RBZA 5J2NB 3R5AA 1XR7A 2VG7A 1VISA 3VTIA 3K8WA 5HQLA 1WTBA 4MYUA 1RTZA 4R25A 4BBYA 2UVUA 3TQ1A 1NJWA 1FFGB 1BQMB 2MHEA 1WEZA 3W7BA 3R1LA 3BPSP 3LTOA 1U02A 3DC2A 3EX7B 1KD1T 1VQ4S 3HCXA 1RT6B 4NPOA 1S6QB 4OYXA 3EDRB 3G8TA 1X0PA 3CT9A 1HNIA 4M5LA 3MUTP 4EO8A 2RT3A 1IR2A 2RU3A 3A1YG 4PWDA 4NX9A 4LMZA 3QZ8A 2V4RA 1CJVA 5ETKA 3KK1A 3HHDA 1RWXB 3OVSA 1UCNA 3M9OB 1XNQF 2ZD1A 4WFXA 3QRPA 2OTLS 4TY9A 1IJFB 3LP0A 4J9NA 1I5OB 1UZDA 3LP2B 3T1HJ 4DMZA 4IYQA 2HAFA 1V5VA 1IQTA 2C2DA 1OYEA 1RSCA 4J9UE 4F36A 2ZVSA 2ZBIA 1U09A 4X4TA 3OTOF 3MEEB 5LSOA 1ZPWX 2OPRA 3EVMA 2MQPA 1J2VA 1S1VB 2JNJA 2N7CA 1IBCB 2GMHA 2OO4A 1R8CA 2BQRA 1S7IA 1OY9A 2R8IA 4JI7F 1S1UA 3ZO7A 2AYEA 3FCWA 2WONB 1E6VB 3DMJB 4CLFA 2DKOB 3QATA 2BMBA 4DFPA 4USTA 3DOKB 3G9CA 2AIRB 4RW4B 1LXJA 1M5VC 3Q0AA 4H4OB 2B8QA 3FDSA 5D0EA 2BE7D 4YY3J 1FX2A 2M8DB 2BJ3A 2X51A 2DNGA 2GIRA 3CD0A 3AB4B 2YKOA 5HROB 2J0WA 3MR3A 4OI6A 2HWHA 4ES1A 3MXHP 1NPPA 3VGVA 1S0NA 1UTAA 4KIAA 2BM0A 2XYHB 3MDFA 3SIPB 2M52A 2KVIA 4B9MA 1VQ9S 3G8SA 2DNOA 1FDDA 4F4AA 4DN9A 2V94A 3MEGA 4IO1A 4USWA 1FF2A 4DL3A 5EWFA 1TL4A 3Q8YA 3KG4A 3TAPA 2I5JB 2LA4A 2R7XA 5FJ4A 1WC1A 3C6UB 4TU9A 4GVLA 3KK2B 3N9UC 3C46A 5FDLB 3JYTA 5BJRA 5ITHA 1KFDA 2JOQA 3WHIA 3T1HF 1UVIA 1S48A 1F5CA 2VDIA 1N6QB 5EX3A 3VGTA 1GH8A 1FXLA 1TV6B 4KHPJ 3R7SB 1YG0A 2VF3A 3JSRA 2JHEA 1ACMB 2ZITA 1MMLA 1SV5B 4I56A 2CFXA 5B0DA 3D7SB 4EZ9A 2HQGA 2J9DE 1HBMB 3BN4A 2DGVA 2ADCA 4G1PA 5FLXU 1CULB 2QEXS 1RT4B 4DHVA 2CQDA 3GCWP 3ZZTA 1M5OC 2B7BB 5M2UA 3D3BJ 3CPWR 2QC3A 4TQRA 4DUYJ 4F3OA 1YJ9S 4OI2A 3LPYA 8AT1B 4LSLB 3V4MA 4NXNJ 3QMQA 3VGUA 1X7VA 2CQ1A 2WSCC 2BKOA 2KRBA 1E6YB 3IAM9 3G6YA 1RBAA 2CPXA 1PAUB 1U1QA 4YY3F 2YKMA 2VFVA 4GC7A 4KKOA 1ZOTA 3D6FB 1ZAXA 4ZS6A 1UPPA 2H4WB 3OBIA 3HSZA 5M2RA 2RRAA 3W61A 4FYYB 5C2GA 1IKWB 4ANEA 4DPYA 1VDHA 5F0UA 2B3TB 4X4VA 4BLGA 3X1LB 3M4XA 5I42B 2MKCA 3MD3A 1RT5A 1QAXA 3PJ9A 3TVKA 6FDRA 3GIJA 4EI2A 3KLEB 2JLFA 2XSJB 4CO2A 2HQ3A 2H48B 4U96A 2BJ9A 1S1TB 3NAHA 1N5QA 3EWGA 2P5VA 3QSYB 2ACMA 2VQFJ 4DQQA 1NM2A 1TL7B 3L3CA 4KHPF 3IG1A 3K5PA 2ZH7A 1YVFA 2A18A 3OTDA 5B0EA 1IKXB 3QNWB 1U6FA 1T95A 3PEJA 1D8ZA 3I55S 1SIWB 1LW2A 1U2RA 4URGA 4B9SA 5KT6A 2C3OA 1FWLA 3E2EA 1UVMA 3GIMA 3O1LA 1LFWA 2R4FA 1FRLA 4DUYF 3TZZA 1F3VA 2ZBCA 4M5HA 5C25A 1VQ6S 4NXNF 2Y1JA 1TL1B 4DL5A 4DN0A 5FD1A 2AZ3A 2DNRA 4J9OA 2HYIB 1WOPA 2HGMA 2N82B 2OUGA 4U6PA 2EK6A 4UOCA 2FLPA 4G6VB 3FQKA 1N5YB 4XPEA 2K06A 4DU8A 3K59A 2P6SA 2MYFA 4KFBB 1NHVA 4PXDA 4DR2J 1WHXA 1H38A 1U0HB 5K9FA 2DHAA 2MXYA 4YDXA 4G3IA 2FHKA 4LT6A 4WTYA 2IDEA 3JS9A 2F9JA 2N7YA 5CA5A 3K8VA 1SB6A 2M3DA 5L8RC 1UWAA 5KT4A 3B54A 5HJYA 4ZCKA 2VJVA 2B4PA 3FBEA 4OYPA 5DG7A 1RT2B 1RAEB 2V5HG 2AV5A 2B9XA 9ATCB 3ILJA 4DPTA 5KFYA 2BACA 3CJKB 1F2GA 1FRHA 2VQFF 1X4CA 4PZVA 5G0RB 1ROFA 4N5SA 5LSRA 2EFQA 3GV7B 3AD8C 1D9AA 1JK9B 2AP6A 1S9GB 2FHMA 3IBFB 1JLAB 2GJIA 1P1TA 5H9FJ 3TR5A 5AE1A 3FSIA 3E01A 3ZZPA 2ASYA 3ENQA 4EBCA 2XZDB 4OIXA 5KG5A 3Q8SB 3MTJA 4YOEA 3HI9A 3I5BA 4JI5J 3ZNJ1 5C7PA 5KFAA 2EEYA 2RDJA 1HLWA 1REVB 1D09B 4WP9A 2R9LA 2KJWA 3A3NB 2VODA 3TARA 1RABB 2MTLA 4OJ3A 4ZLLA 4H54A 1TKZB 4U8YA 1DAXA 2FJDB 5KFGA 4ZK7M 3CC4S 4IRCA 2JEGA 5A0YA 3GFXA 3GJTB 4NLYA 4GKJJ 1T9VA 2E29A 5BYRA 2KYXA 1SIZA 3CVKA 5IFMA 4HKQA 1N0VC 4AFFA 2C2KB 4XPCA 1TR0A 4UTGA 3WC2A 4DV4J 1X5PA 4ZPCA 1OMSA 1T03A 3DGVA 1CJUB 3N5BA 4K4XA 2RB7A 4U8VA 3P45B 1V5IB 3EGVA 3TAQA 2YBVA 4PPDA 3RB0A 1YRTA 1FDNA 3IAS9 4DR2F 3MR2A 4OYOA 1CJKA 4ZVPB 1WI6A 3R9LA 3PW5A 3MPYA 4ZKAA 2GQCA 3BN7A 4ANCA 3IR6B 3MTKA 1S9EB 3TA0A 3HHNB 3I0RB 3MAAB 4NCGA 4Q0BA 3GIRA 4UT4A 4LRCA 3KNGA 4LIRA 2AYGA 1HQ2A 2E1PA 3DLGA 2FB0A 4HH0A 1P9QC 5I3PA 2H3EB 4QW9A 4KRWA 5A6WA 4ZITA 5C24A 1TU0B 1NK4A 4HACB 5JUMA 2MSTA 1HARA 3GZ7A 3BGUA 1FKOB 1HWKA 1J5OA 4YR0A 4AL7A 2G9OA 1YRUA 4FXWA 4F0KA 4I6YA 2IJRA 1HMVB 3F73A 4JI5F 4EK2A 1U2CA 1LWEB 4U7UD 3R97A 2VG7B 5LXYA 1JXVA 3HD2A 4MK9A 3G6VA 4HDGA 1K1SA 2HVZA 2JL9A 1TAUA 1X5SA 1YBAA 2KM8B 3T9ZA 4GKJF 1F9EB 4WE1B 1QY7A 4PG7A 4F25A 1RQ0A 2ROPA 1F1BB 5KFKA 5GAEI 4CO5A 4R0EA 1PO6A 2QMUB 3CCUS 2HHPA 4DV4F 3Q8PB 1JJHA 4L3NA 5GAEU 3OSPA 2F9DA 1LW0A 2PFDA 4IQMA 4J9RA 2IJNA 2DT9A 3BV8A 2VBXA 4EBEA 2RVJA 1GTHA 3T1AA 2OEMA 3H5XA 2HLTA 1UEKA 2D1CA 3KKFA 4CNZA 1LKZA 1HBNA 3MPDA 1OWXA 3KK1B 2DNMA 4WK1A 4USKA 4XIUA 1L3SA 3PO5A 3M05A 4PCQA 2XMAA 2NS1B 3HHLC 3N4WA 2QJ3A 4U9RA 2J7UA 3CD6S 3IR5B 2HNZB 1JLGA 4H4KA 1BLUA 1HA1A 2BKNA 1WC0A 3LGHA 4MMOA 3SSQA 4F04B 3W9IA 3D1OA 1NJXA 4RJVA 3UN3A 4ZPBA 1X4AA 4ZMMA 4C0OC 5MAOA 1W7WA 5AXKA 4DV1J 2WVCA 1N0UA 2CZ9A 2CJAA 2HS4A 1PCAA 1WJ9A 4ZVRB 5J1NA 2DNKA 4IH6A 1GX5A 1PC5A 1WNEA 4QYRA 5CYMA 1NSQA 1S1UB 5AE3A 2OMLA 1DTQA 1VQKS 2JH3A 1Q81T 1MROA 1VGYA 3UCZP 2HS3A 2AW0A 2WOMA 3SV3A 1XR6A 2GQQA 3OR1B 5BYSA 1U1OA 4ERDA 2AJ1A 3M9NB 2QGFB 1JXLA 3GJQB 1UAWA 4LF8J 3R1HA 3K2YA 2C3MA 1SI9A 4KGMA 1VQPS 5B7WA 2FLLA 4G1QA 3SXLA 3LANA 3QYYA 1LEOA 1A7GE 2F40A 3PX0A 4DQRA 3IWXA 4EWTA 1IM4A 3W65A 1KKHA 4HR2A 1RWOB 3CE8A 3M2VA 1I3OB 1HWLA 4P75A 1RYSA 3NBPA 2YNFA 3MEGB 4DV5J 4LUBA 1S6UA 1RUSA 5I3UB 3CUNA 3NS5A 3DRSA 3VF0B 4XO0A 3KDNA 4DUZJ 3QGIA 4JV5J 3TRGA 4J37A 2HWIA 4RBTA 4CDIA 4OZJA 4DBQA 3JYTB 1B7FA 3AB2B 3CJTA 3PYGA 2OJ3A 3MM7B 4RNHA 3R6LB 3M8YA 2W8KA 1T11A 4QIFA 2MGZA 2NUHA 4A46A 3FMWA 5AXMA 4I2PA 2HHHJ 2DHXA 5HQMA 2ASLA 1LWCA 2IHR1 4RBUA 2XNQA 4DV1F 2XBPA 4HHHA 4DFKA 1B0VA 3POTA 4RNFA 4FXVA 4TVAB 2EG1A 2XGQA 2V67A 2CQPA 2XCPA 3VVUA 4ZVHA 1C0TB 1OQ3A 1CJTB 1T02A 1FWKA 4FPIA 4P2FA 3J80U 5FLXY 1HI1A 1TL3B 3BDPA 2J9DA 3LAKA 4FN5A 4BWMA 3MMAB 2QL9B 4JI3J 2DGQA 3AY0A 3CB4A 3AFGA 4HL9A 2YKMB 4N8NA 3OJSA 3JXOA 2CNOB 4KKOB 4N76A 2GO9A 4NWBA 1ELOA 4OYIA 3N6LA 2F63A 4J9PA 2KDOA 4LF8F 3P4UB 1FFSB 4ILRA 4KH0B 4A48A 4Y2CA 3NMAA 2BYCA 3FBFA 3FRZA 2B5JA 2A2DA 4M5NA 3M6XA 2WTFA 4ED0A 4ZJLA 1RT5B 1SC6A 2DK2A 5D8HB 3RW6A 3R8YA 4DV5F 1GTEA 2VPYB 4KHMA 3KTQA 4IFYA 1YQHA 3I6PA 1T3NA 5U47A 3FFIB 2R2TA 3SCLE 2VFSA 2CZ4A 4NZ6A 3OL6A 4LF1A 1KRPA 2N3LA 2P9CA 4DUZF 4JV5F 4OL8A 2VDHA 4QR0A 2WK4A 4NCAA 1Q78A 5HK4A 3NGKA 4K5SA 3UFCX 2L08A 3ZTRA 4ZVGA 1OQ6A 1S4EA 1SH0A 3GJSB 4ZVEA 3MWBA 3KNAA 1X4DA 2KU7A 2MZRA 3KK3B 2ZOGA 4ZP8A 4A8QA 3DXSX 4J9SA 2X7IA 5K20B 1MWYA 2B56A 3JB9k 3M8PB 1VJWA 4MKYA 2OFHX 2ZH4A 3QFWA 3D4JA 3I5CA 4CTAB 1FKPA 3SMZA 4NLOA 5JMNA 2NYHA 2HQDA 2DIUA 2CJKA 3GV8B 3BB5A 1GXLA 2LA6A 1I51B 5KFHA 2AU0A 1N88A 1DARA 4WPAA 4OZLA 1KLMB 1CBKA 3V81B 3I87A 5CXTA 4F02A 4JI3F 4LBPA 3BKFA 2YKNB 2DNLA 2RUSA 2CPYA 4C11A 2V2QA 4WKRA 2Z30B 3CNQP 2UVVA 1B3TA 1TKTB 4IG3A 4YHHJ 4WXWA 3UI3A 3FCHA 3HSDA 3DHWC 4DG1B 4QWCA 4Y3CA 5E33A 5EDWA 7AT1B 4JI0J 4I6AA 2NSCA 3BS9A 1XIQA 5AT1B 4YB7A 2WVEA 1EX8A 2PE8A 4DSLA 2PD1A 2HFZA 1ZM9A 1DQAA 4CO3A 1L3KA 1D9FA 3OLAA 1XQIA 1FWPA 4V19J 3FK4A 2FQQB 3JTPA 1GXUA 1HHSA 3DLKB 4ECTA 4RX6A 2IM0A 3L7UA 4R8UB 4LIWA 4DCJB 2BEFA 4A8YA 1HBOA 4GO7X 1G3OA 2DH9A 4AT1B 3AQOA 2GHWA 4FYVB 2RQCA 1NMEB 1RTDA 3LP1A 3MM6A 5F8NA 1U6ZA 3M9MB 1KLNA 4B3TJ 1XNRJ 5CD4A 5F41A 3P5TL 1F2HA 1DY3A 1RE1B 1Z2ZA 1H73A 3IMQJ 1MN9A 3K7RA 1CS4A 1LWFA 4BC9A 2BKPA 4FF4A 3KXDA 4Q44A 3I32A 2HG4A 3ZFVA 2C2RA 5H1SV 3HSGA 3KLFA 1IR0A 2XHWA 3N79A 2WB1D 2XNRA 3O2IA 1TUWA 2A10A 5A2QU 2DY1A 3M6WA 2MJUA 2VQEJ 4YR3A 4ENOA 2CQBA 4WFNQ 1SJ4P 2XMWA 2CDRB 4YHHF 5D0HA 3I9V9 3A3OB 1TFWA 2XMKA 3B4MA 4PEOA 2CQ0A 4NLWA 1NLKL 2V34A 4JI0F 2V8DA 2UUTA 3LO3A 3HVAA 1OSDA 4M5DB 1VK8A 3SZ2A 3G87A 2AHOB 4ETXA 2HQCA 4Q0BB 2HWTA 2CPHA 3NWRA 4PQAA 3C2PA 2HMIA 1HNVA 3ETOA 2M2BA 4PWUA 4O3RA 4Y0FA 2CPIA 4IDKB 1U8WA 3SI8A 2RUGA 3QWPA 4LF2A 2VOOA 3SDEB 4CYUA 2NPFA 4LRFA 1BWEA 1NB2A 3DKDA 3RTVA 2HZCA 2JFKA 1EKRA 5ETSA 3OFFA 5KT7A 2B4OA 1VIOA 4F26A 5B0CA 1R8AA 1J5OB 1WDDA 4B3TF 1XNRF 1KNZA 1UL3A 4NLQA 1Q8IA 3W60A 4DL6A 4TKTA 3GYGA 2V9WA 2OLWA 4QIGA 2FTRA 2OKQA 5KFZA 4B9VA 4ZJQA 4ZP9A 1MNEA 5DG9A 2ZUGA 2PN6A 1NB7A 1GMUA 5CZXA 3I5AA 4UY85 5RUBA 2CG8A 3N6NA 2HQFA 5LM7E 3MOZA 2FJBB 4DUTA 4DV2F 1GMWD 2VQEF 3EE3A 1Q7LB 5J2PB 3K5OA 1WHWA 3VAKA 4F7VA 4X65J 2R2RA 2W9CA 2P9EA 1VC6A 1A6LA 4PUOA 1RT1A 4LSNA 1PGZA 3ZZUA 2HFVA 1RP5A 3HVTB 1QJHA 2J7KA 3KJNB 3WDOA 4CLZA 3BGRA 2KT2A 3S6EA 1NK0A 3BPDA 1QE1A 4CZCA 1V9OA 2AGQA 2KFYA 4QWAA 3IRXA 4MAKA 3I56S 4N8OA 4DLEA 1VS3A 4Z7CA 4KJIA 1C4CA
chains in the Genus database with same CATH topology
3EYZA 4NX9A 2L9NA 4LMZA 1ZM2A 3OFHA 1UP1A 4QWEA 5D3GB 3QZ8A 2WHOA 2V4RA 1G7CB 3UDCA 3PV8A 3ISND 3KK1A 1KC8T 3HHDA 4ECQA 2RNEA 5B0AA 3BO3A 3OVSA 2DRBA 3E51A 1W25A 4OHXA 3M9OB 2VKRA 2Z2MA 1X5TA 2XC9A 1XNQF 2E5JA 2ZD1A 4ZPVR 4FBUA 3IWNC 2QYCA 2ROGA 4WFXA 4K4YA 2ZKTA 3VAHA 5K8NA 1Q1KA 3CDAA 2IBKA 3BQ1A 1FD2A 4O3OA 2OTLS 1FJGF 4Q7AA 1NO8A 3TVZA 1Q79A 3NKYA 3J7A1 2DTJA 1IJFB 2Y1RI 3LP0A 4TY9A 4J9NA 4IH5A 2YQ3A 4ZA1A 2WB4A 5KOXA 3H4DA 3LP2B 3UW1A 4IRKA 1URRA 4IYQA 4DMZA 5T14A 2JEFA 2KFNA 1MU2B 1WF1A 3KG0A 1R7IA 1B64A 1JLBB 5E3QA 1IQTA 1VIXA 3BJYA 2O67A 2ZZNA 2IAJA 4OI4A 2FJXA 2C2DA 3QO9A 3G6ES 1TVRA 1VQNS 3MM8A 2ZVSA 2LVWA 1UFLA 2ZBIA 1U09A 1RKIA 4Q2LA 3PRDA 4X4TA 3OTOF 2CJQA 4EYIB 3K0JA 3B82A 5D4NA 2KG0A 3HT3A 4WZQA 5DO2A 2J6UA 3JSMB 3PVXA 5KT5A 3MEEB 5LSOA 1ZPWX 3U1MA 1DHMA 2OPRA 2MQPA 3R3TA 1HD0A 1JLFA 1J2VA 1S1VB 3C66A 1CVJA 1MROB 3IG1B 2YKQA 1KR4A 1U8SA 2N7CA 4PRFA 2GMHA 4FVMA 2OO4A 4TY8A 2R7RA 2QA4G 5GAGI 1NK6A 1HFEL 2HHHF 1DTTA 3GWCA 4TXSA 4USIA 1H2VZ 1HYSA 1R8CA 3MI7X 5A8WB 1XK8A 3I96A 2BQRA 2HHWA 1TKXB 2R8IA 4JI7F 5T7LA 1S1UA 5GAGU 3LGNA 1OPIA 2MPUA 1LW2B 2BV3A 1FE4A 2AYEA 4P7VA 4B17A 2JEIA 4JV1A 3CCRS 2ROEA 2WONB 3DFEA 1VBXA 1E6VB 2PSZA 3NLCA 1L3VA 3MOJB 3DMJB 1R3NA 4I69A 5M2PA 2R7OA 1FRMA 3K57A 3SCJE 4E8UA 4DFPA 3DOKB 2B9WA 3G9CA 1QAYA 4CO0A 3G71S 1K1QA 4X65F 4G1QB 5KG0A 3KHRA 4RW4B 1LXJA 1Q82T 3DU5A 1M5VC 4M5DA 3O3LA 1APSA 4HH1A 4AXIA 3Q0AA 1L5UA 3C3LA 2J9EA 3I4PA 2X3GA 3UQSA 3RBDA 1O5JA 4IG0B 2B43A 2N4CA 4H4OB 5KFMA 4RUCA 1PSDA 1OPZA 3FDSA 5K8PA 4KQZA 4QIVA 3RAQA 3M2VB 3MD1A 1IBKF 2M8DB 1KONA 5C25B 2UVWA 4NZ7A 1U26A 4NLRA 1N5VA 2X51A 2V4QA 3RB6A 5HLFA 2DNGA 1NEEA 2GIRA 3CD0A 3CJ3A 3NBPB 4H4MA 3AB4B 4M1KA 5L39A 2XY6A 2YKOA 5HROB 1IN0A 1UVNA 3K5NA 4YB5A 2J0WA 3DRSB 1S0MA 2MDAA 1UVJA 4K4WA 1MSWD 4I2QB 1EP4A 3CCZA 4IDKA 4OI6A 3MR3A 3CXCR 2HWHA 1U2FA 1DLOA 4ES1A 2KKHA 2YWHA 3D1HA 3ZZ0A 3MXHP 3PJXA 2CPFA 2J5AA 3I0SB 2GGPA 2LYVA 2DNQA 3PW4A 3SDEA 1S0NA 4EU0A 2Z8QA 5T41A 4DS5A 2QMWA 5DGBA 4KIAA 5KTQA 1ZPVA 2BM0A 5IT0A 3MDFA 4PXCA 2PFFB 2DB1A 1JNRB 2M52A 4CCHA 1RYRA 2KVIA 3IO1A 2E66A 2Y0SD 4B9MA 3TYTA 2D9PA 3MMBA 1RA7A 2IA0A 3TW0A 2KT5A 2DNOA 4NYPA 3G8SA 4J9MA 3MECA 1FDDA 3VAFA 2KHDA 4DN9A 2V94A 4K50A 3ISZA 3MEGA 4IO1A 4EBDA 3R5DA 5HMWA 4LVOP 1FF2A 4DL3A 5EWFA 1TL4A 2MGZB 2DGOA 4OI1A 3KG4A 3TAPA 3BGFA 5E3RA 4BC7A 2I5JB 2ZM6F 1C1BB 4KE5A 2LA4A 3CGIA 2R7XA 5FJ4A 1JKHA 1H98A 1HQUA 3C6UB 3OSNA 4FPRA 3M32A 4UUWA 4TU9A 2ZOFA 1DFDA 3KK2B 2EVZA 3CCJS 1LWCB 3N9UC 3T9NA 2I2YA 1Y7PA 5HI7A 5E0OA 4HVZA 3C46A 5FDLB 4G1IA 2BVZA 1UA0A 1QUPA 3JYTA 5SUHA 4DV0F 4WIIA 5BJRA 3TO8A 5ITHA 1KFDA 1S0VA 3V4IA 2YWKA 2JOQA 4IO9Q 3T1HF 1UVIA 1S48A 1CEZA 3V2UC 1F5CA 2OMOA 2HHSA 1PC4A 1HBUA 1JNZB 3LALA 5LJ5Y 1FNOA 3G96A 1N6QB 5EX3A 1GH8A 4QU6A 4RKUC 4D3GA 4QW8A 1FRXA 3MEDB 2LXFA 2DCUB 1FXLA 1TV6B 4A8OA 2XS7A 1RWUA 1YG0A 3RU0A 5E3AA 1IKYA 2ZC4A 5IM0A 3JSRA 2JHEA 2F8EX 1FRJA 2ZITA 1UMJA 3THVA 1F9FA 1ZAWA 3SQGA 3ISNC 5DDPC 1MMLA 1SV5B 4I56A 3KMQA 2M9KA 3OV7A 1N52B 2W24A 4KT0C 3KFWX 2DR8A 2CFXA 5B0DA 3V6DB 4YFUA 4EZ9A 1X4BA 2G13A 2JC0A 2RQKA 2GHVC 3EUNA 3OUYB 4A8XA 2DR9A 2HHTA 2J9DE 1HBMB 5J2NA 1BGXT 3BN4A 2LEAA 3OR2A 2DGVA 4JI4F 2E9TA 4C3LA 4X4NA 2ADCA 4G1PA 3G8QA 2EG2A 2YX7A 4IOAQ 5J2PA 4E98A 2QEXS 2KFZA 2EPIA 2IM3A 1RT4B 2X1GA 3J80Y 4B3RF 4I64A 1C4AA 1BQXA 4DHVA 2JZ5A 2CQDA 5J1EB 2G0CA 2OSRA 4N56A 4O4RA 3ZZTA 3MR6A 1M5OC 4NXMF 2B7BB 4RUAA 5M2UA 3E01B 3CPWR 3ITHB 1YTYA 4TQRA 4MK8A 3PR5B 4OLOA 4F3OA 1VRUA 1X4EA 4B3OB 4X62F 1YJ9S 2IYIA 3HVTA 4OI2A 4F4WA 3LPYA 3MFHA 4JUZA 2RS2A 4Q45A 1JJ4A 1H2TZ 1Y3KA 1RT6A 4LSLB 1XMBA 2BRLA 3V4MA 4J9KA 2AGOA 3RR8A 2EC0A 1XWLA 2FGCA 3QMQA 3M2RA 4X4QA 3PJWA 4RU2A 2MZJA 1W2BR 2WRMA 2E5LF 1R89A 4Y6IA 3H2UB 1X7VA 2CQ1A 3IC1A 1U1MA 2UXCF 2WSCC 2KRBA 5DDOC 1E6YB 1C2PA 3IAM9 3MZIA 5IWAF 4LF7F 4M94A 3G6YA 2CPXA 4MYTA 2MZSA 2YNIA 4C9DA 3KLGA 4YY3F 1U1QA 2YKMA 1B0TA 2VFVA 3MMCB 2BXJA 1UJ6A 4NRTA 4GC7A 4KKOA 1ZOTA 4YEAA 2E1CA 2G1DA 3BZQA 5DDQC 5IQQA 2J6TA 2RRNA 5A0YB 2FVPA 4CI0B 1ZAXA 2M7SA 4ZS6A 2VUGA 2AWZA 3H8YA 4ZP7A 4DFJA 4U7UK 1IBLF 4IFYB 2W7AA 3OBIA 2IJFA 2F8HA 1UVKA 2CKWA 5M2RA 2RRAA 4TNOA 1DZ5A 5D3GA 1IKWB 2PT0A 1GXTA 2VG6A 2ZZMA 2Q43A 4ZOSA 2KM8C 3IGVA 1SL2A 1M1KT 4ID5B 4F67A 5F0UA 3OL7A 4ALZA 2B3TB 4X4VA 2VFTA 5LJ3Y 3UR0A 4C8ZA 4ZHRB 1NK8A 1N32F 1T03B 3M30A 3X1LB 2ZH3A 3DRYA 2XY5A 3H98A 3M4XA 5I42B 2MKCA 4OJHA 3FEZA 2NR0A 3VR1A 3CDEA 3DRPB 1T8EA 5KAKA 3H20A 2RU9A 3MD3A 4GC6A 4ECUA 1RT5A 2GC8A 5A8RA 1QAXA 3LF0A 3KLHB 1O0PA 4Z2XA 3THPA 1LXNA 1SUQB 4ID8A 2LMIA 3TVKA 2RMLA 4IR9A 2OPSB 6FDRA 1URNA 3GIJA 1Z4UA 4O44B 1CLFA 3LP2A 2ILYA 1IUJA 3T6JA 2EBGA 5F9NA 3MM5A 3KLEB 1SL1A 4ILLA 1KQGB 1MU2A 3HZGA 2B4UA 2GIQA 2JLFA 1JLBA 1ZETA 1S77D 2XSJB 4OV1A 4XDDA 3D5MA 3DLEB