4B3MJ

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4b3mJ00
3J80U 5A2QU 4AQYJ 4LF4J 4X65J 4GKKJ 1XNRJ 2MEWA 2VQEJ 2UXDJ 2MTLA 4OX9J 4JI0J 2UU9J 3W1YC 3IMQJ 2F4VJ 4LF6J 4DV3J 4JI3J 4DV0J 4YHHJ 4JV5J 4DR6J 4JYAJ 4PWWA 1I94J 4JI4J 4DR4J 4B3SJ 4B3TJ 4DR2J 3R2DJ 4DV2J 4X66J 1N36J 5IT9U 1IBKJ 3R2CJ 5LMNJ 3D3BJ 5IWAJ 1XMOJ 2KVQE 2UUCJ 1HNWJ 4DR1J 4DV1J 5AJ3J 4DV6J 2UUAJ 4LF7J 2HHHJ 4NEYA 4DR5J 4X62J 4V1Ak 4HHUA 4DR3J 4JI2J 1IBLJ 4JI7J 1XMQJ 4DV4J 5LMUJ 1IBMJ 2VQFJ 4LF8J 4DR7J 4DV5J 4GKJJ 3JAMU 2ZM6J 4JI6J 3T1YJ 1HNXJ 2MQ8A 4B3RJ 4KYZA 2UXBJ 4DUZJ 5FLXU 2UUBJ 3J81U 2KL8A 1XNQJ 4JI1J 5BR8J 4LF9J 4DV7J 4JI5J 4DUYJ 1J5EJ 3OTOJ 4NXNJ 4JI8J 4K0KJ 1N34J 4LFCJ 3D3CJ 1HR0J 5LM7E 3T1HJ 1N32J 4KY3A 4NXMJ 4YY3J 4B3MJ 1HNZJ 2UXCJ 4LFAJ 4RJVA 4X64J 4LF5J 4NEZA 1N33J 2E5LJ 1FJGJ 4LFBJ 4KHPJ 3J7AN
chains in the Genus database with same CATH superfamily
1LFPA 2EFNA 1R0AA 5KFFA 2A18A 4JI5F 2P6SA 2H3EB 1QY7A 1ZPVA 4C3MA 4R25A 3BM7A 2VQEJ 2UUWA 2MTLA 2RU9A 3PNIA 2DEJA 3PM9A 4KHMA 5HROA 1U1KA 4EGLA 4N47A 3CCQS 2AHOB 4CLKA 2HFOA 4QR0A 3GV7B 2ZH1A 2OPPB 4Y34A 4K2JA 2ZKTA 2UUCJ 1F9EB 3LAMA 2O67A 3C19A 1LW0A 1FRLA 2D69A 2HVIA 4DV3F 4JI7J 3PX0A 4J9PA 4MYUA 2HFZA 3DOMB 1VRUA 1OSCA 3PRDA 4G1QA 1I1GA 4DJBA 1NKBA 2HNDB 2J0WA 4OYPA 3KYLA 1GTHA 1YVFA 1VFJA 3KK2B 4TY8A 1V5VA 3BEGB 5F9LA 2W2NP 2D9PA 5GAEU 4UOHA 3M8QB 1R8AA 2XO7A 2AYGA 5SUHA 3O5TB 1WEZA 1S1UB 4IOBA 1FTRA 1HW9A 1M5HA 2V8PA 2ZOGA 4Q0BB 2J9DE 4MFBB 1RT5A 1RAFB 1GH8A 1Y7PA 3DOLA 1XJWB 2DNQA 1U49A 4LFBF 1DTQA 3QO9A 4P74A 3QGPA 2KH9A 2GO9A 2KB2A 3NGRA 1FKOA 2KXNB 4QWDA 1EAYC 1ZA2B 3KK3A 4KGVB 3MM7A 2HQFA 4NWBA 4LSLB 2EBEA 4HEA9 3UDCA 3H42A 1L5UA 2NPIA 4HT7A 1NSAA 4H4MA 1N6QB 2J9CA 2UVVA 5HVHA 1OSDA 2HBYB 4OZ5A 5J1EA 2NXEA 4R5PA 4HKQA 4AXIA 2RD5C 4IYQA 5CYMA 1BQNA 3LP0A 2CADA 3BGRA 3CT9A 3KLIA 3KHRA 1H72C 2OD4A 3MMBA 5C24A 4X64J 1ZA1B 1RWWB 2VBZA 4QWAA 5J2NB 5C2GA 1Q82T 1OIAA 5J2QB 3UWTA 1B99A 5GMKa 4YFUA 2AMCB 2DNHA 5ETNA 5EWFA 2WVFA 4WIQA 3M6WA 2Y1RI 2G1DA 1APSA 2DO0A 4PXBA 5J2MA 3CMQA 4N8NA 1YQHA 2ZOFA 5CXTA 4JV2A 4UOGA 2UXDF 1HWJA 1WKJA 3B4MA 5KFZA 3JSMB 1PGZA 2PO4A 1WC0A 4HHUA 2UXCF 4DV4J 1REGX 1C0UA 3PR5B 2YH0A 4NYPA 3M6UA 2V2ZA 4WWSA 4ZPVR 2OPQA 2L08A 3EGWB 3I0SB 3ZFVA 5E3AA 4X4PA 2XCPA 2VBYA 2DGOA 3F41A 2KYZA 2GMHA 4OYZA 4OL8A 1Z1ZA 1A6LA 2JEIA 2R7RA 2FHKA 2RILA 1TKXB 5F41A 2XY6A 1R8CA 3PV8A 2AP6A 1UEUA 2D3OR 4EWTA 3AD9C 1OS5A 1WHVA 4NI2A 2BRLA 1U24A 3C3LA 3I5BA 1TQLA 5KG1A 4OYBA 4K50A 3LUYA 2GVZA 3C15B 2PSZA 1BQMA 5GAGU 1S6PA 3HDSA 4MKAA 3RAQA 1HNIB 4LFAF 3R5DA 4QOTA 1EARA 1T9VA 1C1CB 2JH3A 1QM9A 1YLXA 4AE5A 2WCXA 3H5UA 4KJIA 4OFZA 3Q8QB 2VJUA 2I5JB 3MEEB 3TAQA 1LXJA 3NWGA 1IXKA 1IBMJ 5IT0A 4NMLA 4ZIVA 4TKTA 2CYYA 1YJTA 1LOUA 1RJJA 4D3HA 2UUBJ 2UP1A 2QL5B 4C8YA 5KT2A 3MZIA 1ZAWA 3PEHA 3D3CJ 1RA7A 4WK1A 4QYZK 1EIYB 4RU9A 2GMLA 1P1LA 5KFAA 4FPIA 3TW0A 1U09A 1YZ7A 2DNPA 2JWNA 1DZ5A 3GJSB 4URQU 3NNCA 2LVWA 3DM2A 3HO1A 2QL7B 2GHWA 2V68A 2HNYB 2D3O1 3VAMA 4XTTA 5K14B 1WC5A 4ATNA 1L3VA 3W1YC 3IMQJ 2MKHA 1RACB 2JX2A 2ZE2B 1XERA 1IVZA 4ZCLA 2BE7D 4TQSA 1WG4A 4ZP6A 4YOEA 1K1SA 2GNKA 2ZHOA 3W9IA 1FK9B 2OMLA 4F50A 2ERRA 2NSCA 4EMDA 3OJUA 3K17A 1VHFA 1VBXA 4KT0C 4JYAF 2E5LF 5A6PA 1NSPA 4KSEB 2Q43A 3GP9A 2HVEA 3BQ1A 4QIWD 4UZCA 2DR8A 2UXBJ 2BE2B 2I1RA 4RNFA 4IRKA 4IG3B 2BE9B 2FLPA 2K2PA 1BHNA 2YPYA 2XLKA 4UQGA 4EYIB 3HHKA 2W8LA 4ED4A 1HPZA 3QATA 5DJBA 2DGWA 4WP3A 4UOCA 8ATCB 2XGPA 1WC6A 2FJBB 2V34A 5ADZA 3CCSS 1UJ4A 1UCNA 1TU0B 3N9UC 3TVZA 5MLCV 3IBCB 2FGCA 1KQFB 2HRUA 2V9WA 1VQKS 2CNKB 1SBRA 3R27A 1M5PC 4OYOA 6AT1B 4NLYA 2K3KA 2QLFB 4LIWA 1VQ8S 4HTIA 3OVBA 3O8WA 2VL1A 5K5MA 2XMTA 2WAQD 5I3UA 2QT7A 4NLWA 4ANEA 4YHHJ 1F2GA 2AYEA 2Z56B 3KNGA 5LSRA 5DM6Q 3I56S 3TUJC 2AD9A 1LK5A 2DNLA 3WIVA 2ACYA 4OYXA 1HQEA 2M7SA 3M1VB 3HHNB 2DGTA 3W2WB 2WVEA 2XCAA 2BXJA 3QJLA 1WACA 3M8PA 2HLUA 1HW8A 3OQ2A 1WF2A 3DC2A 1QVFR 2MQ8A 1YJWS 5FIIA 8AT1B 4RW4B 1T3OA 2XSJA 2B7BB 3CB4A 2F5GA 3A3OB 5IFMA 3VAIA 2AJ1A 3GG0A 3A13A 4YB7A 1S6QB 1SQEA 2CG4A 1HA1A 2P9CA 4F02A 2MZSA 2WONA 1DRZA 1RT4A 4U67Q 5H9FK 3MD1A 3RB6A 2GIRA 3ILIA 2R2UA 3P49B 4I2QB 3KHLA 4ICLB 1ZM4A 2B9EA 1KC8T 1UVLA 3DYAA 1GEHA 2EKNA 2IBOA 2P8IA 3QZ8A 2OO4A 4Q43A 5BJRA 4FYYB 2DHXA 1Q95G 3DRPB 1FWKA 4H54A 3A8KA 3SSQA 2FC9A 2BDPA 1X8DA 2O1PA 4CLPA 4NEYA 4F4XA 2RAQA 4J9RA 2HYIB 2DGSA 2YWKA 5D15A 2WHOA 1JLBA 3JQMA 1RXOB 2J0XA 1P9QC 3C46A 2YPZA 1M1HA 2X1BA 3VR1A 1UEVA 1EP4A 3UDLA 1J5EJ 3PXGa 2BQUA 1N54B 3PO5A 2JSXA 2K1RB 3TRGA 3TA1A 2JNJA 5KFYA 3BN4A 1XWLA 4NLXA 4LRFA 1S4FA 3LW5C 1VQ5S 4WF9Q 2DR9A 1HLWA 1FXRA 1JLQB 2AJ2A 3G96A 1HHSA 1YJVA 2QA4S 2DO4A 4G3IA 4HHHA 4HLBA 2VU5A 2DGXA 1PSDA 2RRNA 1XNRJ 4R8UA 1IKVA 4Z7CA 5F8JA 2V67A 1S79A 1RAIB 2EI5A 1YGYA 1N32F 2IRXA 3MUTP 1DLOB 1NK9A 1X4EA 3DLLQ 5JJBA 4ILRA 1FHTA 4YB5A 1GQEA 1NHVA 4IFVA 4R0EA 1U0HB 4ZVPB 2BM0A 1LWCB 1JJCB 3EZUA 3H5YA 3H8YA 3D0IE 1QTNB 1TMJA 5I42B 3IRXB 4WJBA 1KD1T 4GVLA 2XMVA 1AUSL 3TA2A 3JAMU 3NLCA 5KFTA 5ETQA 4CLWA 4DR1F 1SC1B 3CCES 2HHSA 1Q8IA 2RS8A 3M9MB 3MECB 2BW2A 3RRGA 4F3MA 1WORA 1RA6A 1YBTA 1XMQF 1ELOA 4C9DA 4LF8F 3O6QA 3QRRA 3HXMA 5HL7Q 4XPEA 4ZLLA 3OV7A 1FTCA 2YWWA 1SKWA 1U8WA 2D41A 3BR9A 3QT6A 1B64A 4O3OA 3BQ2A 4ZVQB 5H9EK 3UD3P 2QSFA 3J7YU 1JIHA 1LWFA 2KXFA 4USJC 3UD4P 2ZHBA 1C0TB 9ATCB 3CIZA 2WTFA 4RL1A 2BRKA 4NYOA 1CG2A 1YX2A 3IM8A 1IKYB 2R7WA 4PCQA 2VFSA 2DHGA 1KOOA 4FXVA 3CCJS 3GJTB 3MM6A 4TLRA 1NAQA 4ZVGA 1X4GA 1AZSA 1MMDA 2IYIA 1QJHA 5AJ3F 1MU2B 4DX8H 5JVHQ 2MQOA 4TQRA 3PKMA 2UXCJ 2XI2A 3T1YF 2VG6A 1S49A 2EBGA 5KTQA 4CCHA 1G7CB 1MN9A 2IC3A 3Q89A 1RTIA 3AFGA 3MR2A 4UY85 4NYZA 4B3OB 3MOJB 1TELA 4LF2A 4DF8A 2AT1B 5E3PA 2KRRA 2N3OA 2MPUA 4CLUA 3T6JA 3HULA 3K5MA 4X66J 2ZJRQ 1CULB 5AE1A 2ZC3A 2DPJA 3UN5A 1ZBTA 3GONA 5IC6B 1I51B 1TK5A 1AFJA 1KVJA 2BJEA 2PT0A 3IS9A 3BPSP 1JX4A 1IR1A 3K5OA 3L9ZA 5MAOA 1R27B 2KT2A 3W2VA 4HI2A 1R0AB 4LBHA 1WHXA 5KFQA 1W2IA 1QSYA 4P2XA 5HN0A 1T9UA 3KUHA 4XDCA 2PMWA 5HROB 2WBRA 4ZPCA 2QMXA 4C97A 3V81B 3CGIA 4RW8B 3K57A 2YH1A 4B3SF 2L3MA 3KTQA 3RJMB 1U7LA 3JB9k 4ED1A 2DXDA 4C8NA 2RE1A 5A0YA 5AXNA 4RW7B 4LF4J 3AB2B 4PAAA 1RT7B 1I3OB 2CZ4A 2DITA 3UVJB 1YTYA 5A8RA 5J2PA 2W9AA 2W7AA 4I6YA 3NMRA 4G1QB 1C4AA 3BKUA 1YJ9S 4JI4J 3VGUA 4TU9A 1FE0A 1OPZA 8RUCA 3AODA 5GMEA 1KKHA 3QLHA 2MJNA 2P6TA 2DY1A 3RRHA 2FJVA 1OO0B 2XYPB 1GAOA 4M5JA 1BWVA 4YEAA 4DS5A 2QA4G 1N0UA 1RWUA 2YKMB 4LQ9A 4ECZA 2HHPA 3DXSX 4OLOA 2ZDPA 1UZDA 4ZLPA 2MZJA 3JSYA 1D09B 3DOLB 4DL5A 1TL3B 3MTJA 2V8DA 1DTQB 3H98A 3DRRA 3NG8A 3D6TB 3M05A 2AJ4A 5ETLA 2E5LJ 4FP9A 2HBQB 3FK4A 1SH2A 2M8DB 4GKKJ 3OTDA 5D4NA 3SQGA 1Y5IB 2V0NA 3W8PA 2F63A 3M9NB 2XMUA 2AYBA 4GRSA 1SKSA 5HJYA 2XNQA 2UU9J 4IUFA 4GKJF 4IO1A 1LXNA 3QGHA 2R7VA 1NK5A 5JMNA 5LJ3Y 3UI3A 1H7WA 4H4MB 5CHCB 1Y10A 5J1EB 4R5PB 1S99A 1S9EB 3K8WA 3OHAA 4W4MA 1IUJA 3Q8YA 1BQNB 1RTJB 2OD6A 2YNIA 1PYSB 4I56A 2RHSB 1MROA 3OLBA 2HFNA 1RT3B 3I4HX 4ECRA 1SXLA 3H59A 3N79A 4DN9A 2COLA 3NS7B 2GHVC 3TQ1A 3W7BA 1NJIT 2B43A 4PRFA 3FMBA 1N52B 3QIDA 4ELTA 3TZZA 5C7PA 4LF9J 2GAHC 2YX7A 2K7KA 2KG1A 4OI3A 3H7HB 4OI0A 1HR0J 2H5JB 3M6XA 2HS4A 4KO0B 3RR7A 3N6NA 4QYZJ 3R5JB 2OPRA 2XMMA 4O4GA 4DFPA 1U1QA 5D0HA 4U8VA 1N5YB 4KHPJ 1GTEA 3DGVA 3DLKB 1RWNB 4JI0J 1C0UB 2VOOA 3QMQA 7FD1A 1T05B 1JLAA 3OTCA 1SIWB 4X4RA 3RG6A 5KFXA 1TR0A 1RU2A 3AA8A 3AQPA 1HYSB 2G2YA 4EU0A 1EHWA 4ZVSB 1D3WA 1RAOA 2JEJA 4AL6A 2OELA 4PG7A 5HBMB 1HBUB 2XWYA 3Q23A 4WFAQ 1YJ7A 3BH7B 3OTBA 4C2MA 4NA1A 4F4YA 3P8BB 1VRTB 1YZ6A 1X4AA 3IO1A 4B3TF 2FHOB 2A2CA 1HNXJ 4OHZA 2IJRA 3G6XA 1XMOF 4IQMA 3R5AA 1BQMB 2MKJA 4FF4A 5BR8J 1DARA 2I8EA 4KHRA 3QAUA 3NCPA 3N4WA 1FD8A 4CLYA 1MG7A 3UO0A 3UR3C 3CD6S 1N36F 2OLWA 1QAIA 1S10A 4NRUA 2BJDA 3NMAA 1UFKA 2ZBIA 2FZGB 4I68A 3FUYA 7FDRA 1X31C 4EZ6A 5DRKA 1U6BA 5E33A 4K7QA 3G6ES 3T1AA 3CCTA 4ZK7M 2YNGA 4ECVA 2JFDA 2JLGA 5D3GB 4L73A 4WKYA 2EKYA 1UVJA 1PBUA 4X2BA 2H51B 1RWPB 1JLGA 3K5NA 2ALYB 4WCEQ 4DR3J 2C3MA 2C2DA 2ZKUA 2VFVA 4DLGA 3VGVA 1SIZA 2RQKA 3TQEA 3UPFA 1B7FA 4KIAA 1RKJA 2IA6A 3O2IA 3HF5A 3ISZA 2N4DA 2PDAA 2FVQA 3LAKA 4OZ3A 4USUA 2ZH7A 3AAWB 2IM0A 4ELVA 4NXMJ 3K2YA 3RAMA 5IM0A 1WC1A 4YB1P 3THVA 4LF7F 4LRBA 3OTOF 1NKCA 1HBMB 5H9FJ 3DLEA 4DWIA 3ZTPA 3TARA 4L6V3 1RHMB 4N5SA 2JLFA 1S0OA 3OR2A 1H74A 1YKWA 5AXKA 4N76A 4BC7A 1S1TB 2OFHX 4RNHA 4IOAQ 2OIHA 2YKNB 4RBUA 4Z2XA 1YIJS 2HFUA 3I0RB 4ES1A 3CJ5A 2IMWP 2JFKA 2RRAA 3FJ2A 5D8HB 3EZ5A 4PPZA 5D4PA 2C2OB 2UV8G 1E6VA 5EDWA 1VJQA 4UQTA 3BJYA 2J7KA 2MKIA 4DV6F 3DNCA 4DV0F 2QLJB 1RT2A 3SDEB 2ZC4A 4ENOA 1VOMA 3G8QA 2E1PA 2D9OA 1DBDA 3I96A 3DOKB 3OL8A 3MR3A 4WP9A 4PQUA 2HK3A 2KT5A 3WHIA 3GMGA 4QR2A 5K8PA 1VQLS 1X4DA 3G82B 4OJGA 3V4IA 1RBOB 4O44A 4IOCQ 1MLAA 4IH5A 4RW6B 3CEDA 2DR5A 2BM1A 3D7SB 5A76A 1FWLA 4P75A 5L1IA 3MPYA 1IBKJ 2OAUA 3RUBL 4C48A 2X1FA 2X51A 1A7GE 3I31A 5HSPA 5L1KA 3MR7A 4Y2KA 3JXOA 1GK8A 4S0MA 4DHVA 2F7VA 1NXIA 1GMWD 5D0EA 2A6OA 2E5IA 4OI4A 3VALA 5BXIA 5B08A 2DHSA 1JLFA 4HH0A 3F56A 3BDEA 2CPEA 5FDLA 4DR7F 2DXEA 4KGKA 4LREA 2ZVIA 1SKRA 1GNKA 2CQHA 4ZMMA 2W2QP 5BYRA 3MEKA 2HHWA 4A47A 1RTHB 1T95A 1TKZB 1F5BA 3F44A 2HNZA 5H9EJ 4J91A 2LEAA 1ITPA 4X4NA 1JLBB 2AZ3A 4KV8A 2V63A 2XEXA 4GC6A 1FESA 1D9FA 1FJGF 1T03A 2DY9A 4RBTA 4B3SJ 5KFCA 2PIIA 4WTYA 4FZVA 1A0OB 1CJVB 1RYRA 3E01B 4K4XA 2CJXB 3BH6B 2EFVA 5C25A 2J5AA 2VA2A 1HWKA 5FLXU 1IKVB 3M32A 3VCDA 4FF3A 2OMOA 1NLKL 4UW2A 3QSIA 3WX8A 4FYDA 1SJ3P 4XDDA 3MPWA 1BWEA 5M2UA 4PQAA 4WFZA 3KMQA 2BBEA 1JNRB 4OV1A 1VYAA 5KT7A 3ILJA 3NY0A 3KJNB 3ET6A 3N28A 4WE1A 3NGUA 4DCOB 4AL5A 3PFOA 4B9SA 2YXLA 5KT4A 1C4CA 1GXLA 2PE8A 2ZUAA 2HVZA 4NLTA 3PKYA 5E7OB 1NJYA 2QL9B 3G8TA 2QLBB 3KLEB 2P9GA 3HFKA 2EG1A 2G2ZA 4DR5J 1G3OA 2OPPA 3HFVA 2FZKB 4GKJJ 4O4RA 5JVGQ 3RR8A 2IVYA 2MQMA 2W2PP 2HAFA 1YHQS 2FLNA 1T02A 1VHIA 4EUVA 3T1HJ 4PKDB 5CA5A 2CJAA 2CQBA 2R2SA 2HNDA 1T9WA 3NS5A 5ETKA 4M5DB 2ZZMA 1N33J 1YITS 2WSCC 2QC3A 4KB7A 1S57A 2JZ5A 1YBUA 3Q2TC 4LF6J 4GO7X 1K47A 3NS6A 2JHEA 3JAMY 5DG9A 1KOHA 1I94J 1S1UA 2YNFA 1PYTA 3MDFA 1NKEA 4Q0BA 4MFBA 5D78A 3CDAA 2WK4A 4F4WA 2CQDA 2XS7A 3NEKA 5HMXA 2RSQA 3E3XA 2Y8WA 4Q2MA 2DNYA 4DL7A 5FJ4A 1M0SA 3RBDA 5B0BA 3VZIA 1H2UX 2Z0GA 4ZIWA 3EPIA 3VAHA 2KO1A 3FNNA 2LEBA 2ZH9A 3FCHA 5FD1A 5T14A 3FQLA 5HVFA 4LSLA 3ITHA 4DQPA 1F3VA 3AB4B 2HK2A 3BSOA 3QYYA 4J9QA 1WELA 4QU7A 3MM5B 3KUGA 3JYTB 3GILA 4JP8A 2R42A 3M30B 1CSJA 4Q5VA 2FJEB 3SSSA 4AL7A 5EWEA 4DBQA 1F9HA 3IGNA 2HQIA 3B6BA 3K5LA 5J2NA 2VPWB 3RBXA 2RH3A 3ICLA 2ACMA 5J2QA 4OMFG 3D1QA 1NJXA 3TR5A 5KT6A 1N36J 3DMJA 3BF4A 4F8RA 5KFNA 3KLHB 3U1MA 4ZVFA 4NLPA 3N01A 1KHVA 1PKUA 3JSMA 1N5TA 1NEEA 4X4UA 1GFWB 4JI6J 1S76D 5HJXA 5ETMA 2EG2A 1EKRA 3GSDA 1U1PA 1KEKA 1X4FA 4ETZA 2CQCA 2E1MC 5J2PB 1GX6A 2LYVA 4X62F 1Y3KA 1L3SA 4YDDB 3I0SA 2ZVSA 1X4BA 4ZN3A 2E9ZA 5E0OA 1G1XA 3MCOA 4Y3CA 1TUVA 4LF5J 1VC5A 1TKXA 2F40A 3H4DA 1OY8A 5EUHA 2YWEA 2B4UA 2HMIA 1UL3A 4C8KA 2JVOA 1X9SA 4QPXA 4I0WA 3DHXA 2LA4A 2Y1IA 4KC5A 3JS9A 2GVDB 4ZVEA 4O3PA 3R2CJ 4JBCA 4O3NA 3GU0A 2VQEF 2F8EX 3ZNUA 2HLTA 2UUAJ 4LF7J 1LK7A 2POKA 4NZ0A 2BKPA 1C1CA 1FA0A 3ZZPA 3AT1B 5KOWA 5DDRC 4RNOA 3EVWA 4ED6A 3MEEA 3V6DB 3HHLD 3CJ3A 2J8SA 4USMA 1FRIA 5GAHI 3ADAC 2UUCF 3SSRA 3AXKA 5HO4A 3KLVA 3DRXA 4B9MA 2BOAA 4H4KC 1RYSA 3HKZD 1WEXA 1N48A 4ECQA 2L41A 3OFFA 3EJMA 5HMWA 4I7FB 2YNIB 3H90A 4CM2A 2G4BA 2XLJA 1PCAA 4DX5A 1DQAA 3S8SA 1Q8KA 4DV0J 3TP2A 2IMOA 3MMCB 4FBUA 4O3QA 4WTOB 5KFGA 3AJ1A 5K14A 1X4HA 4DV2J 1P8GA 3ENAA 3D3BJ 5C2CA 3TOQA 3NNAA 2ZE2A 3NKYA 1S9GB 3CC4S 2HZCA 4YDXA 2HKEA 1NK6A 3B82A 1FK9A 3MEGB 1YWXA 4N56A 3H5SA 4IDKB 2ZEJA 3J81U 1TL5A 1H6KX 4DCPB 3MOZA 3PX6A 2GQ2A 3RTVA 2GA7A 1X9MA 4WP8A 4RU2A 2BE2A 4K4YA 3GG1A 5CCLA 4IG3A 1UVIA 3E51A 4ZS6A 1VR6A 3V6KA 3WQPA 2R8HA 4ZP9A 3KHHA 4OJHA 1SC6A 2UVRA 4OZJA 5D0GA 2H4YB 4ID8A 2YQ3A 1NK4A 1C1BB 1BY9A 1C2PA 3KWMA 2G0JA 3CNQP 3S1TA 1BE4A 2DBBA 4X64F 3GFHA 1KQKA 1VQNS 4KGMA 4W90B 2CXEA 5GVQA 1UEKA 2PA3A 1RABB 1LFWA 3CXCR 1FNOA 3CD5A 4JOUA 1Q8LA 2OHDA 3QGGA 4MK8A 2CVEA 4O23A 2EW9A 3DU5A 3M8ZA 2M3DA 3HVTB 1UA0A 3M1VA 2WSEC 3W2WA 4IO9Q 1HHQA 4DV7J 3HMJG 4ZVRB 1FFGB 2ZITA 5D6GA 4K0KJ 3EZOA 1NDCA 4DV4F 3V6JA 1KRPA 4RW4A 1YRXA 4ETXA 3TAPA 3M9OB 4CO3A 3HK2A 2Y1LB 2RUGA 5DZ6A 3FFIB 1YDLA 3BBCA 3QFHA 1FO1A 3N5FA 2XZTB 3AXMA 3GIRA 1S6QA 3CO0P 1CJKB 2FZCB 3SCIE 2IAJB 4E8UA 1IQTA 3AQOA 1QSLA 4ED8A 3W63A 1OQ6A 2HHUA 5DLGA 4I2QA 3POTB 4JI8F 4R0JA 4WXWA 3ZZYA 2XC9A 4ICLA 3N6LA 2BOPA 4DPOA 2C3YA 3MAAA 3PJXA 1WD6A 2L9DA 3UNGC 1BXNA 1FJEB 3S01A 4ZJQA 5KFLA 3BQ0A 3QBCA 3DRPA 3NBPA 2AJQA 1CC7A 3G86A 3VGSA 2W9BB 3CDWA 4EO8A 2IBKA 4DUZJ 2H5EA 4M94A 4ECTA 2EFOA 3Q83A 3OR2B 3BBBA 3BZQA 4CM0A 3D4JA 4QU6A 1FRXA 1X0PA 4A8OA 3CCWA 3CDEA 1AB8A 1F2HA 1TUGB 1FKAF 3B78A 2RMLA 4YY3J 1SI9A 5I3QA 4P2SA 2K1RA 2UUBF 1UMJA 1HBOA 5A2QU 2XMKA 1JLQA 2X7IA 4WPAA 5H1SV 5F8GA 2YVSA 2OTJS 3KK1B 1YJRA 2HG4A 4HR2A 1O8BA 3OBIA 3CJSA 3MMAB 2RB7A 4ZDNA 4K8RA 4B17A 5KFSA 1SVDA 3DCAA 1DLOA 2RQMA 1FJ7A 3LALA 2ZDOA 2H48B 5M2RA 5GADU 4Y2CA 4LVOP 1U0HA 2LXUA 1NNDA 1LWCA 4QQBA 1M90T 1NDPA 1RWXB 3BO2A 5LXYA 1Q5YA 1U25A 4EBCA 5I42A 2ZBRA 3MD3A 3BKFA 3DRYA 3IRXA 1WF0A 1AA1B 4OI6A 4XK8C 1U1OA 1HIYA 3CC7S 3UR0A 5SZTA 2JEGA 3MI7X 4TNOA 4HHJA 1X5SA 2CWXA 3MPUB 2W7OA 5ITHA 1Q1KA 2UXBF 3MECA 2YWFA 1HQ2A 4FNIA 2F3JA 4LMZA 1IBLF 1IQZA 1MSWD 2DRAA 1YRUA 2CQ1A 4JV5J 3Q22A 1ZZNA 1HMVB 2CA9A 1FXDA 2Z4PA 2B56A 2NUHA 4PXDA 2ZH8A 5F8HA 2DR7A 4KPCA 1JXVA 4W92B 5LJ5Y 1HNWJ 5LSLA 2YY3A 3TJ9A 1RBAA 1WDTA 2HIQA 4CP5A 3JTOA 1VBYA 5DQIA 5CZXA 2L9WA 4YHHF 4QWCA 4CTAB 1C0TA 2QE5A 2OI2A 4HVZA 3CMAS 1RTDB 3FCWA 2M4MA 4CWBA 2V4QA 2XB2D 3UCGA 3M2UA 2QFIA 3UW1A 2HPUA 4AUKA 3GCXP 3IFEA 3ULHA 4PG6A 1Q7LB 2SXLA 1IKWB 1T03B 4UY8T 1MU2A 2ZH2A 1RE1B 4PPDA 3W64A 4DV1F 1EB0A 3FRYA 4UTGA 3SBMA 4L3KA 1RT1B 3AHPA 3PRBA 4WFYA 5T41A 1VJWA 2ZM6F 5D77A 4CH1A 3LO3A 2B5JB 5EX0A 2V2VA 4B3OA 4BBYA 2JL9A 4JUZA 5LMNJ 3P5BP 4CO1A 1U0SA 2KVQE 1K8AT 1D8YA 3M4XA 1UWAA 3QJJA 4NLGA 3EWGA 2DCUB 1RAEB 1M5SA 1CULA 2O5DA 1VLYA 3OPKA 4OYIA 1PIEA 4IKAA 2FTRA 4MK9A 4J9OA 2W2OP 2WVCA 2MY8A 2W1BA 4YR3A 3D1OA 2XQCA 3DFEA 5F3ZA 5D0RA 3MM8A 1NO8A 4PG8A 1N34J 2LXFA 4CRJA 2CPJA 3UE2A 2E9RX 3CJ4A 3RB3A 2B3TB 1U8SA 3BSAA 2N7CA 3V81A 4X65J 1YG0A 3K5PA 3C6UA 4RW8A 1J5EF 1CQMA 4NZ6A 4ZITA 1TTHB 4K4VA 1J2VA 2YX1A 2AJ0A 2D74B 2DT9A 1UVKA 2MHEA 1NH7A 3GQCA 3QT5A 5KFRA 4RW7A 1F3FA 4NA3A 2Q3PA 1RT7A 2BJ7A 3PACA 3UVJA 4ES2A 2E5GA 5FLXY 3LOUA 1RLDA 4OIXA 3GPAA 1OQ3A 1O6XA 2QA2A 2V4JB 2GZOA 5KT5A 2KVIA 1XNRF 2W4DA 1UVNA 2CG8A 5EN1A 1NPPA 4DL0C 4LF1A 3AOAA 3C16B 3MF5A 4MK7A 3P6YC 1KBRA 3IA0A 2KHCA 1HI0P 4U6PA 2GAGC 1VQOS 5DDQC 3EVOA 2C3OA 4QWBA 3OVAA 3GIJA 2U1AA 3VV2B 2YNHA 2IVFB 1K0VA 3GJRB 2YKMA 4V19J 4O3RA 2YNFB 1EQMA 3QPIA 2PMZD 4Y0FA 1SQGA 3KG1A 1DFDA 4WXOA 1NZ8A 5BYSA 1TL3A 1HNVB 2V9KA 2D7SA 2FJDB 5L9XA 4ZPWR 4KPYA 1KWMA 2KFNA 3AJDA 4O0NA 4DS4A 1QAYA 4QIVA 2XBPA 2CPXA 4IRDA 5IZHA 3G2XA 1Q4RA 1TUWA 4KH1B 1V6HA 5U47A 2CIMA 3PW7A 3VGTA 3ITHB 1Q5VA 2DD8S 2J6SA 4FXWA 3OL9A 5K8MA 2K7JA 4HYKA 1JLCB 4UT4A 1S9EA 3DI6A 5KFWA 3VQSA 2FLLA 1RTJA 3WZ0A 1SJFA 1QVGR 3TAMB 2PEBA 4LSZB 1Y11A 3ENWA 2ZNZA 4FDFA 3I5CA 1RT3A 4JI1J 3VVUA 2D3ZA 2GIFA 1EJ7L 2IM2A 3T41A 4FVMA 3CJ0A 2BMBA 4P2FA 1RKIA 3EDQB 4EK2A 3H20A 2EK1A 3DMJB 3QNWB 4HACB 2AGPA 3G8SA 3MURP 2NSBA 3L95X 1ZM3A 1MMNA 4KO0A 4C98A 2HGLA 1ZETA 1T9TA 3K89A 1QDUB 1N5YA 4EFAC 2ZOMA 3DGPA 1NDLA 4ZVUB 2FHJD 3SZ2A 5J1PA 2ZH3A 3D54A 2I9SA 3L7OA 3DLKA 4NCGB 1NMEB 2VA3A 2EFPA 4YR2A 2QGFB 1T05A 3RB4A 4TU8A 1WOSA 3U02A 1SH0A 1FX4A 3I9V9 2RT3A 3TJAA 1HYSA 3MXHP 1CJUB 3FDSA 4B9VA 5IQ6A 1EX8A 1YK9A 2BYCA 4CT9A 4X66F 1GT8A 4ANCA 3Q24A 4M63A 5HBMA 1HBUA 1LQ9A 2HMIB 3AOBA 3TA0A 4DL6A 2MJUA 4JI8J 1J27A 2V4RA 2DH9A 3VAFA 3C14B 1VRTA 2GC8A 4CO4A 3ZZOA 5LM7E 2RUSA 3M2VB 1HBNB 2AEJA 4ECYA 5HP1B 5IXUA 4KGXB 3BBFA 3GIKA 4ZN1A 1N8RT 4ZVTB 3QRQA 4OYMA 2CPFA 5HI7A 4EYHB 3IP0A 4M5KA 2BEFA 1VLOA 3R7SB 1SQFA 2AWZA 2MY7A 4AXJA 4M1KA 2QIFA 4LF4F 2W9CB 2XNRA 3MHYA 4U9RA 1JJ4A 3DLHA 2ZBPA 2DNMA 3QIPB 2IA0A 2JOQA 1CC8A 5D3GA 3GIIA 4LJMA 4MT1A 3I6PA 3VAJA 2FJAB 3SCJE 2R8IA 3MCMA 2EC2A 2WVBA 4XO0A 3AY0A 2M8HA 4JI4F 3R1HA 2DPIA 4CO0A 4RUAA 3U27A 4LR7A 4IFYB 1WG5A 1TMMA 2WW4A 4J7CA 3FSXA 2KFYA 4FF2A 2HQ3A 4RZRA 2QRRA 2B0GA 1URNA 3DU6A 4Q8FA 1L3KA 2KN4A 3T19A 2UZAA 4C4WA 4I64A 4Y28C 3WIUA 3OUYA 4LSNB 1S12A 1P27B 1EZZB 4MMOA 1WC4A 4TVAB 2MGZB 5A8KB 3M8YA 1HBMA 1LWEB 2Z58B 3IRWP 1J5OB 4ALZA 2FVPA 4DL2A 5KFVA 5L1JA 4NXNF 1VRQC 3IBFB 4GKKF 3OR1B 2H65B 2M88A 1PAEX 1KQGB 1MWZA 1S1TA 2VHGA 1KS2A 3NGSA 5E41A 1YI2S 2UU9F 2YKNA 4IG0B 3QJPA 2V5HG 1RP5A 2Q6CA 5I4MA 3PW5A 2UV8A 1IBLJ 1BUXA 1FRHA 1NU4A 3I0RA 3T5LA 2BR0A 1FCAA 2RQ4A 4C6AA 3QT8A 2PN6A 4USIA 1FJCA 2YKOA 5CABA 3CDUA 4ECWA 1V3SA 4HDHA 4DUYJ 2AGOA 1OWXA 2JLEA 2F8HA 2CQ4A 5HANA 3BS9A 2NYIA 1TL4A 4FPRA 2HWHA 3SDEA 3DLJA 1L3TA 2GO8A 4LF9F 3DOKA 5LXRA 2DH7A 4WKRA 2RVJA 1Y4ZB 3UNYA 3R1LA 5KAKA 1HR0F 2F4VJ 4A8WA 3G82A 1RK8A 3CTRA 4ZVOB 4FXDA 4A8FA 1FWPA 2QN6B 2IJNA 3J81Y 2CZ9A 5KFOA 2FLOA 1U2CA 4KHPF 2Z8QA 4OZLA 2KYXA 1LNQA 4RW6A 4K4ZA 3R97A 5B0EA 5THWA 3W9JA 4ZCMA 4N77A 4DV1J 4JI0F 1QUVA 3BGFA 4PEOA 1SJ4P 2C1EB 3KLFB 5A8WA 3Q86A 1RGVA 4F3OA 1LWXA 2IRUA 4PUOB 3TEHB 3A4TA 2F9JA 5HLFB 4WU3A 4D3GA 3LA0A 2ZM6J 3SCLE 2ZFHA 2YKQA 4W98A 4P10A 2BACA 5LT5A 1RHJB 5KG6A 3RW7A 1SL1A 1S0NA 2CJYB 5BYQA 1HNXF 3BPDA 3MAAB 3QRPA 5K8OA 1K9MT 5BR8F 1W25A 3HX9A 5DQHA 2HHQA 4N41A 3NBPB 2B4OA 4CLLA 1IBCB 4USTA 2J9DA 1T3NA 2XZDB 1TZ0A 4PWWA 2MQQA 4RWWA 4DR4J 2ROPA 1RTHA 1TKZA 1WI6A 2DNOA 3LGHA 2AEMA 3I82A 4O3SA 4LRCA 4MJKA 1IM4A 1ZOTA 2FQQB 1NK7A 3PDNA 2R7SA 1SCJB 2MLZA 3SCKE 1Q7YT 3FC9A 1FDBA 4P7TA 2NCKL 4DOZA 5LMUJ 2VG5B 2XULA 1HBOB 2C22A 3CO9A 3PR4A 1KFSA 1CJVA 1KTVA 3PYFA 5F8IA 3D0HE 3E01A 5EX3A 3BN7A 1S6UA 3HT3A 5F3TA 1Q16B 4Q44A 1R0CB 1TFWA 2H54B 1E6YB 3TYTA 2RS2A 1YBAA 4H4KA 4DR3F 1NM2A 2YKPA 4BHQA 3PYGA 4EBEA 1ZH5A 4OX8A 2XS5A 4XAKA 4J9MA 3LP2B 4FF1A 1WF1A 2AF6A 3OLAA 1PILA 4RUBA 2VKRA 1EQ0A 5E3RA 3HCXA 2HFVA 3IG1B 2OTLS 4DSIA 3KLGA 1S97A 4NXMF 1FE4A 5L46A 1NK8A 2E1AA 4X4TA 4A8KA 3W62A 2HWTA 4MIBA 4UZBA 2HWIA 1RI7A 1XR6A 2FPHX 1KONA 4BWJA 2DH8A 2GQCA 2R3VA 3GZ7A 5CYQB 4V1Ak 2PFDA 3Q8SB 2R4FA 2GW8A 1HI1A 3KLEA 4DV5J 2FY1A 3I87A 4URGA 3MWBA 3OFEA 3P96A 2M5YA 2Y0SD 4ILMA 1RAAB 1S5ZA 4DPTA 2QEXS 4LVNP 1QD1A 2W01A 3MCNA 2G0IA 1WG1A 1TP7A 4DPXA 2ABYA 3R9LA 5L1LA 4LFCJ 2XTJP 2C2NA 1G6BA 1BLUA 1TKTB 6FDRA 4RJVA 3FBFA 2OSQA 4DN0A 4KFBA 4ZHRB 1T8EA 2GS8A 4IR9A 2V8GA 4PABA 4IRCA 2IY5B 4M5DA 1A9NB 3UCZP 3GFZA 1W26A 4BDPA 2CKWA 2QV6A 3M2UB 5KG3A 1N5SA 3ZNJ1 1REVA 4P2MA 1VC0A 3PYEA 4Y2IA 3QT7A 1RT6B 1LV5A 1SKUB 3OJSA 1R89A 1TAUA 2OGUA 1HQUB 4FYWB 1P9YA 1RAJA 5E3CA 5DETA 4NCAA 2XY5A 3C66A 2VFRA 4DPYA 2BABA 1KLMB 1IBKF 1AT1B 3MEDA 3MAHA 4ED2A 1G4CA 1YJUA 3CCUS 1JJHA 4M5IA 4M5NA 3O1LA 3FCVA 4KY3A 1SB6A 2HW3A 3HM9A 4Y2MA 5DG8A 4CIOA 3ZZ0A 1R3NA 3UCUP 2M9KA 1JLEB 3W9HA 3F0NA 3IWNC 2CAJA 1SL2A 2GQQA 3MM5A 3JTPA 1MWYA 2B6AA 3JYTA 2BANB 3PJ9A 1P1TA 3LP1B 2H1YA 3M30A 5KT3A 2LDIA 1RB0A 3CCZA 3OXFA 1U1LA 1D9DA 2FJWA 3VAGA 4LR9A 2LU1A 2R7OA 2WB4A 3MM8B 2ZWOA 1VIOA 5DGAA 1JK9B 2R7TA 3EUNA 2DNZA 1OY6A 2R8KA 1Q86T 5KOXA 4I1TA 1S77D 1V3ZA 1NH8A 2AZ1A 2J7WA 4LQ3A 1DTTB 2L48A 4F4AA 3KLHA 3C6UB 2GIQA 2P9EA 3NCRA 3US5A 2A10A 3ZTOA 3R7BB 1SPBP 2H5IB 3OFHA 3TJ8A 2QYCA 1BQXA 4BS2A 3V5RA 3H25A 4C3KA 1Q53A 3A8JA 2F4FA 1FD2A 4DG1A 2B8PA 1QE1B 3NL0A 1TKDA 1RHUB 3X1LB 2RKIA 5HQLA 1QAJA 3LH2S 3H2UB 2V2QA 2MQPA 4ZCIA 3FGVA 2QLWA 2F8MA 5T7LB 3J81j 1FVQA 5CYJA 4PG5A 2JVRA 3OHBA 2B9WA 2KHDA 2FUG9 2NZCA 2ZH4A 5D4OA 1JXEA 4OJ3A 2YNHB 1VQSA 2IFXA 3SV4A 3FEYB 4G6VB 2HHHJ 2VV5A 2GVDA 1HNZF 1VQMS 4NLUA 2N7YA 2OH2A 2NQPA 4ZPBA 4PR6A 1D1UA 4F4KA 2C42A 3PG9A 2IDEA 1D8ZA 2I38A 1F9FA 1S9FA 4QYRA 4NXNJ 1B7YB 4DR5F 3CWJA 4DR6F 3V6DA 4UF4A 4MKVA 1UP1A 4PZVA 3NGDA 4WBFA 1SJQA 2CFXA 5J1NA 1V3RA 2R8JA 1ZTTA 3R7NB 2E1RA 3F73A 1WSVA 2GGPB 2NPFA 2W2MP 4FS2A 2YQ0A 4RUCA 3JSBA 3DXBA 3J7A1 2LXIA 3N5BA 3DI6B 3M2RA 3CCRS 2C2KB 4I7FA 3T1HF 1Q79A 5GMDA 3R8YA 2DGUA 3UQSA 4DSFA 4DU8A 3UN2A 5AT1B 1X4CA 1N33F 4CYUB 2W8KA 4DFJA 5IT9U 1NK0A 3MMCA 5IWAJ 3KHGA 3G4SS 3HFZB 2CDRB 2ASLA 2R8GA 4KGZB 3D2WA 4LF6F 2A0FB 1UFWA 1VQ7S 1AYEA 3TUIC 2VQFJ 1I94F 3THPA 4H4OB 2GCFA 2NUUG 1S9GA 1WHYA 4XPCA 3M8RA 1X5PA 2XYHB 4QIGA 1RCOB 3K8VA 3MEGA 3DGPB 3ZZTA 4IDKA 1HL6A 3B4DA 1ZS6A 1PJ6A 4J9LA 3LPYA 4DX7A 4WU2A 4DL4A 2RRBA 1NB2A 2AV5A 2WRMA 4OHWA 3KJVB 3AJ2A 5LOQA 2OUGA 1UJ6A 3EXYA 4YQWA 2C2MB 1S7HA 2DEIA 3KJQB 4ED7A 1PJ7A 1UWBB 5F9NA 2XG8A 2VC1A 5B0FA 1F5AA 2IJFA 1PYOB 1ZM2A 1CS4A 5KG7A 1C1BA 4BCAA 5HQMA 3J7Z5 2ZBQA 3R2DJ 2HBZB 3SQOP 3BV8A 1D0EA 4OHXA 1OYDA 2B9YA 5G0RB 2OPSB 3ZTQA 3ZZRA 4OQJA 4F0MA 4PWDB 4GO5X 4K5RA 3SMZA 3E2EA 1AW0A 1TL1B 3FBBA 1TL7A 3AA9A 3Q8PB 5GAEI 3A3PB 4FVCA 4F0HA 4QBUA 3HP6A 1OYEA 1UJ5A 2B8QA 3TO8A 3FBCA 3HVTA 2J76E 4HI1A 3DLBA 4NPOA 2E1CA 1I6JA 1N0VC 2DNRA 2W4CA 4F26A 2V50A 2BVZA 5IOLA 2LU2A 1R8PA 2KDOA 4JI6F 4IH7A 3OFGA 3H5XA 1CJTA 4FKXA 1Q0NA 4HTJA 3H4BA 2OP5A 5L9NA 4LUBA 3FFIA 3TWZA 5DZ7A 2VJVA 1QSSA 1XK8A 2WVDA 3HSJA 2VG7B 3ZZZA 4LF5F 1JKHA 2MYFA 1CJKA 2IAJA 2CRLA 5B0AA 1CQNA 3TX8A 4J9VA 3OL7A 1PG5B 2PEHA 2NLWA 1IR2A 2KXHA 3POTA 1B0PA 2FHMA 3OUYB 2A6MA 3CJTA 1X7VA 1HKAA 3DN9A 4QW8A 4YB6A 1JNZB 2XMAA 5HMYA 1YSJA 3BGOP 2LQJA 1VQ9S 1T9XA 1NDKA 3ZTRA 2UUAF 2W9BA 3HHLC 1S48A 5DM7Q 3V2UC 3I55S 2O01C 1T9YA 2XHWA 1B3TA 2Z30B 4F2RA 2K8GA 2QO3A 4MIWA 4DX6A 4ECXA 1WKLA 2XI3A 3M8SA 4CH0S 3D6FB 2J6TA 2QX0A 2F65A 4YP3A 4J9UE 4UUXA 1NUEA 3PW0A 1HWLA 4YR0A 2NXCA 3MM9B 3RBZA 1FRKA 2B51A 2IVMA 4DR2J 3KK1A 2HQGA 3OD2A 4UOFA 2Y8YA 3MMAA 2ZD1A 1ROFA 3LWMA 2OKQA 3CJKB 1O5JA 3ILOA 2Z2YB 2DVIA 1B0VA 4OLPA 3D1HA 2BX6A 1FF2A 2ASJA 4DV2F 2CQIA 1RCXB 2W24A 4I6AA 3TUPA 3EYZA 2DNNA 3DLGB 1B0TA 2P5VA 4OI1A 2CJBA 3TI0A 4QIFA 1CLFA 5DDOC 5KFIA 3HJFA 3NAHA 5GAGI 4FNHA 1FRMA 2NXUA 3TVYA 5F8NA 2HBRB 2KT3A 5A8WB 3FRZA 3T9NA 3CDBA 4K4TA 3T5JA 2KTQA 3TVKA 1BD6A 3KDOA 3TANA 1DJ0A 1AROP 5DQGA 3ETOA 4CLFA 3QWPA 4YN3B 1HMVA 4X4VA 3BB5A 1X5TA 3D67A 2ZZNA 3CVKA 5CZVA 1U2FA 2XMJA 1MW7A 2RF2A 3ISND 1IKXB 2MZTA 3QGIA 2E7XA 3HZGA 2PGCA 3OTEA 2R2TA 3NWRA 4CTAA 2CJ9A 2R7QA 3D0GE 3SFUA 4FYXB 4USHA 4ANDA 1FKPB 1RTDA 3RGIA 4CQ1A 3IXQA 2FDNA 3WC2A 1Z4UA 4C11B 4FN5A 2QLXA 3TUZC 1L3UA 2YWGA 2DRBA 2PD1A 4GVBB 1IM6A 1OY9A 2XO6A 5DG7A 1IKWA 2ATLA 4DV7F 2FJXA 3EICA 2MDAA 1RISA 1F60B 4K0KF 4OX9J 3JTNA 3HSGA 3G6VA 2ROGA 1TVRB 2JRSA 4JI3J 1JXLA 1RHRB 4F36A 4P7VA 1DAXA 4J9KA 1RT1A 5F0WA 1HD0A 1S0VA 1ACMB 2CPYA 3HT0A 1T11A 1M5VC 2B5JA 4I2PB 4M5LA 1P6TA 2AGQA 4NLDA 1U48A 3OW2R 2NXNA 1PC5A 1RBLA 2VPXB 3W65A 4K4UA 1SUQA 1VDHA 4PYDA 1VQ4S 4P71A 4RWXA 4DQSA 1TV6A 2C2ZB 1SL0A 3RB0A 1U2RA 2KG0A 2V94A 2VPYB 2KL8A 3VVTA 2CQ3A 4JI5J 3KLGB 3BDPA 1UPPA 4DDFA 4DQQA 1WUUA 4NA2A 2Z2LA 1HNZJ 4QWEA 1S59A 4DUZF 3NOCA 2YX4A 2LECA 2LMIA 2HHTA 4OYWA 3FKBA 1VBZA 2V2KA 3HSZA 3QZ7A 3C2PA 3PIOQ 3P45B 4TYAA 4DV3J 4A8YA 2R9LA 1ZYQA 4YY3F 4DR6J 2CJQA 3U1LA 4OHYA 3O44A 3B54A 3TEGA 3MPVA 2X1GA 4CH7A 2ADCA 3BYPA 2EC0A 4M5HA 4NASA 2ADBA 1RDRA 2GFFA 4LIRA 3SIPB 4OX7A 3FEXB 4V19X 3KMSA 2V4JA 1NHKL 3CCMS 4A8XA 5E5NA 4KFBB 2MKYA 1KTQA 3B8HA 2HIYA 2HQCA 2E44A 3A12A 1LW2B 4NLSA 1U26A 3C16A 5ETRA 3VQTA 2BV3A 2MB0B 3PO4A 2CJKA 1S1WB 2JJ4D 2KRBA 1DY3A 2ASDA 1X60A 1REVB 3UN3A 3GR0A 1W2BR 3K59A 2MKSA 4LFBJ 3J80U 1DURA 4C0BA 2RHQB 3MFIA 3CUNA 2OEMA 4X84A 2AU0A 1WOOA 4K4WA 2LQ9A 5G4DA 4L72B 4X4SA 1VC6A 2BA9A 1CVJA 4L3NA 2UVWA 5M2PA 2E9TA 1HNVA 3CIMA 2WSFC 4U7UD 2DNKA 4A46A 4B9TA 4C8OA 3MEDB 2XSFA 1ZTWA 1YJNS 2FYXA 1Y00A 1JJ2R 2PMHA 1KVKA 3CJ8A 3NGKA 3MR6A 3W8GA 2NS1B 5DDPC 2EFQA 4HH1A 4JV5F 2DYAA 2RIJA 1SV5B 4F04B 2VDIA 3IN5A 4DSJA 4NZ7A 2J0SD 1DQ8A 1JLCA 4RW9B 4CNYA 4CLTA 2B6AB 1RUSA 4YMEA 1HNWF 3KG4A 2IPOB 2Z57B 4U95A 3TAMA 2E5JA 1XIQA 2IM1A 3HHDA 1UA1A 4LBIA 5GAHU 3FZBA 1EKSA 4F3QA 1KLNA 2V6AA 4DZ6A 3J7AN 3IAM9 2LEPA 3GIMA 1UTAA 2G9OA 2ZZTA 4B9UA 2LQ5A 2UXDJ 4HACA 2CQ0A 2GJ2A 4ER8A 1S7IA 2DGVA 3Q8VA 1VQ6S 2F9DA 3LANA 1S1VB 4Y6IA 4USVA 3Q8UA 4Z37A 3HPOA 1UKUA 4FS1A 4NCGA 4AT1B 4DG1B 4F67A 1NCLA 1RSCA 4DPUA 1BGXT 2RKIB 3R5GA 3C6TB 4ZJOA 4USWA 1H38A 2LQBA 5LMNF 3ZTSA 1CJUA 4ID5B 2MLXA 2V69A 3CW2C 2A3JA 2XZWA 3ENVA 2HHXA 4LRDA 1NPRA 3EGZA 2X3DA 2G1HA 2HS3A 4LFAJ 3C14A 3W60A 3J7YI 4J9SA 3ELHA 3M2VA 1HBNA 4NLRA 5B7WA 5HP1A 2YBVA 1ICEB 1WTFA 1N34F 3QAEA 4DSKA 4OZ2A 4I4BA 3FVYA 4B3RF 2DXFA 2A1BA 4UUWA 1WEYA 1I5OB 2NXJA 4FBTA 1K44A 1LW0B 2KM8B 5HK4A 4X65F 1GMVA 4OZ1A 4KH0B 2WB1D 1Y5NB 3UD5A 2C3PA 1RU1A 4A48A 1VRUB 1F6TA 2LFVA 2W9CA 5DO2A 2H9ZA 3GJQB 1NJZA 2HZVA 3G87A 3QIPA 4PG4A 4BWMA 1VBKA 3M2RB 4A4JA 1UVMA 4TY8B 2I2YA 2CPHA 3PY8A 4KKOA 1RWMB 3ETMA 4IQXA 1WJ9A 2VOPA 3H2VE 4MYTA 2K06A 2E7VA 1GXUA 4I69A 4WYLA 2MKKA 4IFYA 4A8QA 4N8OA 2QSWA 3U7JA 2XS2A 1ZAVA 3Q2SC 2OSRA 2OEKA 1RT5B 3FBEA 3HJVA 3LGNA 3PHEA 2VDHA 2FVRA 4RX6A 5B0DA 5DGBA 2AQ4A 4K4SA 3GCWP 3QO9B 1FNMA 4RO0A 4LSNA 3T9ZA 5KFHA 4USKA 4JYAJ 2IYGA 4M95A 3MAQA 2GX8A 1CEZA 4DL3A 4K59A 1FKOB 1XNQF 5IS2A 1S4EA 3KK3B 2H4WB 3I32A 2MGZA 3MMJA 3MM7B 1KHWA 2HZAA 4OHVA 5A8KA 2L9NA 2VC0A 3GFXA 1VK8A 3GYXB 1LWEA 4KR0B 1J5OA 4OI2A 1V5IB 2JEFA 4KE5A 4IH6A 5E2QA 3HHEA 3OR1A 4FKYA 2AKWB 3OL6A 4G65A 2BUNA 4OX6A 4IG0A 4DXLA 5CYMB 3LP0B 3BGRB 2HGMA 3IGVA 2M0GB 3KLIB 3MMBB 2EPIA 5C24B 2RDDA 3HLUA 1GMWA 1RTZA 1CS4B 2NR0A 2J8AA 4A8SA 5IT9Y 3NNHA 3IR6B 3WX4A 1XC9A 2YWHA 1FI4A 4JI1F 4RKUC 3ZZUA 2PI4A 2HRYA 3MR5A 2RDIA 1R6YA 3EMTA 1RHQB 5LL6d 5J2MB 1RADB 3PFEA 5DLFA 1TL7B 4X4OA 4ZPTR 3GYGA 4L75A 2CPZA 3KKFA 4OJ1A 2DGQA 1HFEL 2LDYA 1IWGA 3BKTA 2VPZB 5K9FA 5KFPA 3LQVA 2OPQB 4DSLA 2NZ4A 2AX0A 2B4VA 1W7WA 3FEZA 1Y5LB 1UFLA 5L8RC 4QW9A 1CJTB 4EBDA 1G2EA 1TAQA 3KLFA 2LLZA 4PUOA 4CLSA 1LEOA 5B0GA 4CZCA 5HLFA 2FIUA 1OJ4A 4CT8A 1JWWA 2HFSA 3EGNA 4NI2B 1WC3A 2DHHA 1JKHB 3W5XA 4ZCKA 2G13A 4JB8B 3VTIA 4YS2A 4P52A 1TK8A 3BR8A 3PW4A 2GVZB 2K3IA 1F5CA 1H3DA 4HL9A 4OV6A 1K1QA 2O3DA 1S6PB 5ETOA 1H2VZ 1RLCL 4LRAA 2AX1A 5K20B 1S6OA 2M70A 2YTCA 2MEWA 2MZQA 5HVGA 4ZLJA 3GR1A 4Z7YA 3PIPQ 3AD8C 1RQ0A 2G2OA 2UVUA 1FX2A 3PVXA 2BZ2A 5L39A 3SI8A 1MWQA 3FSIA 2X3GA 2Z2ZA 2CQGA 2MKCA 4DEZA 3DDNA 3FQKA 5IV3A 3L4BC 5K8NA 2JC1A 2IM3A 2J9EA 4RNNA 3OXGA 4N7TA 1NSQA 3A8EA 2GV1A 4RPFA 2MMYA 5AE3A 1XBWA 2AIRB 3UFCX 3A8IA 3CMES 3Q0AA 1KDNA 3W61A 2HAIA 3K7RA 3KG0A 2VG5A 2X1AA 4K2XA 1RAHB 5EWGA 3RBEA 2E7WA 1ZPWX 2VD3A 4QR1A 1H2TZ 3ILLA 2KZMA 2LA6A 1N32J 4NLQA 3DM2B 3VHQA 3DDIA 2BJ8A 1M5KC 1E6YA 2AW0A 2MXYA 2B7CB 2ZD1B 1UW4A 2ZJQQ 2XYGB 2KFZA 2EK6A 1H0HB 1PAUB 4L74A 3LP2A 4C0HA 2CUYA 3K0JA 2VF3A 4P6QA 5B0CA 4BLGA 4M8LA 1FERA 2APOA 4MTPA 3LGMA 4DSEA 3IG1A 1BC6A 2E66A 5KG2A 2F1FA 1KFDA 4PYAA 3RZAA 4DR1J 4F25A 1RWKB 3I9ZA 3L7PA 4MIAA 2KM8C 1XMQJ 3TZXA 5C42A 1SJRA 4LF8J 2D3UA 1S0MA 1HPZB 3LPEA 4AQYF 1Q8BA 3G6YA 3HVRA 1UPMB 5CYQA 4KAIA 2RQCA 3AD7C 5ETVA 1R0BG 3CSKA 1FVSA 5KFDA 5CD4A 1JB0C 2W7PA 2CNNB 3NXZA 3KDNA 3L3CA 4ZPDA 3R5BA 2WOMA 3PRVA 1HARA 4GC7A 3W3SA 1HWUA 5HQ8A 4DLEA 4K5SA 5I3UB 4TU7A 1VS3A 1TKTA 2O66A 4DUYF 3OSNA 1TK0A 2RF2B 2XMWA 1RWVB 1JQGA 4U7UK 1F1BB 1S1XA 4ZHRA 4RUHA 2N3LA 5E3QA 3G9CA 1KNZA 1HQEB 1D9AA 2BKOA 3MUMP 1FXLA 2XY7A 3SEOA 2BKNA 2BJ9A 3BSNA 3GYNA 1N5VA 3M8PB 4Y65A 5AJ3J 2F4VF 5ETPA 1X0FA 1VCTA 1WWHA 4MH8A 3M7VA 2XSJB 3RU0A 3R5CA 1RT6A 3T1YJ 1UZHA 4L76A 4LT6A 1HQUA 4DUTA 3QWUA 1FDAA 2WONB 4LBPA 1F0XA 2ATCB 1KLMA 1N88A 3IAS9 1RT4B 2V8VA 1H7XA 2EWHA 4B08A 1Y9OA 3EDRB 3P5TL 1KP6A 2RNEA 2XWXA 4DI6A 1R7IA 3P4UB 3DYAB 3D5MA 3KOAA 3Q8RB 1SUQB 1UETA 4ITSA 1TV6B 4P9SA 1U47A 2PFFB 1JLEA 2FVCA 3V6HA 3E8OA 3ZC4A 1VQYA 4ZP8A 1M5OC 2BANA 4WK3A 1KQSR 3LP1A 4MKYA 2FY8A 2DHAA 4XIUA 5KFBA 2VFTA 3DHWC 3SXLA 1EP4B 3THTA 3RAXA 4DR4F 3GV5B 4DMZA 4B3RJ 5F8LA 5HMZA 3KJFB 2Q79A 1RWOB 1DTTA 3IWXA 4YUDA 4C0OC 1R6VA 1YRTA 3HHLA 1U45A 1IR0A 1IJFB 2CVIA 2JC0A 4TY9A 5LMUF 4RNMA 4M5GA 4ZJLA 4J37A 5CD4H 5KG0A 3ZO7A 2MHNA 2GMJA 4R8UB 2LKZA 3GFYA 1Q78A 4NEZA 2E5HA 3R6LB 3HD2A 3HVWA 1VQPS 1U6ZA 2M52A 2ZH6A 3NRBA 2KU7A 2OEJA 4JI2F 4BC9A 3ENQA 3EM1A 1JMTA 1QE1A 2AEFA 3UDVA 1EETA 4EO6A 4IFVB 3D28A 4WZQA 2CPDA 3DRSA 2QA1A 2J0QD 3L09A 3SYZA 4O0IA 2ASYA 3BSCA 1ZM9A 1XMBA 5KG4A 3NP5A 2BJ1A 2HURA 5T7LA 2DNGA 2ZUGA 3S7RA 5F8MA 1N56A 2ILYA 4ILLA 2C2RA 1WHWA 3EGVA 2RJZA 1AXQA 3BO4A 4F7VA 4DPWA 1Q81T 3OT9A 2ZBCA 4PWUA 4C8MA 2OFGX 3D9BA 1XNQJ 3HI9A 4DCJB 3JQKA 3IBWA 3BGLA 3MTKA 1PO6A 4NLVA 4URSA 5IQQA 1K73T 4DV5F 3SFGA 4X4QA 2QG9B 3PW2A 4NOHA 2QTWA 1R43A 1ULRA 4NE9C 3NAIA 1FDDA 3TX0A 4KTQA 2MZRA 1LWFB 3DOMA 4HDGA 2GGPA 4LFCF 3CE8A 1UW9A 2RDJA 3P3DA 1VIXA 2DCLA 3KK2A 3QSYB 7AT1B 2J6UA 4DQIA 5IC4B 2FC8A 3M8QA 3PJWA 5I3PA 1T94A 5AXMA 4CYUA 3MM6B 1AZSB 4HT5A 1MNEA 2QJ3A 2U2FA 2R7XA 3J80Y 3AH6A 2Q6BA 3W66A 1S72S 2VODA 3PEJA 4CO5A 2VONA 1R31A 2UUTA 4H4OA 3VWSA 2VG6B 3U1NA 1AFIA 2ZWPA 4B02A 4NMXA 1FFSB 3W5YA 3CD0A 5HAOA 2IC3B 3GWCA 1FFWB 1RTIB 2HVDA 2HRTA 2MQLA 3J7ZT 4TXSA 4ED0A 2R7UA 4DU7A 2FGOA 4DF4A 2NREA 3GSIA 1N6QA 3KJVA 3CJ2A 3OXLA 3CJQA 4RBVA 1X9WA 4CLZA 3QQCD 1VISA 5KFKA 3O3LA 3VAKA 1AUDA 1UWBA 2DTJA 2LCWA 2IDLA 2R2RA 2DIUA 4B3TJ 1WKKA 3IS9B 1XMOJ 3W2VB 2QYGA 5F0UA 3KUEA 1OMSA 2WBMA 4ZVHA 1BMQB 5L38A 4JV1A 4DZDA 4B9NA 4WFNQ 5AXLA 5G0RA 2OPSA 3MPDA 1FT8A 2RU3A 2BQRA 2XM3A 1PJ5A 3CD7A 4AYBD 4PWDA 2I0XA 5JXSA 3BO3A 3HD1A 3LWLA 1TL1A 4WZMA 5A0YB 3D6HB 4OZ0A 1KVIA 4KRWA 2XLIA 1SJ1A 6FD1A 2YQ1A 3TNVA 1QUPA 4WFXA 2IIHA 5A8RB 4CO2A 1FRJA 2G0CA 3X3UA 2C28A 2VH7A 2ZH5A 3MGJA 2HGNA 3QLHB 2CNOB 3NCQA 4KKOB 3IM9A 3S6EA 2M2BA 3FSYA 1WSRA 4Q7AA 2VG7A 1NZAA 1U1RA 1N5QA 4Y00A 4QZVB 3T6BA 4B3MF 2PI5A 1VGYA 3C15A 3K58A 4ECSA 5LSOA 3PYDA 3A1YG 1HNIA 3N6MA 2WZ1A 3GV8B 1GMUA 4I6WA 3DRRB 1R8BA 3OTOJ 2HHHF 1TFYA 2OJ3A 3DDKA 3KNAA 4P73A 4OYAA 3IC1A 3I4PA 3SQGB 2I5JA 2IHR1 3HSDA 4AQYJ 1URRA 1U1MA 3C8YA 2DISA 3GLJA 4JI7F 3CF5Q 2EEYA 1T7PA 1H73A 3ONQA 2CZVC 3NGTA 3BREA 1IJEB 1XTZA 1RAGB 5KFMA 2J7UA 2LP4A 4ZP7A 4CNZA 2DR6A 2Y9HA 1T0TV 1MROB 2MSSA 4NX9A 1PC4A 1XR5A 2D1CA 2DK2A 3W5ZA 3VF0B 3HZEA 3H0PA 4DV6J 2B4PA 3MM9A 1WNEA 2HNYA 3DKDA 4C8ZA 5ETSA 3LF0A 2KJWA 3I5AA 1Y0HA 2HVHA 1QAXA 4G1IA 4B9LA 3CJKA 4MAKA 1HD1A 5IWAF 2C2EA 4WYWA 4JV0A 4LR8A 2OPRB 4O4GB 1V9OA 1FDNA 1CPZA 2VZ9A 5IV4A 2E29A 1WTBA 2CWKA 4U96A 2VQFF 2ZHAA 5C5JA 3DLGA 4Y2AA 3T5KA 4I67A 4FYVB 3RRKA 2CQ2A 1JLAB 2HHVA 3OVSA 2CDQA 3R6GB 3GE9A 1B4SA 3BGUA 3RYLA 3QFWA 3UDEA 3PX4A 5KFUA 4U8YA 4TYBA 2DB1A 2A2DA 2GHPA 2CPIA 1QLNA 5AE2A 3EX7B 1SC3B 4NCBA 2VB6A 2KI2A 2MLYA 4TLQA 4RLEA 2ZJPQ 3PCOB 5CAAA 4DR7J 2BQ3A 3PZPA 1VK3A 1LKZA 1IKXA 2VASA 2VFUA 5KG5A 4IR1A 3H40A 2EVZA 2Y0BB 1WOPA 3N0VA 4C7QA 2HQDA 2CNLB 1U02A 1U4BA 2PC6A 1XEZA 1FEEA 1R8HA 4P72A 4OZNA 1FKPA 1FJGJ 1XN9A 2DRDA 5EHHA 4C11A 2JDJA 3CC2S 2ALZA 3TZWA 1FEHA 2EFGA 4GVBA 2YNGB 1U6FA 4RR5A 5CH7B 2P2CB 5CCMA 1UAWA 2MQNA 4ED5A 4ZLNA 1JLGB 2ZNYA 1WDDA 1TVRA 2N4CA 5JUMA 1DQ9A 4F4ZA 4JI2J 4U7CA 4ERDA 4WIIA 1SH3A 1NHUA 4I2PA 2V8HA 2KKHA 3EE3A 4M5MA 3EVMA 5IT4A 2IRYA 2PA8D 4Q45A 1KN6A 3PHTA 1H98A 2CQPA 1IN0A 1IWAA 5IM0B 2QZ8A 4CI0B 3RW6A 2C3UA 2FB0A 2QMUB 2VIHA 2XGQA 3DLEB 5KFEA 2KZZA 3PTWA 4PXCA 1KR4A 1O51A 4ZPAA 3SV3A 2W25A 1DHMA 2QMWA 2EXUA 1O0PA 3M6VA 2ROEA 4C3LA 5C42B 2Q66A 1IBMF 1OPIA 2DJWA 4ECUA 4WFBQ 5EGYA 4ELUA 3CCLS 2GJIA 5ETTA 4E2FB 2LQ8A 1GXTA 1U1NA 4KQZA 3JSRA 2BJ3A 3T5HA 5A2QY 5D4LA 2WOMB 1VI7A 4TN2A 4KBIA 4NLOA 1E6VB 4J9NA 3G71S 4F0KA 2WW8A 1M1KT 1HI8A 3EPGA 1RT2B 1X5OA 4DR2F 4KYZA 3EXCX 2HSEB 2B9XA 2FD2A 1S1XB 2NYHA 4G1PA 1RZMA 4PQUB 1LW2A 2N82B 4ZOSA 3V4IB 2I6WA 4O44B 4QCLA 1S1WA 9RUBA 1Z2LA 3OSPA 1NSKL 3D6MB 5RUBA 3T3FA 3JQJA 4PXEA 2MZ1A 4EI2A 4EZ9A 2KJVA 4DFMA 2GJFA 3IR7B 2Y1JA 4C8LA 3CULA 3BYRA 4ZA1A 2W4PA 4NRTA 2YKAA 3R3TA 2QFJA 3KXDA 1NBEB 3WDOA 2HS0A 3MFHA 4A8MP 1XR7A 2FHJA 3HKWA 4QIEA 1MN7A 2Z2MA 1WI8A 1SC4B 3FMWA 4NL5A 4Q8EA 3LTOA 1M1GA 1NPKA 1ZAXA 1VMBA 3VZHA 5A6WA 2BW7A 4ZKAA 3AOCA 2HEKA 4E98A 2AJFE 1JLFB 3ISNC 3HVAA 3NOGA 5FDLB 3CJRA 1SV5A 4AFFA 2FVSA 3ZXWA 2ILZA 2VUGA 1HWIA 3MUVP 4RW9A 3D68A 1Z2ZA 3IR5B 4Q2LA 3GTYX 2Y3YA 3WBZA 5KFJA 1MMLA 1IKYA 4QJVA 4QPTA 1NJWA 2HNZB 4KV8B 4J5OA 1Y3JA 1HHTP 1KSPA 1CBKA 3MCSA 1QTMA 1B70B 4DQRA 3TZYA 3KFWX 5GADI 1PBAA 2DIVA 3HHLB 4F2SA 4ES3A 2DKOB 4MKBA 1K0TA 3M8WA 5C25B 4CDIA 2VKZG 1N4LA 4E0DA 4OX9F 2Q1LA 3WC0A 4X62J 1S1VA 4J90A 3D66A 3M32B 4JI3F 1FNXH 1ZZFA 5B09A 4GMKA 2VICA 5HATA 1RHKB 1XQIA 4DFKA 3H2LA 3A3NB 1EETB 4EEYA 5DS7A 3DRSB 3FZ2A 1GX5A 3C6TA 2VBXA 3ET6B 3CPWR 2XHCA 2VBWA 4ID5A 3IWLA 4WE1B 4ED3A 4B3MJ 3V4MA 2MSTA 3CCVS 2AYMA 5CQGA 4AD6A 3L7UA 1NB7A 3GB0A 1NRKA
chains in the Genus database with same CATH topology
3J80U 5A2QU 4AQYJ 4LF4J 4X65J 4GKKJ 1XNRJ 2MEWA 2VQEJ 2UXDJ 2MTLA 4OX9J 4JI0J 2UU9J 3W1YC 3IMQJ 2F4VJ 4LF6J 4DV3J 4JI3J 4DV0J 4YHHJ 4JV5J 4DR6J 4JYAJ 4PWWA 1I94J 4JI4J 4DR4J 4B3SJ 4B3TJ 4DR2J 3R2DJ 4DV2J 4X66J 1N36J 5IT9U 1IBKJ 3R2CJ 5LMNJ 3D3BJ 5IWAJ 1XMOJ 2KVQE 2UUCJ 1HNWJ 4DR1J 4DV1J 5AJ3J 4DV6J 2UUAJ 4LF7J 2HHHJ 4NEYA 4DR5J 4X62J 4V1Ak 4HHUA 4DR3J 4JI2J 1IBLJ 4JI7J 1XMQJ 4DV4J 5LMUJ 1IBMJ 2VQFJ 4LF8J 4DR7J 4DV5J 4GKJJ 3JAMU 2ZM6J 4JI6J 3T1YJ 1HNXJ 2MQ8A 4B3RJ 4KYZA 2UXBJ 4DUZJ 5FLXU 2UUBJ 3J81U 2KL8A 1XNQJ 4JI1J 5BR8J 4LF9J 4DV7J 4JI5J 4DUYJ 1J5EJ 3OTOJ 4NXNJ 4JI8J 4K0KJ 1N34J 4LFCJ 3D3CJ 1HR0J 5LM7E 3T1HJ 1N32J 4KY3A 4NXMJ 4YY3J 4B3MJ 1HNZJ 2UXCJ 4LFAJ 4RJVA 4X64J 4LF5J 4NEZA 1N33J 2E5LJ 1FJGJ 4LFBJ 4KHPJ 3J7AN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 U;  5A2Q U;  4AQY J;  4LF4 J;  4X65 J;  4GKK J;  1XNR J;  2MEW A;  2VQE J;  2UXD J;  2MTL A;  4OX9 J;  4JI0 J;  2UU9 J;  3W1Y C;  3IMQ J;  2F4V J;  4LF6 J;  4DV3 J;  4JI3 J;  4DV0 J;  4YHH J;  4JV5 J;  4DR6 J;  4JYA J;  4PWW A;  1I94 J;  4JI4 J;  4DR4 J;  4B3S J;  4B3T J;  4DR2 J;  3R2D J;  4DV2 J;  4X66 J;  1N36 J;  5IT9 U;  1IBK J;  3R2C J;  5LMN J;  3D3B J;  5IWA J;  1XMO J;  2KVQ E;  2UUC J;  1HNW J;  4DR1 J;  4DV1 J;  5AJ3 J;  4DV6 J;  2UUA J;  4LF7 J;  2HHH J;  4NEY A;  4DR5 J;  4X62 J;  4V1A k;  4HHU A;  4DR3 J;  4JI2 J;  1IBL J;  4JI7 J;  1XMQ J;  4DV4 J;  5LMU J;  1IBM J;  2VQF J;  4LF8 J;  4DR7 J;  4DV5 J;  4GKJ J;  3JAM U;  2ZM6 J;  4JI6 J;  3T1Y J;  1HNX J;  2MQ8 A;  4B3R J;  4KYZ A;  2UXB J;  4DUZ J;  5FLX U;  2UUB J;  3J81 U;  2KL8 A;  1XNQ J;  4JI1 J;  5BR8 J;  4LF9 J;  4DV7 J;  4JI5 J;  4DUY J;  1J5E J;  3OTO J;  4NXN J;  4JI8 J;  4K0K J;  1N34 J;  4LFC J;  3D3C J;  1HR0 J;  5LM7 E;  3T1H J;  1N32 J;  4KY3 A;  4NXM J;  4YY3 J;  4B3M J;  1HNZ J;  2UXC J;  4LFA J;  4RJV A;  4X64 J;  4LF5 J;  4NEZ A;  1N33 J;  2E5L J;  1FJG J;  4LFB J;  4KHP J;  3J7A N; 
#chains in the Genus database with same CATH topology
 1LFP A;  2EFN A;  1R0A A;  5KFF A;  2A18 A;  4JI5 F;  2P6S A;  2H3E B;  1QY7 A;  1ZPV A;  4C3M A;  4R25 A;  3BM7 A;  2VQE J;  2UUW A;  2MTL A;  2RU9 A;  3PNI A;  2DEJ A;  3PM9 A;  4KHM A;  5HRO A;  1U1K A;  4EGL A;  4N47 A;  3CCQ S;  2AHO B;  4CLK A;  2HFO A;  4QR0 A;  3GV7 B;  2ZH1 A;  2OPP B;  4Y34 A;  4K2J A;  2ZKT A;  2UUC J;  1F9E B;  3LAM A;  2O67 A;  3C19 A;  1LW0 A;  1FRL A;  2D69 A;  2HVI A;  4DV3 F;  4JI7 J;  3PX0 A;  4J9P A;  4MYU A;  2HFZ A;  3DOM B;  1VRU A;  1OSC A;  3PRD A;  4G1Q A;  1I1G A;  4DJB A;  1NKB A;  2HND B;  2J0W A;  4OYP A;  3KYL A;  1GTH A;  1YVF A;  1VFJ A;  3KK2 B;  4TY8 A;  1V5V A;  3BEG B;  5F9L A;  2W2N P;  2D9P A;  5GAE U;  4UOH A;  3M8Q B;  1R8A A;  2XO7 A;  2AYG A;  5SUH A;  3O5T B;  1WEZ A;  1S1U B;  4IOB A;  1FTR A;  1HW9 A;  1M5H A;  2V8P A;  2ZOG A;  4Q0B B;  2J9D E;  4MFB B;  1RT5 A;  1RAF B;  1GH8 A;  1Y7P A;  3DOL A;  1XJW B;  2DNQ A;  1U49 A;  4LFB F;  1DTQ A;  3QO9 A;  4P74 A;  3QGP A;  2KH9 A;  2GO9 A;  2KB2 A;  3NGR A;  1FKO A;  2KXN B;  4QWD A;  1EAY C;  1ZA2 B;  3KK3 A;  4KGV B;  3MM7 A;  2HQF A;  4NWB A;  4LSL B;  2EBE A;  4HEA 9;  3UDC A;  3H42 A;  1L5U A;  2NPI A;  4HT7 A;  1NSA A;  4H4M A;  1N6Q B;  2J9C A;  2UVV A;  5HVH A;  1OSD A;  2HBY B;  4OZ5 A;  5J1E A;  2NXE A;  4R5P A;  4HKQ A;  4AXI A;  2RD5 C;  4IYQ A;  5CYM A;  1BQN A;  3LP0 A;  2CAD A;  3BGR A;  3CT9 A;  3KLI A;  3KHR A;  1H72 C;  2OD4 A;  3MMB A;  5C24 A;  4X64 J;  1ZA1 B;  1RWW B;  2VBZ A;  4QWA A;  5J2N B;  5C2G A;  1Q82 T;  1OIA A;  5J2Q B;  3UWT A;  1B99 A;  5GMK a;  4YFU A;  2AMC B;  2DNH A;  5ETN A;  5EWF A;  2WVF A;  4WIQ A;  3M6W A;  2Y1R I;  2G1D A;  1APS A;  2DO0 A;  4PXB A;  5J2M A;  3CMQ A;  4N8N A;  1YQH A;  2ZOF A;  5CXT A;  4JV2 A;  4UOG A;  2UXD F;  1HWJ A;  1WKJ A;  3B4M A;  5KFZ A;  3JSM B;  1PGZ A;  2PO4 A;  1WC0 A;  4HHU A;  2UXC F;  4DV4 J;  1REG X;  1C0U A;  3PR5 B;  2YH0 A;  4NYP A;  3M6U A;  2V2Z A;  4WWS A;  4ZPV R;  2OPQ A;  2L08 A;  3EGW B;  3I0S B;  3ZFV A;  5E3A A;  4X4P A;  2XCP A;  2VBY A;  2DGO A;  3F41 A;  2KYZ A;  2GMH A;  4OYZ A;  4OL8 A;  1Z1Z A;  1A6L A;  2JEI A;  2R7R A;  2FHK A;  2RIL A;  1TKX B;  5F41 A;  2XY6 A;  1R8C A;  3PV8 A;  2AP6 A;  1UEU A;  2D3O R;  4EWT A;  3AD9 C;  1OS5 A;  1WHV A;  4NI2 A;  2BRL A;  1U24 A;  3C3L A;  3I5B A;  1TQL A;  5KG1 A;  4OYB A;  4K50 A;  3LUY A;  2GVZ A;  3C15 B;  2PSZ A;  1BQM A;  5GAG U;  1S6P A;  3HDS A;  4MKA A;  3RAQ A;  1HNI B;  4LFA F;  3R5D A;  4QOT A;  1EAR A;  1T9V A;  1C1C B;  2JH3 A;  1QM9 A;  1YLX A;  4AE5 A;  2WCX A;  3H5U A;  4KJI A;  4OFZ A;  3Q8Q B;  2VJU A;  2I5J B;  3MEE B;  3TAQ A;  1LXJ A;  3NWG A;  1IXK A;  1IBM J;  5IT0 A;  4NML A;  4ZIV A;  4TKT A;  2CYY A;  1YJT A;  1LOU A;  1RJJ A;  4D3H A;  2UUB J;  2UP1 A;  2QL5 B;  4C8Y A;  5KT2 A;  3MZI A;  1ZAW A;  3PEH A;  3D3C J;  1RA7 A;  4WK1 A;  4QYZ K;  1EIY B;  4RU9 A;  2GML A;  1P1L A;  5KFA A;  4FPI A;  3TW0 A;  1U09 A;  1YZ7 A;  2DNP A;  2JWN A;  1DZ5 A;  3GJS B;  4URQ U;  3NNC A;  2LVW A;  3DM2 A;  3HO1 A;  2QL7 B;  2GHW A;  2V68 A;  2HNY B;  2D3O 1;  3VAM A;  4XTT A;  5K14 B;  1WC5 A;  4ATN A;  1L3V A;  3W1Y C;  3IMQ J;  2MKH A;  1RAC B;  2JX2 A;  2ZE2 B;  1XER A;  1IVZ A;  4ZCL A;  2BE7 D;  4TQS A;  1WG4 A;  4ZP6 A;  4YOE A;  1K1S A;  2GNK A;  2ZHO A;  3W9I A;  1FK9 B;  2OML A;  4F50 A;  2ERR A;  2NSC A;  4EMD A;  3OJU A;  3K17 A;  1VHF A;  1VBX A;  4KT0 C;  4JYA F;  2E5L F;  5A6P A;  1NSP A;  4KSE B;  2Q43 A;  3GP9 A;  2HVE A;  3BQ1 A;  4QIW D;  4UZC A;  2DR8 A;  2UXB J;  2BE2 B;  2I1R A;  4RNF A;  4IRK A;  4IG3 B;  2BE9 B;  2FLP A;  2K2P A;  1BHN A;  2YPY A;  2XLK A;  4UQG A;  4EYI B;  3HHK A;  2W8L A;  4ED4 A;  1HPZ A;  3QAT A;  5DJB A;  2DGW A;  4WP3 A;  4UOC A;  8ATC B;  2XGP A;  1WC6 A;  2FJB B;  2V34 A;  5ADZ A;  3CCS S;  1UJ4 A;  1UCN A;  1TU0 B;  3N9U C;  3TVZ A;  5MLC V;  3IBC B;  2FGC A;  1KQF B;  2HRU A;  2V9W A;  1VQK S;  2CNK B;  1SBR A;  3R27 A;  1M5P C;  4OYO A;  6AT1 B;  4NLY A;  2K3K A;  2QLF B;  4LIW A;  1VQ8 S;  4HTI A;  3OVB A;  3O8W A;  2VL1 A;  5K5M A;  2XMT A;  2WAQ D;  5I3U A;  2QT7 A;  4NLW A;  4ANE A;  4YHH J;  1F2G A;  2AYE A;  2Z56 B;  3KNG A;  5LSR A;  5DM6 Q;  3I56 S;  3TUJ C;  2AD9 A;  1LK5 A;  2DNL A;  3WIV A;  2ACY A;  4OYX A;  1HQE A;  2M7S A;  3M1V B;  3HHN B;  2DGT A;  3W2W B;  2WVE A;  2XCA A;  2BXJ A;  3QJL A;  1WAC A;  3M8P A;  2HLU A;  1HW8 A;  3OQ2 A;  1WF2 A;  3DC2 A;  1QVF R;  2MQ8 A;  1YJW S;  5FII A;  8AT1 B;  4RW4 B;  1T3O A;  2XSJ A;  2B7B B;  3CB4 A;  2F5G A;  3A3O B;  5IFM A;  3VAI A;  2AJ1 A;  3GG0 A;  3A13 A;  4YB7 A;  1S6Q B;  1SQE A;  2CG4 A;  1HA1 A;  2P9C A;  4F02 A;  2MZS A;  2WON A;  1DRZ A;  1RT4 A;  4U67 Q;  5H9F K;  3MD1 A;  3RB6 A;  2GIR A;  3ILI A;  2R2U A;  3P49 B;  4I2Q B;  3KHL A;  4ICL B;  1ZM4 A;  2B9E A;  1KC8 T;  1UVL A;  3DYA A;  1GEH A;  2EKN A;  2IBO A;  2P8I A;  3QZ8 A;  2OO4 A;  4Q43 A;  5BJR A;  4FYY B;  2DHX A;  1Q95 G;  3DRP B;  1FWK A;  4H54 A;  3A8K A;  3SSQ A;  2FC9 A;  2BDP A;  1X8D A;  2O1P A;  4CLP A;  4NEY A;  4F4X A;  2RAQ A;  4J9R A;  2HYI B;  2DGS A;  2YWK A;  5D15 A;  2WHO A;  1JLB A;  3JQM A;  1RXO B;  2J0X A;  1P9Q C;  3C46 A;  2YPZ A;  1M1H A;  2X1B A;  3VR1 A;  1UEV A;  1EP4 A;  3UDL A;  1J5E J;  3PXG a;  2BQU A;  1N54 B;  3PO5 A;  2JSX A;  2K1R B;  3TRG A;  3TA1 A;  2JNJ A;  5KFY A;  3BN4 A;  1XWL A;  4NLX A;  4LRF A;  1S4F A;  3LW5 C;  1VQ5 S;  4WF9 Q;  2DR9 A;  1HLW A;  1FXR A;  1JLQ B;  2AJ2 A;  3G96 A;  1HHS A;  1YJV A;  2QA4 S;  2DO4 A;  4G3I A;  4HHH A;  4HLB A;  2VU5 A;  2DGX A;  1PSD A;  2RRN A;  1XNR J;  4R8U A;  1IKV A;  4Z7C A;  5F8J A;  2V67 A;  1S79 A;  1RAI B;  2EI5 A;  1YGY A;  1N32 F;  2IRX A;  3MUT P;  1DLO B;  1NK9 A;  1X4E A;  3DLL Q;  5JJB A;  4ILR A;  1FHT A;  4YB5 A;  1GQE A;  1NHV A;  4IFV A;  4R0E A;  1U0H B;  4ZVP B;  2BM0 A;  1LWC B;  1JJC B;  3EZU A;  3H5Y A;  3H8Y A;  3D0I E;  1QTN B;  1TMJ A;  5I42 B;  3IRX B;  4WJB A;  1KD1 T;  4GVL A;  2XMV A;  1AUS L;  3TA2 A;  3JAM U;  3NLC A;  5KFT A;  5ETQ A;  4CLW A;  4DR1 F;  1SC1 B;  3CCE S;  2HHS A;  1Q8I A;  2RS8 A;  3M9M B;  3MEC B;  2BW2 A;  3RRG A;  4F3M A;  1WOR A;  1RA6 A;  1YBT A;  1XMQ F;  1ELO A;  4C9D A;  4LF8 F;  3O6Q A;  3QRR A;  3HXM A;  5HL7 Q;  4XPE A;  4ZLL A;  3OV7 A;  1FTC A;  2YWW A;  1SKW A;  1U8W A;  2D41 A;  3BR9 A;  3QT6 A;  1B64 A;  4O3O A;  3BQ2 A;  4ZVQ B;  5H9E K;  3UD3 P;  2QSF A;  3J7Y U;  1JIH A;  1LWF A;  2KXF A;  4USJ C;  3UD4 P;  2ZHB A;  1C0T B;  9ATC B;  3CIZ A;  2WTF A;  4RL1 A;  2BRK A;  4NYO A;  1CG2 A;  1YX2 A;  3IM8 A;  1IKY B;  2R7W A;  4PCQ A;  2VFS A;  2DHG A;  1KOO A;  4FXV A;  3CCJ S;  3GJT B;  3MM6 A;  4TLR A;  1NAQ A;  4ZVG A;  1X4G A;  1AZS A;  1MMD A;  2IYI A;  1QJH A;  5AJ3 F;  1MU2 B;  4DX8 H;  5JVH Q;  2MQO A;  4TQR A;  3PKM A;  2UXC J;  2XI2 A;  3T1Y F;  2VG6 A;  1S49 A;  2EBG A;  5KTQ A;  4CCH A;  1G7C B;  1MN9 A;  2IC3 A;  3Q89 A;  1RTI A;  3AFG A;  3MR2 A;  4UY8 5;  4NYZ A;  4B3O B;  3MOJ B;  1TEL A;  4LF2 A;  4DF8 A;  2AT1 B;  5E3P A;  2KRR A;  2N3O A;  2MPU A;  4CLU A;  3T6J A;  3HUL A;  3K5M A;  4X66 J;  2ZJR Q;  1CUL B;  5AE1 A;  2ZC3 A;  2DPJ A;  3UN5 A;  1ZBT A;  3GON A;  5IC6 B;  1I51 B;  1TK5 A;  1AFJ A;  1KVJ A;  2BJE A;  2PT0 A;  3IS9 A;  3BPS P;  1JX4 A;  1IR1 A;  3K5O A;  3L9Z A;  5MAO A;  1R27 B;  2KT2 A;  3W2V A;  4HI2 A;  1R0A B;  4LBH A;  1WHX A;  5KFQ A;  1W2I A;  1QSY A;  4P2X A;  5HN0 A;  1T9U A;  3KUH A;  4XDC A;  2PMW A;  5HRO B;  2WBR A;  4ZPC A;  2QMX A;  4C97 A;  3V81 B;  3CGI A;  4RW8 B;  3K57 A;  2YH1 A;  4B3S F;  2L3M A;  3KTQ A;  3RJM B;  1U7L A;  3JB9 k;  4ED1 A;  2DXD A;  4C8N A;  2RE1 A;  5A0Y A;  5AXN A;  4RW7 B;  4LF4 J;  3AB2 B;  4PAA A;  1RT7 B;  1I3O B;  2CZ4 A;  2DIT A;  3UVJ B;  1YTY A;  5A8R A;  5J2P A;  2W9A A;  2W7A A;  4I6Y A;  3NMR A;  4G1Q B;  1C4A A;  3BKU A;  1YJ9 S;  4JI4 J;  3VGU A;  4TU9 A;  1FE0 A;  1OPZ A;  8RUC A;  3AOD A;  5GME A;  1KKH A;  3QLH A;  2MJN A;  2P6T A;  2DY1 A;  3RRH A;  2FJV A;  1OO0 B;  2XYP B;  1GAO A;  4M5J A;  1BWV A;  4YEA A;  4DS5 A;  2QA4 G;  1N0U A;  1RWU A;  2YKM B;  4LQ9 A;  4ECZ A;  2HHP A;  3DXS X;  4OLO A;  2ZDP A;  1UZD A;  4ZLP A;  2MZJ A;  3JSY A;  1D09 B;  3DOL B;  4DL5 A;  1TL3 B;  3MTJ A;  2V8D A;  1DTQ B;  3H98 A;  3DRR A;  3NG8 A;  3D6T B;  3M05 A;  2AJ4 A;  5ETL A;  2E5L J;  4FP9 A;  2HBQ B;  3FK4 A;  1SH2 A;  2M8D B;  4GKK J;  3OTD A;  5D4N A;  3SQG A;  1Y5I B;  2V0N A;  3W8P A;  2F63 A;  3M9N B;  2XMU A;  2AYB A;  4GRS A;  1SKS A;  5HJY A;  2XNQ A;  2UU9 J;  4IUF A;  4GKJ F;  4IO1 A;  1LXN A;  3QGH A;  2R7V A;  1NK5 A;  5JMN A;  5LJ3 Y;  3UI3 A;  1H7W A;  4H4M B;  5CHC B;  1Y10 A;  5J1E B;  4R5P B;  1S99 A;  1S9E B;  3K8W A;  3OHA A;  4W4M A;  1IUJ A;  3Q8Y A;  1BQN B;  1RTJ B;  2OD6 A;  2YNI A;  1PYS B;  4I56 A;  2RHS B;  1MRO A;  3OLB A;  2HFN A;  1RT3 B;  3I4H X;  4ECR A;  1SXL A;  3H59 A;  3N79 A;  4DN9 A;  2COL A;  3NS7 B;  2GHV C;  3TQ1 A;  3W7B A;  1NJI T;  2B43 A;  4PRF A;  3FMB A;  1N52 B;  3QID A;  4ELT A;  3TZZ A;  5C7P A;  4LF9 J;  2GAH C;  2YX7 A;  2K7K A;  2KG1 A;  4OI3 A;  3H7H B;  4OI0 A;  1HR0 J;  2H5J B;  3M6X A;  2HS4 A;  4KO0 B;  3RR7 A;  3N6N A;  4QYZ J;  3R5J B;  2OPR A;  2XMM A;  4O4G A;  4DFP A;  1U1Q A;  5D0H A;  4U8V A;  1N5Y B;  4KHP J;  1GTE A;  3DGV A;  3DLK B;  1RWN B;  4JI0 J;  1C0U B;  2VOO A;  3QMQ A;  7FD1 A;  1T05 B;  1JLA A;  3OTC A;  1SIW B;  4X4R A;  3RG6 A;  5KFX A;  1TR0 A;  1RU2 A;  3AA8 A;  3AQP A;  1HYS B;  2G2Y A;  4EU0 A;  1EHW A;  4ZVS B;  1D3W A;  1RAO A;  2JEJ A;  4AL6 A;  2OEL A;  4PG7 A;  5HBM B;  1HBU B;  2XWY A;  3Q23 A;  4WFA Q;  1YJ7 A;  3BH7 B;  3OTB A;  4C2M A;  4NA1 A;  4F4Y A;  3P8B B;  1VRT B;  1YZ6 A;  1X4A A;  3IO1 A;  4B3T F;  2FHO B;  2A2C A;  1HNX J;  4OHZ A;  2IJR A;  3G6X A;  1XMO F;  4IQM A;  3R5A A;  1BQM B;  2MKJ A;  4FF4 A;  5BR8 J;  1DAR A;  2I8E A;  4KHR A;  3QAU A;  3NCP A;  3N4W A;  1FD8 A;  4CLY A;  1MG7 A;  3UO0 A;  3UR3 C;  3CD6 S;  1N36 F;  2OLW A;  1QAI A;  1S10 A;  4NRU A;  2BJD A;  3NMA A;  1UFK A;  2ZBI A;  2FZG B;  4I68 A;  3FUY A;  7FDR A;  1X31 C;  4EZ6 A;  5DRK A;  1U6B A;  5E33 A;  4K7Q A;  3G6E S;  3T1A A;  3CCT A;  4ZK7 M;  2YNG A;  4ECV A;  2JFD A;  2JLG A;  5D3G B;  4L73 A;  4WKY A;  2EKY A;  1UVJ A;  1PBU A;  4X2B A;  2H51 B;  1RWP B;  1JLG A;  3K5N A;  2ALY B;  4WCE Q;  4DR3 J;  2C3M A;  2C2D A;  2ZKU A;  2VFV A;  4DLG A;  3VGV A;  1SIZ A;  2RQK A;  3TQE A;  3UPF A;  1B7F A;  4KIA A;  1RKJ A;  2IA6 A;  3O2I A;  3HF5 A;  3ISZ A;  2N4D A;  2PDA A;  2FVQ A;  3LAK A;  4OZ3 A;  4USU A;  2ZH7 A;  3AAW B;  2IM0 A;  4ELV A;  4NXM J;  3K2Y A;  3RAM A;  5IM0 A;  1WC1 A;  4YB1 P;  3THV A;  4LF7 F;  4LRB A;  3OTO F;  1NKC A;  1HBM B;  5H9F J;  3DLE A;  4DWI A;  3ZTP A;  3TAR A;  4L6V 3;  1RHM B;  4N5S A;  2JLF A;  1S0O A;  3OR2 A;  1H74 A;  1YKW A;  5AXK A;  4N76 A;  4BC7 A;  1S1T B;  2OFH X;  4RNH A;  4IOA Q;  2OIH A;  2YKN B;  4RBU A;  4Z2X A;  1YIJ S;  2HFU A;  3I0R B;  4ES1 A;  3CJ5 A;  2IMW P;  2JFK A;  2RRA A;  3FJ2 A;  5D8H B;  3EZ5 A;  4PPZ A;  5D4P A;  2C2O B;  2UV8 G;  1E6V A;  5EDW A;  1VJQ A;  4UQT A;  3BJY A;  2J7K A;  2MKI A;  4DV6 F;  3DNC A;  4DV0 F;  2QLJ B;  1RT2 A;  3SDE B;  2ZC4 A;  4ENO A;  1VOM A;  3G8Q A;  2E1P A;  2D9O A;  1DBD A;  3I96 A;  3DOK B;  3OL8 A;  3MR3 A;  4WP9 A;  4PQU A;  2HK3 A;  2KT5 A;  3WHI A;  3GMG A;  4QR2 A;  5K8P A;  1VQL S;  1X4D A;  3G82 B;  4OJG A;  3V4I A;  1RBO B;  4O44 A;  4IOC Q;  1MLA A;  4IH5 A;  4RW6 B;  3CED A;  2DR5 A;  2BM1 A;  3D7S B;  5A76 A;  1FWL A;  4P75 A;  5L1I A;  3MPY A;  1IBK J;  2OAU A;  3RUB L;  4C48 A;  2X1F A;  2X51 A;  1A7G E;  3I31 A;  5HSP A;  5L1K A;  3MR7 A;  4Y2K A;  3JXO A;  1GK8 A;  4S0M A;  4DHV A;  2F7V A;  1NXI A;  1GMW D;  5D0E A;  2A6O A;  2E5I A;  4OI4 A;  3VAL A;  5BXI A;  5B08 A;  2DHS A;  1JLF A;  4HH0 A;  3F56 A;  3BDE A;  2CPE A;  5FDL A;  4DR7 F;  2DXE A;  4KGK A;  4LRE A;  2ZVI A;  1SKR A;  1GNK A;  2CQH A;  4ZMM A;  2W2Q P;  5BYR A;  3MEK A;  2HHW A;  4A47 A;  1RTH B;  1T95 A;  1TKZ B;  1F5B A;  3F44 A;  2HNZ A;  5H9E J;  4J91 A;  2LEA A;  1ITP A;  4X4N A;  1JLB B;  2AZ3 A;  4KV8 A;  2V63 A;  2XEX A;  4GC6 A;  1FES A;  1D9F A;  1FJG F;  1T03 A;  2DY9 A;  4RBT A;  4B3S J;  5KFC A;  2PII A;  4WTY A;  4FZV A;  1A0O B;  1CJV B;  1RYR A;  3E01 B;  4K4X A;  2CJX B;  3BH6 B;  2EFV A;  5C25 A;  2J5A A;  2VA2 A;  1HWK A;  5FLX U;  1IKV B;  3M32 A;  3VCD A;  4FF3 A;  2OMO A;  1NLK L;  4UW2 A;  3QSI A;  3WX8 A;  4FYD A;  1SJ3 P;  4XDD A;  3MPW A;  1BWE A;  5M2U A;  4PQA A;  4WFZ A;  3KMQ A;  2BBE A;  1JNR B;  4OV1 A;  1VYA A;  5KT7 A;  3ILJ A;  3NY0 A;  3KJN B;  3ET6 A;  3N28 A;  4WE1 A;  3NGU A;  4DCO B;  4AL5 A;  3PFO A;  4B9S A;  2YXL A;  5KT4 A;  1C4C A;  1GXL A;  2PE8 A;  2ZUA A;  2HVZ A;  4NLT A;  3PKY A;  5E7O B;  1NJY A;  2QL9 B;  3G8T A;  2QLB B;  3KLE B;  2P9G A;  3HFK A;  2EG1 A;  2G2Z A;  4DR5 J;  1G3O A;  2OPP A;  3HFV A;  2FZK B;  4GKJ J;  4O4R A;  5JVG Q;  3RR8 A;  2IVY A;  2MQM A;  2W2P P;  2HAF A;  1YHQ S;  2FLN A;  1T02 A;  1VHI A;  4EUV A;  3T1H J;  4PKD B;  5CA5 A;  2CJA A;  2CQB A;  2R2S A;  2HND A;  1T9W A;  3NS5 A;  5ETK A;  4M5D B;  2ZZM A;  1N33 J;  1YIT S;  2WSC C;  2QC3 A;  4KB7 A;  1S57 A;  2JZ5 A;  1YBU A;  3Q2T C;  4LF6 J;  4GO7 X;  1K47 A;  3NS6 A;  2JHE A;  3JAM Y;  5DG9 A;  1KOH A;  1I94 J;  1S1U A;  2YNF A;  1PYT A;  3MDF A;  1NKE A;  4Q0B A;  4MFB A;  5D78 A;  3CDA A;  2WK4 A;  4F4W A;  2CQD A;  2XS7 A;  3NEK A;  5HMX A;  2RSQ A;  3E3X A;  2Y8W A;  4Q2M A;  2DNY A;  4DL7 A;  5FJ4 A;  1M0S A;  3RBD A;  5B0B A;  3VZI A;  1H2U X;  2Z0G A;  4ZIW A;  3EPI A;  3VAH A;  2KO1 A;  3FNN A;  2LEB A;  2ZH9 A;  3FCH A;  5FD1 A;  5T14 A;  3FQL A;  5HVF A;  4LSL A;  3ITH A;  4DQP A;  1F3V A;  3AB4 B;  2HK2 A;  3BSO A;  3QYY A;  4J9Q A;  1WEL A;  4QU7 A;  3MM5 B;  3KUG A;  3JYT B;  3GIL A;  4JP8 A;  2R42 A;  3M30 B;  1CSJ A;  4Q5V A;  2FJE B;  3SSS A;  4AL7 A;  5EWE A;  4DBQ A;  1F9H A;  3IGN A;  2HQI A;  3B6B A;  3K5L A;  5J2N A;  2VPW B;  3RBX A;  2RH3 A;  3ICL A;  2ACM A;  5J2Q A;  4OMF G;  3D1Q A;  1NJX A;  3TR5 A;  5KT6 A;  1N36 J;  3DMJ A;  3BF4 A;  4F8R A;  5KFN A;  3KLH B;  3U1M A;  4ZVF A;  4NLP A;  3N01 A;  1KHV A;  1PKU A;  3JSM A;  1N5T A;  1NEE A;  4X4U A;  1GFW B;  4JI6 J;  1S76 D;  5HJX A;  5ETM A;  2EG2 A;  1EKR A;  3GSD A;  1U1P A;  1KEK A;  1X4F A;  4ETZ A;  2CQC A;  2E1M C;  5J2P B;  1GX6 A;  2LYV A;  4X62 F;  1Y3K A;  1L3S A;  4YDD B;  3I0S A;  2ZVS A;  1X4B A;  4ZN3 A;  2E9Z A;  5E0O A;  1G1X A;  3MCO A;  4Y3C A;  1TUV A;  4LF5 J;  1VC5 A;  1TKX A;  2F40 A;  3H4D A;  1OY8 A;  5EUH A;  2YWE A;  2B4U A;  2HMI A;  1UL3 A;  4C8K A;  2JVO A;  1X9S A;  4QPX A;  4I0W A;  3DHX A;  2LA4 A;  2Y1I A;  4KC5 A;  3JS9 A;  2GVD B;  4ZVE A;  4O3P A;  3R2C J;  4JBC A;  4O3N A;  3GU0 A;  2VQE F;  2F8E X;  3ZNU A;  2HLT A;  2UUA J;  4LF7 J;  1LK7 A;  2POK A;  4NZ0 A;  2BKP A;  1C1C A;  1FA0 A;  3ZZP A;  3AT1 B;  5KOW A;  5DDR C;  4RNO A;  3EVW A;  4ED6 A;  3MEE A;  3V6D B;  3HHL D;  3CJ3 A;  2J8S A;  4USM A;  1FRI A;  5GAH I;  3ADA C;  2UUC F;  3SSR A;  3AXK A;  5HO4 A;  3KLV A;  3DRX A;  4B9M A;  2BOA A;  4H4K C;  1RYS A;  3HKZ D;  1WEX A;  1N48 A;  4ECQ A;  2L41 A;  3OFF A;  3EJM A;  5HMW A;  4I7F B;  2YNI B;  3H90 A;  4CM2 A;  2G4B A;  2XLJ A;  1PCA A;  4DX5 A;  1DQA A;  3S8S A;  1Q8K A;  4DV0 J;  3TP2 A;  2IMO A;  3MMC B;  4FBU A;  4O3Q A;  4WTO B;  5KFG A;  3AJ1 A;  5K14 A;  1X4H A;  4DV2 J;  1P8G A;  3ENA A;  3D3B J;  5C2C A;  3TOQ A;  3NNA A;  2ZE2 A;  3NKY A;  1S9G B;  3CC4 S;  2HZC A;  4YDX A;  2HKE A;  1NK6 A;  3B82 A;  1FK9 A;  3MEG B;  1YWX A;  4N56 A;  3H5S A;  4IDK B;  2ZEJ A;  3J81 U;  1TL5 A;  1H6K X;  4DCP B;  3MOZ A;  3PX6 A;  2GQ2 A;  3RTV A;  2GA7 A;  1X9M A;  4WP8 A;  4RU2 A;  2BE2 A;  4K4Y A;  3GG1 A;  5CCL A;  4IG3 A;  1UVI A;  3E51 A;  4ZS6 A;  1VR6 A;  3V6K A;  3WQP A;  2R8H A;  4ZP9 A;  3KHH A;  4OJH A;  1SC6 A;  2UVR A;  4OZJ A;  5D0G A;  2H4Y B;  4ID8 A;  2YQ3 A;  1NK4 A;  1C1B B;  1BY9 A;  1C2P A;  3KWM A;  2G0J A;  3CNQ P;  3S1T A;  1BE4 A;  2DBB A;  4X64 F;  3GFH A;  1KQK A;  1VQN S;  4KGM A;  4W90 B;  2CXE A;  5GVQ A;  1UEK A;  2PA3 A;  1RAB B;  1LFW A;  3CXC R;  1FNO A;  3CD5 A;  4JOU A;  1Q8L A;  2OHD A;  3QGG A;  4MK8 A;  2CVE A;  4O23 A;  2EW9 A;  3DU5 A;  3M8Z A;  2M3D A;  3HVT B;  1UA0 A;  3M1V A;  2WSE C;  3W2W A;  4IO9 Q;  1HHQ A;  4DV7 J;  3HMJ G;  4ZVR B;  1FFG B;  2ZIT A;  5D6G A;  4K0K J;  3EZO A;  1NDC A;  4DV4 F;  3V6J A;  1KRP A;  4RW4 A;  1YRX A;  4ETX A;  3TAP A;  3M9O B;  4CO3 A;  3HK2 A;  2Y1L B;  2RUG A;  5DZ6 A;  3FFI B;  1YDL A;  3BBC A;  3QFH A;  1FO1 A;  3N5F A;  2XZT B;  3AXM A;  3GIR A;  1S6Q A;  3CO0 P;  1CJK B;  2FZC B;  3SCI E;  2IAJ B;  4E8U A;  1IQT A;  3AQO A;  1QSL A;  4ED8 A;  3W63 A;  1OQ6 A;  2HHU A;  5DLG A;  4I2Q A;  3POT B;  4JI8 F;  4R0J A;  4WXW A;  3ZZY A;  2XC9 A;  4ICL A;  3N6L A;  2BOP A;  4DPO A;  2C3Y A;  3MAA A;  3PJX A;  1WD6 A;  2L9D A;  3UNG C;  1BXN A;  1FJE B;  3S01 A;  4ZJQ A;  5KFL A;  3BQ0 A;  3QBC A;  3DRP A;  3NBP A;  2AJQ A;  1CC7 A;  3G86 A;  3VGS A;  2W9B B;  3CDW A;  4EO8 A;  2IBK A;  4DUZ J;  2H5E A;  4M94 A;  4ECT A;  2EFO A;  3Q83 A;  3OR2 B;  3BBB A;  3BZQ A;  4CM0 A;  3D4J A;  4QU6 A;  1FRX A;  1X0P A;  4A8O A;  3CCW A;  3CDE A;  1AB8 A;  1F2H A;  1TUG B;  1FKA F;  3B78 A;  2RML A;  4YY3 J;  1SI9 A;  5I3Q A;  4P2S A;  2K1R A;  2UUB F;  1UMJ A;  1HBO A;  5A2Q U;  2XMK A;  1JLQ A;  2X7I A;  4WPA A;  5H1S V;  5F8G A;  2YVS A;  2OTJ S;  3KK1 B;  1YJR A;  2HG4 A;  4HR2 A;  1O8B A;  3OBI A;  3CJS A;  3MMA B;  2RB7 A;  4ZDN A;  4K8R A;  4B17 A;  5KFS A;  1SVD A;  3DCA A;  1DLO A;  2RQM A;  1FJ7 A;  3LAL A;  2ZDO A;  2H48 B;  5M2R A;  5GAD U;  4Y2C A;  4LVO P;  1U0H A;  2LXU A;  1NND A;  1LWC A;  4QQB A;  1M90 T;  1NDP A;  1RWX B;  3BO2 A;  5LXY A;  1Q5Y A;  1U25 A;  4EBC A;  5I42 A;  2ZBR A;  3MD3 A;  3BKF A;  3DRY A;  3IRX A;  1WF0 A;  1AA1 B;  4OI6 A;  4XK8 C;  1U1O A;  1HIY A;  3CC7 S;  3UR0 A;  5SZT A;  2JEG A;  3MI7 X;  4TNO A;  4HHJ A;  1X5S A;  2CWX A;  3MPU B;  2W7O A;  5ITH A;  1Q1K A;  2UXB F;  3MEC A;  2YWF A;  1HQ2 A;  4FNI A;  2F3J A;  4LMZ A;  1IBL F;  1IQZ A;  1MSW D;  2DRA A;  1YRU A;  2CQ1 A;  4JV5 J;  3Q22 A;  1ZZN A;  1HMV B;  2CA9 A;  1FXD A;  2Z4P A;  2B56 A;  2NUH A;  4PXD A;  2ZH8 A;  5F8H A;  2DR7 A;  4KPC A;  1JXV A;  4W92 B;  5LJ5 Y;  1HNW J;  5LSL A;  2YY3 A;  3TJ9 A;  1RBA A;  1WDT A;  2HIQ A;  4CP5 A;  3JTO A;  1VBY A;  5DQI A;  5CZX A;  2L9W A;  4YHH F;  4QWC A;  4CTA B;  1C0T A;  2QE5 A;  2OI2 A;  4HVZ A;  3CMA S;  1RTD B;  3FCW A;  2M4M A;  4CWB A;  2V4Q A;  2XB2 D;  3UCG A;  3M2U A;  2QFI A;  3UW1 A;  2HPU A;  4AUK A;  3GCX P;  3IFE A;  3ULH A;  4PG6 A;  1Q7L B;  2SXL A;  1IKW B;  1T03 B;  4UY8 T;  1MU2 A;  2ZH2 A;  1RE1 B;  4PPD A;  3W64 A;  4DV1 F;  1EB0 A;  3FRY A;  4UTG A;  3SBM A;  4L3K A;  1RT1 B;  3AHP A;  3PRB A;  4WFY A;  5T41 A;  1VJW A;  2ZM6 F;  5D77 A;  4CH1 A;  3LO3 A;  2B5J B;  5EX0 A;  2V2V A;  4B3O A;  4BBY A;  2JL9 A;  4JUZ A;  5LMN J;  3P5B P;  4CO1 A;  1U0S A;  2KVQ E;  1K8A T;  1D8Y A;  3M4X A;  1UWA A;  3QJJ A;  4NLG A;  3EWG A;  2DCU B;  1RAE B;  1M5S A;  1CUL A;  2O5D A;  1VLY A;  3OPK A;  4OYI A;  1PIE A;  4IKA A;  2FTR A;  4MK9 A;  4J9O A;  2W2O P;  2WVC A;  2MY8 A;  2W1B A;  4YR3 A;  3D1O A;  2XQC A;  3DFE A;  5F3Z A;  5D0R A;  3MM8 A;  1NO8 A;  4PG8 A;  1N34 J;  2LXF A;  4CRJ A;  2CPJ A;  3UE2 A;  2E9R X;  3CJ4 A;  3RB3 A;  2B3T B;  1U8S A;  3BSA A;  2N7C A;  3V81 A;  4X65 J;  1YG0 A;  3K5P A;  3C6U A;  4RW8 A;  1J5E F;  1CQM A;  4NZ6 A;  4ZIT A;  1TTH B;  4K4V A;  1J2V A;  2YX1 A;  2AJ0 A;  2D74 B;  2DT9 A;  1UVK A;  2MHE A;  1NH7 A;  3GQC A;  3QT5 A;  5KFR A;  4RW7 A;  1F3F A;  4NA3 A;  2Q3P A;  1RT7 A;  2BJ7 A;  3PAC A;  3UVJ A;  4ES2 A;  2E5G A;  5FLX Y;  3LOU A;  1RLD A;  4OIX A;  3GPA A;  1OQ3 A;  1O6X A;  2QA2 A;  2V4J B;  2GZO A;  5KT5 A;  2KVI A;  1XNR F;  2W4D A;  1UVN A;  2CG8 A;  5EN1 A;  1NPP A;  4DL0 C;  4LF1 A;  3AOA A;  3C16 B;  3MF5 A;  4MK7 A;  3P6Y C;  1KBR A;  3IA0 A;  2KHC A;  1HI0 P;  4U6P A;  2GAG C;  1VQO S;  5DDQ C;  3EVO A;  2C3O A;  4QWB A;  3OVA A;  3GIJ A;  2U1A A;  3VV2 B;  2YNH A;  2IVF B;  1K0V A;  3GJR B;  2YKM A;  4V19 J;  4O3R A;  2YNF B;  1EQM A;  3QPI A;  2PMZ D;  4Y0F A;  1SQG A;  3KG1 A;  1DFD A;  4WXO A;  1NZ8 A;  5BYS A;  1TL3 A;  1HNV B;  2V9K A;  2D7S A;  2FJD B;  5L9X A;  4ZPW R;  4KPY A;  1KWM A;  2KFN A;  3AJD A;  4O0N A;  4DS4 A;  1QAY A;  4QIV A;  2XBP A;  2CPX A;  4IRD A;  5IZH A;  3G2X A;  1Q4R A;  1TUW A;  4KH1 B;  1V6H A;  5U47 A;  2CIM A;  3PW7 A;  3VGT A;  3ITH B;  1Q5V A;  2DD8 S;  2J6S A;  4FXW A;  3OL9 A;  5K8M A;  2K7J A;  4HYK A;  1JLC B;  4UT4 A;  1S9E A;  3DI6 A;  5KFW A;  3VQS A;  2FLL A;  1RTJ A;  3WZ0 A;  1SJF A;  1QVG R;  3TAM B;  2PEB A;  4LSZ B;  1Y11 A;  3ENW A;  2ZNZ A;  4FDF A;  3I5C A;  1RT3 A;  4JI1 J;  3VVU A;  2D3Z A;  2GIF A;  1EJ7 L;  2IM2 A;  3T41 A;  4FVM A;  3CJ0 A;  2BMB A;  4P2F A;  1RKI A;  3EDQ B;  4EK2 A;  3H20 A;  2EK1 A;  3DMJ B;  3QNW B;  4HAC B;  2AGP A;  3G8S A;  3MUR P;  2NSB A;  3L95 X;  1ZM3 A;  1MMN A;  4KO0 A;  4C98 A;  2HGL A;  1ZET A;  1T9T A;  3K89 A;  1QDU B;  1N5Y A;  4EFA C;  2ZOM A;  3DGP A;  1NDL A;  4ZVU B;  2FHJ D;  3SZ2 A;  5J1P A;  2ZH3 A;  3D54 A;  2I9S A;  3L7O A;  3DLK A;  4NCG B;  1NME B;  2VA3 A;  2EFP A;  4YR2 A;  2QGF B;  1T05 A;  3RB4 A;  4TU8 A;  1WOS A;  3U02 A;  1SH0 A;  1FX4 A;  3I9V 9;  2RT3 A;  3TJA A;  1HYS A;  3MXH P;  1CJU B;  3FDS A;  4B9V A;  5IQ6 A;  1EX8 A;  1YK9 A;  2BYC A;  4CT9 A;  4X66 F;  1GT8 A;  4ANC A;  3Q24 A;  4M63 A;  5HBM A;  1HBU A;  1LQ9 A;  2HMI B;  3AOB A;  3TA0 A;  4DL6 A;  2MJU A;  4JI8 J;  1J27 A;  2V4R A;  2DH9 A;  3VAF A;  3C14 B;  1VRT A;  2GC8 A;  4CO4 A;  3ZZO A;  5LM7 E;  2RUS A;  3M2V B;  1HBN B;  2AEJ A;  4ECY A;  5HP1 B;  5IXU A;  4KGX B;  3BBF A;  3GIK A;  4ZN1 A;  1N8R T;  4ZVT B;  3QRQ A;  4OYM A;  2CPF A;  5HI7 A;  4EYH B;  3IP0 A;  4M5K A;  2BEF A;  1VLO A;  3R7S B;  1SQF A;  2AWZ A;  2MY7 A;  4AXJ A;  4M1K A;  2QIF A;  4LF4 F;  2W9C B;  2XNR A;  3MHY A;  4U9R A;  1JJ4 A;  3DLH A;  2ZBP A;  2DNM A;  3QIP B;  2IA0 A;  2JOQ A;  1CC8 A;  5D3G A;  3GII A;  4LJM A;  4MT1 A;  3I6P A;  3VAJ A;  2FJA B;  3SCJ E;  2R8I A;  3MCM A;  2EC2 A;  2WVB A;  4XO0 A;  3AY0 A;  2M8H A;  4JI4 F;  3R1H A;  2DPI A;  4CO0 A;  4RUA A;  3U27 A;  4LR7 A;  4IFY B;  1WG5 A;  1TMM A;  2WW4 A;  4J7C A;  3FSX A;  2KFY A;  4FF2 A;  2HQ3 A;  4RZR A;  2QRR A;  2B0G A;  1URN A;  3DU6 A;  4Q8F A;  1L3K A;  2KN4 A;  3T19 A;  2UZA A;  4C4W A;  4I64 A;  4Y28 C;  3WIU A;  3OUY A;  4LSN B;  1S12 A;  1P27 B;  1EZZ B;  4MMO A;  1WC4 A;  4TVA B;  2MGZ B;  5A8K B;  3M8Y A;  1HBM A;  1LWE B;  2Z58 B;  3IRW P;  1J5O B;  4ALZ A;  2FVP A;  4DL2 A;  5KFV A;  5L1J A;  4NXN F;  1VRQ C;  3IBF B;  4GKK F;  3OR1 B;  2H65 B;  2M88 A;  1PAE X;  1KQG B;  1MWZ A;  1S1T A;  2VHG A;  1KS2 A;  3NGS A;  5E41 A;  1YI2 S;  2UU9 F;  2YKN A;  4IG0 B;  3QJP A;  2V5H G;  1RP5 A;  2Q6C A;  5I4M A;  3PW5 A;  2UV8 A;  1IBL J;  1BUX A;  1FRH A;  1NU4 A;  3I0R A;  3T5L A;  2BR0 A;  1FCA A;  2RQ4 A;  4C6A A;  3QT8 A;  2PN6 A;  4USI A;  1FJC A;  2YKO A;  5CAB A;  3CDU A;  4ECW A;  1V3S A;  4HDH A;  4DUY J;  2AGO A;  1OWX A;  2JLE A;  2F8H A;  2CQ4 A;  5HAN A;  3BS9 A;  2NYI A;  1TL4 A;  4FPR A;  2HWH A;  3SDE A;  3DLJ A;  1L3T A;  2GO8 A;  4LF9 F;  3DOK A;  5LXR A;  2DH7 A;  4WKR A;  2RVJ A;  1Y4Z B;  3UNY A;  3R1L A;  5KAK A;  1HR0 F;  2F4V J;  4A8W A;  3G82 A;  1RK8 A;  3CTR A;  4ZVO B;  4FXD A;  4A8F A;  1FWP A;  2QN6 B;  2IJN A;  3J81 Y;  2CZ9 A;  5KFO A;  2FLO A;  1U2C A;  4KHP F;  2Z8Q A;  4OZL A;  2KYX A;  1LNQ A;  4RW6 A;  4K4Z A;  3R97 A;  5B0E A;  5THW A;  3W9J A;  4ZCM A;  4N77 A;  4DV1 J;  4JI0 F;  1QUV A;  3BGF A;  4PEO A;  1SJ4 P;  2C1E B;  3KLF B;  5A8W A;  3Q86 A;  1RGV A;  4F3O A;  1LWX A;  2IRU A;  4PUO B;  3TEH B;  3A4T A;  2F9J A;  5HLF B;  4WU3 A;  4D3G A;  3LA0 A;  2ZM6 J;  3SCL E;  2ZFH A;  2YKQ A;  4W98 A;  4P10 A;  2BAC A;  5LT5 A;  1RHJ B;  5KG6 A;  3RW7 A;  1SL1 A;  1S0N A;  2CJY B;  5BYQ A;  1HNX F;  3BPD A;  3MAA B;  3QRP A;  5K8O A;  1K9M T;  5BR8 F;  1W25 A;  3HX9 A;  5DQH A;  2HHQ A;  4N41 A;  3NBP B;  2B4O A;  4CLL A;  1IBC B;  4UST A;  2J9D A;  1T3N A;  2XZD B;  1TZ0 A;  4PWW A;  2MQQ A;  4RWW A;  4DR4 J;  2ROP A;  1RTH A;  1TKZ A;  1WI6 A;  2DNO A;  3LGH A;  2AEM A;  3I82 A;  4O3S A;  4LRC A;  4MJK A;  1IM4 A;  1ZOT A;  2FQQ B;  1NK7 A;  3PDN A;  2R7S A;  1SCJ B;  2MLZ A;  3SCK E;  1Q7Y T;  3FC9 A;  1FDB A;  4P7T A;  2NCK L;  4DOZ A;  5LMU J;  2VG5 B;  2XUL A;  1HBO B;  2C22 A;  3CO9 A;  3PR4 A;  1KFS A;  1CJV A;  1KTV A;  3PYF A;  5F8I A;  3D0H E;  3E01 A;  5EX3 A;  3BN7 A;  1S6U A;  3HT3 A;  5F3T A;  1Q16 B;  4Q44 A;  1R0C B;  1TFW A;  2H54 B;  1E6Y B;  3TYT A;  2RS2 A;  1YBA A;  4H4K A;  4DR3 F;  1NM2 A;  2YKP A;  4BHQ A;  3PYG A;  4EBE A;  1ZH5 A;  4OX8 A;  2XS5 A;  4XAK A;  4J9M A;  3LP2 B;  4FF1 A;  1WF1 A;  2AF6 A;  3OLA A;  1PIL A;  4RUB A;  2VKR A;  1EQ0 A;  5E3R A;  3HCX A;  2HFV A;  3IG1 B;  2OTL S;  4DSI A;  3KLG A;  1S97 A;  4NXM F;  1FE4 A;  5L46 A;  1NK8 A;  2E1A A;  4X4T A;  4A8K A;  3W62 A;  2HWT A;  4MIB A;  4UZB A;  2HWI A;  1RI7 A;  1XR6 A;  2FPH X;  1KON A;  4BWJ A;  2DH8 A;  2GQC A;  2R3V A;  3GZ7 A;  5CYQ B;  4V1A k;  2PFD A;  3Q8S B;  2R4F A;  2GW8 A;  1HI1 A;  3KLE A;  4DV5 J;  2FY1 A;  3I87 A;  4URG A;  3MWB A;  3OFE A;  3P96 A;  2M5Y A;  2Y0S D;  4ILM A;  1RAA B;  1S5Z A;  4DPT A;  2QEX S;  4LVN P;  1QD1 A;  2W01 A;  3MCN A;  2G0I A;  1WG1 A;  1TP7 A;  4DPX A;  2ABY A;  3R9L A;  5L1L A;  4LFC J;  2XTJ P;  2C2N A;  1G6B A;  1BLU A;  1TKT B;  6FDR A;  4RJV A;  3FBF A;  2OSQ A;  4DN0 A;  4KFB A;  4ZHR B;  1T8E A;  2GS8 A;  4IR9 A;  2V8G A;  4PAB A;  4IRC A;  2IY5 B;  4M5D A;  1A9N B;  3UCZ P;  3GFZ A;  1W26 A;  4BDP A;  2CKW A;  2QV6 A;  3M2U B;  5KG3 A;  1N5S A;  3ZNJ 1;  1REV A;  4P2M A;  1VC0 A;  3PYE A;  4Y2I A;  3QT7 A;  1RT6 B;  1LV5 A;  1SKU B;  3OJS A;  1R89 A;  1TAU A;  2OGU A;  1HQU B;  4FYW B;  1P9Y A;  1RAJ A;  5E3C A;  5DET A;  4NCA A;  2XY5 A;  3C66 A;  2VFR A;  4DPY A;  2BAB A;  1KLM B;  1IBK F;  1AT1 B;  3MED A;  3MAH A;  4ED2 A;  1G4C A;  1YJU A;  3CCU S;  1JJH A;  4M5I A;  4M5N A;  3O1L A;  3FCV A;  4KY3 A;  1SB6 A;  2HW3 A;  3HM9 A;  4Y2M A;  5DG8 A;  4CIO A;  3ZZ0 A;  1R3N A;  3UCU P;  2M9K A;  1JLE B;  3W9H A;  3F0N A;  3IWN C;  2CAJ A;  1SL2 A;  2GQQ A;  3MM5 A;  3JTP A;  1MWY A;  2B6A A;  3JYT A;  2BAN B;  3PJ9 A;  1P1T A;  3LP1 B;  2H1Y A;  3M30 A;  5KT3 A;  2LDI A;  1RB0 A;  3CCZ A;  3OXF A;  1U1L A;  1D9D A;  2FJW A;  3VAG A;  4LR9 A;  2LU1 A;  2R7O A;  2WB4 A;  3MM8 B;  2ZWO A;  1VIO A;  5DGA A;  1JK9 B;  2R7T A;  3EUN A;  2DNZ A;  1OY6 A;  2R8K A;  1Q86 T;  5KOX A;  4I1T A;  1S77 D;  1V3Z A;  1NH8 A;  2AZ1 A;  2J7W A;  4LQ3 A;  1DTT B;  2L48 A;  4F4A A;  3KLH A;  3C6U B;  2GIQ A;  2P9E A;  3NCR A;  3US5 A;  2A10 A;  3ZTO A;  3R7B B;  1SPB P;  2H5I B;  3OFH A;  3TJ8 A;  2QYC A;  1BQX A;  4BS2 A;  3V5R A;  3H25 A;  4C3K A;  1Q53 A;  3A8J A;  2F4F A;  1FD2 A;  4DG1 A;  2B8P A;  1QE1 B;  3NL0 A;  1TKD A;  1RHU B;  3X1L B;  2RKI A;  5HQL A;  1QAJ A;  3LH2 S;  3H2U B;  2V2Q A;  2MQP A;  4ZCI A;  3FGV A;  2QLW A;  2F8M A;  5T7L B;  3J81 j;  1FVQ A;  5CYJ A;  4PG5 A;  2JVR A;  3OHB A;  2B9W A;  2KHD A;  2FUG 9;  2NZC A;  2ZH4 A;  5D4O A;  1JXE A;  4OJ3 A;  2YNH B;  1VQS A;  2IFX A;  3SV4 A;  3FEY B;  4G6V B;  2HHH J;  2VV5 A;  2GVD A;  1HNZ F;  1VQM S;  4NLU A;  2N7Y A;  2OH2 A;  2NQP A;  4ZPB A;  4PR6 A;  1D1U A;  4F4K A;  2C42 A;  3PG9 A;  2IDE A;  1D8Z A;  2I38 A;  1F9F A;  1S9F A;  4QYR A;  4NXN J;  1B7Y B;  4DR5 F;  3CWJ A;  4DR6 F;  3V6D A;  4UF4 A;  4MKV A;  1UP1 A;  4PZV A;  3NGD A;  4WBF A;  1SJQ A;  2CFX A;  5J1N A;  1V3R A;  2R8J A;  1ZTT A;  3R7N B;  2E1R A;  3F73 A;  1WSV A;  2GGP B;  2NPF A;  2W2M P;  4FS2 A;  2YQ0 A;  4RUC A;  3JSB A;  3DXB A;  3J7A 1;  2LXI A;  3N5B A;  3DI6 B;  3M2R A;  3CCR S;  2C2K B;  4I7F A;  3T1H F;  1Q79 A;  5GMD A;  3R8Y A;  2DGU A;  3UQS A;  4DSF A;  4DU8 A;  3UN2 A;  5AT1 B;  1X4C A;  1N33 F;  4CYU B;  2W8K A;  4DFJ A;  5IT9 U;  1NK0 A;  3MMC A;  5IWA J;  3KHG A;  3G4S S;  3HFZ B;  2CDR B;  2ASL A;  2R8G A;  4KGZ B;  3D2W A;  4LF6 F;  2A0F B;  1UFW A;  1VQ7 S;  1AYE A;  3TUI C;  2VQF J;  1I94 F;  3THP A;  4H4O B;  2GCF A;  2NUU G;  1S9G A;  1WHY A;  4XPC A;  3M8R A;  1X5P A;  2XYH B;  4QIG A;  1RCO B;  3K8V A;  3MEG A;  3DGP B;  3ZZT A;  4IDK A;  1HL6 A;  3B4D A;  1ZS6 A;  1PJ6 A;  4J9L A;  3LPY A;  4DX7 A;  4WU2 A;  4DL4 A;  2RRB A;  1NB2 A;  2AV5 A;  2WRM A;  4OHW A;  3KJV B;  3AJ2 A;  5LOQ A;  2OUG A;  1UJ6 A;  3EXY A;  4YQW A;  2C2M B;  1S7H A;  2DEI A;  3KJQ B;  4ED7 A;  1PJ7 A;  1UWB B;  5F9N A;  2XG8 A;  2VC1 A;  5B0F A;  1F5A A;  2IJF A;  1PYO B;  1ZM2 A;  1CS4 A;  5KG7 A;  1C1B A;  4BCA A;  5HQM A;  3J7Z 5;  2ZBQ A;  3R2D J;  2HBZ B;  3SQO P;  3BV8 A;  1D0E A;  4OHX A;  1OYD A;  2B9Y A;  5G0R B;  2OPS B;  3ZTQ A;  3ZZR A;  4OQJ A;  4F0M A;  4PWD B;  4GO5 X;  4K5R A;  3SMZ A;  3E2E A;  1AW0 A;  1TL1 B;  3FBB A;  1TL7 A;  3AA9 A;  3Q8P B;  5GAE I;  3A3P B;  4FVC A;  4F0H A;  4QBU A;  3HP6 A;  1OYE A;  1UJ5 A;  2B8Q A;  3TO8 A;  3FBC A;  3HVT A;  2J76 E;  4HI1 A;  3DLB A;  4NPO A;  2E1C A;  1I6J A;  1N0V C;  2DNR A;  2W4C A;  4F26 A;  2V50 A;  2BVZ A;  5IOL A;  2LU2 A;  1R8P A;  2KDO A;  4JI6 F;  4IH7 A;  3OFG A;  3H5X A;  1CJT A;  4FKX A;  1Q0N A;  4HTJ A;  3H4B A;  2OP5 A;  5L9N A;  4LUB A;  3FFI A;  3TWZ A;  5DZ7 A;  2VJV A;  1QSS A;  1XK8 A;  2WVD A;  3HSJ A;  2VG7 B;  3ZZZ A;  4LF5 F;  1JKH A;  2MYF A;  1CJK A;  2IAJ A;  2CRL A;  5B0A A;  1CQN A;  3TX8 A;  4J9V A;  3OL7 A;  1PG5 B;  2PEH A;  2NLW A;  1IR2 A;  2KXH A;  3POT A;  1B0P A;  2FHM A;  3OUY B;  2A6M A;  3CJT A;  1X7V A;  1HKA A;  3DN9 A;  4QW8 A;  4YB6 A;  1JNZ B;  2XMA A;  5HMY A;  1YSJ A;  3BGO P;  2LQJ A;  1VQ9 S;  1T9X A;  1NDK A;  3ZTR A;  2UUA F;  2W9B A;  3HHL C;  1S48 A;  5DM7 Q;  3V2U C;  3I55 S;  2O01 C;  1T9Y A;  2XHW A;  1B3T A;  2Z30 B;  4F2R A;  2K8G A;  2QO3 A;  4MIW A;  4DX6 A;  4ECX A;  1WKL A;  2XI3 A;  3M8S A;  4CH0 S;  3D6F B;  2J6T A;  2QX0 A;  2F65 A;  4YP3 A;  4J9U E;  4UUX A;  1NUE A;  3PW0 A;  1HWL A;  4YR0 A;  2NXC A;  3MM9 B;  3RBZ A;  1FRK A;  2B51 A;  2IVM A;  4DR2 J;  3KK1 A;  2HQG A;  3OD2 A;  4UOF A;  2Y8Y A;  3MMA A;  2ZD1 A;  1ROF A;  3LWM A;  2OKQ A;  3CJK B;  1O5J A;  3ILO A;  2Z2Y B;  2DVI A;  1B0V A;  4OLP A;  3D1H A;  2BX6 A;  1FF2 A;  2ASJ A;  4DV2 F;  2CQI A;  1RCX B;  2W24 A;  4I6A A;  3TUP A;  3EYZ A;  2DNN A;  3DLG B;  1B0T A;  2P5V A;  4OI1 A;  2CJB A;  3TI0 A;  4QIF A;  1CLF A;  5DDO C;  5KFI A;  3HJF A;  3NAH A;  5GAG I;  4FNH A;  1FRM A;  2NXU A;  3TVY A;  5F8N A;  2HBR B;  2KT3 A;  5A8W B;  3FRZ A;  3T9N A;  3CDB A;  4K4T A;  3T5J A;  2KTQ A;  3TVK A;  1BD6 A;  3KDO A;  3TAN A;  1DJ0 A;  1ARO P;  5DQG A;  3ETO A;  4CLF A;  3QWP A;  4YN3 B;  1HMV A;  4X4V A;  3BB5 A;  1X5T A;  3D67 A;  2ZZN A;  3CVK A;  5CZV A;  1U2F A;  2XMJ A;  1MW7 A;  2RF2 A;  3ISN D;  1IKX B;  2MZT A;  3QGI A;  2E7X A;  3HZG A;  2PGC A;  3OTE A;  2R2T A;  3NWR A;  4CTA A;  2CJ9 A;  2R7Q A;  3D0G E;  3SFU A;  4FYX B;  4USH A;  4AND A;  1FKP B;  1RTD A;  3RGI A;  4CQ1 A;  3IXQ A;  2FDN A;  3WC2 A;  1Z4U A;  4C11 B;  4FN5 A;  2QLX A;  3TUZ C;  1L3U A;  2YWG A;  2DRB A;  2PD1 A;  4GVB B;  1IM6 A;  1OY9 A;  2XO6 A;  5DG7 A;  1IKW A;  2ATL A;  4DV7 F;  2FJX A;  3EIC A;  2MDA A;  1RIS A;  1F60 B;  4K0K F;  4OX9 J;  3JTN A;  3HSG A;  3G6V A;  2ROG A;  1TVR B;  2JRS A;  4JI3 J;  1JXL A;  1RHR B;  4F36 A;  4P7V A;  1DAX A;  4J9K A;  1RT1 A;  5F0W A;  1HD0 A;  1S0V A;  1ACM B;  2CPY A;  3HT0 A;  1T11 A;  1M5V C;  2B5J A;  4I2P B;  4M5L A;  1P6T A;  2AGQ A;  4NLD A;  1U48 A;  3OW2 R;  2NXN A;  1PC5 A;  1RBL A;  2VPX B;  3W65 A;  4K4U A;  1SUQ A;  1VDH A;  4PYD A;  1VQ4 S;  4P71 A;  4RWX A;  4DQS A;  1TV6 A;  2C2Z B;  1SL0 A;  3RB0 A;  1U2R A;  2KG0 A;  2V94 A;  2VPY B;  2KL8 A;  3VVT A;  2CQ3 A;  4JI5 J;  3KLG B;  3BDP A;  1UPP A;  4DDF A;  4DQQ A;  1WUU A;  4NA2 A;  2Z2L A;  1HNZ J;  4QWE A;  1S59 A;  4DUZ F;  3NOC A;  2YX4 A;  2LEC A;  2LMI A;  2HHT A;  4OYW A;  3FKB A;  1VBZ A;  2V2K A;  3HSZ A;  3QZ7 A;  3C2P A;  3PIO Q;  3P45 B;  4TYA A;  4DV3 J;  4A8Y A;  2R9L A;  1ZYQ A;  4YY3 F;  4DR6 J;  2CJQ A;  3U1L A;  4OHY A;  3O44 A;  3B54 A;  3TEG A;  3MPV A;  2X1G A;  4CH7 A;  2ADC A;  3BYP A;  2EC0 A;  4M5H A;  4NAS A;  2ADB A;  1RDR A;  2GFF A;  4LIR A;  3SIP B;  4OX7 A;  3FEX B;  4V19 X;  3KMS A;  2V4J A;  1NHK L;  3CCM S;  4A8X A;  5E5N A;  4KFB B;  2MKY A;  1KTQ A;  3B8H A;  2HIY A;  2HQC A;  2E44 A;  3A12 A;  1LW2 B;  4NLS A;  1U26 A;  3C16 A;  5ETR A;  3VQT A;  2BV3 A;  2MB0 B;  3PO4 A;  2CJK A;  1S1W B;  2JJ4 D;  2KRB A;  1DY3 A;  2ASD A;  1X60 A;  1REV B;  3UN3 A;  3GR0 A;  1W2B R;  3K59 A;  2MKS A;  4LFB J;  3J80 U;  1DUR A;  4C0B A;  2RHQ B;  3MFI A;  3CUN A;  2OEM A;  4X84 A;  2AU0 A;  1WOO A;  4K4W A;  2LQ9 A;  5G4D A;  4L72 B;  4X4S A;  1VC6 A;  2BA9 A;  1CVJ A;  4L3N A;  2UVW A;  5M2P A;  2E9T A;  1HNV A;  3CIM A;  2WSF C;  4U7U D;  2DNK A;  4A46 A;  4B9T A;  4C8O A;  3MED B;  2XSF A;  1ZTW A;  1YJN S;  2FYX A;  1Y00 A;  1JJ2 R;  2PMH A;  1KVK A;  3CJ8 A;  3NGK A;  3MR6 A;  3W8G A;  2NS1 B;  5DDP C;  2EFQ A;  4HH1 A;  4JV5 F;  2DYA A;  2RIJ A;  1SV5 B;  4F04 B;  2VDI A;  3IN5 A;  4DSJ A;  4NZ7 A;  2J0S D;  1DQ8 A;  1JLC A;  4RW9 B;  4CNY A;  4CLT A;  2B6A B;  1RUS A;  4YME A;  1HNW F;  3KG4 A;  2IPO B;  2Z57 B;  4U95 A;  3TAM A;  2E5J A;  1XIQ A;  2IM1 A;  3HHD A;  1UA1 A;  4LBI A;  5GAH U;  3FZB A;  1EKS A;  4F3Q A;  1KLN A;  2V6A A;  4DZ6 A;  3J7A N;  3IAM 9;  2LEP A;  3GIM A;  1UTA A;  2G9O A;  2ZZT A;  4B9U A;  2LQ5 A;  2UXD J;  4HAC A;  2CQ0 A;  2GJ2 A;  4ER8 A;  1S7I A;  2DGV A;  3Q8V A;  1VQ6 S;  2F9D A;  3LAN A;  1S1V B;  4Y6I A;  4USV A;  3Q8U A;  4Z37 A;  3HPO A;  1UKU A;  4FS1 A;  4NCG A;  4AT1 B;  4DG1 B;  4F67 A;  1NCL A;  1RSC A;  4DPU A;  1BGX T;  2RKI B;  3R5G A;  3C6T B;  4ZJO A;  4USW A;  1H38 A;  2LQB A;  5LMN F;  3ZTS A;  1CJU A;  4ID5 B;  2MLX A;  2V69 A;  3CW2 C;  2A3J A;  2XZW A;  3ENV A;  2HHX A;  4LRD A;  1NPR A;  3EGZ A;  2X3D A;  2G1H A;  2HS3 A;  4LFA J;  3C14 A;  3W60 A;  3J7Y I;  4J9S A;  3ELH A;  3M2V A;  1HBN A;  4NLR A;  5B7W A;  5HP1 A;  2YBV A;  1ICE B;  1WTF A;  1N34 F;  3QAE A;  4DSK A;  4OZ2 A;  4I4B A;  3FVY A;  4B3R F;  2DXF A;  2A1B A;  4UUW A;  1WEY A;  1I5O B;  2NXJ A;  4FBT A;  1K44 A;  1LW0 B;  2KM8 B;  5HK4 A;  4X65 F;  1GMV A;  4OZ1 A;  4KH0 B;  2WB1 D;  1Y5N B;  3UD5 A;  2C3P A;  1RU1 A;  4A48 A;  1VRU B;  1F6T A;  2LFV A;  2W9C A;  5DO2 A;  2H9Z A;  3GJQ B;  1NJZ A;  2HZV A;  3G87 A;  3QIP A;  4PG4 A;  4BWM A;  1VBK A;  3M2R B;  4A4J A;  1UVM A;  4TY8 B;  2I2Y A;  2CPH A;  3PY8 A;  4KKO A;  1RWM B;  3ETM A;  4IQX A;  1WJ9 A;  2VOP A;  3H2V E;  4MYT A;  2K06 A;  2E7V A;  1GXU A;  4I69 A;  4WYL A;  2MKK A;  4IFY A;  4A8Q A;  4N8O A;  2QSW A;  3U7J A;  2XS2 A;  1ZAV A;  3Q2S C;  2OSR A;  2OEK A;  1RT5 B;  3FBE A;  3HJV A;  3LGN A;  3PHE A;  2VDH A;  2FVR A;  4RX6 A;  5B0D A;  5DGB A;  2AQ4 A;  4K4S A;  3GCW P;  3QO9 B;  1FNM A;  4RO0 A;  4LSN A;  3T9Z A;  5KFH A;  4USK A;  4JYA J;  2IYG A;  4M95 A;  3MAQ A;  2GX8 A;  1CEZ A;  4DL3 A;  4K59 A;  1FKO B;  1XNQ F;  5IS2 A;  1S4E A;  3KK3 B;  2H4W B;  3I32 A;  2MGZ A;  3MMJ A;  3MM7 B;  1KHW A;  2HZA A;  4OHV A;  5A8K A;  2L9N A;  2VC0 A;  3GFX A;  1VK8 A;  3GYX B;  1LWE A;  4KR0 B;  1J5O A;  4OI2 A;  1V5I B;  2JEF A;  4KE5 A;  4IH6 A;  5E2Q A;  3HHE A;  3OR1 A;  4FKY A;  2AKW B;  3OL6 A;  4G65 A;  2BUN A;  4OX6 A;  4IG0 A;  4DXL A;  5CYM B;  3LP0 B;  3BGR B;  2HGM A;  3IGV A;  2M0G B;  3KLI B;  3MMB B;  2EPI A;  5C24 B;  2RDD A;  3HLU A;  1GMW A;  1RTZ A;  1CS4 B;  2NR0 A;  2J8A A;  4A8S A;  5IT9 Y;  3NNH A;  3IR6 B;  3WX4 A;  1XC9 A;  2YWH A;  1FI4 A;  4JI1 F;  4RKU C;  3ZZU A;  2PI4 A;  2HRY A;  3MR5 A;  2RDI A;  1R6Y A;  3EMT A;  1RHQ B;  5LL6 d;  5J2M B;  1RAD B;  3PFE A;  5DLF A;  1TL7 B;  4X4O A;  4ZPT R;  3GYG A;  4L75 A;  2CPZ A;  3KKF A;  4OJ1 A;  2DGQ A;  1HFE L;  2LDY A;  1IWG A;  3BKT A;  2VPZ B;  5K9F A;  5KFP A;  3LQV A;  2OPQ B;  4DSL A;  2NZ4 A;  2AX0 A;  2B4V A;  1W7W A;  3FEZ A;  1Y5L B;  1UFL A;  5L8R C;  4QW9 A;  1CJT B;  4EBD A;  1G2E A;  1TAQ A;  3KLF A;  2LLZ A;  4PUO A;  4CLS A;  1LEO A;  5B0G A;  4CZC A;  5HLF A;  2FIU A;  1OJ4 A;  4CT8 A;  1JWW A;  2HFS A;  3EGN A;  4NI2 B;  1WC3 A;  2DHH A;  1JKH B;  3W5X A;  4ZCK A;  2G13 A;  4JB8 B;  3VTI A;  4YS2 A;  4P52 A;  1TK8 A;  3BR8 A;  3PW4 A;  2GVZ B;  2K3I A;  1F5C A;  1H3D A;  4HL9 A;  4OV6 A;  1K1Q A;  2O3D A;  1S6P B;  5ETO A;  1H2V Z;  1RLC L;  4LRA A;  2AX1 A;  5K20 B;  1S6O A;  2M70 A;  2YTC A;  2MEW A;  2MZQ A;  5HVG A;  4ZLJ A;  3GR1 A;  4Z7Y A;  3PIP Q;  3AD8 C;  1RQ0 A;  2G2O A;  2UVU A;  1FX2 A;  3PVX A;  2BZ2 A;  5L39 A;  3SI8 A;  1MWQ A;  3FSI A;  2X3G A;  2Z2Z A;  2CQG A;  2MKC A;  4DEZ A;  3DDN A;  3FQK A;  5IV3 A;  3L4B C;  5K8N A;  2JC1 A;  2IM3 A;  2J9E A;  4RNN A;  3OXG A;  4N7T A;  1NSQ A;  3A8E A;  2GV1 A;  4RPF A;  2MMY A;  5AE3 A;  1XBW A;  2AIR B;  3UFC X;  3A8I A;  3CME S;  3Q0A A;  1KDN A;  3W61 A;  2HAI A;  3K7R A;  3KG0 A;  2VG5 A;  2X1A A;  4K2X A;  1RAH B;  5EWG A;  3RBE A;  2E7W A;  1ZPW X;  2VD3 A;  4QR1 A;  1H2T Z;  3ILL A;  2KZM A;  2LA6 A;  1N32 J;  4NLQ A;  3DM2 B;  3VHQ A;  3DDI A;  2BJ8 A;  1M5K C;  1E6Y A;  2AW0 A;  2MXY A;  2B7C B;  2ZD1 B;  1UW4 A;  2ZJQ Q;  2XYG B;  2KFZ A;  2EK6 A;  1H0H B;  1PAU B;  4L74 A;  3LP2 A;  4C0H A;  2CUY A;  3K0J A;  2VF3 A;  4P6Q A;  5B0C A;  4BLG A;  4M8L A;  1FER A;  2APO A;  4MTP A;  3LGM A;  4DSE A;  3IG1 A;  1BC6 A;  2E66 A;  5KG2 A;  2F1F A;  1KFD A;  4PYA A;  3RZA A;  4DR1 J;  4F25 A;  1RWK B;  3I9Z A;  3L7P A;  4MIA A;  2KM8 C;  1XMQ J;  3TZX A;  5C42 A;  1SJR A;  4LF8 J;  2D3U A;  1S0M A;  1HPZ B;  3LPE A;  4AQY F;  1Q8B A;  3G6Y A;  3HVR A;  1UPM B;  5CYQ A;  4KAI A;  2RQC A;  3AD7 C;  5ETV A;  1R0B G;  3CSK A;  1FVS A;  5KFD A;  5CD4 A;  1JB0 C;  2W7P A;  2CNN B;  3NXZ A;  3KDN A;  3L3C A;  4ZPD A;  3R5B A;  2WOM A;  3PRV A;  1HAR A;  4GC7 A;  3W3S A;  1HWU A;  5HQ8 A;  4DLE A;  4K5S A;  5I3U B;  4TU7 A;  1VS3 A;  1TKT A;  2O66 A;  4DUY F;  3OSN A;  1TK0 A;  2RF2 B;  2XMW A;  1RWV B;  1JQG A;  4U7U K;  1F1B B;  1S1X A;  4ZHR A;  4RUH A;  2N3L A;  5E3Q A;  3G9C A;  1KNZ A;  1HQE B;  1D9A A;  2BKO A;  3MUM P;  1FXL A;  2XY7 A;  3SEO A;  2BKN A;  2BJ9 A;  3BSN A;  3GYN A;  1N5V A;  3M8P B;  4Y65 A;  5AJ3 J;  2F4V F;  5ETP A;  1X0F A;  1VCT A;  1WWH A;  4MH8 A;  3M7V A;  2XSJ B;  3RU0 A;  3R5C A;  1RT6 A;  3T1Y J;  1UZH A;  4L76 A;  4LT6 A;  1HQU A;  4DUT A;  3QWU A;  1FDA A;  2WON B;  4LBP A;  1F0X A;  2ATC B;  1KLM A;  1N88 A;  3IAS 9;  1RT4 B;  2V8V A;  1H7X A;  2EWH A;  4B08 A;  1Y9O A;  3EDR B;  3P5T L;  1KP6 A;  2RNE A;  2XWX A;  4DI6 A;  1R7I A;  3P4U B;  3DYA B;  3D5M A;  3KOA A;  3Q8R B;  1SUQ B;  1UET A;  4ITS A;  1TV6 B;  4P9S A;  1U47 A;  2PFF B;  1JLE A;  2FVC A;  3V6H A;  3E8O A;  3ZC4 A;  1VQY A;  4ZP8 A;  1M5O C;  2BAN A;  4WK3 A;  1KQS R;  3LP1 A;  4MKY A;  2FY8 A;  2DHA A;  4XIU A;  5KFB A;  2VFT A;  3DHW C;  3SXL A;  1EP4 B;  3THT A;  3RAX A;  4DR4 F;  3GV5 B;  4DMZ A;  4B3R J;  5F8L A;  5HMZ A;  3KJF B;  2Q79 A;  1RWO B;  1DTT A;  3IWX A;  4YUD A;  4C0O C;  1R6V A;  1YRT A;  3HHL A;  1U45 A;  1IR0 A;  1IJF B;  2CVI A;  2JC0 A;  4TY9 A;  5LMU F;  4RNM A;  4M5G A;  4ZJL A;  4J37 A;  5CD4 H;  5KG0 A;  3ZO7 A;  2MHN A;  2GMJ A;  4R8U B;  2LKZ A;  3GFY A;  1Q78 A;  4NEZ A;  2E5H A;  3R6L B;  3HD2 A;  3HVW A;  1VQP S;  1U6Z A;  2M52 A;  2ZH6 A;  3NRB A;  2KU7 A;  2OEJ A;  4JI2 F;  4BC9 A;  3ENQ A;  3EM1 A;  1JMT A;  1QE1 A;  2AEF A;  3UDV A;  1EET A;  4EO6 A;  4IFV B;  3D28 A;  4WZQ A;  2CPD A;  3DRS A;  2QA1 A;  2J0Q D;  3L09 A;  3SYZ A;  4O0I A;  2ASY A;  3BSC A;  1ZM9 A;  1XMB A;  5KG4 A;  3NP5 A;  2BJ1 A;  2HUR A;  5T7L A;  2DNG A;  2ZUG A;  3S7R A;  5F8M A;  1N56 A;  2ILY A;  4ILL A;  2C2R A;  1WHW A;  3EGV A;  2RJZ A;  1AXQ A;  3BO4 A;  4F7V A;  4DPW A;  1Q81 T;  3OT9 A;  2ZBC A;  4PWU A;  4C8M A;  2OFG X;  3D9B A;  1XNQ J;  3HI9 A;  4DCJ B;  3JQK A;  3IBW A;  3BGL A;  3MTK A;  1PO6 A;  4NLV A;  4URS A;  5IQQ A;  1K73 T;  4DV5 F;  3SFG A;  4X4Q A;  2QG9 B;  3PW2 A;  4NOH A;  2QTW A;  1R43 A;  1ULR A;  4NE9 C;  3NAI A;  1FDD A;  3TX0 A;  4KTQ A;  2MZR A;  1LWF B;  3DOM A;  4HDG A;  2GGP A;  4LFC F;  3CE8 A;  1UW9 A;  2RDJ A;  3P3D A;  1VIX A;  2DCL A;  3KK2 A;  3QSY B;  7AT1 B;  2J6U A;  4DQI A;  5IC4 B;  2FC8 A;  3M8Q A;  3PJW A;  5I3P A;  1T94 A;  5AXM A;  4CYU A;  3MM6 B;  1AZS B;  4HT5 A;  1MNE A;  2QJ3 A;  2U2F A;  2R7X A;  3J80 Y;  3AH6 A;  2Q6B A;  3W66 A;  1S72 S;  2VOD A;  3PEJ A;  4CO5 A;  2VON A;  1R31 A;  2UUT A;  4H4O A;  3VWS A;  2VG6 B;  3U1N A;  1AFI A;  2ZWP A;  4B02 A;  4NMX A;  1FFS B;  3W5Y A;  3CD0 A;  5HAO A;  2IC3 B;  3GWC A;  1FFW B;  1RTI B;  2HVD A;  2HRT A;  2MQL A;  3J7Z T;  4TXS A;  4ED0 A;  2R7U A;  4DU7 A;  2FGO A;  4DF4 A;  2NRE A;  3GSI A;  1N6Q A;  3KJV A;  3CJ2 A;  3OXL A;  3CJQ A;  4RBV A;  1X9W A;  4CLZ A;  3QQC D;  1VIS A;  5KFK A;  3O3L A;  3VAK A;  1AUD A;  1UWB A;  2DTJ A;  2LCW A;  2IDL A;  2R2R A;  2DIU A;  4B3T J;  1WKK A;  3IS9 B;  1XMO J;  3W2V B;  2QYG A;  5F0U A;  3KUE A;  1OMS A;  2WBM A;  4ZVH A;  1BMQ B;  5L38 A;  4JV1 A;  4DZD A;  4B9N A;  4WFN Q;  5AXL A;  5G0R A;  2OPS A;  3MPD A;  1FT8 A;  2RU3 A;  2BQR A;  2XM3 A;  1PJ5 A;  3CD7 A;  4AYB D;  4PWD A;  2I0X A;  5JXS A;  3BO3 A;  3HD1 A;  3LWL A;  1TL1 A;  4WZM A;  5A0Y B;  3D6H B;  4OZ0 A;  1KVI A;  4KRW A;  2XLI A;  1SJ1 A;  6FD1 A;  2YQ1 A;  3TNV A;  1QUP A;  4WFX A;  2IIH A;  5A8R B;  4CO2 A;  1FRJ A;  2G0C A;  3X3U A;  2C28 A;  2VH7 A;  2ZH5 A;  3MGJ A;  2HGN A;  3QLH B;  2CNO B;  3NCQ A;  4KKO B;  3IM9 A;  3S6E A;  2M2B A;  3FSY A;  1WSR A;  4Q7A A;  2VG7 A;  1NZA A;  1U1R A;  1N5Q A;  4Y00 A;  4QZV B;  3T6B A;  4B3M F;  2PI5 A;  1VGY A;  3C15 A;  3K58 A;  4ECS A;  5LSO A;  3PYD A;  3A1Y G;  1HNI A;  3N6M A;  2WZ1 A;  3GV8 B;  1GMU A;  4I6W A;  3DRR B;  1R8B A;  3OTO J;  2HHH F;  1TFY A;  2OJ3 A;  3DDK A;  3KNA A;  4P73 A;  4OYA A;  3IC1 A;  3I4P A;  3SQG B;  2I5J A;  2IHR 1;  3HSD A;  4AQY J;  1URR A;  1U1M A;  3C8Y A;  2DIS A;  3GLJ A;  4JI7 F;  3CF5 Q;  2EEY A;  1T7P A;  1H73 A;  3ONQ A;  2CZV C;  3NGT A;  3BRE A;  1IJE B;  1XTZ A;  1RAG B;  5KFM A;  2J7U A;  2LP4 A;  4ZP7 A;  4CNZ A;  2DR6 A;  2Y9H A;  1T0T V;  1MRO B;  2MSS A;  4NX9 A;  1PC4 A;  1XR5 A;  2D1C A;  2DK2 A;  3W5Z A;  3VF0 B;  3HZE A;  3H0P A;  4DV6 J;  2B4P A;  3MM9 A;  1WNE A;  2HNY A;  3DKD A;  4C8Z A;  5ETS A;  3LF0 A;  2KJW A;  3I5A A;  1Y0H A;  2HVH A;  1QAX A;  4G1I A;  4B9L A;  3CJK A;  4MAK A;  1HD1 A;  5IWA F;  2C2E A;  4WYW A;  4JV0 A;  4LR8 A;  2OPR B;  4O4G B;  1V9O A;  1FDN A;  1CPZ A;  2VZ9 A;  5IV4 A;  2E29 A;  1WTB A;  2CWK A;  4U96 A;  2VQF F;  2ZHA A;  5C5J A;  3DLG A;  4Y2A A;  3T5K A;  4I67 A;  4FYV B;  3RRK A;  2CQ2 A;  1JLA B;  2HHV A;  3OVS A;  2CDQ A;  3R6G B;  3GE9 A;  1B4S A;  3BGU A;  3RYL A;  3QFW A;  3UDE A;  3PX4 A;  5KFU A;  4U8Y A;  4TYB A;  2DB1 A;  2A2D A;  2GHP A;  2CPI A;  1QLN A;  5AE2 A;  3EX7 B;  1SC3 B;  4NCB A;  2VB6 A;  2KI2 A;  2MLY A;  4TLQ A;  4RLE A;  2ZJP Q;  3PCO B;  5CAA A;  4DR7 J;  2BQ3 A;  3PZP A;  1VK3 A;  1LKZ A;  1IKX A;  2VAS A;  2VFU A;  5KG5 A;  4IR1 A;  3H40 A;  2EVZ A;  2Y0B B;  1WOP A;  3N0V A;  4C7Q A;  2HQD A;  2CNL B;  1U02 A;  1U4B A;  2PC6 A;  1XEZ A;  1FEE A;  1R8H A;  4P72 A;  4OZN A;  1FKP A;  1FJG J;  1XN9 A;  2DRD A;  5EHH A;  4C11 A;  2JDJ A;  3CC2 S;  2ALZ A;  3TZW A;  1FEH A;  2EFG A;  4GVB A;  2YNG B;  1U6F A;  4RR5 A;  5CH7 B;  2P2C B;  5CCM A;  1UAW A;  2MQN A;  4ED5 A;  4ZLN A;  1JLG B;  2ZNY A;  1WDD A;  1TVR A;  2N4C A;  5JUM A;  1DQ9 A;  4F4Z A;  4JI2 J;  4U7C A;  4ERD A;  4WII A;  1SH3 A;  1NHU A;  4I2P A;  2V8H A;  2KKH A;  3EE3 A;  4M5M A;  3EVM A;  5IT4 A;  2IRY A;  2PA8 D;  4Q45 A;  1KN6 A;  3PHT A;  1H98 A;  2CQP A;  1IN0 A;  1IWA A;  5IM0 B;  2QZ8 A;  4CI0 B;  3RW6 A;  2C3U A;  2FB0 A;  2QMU B;  2VIH A;  2XGQ A;  3DLE B;  5KFE A;  2KZZ A;  3PTW A;  4PXC A;  1KR4 A;  1O51 A;  4ZPA A;  3SV3 A;  2W25 A;  1DHM A;  2QMW A;  2EXU A;  1O0P A;  3M6V A;  2ROE A;  4C3L A;  5C42 B;  2Q66 A;  1IBM F;  1OPI A;  2DJW A;  4ECU A;  4WFB Q;  5EGY A;  4ELU A;  3CCL S;  2GJI A;  5ETT A;  4E2F B;  2LQ8 A;  1GXT A;  1U1N A;  4KQZ A;  3JSR A;  2BJ3 A;  3T5H A;  5A2Q Y;  5D4L A;  2WOM B;  1VI7 A;  4TN2 A;  4KBI A;  4NLO A;  1E6V B;  4J9N A;  3G71 S;  4F0K A;  2WW8 A;  1M1K T;  1HI8 A;  3EPG A;  1RT2 B;  1X5O A;  4DR2 F;  4KYZ A;  3EXC X;  2HSE B;  2B9X A;  2FD2 A;  1S1X B;  2NYH A;  4G1P A;  1RZM A;  4PQU B;  1LW2 A;  2N82 B;  4ZOS A;  3V4I B;  2I6W A;  4O44 B;  4QCL A;  1S1W A;  9RUB A;  1Z2L A;  3OSP A;  1NSK L;  3D6M B;  5RUB A;  3T3F A;  3JQJ A;  4PXE A;  2MZ1 A;  4EI2 A;  4EZ9 A;  2KJV A;  4DFM A;  2GJF A;  3IR7 B;  2Y1J A;  4C8L A;  3CUL A;  3BYR A;  4ZA1 A;  2W4P A;  4NRT A;  2YKA A;  3R3T A;  2QFJ A;  3KXD A;  1NBE B;  3WDO A;  2HS0 A;  3MFH A;  4A8M P;  1XR7 A;  2FHJ A;  3HKW A;  4QIE A;  1MN7 A;  2Z2M A;  1WI8 A;  1SC4 B;  3FMW A;  4NL5 A;  4Q8E A;  3LTO A;  1M1G A;  1NPK A;  1ZAX A;  1VMB A;  3VZH A;  5A6W A;  2BW7 A;  4ZKA A;  3AOC A;  2HEK A;  4E98 A;  2AJF E;  1JLF B;  3ISN C;  3HVA A;  3NOG A;  5FDL B;  3CJR A;  1SV5 A;  4AFF A;  2FVS A;  3ZXW A;  2ILZ A;  2VUG A;  1HWI A;  3MUV P;  4RW9 A;  3D68 A;  1Z2Z A;  3IR5 B;  4Q2L A;  3GTY X;  2Y3Y A;  3WBZ A;  5KFJ A;  1MML A;  1IKY A;  4QJV A;  4QPT A;  1NJW A;  2HNZ B;  4KV8 B;  4J5O A;  1Y3J A;  1HHT P;  1KSP A;  1CBK A;  3MCS A;  1QTM A;  1B70 B;  4DQR A;  3TZY A;  3KFW X;  5GAD I;  1PBA A;  2DIV A;  3HHL B;  4F2S A;  4ES3 A;  2DKO B;  4MKB A;  1K0T A;  3M8W A;  5C25 B;  4CDI A;  2VKZ G;  1N4L A;  4E0D A;  4OX9 F;  2Q1L A;  3WC0 A;  4X62 J;  1S1V A;  4J90 A;  3D66 A;  3M32 B;  4JI3 F;  1FNX H;  1ZZF A;  5B09 A;  4GMK A;  2VIC A;  5HAT A;  1RHK B;  1XQI A;  4DFK A;  3H2L A;  3A3N B;  1EET B;  4EEY A;  5DS7 A;  3DRS B;  3FZ2 A;  1GX5 A;  3C6T A;  2VBX A;  3ET6 B;  3CPW R;  2XHC A;  2VBW A;  4ID5 A;  3IWL A;  4WE1 B;  4ED3 A;  4B3M J;  3V4M A;  2MST A;  3CCV S;  2AYM A;  5CQG A;  4AD6 A;  3L7U A;  1NB7 A;  3GB0 A;  1NRK A; 
#chains in the Genus database with same CATH homology
 3J80 U;  5A2Q U;  4AQY J;  4LF4 J;  4X65 J;  4GKK J;  1XNR J;  2MEW A;  2VQE J;  2UXD J;  2MTL A;  4OX9 J;  4JI0 J;  2UU9 J;  3W1Y C;  3IMQ J;  2F4V J;  4LF6 J;  4DV3 J;  4JI3 J;  4DV0 J;  4YHH J;  4JV5 J;  4DR6 J;  4JYA J;  4PWW A;  1I94 J;  4JI4 J;  4DR4 J;  4B3S J;  4B3T J;  4DR2 J;  3R2D J;  4DV2 J;  4X66 J;  1N36 J;  5IT9 U;  1IBK J;  3R2C J;  5LMN J;  3D3B J;  5IWA J;  1XMO J;  2KVQ E;  2UUC J;  1HNW J;  4DR1 J;  4DV1 J;  5AJ3 J;  4DV6 J;  2UUA J;  4LF7 J;  2HHH J;  4NEY A;  4DR5 J;  4X62 J;  4V1A k;  4HHU A;  4DR3 J;  4JI2 J;  1IBL J;  4JI7 J;  1XMQ J;  4DV4 J;  5LMU J;  1IBM J;  2VQF J;  4LF8 J;  4DR7 J;  4DV5 J;  4GKJ J;  3JAM U;  2ZM6 J;  4JI6 J;  3T1Y J;  1HNX J;  2MQ8 A;  4B3R J;  4KYZ A;  2UXB J;  4DUZ J;  5FLX U;  2UUB J;  3J81 U;  2KL8 A;  1XNQ J;  4JI1 J;  5BR8 J;  4LF9 J;  4DV7 J;  4JI5 J;  4DUY J;  1J5E J;  3OTO J;  4NXN J;  4JI8 J;  4K0K J;  1N34 J;  4LFC J;  3D3C J;  1HR0 J;  5LM7 E;  3T1H J;  1N32 J;  4KY3 A;  4NXM J;  4YY3 J;  4B3M J;  1HNZ J;  2UXC J;  4LFA J;  4RJV A;  4X64 J;  4LF5 J;  4NEZ A;  1N33 J;  2E5L J;  1FJG J;  4LFB J;  4KHP J;  3J7A N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...