4CI0B

Electron cryo-microscopy of f420-reducing nife hydrogenase frh
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
228
structure length
228
Chain Sequence
b'KPRIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F420-REDUCING HYDROGENASE, SUBUNIT ALPHA
publication title Atomic Model of the F420-Reducing [Nife] Hydrogenase by Electron Cryo-Electron Microscopy Using a Direct Electron Detector.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 47
structure length 228
sequence length 228
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ci0B02
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ci0B01
1R27B 5ADUS 2UZAA 1DFDA 4KO1S 4TTTS 4UCWA 1ROFA 3MM8A 5JRDS 4UPVA 4URHA 2XSJB 1H98A 1Y4ZB 1B0VA 2XSJA 2VPYB 3MM9B 3MM9A 4CI0B 2WSFC 1FRFS 1WUHS 4UD6A 2GMHA 1FRMA 2VPZB 2ZVSA 4YDDB 4UQPA 4Y28C 3ZE9A 2C3UA 1BLUA 3OR2A 1FXDA 1K0TA 4KN9S 1IR0A 2FJBB 2FJEB 2WB1D 4KO2S 4UEQA 1G3OA 3OR1B 1JNZB 1FRKA 1JNRB 1SIZA 3PNIA 2V4JB 4L6V3 4IUCS 4IUDS 1FCAA 4UD2A 4UEWA 4KL8S 4UCQA 3HKZD 1C4CA 4KO4S 4RKUC 5CH7B 2C3OA 1GAOA 3MM6A 5BYSA 2FJAB 4GD3Q 1SIWB 3MM8B 3MM5B 1E3DA 3MM5A 1H2RS 1WULS 3ZE7A 5BYQA 1RGVA 1KQGB 1YRQA 5A4IS 2C3MA 3IR6B 1BWEA 5JSHA 1Y5NB 2O01C 3EXYA 4U9HS 1H2AS 2C42A 2FJDB 3OR2B 5JSUA 3ZEAA 2WPNA 3CURA 3H3XA 1VJWA 3MMAB 1C4AA 1F5BA 3MMAA 1KEKA 5D51S 3MMBA 3MYRA 1FDNA 1UBUS 1GT8A 1WUJS 1UBRS 1FRXA 2FRVA 5JSKA 3ZE8A 5JSYA 5A4FS 2C3YA 2FGOA 2VPXB 2Y0SD 1FRHA 2PDAA 7FDRA 3AYZB 2FDNA 3MM6B 1CLFA 4UE2A 1A6LA 1F2GA 1FDBA 1BC6A 1JB0C 1FTCA 1HFEL 2Z8QA 5BYRA 6FD1A 4IUBS 3EUNA 5A4MS 4OV1A 1G6BA 1GTEA 1WTFA 3GYXB 1YQWA 1FRLA 1H7XA 1KQFB 1FRJA 3LW5C 4UCXA 2VKRA 3AYXB 1Y5LB 1Q16B 1YQ9A 1H7WA 2C3PA 1FF2A 4AYBD 5JT1A 1DURA 2FD2A 1FRVA 5E7OB 1UBHS 4UE3S 1AXQA 1PC4A 2IVFB 1DAXA 1UBJS 2GMJA 3C8YA 2WAQD 3CUSA 4KO3S 4XK8C 3MMBB 1UBMS 1FRIA 4UE6A 1PC5A 1XERA 1FEHA 1WUKS 1GTHA 4UPEA 4ID8A 4XDCA 1D3WA 3IR7B 5L8RC 3IR5B 3MMCB 1FXRA 1BQXA 3RGWS 3MMCA 5CHCB 4KT0C 4DHVA 3USES 3ZE6A 7FD1A 1WUIS 1H0HB 2V2KA 4XDDA 3UQYS 4OMFG 1UBTS 1CC1S 1FDDA 1FDAA 6FDRA 1UBOS 1UBKS 1F5CA 1FD2A 3OR1A 1IQZA 3MM7B 3USCS 2VPWB 1Y5IB 1B0TA 3MM7A 3EGWB 1B0PA 1FERA 1SJ1A 1UBLS 2V4JA 2WSCC 2PA8D 4C3OB 4U9IS 1BD6A 5FD1A 4UQLA 2PMZD 2WSEC
chains in the Genus database with same CATH superfamily
1RJDA 3NEKA 3R9LA 1YL5A 5DYIA 3NHJA 3QJJA 5FLXU 2WOJA 2A9JA 2WF8A 1D1QA 3OPXA 4NYMR 4N3AA 3IXMA 4MI1A 3V4OA 4LF9J 4HNAB 3ZVLA 4FINA 1Q21A 4XPEA 2YBEA 3I42A 2HF7A 4I1YA 3RJZA 1YJAA 2PS1A 4ARZB 2R1VB 1T1SA 2O2JA 5B1HA 1A9RA 2ZSJA 2P0AA 4ELTA 4HB0A 4C6RA 3UT5A 3E15A 1YITS 3BXGA 4U2DA 3GAFA 2QZ8A 3M1YA 3SHOA 3REOA 1LW2A 3QGIA 3IUQA 2IH4A 1R6XA 1N32B 3GA7A 1G1AA 2W7TA 3WKAA 1G8YA 5KYGA 3AFIA 3CWQA 1WUKS 3QIDA 4G6ZA 2A18A 4USUA 4OHBA 4OMUA 2PGNA 4KX5A 1J0BA 1QG6A 3WSWA 3DTNA 2XMPA 2DUUA 3D7RA 3IUBA 2QWXA 2V58A 1FD2A 1G2IA 3CIMA 1Q4RA 1WHTA 1YJBA 1SH3A 3S6EA 3IG1B 5AHRA 2A6PA 4CV2A 5IJWA 1HBOB 3I31A 4FP9A 4F86A 1VJRA 2COLA 3WDMA 4Z4FA 4LDZA 4R31A 3TIFA 5K8VA 1MIHA 3JD4A 1PQYA 1WNEA 3MUMP 1NBIA 3KZMA 2ZSDA 3U7QB 4UOEA 3WZ0A 2HNYA 1ISSA 1MV8A 5KUTA 3O1HB 1OX6A 4ZPVR 1R6BX 1TKZA 2W6IA 2PBRA 3ISTA 1L7EA 4L9RA 3ENNA 3T9EA 1VMKA 3T9CA 4B4VA 2VP6A 3R3JA 2FTKE 3AR8A 4JLWA 2QL9A 3OSZA 2V2ZA 3QVGA 1X31C 1I2CA 2F48A 1U3UA 2L41A 3L1UA 1RAHA 4DR6B 3QGHA 3PFCA 1V71A 1I51A 4E2FB 4QARA 4OYHA 5F52A 3VBEA 1K08A 1KI4A 4LMAA 1COWA 4ZLPA 5CM9C 2PUFA 4M2LA 4JJ6A 1RP7A 5KX5B 4PQGA 4H4OB 1LTQA 1S7HA 4WK1A 2YC4C 4I1PA 3VGJA 5G4KB 1N6QA 4QDXA 2NO7A 1YKWA 3A2LA 3E8XA 2V5HG 4KPEC 2NXCA 1PT8A 3IALA 2QIOA 1K88A 2J5RA 2YV1A 4MO2A 1R8XA 1MRSA 1WPQA 2Q2NA 1JDSA 3Q0TA 1YCFA 4YAFA 2IV3A 1MFPA 5JPIA 1CUZA 1HQKA 2VFRA 3CJTA 5EWLA 3FCHA 4FDLA 4DT1B 1BMDA 1H0RA 2MOKA 3D67A 5CJPA 1N25A 2A0UA 3MM4A 1JNYA 3ODPA 1JKJA 1RXUA 3HY3A 3K4QA 5D5QA 2ALZA 1G7RA 3ETGA 3V1UA 1QZTA 2QAGB 2VTKA 1KI8A 1N56A 1XL0A 1L7QA 5KMGB 1RXVA 2C9CA 1UADA 4CTMA 2SKEA 4OI3A 4RF2A 3WC0A 1GNLA 2CQPA 2IM1A 1XEFA 1FD8A 2QP3A 5AK5A 3M7IA 4CN8A 4B45A 5DETA 2GFIA 2EARA 2D1YA 2NSJA 2WV9A 3I4FA 3OEWA 4UPEA 2WJWA 4IZHA 4FXPA 4PSCA 4JN6B 5IQ6A 2MLXA 2WQ7A 3HCPA 1FK9A 4IX1A 1Z88A 4Q4HA 2MSKA 1MMNA 1JKXA 1ENZA 4C3OB 1GSIA 3ROEA 4CM6A 3COZA 3EISA 3PX6A 2WVBA 5EJ6A 1VQKS 1N8NA 3GJSA 2XE4A 2QPTA 4HH4A 2PKXA 4I6AA 3COPA 2HTFA 1GZDA 2ZWIA 4FNOA 3K3PA 2YKNB 4AQ7A 2JH3A 1H72C 4IRMA 3BYPA 1PFVA 3WGTA 1OGIA 3X3HA 3UR0A 2Z2LA 2WJYA 3AM1A 1ISMA 3WLSA 3INRA 5IABA 1I6WA 2AW5A 3DAHA 1DPGA 2C9YA 1FA0A 3IHWA 2GM3A 2R7VA 2P9FA 1NYQA 2NU8A 4X65F 3QVKA 2OPPA 2SECE 2VDKB 4QQRA 4W5WA 4QVGA 1FCJA 3KWLA 1Y98A 4DL3A 2FPIA 2DLNA 2HV8A 2FPOA 3JZDA 4Z9XA 3T8YA 4EEYA 4MV1A 3KLEA 2WVJA 5ADWA 1YF3A 4EA6A 2JLEA 4ACAA 1N5JA 3COYA 3WRXA 1XXHB 2ZE7A 1N5SA 4JKOA 2ZSFA 5AXLA 2YOHA 1NDKA 1WB4A 4YO8A 2DWQA 1NUUA 1RKBA 3DXZA 3B54A 4OYXA 2E5HA 5FO0A 3EDOA 1A76A 3WLHA 3C15A 4FLFA 4CLWA 2CXXA 1ZPWX 2R9VA 5LD2B 2HNZB 3UJPA 5D87A 1D4AA 3ZGVA 3HO8A 1E2GA 4RWWA 1BHQ1 2ZBQA 4N76A 3IE0A 1Y7HA 2IKSA 4LOJA 2GO9A 1MDFA 3RUAA 2F8HA 1KJIA 5J9FA 4DSJA 4Q0BB 2XDQB 5HKKD 4B6EA 4KYUA 5CVEA 5TQ2A 3NATA 2QD2A 4ZRNA 2WMOB 1RKQA 3LFTA 3EWSA 4L5BA 2C2DA 5JCPA 3BXXA 4EYIB 4TL7A 4FHCA 1KU6A 3CY6A 3DZDA 1XEWX 1V37A 2FEXA 4H6PA 4KSYA 4WOBA 2HU2A 2OZVA 5DM0A 1R0YA 2QSWA 2OOKA 4LRQA 1ODJA 5TY0A 1JLMA 3HR7A 4MHSA 3E7FA 5KNCD 4DPKA 5L3ZA 3UN2A 1H1LA 2Y99A 2X76A 3I1JA 3TLXA 1OU4A 2AEMA 2RCNA 2PV0A 3G5LA 3KPVA 1RVDA 1IWPB 1NU8A 3CZ9A 1ZVVA 1SXIA 3AF6A 2Y4OA 5IF9A 5DNVA 2VYCA 3TEJA 1U0BB 1WLYA 4UBNA 1WCXA 3G2JA 2GYWA 4HTAA 3KDAA 1H05A 1XWFA 1WCIB 3OJXA 1HFWA 4KVFA 2RQCA 1QYIA 3W6PA 1LDGA 3CVJA 3V7NA 3HSGA 1ONBA 3IWNC 5THQA 4MKVA 1O6FA 1GXSB 4YJFB 3C6TB 3DNMA 3F9CA 3VQSA 4KFRA 4QO7A 3CCLS 1D2RA 1XZFA 4QC2A 2E37A 3GRFA 1TO1E 2DGUA 5HWSA 4ILEA 2GM9A 2B8EA 2ZI9A 1OJ4A 5A7HA 3SV4A 3S2IA 3UWMA 3VBCA 4AO8A 3QT5A 3MD9A 4OB8A 4ASUD 4ED8A 1Q22A 3FSGD 1LBQA 3EZUA 3TRDA 1GR0A 4OMFG 3QBCA 5J1PA 4DS4A 1JGTA 2HMYB 2KJQA 4ES3A 4IRKA 1DAHA 2XUOA 3DAFA 4ZEMA 2BE9A 2WDZA 4RUKA 5LJIA 1P9OA 3EF1A 1Q95A 3IBTA 2C2RA 5AM0A 2VP0A 4Y2YA 1T0BA 2NZVG 1EVLA 1GN9A 3LUJA 1UBCA 3LW7A 3QXCA 2J6CA 4X1YA 1HYSB 5FTNA 3UVEA 3SIPA 4LRBA 3NONA 3BDAA 4W1QA 2BFBB 5H3CA 1U6BA 1VJTA 2YKMA 1CDOA 4QXPA 5DGBA 1NMYA 3F6SA 3PFEA 2O19A 3I32A 1JKMA 1X7WA 4EVRA 5AVTA 5JAHA 1Q8IA 1U47A 3DI6B 3WQQA 3AQ4A 4D99A 3ZZ0A 1S12A 3UH0A 2E9TA 1QGAA 2BQRA 4BY9E 3V2IA 1WMFA 4YNBA 3H5XA 2CWDA 4XCXA 4KE6A 2QC3A 1NJ5A 2JANA 1B8OA 2ASEA 4EM6A 4O3NA 2JVKA 3WMGA 5IVKA 3NM5A 2VH5R 1VG0B 3LCRA 4U7DA 1FNXH 1MQ9A 2IBKA 4COKA 5KT2A 4U00A 3O75A 1C9EA 3VU8A 1ZYQA 1IM2A 5ITSA 1U2RA 3KO8A 2SCUA 3EZFA 1YV9A 4YRGA 4O4RA 3EDQA 1E2HA 4INPA 1VCMA 4E88A 3QWHA 3P9RA 2O8DB 1V1RA 5T7LA 1C3OA 4TWRA 2OBBA 3QVXA 3MTJA 4TKZA 1RDRA 3NXZA 2R7RA 2GVZB 4B9NA 4KYTA 2FEOA 1U8FO 3PK0A 1UPXA 1K1QA 4XWYA 4J9RA 2J30A 3F6EX 3RW6A 4NG4A 2G04A 2P9GA 1JSCA 3WLRA 3NIGB 2WZDA 2J5AA 3I0RA 1MB2A 1NGSA 3NP9A 1I8TA 2C2EA 4D81A 1CRQA 4A3SA 4OHPA 5A4MS 1Z2ZA 3WGHA 1UQTA 2YIJA 1NFQA 4QT0A 2RQMA 4EUSA 2QTNA 1YE8A 2FGJA 5AI4A 4X6LA 3L1IA 1K5GA 5C24B 1KO1A 2UZ3A 3WLAA 3ABRB 1YDLA 5ETNA 4L08A 1AXEA 3KK3A 2BYTA 1DTQA 4CI9A 3AUJB 4EFAC 1F3FA 3UJCA 3SIXA 3TEHB 4OA5A 2RGAA 3H5VA 4UD6A 1IPHA 3GDFA 2O05A 4N9QA 4NBLA 1YQTA 2QX0A 4K28A 5B55A 3MXTA 1MPTA 2XMAA 4DL5A 3BEDA 4LI3X 5AHWA 1CF2O 1WKVA 4UHKA 3N9IA 3SDZA 4DLWA 2HK3A 2E89A 1N5TA 2RU9A 4S1WA 5EJ5A 2HEKA 2IM3A 1TM2A 4A2QA 1V8ZA 5FXMA 4UZBA 1AKMA 5M2RA 1MV5A 2D2IA 5J2TB 2R66A 3AEKB 3T1AA 3QATA 1L5ZA 3DXXA 3P32A 1I0LA 4ZU1X 5FRDA 4AUKA 1NK0A 4NXMB 4CR7A 3PUYA 2FY1A 1B1AA 4A8FA 4HYKA 3OY2A 1NBAA 1QQBA 2M2BA 4MO9A 1RK8A 3FGZA 3MPUA 4TMVA 3SXUA 3UN1A 4BUJA 4M5DB 4IZ6A 4HDCA 4IGEA 1F51E 2MQQA 5JDCA 4XA8A 5C7PA 3BRWD 1PV4A 3KJQB 1K2VN 2YNHA 1QGUA 4DSLA 2O0KA 3J7YU 2PQ2A 3L8DA 1XIQA 3IBCA 3ZXYA 1U2SA 5L3SB 1ZHHA 1I3KA 4ZOLA 1S6PA 3GBSA 1O6XA 5EXDA 4QQNA 1E3MA 5HLFA 2XYGA 4LXHA 2LEPA 4DIFA 4QD3A 2VJVA 1CC7A 1I94F 3U44A 2XMKA 1WEZA 4ENUA 5BSHA 5KHAA 1WO8A 4B3TJ 5DJBA 1PGOA 1XI2A 4P3XA 3GMSA 4QBKA 2YY5A 4DOMA 5ECGC 4PGAA 2B6HA 2BFFB 1H66A 3UFXB 3GCWA 2PFDA 1EAMA 4CM9D 4BMCA 2ZPUA 2OSVA 2PQMA 2HBZB 2HA6A 2J9GA 3FOZA 5CTJA 3TN7A 3DFFA 5IKXA 3QIPA 3A9SA 3AU8A 2OC4A 1X4EA 3ZTWA 4U2FA 1L5LA 4PONA 1UQUA 4C76A 4QVIA 5KFHA 1GY8A 5GAJA 5EN4A 1TK9A 2YUIA 1EGHA 3HFJA 2OHVA 4WWHA 4RUCA 1HEIA 1UFVA 1Y1RA 4B74A 4B7XA 3DW3X 1H4QA 3LC1O 1QBKC 3GR6A 4FGWA 3DHXA 1AKQA 4L15A 3N6NA 3ZGNA 1BDHA 4HSGA 3HO6A 3GPAA 3VPHA 3F7OA 3L0ZA 3V4IB 2FWAA 2F4VF 2DSTA 1IVNA 1FFCA 1T10A 4A10A 3IAS9 2GHRA 5TF4A 1FFEA 2ZJ7A 1N5YB 4EG5A 4GOJA 1U5BB 3K0FB 3U3RA 4LAFA 3BL8A 1W87A 2DKFA 5LLDA 4B3RJ 3OMWA 3LDFA 3SC2A 5LLTA 4M5HA 1JXAA 3B85A 2V7BA 4C8LA 1WTBA 3QKSA 3VX4A 5AE1A 1MUUA 2CQGA 2P6PA 3CVOA 3D0HE 3DQQA 3K1AB 4L8LA 2V98A 2DK2A 1F2HA 4E8UA 2W1BA 3M3PA 5JALA 4UMFA 1RTDB 3JTNA 5K3DA 1HDIA 1SCQA 3H9GA 1C7FA 4V2UA 4XJVA 1M6HA 1EHWA 2VCHA 3WLTA 3SKVA 1HWKA 5KFDA 2YMQA 2IP4A 3MEGA 5IJ9A 3QU7A 1USWA 1G20A 5KCZA 3G6YA 5JRZA 1H2YA 3FZEA 4MS3B 1RJEA 3QE3A 4ND2A 1USVA 3LKZA 1YRTA 3O84A 3OU7A 4F97A 4MLPA 1XMOB 3DE5X 4JT4A 1C41A 3DD1A 2C3MA 1KH1A 3KDOA 1CNFA 5EWJB 4MV6A 1EJ6A 3NHLA 2JFYA 1KS9A 1QX3A 5IHXA 1USKA 2LECA 1U5CA 2BEKA 2OPHA 2GKGA 3S5JA 4D3ZA 3RFUA 1QHHB 5IJ0B 2NYUA 4FS8A 1HQUA 1MW9X 1TEVA 4OL8A 1ZAVA 1PSWA 4NLOA 5FF9A 4AIIA 5GP1A 4BHTA 1N36B 4JV2A 3M33A 1ZX1A 4DV1F 1B8VA 4BJ5A 2X9GA 3AQIA 3K70C 4OHVA 3VPSA 5LNK6 4NCIA 1BWQA 1ISHA 1HNXB 1U45A 1FRQA 2H16A 4PBSA 3R6LB 4ID5A 5DQHA 3TLYA 4V2IA 1US8A 1Z6XA 2WWIA 3KG0A 4GX2A 4H7PA 4OQZA 3KKMA 1X42A 3SZUA 1K0UA 1KVIA 5BXIA 4R9VA 2XA1A 2QTZA 3P19A 2MHEA 2FJ0A 3QH4A 4NU6A 1YS1X 1KQGA 4FLEA 1P1IA 1IOZA 1FVHA 1B7GO 2WPDA 3I0SA 2Q3JA 3UGJA 1FO1A 2FEPA 4FBLA 3E35A 2AI2A 4UDNA 2XW6A 1YA6A 3EBPA 4BNMA 2FLWA 1G2OA 3HABA 2BGIA 4MKFA 4BQQA 4X20A 3N07A 2A3JA 1Q50A 2ADOA 2HO5A 1U2TA 1YI0A 2BN4A 3P52A 3ZY2A 3DU5A 2OV3A 2VHQA 2YHSA 3FHTA 3N2IA 3T52A 3GD7A 5ER9A 5F4BA 3IVCA 2XMQA 2LFVA 2PU5A 3X1DA 4WKOA 4DLBA 4X1OA 4LV6A 2W9CA 3VR6D 1YXMA 1QH0A 3R5XA 1AUVA 4F1WA 3P4UB 1AKNA 4P4SB 1N2OA 1ZL2A 1KEVA 5DLQC 2CJYA 1MWZA 3DLKA 4K9LA 1R8JA 4YJ2A 1S9HA 1O58A 4FXWA 2YNGB 3TZWA 4BEWA 2R1UA 4IMJB 4GX0A 3FCEA 1XPRA 2WTEA 3N1UA 2COUA 3CNQS 2GHWA 5IW8A 2H4XA 5SY9A 1UM9A 3MQ2A 5IC6A 3R8XA 1DFIA 4QR1A 1PT5A 3HKEB 1E7MA 3I2GA 2Z6QA 4WXHA 2J9DE 2RHTA 4B73A 4IX9A 3BDPA 5ILOA 4MI3A 1OE0A 1LW7A 4O1MA 2UXBF 1QUEA 4YDXA 2HHPA 5BQPA 1QYCA 4TV9B 4OJHA 1JWBB 3RUEA 1DP4A 3EDRB 2PBLA 4G85A 3W2VA 3L05A 5BV0A 3N01A 3IBFB 1MAHA 2X2FA 2II6A 2FR8A 5UKDA 4Y2TA 4NA1A 4PXYA 3ZY5A 2AJQA 3R0ZA 2K3IA 1VC0A 4M0KA 4RLFA 3KJHA 3DBHA 2C7QA 3O8OB 3FSYA 1P5FA 3S1SA 4ESHA 2PX4A 5LSOA 2WUWE 1KJ8A 4C2UA 3S8EA 4OVKA 3CSDA 1U2DA 5TS3A 1A9OA 2K2QB 4XI9A 4LSNA 5IZCA 2VQEF 1PYSB 3KEMA 1VXRA 3QXHA 1VMDA 1F0YA 3AESB 4AKGA 2OKGA 1Y0BA 5KTSA 1IFXA 1DLOA 2CLMB 1P3JA 4B82A 4N1AA 4NH4A 1VI7A 3ICQB 1SVSA 5CVDA 5TF0A 5JNVA 3U3OA 1U6ZA 3CCZA 3G9CA 1EFPB 4AURA 2RH4A 3CVWA 3U7RA 4BKOA 2ISSD 4J1NA 2GIRA 4JLDA 2KB0A 1IHPA 4B2YA 1TPYA 5HMYA 2H4HA 3IR7A 5AVKA 4N56A 2GK6A 1L5SA 2MJNA 4EG1A 3M5CA 3M3HA 4C0JA 1KTQA 1U7HA 1JJFA 4GOOD 3KJFA 1IKXA 1H23A 4W9NC 4CIOA 1O8CA 5BY2A 2YKAA 2QUAA 4DLZA 1TQ2A 2ZUFA 1XDGA 3S6JA 4FYPA 5CM8B 3NWPA 3NOGA 1N7GA 1SBCA 3PGKA 3OSNA 1MGOA 2JLYA 2RAVA 1FRMA 2Y27A 4DCJA 5L46A 3WL3A 4JUAA 1C0UB 1Q6ZA 4E33A 3GFGA 4AMVA 2FE1A 2G40A 1G38A 3P0HA 1LWFB 3JAKA 3LPYA 3RVNA 4B6PA 1EKSA 2R4UA 3OBBA 3B2NA 3EH1A 16PKA 2KLBA 3T1HF 1PJAA 1Z07A 5B3LA 3E01B 4EKYA 2PNJA 3TCNA 4A8XA 3SLKA 2CSUA 3INGA 2OY0A 2X0NA 4IDHA 4TY9A 3UCFA 2Q0XA 4OQNA 2O3JA 2HRYA 3EEIA 1IUNA 4G3IA 1OTXA 2XOKA 3B1WA 5THWA 4B4KA 2IA6A 5E2IA 5EIFA 3UTDA 5EHIA 4GGOA 1IEQA 2I6XA 3IAS6 4KWIA 3ML1A 3ZJVA 4TT3D 4D9MA 4KQ6A 4L3WA 3JARB 4RIFA 3RVKA 2NQ2C 5E2AA 1G6HA 4CMEC 2F3QA 3ORHA 4M5LA 1HWJA 2FPGA 4J4BA 1L5OA 3PITA 1QM5A 3E81A 3CDWA 3DRRB 1EE9A 3AETA 3TAQA 1Z0IA 4YREA 1UJMA 7AT1B 1XMPA 4NENA 2R7MA 3FAZA 3OZFA 2UU9B 3GN2A 2DIVA 4G5HA 3UC9A 2Q4OA 1Y34E 4KTVE 1Z1ZA 3FUUA 3M5PA 2X4LA 2P6TA 3FKQA 1YWGO 2FSVA 4PLGA 3FEYB 5AM5A 4GOLD 1FXUA 4WVFA 4DW8A 5CGZA 1YO6A 3RYFA 3OIYA 2QAIA 2GA7A 5BRNA 3RPEA 1CBUA 2KTQA 2YICA 2PSFA 3WIEA 1H6KX 1VGYA 1Z82A 3UK6A 4CLKA 1PCXA 2C28A 2ERCA 3CJ3A 3UT0A 1M5RA 5HR5A 2BPOA 4AF6A 1OIAA 1JA1A 1Z68A 3TTYA 5T5QA 1UZDA 1KKHA 3S40A 3ZWYA 2WT4A 5JFOA 4L85A 4FMDF 5ITHA 4MX8A 4BLSA 3DPIA 3F6CA 4ZZ1A 3DMJA 3AOEA 3KHLA 2NACA 3JB9k 4Y7DA 5FUMA 3NGUA 2BKNA 5DHAA 2RH5A 3RCBA 2PX0A 3KZCA 3CCTA 3HDVA 3WGIA 4HYQA 1KS2A 2G67A 5KG0A 1L8OA 3LWNA 3QWIA 3UWOA 3K5WA 4HLUA 3R7LA 3BE8A 1U8SA 1KQ3A 1ZTTA 3LP2A 5GONA 2REXB 4QYZJ 2XBMA 3ZCQA 3NAHA 4UM8B 4I81A 3DOMA 1PO6A 4QCLA 4O2LA 4JBWA 3OQJA 4I64A 1ZOOA 3WGUA 3D4BA 2VA3A 3ZCXA 2AD9A 3H83A 3ZYZA 3DQPA 1UPAA 1CG6A 2IEZA 2X1VA 3PXCX 3KOXA 4EIWA 1WC3A 3CDUA 1Q81T 4FKYA 3OEYA 2PD6A 4ZPXA 2WTBA 1FTRA 5EE5B 1AA6A 1HRKA 3D8UA 4V0MA 3TVDA 2IBOA 2X1HA 4A8KA 5I7SA 1JR2A 4R8SA 3AOAA 4KMSA 1HSZA 4ZODA 4FEEA 3RSZA 1QFYA 3RE1A 1T3GA 1MW8X 4A8TA 4CMBA 1VE9A 2IZ7A 3K2QA 1YHZA 1QIGA 1C9YA 4GYKA 2L9NA 4NCJA 4QYRA 2MZRA 1IBMJ 2OLEA 5ALMA 2DOKA 1R9GA 1SC9A 5CB6A 5LT5A 3PPWA 5LBTA 1J0DA 2LP4A 1BXRA 5F0UA 1NZ8A 1BROA 4QLBA 1CQIA 1HNIB 3W61A 5FFFA 5I47A 4FNIA 2RGUA 1UDWA 1WW3A 3EH2A 1ZC3A 4XPCA 1NFFA 4JL8A 4K26A 3QU9A 3A6LA 3OE4A 1GGEA 2IX3A 3FOBA 1Z2OX 2WNSA 1Z6PA 5DLDA 4M8KA 5M5BA 5KT6A 4FC7A 1QLHA 3K9GA 3KLGB 4C5CA 2XPCA 2K3KA 1TK5A 1WELA 4MMOA 4NLRA 2IUSA 3NWEA 1YVFA 3EFHA 2NXWA 5AHXA 2CJWB 3E6AA 3RYIA 2Y9HA 1DWPA 1FMLA 1BKSB 4DV4B 1ODKA 4G0XA 3GK3A 4PR6A 1PX0A 5FBHA 2FA9A 2QTWA 4MQFA 2I3BA 4KGXA 4RM2A 3HBJA 1Z33A 4G0MA 4HDGA 1ND5A 2Q1YA 2VDHA 1Y00A 2GESA 4MFBB 2FPUA 3DLPX 4YK7A 4OL9A 3N8DA 4NFSA 1YIDA 1P3DA 4X97A 2FMHA 2F65A 5GMOA 4YFUA 3AG5A 5E3RA 3K2IA 5FLXY 3DL7A 3K2BA 2RD2A 4D3HA 2HA0A 5IH3A 1JG1A 4LY0A 5KTNA 1J25A 3LAMA 1FYVA 1LRLA 5F8LA 4GXRA 5DU2A 5JD3A 1IATA 1N2BA 1GQQA 4ZEVA 2Z30B 2G70A 1RRCA 3E03A 3G86A 2RKIB 2FSGA 2JS7A 2LW7A 1KY2A 4NLWA 2YZNA 1P1CA 4JEMA 2D8AA 1GPYA 4QA9A 3RUHA 3GLGB 1V9SA 4WK6A 2O0JA 4UJ3A 2EW2A 2UUCB 4JROA 3OJ0A 3LF0A 4P2MA 1C2PA 4P3PA 1M8GA 1SXJD 1X8KA 3U3ZA 1KU0A 2XE7A 5SUHA 2DFKB 1WXWA 5A9RA 3ROQA 5BV1A 1E7SA 3HP4A 4I5GA 2Z6VA 5ALFA 3ZE2B 1R7IA 1Q3TA 3I5CA 1JVNA 1SL0A 2L08A 2BJ8A 1VFJA 4LF5F 5JYCA 4Q1CA 4J37A 4DG1A 3UCZP 5D0HA 1CUUA 3N2GB 4N82A 3MPWA 1XNQB 3RU3A 5F23A 4PG8A 1W9HA 3B1KA 3AX6A 3HBLA 5CA0B 4FZ3A 2IEAA 2J0XA 1A2KC 1E9BA 3WGOA 3VHXB 2AGQA 3IDFA 4ILRA 3MPVA 3SZGA 4P3NA 1AO3A 4FFLA 3VNAA 1N54B 4TS1A 2G25A 1OUMA 2IRXA 4BZXA 1S77D 3O93A 2PXCA 1IVYA 1QFSA 3JQBA 4FYWA 3CEHA 2JCVA 3B38A 1O57A 2AKWB 2DNYA 1A9SA 1Q0SA 1B0AA 1T5SA 4H1WA 4R2WA 2EWWA 1FXWA 2W2LD 1YZVA 1BUXA 3VU3A 4R68A 4ENPA 1JJHA 3G2QA 1PG2A 1IB6A 1S9GB 4RCYA 4D26A 4BKMA 4HWOA 1JG7A 4UHHA 3UMMA 2W6QA 4CEJB 1PE0A 3EMTA 3AFGA 1VGVA 2GO8A 1Z3IX 5JU6A 2RGBA 2GN9A 1FFSB 3E58A 1D07A 3AR2A 1KDOA 3Q1KA 1BGWA 4M5KA 1RP1A 1M6VA 2YWXA 4S04A 2I8AA 3LDGA 5D6GA 1Z4KA 2XRMA 3HCFA 1HNWF 3C43A 2OYCA 4AWXA 2HZAA 2XXAA 1X0FA 4CKBA 2C99A 1ZGHA 3L7AA 1NQXA 3UZUA 2LCFA 2VTVA 1ZD5A 3FBCA 3KNAA 7FDRA 2MKKA 1AUSL 2H63A 1VK8A 4HDSA 4UNRA 1JHUA 4PAMA 5FBKA 4L3OA 3BGIA 4CLXA 3F5DA 1AXQA 2EJTA 1DQSA 4F11A 1ZH8A 2YHAA 5K0SA 4CMIB 4BO6A 3RFFA 3GLIA 2ZTUA 3OHPA 2WHQA 4FCCA 2JJ1A 3G87A 5D4PA 4TTVA 3BM7A 1W8DA 3B53X 1YZQA 2ZT7A 4PAWA 4BNIA 4H7IA 1R8SA 4CZ2A 5FPPA 2C2GA 1U7LA 1S6OA 3THXB 4MLDA 4AY2A 3ES9A 4RZHA 4MUJA 1S48A 4FYIA 2DF8A 4Z86A 2WG2A 2Q79A 1BDBA 2BONA 2EX0A 3DPUA 1Q1GA 4I0WA 4TV9F 2L9WA 4RZIA 2AFIB 3P4XA 1JHQA 2HJHA 1HPLA 4PC1A 1W25A 3WL8A 3B13B 4P10A 3EGOA 3JASA 2Y1RI 1BEUB 1K6XA 5D00A 3TNFA 5IJXA 3SPXA 1FRHA 4C3MA 2F1FA 2PZ8A 4AVYA 4J3JA 4TLBA 2FJWA 3PDHA 4BAZA 3RTEA 3C98A 3GLHB 1U1OA 2RSLA 4DSNA 4D98A 4RK0A 2GCPA 2CZ9A 3OX3A 2C7OA 3OICA 4FD2A 3MTEA 5TPWA 1BCRA 4IQFA 4X4QA 5D3MA 2XV1A 3HCBA 3ZGOA 3LT1A 1DAFA 3PX4A 3NNCA 5AM2A 5SZIA 3JWGA 2XWBF 1M1KT 2RRBA 4DA0A 5J2NA 2R2RA 2DBBA 3A58B 4BNWA 5LZ8A 5F8JA 1EI9A 4BGDA 4G4SP 1O5TA 1GQEA 1QFXA 2WICA 3OHBA 3LTEA 1Y9AA 2OV2A 2QE5A 1RS0A 2AMFA 4KO0A 3AGQA 4L8VA 1Q0HA 4R0NA 5JXWA 3KVNA 3LYLA 2NQ8A 1IXZA 5T14A 4ZO6A 3HVTA 2BV3A 1AHNA 4FFMA 4JC4A 3FLAA 4TKVA 1QG2A 2RDIA 3FZ2A 1R64A 4OYAA 1FYWA 5DPMA 3LBYA 1L5KA 2LLZA 2CYAA 4C3ZA 5F64A 4J9OA 1DDGA 1LS6A 4N7JA 3MOSA 2FLPA 1Y8QB 3HC7A 3RSOA 3V8VA 2JFVA 2FHJD 3U61B 1DO8A 5E6UB 3JAMU 1S0VA 4L78A 3OU6A 1ZM9A 1T3OA 1BXKA 1I3MA 1X8DA 1IBKF 2P77A 4K8RA 4Q00A 4WRRA 4XEHA 3E27A 3R97A 1VB5A 2GM4A 4BVKA 2FP4B 2I2WA 2P1RA 1RJJA 3E51A 3KYDB 2ZE8A 3QBDA 4Y9RA 4W92B 4X1KB 5FHQA 1P80A 1VE6A 4PX9A 3SOPA 2WONB 4ZC1A 4DV3J 2DQYA 2G9QA 3HADA 4K9NA 1RWMB 3LFUA 4LJRA 4LBHA 1EQAA 2ZR9A 2HEGA 1Y3HA 1IDN1 3V7WA 4BFZA 2PZJA 2ZB3A 4MV7A 1Y3JA 3I6YA 1C4AA 2YN0A 2Y3IA 5EFOA 3G8CA 1GITA 3SZ2A 4B3DA 4QYZK 4C2BA 3GLGE 4OLHA 1QAQA 1A2QA 1GZ6A 2I29A 3GOHA 4QPTA 1ZISA 4BMSA 4QSHA 1QLNA 4DL2A 4CF5A 1YC2A 4D9NA 4UNSA 1HNZB 4ZO4A 1W5TA 2VKZG 3RGWS 1J0XO 2BT4A 2EATA 3QMQA 1T8TA 2K4MA 4EJSA 3GSDA 5J3JA 1A2BA 1NR5A 2SKCA 1A96A 4X1IB 3ABZA 3ZHTA 4LFAB 4PFKA 2J32A 4G84A 1ADBA 2BLNA 5KTRA 5ALSA 3RS9A 2BJDA 4Q44A 3AHHA 3WQPA 3OTWA 4YB6A 2WM2A 3K8ZA 3S2EA 1E32A 2QZ9A 2UXDB 4V24A 5DDRC 4Q7AA 3U0BA 3GT0A 5B0BA 1DVRA 1ZUIA 1WAMA 3HNOA 2XUGA 4LQLA 3IA0A 3B5EA 3NM6B 4UFOA 1WD6A 3RBDA 1RYDA 1YQ9A 4ZVPB 2PKCA 4WXMA 2GJ9A 4TQUS 1VQNS 3WADA 2VICA 1R0RE 3GP8A 1FEHA 2N7YA 2JLAA 1ZAKA 3UYKA 4YWJA 2JB9A 4AF8A 1RTTA 5DBHX 5K01A 1XRLA 4N0DA 2ANCA 3A6JA 4CRJA 4OLPA 4KXWA 2QLMA 2OD7A 4M1ZA 4JNCA 3F56A 1PJSA 3QVSA 1RPTA 1V7ZA 3W4JA 2JAOA 4AXBA 5L9XA 1QSGA 3EOBI 3F4LA 5T64A 1F8XA 3NG8A 1ABEA 3R74A 3IQZA 3WIUA 1FB5A 4DNOA 2EKDA 3WGJA 3FZYA 3PNOA 4WN9A 3L9WA 4WTOA 1T2DA 1N2IA 3CUUA 4J1TA 4ZAGA 2PRIA 1ODFA 3A4YA 1XLUA 4PWYA 3GRPA 8ADHA 3QYJA 4TYMA 1RWKA 1TJ3A 3MRSA 2B4YA 4PWDA 4NRTA 1IWAA 5FOWA 4G5XA 4MQ4A 1N34J 2FQQA 1JLEB 1SUPA 3V8PA 4Y6RA 4GF5A 5LMUJ 1XDBA 2CW5A 1QAIA 4ENTA 2GXAA 5DBFA 2BR5A 3FGPA 3L7DA 1GLGA 1S10A 1NM5A 4O4GB 3BH7B 2EJWA 4UASA 3RC1A 2HFNA 4X63A 3ZN2A 4FMPA 1AN0A 4G5GA 2FMUA 4RELA 3K1TA 2AMLA 1APBA 2G2ZA 3DCYA 4R8LA 4WK4B 3TOCA 3EX7C 1S7CA 2Q4TA 1OAOC 4RLHA 2PI5A 5C25A 4X4TA 2BX6A 4LF6B 1X94A 3K8OE 4IDKA 3DOHA 4CLEA 5LQKA 3EGEA 1NF9A 1S0UA 1R0XA 5JAUA 4OAPA 5FPHA 2DTDA 2XS2A 4G0PA 1HWLA 2AFIE 1ZPVA 3B48A 4J16A 3NG1A 4DUZJ 1SVKA 1MROB 3IV9A 1K8AT 2FSHA 4JI4B 1X15A 7ABPA 2G1KA 2LEAA 1QF9A 1ULZA 3QOWA 3SZRA 3CVVA 4RTLA 1NH8A 2C42A 3EXIA 4W8HA 4C7OB 4IR7A 4UXHA 1MC1A 2I8CA 4NECA 3P6YC 2GYUA 3O4RA 3GLHE 3OTOJ 2C4HA 3QQCD 1YR8A 5DNCA 3PFBA 2MQNA 2NLWA 5HA5A 2OOSA 1PDWA 4F56A 2CF6A 1DWOA 3AZOA 4C4SA 1DJ0A 3N6MA 5TVKA 1XO1A 1KETA 1PNRA 4UOFA 5FI5A 1BFKA 3G59A 4OFZA 4HH1A 4KH1A 4RY8A 1TEZA 2JDIA 4KR0A 1A8UA 4RJJA 4GLOA 2X41A 3IO1A 4IEFB 2CPXA 3HBAA 5I9NA 3QVLA 3THPA 3SFTA 1HI0P 1IQZA 2WCXA 1LFAA 1A71A 3PW4A 3HB7A 4F4KA 2QLJB 2JIDA 3GEBA 1YQHA 2ID4A 1MAVA 1CZRA 3ETJA 2G8NA 3JPWA 1T1GA 3TUJC 1IHUA 4MP3A 1PEKE 4FX2A 2VG7A 3L41A 3CLTC 3UE2A 2ZVPX 4RQAA 4JQYA 5JAQA 2IYAA 3UGTA 2QG6A 1I6MA 4WZAE 3GY0A 4E08A 1L7RA 3WHKA 4GLJA 2AOUA 3EIQA 3C66A 3MMJA 3VR2D 3H25A 1RAEB 5IH7A 4B35A 3E23A 4U9HS 2DLDA 3CZMA 2GRAA 1KRWA 4A8MP 1T4BA 4H15A 2YZGA 1RYZA 2ZI5A 3AU9A 3MT0A 2ZE2B 2WE8A 2MINA 3ZH2A 5B7PA 4DBZA 3QFHA 4EEKA 3LC2O 5GM1A 4F46A 3C5WP 2DD8S 2ZW9A 2JGFA 4OHXA 4GKVA 2LEBA 2HGSA 4XZ3A 3PYMA 1IZ7A 4CG3A 3JTOA 5A5EA 4NX9A 4J9UE 3UR3C 5A6SA 3HCDA 1JQDA 3NRCA 1KKMA 1HBJA 1S9EB 2AHOA 2E5LJ 4HX9A 4C0BA 5K1ZA 3TAMB 3VU0A 5EL0A 3QHQA 3NMAA 1N3IA 1UDXA 3Q8PB 5JO0A 2CQ4A 1VMBA 1REVB 5BSGA 2WM3A 3L3CA 5LMZA 1C2TA 5LP6A 3EMDA 4QICA 4YYEA 2P3QA 2ETVA 4CQMA 3CSSA 1M1YA 4L0CA 3BGLA 2QN9A 4ZP7A 3L0SA 1GRRA 2XMJA 2B5WA 1QDLB 3V6DA 2KMLA 3EMVA 3CMES 1HBUA 1S49A 1H2AS 2LIPA 4BE7B 1LLFA 2XMCA 4LBZA 1SG6A 3K70B 3B52X 3HJAA 2P4QA 4B3SJ 4HD8A 2WUVA 5HRUA 2YRFA 2W6JA 2WM8A 3H8WA 5FQOA 1VDMA 1XZPA 2R42A 2UKDA 3EN0A 1PKEA 4KBIA 3PJGA 1GDTA 4EUNA 4F9EA 3BN7A 3DBLA 3JVIA 2FUKA 1V8PA 4QTZA 3NOVA 2IY8A 4A27A 2R6FA 4QULA 1RRKA 1E8MA 3IHLA 1DC4A 5IDVA 3F0NA 3CM0A 5JMNA 4IFVA 3MTDA 5HI7A 1D1UA 1EP9A 3T7EA 4CLOB 2QA2A 4FBTA 1NMEA 4GC9A 2YPYA 3A6HA 2MJUA 1GRQA 3CW2A 3W63A 2EKLA 1EZ1A 2BMVA 1P1FA 4BE9A 1S8AA 3V8EA 1X77A 5FPSA 1HOTA 2Q5OA 4F4HA 2FZ5A 4F0MA 1TMKA 2GA8A 2XB9A 2Z4SA 4B9EA 1N9ZA 2Z43A 4G63A 3MWKA 1KHWA 3L4EA 2XNCA 1H2BA 2QVGA 1NUSA 4MUNA 1KPIA 2B43A 2IM2A 1RWOA 4QHSA 3D3JA 4RD6A 5F3ZA 5KNBH 2QMXA 1BE6A 3JS9A 2Q9BA 3IMCA 1NRJB 3OUZA 3OIUA 3D02A 1H7WA 2MKIA 1N0WA 5T4FA 2ZLBA 3EFOA 1WMSA 3MBOA 2R7KA 2OVFA 3EBLA 2PI4A 1P6TA 1GQ2A 5EC8A 2JGAA 2H1RA 4KXXA 3SYLA 1G8GA 1NBMD 3CF4G 1UR5A 1Q86T 1B00A 2QE7A 2ZFUA 4D3SA 2HW3A 2Z2KA 2F9MA 1S1XA 1Y42X 1WF6A 1U1GA 4UEJA 3ROPA 4DX5A 1AS3A 4DN0A 5KC8A 2J3KA 3AI1A 2X3DA 1JNZB 3WVNA 3GYGA 4JV0A 3KQVA 3KOYA 3G5AA 1CUYA 4XYBA 1GGKA 2B36A 4LRXA 2HHVA 1PDOA 1ECJA 3CB2A 2WSSD 4KI0A 3CDAA 5ICFA 3EVCA 2HJVA 1R5BA 3CSKA 5KFEA 2CXHA 1DKRA 4GRIA 4YJGB 4F4CA 3CZ5A 1ZN7A 2R7TA 1T4MA 2O0HA 2WIBA 2RCYA 3ZOZA 3WMEA 5FI3A 3WB9A 2WOOA 2V59A 2W4MA 2ZM6J 4KDRA 1MIOB 1QUVA 3L0BA 2ZCUA 4IAOA 4R5HA 3DHNA 2H65A 3FDZB 3T9BA 1N0HA 2RAPA 4BMOB 2UYHA 2P0YA 3LANA 5BURA 4X85A 1UBFA 4HYTA 2D2XA 4WOPA 4ALNA 2R6HA 5LMNB 1CC1S 4GU5A 4QEKA 5CNKA 1VRQC 4C08A 2AP6A 2GJ4A 1U6KA 2G1JA 4WY2A 3DMFA 4DJEC 1JG2A 3PTAA 2ZSHA 3EXHA 2I7CA 4L8YA 1HRDA 4H35A 5IKPA 1WE2A 2L17A 1BGXT 3K5PA 1TMJA 4RXTA 2D06A 2YY7A 3TL3A 3D4JA 2H59A 1YCDA 4OA8A 2OD6A 3BJMA 3T4PA 5A3VA 5E3QA 2YWEA 2H9YA 4NYIQ 5H1SV 1S2NA 1G0OA 1L8QA 4LK2A 3SEZA 3AXKA 2VBCA 3JAWA 4OI6A 4DEVA 4BKRA 2V68A 5DH9A 3ET5A 1U0GA 1XR3A 4EZ6A 4HJRA 1SZCA 4S1PA 3SICE 1EB0A 3CX4A 4DKXA 3G0IA 1OMSA 3WLOA 2AVNA 1IRIA 2U2FA 1FC0A 2IVFA 1GAWA 1N75A 1NUAA 3OA0A 5IVDA 1EBFA 3QBVA 3TLMA 2IH5A 4Y6QA 1MW7A 2YVKA 2GQ0A 1N1GA 3GEDA 4ANEA 1N5OX 5F5NA 3LNCA 4J8PA 4AUNA 5A4AA 1WZIA 2P3SA 4R9RA 3F78A 5HQ8A 4I9UA 1JZTA 1ZBQA 1R4NB 2XYHB 2RVJA 3B78A 1PJZA 1DIGA 4F93B 4EMSA 1FWPA 1Z8NA 4RMJA 2OVBA 4FXOA 2WUFA 1Y1SA 5JMWA 2Y1EA 2OYRA 1G7CB 3HYNA 4C8MA 4BHQA 4MLZA 1R12A 3QE9Y 4EHAA 4FDTA 4Y2KA 2NXEA 3UYLA 3ECCA 1D5CA 5DHQA 3MFHA 4W99A 2F1IA 3NOXA 1NPYA 3WX8A 3W8GA 1RHJB 4EQZA 3GUHA 1JDPA 2VG5A 5LJ3Y 3C3EA 5DXFA 4DLXA 2FPHX 5A8KA 5DE3A 1NT4A 4MR8A 1T9GS 1GMWD 3C7DB 4NJOA 4HDMA 4N18A 3WWOA 3QKIA 3ZU6A 1BFDA 2H06A 3FLEA 3DHVA 4ZHQB 2JEZA 2D3UA 1W96A 3E9CA 1D7OA 1GU0A 2PZLA 1P5JA 2HLDA 4RW4B 1E0JA 1WEXA 5A5VA 4MW5A 4URSA 3CUTA 1TL3A 1T5LA 2D3TA 2EFNA 2M8DB 1W6UA 3VYTB 1OZGA 1Z0DA 2ATVA 3HCOA 1LKZA 4UEQA 4ECAA 2VQSA 3NDBB 2XRZA 3ICWA 5IQQA 4OZ3A 4DCUA 4RTKA 1PILA 5HFAA 1BDJA 4QGSA 1QUPA 2IT1A 3EXFB 1TCVA 2OXCA 2PUTA 4EYEA 2X1LA 1Z0KA 4JV1A 4CO2A 4P22A 1UBUS 3VPBA 4YRFA 2QL5B 3ZJ5A 1EDDA 4G0ZA 3PQ6A 4PX2A 4KGZB 5K3AA 2OAP1 1KEWA 1FTCA 4ZAXA 4HEA9 3PDUA 1GUYA 4F12A 2R87A 1RHQB 3HFZB 1CJVA 2BFDB 5FOXA 1P2DA 4WYLA 2C54A 1DTEA 4V0RA 1RFLA 1GJRA 4UUXA 1U6FA 2WAXA 2QRPA 1QAXA 1L3UA 4CQNA 5CHCB 2HQIA 1D09B 5C7LO 4Q93A 3BGUA 1GUZA 2RF2B 5ARCA 3CH6A 1E2LA 2AG5A 2ZSKA 2OXIA 2H0RA 1ZBTA 3L8EA 3IDQA 4PQUA 4P75A 2W2KA 4DZRA 1UK9A 1M0TA 1E1NA 4BNVA 3SCIE 4USIA 1B43A 4D57A 3Q8MA 1B4DA 2D2FA 1VKNA 2H7YA 2Q45A 3ICPA 4O5AA 4BBYA 4UMVA 4FGZA 2OIHA 4LQDA 4RIGA 4RW7B 3R5DA 2OBYA 4EZ9A 3EPPA 1EP1B 4KVGA 4WUTA 4B6JA 1SV5B 4BC7A 3CJ4A 3Q41A 1L4NA 2BH2A 2IYZA 4DGSA 3GEPA 1RHMA 3UK1A 2JZNA 5EZQA 1PUJA 3D6TB 4OJKA 3K31A 4OPMA 4ZVTA 3EXEB 2UVRA 4KQXA 1NR1A 2JBHA 4PLVA 3VZPA 5AW4A 3FMIA 1PIEA 4P4NA 1XXHE 4U2CA 1KZ4A 3JRXA 5D1HA 3A27A 2AEEA 5BNZA 1FX0A 2I0XA 4AJEA 2QQGA 2CLIB 4I2PB 1MDBA 5L8RC 2XUKA 4XE5A 5AKHA 1RXOB 2QVYX 1PJLA 2Q6TA 5TX7A 3PHJA 3G82C 2OI2A 4I4CA 5TMPA 4LQ3A 3HDQA 3S68A 1NULA 2ZJAA 2JFQA 4UKDA 4JVLA 3QLVA 1JP7A 1SIBE 5D5HA 1N32F 4Z6KA 3PNKA 3EY9A 1F4PA 2CXSA 3S1LA 1G59A 5BNTA 4Y2GA 3CEPB 5DYWA 3AB3A 3TJRA 3SSNA 4WXRA 1V9LA 1OYVA 5L9AA 4HDRB 5CCLA 2DKOA 5L7TA 1TQ4A 2VYQA 4RE5A 4OYYA 5CH7B 1TUBA 1Q82T 3H18A 3QG1A 2NYIA 2F62A 2VC1A 4FOOA 4ICLA 1ZXBA 1HETA 4GZLA 1ZM2A 3ONQA 5IZ4A 2W2XA 3GFTA 3K57A 2PS3A 1PFWA 5JCXA 3Q88A 2QVLA 5IN4A 3H40A 3H8VA 4RV9A 2NT3A 2VKRA 4OBEA 2EQAA 3DP7A 3BMXA 2LV8A 3L7UA 2QRQA 3G6XA 3R24A 1VMEA 2CK3D 3G89A 1P5ZB 1KTIA 3I55S 4PXDA 2O8EA 4DR6F 3VR3D 3EZXA 7REQB 1CEYA 4Z7OB 4AZ0B 3Q5DA 2A1TR 5H81A 5F3DA 2HDOA 5KX5F 3A1FA 1CD5A 2XJ9A 4NCBA 1SC1A 3C3DA 4QYMA 2M6RA 3TBKA 2XZTA 2OTCA 4RD1A 1MG7A 2OPRB 4CLFA 1ZQ1A 1ECPA 4MIEA 4GYJA 3UAVA 3ZVMA 2X86A 3C87A 4DXHA 4NCHA 4RGQA 5KQPA 5I7FA 2O3TA 8ABPA 1XZKA 3KPJA 1NWCA 2IYLD 1E5XA 3LALA 2IC3B 2XHWA 4KKOB 4KHPJ 3R5JB 1PR0A 1OQAA 4AAYA 1IUOA 5B6IA 1PVOA 1HA3A 2XWPA 3IT0A 5JCJA 4KQ1A 3MTGA 3NGXA 4JFAA 4Y34A 2LXIA 3PW0A 1GCOA 5KFOA 1GGMA 4K6HA 1FLAA 5DX8A 4N5LA 3MWYW 3RKSA 4AY5A 3K0CA 2XWQA 2VUIB 5KIAA 4H60A 4NOHA 1Q1KA 2DFPA 5BR8J 3D8RA 1X1CA 4WSOA 3BPSP 2GLTA 1SQGA 1VRCA 3H2BA 5TVGA 1U04A 3W1WA 1YRXA 4MLCA 4EX7A 1ZZFA 3DKVA 5HNKA 4GRSA 1CS4A 1G3MA 4RZQA 4OYOA 5TQVA 3MLAA 1G8FA 5G0RB 3DAPA 4FFDA 1AKYA 3DMHA 3FWKA 4O4IA 3GNLA 1RB0A 1M1ZA 4BU0A 1NUTA 1OX4B 3H42A 2WVAA 5IMSA 3IQEA 2X9QA 1NRWA 4G4IA 3F47A 2ZH7A 4E3WA 2IP1A 1JSRA 3MMNA 3QVVA 3ZXUB 2BFPA 2EWVA 5LYJA 4DL4A 3D0RA 3SFZA 1GTSA 2MIIA 4JIMA 2HVHA 4ALZA 1DPFA 1D2CA 1EQ2A 4G1QA 2ZYHA 1WDTA 4ARUA 4FWBA 4DANA 2VEDA 2G77B 2VBZA 2ZB7A 1UJ5A 4RQUA 3UEOA 3ACDA 3ABSB 2HHAA 2KM1A 2P68A 1SN7A 3Q8RB 3QI2A 3UHPA 4MAKA 1EK1A 5I3ZA 2FZKA 4RPGA 1Q12A 4JP3A 3NHWA 3N5CA 1XV5A 3EVZA 4ZANA 2WSLA 4KPUA 3BMQB 2V8PA 3KAPA 1SRQA 4GVPA 4L4UA 2CL7X 1NPDA 4JGBA 1B3BA 4YLGA 3R8FA 4IFBA 2F4NA 1JVBA 2ADMA 2IZ1A 3FRHA 2ZIGA 2PMFA 3K4HA 3GRZA 4ETMA 3OLBA 2E85A 2ZIZA 4J4HA 1MA3A 3I92A 3KJVB 4EY5A 3UXHA 3TUZC 1LEHA 3WLQA 3ZD8A 2W0SA 3FAKA 5KI6A 1NAHA 3KDSE 1R4MA 1WS6A 4NLPA 4O0NA 1QGZA 4LRUA 2ATEA 3V7YA 4P6VF 4AO7A 1BHJA 1BS2A 1KEKA 2PKQP 3A4IA 5BSFA 2WF5A 3RVBA 4MUFA 1W52X 3WLIA 2ORWA 4KTTE 1E3QA 2FCAA 4RS3A 2XLCA 4ADSG 1C4KA 3VU9B 2OQIA 1I36A 3M30B 3FUTA 2ZAIA 4AC9A 4MEAA 2D5LA 3DDZX 5TQ0A 4RL4A 3W2EA 4RORA 4AQYJ 3NJ4A 5KFZA 4RA6A 5IU6A 4KT0C 1J2JA 2QIPA 3DMTC 1S4FA 1ONOA 4NE9C 4IFIA 3NC4A 4JQCA 1VI6A 2AX1A 3UV3A 3LLSA 1NX9A 4CKCA 5K3FB 5FPYA 3NPAA 1I3CA 4MWSA 2L19A 2B4OA 4HEA6 4JB0A 5ELXA 1A7UA 4DHEA 4FKMA 4BP1A 3ASVA 1HQ2A 3EZ5A 2H8KA 3B51X 1EX7A 4ZIVA 3THYA 3QT8A 3MPDA 4UQTA 1T9CA 1TCCA 5DT9A 4ZAWA 4QUIA 4KQ2A 4FOSA 1X1TA 4P34A 1B41A 2EFEB 1TX4B 5IBPA 2QW1A 3BTOA 3N2KB 2VDOB 1VBNA 2JHEA 1O95D 4B08A 4XTTA 3GJ6A 3V6JA 1V48A 4PSVA 2W71A 2WU3A 3PIRA 3T94A 4BN4A 3OD5A 1VECA 5EZYA 5G0UA 3LDAA 3ZDCA 5SYNA 1XMVA 4PO8A 4JI3B 1EVZA 3LY8A 1ECGA 3W8FA 1IYZA 3DWFA 1G21A 1I80A 4S0XA 2QG9A 2HHLA 4Z4IA 2ONKA 3RFCA 4M7RA 1E96A 1PFKA 5AW0A 2VDPB 3RB8A 4IIHA 3OOEA 4B9MA 1WORA 3LY9A 4IICA 2AQHA 3F1LA 1AKTA 4D56A 3ER8A 2QS9A 5HBMA 2WWWA 5IT4A 3FNIA 1KIMA 5J4KA 1V6AA 3FBTA 1RCTE 4WZBB 2CNOA 4IZOA 4O59O 3IEVA 5DTIA 2A14A 3BBFA 3HHLA 3BJYA 1T1EA 5EWMA 2YZKA 2V69A 1SGWA 2D7SA 4IINA 4LSZA 4CHTA 2XVAA 2UZ4A 3KCNA 2CPYA 2V7QA 1CRLA 2YH1A 2DHDA 4LZWA 2OO7A 3HUEA 3IS9A 5M3BA 4FNGA 4DUTA 2ZH5A 2V7XA 1C8VB 3DPSA 2OFWA 2G3YA 2FWPA 4F21A 1D3WA 3RS7A 2FRDC 3CO0P 2AUTA 2MHNA 1PJ3A 1TTHA 2ZK7A 3ER6A 1ZI9A 4EYQA 5BVGB 2ZUUA 3CH4B 3QV1A 3N0TA 1JLHA 4KK3A 5B2ZA 2DTXA 1O6GA 4OQQA 1C4OA 5EPOA 3L0CA 4QTYA 5AQ1A 3F46A 5JXSA 4KAIA 1W1WA 2AMYA 1GILA 3O8RA 4Z0TA 2O5CA 1J2EA 3RYCA 5F7OA 1E1QA 3WFIA 1GMVA 2XWXA 4H4MB 4LF1A 5AYVA 3AHCA 3ET6A 2VF8A 2B9VA 1Z2EA 2IPOB 3R7NB 5CAEA 2AX0A 2AI1A 3QMVA 4ARSA 2FHMA 4GLLA 3M9LA 4P4GA 4E13A 1X4AA 3VSAA 1OBFO 2P79A 1J00A 3OQNA 1N7IA 4O4HB 2WYWA 1WY5A 2HIAA 2PTHA 2OXRA 3SU8A 1U2FA 2C61A 4AMZA 5HROB 1IN0A 4ZK2A 4XLTA 1CG2A 1XEAA 4E2XA 3H3JA 1TL7A 4Q3DA 1WPRA 1JQ3A 1O6BA 3H5NA 4BKUA 4K9MA 1NLKL 1WZCA 4DV7B 1M9NA 3DVQX 3HHKA 3S29A 2FQXA 1VRWA 3RRJA 2N3LA 2L48A 3OPQA 3W60A 4JXJA 2B61A 1VYTA 1OI7A 2B3TA 4GVLA 2PZGA 2RARA 1Z12A 1NRIA 1DDOA 2GEKA 2H1FA 4NYMQ 3S8SA 1XHFA 3RQSA 3JAMY 2YHUA 1I5EA 4LF9B 1VHLA 5AI8A 3TXAA 2D5AA 1F17A 1YBUA 1BXNA 3ED5A 1VISA 1RTKA 1WL8A 1UJNA 3KXLA 1YJNS 4DCPA 2G9VA 4WOKA 4U2GA 3R7WB 2A1UB 3V1NA 3UPUA 2TYSB 2R751 2RUGA 1RJGA 3RYHB 1H6BA 5DYNA 1EVKA 4MJ3A 3GHHA 3TZ6A 3SX2A 4D9IA 1Z62A 1KP6A 1CS0B 2JFZA 2NVWA 2BFNA 4RF3A 1TL1B 2IYFA 3ONDA 3BF4A 1RFGE 4DIOA 4M1WA 1JS1X 4BNYA 4RLQA 1GZUA 1LQ9A 2IEDA 1DARA 5BMVB 3UB3A 1YQGA 3R0QA 2ZSEA 5C0OE 1V3VA 4JH0A 4L50A 2ZT6A 3EVBA 3PL5A 3EG9B 2BR3A 5J2TF 4GPEA 4C7KA 3HVKA 2P2GA 2O2IA 4RY0A 3CLRD 4OSEA 2HQGA 4BC9A 4X92A 1RTHB 5ETMA 4NXMF 4HNVA 1LWEA 1VHIA 3RRHA 3R3XA 3GGDA 3CVYA 4GO5X 4NBSA 2C88A 3WLMA 4AXJA 1QOQB 4MQ5A 1JALA 2O7VA 4IH1A 2QLLA 4Y6SA 2CNNA 1Z26A 3ZNJ1 4Y1RB 5MFPA 5ITZB 2CRLA 3HVWA 3KVYA 2NW6A 3ZGYA 3DEYX 4G2TA 3AJ1A 5GZ1A 3D2CA 1GRVA 3ZS8A 3M8QB 1SH2A 2PMWB 2F3PA 5SYAA 3ELYA 2BI8A 3BBLA 1RKIA 3DT6A 3EX7B 3FYUB 5I7HA 2ODNA 1TC2A 5ETPA 4D3GA 2H07A 4GP7A 4PRLA 5TLSA 1Z0ZA 2IV7A 1VGQA 3WB0A 2XGQA 3UNXA 2B8QA 5HN0A 1KH3A 2AV6A 4WCVA 3S1AB 1G7SA 4FYXA 2ZXEA 3H9EO 5DK4A 3AXSA 5D1NA 1VQPS 5HJ5A 1IDOA 3SIRA 5KJCA 5JD6A 3ADOA 3M70A 3P5TL 3IUNA 3TNJA 1GSAA 3OR1A 1J9GA 2ZI6A 3TAPA 1R4ZA 3G2LA 1VCTA 1E2DA 3PZPA 1C9DB 5IUNC 4C0SA 1E99A 4B6GA 1F0KA 3O92A 4R7TA 1G3RA 3OQMA 4DDTA 4BO2A 4M1QA 4UQPA 4UU1A 1OZFA 1RABA 2HIQA 1JKIA 3GJ5A 3UJ3X 2MZTA 1NAIA 1WHWA 1L1QA 1SCKA 1KYWA 3IJPA 4IF6A 5B7NA 4A4DA 2PXXA 1B8PA 4DX8H 4XJTA 2GZ3A 4BXOB 2I4OA 1G4CA 1TUGB 1TOAA 1SY7A 3UDLA 4NYJR 1PR2A 4KDCA 3DF9A 4PWWA 3BGSA 1PEYA 1ACLA 1YZ7A 2MSDB 4HI2A 3QLEA 3CRNA 3MR7A 1E2IA 3JYTB 1UXIA 1L9KA 1PSDA 1M34B 3A7DA 3IAM9 1NLFA 3PD0A 3AD7C 2EP5A 3G1TA 4PZ0A 3KYCB 3C45A 4FVMA 3U1BA 3I8OA 4INJA 4L9SA 4BCBA 3KOZA 3O8QA 1BQEA 1UKBA 2CDRB 1NY5A 5JBIA 3R9IA 3BIWA 5AIBA 3SS8A 3T1NA 1YFJA 2UUBJ 4AKEA 4F5WA 2XUPA 3IDZA 1IZYA 1UFLA 4RPKA 3KLIB 3QSIA 1LTHR 3EGWB 4URVR 4KIGA 1DTTA 1GNPA 4H3HB 3TP2A 1Y10A 2IU3A 5HS4A 4HVZA 4ZZIA 3TW6A 4FBUA 2FN9A 1D9AA 4LRYA 3RR2A 3SM3A 1FXDA 3PENA 1UIRA 3DLIA 2I5JA 3LSYA 1VJ1A 3QTTA 4MQ6A 3DE6X 1Q92A 1XVIA 1KL7A 4DFKA 2BEUA 3D59A 1J90A 5EHQA 1QG0A 3IO5A 1Y6GA 3E9NA 5K0CA 3AHGA 2H4JA 5BSWA 3AOBA 5E2BA 5A0TA 4OX9Y 3B8HA 5AI6A 4C4XA 1W1UA 3CVXA 5FI0B 3OAAA 5MGNA 3ELHA 3KQQA 1YKGA 1M67A 2C5BA 2PXAA 5LOQA 1B6RA 1XMOF 1WW2A 2A5FA 3H2SA 2WUDA 1KEEB 4L0DA 4EMBA 1ZD9A 2ANBA 2PT9A 1JX6A 2JBAA 3N8GA 3H2ZA 5EYPB 5D5PA 1LV8A 4CG2A 3BCUA 5HIIA 2A0FB 5L4LA 3BWEA 4WFIA 3PIDA 4MI6A 1QYVA 1FTSA 1XJWA 4FVCA 2W6MA 4MKHA 4LMPA 5A8WB 2GEFA 1ODSA 4OLBA 1RHKB 2FYTA 1EFDN 4ZQBA 4P38A 121PA 1N36F 1NQAO 2GJFA 4ZLLA 4NPAA 1IAQA 1W36D 3FVRA 1FKPA 3GFPA 4IGFA 1DGQA 4GICA 1DC8A 4FN5A 1XVVA 3JYPA 1F60A 3HB4X 4KO4S 1E6CA 3MINB 1XWLA 3N28A 4KQFA 2JCYA 5HJ2A 4DM3A 1HNXF 2YKGA 4D0SA 3QVOA 5EUBA 1J9ZA 5HILA 2EXUA 1OS5A 4R05A 2QQFA 5JSZA 1M83A 4KIFA 2YX1A 4EW6A 4BATA 1G5PA 2EW9A 2RGEA 1QZZA 1JEJA 3EPIA 1F0NA 1HTBA 3IHTA 2H85A 1WCV1 1EETB 4V1Ak 1TKCA 4KWEA 1QV7A 2QRRA 3EQ9A 1SUDA 4ND3A 3E48A 4QJVA 1Z4JA 3NOQA 3M6IA 4BMPB 2R4FA 4NKRA 4QPPA 1E2MA 1QKIA 4KYVA 3QW2A 1SVWA 3JQJA 5JNUA 5EJAA 3E7WA 1U0HA 1C1XA 4HGQA 1LBSA 2HLHA 4K9OA 3HQ4O 2HK7A 1CY7A 4B4OA 1IKVB 5C32A 2DT8A 4TTPA 2WB4A 3DOIA 4UUMA 3M2UA 4D4KA 2ODWA 3FN4A 1JYEA 3SC4A 2BCGY 3OSUA 2VQ3A 5DT2A 4K9SA 3TSOA 3VDXA 1JIKA 1PG0A 2BKPA 1UOPA 3G2MA 4EVSA 3MM8B 2OGTA 4M86A 1BXGB 3ZQKA 3K5IA 3OR2B 2A92A 1Y9DA 4DCGA 4BX8A 1AK2A 3ENQA 5ALGA 3BS9A 2HA2A 1SH0A 3IYLW 1O89A 2G0IA 3HPRA 4MVJE 3ADCA 1Y5LB 4ED0A 3TSAA 2IS6A 3GRVA 4RK5A 4CCAA 2QLTA 2PMHA 5J4LA 5BWCA 2YCBA 1CF4A 1JXLA 4NEZA 5KKAA 5FLXA 1KNXA 1S1WB 2Z09A 2R2UA 1JDTA 1JXMA 2NUUG 1HW9A 5L6LB 3HCNA 4AD8A 4RUHA 4MI9A 5C1PA 4FS1A 4YCAA 4E4YA 3AJAA 5CVTA 4P3KA 8ATCA 5JD4A 3BGFA 4L4RA 1FDWA 1QB7A 1WC5A 3M6FA 3MWDA 3O2NA 4BNKA 2CMDA 3EGIA 4X94A 4AD6A 1M72A 3BB4A 3LD9A 1SKUB 4MB6A 4KW7A 3IE2A 3RWMB 2IIPA 4J2HA 4QFBA 1FJ7A 3OLVA 4HZIA 3WBKA 4L74A 5LQJA 3T4UA 2FXVA 3N2EA 1DCTA 4TS3A 3QLHA 2Y1OA 2CUZA 4RX6A 1TVRB 5KFIA 4IILA 1A5TA 2LBPA 4MVJH 4GQAA 3SOZA 4WGFA 3PHCA 3DS8A 1I1NA 2QRVA 2HCRA 3CXRA 1KFDA 2BELA 2DGWA 4AYBD 4J76A 5FEMA 5IAOA 1DAPA 4FVTA 1LV5A 2VC0A 1X80B 3I05A 3GJYA 3GQBA 4F3KA 2UP1A 5AJYA 2OAUA 1U7DA 2I1LA 5AVQA 3HSZA 4TU9A 3SIWA 1T1RA 3M8PB 621PA 1CPZA 2AN3A 2CD7A 1VA4A 2GHQA 3WYDA 3R0XA 2VSFA 2Z57B 1RISA 4D0RA 1F5NA 1VL6A 3PB3A 2R5WA 1HL7A 5JDIA 3EODA 4BLPA 4E09A 3OJEA 4BN0A 4CM8B 1CDDA 4MEJA 4KN8A 4AB1A 1FDUA 4IIFA 5IUKC 3KTAA 2HK2A 1DOZA 1NHVA 5FIUA 2YOFA 2VJBA 2HMSA 3ZZNA 3JS5A 4EHBA 4HXEB 5DULA 3RJ5A 4LPKA 2ZIWB 1S6YA 3D6FB 3HNRA 4R1TA 4WADA 1L8LA 3I01A 1JLGA 3LPDA 3TQHA 4TMZA 3FNGA 2AT1B 4GECA 3R0VA 2H4WA 4QG7A 1DXHA 4ILMA 4NZZA 1WG5A 2AVDA 4YRQA 1MABA 4ZIWA 1R0ZA 4YCBA 1B23P 2V2QA 1YZHA 5AT1B 2ZRPA 1W0KA 5L9NA 3L0IB 3I2JA 3O8BA 2R8JA 1AS2A 1XMXA 1BX3A 2PSEA 2MKHA 3K2YA 3PGA1 1JLAA 4PRKA 4BTEA 1GKIA 2ZDHA 1YJTA 3QUCA 3ITEA 1U3FA 1Y9EA 1JR3E 3PJEA 1SU6A 3EQ6A 1L7BA 4KAJA 4UCWA 1L4MA 5CG1A 2OPBA 4ZPBA 1KK3A 3NBZC 3IAM6 1ZOPA 3CEDA 2IQIA 2QW0X 3L06A 5EHZA 2VP9A 2QN2A 1HE8B 4LRSB 2ISCA 4ZCQA 3U7IA 4ZQEA 1ULSA 3DUWA 4MGHA 2AYBA 2GYVA 3IRUA 3KLBA 4CTOA 1Z4IA 2VK1A 2I3DA 2DR0A 3C3AA 4ZIRA 1YSCA 3GRYA 4RKFA 2P5UA 3NVKI 1GFSA 3EEFA 2ONCA 4GEGA 1XU9A 2YNFB 5AKKA 1F0PA 4KNVA 1FRNA 3TLGA 1RWQA 3OEHD 3IUJA 3QZUA 4YB7A 2UU9F 3INNA 4TMFA 4MVYA 2QQ0A 3QPDA 1UMBA 5AK6A 1VGRA 3UHAA 2PYIA 1IM8A 3D4LA 3SZMA 1TE2A 1F6DA 4KZKA 1NUPA 4BLTA 3P5BP 3ZU5A 4OO3A 3KT6A 2RHWA 4OHFA 1ZBDA 5GMDA 3C24A 3ESBA 3UNYA 4YMTA 2VDUE 1ACMB 3RV4A 3U48A 2H3HA 1T9YA 3G79A 2QN1A 3ONWA 2B1RA 2ODAA 3VAHA 4F45A 1RU2A 4MVJF 3BJEA 3OBIA 4B3TB 1VOMA 1QQAA 1MP0A 3KHKA 3ZW8A 2XRFA 5B3AA 4X4PA 2LCQA 4X5OA 5C4IA 1CB0A 3OIVA 1GXLA 4Q19A 1LSUA 3QX8A 4KO8A 4GL4A 1H3EA 3RLIA 1QB8A 5F5LA 4H6WA 5KWJA 4HQRA 1OI3A 1CEXA 1Z7WA 1Y5IA 4I6GA 2IXBA 3GELA 4L2IB 4OQPA 4HQLA 3BMNB 1Z2PX 4EG3A 3CRRA 2BR0A 1ISRA 3SR3A 1Z28A 4K81B 4KAAA 3POTA 3MUOA 3A9UA 5C51B 1EG2A 3QPIA 3BSNA 4RADA 2ZBCA 2BUAA 3GXBA 3M6UA 4DQ0A 2QLFA 4AJ1A 4X4SA 5JAMA 2BBEA 3I12A 3DV0B 1J7JA 3O5AA 4JLNA 5FTJA 4LR7A 3ZTYA 2W6PA 4Z7QB 1XRRA 4A5SA 1I14A 4ZTUB 5DM70 1GARA 3OFNA 2PKRA 1KJ9A 1NA5A 4INOA 2HWTA 3S2YA 2FPPA 1PWHA 2JD0A 3CEJA 3TPZA 3RT7A 3WZLA 4DYHA 3NYRA 4TLRA 3M4YA 4QTTB 1A5ZA 4JLKA 1LPBB 1HDGO 2IHKA 2KG1A 1P19A 1WHYA 3PHGA 3G82B 3K09C 3NXKA 3PKZA 2BFMA 1JZQA 1ZG3A 1VJ0A 2BOAA 2HRBA 5C8ZA 2YQ3A 2F00A 3ZV3A 5AJ3F 2FHOB 1G17A 4MV5A 1IEVA 5JMOA 4M76B 3FYUC 1UPPA 1LLQA 4HF7A 3CLUD 2MYUA 4Y1EA 4F8JA 5E6SA 5ELMA 1BY9A 2NAPA 2PGIA 1GPAA 2RMLA 5L1JA 3ETHA 5LZ2A 1HZZC 1MKYA 4DQKA 1VHFA 4AX8A 5I5GA 1BMQA 3SN6A 3GUZA 2ZBDA 1OYOA 1ZU5A 2ERYA 3PCRB 2JC1A 3BN3A 2BEWA 3NI2A 3W06A 1QP7A 2PJRA 4FS2A 5LVAA 1BEEA 1P9YA 3KQPA 3EFEA 2VJMA 1SXHA 5DEIA 1CIPA 2CWWA 4ZI7A 1ADGA 4JBCA 4DIBA 4XWGA 4GEKA 1PJ2A 1W76A 1XA0A 2F6RA 3LTNC 3S44A 2J5XA 1NBEB 1VRUA 4PN3A 1SIWA 4DV4F 5KYUB 1PR4A 2GS9A 4RTNA 2E9RX 2X19A 2FG6C 2WKSA 3TX6A 4GVBA 1KI2A 1M2GA 2Z8YM 4GT1A 2KRBA 4OQMA 2P35A 4EF6A 1IVZA 3CUKA 4X93A 3BOSA 3H9BA 1NK7A 1QDEA 5IDYA 2VATA 1GR1A 5F4ZA 3OOSA 3I61A 3VKFA 4KR2A 2YIMA 1FRIA 4NZOA 1S3FA 4QBIA 2DRDA 5CB4B 1S0MA 3ZWDA 1GFZA 2H2IA 3ZNNA 3Q3IA 4MRMA 1T2UA 2BEJA 3K6RA 1JJBA 4FYJA 3ZZZA 5CYOA 4PUOA 2B8TA 2I8LA 1ZJ5A 3LP8A 2AGPA 1U26A 4DR1J 2DPHA 1BDMA 4A92A 1JK9B 1J70A 4USKA 1V95A 2UUCF 1X4GA 5DI3B 1FVXA 4OYPA 3FFAA 2AMVA 1NOJA 4AJJA 3HM9A 1E89A 2ZH2A 4AI6A 4XASA 3VC3A 4UHFA 1Y3CE 4PIVA 4G4JA 5AKGA 3GE9A 4YRDA 5AXNA 1RHRA 4TV8A 4MPPA 2XEDA 4HX2A 4JZKA 1OLXA 4DPXA 4FEAA 4C5AA 1P77A 5SICE 2P9EA 3TARA 3E61A 3X2EA 4CM7A 4DPUA 2XHEA 1CT9A 3DOOA 4IEIA 3OVBA 4N8NA 5BT8A 3U6BA 1U1EA 5CFPA 2CWKA 2IHUA 4DR4J 1SOWA 1NXOA 3D54D 1XNQF 2QMYA 2OORA 2AMCB 4I6WA 3FHOA 3EY4A 3FG9A 5CA0F 4V1CI 1RAGA 4Z1MD 3U4GA 1GG8A 4K2AA 3ETDA 4EFNA 2X8JB 3EZGA 4QBTA 3I04A 4K88A 5B30A 1TA9A 3PPYA 2WEKA 3NS7B 3MMCB 2AZ1A 3H7AA 1NMQA 1CHNA 1EFAA 1SVUA 2D4HA 2XXJA 3WKCA 3B3AA 2SKDA 3RRNA 2GR9A 5BVHB 3K1ZA 5BYJA 1G18A 2J0SA 4X9XA 2B4RO 3MWFA 3SQGB 4JJFA 1Y6RA 2AQIA 4PXBA 1ABFA 3AVQA 1GFIA 3IP7A 2C5GA 2MGZB 3D6MA 2ABYA 4TWIA 3IM9A 5DRKA 3HLUA 1NAQA 1Q7TA 1Q1BA 5KYWA 5CT8A 4WKNA 1EGQA 4DDHA 1TKBA 2H7CA 5EZ6B 1TVKA 5EY5B 3PFHA 4L28A 1GNVA 2IW1A 3ZU2A 1F9FA 1VJQA 3Q7IA 2SHKA 4EQ6A 2V6MA 4RUBA 5LYYA 4L3NA 4K4TA 4JVSB 3T1YJ 3KSAC 4HLNA 4DDKA 4QAJA 3HG7A 3M7VA 3IIIA 4R2HA 2AZDA 1TT7A 4EGQA 4MHTA 3ZUGA 1CDEA 2J8ZA 1AMNA 3P9QA 3ZG6A 1SUFA 1N88A 3CT6A 2DU8A 1TRHA 3V6KA 3OZAA 2AE2A 3G2KA 3DRPB 5D4OA 2VWPA 3M2RA 1TNDA 2EF0A 1FQWA 2R8YA 4B5LA 1CR6A 4LRFA 4KYZA 1QHNA 3KSBC 4JJ7A 1H8HD 4IH9A 2IYRA 5L1IA 4X44A 3B3JA 2XGGA 2KFZA 2W7AA 5DISB 2GDJA 2AOWA 1QE3A 1RT7B 4OIXA 2NXNA 4IHJB 2YKQA 1TECE 3M83A 4TLLB 3PICA 1YRUA 1TM5E 3MM5B 3L49A 4RMIA 1V1MA 4EPVA 4FE7A 2RUSA 1E9AA 1XD2B 1U3WA 3HCAA 2OBMA 3ADPA 4F0KA 2H29A 4U7CA 1YVEI 5JSKA 4B9TA 3A70A 4REOA 3NNHA 1FESA 2RI1A 1GUBA 2F43B 2C2MA 1GZ4A 3QXGA 4I56A 5HEKA 3I3SR 3P7MA 2ZE6A 4UCFA 2DISA 3PA8A 3L0YA 1Y3BE 4UE6A 3I5XA 4NESA 3MIZA 4LOLA 1GLNA 5ALPA 1QJHA 3A3PB 3LCCA 4MVJG 1RYHA 4BNDB 2BFEA 4QPCA 3FZQA 4XD7D 3A31A 5TJ9A 1ZINA 2OV6A 1QIDA 1NNSA 2GRUA 1ZK2A 4E1AA 3LX6A 1TZ0A 5K45A 1SMKA 1K68A 4CF7A 3TX2A 4WE3A 4DCMA 5HG0A 4FW9A 1Y4ZB 5AHKA 4LZNA 5EJ4A 2QSZA 2X4IA 3QGPA 2WW8A 2O6LA 3OM0A 1CUAA 2ONYA 3IP3A 1GTMA 4BNUA 5ISMA 3NALA 2UVUA 3RIEA 2VNKA 2Z58B 1UVIA 3JQ8B 5C37A 5ICCA 5JE8A 2YHBA 3ZI4A 3LX4A 2XEXA 1A7GE 3I39X 5LSRA 2O20A 1N2CB 3GBPA 1LQUA 1FNOA 2X9VA 4DMUB 3U4MA 1AM4D 4NYPA 3TRKA 2PWYA 5AESA 1OFTA 4XUEA 1HPZB 3DNPA 5IHPA 2FWIA 4IJUA 4AJOA 3R44A 3NGTA 4IG3A 1WU8A 3FYDA 1U9IA 2WFAA 4CGZA 5B2FA 3VO2A 1J1UA 3LP0B 2FW7A 2H1SA 4N8EA 4ZP8A 2OELA 2P3OA 5E2QA 2HWHA 4OJMX 3TG8A 4TQSA 2PPLA 4IY1A 3TFWA 4KE7A 3RSHA 2UUWA 4XX0A 3ST7A 5AKIA 4IH4A 2J3QA 2QY9A 2K6GA 4AUEA 4Y9DA 1TM4E 1W581 1RWXB 1I2MA 3SBEA 2JVJA 4KBGA 3V32A 3IR6A 1HWUA 1MB4A 5CX1A 2FDRA 4B47A 1UXOA 4UHCA 3F1KA 5J47A 1VG9B 5CD4H 1J5OB 1QJ4A 2PA3A 1NQOA 1NP7A 1FXSA 1IN6A 2IXFA 4PNPA 4O8CA 3UT6A 1E5LA 3IEKA 3PFKA 2FMFA 4RGYA 2FX2A 4IL5A 3PCXA 1GCGA 4IJWA 1U0RA 1GKLA 5KNDA 3HSSA 3ILSA 1GDDA 3AR3A 3CWZA 2NAFA 2W4QA 1Y4SA 1J7KA 3KLHB 1XG5A 2ZIXA 5A8RA 2CL5A 2J6TA 2EZ4A 5DLEA 2XCAA 4JB2A 1NK4A 5KQLA 1P1LA 5ECWA 1GPMA 5J5VA 4FU0A 5KB3A 4RLEA 4J9SA 3C48A 5EKXA 2IHZA 4M7WA 2VH7A 3GWGA 2MLYA 1QQ6A 5DBIA 1VLHA 1P3Y1 4WZMA 3T5PA 3VYUB 1H0HA 3KUEA 5ALTA 2NYAA 4DLYA 4CO3A 5JR3A 2VRWA 1W2WB 2W9XA 1RRGA 4ZP6A 4NJEB 1W48A 2NU9A 4M1OA 1YBVA 2LPMA 2QN6A 5IM5A 1HNZF 4J0JA 4K6KA 1YI1A 3ZV6A 4PR0A 5IDXA 1HH4A 3NGMA 4HQOA 4Z4QA 1KOGA 2EZ8A 5KFXA 3CMMA 1AGNA 3P96A 1E0SA 1BD3A 3H0CA 3RK4A 4S3MA 1LBIA 2OB1A 3FNRA 1O94D 1Q79A 5CX4A 1E63A 3L4BC 4GM1A 4J0CA 3YASA 3DDWA 5ETKA 1E4EB 4NFYA 2H00A 3P0FA 1IM6A 1DUVG 4LFAF 4II7A 4CL0A 1RT6B 3AY7A 4J1QA 5CGQB 3AJEA 4M8IA 4NBTA 4TSRA 3CUNA 3HE3A 2NUAA 2E5JA 3D6NB 4BWGA 1RE1B 4O8ZA 4LNAA 4ZHRA 2XMGA 3LCMA 5DHSA 3VKVA 3W9SA 1ZM3A 3ILIA 5EQFA 2UXDF 3GV8B 4HACB 1BH6A 1Z74A 2B92A 2VWGA 1JKHB 5IX8A 5JBQA 1BKYA 4H1HA 4JV5J 1IZ0A 4KXQA 2YJNA 3NTUA 5KCMA 3BQ0A 4KQ9A 4ND7A 4C0WA 4C97A 2B6AB 3BFKA 4A9AA 2PGJA 3L8CA 1YOVA 4TMWA 1FTYA 1QH1B 2B7LA 4Y18A 2V55B 4JI5J 1F9EB 2AQ4A 2EBFX 2X5OA 4H7EA 3EUWA 3KKFA 2WF9A 5JMPA 1V3TA 3BIOA 4Z9BA 3WQSB 5B1IA 2QBYB 3A14A 4R8UB 5F35A 2V8HA 5IFKA 1X7YB 1IBMB 3QYPA 4CWBA 1THZA 5F33A 3HRIA 3AR4A 2Z2MA 1I3OA 4GI7A 3ZHVA 2IPAB 4CCYA 4L7VA 2J6SA 4IQ4A 4GMFA 1URRA 1GKKA 2O14A 2XNKA 5KTOA 2VUHB 2AWNA 3QYAA 4FDMA 4PZCA 5FPKA 2PX2A 5BR7A 1U3DA 1DAMA 4M87A 5IDWA 1I7LA 1EJ2A 4DA7A 2HQDA 2ZTHA 1MX1A 2ZJ3A 2WE7A 1YR1A 1JBQA 3A12A 5FEUA 3BAZA 1CRPA 4OFWA 2QL7A 1Z2LA 4WIIA 4DSOA 4J2OA 4M63A 3D7SA 3WK5A 3USES 1E9FA 4LR9A 1JBKA 3COSA 1NQVA 2EGUA 1IUPA 1DLJA 5LN1A 3BDIA 2R6CA 3HT3A 3MVEA 4PEVA 3Q8WA 1WKBA 4WQMA 1WDLA 2FN8A 2ZREA 4YECA 2BGGA 4X66J 1LI7A 3CKYA 4BRZA 2Y6UA 1WJ9A 4DUYJ 3A6GA 1UPBA 2BBWA 1VL8A 1U98A 4UM5A 3PJRA 4HNRA 4AMGA 4RU1A 1RAAB 4EY3A 4C6TB 4CEHA 3AIIA 3CYFA 1KO4A 1RACA 3JSMA 4O2BA 2P6OA 1PN3A 4LY9A 4U02A 4LRDA 3N5FA 4USJC 2NT4A 1XTTA 4LF6F 1S4MA 5GADl 2JW5A 1XRNA 5HMZA 1FFWB 2DGTA 3SF8B 2DERA 4MA4A 1C0PA 2QGZA 3VOBA 2MU1A 1TVCA 2XZOA 4WV3A 4JI4F 2OFHX 5K2OA 4Y2HA 3DDOA 2IWRA 5I7VA 4ZVOA 1SUQA 3F44A 4AYXA 4ZCLA 1WY7A 3PLRA 1FXRA 3KYBA 2G0CA 3RIXA 4I66A 4DQDA 1SXJC 3K71B 2PZBA 1REQB 2JIOA 3H9JA 4D41A 3E2EA 4PYLA 1UBLS 3U0VA 5F7ZA 5JS2A 2D74B 3VNRA 4OGWA 5CW1A 4XDYA 2H51A 1I2DA 5J2MA 1ROFA 1M3SA 4N5MA 5EUMA 4TRRA 5LLSA 5CXQA 1KJZA 1K0FA 2VXCA 2EQBA 5CFZA 4BEJA 5GIOE 2Y8WA 2PKEA 1S0OA 4I9HA 1NBHA 1EVIA 2Y4NA 3ZE1B 2YV4A 1V7PC 3TLAA 4C11A 2QEXS 3KHGA 4NRDA 1LSSA 1T05A 4AWAA 3AAWB 3WFZA 4UUQA 1GIAA 4HXGA 4MITA 3Q40A 1R37A 2NSLA 5B1DA 4Q4JB 4DNFA 2BJ1A 4D6PA 1SCIA 2Q21A 5D85A 4RMNA 1HI9A 4WFZA 2FRXA 5D84A 2OP0A 1GU1A 4BNZA 2Q6OA 1CJKC 4UVDA 3RVQA 4RIEA 3D7MA 3QNWA 3C74A 4EB6A 3PGVA 2YN4A 2DBRA 4OZ5A 1U28C 2MYTA 1XF9A 4MR9A 2Q2WA 4BBJA 2M9MA 1R27B 2EHJA 4OSPA 5BV8A 4EKEA 5B09A 4LOHA 2Q9UA 5C1DA 3NYWA 4W82A 3PZRA 4HRXA 4RTSA 3EW9A 1IHYA 3ELBA 1DBRA 3GCDA 3OVSA 1RWWA 2B4VA 4KDFA 2QORA 1WQ1R 2P2DA 3TW8A 5F9FA 4ZOEA 2Q5LA 4NPCA 1RLTA 4L4XA 5KWVA 1ZKDA 2E49A 2B1IA 4YAIA 2XLIA 2EK1A 1TK2A 3B6JA 1RQPA 1FDIA 1QIIA 2I54A 2BISA 3FMBA 1G16A 4CDIA 5I42B 1W59A 3EPGA 3PRHA 3UV6A 3TM4A 3QUSA 1WA5A 4BB5A 4DYVA 2DPMA 4CEIB