4X62F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4x62F00
1IBLF 3ZZPA 4LFCF 4B3SF 4DV1F 5LMUF 1N36F 4LF7F 2UUCF 4KHPF 4X64F 1B64A 1N34F 2E5LF 2UUBF 4X65F 1F60B 4OX9F 1XMQF 4DV0F 4DV5F 4JI5F 4LF4F 1CQNA 1I94F 1IJEB 4B3MF 1VMBA 1HNZF 4JYAF 4JI3F 4X62F 4JI7F 4JI1F 2BVZA 2HHHF 2UXBF 4LF9F 4LFAF 1CQMA 1LOUA 1QJHA 3T1HF 2VQFF 4JI4F 4JI6F 1G1XA 3OTOF 4DR1F 2VQEF 4DV6F 4LF6F 1G7CB 4JI2F 4DUYF 5LMNF 1IBKF 1N32F 4DR4F 4DR3F 2B7BB 4X66F 1XMOF 4GKKF 4DR2F 2ZM6F 2B7CB 2UXCF 1IBMF 4DR7F 4NXNF 4AQYF 1RISA 1J5EF 2KJWA 4DV4F 1FKAF 2YY3A 4YHHF 1XNRF 4K0KF 1XNQF 1HNWF 4DUZF 4JI0F 1FJGF 4JV5F 2UUAF 5BR8F 4LFBF 1GH8A 4NXMF 4B3TF 1IJFB 2F4VF 4DV2F 4LF8F 4DV7F 4LF5F 5AJ3F 1HR0F 3T1YF 4B3RF 5IWAF 4DR5F 2KJVA 1N33F 3R3TA 2J5AA 2UU9F 4DR6F 4GKJF 4YY3F 4DV3F 1HNXF 4JI8F 2BXJA 2UXDF 2RJZA
chains in the Genus database with same CATH superfamily
3PO4A 2X1GA 4OX9J 1S48A 4NX9A 2V8GA 1S72S 2JEIA 3POTB 1B3TA 4X4NA 2HNYB 3KG4A 4A8KA 4DV0F 1PYSB 2OGUA 3CJ2A 1HHSA 3QQCD 4P6QA 1TTHB 4WE1A 2HFUA 4UY8T 3MPVA 2ASLA 4KPCA 5J1EA 3M6WA 4NLVA 2HHWA 1WC1A 4JOUA 4RUAA 1G1XA 3FK4A 3DLKA 2CNOB 3H5XA 2WVBA 2QL5B 5J2NB 4ED8A 3MOZA 2OEJA 4W90B 4I2QA 2PFFB 1UWBB 1J5EJ 3R1LA 2BRKA 4FVMA 3A4TA 1HMVB 3BN7A 4DR7F 2DHXA 1RT5B 4LRBA 3CCES 4NRUA 2PD1A 1NK6A 3M9MB 2OFHX 3PEJA 2AQ4A 3PRDA 4NLYA 2ZD1A 1ZZNA 3CCVS 3O44A 3NCPA 1RAAB 4Q5VA 3Q8VA 3DGPA 3DGVA 1S49A 3C3LA 1PC4A 1SUQB 5E3RA 4LREA 2HMIA 4ZIWA 5ETSA 4ID8A 4ZS6A 2HBQB 3IBCB 2JZ5A 3PCOB 1MU2B 3JXOA 3W65A 4ZVRB 2AJ0A 2QA4S 1C1CB 5HLFB 2ROEA 3NMRA 2YH1A 2YPZA 1RAGB 1BQMA 2K8GA 5J2QA 1HWUA 5GVQA 2ZNZA 5LL6d 2VUGA 1WEZA 3QMQA 1NK4A 5MLCV 4DL3A 1EP4A 2IVMA 4PABA 1KONA 3BDEA 4CLTA 2HZCA 4F04B 2JEGA 3J80Y 3ILLA 1U1QA 3FBFA 4C4WA 1UA0A 5HI7A 5BYQA 3S6EA 4DV7F 1V3SA 2GW8A 1T03B 3NGTA 1IWGA 5G0RA 4A8MP 2ZOFA 3UD4P 2YNHA 1T3NA 4DX7A 2R4FA 1FWKA 1S79A 1S9EB 2A6MA 4LBPA 2CVEA 2AYEA 4ZITA 1QD1A 3M30A 4NA1A 2W4PA 3EM1A 1LWXA 2FGCA 3KK2B 4IUFA 2DGSA 1V5VA 1JKHA 5D0HA 1DQAA 1K9MT 1WHWA 4IOCQ 1YSJA 3A1YG 3NP5A 3RB4A 1G6BA 2MKCA 1DZ5A 1ZAWA 2AYBA 2DK2A 1WC6A 1HNZJ 2HQCA 2W1BA 2N82B 3DLGA 5DGBA 4IDKB 4F4ZA 1RTJB 2CNNB 4C3MA 1A0OB 2VZ9A 2GJIA 3DYAA 1NSPA 2RRNA 1UVIA 3M9NB 3K59A 2CJAA 1HW9A 1RU2A 5HJXA 2MZQA 4MYUA 3QPIA 3J81j 2Q3PA 2KXNB 2BOPA 4B3OA 4EU0A 2MJNA 2P2CB 1TMJA 1YTYA 5IWAJ 1N33J 4GVBA 2ZBCA 4I1TA 1YZ6A 1VQNS 2VPWB 4DQRA 4RR5A 4NLGA 3MFIA 2ASYA 2HNDA 3LPEA 4ZIVA 5LMUJ 4LF7J 3MD3A 3P5BP 2VIHA 3JS9A 5J1NA 1X7VA 3JTOA 2V2KA 3R5CA 4GO7X 1BQNB 3R7BB 4X62J 2XYPB 2B4VA 3V2UC 4L6V3 4JI3F 2R7SA 4DQIA 2RDJA 4KAIA 5ETLA 3T1HJ 1JK9B 3EXCX 3L9ZA 3TR5A 4OJGA 1QVFR 1LOUA 1H98A 4WXWA 3O6QA 4JI2J 4DUYJ 5HN0A 2VQEF 3KK1A 4ZA1A 5CHCB 2NUHA 4CQ1A 1IKXB 2KHCA 1R31A 1APSA 1XNQF 2BYCA 2HNZB 1NH7A 4O4GB 5L8RC 1DURA 3CC7S 3QGIA 3G87A 4YY3J 3TUZC 3FSIA 4AFFA 1GQEA 3G82B 5KFXA 5AXNA 4OJ3A 4USVA 1Q82T 1RUSA 3HLUA 4O3NA 2RHSB 4R5PA 3BYRA 1N0UA 2YX7A 5THWA 3I31A 1PSDA 1Y11A 2Z58B 2J8AA 4ZJOA 2XSJA 2NSBA 3K5NA 2W4DA 2WONA 2F1FA 4I68A 1U24A 4UTGA 1Q78A 5DO2A 1KTVA 2B56A 4M5IA 5GMKa 5B0DA 1SV5A 3UR3C 4MKBA 1F3FA 4NL5A 2PDAA 1V5IB 2XMWA 4U9RA 4A8WA 4IOBA 1U2CA 1Y9OA 4IRKA 1VBXA 2EBEA 1F9HA 1XMOF 3FQKA 1FCAA 1HYSB 1RK8A 2E1MC 2CWKA 2Y0BB 2F3JA 4KSEB 4YHHF 2LU1A 3PEHA 4IG3B 2BJ3A 1HNWF 4DSIA 2LQ5A 1J5OB 3TANA 3MAHA 4C11B 1JLCA 1GH8A 2JH3A 3I0RB 3CD5A 2HGLA 2GC8A 5KG5A 2W9CB 1SJ1A 3ZZTA 3UPFA 5KT4A 5EX0A 3B6BA 2CWXA 2W9BA 4O3OA 5IZHA 2Y1IA 3D68A 4KGVB 1B64A 3CJSA 1QTNB 2JEFA 3TJ9A 5A6WA 1NDKA 3VF0B 1M1KT 2JL9A 1EJ7L 3LGMA 3D67A 4IG0B 3MI7X 4JI4J 5K9FA 3QJPA 4V1Ak 4DL6A 4A8FA 1PGZA 1C2PA 3ZZRA 3CJKB 4U8VA 2WVDA 2CYYA 3MAQA 2BW2A 1LNQA 1S0MA 4PUOA 5ETNA 4UY85 2BE7D 4YEAA 4I6WA 1VJWA 5LJ5Y 3TA1A 4CRJA 5LXRA 4RX6A 1IKVA 4LF8J 3T41A 2DR7A 1R0CB 4FNIA 4FVCA 2HHVA 2Q66A 4NXMF 1S9GB 2JJ4D 1Q95G 1O5JA 3FBBA 2C2EA 4KO0A 3CJ5A 3MPDA 2VBZA 2Q43A 3B4DA 1RTIA 3M6UA 3W2WA 2FJVA 3EPIA 2BV3A 1RA6A 2GGPA 1JQGA 4DX6A 1UWAA 1WNEA 4KTQA 3M2VB 1KQKA 3FFIA 1RWWB 3HPOA 3W63A 2H48B 3KXDA 3KJVA 3HT3A 2B6AB 4KQZA 1IBMJ 1H3DA 4HT5A 3CIZA 1MW7A 1NJWA 2ILYA 3PRVA 4M95A 4IR9A 4Z7YA 5BR8J 1TUVA 3HHKA 2XMAA 3I5BA 3BS9A 3EX7B 4LFBF 5GAEI 4IFVB 2O3DA 2CQHA 2M70A 4OJHA 3J80U 1HWIA 2MQMA 2XS5A 2WAQD 1DFDA 4DFKA 1X4FA 3QLHA 1O51A 5KT3A 2N4DA 2HHTA 3QT8A 3QSIA 2ZBPA 4K4XA 3L7UA 4LSNB 5EWEA 3GILA 2LLZA 4LFAJ 2K2PA 3RBZA 1KSPA 4NLDA 4C8KA 2MLZA 4Q7AA 2BE2B 2CPDA 1T0TV 3OTOJ 1MG7A 4FXDA 2VOOA 4PWDB 1VQLS 3UDCA 3SFGA 2QLXA 1Q8LA 1FDBA 2ZC4A 5D3GB 4DUTA 3E3XA 4ZDNA 1X4GA 1CG2A 2VKRA 2R2RA 3I32A 4PWUA 2HHQA 2ZZTA 1MWQA 3R97A 5IT0A 4ZVTB 3P45B 1N48A 3EVWA 4DR5F 2A0FB 2E9ZA 1N54B 4FYYB 3BGFA 1K1SA 2YNGB 4KV8A 2O66A 4PWWA 1K73T 4J37A 2M9KA 4EYIB 1RKIA 1VS3A 1IJEB 2X51A 1DTQA 4EYHB 1U4BA 3CF5Q 2PEHA 2EC0A 3R5DA 3TJ8A 4IYQA 1QAJA 1UP1A 5DJBA 2FVSA 2RF2B 3TA0A 4DR2J 1RT4A 1C4AA 3VAIA 3GYXB 2J6UA 4LSZB 2DY9A 3EZOA 4DXLA 4J9NA 1SC6A 5KT7A 2ADCA 2RT3A 3W61A 1RA7A 2JVOA 2EK1A 1N4LA 1JXVA 1R6VA 3MPYA 3K5LA 5DQGA 2O1PA 4ANDA 4H4KC 2OUGA 3OD2A 4CNZA 3SDEA 1VQ4S 1NSKL 4QWBA 2PO4A 4RW7A 2AX1A 2UXDJ 1M0SA 1S10A 4DV3F 2DISA 4KKOB 3IRWP 3HFKA 2W8LA 4Z7CA 4J9OA 1NZAA 4QBUA 1MWZA 1QE1A 3IR7B 3VAGA 1UFKA 1UPPA 3CCJS 2AD9A 4J9QA 4PQUB 1S1VB 2MYFA 2QL9B 4NWBA 1VDHA 4N8NA 1LWEA 3AHPA 1X31C 2RQMA 2MB0B 2DIUA 2JOQA 4UZCA 2NXUA 4JI6F 1VC0A 4AYBD 4NLWA 4HEA9 1NKEA 3HO1A 2N7CA 3PACA 4HHJA 3DLEB 1ZAVA 3VZHA 1SJRA 1CEZA 3KLFA 2GVDA 1OO0B 4DUZJ 1NDCA 3GJTB 3AQOA 2KJWA 4EI2A 2OI2A 2YQ0A 3TEHB 3BQ2A 1FRXA 3G71S 3PKYA 4M5HA 3E01A 3DRXA 1U6FA 2B8QA 2DNYA 4ICLA 3GZ7A 4CT8A 1ICEB 4TY8A 3BSCA 3K58A 1Q5VA 1VHIA 2F7VA 2QMWA 2AJFE 1YG0A 3HF5A 2BANB 1K0VA 1CS4B 2DGXA 2SXLA 4ECUA 2WRMA 2EW9A 2HW3A 4P52A 1C0UB 1CJUB 1HL6A 3TVKA 2UVRA 1RAJA 3HJVA 5DETA 2GZOA 1P8GA 2ZH2A 5DGAA 1LK5A 3SXLA 4KFBB 3HSGA 2IFXA 1KTQA 1SVDA 2GHVC 2ALZA 4NLQA 3TAQA 2ZBRA 5T7LA 3FEZA 1U0HA 1WEXA 1YVFA 1JJHA 4W92B 4OI4A 3J7YU 2J9DE 1VHFA 4PPDA 2MQLA 4C8OA 2FGOA 1U6BA 2K3KA 1TELA 4JV5J 3T1AA 3IFEA 3SFUA 1FJCA 2MDAA 4GVLA 4RLEA 1KBRA 3GIJA 5C24A 1XK8A 2DNZA 3S8SA 3VQSA 5FJ4A 2FVPA 5KFBA 2J7UA 2QMXA 4C3KA 3AD9C 2AP6A 2XO6A 5JJBA 1FX4A 4WE1B 1RACB 2G0JA 3NBPA 4YOEA 4BBYA 3D1OA 4X65J 4KE5A 4ED7A 5J1EB 1N5QA 2AGOA 3FZ2A 5IOLA 4X4TA 2R7XA 1EB0A 5ITHA 3CGIA 2JLEA 5ETOA 2V4JA 1VGYA 3DLKB 3FRZA 4Y2KA 3JQJA 1L3TA 2YKOA 4C9DA 4I2QB 2FHJD 1R0AB 3TJAA 2HBRB 3H98A 5CH7B 3R5GA 5CQGA 3Q8UA 2C2MB 5D15A 1R89A 3H4BA 2FDNA 5KFRA 1OJ4A 4CZCA 5KFGA 3DOMA 2ZD1B 3W8PA 4KHRA 2D74B 3H4DA 5B0GA 2UUWA 2GIQA 3DGPB 1B4SA 1OPIA 4FF2A 3L09A 3BV8A 3T9ZA 2HVZA 5AJ3J 1LW0B 2P6SA 1G3OA 1QVGR 3ZNUA 1S4EA 3EMTA 1TKXA 5KFOA 2COLA 5DZ6A 1JB0C 3ENVA 2KB2A 5I42A 4G1IA 2DNQA 1U2RA 1BQMB 4O44B 3R2DJ 2KXFA 4DS5A 5LOQA 5J2QB 1D3WA 4CO5A 3RBEA 1T3OA 1RSCA 1F60B 2DBBA 3AOAA 3ADAC 4OYBA 1Y0HA 3ENQA 3F41A 3MEDB 4ZCIA 1UJ4A 3C14A 3UNGC 3CCTA 2BRLA 9RUBA 2BVZA 1EP4B 3HK2A 3KJQB 1NAQA 4EZ9A 1CJTB 3NGKA 2HG4A 3QAUA 1NK8A 2JX2A 3SIPB 3BO4A 1T9XA 3IBFB 2AYGA 1G7CB 4Q8EA 4I69A 3PYFA 3QSYB 4DR3F 3DHXA 5K8MA 2J0SD 4C8NA 2L08A 1N5SA 1MMDA 1UFLA 5G0RB 1GXLA 4CO3A 2JEJA 4K4ZA 2WBMA 1Q81T 1JJ2R 2KZMA 3OL8A 3MFHA 2NLWA 4MIAA 5B0FA 4WZQA 4QOTA 4WFYA 1JKHB 3KLEA 1R6YA 3GCWP 1H2UX 2RJZA 2IC3A 1QDUB 2VICA 4ZVGA 1R8BA 3LA0A 5A6PA 4FZVA 1Q4RA 4URGA 2UUBF 1FD2A 3MMBA 2QIFA 3QZ8A 2MKYA 1HI8A 2QA2A 3DYAB 3S1TA 3H25A 4OI0A 2M2BA 4K4SA 3DOLA 4CO4A 3M4XA 1FKOA 4EFAC 4UW2A 4TU7A 4X4UA 2NREA 5SZTA 2VQFF 2F8HA 3I6PA 2CZ9A 4B3OB 4LF6F 4ZPTR 2ZH8A 4GVBB 4XDCA 4OZ0A 3A8KA 2C3UA 1YJRA 2RILA 1FD8A 4DN9A 3BZQA 3GFHA 3HSJA 1REGX 2DNLA 5DG9A 2GQCA 1HIYA 3RR8A 4PG5A 3CC4S 2V8VA 1IUJA 2Z2YB 1KWMA 4K4UA 3BR9A 1S0VA 4CM0A 3MGJA 2HWTA 4F8RA 2CADA 2VA3A 3O8WA 2HFNA 3F44A 1R3NA 5F0WA 1U7LA 3LO3A 4PG4A 3HULA 2QYCA 1TFWA 4X84A 5ETVA 4ECWA 4LF9J 3KK1B 3VGTA 3BGUA 3Q23A 3D0HE 4IO9Q 3LWMA 4MMOA 4U96A 5GAGI 1TAUA 1XJWB 2KT3A 2PE8A 2CKWA 4C8MA 4KHMA 4FS1A 1IBKJ 2ASDA 3AQPA 2L9DA 5HQMA 5KTQA 1TL7B 1Q86T 5HP1A 2XC9A 1GAOA 1CC7A 4GKKF 1EETA 3NWRA 4S0MA 2UUAJ 3G4SS 1VIXA 3HJFA 4R5PB 2H9ZA 4NEYA 3K2YA 4ALZA 2XSJB 2UU9J 4X4OA 4MFBA 2NZCA 5KG7A 3CXCR 1SL0A 4WBFA 1IKYA 2UP1A 2QLBB 3SCKE 4FBTA 3GWCA 1DJ0A 1UVMA 1SV5B 1FEHA 1CJKA 1VJQA 2Y3YA 2NPFA 3GIMA 5LM7E 1VI7A 5B7WA 4OYWA 1S76D 1I51B 4U95A 3J7A1 2HHSA 2F8MA 3JB9k 1YITS 4QU7A 3OSNA 3OR2A 2V8HA 1VQYA 2VDHA 2H65B 1JLCB 1N5VA 4LRCA 2KL8A 2PT0A 3MPWA 4JI0J 3QIPB 3KWMA 2HVIA 2W9BB 3BYPA 1A7GE 2CVIA 3ZZUA 2M5YA 3SCJE 1T9WA 1FK9A 3Q2SC 1HR0F 2DKOB 1A6LA 1PG5B 3IS9B 4IR1A 2BXJA 5AXMA 5H9EJ 3BEGB 3MR6A 4B3SF 2AEFA 1XBWA 5HVFA 4LF4J 2GVZA 4X64F 4NASA 4WWSA 3HD2A 1S59A 4DX5A 3D3BJ 3OBIA 4WTOB 3HHLC 4O23A 4UF4A 4RUBA 5D78A 2NS1B 2Z2ZA 3LH2S 3HHLB 4PUOB 4L72B 5M2UA 1QSLA 3TQEA 2ZFHA 1FTRA 3F56A 3QATA 4ZVEA 5ETMA 2AU0A 4Q8FA 3RAXA 3GCXP 4MH8A 1IKVB 1ITPA 3HXMA 3W5XA 4JB8B 4DR4F 1CC8A 2CG8A 2OD6A 3LUYA 5HL7Q 3NKYA 3GLJA 1ZBTA 3W5YA 3GP9A 4USIA 2EVZA 2AZ3A 2IM0A 1X9MA 3Q83A 2R9LA 1RTIB 3MM9A 4BDPA 2Q1LA 3W2WB 3VGUA 3IO1A 4FDFA 4C98A 1R27B 1EKRA 4GO5X 2GGPB 4OX7A 1NCLA 4I4BA 1ZTWA 2JLGA 2M3DA 3ETOA 4DHVA 1RT6A 3FFIB 2UUCF 1RT2A 3NY0A 4FS2A 4WCEQ 4ZPVR 3NS7B 3NS5A 1X5PA 4NMXA 3KJVB 3CMES 2UXBJ 4U67Q 3JTNA 3DDKA 2DGWA 3GIRA 3UW1A 3X3UA 5F41A 2UVWA 3IR6B 3DRYA 3NGSA 3MD1A 5E3AA 4A46A 1HQUA 2YNFA 3AA9A 1TUWA 1P1LA 4RPFA 2V2VA 3PM9A 3NS6A 4TKTA 5AE3A 2MZRA 1VQ8S 2KH9A 2VBYA 3TOQA 4UOCA 4UT4A 1U6ZA 3MR2A 1HNIA 3ISNC 5ETPA 1DQ9A 5E5NA 3LOUA 3QLHB 3N6NA 4P2FA 2KVQE 3FBCA 4NCBA 2IJRA 1GX6A 2VKZG 3R5AA 2B4UA 1WC3A 1FEEA 5L39A 2F63A 4B17A 3W8GA 2DNNA 2IA6A 5FIIA 3OTCA 2FY8A 2YKNB 4A8SA 2R2TA 4QIGA 3IR5B 4WIQA 2LP4A 3WIUA 3PY8A 2P8IA 5KFJA 2CQCA 2KU7A 3ZZZA 2V4QA 4DCPB 3BKFA 4JI1F 3MUVP 5I3UA 4HVZA 2M7SA 4Q45A 2ROPA 2DH9A 1N32J 4D3GA 4C0OC 1P27B 4TQSA 1QAYA 1G4CA 1YJNS 2B7BB 4UQGA 1S12A 3T9NA 2G2YA 4CLYA 2AKWB 1RXOB 4OZJA 3ETMA 2WSEC 3UN3A 4ES1A 4KC5A 2GJ2A 4ZKAA 4YS2A 1D8ZA 1FRIA 1VBZA 3IAM9 5IXUA 3NGRA 2HRUA 1WJ9A 3OHBA 3BBFA 2VU5A 5C42A 3HVTA 1JLGA 1DTQB 4WJBA 1X4EA 4ECSA 5DM6Q 2RAQA 2EXUA 3EVOA 2A18A 4RNOA 4B9TA 4DV5J 2GMJA 2DGOA 2YWHA 2W2PP 3ZZYA 1HD0A 1NZ8A 1JLFB 2DNMA 3KHLA 3K5OA 3FMBA 1VLOA 1RT4B 2VFTA 2J0XA 4A8QA 1LKZA 2UZAA 3ZTOA 4NCGA 4CLKA 2HVDA 4ZLPA 3B78A 4QWCA 5LSRA 2B4OA 1N5YA 3D54A 2FPHX 2RRBA 3HM9A 4DV6F 4LT6A 3PV8A 2EC2A 3LANA 1TKDA 4F3OA 1WC0A 5LMNF 3SDEB 2W24A 3TZWA 4RW7B 3QWUA 2QA1A 4GMKA 3NCRA 2DXFA 2FQQB 1OS5A 2K1RA 3TRGA 2XLKA 1D9AA 2V50A 1FJGF 2AJ4A 3RAQA 1Q1KA 3JAMY 1QE1B 2GQ2A 1X0FA 4OYZA 1HNXJ 4PPZA 2CUYA 1HPZA 2L9NA 2ATLA 1IBLJ 1L3VA 1FI4A 2RQKA 5KFZA 3DI6A 3GU0A 4ECYA 2J7WA 1LWEB 2RU9A 2GQQA 3VGVA 4QPTA 1HBUB 1ZM3A 4OX9F 3BKTA 4MKVA 1FRLA 3CO9A 5KFKA 1SI9A 4QCLA 3OTDA 3DHWC 1KS2A 4RW8A 3KLFB 3Q8QB 3QJJA 4WYLA 4Q44A 2HLUA 4X4VA 1NKCA 2HFOA 2NYIA 4ZPWR 1RYSA 3PHTA 2HQDA 1HW8A 3E01B 3TZXA 1KD1T 4ICLB 5CD4A 4TY8B 3RBDA 3CCZA 2NQPA 2HZVA 4K0KJ 2C3OA 2E44A 1VR6A 3M8PA 2QRRA 2V8PA 2GMLA 1J5EF 4J5OA 2HS4A 2O67A 3U02A 2KTQA 2CPIA 4CO2A 2YH0A 5KFMA 4PAAA 3HFZB 4ZMMA 2CNKB 1RBAA 2DNOA 2QN6B 1JLQB 2AGPA 4Q0BA 1LXJA 4DX8H 1Q16B 4AE5A 3A8JA 3HHNB 3MM7B 3JSRA 4WU3A 1SJ4P 2E5JA 1KQSR 3RW7A 3FZBA 2E5LF 3ITHA 2ZJQQ 2VB6A 2EFGA 2Q79A 2CPYA 3FNNA 1RE1B 1UJ6A 3RZAA 2BE9B 2QSWA 2ZE2B 3BO2A 4OIXA 3UR0A 3R1HA 2ZJRQ 4OLOA 1BC6A 2OPPB 4W4MA 2UXCJ 1FKPA 2QGFB 1ZA2B 1U0SA 3MMCA 5H9EK 2IJFA 5KFPA 4K2XA 4ETXA 3VAMA 1SJFA 2KRRA 2Q6BA 2F4VJ 4ECTA 3ISZA 2CQBA 3DRSA 3V81A 4LIWA 4EEYA 2LQJA 4LF5F 1HA1A 1LWFA 2KHDA 1JLEA 3RYLA 2FHMA 2V4JB 4DWIA 1RBLA 3CJ4A 3UFCX 2MHEA 1WHYA 3M8WA 2PMWA 3H40A 1AT1B 5DDOC 5IC6B 3IWXA 2C2RA 1RT1A 4AL6A 3OXFA 5JUMA 3DOMB 4HDHA 2IRYA 3GE9A 4JV2A 1EKSA 3PR5B 2ZJPQ 1A9NB 1Y3JA 5B0CA 2H5EA 3QO9A 1KLNA 1FTCA 5BXIA 1AFJA 1F5AA 1OY8A 1RWMB 2V63A 1TR0A 5ETRA 2XLJA 4FF3A 3AOBA 4NZ7A 1ZZFA 4TYBA 4BCAA 4DPYA 5F8HA 3I5AA 2FLPA 1TKXB 5SUHA 4QIVA 2KZZA 4OZ1A 3FEYB 5I42B 4O3PA 1S57A 3V6DA 4ZPCA 4C8ZA 3NWGA 5K8OA 3NXZA 3KFWX 1RWNB 1RP5A 4ANCA 3TO8A 4MKAA 2OPQA 5CABA 5IWAF 1N33F 5GAEU 2UVVA 3C14B 4NXMJ 2B4PA 2ZH3A 3LGNA 3N01A 5EGYA 2IM2A 5LMUF 3DRPA 4LF7F 3TARA 2MZ1A 2CNLB 1TK5A 2ZEJA 1M5SA 3NCQA 2UVUA 4P75A 1ZM2A 2MEWA 5IV3A 1M90T 3KOAA 4X62F 2EPIA 1FNXH 4YP3A 2G13A 2AHOB 2N4CA 4GC7A 4CM2A 2I8EA 1UETA 1CQMA 3M32A 2MLYA 3AY0A 1H74A 2VHGA 3T5HA 4KB7A 3T1HF 2CQ2A 4DLGA 2V94A 4X4PA 3TZYA 4RWXA 4JI2F 4DUYF 2GNKA 5F8IA 1B7YB 1L3KA 1TAQA 1K47A 1TL4A 1HWJA 2VG7B 3KLEB 4IH7A 4LMZA 3MMAB 4RW4A 2OELA 3QZ7A 1NDPA 4ED2A 3H5UA 2IC3B 4PYAA 3OPKA 1O0PA 2AJ2A 4HDGA 3SSQA 1PBAA 3MMBB 4KJIA 2IHR1 2K7JA 2DNRA 6AT1B 1TL1B 2DR8A 2OO4A 1S1UA 5MAOA 4YY3F 3OSPA 3DOLB 2HVEA 4OI3A 2ZZMA 4A4JA 1YJTA 2CXEA 1FKOB 3EXYA 4ELTA 2QV6A 2R7TA 1J2VA 1TKTA 2OD4A 2D3O1 4P73A 1X4BA 2IRXA 3FSXA 3H8YA 2YX4A 4PXCA 4YMEA 1URNA 2R2SA 4K59A 2C2ZB 4CLLA 5F3TA 4B9LA 3R7NB 2A2CA 1VYAA 3C16A 2X1FA 1WHXA 2RB7A 4QQBA 1JNZB 1L3UA 1NLKL 4ZVPB 1ZETA 3J7AN 2H1YA 3V4IA 1UMJA 7FDRA 2KVIA 3M2RA 1WTBA 4C2MA 1QY7A 1ZA1B 5IQ6A 3AB4B 2IJNA 1VLYA 4ZPBA 2VOPA 2QE5A 3MECB 3IRXA 2C28A 3QIDA 1ZOTA 1OQ6A 4ZPAA 1U1NA 5B0EA 2FY1A 1ZM4A 3QFWA 2YBVA 4DSFA 2LEPA 5T14A 2K06A 3W1YC 3OVBA 2GO8A 4ZVHA 4Q2LA 4ED1A 4UOGA 3GB0A 3WC2A 3LP2A 3BJYA 1X9WA 3B82A 2C2KB 3JAMU 1VISA 2ZC3A 3ZNJ1 1H2VZ 2KI2A 3T3FA 2W2OP 4CH7A 2P5VA 5GADU 2DNGA 1T7PA 3LAKA 4XO0A 2BUNA 2F5GA 4TQRA 3AT1B 3I0SA 2HBZB 3B4MA 2Z4PA 2FC8A 5HP1B 4QYZJ 3W62A 1EETB 2OMOA 1NB2A 4WFXA 3GSDA 5F9LA 4F4XA 4JI4F 4PKDB 4M5DA 1ULRA 1H2TZ 2EI5A 5M2PA 1L3SA 1GK8A 2DO0A 4RW9B 4DV4J 2C2OB 1ZYQA 4MFBB 2A6OA 4K4YA 4IQMA 5CYJA 2FZKB 3FGVA 1CULA 1HBNA 4CTAA 3V6KA 5GMEA 4USHA 1IKYB 4NI2A 4NA3A 1N8RT 4ED6A 3K57A 2VG6A 3N0VA 3OT9A 4LF8F 5RUBA 3M7VA 1CJKB 3G6ES 3D1QA 3QYYA 5DDRC 1FRHA 1L5UA 1YIJS 3ICLA 2WB1D 3CULA 1YX2A 2W2QP 1S1TA 2Z8QA 3OR2B 1XEZA 3F73A 3MF5A 3BN4A 4UOFA 3W9HA 5H1SV 3CJTA 3JSMB 4F4YA 4L76A 2OIHA 3ET6A 2DHSA 2I6WA 1D09B 3DKDA 1MMNA 3P4UB 1URRA 2CRLA 2A10A 4A8YA 1S7IA 1OMSA 5H9FJ 4WK3A 1YRUA 5KFLA 2KFZA 4QYRA 1FK9B 1W7WA 1IBMF 1B0TA 1H7XA 1T95A 3AH6A 4RNFA 4G1PA 4USUA 4B3TJ 2X1BA 3OTEA 4LR7A 4DF4A 5BR8F 2GVZB 4PRFA 4USWA 1F3VA 2VBXA 2GHWA 1JXEA 2AEMA 3K7RA 2MZSA 4DV1J 3LP0A 2MKJA 2RQ4A 2WOMA 2CQ4A 3LW5C 2NXEA 3THVA 1C1BA 1UWBA 1RZMA 1F2GA 3PKMA 2YKQA 1U48A 3I87A 5ETQA 4H54A 3DMJA 3UQSA 2D9OA 1MNEA 4DSJA 4OZLA 4LFAF 2BJ7A 4B9VA 4O3SA 2J0QD 3HKZD 3O2IA 2FJWA 3OL7A 2B5JA 3OTOF 2E9RX 1TK8A 1AXQA 2FZGB 1I5OB 1S7HA 4ZP6A 1RWOB 3MM9B 2X3DA 1WSRA 3CSKA 3F0NA 4NMLA 4RBUA 4A48A 5D6GA 1WKKA 1U1RA 2I9SA 3GR0A 5ADZA 1RT6B 1PYOB 1V9OA 4NPOA 1RT2B 1KOOA 3OUYA 4FF4A 2FJBB 1HHQA 2MQOA 1SL1A 2WCXA 2R8GA 5A2QY 1KHWA 3PYDA 1NXIA 3CD7A 1HQUB 2D9PA 3UE2A 3QRPA 1WSVA 5JVGQ 1RHQB 3LPYA 4FKXA 1GEHA 3GFZA 4I0WA 4EUVA 5L38A 5BYRA 3V4MA 2Z56B 5IM0A 1RBOB 3T19A 1HNIB 1XQIA 4R8UA 2V8DA 3N4WA 2DR5A 2DGVA 2LXUA 1UPMB 2VD3A 2E7XA 3Q8YA 2KM8C 2DNPA 3GV8B 2CQDA 2L41A 4DR2F 1WDDA 2KM8B 1NKBA 4F2SA 1D1UA 1QSSA 3A3PB 1AYEA 4CLUA 4OX6A 1YBTA 3T1YJ 4PXDA 4DL0C 3PX6A 3WX4A 3M6XA 1S6PB 4QR1A 3H2LA 2JDJA 2HS3A 4ZCKA 2RD5C 4DPOA 1N36J 5I3UB 2UXDF 1D9DA 5CAAA 4J9PA 2GO9A 4CYUA 4OHYA 3CDWA 3OV7A 2JHEA 4C3LA 3NMAA 1VMBA 5KFNA 3KMQA 2MTLA 1W2IA 5HATA 1RWKB 2NCKL 4DL7A 2BKOA 4WFZA 4YUDA 1CBKA 2OAUA 3PHEA 3ENAA 1ZPWX 4X66J 5DG7A 4DN0A 4F4WA 1T9TA 2GIFA 2GJFA 1GMUA 1SQEA 5HAOA 4ZP8A 4TXSA 5C42B 3JYTB 3AJ2A 1YJ7A 1JLGB 1UFWA 3LP1A 4LQ3A 1FE0A 2AYMA 4DUZF 2MSTA 2ADBA 4FPRA 3ZTPA 4HI2A 1DBDA 5BJRA 3HX9A 4OX8A 5L1KA 3FEXB 2BM1A 2D3UA 3IG1A 3CW2C 3PW2A 2K3IA 4NCGB 2ZH6A 2QO3A 1U1MA 3BR8A 3IM8A 1YBUA 1DHMA 3AA8A 5KFAA 3UCGA 1IKXA 1YJVA 4OZ5A 1PKUA 1IR2A 4RNNA 2MJUA 2KYXA 4DR1J 3UNYA 3ZFVA 2K1RB 2AWZA 1U47A 2R7VA 5AXKA 1KKHA 4XIUA 1VBKA 2QYGA 2QLFB 2PMHA 2CZVC 1FERA 4RU9A 4WZMA 4CI0B 4LF6J 1BHNA 4E98A 2XS7A 2MPUA 3THTA 2WW4A 4FXVA 1HWKA 3DI6B 3GYGA 3J81Y 4ES3A 4UUXA 4JV5F 1YQHA 3BKUA 3PJ9A 2EFNA 2M88A 2VJVA 4QYZK 2QTWA 1AUSL 5B0BA 3H2UB 3AXMA 3DCAA 1T9UA 4AD6A 1IVZA 1ELOA 4JUZA 3QGGA 2ZUGA 4B3MJ 4ID5A 3U27A 4F26A 4Y0FA 1RHJB 3H90A 3T5KA 4X65F 1HYSA 2W25A 3GJQB 2E7VA 1RADB 5C25A 1AZSA 3HI9A 1X4DA 4IG3A 3PXGa 3GV7B 1S1XA 3R6LB 1HHTP 2IBKA 4DG1A 1TP7A 1RAOA 3M8PB 3O5TB 2X1AA 3MOJB 2DNKA 2NXNA 3GQCA 5KFHA 2XY5A 2IVYA 4L3KA 1HBOA 3H2VE 3D1HA 5JVHQ 3MCSA 3GJRB 1F6TA 3PTWA 3R7SB 3J7YI 3MR5A 3BGLA 2V9KA 5ETKA 4KGMA 4IG0A 5F9NA 2V0NA 5AJ3F 1N56A 2KJVA 3ITHB 1VC5A 3PO5A 4WIIA 5D4LA 4XPEA 2MGZA 2W4CA 5C2GA 3MZIA 1PAEX 5H9FK 2CJ9A 3MR3A 1PYTA 2AZ1A 1CQNA 4EO8A 4DBQA 1H38A 1WF1A 1PAUB 2CQ0A 4L74A 4F25A 3MMCB 1PBUA 2AJ1A 3PW5A 2JRSA 2DGQA 5AE2A 1XN9A 1FJ7A 4RJVA 4ZN1A 4XDDA 3PZPA 1FF2A 4X4SA 3DRSB 3V81B 3B54A 3CTRA 2YKAA 1IBCB 2LXFA 1Z2ZA 3IXQA 1LWFB 1JLEB 3BSAA 2D41A 1QTMA 3AFGA 2CQIA 1C0TA 3D2WA 1RQ0A 1W25A 5EX3A 1JLBB 4I64A 3CCLS 5B09A 4K4WA 2IMWP 2RMLA 3R6GB 2IRUA 5KT2A 3DDNA 2RUGA 1RTHB 1RT1B 2OKQA 4J9SA 1WWHA 2FZCB 4M5KA 5CYMA 4DMZA 1SIWB 2B6AA 4ZPDA 1HWLA 5CA5A 4NEZA 3VVTA 2NPIA 1XC9A 4JI7J 3QO9B 5A2QU 1IWAA 2C42A 4NLOA 4DQPA 4XTTA 4ED4A 3KLHA 4CH1A 3GFYA 2P9EA 3M1VB 3MM8A 3CJ8A 5KFIA 5K14B 3WHIA 4RNMA 3V6DB 1NSAA 2B9YA 2W9AA 4TLQA 3DRRA 1U1LA 4ZP9A 3LTOA 3PYGA 5HMYA 2HHXA 2OPQB 3KHRA 3CJRA 5E7OB 1T9VA 1TK0A 2W8KA 5M2RA 2JSXA 3HCXA 3GG1A 1FA0A 4IFYA 5J2PA 3G8TA 3EZ5A 4TU9A 3DRPB 2EK6A 1SL2A 1U8SA 3PFEA 2VPXB 1RCXB 2Y1LB 3P3DA 3NNHA 5D0EA 2DGTA 1H7WA 4BC7A 1Y3KA 2IIHA 4C0BA 1S6OA 1VC6A 3L7OA 4N77A 1G2EA 5EUHA 1KLMB 4WK1A 1BD6A 3VZIA 4DPTA 4DU8A 3M32B 3VR1A 1DRZA 3A8IA 3DN9A 4J90A 2G9OA 3QFHA 2PA3A 4Q43A 2CQGA 1Z1ZA 4WFBQ 1QAIA 2IBOA 2QMUB 4OJ1A 4LF9F 1X8DA 4M1KA 3KLGA 5HMZA 2DHGA 4U8YA 3Q24A 2ZH4A 4RW4B 1FXDA 2OPSA 3W66A 4DDFA 2HAIA 3WC0A 2XM3A 2P9GA 2CPZA 1IBKF 2DH7A 1RWXB 2YNGA 1TVRA 2DYAA 2BKPA 4N41A 2J6TA 1S1UB 1UVNA 4PG6A 5HVGA 3FCWA 2HAFA 4C7QA 4ZVSB 4OYXA 2UUAF 2CJQA 1TKTB 1HFEL 4ERDA 4RO0A 2GAHC 4RL1A 3TEGA 1MSWD 2UU9F 2HLTA 1WI6A 3HHLD 1Q7YT 3H7HB 4OI1A 5CCMA 2J6SA 1LW2B 3C16B 3SQGA 1OSDA 2J0WA 1RT7A 1U8WA 3G6VA 2HHUA 3W60A 3V4IB 3GYNA 4ZN3A 1D9FA 3BBCA 2IDEA 3W9JA 4CT9A 3BB5A 3OQ2A 2EG2A 2C1EB 3IRXB 3KG0A 4MK9A 4H4KA 2AT1B 3CD0A 4ZP7A 4HACA 5HANA 2X3GA 3VAHA 3CPWR 5GAHI 1KFDA 2ZM6J 3DU6A 3BF4A 4AQYJ 1LK7A 4Y6IA 5FDLA 4NA2A 2DH8A 3ZZOA 2ZH1A 1BE4A 3W64A 2RHQB 3TAMA 2OLWA 3SYZA 1N6QA 4JI0F 5CD4H 1S1VA 3MEKA 2MLXA 4PEOA 1S9FA 3JSYA 2NSCA 3V6JA 2HK3A 2KN4A 5K20B 2LYVA 3VWSA 4WKYA 4C48A 3W7BA 4AL5A 4OYPA 2HFSA 3I0SB 3J81U 1Q79A 4USMA 1FESA 2VODA 2QT7A 2A3JA 3CJ0A 2RUSA 1UW4A 4ATNA 4EZ6A 3BH7B 2XMKA 2EFPA 2R8IA 4RU2A 1B0VA 1PO6A 1B0PA 1ZAXA 1EZZB 2N7YA 2VDIA 4M5GA 3RB0A 4M5DB 4K5SA 4LF4F 3CVKA 1DTTB 2IM1A 5AE1A 3T6JA 4AL7A 2BABA 3MEEA 2KFNA 1R8PA 4QU6A 2BEFA 1AA1B 5KFCA 4OZ3A 3VGSA 1S6UA 3C8YA 2AW0A 4R0EA 1CULB 4K4VA 4CTAB 3K8WA 3ISND 4NI2B 1XR6A 3LALA 3JQKA 2DY1A 2F9JA 2BANA 2VG6B 2DO4A 3D6HB 3HFVA 3THPA 4DCOB 2FIUA 1OYEA 4U7UK 1C0UA 4EK2A 4B9MA 1CJUA 5E0OA 5G4DA 3I9V9 5L1IA 1OIAA 4K50A 2IY5B 1RAHB 2VA2A 3IC1A 1YJ9S 2BQ3A 2VV5A 4ZJLA 5HBMA 1TV6A 3L3CA 3TVZA 1NM2A 1S1TB 3CE8A 1Y7PA 2VG5B 2VFSA 1QUPA 4C8YA 4OV1A 1VBYA 2ASJA 5GMDA 3ZZPA 4JI5J 3ET6B 4YDXA 8RUCA 3MCMA 2GS8A 2VFUA 3AJ1A 3TX0A 1ROFA 2QG9B 5FLXY 2EKNA 1ZM9A 5D77A 5L9XA 2IMOA 5DG8A 4QWAA 2UXBF 3ILOA 1QJHA 2FLLA 3TQ1A 3R9LA 2F8EX 1JXLA 2DVIA 1O6XA 3AD8C 1UCNA 2VL1A 2XS2A 5KFDA 5A76A 3I96A 3VAKA 1HBMA 5KFUA 1YJUA 2YWKA 3RTVA 1EIYB 4G1QA 2QA4G 4P72A 3LP0B 3V6HA 2V67A 1F2HA 2WOMB 1C1BB 4J9RA 4Y34A 1R0AA 4QR2A 4O0IA 4PZVA 4JI8J 3I55S 3G8QA 4FBUA 5A8WA 3EE3A 4C8LA 3DMJB 3HHEA 3K5PA 4QIFA 4KHPJ 1NJYA 1UKUA 2M4MA 2I0XA 3H42A 1WACA 1M1HA 1T02A 2LDYA 4ED0A 1NRKA 1CJVA 2B5JB 2HHHJ 1WEYA 4U6PA 4ECQA 4OZ2A 1KVIA 4UQTA 5I4MA 2E5LJ 3E8OA 1LW0A 1NSQA 1FFWB 1NPKA 1RWUA 2CPJA 5C7PA 2HSEB 3LWLA 4DSEA 5HROA 2EFQA 3T5LA 2HIYA 4E0DA 4I6AA 2N3LA 2NZ4A 1QAXA 1E6YA 2I2YA 2HMIB 1N32F 4O44A 3OUYB 4G6VB 1WOSA 5D4PA 3OXLA 3MEDA 4WXOA 3FCHA 1WKJA 4KR0B 2OHDA 4OFZA 4JV0A 4UOHA 1CJTA 3O1LA 2XYGB 4ZK7M 3N6LA 4KH0B 4R0JA 1Q7LB 4CP5A 2C22A 4LF5J 3M2UA 3UD5A 5IM0B 1CSJA 3GONA 2F9DA 2CPEA 4R8UB 4DV5F 1Q8KA 4EBDA 1HARA 3GR1A 1DAXA 2XTJP 4EMDA 2HZAA 1K1QA 3P8BB 3WDOA 1JMTA 2C2DA 2OMLA 2E7WA 2BW7A 1KDNA 2XMTA 2XWXA 2YNHB 3PX4A 3S01A 3EGZA 3VTIA 4PCQA 3ZTQA 2W7OA 2J9DA 7FD1A 1Y5NB 2LA6A 3M30B 2V69A 4J7CA 3KG1A 1NPPA 4IKAA 1NO8A 3M8YA 3HT0A 1UEKA 2GV1A 3BPSP 2YNIA 4CYUB 4TU8A 2C3PA 5U47A 3DLGB 5DS7A 1KN6A 2KRBA 2YVSA 3RJMB 3NNCA 4LSLA 3R2CJ 2ZKTA 2Y9HA 4BLGA 2GX8A 1WI8A 5DZ7A 1HNXF 4HYKA 3EZUA 3TVYA 3C66A 3UD3P 1F5BA 1RTZA 1WG4A 1IBLF 4B9SA 1FT8A 4Y2CA 1HNVA 2J8SA 3KJNB 4X4QA 1BWVA 4NLTA 3AOCA 1CVJA 3DM2A 5A8RA 2EEYA 3LP1B 2HNDB 5HVHA 2BOAA 5DDQC 4NXNJ 3ELHA 1F9FA 4DOZA 5CCLA 1IN0A 4NLUA 4AXJA 2CDQA 2OFGX 3FSYA 1FWPA 3D9BA 4BHQA 3MHYA 1FHTA 3KNAA 4K0KF 2ZDPA 2MXYA 4HT7A 3IG1B 2ZVSA 2DHHA 5L46A 1RABB 1VCTA 1VQ9S 4B3RJ 1MN7A 1NJZA 3IAS9 3JQMA 3D66A 5CZVA 2QSFA 2IDLA 1X60A 4OZNA 1D8YA 4GRSA 4WFNQ 3CEDA 2DRAA 4OYMA 4F7VA 1TL7A 3EUNA 4FYXB 4ZVFA 4B9NA 2WBRA 3Q8PB 3SV4A 2R7WA 3RB3A 2PIIA 2GAGC 1PC5A 4M8LA 6FD1A 3CT9A 2R8KA 2CA9A 2LQBA 4CNYA 2JC0A 1U2FA 4ECRA 1EX8A 4C97A 2B51A 2BJ9A 1NK5A 1IQZA 5A0YA 1RU1A 3B8HA 2KO1A 2WONB 3DLJA 3OW2R 5IT4A 2UXCF 2BJ8A 3CJ3A 3FKBA 1WHVA 4KIAA 2VC0A 3RAMA 2XMVA 1LEOA 3ZTRA 3IM9A 4W98A 1SKUB 1IR0A 4ID5B 4DR6J 3VHQA 2F4VF 1VQMS 4PXBA 2CJBA 4HL9A 1YWXA 2HVHA 5C25B 1AZSB 3ULHA 4AT1B 2JWNA 1S4FA 5F3ZA 2OH2A 3K89A 1S1XB 4F0MA 5J2MA 5J1PA 4DG1B 1I94J 1LWCA 2D3OR 2I5JA 1B99A 2DEIA 3QBCA 3QIPA 1VIOA 2RRAA 3W2VA 4BC9A 1KVJA 4IQXA 4J9MA 2DCUB 3OR1A 2YQ3A 4DZ6A 4M5MA 3N6MA 4LRDA 1HBOB 1M1GA 3KLVA 1M5VC 5FLXU 2ZHAA 3KLIA 4P2SA 3UN5A 1S5ZA 4ZLJA 4O3RA 2MZJA 3IS9A 2GCFA 3CCRS 4DPXA 3GIKA 4RBTA 2QFJA 3HP6A 4Z2XA 2ZH5A 1XNRJ 2DT9A 3TZZA 3VCDA 4LIRA 2DIVA 1SBRA 2XLIA 2MGZB 3MEGA 2H4YB 2XEXA 1X5SA 1WD6A 4NZ0A 1BWEA 4LF2A 3HHLA 4J9UE 3I5CA 1AB8A 2BDPA 5KFQA 3IGVA 1VRTA 5CYQA 4USJC 2CJYB 3KMSA 2BQRA 1Y00A 2EFOA 1JWWA 2R8HA 4QPXA 2OP5A 2DTJA 1TUGB 2WW8A 3G2XA 4LFCF 1XMQJ 2CJKA 2M52A 4ZHRA 1U1PA 5C2CA 4JYAJ 3PW7A 3RU0A 3KUHA 4KT0C 2FUG9 3CDBA 3TAPA 3NG8A 3N5BA 3EYZA 4H4MA 2FLNA 2R7UA 3QT6A 2AMCB 4LBHA 2MKIA 2QZ8A 2O01C 1S0NA 2CQ1A 4LVOP 2RU3A 2QEXS 1C0TB 1Z4UA 4KO0B 5LT5A 3BO3A 2MKHA 2KG1A 5AXLA 4QIEA 3WX8A 4F36A 3HKWA 1VRUA 2RIJA 2I1RA 3KDNA 3A3NB 3TUIC 5CYMB 4DV2J 4IOAQ 2D69A 1UEUA 5F0UA 2RS8A 3KHGA 1SPBP 4GKJJ 4N47A 4F2RA 2E9TA 2J5AA 1S1WA 3PJWA 3CIMA 2XI2A 3KLHB 1IXKA 1NNDA 1BMQB 2D1CA 2LEBA 4DV0J 4NLXA 2EWHA 1N88A 1XIQA 2RSQA 3MM8B 3GV5B 3I9ZA 5K8NA 3M05A 2XMMA 3ZTSA 4CDIA 4EBEA 3DRRB 2FHOB 1M5HA 3RBXA 3OVSA 1FNOA 3GTYX 4J9LA 2WHOA 1TZ0A 1WG1A 2XZWA 1VFJA 3D0GE 2MY8A 1U45A 1I6JA 2XGQA 4IFYB 4A8OA 5J2PB 1OQ3A 4DR7J 3EWGA 1WOOA 2YKNA 3PFOA 3OFGA 3N79A 1ZTTA 3MM5A 5F8MA 2NYHA 3D6FB 1FKAF 2CAJA 3MAAA 2L9WA 2LDIA 3CWJA 2XHCA 3A13A 1XMBA 1WUUA 1WTFA 3OJSA 3WZ0A 1U49A 5DQHA 5K5MA 4F4AA 2B9EA 4X2BA 2F4FA 3OFFA 4OYIA 5D4OA 4N8OA 2B8PA 2KT2A 4N76A 1FDAA 1VQSA 1RWPB 3OLBA 3EDQB 2YWGA 2VBWA 1N34F 3KLGB 2IPOB 2H54B 1I1GA 4ZJQA 4WFAQ 2VF3A 2OPSB 3MURP 3KNGA 3V5RA 1S6QA 2OEKA 2YWEA 1SXLA 3CCQS 4MAKA 4MIWA 4MYTA 5I3QA 4DQQA 1U02A 5D4NA 1UTAA 2V9WA 5D0RA 1TVRB 1OSCA 1ZPVA 4F3QA 2QC3A 3TI0A 3KUGA 4IH6A 1AROP 2V6AA 4LR9A 3CMAS 4J9VA 4KV8B 3EGNA 5KAKA 5FD1A 1YK9A 3GSIA 2XYHB 4HI1A 3D6TB 3L7PA 4DV4F 3KUEA 1JLFA 1FVSA 2A1BA 4ILMA 4DV7J 5KFTA 4KGXB 3SQGB 4EO6A 1U26A 3HDSA 2FHJA 4DL4A 2KXHA 1RT7B 1WC5A 3H5YA 4OL8A 4P71A 1YI2S 5E33A 3EGVA 4CLPA 4RUCA 2R3VA 3NLCA 3AB2B 1TL3A 4HR2A 1HQEA 4HACB 4OMFG 5D8HB 1IKWA 3JTPA 2UUTA 2ZUAA 3W9IA 3FVYA 2RKIA 4FPIA 3CCWA 3DLHA 5GADI 5FDLB 3CO0P 2NUUG 4P9SA 5B0AA 3L4BC 1HI1A 2DPIA 3M6VA 2YKMA 3TAMB 1KFSA 1K0TA 2V2ZA 3SEOA 2ERRA 3CB4A 1F9EB 2WTFA 1V3RA 1N6QB 4TY9A 3GG0A 4MJKA 3D4JA 2C3YA 3QWPA 1WOPA 3HVAA 5I3PA 1HBUA 2IM3A 4YDDB 2HFVA 2JFDA 3NGDA 3H5SA 2KG0A 3K8VA 3M8QA 2ACYA 4I56A 2DNHA 2G1DA 4B3TF 4URSA 3C6UA 3SSRA 4YR2A 4L3NA 3DNCA 1RLDA 1I3OB 2FB0A 3PRBA 2VC1A 4WP3A 1WDTA 3MEEB 3TWZA 5K8PA 2DITA 5EHHA 2WSCC 4DV1F 2GVDB 3QAEA 4JI3J 5HMWA 4WYWA 2JFKA 1D0EA 3CUNA 4MIBA 4K4TA 4HHHA 1GNKA 2OTLS 4RUHA 5CZXA 2MKSA 5IC4B 2B0GA 2VQEJ 3CMQA 3HSDA 1JX4A 2G2ZA 3QT7A 1F5CA 5DLFA 1RWVB 1TU0B 5KG4A 4H4OA 3EGWB 1JLQA 4A47A 2BKNA 3K17A 3UDLA 5HBMB 1TV6B 2NXJA 4B02A 3MM7A 1FRKA 3I56S 2R7OA 1XNQJ 3NEKA 3MCOA 1RI7A 5IV4A 3CDAA 2VFVA 2AGQA 1O8BA 2OPRA 1GMWD 1QSYA 2HYIB 1AUDA 4CO0A 3N5FA 5T7LB 2V5HG 1U0HB 4M5JA 1M5KC 5IS2A 2ZE2A 2B9WA 4RZRA 5HMXA 2Y0SD 3PR4A 2J7KA 1FXLA 2OPPA 1DARA 3EICA 4N56A 1NJIT 1Q8BA 1UA1A 2DRBA 1TKZA 4F4KA 3M8RA 2E1AA 1P6TA 2ALYB 3QRQA 4TLRA 3BSNA 5C24B 3SZ2A 1UL3A 4LJMA 2LQ8A 2AF6A 1VQKS 2CG4A 2ZHBA 3A3OB 4N7TA 3DC2A 4Z37A 1HBMB 2XBPA 4G1QB 5LXYA 3NBPB 4IRCA 1RHUB 3MM6A 1XMOJ 2DHAA 2G4BA 3HVWA 1UVLA 3IA0A 5HSPA 4YHHJ 4MT1A 1E6VA 3BH6B 1HNWJ 1SIZA 1NPRA 3X1LB 4WP9A 2V2QA 5A8WB 4DL2A 1TQLA 1MN9A 1H6KX 2VJUA 8ATCB 1NJXA 1SQGA 2OEMA 4DU7A 4K7QA 4OLPA 2F40A 3ZO7A 1JJ4A 5KFVA 1U1OA 1UZHA 2DGUA 1EQMA 1XR5A 2M0GB 4F0HA 3T1YF 1CJVB 2A2DA 2XZTB 4PQAA 2OTJS 2DB1A 2VASA 3JSBA 5KFWA 1RCOB 4Y2IA 3NOCA 2WVEA 3U1MA 1N36F 4P7TA 3HZGA 3CDEA 5D0GA 4FXWA 5HROB 1BQXA 2YWWA 1HNZF 2HS0A 1E6YB 2HFZA 2FVQA 2DR6A 3CCMS 3ILJA 1RT3A 2GA7A 2WK4A 3R5JB 2EBGA 4FF1A 4DS4A 2AIRB 1T94A 3WBZA 1MWYA 2MQ8A 1WELA 2L3MA 3I4HX 3FJ2A 7AT1B 1S77D 4X66F 4F02A 5BYSA 5KT6A 2MSSA 3TP2A 2H4WB 4LUBA 3OHAA 4D3HA 2XSFA 2E1CA 4I2PA 2XY6A 4K5RA 3OFEA 3HVRA 1RGVA 3M2UB 5DDPC 3U7JA 1T05A 2PI5A 4DCJB 1KQFB 2R42A 2PGCA 1HI0P 2ATCB 2LMIA 1Z2LA 4QWDA 3HZEA 2VFRA 2U2FA 2W2MP 3ZXWA 1REVA 2FJDB 1F0XA 4C6AA 2PEBA 2N3OA 2VG7A 4MKYA 3MMAA 2IAJA 3W3SA 2GFFA 3M8SA 2UV8A 1FDNA 3QRRA 1PILA 4QR0A 1SB6A 2PFDA 4DI6A 4DR1F 1TL1A 3UN2A 8AT1B 4OYOA 1OY6A 3OL6A 3AXKA 3ZZ0A 2JC1A 2MKKA 2YNIB 1N5TA 1UAWA 3G8SA 2PI4A 4LSLB 2YKPA 4PYDA 4YB1P 1JJCB 3UVJA 2EKYA 2R7QA 4LFBJ 4ETZA 3PW4A 2XQCA 2MQQA 5IT9Y 1H72C 1ZS6A 1KC8T 3QGPA 3C6TA 2KYZA 1HNVB 4YB5A 1C4CA 1VQ7S 2O5DA 1NHUA 3TX8A 5KG2A 2DXEA 3TYTA 5KFFA 2BACA 3DM2B 5A8RB 4I7FA 2J76E 2HGNA 4AUKA 1HD1A 3MECA 2XCAA 4LBIA 4B3MF 1KEKA 4K8RA 3ONQA 2PN6A 2LFVA 1RB0A 2WB4A 2HEKA 3BM7A 1T11A 2XCPA 2U1AA 1OY9A 3L95X 4AXIA 1EHWA 4ER8A 3BDPA 3VV2B 2FJEB 1BUXA 3US5A 4P2XA 4XK8C 1WF0A 4Y3CA 5GAHU 3I82A 1JIHA 2YY3A 4F50A 1PIEA 1YKWA 2OSRA 4KGKA 3CC2S 2RS2A 3G96A 2ZVIA 4DR5J 3GMGA 4WPAA 4F0KA 2P9CA 2FD2A 4WU2A 3KK3A 1UZDA 4N5SA 1DY3A 2IA0A 2BBEA 3J7ZT 1CLFA 5JMNA 4UZBA 4RW9A 2LECA 5KOXA 5KFEA 1WF2A 3P49B 1VQPS 1K44A 4HLBA 4JP8A 3TW0A 5A0YB 2HK2A 4Y00A 1RTDA 4YFUA 3E51A 1RKJA 5B08A 2MHNA 4Y2MA 4CCHA 2HKEA 4EWTA 1DQ8A 3EJMA 3H59A 1Y4ZB 3BGRA 4UUWA 4DFJA 1BXNA 4NZ6A 4M94A 1OWXA 5HQ8A 2I38A 1WC4A 4OHVA 5C5JA 2R8JA 4NLPA 2J9CA 2ZH9A 3OLAA 2Y1JA 4M63A 3AODA 3VQTA 1Y10A 4ED5A 1NMEB 5J2MB 2BM0A 3UCUP 5E2QA 1MROA 2JLFA 1RAIB 1AW0A 1U1KA 1LWCB 3JSMA 2I5JB 3QNWB 4DV3J 3KJFB 4M5NA 2Y1RI 3LF0A 3CJQA 2H5JB 3W2VB 3BBBA 1FJEB 1N0VC 3PNIA 4I67A 4J91A 4DQSA 3OR1B 4XPCA 3DFEA 1TMMA 4L75A 2QFIA 3C15A 3P6YC 3DOKA 3BQ0A 1IM4A 1B70B 5KG6A 3DXBA 1DLOA 3AD7C 1XTZA 1YRXA 3BGOP 2PMZD 3UCZP 4RW6A 3KLIB 1U25A 4CIOA 4P74A 3BSOA 2HRTA 3G6XA 3SV3A 2IVFB 3MR7A 3PIPQ 4JI7F 4PG7A 1NHKL 5A8KA 1JLAA 4JI6J 1LQ9A 1P9YA 1QLNA 3POTA 4BWMA 1W26A 2HNYA 4ENOA 1SH3A 2MMYA 4NOHA 4U7CA 3P96A 3MEGB 2DRDA 5CXTA 3RRGA 2DPJA 2LXIA 2MQNA 2XG8A 2XI3A 3TUPA 3HMJG 1VRTB 5CYQB 1F1BB 5JXSA 2YX1A 4ECVA 4FYDA 1RLCL 2HGMA 4QW9A 4ZCMA 1KVKA 2FLOA 2XNQA 5J2NA 4MK7A 2G2OA 4ILRA 1XWLA 1NHVA 4ZHRB 3C2PA 2ZBQA 1FFSB 3C19A 6FDRA 1SH2A 1HMVA 2E29A 2RDDA 5EWFA 2M8DB 1YZ7A 3NOGA 1RT5A 3N9UC 4TVAB 2DR9A 1Q53A 1NK9A 3SMZA 3FRYA 3KTQA 1WG5A 4YR0A 4H4MB 4B08A 4WTYA 2GHPA 2QLJB 3MMJA 4GC6A 4CH0S 5HQLA 1P9QC 3T6BA 1GT8A 1SUQA 4HKQA 3MUTP 3G86A 3MTKA 1QM9A 1SKRA 1VRUB 1ACMB 1H0HB 1R43A 2DD8S 1MU2A 3HHDA 3CNQP 1C1CA 4E8UA 5HLFA 1UVKA 1SJ3P 1V6HA 4LR8A 3MPUB 4RNHA 2B43A 3BPDA 1ZH5A 2FC9A 4ELVA 3TA2A 5E3QA 4P10A 1S1WB 2WVCA 4DPUA 1PCAA 4R25A 1B7FA 3RRKA 4B9UA 2LEAA 1NK0A 2KDOA 3VAJA 4KH1B 4CLFA 2YNFB 3G6YA 4XAKA 4NCAA 2HIQA 1S99A 4CO1A 3H0PA 4ZOSA 4A8XA 3WIVA 2Y8WA 4DF8A 1YBAA 1U09A 1KOHA 3T5JA 4FNHA 2D7SA 3P5TL 4LRAA 1T03A 1GMVA 1X4AA 4IH5A 5L9NA 1HQ2A 3CCSS 2CPHA 4YB7A 1S9EA 3MM5B 3IN5A 2H3EB 1S6PA 2G1HA 3MAAB 3KK2A 2ZKUA 5HK4A 2RVJA 3IWLA 1M5OC 4NE9C 2XULA 3D6MB 1GMWA 2ZM6F 4OHXA 2NR0A 4AQYF 2BJDA 4IDKA 2KT5A 1RTJA 4DJBA 4YR3A 3RGIA 3PX0A 2JNJA 3DLLQ 3Q8SB 1Y5IB 3NAHA 2VONA 2BR0A 4PR6A 5KFSA 1YHQS 1S6QB 5ETTA 2YWFA 2CDRB 5IT9U 1YJWS 3KHHA 3IBWA 3RG6A 2WVFA 1PJ5A 4WP8A 2ZHOA 3SCLE 1P1TA 1PJ7A 3UDEA 2FYXA 4OQJA 3JYTA 2HWHA 4ZLNA 3TNVA 1LXNA 2HWIA 3GFXA 1LV5A 4DL5A 3N28A 3HSZA 4RBVA 4O4RA 3RUBL 1KQGB 1BQNA 5HO4A 3HVTB 4ZLLA 2C2NA 2K7KA 3IGNA 2CPFA 2XGPA 2XMJA 4DR3J 4WF9Q 2DEJA 2XWYA 3ILIA 1RHRB 2B7CB 1SJQA 5L1LA 1GXTA 3RRHA 2RNEA 2W2NP 4NRTA 2LKZA 1NB7A 4KBIA 4ZVOB 5DM7Q 4EGLA 1TL3B 2DCLA 2YXLA 1HQEB 1N5YB 4URQU 1IKWB 2RKIB 2HHPA 1T8EA 4M5LA 2HNZA 4FYVB 2UUBJ 4O4GA 4ED3A 3NGUA 3GIIA 4QWEA 1WKLA 2YQ1A 1J27A 3MUMP 1FDDA 2YKMB 3G82A 3DLBA 5GAGU 4JI5F 5KG0A 1PJ6A 2G0CA 5E41A 4LF1A 5IQQA 1UVJA 1RJJA 1NEEA 1YRTA 3J7Z5 2VQFJ 4YQWA 4ILLA 3OXGA 1HPZB 2AX0A 2OSQA 2ZWOA 2F65A 4YN3B 1EQ0A 1JNRB 1RHMB 4V19X 2CJXB 1FRMA 2W01A 3M8QB 3G9CA 4L73A 4Y28C 2H51B 4HH1A 2JVRA 2XZDB 2FHKA 3C6UB 3ZC4A 2PA8D 3A8EA 2UV8G 2Z2LA 1X9SA 1X0PA 4YB6A 1FWLA 1Q8IA 5T41A 3FBEA 4IO1A 4RW8B 1SC1B 2HURA 4DZDA 4RKUC 2HRYA 4ANEA 1NU4A 5EDWA 1TFYA 4JI8F 3RW6A 4P7VA 4O3QA 1J5OA 2ILZA 2W7AA 4C11A 4KHPF 3I0RA 1NH8A 5AT1B 4F67A 3VAFA 2W9CA 4H4OB 1Q0NA 4QJVA 4KRWA 3S7RA 4BWJA 3W5ZA 1NK7A 2ROGA 1K8AT 2BQUA 2HHHF 2Y8YA 2XNRA 4USTA 2D3ZA 3UWTA 3Q22A 4Q0BB 3R5BA 2OPRB 4GKKJ 1X4CA 3UO0A 2G0IA 1BGXT 4TYAA 2E5GA 1MMLA 3D0IE 4CLSA 3E2EA 2AV5A 2XB2D 3BREA 4ELUA 1OPZA 5IFMA 1EARA 1SQFA 1FRJA 4OI6A 2HQIA 1KNZA 1UW9A 3LQVA 3CJKA 3VALA 2R7RA 3Q0AA 3D7SB 1YLXA 5KT5A 4Q2MA 2POKA 2FJAB 1IJFB 1SKSA 2Z30B 2V68A 1TKZB 3MWBA 2ZZNA 4WKRA 4OYAA 4DLEA 4CWBA 1VK3A 2HQGA 3AAWB 1QUVA 2RQCA 4DSKA 1FKPB 2KFYA 2BA9A 2ZNYA 3GPAA 4QIWD 3KDOA 1R8AA 1S9GA 3SI8A 1KRPA 3MM6B 5KG1A 2R2UA 1FVQA 4MTPA 4Y2AA 1LFPA 1JLBA 1E6VB 5EWGA 1V3ZA 2MY7A 2CIMA 1RTHA 4KY3A 2VH7A 4OHZA 1T9YA 4EBCA 3GJSB 1RAFB 2QJ3A 2C3MA 4K2JA 1GXUA 3M2VA 4ZVUB 4KPYA 5E3CA 1NUEA 2W7PA 2P6TA 1UEVA 2EFVA 1GTEA 1IM6A 4NLSA 2ZBIA 3WQPA 3R8YA 3QGHA 2CPXA 1YDLA 1HR0J 3M9OB 4HTIA 3FUYA 1HKAA 1NDLA 2LCWA 2DJWA 4PXEA 3R27A 5HJYA 2XY7A 2CQPA 5F8LA 2E1PA 3DXSX 1VQ5S 3M1VA 3R3TA 2LA4A 4ZVQB 1OYDA 3FMWA 4B3SJ 5K14A 4KGZB 2KKHA 4X64J 4HH0A 3D28A 3ENWA 2HQFA 2LVWA 4NYPA 2QL7B 2ZWPA 1RT3B 2B9XA 4PG8A 5DQIA 4FP9A 4IFVA 9ATCB 1FXRA 3OVAA 4JV1A 1YGYA 4OHWA 2RDIA 3PVXA 4LFCJ 3EPGA 4KYZA 1R7IA 2FJXA 3UDVA 1RYRA 3LAMA 1GX5A 2E66A 3Q89A 2WSFC 3DU5A 2LU2A 1FO1A 4G3IA 1NBEB 2AEJA 5LJ3Y 1SC3B 4U7UD 1W2BR 1SH0A 4DEZA 4LSNA 3MDFA 2ACMA 4DR4J 3FCVA 4OV6A 3U1LA 4I2PB 3Q2TC 4OI2A 5LSLA 3PJXA 1S0OA 1KLMA 1R8HA 1T05B 2BE2A 4NYZA 3U1NA 3MXHP 2CZ4A 4NXNF 3PW0A 1LFWA 4PWDA 1RISA 2BJEA 3UI3A 2BZ2A 3EVMA 2XHWA 2CQ3A 2FTRA 4TN2A 5D3GA 1VRQC 2XMUA 1REVB 2Z0GA 2BJ1A 1S97A 1UJ5A 3OTBA 4B3RF 3RR7A 4RWWA 1M5PC 1Q5YA 2UUCJ 2ZH7A 2IAJB 4ITSA 1H73A 4BS2A 1TL5A 3PDNA 3D5MA 5LSOA 5E3PA 3AJDA 3OL9A 1FX2A 3FC9A 1KHVA 1FE4A 3HD1A 4I6YA 1GFWB 2IYGA 2FVCA 4DPWA 1GTHA 2WZ1A 4JBCA 3PYEA 5KG3A 3IMQJ 1X5OA 3UVJB 4MK8A 3A12A 4NLRA 1RAEB 3Q8RB 1XERA 1LW2A 2MQPA 2J9EA 2VPYB 3C6TB 2DXDA 3Q86A 2RF2A 4C0HA 3M8ZA 1VK8A 1RHKB 2L48A 3CD6S 1SCJB 2YPYA 4I7FB 2QX0A 2E5IA 2PSZA 2APOA 4USKA 3IWNC 4DR6F 3M2RB 2IYIA 4O0NA 2H5IB 3C46A 1VOMA 2X7IA 1AFIA 2ZOMA 2HBYB 4QW8A 4JI1J 1FNMA 1I94F 4QZVB 3IP0A 2Q6CA 4ECZA 4F3MA 3SBMA 2ZDOA 1KP6A 4KKOA 3LGHA 1N34J 2OJ3A 2E5HA 4TNOA 2HQ3A 1XR7A 3O3LA 4HTJA 3QT5A 3VVUA 2V34A 4IRDA 4ES2A 1HLWA 2ZOGA 3LP2B 2ZITA 5DLGA 1WORA 2XO7A 4PQUA 2HPUA 4G65A 3SCIE 3K5MA 2AJQA 2RH3A 2MZTA 1MLAA 3KK3B 4DFPA 4FYWB 1VQOS 1KR4A 4J9KA 3CCUS 3QJLA 2Z57B 1XNRF 1N52B 1DTTA 5DRKA 1X5TA 1EAYC 2GMHA 3BQ1A 4P2MA 4ZCLA 2ABYA 5F8GA 3SSSA 3DDIA 1FFGB 3DLEA 3D3CJ 3NNAA 2RE1A 2PC6A 1IR1A 3OFHA 3MTJA 3SQOP 4HHUA 2YTCA 1R0BG 1Y5LB 4LRFA 3TUJC 4FKYA 4LVNP 4ECXA 3PG9A 1RTDB 3EDRB 3H20A 2E1RA 4NYOA 2V4RA 4DSLA 5KOWA 1R8CA 1XMQF 1HBNB 3K0JA 2EG1A 4CLWA 3BGRB 4LQ9A 2CFXA 4JYAF 5EN1A 3MCNA 5KFYA 3OJUA 2GIRA 1CS4A 4CLZA 2NXCA 4DV6J 2LQ9A 1VQ6S 3I4PA 2M8HA 3RB6A 3FDSA 5LMNJ 4V19J 2VG5A 2BX6A 1MROB 5L1JA 4KFBA 4FN5A 3KYLA 1X4HA 1FJGJ 4Y65A 1SC4B 3CDUA 2QLWA 3KKFA 2B3TB 5F8NA 5F8JA 1IQTA 2Z2MA 3C15B 2FVRA 4DFMA 3DOKB 1SKWA 1BY9A 1DLOB 2BMBA 3NRBA 4DV2F 3FQLA 4X4RA 4RW6B 1RDRA 4E2FB 1CPZA 1BLUA 4GKJF 3NAIA 3PIOQ 2VPZB 3NL0A 5A8KB 1JLAB
chains in the Genus database with same CATH topology
2OPPA 2X1GA 3MR6A 3PO4A 4B3SF 1S48A 4NX9A 1XBWA 1DARA 2V8GA 3MZIA 1S72S 2JEIA 3POTB 4N56A 1NJIT 1Q8BA 4X64F 1UA1A 2DRBA 4X4NA 2HNYB 1TKZA 2CJ9A 3MR3A 4F4KA 3M8RA 3KG4A 2E1AA 4A8KA 4DV0F 3OBIA 1P6TA 1CQNA 3CJ2A 1HHSA 3HHLC 4P6QA 4TLRA 4O23A 4EO8A 3BSNA 4DBQA 1H38A 4WE1A 1WF1A 5C24B 3SZ2A 1UL3A 5D78A 4LJMA 2NS1B 2AF6A 3LH2S 3MPVA 4UY8T 2ASLA 3HHLB 4PUOB 4L72B 2CQ0A 1VQKS 5M2UA 4F25A 3MMCB 5J1EA 2CG4A 2AJ1A 2ZHBA 1QSLA 3M6WA 4NLVA 2ZFHA 3DC2A 3PW5A 2HHWA 1FTRA 3F56A 4Z37A 4JOUA 4ZVEA 1HBMB 2JRSA 4RUAA 1G1XA 2DGQA 2AU0A 4Q8FA 5AE2A 3RAXA 2XBPA 4G1QB 5LXYA 4MH8A 3NBPB 1XN9A 1FJ7A 1IKVB 3DLKA 4IRCA 3H5XA 3MM6A 5J2NB 4ED8A 4XDDA 3HXMA 3MOZA 3PZPA 1FF2A 4X4SA 3DRSB 2DHAA 2G4BA 4W90B 3V81B 4I2QA 3HVWA 2PFFB 3CTRA 4DR4F 1UWBB 2YKAA 3R1LA 2LXFA 1UVLA 2BRKA 3IA0A 1E6VA 1Z2ZA 4FVMA 1CC8A 3IXQA 1HMVB 1LWFB 2OD6A 1SIZA 1JLEB 3BN7A 3BSAA 4DR7F 2D41A 3LUYA 3X1LB 2DHXA 5HL7Q 3NKYA 1RT5B 5A8WB 4DL2A 1QTMA 1TQLA 3CCES 1ZBTA 2CQIA 4NRUA 2PD1A 1H6KX 4USIA 2EVZA 1NK6A 1C0TA 3D2WA 1NJXA 1RQ0A 3M9MB 1W25A 5EX3A 1JLBB 4OLPA 4I64A 2IM0A 2F40A 2OFHX 3PEJA 3CCLS 1X9MA 5B09A 2AQ4A 4K4WA 2IMWP 2RMLA 3PRDA 2R9LA 1JJ4A 4NLYA 2ZD1A 5KFVA 1RTIB 3MM9A 1U1OA 4BDPA 2DGUA 2Q1LA 3W2WB 2IRUA 3IO1A 1XR5A 3CCVS 1ZZNA 2M0GB 4C98A 3DDNA 3O44A 5KT2A 1R27B 3T1YF 3NCPA 4GO5X 2RUGA 1RTHB 2A2DA 1RT1B 2GGPB 4OX7A 2OKQA 4J9SA 4Q5VA 1WWHA 4PQAA 2OTJS 3DGPA 2DB1A 4I4BA 2VASA 1ZTWA 5CYMA 4DMZA 2JLGA 3JSBA 1S49A 3C3LA 1SIWB 2M3DA 3ETOA 1PC4A 5KFWA 1SUQB 2B6AA 4Y2IA 5E3RA 4ZPDA 4DHVA 2HMIA 1HWLA 3U1MA 1RT6A 3FFIB 1N36F 2UUCF 4P7TA 4ID8A 5CA5A 1RT2A 4ZS6A 3HZGA 4FS2A 3CDEA 4WCEQ 4ZPVR 2JZ5A 2NPIA 1XC9A 4FXWA 3QO9B 5HROB 3NS5A 1X5PA 1BQXA 3KJVB 1MU2B 3CMES 1HNZF 2HS0A 2AJ0A 2QA4S 4U67Q 2C42A 3JTNA 1C1CB 5HLFB 4NLOA 1E6YB 2HFZA 2ROEA 4DQPA 3DDKA 2FVQA 3NMRA 2YH1A 2DGWA 3KLHA 3UW1A 3X3UA 5F41A 2UVWA 1BQMA 4CH1A 3IR6B 3GFYA 3CCMS 3DRYA 3MD1A 2P9EA 5E3AA 1RT3A 4A46A 2K8GA 1HQUA 5J2QA 1HWUA 3M1VB 2GA7A 2YNFA 3MM8A 5GVQA 3AA9A 2WK4A 2ZNZA 5KFIA 2EBGA 5K14B 4FF1A 4RNMA 3V6DB 1P1LA 4DS4A 1T94A 2B9YA 3PM9A 5LL6d 2W9AA 4TLQA 3WBZA 3NS6A 1MWYA 1WELA 2L3MA 3DRRA 4TKTA 1U1LA 3I4HX 4ZP9A 2VUGA 5AE3A 2MZRA 1WEZA 3FJ2A 1VQ8S 2KH9A 3QMQA 1S77D 1NK4A 5MLCV 2VBYA 4DL3A 1EP4A 2IVMA 3TOQA 4X66F 4F02A 5HMYA 1KONA 4UOCA 2HHXA 2OPQB 3BDEA 5BYSA 3KHRA 5KT6A 1U6ZA 3MR2A 5E7OB 2HZCA 2MSSA 1HNIA 3ISNC 2JEGA 3TP2A 3J80Y 1TK0A 2W8KA 4LUBA 3OHAA 1DQ9A 5M2RA 2JSXA 1U1QA 5E5NA 3GG1A 3LOUA 1FA0A 3QLHB 4IFYA 3N6NA 4D3HA 4C4WA 2XSFA 2E1CA 4I2PA 2XY6A 5J2PA 3G8TA 4K5RA 4NCBA 3OFEA 3HVRA 3EZ5A 1GX6A 1UA0A 2VKZG 1RGVA 3M2UB 4TU9A 3DRPB 3R5AA 5HI7A 5BYQA 2EK6A 3U7JA 5DDPC 2B4UA 1SL2A 1T05A 1U8SA 3S6EA 4DV7F 1FEEA 2PI5A 1V3SA 3PFEA 2VPXB 5L39A 2GW8A 3P3DA 1T03B 3NNHA 4B17A 2DGTA 1H7WA 2DNNA 5G0RA 1KQFB 4BC7A 4A8MP 1Y3KA 2ZOFA 2IA6A 3UD4P 4C0BA 5FIIA 2YNHA 1S6OA 1T3NA 1VC6A 3L7OA 3OTCA 4N77A 2PGCA 2R4FA 1G2EA 1HI0P 2YKNB 4A8SA 5EUHA 1KLMB 2LMIA 1Z2LA 4WK1A 4QWDA 2R2TA 1BD6A 3HZEA 4QIGA 1S79A 1S9EB 3VZIA 2VFRA 2U2FA 3IR5B 1REVA 2AYEA 2CVEA 2FJDB 3M32B 3VR1A 1F0XA 1DRZA 3PY8A 5KFJA 3M30A 4NA1A 2CQCA 2W4PA 3DN9A 2FGCA 2N3OA 3KK2B 4IUFA 2DGSA 2KU7A 2G9OA 2VG7A 1JKHA 3ZZZA 2PA3A 2V4QA 4MKYA 4Q43A 2CQGA 1DQAA 1K9MT 3MMAA 1Z1ZA 1WHWA 4WFBQ 4IOCQ 2IBOA 1YSJA 1QAIA 3A1YG 4JI1F 4OJ1A 3MUVP 3NP5A 5I3UA 3RB4A 2IAJA 1G6BA 4HVZA 2M7SA 4Q45A 4LF9F 2ROPA 1X8DA 2MKCA 1ZAWA 1DZ5A 2AYBA 2DK2A 3W3SA 4M1KA 2GFFA 3M8SA 2UV8A 2N82B 3DLGA 2DH9A 5DGBA 3KLGA 1FDNA 5HMZA 4IDKB 1PILA 2DHGA 1SB6A 4QR0A 4F4ZA 1RTJB 3Q24A 4D3GA 4RW4B 2ZH4A 4C3MA 4DR1F 1TL1A 1FXDA 1P27B 4C0OC 2OPSA 4DDFA 3OL6A 2VZ9A 2GJIA 3DYAA 3ZZ0A 2HAIA 2JC1A 2RRNA 1UVIA 3WC0A 4TQSA 2MKKA 2P9GA 2CPZA 2YNIB 1IBKF 2DH7A 3M9NB 3K59A 1QAYA 1N5TA 1UAWA 2CJAA 2YNGA 1HW9A 1YJNS 3G8SA 2B7BB 4UQGA 1TVRA 3T9NA 2PI4A 4LSLB 2YKPA 2MZQA 4MYUA 4N41A 2J6TA 4OZJA 1S1UB 4YB1P 2EKYA 3QPIA 2WSEC 1UVNA 2Q3PA 2R7QA 4PG6A 4ES1A 4KC5A 4ETZA 3PW4A 2KXNB 2BOPA 2GJ2A 4B3OA 4EU0A 2MJNA 4ZKAA 4C7QA 2MQQA 1D8ZA 1FRIA 5IT9Y 1YTYA 2UUAF 2CJQA 1VBZA 2ZBCA 4I1TA 1TKTB 1KC8T 1HFEL 3IAM9 1VQNS 5IXUA 2VPWB 3QGPA 3C6TA 2KYZA 2HRUA 4DQRA 4ERDA 1HNVB 4YB5A 5C42A 3OHBA 4NLGA 3HVTA 1C4CA 1JLGA 2ASYA 3MFIA 1MSWD 2UU9F 2HNDA 1DTQB 2HLTA 1WI6A 3HHLD 1Q7YT 4WJBA 4OI1A 1VQ7S 2O5DA 1NHUA 1X4EA 3MD3A 5CCMA 4ECSA 2J6SA 5DM6Q 3TX8A 5KG2A 1LW2B 3TYTA 2A18A 5J1NA 5KFFA 1X7VA 2BACA 3JTOA 4RNOA 4B9TA 2V2KA 3R5CA 3DM2B 4GO7X 1BQNB 2GMJA 5A8RB 3SQGA 4I7FA 2DGOA 2J76E 2HGNA 2YWHA 3ZZYA 1OSDA 1HD0A 2J0WA 4AUKA 1RT7A 2B4VA 1HD1A 3MECA 3G6VA 2HHUA 1JLFB 3V2UC 2XCAA 2DNMA 4L6V3 3KHLA 4B3MF 3K5OA 3V4IB 3FMBA 1KEKA 4JI3F 2R7SA 1RT4B 3ONQA 3GYNA 2PN6A 2VFTA 2J0XA 1D9FA 4A8QA 4DQIA 2RDJA 2UZAA 1LKZA 2WB4A 4KAIA 3BM7A 2XCPA 1JK9B 3BB5A 4CT9A 4NCGA 3EXCX 2U1AA 3OQ2A 2EG2A 4ZLPA 3B78A 3TR5A 4QWCA 3IRXB 3KG0A 4MK9A 5LSRA 4OJGA 3L95X 1QVFR 4H4KA 1LOUA 4AXIA 1H98A 2B4OA 3CD0A 3O6QA 4WXWA 1K0TA 4ZP7A 1N5YA 3D54A 5HN0A 2FPHX 2RRBA 2X3GA 3BDPA 3HM9A 2VQEF 3VAHA 4LT6A 4DV6F 3PV8A 3CPWR 2FJEB 5GAHI 1KFDA 3US5A 3KK1A 3LANA 1TKDA 4F3OA 3DU6A 5LMNF 3BF4A 4XK8C 4ZA1A 3SDEB 1WF0A 1LK7A 4Y6IA 5CHCB 5FDLA 4Y3CA 5GAHU 3I82A 2NUHA 2W24A 1JIHA 4CQ1A 4RW7B 3QWUA 2QA1A 4NA2A 2DH8A 4GMKA 1IKXB 3NCRA 3ZZOA 2ZH1A 1OS5A 3TAMA 2K1RA 2KHCA 2YY3A 3TRGA 4F50A 1R31A 2OLWA 3SYZA 1APSA 1XNQF 2XLKA 1D9AA 2BYCA 3CC2S 2HNZB 2OSRA 4KGKA 1N6QA 1NH7A 4JI0F 5CD4H 1FJGF 2RS2A 2AJ4A 4O4GB 5L8RC 1S1VA 3G96A 3RAQA 3MEKA 1DURA 1Q1KA 3GMGA 3CC7S 3QGIA 3JAMY 1S9FA 1QE1B 2GQ2A 2FD2A 2P9CA 3JSYA 4WU2A 1X0FA 2NSCA 3V6JA 4PPZA 3TUZC 3KK3A 1HPZA 2L9NA 1GQEA 2KN4A 5KFXA 4AFFA 5AXNA 3FSIA 2LYVA 4OJ3A 4N5SA 1Q82T 2ATLA 3VWSA 4WKYA 3HLUA 2IA0A 3W7BA 1L3VA 4AL5A 2RQKA 2BBEA 3I0SB 1Q79A 4O3NA 1FESA 5KFZA 3J7ZT 4R5PA 2QT7A 2VODA 1CLFA 2A3JA 1N0UA 3DI6A 4ECYA 3CJ0A 2YX7A 2J7WA 5THWA 1UW4A 3I31A 4ATNA 4EZ6A 2XMKA 1LWEB 1PSDA 2EFPA 2RU9A 4RW9A 2R8IA 2GQQA 2LECA 2J8AA 5KOXA 2XSJA 4RU2A 2NSBA 4QPTA 3K5NA 1B0VA 2W4DA 1B0PA 1ZAXA 5KFEA 1PO6A 1HBUB 1ZM3A 2N7YA 2WONA 3RB0A 1WF2A 4OX9F 2F1FA 4M5DB 4K5SA 3P49B 4LF4F 3CVKA 1DTTB 2IM1A 4I68A 1FRLA 1VQPS 1U24A 3CO9A 4HLBA 5AE1A 1Q78A 3T6JA 5DO2A 4AL7A 1KTVA 5KFKA 1SI9A 4QCLA 3TW0A 2BABA 5A0YB 2B56A 3OTDA 3MEEA 4Y00A 1RTDA 2KFNA 3DHWC 3E51A 4YFUA 1RKJA 1KS2A 1R8PA 4QU6A 5GMKa 5B08A 4RW8A 3KLFB 5B0DA 2MHNA 3Q8QB 3QJJA 4WYLA 4Y2MA 5KFCA 4Q44A 4CCHA 2HLUA 1S6UA 1SV5A 3C8YA 2AW0A 3UR3C 4MKBA 4X4VA 4R0EA 1NKCA 2HFOA 4K4VA 4EWTA 2NYIA 4CTAB 1DQ8A 4ZPWR 3K8WA 4NL5A 3ISND 2PDAA 1RYSA 3H59A 1Y4ZB 1XR6A 3BGRA 4UUWA 2XMWA 4U9RA 1HW8A 3E01B 4DFJA 4A8WA 3LALA 4IOBA 1Y9OA 4NZ6A 2F9JA 4IRKA 4M94A 2BANA 1KD1T 1OWXA 4ICLB 2I38A 5HQ8A 2VG6B 1VBXA 2EBEA 5C5JA 2DO4A 4OHVA 4TY8B 3RBDA 3CCZA 3THPA 1XMOF 2NQPA 3FQKA 1FCAA 2R8JA 2C3OA 1HYSB 2FIUA 4NLPA 1RK8A 2E1MC 2E44A 2J9CA 1C0UA 3M8PA 4U7UK 4B9MA 2ZH9A 3OLAA 2F3JA 2QRRA 5E0OA 2GMLA 1J5EF 4J5OA 4KSEB 5G4DA 3I9V9 4YHHF 4M63A 2Y1JA 2HS4A 2O67A 2LU1A 3PEHA 3U02A 4IG3B 5L1IA 1OIAA 1HNWF 4K50A 3VQTA 4DSIA 2KTQA 2CPIA 4ED5A 5J2MB 4CO2A 2VA2A 2BM0A 3IC1A 2LQ5A 3UCUP 1J5OB 5E2QA 2YH0A 1MROA 3TANA 2JLFA 5KFMA 1YJ9S 2BQ3A 3MAHA 4C11B 2VV5A 1AW0A 1JLCA 5HBMA 1GH8A 1TV6A 1LWCB 1U1KA 2JH3A 3I0RB 3JSMA 3CD5A 3TVZA 3L3CA 4ZMMA 2I5JB 2HGLA 1S1TB 2Y1RI 3CE8A 3LF0A 2DNOA 2GC8A 5KG5A 2W9CB 1SJ1A 3ZZTA 3UPFA 1Y7PA 5KT4A 2VG5B 5EX0A 1JLQB 2VFSA 2AGPA 4Q0BA 3W2VB 1LXJA 1QUPA 4DX8H 1FJEB 2W9BA 1N0VC 3PNIA 4O3OA 4I67A 4DQSA 1Q16B 3OR1B 4XPCA 4OV1A 4AE5A 3DFEA 4C8YA 1VBYA 2ASJA 3HHNB 3MM7B 3JSRA 4WU3A 3ZZPA 3P6YC 3DOKA 5IZHA 3BQ0A 1SJ4P 2E5JA 1KQSR 3RW7A 1IM4A 2Y1IA 1B64A 5KG6A 3DXBA 4YDXA 1DLOA 1XTZA 3FZBA 2E5LF 1YRXA 2VFUA 2JEFA 3AJ1A 2PMZD 5A6WA 3UCZP 4RW6A 3KLIB 1ROFA 3ITHA 1U25A 4CIOA 3VF0B 3BSOA 5FLXY 2JL9A 1M1KT 3G6XA 3SV3A 2IVFB 1ZM9A 2ZJQQ 2VB6A 5D77A 3PIPQ 3LGMA 4JI7F 2EFGA 2Q79A 4PG7A 5L9XA 4IG0B 2IMOA 2CPYA 5DG8A 4QWAA 3FNNA 5A8KA 1JLAA 3MI7X 1UJ6A 2UXBF 1LQ9A 5K9FA 1QLNA 3RZAA 3QJPA 3POTA 4DL6A 4BWMA 2QSWA 2ZE2B 1QJHA 2HNYA 3BO2A 2FLLA 1SH3A 4OIXA