4X62F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 27
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4x62F00
4DV7F 1CQNA 3T1HF 4DR6F 4DV3F 2RJZA 2UXBF 1N34F 1IBLF 5LMNF 1FJGF 4B3MF 1XMOF 1XNQF 5IWAF 4JI0F 1XMQF 5AJ3F 2ZM6F 4YY3F 1IJEB 2VQEF 4DV0F 4DV4F 2UUCF 4DR1F 1IBMF 2B7BB 4DV1F 4KHPF 3ZZPA 1IJFB 1HNXF 1QJHA 4JI8F 4DR7F 2BVZA 4YHHF 4LF7F 4LF4F 4B3TF 4AQYF 4JI4F 4LF6F 4DR3F 4JI3F 4JI6F 4DR4F 4JI1F 4DR2F 4NXMF 1HR0F 2F4VF 2UUAF 5BR8F 4DV6F 2UU9F 3OTOF 2E5LF 1J5EF 1HNWF 4DUZF 1FKAF 2UXCF 1I94F 2B7CB 4OX9F 4GKKF 1N36F 1VMBA 4NXNF 4DR5F 1RISA 2VQFF 4B3RF 4X64F 1B64A 4LF5F 1LOUA 4K0KF 1G7CB 4JYAF 4LFBF 4JI7F 4DUYF 2KJWA 4LFAF 4LFCF 2BXJA 1N32F 3T1YF 2HHHF 1GH8A 1F60B 4DV5F 4X62F 1G1XA 5LMUF 4JI5F 2UUBF 4JI2F 2UXDF 4B3SF 4JV5F 1XNRF 2KJVA 2YY3A 4X65F 4DV2F 4GKJF 4LF9F 1N33F 1IBKF 1HNZF 3R3TA 4LF8F 2J5AA 1CQMA 4X66F
chains in the Genus database with same CATH superfamily
3G6XA 4ETXA 1VHFA 3ZZ0A 3HP6A 2IA6A 2FHOB 1HWUA 1OWXA 1FFWB 3W9HA 3AB4B 3ELHA 1WWHA 4K59A 3SI8A 2NSBA 2J9DE 2AJ2A 3KK1A 2IA0A 1RSCA 3PTWA 4F4WA 3VZHA 1TTHB 1KTVA 3FEXB 5E2QA 2CDQA 1MWQA 2IBOA 2ZZTA 3KDNA 1SKRA 1U8WA 1FVQA 5DDRC 4P73A 2E9ZA 1RWUA 3G96A 4RW9A 5E7OB 3QQCD 3P45B 1G7CB 5CABA 1V6HA 4FP9A 3VAFA 2P6SA 3D1QA 2KU7A 4MTPA 2J0XA 4I6WA 2LQ9A 4B9MA 2ZE2A 3QSIA 5L1JA 3PHEA 3RW7A 2XLKA 3DNCA 1HBUB 1JLCB 3DRRB 4NMLA 2J0WA 1DQ9A 2ZWPA 3M8WA 5GAHI 2H48B 4U9RA 2E66A 2M2BA 2XSJA 3S6EA 2QLFB 2LECA 1F5CA 2ZKUA 2R8JA 3TQEA 3KJVA 3I0SB 1KKHA 5HLFA 1QAYA 1IBKJ 1X4HA 3E2EA 5FDLB 3QLHA 1S6OA 3IS9B 4LT6A 4OYIA 4NYOA 5FJ4A 4ILRA 4BCAA 1M5PC 4OX7A 3NCRA 2BQRA 4J9KA 2RF2A 4DL5A 2ACYA 1BGXT 2C1EB 2KKHA 3DLGB 3SQGB 3Q8VA 1P8GA 1AZSB 1RU1A 1NSQA 1QY7A 4DMZA 5LJ5Y 2EKNA 3BR9A 7FD1A 3D9BA 1O0PA 1J5OB 1RAOA 1B7YB 1NPRA 4F4XA 5KT6A 4A8FA 2DNGA 4PYDA 2J9EA 1R89A 3NOGA 2YNHA 3MPWA 3CD6S 1M5KC 2ZH6A 4RLEA 3TP2A 3C6TB 5KG7A 3DI6A 3HKWA 5DS7A 4ZMMA 3MAAA 3D68A 4CTAB 2AGOA 1CEZA 2JHEA 1JLAA 2W2OP 3I55S 3SXLA 4WKRA 2QGFB 3VGUA 5C24A 3W1YC 4I0WA 2FZKB 3KMSA 2DXDA 3GR1A 1VC5A 1HA1A 1V3SA 4F3OA 4DR7F 4DG1B 2RRBA 2V2ZA 1H7XA 3WHIA 3GLJA 4KE5A 2EC0A 4ECRA 2CNOB 5ETRA 2FC9A 5H9FJ 3Q8UA 1KQGB 3OTOF 2X51A 3E01B 3X1LB 2RT3A 3FNNA 1OMSA 1SC4B 3FCWA 1VLOA 5K8MA 3TX0A 4MAKA 2MLXA 4KPYA 3DOKA 2UP1A 1VRUB 2VPYB 2XZTB 5L1KA 3M6UA 3TJ8A 3CMES 2XHWA 2HQDA 3FUYA 2MQNA 2HRUA 4FNHA 2AW0A 5T7LA 4PABA 3H2VE 2UXDJ 2GFFA 4A47A 3TA1A 2VU5A 2ZH5A 2Q3PA 5KFYA 4MIWA 5K14A 2BM1A 3ZZRA 2AYEA 3IWNC 3OXLA 3N4WA 5KG0A 2HQCA 2DY9A 3T5JA 1Z4UA 3MM6B 2LQBA 1IN0A 2UVUA 4NLOA 3LF0A 2EWHA 1RCXB 1N33J 4QU6A 5HMZA 2IFXA 1Q16B 2YKNA 4HEA9 3BO3A 1PSDA 2W2NP 3W62A 3HI9A 1K0TA 4C48A 4J9SA 4DOZA 3ADAC 4RL1A 4CO2A 4JP8A 4IUFA 4C8LA 1JXEA 1WF2A 1RT2B 4M95A 1RYSA 2FJAB 2QYCA 3GJSB 4DN0A 4OYPA 2BMBA 1TP7A 1X5TA 2DNQA 2XY5A 1VJWA 1RA6A 5E41A 4OZ1A 2GJ2A 2KT2A 1YX2A 1SKUB 3W64A 4CM0A 4I2QB 4LF9F 1YJVA 3CCWA 2FVCA 4JI2J 1UVKA 4A4JA 4NCBA 2DRAA 3F56A 3HMJG 5HANA 3U1LA 5A8WA 4C3KA 2HYIB 2FVQA 2CPZA 4UF4A 2Z0GA 4ZP9A 2M9KA 2KZZA 3TANA 4OZ0A 4WU2A 4X62J 3PDNA 1F9EB 1X4FA 2H3EB 3WC0A 4TN2A 3OLAA 4HL9A 3G9CA 2HHWA 2HW3A 1B7FA 3T5LA 1EX8A 4RUAA 3AA8A 5DDPC 3BSCA 4CT9A 3QGGA 2MY7A 4IO9Q 2OUGA 2ATCB 1Q8LA 2WB4A 1Y3KA 5DQIA 2ZZMA 1ZYQA 4QIWD 2MKIA 4X4QA 3TVZA 2I5JA 1FEHA 3MCOA 2LEAA 3LAMA 4C4WA 2HNYB 1YIJS 1GXLA 3DOMB 3CGIA 4DBQA 2KDOA 5EDWA 3VGTA 1HNZF 1V3RA 4PPDA 5CYMB 2NS1B 2P9GA 3CDAA 2R7UA 2K7JA 2MKSA 2VA3A 2DPIA 4Q2MA 3NGTA 3DLHA 1IQZA 2FY1A 2GA7A 3KK3B 1W2IA 1FT8A 4ER8A 4YY3F 1X60A 1P27B 2AJ1A 5LJ3Y 3HDSA 4LF1A 1IBMJ 1KFSA 3POTB 3CDEA 4RW7B 4H4OA 1F2HA 2YH1A 2V50A 1JMTA 2W9BA 4WE1B 4B9UA 1GTEA 1Q5VA 3H4DA 1J5EJ 4DZDA 2C3UA 1UP1A 2R2SA 3H7HB 1QSYA 2IMOA 4LBHA 4L3NA 3PJWA 2QEXS 1I51B 3R7BB 4CI0B 3I4HX 2E44A 4AD6A 1TV6A 1SUQA 1YG0A 2BEFA 1R7IA 2J6UA 1LXNA 4CO1A 3MMBA 2OPQB 3CO9A 4DFJA 4JI0F 1JB0C 1N5YA 1PILA 1LWEA 3CD0A 2D1CA 3PO4A 4O0NA 1QAXA 1TKXB 2WVBA 1IWGA 1VJQA 3R5JB 2W24A 4DV6F 1KOHA 2BQ3A 2FHJD 5D3GB 3LP0A 3QO9A 4TQSA 2YNIA 5HATA 5DJBA 3A3NB 2XMUA 1HNIA 1R27B 1TKZB 4HH0A 5KG1A 4U67Q 3TUZC 3BQ0A 2KG1A 4IFYA 3UNGC 3NBPB 1EP4A 1XR5A 4LFAF 2HFNA 1YZ6A 5J2PA 1IKXA 2ZH9A 2NUUG 1VQ7S 4GVBB 4XDCA 4Y28C 4O4GB 1VQ8S 3OR1B 1JLBB 2RJZA 3NS7B 1BHNA 1U1PA 2PFFB 3QJLA 4GO5X 2HVHA 2PD1A 1GFWB 4H4MB 5AJ3F 4QIEA 4YP3A 4E98A 1F1BB 4OIXA 2QE5A 3OD2A 4MKAA 3N01A 4A8XA 1NK7A 1TMJA 4NLUA 2VFRA 3UDLA 3KLGB 2RHSB 4WKYA 4K4VA 3BGFA 4MT1A 2A10A 2GMJA 2ADCA 4O3QA 3V6KA 3B4DA 1B0PA 2QL5B 2AJQA 2BA9A 5L46A 1UWAA 4NE9C 1K1SA 4WFYA 3Q8SB 2D3UA 4X4NA 2P9CA 4I56A 3LGHA 2FYXA 4OX8A 2MDAA 3GSIA 1YBUA 4ILLA 3ENVA 2EBGA 1FHTA 4ZVHA 1FTCA 2HS3A 4KFBB 4L3KA 1RWXB 1JJHA 2QIFA 3FMWA 2XC9A 2CQDA 2AF6A 3N6MA 4B9NA 1VBYA 2G2OA 1B3TA 4PCQA 4Y0FA 3U7JA 3D0HE 4UUXA 4DUYJ 3PR5B 1XNQF 2ZJQQ 3JSRA 1IUJA 3AD8C 4W98A 2K1RA 2O5DA 4TY8B 4NLDA 2XYPB 2E29A 3HFKA 1BUXA 3HD2A 5CA5A 4HLBA 2P5VA 5A8RA 1Y00A 4RX6A 3QGPA 2G0CA 3EJMA 2JRSA 5A0YA 2BKOA 2ZJRQ 2VUGA 2H4YB 3CCES 3QWUA 2LXFA 3IWXA 5KFPA 2LEPA 1TUVA 1D8ZA 1NSKL 4R25A 1E6YB 2B6AB 3HT0A 2DT9A 2M88A 4B3RJ 3FKBA 1N32F 1LWCB 1S6PA 3LW5C 9RUBA 1GXTA 4USTA 2VG6A 4DFPA 1LXJA 3LWLA 2X1BA 2DCUB 2R7OA 1TL3A 4ZP6A 3GFZA 2OTLS 3GQCA 4CYUB 3OTEA 5F0WA 2BYCA 2W4PA 2FLOA 3RB4A 2KYXA 1DTQB 3I5CA 1YJRA 1BQMB 4ZPTR 1WTFA 1IJFB 4WFNQ 1JXVA 1B99A 4ID5B 2PEBA 4FF4A 4HACB 4DV3J 4JI4F 3ITHA 1AA1B 2HZVA 4QW9A 3PX6A 3DYAA 2ZD1B 5CYJA 4UOHA 5IT0A 2BE2A 4XO0A 7FDRA 5I3PA 2GS8A 3PKYA 1JJCB 2DIVA 3J81U 4J9UE 1ELOA 5LXYA 4CDIA 3MR3A 1X8DA 2AT1B 1CJKA 2C28A 3CCMS 2V67A 4NWBA 3AJ2A 3K57A 3DLEB 1KLNA 5EWFA 1RTJB 2A6MA 3D4JA 1SJQA 4P2SA 4E2FB 4DL3A 2XB2D 3A13A 2WVCA 1LK5A 5HROA 4ICLB 2J0QD 2LU2A 3B78A 3M2UA 2DY1A 1VC0A 1CJUB 2K3IA 2GAHC 4G1PA 2MZJA 1TL7A 4M5DA 3NL0A 2EKYA 5KTQA 1VQSA 2X7IA 3WX4A 2VH7A 1RCOB 2DHAA 1CBKA 1UFKA 1UW9A 5IV3A 3KUHA 2C2RA 3RG6A 1S1TB 1JQGA 2OPPB 5IXUA 3GCXP 3CO0P 5E3QA 4O44B 3PW2A 1Q5YA 4Q44A 1F5AA 2LQ8A 4NZ0A 4AL5A 3H40A 2JEGA 2IJRA 3HSGA 5KFRA 2DR9A 3KUGA 1MSWD 2MJNA 5D0GA 1L3KA 4DSEA 4LSNB 4ZVSB 5CQGA 1KDNA 4UZBA 3M8SA 1HQ2A 1VK3A 2C2OB 2FD2A 5IC4B 2KG0A 3C3LA 1UWBB 1ZS6A 1WKJA 2LEBA 3K5LA 4PG5A 4KYZA 3PW0A 3A8JA 4L74A 4ZJQA 5C42B 5LMUF 3IG1B 4G6VB 1LW0B 2RQCA 4WIQA 2CFXA 2XEXA 4A8SA 4I7FB 5FLXU 2EW9A 3RBZA 1XK8A 5AXMA 1RT3B 4AFFA 3MR6A 5I3UB 3C14A 3OR2A 2DVIA 1OJ4A 4OX6A 1QD1A 1RQ0A 2E5JA 2I2YA 3Q8RB 4IG3B 1N48A 5KFWA 2BABA 1PC5A 1RHUB 2JOQA 3HD1A 4KPCA 1RE1B 4IOAQ 2F3JA 2AJ0A 3OJSA 2BDPA 1F9FA 4P9SA 3OVSA 4KHPJ 4RNFA 2ZFHA 3GFHA 2CYYA 1QDUB 2KXFA 1MN7A 1GX5A 5IWAJ 2PSZA 2VJUA 2XZWA 2KXHA 1LKZA 4DV4J 3MECA 1S76D 3P49B 1RJJA 2CJKA 3KLFA 1RTIB 3CIZA 2C2KB 4F25A 1BQNB 5F9LA 3QJJA 1QSLA 3RU0A 3HT3A 2CVEA 1N6QB 1U26A 1RU2A 4LF5F 2CG4A 4LFBF 4K4SA 2BV3A 2ZHOA 4BWMA 2GV1A 3ILLA 2Z58B 4BC9A 4CNYA 3BDEA 4DUZJ 3R5BA 1FXRA 4WWSA 1WI8A 3B4MA 5HI7A 5F41A 2NREA 5KFCA 1RTZA 3GR0A 4YS2A 1BLUA 4WP3A 3TUJC 3VALA 1NDLA 5CYQB 4X4TA 4Y3CA 1WC6A 3GILA 2P9EA 2DB1A 1SQGA 2QG9B 1UEVA 4EUVA 4WZQA 4YHHF 5KFLA 3TAPA 2PA3A 4RW4A 1QTMA 4USUA 5KT5A 1DZ5A 1HWLA 3LPEA 2DJWA 3K5PA 4V19X 3DM2B 4GO7X 1X4EA 1VS3A 1VQ4S 1Q53A 4DR4J 1KHVA 3EWGA 1NJWA 4N8OA 2KVIA 1HYSB 1VC6A 4KGKA 3C19A 1UVLA 4PUOA 3PG9A 3ZNUA 3Q86A 4OYWA 1FJEB 4P52A 4C0HA 4ZVQB 2OEJA 3HSDA 3PEHA 3NMAA 4YUDA 2VDIA 4CLFA 4J9LA 3KG0A 3PFOA 3ZZOA 1GX6A 3DKDA 4PG8A 2MY8A 5ETKA 4M1KA 3NGRA 1LW2A 3P4UB 5B0CA 3TX8A 3HJVA 4LRDA 4PXCA 2ZNZA 2NXJA 2VFVA 2F4FA 2MZ1A 2FVRA 2GVZB 3HPOA 1LWFB 3RR8A 3M6WA 4QIGA 4DHVA 3JTOA 1CULB 3D6TB 1M5OC 2DGQA 4OZ3A 4FKYA 2L9NA 2FJXA 3CCJS 1N5TA 2VJVA 5JMNA 4MH8A 1RAIB 2RKIA 3FFIA 2N4DA 5C25A 4JI3F 2V8VA 5EHHA 5EN1A 4J91A 4NXMF 1ZPVA 4Q0BB 4IRCA 1TAQA 1TUGB 1SL1A 2NZ4A 4DXLA 1RAGB 5JXSA 1RWVB 1CS4B 2E9TA 4YMEA 1OQ3A 3LALA 3KHLA 4PYAA 4R0JA 2RD5C 4QJVA 3KDOA 3AJ1A 4PXBA 3UCUP 3AXKA 1LFWA 2Q66A 1RTHB 4KKOB 4DS5A 2OFHX 1NDCA 1H2TZ 1KFDA 3KK1B 4N5SA 2DRDA 3CMAS 3CDWA 1FFGB 2DNNA 2QV6A 1G1XA 4F4AA 3VAGA 1NBEB 3TQ1A 2KJVA 4ANDA 1Z2ZA 3CCUS 3B54A 4WYLA 3US5A 2EFPA 4ZA1A 2V0NA 5M2UA 3N6LA 2RU9A 5LMNJ 4CLKA 5ADZA 2DGWA 4TU9A 3HVWA 4QU7A 3PM9A 1HWJA 4U95A 3CEDA 1EQ0A 1ZOTA 3VQSA 4NPOA 2ZM6J 2Z2LA 2VQEJ 4DZ6A 3UW1A 1HBUA 1WG1A 1JLCA 3DRRA 3AQPA 4DR6J 4LF6F 4OMFG 1MWZA 4JI6J 5IQQA 1UA0A 1FESA 4ZIVA 2LU1A 2K8GA 2CZ4A 3I0SA 3W5YA 4HVZA 5FDLA 3PJ9A 3N79A 3IS9A 1HPZB 1Q8KA 3DRPB 4C8ZA 1T03B 2V8PA 5D78A 1T9YA 3IBCB 1N4LA 1OYEA 2Z2ZA 4BLGA 3ZTSA 2PA8D 4MK9A 2RE1A 1NZAA 3FEZA 2O67A 3DLGA 4EZ9A 3SQGA 2RF2B 1UPMB 4J9QA 2JEIA 1AZSA 4NOHA 4ES3A 2BUNA 2EPIA 1J5OA 2ZITA 1KS2A 4CO0A 3ZTPA 1U0SA 2ALZA 2V8HA 4M5HA 2F7VA 5LL6d 2W2QP 3IP0A 3BSNA 4P2FA 3OFFA 2LQ5A 1IJEB 3TVYA 2E9RX 3H42A 3MM7B 1OSCA 3DXSX 3C6TA 1SI9A 2Q6BA 1HD1A 4CTAA 1DAXA 2JEFA 3KMQA 8AT1B 2HHUA 3HHLB 2DHXA 4ITSA 4UOCA 3J81Y 3EUNA 4DL6A 5CD4A 1S10A 3CTRA 4CZCA 1RHMB 1JLAB 2YWKA 3MEKA 3L4BC 1HKAA 3MEGB 4NLRA 3B6BA 4DG1A 2JZ5A 1TQLA 1FWPA 3NNCA 2YX4A 5ETPA 5AT1B 4N56A 3EDRB 3FZBA 4ECTA 1WC4A 1U09A 2HGMA 3E01A 1L3SA 1RDRA 2C3OA 5FIIA 4DS4A 2LLZA 4Q7AA 3K5NA 3ETOA 3VQTA 5GAEI 1LK7A 2YWGA 1WSRA 4GKJF 3CJRA 4AYBD 3EVWA 4A8WA 1NDPA 1VRUA 4C11B 3MEDA 1TR0A 2A1BA 1N54B 3CCRS 2Z30B 3QAUA 2UVRA 1Q79A 1S49A 3H59A 5DM7Q 3HVRA 1T94A 1YBAA 1NKBA 3T9NA 2LDYA 4W90B 2F9JA 5IZHA 3D54A 1VQMS 2CG8A 1U48A 2KT3A 3NRBA 3KK2B 1O6XA 2KN4A 3OL9A 1UZDA 1G6BA 5KAKA 2V68A 1VQPS 3J7YU 2NZCA 1VQLS 2HLTA 2OHDA 3PX0A 2J76E 1R0BG 4Y2CA 4PG6A 3ILJA 2B9XA 1F9HA 3MM6A 5J2NB 2XMAA 4RUCA 4IO1A 4K4YA 4TYAA 2HIQA 1FDDA 5DLFA 3CD7A 1T95A 2KZMA 2WBMA 5FLXY 4X4OA 1TK8A 3BF4A 4RW8B 2Q6CA 2HGNA 4ELUA 3B8HA 1RT2A 3W60A 4ZS6A 3AH6A 1J2VA 1TL4A 5DGBA 3TW0A 1REGX 4U7CA 3THPA 3QFHA 2XMTA 3MPDA 3ISNC 5CCMA 1Y10A 3PZPA 2ZBIA 2HBRB 4HH1A 3CDBA 4I2QA 2JC1A 5EUHA 2B8PA 3K7RA 2ZHAA 1X4GA 4B02A 2YX7A 2RILA 3I82A 4WXOA 4UUWA 2FIUA 2DNKA 4OI2A 4Y34A 2NQPA 1K1QA 4B9VA 1NAQA 1FRLA 1EZZB 2U1AA 1VGYA 5D4OA 4X4RA 3N28A 3G8TA 5DQHA 2KB2A 2OKQA 3M8ZA 2WAQD 2E5LJ 3BDPA 2JSXA 2UXCF 4BS2A 4FVMA 2N7YA 4M5GA 4C98A 3O2IA 1N36F 5LSRA 4PXDA 4J7CA 2Z8QA 3SDEB 2R9LA 3UD4P 5KT4A 1KRPA 2VQFJ 2XM3A 1FA0A 1FJ7A 3D3CJ 4JOUA 1M0SA 1OY8A 5ETMA 4JYAJ 1XBWA 3TA2A 4AXJA 3K8WA 3T1YJ 2BRLA 4DF4A 3GYGA 4JI5J 2HZCA 2GMHA 5D0EA 1JLFB 5MLCV 4NX9A 1HW9A 3PYDA 4CLLA 3JTNA 3Q23A 1R8PA 2DXEA 1SL2A 5CCLA 4RKUC 1X31C 2HNYA 1B70B 5F3ZA 2VKZG 1QE1B 3PEJA 1YZ7A 3J80U 4WXWA 3DOMA 3CVKA 5CYMA 3IGNA 5BXIA 1P1LA 2MKKA 2ZH2A 3SIPB 4KRWA 3KK3A 1FX2A 4KO0B 1RK8A 1RABB 5HQLA 4ECWA 4WBFA 3GWCA 3V4MA 5A2QU 2FTRA 4M5NA 3J7Z5 1L3UA 1Y11A 4PQAA 3ISZA 2NUHA 3POTA 4RW7A 4H4KC 1HQEB 2R8IA 4OYAA 3WC2A 4N77A 2BOAA 3IRWP 1OSDA 4WE1A 2Q1LA 2DGXA 3PIOQ 2XQCA 2YWEA 4F67A 2IY5B 1WUUA 5AXNA 1GT8A 2XMKA 3BM7A 2HURA 1XR7A 4YDDB 4A8QA 2B9WA 2GGPB 2LDIA 3W8PA 2LA6A 1D3WA 2HNZB 3VV2B 2CRLA 1FRKA 3D67A 4F2RA 2QSFA 4ZPWR 1Q86T 2XMJA 2E1MC 4OFZA 2OPQA 2CPXA 3KLIA 3PYEA 5BR8F 2OELA 4DX7A 1SC1B 3SEOA 1H98A 1KLMA 2WVEA 1F2GA 1HW8A 3D2WA 2AEMA 4R5PB 4RWWA 1GMWD 2COLA 1R8HA 1DFDA 5B09A 2PO4A 4GC7A 3NGDA 1VMBA 1VFJA 4ZLNA 1TKXA 1Y5NB 3TJ9A 1AUDA 2I9SA 1FI4A 3Q24A 4GVLA 3ENQA 4DX6A 2MZTA 1WG5A 4L75A 3QSYB 2IRXA 1BMQB 5D3GA 2N4CA 1MG7A 2OMLA 1GMWA 3B82A 1WDDA 4FYVB 4DCPB 3MD3A 2V9WA 4UT4A 1TKZA 4KGMA 4HTJA 2AMCB 5D6GA 3HHKA 1QUVA 4AE5A 3G4SS 3NBPA 3TNVA 4W92B 1GMVA 2YX1A 1AROP 1F6TA 1PJ5A 2CNKB 2DNOA 4NEZA 1S99A 3ILOA 4LBIA 2BM0A 3FBFA 5D0HA 4GVBA 3KG4A 2FC8A 1UKUA 1S6QB 2XWXA 1H74A 1RT1B 4O4GA 3OR1A 1JLBA 3BSAA 1C1BB 4P7TA 5DRKA 1WEXA 4H4MA 3Q0AA 3Q22A 1H3DA 1YRXA 3R27A 1J27A 4ECYA 4B9SA 2XGPA 2HRTA 2Q79A 4G65A 3OBIA 4I67A 5B0EA 3KLGA 3KLHB 3MAQA 3ISND 3DOLB 1R0CB 3Q2TC 5KFEA 1S9GB 4HI2A 1SIZA 3TEHB 1RADB 1GTHA 3NMRA 1XWLA 4JV0A 2YWFA 4X65J 4IOCQ 5E3RA 3R8YA 2XSFA 2CPIA 4Y2KA 1BQXA 4CLYA 3PW7A 4J9PA 4RW6B 2HZAA 4KFBA 2I8EA 2RQMA 1RT7B 1KQKA 2B0GA 5DDQC 4NLGA 2WZ1A 1XERA 4KQZA 4X84A 2IHR1 3BQ1A 3I9V9 1S48A 3P5BP 4ZPCA 1QVFR 4J9OA 1NB2A 4FF1A 4LSZB 1D1UA 4OLPA 5HO4A 3FVYA 4ECXA 4AL6A 1KVKA 2OPRB 4O23A 3UCZP 1RT5B 4KGVB 3HCXA 2FLNA 2KL8A 2GHVC 2K1RB 3OFHA 1T7PA 1I3OB 3C66A 2EC2A 2BE9B 2AEJA 5F8JA 1VR6A 2QSWA 2RRAA 3DLJA 3QNWB 2QA2A 3T6JA 2CJYB 2FJEB 4USIA 1CQMA 1E6YA 2B6AA 3W3SA 2M52A 1LWCA 2ILZA 2F9DA 1EHWA 3FDSA 4PQUB 1B4SA 4DU8A 3JSMB 3MPVA 1FDAA 1FNXH 2MPUA 4CYUA 4QBUA 2CQ3A 1AW0A 4DV0J 2C2EA 3MUMP 2J9DA 1AXQA 4RU2A 4NL5A 3NS6A 5A6WA 4JUZA 4ES1A 4LF7J 2NLWA 2YXLA 3PYGA 2DGSA 1VQ9S 2V63A 1DTQA 3GYNA 1H6KX 4YY3J 1PKUA 3EGWB 1JIHA 3ONQA 1BQMA 4ZDNA 2RDDA 4CH0S 3VVUA 4HACA 3QBCA 2IM3A 3DHXA 3DDNA 4K5RA 2JWNA 1DQAA 4U8VA 2ZHBA 4YFUA 3VHQA 3VWSA 4LFCJ 3W9IA 2YNFB 2UXDF 5KFIA 4JV1A 3UE2A 1PG5B 2EEYA 2N3LA 2PMZD 1JLQB 1QSSA 3QRQA 3DLEA 1K73T 2PFDA 3A4TA 2APOA 2ACMA 1S0NA 4ICLA 3I56S 4WIIA 4OZJA 4DV1F 2XMVA 3M32B 3VVTA 2UUCJ 4MYUA 4IG0B 2ZH8A 1CJUA 2J0SD 2FHMA 3I96A 2UV8G 1FJCA 4NYPA 1RGVA 2U2FA 3UN3A 4QPXA 3D3BJ 1YSJA 1V5VA 4M5MA 4ED2A 3GPAA 2HWHA 2EXUA 1S1TA 2OD4A 3SFUA 2OPPA 4O44A 3O5TB 2ZC3A 1C1CA 4KC5A 1Y3JA 3UQSA 3M05A 5DZ6A 2CNNB 4DV6J 2JFKA 2HGLA 3FGVA 1DURA 1KNZA 1FDBA 4OI4A 3KOAA 3UVJA 4JI2F 4DV5J 1TAUA 5E3PA 4LSNA 2G0IA 2GO8A 2CQ2A 2AYBA 4CCHA 4HI1A 3QGIA 3LP1B 1UWBA 2AYGA 2ROGA 3VZIA 2B9EA 2MKYA 5C42A 1R6YA 1SXLA 4DU7A 3IG1A 4WFXA 4OZNA 1LW0A 4Z2XA 3JQMA 4LR7A 1IWAA 5DO2A 3AD7C 1NH7A 4I7FA 2MTLA 3CIMA 3LUYA 1S4FA 1RT3A 4G3IA 5I3UA 4DR3F 5A2QY 5A8KB 2CJQA 4IG3A 4N8NA 2ZOMA 1T3NA 3BB5A 2XYHB 1RA7A 1FWLA 3OR2B 2W9AA 2LA4A 1VDHA 3DXBA 1IQTA 1OQ6A 2WBRA 4LREA 1S0OA 3S7RA 3IXQA 3TVKA 4WCEQ 4X4SA 1TL1B 1W25A 4TU8A 4J9MA 2WCXA 4A48A 1TFWA 4DSKA 4DPTA 3GONA 3HLUA 2POKA 2G9OA 2CAJA 1RTIA 5GMKa 1RT6B 1SQEA 1BQNA 4PXEA 1N6QA 1NHKL 3CJ4A 3ILIA 3LANA 3FQKA 4OYBA 5IQ6A 1ZAXA 3EICA 2V4RA 3P96A 1IBMF 2NPIA 2RUGA 1VCTA 3CCLS 3W63A 1SJFA 2H1YA 3ZZZA 5M2RA 4DF8A 1XNQJ 5CYQA 3NY0A 1J5EF 1RHQB 5B08A 1KSPA 1A7GE 2ZBRA 4A8OA 2XMWA 1VOMA 2DXFA 3P6YC 1SC3B 3I5BA 3BBBA 2C2DA 3LPYA 3DM2A 1B64A 4OV1A 3NWRA 2HVZA 4IH5A 4CH7A 5J1PA 4LRCA 1HYSA 2OFGX 5KFXA 2C3MA 4ZCLA 4A8YA 1LV5A 4ZVTB 3G6ES 1YK9A 3FBEA 4RWXA 2GHWA 4NRTA 1FNOA 1R6VA 3HK2A 5LM7E 4WFAQ 1S79A 3RGIA 2XS7A 1YQHA 3KLEB 2DNHA 2DO4A 2HHVA 5IFMA 1FRIA 4LIRA 1GNKA 1H2VZ 1N8RT 4B3TF 2E1RA 2GVZA 3K8VA 1LWFA 1JJ2R 1PBAA 5IC6B 1CULA 1L3VA 4CLPA 1O5JA 4UQTA 2BANB 2V8GA 3ZO7A 1P1TA 3M4XA 2V34A 2DHHA 5DG7A 2EK1A 2V4JB 1PIEA 2G1HA 5KT2A 4ECZA 2DGVA 4Q0BA 4AUKA 5M2PA 2I1RA 2A3JA 3MUVP 5C25B 1DLOB 4ZPAA 1NK9A 1CS4A 1WC5A 4TQRA 3OHBA 4CO5A 3DDKA 1FE0A 1KP6A 4C0OC 4TNOA 3QRRA 1WDTA 1G3OA 1S7HA 1RWPB 1FCAA 3NG8A 1RTHA 4KKOA 4V19J 2EFOA 2C42A 2DR5A 1I6JA 4NMXA 2B4PA 4ED6A 3KHRA 1XEZA 3PY8A 3K17A 3M1VB 2NXCA 3BH7B 3W8GA 2KM8C 4F02A 2R8HA 3K59A 4EYHB 1WD6A 2HKEA 2HAFA 1BWVA 2HHPA 2UUTA 2VIHA 5HJYA 4DR2F 4AQYJ 1RWKB 4DFMA 2HVDA 1RWMB 4OQJA 1HR0J 4DPUA 4IDKB 4FXWA 2BACA 3T41A 3C2PA 4ZLPA 3SCIE 3AFGA 2C3YA 2AJ4A 4ZP8A 1TZ0A 2X1AA 3Q83A 3E3XA 2ROPA 1GEHA 4X64J 1R31A 3EZUA 5AE2A 3R5GA 1I5OB 1S97A 4LR8A 4EWTA 4QYRA 2CJ9A 3M2VB 3HFZB 4DLGA 2WB1D 2Y1IA 1CC7A 1HPZA 1FFSB 3DRPA 1T03A 1MROB 2D3OR 2HAIA 4DV7J 5KFSA 1Z2LA 1EQMA 4OHXA 5AXKA 1REVA 4F0HA 3MD1A 3T1AA 4TYBA 5LMUJ 2C2NA 3WX8A 2W8LA 4MK7A 3QT8A 3Q8PB 3DHWC 4DL4A 4UY85 5KG3A 4PEOA 3U1NA 2X3DA 4DQPA 3A1YG 1WKKA 2WONB 4ZVEA 3DLLQ 3T3FA 2XY6A 4JI1J 4QWCA 4J9RA 5EWEA 1FE4A 4UOFA 5A6PA 2LVWA 2MJUA 2AZ1A 3MM7A 5C7PA 2J7KA 4K4XA 5I3QA 1X4AA 2UUWA 3ET6B 1XIQA 2J8AA 4ZVPB 3D28A 2IBKA 3HHLA 4B3RF 2YKMB 4L6V3 4ZVFA 2ZH7A 1SKSA 4KV8B 2OI2A 5G4DA 2V69A 2H65B 1S1UB 3MEGA 1JXLA 2BJ7A 3BH6B 1M1KT 3J7AN 1UVMA 3LWMA 2P8IA 5CZXA 3TRGA 4DCJB 4K2JA 1UJ6A 4N41A 2G2YA 1I1GA 3CCSS 2XS5A 1UFLA 1UFWA 5RUBA 4HHHA 1BWEA 1D8YA 3TZZA 1FD8A 3UD5A 2WTFA 4C11A 3R6LB 4OYOA 3CCQS 2IAJB 1SVDA 3D6MB 1QJHA 4IRKA 4DX5A 1SC6A 3MEDB 4ELTA 4CP5A 2C3PA 4LF4J 3JQJA 3GU0A 1HLWA 2KHDA 2MQLA 3H0PA 4ECSA 3OXFA 5IT9U 1CG2A 4Q8FA 3HZEA 3ZTQA 5CAAA 4EYIB 2F8HA 3KK2A 4PPZA 1RWWB 3ZFVA 1W2BR 2YKOA 3J81j 2BW2A 4R0EA 2AHOB 4DR5F 4DSJA 4ELVA 4GKKJ 3QPIA 1U6FA 4ENOA 2DBBA 4P2MA 2G0JA 3AOAA 1RWOB 1V3ZA 4B3OB 2L41A 3A3OB 2HHHJ 2AQ4A 2EG2A 4QWDA 5J2NA 3UR3C 1IKWB 2DNLA 4B08A 3MURP 4XIUA 4YB7A 1HBNB 1T3OA 3T1HJ 1RWNB 2UXBJ 1IBLJ 1S9EB 4V1Ak 3I32A 3EGNA 2O66A 3UWTA 2VFTA 4RW8A 6FD1A 3OFGA 5IV4A 2ZDOA 3QAEA 2MYFA 4EO6A 1IR0A 4OJGA 4WTYA 2MHEA 3UDCA 1SH0A 3UPFA 4CT8A 2YH0A 4HT5A 2QLBB 4ES2A 1EAYC 1C0TA 3MF5A 2LP4A 4USMA 3BBFA 3H25A 1W7WA 3A8EA 1U02A 4JI3J 2BX6A 3VAKA 3I9ZA 1T9XA 4X2BA 3TAQA 2MQQA 3K5MA 2QA4S 5KFBA 3NAHA 3OLBA 1X5PA 4FDFA 1OPIA 3PRDA 4YEAA 4IQMA 3W2WB 4KAIA 2GVDB 2K3KA 2QA1A 2Y1RI 4J9VA 4QWBA 1XNRJ 2CQBA 4OJ1A 3SDEA 5IM0A 2AX1A 4CNZA 4FN5A 3G6VA 2DNZA 2CJBA 4DPXA 1ZAWA 4QYZK 4DUTA 4YN3B 4B17A 4FYWB 5K8PA 3I0RB 3ZC4A 2B51A 1JLFA 1FXLA 4KHPF 1Y0HA 1H0HB 2B9YA 2L48A 2DGUA 4QWAA 3MR5A 3MPYA 4ED1A 3FSIA 2R3VA 1A0OB 1U1MA 3KJNB 1IR2A 1QVGR 1QE1A 4IQXA 2JDJA 2ERRA 2VPZB 3F44A 3BGUA 1NJZA 3CJ2A 4C8NA 5SZTA 3NGSA 4LRAA 4LF6J 4F7VA 2PIIA 4KO0A 1WHXA 4E0DA 3TUPA 1HQUA 2KTQA 3TZYA 2FPHX 2KH9A 2HHSA 3I5AA 2ZOFA 2DNRA 2MMYA 4I6YA 4JV5F 2VPXB 5FD1A 5EX0A 1DRZA 2VC0A 3OT9A 4HHJA 2A2DA 1HQEA 3R1HA 1N34F 2WW8A 2VKRA 3QYYA 4DQQA 2YKQA 4YR2A 4HKQA 1MMLA 3V4IB 3RRGA 3LA0A 4MJKA 5I42B 3HO1A 1SKWA 2FGCA 4Y00A 4Y2IA 2GGPA 4EFAC 4ALZA 5EGYA 4DR4F 2W01A 5B0AA 3UO0A 1KD1T 3ZNJ1 2HNZA 4MKVA 4DN9A 1EKSA 5L9NA 4ZVGA 2MQMA 1VBXA 3UCGA 2UU9J 2DISA 2KFYA 4DCOB 1X5OA 5ETOA 4ECQA 3D6HB 4AL7A 1S0MA 1NK0A 4WK1A 1NU4A 5J2MB 3GG1A 3H2UB 3MI7X 2RS2A 1XJWB 4K0KJ 2FZCB 3KLIB 3OXGA 3HULA 3N0VA 3OVBA 4R5PA 2WK4A 1D9AA 5LT5A 1VQKS 3R7NB 2LKZA 9ATCB 3SSQA 1KLMB 2HBQB 1NHVA 3K2YA 3BEGB 2LXUA 4H4KA 1NPPA 1FKPB 3UN2A 4OHVA 5GAGI 3RAXA 4DR1F 3BGRB 3KKFA 1H73A 1FK9B 2MSTA 3C8YA 2DTJA 2HWIA 4URGA 3KWMA 1F3FA 3OL8A 4JI8J 1WSVA 1WOOA 2CADA 4EGLA 2FJWA 1KVJA 1FKAF 1FVSA 1S6QA 2V8DA 1RT1A 1RXOB 3NCQA 1KBRA 3WIVA 2CPYA 1C1BA 3P3DA 1ACMB 2IDEA 1B0TA 4KT0C 2GIRA 3GV8B 3KHHA 3FJ2A 4KGZB 3R1LA 3OUYB 4LIWA 4KH1B 5F9NA 2HFVA 2CPDA 3GMGA 3MUTP 1HFEL 5I4MA 3CSKA 3FC9A 2EI5A 3JB9k 2W25A 2B56A 2KI2A 2EBEA 5ETVA 2X3GA 5DM6Q 2HQFA 4LMZA 3KJQB 3KLHA 3KYLA 3DOLA 5LMNF 3PKMA 1RTDB 2ZZNA 1S9GA 2OEMA 3DCAA 4QCLA 2ZM6F 2IYGA 3IR6B 2OMOA 2VQEF 2W4CA 1RI7A 1CPZA 5JJBA 1CVJA 5THWA 1OY6A 2EG1A 1DQ8A 2JC0A 2RRNA 5AE3A 1BY9A 2HLUA 3GFXA 4YQWA 4CLZA 3VCDA 4JI6F 2W2PP 1AFIA 1UVIA 3MM9B 3ULHA 1L5UA 2AJFE 2IM1A 1QAJA 4RW6A 2AYMA 1RT7A 4NLTA 2D3O1 2Y1LB 1HNWJ 1FXDA 3MOJB 1RUSA 4P74A 3OTDA 2HFOA 3S01A 1U1KA 4P71A 4WP9A 2BJEA 2MZQA 1X9SA 3IC1A 3FMBA 5DETA 2OSRA 4MK8A 2OPRA 4ZN3A 4MIAA 1LQ9A 2AGQA 4FBUA 1RT5A 1CJTB 5HVFA 2AZ3A 4FPIA 3TZXA 4FNIA 2P6TA 2HNDB 4OI3A 3BQ2A 1MU2B 3KLVA 3V6JA 3O8WA 4XK8C 4X4UA 4NLYA 2IIHA 4L73A 2IC3B 2ILYA 3VAMA 1WTBA 2VC1A 1Y7PA 2D41A 4YDXA 1EETB 1KR4A 5DG9A 1HI1A 3VTIA 4BWJA 1ZZNA 3GB0A 4LSLB 3MFIA 2PI4A 5IT9Y 1FNMA 2H4WB 2QO3A 1HWIA 2B5JB 3UDEA 4RO0A 4PQUA 2CJXB 2H5EA 1WHWA 3D0GE 5A76A 3JSMA 2GC8A 4OL8A 5AE1A 2GZOA 3DFEA 3IRXB 2ZNYA 2ZBCA 2DCLA 1HARA 1TL5A 3KNGA 3W5XA 4OX9J 4Z37A 4NXNJ 2O3DA 5DGAA 2ZWOA 1YRUA 1IKVB 3NXZA 3R7SB 4Q5VA 4ZJOA 3AT1B 3T5KA 2M8DB 1N0UA 4UOGA 2JLFA 4PRFA 1ROFA 4LF8F 5ETTA 3GIMA 3MEEB 4M8LA 1FEEA 1JLGB 2UZAA 4LRFA 1N0VC 3PCOB 4U8YA 1Q7LB 5KFDA 2C2ZB 5D8HB 2YNFA 3MMCB 2ZBPA 5GMDA 2L3MA 4RNNA 3MMJA 2CZ9A 2VOPA 1HMVB 1FRXA 3MTJA 4TVAB 1JLQA 3EXCX 2BBEA 2GIQA 5HP1B 2HVIA 1G2EA 4Q45A 5GMEA 5LSOA 2CQHA 3DRSB 1U2FA 3H20A 4GC6A 4ED3A 1F5BA 4RU9A 3DMJB 3M32A 4PWDB 3GFYA 4IG0A 3ENAA 2B43A 3K58A 5F0UA 3A3PB 4C8YA 2K7KA 1Q8BA 2B4UA 2QLWA 3RAMA 5BR8J 4K4WA 4BC7A 3K89A 1ITPA 2OH2A 4CWBA 5DG8A 3UFCX 3LGMA 4QPTA 3QJPA 3BO4A 2FGOA 2OJ3A 5JUMA 3DGVA 2VHGA 2VV5A 2VASA 3U27A 2FQQB 4FYDA 1C0UB 3BYPA 1C1CB 2XI2A 4O3NA 4Q43A 1UCNA 1SH3A 5HSPA 2M70A 1TKTA 2NXEA 2WHOA 3UVJB 2HMIB 3LP1A 4KJIA 1ZTWA 2Y8WA 3RBDA 3L3CA 3EPGA 1WELA 4EEYA 1S5ZA 2XO6A 3NWGA 2E5LF 4OJ3A 1EARA 4EBCA 5ETQA 5HMYA 3L7UA 1PO6A 3C15B 3SCJE 4UQGA 4C8OA 1U2RA 4ZKAA 4R8UB 2VQFF 3CUNA 5A8KA 1XTZA 3BO2A 2WSEC 3EVMA 1S77D 4ZPVR 2OLWA 2XNQA 2H5JB 4JYAF 2RUSA 1TKDA 1S1WB 3T1YF 4LVNP 2Y8YA 2CKWA 3KFWX 4JI5F 3PRVA 2VG5B 2D74B 4Y6IA 4WYWA 1TK0A 1B0VA 4YB1P 1TL1A 1VHIA 2KRBA 3OVAA 5J2QB 1FX4A 1MNEA 3FK4A 3CW2C 3VR1A 5HQMA 1XN9A 1VRTB 5KFFA 2VFUA 4B3MF 5IOLA 4QIVA 4F3MA 1GQEA 1RT6A 1OIAA 2RS8A 1U24A 4C97A 2DH7A 2ZOGA 2VG7B 4Y2AA 1Q7YT 2E5IA 2R2RA 2ZUAA 4JV2A 1RAEB 2YKPA 2MEWA 3VF0B 2RVJA 4UTGA 3BV8A 1AT1B 2N82B 3BR8A 3TJAA 4USWA 4ZHRB 3WBZA 3OFEA 3IR5B 2I6WA 4FZVA 2KHCA 2MLYA 5L1IA 3NNAA 1F60B 2XMMA 3G71S 5H9EJ 1K47A 3RB0A 1NB7A 2QL9B 3KG1A 2G4BA 3RRHA 4RZRA 3M6VA 2ZH1A 3C46A 1KN6A 1HHTP 2E1CA 3LGNA 1WOPA 2F63A 4K2XA 1YLXA 2PMWA 4FBTA 1D09B 1DTTB 3HM9A 3N5BA 4FYYB 3MM8B 1NSAA 1YJTA 4NCAA 1AUSL 2F5GA 1RZMA 5LSLA 2OGUA 1WC1A 2MGZB 5HMWA 2B7BB 3QATA 1WHYA 5J1EA 5H1SV 2CDRB 1VRQC 4F26A 5D0RA 2IVYA 3OSNA 2F40A 2YKAA 3JYTB 3EM1A 3AA9A 1M1HA 1PBUA 1FD2A 3KLEA 1U25A 1CSJA 4U96A 2MQ8A 5D15A 2DPJA 5D4PA 5LXRA 6FDRA 3U1MA 1LOUA 3A12A 1WI6A 5D77A 2CNLB 2BANA 3PR4A 3J7ZT 1UEUA 3PHTA 4B3SF 4OYMA 2V4JA 1N5SA 2MZSA 3VAIA 1WOSA 4I69A 4RBTA 4WFBQ 1FKOB 3D0IE 1SBRA 3BKFA 1DLOA 5B0BA 2VF3A 4DSFA 5KFMA 1MMDA 2HS4A 4C2MA 2VFSA 4FS1A 3SMZA 2BW7A 3BZQA 3TAMB 1UJ4A 4CO4A 4IR1A 4YOEA 4TY9A 1VQYA 2W7AA 3QIDA 1IVZA 4WFZA 5HK4A 2JVRA 1PAUB 2NYIA 3O1LA 3M1VA 1FWKA 3OV7A 1VLYA 5K20B 4IOBA 2PMHA 4C6AA 4IKAA 4DV1J 3MAHA 3BREA 1NO8A 4ED4A 4IH6A 4LRBA 3HKZD 4C3LA 2KJWA 2DNMA 3NKYA 3W2VB 2OPSB 4IDKA 1NCLA 3G8QA 2DK2A 4QWEA 4OI0A 3M7VA 1ULRA 2DO0A 4X65F 3CJ8A 3PW5A 3GG0A 4XTTA 1N5VA 1ZBTA 4X66F 1HIYA 2JX2A 4ZCMA 1U1RA 3TI0A 2MKJA 3BPDA 1XMQF 2DGOA 2QC3A 2RQ4A 2RH3A 3HVTB 2HIYA 3MFHA 1IKYB 1VQ5S 3M2VA 2AP6A 2E7XA 4QR0A 2HK3A 2RU3A 1MROA 5EX3A 3RBXA 5HJXA 1HNXJ 3CCTA 3FCVA 1FRHA 1O51A 1NNDA 1EJ7L 2UVVA 1Q1KA 2F4VJ 3M2RB 1UEKA 3PW4A 1MMNA 4U6PA 1REVB 2HEKA 4ERDA 1S6UA 5AXLA 4TXSA 2DH8A 3FSYA 2E5HA 4ED5A 4DR3J 2WONA 2QX0A 3R97A 2QZ8A 3UDVA 5CXTA 1LFPA 3UD3P 3UR0A 1U0HB 4NYZA 1OY9A 4JI7J 3ZZTA 3HFVA 1ZM3A 4DV2F 3ET6A 2UUBJ 1XC9A 3I4PA 2YKMA 2NXNA 2EK6A 4KV8A 4EK2A 4QQBA 4KBIA 1S1UA 2IRYA 1PCAA 3FBBA 3AHPA 1CJVB 2HRYA 3M6XA 4DV0F 4F0MA 3X3UA 2HQ3A 4Q2LA 1WG4A 1G4CA 4LF7F 3FRZA 3CCVS 3R2CJ 2GIFA 5HN0A 3M8QB 2NSCA 2VZ9A 4FS2A 1SPBP 1O8BA 1YGYA 2JL9A 1HNVB 2V94A 3M30A 2UUAJ 4MFBB 2IAJA 2BJ9A 3EMTA 2E1AA 3D5MA 3HJFA 2D9PA 2MHNA 2PEHA 2Y0BB 4RUBA 4EZ6A 4LFCF 1UVJA 4OHWA 1HBMB 3S8SA 4X4PA 2XO7A 1BXNA 2DKOB 1CLFA 4DJBA 1YHQS 4LBPA 2ZVSA 2KVQE 2YQ1A 1Q8IA 4OYZA 3IR7B 3W66A 3R5CA 3HZGA 4PAAA 5DLGA 1URNA 4B3OA 1FJGJ 3EX7B 2F8EX 2UUCF 3IAM9 1U1OA 1UETA 1IKWA 3JS9A 1VBZA 3KTQA 1IBCB 4KSEB 2ABYA 5H9EK 2H5IB 1HBNA 4NCGB 4I6AA 3AAWB 5KFKA 1APSA 3R5AA 1S9EA 4XPCA 5GADI 1C2PA 1K0VA 1YI2S 1I94F 3CDUA 5SUHA 1M5SA 5DDOC 2MKHA 4K50A 1RAAB 2R7TA 5HL7Q 2FVSA 4B3TJ 1FTRA 1YJ9S 2R7QA 1VQOS 4P10A 1U7LA 2DH9A 3EZ5A 5KFNA 1MWYA 4DV5F 3BGOP 4P75A 1S4EA 3QT6A 3GV7B 1U4BA 3JAMU 4D3HA 4NA1A 2FHJA 3QWPA 1C0TB 2FJDB 3HHNB 1CC8A 3M8PB 4LQ3A 4NA3A 3CJSA 1RT4B 2R2UA 3T6BA 2KO1A 2LMIA 5H9FK 3DRXA 4RJVA 3BPSP 3IBWA 4CLSA 3W2WA 2GVDA 3SV4A 2VA2A 3ZZYA 2FY8A 2VBYA 1FRMA 1PYTA 4OZ2A 5HQ8A 4RPFA 2FJVA 3W65A 3RZAA 4YR3A 4DLEA 4HHUA 8ATCB 2ZJPQ 3V5RA 3I0RA 3LP2B 5IM0B 1PJ6A 2VB6A 3RB6A 2YNGB 4CLUA 1SJ3P 3CMQA 4TU7A 3SBMA 2RHQB 3DN9A 3NCPA 4PKDB 2NXUA 4DR2J 3V6DB 1KOOA 2HHQA 4EBDA 1R8BA 3R5DA 3QZ7A 2HPUA 1PAEX 1RAFB 1Y9OA 1RBLA 4KY3A 3VAHA 1XR6A 5GAHU 4CRJA 3L7PA 3T19A 2HVEA 3KHGA 1L3TA 3UNYA 2CVIA 3IBFB 1HQUB 1RAJA 1R43A 3AD9C 1F0XA 2MQPA 3RRKA 4TKTA 4H54A 2M3DA 4F50A 1R0AB 1NJIT 4ZVUB 1VIOA 2CQIA 2W8KA 4NLQA 3V4IA 2FDNA 3C6UB 4L76A 5I42A 1TVRA 1WKLA 4PWWA 4UW2A 3MR7A 4NI2B 4K5SA 2CWKA 1YTYA 3G2XA 2QLXA 4Y65A 2OIHA 5B0DA 3RTVA 2NCKL 3G82B 1ZA2B 1Y5IB 1S1VB 4J90A 2DIUA 1JNRB 1HI8A 2N7CA 1DARA 2FHKA 4WJBA 3EZOA 2HHXA 2ADBA 1NRKA 1KC8T 5J2MA 2J5AA 3IWLA 2CQGA 2CQPA 2CQ1A 4TLQA 2VL1A 1XMOF 4DEZA 3QGHA 3NS5A 3D1HA 2ZDPA 3N9UC 1M5VC 1S59A 2PN6A 4NA2A 4BBYA 4KIAA 2ZC4A 2E5GA 2AIRB 1NSPA 2E7WA 2IDLA 2BZ2A 2R8KA 5E3AA 4DR7J 1KHWA 3AB2B 1YBTA 1SJ1A 3IGVA 3L7OA 3MCMA 1FKPA 2XULA 3QIPB 2LYVA 4P2XA 2IVMA 4C8KA 3CD5A 2GMLA 2WOMB 2CPHA 3BGRA 3OTOJ 1FK9A 1T9VA 5F3TA 1HBOB 5KOWA 5CZVA 2B7CB 4HT7A 4K4TA 2GJIA 1NEEA 3BYRA 4DSIA 2AGPA 2IM2A 4WF9Q 4B9TA 1K9MT 4ATNA 5C2CA 4DQSA 3V81B 1Q95G 1SJ4P 4B9LA 3CWJA 3ZZUA 2IJFA 3LOUA 1P9YA 1Q82T 4KGXB 4KHRA 5GVQA 2DHSA 1KQFB 1D0EA 2AD9A 3AJDA 2G2ZA 2EFGA 3CNQP 1VIXA 2QMUB 2IPOB 2YPZA 4DR5J 2B4OA 5K9FA 3OUYA 2WW4A 1RHRB 4USVA 3OTCA 2QA4G 1IM4A 3PJXA 1WNEA 2KFNA 5G0RA 3E8OA 4LR9A 2YWHA 1F3VA 2IJNA 2VONA 3L95X 2R2TA 2BVZA 5JVGQ 2XBPA 4JB8B 4AQYF 2NPFA 1RTDA 2XGQA 3GIJA 4M5IA 3JXOA 1HR0F 2A0FB 2Z57B 5HVHA 4QOTA 4K4ZA 4ZK7M 1VQ6S 5KT3A 3CJTA 2MB0B 3CC7S 2M0GB 2HBYB 4FKXA 1U47A 4CQ1A 2JLGA 1U6ZA 2GW8A 1KWMA 3F41A 2VODA 3MM9A 4X64F 3F73A 3DLKB 2JNJA 4ANCA 4USJC 2UV8A 4UZCA 1RLCL 1TUWA 2I0XA 2XLIA 3AY0A 1S1XB 4DL0C 3R9LA 2ALYB 5JVHQ 1RKJA 1IBKF 2RB7A 4WK3A 4MYTA 2W9CB 4LF9J 3WZ0A 3OW2R 5E3CA 4DV7F 3GZ7A 1WC0A 1SV5B 1A6LA 3HSJA 2ROEA 3MMAB 3GJTB 4CLWA 2F8MA 5L1LA 1R8AA 2YQ0A 2ASYA 4G1QB 1CJTA 3SV3A 5CHCB 2ZEJA 4LVOP 1JKHB 2OEKA 1W26A 5BYRA 3D1OA 5F8MA 2HNDA 4ETZA 4JI1F 1MU2A 2Q43A 2IC3A 1S0VA 2MQOA 1EETA 1NJXA 3MTKA 1P9QC 5HBMB 1XQIA 2LFVA 1VISA 4LSLA 4ZCKA 2RMLA 3TEGA 2B5JA 3EGZA 2K2PA 3V6HA 1Y5LB 3FZ2A 2HFUA 3CULA 3MHYA 2ASLA 3GIIA 1NDKA 3HHEA 2A6OA 3IRXA 4A8KA 2MZRA 4Y2MA 2QMWA 1H72C 2RDJA 3MWBA 4OI1A 4LF2A 2B8QA 4WU3A 3BBCA 3EGVA 1HNZJ 2GJFA 1T05B 1GAOA 2W1BA 2DHGA 5KG6A 4J9NA 3CXCR 1IKVA 2IYIA 4URSA 1YJ7A 2QT7A 4JV5J 4F3QA 1ZM4A 4ZJLA 4PZVA 2EFNA 5KG4A 4LF4F 3MEEA 1JLGA 1N34J 3SZ2A 2CJAA 2OSQA 3Q89A 5D4NA 1H2UX 1R8CA 2RIJA 3CJKB 2GAGC 4HDGA 5HAOA 3BSOA 3MMCA 2BJ8A 4HR2A 2HFSA 1IR1A 1JLEB 4MKBA 2DNPA 4UY8T 4I64A 1HMVA 1E6VA 2LQJA 3TO8A 4GKKF 3DRYA 5HP1A 2BKNA 3JAMY 1DJ0A 2PI5A 3C16B 1ZETA 2J6SA 3MR2A 2R8GA 3DRSA 1IXKA 1Q81T 2BXJA 4C3MA 2HHHF 2FB0A 2OO4A 4M5JA 3DMJA 4JBCA 2VBWA 4PWDA 2V5HG 1N33F 3MM5B 2IM0A 3DGPB 3AXMA 3CCZA 2HFZA 3T1HF 1YDLA 1KTQA 2UXBF 1IBLF 4NASA 1C4CA 5F8HA 2A2CA 5KFOA 7AT1B 1YITS 2QJ3A 4G1IA 4FF2A 4JI0J 3SFGA 2C2MB 3PO5A 2CIMA 4FYXB 3TA0A 5KG2A 1M90T 3BN4A 1C0UA 2HG4A 2BOPA 5GAGU 3GYXB 1RP5A 1V9OA 2JH3A 4IFVB 1VQNS 4E8UA 1DBDA 4DR1J 5K8OA 2XTJP 4I2PB 5DZ7A 2HMIA 1QAIA 1N88A 1ZA1B 2GO9A 3TYTA 3M9OB 1TKTB 2ASJA 4QR2A 3OPKA 3RYLA 4X62F 2J8SA 2MKCA 1T0TV 5E33A 4LFAJ 1VYAA 3P5TL 3C15A 1SQFA 3M9MB 1XNRF 3NP5A 3H5YA 3PX4A 4R8UA 2VICA 2BJDA 4ED7A 1GK8A 4YB5A 3V2UC 1NLKL 4YB6A 1UJ5A 4AXIA 1SIWB 2FUG9 1NM2A 1S1WA 1NKEA 2V9KA 1OPZA 2VG5A 4P7VA 1TK5A 2KRRA 1NXIA 5AJ3J 2X1FA 2ATLA 5J2QA 4KB7A 3BJYA 4ZPBA 2XZDB 1SJRA 2CA9A 2M7SA 1ZM2A 3E51A 1HD0A 1TMMA 3U02A 1VRTA 4RW9B 4QW8A 3GCWP 1OS5A 2D3ZA 1U2CA 3HHLC 4ANEA 2R7XA 3HVAA 4ZPDA 2XY7A 3EVOA 1WEZA 2ZE2B 2O1PA 2VG7A 3GIKA 4KH0B 4NRUA 1UL3A 1U1LA 4MMOA 2R7RA 2VD3A 4NLSA 2ASDA 4ZVRB 3GJRB 2AX0A 3Q8YA 3ICLA 2XSJB 2IRUA 2XWYA 2DEIA 5ETSA 4OHZA 1S9FA 1KVIA 3CJ5A 3O44A 3R3TA 3KJVB 5HLFB 1UVNA 4ZHRA 2HSEB 2EFVA 3GV5B 1UA1A 3QLHB 2RSQA 1NJYA 1TU0B 4A8MP 3THVA 2YWWA 3LAKA 3NGKA 2V2VA 1NK4A 4C0BA 2PDAA 1BD6A 1LWXA 1WACA 1D9FA 1YJNS 3QMQA 4DQRA 3FBCA 3G87A 1DTTA 1FO1A 3MM8A 2UU9F 5L9XA 2V6AA 2F65A 2MGZA 2YNHB 4EU0A 1WF1A 3A8KA 1RLDA 5J1EB 3DI6B 3IM9A 3JYTA 3MAAB 4K0KF 1HHSA 3CPWR 2Z4PA 4O3OA 3EYZA 5C24B 1N32J 3H8YA 3PRBA 3G8SA 3OTBA 3RJMB 3BN7A 3LQVA 2OAUA 3CC4S 3SSRA 3TOQA 1AYEA 5L38A 4CO3A 2XLJA 2YVSA 3CC2S 2ZBQA 4NLWA 4F36A 1X9MA 2NYHA 3CJ0A 1S7IA 1U8SA 2G13A 1YKWA 4O4RA 3DOKB 3PV8A 4WPAA 4USKA 1C4AA 4JI8F 4LF8J 4NLPA 2WSCC 1FKOA 3P8BB 5C2GA 2SXLA 4QYZJ 3H5SA 2L9DA 4JI4J 5E0OA 3H4BA 1YRTA 2GNKA 5KFHA 2DRBA 1NZ8A 1U1NA 3TAMA 3IN5A 4OYXA 4TLRA 1RAHB 2WSFC 3R6GB 5T7LB 3CT9A 2L9WA 2GCFA 4PG4A 1T11A 1RHKB 2UVWA 2Y9HA 1ICEB 5K14B 4DX8H 4F04B 5BYQA 3GP9A 2WVDA 1NUEA 4FXVA 3AOCA 4CH1A 3OL7A 2VOOA 4WTOB 1MLAA 4NZ6A 2R7WA 4ECVA 4LJMA 4L72B 3THTA 3J7A1 2HWTA 2YKNB 3W2VA 2OPSA 1UAWA 4O0IA 2MSSA 5IS2A 1FERA 3IA0A 3I6PA 2CQ0A 2KFZA 2E7VA 4EO8A 2HQGA 1WORA 5F8GA 1K44A 3ETMA 4F8RA 3HVTA 1HNWF 1IKYA 3PIPQ 3H2LA 2DR8A 3K0JA 2A18A 2M5YA 4ZOSA 1MN9A 1UZHA 2ZUGA 3ZTRA 5A8WB 1AB8A 2FLPA 2DGTA 4DUYF 2X1GA 4DWIA 2D69A 3M2RA 4RNHA 3M8RA 1VBKA 3K5OA 3PXGa 4ECUA 4ZITA 5HMXA 4RNOA 1NK8A 2QYGA 4M5KA 3SCKE 2H51B 3IMQJ 3MPUB 1D9DA 4DPOA 1U0HA 4XDDA 2KM8B 3HHLD 1H7WA 3L09A 4DPYA 4YR0A 3ZZPA 3DLBA 2ZKTA 4PR6A 1T02A 3BKUA 3H5UA 3TR5A 3OSPA 3OQ2A 5F8IA 3N6NA 1OYDA 4U7UK 2I5JB 2AV5A 4B3MJ 1AFJA 1HI0P 1CJVA 4Z7YA 2WVFA 2D9OA 2H9ZA 4OX9F 5L39A 3VAJA 2QRRA 4DFKA 5U47A 4NXNF 3M8QA 3KNAA 2ZH3A 3G6YA 2LCWA 1JNZB 1PYOB 2XS2A 1HNVA 2QTWA 2XCAA 4LF5J 4MFBA 3RB3A 3Q2SC 4LFBJ 1NMEB 4DPWA 2FVPA 3L9ZA 3TZWA 3HSZA 3M30B 2JLEA 4EMDA 2DITA 3Q8QB 4DV3F 2GQCA 1ZTTA 4H4OB 4ILMA 3SSSA 2I38A 4LQ9A 2B4VA 4F4ZA 1PGZA 1HBMA 4ID8A 3VGVA 2V2KA 3W61A 2BE7D 3W7BA 2W9BB 3OL6A 3T9ZA 4ED8A 2GQQA 4O3SA 2L08A 3D66A 2JVOA 2CQ4A 1QUPA 1T9WA 2W7PA 4I4BA 1T9TA 1UTAA 4YHHJ 1NH8A 3KXDA 2GQ2A 4PG7A 4IR9A 2IMWP 3F0NA 5KFTA 3BKTA 2EVZA 4P72A 2RDIA 1T8EA 4BDPA 2M8HA 5KFAA 3O6QA 2CPJA 4OZLA 2OTJS 5EWGA 1TV6B 1SUQB 2LXIA 3NEKA 3RW6A 4NCGA 1LEOA 1PYSB 3W9JA 5DQGA 5T41A 3AOBA 4N76A 3MMBB 1QTNB 4F4YA 3AODA 1N5YB 2DR6A 3KUEA 3QZ8A 2W7OA 1LWEB 3GE9A 5ETNA 4QIFA 2OD6A 3RR7A 1VK8A 1XMBA 2Y3YA 2AEFA 1RB0A 3GTYX 1TELA 1X9WA 4OHYA 4RNMA 4ZVOB 1X0FA 4N47A 5KFZA 2CPFA 3QFWA 3LP0B 4F2SA 2B3TB 4B3SJ 4WZMA 3QO9B 2YNIB 2VBZA 1HNIB 1RBAA 3MXHP 3M8PA 5L8RC 2DEJA 2QMXA 2DR7A 4IFYB 3RAQA 1RT4A 3H98A 2WRMA 1GMUA 1EP4B 4NXMJ 1NHUA 2J7WA 5J2PB 1IKXB 4KTQA 3H5XA 4S0MA 2V4QA 5K8NA 2FJBB 2KYZA 2QFJA 1TFYA 4ZCIA 3LP2A 3M8YA 2DD8S 4DDFA 2Z2MA 5J1NA 4KHMA 4EBEA 1JWWA 5KFQA 2YNGA 2W2MP 1QM9A 3RUBL 3TARA 5KFUA 4Q8EA 2ZVIA 3IFEA 3MGJA 2XNRA 1S72S 4DL7A 2CPEA 1ZH5A 3V6DA 4IRDA 1FRJA 2AWZA 3GJQB 5IWAF 2M4MA 2VDHA 3FRYA 2GHPA 3QT7A 4DV4F 3T5HA 4EI2A 3IO1A 3JSBA 3FQLA 3D7SB 2O01C 4X66J 4FF3A 2PT0A 3CE8A 2DYAA 2QFIA 4FVCA 1NK6A 4NEYA 3ZXWA 1HWKA 2PE8A 1XMQJ 2E1PA 4URQU 5B0GA 2YQ3A 4DUZF 5KFJA 1HHQA 1LNQA 3PFEA 1EKRA 3SYZA 3HXMA 1R0AA 2BKPA 4OLOA 2IVFB 3HHDA 2C22A 4DL2A 1RBOB 4QR1A 4NZ7A 4BHQA 3C6UA 1P6TA 1NKCA 1QLNA 2JFDA 2JEJA 1UW4A 4TY8A 1RYRA 2Z56B 4NI2A 3TUIC 4OZ5A 2XG8A 4OV6A 4K4UA 5BYSA 1TVRB 3G82A 4RBUA 1SL0A 4NLVA 1S1VA 4W4MA 4IH7A 3NNHA 2HK2A 1SB6A 2CZVC 5KFGA 5A8RB 3PNIA 5A0YB 4MIBA 4F4KA 2CXEA 3D6FB 5E5NA 3SQOP 1M1GA 4DV2J 3UI3A 3DDIA 1X5SA 2R42A 4RBVA 5BJRA 3IAS9 1Q4RA 4X4VA 3I87A 1IM6A 3H90A 1S6PB 1WC3A 1Q78A 2FZGB 4HYKA 4D3GA 3GSDA 2VG6B 3S1TA 2CQCA 1TL3B 3W5ZA 5KT7A 2EFQA 2G1DA 2RAQA 3CF5Q 2BRKA 2PC6A 2K06A 2CWXA 3QIPA 2V2QA 4F0KA 1R3NA 2J6TA 2WOMA 5GAEU 3WIUA 4RR5A 1X4BA 3FCHA 1JJ4A 1HBOA 3BS9A 4ID5A 2MLZA 1WF0A 1DY3A 1S12A 3NGUA 4GKJJ 1CQNA 1X4DA 1U1QA 4ZLLA 2ZD1A 3ITHB 2R7SA 3O3LA 3V81A 4WP8A 2PGCA 1Q0NA 1ZAVA 3R2DJ 3DYAB 1JX4A 1VI7A 2BE2B 1MW7A 2QL7B 5CH7B 1ZM9A 1NK5A 2HBZB 5HVGA 3TWZA 3MCSA 3BGLA 4M63A 2XCPA 4FXDA 8RUCA 1BC6A 3NLCA 3NAIA 1RTJA 2GX8A 3ZTOA 1CJKB 1SCJB 3RBEA 2Y0SD 1WJ9A 1PC4A 1PJ7A 3WDOA 1WHVA 3UN5A 4XAKA 4J37A 4AT1B 3JQKA 5HROB 4U7UD 3MOZA 3JSYA 2MXYA 5G0RB 3MCNA 1X4CA 5GADU 3M2UB 3OHAA 2R4FA 1KQSR 1ZZFA 4N7TA 3WQPA 5KG5A 1TL7B 4M5DB 2JJ4D 3CJ3A 4ZN1A 1I94J 4CIOA 1H38A 3N5FA 3OJUA 4K8RA 5D4LA 3A8IA 4DR6F 2AU0A 3DLKA 5KOXA 4LUBA 3IM8A 2DNYA 5KFVA 4ED0A 3GIRA 3EDQB 4J5OA 3LTOA 2BJ3A 2VPWB 3M9NB 3I31A 1WEYA 1S1XA 3J80Y 3DU6A 3DU5A 5ITHA 2W9CA 1HNXF 1Y4ZB 1SV5A 1UPPA 4QZVB 3PYFA 3MMAA 1YJWS 2QN6B 3PACA 2F4VF 5K5MA 4G1QA 1YJUA 1X0PA 1JK9B 3JTPA 1JKHA 4DI6A 1HL6A 5ETLA 2HS0A 2N3OA 1RACB 5B0FA 2UXCJ 2Z2YB 3MZIA 3QRPA 1SH2A 2HQIA 4C7QA 1N36J 4CLTA 3G86A 4O3PA 3C14B 4JI7F 5HBMA 1U6BA 1GH8A 2R7VA 1OO0B 1EB0A 2UUBF 2NR0A 3SCLE 4M94A 2YY3A 1NPKA 2YBVA 2J7UA 2HHTA 1N5QA 1K8AT 2XI3A 3FSXA 3FEYB 3HF5A 4USHA 3DC2A 4P6QA 2FLLA 4A46A 2CUYA 4ZP7A 4PWUA 2P2CB 2RQKA 3ENWA 5T14A 1ZPWX 3MECB 3KLFB 5LOQA 2BR0A 1S57A 1FF2A 1T05A 3CB4A 5B7WA 4GMKA 3HX9A 1Z1ZA 3PVXA 2UUAF 4IYQA 1UMJA 4O3RA 1YVFA 3LH2S 2RNEA 4I68A 4NLXA 2J9CA 4ZIWA 1YWXA 4RUHA 1RISA 1N52B 4M5LA 1DHMA 2F1FA 3CJKA 6AT1B 2ZH4A 2OP5A 4K7QA 4KR0B 3QT5A 1KEKA 4Z7CA 1JLEA 1T9UA 2KT5A 4OJHA 1V5IB 4GRSA 2YPYA 4I1TA 3LO3A 4CM2A 1KONA 2H54B 3C16A 2W4DA 4RW4B 1E6VB 1RKIA 4C8MA 1FJGF 1EIYB 1GXUA 1U45A 3J7YI 1X7VA 1URRA 5F8NA 3EPIA 3MM5A 5CD4H 3DGPA 2Y1JA 4DQIA 3CJQA 2BQUA 4PUOB 2AKWB 3EXYA 4OI6A 5MAOA 4DSLA 2D7SA 3MDFA 2XHCA 4C9DA 4FPRA 4HTIA 5IT4A 2KXNB 1XMOJ 4XPEA 1A9NB 1N56A 3AQOA 1M5HA 5C5JA 3KJFB 5F8LA 2VBXA 1LW2B 2BJ1A 2YTCA 1U49A 1BE4A 1FDNA 4IFVA 1RHJB 4MKYA 3EE3A 4HDHA 4ZLJA 3VGSA 4I2PA 2XYGB 3NOCA 2RKIB 3FFIB 2QLJB
chains in the Genus database with same CATH topology
5E3CA 2A2DA 1HQEA 4DV7F 3GZ7A 4ETXA 3G6XA 3CCRS 1VHFA 3ZZ0A 1SV5B 3R1HA 3QAUA 2UVRA 1A6LA 1Q79A 1N34F 1S49A 2WW8A 3H59A 2VKRA 3HP6A 2IA6A 3QYYA 2ROEA 4DQQA 5DM7Q 2FHOB 3MMAB 3HVRA 1HWUA 1OWXA 2YKQA 1T94A 1YBAA 1NKBA 2F8MA 5L1LA 3T9NA 2LDYA 1R8AA 4YR2A 4W90B 3AB4B 2F9JA 2ASYA 4HKQA 1MMLA 3V4IB 5IZHA 3RRGA 3D54A 1VQMS 1WWHA 4MJKA 5I42B 4G1QB 4K59A 1U48A 2KT3A 3SI8A 3SV3A 3HO1A 2NSBA 3NRBA 4LVOP 5CHCB 1SKWA 1JKHB 2J9DE 2FGCA 4Y00A 4Y2IA 3KK2B 2GGPA 4EFAC 4ALZA 3KK1A 5EGYA 2IA0A 5BYRA 2KN4A 3D1OA 3OL9A 5F8MA 2HNDA 4F4WA 4ETZA 1G6BA 5KAKA 1VQPS 4JI1F 3VZHA 3J7YU 4DR4F 1MU2A 1VQLS 5B0AA 1KTVA 3FEXB 2Q43A 5E2QA 2IC3A 1KD1T 2CDQA 2HNZA 2HLTA 2IBOA 4DN9A 1SKRA 5L9NA 1S0VA 4ZVGA 1EETA 2MQOA 3MTKA 2J76E 1P9QC 3PX0A 1NJXA 5HBMB 4Y2CA 1FVQA 2MQMA 4PG6A 3UCGA 1VBXA 2B9XA 5DDRC 3MM6A 2DISA 2KFYA 4ECQA 1X5OA 4LSLA 4ZCKA 4AL7A 2RMLA 1S0MA 1NK0A 2E9ZA 1RWUA 5J2NB 3G96A 4RUCA 4WK1A 4IO1A 4K4YA 2B5JA 4RW9A 5E7OB 1NU4A 5J2MB 3EGZA 4TYAA 2K2PA 2HIQA 1FDDA 3GG1A 3V6HA 3H2UB 3CD7A 1T95A 1Y5LB 5DLFA 2KZMA 3FZ2A 3MI7X 3CULA 3MHYA 1G7CB 2WBMA 1V6HA 2ASLA 5FLXY 3GIIA 2RS2A 4FP9A 3HHEA 3VAFA 2P6SA 4X4OA 3D1QA 3IRXA 1TK8A 2KU7A 3KLIB 4MTPA 3BF4A 2J0XA 4I6WA 2LQ9A 4B9MA 2ZE2A 3OXGA 4A8KA 2MZRA 4Y2MA 3N0VA 3OVBA 4RW8B 2Q6CA 4R5PA 2HGNA 2WK4A 5L1JA 4ELUA 2QMWA 1D9AA 3B8HA 3PHEA 5LT5A 1RT2A 1VQKS 3RW7A 2RDJA 3MWBA 3AH6A 4ZS6A 4OI1A 2XLKA 2LKZA 1J2VA 1TL4A 3SSQA 3TW0A 5DGBA 1KLMB 4U7CA 3DNCA 3THPA 1HBUB 4WU3A 1JLCB 2XMTA 3DRRB 1T05B 3ISNC 1NHVA 1GAOA 3K2YA 2J0WA 4NMLA 5CCMA 1DQ9A 2DHGA 5KG6A 5GAHI 4J9NA 3BEGB 2LXUA 3CXCR 4H4KA 4U9RA 2E66A 1FKPB 2M2BA 3PZPA 1IKVA 2IYIA 2XSJA 2ZBIA 4URSA 3S6EA 4OHVA 2QT7A 3CDBA 4HH1A 5GAGI 2LECA 3RAXA 1F5CA 2ZKUA 4I2QA 2JC1A 4DR1F 5EUHA 3BGRB 3KKFA 2R8JA 1FK9B 2MSTA 3K7RA 4F3QA 1ZM4A 3C8YA 2DTJA 3KJVA 3I0SB 2ZHAA 2HWIA 5HLFA 1QAYA 4URGA 1X4HA 1X4GA 2EFNA 3KWMA 4B02A 3E2EA 5KG4A 4LF4F 2YX7A 2RILA 5FDLB 3I82A 3QLHA 3OL8A 3MEEA 1S6OA 4WXOA 4UUWA 1JLGA 3IS9B 4LT6A 2FIUA 3SZ2A 2CJAA 2OSQA 2DNKA 4NYOA 5FJ4A 5D4NA 1H2UX 1R8CA 4ILRA 2RIJA 4OI2A 4BCAA 4EGLA 1M5PC 4Y34A 3CJKB 2NQPA 1K1QA 4HDGA 4B9VA 1NAQA 4OX7A 2FJWA 3NCRA 1FRLA 2U1AA 2BQRA 4J9KA 3BSOA 1VGYA 3MMCA 5D4OA 3N28A 2RF2A 4X4RA 3G8TA 5DQHA 4DL5A 2KB2A 2OKQA 1KVJA 2WAQD 3BDPA 1JLEB 2ACYA 2JSXA 4MKBA 1FKAF 1FVSA 2DNPA 2UXCF 1BGXT 1S6QA 2V8DA 4I64A 1HMVA 2KKHA 4UY8T 1RT1A 3DLGB 3NCQA 3SQGB 4BS2A 4FVMA 1E6VA 2N7YA 1P8GA 2CPYA 2LQJA 3TO8A 4C98A 1C1BA 3O2IA 3P3DA 1N36F 4GKKF 3DRYA 5LSRA 5HP1A 3JAMY 1QY7A 1DJ0A 4DMZA 5LJ5Y 1B0TA 4KT0C 2GIRA 3GV8B 4PXDA 2PI5A 3BR9A 7FD1A 2Z8QA 3SDEB 3KHHA 2R9LA 1ZETA 3UD4P 5KT4A 3FJ2A 1O0PA 1J5OB 3MR2A 2J6SA 1KRPA 3DRSA 3R1LA 3OUYB 2R8GA 4LIWA 1IXKA 1FA0A 1Q81T 1FJ7A 4JOUA 1M0SA 2BXJA 5F9NA 2CPDA 3GMGA 4C3MA 3MUTP 2HHHF 4F4XA 1HFEL 5KT6A 1XBWA 3TA2A 2FB0A 4AXJA 2OO4A 2DNGA 4A8FA 5I4MA 2J9EA 3CSKA 1R89A 3K8WA 3DMJA 4JBCA 2EI5A 2VBWA 3JB9k 2BRLA 2W25A 4PWDA 2YNHA 2B56A 4DF4A 3MPWA 3CD6S 1M5KC 2HZCA 2KI2A 2GMHA 2ZH6A 4RLEA 2V5HG 3TP2A 1JLFB 2EBEA 3MM5B 1N33F 2IM0A 2X3GA 3C6TB 5KG7A 3CCZA 5MLCV 4NX9A 1HW9A 3DI6A 3HKWA 5DS7A 4ZMMA 5DM6Q 2HFZA 3JTNA 4LMZA 3T1HF 3KLHA 3KYLA 4CTAB 1KTQA 2UXBF 3DOLA 1IBLF 2AGOA 5LMNF 1CEZA 2JHEA 3PKMA 1RTDB 2ZZNA 3Q23A 1JLAA 1R8PA 1C4CA 3I55S 3SXLA 4WKRA 5F8HA 1SL2A 5CCLA 4RKUC 1S9GA 2HNYA 5F3ZA 5C24A 2VKZG 3DCAA 4QCLA 1QE1B 2A2CA 5KFOA 2ZM6F 2IYGA 3PEJA 4I0WA 1YITS 3IR6B 2OMOA 2VQEF 4G1IA 4FF2A 4WXWA 3DOMA 3KMSA 3CVKA 3SFGA 2W4CA 1RI7A 1CPZA 3GR1A 5JJBA 1VC5A 5THWA 3PO5A 1CVJA 2EG1A 2CIMA 1DQ8A 2JC0A 2RRNA 1HA1A 5CYMA 5AE3A 3IGNA 3TA0A 1V3SA 1BY9A 5KG2A 4F3OA 1P1LA 2HLUA 3GFXA 2MKKA 4DG1B 2RRBA 2ZH2A 4YQWA 1H7XA 1M90T 4DR7F 3BN4A 1C0UA 2HG4A 4KRWA 4KE5A 4JI6F 3VCDA 2BOPA 2EC0A 5GAGU 1AFIA 1UVIA 3MM9B 3ULHA 3KK3A 1L5UA 4ECRA 3GYXB 1RP5A 1V9OA 4KO0B 1RK8A 2AJFE 2FC9A 5H9FJ 2IM1A 1QAJA 4RW6A 1KQGB 3OTOF 4ECWA 2JH3A 2AYMA 2X51A 4IFVB 3E01B 3X1LB 1RT7A 2RT3A 3FNNA 3GWCA 1VQNS 4NLTA 4E8UA 1DBDA 3V4MA 2FTRA 5K8OA 3J7Z5 1L3UA 5K8MA 4MAKA 4KPYA 4I2PB 1FXDA 3DOKA 2HMIA 1QAIA 1N88A 4PQAA 3MOJB 2UP1A 3ISZA 2NUHA 1VRUB 2GO9A 3POTA 3OTDA 4RW7A 2HFOA 3TYTA 2VPYB 3S01A 1U1KA 4H4KC 3M9OB 1HQEB 1TKTB 2R8IA 2BJEA 2MZQA 3WC2A 5L1KA 4N77A 3M6UA 2ASJA 3IRWP 4QR2A 1X9SA 1OSDA 3IC1A 2Q1LA 2DGXA 3OPKA 4WE1A 3RYLA 3PIOQ 3FMBA 3CMES 2XHWA 5DETA 4X62F 2OSRA 2YWEA 4MK8A 4F67A 2OPRA 2MKCA 5E33A 4MIAA 1LQ9A 2AGQA 2MQNA 3P5TL 4FBUA 1RT5A 2HRUA 3M9MB 1XNRF 4FNHA 2AW0A 3NP5A 5T7LA 3H5YA 3H2VE 4R8UA 5AXNA 3PX4A 1GT8A 2XMKA 2GFFA 3BM7A 4A47A 1XR7A 4FNIA 2P6TA 4YDDB 3TA1A 2BJDA 4A8QA 2B9WA 4ED7A 2GGPB 2LDIA 4YB5A 3V2UC 4YB6A 1UJ5A 2ZH5A 2HNDB 4AXIA 1SIWB 2Q3PA 2LA6A 4OI3A 5KFYA 2FUG9 3BQ2A 1MU2B 1S1WA 1NKEA 3KLVA 3V6JA 4MIWA 3O8WA 4XK8C 5K14A 4X4UA 1D3WA 4NLYA 2BM1A 2IC3B 2HNZB 2V9KA 2ILYA 1OPZA 3ZZRA 3VAMA 1WTBA 2VC1A 2AYEA 1Y7PA 3IWNC 2D41A 2VG5A 3OXLA 4P7VA 2CRLA 1EETB 1FRKA 1KR4A 4YDXA 3N4WA 1TK5A 5KG0A 5DG9A 3T5JA 1Z4UA 2KRRA 1HI1A 2X1FA 4F2RA 3MM6B 3VTIA 4BWJA 2QSFA 2LQBA 1IN0A 2UVUA 4ZPWR 1ZZNA 4NLOA 3LF0A 2EWHA 3GB0A 5J2QA 4KB7A 3BJYA 2ATLA 4ZPBA 1Q86T 4LSLB 1SJRA 2XMJA 3MFIA 2M7SA 2PI4A 1ZM2A 1FNMA 3E51A 5IT9Y 1HD0A 2QO3A 4QU6A 1HWIA 3U02A 5HMZA 2E1MC 2IFXA 4OFZA 1VRTA 1Q16B 2B5JB 2YKNA 4RW9B 4HEA9 3BO3A 4QW8A 2OPQA 1PSDA 2CPXA 3KLIA 1OS5A 2D3ZA 4PQUA 2H5EA 3HI9A 1WHWA 5BR8F 1K0TA 3D0GE 4J9SA 3JSMA 2GC8A 4OL8A 5AE1A 4DOZA 3HHLC 2R7XA 3DFEA 3HVAA 4ZPDA 3SEOA 3IRXB 1H98A 2ZNYA 1KLMA 2XY7A 2ZBCA 2DCLA 4CO2A 1HARA 1F2GA 1WEZA 2ZE2B 1HW8A 3D2WA 4IUFA 4R5PB 4RWWA 4C8LA 1JXEA 1WF2A 2COLA 1R8HA 1TL5A 1DFDA 5B09A 2O1PA 1RT2B 2PO4A 2VG7A 3KNGA 3NGDA 1VMBA 4GC7A 1VFJA 4M95A 3GIKA 1RYSA 1TKXA 4NRUA 1Y5NB 1UL3A 1U1LA 4MMOA 2FJAB 2QYCA 4Z37A 2R7RA 4DN0A 1AUDA 2VD3A 4NLSA 2ASDA 1TP7A 1X5TA 2DNQA 2I9SA 3Q24A 3ENQA 2XY5A 2MZTA 1WG5A 2O3DA 5DGAA 1VJWA 2IRXA 2AX0A 1RA6A 5D3GA 2N4CA 5E41A 2OMLA 3ICLA 1YRUA 1IKVB 2XSJB 3B82A 4OZ1A 2GJ2A 4Q5VA 2KT2A 2IRUA 3MD3A 3T5KA 2XWYA 2M8DB 4I2QB 2V9WA 1YJVA 4LF9F 3CCWA 1TKZA 1N0UA 2FVCA 4KGMA 4OHZA 4HTJA 1S9FA 2JLFA 4PRFA 1KVIA 3CJ5A 3O44A 1ROFA 3R3TA 5D6GA 3HHKA 3KJVB 4LF8F 5HLFB 1UVNA 1QUVA 1UVKA 4A4JA 4ZHRA 4NCBA 2DRAA 3F56A 4AE5A 2EFVA 3HMJG 3U1LA 3G4SS 3NBPA 3TNVA 5A8WA 3GV5B 4W92B 4C3KA 1UA1A 3QLHB 3GIMA 2HYIB 3MEEB 2FVQA 2RSQA 2YX1A 1FEEA 1JLGB 1AROP 2CPZA 2UZAA 4M8LA 1NJYA 1N0VC 2DNOA 4A8MP 3THVA 1S99A 2Z0GA 4ZP9A 2M9KA 2KZZA 1Q7LB 5KFDA 3TANA 2BM0A 4OZ0A 3LAKA 3NGKA 4WU2A 5D8HB 3PDNA 2YNFA 1NK4A 3MMCB 2L3MA 1X4FA 4C0BA 3WC0A 2PDAA 4RNNA 4TN2A 3KG4A 3MMJA 2FC8A 3OLAA 1UKUA 1S6QB 4HL9A 2XWXA 3G9CA 1HMVB 2VOPA 1BD6A 2HW3A 2HHWA 1RT1B 4O4GA 1FRXA 3OR1A 1B7FA 3MTJA 1JLBA 1JLQA 3T5LA 3BSAA 1WACA 1C1BB 3EXCX 2BBEA 4P7TA 1YJNS 2GIQA 1D9FA 5HP1B 2HVIA 1G2EA 3QMQA 5DRKA 4RUAA 4DQRA 4Q45A 1WEXA 3AA8A 5LSOA 1DTTA 2CQHA 5DDPC 4H4MA 1FO1A 3DRSB 1U2FA 3MM8A 2UU9F 3Q0AA 5L9XA 3H20A 3Q22A 4GC6A 1H3DA 1YRXA 3BSCA 3R27A 4CT9A 4ED3A 3QGGA 2MGZA 2MY7A 1F5BA 4ECYA 4IO9Q 4B9SA 2XGPA 4RU9A 3DMJB 2WB4A 1Q8LA 3M32A 4PWDB 3GFYA 1Y3KA 2YNHB 4IG0A 4EU0A 2B43A 5DQIA 3K58A 2ZZMA 1ZYQA 1WF1A 5F0UA 2Q79A 4QIWD 2MKIA 4X4QA 5J1EB 3DI6B 3OBIA 5B0EA 4I67A 3TVZA 3JYTA 2I5JA 3KLGA 4C8YA 3KLHB 2K7KA 3MAQA 1Q8BA 2B4UA 1FEHA 3ISND 4K0KF 2QLWA 3DOLB 1HHSA 3CPWR 2Z4PA 2LEAA 3RAMA 4O3OA 3LAMA 4K4WA 4BC7A 4C4WA 3Q2TC 5KFEA 3EYZA 2OH2A 1S9GB 2HNYB 4HI2A 1YIJS 1SIZA 5C24B 5DG8A 3UFCX 3LGMA 3H8YA 1GTHA 4QPTA 3PRBA 1GXLA 3G8SA 3QJPA 3OTBA 3BN7A 3LQVA 3BO4A 2FGOA 2OAUA 2OJ3A 3CGIA 4DBQA 3CC4S 2KDOA 3NMRA 3SSRA 1XWLA 5JUMA 5EDWA 3TOQA 1HNZF 1V3RA 4PPDA 5CYMB 2YWFA 4JV0A 2NS1B 4IOCQ 2P9GA 3CDAA 5L38A 2R7UA 5E3RA 4CO3A 2VV5A 2K7JA 2MKSA 2VASA 2CPIA 2XSFA 3U27A 2VA3A 4Y2KA 2DPIA 4Q2MA 1BQXA 2XLJA 4FYDA 1C0UB 2YVSA 3DLHA 1IQZA 2FY1A 3CC2S 2GA7A 3KK3B 1C1CB 4NLWA 1W2IA 3PW7A 4J9PA 1X9MA 2XI2A 1FT8A 4RW6B 4KFBA 2I8EA 4YY3F 1P27B 2RQMA 3CJ0A 4O3NA 1RT7B 4Q43A 1U8SA 1SH3A 2G13A 1KQKA 2B0GA 5DDQC 4NLGA 2AJ1A 4O4RA 5LJ3Y 3HDSA 1XERA 2M70A 1TKTA 2WHOA 3DOKB 3PV8A 2HMIB 3LP1A 1C4AA