4B3MJ

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4b3mJ00
5BR8J 3OTOJ 4X64J 4JI2J 4X66J 4B3SJ 4NXNJ 1N36J 3IMQJ 3T1YJ 4DUZJ 4JI0J 4DR4J 4JI1J 1N32J 4DR1J 4AQYJ 1XMOJ 1HNWJ 1IBKJ 4B3RJ 4DV5J 4DV0J 5AJ3J 4LF6J 4HHUA 2HHHJ 5A2QU 5IWAJ 4DUYJ 1IBLJ 4JV5J 4X65J 4JYAJ 4X62J 4K0KJ 4DV3J 4B3MJ 3R2DJ 4KYZA 5LMNJ 4V1Ak 2UUAJ 3D3BJ 2VQFJ 3J80U 4RJVA 4PWWA 5IT9U 2E5LJ 4DR7J 3D3CJ 4LF8J 4LF4J 4GKKJ 4OX9J 4NXMJ 2F4VJ 2KVQE 3JAMU 4JI8J 1N34J 4DV6J 4JI7J 4KY3A 1HNXJ 4JI5J 2UUBJ 3W1YC 4DV7J 2UXBJ 2ZM6J 5LM7E 4LFAJ 4JI4J 4GKJJ 4LF9J 2MTLA 4NEYA 3R2CJ 2MQ8A 2KL8A 2VQEJ 4DR5J 1XMQJ 4LFCJ 1XNQJ 3J7AN 4DR6J 4DV2J 4B3TJ 2UU9J 4YHHJ 2UXCJ 2UXDJ 4DV4J 1XNRJ 4DR3J 4JI6J 1HR0J 1N33J 4LF5J 4NEZA 4YY3J 4LF7J 4KHPJ 4JI3J 1HNZJ 2UUCJ 1J5EJ 1IBMJ 3J81U 2MEWA 5FLXU 3T1HJ 4LFBJ 4DR2J 1I94J 5LMUJ 1FJGJ 4DV1J
chains in the Genus database with same CATH superfamily
3BQ0A 5BR8J 4USMA 1UFKA 1RTZA 1WG4A 4FYWB 1JLAB 4DF8A 1B0VA 4CCHA 2QA4S 2ZM6F 1RTHB 1T05A 4Y65A 2FYXA 5C25B 4RU9A 1VIXA 3EVMA 2MKYA 3HD2A 4D3GA 3JTPA 3RG6A 3RAQA 5KFVA 1YJNS 2CQGA 2DHXA 2W4CA 3M6XA 1N34J 4DL3A 1BGXT 4C11A 4BCAA 1S0MA 3W60A 4LBIA 2AU0A 2J6SA 1NU4A 2ACYA 1YZ6A 2CPFA 4YEAA 4OI3A 3GYNA 5L1KA 2JC1A 2NLWA 3A3PB 2AV5A 5EHHA 2OPRB 1TL1B 4FF1A 1WORA 1ZOTA 4K4SA 4RW8B 4OYBA 3KLVA 3TANA 2PN6A 3AOCA 5E3PA 2PFFB 1S72S 1QLNA 5D0EA 2CQ3A 4Y28C 4EK2A 3Q8SB 4B3SJ 4LF8F 2BM0A 3R27A 5ETMA 2VFUA 4DSEA 1HPZA 4ZJQA 1JLEB 2O67A 1MN7A 3ZTQA 5ITHA 1U6FA 4IG3B 1T9UA 3OL7A 3ZZUA 4KPCA 1FA0A 3TZWA 2FY8A 2FZGB 3QJJA 3T6JA 5K8MA 5LMNJ 2CJKA 2UUAJ 1Q95G 3G82A 1EAYC 1S6UA 2XYPB 4WK3A 4E8UA 1HYSA 5K20B 2JEFA 4JI3F 1RAHB 4CYUB 3T5HA 3MPWA 3KG1A 1FFWB 2KXNB 1SH0A 4MTPA 2XS5A 3FDSA 1F9EB 3M6WA 1WG5A 4DS5A 2I8EA 4JI6J 1PILA 3KHLA 1VRTA 1JLCB 1AZSA 5C24B 3R97A 1DQ8A 5I3UA 4ELUA 4AXIA 2FHJD 4LVOP 3FEXB 4LF1A 4DR2J 2YX4A 2B6AA 1TKXA 4ZN1A 2NCKL 1EETA 2DNRA 3MFHA 2A0FB 2RNEA 2D74B 3NXZA 1N5TA 3PZPA 1X31C 5BYRA 3KK2A 1EIYB 2Q66A 3I0SA 3W2VA 3CDUA 1RABB 1AW0A 1HBOA 4IOBA 4C8ZA 4P75A 3GFHA 3VQSA 3G71S 3R7NB 3PEHA 2Q6CA 1CULA 2VU5A 3Q83A 1S1VA 3A12A 1F9FA 1T05B 2NXCA 5DG8A 2O01C 1TZ0A 4KY3A 2IM0A 4WKYA 4NLQA 2XEXA 1MROA 1VR6A 2G13A 4ED6A 4LFCJ 2DNPA 3TEGA 1KOOA 5D0GA 5FDLB 4B3TJ 3SXLA 2XG8A 3D67A 2HAFA 2N3OA 1R0BG 2R7TA 4C11B 2E9RX 1RHUB 5C5JA 4CT9A 5B0DA 3QATA 5IC4B 1HBNA 3MUMP 5AT1B 1S1TA 1NSKL 2AT1B 3IR6B 5CXTA 4Q5VA 4KFBA 4GVBA 1IKYA 4J9OA 4ATNA 1RYRA 4DOZA 1M5SA 3GU0A 2V0NA 3TUJC 3MEKA 3EZUA 2K06A 1Y9OA 2RQKA 5D4OA 1D1UA 5KFRA 2E29A 1HPZB 3KHRA 4HEA9 1YJTA 1A9NB 1N33F 5CAAA 4KSEB 3UNGC 4ELVA 5A2QY 4N47A 1JLFB 2OEKA 4F2RA 3G82B 2W9AA 4ZLLA 4P6QA 3UDVA 5GADI 2M5YA 3VZHA 2LP4A 4F4KA 1KHWA 4O3OA 2HRTA 3PJ9A 2HZAA 4WE1B 1XJWB 2CQBA 4ZHRB 1HNZJ 2HNDA 2IAJA 2MKIA 1R8PA 4K0KF 2DHSA 2KM8C 3CIMA 1FRIA 2FQQB 1M1GA 2A3JA 3PFOA 5HROA 2GO9A 4B9LA 2ADBA 4O0IA 5E3CA 2W9CA 3KLIA 3T1YJ 4JI0J 4YQWA 3M8WA 2KB2A 1VRTB 3DLKB 1S12A 1AZSB 2VF3A 4RO0A 4AE5A 4I2QA 4C3LA 2J9EA 1NDLA 4DV5J 1LK5A 2ZZTA 3CCSS 2OPQA 3PX4A 2B6AB 1TKXB 3H98A 4DN0A 1EETB 1XMQF 4QYZJ 3AQPA 5ETVA 3EM1A 1SL2A 2DR6A 1DZ5A 3KK2B 3NL0A 3KJFB 4NXMJ 4P73A 5F0WA 3I0SB 1XERA 5BJRA 3LPEA 1JWWA 1HBOB 1X0FA 1RYSA 5KFLA 4LFAJ 1IKWA 3VV2B 2D3OR 4LMZA 3N6NA 1CULB 2NR0A 3HSGA 4ECTA 5T7LA 2ZJQQ 4AQYF 1S6PA 4V19J 1R6YA 2UXDJ 4K59A 2ZBPA 1QE1A 1C4CA 4C0BA 4RZRA 1SKWA 2DTJA 1YJUA 3HCXA 1N34F 1JIHA 4TLQA 2Q79A 5D6GA 3LF0A 4KO0A 2R7OA 1H0HB 4IDKA 5KG1A 2CWKA 1U4BA 1GEHA 1VQYA 3IFEA 2XSJA 4KRWA 1N8RT 1HBNB 1S1TB 3W8GA 3BO4A 2PT0A 2XI3A 1VCTA 5KG2A 2YH0A 1HFEL 4KFBB 4DX8H 1RHKB 1VJQA 4GVBB 3OVAA 4LF9F 1IKYB 3SIPB 1P1TA 5B0EA 1S5ZA 5E0OA 2HIQA 2XLJA 1P1LA 1WOOA 3L7UA 4LT6A 3E8OA 1FRKA 4MIBA 2GGPB 4B3SF 4P74A 2FJVA 3HD1A 2IM1A 2D9PA 1HHQA 3EICA 3GCWP 3U1NA 3PIPQ 2XLIA 2G2OA 1FJGF 4JI4J 3GJQB 2LDYA 2E7XA 2MQ8A 2LEPA 4XK8C 3T5KA 4PKDB 2RDJA 5RUBA 1T03A 4U6PA 3AHPA 4TN2A 1IBKF 4B9SA 2BKNA 1HI8A 2HBQB 4C4WA 1VK8A 1KQGB 4U95A 5HSPA 3EJMA 4W92B 4QWCA 2DGOA 2EG1A 4KHRA 4OYIA 1YJVA 4X64J 4CNYA 4ZIVA 4NA3A 4WP3A 4KH0B 2VA3A 4O3SA 2IAJB 2CDRB 3CNQP 4C0OC 3DC2A 5CYJA 5IXUA 4N41A 2IY5B 5AJ3J 5HROB 1CEZA 2ABYA 3G6ES 2W9CB 1JJ4A 4OZLA 3C19A 1FRMA 4F4AA 2DCUB 2Z57B 3RB4A 3VALA 4HDGA 2EBGA 4I2QB 3GG1A 4CT8A 1T9TA 2VODA 2B51A 1HD1A 4PXBA 2BQ3A 2OPQB 2C42A 2ASLA 3AOBA 1TKZA 1IBMF 3NMAA 1D8ZA 4FPRA 5GMEA 1FT8A 3CGIA 2F63A 2H3EB 1WEYA 2YNHB 4Z7CA 4N56A 2MSSA 5EN1A 1IR1A 1GX6A 3UO0A 1RCOB 2XY6A 1WOSA 4DPOA 4N7TA 5I4MA 1WHWA 3NGKA 3MTJA 3RZAA 2AGPA 1IKWB 2PO4A 5IWAF 1M5KC 5KFWA 2P6TA 1ULRA 2YKPA 5T7LB 1FCAA 3ICLA 3Q2TC 1S6PB 3C16A 2P9GA 5BXIA 3IMQJ 3W7BA 4DR4J 4CLSA 1EJ7L 3N0VA 3RBZA 3I82A 2QLBB 4KO0B 4M1KA 1RWUA 4NYZA 2W8KA 4JI7F 1U2CA 1UVKA 2B4VA 3V6JA 3ZC4A 4IDKB 3SCJE 2XSJB 4DR6F 2EWHA 1CJKA 2W2OP 1ZM9A 4YHHF 2VG6A 4DR3F 2AMCB 2Y8WA 3ITHA 2PFDA 2JNJA 1L5UA 1JX4A 2UUBJ 2UXBJ 1B99A 4GKJJ 4L3NA 3HULA 4NXNF 1IWAA 1DTTA 4LR7A 4DL4A 1PYTA 4DSKA 2HQCA 2GHPA 1XMOF 2CJQA 4K4UA 4X84A 4DL0C 1HR0J 3CB4A 3RBXA 4CWBA 4NZ7A 3WQPA 2AD9A 2HVHA 1P27B 4C8OA 3H8YA 3TJAA 1T03B 3TI0A 2GFFA 2P9EA 2P6SA 4X66J 4PCQA 4F02A 3I56S 5IT0A 4WFZA 1HI0P 4JBCA 2F4VF 3NCQA 4OHVA 1TK8A 3HHDA 3H2UB 2XI2A 2Z8QA 1M5PC 3OPKA 3UPFA 2EPIA 3MCOA 2Q6BA 2UVUA 2GNKA 3FSYA 4WYLA 5C42A 3BQ1A 2IJFA 1T9XA 3G6VA 1SIWB 4Z2XA 3W2WA 2OO4A 1HQUA 1N4LA 3M2UB 1VQ7S 1HBUB 2DHAA 5AXLA 1LXJA 1MW7A 4WKRA 2R2UA 3NNCA 4UQTA 2XMJA 4L72B 4CM2A 3BEGB 2HWHA 3DI6A 1X4GA 3E01A 4LREA 1SC1B 4NXMF 4KHPJ 2HQDA 3WIVA 4I0WA 1OWXA 1RWPB 4DV3F 3CJ0A 1FDBA 3NGSA 2ZDPA 2RU3A 2VDHA 2BA9A 4ES1A 1S1WA 3PRDA 5J2NA 2WVBA 1SC3B 2MSTA 3RYLA 3KG4A 2H4YB 2ZUAA 4NLSA 2YBVA 1ZAVA 5KOXA 2VV5A 3C16B 3SYZA 4ECQA 5KFFA 3QAUA 1PJ6A 2VQEF 4KYZA 4OYPA 2FHMA 2IM3A 3MR6A 1KVIA 4AL5A 3R8YA 1KLMA 4ZVEA 1LNQA 3R5AA 4L6V3 1OQ6A 2DGQA 2NS1B 2FC9A 3FFIA 2BE2A 3CDWA 3R5JB 3BJYA 2QV6A 1UAWA 2KT2A 4NLDA 3G8TA 3M7VA 1DY3A 2VG6B 4CLTA 1FERA 2R7UA 1K0VA 2Z2ZA 3ITHB 4ZOSA 4UOCA 4DR1F 4C97A 4PEOA 2EK1A 4OI1A 3N28A 2NUUG 4NL5A 1XK8A 1WC5A 2DBBA 1QUPA 2W7OA 1PYOB 5DQGA 5DG9A 2UZAA 4LRBA 2MZ1A 5DQIA 3GQCA 2E9TA 2HPUA 2R7RA 2DRDA 2WZ1A 1VQOS 4NLGA 1FNMA 2HHHJ 2KYZA 4F3QA 1U8WA 2IJRA 2A2DA 4TXSA 2OTJS 2IA0A 2GJIA 2R42A 3MDFA 3A8KA 2N7CA 2E5LJ 3K7RA 2VJVA 2N3LA 2KDOA 1MMLA 4CO2A 4JI8J 2UUCF 2XZWA 2QX0A 1F0XA 2PMWA 5C42B 2G1HA 4A8FA 2MZJA 3W2WB 3K8VA 1Q8KA 1HQUB 4J90A 4IG0A 4E98A 3T5LA 3I31A 3IA0A 4PRFA 4NYPA 3DLJA 2HMIA 3ISNC 2K8GA 3J81j 4G1QA 2KO1A 4ED3A 4DU7A 4A46A 5KT2A 2DR9A 1NK5A 3DI6B 3Q8PB 3E01B 3GIMA 4ENOA 3JAMY 5T14A 2G1DA 3ZNUA 1XIQA 1PGZA 3CF5Q 3J7ZT 3TZXA 3AJ1A 3FJ2A 2GHWA 2MKCA 1YITS 3IS9A 4DZ6A 1OY6A 2CJXB 5J2NB 1ZTTA 3RAMA 3GYGA 3GJSB 4U96A 4ZPBA 1O8BA 5KFGA 5HANA 4NE9C 5EWGA 3L7OA 5DQHA 2WONA 1HQ2A 1NH8A 3J7YU 4WTYA 2KVQE 4ILMA 3VGVA 1EP4A 1TFWA 4ZDNA 3M8QA 5LM7E 2HNYA 2PSZA 3R6LB 4OX8A 3UN5A 1VRQC 1RISA 2AEMA 3FFIB 2XNQA 1NHVA 2BE2B 2HWIA 4A4JA 3DRSA 3PX0A 2AZ3A 3AFGA 2C3UA 4P9SA 2O66A 4F0KA 1JNRB 2D9OA 3OTDA 3TUZC 1Z1ZA 3GPAA 2QT7A 1PO6A 5DO2A 4NPOA 3W62A 4CLWA 2C1EB 2HAIA 3CCZA 4DQPA 4FXVA 1VLOA 3AY0A 5B0FA 3RW7A 4DX7A 5DM6Q 5F8JA 4EFAC 2RSQA 2RRAA 2LU1A 2ZHAA 3F44A 1CJUA 1NRKA 3FBBA 3AOAA 3O3LA 3DOLB 2NZ4A 2AYMA 1NUEA 1LW0A 3B6BA 4PUOA 3RU0A 2ZBQA 3NY0A 2J0WA 3RJMB 1S7IA 2DGVA 4F0MA 4YB7A 2BRLA 5K5MA 4M5JA 4OI4A 2PA3A 2JJ4D 2VB6A 4F7VA 2GQQA 2OTLS 1HW8A 1VQ9S 3IAM9 2R7SA 1WF1A 5D3GA 2IBOA 2IRYA 3CPWR 1PKUA 2Y3YA 2MXYA 2B9YA 2DCLA 2FZKB 5DZ6A 2X3DA 3PV8A 5G0RA 4C8LA 3PJWA 1H6KX 2B9WA 1R0CB 2M0GB 2VPYB 3J80Y 4FVMA 4DQIA 2MB0B 4IFVB 1IWGA 4KPYA 3ENAA 2QLFB 3ZZYA 3D0GE 4IG0B 4WCEQ 4K2XA 1FO1A 2ASYA 4MK7A 2PMHA 1Y3JA 3CJ3A 3GLJA 1VLYA 1IBLJ 2JOQA 1URRA 1X9WA 1PAEX 3M30A 2GJFA 4B3MJ 3TX0A 4I67A 3U1MA 1U1NA 3IS9B 3CO0P 3TQ1A 1QJHA 4ZVPB 2RIJA 1RHJB 4DV7J 4QCLA 1QM9A 4DL6A 1HA1A 3W3SA 1DFDA 5HL7Q 3HSJA 3NMRA 2WONB 1F1BB 3VGTA 3KUHA 4F3MA 2B56A 1V6HA 5HP1B 3CO9A 5I42A 1EP4B 3V6KA 3QJLA 4DJBA 3M8QB 4LF6F 4K4YA 4EYHB 4BLGA 2A1BA 2BJ9A 2MKHA 1FE4A 1F5BA 5KT5A 7AT1B 4LFBJ 3E2EA 1HW9A 3VAHA 1R89A 1RT5B 1UP1A 5D0RA 1AFJA 5F8NA 1SJ3P 5ETTA 3ETMA 3QIPA 4Y2CA 4XO0A 5IS2A 3NWGA 1HI1A 1FKAF 2LKZA 3MEDA 4O23A 5LSRA 1WOPA 1IXKA 3CWJA 5ETLA 4AD6A 1VQ5S 2BQUA 2JLEA 3BS9A 3MPUB 2R8GA 1WTFA 3ZTSA 4QR0A 2KVIA 3JSMA 1EKRA 2BQRA 3LANA 4CH1A 1CJUB 1LW0B 1XR5A 4E2FB 4PUOB 3QO9A 4RL1A 4MKBA 3TAMB 1KOHA 1AYEA 4KHMA 6FDRA 3VAMA 1PBAA 1JQGA 4ZCLA 1J5OA 3G8SA 3CXCR 4BDPA 1XNRJ 1YRXA 3UVJA 4DZDA 5D3GB 4ZLPA 4Q0BA 2AYEA 4J9PA 3TA1A 2LDIA 3KKFA 1K44A 4X4QA 2LYVA 5G0RB 3FBEA 2DNKA 1L3SA 3CVKA 4CRJA 2JHEA 3NP5A 2NZCA 1CJVA 2B4OA 4F3OA 3OLBA 2QEXS 4I56A 2AYBA 5HAOA 3EDRB 3HXMA 2PEHA 3AJDA 3MXHP 2VDIA 3DXBA 1VC0A 5KG4A 3GP9A 3MMCA 2CPHA 1QTMA 2L9DA 3M30B 2VJUA 2HHQA 4KV8A 2OMLA 2DRAA 2DNYA 4USIA 4XAKA 4EGLA 1YG0A 4HTJA 1RAJA 3RBEA 4FKXA 4OJHA 3F41A 4B17A 3HSDA 3DMJA 4RWXA 2MLXA 2QZ8A 1KVKA 1QD1A 1S4FA 3AB2B 4EWTA 2XY5A 3D7SB 3Q8RB 4OZ5A 1SQFA 2LFVA 3UDEA 1UW9A 3D2WA 2DNGA 5I42B 4IYQA 4KGMA 3MOJB 3BGFA 1WKLA 5M2UA 3MM9A 4DUZJ 1Z2ZA 3PW2A 2YWKA 2OPPA 4DFJA 3K2YA 1JJ2R 2RH3A 1B0TA 2X3GA 1KR4A 3U27A 1FRXA 2FVCA 3POTA 1NKEA 1VHIA 3MEDB 5T41A 1IM4A 3PRBA 2BM1A 3NOCA 1GNKA 4FN5A 3R5DA 1XWLA 1KNZA 1VS3A 1N54B 3MUVP 3PHEA 4NWBA 2N4CA 2ZH2A 3I87A 3JSMB 2M88A 1XR7A 1DARA 1JXLA 2ZHBA 4ZJLA 1TUVA 2DJWA 4TNOA 3T6BA 3PACA 3N6MA 2JH3A 3D0IE 2DO0A 2G9OA 2L41A 1RT7A 4BWMA 2I38A 3QLHA 2JEIA 5GVQA 1J5OB 5GAHU 4J5OA 3IC1A 2OUGA 2M2BA 1WKKA 3VAIA 1ZA2B 3UVJB 4YB5A 5B0BA 3MPDA 2CWXA 2LVWA 4QIEA 4Q0BB 3CMQA 2MZSA 3AD8C 2ZHOA 3CCLS 1I5OB 3LH2S 3IM9A 3W5YA 4NCGA 3FNNA 1Q0NA 2V8VA 1N5SA 1WNEA 3KNAA 3MTKA 1RWKB 5KFXA 1CJVB 3GJTB 3QT5A 3K5NA 2RDIA 3FEYB 1VQ6S 1Z4UA 4V19X 1L3TA 2UV8G 4X4OA 3K0JA 4LF5F 1YIJS 2YWGA 4WTOB 3GIJA 4XPEA 2J0XA 1U1MA 2QO3A 1KWMA 4ZVOB 1RT6B 2LQJA 2AGQA 3CUNA 1TKTA 3UR0A 2IVMA 1R8AA 3O44A 4KV8B 1R3NA 2FHKA 1RJJA 5JMNA 4CNZA 4TY8A 4OZNA 4CTAA 1VQ4S 8AT1B 1IR0A 1DHMA 1OYEA 4FNHA 1EQ0A 3DMJB 3NS5A 3OTEA 3M8PA 2CPYA 2P2CB 2WBRA 4QPTA 2FY1A 3R9LA 2G2YA 2EFPA 2XSFA 1MLAA 2M9KA 5CD4H 3OHBA 5LT5A 3DRRB 2IC3A 5D78A 3W5ZA 3WC2A 1S0NA 3HPOA 3M2VA 2DVIA 2EXUA 1TELA 4CLYA 3L09A 4TU9A 2OPPB 2UU9F 4FXDA 3HLUA 3JQJA 2CJBA 3DYAA 1SUQA 3D3CJ 3TR5A 1UFWA 1OPIA 3I5CA 4I7FA 3TNVA 5DDOC 1N5VA 3POTB 2BDPA 2XMVA 2IVFB 4KIAA 3PKMA 3GFZA 1K9MT 3D6FB 2CQCA 4F36A 1X8DA 4OYZA 1X5SA 3BPSP 2GVZA 1RAFB 1T02A 4K4TA 3I0RA 4M5GA 4M5MA 2E7WA 1YJ9S 4DV4J 3HP6A 1YRUA 3TP2A 4DFMA 1NJYA 2M4MA 3HKZD 3LGNA 1R8HA 3E3XA 4C8KA 3VF0B 1YHQS 1VIOA 4XDDA 3MAQA 4HACA 3UQSA 4UY85 4ZPCA 2KRBA 2MMYA 2VFSA 1UPPA 3RAXA 4IRCA 2V2VA 1HNWJ 4HVZA 1RT7B 3QLHB 2MQOA 2C3YA 1FKPA 4KTQA 2VPZB 1TQLA 4X65J 4CO5A 2N82B 3AJ2A 3H5YA 1M1HA 1CSJA 1CQMA 2OPSA 5HATA 4TYAA 3DRYA 4NCGB 2HS4A 4KKOA 5A8WA 4N8NA 3G9CA 2CYYA 2VFVA 4TU8A 2XO6A 4ZJOA 4USVA 1KS2A 4QYRA 2FLLA 5KTQA 3ENVA 2L9NA 3FMWA 2YX1A 3FCVA 1RACB 1RWWB 3IXQA 2DT9A 1H38A 1LKZA 5B09A 3MZIA 2J8AA 2HWTA 5CYMB 1TKTB 1TAQA 4JYAF 1NJWA 3T1HJ 3PW4A 3TWZA 4Y34A 2J5AA 2D3UA 1UEVA 3GE9A 4OJ1A 1I94J 1H7XA 1UMJA 2B3TB 2IHR1 4PXCA 2ZH7A 3HI9A 4DXLA 4FNIA 4TY8B 4CTAB 4FF4A 2NXUA 3CE8A 1VRUA 3PTWA 2KHDA 4DV6F 1NKCA 2CQ4A 2BE7D 2BYCA 4X62J 3OL9A 2FUG9 1Y00A 2VQFJ 4PWUA 2R7VA 4ECZA 2E44A 2VPXB 1REVA 4B9VA 2WB4A 5GAEU 5KFJA 2UUTA 2IC3B 3UCZP 5J2QA 2A6MA 3RW6A 4DDFA 3M2VB 4ZPWR 3JAMU 5L8RC 1NK4A 1GX5A 1JLGA 1UVJA 1FJ7A 3ZFVA 2ZUGA 2DHGA 1S7HA 1T0TV 1DJ0A 3DYAB 4IUFA 1SUQB 2VONA 3BR9A 2ZKTA 3QPIA 1BQXA 5D4PA 2ZH8A 3I9ZA 4I7FB 3NWRA 3V5RA 3K5PA 2HS3A 3CSKA 4Y0FA 2AEFA 1T3NA 4PYAA 4WFYA 4U7UD 2CADA 3OSNA 3CULA 1Y4ZB 2AQ4A 2KU7A 4L76A 3BN7A 3BO2A 2VC0A 1H2UX 2QFJA 1KP6A 4HACB 4JV5J 1TVRB 3N4WA 3EE3A 2YPYA 1B7FA 1FKOA 3R3TA 3MD1A 1L3KA 1D9AA 4ZA1A 4WFAQ 3RRKA 3T1AA 1IBCB 5D4NA 1FKPB 2VBWA 3AXKA 3D54A 3MM5A 1SJ1A 4OX9J 3KMQA 5CCLA 1RXOB 1HL6A 2ILYA 3RUBL 4JI5J 4M63A 3TW0A 2OPSB 2IMWP 4JI2F 4LSLA 3Q8YA 1WC3A 5F9LA 2MKSA 3HHKA 3H59A 2LMIA 2BEFA 2J9DA 4RUAA 4ID8A 3BGRA 4ED8A 5J1PA 4Q43A 1WUUA 1RADB 4R0EA 1I51B 4A8KA 4ERDA 4EO8A 2WW4A 4UF4A 4DR7F 2YQ0A 4AFFA 2DGTA 2UP1A 5A6WA 1IVZA 4DG1A 1VISA 2DIUA 3M2RA 2FB0A 4ZN3A 2ZNZA 4DL5A 2ZD1B 4DUYJ 1D09B 2VL1A 3BKTA 3MEEA 4K2JA 1LWCA 1C1CA 1ZZFA 2H5IB 3MR3A 3J80U 5IV4A 4DV2F 4ZKAA 5KFBA 1AT1B 4LSNB 3PR5B 3K57A 2XTJP 2YNGA 2JWNA 4LF7F 2YXLA 5FD1A 4A8SA 4NLYA 3OFEA 3ZZOA 4NCAA 1UZDA 1YTYA 2CPIA 2F7VA 2RMLA 1REVB 1W7WA 4F4WA 2ZM6J 1U1LA 4C48A 5J2QB 2XS2A 5CD4A 1F2GA 2CZ9A 1JLGB 1FX4A 4J9UE 4NMXA 3RTVA 2C3OA 3QWUA 3H2VE 3DHXA 3T3FA 2XMKA 3QFWA 3RBDA 4CH0S 3UN2A 3S8SA 4N8OA 1HARA 3QZ8A 3OUYA 2COLA 1G7CB 2CQDA 2RRNA 3M05A 3CJ5A 5D77A 1X4FA 3QGPA 2DB1A 1NPRA 5JJBA 3BPDA 2VBZA 4QZVB 3D3BJ 4CLKA 1R43A 4DL7A 2DIVA 1WTBA 3MAHA 2IPOB 1PCAA 2JVRA 3NGTA 3S6EA 4LF8J 5KFZA 1BQMA 2DITA 1RTIA 5DDQC 3I32A 3J7YI 1C0TA 4HH0A 2E1CA 3JSRA 3KMSA 1N6QA 1TK5A 4OIXA 1ZA1B 1AUDA 3MM5B 2J8SA 3CD7A 4JV1A 5LJ5Y 3HT0A 2HLUA 3P96A 2GQCA 3IO1A 1K1SA 4KGVB 4JI3J 2HGLA 4LSLB 4QW9A 1S6OA 4YMEA 1NDKA 2GX8A 2HFSA 3BGRB 1XBWA 1GMWA 3NOGA 4YR2A 5IM0A 3TVYA 3EXYA 1SCJB 3N01A 2ZDOA 1HD0A 4IKAA 2ZH4A 3C3LA 2VBXA 1JLBA 4CLUA 3JS9A 3BQ2A 5HVHA 2V8PA 3CMAS 4DR5F 3LW5C 2IMOA 4DG1B 3CC4S 1I94F 4F4ZA 4H4KA 3TA0A 2YY3A 3M2RB 4X2BA 4NI2A 3GIRA 4QQBA 3W65A 1YI2S 4RBTA 3MEEB 4U7UK 2C2DA 1LWCB 1C1CB 5JVGQ 5I3QA 1BQNA 2V4RA 1RWVB 1REGX 3EDQB 2KZMA 1N56A 3UN3A 2CRLA 4DCJB 2QMWA 3MMJA 1DLOA 4LIWA 2ZH5A 4KJIA 1KSPA 2V4QA 1RAGB 4LUBA 1LW2A 4MMOA 3HVRA 4K7QA 2Z4PA 3JTOA 4RNOA 3BGUA 1P6TA 2RS8A 2R4FA 4I6WA 2C2KB 4Y6IA 1I3OB 1U25A 3LWMA 1SIZA 1KC8T 3TVKA 4OLPA 2X1FA 3OUYB 1X5OA 3M6UA 4OHXA 3IAS9 5ADZA 2FVQA 1TL1A 2UXCF 4KAIA 2FHOB 1RAAB 4DLGA 2ZFHA 4OMFG 2FJDB 4Y2MA 3LGMA 1S9EA 1KD1T 2QA2A 2RD5C 4AT1B 3OW2R 3FBFA 3QT8A 1FXRA 1BY9A 4K4ZA 2IJNA 4X4RA 3C46A 1RT2B 1YGYA 1BQMB 3FRZA 1OPZA 1RTIB 4USJC 2HW3A 2PC6A 2ACMA 1HNVB 1QSYA 2OHDA 2K3KA 5H9FJ 2LEBA 2WSEC 1N6QB 4DV0F 1N33J 1HBMA 4IOAQ 4OFZA 5M2RA 3D1OA 4JI5F 3R6GB 2VPWB 2K7JA 3CTRA 1IKXA 4Q44A 4NA2A 1L3UA 4F4XA 1LK7A 2DXDA 5KG3A 2P9CA 1YSJA 5HBMA 3FEZA 3ADAC 5EUHA 1JMTA 2CKWA 2QSWA 4K0KJ 5IM0B 3CT9A 1MWZA 4LSZB 5G4DA 1QSSA 4KB7A 2XY7A 2CAJA 3HHLA 2GMJA 1BXNA 4MFBA 4MT1A 4W4MA 3EWGA 2HGNA 4NI2B 1XMQJ 5F3ZA 3NGUA 2D1CA 5EWEA 4EBCA 2DGXA 3LA0A 2ZC3A 1BQNB 2HQGA 3KDOA 2RDDA 4MYTA 1GAOA 2ASJA 3KLEA 4UUXA 4WIIA 1NK7A 2CVEA 4OJGA 4ZPDA 2RHSB 2W2PP 1DLOB 3F0NA 2HBRB 1CG2A 1SXLA 2OKQA 1PC5A 1KN6A 1OQ3A 4AQYJ 1YKWA 1LW2B 2WB1D 1W25A 3S1TA 1U1KA 5FDLA 2HHTA 2GIQA 2NPIA 4KQZA 5KOWA 1U09A 2V9KA 4UZBA 2MKKA 1SQEA 1H72C 2E5JA 1VC6A 2V6AA 1WSRA 3K8WA 4NOHA 2U1AA 3OTCA 3UI3A 4CI0B 3QBCA 4A8OA 3KHHA 5J2MA 2AJ4A 2Y9HA 3D1QA 3OXLA 3OVBA 3KJVB 4ZLJA 1FRHA 4LF9J 4DS4A 2Z2MA 4H54A 4G1IA 4RBUA 4A8WA 3O5TB 1B4SA 1S9EB 1FESA 1SJQA 3VQTA 4HT7A 4ETZA 2YKAA 3DOKB 2CPXA 4U67Q 2ZOGA 2RE1A 1UWAA 4NASA 4CH7A 1M0SA 3ILLA 1B0PA 3UD4P 4OHWA 1FJGJ 1Q1KA 4YOEA 4DBQA 3QIDA 1JLFA 4WXOA 1HBMB 3CEDA 5HJXA 1Y7PA 1IBKJ 1SQGA 4OYWA 2JEGA 3HFKA 2MGZA 1NPKA 1IKXB 3IRWP 4X4VA 4WE1A 1U26A 3N5FA 4C7QA 5B0AA 2QA4G 1DQAA 4ZHRA 1BLUA 3WC0A 2YNIA 5HBMB 3BDPA 1ZS6A 3C15B 1RU1A 1H74A 2AJ2A 3P8BB 4FBTA 2E1RA 5DG7A 1S57A 4FS1A 1D8YA 3QRQA 2OD6A 3H4DA 2X7IA 2DXFA 3DLKA 2LQBA 3G87A 3N79A 3HHLB 2GIFA 4P2SA 3I96A 3FMBA 4JI1F 1AXQA 3DHWC 4MFBB 3NRBA 4ECVA 3QRPA 2YWWA 4IH5A 1A0OB 3KUEA 4DFPA 5F8HA 4RLEA 4PG6A 1IBMJ 2CNOB 3JSBA 4ALZA 3MM7A 3Q24A 3CCMS 2MQPA 1TP7A 1XN9A 5GAHI 5KFNA 1FD8A 3UR3C 4ID5A 4X4SA 4WFXA 3KLEB 4B02A 3TOQA 2NSBA 4B9NA 4M5LA 2KTQA 2XGPA 2R8IA 1UZHA 5HMWA 5IWAJ 4J9KA 3IWLA 3IRXB 1S59A 1S48A 1SBRA 2GHVC 5DZ7A 2HKEA 2OSQA 3FCHA 4L75A 4QIVA 1APSA 2FGCA 2DHHA 3PG9A 4YY3F 2PMZD 1S1UA 1G4CA 4F67A 3AD9C 3M1VB 3CW2C 4JI7J 1L3VA 1RUSA 1WC1A 2G4BA 1P8GA 3IBFB 4WJBA 2R7WA 2AHOB 3ZTRA 4DR6J 5J2MB 1VJWA 5LSOA 4YHHJ 4UOGA 2V69A 4C2MA 4ZVQB 2DH9A 4DR3J 2C2MB 3MCSA 1LWFA 2YWFA 1ZZNA 2QYGA 3Q8VA 3ILIA 4A8QA 4QW8A 1Y11A 2GGPA 2X1GA 1RQ0A 5KFQA 2JFKA 3CD5A 2DNQA 3TJ9A 4NXNJ 4F2SA 3DRXA 4I2PB 4ZCKA 3MR5A 3W5XA 4GKKF 1VFJA 3SQOP 4ZVTB 3RR7A 5H1SV 4PZVA 1XMOJ 2QL9B 2KFNA 3CDBA 1RCXB 3EGNA 4RNMA 3VAGA 2C22A 4HTIA 2V2KA 2DY1A 4FS2A 4MK9A 2KRRA 3EZ5A 3GWCA 4J91A 2V8HA 2W4PA 4CM0A 4ETXA 2ZH6A 2MGZB 1SJFA 3FUYA 2HLTA 2OEMA 3CJRA 2F4VJ 1AB8A 1S97A 5KT6A 3J7Z5 5F8MA 3GV8B 2YNIB 4PR6A 1XQIA 5J1NA 5L1JA 3MM6A 4RW7B 1SVDA 1JKHB 1UEUA 5DJBA 3OHAA 3BR8A 1SB6A 2B8PA 3ONQA 2MDAA 1JJCB 1E6VB 3B4MA 1PG5B 2IIHA 2XQCA 1FDDA 1CS4B 2R7QA 4Y2IA 5B7WA 2UVWA 1S6QA 1SC4B 2NQPA 2DPIA 4IQXA 2HS0A 4QJVA 2YNHA 3CJKA 4WU3A 3MM7B 2CUYA 4J9LA 2I5JA 3WBZA 4H4KC 4ANDA 3GMGA 2XMTA 4DV3J 4ZMMA 1RE1B 3O6QA 4V1Ak 4ID5B 5KAKA 2KJWA 4UUWA 1T7PA 2M52A 5IOLA 3HM9A 3SCLE 4RKUC 2OFHX 4G1PA 4CIOA 5CH7B 3LQVA 3AXMA 4IQMA 2CJYB 1FX2A 3UFCX 3TA2A 1IKVA 3M8YA 3PDNA 1KQFB 2N4DA 3K17A 5LXRA 3OTOF 3CCES 2VQEJ 1GXTA 2M8HA 3NGDA 2GC8A 2NYIA 4ZVHA 1S1UB 1PC4A 2AYGA 1ZETA 4NX9A 1UPMB 1NSPA 2CA9A 4ZP7A 3JTNA 1B70B 2X1AA 1S9GA 4FVCA 2LECA 1MMNA 1LWFB 1QVGR 1F9HA 4NZ0A 4G3IA 1KDNA 3NS7B 4DR1J 1OYDA 2MHEA 3PRVA 3DLGB 4HLBA 4CDIA 2ZH1A 2HHPA 5KG6A 3THTA 3EZOA 3UCUP 3PCOB 2QRRA 1OMSA 3PIOQ 4ZVGA 1ICEB 5GAEI 4OZ3A 4ZIWA 3UW1A 3J81Y 3JQKA 2ZITA 3VHQA 2A2CA 2AIRB 2CG4A 3FSXA 4PG4A 2M8DB 3IM8A 3D6HB 3DU5A 5CZXA 2G0CA 5JXSA 2E5HA 1SH2A 2ZKUA 2Y1IA 4QIGA 2FVRA 1N32F 1SH3A 4MH8A 1UFLA 2CPDA 1RWXB 2NXNA 1WHYA 4QWDA 3DN9A 3D68A 2W7AA 2UUCJ 3NNHA 3MM6B 4ED2A 3RB3A 2PA8D 2AJFE 4YR3A 2FLPA 3MCNA 1V3SA 3HX9A 1XR6A 3M2UA 4KBIA 1HBUA 4M95A 4Z7YA 4M94A 2DNHA 1LQ9A 3PNIA 3IBWA 2XO7A 3EMTA 2YPZA 2BACA 2ZEJA 1S6QB 2Z56B 2CQHA 3MCMA 2FDNA 5DGAA 2UUWA 2NYHA 4MK8A 3KUGA 3BO3A 3HHLC 4RW4B 2FJWA 3CJKB 1VOMA 5H9FK 2BJ8A 2QC3A 4K8RA 2I5JB 2JRSA 3DXSX 2E5IA 3W66A 3NCRA 2YTCA 2V5HG 1SL1A 3C8YA 3OJSA 4TQSA 2CZ4A 4USHA 2YKMA 1TK0A 2D41A 2H1YA 5L1IA 3MAAA 1N36F 4YS2A 1BC6A 1O6XA 3CCQS 1IKVB 2KXHA 1R7IA 2H9ZA 4MKVA 4HT5A 1KQKA 4DPWA 5M2PA 2ROGA 4RW6A 2RB7A 3LP0A 1YX2A 5IT9Y 2ERRA 1TL3A 3E51A 1UWBA 2O5DA 4Y00A 1N5QA 2XMUA 3SQGA 2HZVA 1BD6A 5ETPA 1SL0A 3QT6A 2FVSA 2KI2A 4GVLA 2QGFB 4C6AA 4NYOA 1UVIA 2DR7A 1V9OA 2OAUA 3HT3A 2WW8A 1S9GB 2RKIA 2M3DA 4F4YA 2RS2A 1O5JA 1XNQF 5KG5A 1EZZB 4DX6A 2QTWA 1VMBA 2X1BA 4DPUA 3L95X 2KXFA 5HJYA 2I9SA 4IRDA 1F5CA 5IFMA 3R5BA 2DGUA 3D28A 5A6PA 5LXYA 3PX6A 5KT7A 4ZVSB 3QT7A 3GG0A 4NLPA 1OSCA 1UKUA 4HKQA 2ADCA 3QJPA 1FDNA 8RUCA 3N9UC 1ZAWA 1EHWA 1N5YA 4DEZA 3BBCA 2Q3PA 3MM8A 1YK9A 2U2FA 3CCJS 3BSOA 3HFZB 4ED0A 5E33A 1U7LA 4HI2A 4EBEA 4FBUA 2MZTA 1NZ8A 1CVJA 4O0NA 2FHJA 3KOAA 1RKIA 5A0YA 1HNXF 1RT3A 3FK4A 1G6BA 4W90B 3HVTA 3IBCB 4ANCA 2MLZA 4ECYA 1KQSR 1FWPA 4O44A 4Y3CA 3TZYA 3JYTB 2CIMA 2EVZA 4ZVFA 3ENWA 4F8RA 1TL7B 2Z0GA 2V68A 3MURP 3DLLQ 3AA9A 3K59A 1LV5A 4M5NA 2QIFA 2B43A 2BJ7A 4XPCA 5E3QA 2HHVA 1Q81T 1CC8A 5C2GA 1M5HA 4IO1A 3G6YA 4MKYA 5AE1A 3C66A 4YB1P 3ILOA 3D0HE 2RVJA 2YKMB 1U0HA 4ES3A 3ZO7A 4TU7A 1RBLA 2G0IA 3NKYA 3BN4A 4ZPVR 3MAAB 2DXEA 1RTDA 2HYIB 1FD2A 1Q16B 2YQ1A 3ZTPA 1DAXA 4AL6A 2JVOA 1SKSA 2H4WB 4BC7A 4OX6A 1X4AA 3EVWA 3R5CA 1TUGB 2ROEA 4RW6B 1SPBP 1PSDA 2J76E 3LP0B 5HLFB 1ZTWA 4P7TA 1N88A 3LAMA 2KG0A 2ZH9A 4HDHA 1TL3B 2BRKA 1UWBB 3D5MA 5F8IA 4LF6J 3HJFA 3SQGB 1NK8A 2J7KA 1HWIA 1VQ8S 4NMLA 4ED1A 5L39A 4QIFA 2F4FA 4K4VA 1BE4A 1H73A 2QSFA 2RKIB 1Q8BA 5FIIA 4YP3A 1Q5VA 1NKBA 1VBZA 2V63A 3A13A 2DEIA 2FIUA 5CYQA 1JNZB 2IM2A 1WI8A 2HVEA 3CCUS 2XULA 1X4EA 3FGVA 5HMXA 3RRHA 1SKRA 5KFYA 4USTA 3DOLA 2B7CB 3LP1A 4C3KA 2W25A 4B3RF 2XZTB 4QR1A 4DQQA 3HK2A 1BWEA 3SBMA 3H90A 2W01A 4UY8T 1U2RA 2XHWA 1FWKA 3TX8A 1RWMB 2V2ZA 5LMUJ 1OJ4A 1N5YB 1X60A 2LXFA 3MM8B 2MZRA 1OS5A 4TYBA 1NLKL 5ETNA 3V4IA 3UWTA 4HHUA 4Q8EA 2KFZA 4IR9A 2ZWOA 3ISZA 1T9VA 3OR2A 1R6VA 1D9FA 4C98A 1M90T 5A0YB 1RT3B 3OFGA 4IFVA 3GCXP 1Z2LA 3HVTB 2V67A 3HZGA 4O44B 3EPIA 5IQ6A 5AXNA 1U2FA 2RF2A 4LRDA 2XYHB 1U6ZA 4PG7A 1RZMA 3D6MB 3QGGA 3VVUA 1UJ6A 5LJ3Y 5HI7A 3T41A 1HWJA 2BVZA 2QMXA 4EYIB 4LJMA 5LSLA 3QZ7A 4XDCA 1TMMA 2CPEA 2LLZA 6FD1A 3Q0AA 5ETSA 3GR0A 4DI6A 2OH2A 1U0HB 2GQ2A 1RA6A 2LQ5A 1U24A 3C14A 2ZZMA 2I6WA 3EVOA 2M7SA 3B78A 2HBYB 2HHXA 5KFKA 3TZZA 1KONA 3N5BA 1F60B 1RTDB 1FEEA 4EU0A 3OD2A 1NHUA 3TEHB 2P5VA 3A8IA 5HP1A 2IYIA 2Z2YB 4ELTA 1R8CA 5KFCA 4PPDA 5E5NA 2EC2A 3A4TA 4WPAA 4UOHA 3H20A 1Q53A 5A8KA 1FNXH 4L73A 2B4PA 1IJEB 3PO5A 3D9BA 1RT5A 2BR0A 1RLDA 5HQLA 2MJUA 3HKWA 1U1OA 2ZOMA 3GV7B 3HFVA 1NK6A 2MTLA 2EBEA 1VBYA 1WD6A 4QYZK 1AROP 4OI0A 4WWSA 5EX0A 2KN4A 2W2NP 5CYQB 2WTFA 3U1LA 3IGNA 2EI5A 4H4OA 2MKJA 1EKSA 3PXGa 3LP1B 5EGYA 2ZOFA 2GIRA 2WRMA 1RWNB 3PVXA 3TAMA 1FRJA 4PXDA 4OYOA 1P9YA 4DQSA 1NM2A 4ES2A 5DDPC 1XMBA 3R5GA 4P7VA 4LQ9A 1RKJA 6AT1B 2VFRA 2Y0SD 2CNNB 4ER8A 1UCNA 1VBXA 4RJVA 3CC2S 5E7OB 2QN6B 4NCBA 1E6YA 4P72A 2GAGC 3V4IB 1ZM4A 1N52B 2XM3A 3DU6A 2ZJPQ 2MPUA 4PAAA 4CLZA 1J5EF 3JQMA 2HBZB 3QRRA 3OR2B 2BX6A 1VQLS 3H42A 2EEYA 3AH6A 1MN9A 4OI2A 3PO4A 2KFYA 3IP0A 2ALZA 1TTHB 1V3ZA 3IN5A 1FWLA 4LF5J 1F2HA 1WDDA 2RF2B 3ETOA 4I69A 2GV1A 5FLXU 2JFDA 3CC7S 4IOCQ 1G2EA 1OY8A 2V94A 1RTJA 4N77A 2YKOA 5LL6d 1X4CA 2BW2A 3OL8A 3I9V9 4J9RA 2BANA 5HMYA 3BGLA 4EO6A 3C14B 4MIAA 5KFTA 2CNKB 3WHIA 3C6TA 3FVYA 2WVCA 2GZOA 2FTRA 4OL8A 2L3MA 1SC6A 1BWVA 4GRSA 5L9XA 2CPJA 3LOUA 1F3FA 3F73A 2V34A 4XIUA 2YWHA 2MHNA 3EGZA 4DN9A 3OXFA 3CJ4A 2B9EA 5A8KB 4X4NA 2A10A 1LFPA 3LAKA 3X1LB 4RPFA 5KFIA 2UU9J 1A6LA 2DY9A 3DRPA 4GC6A 2VH7A 5F8LA 1JJHA 3DLBA 2RUSA 1HHSA 4KH1B 4B08A 1NNDA 1HYSB 3M32A 1UA0A 4FF3A 1ITPA 4CP5A 1H2TZ 5C2CA 4DFKA 4OX7A 3G96A 3SSSA 4OJ3A 3KLHA 9ATCB 2FC8A 1MU2A 4URQU 3FZBA 2BJDA 2XHCA 2BJ3A 2F1FA 4USWA 4H4OB 4GO7X 4F50A 4BC9A 4LRCA 4Q8FA 4C9DA 1QDUB 3GYXB 3H4BA 5LMUF 2HG4A 3MWBA 2CPZA 5I3UB 4A48A 2B4UA 1VQMS 4FYDA 2C2NA 1T8EA 3HDSA 3A1YG 2WAQD 2A18A 4DPYA 1V5IB 2V2QA 1IQZA 4CLLA 1E6YB 4C8NA 4LR8A 1WKJA 4TQRA 4DV1F 2YKQA 5BR8F 2WVDA 1YRTA 1IQTA 4URSA 1C4AA 3V81A 3W2VB 4LF2A 1ZPWX 1UEKA 2R8KA 5CCMA 2RQMA 4DCPB 4P2XA 1UJ5A 3GFYA 5KFUA 2OGUA 3R1HA 4TKTA 3J81U 4YN3B 3SFUA 1S1VB 2JDJA 3AT1B 1GTEA 2GCFA 3NLCA 3EGWB 2NUHA 2EG2A 4DL2A 1EQMA 1MROB 1RT6A 1TL5A 3MOZA 1HMVA 3SSRA 2BZ2A 3SDEA 3JSYA 2H54B 3CCVS 4J9QA 4JYAJ 4CLFA 3M9OB 2E7VA 1RTJB 4NZ6A 2F8HA 3KDNA 3BM7A 3JXOA 2BANB 1NMEB 3NGRA 4LBPA 1FJCA 1OSDA 4U8YA 3C6TB 3OQ2A 4ED5A 4DV6J 1U0SA 1VQPS 2MQMA 4AL7A 4PQAA 3IWNC 1YQHA 2I2YA 1MNEA 3DRRA 1WHVA 1W2BR 3SCIE 3D1HA 1S79A 4IR1A 2LEAA 3KJQB 3MPYA 1GQEA 5AXKA 1R27B 4JV2A 2HFZA 1K47A 4ECXA 3ET6A 4ZPAA 3UDCA 5LMNF 2IA6A 2UUAF 3ULHA 4F26A 4PQUA 4WIQA 1KRPA 3CCTA 4NLOA 2DNMA 1HQEA 2OJ3A 4ITSA 2VIHA 3A3OB 3DRPB 5L9NA 3WIUA 1S49A 3C6UA 4M5KA 5A8RA 1U6BA 3KHGA 1RLCL 3M32B 2XYGB 4WU2A 3DGPA 3P6YC 3TARA 3DGVA 4G65A 3KLHB 1CBKA 1PJ7A 1MU2B 2RUGA 5IT9U 1RT4A 3FC9A 2HNDB 2JSXA 1XC9A 3H7HB 1FK9A 4EZ6A 1RAOA 4JI6F 2ZWPA 1CJTA 3NNAA 1KEKA 2VZ9A 2AWZA 1MWYA 2POKA 3KLIB 4WF9Q 1NB2A 5F3TA 1G1XA 1Q5YA 3SI8A 4DR2F 4LIRA 4GO5X 4Q2MA 1KBRA 3KJNB 4Y2KA 1FXLA 2H5JB 3M9NB 4ECUA 3BDEA 2MY8A 2IYGA 1VDHA 2HQIA 2HSEB 2PI5A 2XWXA 1NXIA 1Q7YT 3AODA 2ZBRA 1WEXA 3V81B 1MWQA 1UVNA 3T19A 3UDLA 1FJEB 4P71A 3R7SB 4JI2J 2JEJA 1IM6A 4OHZA 2M70A 1S4EA 4MJKA 2DYAA 5KFHA 2E1PA 2VOPA 2C2OB 5KFEA 5KFDA 2LA6A 3NAIA 1X5PA 2W1BA 1QE1B 4LFCF 4WZMA 4YUDA 3GJRB 2VD3A 4FKYA 5L38A 4B3TF 4DR7J 1HMVB 4N5SA 2EK6A 1T9YA 4CZCA 5CYMA 3SV3A 2ZZNA 5I3PA 3V6DA 1S9FA 2QMUB 2XMWA 3SDEB 4OZ1A 1TAUA 1Y3KA 2Q1LA 1TMJA 1RBAA 1Y0HA 5HQ8A 1IN0A 3IGVA 3I5BA 2QL5B 2KZZA 2CJ9A 4RNHA 1W26A 1PYSB 3MGJA 3D4JA 3SV4A 1FF2A 1I1GA 4K5RA 4DV2J 1HWKA 3N6LA 2RU9A 2J9CA 3WDOA 1URNA 1VHFA 1P9QC 4ZPTR 2ZJRQ 4LF7J 2JZ5A 5IQQA 2FLOA 2DRBA 2E5GA 1KTVA 4D3HA 2RRBA 3QQCD 5ETKA 5KFOA 2F3JA 2V9WA 3ET6B 4ZVUB 1LXNA 3TRGA 1GH8A 1MG7A 4B9TA 1ACMB 4PQUB 3FBCA 4JV0A 2W7PA 3OL6A 1W2IA 4N76A 3BZQA 3MEGA 1HQEB 5EWFA 5K8OA 3C6UB 5A8RB 2CQ0A 1FFSB 3UD3P 2SXLA 4EI2A 1F5AA 4HHJA 4HI1A 4P2MA 1QAYA 3DGPB 4EUVA 1HNZF 1NO8A 3SEOA 4ILLA 4RNFA 3AD7C 2HVDA 1RDRA 1RT4B 2C2ZB 1IUJA 4PG5A 2JLGA 1FK9B 2WSCC 3W8PA 4O3RA 4MKAA 1CJTB 3T1YF 2QLXA 4ILRA 4JI0F 2NXJA 3GFXA 3ZZPA 4URGA 2DNNA 2QE5A 1TVRA 4FPIA 3CD6S 4DV5F 2HGMA 2AW0A 2DH7A 5CZVA 5THWA 5KT3A 4DSJA 2XCAA 1FTCA 8ATCB 2OFGX 2YH1A 1TKZB 2NPFA 3MI7X 2B8QA 3M4XA 3PR4A 4I4BA 2HIYA 2D3ZA 5E3AA 3R1LA 5HMZA 4LFAF 3PYEA 4NLXA 1HWLA 4PWDA 2WVFA 3LTOA 3QSYB 2UXDF 2DNOA 4LF4J 2CDQA 2BV3A 5J1EA 3DCAA 2KG1A 1EARA 3A3NB 2ASDA 3W1YC 1JB0C 1ZM3A 5B0CA 7FDRA 2EKYA 3V6DB 2C3MA 4DR5J 2ZD1A 4DSIA 4QWBA 3SCKE 1Q86T 2XMAA 1SJ4P 3GB0A 3H0PA 3QMQA 4QWEA 4AYBD 3CDEA 4WFBQ 3OTBA 1RAIB 2BKOA 1CJKB 3P45B 1GTHA 4LSNA 4A8YA 2MQNA 4I6AA 5DLGA 3DDKA 5IC6B 1T95A 1NH7A 2QG9B 2J7UA 5HO4A 4O4RA 2G0JA 5GAGU 2J7WA 3AA8A 1KFSA 2IFXA 2XBPA 1FVSA 3DKDA 1VK3A 1Y10A 1DTTB 2YQ3A 2BOPA 3BB5A 4JI4F 2GS8A 1NDPA 2H48B 3HF5A 3GSIA 2ZBCA 2R3VA 3PJXA 3DLEA 5J2PA 4ZK7M 1GK8A 2AJ0A 3NG8A 3MEGB 1UA1A 2V8DA 1QSLA 2MQLA 3GIKA 3CJ8A 3UD5A 1DRZA 4WFNQ 4X64F 3EPGA 1TFYA 3KLGA 1M1KT 1TV6A 3OFFA 1RP5A 4RUCA 4IH7A 4ZS6A 2UXCJ 5SZTA 2HRUA 4FYVB 4DU8A 3HHNB 5AJ3F 2BOAA 2OLWA 5HN0A 3OJUA 2MEWA 1VGYA 4C8MA 1RHQB 4J9SA 2VKZG 5H9EJ 3OVSA 4NLVA 2CNLB 1QAIA 4X4PA 4F25A 4UT4A 1AA1B 2EKNA 1NEEA 3H2LA 3EGVA 4QPXA 2GW8A 4DV0J 2VUGA 4AUKA 5AE3A 4DCOB 2E66A 3CJ2A 4LBHA 4ECWA 2W24A 3V4MA 1B7YB 2FJAB 2OELA 3P4UB 4G6VB 1JXEA 1S1WB 4PWDB 2AX0A 2WVEA 3PW5A 5ETOA 1GT8A 1WHXA 1SKUB 4KR0B 1NJZA 3DFEA 3QNWB 4EEYA 1VQKS 2I1RA 2OIHA 4DR4F 3PYDA 1G3OA 5J1EB 2W9BA 1NDCA 3T9NA 2QL7B 4KE5A 3TO8A 1KLMB 2UVRA 3BF4A 3BKFA 3ZZRA 1Y5LB 3HMJG 1RWOB 3PYFA 4TVAB 1TL4A 2F40A 4YR0A 1LWXA 3PEJA 2G2ZA 3BBFA 1NZAA 1KFDA 4J7CA 1XTZA 4O3NA 2UUBF 3IR5B 3G6XA 2UXBF 1WDTA 4GKJF 4AXJA 2PIIA 2BABA 2EFQA 1LEOA 4K50A 2HEKA 2BXJA 2DEJA 1NSAA 1HR0F 2EFVA 3RR8A 4QBUA 5KFSA 1GXLA 4WYWA 4P2FA 3MR2A 4NLUA 2AGOA 3KXDA 4U8VA 1JK9B 3DLEB 1K1QA 3W61A 3WX8A 5J2PB 4YB6A 4DPTA 4X66F 3A8JA 3B82A 4HHHA 2WK4A 2LQ9A 3F56A 3EYZA 1Q8IA 2ILZA 1X4DA 2MZQA 4JOUA 3Q86A 2OP5A 3KLGB 4RWWA 4RNNA 1TV6B 2R7XA 3U02A 1D3WA 3M9MB 5AE2A 3TUIC 3BV8A 1QVFR 1FVQA 1KKHA 5B08A 4ED7A 3HZEA 2BKPA 2F5GA 2JL9A 4C8YA 1RT2A 1GMVA 3K5LA 4OZ0A 1VYAA 2VG5A 5A2QU 1ZAXA 3A8EA 1HNVA 1YBTA 4S0MA 3H5UA 2HHWA 2HMIB 3KLFA 4G1QB 1QAJA 2PDAA 2UVVA 1SV5A 1SI9A 3THPA 4KHPF 1X4BA 2N7YA 1DQ9A 3R2CJ 2E9ZA 3GZ7A 4OYMA 2LXUA 4F0HA 4YFUA 2IDEA 4LF4F 2GMHA 4I64A 4FXWA 5CHCB 4QU7A 3J7A1 2FJBB 4KC5A 1BHNA 4ANEA 2W9BB 1FXDA 2RILA 4R25A 2C2RA 2ATCB 1NSQA 5SUHA 4JI1J 1RT1A 5MLCV 2HNYB 1S1XA 4EZ9A 4R8UA 4IO9Q 2LQ8A 3M8RA 3DRSB 1Q78A 3TAQA 2IRUA 2DGWA 3HJVA 5KFMA 2K1RA 2H5EA 3CDAA 4UW2A 2F8EX 3B4DA 2K2PA 1BMQB 1Q7LB 3BYRA 4BS2A 3L4BC 5F0UA 3EXCX 3KG0A 2CFXA 3K58A 2ALYB 2Z30B 1U8SA 1IR2A 5KFAA 1UJ4A 4YY3J 3PW7A 2HHHF 1HHTP 3PYGA 2E5LF 2QYCA 2FVPA 2L08A 4ZVRB 4C0HA 3ZXWA 2IBKA 3DLHA 3KJVA 2W2MP 4JI8F 1UVMA 2KT5A 1FEHA 4L74A 1RHRB 5IV3A 1JXVA 1NJXA 3DOKA 4HR2A 2AX1A 5C7PA 2BBEA 2VG5B 2OI2A 2K7KA 3TQEA 4C3MA 4RUHA 4CO3A 4GKKJ 4WP9A 4M5DA 2AZ1A 4RW9A 4IFYA 3Q8UA 1RB0A 2NSCA 2DNZA 1UTAA 4U9RA 3KLFB 1ZYQA 3VTIA 2VASA 1SV5B 4LQ3A 1VQSA 2C28A 1U47A 4OZ2A 2FGOA 2KYXA 2FLNA 2DGSA 2YKNA 2MQQA 3G86A 1WF2A 2CG8A 3KWMA 1N0VC 3C15A 2YVSA 3ZZTA 4NRUA 1Q79A 4MYUA 1RI7A 2X51A 3M8ZA 4K4WA 1OY9A 1WACA 1B3TA 2DPJA 2BUNA 3DDNA 3RRGA 4BBYA 2C2EA 4GC7A 3CJQA 3ZZZA 1M5VC 5L46A 2GA7A 3X3UA 1RT1B 1S1XB 2R2SA 4R8UB 4HH1A 1N0UA 1QTNB 3BYPA 1V5VA 4ZP8A 1TU0B 2I0XA 4U7CA 1ZM2A 5HK4A 3I55S 1NHKL 4PYDA 3LWLA 2K1RB 5KFPA 1C0UA 2CXEA 3K89A 4J9VA 5AXMA 4EBDA 3QIPB 3ILJA 1U1PA 2UV8A 3W9HA 4WXWA 3H40A 4CQ1A 4M5HA 1S10A 1RA7A 1UW4A 2VICA 3BSCA 3IRXA 4GMKA 3MD3A 1T11A 3EX7B 3VAFA 4LRAA 1S76D 3OTOJ 4ECRA 3M1VA 3QO9B 2E1MC 3I6PA 3WZ0A 1YJRA 2ZNYA 1WEZA 3BSAA 2BJ1A 4Q45A 4DHVA 3BBBA 2RHQB 3ENQA 3CJSA 1J27A 1S77D 4QR2A 1JLQA 1AFIA 3OBIA 1ZPVA 1Y5IB 4ZP9A 3NCPA 1AUSL 2R9LA 1NK0A 3H5XA 3VCDA 4I2PA 2P8IA 5DS7A 2APOA 3TUPA 2KL8A 4XTTA 2H51B 5DDRC 1Q82T 2OD4A 1K0TA 2W4DA 1WC6A 4Y2AA 4M5DB 4UOFA 4X4TA 4OZJA 4K5SA 4IFYB 4RW9B 2RAQA 5A76A 3VGUA 1TKDA 1GMWD 3OR1A 3NS6A 1IBLF 3MMCB 3BSNA 5D8HB 4M8LA 4B3MF 3QAEA 4DSFA 3GONA 4PXEA 5IZHA 2ZC4A 1YBAA 2GJ2A 4NLWA 4PG8A 2DO4A 1F3VA 3G8QA 1ROFA 2KKHA 1O51A 2YKNB 1KLNA 1N32J 3P5BP 3LPYA 1VI7A 3Q22A 4RW7A 2ZVSA 2HRYA 4DV7F 1JKHA 2EC0A 4NLTA 2E1AA 1H98A 3MMBA 2FJEB 1WSVA 1E6VA 4OV1A 2F9JA 2DK2A 4ZCMA 2R8JA 1RSCA 1CS4A 1FRLA 1RK8A 3NBPA 4DUTA 3KK3A 2Q43A 3K5MA 2HVZA 3KNGA 3KFWX 3MM9B 5H9EK 2CVIA 1PAUB 9RUBA 1S99A 3TJ8A 2O1PA 4HYKA 4LFBF 1H3DA 4QOTA 5GADU 3O2IA 4FDFA 2WCXA 3VAKA 1ZBTA 1D0EA 4ZCIA 4DPXA 2O3DA 2VHGA 3MFIA 1YBUA 7FD1A 2J9DE 1C0UB 4J37A 3TVZA 2HVIA 3P3DA 1EX8A 2GAHC 2HURA 5DLFA 2XGQA 5JUMA 2ZBIA 4J9MA 2XCPA 1HNIA 1WG1A 4FYXB 4WBFA 1YJWS 1NB7A 1N36J 2AEJA 4OLOA 2KHCA 2A6OA 1R31A 2B7BB 4JB8B 3CCRS 2ROPA 1X9MA 3G2XA 3CMES 1MSWD 2QA1A 2WSFC 4KGXB 3PW0A 3QYYA 4KT0C 2Y1LB 3DDIA 3HVWA 4PWWA 2EFNA 3ZNJ1 1PJ5A 3Q8QB 2HQFA 1XNRF 2GVDA 3AQOA 3I5AA 4ICLA 1C2PA 3PM9A 2BW7A 3K5OA 1FDAA 4I1TA 3IG1A 4RR5A 4A47A 3MR7A 1JLQB 5F8GA 5D4LA 1YZ7A 3DLGA 1R0AA 3L3CA 2XC9A 3FRYA 1XNQJ 2BJEA 3R7BB 1H7WA 4DSLA 4B3OA 4BWJA 1HWUA 2F65A 1HIYA 4EMDA 2OMOA 2JC0A 5ETQA 2VFTA 4P10A 4IH6A 1C1BA 1WC0A 1S0VA 4B9MA 3JB9k 4FP9A 3NAHA 3VR1A 4OQJA 3KK1A 4UQGA 1O0PA 3QGIA 3OR1B 3OSPA 2CQ1A 2DH8A 4F04B 3O1LA 2BMBA 2Y0BB 1T9WA 3KTQA 3US5A 2DR5A 5U47A 3O8WA 3HHLD 5FLXY 4WZQA 1B64A 3FKBA 2B5JA 2HFNA 4ED4A 4UZCA 3PKYA 3VVTA 4KGKA 1A7GE 1FI4A 3WX4A 1VBKA 3OXGA 4RU2A 2ZE2A 3FCWA 2QJ3A 1I6JA 5K8PA 3MMBB 3M8PB 3HSZA 2L9WA 3IWXA 2NREA 2HK2A 4RUBA 1HNXJ 1T94A 2XS7A 3PHTA 5D15A 3OT9A 3UE2A 2DR8A 2CQ2A 3IR7B 3NBPB 3KK3B 2D69A 2VOOA 4DUZF 2HHUA 5BYQA 2CQPA 4PABA 3SSQA 4DLEA 2J0QD 5K8NA 5CABA 1Q4RA 3FQLA 2XNRA 4NEZA 5HQMA 4CO4A 3AAWB 4RW4A 3S7RA 3VAJA 1WJ9A 3LP2A 1V3RA 2VKRA 3DM2A 3OV7A 5K14A 3GR1A 4RBVA 4WP8A 2DISA 5CQGA 5DM7Q 3CJTA 3MF5A 2XLKA 2BE9B 2GVZB 3I0RB 2V50A 1HNIB 1YWXA 4USUA 3L7PA 2HHSA 1CLFA 3R2DJ 1PBUA 5IT4A 4PPZA 1FNOA 2CQIA 2KH9A 3LO3A 2R2RA 3C2PA 3QWPA 3VZIA 4JUZA 5DGBA 1T3OA 5B0GA 3TAPA 2IVYA 1HKAA 1R8BA 1QAXA 4W98A 1X4HA 4IRKA 3GSDA 2H65B 4NEYA 5CA5A 4TLRA 1LWEA 2GVDB 2PEBA 2EW9A 5JVHQ 4ICLB 2RJZA 1U45A 3MMAA 4QU6A 1OIAA 3IG1B 1UL3A 1QY7A 1RAEB 3U7JA 2LXIA 3BH6B 2D3O1 1EB0A 1X7VA 4OHYA 2HK3A 3VGSA 1R0AB 2B9XA 4KKOB 5A8WB 2JX2A 2L48A 1X9SA 4B3OB 5E3RA 3LALA 2MJNA 3SMZA 4KGZB 3QSIA 5GAGI 4DX5A 2PI4A 5D0HA 1C1BB 2YX7A 4RX6A 3KK1B 2RQ4A 3HVAA 1U48A 4B3RJ 2NXEA 4CLPA 1NJIT 1Q8LA 3P5TL 1FFGB 4OV6A 5DRKA 2EFOA 1U1QA 4ZLNA 2V4JA 4OI6A 2FPHX 2IDLA 4OYAA 2GMLA 1DBDA 4I6YA 3B54A 1QUVA 2B0GA 1S0OA 1GXUA 4MIWA 2B5JB 2QLWA 3VWSA 3H25A 2YNFA 3W64A 2YWEA 1VRUB 2LU2A 5EX3A 2ZE2B 3CIZA 4BHQA 3S01A 2WBMA 2AJQA 2Y1JA 2ZVIA 2FJXA 3JYTA 4O3QA 2LCWA 2EFGA 1DTQA 4QWAA 2HZCA 1TL7A 1WWHA 4E0DA 1K73T 4NLRA 3BGOP 5GMDA 2PGCA 4R5PA 5LOQA 2AJ1A 5MAOA 2V8GA 3P49B 2F9DA 3HHEA 1YJ7A 4Q2LA 3LP2B 3DM2B 1WC4A 2W8LA 2OEJA 5KG7A 3LGHA 5K14B 3H5SA 2D7SA 4ZP6A 3GTYX 4K4XA 3M6VA 3V6HA 2QLJB 2HNZA 3SFGA 2Y8YA 3DOMA 1XEZA 4DV4F 3T9ZA 1KVJA 2KT3A 3PFEA 3AB4B 4YDXA 1N48A 1UETA 3MUTP 3ZZ0A 4H4MA 4FF2A 3UCGA 3UNYA 1CPZA 1MMDA 5HLFA 3D66A 2HFOA 4DMZA 2MY7A 3L9ZA 1GMUA 3ELHA 2IRXA 4LRFA 1HNWF 1FKOB 1VC5A 2AF6A 2AKWB 1PIEA 4X65F 1LWEB 2GO8A 2VG7A 1X5TA 2QFIA 2RQCA 3MMAB 3MPVA 4ZITA 1H2VZ 3MHYA 1WI6A 1KTQA 3RGIA 1Y5NB 1NK9A 2AP6A 4Z37A 4J9NA 4DQRA 2XMMA 2XWYA 3V2UC 2Y1RI 5HVGA 2WOMA 3GILA 2FZCB 4HL9A 2WHOA 3MECA 1LFWA 5BYSA 4YDDB 4MAKA 1DURA 2W2QP 2VBYA 4O3PA 2C3PA 3D6TB 3ISND 2V4JB 1WELA 1CC7A 1SJRA 3T1HF 1YDLA 2OSRA 2VA2A 4O4GA 3FSIA 5EDWA 1OO0B 2J6UA 2VC1A 1X0PA 1TR0A 2LA4A 1FHTA 4CO0A 3J7AN 2R2TA 2YNFB 2HFVA 2MYFA 3RB6A 1FE0A 4CO1A 1YLXA 1JLAA 1J5EJ 4X62F 2YNGB 2VQFF 3OLAA 1VQNS 4A8XA 4DV1J 4FZVA 1ELOA 1DTQB 3FZ2A 1RTHA 5FJ4A 5C25A 1CQNA 2DNLA 1GFWB 2DD8S 3EUNA 2HQ3A 4R5PB 4DWIA 2ATLA 3Q2SC 3LUYA 3THVA 3QFHA 5DETA 4OYXA 4NA1A 1U1RA 4Q7AA 3KYLA 4FYYB 4X4UA 3BREA 4UTGA 3GV5B 1UVLA 1HLWA 2HNZB 5E2QA 3DOMB 5ETRA 1NAQA 3HO1A 2OPRA 4RW8A 3OFHA 2CZVC 1J2VA 2Z58B 4DF4A 4H4MB 2MLYA 4USKA 3M8SA 2CJAA 2HFUA 5KT4A 1NCLA 3G4SS 3W9IA 4JV5F 1RU2A 4JP8A 4WK1A 1JLEA 2Z2LA 1KHVA 2DKOB 1NBEB 2F8MA 2K3IA 2PD1A 4IG3A 3BH7B 5K9FA 1C0TB 5F41A 3W63A 2XZDB 4ECSA 4OX9F 1WF0A 1K8AT 1RBOB 1U02A 2VG7B 1YVFA 5F9NA 3QGHA 3ZTOA 3BKUA 2JLFA 3I4PA 3GIIA 1LOUA 2KM8B 4R0JA 4CYUA 4LVNP 3TYTA 4LR9A 3T5JA 3Q89A 4A8MP 4P52A 4L3KA 2KJVA 1NPPA 2PE8A 3CD0A 5HVFA 4QIWD 1D9DA 4M5IA 1RHMB 1FTRA 5KG0A 2WOMB 5L1LA 1U49A 3DNCA 3MECB 3NEKA 3FQKA 2R8HA 1TUWA 3SZ2A 1RGVA 3PY8A 1F6TA 1JLCA 5GMKa 5C24A 4TY9A 3W9JA 2FD2A 1IJFB 1JLBB 5E41A 3Q23A 3B8HA 1ZH5A 2J6TA 4I68A 2ZH3A 1BUXA 2J0SD 4O4GB 2XB2D 1M5OC 4DUYF 2RT3A 4NRTA 3CCWA 3RB0A 3I4HX 4B9UA
chains in the Genus database with same CATH topology
5BR8J 3OTOJ 4X64J 4JI2J 4X66J 4B3SJ 4NXNJ 1N36J 3IMQJ 3T1YJ 4DUZJ 4JI0J 4DR4J 4JI1J 1N32J 4DR1J 4AQYJ 1XMOJ 1HNWJ 1IBKJ 4B3RJ 4DV5J 4DV0J 5AJ3J 4LF6J 4HHUA 2HHHJ 5A2QU 5IWAJ 4DUYJ 1IBLJ 4JV5J 4X65J 4JYAJ 4X62J 4K0KJ 4DV3J 4B3MJ 3R2DJ 4KYZA 5LMNJ 4V1Ak 2UUAJ 3D3BJ 2VQFJ 3J80U 4RJVA 4PWWA 5IT9U 2E5LJ 4DR7J 3D3CJ 4LF8J 4LF4J 4GKKJ 4OX9J 4NXMJ 2F4VJ 2KVQE 3JAMU 4JI8J 1N34J 4DV6J 4JI7J 4KY3A 1HNXJ 4JI5J 2UUBJ 3W1YC 4DV7J 2UXBJ 2ZM6J 5LM7E 4LFAJ 4JI4J 4GKJJ 4LF9J 2MTLA 4NEYA 3R2CJ 2MQ8A 2KL8A 2VQEJ 4DR5J 1XMQJ 4LFCJ 1XNQJ 3J7AN 4DR6J 4DV2J 4B3TJ 2UU9J 4YHHJ 2UXCJ 2UXDJ 4DV4J 1XNRJ 4DR3J 4JI6J 1HR0J 1N33J 4LF5J 4NEZA 4YY3J 4LF7J 4KHPJ 4JI3J 1HNZJ 2UUCJ 1J5EJ 1IBMJ 3J81U 2MEWA 5FLXU 3T1HJ 4LFBJ 4DR2J 1I94J 5LMUJ 1FJGJ 4DV1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 J;  3OTO J;  4X64 J;  4JI2 J;  4X66 J;  4B3S J;  4NXN J;  1N36 J;  3IMQ J;  3T1Y J;  4DUZ J;  4JI0 J;  4DR4 J;  4JI1 J;  1N32 J;  4DR1 J;  4AQY J;  1XMO J;  1HNW J;  1IBK J;  4B3R J;  4DV5 J;  4DV0 J;  5AJ3 J;  4LF6 J;  4HHU A;  2HHH J;  5A2Q U;  5IWA J;  4DUY J;  1IBL J;  4JV5 J;  4X65 J;  4JYA J;  4X62 J;  4K0K J;  4DV3 J;  4B3M J;  3R2D J;  4KYZ A;  5LMN J;  4V1A k;  2UUA J;  3D3B J;  2VQF J;  3J80 U;  4RJV A;  4PWW A;  5IT9 U;  2E5L J;  4DR7 J;  3D3C J;  4LF8 J;  4LF4 J;  4GKK J;  4OX9 J;  4NXM J;  2F4V J;  2KVQ E;  3JAM U;  4JI8 J;  1N34 J;  4DV6 J;  4JI7 J;  4KY3 A;  1HNX J;  4JI5 J;  2UUB J;  3W1Y C;  4DV7 J;  2UXB J;  2ZM6 J;  5LM7 E;  4LFA J;  4JI4 J;  4GKJ J;  4LF9 J;  2MTL A;  4NEY A;  3R2C J;  2MQ8 A;  2KL8 A;  2VQE J;  4DR5 J;  1XMQ J;  4LFC J;  1XNQ J;  3J7A N;  4DR6 J;  4DV2 J;  4B3T J;  2UU9 J;  4YHH J;  2UXC J;  2UXD J;  4DV4 J;  1XNR J;  4DR3 J;  4JI6 J;  1HR0 J;  1N33 J;  4LF5 J;  4NEZ A;  4YY3 J;  4LF7 J;  4KHP J;  4JI3 J;  1HNZ J;  2UUC J;  1J5E J;  1IBM J;  3J81 U;  2MEW A;  5FLX U;  3T1H J;  4LFB J;  4DR2 J;  1I94 J;  5LMU J;  1FJG J;  4DV1 J; 
#chains in the Genus database with same CATH topology
 3BQ0 A;  5BR8 J;  4USM A;  1UFK A;  1RTZ A;  1WG4 A;  4FYW B;  1JLA B;  4DF8 A;  1B0V A;  4CCH A;  2QA4 S;  2ZM6 F;  1RTH B;  1T05 A;  4Y65 A;  2FYX A;  5C25 B;  4RU9 A;  1VIX A;  3EVM A;  2MKY A;  3HD2 A;  4D3G A;  3JTP A;  3RG6 A;  3RAQ A;  5KFV A;  1YJN S;  2CQG A;  2DHX A;  2W4C A;  3M6X A;  1N34 J;  4DL3 A;  1BGX T;  4C11 A;  4BCA A;  1S0M A;  3W60 A;  4LBI A;  2AU0 A;  2J6S A;  1NU4 A;  2ACY A;  1YZ6 A;  2CPF A;  4YEA A;  4OI3 A;  3GYN A;  5L1K A;  2JC1 A;  2NLW A;  3A3P B;  2AV5 A;  5EHH A;  2OPR B;  1TL1 B;  4FF1 A;  1WOR A;  1ZOT A;  4K4S A;  4RW8 B;  4OYB A;  3KLV A;  3TAN A;  2PN6 A;  3AOC A;  5E3P A;  2PFF B;  1S72 S;  1QLN A;  5D0E A;  2CQ3 A;  4Y28 C;  4EK2 A;  3Q8S B;  4B3S J;  4LF8 F;  2BM0 A;  3R27 A;  5ETM A;  2VFU A;  4DSE A;  1HPZ A;  4ZJQ A;  1JLE B;  2O67 A;  1MN7 A;  3ZTQ A;  5ITH A;  1U6F A;  4IG3 B;  1T9U A;  3OL7 A;  3ZZU A;  4KPC A;  1FA0 A;  3TZW A;  2FY8 A;  2FZG B;  3QJJ A;  3T6J A;  5K8M A;  5LMN J;  2CJK A;  2UUA J;  1Q95 G;  3G82 A;  1EAY C;  1S6U A;  2XYP B;  4WK3 A;  4E8U A;  1HYS A;  5K20 B;  2JEF A;  4JI3 F;  1RAH B;  4CYU B;  3T5H A;  3MPW A;  3KG1 A;  1FFW B;  2KXN B;  1SH0 A;  4MTP A;  2XS5 A;  3FDS A;  1F9E B;  3M6W A;  1WG5 A;  4DS5 A;  2I8E A;  4JI6 J;  1PIL A;  3KHL A;  1VRT A;  1JLC B;  1AZS A;  5C24 B;  3R97 A;  1DQ8 A;  5I3U A;  4ELU A;  4AXI A;  2FHJ D;  4LVO P;  3FEX B;  4LF1 A;  4DR2 J;  2YX4 A;  2B6A A;  1TKX A;  4ZN1 A;  2NCK L;  1EET A;  2DNR A;  3MFH A;  2A0F B;  2RNE A;  2D74 B;  3NXZ A;  1N5T A;  3PZP A;  1X31 C;  5BYR A;  3KK2 A;  1EIY B;  2Q66 A;  3I0S A;  3W2V A;  3CDU A;  1RAB B;  1AW0 A;  1HBO A;  4IOB A;  4C8Z A;  4P75 A;  3GFH A;  3VQS A;  3G71 S;  3R7N B;  3PEH A;  2Q6C A;  1CUL A;  2VU5 A;  3Q83 A;  1S1V A;  3A12 A;  1F9F A;  1T05 B;  2NXC A;  5DG8 A;  2O01 C;  1TZ0 A;  4KY3 A;  2IM0 A;  4WKY A;  4NLQ A;  2XEX A;  1MRO A;  1VR6 A;  2G13 A;  4ED6 A;  4LFC J;  2DNP A;  3TEG A;  1KOO A;  5D0G A;  5FDL B;  4B3T J;  3SXL A;  2XG8 A;  3D67 A;  2HAF A;  2N3O A;  1R0B G;  2R7T A;  4C11 B;  2E9R X;  1RHU B;  5C5J A;  4CT9 A;  5B0D A;  3QAT A;  5IC4 B;  1HBN A;  3MUM P;  5AT1 B;  1S1T A;  1NSK L;  2AT1 B;  3IR6 B;  5CXT A;  4Q5V A;  4KFB A;  4GVB A;  1IKY A;  4J9O A;  4ATN A;  1RYR A;  4DOZ A;  1M5S A;  3GU0 A;  2V0N A;  3TUJ C;  3MEK A;  3EZU A;  2K06 A;  1Y9O A;  2RQK A;  5D4O A;  1D1U A;  5KFR A;  2E29 A;  1HPZ B;  3KHR A;  4HEA 9;  1YJT A;  1A9N B;  1N33 F;  5CAA A;  4KSE B;  3UNG C;  4ELV A;  5A2Q Y;  4N47 A;  1JLF B;  2OEK A;  4F2R A;  3G82 B;  2W9A A;  4ZLL A;  4P6Q A;  3UDV A;  5GAD I;  2M5Y A;  3VZH A;  2LP4 A;  4F4K A;  1KHW A;  4O3O A;  2HRT A;  3PJ9 A;  2HZA A;  4WE1 B;  1XJW B;  2CQB A;  4ZHR B;  1HNZ J;  2HND A;  2IAJ A;  2MKI A;  1R8P A;  4K0K F;  2DHS A;  2KM8 C;  3CIM A;  1FRI A;  2FQQ B;  1M1G A;  2A3J A;  3PFO A;  5HRO A;  2GO9 A;  4B9L A;  2ADB A;  4O0I A;  5E3C A;  2W9C A;  3KLI A;  3T1Y J;  4JI0 J;  4YQW A;  3M8W A;  2KB2 A;  1VRT B;  3DLK B;  1S12 A;  1AZS B;  2VF3 A;  4RO0 A;  4AE5 A;  4I2Q A;  4C3L A;  2J9E A;  1NDL A;  4DV5 J;  1LK5 A;  2ZZT A;  3CCS S;  2OPQ A;  3PX4 A;  2B6A B;  1TKX B;  3H98 A;  4DN0 A;  1EET B;  1XMQ F;  4QYZ J;  3AQP A;  5ETV A;  3EM1 A;  1SL2 A;  2DR6 A;  1DZ5 A;  3KK2 B;  3NL0 A;  3KJF B;  4NXM J;  4P73 A;  5F0W A;  3I0S B;  1XER A;  5BJR A;  3LPE A;  1JWW A;  1HBO B;  1X0F A;  1RYS A;  5KFL A;  4LFA J;  1IKW A;  3VV2 B;  2D3O R;  4LMZ A;  3N6N A;  1CUL B;  2NR0 A;  3HSG A;  4ECT A;  5T7L A;  2ZJQ Q;  4AQY F;  1S6P A;  4V19 J;  1R6Y A;  2UXD J;  4K59 A;  2ZBP A;  1QE1 A;  1C4C A;  4C0B A;  4RZR A;  1SKW A;  2DTJ A;  1YJU A;  3HCX A;  1N34 F;  1JIH A;  4TLQ A;  2Q79 A;  5D6G A;  3LF0 A;  4KO0 A;  2R7O A;  1H0H B;  4IDK A;  5KG1 A;  2CWK A;  1U4B A;  1GEH A;  1VQY A;  3IFE A;  2XSJ A;  4KRW A;  1N8R T;  1HBN B;  1S1T B;  3W8G A;  3BO4 A;  2PT0 A;  2XI3 A;  1VCT A;  5KG2 A;  2YH0 A;  1HFE L;  4KFB B;  4DX8 H;  1RHK B;  1VJQ A;  4GVB B;  3OVA A;  4LF9 F;  1IKY B;  3SIP B;  1P1T A;  5B0E A;  1S5Z A;  5E0O A;  2HIQ A;  2XLJ A;  1P1L A;  1WOO A;  3L7U A;  4LT6 A;  3E8O A;  1FRK A;  4MIB A;  2GGP B;  4B3S F;  4P74 A;  2FJV A;  3HD1 A;  2IM1 A;  2D9P A;  1HHQ A;  3EIC A;  3GCW P;  3U1N A;  3PIP Q;  2XLI A;  2G2O A;  1FJG F;  4JI4 J;  3GJQ B;  2LDY A;  2E7X A;  2MQ8 A;  2LEP A;  4XK8 C;  3T5K A;  4PKD B;  2RDJ A;  5RUB A;  1T03 A;  4U6P A;  3AHP A;  4TN2 A;  1IBK F;  4B9S A;  2BKN A;  1HI8 A;  2HBQ B;  4C4W A;  1VK8 A;  1KQG B;  4U95 A;  5HSP A;  3EJM A;  4W92 B;  4QWC A;  2DGO A;  2EG1 A;  4KHR A;  4OYI A;  1YJV A;  4X64 J;  4CNY A;  4ZIV A;  4NA3 A;  4WP3 A;  4KH0 B;  2VA3 A;  4O3S A;  2IAJ B;  2CDR B;  3CNQ P;  4C0O C;  3DC2 A;  5CYJ A;  5IXU A;  4N41 A;  2IY5 B;  5AJ3 J;  5HRO B;  1CEZ A;  2ABY A;  3G6E S;  2W9C B;  1JJ4 A;  4OZL A;  3C19 A;  1FRM A;  4F4A A;  2DCU B;  2Z57 B;  3RB4 A;  3VAL A;  4HDG A;  2EBG A;  4I2Q B;  3GG1 A;  4CT8 A;  1T9T A;  2VOD A;  2B51 A;  1HD1 A;  4PXB A;  2BQ3 A;  2OPQ B;  2C42 A;  2ASL A;  3AOB A;  1TKZ A;  1IBM F;  3NMA A;  1D8Z A;  4FPR A;  5GME A;  1FT8 A;  3CGI A;  2F63 A;  2H3E B;  1WEY A;  2YNH B;  4Z7C A;  4N56 A;  2MSS A;  5EN1 A;  1IR1 A;  1GX6 A;  3UO0 A;  1RCO B;  2XY6 A;  1WOS A;  4DPO A;  4N7T A;  5I4M A;  1WHW A;  3NGK A;  3MTJ A;  3RZA A;  2AGP A;  1IKW B;  2PO4 A;  5IWA F;  1M5K C;  5KFW A;  2P6T A;  1ULR A;  2YKP A;  5T7L B;  1FCA A;  3ICL A;  3Q2T C;  1S6P B;  3C16 A;  2P9G A;  5BXI A;  3IMQ J;  3W7B A;  4DR4 J;  4CLS A;  1EJ7 L;  3N0V A;  3RBZ A;  3I82 A;  2QLB B;  4KO0 B;  4M1K A;  1RWU A;  4NYZ A;  2W8K A;  4JI7 F;  1U2C A;  1UVK A;  2B4V A;  3V6J A;  3ZC4 A;  4IDK B;  3SCJ E;  2XSJ B;  4DR6 F;  2EWH A;  1CJK A;  2W2O P;  1ZM9 A;  4YHH F;  2VG6 A;  4DR3 F;  2AMC B;  2Y8W A;  3ITH A;  2PFD A;  2JNJ A;  1L5U A;  1JX4 A;  2UUB J;  2UXB J;  1B99 A;  4GKJ J;  4L3N A;  3HUL A;  4NXN F;  1IWA A;  1DTT A;  4LR7 A;  4DL4 A;  1PYT A;  4DSK A;  2HQC A;  2GHP A;  1XMO F;  2CJQ A;  4K4U A;  4X84 A;  4DL0 C;  1HR0 J;  3CB4 A;  3RBX A;  4CWB A;  4NZ7 A;  3WQP A;  2AD9 A;  2HVH A;  1P27 B;  4C8O A;  3H8Y A;  3TJA A;  1T03 B;  3TI0 A;  2GFF A;  2P9E A;  2P6S A;  4X66 J;  4PCQ A;  4F02 A;  3I56 S;  5IT0 A;  4WFZ A;  1HI0 P;  4JBC A;  2F4V F;  3NCQ A;  4OHV A;  1TK8 A;  3HHD A;  3H2U B;  2XI2 A;  2Z8Q A;  1M5P C;  3OPK A;  3UPF A;  2EPI A;  3MCO A;  2Q6B A;  2UVU A;  2GNK A;  3FSY A;  4WYL A;  5C42 A;  3BQ1 A;  2IJF A;  1T9X A;  3G6V A;  1SIW B;  4Z2X A;  3W2W A;  2OO4 A;  1HQU A;  1N4L A;  3M2U B;  1VQ7 S;  1HBU B;  2DHA A;  5AXL A;  1LXJ A;  1MW7 A;  4WKR A;  2R2U A;  3NNC A;  4UQT A;  2XMJ A;  4L72 B;  4CM2 A;  3BEG B;  2HWH A;  3DI6 A;  1X4G A;  3E01 A;  4LRE A;  1SC1 B;  4NXM F;  4KHP J;  2HQD A;  3WIV A;  4I0W A;  1OWX A;  1RWP B;  4DV3 F;  3CJ0 A;  1FDB A;  3NGS A;  2ZDP A;  2RU3 A;  2VDH A;  2BA9 A;  4ES1 A;  1S1W A;  3PRD A;  5J2N A;  2WVB A;  1SC3 B;  2MST A;  3RYL A;  3KG4 A;  2H4Y B;  2ZUA A;  4NLS A;  2YBV A;  1ZAV A;  5KOX A;  2VV5 A;  3C16 B;  3SYZ A;  4ECQ A;  5KFF A;  3QAU A;  1PJ6 A;  2VQE F;  4KYZ A;  4OYP A;  2FHM A;  2IM3 A;  3MR6 A;  1KVI A;  4AL5 A;  3R8Y A;  1KLM A;  4ZVE A;  1LNQ A;  3R5A A;  4L6V 3;  1OQ6 A;  2DGQ A;  2NS1 B;  2FC9 A;  3FFI A;  2BE2 A;  3CDW A;  3R5J B;  3BJY A;  2QV6 A;  1UAW A;  2KT2 A;  4NLD A;  3G8T A;  3M7V A;  1DY3 A;  2VG6 B;  4CLT A;  1FER A;  2R7U A;  1K0V A;  2Z2Z A;  3ITH B;  4ZOS A;  4UOC A;  4DR1 F;  4C97 A;  4PEO A;  2EK1 A;  4OI1 A;  3N28 A;  2NUU G;  4NL5 A;  1XK8 A;  1WC5 A;  2DBB A;  1QUP A;  2W7O A;  1PYO B;  5DQG A;  5DG9 A;  2UZA A;  4LRB A;  2MZ1 A;  5DQI A;  3GQC A;  2E9T A;  2HPU A;  2R7R A;  2DRD A;  2WZ1 A;  1VQO S;  4NLG A;  1FNM A;  2HHH J;  2KYZ A;  4F3Q A;  1U8W A;  2IJR A;  2A2D A;  4TXS A;  2OTJ S;  2IA0 A;  2GJI A;  2R42 A;  3MDF A;  3A8K A;  2N7C A;  2E5L J;  3K7R A;  2VJV A;  2N3L A;  2KDO A;  1MML A;  4CO2 A;  4JI8 J;  2UUC F;  2XZW A;  2QX0 A;  1F0X A;  2PMW A;  5C42 B;  2G1H A;  4A8F A;  2MZJ A;  3W2W B;  3K8V A;  1Q8K A;  1HQU B;  4J90 A;  4IG0 A;  4E98 A;  3T5L A;  3I31 A;  3IA0 A;  4PRF A;  4NYP A;  3DLJ A;  2HMI A;  3ISN C;  2K8G A;  3J81 j;  4G1Q A;  2KO1 A;  4ED3 A;  4DU7 A;  4A46 A;  5KT2 A;  2DR9 A;  1NK5 A;  3DI6 B;  3Q8P B;  3E01 B;  3GIM A;  4ENO A;  3JAM Y;  5T14 A;  2G1D A;  3ZNU A;  1XIQ A;  1PGZ A;  3CF5 Q;  3J7Z T;  3TZX A;  3AJ1 A;  3FJ2 A;  2GHW A;  2MKC A;  1YIT S;  3IS9 A;  4DZ6 A;  1OY6 A;  2CJX B;  5J2N B;  1ZTT A;  3RAM A;  3GYG A;  3GJS B;  4U96 A;  4ZPB A;  1O8B A;  5KFG A;  5HAN A;  4NE9 C;  5EWG A;  3L7O A;  5DQH A;  2WON A;  1HQ2 A;  1NH8 A;  3J7Y U;  4WTY A;  2KVQ E;  4ILM A;  3VGV A;  1EP4 A;  1TFW A;  4ZDN A;  3M8Q A;  5LM7 E;  2HNY A;  2PSZ A;  3R6L B;  4OX8 A;  3UN5 A;  1VRQ C;  1RIS A;  2AEM A;  3FFI B;  2XNQ A;  1NHV A;  2BE2 B;  2HWI A;  4A4J A;  3DRS A;  3PX0 A;  2AZ3 A;  3AFG A;  2C3U A;  4P9S A;  2O66 A;  4F0K A;  1JNR B;  2D9O A;  3OTD A;  3TUZ C;  1Z1Z A;  3GPA A;  2QT7 A;  1PO6 A;  5DO2 A;  4NPO A;  3W62 A;  4CLW A;  2C1E B;  2HAI A;  3CCZ A;  4DQP A;  4FXV A;  1VLO A;  3AY0 A;  5B0F A;  3RW7 A;  4DX7 A;  5DM6 Q;  5F8J A;  4EFA C;  2RSQ A;  2RRA A;  2LU1 A;  2ZHA A;  3F44 A;  1CJU A;  1NRK A;  3FBB A;  3AOA A;  3O3L A;  3DOL B;  2NZ4 A;  2AYM A;  1NUE A;  1LW0 A;  3B6B A;  4PUO A;  3RU0 A;  2ZBQ A;  3NY0 A;  2J0W A;  3RJM B;  1S7I A;  2DGV A;  4F0M A;  4YB7 A;  2BRL A;  5K5M A;  4M5J A;  4OI4 A;  2PA3 A;  2JJ4 D;  2VB6 A;  4F7V A;  2GQQ A;  2OTL S;  1HW8 A;  1VQ9 S;  3IAM 9;  2R7S A;  1WF1 A;  5D3G A;  2IBO A;  2IRY A;  3CPW R;  1PKU A;  2Y3Y A;  2MXY A;  2B9Y A;  2DCL A;  2FZK B;  5DZ6 A;  2X3D A;  3PV8 A;  5G0R A;  4C8L A;  3PJW A;  1H6K X;  2B9W A;  1R0C B;  2M0G B;  2VPY B;  3J80 Y;  4FVM A;  4DQI A;  2MB0 B;  4IFV B;  1IWG A;  4KPY A;  3ENA A;  2QLF B;  3ZZY A;  3D0G E;  4IG0 B;  4WCE Q;  4K2X A;  1FO1 A;  2ASY A;  4MK7 A;  2PMH A;  1Y3J A;  3CJ3 A;  3GLJ A;  1VLY A;  1IBL J;  2JOQ A;  1URR A;  1X9W A;  1PAE X;  3M30 A;  2GJF A;  4B3M J;  3TX0 A;  4I67 A;  3U1M A;  1U1N A;  3IS9 B;  3CO0 P;  3TQ1 A;  1QJH A;  4ZVP B;  2RIJ A;  1RHJ B;  4DV7 J;  4QCL A;  1QM9 A;  4DL6 A;  1HA1 A;  3W3S A;  1DFD A;  5HL7 Q;  3HSJ A;  3NMR A;  2WON B;  1F1B B;  3VGT A;  3KUH A;  4F3M A;  2B56 A;  1V6H A;  5HP1 B;  3CO9 A;  5I42 A;  1EP4 B;  3V6K A;  3QJL A;  4DJB A;  3M8Q B;  4LF6 F;  4K4Y A;  4EYH B;  4BLG A;  2A1B A;  2BJ9 A;  2MKH A;  1FE4 A;  1F5B A;  5KT5 A;  7AT1 B;  4LFB J;  3E2E A;  1HW9 A;  3VAH A;  1R89 A;  1RT5 B;  1UP1 A;  5D0R A;  1AFJ A;  5F8N A;  1SJ3 P;  5ETT A;  3ETM A;  3QIP A;  4Y2C A;  4XO0 A;  5IS2 A;  3NWG A;  1HI1 A;  1FKA F;  2LKZ A;  3MED A;  4O23 A;  5LSR A;  1WOP A;  1IXK A;  3CWJ A;  5ETL A;  4AD6 A;  1VQ5 S;  2BQU A;  2JLE A;  3BS9 A;  3MPU B;  2R8G A;  1WTF A;  3ZTS A;  4QR0 A;  2KVI A;  3JSM A;  1EKR A;  2BQR A;  3LAN A;  4CH1 A;  1CJU B;  1LW0 B;  1XR5 A;  4E2F B;  4PUO B;  3QO9 A;  4RL1 A;  4MKB A;  3TAM B;  1KOH A;  1AYE A;  4KHM A;  6FDR A;  3VAM A;  1PBA A;  1JQG A;  4ZCL A;  1J5O A;  3G8S A;  3CXC R;  4BDP A;  1XNR J;  1YRX A;  3UVJ A;  4DZD A;  5D3G B;  4ZLP A;  4Q0B A;  2AYE A;  4J9P A;  3TA1 A;  2LDI A;  3KKF A;  1K44 A;  4X4Q A;  2LYV A;  5G0R B;  3FBE A;  2DNK A;  1L3S A;  3CVK A;  4CRJ A;  2JHE A;  3NP5 A;  2NZC A;  1CJV A;  2B4O A;  4F3O A;  3OLB A;  2QEX S;  4I56 A;  2AYB A;  5HAO A;  3EDR B;  3HXM A;  2PEH A;  3AJD A;  3MXH P;  2VDI A;  3DXB A;  1VC0 A;  5KG4 A;  3GP9 A;  3MMC A;  2CPH A;  1QTM A;  2L9D A;  3M30 B;  2VJU A;  2HHQ A;  4KV8 A;  2OML A;  2DRA A;  2DNY A;  4USI A;  4XAK A;  4EGL A;  1YG0 A;  4HTJ A;  1RAJ A;  3RBE A;  4FKX A;  4OJH A;  3F41 A;  4B17 A;  3HSD A;  3DMJ A;  4RWX A;  2MLX A;  2QZ8 A;  1KVK A;  1QD1 A;  1S4F A;  3AB2 B;  4EWT A;  2XY5 A;  3D7S B;  3Q8R B;  4OZ5 A;  1SQF A;  2LFV A;  3UDE A;  1UW9 A;  3D2W A;  2DNG A;  5I42 B;  4IYQ A;  4KGM A;  3MOJ B;  3BGF A;  1WKL A;  5M2U A;  3MM9 A;  4DUZ J;  1Z2Z A;  3PW2 A;  2YWK A;  2OPP A;  4DFJ A;  3K2Y A;  1JJ2 R;  2RH3 A;  1B0T A;  2X3G A;  1KR4 A;  3U27 A;  1FRX A;  2FVC A;  3POT A;  1NKE A;  1VHI A;  3MED B;  5T41 A;  1IM4 A;  3PRB A;  2BM1 A;  3NOC A;  1GNK A;  4FN5 A;  3R5D A;  1XWL A;  1KNZ A;  1VS3 A;  1N54 B;  3MUV P;  3PHE A;  4NWB A;  2N4C A;  2ZH2 A;  3I87 A;  3JSM B;  2M88 A;  1XR7 A;  1DAR A;  1JXL A;  2ZHB A;  4ZJL A;  1TUV A;  2DJW A;  4TNO A;  3T6B A;  3PAC A;  3N6M A;  2JH3 A;  3D0I E;  2DO0 A;  2G9O A;  2L41 A;  1RT7 A;  4BWM A;  2I38 A;  3QLH A;  2JEI A;  5GVQ A;  1J5O B;  5GAH U;  4J5O A;  3IC1 A;  2OUG A;  2M2B A;  1WKK A;  3VAI A;  1ZA2 B;  3UVJ B;  4YB5 A;  5B0B A;  3MPD A;  2CWX A;  2LVW A;  4QIE A;  4Q0B B;  3CMQ A;  2MZS A;  3AD8 C;  2ZHO A;  3CCL S;  1I5O B;  3LH2 S;  3IM9 A;  3W5Y A;  4NCG A;  3FNN A;  1Q0N A;  2V8V A;  1N5S A;  1WNE A;  3KNA A;  3MTK A;  1RWK B;  5KFX A;  1CJV B;  3GJT B;  3QT5 A;  3K5N A;  2RDI A;  3FEY B;  1VQ6 S;  1Z4U A;  4V19 X;  1L3T A;  2UV8 G;  4X4O A;  3K0J A;  4LF5 F;  1YIJ S;  2YWG A;  4WTO B;  3GIJ A;  4XPE A;  2J0X A;  1U1M A;  2QO3 A;  1KWM A;  4ZVO B;  1RT6 B;  2LQJ A;  2AGQ A;  3CUN A;  1TKT A;  3UR0 A;  2IVM A;  1R8A A;  3O44 A;  4KV8 B;  1R3N A;  2FHK A;  1RJJ A;  5JMN A;  4CNZ A;  4TY8 A;  4OZN A;  4CTA A;  1VQ4 S;  8AT1 B;  1IR0 A;  1DHM A;  1OYE A;  4FNH A;  1EQ0 A;  3DMJ B;  3NS5 A;  3OTE A;  3M8P A;  2CPY A;  2P2C B;  2WBR A;  4QPT A;  2FY1 A;  3R9L A;  2G2Y A;  2EFP A;  2XSF A;  1MLA A;  2M9K A;  5CD4 H;  3OHB A;  5LT5 A;  3DRR B;  2IC3 A;  5D78 A;  3W5Z A;  3WC2 A;  1S0N A;  3HPO A;  3M2V A;  2DVI A;  2EXU A;  1TEL A;  4CLY A;  3L09 A;  4TU9 A;  2OPP B;  2UU9 F;  4FXD A;  3HLU A;  3JQJ A;  2CJB A;  3DYA A;  1SUQ A;  3D3C J;  3TR5 A;  1UFW A;  1OPI A;  3I5C A;  4I7F A;  3TNV A;  5DDO C;  1N5V A;  3POT B;  2BDP A;  2XMV A;  2IVF B;  4KIA A;  3PKM A;  3GFZ A;  1K9M T;  3D6F B;  2CQC A;  4F36 A;  1X8D A;  4OYZ A;  1X5S A;  3BPS P;  2GVZ A;  1RAF B;  1T02 A;  4K4T A;  3I0R A;  4M5G A;  4M5M A;  2E7W A;  1YJ9 S;  4DV4 J;  3HP6 A;  1YRU A;  3TP2 A;  4DFM A;  1NJY A;  2M4M A;  3HKZ D;  3LGN A;  1R8H A;  3E3X A;  4C8K A;  3VF0 B;  1YHQ S;  1VIO A;  4XDD A;  3MAQ A;  4HAC A;  3UQS A;  4UY8 5;  4ZPC A;  2KRB A;  2MMY A;  2VFS A;  1UPP A;  3RAX A;  4IRC A;  2V2V A;  1HNW J;  4HVZ A;  1RT7 B;  3QLH B;  2MQO A;  2C3Y A;  1FKP A;  4KTQ A;  2VPZ B;  1TQL A;  4X65 J;  4CO5 A;  2N82 B;  3AJ2 A;  3H5Y A;  1M1H A;  1CSJ A;  1CQM A;  2OPS A;  5HAT A;  4TYA A;  3DRY A;  4NCG B;  2HS4 A;  4KKO A;  5A8W A;  4N8N A;  3G9C A;  2CYY A;  2VFV A;  4TU8 A;  2XO6 A;  4ZJO A;  4USV A;  1KS2 A;  4QYR A;  2FLL A;  5KTQ A;  3ENV A;  2L9N A;  3FMW A;  2YX1 A;  3FCV A;  1RAC B;  1RWW B;  3IXQ A;  2DT9 A;  1H38 A;  1LKZ A;  5B09 A;  3MZI A;  2J8A A;  2HWT A;  5CYM B;  1TKT B;  1TAQ A;  4JYA F;  1NJW A;  3T1H J;  3PW4 A;  3TWZ A;  4Y34 A;  2J5A A;  2D3U A;  1UEV A;  3GE9 A;  4OJ1 A;  1I94 J;  1H7X A;  1UMJ A;  2B3T B;  2IHR 1;  4PXC A;  2ZH7 A;  3HI9 A;  4DXL A;  4FNI A;  4TY8 B;  4CTA B;  4FF4 A;  2NXU A;  3CE8 A;  1VRU A;  3PTW A;  2KHD A;  4DV6 F;  1NKC A;  2CQ4 A;  2BE7 D;  2BYC A;  4X62 J;  3OL9 A;  2FUG 9;  1Y00 A;  2VQF J;  4PWU A;  2R7V A;  4ECZ A;  2E44 A;  2VPX B;  1REV A;  4B9V A;  2WB4 A;  5GAE U;  5KFJ A;  2UUT A;  2IC3 B;  3UCZ P;  5J2Q A;  2A6M A;  3RW6 A;  4DDF A;  3M2V B;  4ZPW R;  3JAM U;  5L8R C;  1NK4 A;  1GX5 A;  1JLG A;  1UVJ A;  1FJ7 A;  3ZFV A;  2ZUG A;  2DHG A;  1S7H A;  1T0T V;  1DJ0 A;  3DYA B;  4IUF A;  1SUQ B;  2VON A;  3BR9 A;  2ZKT A;  3QPI A;  1BQX A;  5D4P A;  2ZH8 A;  3I9Z A;  4I7F B;  3NWR A;  3V5R A;  3K5P A;  2HS3 A;  3CSK A;  4Y0F A;  2AEF A;  1T3N A;  4PYA A;  4WFY A;  4U7U D;  2CAD A;  3OSN A;  3CUL A;  1Y4Z B;  2AQ4 A;  2KU7 A;  4L76 A;  3BN7 A;  3BO2 A;  2VC0 A;  1H2U X;  2QFJ A;  1KP6 A;  4HAC B;  4JV5 J;  1TVR B;  3N4W A;  3EE3 A;  2YPY A;  1B7F A;  1FKO A;  3R3T A;  3MD1 A;  1L3K A;  1D9A A;  4ZA1 A;  4WFA Q;  3RRK A;  3T1A A;  1IBC B;  5D4N A;  1FKP B;  2VBW A;  3AXK A;  3D54 A;  3MM5 A;  1SJ1 A;  4OX9 J;  3KMQ A;  5CCL A;  1RXO B;  1HL6 A;  2ILY A;  3RUB L;  4JI5 J;  4M63 A;  3TW0 A;  2OPS B;  2IMW P;  4JI2 F;  4LSL A;  3Q8Y A;  1WC3 A;  5F9L A;  2MKS A;  3HHK A;  3H59 A;  2LMI A;  2BEF A;  2J9D A;  4RUA A;  4ID8 A;  3BGR A;  4ED8 A;  5J1P A;  4Q43 A;  1WUU A;  1RAD B;  4R0E A;  1I51 B;  4A8K A;  4ERD A;  4EO8 A;  2WW4 A;  4UF4 A;  4DR7 F;  2YQ0 A;  4AFF A;  2DGT A;  2UP1 A;  5A6W A;  1IVZ A;  4DG1 A;  1VIS A;  2DIU A;  3M2R A;  2FB0 A;  4ZN3 A;  2ZNZ A;  4DL5 A;  2ZD1 B;  4DUY J;  1D09 B;  2VL1 A;  3BKT A;  3MEE A;  4K2J A;  1LWC A;  1C1C A;  1ZZF A;  2H5I B;  3MR3 A;  3J80 U;  5IV4 A;  4DV2 F;  4ZKA A;  5KFB A;  1AT1 B;  4LSN B;  3PR5 B;  3K57 A;  2XTJ P;  2YNG A;  2JWN A;  4LF7 F;  2YXL A;  5FD1 A;  4A8S A;  4NLY A;  3OFE A;  3ZZO A;  4NCA A;  1UZD A;  1YTY A;  2CPI A;  2F7V A;  2RML A;  1REV B;  1W7W A;  4F4W A;  2ZM6 J;  1U1L A;  4C48 A;  5J2Q B;  2XS2 A;  5CD4 A;  1F2G A;  2CZ9 A;  1JLG B;  1FX4 A;  4J9U E;  4NMX A;  3RTV A;  2C3O A;  3QWU A;  3H2V E;  3DHX A;  3T3F A;  2XMK A;  3QFW A;  3RBD A;  4CH0 S;  3UN2 A;  3S8S A;  4N8O A;  1HAR A;  3QZ8 A;  3OUY A;  2COL A;  1G7C B;  2CQD A;  2RRN A;  3M05 A;  3CJ5 A;  5D77 A;  1X4F A;  3QGP A;  2DB1 A;  1NPR A;  5JJB A;  3BPD A;  2VBZ A;  4QZV B;  3D3B J;  4CLK A;  1R43 A;  4DL7 A;  2DIV A;  1WTB A;  3MAH A;  2IPO B;  1PCA A;  2JVR A;  3NGT A;  3S6E A;  4LF8 J;  5KFZ A;  1BQM A;  2DIT A;  1RTI A;  5DDQ C;  3I32 A;  3J7Y I;  1C0T A;  4HH0 A;  2E1C A;  3JSR A;  3KMS A;  1N6Q A;  1TK5 A;  4OIX A;  1ZA1 B;  1AUD A;  3MM5 B;  2J8S A;  3CD7 A;  4JV1 A;  5LJ5 Y;  3HT0 A;  2HLU A;  3P96 A;  2GQC A;  3IO1 A;  1K1S A;  4KGV B;  4JI3 J;  2HGL A;  4LSL B;  4QW9 A;  1S6O A;  4YME A;  1NDK A;  2GX8 A;  2HFS A;  3BGR B;  1XBW A;  1GMW A;  3NOG A;  4YR2 A;  5IM0 A;  3TVY A;  3EXY A;  1SCJ B;  3N01 A;  2ZDO A;  1HD0 A;  4IKA A;  2ZH4 A;  3C3L A;  2VBX A;  1JLB A;  4CLU A;  3JS9 A;  3BQ2 A;  5HVH A;  2V8P A;  3CMA S;  4DR5 F;  3LW5 C;  2IMO A;  4DG1 B;  3CC4 S;  1I94 F;  4F4Z A;  4H4K A;  3TA0 A;  2YY3 A;  3M2R B;  4X2B A;  4NI2 A;  3GIR A;  4QQB A;  3W65 A;  1YI2 S;  4RBT A;  3MEE B;  4U7U K;  2C2D A;  1LWC B;  1C1C B;  5JVG Q;  5I3Q A;  1BQN A;  2V4R A;  1RWV B;  1REG X;  3EDQ B;  2KZM A;  1N56 A;  3UN3 A;  2CRL A;  4DCJ B;  2QMW A;  3MMJ A;  1DLO A;  4LIW A;  2ZH5 A;  4KJI A;  1KSP A;  2V4Q A;  1RAG B;  4LUB A;  1LW2 A;  4MMO A;  3HVR A;  4K7Q A;  2Z4P A;  3JTO A;  4RNO A;  3BGU A;  1P6T A;  2RS8 A;  2R4F A;  4I6W A;  2C2K B;  4Y6I A;  1I3O B;  1U25 A;  3LWM A;  1SIZ A;  1KC8 T;  3TVK A;  4OLP A;  2X1F A;  3OUY B;  1X5O A;  3M6U A;  4OHX A;  3IAS 9;  5ADZ A;  2FVQ A;  1TL1 A;  2UXC F;  4KAI A;  2FHO B;  1RAA B;  4DLG A;  2ZFH A;  4OMF G;  2FJD B;  4Y2M A;  3LGM A;  1S9E A;  1KD1 T;  2QA2 A;  2RD5 C;  4AT1 B;  3OW2 R;  3FBF A;  3QT8 A;  1FXR A;  1BY9 A;  4K4Z A;  2IJN A;  4X4R A;  3C46 A;  1RT2 B;  1YGY A;  1BQM B;  3FRZ A;  1OPZ A;  1RTI B;  4USJ C;  2HW3 A;  2PC6 A;  2ACM A;  1HNV B;  1QSY A;  2OHD A;  2K3K A;  5H9F J;  2LEB A;  2WSE C;  1N6Q B;  4DV0 F;  1N33 J;  1HBM A;  4IOA Q;  4OFZ A;  5M2R A;  3D1O A;  4JI5 F;  3R6G B;  2VPW B;  2K7J A;  3CTR A;  1IKX A;  4Q44 A;  4NA2 A;  1L3U A;  4F4X A;  1LK7 A;  2DXD A;  5KG3 A;  2P9C A;  1YSJ A;  5HBM A;  3FEZ A;  3ADA C;  5EUH A;  1JMT A;  2CKW A;  2QSW A;  4K0K J;  5IM0 B;  3CT9 A;  1MWZ A;  4LSZ B;  5G4D A;  1QSS A;  4KB7 A;  2XY7 A;  2CAJ A;  3HHL A;  2GMJ A;  1BXN A;  4MFB A;  4MT1 A;  4W4M A;  3EWG A;  2HGN A;  4NI2 B;  1XMQ J;  5F3Z A;  3NGU A;  2D1C A;  5EWE A;  4EBC A;  2DGX A;  3LA0 A;  2ZC3 A;  1BQN B;  2HQG A;  3KDO A;  2RDD A;  4MYT A;  1GAO A;  2ASJ A;  3KLE A;  4UUX A;  4WII A;  1NK7 A;  2CVE A;  4OJG A;  4ZPD A;  2RHS B;  2W2P P;  1DLO B;  3F0N A;  2HBR B;  1CG2 A;  1SXL A;  2OKQ A;  1PC5 A;  1KN6 A;  1OQ3 A;  4AQY J;  1YKW A;  1LW2 B;  2WB1 D;  1W25 A;  3S1T A;  1U1K A;  5FDL A;  2HHT A;  2GIQ A;  2NPI A;  4KQZ A;  5KOW A;  1U09 A;  2V9K A;  4UZB A;  2MKK A;  1SQE A;  1H72 C;  2E5J A;  1VC6 A;  2V6A A;  1WSR A;  3K8W A;  4NOH A;  2U1A A;  3OTC A;  3UI3 A;  4CI0 B;  3QBC A;  4A8O A;  3KHH A;  5J2M A;  2AJ4 A;  2Y9H A;  3D1Q A;  3OXL A;  3OVB A;  3KJV B;  4ZLJ A;  1FRH A;  4LF9 J;  4DS4 A;  2Z2M A;  4H54 A;  4G1I A;  4RBU A;  4A8W A;  3O5T B;  1B4S A;  1S9E B;  1FES A;  1SJQ A;  3VQT A;  4HT7 A;  4ETZ A;  2YKA A;  3DOK B;  2CPX A;  4U67 Q;  2ZOG A;  2RE1 A;  1UWA A;  4NAS A;  4CH7 A;  1M0S A;  3ILL A;  1B0P A;  3UD4 P;  4OHW A;  1FJG J;  1Q1K A;  4YOE A;  4DBQ A;  3QID A;  1JLF A;  4WXO A;  1HBM B;  3CED A;  5HJX A;  1Y7P A;  1IBK J;  1SQG A;  4OYW A;  2JEG A;  3HFK A;  2MGZ A;  1NPK A;  1IKX B;  3IRW P;  4X4V A;  4WE1 A;  1U26 A;  3N5F A;  4C7Q A;  5B0A A;  2QA4 G;  1DQA A;  4ZHR A;  1BLU A;  3WC0 A;  2YNI A;  5HBM B;  3BDP A;  1ZS6 A;  3C15 B;  1RU1 A;  1H74 A;  2AJ2 A;  3P8B B;  4FBT A;  2E1R A;  5DG7 A;  1S57 A;  4FS1 A;  1D8Y A;  3QRQ A;  2OD6 A;  3H4D A;  2X7I A;  2DXF A;  3DLK A;  2LQB A;  3G87 A;  3N79 A;  3HHL B;  2GIF A;  4P2S A;  3I96 A;  3FMB A;  4JI1 F;  1AXQ A;  3DHW C;  4MFB B;  3NRB A;  4ECV A;  3QRP A;  2YWW A;  4IH5 A;  1A0O B;  3KUE A;  4DFP A;  5F8H A;  4RLE A;  4PG6 A;  1IBM J;  2CNO B;  3JSB A;  4ALZ A;  3MM7 A;  3Q24 A;  3CCM S;  2MQP A;  1TP7 A;  1XN9 A;  5GAH I;  5KFN A;  1FD8 A;  3UR3 C;  4ID5 A;  4X4S A;  4WFX A;  3KLE B;  4B02 A;  3TOQ A;  2NSB A;  4B9N A;  4M5L A;  2KTQ A;  2XGP A;  2R8I A;  1UZH A;  5HMW A;  5IWA J;  4J9K A;  3IWL A;  3IRX B;  1S59 A;  1S48 A;  1SBR A;  2GHV C;  5DZ7 A;  2HKE A;  2OSQ A;  3FCH A;  4L75 A;  4QIV A;  1APS A;  2FGC A;  2DHH A;  3PG9 A;  4YY3 F;  2PMZ D;  1S1U A;  1G4C A;  4F67 A;  3AD9 C;  3M1V B;  3CW2 C;  4JI7 J;  1L3V A;  1RUS A;  1WC1 A;  2G4B A;  1P8G A;  3IBF B;  4WJB A;  2R7W A;  2AHO B;  3ZTR A;  4DR6 J;  5J2M B;  1VJW A;  5LSO A;  4YHH J;  4UOG A;  2V69 A;  4C2M A;  4ZVQ B;  2DH9 A;  4DR3 J;  2C2M B;  3MCS A;  1LWF A;  2YWF A;  1ZZN A;  2QYG A;  3Q8V A;  3ILI A;  4A8Q A;  4QW8 A;  1Y11 A;  2GGP A;  2X1G A;  1RQ0 A;  5KFQ A;  2JFK A;  3CD5 A;  2DNQ A;  3TJ9 A;  4NXN J;  4F2S A;  3DRX A;  4I2P B;  4ZCK A;  3MR5 A;  3W5X A;  4GKK F;  1VFJ A;  3SQO P;  4ZVT B;  3RR7 A;  5H1S V;  4PZV A;  1XMO J;  2QL9 B;  2KFN A;  3CDB A;  1RCX B;  3EGN A;  4RNM A;  3VAG A;  2C22 A;  4HTI A;  2V2K A;  2DY1 A;  4FS2 A;  4MK9 A;  2KRR A;  3EZ5 A;  3GWC A;  4J91 A;  2V8H A;  2W4P A;  4CM0 A;  4ETX A;  2ZH6 A;  2MGZ B;  1SJF A;  3FUY A;  2HLT A;  2OEM A;  3CJR A;  2F4V J;  1AB8 A;  1S97 A;  5KT6 A;  3J7Z 5;  5F8M A;  3GV8 B;  2YNI B;  4PR6 A;  1XQI A;  5J1N A;  5L1J A;  3MM6 A;  4RW7 B;  1SVD A;  1JKH B;  1UEU A;  5DJB A;  3OHA A;  3BR8 A;  1SB6 A;  2B8P A;  3ONQ A;  2MDA A;  1JJC B;  1E6V B;  3B4M A;  1PG5 B;  2IIH A;  2XQC A;  1FDD A;  1CS4 B;  2R7Q A;  4Y2I A;  5B7W A;  2UVW A;  1S6Q A;  1SC4 B;  2NQP A;  2DPI A;  4IQX A;  2HS0 A;  4QJV A;  2YNH A;  3CJK A;  4WU3 A;  3MM7 B;  2CUY A;  4J9L A;  2I5J A;  3WBZ A;  4H4K C;  4AND A;  3GMG A;  2XMT A;  4DV3 J;  4ZMM A;  1RE1 B;  3O6Q A;  4V1A k;  4ID5 B;  5KAK A;  2KJW A;  4UUW A;  1T7P A;  2M52 A;  5IOL A;  3HM9 A;  3SCL E;  4RKU C;  2OFH X;  4G1P A;  4CIO A;  5CH7 B;  3LQV A;  3AXM A;  4IQM A;  2CJY B;  1FX2 A;  3UFC X;  3TA2 A;  1IKV A;  3M8Y A;  3PDN A;  1KQF B;  2N4D A;  3K17 A;  5LXR A;  3OTO F;  3CCE S;  2VQE J;  1GXT A;  2M8H A;  3NGD A;  2GC8 A;  2NYI A;  4ZVH A;  1S1U B;  1PC4 A;  2AYG A;  1ZET A;  4NX9 A;  1UPM B;  1NSP A;  2CA9 A;  4ZP7 A;  3JTN A;  1B70 B;  2X1A A;  1S9G A;  4FVC A;  2LEC A;  1MMN A;  1LWF B;  1QVG R;  1F9H A;  4NZ0 A;  4G3I A;  1KDN A;  3NS7 B;  4DR1 J;  1OYD A;  2MHE A;  3PRV A;  3DLG B;  4HLB A;  4CDI A;  2ZH1 A;  2HHP A;  5KG6 A;  3THT A;  3EZO A;  3UCU P;  3PCO B;  2QRR A;  1OMS A;  3PIO Q;  4ZVG A;  1ICE B;  5GAE I;  4OZ3 A;  4ZIW A;  3UW1 A;  3J81 Y;  3JQK A;  2ZIT A;  3VHQ A;  2A2C A;  2AIR B;  2CG4 A;  3FSX A;  4PG4 A;  2M8D B;  3IM8 A;  3D6H B;  3DU5 A;  5CZX A;  2G0C A;  5JXS A;  2E5H A;  1SH2 A;  2ZKU A;  2Y1I A;  4QIG A;  2FVR A;  1N32 F;  1SH3 A;  4MH8 A;  1UFL A;  2CPD A;  1RWX B;  2NXN A;  1WHY A;  4QWD A;  3DN9 A;  3D68 A;  2W7A A;  2UUC J;  3NNH A;  3MM6 B;  4ED2 A;  3RB3 A;  2PA8 D;  2AJF E;  4YR3 A;  2FLP A;  3MCN A;  1V3S A;  3HX9 A;  1XR6 A;  3M2U A;  4KBI A;  1HBU A;  4M95 A;  4Z7Y A;  4M94 A;  2DNH A;  1LQ9 A;  3PNI A;  3IBW A;  2XO7 A;  3EMT A;  2YPZ A;  2BAC A;  2ZEJ A;  1S6Q B;  2Z56 B;  2CQH A;  3MCM A;  2FDN A;  5DGA A;  2UUW A;  2NYH A;  4MK8 A;  3KUG A;  3BO3 A;  3HHL C;  4RW4 B;  2FJW A;  3CJK B;  1VOM A;  5H9F K;  2BJ8 A;  2QC3 A;  4K8R A;  2I5J B;  2JRS A;  3DXS X;  2E5I A;  3W66 A;  3NCR A;  2YTC A;  2V5H G;  1SL1 A;  3C8Y A;  3OJS A;  4TQS A;  2CZ4 A;  4USH A;  2YKM A;  1TK0 A;  2D41 A;  2H1Y A;  5L1I A;  3MAA A;  1N36 F;  4YS2 A;  1BC6 A;  1O6X A;  3CCQ S;  1IKV B;  2KXH A;  1R7I A;  2H9Z A;  4MKV A;  4HT5 A;  1KQK A;  4DPW A;  5M2P A;  2ROG A;  4RW6 A;  2RB7 A;  3LP0 A;  1YX2 A;  5IT9 Y;  2ERR A;  1TL3 A;  3E51 A;  1UWB A;  2O5D A;  4Y00 A;  1N5Q A;  2XMU A;  3SQG A;  2HZV A;  1BD6 A;  5ETP A;  1SL0 A;  3QT6 A;  2FVS A;  2KI2 A;  4GVL A;  2QGF B;  4C6A A;  4NYO A;  1UVI A;  2DR7 A;  1V9O A;  2OAU A;  3HT3 A;  2WW8 A;  1S9G B;  2RKI A;  2M3D A;  4F4Y A;  2RS2 A;  1O5J A;  1XNQ F;  5KG5 A;  1EZZ B;  4DX6 A;  2QTW A;  1VMB A;  2X1B A;  4DPU A;  3L95 X;  2KXF A;  5HJY A;  2I9S A;  4IRD A;  1F5C A;  5IFM A;  3R5B A;  2DGU A;  3D28 A;  5A6P A;  5LXY A;  3PX6 A;  5KT7 A;  4ZVS B;  3QT7 A;  3GG0 A;  4NLP A;  1OSC A;  1UKU A;  4HKQ A;  2ADC A;  3QJP A;  1FDN A;  8RUC A;  3N9U C;  1ZAW A;  1EHW A;  1N5Y A;  4DEZ A;  3BBC A;  2Q3P A;  3MM8 A;  1YK9 A;  2U2F A;  3CCJ S;  3BSO A;  3HFZ B;  4ED0 A;  5E33 A;  1U7L A;  4HI2 A;  4EBE A;  4FBU A;  2MZT A;  1NZ8 A;  1CVJ A;  4O0N A;  2FHJ A;  3KOA A;  1RKI A;  5A0Y A;  1HNX F;  1RT3 A;  3FK4 A;  1G6B A;  4W90 B;  3HVT A;  3IBC B;  4ANC A;  2MLZ A;  4ECY A;  1KQS R;  1FWP A;  4O44 A;  4Y3C A;  3TZY A;  3JYT B;  2CIM A;  2EVZ A;  4ZVF A;  3ENW A;  4F8R A;  1TL7 B;  2Z0G A;  2V68 A;  3MUR P;  3DLL Q;  3AA9 A;  3K59 A;  1LV5 A;  4M5N A;  2QIF A;  2B43 A;  2BJ7 A;  4XPC A;  5E3Q A;  2HHV A;  1Q81 T;  1CC8 A;  5C2G A;  1M5H A;  4IO1 A;  3G6Y A;  4MKY A;  5AE1 A;  3C66 A;  4YB1 P;  3ILO A;  3D0H E;  2RVJ A;  2YKM B;  1U0H A;  4ES3 A;  3ZO7 A;  4TU7 A;  1RBL A;  2G0I A;  3NKY A;  3BN4 A;  4ZPV R;  3MAA B;  2DXE A;  1RTD A;  2HYI B;  1FD2 A;  1Q16 B;  2YQ1 A;  3ZTP A;  1DAX A;  4AL6 A;  2JVO A;  1SKS A;  2H4W B;  4BC7 A;  4OX6 A;  1X4A A;  3EVW A;  3R5C A;  1TUG B;  2ROE A;  4RW6 B;  1SPB P;  1PSD A;  2J76 E;  3LP0 B;  5HLF B;  1ZTW A;  4P7T A;  1N88 A;  3LAM A;  2KG0 A;  2ZH9 A;  4HDH A;  1TL3 B;  2BRK A;  1UWB B;  3D5M A;  5F8I A;  4LF6 J;  3HJF A;  3SQG B;  1NK8 A;  2J7K A;  1HWI A;  1VQ8 S;  4NML A;  4ED1 A;  5L39 A;  4QIF A;  2F4F A;  4K4V A;  1BE4 A;  1H73 A;  2QSF A;  2RKI B;  1Q8B A;  5FII A;  4YP3 A;  1Q5V A;  1NKB A;  1VBZ A;  2V63 A;  3A13 A;  2DEI A;  2FIU A;  5CYQ A;  1JNZ B;  2IM2 A;  1WI8 A;  2HVE A;  3CCU S;  2XUL A;  1X4E A;  3FGV A;  5HMX A;  3RRH A;  1SKR A;  5KFY A;  4UST A;  3DOL A;  2B7C B;  3LP1 A;  4C3K A;  2W25 A;  4B3R F;  2XZT B;  4QR1 A;  4DQQ A;  3HK2 A;  1BWE A;  3SBM A;  3H90 A;  2W01 A;  4UY8 T;  1U2R A;  2XHW A;  1FWK A;  3TX8 A;  1RWM B;  2V2Z A;  5LMU J;  1OJ4 A;  1N5Y B;  1X60 A;  2LXF A;  3MM8 B;  2MZR A;  1OS5 A;  4TYB A;  1NLK L;  5ETN A;  3V4I A;  3UWT A;  4HHU A;  4Q8E A;  2KFZ A;  4IR9 A;  2ZWO A;  3ISZ A;  1T9V A;  3OR2 A;  1R6V A;  1D9F A;  4C98 A;  1M90 T;  5A0Y B;  1RT3 B;  3OFG A;  4IFV A;  3GCX P;  1Z2L A;  3HVT B;  2V67 A;  3HZG A;  4O44 B;  3EPI A;  5IQ6 A;  5AXN A;  1U2F A;  2RF2 A;  4LRD A;  2XYH B;  1U6Z A;  4PG7 A;  1RZM A;  3D6M B;  3QGG A;  3VVU A;  1UJ6 A;  5LJ3 Y;  5HI7 A;  3T41 A;  1HWJ A;  2BVZ A;  2QMX A;  4EYI B;  4LJM A;  5LSL A;  3QZ7 A;  4XDC A;  1TMM A;  2CPE A;  2LLZ A;  6FD1 A;  3Q0A A;  5ETS A;  3GR0 A;  4DI6 A;  2OH2 A;  1U0H B;  2GQ2 A;  1RA6 A;  2LQ5 A;  1U24 A;  3C14 A;  2ZZM A;  2I6W A;  3EVO A;  2M7S A;  3B78 A;  2HBY B;  2HHX A;  5KFK A;  3TZZ A;  1KON A;  3N5B A;  1F60 B;  1RTD B;  1FEE A;  4EU0 A;  3OD2 A;  1NHU A;  3TEH B;  2P5V A;  3A8I A;  5HP1 A;  2IYI A;  2Z2Y B;  4ELT A;  1R8C A;  5KFC A;  4PPD A;  5E5N A;  2EC2 A;  3A4T A;  4WPA A;  4UOH A;  3H20 A;  1Q53 A;  5A8K A;  1FNX H;  4L73 A;  2B4P A;  1IJE B;  3PO5 A;  3D9B A;  1RT5 A;  2BR0 A;  1RLD A;  5HQL A;  2MJU A;  3HKW A;  1U1O A;  2ZOM A;  3GV7 B;  3HFV A;  1NK6 A;  2MTL A;  2EBE A;  1VBY A;  1WD6 A;  4QYZ K;  1ARO P;  4OI0 A;  4WWS A;  5EX0 A;  2KN4 A;  2W2N P;  5CYQ B;  2WTF A;  3U1L A;  3IGN A;  2EI5 A;  4H4O A;  2MKJ A;  1EKS A;  3PXG a;  3LP1 B;  5EGY A;  2ZOF A;  2GIR A;  2WRM A;  1RWN B;  3PVX A;  3TAM A;  1FRJ A;  4PXD A;  4OYO A;  1P9Y A;  4DQS A;  1NM2 A;  4ES2 A;  5DDP C;  1XMB A;  3R5G A;  4P7V A;  4LQ9 A;  1RKJ A;  6AT1 B;  2VFR A;  2Y0S D;  2CNN B;  4ER8 A;  1UCN A;  1VBX A;  4RJV A;  3CC2 S;  5E7O B;  2QN6 B;  4NCB A;  1E6Y A;  4P72 A;  2GAG C;  3V4I B;  1ZM4 A;  1N52 B;  2XM3 A;  3DU6 A;  2ZJP Q;  2MPU A;  4PAA A;  4CLZ A;  1J5E F;  3JQM A;  2HBZ B;  3QRR A;  3OR2 B;  2BX6 A;  1VQL S;  3H42 A;  2EEY A;  3AH6 A;  1MN9 A;  4OI2 A;  3PO4 A;  2KFY A;  3IP0 A;  2ALZ A;  1TTH B;  1V3Z A;  3IN5 A;  1FWL A;  4LF5 J;  1F2H A;  1WDD A;  2RF2 B;  3ETO A;  4I69 A;  2GV1 A;  5FLX U;  2JFD A;  3CC7 S;  4IOC Q;  1G2E A;  1OY8 A;  2V94 A;  1RTJ A;  4N77 A;  2YKO A;  5LL6 d;  1X4C A;  2BW2 A;  3OL8 A;  3I9V 9;  4J9R A;  2BAN A;  5HMY A;  3BGL A;  4EO6 A;  3C14 B;  4MIA A;  5KFT A;  2CNK B;  3WHI A;  3C6T A;  3FVY A;  2WVC A;  2GZO A;  2FTR A;  4OL8 A;  2L3M A;  1SC6 A;  1BWV A;  4GRS A;  5L9X A;  2CPJ A;  3LOU A;  1F3F A;  3F73 A;  2V34 A;  4XIU A;  2YWH A;  2MHN A;  3EGZ A;  4DN9 A;  3OXF A;  3CJ4 A;  2B9E A;  5A8K B;  4X4N A;  2A10 A;  1LFP A;  3LAK A;  3X1L B;  4RPF A;  5KFI A;  2UU9 J;  1A6L A;  2DY9 A;  3DRP A;  4GC6 A;  2VH7 A;  5F8L A;  1JJH A;  3DLB A;  2RUS A;  1HHS A;  4KH1 B;  4B08 A;  1NND A;  1HYS B;  3M32 A;  1UA0 A;  4FF3 A;  1ITP A;  4CP5 A;  1H2T Z;  5C2C A;  4DFK A;  4OX7 A;  3G96 A;  3SSS A;  4OJ3 A;  3KLH A;  9ATC B;  2FC8 A;  1MU2 A;  4URQ U;  3FZB A;  2BJD A;  2XHC A;  2BJ3 A;  2F1F A;  4USW A;  4H4O B;  4GO7 X;  4F50 A;  4BC9 A;  4LRC A;  4Q8F A;  4C9D A;  1QDU B;  3GYX B;  3H4B A;  5LMU F;  2HG4 A;  3MWB A;  2CPZ A;  5I3U B;  4A48 A;  2B4U A;  1VQM S;  4FYD A;  2C2N A;  1T8E A;  3HDS A;  3A1Y G;  2WAQ D;  2A18 A;  4DPY A;  1V5I B;  2V2Q A;  1IQZ A;  4CLL A;  1E6Y B;  4C8N A;  4LR8 A;  1WKJ A;  4TQR A;  4DV1 F;  2YKQ A;  5BR8 F;  2WVD A;  1YRT A;  1IQT A;  4URS A;  1C4A A;  3V81 A;  3W2V B;  4LF2 A;  1ZPW X;  1UEK A;  2R8K A;  5CCM A;  2RQM A;  4DCP B;  4P2X A;  1UJ5 A;  3GFY A;  5KFU A;  2OGU A;  3R1H A;  4TKT A;  3J81 U;  4YN3 B;  3SFU A;  1S1V B;  2JDJ A;  3AT1 B;  1GTE A;  2GCF A;  3NLC A;  3EGW B;  2NUH A;  2EG2 A;  4DL2 A;  1EQM A;  1MRO B;  1RT6 A;  1TL5 A;  3MOZ A;  1HMV A;  3SSR A;  2BZ2 A;  3SDE A;  3JSY A;  2H54 B;  3CCV S;  4J9Q A;  4JYA J;  4CLF A;  3M9O B;  2E7V A;  1RTJ B;  4NZ6 A;  2F8H A;  3KDN A;  3BM7 A;  3JXO A;  2BAN B;  1NME B;  3NGR A;  4LBP A;  1FJC A;  1OSD A;  4U8Y A;  3C6T B;  3OQ2 A;  4ED5 A;  4DV6 J;  1U0S A;  1VQP S;  2MQM A;  4AL7 A;  4PQA A;  3IWN C;  1YQH A;  2I2Y A;  1MNE A;  3DRR A;  1WHV A;  1W2B R;  3SCI E;  3D1H A;  1S79 A;  4IR1 A;  2LEA A;  3KJQ B;  3MPY A;  1GQE A;  5AXK A;  1R27 B;  4JV2 A;  2HFZ A;  1K47 A;  4ECX A;  3ET6 A;  4ZPA A;  3UDC A;  5LMN F;  2IA6 A;  2UUA F;  3ULH A;  4F26 A;  4PQU A;  4WIQ A;  1KRP A;  3CCT A;  4NLO A;  2DNM A;  1HQE A;  2OJ3 A;  4ITS A;  2VIH A;  3A3O B;  3DRP B;  5L9N A;  3WIU A;  1S49 A;  3C6U A;  4M5K A;  5A8R A;  1U6B A;  3KHG A;  1RLC L;  3M32 B;  2XYG B;  4WU2 A;  3DGP A;  3P6Y C;  3TAR A;  3DGV A;  4G65 A;  3KLH B;  1CBK A;  1PJ7 A;  1MU2 B;  2RUG A;  5IT9 U;  1RT4 A;  3FC9 A;  2HND B;  2JSX A;  1XC9 A;  3H7H B;  1FK9 A;  4EZ6 A;  1RAO A;  4JI6 F;  2ZWP A;  1CJT A;  3NNA A;  1KEK A;  2VZ9 A;  2AWZ A;  1MWY A;  2POK A;  3KLI B;  4WF9 Q;  1NB2 A;  5F3T A;  1G1X A;  1Q5Y A;  3SI8 A;  4DR2 F;  4LIR A;  4GO5 X;  4Q2M A;  1KBR A;  3KJN B;  4Y2K A;  1FXL A;  2H5J B;  3M9N B;  4ECU A;  3BDE A;  2MY8 A;  2IYG A;  1VDH A;  2HQI A;  2HSE B;  2PI5 A;  2XWX A;  1NXI A;  1Q7Y T;  3AOD A;  2ZBR A;  1WEX A;  3V81 B;  1MWQ A;  1UVN A;  3T19 A;  3UDL A;  1FJE B;  4P71 A;  3R7S B;  4JI2 J;  2JEJ A;  1IM6 A;  4OHZ A;  2M70 A;  1S4E A;  4MJK A;  2DYA A;  5KFH A;  2E1P A;  2VOP A;  2C2O B;  5KFE A;  5KFD A;  2LA6 A;  3NAI A;  1X5P A;  2W1B A;  1QE1 B;  4LFC F;  4WZM A;  4YUD A;  3GJR B;  2VD3 A;  4FKY A;  5L38 A;  4B3T F;  4DR7 J;  1HMV B;  4N5S A;  2EK6 A;  1T9Y A;  4CZC A;  5CYM A;  3SV3 A;  2ZZN A;  5I3P A;  3V6D A;  1S9F A;  2QMU B;  2XMW A;  3SDE B;  4OZ1 A;  1TAU A;  1Y3K A;  2Q1L A;  1TMJ A;  1RBA A;  1Y0H A;  5HQ8 A;  1IN0 A;  3IGV A;  3I5B A;  2QL5 B;  2KZZ A;  2CJ9 A;  4RNH A;  1W26 A;  1PYS B;  3MGJ A;  3D4J A;  3SV4 A;  1FF2 A;  1I1G A;  4K5R A;  4DV2 J;  1HWK A;  3N6L A;  2RU9 A;  2J9C A;  3WDO A;  1URN A;  1VHF A;  1P9Q C;  4ZPT R;  2ZJR Q;  4LF7 J;  2JZ5 A;  5IQQ A;  2FLO A;  2DRB A;  2E5G A;  1KTV A;  4D3H A;  2RRB A;  3QQC D;  5ETK A;  5KFO A;  2F3J A;  2V9W A;  3ET6 B;  4ZVU B;  1LXN A;  3TRG A;  1GH8 A;  1MG7 A;  4B9T A;  1ACM B;  4PQU B;  3FBC A;  4JV0 A;  2W7P A;  3OL6 A;  1W2I A;  4N76 A;  3BZQ A;  3MEG A;  1HQE B;  5EWF A;  5K8O A;  3C6U B;  5A8R B;  2CQ0 A;  1FFS B;  3UD3 P;  2SXL A;  4EI2 A;  1F5A A;  4HHJ A;  4HI1 A;  4P2M A;  1QAY A;  3DGP B;  4EUV A;  1HNZ F;  1NO8 A;  3SEO A;  4ILL A;  4RNF A;  3AD7 C;  2HVD A;  1RDR A;  1RT4 B;  2C2Z B;  1IUJ A;  4PG5 A;  2JLG A;  1FK9 B;  2WSC C;  3W8P A;  4O3R A;  4MKA A;  1CJT B;  3T1Y F;  2QLX A;  4ILR A;  4JI0 F;  2NXJ A;  3GFX A;  3ZZP A;  4URG A;  2DNN A;  2QE5 A;  1TVR A;  4FPI A;  3CD6 S;  4DV5 F;  2HGM A;  2AW0 A;  2DH7 A;  5CZV A;  5THW A;  5KT3 A;  4DSJ A;  2XCA A;  1FTC A;  8ATC B;  2OFG X;  2YH1 A;  1TKZ B;  2NPF A;  3MI7 X;  2B8Q A;  3M4X A;  3PR4 A;  4I4B A;  2HIY A;  2D3Z A;  5E3A A;  3R1L A;  5HMZ A;  4LFA F;  3PYE A;  4NLX A;  1HWL A;  4PWD A;  2WVF A;  3LTO A;  3QSY B;  2UXD F;  2DNO A;  4LF4 J;  2CDQ A;  2BV3 A;  5J1E A;  3DCA A;  2KG1 A;  1EAR A;  3A3N B;  2ASD A;  3W1Y C;  1JB0 C;  1ZM3 A;  5B0C A;  7FDR A;  2EKY A;  3V6D B;  2C3M A;  4DR5 J;  2ZD1 A;  4DSI A;  4QWB A;  3SCK E;  1Q86 T;  2XMA A;  1SJ4 P;  3GB0 A;  3H0P A;  3QMQ A;  4QWE A;  4AYB D;  3CDE A;  4WFB Q;  3OTB A;  1RAI B;  2BKO A;  1CJK B;  3P45 B;  1GTH A;  4LSN A;  4A8Y A;  2MQN A;  4I6A A;  5DLG A;  3DDK A;  5IC6 B;  1T95 A;  1NH7 A;  2QG9 B;  2J7U A;  5HO4 A;  4O4R A;  2G0J A;  5GAG U;  2J7W A;  3AA8 A;  1KFS A;  2IFX A;  2XBP A;  1FVS A;  3DKD A;  1VK3 A;  1Y10 A;  1DTT B;  2YQ3 A;  2BOP A;  3BB5 A;  4JI4 F;  2GS8 A;  1NDP A;  2H48 B;  3HF5 A;  3GSI A;  2ZBC A;  2R3V A;  3PJX A;  3DLE A;  5J2P A;  4ZK7 M;  1GK8 A;  2AJ0 A;  3NG8 A;  3MEG B;  1UA1 A;  2V8D A;  1QSL A;  2MQL A;  3GIK A;  3CJ8 A;  3UD5 A;  1DRZ A;  4WFN Q;  4X64 F;  3EPG A;  1TFY A;  3KLG A;  1M1K T;  1TV6 A;  3OFF A;  1RP5 A;  4RUC A;  4IH7 A;  4ZS6 A;  2UXC J;  5SZT A;  2HRU A;  4FYV B;  4DU8 A;  3HHN B;  5AJ3 F;  2BOA A;  2OLW A;  5HN0 A;  3OJU A;  2MEW A;  1VGY A;  4C8M A;  1RHQ B;  4J9S A;  2VKZ G;  5H9E J;  3OVS A;  4NLV A;  2CNL B;  1QAI A;  4X4P A;  4F25 A;  4UT4 A;  1AA1 B;  2EKN A;  1NEE A;  3H2L A;  3EGV A;  4QPX A;  2GW8 A;  4DV0 J;  2VUG A;  4AUK A;  5AE3 A;  4DCO B;  2E66 A;  3CJ2 A;  4LBH A;  4ECW A;  2W24 A;  3V4M A;  1B7Y B;  2FJA B;  2OEL A;  3P4U B;  4G6V B;  1JXE A;  1S1W B;  4PWD B;  2AX0 A;  2WVE A;  3PW5 A;  5ETO A;  1GT8 A;  1WHX A;  1SKU B;  4KR0 B;  1NJZ A;  3DFE A;  3QNW B;  4EEY A;  1VQK S;  2I1R A;  2OIH A;  4DR4 F;  3PYD A;  1G3O A;  5J1E B;  2W9B A;  1NDC A;  3T9N A;  2QL7 B;  4KE5 A;  3TO8 A;  1KLM B;  2UVR A;  3BF4 A;  3BKF A;  3ZZR A;  1Y5L B;  3HMJ G;  1RWO B;  3PYF A;  4TVA B;  1TL4 A;  2F40 A;  4YR0 A;  1LWX A;  3PEJ A;  2G2Z A;  3BBF A;  1NZA A;  1KFD A;  4J7C A;  1XTZ A;  4O3N A;  2UUB F;  3IR5 B;  3G6X A;  2UXB F;  1WDT A;  4GKJ F;  4AXJ A;  2PII A;  2BAB A;  2EFQ A;  1LEO A;  4K50 A;  2HEK A;  2BXJ A;  2DEJ A;  1NSA A;  1HR0 F;  2EFV A;  3RR8 A;  4QBU A;  5KFS A;  1GXL A;  4WYW A;  4P2F A;  3MR2 A;  4NLU A;  2AGO A;  3KXD A;  4U8V A;  1JK9 B;  3DLE B;  1K1Q A;  3W61 A;  3WX8 A;  5J2P B;  4YB6 A;  4DPT A;  4X66 F;  3A8J A;  3B82 A;  4HHH A;  2WK4 A;  2LQ9 A;  3F56 A;  3EYZ A;  1Q8I A;  2ILZ A;  1X4D A;  2MZQ A;  4JOU A;  3Q86 A;  2OP5 A;  3KLG B;  4RWW A;  4RNN A;  1TV6 B;  2R7X A;  3U02 A;  1D3W A;  3M9M B;  5AE2 A;  3TUI C;  3BV8 A;  1QVF R;  1FVQ A;  1KKH A;  5B08 A;  4ED7 A;  3HZE A;  2BKP A;  2F5G A;  2JL9 A;  4C8Y A;  1RT2 A;  1GMV A;  3K5L A;  4OZ0 A;  1VYA A;  2VG5 A;  5A2Q U;  1ZAX A;  3A8E A;  1HNV A;  1YBT A;  4S0M A;  3H5U A;  2HHW A;  2HMI B;  3KLF A;  4G1Q B;  1QAJ A;  2PDA A;  2UVV A;  1SV5 A;  1SI9 A;  3THP A;  4KHP F;  1X4B A;  2N7Y A;  1DQ9 A;  3R2C J;  2E9Z A;  3GZ7 A;  4OYM A;  2LXU A;  4F0H A;  4YFU A;  2IDE A;  4LF4 F;  2GMH A;  4I64 A;  4FXW A;  5CHC B;  4QU7 A;  3J7A 1;  2FJB B;  4KC5 A;  1BHN A;  4ANE A;  2W9B B;  1FXD A;  2RIL A;  4R25 A;  2C2R A;  2ATC B;  1NSQ A;  5SUH A;  4JI1 J;  1RT1 A;  5MLC V;  2HNY B;  1S1X A;  4EZ9 A;  4R8U A;  4IO9 Q;  2LQ8 A;  3M8R A;  3DRS B;  1Q78 A;  3TAQ A;  2IRU A;  2DGW A;  3HJV A;  5KFM A;  2K1R A;  2H5E A;  3CDA A;  4UW2 A;  2F8E X;  3B4D A;  2K2P A;  1BMQ B;  1Q7L B;  3BYR A;  4BS2 A;  3L4B C;  5F0U A;  3EXC X;  3KG0 A;  2CFX A;  3K58 A;  2ALY B;  2Z30 B;  1U8S A;  1IR2 A;  5KFA A;  1UJ4 A;  4YY3 J;  3PW7 A;  2HHH F;  1HHT P;  3PYG A;  2E5L F;  2QYC A;  2FVP A;  2L08 A;  4ZVR B;  4C0H A;  3ZXW A;  2IBK A;  3DLH A;  3KJV A;  2W2M P;  4JI8 F;  1UVM A;  2KT5 A;  1FEH A;  4L74 A;  1RHR B;  5IV3 A;  1JXV A;  1NJX A;  3DOK A;  4HR2 A;  2AX1 A;  5C7P A;  2BBE A;  2VG5 B;  2OI2 A;  2K7K A;  3TQE A;  4C3M A;  4RUH A;  4CO3 A;  4GKK J;  4WP9 A;  4M5D A;  2AZ1 A;  4RW9 A;  4IFY A;  3Q8U A;  1RB0 A;  2NSC A;  2DNZ A;  1UTA A;  4U9R A;  3KLF B;  1ZYQ A;  3VTI A;  2VAS A;  1SV5 B;  4LQ3 A;  1VQS A;  2C28 A;  1U47 A;  4OZ2 A;  2FGO A;  2KYX A;  2FLN A;  2DGS A;  2YKN A;  2MQQ A;  3G86 A;  1WF2 A;  2CG8 A;  3KWM A;  1N0V C;  3C15 A;  2YVS A;  3ZZT A;  4NRU A;  1Q79 A;  4MYU A;  1RI7 A;  2X51 A;  3M8Z A;  4K4W A;  1OY9 A;  1WAC A;  1B3T A;  2DPJ A;  2BUN A;  3DDN A;  3RRG A;  4BBY A;  2C2E A;  4GC7 A;  3CJQ A;  3ZZZ A;  1M5V C;  5L46 A;  2GA7 A;  3X3U A;  1RT1 B;  1S1X B;  2R2S A;  4R8U B;  4HH1 A;  1N0U A;  1QTN B;  3BYP A;  1V5V A;  4ZP8 A;  1TU0 B;  2I0X A;  4U7C A;  1ZM2 A;  5HK4 A;  3I55 S;  1NHK L;  4PYD A;  3LWL A;  2K1R B;  5KFP A;  1C0U A;  2CXE A;  3K89 A;  4J9V A;  5AXM A;  4EBD A;  3QIP B;  3ILJ A;  1U1P A;  2UV8 A;  3W9H A;  4WXW A;  3H40 A;  4CQ1 A;  4M5H A;  1S10 A;  1RA7 A;  1UW4 A;  2VIC A;  3BSC A;  3IRX A;  4GMK A;  3MD3 A;  1T11 A;  3EX7 B;  3VAF A;  4LRA A;  1S76 D;  3OTO J;  4ECR A;  3M1V A;  3QO9 B;  2E1M C;  3I6P A;  3WZ0 A;  1YJR A;  2ZNY A;  1WEZ A;  3BSA A;  2BJ1 A;  4Q45 A;  4DHV A;  3BBB A;  2RHQ B;  3ENQ A;  3CJS A;  1J27 A;  1S77 D;  4QR2 A;  1JLQ A;  1AFI A;  3OBI A;  1ZPV A;  1Y5I B;  4ZP9 A;  3NCP A;  1AUS L;  2R9L A;  1NK0 A;  3H5X A;  3VCD A;  4I2P A;  2P8I A;  5DS7 A;  2APO A;  3TUP A;  2KL8 A;  4XTT A;  2H51 B;  5DDR C;  1Q82 T;  2OD4 A;  1K0T A;  2W4D A;  1WC6 A;  4Y2A A;  4M5D B;  4UOF A;  4X4T A;  4OZJ A;  4K5S A;  4IFY B;  4RW9 B;  2RAQ A;  5A76 A;  3VGU A;  1TKD A;  1GMW D;  3OR1 A;  3NS6 A;  1IBL F;  3MMC B;  3BSN A;  5D8H B;  4M8L A;  4B3M F;  3QAE A;  4DSF A;  3GON A;  4PXE A;  5IZH A;  2ZC4 A;  1YBA A;  2GJ2 A;  4NLW A;  4PG8 A;  2DO4 A;  1F3V A;  3G8Q A;  1ROF A;  2KKH A;  1O51 A;  2YKN B;  1KLN A;  1N32 J;  3P5B P;  3LPY A;  1VI7 A;  3Q22 A;  4RW7 A;  2ZVS A;  2HRY A;  4DV7 F;  1JKH A;  2EC0 A;  4NLT A;  2E1A A;  1H98 A;  3MMB A;  2FJE B;  1WSV A;  1E6V A;  4OV1 A;  2F9J A;  2DK2 A;  4ZCM A;  2R8J A;  1RSC A;  1CS4 A;  1FRL A;  1RK8 A;  3NBP A;  4DUT A;  3KK3 A;  2Q43 A;  3K5M A;  2HVZ A;  3KNG A;  3KFW X;  3MM9 B;  5H9E K;  2CVI A;  1PAU B;  9RUB A;  1S99 A;  3TJ8 A;  2O1P A;  4HYK A;  4LFB F;  1H3D A;  4QOT A;  5GAD U;  3O2I A;  4FDF A;  2WCX A;  3VAK A;  1ZBT A;  1D0E A;  4ZCI A;  4DPX A;  2O3D A;  2VHG A;  3MFI A;  1YBU A;  7FD1 A;  2J9D E;  1C0U B;  4J37 A;  3TVZ A;  2HVI A;  3P3D A;  1EX8 A;  2GAH C;  2HUR A;  5DLF A;  2XGQ A;  5JUM A;  2ZBI A;  4J9M A;  2XCP A;  1HNI A;  1WG1 A;  4FYX B;  4WBF A;  1YJW S;  1NB7 A;  1N36 J;  2AEJ A;  4OLO A;  2KHC A;  2A6O A;  1R31 A;  2B7B B;  4JB8 B;  3CCR S;  2ROP A;  1X9M A;  3G2X A;  3CME S;  1MSW D;  2QA1 A;  2WSF C;  4KGX B;  3PW0 A;  3QYY A;  4KT0 C;  2Y1L B;  3DDI A;  3HVW A;  4PWW A;  2EFN A;  3ZNJ 1;  1PJ5 A;  3Q8Q B;  2HQF A;  1XNR F;  2GVD A;  3AQO A;  3I5A A;  4ICL A;  1C2P A;  3PM9 A;  2BW7 A;  3K5O A;  1FDA A;  4I1T A;  3IG1 A;  4RR5 A;  4A47 A;  3MR7 A;  1JLQ B;  5F8G A;  5D4L A;  1YZ7 A;  3DLG A;  1R0A A;  3L3C A;  2XC9 A;  3FRY A;  1XNQ J;  2BJE A;  3R7B B;  1H7W A;  4DSL A;  4B3O A;  4BWJ A;  1HWU A;  2F65 A;  1HIY A;  4EMD A;  2OMO A;  2JC0 A;  5ETQ A;  2VFT A;  4P10 A;  4IH6 A;  1C1B A;  1WC0 A;  1S0V A;  4B9M A;  3JB9 k;  4FP9 A;  3NAH A;  3VR1 A;  4OQJ A;  3KK1 A;  4UQG A;  1O0P A;  3QGI A;  3OR1 B;  3OSP A;  2CQ1 A;  2DH8 A;  4F04 B;  3O1L A;  2BMB A;  2Y0B B;  1T9W A;  3KTQ A;  3US5 A;  2DR5 A;  5U47 A;  3O8W A;  3HHL D;  5FLX Y;  4WZQ A;  1B64 A;  3FKB A;  2B5J A;  2HFN A;  4ED4 A;  4UZC A;  3PKY A;  3VVT A;  4KGK A;  1A7G E;  1FI4 A;  3WX4 A;  1VBK A;  3OXG A;  4RU2 A;  2ZE2 A;  3FCW A;  2QJ3 A;  1I6J A;  5K8P A;  3MMB B;  3M8P B;  3HSZ A;  2L9W A;  3IWX A;  2NRE A;  2HK2 A;  4RUB A;  1HNX J;  1T94 A;  2XS7 A;  3PHT A;  5D15 A;  3OT9 A;  3UE2 A;  2DR8 A;  2CQ2 A;  3IR7 B;  3NBP B;  3KK3 B;  2D69 A;  2VOO A;  4DUZ F;  2HHU A;  5BYQ A;  2CQP A;  4PAB A;  3SSQ A;  4DLE A;  2J0Q D;  5K8N A;  5CAB A;  1Q4R A;  3FQL A;  2XNR A;  4NEZ A;  5HQM A;  4CO4 A;  3AAW B;  4RW4 A;  3S7R A;  3VAJ A;  1WJ9 A;  3LP2 A;  1V3R A;  2VKR A;  3DM2 A;  3OV7 A;  5K14 A;  3GR1 A;  4RBV A;  4WP8 A;  2DIS A;  5CQG A;  5DM7 Q;  3CJT A;  3MF5 A;  2XLK A;  2BE9 B;  2GVZ B;  3I0R B;  2V50 A;  1HNI B;  1YWX A;  4USU A;  3L7P A;  2HHS A;  1CLF A;  3R2D J;  1PBU A;  5IT4 A;  4PPZ A;  1FNO A;  2CQI A;  2KH9 A;  3LO3 A;  2R2R A;  3C2P A;  3QWP A;  3VZI A;  4JUZ A;  5DGB A;  1T3O A;  5B0G A;  3TAP A;  2IVY A;  1HKA A;  1R8B A;  1QAX A;  4W98 A;  1X4H A;  4IRK A;  3GSD A;  2H65 B;  4NEY A;  5CA5 A;  4TLR A;  1LWE A;  2GVD B;  2PEB A;  2EW9 A;  5JVH Q;  4ICL B;  2RJZ A;  1U45 A;  3MMA A;  4QU6 A;  1OIA A;  3IG1 B;  1UL3 A;  1QY7 A;  1RAE B;  3U7J A;  2LXI A;  3BH6 B;  2D3O 1;  1EB0 A;  1X7V A;  4OHY A;  2HK3 A;  3VGS A;  1R0A B;  2B9X A;  4KKO B;  5A8W B;  2JX2 A;  2L48 A;  1X9S A;  4B3O B;  5E3R A;  3LAL A;  2MJN A;  3SMZ A;  4KGZ B;  3QSI A;  5GAG I;  4DX5 A;  2PI4 A;  5D0H A;  1C1B B;  2YX7 A;  4RX6 A;  3KK1 B;  2RQ4 A;  3HVA A;  1U48 A;  4B3R J;  2NXE A;  4CLP A;  1NJI T;  1Q8L A;  3P5T L;  1FFG B;  4OV6 A;  5DRK A;  2EFO A;  1U1Q A;  4ZLN A;  2V4J A;  4OI6 A;  2FPH X;  2IDL A;  4OYA A;  2GML A;  1DBD A;  4I6Y A;  3B54 A;  1QUV A;  2B0G A;  1S0O A;  1GXU A;  4MIW A;  2B5J B;  2QLW A;  3VWS A;  3H25 A;  2YNF A;  3W64 A;  2YWE A;  1VRU B;  2LU2 A;  5EX3 A;  2ZE2 B;  3CIZ A;  4BHQ A;  3S01 A;  2WBM A;  2AJQ A;  2Y1J A;  2ZVI A;  2FJX A;  3JYT A;  4O3Q A;  2LCW A;  2EFG A;  1DTQ A;  4QWA A;  2HZC A;  1TL7 A;  1WWH A;  4E0D A;  1K73 T;  4NLR A;  3BGO P;  5GMD A;  2PGC A;  4R5P A;  5LOQ A;  2AJ1 A;  5MAO A;  2V8G A;  3P49 B;  2F9D A;  3HHE A;  1YJ7 A;  4Q2L A;  3LP2 B;  3DM2 B;  1WC4 A;  2W8L A;  2OEJ A;  5KG7 A;  3LGH A;  5K14 B;  3H5S A;  2D7S A;  4ZP6 A;  3GTY X;  4K4X A;  3M6V A;  3V6H A;  2QLJ B;  2HNZ A;  3SFG A;  2Y8Y A;  3DOM A;  1XEZ A;  4DV4 F;  3T9Z A;  1KVJ A;  2KT3 A;  3PFE A;  3AB4 B;  4YDX A;  1N48 A;  1UET A;  3MUT P;  3ZZ0 A;  4H4M A;  4FF2 A;  3UCG A;  3UNY A;  1CPZ A;  1MMD A;  5HLF A;  3D66 A;  2HFO A;  4DMZ A;  2MY7 A;  3L9Z A;  1GMU A;  3ELH A;  2IRX A;  4LRF A;  1HNW F;  1FKO B;  1VC5 A;  2AF6 A;  2AKW B;  1PIE A;  4X65 F;  1LWE B;  2GO8 A;  2VG7 A;  1X5T A;  2QFI A;  2RQC A;  3MMA B;  3MPV A;  4ZIT A;  1H2V Z;  3MHY A;  1WI6 A;  1KTQ A;  3RGI A;  1Y5N B;  1NK9 A;  2AP6 A;  4Z37 A;  4J9N A;  4DQR A;  2XMM A;  2XWY A;  3V2U C;  2Y1R I;  5HVG A;  2WOM A;  3GIL A;  2FZC B;  4HL9 A;  2WHO A;  3MEC A;  1LFW A;  5BYS A;  4YDD B;  4MAK A;  1DUR A;  2W2Q P;  2VBY A;  4O3P A;  2C3P A;  3D6T B;  3ISN D;  2V4J B;  1WEL A;  1CC7 A;  1SJR A;  3T1H F;  1YDL A;  2OSR A;  2VA2 A;  4O4G A;  3FSI A;  5EDW A;  1OO0 B;  2J6U A;  2VC1 A;  1X0P A;  1TR0 A;  2LA4 A;  1FHT A;  4CO0 A;  3J7A N;  2R2T A;  2YNF B;  2HFV A;  2MYF A;  3RB6 A;  1FE0 A;  4CO1 A;  1YLX A;  1JLA A;  1J5E J;  4X62 F;  2YNG B;  2VQF F;  3OLA A;  1VQN S;  4A8X A;  4DV1 J;  4FZV A;  1ELO A;  1DTQ B;  3FZ2 A;  1RTH A;  5FJ4 A;  5C25 A;  1CQN A;  2DNL A;  1GFW B;  2DD8 S;  3EUN A;  2HQ3 A;  4R5P B;  4DWI A;  2ATL A;  3Q2S C;  3LUY A;  3THV A;  3QFH A;  5DET A;  4OYX A;  4NA1 A;  1U1R A;  4Q7A A;  3KYL A;  4FYY B;  4X4U A;  3BRE A;  4UTG A;  3GV5 B;  1UVL A;  1HLW A;  2HNZ B;  5E2Q A;  3DOM B;  5ETR A;  1NAQ A;  3HO1 A;  2OPR A;  4RW8 A;  3OFH A;  2CZV C;  1J2V A;  2Z58 B;  4DF4 A;  4H4M B;  2MLY A;  4USK A;  3M8S A;  2CJA A;  2HFU A;  5KT4 A;  1NCL A;  3G4S S;  3W9I A;  4JV5 F;  1RU2 A;  4JP8 A;  4WK1 A;  1JLE A;  2Z2L A;  1KHV A;  2DKO B;  1NBE B;  2F8M A;  2K3I A;  2PD1 A;  4IG3 A;  3BH7 B;  5K9F A;  1C0T B;  5F41 A;  3W63 A;  2XZD B;  4ECS A;  4OX9 F;  1WF0 A;  1K8A T;  1RBO B;  1U02 A;  2VG7 B;  1YVF A;  5F9N A;  3QGH A;  3ZTO A;  3BKU A;  2JLF A;  3I4P A;  3GII A;  1LOU A;  2KM8 B;  4R0J A;  4CYU A;  4LVN P;  3TYT A;  4LR9 A;  3T5J A;  3Q89 A;  4A8M P;  4P52 A;  4L3K A;  2KJV A;  1NPP A;  2PE8 A;  3CD0 A;  5HVF A;  4QIW D;  1D9D A;  4M5I A;  1RHM B;  1FTR A;  5KG0 A;  2WOM B;  5L1L A;  1U49 A;  3DNC A;  3MEC B;  3NEK A;  3FQK A;  2R8H A;  1TUW A;  3SZ2 A;  1RGV A;  3PY8 A;  1F6T A;  1JLC A;  5GMK a;  5C24 A;  4TY9 A;  3W9J A;  2FD2 A;  1IJF B;  1JLB B;  5E41 A;  3Q23 A;  3B8H A;  1ZH5 A;  2J6T A;  4I68 A;  2ZH3 A;  1BUX A;  2J0S D;  4O4G B;  2XB2 D;  1M5O C;  4DUY F;  2RT3 A;  4NRT A;  3CCW A;  3RB0 A;  3I4H X;  4B9U A; 
#chains in the Genus database with same CATH homology
 5BR8 J;  3OTO J;  4X64 J;  4JI2 J;  4X66 J;  4B3S J;  4NXN J;  1N36 J;  3IMQ J;  3T1Y J;  4DUZ J;  4JI0 J;  4DR4 J;  4JI1 J;  1N32 J;  4DR1 J;  4AQY J;  1XMO J;  1HNW J;  1IBK J;  4B3R J;  4DV5 J;  4DV0 J;  5AJ3 J;  4LF6 J;  4HHU A;  2HHH J;  5A2Q U;  5IWA J;  4DUY J;  1IBL J;  4JV5 J;  4X65 J;  4JYA J;  4X62 J;  4K0K J;  4DV3 J;  4B3M J;  3R2D J;  4KYZ A;  5LMN J;  4V1A k;  2UUA J;  3D3B J;  2VQF J;  3J80 U;  4RJV A;  4PWW A;  5IT9 U;  2E5L J;  4DR7 J;  3D3C J;  4LF8 J;  4LF4 J;  4GKK J;  4OX9 J;  4NXM J;  2F4V J;  2KVQ E;  3JAM U;  4JI8 J;  1N34 J;  4DV6 J;  4JI7 J;  4KY3 A;  1HNX J;  4JI5 J;  2UUB J;  3W1Y C;  4DV7 J;  2UXB J;  2ZM6 J;  5LM7 E;  4LFA J;  4JI4 J;  4GKJ J;  4LF9 J;  2MTL A;  4NEY A;  3R2C J;  2MQ8 A;  2KL8 A;  2VQE J;  4DR5 J;  1XMQ J;  4LFC J;  1XNQ J;  3J7A N;  4DR6 J;  4DV2 J;  4B3T J;  2UU9 J;  4YHH J;  2UXC J;  2UXD J;  4DV4 J;  1XNR J;  4DR3 J;  4JI6 J;  1HR0 J;  1N33 J;  4LF5 J;  4NEZ A;  4YY3 J;  4LF7 J;  4KHP J;  4JI3 J;  1HNZ J;  2UUC J;  1J5E J;  1IBM J;  3J81 U;  2MEW A;  5FLX U;  3T1H J;  4LFB J;  4DR2 J;  1I94 J;  5LMU J;  1FJG J;  4DV1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...