3VVUA

Crystal structure of reconstructed bacterial ancestral ndk, bac1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
MERTFVMIKPDGVQRGLIGEIISRFERKGFKIVAMKLMRISQELAEKHYAEHREKPFFSGLVDFITSGPVVAMVLEGKNVVEVVRKMIGATNPKEAAPGTIRGDFGMSVGKNVIHGSDSLESAEREISLFFKDEELVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental evidence for the thermophilicity of ancestral life
pubmed doi rcsb
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 39
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3vvuA00
3VVTA 1BUXA 1XQIA 4O0NA 3Q86A 3FCVA 4C6AA 2AZ3A 5C7PA 3Q89A 5CABA 3NGUA 1B4SA 1NB2A 1F6TA 3ETMA 4UOFA 3ZTSA 1NSKL 1WKLA 3FBBA 1NDPA 3JS9A 1NPKA 3Q8VA 4DI6A 1NLKL 5IOLA 2DXDA 3EMTA 3FBCA 1BE4A 2DXFA 4F4AA 1NDKA 1HIYA 1KDNA 3PJ9A 3BH6B 1NHKL 1NDLA 2HVDA 1LEOA 4W98A 4EK2A 3VGSA 4KPCA 1MN7A 1WKJA 3G2XA 4F36A 1BHNA 3L7UA 1HLWA 3EJMA 3FKBA 1NSQA 4DZ6A 3ZTOA 3EE3A 3ZTPA 3NGTA 3BH7B 4ANEA 2NCKL 2DY9A 4DUTA 3MPDA 4UOHA 2B8PA 3Q8YA 1HHQA 3DKDA 3GPAA 4UOGA 1UCNA 2DXEA 1WKKA 4S0MA 3VGVA 3ELHA 3FBFA 3EICA 2BEFA 4FKYA 3ENAA 3VGTA 2HVEA 2VU5A 2CWKA 3EVOA 4FKXA 1NCLA 1S57A 3FCWA 3VVUA 5BXIA 2BX6A 1S5ZA 1VYAA 3EM1A 3ZTQA 1NUEA 3R9LA 2B8QA 3B54A 3Q8UA 1LWXA 3FBEA 1PKUA 1NDCA 1EHWA 1F3FA 3BBCA 3FC9A 4ANDA 1S59A 2AZ1A 4HR2A 3WX8A 1B99A 2DYAA 3DDIA 3NGRA 1MN9A 1K44A 3ZTRA 4WBFA 1W7WA 5CAAA 1XIQA 4CP5A 3Q83A 1U8WA 2HURA 3GP9A 1JXVA 3BBBA 3PRVA 4ENOA 2ZUAA 4ANCA 1ZS6A 3EVWA 1PAEX 3EVMA 3VGUA 1NSPA 3NGSA 3BBFA 3B6BA
chains in the Genus database with same CATH superfamily
4EZ9A 4B3TJ 5D6GA 3D5MA 3I87A 4DV3J 2ROEA 1XMBA 2RJZA 4IG3B 3ISND 3KLFA 4Y34A 3MF5A 2DEJA 4UUWA 1HFEL 1R7IA 1CJVA 1URNA 2C2NA 4AXIA 2FC9A 4ZCKA 2BJ9A 2RNEA 2M52A 2AU0A 2PEBA 5HO4A 4QZVB 4C8MA 3MECB 1C4CA 4F0KA 1SKSA 4GO7X 4QYZJ 3CXCR 1VQOS 3LP1A 1SBRA 4RR5A 3MUTP 1S10A 2W8KA 3GMGA 2ATCB 4C8LA 2CVIA 2YH0A 3LP2A 3N5FA 5HVFA 5KFIA 1WHXA 4WCEQ 2Q66A 4PXDA 3F41A 1UEKA 3L09A 3J81Y 4C4WA 2F8EX 2I5JB 3M05A 4HL9A 2RE1A 4NI2A 4DEZA 1HNXF 1WC5A 3HD1A 3IR7B 2YKNA 1Y0HA 1IWGA 2HVDA 3OD2A 3RJMB 5T7LA 1R0BG 1IKVB 4KPCA 4DL5A 2JH3A 4CLPA 5GAHI 4YR0A 2I38A 3EZ5A 1RAGB 4OI6A 2R2RA 4A8SA 3OFEA 3OHAA 3UD4P 1SL0A 2ZKTA 1RUSA 2QIFA 2I5JA 3PEHA 2HHSA 3NGTA 3G6ES 5IC4B 2HIYA 2AV5A 2B5JA 4DUTA 3QMQA 1SKUB 2ZH8A 1WTBA 1N8RT 3Q8YA 3CJ8A 2W7PA 2W2NP 3DXBA 4V1Ak 5KFOA 2B0GA 1HNZJ 1YBTA 2Q43A 2LQJA 3MMAB 4CH0S 5DG9A 2BKPA 3QSIA 2GAGC 1F60B 1FD2A 2HAIA 4DV6J 2X1FA 3VALA 2D9PA 2QJ3A 3LP0A 4C11A 3M2RB 2CQIA 1BC6A 1QTNB 1RP5A 2MJNA 4DL0C 1TUWA 2GQCA 3R5BA 1L5UA 1T03A 3C6UA 1HHSA 4U7UD 2QN6B 3V6HA 1TMMA 2VD3A 4DG1B 3G6YA 3AODA 1AW0A 3I32A 2DISA 3GIMA 1S57A 3HHNB 3DGPB 1IR0A 3TA0A 1ULRA 4EEYA 1F0XA 4DX6A 2PO4A 2WOMB 3H90A 4DV6F 2H3EB 2VPYB 3SFUA 3UPFA 4UY8T 4XDCA 2XZDB 5I42B 2RH3A 1T8EA 2K3IA 3NBPA 5HROB 2XO7A 1TK5A 3FBEA 1HNIB 4P74A 3M32B 4FNIA 4U7UK 4CM2A 3A8IA 3NS5A 2VKRA 2ZE2B 3BYPA 4Q44A 3R5DA 2DB1A 1RTHB 1YX2A 1UFKA 4J90A 4MIWA 3PHEA 4NRTA 2J9DE 3HHEA 3PO4A 4P73A 5K8MA 1HQ2A 1RWUA 2WW4A 5F8MA 4RW4A 5CXTA 1H2UX 1S9GB 2I1RA 1DQAA 2HK3A 1RADB 4KT0C 4FYDA 3BF4A 1FRIA 1VK8A 3PJWA 4WBFA 4X65F 1O0PA 4K2JA 1A0OB 3ADAC 4TY9A 1HARA 1HNXJ 1HNZF 2J6SA 2I6WA 1PC4A 4XPCA 1TV6B 5HVHA 3QZ8A 2ALZA 1N88A 1CVJA 5GAEI 3BBBA 3OSNA 1TKZA 4FVCA 3M30B 4OYXA 1YDLA 4KO0A 2N3OA 5DG8A 3TOQA 4U7CA 2R7WA 3OJSA 4WXWA 1RBLA 2L3MA 2RS8A 4ILMA 1Q7LB 2B6AA 4HI1A 2AYEA 1PYTA 1KVKA 4XTTA 3DRPB 2VFTA 1SQFA 3UFCX 2UUAF 1RQ0A 2FZGB 1XMQJ 4NLUA 2A18A 4LFCF 4LQ9A 2Z8QA 3U27A 2LYVA 2JNJA 5M2PA 3PO5A 5KG4A 3M1VB 3TZXA 2VB6A 5G0RA 1SJFA 2E5HA 4IG0A 2BRLA 4ZN1A 2RKIA 1Y4ZB 4GKKF 1OIAA 5GAGI 2LEPA 1QSSA 4X66J 2UUCF 3DRSB 1FK9A 2CJQA 4ID5A 2KXFA 3CDEA 3CCRS 3TQEA 1N32F 4ED4A 8RUCA 1IKVA 3M4XA 2UU9J 3AD9C 1Q8LA 1NPKA 4ITSA 4A8OA 3GR1A 4DU7A 1HHTP 2NYIA 3FBCA 3RBXA 5KT4A 1LWEB 2VBZA 4JI0F 2A3JA 2P2CB 4CO0A 3VAMA 2DXFA 5DDRC 3EWGA 2VONA 1GTEA 1JKHA 1KQFB 3DMJB 1KD1T 1DZ5A 1DY3A 4RWWA 4ES2A 2YKMB 1KDNA 2JC0A 2MTLA 3I9V9 4NYOA 2VFRA 4K0KF 3R1LA 3W5XA 2MQ8A 2M70A 4QYRA 4EK2A 3PYFA 3OTBA 3LO3A 4NA1A 1RB0A 1SJ4P 4F3MA 4TYAA 4HT7A 1VBKA 1HKAA 2E1RA 2VICA 4LF7F 4LF7J 1NZ8A 1Q8KA 2EW9A 2MYFA 2Q6CA 3KFWX 3HKWA 1UPPA 3HVTB 4LRDA 5AJ3J 3EJMA 2HHHF 1WNEA 1FWLA 2A1BA 1CQMA 3LF0A 4RL1A 3OVAA 4FPRA 4FZVA 3SV4A 2M88A 3OJUA 1MWYA 2AJ2A 4K4WA 4OI1A 1R89A 3IGVA 4C8YA 1MU2B 2JVRA 4QWAA 2B8PA 1ITPA 3OTOF 1N5QA 1RTHA 1S4FA 1SV5A 2OO4A 4KRWA 2ZHBA 2BR0A 4NYPA 4YR2A 4Y2KA 4KQZA 1T9TA 3D6TB 2VIHA 2K1RB 1T9YA 2BZ2A 2E66A 4I2PB 2QA4G 7FD1A 1NJZA 4AQYF 4RBVA 2OIHA 3KDNA 4C97A 1H74A 2CZ4A 2W9BB 4RUCA 4NXMJ 1AYEA 3QZ7A 4KC5A 4ZS6A 2EKYA 3M8QA 5L1JA 4WFNQ 2QEXS 4PPDA 1EIYB 5CYQA 1ZZNA 1N36F 4JI0J 4UQTA 1R8BA 1VYAA 4RW8A 5A8RB 4R5PB 2MGZA 4J9PA 2BKNA 2HFOA 1ZAWA 1WHYA 3B54A 4P7TA 1HW9A 3I56S 1HNWJ 1LXJA 1L3TA 1PKUA 3CDBA 5HAOA 1NDCA 3T1HJ 2YNHA 1S9FA 4DSJA 5EDWA 3W66A 4X64F 1JLBB 3CJ5A 4IFYA 1CBKA 1P9YA 4L6V3 3BREA 3CIZA 1HD0A 5IM0B 3IS9B 2ZM6J 2IM3A 4KY3A 2JL9A 4M5JA 1UEUA 4NLWA 5CCMA 2KM8B 4DWIA 4AL5A 2AGPA 1M5SA 1U0HA 3FZBA 3PW5A 1RWOB 1N5YB 1CS4A 3CJ0A 4OYOA 3MXHP 3PVXA 2L9WA 3AY0A 2HHQA 4IO1A 1Q53A 5A0YB 4OZLA 3I5CA 4X4NA 3NMRA 1KTQA 5KG5A 2YQ0A 4P75A 3V2UC 1AUSL 3K2YA 2FJVA 2B7BB 2A0FB 4Q7AA 5IQQA 3VTIA 1OY9A 4H4OB 4P9SA 4R0JA 4CH1A 3LUYA 2J7WA 3LOUA 4P2XA 4L3KA 3RZAA 2E5GA 3HJFA 1TMJA 3LAMA 1HBMB 1EP4A 3MZIA 2X3DA 4DR1J 1EZZB 2EG2A 4O44B 4JUZA 2NPFA 3BV8A 1SC6A 4ZITA 5HLFB 4RW7B 3UI3A 2HNZA 3ZNUA 3TZYA 2HZVA 2E29A 1X7VA 3GIIA 2ZOMA 5IZHA 3UCGA 4C6AA 2AZ3A 2XWYA 1VK3A 2XG8A 2D1CA 3M8ZA 4YB7A 5CABA 1KFSA 1PGZA 1YZ6A 3QT6A 3AB2B 1ZA1B 3JXOA 4QJVA 1M1KT 1NSKL 1S1TA 2GZOA 3DNCA 4BWJA 4YDDB 3H5YA 1D9FA 2CPHA 3I4HX 1B7YB 1TL5A 2VG6B 3EZUA 2F4FA 1K1QA 1M1HA 3CJRA 4X84A 1C2PA 3RAXA 1L3SA 1MSWD 1AFIA 1TELA 4LRFA 1TL7B 4GVLA 4BHQA 2GJ2A 5D0GA 5C25B 3MMJA 1J2VA 3NGKA 4PCQA 4TN2A 3RYLA 1FI4A 2BVZA 4LSLB 2YNFB 1NK5A 3PJ9A 3UW1A 1S1WB 3MPYA 3R7NB 4ZIWA 1NK4A 4WZMA 3OPKA 4W92B 5HP1A 4U95A 5B0GA 4DR6J 1S1VA 2VC0A 1VJWA 4F36A 4M5MA 1M5VC 2Z58B 2AF6A 5KT6A 5KFJA 3FRZA 1HLWA 1PYOB 3CCQS 4QPXA 3W9HA 2ZM6F 2G1HA 2JZ5A 3BO2A 2MQQA 3BH7B 2OPPB 2V9KA 3MR5A 2ZH1A 4NZ6A 2EFNA 1YJUA 2R7QA 2DHAA 1IJEB 3GPAA 1Q8IA 2IJRA 2M3DA 1YRUA 1FRLA 3BKUA 3NRBA 4ZVRB 3SFGA 5F8JA 1WC1A 4IRCA 1KQGB 2RF2B 2YTCA 3V4MA 2W25A 1AB8A 2MKSA 3K8WA 2BOAA 2OELA 3EPGA 2KTQA 2WB1D 1YTYA 3CD5A 2IC3A 1RAFB 2JLFA 3SCLE 2BDPA 1F3VA 2OPQB 1RTIA 2HVEA 2QFIA 3T6BA 3KMSA 2HMIB 1SL1A 1UA0A 2YKPA 4KGVB 4K2XA 2RDIA 1K1SA 2FTRA 2F4VF 1FJCA 3IC1A 3DYAB 2R8IA 1QDUB 4JV5J 4RUAA 5J2PA 2K8GA 4YN3B 1IM4A 2HAFA 1OPIA 1D3WA 2EEYA 1DLOA 3HD2A 1V5VA 1W2IA 2P6SA 1RGVA 4RBUA 7FDRA 1ZTWA 2C3MA 2HQ3A 2V8DA 3CJQA 3RRHA 3ZTQA 2RQMA 1JNRB 2PEHA 2XM3A 2V34A 3MR6A 1A7GE 1KLMB 3ZNJ1 3E2EA 3C6UB 4LFAJ 2ASDA 3US5A 2HNYA 1L3KA 1XK8A 4MJKA 1I5OB 3H7HB 3VR1A 2XB2D 4AYBD 3A12A 2ACMA 1Y9OA 3MMCA 4UZCA 4WPAA 4RNOA 4ED2A 2KVIA 3MMAA 1KEKA 1EX8A 3FC9A 4NXMF 4QR2A 4DV3F 3ONQA 5KT7A 5HQ8A 3OL7A 3KNGA 1UVMA 2RD5C 3PXGa 4X62F 1RYRA 2KRRA 3NL0A 1SIZA 2C2MB 5LJ3Y 4DN0A 1Y5NB 1Y7PA 1BGXT 2QL7B 3PFEA 4IG3A 5DQHA 4LFAF 2JDJA 1D1UA 1RKIA 2DCUB 4O3PA 3TNVA 4DOZA 2KL8A 4TU8A 3X3UA 1IBKJ 4OL8A 2CPZA 3CO9A 1W2BR 4WE1B 3BKTA 4JI8F 3OFFA 3J7YU 4A8YA 4OI4A 4CH7A 1GMUA 3MM9A 3EX7B 3MCOA 5HMYA 1NRKA 1S1VB 3WZ0A 2XTJP 3LPYA 1T94A 1ZM3A 3M32A 3CCMS 4C98A 2ZUGA 2F4VJ 2RRBA 4ECXA 2HMIA 1MROA 2ADCA 4WIIA 2AMCB 4BS2A 2B4VA 2OSRA 1FFWB 1Z1ZA 4O0NA 4NA3A 1UVNA 3TX0A 1LFWA 5C42B 1NKEA 3M30A 3EYZA 4NCGA 3CCLS 3H2VE 4WE1A 2FYXA 3UDEA 3MD3A 3ILLA 3AFGA 3J7A1 1G7CB 1TL4A 4OYBA 5KFZA 1CJTB 1ZH5A 3P96A 4NLYA 2DXDA 2DNNA 4TU7A 4DUZF 4PWWA 1FE4A 1GH8A 3FEYB 1VIOA 5KFCA 1Y5IB 5KOWA 3FSIA 1ZBTA 3KLFB 1U2RA 1JNZB 4KAIA 1KBRA 1NDKA 2C2KB 2H4YB 3GQCA 2GMLA 4B08A 1TK0A 3QT5A 4CWBA 4LF6F 4CLFA 2QYGA 3MEDB 1KQSR 2DNGA 3D68A 4I6YA 2DHXA 4ZPDA 5BR8J 2JC1A 2MB0B 3R8YA 1WKJA 4ICLA 3N6LA 4J9RA 2WVBA 4KTQA 1GMWD 2DY1A 2CDRB 3JTOA 4ZK7M 4NPOA 5KG0A 3KG4A 2ASYA 1JB0C 2HWIA 4KB7A 1IKYB 4OMFG 3H40A 4DQRA 4KR0B 3IM9A 3RTVA 3P45B 4BLGA 4USHA 2KM8C 2BKOA 3C19A 3PKMA 2DHHA 2LLZA 3HHDA 2OH2A 1I51B 1WI6A 2CJXB 3NWGA 2MZTA 3T9ZA 5J1EB 1WC4A 1H7WA 2B56A 3Q2SC 1YJTA 2E9TA 3HJVA 3UNYA 2ZH7A 1UVJA 1P6TA 2C1EB 2GO9A 4UT4A 1SXLA 1FKOB 2QLFB 3TAPA 2P9CA 4UOCA 4DR7F 2QL5B 1RWMB 4Q2LA 1NZAA 5ETPA 5A6WA 2LQ9A 2ZHAA 2HKEA 4NCGB 4KHPF 4I7FB 4HACB 4PG8A 1U0SA 5FDLB 2JHEA 4LR8A 4USKA 1HL6A 1MW7A 3UN5A 2BX6A 1FRHA 2PA8D 1CC7A 4NLRA 2MQNA 3CDWA 3VF0B 2AJFE 3CMAS 1EB0A 2LA4A 3R97A 5DO2A 2DGXA 2UVWA 2E7WA 4A8XA 4JI3J 3TEGA 2B8QA 4UQGA 3P3DA 2XS5A 4G1QA 1VBXA 2OKQA 3GFZA 1YJWS 2B9XA 3N01A 3JYTA 3QPIA 4PAAA 1NK0A 1FFSB 3BO4A 5HP1B 5EGYA 1OPZA 4ZVOB 1UW4A 3V81A 2V5HG 3D0IE 2XCAA 4BDPA 1APSA 2B3TB 2DYAA 2MLZA 4QIWD 3CJ3A 3TI0A 4CO2A 1HNIA 5KFSA 4V19X 1KP6A 3L7OA 4DFMA 1KHWA 2D9OA 2FJWA 1S0NA 5LXYA 2POKA 1JLCA 4I2QB 1B70B 3O44A 1I94J 1WELA 2CWXA 3VHQA 1QLNA 5IV4A 1MG7A 4B3SJ 1WWHA 4YR3A 3IO1A 4RU9A 1U6BA 5ETTA 3VGUA 1SC4B 2Q79A 4DU8A 1F9HA 5HN0A 4NLTA 3BBFA 2JLEA 1XMOJ 3SSSA 1REGX 1KSPA 3K57A 2VG7A 3FSXA 5EWFA 1F5AA 2KXHA 1SH3A 4Y2CA 3VWSA 1K47A 4QR0A 4WTOB 4M5IA 3SQGA 3D3BJ 1JKHB 5F41A 4F3QA 2XGPA 2HHVA 3F0NA 4JI2F 4OZ0A 4PRFA 1AZSB 1X5OA 4KH0B 2CDQA 2U2FA 5C7PA 1LK5A 1YJRA 1B4SA 2WBRA 4QW8A 1FXRA 1JJCB 1MMLA 4OHZA 3IRXB 3TVKA 2HGLA 4DPXA 5HBMB 3CC2S 3PX0A 2CZVC 1JLQB 3PDNA 1VRQC 5J1NA 3C16B 4NWBA 2YX4A 3QO9A 1LKZA 2XSJA 4KGZB 4TQRA 5KG2A 3I5AA 3KWMA 1BMQB 3TAMA 3H0PA 4LT6A 4RBTA 5A8WB 1T9VA 5HMXA 1UVKA 2V2VA 4DG1A 2HRYA 4M5DB 2HHHJ 4HACA 3RGIA 2E9RX 3AJDA 4NXNJ 1WTFA 1NAQA 2QA2A 4YY3J 4B9UA 2WVDA 2DR6A 2OEMA 3L7UA 5EHHA 2MXYA 4ZVGA 2MKHA 3CVKA 4F4WA 2KYZA 3DHWC 3PX4A 2ZNYA 3M8WA 4F2RA 1JLFA 2XSFA 4QIEA 1BY9A 3ZTOA 3KK3A 3G9CA 1BD6A 5CCLA 2CQ4A 2CQ0A 3HVRA 1XNQF 3CCVS 2MEWA 5JVHQ 1FK9B 1H2TZ 1S12A 2NUUG 3JYTB 3RW7A 2GJFA 1DURA 1HHQA 1TTHB 3B4MA 1JMTA 3OTCA 5ETLA 4O3QA 3HI9A 5I3QA 2ZC4A 5GADU 3VAIA 4FPIA 2M8DB 1QVGR 2EFVA 3M8SA 3W64A 1HI8A 2XMTA 1X4BA 4K4YA 1QUVA 3G8QA 3IWLA 3OBIA 4MT1A 5KG7A 3S7RA 3LALA 3DDNA 5L1LA 3DOKA 1FDDA 4ED5A 4ES1A 1IQZA 4RNMA 1RTJB 2DD8S 3ET6A 1SQGA 1U09A 5F3TA 1Y3KA 2XY6A 1X4HA 4Z2XA 5DDPC 3HSJA 2C3UA 4HHJA 2Y9HA 3T19A 2RF2A 3FZ2A 4F0HA 3QGPA 3T5KA 2MDAA 1IQTA 3I82A 4NCBA 3FMWA 4MK8A 1NK7A 1CQNA 2XHWA 2A6OA 2YWWA 2QTWA 1LWXA 2GFFA 2HBYB 2LA6A 5DLFA 1TK8A 4LF4F 5E7OB 5CZVA 4RW9A 2CNOB 3CUNA 1S9GA 2Y8WA 2GHPA 3JTPA 3OR1A 2W2MP 4AQYJ 2F5GA 3M8PA 5J2MB 3CULA 3UNGC 3N4WA 1K73T 3TARA 2EBGA 4LSNB 1FNXH 5LM7E 4ELTA 3P49B 2FHOB 1Q5VA 5J2NB 2AJQA 2BABA 3C2PA 3ENQA 3OTOJ 2M9KA 2Z4PA 4OYIA 2MKKA 1HPZA 2A2DA 2LKZA 2WRMA 4PUOA 1OQ3A 3MEEA 2FJAB 2IFXA 2N7CA 1RAEB 4FS2A 4A46A 3E8OA 2EWHA 4ECZA 1VS3A 1WF0A 3LH2S 4IRDA 2Y1RI 4CT9A 5F9NA 2GW8A 2DK2A 3BO3A 3P6YC 2Z2LA 1C0UA 3M2UB 3R7BB 2MQLA 5K8NA 5IM0A 5AJ3F 3CPWR 1RABB 2H51B 1YIJS 2YWKA 2JVOA 3GR0A 2JEFA 4ENOA 2LVWA 3CD0A 3S6EA 2FGOA 4YY3F 3AB4B 5DS7A 3HO1A 3W61A 4B3MJ 1Q95G 3M2RA 1CC8A 1KKHA 3NG8A 3OFHA 3M6XA 4L74A 3ZZPA 5JJBA 3C3LA 4YHHJ 1IKXA 1OQ6A 4OYZA 4WU3A 2IM2A 5D4NA 4K7QA 3VVTA 5CH7B 5L39A 3GJQB 4CTAA 3K89A 3HZGA 5DZ6A 1EETB 3CTRA 3E01B 4O44A 1HBUA 3K58A 2JX2A 1PC5A 4GO5X 2UXDF 2JFDA 3GFHA 2FZCB 4G6VB 9ATCB 2BANB 1HMVA 2YX7A 3NGUA 4EU0A 1F6TA 3FUYA 1SH2A 1NK6A 4LQ3A 1HQUB 1NDPA 3Q8VA 1I1GA 1YHQS 2YXLA 4JI2J 4MYUA 3AT1B 5C25A 1RCXB 2CQPA 4H54A 3H42A 5HATA 2CJAA 3OLAA 1GXUA 3FK4A 5KFMA 2E1CA 2EKNA 3CCTA 5KFNA 3UO0A 1I3OB 1YQHA 2FC8A 3UN3A 2IM0A 1MWZA 2NXJA 1JXEA 1RWPB 4W98A 4Y2MA 3R5GA 1VQLS 3GCXP 5F9LA 1OMSA 4NLPA 3G71S 5LOQA 2CJ9A 2OMLA 3BSAA 2ZNZA 5GAEU 2XMAA 2X3GA 4DZ6A 4JI4F 2VBWA 4CM0A 1DTTA 4Q8EA 4HLBA 3U1NA 3E3XA 3AAWB 4K4TA 2BXJA 4H4KA 3IXQA 2FJDB 5D78A 3GJTB 2LEAA 1RT7A 4OLPA 2RVJA 2CAJA 5KTQA 3J7ZT 3KHHA 4EYIB 5J2MA 1UJ5A 1FJGJ 1T3OA 5H9FK 1PJ7A 3FEXB 4OIXA 3T1YJ 4B9LA 4GKJF 2KO1A 5LMNJ 1QAXA 4S0MA 5CYQB 3R2CJ 3ZZ0A 5F8IA 3ELHA 4MFBB 2KB2A 4RO0A 2K7KA 2NXUA 5J2PB 4P10A 3CC4S 1VHFA 4WKYA 4MK7A 2AW0A 4FN5A 1AFJA 2RAQA 3K59A 4B3TF 3QGIA 1TFYA 3V6JA 3BPDA 2KRBA 2QLJB 4ICLB 5SUHA 5C42A 4RNNA 4DFKA 4DV5J 4DL6A 1YJNS 4C0HA 1DTQA 2LEBA 2ILYA 2F63A 3T41A 2NPIA 2RQ4A 1T05A 2RB7A 1S5ZA 2DNOA 4C8OA 3KG1A 3JQMA 4RUHA 2HG4A 1ZAVA 3F73A 1E6VA 1JLBA 3NS7B 4IFYB 1N0UA 3JB9k 2FJXA 2OP5A 3CJKA 3KLHA 3SEOA 2FHJD 1TL7A 4J9KA 5KFDA 4DR7J 2CUYA 1F3FA 1RHUB 2J5AA 1R43A 1RZMA 1IBMJ 3TA1A 3NCQA 3NOCA 4TNOA 2D3OR 3UVJA 2Y8YA 3FCHA 4Q0BA 2DGTA 1B7FA 4EBDA 2ZBQA 4EFAC 1Z2ZA 2YNIA 1KQKA 2DBBA 3A4TA 3RU0A 2ZWOA 3FNNA 4KV8B 2FHKA 2AJ4A 2W4PA 1RHMB 1RT2B 2CQBA 1HQEA 2XMMA 2CRLA 1V3SA 2J9EA 3THPA 4E98A 4LRBA 1PJ5A 1NB7A 3RW6A 2J6TA 2H5IB 2BACA 4KV8A 3HP6A 5D4LA 3TUIC 1VR6A 2NR0A 2MLYA 3PRVA 5HI7A 3MAAA 5KFLA 4DV7J 4IH6A 2NUHA 2QC3A 1FERA 3I0SB 5HMWA 3D3CJ 3AOBA 3NBPB 4OJ1A 3M9NB 4C48A 3S01A 2B4OA 1XBWA 3NGSA 5RUBA 3FGVA 4RLEA 3MGJA 3W8PA 1WDTA 4IO9Q 3OW2R 4M95A 4K5SA 1X0PA 4DR2J 2GX8A 2KT5A 1VMBA 1BUXA 1IJFB 5T41A 4O4GA 2BA9A 3OTEA 3DLGB 3LTOA 3AH6A 2CQCA 2PE8A 3BYRA 4NZ7A 3PIPQ 3FCVA 4DPTA 1ZPVA 2R7TA 3DOLB 4OZ1A 4FYYB 2Z30B 2MZQA 4BBYA 2ACYA 2HVZA 4LF5J 5THWA 4IKAA 4JI1J 4DI6A 3GV7B 1U6FA 1R8HA 4U8YA 2QL9B 3DFEA 2CPXA 1XR6A 4GC6A 2AYMA 3MEDA 4NL5A 3MM5B 1U49A 2YKOA 3KUGA 1TV6A 3MECA 4WP8A 4Z7YA 3M8PB 2ZH9A 2BRKA 1WEYA 5A76A 5F8HA 4NEZA 1K0TA 4WWSA 2GS8A 4NA2A 1IBMF 1T7PA 3MCNA 2VQEF 1RLDA 4FDFA 4TXSA 4BC7A 3KTQA 3DYAA 1V3RA 1MMNA 2XZTB 4LSZB 3R7SB 5HVGA 1H0HB 3POTB 1IBKF 4ZJLA 5D77A 4N56A 4ES3A 1RAHB 2Z2ZA 3SCJE 3MM5A 2R4FA 5G0RB 4F7VA 3KLVA 5LT5A 1HI0P 5T7LB 4WFYA 4K4XA 1C0UB 4QYZK 2NS1B 2IC3B 3F56A 1S6OA 1BXNA 4NYZA 1ZYQA 2LU1A 2VPXB 3W9JA 4YB1P 2UXBJ 4LF8F 5A8KA 2ZBRA 4XDDA 2AP6A 4B9SA 4JI7F 2AIRB 4MKYA 1OJ4A 2WVFA 2M2BA 2I2YA 4NLGA 2CPYA 2O01C 4PG5A 5ETOA 2BOPA 4O3NA 1R3NA 3A3NB 2GMHA 3W8GA 2DCLA 1RE1B 1FO1A 2VASA 3C8YA 4XAKA 3VGVA 2B51A 5E2QA 2XY7A 2EC0A 3HHLD 2LFVA 3EGWB 1N4LA 4OX7A 2GMJA 1RI7A 4FKYA 1NU4A 2Y0BB 1ZPWX 3MM7B 2FGCA 2C42A 3GCWP 1WUUA 2E5LJ 1DJ0A 2C2RA 2C28A 2J8AA 3ILIA 3I96A 1HMVB 1U24A 4OHVA 4K5RA 5H1SV 3BQ0A 2VZ9A 1QSLA 3D6MB 3N6MA 2FJBB 4ZP9A 2D41A 3RG6A 1R8PA 2HYIB 3CD6S 4X66F 1MMDA 4X62J 1Q1KA 1U1PA 1HYSB 3KJVA 2YPZA 2HLTA 1X5SA 3H5XA 3Q8UA 3BGUA 4OZNA 1HQEB 3DOKB 3FEZA 4I6WA 4OJ3A 2OTLS 2IBKA 1KRPA 2UV8G 5LL6d 4DR3F 1DRZA 4AL6A 3H5SA 4ECQA 3DCAA 4I64A 1PJ6A 2W9CA 2CFXA 4DX8H 2CQGA 4KGKA 3RAQA 1FKAF 3PV8A 3EGNA 1U1RA 5LSRA 1VGYA 4DSKA 1FVSA 2FQQB 1K44A 3DU5A 3NGRA 1WACA 2BUNA 3IAS9 5CYJA 2L48A 1HR0F 2NREA 3PW0A 1CLFA 4I6AA 4X2BA 5D0EA 3GTYX 3NWRA 5MLCV 3M9OB 2ZWPA 2J7KA 2J7UA 4RKUC 1FWPA 1OY6A 2H65B 3DRPA 4ECVA 1W25A 2R8KA 2F9DA 2FLOA 2MLXA 4RW8B 4YB5A 5B0FA 5FD1A 1FWKA 3IM8A 2VF3A 3PTWA 5L46A 2HIQA 1FKOA 1IKWB 1FXDA 3KKFA 1NSPA 2NZCA 4KYZA 3SCKE 4DQIA 2R7SA 1R8CA 3WC0A 1F5CA 2AJ1A 4EI2A 2BW2A 1CJKB 4X4QA 3B8HA 3CF5Q 3IR6B 4KH1B 4DX5A 4Y0FA 1VQMS 2VH7A 4MK9A 2VA2A 1IKWA 1RWNB 4PPZA 5B7WA 2E1PA 5KFEA 4KE5A 4DLGA 1T3NA 1RTDB 5HK4A 1JLQA 4WFZA 3ZZTA 5GAHU 4DL2A 3BR8A 1OO0B 3RB4A 2I8EA 2YKNB 4NLSA 3MPUB 1WKLA 4OYWA 4ZPVR 4EUVA 2BE2A 4DPOA 2LCWA 2WAQD 3CJKB 3UR0A 4PG6A 3K5NA 1IXKA 4DV0F 1HBOA 4NMLA 1RTZA 1OYEA 4DFPA 4JYAF 3JSYA 1FF2A 2ZE2A 3BS9A 3DC2A 4Y2AA 1FVQA 1T95A 4F4AA 1Q16B 5E3RA 2Q1LA 3EPIA 3WQPA 2PI4A 3Q2TC 5KFXA 3D6HB 4DR1F 1E6YA 2Q3PA 1FCAA 4IFVA 4LBPA 4OJHA 1UP1A 3PZPA 1V9OA 5IT0A 3V6DB 4WFAQ 3PX6A 4OHXA 4CCHA 2BJ3A 2AHOB 3IBWA 1JX4A 4KJIA 3TX8A 2P9GA 3JSBA 3EDQB 3BR9A 1JJ4A 4IQMA 2PN6A 1D8YA 4A8MP 5KFWA 4DUYF 1URRA 3OL9A 1EARA 4JBCA 3KDOA 2XMVA 4J9UE 4KHMA 3DMJA 3EE3A 4CLYA 1RT3A 5HJXA 3KJVB 3K5LA 3B78A 5CD4A 4DMZA 2E5JA 4FNHA 2DY9A 5LJ5Y 2G4BA 1T11A 2UUBF 3D28A 2FVSA 3ITHB 4IH5A 4ZHRA 1DHMA 1EKSA 1FD8A 4TU9A 3O3LA 3QRRA 2HBZB 2DXEA 2GNKA 1HBOB 1RSCA 3TP2A 4RNHA 5HMZA 5IWAJ 1LWEA 4KGXB 3MURP 2DNKA 4LRCA 1S76D 3CMES 1N5TA 2V2ZA 1UA1A 3TZWA 1RACB 2HGNA 1U8SA 4LJMA 1VJQA 2RKIB 2RDJA 2ILZA 1E6YB 3QSYB 3ILOA 1K9MT 5LMUJ 4KPYA 1RAIB 4J7CA 1F9EB 2MZRA 1WHWA 3D67A 1TUVA 3BGLA 2VU5A 2CWKA 2XNQA 3DRSA 1PYSB 5KFYA 1T9UA 1H98A 1VRTA 1SC1B 1U7LA 4JB8B 2W9CB 2M4MA 2VODA 4N8OA 1CG2A 3DOMB 4HH1A 4LVOP 3QRPA 3GSIA 3RUBL 4B3OA 2GIQA 5D15A 1QAIA 2W8LA 1JLFB 2B9WA 3JQKA 4MKBA 1UWBA 2D74B 4OV1A 2P9EA 3TR5A 4OX9F 5H9FJ 3U1MA 2VJUA 2NQPA 2ABYA 2HFZA 1KS2A 1TL3B 2GIFA 3NXZA 5KG1A 3W9IA 2B9YA 1NH8A 4M5GA 3ZZUA 1UJ6A 3GG0A 4QWDA 2KH9A 3HK2A 1LQ9A 2W2PP 3BGFA 1RHQB 2VL1A 1HPZB 4PEOA 5F3ZA 3RR7A 3DU6A 4TKTA 4YEAA 1ZA2B 3HHKA 2DT9A 3NKYA 4Q2MA 4ZKAA 3MFHA 4J9LA 1BWEA 5AT1B 4DPYA 2EBEA 2NSCA 4N47A 3WIVA 4E2FB 4OJGA 2AZ1A 4RX6A 3D0HE 4KGMA 3OHBA 1NM2A 3GZ7A 1K0VA 3DLEB 3HX9A 3KLHB 1RT4B 3ZTRA 3IRXA 3RRKA 2C22A 3JAMU 2GJIA 3CMQA 2C3YA 4CLLA 1HWUA 1YRTA 3M2VB 4DXLA 2V63A 3SZ2A 1H73A 1VQYA 3T5LA 3NAIA 1Q4RA 2CQDA 1PAUB 3QIPB 2OHDA 4JOUA 1IR1A 2WW8A 3H5UA 4A48A 5IFMA 1NJXA 4CLTA 4DX7A 2MY7A 3HXMA 5LMNF 2C2DA 1B0TA 2PGCA 3BQ1A 2E1MC 2E1AA 2V2KA 1GXTA 3DLKB 1GFWB 3DM2A 1H3DA 4Q5VA 3HSGA 1S9EA 2VKZG 1SKWA 4G3IA 4W90B 1A6LA 3GONA 2W2OP 2JJ4D 1JLAA 3L4BC 3OR1B 3M2VA 3BQ2A 1U45A 3ENVA 1XQIA 2VBXA 4R8UA 4LBHA 4LFBJ 1S1TB 3M6WA 5ADZA 2Y3YA 3Q86A 2HLUA 3U02A 1ZAXA 2DNPA 3MTJA 3IG1A 4USVA 4N76A 3MPVA 1D9AA 3T6JA 2MQOA 5B09A 3D4JA 2YPYA 1C1BA 3FBBA 1NLKL 1TL3A 2H9ZA 5EN1A 3CW2C 4PXBA 2FUG9 3W3SA 1S7IA 1YJVA 3ISNC 4ZCLA 3VQTA 1Q7YT 2YBVA 3OR2B 2VOPA 1X0FA 4H4OA 4GKJJ 4YMEA 2WHOA 2IYGA 1R31A 2YY3A 4EO6A 4DR4F 3VAJA 1XEZA 2XYGB 2G0IA 2AX0A 2R3VA 1RBOB 1SV5B 2DO0A 1SB6A 3G82B 4YP3A 1RT4A 3Q8SB 1L3UA 2BQUA 3RBEA 1J5EJ 2DNMA 2JRSA 1RCOB 1D0EA 4M63A 1RT5A 3D7SB 3DRRA 1FRJA 3TANA 4I0WA 1TUGB 3LANA 3MPWA 2VPZB 5EUHA 2RU3A 1N48A 1NJYA 3H2UB 2ZKUA 3V4IA 4K0KJ 4ANEA 1ZTTA 1XC9A 1WOSA 4FVMA 2D7SA 1NMEB 3MMBA 2DVIA 3MAQA 1UEVA 1T02A 4CDIA 3IBFB 3DKDA 1HQUA 2IDEA 2ROPA 2DR9A 3TW0A 4DR4J 2HBRB 1Q82T 2XCPA 2HRTA 1WKKA 4LF1A 4CQ1A 2E5LF 4WJBA 1VISA 2D3ZA 2HQCA 1IKXB 2MKJA 1VLOA 2CJKA 4M5LA 4DSEA 5GMKa 1LOUA 3NEKA 3THTA 3KLIA 2BE7D 2NXNA 3QQCD 3KK2B 2V8HA 1TKXB 4G1IA 3QT7A 4Z7CA 3BJYA 1RA6A 3T9NA 3TZZA 2V50A 1VFJA 3CEDA 3W62A 3PIOQ 2VHGA 1U1LA 3VAFA 2JEJA 3VVUA 4JV2A 2IVMA 5JXSA 4NMXA 5M2UA 5DG7A 4ILLA 3Q22A 1C1CB 1N33F 2R8HA 2P6TA 4CO1A 1FEHA 4HHHA 1HNVA 2OPRA 3R27A 4J37A 2CADA 5EWEA 5GMDA 2VUGA 3MDFA 3HMJG 1JJHA 3MCSA 3R9LA 4D3GA 3HF5A 2X7IA 2OPQA 3UD3P 2E5IA 2ROGA 2R7RA 2FHMA 1EHWA 2PA3A 1P1LA 3MR7A 3ULHA 3WIUA 4A8QA 2K7JA 2ZOFA 4B9NA 2GO8A 3UQSA 4PR6A 3SCIE 3ZZZA 2NSBA 1F2HA 4CYUB 4J9NA 2LQ5A 2UV8A 5DQGA 5CZXA 4WFXA 2LMIA 3AD8C 1RWVB 1REVB 1HWKA 1S1XA 1HNVB 2OPRB 3D54A 3PRDA 1S6QB 3LW5C 4HDHA 3VCDA 5B0BA 1P8GA 1GX5A 1B64A 4ECWA 3HULA 5AXNA 1Q79A 2D3UA 2GQ2A 3KUHA 1RHRB 3NAHA 4N8NA 5GADI 2CJYB 3GFYA 1WSRA 1WOPA 1FA0A 3Q83A 2KG1A 3OVSA 1DAXA 5KT2A 5F8LA 4UW2A 2N3LA 3SXLA 1WG5A 2JOQA 2LXUA 1XJWB 4JP8A 2O5DA 4UTGA 1TKTB 4FYXB 1BQMA 4Y28C 5H9EK 2ZJPQ 1REVA 4ZCIA 1RAAB 1PAEX 2C2EA 4MMOA 5KFBA 4NEYA 2XQCA 4P7VA 3HSDA 3TAQA 1ACMB 4ZVPB 3DOLA 2ZZMA 1EKRA 4FXVA 3PYEA 4DL4A 4K4SA 3PACA 3L95X 2NXEA 2IMOA 4Q45A 1FRMA 2RS2A 2HFNA 3BN7A 3PYGA 2V8GA 4U96A 4F25A 2ZJQQ 3IWNC 5BYRA 3GJRB 1S72S 3J7AN 2OI2A 4ED7A 3I0SA 3NOGA 4UOFA 5GAGU 5JUMA 4PWDA 1E6VB 4EBEA 2FB0A 3G6VA 2CZ9A 4L76A 1CEZA 2SXLA 2IDLA 4LIWA 2J8SA 2QMWA 4XO0A 4DV2F 2IRXA 3NNHA 2FLNA 3CCZA 1UWAA 1F1BB 3LPEA 2BM1A 5L1IA 1QM9A 1UFWA 1RWWB 3AHPA 4GVBB 2VFUA 1UJ4A 1QTMA 5KT5A 1FDAA 4ZVTB 4LMZA 4O3OA 2V4QA 4PKDB 2ZH6A 1HIYA 3KJNB 5ETMA 4YS2A 1F2GA 5J2NA 5JVGQ 1Y00A 5DM7Q 4JI6F 1NDLA 3UCUP 2M0GB 3GFXA 1S79A 4FYWB 2AJ0A 2XY5A 3RB6A 1SC3B 3IWXA 2GC8A 3BGRA 1HWJA 1JJ2R 3PR4A 5F0UA 2QLWA 3TEHB 3FKBA 1U1NA 1WSVA 4QR1A 2VBYA 3GB0A 4LUBA 2JEGA 2YNGB 3BM7A 5D4OA 2HHXA 1FE0A 5M2RA 2ZDPA 2NCKL 3DHXA 3HVAA 3BSCA 2IRYA 1U47A 2QMXA 4CLUA 3IR5B 1HA1A 1FESA 2PMHA 4DHVA 2VQFF 4ED3A 4ZLLA 3KJQB 4QIFA 1ZETA 3MM8A 1IVZA 4M1KA 1MROB 4NE9C 2IPOB 1RJJA 2BJ7A 2DH8A 3GIRA 2ZDOA 4I69A 4RWXA 4CI0B 5IT9Y 1S6UA 4OI2A 2R2TA 3KK1B 4DV4F 2KKHA 2PT0A 2VG7B 5FLXU 2BJEA 3J7Z5 5LMUF 3P5TL 2OSQA 2IJNA 2DRBA 1Q5YA 2PIIA 4FKXA 3MR2A 3FCWA 1HBNB 3CIMA 3I55S 2VJVA 2GVZB 4F8RA 4JI5J 4LF8J 2YQ3A 3POTA 3K5PA 3H4DA 4F4YA 1OWXA 1T03B 2IM1A 3O6QA 2YWFA 4LR9A 5K8PA 1LNQA 3NP5A 4YFUA 3LP0B 4C11B 1WF2A 4ZA1A 3BZQA 1VHIA 3OV7A 3HLUA 5IC6B 4ZCMA 2Y1JA 3C46A 4RW4B 3C66A 4WYWA 5KAKA 2M8HA 3N9UC 1PBAA 2EPIA 4B3RF 3CDAA 1X5PA 1VQPS 3QJLA 1SIWB 4DBQA 4J9QA 2XMWA 4RJVA 3DN9A 4I68A 4QU7A 3D9BA 5A8WA 3IBCB 2HWHA 2V4RA 2QG9B 1B99A 2IMWP 3SBMA 2C2OB 2W1BA 2F8MA 4DR5F 3EDRB 3ICLA 1P27B 4PWDB 4ZP6A 4RU2A 3BDPA 1ELOA 1JLGA 3N79A 1N5VA 4TY8B 1H72C 4DSIA 1QVFR 1TR0A 3BSOA 1ZM9A 3N6NA 4XIUA 4LF9J 2JEIA 2IY5B 2CQHA 1U8WA 1SL2A 2GHVC 1BQNA 1VRUA 3DGPA 5DGBA 1IBCB 3PCOB 1JXVA 1VBYA 3RRGA 3R2DJ 3G96A 4M5NA 1RYSA 1YK9A 4Y3CA 4CLWA 4DV0J 1ZS6A 2AQ4A 1G3OA 3EVWA 5KT3A 2QA4S 4ELVA 4DV1J 1FTCA 2MZJA 1SJRA 4DUYJ 4JI3F 5E3CA 2UXCJ 2XGQA 3A8EA 2CNKB 2GVDA 1N33J 2HVIA 5ETNA 1TL1B 4I56A 2OEJA 1U2FA 4JV0A 3X1LB 5E33A 4ZJQA 4O0IA 4K4VA 5KFRA 2G2OA 2J76E 4E0DA 2MKCA 4C8KA 1G2EA 1WF1A 1QSYA 3PJXA 3QRQA 3QJPA 5AE3A 1QUPA 3M6VA 4ID8A 3RB0A 3AOAA 1S0MA 1FDNA 1U25A 3OUYA 1KR4A 2B4PA 3QWPA 4EBCA 2GV1A 2LDYA 1VCTA 3CJ2A 3GSDA 3UR3C 4P72A 2HQFA 4R25A 5SZTA 5C24A 1ICEB 2KZMA 3M2UA 1BE4A 2IHR1 2K06A 3M1VA 3MM8B 3OQ2A 4IG0B 2WB4A 4K50A 4DV5F 4AD6A 3LQVA 5L8RC 4OYPA 4AE5A 3KUEA 1AZSA 1HWLA 3L9ZA 2LXFA 3D1QA 3V81B 1HR0J 2BV3A 3BH6B 3HSZA 2XLKA 2F65A 2R7UA 1IM6A 1YZ7A 3KK3B 3VGSA 3LGNA 3C14A 3MEGA 2BE2B 4DCPB 2O1PA 4IDKB 2CQ2A 2FPHX 3NLCA 1KN6A 4NLQA 3SI8A 1R27B 4YOEA 1C4AA 1S99A 1SUQA 4CTAB 3TJ9A 2DPJA 5FJ4A 1HI1A 2DNQA 2QA1A 1UTAA 1WG4A 5H9EJ 4B3RJ 4EMDA 3TJAA 1T9WA 3OT9A 3J81U 1X4CA 2L41A 2KG0A 4N41A 3QT8A 4Y6IA 2AKWB 2QLBB 2NXCA 1QD1A 1WEXA 3I4PA 3EXCX 1YI2S 4NASA 8AT1B 2KHCA 3N0VA 4C0OC 4F02A 4LF9F 5CYMB 3TVZA 2N4CA 2G0JA 4WP3A 3T5JA 2Y1IA 5BYSA 2EK1A 1SKRA 4A8FA 4C8ZA 1VQ9S 1NPPA 2ZVIA 3EICA 4IOCQ 1UWBB 2VV5A 3MFIA 4LF4J 2OD4A 1JQGA 3PHTA 1WG1A 1B0VA 3ENAA 4P6QA 1RWXB 3PEJA 4WTYA 2WTFA 4J9MA 2AEJA 1PSDA 4M5HA 5HQLA 4NLVA 1TAQA 4W4MA 5I42A 4DS5A 2V8VA 5FIIA 3W2WB 3ZZRA 1IBLF 1WC3A 4DS4A 3TYTA 1AXQA 3OTDA 2V4JA 5J1PA 3VAKA 1RA7A 1X8DA 2VPWB 4P2FA 4C3MA 5C24B 5LXRA 3DI6B 1P9QC 1NUEA 4MTPA 1EQ0A 1NO8A 3T1AA 2MY8A 4MIAA 4OZ5A 4OYAA 1TKXA 3UE2A 4F26A 4C0BA 4E8UA 5F0WA 3PW2A 1NNDA 2K3KA 2EVZA 1NH7A 1RT7B 3MAHA 2OGUA 2HQGA 4N5SA 1Q81T 2HHWA 3ITHA 4ZHRB 2VDIA 1S4EA 3BBCA 3TUZC 4AL7A 2UXCF 2HHUA 1DFDA 4ZVFA 4XPEA 4DV1F 1TKZB 2R7OA 1YSJA 3AA9A 4BC9A 1NXIA 2X1AA 1BWVA 2MQMA 2IYIA 4X4TA 1LWCA 2DEIA 3DDIA 2XMUA 2JLGA 3K5MA 2J0QD 4JI6J 1ZZFA 2J0WA 2QSWA 3HFVA 3UD5A 4KSEB 3VQSA 1U48A 1XIQA 3AA8A 1YITS 4PG7A 2QSFA 1SJ1A 2XSJB 2H1YA 3W2WA 4DCOB 2B4UA 3B82A 4CNYA 1U1OA 1HW8A 5J2QA 4UY85 2EFPA 1S9EB 2ZUAA 3LAKA 2V4JB 3N28A 4AT1B 3CSKA 4IFVB 5MAOA 4YQWA 1U0HB 5E3PA 1NJIT 3GYNA 1N5YA 1X4EA 4C3LA 2UUWA 4ECRA 2H5JB 2Z0GA 3C14B 3MEGB 3H59A 4NOHA 2XZWA 1YBUA 3WHIA 1P1TA 4Y00A 4F67A 2ZJRQ 2OPSA 2ZOGA 2BANA 3SMZA 3TVYA 1BQXA 2HWTA 2XMJA 2GHWA 2VQEJ 1FJEB 2CYYA 4ZVQB 4HKQA 3MTKA 1DQ8A 1RHJB 1OSDA 3D1HA 1YJ9S 1N34F 2JFKA 2RUGA 4DZDA 2VG6A 2YQ1A 2O67A 3LWMA 2UUCJ 3CC7S 4M8LA 4KBIA 4ZVSB 3DRYA 4KHRA 3SSQA 3JS9A 4NZ0A 3RBZA 4JI5F 2XMKA 2CPFA 3H25A 4USUA 2DGUA 2LU2A 2G1DA 4DV2J 3LGHA 4DV7F 5A8RA 2ASJA 3SDEA 1X9MA 1RT1A 1N5SA 5I3PA 3O2IA 3R5AA 2UUAJ 2L9DA 4R8UB 3ZZYA 1FRKA 4K59A 4ER8A 4D3HA 2HNDB 1M5HA 1YG0A 4ZPBA 3G8SA 1DBDA 3G4SS 4DN9A 1FJGF 1HWIA 2IAJB 4KKOA 3T5HA 2M5YA 1CJUA 5EX3A 1VIXA 2HHPA 4A8WA 1KVJA 3THVA 3BDEA 2FVPA 3NCRA 3TA2A 4TLRA 3BPSP 1XERA 2OPSB 2QE5A 1CULA 1GQEA 3VV2B 5C2GA 2HS4A 4JI4J 1RLCL 2AYGA 1H38A 3DLGA 1R8AA 2F9JA 2BQRA 3PM9A 2A6MA 4OZ2A 4FF3A 3MHYA 2RRNA 5DRKA 2HBQB 2IVYA 5J2QB 4LVNP 2HQDA 5D4PA 1X4AA 4CNZA 2ASLA 4QCLA 2OFHX 2E9ZA 4Z37A 5E0OA 4UOGA 2RUSA 2KHDA 2OUGA 1WC0A 2EFGA 4PQAA 1X9WA 1FX2A 2YKQA 4OI0A 1NBEB 1T9XA 2W01A 2XULA 3NS6A 1PO6A 3TUPA 1S1UA 1FFGB 3QAEA 4AXJA 4QPTA 4CO4A 1WDDA 1LWCB 1ZM2A 4ZLNA 1XR5A 3MOZA 3R1HA 1I6JA 2HNDA 5IT4A 2UVVA 2O3DA 3OXLA 2OJ3A 2IIHA 4G1PA 2LECA 4H4MA 4PQUB 1S7HA 3CGIA 5ETSA 2VG5B 1LFPA 2UZAA 1FDBA 1WEZA 4H4KC 4RW6B 4ZPWR 3SSRA 5BXIA 6AT1B 2RQCA 4USIA 1LW0B 4CLZA 2BQ3A 2DPIA 2J9CA 4J5OA 4O3RA 2YWEA 3PNIA 1MNEA 4GRSA 4USMA 1CJTA 3R5CA 3PYDA 3QO9B 1FKPA 3HHLB 1O51A 2PC6A 4ZIVA 2GIRA 3HT0A 3W5ZA 3AXMA 3DLKA 2W9AA 2HFSA 2PI5A 2O66A 5A0YA 4WYLA 4DQPA 4WFBQ 1V3ZA 1S6QA 2DJWA 3TJ8A 3A1YG 4ED8A 3D2WA 3GYXB 4N7TA 4ALZA 1LW0A 1VQNS 3CWJA 5CQGA 2W4DA 2YNFA 3RR8A 2DIUA 2X1GA 2YNHB 4HR2A 2MHEA 4DR5J 1N52B 2AYBA 3DDKA 1A9NB 4EO8A 2H48B 3IS9A 4YUDA 1MN9A 1AT1B 3FFIB 5E3QA 3L3CA 2JWNA 2LQBA 1RT3B 1RDRA 1DARA 3GJSB 1WJ9A 4IOBA 3W1YC 2LXIA 4C7QA 2V69A 2AD9A 2FVRA 1MWQA 3WC2A 4F2SA 1RT1B 4C3KA 1M5KC 1GXLA 2GVZA 1I94F 5BR8F 4P52A 1SI9A 1IUJA 1SJQA 2OPPA 2CKWA 3I5BA 4ECUA 4WKRA 2XNRA 3KYLA 2VOOA 4PZVA 1WHVA 2VC1A 2DR8A 2R7VA 5KFKA 2RSQA 3JSMB 3OFGA 1RXOB 2RQKA 4ZLJA 2Y0SD 2M7SA 5B0AA 2QGFB 2WSCC 2ZFHA 1JIHA 1PCAA 2XLJA 4QU6A 5HL7Q 2CPDA 2UXDJ 2CQ3A 2MZSA 1H7XA 2P8IA 1F5BA 1N6QB 1MLAA 1RTJA 3ET6B 1QAJA 2OAUA 2PD1A 1GNKA 1HBMA 3QJJA 1DTTB 1N36J 4CYUA 3QGHA 4OZJA 4ZJOA 5EWGA 3HDSA 2NLWA 4WU2A 3BN4A 4ZP7A 4LSLA 3AQOA 5DDQC 3MCMA 4L73A 9RUBA 5A2QY 3FDSA 2MZ1A 1NB2A 4DR3J 1N56A 4O4GB 3MM9B 3DLHA 3I0RB 2WSFC 2RDDA 2ZBIA 3KLGB 3M9MB 3D1OA 4OI3A 4LIRA 2FDNA 4ETZA 1TFWA 5E3AA 4A4JA 1J5OB 3DLBA 2WBMA 3EMTA 2MMYA 3BB5A 4M94A 4KIAA 4RW9B 5KFHA 5K9FA 3EXYA 3MUVP 3C6TB 4IRKA 2YNGA 4J91A 5K8OA 2UXBF 4G1QB 3KLIB 2JSXA 6FD1A 3HM9A 2ZEJA 2Z2MA 1RTIB 4J9VA 3TQ1A 4WIQA 1NHKL 3CJ4A 5D0RA 4ZDNA 1XTZA 5AXLA 4H4MB 2BJ1A 4L72B 4CO5A 3GV8B 4ELUA 1GTHA 1MN7A 1RT6A 4QIGA 2H54B 3G2XA 3TUJC 3UDVA 1GT8A 4NI2B 3FFIA 3OSPA 1U1QA 1TL1A 2J9DA 2W7AA 1ROFA 3H98A 3ZC4A 2WONA 4FS1A 3H20A 2RRAA 2OD6A 1VC5A 2ZBCA 4USJC 3ZTPA 1D09B 1F9FA 2CIMA 2CVEA 2V67A 5AXKA 4ZVUB 5KOXA 3IRWP 4WK1A 3CCES 1FX4A 2BM0A 4LF2A 3CJTA 3MPDA 4JI7J 3QNWB 1R6VA 4FF1A 3JQJA 1QY7A 1HBNA 2CXEA 2KDOA 1XWLA 1U1KA 2ATLA 2IA0A 2P5VA 4IDKA 2BJ8A 1DLOB 2BJDA 3D0GE 5KFAA 1VQ6S 1R0AB 1D8ZA 2XBPA 3GU0A 1S1XB 3SIPB 1IKYA 3KJFB 1JLAB 1JLEA 2BEFA 3GE9A 3LGMA 1CS4B 3VZIA 5A6PA 2MQPA 3VAGA 3ZZOA 4EZ6A 4ZN3A 2R2UA 1YWXA 3VGTA 1BLUA 2HPUA 5A8KB 2HVHA 4U6PA 2XWXA 4UUXA 4P2SA 4F4KA 3EUNA 1Z4UA 4TLQA 3ZFVA 4V19J 2CNNB 2FVCA 3QYYA 1HYSA 1M5OC 4DF4A 5B0CA 4HEA9 1RTDA 1FHTA 2NZ4A 3OL8A 4GKKJ 2VFSA 2XHCA 1FTRA 3S1TA 2B9EA 3TO8A 2MSSA 3AJ2A 1YJ7A 1QAYA 4LFBF 2R8GA 4B9TA 3QAUA 1XMQF 2V68A 1JWWA 2DNZA 5KFFA 4NX9A 1KLNA 1M1GA 2CG8A 2XYHB 3CCWA 4ED0A 4IR1A 2ZHOA 4DDFA 2V9WA 3DGVA 3KHGA 2XI2A 1IR2A 1B0PA 1NSAA 4EYHB 3NCPA 2KVQE 2IBOA 1S59A 3WX8A 5L38A 3UN2A 4X4UA 4DR2F 1M0SA 1CULB 3CT9A 3GV5B 1XN9A 3ILJA 5E41A 1X5TA 5HROA 1KONA 3V6KA 2N4DA 1G4CA 3QWUA 5D3GA 1TVRB 2DHSA 2KT3A 1WC6A 1Y5LB 3FQKA 3FVYA 5K14A 4ATNA 4X65J 1O6XA 1DQ9A 2K2PA 1Y11A 4OYMA 2W7OA 2HURA 3GP9A 2N7YA 1PG5B 4ZPAA 4DR6F 2ZH4A 4U67Q 3K5OA 1VQSA 1WI8A 3IFEA 4U9RA 3PR5B 2G13A 4QIVA 3W2VA 3Q8PB 3G8TA 1FXLA 5EX0A 1NK8A 3C15B 1RAJA 2ZH2A 1R0AA 4HTJA 3O1LA 2DIVA 1HD1A 5IT9U 1NEEA 4QWEA 2A2CA 2DNRA 2HSEB 3FMBA 3QLHB 4OFZA 4B3OB 1H6KX 1U6ZA 2HK2A 2C2ZB 3QATA 3E51A 4MH8A 1WOOA 3UDLA 2CPIA 1B3TA 5GMEA 2DR7A 3GIJA 4WZQA 4OX9J 4DJBA 5DLGA 1EAYC 2KJWA 4DLEA 5I4MA 1RU1A 1GMWA 2YVSA 3Q89A 2B5JB 2HGMA 2PFDA 2YKAA 3LP2B 4I7FA 4OX6A 3A8JA 3ETMA 3ISZA 4WXOA 5AE1A 3TRGA 3Q23A 1U4BA 1RT6B 1RKJA 4KHPJ 3DOMA 2CA9A 5J1EA 4UZBA 4L3NA 1FNMA 1KLMA 3GYGA 3QLHA 5LSLA 4B3SF 3QBCA 4IQXA 3KHLA 4O3SA 2MKYA 3DI6A 1BQNB 1VRUB 3NMAA 4RZRA 1S6PB 3A8KA 2GCFA 3W65A 4F04B 3OVBA 1VQ5S 1KHVA 4X4RA 1O5JA 4ZLPA 2N82B 5ETRA 3KLEB 3W2VB 3CCSS 1R6YA 3CB4A 4LRAA 3KK1A 4IOAQ 4DSLA 5D8HB 2EI5A 2GGPB 2Y1LB 3R5JB 1JK9B 2QLXA 2EFQA 1OY8A 1S6PA 3A3PB 4QW9A 3OUYB 5HBMA 5B08A 2RU9A 2VFVA 1TU0B 3KLGA 4DL3A 3MOJB 1RBAA 4HHUA 4PG4A 1IN0A 3CE8A 1NJWA 4IR9A 4F50A 5K14B 2DGOA 5IV3A 3HFKA 3J81j 4C2MA 1VOMA 1NSQA 2Q6BA 2ZZNA 3SQGB 1CSJA 3OLBA 4CO3A 1TP7A 4DQQA 1J27A 2DNYA 3W5YA 5CYMA 4RUBA 2KZZA 3J80U 3D6FB 3IN5A 4FF2A 1BQMB 1G1XA 1KTVA 2DGVA 2IAJA 4KKOB 5KFGA 3NGDA 3M8RA 2YX1A 4ZP8A 4X4PA 1C1BB 4ILRA 1U1MA 2PMZD 4NLOA 2VA3A 4UF4A 4O23A 1VC0A 2COLA 2BMBA 3MM7A 1X4DA 3CD7A 2QYCA 3OL6A 4ERDA 1EQMA 1FRXA 2HRUA 4M5KA 3WDOA 2FVQA 1XNRJ 1SUQB 2YWHA 3VAHA 2DNLA 3DM2B 1RISA 3KXDA 2ALYB 1K8AT 2ADBA 2HQIA 1L3VA 4QOTA 2YKMA 1EJ7L 3G6XA 3CCUS 3T3FA 4PXCA 4IH7A 4DF8A 1GAOA 3CO0P 2ERRA 1X60A 1YBAA 1UKUA 4FBTA 3H4BA 1VQ7S 4ZMMA 5ETQA 3AXKA 4YHHF 2EG1A 2FD2A 2CQ1A 2DNHA 3I0RA 5K20B 5U47A 2ZBPA 2EC2A 2K1RA 2QX0A 2CNLB 1Q86T 2WCXA 3FQLA 4Y65A 5LSOA 1RK8A 4TQSA 3W63A 1LXNA 1UVIA 2WSEC 5KFQA 1NK9A 5L9NA 3G86A 3SDEB 3K17A 2HZCA 3KLEA 3HKZD 2OLWA 4O4RA 1UAWA 2Z2YB 3M6UA 4YB6A 1FNOA 2ZH3A 2RILA 1UZHA 2DKOB 2J6UA 2DRAA 3P4UB 4C8NA 3JAMY 1VBZA 2XS2A 3NNCA 4RNFA 2UVRA 1UPMB 1FEEA 1VI7A 3BGRB 4DPWA 3K8VA 3ENWA 5F8NA 2B6AB 1KC8T 2F8HA 4B9VA 2J0XA 1JLCB 1GEHA 4I2QA 5KFTA 2EK6A 3G87A 4CIOA 4KO0B 1PIEA 2H4WB 2XLIA 4LF6J 2PSZA 1AROP 2WZ1A 3MWBA 4CP5A 1X4GA 5CAAA 2XC9A 4ED1A 4PQUA 2MSTA 1LV5A 5BJRA 1OYDA 1NHUA 3B4DA 1J5EF 2H5EA 2OMOA 2GVDB 1M90T 2UUTA 3MMBB 5IQ6A 4DUZJ 4FXDA 2V2QA 1LW2B 2ZVSA 3DLJA 2C3PA 2XEXA 3EZOA 4PWUA 4ECTA 3RBDA 4X4VA 5I3UB 1JLEB 5IS2A 4LF5F 4JV1A 1W26A 5G4DA 1X31C 2HFUA 3B6BA 1JXLA 2CPJA 3C16A 2GAHC 2KN4A 3S8SA 4USWA 3Q0AA 1TKDA 2D3O1 1Q8BA 5KFUA 3ZO7A 2LDIA 3MM6B 4F4XA 2GQQA 3AJ1A 1GX6A 2EXUA 4CRJA 1TQLA 1VQ8S 1WD6A 4DPUA 4L75A 2HNZB 3J80Y 2L08A 3HPOA 4LR7A 2UP1A 2GA7A 3MEEB 5IWAF 5DDOC 1ZM4A 3CCJS 4OLOA 4RW6A 2QFJA 1M5PC 1HNWF 3HFZB 1G6BA 3BKFA 1N34J 2PDAA 2HS3A 1HBUB 2QZ8A 5HJYA 5HQMA 5HSPA 1NHVA 2AWZA 2V0NA 4IYQA 2J0SD 4ZPCA 1C0TA 1RAOA 3BEGB 2OFGX 3R6GB 3FJ2A 2RHSB 3I6PA 5B0DA 2MGZB 3HT3A 4DV4J 1RU2A 4MIBA 4NRUA 8ATCB 1AA1B 1XNQJ 3HZEA 2F40A 3SQOP 2YH1A 3MD1A 4HT5A 2E7VA 3KOAA 3IG1B 3GWCA 5GVQA 1KOOA 2DR5A 1YGYA 3MEKA 1NKCA 1LEOA 1KFDA 1R0CB 2BYCA 3UCZP 2HZAA 2IJFA 2R2SA 1OS5A 4I1TA 3H8YA 4LBIA 4NXNF 1FJ7A 2CPEA 2V94A 4DSFA 1S1WA 3H2LA 3Q8RB 2OTJS 2APOA 2ZITA 2IA6A 1UL3A 1YKWA 2B43A 4CT8A 3LWLA 2W9BA 5L9XA 1TAUA 1UMJA 4YDXA 2V8PA 5KFVA 3QIPA 1PBUA 4FXWA 2DGSA 2Z57B 5K5MA 4JYAJ 3UWTA 1VC6A 4URSA 1S49A 1CJUB 1VRTB 3CDUA 2BBEA 3JTNA 3CJSA 4PYDA 3BGOP 5AE2A 2WOMA 3A3OB 3F44A 3U1LA 5CD4H 4NCAA 4HVZA 1Z2LA 3A13A 2X51A 1CJKA 3IGNA 4R5PA 2FIUA 4J9OA 1SVDA 2AEFA 1NKBA 4WF9Q 3M7VA 4QBUA 3HHLA 4F4ZA 3DLEA 4PABA 2I0XA 4K4UA 4BWMA 3PW4A 1UETA 3Q8QB 4OQJA 4G65A 3K7RA 1Y10A 2MPUA 4P71A 2IVFB 3MR3A 4HYKA 2W4CA 2E7XA 3UDCA 4B17A 4JI1F 3PKYA 3PW7A 4DCJB 5E5NA 2Z56B 3RB3A 1IBLJ 4OX8A 3SV3A 4C9DA 1KVIA 3VZHA 3HCXA 4I2PA 2HHTA 1C0TB 2DHGA 2DH7A 3T1YF 3DLLQ 3HHLC 1NPRA 3BSNA 1WORA 2HEKA 3QFWA 2I9SA 3PG9A 1N32J 3TAMB 3DRXA 3MI7X 2DO4A 3QIDA 1XNRF 2KFNA 2CG4A 4ECSA 3V5RA 5I3UA 2GGPA 2HFVA 2KT2A 4DQSA 3MM6A 1C1CA 2UVUA 3G82A 1UFLA 3ZXWA 1QJHA 4FP9A 3SYZA 1VQKS 1LW2A 3OXGA 3HVTA 2UUBJ 3I9ZA 4ID5B 1XMOF 4X4OA 1FKPB 3IMQJ 4LFCJ 4NLDA 2KYXA 3Q24A 3D66A 3KG0A 1VQ4S 3PRBA 5T14A 2R7XA 2MHNA 1SH0A 4EGLA 2BW7A 1W7WA 3R6LB 4RW7A 4PUOB 3P8BB 2VG5A 5CA5A 4A8KA 4TYBA 1XR7A 2MJUA 1EP4B 1EETA 3E01A 2RT3A 2G0CA 1GMVA 1T05B 1OSCA 1CPZA 4B02A 1YVFA 3WBZA 4ANCA 4QWCA 6FDRA 3ETOA 3FRYA 4M5DA 1FT8A 4KFBA 1IWAA 3M8YA 4CLSA 3J7YI 1U02A 2KI2A 3MUMP 2KFYA 1TKTA 2G2ZA 5KG6A 4URGA 5C5JA 4ED6A 1D9DA 1N54B 2DITA 2HNYB 2OEKA 3FSYA 5A2QU 4WP9A 4QQBA 4XK8C 4MFBA 1Y3JA 2W2QP 1RT5B 3DRRB 3O5TB 3C6TA 5CHCB 4Q0BB 2AGQA 2FZKB 2R9LA 3CNQP 1RWKB 2WVEA 1J5OA 2RHQB 1YLXA 2DGQA 4URQU 4ETXA 5B0EA 4OHYA 2IRUA 5DGAA 3AQPA 4HH0A 2VDHA 3ZTSA 4B3MF 2KXNB 1LWFB 2F1FA 4Q43A 3QGGA 1DTQB 2B7CB 4I4BA 3OXFA 5IOLA 4MYTA 4F3OA 3QFHA 1TZ0A 4LREA 1S97A 1U26A 2XI3A 3IP0A 4ZPTR 1LWFA 2YWGA 5DZ7A 1ZOTA 1AUDA 2HW3A 4LSNA 5DETA 4PXEA 1RHKB 2WK4A 1S77D 1MU2A 4CZCA 4MKAA 3JSMA 3PY8A 2XYPB 2F7VA 4AFFA 3M8QB 1UW9A 1VLYA 1T0TV 2FJEB 4HI2A 1BHNA 3L7PA 2QV6A 2ZH5A 3W7BA 3EGVA 2FHJA 4WK3A 4ZOSA 5ETVA 4FBUA 4X4SA 1KOHA 3N5BA 3NNAA 1Q0NA 4OZ3A 1YRXA 2X1BA 2EFOA 4ZVHA 3T1HF 3KMQA 4P2MA 4A47A 2MKIA 4B9MA 3KNAA 4DL7A 2PMWA 4HDGA 4HTIA 4UOHA 3WX4A 4Y2IA 3W60A 1S1UB 1VDHA 5ITHA 2A10A 3MMCB 2QRRA 1UCNA 4F0MA 5IXUA 5KG3A 2KFZA 3V4IB 5FLXY 1V5IB 1SQEA 4QWBA 5DQIA 2FLPA 2FY1A 2YNIB 1H2VZ 2DGWA 3FBFA 4BCAA 2XS7A 2DTJA 1PILA 2WVCA 2XO6A 3GLJA 4TVAB 1UZDA 4GC7A 2QT7A 2FLLA 2NYHA 4MAKA 4K8RA 5ETKA 2CJBA 4EWTA 1KNZA 1Q78A 2UU9F 4NLXA 1S0OA 4ZVEA 3EVOA 5BYQA 4OHWA 2L9NA 2G9OA 1NCLA 1S48A 3R3TA 4PYAA 4R0EA 2U1AA 5HANA 5C2CA 4X64J 2F3JA 3JSRA 3KK2A 4FF4A 4N77A 3GG1A 3AOCA 4MKVA 3MAAB 2WONB 1SJ3P 2AEMA 2BE9B 3EM1A 5FDLA 2RIJA 2LQ8A 2QO3A 5JMNA 3GIKA 3KHRA 2W24A 4KFBB 1S0VA 2FY8A 1V6HA 4GVBA 4USTA 2HS0A 1TVRA 5L1KA 3OR2A 4Q8FA 4J9SA 4IUFA 5HLFA 1X4FA 3AD7C 3K0JA 2LP4A 4U8VA 7AT1B 2AGOA 5F8GA 3IAM9 2PFFB 2E44A 1RT2A 2D69A 3LA0A 4K4ZA 5AXMA 4GMKA 2KU7A 1CJVB 2KJVA 2VQFJ 2ZC3A 4ANDA 5DJBA 2R42A 1UVLA 3C15A 1LK7A 4OV6A 3V6DA 3RAMA 1X9SA 5D0HA 2DRDA 3TWZA 3UVJB 5KFPA 2AT1B 4CLKA 2ZZTA 1QE1B 2V6AA 2ZD1A 3EGZA 4I67A 4JI8J 3HVWA 1SCJB 2QMUB 3GILA 4FYVB 1U2CA 1JLGB 4TY8A 1KWMA 1O8BA 2G2YA 2AX1A 4AUKA 4ECYA 3IA0A 1GK8A 2DH9A 3DXSX 3PFOA 3I31A 2R8JA 1N6QA 1SPBP 3EVMA 2C3OA 3O8WA 4RPFA 5DM6Q 4DFJA 2RMLA 5D3GB 3LP1B 1QE1A 2ZD1B 4JV5F 3P5BP 1N0VC 3NY0A 3U7JA
chains in the Genus database with same CATH topology
3VVTA 1BUXA 1XQIA 4O0NA 3Q86A 3FCVA 4C6AA 2AZ3A 5C7PA 3Q89A 5CABA 3NGUA 1B4SA 1NB2A 1F6TA 3ETMA 4UOFA 3ZTSA 1NSKL 1WKLA 3FBBA 1NDPA 3JS9A 1NPKA 3Q8VA 4DI6A 1NLKL 5IOLA 2DXDA 3EMTA 3FBCA 1BE4A 2DXFA 4F4AA 1NDKA 1HIYA 1KDNA 3PJ9A 3BH6B 1NHKL 1NDLA 2HVDA 1LEOA 4W98A 4EK2A 3VGSA 4KPCA 1MN7A 1WKJA 3G2XA 4F36A 1BHNA 3L7UA 1HLWA 3EJMA 3FKBA 1NSQA 4DZ6A 3ZTOA 3EE3A 3ZTPA 3NGTA 3BH7B 4ANEA 2NCKL 2DY9A 4DUTA 3MPDA 4UOHA 2B8PA 3Q8YA 1HHQA 3DKDA 3GPAA 4UOGA 1UCNA 2DXEA 1WKKA 4S0MA 3VGVA 3ELHA 3FBFA 3EICA 2BEFA 4FKYA 3ENAA 3VGTA 2HVEA 2VU5A 2CWKA 3EVOA 4FKXA 1NCLA 1S57A 3FCWA 3VVUA 5BXIA 2BX6A 1S5ZA 1VYAA 3EM1A 3ZTQA 1NUEA 3R9LA 2B8QA 3B54A 3Q8UA 1LWXA 3FBEA 1PKUA 1NDCA 1EHWA 1F3FA 3BBCA 3FC9A 4ANDA 1S59A 2AZ1A 4HR2A 3WX8A 1B99A 2DYAA 3DDIA 3NGRA 1MN9A 1K44A 3ZTRA 4WBFA 1W7WA 5CAAA 1XIQA 4CP5A 3Q83A 1U8WA 2HURA 3GP9A 1JXVA 3BBBA 3PRVA 4ENOA 2ZUAA 4ANCA 1ZS6A 3EVWA 1PAEX 3EVMA 3VGUA 1NSPA 3NGSA 3BBFA 3B6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VVT A;  1BUX A;  1XQI A;  4O0N A;  3Q86 A;  3FCV A;  4C6A A;  2AZ3 A;  5C7P A;  3Q89 A;  5CAB A;  3NGU A;  1B4S A;  1NB2 A;  1F6T A;  3ETM A;  4UOF A;  3ZTS A;  1NSK L;  1WKL A;  3FBB A;  1NDP A;  3JS9 A;  1NPK A;  3Q8V A;  4DI6 A;  1NLK L;  5IOL A;  2DXD A;  3EMT A;  3FBC A;  1BE4 A;  2DXF A;  4F4A A;  1NDK A;  1HIY A;  1KDN A;  3PJ9 A;  3BH6 B;  1NHK L;  1NDL A;  2HVD A;  1LEO A;  4W98 A;  4EK2 A;  3VGS A;  4KPC A;  1MN7 A;  1WKJ A;  3G2X A;  4F36 A;  1BHN A;  3L7U A;  1HLW A;  3EJM A;  3FKB A;  1NSQ A;  4DZ6 A;  3ZTO A;  3EE3 A;  3ZTP A;  3NGT A;  3BH7 B;  4ANE A;  2NCK L;  2DY9 A;  4DUT A;  3MPD A;  4UOH A;  2B8P A;  3Q8Y A;  1HHQ A;  3DKD A;  3GPA A;  4UOG A;  1UCN A;  2DXE A;  1WKK A;  4S0M A;  3VGV A;  3ELH A;  3FBF A;  3EIC A;  2BEF A;  4FKY A;  3ENA A;  3VGT A;  2HVE A;  2VU5 A;  2CWK A;  3EVO A;  4FKX A;  1NCL A;  1S57 A;  3FCW A;  3VVU A;  5BXI A;  2BX6 A;  1S5Z A;  1VYA A;  3EM1 A;  3ZTQ A;  1NUE A;  3R9L A;  2B8Q A;  3B54 A;  3Q8U A;  1LWX A;  3FBE A;  1PKU A;  1NDC A;  1EHW A;  1F3F A;  3BBC A;  3FC9 A;  4AND A;  1S59 A;  2AZ1 A;  4HR2 A;  3WX8 A;  1B99 A;  2DYA A;  3DDI A;  3NGR A;  1MN9 A;  1K44 A;  3ZTR A;  4WBF A;  1W7W A;  5CAA A;  1XIQ A;  4CP5 A;  3Q83 A;  1U8W A;  2HUR A;  3GP9 A;  1JXV A;  3BBB A;  3PRV A;  4ENO A;  2ZUA A;  4ANC A;  1ZS6 A;  3EVW A;  1PAE X;  3EVM A;  3VGU A;  1NSP A;  3NGS A;  3BBF A;  3B6B A; 
#chains in the Genus database with same CATH topology
 4EZ9 A;  4B3T J;  5D6G A;  3D5M A;  3I87 A;  4DV3 J;  2ROE A;  1XMB A;  2RJZ A;  4IG3 B;  3ISN D;  3KLF A;  4Y34 A;  3MF5 A;  2DEJ A;  4UUW A;  1HFE L;  1R7I A;  1CJV A;  1URN A;  2C2N A;  4AXI A;  2FC9 A;  4ZCK A;  2BJ9 A;  2RNE A;  2M52 A;  2AU0 A;  2PEB A;  5HO4 A;  4QZV B;  4C8M A;  3MEC B;  1C4C A;  4F0K A;  1SKS A;  4GO7 X;  4QYZ J;  3CXC R;  1VQO S;  3LP1 A;  1SBR A;  4RR5 A;  3MUT P;  1S10 A;  2W8K A;  3GMG A;  2ATC B;  4C8L A;  2CVI A;  2YH0 A;  3LP2 A;  3N5F A;  5HVF A;  5KFI A;  1WHX A;  4WCE Q;  2Q66 A;  4PXD A;  3F41 A;  1UEK A;  3L09 A;  3J81 Y;  4C4W A;  2F8E X;  2I5J B;  3M05 A;  4HL9 A;  2RE1 A;  4NI2 A;  4DEZ A;  1HNX F;  1WC5 A;  3HD1 A;  3IR7 B;  2YKN A;  1Y0H A;  1IWG A;  2HVD A;  3OD2 A;  3RJM B;  5T7L A;  1R0B G;  1IKV B;  4KPC A;  4DL5 A;  2JH3 A;  4CLP A;  5GAH I;  4YR0 A;  2I38 A;  3EZ5 A;  1RAG B;  4OI6 A;  2R2R A;  4A8S A;  3OFE A;  3OHA A;  3UD4 P;  1SL0 A;  2ZKT A;  1RUS A;  2QIF A;  2I5J A;  3PEH A;  2HHS A;  3NGT A;  3G6E S;  5IC4 B;  2HIY A;  2AV5 A;  2B5J A;  4DUT A;  3QMQ A;  1SKU B;  2ZH8 A;  1WTB A;  1N8R T;  3Q8Y A;  3CJ8 A;  2W7P A;  2W2N P;  3DXB A;  4V1A k;  5KFO A;  2B0G A;  1HNZ J;  1YBT A;  2Q43 A;  2LQJ A;  3MMA B;  4CH0 S;  5DG9 A;  2BKP A;  3QSI A;  2GAG C;  1F60 B;  1FD2 A;  2HAI A;  4DV6 J;  2X1F A;  3VAL A;  2D9P A;  2QJ3 A;  3LP0 A;  4C11 A;  3M2R B;  2CQI A;  1BC6 A;  1QTN B;  1RP5 A;  2MJN A;  4DL0 C;  1TUW A;  2GQC A;  3R5B A;  1L5U A;  1T03 A;  3C6U A;  1HHS A;  4U7U D;  2QN6 B;  3V6H A;  1TMM A;  2VD3 A;  4DG1 B;  3G6Y A;  3AOD A;  1AW0 A;  3I32 A;  2DIS A;  3GIM A;  1S57 A;  3HHN B;  3DGP B;  1IR0 A;  3TA0 A;  1ULR A;  4EEY A;  1F0X A;  4DX6 A;  2PO4 A;  2WOM B;  3H90 A;  4DV6 F;  2H3E B;  2VPY B;  3SFU A;  3UPF A;  4UY8 T;  4XDC A;  2XZD B;  5I42 B;  2RH3 A;  1T8E A;  2K3I A;  3NBP A;  5HRO B;  2XO7 A;  1TK5 A;  3FBE A;  1HNI B;  4P74 A;  3M32 B;  4FNI A;  4U7U K;  4CM2 A;  3A8I A;  3NS5 A;  2VKR A;  2ZE2 B;  3BYP A;  4Q44 A;  3R5D A;  2DB1 A;  1RTH B;  1YX2 A;  1UFK A;  4J90 A;  4MIW A;  3PHE A;  4NRT A;  2J9D E;  3HHE A;  3PO4 A;  4P73 A;  5K8M A;  1HQ2 A;  1RWU A;  2WW4 A;  5F8M A;  4RW4 A;  5CXT A;  1H2U X;  1S9G B;  2I1R A;  1DQA A;  2HK3 A;  1RAD B;  4KT0 C;  4FYD A;  3BF4 A;  1FRI A;  1VK8 A;  3PJW A;  4WBF A;  4X65 F;  1O0P A;  4K2J A;  1A0O B;  3ADA C;  4TY9 A;  1HAR A;  1HNX J;  1HNZ F;  2J6S A;  2I6W A;  1PC4 A;  4XPC A;  1TV6 B;  5HVH A;  3QZ8 A;  2ALZ A;  1N88 A;  1CVJ A;  5GAE I;  3BBB A;  3OSN A;  1TKZ A;  4FVC A;  3M30 B;  4OYX A;  1YDL A;  4KO0 A;  2N3O A;  5DG8 A;  3TOQ A;  4U7C A;  2R7W A;  3OJS A;  4WXW A;  1RBL A;  2L3M A;  2RS8 A;  4ILM A;  1Q7L B;  2B6A A;  4HI1 A;  2AYE A;  1PYT A;  1KVK A;  4XTT A;  3DRP B;  2VFT A;  1SQF A;  3UFC X;  2UUA F;  1RQ0 A;  2FZG B;  1XMQ J;  4NLU A;  2A18 A;  4LFC F;  4LQ9 A;  2Z8Q A;  3U27 A;  2LYV A;  2JNJ A;  5M2P A;  3PO5 A;  5KG4 A;  3M1V B;  3TZX A;  2VB6 A;  5G0R A;  1SJF A;  2E5H A;  4IG0 A;  2BRL A;  4ZN1 A;  2RKI A;  1Y4Z B;  4GKK F;  1OIA A;  5GAG I;  2LEP A;  1QSS A;  4X66 J;  2UUC F;  3DRS B;  1FK9 A;  2CJQ A;  4ID5 A;  2KXF A;  3CDE A;  3CCR S;  3TQE A;  1N32 F;  4ED4 A;  8RUC A;  1IKV A;  3M4X A;  2UU9 J;  3AD9 C;  1Q8L A;  1NPK A;  4ITS A;  4A8O A;  3GR1 A;  4DU7 A;  1HHT P;  2NYI A;  3FBC A;  3RBX A;  5KT4 A;  1LWE B;  2VBZ A;  4JI0 F;  2A3J A;  2P2C B;  4CO0 A;  3VAM A;  2DXF A;  5DDR C;  3EWG A;  2VON A;  1GTE A;  1JKH A;  1KQF B;  3DMJ B;  1KD1 T;  1DZ5 A;  1DY3 A;  4RWW A;  4ES2 A;  2YKM B;  1KDN A;  2JC0 A;  2MTL A;  3I9V 9;  4NYO A;  2VFR A;  4K0K F;  3R1L A;  3W5X A;  2MQ8 A;  2M70 A;  4QYR A;  4EK2 A;  3PYF A;  3OTB A;  3LO3 A;  4NA1 A;  1RB0 A;  1SJ4 P;  4F3M A;  4TYA A;  4HT7 A;  1VBK A;  1HKA A;  2E1R A;  2VIC A;  4LF7 F;  4LF7 J;  1NZ8 A;  1Q8K A;  2EW9 A;  2MYF A;  2Q6C A;  3KFW X;  3HKW A;  1UPP A;  3HVT B;  4LRD A;  5AJ3 J;  3EJM A;  2HHH F;  1WNE A;  1FWL A;  2A1B A;  1CQM A;  3LF0 A;  4RL1 A;  3OVA A;  4FPR A;  4FZV A;  3SV4 A;  2M88 A;  3OJU A;  1MWY A;  2AJ2 A;  4K4W A;  4OI1 A;  1R89 A;  3IGV A;  4C8Y A;  1MU2 B;  2JVR A;  4QWA A;  2B8P A;  1ITP A;  3OTO F;  1N5Q A;  1RTH A;  1S4F A;  1SV5 A;  2OO4 A;  4KRW A;  2ZHB A;  2BR0 A;  4NYP A;  4YR2 A;  4Y2K A;  4KQZ A;  1T9T A;  3D6T B;  2VIH A;  2K1R B;  1T9Y A;  2BZ2 A;  2E66 A;  4I2P B;  2QA4 G;  7FD1 A;  1NJZ A;  4AQY F;  4RBV A;  2OIH A;  3KDN A;  4C97 A;  1H74 A;  2CZ4 A;  2W9B B;  4RUC A;  4NXM J;  1AYE A;  3QZ7 A;  4KC5 A;  4ZS6 A;  2EKY A;  3M8Q A;  5L1J A;  4WFN Q;  2QEX S;  4PPD A;  1EIY B;  5CYQ A;  1ZZN A;  1N36 F;  4JI0 J;  4UQT A;  1R8B A;  1VYA A;  4RW8 A;  5A8R B;  4R5P B;  2MGZ A;  4J9P A;  2BKN A;  2HFO A;  1ZAW A;  1WHY A;  3B54 A;  4P7T A;  1HW9 A;  3I56 S;  1HNW J;  1LXJ A;  1L3T A;  1PKU A;  3CDB A;  5HAO A;  1NDC A;  3T1H J;  2YNH A;  1S9F A;  4DSJ A;  5EDW A;  3W66 A;  4X64 F;  1JLB B;  3CJ5 A;  4IFY A;  1CBK A;  1P9Y A;  4L6V 3;  3BRE A;  3CIZ A;  1HD0 A;  5IM0 B;  3IS9 B;  2ZM6 J;  2IM3 A;  4KY3 A;  2JL9 A;  4M5J A;  1UEU A;  4NLW A;  5CCM A;  2KM8 B;  4DWI A;  4AL5 A;  2AGP A;  1M5S A;  1U0H A;  3FZB A;  3PW5 A;  1RWO B;  1N5Y B;  1CS4 A;  3CJ0 A;  4OYO A;  3MXH P;  3PVX A;  2L9W A;  3AY0 A;  2HHQ A;  4IO1 A;  1Q53 A;  5A0Y B;  4OZL A;  3I5C A;  4X4N A;  3NMR A;  1KTQ A;  5KG5 A;  2YQ0 A;  4P75 A;  3V2U C;  1AUS L;  3K2Y A;  2FJV A;  2B7B B;  2A0F B;  4Q7A A;  5IQQ A;  3VTI A;  1OY9 A;  4H4O B;  4P9S A;  4R0J A;  4CH1 A;  3LUY A;  2J7W A;  3LOU A;  4P2X A;  4L3K A;  3RZA A;  2E5G A;  3HJF A;  1TMJ A;  3LAM A;  1HBM B;  1EP4 A;  3MZI A;  2X3D A;  4DR1 J;  1EZZ B;  2EG2 A;  4O44 B;  4JUZ A;  2NPF A;  3BV8 A;  1SC6 A;  4ZIT A;  5HLF B;  4RW7 B;  3UI3 A;  2HNZ A;  3ZNU A;  3TZY A;  2HZV A;  2E29 A;  1X7V A;  3GII A;  2ZOM A;  5IZH A;  3UCG A;  4C6A A;  2AZ3 A;  2XWY A;  1VK3 A;  2XG8 A;  2D1C A;  3M8Z A;  4YB7 A;  5CAB A;  1KFS A;  1PGZ A;  1YZ6 A;  3QT6 A;  3AB2 B;  1ZA1 B;  3JXO A;  4QJV A;  1M1K T;  1NSK L;  1S1T A;  2GZO A;  3DNC A;  4BWJ A;  4YDD B;  3H5Y A;  1D9F A;  2CPH A;  3I4H X;  1B7Y B;  1TL5 A;  2VG6 B;  3EZU A;  2F4F A;  1K1Q A;  1M1H A;  3CJR A;  4X84 A;  1C2P A;  3RAX A;  1L3S A;  1MSW D;  1AFI A;  1TEL A;  4LRF A;  1TL7 B;  4GVL A;  4BHQ A;  2GJ2 A;  5D0G A;  5C25 B;  3MMJ A;  1J2V A;  3NGK A;  4PCQ A;  4TN2 A;  3RYL A;  1FI4 A;  2BVZ A;  4LSL B;  2YNF B;  1NK5 A;  3PJ9 A;  3UW1 A;  1S1W B;  3MPY A;  3R7N B;  4ZIW A;  1NK4 A;  4WZM A;  3OPK A;  4W92 B;  5HP1 A;  4U95 A;  5B0G A;  4DR6 J;  1S1V A;  2VC0 A;  1VJW A;  4F36 A;  4M5M A;  1M5V C;  2Z58 B;  2AF6 A;  5KT6 A;  5KFJ A;  3FRZ A;  1HLW A;  1PYO B;  3CCQ S;  4QPX A;  3W9H A;  2ZM6 F;  2G1H A;  2JZ5 A;  3BO2 A;  2MQQ A;  3BH7 B;  2OPP B;  2V9K A;  3MR5 A;  2ZH1 A;  4NZ6 A;  2EFN A;  1YJU A;  2R7Q A;  2DHA A;  1IJE B;  3GPA A;  1Q8I A;  2IJR A;  2M3D A;  1YRU A;  1FRL A;  3BKU A;  3NRB A;  4ZVR B;  3SFG A;  5F8J A;  1WC1 A;  4IRC A;  1KQG B;  2RF2 B;  2YTC A;  3V4M A;  2W25 A;  1AB8 A;  2MKS A;  3K8W A;  2BOA A;  2OEL A;  3EPG A;  2KTQ A;  2WB1 D;  1YTY A;  3CD5 A;  2IC3 A;  1RAF B;  2JLF A;  3SCL E;  2BDP A;  1F3V A;  2OPQ B;  1RTI A;  2HVE A;  2QFI A;  3T6B A;  3KMS A;  2HMI B;  1SL1 A;  1UA0 A;  2YKP A;  4KGV B;  4K2X A;  2RDI A;  1K1S A;  2FTR A;  2F4V F;  1FJC A;  3IC1 A;  3DYA B;  2R8I A;  1QDU B;  4JV5 J;  4RUA A;  5J2P A;  2K8G A;  4YN3 B;  1IM4 A;  2HAF A;  1OPI A;  1D3W A;  2EEY A;  1DLO A;  3HD2 A;  1V5V A;  1W2I A;  2P6S A;  1RGV A;  4RBU A;  7FDR A;  1ZTW A;  2C3M A;  2HQ3 A;  2V8D A;  3CJQ A;  3RRH A;  3ZTQ A;  2RQM A;  1JNR B;  2PEH A;  2XM3 A;  2V34 A;  3MR6 A;  1A7G E;  1KLM B;  3ZNJ 1;  3E2E A;  3C6U B;  4LFA J;  2ASD A;  3US5 A;  2HNY A;  1L3K A;  1XK8 A;  4MJK A;  1I5O B;  3H7H B;  3VR1 A;  2XB2 D;  4AYB D;  3A12 A;  2ACM A;  1Y9O A;  3MMC A;  4UZC A;  4WPA A;  4RNO A;  4ED2 A;  2KVI A;  3MMA A;  1KEK A;  1EX8 A;  3FC9 A;  4NXM F;  4QR2 A;  4DV3 F;  3ONQ A;  5KT7 A;  5HQ8 A;  3OL7 A;  3KNG A;  1UVM A;  2RD5 C;  3PXG a;  4X62 F;  1RYR A;  2KRR A;  3NL0 A;  1SIZ A;  2C2M B;  5LJ3 Y;  4DN0 A;  1Y5N B;  1Y7P A;  1BGX T;  2QL7 B;  3PFE A;  4IG3 A;  5DQH A;  4LFA F;  2JDJ A;  1D1U A;  1RKI A;  2DCU B;  4O3P A;  3TNV A;  4DOZ A;  2KL8 A;  4TU8 A;  3X3U A;  1IBK J;  4OL8 A;  2CPZ A;  3CO9 A;  1W2B R;  4WE1 B;  3BKT A;  4JI8 F;  3OFF A;  3J7Y U;  4A8Y A;  4OI4 A;  4CH7 A;  1GMU A;  3MM9 A;  3EX7 B;  3MCO A;  5HMY A;  1NRK A;  1S1V B;  3WZ0 A;  2XTJ P;  3LPY A;  1T94 A;  1ZM3 A;  3M32 A;  3CCM S;  4C98 A;  2ZUG A;  2F4V J;  2RRB A;  4ECX A;  2HMI A;  1MRO A;  2ADC A;  4WII A;  2AMC B;  4BS2 A;  2B4V A;  2OSR A;  1FFW B;  1Z1Z A;  4O0N A;  4NA3 A;  1UVN A;  3TX0 A;  1LFW A;  5C42 B;  1NKE A;  3M30 A;  3EYZ A;  4NCG A;  3CCL S;  3H2V E;  4WE1 A;  2FYX A;  3UDE A;  3MD3 A;  3ILL A;  3AFG A;  3J7A 1;  1G7C B;  1TL4 A;  4OYB A;  5KFZ A;  1CJT B;  1ZH5 A;  3P96 A;  4NLY A;  2DXD A;  2DNN A;  4TU7 A;  4DUZ F;  4PWW A;  1FE4 A;  1GH8 A;  3FEY B;  1VIO A;  5KFC A;  1Y5I B;  5KOW A;  3FSI A;  1ZBT A;  3KLF B;  1U2R A;  1JNZ B;  4KAI A;  1KBR A;  1NDK A;  2C2K B;  2H4Y B;  3GQC A;  2GML A;  4B08 A;  1TK0 A;  3QT5 A;  4CWB A;  4LF6 F;  4CLF A;  2QYG A;  3MED B;  1KQS R;  2DNG A;  3D68 A;  4I6Y A;  2DHX A;  4ZPD A;  5BR8 J;  2JC1 A;  2MB0 B;  3R8Y A;  1WKJ A;  4ICL A;  3N6L A;  4J9R A;  2WVB A;  4KTQ A;  1GMW D;  2DY1 A;  2CDR B;  3JTO A;  4ZK7 M;  4NPO A;  5KG0 A;  3KG4 A;  2ASY A;  1JB0 C;  2HWI A;  4KB7 A;  1IKY B;  4OMF G;  3H40 A;  4DQR A;  4KR0 B;  3IM9 A;  3RTV A;  3P45 B;  4BLG A;  4USH A;  2KM8 C;  2BKO A;  3C19 A;  3PKM A;  2DHH A;  2LLZ A;  3HHD A;  2OH2 A;  1I51 B;  1WI6 A;  2CJX B;  3NWG A;  2MZT A;  3T9Z A;  5J1E B;  1WC4 A;  1H7W A;  2B56 A;  3Q2S C;  1YJT A;  2E9T A;  3HJV A;  3UNY A;  2ZH7 A;  1UVJ A;  1P6T A;  2C1E B;  2GO9 A;  4UT4 A;  1SXL A;  1FKO B;  2QLF B;  3TAP A;  2P9C A;  4UOC A;  4DR7 F;  2QL5 B;  1RWM B;  4Q2L A;  1NZA A;  5ETP A;  5A6W A;  2LQ9 A;  2ZHA A;  2HKE A;  4NCG B;  4KHP F;  4I7F B;  4HAC B;  4PG8 A;  1U0S A;  5FDL B;  2JHE A;  4LR8 A;  4USK A;  1HL6 A;  1MW7 A;  3UN5 A;  2BX6 A;  1FRH A;  2PA8 D;  1CC7 A;  4NLR A;  2MQN A;  3CDW A;  3VF0 B;  2AJF E;  3CMA S;  1EB0 A;  2LA4 A;  3R97 A;  5DO2 A;  2DGX A;  2UVW A;  2E7W A;  4A8X A;  4JI3 J;  3TEG A;  2B8Q A;  4UQG A;  3P3D A;  2XS5 A;  4G1Q A;  1VBX A;  2OKQ A;  3GFZ A;  1YJW S;  2B9X A;  3N01 A;  3JYT A;  3QPI A;  4PAA A;  1NK0 A;  1FFS B;  3BO4 A;  5HP1 B;  5EGY A;  1OPZ A;  4ZVO B;  1UW4 A;  3V81 A;  2V5H G;  3D0I E;  2XCA A;  4BDP A;  1APS A;  2B3T B;  2DYA A;  2MLZ A;  4QIW D;  3CJ3 A;  3TI0 A;  4CO2 A;  1HNI A;  5KFS A;  4V19 X;  1KP6 A;  3L7O A;  4DFM A;  1KHW A;  2D9O A;  2FJW A;  1S0N A;  5LXY A;  2POK A;  1JLC A;  4I2Q B;  1B70 B;  3O44 A;  1I94 J;  1WEL A;  2CWX A;  3VHQ A;  1QLN A;  5IV4 A;  1MG7 A;  4B3S J;  1WWH A;  4YR3 A;  3IO1 A;  4RU9 A;  1U6B A;  5ETT A;  3VGU A;  1SC4 B;  2Q79 A;  4DU8 A;  1F9H A;  5HN0 A;  4NLT A;  3BBF A;  2JLE A;  1XMO J;  3SSS A;  1REG X;  1KSP A;  3K57 A;  2VG7 A;  3FSX A;  5EWF A;  1F5A A;  2KXH A;  1SH3 A;  4Y2C A;  3VWS A;  1K47 A;  4QR0 A;  4WTO B;  4M5I A;  3SQG A;  3D3B J;  1JKH B;  5F41 A;  4F3Q A;  2XGP A;  2HHV A;  3F0N A;  4JI2 F;  4OZ0 A;  4PRF A;  1AZS B;  1X5O A;  4KH0 B;  2CDQ A;  2U2F A;  5C7P A;  1LK5 A;  1YJR A;  1B4S A;  2WBR A;  4QW8 A;  1FXR A;  1JJC B;  1MML A;  4OHZ A;  3IRX B;  3TVK A;  2HGL A;  4DPX A;  5HBM B;  3CC2 S;  3PX0 A;  2CZV C;  1JLQ B;  3PDN A;  1VRQ C;  5J1N A;  3C16 B;  4NWB A;  2YX4 A;  3QO9 A;  1LKZ A;  2XSJ A;  4KGZ B;  4TQR A;  5KG2 A;  3I5A A;  3KWM A;  1BMQ B;  3TAM A;  3H0P A;  4LT6 A;  4RBT A;  5A8W B;  1T9V A;  5HMX A;  1UVK A;  2V2V A;  4DG1 A;  2HRY A;  4M5D B;  2HHH J;  4HAC A;  3RGI A;  2E9R X;  3AJD A;  4NXN J;  1WTF A;  1NAQ A;  2QA2 A;  4YY3 J;  4B9U A;  2WVD A;  2DR6 A;  2OEM A;  3L7U A;  5EHH A;  2MXY A;  4ZVG A;  2MKH A;  3CVK A;  4F4W A;  2KYZ A;  3DHW C;  3PX4 A;  2ZNY A;  3M8W A;  4F2R A;  1JLF A;  2XSF A;  4QIE A;  1BY9 A;  3ZTO A;  3KK3 A;  3G9C A;  1BD6 A;  5CCL A;  2CQ4 A;  2CQ0 A;  3HVR A;  1XNQ F;  3CCV S;  2MEW A;  5JVH Q;  1FK9 B;  1H2T Z;  1S12 A;  2NUU G;  3JYT B;  3RW7 A;  2GJF A;  1DUR A;  1HHQ A;  1TTH B;  3B4M A;  1JMT A;  3OTC A;  5ETL A;  4O3Q A;  3HI9 A;  5I3Q A;  2ZC4 A;  5GAD U;  3VAI A;  4FPI A;  2M8D B;  1QVG R;  2EFV A;  3M8S A;  3W64 A;  1HI8 A;  2XMT A;  1X4B A;  4K4Y A;  1QUV A;  3G8Q A;  3IWL A;  3OBI A;  4MT1 A;  5KG7 A;  3S7R A;  3LAL A;  3DDN A;  5L1L A;  3DOK A;  1FDD A;  4ED5 A;  4ES1 A;  1IQZ A;  4RNM A;  1RTJ B;  2DD8 S;  3ET6 A;  1SQG A;  1U09 A;  5F3T A;  1Y3K A;  2XY6 A;  1X4H A;  4Z2X A;  5DDP C;  3HSJ A;  2C3U A;  4HHJ A;  2Y9H A;  3T19 A;  2RF2 A;  3FZ2 A;  4F0H A;  3QGP A;  3T5K A;  2MDA A;  1IQT A;  3I82 A;  4NCB A;  3FMW A;  4MK8 A;  1NK7 A;  1CQN A;  2XHW A;  2A6O A;  2YWW A;  2QTW A;  1LWX A;  2GFF A;  2HBY B;  2LA6 A;  5DLF A;  1TK8 A;  4LF4 F;  5E7O B;  5CZV A;  4RW9 A;  2CNO B;  3CUN A;  1S9G A;  2Y8W A;  2GHP A;  3JTP A;  3OR1 A;  2W2M P;  4AQY J;  2F5G A;  3M8P A;  5J2M B;  3CUL A;  3UNG C;  3N4W A;  1K73 T;  3TAR A;  2EBG A;  4LSN B;  1FNX H;  5LM7 E;  4ELT A;  3P49 B;  2FHO B;  1Q5V A;  5J2N B;  2AJQ A;  2BAB A;  3C2P A;  3ENQ A;  3OTO J;  2M9K A;  2Z4P A;  4OYI A;  2MKK A;  1HPZ A;  2A2D A;  2LKZ A;  2WRM A;  4PUO A;  1OQ3 A;  3MEE A;  2FJA B;  2IFX A;  2N7C A;  1RAE B;  4FS2 A;  4A46 A;  3E8O A;  2EWH A;  4ECZ A;  1VS3 A;  1WF0 A;  3LH2 S;  4IRD A;  2Y1R I;  4CT9 A;  5F9N A;  2GW8 A;  2DK2 A;  3BO3 A;  3P6Y C;  2Z2L A;  1C0U A;  3M2U B;  3R7B B;  2MQL A;  5K8N A;  5IM0 A;  5AJ3 F;  3CPW R;  1RAB B;  2H51 B;  1YIJ S;  2YWK A;  2JVO A;  3GR0 A;  2JEF A;  4ENO A;  2LVW A;  3CD0 A;  3S6E A;  2FGO A;  4YY3 F;  3AB4 B;  5DS7 A;  3HO1 A;  3W61 A;  4B3M J;  1Q95 G;  3M2R A;  1CC8 A;  1KKH A;  3NG8 A;  3OFH A;  3M6X A;  4L74 A;  3ZZP A;  5JJB A;  3C3L A;  4YHH J;  1IKX A;  1OQ6 A;  4OYZ A;  4WU3 A;  2IM2 A;  5D4N A;  4K7Q A;  3VVT A;  5CH7 B;  5L39 A;  3GJQ B;  4CTA A;  3K89 A;  3HZG A;  5DZ6 A;  1EET B;  3CTR A;  3E01 B;  4O44 A;  1HBU A;  3K58 A;  2JX2 A;  1PC5 A;  4GO5 X;  2UXD F;  2JFD A;  3GFH A;  2FZC B;  4G6V B;  9ATC B;  2BAN B;  1HMV A;  2YX7 A;  3NGU A;  4EU0 A;  1F6T A;  3FUY A;  1SH2 A;  1NK6 A;  4LQ3 A;  1HQU B;  1NDP A;  3Q8V A;  1I1G A;  1YHQ S;  2YXL A;  4JI2 J;  4MYU A;  3AT1 B;  5C25 A;  1RCX B;  2CQP A;  4H54 A;  3H42 A;  5HAT A;  2CJA A;  3OLA A;  1GXU A;  3FK4 A;  5KFM A;  2E1C A;  2EKN A;  3CCT A;  5KFN A;  3UO0 A;  1I3O B;  1YQH A;  2FC8 A;  3UN3 A;  2IM0 A;  1MWZ A;  2NXJ A;  1JXE A;  1RWP B;  4W98 A;  4Y2M A;  3R5G A;  1VQL S;  3GCX P;  5F9L A;  1OMS A;  4NLP A;  3G71 S;  5LOQ A;  2CJ9 A;  2OML A;  3BSA A;  2ZNZ A;  5GAE U;  2XMA A;  2X3G A;  4DZ6 A;  4JI4 F;  2VBW A;  4CM0 A;  1DTT A;  4Q8E A;  4HLB A;  3U1N A;  3E3X A;  3AAW B;  4K4T A;  2BXJ A;  4H4K A;  3IXQ A;  2FJD B;  5D78 A;  3GJT B;  2LEA A;  1RT7 A;  4OLP A;  2RVJ A;  2CAJ A;  5KTQ A;  3J7Z T;  3KHH A;  4EYI B;  5J2M A;  1UJ5 A;  1FJG J;  1T3O A;  5H9F K;  1PJ7 A;  3FEX B;  4OIX A;  3T1Y J;  4B9L A;  4GKJ F;  2KO1 A;  5LMN J;  1QAX A;  4S0M A;  5CYQ B;  3R2C J;  3ZZ0 A;  5F8I A;  3ELH A;  4MFB B;  2KB2 A;  4RO0 A;  2K7K A;  2NXU A;  5J2P B;  4P10 A;  3CC4 S;  1VHF A;  4WKY A;  4MK7 A;  2AW0 A;  4FN5 A;  1AFJ A;  2RAQ A;  3K59 A;  4B3T F;  3QGI A;  1TFY A;  3V6J A;  3BPD A;  2KRB A;  2QLJ B;  4ICL B;  5SUH A;  5C42 A;  4RNN A;  4DFK A;  4DV5 J;  4DL6 A;  1YJN S;  4C0H A;  1DTQ A;  2LEB A;  2ILY A;  2F63 A;  3T41 A;  2NPI A;  2RQ4 A;  1T05 A;  2RB7 A;  1S5Z A;  2DNO A;  4C8O A;  3KG1 A;  3JQM A;  4RUH A;  2HG4 A;  1ZAV A;  3F73 A;  1E6V A;  1JLB A;  3NS7 B;  4IFY B;  1N0U A;  3JB9 k;  2FJX A;  2OP5 A;  3CJK A;  3KLH A;  3SEO A;  2FHJ D;  1TL7 A;  4J9K A;  5KFD A;  4DR7 J;  2CUY A;  1F3F A;  1RHU B;  2J5A A;  1R43 A;  1RZM A;  1IBM J;  3TA1 A;  3NCQ A;  3NOC A;  4TNO A;  2D3O R;  3UVJ A;  2Y8Y A;  3FCH A;  4Q0B A;  2DGT A;  1B7F A;  4EBD A;  2ZBQ A;  4EFA C;  1Z2Z A;  2YNI A;  1KQK A;  2DBB A;  3A4T A;  3RU0 A;  2ZWO A;  3FNN A;  4KV8 B;  2FHK A;  2AJ4 A;  2W4P A;  1RHM B;  1RT2 B;  2CQB A;  1HQE A;  2XMM A;  2CRL A;  1V3S A;  2J9E A;  3THP A;  4E98 A;  4LRB A;  1PJ5 A;  1NB7 A;  3RW6 A;  2J6T A;  2H5I B;  2BAC A;  4KV8 A;  3HP6 A;  5D4L A;  3TUI C;  1VR6 A;  2NR0 A;  2MLY A;  3PRV A;  5HI7 A;  3MAA A;  5KFL A;  4DV7 J;  4IH6 A;  2NUH A;  2QC3 A;  1FER A;  3I0S B;  5HMW A;  3D3C J;  3AOB A;  3NBP B;  4OJ1 A;  3M9N B;  4C48 A;  3S01 A;  2B4O A;  1XBW A;  3NGS A;  5RUB A;  3FGV A;  4RLE A;  3MGJ A;  3W8P A;  1WDT A;  4IO9 Q;  3OW2 R;  4M95 A;  4K5S A;  1X0P A;  4DR2 J;  2GX8 A;  2KT5 A;  1VMB A;  1BUX A;  1IJF B;  5T41 A;  4O4G A;  2BA9 A;  3OTE A;  3DLG B;  3LTO A;  3AH6 A;  2CQC A;  2PE8 A;  3BYR A;  4NZ7 A;  3PIP Q;  3FCV A;  4DPT A;  1ZPV A;  2R7T A;  3DOL B;  4OZ1 A;  4FYY B;  2Z30 B;  2MZQ A;  4BBY A;  2ACY A;  2HVZ A;  4LF5 J;  5THW A;  4IKA A;  4JI1 J;  4DI6 A;  3GV7 B;  1U6F A;  1R8H A;  4U8Y A;  2QL9 B;  3DFE A;  2CPX A;  1XR6 A;  4GC6 A;  2AYM A;  3MED A;  4NL5 A;  3MM5 B;  1U49 A;  2YKO A;  3KUG A;  1TV6 A;  3MEC A;  4WP8 A;  4Z7Y A;  3M8P B;  2ZH9 A;  2BRK A;  1WEY A;  5A76 A;  5F8H A;  4NEZ A;  1K0T A;  4WWS A;  2GS8 A;  4NA2 A;  1IBM F;  1T7P A;  3MCN A;  2VQE F;  1RLD A;  4FDF A;  4TXS A;  4BC7 A;  3KTQ A;  3DYA A;  1V3R A;  1MMN A;  2XZT B;  4LSZ B;  3R7S B;  5HVG A;  1H0H B;  3POT B;  1IBK F;  4ZJL A;  5D77 A;  4N56 A;  4ES3 A;  1RAH B;  2Z2Z A;  3SCJ E;  3MM5 A;  2R4F A;  5G0R B;  4F7V A;  3KLV A;  5LT5 A;  1HI0 P;  5T7L B;  4WFY A;  4K4X A;  1C0U B;  4QYZ K;  2NS1 B;  2IC3 B;  3F56 A;  1S6O A;  1BXN A;  4NYZ A;  1ZYQ A;  2LU1 A;  2VPX B;  3W9J A;  4YB1 P;  2UXB J;  4LF8 F;  5A8K A;  2ZBR A;  4XDD A;  2AP6 A;  4B9S A;  4JI7 F;  2AIR B;  4MKY A;  1OJ4 A;  2WVF A;  2M2B A;  2I2Y A;  4NLG A;  2CPY A;  2O01 C;  4PG5 A;  5ETO A;  2BOP A;  4O3N A;  1R3N A;  3A3N B;  2GMH A;  3W8G A;  2DCL A;  1RE1 B;  1FO1 A;  2VAS A;  3C8Y A;  4XAK A;  3VGV A;  2B51 A;  5E2Q A;  2XY7 A;  2EC0 A;  3HHL D;  2LFV A;  3EGW B;  1N4L A;  4OX7 A;  2GMJ A;  1RI7 A;  4FKY A;  1NU4 A;  2Y0B B;  1ZPW X;  3MM7 B;  2FGC A;  2C42 A;  3GCW P;  1WUU A;  2E5L J;  1DJ0 A;  2C2R A;  2C28 A;  2J8A A;  3ILI A;  3I96 A;  1HMV B;  1U24 A;  4OHV A;  4K5R A;  5H1S V;  3BQ0 A;  2VZ9 A;  1QSL A;  3D6M B;  3N6M A;  2FJB B;  4ZP9 A;  2D41 A;  3RG6 A;  1R8P A;  2HYI B;  3CD6 S;  4X66 F;  1MMD A;  4X62 J;  1Q1K A;  1U1P A;  1HYS B;  3KJV A;  2YPZ A;  2HLT A;  1X5S A;  3H5X A;  3Q8U A;  3BGU A;  4OZN A;  1HQE B;  3DOK B;  3FEZ A;  4I6W A;  4OJ3 A;  2OTL S;  2IBK A;  1KRP A;  2UV8 G;  5LL6 d;  4DR3 F;  1DRZ A;  4AL6 A;  3H5S A;  4ECQ A;  3DCA A;  4I64 A;  1PJ6 A;  2W9C A;  2CFX A;  4DX8 H;  2CQG A;  4KGK A;  3RAQ A;  1FKA F;  3PV8 A;  3EGN A;  1U1R A;  5LSR A;  1VGY A;  4DSK A;  1FVS A;  2FQQ B;  1K44 A;  3DU5 A;  3NGR A;  1WAC A;  2BUN A;  3IAS 9;  5CYJ A;  2L48 A;  1HR0 F;  2NRE A;  3PW0 A;  1CLF A;  4I6A A;  4X2B A;  5D0E A;  3GTY X;  3NWR A;  5MLC V;  3M9O B;  2ZWP A;  2J7K A;  2J7U A;  4RKU C;  1FWP A;  1OY6 A;  2H65 B;  3DRP A;  4ECV A;  1W25 A;  2R8K A;  2F9D A;  2FLO A;  2MLX A;  4RW8 B;  4YB5 A;  5B0F A;  5FD1 A;  1FWK A;  3IM8 A;  2VF3 A;  3PTW A;  5L46 A;  2HIQ A;  1FKO A;  1IKW B;  1FXD A;  3KKF A;  1NSP A;  2NZC A;  4KYZ A;  3SCK E;  4DQI A;  2R7S A;  1R8C A;  3WC0 A;  1F5C A;  2AJ1 A;  4EI2 A;  2BW2 A;  1CJK B;  4X4Q A;  3B8H A;  3CF5 Q;  3IR6 B;  4KH1 B;  4DX5 A;  4Y0F A;  1VQM S;  2VH7 A;  4MK9 A;  2VA2 A;  1IKW A;  1RWN B;  4PPZ A;  5B7W A;  2E1P A;  5KFE A;  4KE5 A;  4DLG A;  1T3N A;  1RTD B;  5HK4 A;  1JLQ A;  4WFZ A;  3ZZT A;  5GAH U;  4DL2 A;  3BR8 A;  1OO0 B;  3RB4 A;  2I8E A;  2YKN B;  4NLS A;  3MPU B;  1WKL A;  4OYW A;  4ZPV R;  4EUV A;  2BE2 A;  4DPO A;  2LCW A;  2WAQ D;  3CJK B;  3UR0 A;  4PG6 A;  3K5N A;  1IXK A;  4DV0 F;  1HBO A;  4NML A;  1RTZ A;  1OYE A;  4DFP A;  4JYA F;  3JSY A;  1FF2 A;  2ZE2 A;  3BS9 A;  3DC2 A;  4Y2A A;  1FVQ A;  1T95 A;  4F4A A;  1Q16 B;  5E3R A;  2Q1L A;  3EPI A;  3WQP A;  2PI4 A;  3Q2T C;  5KFX A;  3D6H B;  4DR1 F;  1E6Y A;  2Q3P A;  1FCA A;  4IFV A;  4LBP A;  4OJH A;  1UP1 A;  3PZP A;  1V9O A;  5IT0 A;  3V6D B;  4WFA Q;  3PX6 A;  4OHX A;  4CCH A;  2BJ3 A;  2AHO B;  3IBW A;  1JX4 A;  4KJI A;  3TX8 A;  2P9G A;  3JSB A;  3EDQ B;  3BR9 A;  1JJ4 A;  4IQM A;  2PN6 A;  1D8Y A;  4A8M P;  5KFW A;  4DUY F;  1URR A;  3OL9 A;  1EAR A;  4JBC A;  3KDO A;  2XMV A;  4J9U E;  4KHM A;  3DMJ A;  3EE3 A;  4CLY A;  1RT3 A;  5HJX A;  3KJV B;  3K5L A;  3B78 A;  5CD4 A;  4DMZ A;  2E5J A;  4FNH A;  2DY9 A;  5LJ5 Y;  2G4B A;  1T11 A;  2UUB F;  3D28 A;  2FVS A;  3ITH B;  4IH5 A;  4ZHR A;  1DHM A;  1EKS A;  1FD8 A;  4TU9 A;  3O3L A;  3QRR A;  2HBZ B;  2DXE A;  2GNK A;  1HBO B;  1RSC A;  3TP2 A;  4RNH A;  5HMZ A;  5IWA J;  1LWE A;  4KGX B;  3MUR P;  2DNK A;  4LRC A;  1S76 D;  3CME S;  1N5T A;  2V2Z A;  1UA1 A;  3TZW A;  1RAC B;  2HGN A;  1U8S A;  4LJM A;  1VJQ A;  2RKI B;  2RDJ A;  2ILZ A;  1E6Y B;  3QSY B;  3ILO A;  1K9M T;  5LMU J;  4KPY A;  1RAI B;  4J7C A;  1F9E B;  2MZR A;  1WHW A;  3D67 A;  1TUV A;  3BGL A;  2VU5 A;  2CWK A;  2XNQ A;  3DRS A;  1PYS B;  5KFY A;  1T9U A;  1H98 A;  1VRT A;  1SC1 B;  1U7L A;  4JB8 B;  2W9C B;  2M4M A;  2VOD A;  4N8O A;  1CG2 A;  3DOM B;  4HH1 A;  4LVO P;  3QRP A;  3GSI A;  3RUB L;  4B3O A;  2GIQ A;  5D15 A;  1QAI A;  2W8L A;  1JLF B;  2B9W A;  3JQK A;  4MKB A;  1UWB A;  2D74 B;  4OV1 A;  2P9E A;  3TR5 A;  4OX9 F;  5H9F J;  3U1M A;  2VJU A;  2NQP A;  2ABY A;  2HFZ A;  1KS2 A;  1TL3 B;  2GIF A;  3NXZ A;  5KG1 A;  3W9I A;  2B9Y A;  1NH8 A;  4M5G A;  3ZZU A;  1UJ6 A;  3GG0 A;  4QWD A;  2KH9 A;  3HK2 A;  1LQ9 A;  2W2P P;  3BGF A;  1RHQ B;  2VL1 A;  1HPZ B;  4PEO A;  5F3Z A;  3RR7 A;  3DU6 A;  4TKT A;  4YEA A;  1ZA2 B;  3HHK A;  2DT9 A;  3NKY A;  4Q2M A;  4ZKA A;  3MFH A;  4J9L A;  1BWE A;  5AT1 B;  4DPY A;  2EBE A;  2NSC A;  4N47 A;  3WIV A;  4E2F B;  4OJG A;  2AZ1 A;  4RX6 A;  3D0H E;  4KGM A;  3OHB A;  1NM2 A;  3GZ7 A;  1K0V A;  3DLE B;  3HX9 A;  3KLH B;  1RT4 B;  3ZTR A;  3IRX A;  3RRK A;  2C22 A;  3JAM U;  2GJI A;  3CMQ A;  2C3Y A;  4CLL A;  1HWU A;  1YRT A;  3M2V B;  4DXL A;  2V63 A;  3SZ2 A;  1H73 A;  1VQY A;  3T5L A;  3NAI A;  1Q4R A;  2CQD A;  1PAU B;  3QIP B;  2OHD A;  4JOU A;  1IR1 A;  2WW8 A;  3H5U A;  4A48 A;  5IFM A;  1NJX A;  4CLT A;  4DX7 A;  2MY7 A;  3HXM A;  5LMN F;  2C2D A;  1B0T A;  2PGC A;  3BQ1 A;  2E1M C;  2E1A A;  2V2K A;  1GXT A;  3DLK B;  1GFW B;  3DM2 A;  1H3D A;  4Q5V A;  3HSG A;  1S9E A;  2VKZ G;  1SKW A;  4G3I A;  4W90 B;  1A6L A;  3GON A;  2W2O P;  2JJ4 D;  1JLA A;  3L4B C;  3OR1 B;  3M2V A;  3BQ2 A;  1U45 A;  3ENV A;  1XQI A;  2VBX A;  4R8U A;  4LBH A;  4LFB J;  1S1T B;  3M6W A;  5ADZ A;  2Y3Y A;  3Q86 A;  2HLU A;  3U02 A;  1ZAX A;  2DNP A;  3MTJ A;  3IG1 A;  4USV A;  4N76 A;  3MPV A;  1D9A A;  3T6J A;  2MQO A;  5B09 A;  3D4J A;  2YPY A;  1C1B A;  3FBB A;  1NLK L;  1TL3 A;  2H9Z A;  5EN1 A;  3CW2 C;  4PXB A;  2FUG 9;  3W3S A;  1S7I A;  1YJV A;  3ISN C;  4ZCL A;  3VQT A;  1Q7Y T;  2YBV A;  3OR2 B;  2VOP A;  1X0F A;  4H4O A;  4GKJ J;  4YME A;  2WHO A;  2IYG A;  1R31 A;  2YY3 A;  4EO6 A;  4DR4 F;  3VAJ A;  1XEZ A;  2XYG B;  2G0I A;  2AX0 A;  2R3V A;  1RBO B;  1SV5 B;  2DO0 A;  1SB6 A;  3G82 B;  4YP3 A;  1RT4 A;  3Q8S B;  1L3U A;  2BQU A;  3RBE A;  1J5E J;  2DNM A;  2JRS A;  1RCO B;  1D0E A;  4M63 A;  1RT5 A;  3D7S B;  3DRR A;  1FRJ A;  3TAN A;  4I0W A;  1TUG B;  3LAN A;  3MPW A;  2VPZ B;  5EUH A;  2RU3 A;  1N48 A;  1NJY A;  3H2U B;  2ZKU A;  3V4I A;  4K0K J;  4ANE A;  1ZTT A;  1XC9 A;  1WOS A;  4FVM A;  2D7S A;  1NME B;  3MMB A;  2DVI A;  3MAQ A;  1UEV A;  1T02 A;  4CDI A;  3IBF B;  3DKD A;  1HQU A;  2IDE A;  2ROP A;  2DR9 A;  3TW0 A;  4DR4 J;  2HBR B;  1Q82 T;  2XCP A;  2HRT A;  1WKK A;  4LF1 A;  4CQ1 A;  2E5L F;  4WJB A;  1VIS A;  2D3Z A;  2HQC A;  1IKX B;  2MKJ A;  1VLO A;  2CJK A;  4M5L A;  4DSE A;  5GMK a;  1LOU A;  3NEK A;  3THT A;  3KLI A;  2BE7 D;  2NXN A;  3QQC D;  3KK2 B;  2V8H A;  1TKX B;  4G1I A;  3QT7 A;  4Z7C A;  3BJY A;  1RA6 A;  3T9N A;  3TZZ A;  2V50 A;  1VFJ A;  3CED A;  3W62 A;  3PIO Q;  2VHG A;  1U1L A;  3VAF A;  2JEJ A;  3VVU A;  4JV2 A;  2IVM A;  5JXS A;  4NMX A;  5M2U A;  5DG7 A;  4ILL A;  3Q22 A;  1C1C B;  1N33 F;  2R8H A;  2P6T A;  4CO1 A;  1FEH A;  4HHH A;  1HNV A;  2OPR A;  3R27 A;  4J37 A;  2CAD A;  5EWE A;  5GMD A;  2VUG A;  3MDF A;  3HMJ G;  1JJH A;  3MCS A;  3R9L A;  4D3G A;  3HF5 A;  2X7I A;  2OPQ A;  3UD3 P;  2E5I A;  2ROG A;  2R7R A;  2FHM A;  1EHW A;  2PA3 A;  1P1L A;  3MR7 A;  3ULH A;  3WIU A;  4A8Q A;  2K7J A;  2ZOF A;  4B9N A;  2GO8 A;  3UQS A;  4PR6 A;  3SCI E;  3ZZZ A;  2NSB A;  1F2H A;  4CYU B;  4J9N A;  2LQ5 A;  2UV8 A;  5DQG A;  5CZX A;  4WFX A;  2LMI A;  3AD8 C;  1RWV B;  1REV B;  1HWK A;  1S1X A;  1HNV B;  2OPR B;  3D54 A;  3PRD A;  1S6Q B;  3LW5 C;  4HDH A;  3VCD A;  5B0B A;  1P8G A;  1GX5 A;  1B64 A;  4ECW A;  3HUL A;  5AXN A;  1Q79 A;  2D3U A;  2GQ2 A;  3KUH A;  1RHR B;  3NAH A;  4N8N A;  5GAD I;  2CJY B;  3GFY A;  1WSR A;  1WOP A;  1FA0 A;  3Q83 A;  2KG1 A;  3OVS A;  1DAX A;  5KT2 A;  5F8L A;  4UW2 A;  2N3L A;  3SXL A;  1WG5 A;  2JOQ A;  2LXU A;  1XJW B;  4JP8 A;  2O5D A;  4UTG A;  1TKT B;  4FYX B;  1BQM A;  4Y28 C;  5H9E K;  2ZJP Q;  1REV A;  4ZCI A;  1RAA B;  1PAE X;  2C2E A;  4MMO A;  5KFB A;  4NEY A;  2XQC A;  4P7V A;  3HSD A;  3TAQ A;  1ACM B;  4ZVP B;  3DOL A;  2ZZM A;  1EKR A;  4FXV A;  3PYE A;  4DL4 A;  4K4S A;  3PAC A;  3L95 X;  2NXE A;  2IMO A;  4Q45 A;  1FRM A;  2RS2 A;  2HFN A;  3BN7 A;  3PYG A;  2V8G A;  4U96 A;  4F25 A;  2ZJQ Q;  3IWN C;  5BYR A;  3GJR B;  1S72 S;  3J7A N;  2OI2 A;  4ED7 A;  3I0S A;  3NOG A;  4UOF A;  5GAG U;  5JUM A;  4PWD A;  1E6V B;  4EBE A;  2FB0 A;  3G6V A;  2CZ9 A;  4L76 A;  1CEZ A;  2SXL A;  2IDL A;  4LIW A;  2J8S A;  2QMW A;  4XO0 A;  4DV2 F;  2IRX A;  3NNH A;  2FLN A;  3CCZ A;  1UWA A;  1F1B B;  3LPE A;  2BM1 A;  5L1I A;  1QM9 A;  1UFW A;  1RWW B;  3AHP A;  4GVB B;  2VFU A;  1UJ4 A;  1QTM A;  5KT5 A;  1FDA A;  4ZVT B;  4LMZ A;  4O3O A;  2V4Q A;  4PKD B;  2ZH6 A;  1HIY A;  3KJN B;  5ETM A;  4YS2 A;  1F2G A;  5J2N A;  5JVG Q;  1Y00 A;  5DM7 Q;  4JI6 F;  1NDL A;  3UCU P;  2M0G B;  3GFX A;  1S79 A;  4FYW B;  2AJ0 A;  2XY5 A;  3RB6 A;  1SC3 B;  3IWX A;  2GC8 A;  3BGR A;  1HWJ A;  1JJ2 R;  3PR4 A;  5F0U A;  2QLW A;  3TEH B;  3FKB A;  1U1N A;  1WSV A;  4QR1 A;  2VBY A;  3GB0 A;  4LUB A;  2JEG A;  2YNG B;  3BM7 A;  5D4O A;  2HHX A;  1FE0 A;  5M2R A;  2ZDP A;  2NCK L;  3DHX A;  3HVA A;  3BSC A;  2IRY A;  1U47 A;  2QMX A;  4CLU A;  3IR5 B;  1HA1 A;  1FES A;  2PMH A;  4DHV A;  2VQF F;  4ED3 A;  4ZLL A;  3KJQ B;  4QIF A;  1ZET A;  3MM8 A;  1IVZ A;  4M1K A;  1MRO B;  4NE9 C;  2IPO B;  1RJJ A;  2BJ7 A;  2DH8 A;  3GIR A;  2ZDO A;  4I69 A;  4RWX A;  4CI0 B;  5IT9 Y;  1S6U A;  4OI2 A;  2R2T A;  3KK1 B;  4DV4 F;  2KKH A;  2PT0 A;  2VG7 B;  5FLX U;  2BJE A;  3J7Z 5;  5LMU F;  3P5T L;  2OSQ A;  2IJN A;  2DRB A;  1Q5Y A;  2PII A;  4FKX A;  3MR2 A;  3FCW A;  1HBN B;  3CIM A;  3I55 S;  2VJV A;  2GVZ B;  4F8R A;  4JI5 J;  4LF8 J;  2YQ3 A;  3POT A;  3K5P A;  3H4D A;  4F4Y A;  1OWX A;  1T03 B;  2IM1 A;  3O6Q A;  2YWF A;  4LR9 A;  5K8P A;  1LNQ A;  3NP5 A;  4YFU A;  3LP0 B;  4C11 B;  1WF2 A;  4ZA1 A;  3BZQ A;  1VHI A;  3OV7 A;  3HLU A;  5IC6 B;  4ZCM A;  2Y1J A;  3C46 A;  4RW4 B;  3C66 A;  4WYW A;  5KAK A;  2M8H A;  3N9U C;  1PBA A;  2EPI A;  4B3R F;  3CDA A;  1X5P A;  1VQP S;  3QJL A;  1SIW B;  4DBQ A;  4J9Q A;  2XMW A;  4RJV A;  3DN9 A;  4I68 A;  4QU7 A;  3D9B A;  5A8W A;  3IBC B;  2HWH A;  2V4R A;  2QG9 B;  1B99 A;  2IMW P;  3SBM A;  2C2O B;  2W1B A;  2F8M A;  4DR5 F;  3EDR B;  3ICL A;  1P27 B;  4PWD B;  4ZP6 A;  4RU2 A;  3BDP A;  1ELO A;  1JLG A;  3N79 A;  1N5V A;  4TY8 B;  1H72 C;  4DSI A;  1QVF R;  1TR0 A;  3BSO A;  1ZM9 A;  3N6N A;  4XIU A;  4LF9 J;  2JEI A;  2IY5 B;  2CQH A;  1U8W A;  1SL2 A;  2GHV C;  1BQN A;  1VRU A;  3DGP A;  5DGB A;  1IBC B;  3PCO B;  1JXV A;  1VBY A;  3RRG A;  3R2D J;  3G96 A;  4M5N A;  1RYS A;  1YK9 A;  4Y3C A;  4CLW A;  4DV0 J;  1ZS6 A;  2AQ4 A;  1G3O A;  3EVW A;  5KT3 A;  2QA4 S;  4ELV A;  4DV1 J;  1FTC A;  2MZJ A;  1SJR A;  4DUY J;  4JI3 F;  5E3C A;  2UXC J;  2XGQ A;  3A8E A;  2CNK B;  2GVD A;  1N33 J;  2HVI A;  5ETN A;  1TL1 B;  4I56 A;  2OEJ A;  1U2F A;  4JV0 A;  3X1L B;  5E33 A;  4ZJQ A;  4O0I A;  4K4V A;  5KFR A;  2G2O A;  2J76 E;  4E0D A;  2MKC A;  4C8K A;  1G2E A;  1WF1 A;  1QSY A;  3PJX A;  3QRQ A;  3QJP A;  5AE3 A;  1QUP A;  3M6V A;  4ID8 A;  3RB0 A;  3AOA A;  1S0M A;  1FDN A;  1U25 A;  3OUY A;  1KR4 A;  2B4P A;  3QWP A;  4EBC A;  2GV1 A;  2LDY A;  1VCT A;  3CJ2 A;  3GSD A;  3UR3 C;  4P72 A;  2HQF A;  4R25 A;  5SZT A;  5C24 A;  1ICE B;  2KZM A;  3M2U A;  1BE4 A;  2IHR 1;  2K06 A;  3M1V A;  3MM8 B;  3OQ2 A;  4IG0 B;  2WB4 A;  4K50 A;  4DV5 F;  4AD6 A;  3LQV A;  5L8R C;  4OYP A;  4AE5 A;  3KUE A;  1AZS A;  1HWL A;  3L9Z A;  2LXF A;  3D1Q A;  3V81 B;  1HR0 J;  2BV3 A;  3BH6 B;  3HSZ A;  2XLK A;  2F65 A;  2R7U A;  1IM6 A;  1YZ7 A;  3KK3 B;  3VGS A;  3LGN A;  3C14 A;  3MEG A;  2BE2 B;  4DCP B;  2O1P A;  4IDK B;  2CQ2 A;  2FPH X;  3NLC A;  1KN6 A;  4NLQ A;  3SI8 A;  1R27 B;  4YOE A;  1C4A A;  1S99 A;  1SUQ A;  4CTA B;  3TJ9 A;  2DPJ A;  5FJ4 A;  1HI1 A;  2DNQ A;  2QA1 A;  1UTA A;  1WG4 A;  5H9E J;  4B3R J;  4EMD A;  3TJA A;  1T9W A;  3OT9 A;  3J81 U;  1X4C A;  2L41 A;  2KG0 A;  4N41 A;  3QT8 A;  4Y6I A;  2AKW B;  2QLB B;  2NXC A;  1QD1 A;  1WEX A;  3I4P A;  3EXC X;  1YI2 S;  4NAS A;  8AT1 B;  2KHC A;  3N0V A;  4C0O C;  4F02 A;  4LF9 F;  5CYM B;  3TVZ A;  2N4C A;  2G0J A;  4WP3 A;  3T5J A;  2Y1I A;  5BYS A;  2EK1 A;  1SKR A;  4A8F A;  4C8Z A;  1VQ9 S;  1NPP A;  2ZVI A;  3EIC A;  4IOC Q;  1UWB B;  2VV5 A;  3MFI A;  4LF4 J;  2OD4 A;  1JQG A;  3PHT A;  1WG1 A;  1B0V A;  3ENA A;  4P6Q A;  1RWX B;  3PEJ A;  4WTY A;  2WTF A;  4J9M A;  2AEJ A;  1PSD A;  4M5H A;  5HQL A;  4NLV A;  1TAQ A;  4W4M A;  5I42 A;  4DS5 A;  2V8V A;  5FII A;  3W2W B;  3ZZR A;  1IBL F;  1WC3 A;  4DS4 A;  3TYT A;  1AXQ A;  3OTD A;  2V4J A;  5J1P A;  3VAK A;  1RA7 A;  1X8D A;  2VPW B;  4P2F A;  4C3M A;  5C24 B;  5LXR A;  3DI6 B;  1P9Q C;  1NUE A;  4MTP A;  1EQ0 A;  1NO8 A;  3T1A A;  2MY8 A;  4MIA A;  4OZ5 A;  4OYA A;  1TKX A;  3UE2 A;  4F26 A;  4C0B A;  4E8U A;  5F0W A;  3PW2 A;  1NND A;  2K3K A;  2EVZ A;  1NH7 A;  1RT7 B;  3MAH A;  2OGU A;  2HQG A;  4N5S A;  1Q81 T;  2HHW A;  3ITH A;  4ZHR B;  2VDI A;  1S4E A;  3BBC A;  3TUZ C;  4AL7 A;  2UXC F;  2HHU A;  1DFD A;  4ZVF A;  4XPE A;  4DV1 F;  1TKZ B;  2R7O A;  1YSJ A;  3AA9 A;  4BC9 A;  1NXI A;  2X1A A;  1BWV A;  2MQM A;  2IYI A;  4X4T A;  1LWC A;  2DEI A;  3DDI A;  2XMU A;  2JLG A;  3K5M A;  2J0Q D;  4JI6 J;  1ZZF A;  2J0W A;  2QSW A;  3HFV A;  3UD5 A;  4KSE B;  3VQS A;  1U48 A;  1XIQ A;  3AA8 A;  1YIT S;  4PG7 A;  2QSF A;  1SJ1 A;  2XSJ B;  2H1Y A;  3W2W A;  4DCO B;  2B4U A;  3B82 A;  4CNY A;  1U1O A;  1HW8 A;  5J2Q A;  4UY8 5;  2EFP A;  1S9E B;  2ZUA A;  3LAK A;  2V4J B;  3N28 A;  4AT1 B;  3CSK A;  4IFV B;  5MAO A;  4YQW A;  1U0H B;  5E3P A;  1NJI T;  3GYN A;  1N5Y A;  1X4E A;  4C3L A;  2UUW A;  4ECR A;  2H5J B;  2Z0G A;  3C14 B;  3MEG B;  3H59 A;  4NOH A;  2XZW A;  1YBU A;  3WHI A;  1P1T A;  4Y00 A;  4F67 A;  2ZJR Q;  2OPS A;  2ZOG A;  2BAN A;  3SMZ A;  3TVY A;  1BQX A;  2HWT A;  2XMJ A;  2GHW A;  2VQE J;  1FJE B;  2CYY A;  4ZVQ B;  4HKQ A;  3MTK A;  1DQ8 A;  1RHJ B;  1OSD A;  3D1H A;  1YJ9 S;  1N34 F;  2JFK A;  2RUG A;  4DZD A;  2VG6 A;  2YQ1 A;  2O67 A;  3LWM A;  2UUC J;  3CC7 S;  4M8L A;  4KBI A;  4ZVS B;  3DRY A;  4KHR A;  3SSQ A;  3JS9 A;  4NZ0 A;  3RBZ A;  4JI5 F;  2XMK A;  2CPF A;  3H25 A;  4USU A;  2DGU A;  2LU2 A;  2G1D A;  4DV2 J;  3LGH A;  4DV7 F;  5A8R A;  2ASJ A;  3SDE A;  1X9M A;  1RT1 A;  1N5S A;  5I3P A;  3O2I A;  3R5A A;  2UUA J;  2L9D A;  4R8U B;  3ZZY A;  1FRK A;  4K59 A;  4ER8 A;  4D3H A;  2HND B;  1M5H A;  1YG0 A;  4ZPB A;  3G8S A;  1DBD A;  3G4S S;  4DN9 A;  1FJG F;  1HWI A;  2IAJ B;  4KKO A;  3T5H A;  2M5Y A;  1CJU A;  5EX3 A;  1VIX A;  2HHP A;  4A8W A;  1KVJ A;  3THV A;  3BDE A;  2FVP A;  3NCR A;  3TA2 A;  4TLR A;  3BPS P;  1XER A;  2OPS B;  2QE5 A;  1CUL A;  1GQE A;  3VV2 B;  5C2G A;  2HS4 A;  4JI4 J;  1RLC L;  2AYG A;  1H38 A;  3DLG A;  1R8A A;  2F9J A;  2BQR A;  3PM9 A;  2A6M A;  4OZ2 A;  4FF3 A;  3MHY A;  2RRN A;  5DRK A;  2HBQ B;  2IVY A;  5J2Q B;  4LVN P;  2HQD A;  5D4P A;  1X4A A;  4CNZ A;  2ASL A;  4QCL A;  2OFH X;  2E9Z A;  4Z37 A;  5E0O A;  4UOG A;  2RUS A;  2KHD A;  2OUG A;  1WC0 A;  2EFG A;  4PQA A;  1X9W A;  1FX2 A;  2YKQ A;  4OI0 A;  1NBE B;  1T9X A;  2W01 A;  2XUL A;  3NS6 A;  1PO6 A;  3TUP A;  1S1U A;  1FFG B;  3QAE A;  4AXJ A;  4QPT A;  4CO4 A;  1WDD A;  1LWC B;  1ZM2 A;  4ZLN A;  1XR5 A;  3MOZ A;  3R1H A;  1I6J A;  2HND A;  5IT4 A;  2UVV A;  2O3D A;  3OXL A;  2OJ3 A;  2IIH A;  4G1P A;  2LEC A;  4H4M A;  4PQU B;  1S7H A;  3CGI A;  5ETS A;  2VG5 B;  1LFP A;  2UZA A;  1FDB A;  1WEZ A;  4H4K C;  4RW6 B;  4ZPW R;  3SSR A;  5BXI A;  6AT1 B;  2RQC A;  4USI A;  1LW0 B;  4CLZ A;  2BQ3 A;  2DPI A;  2J9C A;  4J5O A;  4O3R A;  2YWE A;  3PNI A;  1MNE A;  4GRS A;  4USM A;  1CJT A;  3R5C A;  3PYD A;  3QO9 B;  1FKP A;  3HHL B;  1O51 A;  2PC6 A;  4ZIV A;  2GIR A;  3HT0 A;  3W5Z A;  3AXM A;  3DLK A;  2W9A A;  2HFS A;  2PI5 A;  2O66 A;  5A0Y A;  4WYL A;  4DQP A;  4WFB Q;  1V3Z A;  1S6Q A;  2DJW A;  3TJ8 A;  3A1Y G;  4ED8 A;  3D2W A;  3GYX B;  4N7T A;  4ALZ A;  1LW0 A;  1VQN S;  3CWJ A;  5CQG A;  2W4D A;  2YNF A;  3RR8 A;  2DIU A;  2X1G A;  2YNH B;  4HR2 A;  2MHE A;  4DR5 J;  1N52 B;  2AYB A;  3DDK A;  1A9N B;  4EO8 A;  2H48 B;  3IS9 A;  4YUD A;  1MN9 A;  1AT1 B;  3FFI B;  5E3Q A;  3L3C A;  2JWN A;  2LQB A;  1RT3 B;  1RDR A;  1DAR A;  3GJS B;  1WJ9 A;  4IOB A;  3W1Y C;  2LXI A;  4C7Q A;  2V69 A;  2AD9 A;  2FVR A;  1MWQ A;  3WC2 A;  4F2S A;  1RT1 B;  4C3K A;  1M5K C;  1GXL A;  2GVZ A;  1I94 F;  5BR8 F;  4P52 A;  1SI9 A;  1IUJ A;  1SJQ A;  2OPP A;  2CKW A;  3I5B A;  4ECU A;  4WKR A;  2XNR A;  3KYL A;  2VOO A;  4PZV A;  1WHV A;  2VC1 A;  2DR8 A;  2R7V A;  5KFK A;  2RSQ A;  3JSM B;  3OFG A;  1RXO B;  2RQK A;  4ZLJ A;  2Y0S D;  2M7S A;  5B0A A;  2QGF B;  2WSC C;  2ZFH A;  1JIH A;  1PCA A;  2XLJ A;  4QU6 A;  5HL7 Q;  2CPD A;  2UXD J;  2CQ3 A;  2MZS A;  1H7X A;  2P8I A;  1F5B A;  1N6Q B;  1MLA A;  1RTJ A;  3ET6 B;  1QAJ A;  2OAU A;  2PD1 A;  1GNK A;  1HBM A;  3QJJ A;  1DTT B;  1N36 J;  4CYU A;  3QGH A;  4OZJ A;  4ZJO A;  5EWG A;  3HDS A;  2NLW A;  4WU2 A;  3BN4 A;  4ZP7 A;  4LSL A;  3AQO A;  5DDQ C;  3MCM A;  4L73 A;  9RUB A;  5A2Q Y;  3FDS A;  2MZ1 A;  1NB2 A;  4DR3 J;  1N56 A;  4O4G B;  3MM9 B;  3DLH A;  3I0R B;  2WSF C;  2RDD A;  2ZBI A;  3KLG B;  3M9M B;  3D1O A;  4OI3 A;  4LIR A;  2FDN A;  4ETZ A;  1TFW A;  5E3A A;  4A4J A;  1J5O B;  3DLB A;  2WBM A;  3EMT A;  2MMY A;  3BB5 A;  4M94 A;  4KIA A;  4RW9 B;  5KFH A;  5K9F A;  3EXY A;  3MUV P;  3C6T B;  4IRK A;  2YNG A;  4J91 A;  5K8O A;  2UXB F;  4G1Q B;  3KLI B;  2JSX A;  6FD1 A;  3HM9 A;  2ZEJ A;  2Z2M A;  1RTI B;  4J9V A;  3TQ1 A;  4WIQ A;  1NHK L;  3CJ4 A;  5D0R A;  4ZDN A;  1XTZ A;  5AXL A;  4H4M B;  2BJ1 A;  4L72 B;  4CO5 A;  3GV8 B;  4ELU A;  1GTH A;  1MN7 A;  1RT6 A;  4QIG A;  2H54 B;  3G2X A;  3TUJ C;  3UDV A;  1GT8 A;  4NI2 B;  3FFI A;  3OSP A;  1U1Q A;  1TL1 A;  2J9D A;  2W7A A;  1ROF A;  3H98 A;  3ZC4 A;  2WON A;  4FS1 A;  3H20 A;  2RRA A;  2OD6 A;  1VC5 A;  2ZBC A;  4USJ C;  3ZTP A;  1D09 B;  1F9F A;  2CIM A;  2CVE A;  2V67 A;  5AXK A;  4ZVU B;  5KOX A;  3IRW P;  4WK1 A;  3CCE S;  1FX4 A;  2BM0 A;  4LF2 A;  3CJT A;  3MPD A;  4JI7 J;  3QNW B;  1R6V A;  4FF1 A;  3JQJ A;  1QY7 A;  1HBN A;  2CXE A;  2KDO A;  1XWL A;  1U1K A;  2ATL A;  2IA0 A;  2P5V A;  4IDK A;  2BJ8 A;  1DLO B;  2BJD A;  3D0G E;  5KFA A;  1VQ6 S;  1R0A B;  1D8Z A;  2XBP A;  3GU0 A;  1S1X B;  3SIP B;  1IKY A;  3KJF B;  1JLA B;  1JLE A;  2BEF A;  3GE9 A;  3LGM A;  1CS4 B;  3VZI A;  5A6P A;  2MQP A;  3VAG A;  3ZZO A;  4EZ6 A;  4ZN3 A;  2R2U A;  1YWX A;  3VGT A;  1BLU A;  2HPU A;  5A8K B;  2HVH A;  4U6P A;  2XWX A;  4UUX A;  4P2S A;  4F4K A;  3EUN A;  1Z4U A;  4TLQ A;  3ZFV A;  4V19 J;  2CNN B;  2FVC A;  3QYY A;  1HYS A;  1M5O C;  4DF4 A;  5B0C A;  4HEA 9;  1RTD A;  1FHT A;  2NZ4 A;  3OL8 A;  4GKK J;  2VFS A;  2XHC A;  1FTR A;  3S1T A;  2B9E A;  3TO8 A;  2MSS A;  3AJ2 A;  1YJ7 A;  1QAY A;  4LFB F;  2R8G A;  4B9T A;  3QAU A;  1XMQ F;  2V68 A;  1JWW A;  2DNZ A;  5KFF A;  4NX9 A;  1KLN A;  1M1G A;  2CG8 A;  2XYH B;  3CCW A;  4ED0 A;  4IR1 A;  2ZHO A;  4DDF A;  2V9W A;  3DGV A;  3KHG A;  2XI2 A;  1IR2 A;  1B0P A;  1NSA A;  4EYH B;  3NCP A;  2KVQ E;  2IBO A;  1S59 A;  3WX8 A;  5L38 A;  3UN2 A;  4X4U A;  4DR2 F;  1M0S A;  1CUL B;  3CT9 A;  3GV5 B;  1XN9 A;  3ILJ A;  5E41 A;  1X5T A;  5HRO A;  1KON A;  3V6K A;  2N4D A;  1G4C A;  3QWU A;  5D3G A;  1TVR B;  2DHS A;  2KT3 A;  1WC6 A;  1Y5L B;  3FQK A;  3FVY A;  5K14 A;  4ATN A;  4X65 J;  1O6X A;  1DQ9 A;  2K2P A;  1Y11 A;  4OYM A;  2W7O A;  2HUR A;  3GP9 A;  2N7Y A;  1PG5 B;  4ZPA A;  4DR6 F;  2ZH4 A;  4U67 Q;  3K5O A;  1VQS A;  1WI8 A;  3IFE A;  4U9R A;  3PR5 B;  2G13 A;  4QIV A;  3W2V A;  3Q8P B;  3G8T A;  1FXL A;  5EX0 A;  1NK8 A;  3C15 B;  1RAJ A;  2ZH2 A;  1R0A A;  4HTJ A;  3O1L A;  2DIV A;  1HD1 A;  5IT9 U;  1NEE A;  4QWE A;  2A2C A;  2DNR A;  2HSE B;  3FMB A;  3QLH B;  4OFZ A;  4B3O B;  1H6K X;  1U6Z A;  2HK2 A;  2C2Z B;  3QAT A;  3E51 A;  4MH8 A;  1WOO A;  3UDL A;  2CPI A;  1B3T A;  5GME A;  2DR7 A;  3GIJ A;  4WZQ A;  4OX9 J;  4DJB A;  5DLG A;  1EAY C;  2KJW A;  4DLE A;  5I4M A;  1RU1 A;  1GMW A;  2YVS A;  3Q89 A;  2B5J B;  2HGM A;  2PFD A;  2YKA A;  3LP2 B;  4I7F A;  4OX6 A;  3A8J A;  3ETM A;  3ISZ A;  4WXO A;  5AE1 A;  3TRG A;  3Q23 A;  1U4B A;  1RT6 B;  1RKJ A;  4KHP J;  3DOM A;  2CA9 A;  5J1E A;  4UZB A;  4L3N A;  1FNM A;  1KLM A;  3GYG A;  3QLH A;  5LSL A;  4B3S F;  3QBC A;  4IQX A;  3KHL A;  4O3S A;  2MKY A;  3DI6 A;  1BQN B;  1VRU B;  3NMA A;  4RZR A;  1S6P B;  3A8K A;  2GCF A;  3W65 A;  4F04 B;  3OVB A;  1VQ5 S;  1KHV A;  4X4R A;  1O5J A;  4ZLP A;  2N82 B;  5ETR A;  3KLE B;  3W2V B;  3CCS S;  1R6Y A;  3CB4 A;  4LRA A;  3KK1 A;  4IOA Q;  4DSL A;  5D8H B;  2EI5 A;  2GGP B;  2Y1L B;  3R5J B;  1JK9 B;  2QLX A;  2EFQ A;  1OY8 A;  1S6P A;  3A3P B;  4QW9 A;  3OUY B;  5HBM A;  5B08 A;  2RU9 A;  2VFV A;  1TU0 B;  3KLG A;  4DL3 A;  3MOJ B;  1RBA A;  4HHU A;  4PG4 A;  1IN0 A;  3CE8 A;  1NJW A;  4IR9 A;  4F50 A;  5K14 B;  2DGO A;  5IV3 A;  3HFK A;  3J81 j;  4C2M A;  1VOM A;  1NSQ A;  2Q6B A;  2ZZN A;  3SQG B;  1CSJ A;  3OLB A;  4CO3 A;  1TP7 A;  4DQQ A;  1J27 A;  2DNY A;  3W5Y A;  5CYM A;  4RUB A;  2KZZ A;  3J80 U;  3D6F B;  3IN5 A;  4FF2 A;  1BQM B;  1G1X A;  1KTV A;  2DGV A;  2IAJ A;  4KKO B;  5KFG A;  3NGD A;  3M8R A;  2YX1 A;  4ZP8 A;  4X4P A;  1C1B B;  4ILR A;  1U1M A;  2PMZ D;  4NLO A;  2VA3 A;  4UF4 A;  4O23 A;  1VC0 A;  2COL A;  2BMB A;  3MM7 A;  1X4D A;  3CD7 A;  2QYC A;  3OL6 A;  4ERD A;  1EQM A;  1FRX A;  2HRU A;  4M5K A;  3WDO A;  2FVQ A;  1XNR J;  1SUQ B;  2YWH A;  3VAH A;  2DNL A;  3DM2 B;  1RIS A;  3KXD A;  2ALY B;  1K8A T;  2ADB A;  2HQI A;  1L3V A;  4QOT A;  2YKM A;  1EJ7 L;  3G6X A;  3CCU S;  3T3F A;  4PXC A;  4IH7 A;  4DF8 A;  1GAO A;  3CO0 P;  2ERR A;  1X60 A;  1YBA A;  1UKU A;  4FBT A;  3H4B A;  1VQ7 S;  4ZMM A;  5ETQ A;  3AXK A;  4YHH F;  2EG1 A;  2FD2 A;  2CQ1 A;  2DNH A;  3I0R A;  5K20 B;  5U47 A;  2ZBP A;  2EC2 A;  2K1R A;  2QX0 A;  2CNL B;  1Q86 T;  2WCX A;  3FQL A;  4Y65 A;  5LSO A;  1RK8 A;  4TQS A;  3W63 A;  1LXN A;  1UVI A;  2WSE C;  5KFQ A;  1NK9 A;  5L9N A;  3G86 A;  3SDE B;  3K17 A;  2HZC A;  3KLE A;  3HKZ D;  2OLW A;  4O4R A;  1UAW A;  2Z2Y B;  3M6U A;  4YB6 A;  1FNO A;  2ZH3 A;  2RIL A;  1UZH A;  2DKO B;  2J6U A;  2DRA A;  3P4U B;  4C8N A;  3JAM Y;  1VBZ A;  2XS2 A;  3NNC A;  4RNF A;  2UVR A;  1UPM B;  1FEE A;  1VI7 A;  3BGR B;  4DPW A;  3K8V A;  3ENW A;  5F8N A;  2B6A B;  1KC8 T;  2F8H A;  4B9V A;  2J0X A;  1JLC B;  1GEH A;  4I2Q A;  5KFT A;  2EK6 A;  3G87 A;  4CIO A;  4KO0 B;  1PIE A;  2H4W B;  2XLI A;  4LF6 J;  2PSZ A;  1ARO P;  2WZ1 A;  3MWB A;  4CP5 A;  1X4G A;  5CAA A;  2XC9 A;  4ED1 A;  4PQU A;  2MST A;  1LV5 A;  5BJR A;  1OYD A;  1NHU A;  3B4D A;  1J5E F;  2H5E A;  2OMO A;  2GVD B;  1M90 T;  2UUT A;  3MMB B;  5IQ6 A;  4DUZ J;  4FXD A;  2V2Q A;  1LW2 B;  2ZVS A;  3DLJ A;  2C3P A;  2XEX A;  3EZO A;  4PWU A;  4ECT A;  3RBD A;  4X4V A;  5I3U B;  1JLE B;  5IS2 A;  4LF5 F;  4JV1 A;  1W26 A;  5G4D A;  1X31 C;  2HFU A;  3B6B A;  1JXL A;  2CPJ A;  3C16 A;  2GAH C;  2KN4 A;  3S8S A;  4USW A;  3Q0A A;  1TKD A;  2D3O 1;  1Q8B A;  5KFU A;  3ZO7 A;  2LDI A;  3MM6 B;  4F4X A;  2GQQ A;  3AJ1 A;  1GX6 A;  2EXU A;  4CRJ A;  1TQL A;  1VQ8 S;  1WD6 A;  4DPU A;  4L75 A;  2HNZ B;  3J80 Y;  2L08 A;  3HPO A;  4LR7 A;  2UP1 A;  2GA7 A;  3MEE B;  5IWA F;  5DDO C;  1ZM4 A;  3CCJ S;  4OLO A;  4RW6 A;  2QFJ A;  1M5P C;  1HNW F;  3HFZ B;  1G6B A;  3BKF A;  1N34 J;  2PDA A;  2HS3 A;  1HBU B;  2QZ8 A;  5HJY A;  5HQM A;  5HSP A;  1NHV A;  2AWZ A;  2V0N A;  4IYQ A;  2J0S D;  4ZPC A;  1C0T A;  1RAO A;  3BEG B;  2OFG X;  3R6G B;  3FJ2 A;  2RHS B;  3I6P A;  5B0D A;  2MGZ B;  3HT3 A;  4DV4 J;  1RU2 A;  4MIB A;  4NRU A;  8ATC B;  1AA1 B;  1XNQ J;  3HZE A;  2F40 A;  3SQO P;  2YH1 A;  3MD1 A;  4HT5 A;  2E7V A;  3KOA A;  3IG1 B;  3GWC A;  5GVQ A;  1KOO A;  2DR5 A;  1YGY A;  3MEK A;  1NKC A;  1LEO A;  1KFD A;  1R0C B;  2BYC A;  3UCZ P;  2HZA A;  2IJF A;  2R2S A;  1OS5 A;  4I1T A;  3H8Y A;  4LBI A;  4NXN F;  1FJ7 A;  2CPE A;  2V94 A;  4DSF A;  1S1W A;  3H2L A;  3Q8R B;  2OTJ S;  2APO A;  2ZIT A;  2IA6 A;  1UL3 A;  1YKW A;  2B43 A;  4CT8 A;  3LWL A;  2W9B A;  5L9X A;  1TAU A;  1UMJ A;  4YDX A;  2V8P A;  5KFV A;  3QIP A;  1PBU A;  4FXW A;  2DGS A;  2Z57 B;  5K5M A;  4JYA J;  3UWT A;  1VC6 A;  4URS A;  1S49 A;  1CJU B;  1VRT B;  3CDU A;  2BBE A;  3JTN A;  3CJS A;  4PYD A;  3BGO P;  5AE2 A;  2WOM A;  3A3O B;  3F44 A;  3U1L A;  5CD4 H;  4NCA A;  4HVZ A;  1Z2L A;  3A13 A;  2X51 A;  1CJK A;  3IGN A;  4R5P A;  2FIU A;  4J9O A;  1SVD A;  2AEF A;  1NKB A;  4WF9 Q;  3M7V A;  4QBU A;  3HHL A;  4F4Z A;  3DLE A;  4PAB A;  2I0X A;  4K4U A;  4BWM A;  3PW4 A;  1UET A;  3Q8Q B;  4OQJ A;  4G65 A;  3K7R A;  1Y10 A;  2MPU A;  4P71 A;  2IVF B;  3MR3 A;  4HYK A;  2W4C A;  2E7X A;  3UDC A;  4B17 A;  4JI1 F;  3PKY A;  3PW7 A;  4DCJ B;  5E5N A;  2Z56 B;  3RB3 A;  1IBL J;  4OX8 A;  3SV3 A;  4C9D A;  1KVI A;  3VZH A;  3HCX A;  4I2P A;  2HHT A;  1C0T B;  2DHG A;  2DH7 A;  3T1Y F;  3DLL Q;  3HHL C;  1NPR A;  3BSN A;  1WOR A;  2HEK A;  3QFW A;  2I9S A;  3PG9 A;  1N32 J;  3TAM B;  3DRX A;  3MI7 X;  2DO4 A;  3QID A;  1XNR F;  2KFN A;  2CG4 A;  4ECS A;  3V5R A;  5I3U A;  2GGP A;  2HFV A;  2KT2 A;  4DQS A;  3MM6 A;  1C1C A;  2UVU A;  3G82 A;  1UFL A;  3ZXW A;  1QJH A;  4FP9 A;  3SYZ A;  1VQK S;  1LW2 A;  3OXG A;  3HVT A;  2UUB J;  3I9Z A;  4ID5 B;  1XMO F;  4X4O A;  1FKP B;  3IMQ J;  4LFC J;  4NLD A;  2KYX A;  3Q24 A;  3D66 A;  3KG0 A;  1VQ4 S;  3PRB A;  5T14 A;  2R7X A;  2MHN A;  1SH0 A;  4EGL A;  2BW7 A;  1W7W A;  3R6L B;  4RW7 A;  4PUO B;  3P8B B;  2VG5 A;  5CA5 A;  4A8K A;  4TYB A;  1XR7 A;  2MJU A;  1EP4 B;  1EET A;  3E01 A;  2RT3 A;  2G0C A;  1GMV A;  1T05 B;  1OSC A;  1CPZ A;  4B02 A;  1YVF A;  3WBZ A;  4ANC A;  4QWC A;  6FDR A;  3ETO A;  3FRY A;  4M5D A;  1FT8 A;  4KFB A;  1IWA A;  3M8Y A;  4CLS A;  3J7Y I;  1U02 A;  2KI2 A;  3MUM P;  2KFY A;  1TKT A;  2G2Z A;  5KG6 A;  4URG A;  5C5J A;  4ED6 A;  1D9D A;  1N54 B;  2DIT A;  2HNY B;  2OEK A;  3FSY A;  5A2Q U;  4WP9 A;  4QQB A;  4XK8 C;  4MFB A;  1Y3J A;  2W2Q P;  1RT5 B;  3DRR B;  3O5T B;  3C6T A;  5CHC B;  4Q0B B;  2AGQ A;  2FZK B;  2R9L A;  3CNQ P;  1RWK B;  2WVE A;  1J5O A;  2RHQ B;  1YLX A;  2DGQ A;  4URQ U;  4ETX A;  5B0E A;  4OHY A;  2IRU A;  5DGA A;  3AQP A;  4HH0 A;  2VDH A;  3ZTS A;  4B3M F;  2KXN B;  1LWF B;  2F1F A;  4Q43 A;  3QGG A;  1DTQ B;  2B7C B;  4I4B A;  3OXF A;  5IOL A;  4MYT A;  4F3O A;  3QFH A;  1TZ0 A;  4LRE A;  1S97 A;  1U26 A;  2XI3 A;  3IP0 A;  4ZPT R;  1LWF A;  2YWG A;  5DZ7 A;  1ZOT A;  1AUD A;  2HW3 A;  4LSN A;  5DET A;  4PXE A;  1RHK B;  2WK4 A;  1S77 D;  1MU2 A;  4CZC A;  4MKA A;  3JSM A;  3PY8 A;  2XYP B;  2F7V A;  4AFF A;  3M8Q B;  1UW9 A;  1VLY A;  1T0T V;  2FJE B;  4HI2 A;  1BHN A;  3L7P A;  2QV6 A;  2ZH5 A;  3W7B A;  3EGV A;  2FHJ A;  4WK3 A;  4ZOS A;  5ETV A;  4FBU A;  4X4S A;  1KOH A;  3N5B A;  3NNA A;  1Q0N A;  4OZ3 A;  1YRX A;  2X1B A;  2EFO A;  4ZVH A;  3T1H F;  3KMQ A;  4P2M A;  4A47 A;  2MKI A;  4B9M A;  3KNA A;  4DL7 A;  2PMW A;  4HDG A;  4HTI A;  4UOH A;  3WX4 A;  4Y2I A;  3W60 A;  1S1U B;  1VDH A;  5ITH A;  2A10 A;  3MMC B;  2QRR A;  1UCN A;  4F0M A;  5IXU A;  5KG3 A;  2KFZ A;  3V4I B;  5FLX Y;  1V5I B;  1SQE A;  4QWB A;  5DQI A;  2FLP A;  2FY1 A;  2YNI B;  1H2V Z;  2DGW A;  3FBF A;  4BCA A;  2XS7 A;  2DTJ A;  1PIL A;  2WVC A;  2XO6 A;  3GLJ A;  4TVA B;  1UZD A;  4GC7 A;  2QT7 A;  2FLL A;  2NYH A;  4MAK A;  4K8R A;  5ETK A;  2CJB A;  4EWT A;  1KNZ A;  1Q78 A;  2UU9 F;  4NLX A;  1S0O A;  4ZVE A;  3EVO A;  5BYQ A;  4OHW A;  2L9N A;  2G9O A;  1NCL A;  1S48 A;  3R3T A;  4PYA A;  4R0E A;  2U1A A;  5HAN A;  5C2C A;  4X64 J;  2F3J A;  3JSR A;  3KK2 A;  4FF4 A;  4N77 A;  3GG1 A;  3AOC A;  4MKV A;  3MAA B;  2WON B;  1SJ3 P;  2AEM A;  2BE9 B;  3EM1 A;  5FDL A;  2RIJ A;  2LQ8 A;  2QO3 A;  5JMN A;  3GIK A;  3KHR A;  2W24 A;  4KFB B;  1S0V A;  2FY8 A;  1V6H A;  4GVB A;  4UST A;  2HS0 A;  1TVR A;  5L1K A;  3OR2 A;  4Q8F A;  4J9S A;  4IUF A;  5HLF A;  1X4F A;  3AD7 C;  3K0J A;  2LP4 A;  4U8V A;  7AT1 B;  2AGO A;  5F8G A;  3IAM 9;  2PFF B;  2E44 A;  1RT2 A;  2D69 A;  3LA0 A;  4K4Z A;  5AXM A;  4GMK A;  2KU7 A;  1CJV B;  2KJV A;  2VQF J;  2ZC3 A;  4AND A;  5DJB A;  2R42 A;  1UVL A;  3C15 A;  1LK7 A;  4OV6 A;  3V6D A;  3RAM A;  1X9S A;  5D0H A;  2DRD A;  3TWZ A;  3UVJ B;  5KFP A;  2AT1 B;  4CLK A;  2ZZT A;  1QE1 B;  2V6A A;  2ZD1 A;  3EGZ A;  4I67 A;  4JI8 J;  3HVW A;  1SCJ B;  2QMU B;  3GIL A;  4FYV B;  1U2C A;  1JLG B;  4TY8 A;  1KWM A;  1O8B A;  2G2Y A;  2AX1 A;  4AUK A;  4ECY A;  3IA0 A;  1GK8 A;  2DH9 A;  3DXS X;  3PFO A;  3I31 A;  2R8J A;  1N6Q A;  1SPB P;  3EVM A;  2C3O A;  3O8W A;  4RPF A;  5DM6 Q;  4DFJ A;  2RML A;  5D3G B;  3LP1 B;  1QE1 A;  2ZD1 B;  4JV5 F;  3P5B P;  1N0V C;  3NY0 A;  3U7J A; 
#chains in the Genus database with same CATH homology
 3VVT A;  1BUX A;  1XQI A;  4O0N A;  3Q86 A;  3FCV A;  4C6A A;  2AZ3 A;  5C7P A;  3Q89 A;  5CAB A;  3NGU A;  1B4S A;  1NB2 A;  1F6T A;  3ETM A;  4UOF A;  3ZTS A;  1NSK L;  1WKL A;  3FBB A;  1NDP A;  3JS9 A;  1NPK A;  3Q8V A;  4DI6 A;  1NLK L;  5IOL A;  2DXD A;  3EMT A;  3FBC A;  1BE4 A;  2DXF A;  4F4A A;  1NDK A;  1HIY A;  1KDN A;  3PJ9 A;  3BH6 B;  1NHK L;  1NDL A;  2HVD A;  1LEO A;  4W98 A;  4EK2 A;  3VGS A;  4KPC A;  1MN7 A;  1WKJ A;  3G2X A;  4F36 A;  1BHN A;  3L7U A;  1HLW A;  3EJM A;  3FKB A;  1NSQ A;  4DZ6 A;  3ZTO A;  3EE3 A;  3ZTP A;  3NGT A;  3BH7 B;  4ANE A;  2NCK L;  2DY9 A;  4DUT A;  3MPD A;  4UOH A;  2B8P A;  3Q8Y A;  1HHQ A;  3DKD A;  3GPA A;  4UOG A;  1UCN A;  2DXE A;  1WKK A;  4S0M A;  3VGV A;  3ELH A;  3FBF A;  3EIC A;  2BEF A;  4FKY A;  3ENA A;  3VGT A;  2HVE A;  2VU5 A;  2CWK A;  3EVO A;  4FKX A;  1NCL A;  1S57 A;  3FCW A;  3VVU A;  5BXI A;  2BX6 A;  1S5Z A;  1VYA A;  3EM1 A;  3ZTQ A;  1NUE A;  3R9L A;  2B8Q A;  3B54 A;  3Q8U A;  1LWX A;  3FBE A;  1PKU A;  1NDC A;  1EHW A;  1F3F A;  3BBC A;  3FC9 A;  4AND A;  1S59 A;  2AZ1 A;  4HR2 A;  3WX8 A;  1B99 A;  2DYA A;  3DDI A;  3NGR A;  1MN9 A;  1K44 A;  3ZTR A;  4WBF A;  1W7W A;  5CAA A;  1XIQ A;  4CP5 A;  3Q83 A;  1U8W A;  2HUR A;  3GP9 A;  1JXV A;  3BBB A;  3PRV A;  4ENO A;  2ZUA A;  4ANC A;  1ZS6 A;  3EVW A;  1PAE X;  3EVM A;  3VGU A;  1NSP A;  3NGS A;  3BBF A;  3B6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...