4LSZB

Caspase-7 in complex with darpin d7.18
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
RYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Caspase-7 subunit p20
publication title Combined inhibition of caspase 3 and caspase 7 by two highly selective DARPins slows down cellular demise.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4lszB00
3SIPB 2Y1LB 1SC1B 1RWVB 3KJNB 2HBYB 2H54B 1PAUB 2QLJB 2CJYB 2HBRB 2XZDB 2QLBB 2QLFB 2Y0BB 1RWNB 3IBCB 3P45B 4ZVUB 2XYGB 3QNWB 2QL7B 3R7BB 1RHMB 4ZVRB 3D6FB 2CJXB 2H4YB 1RHRB 2CNOB 2XYPB 4ZVSB 3R6LB 1RWMB 2HBZB 2CDRB 3EDQB 4ZVPB 2DKOB 1RHUB 2H51B 1F9EB 1SC3B 1IBCB 2HBQB 1RWWB 2C2KB 4LSZB 5K20B 5IC4B 1RWPB 1NMEB 3IBFB 2P2CB 1RHQB 3KJQB 3D6HB 3R5JB 3R7NB 1PYOB 2QL9B 1I51B 1RE1B 2CNNB 4ZVQB 4DCJB 1QDUB 2C2MB 3EDRB 3GJQB 3NS7B 3GJSB 1RWXB 3R6GB 1RWOB 1RHJB 4DCPB 3GJTB 1RHKB 1ICEB 3P4UB 1SC4B 1BMQB 2C2ZB 2H48B 2H5JB 1RWKB 2CNKB 2H65B 4ZVOB 1QTNB 3D6MB 5IC6B 2C1EB 3R7SB 3KJFB 4ZVTB 2C2OB 3GJRB 2FQQB 2H4WB 2H5IB 4DCOB 2XYHB 1I3OB 1GFWB 3RJMB 4JB8B 2QL5B 2XZTB 2CNLB
chains in the Genus database with same CATH superfamily
2XMWA 1VQPS 2E5LJ 2QX0A 2DRAA 1YI2S 2VG7B 5BR8F 3UN2A 1FNOA 5ETQA 1BC6A 1CBKA 2X3DA 1NJWA 3JS9A 4WK3A 2VFSA 3CMES 4EBEA 3R3TA 4QYZJ 4BWMA 1Y00A 1SH3A 5KT3A 5LSRA 5ITHA 4KGMA 5BYRA 3D0GE 2M9KA 2Y8WA 1NK8A 2E1CA 4L3NA 3M2RB 4P7TA 2RKIB 3MUVP 4X62F 4IOCQ 2Y1RI 2RRNA 3V6KA 2BUNA 3MR3A 4PPZA 2BE2B 5AJ3J 2W9AA 2ZZMA 1WG5A 4DF8A 2VFRA 1HA1A 2E5LF 2QEXS 1SJRA 1WC0A 2OFGX 5IT9U 4EWTA 4PWDA 4DN0A 2B43A 3MI7X 4ZVTB 1RTIA 3AT1B 4ALZA 1VQNS 2WBRA 2GA7A 4ZPDA 4M5HA 4DPOA 2DNPA 5B0FA 1NU4A 4EBDA 4K4UA 3IWLA 2KG1A 3N9UC 1SKSA 4TU8A 2NXCA 3EJMA 3DRSB 4V1Ak 4IQXA 4B3OA 2EFNA 4QWAA 2QL7B 4J9UE 2HNYA 1FE0A 3LP2B 4C11A 3CCMS 3H8YA 1XR6A 3MM6B 5AJ3F 4IRDA 3OBIA 1VQ6S 1FK9A 1R8CA 1GK8A 3P5TL 1RWWB 4DFPA 2M8DB 4CCHA 1PYOB 3CVKA 3GLJA 5SZTA 1A0OB 1T9UA 3OHBA 5C2GA 3A1YG 3OQ2A 4KRWA 1S1WA 1TKDA 5D6GA 3SSRA 2N3LA 3ZZUA 2V4JB 4I56A 1IR2A 3MFHA 2ZWOA 3T1YJ 3OFFA 1RB0A 3N4WA 3TUJC 3I0SB 5LXRA 4ZN3A 3VAHA 1HI0P 3IR6B 1S1VB 1F3FA 3DOMB 4OFZA 2X51A 2HFOA 3T9ZA 4DFMA 3MMCA 3OLAA 3MR5A 1YITS 3KLIA 3CDWA 1KONA 3I9V9 3VGVA 1O0PA 3GTYX 3BGFA 2GQ2A 4DLEA 3GZ7A 3TEGA 1BLUA 4C8MA 1LXNA 3EZOA 1T94A 4PPDA 3LOUA 3T1YF 2WB1D 1CS4B 5I3PA 3MM7A 3PFEA 5LSLA 4OI6A 4PUOA 2MKYA 3KUHA 3OJSA 2HFUA 2IDEA 4IOAQ 1R3NA 3FCHA 4J9RA 1R0CB 3PYEA 2PIIA 4TYAA 2JSXA 2LKZA 3BN7A 4DXLA 1G6BA 3QLHB 4JP8A 4I7FB 3VALA 2A2CA 4FXWA 3SI8A 1WNEA 1AW0A 3QSYB 3Q83A 3KFWX 1I3OB 2Q43A 4WF9Q 3QJPA 2JEFA 3GPAA 4JI4J 1TAQA 2VZ9A 3HKZD 1R8HA 1KTQA 2BEFA 2J8SA 1J5OA 5LM7E 1N5TA 4CT8A 1TKZB 4NLRA 2F5GA 4ZVSB 2J7KA 4KGZB 3T41A 2OPSA 2G0IA 1FWLA 4HI2A 2IVYA 4F7VA 1TELA 1RJJA 2VPYB 4NLSA 2RDJA 2DXFA 1UMJA 1FRKA 1C0UA 1CULA 3O44A 3OL7A 2DXEA 2J6UA 2P2CB 3Q89A 4PG8A 5D4NA 2FGCA 2PEHA 4O3OA 4YEAA 2B7CB 2DPIA 3AOAA 1PCAA 4HVZA 4JI4F 5IFMA 2KN4A 2C3UA 1K9MT 3DU6A 4CH0S 2XS2A 1FDDA 4X4UA 1DTQA 2ZJRQ 1ELOA 2FZCB 4IRKA 3PJ9A 3HF5A 1R0AA 3WBZA 3DOLA 4DSEA 2FY8A 1VJWA 4WTYA 5DLGA 3JYTB 2P9EA 5B0GA 4CTAA 2E1PA 2G1HA 1WEYA 4Q0BA 1ZAWA 2DHXA 3LGMA 3CXCR 1IQTA 3D0IE 3N6LA 3DRYA 3A8EA 4X2BA 4O23A 2VFUA 3ILLA 2BZ2A 3P8BB 1X9MA 5K8PA 4KV8A 3FEYB 2CIMA 3QO9B 1RTZA 1CJTB 4DSJA 3O8WA 2XMAA 3PRDA 2PI4A 3A8IA 2ZH3A 4ZP8A 4F2RA 3C16B 3PW7A 1Y5IB 2K3IA 4DUZJ 1NSQA 1G7CB 1H74A 3MCNA 3CB4A 1N0VC 1N5QA 3MPWA 1S1TB 4DQSA 3PEHA 3IR7B 2HVIA 1URNA 4K50A 1LW0A 1ZZNA 4J9OA 3IG1B 1WELA 2OJ3A 1JLAA 3HHLB 3NNAA 2QSWA 3IR5B 3JXOA 2AJ2A 2ZBQA 5DO2A 2XS7A 3CD5A 5KG2A 5ETOA 2QGFB 3D3BJ 1BXNA 3D9BA 2FZKB 2IC3A 1NKEA 4OYZA 3I4PA 1S0OA 4NXNJ 1TFWA 3MCOA 2B4UA 3TVKA 3LW5C 4OYXA 4DUZF 2L41A 1KQKA 1U09A 3V4IB 2ZHOA 2LQ8A 2MQ8A 2DR9A 2UUCJ 4NXMJ 1GH8A 2XMTA 2LU1A 1U1LA 1EZZB 4X4TA 2LQ5A 3CIZA 4P72A 2YNFA 3GSDA 4ELTA 2HRUA 2P8IA 3KUEA 3CCQS 2BW7A 1MWYA 2ZHAA 1NDKA 4XDCA 3I32A 1RLCL 2Q3PA 3EUNA 2ZOFA 1MG7A 3J81U 4NCAA 4B3MJ 4NXNF 2IM1A 2N82B 3UW1A 2CQ0A 1EB0A 3I6PA 1HBUA 1FX4A 2DD8S 3ITHB 2CZVC 1TKTA 4NLTA 2FQQB 3DI6A 3FCWA 2UUCF 4NXMF 3POTB 2EWHA 1RAIB 3NP5A 3L9ZA 4NLWA 2DHAA 3W1YC 2EK1A 3GIRA 4USJC 4ED3A 2MSTA 2MLYA 3HPOA 3GIKA 3GWCA 2B3TB 3NS5A 3JSYA 4WTOB 4ILMA 1RBOB 2NR0A 1RAFB 4JV0A 3MECB 3FRYA 3QJLA 1H2UX 2MQLA 1NHKL 4PR6A 1S1XA 4B3MF 2FHKA 3LPYA 2DRDA 2CQGA 1HHTP 2YNGA 1S1UA 4GKKJ 4DUTA 4K4WA 1U1KA 1X9WA 4XTTA 1HNIB 1F60B 4C8NA 1QUVA 2HVZA 5AXMA 3TP2A 2BE7D 4R0JA 1KD1T 2AYGA 3A4TA 2XBPA 1WHWA 5CZVA 5KG5A 4P10A 4DL7A 1GMWA 2HIQA 3FBEA 3PEJA 1CJVB 3IA0A 1RT4B 3CJ0A 1VR6A 2LA4A 4TU7A 5FDLB 3JSMB 3JB9k 5HJXA 2DNMA 2CQBA 4KHRA 1TU0B 2NCKL 1WOSA 2Z2LA 4XDDA 2KT2A 4ZCMA 3CT9A 4OZNA 3KMQA 2A18A 2CQ2A 1PYSB 4GKKF 3MEDB 4N8NA 3G2XA 3C19A 3KUGA 2ROPA 3QAEA 3TQ1A 2GX8A 5F8HA 2D3UA 3HP6A 2IBOA 1VQ5S 1GT8A 1CC8A 5ETVA 2HWTA 2HZVA 1YKWA 2HBZB 1R8AA 3CJKA 3FUYA 4PCQA 4MFBB 4NASA 3AA9A 4MJKA 1YJUA 4F4YA 4NOHA 4K5RA 2AW0A 2Q66A 1SJQA 3D67A 3EICA 2R7XA 4OX9J 4R8UB 1SJ3P 3BKUA 2BYCA 3NGSA 2D9OA 4YMEA 3MUMP 4KAIA 1X5SA 1S6QB 3PY8A 1FKOA 4DV3J 1HWJA 3M9NB 2PC6A 3K57A 1DRZA 1UFWA 4OX7A 2OELA 1W7WA 2A3JA 2R7QA 3OVSA 4YB1P 1MU2B 1B70B 2BKPA 3GR1A 1SPBP 4MIBA 2GJFA 4U9RA 3PRVA 3TJ8A 5J2QB 1DAXA 1FNMA 1JJ4A 3MZIA 2OEMA 5HANA 2QMXA 4DS5A 2QV6A 3P45B 1LKZA 2XG8A 4OX9F 4PZVA 2VBYA 2UXCJ 1NDLA 1SVDA 1UA0A 5DLFA 3TZXA 4ZP9A 4F26A 2VC0A 5IQ6A 2YNHA 4EK2A 1SV5A 5LL6d 1VRQC 4DV3F 4HH0A 5B7WA 4I2PB 2R7UA 1WWHA 2BOAA 3H42A 3VCDA 1UWBA 2W7OA 1RT3A 3X1LB 2HVEA 2LQBA 1RHKB 1X4FA 3EWGA 1KLMB 4GO5X 3R1HA 1BE4A 2C3MA 2FJEB 3FMBA 3PVXA 5HATA 4XPCA 2YVSA 2DNZA 4USVA 3N6NA 2OPRB 3R5DA 4B3TJ 1FRMA 1S99A 5E3PA 2UXCF 2CQHA 3CMQA 2AGPA 2B5JB 1CJKA 4O3PA 4QWBA 4FYXB 2KH9A 2MY7A 3I5AA 4IG0B 4I64A 3EVWA 3THVA 1X0FA 2JH3A 2QC3A 5GADI 2EW9A 3KLGA 3NBPB 1RT7B 4QBUA 3JQMA 3G6YA 3W2VB 3HMJG 1C1CA 1Y9OA 2HQFA 2DO4A 3C6UB 3J81Y 3BO2A 3PW0A 4CH7A 2ZUAA 1VRTA 1ZM9A 2RDDA 3K8WA 3BDEA 4IYQA 4ZCIA 2BKOA 2MTLA 5KFWA 4ZS6A 4F50A 4B3TF 3VZHA 4AL7A 1WHXA 3HK2A 1U26A 1IJEB 5F3TA 4OI2A 4ITSA 2QFJA 4QIFA 4JV2A 3H0PA 4PXDA 2VH7A 3RG6A 3PKYA 4I2QB 4JI2J 3MWBA 1XIQA 1REGX 3QATA 2Z8QA 3SCIE 1ZH5A 1MWQA 1GXUA 8RUCA 4ZLPA 1K1QA 1RT5B 4N47A 2RSQA 3KYLA 3D7SB 3DN9A 3R97A 2O5DA 2WOMA 4BLGA 3IP0A 4BWJA 2CJBA 4CO3A 3B6BA 1MSWD 3W63A 3BH6B 1N32J 2CPDA 1XJWB 2XNQA 1VRUB 4PABA 4H4MA 4N77A 2DNLA 3RR8A 4GVLA 4CLSA 1U0HB 3PYGA 3W61A 1U1QA 4JI2F 2QRRA 3LP1A 1QTMA 5LOQA 2CQIA 3W7BA 5J2PB 4KGXB 4RW8A 4NI2A 2FJVA 1FERA 2XI3A 1RU1A 4RL1A 2ILYA 3HHDA 2BA9A 1UJ5A 5CYQA 5H9FK 1NSAA 3JSBA 3T5JA 1RT1B 3GCXP 3KK2A 1QJHA 2YKAA 2RQ4A 5IC6B 1S6OA 3FZ2A 2DT9A 3DYAA 2V2VA 3UR0A 5EUHA 1J27A 3MPVA 2AP6A 1N32F 4A8MP 1U6ZA 1V6HA 1X5TA 2BMBA 3KG0A 2J0XA 1Z2LA 2YKNA 2HPUA 4KSEB 2ZVIA 5ETMA 2H3EB 4X84A 3M4XA 4CH1A 2V8HA 1UEUA 2DYAA 5DDPC 5EN1A 5L9XA 5H1SV 5ETNA 1V3RA 3KDOA 4P7VA 4WE1A 3I82A 4PG5A 1YJ7A 4AXJA 2YQ1A 2F4FA 4I6AA 2DNQA 2D41A 1U1OA 3OHAA 1YZ7A 1E6VB 4E98A 2VHGA 1JLCB 2V9WA 1D0EA 1H98A 4B9SA 3FCVA 3CIMA 2LXIA 3CULA 1R6VA 3M1VB 1UFKA 5CD4H 1QE1B 2F7VA 4Y2MA 9ATCB 1ZZFA 2IJNA 1UCNA 1P1LA 3VGSA 4DQPA 3M30B 2B9YA 3WX4A 2YXLA 1LFPA 2K06A 4ECZA 3LP0A 2CRLA 4M94A 1VHFA 2WSEC 2ZD1B 4ZMMA 2AYEA 2WCXA 3NCPA 5AXKA 2W1BA 2XY7A 3EM1A 3ZTPA 2HHXA 3G96A 1CSJA 3OTEA 1RWVB 3LWLA 2BQRA 4LT6A 3Q8PB 4LR8A 1ZM4A 2QLJB 3J7ZT 2VA2A 3GYXB 2V9KA 1ITPA 3SYZA 4GC6A 2CVEA 3DLKA 4ECUA 2W9BB 2OIHA 4ID5B 2VIHA 1L3VA 4J9VA 5L38A 3GFYA 2IM0A 2E1AA 2OPQA 1NSPA 3RB4A 2AKWB 3GE9A 4YR3A 2DGQA 1VGYA 4R25A 1C4AA 5BYQA 3OXLA 4ECRA 5IZHA 3U27A 1WKLA 2HFSA 1AFJA 3DLEB 2W24A 5KT4A 3AB2B 2GGPB 3HD1A 4BS2A 2F8EX 1NDCA 4KH0B 3M32B 1NEEA 2WRMA 4NYPA 1XR7A 3KHLA 2QO3A 3BEGB 2PGCA 3UDLA 2PI5A 3EPGA 1S4FA 4U6PA 1HYSA 2GFFA 4XIUA 1RCOB 2KZZA 3T5KA 3AQPA 3DRXA 1RADB 1K47A 2DNYA 5A8RA 2Y1IA 3IRWP 3V2UC 3HT0A 2BM1A 1NK5A 2M2BA 2OGUA 2J7WA 2JC0A 3RBXA 2AQ4A 5A8KB 4LRAA 3F73A 3CE8A 2W25A 2OMLA 3MUTP 1AZSA 2AJ0A 4FF2A 4OZLA 4RW9A 3KJQB 3IAS9 4ZHRA 2VL1A 2XY5A 4IQMA 3F41A 4HTJA 1EAYC 2D74B 2EI5A 1XMOJ 4U8YA 3OD2A 2G2OA 4E2FB 4RBVA 2E5HA 4DFJA 2BRKA 4C9DA 1S9GA 4UY85 3CGIA 4H4KC 3FJ2A 3OR2B 2W8LA 3MAHA 1U48A 4J9NA 5I4MA 2JX2A 2EG2A 1DQAA 2YPYA 1D8ZA 2OPPA 2LFVA 4WXOA 3PNIA 4RUAA 4OJ1A 5B0AA 5HN0A 2C2RA 3VZIA 4M1KA 2DH9A 2HZCA 4F0HA 4G6VB 4ANDA 1OYDA 1UVMA 1NBEB 2ACYA 3DLGB 3W64A 2CUYA 3MAAB 4ED1A 3EE3A 1XMOF 2IAJB 2RS8A 2FC9A 2M3DA 2FIUA 1IBCB 3LALA 4KC5A 3E8OA 3NS6A 3S6EA 2B7BB 2RKIA 3D6HB 3MMBB 2DH8A 3IGNA 3IM8A 1FRLA 2RU9A 1ACMB 2XULA 1BMQB 4KO0B 1JLFA 2KXHA 4USTA 2ZC3A 2KVQE 2E7VA 4NEZA 3QMQA 2BR0A 3HJFA 2M7SA 5AE1A 5EWGA 1FEEA 5KG3A 3OXFA 1IKWA 4LMZA 2IIHA 3G82B 2NS1B 2GMJA 2KI2A 1S77D 1BUXA 2MPUA 1T9XA 2F4VJ 2BM0A 2VV5A 2WONB 5C24A 1T03A 3IBCB 4JV5J 4DHVA 4C3KA 3LP2A 3W60A 3ICLA 3S8SA 2NUUG 4F0MA 4HL9A 5DJBA 5HQMA 3W3SA 1EETB 5E3RA 3IXQA 5D3GA 4B3SJ 3PXGa 3WDOA 3CF5Q 2C3PA 1PJ7A 2I8EA 1VBXA 4DX5A 2RUGA 3GP9A 3BR9A 2ADCA 3BQ2A 1Q86T 2HKEA 2VBWA 5JXSA 1YHQS 1S12A 2YY3A 3P5BP 1Z4UA 2F4VF 5L39A 3TNVA 4JV5F 1T9WA 2CQPA 5C7PA 1XQIA 3V4MA 3RJMB 2R8HA 4M5DA 1SL0A 4ES1A 4ZPVR 4B3SF 3LWMA 1X7VA 1MW7A 1UJ6A 1WKJA 1N54B 2ZH6A 3FGVA 2BRLA 3W2WA 2YNIB 2O01C 3B4MA 3OSPA 3J7Z5 3L09A 2ALYB 1T02A 2O3DA 3TJ9A 3DMJA 4FVCA 3AB4B 2XSJB 2COLA 3DM2B 3MGJA 2JEGA 5B0CA 2NLWA 3GONA 1JWWA 3QIPB 5A8WA 4ECWA 3R27A 3MR7A 2LP4A 3MEEA 4MH8A 1DBDA 3LAMA 1SKRA 4WFZA 4WYWA 4CLKA 3KLHA 4LSLA 5THWA 3TAMB 1FDNA 4DU8A 2KJWA 3RUBL 1ZAXA 4NA3A 1B99A 1QTNB 2C1EB 2QA4G 4URQU 1GTHA 3RB3A 4ZLNA 1LWFB 1WC6A 4C0BA 4LBIA 1P27B 1WTBA 3VGTA 4M5LA 1RABB 2CZ9A 4KR0B 3QBCA 3TOQA 2OSQA 1BQNB 4X66J 2ZNZA 1LW2A 2MEWA 4Y0FA 1IR1A 3HSJA 3HCXA 3CCJS 4X64J 2J76E 1N34J 3W9HA 2KM8B 1HWIA 2ZOGA 4ED8A 5KFKA 4P9SA 4RWXA 3RZAA 3SFGA 3MPUB 6AT1B 4ECXA 4CP5A 3LO3A 2HNZB 4K4TA 1IKVB 1SCJB 2PFFB 1XBWA 2AIRB 3K5MA 5HP1A 3NAHA 2EEYA 2XWXA 4EEYA 3ETOA 2J8AA 5KT6A 5KFVA 1IM4A 1JLEA 1Q16B 2DGUA 4O3NA 2KG0A 3TARA 2G9OA 2V63A 3NY0A 2AD9A 3MEGA 3KNGA 2NZ4A 4X66F 5D78A 3CJSA 4CLYA 5BYSA 2GJ2A 2CPHA 2VPZB 5T7LB 4DQQA 4I6WA 2HRYA 4X64F 1N34F 3R1LA 2RUSA 1TVRA 4TXSA 1S10A 3OTOJ 4QYRA 1B7FA 1TV6A 2JOQA 3BQ1A 1S76D 5M2RA 4QCLA 4WFAQ 3IAM9 2IDLA 4WBFA 2IMWP 3BSNA 5B09A 1U1PA 3SXLA 2GC8A 2ZDOA 1RI7A 2BX6A 4W90B 3GCWP 4B02A 5ETSA 3MHYA 4B9MA 2A6MA 2YKMB 1OPZA 2CPFA 2W4CA 3RW7A 2XHWA 3LTOA 1FVQA 1KFDA 1D09B 4A8SA 1IWAA 1T9YA 1F6TA 4LF7J 4DL3A 5GAGU 3GJQB 2V50A 1TTHB 2DR5A 3I4HX 3OTOF 2DCLA 3A3PB 2K1RB 2WVCA 1X4EA 4LF8J 2GVDA 3MURP 3ZC4A 5CCMA 2G2ZA 5GMEA 3CO0P 2AHOB 1VQ7S 3D68A 2VFTA 4NL5A 3IMQJ 8AT1B 4DX8H 2RF2B 4H4OA 3C14A 5I42B 3BREA 3HVTB 2QLXA 4M5GA 1G4CA 3CJ2A 3CCLS 2U1AA 3NGRA 4MK7A 1N36J 4M8LA 1U8WA 4LF7F 1AXQA 1T11A 2Z30B 4CLFA 3G9CA 2R7TA 2VPWB 4ILLA 3MOJB 2IRXA 5KT7A 3ZNJ1 2IA0A 1NK4A 1HPZA 3MM9B 4HACA 4LF8F 4NCBA 1R27B 2C2KB 3DLLQ 2QL9B 2QLWA 1NNDA 3IGVA 4DCJB 3G6VA 3SDEA 3CMAS 5KFYA 1GEHA 3KTQA 3K2YA 2DNNA 3M8PA 2BANB 2MZJA 4WU2A 5C42B 4OHVA 3DFEA 3W5YA 3HM9A 1N36F 1IBMJ 2QA1A 3M2UB 1BQMA 3BR8A 4K4SA 3QFWA 3FDSA 3ZXWA 3DLHA 1FD2A 1VQSA 1RHRB 4NE9C 4B9LA 3D3CJ 1WORA 3KK1B 3VAMA 1ROFA 2UUBJ 1K0VA 1S6PA 2C42A 4C3MA 5HBMA 2UUWA 1KDNA 3HO1A 1KN6A 3Q23A 5C25B 1RGVA 2OUGA 2R7VA 3H90A 4CNZA 4A8OA 3VVUA 1IBMF 2DY9A 4DG1A 4N76A 3CC2S 4G1PA 3PO5A 1P8GA 1FD8A 1HQ2A 2J6TA 4DX6A 3J7YU 4KGVB 4CYUA 4JI8J 4LBHA 2EPIA 3DHXA 2C2NA 3SBMA 4XK8C 1MNEA 3D6MB 3JSRA 4M63A 2GJIA 1KC8T 3G6XA 3JSMA 2Q6CA 2XMUA 3CCSS 2XMKA 3AJ2A 4C8KA 4QIVA 1JLGA 1IXKA 5F8LA 3SQGB 3H59A 2P9GA 2UUBF 4A4JA 2D9PA 2HMIB 2FJAB 3DU5A 1TL5A 3FEXB 4QIWD 2WTFA 4IFYB 2M52A 3L7PA 3AY0A 5FJ4A 3BPDA 1VLYA 4RW7A 3G87A 2A10A 3HZEA 2HSEB 2DTJA 4Q2LA 4LSNA 4CQ1A 4JI8F 1A9NB 3VHQA 5KFFA 1FX2A 4J5OA 2M8HA 2RD5C 3JAMU 4QPTA 3KHHA 3JTPA 3V81A 4PYDA 2MJNA 1K1SA 4UUWA 3FFIB 1S6QA 2KYXA 5HROB 1H7WA 3DGPA 2DBBA 2E5JA 2MQQA 3R2CJ 2HZAA 1WTFA 4GVBB 1TKXB 2WSFC 4O4RA 4U7CA 5F8IA 4H4KA 3G6ES 1F9FA 1TUVA 3HVRA 2V0NA 4ATNA 4RNOA 4JOUA 2NZCA 2RS2A 2HQ3A 1Q0NA 5A2QU 4ILRA 5RUBA 3ADAC 4FS2A 4B17A 3LPEA 3ENWA 2YKPA 2HQDA 5J2QA 1EQ0A 4NZ7A 4C2MA 1Q8BA 2B6AA 3D28A 2I9SA 1RWNB 2EFOA 1V3ZA 1VC0A 3E01A 1DQ9A 2CJXB 1OY9A 4L74A 2H4YB 4PAAA 7AT1B 1GX6A 1FCAA 3QQCD 4QWDA 4JUZA 4J9MA 2FHJD 1C1BB 3BPSP 2RAQA 1UPMB 5DGAA 2LDIA 2EFQA 1KEKA 2H9ZA 1FI4A 1U7LA 1N5YA 4DWIA 4K59A 3AD8C 3MMJA 1RWOB 5KFUA 4M95A 4FN5A 2KL8A 2LEPA 2O66A 1HL6A 2DISA 3UPFA 2HQGA 1A7GE 3FMWA 1N6QA 5K8NA 4A47A 4DV7J 5KAKA 5G0RB 1AFIA 1FRHA 2ZBCA 4ZP7A 3NKYA 4NWBA 3KOAA 3TRGA 4YOEA 2AU0A 5T14A 4UUXA 1SI9A 2W9CA 2A2DA 2QLBB 3EZUA 2GIFA 3IM9A 3NBPA 2CPIA 3QT6A 5KFOA 2AMCB 1RTJB 5JMNA 3NWRA 3I31A 2DRBA 4MMOA 3QWPA 3TAPA 3ISND 3LGNA 3U1LA 1S9EB 4RU2A 3X3UA 2MZQA 5K9FA 2KM8C 1YVFA 3PHEA 3RBEA 5J1EA 2WW8A 2YWEA 3MD3A 4DLGA 4EMDA 4ENOA 3OXGA 2CG8A 2G1DA 4WFBQ 3TVYA 3HZGA 2XWYA 3C15A 1RWPB 1M5VC 2ABYA 3FSXA 2R2SA 2HWHA 1Q8KA 5H9EK 4DV7F 2MZ1A 3UCUP 1WACA 2NUHA 3TR5A 2ASLA 4U96A 1REVA 4V19J 3DRPA 4AFFA 3TA1A 4CRJA 1T05B 2NXNA 5HAOA 2YX1A 5A6PA 4DU7A 3VGUA 3LH2S 3ZTRA 3MAQA 3TZWA 4TLRA 4PKDB 2WSCC 2V6AA 4P75A 1U2FA 2GAHC 2FLNA 5F9LA 5KFPA 4PWDB 4KFBA 4WKYA 2X1BA 3MM8A 1Q5VA 1I1GA 1RTIB 4U7UD 3F44A 2V94A 3R5BA 1S0NA 4B3RF 1QY7A 5IQQA 5IOLA 1DLOA 1U45A 2HFNA 3OVBA 1ZTTA 4ZVHA 3W8GA 1AROP 3SV3A 1ULRA 4B3OB 2E29A 2HHHJ 2HBQB 4F4KA 1GXLA 4ED7A 2UVVA 2G4BA 2HNYB 4C11B 2PMZD 5D15A 1I51B 3UO0A 2J0WA 4DV4J 4MIWA 3FC9A 1N5SA 2NXUA 2CAJA 1PBAA 1Y7PA 5KFAA 4DDFA 4OYPA 3KLFA 2Z2MA 1PIEA 2WAQD 3J7A1 4LR7A 4YHHJ 5EHHA 1KR4A 1VQMS 4ANEA 5AXLA 4QWCA 1FKPA 2XZTB 4DPXA 1S48A 2PD1A 5GAEU 2HHHF 3ULHA 2DVIA 1PSDA 3O1LA 5KFHA 3UVJB 4LFAJ 1NHVA 3IRXA 4DV4F 1HBOA 2JL9A 2XLJA 1YLXA 3H5YA 3KLEB 3H25A 3MMCB 3KLIB 1MN9A 1TL1A 4YHHF 5KG6A 1TL7A 1QE1A 4NA1A 5B0BA 3CD6S 1YX2A 4YB6A 3UE2A 2L9WA 2MQMA 2IBKA 1GMVA 3MM7B 1F5CA 3C6TA 4PUOB 3QRRA 4LIWA 4IH7A 1GNKA 4LFAF 3NGDA 1HI1A 3MCSA 4Y2KA 3C2PA 2FJBB 1N5VA 3MTJA 5HLFA 3ZZZA 3RYLA 2UUTA 2XNRA 4UF4A 5I3QA 2QTWA 3VAJA 5L46A 1N33J 1G2EA 1IKYB 2E5GA 2ZE2A 4ZN1A 2NYHA 4LQ9A 1G3OA 2R9LA 3BM7A 3CCES 3MM5A 3IBWA 3NXZA 4AYBD 3FBBA 1J5OB 4ZJLA 1HW9A 3GFXA 2FVRA 3T6BA 3P49B 4BCAA 3UQSA 3PCOB 4KH1B 2ATCB 2F63A 1CVJA 2OPSB 1VBYA 2ZUGA 2JC1A 3V6DB 1HNXJ 5EDWA 4KHMA 4OLPA 2HIYA 4KB7A 3GV5B 1ZPWX 2ZHBA 2OTLS 4F3MA 1C0UB 3SQOP 2L9NA 4AUKA 3CJ5A 1N33F 1HKAA 2QYCA 1EX8A 3THPA 2ZZTA 3CD0A 5FLXU 2ACMA 1P9YA 1PJ6A 1DTQB 5EWEA 5JVHQ 1PAEX 2KHCA 4ED2A 3DOLB 1URRA 5HO4A 4RW6A 3R5GA 1EP4A 4ZLJA 1HNWJ 4ZVRB 4OHXA 1S6UA 4BC7A 2M5YA 4CTAB 4DR6J 1HNXF 4Q0BB 5A8KA 3GB0A 2HLUA 1RHUB 1DURA 1T3OA 2KDOA 1NH8A 3CO9A 1XTZA 2YBVA 3QFHA 4P74A 1NK6A 8ATCB 2PEBA 2OO4A 2V8PA 1O51A 2VU5A 1H0HB 1W2BR 5KFQA 1HW8A 4OYBA 5D4PA 1SUQA 4A48A 5DDOC 1TL3A 2VDHA 4F4ZA 3GIJA 2ZH9A 2L9DA 1WI6A 2F1FA 2C2DA 4ECQA 1QAJA 4IOBA 2KRBA 1LW0B 1HNWF 3N5FA 2JWNA 2BOPA 5CXTA 1KTVA 3CCWA 4ZVEA 2OSRA 1LEOA 2DEIA 5K14B 4A8FA 2H54B 4C8LA 3K5NA 1VJQA 3KJVB 1RQ0A 3J80Y 2IA6A 4MK8A 1OY8A 2IC3B 1DY3A 1K0TA 4OZ0A 5E3CA 4ECSA 4UOGA 1HMVA 2CZ4A 5DS7A 2OAUA 4Z2XA 2VKRA 1LK5A 3DOKA 5J1NA 3S1TA 2OEKA 3A12A 3V5RA 3U1MA 2PMWA 3LANA 2U2FA 3Q24A 4ETXA 4YFUA 3A3NB 1RHJB 3HKWA 2N7CA 1F1BB 4IH6A 1H6KX 4LVNP 1R6YA 2K2PA 2YNFB 1UW9A 2P5VA 4KTQA 1DZ5A 4P73A 2AJQA 3FVYA 2AZ3A 1KQSR 4OJGA 1I6JA 3RU0A 1HQEA 1MN7A 3VAGA 2JLEA 2J9EA 1HBUB 3BGRA 1EIYB 1TKTB 2HNDA 3DI6B 3AXMA 2WONA 2YX7A 1NB2A 2WB4A 3UFCX 3MFIA 3OV7A 4FBUA 2RHQB 1R0BG 4LF4J 4DR4J 4LR9A 1YK9A 1U25A 1SC3B 4O4GA 4DSIA 5MLCV 1HBNA 1TAUA 4FP9A 2W7PA 1BY9A 1S1XB 1HIYA 3PG9A 2PMHA 1V9OA 4OIXA 4LFCJ 3C46A 1UP1A 2YNGB 1S1UB 2HVDA 1M0SA 2CJAA 3P3DA 3SZ2A 2JRSA 3OFHA 1JLQA 3Q8SB 4USUA 1RTDA 2G0JA 3ETMA 4OHZA 4LF4F 2IFXA 4DR4F 1HNVA 4ED0A 1YBUA 1J2VA 4JB8B 1XN9A 2O67A 2XMVA 4NLOA 3QPIA 2Y1LB 3IWXA 1U49A 3H20A 5GMDA 1JB0C 5DZ7A 5HMWA 2YNIA 2MLZA 3QNWB 3R7BB 1Q78A 3ZZRA 4PWWA 1F0XA 2FDNA 4LFCF 4C48A 5E2QA 4WCEQ 3GIIA 4NLQA 2DHHA 4USWA 5CA5A 3ZNUA 3D6TB 1ZYQA 2OI2A 4NZ6A 3OL6A 4JI5J 1WG1A 2KB2A 4WP9A 2JEJA 4OV6A 3ZTSA 5GAGI 2XCAA 3A8JA 4KYZA 4I67A 4Q43A 4ER8A 4UQGA 1QM9A 5F9NA 3CJKB 1VC5A 1N48A 1EARA 5KFCA 5A0YA 1NK0A 3GJTB 3TWZA 4DBQA 3TZYA 2YH1A 2DGWA 1D9AA 1VYAA 4CDIA 2XLIA 4B9TA 2M4MA 3AH6A 1FKOB 1RAEB 4ZCKA 1BWVA 1N8RT 1TR0A 3AAWB 4RKUC 1Q95G 3MTKA 3FQKA 4G3IA 1VBKA 1RISA 2MZTA 4MIAA 3KHGA 3WIVA 1KQGB 5HI7A 5DM6Q 4JI5F 1KWMA 1TQLA 3U7JA 4DF4A 5SUHA 5IT9Y 1KRPA 3ET6A 1TK0A 3NAIA 4OZ3A 3D6FB 2EC0A 1OQ3A 2HHUA 2ZDPA 3OVAA 2Z57B 2CKWA 2JFKA 2F65A 2E5IA 1Q81T 3HSGA 4OI4A 2V4QA 4MK9A 4FXDA 1WJ9A 1EKSA 3ZZ0A 4CO1A 4MAKA 4O44A 1UVLA 2UP1A 4DV1J 2P6SA 1IWGA 2YNHB 4ZVQB 4IDKA 4FYYB 1AYEA 3GJSB 4UT4A 1RKIA 2AX1A 1S57A 3QWUA 4PXBA 3KHRA 4QU6A 2ZBPA 4F3QA 3PHTA 2J5AA 1UWBB 3OTBA 1RT3B 2CPXA 3NCRA 4HI1A 4AQYJ 2PFDA 2B0GA 4ZCLA 2MSSA 3VR1A 4F4XA 4KHPJ 2GVZA 2LDYA 3GMGA 1YJVA 3TO8A 4DV1F 3RRHA 1RYRA 1T7PA 4QYZK 4RJVA 4ED6A 2BQUA 4TNOA 1CJKB 3QT8A 3O2IA 2L3MA 2DCUB 4CWBA 1NKCA 4ZP6A 4FYWB 4ZVPB 2DR6A 5BXIA 1JXVA 3KLGB 4ES2A 4GRSA 1L3TA 2MKCA 2F9DA 1JKHB 3JTOA 1AA1B 4X4SA 4GO7X 1C1CB 2WVFA 1Q5YA 1SKUB 3PRBA 1IN0A 2DR7A 2FVPA 2B56A 5DRKA 4L75A 1M5OC 3AJDA 1EJ7L 3D0HE 4AQYF 3RW6A 4DSLA 3J7YI 4USKA 1QDUB 4ICLA 2VICA 3IN5A 2IMOA 5DQHA 2IYIA 4PXCA 1NJIT 1TUGB 3UR3C 2R2TA 1BGXT 4KHPF 4L3KA 1WHVA 2KKHA 2RT3A 4NLVA 2CPYA 3UD4P 4F0KA 2E9RX 1T0TV 1M5KC 3AFGA 5HVFA 1CJUB 3O3LA 1RLDA 2YWGA 1AUSL 5LMNJ 3JQKA 2GW8A 1DTTA 5B0EA 5C5JA 3TANA 4WPAA 2FYXA 3B54A 4FPRA 2NPIA 4O0NA 5KFMA 2QIFA 1L3KA 5D8HB 1SL1A 1D3WA 3VAIA 3QGIA 1NDPA 4P2SA 3FSIA 4U67Q 3Q8UA 3B8HA 3HHNB 2WOMB 3QRQA 5JJBA 2PSZA 3H7HB 3BBCA 2GHVC 5KT2A 2ASJA 4JYAJ 4ZPCA 3CDEA 2YKQA 1NAQA 3RRKA 2HHSA 4TU9A 3CC7S 1JJHA 2AYMA 1V3SA 1F3VA 4H4MB 1YJWS 3NMRA 2BDPA 2EFPA 3D2WA 1HQUA 1FDBA 2XQCA 1SB6A 5LMNF 4Y28C 3R6GB 3LP1B 3TA0A 4JI3J 3E51A 4RW8B 4CLZA 3PW4A 2KT5A 4OYIA 4HR2A 4YDDB 2A1BA 4TVAB 5C42A 2PDAA 1FTCA 4HHJA 1JLBA 2HWIA 4WZQA 3NEKA 5CYQB 3SCJE 4U8VA 1GFWB 2PA8D 5L1LA 2DGSA 3KK2B 4JYAF 5KFBA 5L1KA 4E0DA 3CDAA 4OHWA 4EFAC 3DYAB 5D0RA 2W8KA 1AUDA 3MMAB 2MGZA 1C2PA 4YR0A 3K58A 2YKNB 4Y6IA 1YZ6A 2QZ8A 4WU3A 4N56A 5KFIA 3BSCA 4JI3F 2VD3A 1JX4A 1OPIA 2M70A 5DQIA 1FT8A 3US5A 2F3JA 1FNXH 5C25A 1Q4RA 3BGLA 4WE1B 5D4OA 4WP3A 2FY1A 2LXFA 5DDQC 2CJQA 4ED5A 1TK5A 1RA7A 1RACB 1CPZA 2G13A 1S97A 4TKTA 4GKJJ 3ISNC 2D69A 3L4BC 3FQLA 1FXRA 5M2PA 4OHYA 4NLGA 1X4GA 3F0NA 2C2ZB 3M8SA 7FDRA 2UVRA 2XS5A 4F4AA 1LV5A 5C2CA 4QJVA 4LFBJ 4UOFA 4HLBA 3CW2C 6FDRA 4TN2A 3SCKE 2QSFA 3AJ1A 2CQCA 1WC5A 1RAHB 3NGKA 2K7KA 2YQ3A 3H98A 2ZH4A 3LP0B 1KKHA 5KOWA 3CDUA 4FNIA 1RA6A 3Q2TC 5HJYA 4K4YA 4HT5A 2JZ5A 2V2ZA 4EZ9A 4GKJF 2D3OR 5IV3A 1T3NA 3DDIA 3CCTA 2L48A 3ENVA 4WWSA 1UZDA 2B4VA 4YS2A 5KFZA 4DQRA 4LFBF 4ECTA 2FVCA 5CH7B 3DLKB 1PC5A 4DR5J 3K0JA 4URGA 1TFYA 2ZH5A 1FESA 2KO1A 3OW2R 1RKJA 4LF9J 1HI8A 2R4FA 1ICEB 2OPQB 3OPKA 3M6UA 1IKXA 4LREA 2XC9A 2R2UA 3KJFB 4O3RA 3GJRB 2ZM6J 2MKKA 5B0DA 4YP3A 3QT5A 3ZTOA 1RT2A 2WHOA 4IO9Q 2LLZA 1DQ8A 2BACA 1HD0A 3LA0A 2HGMA 1HWKA 3HFKA 1S4EA 3L95X 4RW4A 3UDVA 4DR5F 2XYGB 5FD1A 3ILOA 4ID8A 2VOOA 4M5JA 4LF9F 1HYSB 2JHEA 4ZOSA 2AWZA 4XAKA 4X4OA 2APOA 5J2NA 2EXUA 1RAAB 2DNHA 4CO2A 5CHCB 1S0VA 1B0VA 5A8RB 4C0HA 2HQCA 1RK8A 4UY8T 2ZM6F 3TEHB 4E8UA 1OSCA 2MQNA 5CYMA 4C97A 2RQCA 3D1OA 4I0WA 3HJVA 3HHKA 3M9OB 2D3ZA 2KVIA 1M5SA 1FJ7A 4K2XA 3OR1B 5LT5A 2H48B 1AZSB 3RAXA 4RW9B 2XO6A 4ZHRB 5HVGA 3PW5A 3UD5A 3T19A 4J37A 3MXHP 1H73A 1LWCB 2QJ3A 1SH0A 1U4BA 4NCGA 1X4AA 1H3DA 5BJRA 1QSSA 4KY3A 4ZDNA 5HVHA 1H72C 5GAEI 2EKNA 1BWEA 4XPEA 2K7JA 4KPCA 2J9CA 4LUBA 1S9GB 5F8JA 2UVWA 1E6YA 2DO0A 3NNHA 2H1YA 1APSA 4KIAA 3MPDA 4DR2J 2OPPB 2DR8A 1S9EA 4R5PB 4KKOA 2KZMA 4F4WA 2ROEA 4G1QA 2LXUA 4QOTA 4ANCA 2Y9HA 4M5NA 2LVWA 3ZFVA 2DGTA 5LXYA 3HHLC 4HHHA 3M7VA 4B9NA 3ZZPA 2D3O1 3K7RA 4IG3A 2RHSB 2GCFA 1GX5A 2QMWA 1QD1A 5HMXA 3CUNA 2XZWA 1RTHA 4Z7YA 1VQ4S 3M8RA 2H5JB 3H2UB 1T05A 1YDLA 2MKIA 2Z58B 2EC2A 4DR2F 3N5BA 4Z7CA 1JMTA 1KVJA 3W8PA 4DR3J 4NYZA 2KTQA 1JLFB 1SBRA 3CJ8A 3KWMA 1Q7YT 4K5SA 3E3XA 2CADA 4Q8FA 2C2EA 1W25A 1YRTA 3TVZA 2XLKA 1M5HA 2CQ4A 1C0TA 3GQCA 1IKWB 1X4HA 2DNRA 2DHGA 5GAHI 3LQVA 4K2JA 4ZIVA 3BH7B 1VIXA 3EX7B 2CDRB 1HLWA 4EZ6A 5KFLA 2JVRA 2HHWA 2KJVA 1LWEA 5C24B 4YUDA 1T03B 2OD4A 3CPWR 5ETLA 4O3SA 2B8PA 4OZJA 3FSYA 1OYEA 3EDRB 3I0RA 4DR3F 1W2IA 5HMYA 5D3GB 3CJRA 2ZH2A 1UTAA 4FBTA 1VHIA 2FJWA 2CQ1A 4PQUA 4OJHA 3M6XA 2XYHB 4IFVB 2RIJA 1FTRA 4NLDA 4C4WA 5IT0A 4TY8A 1S7HA 2CPEA 3RBDA 4Y3CA 3KJNB 4AL5A 2BBEA 2XZDB 2RNEA 3M8YA 1BD6A 3Q8QB 3H2VE 1BQXA 3L3CA 2GMHA 4KE5A 3ZZTA 3UVJA 4M5DB 4DL0C 1CEZA 2XO7A 2RRBA 1UWAA 2VF3A 1NPKA 3LGHA 4UTGA 4OZ1A 3S01A 3KLEA 2MHEA 3SMZA 1WOOA 2UZAA 1LQ9A 5IM0A 3W2WB 3K5LA 3K89A 2I5JA 4KQZA 2AGOA 1QVFR 2RE1A 2IM3A 3I56S 3DMJB 1UEKA 1QAYA 3N28A 5J2MA 2EG1A 2FC8A 3ISZA 5KOXA 2EFVA 2Z0GA 3HSZA 5A8WB 1LFWA 1UVJA 3MEEB 3D1HA 3PZPA 2JLFA 4NPOA 1KOOA 4RNMA 3T6JA 1GXTA 3EXYA 1FE4A 3KLHB 4LSLB 3CCZA 2YPZA 1FJEB 5MAOA 2ZKUA 2XTJP 3EMTA 2IHR1 2VQFJ 1JQGA 1NKBA 3CC4S 2NXJA 3TA2A 1SIWB 2VG5A 5HK4A 2DB1A 4IH5A 1W26A 4PXEA 3HT3A 2VG6A 4I4BA 1LOUA 5AE2A 4USHA 2EK6A 1IKYA 3RR7A 1XR5A 2WVDA 3N79A 1UL3A 3FK4A 2OTJS 4GC7A 1WEXA 2B9XA 2QA4S 1VK8A 5DM7Q 2WVBA 3PKMA 3TX8A 1LW2B 1PG5B 3M2VA 3AA8A 3KK3A 1RHQB 2B9EA 2ZFHA 3VAKA 3IWNC 4ED4A 2V5HG 4URSA 1NSKL 3V6DA 4CO4A 4Q8EA 3AOCA 1OQ6A 3PFOA 3W65A 1FJCA 1WF1A 2LQJA 3PX0A 5DDRC 1K44A 5EX0A 4F25A 4NLPA 2VKZG 2VQFF 4LRDA 2J9DE 4J9QA 3HVWA 5CZXA 5HP1B 1RAOA 1HR0J 4K4XA 2VG7A 3PYDA 1XK8A 2C22A 3BF4A 1JLEB 5EWFA 2I2YA 1NPRA 1QLNA 1NH7A 3MEGB 4MKBA 2ZVSA 2JNJA 3TI0A 2YWHA 3OTCA 1Q1KA 1Y3KA 1TVRB 3M2RA 1NK7A 3BJYA 2FD2A 1TV6B 3CEDA 3PR4A 2BE2A 2C3YA 3Q0AA 4YB5A 1VIOA 1RAGB 2LEBA 2GQCA 4ERDA 4DPWA 1HWUA 1HR0F 4FYVB 4I6YA 1VMBA 5LSOA 2FHJA 4JI0J 3KNAA 4RZRA 3EZ5A 3DXSX 1S9FA 3AQOA 4K0KJ 5HL7Q 2H65B 3I5CA 4EBCA 4WXWA 1VOMA 1RP5A 3V6HA 5KFDA 1RDRA 1U8SA 3DRSA 1PC4A 3FKBA 4PG6A 4MKVA 2YWWA 3UN5A 4AXIA 3MM6A 4P6QA 3I87A 4AD6A 5K14A 2GVDB 2HBYB 3KJVA 1S72S 1UZHA 1VISA 3CTRA 1U47A 2X3GA 4LJMA 2CFXA 2AEMA 4H4OB 3C14B 5ADZA 4JI0F 1ZM2A 4N5SA 1QSLA 3RB0A 4P2MA 4BC9A 3TAQA 1MROB 3HFVA 2QMUB 1P1TA 2C3OA 3QJJA 4K0KF 4D3GA 4F8RA 1RU2A 1MWZA 4DR7J 3HI9A 4FPIA 3GG1A 2DHSA 5KG4A 2V4JA 2GIRA 2GHWA 2RVJA 2AGQA 1PYTA 3TX0A 2E1MC 5J1PA 1WUUA 2VFVA 4A8QA 5K5MA 3I0SA 1VS3A 2XGQA 1HPZB 4HACB 2PT0A 3H4DA 2VC1A 3V6JA 5H9FJ 1FFSB 1S1VA 3DOMA 2NSCA 1NXIA 3WQPA 3SDEB 4PYAA 3KG1A 3IS9B 4X4RA 1FWPA 4X4QA 3CCUS 4MKYA 1DJ0A 3PJXA 1V5VA 3M8PB 5KFXA 4DV0J 1NZ8A 5DZ6A 3NOCA 4DR7F 5L9NA 4MYTA 1BQMB 2AZ1A 1B3TA 1NHUA 1CS4A 1IVZA 1MLAA 2LA6A 3EDQB 2UV8A 1YRUA 3CSKA 3PTWA 4ZPTR 1SKWA 1WDTA 2HURA 3DGVA 4LSZB 5HQ8A 3QLHA 4I7FA 2E9ZA 1M1KT 2NYIA 4M5IA 2DGXA 1S6PB 5HBMB 2IY5B 2KXNB 4DV0F 2CQ3A 3EVMA 2GV1A 3MCMA 3P4UB 5ETKA 1SQEA 4HEA9 4L6V3 3BQ0A 2MZSA 4DG1B 1NCLA 4L73A 3OL9A 3E2EA 4MYUA 3G4SS 1TP7A 5F3ZA 1T9VA 1TKZA 4CYUB 2LQ9A 1WKKA 3PYFA 5F0WA 1PKUA 1YTYA 3R8YA 4C98A 3PO4A 2R7RA 1OIAA 2ASDA 3TUIC 3PX6A 4ECVA 5D4LA 2HAIA 1JLGB 4G65A 5IT4A 4UZCA 4C6AA 4RO0A 2LECA 1AT1B 1M90T 1B64A 1JJ2R 2OH2A 2DKOB 3D1QA 2J0SD 3UNGC 4AL6A 1QSYA 4RW7B 2M0GB 3QGPA 4CT9A 2MDAA 3BO4A 4GMKA 3R5CA 4X4VA 4LSNB 2DEJA 3PDNA 2EBEA 1FXDA 2ALZA 4EGLA 5CABA 3JYTA 1I94J 4FF1A 4EU0A 3SCLE 1KS2A 1NO8A 3MOZA 5IWAJ 5M2UA 2MMYA 2Q79A 1T95A 3V81B 1RAJA 3BKTA 4J9LA 3OFGA 1F9HA 3OSNA 1D9FA 3DGPB 3EYZA 3CJTA 4WFXA 2MJUA 2CNLB 2ZH7A 2R8JA 3ILIA 2ZWPA 3QO9A 2AJFE 4DR1J 3NWGA 1CJTA 3VQTA 1HBMB 2NREA 1S49A 2L08A 5CCLA 3C16A 3PJWA 1VQYA 2ZEJA 1VQLS 3CD7A 2B4PA 2FGOA 1S1TA 1U1RA 3QGHA 3ELHA 2B6AB 2ZZNA 2IRUA 1I94F 3R2DJ 4WZMA 1XC9A 3IG1A 4WIIA 3W9JA 3HHLA 5IWAF 4QWEA 2XHCA 1VK3A 3E01B 2N4DA 4LVOP 3RRGA 2ZH8A 1RYSA 4K8RA 4NRTA 3BS9A 4ZA1A 4QQBA 5KG7A 4LIRA 4DR1F 3KXDA 3K17A 3Q8YA 2CJKA 4H54A 1N5YB 5DGBA 2W2MP 2XCPA 1F2HA 2OHDA 4ZIWA 2HG4A 3KG4A 4G1IA 3V4IA 2FLLA 4RR5A 1TMMA 2CA9A 2DK2A 3QSIA 1N4LA 1PO6A 2AYBA 1S59A 1RXOB 1TL4A 1X60A 1FHTA 2QE5A 1N6QB 2DXDA 3IFEA 3UCZP 1WSVA 5IS2A 2UVUA 2XYPB 2VQEJ 2YWKA 2HHTA 4CLLA 2FUG9 2W9CB 2E9TA 2HFZA 1JKHA 2DITA 1F9EB 1WEZA 2G0CA 3ENAA 2J9DA 1N88A 4Z37A 3H5XA 4NEYA 3GILA 3ITHA 4P2FA 2BABA 1X5PA 3TZZA 1MMLA 1LK7A 1N0UA 3POTA 3NS7B 4OZ2A 1SXLA 5J1EB 3EGNA 5F0UA 1SC6A 2FHMA 4YY3J 4HDHA 2XMJA 7FD1A 3C15B 4J9PA 4L76A 1F5AA 1FVSA 2R3VA 3UNYA 3DLBA 3RAMA 2GHPA 4S0MA 3QIDA 2H4WB 4NX9A 4EUVA 3DNCA 4USIA 3OJUA 1M1GA 5DETA 1CJUA 4CLTA 2VQEF 3MECA 3DRRB 1REVB 4OYWA 2W4PA 3TJAA 3VQSA 3BO3A 3DRPB 1KVIA 1IQZA 2A6OA 3C66A 1HHSA 2MZRA 3BYRA 4J9SA 3A13A 1QUPA 3MR6A 1HNIA 3H2LA 1Q8IA 1R7IA 3GYGA 3EVOA 4A8WA 2R8GA 3KKFA 4KFBB 4DS4A 3MM8B 3SSSA 3T1HJ 1HNZJ 2Z2ZA 2JVOA 2N3OA 1CQMA 5GVQA 4YY3F 2CYYA 5KT5A 3H5SA 2HK2A 3HX9A 2X1AA 1CJVA 3W5XA 1RT4A 3MEKA 3CNQP 2WBMA 3PIPQ 1OS5A 2ZJPQ 1DLOB 3GFHA 4BHQA 2RQMA 3RGIA 5FDLA 3NG8A 4C8ZA 2BQ3A 2GMLA 1Q7LB 1RWXB 1ZA2B 2F40A 2OEJA 2ZC4A 2A0FB 3GG0A 1UA1A 3ENQA 4BBYA 1YG0A 3LF0A 1YIJS 3C8YA 1VI7A 3MEDA 2MXYA 2QT7A 4ZKAA 3N6MA 3HXMA 1RCXB 3T1AA 4JBCA 2QL5B 2IRYA 2JFDA 3T1HF 1HNZF 2HFVA 3Q8VA 3KLFB 1ZPVA 3QGGA 4OMFG 4NRUA 4IRCA 2IM2A 2BKNA 1OMSA 4QPXA 1YJNS 3ZO7A 4MFBA 4QW9A 4ZPBA 3GR0A 2W2OP 3OUYB 4OX6A 4RBTA 3MMAA 4OL8A 2VASA 1RT6B 4OLOA 1FKPB 2BXJA 2FLOA 2MY8A 4R8UA 1B4SA 3AXKA 3FBFA 2UU9J 3NRBA 1GMUA 5L8RC 5E3AA 1WD6A 2FZGB 2BE9B 3EGVA 1KSPA 3IRXB 5I3UB 1HBOB 5JUMA 3M8QB 2BVZA 2HGLA 1P6TA 4W92B 1BHNA 1MU2A 4UZBA 4F3OA 4YQWA 4NMLA 1TL1B 2F9JA 3THTA 1TL7B 2W01A 1O8BA 4ZVOB 5KTQA 2POKA 2UUAJ 1FWKA 1NK9A 3MDFA 4W4MA 1D8YA 4DSFA 3P96A 2D7SA 2MB0B 2ADBA 3M8ZA 4M5MA 1JXLA 2DIVA 2UU9F 1WG4A 4UW2A 4F02A 3EGWB 2HQIA 4NA2A 3C6TB 3PM9A 4ELUA 1Q8LA 3U02A 1Y5NB 4I2PA 2Y0BB 3H40A 1C4CA 3GIMA 3QZ7A 4CLWA 1OWXA 5HLFB 2F8MA 1D1UA 1VLOA 1ZS6A 1GTEA 2OMOA 1KLMA 5EGYA 2KFZA 2BJ7A 2UUAF 1FFGB 3IBFB 4Y2AA 1JNRB 2ZE2B 2OPRA 2GO9A 3MM5B 3N0VA 4N41A 3D66A 2F8HA 2B5JA 1ZTWA 1UFLA 5EX3A 5DG9A 4IG0A 4WFNQ 4N7TA 2CNKB 4X4PA 4IR1A 1JJCB 2VBZA 2C2OB 2GS8A 3P6YC 1RT7A 2CJ9A 3W2VA 1XNQJ 3HFZB 4EI2A 1H2TZ 1PBUA 3QT7A 3Q2SC 3C6UA 4PG7A 2BV3A 1VQ8S 2DGVA 3AD7C 2BJ1A 1OO0B 4OYOA 1FDAA 4FF4A 1YJ9S 2DJWA 4CO0A 2YTCA 2MQOA 4U95A 5D0HA 4CI0B 4TQRA 1FRJA 2FHOB 2HHPA 3HDSA 1G1XA 3KDNA 4U7UK 2VOPA 3FRZA 2I0XA 2XM3A 2KXFA 2AEJA 2DIUA 3W62A 3HHEA 4ELVA 4RW6B 4N8OA 4CIOA 3O6QA 2DH7A 3DDKA 4I2QA 3LAKA 3ZZOA 5KFNA 1EP4B 4ES3A 2V2QA 2BW2A 2DNGA 1NLKL 1HWLA 2HYIB 1XNQF 5D77A 1RT5A 4OYAA 1V5IB 1HFEL 2Q1LA 3NLCA 3OR1A 5E33A 1HARA 3RBZA 4DV2J 3PX4A 3ZZYA 4R0EA 2RDIA 2YKOA 2R8KA 1FO1A 4OI0A 1LWCA 5FIIA 1J5EJ 2QN6B 1SUQB 2WW4A 4YB7A 1VRUA 5ETPA 1TL3B 3HLUA 5ETRA 4J90A 4NLUA 2IVFB 3BSOA 1UKUA 1U0HA 2ZNYA 1I5OB 5T41A 1YWXA 5J2PA 4WK1A 2ZOMA 4FF3A 4K4VA 3DXBA 2DPJA 4R5PA 4FS1A 1FF2A 1R8BA 3N01A 4P52A 3GV7B 4DV2F 1SL2A 1GMWD 3G8TA 1FK9B 2ASYA 1RT1A 2VDIA 2JJ4D 2X1GA 1RUSA 4OQJA 4IKAA 3W9IA 4HKQA 1U2RA 2JDJA 5JVGQ 1J5EF 2FVQA 2XB2D 4B08A 1UEVA 1HMVB 4YR2A 2J7UA 2HS3A 1JXEA 2V67A 1GQEA 1RWUA 1XNRJ 4DX7A 3DOKB 3PR5B 1S1WB 2CXEA 4DPTA 4PRFA 2MKJA 3R7SB 3IO1A 3K59A 3L7UA 3JAMY 1YGYA 4QW8A 3JQJA 4F2SA 2R7OA 3EXCX 3G71S 1WC3A 2VBXA 4RPFA 1E6VA 1CQNA 2V34A 1JLCA 1UVKA 3VWSA 4DL4A 1IUJA 2V69A 2OLWA 4ZJOA 1XERA 1Z1ZA 3M1VA 1HQEB 1NPPA 9RUBA 3PV8A 4IR9A 2AJ1A 4Y2IA 4EYHB 1RWMB 4C3LA 2ILZA 4PEOA 2X7IA 3BGRB 1XNRF 1F2GA 1B7YB 5A2QY 2HNDB 1N56A 2H51B 1KHVA 3M30A 5DQGA 4OZ5A 4L72B 5B08A 2CPJA 4OI3A 1VDHA 3OFEA 3J81j 2ZD1A 2CNNB 3K5PA 3KLVA 2IYGA 3ZTQA 1SC4B 2V8GA 3H4BA 4O4GB 1HBNB 2KHDA 2V4RA 5IV4A 1YQHA 4FDFA 4WIQA 2B9WA 2DNKA 2EBGA 2E66A 2SXLA 2CVIA 4OJ3A 4IFVA 1L3SA 4C8YA 2W9BA 2XI2A 2HRTA 4ID5A 1R89A 4NZ0A 3NL0A 1JLQB 4Q5VA 3D5MA 1RTDB 5F8MA 3MF5A 1HNVB 3GSIA 4J7CA 2CQDA 2IJRA 4O3QA 3S7RA 2XMMA 1TZ0A 2J6SA 1U24A 1T8EA 2W2PP 2CPZA 4FYDA 2HHQA 2BJ8A 4JV1A 1L5UA 1KQFB 1CULB 1UETA 1LXJA 3L7OA 3WC0A 4D3HA 4RBUA 2Z4PA 3DLEA 1KOHA 2GGPA 3Q86A 4J9KA 3M32A 2E7WA 5F41A 1UJ4A 5DG7A 2FPHX 2K8GA 1X4CA 4UQTA 3T3FA 4FKXA 2VPXB 2GZOA 1RWKB 2E7XA 1NUEA 3NGTA 3DDNA 1NJXA 1R0AB 5E41A 1KFSA 5A0YB 1EHWA 1U0SA 4LF1A 3GYNA 2HS4A 4NYOA 1K8AT 4V19X 2R8IA 5ETTA 1Q82T 1WF2A 2HS0A 2UXBJ 2PO4A 3HSDA 2G2YA 4TLQA 2P6TA 3K8VA 3DC2A 3F56A 1RHMB 2YX4A 4KV8B 2P9CA 3R6LB 3CJ4A 4A8YA 4LBPA 5GMKa 4FXVA 4FKYA 2CWKA 4DN9A 1ZBTA 3ET6B 2EVZA 4CM2A 1UVNA 2NXEA 4KBIA 2H5EA 4QIEA 1NB7A 4RWWA 4LF6J 1Y10A 1DHMA 1XMQJ 1U02A 1NJYA 3OR2A 2UV8G 1F5BA 4OV1A 1DFDA 4O44B 1JLAB 4DR6F 5KFJA 2W7AA 3CJ3A 2K3KA 2RU3A 1Z2ZA 2OFHX 2NPFA 4RUCA 2UXBF 4P71A 1RBAA 2LMIA 2MQPA 4WJBA 4IDKB 1EKRA 1TK8A 3C3LA 1U2CA 3FEZA 2V8VA 2NSBA 3VTIA 1XWLA 3ILJA 5KG1A 3FZBA 1VCTA 3VAFA 3PIOQ 4CNYA 4DV6J 4Y2CA 2Q6BA 1Q79A 3DLGA 2GIQA 3MAAA 3NMAA 4EYIB 2HHVA 4UOHA 5AE3A 4C8OA 2IAJA 2WZ1A 2AEFA 4ZVUB 3FBCA 5E5NA 4LF6F 5F8GA 4USMA 2CNOB 1XMQF 1LNQA 3MMBA 4JI1J 2GVZB 2AX0A 3G86A 4DPUA 5D0EA 1IBLJ 2Y0SD 4XO0A 1YSJA 2R7SA 4KO0A 2MHNA 2BJ9A 1B0TA 4LQ3A 2N4CA 1YJRA 1ZA1B 3WHIA 3A3OB 5KFSA 4NMXA 3QRPA 1H2VZ 4DV6F 4CO5A 5KG0A 3RB6A 5H9EJ 3CCRS 3G82A 1JK9B 1TUWA 1WHYA 1LWXA 3D54A 2QYGA 1JIHA 2AV5A 4ZJQA 3SV4A 5LMUJ 1L3UA 3K5OA 4ICLB 3Q8RB 1QVGR 3KMSA 1ZAVA 2V68A 2HVHA 4JI1F 1KBRA 1Y5LB 1ZOTA 4WYLA 1KHWA 4DQIA 1IJFB 2V2KA 1IBLF 4LF2A 2BJDA 1EETA 3WIUA 5F8NA 4IUFA 3B82A 2CJYB 2AT1B 3JTNA 1M5PC 3I9ZA 1IR0A 2XGPA 2MLXA 1YJTA 1U6BA 4KJIA 1UVIA 3QZ8A 4WP8A 2ROGA 3EGZA 1X31C 2O1PA 3TUZC 2OD6A 2YWFA 1DTTB 3NNCA 5HMZA 1MROA 3TQEA 4DSKA 4MT1A 1FFWB 4ZLLA 1Q53A 5LMUF 2VJUA 3U1NA 5E3QA 1D9DA 4HT7A 4ZPWR 1U6FA 1WF0A 1PJ5A 5HSPA 5LJ3Y 4ZK7M 2ERRA 2KU7A 4Y34A 4DL6A 3TW0A 2OKQA 2PE8A 1HQUB 3IC1A 3IS9A 3UDCA 1KVKA 2H5IB 4RNFA 1SJ1A 1SJ4P 5U47A 4PG4A 3R9LA 3RAQA 3BDPA 4QZVB 4DFKA 3SIPB 1CLFA 1SC1B 3BSAA 1RSCA 2XSJA 3MPYA 1JLBB 3DM2A 4DJBA 4M5KA 2Y1JA 2RQKA 3QIPA 1UW4A 4DUYJ 2FVSA 2DY1A 4BDPA 2FB0A 1GAOA 4X4NA 5FLXY 1R31A 2RMLA 3TAMA 2MGZB 5K20B 2FLPA 5L1JA 2C2MB 5L1IA 3BB5A 2EFGA 1SQFA 2M88A 3M6WA 1R8PA 3D4JA 1LWFA 1XEZA 4F36A 2NQPA 1R43A 3I96A 4KPYA 1FRXA 3HULA 1RBLA 4JI7J 1KNZA 3LUYA 4DCOB 3DCAA 4DUYF 1BQNA 3I5BA 5DG8A 3NGUA 2VONA 2HK3A 3CCVS 4B9VA 1U1MA 3MR2A 4IO1A 3W66A 2AF6A 2PA3A 4HDGA 3R5AA 1FXLA 3O5TB 3PW2A 3BV8A 1MMDA 2HLTA 2IJFA 5CD4A 1VC6A 2HNZA 2W2QP 1IKVA 2C28A 1SV5B 4ZITA 4RUHA 4UOCA 5CQGA 1DARA 3M05A 3AODA 4QR1A 2ZBRA 4WFYA 1B0PA 2ZJQQ 3BGUA 2MYFA 4W98A 4ZPAA 5KFRA 2JEIA 4JI7F 4DEZA 1PILA 4B9UA 1YBTA 1S7IA 1YBAA 2ZITA 2DNOA 4DCPB 5T7LA 4Q7AA 1O6XA 3H5UA 1P9QC 3SFUA 2D1CA 4TY9A 3RTVA 5D0GA 4YN3B 4A8XA 1VQOS 2Y8YA 2LCWA 3GV8B 3DKDA 4ECYA 2VJVA 3GFZA 1YRXA 4LRFA 1O5JA 1WC4A 4HTIA 4HH1A 1IKXB 2RJZA 4NLYA 4EO8A 3J7AN 1PAUB 1HBMA 1OSDA 1WC1A 2YKMA 3QYYA 2QA2A 2I1RA 2LYVA 1RT2B 2IPOB 3SEOA 4HHUA 1EQMA 2CWXA 2KT3A 3T5HA 4DPYA 4AE5A 1VRTB 2VUGA 4Y65A 2GQQA 5KFGA 1NZAA 2YQ0A 4Q45A 2K1RA 4RNHA 4RW4B 2HEKA 5IC4B 3VV2B 4I1TA 1CG2A 3R7NB 2X1FA 2VODA 4CZCA 3BN4A 5J2NB 5AT1B 1WSRA 5KFTA 4KT0C 4EO6A 2MKSA 3M9MB 3CWJA 3QAUA 2RF2A 5IXUA 5I42A 2KFNA 2KYZA 2CDQA 5K8MA 2E1RA 1WDDA 3HVTA 3OT9A 5CYMB 2I6WA 1SJFA 2ATLA 1H38A 1X9SA 1JNZB 4Y00A 2RH3A 2B51A 2QFIA 3M8WA 4ZVFA 4I69A 4QU7A 1OJ4A 3TUPA 4NCGB 3MM9A 2FTRA 1AB8A 3VF0B 1UPPA 3UN3A 1FEHA 2HW3A 2FJXA 4X65J 2R42A 3M6VA 2B4OA 1E6YB 4RX6A 4NI2B 4QIGA 4OYMA 2BANA 1M1HA 2IVMA 4PWUA 2I38A 3R5JB 4LF5J 4KKOB 1RE1B 2GO8A 2LEAA 4A46A 3HD2A 6FD1A 2BJEA 4G1QB 3G8SA 3M2UA 1T9TA 2XSFA 4K4ZA 1HD1A 2ZKTA 2CG4A 1Y3JA 2V8DA 2EKYA 4B3RJ 4IG3B 3BZQA 1XMBA 3DHWC 3BBFA 1RTHB 4DL5A 2N7YA 2XY6A 3DRRA 3PACA 4X65F 4DMZA 4CLPA 1NJZA 3DLJA 2RILA 2QG9B 3B4DA 1SIZA 4NLXA 2KRRA 2RRAA 3KK1A 2R7WA 3BGOP 2ZBIA 1FKAF 4TQSA 1X4DA 1VBZA 5GADU 1CC7A 4FZVA 4LF5F 1FJGJ 2MKHA 5K8OA 4DI6A 4I68A 4ETZA 3UWTA 3AOBA 1A6LA 1H7XA 2BJ3A 1FA0A 3UCGA 3VVTA 4Q2MA 3I55S 2VA3A 1PGZA 4P2XA 1C0TB 2WK4A 1QAIA 3BYPA 2LU2A 3W5ZA 3A8KA 4QR2A 1SH2A 3OLBA 4DV5J 1LWEB 1MMNA 1UAWA 1KLNA 2Z56B 4QR0A 3SQGA 3J80U 5LJ5Y 3OTDA 2HMIA 5AXNA 1IM6A 1VFJA 4F04B 1NRKA 3AD9C 3SSQA 4IFYA 3I0RB 4MKAA 3WZ0A 3CDBA 1FJGF 3AHPA 2Z2YB 1S0MA 3T9NA 4JI6J 1VQ9S 1X0PA 1KP6A 4K7QA 2W2NP 5HQLA 4A8KA 4PQUB 2W4DA 4CLUA 2HAFA 2HBRB 4MTPA 2QLFB 4RU9A 4RUBA 2GAGC 3OUYA 4DZDA 2E44A 1IBKJ 5E7OB 1RT6A 3ONQA 1WI8A 4TY8B 2UXDJ 4DV5F 1TMJA 3NOGA 2RB7A 3B78A 5CAAA 1FRIA 2OP5A 1S5ZA 3G8QA 3UDEA 3FFIA 1OY6A 5HROA 5A76A 3WC2A 3FNNA 4F67A 2AJ4A 4AT1B 4LRCA 4GVBA 1N52B 1WOPA 1TKXA 4DZ6A 4YDXA 5I3UA 1QAXA 3M8QA 4OX8A 3MD1A 4JI6F 5IM0B 2PN6A 4HYKA 2I5JB 1Y4ZB 3TYTA 2WVEA 2JLGA 4WKRA 1S79A 2HGNA 1IBKF 5J2MB 2VB6A 4OI1A 4FVMA 2KFYA 2UXDF 2R2RA 3UI3A 2GNKA 4TYBA 2J0QD 5E0OA 4O0IA 3OL8A 1SQGA 1C1BA 3CJQA 4DL2A 1NM2A 4CM0A 1U1NA 1X8DA 4C7QA 2Y3YA 4Q44A 2B8QA 2YH0A 4DOZA 3Q22A 3HHLD 2FJDB 2VG5B 1Y11A 3NCQA 1K73T 5BR8J 4LRBA 3BKFA 1X5OA 1NMEB 2VG6B 3BBBA 1X4BA 3WX8A 2DGOA 5GAHU 5A6WA 5G0RA 3GU0A 3M2VB 5CYJA 4RNNA 3KK3B 1Y0HA 1ZM3A 4KGKA 4PQAA 4ZVGA 4C0OC 3HVAA 4RLEA 2ZH1A 4J91A 4X62J 3UD3P 2XEXA 4FNHA 5KFEA 3EPIA 3T5LA 1RTJA 1HHQA 1RZMA 1ZETA 5G4DA 1VQKS
chains in the Genus database with same CATH topology
3SIPB 2Y1LB 1SC1B 1RWVB 3KJNB 2HBYB 2H54B 1PAUB 2QLJB 2CJYB 2HBRB 2XZDB 2QLBB 2QLFB 2Y0BB 1RWNB 3IBCB 3P45B 4ZVUB 2XYGB 3QNWB 2QL7B 3R7BB 1RHMB 4ZVRB 3D6FB 2CJXB 2H4YB 1RHRB 2CNOB 2XYPB 4ZVSB 3R6LB 1RWMB 2HBZB 2CDRB 3EDQB 4ZVPB 2DKOB 1RHUB 2H51B 1F9EB 1SC3B 1IBCB 2HBQB 1RWWB 2C2KB 4LSZB 5K20B 5IC4B 1RWPB 1NMEB 3IBFB 2P2CB 1RHQB 3KJQB 3D6HB 3R5JB 3R7NB 1PYOB 2QL9B 1I51B 1RE1B 2CNNB 4ZVQB 4DCJB 1QDUB 2C2MB 3EDRB 3GJQB 3NS7B 3GJSB 1RWXB 3R6GB 1RWOB 1RHJB 4DCPB 3GJTB 1RHKB 1ICEB 3P4UB 1SC4B 1BMQB 2C2ZB 2H48B 2H5JB 1RWKB 2CNKB 2H65B 4ZVOB 1QTNB 3D6MB 5IC6B 2C1EB 3R7SB 3KJFB 4ZVTB 2C2OB 3GJRB 2FQQB 2H4WB 2H5IB 4DCOB 2XYHB 1I3OB 1GFWB 3RJMB 4JB8B 2QL5B 2XZTB 2CNLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIP B;  2Y1L B;  1SC1 B;  1RWV B;  3KJN B;  2HBY B;  2H54 B;  1PAU B;  2QLJ B;  2CJY B;  2HBR B;  2XZD B;  2QLB B;  2QLF B;  2Y0B B;  1RWN B;  3IBC B;  3P45 B;  4ZVU B;  2XYG B;  3QNW B;  2QL7 B;  3R7B B;  1RHM B;  4ZVR B;  3D6F B;  2CJX B;  2H4Y B;  1RHR B;  2CNO B;  2XYP B;  4ZVS B;  3R6L B;  1RWM B;  2HBZ B;  2CDR B;  3EDQ B;  4ZVP B;  2DKO B;  1RHU B;  2H51 B;  1F9E B;  1SC3 B;  1IBC B;  2HBQ B;  1RWW B;  2C2K B;  4LSZ B;  5K20 B;  5IC4 B;  1RWP B;  1NME B;  3IBF B;  2P2C B;  1RHQ B;  3KJQ B;  3D6H B;  3R5J B;  3R7N B;  1PYO B;  2QL9 B;  1I51 B;  1RE1 B;  2CNN B;  4ZVQ B;  4DCJ B;  1QDU B;  2C2M B;  3EDR B;  3GJQ B;  3NS7 B;  3GJS B;  1RWX B;  3R6G B;  1RWO B;  1RHJ B;  4DCP B;  3GJT B;  1RHK B;  1ICE B;  3P4U B;  1SC4 B;  1BMQ B;  2C2Z B;  2H48 B;  2H5J B;  1RWK B;  2CNK B;  2H65 B;  4ZVO B;  1QTN B;  3D6M B;  5IC6 B;  2C1E B;  3R7S B;  3KJF B;  4ZVT B;  2C2O B;  3GJR B;  2FQQ B;  2H4W B;  2H5I B;  4DCO B;  2XYH B;  1I3O B;  1GFW B;  3RJM B;  4JB8 B;  2QL5 B;  2XZT B;  2CNL B; 
#chains in the Genus database with same CATH topology
 2XMW A;  1VQP S;  2E5L J;  2QX0 A;  2DRA A;  1YI2 S;  2VG7 B;  5BR8 F;  3UN2 A;  1FNO A;  5ETQ A;  1BC6 A;  1CBK A;  2X3D A;  1NJW A;  3JS9 A;  4WK3 A;  2VFS A;  3CME S;  4EBE A;  3R3T A;  4QYZ J;  4BWM A;  1Y00 A;  1SH3 A;  5KT3 A;  5LSR A;  5ITH A;  4KGM A;  5BYR A;  3D0G E;  2M9K A;  2Y8W A;  1NK8 A;  2E1C A;  4L3N A;  3M2R B;  4P7T A;  2RKI B;  3MUV P;  4X62 F;  4IOC Q;  2Y1R I;  2RRN A;  3V6K A;  2BUN A;  3MR3 A;  4PPZ A;  2BE2 B;  5AJ3 J;  2W9A A;  2ZZM A;  1WG5 A;  4DF8 A;  2VFR A;  1HA1 A;  2E5L F;  2QEX S;  1SJR A;  1WC0 A;  2OFG X;  5IT9 U;  4EWT A;  4PWD A;  4DN0 A;  2B43 A;  3MI7 X;  4ZVT B;  1RTI A;  3AT1 B;  4ALZ A;  1VQN S;  2WBR A;  2GA7 A;  4ZPD A;  4M5H A;  4DPO A;  2DNP A;  5B0F A;  1NU4 A;  4EBD A;  4K4U A;  3IWL A;  2KG1 A;  3N9U C;  1SKS A;  4TU8 A;  2NXC A;  3EJM A;  3DRS B;  4V1A k;  4IQX A;  4B3O A;  2EFN A;  4QWA A;  2QL7 B;  4J9U E;  2HNY A;  1FE0 A;  3LP2 B;  4C11 A;  3CCM S;  3H8Y A;  1XR6 A;  3MM6 B;  5AJ3 F;  4IRD A;  3OBI A;  1VQ6 S;  1FK9 A;  1R8C A;  1GK8 A;  3P5T L;  1RWW B;  4DFP A;  2M8D B;  4CCH A;  1PYO B;  3CVK A;  3GLJ A;  5SZT A;  1A0O B;  1T9U A;  3OHB A;  5C2G A;  3A1Y G;  3OQ2 A;  4KRW A;  1S1W A;  1TKD A;  5D6G A;  3SSR A;  2N3L A;  3ZZU A;  2V4J B;  4I56 A;  1IR2 A;  3MFH A;  2ZWO A;  3T1Y J;  3OFF A;  1RB0 A;  3N4W A;  3TUJ C;  3I0S B;  5LXR A;  4ZN3 A;  3VAH A;  1HI0 P;  3IR6 B;  1S1V B;  1F3F A;  3DOM B;  4OFZ A;  2X51 A;  2HFO A;  3T9Z A;  4DFM A;  3MMC A;  3OLA A;  3MR5 A;  1YIT S;  3KLI A;  3CDW A;  1KON A;  3I9V 9;  3VGV A;  1O0P A;  3GTY X;  3BGF A;  2GQ2 A;  4DLE A;  3GZ7 A;  3TEG A;  1BLU A;  4C8M A;  1LXN A;  3EZO A;  1T94 A;  4PPD A;  3LOU A;  3T1Y F;  2WB1 D;  1CS4 B;  5I3P A;  3MM7 A;  3PFE A;  5LSL A;  4OI6 A;  4PUO A;  2MKY A;  3KUH A;  3OJS A;  2HFU A;  2IDE A;  4IOA Q;  1R3N A;  3FCH A;  4J9R A;  1R0C B;  3PYE A;  2PII A;  4TYA A;  2JSX A;  2LKZ A;  3BN7 A;  4DXL A;  1G6B A;  3QLH B;  4JP8 A;  4I7F B;  3VAL A;  2A2C A;  4FXW A;  3SI8 A;  1WNE A;  1AW0 A;  3QSY B;  3Q83 A;  3KFW X;  1I3O B;  2Q43 A;  4WF9 Q;  3QJP A;  2JEF A;  3GPA A;  4JI4 J;  1TAQ A;  2VZ9 A;  3HKZ D;  1R8H A;  1KTQ A;  2BEF A;  2J8S A;  1J5O A;  5LM7 E;  1N5T A;  4CT8 A;  1TKZ B;  4NLR A;  2F5G A;  4ZVS B;  2J7K A;  4KGZ B;  3T41 A;  2OPS A;  2G0I A;  1FWL A;  4HI2 A;  2IVY A;  4F7V A;  1TEL A;  1RJJ A;  2VPY B;  4NLS A;  2RDJ A;  2DXF A;  1UMJ A;  1FRK A;  1C0U A;  1CUL A;  3O44 A;  3OL7 A;  2DXE A;  2J6U A;  2P2C B;  3Q89 A;  4PG8 A;  5D4N A;  2FGC A;  2PEH A;  4O3O A;  4YEA A;  2B7C B;  2DPI A;  3AOA A;  1PCA A;  4HVZ A;  4JI4 F;  5IFM A;  2KN4 A;  2C3U A;  1K9M T;  3DU6 A;  4CH0 S;  2XS2 A;  1FDD A;  4X4U A;  1DTQ A;  2ZJR Q;  1ELO A;  2FZC B;  4IRK A;  3PJ9 A;  3HF5 A;  1R0A A;  3WBZ A;  3DOL A;  4DSE A;  2FY8 A;  1VJW A;  4WTY A;  5DLG A;  3JYT B;  2P9E A;  5B0G A;  4CTA A;  2E1P A;  2G1H A;  1WEY A;  4Q0B A;  1ZAW A;  2DHX A;  3LGM A;  3CXC R;  1IQT A;  3D0I E;  3N6L A;  3DRY A;  3A8E A;  4X2B A;  4O23 A;  2VFU A;  3ILL A;  2BZ2 A;  3P8B B;  1X9M A;  5K8P A;  4KV8 A;  3FEY B;  2CIM A;  3QO9 B;  1RTZ A;  1CJT B;  4DSJ A;  3O8W A;  2XMA A;  3PRD A;  2PI4 A;  3A8I A;  2ZH3 A;  4ZP8 A;  4F2R A;  3C16 B;  3PW7 A;  1Y5I B;  2K3I A;  4DUZ J;  1NSQ A;  1G7C B;  1H74 A;  3MCN A;  3CB4 A;  1N0V C;  1N5Q A;  3MPW A;  1S1T B;  4DQS A;  3PEH A;  3IR7 B;  2HVI A;  1URN A;  4K50 A;  1LW0 A;  1ZZN A;  4J9O A;  3IG1 B;  1WEL A;  2OJ3 A;  1JLA A;  3HHL B;  3NNA A;  2QSW A;  3IR5 B;  3JXO A;  2AJ2 A;  2ZBQ A;  5DO2 A;  2XS7 A;  3CD5 A;  5KG2 A;  5ETO A;  2QGF B;  3D3B J;  1BXN A;  3D9B A;  2FZK B;  2IC3 A;  1NKE A;  4OYZ A;  3I4P A;  1S0O A;  4NXN J;  1TFW A;  3MCO A;  2B4U A;  3TVK A;  3LW5 C;  4OYX A;  4DUZ F;  2L41 A;  1KQK A;  1U09 A;  3V4I B;  2ZHO A;  2LQ8 A;  2MQ8 A;  2DR9 A;  2UUC J;  4NXM J;  1GH8 A;  2XMT A;  2LU1 A;  1U1L A;  1EZZ B;  4X4T A;  2LQ5 A;  3CIZ A;  4P72 A;  2YNF A;  3GSD A;  4ELT A;  2HRU A;  2P8I A;  3KUE A;  3CCQ S;  2BW7 A;  1MWY A;  2ZHA A;  1NDK A;  4XDC A;  3I32 A;  1RLC L;  2Q3P A;  3EUN A;  2ZOF A;  1MG7 A;  3J81 U;  4NCA A;  4B3M J;  4NXN F;  2IM1 A;  2N82 B;  3UW1 A;  2CQ0 A;  1EB0 A;  3I6P A;  1HBU A;  1FX4 A;  2DD8 S;  3ITH B;  2CZV C;  1TKT A;  4NLT A;  2FQQ B;  3DI6 A;  3FCW A;  2UUC F;  4NXM F;  3POT B;  2EWH A;  1RAI B;  3NP5 A;  3L9Z A;  4NLW A;  2DHA A;  3W1Y C;  2EK1 A;  3GIR A;  4USJ C;  4ED3 A;  2MST A;  2MLY A;  3HPO A;  3GIK A;  3GWC A;  2B3T B;  3NS5 A;  3JSY A;  4WTO B;  4ILM A;  1RBO B;  2NR0 A;  1RAF B;  4JV0 A;  3MEC B;  3FRY A;  3QJL A;  1H2U X;  2MQL A;  1NHK L;  4PR6 A;  1S1X A;  4B3M F;  2FHK A;  3LPY A;  2DRD A;  2CQG A;  1HHT P;  2YNG A;  1S1U A;  4GKK J;  4DUT A;  4K4W A;  1U1K A;  1X9W A;  4XTT A;  1HNI B;  1F60 B;  4C8N A;  1QUV A;  2HVZ A;  5AXM A;  3TP2 A;  2BE7 D;  4R0J A;  1KD1 T;  2AYG A;  3A4T A;  2XBP A;  1WHW A;  5CZV A;  5KG5 A;  4P10 A;  4DL7 A;  1GMW A;  2HIQ A;  3FBE A;  3PEJ A;  1CJV B;  3IA0 A;  1RT4 B;  3CJ0 A;  1VR6 A;  2LA4 A;  4TU7 A;  5FDL B;  3JSM B;  3JB9 k;  5HJX A;  2DNM A;  2CQB A;  4KHR A;  1TU0 B;  2NCK L;  1WOS A;  2Z2L A;  4XDD A;  2KT2 A;  4ZCM A;  3CT9 A;  4OZN A;  3KMQ A;  2A18 A;  2CQ2 A;  1PYS B;  4GKK F;  3MED B;  4N8N A;  3G2X A;  3C19 A;  3KUG A;  2ROP A;  3QAE A;  3TQ1 A;  2GX8 A;  5F8H A;  2D3U A;  3HP6 A;  2IBO A;  1VQ5 S;  1GT8 A;  1CC8 A;  5ETV A;  2HWT A;  2HZV A;  1YKW A;  2HBZ B;  1R8A A;  3CJK A;  3FUY A;  4PCQ A;  4MFB B;  4NAS A;  3AA9 A;  4MJK A;  1YJU A;  4F4Y A;  4NOH A;  4K5R A;  2AW0 A;  2Q66 A;  1SJQ A;  3D67 A;  3EIC A;  2R7X A;  4OX9 J;  4R8U B;  1SJ3 P;  3BKU A;  2BYC A;  3NGS A;  2D9O A;  4YME A;  3MUM P;  4KAI A;  1X5S A;  1S6Q B;  3PY8 A;  1FKO A;  4DV3 J;  1HWJ A;  3M9N B;  2PC6 A;  3K57 A;  1DRZ A;  1UFW A;  4OX7 A;  2OEL A;  1W7W A;  2A3J A;  2R7Q A;  3OVS A;  4YB1 P;  1MU2 B;  1B70 B;  2BKP A;  3GR1 A;  1SPB P;  4MIB A;  2GJF A;  4U9R A;  3PRV A;  3TJ8 A;  5J2Q B;  1DAX A;  1FNM A;  1JJ4 A;  3MZI A;  2OEM A;  5HAN A;  2QMX A;  4DS5 A;  2QV6 A;  3P45 B;  1LKZ A;  2XG8 A;  4OX9 F;  4PZV A;  2VBY A;  2UXC J;  1NDL A;  1SVD A;  1UA0 A;  5DLF A;  3TZX A;  4ZP9 A;  4F26 A;  2VC0 A;  5IQ6 A;  2YNH A;  4EK2 A;  1SV5 A;  5LL6 d;  1VRQ C;  4DV3 F;  4HH0 A;  5B7W A;  4I2P B;  2R7U A;  1WWH A;  2BOA A;  3H42 A;  3VCD A;  1UWB A;  2W7O A;  1RT3 A;  3X1L B;  2HVE A;  2LQB A;  1RHK B;  1X4F A;  3EWG A;  1KLM B;  4GO5 X;  3R1H A;  1BE4 A;  2C3M A;  2FJE B;  3FMB A;  3PVX A;  5HAT A;  4XPC A;  2YVS A;  2DNZ A;  4USV A;  3N6N A;  2OPR B;  3R5D A;  4B3T J;  1FRM A;  1S99 A;  5E3P A;  2UXC F;  2CQH A;  3CMQ A;  2AGP A;  2B5J B;  1CJK A;  4O3P A;  4QWB A;  4FYX B;  2KH9 A;  2MY7 A;  3I5A A;  4IG0 B;  4I64 A;  3EVW A;  3THV A;  1X0F A;  2JH3 A;  2QC3 A;  5GAD I;  2EW9 A;  3KLG A;  3NBP B;  1RT7 B;  4QBU A;  3JQM A;  3G6Y A;  3W2V B;  3HMJ G;  1C1C A;  1Y9O A;  2HQF A;  2DO4 A;  3C6U B;  3J81 Y;  3BO2 A;  3PW0 A;  4CH7 A;  2ZUA A;  1VRT A;  1ZM9 A;  2RDD A;  3K8W A;  3BDE A;  4IYQ A;  4ZCI A;  2BKO A;  2MTL A;  5KFW A;  4ZS6 A;  4F50 A;  4B3T F;  3VZH A;  4AL7 A;  1WHX A;  3HK2 A;  1U26 A;  1IJE B;  5F3T A;  4OI2 A;  4ITS A;  2QFJ A;  4QIF A;  4JV2 A;  3H0P A;  4PXD A;  2VH7 A;  3RG6 A;  3PKY A;  4I2Q B;  4JI2 J;  3MWB A;  1XIQ A;  1REG X;  3QAT A;  2Z8Q A;  3SCI E;  1ZH5 A;  1MWQ A;  1GXU A;  8RUC A;  4ZLP A;  1K1Q A;  1RT5 B;  4N47 A;  2RSQ A;  3KYL A;  3D7S B;  3DN9 A;  3R97 A;  2O5D A;  2WOM A;  4BLG A;  3IP0 A;  4BWJ A;  2CJB A;  4CO3 A;  3B6B A;  1MSW D;  3W63 A;  3BH6 B;  1N32 J;  2CPD A;  1XJW B;  2XNQ A;  1VRU B;  4PAB A;  4H4M A;  4N77 A;  2DNL A;  3RR8 A;  4GVL A;  4CLS A;  1U0H B;  3PYG A;  3W61 A;  1U1Q A;  4JI2 F;  2QRR A;  3LP1 A;  1QTM A;  5LOQ A;  2CQI A;  3W7B A;  5J2P B;  4KGX B;  4RW8 A;  4NI2 A;  2FJV A;  1FER A;  2XI3 A;  1RU1 A;  4RL1 A;  2ILY A;  3HHD A;  2BA9 A;  1UJ5 A;  5CYQ A;  5H9F K;  1NSA A;  3JSB A;  3T5J A;  1RT1 B;  3GCX P;  3KK2 A;  1QJH A;  2YKA A;  2RQ4 A;  5IC6 B;  1S6O A;  3FZ2 A;  2DT9 A;  3DYA A;  2V2V A;  3UR0 A;  5EUH A;  1J27 A;  3MPV A;  2AP6 A;  1N32 F;  4A8M P;  1U6Z A;  1V6H A;  1X5T A;  2BMB A;  3KG0 A;  2J0X A;  1Z2L A;  2YKN A;  2HPU A;  4KSE B;  2ZVI A;  5ETM A;  2H3E B;  4X84 A;  3M4X A;  4CH1 A;  2V8H A;  1UEU A;  2DYA A;  5DDP C;  5EN1 A;  5L9X A;  5H1S V;  5ETN A;  1V3R A;  3KDO A;  4P7V A;  4WE1 A;  3I82 A;  4PG5 A;  1YJ7 A;  4AXJ A;  2YQ1 A;  2F4F A;  4I6A A;  2DNQ A;  2D41 A;  1U1O A;  3OHA A;  1YZ7 A;  1E6V B;  4E98 A;  2VHG A;  1JLC B;  2V9W A;  1D0E A;  1H98 A;  4B9S A;  3FCV A;  3CIM A;  2LXI A;  3CUL A;  1R6V A;  3M1V B;  1UFK A;  5CD4 H;  1QE1 B;  2F7V A;  4Y2M A;  9ATC B;  1ZZF A;  2IJN A;  1UCN A;  1P1L A;  3VGS A;  4DQP A;  3M30 B;  2B9Y A;  3WX4 A;  2YXL A;  1LFP A;  2K06 A;  4ECZ A;  3LP0 A;  2CRL A;  4M94 A;  1VHF A;  2WSE C;  2ZD1 B;  4ZMM A;  2AYE A;  2WCX A;  3NCP A;  5AXK A;  2W1B A;  2XY7 A;  3EM1 A;  3ZTP A;  2HHX A;  3G96 A;  1CSJ A;  3OTE A;  1RWV B;  3LWL A;  2BQR A;  4LT6 A;  3Q8P B;  4LR8 A;  1ZM4 A;  2QLJ B;  3J7Z T;  2VA2 A;  3GYX B;  2V9K A;  1ITP A;  3SYZ A;  4GC6 A;  2CVE A;  3DLK A;  4ECU A;  2W9B B;  2OIH A;  4ID5 B;  2VIH A;  1L3V A;  4J9V A;  5L38 A;  3GFY A;  2IM0 A;  2E1A A;  2OPQ A;  1NSP A;  3RB4 A;  2AKW B;  3GE9 A;  4YR3 A;  2DGQ A;  1VGY A;  4R25 A;  1C4A A;  5BYQ A;  3OXL A;  4ECR A;  5IZH A;  3U27 A;  1WKL A;  2HFS A;  1AFJ A;  3DLE B;  2W24 A;  5KT4 A;  3AB2 B;  2GGP B;  3HD1 A;  4BS2 A;  2F8E X;  1NDC A;  4KH0 B;  3M32 B;  1NEE A;  2WRM A;  4NYP A;  1XR7 A;  3KHL A;  2QO3 A;  3BEG B;  2PGC A;  3UDL A;  2PI5 A;  3EPG A;  1S4F A;  4U6P A;  1HYS A;  2GFF A;  4XIU A;  1RCO B;  2KZZ A;  3T5K A;  3AQP A;  3DRX A;  1RAD B;  1K47 A;  2DNY A;  5A8R A;  2Y1I A;  3IRW P;  3V2U C;  3HT0 A;  2BM1 A;  1NK5 A;  2M2B A;  2OGU A;  2J7W A;  2JC0 A;  3RBX A;  2AQ4 A;  5A8K B;  4LRA A;  3F73 A;  3CE8 A;  2W25 A;  2OML A;  3MUT P;  1AZS A;  2AJ0 A;  4FF2 A;  4OZL A;  4RW9 A;  3KJQ B;  3IAS 9;  4ZHR A;  2VL1 A;  2XY5 A;  4IQM A;  3F41 A;  4HTJ A;  1EAY C;  2D74 B;  2EI5 A;  1XMO J;  4U8Y A;  3OD2 A;  2G2O A;  4E2F B;  4RBV A;  2E5H A;  4DFJ A;  2BRK A;  4C9D A;  1S9G A;  4UY8 5;  3CGI A;  4H4K C;  3FJ2 A;  3OR2 B;  2W8L A;  3MAH A;  1U48 A;  4J9N A;  5I4M A;  2JX2 A;  2EG2 A;  1DQA A;  2YPY A;  1D8Z A;  2OPP A;  2LFV A;  4WXO A;  3PNI A;  4RUA A;  4OJ1 A;  5B0A A;  5HN0 A;  2C2R A;  3VZI A;  4M1K A;  2DH9 A;  2HZC A;  4F0H A;  4G6V B;  4AND A;  1OYD A;  1UVM A;  1NBE B;  2ACY A;  3DLG B;  3W64 A;  2CUY A;  3MAA B;  4ED1 A;  3EE3 A;  1XMO F;  2IAJ B;  2RS8 A;  2FC9 A;  2M3D A;  2FIU A;  1IBC B;  3LAL A;  4KC5 A;  3E8O A;  3NS6 A;  3S6E A;  2B7B B;  2RKI A;  3D6H B;  3MMB B;  2DH8 A;  3IGN A;  3IM8 A;  1FRL A;  2RU9 A;  1ACM B;  2XUL A;  1BMQ B;  4KO0 B;  1JLF A;  2KXH A;  4UST A;  2ZC3 A;  2KVQ E;  2E7V A;  4NEZ A;  3QMQ A;  2BR0 A;  3HJF A;  2M7S A;  5AE1 A;  5EWG A;  1FEE A;  5KG3 A;  3OXF A;  1IKW A;  4LMZ A;  2IIH A;  3G82 B;  2NS1 B;  2GMJ A;  2KI2 A;  1S77 D;  1BUX A;  2MPU A;  1T9X A;  2F4V J;  2BM0 A;  2VV5 A;  2WON B;  5C24 A;  1T03 A;  3IBC B;  4JV5 J;  4DHV A;  4C3K A;  3LP2 A;  3W60 A;  3ICL A;  3S8S A;  2NUU G;  4F0M A;  4HL9 A;  5DJB A;  5HQM A;  3W3S A;  1EET B;  5E3R A;  3IXQ A;  5D3G A;  4B3S J;  3PXG a;  3WDO A;  3CF5 Q;  2C3P A;  1PJ7 A;  2I8E A;  1VBX A;  4DX5 A;  2RUG A;  3GP9 A;  3BR9 A;  2ADC A;  3BQ2 A;  1Q86 T;  2HKE A;  2VBW A;  5JXS A;  1YHQ S;  1S12 A;  2YY3 A;  3P5B P;  1Z4U A;  2F4V F;  5L39 A;  3TNV A;  4JV5 F;  1T9W A;  2CQP A;  5C7P A;  1XQI A;  3V4M A;  3RJM B;  2R8H A;  4M5D A;  1SL0 A;  4ES1 A;  4ZPV R;  4B3S F;  3LWM A;  1X7V A;  1MW7 A;  1UJ6 A;  1WKJ A;  1N54 B;  2ZH6 A;  3FGV A;  2BRL A;  3W2W A;  2YNI B;  2O01 C;  3B4M A;  3OSP A;  3J7Z 5;  3L09 A;  2ALY B;  1T02 A;  2O3D A;  3TJ9 A;  3DMJ A;  4FVC A;  3AB4 B;  2XSJ B;  2COL A;  3DM2 B;  3MGJ A;  2JEG A;  5B0C A;  2NLW A;  3GON A;  1JWW A;  3QIP B;  5A8W A;  4ECW A;  3R27 A;  3MR7 A;  2LP4 A;  3MEE A;  4MH8 A;  1DBD A;  3LAM A;  1SKR A;  4WFZ A;  4WYW A;  4CLK A;  3KLH A;  4LSL A;  5THW A;  3TAM B;  1FDN A;  4DU8 A;  2KJW A;  3RUB L;  1ZAX A;  4NA3 A;  1B99 A;  1QTN B;  2C1E B;  2QA4 G;  4URQ U;  1GTH A;  3RB3 A;  4ZLN A;  1LWF B;  1WC6 A;  4C0B A;  4LBI A;  1P27 B;  1WTB A;  3VGT A;  4M5L A;  1RAB B;  2CZ9 A;  4KR0 B;  3QBC A;  3TOQ A;  2OSQ A;  1BQN B;  4X66 J;  2ZNZ A;  1LW2 A;  2MEW A;  4Y0F A;  1IR1 A;  3HSJ A;  3HCX A;  3CCJ S;  4X64 J;  2J76 E;  1N34 J;  3W9H A;  2KM8 B;  1HWI A;  2ZOG A;  4ED8 A;  5KFK A;  4P9S A;  4RWX A;  3RZA A;  3SFG A;  3MPU B;  6AT1 B;  4ECX A;  4CP5 A;  3LO3 A;  2HNZ B;  4K4T A;  1IKV B;  1SCJ B;  2PFF B;  1XBW A;  2AIR B;  3K5M A;  5HP1 A;  3NAH A;  2EEY A;  2XWX A;  4EEY A;  3ETO A;  2J8A A;  5KT6 A;  5KFV A;  1IM4 A;  1JLE A;  1Q16 B;  2DGU A;  4O3N A;  2KG0 A;  3TAR A;  2G9O A;  2V63 A;  3NY0 A;  2AD9 A;  3MEG A;  3KNG A;  2NZ4 A;  4X66 F;  5D78 A;  3CJS A;  4CLY A;  5BYS A;  2GJ2 A;  2CPH A;  2VPZ B;  5T7L B;  4DQQ A;  4I6W A;  2HRY A;  4X64 F;  1N34 F;  3R1L A;  2RUS A;  1TVR A;  4TXS A;  1S10 A;  3OTO J;  4QYR A;  1B7F A;  1TV6 A;  2JOQ A;  3BQ1 A;  1S76 D;  5M2R A;  4QCL A;  4WFA Q;  3IAM 9;  2IDL A;  4WBF A;  2IMW P;  3BSN A;  5B09 A;  1U1P A;  3SXL A;  2GC8 A;  2ZDO A;  1RI7 A;  2BX6 A;  4W90 B;  3GCW P;  4B02 A;  5ETS A;  3MHY A;  4B9M A;  2A6M A;  2YKM B;  1OPZ A;  2CPF A;  2W4C A;  3RW7 A;  2XHW A;  3LTO A;  1FVQ A;  1KFD A;  1D09 B;  4A8S A;  1IWA A;  1T9Y A;  1F6T A;  4LF7 J;  4DL3 A;  5GAG U;  3GJQ B;  2V50 A;  1TTH B;  2DR5 A;  3I4H X;  3OTO F;  2DCL A;  3A3P B;  2K1R B;  2WVC A;  1X4E A;  4LF8 J;  2GVD A;  3MUR P;  3ZC4 A;  5CCM A;  2G2Z A;  5GME A;  3CO0 P;  2AHO B;  1VQ7 S;  3D68 A;  2VFT A;  4NL5 A;  3IMQ J;  8AT1 B;  4DX8 H;  2RF2 B;  4H4O A;  3C14 A;  5I42 B;  3BRE A;  3HVT B;  2QLX A;  4M5G A;  1G4C A;  3CJ2 A;  3CCL S;  2U1A A;  3NGR A;  4MK7 A;  1N36 J;  4M8L A;  1U8W A;  4LF7 F;  1AXQ A;  1T11 A;  2Z30 B;  4CLF A;  3G9C A;  2R7T A;  2VPW B;  4ILL A;  3MOJ B;  2IRX A;  5KT7 A;  3ZNJ 1;  2IA0 A;  1NK4 A;  1HPZ A;  3MM9 B;  4HAC A;  4LF8 F;  4NCB A;  1R27 B;  2C2K B;  3DLL Q;  2QL9 B;  2QLW A;  1NND A;  3IGV A;  4DCJ B;  3G6V A;  3SDE A;  3CMA S;  5KFY A;  1GEH A;  3KTQ A;  3K2Y A;  2DNN A;  3M8P A;  2BAN B;  2MZJ A;  4WU2 A;  5C42 B;  4OHV A;  3DFE A;  3W5Y A;  3HM9 A;  1N36 F;  1IBM J;  2QA1 A;  3M2U B;  1BQM A;  3BR8 A;  4K4S A;  3QFW A;  3FDS A;  3ZXW A;  3DLH A;  1FD2 A;  1VQS A;  1RHR B;  4NE9 C;  4B9L A;  3D3C J;  1WOR A;  3KK1 B;  3VAM A;  1ROF A;  2UUB J;  1K0V A;  1S6P A;  2C42 A;  4C3M A;  5HBM A;  2UUW A;  1KDN A;  3HO1 A;  1KN6 A;  3Q23 A;  5C25 B;  1RGV A;  2OUG A;  2R7V A;  3H90 A;  4CNZ A;  4A8O A;  3VVU A;  1IBM F;  2DY9 A;  4DG1 A;  4N76 A;  3CC2 S;  4G1P A;  3PO5 A;  1P8G A;  1FD8 A;  1HQ2 A;  2J6T A;  4DX6 A;  3J7Y U;  4KGV B;  4CYU A;  4JI8 J;  4LBH A;  2EPI A;  3DHX A;  2C2N A;  3SBM A;  4XK8 C;  1MNE A;  3D6M B;  3JSR A;  4M63 A;  2GJI A;  1KC8 T;  3G6X A;  3JSM A;  2Q6C A;  2XMU A;  3CCS S;  2XMK A;  3AJ2 A;  4C8K A;  4QIV A;  1JLG A;  1IXK A;  5F8L A;  3SQG B;  3H59 A;  2P9G A;  2UUB F;  4A4J A;  2D9P A;  2HMI B;  2FJA B;  3DU5 A;  1TL5 A;  3FEX B;  4QIW D;  2WTF A;  4IFY B;  2M52 A;  3L7P A;  3AY0 A;  5FJ4 A;  3BPD A;  1VLY A;  4RW7 A;  3G87 A;  2A10 A;  3HZE A;  2HSE B;  2DTJ A;  4Q2L A;  4LSN A;  4CQ1 A;  4JI8 F;  1A9N B;  3VHQ A;  5KFF A;  1FX2 A;  4J5O A;  2M8H A;  2RD5 C;  3JAM U;  4QPT A;  3KHH A;  3JTP A;  3V81 A;  4PYD A;  2MJN A;  1K1S A;  4UUW A;  3FFI B;  1S6Q A;  2KYX A;  5HRO B;  1H7W A;  3DGP A;  2DBB A;  2E5J A;  2MQQ A;  3R2C J;  2HZA A;  1WTF A;  4GVB B;  1TKX B;  2WSF C;  4O4R A;  4U7C A;  5F8I A;  4H4K A;  3G6E S;  1F9F A;  1TUV A;  3HVR A;  2V0N A;  4ATN A;  4RNO A;  4JOU A;  2NZC A;  2RS2 A;  2HQ3 A;  1Q0N A;  5A2Q U;  4ILR A;  5RUB A;  3ADA C;  4FS2 A;  4B17 A;  3LPE A;  3ENW A;  2YKP A;  2HQD A;  5J2Q A;  1EQ0 A;  4NZ7 A;  4C2M A;  1Q8B A;  2B6A A;  3D28 A;  2I9S A;  1RWN B;  2EFO A;  1V3Z A;  1VC0 A;  3E01 A;  1DQ9 A;  2CJX B;  1OY9 A;  4L74 A;  2H4Y B;  4PAA A;  7AT1 B;  1GX6 A;  1FCA A;  3QQC D;  4QWD A;  4JUZ A;  4J9M A;  2FHJ D;  1C1B B;  3BPS P;  2RAQ A;  1UPM B;  5DGA A;  2LDI A;  2EFQ A;  1KEK A;  2H9Z A;  1FI4 A;  1U7L A;  1N5Y A;  4DWI A;  4K59 A;  3AD8 C;  3MMJ A;  1RWO B;  5KFU A;  4M95 A;  4FN5 A;  2KL8 A;  2LEP A;  2O66 A;  1HL6 A;  2DIS A;  3UPF A;  2HQG A;  1A7G E;  3FMW A;  1N6Q A;  5K8N A;  4A47 A;  4DV7 J;  5KAK A;  5G0R B;  1AFI A;  1FRH A;  2ZBC A;  4ZP7 A;  3NKY A;  4NWB A;  3KOA A;  3TRG A;  4YOE A;  2AU0 A;  5T14 A;  4UUX A;  1SI9 A;  2W9C A;  2A2D A;  2QLB B;  3EZU A;  2GIF A;  3IM9 A;  3NBP A;  2CPI A;  3QT6 A;  5KFO A;  2AMC B;  1RTJ B;  5JMN A;  3NWR A;  3I31 A;  2DRB A;  4MMO A;  3QWP A;  3TAP A;  3ISN D;  3LGN A;  3U1L A;  1S9E B;  4RU2 A;  3X3U A;  2MZQ A;  5K9F A;  2KM8 C;  1YVF A;  3PHE A;  3RBE A;  5J1E A;  2WW8 A;  2YWE A;  3MD3 A;  4DLG A;  4EMD A;  4ENO A;  3OXG A;  2CG8 A;  2G1D A;  4WFB Q;  3TVY A;  3HZG A;  2XWY A;  3C15 A;  1RWP B;  1M5V C;  2ABY A;  3FSX A;  2R2S A;  2HWH A;  1Q8K A;  5H9E K;  4DV7 F;  2MZ1 A;  3UCU P;  1WAC A;  2NUH A;  3TR5 A;  2ASL A;  4U96 A;  1REV A;  4V19 J;  3DRP A;  4AFF A;  3TA1 A;  4CRJ A;  1T05 B;  2NXN A;  5HAO A;  2YX1 A;  5A6P A;  4DU7 A;  3VGU A;  3LH2 S;  3ZTR A;  3MAQ A;  3TZW A;  4TLR A;  4PKD B;  2WSC C;  2V6A A;  4P75 A;  1U2F A;  2GAH C;  2FLN A;  5F9L A;  5KFP A;  4PWD B;  4KFB A;  4WKY A;  2X1B A;  3MM8 A;  1Q5V A;  1I1G A;  1RTI B;  4U7U D;  3F44 A;  2V94 A;  3R5B A;  1S0N A;  4B3R F;  1QY7 A;  5IQQ A;  5IOL A;  1DLO A;  1U45 A;  2HFN A;  3OVB A;  1ZTT A;  4ZVH A;  3W8G A;  1ARO P;  3SV3 A;  1ULR A;  4B3O B;  2E29 A;  2HHH J;  2HBQ B;  4F4K A;  1GXL A;  4ED7 A;  2UVV A;  2G4B A;  2HNY B;  4C11 B;  2PMZ D;  5D15 A;  1I51 B;  3UO0 A;  2J0W A;  4DV4 J;  4MIW A;  3FC9 A;  1N5S A;  2NXU A;  2CAJ A;  1PBA A;  1Y7P A;  5KFA A;  4DDF A;  4OYP A;  3KLF A;  2Z2M A;  1PIE A;  2WAQ D;  3J7A 1;  4LR7 A;  4YHH J;  5EHH A;  1KR4 A;  1VQM S;  4ANE A;  5AXL A;  4QWC A;  1FKP A;  2XZT B;  4DPX A;  1S48 A;  2PD1 A;  5GAE U;  2HHH F;  3ULH A;  2DVI A;  1PSD A;  3O1L A;  5KFH A;  3UVJ B;  4LFA J;  1NHV A;  3IRX A;  4DV4 F;  1HBO A;  2JL9 A;  2XLJ A;  1YLX A;  3H5Y A;  3KLE B;  3H25 A;  3MMC B;  3KLI B;  1MN9 A;  1TL1 A;  4YHH F;  5KG6 A;  1TL7 A;  1QE1 A;  4NA1 A;  5B0B A;  3CD6 S;  1YX2 A;  4YB6 A;  3UE2 A;  2L9W A;  2MQM A;  2IBK A;  1GMV A;  3MM7 B;  1F5C A;  3C6T A;  4PUO B;  3QRR A;  4LIW A;  4IH7 A;  1GNK A;  4LFA F;  3NGD A;  1HI1 A;  3MCS A;  4Y2K A;  3C2P A;  2FJB B;  1N5V A;  3MTJ A;  5HLF A;  3ZZZ A;  3RYL A;  2UUT A;  2XNR A;  4UF4 A;  5I3Q A;  2QTW A;  3VAJ A;  5L46 A;  1N33 J;  1G2E A;  1IKY B;  2E5G A;  2ZE2 A;  4ZN1 A;  2NYH A;  4LQ9 A;  1G3O A;  2R9L A;  3BM7 A;  3CCE S;  3MM5 A;  3IBW A;  3NXZ A;  4AYB D;  3FBB A;  1J5O B;  4ZJL A;  1HW9 A;  3GFX A;  2FVR A;  3T6B A;  3P49 B;  4BCA A;  3UQS A;  3PCO B;  4KH1 B;  2ATC B;  2F63 A;  1CVJ A;  2OPS B;  1VBY A;  2ZUG A;  2JC1 A;  3V6D B;  1HNX J;  5EDW A;  4KHM A;  4OLP A;  2HIY A;  4KB7 A;  3GV5 B;  1ZPW X;  2ZHB A;  2OTL S;  4F3M A;  1C0U B;  3SQO P;  2L9N A;  4AUK A;  3CJ5 A;  1N33 F;  1HKA A;  2QYC A;  1EX8 A;  3THP A;  2ZZT A;  3CD0 A;  5FLX U;  2ACM A;  1P9Y A;  1PJ6 A;  1DTQ B;  5EWE A;  5JVH Q;  1PAE X;  2KHC A;  4ED2 A;  3DOL B;  1URR A;  5HO4 A;  4RW6 A;  3R5G A;  1EP4 A;  4ZLJ A;  1HNW J;  4ZVR B;  4OHX A;  1S6U A;  4BC7 A;  2M5Y A;  4CTA B;  4DR6 J;  1HNX F;  4Q0B B;  5A8K A;  3GB0 A;  2HLU A;  1RHU B;  1DUR A;  1T3O A;  2KDO A;  1NH8 A;  3CO9 A;  1XTZ A;  2YBV A;  3QFH A;  4P74 A;  1NK6 A;  8ATC B;  2PEB A;  2OO4 A;  2V8P A;  1O51 A;  2VU5 A;  1H0H B;  1W2B R;  5KFQ A;  1HW8 A;  4OYB A;  5D4P A;  1SUQ A;  4A48 A;  5DDO C;  1TL3 A;  2VDH A;  4F4Z A;  3GIJ A;  2ZH9 A;  2L9D A;  1WI6 A;  2F1F A;  2C2D A;  4ECQ A;  1QAJ A;  4IOB A;  2KRB A;  1LW0 B;  1HNW F;  3N5F A;  2JWN A;  2BOP A;  5CXT A;  1KTV A;  3CCW A;  4ZVE A;  2OSR A;  1LEO A;  2DEI A;  5K14 B;  4A8F A;  2H54 B;  4C8L A;  3K5N A;  1VJQ A;  3KJV B;  1RQ0 A;  3J80 Y;  2IA6 A;  4MK8 A;  1OY8 A;  2IC3 B;  1DY3 A;  1K0T A;  4OZ0 A;  5E3C A;  4ECS A;  4UOG A;  1HMV A;  2CZ4 A;  5DS7 A;  2OAU A;  4Z2X A;  2VKR A;  1LK5 A;  3DOK A;  5J1N A;  3S1T A;  2OEK A;  3A12 A;  3V5R A;  3U1M A;  2PMW A;  3LAN A;  2U2F A;  3Q24 A;  4ETX A;  4YFU A;  3A3N B;  1RHJ B;  3HKW A;  2N7C A;  1F1B B;  4IH6 A;  1H6K X;  4LVN P;  1R6Y A;  2K2P A;  2YNF B;  1UW9 A;  2P5V A;  4KTQ A;  1DZ5 A;  4P73 A;  2AJQ A;  3FVY A;  2AZ3 A;  1KQS R;  4OJG A;  1I6J A;  3RU0 A;  1HQE A;  1MN7 A;  3VAG A;  2JLE A;  2J9E A;  1HBU B;  3BGR A;  1EIY B;  1TKT B;  2HND A;  3DI6 B;  3AXM A;  2WON A;  2YX7 A;  1NB2 A;  2WB4 A;  3UFC X;  3MFI A;  3OV7 A;  4FBU A;  2RHQ B;  1R0B G;  4LF4 J;  4DR4 J;  4LR9 A;  1YK9 A;  1U25 A;  1SC3 B;  4O4G A;  4DSI A;  5MLC V;  1HBN A;  1TAU A;  4FP9 A;  2W7P A;  1BY9 A;  1S1X B;  1HIY A;  3PG9 A;  2PMH A;  1V9O A;  4OIX A;  4LFC J;  3C46 A;  1UP1 A;  2YNG B;  1S1U B;  2HVD A;  1M0S A;  2CJA A;  3P3D A;  3SZ2 A;  2JRS A;  3OFH A;  1JLQ A;  3Q8S B;  4USU A;  1RTD A;  2G0J A;  3ETM A;  4OHZ A;  4LF4 F;  2IFX A;  4DR4 F;  1HNV A;  4ED0 A;  1YBU A;  1J2V A;  4JB8 B;  1XN9 A;  2O67 A;  2XMV A;  4NLO A;  3QPI A;  2Y1L B;  3IWX A;  1U49 A;  3H20 A;  5GMD A;  1JB0 C;  5DZ7 A;  5HMW A;  2YNI A;  2MLZ A;  3QNW B;  3R7B B;  1Q78 A;  3ZZR A;  4PWW A;  1F0X A;  2FDN A;  4LFC F;  4C48 A;  5E2Q A;  4WCE Q;  3GII A;  4NLQ A;  2DHH A;  4USW A;  5CA5 A;  3ZNU A;  3D6T B;  1ZYQ A;  2OI2 A;  4NZ6 A;  3OL6 A;  4JI5 J;  1WG1 A;  2KB2 A;  4WP9 A;  2JEJ A;  4OV6 A;  3ZTS A;  5GAG I;  2XCA A;  3A8J A;  4KYZ A;  4I67 A;  4Q43 A;  4ER8 A;  4UQG A;  1QM9 A;  5F9N A;  3CJK B;  1VC5 A;  1N48 A;  1EAR A;  5KFC A;  5A0Y A;  1NK0 A;  3GJT B;  3TWZ A;  4DBQ A;  3TZY A;  2YH1 A;  2DGW A;  1D9A A;  1VYA A;  4CDI A;  2XLI A;  4B9T A;  2M4M A;  3AH6 A;  1FKO B;  1RAE B;  4ZCK A;  1BWV A;  1N8R T;  1TR0 A;  3AAW B;  4RKU C;  1Q95 G;  3MTK A;  3FQK A;  4G3I A;  1VBK A;  1RIS A;  2MZT A;  4MIA A;  3KHG A;  3WIV A;  1KQG B;  5HI7 A;  5DM6 Q;  4JI5 F;  1KWM A;  1TQL A;  3U7J A;  4DF4 A;  5SUH A;  5IT9 Y;  1KRP A;  3ET6 A;  1TK0 A;  3NAI A;  4OZ3 A;  3D6F B;  2EC0 A;  1OQ3 A;  2HHU A;  2ZDP A;  3OVA A;  2Z57 B;  2CKW A;  2JFK A;  2F65 A;  2E5I A;  1Q81 T;  3HSG A;  4OI4 A;  2V4Q A;  4MK9 A;  4FXD A;  1WJ9 A;  1EKS A;  3ZZ0 A;  4CO1 A;  4MAK A;  4O44 A;  1UVL A;  2UP1 A;  4DV1 J;  2P6S A;  1IWG A;  2YNH B;  4ZVQ B;  4IDK A;  4FYY B;  1AYE A;  3GJS B;  4UT4 A;  1RKI A;  2AX1 A;  1S57 A;  3QWU A;  4PXB A;  3KHR A;  4QU6 A;  2ZBP A;  4F3Q A;  3PHT A;  2J5A A;  1UWB B;  3OTB A;  1RT3 B;  2CPX A;  3NCR A;  4HI1 A;  4AQY J;  2PFD A;  2B0G A;  4ZCL A;  2MSS A;  3VR1 A;  4F4X A;  4KHP J;  2GVZ A;  2LDY A;  3GMG A;  1YJV A;  3TO8 A;  4DV1 F;  3RRH A;  1RYR A;  1T7P A;  4QYZ K;  4RJV A;  4ED6 A;  2BQU A;  4TNO A;  1CJK B;  3QT8 A;  3O2I A;  2L3M A;  2DCU B;  4CWB A;  1NKC A;  4ZP6 A;  4FYW B;  4ZVP B;  2DR6 A;  5BXI A;  1JXV A;  3KLG B;  4ES2 A;  4GRS A;  1L3T A;  2MKC A;  2F9D A;  1JKH B;  3JTO A;  1AA1 B;  4X4S A;  4GO7 X;  1C1C B;  2WVF A;  1Q5Y A;  1SKU B;  3PRB A;  1IN0 A;  2DR7 A;  2FVP A;  2B56 A;  5DRK A;  4L75 A;  1M5O C;  3AJD A;  1EJ7 L;  3D0H E;  4AQY F;  3RW6 A;  4DSL A;  3J7Y I;  4USK A;  1QDU B;  4ICL A;  2VIC A;  3IN5 A;  2IMO A;  5DQH A;  2IYI A;  4PXC A;  1NJI T;  1TUG B;  3UR3 C;  2R2T A;  1BGX T;  4KHP F;  4L3K A;  1WHV A;  2KKH A;  2RT3 A;  4NLV A;  2CPY A;  3UD4 P;  4F0K A;  2E9R X;  1T0T V;  1M5K C;  3AFG A;  5HVF A;  1CJU B;  3O3L A;  1RLD A;  2YWG A;  1AUS L;  5LMN J;  3JQK A;  2GW8 A;  1DTT A;  5B0E A;  5C5J A;  3TAN A;  4WPA A;  2FYX A;  3B54 A;  4FPR A;  2NPI A;  4O0N A;  5KFM A;  2QIF A;  1L3K A;  5D8H B;  1SL1 A;  1D3W A;  3VAI A;  3QGI A;  1NDP A;  4P2S A;  3FSI A;  4U67 Q;  3Q8U A;  3B8H A;  3HHN B;  2WOM B;  3QRQ A;  5JJB A;  2PSZ A;  3H7H B;  3BBC A;  2GHV C;  5KT2 A;  2ASJ A;  4JYA J;  4ZPC A;  3CDE A;  2YKQ A;  1NAQ A;  3RRK A;  2HHS A;  4TU9 A;  3CC7 S;  1JJH A;  2AYM A;  1V3S A;  1F3V A;  4H4M B;  1YJW S;  3NMR A;  2BDP A;  2EFP A;  3D2W A;  1HQU A;  1FDB A;  2XQC A;  1SB6 A;  5LMN F;  4Y28 C;  3R6G B;  3LP1 B;  3TA0 A;  4JI3 J;  3E51 A;  4RW8 B;  4CLZ A;  3PW4 A;  2KT5 A;  4OYI A;  4HR2 A;  4YDD B;  2A1B A;  4TVA B;  5C42 A;  2PDA A;  1FTC A;  4HHJ A;  1JLB A;  2HWI A;  4WZQ A;  3NEK A;  5CYQ B;  3SCJ E;  4U8V A;  1GFW B;  2PA8 D;  5L1L A;  2DGS A;  3KK2 B;  4JYA F;  5KFB A;  5L1K A;  4E0D A;  3CDA A;  4OHW A;  4EFA C;  3DYA B;  5D0R A;  2W8K A;  1AUD A;  3MMA B;  2MGZ A;  1C2P A;  4YR0 A;  3K58 A;  2YKN B;  4Y6I A;  1YZ6 A;  2QZ8 A;  4WU3 A;  4N56 A;  5KFI A;  3BSC A;  4JI3 F;  2VD3 A;  1JX4 A;  1OPI A;  2M70 A;  5DQI A;  1FT8 A;  3US5 A;  2F3J A;  1FNX H;  5C25 A;  1Q4R A;  3BGL A;  4WE1 B;  5D4O A;  4WP3 A;  2FY1 A;  2LXF A;  5DDQ C;  2CJQ A;  4ED5 A;  1TK5 A;  1RA7 A;  1RAC B;  1CPZ A;  2G13 A;  1S97 A;  4TKT A;  4GKJ J;  3ISN C;  2D69 A;  3L4B C;  3FQL A;  1FXR A;  5M2P A;  4OHY A;  4NLG A;  1X4G A;  3F0N A;  2C2Z B;  3M8S A;  7FDR A;  2UVR A;  2XS5 A;  4F4A A;  1LV5 A;  5C2C A;  4QJV A;  4LFB J;  4UOF A;  4HLB A;  3CW2 C;  6FDR A;  4TN2 A;  3SCK E;  2QSF A;  3AJ1 A;  2CQC A;  1WC5 A;  1RAH B;  3NGK A;  2K7K A;  2YQ3 A;  3H98 A;  2ZH4 A;  3LP0 B;  1KKH A;  5KOW A;  3CDU A;  4FNI A;  1RA6 A;  3Q2T C;  5HJY A;  4K4Y A;  4HT5 A;  2JZ5 A;  2V2Z A;  4EZ9 A;  4GKJ F;  2D3O R;  5IV3 A;  1T3N A;  3DDI A;  3CCT A;  2L48 A;  3ENV A;  4WWS A;  1UZD A;  2B4V A;  4YS2 A;  5KFZ A;  4DQR A;  4LFB F;  4ECT A;  2FVC A;  5CH7 B;  3DLK B;  1PC5 A;  4DR5 J;  3K0J A;  4URG A;  1TFY A;  2ZH5 A;  1FES A;  2KO1 A;  3OW2 R;  1RKJ A;  4LF9 J;  1HI8 A;  2R4F A;  1ICE B;  2OPQ B;  3OPK A;  3M6U A;  1IKX A;  4LRE A;  2XC9 A;  2R2U A;  3KJF B;  4O3R A;  3GJR B;  2ZM6 J;  2MKK A;  5B0D A;  4YP3 A;  3QT5 A;  3ZTO A;  1RT2 A;  2WHO A;  4IO9 Q;  2LLZ A;  1DQ8 A;  2BAC A;  1HD0 A;  3LA0 A;  2HGM A;  1HWK A;  3HFK A;  1S4E A;  3L95 X;  4RW4 A;  3UDV A;  4DR5 F;  2XYG B;  5FD1 A;  3ILO A;  4ID8 A;  2VOO A;  4M5J A;  4LF9 F;  1HYS B;  2JHE A;  4ZOS A;  2AWZ A;  4XAK A;  4X4O A;  2APO A;  5J2N A;  2EXU A;  1RAA B;  2DNH A;  4CO2 A;  5CHC B;  1S0V A;  1B0V A;  5A8R B;  4C0H A;  2HQC A;  1RK8 A;  4UY8 T;  2ZM6 F;  3TEH B;  4E8U A;  1OSC A;  2MQN A;  5CYM A;  4C97 A;  2RQC A;  3D1O A;  4I0W A;  3HJV A;  3HHK A;  3M9O B;  2D3Z A;  2KVI A;  1M5S A;  1FJ7 A;  4K2X A;  3OR1 B;  5LT5 A;  2H48 B;  1AZS B;  3RAX A;  4RW9 B;  2XO6 A;  4ZHR B;  5HVG A;  3PW5 A;  3UD5 A;  3T19 A;  4J37 A;  3MXH P;  1H73 A;  1LWC B;  2QJ3 A;  1SH0 A;  1U4B A;  4NCG A;  1X4A A;  1H3D A;  5BJR A;  1QSS A;  4KY3 A;  4ZDN A;  5HVH A;  1H72 C;  5GAE I;  2EKN A;  1BWE A;  4XPE A;  2K7J A;  4KPC A;  2J9C A;  4LUB A;  1S9G B;  5F8J A;  2UVW A;  1E6Y A;  2DO0 A;  3NNH A;  2H1Y A;  1APS A;  4KIA A;  3MPD A;  4DR2 J;  2OPP B;  2DR8 A;  1S9E A;  4R5P B;  4KKO A;  2KZM A;  4F4W A;  2ROE A;  4G1Q A;  2LXU A;  4QOT A;  4ANC A;  2Y9H A;  4M5N A;  2LVW A;  3ZFV A;  2DGT A;  5LXY A;  3HHL C;  4HHH A;  3M7V A;  4B9N A;  3ZZP A;  2D3O 1;  3K7R A;  4IG3 A;  2RHS B;  2GCF A;  1GX5 A;  2QMW A;  1QD1 A;  5HMX A;  3CUN A;  2XZW A;  1RTH A;  4Z7Y A;  1VQ4 S;  3M8R A;  2H5J B;  3H2U B;  1T05 A;  1YDL A;  2MKI A;  2Z58 B;  2EC2 A;  4DR2 F;  3N5B A;  4Z7C A;  1JMT A;  1KVJ A;  3W8P A;  4DR3 J;  4NYZ A;  2KTQ A;  1JLF B;  1SBR A;  3CJ8 A;  3KWM A;  1Q7Y T;  4K5S A;  3E3X A;  2CAD A;  4Q8F A;  2C2E A;  1W25 A;  1YRT A;  3TVZ A;  2XLK A;  1M5H A;  2CQ4 A;  1C0T A;  3GQC A;  1IKW B;  1X4H A;  2DNR A;  2DHG A;  5GAH I;  3LQV A;  4K2J A;  4ZIV A;  3BH7 B;  1VIX A;  3EX7 B;  2CDR B;  1HLW A;  4EZ6 A;  5KFL A;  2JVR A;  2HHW A;  2KJV A;  1LWE A;  5C24 B;  4YUD A;  1T03 B;  2OD4 A;  3CPW R;  5ETL A;  4O3S A;  2B8P A;  4OZJ A;  3FSY A;  1OYE A;  3EDR B;  3I0R A;  4DR3 F;  1W2I A;  5HMY A;  5D3G B;  3CJR A;  2ZH2 A;  1UTA A;  4FBT A;  1VHI A;  2FJW A;  2CQ1 A;  4PQU A;  4OJH A;  3M6X A;  2XYH B;  4IFV B;  2RIJ A;  1FTR A;  4NLD A;  4C4W A;  5IT0 A;  4TY8 A;  1S7H A;  2CPE A;  3RBD A;  4Y3C A;  3KJN B;  4AL5 A;  2BBE A;  2XZD B;  2RNE A;  3M8Y A;  1BD6 A;  3Q8Q B;  3H2V E;  1BQX A;  3L3C A;  2GMH A;  4KE5 A;  3ZZT A;  3UVJ A;  4M5D B;  4DL0 C;  1CEZ A;  2XO7 A;  2RRB A;  1UWA A;  2VF3 A;  1NPK A;  3LGH A;  4UTG A;  4OZ1 A;  3S01 A;  3KLE A;  2MHE A;  3SMZ A;  1WOO A;  2UZA A;  1LQ9 A;  5IM0 A;  3W2W B;  3K5L A;  3K89 A;  2I5J A;  4KQZ A;  2AGO A;  1QVF R;  2RE1 A;  2IM3 A;  3I56 S;  3DMJ B;  1UEK A;  1QAY A;  3N28 A;  5J2M A;  2EG1 A;  2FC8 A;  3ISZ A;  5KOX A;  2EFV A;  2Z0G A;  3HSZ A;  5A8W B;  1LFW A;  1UVJ A;  3MEE B;  3D1H A;  3PZP A;  2JLF A;  4NPO A;  1KOO A;  4RNM A;  3T6J A;  1GXT A;  3EXY A;  1FE4 A;  3KLH B;  4LSL B;  3CCZ A;  2YPZ A;  1FJE B;  5MAO A;  2ZKU A;  2XTJ P;  3EMT A;  2IHR 1;  2VQF J;  1JQG A;  1NKB A;  3CC4 S;  2NXJ A;  3TA2 A;  1SIW B;  2VG5 A;  5HK4 A;  2DB1 A;  4IH5 A;  1W26 A;  4PXE A;  3HT3 A;  2VG6 A;  4I4B A;  1LOU A;  5AE2 A;  4USH A;  2EK6 A;  1IKY A;  3RR7 A;  1XR5 A;  2WVD A;  3N79 A;  1UL3 A;  3FK4 A;  2OTJ S;  4GC7 A;  1WEX A;  2B9X A;  2QA4 S;  1VK8 A;  5DM7 Q;  2WVB A;  3PKM A;  3TX8 A;  1LW2 B;  1PG5 B;  3M2V A;  3AA8 A;  3KK3 A;  1RHQ B;  2B9E A;  2ZFH A;  3VAK A;  3IWN C;  4ED4 A;  2V5H G;  4URS A;  1NSK L;  3V6D A;  4CO4 A;  4Q8E A;  3AOC A;  1OQ6 A;  3PFO A;  3W65 A;  1FJC A;  1WF1 A;  2LQJ A;  3PX0 A;  5DDR C;  1K44 A;  5EX0 A;  4F25 A;  4NLP A;  2VKZ G;  2VQF F;  4LRD A;  2J9D E;  4J9Q A;  3HVW A;  5CZX A;  5HP1 B;  1RAO A;  1HR0 J;  4K4X A;  2VG7 A;  3PYD A;  1XK8 A;  2C22 A;  3BF4 A;  1JLE B;  5EWF A;  2I2Y A;  1NPR A;  1QLN A;  1NH7 A;  3MEG B;  4MKB A;  2ZVS A;  2JNJ A;  3TI0 A;  2YWH A;  3OTC A;  1Q1K A;  1Y3K A;  1TVR B;  3M2R A;  1NK7 A;  3BJY A;  2FD2 A;  1TV6 B;  3CED A;  3PR4 A;  2BE2 A;  2C3Y A;  3Q0A A;  4YB5 A;  1VIO A;  1RAG B;  2LEB A;  2GQC A;  4ERD A;  4DPW A;  1HWU A;  1HR0 F;  4FYV B;  4I6Y A;  1VMB A;  5LSO A;  2FHJ A;  4JI0 J;  3KNA A;  4RZR A;  3EZ5 A;  3DXS X;  1S9F A;  3AQO A;  4K0K J;  5HL7 Q;  2H65 B;  3I5C A;  4EBC A;  4WXW A;  1VOM A;  1RP5 A;  3V6H A;  5KFD A;  1RDR A;  1U8S A;  3DRS A;  1PC4 A;  3FKB A;  4PG6 A;  4MKV A;  2YWW A;  3UN5 A;  4AXI A;  3MM6 A;  4P6Q A;  3I87 A;  4AD6 A;  5K14 A;  2GVD B;  2HBY B;  3KJV A;  1S72 S;  1UZH A;  1VIS A;  3CTR A;  1U47 A;  2X3G A;  4LJM A;  2CFX A;  2AEM A;  4H4O B;  3C14 B;  5ADZ A;  4JI0 F;  1ZM2 A;  4N5S A;  1QSL A;  3RB0 A;  4P2M A;  4BC9 A;  3TAQ A;  1MRO B;  3HFV A;  2QMU B;  1P1T A;  2C3O A;  3QJJ A;  4K0K F;  4D3G A;  4F8R A;  1RU2 A;  1MWZ A;  4DR7 J;  3HI9 A;  4FPI A;  3GG1 A;  2DHS A;  5KG4 A;  2V4J A;  2GIR A;  2GHW A;  2RVJ A;  2AGQ A;  1PYT A;  3TX0 A;  2E1M C;  5J1P A;  1WUU A;  2VFV A;  4A8Q A;  5K5M A;  3I0S A;  1VS3 A;  2XGQ A;  1HPZ B;  4HAC B;  2PT0 A;  3H4D A;  2VC1 A;  3V6J A;  5H9F J;  1FFS B;  1S1V A;  3DOM A;  2NSC A;  1NXI A;  3WQP A;  3SDE B;  4PYA A;  3KG1 A;  3IS9 B;  4X4R A;  1FWP A;  4X4Q A;  3CCU S;  4MKY A;  1DJ0 A;  3PJX A;  1V5V A;  3M8P B;  5KFX A;  4DV0 J;  1NZ8 A;  5DZ6 A;  3NOC A;  4DR7 F;  5L9N A;  4MYT A;  1BQM B;  2AZ1 A;  1B3T A;  1NHU A;  1CS4 A;  1IVZ A;  1MLA A;  2LA6 A;  3EDQ B;  2UV8 A;  1YRU A;  3CSK A;  3PTW A;  4ZPT R;  1SKW A;  1WDT A;  2HUR A;  3DGV A;  4LSZ B;  5HQ8 A;  3QLH A;  4I7F A;  2E9Z A;  1M1K T;  2NYI A;  4M5I A;  2DGX A;  1S6P B;  5HBM B;  2IY5 B;  2KXN B;  4DV0 F;  2CQ3 A;  3EVM A;  2GV1 A;  3MCM A;  3P4U B;  5ETK A;  1SQE A;  4HEA 9;  4L6V 3;  3BQ0 A;  2MZS A;  4DG1 B;  1NCL A;  4L73 A;  3OL9 A;  3E2E A;  4MYU A;  3G4S S;  1TP7 A;  5F3Z A;  1T9V A;  1TKZ A;  4CYU B;  2LQ9 A;  1WKK A;  3PYF A;  5F0W A;  1PKU A;  1YTY A;  3R8Y A;  4C98 A;  3PO4 A;  2R7R A;  1OIA A;  2ASD A;  3TUI C;  3PX6 A;  4ECV A;  5D4L A;  2HAI A;  1JLG B;  4G65 A;  5IT4 A;  4UZC A;  4C6A A;  4RO0 A;  2LEC A;  1AT1 B;  1M90 T;  1B64 A;  1JJ2 R;  2OH2 A;  2DKO B;  3D1Q A;  2J0S D;  3UNG C;  4AL6 A;  1QSY A;  4RW7 B;  2M0G B;  3QGP A;  4CT9 A;  2MDA A;  3BO4 A;  4GMK A;  3R5C A;  4X4V A;  4LSN B;  2DEJ A;  3PDN A;  2EBE A;  1FXD A;  2ALZ A;  4EGL A;  5CAB A;  3JYT A;  1I94 J;  4FF1 A;  4EU0 A;  3SCL E;  1KS2 A;  1NO8 A;  3MOZ A;  5IWA J;  5M2U A;  2MMY A;  2Q79 A;  1T95 A;  3V81 B;  1RAJ A;  3BKT A;  4J9L A;  3OFG A;  1F9H A;  3OSN A;  1D9F A;  3DGP B;  3EYZ A;  3CJT A;  4WFX A;  2MJU A;  2CNL B;  2ZH7 A;  2R8J A;  3ILI A;  2ZWP A;  3QO9 A;  2AJF E;  4DR1 J;  3NWG A;  1CJT A;  3VQT A;  1HBM B;  2NRE A;  1S49 A;  2L08 A;  5CCL A;  3C16 A;  3PJW A;  1VQY A;  2ZEJ A;  1VQL S;  3CD7 A;  2B4P A;  2FGO A;  1S1T A;  1U1R A;  3QGH A;  3ELH A;  2B6A B;  2ZZN A;  2IRU A;  1I94 F;  3R2D J;  4WZM A;  1XC9 A;  3IG1 A;  4WII A;  3W9J A;  3HHL A;  5IWA F;  4QWE A;  2XHC A;  1VK3 A;  3E01 B;  2N4D A;  4LVO P;  3RRG A;  2ZH8 A;  1RYS A;  4K8R A;  4NRT A;  3BS9 A;  4ZA1 A;  4QQB A;  5KG7 A;  4LIR A;  4DR1 F;  3KXD A;  3K17 A;  3Q8Y A;  2CJK A;  4H54 A;  1N5Y B;  5DGB A;  2W2M P;  2XCP A;  1F2H A;  2OHD A;  4ZIW A;  2HG4 A;  3KG4 A;  4G1I A;  3V4I A;  2FLL A;  4RR5 A;  1TMM A;  2CA9 A;  2DK2 A;  3QSI A;  1N4L A;  1PO6 A;  2AYB A;  1S59 A;  1RXO B;  1TL4 A;  1X60 A;  1FHT A;  2QE5 A;  1N6Q B;  2DXD A;  3IFE A;  3UCZ P;  1WSV A;  5IS2 A;  2UVU A;  2XYP B;  2VQE J;  2YWK A;  2HHT A;  4CLL A;  2FUG 9;  2W9C B;  2E9T A;  2HFZ A;  1JKH A;  2DIT A;  1F9E B;  1WEZ A;  2G0C A;  3ENA A;  2J9D A;  1N88 A;  4Z37 A;  3H5X A;  4NEY A;  3GIL A;  3ITH A;  4P2F A;  2BAB A;  1X5P A;  3TZZ A;  1MML A;  1LK7 A;  1N0U A;  3POT A;  3NS7 B;  4OZ2 A;  1SXL A;  5J1E B;  3EGN A;  5F0U A;  1SC6 A;  2FHM A;  4YY3 J;  4HDH A;  2XMJ A;  7FD1 A;  3C15 B;  4J9P A;  4L76 A;  1F5A A;  1FVS A;  2R3V A;  3UNY A;  3DLB A;  3RAM A;  2GHP A;  4S0M A;  3QID A;  2H4W B;  4NX9 A;  4EUV A;  3DNC A;  4USI A;  3OJU A;  1M1G A;  5DET A;  1CJU A;  4CLT A;  2VQE F;  3MEC A;  3DRR B;  1REV B;  4OYW A;  2W4P A;  3TJA A;  3VQS A;  3BO3 A;  3DRP B;  1KVI A;  1IQZ A;  2A6O A;  3C66 A;  1HHS A;  2MZR A;  3BYR A;  4J9S A;  3A13 A;  1QUP A;  3MR6 A;  1HNI A;  3H2L A;  1Q8I A;  1R7I A;  3GYG A;  3EVO A;  4A8W A;  2R8G A;  3KKF A;  4KFB B;  4DS4 A;  3MM8 B;  3SSS A;  3T1H J;  1HNZ J;  2Z2Z A;  2JVO A;  2N3O A;  1CQM A;  5GVQ A;  4YY3 F;  2CYY A;  5KT5 A;  3H5S A;  2HK2 A;  3HX9 A;  2X1A A;  1CJV A;  3W5X A;  1RT4 A;  3MEK A;  3CNQ P;  2WBM A;  3PIP Q;  1OS5 A;  2ZJP Q;  1DLO B;  3GFH A;  4BHQ A;  2RQM A;  3RGI A;  5FDL A;  3NG8 A;  4C8Z A;  2BQ3 A;  2GML A;  1Q7L B;  1RWX B;  1ZA2 B;  2F40 A;  2OEJ A;  2ZC4 A;  2A0F B;  3GG0 A;  1UA1 A;  3ENQ A;  4BBY A;  1YG0 A;  3LF0 A;  1YIJ S;  3C8Y A;  1VI7 A;  3MED A;  2MXY A;  2QT7 A;  4ZKA A;  3N6M A;  3HXM A;  1RCX B;  3T1A A;  4JBC A;  2QL5 B;  2IRY A;  2JFD A;  3T1H F;  1HNZ F;  2HFV A;  3Q8V A;  3KLF B;  1ZPV A;  3QGG A;  4OMF G;  4NRU A;  4IRC A;  2IM2 A;  2BKN A;  1OMS A;  4QPX A;  1YJN S;  3ZO7 A;  4MFB A;  4QW9 A;  4ZPB A;  3GR0 A;  2W2O P;  3OUY B;  4OX6 A;  4RBT A;  3MMA A;  4OL8 A;  2VAS A;  1RT6 B;  4OLO A;  1FKP B;  2BXJ A;  2FLO A;  2MY8 A;  4R8U A;  1B4S A;  3AXK A;  3FBF A;  2UU9 J;  3NRB A;  1GMU A;  5L8R C;  5E3A A;  1WD6 A;  2FZG B;  2BE9 B;  3EGV A;  1KSP A;  3IRX B;  5I3U B;  1HBO B;  5JUM A;  3M8Q B;  2BVZ A;  2HGL A;  1P6T A;  4W92 B;  1BHN A;  1MU2 A;  4UZB A;  4F3O A;  4YQW A;  4NML A;  1TL1 B;  2F9J A;  3THT A;  1TL7 B;  2W01 A;  1O8B A;  4ZVO B;  5KTQ A;  2POK A;  2UUA J;  1FWK A;  1NK9 A;  3MDF A;  4W4M A;  1D8Y A;  4DSF A;  3P96 A;  2D7S A;  2MB0 B;  2ADB A;  3M8Z A;  4M5M A;  1JXL A;  2DIV A;  2UU9 F;  1WG4 A;  4UW2 A;  4F02 A;  3EGW B;  2HQI A;  4NA2 A;  3C6T B;  3PM9 A;  4ELU A;  1Q8L A;  3U02 A;  1Y5N B;  4I2P A;  2Y0B B;  3H40 A;  1C4C A;  3GIM A;  3QZ7 A;  4CLW A;  1OWX A;  5HLF B;  2F8M A;  1D1U A;  1VLO A;  1ZS6 A;  1GTE A;  2OMO A;  1KLM A;  5EGY A;  2KFZ A;  2BJ7 A;  2UUA F;  1FFG B;  3IBF B;  4Y2A A;  1JNR B;  2ZE2 B;  2OPR A;  2GO9 A;  3MM5 B;  3N0V A;  4N41 A;  3D66 A;  2F8H A;  2B5J A;  1ZTW A;  1UFL A;  5EX3 A;  5DG9 A;  4IG0 A;  4WFN Q;  4N7T A;  2CNK B;  4X4P A;  4IR1 A;  1JJC B;  2VBZ A;  2C2O B;  2GS8 A;  3P6Y C;  1RT7 A;  2CJ9 A;  3W2V A;  1XNQ J;  3HFZ B;  4EI2 A;  1H2T Z;  1PBU A;  3QT7 A;  3Q2S C;  3C6U A;  4PG7 A;  2BV3 A;  1VQ8 S;  2DGV A;  3AD7 C;  2BJ1 A;  1OO0 B;  4OYO A;  1FDA A;  4FF4 A;  1YJ9 S;  2DJW A;  4CO0 A;  2YTC A;  2MQO A;  4U95 A;  5D0H A;  4CI0 B;  4TQR A;  1FRJ A;  2FHO B;  2HHP A;  3HDS A;  1G1X A;  3KDN A;  4U7U K;  2VOP A;  3FRZ A;  2I0X A;  2XM3 A;  2KXF A;  2AEJ A;  2DIU A;  3W62 A;  3HHE A;  4ELV A;  4RW6 B;  4N8O A;  4CIO A;  3O6Q A;  2DH7 A;  3DDK A;  4I2Q A;  3LAK A;  3ZZO A;  5KFN A;  1EP4 B;  4ES3 A;  2V2Q A;  2BW2 A;  2DNG A;  1NLK L;  1HWL A;  2HYI B;  1XNQ F;  5D77 A;  1RT5 A;  4OYA A;  1V5I B;  1HFE L;  2Q1L A;  3NLC A;  3OR1 A;  5E33 A;  1HAR A;  3RBZ A;  4DV2 J;  3PX4 A;  3ZZY A;  4R0E A;  2RDI A;  2YKO A;  2R8K A;  1FO1 A;  4OI0 A;  1LWC A;  5FII A;  1J5E J;  2QN6 B;  1SUQ B;  2WW4 A;  4YB7 A;  1VRU A;  5ETP A;  1TL3 B;  3HLU A;  5ETR A;  4J90 A;  4NLU A;  2IVF B;  3BSO A;  1UKU A;  1U0H A;  2ZNY A;  1I5O B;  5T41 A;  1YWX A;  5J2P A;  4WK1 A;  2ZOM A;  4FF3 A;  4K4V A;  3DXB A;  2DPJ A;  4R5P A;  4FS1 A;  1FF2 A;  1R8B A;  3N01 A;  4P52 A;  3GV7 B;  4DV2 F;  1SL2 A;  1GMW D;  3G8T A;  1FK9 B;  2ASY A;  1RT1 A;  2VDI A;  2JJ4 D;  2X1G A;  1RUS A;  4OQJ A;  4IKA A;  3W9I A;  4HKQ A;  1U2R A;  2JDJ A;  5JVG Q;  1J5E F;  2FVQ A;  2XB2 D;  4B08 A;  1UEV A;  1HMV B;  4YR2 A;  2J7U A;  2HS3 A;  1JXE A;  2V67 A;  1GQE A;  1RWU A;  1XNR J;  4DX7 A;  3DOK B;  3PR5 B;  1S1W B;  2CXE A;  4DPT A;  4PRF A;  2MKJ A;  3R7S B;  3IO1 A;  3K59 A;  3L7U A;  3JAM Y;  1YGY A;  4QW8 A;  3JQJ A;  4F2S A;  2R7O A;  3EXC X;  3G71 S;  1WC3 A;  2VBX A;  4RPF A;  1E6V A;  1CQN A;  2V34 A;  1JLC A;  1UVK A;  3VWS A;  4DL4 A;  1IUJ A;  2V69 A;  2OLW A;  4ZJO A;  1XER A;  1Z1Z A;  3M1V A;  1HQE B;  1NPP A;  9RUB A;  3PV8 A;  4IR9 A;  2AJ1 A;  4Y2I A;  4EYH B;  1RWM B;  4C3L A;  2ILZ A;  4PEO A;  2X7I A;  3BGR B;  1XNR F;  1F2G A;  1B7Y B;  5A2Q Y;  2HND B;  1N56 A;  2H51 B;  1KHV A;  3M30 A;  5DQG A;  4OZ5 A;  4L72 B;  5B08 A;  2CPJ A;  4OI3 A;  1VDH A;  3OFE A;  3J81 j;  2ZD1 A;  2CNN B;  3K5P A;  3KLV A;  2IYG A;  3ZTQ A;  1SC4 B;  2V8G A;  3H4B A;  4O4G B;  1HBN B;  2KHD A;  2V4R A;  5IV4 A;  1YQH A;  4FDF A;  4WIQ A;  2B9W A;  2DNK A;  2EBG A;  2E66 A;  2SXL A;  2CVI A;  4OJ3 A;  4IFV A;  1L3S A;  4C8Y A;  2W9B A;  2XI2 A;  2HRT A;  4ID5 A;  1R89 A;  4NZ0 A;  3NL0 A;  1JLQ B;  4Q5V A;  3D5M A;  1RTD B;  5F8M A;  3MF5 A;  1HNV B;  3GSI A;  4J7C A;  2CQD A;  2IJR A;  4O3Q A;  3S7R A;  2XMM A;  1TZ0 A;  2J6S A;  1U24 A;  1T8E A;  2W2P P;  2CPZ A;  4FYD A;  2HHQ A;  2BJ8 A;  4JV1 A;  1L5U A;  1KQF B;  1CUL B;  1UET A;  1LXJ A;  3L7O A;  3WC0 A;  4D3H A;  4RBU A;  2Z4P A;  3DLE A;  1KOH A;  2GGP A;  3Q86 A;  4J9K A;  3M32 A;  2E7W A;  5F41 A;  1UJ4 A;  5DG7 A;  2FPH X;  2K8G A;  1X4C A;  4UQT A;  3T3F A;  4FKX A;  2VPX B;  2GZO A;  1RWK B;  2E7X A;  1NUE A;  3NGT A;  3DDN A;  1NJX A;  1R0A B;  5E41 A;  1KFS A;  5A0Y B;  1EHW A;  1U0S A;  4LF1 A;  3GYN A;  2HS4 A;  4NYO A;  1K8A T;  4V19 X;  2R8I A;  5ETT A;  1Q82 T;  1WF2 A;  2HS0 A;  2UXB J;  2PO4 A;  3HSD A;  2G2Y A;  4TLQ A;  2P6T A;  3K8V A;  3DC2 A;  3F56 A;  1RHM B;  2YX4 A;  4KV8 B;  2P9C A;  3R6L B;  3CJ4 A;  4A8Y A;  4LBP A;  5GMK a;  4FXV A;  4FKY A;  2CWK A;  4DN9 A;  1ZBT A;  3ET6 B;  2EVZ A;  4CM2 A;  1UVN A;  2NXE A;  4KBI A;  2H5E A;  4QIE A;  1NB7 A;  4RWW A;  4LF6 J;  1Y10 A;  1DHM A;  1XMQ J;  1U02 A;  1NJY A;  3OR2 A;  2UV8 G;  1F5B A;  4OV1 A;  1DFD A;  4O44 B;  1JLA B;  4DR6 F;  5KFJ A;  2W7A A;  3CJ3 A;  2K3K A;  2RU3 A;  1Z2Z A;  2OFH X;  2NPF A;  4RUC A;  2UXB F;  4P71 A;  1RBA A;  2LMI A;  2MQP A;  4WJB A;  4IDK B;  1EKR A;  1TK8 A;  3C3L A;  1U2C A;  3FEZ A;  2V8V A;  2NSB A;  3VTI A;  1XWL A;  3ILJ A;  5KG1 A;  3FZB A;  1VCT A;  3VAF A;  3PIO Q;  4CNY A;  4DV6 J;  4Y2C A;  2Q6B A;  1Q79 A;  3DLG A;  2GIQ A;  3MAA A;  3NMA A;  4EYI B;  2HHV A;  4UOH A;  5AE3 A;  4C8O A;  2IAJ A;  2WZ1 A;  2AEF A;  4ZVU B;  3FBC A;  5E5N A;  4LF6 F;  5F8G A;  4USM A;  2CNO B;  1XMQ F;  1LNQ A;  3MMB A;  4JI1 J;  2GVZ B;  2AX0 A;  3G86 A;  4DPU A;  5D0E A;  1IBL J;  2Y0S D;  4XO0 A;  1YSJ A;  2R7S A;  4KO0 A;  2MHN A;  2BJ9 A;  1B0T A;  4LQ3 A;  2N4C A;  1YJR A;  1ZA1 B;  3WHI A;  3A3O B;  5KFS A;  4NMX A;  3QRP A;  1H2V Z;  4DV6 F;  4CO5 A;  5KG0 A;  3RB6 A;  5H9E J;  3CCR S;  3G82 A;  1JK9 B;  1TUW A;  1WHY A;  1LWX A;  3D54 A;  2QYG A;  1JIH A;  2AV5 A;  4ZJQ A;  3SV4 A;  5LMU J;  1L3U A;  3K5O A;  4ICL B;  3Q8R B;  1QVG R;  3KMS A;  1ZAV A;  2V68 A;  2HVH A;  4JI1 F;  1KBR A;  1Y5L B;  1ZOT A;  4WYL A;  1KHW A;  4DQI A;  1IJF B;  2V2K A;  1IBL F;  4LF2 A;  2BJD A;  1EET A;  3WIU A;  5F8N A;  4IUF A;  3B82 A;  2CJY B;  2AT1 B;  3JTN A;  1M5P C;  3I9Z A;  1IR0 A;  2XGP A;  2MLX A;  1YJT A;  1U6B A;  4KJI A;  1UVI A;  3QZ8 A;  4WP8 A;  2ROG A;  3EGZ A;  1X31 C;  2O1P A;  3TUZ C;  2OD6 A;  2YWF A;  1DTT B;  3NNC A;  5HMZ A;  1MRO A;  3TQE A;  4DSK A;  4MT1 A;  1FFW B;  4ZLL A;  1Q53 A;  5LMU F;  2VJU A;  3U1N A;  5E3Q A;  1D9D A;  4HT7 A;  4ZPW R;  1U6F A;  1WF0 A;  1PJ5 A;  5HSP A;  5LJ3 Y;  4ZK7 M;  2ERR A;  2KU7 A;  4Y34 A;  4DL6 A;  3TW0 A;  2OKQ A;  2PE8 A;  1HQU B;  3IC1 A;  3IS9 A;  3UDC A;  1KVK A;  2H5I B;  4RNF A;  1SJ1 A;  1SJ4 P;  5U47 A;  4PG4 A;  3R9L A;  3RAQ A;  3BDP A;  4QZV B;  4DFK A;  3SIP B;  1CLF A;  1SC1 B;  3BSA A;  1RSC A;  2XSJ A;  3MPY A;  1JLB B;  3DM2 A;  4DJB A;  4M5K A;  2Y1J A;  2RQK A;  3QIP A;  1UW4 A;  4DUY J;  2FVS A;  2DY1 A;  4BDP A;  2FB0 A;  1GAO A;  4X4N A;  5FLX Y;  1R31 A;  2RML A;  3TAM A;  2MGZ B;  5K20 B;  2FLP A;  5L1J A;  2C2M B;  5L1I A;  3BB5 A;  2EFG A;  1SQF A;  2M88 A;  3M6W A;  1R8P A;  3D4J A;  1LWF A;  1XEZ A;  4F36 A;  2NQP A;  1R43 A;  3I96 A;  4KPY A;  1FRX A;  3HUL A;  1RBL A;  4JI7 J;  1KNZ A;  3LUY A;  4DCO B;  3DCA A;  4DUY F;  1BQN A;  3I5B A;  5DG8 A;  3NGU A;  2VON A;  2HK3 A;  3CCV S;  4B9V A;  1U1M A;  3MR2 A;  4IO1 A;  3W66 A;  2AF6 A;  2PA3 A;  4HDG A;  3R5A A;  1FXL A;  3O5T B;  3PW2 A;  3BV8 A;  1MMD A;  2HLT A;  2IJF A;  5CD4 A;  1VC6 A;  2HNZ A;  2W2Q P;  1IKV A;  2C28 A;  1SV5 B;  4ZIT A;  4RUH A;  4UOC A;  5CQG A;  1DAR A;  3M05 A;  3AOD A;  4QR1 A;  2ZBR A;  4WFY A;  1B0P A;  2ZJQ Q;  3BGU A;  2MYF A;  4W98 A;  4ZPA A;  5KFR A;  2JEI A;  4JI7 F;  4DEZ A;  1PIL A;  4B9U A;  1YBT A;  1S7I A;  1YBA A;  2ZIT A;  2DNO A;  4DCP B;  5T7L A;  4Q7A A;  1O6X A;  3H5U A;  1P9Q C;  3SFU A;  2D1C A;  4TY9 A;  3RTV A;  5D0G A;  4YN3 B;  4A8X A;  1VQO S;  2Y8Y A;  2LCW A;  3GV8 B;  3DKD A;  4ECY A;  2VJV A;  3GFZ A;  1YRX A;  4LRF A;  1O5J A;  1WC4 A;  4HTI A;  4HH1 A;  1IKX B;  2RJZ A;  4NLY A;  4EO8 A;  3J7A N;  1PAU B;  1HBM A;  1OSD A;  1WC1 A;  2YKM A;  3QYY A;  2QA2 A;  2I1R A;  2LYV A;  1RT2 B;  2IPO B;  3SEO A;  4HHU A;  1EQM A;  2CWX A;  2KT3 A;  3T5H A;  4DPY A;  4AE5 A;  1VRT B;  2VUG A;  4Y65 A;  2GQQ A;  5KFG A;  1NZA A;  2YQ0 A;  4Q45 A;  2K1R A;  4RNH A;  4RW4 B;  2HEK A;  5IC4 B;  3VV2 B;  4I1T A;  1CG2 A;  3R7N B;  2X1F A;  2VOD A;  4CZC A;  3BN4 A;  5J2N B;  5AT1 B;  1WSR A;  5KFT A;  4KT0 C;  4EO6 A;  2MKS A;  3M9M B;  3CWJ A;  3QAU A;  2RF2 A;  5IXU A;  5I42 A;  2KFN A;  2KYZ A;  2CDQ A;  5K8M A;  2E1R A;  1WDD A;  3HVT A;  3OT9 A;  5CYM B;  2I6W A;  1SJF A;  2ATL A;  1H38 A;  1X9S A;  1JNZ B;  4Y00 A;  2RH3 A;  2B51 A;  2QFI A;  3M8W A;  4ZVF A;  4I69 A;  4QU7 A;  1OJ4 A;  3TUP A;  4NCG B;  3MM9 A;  2FTR A;  1AB8 A;  3VF0 B;  1UPP A;  3UN3 A;  1FEH A;  2HW3 A;  2FJX A;  4X65 J;  2R42 A;  3M6V A;  2B4O A;  1E6Y B;  4RX6 A;  4NI2 B;  4QIG A;  4OYM A;  2BAN A;  1M1H A;  2IVM A;  4PWU A;  2I38 A;  3R5J B;  4LF5 J;  4KKO B;  1RE1 B;  2GO8 A;  2LEA A;  4A46 A;  3HD2 A;  6FD1 A;  2BJE A;  4G1Q B;  3G8S A;  3M2U A;  1T9T A;  2XSF A;  4K4Z A;  1HD1 A;  2ZKT A;  2CG4 A;  1Y3J A;  2V8D A;  2EKY A;  4B3R J;  4IG3 B;  3BZQ A;  1XMB A;  3DHW C;  3BBF A;  1RTH B;  4DL5 A;  2N7Y A;  2XY6 A;  3DRR A;  3PAC A;  4X65 F;  4DMZ A;  4CLP A;  1NJZ A;  3DLJ A;  2RIL A;  2QG9 B;  3B4D A;  1SIZ A;  4NLX A;  2KRR A;  2RRA A;  3KK1 A;  2R7W A;  3BGO P;  2ZBI A;  1FKA F;  4TQS A;  1X4D A;  1VBZ A;  5GAD U;  1CC7 A;  4FZV A;  4LF5 F;  1FJG J;  2MKH A;  5K8O A;  4DI6 A;  4I68 A;  4ETZ A;  3UWT A;  3AOB A;  1A6L A;  1H7X A;  2BJ3 A;  1FA0 A;  3UCG A;  3VVT A;  4Q2M A;  3I55 S;  2VA3 A;  1PGZ A;  4P2X A;  1C0T B;  2WK4 A;  1QAI A;  3BYP A;  2LU2 A;  3W5Z A;  3A8K A;  4QR2 A;  1SH2 A;  3OLB A;  4DV5 J;  1LWE B;  1MMN A;  1UAW A;  1KLN A;  2Z56 B;  4QR0 A;  3SQG A;  3J80 U;  5LJ5 Y;  3OTD A;  2HMI A;  5AXN A;  1IM6 A;  1VFJ A;  4F04 B;  1NRK A;  3AD9 C;  3SSQ A;  4IFY A;  3I0R B;  4MKA A;  3WZ0 A;  3CDB A;  1FJG F;  3AHP A;  2Z2Y B;  1S0M A;  3T9N A;  4JI6 J;  1VQ9 S;  1X0P A;  1KP6 A;  4K7Q A;  2W2N P;  5HQL A;  4A8K A;  4PQU B;  2W4D A;  4CLU A;  2HAF A;  2HBR B;  4MTP A;  2QLF B;  4RU9 A;  4RUB A;  2GAG C;  3OUY A;  4DZD A;  2E44 A;  1IBK J;  5E7O B;  1RT6 A;  3ONQ A;  1WI8 A;  4TY8 B;  2UXD J;  4DV5 F;  1TMJ A;  3NOG A;  2RB7 A;  3B78 A;  5CAA A;  1FRI A;  2OP5 A;  1S5Z A;  3G8Q A;  3UDE A;  3FFI A;  1OY6 A;  5HRO A;  5A76 A;  3WC2 A;  3FNN A;  4F67 A;  2AJ4 A;  4AT1 B;  4LRC A;  4GVB A;  1N52 B;  1WOP A;  1TKX A;  4DZ6 A;  4YDX A;  5I3U A;  1QAX A;  3M8Q A;  4OX8 A;  3MD1 A;  4JI6 F;  5IM0 B;  2PN6 A;  4HYK A;  2I5J B;  1Y4Z B;  3TYT A;  2WVE A;  2JLG A;  4WKR A;  1S79 A;  2HGN A;  1IBK F;  5J2M B;  2VB6 A;  4OI1 A;  4FVM A;  2KFY A;  2UXD F;  2R2R A;  3UI3 A;  2GNK A;  4TYB A;  2J0Q D;  5E0O A;  4O0I A;  3OL8 A;  1SQG A;  1C1B A;  3CJQ A;  4DL2 A;  1NM2 A;  4CM0 A;  1U1N A;  1X8D A;  4C7Q A;  2Y3Y A;  4Q44 A;  2B8Q A;  2YH0 A;  4DOZ A;  3Q22 A;  3HHL D;  2FJD B;  2VG5 B;  1Y11 A;  3NCQ A;  1K73 T;  5BR8 J;  4LRB A;  3BKF A;  1X5O A;  1NME B;  2VG6 B;  3BBB A;  1X4B A;  3WX8 A;  2DGO A;  5GAH U;  5A6W A;  5G0R A;  3GU0 A;  3M2V B;  5CYJ A;  4RNN A;  3KK3 B;  1Y0H A;  1ZM3 A;  4KGK A;  4PQA A;  4ZVG A;  4C0O C;  3HVA A;  4RLE A;  2ZH1 A;  4J91 A;  4X62 J;  3UD3 P;  2XEX A;  4FNH A;  5KFE A;  3EPI A;  3T5L A;  1RTJ A;  1HHQ A;  1RZM A;  1ZET A;  5G4D A;  1VQK S; 
#chains in the Genus database with same CATH homology
 3SIP B;  2Y1L B;  1SC1 B;  1RWV B;  3KJN B;  2HBY B;  2H54 B;  1PAU B;  2QLJ B;  2CJY B;  2HBR B;  2XZD B;  2QLB B;  2QLF B;  2Y0B B;  1RWN B;  3IBC B;  3P45 B;  4ZVU B;  2XYG B;  3QNW B;  2QL7 B;  3R7B B;  1RHM B;  4ZVR B;  3D6F B;  2CJX B;  2H4Y B;  1RHR B;  2CNO B;  2XYP B;  4ZVS B;  3R6L B;  1RWM B;  2HBZ B;  2CDR B;  3EDQ B;  4ZVP B;  2DKO B;  1RHU B;  2H51 B;  1F9E B;  1SC3 B;  1IBC B;  2HBQ B;  1RWW B;  2C2K B;  4LSZ B;  5K20 B;  5IC4 B;  1RWP B;  1NME B;  3IBF B;  2P2C B;  1RHQ B;  3KJQ B;  3D6H B;  3R5J B;  3R7N B;  1PYO B;  2QL9 B;  1I51 B;  1RE1 B;  2CNN B;  4ZVQ B;  4DCJ B;  1QDU B;  2C2M B;  3EDR B;  3GJQ B;  3NS7 B;  3GJS B;  1RWX B;  3R6G B;  1RWO B;  1RHJ B;  4DCP B;  3GJT B;  1RHK B;  1ICE B;  3P4U B;  1SC4 B;  1BMQ B;  2C2Z B;  2H48 B;  2H5J B;  1RWK B;  2CNK B;  2H65 B;  4ZVO B;  1QTN B;  3D6M B;  5IC6 B;  2C1E B;  3R7S B;  3KJF B;  4ZVT B;  2C2O B;  3GJR B;  2FQQ B;  2H4W B;  2H5I B;  4DCO B;  2XYH B;  1I3O B;  1GFW B;  3RJM B;  4JB8 B;  2QL5 B;  2XZT B;  2CNL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...