4CI0B

Electron cryo-microscopy of f420-reducing nife hydrogenase frh
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
228
structure length
228
Chain Sequence
KPRIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Model of the F420-Reducing [Nife] Hydrogenase by Electron Cryo-Electron Microscopy Using a Direct Electron Detector.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords F420-REDUCING HYDROGENASE, SUBUNIT ALPHA
total genus 47
structure length 228
sequence length 228
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ci0B02
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ci0B01
5JSYA 1Y5IB 1FRKA 1A6LA 4UE6A 1FDAA 1C4AA 1GTEA 2UZAA 4C3OB 5CH7B 1FD2A 5A4FS 1KQGB 3AYZB 1WULS 1FRIA 2Z8QA 1JB0C 1XERA 3MM7A 3PNIA 4KO2S 1KEKA 3CURA 3OR1A 1UBUS 1WUKS 3MMCB 5BYQA 1HFEL 4ID8A 4UD6A 1F5BA 1FRFS 1YRQA 4UE2A 1WUJS 1FTCA 3MM7B 4OV1A 2FRVA 1G6BA 1FRHA 2C3OA 1F5CA 3MMAA 2FD2A 1UBTS 3USCS 1C4CA 3CUSA 2V4JB 4URHA 2VPXB 4YDDB 1AXQA 1B0TA 3HKZD 6FDRA 1UBRS 2VKRA 4UCXA 2PMZD 7FDRA 4UPVA 1FXDA 2WSCC 2WAQD 3MM5B 4UEQA 1G3OA 5D51S 2VPWB 1H7WA 3MMAB 1WTFA 1DURA 1UBKS 3GYXB 1R27B 2ZVSA 5A4MS 4IUBS 3MM6A 1FDNA 4KL8S 1PC4A 2FJBB 3IR6B 2C3PA 1FERA 1WUHS 4CI0B 2PA8D 1GTHA 1KQFB 1BWEA 4RKUC 1FXRA 4IUDS 3EGWB 2VPZB 1FRLA 3C8YA 3ZE7A 3ZEAA 3EXYA 3AYXB 2V2KA 3MM8A 3OR2A 5CHCB 1UBHS 4U9IS 1GT8A 3MM9A 3MMBB 2WB1D 2WSFC 1F2GA 7FD1A 2XSJA 1BLUA 4KN9S 4IUCS 1E3DA 3IR7B 1FRVA 2VPYB 1SJ1A 3ZE9A 1H98A 1FRJA 4UD2A 1FRMA 2FJEB 3MM9B 1YQ9A 4UEWA 4XDCA 4Y28C 2WSEC 1UBMS 1PC5A 2FJAB 3LW5C 3MYRA 1CC1S 3ZE6A 2GMJA 1FDDA 1VJWA 1Y5NB 2C42A 1CLFA 2O01C 4KO1S 4UCWA 3IR5B 5JSHA 1FCAA 5FD1A 5BYSA 1H2AS 1D3WA 1Q16B 4AYBD 1DFDA 1FEHA 4KO3S 2C3YA 3EUNA 3OR1B 1WUIS 1BC6A 5JSUA 3ZE8A 1Y5LB 6FD1A 4TTTS 1UBOS 5L8RC 1IR0A 1Y4ZB 4KT0C 5BYRA 1H2RS 4UCQA 2WPNA 1IQZA 2GMHA 3MMCA 5ADUS 1FF2A 1UBLS 1ROFA 2V4JA 4UE3S 1SIZA 4DHVA 2Y0SD 2C3MA 4L6V3 1BD6A 4XDDA 1DAXA 2C3UA 2FGOA 1H0HB 4UQLA 5JT1A 1FDBA 2XSJB 4U9HS 3USES 1K0TA 3MM8B 1RGVA 2FDNA 3OR2B 4GD3Q 1B0VA 4UQPA 3MM5A 3MMBA 5E7OB 3UQYS 1UBJS 5JRDS 3MM6B 4XK8C 1YQWA 1BQXA 4UPEA 1JNZB 3RGWS 5A4IS 3H3XA 1SIWB 1FRXA 4OMFG 1JNRB 1B0PA 2FJDB 1GAOA 1H7XA 2PDAA 2IVFB 4KO4S 5JSKA
chains in the Genus database with same CATH superfamily
2QN6A 3OMXA 4CH0S 4MGYR 4HGRA 3R7LA 2DNQA 4E3WA 3C6KA 3ISTA 4PO3X 3AZPA 2IDEA 1S8OA 3OP1A 2R11A 4C03A 2LA6A 3RIXA 3NH6A 4TVKA 2NSLA 1WTCA 2WWVD 1RACA 3D7LA 4BKMA 3D6MB 3CPWR 4UW2A 1PGJA 4EK2A 1IEVA 4BGUA 4Z7YA 4BZQA 2HB6A 1EESA 5HROB 4CU2A 4MQBA 3SS9X 1X7WB 3TKLA 3RSFA 1S3IA 2PSDA 4DUYB 4MTPA 3EGEA 4RQUA 5E9AA 4DWWA 2B1RA 3LW8A 1TK8A 2P35A 4J9SA 2XD9A 5B1EA 2IZ0A 2KU7A 4G25A 4Q0BA 1XTKA 1RR6A 1XXHB 3QVXA 3GLQA 1LS6A 1M74A 5IVKA 3MW8A 4ML3A 1V8ZA 1OH5A 2PBRA 1NUPA 1AM4D 3REQB 3WV4A 5DGDA 1B0VA 2CXOA 4NHEA 3LUFA 1JAXA 1I2DA 5IK2D 3FFWA 1KJWA 5C7LO 2IYIA 3DEZA 3G0GA 3FGNA 1UXKA 1VK3A 1DWQA 3D8TA 1LLFA 1BWSA 1E4OA 1SBQA 3O2JA 1U8CB 3IXLA 1QKJA 4ZDNA 1YDWA 4A46A 2C2KA 1ZXXA 3QVOA 5LDHA 4LHSA 2DKNA 2RUSA 4Z9XA 3QBVA 1NHWA 4YX9A 3JQ7B 3H04A 1OW3B 1RI7A 1GTHA 2EEZA 3DN9A 3HB4X 3FFAA 2IYVA 2HIHA 3DBIA 3FWNA 4H6WA 1GWNA 1WWHA 2FFQA 2JC3A 2JFVA 3X1JA 3V3KA 4OJ1A 2QMXA 2F8MA 4CKWB 1V41E 1QWOA 1E8DA 1YDFA 1OGIA 1QONA 2Z2LA 4F4CA 1VL2A 5FAKA 1JHOA 4USKA 1GZ6A 5AKHA 3BKTA 5KOHB 3AEUA 2VD3A 2WOMB 1E6WA 1BQXA 3TTUA 2CMKA 2NLOA 4NONA 2NREA 3QQ5A 5KNCD 2P40A 3CJ4A 3S81A 3NTLA 1W36D 3RRKA 2QV7A 2F63A 1QG0A 2HSDA 1BE1A 1TUBB 1IB6A 3PVCA 1VQ8S 3BWVA 3MR6A 4F3QA 4H3SA 2V4MA 4C0KA 2NYHA 3HT3A 1YBMA 3I23A 3O1JC 3PY8A 4MQLA 3QFFA 2A3JA 1YBVA 3ESCA 2VYFA 4LV6A 3O3OB 4XVRA 2PYZA 2ZM6F 1QYRA 5EGYA 3AIKA 3MTAA 1TJ3A 1HQEA 2GV1A 1OI7A 3PK0A 1MC5A 2VJDA 2HRTA 1C0IA 4U8YA 4J2OA 5FIUA 5CVUA 4FTWA 1JLGB 2YWEA 5CH3A 3CPEA 4ZCTA 4H4CA 3ZN2A 3BMNB 3RRNA 3V55A 3CUYA 3Q4GA 3RGWS 5CLJA 1UAYA 1PR6A 1FRXA 2A7XA 4OF4A 2O50A 4GKVA 4HEQA 3WDOA 3EIUA 3BF7A 1BC5A 5WRFA 2Z08A 1OSNA 4BX0A 4EQ6A 3LE8A 5ALNA 4F93B 3GJ5A 2V5VA 2UU9B 1E2LA 5FRDA 1QVRA 4U02A 5L9XA 2AA3A 4PHFA 2YTCA 3W77A 4TM7A 2KVQE 3DJFA 4ZJZA 4JHLA 5H9WA 4ECXA 2RHGB 1C0PA 1J0DA 1W36B 4RHUA 4C9DA 1L5QA 1LQ9A 2D4HA 5IH7A 3B1WA 2PX2A 4KQHA 2VG8A 5EN4A 4RTLA 3EGCA 2YHBA 5EWLB 3AZOA 4U7TB 1TMJA 3CBQA 2C2MB 5L4LA 5FEUA 3I01A 5AVTA 1VIAA 1SXGA 2OPRB 1UMDA 2R2AA 3Q7RA 2FSFA 1GGEA 3C39A 3WYAA 1NC1A 4YJ2A 4UXJA 2X15A 4CM4B 2AB0A 2ZRMA 1T34A 2I1LA 4R3UC 1FU8A 1E5DA 2YVQA 3FRJA 4B33A 1VBFA 1WMDA 4IX9A 5IMSA 3U3RA 2V55B 3JYTA 4G23A 1A6LA 1NJYA 4R2KA 1EINA 1FFGA 4YAWA 4US1R 4W98A 3JVEA 2OTLS 3WL5A 5JXIA 4O2BB 1OFGA 2V7EA 3ANSA 5HE9A 1EDEA 1C1XA 4JJGA 4CQ1A 4JUAA 1ZHHA 2RB4A 3C66A 4Z51A 3AH8A 3AFGA 2H1LA 1LQ2A 4BDTA 1JFTA 4HDMA 2ATCB 3JQKA 2JIPA 3HX9A 5KSYA 4YQFA 2F3JA 3I09A 4AKHA 3OTEA 1TKBA 3H3JA 2O2SA 2ZFHA 1CUVA 5LB4A 1WVGA 4G0XA 3QMPA 2H4HA 4YHHJ 1Q57A 3Q86A 2EBUA 4Y98A 4ZAGA 5ELLA 2MYNA 4UQTA 2J41A 1E2DA 4PX3A 1XP5A 3TG8A 3PSAA 4LC9A 1RJ9B 2DQKA 1TB4A 4MKAA 4CMKA 4LBHA 2X22A 3QVSA 5IKXA 3O93A 2OCPA 2VA9A 4HXYA 2GCIA 3BYPA 4KYVA 2R00A 4M5DA 2FUNB 1SUFA 4IVNA 1YS7A 3ERCA 4NU8X 1WULS 2YZMA 2FJVA 5KHOC 1I7NA 1BQ4A 3GAMA 1OQ3A 1BWPA 4LYAA 2J8SA 1JWWA 4KR7A 5EX0A 1DX4A 6PFKA 1MDBA 1KEPA 4TTQA 2FJWA 3POTB 2XGQA 2A5GA 3LX5A 3US5A 4YUVA 1R4AA 3ONQA 2ACEA 2Z6QA 3OR2A 1UKZA 1UEVA 3BRWD 4CT4B 4CIAA 4Q45A 4UEWA 1AXRA 1RTZA 3VKGA 5JNVA 2CNOA 1N2GA 5FD1A 2CQDA 2MCFA 6Q21A 4K6FA 3KR2A 4OZ2A 4WD3A 1DKNA 2FY8A 2C2OB 5JBQA 1XV5A 2VF4X 3L7JA 2QVZX 3FPAA 4AS2A 3KC2A 4OZ5A 2VJBA 2P2ZA 1LPPA 1ZUWA 1CR2A 4IKEA 2XBUA 1OT5A 4DJTA 4FE3A 4RPHA 4X1KB 1YD7A 1PJLA 4XCXA 1ZW6A 3W6PA 5BVHA 4YP6A 2J3EA 4DLKA 5CTAA 1Z33A 5L45A 2ZVJA 1O5TA 4P10A 5JD6A 3I0RB 4G4SP 2PMDA 1HBJA 3I6MA 3ZI7A 3IOBA 5K51A 2Q5EA 1JWLA 1NFRA 2UXDJ 4DJJA 2RNEA 1ULZA 1RWPB 2IA5A 2WUEA 4MJ3A 3M9OB 2UYOA 2EZ4A 2ZYVX 1HA1A 1Y9AA 4X84A 3SQGB 3GLIB 3UD3P 2XUOA 1GYRA 2XRFA 2R1TB 2R60A 5L6LB 2AW5A 3AESA 2OFHX 3MOGA 3IKJA 1DDIA 4HAOA 2J0SA 2D5IA 2VG7B 4P4GA 2IEIA 3GPBA 4QQ8A 1C29B 1JA1A 3GA0A 4QTYA 5DN9A 3QJJA 2VPPA 1T8PA 2MYPA 2E21A 3FIJA 4X20A 2V4ZA 1QK3A 3NUZA 2IEAA 4ED1A 3C8DA 2WHPB 2XB2A 1RB0A 4QLAA 1IUJA 2DQYA 3MM8B 2R1VB 4DQSA 4BJHB 4WY8A 3RUBL 1DPFA 5A8KA 3RAJA 3UFXB 5IPFA 3LLMA 2R7KA 1LOUA 4CEHA 3BQ9A 1XEXA 4H4MA 2MYFA 4TQUS 1KMNA 1J5EJ 5CX1B 3C6TB 3CJTA 3TZKA 3GIMA 4IMPA 5EPOA 1Z25A 3C16A 3GZTB 5CHEA 5A4KA 5AJTA 3UR3C 3N74A 1RWMA 1HD1A 4GGMX 1J49A 4DMRA 3JQAA 5LMUB 5AIAA 3B20A 4W5QA 2BE9B 3TPCA 1RZVA 2I22A 5C5CA 4U8VA 4IH6A 2IDLA 1YDMA 2BE2A 1NLMA 4X0EA 5CB0A 4CIBA 4DE5A 4UOCA 3T5LA 1VSTA 3BXEA 4ZODA 5C8YA 4IDQA 1UKBA 4FMDB 4DRXA 1BFUA 3VGTA 1ATZA 4OSPA 1H2RS 2QTRA 4WCDA 4DV1B 3RHTA 4KO0A 3KJFB 2BMAA 3TX6A 5I48A 3HMJG 2H7YA 3RVMA 3EGWA 3D6JA 4MPJA 3IKMB 3A9WA 2BPOA 3LFTA 1KE2A 3GQBA 2NZ4A 2E29A 3JVDA 2PX6A 4AQYB 2FZVA 3IDQA 5C2CA 3FLEA 3ZDZB 3Q83A 1YV9A 3OCJA 4I9GA 4GKKJ 3T1YF 4ZP7A 3K2IA 5FORA 4IG9A 3NGLA 2AN4A 2QFJA 1FMCA 2I66A 1YOVB 3L7LA 1A9XB 1FW6A 4L7VA 1J5OA 2MDAA 1FYDA 2C2DA 2WKSA 3AQOA 2IYFA 2WCXA 2VJQA 1S89A 1E92A 3KK1B 2W6CX 3FEYB 4PNPA 4FX5A 4D6YA 1KJQA 4BCBA 5GP1A 2E55A 3PLAE 2BF7A 3OZIA 2OH2A 1CVRA 1KO1A 1KKUA 3ZZNA 4BKUA 2FTRA 4K9NA 1UK8A 2KYXA 3NKLA 1XKXA 2WKPA 4J9RA 5BN4B 4H1HA 1PHRA 3LWNA 4DDTA 1JKHB 4XM0A 4ZMRA 1FPQA 4M1YA 3CCBA 2YJTD 2R1ZA 2LXFA 1BHJA 1IQRA 1Z0UA 1M34A 3FDZB 4L3OA 4NCNA 4OAQA 5BOSB 1N34J 4X3OA 3IA0A 1XJWA 2X41A 2ZWOA 4MPPA 2YZ7A 3AWDA 2YJZA 4H4MB 4OK6A 2WTAA 1XTBA 2CIMA 4IIYA 1WSAA 1FD2A 1Z4IA 1Q0UA 2ZWIA 1I4EB 4NFYA 2V8GA 3E82A 5C1BA 3WK8A 2DNYA 4EFNA 2RHOA 4JYCA 3FCCA 1Y1SA 5B0FA 1PZHA 3NXSA 5GAEU 1UDXA 2QJ3A 1V5IB 2ZUAA 4NQZA 1JI0A 1N2IA 5KYUA 3H9EO 4UMDA 4UOGA 2FRXA 1GA1A 3ZEAA 4NYJR 1N77A 4GKJB 2VWQA 4MH8A 2DUJA 2ZE2A 1X1TA 1L8AA 4A8HA 1DCKA 1FYFA 2YN2A 2ZRAA 3J7ZT 3SLGA 2Z2KA 2HS0A 3K8VA 3P5SA 4EY5A 2QOEA 3EFEA 3EZLA 3V4FA 2ZPTX 1NE7A 2GO8A 3HVIA 4LXTA 1GXLA 1T8TA 9LDBA 2PMBA 3GBVA 2WP8J 2R7MA 1JWAB 5EMMA 3Q1KA 3WGTA 4EELA 4GXRA 2IXDA 3RVSA 3UWDA 2PUCA 1KMMA 3QLVC 2PD4A 3EWNA 4EI9A 2JAQA 3KG1A 4G4JA 1YZ3A 4IW3B 1HTBA 4QDUA 1AHNA 1EIWA 3QT7A 2VIIA 2UZ0A 3K94A 2I4IA 1P8GA 5L9NA 4L4UA 4B3RB 2DJ5A 1PNTA 2PRSA 4L6AA 3H97A 4NBUA 3L7PA 1DDOA 3O2QB 1JALA 3LGXA 3O5AA 4US0R 4N39A 1MLDA 4DV2F 2VXCA 3WDMA 4A73A 2VHUA 4YRLA 1XZAA 3F2IA 2X86A 3NHRA 4JOSA 2DTDA 3PFHA 2XUGA 3EVZA 2XHWA 3EVWA 4MKZA 1FS5A 1GAJA 3LF0A 1X1QA 2QT9A 4EWLA 5A06A 1XHEA 3ZO7A 3KLNA 1N0WA 5EUQB 5LDGA 1FLNA 3BDEA 2W11A 3OLXA 3RYFA 3KZVA 3GZNB 1PTJA 1WXFA 3E9CA 3JSYA 1YZ7A 1VE5A 3EGNA 4KLZA 5K3FA 3SSSA 2X0JA 4AZWA 2C2RA 1HNVA 1N2SA 1RT3B 5F2KA 3IUQA 3PDIB 4Z9FA 3LKDA 2NO7A 4JHXA 3BULA 3MQ2A 1SXJE 4LC1A 3HRKA 1SZCA 1RS0A 3CDEA 3N8KA 3QUQA 3WKDA 3A0RB 3U6BA 3HADA 2APOA 4OLOA 1E9DA 2DULA 4IY1A 4DR5F 1RI3A 4TTRA 1V1RA 3NHLA 1Y6FA 2ZUSA 3NMAA 4HGPA 1BJRE 3HI6A 4LUBA 4JV1A 4GMKA 2V63A 4F91B 3H59A 5ITWA 3ASUA 2C96A 4YO7A 5E3QA 1U8FO 4JMPA 2R6JA 3LC1O 2G9OA 3JASA 4OYLA 5J2TF 4B73A 1QH8B 1RWBA 3VZPA 2QI9C 2HA2A 1TAUA 1JLSA 4HI2A 2CF6A 1E2JA 4MIBA 2ZVQX 1T8RA 1CW2B 1DIHA 2IKQA 1N5IA 4HLBA 2N75A 2FUCA 3HU5A 1IPHA 1Z22A 5KVSA 3G86A 4OYYA 3IURA 3KR0A 3OOJA 2QQEA 2W7OA 3GR6A 1N1EA 3BAFA 3S27A 2BKPA 1IM4A 1ZH6A 5I9IA 3WGZA 4HDAA 4X66B 4G0QA 4BJ6A 5IP5A 5GQSA 2H7XA 4PSKA 3GMTA 1TGYA 3D5EA 3TNDA 4CL2A 5A2QA 1O5IA 3OHPA 1X1SA 4BAGA 2DR0A 4ZLJA 3K57A 4ES3A 4FPIA 4NPOA 4AJHA 4L07A 1LPAB 3EEQA 3IVMA 4C06A 3P2JA 1U0RA 1V25A 1AZSA 4XYEA 1X9HA 1IIBA 3ZBQA 4KK3A 3EZUA 4S1WA 1RADA 4RQTA 5FV4A 3OTWA 3UAGA 1NYTA 3IDZA 4FQ8A 1NB7A 2EP8A 5JANA 3FG9A 2C4HA 3OY2A 4W8GA 1PT8A 4QELA 3B5IA 1IBLF 2VDPB 5FUYA 2GXAA 2J09A 1BFDA 3WLKX 3E5NA 4L15A 2P8SA 2HKIA 1W59A 1HMVA 1R6VA 2BN4A 2YQ3A 2NSBA 2J9FA 3LVFO 1G8PA 3WFZA 2LRHA 1HQYE 2PXXA 4QOIA 5TSDA 2QJFA 5JSZA 3EICA 1M83A 1R4NB 1TX4B 1NK8A 1HDCA 4DM7A 4AZTA 2JVJA 4RFLA 1W5EA 3ZVMA 1KAGA 4ZS6A 5AUQA 1XDBA 3U9LA 3C4QA 4LF4F 2PZAA 4ZVSA 2YJGA 3IKLA 4ZI7B 2PX5A 2VL7A 1SHUX 1ISRA 3OKAA 1PJ2A 2C31A 1WY5A 2O7VA 3KTAA 2QYHA 4PLHA 4DV3J 4E5KA 3ZZOA 1PEKE 3TPFA 3FKBA 1GN8A 4QVGA 2B4OA 1RMTA 1X9SA 3J7YI 5ESRA 4NENB 5TQJA 2CWDA 1R0YA 2NN3C 2F1JA 2W5UA 4BO3A 4B9MA 4A5OA 4M9QA 1S2MA 2DNOA 2ZRPA 1D2AA 4NLPA 2GX6A 1WHVA 5BQFA 3E1GA 5LWHA 1C8KA 3LBFA 2A0FB 1N3LA 5EXPA 2XYHA 1XMOJ 3AM5A 1VG0B 2XGSA 1MQ9A 4BLWA 3TK1A 2F59A 2YNMC 4D3HA 2XTZA 2A9VA 1TUGA 4K4UA 2J7PD 2QRKA 3FWHA 4JL6A 3FJ2A 3QPUA 1AXGA 4DV2J 1TE2A 4MYSA 1UR5A 5A3SA 4KRGA 1D03A 1F60A 1P39A 3CCRS 2BMEA 3B9QA 4QIWD 4XGQA 1OSDA 2HLDA 2E9RX 1QMPA 1YKGA 3RVKA 1DAPA 2P11A 3NHKA 3RYLA 3DF7A 3HFJA 2X5OA 2Q1YA 4D9HA 2KHZA 3J81Y 1N6PA 4CT9A 2F8LA 5C7OO 2VTDA 5J9FA 3DC7A 3SMVA 3ZJVA 4X64J 2HRRA 1IN5A 2GAHC 3LXRA 1LDNA 2CEKA 3WLLA 2WYWA 1GZDA 4DQIA 5TLSA 2HQGA 5FUWA 4DR7B 2PXAA 1TVRA 4ER3A 4EHNA 3NMUF 4DR3F 2CQ2A 1Y37A 1JG3A 2PUDA 1DZ3A 4J2TA 1U0FA 4WKPA 2MLZA 1ZQ9A 2NUTA 1IZ8A 1G59A 4MRMA 4TKVA 4NYIQ 4WL0A 4RJVA 2FX3A 5EWFA 5MN4A 1J25A 4QXPA 1O0BA 4HAYA 4CFSA 4UJ5A 4X71A 1XCMA 2FPWA 2RGCA 3DHXA 4AL5A 4HUJA 4RPCA 5FB3A 1WMBA 5H70A 4RACA 4QUJA 1PX0A 2HSWA 4YCSA 4DOMA 1VC6A 5FA8A 5EWJA 4CQLA 4RPIA 4X54A 4U6QA 5EX3A 4HUQB 1E2GA 8ADHA 4RTSA 5B0EA 4B2IA 3LGNA 1GARA 2V65A 3P8ZA 3VKWA 3L1VA 2W9BA 3RSGA 4X66F 4KIWA 1NAQA 5CT6A 4EGSA 4V0OA 3U1MA 2OZPA 3RBZA 1UETA 4RH3A 2Z5FA 2O5EA 4F5EA 2DITA 1QB7A 3CD5A 3NNAA 2PWPA 4FS3A 4NKRA 1WNEA 1YZFA 4RESA 3M5WA 2H48A 5AUOB 2VFRA 1P2DA 4F3TA 2HBQA 4YRCA 3QYAA 5G1PA 3GFFA 3ICCA 4MEBA 1YRBA 3K5HA 2EG2A 2QUAA 3IH5A 2KXNB 3C6XA 1G17A 2DTJA 3MSCA 2B8JA 4XIIA 5KNCA 1L4FA 3ZNOA 3NOQA 4PZ9A 5BV7A 3NBYC 3EPIA 1Y4UA 3MXOA 4RBUA 4J1TA 4WXYB 2RQ4A 3LUPA 3TCNA 3KDAA 4ACAA 1W2IA 2VP2A 2ENUA 3RAPR 3QJPA 1JSLA 1OAAA 3LIPA 1I10A 3H8JA 4JDPA 3N1UA 3H5LA 4RTKA 1WTAA 4JK3A 5J63A 1NZ8A 4BNMA 3FMVA 1X1EA 4PAQA 4IINA 1GGHA 4BNTA 2WG1A 1SD1A 5D3GA 3A8IA 2GI4A 4GL4A 1N2JA 3DLEA 3VYVA 2I9KA 1NBHA 2KE5A 4WFNQ 1PFQA 4BC1A 3PFCA 1HNWF 3L3BA 3P2OA 2KS6A 2J9ZB 3DM5A 4LDPA 5KTMA 4DY6A 3DMRA 4E94A 3TAHA 3MR3A 2C2WA 5ALGA 2PGCA 4Q4AA 3OX1A 2OGWA 3U4AA 4OX9F 4NLUA 3EN0A 4HOYA 4IZOA 5KOIA 1Q74A 3RHFA 3SLKA 2HVEA 4YROA 3NTRA 1PQWA 1IRIA 2DCMA 1AHPA 1ZUHA 3GCDA 1UFRA 3R2JA 4R2LA 5JE8A 2XOKD 4LF5J 2RBEA 3MM9A 5C5JA 2PKQP 4DKXA 4LHZA 4XYLA 4KN6A 3IR7B 5D4OA 1BXKA 3TZWA 1MABB 3GEGA 1NXQA 4JI6F 2BFDB 3PWSA 4BHTA 1C8BA 4MR7A 4MDYA 1PBUA 5KNCH 4FR2A 2A9FA 4TXJA 4X6YA 3CTPA 1TM3E 1KQ3A 3RB0A 2B7CA 4DMLA 1FXSA 4QSMA 3AUFA 4JI2J 1S6QA 1RJDA 3AW8A 5J4VA 1RT1A 1X42A 4U5QA 3H2IA 5FOVA 3TD6A 2ZUTA 4MV9A 4UBNA 4PR0A 1GOTA 1HBUA 3H2VE 4IG4A 3K0FA 5K3OA 1TQ4A 5KQLA 1CE8B 1ESDA 3G6ES 2YWRA 3PKJA 3SQOA 2CZVC 4OYRA 4BXOA 1WXWA 4ICIA 1WKCA 3I1IA 4GX5A 2XGJA 1H9AA 4MR9A 3ZKWB 3S44A 4WF9Q 2XIQA 3RTAA 2EZ9A 1DZIA 1JH8A 4Q3DA 4B0OA 2YNGB 4PZ0A 3IILA 5K2OA 3G1WA 1XRJA 4YV2A 3PPYA 1QX4A 3FPLA 5LP6B 3GBPA 4ZCIA 4JP5A 3GRFA 5K5MA 5EKSA 2V6JA 5JNWA 4E03A 4YDXA 2OO5C 1L7PA 3T9DA 2ZJBA 1LFAA 1B8NA 4DLTA 1U5BB 3ASYA 4FKBA 5JS6A 1RT4B 4L5IA 4TV9B 3W79A 2JAOA 4RNNA 2IHYA 4MKFA 2D1SA 4ZQIA 1LWOA 1IOLA 2K1RB 1VG9B 5G4KA 1R0LA 4I2PA 3FGPA 2Y0EA 5ADHA 2AFHA 3U3DA 5TPWA 4PYDA 2CFIA 2UXCB 1F38A 4DX8H 2VT7A 3U16A 1U2QA 3EM1A 1GILA 4J7UA 1MN9A 3DGPB 3TW0A 1E1QD 2AI2A 2C83A 3GWGA 4M9UA 2ZVSA 5JH7F 3RDPA 4CWBA 2B36A 2R96A 1P18A 3L9ZA 3RAEC 2D74B 1TKRA 5KNDH 2HHQA 3TLCA 2CHUA 3FNHA 3QKSA 3OETA 3FOBA 5EERA 2W4MA 4C6AA 2LCQA 5EHZA 5MFZA 5FL7D 4CDGA 2ASEA 3UOGA 5J58A 5LQJA 3WK9A 2WQ7A 1FE4A 5LP6F 2BA9A 1CZUA 5CH8A 4EMUA 3HDGA 4NXMJ 1PW5A 2DF8A 3TI0A 1ESZA 1M3SA 3E58A 1A8SA 1K9VF 3RVBA 2BX6A 5K0JA 3UJAA 1SOWA 3U3MA 1AU9A 1M33A 1M8PA 3RVQA 4D4IA 5CLHA 2XA9A 5C18A 5K7SA 3GDOA 3H40A 2AV5A 2D2EA 1J1IA 5A9TA 3VSAA 4B2LA 3AT1B 1Q95G 3IT0A 2X0NA 4QLOA 2G08A 4CQMA 4Q9AA 3CMCO 5AM5A 1TFRA 2IPNA 2QTVB 1BMFD 3IR6B 1KKLA 3LX8A 1E4VA 4G0WA 1GM5A 5BORA 1VIMA 4ICLB 1HM5A 5BQXA 1SA0B 2QG9A 4JA0A 1RIFA 1P5RA 4KO1S 3LQYA 4RTNA 5GM2A 1BRTA 3EEBA 1DY3A 3M89A 4PQFA 4YRTA 2PKCA 5D1NA 4E7PA 1BE4A 4KKOA 1X5PA 1ZUNB 3N75A 4B83A 1P2GA 3ET4A 1SB6A 1CRQA 1DIBA 3TUJC 1HQDA 1H66A 3USES 4WCFC 1IHXA 3Q8YA 3CJKA 4EGCB 2EFGA 2Q5OA 1S7HA 2Y2UA 4IRXA 3EYZA 5BWLA 5E33A 3HCOA 3V8NA 3QLUC 5BRAA 3DEIA 2GIQA 2BSXA 2B9XA 4F92B 3CN9A 4JT4A 3LYHA 4AP5A 3D6HB 2WJPA 2CVFA 2CFCA 2HU5A 2DCLA 3GR1A 3OZGA 3R2CJ 1WKLA 2YVLA 5AE1A 1GKKA 2FHJD 3KWJA 3G9QA 1CIVA 3HJNA 1TKTA 2AZ3A 1H0KA 1U6IA 3PEJA 4NYMR 1AKQA 2QMQA 1AGYA 4LMZA 3T5CA 3T1HJ 4PM4A 2WQZA 1QZZA 3NC4A 1WKJA 4X5OA 3SQLA 5CDSA 1XQ9A 2KFZA 5CNJA 1SD2A 3OX3A 1W1IA 2RRNA 4QASA 3SSMA 4MWZA 2X5KO 4ND6A 2E87A 1TFYA 4QEKA 1WG5A 1B8PA 4DHVA 2CADA 3IMCA 3O7MA 5E1MA 3GEPA 4ZVUB 4OQZA 4EH1A 3U09A 4V24A 4QECA 2OXEA 1UZHA 2UDPA 1L1EA 3PHHA 4HAVA 3CMAS 2YMQA 4JENA 1CBKA 1KKMA 2Z2YB 1VHLA 4JS0A 2MIIA 3C14A 3KUXA 1GD1O 1CULB 2AV6A 1H05A 5F33A 1UK9A 1D6NA 3N07A 1JYSA 3AG5A 2PEHA 3WO0A 2HXYA 2CL5A 3IVGA 3KLGB 4Y3UA 1VRCA 2QAGA 4LOLA 3KLFB 3S8YA 3RBEA 1LB1B 2IOFK 2Z30B 1KMHB 5JRZA 3PQ6A 4IQFA 2XSFA 1XYVA 2H9IA 2AOUA 3OL9A 4BFXA 1VTKA 3UJDA 1WB6A 2RDJA 1F6TA 2IE0A 3C7AA 2WZQA 5DISB 3DVQX 1WHTB 4INOA 4DMHA 5A9RA 5GOZA 3PA6A 1S02A 5D5HA 1HI1A 3PR2B 5DF1A 2NTNA 3ZU5A 1IL0A 3BO3A 1OLXA 2XWXA 2KB0A 2C3UA 4L7QA 4DCGA 1FJ2A 5KVAA 2ZSFA 5DZ6A 3PG9A 3VQTA 3QUTA 1E66A 3TXAA 4LOAA 4WK2B 4GC5A 1RZ3A 3FKSD 3D3QA 1WHSA 4MQ6A 1C1CA 1OXMA 1II8A 2OBLA 1YRLA 2QTBA 2VODA 3Q85A 3E15A 1IN4A 5FL3A 2JLXA 4B47A 3FTQA 2HAIA 3WHLA 1NWHA 4OLAA 3SXPA 3PGMA 3VMMA 3VOTA 3RO7A 4PG6A 1E3TA 5BR8F 4ZGBA 2BGMA 4EYEA 4IOBA 3BGIA 3DBHB 2EIHA 4G63A 2HWTA 2HQSA 1U5AA 3V1LA 4U0JA 3AV0B 3LCRA 4LNUB 1G4UR 4BC7A 5D7NA 1FRVA 3NHPA 1AGNA 2ZK7A 1ORVA 3AJAA 4RZXA 1WW8A 4LGVA 2UXCJ 2G36A 4RMJA 4ZQEA 4B4UA 1X1CA 3G9TA 2VHVA 4FGWA 2V6MA 3JZFA 1C3JA 4FNGA 4UAJA 4M0PA 2XW6A 4DAOA 1XWFA 3BTVA 1PP4A 2YWDA 1RHQB 1N2OA 3HN6A 1U2RA 4UM7A 3V97A 4AB1A 3S28A 2GMLA 1FNBA 1YGPA 1T5DX 3V42A 2ADFA 2RK4A 1I4LD 3C16C 4QRIA 2WAAA 1IZ0A 2DOKA 4ZYVA 1CR0A 1R8CA 2IC3B 3HSSA 1I51B 2VQFF 4M5IA 1BVRA 5AR1A 4L9SA 2QRJA 5HI7A 1CY7A 5I7WA 3H75A 3MEEB 5KMGA 2ZRBA 3K70C 2BGIA 3SQNA 3AHFA 4YCAA 3QT5A 2YASA 4R9SA 3PPIA 4GXQA 3WL6A 1NSAA 2X8BA 4J7CA 3JYHA 3KXKA 2Y3IA 1Q7YT 1GUBA 5E6RB 5L3VA 1YRUA 3EXHB 1K3FA 1KTIA 2XF8A 4OJGA 4XLZA 1P2FA 4AY2A 3VR5A 2VU5A 3LVBA 2QTTA 4BATA 3UHAA 2VFVA 3GZ4A 2I2BA 3JTPA 3D3KA 4Y6OA 3OAAD 1WLSA 1CTQA 4Q8FA 1KS2A 3U31A 2QROA 4UDYX 5AW1A 1E4EB 3NQ41 1U9ZA 5HZKA 1NBEA 5K9ZA 1PWHA 3OZFA 3N8NA 3RUIA 2QN2A 3PNMA 3MELA 4L5JA 3ICVA 3L0IB 5JVDA 4PG4A 1N7GA 3TA0A 4ZV4A 4N40A 1E2IA 2VHEA 4RXTA 5CDYA 4PYKA 2CN1A 4TV9F 3NYWA 4B40A 3R8CA 4LKOA 3N6MA 3W65A 3C7DB 2XTMA 2FVQA 3OHAA 4RYDA 5DU2A 1KQGB 1Y1PA 5D6OA 1KJ9A 1UJBA 5E6UA 3FYTA 4BHQA 1P74A 3VYWA 1EQAA 3UBTA 1X2BA 2GN9A 5CVJA 4YHBA 1Y34E 1VJRA 5LP6C 1CEZA 2UXBB 3PUWA 4XGRA 1YJWS 4P4LA 3OOYA 2BTOA 3SI7A 1XN9A 1KFKB 4YC7A 3NCPA 3HZOA 3V81B 2EDAA 2GDZA 3TKYA 4O4LF 1F3OA 5CVTA 5AVSA 2CUYA 2DGOA 1FDDA 1A1VA 2VAVA 3D7NA 3W9SA 1RABB 3M9WA 3ZGXA 2CLMB 3MR7A 2HRYA 3ZLTA 5FD8A 2KJQA 4ZEWA 4J0QA 1C7ZA 2WUGA 3F67A 4O29A 2QKYA 2HIAA 3AINA 2Q5CA 1DUIA 3W5XA 1VCNA 3SJUA 2FHPA 3R4VA 2VH2A 5AUNB 3VDQA 4I6GA 1QRRA 3BE8A 3OSNA 1T3HA 4WWHA 2AFIB 1P6UA 4LV5B 2G4BA 3WGYA 3O0TA 2HHHF 3HHPA 5ETSA 1LPSA 4JI6B 1UBGA 3CRNA 1TKZB 1MOPA 2PFSA 1DOHA 2ZYIA 2IYTA 1EK2A 2B94A 3ESBA 4PO9A 5F35A 2FMKA 4YBZA 4HEJA 2PXCA 2AKAB 1N34F 1DCFA 5J4KA 5FWXA 1NN0A 3G2QA 4RVHA 4P9NA 5C1IA 4ALJA 1TL3A 7MHTA 3T61A 4UTRA 3UW1A 3T1HB 3EZ9A 2XMGA 3CUEF 3SAJA 6AT1B 1USUA 3E22B 5HF9A 3ONVA 4DV0F 2OPQA 1CJUB 3LT2A 3VA7A 4WXEA 2NU9A 4I1YA 1RKJA 2Y9PB 4IHJF 1CZOA 2RIPA 3GJXC 2V8DA 3PE3A 4WOJA 5C2GA 3KLEB 1C9DB 4LF9J 1P6XA 4XYGA 4YRZA 1QCZA 4MROA 3KQTA 4LGMA 2KMLA 1K0FA 4B44A 4FCTA 3LGHA 4ND8A 4GVXA 1F2UB 2V6FA 1RLCL 1Q81T 2XMAA 3BE5A 3L0CA 2B5WA 2GHWA 1NV8A 4LQ3A 1Y0HA 4FVMA 5IC6A 3ORFA 3DVAB 5BSHA 1DAFA 3RKSA 3RAFC 3VVLA 4MIAA 3NEJA 2PS1A 2D8MA 4E2YA 4JWTA 3BE6A 2YVSA 1AKEA 3JALB 5JZMA 4EO9A 2OESA 3DLKB 2QLLA 1G3RA 4O4LB 2BP7A 5IASA 1F2GA 5A0VA 5ESXA 4ABYA 1E1MA 4RIIA 4E4RA 4ITRC 1SCJB 3NIWA 3MWLA 1SBNE 2OSRA 3I8OA 2VHQA 4QT0A 4GR9A 2UXBF 2D1YA 1ZD9A 1YI0A 2YBEA 4J9OA 1ROFA 1D04A 3O31A 2PT9A 2ZVDA 4MFBA 4YV1A 4PRFA 4UTXA 1C0TB 5JCPA 3GMIA 3W2HA 5LMUJ 2HURA 4NL5A 1P7PA 4U95A 4A1FA 3GC6A 3X1KA 4BC9A 1LJ8A 2GRAA 1IQTA 1GU7A 3FPJA 2XLCA 1LWEA 5I8WA 2Q3DA 3ITKA 5JMNA 4R2MA 5J1EB 1NU6A 4TUYB 1M5SA 1PW7A 4JL5A 4UZEA 3CD7A 5DGCA 3E6AA 2ZBUA 4O5OA 1MMLA 1BN6A 3U4CA 2G88A 3UANA 2FXVA 1JHQA 2VOOA 3EUWA 5CFNA 3ZJ4A 5CYQA 1IXZA 4FS8A 4UU7A 4HH3C 5KSPA 3GCGA 1LBIA 1UP1A 1PHPA 3BAZA 1JLKA 1Z7GA 1N6IA 4QWBA 3N2EA 2OHGA 3KQKA 3CRZA 3FHJA 1WVIA 1LCIA 5AVVA 4Y2GA 3N0VA 2MSNA 2WE8A 4MW1A 2HRQA 3ENZA 4JT9A 3ILVA 4I7FB 3D6VA 3UXYA 2WW8A 1K6JA 5K0NA 3VDXA 1HNIA 4DU7A 3AF4A 4ER0A 4H7DA 3QENA 3WBJA 1YNOA 3RREA 1FTWA 3O83A 4NEYA 1R8BA 1V3UA 1N34B 4MQEB 4EI8A 2UUAJ 3SDEB 4RGVA 3IUSA 3SC3A 2YHAA 3U1VA 3LUCA 4NEZA 4PXBA 2AH5A 4OFXA 5ITHA 2RHDA 2R00C 1QTQA 3KYCA 3OOWA 3JALA 1ZM7A 5LOVA 1BDBA 2CXUA 1PC4A 3AA8A 1DIRA 4ZKDA 5F76A 3A6EA 2W2QA 1TUVA 2OYSA 5ULLA 2WSYB 3AL2A 3EOZA 4HTFA 5E8JA 3VNUA 2K2WA 3MCMA 1AV7A 2YYYA 2C99A 2BKXA 2KXFA 3JPYA 3I04M 4ZI2A 1YOBA 1WHWA 4L8FA 3M2VB 2FW7A 5AJWA 4RNOA 5JY1A 3FKQA 3W5HA 1QMGA 2JAUA 1HOTA 1RVV1 3DHYA 2HA7A 1D7AA 4K9MA 3T38A 4NNPA 2E9TA 1OWOA 1AUQA 2FDCA 2Y0SD 2VZLA 3WNQA 1LVGA 3SIWA 2CPHA 2PLRA 5ALMA 4ICLA 5K99A 3WGQA 4P4TA 3GDFA 4O2BA 1VMBA 1OI4A 3GL9A 1FXUA 2ECPA 1IKWA 3V7YA 1Q8BA 3CPHA 2WFLA 2IITA 3I3SR 5ER9A 4X4QA 4I6EA 1RE0A 2QX9A 4DS5A 1AFJA 1O97C 2CA9A 1Y4SA 4C04A 3L1KA 3LCUA 5EJ7A 4FBGA 3NHWA 4BLOA 3H9QA 4YAGA 4W9NA 4RUHA 3AOGA 4F2DA 5CVEA 2JDIA 3TUIC 4GO1A 3N7AA 5HIMA 1ATIA 1XU9A 3UE2A 3NUGA 3ZDXB 4NLXA 1A8IA 3D6NB 2O2JA 3O3LA 1KK1A 1RJ9A 1NIJA 1T8UA 1H2AS 4RUKA 3QF4B 3I12A 2ZI5A 3DMYA 4H7FA 2DHRA 1DFDA 4YBRA 4KN5A 4L9AA 3FA2A 2HMYB 3UMSA 2HBRA 2GO1A 3FQLA 4Y0VA 4NXMF 4N0DA 3H5NA 2AUTA 3PEYA 1PIWA 3A70A 4DTCA 4A8YA 3L18A 2DUNA 3TMKA 3U1BA 2PO4A 5ETLA 3MTQA 3EIQA 4ZQHA 4EX7A 2E5WA 4FS1A 1KO4A 3AD8C 3GCXP 2WZCA 3JAMU 1S6PB 5C25A 1QDUA 4EK9A 3SYRA 2OIHA 2Z4PA 5CD9A 3F6YA 1M5HA 2EL9A 1ENPA 3RRHA 1G64A 2REQA 4PTZA 3HV2A 1QF9A 3WLPA 3FAZA 2Z6UA 3WA6A 1TCUA 5J2NB 4B3BA 1NUAA 1GXUA 3GJRB 1WSWA 4PX2A 1YDLA 3A4VA 3TTVA 4GLBA 1XF1A 3FM9A 4P7JA 1CLFA 4S04A 4AYBD 1DBIA 3ZU2A 2XHEA 4IFBA 3G9CA 3DOLA 2BEVA 4C21A 1NE2A 4TKZA 1IQZA 4WCFA 1CQZA 1VRUA 3NRCA 3IQWA 5AKYA 4CMHA 3AHEA 4BECA 5LM7E 3IA2A 1W4BA 1IG3A 5KWVA 1RYHA 2H0RA 1WVMA 4PFKA 4PHCA 3W7VA 3FRZA 3F74A 4B6EA 3DD1A 1L4BA 4UZFA 3MFYA 3PC2A 3BHIA 5ADVA 3QSGA 3E8XA 3ZS9A 4M7PA 3LGMA 4HYQA 1M90T 2HSJA 1E6CA 1IM5A 2MSWA 2FMXA 3F9IA 1QCDA 4KGDA 3ZWDA 4GKAA 1COWA 2Y1KA 1OLXB 4MKYA 2GPYA 4ZCSA 2WWGA 4JH0A 1UWKA 5IMBA 3ZUPA 2XAUA 3CPJB 4LF8F 1ZVJA 3DMTC 3AH6A 2VCEA 1R27A 5C1DA 1TADA 4BNYA 5KDDA 5JVGQ 3IM9A 2Z8ZA 3AG6A 4OXYA 1BHSA 4FZJA 4DR1J 4PONA 1KU0A 3IPLA 5CXTA 4I8IA 4GVBA 1GG8A 2B6HA 2ZDOA 4I4BA 5JQGA 2VA8A 4HDOB 1BS9A 5L6MB 3FI0A 3R9XB 1U1EA 2XUDA 5JYDA 4OJHA 4Y3CA 5JSUA 4OQDA 3PXBA 3D68A 4AUKA 4H7HA 3RU3A 4TRNA 2LVWA 3OHBA 3DJYA 5KC9A 4CM1A 4FP9A 5J5VA 3E5RA 3QBEA 2UP1A 1V1MA 4IO0A 1RLOA 3ENVA 4HDCA 1ZZEA 1X77A 1RKVA 2JLUA 4I6AA 4B3SB 4QULA 1YQUA 4WZQA 3I28A 3L4BC 1Y3FE 2GUWA 5KTSA 4OH7A 1M0TA 1F5BA 4FVTA 2NZWA 4DCMA 1UBTS 1XU7A 3T15A 2BKNA 4E12A 2SHKA 5JU6A 2OK7A 3CC2S 3BICA 1P81A 2D1FA 1R9GA 2DUWA 3ROZA 1Y63A 4JI2F 4IV0A 2ATIA 3KLEA 4E21A 3S5UA 1PWEA 2CJWA 2PA8D 1P17A 1EFPB 4C3ZA 2JLWA 2ASLA 3RS3A 3OJOA 1JNYA 3KSUA 3W90A 1HKUA 2FOXA 2IAJB 1KDVA 5BWOA 4LWPA 2PUWA 1KEEA 2BMJA 3DXBA 5FWYB 4AQ7A 1M2VB 3INTA 1QP8A 2ZRGA 4LNHA 2CJYA 3CH7A 3L1JA 1O51A 1D1QA 2NV6A 2AGOA 1U0EA 3LWMA 2WJ3A 4L5AA 5FTJA 3GLHA 4V0KA 1P7YA 3VNBA 3J7AC 3V4IA 1N8NA 5A71A 1HEUA 4UBIA 2NZ8A 4KTVE 2I78A 4JI5B 4C1NA 1HDGO 3G82C 3VOBA 2R9LA 1JLRA 4KH1A 4QDXA 3B9BA 3L8FA 2YNGA 2X23A 2PVSA 4C3KA 3KYBA 2PT5A 5C4GB 3SHVA 4JNKA 4XUEA 2JJQA 2O06A 2X8JA 2F64A 3UOAB 4Q15A 2R2RA 4XR4A 4MKGA 3EXCX 3Q89A 1EJ2A 2DK2A 5G40A 1KOHA 1GU1A 3OH8A 3WLNA 2WUVA 2ZSUA 1ZJ4A 4JMLA 1NXXA 1WBDA 3PQ8A 1PAEX 1ZS6A 1VBKA 3E2PA 2WNIA 2VDRB 4CCWA 4DQPA 1Z8FA 4CKEA 2BR0A 3IP8A 5FULA 4C6SA 3BSOA 3VSCA 5IANA 3EUNA 2ZR8A 3PFWO 3TVZA 4AFFA 4FFWA 4D44A 4QTXA 1U8SA 3DCNA 4CQNA 3K32A 4LI0A 2WA2A 3TTWA 3WSTA 1Z5ZA 3FMPB 2L18A 1IBKJ 1U24A 5TVKA 5FWNA 1AB8A 1XCPA 3M6FA 5HDBB 4CCYB 4F12A 2GZDA 5CBPA 2UZAA 1CDDA 2QMUA 3MJRA 4FK8A 1RT6A 4DUZF 5EL0A 2QN6B 4DZRA 1PS8A 2QV6A 5IHPA 2LIVA 4ENPA 1PYDA 4HLDA 4TYYA 1GDTA 4LNAA 1PYGA 2G72A 3JVIA 5MF6A 2VBCA 5LQNA 2UZIR 2FSVA 3IV9A 4DAEA 4CO1A 3LP5A 2XVXA 3D0KA 4Z0TA 1UDBA 4TOIA 4XWTA 5DHAA 5FOWA 4J16A 2JA1A 1M75A 3MOZA 1SPBS 4DMKA 3P4YA 5ALWA 1RAHB 3QX8A 4BLPA 5D3GB 3FSIA 4BPBA 2VH7A 3T6BA 1W0KA 2LYVA 3WTCA 3I2KA 5MGNA 2PR2A 3KKOA 4GXTA 1CKEA 2P4HX 3IWLA 3GIDA 3AUTA 4HWKA 3I04A 1OTXA 2YIJA 2NO5A 4EJSC 2MR6A 5KDOA 1VQNS 4QWAA 3WE7A 4TYWA 2QL9A 2PMHA 4OMUA 2XCSB 3W8RA 1XJ0A 4LJ7A 5EZYA 2H65A 4BFTA 1FRNA 1KL7A 3OE7D 3GMDA 4QL3A 4JLPA 1Z2PX 4CBVA 1SULA 4OYWA 1W2GA 1YOVA 3BHMA 3WS7A 1VB3A 4TKMA 3FCSB 2CFSA 8GPBA 2L0XA 2BAGA 3JVUA 1NR5A 2ZWAA 1KI9A 4QQRA 1BWQA 2VASA 2HLHA 3QE0A 4UM9D 2UXCF 1HRDA 2FMTA 4R8RA 1TFUA 4C0WA 2HL6A 2FP3A 4JBHA 4R9UC 4N77A 1D0SA 3EQ2A 3TINA 4BMOB 2GD1O 1OBVA 4OZLA 5JZBA 4PTLA 2BE7A 2Q21A 3TZHA 2VA2A 3T3GA 2F3RA 2COEA 5KB3A 1RRVA 1NW9B 4ETWA 1SCUA 3ROPA 1XR3A 3VJKA 4QW9A 4JJ4A 4LVOP 1RC1A 5JNSA 1MX1A 3P97A 1Q1QA 1A97A 3VKVA 1Y4AE 1K6MA 2EP7A 4RVUA 3AF0A 5B0BA 2ZUUA 1Q0PA 3RBXA 4HTFB 1HQKA 3DLKA 2I1RA 2VHWA 2PO7A 1KMIY 2QA4G 1IUNA 3EVOA 3K6SB 4KVAA 4KFBB 2QY9A 4CLYA 3WKBA 5TT1A 3DZ8A 3PC8C 2P3OA 4INZA 3FNIA 4WWSA 1E2MA 3Q7IA 4H7KA 4XVUA 1Q0RA 1O4WA 4WERA 3VU9A 1HRKA 3PU6A 1SCKA 3FPHA 3OE7A 4J03A 2C3OA 2P9ZA 3A2MA 1GV0A 2XB4A 3BERA 3B5JA 3CF4A 2ANCA 4RH1A 4B6GA 2QL5A 4O1MA 3G9XA 1FDRA 4NEQA 2G6BA 5GM1A 4EO4A 1REQB 2O5VA 3Q40A 4HQOA 1A95A 2VSNA 2QP3A 3E9NA 3B82A 4LVUA 1G21A 3EZNA 1AC5A 4PAWA 2DT9A 4HLUA 1PJTA 2XUQA 2DHQA 2GEKA 4QGBA 4RWXA 4WACA 2JFPA 3ETHA 5F8IA 3KL4A 3VDRA 4UVIA 4B3DA 2JBHA 2CT8A 3ILXA 3PQEA 3HM9A 2PIDA 3RS7A 1S0OA 3MCWA 1M2OB 4GECA 3D1HA 4FFPA 4ALIA 2X5NA 4JLBA 4ZT7A 3U4MA 4LTMA 3SXLA 1L3VA 1BGVA 5E3JA 3TZXA 2RG7A 2OMEA 4RD2A 3N58A 4OYXA 4G8JA 3CSSA 1R6BX 1QHNA 2J0WA 4UOHA 4P73A 2R7OA 4KGMA 3HPOA 1N5KA 3X1XA 5DTQA 4HDMB 3A1TA 1A2BA 1TU4A 2EG9A 4FMPA 3FBGA 5HF5A 5EIWA 5B2EA 2B5JA 1DWOA 4ZYUA 1LFWA 3WJ7A 4H1TA 5CGQB 1YVRA 3G87A 4BNDA 1E99A 1A71A 3FOZA 2L3MA 1REVB 4FHDA 4QYRA 1A9TA 5KBYA 1NURA 4GU5A 3GXOA 5DG8A 4ZXPA 3DXZA 4C43A 5G2OA 3LDAA 5KDLA 1ZL2A 4S1VA 3OI7A 4RJLA 4JYZA 5HWSA 5JRDS 1VE7A 3GG2A 4WBXC 1RMYA 1UUFA 4BNFA 4FGZA 2R25B 3TZZA 4K8RA 3K0FB 4UAGA 4H60A 2PRJA 5BXIA 4C6HA 1JZQA 2FYTA 4QG7A 3M0EA 1QFZA 2EP5A 2XLBA 4EBEA 1SEVA 4N5IX 5I8ZA 1D3AA 5BYJA 2PMCA 4LRFA 5AK5A 4IVRA 5GZ6A 4DV0B 1CQPA 2IIHA 3E9RA 1FZQA 4DJFC 1Y3AA 1GA4A 1GPH1 2A67A 4FYJA 2O3DA 5D2CA 2AZMA 3WRYA 2P5VA 3W04A 1P3JA 2OUKA 1VKRA 4Z99A 4K2AA 3TQEA 1SB8A 3MTDA 5JO9A 2JF0A 3DL2A 4B9SA 2DY0A 2GHRA 5KFSA 2ASYA 2UVWA 3OFKA 3GLGE 1CQIA 3Q87B 3H5VA 4WN3A 3RB4A 2QRVA 1TAHA 2E1RA 1T6NA 2JJ1D 4WE3A 3PYEA 1O6FA 1KVKA 1G8AA 1CY0A 3L40A 3RRXA 4EFKA 4B85A 4CM2A 5JJKA 4W90B 1H1DA 4MIEA 4R68A 4M5LA 5CM8B 4YIHA 2XYPB 2I91A 3PYXA 3LDFA 1K63A 3EXEB 1J5EB 1T0TV 1QAJA 1VKHA 1TQ8A 2OKQA 1GUFA 5BSGA 4DBZA 1IBRA 2W1BA 2XA1A 1O95C 2J0UB 3WGLA 2WSBA 4QU5A 1GKLA 4Z1MA 1WIWA 1FK9B 4MUKA 1I2AA 5FA6A 4PN3A 4QTTB 1A1SA 2OBNA 4KZPA 3DONA 3C8UA 4F5YA 3GSIA 2YIVX 1OLUB 2JGIA 2EBGA 4E14A 3DLAA 4Y6IA 4U7FA 3RSSA 1F9HA 1UPAA 2BJVA 1GTRA 3KHTA 4YGXB 3MCAA 5KNBH 4DR1B 2YVKA 1QIMA 3TYTA 3BJIC 3MEEA 1H2YA 1Z75A 1PJCA 4WGFA 3FBTA 3VNSA 1GPAA 4IOLA 2O2YA 4Q01A 3K6JA 3IEIA 2GS9A 4C98A 4TMXA 4XLLA 2XYQA 3TJRA 5D84A 5HFNA 2AT1A 2NU6A 2ZUDA 4XPIA 2FE1A 4P0PB 2WHOA 1T0BA 3T1TA 1GY8A 5EMKA 6ADHA 2APJA 5J1TB 4C5BA 5J2UB 4RL4A 1J09A 5DMXA 1KIFA 2TSYB 3PIDA 4JYPA 4OUKX 1GNQA 2Q5LA 2GB4A 4MUNA 3DBLA 3DAFA 2WIFA 2QXUA 2BVNA 5FOSA 2R85A 4XIUA 1MV8A 1ZTTA 1C1YA 3PZRA 2XX3A 4JI8F 2EBHX 5FBHA 4NAUA 3NFRA 3T1OA 4P82A 3V4ZA 1JILA 3NBPA 2H29A 3ZZTA 1NTRA 4C87A 3O8CA 1NUQA 4KR0B 3LFHA 3V7WA 2AX0A 2VNJA 3U7HB 4MCAA 5GAHI 4IICA 1TAQA 3EUEA 1YQ9A 2GCEA 3UWSA 3DE3X 2FJAB 2K7FA 2JC0A 3EC7A 1KJYA 4QUEA 1NJ8A 4A10A 1V7QA 3CVOA 4QXRA 3TBKA 2GD2A 1L3TA 4DG8A 1CZNA 2WBRA 2LD4A 4CMEA 4PWDB 2HO5A 4F11A 2OQRA 5TV2A 2C4VA 3HJHA 4NXNB 5BUZA 1QANA 1LWFB 1QGUA 3KELA 1N0VC 4MCIA 1RXYA 2MZQA 1VGQA 1R12A 2JD2A 1T5HX 2QD4A 4KQXA 4MI6A 2JCVA 1VIOA 3FE2A 1QUPA 2CSUA 4HNSA 2KRBA 1VRVA 5E7IA 4CLOA 2J4DA 4WA7A 4EJ2A 1G7RA 4YXWD 4KR2A 2VOEA 4LSZA 3RQIA 1TNDA 2ZDHA 3P9PA 3T35A 1IEXA 3CEJA 2DJWA 5KG7A 3SEAA 2GSWA 3HSKA 4DR1F 1JIJA 3R40A 2Z0MA 4BQOA 1IXYA 1P45A 4DNQA 1L5FA 2I1VB 2H3EB 4MVXA 4YR7A 1N1GA 2JH8A 4D9NA 4F0HA 1FCAA 3M3HA 4Q9HA 3QVTA 1TTHA 3MNFA 1WDDA 3BVPA 3THPA 4ZMSA 2MXYA 3FYCA 1MEEA 4ID3A 3TANA 3C4JA 4HXGA 4IDKA 4YAFA 1EK1A 4BKOA 3FSGA 1SVIA 4F8JA 1F7UA 5C7IO 1YB2A 4FWIB 1FYEA 4FYDA 4NR0A 2Q3JA 1T8SA 4XJXA 4J29A 1II0A 1GGFA 3AVTA 5LIPA 4KGXA 4GMDA 4E33A 5AXLA 3GD5A 3ZFVA 1OA1A 1SQ0A 3R6GB 4UE2A 4BLGA 3IXMA 4KACA 5HPYB 1HXHA 3E7XA 3ROQA 3OFEA 3ABIA 4AUNA 1J06A 1I6LA 5BWNA 4EIWA 4Z6KA 1SCDA 3NLCA 5ALLA 3K0SA 1U4SA 4CM8A 2VICA 2FUG1 1ISIA 3P9YA 1KYQA 5J4YA 3RB3A 4I1VA 5JD5A 1PEAA 1CEQA 4F72A 4U9IS 4C8NA 4BQEA 1V11B 2RDMA 2DBRA 2NVOA 3LPEA 3NJ8A 3OBIA 1ADJA 1KU6A 3HKCB 2H5LA 5JZ9A 4HZUA 3KNAA 1P6QA 2H17A 5C5EA 2VWHA 4XXHA 3JQPA 3C6UB 4LRDA 5E41A 4HH0A 1T3OA 1P9WA 1HETA 3GB9A 3RYHA 2OB1A 5CHYA 1XQWA 4YECA 3ENWA 1K7SN 3A1VA 3D8NA 4J0EA 1JL3A 4ENSA 4DPXA 3ZDBA 2MKHA 4MRPA 3GDGA 4R05A 1LW6E 2WSSD 3C6MA 3AF3A 3HRHA 1T1IA 4D9EA 1ULHA 1E1KA 3AVXA 2QTFA 2YWJA 2Y1DA 1BUXA 2F4FA 3NBQA 4E2XA 2A8YA 1AA6A 4W5RA 5KG4A 5K3DA 3FJOA 3P71T 4YN3B 1LV5A 2NPFA 2XVAA 4EDFA 2LLZA 2K5UA 1N0IA 4MV0A 1KJJA 3DDUA 2CQ4A 2FX5A 1Z2NX 3TSWA 1V6AA 3TIXB 3U9SA 5DK6A 3EFHA 3E84A 2ZU6A 3WY9A 1ZRMA 3B85A 4IIVA 2BW0A 4GOLD 4HTIA 5KFCA 4EY8A 4WT7A 2G1PA 3F6SA 1UBMS 2X1AA 1XRPA 4DUYF 1FOEB 1MAWA 4IIDA 4N8EA 4XPCA 1T02A 10MHA 3R0XA 1FFXB 1LF5A 1IZZA 3IAAA 2SICE 3HZRA 3G9UA 1L4KA 2JIMA 5DGAA 1J9ZA 3EG9B 2ZLBA 5L3SB 5I7VA 2ZQYA 4L6V3 3Q1LA 3NPMA 4CMEC 2EHJA 4ZRDA 3DDHA 2H9AA 4HGYA 4AROA 2Y27A 3B53X 1O87A 1Z0SA 1OXVA 3UB2A 1SXQA 1HDYA 1SCIA 2KDOA 1TK9A 3BD7A 2M6SA 3JSMB 4MMOA 2O8DA 2ONZA 3WC2A 3EPGA 1JDNA 1L5MA 5DYGA 1WUUA 2M7SA 2DNNA 1R6AA 2LQBA 1ZLYA 2AWNA 3EJMA 2CZ9A 3LHIA 4ZEVA 1RQ0A 4MINA 2H51B 1ODCA 3F3MA 3KJNB 5ICEA 3NGSA 2UYQA 5H9VA 1W47A 1QB8A 2W2XA 4EVSA 3KEFA 1HA3A 1UC8A 1QXSA 2QG4A 3NS7A 5AD1A 1IY0A 4GZMA 4NZ9A 1X4HA 4MVYA 3SX2A 3G1TA 2F3QA 4M76B 4ABTA 1ECGA 3CRVA 4JC5A 4C78A 4IIUA 3M6XA 3OJ0A 3T9CA 4JP3A 4ZHQB 1QHHA 3KCQA 4PC2A 1G18A 2CLEB 3MB5A 1VISA 1JIXA 4X6XA 1SV5A 4IDCA 1U2PA 1LEOA 4LRQA 4TROA 3E27A 2OO3A 4DW8A 4AL4A 4Q4HB 2E4VA 5K8PA 1CE8A 2MSDB 3P3DA 3H2HA 1RBZA 3GEIA 1UMJA 5MHTA 3W5ZA 4ECSA 3RV3A 4RR5A 3M2UA 3WR5A 4AAYA 2GRJA 5IU6A 2X5XA 1RT7B 5LQCA 1Z8HA 1ZIXA 3BXGA 3REQA 2HYDA 4GOJA 1JBQA 4CV3A 2HFZA 5E6SB 4X1KA 2DFLA 2BKLA 2WHQA 3V9PA 4L75A 1Z06A 1N7JA 4AMZA 2JIOA 4D57A 4MQ4A 3O8OA 5DW3A 3RB6A 3IYLW 1TJNA 4IUCS 5AHRA 4RUAA 1Q7CA 5CFZA 5E3AA 4DA0A 1XDZA 3EPHA 1YL6A 3BSCA 2GXSA 5JH7B 2VYVA 4RZ3A 4LFBB 2BT4A 3U3OA 4KMMA 2WPDA 2QRQA 3BH0A 3IQEA 2HHUA 5DTJA 1LF0A 1CR6A 4H1UA 3A8EA 4TWAA 4Z4FA 4D96A 3DPUA 4AO7A 4QREA 2AFIA 3NG8A 3WWEA 3BL8A 4P32A 2GM4A 2LXIA 4X94A 2LCIA 4ENOA 3HDQA 4OOFA 5D01A 2CVIA 4LHYA 1TM5E 4YO8A 3MUTP 4J0GA 1B16A 1H2XA 4OIFA 2CXNA 2DXFA 1G5PA 1DTTB 2HG4A 1W87A 1PK8A 1H0HA 3KT6A 2XV1A 4CKCB 5FLXA 4Q24A 4G5GA 4DARA 4RC9A 1TUWA 2W6JA 2X9GA 4F4KA 1W4AA 3JAWB 3OQBA 5LXTA 2BZ0A 2JEOA 2OO4A 3N6XA 4F4YA 1OYOA 4IQ4A 1NMZA 4HRAA 1YVEI 1B1CA 3VZHA 4MO2A 3LSYA 1GRQA 5E38A 4ESHA 3IJRA 3MC1A 4J6EA 3U48A 1DLJA 1FRQA 2Q29A 1LDEA 2F17A 2J0VA 4X44A 3DQZA 2XQIA 1PFYA 5LQSA 3HD1A 3GPDG 2DPIA 4G97A 1SK9A 2H7VA 4LRTB 4CRJA 3F56A 2IF2A 2IYWA 1FMTA 2RH9B 3CF2A 4HX9A 1IULA 1AN0A 4C76A 1XFDA 4JR1A 2WV9A 1XIQA 4JJ7A 2UVQA 5LXRA 8MHTA 4NFHA 3O9VA 5JSKA 1YJUA 3GLGB 2WTMA 5CB6A 4DRYA 2OXCA 1CEEA 1YZNA 1L7NA 3KUCA 3V6KA 2O8EA 2DYKA 5GMOA 4Z54A 2FP4A 4F36A 2WBMA 4I64A 1D8TA 3GVIA 4GLFA 4JLMA 2ZBIA 1G5RA 1QGUB 5D6GA 1BG6A 4Q18A 1E6EA 5KJ1A 4B02A 5JZSA 2WM2A 5L3ZA 2W6JD 2WVCA 3K35A 4B9TA 3VBCA 2Z95A 4AJPA 1EGVB 1XHFA 1SCJA 3W8PA 4OXQA 3NWBA 3K15A 4HLUC 3PC6A 5E7QA 1TQ2A 1YDEA 1D4FA 4CO2A 4JI4F 4TS3A 5BRNA 3EE3A 4JBLA 3TYXA 2UU9F 2JHFA 2O7SA 5ALKA 3KSBC 4M38A 4BO8A 4D25A 5I42A 2JJ8A 4KNWA 3KFWX 3RH0A 1K0UA 3F5FA 1ISMA 2L48A 3JQEA 3LFUA 2O0LA 4G1MB 3RVJA 4FOOA 1HNWB 1A4IA 2PL5A 4MQFA 1VSVA 3IRVA 2GJSA 3WYFA 2EC0A 1AA1B 2AI1A 4E5DA 2IEBA 3AR6A 1POWA 4QCLA 4LE1A 3ANYB 3PIOQ 2DVMA 3FDJA 2BEKA 4MUGA 3PDIA 5CVCA 3OURA 3PI6A 3ZWMA 3LTEA 1ADYA 3KLFA 2FZCB 1K4KA 3HE3A 3D4NA 2W6PA 3UG6A 2ZEJA 3OTHA 4ZLNA 4Q05A 4TUYF 1MFZA 3KT8A 1PKEA 1JB1A 2IZOA 4QJ5A 3N6NA 1H6BA 4BN4A 3ONNA 1HSOA 1A2KC 1R50A 3SFGA 3RVLA 1T35A 5IM5A 5DZ7A 4ZT3A 3PXGa 1BGXT 1IWGA 2QT0A 1L4HA 1CUXA 1VQYA 3QHQA 1U9IA 1E79D 3ZE0B 4KO3S 4IJKA 3PYGA 4MCJA 4JI2B 5F64A 1NNLA 5KTYA 4DR4J 4PZDA 2PG3A 4MKBA 2YC2C 3K30A 4CDRA 1QO0A 1OTYA 2V94A 2BJ8A 1X7WA 2DUMA 4ARCA 3DLCA 3R6LB 3OEEA 4NYZA 1CJTA 1UMBA 4HEA1 4PEOA 3AC0A 4KBFA 4L3WA 2AG5A 2OPHA 2FLKA 5L9AA 1D09B 4HNQA 4DUZJ 2PS0A 4YS6A 3P20A 5JS1A 4BWMA 2JEJA 2UUCF 2NUPB 2ZYHA 2OFFA 5EXXA 1WZEA 1DRKA 3CZAA 4K3VA 4MULA 7FDRA 4M1TA 1DRZA 1FKPA 2AQIA 3U7QA 2BY4A 5C53B 5TVGA 4XIJA 2QM8A 3BRCA 4LF7B 5M34A 4JGGA 3OZCA 3HSZA 3MXHP 4O0MA 2XE6A 1WHTA 3UB3A 2GJ4A 1XDDA 2CLCX 1MN7A 5B1HA 4XSGA 3A12A 4FYVB 2C1EA 3W3AA 3DDOA 3UWKA 1IXRC 4FB4A 2N42A 1WEYA 1CQIB 2WIAA 5DVZA 2ZSJA 3GLFE 1N52B 3KJIA 4IJWA 2Y8WA 2B83A 2F1IA 1SUWA 1XLWA 3U17A 3D6HA 4BQNA 1KARA 1P5HA 1Q1AA 3BM7A 4QPDA 3ZZ0A 2ZNYA 2AJ4A 2VPXA 1I1QB 1ESNA 5DETA 4Q9IA 2A1IA 1CY8A 2A5JA 4URWR 5EMNA 4CEJA 4K59A 2BRUA 1B14A 5T7LB 3RBDA 2ODPA 3O1IC 1UM9B 3G23A 5J2UF 1XQ1A 4ARZB 3MPVA 4MICA 3T41A 2AJ2A 4EABA 4MUEA 1JVSA 1J2UA 4AZ3B 5EXTA 1O97D 5HVHA 2PD6A 2GILA 2PTHA 3C3YA 3H5XA 1BFKA 3CX7A 3UMRA 2QTZA 2GH1A 1HL6A 4QGHA 2P5TB 3C0KA 2F65A 1S6UA 3E22A 1OB5A 1K9MT 4LDRA 1FW8A 1SI9A 2MQQA 1N2EA 2Q49A 1QQBA 4OKIA 3IHWA 2IFXA 3L1HA 5AM0A 4EJFA 2QVXX 1PV2A 1VL6A 2ORYA 3E0QA 2AXNA 3S1AA 4COKA 3PR1A 3E3OA 5JYCA 3IBWA 3NHJA 2AF6A 4BRZA 5KYWA 3GXBA 1S7CA 2VRBA 4YUYA 3FCAA 1TR0A 4RVSA 4ARBA 4LJ8A 3GG0A 1DWPA 1DXQA 3I39X 1ZUD1 3A9VA 1RTKA 3I5XA 1KNQA 4EUNA 4RF2A 5A5DA 1LLCA 2Z0GA 4XUDA 3PPXA 1Q0NA 2YYZA 5JBIA 1JA0A 4IRDA 4QXMA 2CD7A 1B26A 4YDQA 1FKPB 5EWEA 3K05A 4BQPA 3VNQA 2OQ2A 2GZMA 4EL5A 4JB8B 4MS3A 4KXVA 2C3PA 2KT3A 4H6PA 1TQDA 4R71A 1I2BA 1EP1B 3T9EA 5D87A 4H4KA 4J3NA 2I76A 1OPIA 3PC8A 1PQUA 2FU5C 4R0MA 5ETPA 3I30X 3N2GB 2IEYA 1UOPA 3PRDA 2IDJA 3CXUA 3SSRA 2BFWA 1WR8A 4H9GA 4CO5A 4IIBA 2QJTA 2N47A 3RRYA 5IDXA 3FCHA 4A47A 3M9XA 5KSOA 3BF8A 2GLUA 1Q7RA 4HACA 2J59A 1KEUA 4D8VA 5B7GA 1X60A 2WJHA 1ZK4A 3NBMA 3HA5A 3OX2A 4J8PA 3CWQA 4IJUA 2BH2A 1U3GA 4C3MA 2BUCA 3QVJA 4ILRA 2QU7A 4JYMA 1TL7B 3RFFA 3FFTA 4OYBA 4P5EA 2OYRA 3WMRA 4C7MA 1MJGA 4K9KA 4DR5J 3CDUA 1ECCA 2G28A 2YWGA 3WHKA 3L7YA 4D6PA 3TLAA 4BZXA 5EJMA 1ZFNA 2GKSA 3UAYA 1RU1A 1Y9ZA 3IIMA 4U3JA 1YJ5A 1O03A 1J9GA 2PE8A 2P75A 4NJEA 4WOBA 1PU2A 3GLHE 5BN5B 2EZTA 2C42A 1NHVA 1HE5A 2XB9A 3GFZA 1QF7A 3HCEA 3IGFA 3KHSA 2GBLA 2QUIA 3F5SA 3OCCA 1RJWA 3ILLA 5J23A 3EGZA 3OLYA 4HK4A 3I6QA 3O2IA 5DOZA 4H7JA 2J7KA 4DV5B 1RNLA 3PKYA 1D1TA 4JXZA 2D3ZA 5K14B 3H0EA 3V4VB 2W6MA 1WPQA 2TMGA 3K17A 4L8GA 4XRRA 4EY3A 2XYGA 4MAFA 4L95C 1P0MA 4ZA1A 1PT6A 4EO8A 3F5DA 1NHGA 1LBQA 2PBFA 2IEZA 4W6QA 4ZIWA 5AVXA 2RE1A 4C2UA 3AT1A 4B35A 2ACWA 3HXLA 2I6FA 3K20A 1P5JA 1WSVA 4E11A 3H5RA 1CF4A 1AD2A 5KQPA 3HACA 3ISVA 3KWMA 2B99A 3NT2A 2IIPA 3O91A 2GEVA 3G0BA 2FR1A 4GZLA 4JBWA 4H4OB 4DPYA 1RWOA 3QGIA 1VPDA 4Q44A 1BQEA 4O3PA 4QUDA 2YBVA 2WD7B 1CEXA 2E49A 1X7XB 4BVJA 1M2OA 3KOMA 3K1TA 1KY5A 3X2EA 1QNFA 4XGKA 2QZ9A 1IBLB 4Q1CA 2CLLB 1IUOA 3FZGA 4YAKA 4MV4A 2XLIA 1V1RB 1Z88A 3K1YA 1W4RA 5JDIA 5IBPA 4ZEXA 4LF7F 1DINA 2OKCA 3CJSA 1P0PA 4QBGB 2YKAA 5CB4A 1X80B 3B70A 4NMXA 1ISJA 5HVNA 1S1XA 3PHGA 1WA5A 3A2NA 3SE0A 1I14A 2JHEA 4I55A 1TKXB 1Y80A 3EQ6A 4TV9A 3HD2A 2OO7A 1BEZA 3QOFA 4K46A 1NLZA 3Q0EA 4R7TA 1M0EA 3FI9A 4WZBB 1FKOB 1A96A 3CY6A 4M83A 3Q3GE 3WKCA 2MSSA 2NPIA 3H7HB 4F7WA 3THSA 3THVA 3U27A 3SFTA 2WYUA 2GYVA 2HMTA 3QMVA 2HJWA 4FYYB 3EEFA 4DADA 3HFKA 1XNQJ 2ECOA 4H59A 3ZI0A 1XXHA 4DLWA 1Z36A 4Q3CA 2QE6A 2UUBJ 3CLRC 3GGJA 3T12A 4YJ2B 3ZKWA 3LSTA 1N48A 1E6VA 3UFCX 1M1YA 3UATA 4RW4B 2HI0A 2Z58A 1WG4A 2CPXA 1UQRA 5BR7A 4QUAA 4R2WA 1NLYA 3LKBA 2V3CC 1KRWA 1YIAA 2RI6A 2O2DA 1W35A 5D8DA 1ZAXA 4IMRA 3FPEA 2NM0A 3U44B 1XTUA 4LHEA 3B4MA 2YKMB 1QZ3A 3FWKA 3G2HA 3BDPA 4QDTA 1RABA 2OHJA 2AYXA 3UXEA 3B2EA 3OZXA 3LHFA 3U26A 1BQMA 4OA5A 1SHJA 1CC7A 2YNHB 2REBA 1UIMA 4I1SA 4LF4J 3WWOA 4JIGA 2GYYA 1T3SA 3K9BA 2IPXA 5HYVA 2PEZA 2OBFA 1X70A 1RIIA 2CLOB 1GNVA 3JSMA 3Q8MA 3U7IA 2XYHB 5LL6d 1PJ3A 1KYIA 4JQCA 1OFVA 3HU2A 1R6XA 2VRCA 2PSHA 2HHTA 3ZY3A 3D0IE 3JQ8A 5DRKA 1E2NA 2ODWA 5ISMA 2PX4A 5EKDA 3WGUA 2AR7A 2H51A 3DTVA 3TS1A 1I7DA 5DYTA 2O5RA 4GRIA 2I2DA 4TQAA 3ET6B 3VAZA 1J0EA 3A1SA 4QM7A 4M5JA 2OCDA 2AX3A 4CDMA 1CUCA 4ATNA 3A05A 1O96A 2DGVA 1M1NA 4RWZA 4HF7A 3SBMA 1VBNA 5E2QA 3HLYA 2ZHOA 1T9CA 1D3WA 2QQGA 1EUDB 3R3YA 2ZIXB 4RS4A 3WVNA 2ZAYA 1K89A 3ZTSA 1RE1A 1XLVA 2W2QP 4GI1A 3OZDA 2IUTA 4KITB 3W66A 1CBUA 2QJWA 4L4ZA 3I5CA 3I4HX 1RPAA 3PXXA 3WJ2A 2Y1XA 3V1UA 2W2MP 4B2YA 3G2LA 2YQ0A 3G8SA 2DJIA 1ZONA 5G0RB 3HFGA 2W4QA 4QLBA 4X95A 5G0UA 4MDHA 5LCXA 4CLZA 3JU3A 3S1TA 3VPGA 5ED4A 5AXNA 4B3JA 3IQIX 2F67A 1Z7YA 2QNIA 4ND8B 1X9IA 1HBUB 2VATA 3TX8A 4N5MA 2WWIA 3P5TL 4DMFA 3M8PA 5FBLB 2Q8QA 1OIAA 3OE1A 2CXEA 1G6Q1 2JVKA 1WEKA 4LY9A 1IPEA 1I13A 3EZ7A 4CXMA 4JJIA 3OSUA 2NTVA 2FR0A 3CKMA 3EGWB 4QGFA 4QU7A 3ECCA 2I4LA 3KTOA 2X1VA 3OP4A 5JAZA 4G5QA 5B53A 4OHPA 1NBMA 4R9RA 5LP1A 4ITVA 2E4YA 3MECB 4DV4B 4TXLA 4UUBA 1GQFA 4DDHA 1WXHA 3NGMA 3CUNA 1CNFA 2ETXA 2GNKA 4DQKA 2OD9A 4Y1GA 3UDVA 3OV7A 1NJ5A 2IMOA 1HPZA 1FTRA 4A8MP 3BS9A 3L95X 4ZVTA 3BIXA 5H3HA 5EHHA 4O4GA 3AR4A 3EVFA 2YH2A 1QGED 2ZUCA 5C7PA 4KBIA 3UD4P 4BFYA 2CAJA 4IG3A 1KZ7B 3VSEA 3MRSA 5JSYA 1NRWA 4ZFNA 1C0TA 4G0PA 2CF5A 2Q66A 2JHCA 2G71A 2X6TA 1NR1A 4DV5F 1LUAA 1FDWA 2YYAA 4J3FA 1PV4A 1EQMA 5EEGA 3BSYA 3RRBA 2BF4A 1VCMA 2AFHB 2B4QA 5J43A 2EWMA 5IHXA 3MI7X 2E9ZA 2OFGX 4MAKA 4JFRA 1Q84A 2ODQA 3QVGB 1L0BA 1HDRA 5LOQA 2GQQA 2CUKA 2QRVB 3LLCA 1DEKA 4D3XA 3JYLA 2EV9A 3HBFA 1QHYA 2XCQA 2GZOA 5JS7A 4YHHB 1R8XA 621PA 3CB4A 2FGCA 5AW5A 3F5QA 2DYAA 1JAZA 3DDKA 4FOSA 2G0JA 4CNYA 1PT5A 2AK3A 3OIWA 4ELTA 1VRUB 2G83A 2AG6A 4RWEA 3SYTA 2DLCX 1F5NA 1GUYA 1Z39A 3PDNA 2ZSBA 5ED0A 1GTSA 2H00A 1JLAA 3BRQA 2MR5A 4JAVC 4NS1A 4C7OB 1Q1KA 5HVFA 1TQHA 3Q8PB 4Q9LA 1M2NA 2GJ9A 5JNTA 4YJ2F 3UAVA 3E53A 3RM3A 1N5DA 3OAAA 4EMTA 3MAAA 2YY6A 3NS5A 1WUKS 2AU0A 3K1AA 1ZH8A 4FJ2A 3CW2A 1ONPA 2WFZA 3QLUA 1W2BR 2F8TA 1BJKA 3A9SA 2W8KA 3LH5A 3D28A 2FSUA 3FB1A 1LBTA 4Z4IA 5D85A 4C2TA 2G82A 2BM9A 1WTFA 5GAHU 1IBCB 2MZTA 3MJFA 4JJZA 3RYTC 1DCMA 4IDKB 4DWIA 5HMMA 4PZPA 3W2VA 4P92A 3VNAA 4PSUA 2POCA 3WJ1A 5M5BA 5T41A 1W8IA 1MA3A 7AT1B 2EW8A 3FWPA 3P0RA 2B1JA 2H2DA 4KOEC 3FVTA 2AZ4A 3LQ2A 4GHWA 4TSRA 4G3XA 4DPUA 1YMQA 1D8AA 2FJ0A 2V7WA 3ZHOA 1RTHB 1ZAKA 3TI7A 4ZT6A 2XWPA 1IY2A 5G3ZA 4C4AA 4BIIA 5JWHA 3EXHC 2Q46A 2XMSA 1I5RA 2EKDA 4K7QA 4M60A 1RKUA 1DO0A 1W94A 3CLSC 4RK7A 1Y6ZA 1RP5A 1FFEA 3OG9A 1ITZA 1CV2A 5AQ1A 3AYZB 5DNUA 3JYNA 1RYBA 1RXIA 3HFSA 2H5IA 4RLHA 2O14A 3FMBA 2HOQA 3IAXA 3ETLA 3GZNA 2WVAA 1YZ6A 5DHSA 5C81A 4UDOA 4OX9B 1JKHA 4OIMA 4BEWA 4WXHA 2GXUA 2BMWA 3A1CA 1HR0B 1QH9A 1GCIA 4UW9A 3FNEA 4CETA 3QMMA 1G3UA 4WZAB 4FN4A 2CJAA 3B3JA 5ECGC 3FKSA 5K3EA 3HV0A 1A8HA 4YT4A 1QH1A 4EB6A 4NYIR 3G5MA 4HI0E 4Y1FA 1WP4A 3BQ0A 2C54A 2Z9CA 4DWVA 4AMYA 3AB7A 3H8YA 2P9QA 3IJPA 3D4IA 2YCLA 1J5OB 3FDSA 3WG9A 2IZZA 1X7GA 3RTVA 1OLOA 2F55A 1U9IC 2EK6A 2WM8A 3WMWA 3VR6H 3SJZA 2ZSHA 3PJ9A 2Q3CA 2WJGA 3V4OA 1W4LA 1I0ZA 1MWZA 3L9WA 4W7SA 4WXOA 3FMOB 1QTIA 2Y4OA 1IBCA 2C7QA 4H0NA 2Q7XA 2DWPA 2B9YA 1QTNA 4N5NA 4QC2A 1L9KA 4F04B 1PJSA 3NGRA 3HO8A 5KYWB 2DGUA 2GN0A 4GP9A 3BKFA 3KJQB 3MA0A 5B4VA 3T3NA 3F98A 5FOQA 3I9OA 1MN6A 1CYDA 1KNZA 2XT6A 3RJ9A 1UAWA 3GD7A 4YPFA 2X9VA 2VTVA 3RADC 2Z8YA 4J7AA 3K0KA 3GEMA 5CA1A 4JASB 4GL2A 2E1CA 3ZNNA 2FF7A 4PC1A 2JFOA 2BHTA 4RA9B 4UBOA 3VM6A 3V4IB 2ZB7A 3HB9A 3KVVA 3EXFA 5IDYA 2NP7A 2GK6A 4LMBA 2ZIEA 1BKSB 4LXYA 3ILIA 3M3DA 5AHWA 2XWQA 1BY9A 2II6A 5IS2A 4LE0A 3SZLA 3VZQA 1RHJA 3J7AN 3OD2A 4RW4A 5GGYA 1QHGA 2UUCB 5T7BA 1S0VA 3C97A 3KWFA 1PUXA 4N1AA 1L6IA 3WLQA 4DV5J 1BROA 2BFDA 3IUPA 4C0BA 3II6X 3SE7A 1UINA 3U39A 1PG2A 1KY4A 2UVPB 4ID8A 5F9MA 4L02A 2CNLB 3KKZA 4AL6A 2GF2A 4YMEA 3DRRB 3HKCA 2IOFA 4KSEB 5JAUA 4D9MA 2YXLA 1B8UA 3KZMA 2YKNB 2W42A 2YN4A 2PI4A 1C5KA 1YT5A 1DQZA 1UBKS 2WVGA 2CYBA 3BYRA 5IJ9B 1X9GA 3CO0S 1NONA 5FPYA 2FDXA 2QVLA 2ZM6B 4O4JB 4OJYA 4XGNA 1F12A 4ROSA 5GOTA 2FWPA 4PRKA 1T2UA 2HNBA 1AV6A 3LK7A 3RSCA 4OV6B 1W73A 4AMUA 2DNKA 4FVCA 5LDDC 4LFAJ 2PRYA 2C0QA 1BYUA 2J7WA 1EGHA 5HHTA 5JZOA 3P32A 3I58A 4FXWA 1LNSA 4CUJA 2WIDA 3CMQA 5IZHA 2HSEA 1VDZA 5SYAA 1BD3A 3O75A 4Q02A 3D31A 5FFMA 1HI0P 3V7NA 1ADBA 4BCAA 3L01A 2B9WA 5L1KA 1OX5A 4KO4S 5KX5A 4Y7DA 4YQYA 3UF0A 1Y5IB 4YI3A 3PXDA 1N9ZA 4FDVA 3CLHA 1P4GA 5AM3A 5SY9A 4M9SA 1JU3A 2IDMA 1E8MA 3UMVA 5M29A 2PGXA 5EUBA 4Y2TA 1IEWA 3U44A 1GV1A 4KX5A 5IT9A 3THWA 1YJVA 2JD0A 4LSZB 2D41A 4L57A 1PZXA 2J0SD 3ZXIA 1E18A 3R20A 3WISA 1TEXA 3T7AA 4QQKA 1TUGB 1M34B 3CIFA 4RJTA 1BH6A 5JW6A 3F6PA 2M8HA 4ZEOA 4P4NA 2VP9A 1MQ8B 5FOUA 1E6YB 1VJWA 4K2HA 5HBMA 1IJFB 1X87A 2GSDA 3R97A 3CF4G 5GMDA 2C58A 2AJ8A 5BW8A 1KOOA 3BJYA 1P4HA 3KFVA 4LF6B 4UVHA 4WKOA 2ZW9A 3DE1X 1ZZFA 4C0SA 2WU3A 4QOEA 2Y0BA 1Y89A 3AQIA 5DDRC 1P1KA 1D1SA 2P2LA 4V02A 1RQPA 2QL7A 3ND6A 4RAQA 1FVFA 1ODFA 3GIJA 3CZ4A 4MWSA 2FPMA 4WXRA 4NECA 4F2SA 1OZAA 3WA7A 2FW9A 3ZHCA 4JBCA 4K0KB 4UXHA 1TQLA 3ENKA 4NI2A 4S2UA 2R9VA 1QR2A 3Q2SC 1OD6A 3I83A 2GGSA 5INTA 1YVUA 4G5SA 5KTRA 3TDMA 2VA3A 1OJ4A 1N8KA 1GGKA 4OGLA 3EA4A 4A91A 2DKOB 3T3HA 3HN2A 4LFCJ 2RKBA 1JXOA 2X8JB 5D3KA 3GU3A 4ZAYA 2GS8A 3QIDA 4M5KA 3R5JB 2R751 3IPAA 2I3ZA 4G6ZA 5FHQA 1M2GA 3G0OA 4MIKA 3PQ2A 3D5TA 4LSMA 4S1PA 4G1PA 2BI4A 3IOMA 3T5GA 1BQ3A 3C85A 2WD9A 3D2BA 4FGKA 3DBHA 5K45A 5KS2A 1DARA 3MHPA 1G7CA 2QD5A 1F8XA 3MWKA 3GMGA 1OWPA 3CJQA 2ADBA 2RI1A 2FHJA 5J2TB 4JX9A 2GAGC 3EMVA 3C3CA 4FBUA 2KL8A 5JPCA 4KQIA 4DA8A 5KWSA 1QRTA 2CJKA 4JUDX 2DVIA 3MM7B 4PPFA 3D0HE 5DYWA 5KT7A 1T5LA 3BZUA 3L6RA 2VNHA 2AC4A 3VISA 2PGJA 2XUFA 4GX1A 1SJ9A 1FVOA 1KF0A 2EFCB 5EE9A 4MPRA 3DFUA 4I1UA 1PRYA 1BEUB 2E5FA 2PBLA 2JS7A 3VRHA 3IBGA 4HKTA 1FP4A 2NXJA 4YCBA 4ZT2A 2B8WA 5J1PA 1VRWA 5E0KB 2PEBA 3RT1A 3R7WA 4OBWA 2N3LA 2VXBA 3KIPA 4Q47A 4CV2A 3GFPA 2H31A 3T4XA 1RBYA 2REOA 5IVDA 2P9FA 2PD1A 5DW0A 1GEEA 1JPJA 4MYDA 2A1TS 5ADUS 2C9YA 4XM2A 2AIRA 1BX1A 2QL7B 5K8CA 4B32A 1H0HB 1Z7BA 2WYOA 1EYZA 3BMQA 3I8XA 1XG5A 3E18A 2O2CA 1SUSA 2ZM5A 1LLQA 5JZVA 5CCEA 4CT8A 2E18A 4ZZ3A 5AJYA 6AT1A 3NRJA<