4CI0B

Electron cryo-microscopy of f420-reducing nife hydrogenase frh
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
228
structure length
228
Chain Sequence
KPRIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords F420-REDUCING HYDROGENASE, SUBUNIT ALPHA
publication title Atomic Model of the F420-Reducing [Nife] Hydrogenase by Electron Cryo-Electron Microscopy Using a Direct Electron Detector.
pubmed doi rcsb
total genus 47
structure length 228
sequence length 228
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ci0B02
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ci0B01
2FDNA 4RKUC 1GT8A 3H3XA 4YDDB 1H7XA 2C3YA 2FJAB 1FRLA 2FJBB 4L6V3 3MM5A 5CHCB 1JNZB 1A6LA 3MMCA 1Y5IB 1YRQA 4UPVA 4UE2A 1FRVA 4KN9S 1FRIA 4OV1A 1FXDA 1PC5A 3C8YA 4KO3S 4AYBD 4UE6A 1BC6A 3OR1A 1WULS 3MMAA 1UBKS 1F5CA 5JSKA 7FDRA 5A4MS 1KQGB 3MYRA 3CURA 1JNRB 1BWEA 1FD2A 2XSJA 4U9HS 4UQLA 2VPYB 5JSUA 1XERA 3RGWS 2UZAA 3MMBA 4UPEA 2ZVSA 2V4JB 1IQZA 1IR0A 4UD6A 1C4CA 1F5BA 1Y4ZB 1H2AS 4GD3Q 3MM8B 1FRJA 4KO2S 1UBLS 2GMHA 1FDNA 7FD1A 5JSYA 6FD1A 4U9IS 3MM9B 2Z8QA 2FRVA 2FGOA 4XK8C 3IR7B 3USCS 1B0TA 4XDCA 1AXQA 2V2KA 2VKRA 3MM5B 1FRFS 1SIZA 1B0PA 2GMJA 5JSHA 1FERA 4C3OB 2O01C 2WSEC 1FF2A 3MM7A 1WUHS 4TTTS 1VJWA 2C42A 3MM6A 1B0VA 1FXRA 2Y0SD 5CH7B 3ZE9A 1FRXA 1BLUA 4KL8S 4KO1S 2WAQD 3IR6B 1DURA 1ROFA 1Y5LB 1R27B 4IUCS 3MMAB 2PA8D 4KT0C 1HFEL 5A4FS 5FD1A 3EXYA 1FRHA 2FD2A 2VPWB 5BYRA 3AYXB 4UEQA 1E3DA 5ADUS 1CLFA 1Y5NB 1UBJS 4IUDS 3UQYS 3EUNA 2WB1D 1H2RS 2PMZD 1Q16B 1FRMA 3OR2A 4KO4S 4CI0B 2C3UA 1FDAA 1UBMS 4URHA 1DFDA 1GAOA 4UE3S 3CUSA 5E7OB 2C3MA 1YQ9A 1BQXA 1PC4A 4UQPA 1UBRS 3EGWB 1WUIS 3ZE6A 3MMCB 1UBOS 5BYQA 1C4AA 3LW5C 1FEHA 2WPNA 1CC1S 1UBTS 1DAXA 3ZE8A 3GYXB 3MM8A 2C3PA 2C3OA 1WUJS 4DHVA 1JB0C 3OR1B 3MM9A 3MM7B 1KQFB 3ZEAA 1SJ1A 4UCXA 2WSFC 3USES 3MM6B 1H0HB 1FTCA 4XDDA 1YQWA 3AYZB 1WUKS 5JT1A 5BYSA 1UBUS 4OMFG 3ZE7A 2XSJB 1F2GA 1FRKA 2IVFB 1D3WA 3MMBB 2VPZB 2VPXB 4UD2A 2FJDB 4UEWA 1K0TA 5A4IS 5JRDS 4Y28C 4UCQA 3HKZD 5D51S 1H7WA 6FDRA 1UBHS 1FDBA 1FDDA 1G6BA 5L8RC 3IR5B 1RGVA 3OR2B 4ID8A 1H98A 2V4JA 4UCWA 1G3OA 2PDAA 1FCAA 4IUBS 3PNIA 1KEKA 2FJEB 1BD6A 1GTHA 1SIWB 2WSCC 1GTEA 1WTFA
chains in the Genus database with same CATH superfamily
4ENSA 3TKYA 3ABRB 5LFAA 1FRLA 1JSXA 4TY9A 3NBKA 1ZCAA 3WY9A 5FBWB 3OM8A 4Y7CA 4I9NA 1K1SA 4FXOA 4YMVA 4QPTA 1DIRA 1PZMA 3EHDA 3KQMA 5I3PA 2KHDA 3LVRE 4AN1A 3I6IA 2CZQA 1WX1A 4RW9A 3NVAA 5LMCA 1WB4A 3KJVA 1ZIXA 3OU6A 4IGIA 1Q7LB 2LBPA 3OZSA 3WRXC 1QH1B 2HMUA 4IZOA 2ZJZA 2VSFA 2ZM6F 1AXGA 2V50A 4DVJA 1V8FA 1K9VF 1QFSA 4MRNA 3K9NA 5E4FA 2IL1A 4DYHA 4A2QA 1FFSA 2HWXA 2ZS8A 1UJCA 2FP3A 2D00A 3WICA 4FOOA 5D0RA 1DEOA 3O3MB 4JJ6A 4BP3A 3LI2A 3CDWA 1GPBA 1G6BA 4J9MA 2CBXA 3EIFA 2YW9A 4XX0B 2KJVA 4BYMA 2V6AA 1AH2A 4AD6A 2VOJA 1BDMA 5I3UA 2AMFA 2LZ0A 4RTQA 3LECA 1ESZA 3GJ3A 2ZH4A 3SBOA 1QO0A 2H2AA 2FWPA 2F4FA 2O07A 2Q1XA 2XYQA 1T0PA 3QP9A 4V03A 2HA7A 1XKLA 1MLDA 5CFPA 4R1TA 1VIXA 4DFJA 2IFTA 4RTMA 2C9YA 2C42A 3HDGA 2GBFA 3LFUA 1AV7A 3HKCB 3FWKA 4HWRA 1FDRA 3T5MA 1KSGA 2PWAA 3ZVMA 3BN3A 2X40A 2EX1A 3HUUA 1KL7A 1VRWA 2P6UA 4U7WA 5CFMA 4HSGA 1MN6A 3WLEA 2H7XA 3WDLA 1VJ1A 4YHBA 5E1OA 1ST3A 2F3SA 5A2GA 3COPA 2FUG9 1CZRA 1ZG3A 1VL1A 3T1YJ 1ADJA 3Q8SB 1FYWA 1XZ8A 1TK5A 4MOWA 3MEGB 1P4SA 4G09A 3JD2A 1CE8A 3NGLA 1KZ4A 2AVNA 3BGOS 2HLHA 4URUR 1Y89A 1KR4A 1Q7TA 2RUSA 4RNMA 3IUJA 3ZJVA 2M7SA 2J5RA 3VI4B 1O51A 1CUWA 3GPLA 3A3OA 4S12A 1QQ7A 2O2ZA 4F3TA 1LK5A 1D07A 1FSPA 3TA0A 5ADWA 3RVLA 2O52A 3R3WA 3EZLA 4DL6A 3ZZPA 2WIKA 1TAHA 3AC0A 4XO0A 1XU4A 1N32F 1H1DA 4NU0A 2XGSA 3V1TC 1E6CA 3DV9A 3IBFB 5DIZA 5MN4A 1V47A 3C98A 1HKAA 1I5RA 2V6IA 4MFBA 5EGSA 1I6LA 1M72A 5DGHA 1Q1ZA 1T4DA 3OZFA 4UNNA 4L0DA 2AOTA 2SCUB 4PZAA 1QRSA 3KHUA 4F93B 1GDDA 4S1VA 3P9QA 1EZ1A 4E1BA 3NHYA 1V3ZA 2VPZB 1X87A 1WPXA 1XTZA 2V4JA 2DTXA 1T9BA 4Z4EA 4P31A 2ZKLA 2CNKA 1O5OA 2MQQA 4X20B 3RSHA 2X15A 4WDQA 3FHOA 3HP4A 3E3OA 4MKIA 3W2HA 4LXGA 4ZYYA 3NCRA 4BV8A 3TOZA 2DBVO 5AJ3J 3N6NA 4JWTA 1NF3A 2E5WA 2HHHF 4L9RA 4C2TA 1KMHB 3RR7A 4CT8A 1DEHA 3T5AA 2W2PP 1OIWA 2VKQA 5AJHA 3CNOA 3HDTA 3T41A 3N2KB 2XE8A 1KVUA 3SVZA 4G0QA 2VO1A 4DQVA 1C9EA 2XVXA 2PZBA 4OLFA 1E9CA 1PLKA 3R3VA 1C4OA 5GONA 3JYQA 3D8SA 4G6VB 4BIMA 3OD1A 4O4JF 3MWEB 4EG7A 1JDUA 2HRCA 1SQ5A 3N28A 5BQPA 1T7PA 4Q1BA 4D41A 1MU2B 4P3NA 2QJRA 2JASA 4NENA 3GFRA 1JG6A 2E66A 5A8RB 2MSWA 3E9EA 3VAGA 4OI3A 1OSDA 3JD4A 5KNBA 1G291 1C80A 2ZBPA 5TQJA 1M6WA 2J7KA 1HWLA 5ESWA 2GVDB 4YR9A 4OQQA 1IFXA 5IJ0A 2PKXA 2XULA 2NN3C 4G1VA 4FOLA 4TKUA 2M32A 1PILA 3U27A 3I31A 2D1RA 2ZIAA 2G4LA 3N0RA 2OPPB 3T1OA 1KHTA 4RKYA 1RXOB 1GGFA 3AGQA 1U5BA 2WQ6A 4Z0PA 3RDPA 4LCJA 5A5GA 3C3EA 1T9DA 2CNWD 1H2UX 3RRFA 2Q6LA 4WFBQ 4DFDA 2A2CA 1Z5OA 3B1JA 5BUSA 1KMIY 2JZCA 4L3WA 3NFRA 2Y0SD 3KFLA 3RBEA 4PZYA 5EIBC 3ABSB 3SYTA 4O3QA 3WWCA 1GTVA 3H9EO 1E98A 4ERDA 2NQPA 1JBEA 1ND5A 2RT3A 2X9QA 2HSWA 4DXAA 4PLGA 4NLSA 4I50B 2JGDB 3HCRA 3ND8A 5EXPA 5D1HA 2WONB 1QTNB 1IK4A 1KQFB 1HYHA 4PGHA 3QT6A 2NT3A 3L6UA 3JVUA 1ZX1A 2BMDA 3WL6A 4AG5A 1A4IA 2ZIEA 1P45A 2PSZA 4L4RA 4F04A 3UOWA 2OUIA 5I9NA 4LF5F 2GAOA 2Y1GA 3S4YA 2RGEA 1AB6A 1S99A 2GHQA 3IT0A 2R6CA 1NMEA 2GPTA 1UKZA 4DMMA 3O82A 2O9JA 1WXHA 4FX5A 2PMBA 4WZBE 3PPYA 3EXIA 1EM8B 4E21A 1FW8A 2KHZA 5AO9A 1FDTA 3GFFA 3P32A 5E2AA 4C3VA 5ICSA 4G0YA 1L5HA 3U49A 1QFYA 4WFNQ 4P81A 1TU0B 3O7MA 3HCDA 3HWSA 4M2LA 1FPMA 4EJ0A 2WEKA 4L4UA 1G3RA 4CMIB 4I08A 5KKAA 2FG7C 1HTTA 2XJ4A 4H4OB 1KBZA 1OLSB 3BILA 2ZDHA 2HT6A 2CF5A 2G09A 3NS6A 2VYNA 4CKZA 3GN1A 2IIHA 1UZAA 3A3PB 1IQRA 3O1JC 1UBRS 5F78A 2ZFUA 1U0OC 2VHEA 4K4TA 3A05A 2R8YA 4CO0A 4CYMA 3PFGA 5EWMB 4ECVA 1E4VA 2H65B 3RNOA 1ETHA 4Z3KA 3GBVA 3K5LA 1Z7BA 1IBMJ 4JI2F 2NUPB 2Q5FA 3ZC4A 2P8JA 5JAQA 1P9QC 3AR6A 2C1EA 3CXCR 2GXQA 4PANA 1N0UA 1GSIA 4K50A 3QG5A 4G9BA 4DLSA 1VQOS 2CCJA 1U49A 4ZHQA 2IP4A 2C9MA 3HMQA 4HPJB 1N9KA 4I0WA 1YS7A 3N7TA 5FOVA 4AXBA 1VLYA 4PRKA 3BHNA 4LYGA 2OUKA 2P9FA 1KK0A 3AB7A 4XK8C 5AI8A 4S04A 2C88A 1NDLA 5AM2A 3Q8LA 3Q0AA 1DG3A 1R0ZA 3R0VA 3RS9A 3PPIA 3O4IA 2XSZA 4DQDA 3VPGA 2YMLA 1R8JA 2E9ZA 4QPDA 1WUIS 2RI6A 1BS9A 4UXIA 4TRNA 1V96A 1H4QA 4RVDA 1P1HA 2V54A 3D6UA 2CXEA 2UZ3A 5CW2A 4D45A 2Q6BA 1Z2NX 3FMGA 4TZKA 2AF6A 2B3TB 2VB6A 4I8IA 3KTDA 2UP1A 2FX5A 4U2BA 3SK0A 3X2FA 5ED4A 4K9SA 4O5AA 1E1CA 4MW0A 4JV5J 1AX9A 2FJEB 3CCZA 3RASA 2FFJA 1F2TB 1VIAA 5G0TA 3ECSA 3ND5A 4LQ3A 3SYZA 1AQUA 4OK5A 1J7JA 5AJYA 3OHAA 3KHTA 4LYHA 3SZRA 2O8DA 1BC6A 2ZBEA 4UZSA 4RZ3A 3UT5A 1WPRA 2DJWA 3OOJA 1V9LA 3MBOA 1I7SB 3WS7A 1U8UA 4A8OA 1MF7A 4DG1B 3CLRC 5F2EA 1S6QA 3N6LA 4MGKR 2KT2A 5H4GA 4NLGA 4G36A 4P3XA 3HTXA 3U3JA 3JR7A 4KV7A 4F8RA 4ACBA 1LWCB 4FMBB 1P7PA 1TW3A 4YALA 4LSGA 3RC7A 3G8CA 2VJMB 2C20A 4UNPA 5FLEX 5LWQA 3MB5A 4HDMA 4R2IA 4CV1A 4WXEA 1J06A 3SU8A 1V5IA 3GFHA 4UU7A 4F7DA 2XMTA 1QVWA 3DKIA 1DGQA 3V00A 4G5QA 5JZSA 4KVFA 3EIHA 4EHJA 2CMDA 3FUWA 2WF8A 2J9EA 4N7TA 1K2VN 1PV4A 3VH3A 4U8GA 2PMFA 4O4GB 1UT6A 3N59A 4AZWA 1QE0A 3UEOA 2UYCA 4KITB 3IAUA 2I65A 4WK4B 4R51A 1SVWA 2R2TA 1LBSA 4DA8A 5CNMA 3G6XA 3HULA 2NU8A 2R87A 4ENUA 1L8XA 1OAOC 4B3DA 4MQFA 1WMDA 3IBCB 5HSPA 1KLNA 3MNFA 1Z26A 2CMFA 5K8IA 2CJXA 1YOVA 2BC9A 2B4QA 2B4YA 3HI9A 4S2UA 4A8MP 1KN6A 3ANTA 1TELA 4HADA 3OE7D 3R3UA 2H0QA 3MA0A 4Q19A 3UPFA 4WJKB 3ZYCA 5G02A 4DFMA 1TAUA 2IE0A 4ZRMA 1MMFB 3HBFA 3T15A 3MUFA 1WXIA 4E1VA 1XTJA 2GGSA 3AR7A 4YONB 2I4LA 1QHHA 1BEZA 5ALXA 4M55A 1RC0A 4J03A 4NNJA 3JAKA 3CBQA 5FEMA 2J45A 4PWDA 5ENZA 3H16A 5CHEA 5HBGA 3PNLA 5H3LA 3C15B 3NP7A 1TUVA 4ZODA 4KFBA 1TL3B 4ALIA 2EVZA 4Z9BA 3GLRA 2A18A 2LD4A 3EC1A 1TQLA 3I9ZA 4RLFA 4LR9A 4DC1A 1BSVA 2CJBA 3CNBA 4H6VA 4RR5A 2X23A 5THQA 3V4PB 1NXQA 4PTLA 1C14A 3NUQA 2ABYA 1RIFA 3TPZA 1GTEA 3JRXA 3TXAA 4ZZ0A 5JH7F 3ZWBA 2OHOA 3GLHB 4F6LA 2YMMA 3O03A 5BV2P 1P2TA 3TIFA 2P3LA 3RM3A 5I8WA 4X41A 4B32A 2XSJA 1IG0A 1V25A 4EF6A 3KB6A 1PYSB 3MOGA 1U3DA 2W43A 3GQBB 3G2KA 1JAIA 2G76A 3IWLA 2PS1A 2Q6IA 3DAYA 4UVIA 1JLBA 1AT1B 3BL5A 4NE9C 2NNLD 2PZEA 5JJIA 3H65A 2XVAA 3CS3A 1RABA 1YQDA 1OGYA 5FF9A 3GVHA 3BN7A 3PJFA 2XMSA 2HNYB 1ZWLA 4KW7A 2IELA 1TCBA 4IIUA 2IRYA 3SEOA 3PENA 1SQ0A 4YFYA 2JI6A 2M6SA 2IK8A 4UCXA 3L1VA 1U6BA 1KXJA 4LMPA 4D2IA 4P0PB 4US1R 3REGA 2CQ0A 1T9WA 1H8HA 4JP3A 4LVNP 1ETUA 1EX6A 3QMMA 3U40A 2HZAA 4CLLA 1A8HA 4DJEC 2BP7A 1HBOA 1K06A 4ZYWA 3I4LA 3M9NB 4Q3CA 4YRAA 1M74A 2OP0A 2UYOA 2H16A 4JYMA 1CVJA 4UARA 4NK5A 4KLCA 3H1PA 2VJUA 1T2EA 3ZVNA 1JLCA 2C04A 2HK6A 4TLLB 1U6JA 1KY3A 4BO3A 3ORQA 4S0MA 5IWAF 2AI1A 3QSYB 2V5VA 3KJNB 5EIAA 1RRKA 1A9NB 2HHLA 2ZRKA 2R00A 4CKXA 3NONA 4M38A 4D82A 1Q77A 4TTPA 2VSXA 3A4VA 3H40A 4OGLA 3HVTB 3IOCA 5K5MA 3DLGA 4YGYA 5CURA 3ZNOA 3BFXA 3VR0A 3AEQB 4PLWA 2CLOB 3VH4A 1O57A 3RSLA 2XMVA 3VYRB 3FDXA 2U2FA 2HJ9A 2LEPA 4MGEA 2JFBA 3WC0A 3A1TA 3C6TA 1RYZA 3RHTA 3TEMA 2J0VA 4XVUA 2I03A 3E9ZA 4ZAWA 1VC2A 3UXMA 3OR1B 4I6EA 2WHEA 4KVAA 4D8VA 1W30A 4GR9A 4LXIA 3OUZA 3B6KA 5GMDA 1XP8A 3H8VA 1FRKA 4MW1A 4LF6B 2FKNA 4OIXA 1PQ4A 1W1IA 1PO6A 3HSKA 1K3UB 1XDWA 5CFLA 4EIWA 3WGJA 4CW7A 1KO4A 1X1DA 4J9VA 2HO5A 1M5UA 5I4KA 2XEXA 3C8YA 2OJ3A 4RX1A 2R48A 3Q8PB 2A7XA 3ZVLA 1JJIA 5LSRA 2XUIA 4M1QA 4P75A 4NXNF 2Y66A 4AUNA 3QIPA 4KQ2A 3WAGA 2BANB 3BK2A 3HR4A 1XGKA 2V7GA 3HXQA 2JIPA 5BXQC 1IHYA 4FCCA 4X64F 1VC6A 3MGJA 3T1HB 4KAAA 5LL6P 4O4LB 1RHJB 3BR8A 2DY9A 3V34A 3JVIA 4N3BA 1SZCA 2P35A 5B0AA 5HJ5A 1W2WB 3DCIA 2WJPA 3ABIA 4V19J 1ICIA 1Y9AA 4DL9A 2GFHA 3G9QA 4PRLA 3JSXA 1EQ0A 4ZDKA 4A8JA 4DNQA 4KNYA 3QOWA 2Q5EA 3NL0A 1J5EB 3U19A 1YJ7A 1E0KA 4HX9A 2ZSBA 4G23A 2QXUA 2FTRA 1Z6TA 4WKGA 3SC2B 1L1FA 4AQYF 4W4MA 1BRMA 3V2GA 4MHTA 1ODLA 4KMRA 3P5BP 4GICA 1STOA 1E18A 4WERA 2PBFA 3HHLC 3ANYB 3CEMA 4BKMA 3MQ2A 3ZDRA 5C1DA 3W9UA 2AG6A 1S0OA 2C7QA 5JO0A 1RJEA 3RGWS 4Y0NA 3JVDA 2P79A 2I38A 2OCGA 3E23A 2D8AA 5L53A 1EFAA 2FC9A 1A9QA 3RR2A 3ZNUA 2DNOA 3WRWA 3TLEA 2JANA 2O54A 4GLOA 1Y4AE 3DMHA 4G97A 3HK2A 3W6NA 2HNAA 3OZWA 1P0CA 4CLWA 4AKIA 3KQYA 1Z4QA 4X44A 3W5JA 5HVHA 2OLWA 4FFDA 3LUBA 3GLGA 1XIVA 1X86B 2WZCA 2B6AB 2EV9A 3TEFA 3OZ7A 1X4EA 1DQPA 4O2AF 1N36B 4QJVA 2ODTX 4ETWA 2RS2A 2CCKA 3AU8A 4BNWA 5D5HA 3OY2A 1KEZA 2CLLB 1VFNA 3KUDA 1KO1A 4OZ2A 2MPUA 1W0KD 2IITA 2B82A 4QOSA 2Q0XA 3PIOQ 4IIYA 1EP4B 2JVJA 4CF5A 3PX6A 4I9FA 1NU6A 4KFUA 1TFYA 5B0EA 2VVTA 2DLNA 1ZVQA 2ZI7A 2FR8A 4P33A 4HOYA 1I9CA 1U8AA 5F3RA 3LA6A 3GJQA 3ZV6A 2H0RA 1H9BA 5A6WA 4DV2J 1EKXA 4X8HA 1U0LA 4GZ6A 4ENVA 3B6MA 4PYMA 1ZKMA 3AXKA 5BR4A 3JARB 4IJ5A 3LKVA 2AEEA 1ECCA 2X86A 3C85A 2D0IA 4JHLA 2HG4A 2OKGA 4ZALA 4EB6A 4EYQA 2P7IA 3PGKA 3NXZA 1YZNA 4LJKA 4DS4A 4ZOBA 3VYTB 3TWOA 2DECA 4IJ6A 3O8QB 3IJRA 2JLUA 2CHUA 4KXXA 3OKPA 1QU2A 2OILA 3ROQA 1TQ2A 5AIAA 2LEAA 2YWWA 3EH2A 5C31A 4ED8A 3T6BA 4EG3A 2FPLA 4O1IA 3I8XA 3HFRA 1PKEA 2BFFB 1EVQA 1NVTA 2AK3A 1RC8A 3TUZC 4JA0A 4Q21A 2AFIE 2M2BA 1WA5A 5DOVA 1VG8A 4QBGB 3WKAA 1JHAA 1LDEA 4HR7A 1I5OA 2HVIA 1OFIA 3A2NA 1OVMA 3UDLA 1W26A 4OJYA 4YLEA 3N8GA 4BLRA 1R3UA 4A82A 1L1QA 1RWXA 3ESDA 3KK2B 3KLEB 4MRVA 3W1YC 1Z5VA 2V8GA 1B23P 4ZDJA 2VAMA 5E4JA 3UK0A 4ZN3A 1QF9A 1TIBA 4MDFA 1UJBA 3CUEF 2W2TA 3TLBA 3KV1A 4QQKA 4BU1A 3G87A 1JLFB 4GXTA 4EW1A 3E3NA 4KXLA 3RUAA 2F1HA 3K94A 4BNDB 4UMVA 5JQGF 3KVVA 3A2LA 1M2NA 2OPBA 3HLKA 4QTUB 4P7JA 3HD2A 3IV9A 4H4KA 3A4TA 1NW3A 2VODA 2JI9A 3ZHOA 3ZNPA 4R8LA 1ABFA 1LKZA 1SN7A 4OVKA 3O21A 4JI3B 4KR2A 4G65A 2B0GA 2QD3A 2WM3A 3DOLB 1NJIT 3SEZA 1K66A 2EDAA 5UKDA 3H4IA 4UCQA 5FPQA 2IUEA 3BAFA 1IXKA 4XYGA 3I9OA 4K2XA 1K8QA 3JQCA 2DVIA 2GV1A 4YCAA 2CNWA 2WLTA 2YV4A 5C24B 2C5FA 5ECDA 1Z4MA 4B40A 1WOOA 1L5RA 1EBUA 3NR2A 3W0LB 4FGWA 3K73O 3F7MA 3KLMX 4AL7A 4JT2A 2I99A 4TTRA 2JCGA 3HO6A 3G86A 3LIIA 2QYSA 4IDBA 1TUEA 5EHGA 2FCAA 1NSKL 2CWKA 1LGYA 2RKOA 3IV7A 4M0UA 1ZNYA 1ZTTA 2WY2D 4WIAA 4MVJH 2IEZA 4PG8A 5LUBA 1IEWA 3SBEA 5DBFA 4UBNA 1AMUA 3K5HA 1SKAA 1Z6YA 3G68A 4M7WA 4C0JA 2DGXA 2NG1A 3VTAA 1RRFA 2IHZA 3QKTA 5K8PA 1W1WA 3K59A 2DPJA 2ZSDA 1HYQA 2LEBA 1IDOA 3K0HA 5E3RA 3AINA 4OOFA 5AICA 1UBGA 2DEJA 1PAEX 4EPRA 1QNLA 3GLFA 2GHRA 1TEVA 2QZSA 4PKDB 3PNMA 3DE0X 1O97D 3UJHA 3RJZA 5C51B 1JPVA 2Q3DA 1F2DA 3OSNA 4B3MB 1ZHOA 2GZRA 4HRVA 2FI1A 4UVHA 5F7OA 5HQ3B 4BP8A 1QP4A 7FD1A 2CHQA 4PRZA 1GG8A 2GT1A 2I7TA 4GRAA 4OO3A 4QBTA 5C5IA 1RNLA 4WEOA 4DDMA 4FYPA 2IX9A 4CKCA 5ITSA 2I9KA 4WY2A 1HNWB 1FXWF 2M2IA 2HI0A 4PPNA 3TSWA 2HBYA 1XZEA 4Q44A 2G67A 2QROA 3UB3A 2BH9A 3RU3A 1XA3A 1AZWA 2W6OA 3D67A 2QSFA 1VIDA 1E3LA 5BYQA 2MZJA 2AKYA 4YIHA 5L95A 2J0WA 3KU1A 2PLFA 1VBMA 5LXYA 4QU0A 1QCZA 2QA5A 1IZ0A 4LF8J 2JAXA 2VAVA 6YASA 4YDXA 3FCOA 1XMQB 3PEHA 1POXA 2ATIA 2FZGA 2DSNA 3I09A 4IHJB 2O14A 5EQTA 2C7BA 2QTCA 4NEQA 3KLVA 1GGNA 3DMTA 3F6PA 2O05A 3O0DA 3PEEA 2OSQA 4Q02A 2BEUB 2P2ZA 5EZYB 2OCBA 4MQ5A 2O8FB 1UKEA 2NZXA 1HI9A 4JI5B 4LF2A 1IQZA 1RM3A 1ZFNA 3W2VA 1Q2UA 1UFOA 2QA4G 4HAVA 2FSPA 4MUHA 5KFQA 4FP9A 3QEBZ 5L6MB 3D7MA 2A3NA 1ZR4A 1HGXA 1QCYA 1KAHA 1ESNA 1UBNA 4DIEA 1JJFA 4C01A 3GUZA 2WU0A 1GPAA 2QRLA 1SCNE 3NETA 4GOKA 1EQMA 5IU6A 1YZ3A 3NTXA 4B73A 3S7ZA 1U02A 4KQ6A 5FO1A 3USES 3VKHA 2CZ9A 5A0YA 5M2PA 1MA3A 3H5TA 5HJXA 2PEHA 1EZZB 2AMVA 3MTEA 4H1UA 1O5IA 1VHWA 5KREA 3K35A 1NAIA 3UVEA 1Q95A 1ZRNA 2L82A 4JIGA 1B7FA 2E1MC 2A9FA 4EQ6B 3ZJ4A 2CUTA 3KU4A 1AOXA 4M0KA 3DTNA 1ZNWA 3DWIA 4JGGA 4L76A 1TCVA 4X7RA 1X4AA 5A4MS 1DKPA 4ZV9A 1HSZA 3L77A 4LC9A 4ZAVA 1ZJJA 1RTIA 4M86A 5K2OA 3NBXX 1T5OA 2BGIA 4KHPJ 2JLVA 1WPQA 4PLCA 5IKOA 1T2FA 3ZXIA 4ILMA 3DAOA 1EXMA 2AN1A 4E4TA 5F9MA 1H6KX 3NAQA 1VSBA 5JRJA 4K0KJ 3DSRA 4GKJF 3ILXA 1YVPA 4PEOA 5G0WA 1BJTA 2QENA 1N6LA 1AZTA 3AO0B 4BMXA 2Q3LA 1URPA 1KZYC 3MCMA 2BFDB 1Q8IA 3KKFA 4JJ4A 1L2TA 3VKVA 3R75A 3ND6A 2DCLA 4G5XA 4AO8A 521PA 4ES3A 2P2LA 2C78A 4J6EA 4NCXA 5K99A 2CFTA 3QUAA 3DI6B 5FR2A 3ONDA 1ZSVA 2POCA 1UMDB 3TX6A 1R8AA 2A9OA 4G37A 1F5CA 3G8BA 4LSMA 1VK8A 4Q1AA 5JNTA 2PL1A 1JR2A 4G1CA 3SDZA 4Q1DA 3LYAA 8LDHA 4Y0VA 4F4ZA 2P2DA 4DF8A 3TG8A 2X7JA 3WQQA 2AJFE 2QN3A 4UHDA 2XTNA 2M6KA 5L45A 2LCFA 1XN4A 4KXFB 2HF9A 3JV7A 3I9V1 1HMPA 3NNSA 2ZBVA 4CIOA 1YNOA 4U2CA 4O3MA 1Q19A 1NV8A 5B55A 4R4JA 2JIMA 4DPKA 1SC3B 1QFXA 1ISPA 5IZCC 1E58A 5KNBD 1JDBC 4C3MA 4LR8A 4B33A 1ZIDA 4LVOP 1C41A 1Z0SA 2UXDB 4KJIA 4XDDA 1RQ2A 3PXAA 4H16A 4CH0S 3ESBA 3H83A 2C4WA 1PAUB 4XSVA 1QXSA 1F6DA 1HDXA 2YKQA 2EQBA 1O58A 1M0SA 1P9LA 1TF2A 2I8AA 4BVEA 1NR7A 3E1SA 3S01A 4ZPTR 5CVDA 4EI2A 5KT7A 5CEEA 4F72A 4CUKA 3QPWA 3KQUA 2I5JB 3V5RA 1XTIA 1IAVA 5DNWA 3KT8A 1XMOF 2MKCA 4HUTA 4TYPA 1W73A 4MYCA 1J0CA 2QW1A 3H1BA 2WAMA 3AY3A 1NDCA 2VT2A 5C7OO 2IOYA 4GMDA 5T8KA 5KOHB 4FGZA 3VDNB 1ZM3A 5I48A 4PW0A 1Q7GA 1BXRA 2H7CA 1G5QA 5IV3A 3KG4A 4C3UA 4EYGA 3WX0A 1XXHE 4BO8A 2VRWA 2V9KA 2AN5A 1DURA 5LQCA 2ACKA 3WL7A 2IIVA 4OXKA 4MVXA 4OFWA 2A0XA 4I69A 4V02A 3PFOA 3IO1A 1A9ZA 3RNLA 1ADBA 4QLOA 4WF9Q 3GFXA 2QQGA 3DOKB 1FFHA 4EO9A 2MWMA 3R6GB 3CY6A 2H9AA 1NUTA 4Y1FA 3ZZZA 3BMCA 2CQGA 3AVPA 3CSUA 3T3GA 6GPBA 3WMRA 2PVPA 1FNNA 1DRKA 1SU4A 3GGDA 2L42A 3PW5A 2OGZA 1BD6A 4YJDA 2MQNA 3MMNA 5H5JA 3CE8A 2BTOA 3TXXA 3AKCA 4ZVOB 2J5XA 4NLVA 4MGIR 2WHPB 1RT2A 5AVVA 4KHZA 4KMMA 3W90A 3GFGA 3JAWA 4LYEA 3WNBA 5ADHA 3F90A 3DVAB 1TM3E 3QI2A 1Z4JA 1AKQA 4JY7A 3FI0A 1UXJA 2QYOA 2Y05A 2VYND 1Y4UA 2LXNA 3BGUA 3K09A 2RHRA 3KOAA 3NHLA 4ROTA 1D9AA 3AB3A 2HMSA 3FF1A 3W5BA 4OYIA 3I73A 2WRMA 3WWOA 3BH7B 2O50A 2R2GA 3CLKA 3Q9SA 4LFBF 3WAKA 1YR1A 3SQOP 3A13A 1O96B 4MKVA 4B3SJ 1KQ3A 1MQAA 5K0CA 1XYGA 4A27A 5EUHA 2XNDD 4JLWA 1KVQA 4CM0A 2RB7A 2BMEA 2MB0B 3D3NA 3SYNA 3THOA 4O0LA 3PW0A 2GESA 3PVCA 2WFLB 3R9LA 2OHXA 4Q1EA 1R8QA 4AY3A 5F23A 2O67A 4EY7A 1MHTA 1FDNA 2QP3A 2AJ4A 4HNTA 4X3CA 1NKSA 4L3OA 4J0HA 2EXUA 5KMGB 3IXQA 4TYNA 3JQGA 1MJGA 4MWZA 3JQAD 1J20A 1H2ZA 4B5LA 2WDZA 3AFNA 2C7OA 3V1NA 1XA0A 4B75A 1DC3A 1Y7TA 3Q6MA 3FOBA 1FW6A 1U1GA 2H1CA 4EG8A 3NEYA 1W36B 5IV4A 4IPTA 2ZNYA 4PUOA 1O94D 3OIFA 4HYEA 4ZOEA 4IIHA 5AJUA 2ADFA 4QWBA 4MKAA 1C29B 4CMCA 3DOUA 3QV1A 1N4DA 3BIXA 3H2JA 1X3LA 2GVNA 1P5HA 4XLLA 2R1ZA 1UKVY 3ORSA 1R6TA 1JHVA 3NGKA 3UGJA 4II2A 2J33A 1CUFA 1UP7A 1E66A 4DNPA 1RLMA 3DFUA 2D9PA 4DDTA 3MVEA 3FIUA 4IO9Q 4F6CA 2A5DA 5IJAA 4EJFA 1NQOA 4YV2A 2GHIA 4BBYA 2UU9B 1E2UA 1WY5A 1TU4A 3A1NA 4QBIA 2E7ZA 5JATA 4M49A 4TWIA 1VFPA 5HAOA 1SV5B 4AO7A 2VBXA 2CPEA 2GKSA 3IP3A 3A27A 2WIGA 2J9RA 4KAFA 3ZXXA 5CB6A 4J9SA 4PRYA 1ND6A 4P72A 4GHWA 3HL4A 1KQNA 2HH9A 3L05A 4MI9A 3QEOA 1SPXA 3P8BB 1H22A 3C45A 5DXFA 2ZWIA 3EAFA 4LG1A 2XTJA 1NZDA 2GTPA 3EYWA 4RE6A 2NSHA 2ACWA 3DFZA 4JBGA 1W0KA 3EVEA 1SU8A 2Z3WA 5DHRA 1MUUA 2VPXB 3IA2A 4GRDA 4B45A 4WNIA 1VRCA 1CS4C 1UEKA 3ASZA 1Z0ZA 4KFCA 2REQA 1BHSA 2CDNA 4JCOA 1F9EB 3T1TA 4Z7CA 1BMDA 4RMJA 4TYWA 3FCWA 2WABA 4LMRA 1ZZNA 5L4SA 3DBRA 1XCJA 3EXEA 3P45A 4JNKA 1JA9A 2Q41A 4XWWA 1ULBA 4INZA 3KK3A 1Q5PA 4ZCMA 1DKQA 1P80A 1OX4B 2YIJA 4X63A 1JEYA 2X3UA 3KT3A 3EVWA 4OMUA 2WFZA 3G0BA 3R23A 1E0JA 1IU9A 3R5CA 1F7UA 1Z2ZA 2Z2MA 3ZI4A 1HSOA 4U3JB 1PEKE 3Q8RB 2FE4A 3PEUA 1W4ZA 4M0LA 3AY7A 4ETNA 2QGFB 4IXWA 4BBZA 4FYYA 2QZZA 3SAJA 2DB3A 2IH5A 2IYIA 3LWNA 3G6KA 2BXJA 4YRPA 2W2QP 3DHVA 3OTHA 2XE4A 4E2FA 3IPAA 1RAFB 4M5IA 3MOIA 1P74A 2DTDA 1XMIA 4QPCA 3RSQA 1F8UA 1N9GA 1OYDA 1G7RA 3OCZA 5BNFA 4KX5A 4EY8A 4M60A 2LKCA 4G01B 3IRXB 5TPZA 1LPOA 2ZIFA 4XAQA 2G6BA 4OHVA 1E2PA 5IM0B 2SKDA 2XMKA 1TL1A 1D9DA 3JZAA 1ORDA 4QUIA 2BE9A 1UJMA 1E4OA 4ZZ1A 2ZIWB 3D2CA 4EMTA 3R0ZA 3UH1A 3L43A 1JPUA 3WGKA 1NTOA 3NYQA 2EARA 1Q53A 1N8SA 1S6UA 2KB2A 1N2CA 5DPMA 4EW2A 3LM8A 1YRLA 5IX8A 2O1WA 3H2BA 1NLMA 4KO4S 5JV5A 1FP7A 2FHSA 4IQGA 3Q0TA 1CCWA 3VZPA 3D6VA 1U1PA 3M9WA 4I4NA 2XS5A 4HTIA 2KH9A 4TV8F 1U2EA 1Y3BE 1D1QA 1RKBA 2VJLA 4LJ6A 1G6KA 2Y8EA 2YNFB 1CPZA 1SELA 3QHQA 4QUKA 3K9FC 2JCXA 4K87A 3TSYA 4RVNA 3W6OA 1RAIB 1HDOA 1RI2A 4CKEA 1KDOA 1H1LB 2IDJA 1N34F 1QP7A 1X13A 4DQ0A 4Q4JB 2MT9A 1T4CA 1VYVA 5C46F 1KGDA 1KDTA 2WI8A 1EWRA 4TLBA 3T95A 2HHXA 4RIEA 5CG2A 4YDHB 2EL7A 4F4IA 1SHUX 3SSQA 5DNUA 5CEFA 3OXGA 1P9WA 5I51A 4A23A 1UPUA 1E1LA 4P54A 2NO6A 3MUNA 4UHKA 1U7UA 5K14A 2WWGA 5JECA 5K6AA 1MN7A 2AD9A 3FEXB 4AG6A 4QYIA 2VPWB 1D1PA 3NKLA 3CEAA 4XM1A 2YWXA 3DOCA 4DCPA 1F8FA 1JQBA 5DP2A 3EA4A 4IXMA 2IRXA 3RVRA 2MHCA 3DAFA 4LRFA 3GVCA 3WKDA 1LBTA 4KGXB 2QDXA 1MJGM 3IP6A 3CVWA 2W9AA 3FCHA 3ZGZA 2OP1A 1SK8A 2MTBA 5JAIA 2J6BA 5KTPA 4BRZA 1USGA 3ITEA 3S7TA 3SHQA 3SQWA 3OPXA 3UJ9A 2HAFA 2SECE 4FBGA 2FQQA 5BMVB 2PWYA 3QFRA 4EWTA 1HNNA 2Z57B 3VR5D 4UTRA 3ZBUA 4TSFA 1VLJA 4EELA 2AHRA 1JTFA 3W5ZA 4G8BA 4KPEC 2E37A 4GKKB 4FNMA 5BWOA 2EU8A 3IAFA 3QXJA 1X7WB 2HYIC 3LVFO 2B4TO 2GZ2A 3MM8B 5J43A 4OJMX 1ZVJA 5KPJA 3SBXA 3NMAA 1T8PA 5HUJA 4ZYTA 2JD1A 4M5JA 3I0RA 2GN1A 3BGSA 2IRUA 2O7VA 1QG4A 3CH4B 1ELOA 5EN1A 2JEGA 4YECA 4YUVA 5IHXA 3FNFA 2NQ2C 4QC2A 4C6TB 4RGYA 4MIKA 3ZDQA 2WUDA 2HQGA 1Z5GA 4OBEA 4EG4A 2E48A 2PE8A 4GPTA 3ER9A 3SY8A 3JWIA 3IP0A 3B6BA 4ZRNA 1UMKA 3LDHA 1RAAB 5LYYA 1FK8A 2R7VA 2QI9F 1G8FA 2EEYA 2ZRBA 1FTYA 2IW1A 2JFZA 1CNFA 1WXFA 2VSNA 4Y2VA 2WTXA 4FJ0A 3M5CA 5CIYA 1S9FA 1V5VA 2R84A 1E2MA 3B6EA 3RQSA 3W78A 1JDVA 4BNKA 1AYEA 3GJ5A 4M46A 3GLIB 4P52A 3NHPA 1NVEA 5A3RA 1C3EA 1FSGA 2AC2A 4OGFA 3F41A 1CR1A 1HMVB 3RIEA 3JQPA 5CXXA 1YRHA 3KWJA 1NDQA 2OVBA 5JNUA 2UV8A 4CM2A 1MTOA 2H08A 1CJCA 2YN2A 4DLVA 3MTKA 2R8HA 4F36A 4CQLB 3HKDA 1EFLA 3ZE8A 1QONA 5C4IA 3JTNA 5KNCA 2ZHAA 2KX7A 3MM7B 5BW6B 5ESXA 3RUCA 1MDBA 3F96A 5A7FA 1LNQA 3V6DB 3IO3A 5ERYA 3ZD9A 2D6FA 1ECLA 3BGWA 5KVSA 2ISQA 3T5KA 5CUQA 4ZV7A 5H8WA 4BJ5A 5FDLA 1PEAA 1YHQS 3K2BA 2CYAA 4MW7A 1OO0B 1WHXA 3BCHA 1R66A 4NLUA 2I76A 1UH5A 1L7XA 3O8OB 3BN4A 4RK4A 5T7LA 1GEGA 3BD8A 4EHHA 1KERA 2WU3A 5F52A 1QQ6A 2YHUA 4N6GA 1ID1A 3OTCA 5TJHA 4WACA 5KZMB 1CJKA 4JBXA 5IAOA 4R9RA 2OXRA 4RCZA 2CFOA 3T5GA 3OO1A 3MM6A 1QH8B 1U2DA 2VTBA 5H3CA 5DTEA 4HC4A 3DEZA 1LC3A 3KV3O 4JOCA 1F17A 2X4IA 3ZI7A 4WEQA 2ZM6J 1Z83A 2DQSA 1M1XB 4ZU6X 1JTEA 1UMCA 5GZ6A 5ALJA 4N3CA 1IZYA 1EAYC 4WESA 5J23A 1P9NA 3RUBL 5KG3A 1N8RT 4XTTA 2IUFA 4LFCF 3C4JA 4MMZB 4FOPA 4NOLA 2G17A 5EP1A 1Z56C 2V9PA 4XLZA 4GOLD 2NPFA 2ZXEA 4BB0A 4GE0A 3R7WB 2P2YA 4BCAA 1YS1X 4BU0A 4QBFA 2JGMA 1J0AA 5KFDA 4GVXA 3D02A 2BM9A 2HRQA 4ZAGA 3ZYZA 3SPXA 1DRUA 3WKEA 2I2CA 3O2JA 1SXQA 1HFJA 4F9EA 1ICEB 4BCBA 4PFQA 1BRTA 3FSXA 4M0CA 2Z56A 3EVBA 2FRXA 2G9QA 2C2KA 1WWHA 2X0NA 2LLZA 3PDUA 3BXPA 1CJTC 1R27B 2PIDA 1AB5A 2VG6A 1WZNA 3IMKA 1VQ5S 1A71A 3AEZA 5B6IA 4JI0B 2ODPA 1YCFA 2IZZA 4V0KA 4ELUA 4QXAA 4MVJG 4YJ2A 4RJVA 4ZVPB 3NOQA 2DGOA 1ZJ5A 3F8SA 5FI5A 5IANA 3EARA 4PNZA 5A8KB 1JT2A 2J87A 2DETA 2X8AA 2BF4A 5THKA 3OZUA 3PX7A 3D1HA 1BQ3A 4EQZA 3WFZA 2JGJA 4R0VA 2LP4Y 2WJHA 1GFSA 4LF9F 3KYJB 4KRWA 3R7NA 2CDBA 3ZZ0A 2O8EA 2GRAA 4ZYUA 5ED0A 4L2IA 1CEEA 3M1YA 1WKLA 5DNCA 3RRKA 3OEHD 2K3KA 3QM1A 2G9NA 1YBTA 1SXIA 1JJBA 4OXYA 4W5QA 3NNCA 3KS9A 1F60B 3N9UC 3O4HA 1MFZA 3VDXA 4XQ9A 3J80Y 4IGKA 2GHWA 4C0HA 3I1FA 3TGLA 1N32J 3N8HA 3OT4A 2YCLA 4IDDA 3SDSA 4RQAA 1YRUA 4RNFA 2OPHA 1H4SA 2RDDA 4XJSA 4TTVA 3KXPA 2W48A 4BMDA 4X4RA 4B9TA 4X1OA 4NARA 1SKUB 2AJCA 1LV7A 5JPIA 3W2WB 3H8YA 4AVYA 4DT1A 4Z4IA 1Z62A 2IXTA 3PYLA 3TX8A 1JWWA 4P22A 4QX6A 2GZSA 1FDOA 3UMVA 1VQLS 4YY3J 1JXVA 3UBMA 2M8DB 1FNMA 3M8QA 3WIDA 5F3ZA 5JR3A 2XYPB 3MMCA 4ANDA 3POTB 4C8YA 4Y2CA 3PUKA 2OMLA 3A9RA 3EA5A 4AULA 4AWBA 2YDYA 2IDMA 2BY4A 2ADCA 1CZKA 4XQEA 2B1JA 4MW5A 4M0PA 1MN9A 2RC6A 3FUUA 1PR4A 2FWJA 1JLRA 1KJNA 1J70A 4ZVHA 1ODIA 5CLIA 1R8YA 2BELA 2Z5GA 2FZ5A 5I7AA 1J8DA 3O1LA 1FUYB 3TA2A 5EIHA 1V3SA 4NNOA 4RY8A 4UTGA 4XVRA 2D1TA 2HHVA 1VOTA 4WZBB 2QR5A 4OCZA 2BEVB 2XNDA 1N6HA 4OL0A 1RCFA 1WG8A 2YH0A 1RSZA 3OFEA 3LLVA 4BNIA 3IEUA 2JFQA 1K5DA 1GOTA 1Y3JA 1U4OA 2QX4A 4QDUA 3EIXA 5AJXA 4B4KA 3H3XA 5FCDA 1DXQA 4ZDWA 1KTQA 2RKWA 3R7SB 3HBNA 2Z98A 4RA9A 5KYWA 4QUAA 4KWEA 1JQDA 1DTTA 4B3RB 3DM2A 4FEYA 5AHKA 3G8SA 2AF3C 5EY5B 2IYVA 3RAXA 3T7KA 3I96A 4C11A 3JQAA 2MZSA 2ZRPA 5SZIA 1K89A 3DV2A 1D0EA 5HZKA 3LX6A 1TQDA 1T03A 4AS2A 4E30A 3PX4A 3U3KA 1T36A 1G7CB 4DR6F 2J7UA 3AOEC 4DRZA 5I4BA 2XM3A 4URSA 1I51B 5B7PA 4JIMA 1O94A 2PR2A 3IKVA 4WZAA 4P4TA 2WWYA 3OFJA 1XWLA 3EXG2 1KHHA 1IKXA 3TCKA 3V4VB 1VCMA 3AODA 1RE0A 4MWCA 1KC1A 3VVTA 2N75A 4YJFB 1JYFA 1ZJ6A 5KT5A 1O97C 4REOA 5E6UA 3O31A 4IIDA 5IAJA 5FQOA 1E7YA 2G1PA 4LF5J 5K0NA 4KO8A 4KODA 3KXLA 2IBOA 2B99A 1NHKL 3SCLE 3GP9A 3MM5A 3WHIA 2P9BA 3W4JA 1B43A 1RAGA 1ZD1A 1VFJA 1HKHA 3HUTA 3QJ5A 1X80B 1EIZA 4RACA 1T9GR 1A2QA 4MIAA 4MTCA 2GZDA 3KYCA 4M8KA 2E89A 4OYXA 4NCNA 5AT1B 4MP6A 3ROZA 4NP6A 4UBKA 5HM8A 3V1UA 3K6SB 3X3HA 3ISTA 1OOEA 3N5BA 1FESA 5KQLA 5D4NA 2PA0A 3TECE 1EIWA 4I1UA 4QXMA 4E11A 3AI1A 4LQCA 4CF4A 2YKAA 3BXFA 2OTLS 3REQB 3PG9A 3IODA 5CT5A 3VGSA 1R0CB 1OSCA 2QD2A 1O89A 1WDTA 4K6HA 4R9NA 3N8KA 2MYUA 1CUZA 4OYBA 2NTJA 1HYBA 2HF8A 4PGGA 8GPBA 1L4FA 1CJUA 1JFTA 4QYZK 2AL7A 1E7SA 2HFUA 3R0XA 2Q5QA 2I6GA 1ZSNA 3HYCA 2ECOA 3B7PA 3K7RA 2MLXA 4F67A 1SQFA 1E94E 1NH7A 2OG1A 4RQTA 4GM4A 3DB1A 1XHEA 2QUIA 2EF1A 2Y99A 5ALWA 5BT9A 4USIA 4RGQA 4IIJB 2JJ4D 2PFSA 5LDDC 2Q5IA 3NMUF 3WC2A 4RK5A 2W8LA 2KU7A 1F2UB 4Q4CA 2C4UA 2W7OA 4N12A 1DY3A 3N58A 1I94B 5EVJA 2XUDA 1GU1A 1T94A 1NUEA 5I42B 1JILA 2RB5A 2W7TA 2XDYA 4ELVA 1ZSYA 2GO7A 3PG5A 3QLTA 3P96A 2VN8A 1KC8T 2B8JA 4FI3C 4C3ZA 3P9XA 1X8KA 3UJAA 4Z9AA 5AI6A 3D3JA 4QQNA 2UUAB 2IU4A 4PPYA 2XUHA 1NAQA 3TJ9A 1P4JA 3ZHUA 3KL2A 3RG2A 3BGFA 3E15A 5C7PA 3DMRA 1JKHB 4MRSA 3WLOA 1MC4A 3VSAA 1L3TA 4FLMA 2ON6A 4RZHA 1JLLA 3Q5GA 2DR6A 5D5QA 5J2MA 1HT1E 3MCTA 4J0JA 1QRRA 5ERGB 3A8EA 1N6QA 2E4AA 2AUMA 3F2IA 3BK7A 3AR4A 1SKYB 2FQYA 1UW9A 3G96A 2PBRA 3D81A 2FZCA 4BFUA 2RE8A 4ZAFA 4EHNA 4D9IA 1KP9A 1S9GA 1SAYA 2GR9A 3IC1A 2R1TA 3MR3A 1ZC3A 1REVA 1NKVA 1MHPA 1K8ZB 5F8MA 2AH5A 1W34A 3CG4A 1OV6A 2P4QA 3HCAA 3TYTA 2ZZTA 3WV5A 4K5RA 2ZBQA 5FOTA 1PWZA 1U26A 5TMDA 4M5LA 4UOQA 2YWGA 3K5NA 5G1PA 1O0PA 5ELMA 1C1XA 2VF3A 1IUKA 2I22A 4XJXA 1TT5B 4R84A 1TVEA 3MINB 3GZNB 3E9YA 4XYLA 1NRKA 5K6TA 1NVGA 3RCBA 4J91A 5A06A 3EIOA 2G8LA 5F3DA 1RBQA 2XYHA 4N0MA 2B1IA 1UVNA 1Z5PA 4K26A 2BFPA 3VGTA 4NDZA 3N3AC 2F59A 2J5BA 4H2DA 3GZTB 3L7NA 4C1BA 3A6FA 3QWBA 4DDKA 1UIRA 4TKZA 4AXXA 1RXVA 4EB0A 2YKNA 1L9XA 4OX9F 4LN1A 1RHUB 2RIRA 3GRZA 3ADPA 2XDWA 2J8SA 5K4HA 1SC4B 5LT5A 2RGUA 4LTNA 1EDZA 3UM9A 2OK8A 1NFFA 5F3WB 4IR7A 1T0BA 4HJRA 1V0JA 2GJIA 3GU0A 3CZ9A 2WAQD 2RH4A 3FMWA 3EGXB 4ZZ3A 1RTDA 3BZWA 3O83A 4RQUA 3WGQA 5JMTA 3V80A 4QJIA 1DLOA 2M88A 3OU2A 1EJ6A 4J3NA 3A28A 3SDBA 1XWWA 2XODA 4M99A 4B3TB 1C4AA 2M4MA 3WWZA 5BN3B 3GCDA 2RAUA 1TC2A 3LD9A 1K4YA 2Y77A 1LPSA 4JXZA 4NPAA 4IDOA 2K6GA 3K8YA 4YRIA 4BO4A 4ZI7B 1GVHA 2Z2KA 2P1RA 3VR5A 2KE5A 3QWUA 3SSSA 3RT7A 4RAOA 1Y4SA 2ZUFA 2ODNA 4MA5A 4IHAA 2AR9A 2VHXA 3Q7SA 5GADl 3PFBA 2HBQB 2ZS9A 4E12A 4KIGA 4MDHA 3W5SA 4PWYA 1QTMA 4WAUA 3ZBQA 4EKYA 1V16B 5CAEA 1PRYA 3GJ4A 1RCXB 4E0DA 3RC3A 5EX3A 1B0TA 3EMDA 3CJ8A 2HHJA 5I9IA 2FUCA 3T3NA 1Q0ZA 1RHKA 1OJ7A 4OUDB 2FFQA 5IH3A 4FPXA 3EJWA 2GNKA 2AOUA 4OHOA 4Z7NB 3N76A 1XG5A 3PK0A 3REFA 3RRZA 3DE4X 3MDFA 3CVYA 4ZOLB 2GDZA 2WM2A 3F4LA 2G07A 1S1VB 1FNBA 4BMNA 1PZGA 1HZZC 3PKZA 2IQ5A 4PYNA 4D4LA 3PKJA 5B64A 3MD1A 1AM4D 4I19A 2GAFA 4BB9A 2CPHA 3LC7O 1NJZA 1QSSA 3T94A 3NGSA 1JH8A 1OXUA 2ZRCA 1TV6A 2A86A 1O7JA 4I4IA 3RVPA 1O87A 1MH9A 4G86A 1XK6A 2CN1A 2AV6A 4PAOA 1JUDA 7FDRA 2JGIA 1TRKA 3VU9B 3KE8A 4PLYA 5IWAJ 3GRFA 1KH1A 3NAIA 3PI6A 1MG0A 3LALA 3HFSA 1OE0A 4IX9A 1NAHA 3IEXA 1VJDA 4TV9A 5IDQA 3AVUA 4FBUA 1C8BA 4Q47A 3SZMA 721PA 1THTA 4OYLA 1WNTA 4GOMD 2HA2A 3AEUA 4FDUA 4L5YA 2HXGA 2JEZA 4BNTA 2ISSD 4Z7QB 3LU1A 2WUGA 3K0KA 1F8GA 4KTTE 1PV1A 5KINB 4LYDA 5KYXA 1DTWB 1SOWA 4GPD1 4V38A 1VKNA 2GYYA 1JU9A 7MHTA 2BJ1A 1Z4KA 1WEHA 1BXGA 3FYUB 3HNRA 4DX6A 4U1RA 5U9CA 1MGPA 1N4AA 1YR9A 3UWDA 1LQ9A 4IOLA 2EJBA 1YH3A 2VK2A 1TO6A 2E4WA 4IMPA 2VOOA 3ORFA 1EQUA 4X62J 4BNJA 2JS7A 1ZL2A 5DX8A 4O4IB 4BWMA 3BO3A 4Q7MB 2JJQA 2DKFA 2JPDA 2GQQA 1KY4A 4F5WA 3UWPA 3WB2A 3AF0A 1KMMA 5HSGA 1UBFA 2DCUA 1CULB 1T8WA 4L4YA 2I5PO 3GP3A 1NSAA 3C7AA 4W92B 1NW8A 3ISZA 4BLUA 4Z6KA 3DNFA 2YBDA 5BWBA 2WV7A 4L57A 5CA0F 3V4OA 3I6YA 2NZCA 1A0OA 1P5RA 3QNWA 1EJ2A 3IP1A 3QOFA 4NAUA 2B20A 4CN8A 1PS8A 3FVQA 3KZNA 4PXYA 1NPTO 4Q00A 4BO5A 3LH2S 5FLYA 3I72A 1N75A 5AW4A 4XDYA 1VQ6S 3WJ1A 2Z0MA 3U3XA 1X9HA 4M94A 1Q0HA 3K32A 1RCUA 1CG2A 2ZYWX 4DIFA 4QTXA 4GECA 2W6PA 5TPZD 3VMFA 2BZSA 4FMCF 1WVGA 4RYLA 1TVKB 4U7DA 2VDRB 2HA6A 1O9HA 1Z34A 1TK9A 2WJIA 1VG1A 2WP8J 1XRLA 4RGVA 3ZDYB 2VH2A 4IVPA 3TZYA 1TDJA 2GTHA 1F1JA 2ZB2A 1VB5A 3DOHA 4AB1A 4CVNA 1S9HA 5K0LA 2FP4B 5IBRA 2QIFA 2BE2A 2AFIB 1NQXA 1IJFA 1XCLA 4QU5A 2JFKA 3GBSA 3EPHA 2IBKA 2WKWA 3TRHA 2PXCA 4GZ3A 2XMJA 3E4CA 4MR9B 1RXYA 4RZQA 1KEEA 4KRXA 1U6IA 4TL9A 2IVFB 3FETA 4Y0FA 2BCGY 3RB3A 5DYNA 5LMZA 1Z22A 1CY4A 5KFRA 3X3UA 1NUHA 1KAEA 2YRWA 2FMKA 1PJCA 1HG1A 3OEHA 1WF1A 2C4MA 5HNKA 3O84A 1C7QA 4B5KA 2GILA 4QTTB 1X3SA 3RVKA 4JHXA 3FMPB 3FNHA 2YNGA 3JQQA 1FO1A 4NOMA 1J21A 2QY9A 4RHFA 4DGSA 4Z53A 3L07A 4G1IA 1U8CB 3GFVA 4E98A 1AN9A 4B7ZA 2I6XA 1BIFA 3D0IE 4H15A 1GTL1 2OZLB 1LW7A 2RRAA 1CU1A 4HZUB 3UT6A 3D43A 3DEJA 4YQZA 4AF8A 1BWRA 2GH1A 5D15A 1I6MA 3IMCA 3ROPA 3V4IB 4C29A 2IA5A 2KKHA 5KFVA 2UXBF 5A9SA 1RT1B 4DLXA 3DMJA 4A6DA 5BWCA 2E3JA 1EA5A 3KKLA 1KVRA 5KFAA 3SZ3A 4IQ4A 3K0BA 2VXYA 5F3TA 1IBLJ 3OLBA 3IQFA 2BTQA 1UWBA 4CMAA 4TSFD 1QF7A 1KKLA 2YXBA 3AG6A 2BRKA 2ZU6A 1RWOB 4QU9A 2HPZA 3KSZO 2ZH9A 3UCEA 1T2NA 3NPAA 2ZR0A 3P71T 4HGZA 3DZHA 3AL2A 2E4UA 3SLGA 1U7DA 2K7ZA 1FMLA 3GZJA 2HLDD 4G1BA 1MT0A 1VCHA 4NEYA 1GAQA 3HGQA 3ZOKA 3U7EB 1L7PA 4RTOA 1SH2A 4WH0A 2VFUA 3BHJA 1DU4A 2XB4A 4LJLA 2ZPUA 2PH5A 3PEVA 3GDFA 1Y5RA 1S1TA 2FPXA 4O2LA 2NX2A 5CYFA 1WELA 1M5SA 1DHRA 4JT9A 3WK9A 5CYPA 3QPIA 4NRDA 4UW2A 2VPIA 1AKNA 1MNEA 1HBNA 3EUNA 1M2VA 1VHLA 3KELA 3F5SA 1TEHA 2AGOA 1CZLA 4KR9A 3R9XB 1Z2OX 1HARA 3PZPA 4TY8B 1UEXC 5DW3A 4F0KA 1UXIA 1KOLA 1N5DA 1U1DA 2NQTA 3QGIA 2OB1A 2VPYA 3KHKA 2EFNA 3DBVO 2R00C 3WBKA 4FK8A 4L73A 4JXXA 2UVRA 1BQ4A 3UJNA 4M9XA 1T6XA 2JCSA 1ZGZA 1ZXBA 1MO3A 4INPA 1EMDA 4Y2HA 4GYJA 2XIQA 1AKUA 2HFSA 1SQSA 1SK9A 3ZGXA 2COLA 2Q6TA 2JH8A 4QEDA 4XR9A 1W1UA 4FSDA 1H94A 2BUAA 2H48B 2YVSA 5G4KA 5LZ8A 3OKFA 4O59O 1ZS6A 2VG8A 4AXIA 5KFJA 4EG5A 3FFTA 3U7QA 3DVLA 2A3JA 1I32A 3RIMA 5KG1A 5AXNA 3OT1A 3ZCRA 2V3VA 1R4AA 2V3CC 2IFXA 3LKZA 5KNCD 4FFBA 3N2GA 1GLNA 2JB9A 4F4JA 3DXXA 4CG2A 4P5PA 2YVQA 4B79A 5HJEA 3U7GA 2O8NA 2F8SA 3JD1A 3CCLS 1VBKA 3BC1A 3AJ1A 3DKVA 3QOXA 1W59A 2WMYA 4E14A 1N5LA 1FDSA 4IIXA 1GRCA 4D80A 5CD1A 3HB7A 5CA5A 4UHBA 2BR5A 2I4IA 3OX1A 3L6DA 1TFRA 1C0TA 2YNMD 3I2KA 3KO8A 1OTYA 3MCVA 3B85A 2V03A 3DEIA 5KVVA 4PHCA 2DPYA 5K7SA 2ZULA 1BS1A 3QW2A 2RMLA 5BWMA 1D5CA 5IAGA 3BWEA 2C96A 1XERA 1AF7A 16PKA 1XZKA 4RUCA 1WKBA 2GF9A 2GOYA 3TAQA 4PS1A 5BR8B 3HGMA 1GUBA 2OFHX 1YJ8A 1LW0B 1U0GA 4Z2YA 3UATA 3R8CA 5CABA 5SZHB 3TUJC 4DG9A 1TUIA 2QVBA 3WYDA 3DRXA 5K0TA 2OBLA 4A8JC 1E6VA 1NVDA 1YZ6A 1UIMA 2NIPA 3LPDA 5IJZA 2J5QA 2GIFA 4JVLA 2PD4A 3E7WA 3ZCSA 1M2WA 5KQGA 5TE9A 4JKOA 4G3IA 4LBIA 5D3MA 1NOJA 2IS2A 1FTCA 2ZWAA 4OP1A 1TYZA 3PUIA 2BACA 4MUGA 4LMAA 3QATA 4QGFA 1RRGA 1SWVA 3JSMB 3LXRA 2CL5A 4Q9DA 4D46A 4X93A 1XCMA 2CFIA 3HJBA 2FDNA 2PUDA 5J1NA 3BKFA 4DV7F 1AFIA 1YTUA 1E3QA 1NP6A 3NBAA 3Q86A 3GFQA 2JDJA 4I5GA 1PTKA 1PYTA 4PC1A 2HHAA 5C8YF 4HVLA 3SLKA 3MS7A 5BR7A 4WTYA 2H52A 2ZUDA 1GGMA 1SQ6A 5J2PB 5JQGA 2LPMA 3DOMB 4RUHA 4ZCRA 1O95A 3E9RA 4RD4A 2PH1A 4Q3EA 5CVEA 2B36A 2OL4A 2OAP1 3PXDA 1AVTA 5ELXA 1SJ4P 3IESA 2PXAA 4DUZJ 1SC9A 1ODFA 3MFYA 1K3TA 3ITDA 2WSYB 3VNQA 1K97A 4YOEA 1YS9A 4JUZA 5IM4F 1Z4LA 2FR8C 4F4CA 1E61A 4LRDA 4UCFA 1HKUA 1GUYA 2IYPA 1MWYA 2YNHB 2CZCA 1XC9A 4LRQA 3ZZOA 4FFLA 3S6EA 4FFPA 2AOXA 5CLJA 4FC6A 4EHDA 3PJ9A 4O3SA 3RYCB 4YVFA 3F56A 3PGJA 5AW9A 4K8OA 1B2LA 4P0QB 2BR4A 4WJLA 3PZRA 2QRJA 4UOEA 4IS2A 1JZTA 3LFTA 1IBCB 3VVMA 1W0JA 2BMVA 1DAEA 1P1TA 3H5LA 1RTHB 5K5EA 3BB5A 1BVUA 3CZ4A 2W2LA 2V1XA 3PBKA 4TMTA 4KPUB 2P69A 2CXRA 3H7IA 4AZVA 3LUYA 3CPJB 2GEBA 1ZQ1A 1D0IA 5K3FB 4CTOA 4ZREA 3WGTA 1E1MA 5AIBA 4YHHF 4GXNA 2X9LA 2GCOA 3UCUP 4DDFA 1E6LA 3KEQA 4RVOA 5EWJA 5ETMA 4M1MA 4GKJJ 4Q4AA 6ABPA 4WXRA 4NPOA 3DE5X 1HYEA 5FUVA 2C4NA 1HPZA 5IM5A 1HNIB 1JBQA 5COQA 4KIJA 5JS1A 1NNSA 4DC0A 4MRAA 3QLUA 1PK9A 4ECSA 2F3UA 3ETEA 3PRHA 2TMYA 3BEDA 4DXDA 2IKQA 4DE5A 3GJSA 2CWDA 4B2LA 4K4YA 3E3AA 3VX4A 4ZOAA 2BGRA 1Q16A 3NYWA 3I9KA 1M5TA 4DV6B 3U4MA 1WVIA 3AV0B 1XXHB 4JUAA 2AJ8A 4MVJI 4YWHA 2FR1A 3V1YA 4XASA 2DFPA 4URWR 1A7GE 4KYTA 5LOVF 5KKNB 3MMAA 1NKBA 5F8HA 2Z5VA 3PZBA 3TOQA 3RI3A 1VE5A 1DJPA 1K63A 3K70B 1HA3A 4H4KC 4ZKEA 2R7UA 1R0SA 2IZ7A 2IDLA 1IHPA 2Q45A 4BNMA 2NPOA 2VNJA 3B1FA 3SZLA 4USMA 3DDWA 2Q2QA 3N0VA 1XLTA 4L0CA 5LKAA 3EQ9A 3VZDA 3R27A 1M8PA 5KJ6A 2IHUA 1CLUA 3P4YA 4S0ZA 4EA8A 3UAOA 3W5IA 5K51A 3G0GA 4ZT7A 1YQEA 5LVAA 4PX9A 5E7QA 2HW3A 3DO5A 1KK2A 4IQ0A 3E7FA 4I8XA 4IDKB 4QYZJ 5IXYA 2QW0X 1Z75A 4WADA 4NIMA 1UINA 4DR1B 5IVKA 4NMWA 4TQRA 4IDGA 3UCFA 5DM0A 3AOBA 2MQOA 4H4MA 3N70A 3D7LA 2B35A 1U8ZA 3HFGA 3U7JA 4FBTA 1M1UA 3FFXA 1WHSB 5D3GA 2EC5A 3K16A 1EUDB 1IEXA 3V9AA 3RWOA 1MNQA 5LLDA 1RPTA 5HN0A 4X4QA 3M6AA 1KJ8A 2P2SA 3HRKA 2YHIA 3DTVB 2W9BA 4J0GA 1GITA 3U56A 3THXA 1OPZA 5GJCA 5LMUF 2YNIA 1KBOA 2JEJA 4MMYB 2Z2IA 1G6Q1 1GVNB 4C5BA 4BFZA 1DV2A 2PLNA 5KHLB 2YKPA 2CXOA 3AA8A 3HN7A 1FHTA 1H93A 2BD0A 2JEOA 4WINA 3I6ZA 1A1VA 3I5MA 4ZTZB 3OJUA 3HB5X 5GGXA 5FHRA 1YR6A 3CZRA 2PGOA 3ZTQA 2HWWA 3UG7A 4Q7AA 3L6EA 3EZOA 2QTRA 3G2IA 3MTQA 4LUCA 2C95A 4LGVA 4U8HA 2O8VA 2VUHB 3KFVA 2FPGB 3ODGA 3R9IA 2ZI9A 1Z38A 1E2BA 2P2CA 3VOBA 2NM0A 4WA7A 2MGZA 4I55A 3G9ZA 1XL1A 4V3CA 2WOMB 3PS9A 1MB9A 4IRUB 3AZPA 3TRKA 3ILOA 2L17A 4LXUA 4PVDA 5DWQA 4F4KA 3J7YI 4V39A 3TEGA 1H4TA 1RLJA 4ZHRA 3CRVA 2AKWB 4J1QA 3UAXA 1H5NA 2ATCB 4DV4B 4DWVA 1KBRA 4J2TA 5JC8A 2CSUA 2NWQA 1SIZA 4JLVA 2X0DA 4NHEA 3SYLA 1L5MA 2NTVA 1FKOB 4I1PA 1ROFA 2W5UA 2IUTA 4BAGA 1G8AA 3VNUA 3U7RA 2VQSA 4M8SA 2C5GA 2IHNA 4RS3A 3BDPA 1QAIA 3HFZB 3L40A 5DLEA 3DMTC 2L0XA 1UCNA 4KE9A 1JHUA 2OV6A 4BDSA 6REQA 4KUHA 2XZLA 4B8YA 2AQHA 3E1KA 1XTSA 1UT5A 1D2AA 2VBYA 1TJ4A 4A3SA 1TYDE 1TLLA 2BKNA 4YP5A 1ZC4A 2W6ID 3RYLA 2N7YA 2NUTB 4FDTA 3C8DA 2FJAB 3T3MB 1T26A 2W71A 4WOPA 3D64A 3ZZ1A 1OTXA 4KQJA 5DN6A 5D8DA 2ZATA 1C2PA 2EK6A 1PJAA 4K9MA 2QX0A 3GUVA 4O2RA 2CQIA 1KQGB 5KFCA 2Q6VA 3ZDXB 1YC2A 4OY3A 4EX7A 1BCRB 1YTYA 1XALA 3N01A 2D5IA 3R8XA 2XCIA 2HIQA 3D6AA 2RQKA 3ETLA 4DUYF 2ZGVA 3IUSA 2RHBA 3Q88A 3W3SA 1HQEB 4DANA 5C53B 1EJBA 3HJHA 1PK8A 1FRNA 3LP1B 4IG4A 1E5TA 4P71A 4E5PA 4WK1A 2YZKA 5E3CA 1L4GA 2PSEA 2F43B 1G3QA 1JXAA 2FDXA 5B3KA 3U48A 1RLDA 1WUYA 3KKPA 2O3SA 4NJMA 3IWXA 1I3OA 4EHBA 3RREA 4P7GA 5EQDA 3CDEA 1A8PA 4YJHB 4TSKA 1KVKA 4RMHA 2FQ1A 3E9QA 3JWJA 5JVDF 3TQHA 1T2AA 1F0KA 3BCRA 4N76A 2BEJA 1UKCA 2JAWA 2PZMA 1QAXA 4NBWA 1DFHA 1HDGO 3KOZA 4ZN6A 3UV3A 4LGMA 4G1QB 4DR5B 1N1MA 1HM5A 3KOYA 3BL8A 5EI5A 5JOQA 1GMWA 3IUQA 1JI3A 2JH3A 2J3QA 4YS2A 3ESXA 3I23A 4IAOA 3WGYA 2HCJB 3EIUA 3OJXA 4Q3BA 1UVLA 1NUPA 4R1MA 4YREA 1T0HB 1SBCA 1PJ4A 2B4VA 3GR0A 1SUWA 1PJTA 3QO9B 2XS2A 1M34E 2C54A 2NO5A 4NDNE 1M5OC 1SXJE 3QIDA 2A4MA 5IXJA 1RYSA 1UF9A 5K45A 1FEHA 3T9CA 1W7WA 2WYOA 3W8EA 1J1ZA 3PX2A 4RMGA 3VA7A 5BN1A 1P72A 1P7CA 2P2NA 3C97A 3O3NB 4GP7A 4N0DA 4NDAA 1QH9A 4MPTA 4GLLA 3V81A 1RT3B 3L7MA 4COOA 3RRGA 4YC7A 3PL1A 2XKKA 2DJIA 3OJCA 3L1JA 5J2QB 2EERA 4QM7A 4DPLA 4DL5A 3O6VA 1PLLA 1RTKA 5FBVB 3GNQA 2DWPA 4KUEA 3I9V6 4BFWA 2TMDA 4HHUA 3QEMA 3I5AA 4LBYA 1HC7A 4RLEA 4JQZA 4MKHA 2Q0SA 2ZJYA 4FSXA 3AUXA 4EFDA 3H90A 1GPYA 2IHBA 4I3HA 5DK6A 1LJLA 2EFOA 1Q84A 2P0AA 5JCOA 1NA5A 4JLMA 1VLLA 2UVDA 5JYCA 3PY8A 4DG5A 3IOMA 4Y1RB 2MOKA 1E0SA 4TKTA 1LEHA 4PGMA 3MTBA 4N5SA 4B6GA 3GJTB 4Y9SA 1JXEA 4EJSA 4O2BB 2QPLA 3TE7A 4QAQA 1RJGA 2H9YA 1X5TA 2G36A 3UO0A 2OXCA 3TB4A 3EM1A 1Y5LA 3UR0A 5T8KC 3BPDA 3OQBA 5E4YA 4WV3A 1X60A 4UUQA 2HLDA 3ES9A 3R5JB 3E7XA 1M0TA 1AZSB 3NCQA 4BCCA 4AN4A 1GR1A 2PSHA 4J6FA 2Y1DA 4HACB 1R4NA 2RGNA 3EGIA 4E51A 1N6IA 3R6WA 1GPKA 1YQTA 4QRIA 3LYHA 3FKSD 1EFPB 4QIGA 1RWKB 2QAIA 2EWWA 4OOEA 2RDIA 1LDMA 1FRFS 3JS5A 1JQAA 4JI1F 4TUYF 2CAJA 3U60B 1C9KA 1X92A 4X00A 4Y6SA 2VJVA 1PGQA 1UBJS 2W6JA 4YI5A 3IRUA 2AIRB 4M1TA 4X1IA 3MAJA 1N92A 3QI7A 1ZD5A 1IWGA 3S7RA 2ZREA 3KJQA 4WXYB 3FUCA 2QMHA 1R0AA 2GN9A 5AKHA 1NG9A 2B0JA 2QLNA 3KIPA 1SUIA 1GXSA 1JQEA 3CTPA 3M8PA 4FYDA 1JR6A 1GPMA 4LDZA 3UC5A 5AXCA 4LXYA 4NMXB 1X39A 4JU8A 4OXQA 4J37A 2EC2A 3WL5A 2MZQA 3DGPA 3T3EA 5JWHA 3Q8KA 5CHCB 3I5XA 3C3LA 2XQJA 4JOQA 3K09C 3E05A 1U98A 2QRQA 4E7OA 2LFVA 1N34J 1FYEA 4L51A 3DLCA 3KFXA 3FCEA 3L3BA 3IE1A 1Z2LA 1YK1A 3HB9A 3M7IA 3X44A 1ZD9A 1U0EA 3J7TA 4M1EA 4KOAA 2OZPA 2NLWA 2KI2A 5HUHA 3L6OO 4OREX 1ESCA 5IJ9A 3RC9A 4MUIA 2QL6A 4MV7A 3IS9A 2DNRA 1TKZB 1SUBA 4BNVA 1LI7A 1XZQA 4MS4B 1SJFA 3TDNA 1A5SB 1EGVB 1E2QA 3DEKA 3IJ5A 3R4CA 2O8CB 3H2ZA 1KS2A 5TQ0A 3VR4H 3ZCUA 3C6ZA 1T9AA 2PL9A 2YNMA 1T3SA 3TQIA 2AKAB 3KTAB 2IWHA 3BUSA 4UC0A 1R5BA 3ROMA 4F4WA 5A04A 3PT9A 3U7FB 3BQ9A 3OT9A 3FUTA 1QJ4A 1RT6B 4K5QA 4D0LB 4DSZA 3PXGa 3K20A 4DN9A 4GKVA 4BAZA 3O5AA 2IGBA 4LAFA 1FEZA 3VTZA 4CPDA 3FA2A 4Y98A 2CKMA 4JJFA 1IKVB 1EVZA 2R4UA 3T7IA 1NVVQ 4GVPA 1M2OA 5JANA 1VRVA 2JAUA 1Z33A 1MJFA 1M1HA 2PLRA 2XCPA 3VVBA 4HGNA 2FQWA 3M2UA 2ATEA 4YUAA 4PAMA 5GJBA 1IIBA 4D57A 3PF8A 3LRPA 3RV4A 5BW4A 5FD1A 2BOAA 1ZIYA 4TZ6A 1PIEA 1P33A 1C5KA 4MW9A 3IX7A 4EFNA 2ZTVA 1ZZFA 3EDMA 3FGZA 4CLKA 1W2IA 3D5TA 4NQZA 3I2JA 1C0PA 1Z0DA 2QYGA 2KT5A 4KXVA 3EODA 2XZDB 4RWWA 1Y63A 4E2WA 3OOSA 4LZOA 4BX0A 1SCJB 4BGUA 2W2MP 3CBGA 2D3O1 4B6RA 2D5AA 3PV0A 3RFCA 3D6HB 2PT9A 3LP0A 2AG5A 1OWMA 5BWLA 4RDHA 1Y5IB 3VGPA 2CNLA 1H74A 2JDIA 2OC4A 3OEYA 4XUCA 3MCUA 4CNYA 1G20E 1GXLA 3QKSA 3JQ8A 3LUGA 5F8NA 2L2QA 1P2SA 2APOA 4F06A 2ZQZA 2DYKA 2NZ8A 3RJMA 2ORED 4IY1A 1V6CA 3CHYA 2J9DA 5BOSA 2DQ4A 5T57A 2OWEA 3LP6A 4ZA1A 4Z0TA 1UQUA 3Q5DA 3T0GA 3BX1A 3M83A 3I5YA 1E3DA 2G4CA 3QX7A 4GX1A 2ZROA 4TWBA 4DLEA 3T9DA 3VV2B 2JRSA 3CNNA 4ETXA 4IL5A 2G3YA 3KK0A 1P29A 5HE9A 3QVSA 3TM4A 4I7FA 4IKEA 4Y6RA 2V7XA 1IBSA 4C7QA 3GMDA 1K0UA 1LI5A 3GGSA 4NYJR 4X97A 4A8HA 1XJWB 4HY3A 1ZTWA 3IXMA 4QIEA 4LJ5A 1GKYA 4FJ2A 2JI4A 4ZVTA 2YYSA 4DA0A 1AA6A 5IFLA 2GX8A 3NXSA 2IU3A 4DPUA 2JBHA 4YACA 3F6YA 3KQTA 4DF4A 1BS2A 1Y98A 5KG0A 3FYSA 1BC5A 4B08A 1FMTA 3O2SB 1WTAA 4R3NA 1OAAA 3QT8A 1UBLS 4KFRA 4A8YA 3FFIB 3SXUA 4TZTA 2YJGA 3NG8A 4O23A 4LJSA 3H97A 4MAMA 1U8SA 4IMJB 1HTWA 2HA4A 4MB6A 4KXNA 4B9EA 2HFJA 1N7JA 4E46A 4HWSA 3QNMA 2PUJA 2O8BB 1WCV1 4W8GA 5LKRA 4N8DA 3WJ2A 4YR0A 1NVFA 1CJVC 3EICA 1ZK2A 3UUFA 1Y42X 2BGUA 1XJ0A 1G8JA 1M7HA 1F5SA 4FNGA 1C4XA 1JLHA 5TVGA 3MAGA 3KXKA 2WVJA 3RK4A 1TZBA 1QX3A 2X1FA 4LFCJ 1EX9A 2H4WA 3HVIA 1TGYA 4RKRA 2BFEB 3HZOA 2NV0A 1S7GA 3T61A 1A2OA 2QIOA 3IR5B 4EFAC 2RU3A 2HHHJ 1SFRA 2RHLA 1YBFA 4CDGA 1XEAA 2Q3EA 2Z30B 2NTEA 2HU2A 1WXDA 3STWA 1S2LA 3A6LA 1QO7A 2IVYA 2BGNA 3BSCA 3NV9A 4XPIB 4YAFA 2IYNA 3QU9A 3S8EA 3QSGA 2Q6KA 5EIXA 3JQMA 1UWAA 1QHEA 1G3IA 3WTCA 4JOSA 1NBME 1YK0A 3ESAA 1GTMA 1ZD4A 4GRSA 4PONA 1RW4A 3QZ7A 5H9FK 2QTFA 3K57A 5KAMA 1SOUA 3NDIA 1GNSA 4YV0A 2VOEA 2UZIR 4KDEA 2FPUA 1Z13A 1XD2B 4A26A 1EVEA 4CEJA 2GCEA 4EVQA 2JGAA 1F48A 1WHTB 4HMQA 2YC4C 1QIFA 3RU2A 4DUGD 1E2LA 4RDCA 4YP9A 1IL0A 2OSVA 1SRQA 2ETVA 1J0XO 1PL0A 3BO4A 5CK4A 1QE1B 4U7JA 1OQAA 4LA4A 3TIIA 3FAZA 4MQ4A 3CUKA 1SURA 1FWKA 4P2XA 5DN9A 5AESA 4ONEA 3DXZA 4DKXA 3CKKA 1QGUB 4LF9J 4FE3A 1VJ5A 1KP6A 4CR8A 3S2FA 1PJ5A 3RZAA 5FTWA 5EMNA 1RU3A 3AF5A 4LBHA 4OJHA 4II3A 3WLQA 3W9HA 1FE0A 2WMNB 3ZWAA 2IYZA 1CY7A 2VP5A 4UHFA 5K6AC 1P61B 4KO3S 1OHHA 4K9NA 1KO5A 4F8EA 2LCIA 4R8UA 3ZDZB 5BN5A 3O75A 5FRDA 1J22A 4DW8A 5LZ2A 1XMXA 1W85B 2VDMB 3ETMA 1XN9A 5FWXA 3W04A 4YRCA 4IFEA 2Z2YA 4FMDF 3VAAA 4UU1A 3SXJA 1SNYA 3LX5A 4WI1A 1A9OA 2EW1A 1EHCA 4UZCA 4K4SA 2KI5A 4JD5A 1U0BB 3DLAA 2IZ5A 2YXEA 4QATA 2GHPA 3U4HA 4X1KB 1YDWA 2YKOA 4UQTA 2HK7A 5JLAA 2Q4OA 5FA8A 2KG0A 2WW8A 2AE1A 2RFLA 3W2EA 1OPRA 1CW2B 4WKRA 4FKMA 2YVAA 3K0JA 2X3DA 1DC4A 4DQSA 2XUPA 2QSUA 1MPXA 2EGGA 5CJ2A 4YGXB 2YR0A 3QE2A 1XFDA 2VSOA 1NBHA 3TD9A 4PO8A 5AFSA 2WA2A 1UM9B 3I5BA 4JLUA 4G5GA 4U9HS 3EE6A 2E6UX 3WWPA 2QF7A 3FDZB 4K7JA 1KY2A 3KALA 1T2DA 1Z2EA 2CLMB 4X9XA 2F8TA 1AMNA 1RK8A 2NYHA 2EG1A 4GYWA 4XXHA 4H6PA 2CW5A 4C0AC 4UTNA 3P20A 5GAHU 5HDBB 2IYWA 2H1FA 4KSYA 2JNJA 4WLUA 3GQCA 3H1FA 2DR9A 2GZOA 3MSCA 5GADI 3PRJA 3FNNA 3PQ4A 3WGIA 2QOEA 3MM4A 1N56A 1F6WA 1P6QA 1PR0A 2JJ2D 2V9ZA 4WK3A 1X9GA 2GUWA 1DB3A 2BMBA 4JI2J 5G0RB 2HS3A 1R9JA 3RUPA 3OSUA 2IAJB 2Q3HA 2W6IA 3SXLA 5H82A 2P78A 5I7VA 4MTPA 2GD6A 3PTWA 2VJPA 2R4QA 3TPFA 3KFWX 5IYZB 3GG2A 2KW5A 4G85A 1U1CA 3TRGA 1RQXA 2EJCA 2PEBA 4EG0A 3CIMA 1YHNA 3BOSA 4Z9XA 1R4MA 4O4JA 1HE3A 3ROKA 2NADA 2O1SA 1P19A 3VR6H 4PYLA 4UBLA 4ECWA 2IH4A 3ZQ6A 3FBBA 3HHEA 2J85A 4OJNA 4AFNA 4OHBA 4HV4A 5HLFA 3THVA 1V3RA 4Z9YA 1E92A 5F12A 3MIIA 2KMLA 3C2QA 1JZSA 1EXWA 3PTLA 3T1VA 3TTSA 3TXYA 2WKRA 1O95D 4A92A 2GBLA 2PO7A 4GM1A 1HYGA 1FA0A 4RETA 2H31A 4BN4A 4DREA 1VKZA 1NVUQ 2EDCA 4DR6J 4I36A 3WI7A 1S48A 4WQMA 1PL8A 1ZH0A 2QLJB 4ND8B 3TUPA 4YK7A 4FHFA 3GHYA 3CJTA 5E3IA 1QVZA 3MFQA 1L5QA 4ICLB 4UU8A 3JZIA 2CPFA 3GD5A 4CV0A 1ZUHA 2OM6A 3TNFA 1OROA 1XR7A 4CR6A 4PPFA 3WYEA 5F1OA 2XB2D 4CMEA 1Y80A 1L7RA 2RHSB 4QWMA 4BQSA 1QUPA 5JCPA 3HZRA 4D96A 2WVFA 2ZLBA 3GX1A 1DBWA 3VF0B 2IF2A 4QYWA 1CJKC 4B3IA 5ITVA 2X4LA 1LSUA 1VQMS 1U2DC 1NWCA 1W0JD 2AFHA 5KFYA 4PXCA 2I1RA 5L1KA 3UTCA 4RLHA 2QLBA 1E89A 2G40A 1GTRA 1RKJA 1DRJA 1ZOOA 1C50A 2W2LD 1RMQA 1KHWA 3Q1LA 5HRCA 2ZSAA 1RFGE 1JEQB 2KLBA 3NQ41 1X5PA 3FYCA 5FBZA 1X31C 4ODIA 5K9ZA 4Q9LA 1FF2A 5DGDA 4I2PA 3TL3A 2CY0A 3NY0A 1GCOA 1J1UA 1EUCA 4XWKA 2Q6CA 3MPYA 2QAGA 2Q3JA 2OFXA 3AV3A 3DGVA 4NSNA 4MHOA 2XF8A 3G3EA 4Z4CA 4EFKA 2J4FA 4C7OB 1CQWA 2NVWA 2PT5A 3NIWA 3HNOA 3EVNA 3QUBA 3P5BA 3TARA 5I7SA 2XLCA 1ZM7A 2NVUB 1EP1B 2ZUBA 5HIKA 2QGNA 3INRA 1NKCA 4J0EA 1XNQB 4B09A 5JDCA 2DFTA 2CD9A 2IDEA 3DXSX 3ZK8A 2IYYA 5D51S 1BQEA 4F4DA 4JLKA 4RCYA 4UOCA 1WHWA 4P98A 2J3DA 3P9RA 1CS0B 1CB0A 2PHZA 1FFGA 2QRRA 3QVXA 1P17A 1KDYA 3QVWA 3RS3A 1GU7A 2VWGA 2QRVA 1RXWA 1SZPA 3MAHA 3FE2A 4CGZA 4NCGB 3K8ZA 2IY7A 4AKHA 4DR4F 1EETB 3UKJA 1YJQA 2ZRLA 3QKIA 4J76A 2WUVA 2AKEA 5EMKA 1V35A 4YBZA 2IPOB 2IZ1A 2CB9A 2P77A 5B6PA 1BD3A 5HF6A 3SHTA 3U1NA 1BHJA 1JDTA 1L4EA 2BGGA 1LA2A 1NASA 3H2SA 3RSZA 2A0FA 1BHNA 2L9NA 4W4TA 3CJ5A 5DU2A 4YJGA 3HS3A 1BMTA 5CB4B 2J9GA 4DS3A 5JVHQ 1LFPA 2VG5B 2J7WA 1S3GA 3EWNA 3CC8A 1MPTA 2EFYA 4WFJA 3FZBA 1FDWA 4M6WA 5B2ZA 1S0VA 3BQ0A 4IJQA 4MQMA 2RNEA 3BE4A 1RXEA 1PZXA 1YE8A 1U1QA 3WMGA 3FRJA 1REGX 4D5EA 4F97A 3RYHA 2YWRA 3TANA 1A82A 5EUBA 3SFTA 1KE1A 2GRUA 3NGTA 4J9RA 3BQ1A 1Y1PA 3AH6A 5HMMA 3FKSA 2YX7A 1TXGA 2DVMA 1TZKA 5AVXA 2J6UA 3RBXA 5TPWB 4DDWA 3OMLA 8ATCA 1JHZA 2FHJD 1W88B 2ODAA 3WNDA 1UL1X 1WPGA 2PUGA 3OQ6A 2R1VB 3MCAA 4NESA 4DM7A 3QEKA 3OLZA 4YROA 2OI2A 1E96A 3QT7A 1PQWA 2ZYDA 3P4UA 5JZBA 4DMZA 1N33F 4ED9A 3RHSA 3A1UA 5DTJA 2V7EA 1G42A 2KM1A 2OT3B 1W52X 3JQ9A 1USVA 1Q5YA 1NUQA 2CQCA 4EEYA 3ZZYA 2VS1A 2QR3A 1MWZA 1IKYA 2FVRA 5DCWA 5FPTA 3G2LA 1A2KC 2NZJA 2QA4S 2OCYC 1TR0A 4FKXA 1M73E 4Z86A 2DHGA 2FN4A 5JARA 4W1QA 3GJ6A 4CRWB 4AX8A 4GF5A 3Q6NA 2QTAA 1K44A 3AQ4A 4GR4A 5DDQC 4NAHA 3GH1A 3HUDA 4LFAB 3EISA 4X65F 4K1LA