4CI0B

Electron cryo-microscopy of f420-reducing nife hydrogenase frh
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
228
structure length
228
Chain Sequence
KPRIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F420-REDUCING HYDROGENASE, SUBUNIT ALPHA
publication title Atomic Model of the F420-Reducing [Nife] Hydrogenase by Electron Cryo-Electron Microscopy Using a Direct Electron Detector.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 47
structure length 228
sequence length 228
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ci0B02
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ci0B01
1UBMS 1YRQA 6FDRA 4OV1A 1B0PA 3OR1B 2WB1D 1Y5NB 4UE3S 5JSKA 1FDBA 1ROFA 3MMBB 3MM5A 2VPWB 1FCAA 2C3UA 1BLUA 1IR0A 1DAXA 1IQZA 1FXDA 4OMFG 3CUSA 2PDAA 1JB0C 1DFDA 4URHA 1XERA 2FD2A 2FJDB 2VKRA 1SIZA 4UEWA 4UPEA 3MM7B 1FRKA 2FGOA 4UD2A 3MM8B 3MM6A 1SIWB 2WSEC 6FD1A 1UBKS 3MM9B 3MMAA 3OR2A 5CH7B 4U9IS 1KEKA 1WULS 4XDCA 3AYZB 1KQFB 2O01C 5BYSA 2WPNA 1GT8A 2GMJA 2FJAB 1DURA 1FRXA 3ZEAA 2VPZB 1H2RS 1Y5IB 1BD6A 1H0HB 2FDNA 2C3YA 1UBOS 4IUCS 1H98A 4U9HS 1A6LA 1FRJA 4IUBS 1D3WA 2PA8D 1FRMA 4KT0C 1C4CA 1C4AA 2C3OA 4GD3Q 1GAOA 1FRVA 1WTFA 1JNZB 4YDDB 2V2KA 4Y28C 1FRLA 4UCWA 5JSYA 1F5BA 1F5CA 1Y4ZB 1FRHA 2FJBB 1K0TA 4KO4S 2C3MA 2XSJA 2ZVSA 4CI0B 3MM5B 1BC6A 1PC5A 2C3PA 1FRIA 3PNIA 4UCQA 3ZE9A 2Y0SD 2C42A 1H2AS 2V4JA 3EXYA 3MMCA 1FXRA 5D51S 1BWEA 4KO1S 1AXQA 2XSJB 4IUDS 4UCXA 3UQYS 1FDDA 2GMHA 2VPXB 1E3DA 5A4IS 5A4MS 1KQGB 3MM6B 1UBHS 2FJEB 3MMAB 3OR2B 4XDDA 2V4JB 1FDAA 3GYXB 1VJWA 1CLFA 1UBRS 4UEQA 4ID8A 5ADUS 1G6BA 1FEHA 1PC4A 1FD2A 1FDNA 3USCS 1YQ9A 4UQPA 4KN9S 3HKZD 4KO2S 1Q16B 3ZE7A 1SJ1A 5E7OB 2UZAA 1WUKS 4DHVA 1WUHS 3AYXB 1B0TA 1UBTS 1UBLS 1GTHA 1G3OA 3MMBA 3ZE6A 3MYRA 4C3OB 3USES 2FRVA 4KO3S 3LW5C 5JT1A 4UE2A 4RKUC 2WSCC 5JSUA 1H7XA 2Z8QA 1FF2A 7FDRA 1HFEL 1CC1S 4UE6A 1YQWA 1BQXA 2WSFC 4AYBD 3RGWS 5JRDS 3MM7A 2WAQD 7FD1A 4UQLA 4KL8S 2VPYB 3MM8A 1H7WA 1RGVA 3EUNA 3MMCB 3IR5B 3MM9A 3CURA 1B0VA 5L8RC 1JNRB 4UD6A 4TTTS 4L6V3 2PMZD 1FRFS 5CHCB 5FD1A 1F2GA 3ZE8A 1WUIS 1R27B 4XK8C 5BYQA 3EGWB 1GTEA 1FERA 2IVFB 1UBJS 4UPVA 3OR1A 5JSHA 5A4FS 1Y5LB 5BYRA 3C8YA 1FTCA 1UBUS 3IR6B 3H3XA 1WUJS 3IR7B
chains in the Genus database with same CATH superfamily
5HP4A 1A0OB 5BR7A 5B1EA 1Y4ZA 4IZ6A 1QH1A 3CVJA 4C3VA 1LW0A 5ETNA 2YJ6A 1MUUA 5IM4A 3F3SA 5C80A 2O8FA 4J4BA 3VJKA 2O5DA 5FUWA 1GTMA 4PZUA 3HXTA 1Q2XA 4N7TA 4IQFA 3ZWWA 2X2OA 2JAHA 3EXAA 3PWZA 1WSBA 2YL2A 2AN5A 5ETTA 3W5JA 1QHSA 2A6MA 1P17A 3JQJA 4AJOA 3C3XA 3CLRD 3VV2A 1X9SA 4MUJA 4C7QA 2CD9A 4G85A 2H5JB 3ADDA 3A10A 3EVZA 4UC0A 4F7WA 3DYIA 2P0YA 4YB5A 4EEZA 4KHZA 1PFYA 2GCPA 4BMCA 5KOJA 2OM2A 1R0KA 5EJ2A 2PIIA 3NY0A 2EFDB 5TE9A 2RB7A 4FBGA 4IDHA 3TX2A 1EFUA 5K8MA 3B4MA 4XVRA 3MEEA 2QL6A 1GFZA 2XOKD 4KWCA 3IE1A 3A1CA 3PDHA 3AILA 2YJNA 2HU7A 4BLTA 1FUEA 5A5DA 1O51A 3LWZA 5KWEA 5LSRA 2QS9A 3V34A 2HWXA 2L19A 3BREA 3MCSA 3C3EA 2HUPA 3BDEA 2GN2A 4QVIA 1KFKB 4DR3F 1MOPA 2XWPA 3M05A 1KNZA 1M2EA 1RHKB 4Z0HO 4P32A 1RACB 1I94J 3HHLD 3X1DA 3OPYA 4OXNA 4IIUA 2VTDA 3A6EA 4RTMA 3HCRA 2JASA 4KOAA 1SOMA 2QXUA 2DGQA 4IJ5A 2MZQA 3H84A 4XEHA 4IG0B 2FSVA 2PBZA 3O4FA 5C1PA 1M8PA 3DVQX 1WA5A 4DV1J 3AVVA 4I6WA 4OYOA 3RYCB 3O94A 5B58T 1EQMA 4I1OA 4MULA 3U16A 1T6NA 3T6KA 1XRNA 4A7PA 2AYMA 4C6HA 4BLRA 3MMAB 3BMOB 4HDKB 2CEAA 1N34J 3DTYA 4IH7A 4YJFB 1KPIA 1Y8RB 2BDUA 2HU8A 3GFOA 2EP7A 3IHWA 2JAXA 3IP7A 3NYWA 1BQ4A 4NYOA 1TUIA 1YJ8A 1HSZA 1VYUA 4ECXA 5C42A 4V2UA 5A5EA 4QFDA 1T3ZA 2VHGA 2FMTA 3BT7A 4ALMA 4RHCA 3I04M 1FX0B 1AB8A 3W5IA 2I66A 1NDQA 1EI9A 3ST7A 2ZOSA 3F8TA 3TSYA 4ZEOA 3L7JA 1MSWD 3OZTA 1MABA 1L9KA 3ZY4A 1R4NA 2BANA 4QR2A 3WIEA 4XPIB 4DSUA 4LV8B 5B4UA 1J0BA 1T5BA 1BN6A 2Z2JA 3PFKA 3O73A 1F8UA 3DVLA 5K8CA 3CVUA 3BQMB 4ZEWA 3DGVA 2JLRA 1J24A 3NHUA 3K70C 3NTOA 4DI6A 4B82A 3BMNB 2L08A 1T34A 4X65J 2B9VA 2MLYA 1JLMA 5AW3A 1QRTA 1TF2A 3TAQA 4X1KB 5FFMA 3H9GA 3KDSE 4MKGA 4UKDA 5M2RA 5AM5A 2L18A 1OC4A 1K1SA 1ES9A 1OLXA 4PSDA 2AWZA 3C8MA 1H85A 2VSXA 2CJAA 4BP3A 2VP6A 3D3NA 4F4XA 4OX9J 3Q9UA 4ALIA 3O3NB 3ER8A 1DZ5A 5ES4B 1R6BX 4FS1A 3DFMA 2P0AA 3CJKA 4RVHA 2GIRA 3TJMA 2WONA 2PMWA 3RTAA 3QMPA 5B1SA 3E7WA 2A1TS 3RYIB 4BGDA 4RVSA 4YPOA 3OIFA 1OOEA 3EQZA 4B7CA 2FDNA 2X14A 5KFDA 3VAZA 3RR8A 1NUQA 4MVJG 3I6IA 1MPXA 3IQFA 3H42A 1PG2A 1MJNA 1H9BA 1XN4A 3L92A 5KJCA 2ZRPA 2XZTA 3GV5B 2VRWA 1E0JA 5EUHA 4JBCA 4HJRA 5B1HA 5LMUJ 1ZOSA 5ENDA 3HFKA 4FBUA 2KLBA 3G6WA 4AS2A 2WWYA 3KAPA 5L7YA 3AQPA 2Q3CA 4F45A 5EMLA 3TARA 3ROTA 2ZBFA 2VJPA 3ND9A 2FWIA 3IR5A 1RR6A 1H7XA 3V9AA 4CKEB 3FFIA 3TQHA 3HU1A 3W4JA 1UC4B 3FPEA 3M6VA 1D6NA 4CMIA 3OEEA 3PVXA 3B7GA 3TP2A 2H2IA 4USTA 3GH3A 1UZHA 3SCZA 1HSOA 4F3OA 1FA9A 2WCXA 1WU8A 5A4DA 3FDSA 4NOHA 1F7UA 2CFSA 3I0SB 4DPYA 3QOWA 3QGPA 2GBLC 2NACA 3DMJA 2VZLA 3NHYA 3FBFA 4B4KA 4G5FA 2C5LA 4EWLA 3BBCA 5IKMA 1H2FA 1P4RA 2FR1A 2MJLA 4C0HA 4Q7KA 1XNQF 4HK4A 1A76A 1UEXC 1C4XA 2BRLA 2FCRA 4LYGA 2ZVSA 4CQNA 2OHIA 4CEIA 3R0VA 4ZJOA 1Z6ZA 4FILA 2PMKA 4IIHA 1TW2A 5D8DA 2JZNA 1E6YB 1EA7A 3E4DA 2M6RA 1WXQA 2XZLA 5B0AA 2XI2A 2O3SA 4ZAVA 2MB0B 3KUGA 1D2EA 4C7VA 4HMQA 2CUTA 4PX5A 5GZ6A 5LXYA 4BFUA 1QUPA 4I50A 2QA4G 1MOZA 3VKUA 2WBLC 4RIFA 3X1JA 4ECZA 2E55A 3OCXA 5BSGA 4NPOA 2CNWD 2HMWA 4PLZA 4GWGA 3DP9A 4EAAA 2R1VB 3BHNA 2ZP1A 3MEDA 4KXWA 1E9AA 3HEAA 3AA9A 3INTA 1C2YA 2VOPA 1T5OA 2K8GA 1G64A 2XE8A 2W2PA 1VL8A 3N07A 4C14A 1JA0A 5I9TA 1HV8A 3ZIUA 5ALPA 2HFOA 1J5OB 1LQUA 1UVLA 3NOXA 3KG0A 2OCGA 1B8PA 4ILMA 3PDWA 1XZFA 2P2CB 4AS1A 2BFEA 2ZRLA 2ZVQX 1E3DA 4UTOA 1BU5A 2NZXA 3TRHA 3PCTA 4ZIVA 2P62A 2OFGX 2QLLA 3TW8B 4F9FA 2XMTA 4DIKA 2Z5LA 1VQKS 2Y4NA 3FYUA 5CYPA 2IPOA 4LDAA 3NUGA 4RVGA 1DWOA 3O9VA 1WRBA 3EMDA 3KUEA 1N2IA 4AZWA 5H7XA 4Z2YA 2N3OA 1SBIA 1UOOA 1VG0B 4A2CA 4OQDA 3DHVA 1K0FA 1KJ9A 2FF5A 4DSIA 4L8YA 5FIIA 4MW1A 3WKAA 3HSYA 4XCXA 3IERA 1XCPA 5ICMA 1I94B 2A1IA 5U1PA 5BOVA 2ACMA 2ROEA 2BWJA 3EE6A 5HCIA 4QNNA 2DCMA 5D3MA 4KYZA 2JDJA 1FDUA 1ZSYA 4GEGA 3ICLA 2GJKA 4ED6A 3NGRA 4DV3F 4L75A 4XUEA 2J9ZB 3PR5B 5G0SA 4DV1B 5KOIA 2LCWA 1H65A 4JXXA 3KDNA 1VBZA 3ZZMA 4NYIQ 4TKVB 4OHVA 5JRZA 5F21A 2CQGA 4QIVA 3L8MA 2BGMA 1AZLA 5EVCA 2P5SA 4RW9B 3CH4B 3BFJA 1A9XA 4IYQA 2ZXEA 2H51B 4B9NA 1DEAA 1OGJA 1GNLA 3WE7A 1MVLA 3L7DA 1L8QA 2P8IA 3HABA 3LF1A 3AKDA 3P0FA 4DHVA 1NMZA 5D4OA 1HNZJ 4MOWA 4B5KA 1CEQA 2QPLA 2NUTA 4JZKA 1SBYA 2NVWA 3LE8A 1ZMOA 3Q9NA 3JSBA 1TL3A 3DFIA 2ZAIA 2IM2A 3GZJA 1IBCB 4DXLA 4MV1A 3RVLA 4F1JA 2RH9B 1OXMA 4LX8A 1CYDA 3FA2A 3N01A 3M4JA 3FWZA 1ZRMA 2VUUA 3T7AA 3E18A 3N0XA 4QAQA 3UCFA 1E4YA 2ADFA 2NO7A 1R31A 3C7KA 1PDVA 1F4VA 4K9NA 4CMAA 3KQKA 1KC8T 1KQOA 2WE7A 5KDOA 3T6JA 4K4UA 5BV0A 1M2WA 3D66A 3LV8A 5EFZA 1SBHA 4WK3A 3OC6A 1Y5IB 5CRIA 1U0HB 1DP4A 4E08A 4Q3CA 3MTGA 4NBTA 4JLUA 2V6AA 1XTRA 1JQ5A 1PZGA 4TQ9A 2WAYA 2BR5A 3CVKA 3D7SA 4E22A 2PBLA 5DNVA 3KOOA 4K40A 3UB2A 5MFZA 3TTSA 4TYBA 1ODJA 4C4WA 3OHAA 1LDBA 4NYZA 3TVZA 3AR5A 4K9KA 3UCUP 3KT3A 5K3FA 1N5TA 4OFXA 2VFSA 3V5NA 5BPHA 1AKQA 2O7RA 4WTOB 5I7RA 1IWAA 5K9ZA 5CZVA 3ND6A 4KR6A 4B84A 3FZ2A 4X65B 2PUVA 5KQGA 4CNYA 2WF5A 4GGOA 3I9V6 4HAZA 4KHMA 3OJEA 3MFQA 3MYRA 1RABB 1L5MA 4S3MA 3TKAA 3HUTA 3JB9k 2EW2A 4G41A 5AIBA 4OX9B 2FE4A 2HIHA 4XA8A 3QBTA 4EA6A 1XEAA 3CSUA 5B64A 3CN7A 4UUWA 1CXZA 5IKXA 4C4AA 4ZOSA 4IKEA 2W2LD 3NM5A 5DVZA 3DOIA 2OV1A 2D3TA 3P3DA 1P5RA 5KZMB 4S1NA 2ZJAA 4D8YA 1MB2A 1W34A 5IAAA 1SVDA 4M0EA 3IRUA 1FI4A 1V5IA 1T6ZA 4LXGA 1P5FA 2O2ZA 2CFCA 3BIXA 1Q57A 1J25A 3KJVB 3RUHA 3DRSA 4QGHA 3F4LA 1JYEA 4XEUA 5E2BA 5IQ6A 3BRWD 3ZUGA 5LMUB 4P3PA 2XPCA 3L93A 1A9YA 3AM5A 3H2ZA 4JP5A 5C2CA 1AQ6A 2D59A 4FLFA 3KZMA 3A4MA 1Q0RA 3LHDA 1C9EA 3R3JA 3DT9A 2O59A 3NKVA 4FNHA 1ABEA 4IICA 2HLDA 4FXOA 2ZI9A 2DWCA 3RTGA 5GAEI 2NZUG 2I1VB 4JJGA 4L4UA 3WSVA 2IDEA 4E2WA 1HLPA 4WK0B 4W1PA 5FUMA 4KREA 2PD6A 2DGWA 1F60B 2ZBEA 1I10A 1LVGA 3D8SA 3MD3A 3AJAA 3TJ8A 2REQA 5ICEA 3O4IA 2ZBQA 3VMFA 1W2IA 2FN8A 3V7FA 4D0NA 4G5RA 1GGEA 1TKTA 2D74B 1GWNA 1MROB 4LECA 2ZRAA 1FX2A 2OO3A 3QAEA 4NZ0A 1WCIA 5JHGB 1PR9A 4L57A 4O1HA 1T9ZA 3EIEA 3UK2A 4KZKA 4J0GA 2UYYA 1HDRA 5K3EA 4PPFA 2HZBA 5HIIA 4EGJA 3RK1A 1NK0A 1TFYA 4IQGA 3BFKA 1GMWD 4EHFA 4ZLLA 3DOCA 4MHOA 4LOLA 3GK3A 2IX9A 4I1RA 4PZYA 3GW8A 2Z2IA 3BGVA 1WDDA 4CTNA 2ASLA 4PPNA 4WV3A 4AROA 3AESB 4MO2A 2YHIB 3J7ZT 2G2OA 1QY7A 3FC9A 4RH1A 1FY2A 1T8WA 2XV1A 3D0OA 3LP0A 3L7LA 4DN6A 2OMOA 4AYBD 2UZ1A 2QRRA 2GR9A 3VVBA 1T5TA 1GMVA 1QRDA 1ZXBA 2HIQA 1KERA 4NZZA 5CHCB 1PLKA 4BHTA 1TAHA 1R5BA 4FX2A 2IU3A 3T1NA 3SFVA 2HO5A 4Q6WA 2OD6A 3SKXA 4J37A 4X44A 4DYDA 1GG2A 4B0OA 2F67A 3NASA 4DQIA 1IR0A 4Q9JA 1HC7A 3OE4A 2GN0A 3V1TC 2J8SA 2Q5JA 1J1IA 4TL7A 4ND7A 1T5SA 2PRKA 3PYXA 2JCGA 3EVBA 1GR1A 4FYJA 1T4CB 1J70A 4P0QB 3GJQB 5E6RB 5LDHA 3COWA 1D0SA 1MXFA 1PO6A 1EP3B 3G4SS 5J1SB 1S12A 4RHUA 5HYVA 5JZBA 3JQBC 4P7GA 4O0IA 3LHIA 2VAVA 2PU5A 2YMLA 3UHFA 4P7JA 3VNBA 3AGQA 3UJCA 4IWXA 3CMCO 3C45A 2VDLB 3TXXA 2PT7A 1FYVA 2JGMA 4LR8A 5TVKA 3D3KA 1KDPA 2ZVIA 4RACA 2JJ8A 4LHVA 2LWIA 3PNBA 1E9EA 5CFOA 1YR8A 1K3TA 2BFCB 1E7WA 1U5CA 2HF2A 1Y5MA 2LUOA 2GEFA 2R86A 1T9HA 4OXRA 3LX6A 3I2FA 1FXDA 4LDQA 4O3PA 3T9CA 3VU3A 3IUBA 1YIAA 3MUNA 4O4IB 4QRHA 4MS3B 1SUIA 1W88B 2IZOA 1KY5A 2ZH7A 3RS5A 3AKZA 1A6LA 4C3UA 2NOAA 2FPOA 1FFGA 3HU5A 1PKEA 3T3NA 4PXBA 2XUOA 3HADA 3HYLA 1SK8A 4W5NA 5EN4A 2Z30A 1Y10A 1WMFA 5JAIA 4YEAA 2HRZA 4DLVA 4EJ0A 3RTVA 1QFSA 2WUWE 1W5SA 2NP6A 1HNZB 1VI5A 4CQMD 5E7OB 2CLLB 1R0YA 2R6GA 4I6EA 2D5IA 2JI6A 2FHJA 2ZT7A 1IBKJ 2PZEA 4R0EA 5TDHA 3JWGA 5ETPA 1S99A 1VLJA 4I1PA 2O7VA 1UPAA 2P9ZA 4S12A 1MLDA 5K8PA 3N1UA 3R3HA 1UKCA 1KJZA 1LV5A 3O93A 1S6UA 3IIIA 5IUKC 2SECE 4TXJA 4EHHA 3DDCA 3ICQB 2ZQYA 3ZI7A 2NU6B 2BAGA 3EG9B 3EZUA 4OL8A 1RBQA 3SF8B 3M1IA 1ISMA 1NBHA 1SCIA 1T3TA 4UEJA 2PG3A 3LSYA 4V1Ak 1XR3A 4REQB 4F04A 4N5HX 4EB3A 2CZ9A 2AN1A 4BOYA 3UPTA 4NL5A 1OZAA 3UPDA 1JMTA 3CLTC 1Z68A 5FPHA 4DSZA 4CLXA 4CKXA 3ACBA 2VQFJ 3G59A 1Q8IA 3EGWA 2NQTA 4CLOB 3QM1A 3MA0A 1ENYA 1O9HA 1SFRA 1GTZA 2N46A 2R2TA 1LBIA 2OHJA 1NDKA 3IAM6 4CLPA 1Y6ZA 2GS9A 3IGNA 2YYAA 1ZM9A 1AHNA 1HE5A 2GGSA 2GKGA 4QZVB 3L6UA 1L7QA 5FTJA 1IBMF 1Z06A 4MV9A 1WOMA 5JVDF 3LVQE 1PK9A 4ZVRA 4QOIA 3ESRA 5CG1A 2WFMA 2MIIA 1KS9A 2C78A 2QLBB 3FGOA 2R7LA 4RD0A 4I64A 1VKOA 2V0NA 2A2DA 2M52A 4D9MA 1YZFA 3GT7A 5TEVA 1Z2NX 3TSZA 1PK8A 3MSXA 3GGGA 2XUJA 3HSDA 2YZ7A 1N54B 2AXQA 1W4CA 4P8RA 3RWMB 4CG3A 1SHKA 4Q3NA 1P2BA 4HGNA 3KHTA 3LYHA 3ZHSA 1RWKB 1N0IA 4ZT7A 2XY7A 2AW5A 3Q8KA 2QUIA 1RWNB 4FFRA 2RI1A 3UBMA 3UENA 2B51A 2RKBA 1THZA 4R83A 1ZNWA 5J5VA 3EH1A 2V5VA 5JVHQ 4FR0A 3EZFA 3ONWA 2AU0A 3CO5A 2XCPA 3RRBA 4DVGA 1G6BA 1ARZA 4C1BA 2OHOA 3B1JA 4H7IA 4FF1A 4JYCA 2CJWA 4OZLA 1VPLA 2Q5QA 2MSDB 5AKLA 1G2OA 1YDFA 2QN8A 3PNVA 1QSLA 4H6WA 1FPMA 2WAOA 4TMZA 3ZDDA 3VJRA 3VR2D 1NK7A 1UMBB 1OTHA 1PO7A 1ISIA 3F49S 2QI9C 2W2XA 4F97A 3DEHA 4IGFA 4CG2A 1RWBA 1Q53A 3K0CC 2WHQA 1V7ZA 3A6LA 3NJ4A 5LZ5A 3T3DA 4V0QA 5IZCC 4EY8A 3RW6A 2B61A 3NTQA 5I5EA 1U2SA 1OWNA 3HSKA 3KSZO 2VK8A 4EPWA 4XM0A 3AI1A 3DE2X 4MJLA 4LJKA 2EZ4A 3DYBA 1C0TB 3G49A 4WAUA 4NZOA 1S3GA 1TAQA 3MGAA 3CRVA 1P7WA 2W9CB 4D92A 3VSDA 4EUKA 2ZRIA 3R74A 2M4MA 2OY0A 4KRGA 2HR1A 3FOAA 1X86B 3K09C 1T2VA 4WF9Q 1FJ2A 3Q4GA 4BWJA 2BJDA 3PX3A 4XLTA 4X1IB 1FVQA 1GL6A 3QFCA 4JSRA 1RWPA 1DINA 1B3BA 4C3OB 3URKA 3LW5C 1MXHA 1PE0A 3L1HA 4GI1A 2GPSA 2XZWA 2IJRA 1MRSA 3ADOA 3MMCB 4EKEA 2AGPA 2A1UA 1KVIA 4R2KA 2AWOA 3RSQA 4IDKB 4CLUA 2J09A 2C4MA 4WCFB 2CQPA 3ANTA 4AMVA 4A8MP 2HJ9A 2AJ4A 5KS2A 1BQNB 2XUZA 3T35A 3VM6A 4RIHA 1MTZA 4LI3X 1BDIA 3BG5A 3CZQA 1AZSA 1OAAA 2YNGA 2C1XA 4LZLA 3ZJVA 5EYPB 1NBAA 3TAMB 1RQRA 1CF9A 3TNVA 4J0IA 4M5JA 2PGIA 5BSFA 3A27A 2NUPB 4PRZA 1JPJA 1DURA 5I3UA 3CDBA 2LQJA 4J1SA 1YDWA 2AK3A 1BUXA 3LWNA 4F46A 4NAHA 1HPLA 2BRUA 1VL1A 1HQEB 2P30A 5A8KA 3O4HA 3R6LA 2BD0A 3TW6A 1FEHA 4OK5A 2O7QA 3OV7A 1PWZA 4TWIA 3UMJA 5KYYA 4ER5A 2K5UA 3NHWA 2E4ZA 3EGVA 1NOKA 4EW3A 3GA7A 1O0SA 4Y2YA 3AEKB 2Z58B 2CBGA 1TGVA 5GY7A 1QCCA 3VQSA 1YI2S 1W581 3PIDA 4RUBA 5FYDA 2BBEA 1ESEA 4WZBE 3NKYA 3OCUA 4AZ0A 3ETDA 2G4LA 2YXLA 3TLXA 4DLXA 2CV2A 3QKSA 1SIUA 3WMXA 2GLUA 5LJ3Y 2YIDA 1LK7A 3P0RA 4MUGA 3C3CA 3KLHB 1GTSA 5DDQC 1OPXA 3EGOA 4DS5A 5DNDA 5B6IA 3AG5A 4KQXA 1UBSB 4WA8A 5LUBA 4NNJA 1T29A 5KNCA 1FMJA 2NU8B 3R7NB 3E22B 5BUSA 5K20B 1JHZA 3V2UC 3X1MA 3ODGA 1V95A 4KB5A 1Y7HA 3NKFA 1CC7A 4FWTA 1U6FA 4KR2A 2ZUWA 2QL9A 4QWDA 4E33A 3BSWA 3TS1A 1ZGCA 3JYOA 5GMKa 1JR6A 1ULUA 4JI8B 1IBKB 5DRYA 3GPIA 4EBFA 5ADZA 4XCVA 4R0MA 4O2AF 1H1TA 3RUFA 3BM7A 2VHYA 5UKDA 4G6ZA 3UMRA 2HRQA 3PRVA 3R5JB 1JK9B 1ISRA 4IV8A 4JI4F 1JFSA 2G08A 2F8MA 2HMTA 3LLMA 3G8AA 4DQSA 1W25A 3JQGA 2P68A 3ENWA 2PIDA 4RD6A 3ORSA 4OJNA 2KTQA 4G9GA 4KFTA 3IV7A 5AVWA 4BE7B 4CL3A 2Z8YM 2ORYA 1I9GA 2ATLA 5JS1A 2O2SA 3RS0A 4H17A 2YJ4A 5CDTA 2B4OA 4P4LA 2NMVA 2O1XA 2VQFB 2Z1MA 5AUQA 4UW2A 4BBZA 1A2OA 2O3QA 1A96A 4H27A 2HJHA 1T9CA 2XMSA 4ITRC 3T99A 4DY4A 3S0JA 3CRQA 3GYBA 1BXKA 2VHJA 2JCVA 3HFJA 2M9MA 5K09A 1WV0A 3EJ6A 2IHNA 3W8GA 2VRNA 2KT3A 4A1FA 1H42A 1FWKA 4Q9AA 1FX1A 4DUYF 5EC8A 4BE4A 2AJ1A 2X8AA 5KQSA 1LTKA 3TK1A 4BFZA 1HKHA 4ZYXA 3WQHA 4GECA 2XMZA 5HFAA 4YNBA 2W58A 5TGTA 4J1NA 3AFNA 2D9OA 2CMKA 3H3FA 2AMJA 2VXBA 1YO6A 1FW6A 5F7XA 1DTTA 1HE1C 4UEWA 3IE2A 4Q1AA 1F5NA 3MC1A 4P0PB 3RVMA 4TT8A 4MRPA 4O4JA 2BEFA 1C4CA 4FMPA 2OV8A 1IUOA 4QTZA 3KPYA 5AJVB 2G13A 4TXHA 4ND3A 5ETJA 4XVCA 3HR7A 4Z4FA 1T13A 4AT1A 1Q83A 4PR0A 2P78A 2ZIUB 4O3SA 3ONFA 3NMAA 3EEQA 4UULA 5EA2A 1SJ9A 4TV9A 2VQSA 2C83A 5JEEA 1NW4A 1R12A 4TSFD 4IBOA 4K4WA 4CM9D 2CPEA 2G36A 4AO6A 4BMXA 2PMZD 3LC2O 4PC6A 5JDIA 3A3PA 3SM3A 4UMFA 3RI3A 1U0NA 1P1HA 3F78A 5LFAA 1U0GA 2GCOB 1C9JA 3GFYA 3K6KA 3KG2A 3SAJA 4CE6A 4K1XA 1OSCA 1RXWA 3GZNA 2W00A 3AIMA 1SHLA 5JZVA 1E6WA 4NU5A 3M8SA 3INGA 3IAFA 4EY6A 4GO1A 4YCSA 3VX3A 1Y33E 5LU8A 5I3PA 3Q3CA 3L05A 1HRDA 1YFKA 1YMUA 4KGDA 2W8KA 2QC3A 1FT8A 3IKMB 5J2NB 3MR7A 1TQLA 4DPTA 4GSYA 1JE0A 1PS9A 4Y3CA 4K7QA 2KI2A 3ZX5A 4IQMA 4DSJA 3L0ZA 4PONA 2BACA 4XD7D 4X6LA 4BKUA 1ICEA 2Z3ZA 4U2DA 4WBSA 4A03A 3P2YA 1QRRA 4EGLA 1TT5B 3TOCA 2RGCA 4HFNA 1YBHA 1SPXA 3DCJA 3B1YA 5A5VA 1E6KA 4AZSA 3ZNPA 4QIGA 5FAXA 5FL7A 3QKTA 2FQYA 3P52A 4DNOA 1QHHB 1Z07A 3IEXA 5LKAA 3DLJA 4AULA 5L1KA 4X90A 1TXGA 3KFLA 3KETA 2Y76A 4TPKA 4HX9A 1WUUA 2RD5C 4A8QA 3SBXA 2O67A 2J9DE 4B34A 5JSQA 4MHTA 3ZK9A 1NKTA 3IEUA 1M5SA 1TJYA 4TMTA 3C4QA 3WWZA 4RD2A 2WMOB 1T15A 2H2AA 3A9WA 5A9RA 4MJXA 3BJZA 1JSZA 1YQQA 3DL4A 3WLEA 4KRWA 4JQOA 3Q1LA 1I7QB 1OJ7A 1DB3A 4FNIA 1G21A 1CS4A 3CCLS 3WY9A 1E5DA 1YB2A 3MUEA 4R1NA 5K0BA 3TB6A 1BVRA 1XQ9A 1UBNA 2F9DA 1C8LA 1C9DB 4I9GA 3WRYC 2AD9A 2MSNA 2ZI4A 1YJAA 3ZLBA 4JI3F 1LF5A 4WEQA 3OJLA 3EDMA 2VT2A 1NFFA 4IIYA 5EE1A 3RVBA 1V3QE 7AT1A 2DNKA 2FJWA 1I4EB 1QP4A 1VRCA 1EK2A 5KYXB 1Z5GA 1XEWX 3FCUB 3T06B 2YX4A 1R8HA 1WSRA 5LIPA 5L38A 1DQ8A 1HHTP 5H3CA 5F73A 1SU4A 4E2YA 3ND8A 4W7SA 2VBZA 3MM8B 1Z0UA 2BABA 4RX6A 3L0YA 1TECE 2VXOA 4UMDA 1M0TA 3PUVA 2FPRA 3KJZA 4BNMA 5I3CA 1TUGB 2XTJA 3R1HA 3RIHA 4U7UD 4BJHB 3ZTOA 3IMEA 5EWGA 3AIKA 2DHCA 1ZIDA 4TRJA 2QGFB 3TD6A 1KVSA 1IPEA 1L5UA 5CFLA 10MHA 3BK1A 1BDJA 5DDOC 4G86A 4LF5B 2W4QA 3DE7X 4FFOA 5A0FA 3N28A 1GL3A 1C4KA 4QYZK 3FMGA 4RVUA 4TKZA 5A6SB 1I3CA 3WKCA 1USUA 1XLTA 1U0HC 1VIXA 3VKGA 3BMQB 4A6XA 2H2WA 3GCXP 4ZAZA 4D8VA 1XNQJ 3FLBA 2QD5A 5CXTA 1HM5A 1JNRB 4CM2A 3J7AN 3M2TA 5EQFA 3TGPA 3GIDA 3IDFA 3UJ9A 1NA5A 4A8OA 3RSLA 1M2FA 3N75A 2HQRA 4YMUA 1ULRA 2ZHAA 1TK5A 3JTEA 1VQSA 4WK1A 1ZD1A 2OECA 5C7YA 3E3AA 1U7XA 4IDBA 4TV8F 3PIRA 3NEYA 5FAKA 3UICA 1W5TA 2NUAB 4ZVEA 1KAEA 1Y5RA 4DB4A 1TE2A 2RHRA 3FRHA 3A8EA 1XRQA 3VNSA 1NDPA 5JSZA 1VCNA 3YASA 1D2CA 4WXMA 1Y9AA 2I2CA 3BIWA 4B44A 4A8KA 5LDGA 1CPZA 4S05A 3ZHRA 2I7VA 3FCAA 1T3NA 1AURA 3U02A 4OUKX 1JMVA 4HR7A 3KVOA 4PN7A 2BQRA 3GA0A 3T6BA 5IV3A 1G7TA 2ZWOA 4HDNA 4DM3A 1NE2A 3R23A 4B79A 3NAHA 1E1RA 3GFSA 1QR6A 4BIMA 1LTHR 1RVV1 4J03A 4NLUA 3W8EA 5G1OA 2UV8A 5D3GA 2HVDA 1W5BA 1U2EA 3ZKWB 1Z33A 1AXEA 5EHXA 2BP7B 3N9UC 2NTEA 1OQAA 3SI7A 3QGMA 3C6UB 4D9NA 2GNOA 4FDUA 1Y8ZA 1N6PA 5EJ4A 3ZKAA 3VR6A 3SQMA 3PNYA 4R4JA 4GNKA 4PFJA 821PA 1VB3A 3PW5A 1U0FA 5HAOA 1L5ZA 5K1ZA 5JU6A 3KLFB 3GGSA 1K7CA 5IJ0A 3HBJA 4QG7A 3GWCA 2WVGA 1NFQA 3QK7A 3K6JA 4PTYA 4DR3B 3TIXB 4WZZA 1TMGE 2NZJA 3OD5A 2YV4A 2IY8A 4OMUA 2QQGA 1LQ9A 3I05A 1VPVA 3KVVA 3QPBA 3HO1A 2WKWA 3DXSX 3RWBA 4MQFB 5LQKA 4LIRA 5AI0A 1D8ZA 5TQ2A 1SJ1A 3BXHA 5GAEU 4DV3J 1HWIA 1RLTA 3CMMA 1DBPA 1KYTA 3KYBA 1NQUA 3PCRB 2QLWA 3HK2A 4ZVVA 1PYOB 4OLHA 1ZM7A 3OJCA 1JHMA 3SEFA 3MM9A 4OIFA 2OCBA 1ZC4A 2JKVA 3QBJA 4BTLA 1L5HA 5J1EA 2MINA 3OWOA 3DRPB 1KPGA 1KY2A 3C8YA 5CD9A 4GZ5A 3H11B 4XRRA 3R5AA 1YRQA 4DFMA 1PFGA 1PR4A 4JQCA 4QQKA 2CSXA 1R89A 1B1AA 2EZUA 2A0FB 2XIQA 1OREA 1EXDA 4KLCA 1VE9A 5KFPA 1CVJA 3TR0A 1JXVA 5CXUA 5BWNA 4HX5A 1T6BY 1W26A 3JTOA 5A7HA 4P7VA 3CULA 5KDDA 3OTBA 2C58A 5IDWA 1H98A 5EPOA 2QVLA 1WVIA 1AT1B 1AM4D 4EYEA 1QG4A 1YBTA 4E46A 1N6IA 2Y3IA 4RU1A 4FGZA 1RT9A 1KFEB 3CCSS 5K4AA 1OZ0A 3DBLA 4RM2A 1OHHA 5TC4A 4FHZA 3LUYA 2PUDA 4DLYA 3R4CA 3ZE7A 2GPBA 3RFVA 2XMWA 3RRZA 3GIKA 3SEAA 2H08A 4XXHA 3NHPA 3QPCA 3HDSA 4ER0A 1EG2A 3NBMA 3IG1B 1FVXA 1G8SA 4CDIA 5TXGA 4HMPA 4I69A 4RE6A 4AJPA 3FNRA 1XFAA 5E7JA 4RZSA 3EICA 1CS0A 3OEHA 5KG1A 4E4YA 4KJIA 1FNBA 4LQDA 3TL2A 2VB6A 2VSFA 3E9RA 3GLRA 3D4OA 2YBVA 2JBAB 1S01A 3H5XA 4QUBA 2LKDA 2HBZB 1XK7A 4F6RB 4E07A 3LA0A 1PJZA 2QJRA 5DNCA 1FJEB 3AVOA 4NEYA 4Z9YA 1H6BA 2AFIB 1SEPA 3QUCA 3RU3A 3W9HA 1SZPA 3T7DA 1KI4A 1IATA 1EFHA 4ZP6A 3ZW8A 5ICGA 4TLAA 2VO1A 4JJ7A 4RA9B 4CTOA 1TVEA 5G3ZA 3CIOA 3JQAA 2KI5A 2EC2A 4R1TA 4EMSA 5GOZA 5AJ3F 5G0VA 1T0BA 1F0PA 1GXLA 3GLQA 3JZFA 4NLTA 1N56A 1N5OX 3GMGA 1I5RA 1DLOB 3HDQA 3DEZA 1D09A 1AH2A 4HF7A 3Q5GA 1QWSA 3Q8SB 1V4NA 4X4SA 4RORA 1IVSA 2Y1RI 3HDYA 2QWXA 4JXZA 4QM6A 1F6WA 2C2HA 1A1VA 2GHWA 2Z4PA 2WHXA 3NAGA 1JXOA 1P9LA 1KDNA 4K0RA 4NENA 4JQYA 2I4IA 3AH8A 2ACYA 1JF8A 5ERYA 2QIPA 1YB4A 2BVNA 1XL1A 4L78A 4EG5A 1KE2A 3IQWA 3VV3A 1NJ8A 1N5YB 3AT1B 3N3AC 3NI2A 1NU8A 1A77A 4K9RA 2ZBDA 4JBWA 2PQ0A 4S1OA 4M1QA 3NAIA 1JKFA 3TVTA 3K05A 5KG3A 4QVKA 1XRLA 4DTIA 3NBYC 3DV0B 2WSBA 1T9XA 5JW6A 3CU5A 5DLYA 2AF6A 1BXZA 4FP9A 1QP8A 1MO4A 1T6XA 5JCXA 1O97C 3IQHX 3TUPA 3EIXA 5FWYB 3NOCA 2IYFA 3B13B 3LOPA 2GETA 1FTRA 4QA9A 3KD2A 4J0KA 1JKIA 3WYEA 1XNQB 5FA6A 4D0LB 3TA1A 1D1QA 2HMVA 5B4TA 3KL2A 4C8NA 3IIMA 5IFKA 5JSUA 3NV9A 2BL4A 4MDEA 1SI9A 3RQIA 2VH7A 3A6ZA 3ILJA 1YJNS 4BAZA 4CG1A 3FNNA 4KACA 5E3JA 1COWA 3K0FA 3Q83A 1O8BA 1GLGA 3K17A 5LC1A 3BILA 3WYBA 3V6DA 4JKYA 3CR3C 5KG4A 4HNUA 2M3DA 2P6OA 4CQ1A 4QG3A 4KLAA 2VOOA 3LECA 2EJCA 1D6SA 2CJPA 2VBFA 2QVBA 4KE9A 4LY3A 1JIVA 4M8NE 4BNWA 2OELA 2GBGA 1CPYA 4OA8A 4CF7A 4ZPWR 4ZMMA 4A10A 5L4LA 2G0TA 3PNMA 3ZO7A 4BP8A 1G8KA 2HV8A 4QJBA 1E1QA 1WO8A 2JH3A 2Q5OA 1ECJA 4O4GA 2CXPA 2AFIE 4WKOA 1YASA 4NOJA 2I71A 1WC5A 4B85A 3OHSX 2B5OA 2QMOA 4KGVB 1P1KA 4U0KA 2YICA 4WIIA 1NPDA 2QQEA 4O25A 1SXHA 2ZRKA 4AQDA 1WB6A 5AKYA 1XR5A 2HGNA 1Q84A 4YB8A 2KN4A 2UU9F 1UP1A 2FPWA 2WMDA 1RBAA 1U9YA 4B6EA 3IC1A 1UWKA 3TQOA 4ES1A 2JLVA 4WL0A 2BFPA 3HF5A 3C3JA 2Z08A 1JQKA 1YNSA 1P1JA 4NARA 1R3DA 4XWOA 3JVVA 1IRXA 1KK3A 4F1KA 2O1WA 1SMKA 1F0NA 2O8CB 3CJSA 3RAPR 3DXYA 3D54A 3VVCA 3W04A 3FDZB 3LANA 4QYIB 1B0UA 2DXFA 2P8JA 1JWBB 3F3MA 3V8MA 2XNCA 4O02B 2F8TA 3DHXA 1QBKC 5IANA 2HSWA 1P7PA 2YWJA 3RADC 1FKPA 4LSGA 2Z09A 3LU1A 1JAZA 1FFHA 2W6MA 2ZWVA 4YCAA 4C5CA 2DULA 4NAUA 4R5PB 3SZUA 1IKYA 2FZVA 4C0SA 4BX3A 2BGKA 4LJ6A 3TW0A 2JIQA 3HX9A 2FJPA 2PKCA 5CM9C 1TZ2A 2JD1A 2XOXA 5CW2A 3WGQA 5IU6A 2FRXA 4DV3B 4ZRNA 3VPGA 4US1R 2NT3A 4W9NC 5IT4A 2EU8A 2FFHA 1R9GA 2D2EA 3QNUA 4NC9A 1TVKB 1OPIA 3FVRA 2AB0A 3FVYA 5B7PA 3EYAA 1B0VA 5ILQA 2HAFA 3GDWA 4E70A 2B1GA 2IE0A 3FKSA 4DMKA 1VA5A 2AHOA 3B7PA 1J0CA 2J6IA 1WY5A 4ZZ2A 1Q5VA 2PE8A 3MECA 1X4AA 3O9ZA 4ZOAA 3NTVA 2XGMA 5FPYA 1YV9A 3AQIA 1EZZA 1Q3TA 4R71A 4CZCA 5FOVA 4URWR 1S1WB 4GMGA 5JANA 1QHXA 5REQB 1YZ6A 2K7KA 4HNAA 1XA3A 4M88A 2XNDA 3LZDA 4YIKA 4DL7A 1H05A 5BYKA 1S10A 4KYVA 2O3UA 4CEHA 3P4UB 3E9CA 4CO0A 1F0KA 2W6IA 3F9CA 1KZYC 4W5JA 3G9TA 2KHZA 3O1IC 4GAEA 2XB2D 2ZI7A 4FS8A 3R0QA 2FG5A 1QQ6A 2EF1A 3ZNJ1 2YS6A 4TXMA 2X5XA 3AVWA 3ZWNA 2AXPA 3DNMA 4R01A 4ZVOA 3U61B 4I36A 3H1TA 3C6MA 1GIAA 4C7JA 4Y2VA 3W5ZA 4H7DA 3A4NA 5FR1A 5FL3A 1TTTA 1HARA 3UMGA 4WECA 2BFNA 3K92A 3SMVA 4YAEA 2PLAA 4WKGA 3V4FA 4DUPA 5AYVA 1R00A 2DY0A 1FW8A 3M2PA 3T8YA 3C41J 5AI8A 3TRJA 3FSJX 4M2LA 1E2DA 3ITEA 4E5SA 2VC2B 2DIUA 1ESCA 1W19A 5A3VA 2IUYA 1H1DA 2REOA 4UBKA 4D3GA 4K87A 1B70B 3FYTA 4AI6A 1SD2A 2Q5HA 5KCZA 3QATA 4A8JB 1TM2A 1S77D 5GVRA 3QF4A 4AJ4A 1WNTA 3QRWA 2W2MA 3ANMA 2B7BB 1BZYA 5NLLA 1IJKA 5I8PA 1WPXA 5SZJA 1GOTA 4QWBA 3U56A 3PXCX 1C3EA 2C2GA 3CEPB 1U8YA 3QQPA 3UA4A 4GOLD 1UEIA 3ZNOA 1Z8HA 2YTCA 1G17A 1QLWA 3UG6A 4C05A 5ECDA 1GEEA 4LRCA 1S3SA 3QPIA 2QM3A 3KELA 2ODEA 3MF4A 5HGXA 1E1LA 3FHLA 1M33A 2X41A 4YRBA 1U5BB 3V4VB 2MSCB 4IQXA 1PJSA 4Z7OB 3BB5A 3OXLA 3DEYX 4QXRA 4D44A 1ZLYA 1M8GA 1I5OB 1R7IA 4F3TA 3JSAA 4JV5F 2DIVA 3MEGB 4KH0A 1G7RA 2DBZA 3VZCA 3S55A 2O6HA 4R54A 4J2TA 3TEFA 3BDIA 1EKSA 3FNIA 3D3CJ 5DCWA 5T67A 3W2GA 1FJCA 4CRWB 1RJFA 5CITA 4ZOEA 3F5SA 2CDNA 2XYRA 5HJ7A 1MQSA 3VNQA 3W1WA 7MDHA 4XDDA 3JYQA 3DMTA 3QEJA 1ODLA 1FK8A 3A32A 5HG0A 3U6BA 3W34A 2ZJ4A 1MB0A 3L4EA 5CB8A 3RRHA 1TM7E 2DJ5A 2RIJA 1A9PA 1QO7A 1XMPA 5KNBD 1ZNYA 3G7UA 3KNAA 4CJXA 1FNXH 3PWSA 1NUUA 2Q5LA 4RBVA 5E4JA 5T7BA 3LOQA 4FGLA 4HNGA 4RY9A 3AD9C 2IBTA 1NQOA 4NLXA 2C5BA 2CLMB 5I42A 1WKBA 5E8JA 3ND7A 2ZBVA 4PWUA 4M5IA 3QUBA 3W2HA 4RHFA 3PTZA 5ANRB 3MTBA 5JE8A 4KOEC 2DTJA 1PGJA 5EP2A 1D2HA 2CPZA 2N4CA 3WRXC 5A03A 4X95A 4R9RA 4KQWA 2HGZA 1NBEB 4ZVPB 5AXLA 2QYTA 3DLPX 1F9EB 1U94A 3Q2OA 4MDYA 2Y1DA 3JAMU 1TQ8A 3UBTA 2XE7A 1ETHA 4HB2A 2XGJA 4P5EA 5DKFA 1OXKB 1Y98A 3N74A 4DUZF 3EB9A 3TLJA 1RLOA 1BGWA 2WFLB 4E5MA 1YFJA 2HNZB 2DBYA 4RUAA 1ZXLA 2R751 3BJEA 3PBKA 4U96A 5HVGA 1SV5A 1Q1KA 4DX8H 2XSZA 1PIWA 3K71B 3LWDA 3B89A 5ARCA 3JWIA 5KOYA 4LYDA 3UPUA 4CDMA 5IUJC 3M8ZA 3UTDA 3KLIA 4P6VF 1KEUA 3QGIA 3KB6A 1GCAA 2XNSA 3KMSA 5SYAA 5TPWA 1Z9BA 2W98A 3MTDA 2E5JA 2I80A 4M1KA 1M34B 2LP4Y 1QAYA 2Q8QA 4JVNA 2EERA 4PQGA 2JFYA 4LSMA 2REXB 5AW1A 5FPKA 2H8GA 1W9HA 1L6IA 3WA6A 3CCVS 3KPUA 4CUKA 2W2OA 3AY3A 4YGYA 1DC8A 4G01B 4ISBA 2GN4A 5AVXA 3FHJA 5BT9A 3U7QA 2VRBA 3DH0A 3VO8A 4TKTA 2IYXA 5K0EA 2P5TB 2HF9A 3I3OA 2J8AA 2QX6A 3U19A 2VYVA 2Y1FA 5DT2A 2N47A 3AL0C 1RU1A 2J5RA 1BH6A 2XKAA 3DUFA 4YECA 4FN4A 3D6NB 4HLUA 1GLVA 2CL0X 5FWXA 3JVEA 3WA7A 1RS0A 2WFZA 3QZUA 4KXMA 5CCLA 3R0ZA 4M5LA 3NBXX 1WPRA 5G4KB 4H6XA 5IVDA 1MKYA 2IA0A 3MM7A 5LQJA 4TM7A 5D3ZA 3TQSA 1Q7EA 2P9YA 4EG4A 5DPMA 3T7EA 3CG4A 2G25A 2I4TA 3DOOA 1A8SA 2VK4A 4RF5A 2MSLA 3V42A 3KKNA 4Y7DA 4URHA 4C6AA 4HDRA 1R4AA 3QE9Y 2ZWAA 1RAHA 2JC3A 3NRJA 2HQBA 3QBDA 1GUYA 3DBHB 5AHWA 4OJGA 3L43A 3OE7D 3ENVA 2JPDA 1BXRB 2D1YA 3KE9A 5E7QA 4HXFB 5CNKA 3P2KA 4JI4J 2AV6A 1ZK1A 2ENWA 1WC0A 4LHZA 4KIFA 2ILZA 2ZE2B 3MTJA 2V8GA 1UPMB 1RXIA 2BMAA 5D7NA 2HPZA 3WFZA 5IG2A 3AYXB 4OFWA 2EHJA 5E3PA 1V5GA 2QEXS 1P8GA 3GFVA 3GJTB 2U1AA 5JMTA 3CISA 4CCHA 3I5BA 2IFXA 4N7MA 2Q99A 3QXGA 3WZMA 3IWNC 4B33A 4IHKA 1EFPA 2I2XB 4NF2A 5JH7A 2HWHA 3GEGA 1RHMA 2IRWA 4QREA 3NXSA 4DYVA 4IIEA 3KP1A 3HDJA 1UCNA 3O8QA 4WESB 2WJAA 3L09A 4Z99A 1W4LA 1T1IA 5IM4F 3N7UA 2I1RA 3EXFB 4ZCLA 3GMSA 4R3NA 3FOBA 4W1QA 1IBMB 3UV3A 5JVDB 2F7VA 5FJIA 3O26A 4NZMA 4CQJA 1WZCA 2HVIA 3KLBA 2WOMA 5I48A 3PE3A 2PZJA 5KFRA 4BMZA 1FQWA 1LWFB 1SH0A 3UY4A 3KOZA 2WIGA 3UCGA 1FMLA 1QM5A 2IEBA 5EIHA 4W5WA 2DR2A 1WNEA 1UOQA 2OAGA 4TKLA 4NI5A 2WDPA 3IFEA 1NM2A 2KFNA 1DIAA 1ZPVA 1MFPA 4UHDA 5K2MA 4UASA 4MCIA 1V4VA 3CRRA 2NO0A 5C46F 3W7BA 2D8MA 3PIPQ 2WTAA 1OQ6A 1IQPA 2GZAA 2ZDPA 4DAEA 4Q18A 3WGVA 1EZ1A 1QYCA 2YWEA 4XUCA 1MO6A 4XB2A 1N78A 2JIBA 3ZTWA 2CVQA 1ST2A 1KKUA 4WA7A 4B8YA 4LJSA 3ZEIA 1XU7A 1HNIB 2CE2X 2PH1A 5E1OA 4CIAA 2PI4A 4ICIA 4J16C 5D7BA 2DH9A 1VZ3A 5ECWA 2E5HA 4I4IA 3G96A 1OX5A 4NFSA 2EZ8A 4KPUA 3UK1A 2Q79A 1W0JA 2V4UA 3VSAA 1E5XA 3P6YC 1EJ0A 2GD2A 4WK2B 2FDXA 1RXUA 5EMMA 2CLIB 3HDVA 3UC9A 3BWEA 2RK6A 3U60B 5K0FA 2M2IA 4R9SA 4DUGD 2WTNA 2EYQA 5CT4A 4MUFA 1QH9A 3TAPA 1UKVY 2XMAA 4J9RA 2Y71A 3BD8A 3DJFA 4KQZA 2Q0HA 3F7MA 1A2KC 3KWFA 4UVIA 2QE7A 4KXLA 3TQTA 3MGCA 1GAWA 2OFWA 1ZR4A 2PX0A 1X0XA 3RVSA 1C0UB 4X60A 4EG3A 1YRAA 1ECGA 1H0HA 2CLEB 4C06A 4I4TA 2O8BB 3B6ZA 2BBSA 2OPRB 4QJVA 1WDKA 4AWBA 1WXDA 1UPTA 4CTMA 4MWOA 4OLJA 3AX6A 3PQCA 3O8CA 4IRKA 2I2YA 1RIFA 4TROA 4H15A 2DK2A 1TO1E 2YWKA 4J6EA 4KGZA 2WAXA 5CBKA 1RTTA 3D2AA 4XJSA 1NYRA 1UINA 3RYHA 3C4VA 1VYVA 1O9BA 2PFKA 1BMQA 5B2FA 4UCXA 1P0PA 1LS6A 2ZRDA 3RHSA 4HKTA 3X3HA 3SMQA 3QNWB 1HBMB 1ZJ4A 3UMFA 4EF6A 1QVVA 4WY8A 5CVDA 2N7CA 3J81A 2H06A 3KSRA 1GCOA 4BUJA 2J07A 4NICA 3TZZA 3PF8A 4MO9A 1AGNA 4LBWA 3HKCA 4IKPA 3VDNB 3C5EA 1XQXA 3KSMA 4LKOA 1ZQ9A 3C6QA 2NYRA 1NM5A 2E37A 3N2ZB 1EDDA 4RGYA 1OB2A 2H48A 3EIFA 2YKAA 1RLMA 3AD8C 2Q6TA 1EAYA 2HOQA 4RLHA 1K6JA 2NCKL 4M76B 5AJZA 5A02A 2W7AA 3V8EA 4WYLA 1TYCA 3IAM9 4IIBA 3FPFA 2JAPA 2DRAA 1UK8A 2V8VA 1YJ5A 2MMCA 2DQ4A 5D15A 2R9VA 2VT3A 3HB0A 4U95A 4JI3J 4L51A 4YAGA 2D3UA 2OVFA 5BQ3A 3P26A 3UW3A 4ZYYA 4MX8A 3R8CA 4LJMA 4IMPA 2BR4A 5EGSA 4MA5A 1O5JA 1KBZA 1OO0B 2J7UA 3ZVNA 4X20B 2IYVA 3L95X 4JI8J 3AF0A 3IBFB 2IZ0A 5DX1A 2ZYDA 1E2BA 2WWVD 1HYQA 4B9MA 1II9A 3DI6A 4X45A 4PR6A 5DBFA 3EASA 1ZA2A 1H4VB 3M34A 3NH9A 4PQEA 2PZAA 3LYLA 2BLLA 4YAIA 2X9NA 2Y27A 3QE2A 1TK8A 4NE7A 3V1YA 2QTGA 2IBMA 1XLWA 2Q66A 1FP7A 5D85A 3CH7A 3KTAA 1M5UA 5FYQA 1A82A 1NO8A 1WMEA 2W5UA 3GBSA 5I5GA 1RC0A 3TSWA 2FX2A 2NTJA 3OLZA 3PXUA 1KYWA 1Y6RA 2V7EA 4OYLA 1NP6A 3HVTB 4KP7A 4O2AB 1KI7A 1YJ9S 3EPIA 2IKSA 4H3KB 3NNHA 1U8WA 3WVNA 1A50B 3D6MB 3EVNA 1HQYE 1CRPA 5ESXA 3CVVA 4KO0A 1AQJA 4H4MA 1CQJB 2CHUA 4Y6LA 2QLTA 4DMHA 4BGIA 3IPXA 4JI4B 2OB2A 2X1FA 4RTLA 3QFTA 3E7XA 4PRYA 4DEZA 1A7GE 2XGPA 5KFAA 1QGYA 3EXG1 3GD5A 2Q4BA 1EVKA 1D4OA 5HBGA 3VYVA 3SEZA 3ESCA 1LQTA 5EHHA 1Q0ZA 3B4DA 2RG1A 3GB0A 1K8ZB 5KNBH 5CEJA 4ZP9A 4DE5A 3DZIA 5JRDS 4CL0A 1R3UA 4E7PA 1G41A 3I9LA 2NU7B 5LZ9A 4JASB 2HQ1A 2VDWB 4G09A 1M73E 1UDWA 4DQXA 4IDAA 3QVMA 2GZ1A 2WG2A 5IH3A 2J4CA 1DC5A 2C99A 3EUFA 3LFTA 2VR1A 4M7OA 3PR1A 4DUYB 3K53A 4W7IA 3WL8A 4G07A 4L0MA 4NQRA 4NL4H 4R6WA 3HJHA 1T0JB 3MBIA 2R2SA 5PGMA 4PQYA 1HYBA 4B48A 2FY8A 4OAPA 2Z6VA 1DL5A 4MQBA 1LPPA 2FVYA 3T5AA 4C5BA 2BCJQ 3OZEA 1DADA 4IDQA 2EG5A 2QXYA 5JYCA 4FWBA 2ZDQA 5FTWA 1C1HA 1FNDA 1TX4B 3T5KA 4DF4A 2VKTA 3ZDXB 3SIPA 3NTXA 4BNYA 2LA6A 2G1JA 3U7EB 4KMOA 4YWJA 3G2QA 1N88A 2AYEA 5EHNA 4LKRA 4I81A 2HBYB 2K87A 3SJCA 5EINA 1V6AA 1PR0A 4F1WA 3GPBA 5LLDA 3U9TA 1KIAA 1LY1A 2QR2A 2D7SA 2YIJA 2HG4A 2Y8EA 3AXMA 1RWVA 1ZDMA 4QICA 1Q15A 2KYZA 1REQA 2OZPA 3P5TL 4MIEA 3C8HA 2ERRA 4Q7JB 5K6AC 3NS7A 1CQMA 1WMDA 2R66A 2WZ1A 2B4AA 4ACAA 2NZ2A 4A26A 4GQBA 1Q7GA 1QCZA 2JGDA 4H4KA 3KT8A 4E2FB 2MHCA 1HT2E 1UT6A 3EZXA 1L2TA 2DGXA 5B53A 1AS3A 2ZGVA 3QBEA 5ITSA 1PNVA 4CR7A 3HP1A 4F85A 1EIYB 1UBHS 3L2OB 1FK9A 3CBGA 5CGZA 3USCS 3ICCA 2FRDC 1PKXA 2QZ4A 3LGMA 1NU6A 1DXQA 7FDRA 4M99A 1VRUB 4B6PA 4BO3A 4ID3A 1MH1A 4E03A 2FJVA 3SHVA 4KFSA 5KOXA 3EUEA 2UXBF 1PLJA 5HDBB 2NO1A 1GARA 4IXNA 4MRRA 3E7DA 3EGXB 5E4FA 3RS9A 3STVA 5CLQA 1Y5NB 4LCJA 1K6MA 3L0CA 1MG7A 1Y7PA 1X1SA 4XM1A 1PYDA 3TLGB 1H0SA 4DFJA 5B37A 2EWMA 4KWTA 2PRIA 2J3JA 2F3JA 2WF9A 3NOGA 3FI9A 4CT4B 1SU7A 4AAYA 4FC7A 1JJ4A 3RS8A 1ZZEA 2PUEA 1NNEA 4ZCMA 3EXG2 3LBNA 2LFVA 4MS4B 2ZB2A 4BX8A 2YOFA 3H5TA 3CW2C 3NMRA 4UOEA 4B3TF 3ZWKA 4D2IA 3ZWAA 5U47A 2X9GA 1H1LB 5ECGC 4PBSA 3J80Y 1MWZA 3KHGA 1QCDA 2GHPA 5JI2E 4L08A 5FBLB 3PL5A 4BVAA 3RFFA 1SQGA 1YHZA 2JHGA 2XOEA 5ELMA 5L8RC 1Z5ZA 6REQA 1IFXA 5F2NA 2CMHA 4M37A 3SZ3A 3C48A 1IHXA 3JWHA 2SXLA 3IP9A 1JI0A 3EQ6A 5FNZA 1ZAKA 1GPDG 5G4DA 1RVDA 1W93A 1GPAA 2YWCA 3IH5A 4IJ6A 3PGA1 1WXEA 5AJ3J 4BO9A 2PL9A 2D3OR 1GTRA 1VJTA 2ODNA 1HZZC 1VBMA 3D2CA 3C14A 3AU9A 4JI3B 4RJIA 3NS6A 1AQUA 1IZZA 3HQ4O 4JL6A 3TJZA 4IJMA 2NG1A 1VQLS 3ELDA 3QRQA 4LF5J 3HM2A 4MCHA 3DN9A 1B15A 4EU0A 5BT8A 1V45E 2MWMA 1XDWA 5AICA 1XTQA 1V16B 2RKIA 4DIUA 1EH5A 3FPCA 3M83A 1CLUA 2FTRA 1AN9A 4OBWA 3A25A 3OVAA 5DX0A 4ZA2A 3UG7A 4QUAA 1JXLA 3QY0A 2FLLA 4YRNA 3OMXA 3PLNA 1A8IA 3SC6A 3FX2A 2DUUA 4TT3A 4HZIA 1SK9A 4JEHA 3DG9A 3P9RA 5DNWA 1CUXA 1HY3A 3QFHA 1YR6A 5IVHA 3PT9A 3DAPA 3IQIX 2R3SA 4BP9A 3BL5A 1JA9A 1NYTA 5E6UB 1M1ZA 3L8YA 4GX0A 4CW7A 4Q3LA 4DWIA 4UNRA 1HBUA 2POKA 1KSFX 5AFSA 1XROA 1JKMA 3KTDA 3U0VA 3TJRA 3DLHA 2H7XA 5KYKA 1KI3A 4GRIA 3OFHA 3U3RA 3M81A 1GTVA 2JD0A 1MB3A 4MIAA 1TUWA 4AZTA 1JZQA 5IMBA 4ADSG 1QGZA 2RU3A 3V4LA 2V68A 3B70A 3FD8A 2W2QP 1VIVA 3W5BA 2O2YA 1XA0A 4EJFA 2VQ6A 2AFHB 3L06A 4B3GA 2WE8A 3TI0A 5EFOA 5J2PA 1I6JA 2CUKA 2X3FA 4ZAYA 1YJTA 5E6SA 3RK0A 4D97A 4TV8B 1IJFA 1AGYA 1T36B 3BGWA 3DEAA 4ERDA 3SSQA 3B3FA 2NLWA 4JDUA 3KOAA 2O3JA 2V4JB 5K0CA 2VDQB 3ZTQA 4K1LA 5K8NA 1LW7A 4EYHB 5T8KC 4YRTA 1UIMA 4YMVA 4A8JC 2Q43A 2W6CX 2C1EB 2G8LA 4MMYB 3SR4A 4HQ0A 1FLVA 4TXLA 1F0YA 1Z4QA 2DQZA 2Z9BA 1HMVA 2CD7A 2ODQA 1RTHA 4HL9A 2NXWA 4E5UA 4BNLA 3L7OA 1Y4UA 5DK4A 2X0DA 1C3XA 2WABA 4EPVA 2Q6CA 4C6SA 4GXRA 2UU9J 4Q8FA 1C9KA 4ZYWA 4LG1A 4CKCA 1SD5A 5KSOA 3ZVLA 4FDVA 4DR3J 2ECPA 3WFIA 3H5YA 3MCWA 2JFDA 4LQ9A 2EJVA 1WTAA 2DEJA 1ONOA 2QZSA 2ACWA 2JIMA 2XXAA 4WVFA 3UUEA 4DMGA 1FRMA 4L27A 1WXIA 4TLMB 5DDPC 5FTMA 5FPQA 4UW9A 3R6TA 2XQGA 1YRLA 3C7CB 3HG7A 2YPZA 3OLVA 3R5SA 4YUWA 2FYTA 5I7AA 4NBVA 3LT4A 3T3PB 4R84A 5EEGA 3QU4A 1SKWA 3MWEB 2B1IA 4CCAA 3EFOA 3WDOA 2HWWA 3OM8A 1HIYA 4XGQA 1IU9A 3HCNA 3ISTA 1WVGA 3P5SA 1S9FA 1OYWA 4XFDA 2K3KA 2ZJOA 4OHRA 2JHEA 2DBVO 3VKFA 2GBCA 3ZBQA 2XADA 4UEKA 1FU7A 5AKKA 3LY5A 3E6AA 1GGMA 1YCFA 1RT7B 2DR8A 1GQRA 4E2ZA 3GJRB 1KFCB 2IDJA 4HPJB 2XUHA 1SBNE 3IVXA 1MU2A 2LMIA 4EW2A 4RW8A 3V4SA 4DBVO 4TTPA 4H7PA 3HWSA 1NR7A 2PXHA 4XVQA 1GGVA 4X3PA 3PHHA 1CB0A 4KV9A 5J58A 5EERA 2JHCA 3FGZA 3U4QB 2VDOB 3FH0A 2Y0PA 3HLUA 2NXEA 1VE1A 4LY0A 2BPOA 4RLQA 2Q27A 3G02A 2ZSAA 1VHDA 3W0LB 5EIXA 5IPFA 2PNJA 1RSZA 2XVXA 1NXWA 1KMMA 3BB3A 3R7SA 1QVGR 3HCWA 3EZGA 4P0TA 4OHWA 2GMHA 4F60A 1GPUA 4U5QA 3DQPA 4YV1A 2YCLA 4BFCA 1H22A 5TRTA 1JLFB 1WSVA 4POOA 5CHYA 1I01A 1CJKB 3E35A 2J0UA 1JG6A 1RTIB 1WXGA 2GCEA 4R8VA 3NWGA 1UWCA 2Q5EA 1F2TB 1XVVA 1A2QA 3PPXA 3NLLA 2RJOA 2GIQA 2J67A 2BE2B 1N2ZA 5CAEA 3FTPA 4UU0A 1XYGA 2DYKA 5A2QA 2KM1A 5K8TA 5HN0A 4EO4A 3FN4A 2DXEA 4EA9A 1QB8A 2GPTA 2BKLA 4ZDNA 4OAQA 4RGQA 1C3OA 1ZVMA 4GM0A 5JAQA 3PD7A 5KVCA 4AN1A 2OCDA 3RC9A 3AB8A 5DSTA 2AUMA 3MWGA 4RFVA 3E15A 3V5RA 3QJYA 2CLOB 3CXUA 4RCVA 1B7FA 1OXVA 4COOA 5CYMA 5HP1A 3LPLA 1GSIA 4L76A 3R5XA 3H2BA 1KDVA 2EW9A 3JVIA 1CDEA 4YHHF 1VYAA 4HDMB 1I3OB 1XNJA 3T5LA 4M89A 3VU9A 5IX8A 1K9MT 4D56A 1H6CA 4LSLA 2DGDA 4GPTA 4DG5A 5THQA 3KT6A 4FR2A 5LZ7A 5HW0A 4OH1A 5FIUA 4HCJA 1QF9A 4BJ1A 4MR8A 4A8WA 4R7TA 4IP0A 1ZTWA 2XDWA 2ZJ5A 5J2QB 1BS1A 4B5LA 2FMHA 1PG5B 2B6AB 2LQ8A 1OA0A 4ZPJA 2JK1A 4MI3A 1NW9B 3FG9A 4UCFA 1SKUA 5L3ZA 4IILA 3FETA 4FF2A 4X6XA 4C11B 1QYDA 3TGWA 5CFRA 3CF0A 1O4VA 5JG7A 1RA7A 5SYMA 2CJXA 3WLKX 1U7TA 4NCXA 4WI1A 3MB5A 2HRYA 3AWIA 5LPNA 4PAQA 3MF5A 2C3MA 1O08A 1SVSA 1IE3A 3G5MA 5AKGA 3S81A 1IY8A 4BTEA 2WEKA 3AQOA 1UT5A 3QVGB 2BFBB 4PGGA 4QO8A 1EJ7L 3DOJA 5CPFA 1ZU4A 4TKMA 1XKXA 4XPZA 5CZXA 2DH6A 2F59A 1UBLS 4INAA 4TSRA 5JC8A 1URPA 1M1UA 4DDVA 1VLHA 3VGUA 1PFWA 3R7AA 1FQKA 2AOWA 3EVEA 2OPSA 4F4DA 4N7JA 1LV7A 4KIAA 3UNXA 4RFSB 1YACA 5F8HA 4V3CA 1GNKA 2O4CA 4ZQGA 4B6FA 2DPMA 2HGMA 2VS1A 2FJAB 4AWAA 4QYWA 1HK7A 3MWBA 1DBSA 3L84A 1GNRA 4QBFA 1LH0A 4LVNA 1PC5A 2AZ3A 1EP9A 2CMDA 4WFQA 2QTFA 4KMMA 2YQ4A 1XELA 2ZKIA 1PFQA 3BKTA 4I3HA 4ITVA 2Q1WA 3G82B 5FEUA 4EI9A 3DLKB 3AJRA 3ZTTA 1VCIA 2FWPA 3VZRA 3D4PA 4L6AA 2FWMX 2OCYC 2Y1EA 1QR2A 1GTHA 2EP8A 3ZE6A 3SKYA 3E3XA 2AF3C 3E03A 4P4UA 1QVFR 1CR1A 2VZ0A 4E4TA 5ELXA 2JL9A 5EZYF 4Y6PA 4OZ5A 3TR5A 1YZLA 1ADYA 2ZH2A 3U7IA 4KQEA 1Q0LA 4BUCA 3ESDA 4XQ0A 1MN9A 1LSUA 1E9BA 1W48A 2WVJA 1S48A 4U7JA 4BQOA 4DIFA 1K47A 2J0VA 5LKRA 1Z12A 2UU9B 2RNEA 2VUIB 5DHFA 2DAPA 3T7SA 4NLVA 4BRZA 1F9AA 2RK3A 4B8WA 1V3ZA 1WZIA 5F7ZA 2NZVG 1K6EA 1UVKA 2HADA 4A6PA 3SYRA 2E5IA 5B30A 3R7BA 1O58A 5JD3A 4OQ4A 3QMVA 5EESA 2F55A 2GHIA 4L72B 2GQCA 2QZ8A 1D7AA 5CDFE 2COUA 3PFGA 3SXPA 1U8TA 4KK4A 2JZCA 1YBUA 3G0GA 2FLOA 1S0UA 2XXJA 2ZU6A 3MBOA 4P4SA 2YNFA 2EBUA 1SJQA 3ROMA 3NO4A 3OD1A 3TBKA 4DJDC 4WN9A 2HH9A 1RHRB 1MMFB 3O8WA 2HHHF 1ZCFA 3OJFA 3OQIA 3KKQA 2JOQA 3OZRA 2YX1A 2ZE5A 3ZWYA 1HFEL 3D5MA 1M2OB 1HPZB 3UXHA 3EBOA 3R5KA 3THYB 3DVAB 4EBBA 4HH1A 2XMDA 2HU5A 1VSVA 5JJKA 1G63A 2DD8S 1Q1BA 3FBGA 2GXUA 1TM4E 2DKOB 1VXOA 1XNGA 5JCJA 3W6OA 2DNNA 3I9ZA 3OR1B 3PJGA 4L9RA 4Q3BA 4GM4A 4R31A 3VH1A 1KDOA 2O8EB 1XTSA 1QDUB 1CP3A 4YHBA 2OFHX 3QEMB 4HQRA 1M54A 1SU6A 4QKQA 2B2XA 5TMDA 2R2RA 3G8DA 1MO5A 5MAOA 3M5PA 3LY9A 5G0WA 4C8LA 3DM2A 1LK5A 2GQ2A 4YB6A 1PWYE 5G0RA 2VN8A 1ZRSA 4BZXA 2C2EA 2EFPA 3EGDA 2MLXA 2I3BA 2IQIA 3TEHB 4PYAA 4UVDA 2WJIA 4O0NA 1XVTA 1YI8A 1VQ5S 2H4YA 2UYCA 2IEIA 1DBWA 3LP2B 3K8QA 1KOGA 4GOXA 1X7XB 4M87A 3D5EA 1B0ZA 4NLDA 2JFUA 3GLFA 2MR5A 1G2PA 1Y1PA 3D7RA 2E1MC 2FE1A 3HKEA 4F96A 1ZGHA 1P1IA 3DC7A 1Z2OX 2XWBF 3HCCA 4XDGA 3HNPA 1VC0A 5ALZA 2QG9B 4LSZB 1P61B 3PRYA 4G4SP 4UZSA 2IW1A 5B3KA 5BWCA 3EW7A 4X4OA 4DSOA 3FFWA 4MQ4A 2CZ4A 2NW6A 1N6LA 2FD2A 4ANEA 1YS9A 1WVMA 4TQAA 3H86A 2D8AA 2NSDA 2VV5A 2FX3A 3FWYA 5K3DA 1UP4A 1NUEA 3KG4A 1TKXB 2FHSA 1T3SA 3FCYA 3AC0A 4AFFA 1U3GA 3KYCB 4KR3A 1PBAA 4URFA 1THTA 3LXRA 1WX1A 4LEIA 2XSJB 4LHSA 2LXFA 5AJHA 3OZXA 2NGRA 1QIJA 3BPSP 2V4MA 1QVWA 1KTQA 1X7VA 3UI3A 3NNCA 5KWJA 4ERXA 4C3KA 4S1PA 5FOSA 3VPDA 4FB5A 2PKXA 1YBVA 3DAYA 1E5QA 4HGYA 4URUR 3NWBA 4JDPA 3ILOA 2DNHA 2XA9A 3UK6A 1W49A 1KR2A 1IXYA 2ZQ5A 2ADBA 5AOBA 1AGPA 3EXIA 3F2VA 4A2QA 1NVBA 3IBCA 1M2VB 3GIMA 2DQSA 4HAXA 1G6OA 7GPBA 3A06A 3LA8A 3GB9A 4CMJA 2OQ2A 2RMKA 4MVJA 3DE3X 3JQDA 3SI8A 1SC3B 2WAAA 3O4RA 2G80A 5J2TA 1L4KA 1GD1O 5FHQA 1ENOA 4UOHA 2OZLA 1U1OA 4Q9IA 1UBOS 2E4YA 4O4JF 1R6UA 4MV8A 4R9VA 2EW8A 5EPEA 2F8SA 1D0VA 4UUMA 1HOXA 5GM1A 2Y0BA 2C9OA 3TUJC 4MTLA 5MGBA 2Q1YA 3AB2B 3U7RA 4K3UA 4YMTA 4JV5B 4MW2A 4K2JA 3C8DA 2EKDA 5BN3B 4XFJA 2AA3A 4K81B 4DA7A 4IUFA 3DL7A 2FW6A 1NOIA 3A1UA 4LE0A 5JS8A 1OZFA 1KHWA 3GNSA 4EQZA 5BR8F 5FTNA 2JD2A 4ZVGA 3H3JA 1P8JA 2AEEA 3COPA 5FF9A 3M2UB 2AMFA 4JLMA 3B3GA 4FVCA 1PSDA 1JSCA 2YZ2A 4YK7A 4WFNQ 3NOOA 4RA6B 5B36A 1U98A 4QTUB 3HXKA 3UN3A 3W2VB 5T64A 1EFVB 4RMGA 3IAAA 3IBSA 5FPPA 3CMES 2MQOA 2ZAMA 5SY6A 5BVHA 4J75A 5YASA 1Z7BA 4ZI7A 2I5JB 4ZICA 2F1KA 1G20B 2CJYB 1RYEA 2ASYA 1Z34A 3PENA 5ETVA 3IIJA 3CE6A 4AN0A 2ZUCA 4QBTA 2B3TA 3HKBB 1PZXA 4BATA 3WS7A 5KUTA 3HB4X 4PPZA 1XQWA 4X6UA 3RR2A 2HPHA 4B32A 1YS1X 1GH8A 2NZ4A 1XTIA 3KLGA 2WG0A 3LZCA 1BXGA 2I65A 1QOZA 4TZ0A 3J81j 1HBJA 1KRPA 2QD3A 4U2BA 5KOHB 2Z8XA 2BUAA 4N54A 4QUJA 1BEUB 1E4EB 3LT0A 2H0RA 5EP4A 4IFVA 4GO7X 1W0KA 3GOQA 4CFZA 1MHPA 3ZE2B 4DL6A 2HSDA 1WDWB 3O3LA 1M1KT 4DLZA 5CTJA 4DRYA 3EDYA 1V1RA 1Z2CA 5GGXA 4DUZB 1IN0A 1Y9EA 4IX9A 2NSJA 2ESRA 4NESA 1EGHA 1WC1A 2FEKA 1R9JA 2WILA 3KEMA 1P9NA 2L9DA 2DGTA 1D1SA 4Q03A 1QHIA 2EDCA 3MD9A 3OWHA 3RF7A 3V1KA 4I6JA 5J2UA 1U3WA 2R8ZA 4OLOA 2VKQA 2FFJA 3KUUA 2RD2A 3O03A 2IHTA 5HQMA 3NDRA 3GILA 2FVRA 3M8WA 4O33A 5KTNA 2Y0SD 3OQNA 4B83A 3MURP 2IIVA 1I7SB 3GLIB 1TCCA 4AKTA 1SCUA 2GCNA 2DFVA 4PYRA 5IN4A 3SJBA 2YFHA 2ZROA 3GRYA 2AN3A 3NR2A 4CT5A 1Z7EA 5B7NA 3NTRA 1J5PA 4W9RA 3PQ6A 1Q1AA 1SO8A 5FWNA 3WQBA 3EC2A 1VSQA 1R66A 3FFTA 3EYWA 3G2LA 4RWEA 4A4JA 1OA1A 1MV8A 3IP3A 1FYXA 2J31A 1P91A 1Q7RA 3TG2A 1JB1A 4OV1A 2QA4S 3V8BA 2EPIA 2QTZA 4KSYA 4DCTA 3MMBB 2PK3A 4WCFC 5BUZA 2VDUE 4C7MA 2JLSA 1ZINA 3JARB 2IS1A 3A2MA 4HTFA 3KU4A 1JE1A 2GA7A 1P1TA 2OC4A 1GDHA 2F3RA 1XQVA 3TZXA 1RYZA 2HMIB 1G20E 2YKMA 3OC0A 4ZA1A 4JLKA 2LCFA 1OSDA 3S5JA 2Q6IA 4AJHA 2VATA 4M0MA 5JROA 1TRHA 5AE2A 2ZJ0A 4WASA 1Z2LA 4DNQA 3UWMA 1BJTA 1P9OA 1R5JA 3MHPA 2YY5A 2GZSA 1CJTA 2GMLA 3HE3A 2E6UX 3COSA 4CTJA 2LDBA 1NUAA 3IDOA 2V7UA 1PNQA 3OT1B 3QLHA 3LTEA 2ILYA 4H7EA 2HT6A 2NPOA 2VPYA 5FBQB 3KEQA 5HHTA 3W1EA 1IOZA 2F00A 3I0MA 3EF1A 1ZI8A 1GV1A 1QAXA 1W35A 1XPRA 3WLHA 3OOWA 2QTWA 2I3DA 4ENOA 4RW6A 1IBMJ 1F5SA 5I4BA 5I45A 3RB0A 3CBQA 4YMLA 2Q46A 2I6WA 1YIJS 1KSJA 4J1TA 4QNMA 4B3DA 2R8GA 4K6KA 3CLHA 1Z0JA 3EEBA 1GM5A 1B1CA 5D1HA 9ATCA 1FEZA 1K3UB 2HNKA 2FMFA 1N32F 4WLEA 3FLMA 1CEYA 3KJQA 2ORVA 4ZRDA 2ATCB 2OTLS 4X5OA 2IYTA 5MLCV 4P86A 1V43A 3JVUA 2QSWA 3W2WA 1SG9A 4BMNA 1T3GA 2AC7A 1D3WA 4M1EA 4FW8A 1Y4ZB 1ZCAA 1QH1B 5LR6A 4Q3AA 3HUUA 2O8FB 1E2HA 3MS7A 4A36A 3FE2A 2XY4A 1L4BA 2P6MA 1V9OA 3UVJA 3W64A 3I01A 4MGKR 3GLIE 5T41A 4RZ3A 2OQIA 3ZCXA 3CLVA 2R6R1 1P39A 2YHUA 3GBPA 2C9DA 2PS1A 5KFLA 4HZGA 4ERNA 4EDFA 2V34A 1B76A 3W7AA 4Q16A 4MH8A 3HB5X 5CCEA 5KOJB 4N9QA 5AW7A 1O0CA 4HX2A 3K20A 2UUBF 3V46A 4FI3F 1NVXQ 1NQTA 5JSHA 2J3MA 5KSYA 3ETCA 4C7XA 5CFQA 1J0DA 1UKUA 2QY9A 3MEEB 3E01A 1M7BA 3DFFA 3IURA 3BO3A 1KJ8A 4ENVA 3N8GA 4PNHA 3TIFA 5KSWB 2V45A 5CFPA 4ZS6A 2ODBA 1CUUA 4P71A 2JF0A 1QU3A 4WXWA 3GLJA 1EUZA 1WC3A 2XOKA 3BCSA 4TSKA 4WKNA 3BFVA 4OX9Y 3DAHA 3O7MA 5ITHA 3QXSA 1ATZA 1ACLA 5JYDA 3WMRA 2RGRA 1DLIA 3FDXA 3OPYB 2X19A 4IUDS 3UOGA 5I7OA 1FSZA 3PGVA 1OJ4A 4MKBA 4RJLA 4E1VA 3FJ2A 3E23A 5F9NA 3ETMA 2R7NA 3NEKA 1GTL1 2E4AA 2JBWA 1HFJA 421PA 2KVQE 4M5HA 1E1NA 3H5LA 4KBYA 2R9LA 2LD4A 1RKXA 3IKVA 4ZHQA 2H3EA 4IXDA 2GMWA 3HI4A 2JRLA 4U7DA 2Z0GA 5ETLA 1M8JA 3KVRA 4H2DA 1RNLA 1J0XO 2H0AA 3NAMA 5LT5A 3WLSA 2SICE 4XO0A 3PVCA 1N77A 3AUTA 3ITDA 1D1TA 1S97A 5C42B 3DCAA 3TCXB 1Q12A 1V8FA 2FHPA 2Q1SA 4USJC 2AD1A 4MMXB 2A0YA 4ZZ0A 3NVMB 2EKZA 2UXBJ 4M0UA 4E1BA 3UK7A 4BN4A 2CYAA 2W7PA 1VG1A 3TA0A 1N0HA 2OPBA 1YL7A 1WEKA 3R9IA 3NATA 2RS8A 3KLEA 2DX7A 1MABB 1ZJWA 1A8UA 3P32A 2X6TA 1R4NB 2RHBA 2BANB 3LIPA 4AB1A 4HQNA 1KZGB 3FJOA 4JQSA 3Q8LA 2D7CA 2VC0A 2QAGA 1LF0A 4GPAA 3I9V9 5DM1A 5IBRA 5LCXA 1DVRA 5CVJA 2NU9A 3E5RA 5HK9A 1ZOOA 5HQ8A 2Q5FA 5CT9A 2EVZA 1D5CA 5HJYA 1QTMA 4FSXA 1YVDA 2B8EA 1SM4A 3V4PB 4B3TJ 4AJ2A 3IV9A 5A9SA 2BBWA 3S29A 5HFJA 2HNYA 3S44A 3IFSA 1L7OA 1KO5A 4UUNA 1ZMRA 2K7FA 2C7RA 2WJWA 3OPNA 4LMRA 3SCIE 5FDLB 4D99A 1JPNA 2J8ZA 1OLXB 4P7BA 3UD3P 2HO4A 1Q86T 4LQLA 5HKBA 3EFBA 3WI7A 4MGZR 4IHQA 2E29A 1Y4SA 1TAGA 1CJBA 3MMJA 4JI2F 1A9RA 4JVMA 3KHKA 4XYMA 3ICOA 3L1JA 2P67A 5CDSA 4CGZA 5KG7A 3IPRA 5JADA 3CJKB 1S2NA 3PDUA 3QENA 3A26A 3PNIA 2YW9A 2PMWB 1W52X 4NAVA 1RAGA 4IRDA 4YUZA 3SFUA 1WB5A 2PD1A 1URRA 2QJFA 4EKIA 3RVQA 2XGSA 1MG5A 1C0LA 1VPEA 4WNYA 4DG9A 1JEDA 2G70A 3H42B 4D42A 2R5WA 1OI3A 3MINA 4A0GA 4XQ9A 2XZTB 3PV0A 1IWBB 2IVZA 1YZKA 3TUIC 3BD7A 1QQ7A 3B53X 4P6QA 1BOOA 3G9UA 4JROA 4K9SA 4KQKA 5EWLA 1ND6A 4DQUA 3EGCA 5WRFA 1SKBA 2DZDA 2A9KA 2JI8A 4J3FA 2W6PA 3PTWA 3AVXA 1CJKC 3AQ4A 1DQAA 4B80A 3FFIB 2GM3A 4MEAA 4CTKA 5AE1A 1CR6A 2H9IA 4CMIB 2JJ1D 2DT5A 5LSLA 2V8BA 2OLEA 3UJDA 2RKWA 4M63A 2EGGA 3EMVA 3WB0A 3HJCA 4C4YA 4YDDB 5KFXA 3A4TA 5BW5A 4GZ6A 1HZJA 2BMFA 4RVFA 3U4CA 4Y6OA 4MB0A 5A8WA 2B5JA 3DKIA 3EA4A 3DMJB 3I1FA 2WKQA 3TBHA 3ET4A 2X23A 1AF7A 1DAMA 2HL6A 3TVKA 5JDCC 2HKEA 2SCUA 3IT3A 2C2KA 2CXUA 3E2PA 4TLCA 1WSAA 2A4MA 1U2DC 3GFQA 2VH1A 1M34E 2O3TA 4E94A 3UMCA 4PICA 1VYTA 3HKDB 3P45B 2BKAA 3UAWA 3BD6A 1FTYA 2C31A 5EIEA 1X1RA 3CVYA 3B3QA 3QT6A 4UDYX 4K7JA 1Y80A 2R2GA 1H38A 1E3LA 4DUYJ 1KMNA 3WHLA 1H8ED 2LA4A 2RHSB 4WXEA 4HSEA 2FUEA 3ZDEA 2VD3A 5AW6A 1YS6A 4KB7A 4IOKA 4Q05A 2X22A 5DI9A 1LWOA 2ES4A 2E1AA 3SZOA 5EWEA 1ACMA 4RTJA 2I6QA 4DV6F 2GERA 3TWZA 1SQ5A 2OPHA 1CUAA 1E2KA 2F1OA 4WKYA 2IOYA 3OZCA 3TZBA 3QLUC 3MEDB 1GYQA 3CRZA 3H87A 4N6NA 5I4KA 1CLFA 4J0HA 4BCAA 2Y1XA 1J8QA 1NCLA 4CM0A 2IBKA 1JH8A 1JQJC 3BH7A 4B4UA 4LRWA 2CNWA 4KYTA 3UR0A 4H7HA 3TEJA 2PZKA 4C98A 1EU1A 4QFMA 4H1UA 1BA2A 3K4PA 3G9XA 2AEFA 1UC8A 5JC1A 2ZYTX 1SELA 3BICA 3MN1A 6PFKA 4GVBB 2ZRGA 4YXWD 2QTBA 2CADA 2EWVA 1E20A 3VGJA 1N9GB 4OD0A 1U4OA 4QXPA 5E7IA 7ADHA 3PM9A 4EZIA 2DRDA 3N2KA 4XTCS 3T3IA 2FGOA 1X1AA 1PNTA 3ZPXA 3BXXA 1FNOA 2PGAA 1KEZA 2WY2D 2R6CA 1G2QA 4FFBA 3HVJA 4RH3A 4FFSA 3FBTA 1U0LA 2ZEJA 2P5YA 3C3AA 3O84A 4N39A 5D3MB 4ETZA 5H1YA 1I6MA 1XIQA 3EVGA 1R0WA 4LCEA 4MUKA 4HUQB 3LX4A 3IR6A 1V3SA 3CKMA 3KFWX 4NBRA 3P9CA 3O6VA 4L6IA 5CNIA 2Q9CA 4WSOA 4PLFA 1DAIA 3JYPA 5JNLA 3LWLA 1R0LA 3F6BX 3VVLA 1OFHA 4M38A 4ZVQA 3TDMA 1PJ5A 1A9XB 2H2FA 4UARA 3RUPA 3PC4A 2E4UA 4QIEA 5EWJB 3AUKA 1WD5A 5CDGA 2FMUA 4FN5A 1JFFB 3NL0A 4C6TA 4TY9A 5A4KA 2O07A 4MAAA 3G82C 2LQBA 3INRA 3D7LA 3OQVA 5BQXA 1EE1A 3IP8A 1ADBA 3SZRA 4S35A 4M6WA 4HT3B 2NUTB 4ALJA 5IZ4A 1ZRHA 2GW8A 1TL3B 5LXTA 4F4KA 1OX6A 2UXBB 4R5HA 4Z86A 4II2A 3KKMA 2IMOA 2ZT6A 3F7OA 2FB0A 2QA2A 5K03A 4B75A 1DRKA 2QG4A 3K5NA 4YCBA 3M49A 5EZQA 1WXXA 1E3WA 4X4NA 3ZOZA 3DRYA 2G0AA 3A9RA 3PX2A 4EHIA 4ND6A 5F5LA 3RVKA 4DCMA 5GMDA 1EUDA 2WU1A 1FSGA 2ID4A 2JLEA 4RJTA 2CNNA 4RF4A 3F9IA 2BW7A 3GH1A 3D7SB 1J06A 1TIBA 1JSRA 1O6CA 1MTOA 2JC1A 2G1PA 1UCFA 1WOOA 2IA5A 3EUNA 2VJAA 3ISVA 5DM70 2FZEA 1YA8A 4B3TB 4FYMA 1N5RA 5SZKB 2PAAA 4Q3KA 4EKNB 1FIUA 3A2KA 3QWAA 5IK2D 2CGEA 5BNZA 3U4MA 2ZJ8A 4IJKA 3LVRE 5DW3A 5KKNB 2J6HA 3QIPA 1RJWA 3N39C 3HSJA 4KR0A 3V8RA 3U44A 1MWYA 2VXCA 3UKJA 1DHMA 1DRJA