3VVUA

Crystal structure of reconstructed bacterial ancestral ndk, bac1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
b'MERTFVMIKPDGVQRGLIGEIISRFERKGFKIVAMKLMRISQELAEKHYAEHREKPFFSGLVDFITSGPVVAMVLEGKNVVEVVRKMIGATNPKEAAPGTIRGDFGMSVGKNVIHGSDSLESAEREISLFFKDEELVEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Experimental evidence for the thermophilicity of ancestral life
pubmed doi rcsb
molecule tags Transferase
total genus 39
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3vvuA00
1VYAA 3BBBA 3Q8UA 1NDLA 2HURA 3EVMA 3EICA 4CP5A 3FKBA 4UOHA 3GPAA 3Q8VA 3NGRA 3Q8YA 3VGUA 3ZTRA 4ANCA 2NCKL 1HLWA 3VVTA 3Q83A 3ZTPA 2HVEA 3ETMA 4FKYA 5IOLA 1NSKL 3FC9A 3FCWA 1JXVA 1EHWA 1NDCA 1S5ZA 2AZ3A 1UCNA 4S0MA 3NGSA 4DI6A 3ELHA 1LEOA 2CWKA 1LWXA 3FBCA 1NSPA 4C6AA 1PKUA 2HVDA 1NUEA 3EVOA 4DZ6A 1NDPA 3R9LA 1NCLA 1HHQA 2AZ1A 3ENAA 1MN7A 1U8WA 2B8QA 2DXDA 3ZTQA 3FBFA 1WKKA 1XIQA 3EVWA 2BEFA 1KDNA 3VGTA 1W7WA 1NPKA 1WKLA 3VGSA 1NLKL 2ZUAA 2DY9A 3Q89A 1NHKL 3ZTSA 1S59A 3MPDA 1HIYA 1B99A 2VU5A 5CABA 1NSQA 4DUTA 2BX6A 3JS9A 3L7UA 1NDKA 3GP9A 3ZTOA 4O0NA 3BBFA 4ENOA 1S57A 3PRVA 1XQIA 4HR2A 3EJMA 3DKDA 3FCVA 2DXFA 1PAEX 4ANDA 1NB2A 3FBEA 1MN9A 3BH7B 5CAAA 1B4SA 1WKJA 4ANEA 5C7PA 1BE4A 3Q86A 2B8PA 3VGVA 4KPCA 3EMTA 4F4AA 4UOFA 3B54A 3NGUA 1BUXA 3EE3A 3PJ9A 3BH6B 1F6TA 1K44A 3EM1A 4WBFA 4W98A 4F36A 1F3FA 4UOGA 3VVUA 3B6BA 2DXEA 1ZS6A 2DYAA 3G2XA 3FBBA 1BHNA 3WX8A 3BBCA 4EK2A 5BXIA 3DDIA 4FKXA 3NGTA
chains in the Genus database with same CATH superfamily
1BQMA 4LR8A 4N8NA 1I51B 2WOMB 5ADZA 2PGCA 3LP2B 3LAMA 4RZRA 1TU0B 2U2FA 4FYYB 5KFDA 3RGIA 2CQPA 3HD1A 1FK9A 2DY1A 1XJWB 2XEXA 2J9EA 2UXBF 3VHQA 2OSQA 2HZAA 3HX9A 2HFZA 2UU9F 2DNPA 1NSPA 1AZSA 1NHUA 4NXMF 1CPZA 1PO6A 2EI5A 1NDPA 1IKYB 4P52A 5KT3A 3TYTA 4URQU 2MZSA 2I6WA 2GZOA 2BEFA 4KY3A 2JC0A 1EKRA 4IRCA 1X31C 1X4AA 4ZK7M 1S59A 4TU8A 1ZBTA 2CVIA 2LA4A 4CLLA 3MXHP 2UUAJ 5M2UA 2P6TA 2ZE2A 1KOOA 2DHAA 4F4KA 2ZITA 3TJ9A 4HDHA 2W25A 4EWTA 3IM8A 4KPCA 3KJNB 4F4AA 4CH1A 4ER8A 1N48A 2ZH9A 1VC6A 3QPIA 2DNOA 3VWSA 1B70B 3CC7S 4QR2A 4UOGA 2J8AA 2Y1RI 3I5AA 2QG9B 3M8PA 3TEHB 2BANB 3I9V9 4C2MA 1TP7A 3H5XA 2UUBJ 3CMQA 2GV1A 3SI8A 3ZZTA 2PC6A 1ZM9A 2JJ4D 3KLFB 4KHPF 1TAUA 3J7ZT 2HQGA 2AGPA 2V2ZA 5A76A 4OX9J 3G6XA 1NCLA 1RA7A 2EBEA 2UVUA 4ZS6A 3RUBL 1JXEA 2BQUA 4H4KC 2CQCA 3K5MA 1NPKA 1FJCA 5F41A 2MQOA 1HI8A 2BKOA 5T7LB 3LGHA 1GMVA 1CS4A 2DNYA 2ZEJA 3CCWA 4EZ9A 1HYSB 3CWJA 3RRKA 2IA0A 2XNQA 3OXFA 2WW4A 3NS7B 2ZDPA 4MMOA 2GA7A 2RDIA 2ZVIA 4Q0BB 3Q8QB 3M9OB 4ECWA 1FCAA 1AZSB 2CQHA 1OY9A 5KFNA 3VGUA 2DRBA 3N4WA 2BJ7A 3D3CJ 3FC9A 2V8DA 1R0AA 1JXVA 2CUYA 3FQKA 4OJ1A 2R7VA 3W2VA 2VD3A 1Y4ZB 2CJQA 3OFEA 1FA0A 1FX4A 4NLXA 2J9CA 3M6UA 3D0GE 2NPIA 5ETMA 3TJ8A 2R4FA 4CT8A 3POTB 5DDPC 1LW2A 4CH0S 1NLKL 2VG6A 5L9NA 4DX8H 1FRJA 2M52A 3G8TA 4M63A 4ECSA 2B4OA 2IMOA 2F9DA 5E3PA 4ZVOB 5KFWA 2YQ1A 1XK8A 4EZ6A 1NU4A 2PA8D 5F8IA 1W2BR 4A8OA 2RILA 4RW4B 2I2YA 3TA0A 2RHSB 3OHAA 1TKTA 3E2EA 1C1CA 3BH6B 4OYPA 2AYMA 2EKYA 2LQBA 4OZ1A 3NGTA 3U02A 3BBBA 2OEMA 2NXUA 1T7PA 3TOQA 3EVMA 3MPWA 3VAHA 1KRPA 4DN0A 3NGKA 1RWUA 2VG7A 3CO0P 4W92B 4MKVA 3TEGA 3OTDA 3H5YA 2NREA 1K8AT 3LUYA 1FXRA 1VR6A 4JI4J 4Y2AA 2Y0BB 3D3BJ 2VFRA 3FRYA 5AJ3F 2CQDA 3HFVA 1C4AA 4LVOP 3PJWA 3D1HA 3HK2A 3KK3A 5KFMA 1J5EJ 1VJQA 3R7BB 3EZ5A 3DRXA 2LEPA 5KFRA 4LRBA 2C2RA 4DV1F 3NXZA 4ZVTB 2KM8C 4M5DA 2E7VA 3UPFA 3T5HA 5KFEA 1TKDA 3KLIA 2QA4S 4NCGB 4FF3A 1UKUA 4ED0A 3TX8A 4BC7A 5B0DA 1QY7A 2FC9A 3MTKA 2R8JA 3BR9A 2PEHA 2ZFHA 3FEYB 3BPDA 1F6TA 4WBFA 2QL9B 2OFGX 3ET6A 4P6QA 1Q95G 2AW0A 2J6TA 4F50A 4OL8A 1FDBA 2VASA 5E3QA 1WNEA 4C0BA 1RLCL 4LR9A 4LF4J 5F9LA 2KB2A 3UNYA 3M6VA 4Y3CA 2UU9J 3ZFVA 3CD7A 1R8CA 2DTJA 2AQ4A 1B0VA 1R7IA 1YDLA 1RAAB 4UY8T 5D0GA 4QOTA 4HYKA 3GLJA 1UVIA 2F8EX 2CQ0A 4PAAA 2FDNA 4DV5J 2D3UA 5GAHU 4R8UB 4RWWA 3ZZ0A 5CYMB 5K14B 2V4QA 2WZ1A 4JI0F 3OL9A 4TQSA 1OIAA 4P2SA 3NRBA 1WG5A 2F4FA 4CM0A 4U96A 2W4PA 2KHDA 4NL5A 5GADU 5F8MA 2HS0A 3KUEA 1BY9A 3BSAA 2B8PA 1RWOB 3N01A 4LSZB 2KHCA 1IBMJ 1K44A 1YG0A 2EC2A 4ZN1A 3CIZA 3NP5A 2ROGA 1UW9A 3FGVA 4HTJA 1RT6A 3AD9C 1N6QB 1TFWA 2FQQB 2KXFA 3CGIA 3EX7B 4DV4J 2PA3A 3KK3B 2B51A 4OQJA 5HATA 4CNYA 2XZWA 1CJUA 1XERA 4DL2A 4Z7CA 4DMZA 1GTEA 3D9BA 4DQRA 4M5DB 1EQMA 1JK9B 1T0TV 2VPYB 4ZIWA 4ECZA 2HGNA 2YKMB 4KIAA 1WG1A 2GCFA 3HVWA 1FWLA 3O1LA 2NYIA 5A8RA 2X1GA 3C6TB 3BDEA 2SXLA 3WDOA 1V9OA 5AT1B 4DV3J 1R6YA 5KT2A 5D4LA 2VB6A 2GVZA 4DUYJ 2LQ5A 4RW7A 2HGLA 4X66F 4J9NA 1KQKA 4FS2A 1YK9A 3IRWP 1ZA2B 2DR5A 4E0DA 4MK7A 3M32B 2BXJA 1C1BB 3LF0A 2FYXA 4Y2KA 1HBNA 3CMAS 3BDPA 3KLEA 4U7UD 2QN6B 5C24B 1H2VZ 5LMUF 2DNQA 2DNNA 5GVQA 3Q8YA 2ATLA 4EEYA 3Q0AA 2V5HG 2EEYA 4DV6F 2ZH7A 1SKRA 2B5JA 3D6FB 4X4UA 2IYGA 1YWXA 4JI7J 5F8NA 1MMDA 3R8YA 4IRKA 4LF8J 2J7KA 2CPDA 1ZPVA 2B3TB 3CD0A 8ATCB 1S9EB 5HBMA 1G2EA 1UVLA 4IDKA 1PSDA 4MKYA 2DIUA 4K4XA 1VRUA 3CCQS 2DY9A 4ECXA 2A10A 1UFWA 2CQIA 3KNGA 3R2DJ 2BOPA 2GJFA 2X3DA 4ZN3A 1X4EA 5KFSA 1RB0A 1RUSA 3B54A 3PY8A 3BR8A 4FN5A 1J5OA 1JJCB 5F0WA 4RL1A 4DXLA 4F2SA 2IHR1 2ZD1B 2WB1D 3CJ4A 3MPVA 4TY8A 3H7HB 4JV1A 5HI7A 5HANA 2HHTA 1U1PA 2JEFA 2RT3A 1S7IA 3CT9A 5A8RB 3FEZA 5AJ3J 3QJPA 3CVKA 1RWVB 2X51A 4RBTA 2W2PP 2HRYA 3O6QA 1FWKA 2GVZB 1FKOA 4RW7B 2GQCA 3PHTA 3HO1A 3OTOJ 1XR7A 2BVZA 4CLZA 4LSNA 1YHQS 5DM7Q 4C3KA 3M7VA 2OPQB 4FXDA 1F9FA 2AMCB 2ASDA 3WZ0A 5HSPA 3FJ2A 5F8HA 1NZAA 1HPZA 4XAKA 3GR1A 1JLBB 2VBYA 3MMBB 1JX4A 1HBNB 4AYBD 5L1LA 3GFHA 2F4VF 3QJJA 3SZ2A 4B3SJ 2HBYB 4F3MA 3W8GA 2B4UA 2LEAA 3BO4A 1RI7A 3NAHA 5HROA 4K4UA 3PZPA 3DLLQ 4G3IA 2B5JB 1NKCA 3I0SB 4TLRA 3D1QA 3WX8A 3ETOA 3ZZUA 3ILJA 5HBMB 5B0EA 4IDKB 4DV2J 3DGPA 2DNGA 1VRUB 3CCSS 1FHTA 5A8WA 3W66A 2MKYA 1N8RT 5A0YA 4G1QB 1FFSB 1UFLA 1HQEA 4DCOB 1P1TA 4UZBA 3C14A 3KLHA 2CADA 2E29A 2IVYA 3OR2A 1P27B 3ZZPA 4KAIA 1NK0A 1H2UX 1U02A 4DS4A 1REGX 1FWPA 5EX0A 4ZVPB 1P9QC 4FYDA 5M2PA 2E1MC 3B4MA 2L9DA 2W1BA 2B7BB 4J9RA 2ZOGA 4DOZA 4TY8B 1WSVA 2HQ3A 4KGKA 5SZTA 3HKWA 1PILA 5KFXA 3TVYA 3HHKA 3EM1A 3HDSA 3I0RA 3DRYA 2KYZA 1YJRA 1SC6A 1FKOB 4ZLPA 5CYQA 2CQBA 2W9CA 1G1XA 3SCIE 4LSNB 1YRUA 4IH5A 5B0BA 2E1CA 2I1RA 4U8VA 4DWIA 1FKAF 1X4CA 2AEMA 2DEJA 2RS8A 3W2WB 3GIRA 4LF7F 4J9UE 2YTCA 2W7OA 2E1PA 3C66A 4DCPB 2DRAA 5HMXA 4DR6J 2BABA 4RX6A 3K8WA 3NY0A 2BKPA 4M5GA 2Q43A 2MKSA 4RWXA 1V5VA 3PRBA 1E6VA 2J7WA 3KYLA 4RO0A 2IBKA 2Y0SD 4WYWA 4DUTA 2EBGA 2L3MA 1SL1A 3A3OB 5HP1A 3A8EA 4IQMA 1WOPA 3I56S 2VFTA 2ZVSA 4C8KA 4KHMA 1U25A 1RBOB 4RR5A 3IRXA 2CQGA 4PXCA 2ZH3A 4HHUA 1W2IA 2F9JA 4EBDA 3EE3A 2YXLA 4NA2A 1TZ0A 3DOMB 3I31A 1N4LA 1WG4A 1XWLA 2FHOB 1M5OC 2NXCA 4ZPWR 2XMVA 4PR6A 5HMZA 3BYPA 1HQEB 5B09A 4RW6A 5LL6d 3OR2B 3E51A 2QFJA 2XHCA 3MMCA 3RBEA 2RMLA 2R2SA 3NCQA 3T9NA 4B3RF 2ACYA 1KLNA 4DV7J 2P9CA 4YY3J 3IFEA 4M95A 3U1MA 4AE5A 5MLCV 1IUJA 1SL2A 1RBLA 5JUMA 3PW7A 3T9ZA 3PVXA 4LRFA 2ZC4A 2XMAA 3L7UA 4OV6A 3T6BA 5HVHA 4OHXA 2VZ9A 1RSCA 2N7YA 4Q44A 3MF5A 4YB5A 5EN1A 3AQOA 3SMZA 3DHXA 2W9CB 1DTQB 1U45A 2CPIA 4OHZA 4PG4A 4C3LA 5C25A 5I42A 3RW6A 3MCMA 3QWPA 5E5NA 1U2CA 3HKZD 1F5CA 2MPUA 1RTDA 4Y6IA 4QPTA 5DQIA 2B56A 4J7CA 1VK8A 3DRRB 2ZWOA 4UOHA 1PBAA 2VA2A 4X4VA 4F4XA 2VC0A 1AFJA 5U47A 2CWXA 2OUGA 4NLVA 3G87A 2BQRA 2UVVA 2BE2A 1VQLS 1FD8A 1BQNB 2HLTA 2VQEF 2A0FB 4IFYB 1E6VB 2RUSA 4F04B 4C8MA 2UXCJ 3MUTP 1JLAA 3OJSA 2QLXA 4PYDA 4ZPBA 4MFBB 2XY5A 3TUPA 1UPPA 4ECUA 2W2MP 3CJRA 4DQPA 3MM8A 1WKLA 2Y3YA 3V5RA 2RE1A 3A8JA 5BR8F 1X7VA 3TAPA 3H4BA 3MOZA 3ZNUA 1UEUA 1S1WA 3CCRS 1X9MA 2OH2A 1DLOA 2DHSA 1N88A 4RW6B 5KFUA 5D15A 2ASYA 1AUSL 3Q8PB 2QFIA 2VL1A 3HHDA 4I68A 2C2EA 5DQGA 3MMCB 3JTPA 4M5NA 3TWZA 2YKNB 4I6AA 4RNHA 2BRKA 3A4TA 3L3CA 2BJ8A 4NLSA 5HLFA 3CNQP 4X64F 4YDXA 4WFZA 1SC4B 3W63A 3LP0A 2YBVA 3NGSA 2QMUB 3PX4A 2H54B 3VAJA 3MDFA 3ILIA 3UQSA 3QGHA 4ZJLA 4DSLA 3NNAA 5IFMA 3ZTQA 2ROEA 3TRGA 4Q8FA 2J0QD 1L5UA 4IUFA 4WXWA 3FMBA 3L95X 4EUVA 1AB8A 3R5BA 2OPSA 5C25B 1SUQB 3SQOP 3Q23A 2M4MA 1RT5A 1H74A 1RADB 2BV3A 4AUKA 3KUHA 4ECYA 4UOFA 4Y34A 3JSMB 4GVBA 5D0HA 4X4TA 3GQCA 1A9NB 2K1RA 4BWJA 4ZKAA 2VQFF 1FX2A 1JLAB 4J5OA 4RW8B 4JI3F 1FXDA 1R31A 1X4BA 3JSYA 3HZGA 4LF7J 4N8OA 1QLNA 1D1UA 3OV7A 4ED3A 4DLEA 2IRYA 3DRPB 5A6WA 3G8SA 4RNMA 1KEKA 3W3SA 3HVRA 1F9EB 3BSOA 3SCKE 1S1WB 3B8HA 2FJDB 3BGUA 4R5PB 1FFWB 1XTZA 1J27A 3AD7C 3MR6A 2MHEA 4GRSA 1IWGA 1V5IB 2YX4A 3MURP 4ZCKA 1XEZA 3HP6A 5KT7A 4DU8A 3R7SB 3THVA 3EXCX 4DPXA 5HLFB 4B9NA 3CCES 2CQ4A 3TNVA 3CE8A 1UWAA 3LP0B 4NMLA 2KXNB 4ID5A 3J81j 3BN7A 4KE5A 1M0SA 1N56A 2QYGA 3UVJB 2Y8WA 3WX4A 1ZZNA 5E33A 4DSEA 2HGMA 1VBYA 1MWZA 3PYDA 2HVEA 4XO0A 4RUCA 4HEA9 2RHQB 3MCSA 2GW8A 2OPSB 1L3VA 2DVIA 4USUA 1FXLA 4F67A 3M8YA 2YX7A 1KR4A 4DL0C 3KOAA 1I3OB 4JB8B 2VBXA 4FVCA 2YNHA 2ERRA 3MMAB 1HWUA 4DEZA 1TVRB 1RT1B 4P2XA 3BSCA 4O0NA 5KFYA 3TANA 3PRVA 1Z1ZA 2I8EA 4DR3F 1SH3A 2ALZA 3OSPA 1ZTWA 3K5PA 2NSCA 3DOKB 4QBUA 1SI9A 2EFQA 2I5JA 1LFWA 3PJ9A 4OFZA 4U7CA 5KT5A 4DQQA 5KFIA 2OMOA 5IWAJ 2RU9A 2KG0A 3IS9B 1HL6A 4F8RA 4Q7AA 4N5SA 4BC9A 4KTQA 4YB7A 5IQQA 3T1YJ 1HBUA 3MECA 4OJ3A 4FPIA 4BS2A 4LRAA 1DTTA 5CA5A 3VAFA 2JSXA 3OLBA 4OYBA 2K3IA 3D68A 5BR8J 1M1HA 1JQGA 2MXYA 2JLFA 3G6ES 2B9YA 3W5YA 2XSJB 5HMYA 2CZ9A 5DJBA 4HTIA 4B9VA 4L3NA 1V3SA 2C28A 3EXYA 5BYQA 4RNNA 4KO0B 1Q53A 4C4WA 5CAAA 4O0IA 4LUBA 3I5CA 3EZUA 1IQZA 1V3RA 1IKVB 4FXWA 4A8MP 5LSRA 2MEWA 4PPDA 4PABA 4YS2A 1S99A 4RU9A 1U0HB 2D74B 3J7Z5 1UA0A 4C98A 2QRRA 2VDHA 1UVKA 1QAIA 1RT2A 5K5MA 4ILLA 4ZPVR 4NX9A 3HULA 1ZAVA 2BKNA 4USVA 2QSWA 3ITHB 3V4IA 3C46A 1UAWA 4X4SA 3T5KA 2QTWA 5DS7A 1KS2A 1X9SA 3WQPA 4FYWB 1IWAA 2LYVA 3S8SA 2DCUB 3JYTA 2ZWPA 3W9HA 1QE1A 2D7SA 5IV3A 1HBMA 3MPDA 2HHPA 5CABA 3GSDA 3HM9A 3AA8A 4DFPA 2V50A 1X5OA 2MGZA 1VJWA 4DG1B 4B3TF 2R7WA 1U1MA 3EJMA 3KHGA 2JRSA 1NJIT 3IWXA 3W64A 3I96A 2AP6A 2ZBIA 6FDRA 1N33F 2VQFJ 2WONB 4P9SA 3SYZA 4UT4A 4XPCA 3PYGA 5B0AA 2QYCA 2IM3A 3MECB 3HI9A 3R5AA 1DTTB 3GPAA 2ZUGA 4DV0F 2FZKB 1R8PA 5IC4B 1E6YB 1TR0A 1XMOF 4DR4F 4ZPTR 3CCVS 4RUBA 1H6KX 4Q43A 3P4UB 2DNZA 4YDDB 5KG1A 4JI8F 2HVIA 4NLQA 2NQPA 1GEHA 2J6UA 3LP1A 3EGVA 4K4ZA 3R5JB 3BQ1A 2GMJA 1I94J 2I9SA 5D6GA 5I3QA 2Q79A 1U6BA 2HVHA 3U7JA 1S6QA 4DR7F 4DUZJ 4F3OA 1MWYA 8AT1B 5FIIA 2AV5A 3RR8A 2BX6A 1PGZA 2OFHX 5D3GA 1QUVA 2Z57B 3L09A 4L75A 3D6HB 1NPRA 1S6OA 4M5LA 2QLJB 1ZH5A 1RT2B 4WF9Q 1TUVA 4CO0A 3PX6A 3IXQA 3V4IB 3VAMA 4TLQA 3EYZA 3HXMA 3U27A 3M4XA 4DSKA 2XMMA 4CO4A 2C2KB 2AT1B 1URRA 2W24A 2W7AA 5E3AA 1NK9A 3FQLA 1TV6B 4DHVA 1NH7A 1LWCA 1O6XA 3JYTB 2DHGA 5A8KB 3JAMY 2M88A 4LJMA 2RAQA 1U4BA 3PR5B 3IWNC 1RAJA 3DFEA 3H25A 4P72A 1TL3A 3I5BA 2CNOB 4N77A 1U1RA 4V19J 4KKOA 3SDEB 3OVSA 4JV5J 4I0WA 2VFVA 2GJIA 3CD5A 2Z0GA 4DR3J 4WU3A 2C2OB 2YWFA 2DISA 4F2RA 5IQ6A 2ZZTA 4A8XA 1X0FA 3CDBA 3AA9A 3E01A 2JEGA 3F56A 2HW3A 1TAQA 1KQGB 1SJQA 4LF6F 1S79A 2W01A 2DGXA 3CD6S 2CG8A 4RBVA 1RT4B 1NKBA 4UY85 2YQ0A 3B6BA 1N54B 4J9VA 2XI3A 1GMWD 2Z8QA 4Z37A 1N32J 1VYAA 3P5TL 3EDQB 2E9ZA 2HHXA 4ED6A 1H38A 1JJ4A 2MLYA 2ZBRA 4ES1A 4LF1A 2PN6A 1KN6A 3W9IA 2UUCF 2N4DA 3HF5A 4ZHRB 3VQSA 2HFSA 3M2VB 1FRIA 2NUUG 1RHKB 3BKUA 4FBUA 2NYHA 2ALYB 5D3GB 2OPPA 4FNHA 2HFOA 3C19A 2AZ1A 3HT0A 1HI0P 1JLGB 4OZ5A 3MEGA 4USMA 5HAOA 5IS2A 1T95A 1XMQJ 3KFWX 3RYLA 3NWGA 3KXDA 3KJFB 2HRUA 2G2OA 1R0CB 3CJ8A 3I6PA 1C2PA 1RWMB 1FNXH 4B9TA 1IBLF 2VG5A 4LIRA 3OTEA 4N56A 3FCVA 4HL9A 1LWCB 2HMIA 3L9ZA 9ATCB 1N36J 3GV7B 1LK5A 4I56A 4YHHJ 3OL6A 1M90T 2KVIA 5H9FK 2HHVA 1TL3B 3Q8SB 1EQ0A 2F8MA 4F4ZA 3MM9A 3CJKB 4KKOB 1JLFA 2DGTA 3DLHA 1BWEA 1G4CA 4H4OB 4MH8A 3Q83A 1Q86T 4FKYA 2MZ1A 1HBOA 2JDJA 1OO0B 1DZ5A 3A8KA 2V63A 2R2RA 4Q45A 5J2NA 2MKCA 4QIGA 1TKXA 2MY8A 4XDCA 1H3DA 1UWBA 4OIXA 3E01B 3HSGA 1QTNB 1B0PA 4HI2A 4ZLLA 5J2QA 4JOUA 1RTHB 3UW1A 1WC0A 2OTJS 3BF4A 1FFGB 1N33J 4KB7A 4WU2A 3NOGA 4CTAA 3L7OA 1VBZA 4LFCF 1VQMS 2IM0A 4KSEB 1WHYA 4JV0A 3CDEA 1LW0A 3MM5A 5ETLA 4YB1P 5FD1A 4DX7A 3KKFA 1A7GE 1KVIA 1Y10A 2IC3B 3MHYA 2K3KA 2K7JA 1HI1A 2OPPB 4CLPA 5DGAA 2MQNA 5ETRA 2J76E 4IFVB 1CQMA 2MQ8A 4JI8J 4IO9Q 4DDFA 1RKJA 1EETB 3V6DA 3K5NA 4YR2A 5KOXA 4KHRA 1HW8A 4WIQA 2HNYB 2CPFA 1F2HA 3VTIA 2FJBB 4DR1F 1JJ2R 1RHRB 2JL9A 4J9LA 1TL7B 2HMIB 2FTRA 3FK4A 2QL7B 5KG3A 4QU7A 4OI0A 1WTFA 5GAEI 3U1NA 3R5GA 1Y7PA 1RTZA 2W4DA 1ITPA 3ILOA 4UQGA 1Q4RA 4OI2A 1GNKA 5ETVA 3MM9B 3P6YC 4IOCQ 1JLFB 2ADBA 4C9DA 1DQ8A 2P9GA 1IR0A 3D7SB 4WKYA 5B08A 2FPHX 5KFJA 2HFUA 2E5LF 1Q78A 2FLOA 4F02A 1LXJA 4K59A 4O3PA 3M8ZA 5J2NB 4FBTA 4LQ3A 3BGOP 2NXEA 4WTYA 4A47A 1AROP 4ANCA 1UWBB 1VS3A 1M5HA 1UFKA 3RBZA 2KT5A 2QA2A 5KFCA 2O3DA 3IAS9 2V2KA 4LQ9A 2ZBCA 1Y5IB 1M1GA 2KTQA 2EPIA 3QT5A 4ZCLA 2QMWA 1NPPA 2QLBB 2HFVA 4PEOA 3Q22A 3DOLB 4O3RA 5F3TA 4K0KF 4O23A 2RJZA 1CC7A 2WVBA 3GB0A 4JI5J 2PI5A 4CLUA 1QSSA 2FHJD 2CVEA 3M9MB 4LF6J 1S1UA 1VOMA 2YWEA 3AD8C 3R5DA 2MB0B 1JXLA 1HNXJ 2DB1A 4A8FA 3UN2A 3GCWP 4ED4A 1JWWA 1WACA 3V6JA 3H59A 1EP4A 1HKAA 3LQVA 4D3HA 2HNZB 4P7VA 4OHWA 3OD2A 5LMNJ 3S7RA 3DYAA 1RGVA 2VC1A 2VHGA 4I2QA 3ZTPA 1Z2LA 3O5TB 2IAJA 3NEKA 2XYGB 3DGVA 4JI1J 2VDIA 4F4YA 3T1HJ 3PW4A 1F2GA 2HVDA 4KV8B 4RNFA 2GMLA 2BBEA 2JVRA 3PW2A 2COLA 2ZJPQ 2W9BA 4U8YA 2CG4A 5C5JA 4RU2A 4NOHA 4HT7A 3MD1A 1RTIA 3VALA 2MZRA 2UUAF 3V6KA 4PWDA 4KH1B 1QM9A 3D5MA 4CYUA 1SXLA 3NL0A 2CZ4A 3CCLS 2Q1LA 1XQIA 3M2UB 4ICLB 3GFZA 4ES3A 1RTJA 1FEEA 2R3VA 4YQWA 3VAIA 4AL6A 3PEHA 2AEJA 2FZCB 2YKQA 3UDCA 3Q8RB 4IR1A 1LWFA 5KFZA 2UUBF 1CG2A 1CJKA 4WFYA 1G7CB 1VCTA 3FDSA 4O4GB 4CO2A 2GO9A 3QGIA 3QRRA 4KC5A 3R5CA 2EFPA 4X62J 2BUNA 4K4WA 2ZH2A 1HWJA 4R0EA 5K8NA 1NHVA 5K9FA 1YIJS 1REVA 4HKQA 4OX9F 2JEJA 3PCOB 4UOCA 2AYBA 2AJ0A 1DBDA 2VH7A 3IMQJ 3RAMA 3KJVA 1V6HA 1EARA 2V2VA 1RU1A 2N4CA 1RHUB 4ZPCA 3HSDA 2Z2LA 1XIQA 3C3LA 4MIWA 4C0OC 2UV8G 3JQJA 4URGA 5KG4A 2FLPA 3C16A 3K17A 4LFCJ 1EP4B 2IFXA 3K5LA 2PEBA 4O44A 4QPXA 4PUOA 3M30A 3UN5A 1SJ4P 2HZVA 4EO6A 3C6UA 3MM6A 2DH8A 3T5JA 3GV5B 1LNQA 3DKDA 4RUAA 2OJ3A 4FYVB 3W1YC 2J5AA 4M1KA 1JKHA 2WVEA 2NZCA 3H98A 4DL7A 3AJ1A 2IAJB 3TZYA 1S72S 3WIUA 1EJ7L 2AWZA 5BXIA 3N6MA 5J2MA 3FFIA 4QWCA 4NMXA 4PXBA 3CJ0A 2AYEA 2HWTA 5KFHA 3ZZRA 4KPYA 1HLWA 2CPXA 1CC8A 1WHVA 1SKUB 1HMVA 3G9CA 3MEDA 4PWDB 1RXOB 2Y9HA 4OV1A 2XGQA 1NZ8A 3PV8A 4ELTA 4QR1A 3FUYA 1JNZB 3CC2S 4MYUA 2IM2A 1WC3A 4B3MJ 5L1IA 2GAGC 1RTJB 2HWIA 2O5DA 2DGVA 3GYGA 4R0JA 4KGXB 4OX7A 1B7YB 2CQ3A 2E5IA 4FF1A 2RUGA 5C2CA 1H72C 1NM2A 3CO9A 2ZH8A 1AFIA 1CJKB 1HR0J 3QIPA 2ZHAA 4DSFA 2A1BA 2BJ9A 2H5EA 5T14A 3H5SA 5D4OA 1TK8A 5DM6Q 3KTQA 2ACMA 1OQ3A 2VIHA 1U6ZA 1REVB 4PYAA 4C11A 1DHMA 2VF3A 3QRQA 4WPAA 3TR5A 1SCJB 4JI4F 4EBEA 3BKFA 2EW9A 3K58A 4ED1A 3FCWA 2QA4G 1NK6A 3IWLA 4HH0A 4CO5A 3GYNA 5C42A 1J5EF 1SBRA 3HFZB 1HNIA 4KRWA 4C6AA 3M30B 2HBZB 3DLBA 3LTOA 5CHCB 3S6EA 1RACB 1FDDA 2LMIA 2APOA 1RT7B 4J9PA 2DXDA 3WIVA 4KGZB 2HRTA 3MEEA 2RS2A 3G82B 4DPWA 4JYAJ 1JKHB 3F44A 2ZUAA 3CJ2A 3TQEA 4JI6J 3QYYA 2JNJA 4HDGA 1OYEA 1TL1A 3FFIB 3LANA 3DMJB 1S48A 5KFGA 2LA6A 3FBEA 3FVYA 2LFVA 2R7QA 3C15A 4KQZA 1QVFR 3P3DA 2HHSA 3PFOA 3QT6A 2HIQA 3M1VA 4B17A 4LF4F 2P6SA 1DARA 1HMVB 2YH1A 4B3OA 1L3TA 1QUPA 1FTCA 5BJRA 4UF4A 5GAHI 3GIKA 3O3LA 4C8YA 3PR4A 3GG1A 3ZZYA 3VVTA 5EUHA 2CPEA 3D4JA 4ELUA 4CLWA 2FJWA 2AYGA 4DV5F 3OJUA 3HMJG 3P49B 5GADI 1H2TZ 3PHEA 4OZ2A 2J7UA 4ZP8A 1TKZA 1TL5A 2CA9A 3EDRB 1N34J 3MAAA 3M05A 3OL8A 3A3NB 1S1TA 3KK1A 1YITS 3MR3A 3Q24A 4ZITA 4YN3B 1NHKL 5IM0B 3TAMA 3GP9A 2GMHA 2KXHA 3U1LA 1DQAA 1IBMF 4XPEA 4DCJB 1N5YA 1QJHA 4NYOA 2BJEA 2AX1A 2UVWA 3GJTB 4FPRA 4YR0A 4OHYA 2XS7A 2WSCC 1GX5A 4DV4F 4QW8A 2YNGB 2Z30B 5FDLA 5C42B 2RF2B 4PQUA 2D1CA 4BCAA 2LECA 2GJ2A 1X0PA 2H3EB 2C3MA 1UEKA 1T3OA 5B0GA 4NA1A 1CSJA 2X1FA 4LT6A 2PMWA 1SQGA 3MEEB 1YLXA 1CEZA 1MSWD 1T03A 2MKIA 4FVMA 1MU2B 2MKJA 2K8GA 2G1DA 3MFIA 4ZLNA 1TL1B 1HHQA 4HACA 2YNFA 4DV3F 3J7YU 1PAUB 4DUYF 4DR5F 1BQMB 3EUNA 3C15B 3SV4A 2YWWA 3DI6A 2VPZB 4YP3A 4KFBA 4CLKA 4X65F 3M1VB 2ZHOA 1QTMA 1FK9B 2HAIA 2MKHA 3IR5B 4B3OB 4PRFA 3QBCA 1EB0A 2F63A 4C8LA 1UVJA 3ISNC 3VQTA 5IZHA 1FJ7A 1EZZB 4DFKA 3HCXA 2XYPB 2JWNA 5D0RA 3VVUA 1ZS6A 4CWBA 2MTLA 2FD2A 3CDWA 3DDIA 4AQYJ 3MR7A 4P10A 4RBUA 2VJVA 2FVCA 3KHRA 1KP6A 3EGZA 2BA9A 5H9EK 4JI7F 3PXGa 2AHOB 2ZE2B 3TA1A 2VPXB 1RAOA 3EGWB 4LF8F 1Y5NB 4MKAA 3IR6B 3KDNA 4IO1A 1SPBP 5M2RA 1YJUA 4BWMA 4QYZK 3BB5A 2FVRA 4LF9J 3CUNA 3CJ5A 2EG1A 2JFKA 2GGPA 2BQ3A 3M8PB 5K8OA 4NZ6A 1RZMA 1UZDA 3R6LB 4XTTA 2FUG9 2DKOB 4CLYA 1RT3A 3CSKA 5LM7E 3QO9A 4KGVB 4ILMA 2HPUA 4K2JA 4DX5A 1RCXB 3ENVA 5EWEA 1X5TA 2XZTB 3OTCA 1Q8LA 5F8LA 1HD0A 4DR2J 3OLAA 4PXEA 2LKZA 2V6AA 5D4PA 3Q8UA 4NLYA 3RJMB 4X4RA 3ADAC 2FJAB 1CS4B 1VQ8S 3ZZOA 1WD6A 3X3UA 4WIIA 5DQHA 4CRJA 1Y11A 3F73A 2RVJA 1S6UA 3SQGA 3DI6B 3OTOF 3LALA 4AL5A 3EVOA 5HMWA 3GJQB 4DS5A 4TU9A 2Z4PA 2QX0A 4YR3A 2RQKA 1XR6A 4OX8A 2V4JA 1HQUA 4IH7A 3MWBA 2YNIA 3D0HE 2X1BA 4B3SF 2NPFA 4ETXA 3MOJB 2LP4A 5KOWA 2MQPA 1R0AB 3W2VB 5IT9Y 2EFGA 4NRTA 1SB6A 2NXJA 3UCGA 1CJTA 2IDLA 3N6LA 4I7FA 1ZZFA 4Y28C 3KNAA 1M1KT 1U26A 2HYIB 3M8QA 5CD4H 4J9SA 1LW2B 3T41A 3M6XA 2VG6B 2ZHBA 4DV2F 5IC6B 1KTVA 2DNLA 1M5SA 1WC4A 1U1LA 1YRTA 2OELA 2LLZA 2ZZNA 2YVSA 3MUVP 3PKMA 3D28A 4MIBA 4UZCA 3RRGA 1SJ3P 1TKTB 4X2BA 2R7RA 1C1CB 1H73A 1U1QA 3QO9B 1FRXA 2KU7A 4OYIA 2V8GA 3JQMA 1JLCA 3QGPA 1JIHA 4U7UK 4QZVB 2G2ZA 2QV6A 3FRZA 1IJFB 4L6V3 2VG7B 4TY9A 2ILZA 4IOAQ 2B6AA 2B9XA 4A8KA 2L9NA 2RQCA 3ENQA 5J1NA 2W2QP 3T3FA 3N79A 2C3UA 2MQLA 3KHLA 3OUYA 1WDDA 4I67A 2MSTA 1I5OB 1HA1A 1IBKJ 3H2LA 3TQ1A 1U7LA 4YFUA 4NLGA 1ZOTA 3SFGA 1S1XA 2V8HA 3HT3A 4FKXA 1Y0HA 1S0OA 1PG5B 3EICA 3M8RA 1UL3A 2W7PA 4LFBJ 3KLIB 3SCLE 2H5IB 1RWPB 1O51A 3ETMA 2CPJA 3NWRA 1DURA 4A8YA 2EFOA 1Z2ZA 3HVTA 3CMES 1W26A 2V4JB 1HQUB 3DLGA 1F60B 4DR5J 1CLFA 4DR6F 5LJ5Y 5EWFA 4NRUA 2CNLB 3ET6B 1ZM4A 3R3TA 2XO6A 3A12A 2FLNA 1P9YA 3FBFA 2PMHA 4XIUA 4X65J 1CJTB 4WFAQ 4ZVGA 4I2PA 4WE1A 4R25A 2XCAA 1PYOB 4P73A 3W61A 3M8SA 1NDKA 3M8QB 1WI8A 4C3MA 4WFBQ 2LCWA 2VFUA 3JSBA 5EX3A 2CQ2A 1U1OA 2R8IA 3O8WA 1RAGB 4CM2A 5CZVA 3R7NB 2XLKA 2DR9A 2OEJA 3IR7B 1S1VA 3VZHA 2DPJA 3KG4A 3WHIA 3TUJC 1PJ5A 3OXLA 1UJ4A 3W60A 4FZVA 3GSIA 1VQYA 2IJRA 3NMAA 1WJ9A 2DR6A 3RZAA 1HHSA 2O66A 2I0XA 1S5ZA 4DV7F 1G3OA 3QJLA 4YY3F 4IG3A 3BJYA 1SJRA 3UWTA 1Y9OA 2FGOA 3QT8A 4M5KA 1FRHA 4OLOA 2IYIA 3FEXB 5D8HB 1RT6B 1YSJA 3ULHA 2HEKA 2DBBA 1HNZJ 2P8IA 3OUYB 1K0TA 2KJWA 1N5QA 2UUWA 3JQKA 4H4MA 1CJUB 4PQAA 3GILA 3UN3A 1DQ9A 2VV5A 4USWA 3W5ZA 4MTPA 2XLJA 4HI1A 1XNQJ 2XMKA 4RPFA 4OI4A 5ETKA 2KRBA 2AU0A 1IKXA 4CI0B 1OY8A 1RK8A 3ONQA 2WBMA 1JJHA 1Y3JA 4RW9A 2DK2A 4NLRA 4LF5J 3PO5A 2WW8A 2DYAA 1B64A 4L74A 1HW9A 1JLQA 4U9RA 1ZAXA 3H5UA 4DX6A 2XGPA 1L3SA 2CJXB 4LRCA 2UXCF 4J37A 2JC1A 2Y1JA 5SUHA 2BMBA 4OYXA 3AHPA 5GAGU 3GIIA 5KFVA 2C3OA 1FE0A 4QR0A 5CZXA 3R27A 1SL0A 1C4CA 5KG5A 3KLEB 4A48A 4Z7YA 5AXLA 3CJTA 3QLHA 5CQGA 2MZTA 2W4CA 4WFNQ 2DCLA 3GONA 1S1VB 2DGSA 3HHEA 2FY8A 1GK8A 4NLWA 5I3UA 3P8BB 4P75A 4ALZA 2J6SA 2LQ8A 3BREA 3GTYX 3RBXA 4IKAA 2D3O1 4ANEA 1SC1B 3MCNA 4NXNJ 1XR5A 2DGWA 1OWXA 3MM7A 2VODA 2FHMA 3K59A 3AJ2A 3OFFA 2F3JA 2J9DA 2YX1A 2CJBA 3UDVA 4EMDA 1Q16B 3HHLA 4NE9C 4OX6A 3QMQA 2XMTA 4F4WA 4N47A 3MUMP 5KFTA 1Q8IA 4USTA 4F7VA 2QJ3A 1UPMB 4O3NA 2HZCA 2DRDA 1TFYA 3UR3C 2BJDA 2EWHA 2LXUA 4YOEA 1S9GA 1GXUA 1GH8A 1G6BA 3TZZA 1J5OB 4KJIA 3ENAA 2HQIA 3BS9A 2IJNA 4LBHA 2OPRA 1HNWJ 2X3GA 2B8QA 2UZAA 2L48A 1T8EA 3KG1A 1FF2A 1O8BA 2WOMA 1MG7A 2AJFE 2MZJA 4GKKJ 2IRUA 2EG2A 2EKNA 3LP2A 3NBPA 4ZP9A 2DXFA 2HHUA 1U09A 5IT0A 4OJHA 3PNIA 1MN9A 4ELVA 2EVZA 1Q8KA 1RAFB 3CTRA 3HHNB 2UXDJ 1IKYA 2CYYA 1XC9A 3OVAA 4J9MA 1BHNA 1CJVA 2KO1A 1HPZB 2D9OA 5D78A 4DFMA 3QNWB 1XNRJ 4N7TA 6FD1A 2AX0A 3QT7A 2R9LA 2NLWA 3OW2R 5EHHA 1ZAWA 5LT5A 3ZNJ1 3QLHB 3G8QA 3MZIA 5HROB 5AE2A 4ZLJA 4AL7A 1Q5YA 2W2NP 3C2PA 2M5YA 3AOBA 5KT6A 3I9ZA 2KYXA 4ILRA 3J7A1 2J0SD 1SC3B 3EVWA 2LXFA 2E66A 1T05A 4X84A 2VBWA 2JFDA 3S1TA 3MR2A 3HSZA 2EK1A 3DGPB 3MEKA 1ULRA 2CNNB 1N52B 4K50A 2QIFA 5A8WB 2WVFA 4OZ3A 4OYWA 4QW9A 4K8RA 5A0YB 2GFFA 3BQ2A 3DN9A 1NB2A 1OPIA 2K06A 3KLFA 5LSOA 2IBOA 4CZCA 3C14B 3KLHB 2WCXA 5FJ4A 1BUXA 3KMSA 2E7XA 1TQLA 2GC8A 2OPRB 3LO3A 4WK3A 5ETNA 1NJYA 4G1PA 3DU5A 3DRSA 4WTOB 2GHVC 2YPZA 1HYSA 1VQOS 3K7RA 3D54A 3I0RB 3QZ8A 1RCOB 3HJVA 4IRDA 3NBPB 2BDPA 1VDHA 4C48A 4Q8EA 1VC0A 3QWUA 5FLXY 3AQPA 2RD5C 2CPYA 5CYQB 4Q2LA 1RWNB 4Q0BA 1WI6A 1RAIB 1RAEB 5BYSA 4ECTA 4I6WA 3BKTA 5LSLA 2G4BA 2RB7A 3T19A 4IYQA 2MMYA 1WEYA 1CJVB 4U6PA 3WBZA 4TN2A 3AOCA 4TU7A 1GFWB 4XDDA 2WHOA 1CBKA 4EU0A 2EK6A 5IWAF 4ZPAA 1BLUA 2VONA 2AGOA 2DHHA 4D3GA 1EKSA 1LK7A 2WRMA 2QA1A 2QL5B 2LU2A 1WDTA 3BEGB 1QD1A 2H4WB 1UP1A 2OSRA 3PX0A 4HH1A 3POTA 5HP1B 1WOSA 4PCQA 1UZHA 3HLUA 3N5FA 1YJWS 2XB2D 4YUDA 3T1YF 2XNRA 4Z2XA 3J81Y 2M8DB 1T05B 3IRXB 4GKJJ 1WEZA 2Z2ZA 2AZ3A 3RTVA 1HARA 3BGRA 1FT8A 2CWKA 1S12A 4E8UA 4A4JA 1U24A 4RW4A 3NAIA 2IPOB 1N0VC 5JVGQ 3QGGA 2RRNA 1YQHA 2MQMA 2HBRB 1VQ4S 1K0VA 3B4DA 4ED2A 4USJC 2HLUA 4WZQA 3JXOA 4KT0C 2CIMA 3RRHA 4ANDA 3QATA 4V1Ak 3CCUS 3VGVA 3UD3P 4PZVA 3DRSB 1T9TA 3QFWA 2WSEC 3NCPA 3W7BA 4X4NA 5H9FJ 2ATCB 2LXIA 1TMJA 2RDJA 1X5SA 4F0MA 4ECVA 1S6PA 5HJYA 1DRZA 4M94A 3IN5A 4C97A 3J7AN 3KMQA 4FF4A 2HHQA 3SXLA 1FI4A 5ITHA 1AXQA 4NCGA 1H7XA 1K1QA 5L8RC 3ISND 5I42B 3NS6A 1SJFA 4QIWD 1DAXA 1SQFA 1RTDB 4Y0FA 4C0HA 1Q7LB 2PE8A 4MJKA 2FVQA 2KJVA 2PDAA 2BE2B 4CLSA 3GV8B 2DITA 4V19X 1QAXA 4J9QA 2CFXA 2FHJA 2RIJA 1KWMA 5A2QY 5AE3A 1AW0A 3MM8B 4PG7A 2AJ1A 3RBDA 1ROFA 1VHIA 2IJFA 3BGRB 5E41A 4LBPA 4R8UA 3GCXP 2ZZMA 5CYMA 5K14A 1APSA 4WZMA 4M5IA 1FJGJ 1X5PA 4I6YA 3NKYA 3L4BC 4Y65A 1DLOB 4EI2A 1UCNA 3KLGA 2LVWA 1R27B 2GQ2A 4OI1A 5CCLA 4JI2J 3PO4A 2BYCA 2KN4A 1Y3KA 1MMNA 4JV2A 2VOPA 1I94F 4RKUC 1VRQC 1ICEB 2DR7A 2PFDA 5LXRA 4F26A 4DUZF 3IAM9 5DETA 3AY0A 4LBIA 2IDEA 2XS2A 4ZVUB 1N6QA 4X4OA 2C3PA 3RR7A 4NYZA 2QT7A 4AXIA 3BYRA 4WYLA 2BW7A 2R8KA 4ZVSB 1AT1B 1PAEX 3A13A 1S6PB 3PKYA 2OD4A 1ZM3A 3IGNA 2EXUA 2E5JA 2Z2YB 3CCTA 1VBKA 1KBRA 2YKMA 3C6TA 1BWVA 4GC6A 2BOAA 4Y00A 3CCJS 5D4NA 3HSJA 2IVMA 4CP5A 1RT5B 3CC4S 3K89A 2YKOA 2BRLA 2D69A 2YY3A 1KQFB 2XG8A 2QE5A 2C22A 2PSZA 4L73A 4JV5F 5A6PA 1MROA 4GVBB 1IXKA 4ATNA 1WUUA 3M32A 2IIHA 3O44A 2UXBJ 4OYOA 4NCBA 2KDOA 2K1RB 3I32A 5HL7Q 1C1BA 2FGCA 4NXMJ 4M5JA 4N76A 3VGSA 2MDAA 2K7KA 4Q2MA 1KC8T 1K73T 4DPTA 5C24A 4OI3A 5I3PA 5DG7A 2KKHA 5IT4A 1XMBA 2OP5A 1FD2A 3G6YA 3HPOA 3EWGA 3GIJA 1FERA 4LR7A 1UVMA 4OZ0A 2KZZA 1N32F 4M8LA 1S9EA 3MFHA 3QIDA 1U0SA 1T9UA 3KLGB 3UI3A 5B0FA 1QAJA 3GYXB 4WK1A 1RA6A 1FNOA 1URNA 4MAKA 3US5A 2Y1LB 3UD5A 4RUHA 4G65A 3I82A 3ZC4A 2MLXA 5HN0A 3T1AA 5C2GA 3DXSX 2EC0A 2GHWA 1F1BB 4KHPJ 1HWIA 2LDIA 2N3LA 4ID5B 1XMQF 3AXMA 2ZOFA 5DG8A 2ZD1A 4CCHA 1WORA 2WSFC 2H65B 2DGOA 4I64A 1N36F 1YBAA 1AUDA 1WC5A 1D9DA 2G0JA 4YHHF 2VPWB 4ZVEA 5C7PA 4X4PA 4FYXB 1VLOA 3TP2A 2HS4A 2YNHB 3H20A 1I1GA 2WK4A 2N7CA 1D8ZA 5KG6A 3J80Y 3VV2B 1VRTA 5IT9U 2AGQA 4A8SA 1MROB 4UW2A 2OPQA 2V69A 2H9ZA 1HFEL 1D9AA 2XLIA 1U48A 1JLBA 3VAKA 2ASJA 3MMBA 3RAXA 1NRKA 2FHKA 1EHWA 2OEKA 2E7WA 2YWKA 2I5JB 3RU0A 2PMZD 2KL8A 3NOCA 3DDKA 3THTA 4O3OA 1YJNS 1HNVA 1FNMA 3HJFA 1IKWA 4X4QA 3I0SA 4F25A 5GMDA 2JOQA 2YPYA 3ZTSA 1EAYC 4Y2MA 2RRBA 3NG8A 5DDQC 2HQDA 2GX8A 1GT8A 4BHQA 3JTOA 3G86A 4QYRA 4GO7X 4CO1A 1JLEA 3MCOA 4PWWA 1HBUB 2DNKA 5GMKa 5HK4A 4QU6A 1WHXA 1OSDA 3TARA 3BQ0A 2AKWB 4CNZA 4AT1B 4I4BA 1YBUA 4G1QA 1FTRA 1MW7A 1KSPA 2MY7A 2P5VA 3W65A 3FSIA 1P6TA 2MZQA 3OXGA 5E3RA 3FBBA 2M70A 4KH0B 1L3UA 1M5PC 2AD9A 2OI2A 1TUWA 2HFNA 2HURA 2HWHA 2UUTA 1Q79A 1HD1A 1FJEB 3MAQA 1T11A 2CRLA 4DI6A 2N3OA 1AA1B 3G71S 3FZBA 1PKUA 2CXEA 3TI0A 1YI2S 2ZNZA 4F0KA 3N9UC 1FO1A 3GZ7A 2KFZA 3QAUA 4J9OA 4MIAA 4LF2A 3GJSB 3GMGA 4C8OA 3UCUP 3HHLC 1HIYA 1B99A 4DV1J 4ED5A 3BZQA 3IGVA 1RHQB 2E1AA 1VRTB 1FE4A 4WP8A 3R1HA 3QSYB 1FDNA 1NK5A 1VC5A 2RQMA 3EMTA 2XMJA 3N6NA 4CT9A 3OPKA 4RNOA 4OZLA 2E1RA 1QE1B 1VQKS 3W2WA 2F7VA 4P74A 3NCRA 2GNKA 4M5HA 2E9TA 3H8YA 1X9WA 1D0EA 3BO3A 1HBMB 1XBWA 1T3NA 4WP3A 3RAQA 2MGZB 1ZM2A 1HNVB 2XYHB 2NS1B 5KAKA 1RWKB 1IKWB 3P5BP 3H4DA 4PWUA 4ZIVA 4LREA 1S76D 3N28A 3MPUB 2XM3A 1SKSA 2Z56B 1WOOA 4HHHA 1JLEB 1FRKA 2K2PA 3DOMA 4JI5F 4TQRA 4IOBA 2E5HA 4EYHB 2KT2A 5F0UA 4RLEA 1HNXF 3SCJE 1NSAA 5DDOC 4JI0J 2N82B 1GQEA 2BACA 2FVSA 3AOAA 4I69A 3VCDA 5L38A 2BW2A 1WEXA 2VKZG 6AT1B 3LP1B 1NBEB 1VQ7S 5LMNF 3M8WA 2KH9A 3HD2A 1IVZA 4MYTA 1T9WA 1S6QB 4ZJOA 5HVGA 3LH2S 4NA3A 1Q5VA 1DFDA 1VHFA 3T6JA 4JI1F 3TUIC 2J0XA 3T1HF 4A8WA 4DZDA 1F5AA 4G6VB 3N5BA 5H1SV 2H1YA 1NDCA 1FDAA 2ZH6A 3TAQA 1QSYA 4NASA 5AXMA 4EBCA 3IG1A 1Q82T 1DTQA 2DH9A 1X60A 3R9LA 2ZOMA 1MN7A 3OFGA 5K20B 1RYRA 5L39A 5L1JA 1KNZA 1QAYA 1D09B 4DL5A 1W25A 4PKDB 1ELOA 2VUGA 3TZXA 2C2DA 3Q2TC 1UETA 3DRRA 1SIWB 2BZ2A 3GFXA 1BMQB 1TMMA 3IM9A 3T5LA 2XI2A 4X66J 1BQNA 2NUHA 4IFYA 5AXKA 4QCLA 4C8ZA 1R43A 1R8HA 2JX2A 4JUZA 4ZVFA 5MAOA 2A18A 2VBZA 2LDYA 5DDRC 4MFBA 1X4GA 2OKQA 4X62F 3CCZA 4GVLA 2ZC3A 4MT1A 1DJ0A 5F9NA 2AJQA 5LMUJ 3BPSP 2C1EB 1TK0A 1CQNA 5EGYA 3DDNA 4H54A 4DV6J 2KI2A 4WFXA 1RLDA 1LEOA 4MK9A 5ETTA 4EO8A 2BE7D 4OJGA 2M2BA 5CD4A 1Q7YT 4QQBA 3PTWA 2OLWA 4MK8A 2PT0A 1J2VA 3NS5A 2HKEA 1VLYA 1VQNS 9RUBA 3KLVA 2YKNA 1UMJA 2ZJRQ 2XZDB 5KFAA 3ZTOA 2YQ3A 3OL7A 5J1EA 1YVFA 2DNRA 1NJWA 1MLAA 4O4RA 5DG9A 1UEVA 1KHWA 3ENWA 3MEGB 2CJAA 2VICA 1OQ6A 4FNIA 4CIOA 4W4MA 1CVJA 2G13A 3IG1B 2IY5B 4FF2A 3GE9A 2R2UA 5E7OB 1QSLA 1IR2A 3PDNA 1SJ1A 2R7SA 1RYSA 3UNGC 4B02A 2VG5B 1SUQA 5H9EJ 2KT3A 2FJXA 4U67Q 3MR5A 3BN4A 1VFJA 1R6VA 2DT9A 1CULA 2QC3A 4B3MF 1RWWB 2HS3A 3UR0A 2X7IA 2YWHA 4QYZJ 1PC5A 4KBIA 2V0NA 3JSMA 1FEHA 1WKKA 1VI7A 2J0WA 1WWHA 1GAOA 2FC8A 2JLEA 2JVOA 2NR0A 4DBQA 3MI7X 1HR0F 2XTJP 1HBOB 3M6WA 4UUXA 4URSA 3FMWA 4IR9A 3UCZP 4RW8A 3G96A 3TUZC 1TL4A 2YKPA 4OYMA 2G1HA 5F8JA 1NK7A 4B08A 1TKXB 5K8MA 2F4VJ 2XS5A 2DH7A 1V3ZA 4ZP6A 1U8SA 4C8NA 3DRPA 1MNEA 3G2XA 4TYBA 4B9UA 4ZCMA 4TNOA 2G0IA 2FVPA 5J2QB 4R5PA 2FY1A 3Q8VA 3UD4P 4CTAB 5E3CA 2GO8A 1OJ4A 4ECRA 1LW0B 3H0PA 1M5KC 4CQ1A 4USKA 3MM5B 4NLPA 3C8YA 4ZPDA 5KFQA 1X4DA 5J1EB 5KFLA 3TVKA 2PIIA 4JYAF 4USHA 1KVJA 2AJ4A 5ETQA 4JI6F 2XHWA 2O67A 3Q2SC 1H7WA 2GAHC 4ZVHA 3TJAA 1JMTA 4YMEA 3LWMA 4DPUA 2WVDA 1M5VC 3UVJA 1KD1T 3V6DB 2FJVA 3PFEA 5FLXU 4DF4A 4OMFG 1S0VA 2YKAA 5JVHQ 3EPIA 3DC2A 2CZVC 1CULB 3X1LB 2ZBQA 3MMAA 2PI4A 2RSQA 2DO4A 1Q1KA 3F41A 2EFNA 1TVRA 3ZTRA 1RT1A 1PCAA 3K2YA 1OY6A 3KDOA 1VQ5S 3OT9A 1D8YA 3IBFB 1UTAA 1SH0A 1WELA 2F65A 1N34F 2JH3A 1S7HA 5D0EA 3GR0A 3NGDA 3PIPQ 3UDEA 2HG4A 1NB7A 3DOKA 5HJXA 3V2UC 2AIRB 3TZWA 1YTYA 1P8GA 3J81U 3N0VA 4YB6A 2WBRA 3AXKA 2G9OA 3IS9A 4NEZA 4ZVRB 5KG2A 5G4DA 2MQQA 2DO0A 2GHPA 3MD3A 4WCEQ 4DU7A 1WC6A 1IQTA 1DY3A 4K4VA 2OMLA 5RUBA 3OBIA 2P9EA 3V6HA 1B4SA 1ZETA 2J8SA 1OMSA 2IVFB 3DXBA 4DQIA 1NJXA 4OI6A 4UTGA 3UDLA 4OLPA 1KVKA 2ZM6F 2CDQA 3J7YI 2DR8A 2YH0A 3MPYA 3G6VA 4OHVA 3CF5Q 1UW4A 2NCKL 1KTQA 1S1UB 3MTJA 5CYJA 1HWLA 2XSJA 3CXCR 3I4HX 4Q5VA 5CCMA 1ACMB 4KO0A 2XMWA 1OPZA 2B7CB 1RABB 1IKVA 3ZZZA 2M8HA 1A0OB 4B3RJ 2C42A 1HHTP 3AT1B 1U0HA 3VZIA 3DYAB 2VOOA 1NO8A 4ZJQA 4I2QB 2XSFA 3SFUA 2XMUA 1UJ5A 4WXOA 4DN9A 1FVQA 3ITHA 1A6LA 3CJQA 3BH7B 4A8QA 1WKJA 3Q86A 1YZ7A 1RAHB 4PG8A 1LQ9A 2D3OR 4AQYF 1U49A 2ADCA 2W9BB 2V4RA 1RTIB 4L72B 4P2MA 3G4SS 4CYUB 1NDLA 1Y5LB 4DL3A 4ZOSA 3K5OA 2CNKB 3NGRA 4AD6A 2I38A 1D3WA 5A2QU 1NSKL 1VIXA 3QSIA 4I1TA 1X4FA 4LF9F 4DG1A 4RJVA 1TUGB 3K8VA 2QSFA 1OYDA 4B9SA 2KVQE 2FZGB 2VQEJ 4GO5X 3V81A 4ITSA 1LWFB 2B0GA 2R42A 2WONA 4NPOA 4G1IA 3SSSA 5HVFA 2RNEA 5KFOA 3TO8A 1H98A 4ZMMA 2QLFB 3PRDA 4YEAA 2X1AA 2DHXA 3DM2A 2MKKA 3OTBA 1E6YA 2A6OA 4WWSA 3KJVB 2GS8A 4MKBA 4LFAF 3D0IE 4DR2F 2GIRA 2FJEB 5L1KA 1GMUA 3C16B 1S10A 4O44B 4PUOB 5JXSA 4GMKA 3AH6A 3QFHA 3C6UB 3MM6B 3K57A 3DCAA 5AXNA 2Y1IA 3PEJA 4ZVQB 2Q6CA 4X64J 5E0OA 3MAHA 2J9DE 3SBMA 5KFKA 3BM7A 1VQ9S 1OS5A 1SKWA 1KQSR 1FVSA 5CH7B 2H51B 2CJYB 2UVRA 1RU2A 3F0NA 2G2YA 1L3KA 2GQQA 2QO3A 5J2MB 2LEBA 4M5MA 4O3QA 1KDNA 1B7FA 1T9VA 3BV8A 2M9KA 1JB0C 4EGLA 1LFPA 4PXDA 2V34A 4U95A 1IM4A 1TV6A 3UO0A 3MGJA 5I4MA 3GFYA 2ZJQQ 5A8KA 2RQ4A 2UV8A 1S57A 3MEDB 4DLGA 2C2ZB 2VJUA 3LGNA 3NGUA 3E8OA 2HAFA 1NNDA 5HQLA 3PYFA 2NXNA 3B82A 1WF1A 4IH6A 4DF8A 1NH8A 2MJUA 4JP8A 1IJEB 2B4VA 3KG0A 3CCMS 5E2QA 3SDEA 3CW2C 2VA3A 5AE1A 3HZEA 2DJWA 4NLOA 3IA0A 1NJZA 3V81B 1C0UA 1RQ0A 3NLCA 3LPEA 4WP9A 3SSRA 1NK8A 3LW5C 3QIPB 5ETSA 2KRRA 3IBWA 4OZNA 1F3VA 1ZTTA 4JI3J 1PYSB 3UFCX 1ZYQA 2Z58B 3AB4B 3ZXWA 3DM2B 2DPIA 3UE2A 1RE1B 4C11B 1RT4A 3FSXA 2JZ5A 5F3ZA 7FDRA 4K4SA 1W7WA 2V67A 2LQJA 1LOUA 2GVDA 1OSCA 1VK3A 2RKIA 1FRLA 3JB9k 3QZ7A 5B7WA 4ZHRA 2H5JB 3O2IA 1HNIB 1RWXB 2ZM6J 1IBKF 4QWEA 3M2VA 1K1SA 2PD1A 2M3DA 1QDUB 3D66A 2B43A 2W9AA 2BM1A 4NLDA 2R8HA 2LU1A 3HVAA 2POKA 1JLGA 3BBCA 4LFBF 3KWMA 5DRKA 3THPA 1HQ2A 4OYZA 2FLLA 1WF0A 4Y2CA 3HHLD 2XBPA 3GG0A 2KG1A 1SV5A 4USIA 4FP9A 1NAQA 3AODA 4AXJA 3J80U 5B0CA 3D6MB 3IBCB 4K4YA 5KFPA 4HVZA 2RU3A 2V8VA 2XO7A 1P1LA 3VAGA 3ZO7A 1KLMA 5IXUA 4QIFA 1R8BA 2JLGA 3P96A 2OO4A 7AT1B 5J1PA 1B0TA 3NNHA 2ZKUA 3OFHA 2CPHA 3SSQA 1RBAA 3CJKA 4IQXA 3R2CJ 4L76A 1FKPA 3CPWR 2E5GA 2WB4A 4H4OA 2JHEA 1BXNA 4HR2A 4P7TA 2NZ4A 5BYRA 1TKZB 3MAAB 1C0UB 1PYTA 2R2TA 1U2RA 1KOHA 1S1TB 2CAJA 4B9MA 2GIFA 2HHHF 3KK1B 4H4KA 3R1LA 3CJ3A 2GIQA 3PJXA 2ZH1A 1KFSA 2RH3A 4DQSA 1SIZA 3TAMB 4KYZA 5HQ8A 3S01A 2MSSA 2E9RX 2M7SA 3EPGA 5KG0A 2HIYA 1N0UA 2PFFB 1T94A 3RB3A 1RTHA 3HFKA 1N5YB 4NWBA 2W8KA 5IV4A 3CJSA 2GVDB 1VISA 2RKIB 5KFFA 1HNZF 2Q6BA 5FDLB 3TX0A 1U8WA 4XK8C 1IR1A 4PQUB 3BGLA 1LKZA 2A2DA 2V9WA 1YZ6A 2MLZA 1YJVA 2IC3A 1F5BA 2FIUA 1XNQF 5EDWA 3P45B 3BO2A 1N5SA 5K8PA 4LFAJ 4HHJA 4ENOA 1ZA1B 1T03B 1VQ6S 4IFVA 1FRMA 2L41A 4DL6A 5KFBA 4LF5F 1EETA 1NXIA 4HACB 1SV5B 4FS1A 2YNFB 3KJQB 1H0HB 5KG7A 5GAGI 2XWYA 2HNYA 3I55S 3MMJA 1TK5A 2C3YA 1BGXT 2ROPA 1TL7A 4KFBB 3M2RA 3W9JA 1KLMB 1S0MA 1LV5A 3JAMU 4QIVA 4JBCA 5IOLA 1S9FA 4TKTA 1WC1A 2QGFB 1T02A 2DGUA 2IM1A 2ZH4A 3GU0A 4OZJA 4CH7A 1LWXA 2IRXA 1FKPB 2F5GA 4ED7A 2HVZA 1YKWA 1R89A 4CO3A 1QVGR 1KFDA 1ZPWX 3KK2A 4J90A 4WKRA 3PM9A 1IM6A 1RJJA 1VQSA 3Q89A 4OYAA 2KZMA 4NZ0A 1S77D 2XQCA 2DNMA 5CXTA 2Z2MA 4ZA1A 2H4YB 1SH2A 2A3JA 2IMWP 4NLUA 4NXNF 1O0PA 3EZOA 4DL4A 4B3TJ 3K0JA 5LOQA 1R8AA 3FNNA 2U1AA 2GGPB 2V94A 4E98A 4ID8A 4LRDA 1SVDA 5G0RA 1NMEB 4AFFA 4EYIB 2R7OA 3DNCA 4DPYA 3D1OA 3GJRB 3KHHA 2BR0A 2F8HA 1YRXA 5HQMA 3OVBA 4BBYA 2PO4A 1RT3B 1TELA 1YX2A 5DZ7A 4NEYA 1R3NA 3W5XA 3DOLA 3CEDA 1RISA 2HSEB 1AYEA 1WHWA 3GWCA 1UVNA 1BC6A 2BJ1A 4DV0J 3ELHA 2VFSA 1U6FA 1HNWF 1VBXA 3H40A 1XMOJ 2ZH5A 2O1PA 4DR4J 4DZ6A 3D67A 1N5VA 4QWAA 1T9YA 3D2WA 2CPZA 1HWKA 1U1NA 7FD1A 2XY6A 2HNZA 4GKKF 3PW5A 1S97A 4NCAA 3SQGB 4DR7J 1S4FA 2M0GB 2B9WA 2ZBPA 3M2RB 2QZ8A 2OIHA 3RB4A 2R7TA 2ABYA 4K4TA 2UXDF 2UP1A 2E44A 2B4PA 2C2MB 5F8GA 4F36A 3JSRA 1LXNA 4KV8A 5THWA 4BDPA 4F0HA 3ICLA 4EK2A 3I87A 1XNRF 2CDRB 1YJTA 4PPZA 2ZDOA 3BSNA 2YNIB 2V9KA 4K7QA 2V8PA 4K5SA 3DHWC 5J2PA 1N5TA 1WSRA 3KK2B 5T41A 3QAEA 4I7FB 1C0TA 3M2UA 4ICLA 5DZ6A 3R97A 3DLEA 3RG6A 5KT4A 4ZCIA 2L9WA 1KKHA 1RKIA 4KGMA 5D77A 4P71A 2CJ9A 4DSIA 4IG0A 4QIEA 1RHMB 4LMZA 1LWEA 1IN0A 2XY7A 4E2FB 3PG9A 1MWQA 1VIOA 2VU5A 5G0RB 4O4GA 2A2CA 3PYEA 2AJ2A 2KM8B 8RUCA 2HHHJ 4TYAA 3CULA 4FXVA 4QWBA 3AAWB 2QEXS 3AB2B 2JEIA 1XN9A 5DGBA 1JLCB 3ILLA 1F0XA 1S0NA 2Y8YA 3A1YG 1VGYA 2FB0A 4NLTA 2R7UA 2DD8S 1RP5A 2D3ZA 3SV3A 2Q66A 3CDUA 3GIMA 2RDDA 2HQFA 4HLBA 4BLGA 1IBCB 4DFJA 2B6AB 4O3SA 3FKBA 3OR1A 3FSYA 1I6JA 2WAQD 3CDAA 3CB4A 3SIPB 2F40A 1JNRB 2QMXA 3ISZA 5DLFA 3LA0A 2R7XA 2WTFA 2KFYA 2UUCJ 2HQCA 3RW7A 4UQTA 4QJVA 4A46A 1WTBA 2CKWA 1Z4UA 1U47A 5DLGA 2C2NA 2CQ1A 1S1XB 2ZKTA 1GXTA 1RHJB 1GX6A 1PJ6A 4ZP7A 3AFGA 1K9MT 3H2VE 4K2XA 1YBTA 3FZ2A 2HNDA 2VKRA 4ES2A 3HVTB 2YWGA 3E3XA 2D9PA 3TVZA 3DLGB 4F3QA 1K47A 4QWDA 1VQPS 1IBLJ 5J2PB 1MMLA 3QQCD 4LVNP 2BE9B 4LIWA 3V4MA 4N41A 3OHBA 4W98A 3A3PB 4TVAB 2DXEA 4I2PB 4WE1B 4C7QA 3IP0A 2HK3A 1BD6A 2B9EA 1C0TB 2A6MA 2V68A 3W62A 4ERDA 2OAUA 3DLEB 2P2CB 2O01C 4GKJF 4Y2IA 2XWXA 3DU6A 3LGMA 4IG0B 2H48B 3TA2A 3H90A 1LWEB 1O5JA 1UA1A 1Q8BA 3W8PA 1GTHA 1NKEA 4CLTA 1EIYB 2AEFA 1T9XA 1TTHB 2D41A 3DLKA 1X4HA 4DJBA 1NK4A 5ETPA 3OSNA 2DIVA 1U1KA 3VGTA 2OHDA 2DNHA 4ETZA 3LAKA 2W8LA 3VF0B 2F1FA 2CJKA 2XULA 3PIOQ 4IG3B 3FCHA 4WJBA 1RDRA 3OR1B 4B9LA 4LSLA 1GXLA 1F3FA 2W2OP 1VMBA 4DSJA 4H4MB 1RT7A 1SQEA 5DO2A 4ZDNA 3G82A 4P2FA 1FESA 4TXSA 1YJ9S 1X8DA 5HO4A 1BQXA 4NI2A 1IKXB 4S0MA 4PG6A 3OQ2A 3DMJA 3LWLA 2HNDB 4RW9B 2HK2A 2DEIA 4KR0B 2AF6A 3BGFA 1JLQB 2BJ3A 2MYFA 1PIEA 5L46A 4DR1J 5LJ3Y 1UJ6A 3L7PA 1Q0NA 3H2UB 1Q81T 3RB0A 4GC7A 3WC2A 4K5RA 4HT5A 3SEOA 1BE4A 4FDFA 3I4PA 2EFVA 3IC1A 3H42A 2Q3PA 2ASLA 4W90B 2XCPA 3PW0A 1PJ7A 2OD6A 5ETOA 3QRPA 1GMWA 2OGUA 1S49A 3NNCA 3RB6A 3IO1A 2MHNA 2R8GA 3LOUA 1U2FA 4DPOA 1FJGF 2QLWA 2E5LJ 5GAEU 1PC4A 1R0BG 4CLFA 3DLKB 1F9HA 5IM0A 5I3UB 3KUGA 2RRAA 1WF2A 4JI2F 3VR1A 4ED8A 4CDIA 1KONA 1KHVA 1NEEA 3B78A 3EGNA 3MM7B 2BANA 3FBCA 3PACA 3WC0A 5JJBA 1NUEA 5L9XA 2HHWA 1PBUA 1EX8A 3DLJA 1D9FA 3LPYA 5JMNA 3M9NB 2KFNA 3HHLB 4PG5A 4NZ7A 2L08A 5KTQA 4LSLB 2YNGA 2NSBA 2RF2A 1YGYA 2IA6A 5LXYA 1NSQA 3CIMA 4EFAC 1B3TA 3JS9A 4J9KA 4UUWA 1S4EA 3BBFA 2V2QA 2BM0A 4K0KJ 1S9GB 4L3KA 3TW0A 2DGQA 3R6GB 2WVCA 2ZNYA 4NYPA 2HBQB 1Y00A 4J91A 3AJDA 3JTNA 4ECQA 1MU2A 1YJ7A 3A8IA 2ILYA 5EWGA 4NI2B 5T7LA 2OTLS 2G0CA 5GMEA 2MJNA 2LQ9A 2XC9A 3D6TB 3NMRA
chains in the Genus database with same CATH topology
1VYAA 3BBBA 3Q8UA 1NDLA 2HURA 3EVMA 3EICA 4CP5A 3FKBA 4UOHA 3GPAA 3Q8VA 3NGRA 3Q8YA 3VGUA 3ZTRA 4ANCA 2NCKL 1HLWA 3VVTA 3Q83A 3ZTPA 2HVEA 3ETMA 4FKYA 5IOLA 1NSKL 3FC9A 3FCWA 1JXVA 1EHWA 1NDCA 1S5ZA 2AZ3A 1UCNA 4S0MA 3NGSA 4DI6A 3ELHA 1LEOA 2CWKA 1LWXA 3FBCA 1NSPA 4C6AA 1PKUA 2HVDA 1NUEA 3EVOA 4DZ6A 1NDPA 3R9LA 1NCLA 1HHQA 2AZ1A 3ENAA 1MN7A 1U8WA 2B8QA 2DXDA 3ZTQA 3FBFA 1WKKA 1XIQA 3EVWA 2BEFA 1KDNA 3VGTA 1W7WA 1NPKA 1WKLA 3VGSA 1NLKL 2ZUAA 2DY9A 3Q89A 1NHKL 3ZTSA 1S59A 3MPDA 1HIYA 1B99A 2VU5A 5CABA 1NSQA 4DUTA 2BX6A 3JS9A 3L7UA 1NDKA 3GP9A 3ZTOA 4O0NA 3BBFA 4ENOA 1S57A 3PRVA 1XQIA 4HR2A 3EJMA 3DKDA 3FCVA 2DXFA 1PAEX 4ANDA 1NB2A 3FBEA 1MN9A 3BH7B 5CAAA 1B4SA 1WKJA 4ANEA 5C7PA 1BE4A 3Q86A 2B8PA 3VGVA 4KPCA 3EMTA 4F4AA 4UOFA 3B54A 3NGUA 1BUXA 3EE3A 3PJ9A 3BH6B 1F6TA 1K44A 3EM1A 4WBFA 4W98A 4F36A 1F3FA 4UOGA 3VVUA 3B6BA 2DXEA 1ZS6A 2DYAA 3G2XA 3FBBA 1BHNA 3WX8A 3BBCA 4EK2A 5BXIA 3DDIA 4FKXA 3NGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYA A;  3BBB A;  3Q8U A;  1NDL A;  2HUR A;  3EVM A;  3EIC A;  4CP5 A;  3FKB A;  4UOH A;  3GPA A;  3Q8V A;  3NGR A;  3Q8Y A;  3VGU A;  3ZTR A;  4ANC A;  2NCK L;  1HLW A;  3VVT A;  3Q83 A;  3ZTP A;  2HVE A;  3ETM A;  4FKY A;  5IOL A;  1NSK L;  3FC9 A;  3FCW A;  1JXV A;  1EHW A;  1NDC A;  1S5Z A;  2AZ3 A;  1UCN A;  4S0M A;  3NGS A;  4DI6 A;  3ELH A;  1LEO A;  2CWK A;  1LWX A;  3FBC A;  1NSP A;  4C6A A;  1PKU A;  2HVD A;  1NUE A;  3EVO A;  4DZ6 A;  1NDP A;  3R9L A;  1NCL A;  1HHQ A;  2AZ1 A;  3ENA A;  1MN7 A;  1U8W A;  2B8Q A;  2DXD A;  3ZTQ A;  3FBF A;  1WKK A;  1XIQ A;  3EVW A;  2BEF A;  1KDN A;  3VGT A;  1W7W A;  1NPK A;  1WKL A;  3VGS A;  1NLK L;  2ZUA A;  2DY9 A;  3Q89 A;  1NHK L;  3ZTS A;  1S59 A;  3MPD A;  1HIY A;  1B99 A;  2VU5 A;  5CAB A;  1NSQ A;  4DUT A;  2BX6 A;  3JS9 A;  3L7U A;  1NDK A;  3GP9 A;  3ZTO A;  4O0N A;  3BBF A;  4ENO A;  1S57 A;  3PRV A;  1XQI A;  4HR2 A;  3EJM A;  3DKD A;  3FCV A;  2DXF A;  1PAE X;  4AND A;  1NB2 A;  3FBE A;  1MN9 A;  3BH7 B;  5CAA A;  1B4S A;  1WKJ A;  4ANE A;  5C7P A;  1BE4 A;  3Q86 A;  2B8P A;  3VGV A;  4KPC A;  3EMT A;  4F4A A;  4UOF A;  3B54 A;  3NGU A;  1BUX A;  3EE3 A;  3PJ9 A;  3BH6 B;  1F6T A;  1K44 A;  3EM1 A;  4WBF A;  4W98 A;  4F36 A;  1F3F A;  4UOG A;  3VVU A;  3B6B A;  2DXE A;  1ZS6 A;  2DYA A;  3G2X A;  3FBB A;  1BHN A;  3WX8 A;  3BBC A;  4EK2 A;  5BXI A;  3DDI A;  4FKX A;  3NGT A; 
#chains in the Genus database with same CATH topology
 1BQM A;  4LR8 A;  4N8N A;  1I51 B;  2WOM B;  5ADZ A;  2PGC A;  3LP2 B;  3LAM A;  4RZR A;  1TU0 B;  2U2F A;  4FYY B;  5KFD A;  3RGI A;  2CQP A;  3HD1 A;  1FK9 A;  2DY1 A;  1XJW B;  2XEX A;  2J9E A;  2UXB F;  3VHQ A;  2OSQ A;  2HZA A;  3HX9 A;  2HFZ A;  2UU9 F;  2DNP A;  1NSP A;  1AZS A;  1NHU A;  4NXM F;  1CPZ A;  1PO6 A;  2EI5 A;  1NDP A;  1IKY B;  4P52 A;  5KT3 A;  3TYT A;  4URQ U;  2MZS A;  2I6W A;  2GZO A;  2BEF A;  4KY3 A;  2JC0 A;  1EKR A;  4IRC A;  1X31 C;  1X4A A;  4ZK7 M;  1S59 A;  4TU8 A;  1ZBT A;  2CVI A;  2LA4 A;  4CLL A;  3MXH P;  2UUA J;  5M2U A;  2P6T A;  2ZE2 A;  1KOO A;  2DHA A;  4F4K A;  2ZIT A;  3TJ9 A;  4HDH A;  2W25 A;  4EWT A;  3IM8 A;  4KPC A;  3KJN B;  4F4A A;  4CH1 A;  4ER8 A;  1N48 A;  2ZH9 A;  1VC6 A;  3QPI A;  2DNO A;  3VWS A;  1B70 B;  3CC7 S;  4QR2 A;  4UOG A;  2J8A A;  2Y1R I;  3I5A A;  2QG9 B;  3M8P A;  3TEH B;  2BAN B;  3I9V 9;  4C2M A;  1TP7 A;  3H5X A;  2UUB J;  3CMQ A;  2GV1 A;  3SI8 A;  3ZZT A;  2PC6 A;  1ZM9 A;  2JJ4 D;  3KLF B;  4KHP F;  1TAU A;  3J7Z T;  2HQG A;  2AGP A;  2V2Z A;  5A76 A;  4OX9 J;  3G6X A;  1NCL A;  1RA7 A;  2EBE A;  2UVU A;  4ZS6 A;  3RUB L;  1JXE A;  2BQU A;  4H4K C;  2CQC A;  3K5M A;  1NPK A;  1FJC A;  5F41 A;  2MQO A;  1HI8 A;  2BKO A;  5T7L B;  3LGH A;  1GMV A;  1CS4 A;  2DNY A;  2ZEJ A;  3CCW A;  4EZ9 A;  1HYS B;  3CWJ A;  3RRK A;  2IA0 A;  2XNQ A;  3OXF A;  2WW4 A;  3NS7 B;  2ZDP A;  4MMO A;  2GA7 A;  2RDI A;  2ZVI A;  4Q0B B;  3Q8Q B;  3M9O B;  4ECW A;  1FCA A;  1AZS B;  2CQH A;  1OY9 A;  5KFN A;  3VGU A;  2DRB A;  3N4W A;  2BJ7 A;  3D3C J;  3FC9 A;  2V8D A;  1R0A A;  1JXV A;  2CUY A;  3FQK A;  4OJ1 A;  2R7V A;  3W2V A;  2VD3 A;  1Y4Z B;  2CJQ A;  3OFE A;  1FA0 A;  1FX4 A;  4NLX A;  2J9C A;  3M6U A;  3D0G E;  2NPI A;  5ETM A;  3TJ8 A;  2R4F A;  4CT8 A;  3POT B;  5DDP C;  1LW2 A;  4CH0 S;  1NLK L;  2VG6 A;  5L9N A;  4DX8 H;  1FRJ A;  2M52 A;  3G8T A;  4M63 A;  4ECS A;  2B4O A;  2IMO A;  2F9D A;  5E3P A;  4ZVO B;  5KFW A;  2YQ1 A;  1XK8 A;  4EZ6 A;  1NU4 A;  2PA8 D;  5F8I A;  1W2B R;  4A8O A;  2RIL A;  4RW4 B;  2I2Y A;  3TA0 A;  2RHS B;  3OHA A;  1TKT A;  3E2E A;  1C1C A;  3BH6 B;  4OYP A;  2AYM A;  2EKY A;  2LQB A;  4OZ1 A;  3NGT A;  3U02 A;  3BBB A;  2OEM A;  2NXU A;  1T7P A;  3TOQ A;  3EVM A;  3MPW A;  3VAH A;  1KRP A;  4DN0 A;  3NGK A;  1RWU A;  2VG7 A;  3CO0 P;  4W92 B;  4MKV A;  3TEG A;  3OTD A;  3H5Y A;  2NRE A;  1K8A T;  3LUY A;  1FXR A;  1VR6 A;  4JI4 J;  4Y2A A;  2Y0B B;  3D3B J;  2VFR A;  3FRY A;  5AJ3 F;  2CQD A;  3HFV A;  1C4A A;  4LVO P;  3PJW A;  3D1H A;  3HK2 A;  3KK3 A;  5KFM A;  1J5E J;  1VJQ A;  3R7B B;  3EZ5 A;  3DRX A;  2LEP A;  5KFR A;  4LRB A;  2C2R A;  4DV1 F;  3NXZ A;  4ZVT B;  2KM8 C;  4M5D A;  2E7V A;  3UPF A;  3T5H A;  5KFE A;  1TKD A;  3KLI A;  2QA4 S;  4NCG B;  4FF3 A;  1UKU A;  4ED0 A;  3TX8 A;  4BC7 A;  5B0D A;  1QY7 A;  2FC9 A;  3MTK A;  2R8J A;  3BR9 A;  2PEH A;  2ZFH A;  3FEY B;  3BPD A;  1F6T A;  4WBF A;  2QL9 B;  2OFG X;  3ET6 A;  4P6Q A;  1Q95 G;  2AW0 A;  2J6T A;  4F50 A;  4OL8 A;  1FDB A;  2VAS A;  5E3Q A;  1WNE A;  4C0B A;  1RLC L;  4LR9 A;  4LF4 J;  5F9L A;  2KB2 A;  3UNY A;  3M6V A;  4Y3C A;  2UU9 J;  3ZFV A;  3CD7 A;  1R8C A;  2DTJ A;  2AQ4 A;  1B0V A;  1R7I A;  1YDL A;  1RAA B;  4UY8 T;  5D0G A;  4QOT A;  4HYK A;  3GLJ A;  1UVI A;  2F8E X;  2CQ0 A;  4PAA A;  2FDN A;  4DV5 J;  2D3U A;  5GAH U;  4R8U B;  4RWW A;  3ZZ0 A;  5CYM B;  5K14 B;  2V4Q A;  2WZ1 A;  4JI0 F;  3OL9 A;  4TQS A;  1OIA A;  4P2S A;  3NRB A;  1WG5 A;  2F4F A;  4CM0 A;  4U96 A;  2W4P A;  2KHD A;  4NL5 A;  5GAD U;  5F8M A;  2HS0 A;  3KUE A;  1BY9 A;  3BSA A;  2B8P A;  1RWO B;  3N01 A;  4LSZ B;  2KHC A;  1IBM J;  1K44 A;  1YG0 A;  2EC2 A;  4ZN1 A;  3CIZ A;  3NP5 A;  2ROG A;  1UW9 A;  3FGV A;  4HTJ A;  1RT6 A;  3AD9 C;  1N6Q B;  1TFW A;  2FQQ B;  2KXF A;  3CGI A;  3EX7 B;  4DV4 J;  2PA3 A;  3KK3 B;  2B51 A;  4OQJ A;  5HAT A;  4CNY A;  2XZW A;  1CJU A;  1XER A;  4DL2 A;  4Z7C A;  4DMZ A;  1GTE A;  3D9B A;  4DQR A;  4M5D B;  1EQM A;  1JK9 B;  1T0T V;  2VPY B;  4ZIW A;  4ECZ A;  2HGN A;  2YKM B;  4KIA A;  1WG1 A;  2GCF A;  3HVW A;  1FWL A;  3O1L A;  2NYI A;  5A8R A;  2X1G A;  3C6T B;  3BDE A;  2SXL A;  3WDO A;  1V9O A;  5AT1 B;  4DV3 J;  1R6Y A;  5KT2 A;  5D4L A;  2VB6 A;  2GVZ A;  4DUY J;  2LQ5 A;  4RW7 A;  2HGL A;  4X66 F;  4J9N A;  1KQK A;  4FS2 A;  1YK9 A;  3IRW P;  1ZA2 B;  2DR5 A;  4E0D A;  4MK7 A;  3M32 B;  2BXJ A;  1C1B B;  3LF0 A;  2FYX A;  4Y2K A;  1HBN A;  3CMA S;  3BDP A;  3KLE A;  4U7U D;  2QN6 B;  5C24 B;  1H2V Z;  5LMU F;  2DNQ A;  2DNN A;  5GVQ A;  3Q8Y A;  2ATL A;  4EEY A;  3Q0A A;  2V5H G;  2EEY A;  4DV6 F;  2ZH7 A;  1SKR A;  2B5J A;  3D6F B;  4X4U A;  2IYG A;  1YWX A;  4JI7 J;  5F8N A;  1MMD A;  3R8Y A;  4IRK A;  4LF8 J;  2J7K A;  2CPD A;  1ZPV A;  2B3T B;  3CD0 A;  8ATC B;  1S9E B;  5HBM A;  1G2E A;  1UVL A;  4IDK A;  1PSD A;  4MKY A;  2DIU A;  4K4X A;  1VRU A;  3CCQ S;  2DY9 A;  4ECX A;  2A10 A;  1UFW A;  2CQI A;  3KNG A;  3R2D J;  2BOP A;  2GJF A;  2X3D A;  4ZN3 A;  1X4E A;  5KFS A;  1RB0 A;  1RUS A;  3B54 A;  3PY8 A;  3BR8 A;  4FN5 A;  1J5O A;  1JJC B;  5F0W A;  4RL1 A;  4DXL A;  4F2S A;  2IHR 1;  2ZD1 B;  2WB1 D;  3CJ4 A;  3MPV A;  4TY8 A;  3H7H B;  4JV1 A;  5HI7 A;  5HAN A;  2HHT A;  1U1P A;  2JEF A;  2RT3 A;  1S7I A;  3CT9 A;  5A8R B;  3FEZ A;  5AJ3 J;  3QJP A;  3CVK A;  1RWV B;  2X51 A;  4RBT A;  2W2P P;  2HRY A;  3O6Q A;  1FWK A;  2GVZ B;  1FKO A;  4RW7 B;  2GQC A;  3PHT A;  3HO1 A;  3OTO J;  1XR7 A;  2BVZ A;  4CLZ A;  4LSN A;  1YHQ S;  5DM7 Q;  4C3K A;  3M7V A;  2OPQ B;  4FXD A;  1F9F A;  2AMC B;  2ASD A;  3WZ0 A;  5HSP A;  3FJ2 A;  5F8H A;  1NZA A;  1HPZ A;  4XAK A;  3GR1 A;  1JLB B;  2VBY A;  3MMB B;  1JX4 A;  1HBN B;  4AYB D;  5L1L A;  3GFH A;  2F4V F;  3QJJ A;  3SZ2 A;  4B3S J;  2HBY B;  4F3M A;  3W8G A;  2B4U A;  2LEA A;  3BO4 A;  1RI7 A;  3NAH A;  5HRO A;  4K4U A;  3PZP A;  3DLL Q;  4G3I A;  2B5J B;  1NKC A;  3I0S B;  4TLR A;  3D1Q A;  3WX8 A;  3ETO A;  3ZZU A;  3ILJ A;  5HBM B;  5B0E A;  4IDK B;  4DV2 J;  3DGP A;  2DNG A;  1VRU B;  3CCS S;  1FHT A;  5A8W A;  3W66 A;  2MKY A;  1N8R T;  5A0Y A;  4G1Q B;  1FFS B;  1UFL A;  1HQE A;  4DCO B;  1P1T A;  4UZB A;  3C14 A;  3KLH A;  2CAD A;  2E29 A;  2IVY A;  3OR2 A;  1P27 B;  3ZZP A;  4KAI A;  1NK0 A;  1H2U X;  1U02 A;  4DS4 A;  1REG X;  1FWP A;  5EX0 A;  4ZVP B;  1P9Q C;  4FYD A;  5M2P A;  2E1M C;  3B4M A;  2L9D A;  2W1B A;  2B7B B;  4J9R A;  2ZOG A;  4DOZ A;  4TY8 B;  1WSV A;  2HQ3 A;  4KGK A;  5SZT A;  3HKW A;  1PIL A;  5KFX A;  3TVY A;  3HHK A;  3EM1 A;  3HDS A;  3I0R A;  3DRY A;  2KYZ A;  1YJR A;  1SC6 A;  1FKO B;  4ZLP A;  5CYQ A;  2CQB A;  2W9C A;  1G1X A;  3SCI E;  4LSN B;  1YRU A;  4IH5 A;  5B0B A;  2E1C A;  2I1R A;  4U8V A;  4DWI A;  1FKA F;  1X4C A;  2AEM A;  2DEJ A;  2RS8 A;  3W2W B;  3GIR A;  4LF7 F;  4J9U E;  2YTC A;  2W7O A;  2E1P A;  3C66 A;  4DCP B;  2DRA A;  5HMX A;  4DR6 J;  2BAB A;  4RX6 A;  3K8W A;  3NY0 A;  2BKP A;  4M5G A;  2Q43 A;  2MKS A;  4RWX A;  1V5V A;  3PRB A;  1E6V A;  2J7W A;  3KYL A;  4RO0 A;  2IBK A;  2Y0S D;  4WYW A;  4DUT A;  2EBG A;  2L3M A;  1SL1 A;  3A3O B;  5HP1 A;  3A8E A;  4IQM A;  1WOP A;  3I56 S;  2VFT A;  2ZVS A;  4C8K A;  4KHM A;  1U25 A;  1RBO B;  4RR5 A;  3IRX A;  2CQG A;  4PXC A;  2ZH3 A;  4HHU A;  1W2I A;  2F9J A;  4EBD A;  3EE3 A;  2YXL A;  4NA2 A;  1TZ0 A;  3DOM B;  3I31 A;  1N4L A;  1WG4 A;  1XWL A;  2FHO B;  1M5O C;  2NXC A;  4ZPW R;  2XMV A;  4PR6 A;  5HMZ A;  3BYP A;  1HQE B;  5B09 A;  4RW6 A;  5LL6 d;  3OR2 B;  3E51 A;  2QFJ A;  2XHC A;  3MMC A;  3RBE A;  2RML A;  2R2S A;  3NCQ A;  3T9N A;  4B3R F;  2ACY A;  1KLN A;  4DV7 J;  2P9C A;  4YY3 J;  3IFE A;  4M95 A;  3U1M A;  4AE5 A;  5MLC V;  1IUJ A;  1SL2 A;  1RBL A;  5JUM A;  3PW7 A;  3T9Z A;  3PVX A;  4LRF A;  2ZC4 A;  2XMA A;  3L7U A;  4OV6 A;  3T6B A;  5HVH A;  4OHX A;  2VZ9 A;  1RSC A;  2N7Y A;  4Q44 A;  3MF5 A;  4YB5 A;  5EN1 A;  3AQO A;  3SMZ A;  3DHX A;  2W9C B;  1DTQ B;  1U45 A;  2CPI A;  4OHZ A;  4PG4 A;  4C3L A;  5C25 A;  5I42 A;  3RW6 A;  3MCM A;  3QWP A;  5E5N A;  1U2C A;  3HKZ D;  1F5C A;  2MPU A;  1RTD A;  4Y6I A;  4QPT A;  5DQI A;  2B56 A;  4J7C A;  1VK8 A;  3DRR B;  2ZWO A;  4UOH A;  1PBA A;  2VA2 A;  4X4V A;  4F4X A;  2VC0 A;  1AFJ A;  5U47 A;  2CWX A;  2OUG A;  4NLV A;  3G87 A;  2BQR A;  2UVV A;  2BE2 A;  1VQL S;  1FD8 A;  1BQN B;  2HLT A;  2VQE F;  2A0F B;  4IFY B;  1E6V B;  2RUS A;  4F04 B;  4C8M A;  2UXC J;  3MUT P;  1JLA A;  3OJS A;  2QLX A;  4PYD A;  4ZPB A;  4MFB B;  2XY5 A;  3TUP A;  1UPP A;  4ECU A;  2W2M P;  3CJR A;  4DQP A;  3MM8 A;  1WKL A;  2Y3Y A;  3V5R A;  2RE1 A;  3A8J A;  5BR8 F;  1X7V A;  3TAP A;  3H4B A;  3MOZ A;  3ZNU A;  1UEU A;  1S1W A;  3CCR S;  1X9M A;  2OH2 A;  1DLO A;  2DHS A;  1N88 A;  4RW6 B;  5KFU A;  5D15 A;  2ASY A;  1AUS L;  3Q8P B;  2QFI A;  2VL1 A;  3HHD A;  4I68 A;  2C2E A;  5DQG A;  3MMC B;  3JTP A;  4M5N A;  3TWZ A;  2YKN B;  4I6A A;  4RNH A;  2BRK A;  3A4T A;  3L3C A;  2BJ8 A;  4NLS A;  5HLF A;  3CNQ P;  4X64 F;  4YDX A;  4WFZ A;  1SC4 B;  3W63 A;  3LP0 A;  2YBV A;  3NGS A;  2QMU B;  3PX4 A;  2H54 B;  3VAJ A;  3MDF A;  3ILI A;  3UQS A;  3QGH A;  4ZJL A;  4DSL A;  3NNA A;  5IFM A;  3ZTQ A;  2ROE A;  3TRG A;  4Q8F A;  2J0Q D;  1L5U A;  4IUF A;  4WXW A;  3FMB A;  3L95 X;  4EUV A;  1AB8 A;  3R5B A;  2OPS A;  5C25 B;  1SUQ B;  3SQO P;  3Q23 A;  2M4M A;  1RT5 A;  1H74 A;  1RAD B;  2BV3 A;  4AUK A;  3KUH A;  4ECY A;  4UOF A;  4Y34 A;  3JSM B;  4GVB A;  5D0H A;  4X4T A;  3GQC A;  1A9N B;  2K1R A;  4BWJ A;  4ZKA A;  2VQF F;  1FX2 A;  1JLA B;  4J5O A;  4RW8 B;  4JI3 F;  1FXD A;  1R31 A;  1X4B A;  3JSY A;  3HZG A;  4LF7 J;  4N8O A;  1QLN A;  1D1U A;  3OV7 A;  4ED3 A;  4DLE A;  2IRY A;  3DRP B;  5A6W A;  3G8S A;  4RNM A;  1KEK A;  3W3S A;  3HVR A;  1F9E B;  3BSO A;  3SCK E;  1S1W B;  3B8H A;  2FJD B;  3BGU A;  4R5P B;  1FFW B;  1XTZ A;  1J27 A;  3AD7 C;  3MR6 A;  2MHE A;  4GRS A;  1IWG A;  1V5I B;  2YX4 A;  3MUR P;  4ZCK A;  1XEZ A;  3HP6 A;  5KT7 A;  4DU8 A;  3R7S B;  3THV A;  3EXC X;  4DPX A;  5HLF B;  4B9N A;  3CCE S;  2CQ4 A;  3TNV A;  3CE8 A;  1UWA A;  3LP0 B;  4NML A;  2KXN B;  4ID5 A;  3J81 j;  3BN7 A;  4KE5 A;  1M0S A;  1N56 A;  2QYG A;  3UVJ B;  2Y8W A;  3WX4 A;  1ZZN A;  5E33 A;  4DSE A;  2HGM A;  1VBY A;  1MWZ A;  3PYD A;  2HVE A;  4XO0 A;  4RUC A;  4HEA 9;  2RHQ B;  3MCS A;  2GW8 A;  2OPS B;  1L3V A;  2DVI A;  4USU A;  1FXL A;  4F67 A;  3M8Y A;  2YX7 A;  1KR4 A;  4DL0 C;  3KOA A;  1I3O B;  4JB8 B;  2VBX A;  4FVC A;  2YNH A;  2ERR A;  3MMA B;  1HWU A;  4DEZ A;  1TVR B;  1RT1 B;  4P2X A;  3BSC A;  4O0N A;  5KFY A;  3TAN A;  3PRV A;  1Z1Z A;  2I8E A;  4DR3 F;  1SH3 A;  2ALZ A;  3OSP A;  1ZTW A;  3K5P A;  2NSC A;  3DOK B;  4QBU A;  1SI9 A;  2EFQ A;  2I5J A;  1LFW A;  3PJ9 A;  4OFZ A;  4U7C A;  5KT5 A;  4DQQ A;  5KFI A;  2OMO A;  5IWA J;  2RU9 A;  2KG0 A;  3IS9 B;  1HL6 A;  4F8R A;  4Q7A A;  4N5S A;  4BC9 A;  4KTQ A;  4YB7 A;  5IQQ A;  3T1Y J;  1HBU A;  3MEC A;  4OJ3 A;  4FPI A;  4BS2 A;  4LRA A;  1DTT A;  5CA5 A;  3VAF A;  2JSX A;  3OLB A;  4OYB A;  2K3I A;  3D68 A;  5BR8 J;  1M1H A;  1JQG A;  2MXY A;  2JLF A;  3G6E S;  2B9Y A;  3W5Y A;  2XSJ B;  5HMY A;  2CZ9 A;  5DJB A;  4HTI A;  4B9V A;  4L3N A;  1V3S A;  2C28 A;  3EXY A;  5BYQ A;  4RNN A;  4KO0 B;  1Q53 A;  4C4W A;  5CAA A;  4O0I A;  4LUB A;  3I5C A;  3EZU A;  1IQZ A;  1V3R A;  1IKV B;  4FXW A;  4A8M P;  5LSR A;  2MEW A;  4PPD A;  4PAB A;  4YS2 A;  1S99 A;  4RU9 A;  1U0H B;  2D74 B;  3J7Z 5;  1UA0 A;  4C98 A;  2QRR A;  2VDH A;  1UVK A;  1QAI A;  1RT2 A;  5K5M A;  4ILL A;  4ZPV R;  4NX9 A;  3HUL A;  1ZAV A;  2BKN A;  4USV A;  2QSW A;  3ITH B;  3V4I A;  3C46 A;  1UAW A;  4X4S A;  3T5K A;  2QTW A;  5DS7 A;  1KS2 A;  1X9S A;  3WQP A;  4FYW B;  1IWA A;  2LYV A;  3S8S A;  2DCU B;  3JYT A;  2ZWP A;  3W9H A;  1QE1 A;  2D7S A;  5IV3 A;  1HBM A;  3MPD A;  2HHP A;  5CAB A;  3GSD A;  3HM9 A;  3AA8 A;  4DFP A;  2V50 A;  1X5O A;  2MGZ A;  1VJW A;  4DG1 B;  4B3T F;  2R7W A;  1U1M A;  3EJM A;  3KHG A;  2JRS A;  1NJI T;  3IWX A;  3W64 A;  3I96 A;  2AP6 A;  2ZBI A;  6FDR A;  1N33 F;  2VQF J;  2WON B;  4P9S A;  3SYZ A;  4UT4 A;  4XPC A;  3PYG A;  5B0A A;  2QYC A;  2IM3 A;  3MEC B;  3HI9 A;  3R5A A;  1DTT B;  3GPA A;  2ZUG A;  4DV0 F;  2FZK B;  1R8P A;  5IC4 B;  1E6Y B;  1TR0 A;  1XMO F;  4DR4 F;  4ZPT R;  3CCV S;  4RUB A;  1H6K X;  4Q43 A;  3P4U B;  2DNZ A;  4YDD B;  5KG1 A;  4JI8 F;  2HVI A;  4NLQ A;  2NQP A;  1GEH A;  2J6U A;  3LP1 A;  3EGV A;  4K4Z A;  3R5J B;  3BQ1 A;  2GMJ A;  1I94 J;  2I9S A;  5D6G A;  5I3Q A;  2Q79 A;  1U6B A;  2HVH A;  3U7J A;  1S6Q A;  4DR7 F;  4DUZ J;  4F3O A;  1MWY A;  8AT1 B;  5FII A;  2AV5 A;  3RR8 A;  2BX6 A;  1PGZ A;  2OFH X;  5D3G A;  1QUV A;  2Z57 B;  3L09 A;  4L75 A;  3D6H B;  1NPR A;  1S6O A;  4M5L A;  2QLJ B;  1ZH5 A;  1RT2 B;  4WF9 Q;  1TUV A;  4CO0 A;  3PX6 A;  3IXQ A;  3V4I B;  3VAM A;  4TLQ A;  3EYZ A;  3HXM A;  3U27 A;  3M4X A;  4DSK A;  2XMM A;  4CO4 A;  2C2K B;  2AT1 B;  1URR A;  2W24 A;  2W7A A;  5E3A A;  1NK9 A;  3FQL A;  1TV6 B;  4DHV A;  1NH7 A;  1LWC A;  1O6X A;  3JYT B;  2DHG A;  5A8K B;  3JAM Y;  2M88 A;  4LJM A;  2RAQ A;  1U4B A;  3PR5 B;  3IWN C;  1RAJ A;  3DFE A;  3H25 A;  4P72 A;  1TL3 A;  3I5B A;  2CNO B;  4N77 A;  1U1R A;  4V19 J;  4KKO A;  3SDE B;  3OVS A;  4JV5 J;  4I0W A;  2VFV A;  2GJI A;  3CD5 A;  2Z0G A;  4DR3 J;  4WU3 A;  2C2O B;  2YWF A;  2DIS A;  4F2R A;  5IQ6 A;  2ZZT A;  4A8X A;  1X0F A;  3CDB A;  3AA9 A;  3E01 A;  2JEG A;  3F56 A;  2HW3 A;  1TAQ A;  1KQG B;  1SJQ A;  4LF6 F;  1S79 A;  2W01 A;  2DGX A;  3CD6 S;  2CG8 A;  4RBV A;  1RT4 B;  1NKB A;  4UY8 5;  2YQ0 A;  3B6B A;  1N54 B;  4J9V A;  2XI3 A;  1GMW D;  2Z8Q A;  4Z37 A;  1N32 J;  1VYA A;  3P5T L;  3EDQ B;  2E9Z A;  2HHX A;  4ED6 A;  1H38 A;  1JJ4 A;  2MLY A;  2ZBR A;  4ES1 A;  4LF1 A;  2PN6 A;  1KN6 A;  3W9I A;  2UUC F;  2N4D A;  3HF5 A;  4ZHR B;  3VQS A;  2HFS A;  3M2V B;  1FRI A;  2NUU G;  1RHK B;  3BKU A;  4FBU A;  2NYH A;  2ALY B;  5D3G B;  2OPP A;  4FNH A;  2HFO A;  3C19 A;  2AZ1 A;  3HT0 A;  1HI0 P;  1JLG B;  4OZ5 A;  3MEG A;  4USM A;  5HAO A;  5IS2 A;  1T95 A;  1XMQ J;  3KFW X;  3RYL A;  3NWG A;  3KXD A;  3KJF B;  2HRU A;  2G2O A;  1R0C B;  3CJ8 A;  3I6P A;  1C2P A;  1RWM B;  1FNX H;  4B9T A;  1IBL F;  2VG5 A;  4LIR A;  3OTE A;  4N56 A;  3FCV A;  4HL9 A;  1LWC B;  2HMI A;  3L9Z A;  9ATC B;  1N36 J;  3GV7 B;  1LK5 A;  4I56 A;  4YHH J;  3OL6 A;  1M90 T;  2KVI A;  5H9F K;  2HHV A;  1TL3 B;  3Q8S B;  1EQ0 A;  2F8M A;  4F4Z A;  3MM9 A;  3CJK B;  4KKO B;  1JLF A;  2DGT A;  3DLH A;  1BWE A;  1G4C A;  4H4O B;  4MH8 A;  3Q83 A;  1Q86 T;  4FKY A;  2MZ1 A;  1HBO A;  2JDJ A;  1OO0 B;  1DZ5 A;  3A8K A;  2V63 A;  2R2R A;  4Q45 A;  5J2N A;  2MKC A;  4QIG A;  1TKX A;  2MY8 A;  4XDC A;  1H3D A;  1UWB A;  4OIX A;  3E01 B;  3HSG A;  1QTN B;  1B0P A;  4HI2 A;  4ZLL A;  5J2Q A;  4JOU A;  1RTH B;  3UW1 A;  1WC0 A;  2OTJ S;  3BF4 A;  1FFG B;  1N33 J;  4KB7 A;  4WU2 A;  3NOG A;  4CTA A;  3L7O A;  1VBZ A;  4LFC F;  1VQM S;  2IM0 A;  4KSE B;  1WHY A;  4JV0 A;  3CDE A;  1LW0 A;  3MM5 A;  5ETL A;  4YB1 P;  5FD1 A;  4DX7 A;  3KKF A;  1A7G E;  1KVI A;  1Y10 A;  2IC3 B;  3MHY A;  2K3K A;  2K7J A;  1HI1 A;  2OPP B;  4CLP A;  5DGA A;  2MQN A;  5ETR A;  2J76 E;  4IFV B;  1CQM A;  2MQ8 A;  4JI8 J;  4IO9 Q;  4DDF A;  1RKJ A;  1EET B;  3V6D A;  3K5N A;  4YR2 A;  5KOX A;  4KHR A;  1HW8 A;  4WIQ A;  2HNY B;  2CPF A;  1F2H A;  3VTI A;  2FJB B;  4DR1 F;  1JJ2 R;  1RHR B;  2JL9 A;  4J9L A;  1TL7 B;  2HMI B;  2FTR A;  3FK4 A;  2QL7 B;  5KG3 A;  4QU7 A;  4OI0 A;  1WTF A;  5GAE I;  3U1N A;  3R5G A;  1Y7P A;  1RTZ A;  2W4D A;  1ITP A;  3ILO A;  4UQG A;  1Q4R A;  4OI2 A;  1GNK A;  5ETV A;  3MM9 B;  3P6Y C;  4IOC Q;  1JLF B;  2ADB A;  4C9D A;  1DQ8 A;  2P9G A;  1IR0 A;  3D7S B;  4WKY A;  5B08 A;  2FPH X;  5KFJ A;  2HFU A;  2E5L F;  1Q78 A;  2FLO A;  4F02 A;  1LXJ A;  4K59 A;  4O3P A;  3M8Z A;  5J2N B;  4FBT A;  4LQ3 A;  3BGO P;  2NXE A;  4WTY A;  4A47 A;  1ARO P;  4ANC A;  1UWB B;  1VS3 A;  1M5H A;  1UFK A;  3RBZ A;  2KT5 A;  2QA2 A;  5KFC A;  2O3D A;  3IAS 9;  2V2K A;  4LQ9 A;  2ZBC A;  1Y5I B;  1M1G A;  2KTQ A;  2EPI A;  3QT5 A;  4ZCL A;  2QMW A;  1NPP A;  2QLB B;  2HFV A;  4PEO A;  3Q22 A;  3DOL B;  4O3R A;  5F3T A;  4K0K F;  4O23 A;  2RJZ A;  1CC7 A;  2WVB A;  3GB0 A;  4JI5 J;  2PI5 A;  4CLU A;  1QSS A;  2FHJ D;  2CVE A;  3M9M B;  4LF6 J;  1S1U A;  1VOM A;  2YWE A;  3AD8 C;  3R5D A;  2MB0 B;  1JXL A;  1HNX J;  2DB1 A;  4A8F A;  3UN2 A;  3GCW P;  4ED4 A;  1JWW A;  1WAC A;  3V6J A;  3H59 A;  1EP4 A;  1HKA A;  3LQV A;  4D3H A;  2HNZ B;  4P7V A;  4OHW A;  3OD2 A;  5LMN J;  3S7R A;  3DYA A;  1RGV A;  2VC1 A;  2VHG A;  4I2Q A;  3ZTP A;  1Z2L A;  3O5T B;  2IAJ A;  3NEK A;  2XYG B;  3DGV A;  4JI1 J;  2VDI A;  4F4Y A;  3T1H J;  3PW4 A;  1F2G A;  2HVD A;  4KV8 B;  4RNF A;  2GML A;  2BBE A;  2JVR A;  3PW2 A;  2COL A;  2ZJP Q;  2W9B A;  4U8Y A;  2CG4 A;  5C5J A;  4RU2 A;  4NOH A;  4HT7 A;  3MD1 A;  1RTI A;  3VAL A;  2MZR A;  2UUA F;  3V6K A;  4PWD A;  4KH1 B;  1QM9 A;  3D5M A;  4CYU A;  1SXL A;  3NL0 A;  2CZ4 A;  3CCL S;  2Q1L A;  1XQI A;  3M2U B;  4ICL B;  3GFZ A;  4ES3 A;  1RTJ A;  1FEE A;  2R3V A;  4YQW A;  3VAI A;  4AL6 A;  3PEH A;  2AEJ A;  2FZC B;  2YKQ A;  3UDC A;  3Q8R B;  4IR1 A;  1LWF A;  5KFZ A;  2UUB F;  1CG2 A;  1CJK A;  4WFY A;  1G7C B;  1VCT A;  3FDS A;  4O4G B;  4CO2 A;  2GO9 A;  3QGI A;  3QRR A;  4KC5 A;  3R5C A;  2EFP A;  4X62 J;  2BUN A;  4K4W A;  2ZH2 A;  1HWJ A;  4R0E A;  5K8N A;  1NHV A;  5K9F A;  1YIJ S;  1REV A;  4HKQ A;  4OX9 F;  2JEJ A;  3PCO B;  4UOC A;  2AYB A;  2AJ0 A;  1DBD A;  2VH7 A;  3IMQ J;  3RAM A;  3KJV A;  1V6H A;  1EAR A;  2V2V A;  1RU1 A;  2N4C A;  1RHU B;  4ZPC A;  3HSD A;  2Z2L A;  1XIQ A;  3C3L A;  4MIW A;  4C0O C;  2UV8 G;  3JQJ A;  4URG A;  5KG4 A;  2FLP A;  3C16 A;  3K17 A;  4LFC J;  1EP4 B;  2IFX A;  3K5L A;  2PEB A;  4O44 A;  4QPX A;  4PUO A;  3M30 A;  3UN5 A;  1SJ4 P;  2HZV A;  4EO6 A;  3C6U A;  3MM6 A;  2DH8 A;  3T5J A;  3GV5 B;  1LNQ A;  3DKD A;  4RUA A;  2OJ3 A;  4FYV B;  3W1Y C;  2J5A A;  4M1K A;  1JKH A;  2WVE A;  2NZC A;  3H98 A;  4DL7 A;  3AJ1 A;  2IAJ B;  3TZY A;  1S72 S;  3WIU A;  1EJ7 L;  2AWZ A;  5BXI A;  3N6M A;  5J2M A;  3FFI A;  4QWC A;  4NMX A;  4PXB A;  3CJ0 A;  2AYE A;  2HWT A;  5KFH A;  3ZZR A;  4KPY A;  1HLW A;  2CPX A;  1CC8 A;  1WHV A;  1SKU B;  1HMV A;  3G9C A;  3MED A;  4PWD B;  1RXO B;  2Y9H A;  4OV1 A;  2XGQ A;  1NZ8 A;  3PV8 A;  4ELT A;  4QR1 A;  3FUY A;  1JNZ B;  3CC2 S;  4MYU A;  2IM2 A;  1WC3 A;  4B3M J;  5L1I A;  2GAG C;  1RTJ B;  2HWI A;  2O5D A;  2DGV A;  3GYG A;  4R0J A;  4KGX B;  4OX7 A;  1B7Y B;  2CQ3 A;  2E5I A;  4FF1 A;  2RUG A;  5C2C A;  1H72 C;  1NM2 A;  3CO9 A;  2ZH8 A;  1AFI A;  1CJK B;  1HR0 J;  3QIP A;  2ZHA A;  4DSF A;  2A1B A;  2BJ9 A;  2H5E A;  5T14 A;  3H5S A;  5D4O A;  1TK8 A;  5DM6 Q;  3KTQ A;  2ACM A;  1OQ3 A;  2VIH A;  1U6Z A;  1REV B;  4PYA A;  4C11 A;  1DHM A;  2VF3 A;  3QRQ A;  4WPA A;  3TR5 A;  1SCJ B;  4JI4 F;  4EBE A;  3BKF A;  2EW9 A;  3K58 A;  4ED1 A;  3FCW A;  2QA4 G;  1NK6 A;  3IWL A;  4HH0 A;  4CO5 A;  3GYN A;  5C42 A;  1J5E F;  1SBR A;  3HFZ B;  1HNI A;  4KRW A;  4C6A A;  3M30 B;  2HBZ B;  3DLB A;  3LTO A;  5CHC B;  3S6E A;  1RAC B;  1FDD A;  2LMI A;  2APO A;  1RT7 B;  4J9P A;  2DXD A;  3WIV A;  4KGZ B;  2HRT A;  3MEE A;  2RS2 A;  3G82 B;  4DPW A;  4JYA J;  1JKH B;  3F44 A;  2ZUA A;  3CJ2 A;  3TQE A;  4JI6 J;  3QYY A;  2JNJ A;  4HDG A;  1OYE A;  1TL1 A;  3FFI B;  3LAN A;  3DMJ B;  1S48 A;  5KFG A;  2LA6 A;  3FBE A;  3FVY A;  2LFV A;  2R7Q A;  3C15 A;  4KQZ A;  1QVF R;  3P3D A;  2HHS A;  3PFO A;  3QT6 A;  2HIQ A;  3M1V A;  4B17 A;  4LF4 F;  2P6S A;  1DAR A;  1HMV B;  2YH1 A;  4B3O A;  1L3T A;  1QUP A;  1FTC A;  5BJR A;  4UF4 A;  5GAH I;  3GIK A;  3O3L A;  4C8Y A;  3PR4 A;  3GG1 A;  3ZZY A;  3VVT A;  5EUH A;  2CPE A;  3D4J A;  4ELU A;  4CLW A;  2FJW A;  2AYG A;  4DV5 F;  3OJU A;  3HMJ G;  3P49 B;  5GAD I;  1H2T Z;  3PHE A;  4OZ2 A;  2J7U A;  4ZP8 A;  1TKZ A;  1TL5 A;  2CA9 A;  3EDR B;  1N34 J;  3MAA A;  3M05 A;  3OL8 A;  3A3N B;  1S1T A;  3KK1 A;  1YIT S;  3MR3 A;  3Q24 A;  4ZIT A;  4YN3 B;  1NHK L;  5IM0 B;  3TAM A;  3GP9 A;  2GMH A;  2KXH A;  3U1L A;  1DQA A;  1IBM F;  4XPE A;  4DCJ B;  1N5Y A;  1QJH A;  4NYO A;  2BJE A;  2AX1 A;  2UVW A;  3GJT B;  4FPR A;  4YR0 A;  4OHY A;  2XS7 A;  2WSC C;  1GX5 A;  4DV4 F;  4QW8 A;  2YNG B;  2Z30 B;  5FDL A;  5C42 B;  2RF2 B;  4PQU A;  2D1C A;  4BCA A;  2LEC A;  2GJ2 A;  1X0P A;  2H3E B;  2C3M A;  1UEK A;  1T3O A;  5B0G A;  4NA1 A;  1CSJ A;  2X1F A;  4LT6 A;  2PMW A;  1SQG A;  3MEE B;  1YLX A;  1CEZ A;  1MSW D;  1T03 A;  2MKI A;  4FVM A;  1MU2 B;  2MKJ A;  2K8G A;  2G1D A;  3MFI A;  4ZLN A;  1TL1 B;  1HHQ A;  4HAC A;  2YNF A;  4DV3 F;  3J7Y U;  1PAU B;  4DUY F;  4DR5 F;  1BQM B;  3EUN A;  3C15 B;  3SV4 A;  2YWW A;  3DI6 A;  2VPZ B;  4YP3 A;  4KFB A;  4CLK A;  4X65 F;  3M1V B;  2ZHO A;  1QTM A;  1FK9 B;  2HAI A;  2MKH A;  3IR5 B;  4B3O B;  4PRF A;  3QBC A;  1EB0 A;  2F63 A;  4C8L A;  1UVJ A;  3ISN C;  3VQT A;  5IZH A;  1FJ7 A;  1EZZ B;  4DFK A;  3HCX A;  2XYP B;  2JWN A;  5D0R A;  3VVU A;  1ZS6 A;  4CWB A;  2MTL A;  2FD2 A;  3CDW A;  3DDI A;  4AQY J;  3MR7 A;  4P10 A;  4RBU A;  2VJV A;  2FVC A;  3KHR A;  1KP6 A;  3EGZ A;  2BA9 A;  5H9E K;  4JI7 F;  3PXG a;  2AHO B;  2ZE2 B;  3TA1 A;  2VPX B;  1RAO A;  3EGW B;  4LF8 F;  1Y5N B;  4MKA A;  3IR6 B;  3KDN A;  4IO1 A;  1SPB P;  5M2R A;  1YJU A;  4BWM A;  4QYZ K;  3BB5 A;  2FVR A;  4LF9 J;  3CUN A;  3CJ5 A;  2EG1 A;  2JFK A;  2GGP A;  2BQ3 A;  3M8P B;  5K8O A;  4NZ6 A;  1RZM A;  1UZD A;  3R6L B;  4XTT A;  2FUG 9;  2DKO B;  4CLY A;  1RT3 A;  3CSK A;  5LM7 E;  3QO9 A;  4KGV B;  4ILM A;  2HPU A;  4K2J A;  4DX5 A;  1RCX B;  3ENV A;  5EWE A;  1X5T A;  2XZT B;  3OTC A;  1Q8L A;  5F8L A;  1HD0 A;  4DR2 J;  3OLA A;  4PXE A;  2LKZ A;  2V6A A;  5D4P A;  3Q8U A;  4NLY A;  3RJM B;  4X4R A;  3ADA C;  2FJA B;  1CS4 B;  1VQ8 S;  3ZZO A;  1WD6 A;  3X3U A;  4WII A;  5DQH A;  4CRJ A;  1Y11 A;  3F73 A;  2RVJ A;  1S6U A;  3SQG A;  3DI6 B;  3OTO F;  3LAL A;  4AL5 A;  3EVO A;  5HMW A;  3GJQ B;  4DS5 A;  4TU9 A;  2Z4P A;  2QX0 A;  4YR3 A;  2RQK A;  1XR6 A;  4OX8 A;  2V4J A;  1HQU A;  4IH7 A;  3MWB A;  2YNI A;  3D0H E;  2X1B A;  4B3S F;  2NPF A;  4ETX A;  3MOJ B;  2LP4 A;  5KOW A;  2MQP A;  1R0A B;  3W2V B;  5IT9 Y;  2EFG A;  4NRT A;  1SB6 A;  2NXJ A;  3UCG A;  1CJT A;  2IDL A;  3N6L A;  4I7F A;  1ZZF A;  4Y28 C;  3KNA A;  1M1K T;  1U26 A;  2HYI B;  3M8Q A;  5CD4 H;  4J9S A;  1LW2 B;  3T41 A;  3M6X A;  2VG6 B;  2ZHB A;  4DV2 F;  5IC6 B;  1KTV A;  2DNL A;  1M5S A;  1WC4 A;  1U1L A;  1YRT A;  2OEL A;  2LLZ A;  2ZZN A;  2YVS A;  3MUV P;  3PKM A;  3D28 A;  4MIB A;  4UZC A;  3RRG A;  1SJ3 P;  1TKT B;  4X2B A;  2R7R A;  1C1C B;  1H73 A;  1U1Q A;  3QO9 B;  1FRX A;  2KU7 A;  4OYI A;  2V8G A;  3JQM A;  1JLC A;  3QGP A;  1JIH A;  4U7U K;  4QZV B;  2G2Z A;  2QV6 A;  3FRZ A;  1IJF B;  4L6V 3;  2VG7 B;  4TY9 A;  2ILZ A;  4IOA Q;  2B6A A;  2B9X A;  4A8K A;  2L9N A;  2RQC A;  3ENQ A;  5J1N A;  2W2Q P;  3T3F A;  3N79 A;  2C3U A;  2MQL A;  3KHL A;  3OUY A;  1WDD A;  4I67 A;  2MST A;  1I5O B;  1HA1 A;  1IBK J;  3H2L A;  3TQ1 A;  1U7L A;  4YFU A;  4NLG A;  1ZOT A;  3SFG A;  1S1X A;  2V8H A;  3HT3 A;  4FKX A;  1Y0H A;  1S0O A;  1PG5 B;  3EIC A;  3M8R A;  1UL3 A;  2W7P A;  4LFB J;  3KLI B;  3SCL E;  2H5I B;  1RWP B;  1O51 A;  3ETM A;  2CPJ A;  3NWR A;  1DUR A;  4A8Y A;  2EFO A;  1Z2Z A;  3HVT A;  3CME S;  1W26 A;  2V4J B;  1HQU B;  3DLG A;  1F60 B;  4DR5 J;  1CLF A;  4DR6 F;  5LJ5 Y;  5EWF A;  4NRU A;  2CNL B;  3ET6 B;  1ZM4 A;  3R3T A;  2XO6 A;  3A12 A;  2FLN A;  1P9Y A;  3FBF A;  2PMH A;  4XIU A;  4X65 J;  1CJT B;  4WFA Q;  4ZVG A;  4I2P A;  4WE1 A;  4R25 A;  2XCA A;  1PYO B;  4P73 A;  3W61 A;  3M8S A;  1NDK A;  3M8Q B;  1WI8 A;  4C3M A;  4WFB Q;  2LCW A;  2VFU A;  3JSB A;  5EX3 A;  2CQ2 A;  1U1O A;  2R8I A;  3O8W A;  1RAG B;  4CM2 A;  5CZV A;  3R7N B;  2XLK A;  2DR9 A;  2OEJ A;  3IR7 B;  1S1V A;  3VZH A;  2DPJ A;  3KG4 A;  3WHI A;  3TUJ C;  1PJ5 A;  3OXL A;  1UJ4 A;  3W60 A;  4FZV A;  3GSI A;  1VQY A;  2IJR A;  3NMA A;  1WJ9 A;  2DR6 A;  3RZA A;  1HHS A;  2O66 A;  2I0X A;  1S5Z A;  4DV7 F;  1G3O A;  3QJL A;  4YY3 F;  4IG3 A;  3BJY A;  1SJR A;  3UWT A;  1Y9O A;  2FGO A;  3QT8 A;  4M5K A;  1FRH A;  4OLO A;  2IYI A;  3FEX B;  5D8H B;  1RT6 B;  1YSJ A;  3ULH A;  2HEK A;  2DBB A;  1HNZ J;  2P8I A;  3OUY B;  1K0T A;  2KJW A;  1N5Q A;  2UUW A;  3JQK A;  4H4M A;  1CJU B;  4PQA A;  3GIL A;  3UN3 A;  1DQ9 A;  2VV5 A;  4USW A;  3W5Z A;  4MTP A;  2XLJ A;  4HI1 A;  1XNQ J;  2XMK A;  4RPF A;  4OI4 A;  5ETK A;  2KRB A;  2AU0 A;  1IKX A;  4CI0 B;  1OY8 A;  1RK8 A;  3ONQ A;  2WBM A;  1JJH A;  1Y3J A;  4RW9 A;  2DK2 A;  4NLR A;  4LF5 J;  3PO5 A;  2WW8 A;  2DYA A;  1B64 A;  4L74 A;  1HW9 A;  1JLQ A;  4U9R A;  1ZAX A;  3H5U A;  4DX6 A;  2XGP A;  1L3S A;  2CJX B;  4LRC A;  2UXC F;  4J37 A;  2JC1 A;  2Y1J A;  5SUH A;  2BMB A;  4OYX A;  3AHP A;  5GAG U;  3GII A;  5KFV A;  2C3O A;  1FE0 A;  4QR0 A;  5CZX A;  3R27 A;  1SL0 A;  1C4C A;  5KG5 A;  3KLE B;  4A48 A;  4Z7Y A;  5AXL A;  3CJT A;  3QLH A;  5CQG A;  2MZT A;  2W4C A;  4WFN Q;  2DCL A;  3GON A;  1S1V B;  2DGS A;  3HHE A;  2FY8 A;  1GK8 A;  4NLW A;  5I3U A;  3P8B B;  4P75 A;  4ALZ A;  2J6S A;  2LQ8 A;  3BRE A;  3GTY X;  3RBX A;  4IKA A;  2D3O 1;  4ANE A;  1SC1 B;  3MCN A;  4NXN J;  1XR5 A;  2DGW A;  1OWX A;  3MM7 A;  2VOD A;  2FHM A;  3K59 A;  3AJ2 A;  3OFF A;  2F3J A;  2J9D A;  2YX1 A;  2CJB A;  3UDV A;  4EMD A;  1Q16 B;  3HHL A;  4NE9 C;  4OX6 A;  3QMQ A;  2XMT A;  4F4W A;  4N47 A;  3MUM P;  5KFT A;  1Q8I A;  4UST A;  4F7V A;  2QJ3 A;  1UPM B;  4O3N A;  2HZC A;  2DRD A;  1TFY A;  3UR3 C;  2BJD A;  2EWH A;  2LXU A;  4YOE A;  1S9G A;  1GXU A;  1GH8 A;  1G6B A;  3TZZ A;  1J5O B;  4KJI A;  3ENA A;  2HQI A;  3BS9 A;  2IJN A;  4LBH A;  2OPR A;  1HNW J;  2X3G A;  2B8Q A;  2UZA A;  2L48 A;  1T8E A;  3KG1 A;  1FF2 A;  1O8B A;  2WOM A;  1MG7 A;  2AJF E;  2MZJ A;  4GKK J;  2IRU A;  2EG2 A;  2EKN A;  3LP2 A;  3NBP A;  4ZP9 A;  2DXF A;  2HHU A;  1U09 A;  5IT0 A;  4OJH A;  3PNI A;  1MN9 A;  4ELV A;  2EVZ A;  1Q8K A;  1RAF B;  3CTR A;  3HHN B;  2UXD J;  1IKY A;  2CYY A;  1XC9 A;  3OVA A;  4J9M A;  1BHN A;  1CJV A;  2KO1 A;  1HPZ B;  2D9O A;  5D78 A;  4DFM A;  3QNW B;  1XNR J;  4N7T A;  6FD1 A;  2AX0 A;  3QT7 A;  2R9L A;  2NLW A;  3OW2 R;  5EHH A;  1ZAW A;  5LT5 A;  3ZNJ 1;  3QLH B;  3G8Q A;  3MZI A;  5HRO B;  5AE2 A;  4ZLJ A;  4AL7 A;  1Q5Y A;  2W2N P;  3C2P A;  2M5Y A;  3AOB A;  5KT6 A;  3I9Z A;  2KYX A;  4ILR A;  3J7A 1;  2J0S D;  1SC3 B;  3EVW A;  2LXF A;  2E66 A;  1T05 A;  4X84 A;  2VBW A;  2JFD A;  3S1T A;  3MR2 A;  3HSZ A;  2EK1 A;  3DGP B;  3MEK A;  1ULR A;  2CNN B;  1N52 B;  4K50 A;  2QIF A;  5A8W B;  2WVF A;  4OZ3 A;  4OYW A;  4QW9 A;  4K8R A;  5A0Y B;  2GFF A;  3BQ2 A;  3DN9 A;  1NB2 A;  1OPI A;  2K06 A;  3KLF A;  5LSO A;  2IBO A;  4CZC A;  3C14 B;  3KLH B;  2WCX A;  5FJ4 A;  1BUX A;  3KMS A;  2E7X A;  1TQL A;  2GC8 A;  2OPR B;  3LO3 A;  4WK3 A;  5ETN A;  1NJY A;  4G1P A;  3DU5 A;  3DRS A;  4WTO B;  2GHV C;  2YPZ A;  1HYS A;  1VQO S;  3K7R A;  3D54 A;  3I0R B;  3QZ8 A;  1RCO B;  3HJV A;  4IRD A;  3NBP B;  2BDP A;  1VDH A;  4C48 A;  4Q8E A;  1VC0 A;  3QWU A;  5FLX Y;  3AQP A;  2RD5 C;  2CPY A;  5CYQ B;  4Q2L A;  1RWN B;  4Q0B A;  1WI6 A;  1RAI B;  1RAE B;  5BYS A;  4ECT A;  4I6W A;  3BKT A;  5LSL A;  2G4B A;  2RB7 A;  3T19 A;  4IYQ A;  2MMY A;  1WEY A;  1CJV B;  4U6P A;  3WBZ A;  4TN2 A;  3AOC A;  4TU7 A;  1GFW B;  4XDD A;  2WHO A;  1CBK A;  4EU0 A;  2EK6 A;  5IWA F;  4ZPA A;  1BLU A;  2VON A;  2AGO A;  2DHH A;  4D3G A;  1EKS A;  1LK7 A;  2WRM A;  2QA1 A;  2QL5 B;  2LU2 A;  1WDT A;  3BEG B;  1QD1 A;  2H4W B;  1UP1 A;  2OSR A;  3PX0 A;  4HH1 A;  3POT A;  5HP1 B;  1WOS A;  4PCQ A;  1UZH A;  3HLU A;  3N5F A;  1YJW S;  2XB2 D;  4YUD A;  3T1Y F;  2XNR A;  4Z2X A;  3J81 Y;  2M8D B;  1T05 B;  3IRX B;  4GKJ J;  1WEZ A;  2Z2Z A;  2AZ3 A;  3RTV A;  1HAR A;  3BGR A;  1FT8 A;  2CWK A;  1S12 A;  4E8U A;  4A4J A;  1U24 A;  4RW4 A;  3NAI A;  2IPO B;  1N0V C;  5JVG Q;  3QGG A;  2RRN A;  1YQH A;  2MQM A;  2HBR B;  1VQ4 S;  1K0V A;  3B4D A;  4ED2 A;  4USJ C;  2HLU A;  4WZQ A;  3JXO A;  4KT0 C;  2CIM A;  3RRH A;  4AND A;  3QAT A;  4V1A k;  3CCU S;  3VGV A;  3UD3 P;  4PZV A;  3DRS B;  1T9T A;  3QFW A;  2WSE C;  3NCP A;  3W7B A;  4X4N A;  5H9F J;  2ATC B;  2LXI A;  1TMJ A;  2RDJ A;  1X5S A;  4F0M A;  4ECV A;  1S6P A;  5HJY A;  1DRZ A;  4M94 A;  3IN5 A;  4C97 A;  3J7A N;  3KMQ A;  4FF4 A;  2HHQ A;  3SXL A;  1FI4 A;  5ITH A;  1AXQ A;  4NCG A;  1H7X A;  1K1Q A;  5L8R C;  3ISN D;  5I42 B;  3NS6 A;  1SJF A;  4QIW D;  1DAX A;  1SQF A;  1RTD B;  4Y0F A;  4C0H A;  1Q7L B;  2PE8 A;  4MJK A;  2FVQ A;  2KJV A;  2PDA A;  2BE2 B;  4CLS A;  3GV8 B;  2DIT A;  4V19 X;  1QAX A;  4J9Q A;  2CFX A;  2FHJ A;  2RIJ A;  1KWM A;  5A2Q Y;  5AE3 A;  1AW0 A;  3MM8 B;  4PG7 A;  2AJ1 A;  3RBD A;  1ROF A;  1VHI A;  2IJF A;  3BGR B;  5E41 A;  4LBP A;  4R8U A;  3GCX P;  2ZZM A;  5CYM A;  5K14 A;  1APS A;  4WZM A;  4M5I A;  1FJG J;  1X5P A;  4I6Y A;  3NKY A;  3L4B C;  4Y65 A;  1DLO B;  4EI2 A;  1UCN A;  3KLG A;  2LVW A;  1R27 B;  2GQ2 A;  4OI1 A;  5CCL A;  4JI2 J;  3PO4 A;  2BYC A;  2KN4 A;  1Y3K A;  1MMN A;  4JV2 A;  2VOP A;  1I94 F;  4RKU C;  1VRQ C;  1ICE B;  2DR7 A;  2PFD A;  5LXR A;  4F26 A;  4DUZ F;  3IAM 9;  5DET A;  3AY0 A;  4LBI A;  2IDE A;  2XS2 A;  4ZVU B;  1N6Q A;  4X4O A;  2C3P A;  3RR7 A;  4NYZ A;  2QT7 A;  4AXI A;  3BYR A;  4WYL A;  2BW7 A;  2R8K A;  4ZVS B;  1AT1 B;  1PAE X;  3A13 A;  1S6P B;  3PKY A;  2OD4 A;  1ZM3 A;  3IGN A;  2EXU A;  2E5J A;  2Z2Y B;  3CCT A;  1VBK A;  1KBR A;  2YKM A;  3C6T A;  1BWV A;  4GC6 A;  2BOA A;  4Y00 A;  3CCJ S;  5D4N A;  3HSJ A;  2IVM A;  4CP5 A;  1RT5 B;  3CC4 S;  3K89 A;  2YKO A;  2BRL A;  2D69 A;  2YY3 A;  1KQF B;  2XG8 A;  2QE5 A;  2C22 A;  2PSZ A;  4L73 A;  4JV5 F;  5A6P A;  1MRO A;  4GVB B;  1IXK A;  4ATN A;  1WUU A;  3M32 A;  2IIH A;  3O44 A;  2UXB J;  4OYO A;  4NCB A;  2KDO A;  2K1R B;  3I32 A;  5HL7 Q;  1C1B A;  2FGC A;  4NXM J;  4M5J A;  4N76 A;  3VGS A;  2MDA A;  2K7K A;  4Q2M A;  1KC8 T;  1K73 T;  4DPT A;  5C24 A;  4OI3 A;  5I3P A;  5DG7 A;  2KKH A;  5IT4 A;  1XMB A;  2OP5 A;  1FD2 A;  3G6Y A;  3HPO A;  3EWG A;  3GIJ A;  1FER A;  4LR7 A;  1UVM A;  4OZ0 A;  2KZZ A;  1N32 F;  4M8L A;  1S9E A;  3MFH A;  3QID A;  1U0S A;  1T9U A;  3KLG B;  3UI3 A;  5B0F A;  1QAJ A;  3GYX B;  4WK1 A;  1RA6 A;  1FNO A;  1URN A;  4MAK A;  3US5 A;  2Y1L B;  3UD5 A;  4RUH A;  4G65 A;  3I82 A;  3ZC4 A;  2MLX A;  5HN0 A;  3T1A A;  5C2G A;  3DXS X;  2EC0 A;  2GHW A;  1F1B B;  4KHP J;  1HWI A;  2LDI A;  2N3L A;  4ID5 B;  1XMQ F;  3AXM A;  2ZOF A;  5DG8 A;  2ZD1 A;  4CCH A;  1WOR A;  2WSF C;  2H65 B;  2DGO A;  4I64 A;  1N36 F;  1YBA A;  1AUD A;  1WC5 A;  1D9D A;  2G0J A;  4YHH F;  2VPW B;  4ZVE A;  5C7P A;  4X4P A;  4FYX B;  1VLO A;  3TP2 A;  2HS4 A;  2YNH B;  3H20 A;  1I1G A;  2WK4 A;  2N7C A;  1D8Z A;  5KG6 A;  3J80 Y;  3VV2 B;  1VRT A;  5IT9 U;  2AGQ A;  4A8S A;  1MRO B;  4UW2 A;  2OPQ A;  2V69 A;  2H9Z A;  1HFE L;  1D9A A;  2XLI A;  1U48 A;  1JLB A;  3VAK A;  2ASJ A;  3MMB A;  3RAX A;  1NRK A;  2FHK A;  1EHW A;  2OEK A;  2E7W A;  2YWK A;  2I5J B;  3RU0 A;  2PMZ D;  2KL8 A;  3NOC A;  3DDK A;  3THT A;  4O3O A;  1YJN S;  1HNV A;  1FNM A;  3HJF A;  1IKW A;  4X4Q A;  3I0S A;  4F25 A;  5GMD A;  2JOQ A;  2YPY A;  3ZTS A;  1EAY C;  4Y2M A;  2RRB A;  3NG8 A;  5DDQ C;  2HQD A;  2GX8 A;  1GT8 A;  4BHQ A;  3JTO A;  3G86 A;  4QYR A;  4GO7 X;  4CO1 A;  1JLE A;  3MCO A;  4PWW A;  1HBU B;  2DNK A;  5GMK a;  5HK4 A;  4QU6 A;  1WHX A;  1OSD A;  3TAR A;  3BQ0 A;  2AKW B;  4CNZ A;  4AT1 B;  4I4B A;  1YBU A;  4G1Q A;  1FTR A;  1MW7 A;  1KSP A;  2MY7 A;  2P5V A;  3W65 A;  3FSI A;  1P6T A;  2MZQ A;  3OXG A;  5E3R A;  3FBB A;  2M70 A;  4KH0 B;  1L3U A;  1M5P C;  2AD9 A;  2OI2 A;  1TUW A;  2HFN A;  2HUR A;  2HWH A;  2UUT A;  1Q79 A;  1HD1 A;  1FJE B;  3MAQ A;  1T11 A;  2CRL A;  4DI6 A;  2N3O A;  1AA1 B;  3G71 S;  3FZB A;  1PKU A;  2CXE A;  3TI0 A;  1YI2 S;  2ZNZ A;  4F0K A;  3N9U C;  1FO1 A;  3GZ7 A;  2KFZ A;  3QAU A;  4J9O A;  4MIA A;  4LF2 A;  3GJS B;  3GMG A;  4C8O A;  3UCU P;  3HHL C;  1HIY A;  1B99 A;  4DV1 J;  4ED5 A;  3BZQ A;  3IGV A;  1RHQ B;  2E1A A;  1VRT B;  1FE4 A;  4WP8 A;  3R1H A;  3QSY B;  1FDN A;  1NK5 A;  1VC5 A;  2RQM A;  3EMT A;  2XMJ A;  3N6N A;  4CT9 A;  3OPK A;  4RNO A;  4OZL A;  2E1R A;  1QE1 B;  1VQK S;  3W2W A;  2F7V A;  4P74 A;  3NCR A;  2GNK A;  4M5H A;  2E9T A;  3H8Y A;  1X9W A;  1D0E A;  3BO3 A;  1HBM B;  1XBW A;  1T3N A;  4WP3 A;  3RAQ A;  2MGZ B;  1ZM2 A;  1HNV B;  2XYH B;  2NS1 B;  5KAK A;  1RWK B;  1IKW B;  3P5B P;  3H4D A;  4PWU A;  4ZIV A;  4LRE A;  1S76 D;  3N28 A;  3MPU B;  2XM3 A;  1SKS A;  2Z56 B;  1WOO A;  4HHH A;  1JLE B;  1FRK A;  2K2P A;  3DOM A;  4JI5 F;  4TQR A;  4IOB A;  2E5H A;  4EYH B;  2KT2 A;  5F0U A;  4RLE A;  1HNX F;  3SCJ E;  1NSA A;  5DDO C;  4JI0 J;  2N82 B;  1GQE A;  2BAC A;  2FVS A;  3AOA A;  4I69 A;  3VCD A;  5L38 A;  2BW2 A;  1WEX A;  2VKZ G;  6AT1 B;  3LP1 B;  1NBE B;  1VQ7 S;  5LMN F;  3M8W A;  2KH9 A;  3HD2 A;  1IVZ A;  4MYT A;  1T9W A;  1S6Q B;  4ZJO A;  5HVG A;  3LH2 S;  4NA3 A;  1Q5V A;  1DFD A;  1VHF A;  3T6J A;  4JI1 F;  3TUI C;  2J0X A;  3T1H F;  4A8W A;  4DZD A;  1F5A A;  4G6V B;  3N5B A;  5H1S V;  2H1Y A;  1NDC A;  1FDA A;  2ZH6 A;  3TAQ A;  1QSY A;  4NAS A;  5AXM A;  4EBC A;  3IG1 A;  1Q82 T;  1DTQ A;  2DH9 A;  1X60 A;  3R9L A;  2ZOM A;  1MN7 A;  3OFG A;  5K20 B;  1RYR A;  5L39 A;  5L1J A;  1KNZ A;  1QAY A;  1D09 B;  4DL5 A;  1W25 A;  4PKD B;  1ELO A;  2VUG A;  3TZX A;  2C2D A;  3Q2T C;  1UET A;  3DRR A;  1SIW B;  2BZ2 A;  3GFX A;  1BMQ B;  1TMM A;  3IM9 A;  3T5L A;  2XI2 A;  4X66 J;  1BQN A;  2NUH A;  4IFY A;  5AXK A;  4QCL A;  4C8Z A;  1R43 A;  1R8H A;  2JX2 A;  4JUZ A;  4ZVF A;  5MAO A;  2A18 A;  2VBZ A;  2LDY A;  5DDR C;  4MFB A;  1X4G A;  2OKQ A;  4X62 F;  3CCZ A;  4GVL A;  2ZC3 A;  4MT1 A;  1DJ0 A;  5F9N A;  2AJQ A;  5LMU J;  3BPS P;  2C1E B;  1TK0 A;  1CQN A;  5EGY A;  3DDN A;  4H54 A;  4DV6 J;  2KI2 A;  4WFX A;  1RLD A;  1LEO A;  4MK9 A;  5ETT A;  4EO8 A;  2BE7 D;  4OJG A;  2M2B A;  5CD4 A;  1Q7Y T;  4QQB A;  3PTW A;  2OLW A;  4MK8 A;  2PT0 A;  1J2V A;  3NS5 A;  2HKE A;  1VLY A;  1VQN S;  9RUB A;  3KLV A;  2YKN A;  1UMJ A;  2ZJR Q;  2XZD B;  5KFA A;  3ZTO A;  2YQ3 A;  3OL7 A;  5J1E A;  1YVF A;  2DNR A;  1NJW A;  1MLA A;  4O4R A;  5DG9 A;  1UEV A;  1KHW A;  3ENW A;  3MEG B;  2CJA A;  2VIC A;  1OQ6 A;  4FNI A;  4CIO A;  4W4M A;  1CVJ A;  2G13 A;  3IG1 B;  2IY5 B;  4FF2 A;  3GE9 A;  2R2U A;  5E7O B;  1QSL A;  1IR2 A;  3PDN A;  1SJ1 A;  2R7S A;  1RYS A;  3UNG C;  4B02 A;  2VG5 B;  1SUQ A;  5H9E J;  2KT3 A;  2FJX A;  4U67 Q;  3MR5 A;  3BN4 A;  1VFJ A;  1R6V A;  2DT9 A;  1CUL A;  2QC3 A;  4B3M F;  1RWW B;  2HS3 A;  3UR0 A;  2X7I A;  2YWH A;  4QYZ J;  1PC5 A;  4KBI A;  2V0N A;  3JSM A;  1FEH A;  1WKK A;  1VI7 A;  2J0W A;  1WWH A;  1GAO A;  2FC8 A;  2JLE A;  2JVO A;  2NR0 A;  4DBQ A;  3MI7 X;  1HR0 F;  2XTJ P;  1HBO B;  3M6W A;  4UUX A;  4URS A;  3FMW A;  4IR9 A;  3UCZ P;  4RW8 A;  3G96 A;  3TUZ C;  1TL4 A;  2YKP A;  4OYM A;  2G1H A;  5F8J A;  1NK7 A;  4B08 A;  1TKX B;  5K8M A;  2F4V J;  2XS5 A;  2DH7 A;  1V3Z A;  4ZP6 A;  1U8S A;  4C8N A;  3DRP A;  1MNE A;  3G2X A;  4TYB A;  4B9U A;  4ZCM A;  4TNO A;  2G0I A;  2FVP A;  5J2Q B;  4R5P A;  2FY1 A;  3Q8V A;  3UD4 P;  4CTA B;  5E3C A;  2GO8 A;  1OJ4 A;  4ECR A;  1LW0 B;  3H0P A;  1M5K C;  4CQ1 A;  4USK A;  3MM5 B;  4NLP A;  3C8Y A;  4ZPD A;  5KFQ A;  1X4D A;  5J1E B;  5KFL A;  3TVK A;  2PII A;  4JYA F;  4USH A;  1KVJ A;  2AJ4 A;  5ETQ A;  4JI6 F;  2XHW A;  2O67 A;  3Q2S C;  1H7W A;  2GAH C;  4ZVH A;  3TJA A;  1JMT A;  4YME A;  3LWM A;  4DPU A;  2WVD A;  1M5V C;  3UVJ A;  1KD1 T;  3V6D B;  2FJV A;  3PFE A;  5FLX U;  4DF4 A;  4OMF G;  1S0V A;  2YKA A;  5JVH Q;  3EPI A;  3DC2 A;  2CZV C;  1CUL B;  3X1L B;  2ZBQ A;  3MMA A;  2PI4 A;  2RSQ A;  2DO4 A;  1Q1K A;  3F41 A;  2EFN A;  1TVR A;  3ZTR A;  1RT1 A;  1PCA A;  3K2Y A;  1OY6 A;  3KDO A;  1VQ5 S;  3OT9 A;  1D8Y A;  3IBF B;  1UTA A;  1SH0 A;  1WEL A;  2F65 A;  1N34 F;  2JH3 A;  1S7H A;  5D0E A;  3GR0 A;  3NGD A;  3PIP Q;  3UDE A;  2HG4 A;  1NB7 A;  3DOK A;  5HJX A;  3V2U C;  2AIR B;  3TZW A;  1YTY A;  1P8G A;  3J81 U;  3N0V A;  4YB6 A;  2WBR A;  3AXK A;  2G9O A;  3IS9 A;  4NEZ A;  4ZVR B;  5KG2 A;  5G4D A;  2MQQ A;  2DO0 A;  2GHP A;  3MD3 A;  4WCE Q;  4DU7 A;  1WC6 A;  1IQT A;  1DY3 A;  4K4V A;  2OML A;  5RUB A;  3OBI A;  2P9E A;  3V6H A;  1B4S A;  1ZET A;  2J8S A;  1OMS A;  2IVF B;  3DXB A;  4DQI A;  1NJX A;  4OI6 A;  4UTG A;  3UDL A;  4OLP A;  1KVK A;  2ZM6 F;  2CDQ A;  3J7Y I;  2DR8 A;  2YH0 A;  3MPY A;  3G6V A;  4OHV A;  3CF5 Q;  1UW4 A;  2NCK L;  1KTQ A;  1S1U B;  3MTJ A;  5CYJ A;  1HWL A;  2XSJ A;  3CXC R;  3I4H X;  4Q5V A;  5CCM A;  1ACM B;  4KO0 A;  2XMW A;  1OPZ A;  2B7C B;  1RAB B;  1IKV A;  3ZZZ A;  2M8H A;  1A0O B;  4B3R J;  2C42 A;  1HHT P;  3AT1 B;  1U0H A;  3VZI A;  3DYA B;  2VOO A;  1NO8 A;  4ZJQ A;  4I2Q B;  2XSF A;  3SFU A;  2XMU A;  1UJ5 A;  4WXO A;  4DN9 A;  1FVQ A;  3ITH A;  1A6L A;  3CJQ A;  3BH7 B;  4A8Q A;  1WKJ A;  3Q86 A;  1YZ7 A;  1RAH B;  4PG8 A;  1LQ9 A;  2D3O R;  4AQY F;  1U49 A;  2ADC A;  2W9B B;  2V4R A;  1RTI B;  4L72 B;  4P2M A;  3G4S S;  4CYU B;  1NDL A;  1Y5L B;  4DL3 A;  4ZOS A;  3K5O A;  2CNK B;  3NGR A;  4AD6 A;  2I38 A;  1D3W A;  5A2Q U;  1NSK L;  1VIX A;  3QSI A;  4I1T A;  1X4F A;  4LF9 F;  4DG1 A;  4RJV A;  1TUG B;  3K8V A;  2QSF A;  1OYD A;  4B9S A;  2KVQ E;  2FZG B;  2VQE J;  4GO5 X;  3V81 A;  4ITS A;  1LWF B;  2B0G A;  2R42 A;  2WON A;  4NPO A;  4G1I A;  3SSS A;  5HVF A;  2RNE A;  5KFO A;  3TO8 A;  1H98 A;  4ZMM A;  2QLF B;  3PRD A;  4YEA A;  2X1A A;  2DHX A;  3DM2 A;  2MKK A;  3OTB A;  1E6Y A;  2A6O A;  4WWS A;  3KJV B;  2GS8 A;  4MKB A;  4LFA F;  3D0I E;  4DR2 F;  2GIR A;  2FJE B;  5L1K A;  1GMU A;  3C16 B;  1S10 A;  4O44 B;  4PUO B;  5JXS A;  4GMK A;  3AH6 A;  3QFH A;  3C6U B;  3MM6 B;  3K57 A;  3DCA A;  5AXN A;  2Y1I A;  3PEJ A;  4ZVQ B;  2Q6C A;  4X64 J;  5E0O A;  3MAH A;  2J9D E;  3SBM A;  5KFK A;  3BM7 A;  1VQ9 S;  1OS5 A;  1SKW A;  1KQS R;  1FVS A;  5CH7 B;  2H51 B;  2CJY B;  2UVR A;  1RU2 A;  3F0N A;  2G2Y A;  1L3K A;  2GQQ A;  2QO3 A;  5J2M B;  2LEB A;  4M5M A;  4O3Q A;  1KDN A;  1B7F A;  1T9V A;  3BV8 A;  2M9K A;  1JB0 C;  4EGL A;  1LFP A;  4PXD A;  2V34 A;  4U95 A;  1IM4 A;  1TV6 A;  3UO0 A;  3MGJ A;  5I4M A;  3GFY A;  2ZJQ Q;  5A8K A;  2RQ4 A;  2UV8 A;  1S57 A;  3MED B;  4DLG A;  2C2Z B;  2VJU A;  3LGN A;  3NGU A;  3E8O A;  2HAF A;  1NND A;  5HQL A;  3PYF A;  2NXN A;  3B82 A;  1WF1 A;  4IH6 A;  4DF8 A;  1NH8 A;  2MJU A;  4JP8 A;  1IJE B;  2B4V A;  3KG0 A;  3CCM S;  5E2Q A;  3SDE A;  3CW2 C;  2VA3 A;  5AE1 A;  3HZE A;  2DJW A;  4NLO A;  3IA0 A;  1NJZ A;  3V81 B;  1C0U A;  1RQ0 A;  3NLC A;  3LPE A;  4WP9 A;  3SSR A;  1NK8 A;  3LW5 C;  3QIP B;  5ETS A;  2KRR A;  3IBW A;  4OZN A;  1F3V A;  1ZTT A;  4JI3 J;  1PYS B;  3UFC X;  1ZYQ A;  2Z58 B;  3AB4 B;  3ZXW A;  3DM2 B;  2DPI A;  3UE2 A;  1RE1 B;  4C11 B;  1RT4 A;  3FSX A;  2JZ5 A;  5F3Z A;  7FDR A;  4K4S A;  1W7W A;  2V67 A;  2LQJ A;  1LOU A;  2GVD A;  1OSC A;  1VK3 A;  2RKI A;  1FRL A;  3JB9 k;  3QZ7 A;  5B7W A;  4ZHR A;  2H5J B;  3O2I A;  1HNI B;  1RWX B;  2ZM6 J;  1IBK F;  4QWE A;  3M2V A;  1K1S A;  2PD1 A;  2M3D A;  1QDU B;  3D66 A;  2B43 A;  2W9A A;  2BM1 A;  4NLD A;  2R8H A;  2LU1 A;  3HVA A;  2POK A;  1JLG A;  3BBC A;  4LFB F;  3KWM A;  5DRK A;  3THP A;  1HQ2 A;  4OYZ A;  2FLL A;  1WF0 A;  4Y2C A;  3HHL D;  2XBP A;  3GG0 A;  2KG1 A;  1SV5 A;  4USI A;  4FP9 A;  1NAQ A;  3AOD A;  4AXJ A;  3J80 U;  5B0C A;  3D6M B;  3IBC B;  4K4Y A;  5KFP A;  4HVZ A;  2RU3 A;  2V8V A;  2XO7 A;  1P1L A;  3VAG A;  3ZO7 A;  1KLM A;  5IXU A;  4QIF A;  1R8B A;  2JLG A;  3P96 A;  2OO4 A;  7AT1 B;  5J1P A;  1B0T A;  3NNH A;  2ZKU A;  3OFH A;  2CPH A;  3SSQ A;  1RBA A;  3CJK A;  4IQX A;  3R2C J;  4L76 A;  1FKP A;  3CPW R;  2E5G A;  2WB4 A;  4H4O A;  2JHE A;  1BXN A;  4HR2 A;  4P7T A;  2NZ4 A;  5BYR A;  1TKZ B;  3MAA B;  1C0U B;  1PYT A;  2R2T A;  1U2R A;  1KOH A;  1S1T B;  2CAJ A;  4B9M A;  2GIF A;  2HHH F;  3KK1 B;  4H4K A;  3R1L A;  3CJ3 A;  2GIQ A;  3PJX A;  2ZH1 A;  1KFS A;  2RH3 A;  4DQS A;  1SIZ A;  3TAM B;  4KYZ A;  5HQ8 A;  3S01 A;  2MSS A;  2E9R X;  2M7S A;  3EPG A;  5KG0 A;  2HIY A;  1N0U A;  2PFF B;  1T94 A;  3RB3 A;  1RTH A;  3HFK A;  1N5Y B;  4NWB A;  2W8K A;  5IV4 A;  3CJS A;  2GVD B;  1VIS A;  2RKI B;  5KFF A;  1HNZ F;  2Q6B A;  5FDL B;  3TX0 A;  1U8W A;  4XK8 C;  1IR1 A;  4PQU B;  3BGL A;  1LKZ A;  2A2D A;  2V9W A;  1YZ6 A;  2MLZ A;  1YJV A;  2IC3 A;  1F5B A;  2FIU A;  1XNQ F;  5EDW A;  3P45 B;  3BO2 A;  1N5S A;  5K8P A;  4LFA J;  4HHJ A;  4ENO A;  1ZA1 B;  1T03 B;  1VQ6 S;  4IFV A;  1FRM A;  2L41 A;  4DL6 A;  5KFB A;  4LF5 F;  1EET A;  1NXI A;  4HAC B;  1SV5 B;  4FS1 A;  2YNF B;  3KJQ B;  1H0H B;  5KG7 A;  5GAG I;  2XWY A;  2HNY A;  3I55 S;  3MMJ A;  1TK5 A;  2C3Y A;  1BGX T;  2ROP A;  1TL7 A;  4KFB B;  3M2R A;  3W9J A;  1KLM B;  1S0M A;  1LV5 A;  3JAM U;  4QIV A;  4JBC A;  5IOL A;  1S9F A;  4TKT A;  1WC1 A;  2QGF B;  1T02 A;  2DGU A;  2IM1 A;  2ZH4 A;  3GU0 A;  4OZJ A;  4CH7 A;  1LWX A;  2IRX A;  1FKP B;  2F5G A;  4ED7 A;  2HVZ A;  1YKW A;  1R89 A;  4CO3 A;  1QVG R;  1KFD A;  1ZPW X;  3KK2 A;  4J90 A;  4WKR A;  3PM9 A;  1IM6 A;  1RJJ A;  1VQS A;  3Q89 A;  4OYA A;  2KZM A;  4NZ0 A;  1S77 D;  2XQC A;  2DNM A;  5CXT A;  2Z2M A;  4ZA1 A;  2H4Y B;  1SH2 A;  2A3J A;  2IMW P;  4NLU A;  4NXN F;  1O0P A;  3EZO A;  4DL4 A;  4B3T J;  3K0J A;  5LOQ A;  1R8A A;  3FNN A;  2U1A A;  2GGP B;  2V94 A;  4E98 A;  4ID8 A;  4LRD A;  1SVD A;  5G0R A;  1NME B;  4AFF A;  4EYI B;  2R7O A;  3DNC A;  4DPY A;  3D1O A;  3GJR B;  3KHH A;  2BR0 A;  2F8H A;  1YRX A;  5HQM A;  3OVB A;  4BBY A;  2PO4 A;  1RT3 B;  1TEL A;  1YX2 A;  5DZ7 A;  4NEY A;  1R3N A;  3W5X A;  3DOL A;  3CED A;  1RIS A;  2HSE B;  1AYE A;  1WHW A;  3GWC A;  1UVN A;  1BC6 A;  2BJ1 A;  4DV0 J;  3ELH A;  2VFS A;  1U6F A;  1HNW F;  1VBX A;  3H40 A;  1XMO J;  2ZH5 A;  2O1P A;  4DR4 J;  4DZ6 A;  3D67 A;  1N5V A;  4QWA A;  1T9Y A;  3D2W A;  2CPZ A;  1HWK A;  1U1N A;  7FD1 A;  2XY6 A;  2HNZ A;  4GKK F;  3PW5 A;  1S97 A;  4NCA A;  3SQG B;  4DR7 J;  1S4F A;  2M0G B;  2B9W A;  2ZBP A;  3M2R B;  2QZ8 A;  2OIH A;  3RB4 A;  2R7T A;  2ABY A;  4K4T A;  2UXD F;  2UP1 A;  2E44 A;  2B4P A;  2C2M B;  5F8G A;  4F36 A;  3JSR A;  1LXN A;  4KV8 A;  5THW A;  4BDP A;  4F0H A;  3ICL A;  4EK2 A;  3I87 A;  1XNR F;  2CDR B;  1YJT A;  4PPZ A;  2ZDO A;  3BSN A;  2YNI B;  2V9K A;  4K7Q A;  2V8P A;  4K5S A;  3DHW C;  5J2P A;  1N5T A;  1WSR A;  3KK2 B;  5T41 A;  3QAE A;  4I7F B;  1C0T A;  3M2U A;  4ICL A;  5DZ6 A;  3R97 A;  3DLE A;  3RG6 A;  5KT4 A;  4ZCI A;  2L9W A;  1KKH A;  1RKI A;  4KGM A;  5D77 A;  4P71 A;  2CJ9 A;  4DSI A;  4IG0 A;  4QIE A;  1RHM B;  4LMZ A;  1LWE A;  1IN0 A;  2XY7 A;  4E2F B;  3PG9 A;  1MWQ A;  1VIO A;  2VU5 A;  5G0R B;  4O4G A;  2A2C A;  3PYE A;  2AJ2 A;  2KM8 B;  8RUC A;  2HHH J;  4TYA A;  3CUL A;  4FXV A;  4QWB A;  3AAW B;  2QEX S;  3AB2 B;  2JEI A;  1XN9 A;  5DGB A;  1JLC B;  3ILL A;  1F0X A;  1S0N A;  2Y8Y A;  3A1Y G;  1VGY A;  2FB0 A;  4NLT A;  2R7U A;  2DD8 S;  1RP5 A;  2D3Z A;  3SV3 A;  2Q66 A;  3CDU A;  3GIM A;  2RDD A;  2HQF A;  4HLB A;  4BLG A;  1IBC B;  4DFJ A;  2B6A B;  4O3S A;  3FKB A;  3OR1 A;  3FSY A;  1I6J A;  2WAQ D;  3CDA A;  3CB4 A;  3SIP B;  2F40 A;  1JNR B;  2QMX A;  3ISZ A;  5DLF A;  3LA0 A;  2R7X A;  2WTF A;  2KFY A;  2UUC J;  2HQC A;  3RW7 A;  4UQT A;  4QJV A;  4A46 A;  1WTB A;  2CKW A;  1Z4U A;  1U47 A;  5DLG A;  2C2N A;  2CQ1 A;  1S1X B;  2ZKT A;  1GXT A;  1RHJ B;  1GX6 A;  1PJ6 A;  4ZP7 A;  3AFG A;  1K9M T;  3H2V E;  4K2X A;  1YBT A;  3FZ2 A;  2HND A;  2VKR A;  4ES2 A;  3HVT B;  2YWG A;  3E3X A;  2D9P A;  3TVZ A;  3DLG B;  4F3Q A;  1K47 A;  4QWD A;  1VQP S;  1IBL J;  5J2P B;  1MML A;  3QQC D;  4LVN P;  2BE9 B;  4LIW A;  3V4M A;  4N41 A;  3OHB A;  4W98 A;  3A3P B;  4TVA B;  2DXE A;  4I2P B;  4WE1 B;  4C7Q A;  3IP0 A;  2HK3 A;  1BD6 A;  2B9E A;  1C0T B;  2A6M A;  2V68 A;  3W62 A;  4ERD A;  2OAU A;  3DLE B;  2P2C B;  2O01 C;  4GKJ F;  4Y2I A;  2XWX A;  3DU6 A;  3LGM A;  4IG0 B;  2H48 B;  3TA2 A;  3H90 A;  1LWE B;  1O5J A;  1UA1 A;  1Q8B A;  3W8P A;  1GTH A;  1NKE A;  4CLT A;  1EIY B;  2AEF A;  1T9X A;  1TTH B;  2D41 A;  3DLK A;  1X4H A;  4DJB A;  1NK4 A;  5ETP A;  3OSN A;  2DIV A;  1U1K A;  3VGT A;  2OHD A;  2DNH A;  4ETZ A;  3LAK A;  2W8L A;  3VF0 B;  2F1F A;  2CJK A;  2XUL A;  3PIO Q;  4IG3 B;  3FCH A;  4WJB A;  1RDR A;  3OR1 B;  4B9L A;  4LSL A;  1GXL A;  1F3F A;  2W2O P;  1VMB A;  4DSJ A;  4H4M B;  1RT7 A;  1SQE A;  5DO2 A;  4ZDN A;  3G82 A;  4P2F A;  1FES A;  4TXS A;  1YJ9 S;  1X8D A;  5HO4 A;  1BQX A;  4NI2 A;  1IKX B;  4S0M A;  4PG6 A;  3OQ2 A;  3DMJ A;  3LWL A;  2HND B;  4RW9 B;  2HK2 A;  2DEI A;  4KR0 B;  2AF6 A;  3BGF A;  1JLQ B;  2BJ3 A;  2MYF A;  1PIE A;  5L46 A;  4DR1 J;  5LJ3 Y;  1UJ6 A;  3L7P A;  1Q0N A;  3H2U B;  1Q81 T;  3RB0 A;  4GC7 A;  3WC2 A;  4K5R A;  4HT5 A;  3SEO A;  1BE4 A;  4FDF A;  3I4P A;  2EFV A;  3IC1 A;  3H42 A;  2Q3P A;  2ASL A;  4W90 B;  2XCP A;  3PW0 A;  1PJ7 A;  2OD6 A;  5ETO A;  3QRP A;  1GMW A;  2OGU A;  1S49 A;  3NNC A;  3RB6 A;  3IO1 A;  2MHN A;  2R8G A;  3LOU A;  1U2F A;  4DPO A;  1FJG F;  2QLW A;  2E5L J;  5GAE U;  1PC4 A;  1R0B G;  4CLF A;  3DLK B;  1F9H A;  5IM0 A;  5I3U B;  3KUG A;  2RRA A;  1WF2 A;  4JI2 F;  3VR1 A;  4ED8 A;  4CDI A;  1KON A;  1KHV A;  1NEE A;  3B78 A;  3EGN A;  3MM7 B;  2BAN A;  3FBC A;  3PAC A;  3WC0 A;  5JJB A;  1NUE A;  5L9X A;  2HHW A;  1PBU A;  1EX8 A;  3DLJ A;  1D9F A;  3LPY A;  5JMN A;  3M9N B;  2KFN A;  3HHL B;  4PG5 A;  4NZ7 A;  2L08 A;  5KTQ A;  4LSL B;  2YNG A;  2NSB A;  2RF2 A;  1YGY A;  2IA6 A;  5LXY A;  1NSQ A;  3CIM A;  4EFA C;  1B3T A;  3JS9 A;  4J9K A;  4UUW A;  1S4E A;  3BBF A;  2V2Q A;  2BM0 A;  4K0K J;  1S9G B;  4L3K A;  3TW0 A;  2DGQ A;  3R6G B;  2WVC A;  2ZNY A;  4NYP A;  2HBQ B;  1Y00 A;  4J91 A;  3AJD A;  3JTN A;  4ECQ A;  1MU2 A;  1YJ7 A;  3A8I A;  2ILY A;  5EWG A;  4NI2 B;  5T7L A;  2OTL S;  2G0C A;  5GME A;  2MJN A;  2LQ9 A;  2XC9 A;  3D6T B;  3NMR A; 
#chains in the Genus database with same CATH homology
 1VYA A;  3BBB A;  3Q8U A;  1NDL A;  2HUR A;  3EVM A;  3EIC A;  4CP5 A;  3FKB A;  4UOH A;  3GPA A;  3Q8V A;  3NGR A;  3Q8Y A;  3VGU A;  3ZTR A;  4ANC A;  2NCK L;  1HLW A;  3VVT A;  3Q83 A;  3ZTP A;  2HVE A;  3ETM A;  4FKY A;  5IOL A;  1NSK L;  3FC9 A;  3FCW A;  1JXV A;  1EHW A;  1NDC A;  1S5Z A;  2AZ3 A;  1UCN A;  4S0M A;  3NGS A;  4DI6 A;  3ELH A;  1LEO A;  2CWK A;  1LWX A;  3FBC A;  1NSP A;  4C6A A;  1PKU A;  2HVD A;  1NUE A;  3EVO A;  4DZ6 A;  1NDP A;  3R9L A;  1NCL A;  1HHQ A;  2AZ1 A;  3ENA A;  1MN7 A;  1U8W A;  2B8Q A;  2DXD A;  3ZTQ A;  3FBF A;  1WKK A;  1XIQ A;  3EVW A;  2BEF A;  1KDN A;  3VGT A;  1W7W A;  1NPK A;  1WKL A;  3VGS A;  1NLK L;  2ZUA A;  2DY9 A;  3Q89 A;  1NHK L;  3ZTS A;  1S59 A;  3MPD A;  1HIY A;  1B99 A;  2VU5 A;  5CAB A;  1NSQ A;  4DUT A;  2BX6 A;  3JS9 A;  3L7U A;  1NDK A;  3GP9 A;  3ZTO A;  4O0N A;  3BBF A;  4ENO A;  1S57 A;  3PRV A;  1XQI A;  4HR2 A;  3EJM A;  3DKD A;  3FCV A;  2DXF A;  1PAE X;  4AND A;  1NB2 A;  3FBE A;  1MN9 A;  3BH7 B;  5CAA A;  1B4S A;  1WKJ A;  4ANE A;  5C7P A;  1BE4 A;  3Q86 A;  2B8P A;  3VGV A;  4KPC A;  3EMT A;  4F4A A;  4UOF A;  3B54 A;  3NGU A;  1BUX A;  3EE3 A;  3PJ9 A;  3BH6 B;  1F6T A;  1K44 A;  3EM1 A;  4WBF A;  4W98 A;  4F36 A;  1F3F A;  4UOG A;  3VVU A;  3B6B A;  2DXE A;  1ZS6 A;  2DYA A;  3G2X A;  3FBB A;  1BHN A;  3WX8 A;  3BBC A;  4EK2 A;  5BXI A;  3DDI A;  4FKX A;  3NGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...