4CI0B

Electron cryo-microscopy of f420-reducing nife hydrogenase frh
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
228
structure length
228
Chain Sequence
KPRIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Model of the F420-Reducing [Nife] Hydrogenase by Electron Cryo-Electron Microscopy Using a Direct Electron Detector.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords F420-REDUCING HYDROGENASE, SUBUNIT ALPHA
total genus 47
structure length 228
sequence length 228
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ci0B02
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ci0B01
1DAXA 1G3OA 2WB1D 5BYQA 1WTFA 3CURA 4IUCS 5A4FS 1UBJS 1SJ1A 2GMJA 5BYSA 3MMAB 4ID8A 4GD3Q 5A4IS 1KEKA 2O01C 1UBKS 1BQXA 3MMBA 3MM7A 7FD1A 1B0TA 3IR7B 4DHVA 4IUBS 2PA8D 1SIZA 1UBTS 3CUSA 4KO1S 3MYRA 4UE3S 2WSFC 1SIWB 1FDBA 1GTEA 1C4AA 4URHA 4UCXA 1KQGB 2VPWB 3MMAA 3AYZB 5CHCB 1YQ9A 1YRQA 1F5CA 2WAQD 5BYRA 1UBRS 3IR6B 5E7OB 1PC4A 1WUIS 3ZE9A 3MM7B 2FD2A 2V4JA 2VKRA 1GAOA 3ZE7A 2ZVSA 3MM9A 1UBUS 1KQFB 1FRKA 1GT8A 3AYXB 2FJAB 2C42A 1H98A 3MM5A 1HFEL 1R27B 1FDNA 4UPVA 2C3YA 3MM6A 4L6V3 3H3XA 1FRJA 3MM8B 1DFDA 5JT1A 2WPNA 2C3UA 4U9HS 1UBMS 1FDDA 2Y0SD 3EUNA 1Y5IB 3MMCB 2UZAA 1FRXA 1FRMA 1H2RS 4OMFG 1Y5LB 4KO4S 3PNIA 1FTCA 3LW5C 5L8RC 1WULS 1Q16B 2FJEB 4KO2S 1F2GA 1FXDA 4CI0B 1JB0C 4YDDB 3MM5B 4UE2A 5ADUS 3MM8A 1CC1S 1H0HB 2C3PA 1BWEA 1B0PA 3EGWB 2FGOA 5JSKA 4UPEA 3USES 1Y5NB 4XDDA 3RGWS 1RGVA 1BD6A 2FJBB 3HKZD 6FDRA 2C3MA 1ROFA 1A6LA 2VPXB 3ZE8A 1UBLS 5JSHA 1FRHA 3MMBB 2FJDB 4UE6A 1H2AS 3MMCA 4TTTS 4IUDS 1XERA 1FRLA 4UCQA 4UEWA 4KN9S 2PDAA 4UCWA 5JSYA 2Z8QA 1FDAA 7FDRA 1WUHS 1PC5A 2C3OA 1UBHS 3ZE6A 2FDNA 4UQLA 4OV1A 1JNZB 4KO3S 1FERA 1G6BA 1AXQA 3OR1B 1K0TA 2FRVA 2V4JB 1FD2A 1FRVA 1H7XA 2XSJB 1WUKS 4KL8S 1CLFA 5D51S 1IR0A 1BLUA 1FEHA 3GYXB 4UD2A 1DURA 1D3WA 3OR2B 5FD1A 2VPYB 3IR5B 1Y4ZB 5JSUA 3EXYA 3MM6B 4Y28C 2VPZB 1H7WA 4RKUC 2V2KA 1YQWA 3C8YA 4UEQA 1IQZA 6FD1A 1FRIA 1WUJS 4KT0C 1FXRA 1C4CA 1FCAA 4C3OB 4XK8C 5A4MS 3ZEAA 1FRFS 1E3DA 2IVFB 2WSCC 1B0VA 1VJWA 3OR2A 4UD6A 2GMHA 4XDCA 2PMZD 1BC6A 5JRDS 4UQPA 1F5BA 1JNRB 1FF2A 1GTHA 2WSEC 3OR1A 5CH7B 4U9IS 4AYBD 1UBOS 3MM9B 2XSJA 3USCS 3UQYS
chains in the Genus database with same CATH superfamily
5AI0A 4A26A 4KQHA 4LC9A 3JVUA 1NDCA 1PV4A 1WKLA 5I3ZA 1Z2DA 8LDHA 2V0NA 2NZ8A 4L4UA 3AJ8A 4KSBA 1FNDA 3W5BA 4TQ9A 1DPGA 1VIXA 2VUTA 3F4BA 3NEKA 2EOAA 3BGLA 2CLLB 2A1UB 3GQBA 2W0MA 1ZN7A 3F44A 4BWGA 4UHBA 3MTEA 1IY1A 1J8FA 1OYOA 5J1TB 3ILJA 2OP1A 1NR5A 2EQAA 1Z9BA 4A6PA 4ITRC 1LRJA 2QOEA 2X8LA 4UHCA 3D02A 1IR2A 1E1MA 3C3CA 3U5TA 2F4VJ 4LUBA 3JV7A 1U9YA 4ELTA 3GEIA 4X45A 5CXXA 1E7YA 3VDRA 4ZALA 3CO0S 1UOQA 1U2DC 5IDWA 4N3NA 3SYLA 1Z68A 1L7BA 4HV4A 1UPUA 1SC4A 3IDZA 4YMIA 1GK8A 3CPHA 5H3LA 2AFIE 2G25A 3PHJA 2E3JA 1L7QA 3A6LA 1P0MA 1OILA 3H83A 4A5SA 3MJSA 1H2UX 3O2JA 3TECE 4ZMMA 4KWHA 4OHUA 4Z54A 2J0QD 3PEJA 1V5WA 3TRHA 4K87A 3PD0A 5SZJA 3G2NA 5B4UA 4F02A 5BT9A 4E15A 1GZVA 1N9KA 4NEYA 4DX5A 4R69A 3AM1A 4DCPB 4MAAA 3AA9A 4OM7A 3QRRA 4N3AA 1NDHA 1W4ZA 5GM2A 4V2UA 5I4KA 2W42A 3QOXA 4P3PA 2QN6A 2QTNA 2ABYA 4HYKA 4EA6A 2OHGA 4RBVA 3I87A 4ECYA 1FMCA 3TUIC 4CMIA 3R7SA 4LK3A 2DHHA 1NZDA 2L48A 1SFRA 3V8NA 3IKMB 3HYRA 4C0WA 3MUVP 4AMBA 3X2EA 2C3OA 4YAOA 3SKVA 3EMTA 1N7JA 3QT8A 2IXTA 5IHXA 3DPUA 2EW2A 3E5RA 5EUBA 4P7BA 4KYUA 1ESEA 1NUUA 4DV1J 1XTQA 1P4AA 4CHGA 4LOKA 3GT0A 1OUMA 2XE4A 4YONB 3T7TA 3HO8A 1XZPA 5EMNA 1HSOA 1DUSA 1FLNA 5JDCC 4AZVA 2NXUA 4WNIA 1T5IA 2AMLA 3EIHA 3B38A 1J22A 2Q5IA 3CCZA 5DTIA 4N12A 1J0CA 2J87A 3FPSA 3VPGA 3C2QA 2EJBA 5GZ6A 3GLHB 4GVBB 1H0SA 3SXUA 2JFVA 1XHLA 4EW3A 4NF2A 2MSDB 4YCJA 5UKDA 5KVVA 3BSNA 4EVQA 4U9HS 2ERCA 1SVIA 3RG8A 2R7WA 2P62A 1N0IA 4TZTA 2H57A 1MU2A 1NLMA 4GM0A 1VLHA 2C95A 3UJBA 1J5PA 1DQAA 1E9FA 2BBEA 2GFHA 5TGTA 2O2GA 3SG0A 5AKJA 3R7WA 2CYAA 4MKVA 2Q2OA 1KNXA 3MOGA 1RZRD 3D3EA 4BLQA 4UCWA 2IZ6A 4LNAA 4DSEA 4YPOA 2OELA 3OF5A 5HRUA 1L5KA 1QC5A 4CEJB 2P9JA 2WJZB 1OI7A 3R4VA 2ZUFA 4QIVA 1I2ZA 1RHRA 1G8GA 5K8OA 3FSGD 3FFXA 4U8YA 2CMGA 2ZR9A 3A6HA 1VPEA 5B1DA 2BYTA 2GXAA 4ECUA 4NRUA 3TZKA 2AT1A 4ZYZA 3CKKA 4NWIA 3DBHA 3KOMA 1H3NA 4QGHA 4A82A 2DUNA 2HNKA 4PC6A 2ZI5A 1M1XB 1GPWB 2EGGA 1ZVVA 2IGBA 2X5NA 2O8CA 3IR6B 1YB5A 1G291 5K1ZA 3PVZA 2VJOA 3FHJA 4EFDA 3NEPX 2VKQA 4ETXA 3FUWA 3ESAA 3ZDFA 1X7VA 1F8FA 4PUOA 4X4UA 4MB0A 5LXYA 2ST1A 4L5AA 4E30A 4NCIA 2DK2A 4K88A 3QMWA 3QUQA 3M70A 4YDQA 3PFWO 2VYQA 3Q9UA 2HFOA 3IEVA 3U1VA 4XYLA 2L2QA 1FDWA 3VKHA 4RQUA 1HD0A 4XCQA 5I01A 1N75A 4BX0A 1SU8A 4YB7A 4EI2A 1MBZA 2O3TA 5GONF 3DXYA 4DR3J 2Y05A 4CL8A 5LL6P 3IR5B 4DJDC 4KREA 1CKEA 5LQMA 4AIRA 5LXTB 3CVOA 3SZRA 4Q9JA 3ZHCA 2QVXX 3ED5A 1GZ3A 4OXYA 1NIPA 4EGJA 1E8DA 2NXWA 3FDIA 1PR9A 1GTHA 4GZLA 2E48A 1NU4A 1ML4A 1U3FA 2PJRA 4PV7A 4YC7A 4FXOA 3B9RA 3MYRA 1ZWKA 1GGVA 4PNHA 1J2JA 2HK3A 2PSFA 2NZJA 2R7LA 3A31A 3JQQA 5LDHA 5H82A 2ZRBA 3PPVA 2E5LJ 4PTYA 4YCLA 1ENPA 4UW9A 1Q0NA 3IDSA 4GS5A 2Y77A 1LWNA 3VR4A 4WNYA 1C0EA 3ORSA 3M30A 3AFOA 4JI6F 3IBCB 4WEQA 2JSXA 2AD1A 5HQ8A 4M9ZA 5CX4A 3GV0A 1QB8A 2DCUB 1BDMA 1GHTA 3CJRA 1FRVA 3U02A 3NTLA 1YJRA 3G8YA 3P4YA 1Z5UA 1L5SA 3OMXA 2BJEA 5CX1A 1UWVA 1K3UB 1CR0A 4JYBA 1L7PA 1XWIA 4XEHA 3SZ3A 1F0NA 2AWOA 3P2MA 3CDAA 5IJZA 2ZBGA 3R5TA 3PFFA 4EECA 2PXHA 2VQ3A 4OBBA 4EJFA 4GKKB 5IF3A 4KFCA 2ZI3A 4ED1A 3RRJA 5M04A 5TQ2A 2Q6IA 4IOBA 5AKGA 3UWDA 1WXHA 3E5MA 4AKGA 2X8JB 4LF9F 3CS3A 3T3EA 2ZANA 2Q2QA 3THWB 3K5LA 2ZRJA 3MJEA 2BEVB 3A1TA 4CLFA 4KC5A 4LWOA 3DJYA 3WLFA 1AHNA 4KQ9A 1YVFA 4E33A 4G0ZA 5A6SA 1JB0C 3OCCA 1TTHA 4FR5A 5JHGB 4DXDA 1REQA 4HJRA 2XLBA 5HR5A 4LMPA 4MEAA 2G7ZA 1DE0A 2ZXFA 3HNOA 4MAMA 1KIMA 5JWHA 2OESA 3D2WA 3GR1A 1SC3B 2XTNA 3A14A 1DQPA 2C1ZA 5J63A 2V94A 4G41A 4TYNA 5JADA 1XK6A 2QY6A 4MSUA 1E7WA 3DO8A 4DQVA 2H2DA 3OKPA 3QPDA 5FLXA 4MUXA 1SOMA 2YWEA 1GMWD 4Y1EA 3OD2A 1ZOSA 3PR4A 2XUKA 2BKAA 4KCGA 1TCUA 2HB6A 1OAAA 2KYZA 1T3OA 1JV2B 2BZ2A 3OA2A 2FJ0A 3GHYA 5HKBA 1KI2A 3PNSA 4CU2A 3NDBB 4IH6A 1USVA 3E58A 2OO5A 1XE3A 1UXIA 2K1RB 1MAHA 4MW7A 5ADVA 5ELMA 1MC4A 13PKA 5T8KA 3W78A 2MEWA 3T1QA 3HT0A 3H2KA 2YS6A 3R74A 4C01A 3QLVA 3E3OA 4MV3A 3MG9A 1WS6A 2I1QA 2DPMA 4FQ7A 1OZFA 1T8YA 3PHBE 1H6AA 1AE1A 3CONA 3BAFA 4DPYA 2JEOA 2XA9A 1U6FA 3ZZOA 4PO3X 1PKEA 3MCOA 1F3FA 4N7JA 4JV5B 1U2RA 4NE7A 4I1IA 2AL7A 3EIXA 2WT4A 3KR0A 2E4ZA 5DHRA 2O1SA 4KXWA 4DMKA 1SB8A 4DXAA 1EUZA 2B7CA 1SCIA 3W8GA 1U1LA 1RT5B 2IEDA 1NK9A 2K6GA 2Y1CA 5ICGA 3HKCA 4DLLA 1XTPA 3VZHA 5C2GA 2GW8A 1THMA 2AEFA 1U65A 4LGCA 4YJGB 1M8KA 5DRTA 3V1MA 3V6DB 2PJUA 2HBRA 1RWVB 3TD6A 4URZR 1DV1A 4RACA 5AIAA 3SJAA 5EIXA 1TD1A 5B2ZA 3ETJA 3GARA 4BO5A 1AQNA 2PIDA 1LA2A 2F8HA 1NN0A 4CODB 2AN9A 3ODPA 3WFJA 1JR3E 3I8SA 1ZVJA 4JWKA 3DSRA 5K0CA 1YAHA 5JBNA 2CVQA 4EYKA 1P3JA 1VJCA 3SJ7A 2DGWA 2RDIA 2FMKA 3W1VA 3NCRA 4YMWA 2V3CC 5CYQA 4A8YA 1E59A 5ALJA 5EWMB 2ODQA 1H73A 1KDNA 2PAAA 4CDGA 4GRAA 3AT1A 1M34A 1KPGA 4ID5A 2OVFA 4YRQA 4IIDA 1V8ZA 3VZCA 1U1DA 4MO9A 1CIVA 3T1YF 1JH8A 1E2KA 4DL5A 2AYYA 1ZD5A 4K0KJ 1RYSA 1NVXQ 2VS1A 1RKBA 1PTJC 1C1CB 4AN4A 2N47A 3LGXA 4CIBA 4TL6A 1ZA2A 3BH6B 3T5TA 3WLQA 2W2KA 4EZIA 5A02A 5IF9A 1TK3A 2AR9A 2X2EA 3HSKA 4ZEMA 3G79A 2XNRA 2JBHA 1Q0SA 3IUPA 2KB2A 3IP5A 1YRYE 1AQLA 1PGNA 3PNIA 1Z0DA 1G16A 3ZWAA 1UDXA 2XYRA 4I8IA 5B7NA 3RR2A 3W8FA 5CM2Z 2QQGA 2A9FA 1E60A 1AV6A 3EISA 2QLTA 4IIJF 1SBQA 3ABOB 1UOPA 1ZCZA 1FYVA 3RS2A 2JLEA 1T0PA 1O0BA 3O9VA 2HL6A 1JQ5A 3TAXA 2ZDGA 2IIPA 1KZ6A 4ZT6A 5F3DA 2H4XA 2VL1A 4DSAA 4OYIA 1OLXB 1EM6A 5ALVA 3NBMA 3RJMB 4R2WA 3I9V6 1C3OB 5EX0A 1GGEA 3OVSA 2DSTA 4DA9A 3AESA 1RWOB 2I34A 1II8B 1QHHB 2M1XA 1X70A 3FNBA 2JGNA 5C3UA 2P4SA 3W7VA 1K75A 3LC1O 2J9DA 1Q5YA 3EUEA 1CHDA 3ISND 3FYSA 4DX6A 1OYYA 2R8YA 1U2SA 5IANA 3R5BA 2JI8A 3RU0A 2JJ4D 2CB9A 5ALTA 1MMLA 3CUVA 4UM9B 1AB5A 4IF4A 3VOTA 2HCBA 1RHQB 1B26A 5EE9A 4JNCA 2Q1TA 1A7GE 3GBVA 4ZKEA 1A9QA 2Q1SA 1ZS9A 4YROA 5EKTA 2J5RA 1HE5A 2VUHB 2UVDA 4X4NA 3UWPA 3QM1A 2GPSA 2IRYA 5H0IA 3KDAA 1TCVA 5FCDA 3MAHA 1HQUB 4LJ8A 4TX1A 1DEHA 4J0GA 1VKNA 5BURA 1MR3F 3V4PB 4UUXA 1FJGB 4GO1A 2G2OA 2O3UA 4B6RA 2VTVA 4ZDWA 4QEZA 1GKIA 4C11B 1IHPA 1SC9A 1M1YE 1I0ZA 5J9FA 4H18A 1VJ0A 3HABA 2DY0A 2DGXA 3N6XA 2M0GB 4MRPA 4LFAJ 4BC9A 4OI6A 4PC3A 5EIHA 3DAPA 2E4YA 3IT1A 4JI4J 1PVVA 4XLLA 4ZVRB 4X1YB 2N3OA 1TB4A 4G2NA 1YI1A 2JC1A 1F9FA 4BBPA 1CVJA 1SCKA 3OQOA 2FMIA 5A8RB 4I7FA 2PT5A 1WDDA 2A4KA 5AW9A 3HB4X 2CXEA 1S9DA 3OEWA 1LDEA 1NUSA 4B8YA 1BXGA 4ZXFA 1DKQA 4OV6A 4UNRA 1Z8FA 3EIEA 3L4KA 5IW8A 1URPA 2HWWA 3FPBA 1JKHA 3BJZA 3LXRA 1T05A 3HZEA 4PGFA 4PPFA 1ZSYA 2MZ1A 5HVGA 5HJEA 1HR0B 1J7KA 4KQEA 4O2BA 1C2PA 3OJEA 3IURA 3QI2A 4D56A 2OKGA 4EHKA 4DM7A 5CYGA 2G9UA 3BL6A 2GBLC 3WJ2A 1G5PA 3TB4A 1Q95G 3PXBA 1ICIA 1SXJC 1E3DA 4NLGA 3PNYA 1FJGJ 4I4TF 1E5LA 2BHRA 3G2LA 3I5XA 4YYZA 1HYGA 2HNYA 2M9MA 5CVVA 4CTKA 4JJIA 2MKIA 4YRLA 1XN1A 1ZU5A 5DT2A 2OSRA 3E5NA 4M1EA 4IYJA 4AUEA 1U4BA 1SGWA 5HTKA 3GJ8A 4OHBA 5ICFA 4ZIRA 4KV7A 4UUBA 5A9SA 2E1RA 2NVUB 4IRKA 4LXQA 3IA0A 4CO2A 2DC1A 4V1Ak 4HDOB 1FDVA 2BCGY 1Z33A 2ZJ0A 3MVEA 3EYWA 1XLTA 1R18A 4LZWA 4DCPA 1PQYA 2A57A 1PUIA 4UOFA 2Z8ZA 3C6BA 2CJPA 1ULHA 1KR5A 4HPJB 2V9KA 2O5EA 4N7BA 1V95A 2CQBA 3MAAA 3DHWC 2FV8A 1N2SA 4RZIA 3H7AA 2R6CA 2XMCA 3ITNA 3KTDA 2GERA 4TMXA 4DXHA 1VSVA 1GDHA 2XGSA 2HK8A 1W6UA 4DADA 3O3OB 3HCBA 2VU5A 5DB4A 1NRKA 4BQIA 3S55A 4I2QA 2XTZA 1X8JA 2A78A 4MI3A 2Q6VA 1LU9A 3PU6A 4P35A 3I39X 2PH5A 4M5DB 2W01A 4N18A 1ZBQA 3RQSA 1A2OA 3ZX4A 3UW3A 2EQBA 3D3WA 4DCNA 2F1IA 3R6WA 4IIFA 3G86A 1VI2A 1ZM9A 4ZJOA 5KYWB 1Q84A 2O2SA 3SQOP 1ULAA 1Q83A 4DCTA 4ILEA 4GZ5A 2V7GA 5CM8B 3KDNA 1PJRA 4LFBF 1CJUB 5B3KA 1QQAA 2DEIA 3PXAA 3L0DA 3BC1A 1J5OB 2V74B 4R8VA 1LBSA 3A4MA 2GVDA 1YLXA 2H3EA 3ZQKA 3K30A 3V55A 3OUYB 2LU1A 3K59A 3CIOA 3EAQA 3QUAA 4D4MA 4KAXA 3V81A 1ARZA 1RT7B 4DWIA 1BXNA 4R1SA 1UWKA 1GNLA 3BMOB 2DWCA 4P8RA 5AK5A 3E7FA 1IUPA 1WY7A 1MU0A 4WK2B 5AVZA 3FBCA 4RD2A 4HAYA 4IHJF 1VTKA 1MGPA 3KQQA 3O3NB 4BMDA 1XRMA 2J6HA 4G4SP 3KFXA 3JB9k 2KI2A 4GM4A 2PS3A 2K1RA 3EVGA 5HBMA 3FLEA 1GNTA 4IYRA 1DT3A 3OQPA 2QTMA 3GR6A 4XYBA 4ZCSA 4CLWA 1CF9A 5TF0A 4ECEA 4JI1B 2VICA 2FETA 4XGQA 4BNVA 4KITB 2HLUA 3RRGA 2JLAA 3IH5A 4OVKA 5CB4F 5J4LA 2DXFA 1BU8A 1YRQA 1EFDN 4GICA 3R5SA 2ZKTA 3DBLA 1GT8A 4FM9A 3PXCX 4C5AA 4Z9BA 2IY8A 1X9SA 2HGNA 1T25A 5A9TA 1O51A 4GYJA 3FMBA 2WW4A 2B8TA 5JWRA 2Y8YA 1FFWA 4GIBA 2J3DA 4YJGA 2BANA 2YWGA 1SQEA 4LDRA 1XMJA 4CUJA 4B8WA 4GOJA 3CCTA 3DZJA 3IB6A 2C2ZA 2J09A 4D0SA 1C0PA 2E85A 4QYZJ 4HB3A 3L7KA 1L4YA 4MOWA 1EX1A 1QM5A 3CM0A 2R00A 2YY3A 3GJ4A 3B85A 4Z7QB 5KFQA 1JDVA 3KUGA 3JYNA 4KBGA 1K7YA 1U2QA 3LOQA 1IG3A 3ESXA 1ZK0A 3QKSA 4R3UC 4KE5A 3PDHA 5MN4A 2ZU6A 1JT2A 3BMCA 1MB3A 2IODA 1X1AA 1I24A 5K20B 1FW8A 1SH2A 1XDGA 3JVDA 2D1RA 2C5SA 1E6LA 3NW9A 1JUDA 2WOOA 4ZI5A 3JS9A 1XDZA 2IPOA 4NARA 2ZSUA 1H8ED 1KSJA 3SYKA 4PSCA 3VV2B 3W66A 2XXBA 1EE2A 3F47A 2NM0A 1NM5A 3H65A 4RV9A 1QIEA 3FAZA 4KRWA 4ER7A 1M66A 4HVCA 4MVJE 3RUEA 4BWJA 1NM5C 5DP1A 3NP7A 3QUSA 1AQYA 2FK7A 4ZVTB 3QTBA 1N88A 1W25A 3NP5A 2GHPA 2CQPA 2VHEA 2Q4RA 1G3MA 3DL4A 1MO4A 3SS7X 1NC3A 1VSBA 4EUHA 1U94A 4G4JA 3SE7A 3F6CA 2ODEA 4X1OA 4Q82A 2JIBA 1PZMA 3CZQA 1WVIA 3D0HE 1P8GA 5IVPA 3BR8A 3ISNC 4QAQA 5KFZA 1CS0B 3CLHA 5IASA 3CT9A 2AH5A 2QB5A 4FT2A 1IKXB 7GPBA 3PGLA 1IBLB 2ZH3A 4PZ0A 3Q7TA 1N9GB 3A3OB 1C4WA 3FRJA 4ND1A 5G4DA 1QGDA 3V8MA 2LUOA 1BWRA 4CLXA 2HVHA 4OI0A 2PKYX 1SXLA 4PG7A 4GWLA 4WXRA 2D3WA 4TYQA 1VIDA 5KDOA 2FOLA 4MUFA 4YRDA 2O8NA 5EZQA 2JLVA 4PZZA 4IFVA 4M7PA 2V98A 4EI7A 1FDIA 4I4TA 4DV4J 1CR2A 4DPMA 2R4FA 5A8KB 1N36J 2GS9A 5CB0A 2Z4TA 3T4XA 4TY9A 2IEYA 2G77B 1TZCA 3ORFA 4MINA 2IT1A 4JEIA 3ZW8A 3FTEA 4F86A 2DTDA 1A8UA 4X6UA 1TC2A 1SXIA 3B1WA 4HPXB 5JIBA 1SCAA 4PE5B 3QPUA 3GJQA 3IOYA 4L9RA 5G0UA 3BGFA 3P2IA 1N6PA 2VRWA 4P6VF 1LWXA 1LRKA 3PEFA 1Z0UA 2COKA 1QYWA 1K27A 1YJUA 1EP3B 1O96A 1KOGA 3ZUPA 5KFHA 3QRWA 4YT2A 1IYZA 3UJ3X 1C7RA 4IW3B 4UDNA 4JBGA 1S9FA 4RTRA 5EI5A 5ENDA 3TO8A 5EFZA 4INAA 3T7RA 3O4HA 3A3OA 1B16A 3OQHA 1DRUA 3J7TA 4J7UA 5I3QA 3BBLA 4OAQA 5FNVF 1NX9A 3G7UA 2VIIA 3MM7A 5A3SA 1DV2A 2P2GA 3IAAA 1NG1A 2ZKIA 5DX1A 3TD2A 4QEKA 3COYA 3J7ZT 3JD3A 3EVEA 3RRKA 3LY9A 3EUAA 1GWNA 1TZ0A 2YOFA 3TWZA 2CNKB 1Z34A 3L6EA 3VNSA 3FG9A 1SBRA 5JDIA 1ICEB 1NV8A 2NSYA 4ICLB 2QTTA 5KFVA 3QMMA 1U3CA 4O3OA 1ZMTA 4PTZA 1DC8A 4O2LA 5E9AA 1SBYA 4UHFA 4EPVA 3OQBA 5BQXA 3ODGA 2XMJA 1K0TA 3VKFA 2IS1A 5CA1B 1YQGA 5JSUA 1FT8A 2REQA 3JQCA 3G2QA 1JKHB 3BXXA 4WJLA 1FCAA 4O1MA 2D74A 3ISTA 1M76A 4F6CA 2B7BA 3I83A 1QIDA 3UMJA 3P97A 2B1QA 3Q89A 4TXNA 1B2LA 2B1IA 4XUDA 3A9UA 3WWEA 3PJDA 4X4QA 2EJUA 4R25A 3B2NA 4NVRA 4MYCA 3IBGA 4JB8B 1KIAA 3CD0A 2VV5A 5CNKA 1H9BA 3WWYA 2GVZA 4BZWA 3QITA 1SUCA 2BJ7A 3KR9A 2NAFA 3JD4A 2QVLA 3R6GB 5ALUA 3CSUA 1A5SB 3Q3CA 2WJ4A 4MQEB 3MM8A 1ZM2A 5LQCA 1E62A 3IO3A 4MZDA 4F1KA 1GPH1 5E2AA 4JQOA 4QJIA 3KVYA 621PA 4NLXA 1GL3A 4LJ4A 2VQFB 3E3MA 3N8GA 4QOSA 4KPFC 3W5VA 3ZVRA 1S72S 3ZDYB 1TFYA 3MYYA 1UBEA 4V0MA 2X3YA 1WV0A 3EA4A 4V1CI 3G8SA 1H7WA 3DLBA 4PZEA 4OHCA 4LI0A 3L40A 1S4MA 2B8PA 4QUEA 5A4MS 1Y8RB 5BW4A 5FDLB 4XAKA 4H4KA 2PX2A 5EGYA 1ZETA 3I01A 2QA4S 1W94A 1GV1A 4N76A 1HEYA 1UFOA 4GAEA 5DIFA 1PBNA 2QU7A 2IVYA 3JVVA 1JDBB 2OK7A 5TJ9A 2G1JA 5ESRA 2PVSA 3BE8A 5LZ4A 2WNIA 1YZ7A 3GAMA 4YRIA 2ZSHA 1IBMF 2CPXA 3BDPA 4IVRA 1OLUB 4C5CA 4HX9A 1II9A 2I2AA 1JAHA 1UT6A 3SAJA 5A0TA 4OGFA 3ELWA 1KOOA 2IJGX 1RDRA 1VHFA 2IHJA 3JZDA 2HS0A 5J2QA 1E1CB 2PE8A 1YRHA 4G5YA 1IUOA 4QBIA 1Y98A 2CFSA 5LLTA 4TN2A 3UN3A 1TP7A 2E37A 4LOLA 2HWIA 3E9NA 2DIVA 4P92A 4OXQA 3C4VA 3A9TA 1RP1A 1CQZA 1H6KX 4ZCTA 2IPLA 4L8GA 4HBGA 2JX2A 3GVXA 2UXCJ 2B4VA 3P0JA 2FP4A 1NK4A 2UUPA 3UCFA 1JU9A 2PZMA 2A0KA 3DO5A 2UUOA 4FGZA 1V2HE 1B1AA 3AA8A 4PYQA 4O2AA 3T9NA 2HKEA 2U2FA 3OJFA 3CPEA 1IBRA 1TT5B 3NH9A 3FTNA 1CRPA 1UF9A 3H8JA 1E0SA 1U9IA 4COOA 1KOHA 5CURA 1Y33E 5KNDD 1D09B 5L53A 4GPTA 1JVNA 3DLCA 3AETA 2C2DA 2PKCA 3FPJA 3MB5A 4PWDA 2ZCUA 2ROGA 1WF0A 1X7HA 4ZK2A 3DMTA 3LO8A 3I2YX 3A3NA 3G2PA 2Y1JA 2Q07A 2Q29A 2HURA 5ESWA 5ETRA 3CVJA 3RHSA 3DRXA 1FVXA 3ONFA 5JAUA 3ZTYA 1XEXB 4BZXA 4FBGA 1FTNA 1Q7CA 5JCXA 3RB4A 4XSGA 3NBPA 2CL5A 4A8SA 5HSPA 1YHYA 4FKBA 3WQSB 2A8YA 1GUAA 1W29A 4EG0A 3N6MA 1OBOA 1RQLA 4A46A 1VQKS 3TW8B 1V2GA 3AKZA 2YN4A 2HV9A 1SHJA 4DL7A 2VK2A 2V3VA 1P6QA 3ZWOA 4DR5B 3H8SA 1RYNA 3S1AA 3DCNA 3F96A 1HRKA 3SSMA 3FD8A 3LWZA 3PFCA 5DO9A 1SJ1A 1VQ6S 3LZCA 4L1KA 4H0FA 3NZEA 2EG9A 1GUZA 4HLDA 3L05A 2ADOA 2FZ4A 3K70D 1G21A 3KUDA 1VL8A 2VA3A 4LFBJ 1LXJA 1ORHA 1GR0A 3AR9A 1PTKA 4TQSA 3EASA 3A6PC 2RHMA 2NSBA 1OS5A 4KOAA 2PT7A 2WG0A 4C7JA 3PYEA 1KAQA 2UUBJ 1LK7A 2LVWA 4HZGA 4UBMA 4Z4HA 4PYIA 1ZNWA 1VRCA 1AJEA 1XERA 3VH2A 4H60A 1JLGA 5B0BA 2D1TA 3AJDA 1R6UA 3WKAA 2Q4OA 4CCHA 3WNZA 5F8LA 2R8XA 1YZUA 3GDHA 2AZMA 1RPAA 1H5UA 3PS9A 1M67A 4UEQA 3FK4A 4CKEA 3IPYA 1AIPA 1U6KA 4YQWA 3KM0A 1WEZA 4C6HA 3ADBA 3BHIA 3QXXA 2EFJA 5E3RA 1PL6A 3KSAC 1SKBA 1X5SA 4LJLA 4GR5A 5L3SA 2XUJA 1AUOA 3EFHA 4IUBS 1U6ZA 3I82A 5HWSA 4BO3A 4RVOA 2WAQD 2PGIA 1JE1A 1NJ5A 2FPKA 2WFZA 1B4DA 4EEZA 3UPFA 2QA4G 2YBVA 1XA4A 2VBYA 3AUAA 1E9DA 2NG1A 1CQIA 4ZHQA 5C7OO 1P9LA 5EZYA 3X2SA 4MITA 3E15A 4C9BA 1G42A 2OO4A 1E1NA 4DEVA 1YU9A 4R1MA 4X20A 1ONNA 2P5YA 4KWCA 4DCJA 1Y1QA 4KAJA 4K3UA 5C5IA 3F4KA 1IVYA 3PVCA 4M87A 2J0WA 2ZETA 4ZVFA 2EERA 1XVUA 5CG1A 5J1EB 1PAUA 4ED3A 1ZHOA 4UBOA 4YP9A 2GHTA 2H54A 5DHSA 4IUFA 3JXEA 4L3OA 2PMDA 1SC1B 3UE2A 1W35A 4OLJA 1NO8A 1OXKB 3EDRB 2XUIA 2IW3A 3SF8B 3TAPA 1DDGA 3K5MA 4RTOA 1VE3A 3RHZA 4K8RA 4EBCA 4QQ8A 3WHPA 3IESA 1UDCA 1ORTA 4ZHRA 1P1CA 1YZ3A 1IKWA 1F4PA 1DTWA 3CIZA 1M6NA 2YWHA 1H1LA 4ZK7M 1JEEA 5EVCA 1YAJA 3ETNA 2AMVA 3PC4A 1ECJA 3OI7A 1J2TA 4ARAA 3ID6C 3EUNA 4AL4A 2O3SA 1PW5A 4N49A 4OMFG 3AR8A 3LALA 3BGSA 3TNDA 3KB1A 5JASA 1I0LA 3W79A 3AERB 1P2GA 4MWSA 1E20A 4O44B 5DTQA 3K9GA 4F4ZA 4AJ2A 4GSLA 3FSEA 4P82A 3T9EA 2XDQB 1C9EA 4EPTA 3T6JA 5SZKB 3FUCA 1YUBA 4QXAA 3UKOA 2YX7A 2HXSA 3D6VA 1VK8A 5AK4A 3BE4A 1GL6A 1Q0LA 2I0XA 1U0BB 2YXEA 1PAUB 5F8MA 5DNYB 3DMHA 4A0SA 4TROA 2JC0A 1Z6ZA 4HQNA 4YJ3B 2X4LA 4B4DA 1D9DA 3EIFA 4D79A 2IS2A 3GJ6A 3W34A 3VO1A 3KK1A 4QOHA 3EZ7A 1CJUC 1YQ9A 3OCVA 2EW8A 1H5QA 3VZRA 4HDSA 2IE8A 3CVYA 4YQZA 3AB7A 2XDWA 3U6KA 4C0QC 3V8QA 2HK6A 2WE8A 4EBFA 3HULA 3B6EA 1ZAVA 1M8GA 4CIXA 2A9QA 4HTAA 5H4GA 2CPZA 3F46A 4B85A 3GH1A 3IG1A 3RB6A 1Z29A 3W04A 1U1PA 3SCLE 5CNIA 1G21E 2G08A 2HH9A 2XG8A 4JI3B 3MEGB 3U7QA 3HZGA 2WSIA 4IRXA 3QSYA 1U8WA 1DAPA 5CAEA 4BVAA 3RGGA 2DT9A 3QU5A 2XC9A 2HDNB 3ZD7A 2Z3VA 5A76A 4Y1FA 2M2IA 1PR1A 1RWPB 2ZBFA 4DR3B 4MQBA 3H84A 1MEEA 1EDZA 3TDKA 2BEUB 1POWA 3W9IA 5KG6A 1Z7BA 1O77A 5MFPA 4L4YA 5EMJA 3QBDA 2HG4A 2AG6A 3L8ZA 4A0GA 5C52B 4ZU6X 4X0EA 5L1JA 4P4LA 4DPXA 3EWIA 4WTYA 3WV4A 2LKCA 1SIWB 3VNRA 1TK0A 1IY2A 1FIUA 3G2OA 5IKOA 3ZGNA 4ZA2A 4WDQA 3E05A 1A88A 2WVAA 4A1OA 1ZEJA 4OA8A 4R84A 5LM3A 1XWWA 1QTIA 3A8JA 3TSYA 1F9AA 2VG7A 4JVOA 4D9BA 3GWCA 2DCMA 4XOIA 1YZTA 2LMIA 4CTAA 4A2QA 4RNNA 5FWXB 2YINC 2A9VA 2OYCA 4G37A 1QSYA 4JLJA 1YIOA 2IC5A 5AVUA 3K5OA 2FJDB 1H4TA 4BVEA 3E2IA 2GYWA 3H75A 1EJ7L 3LP0A 1M7HA 2UV8G 2C0CA 3DEKA 5BQ5A 1R50A 1R66A 2F9LA 3VF0B 1NQTA 1G7SA 3UC5A 4J9LA 3TIFA 2Q0SA 1MRNA 1YVDA 2AFIA 1BVRA 4EL5A 3CIFA 1EXMA 5FHQA 2IELA 1BZYA 4XA8A 3KDSE 2VTDA 4AJOA 4RZQA 2B4AA 2A9OA 2YWFA 3KP1A 1EUCB 4MYHA 4LTMA 1RYRA 2Y0BB 2J48A 3OURA 4OQYA 1HKAA 1XZBA 2CPDA 2QT9A 2JB9A 1EP1B 3LECA 3HCRA 3WXBA 3UJNA 1NBMA 4MJXA 1ETUA 4C0LA 1WUYA 4DF4A 2W6OA 4EB3A 3T15A 2BABA 2X0DA 2I6UA 1Q0TA 1AFIA 3HV2A 5KYXA 3DBOB 1IOLA 3HYLA 4NV3A 4C0OC 4QUGA 3IAS6 2XWQA 1IJFA 2C4HA 2JFXA 3MWKA 3WL4A 4YH1A 2X0RA 5EUQB 1SU6A 1QORA 1HQDA 4F56A 2D3O1 1C1CA 4DANA 5I7HA 3IXQA 1RLUA 1HL3A 3D0IE 3SV4A 3DEFA 1UM9B 4UMDA 3QSIA 1T02A 4XPCA 1PZHA 1PR6A 3OCUA 2P6PA 3A3NB 3IVGA 3TWOA 1OFTA 2DM6A 1JR3D 3B6BA 1R8YA 3A70A 2HQRA 3FPCA 4PKDB 4CM9A 1GJRA 2HA6A 3EQ9A 4YP0A 2P6OA 4GNKA 2EGUA 1O9BA 1IZ9A 2CY0A 1GX6A 3I6QA 2AD9A 3VR2A 3C6KA 1VSTA 1UUFA 1CC7A 4LVCA 1XNHA 3GLUA 3VVUA 4CWBA 1D2AA 4QWMA 1UZLA 2ZWVA 4O4GB 2C2GA 1QAIA 5D6GA 1JR6A 4Q21A 5CDUA 4EL0A 1RT3A 2AYEA 2EKPA 1RQXA 3AUJB 4YCDA 2YCLA 4EMBA 3ZE7A 4OHFA 3UZUA 5CEEA 2C2OA 1ZONA 1BVHA 4R2KA 1KNQA 4BNKA 1LOUA 4JUFA 4AMUA 2HA3A 2IS6A 1X9MA 1MIHA 3AUXA 3ZFVA 1TUVA 2D1QA 4R71A 4AZ3A 3RKRA 4RCYA 3RYLA 2I66A 3WGOA 4KGXB 5DNVA 1D04A 3EN0A 2ZZKA 4PGHA 5GAHI 2XRZA 4MCHA 2ZIEA 3D2LA 1MN7A 4GPBA 4MP3A 3OV7A 2ONZA 1DCFA 1U7TA 3LVQE 3W6NA 1IJKA 2I76A 1JWBB 1AKVA 1KAOA 1I33A 1HFKA 4MQ5A 1AC5A 1YO6A 1IWGA 1X3SA 3I61A 4WRRA 2DH6A 3SLRA 3WQQA 1NF9A 5A5VA 2JF0A 4PPDA 5CD4H 3RUAA 1VLMA 2VWGA 4DPUA 1H42A 1FW6A 1R0CA 3KE9A 4AXJA 1BQXA 2GTPA 3KJFA 3L77A 2JZOA 1AGPA 4P2SA 3KJHA 3IIJA 2Z9DA 3FNGA 3EXG1 3HI9A 2QE7D 2EIHA 1X14A 3DEZA 2AHRA 2YJGA 4RJTA 3H2HA 5CH5A 3WKEA 1H1TA 4NATA 4L4RA 3M8KA 3J7AC 1F4VA 2ZIXA 1HLGA 3Q83A 1P62B 3VJMA 3IOBA 4TYMA 3MBIA 4R1UA 3QLHB 5GZ3A 5KHOC 3OZVA 4AB1A 5CB4A 4F6RB 1I1OA 2HU5A 4E12A 3VSCA 3GF4A 4BNMA 4K40A 2W4PA 2AWNA 4EOGA 4IIXA 2EV9A 5AICA 3O8QB 4J0DA 5A4AA 4HNSA 3BS9A 3QFFA 1W4RA 4L02A 3VUEA 3VOAA 4UHEA 4WI1A 4IJUA 2I1RA 3QJYA 3STTA 1KAHA 2H8GA 3ON5A 1RHRB 3U3JA 1EB8A 4GPD1 3GLKA 3DMJA 1DFHA 3ROPA 3BSOA 1YF3A 2ZQ5A 4V38A 4KGKA 4JP3A 5J2TB 4JZYA 4QNRA 2HPZA 3OTOB 4FE7A 2FUG9 4Q9HA 1U63A 3W9YA 5H70A 1KORA 2ZFUA 1OW3B 1M1KT 1U3TA 3PJRA 2RIPA 3DL7A 1TRHA 4X7RA 4XOUA 5F52A 1F8YA 3IRXA 2LEBA 1HORA 4ZI3A 4UNIA 3R75A 3VC1A 3L07A 3Q3IA 5DLPA 4E5PA 4KODA 4LZLA 1G19A 2PNFA 4KDCA 4V0LA 2P75A 4RZ2A 4K4YA 3WGQA 1GXTA 3JSMB 4YECA 5TVGA 1Y1PA 2ODBA 3BFKA 4QARA 3QZ8A 3LL7A 1H05A 4I1OA 3SR4A 4MB6A 1LEHA 1T4CA 1GU7A 2WRZA 2D0PB 4Y2GA 1Z16A 3NBXX 3NKVA 4ETMA 4MMOA 1IAQA 2CUNA 2XGOA 2HDHA 3THVA 1FBNA 1K5HA 3SQNA 4I4IA 4K8OA 3PP8A 3CLUC 4LJ6A 4YALA 1HYEA 4G8JA 4P5PA 1N5IA 3WIUA 2VJKA 1QG0A 4OA5A 3UV6A 3VKWA 1WZUA 3OM0A 4MK4A 3LH2S 2NW6A 3OAAA 3VYRB 3UV3A 4P3OA 4IQMA 2YQ5A 3N6RA 2VASA 1OGJA 3GIWA 2HHSA 5DV9A 4CWAA 4NXMF 1LDGA 4JJ6A 4ZITA 3IRUA 3W1EA 4PWUA 1I3MA 2W4QA 1A72A 4MV9A 4F3TA 2GD1O 1O4VA 1GPBA 4ZOAA 5IN5A 2R66A 2Z6UA 1DLOB 3OUZA 3VU1A 5BP7A 1NBMD 2OZEA 3EC2A 3I45A 4LRTB 3ISJA 4ZU1X 2XYHB 2ZH6A 3LRTA 3RUPA 4PG5A 4JYCA 4HJXA 3EVTA 5FPSA 3EDYA 5HE9A 1KQOA 3ORHA 3ABRB 3CDEA 1JWLA 2G6BA 5ETNA 4PHTA 3PO5A 3FBWA 2W8KA 4JJEA 3S2IA 3ZTRA 2Y1FA 1NMQA 4KN6A 5LP1A 2J0SD 3NGMA 4X8MA 2W11A 4OHPA 3BFJA 1UK9A 4OJ3A 1TM1E 2A92A 4ABYA 4XWYA 1GEEA 3L1VA 4XGKA 2XQKA 2D5CA 2J5QA 1R0AB 1NPRA 4RZXA 2BI4A 3N2NA 1T8UA 4OEHA 3SDEB 3H9QA 4D25A 2A0UA 3A6EA 2MMCA 3SFUA 4YRMA 1W0KA 1EYZA 3FDSA 4AJIA 3VR2D 1P91A 2ZC4A 2HWHA 4LDJA 1QVRA 3AO0B 1BW9B 3LOPA 5A62A 1TAHA 4G09A 3TZWA 3N8NA 2OOSA 3ADDA 5TPZA 4EHIA 1U31A 3VJKA 2YJ5A 4RKEA 1BUXA 5I7RA 4LOIA 5ALQA 3QU4A 4FR0A 1KVKA 3R97A 4B35A 4DUYJ 3FKBA 1ZZGA 4Q2MA 1TAUA 3S7TA 4EKGA 1VC5A 1DZ5A 3PTLA 1TKTB 1RKIA 3W90A 3ROGA 1NZ8A 5IYZB 5B30A 2V4QA 4UOEA 1VSQA 1VLYA 1LLFA 4CL0A 1N32F 2ZOMA 1X0FA 2ZKUA 4QDJA 6PFKA 1X80A 4AY2A 3JQRA 2FHMA 1KOLA 3H0CA 2R4TA 1T91A 1BXZA 1OZHA 2JGDB 3V7YA 4YXWD 1N8TA 1D2HA 1T4DA 3E8XA 4USWA 2YQ0A 5J5CA 2DY1A 3H2JA 4QSMA 4XGIA 4B5KA 4RKQA 3VC7A 1XNQJ 3LYUA 5BW6B 4RD4A 1J9GA 1TTQB 3DGPA 1T43A 1HWIA 2M7SA 2WOJA 3OQ1A 5KYXB 4BLUA 4DSJA 1OFGA 3FGZA 2H5JB 1UJ2A 2Y68A 3WX0A 2BLLA 4OXNA 1Z6YA 3LYHA 4JJ8A 2O5RA 3O6VA 2OM6A 3BH7B 3H6GA 3PLNA 2PKXA 4H54A 3HXTA 1GX5A 1NLFA 4HDRB 1JLRA 2OMOA 2GZ1A 3WQRA 2JASA 4FXDA 2AUMA 1HWKA 4DF3A 1RU3A 4IXNA 4CXMA 4DUPA 4B7UA 3CRMA 2FEOA 1Z4MA 4W1RA 1P4HA 4HNVA 2FR8A 5FIIA 4I8DA 1MC1A 4MQ6A 4EK2A 5KFAA 1JDUA 4W5QA 4YI5A 1EH5A 1VJ5A 1IQ0A 1OOEA 1K5PA 3HA5A 4I9FA 1IBSA 3IP0A 2QMHA 3ZNNA 1GN8A 1GTVA 3ZY2A 2UZIR 1U3UA 3RYHB 2YV2A 1FDDA 3ICOA 4NZMA 1OLUA 3EXHA 1Y63A 2FYTA 5CDGA 1N1GA 1U9ZA 3Q2KA 1FKOA 1DJPA 2RU9A 3BEDA 1PGPA 2H16A 3I8XA 3D2AA 3O9MA 4BHQA 1ZAYA 3PHHA 2ACKA 4RW8A 2KXNB 4IQ0A 4C22A 3PRKE 1JWWA 3SGLA 4GPIB 2B6NA 4UOHA 2P5UA 3QXJA 1SHLA 1REGX 4I55F 3BFPA 4Z49A 4C98A 3UJ6A 4RQTA 4BB0A 5JALA 2Y0CA 4ZO8A 4RKFA 1OH7A 5C9ZA 3GA7A 3RIYA 1Z15A 4K81B 4J16A 3SXLA 2SCUB 2XIQA 1AMNA 3TQQA 1QM9A 2QRVA 4U3JA 2DAPA 1Q2XA 2K5UA 2HK9A 1CEEA 1NB2A 1YJTA 3SEAA 1H6DA 5KFIA 1YNOA 1EPUA 2VPQA 3OCXA 4RMHA 1BWEA 4KXLA 4U7HA 3H4TA 4PLVA 4E8UA 5KG3A 4OYWA 1XMOB 3KJZA 4ETWA 2LE0A 3KHRA 2I1VB 2IA5A 5D5HA 1WACA 3ZI7A 1EEXB 3NGDA 2ZIXB 4N0QA 2CNLB 2PH7A 3BGIA 2HRDA 4DT1A 4DNFA 3NJRA 5G3YA 1A5AB 3A9SA 3TARA 3GZTB 2YNGB 2NYHA 4AL7A 1YZKA 2PTGA 4ND3A 5E8JA 5B6PA 2DH5A 2X3GA 4J3JA 5JJLA 3T6KA 4ZYUA 2XMKA 3D68A 3HSSA 3ERCA 5EHIA 1EK6A 4RHYA 2NSJA 4K03A 2X9LA 5IC6B 2OAUA 4FI3F 4DMHA 3HKEA 4DA8A 3EMBA 3P7MA 3AXKA 1D2CA 1Q7GA 3EG5A 4RDCA 4WOPA 4ZCIA 3I9V1 3D3QA 5JJKA 4TNOA 1P8AA 2RF2A 1W0JA 1S1XB 2XHWA 3G82C 2W2NA 4WFIA 1ZK1A 1L5HA 3DZ8A 1LW7A 4DY4A 4R0EA 4LF6F 3M8ZA 4YCCA 1LDMA 5EWGA 2AJ2A 2CKWA 4ZAYA 4ALNA 1OROA 3RIGA 2MSWA 3V32A 4Y2XA 2E6UX 2DNQA 1OLOA 3RC2A 4DX7A 5DXAA 2BKVA 3EPJA 2GQ2A 3GLSA 2XCSB 1FFWB 3BMOA 2U1AA 4I64A 1Z0FA 4ZKDA 1OQ3A 1RFLA 5AH0A 1Q0PA 2J0UB 2VNKA 3Q12A 2XVYA 3LNCA 1SJRA 4CMGA 2QUZA 1IUNA 1H6CA 4JI3J 2YNMC 2E1MC 2UXDF 2ZT6A 5C5DA 2GFFA 1LNZA 5CCMA 3WK6A 5E7OB 5JD5A 1V4BA 1BKYA 3NCHA 4C88A 1CP3A 3D5MA 1WF1A 4L3NA 3QX7A 4K86A 3AL2A 5KTNA 3O7MA 4WFQA 3DKIA 2IUUA 2IDZA 5G53C 3VSBA 1GU1A 2JLXA 5JSKA 3I1JA 2HHCA 3SC6A 4F72A 4K6CA 4BVKA 5EJ4A 3VAYA 4EDHA 3REOA 2OORC 1KY4A 1J90A 5DG7A 3ADAC 5HATA 5G4KA 1ZI9A 5E4JA 4R5PA 3Q15C 3K9HA 4DR4J 2G72A 5LUAA 1Q6YA 1S99A 1WB6A 2W9BA 1C8VB 3ENKA 3PTWA 1OREA 1WZEA 3CE9A 2O6LA 4UMVA 3KS9A 2M4MA 5I9IA 4GI3A 5JQGA 5FBZA 2LCWA 1T3ZA 1T5BA 3GPIA 1A8QA 2ZC3A 2VJQA 2VWHA 5L4LA 2IC3A 3M1VA 1C0UB 5CH8A 2KH9A 4TGLA 1WA5A 1EFLA 1RNLA 1XMXA 4FT4A 1O4WA 1NSQA 1GD1O 1QE3A 1YVPA 5BR1A 2W2QA 3K9BA 5FWYA 2XRMA 4L16A 1V9OA 1ZH0A 4NZ9A 2IYFA 3R1HA 3WLAA 3WMGA 4YRFA 3ILXA 5GY7A 4WIQA 3RRHA 4EUFA 1F2GA 3UHAA 1YX2A 3H7HB 3O1HB 4B9SA 3LY7A 3GJZA 5AJWA 5HDBB 1SM4A 4EG5A 3PQ5A 4RYDA 3RODA 3DCYA 3NTOA 3CRRA 4MAFA 4A27A 5IZCA 1JYEA 2RD2A 3I04M 2ZBUA 4DLNA 2A86A 1Y1LA 4HYEA 1EZZA 1KDTA 4R5PB 3OZUA 4PN3A 3INNA 3PHLA 5FV4A 2UUBF 2C2MA 1XQWA 2A1BA 3EVAA 2Z1NA 3VBCA 4LREA 1UAAA 2H48B 3D4LA 1X1SA 3PUYA 4X44A 4OQPA 4N6NA 1FFHA 4CLDA 2H59A 1G3RA 3EG9A 4B83A 1PX0A 3BTOA 4WFAQ 1K9SA 4GOOD 5BXIA 3ZTPA 2A6OA 3NBPB 2XQFA 1ITZA 4H7HA 1MQAA 2H1OA 4IDHA 1FX0A 2Z2LA 3I2HA 4W99A 3DLEB 2OY0A 1VSUA 2WVHA 3M4XA 4N0MA 5JFOA 4IFYA 2YDYA 4E2ZA 4AWAA 1DT5A 2BDEA 3QVLA 4Z6KA 4HAVA 1GTMA 2IM3A 3D4NA 4ZHQF 4DV5B 2G67A 3SWWA 4LGYA 2IVZA 4C9DA 3IG1B 1R7RA 1OVGA 1NHKL 1QG4A 3CH6A 1T0UA 4GSKA 4CR7A 1ZITA 2GCOB 1S1CA 4FOLA 1J8DA 4BDSA 2BKXA 3ONNA 2XCQA 2QYTA 3MJRA 4LQ9A 5EG5A 1I3OA 2I78A 3E7PA 1ACLA 1DC3A 4D45A 3OHPA 3IUEA 2JHCA 1U6JA 1DHTA 4AK9A 1JILA 3PZBA 1X4CA 1CG2A 4GL2A 3WQPA 3QHQA 4FX2A 4U8VA 3GGSA 4R1TA 5DCYA 4BO6A 1KJIA 3ROXA 1PT5A 1GVHA 4IIYA 1TAGA 4D6XA 4Y9DA 3PC3A 3CNLA 2OGTA 3VAMA 3DVQX 2WV9A 2QEQA 3R3XA 4HACA 2PWYA 2ZH9A 3ULHA 4DV1B 2GPYA 3NWRA 3CXUA 2Z2XA 5KQSA 3TZQA 1S1MA 4COKA 1YIAA 4ZMRA 3G88A 1IZ0A 2QTZA 3N28A 2WU0A 1H8EA 2I2CA 3V2UC 2OOKA 4MVJA 2RGDA 5JANA 1RVDA 1KEEA 2FP3A 5MDHA 4IIBA 2HQDA 4NLQA 2CQ4A 3L7MA 1Y5IA 4KHRA 4DR3F 4BWVA 4FVCA 3NVMB 3A58B 4FR2A 5DDIP 3QEJA 3T35A 2W83A 1ZNQO 3IAS1 1KJ9A 6AT1B 1YSCA 3M9NB 2P5SA 3KFVA 2QJWA 1JDNA 3VR4H 2Q5EA 3WP1B 1U8ZA 2BFFA 1QH1A 5BW8A 1T8RA 1MO3A 4WU2A 4PVDA 3VR4D 3VNVA 2V8OA 1KEZA 1XKTA 4WN9A 2IF2A 1BEZA 2APOA 4B76A 4JB8A 1RABB 1BS9A 1WCYA 3BRCA 2IEAA 4AS2A 2GXUA 3LKBA 4FOOA 2BGMA 3UCEA 1T1RA 1IJEB 2XCLA 3H42A 4M0CA 3WO1A 3EF1A 3PWKA 4PXYA 4ED0A 2Q27A 3I05A 5FTKA 1U5BB 2LFVA 1OU4A 4AJEA 1G20E 3GELA 4JD5A 1UINA 4N0PA 1K73T 2RHSB 1KO5A 3M5PA 2G9VA 5CLLA 1TPYA 3PUWA 3TQFA 3TW6A 3SQDA 2ZUVA 4OJQA 3D8NA 1I7PA 3DV9A 2G0IA 2ZXEA 2HMUA 1CEXA 3QT6A 3ESZA 3UMGA 3BTVA 3PA8A 5J43A 3PG9A 3MMCA 2BOAA 1L1EA 5DN6A 1D4ZA 5CXTA 3FW1A 3BX1A 1AKNA 3TD9A 3N8IA 4M9XA 1Y3CE 2BOPA 1VMBA 3GAZA 3AC0A 2BM9A 5DYWA 3FDXA 4H27A 4HADA 3WC4A 1XVLA 1PAEX 4URGA 1I8TA 3QIPB 2DRDA 4ZO9A 1YZNA 2YZ7A 1F5AA 4ZZ0A 5KJEA 5G0RB 2P1DA 1NKCA 2JI6A 2POCA 3FVVA 1VR6A 3DCAA 3LYLA 3ZOKA 3PGVA 1JZTA 3OFKA 4PHFA 4OB7A 5CA0F 1JLQA 1D1SA 4RJKA 3FOAA 4FLMA 4O3SA 1ANKA 4UREA 4LVNP 2VHTA 3JQEA 5CLGA 1U24A 1EGMB 3OZBA 4JC4A 1V6CA 2ZROA 3DVAA 1D4AA 4H4MB 4TXLA 2BMBA 4ZVRA 3KAJA 3OTGA 2XT6A 2ATXA 1YDGA 1UBSB 4R5MA 4JY7A 2DBYA 4JA2A 3DDUA 3QLUA 3LS2A 4FWBA 4CEJA 9LDTA 2AXEA 1ULSA 3TN7A 1VMKA 3RVSA 4NENA 4MYSA 1I1NA 1CCWA 3KJEA 4P73A 3LIPA 4RMGA 3NHWA 2XOEA 3A1CA 4WKRA 2MSEB 4L8YA 4E94A 1IBLJ 2F00A 1S6UA 1MO2A 4C07A 4A15A 4ZXPA 1ZCJA 5CAEB 1HOXA 2O06A 2P5VA 2A5GA 2GD0A 3C3LA 3PUVA 1QIHA 1N0VC 3EW7A 3WYCA 4YASA 4LRCA 5I7UA 1VOMA 3TLJA 2Q3FA 1NB7A 1IUKA 1L4BA 1H2RS 4YHHF 2WYWA 4JT9A 1NLUA 1D8YA 2FPUA 2QN1A 3TMYA 4PYDA 3WGTA 5ES3A 4X66B 2JAHA 1BD6A 2VB6A 5CVDA 4B79A 3R2JA 5AW2A 1QP7A 1BMFA 3THXB 3VVCA 5EJ6A 2QDKA 4BNDB 2FX3A 1IH8A 2HKIA 4I55A 4HWKA 4V3BA 3NFRA 3HXOA 4D8VA 2I22A 3D6HA 1LWFA 4NEZA 3GMIA 1J97A 3RU2A 4CLHA 3QF4B 5F3WB 3POTA 2F8MA 5DYNA 2JVOA 5FPYA 4MI1A 2GK7A 2JGMA 3L0SA 3GFBA 1Y5MA 1QGYA 2R3SA 2L19A 3EJWA 2ZM5A 3ZE9A 4RM2A 1S1VA 4QXMA 3M1VB 3AGPA 4CLSA 4JP1A 2DH9A 4QTTB 3RR7A 3STXA 2BGRA 4QU6A 3GEDA 3PIOQ 2QF7A 3C6MA 1LFPA 4GBMA 3MM5B 3QMVA 2AW0A 3HBFA 1Q8KA 3IRVA 4Y98A 3I12A 3UKJA 4U67Q 5B6JA 1L7XA 1U0HA 2G9RA 5K3BA 1TFUA 1Y3IA 1B0ZA 3V6KA 1GKUB 3EZ5A 4HDGA 3ZDEA 1RADA 2YYZA 4EBBA 3HSGA 3VPDA 3D3NA 2MQOA 4C8KA 3PC6A 3TX0A 3R3YA 3DT9A 5CTAA 1XI2A 3PXGa 3PCTA 3TFQA 1RAGB 1N0WA 3OVBA 4X9XA 1NWCA 1E61A 3TQIA 3E2MA 4ZCRA 1V8PA 4IXTA 1G21B 3QPIA 4CNQA 4RW4B 5EJEA 3GILA 1UL1X 1WKBA 4WE3A 1UJNA 2VTBB 4Z9FA 4UHKA 4DSOA 4OYYA 3ADKA 2W8ZA 2QYCA 2M2BA 1WPRA 4MH8A 4FF3A 1RM0A 4X7PA 3IUNA 2DGVA 9ATCB 3RSLA 4C3UA 4UU0A 4RA6B 2DLCX 2RI1A 4YT4A 3SF8A 3V00A 4UPEA 1AQIA 2MIIA 2NT3A 2YIMA 2NPFA 4BP9A 2AFHE 4YHBA 4CH0S 2E5FA 1F5NA 5K0BA 3LCCA 4XIJA 4L6CA 1NZJA 4DSLA 2ZW9A 3JTOA 1XPJA 2Q4BA 2ZJ8A 4CKYA 1ZFNA 2QZ9A 2WHPA 1QR2A 4D8WA 3QF7A 2A0FA 4FZJA 2W6ZA 1EZ1A 3MF4A 5LQUA 2PWZA 2FKAA 3U16A 5G41A 2B21A 3DYIA 4HOYA 4BFXA 4J7CA 5KC8A 1C50A 5K5MA 3T9DA 1M90T 5BSRA 3NC1C 4UARA 4KLCA 2NTVA 3ELBA 3LWNA 1NAQA 5L1IA 1XC9A 2QN8A 2Q9BA 2YQ3A 1E7MA 2OCKA 3N0WA 4DHVA 4IZHA 1ZEMA 4DA6A 4WK1A 5CFOA 5BSWA 1VP3A 4LXUA 4CCAA 2AE2A 1U5AA 1S8OA 3WB9A 5DG8A 5FUWA 1FDNA 2VG5A 2XM3A 3FNIA 4F6LA 1RE0A 3NI2A 2IZ5A 4P86A 1I2CA 3EWGA 4Z7CA 1BW9A 2RHWA 4NE2A 1WM1A 2FGCA 2Z58A 3RQIA 5IWCA 3OLWA 3MC1A 2XCAA 3CF5Q 4TYBA 3B9BA 1QOPB 2HPUA 3Q3HA 4ZVNA 1DMRA 3ZYCA 2AQ4A 1GZ7A 1SUWA 3ABSB 1EIWA 2ZH7A 2JZNA 2LTAA 5AKHA 1REVA 2PHZA 4TTIA 4ZOBA 2VQEB 4N8OA 1D3WA 4QW8A 4N40A 3KLVA 5LUBA 1NHUA 2XS2A 1WF2A 3HCXA 1S8AA 1NK6A 3DXFA 2QSZA 3DOUA 1LPPA 1RZUA 4YP5A 5MGBA 3QATA 2J8SA 3H2IA 2O0JA 2ZRIA 5K8MA 2YIVX 5TEVA 2DHXA 4ECQA 4TZ6A 3IBTA 2HHXA 2RUSA 1XRLA 5THWA 4DARA 2JZ5A 5C2CA 4OUDA 1MOPA 2J31A 4JHXA 5E0KB 4QDUA 1KQGB 4LGMA 4DDVA 3AD9C 4OAOA 1AGXA 1EGVB 1R4NA 3V97A 3FUTA 1Q1BA 3WWOA 3N53A 1S02A 4GM1A 4EGLA 1RWVA 1ZBDA 4AJ4A 1X9HA 1FSZA 5BWCA 4QOFA 4LQDA 1RT6A 4MKBA 2C20A 2VJMB 3VOBA 2MHNA 5I7OA 2PZAA 3KXKA 5KTYA 1SK8A 1KTQA 3UK7A 2QRKA 4H35A 1JAXA 3PIPQ 1FTSA 3F5MA 3CPSA 4XJSA 3R0VA 1JALA 3GCGA 3AVXA 3T3DA 2GN6A 3F6EX 2RS2A 5HW0A 4NAVA 4WP3A 2DRBA 3FCXA 1NJFA 4JGIA 2HAEA 1VYVA 2BUBA 1QWSA 3SQOA 4CLUA 3U09A 2Y1GA 2NUPA 3KWFA 2Q6TA 3C7TA 2VP2A 3HM2A 4PHCA 2COEA 1F5CA 5EC8A 1KTIA 1VQ9S 4AL6A 1AK2A 4Z4FA 2DSNA 3UXHA 4F7WA 2NZ2A 2AZ3A 3UMSA 3SHFA 2HK2A 2NADA 2OPSB 3Q8MA 3O8WA 4TQRA 2JJMA 5A0YB 3MAQA 2IFXA 3HFGA 1Q82T 2O54A 3M1AA 2C2KA 4C0KA 3FYHA 5D77A 5BNZA 5KVAA 2GNKA 1E99A 3CX6A 5T7BA 5DNWA 1M2VB 2CVIA 2V6BA 1PJBA 1XALA 2JGAA 4A3SA 5AQEA 4DBZA 1ZMBA 4M54A 2FG7C 1FEHA 1YZFA 4QQRA 2R8BA 2CJQA 1UEXC 3M1LA 3O5TB 2W9CA 2DUMA 4P3YA 3CMES 3UB3A 2ACEA 5FBRB 4EFMA 4DLBA 5F76A 3U19A 1ONBA 3HKDA 1FX1A 2Y0DA 3NTRA 4QATA 4K0KB 1WNTA 3T1YB 3KJGA 1SNYA 4YN3B 5CLHA 4FEGA 1X8XA 1U81A 3HA7A 3GQBB 3K6RA 3NUGA 5AVRA 2H5EA 3BGWA 2WYIA 2Q6OA 1CJVA 4WFZA 1DLOA 2H0AA 1X19A 1WR8A 2WDPA 4BP1A 3HV0A 3C6YA 1HD1A 1IRXA 3WLKX 5HQLA 2DHAA 3BIOA 2EFNA 4RKYA 3KQHA 1F2DA 2PX5A 2YC4C 2W2XA 1AKQA 1UKZA 1QH8A 1HLPA 1O57A 3BB1A 3DA8A 2VAWA 3I28A 4CO4A 1FUEA 3O0TA 1JSRA 4AQYF 1YHQS 1Z4LA 3GCZA 2HHHJ 1AG9A 3JASA 4MQUA 5JHHB 1RKQA 2QAGA 3S2EA 3NKYA 1LW0A 1T9UA 3CLKA 1U99A 5KB3A 4N3GA 3PRJA 3H20A 1EETA 2BDTA 1GAEO 1IR1A 4E0BA 2IW1A 4OX9Y 2UUWA 2WUDA 3PFBA 2VPWB 2IM1A 2QMEA 3NM4A 4AZ3B 1BVYF 1EZ4A 5KYGA 5HF6A 1UK8A 1TVMA 1CQJB 1RTJA 1WC4A 1UC8A 1ZO8A 1RLCL 2IYGA 4KFRA 4X4SA 1M1YB 1RAFA 3I31A 3CZMA 3OEED 1N5QA 2EZTA 4M9CA 3NALA 2AX4A 5AOBA 3SJCA 2Y1WA 3SHWA 2MTLA 1ZVQA 2OV4A 2ZRFA 3G8AA 4R2XA 5JPCA 2OPQA 1CB0A 3QU9A 1ZISA 5CAAA 5COBA 1HA3A 1NNI1 2BMAA 2O8BB 2QLLA 2DEJA 4IBOA 4HQ0A 3IR6A 2C5FA 3R5JB 3TQTA 4YQFA 1VQOS 2FN7A 4YLEA 4QFDA 1SHKA 1BS1A 5FKJA 4FB5A 4QM6A 3CW2A 3UT6A 4RTSA 5FUBA 2AF6A 2ZTMA 2F90A 2O8CB 2RI6A 4HMPA 2FPGA 3BJMA 2QGFA 4MPTA 5J4KA 4PGGA 4DILA 5HJ2A 4CCYA 4JUZA 1RUSA 3EZLA 2PFSA 3SXUB 3TBFA 3V1KA 2XPCA 2C03A 4QX6A 1YSJA 2AK2A 1H0RA 5IFLA 3N6NA 5DJ5A 1XD2A 3KYDA 4XZ3A 3GNSA 4D3ZA 2P9YA 4ETNA 1PD1A 1C1HA 2OCLA 2D7SA 3BO2A 1VBFA 1VZ3A 2AEJA 4S2EA 4DV5F 2VUUA 1XHEA 2Y1EA 3O21A 3UTCA 3PRBA 4HUTA 3OTEA 1IEQA 4L28A 1JG1A 1GPMA 1KMCA 5L6MB 2KHCA 2QGZA 4NCHA 1NHGA 1GUYA 1NXPA 4NLYA 1D2RA 1QGOA 2J8AA 3TSCA 1WCV1 1Q11A 2RKIB 1HBMA 1DBWA 3I1IA 4M49A 1R89A 2PZJA 4JV0A 2I8LA 5AM2A 1RDFA 1R8PA 3L8GA 5D1HA 1GT6A 3QVTA 2I62A 2PMWA 3I5YA 3QPWA 4DUGD 1QG2A 3KQNA 4GD3Q 4L51A 2QRZA 5BV8A 4L0MA 3NCQA 1M83A 4DL6A 4UATA 2CDBA 3S1AB 1J5EF 4RADA 1ESMA 3EY9A 1WOMA 3LC0A 2Y9MB 1XOIA 2BCJQ 2G1HA 3ZXXA 1DRWA 3N76A 3FMPB 2YQ1A 2E44A 1R5OA 4OQ4A 3SBMA 5DTJA 2D06A 1Q20A 4BQQA 4EGQA 3WFZA 1HHQA 2RGNC 4FQ5A 2HWTA 2FVSA 2EQ5A 1K2WA 2MTBA 1MNQA 4IOCQ 3ZNQA 2BFPA 1PI3A 1QHXA 2ID8A 2WJPA 1W5BA 2SCUA 3B1ZA 4HHEA 4NYMR 3BBCA 4D97A 1V5FA 2E55A 4FFBB 4M36A 4M5HA 4DL3A 3CCJS 4FIZA 5B09A 4A2PA 2IXBA 3VAKA 1OSCA 2IY7A 4W5JA 1YQEA 3Q9LA 3RARA 5CB6A 1ESZA 1IEVA 1CRQA 2IAJA 5GV7A 3LBNA 1CUIA 2W4MA 4KXQA 1E8MA 5LOVF 5BPHA 5KOHA 4IFIA 2Q4EA 4BFUA 3KLFA 2II6A 3G9QA 3R3SA 3VZIA 2LIVA 1V3TA 3HRKA 5BRNA 2XZTA 3LXMA 4GRIA 4JI3F 2C1EB 4EHNA 3C70A 5I48A 4INJA 1S10A 4MW0A 4G0YA 4FF1A 4ZVQA 1UZUA 4ZT3A 2OTJS 2N0SA 1R3NA 3IN5A 2ILTA 3GEPA 3SVZA 5DGIA 1JJVA 4ASUA 4TZ0A 1F1BB 1HDEA 3PA6A 4GVPA 3N8DA 2X7IA 5C8YB 4B6JA 1XQIA 1DC7A 2ZB7A 3BEOA 2YBDA 5CD9A 3DDCA 3GGDA 1FWKA 1TGYA 2XY4A 1Y3KA 3LHIA 2HA2A 4A4JA 3IDOA 2ZH1A 4W7SA 3FYUA 2PAFA 5EIOA 4M53A 4DR4F 2ETVA 3I2JA 5GOTA 2F3PA 4I0WB 1RIFA 3IEMA 4H6XA 2OFPA 3ZVNA 2PRJA 4DLZA 2UYCA 4LBVA 4C6TB 3NNAA 3TRJA 2XEDA 4YMSA 1C29B 4WLNA 4U7UD 1G8SA 4RESA 5BNIA 1OF1A 3I9KA 2VC1A 3NBZC 3TOZA 1C4AA 3CN7A 4OYOA 2M70A 2FIUA 2VF5X 4PC2A 2G04A 3U48A 3E2PA 2VDUE 2I4RA 1OQAA 5LP6B 2ISQA 1JEYA 1OV6A 4LZPA 1L4LA 4DIDA 1D5WA 4F2DA 3TYXA 2AG8A 1J99A 3S2UA 1NPTO 3OZFA 3EPGA 3MPDA 3VAAA 4NU6A 5KFRA 4KIJA 3OPYI 1UPTA 5KYVA 2IE0A 4LHYA 5J2TF 3QTTA 4OLAA 3CZCA 1OGYA 3EXHC 4MW2A 3QI7A 3DQPA 3KZXA 1IHDA 2ILZA 4RL4A 1DQNA 4F25A 1GXSA 1EIYB 3JQAA 2Z6QA 1S77D 1N2BA 2PD1A 3L09A 2DZDA 4UDOA 4YEAA 2XCOA 1IKXA 4V0NA 5HK9A 3OJLA 3O8RA 1BKDR 1PBAA 3SQWA 3R5HA 1INLA 3MQ4A 4OJKA 2HYIC 2P9ZA 3RVLA 3W9SA 5E4YA 1S1WA 2LCQA 4CDNA 2J6IA 3L46A 4A10A 4CIOA 5ICMA 2WTEA 4XJTA 4KR2A 3UMMA 3B6IA 2KBFA 3G9XA 4K4XA 1RA6A 3QY0A 3OBBA 4XDHA 2JLQA 4AFFA 4BXOB 3KFLA 3GUVA 1UJ4A 1WW8A 3D31A 4QJ5A 1RZMA 5KTSA 1JX6A 1JG6A 2E7XA 2HGZA 2FHOB 3EPHA 4IM7A 1IQPA 4IZIA 4KKVA 2UUCF 1KZHA 2G36A 4V0KA 3MAGA 5PNTA 3RAJA 2EGHA 4GKKJ 3QV2A 4MH0R 2KO1A 1SULA 1E2JA 1JNYA 3P0FA 2FVQA 1D4FA 1S7GA 4J9SA 4F91B 3VAGA 1NVEA 1NBEA 2E9TA 1YE5A 3GFOA 3EC7A 4JNKA 3B12A 1S2LA 1VE1A 4L6AA 3MILA 1BMQA 2GO9A 1AW0A 2YN2A 2CQDA 1EQ2A 4YWJA 5HJYA 3RB0A 2OPRB 2VFRA 3BQMB 3LDHA 2VLIA 3K8YA 2QSWA 4F4WA 2JIOA 3GIRA 3HWWA 4OHOA 3ZJTA 1IPHA 4GLFA 1XQXA 1K4KA 1BFDA 4KB5A 3UK6A 3PGMA 1HR0F 2VHWA 4R16A 1U5CA 1PFYA 4TXMA 4D5EA 2C2MB 1YS9A 4NYMQ 1I2AA 4YX9A 1N9ZA 1JEQB 2W22A 3UDVA 2FW7A 3UAVA 2NO1A 4F4FA 5TVKA 1NVDA 1J06A 2OXRA 1SQ0A 6FDRA 5CJJA 1WHTB 3F9CA 2OO7A 2R87A 3ZV7A 4MZXA 1ODJA 3FNNA 3A12A 1M1YA 4GLLA 3UK0A 1OMSA 3KQLA 1NK7A 4LDNA 4ARIA 3RS8A 4KPEC 1YQQA 2IYUA 4I67A 4NYPA 1E63A 1R3UA 1SJ3P 1HI1A 3CJ0A 1Y9EA 3KTOA 4BNNA 3ICQB 5CRIA 3SC3A 5KWEA 4ISCA 2R3VA 3SCIE 5JD3A 4QT0A 1FS6A 5TDHA 3W2HA 3CH5A 1GPLA 3FVQA 1MPTA 3FI0A 2YZ2A 4QGFA 3PEEA 1DBQA 3KR2A 4OMDA 2YHIB 3DD1A 1S3GA 5SYMA 2I3GA 3ITHB 5CP8A 5C31A 1Y9AA 3P71T 5F64A 2WICA 3LLMA 2ECFA 4M60A 1EHIA 3C19A 3KSBC 2AG1A 1P6XA 4ZVGA 1HK7A 1KQGA 3L6CA 3DQZA 4YRRA 1T9HA 3W5YA 1KJ8A 3EAFA 3KG0A 5IG2A 3C8DA 1XDDA 4A0HA 1JZQA 3Q5EA 5KFCA 4IDEA 2V6GA 2AJFE 5KCZA 3PPXA 3RTBA 1F14A 5I8WA 1Z45A 3THXA 1BAPA 2D4HA 2CAJA 4UOCA 2LP4A 4EFKA 2HBQA 1RXOB 2VIHA 3QHAA 2M32A 3CX8A 3HEBA 3N2GB 1JX4A 1H2AS 3CT4A 5AFSA 4FNOA 1JW9B 4X8HA 4BV9A 4S0XA 5HE8A 3H59A 1G3QA 1JRLA 4JYAB 2HZAA 4KIGA 1Y0BA 1BE0A 1UDAA 2FW8A 2QP9X 2PK3A 2VDKB 1QKJA 2FX2A 2JLGA 3GE9A 4QC2A 4M1QA 2V5AA 1C30A 4FMPA 2PGCA 3VR6A 2BISA 1K5GA 1A7UA 4L76A 5SUHA 4URQU 3HQ4O 5KINB 1L4UA 1UKBA 1SN7A 1IQUA 2CXSA 4DCMA 3Q7EA 1LCIA 1M2KA 3R20A 4MUNA 5AJTA 1RU2A 2ZDOA 3AV0B 2V9WA 2FW9A 1FJHA 2AFHB 4I50B 3TVTA 5EIWA 3KV1A 2DR2A 3ZKWB 1JXVA 1A7AA 1LJ8A 3AU9A 1QGUA 4V03A 1XR6A 4WP9A 4YJ2F 2ZQYA 4JLOA 4MQEA 1KBRA 4XWGA 1R8SA 3KTAB 3BM5A 1SKRA 3SNKA 4GMXA 4W63A 2JLCA 4GKAA 4LSNB 2JC3A 1DQYA 4JLSA 3BKXA 3UK1A 3HJTA 4DBLE 1GFSA 1ZCAA 2D1YA 4OGGA 2H9ZA 4JHLA 3BN7A 5JSHA 4KMMA 3CC8A 3CNNA 3KCQA 4DSTA 4J29A 3FJOA 4B47A 2D5BA 2GTHA 2D0IA 2HUPA 2Y66A 1P8JA 1Y8RA 1NM2A 2B5JA 3CR8A 3TOXA 1M34E 4GZ3A 1HBUA 4AJHA 4PNEA 3NOGA 1NY5A 5GONA 1Q8BA 4OOEA 2AJQA 2WY2D 1GZUA 2FR0A 2XMVA 4CM6A 4OI4A 2WLTA 4N39A 5I4IA 3HKEB 4JYAF 3IDQA 3OOJA 4NFHA 1Z75A 2PSEA 3AB2B 2A9JA 1XB2A 4UFOA 3IQZA 2KHZA 2Q9UA 5HUHA 1CV2A 2Z0MA 5DZSA 5HUJA 2G76A 4AJPA 5BUSA 1WOPA 5KNDH 3AFMA 4YDRA 1JKJA 1QZUA 1B8OA 1Z38A 2JGFA 3NWOA 3GPAA 1CJTC 2EDCA 1PJZA 3VTAA 1HE8B 5TPWA 4KFUA 1F6TA 3C3BA 3GUUA 5CR9A 4W7IA 2HVEA 1NRJB 1C2TA 5LDDC 4ZYVA 2NO7A 1P17A 2EC2A 1LV7A 2QSJA 3NYQA 4C2TA 3FYUC 3OOEA 4KGZA 4DN9A 1NHWA 4UTNA 1HE4A 1ODIA 1KNZA 3UB2A 2ON6A 3UXYA 1PFKA 3UBTA 2BGKA 1MABA 1TU3A 4YHHJ 2JANA 3STWA 2QJTA 1ZJZA 1AO0A 2OD7A 1SZDA 1G41A 4MIKA 2J0UA 3LP1A 1U25A 1SPBP 1Y9JA 2YRFA 3EJMA 5FWYB 2E4UA 4CQMD 4WAUA 2ZK7A 5EZSA 5K0SA 3E7XA 4ENSA 3DL0A 1CDZA 4WOJA 2JG3A 3MTIA 2DJIA 2ZRHA 1HDIA 4NICA 1Q3KA 2NVUA 1RCXB 4CL3A 5JXWA 5F41A 2P6NA 3EYAA 3FFIB 1OZ0A 3WBZA 4F2PA 4URWR 3OPXA 3EARA 4BJ1A 5JROA 1B3RA 4JELA 2ALYB 3VR5D 4D4IA 5IBCA 2HQOA 3DMTC 3WQBA 3IE1A 3NHBA 2HMYB 3IMEA 3W7AA 2QQ5A 3OJWA 1I32A 2PX6A 5ITSA 2H1CA 4R6XA 2RK6A 1C9MA 3DF9A 4C3MA 2Q3CA 4USJC 3LO3A 5KFEA 1Q1ZA 5E6SB 1ULRA 1TM3E 1OTYA 3FNQA 3I56S 3H5SA 4HH0A 4S0ZA 1O6XA 1MC8A 3B5EA 3HM9A 3L0YA 3CWCA 1W30A 1U49A 4C05A 2NO5A 2PX0A 4R3WA 1H65A 4X3CA 5CNJA 4A2CA 4AKHA 1DC4A 3STYA 5T64A 3J80A 2J7PD 1TAQA 5E95A 2VCHA 3DV2A 1RA7A 5CMLA 5KWSA 2J5AA 1J2RA 3ASZA 3DP9A 2QLJA 1XEWX 3RBZA 4H1TA 4X71A 4NCGA 2YJ6A 3JD2A 4D9MA 1IRIA 3O4FA 1WUTA 5GMKa 5C8DA 3I76A 4PIVA 3U80A 5KQPA 4DNQA 1EX9A 3KKLA 2OBNA 3VAHA 5FWNA 1F6BA 2IPNA 1CR6A 3DFEA 4Q9KA 3MTDA 4ER3A 3IQHX 3CF2A 1B0AA 1KRWA 2ZYWX 2FUG6 1R0YA 1ZIOA 2W6JD 2BJ3A 4E09A 4CFZA 4NP6A 4X8OA 2XCTB 3EVCA 1HRDA 2QMZA 2XMQA 4RV5A 3BREA 1KLMB 2L3MA 1JG3A 1M10A 4IUDS 3KLIB 5KMGA 3KDPA 2Y8WA 4YJDA 1BJTA 5CYMB 4JXJA 3W3AH 4MWTA 5D3MA 2NV0A 4CV0A 2RCNA 3DOHA 5EEHA 2PEYA 2KJQA 3H6HA 4I08A 1Z07A 6YASA 1MQSA 3PX7A 2RKIA 5BVGB 1XMSA 3UR0A 4LZZA 3NANA 2ZWPA 3AL0C 2WB1D 4L4ZA 3KOAA 2IXDA 2VSFA 5F0UA 4B3JA 3D9BA 3B70A 2GKSA 3DZBA 3ZHXA 2FSSA 2ZVIA 1KMMA 2J67A 2AJTA 1VKRA 3K4QA 2Z5VA 1AN0A 5HUQA 4Q6BA 5DTEA 4GC6A 2XCPA 4K6FA 4YRGA 3C24A 2KG0A 3DB2A 3R5FA 1X7ZA 2P4HX 1FTCA 1QOQB 2FSHA 4Q1FA 5BOVA 4UTGA 3KHLA 3G6KA 3CD5A 4ZYYA 1K7FB 3EQZA 3M6LA 2OJ3A 1BEUB 4BLGA 4H3HB 1P9QC 2R6HA 4RY8A 3ML1A 4B71A 1P60A 2OZLB 3VMMA 2FFJA 3R7NA 3I2KA 2CE7A 3MUEA 2WWIA 3AI2A 2CLEB 2X9GA 2BQRA 4DSIA 1R6XA 4PRYA 1PQUA 4ALZA 2EK6A 2SXLA 3ZWXA 1LJLA 3RABA 1X9GA 3IEXA 1RS0A 2OC4A 1FLAA 1EM8A 3ZCQA 1PN3A 1NVVR 4GPEA 1DJOA 2X3DA 3UMBA 4YIHA 3BMQB 2JFBA 1HZJA 1WTFA 1SB6A 4OJGA 3ZY6A 5GJCA 4DHEA 4N4AA 1JVBA 3MMBA 2PFKA 3RFVA 4RWWA 1LPAB 5FL3A 1EJ2A 5DSTA 2CXXA 1TMJA 4HWSA 1O3YA 3R3WA 2BBWA 5H9EK 5SZHB 4L6V3 5JSZA 1WF6A 3MJ4A 3RTDA 3NGXA 3AG6A 2AZXA 1VLZA 1VJTA 1YJCA 2DKOA 2J8ZA 2KW5A 4WYWA 4QWEA 4B6GA 3W8RA 3MELA 1GXUA 2RQ4A 2RHHA 3KEMA 3I5AA 3H1BA 2QPAA 3MOJB 2XAAA 3QENA 3W4JA 4F4KA 3IV7A 4RTQA 4EHFA 3DPSA 4DZTA 3EDQA 1E1KA 3AY7A 3RV4A 4M7RA 2BJ8A 1M6YA 1FESA 1JHAA 4J2TA 4DKXA 4JV5F 1V47A 2JBWA 2ZIVB 3LT1A 4IG0A 2NV6A 4ONEA 3QJLA 1SQGA 1Y9ZA 3GJQB 1NH7A 5DYGA 5EWJA 1UFVA 1AMOA 1HNVA 2O2XA 4OZ1A 4LIRA 3DBRA 1UJMA 1R12A 4P22A 2J6CA 2QORA 5E3QA 4FS8A 3OIUA 5I3PA 1VQLS 3TLXA 5JLJA 2H5IA 1AT1A 1FHTA 2IYEA 4MEJA 4FVTA 3I9JA 2DGUA 4INOA 4A8TA 2VDWB 2Z2JA 2GLXA 3ULKA 2G2ZA 4USMA 2UVQA 1P18A 3AHHA 5K0ZA 2QL5A 2OE2A 4F8RA 3DXSX 3FOEC 1YWGO 3HFSA 4CLOA 2J3HA 3A6JA 4PQYA 4BTVA 1L7EA 2F4VB 3AX6A 4TTSA 4FW9A 2HCRA 4WY5A 3OJOA 5HLFA 3GIIA 2QD1A 2I6GA 4BMSA 3LM8A 2B36A 4DA4A 3VU0A 2MY7A 1ZAWA 1KMQA 2YQZA 2PRIA 4O4HB 3P2KA 2B7BB 3SNHA 3WWPA 1JAIA 3EZOA 5KDDA 4QXOA 3Q6NA 4Z7NB 4V0ME 2H07A 4IFTA 3TLYA 2OCPA 5FBQB 5D3QA 2IMOA 1IY9A 1IKYA 1SCUB 3K5NA 1KO4A 2BGUA 3FMOB 3A6FA 3TNYA 3QT5A 1J2EA 3RYIA 3HBLA 1PZXA 2ZIFA 4OLHA 3IMFA 3NOXA 3IMQJ 3A4TA 3ZGOA 1R74A 4BMYA 2RH3A 4DI6A 2ORYA 5CGZA 4FKMA 2RHDA 3VQSA 4XTCS 4CYUB 2OCDA 4JUBA 5EJ2A 3C3PA 1KP9A 4NBKA 3FGNA 2E5LB 5JJ5A 2O23A 5JC1A 3H0PA 4LF5J 1RW4A 5TMBA 4X4TA 1VI6A 3AXSA 3X1YA 3TQ1A 1SO8A 4PYJA 4KV8A 3FTPA 4Y2TA 3GJ3A 4GUAA 4ZVPB 4UNPA 5D0HA 3ZK9A 3A9WA 1NURA 3AB3A 4XARA 4PR6A 1Y5NB 4RVFA 2NYUA 2QVYX 2RAUA 2IRXA 2EKBA 5BUZA 1RCUA 2FC9A 1KWGA 4RKRA 1AXRA 4JCOA 3JAMY 4KK3A 3K8QA 1T2NA 3B78A 4DM4A 2HQCA 3E35A 2VBWA 1FP7A 2R5FA 4F7VA 2VAXA 1RACB 2F5GA 1NSTA 3S28A 3IO5A 3BYPA 4DG9A 1CTQA 3O2IA 4YQYA 4UJ3A 1UOOA 2I6WA 4DVJA 1GZSA 2EX0A 4Y2QA 5JSZB 4CT5A 1JFFB 4AX4A 2VNAA 4LIWA 2RGRA 4M63A 4OX6A 1U7HA 1E79D 2RJ3A 3CR3C 1CXZA 3FBBA 2B4UA 1OFVA 3OZGA 2V55B 4BGUA 4N5LA 3OJ0A 5DN9A 2QI9C 3Q0EA 2B4OA 1ZUNB 4BLVA 1G0OA 4I5EA 1K7CA 2HHHF 5F3RA 1UBTS 2WILA 3KLEA 3SX2A 4ANDA 1VL0A 3E1KA 3F7OA 5A8RA 2IIBA 4TTPA 3AEQB 4BPRA 3F1KA 2HQSA 2A9PA 2DO4A 4F71A 2HFVA 1LY1A 1S2DA 2XR1A 4G1UC 1TJPB 3UMFA 1DSSG 2CXPA 2PV7A 4W4TA 1ATIA 1K66A 1FUYB 3K96A 1UBFA 1E94E 5FX2A 2HLNA 3AR5A 4AYWA 1ZI6A 4CMIB 1FMJA 2V7WA 3F67A 1L4MA 3AI7A 4WOCA 2DNHA 3DI6A 4G0WA 2MJUA 1C41A 5KQLA 3HJAA 1DKRA 4LBIA 5THXA 2V4RA 1VE5A 4CM7A 2HMVA 2CQGA 1RTHA 3WWDA 2O1XA 5E7QA 1IXSB 1FSFA 2AV6A 1VG8A 2QX7A 3Q2SC 3I3SR 3TDNA 5P8WA 6GPBA 4EY5A 2M6RA 5HJ5A 3FNFA 2AEMA 1QO9A 4HGQA 5F5NA 1DAFA 3AETB 4JLDA 2CJFA 3R0QA 3MGAA 3EZ2A 2ZJBA 4XM2A 1EG7A 3BHNA 4OX7A 4MP6A 4K2AA 3KT0A 3P6YC 5AK6A 2GAOA 5CFNA 4XASA 1PJLA 1QO0D 5CFMA 1PEYA 3USZA 3LSTA 4G25A 4UNQA 2C2YA 5JFTA 2GYVA 2X8AA 5IZ4A 3DFIA 1GSOA 3WDMA 4UNNA 1CX9B 4JOUA 5AWFC 4G5RA 2YDXA 1QAXA 1AGNA 1NASA 3W77A 4BQSA 1TUGA 1FP2A 4KPYA<