3VVUA

Crystal structure of reconstructed bacterial ancestral ndk, bac1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
MERTFVMIKPDGVQRGLIGEIISRFERKGFKIVAMKLMRISQELAEKHYAEHREKPFFSGLVDFITSGPVVAMVLEGKNVVEVVRKMIGATNPKEAAPGTIRGDFGMSVGKNVIHGSDSLESAEREISLFFKDEELVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Experimental evidence for the thermophilicity of ancestral life
pubmed doi rcsb
total genus 39
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3vvuA00
3Q8VA 3ENAA 1HIYA 4DUTA 1KDNA 1MN9A 4FKXA 4F4AA 4C6AA 3Q86A 1WKJA 3EVMA 2BEFA 1XIQA 5C7PA 3L7UA 2DYAA 3ELHA 3DKDA 3BH6B 3ETMA 3NGSA 3BBCA 3VGSA 3EICA 1BHNA 3BBBA 2VU5A 2B8QA 1B4SA 2HVEA 1S5ZA 1NDCA 3B54A 3EVWA 2HURA 1NLKL 4UOHA 1PAEX 1WKKA 2BX6A 1NDPA 4S0MA 1U8WA 3GP9A 3Q8UA 1HHQA 1LEOA 1NUEA 3FC9A 1F6TA 3VGUA 4WBFA 4ANEA 3NGUA 3FKBA 3Q89A 4W98A 3EJMA 4FKYA 3ZTQA 3MPDA 3Q8YA 2CWKA 1LWXA 3G2XA 1EHWA 3B6BA 2AZ3A 4DI6A 1NCLA 3Q83A 1K44A 2AZ1A 2DXFA 3ZTOA 3NGRA 1NDLA 1BE4A 2ZUAA 1BUXA 3VGVA 2DY9A 1ZS6A 3FBBA 4CP5A 4UOFA 4EK2A 3FCWA 3DDIA 3PJ9A 3ZTSA 3JS9A 3VVTA 4ANDA 1F3FA 3FBFA 4ENOA 1S59A 1XQIA 3FBEA 4F36A 3GPAA 5IOLA 3BBFA 1B99A 1HLWA 3FBCA 4HR2A 2B8PA 4ANCA 3NGTA 1UCNA 1NSKL 1PKUA 1JXVA 1W7WA 1NDKA 3VVUA 1NB2A 3BH7B 2DXDA 5BXIA 3VGTA 3EM1A 4DZ6A 2NCKL 3WX8A 4UOGA 3PRVA 3R9LA 1NHKL 1NSQA 3ZTRA 3EMTA 1NPKA 1S57A 3EVOA 4KPCA 4O0NA 1WKLA 3FCVA 1VYAA 2HVDA 3EE3A 2DXEA 5CAAA 5CABA 1NSPA 3ZTPA 1MN7A
chains in the Genus database with same CATH superfamily
3M8YA 4DPOA 3OTOJ 2N3OA 2QLBB 4OJ1A 3BH6B 3R27A 1IQTA 2AYGA 1A7GE 2VD3A 2N4CA 4P73A 4RW6B 2CQGA 2RUSA 2OH2A 5DGBA 2HQCA 4C8KA 3OQ2A 4X4TA 1T95A 1QSYA 2G2YA 2J0WA 3BR8A 1EHWA 1FDAA 1HNVB 1LQ9A 4XDDA 1BQMA 5E33A 1UVIA 1WDDA 1AB8A 4UUWA 1NNDA 2G0JA 2JEGA 1TMJA 2VDIA 4J9KA 3K5PA 2HBQB 2KHCA 1X7VA 4FVMA 2M8HA 2KZZA 2KO1A 5KFAA 1NHKL 2EBEA 2G2OA 4KFBA 3KJFB 4Q45A 4MFBB 1WKLA 4QWDA 2V8GA 1P1TA 3JSMB 3Q8VA 1RT1A 2FVRA 3NS6A 3ZNUA 3PYGA 3UN5A 3CJKA 2V9KA 3PYDA 1DLOB 4CLZA 1NB7A 3B4DA 4ZVFA 6FDRA 2XSJA 1AW0A 2CAJA 5L8RC 4ID5B 2ZE2B 3H8YA 4F0HA 3NY0A 2QMXA 3M7VA 2HQGA 4TVAB 1JB0C 2KJVA 3VWSA 1LWXA 4U7UD 3CC4S 4CTAB 1VHIA 4CLKA 1WNEA 3NNHA 4DSEA 3FSXA 3D68A 4KR0B 5FD1A 3IWLA 3GIRA 3GPAA 3R6LB 3EZUA 4GVLA 1R0CB 2M88A 5DDOC 1MROB 4EEYA 3C16B 1KWMA 4O3PA 5AXNA 4C97A 1TELA 2WVFA 4B3OA 2F63A 2BYCA 5FJ4A 2QEXS 5KTQA 1VQ5S 1RXOB 2LECA 4OI3A 5C24B 2ZC4A 2BZ2A 4UQTA 5A8RA 3DLEB 4PWDB 2MPUA 4DFMA 1B4SA 4ZCMA 2EEYA 4YHHF 4J9RA 7FDRA 5I3UA 2W9BA 3KKFA 3F0NA 1F9FA 2YX1A 2VKRA 1LWEA 2H1YA 2EVZA 4NMLA 3TJ9A 4L75A 1VR6A 4DR4F 1HNIA 2V8HA 3QWPA 5DQGA 1G7CB 1KVJA 2ACYA 3EZOA 1FK9A 2R9LA 1FF2A 1V3ZA 2OI2A 4DQRA 2FLPA 4ZN1A 4Q44A 2XYPB 4TLRA 2Z2MA 1S1XB 1HNWF 2BMBA 4Z7CA 1F9EB 2QO3A 3CC2S 1HYSB 4ECSA 4PQAA 1ICEB 1XTZA 4M5NA 2R2UA 3OTBA 3NBPA 3MR6A 2FTRA 2KXHA 4J9VA 3UD3P 2O67A 1IN0A 3DRRB 2QYCA 5LJ5Y 3BGRA 2NQPA 3MAAA 3ELHA 2QIFA 3HD1A 4FF2A 2I9SA 3WDOA 1SPBP 2J7WA 1RT2A 3MECB 1U8SA 4NLTA 2YKAA 2O3DA 2MLZA 1BC6A 3HCXA 2R7UA 4RUBA 3EGWB 2HAFA 1R0AB 2HW3A 3QLHA 3DN9A 2ZVIA 4WXWA 4UOCA 4IRKA 3PZPA 1B7YB 2ZNZA 4RW8B 4NI2B 1T3NA 3KNGA 3LP1A 2QZ8A 2MZSA 2GV1A 3HHKA 3KUHA 3AA8A 3JYTB 1WUUA 2E5JA 3KLHB 3KG4A 2QFJA 3DOKA 3OBIA 4TLQA 1IBMJ 1NKBA 2CJKA 3OTDA 4P10A 5BYQA 2YKMB 4H4OB 5KFBA 4AL6A 4FS2A 4U96A 1DRZA 3TR5A 4EU0A 3UWTA 2UV8A 2M0GB 3NWGA 2DPJA 1NPKA 2LQJA 3NCRA 2G13A 2KB2A 2HQIA 5T7LB 3AHPA 4WE1B 2DR7A 3J7A1 3MD3A 2WW4A 3SV4A 4DG1A 1QUVA 2OPPB 3B8HA 1W25A 4Y3CA 1XR6A 3JTOA 1OS5A 2E1RA 3H98A 4IH6A 2AHOB 3BSCA 5KFTA 3CW2C 2VFRA 3MMJA 3HPOA 1S99A 3TVZA 3Q8UA 3IP0A 1VHFA 3R97A 4HT7A 4YOEA 4LF4J 3GE9A 1VQKS 1HNWJ 3V4IB 3CVKA 2MB0B 1NHVA 3ILLA 3BKUA 2O01C 4DV7F 5DQIA 4ZVSB 2A3JA 5HJYA 3SDEB 2EXUA 2W7AA 3HHLC 2KH9A 1HBMA 3PJ9A 1HHTP 4QR0A 2X3GA 2VJVA 5KFPA 1HW8A 1IM4A 4CH0S 3RRGA 4MFBA 3M32B 1T7PA 2AJ0A 4YR2A 4Y0FA 3JSMA 4OI2A 4ED3A 3OFFA 3RBEA 1S9EB 1OJ4A 2IDEA 1S72S 2VZ9A 5KOWA 1ZYQA 3OL8A 2FHJD 1HR0F 4P6QA 5D4LA 4ED5A 4C8OA 2ZUGA 4MYTA 2HLUA 4DPYA 2DHHA 3ETMA 4ID5A 2ZE2A 3IC1A 3D9BA 5KT5A 4LFBJ 3C15B 2LFVA 4U6PA 1NBEB 1XNQF 4ZN3A 1FRXA 4C8MA 2QA1A 5I3PA 4LSLA 4RPFA 3C16A 8AT1B 4YB1P 4DLGA 3GIMA 5JJBA 3HD2A 1VIXA 1YVFA 2CDQA 3D6MB 4F36A 1ZAVA 5B0EA 3K58A 1XWLA 4ZLLA 4DX7A 2YX7A 3AH6A 4BWMA 3KYLA 1FEEA 5LMNF 3M30A 3PIPQ 3MOJB 4LRBA 3A8JA 5C24A 3SCIE 3CCJS 4CH1A 1RT5B 3FFIB 3GYGA 2CUYA 2ASLA 1C4CA 2JFDA 2LDYA 3FDSA 4B3TF 1PO6A 1R8AA 2NUUG 4MIBA 1X31C 1V3SA 2AP6A 4C3MA 2OO4A 1T9VA 4DV4F 3A4TA 1RABB 5HN0A 2FVQA 3BGUA 5B0FA 3ZTQA 3PR5B 1FRLA 2NUHA 4Y2CA 1AROP 5DJBA 1SQGA 4A8SA 2OMOA 1S1XA 5HMZA 2B43A 4DQPA 1SXLA 1XC9A 2HGLA 4WK3A 4RR5A 4ANDA 1HYSA 4KGZB 1NZ8A 2DGXA 1RHMB 2KN4A 1JNRB 1NDKA 3DU6A 1UKUA 4IR1A 1TVRA 1NK4A 1QM9A 2QSWA 2VBYA 3H5UA 4ZLPA 1BHNA 3HXMA 2LEBA 1DURA 4O0IA 3IS9B 3HLUA 1R0AA 1L3KA 2Z2YB 2M4MA 3N6LA 5CD4A 1MNEA 1LW0B 1YJ9S 3PO4A 3J7AN 3LWMA 5KFSA 4DS4A 4F4YA 4RW8A 1BY9A 4NI2A 2RD5C 4C8NA 1RTJB 1VQ8S 3FC9A 1L3TA 3JYTA 3T1YF 1BMQB 1WC4A 4ZA1A 1UFLA 3Q8YA 1KLMA 5CCMA 1RHRB 1NK6A 3J81j 1T05B 3PJWA 2YWFA 5J2QB 3QJJA 2L41A 3EGZA 4MAKA 4Q2LA 3BM7A 1FE4A 1YSJA 3M6XA 3MM7A 2AJ1A 1T9YA 4HR2A 9RUBA 5CH7B 2G1HA 3MEEA 4XIUA 5T7LA 1UAWA 4WE1A 1RAIB 1FD8A 5CA5A 2CPZA 2ZOGA 2N7YA 2OPPA 4DV4J 2EW9A 3UPFA 3Q8QB 2J6TA 4WFBQ 4QWBA 1T8EA 2DGOA 1S48A 3ONQA 1SJ4P 1RCOB 1HIYA 3H7HB 2XG8A 2V69A 4HACB 4HTJA 1U2FA 1S1UB 1NJZA 5B7WA 3AODA 1H2VZ 3V4IA 2GVZB 3PX4A 1BD6A 2R7XA 5B0AA 2QGFB 3M05A 3V2UC 1ZOTA 3MCNA 3SDEA 1HBOB 3MURP 2J0QD 1YJUA 1HNXF 3A8EA 4ED0A 4L76A 3M32A 4X4QA 7AT1B 1UVKA 4OYOA 5KAKA 4FPRA 2CADA 3A3NB 2XWYA 2B4UA 3KJQB 2CXEA 1K73T 1S9EA 5FDLB 4FXDA 2CPDA 2PFFB 1MMNA 3AOAA 3CC7S 1PKUA 5K9FA 2DR5A 3OR2A 2V2ZA 1UVNA 1UL3A 3GYNA 1HFEL 3TOQA 3LW5C 2MJUA 2CJ9A 4ZDNA 4ZVGA 3TA1A 3BKTA 1FX2A 2KYZA 3R5DA 2MZJA 4ECTA 1UWBB 4OZLA 4O4GB 3GJQB 1KP6A 4DX6A 2XS7A 1Y4ZB 2DNRA 2KJWA 2I5JB 2DGQA 4CRJA 5C25B 4IOCQ 2B6AB 2DGUA 2JOQA 1CS4A 2RHSB 3FKBA 5D4OA 1HWJA 1M5HA 3MPWA 2IDLA 2UUBF 1RAJA 4O23A 1C0UB 1N32J 1ZM9A 4LIRA 1OSCA 1WC3A 3GQCA 4ZCLA 1F5CA 3KTQA 4EMDA 4EK2A 1XJWB 1RTDA 2QLJB 1FKPB 5IT4A 4CLFA 1D09B 4ZVOB 3AXMA 1F9HA 2B4PA 1RT5A 3FFIA 5D4NA 3D2WA 2HRYA 1O6XA 2D3O1 2PO4A 3DLHA 2Z8QA 5ADZA 4TNOA 4MK8A 5AXLA 3H5SA 2VUGA 2W1BA 1KNZA 2DRDA 4JB8B 3QNWB 2AJ2A 3IG1B 1EP4A 4ILMA 1IJFB 1S6OA 3J81Y 2AEFA 4F3QA 4YUDA 3K8WA 3OXLA 2LYVA 5B09A 1N0UA 1WTBA 2UUCJ 1LK7A 3R6GB 4GKKF 4H4KA 4B08A 2PC6A 3QZ8A 2MLXA 1Y9OA 4PEOA 4WBFA 4LUBA 2C3OA 3UNGC 3DRSB 4J91A 1U24A 2QMUB 2FLNA 4NLQA 1WHXA 3FEZA 4YS2A 4QIVA 2ROGA 4I6WA 3ZZ0A 2MQMA 5GAHU 3ENQA 2UVRA 1W7WA 3W2WB 5F8NA 3BYRA 4C0HA 3M8WA 1VQMS 2ZOFA 5AE1A 3G82B 4JI3F 2DO0A 4XTTA 3Q8SB 3IXQA 1UVLA 3A13A 1Y10A 1LW0A 3W60A 1JLEB 2L3MA 1IBLJ 2GZOA 1NH7A 1Z1ZA 2UUBJ 2KYXA 4AYBD 3TAMB 2JFKA 3MPUB 1RT6B 2YQ0A 3A3PB 3GG0A 4JOUA 3LQVA 5IT9Y 2DPIA 3MTJA 4OYAA 4EYHB 2WVCA 3TVKA 3AY0A 2WCXA 1D9DA 3B54A 1VBXA 1R89A 3C6TB 4X4UA 4B9TA 5J2QA 4A8MP 4YR3A 5J2MB 5HO4A 2CPIA 2F9DA 1YWXA 2U2FA 1GK8A 5KFMA 4LF5F 1X5OA 3C6UA 4ZPCA 1WORA 3QAEA 2XZDB 5IM0A 4B9NA 3IGNA 3V81B 1VRTB 3GV7B 2ZH1A 3QATA 1RZMA 3D6HB 4DR5F 4JI4J 1SV5A 1TUGB 4CIOA 2KZMA 3H59A 2V8PA 4DV1J 1M5PC 2OAUA 4GKKJ 4HACA 2YPYA 2LU1A 4LF6F 2CQ2A 1PGZA 2GVZA 4LBHA 3JXOA 2R8JA 1YG0A 4A8YA 1VGYA 2HHUA 1NSAA 2KG0A 2BQUA 2ZH7A 2R3VA 1HBOA 1Q4RA 3D3CJ 4DR6J 4XK8C 1HI1A 2QL5B 4P7VA 2V4RA 1XNRJ 2MKCA 4F2RA 5HI7A 2BVZA 1EETB 2XO6A 4ECRA 2KU7A 4CLLA 1OQ3A 2VG5B 4NLRA 4FZVA 3IBWA 4TKTA 3OVBA 4A47A 5FDLA 2R42A 2ADBA 1DAXA 1RWMB 3BN7A 3QWUA 3EDRB 4X64F 2ALZA 1M90T 3AFGA 3CWJA 2W2QP 1FNMA 1VQPS 2W9CB 3QIPB 1WC5A 4K5RA 4DHVA 5B0GA 1UPMB 1NK9A 2DHXA 1N48A 4ZIVA 2J5AA 2OTLS 1N33F 1VFJA 2WONA 4PZVA 4ATNA 4UQGA 5L1LA 1AXQA 5M2PA 3FMBA 1UWBA 3VAJA 1J5EJ 4IRDA 4NPOA 1TR0A 4OX6A 3E8OA 2AGPA 1N5TA 2RDDA 3H4DA 1T03B 2VQFJ 2I5JA 2IMWP 2B6AA 1ROFA 5KFJA 1RWUA 4KJIA 5DZ6A 3CNQP 2RQKA 2HVEA 1B70B 1C0UA 2FJAB 3NKYA 1S97A 4YB5A 1SUQB 2FJVA 1LOUA 1FTCA 1QAYA 3HT3A 4ER8A 3PJXA 3FMWA 4TQSA 2V4QA 4X65F 2LMIA 4YDDB 3L09A 4USTA 4ZPWR 3HI9A 4KQZA 4K5SA 5B0BA 4LF6J 2OPRB 3R8YA 2GHWA 3BQ2A 4IFVB 3M8PB 1WJ9A 3IO1A 3HVWA 4OHVA 4USJC 4IQMA 4L72B 4OX8A 1S0VA 1PC4A 2KI2A 2DGVA 1IKYB 4DSFA 2CVEA 1FT8A 3G4SS 4R5PA 2HFZA 2W9AA 3IG1A 3QSIA 4QIWD 4DU7A 1EZZB 1JMTA 4WIQA 3PCOB 4FPIA 3HZGA 3MEKA 5HBMA 3LPEA 2JEJA 4X64J 4I56A 2W4DA 4BBYA 3CCVS 2W2NP 4WXOA 4OI6A 1VOMA 1Q5VA 3DRSA 3CF5Q 1FRJA 3UNYA 3RAXA 3HHDA 1KQKA 4K7QA 5F8GA 2HIQA 4FBUA 4KE5A 2BQRA 3IR7B 3K89A 4ZHRB 3MWBA 5HATA 1X4BA 3KHGA 4F8RA 3SCLE 4K4UA 3DXSX 4IR9A 2HAIA 3I56S 2HK2A 1VBZA 1WSVA 5D6GA 2OGUA 1NPPA 3W2WA 4CLUA 4DDFA 3UO0A 1KVKA 2QX0A 3ENVA 1ELOA 4P2XA 5T41A 4DCJB 3IN5A 1CJUA 3G82A 1HHSA 2XS2A 3UDEA 4RBUA 2EK6A 5KT4A 1TL3B 4FYYB 4AE5A 2CQDA 3BN4A 3E3XA 3J7Z5 2C28A 3ICLA 2EC2A 2RU3A 4F7VA 3KLEA 3QT5A 3OD2A 4LFAJ 3HSJA 4ZIWA 1XMQF 3D1HA 1E6VB 2UVUA 1TTHB 2MSSA 3MEGB 5KG3A 1H6KX 2AJFE 1I94J 4CLSA 4DL0C 1U6FA 2FC9A 3C6TA 3RJMB 2PMZD 5J2MA 3RB3A 4WU2A 4NL5A 4YMEA 2MQLA 4DLEA 2LDIA 3QRPA 1OSDA 5M2RA 2HMIB 1Q16B 1RP5A 4M63A 2HLTA 4NCAA 2HS0A 2F40A 3V81A 3SCJE 1UETA 2DJWA 3ETOA 1KFSA 4RWWA 5THWA 2GW8A 1NZAA 4LR9A 2ADCA 3VGVA 1N36F 4DX5A 2IRUA 2RS8A 4C0BA 5GMKa 3PG9A 2HS3A 3MM6A 4G1IA 2B8PA 1NSKL 1ZPVA 3RW6A 1JXVA 1S9GA 3M8SA 3THTA 4ZMMA 3VGTA 3EM1A 2XLKA 3N5BA 4RO0A 1RWXB 4LF7F 1Y7PA 4WU3A 4TYBA 4PPDA 2MXYA 1U1NA 2YWGA 3UR0A 2FB0A 4I4BA 2GO8A 4A8FA 1EETA 1WWHA 3MCSA 4CM0A 2BEFA 4NOHA 4AT1B 2CJXB 3DKDA 5GAEU 1WF1A 5C5JA 2VICA 4W92B 3G8QA 2QA4S 1MU2B 2B7BB 4E8UA 4JI7F 4OYWA 4FYVB 2JEIA 1JWWA 3R5BA 1VQYA 3DGVA 1Q86T 2BBEA 1N0VC 3QGIA 2W9CA 3QIPA 3U7JA 2DNPA 1FWLA 3T1HJ 1IKVA 3M6WA 4ILLA 2HGMA 1XMQJ 1IR1A 4PWUA 2FGCA 5AJ3J 4MKAA 3IAS9 2DT9A 2BACA 1YX2A 1JKHB 4M5JA 1LFPA 4OI1A 5BR8J 1HD0A 1WD6A 2VQEF 4MKVA 2QJ3A 3QGHA 3PKMA 5IS2A 1JXEA 3WQPA 1SCJB 1T03A 1MSWD 3SXLA 4WZQA 1LFWA 5E41A 1X4GA 5KFNA 3KJVB 1H2TZ 5H9EK 4HI1A 4IG3B 4IDKB 4NLWA 1RKIA 1SUQA 2XLJA 4YY3F 2GC8A 4DV2J 1RWPB 2KVIA 3MR3A 1N36J 1D8YA 1WEXA 3C46A 1TU0B 5E3RA 1C2PA 3PACA 1UA1A 1RT3B 3PXGa 1AYEA 3M8PA 3P96A 2MEWA 2J9CA 2OFHX 4I64A 6AT1B 5D3GA 1QAIA 3US5A 1HQ2A 2Z2ZA 4YP3A 2DNGA 3M9MB 4LR8A 3TUZC 3GU0A 1IKYA 2VV5A 5HL7Q 1TAQA 1APSA 3HK2A 2PI4A 3M9NB 1QJHA 4KY3A 2AX0A 1MW7A 4HH1A 3ZZZA 3BSOA 1WF2A 3FQKA 4JI7J 1VQ4S 4Y2AA 4PYAA 1F3VA 4DV3J 4ZCIA 2CPXA 2OEJA 1Q81T 1NRKA 5KG0A 4P72A 4ZVHA 3NAHA 2RH3A 2D41A 1S6UA 4N5SA 2F4VJ 5DZ7A 4RW7B 4R8UA 4HH0A 3M2RB 3N79A 1NK0A 2UUWA 3FEXB 5D4PA 4ZHRA 2UVVA 1FNOA 2E7WA 1CVJA 1M5SA 4TY8B 2A1BA 2VFVA 3V6KA 5KFOA 3TUPA 4U8VA 2AF6A 4PG7A 3T3FA 2VQEJ 1IBCB 4CH7A 5JVHQ 1RHQB 3GJTB 4G1PA 3MR7A 2J0XA 4LQ9A 4ZVRB 2CG4A 2X1FA 2CWKA 4QBUA 3L7PA 3NRBA 3HHLB 1K8AT 3DOMB 2UP1A 4CP5A 3U1MA 1LW2B 2ZOMA 3MM9A 2E5IA 1HBNB 1E6VA 4DFPA 1IM6A 1DFDA 2K3KA 2XQCA 3K8VA 4Q43A 2EI5A 3F56A 1NK8A 2ASYA 4QW9A 3ZZRA 3Q8RB 2GJFA 3VALA 3TW0A 1M5VC 3W65A 2XC9A 1SC4B 4H4MA 2QFIA 2RKIB 3S7RA 9ATCB 2AW0A 2YWKA 3P8BB 1XIQA 2WRMA 1OYEA 2JZ5A 2NYHA 4JI1F 4P2FA 1BLUA 1S1WA 2W25A 3KLIA 1QAXA 2XZWA 1H2UX 2GS8A 5D0GA 3CSKA 1JJHA 4K4WA 3NMRA 4OI0A 2XCPA 4KH0B 2HFUA 2XYHB 2KFNA 1HKAA 2AYEA 4DQIA 1K1QA 4C8YA 1OY9A 3VAMA 3PR4A 2BV3A 1L3SA 3A8KA 3X1LB 2VC0A 3HHEA 4ZVQB 1A9NB 3HSDA 1RWWB 3NGKA 3DLKB 1RTIB 3CDBA 2IFXA 1TUVA 4K4SA 4KSEB 3NCQA 5HQ8A 4B9VA 3D0IE 1KD1T 4Z7YA 4KV8B 2W24A 1FRIA 2C1EB 4K4XA 2CQHA 2RHQB 4GKJJ 1N4LA 3M2UB 5GMDA 2HKEA 4OX9F 1T94A 1MU2A 2WB4A 4Y28C 4EYIB 3E2EA 1UJ6A 4DZDA 5IQQA 2ZFHA 3T1AA 1MMLA 2VG6A 2B9EA 4B3MF 4KHPF 1CC7A 5K8MA 3GJSB 1WOOA 5L9NA 5LSRA 2OMLA 3SIPB 3ILOA 3PM9A 2ATCB 4XPEA 1PIEA 3ILIA 4DUZF 2HHHF 1KBRA 1GX5A 2HZVA 1F6TA 1S6QB 3X3UA 1WOPA 3T9ZA 1S77D 2FLLA 2UV8G 3R2CJ 1DTTB 2BJ1A 4HHUA 1RTHA 3MF5A 4TU9A 4GO7X 2HBRB 3AQPA 1URNA 2YX4A 3FZ2A 3ZTOA 1VS3A 1FFSB 4JUZA 1D8ZA 3M4XA 2C2MB 2A18A 3G6ES 2DY9A 3DLGB 2CPFA 3F41A 3J7ZT 2R7TA 2J0SD 2PT0A 1SB6A 1Q1KA 5BJRA 3I9ZA 4WFAQ 2WSEC 3BV8A 4YB6A 2ZBCA 2FY1A 5KFEA 4IRCA 2E7XA 2E9ZA 1RAOA 2WB1D 5CYQB 2HIYA 1KSPA 4ED4A 5E7OB 1UA0A 1CULB 2DIVA 2C2OB 1T9UA 3LOUA 2IVMA 4E0DA 1FDDA 1RT3A 2R8GA 3GWCA 2H48B 2V2VA 1W2BR 1K0VA 5K8PA 1GXUA 4TU8A 5KFGA 2FHMA 5KG7A 4F26A 3G96A 4KYZA 4ED2A 5DG7A 1TV6B 1KQGB 3M6UA 2KVQE 2HSEB 1VJQA 3GR1A 4HYKA 2DY1A 3HVTB 3RGIA 2B9WA 4RZRA 4MT1A 4OZ1A 4P9SA 2YNFB 2C22A 3FBBA 2WBMA 4FVCA 3KHLA 1TKZA 3HHLD 2QC3A 3AOCA 4CM2A 4LSNB 2YNGB 3DGPB 4KHPJ 1P1LA 2RAQA 3D1OA 5LMUJ 1U0HB 5KG1A 3LGMA 1KR4A 2ZM6J 4CNYA 4NLXA 3M2RA 5BYRA 3T9NA 3CCTA 1X5TA 4NWBA 4X4SA 2UXCF 2DRAA 4TY8A 3MM8A 4WJBA 1WG4A 4PG5A 4A48A 4CO2A 2EKYA 3ENAA 4I0WA 3R7BB 2DR6A 5J1PA 1RT7A 4KO0A 1CJKB 3GSDA 5L9XA 4ZJLA 2DNLA 5SZTA 1PILA 1GH8A 2ROPA 4WYWA 2JVRA 3HHLA 3CJQA 2HQFA 4EBEA 3DOMA 4PWWA 5KG6A 1RAFB 5LT5A 1RA6A 2ZJRQ 2P9CA 1LW2A 3RYLA 2XMMA 1U48A 2A6MA 4LF8F 1HBNA 5I4MA 3PEJA 3MPYA 2ZH5A 5D78A 3BPSP 2I2YA 3FCHA 2EC0A 4CLPA 3MR5A 2LXIA 5HAOA 2R2SA 3IRXA 1YQHA 4OHXA 4PXEA 3RBZA 4U95A 5I42A 3CXCR 3LAMA 3SZ2A 4C11B 1TFYA 5HROB 1CLFA 2V67A 1FJEB 3D1QA 3ZZUA 1AZSB 3DLBA 2ZH4A 4PRFA 4PXBA 1OWXA 3K0JA 1FKOB 4LF2A 2AEMA 4WK1A 1NM2A 1KQFB 3R7NB 3HJFA 2GO9A 2F9JA 5IT0A 3V6DB 3PW4A 4U9RA 2RT3A 4C48A 1BWVA 3NAIA 2HNYB 3JSBA 4P52A 2JEFA 3D6FB 3MUMP 2Q6BA 5IC6B 4ITSA 4Y6IA 1WEZA 3UD4P 5ETTA 2CFXA 2IJFA 2H4WB 4JI8F 5DGAA 1SJ3P 1RTIA 1EIYB 2F4FA 2MKIA 2DK2A 1AUSL 3PHEA 4F50A 1NEEA 4OJ3A 1N34F 4YDXA 3M2UA 3CJRA 2Z57B 1ZPWX 1PG5B 2X7IA 3OXGA 2E1CA 2PDAA 1RISA 1CC8A 4UZCA 3GV8B 2ZH3A 1NJXA 4LFCF 3EYZA 3I5BA 5KFZA 2P9GA 2BJDA 1HMVA 2BJ3A 3TRGA 1RT1B 4LF8J 2GQ2A 1SL1A 1VBYA 2YWWA 4XO0A 5EWEA 3KJNB 4B3RF 1NAQA 3SQGB 3PRDA 4EFAC 1ZM2A 1X4HA 4BHQA 4ECWA 1DTTA 4KHRA 3HFVA 1OIAA 4FS1A 4B9SA 3BREA 3GP9A 2KXFA 3W9HA 3DLGA 4DR7F 2J8SA 5SUHA 4ZOSA 4HDHA 3OVAA 4I2QA 2ZHOA 3ULHA 5DDQC 3VV2B 4ECQA 4FN5A 2FZGB 2F3JA 2C2KB 4JYAJ 5D15A 4QZVB 3LALA 2WOMB 1DJ0A 4JI5J 1YBAA 3MAHA 4DR3F 1MLAA 1OPIA 5CYQA 5K14B 2QLWA 1HNZJ 1TL5A 1TKXB 1FRKA 3RAQA 4KT0C 2IAJB 5CZXA 4RNOA 2DBBA 4NXMF 1PCAA 2LA6A 2PMWA 1JLCB 4JI6F 3WBZA 4G3IA 4Z37A 4MK7A 4NLPA 5A8RB 1XR5A 1DY3A 3N0VA 1W26A 5KFLA 3BO3A 3OTOF 3HVTA 1RBOB 4NRTA 2W9BB 3KNAA 2K7KA 1D9AA 2OIHA 4QR1A 4M95A 2DEJA 3WX4A 2JSXA 4KH1B 3SSRA 2YNFA 1FERA 2R8IA 2EG2A 5CYJA 1WTFA 2NXCA 1UVJA 2RE1A 2D74B 2IM2A 2CQBA 4LSNA 3DGPA 3QZ7A 2K1RB 1U0HA 2AKWB 4K4YA 1FK9B 5EUHA 4CNZA 5HVFA 1IJEB 5F0WA 4B3RJ 4KAIA 2ZWOA 4NLOA 2VB6A 3MTKA 1QD1A 5D77A 2QL9B 2CQ3A 3DRYA 1Q8KA 5CD4H 4R25A 5CCLA 4ED8A 2M7SA 1TL4A 2UUAJ 1CJKA 4QCLA 3W1YC 3V4MA 3FCVA 1VYAA 1JXLA 3GG1A 3W8PA 4DOZA 4DCPB 3BGRB 1W2IA 1D3WA 1QE1B 5AE3A 2POKA 3IWNC 1RT2B 3OJUA 4OHZA 2WSFC 2F8EX 5DLGA 5KG4A 4B02A 3UN3A 3OHAA 4N47A 1U1KA 5HMWA 5H9FJ 2B51A 1X8DA 2CQ4A 5DM7Q 4PG6A 3NLCA 4ECYA 3AJ2A 2RQMA 4NXMJ 1RUSA 2MKYA 4A8OA 5GADI 4A46A 2E29A 2LQ8A 3DDNA 4PUOA 1VK8A 3OFEA 1RJJA 3ENWA 3DOKB 4C11A 2ZKUA 2ZD1B 4USWA 4M1KA 2BR0A 3UR3C 3I5AA 4QU6A 4LF9J 2EFVA 2MMYA 2MQPA 3C3LA 4OZJA 1AZSA 2J8AA 1HD1A 5IC4B 2RIJA 2H4YB 3J81U 1GEHA 3ET6B 1FKOA 4LIWA 4GC6A 4JBCA 4N41A 3V6DA 2HVDA 2RDJA 4X4NA 1QY7A 4DG1B 2HNYA 1HW9A 3V6HA 2G1DA 2RRAA 4QYZJ 4KGMA 2ZEJA 5A76A 2DD8S 2AEJA 1DQ9A 2UXBJ 5LL6d 3NMAA 2NPFA 4KPYA 4DN0A 4PYDA 1LXJA 3O6QA 5D0EA 3UCGA 4ZP7A 1CJTA 1JIHA 1DQAA 2X1AA 3G71S 2JLEA 3SYZA 2CNLB 2I6WA 4LVOP 3CJ4A 1NCLA 3CMES 4QJVA 2E5GA 1HBMB 3G8TA 2P2CB 3OTCA 2BJ9A 1MG7A 2L08A 4LSZB 3VVTA 2M5YA 2MLYA 2YQ1A 4ELUA 4ZVTB 2H5IB 2F65A 1S0OA 1UCNA 2VC1A 2FPHX 5IT9U 2MKJA 3K57A 3P49B 3P4UB 3LWLA 3PNIA 2K7JA 2YNIB 2NXJA 4P2SA 2Z58B 3SQGA 1S6PA 3A8IA 4ALZA 4KGKA 2VPWB 2XI2A 1HWLA 5RUBA 2DCUB 4IO1A 3UN2A 1V3RA 1X9MA 1U1OA 5ETOA 2O1PA 1Q8IA 1T9TA 2LXUA 3ITHB 1X4AA 3JTNA 3CMQA 4X84A 2UZAA 4NCBA 3UW1A 3NGDA 4ES3A 2Y1LB 2FQQB 1YITS 1SH0A 5F9LA 3L3CA 5F8JA 3BSAA 4PG8A 2WOMA 4BWJA 1PYSB 5KFHA 5E3CA 4LSLB 1ZBTA 3KXDA 3QJPA 5K14A 3IFEA 1TKXA 1NDLA 2IAJA 4N8NA 4ZVUB 2HVZA 4PG4A 5MLCV 1JLFA 3AJDA 3QO9A 1JLCA 4O4RA 3M30B 2BW2A 4F02A 3KLGA 1IBMF 1RWNB 3M6VA 3S6EA 2YNHB 3UD5A 1Q53A 2V5HG 1KOHA 5CABA 3ZTPA 2FY8A 3O44A 2HG4A 3PVXA 2W7PA 2HS4A 2FIUA 2DHGA 4X62J 3SQOP 2V63A 1ZH5A 1WF0A 4O3NA 1NDCA 4NLYA 3AD9C 1U09A 5ITHA 4LREA 1FWPA 2W7OA 1A0OB 3OLBA 2K1RA 2EFPA 1HARA 1BWEA 1RADB 2R7QA 1OPZA 4KGVB 3C2PA 1S4EA 4LF4F 2IYIA 5F0UA 2RNEA 1KS2A 2C42A 5C42A 3DM2A 3S8SA 1U0SA 3CJTA 2L9WA 1G3OA 2COLA 3D6TB 3JSRA 1IKWB 1SKSA 4EZ9A 1TVRB 2E7VA 4DBQA 5D8HB 2DGWA 1QE1A 3AXKA 4PCQA 3NP5A 3TYTA 3MCOA 3FRYA 4OLPA 1TP7A 1U1RA 4CYUA 2IVFB 3EZ5A 1Q78A 4ZP8A 1RU2A 2GAGC 5K5MA 2CZ4A 4K0KJ 1MN9A 1URRA 1YK9A 3GIJA 1Q82T 4J9LA 3MXHP 3D4JA 2BJEA 3THPA 4OYZA 4OX7A 3R1LA 1T02A 3I96A 1FVSA 1TMMA 1E6YB 1WHYA 1QVFR 4LFBF 3AB2B 3PTWA 5L46A 4FF3A 3M9OB 1KLMB 1S0NA 1Q8BA 2ZD1A 4WFZA 2VL1A 2W01A 3LA0A 4CO1A 5HVGA 4UT4A 5ETKA 3NNCA 1F60B 1YDLA 4NXNJ 1SH2A 2SXLA 2O5DA 3MM7B 3ET6A 4G6VB 3RUBL 3T5JA 3CEDA 2HZCA 4J9QA 1NJIT 4P74A 3MEEB 2OTJS 3EGNA 2BKNA 1NB2A 1IBKF 5M2UA 1Y11A 3PKYA 3RW7A 3MFIA 5J1EA 4L73A 3A3OB 3QQCD 1YKWA 4GC7A 5DDRC 1JLAA 3W5ZA 4C3LA 4KKOA 1RBAA 1BXNA 3AD8C 1LV5A 4ZPBA 4WP3A 1UJ4A 2DNOA 2ILZA 5KT7A 4HT5A 1U6ZA 4Q8EA 3QT7A 4RNNA 1KTQA 3MDFA 1T11A 5T14A 1PAEX 2GMJA 2CPJA 1FESA 1PJ7A 4IQXA 3K5MA 2R7RA 1N5QA 2C3PA 1NH8A 2CVIA 1RE1B 2LQ9A 5BYSA 3THVA 2C2ZB 4D3HA 2YXLA 4EO8A 5HANA 2DNKA 4OYIA 4DUYJ 1U02A 3RZAA 2YNIA 5IOLA 3NOCA 2HEKA 3UQSA 1REGX 1KHVA 3OR2B 4FF1A 4FXVA 1RK8A 1R31A 3N28A 3PFEA 4FYXB 2ZZMA 5F8LA 4MKYA 4C8ZA 2UXDF 3BQ1A 3ITHA 2D3ZA 4FKXA 3Q0AA 3TNVA 1ULRA 1FFGB 5KT6A 4CCHA 1YRTA 3CJSA 2QN6B 3D67A 2IVYA 1WDTA 4NYZA 3CGIA 1CS4B 5HP1B 4I68A 1LEOA 5GVQA 2V94A 1IBKJ 1J5OB 2WBRA 3FUYA 4DR1J 5ETRA 3HHNB 1U4BA 3VAGA 4C2MA 2EWHA 4PABA 3FK4A 1WHWA 2V0NA 1Y3JA 1RTDB 4F0MA 1KEKA 3IR6B 4N56A 1F3FA 2YNHA 3RR7A 4Y2IA 4F25A 4QWEA 3OL6A 2KFYA 4ZVPB 3I6PA 2NS1B 3G6XA 2C2NA 1VIOA 4IH7A 2NPIA 5E3QA 3CJ0A 4P71A 4DZ6A 2NSBA 1N8RT 4NLDA 1YZ7A 3VTIA 4GO5X 1BQNA 4RKUC 5A8WA 4IYQA 3JAMY 1VRUB 3GSIA 2LKZA 5ETLA 4RU9A 3E51A 1EP4B 2NXUA 3VGSA 3BGFA 3NG8A 4J9NA 4WTOB 3MAQA 3FJ2A 2PFDA 2JL9A 3A1YG 3WIVA 1HBUA 2GJIA 2PI5A 3P5BP 4C4WA 3G6VA 3CCUS 4NLGA 3MMCA 2HBYB 3CO9A 3RB4A 3LP0A 1IKWA 1WG1A 2CJQA 2BJ7A 2UXDJ 4NEZA 3QSYB 1MWQA 3BBFA 2OUGA 4UUXA 3ZO7A 1S0MA 5EN1A 3DCAA 2UU9J 3AD7C 4AQYJ 4QIEA 3G87A 3V6JA 3HKZD 4ZLJA 2MZQA 5A2QY 5CAAA 2RF2A 1JNZB 2WAQD 3GFYA 3KG1A 4J9MA 1KFDA 4R0EA 1P9QC 3LUYA 1E6YA 3KLVA 3IBCB 5L38A 1HQUA 4ICLB 4PXDA 2EK1A 1AT1B 4OV1A 4BC7A 4IOBA 3D7SB 3C6UB 3VHQA 3IRWP 4ZP6A 4BCAA 3CUNA 5IM0B 4ECZA 2VDHA 3KK2B 3WHIA 2HFSA 1S49A 5JMNA 3KK3B 1PYOB 1SV5B 3DDIA 1N32F 4ENOA 3GMGA 2VONA 2XULA 4MMOA 3LPYA 2OSQA 4LJMA 4DQSA 2CJBA 2M70A 1R43A 2H3EB 1EKSA 1B0TA 4JI0J 1IKXB 3PX6A 3KHHA 1M5OC 2Q3PA 4PPZA 2D9PA 5HVHA 3MPVA 1X5PA 3F73A 1U1QA 3MUTP 2E44A 3BO4A 3EPGA 3Q86A 4P2MA 2R7VA 3HO1A 4Q5VA 1N6QB 3MMAA 4RUHA 3BEGB 1FJGJ 4USIA 3I32A 3J80U 2CNOB 1R6VA 4RNHA 3UDCA 2UUCF 3JQMA 3QMQA 4OQJA 4PAAA 3UDLA 1QSLA 3CJ2A 3GCWP 2XM3A 1RT4A 2E9TA 2BM0A 3L9ZA 2XEXA 4M5MA 3ISNC 1VCTA 2AX1A 1XMBA 3QJLA 3BB5A 2HBZB 1NO8A 3CCSS 4CO5A 3QGPA 2WONB 3MM5B 4QOTA 2AGQA 2Q79A 4NA1A 3D0HE 2M3DA 3W62A 3CJ5A 4RU2A 1RHUB 5E2QA 3VAFA 4WIIA 3B82A 2DB1A 3DLLQ 2W4PA 4WFXA 3CDAA 2Z30B 2MQ8A 5D0RA 1MN7A 1H74A 3WC0A 2P5VA 3H90A 3DXBA 2WK4A 1S9FA 5HP1A 3L7UA 1S76D 2EFQA 3GFHA 1IBLF 1RAGB 1J5OA 4N7TA 2MZTA 1RAEB 1C1BA 4QIGA 2MGZB 3KMSA 1JLBA 4D3GA 2ZDPA 4X4VA 1ZM4A 2IRXA 1SJRA 5EGYA 2HFNA 5EWGA 4IFYA 2Q6CA 2ZBIA 4XDCA 1DHMA 4OZ0A 1SJ1A 2I38A 1C4AA 2DKOB 2KG1A 4K2XA 3GJRB 3T5HA 1WC1A 1H7WA 3LP2B 4OZNA 4I2PA 4USVA 2FUG9 2VBZA 2QV6A 4OJGA 2FLOA 4OHYA 3P45B 2AWZA 2IM0A 2EPIA 4NA2A 2YWEA 4I7FB 1YHQS 1SBRA 1S79A 1VRUA 3R5GA 2XNRA 1ZA1B 2GA7A 4R5PB 4JI4F 1VQOS 3TUJC 3VAKA 2IPOB 4QWCA 2J6SA 3CJ8A 1U1PA 3TI0A 4DV1F 3LTOA 1RDRA 5HBMB 1EQ0A 1DQ8A 1Y0HA 4B3SF 2H54B 2CPHA 4RX6A 4W4MA 2C3YA 1S12A 5JXSA 4DR2J 4E2FB 2M52A 2I8EA 4L6V3 3K17A 3VR1A 2IJNA 4H54A 3AJ1A 1U2CA 2W8LA 4DR6F 1VMBA 5HMXA 2VKZG 2Y1RI 4W98A 1XNRF 1REVB 1UVMA 3W5YA 3QGGA 1KLNA 2EFOA 4TXSA 4DL3A 4USUA 1CQMA 2JJ4D 3HT0A 1CJUB 4DV5J 1TKDA 3ZTSA 3UI3A 2BE7D 1U6BA 3MHYA 2Y0BB 1B99A 2ZH9A 1NJYA 1IWGA 2FVSA 1AA1B 2AT1B 1RLDA 3KLEB 2CQIA 1X0PA 1U47A 1YJTA 4PR6A 2JNJA 1UEKA 3PX0A 3W61A 3JSYA 2KTQA 2RJZA 1FO1A 4ICLA 1O51A 2M9KA 2KM8B 3M1VB 1KN6A 1J5EF 2DYAA 2AMCB 3BBCA 1NKEA 2KRBA 3TZYA 4DFJA 1DZ5A 2KDOA 2VQFF 4K8RA 1G4CA 1T9XA 2JX2A 4CZCA 3KK2A 1UMJA 4Y65A 2NZ4A 3RU0A 2OEMA 3KK3A 2NYIA 1ZZNA 2OKQA 3C14B 4RBTA 3OW2R 4ETZA 3T6BA 2KT3A 3WZ0A 1K44A 4WFNQ 1VQSA 4J9SA 3P3DA 2Q66A 1ZAWA 4B3SJ 2VASA 2V4JA 2BA9A 1IKXA 2MY8A 4NYPA 3MM6B 3GONA 1S9GB 2V8VA 3OSNA 1P6TA 2XHWA 2OD6A 2IMOA 4X66J 2Q1LA 2XB2D 3EMTA 1HA1A 1XR7A 3FQLA 2CDRB 1N5YB 2R8HA 1N6QA 4Y2MA 3TJAA 1RKJA 4ZPAA 1NPRA 4V19J 4CT9A 1I6JA 3BQ0A 1SKRA 2FC8A 3DDKA 2LEAA 4OJHA 1NLKL 2BX6A 3H42A 2N3LA 3ZZPA 1I3OB 2LP4A 2W2OP 1IKVB 4FKYA 4Y34A 2WVBA 2O66A 2DNZA 1RAHB 5AXMA 5C2CA 3MEDB 2XSFA 3OJSA 1FXLA 2J7KA 4WCEQ 3MM5A 3R5AA 1UW9A 2CIMA 1F5BA 2YVSA 1VQ7S 4CO0A 1SJQA 4KBIA 5HK4A 1DARA 2GFFA 1P8GA 2DR9A 1G2EA 2ASDA 2KHDA 4J9PA 5KFFA 3UE2A 5DG8A 3POTA 3PRVA 3R9LA 1Z4UA 3L95X 1Y5LB 4O0NA 4F3OA 3BJYA 5F3TA 2AV5A 1TKTB 2MGZA 5AE2A 2Y1IA 2XMUA 4DV6F 2RRBA 3CCQS 4LFAF 2GHPA 4MJKA 1C1CB 4I1TA 4BC9A 3QT6A 1I94F 2RB7A 2LEPA 1FX4A 4IO9Q 2HURA 4USMA 5E3PA 3LP2A 3IM9A 3J7YI 5K8NA 3RG6A 1YJVA 5D3GB 2CNKB 3CD7A 3B6BA 3D54A 4I7FA 5KFKA 3V5RA 1JQGA 4F3MA 3FSIA 5A8KA 2VBXA 2YKPA 4Q0BA 3SSSA 1ACMB 2P9EA 2K06A 2BE2B 2AYMA 4OL8A 3DYAA 1UWAA 2E66A 2HNDA 2HNZB 4DX8H 5ETVA 2C2DA 3BO2A 3D66A 1IUJA 4URQU 1JJ4A 2PD1A 1YI2S 2R4FA 1WSRA 4EBCA 4IH5A 2HGNA 2DNQA 1HI8A 3CCZA 2HQDA 5EDWA 4R8UB 5DETA 4YHHJ 4WF9Q 4QW8A 3EVMA 1WOSA 4EO6A 4KIAA 2CA9A 3W63A 1FCAA 4OYBA 4N76A 2VA2A 1REVA 4RUAA 2ZBPA 2OLWA 5LOQA 4RW6A 4CO4A 1U8WA 2ZJPQ 1F1BB 4EUVA 4FNIA 1NUEA 2XGPA 4NX9A 4DR4J 2MQQA 4ANEA 4OV6A 2QSFA 2J9EA 2OJ3A 4UW2A 1S4FA 3I55S 5GAGU 1QUPA 2IIHA 3RTVA 1HNVA 1X9SA 2C3MA 1M0SA 3T1HF 1YBUA 3MM9B 5D0HA 2QA4G 4DV6J 3TX8A 3BDPA 5AJ3F 2DTJA 2XTJP 4NA3A 2MSTA 3TUIC 4K4ZA 2MHNA 2DRBA 2EFGA 2JRSA 6FD1A 3KLFB 4LR7A 2J6UA 5BR8F 1GT8A 1PBAA 2NCKL 1GFWB 3M1VA 3H25A 3ZTRA 1RWOB 4H4MB 1SL0A 3PW0A 3QRRA 3S01A 5L1KA 3EGVA 4YFUA 3DHWC 1EKRA 4DSKA 1IR2A 1HQEB 4I6YA 2RILA 3H40A 2CQCA 1S1WB 3KLIB 4EI2A 3CPWR 1SQEA 5C2GA 2XO7A 3C14A 1DLOA 4DV2F 1N56A 2XBPA 2B0GA 2HPUA 1IR0A 2HHVA 4QIFA 1TK0A 4CLYA 2AD9A 4B9UA 4CTAA 3BR9A 3FEYB 3BF4A 1ZM3A 2QTWA 3BKFA 5L39A 4F04B 3JTPA 3KFWX 3AA9A 2BANB 1R8PA 2DNHA 2B9XA 3E01B 1N5YA 2ILYA 3VVUA 4YB7A 2LQ5A 3TAPA 1FEHA 1MROA 3P5TL 1WEYA 2FHJA 2HFVA 1RHJB 3PO5A 3TZWA 1RHKB 1U2RA 1TAUA 1F2HA 4B17A 3PY8A 4W90B 1QSSA 2H9ZA 3AB4B 3HDSA 2VG7B 4DV3F 4PKDB 3VZHA 1NJWA 2VG6B 2KL8A 3ZC4A 3O3LA 2F4VF 3DLEA 4PWDA 2H5EA 3MEDA 1Y00A 4DV7J 4WKYA 3TP2A 3DU5A 1T3OA 2E9RX 5IWAF 3DNCA 5HLFB 1RWKB 1RTHB 1ZTTA 2IA6A 1KRPA 1UW4A 2V6AA 4C0OC 4LRAA 2X1BA 3TJ8A 2I1RA 5AXKA 3QIDA 4DL4A 3CCLS 2YY3A 5EX3A 2XWXA 3PHTA 1YJRA 2JWNA 2VPZB 5EHHA 1GTEA 3H2VE 3L7OA 2BOPA 2GJ2A 1TKTA 1RB0A 1HR0J 1H3DA 1R8HA 2YKQA 2Y0SD 2ZKTA 2FVPA 1A6LA 1C1CA 1B64A 4DPXA 3EVOA 2HK3A 2LCWA 1U45A 2Z0GA 1Z2ZA 2LLZA 4YN3B 2BOAA 1XN9A 4OMFG 4GRSA 3N4WA 4CDIA 4C6AA 3DRRA 1B0PA 5C7PA 1PBUA 2E1AA 5GADU 1XNQJ 2ZITA 2E1PA 4Q2MA 2OPSB 3MECA 5H1SV 1CEZA 2MKHA 4UOHA 3UVJB 3M2VB 2MHEA 3H0PA 4U7UK 2Z4PA 2CQ0A 5IV4A 2F8MA 4MYUA 4NMXA 3PRBA 3M8QB 2MZRA 2DNNA 1JJ2R 4YR0A 3PW7A 2BE2A 1RACB 4M5DB 4DI6A 3KUEA 4DPTA 3IBFB 1ZAXA 4EZ6A 1YJWS 2HNZA 4NE9C 3CB4A 5DDPC 1TKZB 5LMNJ 1Q8LA 1GXTA 1M1KT 4KC5A 3KLHA 5K20B 3QRQA 3CO0P 3W8GA 3UDVA 2BDPA 1U1LA 2YKMA 4H4OA 2XS5A 3WIUA 5H9FK 2X3DA 2HWTA 5IWAJ 4AL7A 2RVJA 3MM8B 1XK8A 1OYDA 3TA2A 3TAQA 3TZXA 4B3TJ 2W2PP 2PA8D 3FGVA 4GKJF 1RT7B 2BM1A 4KO0B 2DISA 3W2VB 4NZ6A 4LF1A 2KFZA 3Q2SC 4M5LA 4RNFA 2MYFA 1EQMA 4WYLA 4NZ0A 1FD2A 4FF4A 3HKWA 1X60A 2F8HA 3LAKA 4C98A 1KKHA 5J1NA 1FNXH 4O3QA 1R0BG 5B0DA 3J80Y 4NRUA 4HI2A 4DCOB 4JV1A 1SKUB 3GIIA 3CDWA 2DXFA 3NGRA 2G0IA 1G1XA 3KLFA 1ZS6A 3TARA 4TN2A 1SC6A 1FXDA 3IRXB 1GTHA 4FP9A 2MTLA 4PQUB 5I42B 4QYZK 2VODA 3HVAA 1S10A 1BQXA 1D9FA 4RJVA 4RUCA 4L3KA 2H65B 5KG2A 1HQEA 3GB0A 4U8YA 4AUKA 3EE3A 1FE0A 2UVWA 3O8WA 5LM7E 1U1MA 4DQQA 2J7UA 3ZZOA 3T1YJ 2YWHA 3RRKA 3HM9A 3I0SB 2ZH2A 3SI8A 3C15A 1R7IA 4A8XA 3NEKA 4MH8A 1LKZA 2XMKA 3GYXB 3RB0A 2M8DB 1GMWD 1N54B 2BANA 3DI6B 1H38A 4ELVA 2IY5B 4USHA 3E01A 1GMVA 3D3BJ 3RBXA 2AZ1A 3T41A 4DSIA 4ZJQA 3U1LA 4FYDA 1PAUB 4DF4A 4ECVA 1UJ5A 4J7CA 3SCKE 3BGOP 1S59A 4LBIA 3FBCA 4USKA 2MDAA 1UP1A 4WZMA 4KTQA 4DXLA 2NXEA 1YTYA 3PFOA 2VG7A 4UY85 2Y8WA 2P6TA 4HHJA 2CQPA 3SV3A 5LXYA 1HMVB 5LMUF 5ETPA 1FJCA 4J9UE 1YIJS 2Y8YA 2FJEB 3SBMA 1UFKA 1GMWA 2ZM6F 3NXZA 1TK8A 3KOAA 2V50A 2ZH6A 3CCWA 1NHUA 4F67A 5HLFA 2FJBB 3BBBA 2GX8A 3EVWA 4Z2XA 2E5LF 3OFGA 1HNXJ 2ZJQQ 5DO2A 1OY6A 5G4DA 3NS5A 3AOBA 4I2QB 1PSDA 1NK7A 2WSCC 4N77A 4U7CA 2A2DA 4M5IA 2DHSA 3BDEA 2ZVSA 4NCGB 1FRMA 4UF4A 2HHQA 2RUGA 2B4VA 3QFWA 5I3QA 1VQLS 3QPIA 5ETQA 2ZDOA 3C19A 1S7HA 2R7WA 2MZ1A 1GXLA 3UFCX 5J2NB 1OY8A 1QTMA 1CG2A 3W9JA 3ISZA 2OPSA 2VFSA 3UVJA 3CCES 3M2VA 2DH9A 4OZ3A 3K5NA 1AUDA 4RW9B 3IS9A 4PXCA 4B9MA 2BABA 3M8QA 3DC2A 2DHAA 1VRQC 3DRPB 3KG0A 4M5DA 2QA2A 4A8QA 3H2LA 4E98A 2JDJA 3S1TA 1RTJA 3LH2S 3MFHA 1HI0P 3QAUA 4LQ3A 3EJMA 3QFHA 3IAM9 2YPZA 2Z56B 3KK1B 2YKNB 3IR5B 1WC6A 3Q8PB 4HEA9 3SEOA 2CZ9A 3R5CA 1T05A 3KMQA 3LO3A 4ZITA 5HSPA 2JLFA 3PW2A 2J9DE 5KFDA 2FZCB 1R8BA 2ACMA 1UPPA 3H5XA 1RAAB 2R2TA 1J2VA 3C8YA 1YRUA 2XHCA 5BXIA 4ID8A 4ZPVR 2E5LJ 1RTZA 3GCXP 3W2VA 3W5XA 2FHOB 3CDUA 3N5FA 2YH1A 1EX8A 4DEZA 1X4DA 1T0TV 2XLIA 4M94A 4JI2F 3L4BC 1JJCB 2M2BA 1S1UA 1G6BA 4ZP9A 4L74A 2IJRA 1N5SA 3N9UC 2WTFA 2R7SA 5KFWA 2FGOA 3R7SB 1CQNA 4C7QA 2OHDA 3VGUA 3KDOA 2NZCA 4M5GA 4PQUA 2D3OR 4PUOB 1VK3A 2PN6A 4DL5A 2ZHAA 4K59A 5HMYA 2HYIB 3VQSA 3MI7X 5LJ3Y 2GIRA 2DNMA 2K3IA 3JAMU 4ES2A 2I0XA 4JI3J 1HLWA 1FFWB 3W66A 3CMAS 4JYAF 5IFMA 1B3TA 4JI5F 2ATLA 4M5HA 3Q2TC 2LXFA 2DR8A 1HNZF 2WHOA 5DLFA 1S7IA 2QLFB 5FLXU 3ZZTA 5KFQA 2BRKA 1UZDA 3I0SA 1HWKA 4IKAA 4ZS6A 2BXJA 2VIHA 3ZXWA 4K50A 3CD0A 1UEVA 4Y2KA 3FSYA 4RBVA 3T5LA 4O4GA 1WG5A 4OI4A 2W8KA 1LK5A 3DI6A 4LF5J 2D3UA 2D9OA 3OVSA 1CJTB 4OYMA 1Y5NB 5C25A 4GMKA 1U25A 1VISA 3NGUA 2LVWA 2V2QA 3VAHA 4ETXA 3KWMA 2PSZA 2HHWA 3TWZA 4DR5J 1SVDA 5GAGI 3CIMA 1Q7LB 4HKQA 2CPYA 3G86A 2HRUA 3MMBB 1JX4A 1Y3KA 5A2QU 1MWZA 3FBFA 4JI2J 1XQIA 2Y1JA 2DH8A 3AQOA 2J9DA 3N6NA 2PGCA 1FKPA 3OFHA 4JV0A 4LBPA 3I4HX 4OHWA 1NXIA 2OSRA 3OPKA 3HSZA 4J37A 4NASA 5AT1B 1VLYA 2HZAA 1S6PB 2KM8C 3GFXA 3I5CA 2NLWA 2MQNA 3C66A 3RB6A 2IC3B 1R6YA 3BGLA 1WACA 2R7OA 3FVYA 5G0RB 1X9WA 3DOLB 2ZNYA 2XGQA 2KXNB 4F4AA 4K4TA 2UUAF 2Q43A 3ZNJ1 2BQ3A 1LWCB 3PYFA 2VU5A 4WP9A 4O3RA 4ZK7M 4F4XA 3CULA 1EJ7L 4DL6A 1LNQA 4NCGA 3ADAC 4G65A 3R2DJ 1QAJA 3Q89A 1HWUA 3LF0A 2G2ZA 3OV7A 2VJUA 4OZ5A 2AGOA 1N5VA 1N52B 1FWKA 3AAWB 4QYRA 4NLUA 5CZVA 2V8DA 4KGXB 1BUXA 2VFTA 1C0TB 4RWXA 1JLFB 1X4FA 1N33J 1RQ0A 3I87A 3QO9B 5J2NA 2H51B 2K8GA 1QLNA 3ILJA 3EPIA 1OQ6A 4K4VA 5DG9A 3U02A 3KLGB 2CNNB 4P75A 2GIFA 5ETSA 2HWIA 4LF9F 4RW9A 1NSQA 1Y5IB 1ZZFA 4MTPA 1RI7A 3K59A 3O5TB 1JLEA 3HF5A 3I0RB 3U27A 7FD1A 4TYAA 3DRPA 2C3UA 3OSPA 3TAMA 2VPXB 3HVRA 1RT6A 3IMQJ 4J5OA 1AFJA 4A8WA 3D5MA 5KFYA 5DS7A 1CBKA 3KK1A 4X65J 2YKNA 2RQCA 1I5OB 3OLAA 4MK9A 1WC0A 2JLGA 2UXBF 4ELTA 2BUNA 1K1SA 4N8OA 2APOA 3MOZA 1F5AA 4HVZA 5LSOA 1GX6A 4FBTA 1RCXB 1FRHA 3NNAA 4FYWB 5C42B 3K5LA 3DM2B 2YH0A 4MKBA 4HLBA 3EDQB 2CQ1A 1VRTA 4EBDA 2HFOA 4UY8T 1RYSA 2V68A 2ZBRA 3ISND 1HWIA 3LANA 4LT6A 1YJNS 1KQSR 1QVGR 2MKSA 2WZ1A 1S1TB 2CPEA 4CYUB 4DMZA 2HVHA 3CE8A 3LGHA 3KUGA 2X1GA 3CD5A 3TQEA 4DUTA 3MR2A 2IM1A 3I82A 2OP5A 3CJ3A 2FVCA 4JV5F 3U1NA 1B7FA 2UUTA 2QRRA 3LGNA 1SIWB 4IUFA 2C2EA 4IOAQ 2A10A 1H0HB 1KC8T 2OEKA 1WKKA 2VOOA 4G1QB 4DPUA 1O0PA 2D1CA 1O8BA 3TQ1A 2X51A 1IXKA 2VG5A 3HJVA 2XMTA 3DRXA 2CKWA 4GVBB 5F41A 3G8SA 5HJXA 1KVIA 1R3NA 2V34A 1EB0A 1NMEB 3IGVA 4XAKA 3VCDA 5KFIA 5GMEA 3I9V9 5KFRA 2IBOA 1P9YA 4CT8A 5B0CA 2BKPA 3K7RA 4C8LA 2WW8A 2N4DA 5J1EB 1X0FA 1YGYA 2E1MC 2A2CA 1S57A 1JLAB 2EFNA 4Y00A 3W3SA 1FVQA 2J76E 2L48A 3TX0A 4KKOB 3EXCX 2GQQA 2XZTB 4DV0F 2ZH8A 1SIZA 2B5JB 3GILA 5EWFA 3EICA 5A6PA 5A0YB 1XERA 2BE9B 1I51B 4IG0B 4F4ZA 4A4JA 4J90A 5F8IA 3PEHA 4X2BA 5KOXA 1NDPA 2DITA 2B9YA 4X62F 2NR0A 1DBDA 4LVNP 5CYMB 1WI8A 2GIQA 1SJFA 2DVIA 4LRFA 4WP8A 1TL1B 3EUNA 3MMBA 2CRLA 1WHVA 4V1Ak 5IQ6A 4AXIA 2LU2A 3HULA 4OYPA 2GMHA 4QPTA 3Q22A 3OUYB 1WELA 2OPRA 5F9NA 4IFVA 4HDGA 2ZBQA 4JV5J 1P27B 2XYGB 4ANCA 2XY7A 1R8CA 2IC3A 4LF7J 3BH7B 5G0RA 3D0GE 2GHVC 3DOLA 1Q5YA 3CCMS 4LRCA 1L5UA 3UCZP 2CWXA 5CXTA 1LWCA 1RSCA 2K2PA 1DTQB 2A6OA 5DRKA 3TEGA 2GGPB 3P6YC 2W2MP 2G4BA 3G9CA 2GNKA 4K0KF 2ZC3A 1H98A 4DF8A 1HHQA 3PYEA 2QYGA 1Q95G 1C0TA 5KG5A 5B08A 5F3ZA 3FNNA 4CLTA 2EBGA 2FJDB 4AL5A 2ZUAA 5HQMA 1KTVA 3TA0A 4UZBA 4X4RA 2YKOA 4DV0J 4ZCKA 3KHRA 5KFUA 4F2SA 2NSCA 3R3TA 4NXNF 3T19A 3VF0B 1TL3A 3I0RA 4KB7A 4X4PA 5ETMA 2QT7A 4ZPTR 3SSQA 1HPZB 3CT9A 1BQNB 5A8WB 1L3VA 2HHXA 2FYXA 4KPCA 4YY3J 2VH7A 4AD6A 1H72C 3KDNA 1TK5A 3MEGA 1JLQB 4O3SA 4HL9A 3DHXA 4NLVA 4C9DA 1FHTA 3B4MA 2IM3A 3F44A 3FZBA 4O3OA 1H73A 5KFCA 3OL9A 1UEUA 1ZA2B 1HBUB 3BPDA 1CJVB 4ES1A 2HMIA 1L3UA 1FJ7A 4EGLA 2N82B 1GNKA 3GFZA 3MMCB 5JUMA 1K9MT 2BW7A 1NU4A 2RRNA 3LP0B 3G2XA 2DGTA 3H5YA 2PA3A 3OR1B 2Y9HA 3JB9k 3H4BA 2L9NA 2JVOA 4RW4B 1PJ6A 4NLSA 1FDBA 2QG9B 3GV5B 3QT8A 3OXFA 4H4KC 1VI7A 4LRDA 4CWBA 3K5OA 1S1TA 3IWXA 2HHPA 4UTGA 4X4OA 2LA4A 3BZQA 1VQ6S 3GIKA 1VQ9S 2HQ3A 1JLGB 4DUYF 4DL7A 2EKNA 3MUVP 2A0FB 4O44B 2IRYA 4ILRA 1YRXA 5IXUA 2JH3A 2RF2B 3NOGA 3PW5A 1YJ7A 3JQKA 4NEYA 2FDNA 4CI0B 5GAHI 4G1QA 1WI6A 5J2PB 4TY9A 3CDEA 4M5KA 1SQFA 2R2RA 1HQUB 1VBKA 2IBKA 1PC5A 4OIXA 4GVBA 3T6JA 2FD2A 2RMLA 2B56A 2DCLA 4F4WA 3ZZYA 5E5NA 2ZHBA 1RYRA 1SI9A 3BS9A 4ZVEA 2XMWA 2PMHA 1V6HA 4CLWA 1S1VB 2QLXA 2XMVA 3Q83A 4I6AA 1M1HA 3EXYA 2AYBA 1TL7B 4DR1F 1O5JA 1YZ6A 2QL7B 4DL2A 3O2IA 3RBDA 3VAIA 2NREA 1XBWA 5L1JA 1QTNB 2OPQB 3IA0A 1JKHA 4CO3A 2G0CA 4RLEA 5L1IA 2XNQA 1MMDA 1CPZA 2DXDA 4XPCA 4QR2A 4WKRA 2AIRB 4L3NA 4DWIA 1IWAA 2B5JA 3O1LA 2HHSA 4Q8FA 2XI3A 5A0YA 2DXEA 4JI1J 3KJVA 1TQLA 4IG0A 1SH3A 4DSJA 2GVDB 4ECUA 3J7YU 4IG3A 4IDKA 3HP6A 5CYMA 5LSLA 3H2UB 2V9WA 3CCRS 1TL1A 3MMAB 1ITPA 4FXWA 2VBWA 3HFZB 1NKCA 2PEHA 3OUYA 1TZ0A 2KRRA 5A6WA 4BDPA 4DU8A 5IZHA 2WVDA 1RBLA 4Q7AA 1JK9B 5E3AA 5KFVA 1LXNA 4AXJA 5ETNA 2CJAA 5KFXA 4R0JA 3N6MA 3EWGA 1K47A 1RT4B 3G6YA 2MY7A 2C2RA 2ZZTA 3A12A 3DFEA 4DPWA 1PYTA 2FHKA 3JQJA 1DTQA 1RWVB 1GQEA 2ABYA 4OX9J 1OO0B 2DGSA 1RA7A 2GGPA 2W4CA 2ROEA 2IYGA 2VOPA 3OHBA 1Q0NA 1YLXA 3RAMA 1FI4A 3OTEA 4B3MJ 2ZZNA 2XMAA 2UU9F 1V9OA 4J9OA 4AQYF 2B7CB 4DUZJ 2QMWA 2HHHJ 1SL2A 4RW7A 5IV3A 3HX9A 4KRWA 1C1BB 3UCUP 4QU7A 1JLBB 4OLOA 3AT1B 2XCAA 5JVGQ 3SMZA 1TFWA 2HHTA 3TANA 5F8MA 1KHWA 1I1GA 5E0OA 4IFYB 3K2YA 1M1GA 2JHEA 2CG8A 1VQNS 2RSQA 1FXRA 3W9IA 1XMOF 4LMZA 3NWRA 4FDFA 4F4KA 1V5VA 3TEHB 2F1FA 2Y3YA 4ED1A 1BE4A 4P7TA 4I2PB 4WTYA 5DQHA 2HVIA 3DLJA 2CYYA 4ZPDA 3FCWA 1HPZA 1LWFB 1TUWA 2OFGX 5KT3A 1IQZA 2AU0A 4OZ2A 4QQBA 2G9OA 2XY5A 1SKWA 3PIOQ 3DMJB 3HZEA 1JLQA 2YTCA 3I4PA 1F2GA 2BKOA 2GAHC 1VC5A 4URSA 5MAOA 4WFYA 3TZZA 4JI0F 1F0XA 1UZHA 5FLXY 2H5JB 1VC6A 1B0VA 2RKIA 4MIAA 4TU7A 1SC3B 4BLGA 2N7CA 1CJVA 3CD6S 1XEZA 4HTIA 2DIUA 5CHCB 3OR1A 4S0MA 3H20A 4TQRA 2Z2LA 3ZFVA 4RW4A 1D1UA 1IVZA 2FJWA 1PJ5A 4DN9A 3D28A 4I69A 1FJGF 2JC0A 3BSNA 1U26A 2MQOA 4BS2A 2IA0A 3NS7B 2F7VA 4YQWA 4B9LA 5EX0A 2OD4A 1JLGA 3HSGA 3RRHA 4URGA 3NCPA 3W7BA 4K2JA 4UOFA 3WC2A 3Q23A 4ZLNA 4O44A 3FBEA 1YBTA 3QBCA 1Z2LA 3DLKA 3VQTA 1U49A 1BQMB 3NGTA 3T5KA 2UXCJ 1FTRA 4ZKAA 2DH7A 4KV8A 1BGXT 1RGVA 4OFZA 2VA3A 5J2PA 2F5GA 4ECXA 2B3TB 4RL1A 2L9DA 1MWYA 5LXRA 1GAOA 2XMJA 2P6SA 3CIZA 2KT5A 2DO4A 1XMOJ 1Q7YT 1FA0A 2AJQA 3B78A 1EARA 1KDNA 2DNYA 4KFBB 5K8OA 2B8QA 2D69A 3VZIA 3PV8A 2R8KA 1QDUB 2GCFA 3BYPA 1S1VA 4RNMA 1TL7A 1V5IB 2WVEA 8ATCB 3QYYA 3RR8A 1S6QA 3CJKB 2OPQA 3GR0A 1VC0A 2D7SA 1EAYC 2XSJB 2FJXA 3W64A 1KOOA 2PIIA 4CQ1A 2V4JB 1D0EA 1AFIA 4I67A 2AJ4A 3HMJG 1NK5A 4QPXA 3TO8A 2GQCA 1J27A 4ERDA 2VF3A 2MKKA 4AFFA 4QWAA 1X4CA 2LQBA 1RU1A 2MJNA 3R1HA 2GVDA 3M8RA 2RU9A 2AQ4A 3GLJA 4U67Q 2CJYB 1X5SA 2RQ4A 2XY6A 2ERRA 1ZTWA 2HWHA 1KONA 1WKJA 1CULA 1H7XA 2CZVC 1GMUA 5F8HA 4B3OB 1CSJA 1K0TA 2KT2A 2EG1A 2RDIA 4V19X 4JI8J 3SFGA 3PDNA 2JC1A 3GTYX 4DR2F 3TVYA 1SC1B 1TV6A 1VDHA 3MPDA 2VFUA 5H9EJ 2IHR1 5KT2A 2HRTA 5GAEI 4DFKA 3MCMA 1N34J 5I3UB 3SFUA 3MD1A 1RLCL 1T9WA 2ZWPA 2BJ8A 1LWEB 3JS9A 2P8IA 2GMLA 4DS5A 1FDNA 2YQ3A 2PE8A 2U1AA 4NZ7A 1OMSA 1HNIB 2YNGA 2PEBA 4LFCJ 4DV5F 1X4EA 1M5KC 3POTB 4HHHA 3NL0A 2ALYB 4FNHA 3WX8A 3OT9A 4F0KA 2V2KA 1N88A 2OELA 2BRLA 4ED6A 3EX7B 2DEIA 5DM6Q 4JV2A 1UTAA 4DSLA 3NGSA 2NXNA 5U47A 4KHMA 4M8LA 2VHGA 3NBPB 1S5ZA 1Q79A 4DJBA 1U7LA 4DR7J 4C3KA 1VJWA 4MIWA 1FKAF 5CQGA 1R27B 4WWSA 3MAAB 4JP8A 2QE5A 3GZ7A 4ZJOA 5HQLA 2FZKB 3M8ZA 1LWFA 4EWTA 2VPYB 4DR3J 2AZ3A 5A8KB 2ASJA 1UFWA 4Q0BB 2KKHA 2B4OA 2YBVA 3Q24A 4ED7A 1ZETA 3QLHB 3DMJA 4NYOA 3HFKA 3I31A 3IM8A 8RUCA 3MZIA 3OL7A 4YEAA 2RS2A 3LP1B 3DYAB 4WPAA 2E5HA 2HNDB 3CTRA 5FIIA 3FRZA 4JI6J 1VLOA 1HL6A 4A8KA 4UOGA 3R5JB 5HROA 3MGJA 3N01A 4X66F 4OYXA 1NSPA
chains in the Genus database with same CATH topology
3Q8VA 3ENAA 1HIYA 4DUTA 1KDNA 1MN9A 4FKXA 4F4AA 4C6AA 3Q86A 1WKJA 3EVMA 2BEFA 1XIQA 5C7PA 3L7UA 2DYAA 3ELHA 3DKDA 3BH6B 3ETMA 3NGSA 3BBCA 3VGSA 3EICA 1BHNA 3BBBA 2VU5A 2B8QA 1B4SA 2HVEA 1S5ZA 1NDCA 3B54A 3EVWA 2HURA 1NLKL 4UOHA 1PAEX 1WKKA 2BX6A 1NDPA 4S0MA 1U8WA 3GP9A 3Q8UA 1HHQA 1LEOA 1NUEA 3FC9A 1F6TA 3VGUA 4WBFA 4ANEA 3NGUA 3FKBA 3Q89A 4W98A 3EJMA 4FKYA 3ZTQA 3MPDA 3Q8YA 2CWKA 1LWXA 3G2XA 1EHWA 3B6BA 2AZ3A 4DI6A 1NCLA 3Q83A 1K44A 2AZ1A 2DXFA 3ZTOA 3NGRA 1NDLA 1BE4A 2ZUAA 1BUXA 3VGVA 2DY9A 1ZS6A 3FBBA 4CP5A 4UOFA 4EK2A 3FCWA 3DDIA 3PJ9A 3ZTSA 3JS9A 3VVTA 4ANDA 1F3FA 3FBFA 4ENOA 1S59A 1XQIA 3FBEA 4F36A 3GPAA 5IOLA 3BBFA 1B99A 1HLWA 3FBCA 4HR2A 2B8PA 4ANCA 3NGTA 1UCNA 1NSKL 1PKUA 1JXVA 1W7WA 1NDKA 3VVUA 1NB2A 3BH7B 2DXDA 5BXIA 3VGTA 3EM1A 4DZ6A 2NCKL 3WX8A 4UOGA 3PRVA 3R9LA 1NHKL 1NSQA 3ZTRA 3EMTA 1NPKA 1S57A 3EVOA 4KPCA 4O0NA 1WKLA 3FCVA 1VYAA 2HVDA 3EE3A 2DXEA 5CAAA 5CABA 1NSPA 3ZTPA 1MN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8V A;  3ENA A;  1HIY A;  4DUT A;  1KDN A;  1MN9 A;  4FKX A;  4F4A A;  4C6A A;  3Q86 A;  1WKJ A;  3EVM A;  2BEF A;  1XIQ A;  5C7P A;  3L7U A;  2DYA A;  3ELH A;  3DKD A;  3BH6 B;  3ETM A;  3NGS A;  3BBC A;  3VGS A;  3EIC A;  1BHN A;  3BBB A;  2VU5 A;  2B8Q A;  1B4S A;  2HVE A;  1S5Z A;  1NDC A;  3B54 A;  3EVW A;  2HUR A;  1NLK L;  4UOH A;  1PAE X;  1WKK A;  2BX6 A;  1NDP A;  4S0M A;  1U8W A;  3GP9 A;  3Q8U A;  1HHQ A;  1LEO A;  1NUE A;  3FC9 A;  1F6T A;  3VGU A;  4WBF A;  4ANE A;  3NGU A;  3FKB A;  3Q89 A;  4W98 A;  3EJM A;  4FKY A;  3ZTQ A;  3MPD A;  3Q8Y A;  2CWK A;  1LWX A;  3G2X A;  1EHW A;  3B6B A;  2AZ3 A;  4DI6 A;  1NCL A;  3Q83 A;  1K44 A;  2AZ1 A;  2DXF A;  3ZTO A;  3NGR A;  1NDL A;  1BE4 A;  2ZUA A;  1BUX A;  3VGV A;  2DY9 A;  1ZS6 A;  3FBB A;  4CP5 A;  4UOF A;  4EK2 A;  3FCW A;  3DDI A;  3PJ9 A;  3ZTS A;  3JS9 A;  3VVT A;  4AND A;  1F3F A;  3FBF A;  4ENO A;  1S59 A;  1XQI A;  3FBE A;  4F36 A;  3GPA A;  5IOL A;  3BBF A;  1B99 A;  1HLW A;  3FBC A;  4HR2 A;  2B8P A;  4ANC A;  3NGT A;  1UCN A;  1NSK L;  1PKU A;  1JXV A;  1W7W A;  1NDK A;  3VVU A;  1NB2 A;  3BH7 B;  2DXD A;  5BXI A;  3VGT A;  3EM1 A;  4DZ6 A;  2NCK L;  3WX8 A;  4UOG A;  3PRV A;  3R9L A;  1NHK L;  1NSQ A;  3ZTR A;  3EMT A;  1NPK A;  1S57 A;  3EVO A;  4KPC A;  4O0N A;  1WKL A;  3FCV A;  1VYA A;  2HVD A;  3EE3 A;  2DXE A;  5CAA A;  5CAB A;  1NSP A;  3ZTP A;  1MN7 A; 
#chains in the Genus database with same CATH topology
 3M8Y A;  4DPO A;  3OTO J;  2N3O A;  2QLB B;  4OJ1 A;  3BH6 B;  3R27 A;  1IQT A;  2AYG A;  1A7G E;  2VD3 A;  2N4C A;  4P73 A;  4RW6 B;  2CQG A;  2RUS A;  2OH2 A;  5DGB A;  2HQC A;  4C8K A;  3OQ2 A;  4X4T A;  1T95 A;  1QSY A;  2G2Y A;  2J0W A;  3BR8 A;  1EHW A;  1FDA A;  1HNV B;  1LQ9 A;  4XDD A;  1BQM A;  5E33 A;  1UVI A;  1WDD A;  1AB8 A;  4UUW A;  1NND A;  2G0J A;  2JEG A;  1TMJ A;  2VDI A;  4J9K A;  3K5P A;  2HBQ B;  2KHC A;  1X7V A;  4FVM A;  2M8H A;  2KZZ A;  2KO1 A;  5KFA A;  1NHK L;  2EBE A;  2G2O A;  4KFB A;  3KJF B;  4Q45 A;  4MFB B;  1WKL A;  4QWD A;  2V8G A;  1P1T A;  3JSM B;  3Q8V A;  1RT1 A;  2FVR A;  3NS6 A;  3ZNU A;  3PYG A;  3UN5 A;  3CJK A;  2V9K A;  3PYD A;  1DLO B;  4CLZ A;  1NB7 A;  3B4D A;  4ZVF A;  6FDR A;  2XSJ A;  1AW0 A;  2CAJ A;  5L8R C;  4ID5 B;  2ZE2 B;  3H8Y A;  4F0H A;  3NY0 A;  2QMX A;  3M7V A;  2HQG A;  4TVA B;  1JB0 C;  2KJV A;  3VWS A;  1LWX A;  4U7U D;  3CC4 S;  4CTA B;  1VHI A;  4CLK A;  1WNE A;  3NNH A;  4DSE A;  3FSX A;  3D68 A;  4KR0 B;  5FD1 A;  3IWL A;  3GIR A;  3GPA A;  3R6L B;  3EZU A;  4GVL A;  1R0C B;  2M88 A;  5DDO C;  1MRO B;  4EEY A;  3C16 B;  1KWM A;  4O3P A;  5AXN A;  4C97 A;  1TEL A;  2WVF A;  4B3O A;  2F63 A;  2BYC A;  5FJ4 A;  2QEX S;  5KTQ A;  1VQ5 S;  1RXO B;  2LEC A;  4OI3 A;  5C24 B;  2ZC4 A;  2BZ2 A;  4UQT A;  5A8R A;  3DLE B;  4PWD B;  2MPU A;  4DFM A;  1B4S A;  4ZCM A;  2EEY A;  4YHH F;  4J9R A;  7FDR A;  5I3U A;  2W9B A;  3KKF A;  3F0N A;  1F9F A;  2YX1 A;  2VKR A;  1LWE A;  2H1Y A;  2EVZ A;  4NML A;  3TJ9 A;  4L75 A;  1VR6 A;  4DR4 F;  1HNI A;  2V8H A;  3QWP A;  5DQG A;  1G7C B;  1KVJ A;  2ACY A;  3EZO A;  1FK9 A;  2R9L A;  1FF2 A;  1V3Z A;  2OI2 A;  4DQR A;  2FLP A;  4ZN1 A;  4Q44 A;  2XYP B;  4TLR A;  2Z2M A;  1S1X B;  1HNW F;  2BMB A;  4Z7C A;  1F9E B;  2QO3 A;  3CC2 S;  1HYS B;  4ECS A;  4PQA A;  1ICE B;  1XTZ A;  4M5N A;  2R2U A;  3OTB A;  3NBP A;  3MR6 A;  2FTR A;  2KXH A;  4J9V A;  3UD3 P;  2O67 A;  1IN0 A;  3DRR B;  2QYC A;  5LJ5 Y;  3BGR A;  2NQP A;  3MAA A;  3ELH A;  2QIF A;  3HD1 A;  4FF2 A;  2I9S A;  3WDO A;  1SPB P;  2J7W A;  1RT2 A;  3MEC B;  1U8S A;  4NLT A;  2YKA A;  2O3D A;  2MLZ A;  1BC6 A;  3HCX A;  2R7U A;  4RUB A;  3EGW B;  2HAF A;  1R0A B;  2HW3 A;  3QLH A;  3DN9 A;  2ZVI A;  4WXW A;  4UOC A;  4IRK A;  3PZP A;  1B7Y B;  2ZNZ A;  4RW8 B;  4NI2 B;  1T3N A;  3KNG A;  3LP1 A;  2QZ8 A;  2MZS A;  2GV1 A;  3HHK A;  3KUH A;  3AA8 A;  3JYT B;  1WUU A;  2E5J A;  3KLH B;  3KG4 A;  2QFJ A;  3DOK A;  3OBI A;  4TLQ A;  1IBM J;  1NKB A;  2CJK A;  3OTD A;  4P10 A;  5BYQ A;  2YKM B;  4H4O B;  5KFB A;  4AL6 A;  4FS2 A;  4U96 A;  1DRZ A;  3TR5 A;  4EU0 A;  3UWT A;  2UV8 A;  2M0G B;  3NWG A;  2DPJ A;  1NPK A;  2LQJ A;  3NCR A;  2G13 A;  2KB2 A;  2HQI A;  5T7L B;  3AHP A;  4WE1 B;  2DR7 A;  3J7A 1;  3MD3 A;  2WW4 A;  3SV4 A;  4DG1 A;  1QUV A;  2OPP B;  3B8H A;  1W25 A;  4Y3C A;  1XR6 A;  3JTO A;  1OS5 A;  2E1R A;  3H98 A;  4IH6 A;  2AHO B;  3BSC A;  5KFT A;  3CW2 C;  2VFR A;  3MMJ A;  3HPO A;  1S99 A;  3TVZ A;  3Q8U A;  3IP0 A;  1VHF A;  3R97 A;  4HT7 A;  4YOE A;  4LF4 J;  3GE9 A;  1VQK S;  1HNW J;  3V4I B;  3CVK A;  2MB0 B;  1NHV A;  3ILL A;  3BKU A;  2O01 C;  4DV7 F;  5DQI A;  4ZVS B;  2A3J A;  5HJY A;  3SDE B;  2EXU A;  2W7A A;  3HHL C;  2KH9 A;  1HBM A;  3PJ9 A;  1HHT P;  4QR0 A;  2X3G A;  2VJV A;  5KFP A;  1HW8 A;  1IM4 A;  4CH0 S;  3RRG A;  4MFB A;  3M32 B;  1T7P A;  2AJ0 A;  4YR2 A;  4Y0F A;  3JSM A;  4OI2 A;  4ED3 A;  3OFF A;  3RBE A;  1S9E B;  1OJ4 A;  2IDE A;  1S72 S;  2VZ9 A;  5KOW A;  1ZYQ A;  3OL8 A;  2FHJ D;  1HR0 F;  4P6Q A;  5D4L A;  4ED5 A;  4C8O A;  2ZUG A;  4MYT A;  2HLU A;  4DPY A;  2DHH A;  3ETM A;  4ID5 A;  2ZE2 A;  3IC1 A;  3D9B A;  5KT5 A;  4LFB J;  3C15 B;  2LFV A;  4U6P A;  1NBE B;  1XNQ F;  4ZN3 A;  1FRX A;  4C8M A;  2QA1 A;  5I3P A;  4LSL A;  4RPF A;  3C16 A;  8AT1 B;  4YB1 P;  4DLG A;  3GIM A;  5JJB A;  3HD2 A;  1VIX A;  1YVF A;  2CDQ A;  3D6M B;  4F36 A;  1ZAV A;  5B0E A;  3K58 A;  1XWL A;  4ZLL A;  4DX7 A;  2YX7 A;  3AH6 A;  4BWM A;  3KYL A;  1FEE A;  5LMN F;  3M30 A;  3PIP Q;  3MOJ B;  4LRB A;  3A8J A;  5C24 A;  3SCI E;  3CCJ S;  4CH1 A;  1RT5 B;  3FFI B;  3GYG A;  2CUY A;  2ASL A;  1C4C A;  2JFD A;  2LDY A;  3FDS A;  4B3T F;  1PO6 A;  1R8A A;  2NUU G;  4MIB A;  1X31 C;  1V3S A;  2AP6 A;  4C3M A;  2OO4 A;  1T9V A;  4DV4 F;  3A4T A;  1RAB B;  5HN0 A;  2FVQ A;  3BGU A;  5B0F A;  3ZTQ A;  3PR5 B;  1FRL A;  2NUH A;  4Y2C A;  1ARO P;  5DJB A;  1SQG A;  4A8S A;  2OMO A;  1S1X A;  5HMZ A;  2B43 A;  4DQP A;  1SXL A;  1XC9 A;  2HGL A;  4WK3 A;  4RR5 A;  4AND A;  1HYS A;  4KGZ B;  1NZ8 A;  2DGX A;  1RHM B;  2KN4 A;  1JNR B;  1NDK A;  3DU6 A;  1UKU A;  4IR1 A;  1TVR A;  1NK4 A;  1QM9 A;  2QSW A;  2VBY A;  3H5U A;  4ZLP A;  1BHN A;  3HXM A;  2LEB A;  1DUR A;  4O0I A;  3IS9 B;  3HLU A;  1R0A A;  1L3K A;  2Z2Y B;  2M4M A;  3N6L A;  5CD4 A;  1MNE A;  1LW0 B;  1YJ9 S;  3PO4 A;  3J7A N;  3LWM A;  5KFS A;  4DS4 A;  4F4Y A;  4RW8 A;  1BY9 A;  4NI2 A;  2RD5 C;  4C8N A;  1RTJ B;  1VQ8 S;  3FC9 A;  1L3T A;  3JYT A;  3T1Y F;  1BMQ B;  1WC4 A;  4ZA1 A;  1UFL A;  3Q8Y A;  1KLM A;  5CCM A;  1RHR B;  1NK6 A;  3J81 j;  1T05 B;  3PJW A;  2YWF A;  5J2Q B;  3QJJ A;  2L41 A;  3EGZ A;  4MAK A;  4Q2L A;  3BM7 A;  1FE4 A;  1YSJ A;  3M6X A;  3MM7 A;  2AJ1 A;  1T9Y A;  4HR2 A;  9RUB A;  5CH7 B;  2G1H A;  3MEE A;  4XIU A;  5T7L A;  1UAW A;  4WE1 A;  1RAI B;  1FD8 A;  5CA5 A;  2CPZ A;  2ZOG A;  2N7Y A;  2OPP A;  4DV4 J;  2EW9 A;  3UPF A;  3Q8Q B;  2J6T A;  4WFB Q;  4QWB A;  1T8E A;  2DGO A;  1S48 A;  3ONQ A;  1SJ4 P;  1RCO B;  1HIY A;  3H7H B;  2XG8 A;  2V69 A;  4HAC B;  4HTJ A;  1U2F A;  1S1U B;  1NJZ A;  5B7W A;  3AOD A;  1H2V Z;  3V4I A;  2GVZ B;  3PX4 A;  1BD6 A;  2R7X A;  5B0A A;  2QGF B;  3M05 A;  3V2U C;  1ZOT A;  3MCN A;  3SDE A;  1HBO B;  3MUR P;  2J0Q D;  1YJU A;  1HNX F;  3A8E A;  4ED0 A;  4L76 A;  3M32 A;  4X4Q A;  7AT1 B;  1UVK A;  4OYO A;  5KAK A;  4FPR A;  2CAD A;  3A3N B;  2XWY A;  2B4U A;  3KJQ B;  2CXE A;  1K73 T;  1S9E A;  5FDL B;  4FXD A;  2CPD A;  2PFF B;  1MMN A;  3AOA A;  3CC7 S;  1PKU A;  5K9F A;  2DR5 A;  3OR2 A;  2V2Z A;  1UVN A;  1UL3 A;  3GYN A;  1HFE L;  3TOQ A;  3LW5 C;  2MJU A;  2CJ9 A;  4ZDN A;  4ZVG A;  3TA1 A;  3BKT A;  1FX2 A;  2KYZ A;  3R5D A;  2MZJ A;  4ECT A;  1UWB B;  4OZL A;  4O4G B;  3GJQ B;  1KP6 A;  4DX6 A;  2XS7 A;  1Y4Z B;  2DNR A;  2KJW A;  2I5J B;  2DGQ A;  4CRJ A;  5C25 B;  4IOC Q;  2B6A B;  2DGU A;  2JOQ A;  1CS4 A;  2RHS B;  3FKB A;  5D4O A;  1HWJ A;  1M5H A;  3MPW A;  2IDL A;  2UUB F;  1RAJ A;  4O23 A;  1C0U B;  1N32 J;  1ZM9 A;  4LIR A;  1OSC A;  1WC3 A;  3GQC A;  4ZCL A;  1F5C A;  3KTQ A;  4EMD A;  4EK2 A;  1XJW B;  1RTD A;  2QLJ B;  1FKP B;  5IT4 A;  4CLF A;  1D09 B;  4ZVO B;  3AXM A;  1F9H A;  2B4P A;  1RT5 A;  3FFI A;  5D4N A;  3D2W A;  2HRY A;  1O6X A;  2D3O 1;  2PO4 A;  3DLH A;  2Z8Q A;  5ADZ A;  4TNO A;  4MK8 A;  5AXL A;  3H5S A;  2VUG A;  2W1B A;  1KNZ A;  2DRD A;  4JB8 B;  3QNW B;  2AJ2 A;  3IG1 B;  1EP4 A;  4ILM A;  1IJF B;  1S6O A;  3J81 Y;  2AEF A;  4F3Q A;  4YUD A;  3K8W A;  3OXL A;  2LYV A;  5B09 A;  1N0U A;  1WTB A;  2UUC J;  1LK7 A;  3R6G B;  4GKK F;  4H4K A;  4B08 A;  2PC6 A;  3QZ8 A;  2MLX A;  1Y9O A;  4PEO A;  4WBF A;  4LUB A;  2C3O A;  3UNG C;  3DRS B;  4J91 A;  1U24 A;  2QMU B;  2FLN A;  4NLQ A;  1WHX A;  3FEZ A;  4YS2 A;  4QIV A;  2ROG A;  4I6W A;  3ZZ0 A;  2MQM A;  5GAH U;  3ENQ A;  2UVR A;  1W7W A;  3W2W B;  5F8N A;  3BYR A;  4C0H A;  3M8W A;  1VQM S;  2ZOF A;  5AE1 A;  3G82 B;  4JI3 F;  2DO0 A;  4XTT A;  3Q8S B;  3IXQ A;  1UVL A;  3A13 A;  1Y10 A;  1LW0 A;  3W60 A;  1JLE B;  2L3M A;  1IBL J;  2GZO A;  1NH7 A;  1Z1Z A;  2UUB J;  2KYX A;  4AYB D;  3TAM B;  2JFK A;  3MPU B;  1RT6 B;  2YQ0 A;  3A3P B;  3GG0 A;  4JOU A;  3LQV A;  5IT9 Y;  2DPI A;  3MTJ A;  4OYA A;  4EYH B;  2WVC A;  3TVK A;  3AY0 A;  2WCX A;  1D9D A;  3B54 A;  1VBX A;  1R89 A;  3C6T B;  4X4U A;  4B9T A;  5J2Q A;  4A8M P;  4YR3 A;  5J2M B;  5HO4 A;  2CPI A;  2F9D A;  1YWX A;  2U2F A;  1GK8 A;  5KFM A;  4LF5 F;  1X5O A;  3C6U A;  4ZPC A;  1WOR A;  3QAE A;  2XZD B;  5IM0 A;  4B9N A;  3IGN A;  3V81 B;  1VRT B;  3GV7 B;  2ZH1 A;  3QAT A;  1RZM A;  3D6H B;  4DR5 F;  4JI4 J;  1SV5 A;  1TUG B;  4CIO A;  2KZM A;  3H59 A;  2V8P A;  4DV1 J;  1M5P C;  2OAU A;  4GKK J;  4HAC A;  2YPY A;  2LU1 A;  4LF6 F;  2CQ2 A;  1PGZ A;  2GVZ A;  4LBH A;  3JXO A;  2R8J A;  1YG0 A;  4A8Y A;  1VGY A;  2HHU A;  1NSA A;  2KG0 A;  2BQU A;  2ZH7 A;  2R3V A;  1HBO A;  1Q4R A;  3D3C J;  4DR6 J;  4XK8 C;  1HI1 A;  2QL5 B;  4P7V A;  2V4R A;  1XNR J;  2MKC A;  4F2R A;  5HI7 A;  2BVZ A;  1EET B;  2XO6 A;  4ECR A;  2KU7 A;  4CLL A;  1OQ3 A;  2VG5 B;  4NLR A;  4FZV A;  3IBW A;  4TKT A;  3OVB A;  4A47 A;  5FDL A;  2R42 A;  2ADB A;  1DAX A;  1RWM B;  3BN7 A;  3QWU A;  3EDR B;  4X64 F;  2ALZ A;  1M90 T;  3AFG A;  3CWJ A;  2W2Q P;  1FNM A;  1VQP S;  2W9C B;  3QIP B;  1WC5 A;  4K5R A;  4DHV A;  5B0G A;  1UPM B;  1NK9 A;  2DHX A;  1N48 A;  4ZIV A;  2J5A A;  2OTL S;  1N33 F;  1VFJ A;  2WON A;  4PZV A;  4ATN A;  4UQG A;  5L1L A;  1AXQ A;  5M2P A;  3FMB A;  1UWB A;  3VAJ A;  1J5E J;  4IRD A;  4NPO A;  1TR0 A;  4OX6 A;  3E8O A;  2AGP A;  1N5T A;  2RDD A;  3H4D A;  1T03 B;  2VQF J;  2I5J A;  2IMW P;  2B6A A;  1ROF A;  5KFJ A;  1RWU A;  4KJI A;  5DZ6 A;  3CNQ P;  2RQK A;  2HVE A;  1B70 B;  1C0U A;  2FJA B;  3NKY A;  1S97 A;  4YB5 A;  1SUQ B;  2FJV A;  1LOU A;  1FTC A;  1QAY A;  3HT3 A;  4ER8 A;  3PJX A;  3FMW A;  4TQS A;  2V4Q A;  4X65 F;  2LMI A;  4YDD B;  3L09 A;  4UST A;  4ZPW R;  3HI9 A;  4KQZ A;  4K5S A;  5B0B A;  4LF6 J;  2OPR B;  3R8Y A;  2GHW A;  3BQ2 A;  4IFV B;  3M8P B;  1WJ9 A;  3IO1 A;  3HVW A;  4OHV A;  4USJ C;  4IQM A;  4L72 B;  4OX8 A;  1S0V A;  1PC4 A;  2KI2 A;  2DGV A;  1IKY B;  4DSF A;  2CVE A;  1FT8 A;  3G4S S;  4R5P A;  2HFZ A;  2W9A A;  3IG1 A;  3QSI A;  4QIW D;  4DU7 A;  1EZZ B;  1JMT A;  4WIQ A;  3PCO B;  4FPI A;  3HZG A;  3MEK A;  5HBM A;  3LPE A;  2JEJ A;  4X64 J;  4I56 A;  2W4D A;  4BBY A;  3CCV S;  2W2N P;  4WXO A;  4OI6 A;  1VOM A;  1Q5V A;  3DRS A;  3CF5 Q;  1FRJ A;  3UNY A;  3RAX A;  3HHD A;  1KQK A;  4K7Q A;  5F8G A;  2HIQ A;  4FBU A;  4KE5 A;  2BQR A;  3IR7 B;  3K89 A;  4ZHR B;  3MWB A;  5HAT A;  1X4B A;  3KHG A;  4F8R A;  3SCL E;  4K4U A;  3DXS X;  4IR9 A;  2HAI A;  3I56 S;  2HK2 A;  1VBZ A;  1WSV A;  5D6G A;  2OGU A;  1NPP A;  3W2W A;  4CLU A;  4DDF A;  3UO0 A;  1KVK A;  2QX0 A;  3ENV A;  1ELO A;  4P2X A;  5T41 A;  4DCJ B;  3IN5 A;  1CJU A;  3G82 A;  1HHS A;  2XS2 A;  3UDE A;  4RBU A;  2EK6 A;  5KT4 A;  1TL3 B;  4FYY B;  4AE5 A;  2CQD A;  3BN4 A;  3E3X A;  3J7Z 5;  2C28 A;  3ICL A;  2EC2 A;  2RU3 A;  4F7V A;  3KLE A;  3QT5 A;  3OD2 A;  4LFA J;  3HSJ A;  4ZIW A;  1XMQ F;  3D1H A;  1E6V B;  2UVU A;  1TTH B;  2MSS A;  3MEG B;  5KG3 A;  1H6K X;  2AJF E;  1I94 J;  4CLS A;  4DL0 C;  1U6F A;  2FC9 A;  3C6T A;  3RJM B;  2PMZ D;  5J2M A;  3RB3 A;  4WU2 A;  4NL5 A;  4YME A;  2MQL A;  4DLE A;  2LDI A;  3QRP A;  1OSD A;  5M2R A;  2HMI B;  1Q16 B;  1RP5 A;  4M63 A;  2HLT A;  4NCA A;  2HS0 A;  2F40 A;  3V81 A;  3SCJ E;  1UET A;  2DJW A;  3ETO A;  1KFS A;  4RWW A;  5THW A;  2GW8 A;  1NZA A;  4LR9 A;  2ADC A;  3VGV A;  1N36 F;  4DX5 A;  2IRU A;  2RS8 A;  4C0B A;  5GMK a;  3PG9 A;  2HS3 A;  3MM6 A;  4G1I A;  2B8P A;  1NSK L;  1ZPV A;  3RW6 A;  1JXV A;  1S9G A;  3M8S A;  3THT A;  4ZMM A;  3VGT A;  3EM1 A;  2XLK A;  3N5B A;  4RO0 A;  1RWX B;  4LF7 F;  1Y7P A;  4WU3 A;  4TYB A;  4PPD A;  2MXY A;  1U1N A;  2YWG A;  3UR0 A;  2FB0 A;  4I4B A;  2GO8 A;  4A8F A;  1EET A;  1WWH A;  3MCS A;  4CM0 A;  2BEF A;  4NOH A;  4AT1 B;  2CJX B;  3DKD A;  5GAE U;  1WF1 A;  5C5J A;  2VIC A;  4W92 B;  3G8Q A;  2QA4 S;  1MU2 B;  2B7B B;  4E8U A;  4JI7 F;  4OYW A;  4FYV B;  2JEI A;  1JWW A;  3R5B A;  1VQY A;  3DGV A;  1Q86 T;  2BBE A;  1N0V C;  3QGI A;  2W9C A;  3QIP A;  3U7J A;  2DNP A;  1FWL A;  3T1H J;  1IKV A;  3M6W A;  4ILL A;  2HGM A;  1XMQ J;  1IR1 A;  4PWU A;  2FGC A;  5AJ3 J;  4MKA A;  3IAS 9;  2DT9 A;  2BAC A;  1YX2 A;  1JKH B;  4M5J A;  1LFP A;  4OI1 A;  5BR8 J;  1HD0 A;  1WD6 A;  2VQE F;  4MKV A;  2QJ3 A;  3QGH A;  3PKM A;  5IS2 A;  1JXE A;  3WQP A;  1SCJ B;  1T03 A;  1MSW D;  3SXL A;  4WZQ A;  1LFW A;  5E41 A;  1X4G A;  5KFN A;  3KJV B;  1H2T Z;  5H9E K;  4HI1 A;  4IG3 B;  4IDK B;  4NLW A;  1RKI A;  1SUQ A;  2XLJ A;  4YY3 F;  2GC8 A;  4DV2 J;  1RWP B;  2KVI A;  3MR3 A;  1N36 J;  1D8Y A;  1WEX A;  3C46 A;  1TU0 B;  5E3R A;  1C2P A;  3PAC A;  1UA1 A;  1RT3 B;  3PXG a;  1AYE A;  3M8P A;  3P96 A;  2MEW A;  2J9C A;  2OFH X;  4I64 A;  6AT1 B;  5D3G A;  1QAI A;  3US5 A;  1HQ2 A;  2Z2Z A;  4YP3 A;  2DNG A;  3M9M B;  4LR8 A;  3TUZ C;  3GU0 A;  1IKY A;  2VV5 A;  5HL7 Q;  1TAQ A;  1APS A;  3HK2 A;  2PI4 A;  3M9N B;  1QJH A;  4KY3 A;  2AX0 A;  1MW7 A;  4HH1 A;  3ZZZ A;  3BSO A;  1WF2 A;  3FQK A;  4JI7 J;  1VQ4 S;  4Y2A A;  4PYA A;  1F3V A;  4DV3 J;  4ZCI A;  2CPX A;  2OEJ A;  1Q81 T;  1NRK A;  5KG0 A;  4P72 A;  4ZVH A;  3NAH A;  2RH3 A;  2D41 A;  1S6U A;  4N5S A;  2F4V J;  5DZ7 A;  4RW7 B;  4R8U A;  4HH0 A;  3M2R B;  3N79 A;  1NK0 A;  2UUW A;  3FEX B;  5D4P A;  4ZHR A;  2UVV A;  1FNO A;  2E7W A;  1CVJ A;  1M5S A;  4TY8 B;  2A1B A;  2VFV A;  3V6K A;  5KFO A;  3TUP A;  4U8V A;  2AF6 A;  4PG7 A;  3T3F A;  2VQE J;  1IBC B;  4CH7 A;  5JVH Q;  1RHQ B;  3GJT B;  4G1P A;  3MR7 A;  2J0X A;  4LQ9 A;  4ZVR B;  2CG4 A;  2X1F A;  2CWK A;  4QBU A;  3L7P A;  3NRB A;  3HHL B;  1K8A T;  3DOM B;  2UP1 A;  4CP5 A;  3U1M A;  1LW2 B;  2ZOM A;  3MM9 A;  2E5I A;  1HBN B;  1E6V A;  4DFP A;  1IM6 A;  1DFD A;  2K3K A;  2XQC A;  3K8V A;  4Q43 A;  2EI5 A;  3F56 A;  1NK8 A;  2ASY A;  4QW9 A;  3ZZR A;  3Q8R B;  2GJF A;  3VAL A;  3TW0 A;  1M5V C;  3W65 A;  2XC9 A;  1SC4 B;  4H4M A;  2QFI A;  2RKI B;  3S7R A;  9ATC B;  2AW0 A;  2YWK A;  3P8B B;  1XIQ A;  2WRM A;  1OYE A;  2JZ5 A;  2NYH A;  4JI1 F;  4P2F A;  1BLU A;  1S1W A;  2W25 A;  3KLI A;  1QAX A;  2XZW A;  1H2U X;  2GS8 A;  5D0G A;  3CSK A;  1JJH A;  4K4W A;  3NMR A;  4OI0 A;  2XCP A;  4KH0 B;  2HFU A;  2XYH B;  2KFN A;  1HKA A;  2AYE A;  4DQI A;  1K1Q A;  4C8Y A;  1OY9 A;  3VAM A;  3PR4 A;  2BV3 A;  1L3S A;  3A8K A;  3X1L B;  2VC0 A;  3HHE A;  4ZVQ B;  1A9N B;  3HSD A;  1RWW B;  3NGK A;  3DLK B;  1RTI B;  3CDB A;  2IFX A;  1TUV A;  4K4S A;  4KSE B;  3NCQ A;  5HQ8 A;  4B9V A;  3D0I E;  1KD1 T;  4Z7Y A;  4KV8 B;  2W24 A;  1FRI A;  2C1E B;  4K4X A;  2CQH A;  2RHQ B;  4GKJ J;  1N4L A;  3M2U B;  5GMD A;  2HKE A;  4OX9 F;  1T94 A;  1MU2 A;  2WB4 A;  4Y28 C;  4EYI B;  3E2E A;  1UJ6 A;  4DZD A;  5IQQ A;  2ZFH A;  3T1A A;  1MML A;  2VG6 A;  2B9E A;  4B3M F;  4KHP F;  1CC7 A;  5K8M A;  3GJS B;  1WOO A;  5L9N A;  5LSR A;  2OML A;  3SIP B;  3ILO A;  3PM9 A;  2ATC B;  4XPE A;  1PIE A;  3ILI A;  4DUZ F;  2HHH F;  1KBR A;  1GX5 A;  2HZV A;  1F6T A;  1S6Q B;  3X3U A;  1WOP A;  3T9Z A;  1S77 D;  2FLL A;  2UV8 G;  3R2C J;  1DTT B;  2BJ1 A;  4HHU A;  1RTH A;  3MF5 A;  4TU9 A;  4GO7 X;  2HBR B;  3AQP A;  1URN A;  2YX4 A;  3FZ2 A;  3ZTO A;  1VS3 A;  1FFS B;  4JUZ A;  1D8Z A;  3M4X A;  2C2M B;  2A18 A;  3G6E S;  2DY9 A;  3DLG B;  2CPF A;  3F41 A;  3J7Z T;  2R7T A;  2J0S D;  2PT0 A;  1SB6 A;  1Q1K A;  5BJR A;  3I9Z A;  4WFA Q;  2WSE C;  3BV8 A;  4YB6 A;  2ZBC A;  2FY1 A;  5KFE A;  4IRC A;  2E7X A;  2E9Z A;  1RAO A;  2WB1 D;  5CYQ B;  2HIY A;  1KSP A;  4ED4 A;  5E7O B;  1UA0 A;  1CUL B;  2DIV A;  2C2O B;  1T9U A;  3LOU A;  2IVM A;  4E0D A;  1FDD A;  1RT3 A;  2R8G A;  3GWC A;  2H48 B;  2V2V A;  1W2B R;  1K0V A;  5K8P A;  1GXU A;  4TU8 A;  5KFG A;  2FHM A;  5KG7 A;  4F26 A;  3G96 A;  4KYZ A;  4ED2 A;  5DG7 A;  1TV6 B;  1KQG B;  3M6U A;  2KVQ E;  2HSE B;  1VJQ A;  3GR1 A;  4HYK A;  2DY1 A;  3HVT B;  3RGI A;  2B9W A;  4RZR A;  4MT1 A;  4OZ1 A;  4P9S A;  2YNF B;  2C22 A;  3FBB A;  2WBM A;  4FVC A;  3KHL A;  1TKZ A;  3HHL D;  2QC3 A;  3AOC A;  4CM2 A;  4LSN B;  2YNG B;  3DGP B;  4KHP J;  1P1L A;  2RAQ A;  3D1O A;  5LMU J;  1U0H B;  5KG1 A;  3LGM A;  1KR4 A;  2ZM6 J;  4CNY A;  4NLX A;  3M2R A;  5BYR A;  3T9N A;  3CCT A;  1X5T A;  4NWB A;  4X4S A;  2UXC F;  2DRA A;  4TY8 A;  3MM8 A;  4WJB A;  1WG4 A;  4PG5 A;  4A48 A;  4CO2 A;  2EKY A;  3ENA A;  4I0W A;  3R7B B;  2DR6 A;  5J1P A;  1RT7 A;  4KO0 A;  1CJK B;  3GSD A;  5L9X A;  4ZJL A;  2DNL A;  5SZT A;  1PIL A;  1GH8 A;  2ROP A;  4WYW A;  2JVR A;  3HHL A;  3CJQ A;  2HQF A;  4EBE A;  3DOM A;  4PWW A;  5KG6 A;  1RAF B;  5LT5 A;  1RA6 A;  2ZJR Q;  2P9C A;  1LW2 A;  3RYL A;  2XMM A;  1U48 A;  2A6M A;  4LF8 F;  1HBN A;  5I4M A;  3PEJ A;  3MPY A;  2ZH5 A;  5D78 A;  3BPS P;  2I2Y A;  3FCH A;  2EC0 A;  4CLP A;  3MR5 A;  2LXI A;  5HAO A;  2R2S A;  3IRX A;  1YQH A;  4OHX A;  4PXE A;  3RBZ A;  4U95 A;  5I42 A;  3CXC R;  3LAM A;  3SZ2 A;  4C11 B;  1TFY A;  5HRO B;  1CLF A;  2V67 A;  1FJE B;  3D1Q A;  3ZZU A;  1AZS B;  3DLB A;  2ZH4 A;  4PRF A;  4PXB A;  1OWX A;  3K0J A;  1FKO B;  4LF2 A;  2AEM A;  4WK1 A;  1NM2 A;  1KQF B;  3R7N B;  3HJF A;  2GO9 A;  2F9J A;  5IT0 A;  3V6D B;  3PW4 A;  4U9R A;  2RT3 A;  4C48 A;  1BWV A;  3NAI A;  2HNY B;  3JSB A;  4P52 A;  2JEF A;  3D6F B;  3MUM P;  2Q6B A;  5IC6 B;  4ITS A;  4Y6I A;  1WEZ A;  3UD4 P;  5ETT A;  2CFX A;  2IJF A;  2H4W B;  4JI8 F;  5DGA A;  1SJ3 P;  1RTI A;  1EIY B;  2F4F A;  2MKI A;  2DK2 A;  1AUS L;  3PHE A;  4F50 A;  1NEE A;  4OJ3 A;  1N34 F;  4YDX A;  3M2U A;  3CJR A;  2Z57 B;  1ZPW X;  1PG5 B;  2X7I A;  3OXG A;  2E1C A;  2PDA A;  1RIS A;  1CC8 A;  4UZC A;  3GV8 B;  2ZH3 A;  1NJX A;  4LFC F;  3EYZ A;  3I5B A;  5KFZ A;  2P9G A;  2BJD A;  1HMV A;  2BJ3 A;  3TRG A;  1RT1 B;  4LF8 J;  2GQ2 A;  1SL1 A;  1VBY A;  2YWW A;  4XO0 A;  5EWE A;  3KJN B;  4B3R F;  1NAQ A;  3SQG B;  3PRD A;  4EFA C;  1ZM2 A;  1X4H A;  4BHQ A;  4ECW A;  1DTT A;  4KHR A;  3HFV A;  1OIA A;  4FS1 A;  4B9S A;  3BRE A;  3GP9 A;  2KXF A;  3W9H A;  3DLG A;  4DR7 F;  2J8S A;  5SUH A;  4ZOS A;  4HDH A;  3OVA A;  4I2Q A;  2ZHO A;  3ULH A;  5DDQ C;  3VV2 B;  4ECQ A;  4FN5 A;  2FZG B;  2F3J A;  2C2K B;  4JYA J;  5D15 A;  4QZV B;  3LAL A;  2WOM B;  1DJ0 A;  4JI5 J;  1YBA A;  3MAH A;  4DR3 F;  1MLA A;  1OPI A;  5CYQ A;  5K14 B;  2QLW A;  1HNZ J;  1TL5 A;  1TKX B;  1FRK A;  3RAQ A;  4KT0 C;  2IAJ B;  5CZX A;  4RNO A;  2DBB A;  4NXM F;  1PCA A;  2LA6 A;  2PMW A;  1JLC B;  4JI6 F;  3WBZ A;  4G3I A;  4Z37 A;  4MK7 A;  4NLP A;  5A8R B;  1XR5 A;  1DY3 A;  3N0V A;  1W26 A;  5KFL A;  3BO3 A;  3OTO F;  3HVT A;  1RBO B;  4NRT A;  2W9B B;  3KNA A;  2K7K A;  1D9A A;  2OIH A;  4QR1 A;  4M95 A;  2DEJ A;  3WX4 A;  2JSX A;  4KH1 B;  3SSR A;  2YNF A;  1FER A;  2R8I A;  2EG2 A;  5CYJ A;  1WTF A;  2NXC A;  1UVJ A;  2RE1 A;  2D74 B;  2IM2 A;  2CQB A;  4LSN A;  3DGP A;  3QZ7 A;  2K1R B;  1U0H A;  2AKW B;  4K4Y A;  1FK9 B;  5EUH A;  4CNZ A;  5HVF A;  1IJE B;  5F0W A;  4B3R J;  4KAI A;  2ZWO A;  4NLO A;  2VB6 A;  3MTK A;  1QD1 A;  5D77 A;  2QL9 B;  2CQ3 A;  3DRY A;  1Q8K A;  5CD4 H;  4R25 A;  5CCL A;  4ED8 A;  2M7S A;  1TL4 A;  2UUA J;  1CJK A;  4QCL A;  3W1Y C;  3V4M A;  3FCV A;  1VYA A;  1JXL A;  3GG1 A;  3W8P A;  4DOZ A;  4DCP B;  3BGR B;  1W2I A;  1D3W A;  1QE1 B;  5AE3 A;  2POK A;  3IWN C;  1RT2 B;  3OJU A;  4OHZ A;  2WSF C;  2F8E X;  5DLG A;  5KG4 A;  4B02 A;  3UN3 A;  3OHA A;  4N47 A;  1U1K A;  5HMW A;  5H9F J;  2B51 A;  1X8D A;  2CQ4 A;  5DM7 Q;  4PG6 A;  3NLC A;  4ECY A;  3AJ2 A;  2RQM A;  4NXM J;  1RUS A;  2MKY A;  4A8O A;  5GAD I;  4A46 A;  2E29 A;  2LQ8 A;  3DDN A;  4PUO A;  1VK8 A;  3OFE A;  1RJJ A;  3ENW A;  3DOK B;  4C11 A;  2ZKU A;  2ZD1 B;  4USW A;  4M1K A;  2BR0 A;  3UR3 C;  3I5A A;  4QU6 A;  4LF9 J;  2EFV A;  2MMY A;  2MQP A;  3C3L A;  4OZJ A;  1AZS A;  2J8A A;  1HD1 A;  5IC4 B;  2RIJ A;  2H4Y B;  3J81 U;  1GEH A;  3ET6 B;  1FKO A;  4LIW A;  4GC6 A;  4JBC A;  4N41 A;  3V6D A;  2HVD A;  2RDJ A;  4X4N A;  1QY7 A;  4DG1 B;  2HNY A;  1HW9 A;  3V6H A;  2G1D A;  2RRA A;  4QYZ J;  4KGM A;  2ZEJ A;  5A76 A;  2DD8 S;  2AEJ A;  1DQ9 A;  2UXB J;  5LL6 d;  3NMA A;  2NPF A;  4KPY A;  4DN0 A;  4PYD A;  1LXJ A;  3O6Q A;  5D0E A;  3UCG A;  4ZP7 A;  1CJT A;  1JIH A;  1DQA A;  2X1A A;  3G71 S;  2JLE A;  3SYZ A;  2CNL B;  2I6W A;  4LVO P;  3CJ4 A;  1NCL A;  3CME S;  4QJV A;  2E5G A;  1HBM B;  3G8T A;  2P2C B;  3OTC A;  2BJ9 A;  1MG7 A;  2L08 A;  4LSZ B;  3VVT A;  2M5Y A;  2MLY A;  2YQ1 A;  4ELU A;  4ZVT B;  2H5I B;  2F65 A;  1S0O A;  1UCN A;  2VC1 A;  2FPH X;  5IT9 U;  2MKJ A;  3K57 A;  3P49 B;  3P4U B;  3LWL A;  3PNI A;  2K7J A;  2YNI B;  2NXJ A;  4P2S A;  2Z58 B;  3SQG A;  1S6P A;  3A8I A;  4ALZ A;  4KGK A;  2VPW B;  2XI2 A;  1HWL A;  5RUB A;  2DCU B;  4IO1 A;  3UN2 A;  1V3R A;  1X9M A;  1U1O A;  5ETO A;  2O1P A;  1Q8I A;  1T9T A;  2LXU A;  3ITH B;  1X4A A;  3JTN A;  3CMQ A;  4X84 A;  2UZA A;  4NCB A;  3UW1 A;  3NGD A;  4ES3 A;  2Y1L B;  2FQQ B;  1YIT S;  1SH0 A;  5F9L A;  3L3C A;  5F8J A;  3BSA A;  4PG8 A;  2WOM A;  4BWJ A;  1PYS B;  5KFH A;  5E3C A;  4LSL B;  1ZBT A;  3KXD A;  3QJP A;  5K14 A;  3IFE A;  1TKX A;  1NDL A;  2IAJ A;  4N8N A;  4ZVU B;  2HVZ A;  4PG4 A;  5MLC V;  1JLF A;  3AJD A;  3QO9 A;  1JLC A;  4O4R A;  3M30 B;  2BW2 A;  4F02 A;  3KLG A;  1IBM F;  1RWN B;  3M6V A;  3S6E A;  2YNH B;  3UD5 A;  1Q53 A;  2V5H G;  1KOH A;  5CAB A;  3ZTP A;  2FY8 A;  3O44 A;  2HG4 A;  3PVX A;  2W7P A;  2HS4 A;  2FIU A;  2DHG A;  4X62 J;  3SQO P;  2V63 A;  1ZH5 A;  1WF0 A;  4O3N A;  1NDC A;  4NLY A;  3AD9 C;  1U09 A;  5ITH A;  4LRE A;  1FWP A;  2W7O A;  1A0O B;  3OLB A;  2K1R A;  2EFP A;  1HAR A;  1BWE A;  1RAD B;  2R7Q A;  1OPZ A;  4KGV B;  3C2P A;  1S4E A;  4LF4 F;  2IYI A;  5F0U A;  2RNE A;  1KS2 A;  2C42 A;  5C42 A;  3DM2 A;  3S8S A;  1U0S A;  3CJT A;  2L9W A;  1G3O A;  2COL A;  3D6T B;  3JSR A;  1IKW B;  1SKS A;  4EZ9 A;  1TVR B;  2E7V A;  4DBQ A;  5D8H B;  2DGW A;  1QE1 A;  3AXK A;  4PCQ A;  3NP5 A;  3TYT A;  3MCO A;  3FRY A;  4OLP A;  1TP7 A;  1U1R A;  4CYU A;  2IVF B;  3EZ5 A;  1Q78 A;  4ZP8 A;  1RU2 A;  2GAG C;  5K5M A;  2CZ4 A;  4K0K J;  1MN9 A;  1URR A;  1YK9 A;  3GIJ A;  1Q82 T;  4J9L A;  3MXH P;  3D4J A;  2BJE A;  3THP A;  4OYZ A;  4OX7 A;  3R1L A;  1T02 A;  3I96 A;  1FVS A;  1TMM A;  1E6Y B;  1WHY A;  1QVF R;  4LFB F;  3AB2 B;  3PTW A;  5L46 A;  4FF3 A;  3M9O B;  1KLM B;  1S0N A;  1Q8B A;  2ZD1 A;  4WFZ A;  2VL1 A;  2W01 A;  3LA0 A;  4CO1 A;  5HVG A;  4UT4 A;  5ETK A;  3NNC A;  1F60 B;  1YDL A;  4NXN J;  1SH2 A;  2SXL A;  2O5D A;  3MM7 B;  3ET6 A;  4G6V B;  3RUB L;  3T5J A;  3CED A;  2HZC A;  4J9Q A;  1NJI T;  4P74 A;  3MEE B;  2OTJ S;  3EGN A;  2BKN A;  1NB2 A;  1IBK F;  5M2U A;  1Y11 A;  3PKY A;  3RW7 A;  3MFI A;  5J1E A;  4L73 A;  3A3O B;  3QQC D;  1YKW A;  4GC7 A;  5DDR C;  1JLA A;  3W5Z A;  4C3L A;  4KKO A;  1RBA A;  1BXN A;  3AD8 C;  1LV5 A;  4ZPB A;  4WP3 A;  1UJ4 A;  2DNO A;  2ILZ A;  5KT7 A;  4HT5 A;  1U6Z A;  4Q8E A;  3QT7 A;  4RNN A;  1KTQ A;  3MDF A;  1T11 A;  5T14 A;  1PAE X;  2GMJ A;  2CPJ A;  1FES A;  1PJ7 A;  4IQX A;  3K5M A;  2R7R A;  1N5Q A;  2C3P A;  1NH8 A;  2CVI A;  1RE1 B;  2LQ9 A;  5BYS A;  3THV A;  2C2Z B;  4D3H A;  2YXL A;  4EO8 A;  5HAN A;  2DNK A;  4OYI A;  4DUY J;  1U02 A;  3RZA A;  2YNI A;  5IOL A;  3NOC A;  2HEK A;  3UQS A;  1REG X;  1KHV A;  3OR2 B;  4FF1 A;  4FXV A;  1RK8 A;  1R31 A;  3N28 A;  3PFE A;  4FYX B;  2ZZM A;  5F8L A;  4MKY A;  4C8Z A;  2UXD F;  3BQ1 A;  3ITH A;  2D3Z A;  4FKX A;  3Q0A A;  3TNV A;  1ULR A;  1FFG B;  5KT6 A;  4CCH A;  1YRT A;  3CJS A;  2QN6 B;  3D67 A;  2IVY A;  1WDT A;  4NYZ A;  3CGI A;  1CS4 B;  5HP1 B;  4I68 A;  1LEO A;  5GVQ A;  2V94 A;  1IBK J;  1J5O B;  2WBR A;  3FUY A;  4DR1 J;  5ETR A;  3HHN B;  1U4B A;  3VAG A;  4C2M A;  2EWH A;  4PAB A;  3FK4 A;  1WHW A;  2V0N A;  1Y3J A;  1RTD B;  4F0M A;  1KEK A;  3IR6 B;  4N56 A;  1F3F A;  2YNH A;  3RR7 A;  4Y2I A;  4F25 A;  4QWE A;  3OL6 A;  2KFY A;  4ZVP B;  3I6P A;  2NS1 B;  3G6X A;  2C2N A;  1VIO A;  4IH7 A;  2NPI A;  5E3Q A;  3CJ0 A;  4P71 A;  4DZ6 A;  2NSB A;  1N8R T;  4NLD A;  1YZ7 A;  3VTI A;  4GO5 X;  1BQN A;  4RKU C;  5A8W A;  4IYQ A;  3JAM Y;  1VRU B;  3GSI A;  2LKZ A;  5ETL A;  4RU9 A;  3E51 A;  1EP4 B;  2NXU A;  3VGS A;  3BGF A;  3NG8 A;  4J9N A;  4WTO B;  3MAQ A;  3FJ2 A;  2PFD A;  2JL9 A;  3A1Y G;  3WIV A;  1HBU A;  2GJI A;  2PI5 A;  3P5B P;  4C4W A;  3G6V A;  3CCU S;  4NLG A;  3MMC A;  2HBY B;  3CO9 A;  3RB4 A;  3LP0 A;  1IKW A;  1WG1 A;  2CJQ A;  2BJ7 A;  2UXD J;  4NEZ A;  3QSY B;  1MWQ A;  3BBF A;  2OUG A;  4UUX A;  3ZO7 A;  1S0M A;  5EN1 A;  3DCA A;  2UU9 J;  3AD7 C;  4AQY J;  4QIE A;  3G87 A;  3V6J A;  3HKZ D;  4ZLJ A;  2MZQ A;  5A2Q Y;  5CAA A;  2RF2 A;  1JNZ B;  2WAQ D;  3GFY A;  3KG1 A;  4J9M A;  1KFD A;  4R0E A;  1P9Q C;  3LUY A;  1E6Y A;  3KLV A;  3IBC B;  5L38 A;  1HQU A;  4ICL B;  4PXD A;  2EK1 A;  1AT1 B;  4OV1 A;  4BC7 A;  4IOB A;  3D7S B;  3C6U B;  3VHQ A;  3IRW P;  4ZP6 A;  4BCA A;  3CUN A;  5IM0 B;  4ECZ A;  2VDH A;  3KK2 B;  3WHI A;  2HFS A;  1S49 A;  5JMN A;  3KK3 B;  1PYO B;  1SV5 B;  3DDI A;  1N32 F;  4ENO A;  3GMG A;  2VON A;  2XUL A;  4MMO A;  3LPY A;  2OSQ A;  4LJM A;  4DQS A;  2CJB A;  2M70 A;  1R43 A;  2H3E B;  1EKS A;  1B0T A;  4JI0 J;  1IKX B;  3PX6 A;  3KHH A;  1M5O C;  2Q3P A;  4PPZ A;  2D9P A;  5HVH A;  3MPV A;  1X5P A;  3F73 A;  1U1Q A;  3MUT P;  2E44 A;  3BO4 A;  3EPG A;  3Q86 A;  4P2M A;  2R7V A;  3HO1 A;  4Q5V A;  1N6Q B;  3MMA A;  4RUH A;  3BEG B;  1FJG J;  4USI A;  3I32 A;  3J80 U;  2CNO B;  1R6V A;  4RNH A;  3UDC A;  2UUC F;  3JQM A;  3QMQ A;  4OQJ A;  4PAA A;  3UDL A;  1QSL A;  3CJ2 A;  3GCW P;  2XM3 A;  1RT4 A;  2E9T A;  2BM0 A;  3L9Z A;  2XEX A;  4M5M A;  3ISN C;  1VCT A;  2AX1 A;  1XMB A;  3QJL A;  3BB5 A;  2HBZ B;  1NO8 A;  3CCS S;  4CO5 A;  3QGP A;  2WON B;  3MM5 B;  4QOT A;  2AGQ A;  2Q79 A;  4NA1 A;  3D0H E;  2M3D A;  3W62 A;  3CJ5 A;  4RU2 A;  1RHU B;  5E2Q A;  3VAF A;  4WII A;  3B82 A;  2DB1 A;  3DLL Q;  2W4P A;  4WFX A;  3CDA A;  2Z30 B;  2MQ8 A;  5D0R A;  1MN7 A;  1H74 A;  3WC0 A;  2P5V A;  3H90 A;  3DXB A;  2WK4 A;  1S9F A;  5HP1 A;  3L7U A;  1S76 D;  2EFQ A;  3GFH A;  1IBL F;  1RAG B;  1J5O A;  4N7T A;  2MZT A;  1RAE B;  1C1B A;  4QIG A;  2MGZ B;  3KMS A;  1JLB A;  4D3G A;  2ZDP A;  4X4V A;  1ZM4 A;  2IRX A;  1SJR A;  5EGY A;  2HFN A;  5EWG A;  4IFY A;  2Q6C A;  2ZBI A;  4XDC A;  1DHM A;  4OZ0 A;  1SJ1 A;  2I38 A;  1C4A A;  2DKO B;  2KG1 A;  4K2X A;  3GJR B;  3T5H A;  1WC1 A;  1H7W A;  3LP2 B;  4OZN A;  4I2P A;  4USV A;  2FUG 9;  2VBZ A;  2QV6 A;  4OJG A;  2FLO A;  4OHY A;  3P45 B;  2AWZ A;  2IM0 A;  2EPI A;  4NA2 A;  2YWE A;  4I7F B;  1YHQ S;  1SBR A;  1S79 A;  1VRU A;  3R5G A;  2XNR A;  1ZA1 B;  2GA7 A;  4R5P B;  4JI4 F;  1VQO S;  3TUJ C;  3VAK A;  2IPO B;  4QWC A;  2J6S A;  3CJ8 A;  1U1P A;  3TI0 A;  4DV1 F;  3LTO A;  1RDR A;  5HBM B;  1EQ0 A;  1DQ8 A;  1Y0H A;  4B3S F;  2H54 B;  2CPH A;  4RX6 A;  4W4M A;  2C3Y A;  1S12 A;  5JXS A;  4DR2 J;  4E2F B;  2M52 A;  2I8E A;  4L6V 3;  3K17 A;  3VR1 A;  2IJN A;  4H54 A;  3AJ1 A;  1U2C A;  2W8L A;  4DR6 F;  1VMB A;  5HMX A;  2VKZ G;  2Y1R I;  4W98 A;  1XNR F;  1REV B;  1UVM A;  3W5Y A;  3QGG A;  1KLN A;  2EFO A;  4TXS A;  4DL3 A;  4USU A;  1CQM A;  2JJ4 D;  3HT0 A;  1CJU B;  4DV5 J;  1TKD A;  3ZTS A;  3UI3 A;  2BE7 D;  1U6B A;  3MHY A;  2Y0B B;  1B99 A;  2ZH9 A;  1NJY A;  1IWG A;  2FVS A;  1AA1 B;  2AT1 B;  1RLD A;  3KLE B;  2CQI A;  1X0P A;  1U47 A;  1YJT A;  4PR6 A;  2JNJ A;  1UEK A;  3PX0 A;  3W61 A;  3JSY A;  2KTQ A;  2RJZ A;  1FO1 A;  4ICL A;  1O51 A;  2M9K A;  2KM8 B;  3M1V B;  1KN6 A;  1J5E F;  2DYA A;  2AMC B;  3BBC A;  1NKE A;  2KRB A;  3TZY A;  4DFJ A;  1DZ5 A;  2KDO A;  2VQF F;  4K8R A;  1G4C A;  1T9X A;  2JX2 A;  4CZC A;  3KK2 A;  1UMJ A;  4Y65 A;  2NZ4 A;  3RU0 A;  2OEM A;  3KK3 A;  2NYI A;  1ZZN A;  2OKQ A;  3C14 B;  4RBT A;  3OW2 R;  4ETZ A;  3T6B A;  2KT3 A;  3WZ0 A;  1K44 A;  4WFN Q;  1VQS A;  4J9S A;  3P3D A;  2Q66 A;  1ZAW A;  4B3S J;  2VAS A;  2V4J A;  2BA9 A;  1IKX A;  2MY8 A;  4NYP A;  3MM6 B;  3GON A;  1S9G B;  2V8V A;  3OSN A;  1P6T A;  2XHW A;  2OD6 A;  2IMO A;  4X66 J;  2Q1L A;  2XB2 D;  3EMT A;  1HA1 A;  1XR7 A;  3FQL A;  2CDR B;  1N5Y B;  2R8H A;  1N6Q A;  4Y2M A;  3TJA A;  1RKJ A;  4ZPA A;  1NPR A;  4V19 J;  4CT9 A;  1I6J A;  3BQ0 A;  1SKR A;  2FC8 A;  3DDK A;  2LEA A;  4OJH A;  1NLK L;  2BX6 A;  3H42 A;  2N3L A;  3ZZP A;  1I3O B;  2LP4 A;  2W2O P;  1IKV B;  4FKY A;  4Y34 A;  2WVB A;  2O66 A;  2DNZ A;  1RAH B;  5AXM A;  5C2C A;  3MED B;  2XSF A;  3OJS A;  1FXL A;  2J7K A;  4WCE Q;  3MM5 A;  3R5A A;  1UW9 A;  2CIM A;  1F5B A;  2YVS A;  1VQ7 S;  4CO0 A;  1SJQ A;  4KBI A;  5HK4 A;  1DAR A;  2GFF A;  1P8G A;  2DR9 A;  1G2E A;  2ASD A;  2KHD A;  4J9P A;  5KFF A;  3UE2 A;  5DG8 A;  3POT A;  3PRV A;  3R9L A;  1Z4U A;  3L95 X;  1Y5L B;  4O0N A;  4F3O A;  3BJY A;  5F3T A;  2AV5 A;  1TKT B;  2MGZ A;  5AE2 A;  2Y1I A;  2XMU A;  4DV6 F;  2RRB A;  3CCQ S;  4LFA F;  2GHP A;  4MJK A;  1C1C B;  4I1T A;  4BC9 A;  3QT6 A;  1I94 F;  2RB7 A;  2LEP A;  1FX4 A;  4IO9 Q;  2HUR A;  4USM A;  5E3P A;  3LP2 A;  3IM9 A;  3J7Y I;  5K8N A;  3RG6 A;  1YJV A;  5D3G B;  2CNK B;  3CD7 A;  3B6B A;  3D54 A;  4I7F A;  5KFK A;  3V5R A;  1JQG A;  4F3M A;  3FSI A;  5A8K A;  2VBX A;  2YKP A;  4Q0B A;  3SSS A;  1ACM B;  2P9E A;  2K06 A;  2BE2 B;  2AYM A;  4OL8 A;  3DYA A;  1UWA A;  2E66 A;  2HND A;  2HNZ B;  4DX8 H;  5ETV A;  2C2D A;  3BO2 A;  3D66 A;  1IUJ A;  4URQ U;  1JJ4 A;  2PD1 A;  1YI2 S;  2R4F A;  1WSR A;  4EBC A;  4IH5 A;  2HGN A;  2DNQ A;  1HI8 A;  3CCZ A;  2HQD A;  5EDW A;  4R8U B;  5DET A;  4YHH J;  4WF9 Q;  4QW8 A;  3EVM A;  1WOS A;  4EO6 A;  4KIA A;  2CA9 A;  3W63 A;  1FCA A;  4OYB A;  4N76 A;  2VA2 A;  1REV A;  4RUA A;  2ZBP A;  2OLW A;  5LOQ A;  4RW6 A;  4CO4 A;  1U8W A;  2ZJP Q;  1F1B B;  4EUV A;  4FNI A;  1NUE A;  2XGP A;  4NX9 A;  4DR4 J;  2MQQ A;  4ANE A;  4OV6 A;  2QSF A;  2J9E A;  2OJ3 A;  4UW2 A;  1S4F A;  3I55 S;  5GAG U;  1QUP A;  2IIH A;  3RTV A;  1HNV A;  1X9S A;  2C3M A;  1M0S A;  3T1H F;  1YBU A;  3MM9 B;  5D0H A;  2QA4 G;  4DV6 J;  3TX8 A;  3BDP A;  5AJ3 F;  2DTJ A;  2XTJ P;  4NA3 A;  2MST A;  3TUI C;  4K4Z A;  2MHN A;  2DRB A;  2EFG A;  2JRS A;  6FD1 A;  3KLF B;  4LR7 A;  2J6U A;  5BR8 F;  1GT8 A;  1PBA A;  2NCK L;  1GFW B;  3M1V A;  3H25 A;  3ZTR A;  1RWO B;  4H4M B;  1SL0 A;  3PW0 A;  3QRR A;  3S01 A;  5L1K A;  3EGV A;  4YFU A;  3DHW C;  1EKR A;  4DSK A;  1IR2 A;  1HQE B;  4I6Y A;  2RIL A;  3H40 A;  2CQC A;  1S1W B;  3KLI B;  4EI2 A;  3CPW R;  1SQE A;  5C2G A;  2XO7 A;  3C14 A;  1DLO A;  4DV2 F;  1N56 A;  2XBP A;  2B0G A;  2HPU A;  1IR0 A;  2HHV A;  4QIF A;  1TK0 A;  4CLY A;  2AD9 A;  4B9U A;  4CTA A;  3BR9 A;  3FEY B;  3BF4 A;  1ZM3 A;  2QTW A;  3BKF A;  5L39 A;  4F04 B;  3JTP A;  3KFW X;  3AA9 A;  2BAN B;  1R8P A;  2DNH A;  2B9X A;  3E01 B;  1N5Y A;  2ILY A;  3VVU A;  4YB7 A;  2LQ5 A;  3TAP A;  1FEH A;  1MRO A;  3P5T L;  1WEY A;  2FHJ A;  2HFV A;  1RHJ B;  3PO5 A;  3TZW A;  1RHK B;  1U2R A;  1TAU A;  1F2H A;  4B17 A;  3PY8 A;  4W90 B;  1QSS A;  2H9Z A;  3AB4 B;  3HDS A;  2VG7 B;  4DV3 F;  4PKD B;  3VZH A;  1NJW A;  2VG6 B;  2KL8 A;  3ZC4 A;  3O3L A;  2F4V F;  3DLE A;  4PWD A;  2H5E A;  3MED A;  1Y00 A;  4DV7 J;  4WKY A;  3TP2 A;  3DU5 A;  1T3O A;  2E9R X;  5IWA F;  3DNC A;  5HLF B;  1RWK B;  1RTH B;  1ZTT A;  2IA6 A;  1KRP A;  1UW4 A;  2V6A A;  4C0O C;  4LRA A;  2X1B A;  3TJ8 A;  2I1R A;  5AXK A;  3QID A;  4DL4 A;  3CCL S;  2YY3 A;  5EX3 A;  2XWX A;  3PHT A;  1YJR A;  2JWN A;  2VPZ B;  5EHH A;  1GTE A;  3H2V E;  3L7O A;  2BOP A;  2GJ2 A;  1TKT A;  1RB0 A;  1HR0 J;  1H3D A;  1R8H A;  2YKQ A;  2Y0S D;  2ZKT A;  2FVP A;  1A6L A;  1C1C A;  1B64 A;  4DPX A;  3EVO A;  2HK3 A;  2LCW A;  1U45 A;  2Z0G A;  1Z2Z A;  2LLZ A;  4YN3 B;  2BOA A;  1XN9 A;  4OMF G;  4GRS A;  3N4W A;  4CDI A;  4C6A A;  3DRR A;  1B0P A;  5C7P A;  1PBU A;  2E1A A;  5GAD U;  1XNQ J;  2ZIT A;  2E1P A;  4Q2M A;  2OPS B;  3MEC A;  5H1S V;  1CEZ A;  2MKH A;  4UOH A;  3UVJ B;  3M2V B;  2MHE A;  3H0P A;  4U7U K;  2Z4P A;  2CQ0 A;  5IV4 A;  2F8M A;  4MYU A;  4NMX A;  3PRB A;  3M8Q B;  2MZR A;  2DNN A;  1JJ2 R;  4YR0 A;  3PW7 A;  2BE2 A;  1RAC B;  4M5D B;  4DI6 A;  3KUE A;  4DPT A;  3IBF B;  1ZAX A;  4EZ6 A;  1YJW S;  2HNZ A;  4NE9 C;  3CB4 A;  5DDP C;  1TKZ B;  5LMN J;  1Q8L A;  1GXT A;  1M1K T;  4KC5 A;  3KLH A;  5K20 B;  3QRQ A;  3CO0 P;  3W8G A;  3UDV A;  2BDP A;  1U1L A;  2YKM A;  4H4O A;  2XS5 A;  3WIU A;  5H9F K;  2X3D A;  2HWT A;  5IWA J;  4AL7 A;  2RVJ A;  3MM8 B;  1XK8 A;  1OYD A;  3TA2 A;  3TAQ A;  3TZX A;  4B3T J;  2W2P P;  2PA8 D;  3FGV A;  4GKJ F;  1RT7 B;  2BM1 A;  4KO0 B;  2DIS A;  3W2V B;  4NZ6 A;  4LF1 A;  2KFZ A;  3Q2S C;  4M5L A;  4RNF A;  2MYF A;  1EQM A;  4WYL A;  4NZ0 A;  1FD2 A;  4FF4 A;  3HKW A;  1X60 A;  2F8H A;  3LAK A;  4C98 A;  1KKH A;  5J1N A;  1FNX H;  4O3Q A;  1R0B G;  5B0D A;  3J80 Y;  4NRU A;  4HI2 A;  4DCO B;  4JV1 A;  1SKU B;  3GII A;  3CDW A;  2DXF A;  3NGR A;  2G0I A;  1G1X A;  3KLF A;  1ZS6 A;  3TAR A;  4TN2 A;  1SC6 A;  1FXD A;  3IRX B;  1GTH A;  4FP9 A;  2MTL A;  4PQU B;  5I42 B;  4QYZ K;  2VOD A;  3HVA A;  1S10 A;  1BQX A;  1D9F A;  4RJV A;  4RUC A;  4L3K A;  2H65 B;  5KG2 A;  1HQE A;  3GB0 A;  4U8Y A;  4AUK A;  3EE3 A;  1FE0 A;  2UVW A;  3O8W A;  5LM7 E;  1U1M A;  4DQQ A;  2J7U A;  3ZZO A;  3T1Y J;  2YWH A;  3RRK A;  3HM9 A;  3I0S B;  2ZH2 A;  3SI8 A;  3C15 A;  1R7I A;  4A8X A;  3NEK A;  4MH8 A;  1LKZ A;  2XMK A;  3GYX B;  3RB0 A;  2M8D B;  1GMW D;  1N54 B;  2BAN A;  3DI6 B;  1H38 A;  4ELV A;  2IY5 B;  4USH A;  3E01 A;  1GMV A;  3D3B J;  3RBX A;  2AZ1 A;  3T41 A;  4DSI A;  4ZJQ A;  3U1L A;  4FYD A;  1PAU B;  4DF4 A;  4ECV A;  1UJ5 A;  4J7C A;  3SCK E;  3BGO P;  1S59 A;  4LBI A;  3FBC A;  4USK A;  2MDA A;  1UP1 A;  4WZM A;  4KTQ A;  4DXL A;  2NXE A;  1YTY A;  3PFO A;  2VG7 A;  4UY8 5;  2Y8W A;  2P6T A;  4HHJ A;  2CQP A;  3SV3 A;  5LXY A;  1HMV B;  5LMU F;  5ETP A;  1FJC A;  4J9U E;  1YIJ S;  2Y8Y A;  2FJE B;  3SBM A;  1UFK A;  1GMW A;  2ZM6 F;  3NXZ A;  1TK8 A;  3KOA A;  2V50 A;  2ZH6 A;  3CCW A;  1NHU A;  4F67 A;  5HLF A;  2FJB B;  3BBB A;  2GX8 A;  3EVW A;  4Z2X A;  2E5L F;  3OFG A;  1HNX J;  2ZJQ Q;  5DO2 A;  1OY6 A;  5G4D A;  3NS5 A;  3AOB A;  4I2Q B;  1PSD A;  1NK7 A;  2WSC C;  4N77 A;  4U7C A;  2A2D A;  4M5I A;  2DHS A;  3BDE A;  2ZVS A;  4NCG B;  1FRM A;  4UF4 A;  2HHQ A;  2RUG A;  2B4V A;  3QFW A;  5I3Q A;  1VQL S;  3QPI A;  5ETQ A;  2ZDO A;  3C19 A;  1S7H A;  2R7W A;  2MZ1 A;  1GXL A;  3UFC X;  5J2N B;  1OY8 A;  1QTM A;  1CG2 A;  3W9J A;  3ISZ A;  2OPS A;  2VFS A;  3UVJ A;  3CCE S;  3M2V A;  2DH9 A;  4OZ3 A;  3K5N A;  1AUD A;  4RW9 B;  3IS9 A;  4PXC A;  4B9M A;  2BAB A;  3M8Q A;  3DC2 A;  2DHA A;  1VRQ C;  3DRP B;  3KG0 A;  4M5D A;  2QA2 A;  4A8Q A;  3H2L A;  4E98 A;  2JDJ A;  3S1T A;  1RTJ A;  3LH2 S;  3MFH A;  1HI0 P;  3QAU A;  4LQ3 A;  3EJM A;  3QFH A;  3IAM 9;  2YPZ A;  2Z56 B;  3KK1 B;  2YKN B;  3IR5 B;  1WC6 A;  3Q8P B;  4HEA 9;  3SEO A;  2CZ9 A;  3R5C A;  1T05 A;  3KMQ A;  3LO3 A;  4ZIT A;  5HSP A;  2JLF A;  3PW2 A;  2J9D E;  5KFD A;  2FZC B;  1R8B A;  2ACM A;  1UPP A;  3H5X A;  1RAA B;  2R2T A;  1J2V A;  3C8Y A;  1YRU A;  2XHC A;  5BXI A;  4ID8 A;  4ZPV R;  2E5L J;  1RTZ A;  3GCX P;  3W2V A;  3W5X A;  2FHO B;  3CDU A;  3N5F A;  2YH1 A;  1EX8 A;  4DEZ A;  1X4D A;  1T0T V;  2XLI A;  4M94 A;  4JI2 F;  3L4B C;  1JJC B;  2M2B A;  1S1U A;  1G6B A;  4ZP9 A;  4L74 A;  2IJR A;  1N5S A;  3N9U C;  2WTF A;  2R7S A;  5KFW A;  2FGO A;  3R7S B;  1CQN A;  4C7Q A;  2OHD A;  3VGU A;  3KDO A;  2NZC A;  4M5G A;  4PQU A;  2D3O R;  4PUO B;  1VK3 A;  2PN6 A;  4DL5 A;  2ZHA A;  4K59 A;  5HMY A;  2HYI B;  3VQS A;  3MI7 X;  5LJ3 Y;  2GIR A;  2DNM A;  2K3I A;  3JAM U;  4ES2 A;  2I0X A;  4JI3 J;  1HLW A;  1FFW B;  3W66 A;  3CMA S;  4JYA F;  5IFM A;  1B3T A;  4JI5 F;  2ATL A;  4M5H A;  3Q2T C;  2LXF A;  2DR8 A;  1HNZ F;  2WHO A;  5DLF A;  1S7I A;  2QLF B;  5FLX U;  3ZZT A;  5KFQ A;  2BRK A;  1UZD A;  3I0S A;  1HWK A;  4IKA A;  4ZS6 A;  2BXJ A;  2VIH A;  3ZXW A;  4K50 A;  3CD0 A;  1UEV A;  4Y2K A;  3FSY A;  4RBV A;  3T5L A;  4O4G A;  1WG5 A;  4OI4 A;  2W8K A;  1LK5 A;  3DI6 A;  4LF5 J;  2D3U A;  2D9O A;  3OVS A;  1CJT B;  4OYM A;  1Y5N B;  5C25 A;  4GMK A;  1U25 A;  1VIS A;  3NGU A;  2LVW A;  2V2Q A;  3VAH A;  4ETX A;  3KWM A;  2PSZ A;  2HHW A;  3TWZ A;  4DR5 J;  1SVD A;  5GAG I;  3CIM A;  1Q7L B;  4HKQ A;  2CPY A;  3G86 A;  2HRU A;  3MMB B;  1JX4 A;  1Y3K A;  5A2Q U;  1MWZ A;  3FBF A;  4JI2 J;  1XQI A;  2Y1J A;  2DH8 A;  3AQO A;  2J9D A;  3N6N A;  2PGC A;  1FKP A;  3OFH A;  4JV0 A;  4LBP A;  3I4H X;  4OHW A;  1NXI A;  2OSR A;  3OPK A;  3HSZ A;  4J37 A;  4NAS A;  5AT1 B;  1VLY A;  2HZA A;  1S6P B;  2KM8 C;  3GFX A;  3I5C A;  2NLW A;  2MQN A;  3C66 A;  3RB6 A;  2IC3 B;  1R6Y A;  3BGL A;  1WAC A;  2R7O A;  3FVY A;  5G0R B;  1X9W A;  3DOL B;  2ZNY A;  2XGQ A;  2KXN B;  4F4A A;  4K4T A;  2UUA F;  2Q43 A;  3ZNJ 1;  2BQ3 A;  1LWC B;  3PYF A;  2VU5 A;  4WP9 A;  4O3R A;  4ZK7 M;  4F4X A;  3CUL A;  1EJ7 L;  4DL6 A;  1LNQ A;  4NCG A;  3ADA C;  4G65 A;  3R2D J;  1QAJ A;  3Q89 A;  1HWU A;  3LF0 A;  2G2Z A;  3OV7 A;  2VJU A;  4OZ5 A;  2AGO A;  1N5V A;  1N52 B;  1FWK A;  3AAW B;  4QYR A;  4NLU A;  5CZV A;  2V8D A;  4KGX B;  1BUX A;  2VFT A;  1C0T B;  4RWX A;  1JLF B;  1X4F A;  1N33 J;  1RQ0 A;  3I87 A;  3QO9 B;  5J2N A;  2H51 B;  2K8G A;  1QLN A;  3ILJ A;  3EPI A;  1OQ6 A;  4K4V A;  5DG9 A;  3U02 A;  3KLG B;  2CNN B;  4P75 A;  2GIF A;  5ETS A;  2HWI A;  4LF9 F;  4RW9 A;  1NSQ A;  1Y5I B;  1ZZF A;  4MTP A;  1RI7 A;  3K59 A;  3O5T B;  1JLE A;  3HF5 A;  3I0R B;  3U27 A;  7FD1 A;  4TYA A;  3DRP A;  2C3U A;  3OSP A;  3TAM A;  2VPX B;  3HVR A;  1RT6 A;  3IMQ J;  4J5O A;  1AFJ A;  4A8W A;  3D5M A;  5KFY A;  5DS7 A;  1CBK A;  3KK1 A;  4X65 J;  2YKN A;  2RQC A;  1I5O B;  3OLA A;  4MK9 A;  1WC0 A;  2JLG A;  2UXB F;  4ELT A;  2BUN A;  1K1S A;  4N8O A;  2APO A;  3MOZ A;  1F5A A;  4HVZ A;  5LSO A;  1GX6 A;  4FBT A;  1RCX B;  1FRH A;  3NNA A;  4FYW B;  5C42 B;  3K5L A;  3DM2 B;  2YH0 A;  4MKB A;  4HLB A;  3EDQ B;  2CQ1 A;  1VRT A;  4EBD A;  2HFO A;  4UY8 T;  1RYS A;  2V68 A;  2ZBR A;  3ISN D;  1HWI A;  3LAN A;  4LT6 A;  1YJN S;  1KQS R;  1QVG R;  2MKS A;  2WZ1 A;  1S1T B;  2CPE A;  4CYU B;  4DMZ A;  2HVH A;  3CE8 A;  3LGH A;  3KUG A;  2X1G A;  3CD5 A;  3TQE A;  4DUT A;  3MR2 A;  2IM1 A;  3I82 A;  2OP5 A;  3CJ3 A;  2FVC A;  4JV5 F;  3U1N A;  1B7F A;  2UUT A;  2QRR A;  3LGN A;  1SIW B;  4IUF A;  2C2E A;  4IOA Q;  2A10 A;  1H0H B;  1KC8 T;  2OEK A;  1WKK A;  2VOO A;  4G1Q B;  4DPU A;  1O0P A;  2D1C A;  1O8B A;  3TQ1 A;  2X51 A;  1IXK A;  2VG5 A;  3HJV A;  2XMT A;  3DRX A;  2CKW A;  4GVB B;  5F41 A;  3G8S A;  5HJX A;  1KVI A;  1R3N A;  2V34 A;  1EB0 A;  1NME B;  3IGV A;  4XAK A;  3VCD A;  5KFI A;  5GME A;  3I9V 9;  5KFR A;  2IBO A;  1P9Y A;  4CT8 A;  5B0C A;  2BKP A;  3K7R A;  4C8L A;  2WW8 A;  2N4D A;  5J1E B;  1X0F A;  1YGY A;  2E1M C;  2A2C A;  1S57 A;  1JLA B;  2EFN A;  4Y00 A;  3W3S A;  1FVQ A;  2J76 E;  2L48 A;  3TX0 A;  4KKO B;  3EXC X;  2GQQ A;  2XZT B;  4DV0 F;  2ZH8 A;  1SIZ A;  2B5J B;  3GIL A;  5EWF A;  3EIC A;  5A6P A;  5A0Y B;  1XER A;  2BE9 B;  1I51 B;  4IG0 B;  4F4Z A;  4A4J A;  4J90 A;  5F8I A;  3PEH A;  4X2B A;  5KOX A;  1NDP A;  2DIT A;  2B9Y A;  4X62 F;  2NR0 A;  1DBD A;  4LVN P;  5CYM B;  1WI8 A;  2GIQ A;  1SJF A;  2DVI A;  4LRF A;  4WP8 A;  1TL1 B;  3EUN A;  3MMB A;  2CRL A;  1WHV A;  4V1A k;  5IQ6 A;  4AXI A;  2LU2 A;  3HUL A;  4OYP A;  2GMH A;  4QPT A;  3Q22 A;  3OUY B;  1WEL A;  2OPR A;  5F9N A;  4IFV A;  4HDG A;  2ZBQ A;  4JV5 J;  1P27 B;  2XYG B;  4ANC A;  2XY7 A;  1R8C A;  2IC3 A;  4LF7 J;  3BH7 B;  5G0R A;  3D0G E;  2GHV C;  3DOL A;  1Q5Y A;  3CCM S;  4LRC A;  1L5U A;  3UCZ P;  2CWX A;  5CXT A;  1LWC A;  1RSC A;  2K2P A;  1DTQ B;  2A6O A;  5DRK A;  3TEG A;  2GGP B;  3P6Y C;  2W2M P;  2G4B A;  3G9C A;  2GNK A;  4K0K F;  2ZC3 A;  1H98 A;  4DF8 A;  1HHQ A;  3PYE A;  2QYG A;  1Q95 G;  1C0T A;  5KG5 A;  5B08 A;  5F3Z A;  3FNN A;  4CLT A;  2EBG A;  2FJD B;  4AL5 A;  2ZUA A;  5HQM A;  1KTV A;  3TA0 A;  4UZB A;  4X4R A;  2YKO A;  4DV0 J;  4ZCK A;  3KHR A;  5KFU A;  4F2S A;  2NSC A;  3R3T A;  4NXN F;  3T19 A;  3VF0 B;  1TL3 A;  3I0R A;  4KB7 A;  4X4P A;  5ETM A;  2QT7 A;  4ZPT R;  3SSQ A;  1HPZ B;  3CT9 A;  1BQN B;  5A8W B;  1L3V A;  2HHX A;  2FYX A;  4KPC A;  4YY3 J;  2VH7 A;  4AD6 A;  1H72 C;  3KDN A;  1TK5 A;  3MEG A;  1JLQ B;  4O3S A;  4HL9 A;  3DHX A;  4NLV A;  4C9D A;  1FHT A;  3B4M A;  2IM3 A;  3F44 A;  3FZB A;  4O3O A;  1H73 A;  5KFC A;  3OL9 A;  1UEU A;  1ZA2 B;  1HBU B;  3BPD A;  1CJV B;  4ES1 A;  2HMI A;  1L3U A;  1FJ7 A;  4EGL A;  2N82 B;  1GNK A;  3GFZ A;  3MMC B;  5JUM A;  1K9M T;  2BW7 A;  1NU4 A;  2RRN A;  3LP0 B;  3G2X A;  2DGT A;  3H5Y A;  2PA3 A;  3OR1 B;  2Y9H A;  3JB9 k;  3H4B A;  2L9N A;  2JVO A;  4RW4 B;  1PJ6 A;  4NLS A;  1FDB A;  2QG9 B;  3GV5 B;  3QT8 A;  3OXF A;  4H4K C;  1VI7 A;  4LRD A;  4CWB A;  3K5O A;  1S1T A;  3IWX A;  2HHP A;  4UTG A;  4X4O A;  2LA4 A;  3BZQ A;  1VQ6 S;  3GIK A;  1VQ9 S;  2HQ3 A;  1JLG B;  4DUY F;  4DL7 A;  2EKN A;  3MUV P;  2A0F B;  4O44 B;  2IRY A;  4ILR A;  1YRX A;  5IXU A;  2JH3 A;  2RF2 B;  3NOG A;  3PW5 A;  1YJ7 A;  3JQK A;  4NEY A;  2FDN A;  4CI0 B;  5GAH I;  4G1Q A;  1WI6 A;  5J2P B;  4TY9 A;  3CDE A;  4M5K A;  1SQF A;  2R2R A;  1HQU B;  1VBK A;  2IBK A;  1PC5 A;  4OIX A;  4GVB A;  3T6J A;  2FD2 A;  2RML A;  2B56 A;  2DCL A;  4F4W A;  3ZZY A;  5E5N A;  2ZHB A;  1RYR A;  1SI9 A;  3BS9 A;  4ZVE A;  2XMW A;  2PMH A;  1V6H A;  4CLW A;  1S1V B;  2QLX A;  2XMV A;  3Q83 A;  4I6A A;  1M1H A;  3EXY A;  2AYB A;  1TL7 B;  4DR1 F;  1O5J A;  1YZ6 A;  2QL7 B;  4DL2 A;  3O2I A;  3RBD A;  3VAI A;  2NRE A;  1XBW A;  5L1J A;  1QTN B;  2OPQ B;  3IA0 A;  1JKH A;  4CO3 A;  2G0C A;  4RLE A;  5L1I A;  2XNQ A;  1MMD A;  1CPZ A;  2DXD A;  4XPC A;  4QR2 A;  4WKR A;  2AIR B;  4L3N A;  4DWI A;  1IWA A;  2B5J A;  3O1L A;  2HHS A;  4Q8F A;  2XI3 A;  5A0Y A;  2DXE A;  4JI1 J;  3KJV A;  1TQL A;  4IG0 A;  1SH3 A;  4DSJ A;  2GVD B;  4ECU A;  3J7Y U;  4IG3 A;  4IDK A;  3HP6 A;  5CYM A;  5LSL A;  3H2U B;  2V9W A;  3CCR S;  1TL1 A;  3MMA B;  1ITP A;  4FXW A;  2VBW A;  3HFZ B;  1NKC A;  2PEH A;  3OUY A;  1TZ0 A;  2KRR A;  5A6W A;  4BDP A;  4DU8 A;  5IZH A;  2WVD A;  1RBL A;  4Q7A A;  1JK9 B;  5E3A A;  5KFV A;  1LXN A;  4AXJ A;  5ETN A;  2CJA A;  5KFX A;  4R0J A;  3N6M A;  3EWG A;  1K47 A;  1RT4 B;  3G6Y A;  2MY7 A;  2C2R A;  2ZZT A;  3A12 A;  3DFE A;  4DPW A;  1PYT A;  2FHK A;  3JQJ A;  1DTQ A;  1RWV B;  1GQE A;  2ABY A;  4OX9 J;  1OO0 B;  2DGS A;  1RA7 A;  2GGP A;  2W4C A;  2ROE A;  2IYG A;  2VOP A;  3OHB A;  1Q0N A;  1YLX A;  3RAM A;  1FI4 A;  3OTE A;  4B3M J;  2ZZN A;  2XMA A;  2UU9 F;  1V9O A;  4J9O A;  4AQY F;  2B7C B;  4DUZ J;  2QMW A;  2HHH J;  1SL2 A;  4RW7 A;  5IV3 A;  3HX9 A;  4KRW A;  1C1B B;  3UCU P;  4QU7 A;  1JLB B;  4OLO A;  3AT1 B;  2XCA A;  5JVG Q;  3SMZ A;  1TFW A;  2HHT A;  3TAN A;  5F8M A;  1KHW A;  1I1G A;  5E0O A;  4IFY B;  3K2Y A;  1M1G A;  2JHE A;  2CG8 A;  1VQN S;  2RSQ A;  1FXR A;  3W9I A;  1XMO F;  4LMZ A;  3NWR A;  4FDF A;  4F4K A;  1V5V A;  3TEH B;  2F1F A;  2Y3Y A;  4ED1 A;  1BE4 A;  4P7T A;  4I2P B;  4WTY A;  5DQH A;  2HVI A;  3DLJ A;  2CYY A;  4ZPD A;  3FCW A;  1HPZ A;  1LWF B;  1TUW A;  2OFG X;  5KT3 A;  1IQZ A;  2AU0 A;  4OZ2 A;  4QQB A;  2G9O A;  2XY5 A;  1SKW A;  3PIO Q;  3DMJ B;  3HZE A;  1JLQ A;  2YTC A;  3I4P A;  1F2G A;  2BKO A;  2GAH C;  1VC5 A;  4URS A;  5MAO A;  4WFY A;  3TZZ A;  4JI0 F;  1F0X A;  1UZH A;  5FLX Y;  2H5J B;  1VC6 A;  1B0V A;  2RKI A;  4MIA A;  4TU7 A;  1SC3 B;  4BLG A;  2N7C A;  1CJV A;  3CD6 S;  1XEZ A;  4HTI A;  2DIU A;  5CHC B;  3OR1 A;  4S0M A;  3H20 A;  4TQR A;  2Z2L A;  3ZFV A;  4RW4 A;  1D1U A;  1IVZ A;  2FJW A;  1PJ5 A;  4DN9 A;  3D28 A;  4I69 A;  1FJG F;  2JC0 A;  3BSN A;  1U26 A;  2MQO A;  4BS2 A;  2IA0 A;  3NS7 B;  2F7V A;  4YQW A;  4B9L A;  5EX0 A;  2OD4 A;  1JLG A;  3HSG A;  3RRH A;  4URG A;  3NCP A;  3W7B A;  4K2J A;  4UOF A;  3WC2 A;  3Q23 A;  4ZLN A;  4O44 A;  3FBE A;  1YBT A;  3QBC A;  1Z2L A;  3DLK A;  3VQT A;  1U49 A;  1BQM B;  3NGT A;  3T5K A;  2UXC J;  1FTR A;  4ZKA A;  2DH7 A;  4KV8 A;  1BGX T;  1RGV A;  4OFZ A;  2VA3 A;  5J2P A;  2F5G A;  4ECX A;  2B3T B;  4RL1 A;  2L9D A;  1MWY A;  5LXR A;  1GAO A;  2XMJ A;  2P6S A;  3CIZ A;  2KT5 A;  2DO4 A;  1XMO J;  1Q7Y T;  1FA0 A;  2AJQ A;  3B78 A;  1EAR A;  1KDN A;  2DNY A;  4KFB B;  5K8O A;  2B8Q A;  2D69 A;  3VZI A;  3PV8 A;  2R8K A;  1QDU B;  2GCF A;  3BYP A;  1S1V A;  4RNM A;  1TL7 A;  1V5I B;  2WVE A;  8ATC B;  3QYY A;  3RR8 A;  1S6Q A;  3CJK B;  2OPQ A;  3GR0 A;  1VC0 A;  2D7S A;  1EAY C;  2XSJ B;  2FJX A;  3W64 A;  1KOO A;  2PII A;  4CQ1 A;  2V4J B;  1D0E A;  1AFI A;  4I67 A;  2AJ4 A;  3HMJ G;  1NK5 A;  4QPX A;  3TO8 A;  2GQC A;  1J27 A;  4ERD A;  2VF3 A;  2MKK A;  4AFF A;  4QWA A;  1X4C A;  2LQB A;  1RU1 A;  2MJN A;  3R1H A;  2GVD A;  3M8R A;  2RU9 A;  2AQ4 A;  3GLJ A;  4U67 Q;  2CJY B;  1X5S A;  2RQ4 A;  2XY6 A;  2ERR A;  1ZTW A;  2HWH A;  1KON A;  1WKJ A;  1CUL A;  1H7X A;  2CZV C;  1GMU A;  5F8H A;  4B3O B;  1CSJ A;  1K0T A;  2KT2 A;  2EG1 A;  2RDI A;  4V19 X;  4JI8 J;  3SFG A;  3PDN A;  2JC1 A;  3GTY X;  4DR2 F;  3TVY A;  1SC1 B;  1TV6 A;  1VDH A;  3MPD A;  2VFU A;  5H9E J;  2IHR 1;  5KT2 A;  2HRT A;  5GAE I;  4DFK A;  3MCM A;  1N34 J;  5I3U B;  3SFU A;  3MD1 A;  1RLC L;  1T9W A;  2ZWP A;  2BJ8 A;  1LWE B;  3JS9 A;  2P8I A;  2GML A;  4DS5 A;  1FDN A;  2YQ3 A;  2PE8 A;  2U1A A;  4NZ7 A;  1OMS A;  1HNI B;  2YNG A;  2PEB A;  4LFC J;  4DV5 F;  1X4E A;  1M5K C;  3POT B;  4HHH A;  3NL0 A;  2ALY B;  4FNH A;  3WX8 A;  3OT9 A;  4F0K A;  2V2K A;  1N88 A;  2OEL A;  2BRL A;  4ED6 A;  3EX7 B;  2DEI A;  5DM6 Q;  4JV2 A;  1UTA A;  4DSL A;  3NGS A;  2NXN A;  5U47 A;  4KHM A;  4M8L A;  2VHG A;  3NBP B;  1S5Z A;  1Q79 A;  4DJB A;  1U7L A;  4DR7 J;  4C3K A;  1VJW A;  4MIW A;  1FKA F;  5CQG A;  1R27 B;  4WWS A;  3MAA B;  4JP8 A;  2QE5 A;  3GZ7 A;  4ZJO A;  5HQL A;  2FZK B;  3M8Z A;  1LWF A;  4EWT A;  2VPY B;  4DR3 J;  2AZ3 A;  5A8K B;  2ASJ A;  1UFW A;  4Q0B B;  2KKH A;  2B4O A;  2YBV A;  3Q24 A;  4ED7 A;  1ZET A;  3QLH B;  3DMJ A;  4NYO A;  3HFK A;  3I31 A;  3IM8 A;  8RUC A;  3MZI A;  3OL7 A;  4YEA A;  2RS2 A;  3LP1 B;  3DYA B;  4WPA A;  2E5H A;  2HND B;  3CTR A;  5FII A;  3FRZ A;  4JI6 J;  1VLO A;  1HL6 A;  4A8K A;  4UOG A;  3R5J B;  5HRO A;  3MGJ A;  3N01 A;  4X66 F;  4OYX A;  1NSP A; 
#chains in the Genus database with same CATH homology
 3Q8V A;  3ENA A;  1HIY A;  4DUT A;  1KDN A;  1MN9 A;  4FKX A;  4F4A A;  4C6A A;  3Q86 A;  1WKJ A;  3EVM A;  2BEF A;  1XIQ A;  5C7P A;  3L7U A;  2DYA A;  3ELH A;  3DKD A;  3BH6 B;  3ETM A;  3NGS A;  3BBC A;  3VGS A;  3EIC A;  1BHN A;  3BBB A;  2VU5 A;  2B8Q A;  1B4S A;  2HVE A;  1S5Z A;  1NDC A;  3B54 A;  3EVW A;  2HUR A;  1NLK L;  4UOH A;  1PAE X;  1WKK A;  2BX6 A;  1NDP A;  4S0M A;  1U8W A;  3GP9 A;  3Q8U A;  1HHQ A;  1LEO A;  1NUE A;  3FC9 A;  1F6T A;  3VGU A;  4WBF A;  4ANE A;  3NGU A;  3FKB A;  3Q89 A;  4W98 A;  3EJM A;  4FKY A;  3ZTQ A;  3MPD A;  3Q8Y A;  2CWK A;  1LWX A;  3G2X A;  1EHW A;  3B6B A;  2AZ3 A;  4DI6 A;  1NCL A;  3Q83 A;  1K44 A;  2AZ1 A;  2DXF A;  3ZTO A;  3NGR A;  1NDL A;  1BE4 A;  2ZUA A;  1BUX A;  3VGV A;  2DY9 A;  1ZS6 A;  3FBB A;  4CP5 A;  4UOF A;  4EK2 A;  3FCW A;  3DDI A;  3PJ9 A;  3ZTS A;  3JS9 A;  3VVT A;  4AND A;  1F3F A;  3FBF A;  4ENO A;  1S59 A;  1XQI A;  3FBE A;  4F36 A;  3GPA A;  5IOL A;  3BBF A;  1B99 A;  1HLW A;  3FBC A;  4HR2 A;  2B8P A;  4ANC A;  3NGT A;  1UCN A;  1NSK L;  1PKU A;  1JXV A;  1W7W A;  1NDK A;  3VVU A;  1NB2 A;  3BH7 B;  2DXD A;  5BXI A;  3VGT A;  3EM1 A;  4DZ6 A;  2NCK L;  3WX8 A;  4UOG A;  3PRV A;  3R9L A;  1NHK L;  1NSQ A;  3ZTR A;  3EMT A;  1NPK A;  1S57 A;  3EVO A;  4KPC A;  4O0N A;  1WKL A;  3FCV A;  1VYA A;  2HVD A;  3EE3 A;  2DXE A;  5CAA A;  5CAB A;  1NSP A;  3ZTP A;  1MN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...