4B3MJ

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 7
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4b3mJ00
1XNRJ 2MTLA 4DR5J 1HNXJ 4DV7J 5AJ3J 3R2CJ 4B3RJ 2UUCJ 4GKJJ 2E5LJ 5IT9U 1N34J 2UUBJ 4JI1J 4LF8J 1J5EJ 1N33J 4X64J 1IBLJ 5A2QU 4YHHJ 4LFAJ 4JI4J 4DV1J 1HNWJ 3JAMU 4X65J 4NEYA 1HNZJ 2VQEJ 4HHUA 4DUYJ 4YY3J 3D3BJ 2KL8A 2KVQE 4JI8J 2UUAJ 2ZM6J 4NEZA 4DV5J 2UU9J 5LM7E 3W1YC 4DR6J 4JYAJ 4DR3J 4DR7J 4JI0J 1FJGJ 3IMQJ 3D3CJ 1I94J 3OTOJ 4DR4J 2VQFJ 4DR1J 4LF4J 2UXCJ 3T1YJ 4JI3J 4JV5J 4V1Ak 4DUZJ 5BR8J 4JI5J 4X66J 1IBKJ 3J7AN 1N36J 4DR2J 2MQ8A 4LF6J 4NXMJ 4LF9J 4K0KJ 4LF7J 4KY3A 4B3SJ 3R2DJ 5IWAJ 4DV4J 1XMQJ 4PWWA 4KHPJ 4OX9J 4GKKJ 1XMOJ 2HHHJ 4LFBJ 5LMNJ 4DV2J 1HR0J 5LMUJ 2UXDJ 4LF5J 4B3TJ 3J80U 4LFCJ 4NXNJ 4JI6J 4X62J 5FLXU 1XNQJ 3T1HJ 1N32J 4DV6J 4JI2J 2F4VJ 4AQYJ 4DV3J 3J81U 4KYZA 1IBMJ 4DV0J 4JI7J 2MEWA 4RJVA 4B3MJ 2UXBJ
chains in the Genus database with same CATH superfamily
3O5TB 3CVKA 4WXOA 2HZAA 3PZPA 5KG2A 3KLFA 3A1YG 1HNXJ 3MR6A 3G6ES 3J7Z5 4F50A 3NP5A 4HH0A 4I68A 4DU7A 2IMWP 3OLAA 1JJHA 2EFOA 3SSQA 4V19J 1QVGR 1UL3A 1RLDA 5DLGA 1TMMA 1CSJA 2VH7A 1GT8A 1C0UA 1CJKB 1SC3B 5ETNA 3JTOA 4H4MA 4DX7A 3PX6A 2C2RA 4DPUA 4CLKA 2J6TA 3SXLA 1JQGA 4OYXA 4IOBA 2EPIA 5CCMA 2XEXA 4DV1J 3MDFA 2DNLA 4ENOA 1T9VA 5HVGA 1X4HA 2XMJA 1T05B 4TNOA 4USWA 3E01B 1LW2A 2MQNA 3U27A 5HQMA 3H4BA 3MAHA 1MU2B 3MM6B 5K8PA 3L9ZA 1HBOB 2AP6A 4F4WA 1S57A 3D5MA 1IBLF 4X4NA 2IHR1 3U7JA 2YX1A 1WG5A 4A8XA 1YLXA 4ZIVA 2Y9HA 3H5YA 3ZNJ1 3T6JA 4NLTA 3OSNA 1S1WB 3HHKA 3BBBA 4F4KA 1YX2A 3ZZRA 2Z57B 4C97A 3CJTA 4M5JA 4KV8A 1HWUA 3EUNA 4H4OB 3QGHA 3IWNC 4J9OA 2YWKA 5IT0A 2GQ2A 1RI7A 1H74A 3C16B 3OL9A 2QG9B 3POTA 2F40A 2OHDA 2RQMA 5ETMA 1H98A 1NNDA 2LFVA 3IMQJ 2B4PA 4USTA 2V6AA 4ZVUB 2MSSA 1WC3A 3IG1A 3ZZZA 1RTHA 2LU1A 1WC4A 5C24B 3H4DA 2IA6A 4B3RF 3D67A 2BRLA 3FRZA 1JWWA 2LA4A 2A2CA 4LF4J 2Z8QA 2DXDA 2BEFA 5F9LA 1N5YA 4QWDA 5KFLA 4DUZJ 2J9EA 3TW0A 2E1CA 2HQDA 4KH0B 2G9OA 1S6PA 4L3NA 3I4PA 4HTJA 4JI2F 4RW6A 1SH3A 2C22A 4J9QA 2DR9A 5D77A 1YJTA 4MK9A 2VKRA 3P96A 3PACA 3I0SB 4NE9C 2W25A 3A8EA 4DZDA 4WFNQ 3GFXA 3RTVA 1YZ6A 3UCUP 1DRZA 4DXLA 5CHCB 4DR2J 3SQGA 4LF6J 1O0PA 1LOUA 3MEGA 1VQMS 4AT1B 1IWAA 3K5OA 1FRXA 3PYGA 4KBIA 5KFTA 3WQPA 1D8ZA 1P9YA 3CJ5A 4DX8H 2CJQA 5EWEA 1VC5A 2FJXA 4KY3A 4ED2A 3QIPA 3GU0A 4CO2A 3LTOA 4ZLLA 3KLFB 3G2XA 1Z2ZA 4GVBB 3T9NA 1TL5A 4DMZA 2QLBB 5AE2A 4EBCA 1R0AB 1X5PA 4LQ3A 4WFZA 4NLUA 4ECQA 1SL1A 2KO1A 2UVUA 2J9DE 1R0CB 2CPFA 3BSNA 1S6OA 1CLFA 4PKDB 3QJLA 1P27B 2GMLA 3KMQA 2ACYA 2OD4A 5L9NA 3RR8A 4Y00A 1LQ9A 3HCXA 2O1PA 4G1IA 4A8OA 4DPYA 1TAUA 3H2VE 1FD2A 2F7VA 3IR7B 3NL0A 2DH8A 1VIXA 5KFQA 2B8QA 2MKKA 4LF4F 5MAOA 1N8RT 3P5BP 3K58A 1N5TA 4CH7A 5K8MA 2DTJA 1WC6A 1WELA 2W8LA 5H9EJ 4WP8A 4PWDA 4KKOA 4K2XA 1XTZA 3BZQA 4KYZA 4DV0J 3GYNA 4PQAA 4JI7J 1XQIA 2HBRB 1JLCA 5EWGA 3EGWB 3F41A 4ITSA 4PYAA 4G1QA 4HH1A 1UFLA 2RDJA 1TKXA 3M9OB 4L6V3 2HRTA 3FBFA 1YRXA 2HHWA 4J9LA 3PV8A 1UKUA 5F0WA 1RHUB 4MKVA 2EXUA 4ID8A 3DRSB 1O5JA 5K9FA 6FDRA 3AH6A 5KFSA 3VTIA 4ZLPA 2MQQA 4F4XA 4XIUA 4LF8J 1RA6A 1S0MA 2APOA 3CPWR 1LWCB 2E9RX 2ZC3A 2HQFA 1KQKA 2XWYA 2Q6CA 4DX6A 3RBZA 5C42A 3BO3A 3C3LA 1YJRA 1OQ6A 1HBOA 1UFKA 3ET6B 4NLYA 4WIQA 2D3OR 2WK4A 4A8QA 4JI4J 3W62A 2RF2B 5G0RB 2YPZA 3FFIA 1QUPA 5HMZA 1UEUA 4ZPDA 2OPSB 4ETZA 4C2MA 3OHAA 2HVIA 2DEJA 2C3OA 3NOCA 3V4MA 4LF6F 4X4TA 1SJ1A 4OYWA 5BYRA 3AFGA 1HI8A 1Q1KA 2F3JA 3NGSA 4M5IA 3FMWA 3HX9A 1AZSB 3MHYA 4LR9A 5CH7B 2O01C 5KFGA 3UDEA 2XYPB 1DTTA 4DOZA 2IIHA 1CPZA 1RAFB 2MZRA 2Z2LA 1ICEB 3N0VA 4PAAA 3TNVA 5F8IA 3IRWP 3KK3A 3C16A 3Q8VA 1W2BR 3OJSA 3CCSS 3GIMA 3VAHA 4TVAB 4P2FA 2KG0A 1KLMA 1F3VA 3RBXA 2OPRB 3MWBA 3HHLA 5CQGA 2LVWA 3CD0A 2HNZA 4CTAB 3GILA 1QSSA 3DM2A 5LJ3Y 1FKOB 2A10A 3UDLA 1PG5B 4U7UK 3L3CA 3JSMB 1NBEB 1VJQA 1TKXB 2DB1A 2DNOA 2YVSA 3M8SA 4OI2A 2E5LF 1EZZB 2HS4A 4NLPA 5LMUF 1C1BA 1S4FA 2F65A 5F3TA 4BLGA 4DLEA 2B7CB 4O3PA 2RS2A 3IAM9 3F44A 4DPOA 2KI2A 3GQCA 2BM1A 1X4CA 2JZ5A 3U1NA 2ZOMA 1U02A 5D78A 5GAEI 3NBPB 4N56A 4DFMA 5F8JA 5M2UA 2BKPA 3T3FA 4N76A 3SQGB 2LKZA 2QMXA 1XERA 3MEGB 4DV3F 4OZ0A 4ECXA 2BV3A 1K47A 3E8OA 1WEXA 3VGUA 2VPXB 4J9SA 5HBMB 3UDVA 2QL5B 1UEKA 1T7PA 3GP9A 3UN5A 1FDNA 3T5JA 2QO3A 4NCAA 1O51A 2HMIB 5CCLA 3TQEA 4ECYA 1VQNS 1N36J 1UA1A 2AQ4A 1LWFA 3NS7B 1FEEA 2CQCA 1HHQA 4IYQA 5D4OA 5HI7A 3THVA 2B56A 1XIQA 2QLJB 3O1LA 4KQZA 3EMTA 4U95A 4K4YA 1FNXH 1EX8A 1F5BA 3ZTQA 3MFHA 1QM9A 2FHMA 2AU0A 2XNQA 1KRPA 1HW9A 2NXUA 3FUYA 4CLFA 5T14A 1SIWB 2M2BA 3O2IA 2HG4A 5KAKA 3M32A 1EQMA 5DDQC 5K14B 4EUVA 2YTCA 5RUBA 2N82B 2GJFA 3JSMA 1SQEA 2QC3A 1HA1A 2ZOFA 2AD9A 1Q78A 4Y28C 2GMHA 4CLLA 1CC8A 1NEEA 3D66A 3W64A 3ZC4A 3ZZTA 4JOUA 3IC1A 4LSLB 5AJ3F 4NL5A 1B70B 4NLVA 1Y9OA 2BE2A 4IRKA 3SYZA 4JI6J 2XS5A 1RT6A 2ZBPA 2UXCF 2CQ2A 3V6KA 4F02A 3ETMA 3M8YA 2XS7A 3MD1A 1N32J 5IV4A 2PFFB 4EWTA 1W2IA 2D74B 3CCQS 5DM7Q 2F4VJ 1IJEB 1W25A 2OO4A 2YKPA 3DI6B 3O44A 4OJ3A 3DCAA 1B7YB 3BSOA 3MPDA 3QT5A 1Q16B 3IP0A 3BKUA 1K8AT 3BGOP 4DSLA 1U1RA 4UF4A 2F5GA 2V67A 2VOPA 1WJ9A 1ACMB 2CPEA 3D0GE 3EYZA 4DV7J 1RISA 4ECRA 1J5OA 1H7XA 2UUCJ 5IT9U 1OMSA 1RU2A 1KVKA 3EDQB 2AJFE 3DYAB 3R8YA 1IKWA 2JC0A 1ZPVA 1Y11A 2B3TB 2BVZA 2GVDA 4DUYF 3L95X 2X1AA 1HW8A 2XSJA 4FXVA 1RT5B 1VQPS 4C3MA 1IQZA 5KFNA 5HATA 3J80Y 3EPIA 2VU5A 1S7HA 2ZWPA 3DDNA 3QNWB 4IDKB 1RTIB 2PEHA 1RGVA 4ZJLA 4DL0C 2H3EB 2IY5B 1KONA 1N4LA 5HROB 2W4CA 2XM3A 3AXKA 4YR0A 2W2NP 3TUJC 5KG7A 4ILMA 1RBOB 1WD6A 2FJBB 2DNPA 2CQBA 2IJFA 2DISA 2NXNA 1GMWD 2BOPA 4K4VA 3DM2B 3WIVA 4YY3J 2O5DA 4NI2A 4C8NA 2RT3A 4DN0A 2RMLA 1RT2A 1ZS6A 1NK4A 4NASA 2BM0A 4ZP8A 2DCUB 1DHMA 4OZ2A 1L5UA 3HLUA 4FPIA 4QW8A 2MKCA 5B7WA 2OTLS 1FRJA 3DKDA 3GIKA 4A8WA 1Q53A 3EICA 4WF9Q 1O6XA 2EVZA 1BMQB 3B4MA 3MEDA 2L41A 1Q81T 4Q8EA 1JLBB 4B3MF 1WEYA 1UVMA 1K0VA 2Q1LA 1S6PB 2G2OA 2HQIA 3L09A 4RBVA 2MXYA 2WBMA 2KFYA 4HT7A 2F8MA 2GMJA 3NY0A 4XK8C 3SFGA 2KZZA 3J81j 5K20B 4J9NA 2ZJPQ 1KN6A 1VBXA 2N3LA 4YR3A 4YB1P 1BWEA 3HJFA 1ELOA 2VC0A 5J2PB 1PILA 2J8SA 2ILZA 4CWBA 2N7CA 4KGXB 2BE2B 2FYXA 1CULB 1U1NA 1HQUA 1D1UA 3UE2A 3WIUA 2C42A 1FJCA 1FJ7A 2VD3A 2FLOA 2V68A 4U67Q 3F73A 2DNYA 1M5VC 2ZH6A 4X66J 4KFBA 2P6TA 2NCKL 4LRAA 5K8OA 5M2PA 1HBMA 1HHTP 1ULRA 5CZXA 3RU0A 4NXMJ 2CDQA 1NAQA 2U1AA 3M32B 4KGVB 4EK2A 2BDPA 5KG5A 5J2NA 3RAXA 3KNAA 3SIPB 3TUIC 4YY3F 1NKEA 2ZD1B 3WHIA 5IWAJ 3IM9A 4F7VA 2R7RA 5L46A 2XYGB 4PYDA 2CPIA 1F6TA 3OD2A 1YQHA 4GKKJ 1R8PA 3MMAB 4USMA 2BQUA 5KFVA 2DPJA 2HGLA 1RT6B 3TR5A 2QYCA 5C2CA 2NZ4A 1JLBA 2JWNA 2W2MP 3JAMY 2EWHA 2JH3A 3K7RA 2CPDA 4EBEA 1RT5A 3RW6A 3R27A 4M5DB 5L39A 5M2RA 3GJQB 4LFBF 2CQ4A 1E6VA 2WVEA 4RR5A 3TRGA 2PO4A 4UUWA 4JP8A 4B9TA 3BN7A 1ZZFA 2BYCA 3MZIA 3AT1B 1NLKL 4NI2B 4ELTA 1NPRA 4USVA 5FLXU 4U7UD 3GMGA 3I0RB 5J2PA 3T5KA 4WIIA 2ZH2A 1X5SA 1XR7A 2R42A 2FIUA 1RT1B 3AQOA 3DLGB 3G8QA 4GO7X 3B54A 3DOMA 3A8KA 3Q24A 2FGOA 2CG8A 2FB0A 3HKZD 5D0HA 3MUVP 3G87A 2HFZA 1FFGB 1NXIA 1ZETA 1RT4A 3HJVA 5J1NA 2B4UA 4B3TF 3B6BA 5KFIA 1F3FA 2M88A 3D1OA 3Q86A 2C2MB 5C42B 2FJVA 4N41A 4FF1A 1ZPWX 3ET6A 4C3KA 4NZ7A 1U6BA 3BQ2A 1B3TA 1RWWB 2EK6A 4J5OA 5A8KB 2XZWA 3U02A 3OLBA 1N32F 1JKHA 3LOUA 4N8NA 4RWXA 2WAQD 2VV5A 3QO9B 1RTZA 3EM1A 2X7IA 1RE1B 2IDLA 3RG6A 3E2EA 3KJQB 3DLHA 3N5BA 3V6DB 4LVOP 3GJRB 3GIRA 4I56A 5A2QU 2WB1D 1XMQF 2ZKTA 3N6LA 1HARA 3FCHA 4WFBQ 2VJUA 3EZUA 4M94A 3RRHA 3ZNUA 4C48A 1T03A 3W9HA 3Q8RB 1RHRB 2K2PA 4JYAF 4LRFA 2UUCF 1FXDA 2WRMA 2QA2A 3DU5A 2E9ZA 1ZAWA 5KFFA 4X64F 2FLLA 2XMVA 4HTIA 3LF0A 1RXOB 4HHUA 4HHJA 1KVJA 3CJQA 2ZJRQ 1ZZNA 3I0RA 2DHSA 4ZHRB 1RAHB 3MM9A 3VGTA 1U4BA 2J0XA 5DZ7A 4TQRA 4ED1A 3CJ8A 4NPOA 4UOFA 2R8GA 2LYVA 2F4VF 2HBZB 1UAWA 4DV5J 4NMLA 2H51B 2UU9J 1DQAA 2VFSA 3KLIB 1YZ7A 4ID5B 4R8UA 4FBUA 1TV6A 4DI6A 3IWXA 3KOAA 4X4OA 1WC1A 1WKLA 1OWXA 2NUHA 3M2VA 4MFBB 5A0YB 1IBCB 2KM8C 3CW2C 4HEA9 5D4LA 3AB4B 4AUKA 3UDCA 1K9MT 2KTQA 2XY7A 3ZTSA 3QJPA 3TEGA 4DUZF 3DRXA 2XO7A 2RUGA 3DLEB 2V4RA 2YWEA 4OLOA 4DR1J 3FJ2A 4RW8B 1KS2A 3HKWA 2AGOA 3BKTA 4G3IA 4PWUA 3DXSX 4ERDA 1F9EB 2H48B 3V6DA 2YX4A 1WACA 3NNAA 4Q43A 3H5XA 4OYZA 3CJ4A 4RW9A 2ZH7A 3H5UA 4DUTA 4ED0A 2BANB 1PAUB 3ZXWA 3QYYA 3EE3A 4RBUA 3C66A 1RZMA 1F9HA 5D3GB 2R7TA 3MM8B 2P5VA 3DGPB 5JJBA 4R25A 1I5OB 2FC8A 2HK3A 3EVMA 2IM1A 1S97A 5CXTA 1KKHA 1GMWA 3ONQA 4IFVA 1UVKA 4P2MA 2KU7A 5K14A 4WE1B 3VR1A 2FPHX 3PRDA 4CLTA 4M5NA 2ZZMA 3BN4A 1TQLA 3P49B 3BYRA 1RWVB 5KFEA 1SUQB 2YNHB 2DR8A 2NSCA 2OELA 2PE8A 3THTA 4F3QA 3QPIA 2KN4A 3FRYA 3NEKA 3TX8A 1XMOJ 5IWAF 3W5XA 1KTVA 1S1XB 2D9PA 1LK5A 1NO8A 2ABYA 4ZVSB 5K5MA 4LUBA 7FD1A 1FX4A 3W7BA 5LMUJ 3Q2TC 5KFXA 3ZZOA 1KVIA 2F8EX 1ZTWA 1EQ0A 3ITHB 1WC0A 2XMUA 9RUBA 3PEHA 3GCWP 4ZHRA 2LDIA 3BKFA 1XNQJ 2P2CB 1VC0A 2LA6A 3RUBL 3PJXA 2GW8A 4NA3A 4LMZA 2QTWA 3HHLC 3EDRB 5E41A 4DV3J 4DSEA 3PX4A 4P75A 2MKYA 3HVWA 4O3OA 3I5BA 5F8LA 1VQ4S 1XNQF 1U24A 3SV3A 3HVRA 1H0HB 2HLTA 4KGKA 3PW0A 2DPIA 2BJ1A 2XY6A 5J2QB 2DRAA 1RHQB 2R7QA 2E29A 3TX0A 2RHSB 1CJTA 3EGVA 2W4DA 1Y3JA 5JMNA 1L3VA 4IG3B 3BEGB 3G71S 2HWIA 4FNHA 3K5PA 4LFCF 4RLEA 1A7GE 2WW4A 2WSFC 3ISZA 2I1RA 5LL6d 1JJ4A 4E98A 2CPYA 1EETB 1PJ6A 1RWPB 2CQPA 1VOMA 5MLCV 2RS8A 2XMAA 3C6UB 1S99A 3DOKB 4K4SA 1U6ZA 2W2OP 3VAJA 1X9MA 2JLFA 3GJTB 4K4UA 3HO1A 1FT8A 1U0HA 2DNKA 1V3RA 4YN3B 3MUTP 2E7XA 4DBQA 2NXJA 3PJWA 5F8MA 1HNWF 3DGVA 4OLPA 4QJVA 3CDWA 3OFHA 2QA4S 1YTYA 1VHFA 4FPRA 3DNCA 5B0AA 1N52B 1UWAA 4CP5A 1KLNA 3F56A 3NBPA 1Q79A 2B9XA 5EHHA 3ILLA 4B9LA 2VQEJ 1YRTA 3TUPA 3M1VA 7AT1B 3AD9C 3PKYA 4IFVB 2H4WB 2ZM6J 1Q8IA 5IC6B 5KT3A 2ZBQA 3G96A 2VQEF 3RBEA 2HRUA 2RQ4A 1O8BA 3DLBA 5ETRA 3NAHA 3EZ5A 2HBYB 3H25A 3TZYA 1U1LA 2M7SA 1YBTA 3BGUA 4IH7A 3W5YA 3W2VB 3CJ0A 3L7UA 3MEEB 1S1XA 2G1DA 2ZUGA 2ZE2A 4ICLA 4URGA 2VJVA 3GSIA 2PT0A 3R1LA 4RU2A 1VQ5S 2M4MA 1X4EA 1CULA 3BS9A 3NMAA 4NZ6A 2K7KA 3BSAA 3OSPA 2KFNA 4BHQA 5J2MA 2FLPA 3WZ0A 2F9DA 1VIOA 1QE1B 3TWZA 5C24A 4EO6A 1HNVB 2EG1A 2H54B 4OJGA 4JI6F 2XSFA 3MAAB 2YNIB 5D8HB 1WKKA 5DQIA 3V6HA 1JJ2R 1FK9B 2WW8A 4OL8A 1YKWA 3CD7A 4LBIA 3Q8YA 4M95A 1SJRA 1S7IA 2YWFA 3CJRA 4ZPCA 5HJYA 4KO0A 3MEDB 2JEGA 2ALYB 2XS2A 3BH6B 3R1HA 4ED4A 1VMBA 2JC1A 2YKAA 5T41A 3J7AN 3QFHA 3QRRA 1LFPA 3OL7A 2P9EA 3I32A 5BJRA 3BSCA 3MMAA 1NJIT 4X4QA 3Q2SC 3NS5A 4WTYA 4ZS6A 3PHTA 2UXDF 4J90A 1DJ0A 1U6FA 3CIZA 3D1QA 2VB6A 3D28A 2RKIB 3HP6A 4ELVA 1MW7A 1X5OA 2E7WA 2W24A 2DGVA 1KBRA 2XG8A 4OZ1A 3LGHA 1VK3A 2YPYA 4EU0A 2NS1B 4WP9A 3OVBA 2ZE2B 5ETSA 4MYUA 4Z37A 2EC0A 2PA8D 1S9EA 1WKJA 1HBMB 2D3ZA 2XMTA 2I0XA 3IS9A 5LMNJ 1U0HB 1FD8A 2FVPA 1RWKB 2VICA 3OTBA 2GQCA 2CZ9A 1JLGA 3CO0P 2QFJA 3OVSA 4X65F 3H5SA 4I6YA 4WK3A 2Y1IA 4HT5A 3U1LA 1RDRA 3LA0A 5KOWA 2YNIA 3MR2A 2GA7A 3GIIA 1SJ3P 2BE7D 2H9ZA 4HYKA 4TY8A 1F1BB 2FJWA 5HQLA 1PYTA 1SC1B 4DV6J 2YBVA 1EP4A 4QCLA 1X8DA 4GVBA 5B08A 5C7PA 4Q8FA 2AWZA 3DRPB 1TTHB 3QGIA 3FCWA 1ZA1B 4WYWA 4RJVA 3QJJA 3VHQA 3UD3P 4LBPA 1RT7A 2CAJA 2K06A 3RRGA 2W9BB 4YR2A 2QZ8A 2WONA 2JNJA 2J8AA 1Y5LB 2ZNZA 3K17A 4BWMA 5KFAA 1H73A 3GV5B 3G6VA 1FNMA 1Q82T 4YOEA 5KFRA 4O4GA 3H90A 4J9RA 1U49A 4GKJJ 4URQU 2V4JB 1OQ3A 4WJBA 4ILRA 3QZ8A 3MCSA 3C6TA 1TKDA 4EO8A 3KHRA 1VJWA 1QD1A 1PIEA 1B0PA 3PG9A 5H1SV 4B9NA 1H2VZ 1ZA2B 2VBWA 5FDLA 1ZM3A 3EXCX 2VPYB 1F2GA 1SVDA 2FJDB 3IFEA 3HFZB 3DLKA 1GAOA 1RT4B 3FGVA 3NOGA 5KT6A 3FFIB 3Q23A 2Z58B 4OJHA 1S6QB 2CWXA 1GEHA 4IO1A 3JAMU 1F60B 1HBNB 4KKOB 2DNMA 5SUHA 5B0DA 2Z0GA 5AXNA 2GJIA 1W26A 2LQ9A 2OPQB 4X65J 5DDOC 2ZHBA 1NJZA 1N0VC 3TVYA 1F0XA 3K8VA 3NLCA 2UUTA 3NGUA 3H40A 2VHGA 2X1FA 2ZOGA 3HULA 4E2FB 2E5IA 4Q45A 1B99A 2HGMA 2IRXA 1T02A 4MAKA 1KC8T 2KFZA 1TL7A 4CI0B 4LT6A 4WBFA 5ETQA 2V94A 5I3QA 4RNMA 4ZCMA 5L1IA 2VG7B 1PC5A 1M1KT 2LECA 3PX0A 1M1HA 4AYBD 3D6MB 1MN7A 4OZ3A 2OPRA 4ZCLA 3ZZYA 4CTAA 2JVOA 2CQIA 4UQTA 4PG6A 1S9EB 2GS8A 2QIFA 2DHXA 2VBXA 4NWBA 3EZOA 4GC7A 1SKWA 2M8DB 3D3CJ 4IR9A 4A48A 3HT3A 2UZAA 1RAOA 3KJFB 4ES3A 1SL2A 4ZPTR 2LXIA 1Z1ZA 2IAJB 4RUCA 4RUBA 3PJ9A 4TY8B 2AIRB 4P7TA 5CD4A 4WE1A 2UU9F 4G1PA 4CO4A 5KFOA 1E6VB 4C7QA 1A6LA 2YNFA 3FZBA 3CDBA 5A0YA 1WI6A 4OI6A 3HHLB 2G0CA 1P6TA 4AL6A 3LWMA 2R2TA 4QPTA 2H5EA 1S1WA 3H98A 2JEIA 4USUA 3JSBA 3D4JA 3H59A 2FJEB 1UWBA 5KFKA 3Q8QB 4BCAA 1LWEB 2HZCA 2VFRA 4OHYA 2V8VA 3DOMB 1NH8A 2R7UA 3FDSA 1QTNB 3VGSA 3LPYA 1WDTA 2X3GA 3TA0A 9ATCB 1IKYA 1UZHA 2B6AB 1VQLS 4KHRA 4QR2A 1KQSR 5KFPA 2R2SA 1LK7A 4OYAA 4EZ9A 1C1CB 4LFBJ 2GJ2A 2ZH3A 2ZH9A 3HVTB 5FDLB 2LCWA 3HSJA 5HBMA 1KSPA 3OUYA 2CNNB 1BUXA 2QSFA 4NCGB 1H2UX 1VQYA 1X0FA 4RW6B 2VL1A 2PD1A 4UZCA 5ETPA 2CNKB 1Q7YT 2Z2MA 3CTRA 1HPZA 2DIVA 1KOOA 2V8PA 2R9LA 2L48A 2FVRA 3RYLA 2B7BB 3QATA 1U26A 4CLWA 4XPCA 3HSZA 1VLOA 2GAHC 5HK4A 1LV5A 4ALZA 4UW2A 4ZDNA 4JI2J 1TFYA 2QV6A 4V19X 4U96A 3OJUA 5DG7A 1S48A 3T5HA 2MEWA 1VQKS 1VQSA 3P5TL 2R2UA 4C8LA 4Q0BB 1YBUA 1SIZA 4MKBA 2PGCA 1XC9A 4TU8A 1BQMA 3HM9A 3MMBA 3SFUA 2NXCA 3HFVA 2XLIA 4I6WA 4NRUA 1YJVA 2CNOB 4YFUA 2ZZTA 6AT1B 4ECTA 4BC7A 4FS1A 1IVZA 2KDOA 4P2SA 4D3HA 1UJ4A 1MROA 1VI7A 2ADCA 1OY6A 3QGPA 4CNZA 3KLGA 3IO1A 1HNZF 1N33J 3DRYA 4O44B 2Z4PA 3TJ9A 1KHVA 1NK6A 4YP3A 3PO5A 5F0UA 1TUVA 2OEMA 1C0TB 2WSCC 4PR6A 2HQGA 3D6FB 1RACB 2YNGA 4LFAJ 4YDDB 2MGZB 5LMNF 4CLZA 2ZBCA 3MM7A 3M8QB 3P6YC 3R7NB 1APSA 1RTIA 4M5KA 3ENAA 2GV1A 2B0GA 4M5HA 3PO4A 3VCDA 4FXWA 3QWPA 3I9V9 3WX8A 2GIFA 1RCXB 1FHTA 2ZUAA 5JUMA 4I2PB 1S1UA 4WU2A 2KVQE 2MQPA 4UOGA 3GWCA 4USIA 2BBEA 2IM0A 2YWHA 4Y6IA 4QYRA 3RAQA 2ATLA 2UUAJ 3B4DA 4C8YA 3TARA 3MTKA 4I7FA 1YG0A 3DRSA 3W5ZA 1SQGA 2KYXA 4TQSA 5DZ6A 4F4ZA 3CD6S 2PI5A 3DLJA 2BE9B 5IM0A 1NDCA 5DM6Q 1TL1A 1Y5NB 3A12A 1WG1A 3G8SA 4JI0J 1P1TA 2MQOA 2HNYB 3K59A 2RQCA 4FVMA 3W66A 1C2PA 4A4JA 4LF9F 3K5NA 1CJUA 4ZJQA 1ZM2A 3OVAA 2HWHA 2J0QD 2EEYA 3IR5B 4OV6A 3P8BB 4JB8B 3FVYA 3GG1A 2VZ9A 1JIHA 1Q7LB 4ZVHA 4LSZB 1IWGA 2YKMA 3G8TA 2RRAA 1FWPA 1U1MA 1UWBB 3HZGA 3VVTA 2YNGB 3AJ1A 3M8PB 4B02A 3MGJA 3MEEA 2R4FA 5J1EB 3UR0A 2CPJA 1FJGF 4ICLB 2M5YA 2IVMA 5CABA 3LQVA 3FEYB 1JLQA 4RO0A 4B9SA 1S12A 4PZVA 4P9SA 2AX0A 1R6YA 2RDIA 2ROPA 4YB7A 1BQMB 4ZVFA 4CYUB 5CA5A 5CAAA 4A8MP 3RB0A 1XMOF 2D1CA 2J6SA 1KP6A 2HHUA 2DBBA 3H2LA 3V81B 1SV5B 4C9DA 1JK9B 2IM3A 1RYSA 1K44A 4DV4J 2HIYA 3ZTRA 4ZLJA 2YH1A 1PGZA 4PWDB 4FYDA 1XMQJ 1S77D 2MLXA 2PC6A 1Q0NA 5HLFA 4DV5F 3NAIA 4L73A 1IR0A 2R7VA 3QWUA 3TUZC 2MGZA 1GQEA 4TU7A 3G4SS 3MM7B 1TL1B 1S10A 2A3JA 1SPBP 2N4CA 3IGVA 2FVQA 2ZVSA 3GFYA 1WF2A 4JBCA 2NSBA 4IKAA 4DQRA 4MMOA 4DR5F 3GZ7A 3HF5A 3N4WA 3KHGA 2OMOA 1BC6A 4WYLA 4ZP9A 2GFFA 2GIRA 3OT9A 1S49A 2GHVC 2CNLB 4GMKA 4PEOA 5AT1B 1S1UB 2C3MA 4JV0A 4FN5A 4F0MA 2QL9B 2ZH8A 2HRYA 3AD7C 1IKXB 2L3MA 4DZ6A 1K1QA 3ILIA 4DR1F 4O3SA 3BPDA 3UNYA 4X4VA 4ANCA 7FDRA 3LALA 2DXEA 4AQYJ 3UCZP 3TP2A 1CEZA 1UA0A 5BYSA 4F3OA 4P2XA 2YWWA 2J7WA 1NRKA 1N0UA 2CJXB 4M5LA 3PR4A 2A18A 5IQQA 4DPWA 4Z2XA 1H72C 2LMIA 4WWSA 2AW0A 2ZD1A 3SCLE 4QIGA 4OMFG 5GAHU 3OW2R 2UVVA 4KGMA 4IQMA 2XMKA 1PC4A 3M30A 5AXLA 3IN5A 1MMDA 4JV1A 5IT9Y 1Y10A 1J27A 2UUBJ 1OY9A 4CZCA 1UETA 4GC6A 4JV5F 3FEXB 1RAGB 2FHJA 4CQ1A 1U8SA 4D3GA 3AXMA 3PW5A 3F0NA 1ZM4A 2HPUA 4UOHA 4Y2KA 1DZ5A 3C14B 4UY85 1FVQA 4ZN3A 3H2UB 3UN3A 3BDEA 5L1KA 4LR8A 2P8IA 1NHUA 1D0EA 3DOLA 3NGKA 2GIQA 2NLWA 1KDNA 1YSJA 2W9AA 2YKMB 3TJAA 5E3CA 4DV2F 1AW0A 3KNGA 3T9ZA 1RAAB 4KAIA 1TFWA 2KRRA 4GO5X 2FY1A 5ETVA 2FVCA 1H7WA 3QSIA 1RT1A 3DLGA 4WKYA 1TK8A 4OZ5A 4UY8T 2OFGX 5KT4A 4PXCA 4I67A 2ACMA 3A8IA 1R27B 4MIBA 2B4OA 2DXFA 1IKXA 4E0DA 2KT3A 3GCXP 5JVGQ 1LXNA 1X4BA 3CJKA 1IN0A 3AQPA 4J91A 4HDHA 3OTCA 4NEZA 1QJHA 4X4RA 3HHLD 4K4WA 3HHEA 1VRUA 2QFIA 2POKA 5LM7E 2Y0BB 1UW9A 1WSRA 4DR6J 3M7VA 2ZDPA 3L7PA 1AB8A 3NCQA 2L9NA 4NLSA 3CXCR 3QRQA 3QAUA 4LF2A 4DR7J 4AFFA 2QJ3A 1HBNA 2Q43A 4CO0A 1NSQA 1OPIA 3BGFA 4YEAA 1NKCA 1T0TV 2JJ4D 5B0EA 3Q22A 2M52A 2W2PP 3ZZPA 3EJMA 4UQGA 4DSJA 2QL7B 2LXFA 1NU4A 1UEVA 3MPYA 1WORA 1Q8KA 2GX8A 2HAFA 4K59A 3QIPB 3JB9k 1KOHA 1RSCA 2ZITA 3DLEA 4KGZB 3AJDA 2EI5A 3WDOA 4JV5J 2FTRA 4V1Ak 5D0EA 2MB0B 3BM7A 4DU8A 3FEZA 3A3OB 1X4GA 3TA2A 3UN2A 2UVWA 3V5RA 3CCMS 3GE9A 4O4RA 2FVSA 1HMVB 2KHDA 2CJBA 3D6HB 2DCLA 3TEHB 4JI5J 3B82A 4NLWA 4DSKA 1JLGB 4ILLA 4YQWA 4KE5A 2N3OA 2BA9A 3E51A 3ENWA 1RHKB 1J5OB 1EARA 1M0SA 3T41A 3BO4A 1YITS 1GTHA 2AF6A 4PPZA 5HLFB 2FQQB 1C1CA 4L3KA 2V2VA 3O8WA 4PABA 1AFIA 2VODA 2CFXA 1BE4A 2JL9A 2A2DA 5A8RB 5U47A 3K5LA 2VG5B 5HMWA 2R7XA 4ZVOB 3RBDA 3I31A 1F9FA 2V2KA 2Y1JA 3ETOA 1G2EA 3DI6A 4PUOB 3TYTA 3LAKA 4IDKA 1VQ6S 1NDPA 2BW2A 1CBKA 3SDEA 4KT0C 3D6TB 2CPXA 1HR0J 3I82A 2FC9A 3MPUB 2VOOA 5HAOA 1U2FA 3JYTA 2AT1B 2HFOA 2LQ5A 1R43A 2QLWA 4MIWA 3TZXA 1S6UA 1H3DA 2EFVA 1S0OA 2E1MC 3R6GB 3DC2A 1B64A 5IV3A 2G2ZA 1IKYB 5E5NA 4ZVTB 2QX0A 5I4MA 1FKAF 3OXGA 3J81U 3W3SA 2IYIA 1RWOB 2NUUG 2XZTB 4R0EA 2HVDA 4J9VA 4LRBA 4F0HA 3J7YI 3I6PA 5G0RA 3DMJB 3K8WA 1BWVA 3MR5A 1WWHA 1TMJA 5I42B 1FTRA 1SUQA 1RYRA 4C8ZA 2H5IB 4CLSA 4F8RA 4ZCKA 1C0TA 4P6QA 4QIFA 1UMJA 5AJ3J 4XPEA 2O67A 1IR2A 5HMYA 2GAGC 3R3TA 3KK2B 2B8PA 4AQYF 3BV8A 4OI0A 1Q8LA 3N5FA 1REVA 1B0TA 1YI2S 2RB7A 2VPWB 5H9FJ 3MFIA 4WKRA 4USJC 1UPPA 1NSPA 3DRRA 4ZVPB 1CJVA 2GVZB 2RU3A 1JXLA 4X4PA 2MLZA 1T9WA 4J9KA 5HP1A 5H9EK 2WVDA 2V5HG 1GXUA 1TVRB 4QU6A 4QU7A 5EWFA 1AXQA 1FWLA 3FSIA 4ED3A 4K7QA 1RADB 4UOCA 4EBDA 3NNHA 4IH5A 2MY7A 4WFYA 1X7VA 3CUNA 5J2QA 3KFWX 1L3UA 1FXLA 1WC5A 3UNGC 1X0PA 2U2FA 3QT6A 4TY9A 3PDNA 1FE0A 1N36F 4NZ0A 1VBYA 5J2NB 1HLWA 5ADZA 2CRLA 3RRKA 1SCJB 2W7OA 2IRYA 3ENQA 2XTJP 2Y0SD 2VFVA 3M2UA 1F5AA 1FESA 2HKEA 3C6UA 2ROGA 3KUEA 5KFYA 4LF7F 3MD3A 1VRQC 3BQ0A 2MJNA 1QVFR 3ILJA 1HQEA 2FHKA 3FBBA 2QYGA 3L4BC 3P4UB 1T95A 3QT7A 4XDCA 4CDIA 2JRSA 5I42A 1EKSA 3NCRA 2HVHA 1AUDA 2OEKA 2CADA 3QBCA 4ED5A 1RLCL 1WOSA 1MG7A 2DITA 2HHPA 2IM2A 1URRA 3HT0A 4NA2A 3CULA 4DR6F 4QPXA 5A6WA 1RQ0A 3PRBA 1EKRA 2HVZA 2M9KA 5E7OB 1S9FA 4DG1A 2V2QA 3QQCD 1TVRA 4OFZA 5DS7A 2NR0A 4OYOA 4XTTA 4NCGA 5GMKa 2AEFA 1QTMA 4P73A 5IM0B 2PI4A 5A8KA 2ZKUA 4C3LA 5GADU 1FXRA 2Z2YB 3Q8SB 2EC2A 1UFWA 3GSDA 1I1GA 3FBEA 3Q8UA 1CQNA 2CZ4A 3PIOQ 2I5JA 1FRHA 5GAHI 3KHHA 1FERA 5G4DA 3CGIA 4ECUA 4K0KJ 3DMJA 3BJYA 4RW7A 3K0JA 5I3UB 1RT3A 4B3SJ 5LT5A 1PO6A 3G82B 5ETKA 4ZCIA 1QE1A 1V6HA 1YHQS 2AJQA 3M8RA 3T1AA 8ATCB 4K0KF 4ZVRB 2R3VA 2ZH1A 2F9JA 3KYLA 2CQGA 1NCLA 5ETLA 4OJ1A 3O3LA 1TU0B 1KTQA 1VBKA 3HI9A 2Q3PA 2Z2ZA 4JV2A 5FIIA 4CYUA 4JI4F 4NRTA 1CQMA 3DHWC 3DRRB 4A8KA 2LLZA 4HACA 4AE5A 3GV8B 2GGPA 3LGMA 1HIYA 4O44A 2UXDJ 3M8WA 3V4IA 2FGCA 4ZVGA 3DYAA 3LANA 2KG1A 5T7LA 1JNRB 2KXFA 3MM9B 2J6UA 1MLAA 2C2KB 4YDXA 4RL1A 3T1HJ 1FF2A 4JI7F 2BOAA 4IFYB 3KLHA 1JLAB 3QT8A 2BJ9A 2C3YA 3OR1B 4NOHA 5E3AA 3ZO7A 1RBAA 2CKWA 2YKNB 2B9EA 2BABA 5B0CA 1B4SA 1MWYA 1V9OA 4QQBA 3ZZUA 4A46A 1DQ9A 3MR7A 1CS4A 2B5JB 2MQMA 1T03B 1IBKF 4NXNF 4ZPAA 5KFUA 1FJEB 2RKIA 2MTLA 2ZJQQ 2RUSA 4O23A 1CJVB 2GVZA 3GJSB 4PPDA 5SZTA 3N6MA 2AHOB 4J37A 4WP3A 2RNEA 2E7VA 1RTJA 4H4MB 5KFBA 2ROEA 4I7FB 2GQQA 2BUNA 5KT7A 1UVNA 1RT2B 2OPPB 4RNNA 2DGUA 4DCJB 3GR1A 4PCQA 1SB6A 2W7PA 5AE3A 3MURP 4KHPF 4DV0F 1TUGB 5F8HA 3PVXA 1DLOB 5HO4A 3UD5A 1MWZA 4FBTA 1VHIA 1S9GA 1N56A 1V5IB 2D3UA 5GAGI 1BGXT 3MMCB 4OZNA 1N5SA 5D4NA 1DFDA 4DF8A 1QAJA 4RNHA 3UW1A 1T9YA 3RZAA 3GG0A 3SMZA 1RWNB 2PN6A 1YJUA 4OIXA 1EP4B 1K1SA 3PFEA 3FNNA 1NSKL 1Z2LA 1D3WA 4ED6A 1NH7A 2HS0A 1Q95G 1BHNA 1I51B 3AAWB 3D3BJ 1R89A 2COLA 5I3UA 3HFKA 1QY7A 4Y65A 2I5JB 2WSEC 4ES2A 4QYZK 4B3OA 2CYYA 5LJ5Y 4H4KC 4L74A 4ECZA 4USKA 4TLRA 2QA4G 2MPUA 1PBAA 4CO3A 1SJ4P 2Z56B 2LQ8A 3R9LA 2BANA 1VQ7S 3V6JA 2E66A 3ADAC 4HDGA 1AT1B 1GMVA 3AODA 4RUAA 1FNOA 1BQNB 1Q86T 3KDOA 2VF3A 1N5YB 1AUSL 4I6AA 1I94J 4FYVB 3UVJA 3TQ1A 4DV7F 1IXKA 2NPFA 3OTOJ 1MU2A 3MM6A 5CZVA 2IVFB 2DO4A 4X62F 3BGLA 3CEDA 3UO0A 3ZTPA 2MHNA 3MR3A 1J2VA 3CMAS 3TAMB 1SJFA 2E5JA 2AYBA 2UXCJ 2OTJS 5DGBA 4ZPVR 1NHKL 4P74A 1PBUA 2BMBA 4DFJA 3CCES 1U2RA 2FHOB 4N8OA 5D0RA 2R7OA 3THPA 2M8HA 3OL8A 4CCHA 4BDPA 2DH7A 1UP1A 3GR0A 4DR3F 4CO5A 3M8ZA 5KG6A 2QMUB 4NLDA 1RA7A 2FY8A 1TL4A 3BF4A 4YB5A 5IZHA 2DR5A 2HW3A 4ZP6A 1TL7B 2DNZA 4ECVA 4ECSA 1TL3B 1HQUB 2GZOA 2H5JB 4LF9J 1S76D 1EETA 4PUOA 1S1VB 2CQ1A 2AEJA 2BKNA 2B5JA 4HVZA 3WX4A 5B0FA 3RW7A 3M2RB 1P1LA 1J5EF 1GMUA 3FMBA 3P3DA 4XO0A 3R2DJ 2YXLA 1Y00A 1JLEA 4OQJA 1RWUA 2J9DA 5F41A 2BRKA 1UPMB 4PWWA 3I96A 3KKFA 5ETTA 1CC7A 3PXGa 5JXSA 4OX9J 3PR5B 3LP2A 1RU1A 1S1TB 4ER8A 4DSFA 1U8WA 3I0SA 3G9CA 4RZRA 1ZAVA 3LP1A 4NXMF 2MMYA 1LW0B 2ZBRA 2BXJA 3BH7B 4CM2A 3C14A 3S1TA 3GPAA 4IRDA 1RABB 2DGQA 1NK9A 2YWGA 4OHXA 1JKHB 4U8VA 3TVZA 2VQFF 1HYSB 4LF8F 2LEPA 4M5DA 2VIHA 4UTGA 2L9DA 1X9SA 4QIVA 4OYPA 1RHJB 4N7TA 1HD0A 4OHWA 1FX2A 1C4AA 1Y3KA 2XCPA 1BXNA 2JVRA 3D7SB 1SL0A 4MKAA 5B0BA 1VCTA 3DDKA 1LWEA 1AYEA 4RPFA 5A8WA 3PIPQ 4JI0F 4C8OA 4N47A 2MZSA 2J7KA 3T6BA 1HWKA 3R5DA 4URSA 3LGNA 1DLOA 1FKPA 1GTEA 4KH1B 1IJFB 5L9XA 4ZMMA 3OTOF 3KLEA 2ASDA 3NS6A 4JI1J 2JLGA 1E6YB 3WBZA 2IDEA 4M8LA 1G4CA 3PYFA 4YHHF 1R8CA 4KHMA 3OUYB 2QEXS 1FI4A 1IBLJ 2KZMA 4CM0A 3OFEA 1C4CA 1PYSB 4ZPWR 2AJ4A 2MY8A 3LP2B 1S4EA 1Z4UA 2EFGA 3TA1A 1S0VA 3BREA 5H9FK 2KVIA 1JLCB 4H54A 3TZWA 4K50A 2LDYA 3AOBA 1N6QB 3C8YA 5HN0A 1HKAA 4I2QA 3MEKA 1FCAA 2G0IA 2FDNA 2Y1RI 2IBOA 3RAMA 5J2MB 1HNZJ 1HQEB 4TU9A 4F2SA 2N4DA 2AV5A 4MT1A 2DGOA 5CYJA 2HNZB 2JFKA 3AHPA 4ZK7M 2CJKA 2R8JA 1KFDA 2NPIA 3UWTA 5B09A 2PMZD 4ZIWA 1MROB 2K7JA 4AL5A 4QWAA 3VZHA 3KLGB 5GMDA 3GB0A 4O4GB 3SCJE 4HKQA 5FLXY 2V4JA 2V9KA 3C19A 4ZITA 3CCWA 4KO0B 2IYGA 1RK8A 2NYIA 3QLHB 2DRDA 1HBUB 2MHEA 4CH0S 4EEYA 1UJ5A 1I3OB 3BR9A 1AROP 4DG1B 1I94F 1NJYA 3T5LA 3QRPA 2W01A 3OHBA 1R8AA 1WG4A 3FQLA 2C2EA 3DRPA 1YIJS 2K8GA 1T9TA 2IVYA 2P9CA 3H8YA 4FKYA 3VAGA 3FC9A 3VGVA 5K8NA 1HNIA 3BGRB 2LQJA 3OBIA 3T1YJ 3DFEA 1N88A 2BW7A 1WUUA 3W2WB 1TL3A 1G1XA 4EMDA 1U1OA 3NGTA 4NX9A 1U47A 1FTCA 3OTDA 3Q8PB 4KV8B 1PJ7A 2YX7A 1FKOA 1RAIB 3M4XA 3AA8A 5KTQA 4Y34A 1PKUA 2CA9A 1L3TA 4ZA1A 2WOMB 4RU9A 4RW9B 4EGLA 1JXVA 1VDHA 3PCOB 4TXSA 3CCJS 2VG6A 1M90T 4L75A 3QIDA 3BBCA 4OI1A 3KLEB 4CLPA 4P72A 2UV8G 2B9YA 1RAEB 1SV5A 2IJRA 4F4YA 2J5AA 3CMES 1NDKA 1S6QA 3E01A 3KUHA 3J7YU 2AGPA 1HD1A 4QZVB 2AX1A 1KQFB 3VZIA 2SXLA 1U09A 3DLKB 4I0WA 4A8FA 2DYAA 3QLHA 3VQTA 3GLJA 1BD6A 3KJVB 4DL3A 4H4OA 1U25A 2V69A 4ZKAA 4DL7A 2DD8S 1URNA 1OS5A 4YMEA 1HWJA 2HHQA 3CF5Q 4P10A 2VC1A 1X9WA 4B17A 3HZEA 3N79A 2O66A 1R7IA 2K1RB 2YKOA 2MKIA 4LFCJ 1X31C 3BPSP 1XMBA 3DOKA 3C6TB 5HQ8A 2A0FB 3EGZA 1GK8A 3JQMA 2VFTA 1M5HA 3AJ2A 4ATNA 5FJ4A 3IG1B 4DDFA 1LW2B 1QLNA 1KEKA 3ZTOA 4NMXA 2KJWA 3R5GA 4RNFA 4R5PA 2AJ2A 2CG4A 1UJ6A 3IBFB 1V5VA 1HBUA 1UZDA 2F63A 1TELA 2BR0A 4DR5J 2I38A 2FZCB 4B9UA 1YJNS 1NK7A 2XSJB 2DGTA 4MJKA 2E5LJ 5T7LB 4NYPA 5C5JA 4DV1F 2EKYA 2CXEA 2JSXA 2VDIA 2YNFB 4Z7CA 1T3OA 4BWJA 4FF3A 4YB6A 1PCAA 3UQSA 2ZWOA 4W90B 2BKOA 2HSEB 3G86A 3JQJA 1D9AA 2CPZA 4OYMA 3NG8A 2AJ1A 1YRUA 3E3XA 4YHHJ 3JXOA 2OAUA 4CLYA 4O0NA 1YJ9S 2M70A 1VS3A 1W7WA 2IA0A 3R6LB 3ENVA 2YQ1A 3OQ2A 1YDLA 3AA9A 3SEOA 2VBZA 2J0SD 4X2BA 3MMJA 4DHVA 4NEYA 2P9GA 5IQ6A 1X4FA 2D7SA 5DDPC 4KTQA 4O3QA 4LF5F 2WCXA 2NREA 4I1TA 3FBCA 5LSOA 2NZCA 3CE8A 4LF1A 4PG7A 3OR2A 3CCTA 2KT5A 1FDDA 5KT2A 2V4QA 3LAMA 4YS2A 2XC9A 3ULHA 2GVDB 4AXJA 1XEZA 2P6SA 4NLXA 2IC3A 2OJ3A 1LXJA 4DLGA 1FFSB 3M30B 1JB0C 1K73T 3BDPA 2W1BA 1VRUB 2GHPA 3M1VB 3LH2S 4OZLA 3OL6A 2W9CB 1G7CB 3BBFA 2C28A 4DSIA 4X84A 1XNRF 4PQUB 4DR3J 4JYAJ 4EYHB 4C0BA 1H2TZ 3KJVA 3W8PA 3KLVA 4KRWA 5L1LA 2FZKB 2QMWA 1HWIA 3W2WA 1R6VA 4MK7A 2OSQA 3PTWA 4PG4A 4BC9A 4IOAQ 3NRBA 4O3NA 2RH3A 1AZSA 4OI3A 4RBTA 5E3PA 1SH0A 4AD6A 3RB3A 3MECA 2MDAA 1WF0A 2G13A 1WF1A 2IFXA 1LKZA 3W61A 1S1VA 2VG6B 4MYTA 2BACA 2FHJD 3D0IE 3OFGA 4J9UE 2GGPB 4TYBA 3PW2A 1VFJA 2MYFA 3V4IB 4QIEA 2VA2A 3N28A 4Q44A 1OO0B 1NJXA 2PMHA 1RCOB 3IS9B 5EUHA 2HFVA 1G3OA 5KG4A 3M9MB 4MKYA 3HVTA 3VF0B 1I6JA 3SBMA 2ZZNA 2DNQA 2BQ3A 2N7YA 2MQ8A 4TN2A 2RJZA 1N48A 2OD6A 1UW4A 2J9CA 2AYMA 1KD1T 4Y0FA 2QLXA 2IJNA 3MPVA 4LF7J 3CCUS 4A8YA 3I5AA 3S7RA 1DTTB 2OUGA 3R7BB 4G1QB 1TK0A 2QN6B 1Y0HA 2Y1LB 2M0GB 4P71A 5D15A 2PFDA 2KJVA 1SKRA 1XBWA 4NCBA 5DRKA 3PNIA 3TAQA 4DPXA 2R2RA 2HHHJ 2D3O1 1QAYA 4IRCA 4L72B 2JOQA 1R8BA 1C0UB 1B7FA 3NXZA 1AA1B 1L3SA 3M8PA 3A4TA 2HEKA 4DFKA 1R0BG 8RUCA 5J1EA 1NM2A 4DQPA 3JYTB 2YY3A 1K0TA 2EBGA 3N9UC 3J7ZT 3KK1A 1DQ8A 3OR2B 2R7WA 4WFAQ 2HLUA 1WHVA 2XI2A 4DCOB 2EFPA 5L1JA 3QMQA 2YH0A 2DNHA 3PYEA 1WI8A 2R7SA 1KHWA 4LR7A 5HJXA 4AL7A 1M5SA 4C8KA 1H38A 1R3NA 2FJAB 2PMWA 4C98A 4H4KA 4FYXB 3TVKA 2DIUA 3CCRS 4N5SA 3M8QA 5KG1A 1ZM9A 2HURA 3AY0A 5HVHA 2CQ3A 1IR1A 3IAS9 4QWEA 1HYSA 1LWFB 5EGYA 1N34J 2DY9A 3DXBA 3VQSA 3A8JA 2XLJA 4W4MA 3MCMA 3VALA 4F04B 3RJMB 3BYPA 1FA0A 3IM8A 5HL7Q 5A2QY 1REVB 1GXTA 3T1HF 4B9MA 1JLQB 3GYXB 1S5ZA 4DX5A 4GVLA 4WCEQ 2KM8B 4GKKF 3TOQA 2EK1A 2DY1A 3GFZA 4C0HA 4C0OC 1NMEB 2BZ2A 2GCFA 4K4TA 3RB4A 4Q2MA 2QE5A 3EVWA 1VC6A 1QSLA 2I2YA 3PKMA 3D1HA 8AT1B 2AEMA 2NQPA 5E2QA 1IQTA 3TAMA 1HNWJ 2XYHB 3LP0B 4ZN1A 4XDDA 3DN9A 2DR6A 4F2RA 3M05A 5KOXA 3KMSA 2Q79A 1IUJA 2OSRA 4L76A 4DQQA 4PQUA 2MQLA 3KLIA 3NGRA 2MZQA 1VK8A 1HWLA 3M6XA 1L3KA 4LBHA 5DETA 4JI8J 2CUYA 5KG3A 1RKJA 2HMIA 2VKZG 4LSLA 3HSDA 2DEIA 5DQHA 4I4BA 2E5HA 5D0GA 1D9DA 4DWIA 2WZ1A 4AXIA 3OPKA 3TJ8A 2FLNA 2XNRA 1Q4RA 4FF2A 3K5MA 1TZ0A 2QRRA 4IO9Q 1T8EA 2UXBF 2DRBA 2L08A 2RVJA 3IBWA 2A6OA 1RTDB 5EX0A 1GH8A 4M63A 4X66F 5CYMA 2O3DA 2D9OA 1F5CA 4DPTA 4HI1A 5DQGA 2X51A 3MAQA 2V9WA 3PFOA 2MKHA 2E1PA 4EZ6A 2BJ8A 1T9UA 2JFDA 2DHGA 1UTAA 3PEJA 5LSRA 1VLYA 2VQFJ 5E3RA 2F8HA 2GO8A 3H7HB 3EX7B 3FQKA 3NWRA 1D8YA 2VASA 5E3QA 3CDUA 3VAKA 4J9MA 1DARA 4P52A 2ZC4A 1U0SA 2DJWA 4ID5A 1Q8BA 4R8UB 1LNQA 3X1LB 5GMEA 3OV7A 4J7CA 2DKOB 2G0JA 2VPZB 1XR5A 3NMRA 4F4AA 3KTQA 2HHTA 3PHEA 4FP9A 1CVJA 3K57A 3IRXB 3K2YA 1LWXA 3JTNA 2RILA 3KG4A 2PDAA 2H4YB 1HNIB 1JXEA 2FUG9 2Y3YA 3BGRA 4DJBA 4NYOA 2JEJA 4X4SA 2V8GA 2KXNB 4JI1F 4ZJOA 4P7VA 2QSWA 3G82A 3W8GA 2EKNA 1NHVA 1R0AA 4F3MA 2RU9A 5AE1A 2XHWA 4HL9A 4ZVEA 2AKWB 4ECWA 4FXDA 4Q7AA 2AZ1A 1EAYC 3TO8A 3DOLB 3OXFA 3DDIA 1H6KX 4C11A 3G6XA 2R8IA 3CJ2A 3UFCX 1DTQB 5KFJA 4KFBB 1WDDA 3MM8A 3D0HE 3MOZA 4ELUA 3CC2S 1LWCA 1WNEA 4HACB 2HHHF 2VBYA 3N6NA 2X1GA 3J80U 2XLKA 2HQCA 2PA3A 2WBRA 4OI4A 2EFNA 1T94A 1GFWB 3CCVS 5IT4A 1DURA 2HFUA 3DLLQ 4IR1A 3FKBA 1VRTA 1WHWA 3VV2B 3M9NB 4X62J 2PSZA 4OX6A 1OJ4A 2QT7A 4DEZA 4ZVQB 1OSCA 2LXUA 5A76A 1YVFA 3MXHP 1YK9A 2ZEJA 3A3PB 1BY9A 1RWMB 2KKHA 2WVFA 1U2CA 4ZPBA 2ZFHA 4EFAC 2MSTA 3SV4A 4RWWA 1RKIA 1FRIA 3VAMA 1CS4B 4KR0B 3KHLA 1RP5A 2IBKA 2OH2A 5KG0A 4K4ZA 1WSVA 1UCNA 2VG5A 3GTYX 1WTFA 3KXDA 3KG1A 4C4WA 1RAJA 1TKZB 1T3NA 3J7A1 1MMNA 2KHCA 2XMWA 4QR1A 4F67A 2ERRA 4B3RJ 1JMTA 3IXQA 4A8SA 2ILYA 2C2OB 2CPHA 1REGX 4K8RA 4WK1A 5E0OA 5HVFA 2X1BA 3HMJG 5GADI 3VVUA 2AGQA 3ITHA 1U45A 5KFDA 1J5EJ 4DQSA 1TR0A 3I55S 3CT9A 3KDNA 4CO1A 2BQRA 3A3NB 2MKSA 4A47A 5C25B 5L38A 2F4FA 4X64J 4B08A 1IKVB 4ED7A 3B8HA 3I87A 3O6QA 3IWLA 1DTQA 3T19A 1HR0F 2OPSA 2DNGA 2V2ZA 2HFSA 1VYAA 1C1BB 2C2ZB 5HMXA 3W65A 4DL4A 5EX3A 2V63A 3FK4A 3R5JB 3H0PA 4U9RA 4W92B 2J7UA 4DQIA 3DU6A 1WHYA 5EN1A 4KPYA 5DJBA 4EYIB 1CJUB 3IGNA 3Q83A 3UR3C 1RWXB 1CG2A 1QAXA 1GX6A 2CWKA 3ZFVA 2LU2A 2XB2D 4KPCA 4K5SA 1NK5A 2VA3A 5CYMB 1OYDA 2XQCA 1IBMF 3GFHA 3CC7S 2OGUA 3JQKA 1MMLA 2OPPA 4OX7A 4RX6A 4C8MA 4EI2A 2UP1A 4B3OB 3KK2A 3BR8A 2WOMA 3R7SB 3I4HX 4CIOA 4DF4A 2JHEA 1HI0P 1RTJB 1A0OB 3QFWA 1TP7A 4I2PA 1Q5YA 2PIIA 4QR0A 2CZVC 4OZJA 2HNDA 1JX4A 1D9FA 1FRMA 5J1PA 1QDUB 4I64A 3LWLA 3GV7B 1FJGJ 4WU3A 4R0JA 3C46A 1FK9A 2CJYB 2HYIB 3FCVA 2ZHOA 3V81A 1R31A 2C2DA 5ETOA 1S0NA 3NCPA 1T05A 3VWSA 1U1QA 4U8YA 1SQFA 3PW7A 1HI1A 2HNYA 5C25A 1UVIA 3MM5B 3WC0A 2M3DA 2UUWA 4X4UA 3DHXA 3RB6A 2EFQA 3OTEA 1LEOA 4JUZA 2ZH5A 5HSPA 2VUGA 5F8NA 1ZYQA 4DR7F 3W2VA 2BJDA 4CT8A 3EVOA 1WTBA 5KFZA 4RNOA 1VGYA 4Y2AA 4PXEA 4FS2A 2GHWA 2VDHA 3CDEA 3PRVA 4LQ9A 5CYQB 2DNRA 3R5CA 2XI3A 3W9JA 2CIMA 2WB4A 4WFXA 2HAIA 2VONA 4Q0BA 3CWJA 2UUAF 3PYDA 5DG9A 1NPPA 1IM6A 1JJCB 3MCNA 3Q89A 3UCGA 1JLEB 2MLYA 2MZTA 5LSLA 4FYWB 1RTHB 3MCOA 4CNYA 2I6WA 1OPZA 2XBPA 3D9BA 4LRDA 1NPKA 3KK1B 1SH2A 4PG5A 1TKTB 1OIAA 2JDJA 2BJ7A 2DH9A 1TV6B 2ZVIA 1DBDA 4LSNA 3SSRA 5E33A 1NUEA 3M2VB 1SXLA 3A13A 4MFBA 2JLEA 4ZP7A 2WHOA 4DV2J 1IKVA 2ASJA 3IR6B 4IQXA 4LIRA 4NLQA 5F8GA 3IA0A 2LEAA 3KG0A 3AOAA 1IKWB 4MTPA 2B9WA 2CJ9A 4F26A 2XO6A 2RRBA 3QZ7A 4J9PA 4IOCQ 2E9TA 2GO9A 1Y7PA 2WVBA 4NYZA 4U6PA 3NNCA 2EW9A 1X4AA 3TI0A 4RW8A 2UUBF 1N5VA 1FE4A 1DY3A 1TKZA 2GC8A 2RAQA 2D41A 2WONB 4FNIA 3S8SA 4JI5F 2EBEA 1NSAA 4OHZA 2QA1A 4LREA 1QUVA 4BBYA 1IBMJ 4FVCA 1XWLA 4RW7B 4TKTA 3M2RA 3MUMP 3V2UC 2AYGA 1F2HA 1DAXA 5A8WB 4B3MJ 1ITPA 2W7AA 2HNDB 3I9ZA 2KB2A 4PXDA 1SI9A 3W60A 3EWGA 4LVNP 4CRJA 1FWKA 2CDRB 2L9WA 3ISNC 2BX6A 4KC5A 4Y2IA 2K3KA 5IOLA 3W9IA 4FZVA 4FKXA 4USHA 5D3GA 1ZBTA 1M5OC 4F25A 4B3SF 1EHWA 4CT9A 3CJKB 2V8HA 3FSYA 2XCAA 1MWQA 2KRBA 3MM5A 4MK8A 4F36A 1FRKA 2I8EA 2ALZA 2B51A 5LOQA 1ROFA 3R97A 3QGGA 1TKTA 2G1HA 2OPQA 3NGDA 4K2JA 3C15A 1NZ8A 4N77A 1G6BA 5GAGU 1CJTB 2DHHA 3JTPA 3S6EA 3JSYA 4CH1A 2HS3A 2OLWA 5ITHA 4DL6A 1OYEA 2LP4A 3HXMA 2CQDA 2W4PA 3CIMA 5DG8A 2G4BA 4RW4B 2XGPA 4DV4F 4OHVA 2V8DA 5CYQA 2KXHA 2HWTA 3W63A 1EIYB 1FKPB 2ADBA 2MKJA 2HHVA 1WEZA 2PEBA 2XULA 3HPOA 5BYQA 3R5BA 3W1YC 2ZH4A 3VAIA 2J0WA 2HK2A 4QOTA 2IRUA 4O3RA 2DNNA 4LSNB 3PM9A 2GNKA 4ETXA 1S79A 3LP0A 2JEFA 1Q5VA 4DS4A 1N54B 4C6AA 4MH8A 2I9SA 5IC4B 2DT9A 3SI8A 2YKNA 3TANA 2MZ1A 2RF2A 4GKJF 3H42A 5D6GA 1S9GB 1FO1A 1VISA 5IXUA 3R5AA 1B0VA 1MN9A 1VBZA 2DVIA 1RT3B 2DR7A 5A8RA 5GAEU 1JNZB 4IFYA 3KLHB 3G6YA 2XGQA 4DFPA 1N6QA 3CC4S 2CVIA 3IRXA 1OY8A 4KSEB 2E1RA 4F0KA 3VAFA 1RJJA 1YGYA 2ASYA 3CMQA 4FYYB 2V50A 2X3DA 2OP5A 3CCLS 1FDBA 1BQXA 1PJ5A 3D54A 1RTDA 1UVLA 2WVCA 3LO3A 3PY8A 2LEBA 4E8UA 3SDEB 4OYBA 3UI3A 2Y8WA 5CD4H 4XAKA 1KLMB 1WOOA 4ZOSA 2QGFB 3HD2A 1KFSA 1HMVA 5B0GA 6FD1A 1YBAA 3TZZA 3PW4A 1SJQA 2CVEA 4HI2A 2B6AA 1EJ7L 4LJMA 4ANEA 5AXMA 2ATCB 4OX8A 1JLFB 4DS5A 1NB7A 4TYAA 4U7CA 1N5QA 4FDFA 4WXWA 3EXYA 4RUHA 1KWMA 1RHMB 2DGSA 2IAJA 2W8KA 5KFCA 4YUDA 1JLAA 2CJAA 3MPWA 5KT5A 3GONA 4KHPJ 1MNEA 2MZJA 5IS2A 2C2NA 3ILOA 3CDAA 4I69A 4LRCA 4NLRA 4WZMA 2WTFA 1FFWB 1VRTB 3MMCA 3US5A 1D09B 1HPZB 1T9XA 2B4VA 3C15B 4PRFA 1BLUA 4ANDA 4LFAF 2XMMA 3ICLA 5GVQA 4IUFA 1GXLA 2R8HA 4KJIA 2AJ0A 4LF5J 2RRNA 4B3TJ 2OMLA 5DGAA 5KFWA 4ZLNA 4NXNJ 1GNKA 3QO9A 1TUWA 3HDSA 2HQ3A 2A6MA 2UV8A 4IG0A 4UT4A 1VQ9S 3CB4A 1M1GA 4RW4A 3UPFA 3CD5A 3KWMA 1KNZA 5HANA 1N34F 1N33F 2C3UA 3MTJA 4HLBA 3MOJB 2Y8YA 3SSSA 2RD5C 2CQHA 1XK8A 4WTOB 5EDWA 3WC2A 1FEHA 3MMBB 1FDAA 1IM4A 4TLQA 4KB7A 3UVJB 2OFHX 3NWGA 3HSGA 1AFJA 2Q66A 3D68A 1HNXF 2RSQA 4CLUA 3M6UA 4Z7YA 1FVSA 3KJNB 2YQ0A 3MF5A 5DDRC 2UXBJ 5DLFA 1KQGB 4KIAA 4O0IA 5I3PA 4HR2A 4DL5A 2ZDOA 3ZZ0A 1XNRJ 4WPAA 4Q5VA 4G6VB 3LUYA 4WZQA 1XJWB 3IBCB 1PSDA 1YJ7A 1ZAXA 2NXEA 3R2CJ 3SZ2A 4DV6F 2HZVA 3UD4P 1U1KA 5JVHQ 2C3PA 4S0MA 1S72S 2K1RA 4JI3F 2CQ0A 3M2UB 4Q2LA 5FD1A 3BQ1A 4B9VA 2B43A 3KUGA 1LFWA 3LP1B 3LW5C 4G65A 1QAIA 1U7LA 1LW0A 4UZBA 1V3SA 4M5GA 1VQ8S 2DGWA 4OX9F 1M5PC 2V34A 3I56S 1WOPA 3MI7X 3N01A 2FZGB 2W2QP 1SC4B 2E44A 2AZ3A 4JI8F 1FRLA 2A1BA 1ZTTA 2C1EB 2IPOB 2F1FA 3CJSA 2ZM6F 5DO2A 3SQOP 1SC6A 5LXRA 5KFHA 4C11B 1ZH5A 4PG8A 4UUXA 3MAAA 4R5PB 1GX5A 4M5MA 4BS2A 1BQNA 5A6PA 3AD8C 3C2PA 1S59A 2EG2A 1U1PA 2RDDA 3SCIE 5HP1B 3RR7A 4FF4A 4ED8A 2IMOA 2R8KA 1JLFA 4DUYJ 1QSYA 1P9QC 2KL8A 4NLOA 5F9NA 2XY5A 4QWBA 3QSYB 1NKBA 2HBQB 1HQ2A 1TAQA 2XWXA 2K3IA 2RIJA 2ZBIA 1RUSA 1EB0A 1OSDA 5IFMA 2DO0A 4OYIA 5LXYA 3EPGA 2OIHA 3CCZA 4PXBA 2OKQA 3DGPA 3M6VA 3GIJA 1S1TA 1MSWD 1NB2A 4Y3CA 4GRSA 1X60A 1HNVA 3U1MA 1HFEL 3J81Y 3Q0AA 1RT7B 3H20A 4NLGA 3KK3B 2W9BA 1RB0A 2V0NA 3SCKE 1SBRA 3JS9A 3LPEA 3HHNB 2OI2A 2E1AA 3RGIA 4DR2F 5BR8F 4DR4J 2XZDB 2AMCB 4DL2A 3OXLA 5HROA 3BB5A 2NYHA 2ASLA 4JI3J 1VQOS 1NZAA 1CJKA 1YWXA 4QIWD 1SKSA 5BR8J 4DR4F 1A9NB 2ZNYA 1VR6A 4QWCA 2OEJA 1M5KC 2LQBA 2HHSA 3X3UA 4IH6A 1Y4ZB 2RHQB 4Y2MA 3GYGA 1UVJA 2RE1A 1PAEX 3AB2B 3P45B 5C2GA 2W9CA 5F3ZA 4LIWA 2KYZA 2AYEA 3HHDA 2D69A 1XN9A 2DHAA 4RKUC 1IBKJ 3QAEA 4DN9A 1X4DA 2IC3B 3EGNA 3HK2A 1TK5A 4MIAA 4Y2CA 2Q6BA 4ES1A 1NK8A 2HGNA 1U48A 3FZ2A 4QW9A 2HFNA 3K89A 3AOCA 3S01A 2RQKA 2YNHA 3I5CA 3MECB 3L7OA 4IG3A 2YKQA 2XHCA 3OR1A 4QBUA 3B78A 1V3ZA 1KR4A 3ELHA 2KH9A 2H1YA 4I2QB 1P8GA 1XR6A 3POTB 3D2WA 1NK0A 2UVRA 5L8RC 4QYZJ 1NDLA 1PYOB 4IG0B 4HHHA 2HVEA 4OV1A 3TAPA 2VFUA 5KFMA 4K4XA 1WHXA 1Y5IB 3HVAA 2ZHAA 2DGXA 2Z30B 2MJUA 4M1KA 5D4PA 2VG7A 1T11A 5AXKA 5BXIA 2FD2A 3CJ3A 1X5TA 4W98A 1RBLA 3CNQP 3ISND 2G2YA 2BJEA 3HD1A 3M6WA 2HHXA 3JSRA 1E6YA 2YQ3A 3T1YF 3NKYA 5THWA 3CO9A 2E5GA 2JX2A 2QLFB 4DCPB 1NJWA 1HL6A 1ZOTA 3BO2A 3FSXA 2HIQA 2J76E 2DK2A 2BJ3A 2H65B 3CSKA 3OFFA 4K5RA 1YJWS 2KT2A 1HHSA 4NA1A 1R8HA 1SKUB
chains in the Genus database with same CATH topology
1XNRJ 2MTLA 4DR5J 1HNXJ 4DV7J 5AJ3J 3R2CJ 4B3RJ 2UUCJ 4GKJJ 2E5LJ 5IT9U 1N34J 2UUBJ 4JI1J 4LF8J 1J5EJ 1N33J 4X64J 1IBLJ 5A2QU 4YHHJ 4LFAJ 4JI4J 4DV1J 1HNWJ 3JAMU 4X65J 4NEYA 1HNZJ 2VQEJ 4HHUA 4DUYJ 4YY3J 3D3BJ 2KL8A 2KVQE 4JI8J 2UUAJ 2ZM6J 4NEZA 4DV5J 2UU9J 5LM7E 3W1YC 4DR6J 4JYAJ 4DR3J 4DR7J 4JI0J 1FJGJ 3IMQJ 3D3CJ 1I94J 3OTOJ 4DR4J 2VQFJ 4DR1J 4LF4J 2UXCJ 3T1YJ 4JI3J 4JV5J 4V1Ak 4DUZJ 5BR8J 4JI5J 4X66J 1IBKJ 3J7AN 1N36J 4DR2J 2MQ8A 4LF6J 4NXMJ 4LF9J 4K0KJ 4LF7J 4KY3A 4B3SJ 3R2DJ 5IWAJ 4DV4J 1XMQJ 4PWWA 4KHPJ 4OX9J 4GKKJ 1XMOJ 2HHHJ 4LFBJ 5LMNJ 4DV2J 1HR0J 5LMUJ 2UXDJ 4LF5J 4B3TJ 3J80U 4LFCJ 4NXNJ 4JI6J 4X62J 5FLXU 1XNQJ 3T1HJ 1N32J 4DV6J 4JI2J 2F4VJ 4AQYJ 4DV3J 3J81U 4KYZA 1IBMJ 4DV0J 4JI7J 2MEWA 4RJVA 4B3MJ 2UXBJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR J;  2MTL A;  4DR5 J;  1HNX J;  4DV7 J;  5AJ3 J;  3R2C J;  4B3R J;  2UUC J;  4GKJ J;  2E5L J;  5IT9 U;  1N34 J;  2UUB J;  4JI1 J;  4LF8 J;  1J5E J;  1N33 J;  4X64 J;  1IBL J;  5A2Q U;  4YHH J;  4LFA J;  4JI4 J;  4DV1 J;  1HNW J;  3JAM U;  4X65 J;  4NEY A;  1HNZ J;  2VQE J;  4HHU A;  4DUY J;  4YY3 J;  3D3B J;  2KL8 A;  2KVQ E;  4JI8 J;  2UUA J;  2ZM6 J;  4NEZ A;  4DV5 J;  2UU9 J;  5LM7 E;  3W1Y C;  4DR6 J;  4JYA J;  4DR3 J;  4DR7 J;  4JI0 J;  1FJG J;  3IMQ J;  3D3C J;  1I94 J;  3OTO J;  4DR4 J;  2VQF J;  4DR1 J;  4LF4 J;  2UXC J;  3T1Y J;  4JI3 J;  4JV5 J;  4V1A k;  4DUZ J;  5BR8 J;  4JI5 J;  4X66 J;  1IBK J;  3J7A N;  1N36 J;  4DR2 J;  2MQ8 A;  4LF6 J;  4NXM J;  4LF9 J;  4K0K J;  4LF7 J;  4KY3 A;  4B3S J;  3R2D J;  5IWA J;  4DV4 J;  1XMQ J;  4PWW A;  4KHP J;  4OX9 J;  4GKK J;  1XMO J;  2HHH J;  4LFB J;  5LMN J;  4DV2 J;  1HR0 J;  5LMU J;  2UXD J;  4LF5 J;  4B3T J;  3J80 U;  4LFC J;  4NXN J;  4JI6 J;  4X62 J;  5FLX U;  1XNQ J;  3T1H J;  1N32 J;  4DV6 J;  4JI2 J;  2F4V J;  4AQY J;  4DV3 J;  3J81 U;  4KYZ A;  1IBM J;  4DV0 J;  4JI7 J;  2MEW A;  4RJV A;  4B3M J;  2UXB J; 
#chains in the Genus database with same CATH topology
 3O5T B;  3CVK A;  4WXO A;  2HZA A;  3PZP A;  5KG2 A;  3KLF A;  3A1Y G;  1HNX J;  3MR6 A;  3G6E S;  3J7Z 5;  4F50 A;  3NP5 A;  4HH0 A;  4I68 A;  4DU7 A;  2IMW P;  3OLA A;  1JJH A;  2EFO A;  3SSQ A;  4V19 J;  1QVG R;  1UL3 A;  1RLD A;  5DLG A;  1TMM A;  1CSJ A;  2VH7 A;  1GT8 A;  1C0U A;  1CJK B;  1SC3 B;  5ETN A;  3JTO A;  4H4M A;  4DX7 A;  3PX6 A;  2C2R A;  4DPU A;  4CLK A;  2J6T A;  3SXL A;  1JQG A;  4OYX A;  4IOB A;  2EPI A;  5CCM A;  2XEX A;  4DV1 J;  3MDF A;  2DNL A;  4ENO A;  1T9V A;  5HVG A;  1X4H A;  2XMJ A;  1T05 B;  4TNO A;  4USW A;  3E01 B;  1LW2 A;  2MQN A;  3U27 A;  5HQM A;  3H4B A;  3MAH A;  1MU2 B;  3MM6 B;  5K8P A;  3L9Z A;  1HBO B;  2AP6 A;  4F4W A;  1S57 A;  3D5M A;  1IBL F;  4X4N A;  2IHR 1;  3U7J A;  2YX1 A;  1WG5 A;  4A8X A;  1YLX A;  4ZIV A;  2Y9H A;  3H5Y A;  3ZNJ 1;  3T6J A;  4NLT A;  3OSN A;  1S1W B;  3HHK A;  3BBB A;  4F4K A;  1YX2 A;  3ZZR A;  2Z57 B;  4C97 A;  3CJT A;  4M5J A;  4KV8 A;  1HWU A;  3EUN A;  4H4O B;  3QGH A;  3IWN C;  4J9O A;  2YWK A;  5IT0 A;  2GQ2 A;  1RI7 A;  1H74 A;  3C16 B;  3OL9 A;  2QG9 B;  3POT A;  2F40 A;  2OHD A;  2RQM A;  5ETM A;  1H98 A;  1NND A;  2LFV A;  3IMQ J;  2B4P A;  4UST A;  2V6A A;  4ZVU B;  2MSS A;  1WC3 A;  3IG1 A;  3ZZZ A;  1RTH A;  2LU1 A;  1WC4 A;  5C24 B;  3H4D A;  2IA6 A;  4B3R F;  3D67 A;  2BRL A;  3FRZ A;  1JWW A;  2LA4 A;  2A2C A;  4LF4 J;  2Z8Q A;  2DXD A;  2BEF A;  5F9L A;  1N5Y A;  4QWD A;  5KFL A;  4DUZ J;  2J9E A;  3TW0 A;  2E1C A;  2HQD A;  4KH0 B;  2G9O A;  1S6P A;  4L3N A;  3I4P A;  4HTJ A;  4JI2 F;  4RW6 A;  1SH3 A;  2C22 A;  4J9Q A;  2DR9 A;  5D77 A;  1YJT A;  4MK9 A;  2VKR A;  3P96 A;  3PAC A;  3I0S B;  4NE9 C;  2W25 A;  3A8E A;  4DZD A;  4WFN Q;  3GFX A;  3RTV A;  1YZ6 A;  3UCU P;  1DRZ A;  4DXL A;  5CHC B;  4DR2 J;  3SQG A;  4LF6 J;  1O0P A;  1LOU A;  3MEG A;  1VQM S;  4AT1 B;  1IWA A;  3K5O A;  1FRX A;  3PYG A;  4KBI A;  5KFT A;  3WQP A;  1D8Z A;  1P9Y A;  3CJ5 A;  4DX8 H;  2CJQ A;  5EWE A;  1VC5 A;  2FJX A;  4KY3 A;  4ED2 A;  3QIP A;  3GU0 A;  4CO2 A;  3LTO A;  4ZLL A;  3KLF B;  3G2X A;  1Z2Z A;  4GVB B;  3T9N A;  1TL5 A;  4DMZ A;  2QLB B;  5AE2 A;  4EBC A;  1R0A B;  1X5P A;  4LQ3 A;  4WFZ A;  4NLU A;  4ECQ A;  1SL1 A;  2KO1 A;  2UVU A;  2J9D E;  1R0C B;  2CPF A;  3BSN A;  1S6O A;  1CLF A;  4PKD B;  3QJL A;  1P27 B;  2GML A;  3KMQ A;  2ACY A;  2OD4 A;  5L9N A;  3RR8 A;  4Y00 A;  1LQ9 A;  3HCX A;  2O1P A;  4G1I A;  4A8O A;  4DPY A;  1TAU A;  3H2V E;  1FD2 A;  2F7V A;  3IR7 B;  3NL0 A;  2DH8 A;  1VIX A;  5KFQ A;  2B8Q A;  2MKK A;  4LF4 F;  5MAO A;  1N8R T;  3P5B P;  3K58 A;  1N5T A;  4CH7 A;  5K8M A;  2DTJ A;  1WC6 A;  1WEL A;  2W8L A;  5H9E J;  4WP8 A;  4PWD A;  4KKO A;  4K2X A;  1XTZ A;  3BZQ A;  4KYZ A;  4DV0 J;  3GYN A;  4PQA A;  4JI7 J;  1XQI A;  2HBR B;  1JLC A;  5EWG A;  3EGW B;  3F41 A;  4ITS A;  4PYA A;  4G1Q A;  4HH1 A;  1UFL A;  2RDJ A;  1TKX A;  3M9O B;  4L6V 3;  2HRT A;  3FBF A;  1YRX A;  2HHW A;  4J9L A;  3PV8 A;  1UKU A;  5F0W A;  1RHU B;  4MKV A;  2EXU A;  4ID8 A;  3DRS B;  1O5J A;  5K9F A;  6FDR A;  3AH6 A;  5KFS A;  3VTI A;  4ZLP A;  2MQQ A;  4F4X A;  4XIU A;  4LF8 J;  1RA6 A;  1S0M A;  2APO A;  3CPW R;  1LWC B;  2E9R X;  2ZC3 A;  2HQF A;  1KQK A;  2XWY A;  2Q6C A;  4DX6 A;  3RBZ A;  5C42 A;  3BO3 A;  3C3L A;  1YJR A;  1OQ6 A;  1HBO A;  1UFK A;  3ET6 B;  4NLY A;  4WIQ A;  2D3O R;  2WK4 A;  4A8Q A;  4JI4 J;  3W62 A;  2RF2 B;  5G0R B;  2YPZ A;  3FFI A;  1QUP A;  5HMZ A;  1UEU A;  4ZPD A;  2OPS B;  4ETZ A;  4C2M A;  3OHA A;  2HVI A;  2DEJ A;  2C3O A;  3NOC A;  3V4M A;  4LF6 F;  4X4T A;  1SJ1 A;  4OYW A;  5BYR A;  3AFG A;  1HI8 A;  1Q1K A;  2F3J A;  3NGS A;  4M5I A;  3FMW A;  3HX9 A;  1AZS B;  3MHY A;  4LR9 A;  5CH7 B;  2O01 C;  5KFG A;  3UDE A;  2XYP B;  1DTT A;  4DOZ A;  2IIH A;  1CPZ A;  1RAF B;  2MZR A;  2Z2L A;  1ICE B;  3N0V A;  4PAA A;  3TNV A;  5F8I A;  3IRW P;  3KK3 A;  3C16 A;  3Q8V A;  1W2B R;  3OJS A;  3CCS S;  3GIM A;  3VAH A;  4TVA B;  4P2F A;  2KG0 A;  1KLM A;  1F3V A;  3RBX A;  2OPR B;  3MWB A;  3HHL A;  5CQG A;  2LVW A;  3CD0 A;  2HNZ A;  4CTA B;  3GIL A;  1QSS A;  3DM2 A;  5LJ3 Y;  1FKO B;  2A10 A;  3UDL A;  1PG5 B;  4U7U K;  3L3C A;  3JSM B;  1NBE B;  1VJQ A;  1TKX B;  2DB1 A;  2DNO A;  2YVS A;  3M8S A;  4OI2 A;  2E5L F;  1EZZ B;  2HS4 A;  4NLP A;  5LMU F;  1C1B A;  1S4F A;  2F65 A;  5F3T A;  4BLG A;  4DLE A;  2B7C B;  4O3P A;  2RS2 A;  3IAM 9;  3F44 A;  4DPO A;  2KI2 A;  3GQC A;  2BM1 A;  1X4C A;  2JZ5 A;  3U1N A;  2ZOM A;  1U02 A;  5D78 A;  5GAE I;  3NBP B;  4N56 A;  4DFM A;  5F8J A;  5M2U A;  2BKP A;  3T3F A;  4N76 A;  3SQG B;  2LKZ A;  2QMX A;  1XER A;  3MEG B;  4DV3 F;  4OZ0 A;  4ECX A;  2BV3 A;  1K47 A;  3E8O A;  1WEX A;  3VGU A;  2VPX B;  4J9S A;  5HBM B;  3UDV A;  2QL5 B;  1UEK A;  1T7P A;  3GP9 A;  3UN5 A;  1FDN A;  3T5J A;  2QO3 A;  4NCA A;  1O51 A;  2HMI B;  5CCL A;  3TQE A;  4ECY A;  1VQN S;  1N36 J;  1UA1 A;  2AQ4 A;  1LWF A;  3NS7 B;  1FEE A;  2CQC A;  1HHQ A;  4IYQ A;  5D4O A;  5HI7 A;  3THV A;  2B56 A;  1XIQ A;  2QLJ B;  3O1L A;  4KQZ A;  3EMT A;  4U95 A;  4K4Y A;  1FNX H;  1EX8 A;  1F5B A;  3ZTQ A;  3MFH A;  1QM9 A;  2FHM A;  2AU0 A;  2XNQ A;  1KRP A;  1HW9 A;  2NXU A;  3FUY A;  4CLF A;  5T14 A;  1SIW B;  2M2B A;  3O2I A;  2HG4 A;  5KAK A;  3M32 A;  1EQM A;  5DDQ C;  5K14 B;  4EUV A;  2YTC A;  5RUB A;  2N82 B;  2GJF A;  3JSM A;  1SQE A;  2QC3 A;  1HA1 A;  2ZOF A;  2AD9 A;  1Q78 A;  4Y28 C;  2GMH A;  4CLL A;  1CC8 A;  1NEE A;  3D66 A;  3W64 A;  3ZC4 A;  3ZZT A;  4JOU A;  3IC1 A;  4LSL B;  5AJ3 F;  4NL5 A;  1B70 B;  4NLV A;  1Y9O A;  2BE2 A;  4IRK A;  3SYZ A;  4JI6 J;  2XS5 A;  1RT6 A;  2ZBP A;  2UXC F;  2CQ2 A;  3V6K A;  4F02 A;  3ETM A;  3M8Y A;  2XS7 A;  3MD1 A;  1N32 J;  5IV4 A;  2PFF B;  4EWT A;  1W2I A;  2D74 B;  3CCQ S;  5DM7 Q;  2F4V J;  1IJE B;  1W25 A;  2OO4 A;  2YKP A;  3DI6 B;  3O44 A;  4OJ3 A;  3DCA A;  1B7Y B;  3BSO A;  3MPD A;  3QT5 A;  1Q16 B;  3IP0 A;  3BKU A;  1K8A T;  3BGO P;  4DSL A;  1U1R A;  4UF4 A;  2F5G A;  2V67 A;  2VOP A;  1WJ9 A;  1ACM B;  2CPE A;  3D0G E;  3EYZ A;  4DV7 J;  1RIS A;  4ECR A;  1J5O A;  1H7X A;  2UUC J;  5IT9 U;  1OMS A;  1RU2 A;  1KVK A;  3EDQ B;  2AJF E;  3DYA B;  3R8Y A;  1IKW A;  2JC0 A;  1ZPV A;  1Y11 A;  2B3T B;  2BVZ A;  2GVD A;  4DUY F;  3L95 X;  2X1A A;  1HW8 A;  2XSJ A;  4FXV A;  1RT5 B;  1VQP S;  4C3M A;  1IQZ A;  5KFN A;  5HAT A;  3J80 Y;  3EPI A;  2VU5 A;  1S7H A;  2ZWP A;  3DDN A;  3QNW B;  4IDK B;  1RTI B;  2PEH A;  1RGV A;  4ZJL A;  4DL0 C;  2H3E B;  2IY5 B;  1KON A;  1N4L A;  5HRO B;  2W4C A;  2XM3 A;  3AXK A;  4YR0 A;  2W2N P;  3TUJ C;  5KG7 A;  4ILM A;  1RBO B;  1WD6 A;  2FJB B;  2DNP A;  2CQB A;  2IJF A;  2DIS A;  2NXN A;  1GMW D;  2BOP A;  4K4V A;  3DM2 B;  3WIV A;  4YY3 J;  2O5D A;  4NI2 A;  4C8N A;  2RT3 A;  4DN0 A;  2RML A;  1RT2 A;  1ZS6 A;  1NK4 A;  4NAS A;  2BM0 A;  4ZP8 A;  2DCU B;  1DHM A;  4OZ2 A;  1L5U A;  3HLU A;  4FPI A;  4QW8 A;  2MKC A;  5B7W A;  2OTL S;  1FRJ A;  3DKD A;  3GIK A;  4A8W A;  1Q53 A;  3EIC A;  4WF9 Q;  1O6X A;  2EVZ A;  1BMQ B;  3B4M A;  3MED A;  2L41 A;  1Q81 T;  4Q8E A;  1JLB B;  4B3M F;  1WEY A;  1UVM A;  1K0V A;  2Q1L A;  1S6P B;  2G2O A;  2HQI A;  3L09 A;  4RBV A;  2MXY A;  2WBM A;  2KFY A;  4HT7 A;  2F8M A;  2GMJ A;  3NY0 A;  4XK8 C;  3SFG A;  2KZZ A;  3J81 j;  5K20 B;  4J9N A;  2ZJP Q;  1KN6 A;  1VBX A;  2N3L A;  4YR3 A;  4YB1 P;  1BWE A;  3HJF A;  1ELO A;  2VC0 A;  5J2P B;  1PIL A;  2J8S A;  2ILZ A;  4CWB A;  2N7C A;  4KGX B;  2BE2 B;  2FYX A;  1CUL B;  1U1N A;  1HQU A;  1D1U A;  3UE2 A;  3WIU A;  2C42 A;  1FJC A;  1FJ7 A;  2VD3 A;  2FLO A;  2V68 A;  4U67 Q;  3F73 A;  2DNY A;  1M5V C;  2ZH6 A;  4X66 J;  4KFB A;  2P6T A;  2NCK L;  4LRA A;  5K8O A;  5M2P A;  1HBM A;  1HHT P;  1ULR A;  5CZX A;  3RU0 A;  4NXM J;  2CDQ A;  1NAQ A;  2U1A A;  3M32 B;  4KGV B;  4EK2 A;  2BDP A;  5KG5 A;  5J2N A;  3RAX A;  3KNA A;  3SIP B;  3TUI C;  4YY3 F;  1NKE A;  2ZD1 B;  3WHI A;  5IWA J;  3IM9 A;  4F7V A;  2R7R A;  5L46 A;  2XYG B;  4PYD A;  2CPI A;  1F6T A;  3OD2 A;  1YQH A;  4GKK J;  1R8P A;  3MMA B;  4USM A;  2BQU A;  5KFV A;  2DPJ A;  2HGL A;  1RT6 B;  3TR5 A;  2QYC A;  5C2C A;  2NZ4 A;  1JLB A;  2JWN A;  2W2M P;  3JAM Y;  2EWH A;  2JH3 A;  3K7R A;  2CPD A;  4EBE A;  1RT5 A;  3RW6 A;  3R27 A;  4M5D B;  5L39 A;  5M2R A;  3GJQ B;  4LFB F;  2CQ4 A;  1E6V A;  2WVE A;  4RR5 A;  3TRG A;  2PO4 A;  4UUW A;  4JP8 A;  4B9T A;  3BN7 A;  1ZZF A;  2BYC A;  3MZI A;  3AT1 B;  1NLK L;  4NI2 B;  4ELT A;  1NPR A;  4USV A;  5FLX U;  4U7U D;  3GMG A;  3I0R B;  5J2P A;  3T5K A;  4WII A;  2ZH2 A;  1X5S A;  1XR7 A;  2R42 A;  2FIU A;  1RT1 B;  3AQO A;  3DLG B;  3G8Q A;  4GO7 X;  3B54 A;  3DOM A;  3A8K A;  3Q24 A;  2FGO A;  2CG8 A;  2FB0 A;  3HKZ D;  5D0H A;  3MUV P;  3G87 A;  2HFZ A;  1FFG B;  1NXI A;  1ZET A;  1RT4 A;  3HJV A;  5J1N A;  2B4U A;  4B3T F;  3B6B A;  5KFI A;  1F3F A;  2M88 A;  3D1O A;  3Q86 A;  2C2M B;  5C42 B;  2FJV A;  4N41 A;  4FF1 A;  1ZPW X;  3ET6 A;  4C3K A;  4NZ7 A;  1U6B A;  3BQ2 A;  1B3T A;  1RWW B;  2EK6 A;  4J5O A;  5A8K B;  2XZW A;  3U02 A;  3OLB A;  1N32 F;  1JKH A;  3LOU A;  4N8N A;  4RWX A;  2WAQ D;  2VV5 A;  3QO9 B;  1RTZ A;  3EM1 A;  2X7I A;  1RE1 B;  2IDL A;  3RG6 A;  3E2E A;  3KJQ B;  3DLH A;  3N5B A;  3V6D B;  4LVO P;  3GJR B;  3GIR A;  4I56 A;  5A2Q U;  2WB1 D;  1XMQ F;  2ZKT A;  3N6L A;  1HAR A;  3FCH A;  4WFB Q;  2VJU A;  3EZU A;  4M94 A;  3RRH A;  3ZNU A;  4C48 A;  1T03 A;  3W9H A;  3Q8R B;  1RHR B;  2K2P A;  4JYA F;  4LRF A;  2UUC F;  1FXD A;  2WRM A;  2QA2 A;  3DU5 A;  2E9Z A;  1ZAW A;  5KFF A;  4X64 F;  2FLL A;  2XMV A;  4HTI A;  3LF0 A;  1RXO B;  4HHU A;  4HHJ A;  1KVJ A;  3CJQ A;  2ZJR Q;  1ZZN A;  3I0R A;  2DHS A;  4ZHR B;  1RAH B;  3MM9 A;  3VGT A;  1U4B A;  2J0X A;  5DZ7 A;  4TQR A;  4ED1 A;  3CJ8 A;  4NPO A;  4UOF A;  2R8G A;  2LYV A;  2F4V F;  2HBZ B;  1UAW A;  4DV5 J;  4NML A;  2H51 B;  2UU9 J;  1DQA A;  2VFS A;  3KLI B;  1YZ7 A;  4ID5 B;  4R8U A;  4FBU A;  1TV6 A;  4DI6 A;  3IWX A;  3KOA A;  4X4O A;  1WC1 A;  1WKL A;  1OWX A;  2NUH A;  3M2V A;  4MFB B;  5A0Y B;  1IBC B;  2KM8 C;  3CW2 C;  4HEA 9;  5D4L A;  3AB4 B;  4AUK A;  3UDC A;  1K9M T;  2KTQ A;  2XY7 A;  3ZTS A;  3QJP A;  3TEG A;  4DUZ F;  3DRX A;  2XO7 A;  2RUG A;  3DLE B;  2V4R A;  2YWE A;  4OLO A;  4DR1 J;  3FJ2 A;  4RW8 B;  1KS2 A;  3HKW A;  2AGO A;  3BKT A;  4G3I A;  4PWU A;  3DXS X;  4ERD A;  1F9E B;  2H48 B;  3V6D A;  2YX4 A;  1WAC A;  3NNA A;  4Q43 A;  3H5X A;  4OYZ A;  3CJ4 A;  4RW9 A;  2ZH7 A;  3H5U A;  4DUT A;  4ED0 A;  2BAN B;  1PAU B;  3ZXW A;  3QYY A;  3EE3 A;  4RBU A;  3C66 A;  1RZM A;  1F9H A;  5D3G B;  2R7T A;  3MM8 B;  2P5V A;  3DGP B;  5JJB A;  4R25 A;  1I5O B;  2FC8 A;  2HK3 A;  3EVM A;  2IM1 A;  1S97 A;  5CXT A;  1KKH A;  1GMW A;  3ONQ A;  4IFV A;  1UVK A;  4P2M A;  2KU7 A;  5K14 A;  4WE1 B;  3VR1 A;  2FPH X;  3PRD A;  4CLT A;  4M5N A;  2ZZM A;  3BN4 A;  1TQL A;  3P49 B;  3BYR A;  1RWV B;  5KFE A;  1SUQ B;  2YNH B;  2DR8 A;  2NSC A;  2OEL A;  2PE8 A;  3THT A;  4F3Q A;  3QPI A;  2KN4 A;  3FRY A;  3NEK A;  3TX8 A;  1XMO J;  5IWA F;  3W5X A;  1KTV A;  1S1X B;  2D9P A;  1LK5 A;  1NO8 A;  2ABY A;  4ZVS B;  5K5M A;  4LUB A;  7FD1 A;  1FX4 A;  3W7B A;  5LMU J;  3Q2T C;  5KFX A;  3ZZO A;  1KVI A;  2F8E X;  1ZTW A;  1EQ0 A;  3ITH B;  1WC0 A;  2XMU A;  9RUB A;  3PEH A;  3GCW P;  4ZHR A;  2LDI A;  3BKF A;  1XNQ J;  2P2C B;  1VC0 A;  2LA6 A;  3RUB L;  3PJX A;  2GW8 A;  4NA3 A;  4LMZ A;  2QTW A;  3HHL C;  3EDR B;  5E41 A;  4DV3 J;  4DSE A;  3PX4 A;  4P75 A;  2MKY A;  3HVW A;  4O3O A;  3I5B A;  5F8L A;  1VQ4 S;  1XNQ F;  1U24 A;  3SV3 A;  3HVR A;  1H0H B;  2HLT A;  4KGK A;  3PW0 A;  2DPI A;  2BJ1 A;  2XY6 A;  5J2Q B;  2DRA A;  1RHQ B;  2R7Q A;  2E29 A;  3TX0 A;  2RHS B;  1CJT A;  3EGV A;  2W4D A;  1Y3J A;  5JMN A;  1L3V A;  4IG3 B;  3BEG B;  3G71 S;  2HWI A;  4FNH A;  3K5P A;  4LFC F;  4RLE A;  1A7G E;  2WW4 A;  2WSF C;  3ISZ A;  2I1R A;  5LL6 d;  1JJ4 A;  4E98 A;  2CPY A;  1EET B;  1PJ6 A;  1RWP B;  2CQP A;  1VOM A;  5MLC V;  2RS8 A;  2XMA A;  3C6U B;  1S99 A;  3DOK B;  4K4S A;  1U6Z A;  2W2O P;  3VAJ A;  1X9M A;  2JLF A;  3GJT B;  4K4U A;  3HO1 A;  1FT8 A;  1U0H A;  2DNK A;  1V3R A;  4YN3 B;  3MUT P;  2E7X A;  4DBQ A;  2NXJ A;  3PJW A;  5F8M A;  1HNW F;  3DGV A;  4OLP A;  4QJV A;  3CDW A;  3OFH A;  2QA4 S;  1YTY A;  1VHF A;  4FPR A;  3DNC A;  5B0A A;  1N52 B;  1UWA A;  4CP5 A;  1KLN A;  3F56 A;  3NBP A;  1Q79 A;  2B9X A;  5EHH A;  3ILL A;  4B9L A;  2VQE J;  1YRT A;  3TUP A;  3M1V A;  7AT1 B;  3AD9 C;  3PKY A;  4IFV B;  2H4W B;  2ZM6 J;  1Q8I A;  5IC6 B;  5KT3 A;  2ZBQ A;  3G96 A;  2VQE F;  3RBE A;  2HRU A;  2RQ4 A;  1O8B A;  3DLB A;  5ETR A;  3NAH A;  3EZ5 A;  2HBY B;  3H25 A;  3TZY A;  1U1L A;  2M7S A;  1YBT A;  3BGU A;  4IH7 A;  3W5Y A;  3W2V B;  3CJ0 A;  3L7U A;  3MEE B;  1S1X A;  2G1D A;  2ZUG A;  2ZE2 A;  4ICL A;  4URG A;  2VJV A;  3GSI A;  2PT0 A;  3R1L A;  4RU2 A;  1VQ5 S;  2M4M A;  1X4E A;  1CUL A;  3BS9 A;  3NMA A;  4NZ6 A;  2K7K A;  3BSA A;  3OSP A;  2KFN A;  4BHQ A;  5J2M A;  2FLP A;  3WZ0 A;  2F9D A;  1VIO A;  1QE1 B;  3TWZ A;  5C24 A;  4EO6 A;  1HNV B;  2EG1 A;  2H54 B;  4OJG A;  4JI6 F;  2XSF A;  3MAA B;  2YNI B;  5D8H B;  1WKK A;  5DQI A;  3V6H A;  1JJ2 R;  1FK9 B;  2WW8 A;  4OL8 A;  1YKW A;  3CD7 A;  4LBI A;  3Q8Y A;  4M95 A;  1SJR A;  1S7I A;  2YWF A;  3CJR A;  4ZPC A;  5HJY A;  4KO0 A;  3MED B;  2JEG A;  2ALY B;  2XS2 A;  3BH6 B;  3R1H A;  4ED4 A;  1VMB A;  2JC1 A;  2YKA A;  5T41 A;  3J7A N;  3QFH A;  3QRR A;  1LFP A;  3OL7 A;  2P9E A;  3I32 A;  5BJR A;  3BSC A;  3MMA A;  1NJI T;  4X4Q A;  3Q2S C;  3NS5 A;  4WTY A;  4ZS6 A;  3PHT A;  2UXD F;  4J90 A;  1DJ0 A;  1U6F A;  3CIZ A;  3D1Q A;  2VB6 A;  3D28 A;  2RKI B;  3HP6 A;  4ELV A;  1MW7 A;  1X5O A;  2E7W A;  2W24 A;  2DGV A;  1KBR A;  2XG8 A;  4OZ1 A;  3LGH A;  1VK3 A;  2YPY A;  4EU0 A;  2NS1 B;  4WP9 A;  3OVB A;  2ZE2 B;  5ETS A;  4MYU A;  4Z37 A;  2EC0 A;  2PA8 D;  1S9E A;  1WKJ A;  1HBM B;  2D3Z A;  2XMT A;  2I0X A;  3IS9 A;  5LMN J;  1U0H B;  1FD8 A;  2FVP A;  1RWK B;  2VIC A;  3OTB A;  2GQC A;  2CZ9 A;  1JLG A;  3CO0 P;  2QFJ A;  3OVS A;  4X65 F;  3H5S A;  4I6Y A;  4WK3 A;  2Y1I A;  4HT5 A;  3U1L A;  1RDR A;  3LA0 A;  5KOW A;  2YNI A;  3MR2 A;  2GA7 A;  3GII A;  1SJ3 P;  2BE7 D;  2H9Z A;  4HYK A;  4TY8 A;  1F1B B;  2FJW A;  5HQL A;  1PYT A;  1SC1 B;  4DV6 J;  2YBV A;  1EP4 A;  4QCL A;  1X8D A;  4GVB A;  5B08 A;  5C7P A;  4Q8F A;  2AWZ A;  3DRP B;  1TTH B;  3QGI A;  3FCW A;  1ZA1 B;  4WYW A;  4RJV A;  3QJJ A;  3VHQ A;  3UD3 P;  4LBP A;  1RT7 A;  2CAJ A;  2K06 A;  3RRG A;  2W9B B;  4YR2 A;  2QZ8 A;  2WON A;  2JNJ A;  2J8A A;  1Y5L B;  2ZNZ A;  3K17 A;  4BWM A;  5KFA A;  1H73 A;  3GV5 B;  3G6V A;  1FNM A;  1Q82 T;  4YOE A;  5KFR A;  4O4G A;  3H90 A;  4J9R A;  1U49 A;  4GKJ J;  4URQ U;  2V4J B;  1OQ3 A;  4WJB A;  4ILR A;  3QZ8 A;  3MCS A;  3C6T A;  1TKD A;  4EO8 A;  3KHR A;  1VJW A;  1QD1 A;  1PIE A;  1B0P A;  3PG9 A;  5H1S V;  4B9N A;  1H2V Z;  1ZA2 B;  2VBW A;  5FDL A;  1ZM3 A;  3EXC X;  2VPY B;  1F2G A;  1SVD A;  2FJD B;  3IFE A;  3HFZ B;  3DLK A;  1GAO A;  1RT4 B;  3FGV A;  3NOG A;  5KT6 A;  3FFI B;  3Q23 A;  2Z58 B;  4OJH A;  1S6Q B;  2CWX A;  1GEH A;  4IO1 A;  3JAM U;  1F60 B;  1HBN B;  4KKO B;  2DNM A;  5SUH A;  5B0D A;  2Z0G A;  5AXN A;  2GJI A;  1W26 A;  2LQ9 A;  2OPQ B;  4X65 J;  5DDO C;  2ZHB A;  1NJZ A;  1N0V C;  3TVY A;  1F0X A;  3K8V A;  3NLC A;  2UUT A;  3NGU A;  3H40 A;  2VHG A;  2X1F A;  2ZOG A;  3HUL A;  4E2F B;  2E5I A;  4Q45 A;  1B99 A;  2HGM A;  2IRX A;  1T02 A;  4MAK A;  1KC8 T;  2KFZ A;  1TL7 A;  4CI0 B;  4LT6 A;  4WBF A;  5ETQ A;  2V94 A;  5I3Q A;  4RNM A;  4ZCM A;  5L1I A;  2VG7 B;  1PC5 A;  1M1K T;  2LEC A;  3PX0 A;  1M1H A;  4AYB D;  3D6M B;  1MN7 A;  4OZ3 A;  2OPR A;  4ZCL A;  3ZZY A;  4CTA A;  2JVO A;  2CQI A;  4UQT A;  4PG6 A;  1S9E B;  2GS8 A;  2QIF A;  2DHX A;  2VBX A;  4NWB A;  3EZO A;  4GC7 A;  1SKW A;  2M8D B;  3D3C J;  4IR9 A;  4A48 A;  3HT3 A;  2UZA A;  1RAO A;  3KJF B;  4ES3 A;  1SL2 A;  4ZPT R;  2LXI A;  1Z1Z A;  2IAJ B;  4RUC A;  4RUB A;  3PJ9 A;  4TY8 B;  2AIR B;  4P7T A;  5CD4 A;  4WE1 A;  2UU9 F;  4G1P A;  4CO4 A;  5KFO A;  1E6V B;  4C7Q A;  1A6L A;  2YNF A;  3FZB A;  3CDB A;  5A0Y A;  1WI6 A;  4OI6 A;  3HHL B;  2G0C A;  1P6T A;  4AL6 A;  3LWM A;  2R2T A;  4QPT A;  2H5E A;  1S1W A;  3H98 A;  2JEI A;  4USU A;  3JSB A;  3D4J A;  3H59 A;  2FJE B;  1UWB A;  5KFK A;  3Q8Q B;  4BCA A;  1LWE B;  2HZC A;  2VFR A;  4OHY A;  2V8V A;  3DOM B;  1NH8 A;  2R7U A;  3FDS A;  1QTN B;  3VGS A;  3LPY A;  1WDT A;  2X3G A;  3TA0 A;  9ATC B;  1IKY A;  1UZH A;  2B6A B;  1VQL S;  4KHR A;  4QR2 A;  1KQS R;  5KFP A;  2R2S A;  1LK7 A;  4OYA A;  4EZ9 A;  1C1C B;  4LFB J;  2GJ2 A;  2ZH3 A;  2ZH9 A;  3HVT B;  5FDL B;  2LCW A;  3HSJ A;  5HBM A;  1KSP A;  3OUY A;  2CNN B;  1BUX A;  2QSF A;  4NCG B;  1H2U X;  1VQY A;  1X0F A;  4RW6 B;  2VL1 A;  2PD1 A;  4UZC A;  5ETP A;  2CNK B;  1Q7Y T;  2Z2M A;  3CTR A;  1HPZ A;  2DIV A;  1KOO A;  2V8P A;  2R9L A;  2L48 A;  2FVR A;  3RYL A;  2B7B B;  3QAT A;  1U26 A;  4CLW A;  4XPC A;  3HSZ A;  1VLO A;  2GAH C;  5HK4 A;  1LV5 A;  4ALZ A;  4UW2 A;  4ZDN A;  4JI2 J;  1TFY A;  2QV6 A;  4V19 X;  4U96 A;  3OJU A;  5DG7 A;  1S48 A;  3T5H A;  2MEW A;  1VQK S;  1VQS A;  3P5T L;  2R2U A;  4C8L A;  4Q0B B;  1YBU A;  1SIZ A;  4MKB A;  2PGC A;  1XC9 A;  4TU8 A;  1BQM A;  3HM9 A;  3MMB A;  3SFU A;  2NXC A;  3HFV A;  2XLI A;  4I6W A;  4NRU A;  1YJV A;  2CNO B;  4YFU A;  2ZZT A;  6AT1 B;  4ECT A;  4BC7 A;  4FS1 A;  1IVZ A;  2KDO A;  4P2S A;  4D3H A;  1UJ4 A;  1MRO A;  1VI7 A;  2ADC A;  1OY6 A;  3QGP A;  4CNZ A;  3KLG A;  3IO1 A;  1HNZ F;  1N33 J;  3DRY A;  4O44 B;  2Z4P A;  3TJ9 A;  1KHV A;  1NK6 A;  4YP3 A;  3PO5 A;  5F0U A;  1TUV A;  2OEM A;  1C0T B;  2WSC C;  4PR6 A;  2HQG A;  3D6F B;  1RAC B;  2YNG A;  4LFA J;  4YDD B;  2MGZ B;  5LMN F;  4CLZ A;  2ZBC A;  3MM7 A;  3M8Q B;  3P6Y C;  3R7N B;  1APS A;  1RTI A;  4M5K A;  3ENA A;  2GV1 A;  2B0G A;  4M5H A;  3PO4 A;  3VCD A;  4FXW A;  3QWP A;  3I9V 9;  3WX8 A;  2GIF A;  1RCX B;  1FHT A;  2ZUA A;  5JUM A;  4I2P B;  1S1U A;  4WU2 A;  2KVQ E;  2MQP A;  4UOG A;  3GWC A;  4USI A;  2BBE A;  2IM0 A;  2YWH A;  4Y6I A;  4QYR A;  3RAQ A;  2ATL A;  2UUA J;  3B4D A;  4C8Y A;  3TAR A;  3MTK A;  4I7F A;  1YG0 A;  3DRS A;  3W5Z A;  1SQG A;  2KYX A;  4TQS A;  5DZ6 A;  4F4Z A;  3CD6 S;  2PI5 A;  3DLJ A;  2BE9 B;  5IM0 A;  1NDC A;  5DM6 Q;  1TL1 A;  1Y5N B;  3A12 A;  1WG1 A;  3G8S A;  4JI0 J;  1P1T A;  2MQO A;  2HNY B;  3K59 A;  2RQC A;  4FVM A;  3W66 A;  1C2P A;  4A4J A;  4LF9 F;  3K5N A;  1CJU A;  4ZJQ A;  1ZM2 A;  3OVA A;  2HWH A;  2J0Q D;  2EEY A;  3IR5 B;  4OV6 A;  3P8B B;  4JB8 B;  3FVY A;  3GG1 A;  2VZ9 A;  1JIH A;  1Q7L B;  4ZVH A;  4LSZ B;  1IWG A;  2YKM A;  3G8T A;  2RRA A;  1FWP A;  1U1M A;  1UWB B;  3HZG A;  3VVT A;  2YNG B;  3AJ1 A;  3M8P B;  4B02 A;  3MGJ A;  3MEE A;  2R4F A;  5J1E B;  3UR0 A;  2CPJ A;  1FJG F;  4ICL B;  2M5Y A;  2IVM A;  5CAB A;  3LQV A;  3FEY B;  1JLQ A;  4RO0 A;  4B9S A;  1S12 A;  4PZV A;  4P9S A;  2AX0 A;  1R6Y A;  2RDI A;  2ROP A;  4YB7 A;  1BQM B;  4ZVF A;  4CYU B;  5CA5 A;  5CAA A;  4A8M P;  3RB0 A;  1XMO F;  2D1C A;  2J6S A;  1KP6 A;  2HHU A;  2DBB A;  3H2L A;  3V81 B;  1SV5 B;  4C9D A;  1JK9 B;  2IM3 A;  1RYS A;  1K44 A;  4DV4 J;  2HIY A;  3ZTR A;  4ZLJ A;  2YH1 A;  1PGZ A;  4PWD B;  4FYD A;  1XMQ J;  1S77 D;  2MLX A;  2PC6 A;  1Q0N A;  5HLF A;  4DV5 F;  3NAI A;  4L73 A;  1IR0 A;  2R7V A;  3QWU A;  3TUZ C;  2MGZ A;  1GQE A;  4TU7 A;  3G4S S;  3MM7 B;  1TL1 B;  1S10 A;  2A3J A;  1SPB P;  2N4C A;  3IGV A;  2FVQ A;  2ZVS A;  3GFY A;  1WF2 A;  4JBC A;  2NSB A;  4IKA A;  4DQR A;  4MMO A;  4DR5 F;  3GZ7 A;  3HF5 A;  3N4W A;  3KHG A;  2OMO A;  1BC6 A;  4WYL A;  4ZP9 A;  2GFF A;  2GIR A;  3OT9 A;  1S49 A;  2GHV C;  2CNL B;  4GMK A;  4PEO A;  5AT1 B;  1S1U B;  2C3M A;  4JV0 A;  4FN5 A;  4F0M A;  2QL9 B;  2ZH8 A;  2HRY A;  3AD7 C;  1IKX B;  2L3M A;  4DZ6 A;  1K1Q A;  3ILI A;  4DR1 F;  4O3S A;  3BPD A;  3UNY A;  4X4V A;  4ANC A;  7FDR A;  3LAL A;  2DXE A;  4AQY J;  3UCZ P;  3TP2 A;  1CEZ A;  1UA0 A;  5BYS A;  4F3O A;  4P2X A;  2YWW A;  2J7W A;  1NRK A;  1N0U A;  2CJX B;  4M5L A;  3PR4 A;  2A18 A;  5IQQ A;  4DPW A;  4Z2X A;  1H72 C;  2LMI A;  4WWS A;  2AW0 A;  2ZD1 A;  3SCL E;  4QIG A;  4OMF G;  5GAH U;  3OW2 R;  2UVV A;  4KGM A;  4IQM A;  2XMK A;  1PC4 A;  3M30 A;  5AXL A;  3IN5 A;  1MMD A;  4JV1 A;  5IT9 Y;  1Y10 A;  1J27 A;  2UUB J;  1OY9 A;  4CZC A;  1UET A;  4GC6 A;  4JV5 F;  3FEX B;  1RAG B;  2FHJ A;  4CQ1 A;  1U8S A;  4D3G A;  3AXM A;  3PW5 A;  3F0N A;  1ZM4 A;  2HPU A;  4UOH A;  4Y2K A;  1DZ5 A;  3C14 B;  4UY8 5;  1FVQ A;  4ZN3 A;  3H2U B;  3UN3 A;  3BDE A;  5L1K A;  4LR8 A;  2P8I A;  1NHU A;  1D0E A;  3DOL A;  3NGK A;  2GIQ A;  2NLW A;  1KDN A;  1YSJ A;  2W9A A;  2YKM B;  3TJA A;  5E3C A;  4DV2 F;  1AW0 A;  3KNG A;  3T9Z A;  1RAA B;  4KAI A;  1TFW A;  2KRR A;  4GO5 X;  2FY1 A;  5ETV A;  2FVC A;  1H7W A;  3QSI A;  1RT1 A;  3DLG A;  4WKY A;  1TK8 A;  4OZ5 A;  4UY8 T;  2OFG X;  5KT4 A;  4PXC A;  4I67 A;  2ACM A;  3A8I A;  1R27 B;  4MIB A;  2B4O A;  2DXF A;  1IKX A;  4E0D A;  2KT3 A;  3GCX P;  5JVG Q;  1LXN A;  1X4B A;  3CJK A;  1IN0 A;  3AQP A;  4J91 A;  4HDH A;  3OTC A;  4NEZ A;  1QJH A;  4X4R A;  3HHL D;  4K4W A;  3HHE A;  1VRU A;  2QFI A;  2POK A;  5LM7 E;  2Y0B B;  1UW9 A;  1WSR A;  4DR6 J;  3M7V A;  2ZDP A;  3L7P A;  1AB8 A;  3NCQ A;  2L9N A;  4NLS A;  3CXC R;  3QRQ A;  3QAU A;  4LF2 A;  4DR7 J;  4AFF A;  2QJ3 A;  1HBN A;  2Q43 A;  4CO0 A;  1NSQ A;  1OPI A;  3BGF A;  4YEA A;  1NKC A;  1T0T V;  2JJ4 D;  5B0E A;  3Q22 A;  2M52 A;  2W2P P;  3ZZP A;  3EJM A;  4UQG A;  4DSJ A;  2QL7 B;  2LXF A;  1NU4 A;  1UEV A;  3MPY A;  1WOR A;  1Q8K A;  2GX8 A;  2HAF A;  4K59 A;  3QIP B;  3JB9 k;  1KOH A;  1RSC A;  2ZIT A;  3DLE A;  4KGZ B;  3AJD A;  2EI5 A;  3WDO A;  4JV5 J;  2FTR A;  4V1A k;  5D0E A;  2MB0 B;  3BM7 A;  4DU8 A;  3FEZ A;  3A3O B;  1X4G A;  3TA2 A;  3UN2 A;  2UVW A;  3V5R A;  3CCM S;  3GE9 A;  4O4R A;  2FVS A;  1HMV B;  2KHD A;  2CJB A;  3D6H B;  2DCL A;  3TEH B;  4JI5 J;  3B82 A;  4NLW A;  4DSK A;  1JLG B;  4ILL A;  4YQW A;  4KE5 A;  2N3O A;  2BA9 A;  3E51 A;  3ENW A;  1RHK B;  1J5O B;  1EAR A;  1M0S A;  3T41 A;  3BO4 A;  1YIT S;  1GTH A;  2AF6 A;  4PPZ A;  5HLF B;  2FQQ B;  1C1C A;  4L3K A;  2V2V A;  3O8W A;  4PAB A;  1AFI A;  2VOD A;  2CFX A;  1BE4 A;  2JL9 A;  2A2D A;  5A8R B;  5U47 A;  3K5L A;  2VG5 B;  5HMW A;  2R7X A;  4ZVO B;  3RBD A;  3I31 A;  1F9F A;  2V2K A;  2Y1J A;  3ETO A;  1G2E A;  3DI6 A;  4PUO B;  3TYT A;  3LAK A;  4IDK A;  1VQ6 S;  1NDP A;  2BW2 A;  1CBK A;  3SDE A;  4KT0 C;  3D6T B;  2CPX A;  1HR0 J;  3I82 A;  2FC9 A;  3MPU B;  2VOO A;  5HAO A;  1U2F A;  3JYT A;  2AT1 B;  2HFO A;  2LQ5 A;  1R43 A;  2QLW A;  4MIW A;  3TZX A;  1S6U A;  1H3D A;  2EFV A;  1S0O A;  2E1M C;  3R6G B;  3DC2 A;  1B64 A;  5IV3 A;  2G2Z A;  1IKY B;  5E5N A;  4ZVT B;  2QX0 A;  5I4M A;  1FKA F;  3OXG A;  3J81 U;  3W3S A;  2IYI A;  1RWO B;  2NUU G;  2XZT B;  4R0E A;  2HVD A;  4J9V A;  4LRB A;  4F0H A;  3J7Y I;  3I6P A;  5G0R A;  3DMJ B;  3K8W A;  1BWV A;  3MR5 A;  1WWH A;  1TMJ A;  5I42 B;  1FTR A;  1SUQ A;  1RYR A;  4C8Z A;  2H5I B;  4CLS A;  4F8R A;  4ZCK A;  1C0T A;  4P6Q A;  4QIF A;  1UMJ A;  5AJ3 J;  4XPE A;  2O67 A;  1IR2 A;  5HMY A;  2GAG C;  3R3T A;  3KK2 B;  2B8P A;  4AQY F;  3BV8 A;  4OI0 A;  1Q8L A;  3N5F A;  1REV A;  1B0T A;  1YI2 S;  2RB7 A;  2VPW B;  5H9F J;  3MFI A;  4WKR A;  4USJ C;  1UPP A;  1NSP A;  3DRR A;  4ZVP B;  1CJV A;  2GVZ B;  2RU3 A;  1JXL A;  4X4P A;  2MLZ A;  1T9W A;  4J9K A;  5HP1 A;  5H9E K;  2WVD A;  2V5H G;  1GXU A;  1TVR B;  4QU6 A;  4QU7 A;  5EWF A;  1AXQ A;  1FWL A;  3FSI A;  4ED3 A;  4K7Q A;  1RAD B;  4UOC A;  4EBD A;  3NNH A;  4IH5 A;  2MY7 A;  4WFY A;  1X7V A;  3CUN A;  5J2Q A;  3KFW X;  1L3U A;  1FXL A;  1WC5 A;  3UNG C;  1X0P A;  2U2F A;  3QT6 A;  4TY9 A;  3PDN A;  1FE0 A;  1N36 F;  4NZ0 A;  1VBY A;  5J2N B;  1HLW A;  5ADZ A;  2CRL A;  3RRK A;  1SCJ B;  2W7O A;  2IRY A;  3ENQ A;  2XTJ P;  2Y0S D;  2VFV A;  3M2U A;  1F5A A;  1FES A;  2HKE A;  3C6U A;  2ROG A;  3KUE A;  5KFY A;  4LF7 F;  3MD3 A;  1VRQ C;  3BQ0 A;  2MJN A;  1QVF R;  3ILJ A;  1HQE A;  2FHK A;  3FBB A;  2QYG A;  3L4B C;  3P4U B;  1T95 A;  3QT7 A;  4XDC A;  4CDI A;  2JRS A;  5I42 A;  1EKS A;  3NCR A;  2HVH A;  1AUD A;  2OEK A;  2CAD A;  3QBC A;  4ED5 A;  1RLC L;  1WOS A;  1MG7 A;  2DIT A;  2HHP A;  2IM2 A;  1URR A;  3HT0 A;  4NA2 A;  3CUL A;  4DR6 F;  4QPX A;  5A6W A;  1RQ0 A;  3PRB A;  1EKR A;  2HVZ A;  2M9K A;  5E7O B;  1S9F A;  4DG1 A;  2V2Q A;  3QQC D;  1TVR A;  4OFZ A;  5DS7 A;  2NR0 A;  4OYO A;  4XTT A;  4NCG A;  5GMK a;  2AEF A;  1QTM A;  4P73 A;  5IM0 B;  2PI4 A;  5A8K A;  2ZKU A;  4C3L A;  5GAD U;  1FXR A;  2Z2Y B;  3Q8S B;  2EC2 A;  1UFW A;  3GSD A;  1I1G A;  3FBE A;  3Q8U A;  1CQN A;  2CZ4 A;  3PIO Q;  2I5J A;  1FRH A;  5GAH I;  3KHH A;  1FER A;  5G4D A;  3CGI A;  4ECU A;  4K0K J;  3DMJ A;  3BJY A;  4RW7 A;  3K0J A;  5I3U B;  1RT3 A;  4B3S J;  5LT5 A;  1PO6 A;  3G82 B;  5ETK A;  4ZCI A;  1QE1 A;  1V6H A;  1YHQ S;  2AJQ A;  3M8R A;  3T1A A;  8ATC B;  4K0K F;  4ZVR B;  2R3V A;  2ZH1 A;  2F9J A;  3KYL A;  2CQG A;  1NCL A;  5ETL A;  4OJ1 A;  3O3L A;  1TU0 B;  1KTQ A;  1VBK A;  3HI9 A;  2Q3P A;  2Z2Z A;  4JV2 A;  5FII A;  4CYU A;  4JI4 F;  4NRT A;  1CQM A;  3DHW C;  3DRR B;  4A8K A;  2LLZ A;  4HAC A;  4AE5 A;  3GV8 B;  2GGP A;  3LGM A;  1HIY A;  4O44 A;  2UXD J;  3M8W A;  3V4I A;  2FGC A;  4ZVG A;  3DYA A;  3LAN A;  2KG1 A;  5T7L A;  1JNR B;  2KXF A;  3MM9 B;  2J6U A;  1MLA A;  2C2K B;  4YDX A;  4RL1 A;  3T1H J;  1FF2 A;  4JI7 F;  2BOA A;  4IFY B;  3KLH A;  1JLA B;  3QT8 A;  2BJ9 A;  2C3Y A;  3OR1 B;  4NOH A;  5E3A A;  3ZO7 A;  1RBA A;  2CKW A;  2YKN B;  2B9E A;  2BAB A;  5B0C A;  1B4S A;  1MWY A;  1V9O A;  4QQB A;  3ZZU A;  4A46 A;  1DQ9 A;  3MR7 A;  1CS4 A;  2B5J B;  2MQM A;  1T03 B;  1IBK F;  4NXN F;  4ZPA A;  5KFU A;  1FJE B;  2RKI A;  2MTL A;  2ZJQ Q;  2RUS A;  4O23 A;  1CJV B;  2GVZ A;  3GJS B;  4PPD A;  5SZT A;  3N6M A;  2AHO B;  4J37 A;  4WP3 A;  2RNE A;  2E7V A;  1RTJ A;  4H4M B;  5KFB A;  2ROE A;  4I7F B;  2GQQ A;  2BUN A;  5KT7 A;  1UVN A;  1RT2 B;  2OPP B;  4RNN A;  2DGU A;  4DCJ B;  3GR1 A;  4PCQ A;  1SB6 A;  2W7P A;  5AE3 A;  3MUR P;  4KHP F;  4DV0 F;  1TUG B;  5F8H A;  3PVX A;  1DLO B;  5HO4 A;  3UD5 A;  1MWZ A;  4FBT A;  1VHI A;  1S9G A;  1N56 A;  1V5I B;  2D3U A;  5GAG I;  1BGX T;  3MMC B;  4OZN A;  1N5S A;  5D4N A;  1DFD A;  4DF8 A;  1QAJ A;  4RNH A;  3UW1 A;  1T9Y A;  3RZA A;  3GG0 A;  3SMZ A;  1RWN B;  2PN6 A;  1YJU A;  4OIX A;  1EP4 B;  1K1S A;  3PFE A;  3FNN A;  1NSK L;  1Z2L A;  1D3W A;  4ED6 A;  1NH7 A;  2HS0 A;  1Q95 G;  1BHN A;  1I51 B;  3AAW B;  3D3B J;  1R89 A;  2COL A;  5I3U A;  3HFK A;  1QY7 A;  4Y65 A;  2I5J B;  2WSE C;  4ES2 A;  4QYZ K;  4B3O A;  2CYY A;  5LJ5 Y;  4H4K C;  4L74 A;  4ECZ A;  4USK A;  4TLR A;  2QA4 G;  2MPU A;  1PBA A;  4CO3 A;  1SJ4 P;  2Z56 B;  2LQ8 A;  3R9L A;  2BAN A;  1VQ7 S;  3V6J A;  2E66 A;  3ADA C;  4HDG A;  1AT1 B;  1GMV A;  3AOD A;  4RUA A;  1FNO A;  1BQN B;  1Q86 T;  3KDO A;  2VF3 A;  1N5Y B;  1AUS L;  4I6A A;  1I94 J;  4FYV B;  3UVJ A;  3TQ1 A;  4DV7 F;  1IXK A;  2NPF A;  3OTO J;  1MU2 A;  3MM6 A;  5CZV A;  2IVF B;  2DO4 A;  4X62 F;  3BGL A;  3CED A;  3UO0 A;  3ZTP A;  2MHN A;  3MR3 A;  1J2V A;  3CMA S;  3TAM B;  1SJF A;  2E5J A;  2AYB A;  2UXC J;  2OTJ S;  5DGB A;  4ZPV R;  1NHK L;  4P74 A;  1PBU A;  2BMB A;  4DFJ A;  3CCE S;  1U2R A;  2FHO B;  4N8O A;  5D0R A;  2R7O A;  3THP A;  2M8H A;  3OL8 A;  4CCH A;  4BDP A;  2DH7 A;  1UP1 A;  3GR0 A;  4DR3 F;  4CO5 A;  3M8Z A;  5KG6 A;  2QMU B;  4NLD A;  1RA7 A;  2FY8 A;  1TL4 A;  3BF4 A;  4YB5 A;  5IZH A;  2DR5 A;  2HW3 A;  4ZP6 A;  1TL7 B;  2DNZ A;  4ECV A;  4ECS A;  1TL3 B;  1HQU B;  2GZO A;  2H5J B;  4LF9 J;  1S76 D;  1EET A;  4PUO A;  1S1V B;  2CQ1 A;  2AEJ A;  2BKN A;  2B5J A;  4HVZ A;  3WX4 A;  5B0F A;  3RW7 A;  3M2R B;  1P1L A;  1J5E F;  1GMU A;  3FMB A;  3P3D A;  4XO0 A;  3R2D J;  2YXL A;  1Y00 A;  1JLE A;  4OQJ A;  1RWU A;  2J9D A;  5F41 A;  2BRK A;  1UPM B;  4PWW A;  3I96 A;  3KKF A;  5ETT A;  1CC7 A;  3PXG a;  5JXS A;  4OX9 J;  3PR5 B;  3LP2 A;  1RU1 A;  1S1T B;  4ER8 A;  4DSF A;  1U8W A;  3I0S A;  3G9C A;  4RZR A;  1ZAV A;  3LP1 A;  4NXM F;  2MMY A;  1LW0 B;  2ZBR A;  2BXJ A;  3BH7 B;  4CM2 A;  3C14 A;  3S1T A;  3GPA A;  4IRD A;  1RAB B;  2DGQ A;  1NK9 A;  2YWG A;  4OHX A;  1JKH B;  4U8V A;  3TVZ A;  2VQF F;  1HYS B;  4LF8 F;  2LEP A;  4M5D A;  2VIH A;  4UTG A;  2L9D A;  1X9S A;  4QIV A;  4OYP A;  1RHJ B;  4N7T A;  1HD0 A;  4OHW A;  1FX2 A;  1C4A A;  1Y3K A;  2XCP A;  1BXN A;  2JVR A;  3D7S B;  1SL0 A;  4MKA A;  5B0B A;  1VCT A;  3DDK A;  1LWE A;  1AYE A;  4RPF A;  5A8W A;  3PIP Q;  4JI0 F;  4C8O A;  4N47 A;  2MZS A;  2J7K A;  3T6B A;  1HWK A;  3R5D A;  4URS A;  3LGN A;  1DLO A;  1FKP A;  1GTE A;  4KH1 B;  1IJF B;  5L9X A;  4ZMM A;  3OTO F;  3KLE A;  2ASD A;  3NS6 A;  4JI1 J;  2JLG A;  1E6Y B;  3WBZ A;  2IDE A;  4M8L A;  1G4C A;  3PYF A;  4YHH F;  1R8C A;  4KHM A;  3OUY B;  2QEX S;  1FI4 A;  1IBL J;  2KZM A;  4CM0 A;  3OFE A;  1C4C A;  1PYS B;  4ZPW R;  2AJ4 A;  2MY8 A;  3LP2 B;  1S4E A;  1Z4U A;  2EFG A;  3TA1 A;  1S0V A;  3BRE A;  5H9F K;  2KVI A;  1JLC B;  4H54 A;  3TZW A;  4K50 A;  2LDY A;  3AOB A;  1N6Q B;  3C8Y A;  5HN0 A;  1HKA A;  4I2Q A;  3MEK A;  1FCA A;  2G0I A;  2FDN A;  2Y1R I;  2IBO A;  3RAM A;  5J2M B;  1HNZ J;  1HQE B;  4TU9 A;  4F2S A;  2N4D A;  2AV5 A;  4MT1 A;  2DGO A;  5CYJ A;  2HNZ B;  2JFK A;  3AHP A;  4ZK7 M;  2CJK A;  2R8J A;  1KFD A;  2NPI A;  3UWT A;  5B09 A;  2PMZ D;  4ZIW A;  1MRO B;  2K7J A;  4AL5 A;  4QWA A;  3VZH A;  3KLG B;  5GMD A;  3GB0 A;  4O4G B;  3SCJ E;  4HKQ A;  5FLX Y;  2V4J A;  2V9K A;  3C19 A;  4ZIT A;  3CCW A;  4KO0 B;  2IYG A;  1RK8 A;  2NYI A;  3QLH B;  2DRD A;  1HBU B;  2MHE A;  4CH0 S;  4EEY A;  1UJ5 A;  1I3O B;  3BR9 A;  1ARO P;  4DG1 B;  1I94 F;  1NJY A;  3T5L A;  3QRP A;  2W01 A;  3OHB A;  1R8A A;  1WG4 A;  3FQL A;  2C2E A;  3DRP A;  1YIJ S;  2K8G A;  1T9T A;  2IVY A;  2P9C A;  3H8Y A;  4FKY A;  3VAG A;  3FC9 A;  3VGV A;  5K8N A;  1HNI A;  3BGR B;  2LQJ A;  3OBI A;  3T1Y J;  3DFE A;  1N88 A;  2BW7 A;  1WUU A;  3W2W B;  1TL3 A;  1G1X A;  4EMD A;  1U1O A;  3NGT A;  4NX9 A;  1U47 A;  1FTC A;  3OTD A;  3Q8P B;  4KV8 B;  1PJ7 A;  2YX7 A;  1FKO A;  1RAI B;  3M4X A;  3AA8 A;  5KTQ A;  4Y34 A;  1PKU A;  2CA9 A;  1L3T A;  4ZA1 A;  2WOM B;  4RU9 A;  4RW9 B;  4EGL A;  1JXV A;  1VDH A;  3PCO B;  4TXS A;  3CCJ S;  2VG6 A;  1M90 T;  4L75 A;  3QID A;  3BBC A;  4OI1 A;  3KLE B;  4CLP A;  4P72 A;  2UV8 G;  2B9Y A;  1RAE B;  1SV5 A;  2IJR A;  4F4Y A;  2J5A A;  3CME S;  1NDK A;  1S6Q A;  3E01 A;  3KUH A;  3J7Y U;  2AGP A;  1HD1 A;  4QZV B;  2AX1 A;  1KQF B;  3VZI A;  2SXL A;  1U09 A;  3DLK B;  4I0W A;  4A8F A;  2DYA A;  3QLH A;  3VQT A;  3GLJ A;  1BD6 A;  3KJV B;  4DL3 A;  4H4O A;  1U25 A;  2V69 A;  4ZKA A;  4DL7 A;  2DD8 S;  1URN A;  1OS5 A;  4YME A;  1HWJ A;  2HHQ A;  3CF5 Q;  4P10 A;  2VC1 A;  1X9W A;  4B17 A;  3HZE A;  3N79 A;  2O66 A;  1R7I A;  2K1R B;  2YKO A;  2MKI A;  4LFC J;  1X31 C;  3BPS P;  1XMB A;  3DOK A;  3C6T B;  5HQ8 A;  2A0F B;  3EGZ A;  1GK8 A;  3JQM A;  2VFT A;  1M5H A;  3AJ2 A;  4ATN A;  5FJ4 A;  3IG1 B;  4DDF A;  1LW2 B;  1QLN A;  1KEK A;  3ZTO A;  4NMX A;  2KJW A;  3R5G A;  4RNF A;  4R5P A;  2AJ2 A;  2CG4 A;  1UJ6 A;  3IBF B;  1V5V A;  1HBU A;  1UZD A;  2F63 A;  1TEL A;  2BR0 A;  4DR5 J;  2I38 A;  2FZC B;  4B9U A;  1YJN S;  1NK7 A;  2XSJ B;  2DGT A;  4MJK A;  2E5L J;  5T7L B;  4NYP A;  5C5J A;  4DV1 F;  2EKY A;  2CXE A;  2JSX A;  2VDI A;  2YNF B;  4Z7C A;  1T3O A;  4BWJ A;  4FF3 A;  4YB6 A;  1PCA A;  3UQS A;  2ZWO A;  4W90 B;  2BKO A;  2HSE B;  3G86 A;  3JQJ A;  1D9A A;  2CPZ A;  4OYM A;  3NG8 A;  2AJ1 A;  1YRU A;  3E3X A;  4YHH J;  3JXO A;  2OAU A;  4CLY A;  4O0N A;  1YJ9 S;  2M70 A;  1VS3 A;  1W7W A;  2IA0 A;  3R6L B;  3ENV A;  2YQ1 A;  3OQ2 A;  1YDL A;  3AA9 A;  3SEO A;  2VBZ A;  2J0S D;  4X2B A;  3MMJ A;  4DHV A;  4NEY A;  2P9G A;  5IQ6 A;  1X4F A;  2D7S A;  5DDP C;  4KTQ A;  4O3Q A;  4LF5 F;  2WCX A;  2NRE A;  4I1T A;  3FBC A;  5LSO A;  2NZC A;  3CE8 A;  4LF1 A;  4PG7 A;  3OR2 A;  3CCT A;  2KT5 A;  1FDD A;  5KT2 A;  2V4Q A;  3LAM A;  4YS2 A;  2XC9 A;  3ULH A;  2GVD B;  4AXJ A;  1XEZ A;  2P6S A;  4NLX A;  2IC3 A;  2OJ3 A;  1LXJ A;  4DLG A;  1FFS B;  3M30 B;  1JB0 C;  1K73 T;  3BDP A;  2W1B A;  1VRU B;  2GHP A;  3M1V B;  3LH2 S;  4OZL A;  3OL6 A;  2W9C B;  1G7C B;  3BBF A;  2C28 A;  4DSI A;  4X84 A;  1XNR F;  4PQU B;  4DR3 J;  4JYA J;  4EYH B;  4C0B A;  1H2T Z;  3KJV A;  3W8P A;  3KLV A;  4KRW A;  5L1L A;  2FZK B;  2QMW A;  1HWI A;  3W2W A;  1R6V A;  4MK7 A;  2OSQ A;  3PTW A;  4PG4 A;  4BC9 A;  4IOA Q;  3NRB A;  4O3N A;  2RH3 A;  1AZS A;  4OI3 A;  4RBT A;  5E3P A;  1SH0 A;  4AD6 A;  3RB3 A;  3MEC A;  2MDA A;  1WF0 A;  2G13 A;  1WF1 A;  2IFX A;  1LKZ A;  3W61 A;  1S1V A;  2VG6 B;  4MYT A;  2BAC A;  2FHJ D;  3D0I E;  3OFG A;  4J9U E;  2GGP B;  4TYB A;  3PW2 A;  1VFJ A;  2MYF A;  3V4I B;  4QIE A;  2VA2 A;  3N28 A;  4Q44 A;  1OO0 B;  1NJX A;  2PMH A;  1RCO B;  3IS9 B;  5EUH A;  2HFV A;  1G3O A;  5KG4 A;  3M9M B;  4MKY A;  3HVT A;  3VF0 B;  1I6J A;  3SBM A;  2ZZN A;  2DNQ A;  2BQ3 A;  2N7Y A;  2MQ8 A;  4TN2 A;  2RJZ A;  1N48 A;  2OD6 A;  1UW4 A;  2J9C A;  2AYM A;  1KD1 T;  4Y0F A;  2QLX A;  2IJN A;  3MPV A;  4LF7 J;  3CCU S;  4A8Y A;  3I5A A;  3S7R A;  1DTT B;  2OUG A;  3R7B B;  4G1Q B;  1TK0 A;  2QN6 B;  1Y0H A;  2Y1L B;  2M0G B;  4P71 A;  5D15 A;  2PFD A;  2KJV A;  1SKR A;  1XBW A;  4NCB A;  5DRK A;  3PNI A;  3TAQ A;  4DPX A;  2R2R A;  2HHH J;  2D3O 1;  1QAY A;  4IRC A;  4L72 B;  2JOQ A;  1R8B A;  1C0U B;  1B7F A;  3NXZ A;  1AA1 B;  1L3S A;  3M8P A;  3A4T A;  2HEK A;  4DFK A;  1R0B G;  8RUC A;  5J1E A;  1NM2 A;  4DQP A;  3JYT B;  2YY3 A;  1K0T A;  2EBG A;  3N9U C;  3J7Z T;  3KK1 A;  1DQ8 A;  3OR2 B;  2R7W A;  4WFA Q;  2HLU A;  1WHV A;  2XI2 A;  4DCO B;  2EFP A;  5L1J A;  3QMQ A;  2YH0 A;  2DNH A;  3PYE A;  1WI8 A;  2R7S A;  1KHW A;  4LR7 A;  5HJX A;  4AL7 A;  1M5S A;  4C8K A;  1H38 A;  1R3N A;  2FJA B;  2PMW A;  4C98 A;  4H4K A;  4FYX B;  3TVK A;  2DIU A;  3CCR S;  4N5S A;  3M8Q A;  5KG1 A;  1ZM9 A;  2HUR A;  3AY0 A;  5HVH A;  2CQ3 A;  1IR1 A;  3IAS 9;  4QWE A;  1HYS A;  1LWF B;  5EGY A;  1N34 J;  2DY9 A;  3DXB A;  3VQS A;  3A8J A;  2XLJ A;  4W4M A;  3MCM A;  3VAL A;  4F04 B;  3RJM B;  3BYP A;  1FA0 A;  3IM8 A;  5HL7 Q;  5A2Q Y;  1REV B;  1GXT A;  3T1H F;  4B9M A;  1JLQ B;  3GYX B;  1S5Z A;  4DX5 A;  4GVL A;  4WCE Q;  2KM8 B;  4GKK F;  3TOQ A;  2EK1 A;  2DY1 A;  3GFZ A;  4C0H A;  4C0O C;  1NME B;  2BZ2 A;  2GCF A;  4K4T A;  3RB4 A;  4Q2M A;  2QE5 A;  3EVW A;  1VC6 A;  1QSL A;  2I2Y A;  3PKM A;  3D1H A;  8AT1 B;  2AEM A;  2NQP A;  5E2Q A;  1IQT A;  3TAM A;  1HNW J;  2XYH B;  3LP0 B;  4ZN1 A;  4XDD A;  3DN9 A;  2DR6 A;  4F2R A;  3M05 A;  5KOX A;  3KMS A;  2Q79 A;  1IUJ A;  2OSR A;  4L76 A;  4DQQ A;  4PQU A;  2MQL A;  3KLI A;  3NGR A;  2MZQ A;  1VK8 A;  1HWL A;  3M6X A;  1L3K A;  4LBH A;  5DET A;  4JI8 J;  2CUY A;  5KG3 A;  1RKJ A;  2HMI A;  2VKZ G;  4LSL A;  3HSD A;  2DEI A;  5DQH A;  4I4B A;  2E5H A;  5D0G A;  1D9D A;  4DWI A;  2WZ1 A;  4AXI A;  3OPK A;  3TJ8 A;  2FLN A;  2XNR A;  1Q4R A;  4FF2 A;  3K5M A;  1TZ0 A;  2QRR A;  4IO9 Q;  1T8E A;  2UXB F;  2DRB A;  2L08 A;  2RVJ A;  3IBW A;  2A6O A;  1RTD B;  5EX0 A;  1GH8 A;  4M63 A;  4X66 F;  5CYM A;  2O3D A;  2D9O A;  1F5C A;  4DPT A;  4HI1 A;  5DQG A;  2X51 A;  3MAQ A;  2V9W A;  3PFO A;  2MKH A;  2E1P A;  4EZ6 A;  2BJ8 A;  1T9U A;  2JFD A;  2DHG A;  1UTA A;  3PEJ A;  5LSR A;  1VLY A;  2VQF J;  5E3R A;  2F8H A;  2GO8 A;  3H7H B;  3EX7 B;  3FQK A;  3NWR A;  1D8Y A;  2VAS A;  5E3Q A;  3CDU A;  3VAK A;  4J9M A;  1DAR A;  4P52 A;  2ZC4 A;  1U0S A;  2DJW A;  4ID5 A;  1Q8B A;  4R8U B;  1LNQ A;  3X1L B;  5GME A;  3OV7 A;  4J7C A;  2DKO B;  2G0J A;  2VPZ B;  1XR5 A;  3NMR A;  4F4A A;  3KTQ A;  2HHT A;  3PHE A;  4FP9 A;  1CVJ A;  3K57 A;  3IRX B;  3K2Y A;  1LWX A;  3JTN A;  2RIL A;  3KG4 A;  2PDA A;  2H4Y B;  1HNI B;  1JXE A;  2FUG 9;  2Y3Y A;  3BGR A;  4DJB A;  4NYO A;  2JEJ A;  4X4S A;  2V8G A;  2KXN B;  4JI1 F;  4ZJO A;  4P7V A;  2QSW A;  3G82 A;  3W8G A;  2EKN A;  1NHV A;  1R0A A;  4F3M A;  2RU9 A;  5AE1 A;  2XHW A;  4HL9 A;  4ZVE A;  2AKW B;  4ECW A;  4FXD A;  4Q7A A;  2AZ1 A;  1EAY C;  3TO8 A;  3DOL B;  3OXF A;  3DDI A;  1H6K X;  4C11 A;  3G6X A;  2R8I A;  3CJ2 A;  3UFC X;  1DTQ B;  5KFJ A;  4KFB B;  1WDD A;  3MM8 A;  3D0H E;  3MOZ A;  4ELU A;  3CC2 S;  1LWC A;  1WNE A;  4HAC B;  2HHH F;  2VBY A;  3N6N A;  2X1G A;  3J80 U;  2XLK A;  2HQC A;  2PA3 A;  2WBR A;  4OI4 A;  2EFN A;  1T94 A;  1GFW B;  3CCV S;  5IT4 A;  1DUR A;  2HFU A;  3DLL Q;  4IR1 A;  3FKB A;  1VRT A;  1WHW A;  3VV2 B;  3M9N B;  4X62 J;  2PSZ A;  4OX6 A;  1OJ4 A;  2QT7 A;  4DEZ A;  4ZVQ B;  1OSC A;  2LXU A;  5A76 A;  1YVF A;  3MXH P;  1YK9 A;  2ZEJ A;  3A3P B;  1BY9 A;  1RWM B;  2KKH A;  2WVF A;  1U2C A;  4ZPB A;  2ZFH A;  4EFA C;  2MST A;  3SV4 A;  4RWW A;  1RKI A;  1FRI A;  3VAM A;  1CS4 B;  4KR0 B;  3KHL A;  1RP5 A;  2IBK A;  2OH2 A;  5KG0 A;  4K4Z A;  1WSV A;  1UCN A;  2VG5 A;  3GTY X;  1WTF A;  3KXD A;  3KG1 A;  4C4W A;  1RAJ A;  1TKZ B;  1T3N A;  3J7A 1;  1MMN A;  2KHC A;  2XMW A;  4QR1 A;  4F67 A;  2ERR A;  4B3R J;  1JMT A;  3IXQ A;  4A8S A;  2ILY A;  2C2O B;  2CPH A;  1REG X;  4K8R A;  4WK1 A;  5E0O A;  5HVF A;  2X1B A;  3HMJ G;  5GAD I;  3VVU A;  2AGQ A;  3ITH A;  1U45 A;  5KFD A;  1J5E J;  4DQS A;  1TR0 A;  3I55 S;  3CT9 A;  3KDN A;  4CO1 A;  2BQR A;  3A3N B;  2MKS A;  4A47 A;  5C25 B;  5L38 A;  2F4F A;  4X64 J;  4B08 A;  1IKV B;  4ED7 A;  3B8H A;  3I87 A;  3O6Q A;  3IWL A;  1DTQ A;  3T19 A;  1HR0 F;  2OPS A;  2DNG A;  2V2Z A;  2HFS A;  1VYA A;  1C1B B;  2C2Z B;  5HMX A;  3W65 A;  4DL4 A;  5EX3 A;  2V63 A;  3FK4 A;  3R5J B;  3H0P A;  4U9R A;  4W92 B;  2J7U A;  4DQI A;  3DU6 A;  1WHY A;  5EN1 A;  4KPY A;  5DJB A;  4EYI B;  1CJU B;  3IGN A;  3Q83 A;  3UR3 C;  1RWX B;  1CG2 A;  1QAX A;  1GX6 A;  2CWK A;  3ZFV A;  2LU2 A;  2XB2 D;  4KPC A;  4K5S A;  1NK5 A;  2VA3 A;  5CYM B;  1OYD A;  2XQC A;  1IBM F;  3GFH A;  3CC7 S;  2OGU A;  3JQK A;  1MML A;  2OPP A;  4OX7 A;  4RX6 A;  4C8M A;  4EI2 A;  2UP1 A;  4B3O B;  3KK2 A;  3BR8 A;  2WOM A;  3R7S B;  3I4H X;  4CIO A;  4DF4 A;  2JHE A;  1HI0 P;  1RTJ B;  1A0O B;  3QFW A;  1TP7 A;  4I2P A;  1Q5Y A;  2PII A;  4QR0 A;  2CZV C;  4OZJ A;  2HND A;  1JX4 A;  1D9F A;  1FRM A;  5J1P A;  1QDU B;  4I64 A;  3LWL A;  3GV7 B;  1FJG J;  4WU3 A;  4R0J A;  3C46 A;  1FK9 A;  2CJY B;  2HYI B;  3FCV A;  2ZHO A;  3V81 A;  1R31 A;  2C2D A;  5ETO A;  1S0N A;  3NCP A;  1T05 A;  3VWS A;  1U1Q A;  4U8Y A;  1SQF A;  3PW7 A;  1HI1 A;  2HNY A;  5C25 A;  1UVI A;  3MM5 B;  3WC0 A;  2M3D A;  2UUW A;  4X4U A;  3DHX A;  3RB6 A;  2EFQ A;  3OTE A;  1LEO A;  4JUZ A;  2ZH5 A;  5HSP A;  2VUG A;  5F8N A;  1ZYQ A;  4DR7 F;  3W2V A;  2BJD A;  4CT8 A;  3EVO A;  1WTB A;  5KFZ A;  4RNO A;  1VGY A;  4Y2A A;  4PXE A;  4FS2 A;  2GHW A;  2VDH A;  3CDE A;  3PRV A;  4LQ9 A;  5CYQ B;  2DNR A;  3R5C A;  2XI3 A;  3W9J A;  2CIM A;  2WB4 A;  4WFX A;  2HAI A;  2VON A;  4Q0B A;  3CWJ A;  2UUA F;  3PYD A;  5DG9 A;  1NPP A;  1IM6 A;  1JJC B;  3MCN A;  3Q89 A;  3UCG A;  1JLE B;  2MLY A;  2MZT A;  5LSL A;  4FYW B;  1RTH B;  3MCO A;  4CNY A;  2I6W A;  1OPZ A;  2XBP A;  3D9B A;  4LRD A;  1NPK A;  3KK1 B;  1SH2 A;  4PG5 A;  1TKT B;  1OIA A;  2JDJ A;  2BJ7 A;  2DH9 A;  1TV6 B;  2ZVI A;  1DBD A;  4LSN A;  3SSR A;  5E33 A;  1NUE A;  3M2V B;  1SXL A;  3A13 A;  4MFB A;  2JLE A;  4ZP7 A;  2WHO A;  4DV2 J;  1IKV A;  2ASJ A;  3IR6 B;  4IQX A;  4LIR A;  4NLQ A;  5F8G A;  3IA0 A;  2LEA A;  3KG0 A;  3AOA A;  1IKW B;  4MTP A;  2B9W A;  2CJ9 A;  4F26 A;  2XO6 A;  2RRB A;  3QZ7 A;  4J9P A;  4IOC Q;  2E9T A;  2GO9 A;  1Y7P A;  2WVB A;  4NYZ A;  4U6P A;  3NNC A;  2EW9 A;  1X4A A;  3TI0 A;  4RW8 A;  2UUB F;  1N5V A;  1FE4 A;  1DY3 A;  1TKZ A;  2GC8 A;  2RAQ A;  2D41 A;  2WON B;  4FNI A;  3S8S A;  4JI5 F;  2EBE A;  1NSA A;  4OHZ A;  2QA1 A;  4LRE A;  1QUV A;  4BBY A;  1IBM J;  4FVC A;  1XWL A;  4RW7 B;  4TKT A;  3M2R A;  3MUM P;  3V2U C;  2AYG A;  1F2H A;  1DAX A;  5A8W B;  4B3M J;  1ITP A;  2W7A A;  2HND B;  3I9Z A;  2KB2 A;  4PXD A;  1SI9 A;  3W60 A;  3EWG A;  4LVN P;  4CRJ A;  1FWK A;  2CDR B;  2L9W A;  3ISN C;  2BX6 A;  4KC5 A;  4Y2I A;  2K3K A;  5IOL A;  3W9I A;  4FZV A;  4FKX A;  4USH A;  5D3G A;  1ZBT A;  1M5O C;  4F25 A;  4B3S F;  1EHW A;  4CT9 A;  3CJK B;  2V8H A;  3FSY A;  2XCA A;  1MWQ A;  2KRB A;  3MM5 A;  4MK8 A;  4F36 A;  1FRK A;  2I8E A;  2ALZ A;  2B51 A;  5LOQ A;  1ROF A;  3R97 A;  3QGG A;  1TKT A;  2G1H A;  2OPQ A;  3NGD A;  4K2J A;  3C15 A;  1NZ8 A;  4N77 A;  1G6B A;  5GAG U;  1CJT B;  2DHH A;  3JTP A;  3S6E A;  3JSY A;  4CH1 A;  2HS3 A;  2OLW A;  5ITH A;  4DL6 A;  1OYE A;  2LP4 A;  3HXM A;  2CQD A;  2W4P A;  3CIM A;  5DG8 A;  2G4B A;  4RW4 B;  2XGP A;  4DV4 F;  4OHV A;  2V8D A;  5CYQ A;  2KXH A;  2HWT A;  3W63 A;  1EIY B;  1FKP B;  2ADB A;  2MKJ A;  2HHV A;  1WEZ A;  2PEB A;  2XUL A;  3HPO A;  5BYQ A;  3R5B A;  3W1Y C;  2ZH4 A;  3VAI A;  2J0W A;  2HK2 A;  4QOT A;  2IRU A;  4O3R A;  2DNN A;  4LSN B;  3PM9 A;  2GNK A;  4ETX A;  1S79 A;  3LP0 A;  2JEF A;  1Q5V A;  4DS4 A;  1N54 B;  4C6A A;  4MH8 A;  2I9S A;  5IC4 B;  2DT9 A;  3SI8 A;  2YKN A;  3TAN A;  2MZ1 A;  2RF2 A;  4GKJ F;  3H42 A;  5D6G A;  1S9G B;  1FO1 A;  1VIS A;  5IXU A;  3R5A A;  1B0V A;  1MN9 A;  1VBZ A;  2DVI A;  1RT3 B;  2DR7 A;  5A8R A;  5GAE U;  1JNZ B;  4IFY A;  3KLH B;  3G6Y A;  2XGQ A;  4DFP A;  1N6Q A;  3CC4 S;  2CVI A;  3IRX A;  1OY8 A;  4KSE B;  2E1R A;  4F0K A;  3VAF A;  1RJJ A;  1YGY A;  2ASY A;  3CMQ A;  4FYY B;  2V50 A;  2X3D A;  2OP5 A;  3CCL S;  1FDB A;  1BQX A;  1PJ5 A;  3D54 A;  1RTD A;  1UVL A;  2WVC A;  3LO3 A;  3PY8 A;  2LEB A;  4E8U A;  3SDE B;  4OYB A;  3UI3 A;  2Y8W A;  5CD4 H;  4XAK A;  1KLM B;  1WOO A;  4ZOS A;  2QGF B;  3HD2 A;  1KFS A;  1HMV A;  5B0G A;  6FD1 A;  1YBA A;  3TZZ A;  3PW4 A;  1SJQ A;  2CVE A;  4HI2 A;  2B6A A;  1EJ7 L;  4LJM A;  4ANE A;  5AXM A;  2ATC B;  4OX8 A;  1JLF B;  4DS5 A;  1NB7 A;  4TYA A;  4U7C A;  1N5Q A;  4FDF A;  4WXW A;  3EXY A;  4RUH A;  1KWM A;  1RHM B;  2DGS A;  2IAJ A;  2W8K A;  5KFC A;  4YUD A;  1JLA A;  2CJA A;  3MPW A;  5KT5 A;  3GON A;  4KHP J;  1MNE A;  2MZJ A;  5IS2 A;  2C2N A;  3ILO A;  3CDA A;  4I69 A;  4LRC A;  4NLR A;  4WZM A;  2WTF A;  1FFW B;  1VRT B;  3MMC A;  3US5 A;  1D09 B;  1HPZ B;  1T9X A;  2B4V A;  3C15 B;  4PRF A;  1BLU A;  4AND A;  4LFA F;  2XMM A;  3ICL A;  5GVQ A;  4IUF A;  1GXL A;  2R8H A;  4KJI A;  2AJ0 A;  4LF5 J;  2RRN A;  4B3T J;  2OML A;  5DGA A;  5KFW A;  4ZLN A;  4NXN J;  1GNK A;  3QO9 A;  1TUW A;  3HDS A;  2HQ3 A;  2A6M A;  2UV8 A;  4IG0 A;  4UT4 A;  1VQ9 S;  3CB4 A;  1M1G A;  4RW4 A;  3UPF A;  3CD5 A;  3KWM A;  1KNZ A;  5HAN A;  1N34 F;  1N33 F;  2C3U A;  3MTJ A;  4HLB A;  3MOJ B;  2Y8Y A;  3SSS A;  2RD5 C;  2CQH A;  1XK8 A;  4WTO B;  5EDW A;  3WC2 A;  1FEH A;  3MMB B;  1FDA A;  1IM4 A;  4TLQ A;  4KB7 A;  3UVJ B;  2OFH X;  3NWG A;  3HSG A;  1AFJ A;  2Q66 A;  3D68 A;  1HNX F;  2RSQ A;  4CLU A;  3M6U A;  4Z7Y A;  1FVS A;  3KJN B;  2YQ0 A;  3MF5 A;  5DDR C;  2UXB J;  5DLF A;  1KQG B;  4KIA A;  4O0I A;  5I3P A;  4HR2 A;  4DL5 A;  2ZDO A;  3ZZ0 A;  1XNR J;  4WPA A;  4Q5V A;  4G6V B;  3LUY A;  4WZQ A;  1XJW B;  3IBC B;  1PSD A;  1YJ7 A;  1ZAX A;  2NXE A;  3R2C J;  3SZ2 A;  4DV6 F;  2HZV A;  3UD4 P;  1U1K A;  5JVH Q;  2C3P A;  4S0M A;  1S72 S;  2K1R A;  4JI3 F;  2CQ0 A;  3M2U B;  4Q2L A;  5FD1 A;  3BQ1 A;  4B9V A;  2B43 A;  3KUG A;  1LFW A;  3LP1 B;  3LW5 C;  4G65 A;  1QAI A;  1U7L A;  1LW0 A;  4UZB A;  1V3S A;  4M5G A;  1VQ8 S;  2DGW A;  4OX9 F;  1M5P C;  2V34 A;  3I56 S;  1WOP A;  3MI7 X;  3N01 A;  2FZG B;  2W2Q P;  1SC4 B;  2E44 A;  2AZ3 A;  4JI8 F;  1FRL A;  2A1B A;  1ZTT A;  2C1E B;  2IPO B;  2F1F A;  3CJS A;  2ZM6 F;  5DO2 A;  3SQO P;  1SC6 A;  5LXR A;  5KFH A;  4C11 B;  1ZH5 A;  4PG8 A;  4UUX A;  3MAA A;  4R5P B;  1GX5 A;  4M5M A;  4BS2 A;  1BQN A;  5A6P A;  3AD8 C;  3C2P A;  1S59 A;  2EG2 A;  1U1P A;  2RDD A;  3SCI E;  5HP1 B;  3RR7 A;  4FF4 A;  4ED8 A;  2IMO A;  2R8K A;  1JLF A;  4DUY J;  1QSY A;  1P9Q C;  2KL8 A;  4NLO A;  5F9N A;  2XY5 A;  4QWB A;  3QSY B;  1NKB A;  2HBQ B;  1HQ2 A;  1TAQ A;  2XWX A;  2K3I A;  2RIJ A;  2ZBI A;  1RUS A;  1EB0 A;  1OSD A;  5IFM A;  2DO0 A;  4OYI A;  5LXY A;  3EPG A;  2OIH A;  3CCZ A;  4PXB A;  2OKQ A;  3DGP A;  3M6V A;  3GIJ A;  1S1T A;  1MSW D;  1NB2 A;  4Y3C A;  4GRS A;  1X60 A;  1HNV A;  3U1M A;  1HFE L;  3J81 Y;  3Q0A A;  1RT7 B;  3H20 A;  4NLG A;  3KK3 B;  2W9B A;  1RB0 A;  2V0N A;  3SCK E;  1SBR A;  3JS9 A;  3LPE A;  3HHN B;  2OI2 A;  2E1A A;  3RGI A;  4DR2 F;  5BR8 F;  4DR4 J;  2XZD B;  2AMC B;  4DL2 A;  3OXL A;  5HRO A;  3BB5 A;  2NYH A;  2ASL A;  4JI3 J;  1VQO S;  1NZA A;  1CJK A;  1YWX A;  4QIW D;  1SKS A;  5BR8 J;  4DR4 F;  1A9N B;  2ZNY A;  1VR6 A;  4QWC A;  2OEJ A;  1M5K C;  2LQB A;  2HHS A;  3X3U A;  4IH6 A;  1Y4Z B;  2RHQ B;  4Y2M A;  3GYG A;  1UVJ A;  2RE1 A;  1PAE X;  3AB2 B;  3P45 B;  5C2G A;  2W9C A;  5F3Z A;  4LIW A;  2KYZ A;  2AYE A;  3HHD A;  2D69 A;  1XN9 A;  2DHA A;  4RKU C;  1IBK J;  3QAE A;  4DN9 A;  1X4D A;  2IC3 B;  3EGN A;  3HK2 A;  1TK5 A;  4MIA A;  4Y2C A;  2Q6B A;  4ES1 A;  1NK8 A;  2HGN A;  1U48 A;  3FZ2 A;  4QW9 A;  2HFN A;  3K89 A;  3AOC A;  3S01 A;  2RQK A;  2YNH A;  3I5C A;  3MEC B;  3L7O A;  4IG3 A;  2YKQ A;  2XHC A;  3OR1 A;  4QBU A;  3B78 A;  1V3Z A;  1KR4 A;  3ELH A;  2KH9 A;  2H1Y A;  4I2Q B;  1P8G A;  1XR6 A;  3POT B;  3D2W A;  1NK0 A;  2UVR A;  5L8R C;  4QYZ J;  1NDL A;  1PYO B;  4IG0 B;  4HHH A;  2HVE A;  4OV1 A;  3TAP A;  2VFU A;  5KFM A;  4K4X A;  1WHX A;  1Y5I B;  3HVA A;  2ZHA A;  2DGX A;  2Z30 B;  2MJU A;  4M1K A;  5D4P A;  2VG7 A;  1T11 A;  5AXK A;  5BXI A;  2FD2 A;  3CJ3 A;  1X5T A;  4W98 A;  1RBL A;  3CNQ P;  3ISN D;  2G2Y A;  2BJE A;  3HD1 A;  3M6W A;  2HHX A;  3JSR A;  1E6Y A;  2YQ3 A;  3T1Y F;  3NKY A;  5THW A;  3CO9 A;  2E5G A;  2JX2 A;  2QLF B;  4DCP B;  1NJW A;  1HL6 A;  1ZOT A;  3BO2 A;  3FSX A;  2HIQ A;  2J76 E;  2DK2 A;  2BJ3 A;  2H65 B;  3CSK A;  3OFF A;  4K5R A;  1YJW S;  2KT2 A;  1HHS A;  4NA1 A;  1R8H A;  1SKU B; 
#chains in the Genus database with same CATH homology
 1XNR J;  2MTL A;  4DR5 J;  1HNX J;  4DV7 J;  5AJ3 J;  3R2C J;  4B3R J;  2UUC J;  4GKJ J;  2E5L J;  5IT9 U;  1N34 J;  2UUB J;  4JI1 J;  4LF8 J;  1J5E J;  1N33 J;  4X64 J;  1IBL J;  5A2Q U;  4YHH J;  4LFA J;  4JI4 J;  4DV1 J;  1HNW J;  3JAM U;  4X65 J;  4NEY A;  1HNZ J;  2VQE J;  4HHU A;  4DUY J;  4YY3 J;  3D3B J;  2KL8 A;  2KVQ E;  4JI8 J;  2UUA J;  2ZM6 J;  4NEZ A;  4DV5 J;  2UU9 J;  5LM7 E;  3W1Y C;  4DR6 J;  4JYA J;  4DR3 J;  4DR7 J;  4JI0 J;  1FJG J;  3IMQ J;  3D3C J;  1I94 J;  3OTO J;  4DR4 J;  2VQF J;  4DR1 J;  4LF4 J;  2UXC J;  3T1Y J;  4JI3 J;  4JV5 J;  4V1A k;  4DUZ J;  5BR8 J;  4JI5 J;  4X66 J;  1IBK J;  3J7A N;  1N36 J;  4DR2 J;  2MQ8 A;  4LF6 J;  4NXM J;  4LF9 J;  4K0K J;  4LF7 J;  4KY3 A;  4B3S J;  3R2D J;  5IWA J;  4DV4 J;  1XMQ J;  4PWW A;  4KHP J;  4OX9 J;  4GKK J;  1XMO J;  2HHH J;  4LFB J;  5LMN J;  4DV2 J;  1HR0 J;  5LMU J;  2UXD J;  4LF5 J;  4B3T J;  3J80 U;  4LFC J;  4NXN J;  4JI6 J;  4X62 J;  5FLX U;  1XNQ J;  3T1H J;  1N32 J;  4DV6 J;  4JI2 J;  2F4V J;  4AQY J;  4DV3 J;  3J81 U;  4KYZ A;  1IBM J;  4DV0 J;  4JI7 J;  2MEW A;  4RJV A;  4B3M J;  2UXB J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...