4B3MJ

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 7
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4b3mJ00
1XNQJ 2UUCJ 2HHHJ 2UXDJ 1XMQJ 2UUAJ 5LMUJ 1N32J 1N33J 3J80U 4AQYJ 4JI1J 1N36J 2F4VJ 1XMOJ 3D3BJ 2MTLA 4JI6J 5BR8J 2UU9J 4DUZJ 1I94J 4GKJJ 4KHPJ 4GKKJ 4YHHJ 5IWAJ 4V1Ak 3J81U 4DV3J 2VQEJ 4B3MJ 4JI7J 5A2QU 4DR7J 1HNZJ 4JI2J 5AJ3J 4LF7J 4DR4J 2MQ8A 2UXBJ 3D3CJ 4LFAJ 4X66J 1HNXJ 5FLXU 1HR0J 4LF5J 1N34J 4DV7J 1HNWJ 3IMQJ 4DR5J 4KY3A 3JAMU 3J7AN 1J5EJ 4B3TJ 2KL8A 4HHUA 4LF9J 4YY3J 4LFBJ 4DV2J 2ZM6J 1FJGJ 4JI3J 5LM7E 4JV5J 4K0KJ 4KYZA 4OX9J 3W1YC 2UUBJ 5LMNJ 4NEZA 2VQFJ 3T1YJ 3T1HJ 4DV0J 4JI4J 4NXNJ 4JI8J 2KVQE 4NXMJ 4DUYJ 4LF6J 4LFCJ 4B3RJ 4B3SJ 2MEWA 4DR1J 4DV1J 4DV5J 3R2CJ 4LF4J 4PWWA 4JYAJ 1XNRJ 4DR3J 4RJVA 4DR2J 1IBLJ 1IBKJ 3R2DJ 4LF8J 2UXCJ 4X65J 4DV6J 1IBMJ 4DR6J 4JI5J 4JI0J 5IT9U 4X64J 2E5LJ 4X62J 3OTOJ 4NEYA 4DV4J
chains in the Genus database with same CATH superfamily
3VVUA 4MJKA 2HVIA 3D1OA 5DGBA 2ALYB 4QR1A 3ISNC 4ED4A 2BW2A 2ZKUA 3P45B 4DQQA 1F5BA 4GKJJ 4P52A 3AQPA 2MSSA 3TA1A 2E44A 5D0EA 2HHWA 4V1Ak 2VD3A 2JNJA 3ELHA 4O44B 2P9GA 2GMHA 4CTAB 2OFGX 1RTJB 3UN3A 1U7LA 3OTCA 3W61A 3BGRA 1VDHA 3MZIA 2XS2A 1U49A 3GV7B 1N4LA 5C42A 4BCAA 5IT4A 1HI8A 4OHXA 1HBMB 5CABA 5J2PA 5LMNJ 4M63A 1O6XA 4FBUA 1CJUA 1NZ8A 1NCLA 3UR3C 4YR3A 2QLXA 4NX9A 4TVAB 2M9KA 3AB2B 1HNXF 3GG1A 3Q2TC 1FESA 1T9VA 4CLFA 1F3FA 1Y11A 3OUYB 3PIOQ 4ED5A 3AOAA 4FKYA 4MFBA 4L72B 2XY6A 2ABYA 3QJPA 2B4VA 1OMSA 3Q8QB 2EFVA 3K5NA 1UEKA 1K0VA 2DHXA 2UUWA 1OY6A 1UJ5A 3RB4A 1TUVA 2MQ8A 1MNEA 3KK2B 4B9VA 3FNNA 1JX4A 3QGHA 1VQ9S 3TANA 4UQGA 3UDVA 2Y8YA 4RLEA 1SUQB 3KK3B 4M8LA 4IG3B 1X7VA 2QT7A 4ATNA 4ZLJA 1BWEA 3PYGA 4IDKA 3THVA 3S7RA 2LXUA 4JI1F 2F4VF 1L3SA 4LSZB 5A8RB 1WWHA 1UZHA 3MM9A 2ZH6A 1PBAA 3R7BB 1WG4A 1VC6A 2RKIB 3CJTA 2X1AA 3JSRA 4ZHRB 2U2FA 4DSLA 1SB6A 2HHHJ 2Q3PA 2XMMA 2FPHX 2B0GA 3M8WA 2E1PA 4R0JA 5E3QA 1DLOB 1REVA 1WTFA 4NZ7A 1YJ9S 3FDSA 3IG1A 2LYVA 4ECXA 3W64A 2F40A 4L74A 4Y00A 2Y3YA 4RUAA 3OVBA 4O0IA 2CQ3A 4DZDA 2R7OA 4X4QA 1RJJA 1RAFB 3ENQA 3IGVA 5T7LA 2ZM6J 2VKRA 3BM7A 4CLZA 1JMTA 2NZCA 1N88A 2DHHA 3BH7B 4W98A 1HBNA 4AYBD 2CQ2A 4D3GA 3M8ZA 1YVFA 3MTKA 3VAIA 1U6BA 3M8RA 2LVWA 3UNYA 2AGPA 2RAQA 4OIXA 5CQGA 1BWVA 4L3KA 1NKEA 1XN9A 4ZJOA 3RZAA 3AXKA 4NLSA 3AJ2A 5DGAA 4RU9A 1UMJA 2EXUA 5ADZA 3M6WA 3VAMA 3BDEA 5ETNA 4G1PA 4TXSA 2K7KA 4IH7A 3BYPA 1U1RA 5F9LA 2LMIA 2ILYA 2ZHBA 4IFYB 1X4EA 2DISA 4O3NA 1SJFA 3HHLA 1JXLA 5HN0A 1Q8BA 3KK1B 4ZPWR 1NKBA 2QA4G 1Q4RA 5AXKA 2NPIA 3QSYB 3M30B 3UCZP 4I69A 1GH8A 4K4WA 1RT4A 2OELA 3TEHB 1UFWA 1Y5IB 3MCSA 5L46A 2CZ9A 4ITSA 4PQUA 4WF9Q 3FFIB 1NKCA 4RUCA 4YDDB 3FBBA 4LF1A 1U8WA 2DHGA 4EYIB 1SJ1A 4UF4A 4FXDA 1JLBA 2MZQA 4EBEA 3VZHA 4IH5A 2NLWA 2O3DA 4YB6A 3MEGA 3H2VE 1S4FA 1S1XB 4AXIA 1MN7A 3DXBA 2XZWA 2VICA 3I87A 2RRNA 4FKXA 1U8SA 4MH8A 1TV6A 1TU0B 3HSDA 3RAXA 1G1XA 2DITA 3F73A 3N5FA 1LW0B 2YNIA 5GAHU 1PJ5A 2E5JA 2QJ3A 1RHRB 2VHGA 2XLIA 3RUBL 1GQEA 3QIPA 4N47A 4ANEA 5IOLA 3P6YC 1RCXB 1K8AT 3VGVA 3DDIA 2DK2A 3MCOA 1WC3A 5KT7A 2NXJA 3PO4A 4G1QB 5DETA 4DCJB 3CO0P 4DEZA 3TVYA 4LF7F 5CCLA 2B7CB 2X1FA 1RWWB 4BDPA 1GX5A 2H5JB 3P8BB 2CDRB 1D09B 2NSCA 3HLUA 3UVJA 5KT5A 2BJ8A 5EGYA 2FDNA 4QOTA 2F9JA 5AE2A 3GTYX 3M6XA 4QPXA 2L41A 1TL1B 4J9UE 2JVRA 1VBZA 1J2VA 3VGUA 3T6BA 2FQQB 2YVSA 5A8KA 3NNCA 2V67A 3O8WA 3VCDA 2NREA 4DSJA 2D74B 4F7VA 2CQ0A 2BEFA 3MF5A 1NMEB 1RB0A 1JLCB 1RAIB 5KOXA 4WCEQ 1NDKA 2HNYB 4RKUC 2WB1D 4DV0J 3WC2A 2PEBA 1L3TA 4LBIA 2D3O1 3QJLA 2QTWA 1Q8KA 4ECRA 3TUZC 2QC3A 3NBPA 1U2CA 1OPZA 1E6VB 3H20A 5FDLA 3KOAA 3VHQA 4I2PA 5B0EA 1SJ4P 1G6BA 3TR5A 4OI6A 2E1CA 4S0MA 5A6PA 1RAJA 3LGNA 4EWTA 1WOPA 1S49A 3SCKE 3KLVA 2M4MA 2ZD1B 2B9YA 2XNQA 4IG0B 1RAHB 2GGPB 3EX7B 2BANB 3SFGA 1TZ0A 1CJKB 1CJTA 2DCLA 3LANA 4H4MA 5HVFA 3PZPA 3HD1A 2CUYA 4MTPA 4C2MA 2JFDA 5EX0A 5MAOA 2R7XA 3MPVA 4CQ1A 2YNGA 2DT9A 2DRBA 5K8MA 3FVYA 1DQ8A 2DR5A 3TYTA 4DFJA 4NCAA 4CLKA 1VRUA 3PRVA 4IFVB 1FKPB 2MKSA 2XEXA 2DGVA 4ED6A 3DLEA 3SCJE 3CWJA 3DLBA 2IDLA 2DNNA 2GVDB 4C0HA 5CYJA 3TEGA 4QWCA 4EEYA 2VG5A 4DSKA 4F02A 5C2GA 1R8PA 1PKUA 3EXCX 4QPTA 1VJWA 2J76E 4CLPA 1PC4A 3AB4B 3FZ2A 2V8PA 5CD4A 2ASJA 5K8PA 3HZEA 3GIKA 1JLFA 2RU9A 2X3DA 4NZ6A 3GSDA 3U7JA 1A6LA 5L38A 4JI4F 2DD8S 1HYSB 3J81U 3SQGA 1ZPWX 2GMJA 1RWVB 3N01A 3Q0AA 4DV5F 2DEIA 5HMZA 1LXNA 1IQZA 3L9ZA 1AZSB 1MU2B 4J9OA 1RT1A 2E7VA 3KYLA 5ETRA 2MXYA 1D1UA 1SL2A 4KY3A 4MT1A 3J7AN 3AAWB 3A13A 4ED7A 4PUOA 4AL5A 2GA7A 2WVCA 2HLTA 1VISA 3NS7B 1AT1B 2JEGA 2OIHA 5KG5A 2UV8A 4F4AA 1R8AA 4OZ0A 2W7OA 1WG5A 2XMWA 3TVKA 1WC4A 2XBPA 4LF6J 4XDCA 2J6SA 1VMBA 1RI7A 1FX2A 2MEWA 1C0TA 5F0WA 4KE5A 4KBIA 1F5CA 5KFWA 4FYDA 2HRTA 2XO7A 2ZNZA 2CJAA 4KGZB 4PZVA 2CPYA 1CLFA 1SKSA 2R3VA 2AX1A 1EQMA 1XNQJ 3TP2A 1AUDA 3H98A 5A2QY 3NP5A 4A8WA 4RPFA 3VR1A 1N36J 4UQTA 2V50A 4I7FA 2HFVA 5BR8J 2GQQA 1RTHA 2HVZA 2V8HA 1S1TB 4YY3F 3TAPA 2Z57B 1HNVA 1D9FA 1MW7A 3GJTB 2W25A 2IIHA 4X4TA 3F44A 2PN6A 3GQCA 5L9NA 1FJGJ 1WF2A 2HHPA 2F63A 4KO0B 3DU6A 2EC2A 1WEYA 2V63A 4PYDA 2C2NA 2I0XA 1JLQB 2A1BA 2AYGA 1VS3A 1HD1A 3HHNB 3HK2A 1TMMA 1HWJA 4RW4B 4DV6J 3C3LA 2DY1A 2EC0A 3NEKA 4DR5F 2W9BA 3X1LB 2YKQA 4Z7CA 1DTQB 1FD8A 4M95A 2GHVC 3PW4A 3W5YA 4NLYA 2ZH8A 2D3UA 4P74A 1T9XA 3LP2B 3HULA 3RW7A 1VC5A 2DXEA 1HQUA 1LWCB 8ATCB 2BJEA 2AJQA 2IBOA 5I3QA 1RAEB 3QFWA 3MECA 2CPDA 3DXSX 1RTIB 1TKTB 4OI4A 5L39A 3BKTA 4JI0F 2FHJA 4B3TJ 3GYNA 3K17A 2HWTA 3FSIA 4USUA 4JI3J 3V4IA 4ECZA 3KJFB 3ZZPA 2MZSA 1HW8A 3D0HE 3LQVA 2YH0A 4CLSA 4ECUA 2CPHA 1FRMA 5DDOC 1O51A 3VWSA 3TO8A 5IC6B 4PXCA 4B3MF 1U6ZA 3L3CA 2B8PA 1X60A 2PEHA 3CE8A 2VDHA 3JQKA 4L73A 2FLPA 3PM9A 5KFOA 1RA6A 2ZOGA 2CIMA 3N0VA 1W26A 4F4YA 2OPRA 2OTLS 3QIDA 2UUCJ 1NZAA 5HROB 1XMQJ 4AFFA 1C2PA 3RTVA 2JEFA 3EYZA 3GP9A 3CCSS 3CPWR 2E1AA 1SJQA 3DI6B 2YXLA 2YQ1A 5EWEA 3IO1A 2DRDA 3KLFA 4IRDA 2XM3A 4USTA 3RYLA 4BC9A 1EKSA 1DJ0A 2YWKA 1QAIA 2B9EA 3I0SA 4P71A 3BS9A 2UXCF 2DNZA 3DDKA 2CPXA 3I32A 5KG1A 2AZ3A 2MMYA 1H2VZ 3R6GB 3PYFA 5L1LA 1WDDA 4XK8C 5EN1A 1GEHA 2IAJB 5HVHA 5HLFB 3J80Y 3RB6A 3CT9A 2ZITA 1HNZF 1B3TA 4K4TA 1G4CA 5F8GA 1FD2A 2OHDA 1DTTB 3ZO7A 1RACB 4WWSA 4XO0A 2I1RA 2L9WA 4X4NA 2QA4S 1R6YA 1H38A 3L7OA 4LVNP 1KSPA 3QZ7A 4MAKA 2VOOA 3MEEB 3CB4A 4O3RA 1T3NA 5K14B 2G2ZA 2MY8A 5A8WA 3DM2B 4OV1A 2GIQA 2DO4A 2KXFA 3CUNA 2CPFA 2Z2ZA 1M5SA 1N5YB 4EGLA 5J2MA 5B0CA 4ILMA 3EDRB 2WSEC 1HBOA 4RNOA 5LM7E 3AY0A 4XIUA 2FZCB 1X4FA 1C4AA 4KH0B 5HQLA 3L95X 1N32F 1WI6A 4QU6A 4F25A 1UFLA 4W4MA 4HDHA 4LFCJ 1RDRA 3SV4A 1EQ0A 1RHMB 1H0HB 2R7RA 2RU3A 3CDAA 3DHXA 1F3VA 3ETOA 1HMVA 3FUYA 3U1MA 2KFNA 4EFAC 1J5EF 3HFKA 5ETMA 3A8IA 3NOCA 2BXJA 3C6TB 2YWGA 5SZTA 1UA1A 4OX9F 1IBCB 1H2UX 1H98A 1WKKA 4PPDA 1UVMA 1CEZA 2V8GA 4B3OA 2DH7A 1XMBA 4OMFG 2P6SA 3D6HB 5HP1A 2ASDA 4X66J 1C0UA 4F50A 4LRAA 1DQAA 1Q8LA 1ZM2A 4H4OB 4PWDA 3FK4A 3M32A 2VC1A 4DL6A 4GVBB 1I1GA 4USIA 1W7WA 2UXDF 2P9CA 3OLBA 2Z58B 4ICLA 1T9UA 4DDFA 3IM9A 1R0AB 5LOQA 5CZXA 2UU9F 3MPYA 3M2RB 4DUYJ 3EWGA 3BF4A 3R2CJ 3R5BA 1HD0A 4URSA 3G2XA 4RUHA 3BQ0A 3V6DB 4UZCA 3O3LA 4Y34A 2CQPA 1SQEA 3PACA 1NDCA 2GMLA 1B0PA 1UKUA 3HCXA 1CJUB 2MKKA 1FTRA 3NMRA 2AX0A 2YH1A 3PHEA 2V34A 4HH0A 3MFIA 1VC0A 2CQ4A 2J7WA 1IKVB 4GKKJ 1LV5A 5KFVA 2NXCA 2H4WB 2GS8A 1WC5A 3QAEA 1KONA 4WP8A 2OPSB 3CJKA 4AXJA 1PIEA 5ETOA 2JC1A 2YKPA 4I2QA 4OJ1A 1YX2A 4CP5A 5BJRA 5CXTA 2R7VA 4OYZA 2VFRA 5LSLA 1RAAB 5F8HA 4HH1A 2KVQE 1I5OB 2AYEA 2UVUA 2HURA 3W3SA 3SYZA 3JQMA 3CEDA 3H2UB 4IDKB 1KEKA 2AHOB 4RBVA 2XNRA 4RW6A 1URRA 3QZ8A 2HZCA 2V2ZA 1XERA 2BV3A 2YPZA 4CLTA 4OX7A 1RT5B 3EJMA 3HMJG 4J9SA 3UD4P 5KFSA 1GX6A 4I6AA 4LQ3A 4Q2MA 2ZBIA 4DFKA 4RU2A 4GC6A 1M5KC 4NRUA 5ETKA 1S1UA 3T5KA 3W5ZA 3SZ2A 3ZTRA 2J8AA 1QSSA 1SKUB 4ED0A 1KOHA 3PYDA 1P8GA 4ZP6A 4FYYB 5E41A 3BYRA 2ADCA 3R1HA 3PKYA 1NJZA 2LFVA 2VIHA 4OLOA 3MHYA 4EO6A 1JJ2R 3NNAA 1X5SA 2ZWOA 2LDIA 1PSDA 5RUBA 3LALA 4F2SA 2BE9B 4OZLA 5IM0A 1AB8A 1N5TA 2W2QP 3PNIA 3VV2B 4CNZA 1UZDA 4TYBA 2OJ3A 1WD6A 3EGNA 2B56A 5CZVA 3QAUA 5DDQC 1RTJA 3F41A 5LSOA 5T7LB 1NDPA 5F41A 1RWNB 4C3LA 3NXZA 4OI0A 5GADI 1S0VA 1IBMJ 4LR7A 3M4XA 3EDQB 4TY9A 2OPPB 3CD6S 5KFTA 1HBMA 1HBNB 2IVFB 1F0XA 1TMJA 3M05A 2UUAJ 3J7Z5 1XBWA 3HVTB 2KYZA 2WB4A 4HACA 2HMIB 2XMTA 3OHBA 5IWAJ 4UW2A 4WXOA 4X4RA 1KR4A 4DR4J 3BZQA 3OXLA 2O67A 1BE4A 1WKLA 2WK4A 1S48A 4KQZA 4JI5F 2YWWA 3GFHA 2KL8A 4X62F 2HEKA 2IJNA 4CLYA 3TAMA 4JV5J 3MAQA 1DRZA 2AZ1A 2GO8A 4NMXA 1NK8A 1V3ZA 5F0UA 1XIQA 2CNOB 3IGNA 1N56A 1LKZA 4F0HA 3PJWA 2GX8A 3UN5A 1UWBB 1ZH5A 1S7IA 4LF4J 2R7SA 5KFKA 2AJ4A 1RWPB 1URNA 2DGOA 2YQ3A 1VBXA 1SUQA 4K5RA 3VQSA 4IG3A 4P9SA 3L09A 1U48A 3JAMY 1DHMA 1RT3B 3GR0A 3CJQA 3SIPB 2RDDA 2HHQA 1TL7A 2DH8A 2D1CA 1JLBB 3VZIA 4F2RA 1JJHA 2RKIA 2Z30B 1RP5A 4DSFA 3MEGB 3GCXP 2ZH4A 2KT5A 4FF1A 1DARA 1QD1A 2IVYA 2HNDA 3PR5B 2W8LA 5M2UA 3OT9A 2AJ2A 4C8MA 1A0OB 3CJSA 1WELA 3CCRS 2CJ9A 2R8HA 1TL3A 2XSFA 1T0TV 2EK6A 3OFEA 1KOOA 4ES3A 2AJ0A 2V8VA 4J9MA 1IKWB 2OAUA 2XB2D 3OSPA 1W25A 1BQXA 2J0SD 2CDQA 3N6LA 3M9NB 1N5VA 4NXNF 4NOHA 2PMHA 4IOCQ 4EBCA 5IV3A 4X4PA 1XNRF 2CADA 4QJVA 1SH3A 1SV5A 2FUG9 4OJGA 1WEZA 1BXNA 4Y65A 4CH1A 1IKXB 3OFFA 2Y1IA 2WVBA 4LIWA 3MMBA 3EUNA 1HHTP 3PKMA 4USWA 4YMEA 2Y0BB 2UP1A 1VK8A 3QWPA 2JLGA 2D7SA 1UCNA 4DUTA 4FP9A 1YLXA 1BD6A 2ASYA 3AD7C 5A8KB 3U1NA 2BABA 2I5JB 2MLXA 4Q5VA 4LF2A 4IFYA 1QSYA 4NA2A 3CCQS 4G1IA 3QATA 1FI4A 3EICA 2U1AA 4TY8B 1CG2A 1FRIA 4F4KA 3BGOP 1TKZA 1RK8A 1ZPVA 2XC9A 2GJFA 4OZ5A 2F7VA 3M30A 4FF3A 5JUMA 1OY8A 1S9GB 3QYYA 5HMYA 4NPOA 2G0CA 1OYEA 2BJ3A 3OD2A 4J9LA 4ANDA 4CDIA 4JI2J 2CYYA 2ZZTA 2CQDA 2PMZD 2E5IA 2YNFA 5FDLB 1NK6A 4PXEA 3AA9A 2EKYA 2R7TA 1RTDB 4E2FB 4F3OA 2YKMB 2PFDA 2VG6A 4OZJA 2C3UA 1LWEB 1S1XA 2RUGA 2CRLA 4G65A 2C2DA 4WU3A 3G86A 3W7BA 1LQ9A 3GLJA 5KAKA 1FWKA 2OI2A 3MPWA 2DH9A 1Q53A 1CJTB 4H4MB 3EPGA 2CJXB 1HI0P 1RT7B 3ILOA 2DPJA 2YNGB 3S01A 1NUEA 1Y3KA 3CCLS 3I5CA 1VRUB 2AEMA 2XY7A 2AJFE 3NWRA 1CBKA 4HKQA 3DLEB 2BR0A 1S1WB 1ROFA 4G1QA 1YHQS 1FE4A 1RSCA 1VQ6S 2A10A 3FRZA 2V8DA 3KUEA 3I0RB 2OKQA 3AFGA 4NASA 4TQRA 3Q89A 1S99A 1NHKL 1Y7PA 2FJVA 2CJQA 1JLFB 1YRTA 1TAQA 5HBMA 1X4BA 2AKWB 1KD1T 1SCJB 3IS9B 2MQOA 2HYIB 1D8ZA 2IRYA 1S0MA 2UUBJ 3CD5A 3IC1A 2AEFA 4OI2A 2QFJA 3CDEA 4A8QA 4RUBA 4YHHF 5GAHI 4DV3F 3LW5C 4DV1J 4PUOB 4ZVSB 1YBAA 2LU1A 1N5QA 1NH8A 3QFHA 4M5KA 5CD4H 3G6YA 4DR6J 4DOZA 3AD8C 4WTYA 2AJ1A 3NGTA 5HATA 4LFBF 5F3ZA 4FS1A 1Q1KA 1JLCA 4QZVB 2ZVIA 2HNYA 2HGLA 1WACA 4X4VA 4X4UA 2YTCA 1Q78A 4U96A 4DSEA 5ETSA 5IQQA 4CLUA 4JI7J 1GMWA 2WVFA 3H42A 5GMDA 2LA6A 1BMQB 1FVQA 3LUYA 4DR3F 5KFEA 1X0FA 4P72A 1UETA 2JLEA 2JEJA 1E6VA 2YWHA 4ZP9A 3UD5A 4I7FB 4RW9B 4LFCF 3OVSA 5HJXA 3T1AA 2WONB 3W1YC 3H5UA 2MQLA 1N33F 2RRAA 1HNVB 1Y9OA 4YN3B 1RADB 2E7XA 1SIZA 2VONA 1Y5NB 4CO0A 3MR7A 4OZ2A 4HVZA 4IG0A 4KPCA 2RD5C 1YTYA 5H9EK 2K8GA 3CMQA 4I1TA 2BANA 2NPFA 3QJJA 2QSFA 2ZH9A 1HR0F 1JXEA 2G2YA 3K2YA 1N54B 1XR5A 1N34F 3KNGA 3QT8A 4A8YA 1XJWB 3V6HA 4WYLA 3FC9A 1S76D 2E9TA 2EPIA 4K0KF 1MG7A 1U4BA 5I3PA 2LECA 2VFUA 4JI6J 2QLJB 2MZTA 3TZXA 5H1SV 2ZJRQ 4QIVA 4NLVA 1XC9A 2GHWA 2CQCA 1L5UA 4A47A 2GVDA 1Q5VA 1JLEA 2H51B 2UUTA 4O3QA 3A8JA 2W9BB 2HW3A 3B82A 1X31C 3CNQP 3HSGA 2KU7A 2J7KA 2JL9A 4F0KA 2E5LF 3E01A 2GV1A 1YWXA 1S1VB 1VQLS 4FDFA 1S79A 1QM9A 2E9ZA 3MECB 4NMLA 3IWNC 4JBCA 1J5OB 3UW1A 3GJQB 4DU7A 1MU2A 1FFWB 1MLAA 4U8VA 3HSZA 3DNCA 4ZVRB 4RR5A 5KFCA 2NR0A 2PFFB 1FRXA 4GKKF 1WG1A 3ISZA 3W66A 4P6QA 4P10A 5I4MA 2B4PA 2GAGC 1X9WA 2ZZMA 2AGQA 1SQFA 1KC8T 3NGDA 2CPZA 3J80U 2GQCA 2HBQB 4J9VA 2RF2A 3AD9C 2AYBA 1ZM3A 2E5GA 1NBEB 1FK9B 4ZLNA 5AE1A 2ZJQQ 1C1CB 4LQ9A 2UXBJ 3G87A 2FJBB 4M5NA 1KQKA 3MM6A 2FYXA 5M2RA 2LA4A 4DLGA 3V6JA 3M8SA 3KHLA 2RIJA 1FWPA 4ECYA 3GE9A 2H5EA 1OJ4A 5JVHQ 2VB6A 4LSLA 5B09A 4OYPA 3TRGA 2VC0A 1LK5A 1HWLA 3I0SB 3W9HA 4JI8J 2OFHX 2DBBA 4KJIA 4IYQA 1N5SA 3R8YA 2Z2LA 4Y2CA 1WJ9A 4DU8A 4CWBA 1HFEL 3H5XA 3EMTA 4LFAF 1U25A 4NCBA 3G6VA 4DPWA 3ETMA 4Q7AA 1HHSA 1JNZB 2KDOA 3FRYA 2OMOA 1KLMB 2JVOA 2F8HA 2KB2A 4GMKA 5E3RA 3B4MA 2HZVA 2DR6A 2XZTB 4USMA 2W2MP 4QWDA 4C6AA 4JV0A 4Q44A 3Q8PB 3MMAB 2VA2A 1ZA1B 2LEAA 5HO4A 5AJ3J 4DR1F 4RW4A 4EMDA 6FDRA 3A3NB 4RX6A 5GMKa 3G9CA 3ITHB 4C98A 3HP6A 1TUGB 3R27A 2V2VA 4F4XA 1RHJB 5D78A 3O6QA 5A8WB 3KDNA 5D8HB 2COLA 3GR1A 4HTJA 1CQMA 3LP2A 5CYQA 4NEZA 5KFMA 1XMOF 3HJVA 1IR0A 1QTMA 1N8RT 2ROGA 4B3SJ 4TU8A 2FHJD 2I9SA 1HBOB 1JLGA 1F5AA 4YFUA 1BGXT 4QIWD 4NA3A 1IN0A 1Y3JA 3CCJS 4C8KA 4ZCLA 2HIQA 2FHOB 2BX6A 2F1FA 2IJRA 1FERA 1OPIA 2EFQA 4ZIVA 1IVZA 4YS2A 4Y28C 4E0DA 2XMVA 4ZJQA 3EGZA 1ZZNA 3MWBA 3U1LA 5LMUJ 4KV8A 1FNMA 3SCLE 2W4PA 1SKWA 4ERDA 4KHPJ 4ZVQB 3BPSP 5ITHA 3DRRA 1YJVA 2XYHB 5ETQA 1T03A 1CQNA 1ZA2B 4TN2A 2BA9A 1CPZA 2NSBA 4OX6A 2AMCB 3K59A 3HKWA 5HQ8A 5HROA 1WEXA 1ZOTA 2M52A 2QMWA 1U0SA 2CVIA 3OTOF 4B3OB 2XZDB 4HDGA 3T5LA 1HL6A 2H5IB 4CT9A 4Q43A 1KLNA 4QWEA 4N77A 3N6NA 3B78A 3E51A 1NSAA 4PWDB 3VAFA 1TL5A 3M32B 3MM7B 4NYPA 2K3KA 4LT6A 2JSXA 5KOWA 2FB0A 2RQMA 4FYVB 1OWXA 4ZVGA 2ZOMA 3C2PA 2K1RB 3ENAA 2FIUA 3DYAB 2IAJA 3MD3A 3PVXA 1F6TA 4F36A 3OXFA 3FKBA 3R3TA 5HLFA 1IUJA 2V6AA 3W8GA 4K50A 4USVA 5IV4A 2ZZNA 3ENVA 5KFDA 3KKFA 2FY8A 2FZKB 5FLXY 3P96A 1FX4A 3ILIA 1MMLA 2MQPA 1F9FA 5D4PA 1ELOA 4CLLA 1YZ7A 1X8DA 2F3JA 3EVMA 4CM2A 2KKHA 3TAQA 1SC6A 4V19J 4QYZK 3CCUS 4DX5A 4TNOA 2K06A 2HQCA 4X64F 4F04B 3IAS9 5K8NA 3RRHA 4PAAA 3VAGA 4UOGA 1CULB 4UUWA 1VQ4S 3T1YJ 5GMEA 1NK7A 3A3OB 3D6FB 3DCAA 2VQEF 2IYGA 3LP0A 3MGJA 1N5YA 4JYAJ 4C8YA 4YOEA 3T6JA 1NPRA 3SI8A 3CDUA 4LF8J 2P5VA 4U7CA 3RB3A 3IR7B 2MDAA 4FF2A 1RBOB 4J9NA 4K8RA 4WXWA 4EO8A 2ZEJA 2Z56B 1QAXA 2MHNA 1S57A 2IA6A 1F9EB 5U47A 2K3IA 1PCAA 4CT8A 2H9ZA 4FYXB 4ZPCA 1S10A 1HNWJ 4V19X 2BQ3A 1U2RA 2LQBA 4RW8B 3AOBA 3BB5A 3S1TA 3IBCB 2MY7A 2MQMA 1FFGB 3BSCA 1S1UB 2DR9A 3NKYA 2HQIA 4JUZA 1KVIA 1OS5A 1R8BA 2KFZA 3ZC4A 1M5OC 4Y0FA 2RHQB 1KQFB 2XGPA 4KHMA 4EYHB 4Q45A 4GVLA 2OEJA 4ALZA 4H4OA 2Q1LA 3TWZA 4NWBA 1B99A 1AROP 3LOUA 1TVRA 5IM0B 4GVBA 1RWMB 5IFMA 4DX6A 1WUUA 4OZNA 2RNEA 4IR1A 3HVWA 3ZZRA 3IRXB 2Y1RI 4RNMA 3C46A 2ASLA 1PG5B 1R0AA 3H2LA 4AQYJ 5JXSA 4ID5A 4DQIA 3M2RA 2GZOA 2DXFA 4LBHA 1X9MA 1PYOB 1UPPA 1WOOA 5ETTA 3PFEA 4BLGA 4OYXA 1SBRA 2AW0A 1VRTB 3V6DA 4KKOB 4PG4A 5IXUA 3WDOA 3JAMU 4HACB 2IY5B 2DCUB 1VLYA 4DV4F 4ZVTB 3ZNUA 5AXMA 2GAHC 4W92B 3K89A 4RBUA 2CVEA 1IKVA 1NXIA 4DXLA 2XYGB 2O66A 4WZMA 3BPDA 3D68A 3QT5A 4QWAA 4O4RA 1YJUA 3QT7A 4P7VA 4C0BA 2KHCA 2IRXA 2OPSA 3TAMB 2HAFA 5KFXA 1R31A 4DN0A 1IBLJ 3R2DJ 4MIWA 5CH7B 1CC7A 2R9LA 4EI2A 3EVWA 4LF9F 1U1PA 3DU5A 3EE3A 4OI3A 2O5DA 2EFOA 3KMSA 3MAHA 3W9JA 2IM1A 4DQPA 1YSJA 2BE2A 2G0JA 1FRJA 1VI7A 1GXLA 4P75A 2HHTA 3SSQA 3D3CJ 5JVGQ 2C2KB 1TTHB 3CGIA 2W8KA 1ZZFA 4FVCA 4I4BA 3GPAA 3C66A 3BEGB 4HHHA 1RT5A 2HHXA 1GNKA 4P2SA 1KVKA 4NLQA 3G8QA 1TL7B 4OZ1A 3DMJB 1RZMA 2QE5A 2ZH2A 1HIYA 2DNMA 3MM5A 4ZP7A 3LP1B 2DO0A 3KJVB 3U02A 2F65A 1AXQA 3Q2SC 2HNDB 2MLYA 1JJ4A 1G7CB 3FBFA 5KFIA 2NS1B 5KFFA 2W2OP 1Q0NA 1SI9A 3A8KA 5EUHA 3L7UA 2IJFA 1H7XA 4O4GB 1RGVA 1TL3B 1KS2A 3AJ1A 2KHDA 2FTRA 1FXLA 2EKNA 1BHNA 4PYAA 1SC3B 4U9RA 5A0YB 4B3RF 2H65B 2Q79A 1AA1B 4UOHA 5GAEI 3UDCA 4Y2MA 5E5NA 1HNXJ 2SXLA 1ZS6A 3DRXA 2OPPA 3CMES 5B0GA 4TYAA 1UVLA 3DLGB 2DVIA 2DHAA 1QTNB 3HVTA 2UVWA 1FA0A 2J5AA 3ZTQA 2AT1B 3JSBA 3ENWA 1A7GE 2HMIA 3DOLA 3SQOP 1BQNB 3TARA 5C25B 1SV5B 3OV7A 3PJ9A 1YBUA 5E3PA 3AXMA 3HM9A 1VQPS 1U47A 3IRWP 2NZ4A 4DR7F 1KN6A 2QZ8A 3MMBB 2R2TA 2W24A 2E9RX 2KFYA 3QQCD 4C3MA 4KAIA 5KFLA 3DOMA 2CQGA 1NSKL 2K2PA 2CQBA 2CZVC 3PYEA 6FD1A 2X51A 3N4WA 3QGPA 4ZCMA 2BUNA 4JI1J 2F4VJ 4O3SA 2KT2A 3V5RA 1KWMA 2YQ0A 1UWBA 3VAJA 4HYKA 3DLJA 3BN4A 1S6PA 4LBPA 3VF0B 2UZAA 1Y0HA 3SFUA 2C2ZB 1TKZB 1EZZB 4B9UA 2A18A 4NE9C 4QIGA 1S77D 5E3AA 4KFBB 5LSRA 1RT3A 4EUVA 5J2QB 2V5HG 5KFGA 5KFJA 5IT9Y 4M5HA 3Q83A 4Z7YA 5LXRA 3G8TA 1DZ5A 3PDNA 4IRKA 2IYIA 3N9UC 2NCKL 2W4CA 2YNFB 4LMZA 1FTCA 3OLAA 4R25A 4DUZF 4NXMJ 1YJNS 4DWIA 3JSMA 1QE1A 2HHSA 4CRJA 2VG6B 5FJ4A 5MLCV 3OR2A 1UJ6A 4DL7A 7FD1A 3ZTOA 4RW7A 3SEOA 2ZH3A 3ZFVA 5EX3A 2VOPA 1RWUA 4J37A 3CJRA 2ERRA 4LRDA 3WX4A 2M8DB 2J9DA 1JWWA 3QLHB 1SXLA 3CO9A 3M9OB 5B0DA 3U27A 3NCQA 4J5OA 2GC8A 4FNIA 4DQSA 1RU1A 3ISND 3OL8A 1LW2B 1VQKS 5DO2A 1AUSL 2MZ1A 2N7CA 3HVAA 2HG4A 4ZPBA 3HFZB 4ED2A 2OSQA 1IKWA 2JDJA 1E6YA 3KUGA 1S6QB 1CJVB 4WP9A 4RZRA 4JI8F 2JZ5A 2KTQA 5J1EA 3OFGA 1V3RA 3AQOA 2WBMA 2FJWA 1UW9A 1IR2A 1PGZA 3P49B 3D6MB 5HBMB 1WOSA 3EGWB 1VQ5S 1IKXA 4L3NA 1BUXA 1N6QA 4XPEA 1PAEX 2HVHA 4Q2LA 2RVJA 3BKUA 3DRSB 3FEYB 3JYTA 3I6PA 3PX0A 3KTQA 1FRLA 1H6KX 3OR1A 5F3TA 5CAAA 2LDYA 2F5GA 2N3LA 4OYWA 2CNKB 2I5JA 1WC1A 3E8OA 1MMNA 4ED8A 4I64A 5SUHA 3DRPA 3I56S 1Q82T 1S6UA 4TY8A 4DSIA 4MKYA 3EM1A 5T41A 1NK5A 3BQ1A 4IQXA 2AGOA 3CJ2A 2VZ9A 1S9GA 3MM8B 5T14A 2F8EX 5DDRC 4MIAA 8RUCA 3QO9B 2E66A 2FVSA 3K8WA 4NLWA 5D77A 2MHEA 5DQGA 2VASA 3NGSA 1RTDA 2YKMA 5CYMA 2VBWA 1RLDA 3HX9A 1LWEA 4OV6A 3BV8A 3DKDA 3PG9A 1GK8A 4DV2F 2ZHOA 1K47A 3J81Y 3GU0A 5C2CA 2ZJPQ 3QRQA 5I3UB 5L9XA 1NJWA 3TX8A 2LQ9A 4IRCA 2YX7A 1YITS 1TKXA 1ZTWA 1YJTA 1RT7A 4LF7J 1NPKA 3SV3A 1HI1A 3ZZTA 2OO4A 1Q81T 3ET6B 4ZPAA 4QR2A 4NLOA 4PRFA 3KG0A 2H4YB 5A6WA 3UNGC 2LQ8A 4QIEA 1S1WA 3MMCA 1S9EA 3ICLA 1U1MA 1JLEB 1CSJA 3K58A 3R5GA 1VR6A 1LFPA 1KP6A 4KHRA 4MKBA 3GFZA 3QRRA 2PI4A 3I0RA 3K5OA 4ANCA 1NM2A 3FEXB 3E01B 3Q86A 2XI3A 3H5YA 4UY85 1HHQA 4ES2A 5C7PA 3IS9A 2E5HA 1B7FA 3GG0A 3W9IA 3BGLA 2VODA 1VJQA 5LL6d 2LU2A 3N28A 1O8BA 3G96A 2IM2A 4K2XA 3W62A 2EI5A 2W9CA 1F9HA 4BS2A 1RBAA 3DGVA 4GRSA 1FRHA 4XAKA 3QGIA 4ILLA 5IS2A 3THTA 4N8OA 1IBKF 2FGCA 3HF5A 1BY9A 1R8CA 2RF2B 3HFVA 2XGQA 2VPXB 3D5MA 1RBLA 2ZWPA 4DLEA 2Y9HA 3THPA 1L3VA 1Z2LA 4JYAF 1GMWD 3LF0A 4ECWA 4C0OC 3FZBA 4A4JA 3K5MA 4OHYA 2YNHB 5HVGA 1WC0A 2Q6BA 4P73A 3MM6B 1SL1A 2YKAA 1LFWA 1RT6B 4IH6A 1VOMA 5LXYA 4PWWA 4ZPDA 1T05B 1RYSA 4J9KA 1LEOA 4LF5F 2J7UA 4LSLB 1JLAB 2HQDA 4RW9A 2PI5A 1U09A 4N8NA 2WONA 3MR6A 2D9PA 3CXCR 1FE0A 4W90B 1PO6A 3T41A 2CG8A 1T8EA 1Q5YA 4XPCA 3FBEA 3M8PA 3TZWA 2ZH7A 1WSVA 2HGMA 3P5TL 3UFCX 1R7IA 2QRRA 2G13A 4DPYA 2E29A 4KSEB 4FNHA 2FHKA 3GV8B 2V94A 5L1KA 1PJ6A 1SJ3P 2N4CA 2BM1A 3TA0A 2RE1A 1MSWD 2EG1A 3A3PB 4OHZA 4X2BA 1WF0A 5KG7A 2CJKA 4DPXA 5DG8A 3D1QA 2ZDOA 3NGUA 2HRYA 1V5VA 5BYQA 2AD9A 1RHQB 4JI4J 1UFKA 2AP6A 4GKJF 3S6EA 3HT0A 3KLEB 3CMAS 4DV5J 3PX4A 2VA3A 3B6BA 4RJVA 5D3GB 2V2QA 2I6WA 3NCPA 2IVMA 3GJRB 2HZAA 5CYQB 3B54A 5J2NA 3CJ5A 1S1VA 3O2IA 2XMUA 1U1QA 3CJ4A 4Q8EA 3L4BC 3NS5A 1RTZA 1JLGB 5LMNF 1J5OA 3K7RA 1ZAXA 4QIFA 3CC2S 2VV5A 3QWUA 4G3IA 1YJWS 3Q8SB 4F67A 1KQSR 4ZCIA 4A46A 4KV8B 4DL4A 5D0GA 2NYIA 3VVTA 4DF8A 4PWUA 3BO2A 3IA0A 2KH9A 2ZFHA 2HGNA 4Q8FA 2CG4A 2RMLA 3DRRB 4OYAA 1U24A 2QA2A 1T03B 3CF5Q 1FK9A 1IBLF 2P2CB 4K4VA 2XULA 1UW4A 1C1CA 2ZC3A 3A1YG 4ZVFA 3K57A 5KG2A 2W7PA 3Q24A 2QX0A 3OXGA 2Z2MA 5DQHA 2C42A 1YJ7A 2JWNA 4WU2A 1AFIA 1GXTA 2R8IA 2BJ7A 3VGTA 3ONQA 4WIIA 2HVEA 1X4GA 4FBTA 1D3WA 5LJ5Y 4EU0A 3S8SA 5KFNA 3SDEA 5DRKA 4NLPA 2FGOA 4TKTA 3C8YA 1M90T 2MQNA 1KLMA 3HXMA 4DR5J 2MKYA 2RRBA 3BR8A 2Z0GA 2GW8A 2HHHF 2KJVA 4N7TA 4PG6A 1ZTTA 4OYBA 2FJEB 4C48A 1JK9B 3N79A 1B0VA 3MMAA 2VQFJ 1FRKA 1CS4B 2HS0A 2W2NP 2KJWA 2DHSA 2XSJA 5C24B 1YBTA 4F3MA 2HWHA 3ITHA 4AD6A 3AJDA 2V0NA 5EHHA 4JI0J 3BO4A 4N76A 3PIPQ 2W1BA 3MAAA 2ZM6F 3LWMA 4DS5A 2BJDA 2AIRB 3TJ8A 1JNRB 3LP0B 1VBYA 2ATCB 2WOMA 4J9QA 1Y4ZB 4FYWB 4RO0A 1NB7A 2N4DA 4B3MJ 3PR4A 1M1HA 1D9AA 2DIUA 4AL6A 2IBKA 4DL2A 2BW7A 2MYFA 2RDJA 3QPIA 5HL7Q 2HK2A 3C16A 3UDEA 4A8XA 2HS4A 2JHEA 4WFZA 2ROPA 4I67A 1T9TA 4E8UA 3I96A 2ZH5A 1ZM9A 3T19A 2LLZA 4JV2A 4LREA 2FJAB 1NHVA 2B43A 1W2BR 3KLGA 3I9ZA 1S6OA 3J81j 3WZ0A 1WNEA 1U2FA 4ZA1A 4RNHA 3WHIA 4NCGA 4USJC 1SJRA 3G82A 3RJMB 5L1IA 3JXOA 3X3UA 2NXEA 1WKJA 2GO9A 4LVOP 4UTGA 2RS8A 1K0TA 4WYWA 2ZBQA 4ECQA 1HA1A 4NLRA 2HAIA 3GIRA 2H1YA 4ZVPB 2YX4A 2UXCJ 2H48B 3VAHA 2MQQA 1EHWA 3MI7X 2IMOA 3A12A 3RRKA 1TFYA 5KFHA 2LKZA 4YB1P 4LRCA 1LK7A 2VPZB 3TZYA 2APOA 5DJBA 3HO1A 4WK1A 5KT4A 1U26A 1B70B 2MKHA 3L7PA 2A3JA 1TVRB 3MM7A 5HANA 1JXVA 1HNZJ 3G6ES 2GFFA 4M1KA 2XS5A 3ZZYA 3F56A 2KRRA 4F4ZA 1TKDA 1DBDA 2GIRA 1HWIA 3RBZA 2YWFA 3PHTA 2K1RA 4OX8A 3DYAA 1FEEA 4ID5B 1R8HA 4N5SA 3CDWA 1Y5LB 4NXMF 1FNXH 3I4HX 3PRBA 2ZHAA 1QAJA 1WTBA 1U0HA 3NNHA 1QJHA 4MYTA 2OPQA 2VU5A 4CNYA 4K4UA 3TQ1A 1X5TA 3W63A 1XEZA 4NLGA 2GQ2A 1N0UA 2HFNA 4CO3A 3V81A 1P6TA 3CCTA 3C15A 1K44A 3GSIA 1NLKL 1B4SA 4J7CA 1S97A 1FKAF 1CULA 1W2IA 4M5GA 1HNIA 2Y8WA 3BBCA 4H4KC 5B0BA 1N32J 1EP4B 4LUBA 5F8LA 1I94J 3OTDA 1RABB 3WX8A 4Z2XA 3PFOA 2ILZA 3TNVA 1VQNS 5DZ6A 5K9FA 2C3YA 3KFWX 1DURA 4IOBA 2BKOA 3WIVA 3NS6A 4EK2A 4DL0C 2DNKA 3P4UB 1J5EJ 3OHAA 5K5MA 2BE2B 3PEJA 4DHVA 3RBDA 5HQMA 3TX0A 1K1QA 4OX9J 2KT3A 1IM4A 1VLOA 3R5DA 5KT3A 3OQ2A 1KQGB 5KFAA 2FHMA 2QIFA 3EGVA 1S5ZA 2B5JA 1KHWA 5GAEU 1IKYA 3TJ9A 2HQFA 3D67A 3CCVS 2CWXA 2XS7A 4HT7A 3HHEA 1WHXA 1WORA 4RW8A 3CIZA 4FVMA 1DFDA 2XI2A 3MM5B 4FZVA 1OSDA 4KR0B 2G9OA 1YK9A 2KXHA 2UXDJ 5F8IA 4RWWA 2EBEA 4GC7A 4P2MA 3MUTP 3EZ5A 2RH3A 1BQMA 3GIJA 2ACMA 3M8QB 1S9FA 2VF3A 4DV0F 2UU9J 4C8LA 2M7SA 1SIWB 2WSCC 2DGSA 2QFIA 2KI2A 3KG1A 4L75A 2F9DA 2VH7A 4A48A 3EXYA 3H40A 3DLKA 3D9BA 4K59A 3UN2A 1M5HA 4QYRA 1U02A 4M5IA 1LWXA 3RW6A 3IRXA 2XMKA 3T9ZA 4K4XA 1M5PC 2XWXA 5ETVA 1FDNA 4C4WA 2FVQA 1T9WA 5F8NA 1VRTA 3EVOA 4KKOA 2WZ1A 5B7WA 2M88A 4MKAA 4ZOSA 2B3TB 2PSZA 1IWGA 1PILA 2JOQA 1SQGA 3AHPA 5KG6A 2R7WA 3DOLB 4WFYA 5DS7A 2DIVA 5HI7A 5B0AA 5IT9U 3A4TA 3IBWA 1FWLA 4NLTA 2RILA 1M1KT 1TFWA 3ILJA 4F8RA 1M0SA 2IHR1 4OYOA 5HJYA 1GTEA 2N7YA 3M1VB 3O1LA 3DOMB 4YEAA 1VQ7S 2ZE2B 2YWEA 2BMBA 3K8VA 1S4EA 3KJQB 1AW0A 4U6PA 4N56A 4I0WA 5CHCB 3V6KA 3RB0A 5GAGI 6AT1B 1S6PB 2YX1A 5KT2A 3IM8A 2KM8C 3RAQA 1KTVA 3T1HJ 3Q8UA 2RB7A 2QO3A 5KG0A 2KYXA 4L6V3 2MGZB 1U1KA 1U6FA 3BH6B 1VFJA 3OJSA 2ZNYA 2W2PP 3I4PA 5AT1B 4WKRA 2KG0A 2VBXA 1RLCL 4LRFA 1NH7A 4TQSA 3DMJA 3CCMS 4DCPB 1OIAA 1VQOS 3MD1A 1CC8A 1GTHA 5AXNA 3JSMB 3UE2A 1QE1B 1NB2A 3LP1A 4DPOA 2DNGA 3PW0A 3OR2B 1QAYA 2JRSA 3GYGA 3KJVA 4RW7B 1FKOB 1YG0A 4R0EA 4LF6F 3GCWP 3ULHA 1HQEA 1C1BB 2BOAA 4QR0A 3TUPA 4CYUB 4ZPVR 2LEBA 1YQHA 4O4GA 3POTB 1T9YA 3FCWA 4OHVA 1TAUA 2HFOA 4D3HA 1XNQF 3AH6A 4UZBA 1FFSB 1VCTA 4CLWA 2ZUGA 3M9MB 3OBIA 3RR8A 3T5JA 1UEVA 3HKZD 2BJ1A 1N36F 5A0YA 4ED3A 4NLDA 1RYRA 5BR8F 5K8OA 4WK3A 1E6YB 4CZCA 1FJEB 4CI0B 2RQKA 4LIRA 2D3ZA 1MWYA 4GO5X 2NUHA 1RQ0A 5J1EB 1OYDA 3DLGA 2ZH1A 4K4SA 4ZVEA 2LQJA 4UY8T 3DDNA 2V2KA 4JI5J 5THWA 4X62J 1ZAVA 1FDAA 3FQKA 4BWMA 3BDPA 1VQSA 1VHIA 1FJGF 3FEZA 1BQNA 2DTJA 2POKA 1WF1A 3N5BA 5C25A 1OQ3A 2XO6A 1JJCB 4U95A 1V6HA 1EIYB 1YKWA 1N6QB 5BYSA 2P9EA 5FIIA 2B51A 3UCGA 1D9DA 3JYTB 3NL0A 2H3EB 2ZVSA 3DC2A 3OR1B 4B08A 4DV6F 3HPOA 4K4ZA 3DGPA 1RWXB 2JX2A 2ZBPA 5EWFA 4OJ3A 1TQLA 2V4JA 2KZZA 3DRPB 5H9FJ 3C6UA 3WBZA 4TLRA 4WPAA 1ULRA 2DNHA 3G8SA 4QW8A 2HK3A 5IZHA 3FSYA 4IKAA 4C8ZA 3MMJA 4KFBA 2WCXA 3KNAA 1YRXA 5J2QA 2C3MA 5KG4A 3VAKA 2MLZA 1T7PA 2HBZB 1WSRA 5AE3A 4CH7A 2KM8B 4B3TF 3I55S 3MUVP 4JI3F 3WC0A 1HKAA 2W7AA 2DR8A 1MMDA 4C11A 3HHDA 4I6WA 3D3BJ 2FJDB 4DI6A 2I38A 5CYMB 1RCOB 3NMAA 2HPUA 5DG7A 4JP8A 4Y2IA 3RGIA 3R97A 2MPUA 4OYMA 4F0MA 3UPFA 3BQ2A 3NRBA 2DKOB 2IA0A 3OTEA 1EETA 4WFAQ 1ZBTA 4MMOA 4J9PA 3MR5A 2QL9B 1QLNA 2R8JA 3H25A 1JKHA 3D0GE 3QLHA 1VYAA 2UUCF 3I31A 1TKXB 1XMQF 2XCPA 4HI1A 3MFHA 3W2WB 2R7UA 1Z1ZA 3BSOA 2MJNA 4LRBA 1LW2A 3KLHA 4NXNJ 3GIIA 5HMWA 1GMVA 4WIQA 4H54A 2CQIA 1HWKA 2WHOA 3HT3A 3Q8VA 1XNRJ 5D6GA 3MMCB 1S9EB 1S6QA 1CJVA 2OLWA 2CPIA 3FMWA 4WE1B 3KJNB 5H9FK 4I56A 3GILA 2BKNA 2E1MC 2HFUA 2VPYB 4C8NA 1YI2S 1QVFR 1X4HA 2XLJA 5H9EJ 3IAM9 1BLUA 2A0FB 1Y10A 2RQCA 5A2QU 1I6JA 4B9MA 4C9DA 1MROB 1FDBA 2F4FA 3Q8YA 4J91A 4FPRA 3PW7A 3AT1B 1RT2A 2IFXA 4XDDA 3DRSA 2B9WA 5EWGA 2QEXS 1VRQC 3IMQJ 2VQFF 4DG1B 1NJXA 1FEHA 2XCAA 2W9CB 1T11A 2NXUA 4IUFA 4BC7A 4M5DB 4A8MP 1S7HA 2C28A 4QWBA 2QYGA 4ID8A 3M2UB 3P5BP 4MK7A 4UT4A 2CNLB 3OSNA 3PJXA 4DR2J 4ZN1A 3FCHA 2PA8D 4ZS6A 1IWAA 2G1HA 1HBUB 3AA8A 4R8UB 3MM8A 1NK4A 5D4NA 2DGWA 2XMJA 4HHJA 1YRUA 5K20B 3MEDA 4L76A 2QG9B 4R5PB 4A8SA 2HNZA 2XY5A 1UVJA 4KRWA 3QO9A 3V2UC 2ALZA 1UEUA 2GHPA 3E2EA 1FO1A 2FC8A 4USHA 4ZITA 2OSRA 1X5OA 2BM0A 3JTOA 3KHHA 3M2VA 3MCMA 1FCAA 4ZCKA 3OVAA 2BOPA 3M8PB 3PO5A 1PBUA 1X4CA 1UVIA 2JC0A 4PXBA 2VKZG 4ZN3A 5I3UA 3HD2A 4MK8A 1PJ7A 2NQPA 2R2SA 3PCOB 3J7YU 4C3KA 2YKNA 2LXFA 3FQLA 3R7NB 3QNWB 3ILLA 4A8KA 4EZ6A 4FS2A 1EKRA 4X66F 3ET6A 3DN9A 2QMXA 3D28A 4X65J 3QGGA 4USKA 4TLQA 4DJBA 3ZXWA 3C14B 3CCWA 3LAKA 3TJAA 2P6TA 1KRPA 2PT0A 2AYMA 2OUGA 1IXKA 2V9WA 2GJIA 5L1JA 2J9EA 2CKWA 2XWYA 1IR1A 4YHHJ 3I5AA 4DV3J 4DUYF 2MZRA 4KC5A 5J2NB 3IXQA 3T3FA 4PG5A 1RKIA 2VFTA 2R2UA 3GZ7A 4WFXA 1Q7LB 1R0CB 5KFYA 4DN9A 2VFVA 3SSRA 3KG4A 1HPZB 4LFBJ 3BBFA 3KWMA 5CCMA 5G0RA 4DL5A 4YQWA 1H74A 1V3SA 3LTOA 3HZGA 2GCFA 1Z4UA 1UA0A 2BDPA 4DR3J 4NZ0A 2GVZB 2RJZA 4OI1A 3OJUA 4Q0BA 4U7UD 3SXLA 2IRUA 1I94F 2VBYA 1NEEA 3MR2A 4ENOA 2OP5A 1D8YA 2YNHA 2DJWA 5I42A 1R43A 2DR7A 4LR8A 1N33J 2QN6B 1RT6A 3DOKA 3OL7A 4F26A 2Y1LB 3TI0A 1QVGR 2JH3A 4NL5A 4DZ6A 1T05A 2DGXA 3PTWA 2HHUA 1JLAA 1HR0J 3G71S 4U7UK 1N34J 1O5JA 3IR6B 4ELTA 5IC4B 2WSFC 1OY9A 2DPIA 4WKYA 4NI2A 4K0KJ 3DFEA 1EX8A 3BSAA 3W2VB 1QDUB 1NK9A 5KT6A 4ES1A 4URGA 3SDEB 1EARA 3D66A 2IC3A 4A8FA 1I51B 1EAYC 2OGUA 4U67Q 4WFNQ 1G3OA 1KKHA 3PEHA 3PW5A 2E5LJ 4NLXA 2FLLA 4RWXA 2DY9A 3BGRB 3CCES 3LA0A 3B8HA 2DEJA 3MR3A 3IR5B 4X4OA 2O01C 2KVIA 2XSJB 2GIFA 2ACYA 1A9NB 5C42B 2G2OA 3K5LA 1B64A 2H54B 3KLEA 5J2PB 5E7OB 1WDTA 4Y3CA 2BKPA 3LH2S 3OPKA 1YDLA 2DNLA 5D3GA 3MAAB 2GNKA 3EPIA 2EBGA 2C22A 3GONA 4PXDA 3BO3A 3EZUA 1EB0A 3FMBA 3Q22A 1IBMF 3RRGA 2BVZA 2P8IA 2WOMB 2AEJA 2N3OA 2C2EA 4LSNA 3KLIA 2UUAF 1U1NA 3QBCA 3GWCA 4MFBB 3CC7S 2DGTA 3HHLC 3UCUP 4QW9A 3C16B 4K4YA 4NRTA 3MPDA 4P2FA 3PRDA 3HSJA 1NHUA 3JTNA 5IWAF 2G4BA 4K7QA 3BKFA 3CJ8A 4QYZJ 3VGSA 2DRAA 1JB0C 2Y0SD 4DR4F 2LP4A 2RQ4A 1MWZA 3KLGB 2HLUA 4PG8A 3JSYA 4CO2A 4NCGB 1TELA 2FLOA 3G82B 1XR7A 4MK9A 1LWFA 2FZGB 5BXIA 4JV5F 2QL7B 2JEIA 2B6AA 1H3DA 2C3OA 5E3CA 3ZTPA 2IMWP 1X4DA 5JJBA 3NOGA 1SPBP 2VG7A 2HHVA 1FXRA 2W01A 4ZMMA 1DAXA 4LF4F 3GYXB 3MM9B 4LFAJ 2VFSA 4FPIA 2PO4A 3H7HB 3T9NA 3GV5B 2PA3A 1UPMB 3T1HF 4KGXB 3VTIA 1RXOB 2QGFB 1I3OB 3RBEA 1Q79A 3MCNA 9RUBA 1NJYA 1S0OA 5KG3A 1Q95G 4HI2A 1NDLA 2M70A 1REVB 5CA5A 1RAOA 4DR1J 1NU4A 2XMAA 5KFRA 3IG1B 1RWKB 2CWKA 2VBZA 4O0NA 3FBCA 2PGCA 1UVKA 1U0HB 3BSNA 2L3MA 4KT0C 4MYUA 4G6VB 1K73T 4O44A 3D4JA 1FJ7A 2OPQB 4CTAA 1ICEB 1NJIT 1TP7A 3BGFA 1V9OA 1CS4A 4ECVA 1XMOJ 2NXNA 3V81B 3GB0A 2A6MA 1D0EA 2WAQD 4OHWA 5C24A 1UTAA 1R0BG 4F3QA 3C15B 2FLNA 1RWOB 2D41A 2MZJA 2IM3A 3GIMA 4ED1A 1RUSA 3D54A 3OFHA 1HNIB 2JJ4D 2X1GA 1UL3A 2E1RA 1PC5A 2IM0A 1RISA 2CAJA 4CM0A 3RR7A 3LPEA 1OSCA 4ZK7M 3HVRA 4PQAA 4ETXA 3I9V9 4O3OA 4ZLLA 1FXDA 3UWTA 3OUYA 1VQYA 1KTQA 1FDDA 3CSKA 4I68A 4NA1A 2UVRA 1M1GA 3IN5A 3KMQA 3BJYA 5E2QA 3JB9k 3MPUB 1YZ6A 1Y00A 4KB7A 1H73A 2EFGA 2ZBCA 2R2RA 3OTOJ 3HHLB 1FT8A 2B5JB 1NSQA 1IKYB 3NLCA 3TOQA 3KK2A 4ELVA 2RDIA 1SC4B 4ZJLA 4WZQA 5E33A 1HWUA 1N48A 2DNPA 3KK3A 1F60B 1KFDA 4LJMA 2XG8A 1B7YB 1RT4B 2YY3A 2C2OB 3SCIE 3FSXA 2J0QD 2EW9A 1FF2A 4QBUA 1NO8A 4PQUB 4O3PA 2F8MA 1DY3A 3Q8RB 3FJ2A 5A8RA 4DV7J 1T95A 2Q6CA 2XHWA 3H4DA 1BQMB 4BHQA 1REGX 1M5VC 1R6VA 1X5PA 3ZZOA 3QT6A 1L3KA 4Y2AA 3LGHA 2EFPA 2RT3A 5E0OA 2B8QA 1MWQA 2VPWB 4ELUA 2UVVA 3DLKB 4ZHRA 4DCOB 1V5IB 3BREA 1YJRA 2CPJA 4JI2F 1ACMB 3QSIA 4ER8A 3RAMA 2HVDA 1TV6B 1DLOA 4B9NA 4KGVB 4DPTA 5GAGU 5KTQA 2R7QA 1S12A 4X64J 5G4DA 2YNIB 4F4WA 1X4AA 1HLWA 2L9DA 1GT8A 2QV6A 4HL9A 3QIPB 5M2PA 1KVJA 2GJ2A 3TQEA 4BWJA 4GO7X 2EWHA 1MN9A 2MTLA 3UD3P 4YR0A 1K9MT 2KG1A 1RA7A 2Y1JA 2VQEJ 1IM6A 4CO4A 1WHVA 4IO9Q 4WJBA 2HBYB 3D7SB 4LR9A 4Y6IA 2MSTA 4PR6A 1T02A 3WIUA 4K2JA 3UVJB 1LXJA 5D0HA 1EP4A 2ATLA 2BRLA 4OL8A 4OQJA 2X1BA 4ECTA 1G2EA 1S59A 1X9SA 4P7TA 2VL1A 4IO1A 3OTBA 2KRBA 3TVZA 5LT5A 1SH0A 3N6MA 2V4QA 4I6YA 2Z2YB 4DF4A 5EDWA 4HT5A 4UOFA 2UV8G 3UO0A 2HKEA 1U1OA 1SC1B 2A2CA 2X3GA 2G1DA 2BQUA 1IJEB 3R5CA 3IWLA 3HHLD 4IR9A 2LQ5A 4AUKA 5KFQA 2UUBF 2XYPB 4X4SA 4MIBA 3KK1A 3D2WA 1P9QC 2L48A 2QSWA 4C7QA 2J9DE 1J27A 4DV1F 3PW2A 4J90A 4C8OA 3KHGA 1KHVA 2HQ3A 2KN4A 4ECSA 2MKJA 4ILRA 1X0PA 5ETPA 3PV8A 3MOZA 4DR6F 3ADAC 2C2RA 1JQGA 3FFIA 1NNDA 3NBPB 4OZ3A 4FF4A 4NYOA 3M8QA 1HQEB 4UOCA 4M5MA 8AT1B 4DR2F 4I2PB 4PG7A 2JLFA 2J6TA 4ZPTR 4TU7A 1KFSA 3RU0A 2M8HA 4QU7A 4JI7F 4YB7A 2YBVA 3HI9A 4M5JA 4ZP8A 2HWIA 2I2YA 4DMZA 1Q16B 4HLBA 3NG8A 4DV4J 5B08A 3W65A 1VQ8S 1UJ4A 2QLFB 4JB8B 1LW0A 2DGQA 4B9TA 1S0NA 1IQTA 3JQJA 1VK3A 1RAGB 4KGKA 4ZVUB 1R3NA 2DNRA 2AWZA 1QUVA 4EZ9A 1KBRA 2CPEA 2EK1A 3GFYA 2YKOA 1H72C 1OQ6A 1YIJS 1WHYA 2VG5B 4LF9J 1WI8A 1SH2A 3IWXA 4QCLA 2CNNB 3IBFB 4KYZA 2J8SA 3R1LA 2DB1A 3M1VA 2QA1A 1FVSA 3KHRA 3OL9A 3GMGA 4JI6F 4X65F 2ZE2A 3DGPB 5A76A 4FXVA 3TW0A 1P1LA 1TL1A 2WTFA 3CULA 3SQGB 1XK8A 1F2GA 4FN5A 1VQMS 2V9KA 4H4KA 3J7A1 2V4JB 3CD0A 1RHKB 3AOCA 4EBDA 2ZBRA 3KDOA 4DFPA 3R7SB 1XWLA 3C6UB 1P1TA 1RT1B 4HTIA 3CTRA 3VALA 3G4SS 5HAOA 2BRKA 3P3DA 2MGZA 3H59A 2DNQA 1U1LA 2IDEA 3MDFA 3M6UA 5F8MA 3UDLA 3DLLQ 1K1SA 2HS3A 1C0TB 3K5PA 2MKIA 4WBFA 9ATCB 5F9NA 4C11B 4M5LA 4PCQA 5DLFA 2QLWA 3CD7A 1S72S 4Z37A 3RG6A 1NPPA 1UVNA 4YDXA 3OL6A 2BZ2A 4URQU 5DM6Q 2W4DA 4M94A 4ZIWA 1FKOA 1EETB 1ZYQA 3FCVA 2HRUA 3H5SA 5KFPA 1C1BA 4B3RJ 1UP1A 1RTHB 4CYUA 5DDPC 1JKHB 2M0GB 2UXBF 3POTA 1RE1B 2HQGA 2DYAA 2C3PA 2ZD1A 2BJ9A 3UQSA 3CJ0A 3TA2A 3KLHB 2CJBA 1R27B 1U45A 4IQMA 2GGPA 2FJXA 3M7VA 2CXEA 4K5SA 1CJKA 5IQ6A 2CQHA 2AQ4A 1ITPA 2HFSA 3MURP 4HEA9 4ZVHA 1FNOA 2N82B 3DLHA 4DR7J 7FDRA 5D4LA 2CA9A 4ZLPA 2BACA 4PEOA 4IOAQ 2Z8QA 3E3XA 3RBXA 4DX7A 1JIHA 2FVPA 1GAOA 1FKPA 4IFVA 2E7WA 4X84A 3CJ3A 4B9LA 2D69A 3Q23A 2Q43A 3NAHA 2J0WA 2G0IA 1RT2B 3D0IE 5B0FA 2FVCA 4HR2A 1TL4A 1VIOA 4C97A 1GXUA 2EG2A 3PY8A 4NYZA 5AJ3F 5D15A 3KUHA 3GFXA 1HQUB 5KFZA 3FGVA 3US5A 2ROEA 2B4UA 1HYSA 1H7WA 2XQCA 2Z4PA 5KFUA 5GVQA 3O44A 5JMNA 4RNFA 3ZTSA 3H4BA 2V4RA 2ZKTA 3K0JA 1IJFB 2I8EA 3MOJB 2WVDA 1FJCA 3BN7A 2QL5B 2MB0B 1AZSA 3GJSB 1ZM4A 4FXWA 2HIYA 2KO1A 3V4IB 3JS9A 2VUGA 2NUUG 4DUZJ 2AF6A 2AV5A 2PDAA 3PX6A 2R8GA 3G6XA 4B3SF 1C4CA 4ZDNA 3QRPA 3IFEA 4WP3A 4ZVOB 3MEDB 4CIOA 1P9YA 4UUXA 2HNZB 5J1NA 2R4FA 5DQIA 2XHCA 2KZMA 2C1EB 2OPRB 5LMUF 2RHSB 3W8PA 3B4DA 2DNOA 3M2VB 1TK8A 4KHPF 2B9XA 2ZDPA 4N41A 2MKCA 4PKDB 1F2HA 2J9CA 3KLFB 3SMZA 2X7IA 3QMQA 5HK4A 1S1TA 3MUMP 2NYHA 3TUIC 4DPUA 2D3OR 2KXNB 1L3UA 2WW4A 3W2WA 2PMWA 3MXHP 2YKNB 2ADBA 4CH0S 5DZ7A 2Q66A 1VBKA 3D1HA 3ZZ0A 2J0XA 3V4MA 1B0TA 2BE7D 3PXGa 2BBEA 4KO0A 1RKJA 2ZUAA 3NAIA 1NSPA 4WE1A 3OW2R 1XQIA 3NGRA 1JLQA 2CQ1A 1O0PA 1APSA 4CCHA 3LAMA 5DG9A 3DHWC 1CVJA 1PAUB 1ZETA 1YGYA 2DNYA 2D9OA 1TK5A 2CFXA 4JV1A 4B02A 1MROA 2M2BA 4KTQA 1RU2A 4DFMA 1DTQA 1R89A 2FVRA 3R5JB 5LJ3Y 3R9LA 3D6TB 2OD6A 2OMLA 5DM7Q 4DG1A 5G0RB 1RHUB 2YPYA 1TUWA 3R6LB 3ZZZA 2EFNA 5J2MB 1Q7YT 1LWCA 5AXLA 2RUSA 2PD1A 2XLKA 1VIXA 2OEKA 1HQ2A 5BYRA 2JFKA 1RTIA 1TKTA 4M5DA 2V68A 2WBRA 3WQPA 1SVDA 4ZKAA 1LNQA 3T1YF 4Q0BB 3M2UA 3KXDA 2MJUA 3CW2C 1Q86T 5ETLA 2IPOB 3VQTA 2WRMA 4OYIA 3SBMA 1PYSB 3W5XA 3IP0A 5I42B 3JTPA 4LF8F 1HBUA 4R8UA 2OTJS 2O1PA 2R8KA 1T3OA 5D4OA 2PIIA 4KGMA 5C5JA 2L9NA 3DOKB 2RS2A 1HMVB 1KNZA 3BR9A 4DV2J 2PC6A 4MKVA 2LEPA 4R5PA 2LCWA 1NK0A 2QMUB 3SSSA 4Y2KA 1N0VC 1TR0A 1EJ7L 3CCZA 3T5HA 1F1BB 2QYCA 1H2TZ 3H0PA 1Z2ZA 3TZZA 4YUDA 2VDIA 1AFJA 5HSPA 2HFZA 1TK0A 4NI2B 1QY7A 5HP1B 2R42A 2RSQA 2FY1A 3DI6A 3MEKA 1C0UB 1HNWF 7AT1B 3CIMA 4YR2A 2A6OA 3CC4S 2IC3B 4AT1B 4CO5A 3EZOA 3C19A 3I82A 3I5BA 2HSEB 4J9RA 1XR6A 4DX8H 3DRYA 1HW9A 2CZ4A 1WHWA 1OO0B 5IT0A 3NY0A 5D0RA 3CDBA 4ICLB 4OFZA 2VJUA 4DV7F 2ZC4A 2EEYA 2V69A 3F0NA 1AYEA 4WFBQ 3NCRA 3NWGA 3BBBA 4RBTA 2B4OA 5J1PA 1PYTA 3CVKA 5F8JA 2A2DA 1GMUA 1N52B 2BQRA 3HHKA 3J7ZT 3C14A 3M6VA 3LPYA 4KH1B 3UI3A 4HHUA 4B9SA 1VGYA 2OD4A 2DXDA 3W60A 1FHTA 1DTTA 4AE5A 4OLPA 2FD2A 4BBYA 4AQYF 4A8OA 2PE8A 2J6UA 1UWAA 1UAWA 4PABA 4DL3A 1T94A 4E98A 3R5AA 4DQRA 4QQBA 4RNNA 2B7BB 1XTZA 1SL0A 4KIAA 3M8YA 2FC9A 3MEEA 2OH2A 5K14A 3LWLA 4LSNB 1IBKJ 1ZAWA 3KLIB 1DQ9A 1HPZA 4KPYA 5L8RC 1VHFA 1Q8IA 2L08A 3DM2A 3H90A 4ETZA 3CJKB 4CO1A 2K7JA 3J7YI 4OJHA 2M3DA 4XTTA 4I2QB 4TU9A 4NLUA 4YB5A 4JOUA 2QLBB 3O5TB 5KFBA 4B17A 1HARA 2HBRB 2CJYB 2OEMA 1NRKA 4DS4A 3ZNJ1 2WVEA 3ZZUA 2AU0A 1P27B 2EVZA 1GFWB 3MTJA 2GVZA 3AODA 2VJVA 4PPZA 4P2XA 1LWFB 2BYCA 3HDSA 5DLGA 4U8YA 5FLXU 4AL7A 4LF5J 2B6AB 2XTJP 3LO3A 1NAQA 3H8YA 4RW6B 3TUJC 4YY3J 4WTOB 5FD1A 2DGUA 3BGUA 2WW8A 2VG7B 3A8EA 5GADU 4YP3A 1QSLA 3UR0A 1QUPA 2M5YA 5HMXA 3NGKA 1SKRA 2LXIA 1KDNA 3C6TA 2ZOFA 2W9AA 1LOUA 1WC6A 4DBQA 4RL1A 2C2MB 1BC6A 4O23A 3HJFA 3LGMA 4NEYA 3W2VA
chains in the Genus database with same CATH topology
1XNQJ 2UUCJ 2HHHJ 2UXDJ 1XMQJ 2UUAJ 5LMUJ 1N32J 1N33J 3J80U 4AQYJ 4JI1J 1N36J 2F4VJ 1XMOJ 3D3BJ 2MTLA 4JI6J 5BR8J 2UU9J 4DUZJ 1I94J 4GKJJ 4KHPJ 4GKKJ 4YHHJ 5IWAJ 4V1Ak 3J81U 4DV3J 2VQEJ 4B3MJ 4JI7J 5A2QU 4DR7J 1HNZJ 4JI2J 5AJ3J 4LF7J 4DR4J 2MQ8A 2UXBJ 3D3CJ 4LFAJ 4X66J 1HNXJ 5FLXU 1HR0J 4LF5J 1N34J 4DV7J 1HNWJ 3IMQJ 4DR5J 4KY3A 3JAMU 3J7AN 1J5EJ 4B3TJ 2KL8A 4HHUA 4LF9J 4YY3J 4LFBJ 4DV2J 2ZM6J 1FJGJ 4JI3J 5LM7E 4JV5J 4K0KJ 4KYZA 4OX9J 3W1YC 2UUBJ 5LMNJ 4NEZA 2VQFJ 3T1YJ 3T1HJ 4DV0J 4JI4J 4NXNJ 4JI8J 2KVQE 4NXMJ 4DUYJ 4LF6J 4LFCJ 4B3RJ 4B3SJ 2MEWA 4DR1J 4DV1J 4DV5J 3R2CJ 4LF4J 4PWWA 4JYAJ 1XNRJ 4DR3J 4RJVA 4DR2J 1IBLJ 1IBKJ 3R2DJ 4LF8J 2UXCJ 4X65J 4DV6J 1IBMJ 4DR6J 4JI5J 4JI0J 5IT9U 4X64J 2E5LJ 4X62J 3OTOJ 4NEYA 4DV4J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ J;  2UUC J;  2HHH J;  2UXD J;  1XMQ J;  2UUA J;  5LMU J;  1N32 J;  1N33 J;  3J80 U;  4AQY J;  4JI1 J;  1N36 J;  2F4V J;  1XMO J;  3D3B J;  2MTL A;  4JI6 J;  5BR8 J;  2UU9 J;  4DUZ J;  1I94 J;  4GKJ J;  4KHP J;  4GKK J;  4YHH J;  5IWA J;  4V1A k;  3J81 U;  4DV3 J;  2VQE J;  4B3M J;  4JI7 J;  5A2Q U;  4DR7 J;  1HNZ J;  4JI2 J;  5AJ3 J;  4LF7 J;  4DR4 J;  2MQ8 A;  2UXB J;  3D3C J;  4LFA J;  4X66 J;  1HNX J;  5FLX U;  1HR0 J;  4LF5 J;  1N34 J;  4DV7 J;  1HNW J;  3IMQ J;  4DR5 J;  4KY3 A;  3JAM U;  3J7A N;  1J5E J;  4B3T J;  2KL8 A;  4HHU A;  4LF9 J;  4YY3 J;  4LFB J;  4DV2 J;  2ZM6 J;  1FJG J;  4JI3 J;  5LM7 E;  4JV5 J;  4K0K J;  4KYZ A;  4OX9 J;  3W1Y C;  2UUB J;  5LMN J;  4NEZ A;  2VQF J;  3T1Y J;  3T1H J;  4DV0 J;  4JI4 J;  4NXN J;  4JI8 J;  2KVQ E;  4NXM J;  4DUY J;  4LF6 J;  4LFC J;  4B3R J;  4B3S J;  2MEW A;  4DR1 J;  4DV1 J;  4DV5 J;  3R2C J;  4LF4 J;  4PWW A;  4JYA J;  1XNR J;  4DR3 J;  4RJV A;  4DR2 J;  1IBL J;  1IBK J;  3R2D J;  4LF8 J;  2UXC J;  4X65 J;  4DV6 J;  1IBM J;  4DR6 J;  4JI5 J;  4JI0 J;  5IT9 U;  4X64 J;  2E5L J;  4X62 J;  3OTO J;  4NEY A;  4DV4 J; 
#chains in the Genus database with same CATH topology
 3VVU A;  4MJK A;  2HVI A;  3D1O A;  5DGB A;  2ALY B;  4QR1 A;  3ISN C;  4ED4 A;  2BW2 A;  2ZKU A;  3P45 B;  4DQQ A;  1F5B A;  4GKJ J;  4P52 A;  3AQP A;  2MSS A;  3TA1 A;  2E44 A;  5D0E A;  2HHW A;  4V1A k;  2VD3 A;  2JNJ A;  3ELH A;  4O44 B;  2P9G A;  2GMH A;  4CTA B;  2OFG X;  1RTJ B;  3UN3 A;  1U7L A;  3OTC A;  3W61 A;  3BGR A;  1VDH A;  3MZI A;  2XS2 A;  1U49 A;  3GV7 B;  1N4L A;  5C42 A;  4BCA A;  5IT4 A;  1HI8 A;  4OHX A;  1HBM B;  5CAB A;  5J2P A;  5LMN J;  4M63 A;  1O6X A;  4FBU A;  1CJU A;  1NZ8 A;  1NCL A;  3UR3 C;  4YR3 A;  2QLX A;  4NX9 A;  4TVA B;  2M9K A;  3AB2 B;  1HNX F;  3GG1 A;  3Q2T C;  1FES A;  1T9V A;  4CLF A;  1F3F A;  1Y11 A;  3OUY B;  3PIO Q;  4ED5 A;  3AOA A;  4FKY A;  4MFB A;  4L72 B;  2XY6 A;  2ABY A;  3QJP A;  2B4V A;  1OMS A;  3Q8Q B;  2EFV A;  3K5N A;  1UEK A;  1K0V A;  2DHX A;  2UUW A;  1OY6 A;  1UJ5 A;  3RB4 A;  1TUV A;  2MQ8 A;  1MNE A;  3KK2 B;  4B9V A;  3FNN A;  1JX4 A;  3QGH A;  1VQ9 S;  3TAN A;  4UQG A;  3UDV A;  2Y8Y A;  4RLE A;  1SUQ B;  3KK3 B;  4M8L A;  4IG3 B;  1X7V A;  2QT7 A;  4ATN A;  4ZLJ A;  1BWE A;  3PYG A;  4IDK A;  3THV A;  3S7R A;  2LXU A;  4JI1 F;  2F4V F;  1L3S A;  4LSZ B;  5A8R B;  1WWH A;  1UZH A;  3MM9 A;  2ZH6 A;  1PBA A;  3R7B B;  1WG4 A;  1VC6 A;  2RKI B;  3CJT A;  2X1A A;  3JSR A;  4ZHR B;  2U2F A;  4DSL A;  1SB6 A;  2HHH J;  2Q3P A;  2XMM A;  2FPH X;  2B0G A;  3M8W A;  2E1P A;  4R0J A;  5E3Q A;  1DLO B;  1REV A;  1WTF A;  4NZ7 A;  1YJ9 S;  3FDS A;  3IG1 A;  2LYV A;  4ECX A;  3W64 A;  2F40 A;  4L74 A;  4Y00 A;  2Y3Y A;  4RUA A;  3OVB A;  4O0I A;  2CQ3 A;  4DZD A;  2R7O A;  4X4Q A;  1RJJ A;  1RAF B;  3ENQ A;  3IGV A;  5T7L A;  2ZM6 J;  2VKR A;  3BM7 A;  4CLZ A;  1JMT A;  2NZC A;  1N88 A;  2DHH A;  3BH7 B;  4W98 A;  1HBN A;  4AYB D;  2CQ2 A;  4D3G A;  3M8Z A;  1YVF A;  3MTK A;  3VAI A;  1U6B A;  3M8R A;  2LVW A;  3UNY A;  2AGP A;  2RAQ A;  4OIX A;  5CQG A;  1BWV A;  4L3K A;  1NKE A;  1XN9 A;  4ZJO A;  3RZA A;  3AXK A;  4NLS A;  3AJ2 A;  5DGA A;  4RU9 A;  1UMJ A;  2EXU A;  5ADZ A;  3M6W A;  3VAM A;  3BDE A;  5ETN A;  4G1P A;  4TXS A;  2K7K A;  4IH7 A;  3BYP A;  1U1R A;  5F9L A;  2LMI A;  2ILY A;  2ZHB A;  4IFY B;  1X4E A;  2DIS A;  4O3N A;  1SJF A;  3HHL A;  1JXL A;  5HN0 A;  1Q8B A;  3KK1 B;  4ZPW R;  1NKB A;  2QA4 G;  1Q4R A;  5AXK A;  2NPI A;  3QSY B;  3M30 B;  3UCZ P;  4I69 A;  1GH8 A;  4K4W A;  1RT4 A;  2OEL A;  3TEH B;  1UFW A;  1Y5I B;  3MCS A;  5L46 A;  2CZ9 A;  4ITS A;  4PQU A;  4WF9 Q;  3FFI B;  1NKC A;  4RUC A;  4YDD B;  3FBB A;  4LF1 A;  1U8W A;  2DHG A;  4EYI B;  1SJ1 A;  4UF4 A;  4FXD A;  1JLB A;  2MZQ A;  4EBE A;  3VZH A;  4IH5 A;  2NLW A;  2O3D A;  4YB6 A;  3MEG A;  3H2V E;  1S4F A;  1S1X B;  4AXI A;  1MN7 A;  3DXB A;  2XZW A;  2VIC A;  3I87 A;  2RRN A;  4FKX A;  1U8S A;  4MH8 A;  1TV6 A;  1TU0 B;  3HSD A;  3RAX A;  1G1X A;  2DIT A;  3F73 A;  3N5F A;  1LW0 B;  2YNI A;  5GAH U;  1PJ5 A;  2E5J A;  2QJ3 A;  1RHR B;  2VHG A;  2XLI A;  3RUB L;  1GQE A;  3QIP A;  4N47 A;  4ANE A;  5IOL A;  3P6Y C;  1RCX B;  1K8A T;  3VGV A;  3DDI A;  2DK2 A;  3MCO A;  1WC3 A;  5KT7 A;  2NXJ A;  3PO4 A;  4G1Q B;  5DET A;  4DCJ B;  3CO0 P;  4DEZ A;  3TVY A;  4LF7 F;  5CCL A;  2B7C B;  2X1F A;  1RWW B;  4BDP A;  1GX5 A;  2H5J B;  3P8B B;  2CDR B;  1D09 B;  2NSC A;  3HLU A;  3UVJ A;  5KT5 A;  2BJ8 A;  5EGY A;  2FDN A;  4QOT A;  2F9J A;  5AE2 A;  3GTY X;  3M6X A;  4QPX A;  2L41 A;  1TL1 B;  4J9U E;  2JVR A;  1VBZ A;  1J2V A;  3VGU A;  3T6B A;  2FQQ B;  2YVS A;  5A8K A;  3NNC A;  2V67 A;  3O8W A;  3VCD A;  2NRE A;  4DSJ A;  2D74 B;  4F7V A;  2CQ0 A;  2BEF A;  3MF5 A;  1NME B;  1RB0 A;  1JLC B;  1RAI B;  5KOX A;  4WCE Q;  1NDK A;  2HNY B;  4RKU C;  2WB1 D;  4DV0 J;  3WC2 A;  2PEB A;  1L3T A;  4LBI A;  2D3O 1;  3QJL A;  2QTW A;  1Q8K A;  4ECR A;  3TUZ C;  2QC3 A;  3NBP A;  1U2C A;  1OPZ A;  1E6V B;  3H20 A;  5FDL A;  3KOA A;  3VHQ A;  4I2P A;  5B0E A;  1SJ4 P;  1G6B A;  3TR5 A;  4OI6 A;  2E1C A;  4S0M A;  5A6P A;  1RAJ A;  3LGN A;  4EWT A;  1WOP A;  1S49 A;  3SCK E;  3KLV A;  2M4M A;  2ZD1 B;  2B9Y A;  2XNQ A;  4IG0 B;  1RAH B;  2GGP B;  3EX7 B;  2BAN B;  3SFG A;  1TZ0 A;  1CJK B;  1CJT A;  2DCL A;  3LAN A;  4H4M A;  5HVF A;  3PZP A;  3HD1 A;  2CUY A;  4MTP A;  4C2M A;  2JFD A;  5EX0 A;  5MAO A;  2R7X A;  3MPV A;  4CQ1 A;  2YNG A;  2DT9 A;  2DRB A;  5K8M A;  3FVY A;  1DQ8 A;  2DR5 A;  3TYT A;  4DFJ A;  4NCA A;  4CLK A;  1VRU A;  3PRV A;  4IFV B;  1FKP B;  2MKS A;  2XEX A;  2DGV A;  4ED6 A;  3DLE A;  3SCJ E;  3CWJ A;  3DLB A;  2IDL A;  2DNN A;  2GVD B;  4C0H A;  5CYJ A;  3TEG A;  4QWC A;  4EEY A;  2VG5 A;  4DSK A;  4F02 A;  5C2G A;  1R8P A;  1PKU A;  3EXC X;  4QPT A;  1VJW A;  2J76 E;  4CLP A;  1PC4 A;  3AB4 B;  3FZ2 A;  2V8P A;  5CD4 A;  2ASJ A;  5K8P A;  3HZE A;  3GIK A;  1JLF A;  2RU9 A;  2X3D A;  4NZ6 A;  3GSD A;  3U7J A;  1A6L A;  5L38 A;  4JI4 F;  2DD8 S;  1HYS B;  3J81 U;  3SQG A;  1ZPW X;  2GMJ A;  1RWV B;  3N01 A;  3Q0A A;  4DV5 F;  2DEI A;  5HMZ A;  1LXN A;  1IQZ A;  3L9Z A;  1AZS B;  1MU2 B;  4J9O A;  1RT1 A;  2E7V A;  3KYL A;  5ETR A;  2MXY A;  1D1U A;  1SL2 A;  4KY3 A;  4MT1 A;  3J7A N;  3AAW B;  3A13 A;  4ED7 A;  4PUO A;  4AL5 A;  2GA7 A;  2WVC A;  2HLT A;  1VIS A;  3NS7 B;  1AT1 B;  2JEG A;  2OIH A;  5KG5 A;  2UV8 A;  4F4A A;  1R8A A;  4OZ0 A;  2W7O A;  1WG5 A;  2XMW A;  3TVK A;  1WC4 A;  2XBP A;  4LF6 J;  4XDC A;  2J6S A;  1VMB A;  1RI7 A;  1FX2 A;  2MEW A;  1C0T A;  5F0W A;  4KE5 A;  4KBI A;  1F5C A;  5KFW A;  4FYD A;  2HRT A;  2XO7 A;  2ZNZ A;  2CJA A;  4KGZ B;  4PZV A;  2CPY A;  1CLF A;  1SKS A;  2R3V A;  2AX1 A;  1EQM A;  1XNQ J;  3TP2 A;  1AUD A;  3H98 A;  5A2Q Y;  3NP5 A;  4A8W A;  4RPF A;  3VR1 A;  1N36 J;  4UQT A;  2V50 A;  4I7F A;  2HFV A;  5BR8 J;  2GQQ A;  1RTH A;  2HVZ A;  2V8H A;  1S1T B;  4YY3 F;  3TAP A;  2Z57 B;  1HNV A;  1D9F A;  1MW7 A;  3GJT B;  2W25 A;  2IIH A;  4X4T A;  3F44 A;  2PN6 A;  3GQC A;  5L9N A;  1FJG J;  1WF2 A;  2HHP A;  2F63 A;  4KO0 B;  3DU6 A;  2EC2 A;  1WEY A;  2V63 A;  4PYD A;  2C2N A;  2I0X A;  1JLQ B;  2A1B A;  2AYG A;  1VS3 A;  1HD1 A;  3HHN B;  3HK2 A;  1TMM A;  1HWJ A;  4RW4 B;  4DV6 J;  3C3L A;  2DY1 A;  2EC0 A;  3NEK A;  4DR5 F;  2W9B A;  3X1L B;  2YKQ A;  4Z7C A;  1DTQ B;  1FD8 A;  4M95 A;  2GHV C;  3PW4 A;  3W5Y A;  4NLY A;  2ZH8 A;  2D3U A;  4P74 A;  1T9X A;  3LP2 B;  3HUL A;  3RW7 A;  1VC5 A;  2DXE A;  1HQU A;  1LWC B;  8ATC B;  2BJE A;  2AJQ A;  2IBO A;  5I3Q A;  1RAE B;  3QFW A;  3MEC A;  2CPD A;  3DXS X;  1RTI B;  1TKT B;  4OI4 A;  5L39 A;  3BKT A;  4JI0 F;  2FHJ A;  4B3T J;  3GYN A;  3K17 A;  2HWT A;  3FSI A;  4USU A;  4JI3 J;  3V4I A;  4ECZ A;  3KJF B;  3ZZP A;  2MZS A;  1HW8 A;  3D0H E;  3LQV A;  2YH0 A;  4CLS A;  4ECU A;  2CPH A;  1FRM A;  5DDO C;  1O51 A;  3VWS A;  3TO8 A;  5IC6 B;  4PXC A;  4B3M F;  1U6Z A;  3L3C A;  2B8P A;  1X60 A;  2PEH A;  3CE8 A;  2VDH A;  3JQK A;  4L73 A;  2FLP A;  3PM9 A;  5KFO A;  1RA6 A;  2ZOG A;  2CIM A;  3N0V A;  1W26 A;  4F4Y A;  2OPR A;  2OTL S;  3QID A;  2UUC J;  1NZA A;  5HRO B;  1XMQ J;  4AFF A;  1C2P A;  3RTV A;  2JEF A;  3EYZ A;  3GP9 A;  3CCS S;  3CPW R;  2E1A A;  1SJQ A;  3DI6 B;  2YXL A;  2YQ1 A;  5EWE A;  3IO1 A;  2DRD A;  3KLF A;  4IRD A;  2XM3 A;  4UST A;  3RYL A;  4BC9 A;  1EKS A;  1DJ0 A;  2YWK A;  1QAI A;  2B9E A;  3I0S A;  4P71 A;  3BS9 A;  2UXC F;  2DNZ A;  3DDK A;  2CPX A;  3I32 A;  5KG1 A;  2AZ3 A;  2MMY A;  1H2V Z;  3R6G B;  3PYF A;  5L1L A;  1WDD A;  4XK8 C;  5EN1 A;  1GEH A;  2IAJ B;  5HVH A;  5HLF B;  3J80 Y;  3RB6 A;  3CT9 A;  2ZIT A;  1HNZ F;  1B3T A;  4K4T A;  1G4C A;  5F8G A;  1FD2 A;  2OHD A;  1DTT B;  3ZO7 A;  1RAC B;  4WWS A;  4XO0 A;  2I1R A;  2L9W A;  4X4N A;  2QA4 S;  1R6Y A;  1H38 A;  3L7O A;  4LVN P;  1KSP A;  3QZ7 A;  4MAK A;  2VOO A;  3MEE B;  3CB4 A;  4O3R A;  1T3N A;  5K14 B;  2G2Z A;  2MY8 A;  5A8W A;  3DM2 B;  4OV1 A;  2GIQ A;  2DO4 A;  2KXF A;  3CUN A;  2CPF A;  2Z2Z A;  1M5S A;  1N5Y B;  4EGL A;  5J2M A;  5B0C A;  4ILM A;  3EDR B;  2WSE C;  1HBO A;  4RNO A;  5LM7 E;  3AY0 A;  4XIU A;  2FZC B;  1X4F A;  1C4A A;  4KH0 B;  5HQL A;  3L95 X;  1N32 F;  1WI6 A;  4QU6 A;  4F25 A;  1UFL A;  4W4M A;  4HDH A;  4LFC J;  1RDR A;  3SV4 A;  1EQ0 A;  1RHM B;  1H0H B;  2R7R A;  2RU3 A;  3CDA A;  3DHX A;  1F3V A;  3ETO A;  1HMV A;  3FUY A;  3U1M A;  2KFN A;  4EFA C;  1J5E F;  3HFK A;  5ETM A;  3A8I A;  3NOC A;  2BXJ A;  3C6T B;  2YWG A;  5SZT A;  1UA1 A;  4OX9 F;  1IBC B;  1H2U X;  1H98 A;  1WKK A;  4PPD A;  1UVM A;  1CEZ A;  2V8G A;  4B3O A;  2DH7 A;  1XMB A;  4OMF G;  2P6S A;  3D6H B;  5HP1 A;  2ASD A;  4X66 J;  1C0U A;  4F50 A;  4LRA A;  1DQA A;  1Q8L A;  1ZM2 A;  4H4O B;  4PWD A;  3FK4 A;  3M32 A;  2VC1 A;  4DL6 A;  4GVB B;  1I1G A;  4USI A;  1W7W A;  2UXD F;  2P9C A;  3OLB A;  2Z58 B;  4ICL A;  1T9U A;  4DDF A;  3IM9 A;  1R0A B;  5LOQ A;  5CZX A;  2UU9 F;  3MPY A;  3M2R B;  4DUY J;  3EWG A;  3BF4 A;  3R2C J;  3R5B A;  1HD0 A;  4URS A;  3G2X A;  4RUH A;  3BQ0 A;  3V6D B;  4UZC A;  3O3L A;  4Y34 A;  2CQP A;  1SQE A;  3PAC A;  1NDC A;  2GML A;  1B0P A;  1UKU A;  3HCX A;  1CJU B;  2MKK A;  1FTR A;  3NMR A;  2AX0 A;  2YH1 A;  3PHE A;  2V34 A;  4HH0 A;  3MFI A;  1VC0 A;  2CQ4 A;  2J7W A;  1IKV B;  4GKK J;  1LV5 A;  5KFV A;  2NXC A;  2H4W B;  2GS8 A;  1WC5 A;  3QAE A;  1KON A;  4WP8 A;  2OPS B;  3CJK A;  4AXJ A;  1PIE A;  5ETO A;  2JC1 A;  2YKP A;  4I2Q A;  4OJ1 A;  1YX2 A;  4CP5 A;  5BJR A;  5CXT A;  2R7V A;  4OYZ A;  2VFR A;  5LSL A;  1RAA B;  5F8H A;  4HH1 A;  2KVQ E;  1I5O B;  2AYE A;  2UVU A;  2HUR A;  3W3S A;  3SYZ A;  3JQM A;  3CED A;  3H2U B;  4IDK B;  1KEK A;  2AHO B;  4RBV A;  2XNR A;  4RW6 A;  1URR A;  3QZ8 A;  2HZC A;  2V2Z A;  1XER A;  2BV3 A;  2YPZ A;  4CLT A;  4OX7 A;  1RT5 B;  3EJM A;  3HMJ G;  4J9S A;  3UD4 P;  5KFS A;  1GX6 A;  4I6A A;  4LQ3 A;  4Q2M A;  2ZBI A;  4DFK A;  4RU2 A;  4GC6 A;  1M5K C;  4NRU A;  5ETK A;  1S1U A;  3T5K A;  3W5Z A;  3SZ2 A;  3ZTR A;  2J8A A;  1QSS A;  1SKU B;  4ED0 A;  1KOH A;  3PYD A;  1P8G A;  4ZP6 A;  4FYY B;  5E41 A;  3BYR A;  2ADC A;  3R1H A;  3PKY A;  1NJZ A;  2LFV A;  2VIH A;  4OLO A;  3MHY A;  4EO6 A;  1JJ2 R;  3NNA A;  1X5S A;  2ZWO A;  2LDI A;  1PSD A;  5RUB A;  3LAL A;  4F2S A;  2BE9 B;  4OZL A;  5IM0 A;  1AB8 A;  1N5T A;  2W2Q P;  3PNI A;  3VV2 B;  4CNZ A;  1UZD A;  4TYB A;  2OJ3 A;  1WD6 A;  3EGN A;  2B56 A;  5CZV A;  3QAU A;  5DDQ C;  1RTJ A;  3F41 A;  5LSO A;  5T7L B;  1NDP A;  5F41 A;  1RWN B;  4C3L A;  3NXZ A;  4OI0 A;  5GAD I;  1S0V A;  1IBM J;  4LR7 A;  3M4X A;  3EDQ B;  4TY9 A;  2OPP B;  3CD6 S;  5KFT A;  1HBM A;  1HBN B;  2IVF B;  1F0X A;  1TMJ A;  3M05 A;  2UUA J;  3J7Z 5;  1XBW A;  3HVT B;  2KYZ A;  2WB4 A;  4HAC A;  2HMI B;  2XMT A;  3OHB A;  5IWA J;  4UW2 A;  4WXO A;  4X4R A;  1KR4 A;  4DR4 J;  3BZQ A;  3OXL A;  2O67 A;  1BE4 A;  1WKL A;  2WK4 A;  1S48 A;  4KQZ A;  4JI5 F;  2YWW A;  3GFH A;  2KL8 A;  4X62 F;  2HEK A;  2IJN A;  4CLY A;  3TAM A;  4JV5 J;  3MAQ A;  1DRZ A;  2AZ1 A;  2GO8 A;  4NMX A;  1NK8 A;  1V3Z A;  5F0U A;  1XIQ A;  2CNO B;  3IGN A;  1N56 A;  1LKZ A;  4F0H A;  3PJW A;  2GX8 A;  3UN5 A;  1UWB B;  1ZH5 A;  1S7I A;  4LF4 J;  2R7S A;  5KFK A;  2AJ4 A;  1RWP B;  1URN A;  2DGO A;  2YQ3 A;  1VBX A;  1SUQ A;  4K5R A;  3VQS A;  4IG3 A;  4P9S A;  3L09 A;  1U48 A;  3JAM Y;  1DHM A;  1RT3 B;  3GR0 A;  3CJQ A;  3SIP B;  2RDD A;  2HHQ A;  1TL7 A;  2DH8 A;  2D1C A;  1JLB B;  3VZI A;  4F2R A;  1JJH A;  2RKI A;  2Z30 B;  1RP5 A;  4DSF A;  3MEG B;  3GCX P;  2ZH4 A;  2KT5 A;  4FF1 A;  1DAR A;  1QD1 A;  2IVY A;  2HND A;  3PR5 B;  2W8L A;  5M2U A;  3OT9 A;  2AJ2 A;  4C8M A;  1A0O B;  3CJS A;  1WEL A;  3CCR S;  2CJ9 A;  2R8H A;  1TL3 A;  2XSF A;  1T0T V;  2EK6 A;  3OFE A;  1KOO A;  4ES3 A;  2AJ0 A;  2V8V A;  4J9M A;  1IKW B;  2OAU A;  2XB2 D;  3OSP A;  1W25 A;  1BQX A;  2J0S D;  2CDQ A;  3N6L A;  3M9N B;  1N5V A;  4NXN F;  4NOH A;  2PMH A;  4IOC Q;  4EBC A;  5IV3 A;  4X4P A;  1XNR F;  2CAD A;  4QJV A;  1SH3 A;  1SV5 A;  2FUG 9;  4OJG A;  1WEZ A;  1BXN A;  4Y65 A;  4CH1 A;  1IKX B;  3OFF A;  2Y1I A;  2WVB A;  4LIW A;  3MMB A;  3EUN A;  1HHT P;  3PKM A;  4USW A;  4YME A;  2Y0B B;  2UP1 A;  1VK8 A;  3QWP A;  2JLG A;  2D7S A;  1UCN A;  4DUT A;  4FP9 A;  1YLX A;  1BD6 A;  2ASY A;  3AD7 C;  5A8K B;  3U1N A;  2BAB A;  2I5J B;  2MLX A;  4Q5V A;  4LF2 A;  4IFY A;  1QSY A;  4NA2 A;  3CCQ S;  4G1I A;  3QAT A;  1FI4 A;  3EIC A;  2U1A A;  4TY8 B;  1CG2 A;  1FRI A;  4F4K A;  3BGO P;  1TKZ A;  1RK8 A;  1ZPV A;  2XC9 A;  2GJF A;  4OZ5 A;  2F7V A;  3M30 A;  4FF3 A;  5JUM A;  1OY8 A;  1S9G B;  3QYY A;  5HMY A;  4NPO A;  2G0C A;  1OYE A;  2BJ3 A;  3OD2 A;  4J9L A;  4AND A;  4CDI A;  4JI2 J;  2CYY A;  2ZZT A;  2CQD A;  2PMZ D;  2E5I A;  2YNF A;  5FDL B;  1NK6 A;  4PXE A;  3AA9 A;  2EKY A;  2R7T A;  1RTD B;  4E2F B;  4F3O A;  2YKM B;  2PFD A;  2VG6 A;  4OZJ A;  2C3U A;  1LWE B;  1S1X A;  2RUG A;  2CRL A;  4G65 A;  2C2D A;  4WU3 A;  3G86 A;  3W7B A;  1LQ9 A;  3GLJ A;  5KAK A;  1FWK A;  2OI2 A;  3MPW A;  2DH9 A;  1Q53 A;  1CJT B;  4H4M B;  3EPG A;  2CJX B;  1HI0 P;  1RT7 B;  3ILO A;  2DPJ A;  2YNG B;  3S01 A;  1NUE A;  1Y3K A;  3CCL S;  3I5C A;  1VRU B;  2AEM A;  2XY7 A;  2AJF E;  3NWR A;  1CBK A;  4HKQ A;  3DLE B;  2BR0 A;  1S1W B;  1ROF A;  4G1Q A;  1YHQ S;  1FE4 A;  1RSC A;  1VQ6 S;  2A10 A;  3FRZ A;  2V8D A;  3KUE A;  3I0R B;  2OKQ A;  3AFG A;  4NAS A;  4TQR A;  3Q89 A;  1S99 A;  1NHK L;  1Y7P A;  2FJV A;  2CJQ A;  1JLF B;  1YRT A;  1TAQ A;  5HBM A;  1X4B A;  2AKW B;  1KD1 T;  1SCJ B;  3IS9 B;  2MQO A;  2HYI B;  1D8Z A;  2IRY A;  1S0M A;  2UUB J;  3CD5 A;  3IC1 A;  2AEF A;  4OI2 A;  2QFJ A;  3CDE A;  4A8Q A;  4RUB A;  4YHH F;  5GAH I;  4DV3 F;  3LW5 C;  4DV1 J;  4PUO B;  4ZVS B;  1YBA A;  2LU1 A;  1N5Q A;  1NH8 A;  3QFH A;  4M5K A;  5CD4 H;  3G6Y A;  4DR6 J;  4DOZ A;  3AD8 C;  4WTY A;  2AJ1 A;  3NGT A;  5HAT A;  4LFB F;  5F3Z A;  4FS1 A;  1Q1K A;  1JLC A;  4QZV B;  2ZVI A;  2HNY A;  2HGL A;  1WAC A;  4X4V A;  4X4U A;  2YTC A;  1Q78 A;  4U96 A;  4DSE A;  5ETS A;  5IQQ A;  4CLU A;  4JI7 J;  1GMW A;  2WVF A;  3H42 A;  5GMD A;  2LA6 A;  1BMQ B;  1FVQ A;  3LUY A;  4DR3 F;  5KFE A;  1X0F A;  4P72 A;  1UET A;  2JLE A;  2JEJ A;  1E6V A;  2YWH A;  4ZP9 A;  3UD5 A;  4I7F B;  4RW9 B;  4LFC F;  3OVS A;  5HJX A;  3T1A A;  2WON B;  3W1Y C;  3H5U A;  2MQL A;  1N33 F;  2RRA A;  1HNV B;  1Y9O A;  4YN3 B;  1RAD B;  2E7X A;  1SIZ A;  2VON A;  1Y5N B;  4CO0 A;  3MR7 A;  4OZ2 A;  4HVZ A;  4IG0 A;  4KPC A;  2RD5 C;  1YTY A;  5H9E K;  2K8G A;  3CMQ A;  4I1T A;  2BAN A;  2NPF A;  3QJJ A;  2QSF A;  2ZH9 A;  1HR0 F;  1JXE A;  2G2Y A;  3K2Y A;  1N54 B;  1XR5 A;  1N34 F;  3KNG A;  3QT8 A;  4A8Y A;  1XJW B;  3V6H A;  4WYL A;  3FC9 A;  1S76 D;  2E9T A;  2EPI A;  4K0K F;  1MG7 A;  1U4B A;  5I3P A;  2LEC A;  2VFU A;  4JI6 J;  2QLJ B;  2MZT A;  3TZX A;  5H1S V;  2ZJR Q;  4QIV A;  4NLV A;  1XC9 A;  2GHW A;  2CQC A;  1L5U A;  4A47 A;  2GVD A;  1Q5V A;  1JLE A;  2H51 B;  2UUT A;  4O3Q A;  3A8J A;  2W9B B;  2HW3 A;  3B82 A;  1X31 C;  3CNQ P;  3HSG A;  2KU7 A;  2J7K A;  2JL9 A;  4F0K A;  2E5L F;  3E01 A;  2GV1 A;  1YWX A;  1S1V B;  1VQL S;  4FDF A;  1S79 A;  1QM9 A;  2E9Z A;  3MEC B;  4NML A;  3IWN C;  4JBC A;  1J5O B;  3UW1 A;  3GJQ B;  4DU7 A;  1MU2 A;  1FFW B;  1MLA A;  4U8V A;  3HSZ A;  3DNC A;  4ZVR B;  4RR5 A;  5KFC A;  2NR0 A;  2PFF B;  1FRX A;  4GKK F;  1WG1 A;  3ISZ A;  3W66 A;  4P6Q A;  4P10 A;  5I4M A;  2B4P A;  2GAG C;  1X9W A;  2ZZM A;  2AGQ A;  1SQF A;  1KC8 T;  3NGD A;  2CPZ A;  3J80 U;  2GQC A;  2HBQ B;  4J9V A;  2RF2 A;  3AD9 C;  2AYB A;  1ZM3 A;  2E5G A;  1NBE B;  1FK9 B;  4ZLN A;  5AE1 A;  2ZJQ Q;  1C1C B;  4LQ9 A;  2UXB J;  3G87 A;  2FJB B;  4M5N A;  1KQK A;  3MM6 A;  2FYX A;  5M2R A;  2LA4 A;  4DLG A;  3V6J A;  3M8S A;  3KHL A;  2RIJ A;  1FWP A;  4ECY A;  3GE9 A;  2H5E A;  1OJ4 A;  5JVH Q;  2VB6 A;  4LSL A;  5B09 A;  4OYP A;  3TRG A;  2VC0 A;  1LK5 A;  1HWL A;  3I0S B;  3W9H A;  4JI8 J;  2OFH X;  2DBB A;  4KJI A;  4IYQ A;  1N5S A;  3R8Y A;  2Z2L A;  4Y2C A;  1WJ9 A;  4DU8 A;  4CWB A;  1HFE L;  3H5X A;  3EMT A;  4LFA F;  1U25 A;  4NCB A;  3G6V A;  4DPW A;  3ETM A;  4Q7A A;  1HHS A;  1JNZ B;  2KDO A;  3FRY A;  2OMO A;  1KLM B;  2JVO A;  2F8H A;  2KB2 A;  4GMK A;  5E3R A;  3B4M A;  2HZV A;  2DR6 A;  2XZT B;  4USM A;  2W2M P;  4QWD A;  4C6A A;  4JV0 A;  4Q44 A;  3Q8P B;  3MMA B;  2VA2 A;  1ZA1 B;  2LEA A;  5HO4 A;  5AJ3 J;  4DR1 F;  4RW4 A;  4EMD A;  6FDR A;  3A3N B;  4RX6 A;  5GMK a;  3G9C A;  3ITH B;  4C98 A;  3HP6 A;  1TUG B;  3R27 A;  2V2V A;  4F4X A;  1RHJ B;  5D78 A;  3O6Q A;  5A8W B;  3KDN A;  5D8H B;  2COL A;  3GR1 A;  4HTJ A;  1CQM A;  3LP2 A;  5CYQ A;  4NEZ A;  5KFM A;  1XMO F;  3HJV A;  1IR0 A;  1QTM A;  1N8R T;  2ROG A;  4B3S J;  4TU8 A;  2FHJ D;  2I9S A;  1HBO B;  1JLG A;  1F5A A;  4YFU A;  1BGX T;  4QIW D;  4NA3 A;  1IN0 A;  1Y3J A;  3CCJ S;  4C8K A;  4ZCL A;  2HIQ A;  2FHO B;  2BX6 A;  2F1F A;  2IJR A;  1FER A;  1OPI A;  2EFQ A;  4ZIV A;  1IVZ A;  4YS2 A;  4Y28 C;  4E0D A;  2XMV A;  4ZJQ A;  3EGZ A;  1ZZN A;  3MWB A;  3U1L A;  5LMU J;  4KV8 A;  1FNM A;  3SCL E;  2W4P A;  1SKW A;  4ERD A;  4KHP J;  4ZVQ B;  3BPS P;  5ITH A;  3DRR A;  1YJV A;  2XYH B;  5ETQ A;  1T03 A;  1CQN A;  1ZA2 B;  4TN2 A;  2BA9 A;  1CPZ A;  2NSB A;  4OX6 A;  2AMC B;  3K59 A;  3HKW A;  5HQ8 A;  5HRO A;  1WEX A;  1ZOT A;  2M52 A;  2QMW A;  1U0S A;  2CVI A;  3OTO F;  4B3O B;  2XZD B;  4HDG A;  3T5L A;  1HL6 A;  2H5I B;  4CT9 A;  4Q43 A;  1KLN A;  4QWE A;  4N77 A;  3N6N A;  3B78 A;  3E51 A;  1NSA A;  4PWD B;  3VAF A;  1TL5 A;  3M32 B;  3MM7 B;  4NYP A;  2K3K A;  4LT6 A;  2JSX A;  5KOW A;  2FB0 A;  2RQM A;  4FYV B;  1OWX A;  4ZVG A;  2ZOM A;  3C2P A;  2K1R B;  3ENA A;  2FIU A;  3DYA B;  2IAJ A;  3MD3 A;  3PVX A;  1F6T A;  4F36 A;  3OXF A;  3FKB A;  3R3T A;  5HLF A;  1IUJ A;  2V6A A;  3W8G A;  4K50 A;  4USV A;  5IV4 A;  2ZZN A;  3ENV A;  5KFD A;  3KKF A;  2FY8 A;  2FZK B;  5FLX Y;  3P96 A;  1FX4 A;  3ILI A;  1MML A;  2MQP A;  1F9F A;  5D4P A;  1ELO A;  4CLL A;  1YZ7 A;  1X8D A;  2F3J A;  3EVM A;  4CM2 A;  2KKH A;  3TAQ A;  1SC6 A;  4V19 J;  4QYZ K;  3CCU S;  4DX5 A;  4TNO A;  2K06 A;  2HQC A;  4X64 F;  4F04 B;  3IAS 9;  5K8N A;  3RRH A;  4PAA A;  3VAG A;  4UOG A;  1CUL B;  4UUW A;  1VQ4 S;  3T1Y J;  5GME A;  1NK7 A;  3A3O B;  3D6F B;  3DCA A;  2VQE F;  2IYG A;  3LP0 A;  3MGJ A;  1N5Y A;  4JYA J;  4C8Y A;  4YOE A;  3T6J A;  1NPR A;  3SI8 A;  3CDU A;  4LF8 J;  2P5V A;  4U7C A;  3RB3 A;  3IR7 B;  2MDA A;  4FF2 A;  1RBO B;  4J9N A;  4K8R A;  4WXW A;  4EO8 A;  2ZEJ A;  2Z56 B;  1QAX A;  2MHN A;  1S57 A;  2IA6 A;  1F9E B;  5U47 A;  2K3I A;  1PCA A;  4CT8 A;  2H9Z A;  4FYX B;  4ZPC A;  1S10 A;  1HNW J;  4V19 X;  2BQ3 A;  1U2R A;  2LQB A;  4RW8 B;  3AOB A;  3BB5 A;  3S1T A;  3IBC B;  2MY7 A;  2MQM A;  1FFG B;  3BSC A;  1S1U B;  2DR9 A;  3NKY A;  2HQI A;  4JUZ A;  1KVI A;  1OS5 A;  1R8B A;  2KFZ A;  3ZC4 A;  1M5O C;  4Y0F A;  2RHQ B;  1KQF B;  2XGP A;  4KHM A;  4EYH B;  4Q45 A;  4GVL A;  2OEJ A;  4ALZ A;  4H4O A;  2Q1L A;  3TWZ A;  4NWB A;  1B99 A;  1ARO P;  3LOU A;  1TVR A;  5IM0 B;  4GVB A;  1RWM B;  5IFM A;  4DX6 A;  1WUU A;  4OZN A;  2RNE A;  4IR1 A;  3HVW A;  3ZZR A;  3IRX B;  2Y1R I;  4RNM A;  3C46 A;  2ASL A;  1PG5 B;  1R0A A;  3H2L A;  4AQY J;  5JXS A;  4ID5 A;  4DQI A;  3M2R A;  2GZO A;  2DXF A;  4LBH A;  1X9M A;  1PYO B;  1UPP A;  1WOO A;  5ETT A;  3PFE A;  4BLG A;  4OYX A;  1SBR A;  2AW0 A;  1VRT B;  3V6D A;  4KKO B;  4PG4 A;  5IXU A;  3WDO A;  3JAM U;  4HAC B;  2IY5 B;  2DCU B;  1VLY A;  4DV4 F;  4ZVT B;  3ZNU A;  5AXM A;  2GAH C;  4W92 B;  3K89 A;  4RBU A;  2CVE A;  1IKV A;  1NXI A;  4DXL A;  2XYG B;  2O66 A;  4WZM A;  3BPD A;  3D68 A;  3QT5 A;  4QWA A;  4O4R A;  1YJU A;  3QT7 A;  4P7V A;  4C0B A;  2KHC A;  2IRX A;  2OPS A;  3TAM B;  2HAF A;  5KFX A;  1R31 A;  4DN0 A;  1IBL J;  3R2D J;  4MIW A;  5CH7 B;  1CC7 A;  2R9L A;  4EI2 A;  3EVW A;  4LF9 F;  1U1P A;  3DU5 A;  3EE3 A;  4OI3 A;  2O5D A;  2EFO A;  3KMS A;  3MAH A;  3W9J A;  2IM1 A;  4DQP A;  1YSJ A;  2BE2 A;  2G0J A;  1FRJ A;  1VI7 A;  1GXL A;  4P75 A;  2HHT A;  3SSQ A;  3D3C J;  5JVG Q;  2C2K B;  1TTH B;  3CGI A;  2W8K A;  1ZZF A;  4FVC A;  4I4B A;  3GPA A;  3C66 A;  3BEG B;  4HHH A;  1RT5 A;  2HHX A;  1GNK A;  4P2S A;  1KVK A;  4NLQ A;  3G8Q A;  1TL7 B;  4OZ1 A;  3DMJ B;  1RZM A;  2QE5 A;  2ZH2 A;  1HIY A;  2DNM A;  3MM5 A;  4ZP7 A;  3LP1 B;  2DO0 A;  3KJV B;  3U02 A;  2F65 A;  1AXQ A;  3Q2S C;  2HND B;  2MLY A;  1JJ4 A;  1G7C B;  3FBF A;  5KFI A;  2NS1 B;  5KFF A;  2W2O P;  1Q0N A;  1SI9 A;  3A8K A;  5EUH A;  3L7U A;  2IJF A;  1H7X A;  4O4G B;  1RGV A;  1TL3 B;  1KS2 A;  3AJ1 A;  2KHD A;  2FTR A;  1FXL A;  2EKN A;  1BHN A;  4PYA A;  1SC3 B;  4U9R A;  5A0Y B;  4B3R F;  2H65 B;  2Q79 A;  1AA1 B;  4UOH A;  5GAE I;  3UDC A;  4Y2M A;  5E5N A;  1HNX J;  2SXL A;  1ZS6 A;  3DRX A;  2OPP A;  3CME S;  5B0G A;  4TYA A;  1UVL A;  3DLG B;  2DVI A;  2DHA A;  1QTN B;  3HVT A;  2UVW A;  1FA0 A;  2J5A A;  3ZTQ A;  2AT1 B;  3JSB A;  3ENW A;  1A7G E;  2HMI A;  3DOL A;  3SQO P;  1BQN B;  3TAR A;  5C25 B;  1SV5 B;  3OV7 A;  3PJ9 A;  1YBU A;  5E3P A;  3AXM A;  3HM9 A;  1VQP S;  1U47 A;  3IRW P;  2NZ4 A;  4DR7 F;  1KN6 A;  2QZ8 A;  3MMB B;  2R2T A;  2W24 A;  2E9R X;  2KFY A;  3QQC D;  4C3M A;  4KAI A;  5KFL A;  3DOM A;  2CQG A;  1NSK L;  2K2P A;  2CQB A;  2CZV C;  3PYE A;  6FD1 A;  2X51 A;  3N4W A;  3QGP A;  4ZCM A;  2BUN A;  4JI1 J;  2F4V J;  4O3S A;  2KT2 A;  3V5R A;  1KWM A;  2YQ0 A;  1UWB A;  3VAJ A;  4HYK A;  3DLJ A;  3BN4 A;  1S6P A;  4LBP A;  3VF0 B;  2UZA A;  1Y0H A;  3SFU A;  2C2Z B;  1TKZ B;  1EZZ B;  4B9U A;  2A18 A;  4NE9 C;  4QIG A;  1S77 D;  5E3A A;  4KFB B;  5LSR A;  1RT3 A;  4EUV A;  5J2Q B;  2V5H G;  5KFG A;  5KFJ A;  5IT9 Y;  4M5H A;  3Q83 A;  4Z7Y A;  5LXR A;  3G8T A;  1DZ5 A;  3PDN A;  4IRK A;  2IYI A;  3N9U C;  2NCK L;  2W4C A;  2YNF B;  4LMZ A;  1FTC A;  3OLA A;  4R25 A;  4DUZ F;  4NXM J;  1YJN S;  4DWI A;  3JSM A;  1QE1 A;  2HHS A;  4CRJ A;  2VG6 B;  5FJ4 A;  5MLC V;  3OR2 A;  1UJ6 A;  4DL7 A;  7FD1 A;  3ZTO A;  4RW7 A;  3SEO A;  2ZH3 A;  3ZFV A;  5EX3 A;  2VOP A;  1RWU A;  4J37 A;  3CJR A;  2ERR A;  4LRD A;  3WX4 A;  2M8D B;  2J9D A;  1JWW A;  3QLH B;  1SXL A;  3CO9 A;  3M9O B;  5B0D A;  3U27 A;  3NCQ A;  4J5O A;  2GC8 A;  4FNI A;  4DQS A;  1RU1 A;  3ISN D;  3OL8 A;  1LW2 B;  1VQK S;  5DO2 A;  1AUS L;  2MZ1 A;  2N7C A;  3HVA A;  2HG4 A;  4ZPB A;  3HFZ B;  4ED2 A;  2OSQ A;  1IKW A;  2JDJ A;  1E6Y A;  3KUG A;  1S6Q B;  1CJV B;  4WP9 A;  4RZR A;  4JI8 F;  2JZ5 A;  2KTQ A;  5J1E A;  3OFG A;  1V3R A;  3AQO A;  2WBM A;  2FJW A;  1UW9 A;  1IR2 A;  1PGZ A;  3P49 B;  3D6M B;  5HBM B;  1WOS A;  3EGW B;  1VQ5 S;  1IKX A;  4L3N A;  1BUX A;  1N6Q A;  4XPE A;  1PAE X;  2HVH A;  4Q2L A;  2RVJ A;  3BKU A;  3DRS B;  3FEY B;  3JYT A;  3I6P A;  3PX0 A;  3KTQ A;  1FRL A;  1H6K X;  3OR1 A;  5F3T A;  5CAA A;  2LDY A;  2F5G A;  2N3L A;  4OYW A;  2CNK B;  2I5J A;  1WC1 A;  3E8O A;  1MMN A;  4ED8 A;  4I64 A;  5SUH A;  3DRP A;  3I56 S;  1Q82 T;  1S6U A;  4TY8 A;  4DSI A;  4MKY A;  3EM1 A;  5T41 A;  1NK5 A;  3BQ1 A;  4IQX A;  2AGO A;  3CJ2 A;  2VZ9 A;  1S9G A;  3MM8 B;  5T14 A;  2F8E X;  5DDR C;  4MIA A;  8RUC A;  3QO9 B;  2E66 A;  2FVS A;  3K8W A;  4NLW A;  5D77 A;  2MHE A;  5DQG A;  2VAS A;  3NGS A;  1RTD A;  2YKM A;  5CYM A;  2VBW A;  1RLD A;  3HX9 A;  1LWE A;  4OV6 A;  3BV8 A;  3DKD A;  3PG9 A;  1GK8 A;  4DV2 F;  2ZHO A;  1K47 A;  3J81 Y;  3GU0 A;  5C2C A;  2ZJP Q;  3QRQ A;  5I3U B;  5L9X A;  1NJW A;  3TX8 A;  2LQ9 A;  4IRC A;  2YX7 A;  1YIT S;  1TKX A;  1ZTW A;  1YJT A;  1RT7 A;  4LF7 J;  1NPK A;  3SV3 A;  1HI1 A;  3ZZT A;  2OO4 A;  1Q81 T;  3ET6 B;  4ZPA A;  4QR2 A;  4NLO A;  4PRF A;  3KG0 A;  2H4Y B;  5A6W A;  3UNG C;  2LQ8 A;  4QIE A;  1S1W A;  3MMC A;  1S9E A;  3ICL A;  1U1M A;  1JLE B;  1CSJ A;  3K58 A;  3R5G A;  1VR6 A;  1LFP A;  1KP6 A;  4KHR A;  4MKB A;  3GFZ A;  3QRR A;  2PI4 A;  3I0R A;  3K5O A;  4ANC A;  1NM2 A;  3FEX B;  3E01 B;  3Q86 A;  2XI3 A;  3H5Y A;  4UY8 5;  1HHQ A;  4ES2 A;  5C7P A;  3IS9 A;  2E5H A;  1B7F A;  3GG0 A;  3W9I A;  3BGL A;  2VOD A;  1VJQ A;  5LL6 d;  2LU2 A;  3N28 A;  1O8B A;  3G96 A;  2IM2 A;  4K2X A;  3W62 A;  2EI5 A;  2W9C A;  1F9H A;  4BS2 A;  1RBA A;  3DGV A;  4GRS A;  1FRH A;  4XAK A;  3QGI A;  4ILL A;  5IS2 A;  3THT A;  4N8O A;  1IBK F;  2FGC A;  3HF5 A;  1BY9 A;  1R8C A;  2RF2 B;  3HFV A;  2XGQ A;  2VPX B;  3D5M A;  1RBL A;  2ZWP A;  4DLE A;  2Y9H A;  3THP A;  1L3V A;  1Z2L A;  4JYA F;  1GMW D;  3LF0 A;  4ECW A;  4C0O C;  3FZB A;  4A4J A;  3K5M A;  4OHY A;  2YNH B;  5HVG A;  1WC0 A;  2Q6B A;  4P73 A;  3MM6 B;  1SL1 A;  2YKA A;  1LFW A;  1RT6 B;  4IH6 A;  1VOM A;  5LXY A;  4PWW A;  4ZPD A;  1T05 B;  1RYS A;  4J9K A;  1LEO A;  4LF5 F;  2J7U A;  4LSL B;  1JLA B;  2HQD A;  4RW9 A;  2PI5 A;  1U09 A;  4N8N A;  2WON A;  3MR6 A;  2D9P A;  3CXC R;  1FE0 A;  4W90 B;  1PO6 A;  3T41 A;  2CG8 A;  1T8E A;  1Q5Y A;  4XPC A;  3FBE A;  3M8P A;  3TZW A;  2ZH7 A;  1WSV A;  2HGM A;  3P5T L;  3UFC X;  1R7I A;  2QRR A;  2G13 A;  4DPY A;  2E29 A;  4KSE B;  4FNH A;  2FHK A;  3GV8 B;  2V94 A;  5L1K A;  1PJ6 A;  1SJ3 P;  2N4C A;  2BM1 A;  3TA0 A;  2RE1 A;  1MSW D;  2EG1 A;  3A3P B;  4OHZ A;  4X2B A;  1WF0 A;  5KG7 A;  2CJK A;  4DPX A;  5DG8 A;  3D1Q A;  2ZDO A;  3NGU A;  2HRY A;  1V5V A;  5BYQ A;  2AD9 A;  1RHQ B;  4JI4 J;  1UFK A;  2AP6 A;  4GKJ F;  3S6E A;  3HT0 A;  3KLE B;  3CMA S;  4DV5 J;  3PX4 A;  2VA3 A;  3B6B A;  4RJV A;  5D3G B;  2V2Q A;  2I6W A;  3NCP A;  2IVM A;  3GJR B;  2HZA A;  5CYQ B;  3B54 A;  5J2N A;  3CJ5 A;  1S1V A;  3O2I A;  2XMU A;  1U1Q A;  3CJ4 A;  4Q8E A;  3L4B C;  3NS5 A;  1RTZ A;  1JLG B;  5LMN F;  1J5O A;  3K7R A;  1ZAX A;  4QIF A;  3CC2 S;  2VV5 A;  3QWU A;  4G3I A;  1YJW S;  3Q8S B;  4F67 A;  1KQS R;  4ZCI A;  4A46 A;  4KV8 B;  4DL4 A;  5D0G A;  2NYI A;  3VVT A;  4DF8 A;  4PWU A;  3BO2 A;  3IA0 A;  2KH9 A;  2ZFH A;  2HGN A;  4Q8F A;  2CG4 A;  2RML A;  3DRR B;  4OYA A;  1U24 A;  2QA2 A;  1T03 B;  3CF5 Q;  1FK9 A;  1IBL F;  2P2C B;  4K4V A;  2XUL A;  1UW4 A;  1C1C A;  2ZC3 A;  3A1Y G;  4ZVF A;  3K57 A;  5KG2 A;  2W7P A;  3Q24 A;  2QX0 A;  3OXG A;  2Z2M A;  5DQH A;  2C42 A;  1YJ7 A;  2JWN A;  4WU2 A;  1AFI A;  1GXT A;  2R8I A;  2BJ7 A;  3VGT A;  3ONQ A;  4WII A;  2HVE A;  1X4G A;  4FBT A;  1D3W A;  5LJ5 Y;  4EU0 A;  3S8S A;  5KFN A;  3SDE A;  5DRK A;  4NLP A;  2FGO A;  4TKT A;  3C8Y A;  1M90 T;  2MQN A;  1KLM A;  3HXM A;  4DR5 J;  2MKY A;  2RRB A;  3BR8 A;  2Z0G A;  2GW8 A;  2HHH F;  2KJV A;  4N7T A;  4PG6 A;  1ZTT A;  4OYB A;  2FJE B;  4C48 A;  1JK9 B;  3N79 A;  1B0V A;  3MMA A;  2VQF J;  1FRK A;  1CS4 B;  2HS0 A;  2W2N P;  2KJW A;  2DHS A;  2XSJ A;  5C24 B;  1YBT A;  4F3M A;  2HWH A;  3ITH A;  4AD6 A;  3AJD A;  2V0N A;  5EHH A;  4JI0 J;  3BO4 A;  4N76 A;  3PIP Q;  2W1B A;  3MAA A;  2ZM6 F;  3LWM A;  4DS5 A;  2BJD A;  2AIR B;  3TJ8 A;  1JNR B;  3LP0 B;  1VBY A;  2ATC B;  2WOM A;  4J9Q A;  1Y4Z B;  4FYW B;  4RO0 A;  1NB7 A;  2N4D A;  4B3M J;  3PR4 A;  1M1H A;  1D9A A;  2DIU A;  4AL6 A;  2IBK A;  4DL2 A;  2BW7 A;  2MYF A;  2RDJ A;  3QPI A;  5HL7 Q;  2HK2 A;  3C16 A;  3UDE A;  4A8X A;  2HS4 A;  2JHE A;  4WFZ A;  2ROP A;  4I67 A;  1T9T A;  4E8U A;  3I96 A;  2ZH5 A;  1ZM9 A;  3T19 A;  2LLZ A;  4JV2 A;  4LRE A;  2FJA B;  1NHV A;  2B43 A;  1W2B R;  3KLG A;  3I9Z A;  1S6O A;  3J81 j;  3WZ0 A;  1WNE A;  1U2F A;  4ZA1 A;  4RNH A;  3WHI A;  4NCG A;  4USJ C;  1SJR A;  3G82 A;  3RJM B;  5L1I A;  3JXO A;  3X3U A;  2NXE A;  1WKJ A;  2GO9 A;  4LVO P;  4UTG A;  2RS8 A;  1K0T A;  4WYW A;  2ZBQ A;  4ECQ A;  1HA1 A;  4NLR A;  2HAI A;  3GIR A;  2H1Y A;  4ZVP B;  2YX4 A;  2UXC J;  2H48 B;  3VAH A;  2MQQ A;  1EHW A;  3MI7 X;  2IMO A;  3A12 A;  3RRK A;  1TFY A;  5KFH A;  2LKZ A;  4YB1 P;  4LRC A;  1LK7 A;  2VPZ B;  3TZY A;  2APO A;  5DJB A;  3HO1 A;  4WK1 A;  5KT4 A;  1U26 A;  1B70 B;  2MKH A;  3L7P A;  2A3J A;  1TVR B;  3MM7 A;  5HAN A;  1JXV A;  1HNZ J;  3G6E S;  2GFF A;  4M1K A;  2XS5 A;  3ZZY A;  3F56 A;  2KRR A;  4F4Z A;  1TKD A;  1DBD A;  2GIR A;  1HWI A;  3RBZ A;  2YWF A;  3PHT A;  2K1R A;  4OX8 A;  3DYA A;  1FEE A;  4ID5 B;  1R8H A;  4N5S A;  3CDW A;  1Y5L B;  4NXM F;  1FNX H;  3I4H X;  3PRB A;  2ZHA A;  1QAJ A;  1WTB A;  1U0H A;  3NNH A;  1QJH A;  4MYT A;  2OPQ A;  2VU5 A;  4CNY A;  4K4U A;  3TQ1 A;  1X5T A;  3W63 A;  1XEZ A;  4NLG A;  2GQ2 A;  1N0U A;  2HFN A;  4CO3 A;  3V81 A;  1P6T A;  3CCT A;  3C15 A;  1K44 A;  3GSI A;  1NLK L;  1B4S A;  4J7C A;  1S97 A;  1FKA F;  1CUL A;  1W2I A;  4M5G A;  1HNI A;  2Y8W A;  3BBC A;  4H4K C;  5B0B A;  1N32 J;  1EP4 B;  4LUB A;  5F8L A;  1I94 J;  3OTD A;  1RAB B;  3WX8 A;  4Z2X A;  3PFO A;  2ILZ A;  3TNV A;  1VQN S;  5DZ6 A;  5K9F A;  2C3Y A;  3KFW X;  1DUR A;  4IOB A;  2BKO A;  3WIV A;  3NS6 A;  4EK2 A;  4DL0 C;  2DNK A;  3P4U B;  1J5E J;  3OHA A;  5K5M A;  2BE2 B;  3PEJ A;  4DHV A;  3RBD A;  5HQM A;  3TX0 A;  1K1Q A;  4OX9 J;  2KT3 A;  1IM4 A;  1VLO A;  3R5D A;  5KT3 A;  3OQ2 A;  1KQG B;  5KFA A;  2FHM A;  2QIF A;  3EGV A;  1S5Z A;  2B5J A;  1KHW A;  5GAE U;  1IKY A;  3TJ9 A;  2HQF A;  3D67 A;  3CCV S;  2CWX A;  2XS7 A;  4HT7 A;  3HHE A;  1WHX A;  1WOR A;  4RW8 A;  3CIZ A;  4FVM A;  1DFD A;  2XI2 A;  3MM5 B;  4FZV A;  1OSD A;  4KR0 B;  2G9O A;  1YK9 A;  2KXH A;  2UXD J;  5F8I A;  4RWW A;  2EBE A;  4GC7 A;  4P2M A;  3MUT P;  3EZ5 A;  2RH3 A;  1BQM A;  3GIJ A;  2ACM A;  3M8Q B;  1S9F A;  2VF3 A;  4DV0 F;  2UU9 J;  4C8L A;  2M7S A;  1SIW B;  2WSC C;  2DGS A;  2QFI A;  2KI2 A;  3KG1 A;  4L75 A;  2F9D A;  2VH7 A;  4A48 A;  3EXY A;  3H40 A;  3DLK A;  3D9B A;  4K59 A;  3UN2 A;  1M5H A;  4QYR A;  1U02 A;  4M5I A;  1LWX A;  3RW6 A;  3IRX A;  2XMK A;  3T9Z A;  4K4X A;  1M5P C;  2XWX A;  5ETV A;  1FDN A;  4C4W A;  2FVQ A;  1T9W A;  5F8N A;  1VRT A;  3EVO A;  4KKO A;  2WZ1 A;  5B7W A;  2M88 A;  4MKA A;  4ZOS A;  2B3T B;  2PSZ A;  1IWG A;  1PIL A;  2JOQ A;  1SQG A;  3AHP A;  5KG6 A;  2R7W A;  3DOL B;  4WFY A;  5DS7 A;  2DIV A;  5HI7 A;  5B0A A;  5IT9 U;  3A4T A;  3IBW A;  1FWL A;  4NLT A;  2RIL A;  1M1K T;  1TFW A;  3ILJ A;  4F8R A;  1M0S A;  2IHR 1;  4OYO A;  5HJY A;  1GTE A;  2N7Y A;  3M1V B;  3O1L A;  3DOM B;  4YEA A;  1VQ7 S;  2ZE2 B;  2YWE A;  2BMB A;  3K8V A;  1S4E A;  3KJQ B;  1AW0 A;  4U6P A;  4N56 A;  4I0W A;  5CHC B;  3V6K A;  3RB0 A;  5GAG I;  6AT1 B;  1S6P B;  2YX1 A;  5KT2 A;  3IM8 A;  2KM8 C;  3RAQ A;  1KTV A;  3T1H J;  3Q8U A;  2RB7 A;  2QO3 A;  5KG0 A;  2KYX A;  4L6V 3;  2MGZ B;  1U1K A;  1U6F A;  3BH6 B;  1VFJ A;  3OJS A;  2ZNY A;  2W2P P;  3I4P A;  5AT1 B;  4WKR A;  2KG0 A;  2VBX A;  1RLC L;  4LRF A;  1NH7 A;  4TQS A;  3DMJ A;  3CCM S;  4DCP B;  1OIA A;  1VQO S;  3MD1 A;  1CC8 A;  1GTH A;  5AXN A;  3JSM B;  3UE2 A;  1QE1 B;  1NB2 A;  3LP1 A;  4DPO A;  2DNG A;  3PW0 A;  3OR2 B;  1QAY A;  2JRS A;  3GYG A;  3KJV A;  4RW7 B;  1FKO B;  1YG0 A;  4R0E A;  4LF6 F;  3GCW P;  3ULH A;  1HQE A;  1C1B B;  2BOA A;  4QR0 A;  3TUP A;  4CYU B;  4ZPV R;  2LEB A;  1YQH A;  4O4G A;  3POT B;  1T9Y A;  3FCW A;  4OHV A;  1TAU A;  2HFO A;  4D3H A;  1XNQ F;  3AH6 A;  4UZB A;  1FFS B;  1VCT A;  4CLW A;  2ZUG A;  3M9M B;  3OBI A;  3RR8 A;  3T5J A;  1UEV A;  3HKZ D;  2BJ1 A;  1N36 F;  5A0Y A;  4ED3 A;  4NLD A;  1RYR A;  5BR8 F;  5K8O A;  4WK3 A;  1E6Y B;  4CZC A;  1FJE B;  4CI0 B;  2RQK A;  4LIR A;  2D3Z A;  1MWY A;  4GO5 X;  2NUH A;  1RQ0 A;  5J1E B;  1OYD A;  3DLG A;  2ZH1 A;  4K4S A;  4ZVE A;  2LQJ A;  4UY8 T;  3DDN A;  2V2K A;  4JI5 J;  5THW A;  4X62 J;  1ZAV A;  1FDA A;  3FQK A;  4BWM A;  3BDP A;  1VQS A;  1VHI A;  1FJG F;  3FEZ A;  1BQN A;  2DTJ A;  2POK A;  1WF1 A;  3N5B A;  5C25 A;  1OQ3 A;  2XO6 A;  1JJC B;  4U95 A;  1V6H A;  1EIY B;  1YKW A;  1N6Q B;  5BYS A;  2P9E A;  5FII A;  2B51 A;  3UCG A;  1D9D A;  3JYT B;  3NL0 A;  2H3E B;  2ZVS A;  3DC2 A;  3OR1 B;  4B08 A;  4DV6 F;  3HPO A;  4K4Z A;  3DGP A;  1RWX B;  2JX2 A;  2ZBP A;  5EWF A;  4OJ3 A;  1TQL A;  2V4J A;  2KZZ A;  3DRP B;  5H9F J;  3C6U A;  3WBZ A;  4TLR A;  4WPA A;  1ULR A;  2DNH A;  3G8S A;  4QW8 A;  2HK3 A;  5IZH A;  3FSY A;  4IKA A;  4C8Z A;  3MMJ A;  4KFB A;  2WCX A;  3KNA A;  1YRX A;  5J2Q A;  2C3M A;  5KG4 A;  3VAK A;  2MLZ A;  1T7P A;  2HBZ B;  1WSR A;  5AE3 A;  4CH7 A;  2KM8 B;  4B3T F;  3I55 S;  3MUV P;  4JI3 F;  3WC0 A;  1HKA A;  2W7A A;  2DR8 A;  1MMD A;  4C11 A;  3HHD A;  4I6W A;  3D3B J;  2FJD B;  4DI6 A;  2I38 A;  5CYM B;  1RCO B;  3NMA A;  2HPU A;  5DG7 A;  4JP8 A;  4Y2I A;  3RGI A;  3R97 A;  2MPU A;  4OYM A;  4F0M A;  3UPF A;  3BQ2 A;  3NRB A;  2DKO B;  2IA0 A;  3OTE A;  1EET A;  4WFA Q;  1ZBT A;  4MMO A;  4J9P A;  3MR5 A;  2QL9 B;  1QLN A;  2R8J A;  3H25 A;  1JKH A;  3D0G E;  3QLH A;  1VYA A;  2UUC F;  3I31 A;  1TKX B;  1XMQ F;  2XCP A;  4HI1 A;  3MFH A;  3W2W B;  2R7U A;  1Z1Z A;  3BSO A;  2MJN A;  4LRB A;  1LW2 A;  3KLH A;  4NXN J;  3GII A;  5HMW A;  1GMV A;  4WIQ A;  4H54 A;  2CQI A;  1HWK A;  2WHO A;  3HT3 A;  3Q8V A;  1XNR J;  5D6G A;  3MMC B;  1S9E B;  1S6Q A;  1CJV A;  2OLW A;  2CPI A;  3FMW A;  4WE1 B;  3KJN B;  5H9F K;  4I56 A;  3GIL A;  2BKN A;  2E1M C;  2HFU A;  2VPY B;  4C8N A;  1YI2 S;  1QVF R;  1X4H A;  2XLJ A;  5H9E J;  3IAM 9;  1BLU A;  2A0F B;  1Y10 A;  2RQC A;  5A2Q U;  1I6J A;  4B9M A;  4C9D A;  1MRO B;  1FDB A;  2F4F A;  3Q8Y A;  4J91 A;  4FPR A;  3PW7 A;  3AT1 B;  1RT2 A;  2IFX A;  4XDD A;  3DRS A;  2B9W A;  5EWG A;  2QEX S;  1VRQ C;  3IMQ J;  2VQF F;  4DG1 B;  1NJX A;  1FEH A;  2XCA A;  2W9C B;  1T11 A;  2NXU A;  4IUF A;  4BC7 A;  4M5D B;  4A8M P;  1S7H A;  2C28 A;  4QWB A;  2QYG A;  4ID8 A;  3M2U B;  3P5B P;  4MK7 A;  4UT4 A;  2CNL B;  3OSN A;  3PJX A;  4DR2 J;  4ZN1 A;  3FCH A;  2PA8 D;  4ZS6 A;  1IWA A;  2G1H A;  1HBU B;  3AA8 A;  4R8U B;  3MM8 A;  1NK4 A;  5D4N A;  2DGW A;  2XMJ A;  4HHJ A;  1YRU A;  5K20 B;  3MED A;  4L76 A;  2QG9 B;  4R5P B;  4A8S A;  2HNZ A;  2XY5 A;  1UVJ A;  4KRW A;  3QO9 A;  3V2U C;  2ALZ A;  1UEU A;  2GHP A;  3E2E A;  1FO1 A;  2FC8 A;  4USH A;  4ZIT A;  2OSR A;  1X5O A;  2BM0 A;  3JTO A;  3KHH A;  3M2V A;  3MCM A;  1FCA A;  4ZCK A;  3OVA A;  2BOP A;  3M8P B;  3PO5 A;  1PBU A;  1X4C A;  1UVI A;  2JC0 A;  4PXB A;  2VKZ G;  4ZN3 A;  5I3U A;  3HD2 A;  4MK8 A;  1PJ7 A;  2NQP A;  2R2S A;  3PCO B;  3J7Y U;  4C3K A;  2YKN A;  2LXF A;  3FQL A;  3R7N B;  3QNW B;  3ILL A;  4A8K A;  4EZ6 A;  4FS2 A;  1EKR A;  4X66 F;  3ET6 A;  3DN9 A;  2QMX A;  3D28 A;  4X65 J;  3QGG A;  4USK A;  4TLQ A;  4DJB A;  3ZXW A;  3C14 B;  3CCW A;  3LAK A;  3TJA A;  2P6T A;  1KRP A;  2PT0 A;  2AYM A;  2OUG A;  1IXK A;  2V9W A;  2GJI A;  5L1J A;  2J9E A;  2CKW A;  2XWY A;  1IR1 A;  4YHH J;  3I5A A;  4DV3 J;  4DUY F;  2MZR A;  4KC5 A;  5J2N B;  3IXQ A;  3T3F A;  4PG5 A;  1RKI A;  2VFT A;  2R2U A;  3GZ7 A;  4WFX A;  1Q7L B;  1R0C B;  5KFY A;  4DN9 A;  2VFV A;  3SSR A;  3KG4 A;  1HPZ B;  4LFB J;  3BBF A;  3KWM A;  5CCM A;  5G0R A;  4DL5 A;  4YQW A;  1H74 A;  1V3S A;  3LTO A;  3HZG A;  2GCF A;  1Z4U A;  1UA0 A;  2BDP A;  4DR3 J;  4NZ0 A;  2GVZ B;  2RJZ A;  4OI1 A;  3OJU A;  4Q0B A;  4U7U D;  3SXL A;  2IRU A;  1I94 F;  2VBY A;  1NEE A;  3MR2 A;  4ENO A;  2OP5 A;  1D8Y A;  2YNH A;  2DJW A;  5I42 A;  1R43 A;  2DR7 A;  4LR8 A;  1N33 J;  2QN6 B;  1RT6 A;  3DOK A;  3OL7 A;  4F26 A;  2Y1L B;  3TI0 A;  1QVG R;  2JH3 A;  4NL5 A;  4DZ6 A;  1T05 A;  2DGX A;  3PTW A;  2HHU A;  1JLA A;  1HR0 J;  3G71 S;  4U7U K;  1N34 J;  1O5J A;  3IR6 B;  4ELT A;  5IC4 B;  2WSF C;  1OY9 A;  2DPI A;  4WKY A;  4NI2 A;  4K0K J;  3DFE A;  1EX8 A;  3BSA A;  3W2V B;  1QDU B;  1NK9 A;  5KT6 A;  4ES1 A;  4URG A;  3SDE B;  1EAR A;  3D66 A;  2IC3 A;  4A8F A;  1I51 B;  1EAY C;  2OGU A;  4U67 Q;  4WFN Q;  1G3O A;  1KKH A;  3PEH A;  3PW5 A;  2E5L J;  4NLX A;  2FLL A;  4RWX A;  2DY9 A;  3BGR B;  3CCE S;  3LA0 A;  3B8H A;  2DEJ A;  3MR3 A;  3IR5 B;  4X4O A;  2O01 C;  2KVI A;  2XSJ B;  2GIF A;  2ACY A;  1A9N B;  5C42 B;  2G2O A;  3K5L A;  1B64 A;  2H54 B;  3KLE A;  5J2P B;  5E7O B;  1WDT A;  4Y3C A;  2BKP A;  3LH2 S;  3OPK A;  1YDL A;  2DNL A;  5D3G A;  3MAA B;  2GNK A;  3EPI A;  2EBG A;  2C22 A;  3GON A;  4PXD A;  3BO3 A;  3EZU A;  1EB0 A;  3FMB A;  3Q22 A;  1IBM F;  3RRG A;  2BVZ A;  2P8I A;  2WOM B;  2AEJ A;  2N3O A;  2C2E A;  4LSN A;  3KLI A;  2UUA F;  1U1N A;  3QBC A;  3GWC A;  4MFB B;  3CC7 S;  2DGT A;  3HHL C;  3UCU P;  4QW9 A;  3C16 B;  4K4Y A;  4NRT A;  3MPD A;  4P2F A;  3PRD A;  3HSJ A;  1NHU A;  3JTN A;  5IWA F;  2G4B A;  4K7Q A;  3BKF A;  3CJ8 A;  4QYZ J;  3VGS A;  2DRA A;  1JB0 C;  2Y0S D;  4DR4 F;  2LP4 A;  2RQ4 A;  1MWZ A;  3KLG B;  2HLU A;  4PG8 A;  3JSY A;  4CO2 A;  4NCG B;  1TEL A;  2FLO A;  3G82 B;  1XR7 A;  4MK9 A;  1LWF A;  2FZG B;  5BXI A;  4JV5 F;  2QL7 B;  2JEI A;  2B6A A;  1H3D A;  2C3O A;  5E3C A;  3ZTP A;  2IMW P;  1X4D A;  5JJB A;  3NOG A;  1SPB P;  2VG7 A;  2HHV A;  1FXR A;  2W01 A;  4ZMM A;  1DAX A;  4LF4 F;  3GYX B;  3MM9 B;  4LFA J;  2VFS A;  4FPI A;  2PO4 A;  3H7H B;  3T9N A;  3GV5 B;  2PA3 A;  1UPM B;  3T1H F;  4KGX B;  3VTI A;  1RXO B;  2QGF B;  1I3O B;  3RBE A;  1Q79 A;  3MCN A;  9RUB A;  1NJY A;  1S0O A;  5KG3 A;  1Q95 G;  4HI2 A;  1NDL A;  2M70 A;  1REV B;  5CA5 A;  1RAO A;  4DR1 J;  1NU4 A;  2XMA A;  5KFR A;  3IG1 B;  1RWK B;  2CWK A;  2VBZ A;  4O0N A;  3FBC A;  2PGC A;  1UVK A;  1U0H B;  3BSN A;  2L3M A;  4KT0 C;  4MYU A;  4G6V B;  1K73 T;  4O44 A;  3D4J A;  1FJ7 A;  2OPQ B;  4CTA A;  1ICE B;  1NJI T;  1TP7 A;  3BGF A;  1V9O A;  1CS4 A;  4ECV A;  1XMO J;  2NXN A;  3V81 B;  3GB0 A;  2A6M A;  1D0E A;  2WAQ D;  4OHW A;  5C24 A;  1UTA A;  1R0B G;  4F3Q A;  3C15 B;  2FLN A;  1RWO B;  2D41 A;  2MZJ A;  2IM3 A;  3GIM A;  4ED1 A;  1RUS A;  3D54 A;  3OFH A;  1HNI B;  2JJ4 D;  2X1G A;  1UL3 A;  2E1R A;  1PC5 A;  2IM0 A;  1RIS A;  2CAJ A;  4CM0 A;  3RR7 A;  3LPE A;  1OSC A;  4ZK7 M;  3HVR A;  4PQA A;  4ETX A;  3I9V 9;  4O3O A;  4ZLL A;  1FXD A;  3UWT A;  3OUY A;  1VQY A;  1KTQ A;  1FDD A;  3CSK A;  4I68 A;  4NA1 A;  2UVR A;  1M1G A;  3IN5 A;  3KMQ A;  3BJY A;  5E2Q A;  3JB9 k;  3MPU B;  1YZ6 A;  1Y00 A;  4KB7 A;  1H73 A;  2EFG A;  2ZBC A;  2R2R A;  3OTO J;  3HHL B;  1FT8 A;  2B5J B;  1NSQ A;  1IKY B;  3NLC A;  3TOQ A;  3KK2 A;  4ELV A;  2RDI A;  1SC4 B;  4ZJL A;  4WZQ A;  5E33 A;  1HWU A;  1N48 A;  2DNP A;  3KK3 A;  1F60 B;  1KFD A;  4LJM A;  2XG8 A;  1B7Y B;  1RT4 B;  2YY3 A;  2C2O B;  3SCI E;  3FSX A;  2J0Q D;  2EW9 A;  1FF2 A;  4QBU A;  1NO8 A;  4PQU B;  4O3P A;  2F8M A;  1DY3 A;  3Q8R B;  3FJ2 A;  5A8R A;  4DV7 J;  1T95 A;  2Q6C A;  2XHW A;  3H4D A;  1BQM B;  4BHQ A;  1REG X;  1M5V C;  1R6V A;  1X5P A;  3ZZO A;  3QT6 A;  1L3K A;  4Y2A A;  3LGH A;  2EFP A;  2RT3 A;  5E0O A;  2B8Q A;  1MWQ A;  2VPW B;  4ELU A;  2UVV A;  3DLK B;  4ZHR A;  4DCO B;  1V5I B;  3BRE A;  1YJR A;  2CPJ A;  4JI2 F;  1ACM B;  3QSI A;  4ER8 A;  3RAM A;  2HVD A;  1TV6 B;  1DLO A;  4B9N A;  4KGV B;  4DPT A;  5GAG U;  5KTQ A;  2R7Q A;  1S12 A;  4X64 J;  5G4D A;  2YNI B;  4F4W A;  1X4A A;  1HLW A;  2L9D A;  1GT8 A;  2QV6 A;  4HL9 A;  3QIP B;  5M2P A;  1KVJ A;  2GJ2 A;  3TQE A;  4BWJ A;  4GO7 X;  2EWH A;  1MN9 A;  2MTL A;  3UD3 P;  4YR0 A;  1K9M T;  2KG1 A;  1RA7 A;  2Y1J A;  2VQE J;  1IM6 A;  4CO4 A;  1WHV A;  4IO9 Q;  4WJB A;  2HBY B;  3D7S B;  4LR9 A;  4Y6I A;  2MST A;  4PR6 A;  1T02 A;  3WIU A;  4K2J A;  3UVJ B;  1LXJ A;  5D0H A;  1EP4 A;  2ATL A;  2BRL A;  4OL8 A;  4OQJ A;  2X1B A;  4ECT A;  1G2E A;  1S59 A;  1X9S A;  4P7T A;  2VL1 A;  4IO1 A;  3OTB A;  2KRB A;  3TVZ A;  5LT5 A;  1SH0 A;  3N6M A;  2V4Q A;  4I6Y A;  2Z2Y B;  4DF4 A;  5EDW A;  4HT5 A;  4UOF A;  2UV8 G;  3UO0 A;  2HKE A;  1U1O A;  1SC1 B;  2A2C A;  2X3G A;  2G1D A;  2BQU A;  1IJE B;  3R5C A;  3IWL A;  3HHL D;  4IR9 A;  2LQ5 A;  4AUK A;  5KFQ A;  2UUB F;  2XYP B;  4X4S A;  4MIB A;  3KK1 A;  3D2W A;  1P9Q C;  2L48 A;  2QSW A;  4C7Q A;  2J9D E;  1J27 A;  4DV1 F;  3PW2 A;  4J90 A;  4C8O A;  3KHG A;  1KHV A;  2HQ3 A;  2KN4 A;  4ECS A;  2MKJ A;  4ILR A;  1X0P A;  5ETP A;  3PV8 A;  3MOZ A;  4DR6 F;  3ADA C;  2C2R A;  1JQG A;  3FFI A;  1NND A;  3NBP B;  4OZ3 A;  4FF4 A;  4NYO A;  3M8Q A;  1HQE B;  4UOC A;  4M5M A;  8AT1 B;  4DR2 F;  4I2P B;  4PG7 A;  2JLF A;  2J6T A;  4ZPT R;  4TU7 A;  1KFS A;  3RU0 A;  2M8H A;  4QU7 A;  4JI7 F;  4YB7 A;  2YBV A;  3HI9 A;  4M5J A;  4ZP8 A;  2HWI A;  2I2Y A;  4DMZ A;  1Q16 B;  4HLB A;  3NG8 A;  4DV4 J;  5B08 A;  3W65 A;  1VQ8 S;  1UJ4 A;  2QLF B;  4JB8 B;  1LW0 A;  2DGQ A;  4B9T A;  1S0N A;  1IQT A;  3JQJ A;  1VK3 A;  1RAG B;  4KGK A;  4ZVU B;  1R3N A;  2DNR A;  2AWZ A;  1QUV A;  4EZ9 A;  1KBR A;  2CPE A;  2EK1 A;  3GFY A;  2YKO A;  1H72 C;  1OQ6 A;  1YIJ S;  1WHY A;  2VG5 B;  4LF9 J;  1WI8 A;  1SH2 A;  3IWX A;  4QCL A;  2CNN B;  3IBF B;  4KYZ A;  2J8S A;  3R1L A;  2DB1 A;  3M1V A;  2QA1 A;  1FVS A;  3KHR A;  3OL9 A;  3GMG A;  4JI6 F;  4X65 F;  2ZE2 A;  3DGP B;  5A76 A;  4FXV A;  3TW0 A;  1P1L A;  1TL1 A;  2WTF A;  3CUL A;  3SQG B;  1XK8 A;  1F2G A;  4FN5 A;  1VQM S;  2V9K A;  4H4K A;  3J7A 1;  2V4J B;  3CD0 A;  1RHK B;  3AOC A;  4EBD A;  2ZBR A;  3KDO A;  4DFP A;  3R7S B;  1XWL A;  3C6U B;  1P1T A;  1RT1 B;  4HTI A;  3CTR A;  3VAL A;  3G4S S;  5HAO A;  2BRK A;  3P3D A;  2MGZ A;  3H59 A;  2DNQ A;  1U1L A;  2IDE A;  3MDF A;  3M6U A;  5F8M A;  3UDL A;  3DLL Q;  1K1S A;  2HS3 A;  1C0T B;  3K5P A;  2MKI A;  4WBF A;  9ATC B;  5F9N A;  4C11 B;  4M5L A;  4PCQ A;  5DLF A;  2QLW A;  3CD7 A;  1S72 S;  4Z37 A;  3RG6 A;  1NPP A;  1UVN A;  4YDX A;  3OL6 A;  2BZ2 A;  4URQ U;  5DM6 Q;  2W4D A;  4M94 A;  4ZIW A;  1FKO A;  1EET B;  1ZYQ A;  3FCV A;  2HRU A;  3H5S A;  5KFP A;  1C1B A;  4B3R J;  1UP1 A;  1RTH B;  4CYU A;  5DDP C;  1JKH B;  2M0G B;  2UXB F;  3POT A;  1RE1 B;  2HQG A;  2DYA A;  2C3P A;  2ZD1 A;  2BJ9 A;  3UQS A;  3CJ0 A;  3TA2 A;  3KLH B;  2CJB A;  1R27 B;  1U45 A;  4IQM A;  2GGP A;  2FJX A;  3M7V A;  2CXE A;  4K5S A;  1CJK A;  5IQ6 A;  2CQH A;  2AQ4 A;  1ITP A;  2HFS A;  3MUR P;  4HEA 9;  4ZVH A;  1FNO A;  2N82 B;  3DLH A;  4DR7 J;  7FDR A;  5D4L A;  2CA9 A;  4ZLP A;  2BAC A;  4PEO A;  4IOA Q;  2Z8Q A;  3E3X A;  3RBX A;  4DX7 A;  1JIH A;  2FVP A;  1GAO A;  1FKP A;  4IFV A;  2E7W A;  4X84 A;  3CJ3 A;  4B9L A;  2D69 A;  3Q23 A;  2Q43 A;  3NAH A;  2J0W A;  2G0I A;  1RT2 B;  3D0I E;  5B0F A;  2FVC A;  4HR2 A;  1TL4 A;  1VIO A;  4C97 A;  1GXU A;  2EG2 A;  3PY8 A;  4NYZ A;  5AJ3 F;  5D15 A;  3KUH A;  3GFX A;  1HQU B;  5KFZ A;  3FGV A;  3US5 A;  2ROE A;  2B4U A;  1HYS A;  1H7W A;  2XQC A;  2Z4P A;  5KFU A;  5GVQ A;  3O44 A;  5JMN A;  4RNF A;  3ZTS A;  3H4B A;  2V4R A;  2ZKT A;  3K0J A;  1IJF B;  2I8E A;  3MOJ B;  2WVD A;  1FJC A;  3BN7 A;  2QL5 B;  2MB0 B;  1AZS A;  3GJS B;  1ZM4 A;  4FXW A;  2HIY A;  2KO1 A;  3V4I B;  3JS9 A;  2VUG A;  2NUU G;  4DUZ J;  2AF6 A;  2AV5 A;  2PDA A;  3PX6 A;  2R8G A;  3G6X A;  4B3S F;  1C4C A;  4ZDN A;  3QRP A;  3IFE A;  4WP3 A;  4ZVO B;  3MED B;  4CIO A;  1P9Y A;  4UUX A;  2HNZ B;  5J1N A;  2R4F A;  5DQI A;  2XHC A;  2KZM A;  2C1E B;  2OPR B;  5LMU F;  2RHS B;  3W8P A;  3B4D A;  2DNO A;  3M2V B;  1TK8 A;  4KHP F;  2B9X A;  2ZDP A;  4N41 A;  2MKC A;  4PKD B;  1F2H A;  2J9C A;  3KLF B;  3SMZ A;  2X7I A;  3QMQ A;  5HK4 A;  1S1T A;  3MUM P;  2NYH A;  3TUI C;  4DPU A;  2D3O R;  2KXN B;  1L3U A;  2WW4 A;  3W2W A;  2PMW A;  3MXH P;  2YKN B;  2ADB A;  4CH0 S;  5DZ7 A;  2Q66 A;  1VBK A;  3D1H A;  3ZZ0 A;  2J0X A;  3V4M A;  1B0T A;  2BE7 D;  3PXG a;  2BBE A;  4KO0 A;  1RKJ A;  2ZUA A;  3NAI A;  1NSP A;  4WE1 A;  3OW2 R;  1XQI A;  3NGR A;  1JLQ A;  2CQ1 A;  1O0P A;  1APS A;  4CCH A;  3LAM A;  5DG9 A;  3DHW C;  1CVJ A;  1PAU B;  1ZET A;  1YGY A;  2DNY A;  2D9O A;  1TK5 A;  2CFX A;  4JV1 A;  4B02 A;  1MRO A;  2M2B A;  4KTQ A;  1RU2 A;  4DFM A;  1DTQ A;  1R89 A;  2FVR A;  3R5J B;  5LJ3 Y;  3R9L A;  3D6T B;  2OD6 A;  2OML A;  5DM7 Q;  4DG1 A;  5G0R B;  1RHU B;  2YPY A;  1TUW A;  3R6L B;  3ZZZ A;  2EFN A;  5J2M B;  1Q7Y T;  1LWC A;  5AXL A;  2RUS A;  2PD1 A;  2XLK A;  1VIX A;  2OEK A;  1HQ2 A;  5BYR A;  2JFK A;  1RTI A;  1TKT A;  4M5D A;  2V68 A;  2WBR A;  3WQP A;  1SVD A;  4ZKA A;  1LNQ A;  3T1Y F;  4Q0B B;  3M2U A;  3KXD A;  2MJU A;  3CW2 C;  1Q86 T;  5ETL A;  2IPO B;  3VQT A;  2WRM A;  4OYI A;  3SBM A;  1PYS B;  3W5X A;  3IP0 A;  5I42 B;  3JTP A;  4LF8 F;  1HBU A;  4R8U A;  2OTJ S;  2O1P A;  2R8K A;  1T3O A;  5D4O A;  2PII A;  4KGM A;  5C5J A;  2L9N A;  3DOK B;  2RS2 A;  1HMV B;  1KNZ A;  3BR9 A;  4DV2 J;  2PC6 A;  4MKV A;  2LEP A;  4R5P A;  2LCW A;  1NK0 A;  2QMU B;  3SSS A;  4Y2K A;  1N0V C;  1TR0 A;  1EJ7 L;  3CCZ A;  3T5H A;  1F1B B;  2QYC A;  1H2T Z;  3H0P A;  1Z2Z A;  3TZZ A;  4YUD A;  2VDI A;  1AFJ A;  5HSP A;  2HFZ A;  1TK0 A;  4NI2 B;  1QY7 A;  5HP1 B;  2R42 A;  2RSQ A;  2FY1 A;  3DI6 A;  3MEK A;  1C0U B;  1HNW F;  7AT1 B;  3CIM A;  4YR2 A;  2A6O A;  3CC4 S;  2IC3 B;  4AT1 B;  4CO5 A;  3EZO A;  3C19 A;  3I82 A;  3I5B A;  2HSE B;  4J9R A;  1XR6 A;  4DX8 H;  3DRY A;  1HW9 A;  2CZ4 A;  1WHW A;  1OO0 B;  5IT0 A;  3NY0 A;  5D0R A;  3CDB A;  4ICL B;  4OFZ A;  2VJU A;  4DV7 F;  2ZC4 A;  2EEY A;  2V69 A;  3F0N A;  1AYE A;  4WFB Q;  3NCR A;  3NWG A;  3BBB A;  4RBT A;  2B4O A;  5J1P A;  1PYT A;  3CVK A;  5F8J A;  2A2D A;  1GMU A;  1N52 B;  2BQR A;  3HHK A;  3J7Z T;  3C14 A;  3M6V A;  3LPY A;  4KH1 B;  3UI3 A;  4HHU A;  4B9S A;  1VGY A;  2OD4 A;  2DXD A;  3W60 A;  1FHT A;  1DTT A;  4AE5 A;  4OLP A;  2FD2 A;  4BBY A;  4AQY F;  4A8O A;  2PE8 A;  2J6U A;  1UWA A;  1UAW A;  4PAB A;  4DL3 A;  1T94 A;  4E98 A;  3R5A A;  4DQR A;  4QQB A;  4RNN A;  2B7B B;  1XTZ A;  1SL0 A;  4KIA A;  3M8Y A;  2FC9 A;  3MEE A;  2OH2 A;  5K14 A;  3LWL A;  4LSN B;  1IBK J;  1ZAW A;  3KLI B;  1DQ9 A;  1HPZ A;  4KPY A;  5L8R C;  1VHF A;  1Q8I A;  2L08 A;  3DM2 A;  3H90 A;  4ETZ A;  3CJK B;  4CO1 A;  2K7J A;  3J7Y I;  4OJH A;  2M3D A;  4XTT A;  4I2Q B;  4TU9 A;  4NLU A;  4YB5 A;  4JOU A;  2QLB B;  3O5T B;  5KFB A;  4B17 A;  1HAR A;  2HBR B;  2CJY B;  2OEM A;  1NRK A;  4DS4 A;  3ZNJ 1;  2WVE A;  3ZZU A;  2AU0 A;  1P27 B;  2EVZ A;  1GFW B;  3MTJ A;  2GVZ A;  3AOD A;  2VJV A;  4PPZ A;  4P2X A;  1LWF B;  2BYC A;  3HDS A;  5DLG A;  4U8Y A;  5FLX U;  4AL7 A;  4LF5 J;  2B6A B;  2XTJ P;  3LO3 A;  1NAQ A;  3H8Y A;  4RW6 B;  3TUJ C;  4YY3 J;  4WTO B;  5FD1 A;  2DGU A;  3BGU A;  2WW8 A;  2VG7 B;  3A8E A;  5GAD U;  4YP3 A;  1QSL A;  3UR0 A;  1QUP A;  2M5Y A;  5HMX A;  3NGK A;  1SKR A;  2LXI A;  1KDN A;  3C6T A;  2ZOF A;  2W9A A;  1LOU A;  1WC6 A;  4DBQ A;  4RL1 A;  2C2M B;  1BC6 A;  4O23 A;  3HJF A;  3LGM A;  4NEY A;  3W2V A; 
#chains in the Genus database with same CATH homology
 1XNQ J;  2UUC J;  2HHH J;  2UXD J;  1XMQ J;  2UUA J;  5LMU J;  1N32 J;  1N33 J;  3J80 U;  4AQY J;  4JI1 J;  1N36 J;  2F4V J;  1XMO J;  3D3B J;  2MTL A;  4JI6 J;  5BR8 J;  2UU9 J;  4DUZ J;  1I94 J;  4GKJ J;  4KHP J;  4GKK J;  4YHH J;  5IWA J;  4V1A k;  3J81 U;  4DV3 J;  2VQE J;  4B3M J;  4JI7 J;  5A2Q U;  4DR7 J;  1HNZ J;  4JI2 J;  5AJ3 J;  4LF7 J;  4DR4 J;  2MQ8 A;  2UXB J;  3D3C J;  4LFA J;  4X66 J;  1HNX J;  5FLX U;  1HR0 J;  4LF5 J;  1N34 J;  4DV7 J;  1HNW J;  3IMQ J;  4DR5 J;  4KY3 A;  3JAM U;  3J7A N;  1J5E J;  4B3T J;  2KL8 A;  4HHU A;  4LF9 J;  4YY3 J;  4LFB J;  4DV2 J;  2ZM6 J;  1FJG J;  4JI3 J;  5LM7 E;  4JV5 J;  4K0K J;  4KYZ A;  4OX9 J;  3W1Y C;  2UUB J;  5LMN J;  4NEZ A;  2VQF J;  3T1Y J;  3T1H J;  4DV0 J;  4JI4 J;  4NXN J;  4JI8 J;  2KVQ E;  4NXM J;  4DUY J;  4LF6 J;  4LFC J;  4B3R J;  4B3S J;  2MEW A;  4DR1 J;  4DV1 J;  4DV5 J;  3R2C J;  4LF4 J;  4PWW A;  4JYA J;  1XNR J;  4DR3 J;  4RJV A;  4DR2 J;  1IBL J;  1IBK J;  3R2D J;  4LF8 J;  2UXC J;  4X65 J;  4DV6 J;  1IBM J;  4DR6 J;  4JI5 J;  4JI0 J;  5IT9 U;  4X64 J;  2E5L J;  4X62 J;  3OTO J;  4NEY A;  4DV4 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...