4X62F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4x62F00
1F60B 3R3TA 1GH8A 2UXDF 4DR1F 4LF4F 4X65F 4LF8F 4JI6F 2UU9F 2RJZA 3T1HF 3OTOF 4DV6F 4B3SF 1N32F 2E5LF 1FJGF 2BXJA 1QJHA 4GKKF 4LF5F 1IBMF 4DR2F 1XNRF 4KHPF 1FKAF 1G7CB 2UXCF 2B7CB 5BR8F 5IWAF 4DR7F 5LMUF 1RISA 1XNQF 1J5EF 4LF9F 1G1XA 1HR0F 4NXMF 4JI8F 1CQMA 4DV7F 4B3RF 4GKJF 4JI3F 1IBLF 4JYAF 1HNXF 4B3MF 1B64A 1IJEB 1XMOF 1HNZF 4DV1F 2HHHF 4JI5F 1N33F 2BVZA 2VQEF 2UUCF 5AJ3F 1I94F 4DR4F 4DR6F 4DUYF 4DV4F 1LOUA 2UUAF 1XMQF 4JI0F 4DV5F 4NXNF 4X66F 4DR3F 1HNWF 4OX9F 4DUZF 4LF7F 2J5AA 5LMNF 2F4VF 1CQNA 2YY3A 1N34F 4JI4F 4YHHF 4YY3F 4DV2F 1N36F 4X62F 4DV0F 3ZZPA 2ZM6F 1VMBA 2VQFF 4X64F 4LF6F 4AQYF 2B7BB 4K0KF 2KJVA 4JI1F 2KJWA 4LFAF 4B3TF 4DR5F 2UXBF 4JV5F 1IJFB 3T1YF 4DV3F 4LFBF 2UUBF 4JI7F 4JI2F 4LFCF 1IBKF
chains in the Genus database with same CATH superfamily
5L38A 3B54A 4PQUA 5F0UA 1Z4UA 3CJSA 4IQXA 2UVRA 3CDEA 1RAJA 2FJWA 2HFSA 2G0IA 5DRKA 1KQFB 2AKWB 1TUVA 2LEAA 2ASDA 3PZPA 5G0RB 4IO9Q 3ISNC 2HBZB 4RO0A 4OYIA 2CQ4A 3EZOA 3D28A 4U8VA 2DNQA 2F40A 2MZTA 4KSEB 2HHUA 2FZGB 1N52B 2MSTA 2BOAA 5I3QA 1HBNA 4X4VA 3KUHA 4CYUB 3P3DA 5D4NA 2DO0A 4FXDA 3F73A 3FCHA 4GC6A 2J7UA 3J7A1 1P27B 4DPXA 1SJRA 2HQIA 2HKEA 5EHHA 4C9DA 4LREA 2GAHC 2GV1A 1LW0A 2RMLA 4I69A 4TXSA 3ONQA 4KPCA 3TA1A 1N5YA 1NM2A 3T3FA 1EHWA 3S7RA 2HSEB 5L1JA 3AAWB 4P71A 2E5LF 4NLOA 5J2MB 2QFJA 1FX4A 4X4QA 2HS0A 4RW9B 4L3KA 2AQ4A 5DM6Q 3K5MA 2ZOFA 4GKJF 3M8PB 3M6WA 4AQYJ 3SBMA 2MZSA 3KOAA 4JI1J 2OMLA 3EVOA 2G4BA 4LRBA 2CPIA 2LXIA 4F2RA 5HQLA 3Q0AA 3OV7A 5E7OB 3LP0A 1R27B 1KOOA 1WD6A 2E7XA 1JQGA 2NXJA 2VFUA 2GNKA 2AW0A 4DLGA 3JSBA 2ACYA 3J7Z5 3W2WA 4A8WA 4ZPAA 2YKQA 3N5FA 3IR7B 4I6YA 2E9RX 2JJ4D 3W5YA 1HNVB 2W4CA 1QUVA 1NB2A 4KFBB 3N5BA 4DQQA 3AXKA 4BDPA 4NCAA 4ZJLA 2AX1A 4DX6A 3DOLA 5C24A 4TQRA 2ASJA 2ASLA 4JI7F 2FDNA 1YJ7A 3PRBA 4ZVEA 1XERA 1Y9OA 2AEFA 3CSKA 1Q7YT 2OMOA 2GGPB 4QR2A 1G6BA 2EC2A 1S1TB 3VHQA 1U45A 2BJ8A 3C6TB 2FY8A 2YH0A 2AJ4A 3DU5A 3W8GA 3G6YA 1S7HA 3M2UA 3KLIB 5H9EK 4NYZA 3OVBA 2EKNA 4PG7A 2BYCA 2V68A 1A0OB 1JLFB 4CTAA 3ZO7A 3ZZ0A 1VI7A 2CPZA 1IQZA 3HVAA 2YXLA 4XIUA 3FNNA 4NZ7A 1WUUA 4J9VA 4X62F 5AXMA 3FZ2A 4GVLA 5AT1B 1C1CB 2B7BB 1QAYA 5HSPA 2J76E 4Y3CA 3I9ZA 4AUKA 5LOQA 1HYSB 1U8SA 3CPWR 5RUBA 3MZIA 3FDSA 3H5SA 2FJBB 2K1RA 3N9UC 3I0RB 3ZZZA 3KLHB 2VG6B 4RW6A 1QTMA 2RSQA 3I55S 1SQGA 1FTCA 4XDCA 2OH2A 4OYPA 3KK1A 3PV8A 3HHDA 2CQIA 1IKXB 1HR0F 4IFYA 4J9SA 1S1WB 2IRXA 1MU2B 3IG1B 4ZVSB 3QJJA 1RCOB 3V6DB 5CA5A 1U4BA 3VAFA 2WCXA 1FFSB 2ZUGA 5KG2A 3G6XA 4ZN3A 1OQ3A 2MDAA 2ILZA 3NS5A 3G8SA 2O3DA 2HK3A 4LF5J 2GIQA 3KMSA 5C42B 1VBYA 1SL2A 2MJNA 1RYRA 4QCLA 5IT0A 4B17A 2WOMB 3LH2S 2ZH6A 3QZ8A 4GRSA 1IJFB 2XMVA 2HURA 3RB6A 1G4CA 3CJKA 1NJYA 5AXLA 3US5A 1S0OA 3MM7B 5A0YB 3IFEA 4DN9A 2VC0A 3HJVA 2J6UA 3CTRA 2UUAJ 3QFHA 1CJUA 2CIMA 3HFKA 4X4OA 1HNWJ 3GTYX 1QD1A 4U6PA 1ACMB 1X4DA 2PEBA 2M52A 2KTQA 2JVRA 3QAUA 1K8AT 3CC4S 5CYJA 3H2UB 4JYAF 4Y2MA 2W24A 2MKYA 1BQNB 2HHVA 3NGSA 2FC8A 3R5DA 1IKYA 2YWWA 2JVOA 3TAMB 1BQXA 1HFEL 3JXOA 3VCDA 2PSZA 3DLLQ 1TZ0A 3MOJB 1UETA 4TKTA 1HQEA 1KP6A 1TKZA 2OKQA 7AT1B 2MSSA 2X51A 3J81j 1GXLA 3OFHA 2HLUA 4HHHA 5AE2A 2GA7A 4USWA 4I2QB 2MKSA 4YR3A 1JB0C 4NLWA 4RU2A 2ZZMA 4RW4A 1H73A 2QL7B 1X9SA 4Q8FA 1FXLA 4UZCA 1TV6A 1LK7A 5CYQB 2YQ3A 3BJYA 3HSGA 2IM0A 4AL7A 3JB9k 4J9UE 5D4OA 1KD1T 3OXGA 4CRJA 2B8QA 1RA7A 1NCLA 4QWEA 3DM2B 2Y1RI 2CJBA 3BEGB 4ZIVA 4DL0C 2RQMA 4UT4A 3BQ2A 2CFXA 1L3KA 2XNQA 1HHSA 5EWGA 3SDEA 2IJFA 1TL7B 3D4JA 5HI7A 5KT2A 3IR5B 2IHR1 3DMJB 1P1TA 1O6XA 2F4FA 3L7PA 1JWWA 3RB3A 2HHXA 1AB8A 1S6PA 5D4PA 3K5PA 4DSLA 1HIYA 3DRRB 4G3IA 1UVJA 3GFYA 4F25A 2VZ9A 2CNOB 2HHQA 2QTWA 3HVWA 3QGHA 3NRBA 2YY3A 1JJ2R 2HVZA 1URRA 3MMJA 2Z56B 2KFZA 1FTRA 2I0XA 4USUA 2KI2A 1WG1A 4C8LA 4OYOA 2CXEA 1TKXB 3C66A 1OSDA 1DQAA 4JI3J 4OZJA 1I3OB 4P2FA 2F3JA 2X7IA 4EI2A 3QRPA 2CUYA 4ZVOB 1TP7A 4USTA 3D6MB 2BXJA 3KDNA 3OFGA 2ZZTA 2YPZA 2ADBA 1ZAXA 2FVSA 2KHDA 3P96A 2CQHA 4ZVTB 4PG4A 7FDRA 3CC2S 2DGSA 2ERRA 1R7IA 1MW7A 2DR8A 3HHKA 2HHHF 1C1BB 3OL6A 3M32A 2P9GA 2UUBJ 4PWDA 2XCPA 1FCAA 3BGLA 4FVCA 1ZTTA 4JP8A 4WJBA 1WHXA 2NYHA 2W2MP 2G1DA 4TYBA 2XB2D 2HHSA 3P49B 4V1Ak 1O51A 2HNDA 2DCLA 2CKWA 4ZA1A 2AGQA 4OHXA 3B6BA 2UZAA 2DGUA 4QPTA 3B8HA 1EETA 1CJVA 2J9DA 1LEOA 4C8OA 1N5TA 4I64A 2RB7A 4F3OA 2XULA 4ZP7A 2FVQA 1CULB 1HA1A 2X1AA 5CH7B 1S1UA 1IM4A 1D1UA 1RLCL 3HPOA 5IV3A 1WJ9A 4L72B 4LR9A 5KG6A 1TELA 5FD1A 4OX8A 1HQUA 2VBXA 2YH1A 1Y7PA 2NREA 3CMES 2MKHA 3MCMA 1PCAA 2XHCA 3GJRB 4EBEA 3V81A 3IS9B 4RW8A 3MM6B 4Q0BB 3THPA 2GQCA 4CLSA 4A8XA 4F4AA 3OSPA 3GFHA 4QYRA 5M2RA 2JX2A 3BKUA 3MEDB 4WZQA 2MZQA 1J2VA 2VFVA 4GO7X 2L48A 3WBZA 3LUYA 1VMBA 1QTNB 2L08A 4RNNA 1FRIA 4CLKA 1VQSA 2BBEA 1JXEA 1UFWA 3P8BB 3M6XA 3KJNB 3KHHA 2VQEJ 4ZP6A 3TEHB 3MEEB 3GIKA 1EIYB 3H0PA 1IBMF 3O3LA 3UD4P 2M88A 2KYZA 5BR8F 2JC1A 1FERA 2XMWA 4GVBA 1N36J 4ZVQB 4H4KC 3I9V9 5G4DA 4KIAA 1XMBA 1C0UA 2IMOA 4DV1F 2RS2A 4YDDB 2C3OA 4I6WA 4C8YA 3U02A 1SV5A 1HARA 1HPZB 1N4LA 3FC9A 1SKSA 3POTA 1YJWS 3CMAS 1V5IB 4DR3F 4KE5A 2FVRA 2HIYA 4F7VA 2XS5A 2BJ9A 2RF2A 4LR7A 2VHGA 1F2HA 4M95A 4KH0B 2DJWA 3VQTA 3MM8A 3H25A 1JK9B 4NLXA 1RBLA 5KG7A 2YWKA 3R6GB 1NXIA 1KVKA 2K2PA 4MKVA 5HLFB 2Z2ZA 1RXOB 1ZPWX 5KFAA 5D15A 3MDFA 1EB0A 2HZVA 4RX6A 3NWGA 1WKKA 3CCZA 4MIBA 4DV4J 3HCXA 3LP2B 1X5OA 5I3UB 2CPXA 5BYSA 2KFYA 4NX9A 4HEA9 4DDFA 3WHIA 3IWLA 3RAQA 2J0XA 4XAKA 1VDHA 3OQ2A 4RBTA 4G1QA 2GCFA 2PFFB 2DXDA 4O0NA 1NKEA 3PO4A 3D3BJ 1RKIA 1VRUB 3QFWA 1CJTB 2UUCF 1VS3A 4DN0A 1RAIB 4Y2CA 1WG5A 2NSCA 2VU5A 2HAIA 2MB0B 5KG1A 2IRYA 3GIIA 3AXMA 3M6VA 2Y8WA 5I42A 4B3SJ 3VAIA 2XGPA 2HVHA 4OZ5A 5B7WA 3AH6A 3R97A 4P7TA 3FBCA 3DRXA 5KFXA 5F3ZA 4K0KF 1FK9A 4ICLA 3JSMB 4FS1A 4QU6A 2C2OB 3TANA 4WZMA 2WRMA 2XWXA 2MZJA 1GQEA 1FX2A 1WNEA 4O3RA 3MGJA 4FXWA 1TAUA 2FTRA 2DHGA 2M70A 4F0HA 4LJMA 4J7CA 5FLXY 3CDBA 4C6AA 1XWLA 2KG0A 5MLCV 3GIRA 1H98A 1M90T 4K8RA 2W9BB 3N01A 1Y5IB 2HNZB 2HQ3A 2Q6BA 2E7VA 2KM8C 2GVZA 3T6JA 4NCBA 1W2IA 4ED0A 4DX5A 1VJWA 4B3TJ 3MCOA 5DLFA 3ZTQA 1ZA2B 1WC6A 2MGZB 4WP9A 5C2GA 3AT1B 3EWGA 5JVHQ 2DK2A 3BR8A 1R3NA 4O44A 4RW7A 2BE2A 3CD7A 1XMQF 4RNMA 2IC3A 5K8OA 4RNFA 3KG1A 2DNPA 2V6AA 2KXFA 2NCKL 2PO4A 3QT5A 5KFTA 3CT9A 5A8WB 1SJ4P 2CG4A 4DCOB 4PEOA 4OHYA 2JOQA 2U2FA 3DOMA 2FHOB 1NSPA 2RQCA 4LQ3A 2YNGA 2A6OA 3DLBA 4ECVA 2Q79A 4ZPWR 2ZBQA 1B70B 4HDHA 4IO1A 3QO9B 3FEYB 2P6SA 1BWVA 4PWUA 3L7UA 2GQ2A 1UJ6A 4BWMA 3H7HB 3THVA 3G86A 3DXBA 3TX8A 1MWQA 1JJHA 2W8KA 4NLPA 2DGXA 1RWVB 4I68A 1HNZF 1HW8A 5IZHA 1X4CA 2KXHA 4JI6J 2EWHA 3OL8A 3N0VA 1EKSA 3V4MA 2GJ2A 2JDJA 4ED7A 1RT5B 2IM2A 2F4VF 2DIUA 1UPPA 2X1FA 2IVYA 3FUYA 3WX4A 1NDPA 2MLXA 2H54B 2IDEA 1NHKL 3MMAB 2I8EA 2CWKA 5D0RA 2B3TB 3K2YA 1WF0A 5CCMA 3DRPB 3R27A 3EM1A 3W66A 1RYSA 3BGRA 4H4MA 1HNXJ 4JI5J 3OTOF 4N41A 2H48B 5C7PA 2Z2MA 2OELA 4DL7A 4F4XA 2OPSB 3IWXA 2EPIA 4YEAA 2XNRA 1S99A 1BC6A 1TMMA 4RBUA 3N6MA 3D1QA 3NWRA 3LO3A 1AFJA 3C8YA 2O66A 2BZ2A 3TI0A 1X4FA 2IAJA 3KJVA 1NAQA 3EJMA 4K4YA 1M5PC 2V9WA 1F5AA 2BQUA 3GJQB 1FEEA 4KBIA 3OJUA 3I0SB 4NLUA 4DSJA 3ELHA 3SCKE 5KT3A 1J5EJ 1HWLA 3ENVA 3PJWA 1XR7A 2CPHA 3KUGA 1NZ8A 5KFDA 1FWLA 3R5CA 2JLEA 1K1QA 3BSOA 1U1NA 2JSXA 2BJ7A 4K4ZA 2YWGA 1DFDA 1CVJA 4FNHA 3TUIC 4HH1A 3DU6A 2BE9B 4BBYA 2CZVC 2ATCB 1N0UA 4DJBA 5KFRA 1RT3A 2V2ZA 3NMRA 1RT1B 2JEFA 4IOAQ 1WSVA 3UN2A 4CNZA 2Y0SD 2MQNA 4X65F 1GX5A 1U1RA 4E0DA 5F8JA 4MKYA 2OP5A 3HFVA 4NL5A 2AYBA 2V34A 4HVZA 2W1BA 3E01A 5IWAF 2IIHA 2HHWA 5JMNA 3SQGA 3OXFA 3Q8QB 4JI4J 2I9SA 3PG9A 3DGVA 2AYMA 1NNDA 2NXNA 2I5JA 3RYLA 1YBAA 1S57A 5KFCA 3Q83A 1S79A 3FEXB 4IG3B 4LFBJ 1JLCB 2WB4A 5LSLA 3I4HX 3D7SB 3NOCA 4XK8C 1SUQB 3QSYB 3VGUA 3HZGA 4OZ0A 1TKDA 1FKPA 4OZLA 3NBPB 2HMIA 1G2EA 3ET6B 2GZOA 4IH5A 3DOKB 2LYVA 1JLAA 2F65A 1S9EB 4KAIA 3TA2A 3U1LA 4HHJA 2YX1A 3GG1A 5J2QB 3UCGA 1V5VA 5IT9Y 1GH8A 3NAIA 4LBPA 1K1SA 2Z0GA 1RTZA 5F9NA 3CNQP 4DU8A 4K4TA 4Q5VA 3TZZA 4BHQA 4XPCA 2KRBA 3X1LB 4LF9F 2FLLA 1Q0NA 1IKVB 4YN3B 3BYPA 2DIVA 2KRRA 1IWGA 2W25A 1NPPA 2C2DA 2OPQA 4ZMMA 2GIFA 4Y2IA 2D3UA 3LGHA 1UA1A 5IM0A 2HNYB 4DWIA 3D0GE 4LFCJ 2EKYA 2HFUA 1YK9A 4RUHA 4DPWA 2LQBA 2IJNA 3MUMP 1FFGB 2Y9HA 2KZZA 2OFGX 2H5JB 3MD3A 3DRYA 4P6QA 1FO1A 2IPOB 2HHTA 3MM9B 1ZOTA 3PIPQ 4H54A 2Y0BB 3AA8A 5F8MA 1R6YA 4OX7A 4PQUB 4LUBA 3L9ZA 4ECRA 2M5YA 2ZD1A 2MKCA 3R3TA 1T8EA 4RKUC 1P9QC 1VOMA 1KWMA 2OHDA 5A8KA 3RBXA 1URNA 1S9FA 1PBUA 2LFVA 2LECA 3DDKA 1KR4A 3RB4A 5KFJA 2WVFA 2BX6A 3T5JA 2GHPA 1IBLF 4FDFA 2V69A 4OI0A 1Q79A 2E5JA 2IJRA 3TVYA 4O4GA 1HBNB 3B4DA 4EU0A 4V19X 1YBUA 1NK8A 2QRRA 4QIVA 4DR1J 1NJZA 3NS6A 3PYEA 1M5OC 2R7UA 2QL9B 1YTYA 1QAXA 4YB7A 3W62A 3CD6S 1H74A 1LW0B 5LL6d 2N4DA 4JB8B 1SKRA 3MM5A 3QIDA 1N5YB 1UEUA 3M4XA 3MUVP 1S12A 2R3VA 3HJFA 3A8JA 4OJHA 2R7RA 4H4OA 3PYGA 3P5BP 2XLKA 1LFPA 4FVMA 4EEYA 5KFLA 2B4VA 1QVFR 2QGFB 3QWPA 1U1LA 2R2TA 3U27A 1TL5A 5D4LA 2V8DA 1OJ4A 3N4WA 1NZAA 2F8MA 4IFVA 4A8QA 3MTJA 3BBBA 4QWCA 3T1HJ 2ZZNA 2CQBA 5E3CA 2D9OA 1FDBA 2UXBJ 3LP0B 3QGIA 4PQAA 2ZHOA 1DQ8A 1H2TZ 1UTAA 3W2WB 4M5MA 2M8DB 1WC5A 2XMMA 3ZTSA 3PKYA 1KS2A 2MZ1A 3UCUP 1DURA 4PPDA 5HJYA 2OD6A 2AGPA 5A2QU 1PC5A 1YKWA 3NGRA 3DOLB 5K5MA 5C24B 1S48A 4KT0C 4OYWA 2XY5A 2E5GA 2LMIA 2VG7B 1YZ7A 1N8RT 3SCIE 2KM8B 3G71S 4MIWA 2DHXA 3I56S 4ILMA 1T02A 3HSZA 4OIXA 4CO0A 3PHTA 1DTQA 1VC5A 4NLYA 2VA3A 2KFNA 3CJ4A 3NKYA 1TL3A 1B7YB 2LDYA 3M2UB 2FY1A 2HYIB 1UJ4A 2VPXB 3DFEA 4DS4A 1HBOA 4QWAA 1XIQA 4CTAB 2M4MA 3T6BA 2CDQA 2FGOA 1O5JA 2F9JA 5HP1A 3ZTRA 5HBMA 3B82A 4EZ6A 2UV8A 5HN0A 3FZBA 4DV6J 3TQ1A 2ROEA 4CH7A 5D6GA 2D74B 4YB6A 4ZJQA 3GONA 3DI6A 2MQQA 4O4RA 1ZYQA 4LVNP 3BDPA 2ZJQQ 4LFAF 5D0GA 1FJEB 4F4WA 2K1RB 3NNCA 4I67A 4B3MJ 4RW6B 4KY3A 4Y2KA 2CVEA 4CM0A 2VUGA 1TK5A 4Q8EA 1T9TA 1PG5B 5JXSA 2HQCA 3CCWA 2W2NP 3MXHP 1K44A 3SCJE 3B4MA 3KK1B 2QSWA 1A6LA 4IFYB 2OJ3A 2VICA 3ZNUA 3G8TA 3TJ8A 3R6LB 3EZ5A 2WVEA 2GW8A 3A8IA 3D67A 3UQSA 3WX8A 2IBKA 1RE1B 4B9NA 2BRKA 4TU7A 1JLEA 1RHQB 3AA9A 4WK1A 1UVLA 4N47A 3VAJA 1TR0A 3BKTA 4NYPA 4YMEA 1Q53A 3F0NA 3L4BC 4CO1A 3A3PB 4ED2A 3HDSA 1MN7A 2QL5B 3TP2A 1LQ9A 2L9DA 2ZFHA 1NPKA 2EBGA 4ECXA 1FVSA 3GSDA 4YHHF 3FBBA 2GJIA 1RT7A 2K8GA 3M6UA 3HHLD 1XNQJ 2JWNA 2P6TA 4J9QA 3CJRA 4USKA 1A7GE 3CJKB 4K4WA 3PW2A 4M5LA 4YB1P 4DV3F 2E1AA 3SSQA 3QGPA 1ULRA 3UPFA 2NPIA 5EN1A 4P52A 3FKBA 2ZVSA 3OL9A 1CJUB 3LPYA 4DV2J 1WORA 3HMJG 5JVGQ 2WAQD 1QJHA 5SZTA 5K14A 4ECZA 2BEFA 4FYYB 2HPUA 1JKHA 5L39A 1UA0A 5KOXA 2Q1LA 2OSQA 4FBTA 4NXMF 1Z1ZA 2WW8A 1IKYB 4QZVB 1L5UA 1VQ9S 2KKHA 4ZVFA 4P7VA 5B0GA 1OY6A 4MK8A 3BO4A 1Y3KA 1UWBA 3PDNA 2OTJS 3CCES 1HQEB 2DBBA 2JEJA 1TKZB 3RUBL 3MHYA 2HIQA 1D0EA 3HSJA 4AD6A 1LK5A 1XK8A 2F1FA 4OYMA 3H2LA 4RW4B 4DFMA 3WQPA 1TV6B 5ETLA 3M1VA 3MPUB 1VK3A 2DT9A 4PXBA 1L3VA 4ELTA 4OYZA 4JI2F 3IRWP 1U2FA 2RDDA 4ZITA 4X4NA 2ZDOA 3SXLA 2KT3A 2BA9A 1I94J 3N6NA 1WC4A 4HR2A 1F9EB 4DSEA 3MUTP 3ENQA 1EZZB 5GAGU 4JUZA 2NYIA 2C3MA 2QZ8A 3J81U 4RLEA 5CZXA 2POKA 1VYAA 4HT7A 2R7QA 3OW2R 1BE4A 1S6PB 3GFZA 1WTFA 1Q82T 1RTJA 1Y11A 1HI8A 3AB2B 3BREA 2QLXA 3BB5A 4DR6F 1CLFA 4UOCA 2XC9A 3T5LA 4DV5F 4IUFA 3CIMA 3C19A 1JNRB 4LMZA 4ZVPB 4C3MA 1NHVA 3QMQA 2MQ8A 1FA0A 1X4GA 1R31A 1WELA 2Q66A 5F0WA 2Q6CA 1SJFA 2OTLS 3CO0P 5LJ3Y 2MEWA 2N3LA 3K8WA 3M8WA 2BANA 1TKTA 1V9OA 1HD1A 4LRCA 1UWAA 3PIOQ 2K7KA 4K5SA 2KO1A 1U25A 3UDCA 1UW9A 5L8RC 2BW7A 3OFFA 3SEOA 3W1YC 2F63A 4DUTA 4CDIA 2CWXA 4WP8A 3ZZRA 4BLGA 4OLPA 1GNKA 2HGMA 4WTOB 4WFXA 2GMLA 3JAMU 4OZ1A 4L73A 3G4SS 5ADZA 3M32B 5C5JA 1NEEA 2OIHA 2L41A 5ETVA 1DJ0A 2YQ1A 4PWDB 1M1GA 4M5KA 2G2ZA 1KNZA 3LTOA 1S6QA 5L9XA 1U0HA 4TY8A 4AL5A 1EARA 2H5EA 2FHMA 1SVDA 2J5AA 3KG4A 1GXUA 2DD8S 3I87A 1N34F 4CT9A 1WHWA 3OTCA 2HNDB 1RAAB 4DR7J 3CB4A 2BJEA 1H72C 2QA4G 1EETB 1CJVB 4JV5F 3T1AA 3UWTA 2JLFA 1F5CA 1RWKB 1VR6A 1KHVA 1S1UB 3AD9C 3PKMA 4KPYA 3MPDA 1T3OA 1WOSA 3D0HE 4TLRA 1WI6A 2ZJRQ 2M0GB 2XYHB 2R42A 1HQUB 4IQMA 2ZC3A 2XHWA 1J5EF 3EGVA 4KGVB 3W65A 2QLJB 3V81B 2B9WA 4CIOA 4JV0A 3BZQA 5B0CA 1YJRA 4M5DA 1U1PA 5DJBA 1WDDA 5T41A 4X66F 3AQOA 3RJMB 2NLWA 2DXEA 4O3PA 5JJBA 4NLSA 4CWBA 2QA4S 2XZWA 2ZM6F 4WCEQ 3OLAA 3HD2A 2H4WB 4WTYA 5KFZA 3PJXA 3M9MB 1BWEA 2VKRA 1FNXH 2C2MB 3R8YA 3R2DJ 4IH6A 4WFZA 2F8HA 3PY8A 2RE1A 4F50A 3PW5A 1Z2LA 1N33J 3THTA 3IBFB 2IA6A 4MH8A 4QBUA 2V0NA 4F67A 2MPUA 2CQ3A 3BV8A 1ZM3A 1SQEA 3HXMA 4KTQA 2UXCF 4DEZA 5J2PA 4GVBB 2JEIA 2HRYA 1KQGB 1WEYA 2OI2A 3BBFA 1C0UB 2FHJD 1RBOB 2DRDA 3Q8PB 4J5OA 1SV5B 3D1OA 2HHPA 1Q81T 3VQSA 4OHWA 2A2CA 3POTB 2G0CA 3HVTA 4J9NA 3HHLA 5AJ3F 3T1YJ 4R25A 5HROA 3AOCA 2RF2B 2H5IB 3S01A 2C3YA 4DFPA 4LSNA 2VJUA 5KFKA 3MM8B 4ZLLA 4D3HA 2XZTB 4ECWA 1F1BB 3UVJA 2DNZA 2VDIA 1SB6A 1U6BA 1S4FA 3KNGA 2WSEC 3C14A 2QMXA 2DNKA 1RKJA 4JI8J 3IGNA 1B0TA 5K8MA 3QRQA 1O0PA 1CPZA 4X4RA 5FDLA 3KUEA 4CT8A 4ZCLA 1Y10A 2CQ1A 1S97A 4HKQA 1J5OA 4C4WA 3TAPA 3ZZTA 1HWUA 4DXLA 2X1BA 3DLGA 5GAGI 4B08A 1FKAF 4USIA 2LLZA 4G1QB 5DO2A 4B9UA 3H42A 1FD2A 2WVBA 4G1PA 2EFQA 3QYYA 3CE8A 4LF6J 2FC9A 4ES2A 3A4TA 1ZTWA 3CD5A 1QUPA 3J7YU 3DHXA 3GQCA 4U96A 3LAMA 3D5MA 4N8NA 2H65B 4OQJA 5BXIA 2R2RA 1CJKA 5I42B 2AX0A 3ISND 1CBKA 4DV7J 4OI2A 2LP4A 4OZ3A 4KHMA 3FRZA 1ZAWA 1FK9B 4ICLB 2M9KA 2PD1A 1H2UX 2YWFA 3W3SA 4DLEA 3ENAA 3T9NA 5B0BA 3UFCX 1R8CA 5EUHA 2YKPA 3KMQA 8ATCB 2FPHX 3GJTB 3TUJC 4DV0F 2MKJA 1NDKA 5L1KA 3OUYA 1MNEA 4NPOA 5H9FJ 5B09A 1RU1A 4K2XA 3PTWA 2ROGA 3AJDA 1N54B 2CADA 1Q5VA 1OYEA 5F41A 1KONA 4BCAA 2GVZB 6FDRA 2DHSA 4OJGA 5GMEA 3R5AA 3O5TB 1P9YA 1CG2A 2PI5A 3DRSA 2KVQE 5LXYA 1FI4A 4ES1A 1AUDA 4O44B 4RW7B 2BE2B 3EPGA 4ED1A 3QZ7A 3GP9A 4DR4F 3QT6A 3VAHA 2IC3B 1LOUA 4WP3A 5KT4A 4PPZA 1UCNA 4AYBD 1XR6A 1N0VC 2PI4A 5K8PA 1N5VA 4RNHA 1HNIA 3A3OB 2GAGC 4M63A 1TTHB 4NLGA 2H4YB 2CDRB 4ZLNA 4QR1A 3DOMB 2HVEA 1MMDA 5ETNA 2YNGB 4U9RA 1PC4A 2M8HA 3KJFB 5F8IA 2YKNA 1YIJS 4OYAA 3CCUS 2IMWP 4Y2AA 3J80U 2VBYA 3IP0A 1TVRA 1KSPA 3ILIA 2BACA 3T1HF 2SXLA 5BYRA 3VALA 3W2VA 1KHWA 1UFKA 5D3GA 3M8QA 4NOHA 4IH7A 1KTVA 4G65A 4IRDA 1C0TA 2GQQA 1FKOA 2QYCA 1RI7A 3LGMA 1B64A 4OI6A 2XM3A 3RU0A 1WOPA 3NLCA 2HVIA 1IBKJ 2E7WA 1MG7A 3UDEA 1GTEA 3HKWA 3VV2B 5KFOA 3M7VA 4G6VB 3VTIA 1SIWB 1UFLA 1PYOB 4K5RA 1BY9A 1R8PA 1RHKB 1IBCB 1ZBTA 4QIFA 2IY5B 1RAGB 1S1VA 4URGA 1OWXA 2NXEA 3F41A 2KG1A 1WEXA 3BGRB 5EDWA 4H4MB 5GADI 3CDAA 1B7FA 3OHAA 2LKZA 3MAAA 2AWZA 4DQPA 5DDQC 4LF4F 4ZHRA 5KFIA 4BS2A 1W25A 4DF8A 2ZVIA 4K59A 4I1TA 2E5HA 4DPYA 2XCAA 3IBWA 2HWTA 3AOBA 1KOHA 1HBMA 2FIUA 1QSLA 1GT8A 3JTPA 2IAJB 3KJVB 4YDXA 2QG9B 4Z7YA 3HD1A 3MF5A 4GKKJ 4DR5J 4ZVRB 1B0PA 2D69A 2V4QA 5FJ4A 1XTZA 2L9NA 3BF4A 3MECA 1NK5A 3E8OA 3RR8A 1YITS 3DYAA 5IC6B 2J0SD 3ZZUA 1UVKA 4OI4A 1ZZNA 4PABA 4I7FA 1YVFA 3W60A 4KGXB 3CVKA 4U67Q 3C6UA 2XS7A 5GMKa 1RCXB 2R7OA 1RT3B 4TU9A 1BD6A 4GC7A 5KT7A 1RWNB 4ZOSA 4ZVGA 4R0JA 4N56A 3H98A 4EWTA 2AYEA 2FHJA 2IYGA 2W2PP 3X3UA 3CEDA 4OI1A 2J9DE 1DRZA 1M5SA 2N3OA 3EPIA 2MQLA 1VHIA 3IAS9 3E01B 4YQWA 5LSRA 3SQGB 3RBDA 4KHPF 5F9LA 4O3NA 3UR3C 1KEKA 2A3JA 1D9FA 5ETSA 2WVCA 3O2IA 2EG1A 2I5JB 1UZDA 2VPWB 1L3SA 2HBYB 2HRUA 4K4UA 1XMOF 4RU9A 3IAM9 5DLGA 2YWEA 2LDIA 4J9MA 1T95A 2PGCA 5KOWA 4OX9F 3GCWP 1FKPB 1C2PA 2E5LJ 1IN0A 2HMIB 1NKCA 4DSFA 3D68A 3BQ0A 1JLAB 2OEMA 2C2NA 2EW9A 4DV2F 4J9KA 1RTHA 1P1LA 2ZKTA 1C1BA 1XN9A 3TJ9A 2FUG9 1PYSB 2W2QP 4FF1A 5DM7Q 1FEHA 2C3PA 2K06A 2QA2A 5CHCB 3CF5Q 3PCOB 2M2BA 4F3QA 3S6EA 4M5NA 4M5GA 2D1CA 2JNJA 2AF6A 2V8PA 3KHLA 1OPZA 2YTCA 1NDLA 4A8FA 5AXNA 2NUUG 3Q86A 4KGZB 3HK2A 2HW3A 3SCLE 1PIEA 4K7QA 4NRTA 1NRKA 3VVTA 3TYTA 1QAJA 2OPQB 3GSIA 1ITPA 7FD1A 2C3UA 3I31A 4MKAA 3OXLA 5IM0B 4OHZA 3UE2A 3LP1A 2WSCC 2YX4A 3EICA 3L95X 1JXLA 3GFXA 4JI7J 4YB5A 4DFKA 4JI0F 4B9SA 2P2CB 5HO4A 4AE5A 4LRDA 2VONA 4DX7A 5KFVA 4YY3F 2VBZA 1U0SA 4NZ6A 1S9GA 2VQFF 4X64F 1Q7LB 3ETMA 4DUYJ 1RT6A 5KFFA 5C25A 1SH0A 2ZD1B 4A8YA 2XI2A 5HVFA 4JV1A 2VB6A 2G1HA 1IQTA 1LXNA 4QU7A 4OYBA 5KFMA 5A8KB 4F0MA 2WK4A 1VIXA 2BKOA 3M2RA 2EK6A 1XBWA 2Z2LA 5DETA 4HT5A 3V6KA 3CDWA 5KT6A 2YX7A 3OHBA 4JOUA 3D9BA 3FSIA 1NH7A 2RDIA 4YR0A 3M8ZA 3VZIA 3SYZA 3JQKA 4X62J 4B3RF 1RK8A 4O4GB 2YQ0A 2LQJA 1X8DA 2MJUA 1O8BA 1TU0B 3JSRA 4PXDA 2BE7D 2E1MC 1JMTA 2GHWA 3BPSP 3PO5A 4WPAA 2WVDA 3GYNA 3OVSA 4Y28C 2YNIA 3UNGC 4EUVA 5EWEA 4DUZF 3MM5B 4AT1B 2XMKA 3PYFA 4EBCA 2I38A 2VFSA 4GMKA 3BM7A 5KFPA 3EGWB 1WACA 4MMOA 3FQKA 2DGTA 2MMYA 3BSNA 2I2YA 4TQSA 3C16A 3IC1A 5SUHA 4LF2A 3CCTA 1HL6A 3BKFA 2ALZA 2M3DA 2HRTA 2J6SA 4C11A 2O67A 2UU9F 1ZM4A 4WU3A 3JSYA 3P4UB 3U1NA 1SJ1A 3MMCA 2V4JA 2EFPA 2RVJA 2FLPA 2AEJA 3M9NB 2ZH2A 4IFVB 2E44A 3R2CJ 3Q8VA 3FVYA 5CXTA 3OT9A 1FXDA 1HQ2A 1S7IA 2W9CA 3VVUA 3TZYA 4FF4A 2L9WA 4PG5A 2DR6A 2VA2A 1D9DA 3OR1A 3KFWX 2DH7A 4DCJB 3I32A 2V4RA 4NXNF 2ZNZA 2C2KB 2HFOA 1KVJA 1LWEA 2FJXA 4IRKA 2AYGA 1GMVA 5IC4B 2FJEB 2PN6A 3EDRB 2OEJA 2KJWA 2DNHA 3BN4A 4CLUA 1S10A 2DHHA 1TMJA 4JYAJ 3OVAA 1T03A 1QDUB 2FB0A 2UVVA 2DEJA 1DTQB 2VL1A 2J6TA 4DS5A 3HZEA 1U24A 2LXFA 5LXRA 3KK2A 4WXOA 4LF1A 1TL3B 3KLGA 3BH6B 1HBUA 1RGVA 1HKAA 3QIPA 5DG7A 1LV5A 2Z58B 1HBOB 1U09A 3CO9A 1RAHB 4NMXA 1VQNS 5HP1B 3T5HA 5HBMB 3BN7A 3HHEA 4NA2A 5KG3A 2NSBA 1TUWA 1RWPB 2BABA 2ZBPA 4M1KA 5T7LA 2C22A 4C7QA 1KRPA 3DI6B 3VF0B 3PYDA 2QT7A 2WZ1A 3T19A 2HVDA 2D41A 4QPXA 3K58A 1TL1A 1GMWA 1FF2A 2MGZA 3CWJA 1S6OA 3KTQA 2ZBRA 4Y0FA 4WKYA 1BHNA 1H2VZ 3JYTA 4HDGA 1UW4A 4MK7A 1JLQA 2FJVA 4CM2A 2EFVA 3EYZA 2DH9A 4RZRA 2V2KA 2AT1B 4ZN1A 3J7ZT 3D66A 1ZA1B 1GXTA 1U26A 3RRGA 3FJ2A 3Q2TC 2F7VA 1JLEB 1YRUA 3KXDA 4WU2A 5A2QY 2WB1D 3D1HA 3RBEA 2ZNYA 4B9MA 1LW2A 3CJ0A 4NRUA 2DEIA 3PX0A 5IXUA 2RU3A 1NK9A 4KRWA 4KB7A 3SI8A 2HGLA 2OPPA 2D3OR 5U47A 1X4AA 3PX4A 2Z8QA 5LMNF 4IYQA 1RT7B 2H3EB 4NCGA 3R7BB 2ZEJA 3H2VE 2V8GA 4FPIA 3SV3A 2B4PA 1HI1A 1BXNA 2DY1A 3FSYA 2DNYA 2LU2A 3N28A 4ES3A 2W01A 3BR9A 4CLWA 3KK3A 3AJ1A 2HHHJ 2NR0A 2MZRA 3SMZA 3HP6A 4LF8F 4V19J 5K14B 3KHGA 1UEKA 3B78A 1ELOA 3T5KA 1RSCA 1JKHB 3BSCA 4CH0S 1RISA 3UN3A 3HX9A 1M1KT 4I4BA 4DV7F 3BGFA 5DS7A 1PKUA 4KH1B 1TAQA 3VGVA 1RADB 5ETOA 2YKOA 1UWBB 4F3MA 3AD7C 4ATNA 3GU0A 5LMUJ 4OMFG 4B9VA 2ZUAA 5EX3A 1H3DA 3VAMA 4LF7F 3PRDA 2ROPA 2ABYA 1YJNS 4PYDA 1ROFA 3IRXA 1RABB 3GIJA 1ZM2A 2VKZG 3LQVA 5F8GA 3FFIA 3M1VB 3DXSX 4QJVA 2XO6A 1YWXA 4J9LA 2BJ3A 4DQSA 3W64A 3K8VA 1VRTA 3OPKA 4CLZA 1PYTA 4WWSA 2DR7A 1U2CA 2QFIA 4FKXA 2IDLA 1N32F 1U1MA 5HMZA 5CAAA 1REVA 1WOOA 2LQ9A 1Y3JA 2ATLA 2RRNA 2Y1IA 2NUHA 2DNGA 3OTDA 4WIQA 2XG8A 4PKDB 1RTJB 2YBVA 3DHWC 2AZ1A 1I6JA 2GIRA 2R2UA 4N7TA 3NXZA 1PAUB 5D0HA 4A48A 2BRLA 2VOOA 5CYMA 4HHUA 1F0XA 3MEGA 5A76A 2PT0A 2XBPA 3QATA 4Q44A 1S76D 3G96A 4C8KA 2RUSA 4MJKA 1X0PA 3GPAA 4F36A 2FZCB 2B8PA 2B4OA 5DQIA 1IBMJ 2G2OA 1AUSL 3BBCA 2F8EX 1KC8T 5BR8J 4DBQA 2VF3A 3CJ3A 4NA3A 4UUWA 3V4IA 2BANB 3F44A 2JFKA 5DZ7A 2IVMA 1TKTB 1WHVA 2ZOMA 2BUNA 4WYWA 1V3ZA 5F8LA 4DV1J 4DL6A 1EQMA 3V2UC 2KYXA 3UN5A 2FLOA 2H1YA 4QWBA 2E5IA 3DOKA 4DR3J 4OHVA 1FXRA 2QEXS 1XNRF 3HKZD 4HI2A 2HQDA 3TWZA 3NCQA 2VPZB 3CJ8A 4F02A 2XWYA 2DISA 1LWXA 2KZMA 2RUGA 3UO0A 1S6QB 2EVZA 2Z57B 4AXJA 1U0HB 4TY8B 3I5CA 4N76A 3I96A 1PBAA 3ETOA 2AJQA 2DPJA 2DKOB 3ULHA 2CJYB 3M2VA 4CO4A 4A47A 1AZSA 2ACMA 2C1EB 1KQSR 1ZPVA 2IA0A 3GCXP 4DL5A 1VHFA 2E9ZA 3ZXWA 1YI2S 3OR2A 1U1OA 1C4AA 3J81Y 2E9TA 3TA0A 4RUBA 2PA3A 3AD8C 4UW2A 1YDLA 3TEGA 5L9NA 1HD0A 4MFBA 2RJZA 2UUCJ 5KT5A 3IBCB 1OS5A 4WFYA 2J0QD 4GKKF 3PJ9A 5T14A 2FQQB 1N6QA 3K89A 5CD4A 3MOZA 4L76A 1WHYA 3A3NB 5CABA 1R0AA 5HMXA 3SFUA 1AA1B 2XQCA 1ZETA 4ZS6A 4H4KA 2YVSA 1GFWB 3SSRA 4N77A 4URQU 4K0KJ 2GVDB 4ALZA 2XMUA 4M5DB 1RB0A 3W5XA 3QBCA 4O23A 3CIZA 3FK4A 2X3GA 3M30A 4K2JA 2J7WA 3O8WA 2QSFA 2FHKA 5HQMA 2RT3A 2QA1A 2HFZA 1DLOA 4DQRA 3E3XA 5KFNA 2BDPA 5DQGA 3PW7A 1LWFA 2HZCA 4B9TA 1MMLA 4AQYF 1B99A 2MY8A 4NE9C 2B6AA 1VQ8S 4F04B 4JI1F 4KO0A 1OMSA 5H9EJ 2MLZA 3JAMY 3UD3P 2Y8YA 1FJCA 2RIJA 5DQHA 1FNMA 2F9DA 4ZPBA 3PEJA 3C15A 1TUGB 2DY9A 2K7JA 1SBRA 1XMQJ 5KFUA 4J90A 5J2PB 4ITSA 1NLKL 1CS4A 5ETKA 1EQ0A 3TJAA 4J9RA 1Y5LB 1F2GA 3HVTB 3HHLB 1CEZA 3GB0A 5HROB 4NLRA 2ZH3A 4LSNB 4USVA 1T9VA 4EMDA 4LIWA 3PNIA 2KVIA 1T9YA 1OPIA 3UVJB 1S1XA 1RHRB 3Q22A 2RRBA 2ZH4A 2XSJA 3C14B 4IOCQ 1UZHA 4NEZA 3PW4A 4LSZB 3H40A 1SCJB 1VQ4S 3MMBA 1U7LA 4X4UA 5E3PA 5KFQA 2CYYA 1B4SA 5FDLB 4URSA 1VQKS 4LIRA 1HNZJ 1RWOB 4X4SA 1J5OB 2RQKA 4A8SA 3MURP 4ETXA 3PM9A 2V94A 3DLGB 2VASA 2CJAA 2W7PA 2GO8A 1RTIA 3R7NB 1FJ7A 3K5LA 3ICLA 2VG7A 4OJ3A 2F4VJ 4EGLA 1LKZA 5HANA 5KAKA 5DG9A 3RAXA 3U7JA 1LXJA 4PG8A 5IT4A 4KKOA 5EX0A 3AY0A 2CPJA 4I0WA 4KGMA 1CJKB 2VOPA 4DUYF 4ID8A 3EGZA 1HI0P 2RHQB 4R5PA 2KH9A 4TNOA 3OTOJ 2ZE2A 4KYZA 5A8RA 3VR1A 1WC0A 3GMGA 2YKMA 1EP4A 3ILJA 5ETQA 2CQ0A 1ZH5A 1RTDA 2B9XA 4B02A 4WBFA 2OGUA 5EGYA 1WTBA 1NUEA 3FGVA 3Q2SC 4A8KA 2AZ3A 3GV5B 3Q8SB 2OFHX 1UVIA 5KFEA 3OUYB 3R9LA 3E2EA 1E6VA 1VBKA 3CUNA 4UUXA 4FYDA 4LBIA 5GAEU 3EGNA 1EX8A 1UKUA 2NS1B 2R8HA 2X1GA 4LF5F 1BUXA 4CO2A 1WKJA 5LJ5Y 5D78A 3I5BA 3Q24A 1VBZA 5MAOA 1NK7A 4C3KA 3PFEA 3DRSB 1X9MA 3M8SA 1DY3A 3RZAA 4PXCA 1S72S 5AE3A 2YNHA 2FZKB 4CLTA 2BMBA 2KT2A 4IG0A 1RAEB 3R1LA 3PX6A 1SC1B 1VLYA 2UUAF 4L74A 2QYGA 2FLNA 4X65J 1HNWF 3ENWA 3Q8UA 1HNIB 3ZTPA 4WF9Q 1FNOA 1M5HA 5IV4A 1JLBA 2R9LA 2IM3A 2DYAA 2EFGA 3GLJA 4ZLPA 3IM9A 1UAWA 1S77D 1VRQC 3EVWA 3CCJS 5IWAJ 3NAHA 1X5PA 2YKNB 3BH7B 1DTTA 1VBXA 3LALA 2RD5C 2LEPA 3NGDA 1TVRB 5E3RA 3W9IA 3P6YC 1VQ7S 2CNLB 3TOQA 2PC6A 4USHA 4ZP9A 1MWZA 3ITHA 4Q2LA 2MKIA 2WONA 3W2VB 2O1PA 3Q89A 5D3GB 3M8QB 4USJC 2C28A 3BPDA 1U1KA 2RNEA 3FSXA 4NLTA 4OZNA 1H0HB 1C0TB 3H8YA 3R5JB 1FKOB 1W26A 1R89A 3U1MA 3R1HA 2A0FB 4Z7CA 2YNFA 4DMZA 4G1IA 5ITHA 3TARA 2CZ9A 2DTJA 1IVZA 4TN2A 2E1CA 1V3SA 1UP1A 3K7RA 2CQ2A 1JJ4A 3QLHA 2VDHA 2JZ5A 2OD4A 1OY9A 1A9NB 2MXYA 4Y00A 5F8HA 1L3TA 1QLNA 1S1VB 5KFHA 1IKWA 1M1HA 2E1PA 2ZH8A 3KNAA 2IYIA 4LF9J 4C0HA 1TQLA 2IM1A 3OJSA 3MAAB 4UQGA 4HI1A 4E2FB 1EKRA 4ZHRB 3OFEA 4QYZJ 3CDUA 1T9UA 4CO3A 1Q95G 1ZS6A 2KL8A 1F6TA 3TUZC 1HLWA 2CPFA 1HBMB 2ZC4A 3JTOA 1YZ6A 3RAMA 3FCVA 2M7SA 5I3PA 3Q8RB 2X3DA 2DR5A 4W4MA 4C0OC 4RNOA 3M8YA 3D6TB 1TFYA 3TVZA 4JI3F 1FJGJ 3MECB 1DHMA 2JC0A 2QMUB 2UUWA 3DYAB 1RHJB 4YOEA 1N48A 2NQPA 4I7FB 2Y3YA 5IQ6A 1IXKA 2B43A 3J80Y 1SJ3P 3C6UB 3QT8A 5ETPA 4M94A 2O5DA 4MIAA 2ILYA 9ATCB 2RQ4A 1AW0A 2E66A 1T3NA 3HFZB 4QOTA 4DL4A 4X4PA 1UPMB 2OPRA 4DG1A 1XJWB 3IM8A 2EG2A 1IBLJ 2UUBF 3MWBA 3I5AA 4TVAB 2MQOA 3NNAA 4R0EA 3EX7B 3VGTA 1NH8A 2PEHA 4DFJA 3DDNA 2D9PA 4P2XA 4K4SA 1PSDA 4ECSA 3W61A 2H9ZA 1X4BA 2HLTA 2AJ1A 1CQMA 4ID5A 2BJDA 3G8QA 2NPFA 2GX8A 1FRKA 4ECQA 2VFTA 3RW7A 4DPOA 1HMVA 3OLBA 1TK8A 2ZBCA 1RAOA 4FPRA 4U95A 4XO0A 2BQ3A 3G9CA 3JQMA 1JIHA 2QV6A 3UR0A 4LVOP 3N79A 3DC2A 1MSWD 1PJ6A 1VCTA 3O44A 3TO8A 1RTHB 3RR7A 2JH3A 4WFAQ 2VPYB 2XMAA 3NS7B 4QYZK 3DLEA 1RP5A 2QE5A 1QY7A 1VQPS 4Z2XA 5GAEI 3J7AN 2R7VA 3TQEA 1T94A 4ZDNA 3A13A 1RT4A 5DG8A 2VH7A 4MYTA 1SH3A 3NP5A 2DGWA 2Y1JA 3DGPA 1Q86T 5D8HB 1KFDA 3H90A 3UD5A 4ER8A 4A8OA 1E6YA 5LMUF 3G87A 1S0MA 1U8WA 1YQHA 1RU2A 5AE1A 2GS8A 4YR2A 6AT1B 2J0WA 3LP1B 1R0CB 3NG8A 2DNOA 1NU4A 4MT1A 4ZIWA 3NL0A 4OL8A 1KN6A 1NJXA 2VQEF 4PUOA 4O3OA 5CCLA 4F4ZA 2XY6A 1NDCA 4NLDA 4CLYA 4EZ9A 2D3O1 1VFJA 1WF2A 2YWHA 3NEKA 5HATA 3CW2C 2BJ1A 1S9GB 3JTNA 1N36F 1RT6B 3ZFVA 1Q8LA 4U7CA 2XLIA 1KLMA 5C25B 1VK8A 1YLXA 4N8OA 4RUAA 1SXLA 1OIAA 3BGOP 2GC8A 4P74A 4MKBA 3M2RB 4UTGA 2R2SA 1CC8A 4QQBA 4P10A 4U7UD 4XDDA 5B0EA 9RUBA 4J9OA 4ZLJA 4C97A 3HHNB 2GMJA 4AXIA 4BWJA 4FP9A 4UZBA 1VQMS 2VC1A 6FD1A 2PDAA 3TZXA 1BQMA 3CCRS 2ZITA 3GYGA 3T9ZA 3MD1A 4HACA 4U8YA 4LFAJ 4WE1A 1FHTA 1RACB 3UDLA 2YNIB 5IS2A 4DV4F 3UW1A 4YP3A 4R8UA 3NCRA 4B9LA 5I4MA 1GK8A 3OD2A 1DARA 2OUGA 3LPEA 4F26A 4ANCA 3AB4B 5THWA 2XS2A 1W2BR 4NA1A 4ZJOA 1IM6A 1XC9A 3I82A 4IDKA 2XZDB 4OV1A 3W9HA 3C16B 2LU1A 3G82A 5IQQA 3IGVA 4PZVA 4FYVB 2ZH1A 2C2EA 3KLEA 4PXEA 2R7WA 3VAGA 2RH3A 1U02A 2VG5A 4FF2A 4Q2MA 4C11B 1MROA 2PMWA 1Q8IA 3MMCB 3FQLA 2V4JB 2QO3A 4ELUA 4B3SF 4PRFA 5E3QA 2B56A 3IA0A 3L3CA 3DLKA 1T05A 2QLFB 5J1EA 2LA6A 5HAOA 1WG4A 4ZCMA 1KTQA 1QE1A 2RKIA 3QJLA 3SV4A 2HZAA 3A8KA 2MQMA 4YHHJ 4UF4A 4LSLA 2DHAA 2W9CB 4ILLA 1WF1A 1GAOA 1X0FA 2XGQA 2UV8G 5GAHU 4ECYA 1IJEB 2AIRB 1IR1A 3OR1B 1SL1A 1NO8A 4I2PA 1H7XA 3EDQB 3GV8B 4DV3J 1LWCA 3UCZP 1YG0A 3L7OA 1RBAA 4C3LA 1R0BG 2B5JA 1YX2A 4DL2A 4NZ0A 2QLBB 3EUNA 2V5HG 1LWEB 3H59A 1SKUB 1BLUA 4C2MA 1YRXA 3MPWA 1JLGA 4B3TF 4NXMJ 4C8ZA 1RZMA 1T03B 3FBEA 2B9EA 3SDEB 1ICEB 1U48A 4YS2A 3KK2B 2R7SA 3W8PA 4DQIA 4KC5A 3KLFA 1GMUA 3PW0A 3KLGB 3AHPA 3TX0A 1HBUB 4PCQA 4P73A 3QIPB 3VWSA 4WK3A 3O1LA 2UXDJ 3PHEA 4DOZA 3VGSA 3OTEA 2V9KA 3UI3A 4PG6A 1X5SA 3JQJA 4USMA 4ZK7M 3C3LA 5F3TA 4WXWA 3S1TA 1X5TA 2F5GA 5T7LB 1Y00A 4ZKAA 2BV3A 2CJ9A 4JI2J 4LRAA 1ZAVA 3CJTA 1RWUA 2FVCA 3K59A 2N7YA 4UQTA 5BYQA 1HWJA 1TL1B 4S0MA 5J2NA 1B0VA 3EXYA 2JRSA 4DU7A 2WSFC 3CCSS 2FJAB 4K4XA 2ZDPA 4KV8A 2KDOA 5B0AA 3JYTB 1JLQB 4X2BA 2G0JA 1UL3A 3S8SA 4PWWA 2ZJPQ 4Y34A 4JI6F 4DR6J 2CA9A 3OSNA 1NMEB 1MMNA 4DV5J 3MCNA 3IMQJ 2GHVC 1S6UA 4LT6A 3LF0A 3A8EA 1KFSA 8RUCA 4OV6A 2PMHA 5LT5A 1DZ5A 1WWHA 1HNXF 3BSAA 1FRHA 1LW2B 3NGUA 1X7VA 4JI5F 4B3OA 1XEZA 2OPPB 4NI2A 5HMYA 2XMJA 3PVXA 3PRVA 4OJ1A 5F8NA 4NCGB 3DN9A 4UOFA 4NWBA 1U6ZA 1RLDA 1NHUA 3GILA 4ENOA 1FESA 1FE0A 2XMTA 2R8GA 3F56A 3K0JA 2HBQB 1RT2A 1S5ZA 3KK3B 2K3IA 3CXCR 1T0TV 1FFWB 4QWDA 3M05A 1FT8A 2OLWA 3MPVA 4RW8B 5KG5A 1VIOA 4OFZA 1OY8A 4RR5A 5L1IA 3CJ5A 3SIPB 2QX0A 4CZCA 1N34J 1VLOA 5G0RA 2O01C 2XEXA 1D3WA 3H20A 1OYDA 1IWAA 5KFGA 3VZHA 4JBCA 4W90B 4WKRA 4JV5J 1M0SA 1KKHA 3MCSA 3TR5A 2EFNA 3W9JA 4LBHA 2LQ8A 1FDNA 2K3KA 4OYXA 1U6FA 2CPEA 1FDDA 2HG4A 2GMHA 3IRXB 3ISZA 3ADAC 4CYUA 3FBFA 4FKYA 3WIUA 4BC9A 3K5OA 4Z37A 3FMWA 2PIIA 4JI4F 3FFIB 2DNRA 2I1RA 3HO1A 2OO4A 1HHQA 2VV5A 1VRTB 3AODA 1ZZFA 4NYOA 3K5NA 3WC0A 2DGQA 5K8NA 4F2SA 4LFBF 2ZKUA 4RWWA 2WBMA 5E33A 3WC2A 5HJXA 1REVB 3GJSB 1VQLS 3GIMA 1K0TA 4P72A 4X66J 4E8UA 3IO1A 2B4UA 5J2MA 5HVHA 2C2ZB 2JHEA 2QLWA 5GAHI 5LM7E 4Q43A 4C0BA 4RW9A 2E29A 2ZM6J 3HM9A 3M8PA 5CYMB 5J1NA 3MEGB 4RJVA 4DX8H 4HTIA 5IFMA 1YSJA 4ZCIA 1YJ9S 5KG4A 2V2VA 3FMBA 2DGVA 2RU9A 1IUJA 2A10A 3WIVA 1NK4A 2ADCA 1K73T 1CC7A 3BYRA 3CCQS 4NEYA 3QPIA 3R5BA 2QC3A 4EYIB 3UDVA 3V4IB 4DPUA 2UXCJ 4BC7A 4X84A 1X60A 1HNVA 1SQFA 3JS9A 1APSA 4KFBA 3E51A 4A46A 4EO6A 2AU0A 2MHNA 2HWHA 2RILA 4LFCF 1U47A 2XTJP 4F4YA 1AXQA 4DZDA 5AJ3J 2XYPB 3FCWA 4ECTA 2ZWOA 2GGPA 3VAKA 3QGGA 3MFIA 2CQPA 2DR9A 2P9EA 1S1TA 1SC4B 4FS2A 2CJKA 2XO7A 2ZOGA 3C6TA 1EJ7L 3HSDA 4K50A 1F9FA 1NK6A 5DZ6A 4CP5A 4ED4A 3KLIA 4DR2J 2AD9A 2CPDA 1JLFA 3HLUA 3M2VB 2JEGA 4WIIA 3HULA 1AZSB 3PEHA 2CAJA 2Q43A 3HVRA 4HH0A 1R8HA 5GMDA 2CNNB 2JL9A 3IXQA 3TVKA 5JUMA 3OR2B 4DL3A 3WDOA 4L75A 1C1CA 2J8SA 1DBDA 1N5QA 4MFBB 4WYLA 5GVQA 4ZPTR 1HYSA 2OAUA 4QW8A 3DKDA 4DR1F 4MTPA 4QIEA 1N6QB 1UVMA 2HGNA 2LCWA 4LRFA 1FJGF 2NZ4A 3I0RA 1CSJA 3KLHA 2R8JA 2VG6A 1AROP 1RDRA 1Y5NB 3QJPA 3AJ2A 2IRUA 1R0AB 2HFVA 2B7CB 3TW0A 3BO2A 4KJIA 2IBOA 2HS3A 4JV2A 2CQCA 3LWMA 1IKXA 1X9WA 3PR5B 1S1WA 2HAFA 1MU2A 3IG1A 2HS4A 3P5TL 1U1QA 3M30B 1R8BA 2I6WA 3A12A 1FWKA 1SH2A 3V6DA 1AT1B 1D8ZA 3H5XA 1DLOB 1WSRA 2QJ3A 3H5YA 4DV0J 2MYFA 4LQ9A 4A4JA 3BQ1A 2W8LA 1FRLA 1LWFB 1PJ7A 4J9PA 1Q8BA 1SJQA 1QAIA 2B6AB 4X4TA 3CCVS 3GZ7A 4KO0B 4TLQA 3D0IE 5C42A 2V63A 1YHQS 1WC3A 3G2XA 4ZPVR 2UXBF 3EVMA 5D77A 3PFOA 3GV7B 2WOMA 4J91A 5B08A 1K47A 3FEZA 2LEBA 2AJ0A 4L3NA 2AGOA 3C15B 1P8GA 1IR2A 1GX6A 4QW9A 3HI9A 4YUDA 2CPYA 4DR4J 2VBWA 3MM7A 2CQGA 5A0YA 2HK2A 4M5HA 4Q45A 1CS4B 3LGNA 1R8AA 1S0NA 2UVWA 1U49A 4P9SA 3IN5A 4HTJA 2VD3A 2LQ5A 1Q1KA 4KR0B 1DQ9A 4C8MA 3Q23A 1JJCB 3R5GA 3QT7A 3ZZYA 5DGAA 1TL4A 3MEKA 1YGYA 4RUCA 2GFFA 1BQNA 5B0FA 2WTFA 4AL6A 1S1XB 1NSKL 1REGX 1DAXA 2W7OA 2XSJB 3TAMA 2UP1A 5H9FK 4MAKA 1N88A 4UOGA 5BJRA 1RA6A 1OO0B 3MMBB 3IWNC 2VFRA 2V50A 3A1YG 4CLFA 4AFFA 2AEMA 4MYUA 4HL9A 1WEZA 4I2QA 4OI3A 2DNMA 2EEYA 1SPBP 1F60B 1K9MT 1X4HA 3CULA 2J9EA 3RW6A 4C98A 4DV6F 1RTIB 5CYQA 3I6PA 2W9AA 5KG0A 5EWFA 2KN4A 4Q7AA 1PAEX 2R8KA 2WW4A 1VQ6S 1PO6A 1Q5YA 4ERDA 3QNWB 2BW2A 1QSSA 3DM2A 2N82B 2RDJA 4RBVA 4C48A 2FGCA 4KKOB 2ALYB 5CZVA 2PA8D 4DCPB 2V8HA 4B3MF 5H1SV 1TL7A 2W4DA 4W92B 1AFIA 4DF4A 3DMJA 2RHSB 3DNCA 5A6PA 2AV5A 4ETZA 4R5PB 2Y1LB 2ZH7A 3T41A 2ZE2B 3D54A 4RL1A 4LF4J 5A8RB 3DRRA 3SZ2A 4RWXA 4C8NA 2YKMB 1EP4B 2YPYA 3PXGa 1W7WA 2U1AA 1RTDB 2P9CA 5KFYA 1GMWD 1M5KC 5DGBA 4PAAA 1E6VB 2W4PA 2WHOA 3AFGA 2D3ZA 1TKXA 2VODA 3H4DA 3ZNJ1 3J7YI 2VIHA 1J27A 2CJQA 2EBEA 5ETTA 1QVGR 1YJTA 4LR8A 1WDTA 2CG8A 1S4EA 3C2PA 1XNQF 3P45B 2MHEA 3HT3A 2C42A 4HYKA 1G1XA 5M2PA 3KKFA 1NJIT 2DPIA 2YNHB 5E41A 3D6HB 1HWIA 4IG0B 5E0OA 2DRBA 1FRXA 3DLHA 1F3VA 2PMZD 2ZHBA 4NLVA 3MR7A 4ELVA 2WBRA 1JLBB 3D2WA 3MTKA 2XYGB 2XY7A 4F4KA 4GKJJ 5L46A 3BS9A 5LSOA 5E2QA 4GO5X 4KHPJ 1DTTB 2W2OP 3EMTA 4NASA 4FYWB 2R4FA 4TU8A 4ZCKA 3ITHB 1XMOJ 2WONB 2RS8A 2HQFA 3V6HA 2N7CA 3CJ2A 3UNYA 2EC0A 4FN5A 1CULA 1RUSA 2PE8A 3QWUA 4CLPA 3MAHA 3TZWA 4OX9J 5J1PA 1GEHA 1RJJA 2A18A 1G7CB 2QIFA 5D0EA 4U7UK 2FYXA 5DDOC 1FRJA 2YNFB 1PGZA 3GWCA 4IOBA 1QSYA 4FZVA 1LFWA 4L6V3 3NNHA 1VJQA 4ED6A 3OL7A 1Q4RA 3QLHB 2P5VA 1I94F 3IS9A 1D9AA 3MM6A 1VQYA 4Q0BA 4D3GA 2BKNA 1I5OB 3OTBA 1SC6A 3LANA 5A6WA 4DZ6A 1NKBA 4UOHA 1IKWB 3MEDA 3BGUA 2RAQA 1RQ0A 3TUPA 3ZZPA 1Q78A 1PILA 3MAQA 2DVIA 2UXDF 2A2DA 3FRYA 3KHRA 2Z4PA 3TRGA 1QM9A 3MR6A 4I56A 4ANEA 4JI0J 2D7SA 4NLQA 2KT5A 3MEEA 1VGYA 2AHOB 2COLA 4ED8A 1V3RA 3NOGA 2DH8A 2E1RA 1NK0A 1Z2ZA 4YY3J 2CRLA 1I1GA 2PFDA 3QAEA 2VQFJ 4X64J 3R7SB 2CZ4A 4UY8T 3K57A 3AOAA 4J37A 5FLXU 4M5IA 2CVIA 3BDEA 1HPZA 2AJ2A 2EFOA 5DDPC 1HR0J 3TNVA 1FWPA 2HBRB 1S0VA 1AYEA 4H4OB 4FF3A 3MPYA 1KVIA 2DCUB 2J9CA 3N6LA 2CJXB 3I4PA 4F0KA 4ZPDA 2OPRB 4IKAA 4O3QA 4DG1B 5HK4A 2EXUA 2HQGA 1NJWA 3SQOP 2Q3PA 1WKLA 4B3RJ 3NY0A 2UUTA 4ZPCA 3ILOA 3G6ES 5HLFA 1RHUB 4PYAA 2GO9A 3LWLA 5ETMA 2DNNA 1I51B 1HW9A 1T9WA 1KBRA 2DO4A 5CD4H 4O3SA 4DUZJ 3RBZA 3LP2A 4QIWD 3BO3A 5AXKA 5I3UA 4DR7F 1GTHA 4ID5B 3CD0A 1TK0A 2CQDA 1YBTA 5HL7Q 3MR3A 1VC6A 4MK9A 1HMVB 3EZUA 3PACA 2EI5A 1F3FA 4CO5A 3ILLA 4CLLA 2MTLA 3HHLC 1T7PA 1LNQA 3ZZOA 1VRUA 3MR2A 1CJTA 3QQCD 2J8AA 3RGIA 2UU9J 4DSKA 1RAFB 1T11A 2MQPA 4EFAC 2BQRA 3QSIA 2BR0A 5FIIA 3NCPA 1Q16B 2DXFA 3IR6B 4EO8A 1VISA 1F9HA 1KDNA 3RRHA 5KFSA 3DLEB 4EBDA 3DDIA 1G3OA 1OQ6A 2UVUA 4HLBA 4ZVUB 1B3TA 1RT4B 3W5ZA 4I6AA 1NPRA 3JSMA 1K0VA 5KFBA 1FE4A 2GJFA 3DGPB 3KYLA 1UVNA 1YJVA 4Y65A 2DITA 1E6YB 2AMCB 4NXNJ 3EE3A 2HWIA 4DHVA 4ED5A 2ASYA 1ZM9A 3RRKA 2DRAA 4K4VA 3GR1A 3G6VA 2W9BA 2ZHAA 5B0DA 3GE9A 2HNZA 2LVWA 1IR0A 4PUOB 2AP6A 2DB1A 1N33F 2BVZA 4ZVHA 3RTVA 1SI9A 3K17A 5HMWA 2V8VA 2Z2YB 4CCHA 2IFXA 2KHCA 3AQPA 3SSSA 4ZP8A 1KLMB 2GVDA 2KXNB 1BMQB 2HFNA 3W7BA 2BOPA 2KJVA 4A8MP 5C2CA 5A8WA 4OX6A 1C4CA 5K20B 4WFNQ 3T1YF 1D09B 3QRRA 3OBIA 1XR5A 2KB2A 2DNLA 3MR5A 3CGIA 4ECUA 1X4EA 5KFWA 4P75A 2QN6B 2V67A 4FNIA 3QO9A 3LAKA 1VQ5S 1BQMB 2AJFE 1H7WA 5GADU 2BKPA 4HACB 5KTQA 3KJQB 4JI8F 1WI8A 2R7TA 4WE1B 2N4CA 4P2SA 3D3CJ 4R8UB 1MWYA 2R7XA 5L1LA 4RPFA 4XPEA 1SIZA 1RWMB 3NGKA 3CCLS 2MY7A 2ZH5A 1N5SA 4IDKB 3C46A 1R6VA 3M8RA 3NMAA 1CQNA 3G82B 1Y0HA 1HHTP 2APOA 2H51B 1RT5A 4TY9A 3KLEB 1RWXB 2XSFA 5E3AA 2FVPA 4LF6F 2NXUA 1L3UA 4CH1A 2VG5B 4IR9A 1MROB 2CNKB 2B9YA 3MMAA 4O0IA 4OZ2A 2MKKA 5CQGA 4CI0B 4NMLA 3DRPA 3DLKB 4IRCA 1T05B 5J1EB 3M9OB 2BM1A 3HF5A 1QE1B 2RKIB 2OSRA 2Z30B 5M2UA 3CC7S 3GR0A 4DR2F 5LMNJ 1XQIA 2BM0A 4LSLB 2OPSA 2FD2A 2A1BA 1VC0A 4P2MA 1KLNA 1NSAA 1UMJA 4DPTA 2LA4A 4I2PB 1LWCB 1Y4ZB 5IT9U 2B5JB 1SC3B 2RRAA 1VQOS 2NZCA 2JFDA 3I0SA 2VJVA 4LF8J 1FDAA 3LW5C 2A6MA 4KQZA 3DLJA 2MLYA 2XLJA 4ILRA 1JLGB 4KHRA 3PR4A 1PJ5A 1KQKA 4QR0A 3KWMA 1RHMB 2IVFB 3KLVA 2QMWA 1P6TA 5K9FA 1RT1A 1FD8A 3KLFB 2JLGA 4FYXB 3CMQA 4FBUA 2L3MA 1Q8KA 3WZ0A 2FJDB 3MFHA 4F8RA 3MI7X 4ANDA 3TAQA 2KU7A 4LF7J 1NBEB 2G2YA 2V2QA 1M5VC 4FXVA 1T9XA 3KDOA 3CCMS 1BGXT 1TFWA 2XI3A 1H38A 2W7AA 5HQ8A 4IR1A 4XTTA 2B0GA 5HVGA 3V6JA 4IG3A 2YKAA 4QIGA 1JLCA 3DCAA 5J2NB 2LXUA 4N5SA 2J7KA 1N56A 1N32J 1R43A 1SUQA 3HT0A 3GYXB 4DI6A 1RWWB 1JX4A 3D6FB 4KV8B 4M5JA 3V5RA 4KGKA 4EYHB 3NBPA 3ET6A 1FRMA 3LA0A 2HEKA 4DSIA 2R8IA 3H5UA 1S9EA 4M8LA 3O6QA 5J2QA 1U2RA 1NB7A 1IBKF 3ZTOA 1F5BA 4CNYA 3SFGA 1HWKA 2P8IA 1YJUA 5IOLA 4E98A 3ZC4A 4UY85 2G9OA 1SKWA 2DGOA 1NSQA 3RB0A 1JXVA 3Q8YA 1FVQA 1IKVA 2OEKA 8AT1B 4WFBQ 1EAYC 1UJ5A 5ETRA 4B3OB 4TYAA 2NXCA 5DDRC 4NI2B 4W98A 4Y6IA 3EXCX 2G13A 1OSCA 4EK2A 1SL0A 3CJQA 3H4BA 1MLAA 2HNYA 1WC1A 2C2RA 4ED3A 2ZBIA 2ZH9A 3W63A 3LOUA 5E5NA 1MN9A 1X31C 3RG6A 4CQ1A 2EK1A 1D8YA 2B51A 1XNRJ 3NGTA 1H6KX 3GG0A 4PR6A 3KG0A 1RT2B 4OLOA 3L09A 3MM9A 4YFUA 4DR5F 1S49A 1UEVA 1V6HA 2ZWPA 1S59A 1YRTA 1JNZB
chains in the Genus database with same CATH topology
4H4OA 5L38A 1T03A 2ZJPQ 4PQUA 2UXBF 2FB0A 5F0UA 1Z4UA 4Y34A 4JI6F 2XLKA 2UVVA 4IQXA 1LFPA 2UVRA 3CDEA 1DTQB 1RAJA 2VL1A 2J6TA 4DS5A 2FJWA 4FVMA 3HZEA 1U24A 3OSNA 2LXFA 5LXRA 3KK2A 1MMNA 4WXOA 5KFLA 4EEYA 5DRKA 2B4VA 1QVFR 1KQFB 3QWPA 2GHVC 1S6UA 1U1LA 1TUVA 1TL3B 3KLGA 2LEAA 4LT6A 2R2TA 2ASDA 3PZPA 3U27A 1TL5A 5G0RB 4IO9Q 3LF0A 5D4LA 1HBUA 2V8DA 3ISNC 1RGVA 3A8EA 3QIPA 3N4WA 1NZAA 2F8MA 5DG7A 1KFSA 1LV5A 4IFVA 2CQ4A 1HBOB 1U09A 2PMHA 3D28A 4A8QA 3MTJA 5LT5A 3CO9A 1DZ5A 4QWCA 2ZZNA 2DNQA 2F40A 2CQBA 1WWHA 1HNXF 2MZTA 4KSEB 3BSAA 1FRHA 5E3CA 2D9OA 2HHUA 1VQNS 1LW2B 1FDBA 3LP0B 1X7VA 4JI5F 3QGIA 1N52B 2MSTA 5HP1B 4B3OA 3T5HA 4PQAA 1XEZA 5I3QA 5HBMB 3BN7A 3HHEA 2OPPB 4NA2A 1HBNA 2ZHOA 1DQ8A 1H2TZ 5KG3A 4X4VA 2NSBA 5HMYA 2XMJA 3PVXA 3W2WB 2BABA 2M8DB 2XMMA 3P3DA 4M1KA 5D4NA 4OJ1A 5T7LA 2DO0A 2C22A 3F73A 3FCHA 4GC6A 2J7UA 3J7A1 4FXDA 5F8NA 1P27B 4C7QA 1KRPA 3DI6B 4NCGB 3VF0B 3DN9A 3PKYA 1KS2A 2MZ1A 1SJRA 2HQIA 2QT7A 5EHHA 4C9DA 3T19A 4NWBA 3UCUP 1U6ZA 1DURA 2D41A 4PPDA 4QPXA 3K58A 1TL1A 1NHUA 3GILA 2GV1A 1LW0A 2OD6A 1FF2A 1FESA 1FE0A 2RMLA 2XMTA 2R8GA 2MGZA 2AGPA 4I69A 3F56A 1PC5A 4TXSA 3CWJA 3ONQA 3DOLB 5K5MA 3K0JA 3TA1A 5C24B 1S48A 4KT0C 1S6OA 1N5YA 2XY5A 1RT2A 3KTQA 4Y0FA 3KK3B 2K3IA 2E5GA 2LMIA 2VG7B 4WKYA 3CXCR 3T3FA 1H2VZ 3JYTA 4HDGA 3S7RA 1N8RT 1UW4A 4MK7A 1JLQA 2FJVA 3SCIE 2KM8B 4QWDA 3G71S 4MIWA 2DHXA 5L1JA 3M05A 1FT8A 2EFVA 3I56S 4ILMA 1T02A 3EYZA 2OLWA 3AAWB 2DH9A 3MPVA 4RZRA 2V2KA 2E5LF 4OIXA 4NLOA 4RW8B 4CO0A 5KG5A 3J7ZT 1VIOA 5J2MB 1DTQA 4OFZA 1VC5A 1GXTA 2QFJA 1U26A 3RRGA 4NLYA 3FJ2A 2VA3A 2KFNA 4X4QA 3Q2TC 5L1IA 3CJ4A 2HS0A 3CJ5A 3NKYA 2F7VA 4RW9B 1TL3A 1JLEB 4CZCA 2LDYA 2AQ4A 5DM6Q 3M2UB 3K5MA 5G0RA 2ZOFA 2O01C 2XEXA 1D3WA 3H20A 2FY1A 2HYIB 4GKJF 3M8PB 1YRUA 3M6WA 1UJ4A 4WU2A 5KFGA 2VPXB 5A2QY 3DFEA 2MZSA 2WB1D 3D1HA 3VZHA 3KOAA 4DS4A 1HBOA 4QWAA 2OMLA 2G4BA 4CTAB 4JBCA 4W90B 2CPIA 4WKRA 2LXIA 2M4MA 4F2RA 3Q0AA 3OV7A 1M0SA 3T6BA 2CDQA 3RBEA 2ZNYA 3MCSA 4B9MA 2FGOA 1LW2A 3CJ0A 1O5JA 4NRUA 5E7OB 3LP0A 2F9JA 1R27B 1KOOA 5HP1A 1WD6A 2E7XA 2EFNA 3TR5A 3PX0A 5IXUA 2RU3A 5HBMA 1BC6A 3B82A 4KRWA 1FDNA 2K3KA 4KB7A 1NK9A 3SI8A 4EZ6A 2HGLA 2OPPA 2VFUA 2D3OR 2GNKA 1U6FA 5U47A 2AW0A 1X4AA 3PX4A 2UV8A 2CPEA 3FZBA 1FDDA 2Z8QA 5HN0A 2HG4A 2GMHA 3IRXB 4DLGA 3JSBA 3ISZA 2ACYA 3J7Z5 3W2WA 4A8WA 3TQ1A 2ROEA 5LMNF 4ZPAA 4BC9A 4CH7A 5D6GA 4IYQA 3K5OA 2D74B 4Z37A 3FMWA 4YB6A 1RT7B 2YKQA 3DI6A 4NCGA 3N5FA 3IR7B 2PIIA 4I6YA 2MQQA 4O4RA 2E9RX 4JI4F 2JJ4D 3FFIB 3H2VE 2DNRA 2V8GA 1HNVB 1FKAF 3SV3A 2B4PA 2I1RA 1HI1A 2W4CA 3HO1A 2OO4A 1QUVA 1ZYQA 2VV5A 4KFBB 4LVNP 3BDPA 3N5BA 2ZJQQ 1VRTB 4DQQA 4LFAF 3FSYA 1ZZFA 4NYOA 3K5NA 3WC0A 2DNYA 4BDPA 2DGQA 4NCAA 2LU2A 3N28A 2AX1A 4ES3A 5K8NA 1FJEB 4F2SA 4LFBF 3DOLA 4F4WA 2ZKUA 3BR9A 5C24A 4RWWA 2K1RB 3NNCA 2WBMA 4I67A 4TQRA 2ASJA 2ASLA 4JI7F 5E33A 3KK3A 1APSA 2FDNA 3AJ1A 4RW6B 3PRBA 2MZRA 3SMZA 2NR0A 3HP6A 4ZVEA 4Y2KA 3WC2A 2CVEA 1XERA 4LF8F 1TK5A 1REVB 2VUGA 1VQLS 4Q8EA 4V19J 1Y9OA 5K14B 3CSKA 5JXSA 3KHGA 3CCWA 1Q7YT 3GIMA 2OMOA 2GGPB 3B78A 1ELOA 4QR2A 3MXHP 1K0TA 3T5KA 3SCJE 1G6BA 4E8UA 3B4MA 3KK1B 1CVJA 1S1TB 1JKHB 1U45A 2QSWA 1A6LA 3IO1A 3BSCA 4CH0S 2B4UA 4IFYB 2OJ3A 5J2MA 1RISA 2JHEA 3C6TB 2QLWA 5GAHI 2YH0A 3G8TA 3HX9A 2AJ4A 4Q43A 3EZ5A 1M1KT 2GW8A 4C0BA 4I4BA 3DU5A 4DV7F 3UQSA 3BGFA 4RW9A 2E29A 5DS7A 2IBKA 4B9NA 3G6YA 2BRKA 3HM9A 4TU7A 1S7HA 1JLEA 1TAQA 3AA9A 3M2UA 4WK1A 1UVLA 3KLIB 4N47A 3VAJA 1TR0A 4NYZA 3M8PA 5CYMB 3OVBA 4NYPA 5J1NA 3MEGB 2YKOA 4PG7A 4YMEA 2BYCA 1UWBB 4DX8H 4F3MA 4HTIA 5IFMA 1JLFB 4CTAA 1YSJA 1Q53A 4ZCIA 1YJ9S 5KG4A 4ATNA 4OMFG 3ZZ0A 4B9VA 3FMBA 4CO1A 2DGVA 2RU9A 3HDSA 5EX3A 4ED2A 1VI7A 1IUJA 1H3DA 2A10A 2CPZA 1IQZA 3HVAA 3TP2A 3VAMA 4XIUA 4LF7F 1NK4A 3FNNA 3PRDA 2ROPA 1LQ9A 2ABYA 4NZ7A 1YJNS 2ADCA 2L9DA 1ROFA 2ZFHA 1K73T 1CC7A 3IRXA 2EBGA 4ECXA 1FVSA 3CCQS 3QPIA 3GSDA 4YHHF 3R5BA 4EYIB 4X62F 5AXMA 3V4IB 2GJIA 3GIJA 3FZ2A 1RT7A 2K8GA 1ZM2A 3M6UA 2VKZG 3LQVA 3HHLD 1C1CB 2B7BB 1QAYA 4BC7A 2J76E 4X84A 2JWNA 5F8GA 3FFIA 3M1VB 2P6TA 1HNVA 4J9QA 4Y3CA 3DXSX 4QJVA 1YWXA 3I9ZA 4AUKA 1A7GE 3CJKB 4K4WA 4J9LA 4KFBA 4DQSA 4YB1P 3E51A 3PW2A 3K8VA 1HYSB 1VRTA 1U8SA 4A46A 4EO6A 4DV3F 3OPKA 2AU0A 2E1AA 3SSQA 3CPWR 2MHNA 3QGPA 1ULRA 2HWHA 3UPFA 2RILA 2DR7A 3MZIA 4LFCF 2NPIA 3FDSA 1U47A 5EN1A 3H5SA 2FJBB 2K1RA 3N9UC 4F4YA 3I0RB 1AXQA 2ZVSA 3OL9A 3LPYA 3ZZZA 5JVGQ 3HMJG 3KLHB 2WAQD 2VG6B 4RW6A 1N32F 1QTMA 1U1MA 1QJHA 5HMZA 1REVA 5SZTA 2LQ9A 1Y3JA 2RSQA 3I55S 4ECTA 5K14A 2ATLA 4ECZA 2RRNA 1FTCA 4XDCA 2GGPA 2Y1IA 3VAKA 3QGGA 3MFIA 2CQPA 2OH2A 2NUHA 2DR9A 2HPUA 3KK1A 2P9EA 1S1TA 3HHDA 3PV8A 1JKHA 2CQIA 5L39A 4FS2A 2DNGA 3OTDA 1UA0A 1IKXB 5KOXA 1HR0F 2Q1LA 2OSQA 4IFYA 2XG8A 2CJKA 4J9SA 1S1WB 4PKDB 4FBTA 4NXMF 2IRXA 2XO7A 1MU2B 3IG1B 1RTJB 1Z1ZA 2ZOGA 3C6TA 2WW8A 3QJJA 4K50A 1F9FA 3DHWC 3V6DB 5CA5A 1I6JA 1IKYB 2GIRA 4QZVB 2R2UA 1NK6A 1L5UA 1VQ9S 2KKHA 4ZVFA 1U4BA 3VAFA 4P7VA 4A48A 2BRLA 5B0GA 3KLIA 2WCXA 2AD9A 2VOOA 4MK8A 5CYMA 2ZUGA 5KG2A 1F0XA 3MEGA 3G6XA 2PT0A 2XBPA 3BO4A 1Y3KA 2CPDA 1OQ3A 1UWBA 2MDAA 4Q44A 3PDNA 2ILZA 1S76D 1JLFA 3NS5A 3HLUA 3M2VB 2JEGA 2OTJS 3G96A 3CCES 4WIIA 4C8KA 1HQEB 4MJKA 3PEHA 1X0PA 2DBBA 3G8SA 2JEJA 1TKZB 2O3DA 3MHYA 2Q43A 3HVRA 4HH0A 2B4OA 5DQIA 1R8HA 2HIQA 2GIQA 3KMSA 1D0EA 5C42B 2JL9A 1VBYA 1SL2A 2MJNA 1RYRA 3IXQA 4QCLA 2F8EX 3TVKA 5IT0A 5JUMA 3OR2B 4DL3A 3WDOA 1KC8T 1LK5A 1XK8A 4B17A 4DBQA 3CJ3A 4NA3A 4UUWA 2F1FA 2WOMB 3LH2S 3H2LA 4RW4B 2ZH6A 3V4IA 2BANB 3F44A 3QZ8A 4DFMA 2JFKA 1TV6B 2IVMA 1TKTB 1C1CA 1DBDA 1IJFB 3M1VA 1N5QA 2XMVA 4MFBB 1VK3A 1WHVA 2DT9A 4PXBA 4WYLA 3RB6A 5GVQA 1L3VA 4ELTA 3CJKA 2ZOMA 4ZPTR 2BUNA 4WYWA 4JI2F 3IRWP 1NJYA 1V3ZA 1U2FA 5F8LA 5AXLA 1HYSA 2OAUA 4DL6A 3US5A 4QW8A 3MM7B 1S0OA 3V2UC 4X4NA 4DR1F 2KYXA 5A0YB 2ZDOA 3SXLA 2KT3A 3IFEA 4MTPA 4DN9A 4QIEA 2VC0A 2BA9A 1N6QB 2FLOA 1UVMA 2HGNA 2J6UA 3CTRA 2LCWA 3N6NA 1FJGF 4QWBA 2NZ4A 3I0RA 2E5IA 1CSJA 2CIMA 3DOKA 3HFKA 4X4OA 3KLHA 2R8JA 2VG6A 4DSEA 1AROP 4OHVA 1RDRA 1FXRA 1Y5NB 3MUTP 3AJ2A 2IRUA 1R0AB 2QEXS 1XNRF 3QJPA 3HKZD 2B7CB 3TW0A 4HI2A 3BO2A 4U6PA 4KJIA 3ENQA 1NK0A 2IBOA 2HS3A 4JV2A 5GAGU 4JUZA 1X4DA 2M52A 2NYIA 2C3MA 2QZ8A 3NCQA 2KTQA 2CQCA 2JVRA 2VPZB 4RLEA 3QAUA 1K8AT 5CZXA 2POKA 5CYJA 1IKXA 4HT7A 2R7QA 3LWMA 3CC4S 3H2UB 1X9WA 4F02A 3OW2R 3PR5B 4JYAF 4Y2MA 1S1WA 1S6PB 2XWYA 3GFZA 1WTFA 1MU2A 1Q82T 3IG1A 1RTJA 2HS4A 3P5TL 1U1QA 2DISA 2W24A 3M30B 1R8BA 1BQNB 2HHVA 1HI8A 2KZMA 2RUGA 2FC8A 3AB2B 1SH2A 3R5DA 3BREA 2QLXA 3V6DA 1S6QB 1IKYA 2EVZA 3BB5A 1D8ZA 4DR6F 3H5XA 4AXJA 1DLOB 2JVOA 1CLFA 4UOCA 2XC9A 3T5LA 4TY8B 3TAMB 3H5YA 1BQXA 1HFEL 4DV5F 4IUFA 3I5CA 3CIMA 4N76A 3I96A 2MYFA 4LQ9A 3VCDA 2PSZA 1JNRB 4A4JA 3ETOA 2AJQA 2DPJA 3DLLQ 3BQ1A 1TZ0A 3ULHA 3MOJB 2W8LA 1FRLA 1LWFB 3M2VA 4LMZA 1UETA 4CO4A 4TKTA 4A47A 1HQEA 4C3MA 4J9PA 1NHVA 1TKZA 2OKQA 1Q8BA 3QMQA 1SJQA 1KQSR 1ZPVA 2IA0A 1QAIA 2B6AB 2MSSA 4X4TA 3CCVS 3GZ7A 4KO0B 4TLQA 2X51A 1FA0A 1GXLA 1X4GA 3D0IE 5C42A 3OFHA 2HLUA 1YHQS 1R31A 1WELA 4DL5A 5AE2A 2Q66A 1VHFA 2GA7A 2E9ZA 4ZPVR 4I2QB 1YI2S 2MKSA 3OR2A 5F0WA 2Q6CA 4YR3A 1SJFA 1U1OA 1JB0C 1C4AA 4NLWA 5D77A 3PFOA 2OTLS 3J81Y 2E9TA 5LJ3Y 2N3LA 3TA0A 3K8WA 4RU2A 2ZZMA 3GV7B 2WOMA 2PA3A 4RW4A 5B08A 4UW2A 2BANA 3FEZA 1X9SA 2LEBA 4Q8FA 1FXLA 1TV6A 2AJ0A 4L3NA 2AGOA 1TKTA 1P8GA 1LK7A 1V9OA 5L9NA 1HD1A 3PIOQ 1GX6A 1HD0A 4MFBA 2K7KA 2YQ3A 5CYQB 4K5SA 3BJYA 2IM0A 4AL7A 4QW9A 2RJZA 2KO1A 3HI9A 4YUDA 2CPYA 1U25A 5KT5A 3JB9k 5D4OA 2VBWA 3MM7A 3UDCA 1KD1T 2CQGA 1OS5A 4WFYA 3OXGA 5A0YA 5L8RC 2J0QD 1RA7A 4GKKF 5T14A 4Q45A 4QWEA 1N6QA 3LGNA 1R8AA 3OFFA 3DM2B 3SEOA 2Y1RI 2CJBA 1S0NA 1U49A 2UVWA 3MOZA 3BEGB 3ZZRA 4DL0C 3IN5A 1WHYA 2RQMA 4HTJA 2VD3A 2CFXA 2LQ5A 3BQ2A 1L3KA 2XNQA 1HHSA 4OLPA 1GNKA 1Q1KA 1R0AA 5HMXA 3SFUA 4KR0B 2HGMA 5EWGA 1DQ9A 3SDEA 4WFXA 1ZETA 2IJFA 2GMLA 4ZS6A 4H4KA 4OZ1A 5HI7A 2YVSA 4C8MA 3Q23A 3G4SS 5ADZA 3M32B 3SSRA 1NEEA 3IR5B 4N77A 4URQU 5C5JA 2IHR1 3DMJB 5KT2A 2L41A 1P1TA 1DJ0A 2XMUA