4X62F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 27
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4x62F00
5IWAF 1VMBA 4DV7F 2F4VF 1B64A 2B7CB 1XMOF 4B3MF 4LF5F 2UU9F 4DR2F 3R3TA 4B3TF 4JI4F 1LOUA 4LF9F 4DV2F 4DR5F 1FJGF 4DR1F 4YY3F 4X65F 4K0KF 1N34F 2ZM6F 2HHHF 1G7CB 1GH8A 4DV0F 1F60B 4B3RF 2KJWA 4DV1F 1N36F 4DV5F 4LFAF 2UXDF 4YHHF 4JV5F 2VQFF 5LMNF 1J5EF 1CQMA 4LFCF 4AQYF 4DV3F 4GKKF 1XNRF 2UXBF 1HNZF 4DR3F 2BXJA 1IBKF 2UUAF 4DR4F 2VQEF 1CQNA 4LF7F 1I94F 4DUYF 2E5LF 4JI6F 3OTOF 1HR0F 4DUZF 2UUCF 5BR8F 3ZZPA 1HNXF 4X66F 4KHPF 4JI8F 2J5AA 2BVZA 4JI1F 4LFBF 5AJ3F 4JI2F 4JI7F 4OX9F 1N32F 4GKJF 4JYAF 1XMQF 5LMUF 4DR6F 4NXNF 2RJZA 4X64F 3T1HF 4JI3F 1RISA 1IBMF 1XNQF 4LF6F 1FKAF 2YY3A 2B7BB 2UXCF 1IJEB 4JI0F 1N33F 4JI5F 2KJVA 4LF8F 4DV6F 2UUBF 1IBLF 1QJHA 1HNWF 4DV4F 4NXMF 4LF4F 1IJFB 3T1YF 4DR7F 1G1XA 4B3SF 4X62F
chains in the Genus database with same CATH superfamily
1FD8A 3IFEA 2D3OR 1PCAA 2CQ3A 1R8HA 1B0PA 2DYAA 2MSSA 3G8QA 2RDJA 2MJNA 1KKHA 1RB0A 3W7BA 1N5SA 3H5YA 2HRUA 2G1DA 3I6PA 4FYXB 1KHWA 3BQ2A 2DO0A 4PQUA 4F4ZA 2O66A 4DV2F 4DFMA 3NMAA 4RNNA 3FBCA 3V6DB 1URNA 1TAUA 3BGFA 2DY9A 8ATCB 2ASJA 4ZVTB 5L8RC 1VQ8S 1GH8A 2K8GA 1JJ2R 2GW8A 5DDPC 2VH7A 1Q78A 2OPPB 3CD7A 4NLUA 3R1HA 1T03B 2XMUA 4WF9Q 4RW4A 2KFZA 2EFGA 4KGZB 3MM6B 4WYWA 3MTJA 3MEKA 2JEFA 1QVGR 4NOHA 1H0HB 1EKSA 4B9MA 4USTA 1VISA 1PC5A 1R8CA 3GR0A 4CO1A 3M8YA 3KK3B 3Q2TC 1RWUA 3JYTA 1YJTA 4JV5F 1S5ZA 1S49A 1S76D 3QAEA 3HSGA 4RNHA 5LMNF 5F3ZA 3EDQB 2CJAA 2O5DA 4QQBA 4C3KA 3X1LB 1IKWA 3FCVA 3LWMA 3PO4A 2OEJA 4KGXB 3JTNA 2JRSA 2UUAF 1I94J 5K14B 1M0SA 1JLEA 4XK8C 4CTAB 5IS2A 1WC3A 5J2PA 1U2FA 1RTJA 3GYGA 4WU3A 1Y10A 2FZKB 3NCRA 4QW8A 5IWAJ 3R5BA 4YDXA 4ED0A 4OZNA 2E5LF 1RAOA 2VV5A 4PQAA 4CZCA 2OKQA 1KQSR 1GMUA 2WOMB 2YX4A 2ZNZA 3ZZ0A 2J7KA 5L9XA 1W25A 3AT1B 4OI4A 3H2VE 3PX6A 5GAGI 2Z56B 1OO0B 2LDYA 3CDAA 2N3OA 3OTCA 4P2MA 3TAQA 1P1TA 1W7WA 4CLUA 3PVXA 4NZ7A 1XNRJ 4D3HA 1WKKA 1WF2A 2CYYA 3GV8B 3HHLC 2R7TA 2VIHA 1BMQB 1S7IA 4I64A 1YITS 3A3OB 4DL5A 1LXNA 1I5OB 4FYWB 1IQZA 3CD6S 4YB1P 4JI3J 1RZMA 2GO8A 4OYWA 4RBTA 4DV0J 3DC2A 1IM6A 2HLUA 3OLBA 3M1VA 4P7VA 1NK7A 1YLXA 1HBUB 2BABA 1BWVA 4HH0A 2RH3A 2OHDA 2QO3A 4ZPDA 1C1CB 2OUGA 4ZPWR 5HBMB 3T1HF 1HKAA 3I9V9 1UJ5A 1Z2LA 1LW2A 2PA8D 2G4BA 1FJ7A 1VIXA 3BEGB 2IYIA 1FDDA 5KFVA 2G2OA 2GVZA 3VAJA 1KTVA 1LWFB 2WAQD 3RB3A 2WVEA 1CG2A 2GJIA 2KHDA 2QEXS 2UVVA 2F1FA 3PV8A 3CF5Q 1TL7B 1JLBA 4OHWA 4L3NA 2LECA 4WE1A 3CD5A 2MY8A 2EK6A 2Q1LA 1TTHB 5IOLA 3ZZZA 3GB0A 2UUBJ 2BE2A 1FO1A 3TAPA 3RAQA 1T05B 2R7XA 5DZ6A 2P6SA 1FRHA 3D4JA 4EO8A 2AYBA 1NRKA 3EX7B 1OPIA 4J9SA 4BWMA 3BB5A 3ADAC 1U7LA 4JI5J 4ES3A 2ZWOA 3OD2A 4FVMA 4MFBA 3W9IA 3RGIA 1HI8A 2V2VA 3I5CA 4WJBA 4ZIVA 3VF0B 5IM0B 1UVLA 1NCLA 2GAHC 1TL4A 1VHFA 2V0NA 4HVZA 1GT8A 1XBWA 3VQSA 3CCES 2CIMA 4X4TA 4FKYA 3V6HA 2AWZA 1FXDA 3IM8A 2U2FA 3MM9A 2GHVC 5KFUA 1F9FA 4L73A 2R4FA 1UAWA 1JXVA 3EZOA 2YNHB 5KFPA 1B70B 3JTOA 3CJKA 3SIPB 2BQ3A 2ZNYA 3DM2A 3VR1A 4DL0C 1SJRA 3V4IB 4KJIA 4Y2MA 2OPRB 2DKOB 4F67A 1DRZA 4LF5F 5F8LA 2XLIA 2ADBA 1NK8A 2FZCB 1BD6A 3C6UB 2V2KA 2CQGA 4FBTA 1SCJB 1FF2A 2IA0A 4URSA 3M2VA 4I56A 3KUGA 4FZVA 4LIWA 2M8DB 2PN6A 1FJGF 3QZ8A 1X5PA 4LVNP 3WHIA 3SYZA 4EUVA 1Y3JA 3NWGA 5ETLA 2E9RX 3T41A 2MKJA 2O67A 1R43A 3A1YG 3CE8A 3I4PA 2M52A 1YGYA 2YWKA 3MF5A 5M2UA 1KEKA 5KFWA 2ZM6F 2DNQA 1SUQA 1U09A 4UOFA 1W2BR 3C46A 1IBLJ 1QAJA 2QSFA 2OGUA 5KT7A 2A2CA 4O3RA 3CDBA 2ZC4A 3H42A 5A0YB 2PDAA 2OLWA 4OJ1A 3D5MA 3HVWA 1JLAB 4H4KC 2YH0A 3KJFB 1Y00A 5D4OA 4CQ1A 3S8SA 4V1Ak 2ZH1A 1UVMA 3RJMB 3VVTA 5CQGA 4WWSA 3MURP 1F6TA 4TY8B 5KFMA 3MDFA 1RXOB 4U67Q 1LNQA 3MMCB 5HVHA 4Z7YA 5J1PA 3NNAA 2HVHA 1ZM4A 5B08A 4NYZA 3DRSA 4C7QA 5CAAA 1KP6A 2B9WA 5CA5A 1KVIA 3VGTA 5HP1A 2NXEA 4WFYA 4GKKF 2RU3A 3QPIA 3DLGA 2MYFA 3OXFA 4ZOSA 5JXSA 5KOWA 2ZVSA 2V9KA 1L3UA 1S6UA 3DMJA 4DR3F 2MZTA 1RWVB 1T0TV 3TEHB 4OZLA 3DOLB 3HD1A 4QU7A 4JI7J 1HHSA 1CEZA 4DUTA 1GX6A 1UCNA 4PG5A 4ED7A 2V94A 3QIPA 4DSIA 1UVNA 1G3OA 1UKUA 2KDOA 3TWZA 2XZTB 4OI6A 1SJ3P 1VLOA 2IM1A 4IH7A 3CIZA 3QWUA 3UDEA 3MECA 4YDDB 5GAEU 2VL1A 5EX0A 1IVZA 1VRTA 1K0TA 2WSCC 4QIGA 1WDTA 4NLVA 2YKQA 2AHOB 5MAOA 4B3TJ 4USIA 3SQGA 1BUXA 2DGVA 2H5JB 3DRRB 1NH8A 4JI4J 1XMBA 4ES1A 2E7WA 2V9WA 1XMQF 2NXJA 1DY3A 3M8PB 2HK3A 1Q95G 2FYXA 1Y5IB 4MKVA 1KVJA 1YJUA 3ZXWA 1SL1A 4NXNF 1HBNB 4J9NA 2OH2A 3EZUA 2JZ5A 4TNOA 1FNOA 3U02A 2W9BB 1BGXT 4AQYJ 2OJ3A 3W8GA 2WVFA 3IM9A 1RWPB 2P2CB 3TA1A 3UDVA 4HYKA 1FKAF 2DIUA 2KI2A 3JQMA 2DGSA 4YB7A 3WC0A 4ZCMA 3HPOA 1KONA 1TFYA 3I87A 2UXCF 2LU2A 1HNZF 4ZVPB 4H4OA 4S0MA 5DDQC 4LREA 1FJGJ 3QGGA 1NDPA 3GCWP 1VK8A 3PW7A 1N6QB 1BQMB 3PFOA 3BDPA 2JFDA 3ETOA 2KN4A 1T9XA 7AT1B 1JWWA 2BKNA 5GMEA 3D3CJ 3FSIA 4MT1A 3Q89A 4USJC 1DTQB 4DV6F 1TQLA 4QR1A 4K4UA 2R8HA 1SC6A 3C16A 2J6SA 3QT5A 1W26A 1UEVA 1TKXB 2GX8A 2EXUA 5AE1A 2FLNA 4WK3A 4LF4F 5BYSA 1RABB 2Z4PA 3HX9A 4Y2AA 3UWTA 5D0RA 4A47A 2X1AA 1L3KA 2ZH6A 3UCZP 1SJFA 3IWNC 1HBNA 4N8OA 1FWLA 2VBXA 4AL7A 3QLHA 2UUTA 4C6AA 2KH9A 4H54A 4IO9Q 3BR9A 5IWAF 3PKYA 3IG1B 2HZVA 3TOQA 3GP9A 1DARA 1SJ1A 1RDRA 4TU9A 4DUZJ 1NXIA 3Q24A 1KOHA 2G0CA 4TQSA 4QWEA 1CSJA 1ZZFA 2FD2A 4KV8B 1IBCB 2R8IA 1RUSA 1CPZA 1HW8A 1KRPA 2RQKA 3DOMB 5CYMB 5T41A 3TAMB 4U8VA 2R8KA 5U47A 3HT3A 4QCLA 3PRDA 4ZP8A 3B82A 3TQEA 4XPEA 3KDOA 4JV5J 4DN0A 4X64J 3NWRA 1SH3A 1HFEL 4LQ3A 1YBAA 3W2VA 3V5RA 4CIOA 1QDUB 4ZKAA 4WFXA 2NCKL 1XIQA 3M8RA 1UP1A 3GLJA 2OSQA 1TL5A 2KB2A 2CQPA 3GYXB 4MIAA 2GQ2A 2GIRA 3CCJS 1D09B 5DLGA 2IDEA 2ZD1B 4DSLA 3IS9A 2BJ3A 4NCGA 3A8JA 4AUKA 4CO5A 4NLXA 3CC2S 4ECYA 2JC1A 4UY8T 1WELA 1C0UA 1UZDA 1U25A 2YWGA 4MKAA 4TVAB 3J80Y 3HHLB 3G86A 4FF3A 3OJUA 3IG1A 2QRRA 4LR8A 3NS5A 4OYAA 1TL1B 3QT8A 4OJHA 4KTQA 1TKTB 4IUFA 4O3SA 2Z8QA 5HI7A 2VBWA 3AQOA 1ZA2B 2CPXA 3ITHA 3TZYA 1NDKA 2WB4A 3VHQA 1XNRF 2E1CA 3PIPQ 3DLBA 1KNZA 2UXDJ 1MLAA 4LF7F 1H73A 1XERA 2VOOA 1M5OC 3UO0A 1SQGA 2AEMA 2GCFA 1NBEB 1JJCB 2AJFE 2HHXA 2LKZA 1FDNA 3E01A 5E3RA 4HT7A 2D1CA 1RT6A 2Z58B 1ICEB 4PUOB 2HHTA 4YFUA 4QIFA 5CD4A 4IR1A 2QLWA 1LFPA 4G65A 1UWAA 2PI4A 1NPRA 2KL8A 3QT6A 2HGMA 3ZZRA 4PWDA 3RBDA 1J27A 3E51A 2CDRB 2I8EA 1YDLA 2CQ1A 3EGWB 2C42A 4OJGA 1CULA 3ZTRA 1S0MA 5THWA 4DBQA 1RAEB 1U0HA 4IH5A 4L3KA 4IFYB 2D69A 2FQQB 3C6TB 3Q8YA 4HI1A 2MKSA 4CT8A 1RTIB 1TV6A 1UVKA 3HKWA 1CJUB 3QBCA 1CVJA 2X3GA 3TA0A 4Q43A 2JNJA 2M0GB 3GYNA 4BHQA 3HZGA 3ISZA 3HVTA 4DPOA 2DHXA 4AT1B 3L9ZA 3ISND 3GV7B 2HNYB 2OO4A 2X7IA 3QQCD 2FJDB 3TZWA 2YY3A 3UD5A 4DF4A 1HW9A 3KFWX 1X4HA 5J2QB 4WIQA 3HK2A 2RF2B 2VFRA 2DRBA 3GIJA 1EX8A 4DPUA 3FEZA 4LF4J 2M8HA 3BF4A 3O1LA 2XG8A 5KFNA 4ED8A 3H7HB 2VFSA 3EPIA 2ZE2B 2ZVIA 3IR6B 3LGNA 3QAUA 4CLSA 3RAXA 1EP4B 1P9YA 3KJVB 1U1KA 5JUMA 4JI6J 1BQNA 2IVFB 1RTDB 3P49B 4TYAA 1UEKA 2ZJPQ 1C2PA 1HHQA 2XB2D 3W8PA 4HEA9 4DG1A 2YX7A 2KT2A 3LH2S 1DLOB 3LP0A 2PMWA 4X66J 1LWXA 5IV3A 1ELOA 4M5HA 4P6QA 5K8NA 3TW0A 2FC8A 3HZEA 1O51A 3HFVA 3M05A 2HK2A 4PXCA 3HVTB 2D9OA 2OPSB 3LW5C 4J91A 4O4RA 5D8HB 1QE1A 3DYAA 3VAGA 2DR9A 1B99A 1PAUB 1NZAA 2BKPA 2NLWA 2MQOA 3CD0A 2XSJB 5CYQA 2VD3A 5A6PA 2LFVA 5KFRA 3I56S 2HKEA 2NR0A 1OWXA 2MHNA 3L4BC 1RJJA 2AD9A 1T7PA 5F8JA 3FUYA 3IRWP 5L9NA 2MSTA 2ZJQQ 2NUHA 2L9NA 4TU7A 1RA7A 2MXYA 2ZBIA 1NU4A 1FKPB 3BPSP 5LM7E 5AJ3J 2QFJA 4LF9F 3KLHB 2HZAA 2IJNA 4WXWA 1M1KT 3QFHA 1U1QA 4WZQA 3UNGC 2QMUB 4F2RA 4EI2A 2AEJA 5J1NA 4PG8A 2BJ7A 3TO8A 3JSMA 2JC0A 3EVOA 4HLBA 2HHHF 2ZEJA 1MNEA 2EW9A 4I7FA 2WBMA 1JJHA 2VPYB 3BZQA 4ZPAA 4ER8A 2LA4A 3PR5B 1JLEB 4QWAA 2J9DA 4O44B 3VZHA 1D9DA 4MIBA 3PJXA 1WACA 2X1GA 4CNZA 5KAKA 4C8YA 3FCHA 3MHYA 4LMZA 5HJXA 2CZVC 1S77D 2XC9A 3VCDA 2E9TA 3CCZA 3HDSA 2O3DA 3P5BP 4HACA 4OZ3A 2CQBA 1S1XB 4ZPCA 1IM4A 3CCQS 1JLQA 2GMHA 5DRKA 2ATLA 2RNEA 5KOXA 2EK1A 2DY1A 4USUA 3W64A 4P9SA 2YXLA 2G9OA 1SQEA 1C1BB 1S9GA 3M8PA 1NEEA 1WI8A 4K7QA 2UZAA 3F41A 3D0HE 3GJTB 3QGHA 1VIOA 3A3NB 4LSLB 2OFGX 5C24A 2W9BA 3KJQB 4DLEA 1ITPA 3MPYA 2CPJA 2YWWA 4AD6A 4A8WA 2Y1LB 1VJQA 1RAGB 3ICLA 1RAIB 2UUWA 3K5LA 5DETA 9RUBA 4I0WA 2G2ZA 3BSOA 2HMIB 1K9MT 2CVIA 3T1YJ 4QPTA 4MJKA 4X4VA 1PKUA 2OI2A 3EM1A 4DPWA 1AUDA 4C8OA 4B9TA 5A8WA 4AL5A 1OMSA 2YTCA 4FF1A 1S6QB 3V6JA 2E5JA 2R8GA 5DQIA 3POTA 3EGVA 4U6PA 4CH0S 1NK4A 1HQEB 1TL3A 2ILYA 2L9WA 3EGNA 3KNGA 5IQQA 4WU2A 3WZ0A 5I42A 4JI7F 1T9YA 4K2JA 3AFGA 1FRLA 1TELA 1JLQB 3C66A 5LOQA 4WE1B 2XYGB 4GVBA 2E1MC 5A8RB 4O0NA 2C22A 5B7WA 3KLEA 3W63A 4IDKB 2FVCA 3IAS9 4B17A 2W8LA 4JI3F 3D1OA 3KXDA 4MYUA 2K3KA 5B0EA 2CQ2A 4QIEA 3SSSA 3T1AA 1NB2A 3G6VA 2QYGA 5C24B 2AGQA 3PFEA 1O5JA 3BN7A 2IAJB 3NOCA 1F3VA 5CD4H 3R6GB 1GAOA 1TMJA 3EDRB 5D77A 2KJVA 3DCAA 2YNHA 1FX2A 4I4BA 5T7LB 2C28A 2ALZA 3GQCA 1HWLA 2Z57B 3G8SA 1Q86T 5FDLA 3TI0A 2NQPA 2QMWA 3TAMA 4EGLA 3D3BJ 5DG7A 2R7WA 3HHLD 3W9HA 4Q0BB 2W7AA 1B7FA 2BMBA 4IOBA 4E0DA 4ZITA 1GTEA 1U02A 4KT0C 1UL3A 4OYBA 5F8GA 2Z2ZA 1ZTWA 1S9FA 3AXKA 2BBEA 3HFKA 3U1MA 5AXLA 3G82B 5HMWA 1ZM2A 2VUGA 3MAQA 2ZH8A 3MMBB 1Y7PA 2ZZNA 1VMBA 4DV7F 4DX6A 1RBAA 1UVJA 1OQ6A 3JSYA 1C0UB 4I2QB 1YJ9S 3AH6A 2W4DA 2E1RA 2PO4A 2EI5A 5AT1B 3UFCX 2ASLA 2MJUA 1NJYA 2GZOA 4EBDA 1NKEA 1N54B 1HD0A 2U1AA 4DU8A 1NK0A 3JQJA 2XHCA 3CCSS 1RHRB 3MM8A 3S01A 2Z2LA 2QA2A 7FDRA 3BV8A 3D1HA 3CULA 4K4WA 3AD8C 2D3ZA 2VG5B 5GAEI 5DQHA 2CQIA 2W4CA 1NMEB 1N34F 3I4HX 4IH6A 5EDWA 3H25A 2R7UA 4YB5A 2HBZB 1KTQA 4KB7A 2RB7A 4OHVA 4LRCA 2KZMA 2V8GA 1ZTTA 4OZ1A 3MD3A 3KOAA 5HANA 4RNMA 2C3YA 3V81A 5C2CA 2GIFA 4P2FA 2CUYA 2DK2A 3OUYB 2V34A 2W1BA 1C4CA 3FGVA 1RA6A 3KLVA 4U96A 1HWKA 2DT9A 3DI6A 5CABA 4K50A 2RRBA 4KH1B 4I69A 2B5JA 1T9TA 1IKYB 3F44A 2CQHA 5I4MA 2CQCA 2FTRA 4I2PB 1RT5B 3PJ9A 2I6WA 1WHXA 3CSKA 3IBWA 1K8AT 1J5EF 4DJBA 1UFLA 3U7JA 1EB0A 2OTLS 5ETSA 1U1LA 3M6UA 2HWIA 2LXIA 3I31A 3MEGB 2W24A 1U1PA 1TKDA 3EWGA 1CQNA 3NS7B 1U24A 2BX6A 1TZ0A 2UV8G 2NPFA 4Y6IA 1QUPA 4DL2A 2DPJA 2LEPA 4ENOA 1YIJS 3AJ1A 5SUHA 1UFKA 1SH0A 4ZCKA 2RRNA 2CFXA 4ZVQB 2DH9A 1HLWA 3GJSB 1MN7A 3W62A 2APOA 5KFEA 4Q2MA 2B9EA 3SI8A 1X9MA 5BR8F 3N28A 2HW3A 1FERA 3N5FA 5K9FA 3L7UA 5JMNA 3MCOA 1D8ZA 3R5DA 3V6DA 2Q3PA 3NS6A 4KGKA 2ABYA 2KT5A 2MKIA 2RILA 2NYHA 1RAHB 5IT0A 4UZBA 2C2DA 4OZ2A 4PABA 4BLGA 1NSAA 1N4LA 2ZDPA 3L09A 5EUHA 4A8MP 1EP4A 4URGA 2VKZG 4ZVRB 5KFDA 4NMLA 3J81U 2BYCA 4F36A 1QTNB 2VFVA 4DFJA 5F41A 4G1QB 2MQLA 1YI2S 4C3LA 3A8KA 2NSBA 3UPFA 2QLJB 2F63A 2M2BA 3MEGA 4OYZA 2Q6BA 4LRDA 5GMKa 2P5VA 1X5TA 3FEYB 2YKAA 4KKOA 3T3FA 1X9WA 3LPEA 4GKKJ 1PJ7A 2QLBB 2DR8A 2VPWB 2GAGC 2IDLA 2OFHX 3OSPA 4F7VA 5B0AA 5K14A 5C25B 3R1LA 1LW0A 1ROFA 4JUZA 5A8KA 3HHKA 3I0SA 1KOOA 5G0RA 4F0HA 4YUDA 2FHJD 3B4MA 4JBCA 3I9ZA 1PC4A 3UDCA 1DURA 4XPCA 2WOMA 1TR0A 3MCMA 1NPPA 4RL1A 3MR7A 1RWOB 1RU1A 5B0CA 2PMHA 4LF8F 2IFXA 3ZNUA 4DS5A 3Q8QB 2FB0A 5L1IA 2QN6B 3G4SS 4MAKA 4KYZA 4NXMF 4OI0A 1IJFB 4KV8A 4U7CA 4K4TA 2AYEA 4C3MA 4FVCA 3F56A 2FHKA 1M5PC 4QPXA 1PILA 2V4QA 2OIHA 5LMNJ 2A0FB 1CBKA 2OELA 3VGSA 1MMLA 3AJDA 3K57A 3D9BA 2QYCA 2H1YA 3GIKA 4RW6B 3RB6A 1S1WA 4J9UE 2E66A 3VZIA 2WSEC 4A8KA 3R5GA 4OZ5A 4O44A 3AD9C 2F3JA 3NXZA 5G0RB 2JSXA 2B56A 2QLXA 2MZSA 1O0PA 2EFVA 2XMVA 5IC4B 4DCJB 3KHHA 4KRWA 5FLXY 4DZ6A 4OX9J 1PJ6A 3AD7C 1G6BA 4HACB 3NNCA 2WVCA 1LOUA 1XEZA 2BE9B 3CJTA 5ETRA 2Y1IA 3OR1B 1TAQA 2AMCB 3N4WA 2OSRA 5KFQA 3G96A 3RAMA 3RYLA 4YHHJ 4NE9C 4NLYA 3GMGA 1X0PA 2Y9HA 1TKZA 1T3OA 1GMWD 2EBGA 2J0SD 2WW8A 1X4EA 4I68A 1FRXA 1JNRB 1MROB 3PX0A 1B0VA 3FK4A 3PYDA 5GVQA 1F60B 1NHVA 1FHTA 4LSLA 3FVYA 5EHHA 2HURA 1FRMA 2DR7A 1NPKA 1R31A 1RT1A 1AA1B 5M2PA 1MWYA 4PKDB 2WW4A 3E01B 3FZBA 4I6WA 3HI9A 2ILZA 4PG6A 2XO7A 2XY6A 3DDIA 3SZ2A 4PYDA 5HROA 2ZOFA 2RD5C 1KSPA 2D41A 5AXNA 4DV3J 3O8WA 1HNIA 1CJTA 4TU8A 3BGLA 2YWEA 4NMXA 5H9FK 2AV5A 4ITSA 1E6VA 1WF0A 4F3MA 1RT7B 2BACA 1Q7LB 2CADA 1JIHA 3OR1A 3TJ9A 3W66A 1FK9A 4GVBB 5A8RA 5J2NB 3KWMA 2XWXA 4EFAC 5GADU 4QWCA 2RQCA 2BRKA 5D3GB 1N5YA 1TUVA 4RW9B 3C6TA 3IGNA 1VFJA 4NEYA 1MROA 2DXDA 4CLTA 5K8OA 2XCPA 1XQIA 4ZK7M 2EG1A 1SI9A 3MPDA 2XGPA 4Z2XA 3VAMA 4ED1A 5B0FA 2MY7A 3M2VB 1WG1A 4YR0A 1SUQB 2P9CA 4L72B 3G71S 5ETVA 5AXMA 2CJBA 3RW6A 1HPZB 1S99A 4JI8F 2X1FA 4NXMJ 3OL9A 4B9SA 6FDRA 2AT1B 2CNKB 3K5PA 1JLAA 4OX7A 4O3OA 1BHNA 4IOAQ 3DLKA 2HIYA 2DRAA 2ALYB 5KTQA 3CCTA 3SCIE 5A0YA 2KM8C 2OPQB 1UW4A 2YNIB 4ANEA 2J9CA 3MFIA 4ZCLA 3R9LA 3O5TB 1RT7A 1SV5A 3CJ2A 1EZZB 1K1SA 1KQGB 2D9PA 3PM9A 3L7PA 5CZVA 3CMES 1YKWA 3PCOB 2LYVA 4NZ6A 1N5YB 3GIRA 1MWQA 3MWBA 3Q0AA 5E41A 3WX8A 2CQ4A 2MTLA 1IR1A 3UDLA 2BR0A 2VF3A 2BJ8A 1YJVA 3KK3A 5DDRC 4P2SA 3KYLA 1IR2A 1Q8IA 2O01C 2OEKA 4KFBB 1UETA 3GWCA 3M8QA 1Q8KA 1F0XA 3BGUA 3PHTA 1F3FA 4ID8A 5KFSA 3DYAB 4CM0A 5LJ5Y 2N82B 5E0OA 2MEWA 1OQ3A 3LPYA 3RTVA 2B8QA 2VBYA 4ZVFA 2GNKA 3IBFB 4E8UA 4R5PB 4NCBA 4HHUA 2VOPA 2KTQA 3H2LA 4CTAA 1RADB 1HWJA 1TUGB 4TY9A 4DV4F 3RRKA 2JDJA 3KK1A 4C97A 2R2SA 2M3DA 1LKZA 3GFXA 2UUAJ 4ILMA 2KXFA 4H4KA 2LVWA 2UUCJ 4CO2A 3HLUA 4WP9A 1VC6A 1FNMA 4NRTA 3JAMY 4B3SF 1S57A 3KUEA 2FIUA 4ANDA 2JOQA 3HF5A 1IUJA 5HSPA 4X4PA 2GGPA 2I1RA 2HVIA 3D6HB 2MKHA 2VDIA 3NGUA 1RCOB 4R0EA 4USKA 1RP5A 2GFFA 2DXFA 3C2PA 3QGIA 1B64A 3TVKA 1FX4A 2A6MA 1S6OA 2HQCA 1H74A 2UU9F 5KT3A 4DR2F 2MZQA 1RT4B 3BH6B 2F40A 4I2PA 4LRBA 3CDUA 2DNKA 3IRXB 3IR7B 4O3NA 4F50A 1KN6A 2GS8A 2C2ZB 1NLKL 2CG4A 3N0VA 4KQZA 1FRJA 1R0CB 3MM6A 3B8HA 2MGZA 4IRKA 2RQ4A 4OYIA 4K8RA 4DN9A 3ENVA 2J6TA 5CCLA 1S1XA 1NM2A 1H2UX 3H98A 5DS7A 1RWMB 4X4QA 4DV0F 2GVZB 4CNYA 1NHUA 3TR5A 4R0JA 2HQDA 3JYTB 1Q0NA 3N6MA 2R7QA 2YNFB 4NLSA 5F9LA 5GAHI 2HS0A 3GIIA 4C2MA 3M2UB 1RQ0A 2QA4G 1M90T 1VQYA 4CWBA 1U1MA 1FA0A 3E8OA 2IJFA 2H4YB 3JSRA 2GGPB 2K1RB 2HQFA 3I32A 4FS2A 2RE1A 1X5OA 2BE2B 3I55S 1T05A 5HMXA 3WC2A 1DBDA 3K0JA 3H20A 4NLWA 5KG4A 2XI3A 2CNNB 4OI2A 3TUPA 3Q8PB 1Q16B 2M5YA 3AJ2A 4O3PA 4W90B 2ZOGA 3HSZA 1S12A 5B0BA 3QNWB 1C0TB 1EARA 2VB6A 1S6QA 1U0SA 3NAIA 3AY0A 3OFHA 4OJ3A 5HROB 1M1GA 4Y3CA 2HBRB 4CYUB 4M5KA 5I3QA 4DV6J 5D4PA 1AZSA 1DQ8A 3GZ7A 1HL6A 3CCLS 2A10A 4FPIA 2XYHB 3V4IA 4LFBJ 3DOMA 2I9SA 2CDQA 3MR2A 3CC4S 1E6YA 1LW0B 1X5SA 2E5GA 3WIUA 4EYIB 3OSNA 5FD1A 1YZ6A 3T5KA 1K47A 4IG3A 3THPA 3OXGA 1R8BA 2HIQA 3CT9A 2C3OA 3D28A 4ELVA 1APSA 4EZ6A 2JH3A 5F8MA 3MMAB 2HAFA 4ZLLA 3EUNA 1SKSA 2DGWA 1WC4A 2COLA 4NI2B 3IP0A 3ZFVA 5CH7B 3GIMA 2W9CB 3DLLQ 4NLDA 1ZA1B 3BO2A 2B4UA 3PIOQ 2PD1A 3Q22A 4DR6F 5H9EJ 5E3CA 3P4UB 5ETPA 3LUYA 4KHMA 4M5IA 3CJ8A 3UVJA 3WBZA 3KJNB 6FD1A 4DL4A 3RRGA 4QBUA 4IKAA 2QFIA 3W5YA 3BSAA 2GQQA 2IMOA 2XMTA 1EIYB 3EGZA 2EC0A 7FD1A 3ET6A 4ED3A 2AF6A 1RKIA 3CIMA 1RTZA 3NGKA 2J0QD 3MR5A 3IBCB 1S0VA 2IY5B 2E44A 3HHNB 2HBQB 1XR7A 4OYXA 1JLGA 5D0HA 1PJ5A 5IV4A 3LAKA 5T14A 3MFHA 2FVQA 4C98A 3QO9B 2KT3A 4IG3B 4JV0A 1XTZA 1ZAVA 1DJ0A 4ZVSB 5IM0A 3OTOJ 3MMAA 3FZ2A 3Q8UA 5E3PA 3TJAA 4B02A 1VS3A 1WHWA 3OFEA 3R27A 2KZZA 1Y5NB 3OTBA 3KLGB 1VQOS 3IA0A 2Q66A 1UPPA 2W9CA 2NZCA 2W9AA 3MZIA 5KG7A 4X4RA 1TK8A 1VQ6S 4DR3J 2QV6A 5F8IA 2C3UA 4N47A 3W65A 2K3IA 2XNRA 3K59A 4DR7F 3FBFA 1EAYC 3OBIA 3R8YA 1DAXA 2PEHA 2V6AA 4M94A 1RTIA 1RI7A 3OV7A 1SVDA 1OSCA 4DS4A 3ZTOA 3OL6A 4RU9A 4F02A 2YNGA 2ZC3A 3IC1A 4IFYA 3HFZB 3TUJC 1HQ2A 3CGIA 4ECWA 1KR4A 3SDEA 3GJRB 2VICA 2FUG9 3Q8RB 2I2YA 4M5LA 3ILOA 2MLYA 3CCUS 4YQWA 3GV5B 1WTFA 1T3NA 2MKYA 3V81B 3K89A 2DNZA 3I5BA 5J2QA 1JJ4A 1FVQA 1LWEA 2DCUB 1M5SA 2W2PP 2H51B 1VRQC 1SIZA 4O23A 4JI4F 4EO6A 2EG2A 2HNYA 2V2QA 1V5VA 3M6VA 4ZP7A 2AX1A 3FJ2A 3ENQA 1EQ0A 2MLXA 2VONA 1WNEA 4RBUA 3JB9k 2E5HA 1VCTA 1FE0A 1GFWB 2PEBA 2RF2A 2OPPA 2DBBA 5FLXU 4BBYA 1FK9B 1XMQJ 1VLYA 3W5ZA 4N5SA 1FEEA 2DR5A 2RKIA 4X4NA 4RW9A 3H8YA 3K5MA 4ATNA 2DGOA 4QWDA 3KJVA 2VKRA 4KGVB 5HP1B 4DR6J 1SIWB 2CJQA 3A4TA 4USVA 4DV5F 4FXWA 1LV5A 4DG1B 3OR2B 1N34J 3OL8A 4F3OA 3DMJB 4YHHF 1LFWA 4MK9A 4LSZB 4LF1A 1HR0J 3TEGA 2A1BA 5K8MA 3QFWA 2XSJA 2C2RA 3OPKA 1F9EB 2BJ9A 2QL9B 2VHGA 2ZUAA 2MQPA 2FVSA 4JI8J 1JLCB 3MPVA 4GO5X 2RSQA 1CJVA 2MZ1A 3ETMA 2Y0BB 2A6OA 1JXLA 1HMVA 4M5JA 4RBVA 3TNVA 2FJVA 2E1AA 3MECB 4JI6F 3OTOF 3MAAB 3DHXA 3JSBA 4WFNQ 2EFNA 3DRPA 2HYIB 3F0NA 3UCGA 1JLFA 1RLCL 1VI7A 5ETOA 5DDOC 5DQGA 1MG7A 2G2YA 4X66F 4J9QA 3G9CA 3CTRA 4DFPA 3IAM9 2NZ4A 2J5AA 1LK7A 2HFVA 2CJXB 3KHLA 4J9KA 4KFBA 5HN0A 5KFCA 3FFIA 3H90A 1WSVA 1QLNA 2KU7A 2MMYA 5J2MB 3HO1A 3EXYA 4M63A 3GILA 2CJ9A 5KG1A 2CPZA 3SCJE 4DPYA 2ZUGA 5G4DA 1RAAB 5F3TA 1S10A 4DL6A 4U7UD 2G1HA 5GMDA 3NGRA 4W98A 1ACMB 3M30B 1J2VA 2IMWP 1VGYA 4RJVA 1N6QA 3BGRA 2EC2A 2IC3B 3IWLA 1UA0A 3N01A 1H6KX 1V3ZA 3MAAA 3UR0A 1JLBB 2B7BB 3BR8A 4OQJA 4P74A 1REVA 2VFTA 4DQRA 4Q8EA 4OI1A 3PG9A 2ROEA 3W2WB 2HVZA 2KKHA 5B0GA 1TK5A 2FGOA 1CJKA 1HNVA 1RAFB 4YB6A 1SL2A 2L3MA 4FYVB 3CMAS 3CUNA 1V3RA 1RAJA 1WI6A 3Q83A 3CJ0A 4JB8B 3CJ4A 4OFZA 2ZH9A 4IRCA 2D74B 2ZH3A 3TVYA 1XMOJ 2CJKA 1ZPWX 2J76E 3B4DA 1MWZA 2XZWA 2EFPA 3K2YA 3PRBA 4IQXA 1UA1A 1U6ZA 2Q43A 2MGZB 1I3OB 5KG2A 5I3UB 4JP8A 1OY6A 2DHSA 2F5GA 3MM9B 3M9MB 2JEGA 1T9VA 3CCRS 1Q81T 3BH7B 3HT0A 3GE9A 1KWMA 2F65A 4I1TA 2JWNA 3K58A 4FPRA 3D1QA 2LP4A 3KLEB 2NXNA 2HLTA 5I42B 4ED4A 1Q8LA 1FI4A 1YJRA 2OPRA 3TA2A 3MUVP 1RYRA 3NNHA 3ZTQA 1N5QA 1CULB 2J7UA 2B6AB 2KG0A 4DV7J 2DNLA 3W2WA 3KG0A 4N76A 3NY0A 2LU1A 5ETKA 2BW7A 3FRYA 1RT2A 4IDKA 1DQ9A 3A8IA 4PR6A 4ZJLA 2ZBRA 3MR3A 4QJVA 1RT1B 1T9WA 1NNDA 1REGX 2H5IB 4YY3F 5KT6A 2BOPA 4OLOA 2RIJA 2W2OP 3LGMA 3MPUB 8RUCA 4HL9A 5L1LA 1G1XA 1HNIB 1Q1KA 2Y1RI 2ZKUA 3A13A 4UUXA 4X4OA 2PE8A 4P10A 1VQ5S 4ZJQA 1YX2A 2AGOA 4MKBA 1Y5LB 3PTWA 4DR2J 2ZITA 4QWBA 5GAGU 4RWWA 3VAIA 3THVA 2XHWA 2LQ8A 3MAHA 4M5GA 4QIWD 2KJWA 4EEYA 1RSCA 1KQKA 2HAIA 2ZHAA 2RUSA 1U45A 2EFOA 2HFNA 1FTRA 1S1VA 2XEXA 3MM5B 4LFAF 4DX7A 1HNZJ 1YQHA 4CH1A 4Q5VA 1HBMA 1MMDA 1PYTA 3U27A 1GXLA 1Y11A 1NJWA 1YRXA 1FT8A 4LBHA 5K8PA 1J5OB 1PBUA 1YZ7A 2VJUA 1HPZA 1RHMB 3A3PB 3HCXA 4P72A 4J9RA 2C2NA 2YKNB 2KXNB 1ZYQA 1CC7A 2CPDA 3AB4B 3P8BB 2D7SA 3GSIA 3HSJA 1I94F 1GQEA 2BJDA 3KMSA 3TANA 1IKVA 4LBPA 1CLFA 4XO0A 1JNZB 1N0VC 2QJ3A 5IC6B 4LT6A 2E5LJ 4UQGA 5DM7Q 1BLUA 5E33A 3V2UC 3D2WA 4JI1J 4MTPA 1V9OA 4ZA1A 4LIRA 2VQEJ 1F5CA 1NAQA 1VRTB 2BANB 2P9EA 3M7VA 5M2RA 4DDFA 2AW0A 5BR8J 1TVRB 1YTYA 2Z30B 1IR0A 2IBOA 3TQ1A 5K5MA 4A8QA 2KG1A 2AQ4A 4DSEA 5C42A 5HQMA 2OMOA 4B3OB 4EBEA 1IBMJ 1JKHA 4ERDA 1HBMB 1SPBP 1VC5A 2B51A 4ED2A 3CVKA 5HATA 2WONB 2R8JA 1WG4A 3NMRA 3BKTA 5LSOA 1NB7A 3PW5A 3T6BA 3W9JA 1JQGA 3QIDA 3LTOA 2EBEA 1RU2A 4CCHA 4RR5A 4NEZA 1XNQF 2DNMA 1ZZNA 3OVBA 3KLIB 1FWKA 2KFNA 4K5SA 1S1UB 4F4AA 2ZBQA 4H4OB 2DEIA 1B7YB 4R8UA 4DL7A 4PXDA 1WKJA 2ZFHA 4HHJA 3SEOA 3ZZTA 4ETXA 3VALA 4OX6A 1X9SA 1RWWB 4UQTA 5E3AA 3FNNA 1DLOA 3M32B 3SDEB 5HJYA 2V8DA 3ZTSA 4HHHA 3MPWA 5L1JA 3PX4A 3DKDA 1R7IA 3D0GE 2UUBF 1RTHB 4B9LA 3TUIC 2E9ZA 5F9NA 2NUUG 1C1BA 1S9GB 3C3LA 5KG5A 1HNWF 3RB4A 2FVPA 3R6LB 2HVDA 2YKMA 1SXLA 3K8VA 2LA6A 4RW8B 5KFIA 2NREA 2Y3YA 3SCKE 2WHOA 2R2RA 2M4MA 1VK3A 4CLLA 1Y3KA 3IRXA 3TJ8A 1VQ7S 2DRDA 3LP2A 3FKBA 4M8LA 3W1YC 4DL3A 2HFZA 1NH7A 5BYRA 2IA6A 5I3PA 3UD3P 4IQMA 2ZDOA 1VQ9S 1PYOB 1GMWA 3QRPA 2FPHX 4XIUA 2HHUA 3KKFA 3KK2B 1HQEA 1TL3B 2FHOB 2IRUA 1B4SA 3QWPA 3R3TA 5KFLA 2RS2A 2F8HA 4B3SJ 1MSWD 3PACA 2KVQE 1EETB 2E7VA 1OIAA 4J37A 3CJQA 4RUBA 1Y0HA 3N5BA 4IG0B 4IFVA 2GJFA 3G6ES 4PQUB 3BQ0A 1IWGA 2K1RA 3TYTA 4X65F 5CHCB 1RT3B 1S72S 3QJJA 4PPZA 2ASYA 4B08A 3BKFA 4WPAA 1WUUA 1IKXA 2FLPA 1HQUA 1T9UA 3QJLA 2IPOB 5A2QU 2ZD1A 4KY3A 2P9GA 4OIXA 5A76A 3VAKA 1K73T 3HJFA 3AHPA 2WB1D 1T03A 1VQ4S 3M4XA 5EGYA 3SBMA 4PXEA 4ZP9A 1Q8BA 3BYPA 3HHLA 2GC8A 2H5EA 2NXCA 2VG7B 3S1TA 3BSNA 3HVRA 3ILIA 3GCXP 4Y0FA 5T7LA 2YWHA 3C8YA 2W8KA 3NOGA 3DDKA 2AIRB 1R89A 2ACYA 2HSEB 3CB4A 3NP5A 4NRUA 3EYZA 2Z2MA 4K59A 2XS7A 2K7KA 4DV3F 2ZH5A 5ADZA 1AW0A 4Q0BA 1AFIA 1IKWB 2UU9J 1IBKF 2VDHA 2VQEF 1VHIA 1Y9OA 3DGPA 2Y0SD 4LSNB 4TLQA 4Y2CA 3WDOA 3T5HA 1V6HA 2BQUA 5H1SV 3NG8A 3PEJA 4NA2A 4OV1A 2Z2YB 4YR2A 2XS2A 3H5XA 4GKJJ 2HZCA 5EX3A 2YPZA 4Y2IA 2ZJRQ 1P6TA 2CZ9A 2HNDB 4A4JA 1K1QA 2JVRA 5HQ8A 1HR0F 1TKZB 4KIAA 2O1PA 2XY7A 3UVJB 1KLMB 2HG4A 5BJRA 1EJ7L 2DNGA 2DPIA 1REVB 1GXUA 1HNWJ 1MW7A 4F2SA 4M5NA 1YRUA 2QTWA 4LFBF 4B3RJ 2XMWA 3MM8B 4NLGA 4TKTA 5F0UA 1K0VA 3GJQB 1N48A 1IXKA 1WG5A 2A18A 2B3TB 2BRLA 1XR5A 2VG5A 3LANA 3MTKA 3PDNA 4HDHA 2VBZA 4ILRA 1NHKL 4IYQA 4O3QA 3SFUA 3BDEA 1NSKL 4BCAA 2QA4S 1HIYA 2AJ0A 2HVEA 4AE5A 2DHHA 4QYZK 3M1VB 1WF1A 4CLZA 1VBZA 3BSCA 3PEHA 1HI0P 1HWUA 3CCVS 4HTJA 2DITA 2RVJA 1N8RT 2OP5A 1U6FA 1VYAA 2ZWPA 3KLGA 4WP8A 1NO8A 2PSZA 1H2VZ 3M8WA 2V50A 2GMLA 2XNQA 5D3GA 3QZ7A 1BE4A 1AUSL 2CQDA 3UD4P 1RTDA 3HVAA 2V4JB 4MK8A 2YNGB 4YEAA 1SQFA 4ZVGA 3TRGA 4K4SA 1YSJA 4V19J 1X8DA 4U9RA 4ZVUB 3R5AA 3J80U 4CM2A 4RNFA 2BM1A 3ZNJ1 3P6YC 1R0AB 4R25A 4RX6A 3OVSA 4XDCA 4LQ9A 3M8SA 2LEAA 2QMXA 2JX2A 4MFBB 5KT2A 4C0OC 4KC5A 1GXTA 4I2QA 1P8GA 2OPSA 4X84A 3RBZA 4BC7A 2R2UA 5KG6A 2Y1JA 4U7UK 4P7TA 4HKQA 2C3PA 2OPQA 3R5JB 2V2ZA 5D15A 8AT1B 3OTDA 4OL8A 2MDAA 4N56A 1NK6A 1QD1A 1PSDA 4OYPA 2BQRA 1WOOA 4C9DA 1R8AA 3RZAA 2AYMA 5B09A 2DD8S 2RQMA 4EU0A 2F4VF 2PT0A 1XMOF 3MCSA 5JJBA 2YNIA 1NDCA 3QMQA 4NLOA 4UW2A 2XM3A 1I6JA 4HR2A 3K5NA 3IWXA 3H40A 1S4EA 2ZHOA 2LXUA 1FKPA 1U2CA 4DUYJ 1F2GA 3FEXB 5KFHA 2HFUA 3Q23A 2KVIA 2C2EA 3BKUA 1S0NA 3L3CA 3MEEA 4LFAJ 1F2HA 2V4RA 5BXIA 1D0EA 5D0GA 2V8PA 4UZCA 3ULHA 1NK9A 2VG6B 3GONA 2DNYA 3DRYA 4G1PA 3ZTPA 3T5JA 1AFJA 3QSYB 4F04B 5EWFA 2B5JB 1JLCA 4FXVA 2AJQA 2MZRA 4FYDA 4CLWA 1ZBTA 4OHZA 3NGTA 4B3RF 3ZZOA 2C2OB 2BEFA 2R7VA 4ETZA 4X4SA 1CC8A 2HGLA 4ANCA 4M95A 4X4UA 3FQLA 1NJZA 3TX0A 1MMNA 2NXUA 4Y34A 3AQPA 3WQPA 2W7OA 4F8RA 3FCWA 4YY3J 1V3SA 4RW4B 4A46A 1TMMA 4TY8A 2V69A 1A9NB 4YR3A 3NCQA 3J81Y 3FQKA 4OLPA 1JLFB 1LXJA 3VGUA 5C42B 1S9EB 3D6FB 2VU5A 2GVDA 2ZOMA 4CP5A 5BYQA 2DVIA 1F1BB 3LP1A 2UVRA 1ZH5A 4DV5J 5LSLA 3H59A 3VGVA 2QIFA 4CI0B 4DR4F 1M5HA 2LEBA 2WVBA 3C19A 3I0RA 3J7YU 2OD4A 4ID5A 4EZ9A 2ZKTA 4DEZA 3OQ2A 3DFEA 1N32J 3WX4A 4P2XA 1VRUB 2GHPA 5ETNA 2WBRA 4ZHRB 4LFCJ 4IR9A 1X4DA 2OTJS 4LRAA 4TYBA 2MQQA 1HYSA 5IXUA 2JHEA 3FSYA 2RS8A 3N6LA 3KLFB 1YJ7A 1SJQA 3AA9A 4PWUA 5DLFA 3PKMA 3U1LA 4R8UB 3G8TA 4NLPA 3W60A 1RHQB 2IM3A 3BGRB 3KUHA 5D0EA 1U1OA 4CLKA 4KHRA 3M2UA 4UOCA 2V5HG 3PY8A 4JI2F 4KKOB 4FBUA 4ECXA 2E29A 4PUOA 4JYAF 3FBEA 1S9EA 3HSDA 1VBKA 4ZLNA 4DQSA 3GG1A 3K17A 4LBIA 4EYHB 1FDAA 2F4VJ 2W2NP 4WK1A 4ZLJA 5A8KB 1UEUA 1V5IB 1SKUB 3ILJA 5H9EK 6AT1B 2DNPA 2YKMB 4B9NA 2UXCJ 1L3VA 1K44A 2I5JB 1L3SA 3RR8A 5J1EB 2N4CA 1YK9A 1MU2A 2MLZA 4ZHRA 4WFAQ 2QA1A 3GFYA 4WXOA 4KSEB 5DM6Q 2IM0A 3ENAA 1NSPA 4J9PA 2QT7A 2BM0A 1SBRA 4NLTA 2LQJA 3MCNA 4TQRA 3QYYA 3LO3A 4NYOA 4RPFA 3S6EA 1EHWA 2KHCA 1SL0A 1ULRA 4DI6A 3N79A 4LR7A 1F5AA 4KGMA 4C0BA 1FFWB 4AXIA 1SJ4P 5IT9U 4F3QA 2B6AA 2MQ8A 3KNAA 3SFGA 5SZTA 2HRTA 4JI0J 1PG5B 2VC1A 4J9LA 3J7ZT 2HHSA 4PAAA 1S1WB 2D3UA 4WTYA 1A0OB 1N56A 1KFSA 3G82A 2RUGA 4EMDA 5HK4A 2R2TA 1HQUB 5KFYA 2VFUA 1IN0A 5EWEA 1YJWS 2CKWA 2HWTA 2NSCA 2JJ4D 1LQ9A 1H7WA 3QLHB 3CPWR 1JX4A 4WCEQ 1QSLA 4K4VA 1ZPVA 4FXDA 4WYLA 4WKRA 3Q2SC 3ZZUA 1S59A 2LMIA 3RRHA 4PG7A 4BS2A 3BM7A 5E2QA 4DSJA 3M6XA 2YKPA 1S6PA 4D3GA 1FJEB 3D54A 3QGPA 4L74A 3S7RA 4ECRA 1U48A 4G3IA 3V6KA 2AJ1A 2ACMA 4B3TF 4ZIWA 3P96A 3UN2A 4X2BA 3I82A 3HHDA 1N52B 1RWXB 4DR1F 3JAMU 1D1UA 3EJMA 2J8SA 3RUBL 5AE2A 3T1HJ 2YH1A 1SV5B 4J5OA 3TP2A 3QO9A 5IFMA 2DISA 1Q4RA 1FJCA 5KFXA 4OYOA 5E7OB 1HBUA 1RCXB 2J9DE 3VTIA 4LSNA 2AYGA 2LCWA 1KBRA 5F0WA 2X3DA 5KFKA 4AL6A 3G6XA 2FVRA 4Y65A 4DPTA 2B4PA 4WP3A 5LJ3Y 5ETMA 4Y00A 1FVSA 4YS2A 4BWJA 2RRAA 4PCQA 1CJTB 1WC5A 2HS3A 4GVLA 4ZVHA 1NSQA 1YRTA 2N4DA 4L76A 5HMZA 3CW2C 4KO0A 1TL7A 1HBOB 3IMQJ 1E6VB 1XR6A 1UTAA 2UXDF 2L48A 3W3SA 3QRRA 2DB1A 5ETQA 3ZZYA 4ELUA 4K2XA 1URRA 3VAFA 3RR7A 1TKTA 4MYTA 4AFFA 4LFCF 1Q53A 3FMWA 3B78A 5CCMA 4UY85 4O0IA 3KK1B 1TVRA 1OJ4A 1BY9A 1JXEA 1OPZA 1XN9A 3ITHB 3NEKA 2B0GA 3QATA 4N8NA 2N7CA 3BN4A 2VJVA 2ZZMA 4DV4J 1X4AA 2MZJA 4DXLA 5HVFA 3DRSB 1BWEA 1HA1A 3LQVA 1N36J 3NGSA 4U95A 2WONA 2HWHA 1DTTB 3DLGB 1QTMA 1WEXA 1D9FA 1R6YA 3B6BA 3FSXA 2XMJA 2CVEA 3IR5B 3M8ZA 2P8IA 4ECUA 4LF5J 3OT9A 1KD1T 1RT6B 3TX8A 3BJYA 1WHVA 2UUCF 3MMJA 2VA2A 1UJ4A 3CJKB 2BE7D 2D3O1 4KHPF 1KHVA 2DIVA 2RKIB 3OFGA 2UVUA 1X4BA 2B4VA 2R7OA 3RBEA 4JI1F 5D6GA 2AP6A 3KLIA 1NDLA 4RW7B 1Z1ZA 2QZ8A 4H4MA 3K5OA 2K06A 3RW7A 5KFGA 3OHAA 4NLRA 5C2GA 4GKJF 2HFSA 4DLGA 2E7XA 1M5KC 1RHUB 1U49A 2XYPB 1R3NA 3CDEA 1DFDA 3RG6A 4X64F 2FLOA 4RKUC 2R7RA 4QYZJ 3H5SA 3L7OA 3OR2A 2W25A 3EICA 1IBMF 2F8MA 4LF6F 2BUNA 2GA7A 2KYXA 3CNQP 4WZMA 4AXJA 1RK8A 2E1PA 3BBBA 5DZ7A 3H4BA 1QVFR 3ELHA 4RW8A 2WVDA 2XZDB 4UOGA 2XWYA 4I67A 1NUEA 5HQLA 1HMVB 3NRBA 4JI0F 1N33F 2V68A 2XI2A 4N77A 3J7Z5 2H9ZA 3OXLA 4P71A 4DX5A 2XTJP 5LMUJ 4DCPB 1WKLA 1LK5A 2HHQA 2ZBPA 3SMZA 3VWSA 4K4YA 1XNQJ 3D6MB 4CRJA 2OMLA 4ZPBA 2CWKA 4WFBQ 2IM2A 2ZBCA 2XMAA 1VQKS 2GIQA 4J90A 1Q82T 1RHKB 3D67A 5HVGA 1WD6A 3GTYX 3DRPB 2WSFC 3R7NB 2GQCA 4BC9A 4ZP6A 2UV8A 4E98A 4J9MA 3LP0B 5C5JA 5HLFA 3IGVA 3NLCA 2XSFA 3C16B 5D4LA 2DGTA 5AE3A 4OZ0A 3CO9A 4RW6A 2AZ1A 2F9DA 4X62F 1RT4A 3F73A 2VQFJ 1E6YB 3DLEA 3G87A 1JMTA 4JV2A 1IKXB 1N5VA 4F4WA 2B7CB 2GHWA 1SC3B 3HULA 5GAHU 3KG1A 4V19X 5IQ6A 2AJ4A 3PYGA 1KS2A 4TLRA 3KHRA 1O8BA 1WC0A 2JLEA 2XLJA 3DRRA 4DFKA 4DSFA 1F5BA 3M30A 3NAHA 4RWXA 2IJRA 4DR5F 3EZ5A 1X60A 3D0IE 2YNFA 3PRVA 2PFFB 3LP1B 2IYGA 4KHPJ 2MKCA 1WOSA 4F26A 4NWBA 4OHXA 5DGBA 5CYMA 3FC9A 3DLHA 3JQKA 5IT4A 4Y28C 1OS5A 1R0BG 1GTHA 2J8AA 4QR2A 4YN3B 4A8SA 1B0TA 5HLFB 1ZM9A 3CC7S 4I7FB 3R2CJ 2WK4A 3JS9A 1VRUA 1LEOA 5C7PA 2E5IA 2MHEA 1WORA 1U8SA 1CS4B 1C1CA 1FESA 2HBYB 3DGPB 1YBUA 1JLGB 4KH0B 4MMOA 5HBMA 3W2VB 3QRQA 2OD6A 3DLEB 4DHVA 1YVFA 2GV1A 3UN5A 3SCLE 4FDFA 4PZVA 4N41A 4K0KJ 3UI3A 4GC7A 1QAYA 2AZ3A 2YVSA 1LWFA 3D7SB 4FNHA 4GO7X 3THTA 4CLFA 1QAXA 1X0FA 2IBKA 4YOEA 3Q86A 5I3UA 1WTBA 2CG8A 1LW2B 1J5EJ 1DQAA 3ISNC 3AA8A 2HHWA 1R8PA 3CO0P 2BXJA 1L5UA 1HNXJ 3R5CA 3PZPA 1Q5VA 4HT5A 2AEFA 3U1NA 3DOKA 1ZAXA 3LGHA 4NLQA 1XWLA 2PA3A 2YQ1A 1UZHA 2CPYA 2YX1A 3C15B 4M5MA 2YWFA 5IZHA 4QR0A 2N3LA 2I5JA 3MEDB 3OJSA 1FKOA 2KFYA 5KFJA 2XMMA 3AAWB 4GMKA 1SH2A 4DUZF 2IRXA 2QX0A 2XMKA 2H4WB 4QYRA 1P9QC 2LLZA 3RBXA 2L41A 1OSDA 4NI2A 1YHQS 2UXBJ 4ED6A 4Q2LA 3W61A 2HMIA 1H98A 1Z2ZA 2B4OA 1LWEB 3KHGA 4Q44A 3LAMA 4ICLA 4RZRA 3HKZD 1WC1A 2Y8YA 3J7A1 1FE4A 4LF6J 2UVWA 5MLCV 3Q8VA 4LR9A 4QZVB 1N32F 1IQTA 1X4CA 4UUWA 3VAHA 3MM5A 4LJMA 1X7VA 4EK2A 4MKYA 3ET6B 3H4DA 4O4GA 2BDPA 3DM2B 3BGOP 3EE3A 3MXHP 2C2MB 2PGCA 3EXCX 1M5VC 1J5OA 4ZS6A 1RBLA 3HP6A 1KLNA 2EKYA 4Z37A 2R7SA 2CNLB 1A6LA 1U47A 4LF9J 1TUWA 1UJ6A 1GK8A 1X31C 3PYEA 1VQLS 1BC6A 4DR5J 3M8QB 1PBAA 3C14B 3CJ3A 2CPFA 2DXEA 3CMQA 4A8YA 1S0OA 1TU0B 3O2IA 3DRXA 4LF8J 2DCLA 3HD2A 3HM9A 1RBOB 3TVZA 1VQPS 2ATCB 1IKVB 1S6PB 4ICLB 3EMTA 4RLEA 3OL7A 2POKA 1B3TA 1CJVB 4CLPA 3MOZA 2KM8B 2AKWB 4LF7J 2H48B 1U8WA 2DR6A 3MMCA 3AOBA 2NPIA 4USHA 1WJ9A 2FJAB 2MPUA 4HH1A 4C8KA 3VVUA 3K7RA 1JKHB 3CJ5A 4AYBD 3T19A 2FC9A 1IBKJ 1S4FA 2HHVA 3UQSA 3PYFA 2LDIA 4UOHA 4CH7A 1FDBA 1DZ5A 2ADCA 4CO3A 1AB8A 4XTTA 4P52A 3DOLA 2DH7A 4LF2A 1S97A 2VG6A 4GRSA 4TN2A 1WC6A 2FY8A 2HGNA 1HARA 4B3MF 1N0UA 3BQ1A 1P1LA 3QIPB 1H72C 2DHGA 2J7WA 4PPDA 1QAIA 5K20B 1HBOA 1UVIA 1QE1B 1S1UA 4WKYA 2CA9A 3AOCA 2EWHA 1U0HB 3BREA 2HFOA 5JVHQ 4WBFA 4DQPA 4YMEA 1QM9A 3DXBA 4HTIA 2ZM6J 5GADI 1TP7A 3LOUA 2CWXA 4X65J 2AU0A 2DNHA 3SQGB 1G7CB 3P45B 2B9XA 1CJUA 4ELTA 4RO0A 3Q8SB 3KG4A 1HWIA 1RTHA 2IC3A 3OTEA 5KFOA 2EPIA 2I38A 1DTTA 4F0KA 3J7YI 4ZN3A 1FXRA 4ZVOB 3JSMB 4DU7A 3QJPA 2R3VA 4ID5B 1NKBA 4FKXA 3HXMA 2QC3A 1N36F 5DJBA 3VV2B 1RKJA 3W5XA 2H3EB 1MN9A 2YQ0A 3IXQA 5LL6d 3DI6B 3DU5A 5DG8A 4ILLA 4ZMMA 1OY9A 1O6XA 4ECTA 1OY8A 1HYSB 3CWJA 1IKYA 1ZOTA 2BJ1A 1CQMA 4RW7A 3UNYA 4I6YA 1BQNB 1H2TZ 1EKRA 1SC4B 2JFKA 1NZ8A 3ZO7A 4JV1A 1T02A 4JOUA 4DMZA 2ERRA 5KFFA 2LQ5A 1VBXA 4K4ZA 4LVOP 5KFTA 3R2DJ 2V8HA 3FMBA 2DTJA 4DUYF 1RLDA 1N5TA 2QL7B 1DTQA 3A8EA 2FY1A 1AZSB 3JTPA 3NL0A 1U2RA 2DH8A 2GO9A 2DHAA 2HQIA 1BQMA 4L75A 2F9JA 1TKXA 2RT3A 2PC6A 3LWLA 3LALA 2NS1B 1EETA 2ZH7A 3MM7B 1VQMS 4ZJOA 3UW1A 2VPZB 4UT4A 1PAEX 4FF2A 1PO6A 2OEMA 1RT3A 4X62J 2BKOA 2DO4A 2W4PA 1WHYA 2BVZA 1MU2B 5J1EA 3MOJB 4C11B 2W01A 5AJ3F 1RACB 3RU0A 2XLKA 4C8ZA 3PJWA 3DXSX 3MI7X 2EEYA 2PMZD 3BYRA 2DNNA 2JLFA 4A8XA 1Y4ZB 3BPDA 4NXNJ 5LMUF 4FYYB 2FDNA 5A8WB 2DGQA 3PW0A 2HHHJ 1ZAWA 2QE5A 1S1TB 2RMLA 2VG7A 4RUAA 1H3DA 1UFWA 1FEHA 5HMYA 3G6YA 1RISA 4FF4A 4JYAJ 5EWGA 1DHMA 2G0JA 1FNXH 1L3TA 4JI2J 1CJKB 1T11A 2B43A 4M1KA 2X1BA 2ZH4A 3PW2A 4OX8A 2VA3A 1YBTA 5A2QY 5LT5A 3FBBA 4KBIA 3O3LA 1GX5A 1S1VB 4DX8H 5C25A 5L46A 2JL9A 5KT5A 3NKYA 3MM7A 5JVGQ 3L95X 4JI5F 2Q6CA 4IO1A 4CLYA 1Q79A 2I0XA 3IS9B 2Q79A 4NCGB 1FRKA 4WFZA 3OFFA 2IVYA 2DEJA 2KYZA 2HNZB 4Q7AA 1BXNA 4C11A 2RAQA 1QJHA 3HMJG 1JB0C 2C1EB 1IBLF 4FP9A 4MIWA 2V63A 3X3UA 2IHR1 3CJSA 2HNDA 1TL1A 2M9KA 3BBCA 2VODA 2ROGA 3AXMA 2BA9A 2XULA 3SXLA 3DLJA 2CZ4A 1S1TA 3I96A 4M5DB 3MR6A 1D8YA 3E2EA 4F4XA 2QG9B 5FDLB 3E3XA 3PO5A 1ZM3A 3KMQA 1ZS6A 4A48A 1Q7YT 4UTGA 1X4FA 1RT2B 4W4MA 1U1NA 3KTQA 2BANA 4DSKA 2W2MP 4BDPA 3P5TL 4QIVA 4PRFA 3UR3C 3ENWA 3HJVA 1CS4A 4ZPVR 4F4KA 3KDNA 2FHMA 4NYPA 2XY5A 3H0PA 2XO6A 2YKOA 3OVAA 3CCMS 3IO1A 4PWWA 1FTCA 1H38A 2FJXA 3GR1A 1VQNS 2HNZA 2YBVA 1YJNS 4KO0B 1VC0A 2QLFB 5L1KA 4K0KF 4IOCQ 3I5AA 2HPUA 2BJEA 3B54A 3OHBA 3M9NB 1G4CA 1WWHA 1PYSB 4G1IA 3UN3A 1M1HA 3M9OB 4ZCIA 2FGCA 2YPYA 3C6UA 2MQNA 3ONQA 3TUZC 2CNOB 3SV3A 2V4JA 4DQQA 2ASDA 5IT9Y 1VR6A 2LXFA 3D68A 3MEDA 4J7CA 1VQSA 4URQU 3T6JA 4I6AA 2JLGA 1I1GA 1KVKA 2QGFB 2VC0A 4WIIA 2IAJA 4ZN1A 2YKNA 1T94A 3A12A 3OW2R 2Y8WA 3AB2B 5AXKA 2J0XA 1T8EA 3DHWC 3NBPB 2RU9A 3J81j 1EQMA 2FJBB 1SKRA 2CJYB 4XAKA 3V4MA 1NJXA 4OI3A 4AQYF 4DF8A 4IRDA 1AYEA 2UXBF 2M7SA 4QOTA 1XC9A 4OHYA 1G2EA 2CXEA 3PXGa 4W92B 1S48A 3P3DA 1RT5A 4DR4J 3DU6A 2F7VA 3GFHA 1RGVA 2CAJA 1VBYA 2YQ3A 2KRBA 2QSWA 3M6WA 3CJRA 2OAUA 1C4AA 3MEEB 2ZE2A 1OYEA 3AOAA 4F4YA 2H54B 4CT9A 4B3OA 4OZJA 1P27B 2WCXA 4NASA 4ECZA 1QSYA 4ES2A 1PIEA 2SXLA 1HHTP 4ZDNA 1XK8A 3KK2A 3LA0A 4DV2J 1RYSA 4QU6A 4NX9A 3T9NA 4PEOA 3FFIB 2V8VA 3DNCA 5A6WA 1QY7A 2C2KB 1FD2A 2W2QP 4IFVB 4IG0A 5E3QA 4E2FB 4NL5A 5KFBA 3NBPA 5J2MA 2KO1A 3JXOA 4OX9F 3ZC4A 4B3MJ 1SKWA 4DPXA 4Q8FA 1T95A 5J2PB 2JEIA 4DV1J 1RTJB 4HDGA 5RUBA 2RJZA 3LF0A 4RU2A 1UW9A 5CYQB 2DJWA 3TZZA 2C3MA 3SQOP 2JVOA 1GNKA 2RDDA 3FRZA 1S79A 4OV6A 1R27B 5ITHA 1IWAA 2FJWA 2J9EA 2G13A 3GSDA 3M32A 4C4WA 2F8EX 4A8OA 3J7AN 4ECVA 3O6QA 4G1QA 3M2RB 1KQFB 1F9HA 1Q5YA 1RE1B 2A3JA 4NCAA 5KT4A 1OYDA 1WOPA 2FLLA 2DGUA 2CQ0A 1HNVB 1N88A 4RNOA 3KLHA 1TK0A 2WTFA 4LRFA 1GEHA 3TZXA 2BW2A 4K5RA 4CO4A 4DWIA 5CZXA 2DNRA 2CPIA 4OMFG 4K4XA 2UP1A 5FJ4A 3KLFA 2R42A 2B8PA 2PI5A 5LSRA 2EKNA 1RWKB 5LXRA 2KRRA 2MKKA 4J9OA 2J6UA 4PYAA 4C8NA 4R5PA 1N33J 2R9LA 2FZGB 2ZZTA 3T1YF 1HD1A 5HL7Q 5HAOA 3EPGA 4PXBA 3GG0A 4C8MA 3US5A 4B9UA 2B9YA 3SSRA 4G6VB 1YWXA 4KE5A 5HO4A 3H2UB 3BS9A 2F4FA 1JK9B 1KLMA 2PIIA 4MH8A 2P6TA 2L08A 1S7HA 3M2RA 4NA1A 4USWA 2DGXA 5L38A 4CO0A 1H7XA 2GMJA 2JEJA 2HRYA 2NYIA 5KG3A 5CXTA 3CCWA 2H65B 4OYMA 2AJ2A 4KPCA 4L6V3 3N6NA 4ALZA 5KG0A 3QSIA 1SB6A 3HHEA 1NKCA 1NJIT 1FFSB 5DG9A 1Z4UA 2A2DA 3WIVA 2EVZA 4ED5A 1RWNB 2VASA 3CDWA 4P73A 4XDDA 5ETTA 2N7YA 2V67A 3R7BB 1AXQA 4C0HA 4CDIA 4F25A 4DR1J 4C8LA 3H5UA 4NA3A 3POTB 4GC6A 3N9UC 5D4NA 3UE2A 2XGQA 3R7SB 2VZ9A 1WDDA 2CRLA 5LXYA 3CEDA 4FS1A 3AODA 1U6BA 2G0IA 1FRIA 2FJEB 3NCPA 3GU0A 2M70A 2HQ3A 4WTOB 5L39A 2ZHBA 4DV1F 3DOKB 3PNIA 2BOAA 5KFAA 3I0SB 3C15A 1NK5A 4Y2KA 5FIIA 9ATCB 2HQGA 3DGVA 1RHJB 1AROP 2XS5A 4FN5A 2VQFF 1YG0A 1FKOB 1FXLA 2K7JA 4FNIA 4KR0B 4EBCA 4NZ0A 1FFGB 3MD1A 5E5NA 2QL5B 1UPMB 1R0AA 2MQMA 3RB0A 2BZ2A 2HS4A 3ILLA 3QT7A 5B0DA 4QW9A 1C0TA 2J0WA 4C48A 5DGAA 3T5LA 2HEKA 2K2PA 3CXCR 4PG4A 1X4GA 3TARA 4YP3A 3MGJA 1FCAA 4CYUA 1KC8T 2IRYA 3PW4A 1WEYA 4O4GB 3T9ZA 3SV4A 5J2NA 3ZZPA 4DOZA 3MUMP 2AGPA 1HNXF 3GFZA 3R97A 4Q45A 2CPEA 1A7GE 1BQXA 3G2XA 2IVMA 1LWCB 4NPOA 2CPHA 5H9FJ 4HI2A 3NGDA 1ZETA 2MB0B 2W7PA 3BO4A 2VPXB 3UCUP 4B9VA 1D3WA 1D9AA 1FWPA 2Z0GA 3D66A 3MMBA 1KFDA 2X51A 4Z7CA 1QSSA 1R6VA 5EN1A 2GJ2A 4U8YA 3MUTP 1W2IA 3C14A 1U4BA 4ECQA 2XCAA 4TXSA 1WSRA 4J9VA 1I51B 1PGZA 2RDIA 1GMVA 1UMJA 4DQIA 1VDHA 4PWDB 4A8FA 3DLKB 3D6TB 2M88A 3BO3A 2RHQB 3DDNA 1UWBB 3FDSA 3OLAA 2L9DA 1VOMA 4M5DA 4DZDA 4ZPTR 3IN5A 2BV3A 2ROPA 3PHEA 5DO2A 3SSQA 4LUBA 1IJEB 2WRMA 1KDNA 3O44A 4ZLPA 2ZH2A 3VQTA 5F8NA 1TV6B 2PFDA 1HI1A 3BBFA 1LWCA 4DR7J 1AT1B 2GVDB 2WZ1A 4N7TA 1TFWA 2XBPA 4P75A 3EVWA 4USMA 3GPAA 1VJWA 3DN9A 4MK7A 3I0RB 4F0MA 2DNOA 2EFQA 2XQCA 4ZVEA 3OUYA 1U1RA 5F8HA 1QUVA 4RUHA 4EWTA 3PR4A 2LQBA 2KXHA 2IIHA 1SC1B 3EVMA 2LQ9A 3K8WA 1U26A 4H4MB 3LP2B 5KFZA 2HHPA 4RUCA 4KPYA 2RHSB 4KAIA 2AX0A 4DCOB 5CYJA 2FHJA 1UWBA 1XJWB 4UF4A 4ECSA 5D78A 1WEZA
chains in the Genus database with same CATH topology
1FD8A 3IFEA 2D3OR 2CQ3A 1R8HA 1B0PA 2MSSA 3G8QA 2RDJA 2MJNA 3W7BA 1N5SA 3H5YA 2HRUA 2G1DA 3I6PA 3BQ2A 1KHWA 4PQUA 2DO0A 4F4ZA 2O66A 4DV2F 4DFMA 3NMAA 4RNNA 3V6DB 1TAUA 1URNA 3BGFA 2ASJA 5L8RC 1VQ8S 1GH8A 2K8GA 1JJ2R 2GW8A 5DDPC 2VH7A 1Q78A 2OPPB 3CD7A 4NLUA 3R1HA 1T03B 2XMUA 4WF9Q 4RW4A 2KFZA 2EFGA 3MM6B 4WYWA 3MTJA 3MEKA 2JEFA 1QVGR 4NOHA 1H0HB 4B9MA 1PC5A 1R8CA 3GR0A 4CO1A 3Q2TC 3KK3B 1RWUA 3JYTA 1YJTA 4JV5F 1S49A 1S76D 3QAEA 4RNHA 5LMNF 5F3ZA 2CJAA 2O5DA 4QQBA 4C3KA 3X1LB 1IKWA 3LWMA 3PO4A 3JTNA 2JRSA 2UUAF 5K14B 1M0SA 1JLEA 4XK8C 4CTAB 5IS2A 5J2PA 1U2FA 1RTJA 4WU3A 4QW8A 3NCRA 3R5BA 4YDXA 4ED0A 4OZNA 2E5LF 4CZCA 2VV5A 4PQAA 2OKQA 1KQSR 2ZNZA 2WOMB 2YX4A 3ZZ0A 2J7KA 5L9XA 1W25A 4OI4A 3H2VE 3PX6A 5GAGI 1OO0B 2LDYA 3CDAA 2N3OA 3OTCA 3TAQA 1P1TA 3PVXA 4NZ7A 4D3HA 1WF2A 2CYYA 3GV8B 3HHLC 2R7TA 1YITS 4I64A 4DL5A 1LXNA 3CD6S 1IQZA 4YB1P 2GO8A 4RBTA 3DC2A 2HLUA 3OLBA 1NK7A 3M1VA 4P7VA 1HBUB 2BABA 4HH0A 2RH3A 4ZPDA 2QO3A 4ZPWR 1C1CB 5HBMB 3T1HF 3I9V9 1UJ5A 1Z2LA 1LW2A 2PA8D 2G4BA 1FJ7A 1VIXA 3BEGB 2IYIA 1FDDA 5KFVA 3VAJA 1KTVA 1LWFB 2WAQD 3RB3A 1CG2A 2GJIA 2KHDA 2QEXS 2UVVA 2F1FA 3PV8A 3CF5Q 1JLBA 4OHWA 4L3NA 2LECA 4WE1A 3CD5A 2MY8A 2EK6A 2Q1LA 3ZZZA 3GB0A 2BE2A 1FO1A 3TAPA 3RAQA 1T05B 2R7XA 2P6SA 1FRHA 4EO8A 2AYBA 1NRKA 3EX7B 1OPIA 4J9SA 4BWMA 3BB5A 1U7LA 4ES3A 4FVMA 4MFBA 1HI8A 4WJBA 3I5CA 5IM0B 3VF0B 1UVLA 3CCES 4X4UA 1TL4A 1VHFA 2V0NA 4HVZA 1GT8A 1XBWA 3VQSA 1KVIA 2CIMA 4X4TA 3V6HA 2AWZA 1FXDA 3MM9A 2U2FA 4C3MA 2GHVC 5KFUA 1F9FA 5HROB 2R4FA 1UAWA 4K4TA 5KFPA 2YNHB 2BQ3A 3JTOA 3CJKA 2ZNYA 3DM2A 3VR1A 4DL0C 1SJRA 3V4IB 4KJIA 4Y2MA 2OPRB 4F67A 1DRZA 4LF5F 5F8LA 2XLIA 2ADBA 1NK8A 4FBTA 1BD6A 3C6UB 2V2KA 2CQGA 1FF2A 2IA0A 4URSA 3M2VA 4I56A 4FZVA 4LIWA 2M8DB 2PN6A 1FJGF 3QZ8A 1X5PA 4LVNP 3SYZA 4EUVA 1Y3JA 3NWGA 2E9RX 2JLGA 2MKJA 2O67A 3A1YG 1R43A 3CE8A 3I4PA 2M52A 1YGYA 2YWKA 3MF5A 5M2UA 1KEKA 5KFWA 2ZM6F 2DNQA 1SUQA 1U09A 1W2BR 3C46A 1QAJA 2QSFA 5KT7A 4O3RA 2A2CA 3CDBA 2ZC4A 5A0YB 2PDAA 2OLWA 4OJ1A 3D5MA 3HVWA 1JLAB 4H4KC 2YH0A 5D4OA 1Y00A 4CQ1A 3S8SA 2ZH1A 1UVMA 5CQGA 3MURP 4TY8B 5KFMA 3MDFA 4U67Q 3MMCB 5J1PA 3NNAA 2HVHA 1ZM4A 5B08A 4NYZA 3DRSA 4C7QA 2B9WA 5CA5A 5HP1A 4WFYA 4GKKF 2RU3A 3QPIA 3DLGA 2MYFA 3OXFA 4ZOSA 5JXSA 5KOWA 2ZVSA 2V9KA 1L3UA 1S6UA 3DMJA 4DR3F 2MZTA 4OZLA 3DOLB 4QU7A 1HHSA 1CEZA 1GX6A 4PG5A 4ED7A 2V94A 3QIPA 4DSIA 1UVNA 1G3OA 1UKUA 2KDOA 4OI6A 1SJ3P 2IM1A 4IH7A 3CIZA 3QWUA 4YDDB 3MECA 5GAEU 2VL1A 5EX0A 1VRTA 1K0TA 2WSCC 4QIGA 4NLVA 2YKQA 5MAOA 4USIA 3SQGA 3DRRB 2DGVA 1NH8A 1XMBA 4ES1A 2E7WA 2V9WA 1XMQF 3M8PB 1Y5IB 1KVJA 1YJUA 1SL1A 4NXNF 1HBNB 4J9NA 2OH2A 3EZUA 2JZ5A 4TNOA 1FNOA 3U02A 2W9BB 1BGXT 2OJ3A 1FKAF 3TA1A 4HYKA 2DIUA 2KI2A 4YB7A 2DGSA 4ZCMA 3WC0A 3HPOA 1KONA 1TFYA 3I87A 2UXCF 2LU2A 4H4OA 5DDQC 3QGGA 1VK8A 3PW7A 1N6QB 1BQMB 3PFOA 3BDPA 2JFDA 3ETOA 2KN4A 1JWWA 4DV6F 3FSIA 4USJC 1DTQB 4K4UA 1TQLA 4QR1A 2R8HA 1SC6A 2J6SA 1UEVA 1TKXB 2GX8A 5AE1A 2FLNA 4LF4F 4WK3A 5BYSA 2Z4PA 3HX9A 4Y2AA 3UWTA 4A47A 2X1AA 3UCZP 1L3KA 2ZH6A 1SJFA 3IWNC 1HBNA 4N8OA 2VBXA 4AL7A 3QLHA 2UUTA 2KH9A 4H54A 4IO9Q 3BR9A 5IWAF 3PKYA 3IG1B 3TOQA 1DARA 1SJ1A 1RDRA 4TU9A 3Q24A 1KOHA 2G0CA 4TQSA 4QWEA 1CSJA 1ZZFA 2FD2A 4KV8B 2R8IA 1CPZA 1HW8A 1KRPA 2RQKA 5CYMB 5T41A 3TAMB 2R8KA 5U47A 3HT3A 4QCLA 3PRDA 4ZP8A 3B82A 4XPEA 4DN0A 1SH3A 1HFEL 4LQ3A 1YBAA 3W2VA 3V5RA 4CIOA 4ZKAA 4WFXA 3M8RA 1UP1A 2OSQA 1TL5A 2KB2A 2CQPA 3GYXB 4MIAA 2GQ2A 2GIRA 3CCJS 4DSLA 5DLGA 2ZD1B 3IS9A 4NCGA 4AUKA 4CO5A 3CC2S 4ECYA 4NLXA 4UY8T 2JC1A 1WELA 1C0UA 4MKAA 1U25A 2YWGA 3J80Y 4FF3A 3HHLB 3G86A 3OJUA 3IG1A 2QRRA 3NS5A 1TL1B 4OJHA 4KTQA 4IUFA 1TKTB 4O3SA 2Z8QA 5HI7A 2VBWA 3AQOA 2CPXA 3ITHA 2WB4A 1XNRF 2E1CA 3PIPQ 3DLBA 1KNZA 4LF7F 1XERA 2VOOA 1M5OC 2GCFA 2AJFE 2LKZA 1FDNA 3E01A 5E3RA 4HT7A 2D1CA 1RT6A 4PUOB 2HHTA 4YFUA 4QIFA 4IR1A 2QLWA 1LFPA 2PI4A 4PWDA 3ZZRA 2HGMA 3RBDA 3E51A 2I8EA 2CQ1A 3EGWB 2C42A 4OJGA 1S0MA 5THWA 4DBQA 4IH5A 4IFYB 3C6TB 4HI1A 2MKSA 4CT8A 1RTIB 1TV6A 1UVKA 3HKWA 1CVJA 2X3GA 3TA0A 4Q43A 2M0GB 3GYNA 4BHQA 3HZGA 3ISZA 3HVTA 4DPOA 2DHXA 3ISND 3GV7B 2HNYB 2OO4A 2FJDB 2YY3A 4DF4A 1HW9A 3KFWX 1X4HA 5J2QB 3HK2A 2RF2B 2VFRA 2DRBA 3GIJA 3FEZA 3BF4A 2M8HA 3O1LA 2XG8A 5KFNA 4ED8A 2VFSA 3EPIA 2ZE2B 3IR6B 3LGNA 3QAUA 3RAXA 1EP4B 3KJVB 1U1KA 5JUMA 1BQNA 2IVFB 1RTDB 3P49B 4TYAA 2ZJPQ 2XB2D 1C2PA 4DG1A 4HEA9 2YX7A 2KT2A 3LH2S 1DLOB 3LP0A 5K8NA 1ELOA 4P6QA 3TW0A 2FC8A 3HZEA 1O51A 3M05A 4PXCA 3HVTB 2D9OA 2OPSB 3LW5C 5D8HB 4O4RA 1QE1A 3DYAA 3VAGA 2DR9A 2NLWA 1NZAA 2MQOA 3CD0A 2XSJB 5CYQA 2VD3A 5A6PA 5KFRA 2NR0A 3I56S 5F8JA 1OWXA 2MHNA 2AD9A 1RJJA 1T7PA 3IRWP 5L9NA 2MSTA 2ZJQQ 2NUHA 2L9NA 4TU7A 1RA7A 2MXYA 2ZBIA 1NU4A 1FKPB 2QFJA 4LF9F 3KLHB 2IJNA 4WXWA 1M1KT 1U1QA 4WZQA 3UNGC 4F2RA 3JSMA 5J1NA 4PG8A 3TO8A 2HHHF 2JC0A 4HLBA 1MNEA 2EW9A 4I7FA 2WBMA 1JJHA 2VPYB 3BZQA 4ZPAA 2LA4A 3PR5B 1JLEB 4QWAA 2J9DA 4O44B 3VZHA 1D9DA 4MIBA 3PJXA 1WACA 2X1GA 4CNZA 5KAKA 4C8YA 3FCHA 3MHYA 4LMZA 1S77D 2CZVC 2XC9A 3VCDA 2E9TA 3CCZA 3HDSA 2O3DA 2CQBA 1S1XB 4ZPCA 1IM4A 3CCQS 1JLQA 2GMHA 5DRKA 2ATLA 2RNEA 5KOXA 2EK1A 2G9OA 1SQEA 1C1BB 1S9GA 3M8PA 1NEEA 1WI8A 2UZAA 3F41A 3D0HE 3QGHA 1VIOA 4LSLB 2W9BA 2OFGX 5C24A 4DLEA 3MPYA 2CPJA 4A8WA 3ICLA 2UUWA 3K5LA 5DETA 4I0WA 3BSOA 2HMIB 1K9MT 2CVIA 4QPTA 4MJKA 4X4VA 1AUDA 4C8OA 4B9TA 5A8WA 4AL5A 4FF1A 2YTCA 1S6QB 3V6JA 2E5JA 2R8GA 5DQIA 3POTA 4U6PA 1NK4A 4CH0S 1HQEB 1TL3A 2ILYA 2L9WA 3EGNA 3KNGA 5IQQA 4WU2A 3WZ0A 5I42A 4JI7F 1FRLA 1JLQB 3C66A 4WE1B 5A8RB 2E1MC 2C22A 5B7WA 3KLEA 4IDKB 2FVCA 3IAS9 4B17A 2W8LA 4JI3F 3D1OA 4MYUA 2K3KA 5B0EA 2CQ2A 4QIEA 3SSSA 3T1AA 3G6VA 5C24B 2AGQA 3PFEA 1O5JA 3BN7A 2IAJB 5CD4H 1GAOA 5D77A 2KJVA 3DCAA 2YNHA 4I4BA 5T7LB 2C28A 2ALZA 3GQCA 1HWLA 3G8SA 1Q86T 5FDLA 3TI0A 2NQPA 2QMWA 3TAMA 4EGLA 5DG7A 2R7WA 3HHLD 4Q0BB 2W7AA 1B7FA 4IOBA 4E0DA 1GTEA 4KT0C 1UL3A 5F8GA 1ZTWA 1S9FA 3HFKA 2BBEA 3U1MA 5AXLA 5HMWA 1ZM2A 2VUGA 3MAQA 2ZH8A 3MMBB 1Y7PA 2ZZNA 1VMBA 4DV7F 1UVJA 1OQ6A 3JSYA 1C0UB 4I2QB 1YJ9S 3AH6A 2W4DA 2E1RA 2PO4A 2EI5A 3UFCX 2ASLA 2MJUA 1NJYA 4EBDA 1NKEA 1N54B 1HD0A 2U1AA 1NK0A 3CCSS 3MM8A 3S01A 2Z2LA 2QA2A 7FDRA 3D1HA 3CULA 4K4WA 2D3ZA 2VG5B 5DQHA 2CQIA 2W4CA 1N34F 3I4HX 4IH6A 5EDWA 3H25A 2R7UA 4YB5A 1KTQA 4KB7A 2RB7A 4OHVA 2KZMA 2V8GA 1ZTTA 4OZ1A 3MD3A 3KOAA 4RNMA 2C3YA 3V81A 3OUYB 2DK2A 1C4CA 3FGVA 1RA6A 3KLVA 1HWKA 2DT9A 3DI6A 4K50A 2RRBA 4I69A 2B5JA 1IKYB 3F44A 2CQHA 5I4MA 2CQCA 2FTRA 4I2PB 1RT5B 1K8AT 1WHXA 3CSKA 3IBWA 1J5EF 4DJBA 1UFLA 3U7JA 2OTLS 1U1LA 3M6UA 2HWIA 2LXIA 3I31A 3MEGB 2W24A 1U1PA 1TKDA 1CQNA 1U24A 2UV8G 1TZ0A 2NPFA 4Y6IA 1QUPA 4DL2A 2DPJA 2LEPA 1YIJS 3AJ1A 5SUHA 1SH0A 4ZCKA 2RRNA 2CFXA 1N4LA 2DH9A 5KFEA 2APOA 2HW3A 4Q2MA 3SI8A 1X9MA 5BR8F 3N28A 1FERA 3N5FA 5K9FA 3R5DA 1D8ZA 3V6DA 2Q3PA 3NS6A 4KGKA 2ABYA 2KT5A 2MKIA 2RILA 5IT0A 2C2DA 2ZDPA 3L09A 5EUHA 4A8MP 1EP4A 4URGA 2VKZG 5KFDA 4NMLA 2BYCA 2VFVA 4DFJA 5F41A 4G1QB 2MQLA 1YI2S 4C3LA 2NSBA 3UPFA 5GMKa 2Y1JA 2M2BA 3MEGA 3T3FA 2Q6BA 2P5VA 1X5TA 3FEYB 2YKAA 4KKOA 1X9WA 2DR8A 2VPWB 2OFHX 3OSPA 5B0AA 5K14A 5C25B 3R1LA 1LW0A 1ROFA 4JUZA 5A8KA 3HHKA 3I0SA 1KOOA 5G0RA 4YUDA 2FHJD 3B4MA 4JBCA 3I9ZA 1PC4A 3UDCA 1DURA 4XPCA 2WOMA 1TR0A 5B0CA 2PMHA 4LF8F 2IFXA 4DS5A 3Q8QB 2FB0A 5L1IA 4MAKA 4NXMF 4OI0A 1IJFB 4KV8A 4U7CA 2AYEA 4FVCA 3F56A 2FHKA 1M5PC 4QPXA 1PILA 2V4QA 2OIHA 1MMLA 3K57A 2QYCA 3GIKA 4RW6B 3RB6A 1S1WA 2E66A 3VZIA 2WSEC 4A8KA 4OZ5A 4O44A 2F3JA 5G0RB 2JSXA 2B56A 2QLXA 2MZSA 1O0PA 2EFVA 2XMVA 3KHHA 4KRWA 5FLXY 1G6BA 3NNCA 1LOUA 1XEZA 2Y1IA 3OR1B 1TAQA 3N4WA 2OSRA 3G96A 3RAMA 3RYLA 4NLYA 3GMGA 1X0PA 1TKZA 1T3OA 2J0SD 2EBGA 2WW8A 1X4EA 4I68A 1FRXA 1JNRB 1MROB 3PX0A 1B0VA 5GVQA 1F60B 1NHVA 1FHTA 4LSLA 3FVYA 5EHHA 1FRMA 2DR7A 1R31A 1RT1A 5M2PA 1MWYA 4PKDB 3E01B 3FZBA 4I6WA 2XY6A 3HI9A 2ILZA 4PG6A 2XO7A 3SZ2A 5HROA 2ZOFA 2RD5C 1KSPA 2D41A 5AXNA 3O8WA 1HNIA 4TU8A 3BGLA 2YWEA 2AV5A 4ITSA 1E6VA 1WF0A 4F3MA 1RT7B 2BACA 1Q7LB 3OR1A 1JIHA 5KFQA 2V4RA 1FK9A </