1IBCB

Crystal structure of inhibited interleukin-1beta converting enzyme
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPAGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A combinatorial approach for determining protease specificities: application to interleukin-1beta converting enzyme (ICE).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords INTERLEUKIN-1BETA CONVERTING ENZYME
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1997-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1ibcB00
1RE1B 4ZVOB 1NMEB 3P45B 4LSZB 2C2ZB 3KJQB 1QDUB 2P2CB 3EDQB 2HBZB 3KJFB 3RJMB 2H48B 3D6HB 2H65B 2CNLB 2C2KB 2H5IB 2H4WB 1GFWB 2QL5B 3D6FB 1RHJB 3D6MB 2QL7B 2HBQB 2XZDB 1RWVB 1SC1B 2HBRB 1RHMB 4DCPB 4ZVTB 1RWXB 4ZVPB 1IBCB 1RHRB 1PAUB 3P4UB 4DCJB 2QLFB 1SC3B 1RWOB 1RWWB 3R5JB 3GJQB 1F9EB 4ZVRB 1QTNB 2C1EB 4DCOB 5IC6B 1BMQB 2H54B 1RWPB 1RWNB 2DKOB 3GJSB 5IC4B 1SC4B 1RHUB 2CDRB 3GJRB 2XYGB 2CJYB 2QL9B 2Y1LB 2H4YB 4ZVUB 3IBFB 4JB8B 1I51B 2XZTB 3NS7B 3R6LB 1RWKB 2FQQB 3SIPB 3R6GB 2H5JB 3QNWB 4ZVQB 3GJTB 2H51B 3R7NB 1ICEB 3EDRB 1RWMB 1RHQB 3KJNB 4ZVSB 2CJXB 2QLBB 1RHKB 3IBCB 2HBYB 2XYHB 2C2MB 3R7BB 2XYPB 2QLJB 1I3OB 2CNKB 2Y0BB 1PYOB 3R7SB 2CNNB 2C2OB 5K20B 2CNOB
chains in the Genus database with same CATH superfamily
3ITHB 1MU2B 1S0VA 1V5VA 1YG0A 4ICLA 3TAMA 2AEFA 2R42A 3D4JA 3KLIA 3PYDA 3BH6B 5ETTA 3HLUA 4PYAA 4DWIA 1QDUB 9RUBA 1YKWA 3I82A 3KNAA 3DLKB 4CO1A 4PWDB 1QVFR 2HBZB 1M1GA 3D0IE 3M6UA 2VDHA 1MNEA 1KHWA 2CNLB 4NPOA 2X1BA 4ZPCA 4RO0A 3FJ2A 4CT9A 5D77A 1RJJA 5GAHI 2G2OA 4URSA 5B0EA 5M2RA 3MURP 1LOUA 3G8TA 3BGUA 3PEHA 1VIXA 2V50A 4UQTA 2LQJA 1QM9A 2DHGA 2C2RA 1T05A 4FKYA 3PY8A 1OPZA 4U7CA 2OGUA 3CJKA 4LF6F 2J9DA 3DU5A 4C6AA 5DGAA 2LMIA 2CQPA 2I2YA 4WFXA 2VQFF 1S1XA 4DOZA 3BJYA 2MKCA 2ACYA 4XIUA 4X64F 1J5EF 4B3TF 3FK4A 3UVJA 3Q2TC 3MPYA 2IA6A 3BYRA 1R6YA 4RUHA 1RA7A 4K50A 4R0JA 4UT4A 2LEBA 2VFTA 1YBTA 2PA8D 3MTKA 4DCPB 5L1JA 1QE1A 4UZBA 4OI6A 3WX8A 2KXFA 1RWXB 3KK1B 4K4SA 3JB9k 1XN9A 3TX8A 1RZMA 1U8WA 1JJ4A 2HQFA 3AOAA 3IG1B 3CMES 1REGX 2R4FA 4Q2MA 2UUCJ 1VI7A 4CO4A 4DLGA 3W8GA 2YKQA 5HN0A 1FFSB 5CD4A 3CCJS 1XNQF 4R0EA 5J1PA 5D8HB 4CH7A 4DQRA 4G1PA 2R7SA 5DS7A 3OTEA 3CXCR 1IKYB 1YLXA 1WOOA 2QG9B 1JXEA 2X3DA 1FKOB 3R97A 1GH8A 3WIVA 2YBVA 4I7FA 3HI9A 1AXQA 2D3UA 2M2BA 3PXGa 3RB4A 3POTB 1UW4A 2CQ0A 4URGA 1SJ4P 4DR6J 3NGSA 3BQ1A 1Q81T 3V4MA 3ZZRA 2DKOB 2F7VA 4J9UE 2MZQA 3OSPA 2UU9F 2YKPA 1GMVA 1JXVA 2NCKL 1TL1A 3DDIA 1S1WA 3PG9A 3US5A 3KLHB 5JMNA 4C8YA 1DJ0A 4K2XA 2E5JA 4PYDA 3W1YC 3Q0AA 1HD1A 4RBTA 4NLQA 3CO9A 2E5LJ 2EBEA 3NMAA 1SC6A 3HJFA 1PC5A 1Z2LA 2AX0A 2V0NA 3ZZTA 3MM6A 3KYLA 3D28A 1GXTA 3J80U 2C3YA 4EYIB 4QR1A 1TL1B 2DT9A 1FE4A 1B70B 1Y5NB 4MFBB 3RG6A 1RTJB 2QIFA 1U1KA 1FFGB 1VK3A 4JI7F 3BPDA 4H4MB 1R0CB 3MR6A 1FHTA 2CJ9A 3N6NA 4OI3A 4ETXA 3OL7A 4IOCQ 1RCOB 3L7OA 4WKRA 1EHWA 3DGPB 1NPPA 5LSRA 3VAKA 3GB0A 2F8HA 3TP2A 3Q83A 3CTRA 4OV1A 5LJ5Y 2HFNA 2E5IA 1IBLJ 3WC0A 1HQUB 2H5EA 2V8HA 1R89A 2E9ZA 4PQUA 2MJNA 1YZ6A 1B99A 2WVDA 3FFIB 4QW9A 2VFUA 1X4BA 2DNQA 2XCPA 5ETVA 4MT1A 4DL4A 3IS9A 2FHJA 4P73A 2ZD1B 1S1TA 3MFHA 3DGVA 2FGCA 3Q24A 2UV8A 1NCLA 3UDEA 2QT7A 4YR2A 2ZVSA 1UVKA 1RGVA 5K14A 2GMLA 2PEBA 1HBUB 3GFZA 5DG8A 1Q7YT 3P5BP 1UJ5A 2C2OB 4ENOA 5F8MA 4CZCA 1WF2A 3TYTA 5K20B 4RZRA 2KFYA 1QVGR 4B3MJ 3IR7B 1FX4A 1VQ6S 3GYNA 3N6MA 1X4AA 2RMLA 3UPFA 5IT9Y 3Q8SB 2KRRA 2N3LA 3M6WA 3RJMB 3OUYA 4JV5F 3M2VA 2V2ZA 1XBWA 4OLPA 1I94J 2VG5B 2V63A 3MWBA 3P5TL 2FJWA 4OI1A 1RT6A 1TQLA 4LT6A 3J7A1 2RKIB 3JS9A 5HLFB 2ZJQQ 2IMWP 2F4VJ 4DV0F 2P9GA 2B9YA 2QMXA 3HSZA 4ZLNA 4ERDA 2HQDA 3OTDA 4NLUA 1XWLA 3B82A 2WB1D 2ZH6A 4DFPA 5THWA 4QWDA 1FI4A 1K1QA 2AEMA 1NJIT 2NR0A 3TVYA 2B4OA 2HRYA 4P2MA 3PO4A 3BPSP 4C0BA 2ZHAA 2VB6A 4AL6A 4FXDA 3I9ZA 5CCLA 4X4NA 2QJ3A 3W66A 1JLGA 3R1HA 2U1AA 1RHMB 5ETSA 1U1NA 2XLKA 4ZVTB 4NLRA 2HNZA 3TZZA 3LP0B 4C7QA 5F3TA 1PBAA 2ZFHA 2HFZA 3IMQJ 3KDNA 3U1MA 1U49A 4TQRA 4JI5J 5KFMA 4ILMA 2VPWB 4ED0A 4KGXB 1QLNA 1BE4A 3HCXA 1S1VB 2KDOA 2ZOMA 1N5TA 3IFEA 1VLYA 1DQAA 3UCZP 1SC3B 1N6QA 4AL5A 4ED2A 2FTRA 3D3CJ 1URRA 1VBKA 3OFEA 3FMBA 4CLUA 2DRAA 2IJRA 3MR5A 3OUYB 2FHJD 1UPPA 1D9AA 4W98A 3K0JA 2PE8A 5J2MB 1FKPA 2DITA 4ECTA 5SUHA 3QRRA 1RWPB 5F41A 2AZ3A 4ZLPA 2FJXA 2DGVA 2PSZA 2DGQA 3PDNA 4C4WA 4TY9A 3I0SA 2A6OA 4OV6A 1VR6A 2GJFA 4AD6A 3CCRS 1RT7B 1IQZA 2KI2A 5B0DA 1HYSA 3UR3C 2NZ4A 2ZKTA 4I2QA 3MXHP 1LK7A 1FDDA 1JLQB 4DPWA 3JSMB 2IVMA 2Y9HA 2VBXA 2B6AB 1UVNA 2GO8A 1LW0A 3MZIA 2HMIB 4KKOB 2PMWA 1IKVA 3PRDA 4EYHB 2DNMA 2NLWA 5AE3A 3MEDA 4R8UB 2RIJA 4H4MA 4A8OA 5HQ8A 4LF8J 3R6GB 4F0KA 4YUDA 2WOMA 5CABA 1BWVA 2AZ1A 4XPEA 2ZH8A 2XMKA 1WG1A 1X5PA 5A8KB 4A8YA 1U09A 5MLCV 2VOPA 1X4FA 3WDOA 1VS3A 2FD2A 3OW2R 2Z30B 1JWWA 2XMJA 1JKHB 4JI8F 1XR6A 1JLFB 5A6PA 1V9OA 2C3UA 3P3DA 1C0UA 3M8QB 4ECSA 4NI2B 1HNVB 1VGYA 3DLEB 2Z2ZA 5HI7A 1IM6A 1SJ3P 3TEHB 2ZM6J 1S6QB 1FF2A 1U1MA 4LUBA 1VRUB 4WFYA 5IQQA 2CJKA 3ZNJ1 3VVTA 3E01A 3W5ZA 5LXYA 4RNOA 3ZZYA 3L7PA 4DU8A 2FJVA 2HHXA 1AZSA 3R7SB 2AF6A 1UZDA 4C0OC 1NKCA 3DRPA 3GG1A 4QU7A 1MSWD 2B8PA 1M5HA 5LSOA 1YX2A 2D7SA 3KUEA 2BE2B 4P2SA 2C3PA 3DGPA 2U2FA 2EI5A 3DLGB 2AEJA 4HDHA 4KGVB 2UVRA 1LWEA 2Z4PA 2DTJA 3JYTB 1AFIA 3CDUA 4I6YA 4OYZA 4OX9F 4AUKA 4IG3A 3D6HB 4MMOA 1U2FA 3AD8C 2VIHA 1S9FA 1SKUB 2HNYB 3JTPA 2JC1A 1HMVB 4AQYF 1RAFB 3CC7S 3FVYA 4ZP6A 1X0FA 1WUUA 1M5SA 4FVCA 2CWXA 1JJ2R 1ZPWX 3PIOQ 3I96A 4OZLA 4JI5F 2D41A 1WEXA 2VC0A 3DHWC 1T95A 3MCSA 2CA9A 3ILIA 2KT3A 1JLEB 4B9LA 5D3GA 4QOTA 1NDKA 2W7PA 1S4FA 2OMOA 2E5GA 4P71A 2ZM6F 1N56A 4B3RJ 3D5MA 4RNNA 2HK3A 2M52A 3UD5A 3ISNC 5C2GA 2XGQA 3IR6B 3C3LA 4P10A 4AT1B 3HHLC 4EUVA 2DGOA 4C8NA 4OLOA 4YY3F 5AJ3F 3W2WA 3KK2A 4QU6A 2N4DA 3Q8VA 1NK8A 3L95X 5D4OA 2V8PA 5E5NA 3OL6A 4IFYA 3FBEA 5I3UA 2V68A 5A8RA 4PXDA 4QZVB 2LFVA 3GCXP 5KFPA 3MR7A 2K8GA 2OD6A 3D1OA 3DI6B 3R5AA 5C24A 1SQEA 1IKVB 3WZ0A 4DXLA 3HM9A 1FA0A 1NSKL 1C2PA 1YK9A 1J27A 1RAHB 1PJ5A 2VASA 3CDBA 4K7QA 4LF1A 3CCZA 4LSNB 2R8IA 1D1UA 3D0GE 4G1QA 2ZDPA 4HTIA 3K7RA 4DG1A 4C8KA 3QAUA 1SKRA 3F44A 2JWNA 3O8WA 3ISND 3IWNC 2OI2A 4LF9F 2I1RA 3LGHA 5KG7A 4C11B 4OYIA 1Y7PA 3RBZA 5GAGI 4DJBA 2E5HA 5AXKA 3S6EA 3ZC4A 2RB7A 3I56S 4FS2A 2VQEJ 2I5JB 1UP1A 5IXUA 3H7HB 4I56A 2R2RA 1VC5A 2NYHA 5ETRA 2GW8A 1UVJA 5ADZA 2BZ2A 3HO1A 1QAYA 5I3UB 1XJWB 3TAQA 3U7JA 3QLHB 3D68A 4ID5B 4RNHA 3HSGA 4LF4F 3EPIA 1YJ7A 2L3MA 3MF5A 3I5CA 3NS7B 3ZTRA 2RHSB 3CWJA 3A3OB 2YX7A 1B0TA 3C19A 5BYRA 4NZ6A 5FJ4A 1P8GA 3ET6B 1IKXB 4GO7X 3KHRA 2W9BB 1CULA 2HHPA 1LKZA 4NLXA 4I69A 2RS2A 3KLIB 2MKSA 1TKTA 1O6XA 3B78A 1OJ4A 3QT5A 2GIFA 1U26A 3S7RA 3FUYA 1EAYC 3D3BJ 4K5SA 1VC6A 3EGWB 4JI1J 5L9NA 2MQPA 2FC8A 4O23A 3Q22A 4B3RF 2V4RA 4K59A 1ZETA 2DO4A 4CO5A 4DL2A 1KFDA 3IBCB 4WJBA 4Y2AA 2HBYB 5KFGA 4PXBA 4K4XA 1YJNS 2WW8A 3C16A 3IC1A 2GQQA 4Y2KA 5A6WA 1ZM3A 5IZHA 1U45A 1GNKA 2QLJB 3B8HA 2C3OA 5KFHA 4RX6A 5K8PA 3KLGB 2IJFA 3NAIA 4LREA 4YB5A 4I67A 2HLUA 1NZ8A 2CNKB 3RBDA 2POKA 2Y0BB 2XI3A 1T3OA 3DOLB 3B54A 3H2LA 1TVRB 2VG6B 3T1AA 4Z7CA 3X3UA 4ZKAA 2ZH1A 3C2PA 2KFZA 3FKBA 2X1AA 1SIZA 2CNOB 3TWZA 2E9TA 1IXKA 2NZCA 1ITPA 3FEXB 3HT0A 1WSRA 3CJTA 3EVMA 2YX1A 3M9MB 1X4DA 4ZMMA 2V2QA 2DNHA 3GFXA 2GAHC 1UEVA 3PACA 1OY9A 1KP6A 2Q6BA 3EDQB 1WDTA 1DTTB 4B9VA 2OD4A 4OYBA 5KFFA 2KXHA 1I6JA 1S6OA 3I5BA 3OBIA 1KRPA 2M8HA 2WVCA 5I3PA 1IBMF 1DBDA 4USHA 3MEGB 3I31A 3C14A 3MM8B 3K5LA 4F50A 3V6HA 4ELUA 1HNWJ 2R7UA 3D6FB 3GONA 3G82B 2DCLA 2R7TA 3FNNA 3UNYA 1L3UA 1O5JA 2FIUA 3JQMA 1YZ7A 3NCQA 1B3TA 2CZ4A 2V67A 1LQ9A 1Y11A 3NBPA 5IOLA 2FLNA 4EZ9A 2E7WA 3JYTA 5IV4A 4IOAQ 4BCAA 5KFJA 1RQ0A 2EVZA 4KH1B 3Q8UA 1R43A 2ZITA 4OJHA 3KK3A 2FC9A 4DU7A 2GVZB 2E9RX 2CQ4A 4NA2A 1RWVB 5FD1A 2CVEA 1EKSA 1TKXA 2QFIA 4HACA 4PZVA 1LWFA 1NXIA 4C98A 4J9NA 1YIJS 4JV2A 1H98A 4WP8A 5E3AA 4FVMA 2PI4A 2KT5A 2V2VA 3D1HA 3C6TB 4ATNA 4DSFA 2UP1A 3E01B 4K0KJ 2M88A 4CO0A 5KFOA 4LVNP 4N47A 6FD1A 1XMBA 4PUOB 1RT3A 4MJKA 2ASDA 1Q82T 3DRRB 3CCLS 5E33A 2R7WA 2DPIA 1YBUA 1FDNA 4HI1A 3CCVS 4RUCA 2QLFB 4MAKA 3IRXB 3MEEB 1EKRA 2JHEA 4Y28C 4MIAA 2DNPA 4LJMA 4RWXA 2HHVA 2KB2A 3GJQB 8AT1B 3K59A 2R7XA 1F0XA 5FLXY 1HBMA 1XQIA 2M9KA 2QMUB 3BREA 2UXCJ 1JXLA 2Q66A 3FEYB 4DMZA 1PYTA 2MHEA 3NGKA 5KT3A 3NLCA 3FQKA 1HIYA 2RF2B 2GIRA 2KKHA 2XS5A 2J0WA 4KYZA 3D67A 1VRQC 3PW4A 3QT7A 3KK2B 4DLEA 2WRMA 4CTAB 2YPYA 5KFWA 5F8IA 4TQSA 1UMJA 1M5OC 5KFQA 3I87A 3HFZB 2ZKUA 4YP3A 1TUWA 4WXWA 2BOAA 2F65A 4J37A 2VZ9A 2AHOB 2XO7A 4H4KA 4IRDA 2X7IA 4C48A 3N79A 2DNNA 3BGRA 2NPFA 3VHQA 5H1SV 1LFWA 1YJRA 3MM6B 1TL3A 3R6LB 1RT7A 5C42A 5DETA 3LAKA 1ZZNA 1T11A 1YJTA 3H5SA 3KG1A 5D4NA 1QD1A 3DMJA 4HH1A 1DQ8A 4KTQA 1P9QC 3AQPA 2VG7A 4UW2A 2OO4A 3VQSA 3T1YJ 3OR2B 1Z2ZA 2I9SA 1Q4RA 1U4BA 3MECA 5DDQC 2Z2MA 2P9CA 1NDCA 2YKNA 2V9KA 4M5LA 2OPRB 1OWXA 4KPYA 2LVWA 2ADCA 4U9RA 2LQ5A 4B9SA 3EVOA 2EKNA 3T6JA 2QFJA 4P6QA 3GV5B 1JX4A 1MROA 4DSEA 1L3SA 4MTPA 2Y8YA 3KLVA 3BKTA 3JSBA 4Q2LA 4EI2A 5HSPA 2EFGA 3MDFA 3RB6A 4GVBA 1CPZA 2CG4A 3ADAC 4G65A 1A7GE 1KWMA 5GAEU 3FRYA 1T0TV 1IJEB 4Y00A 3NS5A 4OZ2A 1KTVA 1QSSA 3V6KA 3W62A 2BQRA 3HD2A 2D74B 4JI2F 4HT7A 4OYAA 4A4JA 2EFNA 1TV6B 1C4CA 1UPMB 2CZVC 3K2YA 4YB6A 1KTQA 2CQGA 4ZVEA 4A48A 2ZC3A 3PX4A 3LTOA 4OZNA 2H48B 3ET6A 3VTIA 5HL7Q 2MKJA 1CJUB 3TX0A 2H4WB 3L3CA 3BN4A 4PG8A 1EZZB 3W65A 2BX6A 2W4DA 5CYQA 2YNGB 3VZHA 1NZAA 2HNDA 2ZDOA 2VONA 1ZM4A 2NXJA 1WJ9A 2KT2A 1A9NB 4USWA 1SKSA 3GTYX 2DNRA 1S5ZA 2V4JB 3ETMA 2LEPA 4KO0A 4ZCLA 2QL7B 5G0RB 4LFCF 2JH3A 2P6TA 2DGUA 3GSDA 2XULA 1EP4B 3PJWA 5AXMA 4CP5A 4QWEA 2YKMB 1G6BA 2QZ8A 4NLOA 4DS5A 4DR6F 4LFAJ 2KG0A 4PR6A 2O3DA 5B7WA 3J7AN 3QT8A 3J80Y 2BBEA 3KJVB 3ZXWA 3QIDA 3PFEA 4W92B 1KEKA 3IRWP 4UZCA 4RUBA 5D3GB 3R27A 1NU4A 4DG1B 1KNZA 3K5NA 1CJVB 1YITS 3T1YF 2DR9A 3LWMA 4DL6A 3RRKA 4FYDA 1U1LA 5MAOA 1NB7A 3RAMA 2OP5A 3R5BA 2HRTA 3GWCA 2DBBA 2ROPA 5CHCB 3CCSS 1UWAA 3EGNA 1UFLA 4F04B 2BJ1A 3W2VA 1X31C 4I6AA 5A2QU 1RYRA 3HDSA 1Y4ZB 4IG0B 4IG3B 1NPRA 2DNKA 2EEYA 1B4SA 3BZQA 3EGVA 3QSIA 4O3PA 4F0HA 2VHGA 4Q0BA 1JNRB 1XNRF 2HHHF 2CPFA 2UUCF 4KSEB 3VZIA 1ZH5A 1NRKA 3K5OA 1LXJA 2MTLA 2PO4A 2XMTA 3HHLD 3HHKA 1RWNB 2LXFA 2RUGA 2DXFA 3GJSB 3K8VA 3PHEA 4MYUA 1RTDB 5T7LB 5DM6Q 2CYYA 3J7Z5 2C22A 3TANA 1MWZA 1UETA 4DR2J 5ETKA 3UN2A 4K4TA 2XMAA 3NGRA 1JLEA 4F02A 1DRZA 2X51A 2WK4A 1VQ8S 4O0NA 2QMWA 3U27A 1EIYB 4ELVA 2A0FB 2HWIA 3FGVA 1UCNA 3ILLA 2QL9B 1RSCA 2VF3A 4CLFA 3SEOA 1C4AA 2IAJA 2RDIA 5KFCA 5KG2A 1N54B 4IDKA 1VQNS 4LR9A 3I6PA 4QW8A 1FXRA 3M8QA 1BXNA 1D9DA 4QIVA 2DO0A 1VIOA 5IM0B 3EYZA 1JLFA 1Q86T 2VBZA 1HBNA 1X5OA 2GQCA 2MHNA 4HDGA 1NM2A 4CNZA 4YMEA 4ZP7A 2C2EA 2YH0A 2LU1A 3Q8QB 2F1FA 1RTZA 2UUBJ 3SXLA 2F63A 1K0TA 2CPDA 2B9XA 2HWHA 1RHQB 1KVIA 2B4VA 3JSRA 3N28A 3HF5A 3PYGA 4O44B 4PWUA 5CYJA 2OUGA 2HGLA 4URQU 3PR5B 3TW0A 4PABA 1FXLA 5D0EA 2CQCA 5GMDA 2LECA 1KLMB 4U95A 4E98A 5HP1B 1XNRJ 2D9PA 1HPZB 1RABB 4ZPVR 1OS5A 4NASA 1NNDA 1VRUA 2UV8G 2W1BA 2DXDA 5U47A 2BKOA 1RAEB 4N8OA 4Y0FA 2R9LA 3PVXA 1NJYA 4UF4A 5K14B 2WAQD 2Y1RI 1BY9A 3CD6S 4MKBA 1N4LA 3LP2A 2IM2A 1HHSA 1EETB 1RK8A 4WP3A 4PWWA 3VAMA 5HQMA 3CJ8A 5J2NA 4IRCA 5DM7Q 3DKDA 2R7QA 2R7OA 1VOMA 5HAOA 2FZCB 4NYZA 5D4LA 4A8WA 1EARA 1NJXA 2DR5A 4LF7J 2KHCA 4ZS6A 4ANEA 3O6QA 2WVBA 3M1VA 4HLBA 4C8LA 2VPZB 3BKFA 2V8DA 2BV3A 6AT1B 2A2DA 1VISA 3KJFB 4OMFG 2HVDA 5CZVA 3IN5A 3H5UA 5EX3A 4RW8A 2MQ8A 4V1Ak 1OYEA 1HI8A 2QV6A 1VYAA 2MZ1A 3KK3B 1K9MT 1ACMB 1JLBA 3TUPA 4F3QA 4N77A 2EKYA 1LW0B 3KHLA 1NK5A 1S1VA 1JNZB 3EE3A 4RNFA 1KN6A 1FEHA 3W7BA 2D3OR 3KG4A 5D6GA 2ZOGA 4F4KA 3LP1A 3MECB 1RTHA 1CSJA 3I4HX 2PT0A 3NGDA 2C2NA 2HQIA 3I0RB 5AE1A 3EZUA 1X4EA 2QA4S 2Z2YB 3TO8A 3GPAA 4K2JA 3NRBA 3A1YG 1JLGB 2IRXA 1C0TB 4J90A 3A12A 5EHHA 1FWPA 4HHJA 4WE1B 1LNQA 3SV4A 3GYXB 1SPBP 4X4SA 3HVRA 4IQXA 1R0BG 3S01A 1HBOA 5KFLA 4CLKA 4GVBB 3KWMA 4HR2A 3RUBL 3CCUS 2FGOA 2L9DA 3VAHA 2RRAA 1WF0A 4G6VB 4B17A 4FF4A 3ISZA 5CA5A 1RTIA 3VF0B 2W2NP 3QWUA 4RNMA 2MGZB 5H9EK 1S0MA 2EK6A 1KVJA 3BSNA 1T03A 4TY8B 2FLLA 2GFFA 2XLIA 1D09B 3BDEA 3R2DJ 3ENWA 1IKYA 1DTQA 2ZBIA 3K17A 4Q8FA 3M05A 1WEYA 1JJCB 1GTEA 2HFUA 2W9CA 4N41A 2XWXA 5FDLA 4NCGA 4NLTA 4QIEA 1JIHA 2HGMA 4E2FB 3MM5B 4DR4F 1CLFA 2IM1A 1FRHA 2RDJA 3MMCB 4JI4F 4Q8EA 1NEEA 2WHOA 4BWJA 2DGTA 1NO8A 2JDJA 5HANA 1HWLA 3IR5B 3QWPA 2B7CB 2J9DE 3CJ4A 1K1SA 2HAFA 1FRXA 5CQGA 1C0UB 2N4CA 3N01A 3KLFB 4JI3J 3EGZA 5IT0A 1FNXH 3NMRA 2AJ4A 2ALZA 4Q45A 3HSJA 3PV8A 4OYXA 1HR0J 1M1KT 4ZVUB 2RAQA 2ZJRQ 3ZFVA 4TYAA 2WBRA 4USIA 5JJBA 1NPKA 2AJ0A 2RQMA 2QTWA 1E6YB 3MCOA 1TKZA 1IKWA 4C8OA 1SQFA 3JQJA 2RS8A 5KFZA 1QY7A 1M5KC 4WTYA 3RBEA 1NK9A 5ETOA 2V2KA 1HNXF 1V5IB 2XHWA 2ZVIA 4PG7A 1YBAA 5CCMA 2VU5A 5EN1A 4NCBA 1ICEB 3BKUA 4ZN1A 2MKIA 2YNFB 3MOZA 2CPJA 3MAQA 2VICA 4DQIA 2Z8QA 4DV5F 3JAMY 1UKUA 1VBZA 3MR3A 1S49A 3ZTOA 3SYZA 1REVB 5B0GA 3C14B 2RJZA 4N8NA 4ZVHA 5A76A 4DUYJ 2GIQA 1XMOJ 2HS0A 1LFPA 3CMAS 2ZD1A 4IRKA 3J81U 3M2UA 4YHHJ 2XM3A 5KG4A 1J5OB 4DL0C 3UO0A 1D0EA 4DBQA 3CJRA 3NKYA 4LBPA 4MK7A 1PYOB 1PJ7A 2W25A 4LRAA 1SJRA 4H4KC 3UCUP 2CNNB 2HNYA 2EBGA 5HO4A 4JI3F 2DCUB 2K7KA 3MM9B 3EZOA 5E3QA 2EFPA 3R8YA 3CCES 1NK6A 1N8RT 3FZBA 1UAWA 2HQCA 3DDNA 1Y00A 3P8BB 1Q8IA 3SBMA 2N7CA 2OPRA 2UVWA 4J9PA 1R8HA 1UWBB 4YS2A 1R31A 1HNIB 2YWKA 4ES3A 4DR4J 4FN5A 5IM0A 2VBYA 3F56A 4UOHA 4DPXA 4KGZB 4NOHA 4ECQA 3MM8A 2BQ3A 4QWAA 1U25A 3JXOA 4C9DA 3IA0A 2OSRA 1ULRA 4FBUA 2M4MA 4U8YA 2GVDA 1O51A 2L08A 3UN3A 5GAGU 2CPZA 1RKJA 5CYMA 2OTJS 4OZ0A 2G1DA 1L3VA 2K06A 1UFWA 2JEGA 1HQEB 1FJCA 1QTMA 2ILYA 2BJ9A 1REVA 2UUAF 2E5LF 5L39A 2ZZNA 2VA2A 1JLCA 3Q23A 2VD3A 1NHUA 3UFCX 4FKXA 3U1LA 5HVGA 2X3GA 2BXJA 2ZC4A 4RL1A 2QN6B 2W8LA 4HYKA 2B4PA 5L46A 1FTRA 2EC2A 4DI6A 4WBFA 3H2UB 2VDIA 3J7YI 3BQ0A 3R3TA 1HWIA 4CTAA 1T7PA 1BQXA 3ZTSA 4LSLB 3G6VA 1FX2A 1TKZB 2BE2A 2UXBJ 5C7PA 3DOKA 4F4ZA 2YQ1A 5A0YB 2HVHA 1YSJA 1UW9A 3MEKA 4KC5A 2PA3A 2HMIA 2G2YA 2HAIA 2Y1IA 4ZVGA 2A18A 1R3NA 5KG1A 4WU2A 3MM7A 5IC6B 5KFAA 2XB2D 2KFNA 5CH7B 2C28A 4WYWA 4V19J 4JI0J 2QA1A 3K58A 1N88A 2LQ9A 3FBCA 4AL7A 4KBIA 4Y3CA 2QEXS 4FF2A 2R8GA 5IC4B 3KOAA 2FPHX 2R8HA 2QLXA 5EWEA 3K5MA 3BN7A 1SI9A 1S1UB 1N48A 1QSYA 3SCLE 2E1CA 4MK8A 3LGMA 1RKIA 5FDLB 4ECXA 1IKWB 1LXNA 3O1LA 3NGUA 4I64A 5A0YA 1CBKA 4FDFA 4DEZA 5IT4A 3BGLA 2JLGA 1B0PA 1MROB 2HFOA 1RA6A 3BGOP 1QUPA 1BUXA 2HNDB 1Z1ZA 2VFRA 3QZ8A 4OJ3A 4F25A 3FC9A 5DJBA 4DX5A 3PYFA 4KKOA 3G86A 7FD1A 5I4MA 4F67A 5E41A 3BSCA 3T1HF 3K5PA 5ETLA 1ZPVA 3VWSA 4KH0B 4LR8A 1CQMA 3DOMA 3KLFA 3L9ZA 4FS1A 1X9SA 3MAAA 5H9FK 2AWZA 1NH8A 2OPQA 1SH0A 1N34F 3D0HE 5BJRA 1IJFB 4NLPA 2ZUGA 4B9TA 4X65J 1PG5B 4L75A 4P9SA 3EDRB 5M2UA 4ALZA 2W4PA 2HIYA 4U96A 4CLLA 3LPYA 1N32J 2D1CA 2NPIA 5IQ6A 1H74A 4DN9A 1RBOB 2AJ1A 1FKPB 1EX8A 1M1HA 2B56A 2BMBA 1RT5A 3QQCD 1KDNA 4NCGB 5CAAA 3RTVA 4M5IA 1FCAA 3ZO7A 3GE9A 5SZTA 4X4VA 3U02A 3CPWR 2DEJA 3AD9C 5E3CA 2FVSA 3IM8A 4EMDA 2R2TA 3ILJA 2MB0B 1R8CA 1WC4A 3MCNA 4EWTA 4XDDA 3C15A 4I7FB 2BOPA 4J9MA 4IO1A 2HZCA 4RUAA 2F9DA 1VRTA 3EXCX 2BYCA 3FCHA 3GLJA 3TA1A 2G0CA 2ROEA 3CB4A 5LMUJ 4A8FA 1JLCB 4KB7A 1RT5B 4OL8A 5DO2A 3F0NA 3P45B 2IIHA 2OAUA 4ZOSA 3OLAA 1D8YA 1S0OA 1AB8A 2BUNA 4A47A 2JJ4D 4F4YA 4ECVA 2FY1A 1CQNA 2IMOA 1YWXA 2CUYA 4ZPDA 2AKWB 2CQHA 4CDIA 3A3NB 1DHMA 3SDEA 3O5TB 4MK9A 2CXEA 3BO2A 3D2WA 2XO6A 1WDDA 4AFFA 3I0RA 4DFMA 2GMJA 2DNZA 4PAAA 4JI6F 2GQ2A 2HG4A 2JLEA 2VPYB 3V81B 4HL9A 3M9NB 2ZOFA 3DRRA 2Y3YA 5I3QA 2GC8A 4ECUA 4WP9A 2J6UA 1HNZJ 3HJVA 2M3DA 3VV2B 1WHYA 3KTQA 4ITSA 1BHNA 2DHHA 2ZBQA 5LMNF 3LW5C 4A8SA 1CJTB 1IBKF 4LQ9A 3GYGA 4N7TA 5I42A 3PHTA 3OL9A 1TKDA 3WHIA 4USJC 3DRXA 2BRLA 4RU2A 2KZZA 1YQHA 4DL5A 3BF4A 3M6VA 2RU3A 4NXMF 3MPUB 2ATLA 4H54A 2V8VA 1HWUA 1N34J 1JMTA 4O4GB 3E2EA 1X0PA 1EETA 1A0OB 1JLQA 4LF4J 2W4CA 4X62J 3CJ2A 4L6V3 2B51A 2CPEA 4ZP8A 4DCJB 2B9EA 4QIGA 4TN2A 1OMSA 2BM0A 2HQGA 3FEZA 3E3XA 2PMZD 4BHQA 3M8RA 3AQOA 5KFBA 4G1QB 4NWBA 1JKHA 2COLA 2VUGA 4LSNA 3CC2S 1NAQA 2QA4G 3M32A 4W4MA 4A46A 4EBCA 2JEFA 5F8JA 4JYAF 1N0UA 4LF5F 3TAPA 4XO0A 1TL4A 4KY3A 1PILA 3BBCA 4QWCA 2MPUA 1WG5A 1VQ7S 3CO0P 1H7WA 2FZGB 5C25A 3C46A 2KH9A 1HR0F 3THPA 2AT1B 1G4CA 2DYAA 4XPCA 3CCQS 3CJ5A 2VBWA 2B0GA 1IR1A 5HJYA 4EEYA 1S0NA 4L76A 2Z56B 4UY8T 3W3SA 1RHUB 2OKQA 1AFJA 2W01A 3DYAB 4C97A 3FDSA 1RTIB 3RRGA 2WSEC 1HBNB 2WSFC 2XYGB 3GJRB 2CQ3A 1Q16B 3H5YA 1H7XA 4DDFA 4ZJLA 3G82A 4JV5J 2VPXB 2YWGA 3OR2A 4NXNF 1K0VA 2PI5A 2RHQB 3TQEA 1D3WA 1OYDA 1WORA 3DXSX 1RYSA 1AA1B 2UXDF 3R5GA 4HEA9 4TNOA 4YB7A 3R2CJ 2UVUA 2HEKA 1ZTTA 4AQYJ 1N5YB 1TELA 2F4VF 4DV0J 4NLVA 1FTCA 1TU0B 2K1RB 3AHPA 2Z58B 1TKTB 1UEUA 2IRUA 3PKMA 1DFDA 2FHOB 2GHPA 3CJSA 3PM9A 5GAEI 1YJ9S 2IA0A 2E7VA 2I38A 1VQ4S 2WCXA 2YWWA 2HYIB 4DN0A 2CJXB 5J1EB 3BBFA 4O3NA 3C15B 4FYXB 4EZ6A 3DYAA 2OEMA 3POTA 4M1KA 1HW9A 5D4PA 1RT6B 1GMWD 4X4TA 3Q8PB 4J9RA 3FQLA 2UVVA 3CDEA 4LF5J 1Z4UA 4Y65A 2EWHA 4EBEA 4DFKA 2EK1A 1S99A 5C25B 4DV5J 2ZZMA 2XHCA 3W2VB 3PJXA 2NUUG 3H59A 2HIQA 4OZ3A 1B0VA 3LP0A 3M4XA 4DUYF 1U1RA 5F8GA 2FJEB 2IC3B 4TXSA 1H0HB 4ZPAA 5A8WB 4YHHF 3IG1A 2HSEB 1CS4B 1RBAA 3OXLA 1FVSA 4RW9B 3BB5A 5J2NB 3AXMA 3PRBA 4M5KA 4CYUB 2NREA 4QBUA 4M5JA 1QAXA 1IN0A 2DISA 2O5DA 3GIKA 1OY6A 2LCWA 3K8WA 1F3FA 2F40A 3LALA 4EK2A 3KDOA 2RRNA 3BM7A 4XAKA 4C3KA 5LOQA 1VQMS 4CLSA 4FF1A 2FVCA 2RRBA 3BBBA 1FJGF 3C8YA 1NKEA 1FKAF 3IGNA 2IC3A 5E7OB 4RW7B 4JI2J 4USVA 1HHTP 5A8KA 3M2RB 4WU3A 3THVA 1U1OA 4QIWD 2OIHA 3RR8A 3GZ7A 4Y34A 3FBBA 1TR0A 1RAOA 3RYLA 3H25A 1FRJA 2OEKA 1RBLA 1S72S 1V3SA 1F6TA 1BQNB 1FD8A 1TAQA 2DHSA 2KU7A 3NG8A 4OX7A 1RDRA 4P7TA 2KM8C 4CLYA 3N0VA 3T9ZA 2MZRA 4ZPWR 2BJ7A 4RBVA 3CUNA 4RW7A 4NXNJ 2HFSA 1VCTA 1GT8A 1T9TA 2QO3A 4IQMA 2GNKA 2IHR1 2YNIB 4FXWA 4OZ5A 3L4BC 4L73A 5D0GA 4NRUA 4QQBA 2N3OA 3DRYA 4DFJA 1YJWS 2JC0A 1CVJA 1J5EJ 1TL7A 1N5QA 3G8QA 4M5MA 4J5OA 1BC6A 4K4UA 3EXYA 3HFKA 1KOHA 2XGPA 3TRGA 4IO9Q 3FRZA 2FVQA 1XNQJ 3O2IA 4IKAA 3M8PA 1IBCB 1N36J 3QRPA 2R7VA 3AT1B 3DLLQ 1RHRB 4JI8J 5HP1A 2BW7A 2D9OA 5LSLA 1SUQB 3Q8RB 4F4XA 1WOPA 2DK2A 1HA1A 2IM3A 2MLZA 3CD5A 2Q6CA 3OFFA 2IVFB 2H3EB 2NSBA 3BGRB 4JI1F 3H5XA 1S1WB 1WC0A 2B5JB 1Q8BA 2BW2A 3GV8B 4LIWA 3LWLA 1S79A 1X4CA 2M7SA 2PIIA 4K5RA 1TFWA 5DG9A 3TUZC 1OQ6A 1GAOA 3TOQA 2R7RA 3SSQA 3OV7A 2D69A 2CKWA 3B6BA 3CJQA 3SQGA 4DX6A 5KG6A 4H4OA 4N76A 2CQ1A 1SL0A 2E1MC 1NKBA 4GKJF 3ZZZA 2ZH3A 1N33F 5B0FA 3QAEA 2ILZA 2LKZA 3AJ1A 2L41A 1T9YA 1HQEA 1Q95G 2B43A 1JJHA 2HVZA 2YWHA 4HI2A 3RGIA 3SCKE 3UW1A 3ZTQA 2Z57B 2YXLA 1RACB 1E6VA 1BGXT 1BQMA 4ER8A 4JBCA 1X9WA 2Y0SD 3CMQA 1F5CA 2OPSA 1TL3B 4TVAB 1HHQA 2ACMA 2XZTB 1I1GA 2F9JA 3NWGA 1H3DA 4QJVA 4OX8A 4X65F 3MR2A 2WVFA 1KFSA 9ATCB 2RUSA 1RWKB 2G0JA 3E8OA 3PFOA 4M8LA 2M5YA 4IYQA 4NYPA 2JLFA 4OYMA 2H5JB 5AXNA 1OIAA 3R5DA 4WFBQ 4B3SF 2YKMA 4ZIVA 1X9MA 4NZ0A 2D3O1 2ZBCA 2OJ3A 5EX0A 1X5SA 3BEGB 3GJTB 2BJ8A 4ES1A 1JQGA 5HVFA 3E51A 8RUCA 3QJLA 1RWMB 1QUVA 3VGTA 1P1TA 2XY7A 2IJNA 2J5AA 1Q8KA 4ZVSB 4WK1A 2QX0A 3KUHA 2XS2A 2DIUA 1RHKB 1WC1A 3S1TA 7FDRA 3S8SA 5KT6A 2F8EX 2KXNB 4WFAQ 2C2MB 1SKWA 2BJ3A 4ES2A 1SV5A 3HT3A 3TJAA 1IBLF 2XYPB 1X4GA 2EFVA 4C11A 1S9GB 2WVEA 3LUYA 4I6WA 4YDXA 5GVQA 3W63A 4CM0A 2NXCA 4DR7F 4DSIA 4V19X 3KKFA 1HW8A 3UD3P 4DL3A 3C66A 4DV7J 3CDAA 4NI2A 4Q7AA 2LXUA 1HYSB 3QPIA 4KRWA 5RUBA 1CEZA 1PO6A 2R8JA 2KTQA 3RB0A 4N56A 3AOBA 2ZJPQ 1RE1B 1TK8A 4XK8C 1ZZFA 2FY8A 2MQLA 4OHYA 4NMXA 2HKEA 2P8IA 3U1NA 1KHVA 3TZXA 5DGBA 4ED8A 2ASJA 3NNHA 4I2PA 3WQPA 4F26A 5DQHA 3PZPA 5LMUF 1TUVA 1YJUA 2M0GB 3A3PB 3UQSA 4DUTA 3KLEA 3W9JA 1HD0A 2K2PA 3MEDB 3P96A 2AW0A 1IBKJ 1WKLA 1VDHA 4OQJA 1RAAB 3MMJA 1F2GA 3PEJA 2B6AA 2MGZA 3PKYA 2MQQA 2PDAA 5HBMB 2Q79A 3VR1A 2V9WA 3OHAA 2CG8A 4DHVA 4ZCMA 4OHZA 4L72B 4IFVB 2KJVA 2OPPB 4NLWA 3SV3A 1QJHA 2CQDA 2C3MA 2J0SD 3G4SS 3NCPA 3DMJB 3PYEA 5G4DA 1QAIA 3A4TA 2QSWA 1W2IA 1C0TA 2CQIA 3MMBA 5DG7A 5D15A 3MM5A 2V4QA 1P9YA 4NLGA 3QMQA 1P27B 2ZNYA 2MQMA 3D7SB 1AROP 1GQEA 2BM1A 4IFVA 3T6BA 3AB2B 3DRSA 3FMWA 1RAGB 2W9CB 3NEKA 2P5VA 3IGVA 4M5NA 2RH3A 3UI3A 3SQGB 1NK0A 3AD7C 3QT6A 1UZHA 2FDNA 5B09A 4B9MA 5EGYA 4FF3A 1IM4A 3BH7B 4O3SA 3OR1A 3V4IB 3R5JB 5IV3A 4C8ZA 4IG0A 3VGUA 3DXBA 4WK3A 1RXOB 1WOSA 5GMKa 1QTNB 4X62F 1ZA2B 2HFVA 4LMZA 2EW9A 3DRPB 5J2QB 5B0BA 1L3TA 2L9NA 2AGQA 4YEAA 2KRBA 5KAKA 2HQ3A 3KHHA 1U02A 3WIUA 1NSAA 1NLKL 4KQZA 4KFBB 4P2XA 3TUIC 2MKKA 5C42B 1VHIA 4A8KA 1V3RA 2OPPA 2XY5A 4P2FA 4DR3J 2CPHA 5KT2A 4F2SA 5KG0A 4BC9A 4WYLA 1SB6A 3QGPA 4YR3A 4RPFA 4X64J 2GMHA 4B3TJ 3QJPA 1WACA 2ROGA 3LQVA 4JB8B 4RW4B 1S9EA 4F7VA 1S1XB 2O1PA 2PC6A 2FHKA 1HQUA 2F8MA 2OEJA 4Y2IA 2FQQB 2L48A 3FSIA 3H4BA 1BLUA 3J7ZT 4ZHRB 5KFRA 3B4MA 4AXJA 2XCAA 1TFYA 1TTHB 1MWQA 2FB0A 3ENQA 4Y2MA 3UCGA 3EX7B 4IUFA 3G71S 1ZOTA 2VA3A 4MH8A 3LPEA 3NBPB 3C6UB 4KHPJ 2DR6A 2HPUA 2OHDA 3W8PA 4P75A 4LFAF 4Z37A 2JEJA 4J7CA 2IPOB 4UQGA 1VQSA 4DV6F 2CJAA 3FCVA 1YJVA 5D0RA 2YQ3A 3G2XA 3Q86A 2OFGX 4KJIA 1HPZA 3AFGA 2RU9A 4M63A 1VBYA 2RT3A 4NX9A 1DURA 3KMQA 1LWXA 1T9VA 4QR2A 1SJ1A 2UU9J 4X4PA 1PIEA 3EZ5A 3WC2A 5E3PA 1HMVA 3MGJA 3MD3A 1R27B 4HHUA 4PCQA 3CD7A 3CT9A 2AYEA 2HZVA 4NE9C 2AP6A 3OXFA 5T41A 2VL1A 5HJXA 1N6QB 2DB1A 2LU2A 1XC9A 4F36A 2IY5B 2ZBPA 1RT4B 4NMLA 1U0HB 2YVSA 2P2CB 3KLGA 3A8KA 2DR7A 2BKNA 2E29A 1MN7A 2R2SA 1A6LA 7AT1B 5F3ZA 1RB0A 1TZ0A 1DAXA 3J7YU 2XMVA 4OX9J 2AU0A 2E66A 4WE1A 4YFUA 1J5OA 1KR4A 3NS6A 1H73A 2CPYA 2V5HG 3DM2A 5HMWA 3I55S 1GK8A 2ZE2A 3HSDA 3PW7A 4KPCA 1F9FA 4CIOA 1MG7A 2GZOA 5KFXA 2Z0GA 1H2TZ 5GMEA 4OZJA 1ELOA 4OZ1A 1OSCA 3I4PA 2FLOA 5K8MA 2XSFA 2I6WA 3DOMB 4PRFA 2WONB 2OMLA 2XZDB 4DV6J 3QBCA 3PR4A 3T5HA 2CWKA 4IH5A 2V94A 2HBRB 2YNIA 3GP9A 1LW2A 2HRUA 2BACA 4JV0A 4ED3A 2JZ5A 1S12A 4UUWA 2RE1A 2HHTA 2XNQA 1HWKA 4Q0BB 5KG5A 4RW8B 1VJWA 2WB4A 1HFEL 3ENVA 4ZHRA 4CLWA 1D9FA 3FCWA 2ZHOA 2QGFB 4LR7A 5F0WA 2J6SA 2M8DB 1MWYA 2LA4A 3UDLA 5GADU 4TKTA 3M2RA 3VAGA 2H1YA 1KONA 1FDAA 4GKJJ 3MMAA 2MKHA 1S76D 4LF9J 2BE7D 3HHLA 3SCIE 2ZNZA 1R0AB 3KK1A 4PG5A 2GCFA 2UXBF 3EM1A 2NXEA 3SSRA 4ZP9A 4DCOB 1HNVA 3DLEA 4A8MP 2ZUAA 5KT4A 3TAMB 1F9HA 4MYTA 5EWFA 2HLTA 3NOCA 1S4EA 3MMCA 2WTFA 4PG4A 1ZAWA 1NB2A 3TZWA 4PG6A 1KBRA 5J2MA 2GGPA 3HHNB 2WOMB 4WWSA 4CLZA 4B3SJ 2CJYB 2A2CA 5I42B 2VQEF 2GX8A 1WC3A 2GVZA 1K47A 1KQGB 4U7UD 4WFNQ 1DLOB 5J2PB 2AV5A 1T3NA 3PW2A 2HWTA 1FJEB 2VC1A 4FPIA 3M9OB 4F4WA 1Q5YA 4A8XA 4WZQA 1RTJA 1Y3KA 2EG2A 2HW3A 4U6PA 8ATCB 2VG7B 1IR2A 1UJ6A 4JOUA 4ECWA 2DGWA 1HI1A 1Q78A 2OPSB 2XWYA 4P74A 3K89A 4GRSA 1HI0P 3WX4A 4Y2CA 1DARA 4ECZA 4F3MA 3CNQP 1B7YB 1UEKA 4U7UK 2RNEA 1AUSL 1P6TA 5KFDA 2DR8A 1RU2A 1HL6A 1H38A 2ERRA 4YB1P 3V6JA 2M70A 4J9SA 2BKPA 3Q89A 1KS2A 1PJ6A 3OVAA 1RLCL 5J2QA 1U1PA 2ALYB 3TARA 4CT8A 4G1IA 1FK9B 2EPIA 2RQKA 3ENAA 2HHWA 1RTDA 1U48A 2CPIA 2FUG9 2K7JA 2CFXA 2CQBA 2YNHB 3V5RA 2IDEA 3DLHA 3DOLA 1TK0A 2VFVA 1B7FA 4BLGA 4EFAC 4PPDA 2ZZTA 4Z2XA 3HXMA 1EB0A 2E7XA 1FKOA 2DNOA 3MM9A 2BRKA 4I1TA 1NH7A 4O3RA 2PFFB 3GFHA 1AW0A 1R8PA 2LQBA 3OD2A 4DL7A 2PEHA 4LBIA 3IP0A 3J81j 1FJ7A 3B4DA 1NHKL 4DSJA 4TLRA 3N4WA 3QFHA 2ZE2B 3ICLA 2KM8B 2G0IA 3UD4P 4CNYA 2DNLA 3RR7A 4DX7A 4F3OA 1HBUA 2PD1A 2IBOA 3PIPQ 4LF8F 4DR1F 1UVIA 2EFQA 1WI8A 1VJQA 3CCMS 3IO1A 4J9KA 1S1TB 5DDOC 1WI6A 2YQ0A 3SFGA 1FERA 3T41A 2P6SA 2YWEA 4NXMJ 4M95A 4GKKJ 1XR7A 3UVJB 3NCRA 2MQOA 4FNHA 3GILA 1S6PA 2GA7A 1URNA 5E0OA 2W2QP 1I5OB 3TNVA 3OSNA 1JK9B 1V3ZA 2XI2A 1RAIB 2JFKA 4ETZA 4DR5F 4RR5A 1VQKS 1T05B 1PCAA 2YNGA 1HNZF 2XMMA 1Y5LB 3AJ2A 4DX8H 2BE9B 2PMHA 1VQ5S 1NUEA 5BR8F 4NYOA 3QIPB 5KFNA 2PGCA 4X4OA 3BR9A 4K4WA 2BQUA 2WBMA 1KC8T 2HZAA 1T9UA 1EQMA 1FESA 2BDPA 4DSLA 4RKUC 2AX1A 2OLWA 5ETQA 2DD8S 1S10A 3TQ1A 3V81A 3M8ZA 4X4UA 2CJQA 1WD6A 1G3OA 3OXGA 3RW6A 2J76E 3K57A 1TUGB 2ABYA 1RWWB 3JQKA 3N9UC 3IBWA 3SDEB 3LGNA 4OHWA 4ZVRB 3G9CA 2JL9A 5A8WA 2DHXA 2W8KA 2XEXA 3GSIA 3MUTP 2ZH9A 1I94F 1KLMA 3NXZA 1XMOF 4YOEA 2CDQA 3JSYA 4HT5A 2B8QA 5KFSA 3LH2S 3D9BA 5KFYA 4E8UA 2BEFA 1L3KA 1O8BA 2MQNA 3D1QA 5T7LA 4CCHA 3N5BA 3T9NA 1GX6A 4QIFA 3AAWB 3IWLA 4X4RA 2W2PP 2J8SA 3MUMP 2VG6A 2G9OA 3QO9A 4TYBA 5F9LA 5KFKA 1C1BA 1C1CA 4QYZJ 2MY8A 2WW4A 1WC6A 2V6AA 2V34A 4L3NA 4UY85 2ZHBA 1U24A 2FZKB 3BV8A 2DVIA 4PXEA 2KN4A 4WPAA 1SXLA 3A8IA 1R8AA 3ETOA 3PNIA 1CC8A 2F4FA 3OT9A 1H2VZ 4LRDA 4XTTA 4ZVFA 5KOXA 1FNOA 4TU8A 2OFHX 4DR3F 4KR0B 1K8AT 3BYPA 2VOOA 2LEAA 1FD2A 2CAJA 2YKAA 3MD1A 5FIIA 3HMJG 2UZAA 2ATCB 1Q79A 3M8SA 2ZH7A 4DR1J 2XBPA 1DTTA 1U8SA 1ROFA 1CJVA 2GAGC 3FSXA 4FNIA 3G8SA 1T9WA 2AJQA 2A3JA 3DC2A 4D3GA 1QE1B 1RAJA 2LA6A 3H0PA 2IBKA 1G1XA 1DTQB 1FRMA 2HVEA 1UWBA 3RAQA 2XC9A 4KV8B 2QE5A 4DR5J 1WELA 1EP4A 2VKRA 1JLBB 1NJZA 3DLBA 5JVHQ 1S7HA 1HQ2A 4USTA 5D78A 4QWBA 3SSSA 2JRSA 1VQPS 5BR8J 1FE0A 4KHPF 3C16B 2RF2A 1GMWA 1I3OB 5HMXA 4ECRA 1B64A 2FVPA 4DV2J 1HBOB 2KYZA 4IR9A 2DIVA 1RT2A 2BA9A 4J91A 2NYIA 4QPXA 4RW6B 4IOBA 3M32B 3BSAA 1G2EA 2DH9A 2DPJA 2RQCA 3SZ2A 4O0IA 3IM9A 1XMQF 1T9XA 3GR1A 1ZYQA 2G4BA 3TR5A 1RUSA 3IRXA 2ASYA 2HS4A 3MEEA 3L7UA 2XSJA 4PQAA 4EO6A 2MSSA 1RWUA 1TV6A 1VBXA 4WFZA 4BS2A 1TL7B 4OYWA 2O01C 1U1QA 2EFOA 3LP1B 2KJWA 3CCWA 3HHLB 3KHGA 4DV4F 3UN5A 5DLGA 1R0AA 2JEIA 3CIZA 3D54A 4O4GA 4X4QA 1HKAA 3QIPA 1Y5IB 3VAJA 4RW6A 1ZM9A 1GFWB 4ED5A 2IYGA 1ZM2A 3MPWA 4K8RA 5J1NA 4XDCA 5BYQA 3DNCA 5EUHA 2CJBA 2E1AA 4LFCJ 2LLZA 4ID5A 5HROA 1LWFB 1VHFA 1BQNA 1ZAVA 3CE8A 4WXOA 3NL0A 2APOA 1FJGJ 3HZEA 3KNGA 1DQ9A 4ZCIA 1SBRA 3GV7B 1CJTA 2BVZA 5L38A 1S1UA 1S97A 1KQKA 3H4DA 1V6HA 3UDCA 2ZH4A 4TLQA 1TP7A 3GCWP 1Y0HA 1Q5VA 2CIMA 4ZN3A 5ITHA 1CG2A 1F1BB 4KHRA 2NQPA 3T5LA 3FBFA 1UFKA 1ZTWA 2VODA 3HKZD 1JLAB 5HK4A 5DZ6A 4ID8A 2E1PA 3H90A 3HPOA 1H6KX 4BDPA 2I8EA 4P52A 5C5JA 4DV2F 3G87A 3N6LA 2JSXA 1Q8LA 4L3KA 5HQLA 1ZS6A 4DZ6A 3M30A 5IFMA 1AYEA 1E6VB 1XTZA 1LWCB 2CRLA 2GJ2A 3DU6A 1QSLA 4B9UA 2CPXA 4MKYA 4Y6IA 1H2UX 1RISA 3P4UB 2HHSA 4WCEQ 4ZK7M 5L1LA 2GS8A 3DN9A 4PPZA 4YQWA 4KE5A 4ZLLA 4J9LA 1M5PC 1XIQA 2FYXA 2ZBRA 1Y10A 3SFUA 4FBTA 2DEIA 4O44A 1BD6A 4DV4J 4QYZK 4ZIWA 1VQ9S 2MZSA 3LAMA 3AY0A 4LRCA 4P72A 3ZTPA 4WTOB 4A8QA 1K73T 1TVRA 3CJ0A 2CADA 4OI0A 4FYVB 2ZEJA 2DJWA 1BMQB 2IYIA 2VH7A 5HMZA 3OTBA 1VQOS 1RADB 1FDBA 3W9HA 2MZJA 3MHYA 1MW7A 3I5AA 5IWAJ 2QA2A 3MUVP 2J7WA 1SC4B 3H98A 4DQPA 3HD1A 4UOGA 1TK5A 5B0CA 4ED6A 2GHWA 3W5YA 3NAHA 2UUWA 3DFEA 4GMKA 1U2CA 5AT1B 4O3QA 2K1RA 3IAS9 3RZAA 5LXRA 3EJMA 5B08A 1VMBA 1LWCA 1BQMB 2J7UA 4DPOA 4EO8A 2MYFA 2Y1LB 3P49B 1RLDA 1UA0A 1N52B 3H20A 5KFUA 3Q8YA 4UOCA 2DH8A 4QYRA 2G1HA 2J0XA 3KLHA 3SI8A 1R8BA 2EC0A 1RTHB 3HK2A 5L1KA 3C6UA 1HNIA 1IKXA 1DZ5A 2AD9A 3T5JA 4NEYA 1T94A 2RKIA 5GADI 2RDDA 5HLFA 4K0KF 3TJ8A 5IS2A 2Y1JA 3PRVA 4CI0B 2KHDA 3HFVA 3TA0A 3QFWA 2B9WA 3R7NB 1OO0B 3W64A 2VJVA 1TMMA 3CIMA 3KJNB 2B5JA 5E2QA 2MLXA 2Q43A 2W24A 4R8UA 3LA0A 5DDRC 5M2PA 1S6PB 3BGFA 3HP6A 4OYPA 2HK2A 2YTCA 1W2BR 4KT0C 2A10A 4LQ3A 1WHVA 2AJFE 4PKDB 1OPIA 2MJUA 4I0WA 4B3MF 1UL3A 3ILOA 3M2UB 1MMDA 3UR0A 1L5UA 4B3OB 4ZJQA 1ZAXA 2HURA 4NEZA 3LO3A 2JOQA 4Z7YA 5F8HA 5L9XA 2DY1A 2B7BB 2NXNA 1XK8A 2LYVA 2NUHA 3BSOA 1KVKA 3ITHA 4ED1A 3QSYB 4UTGA 5LM7E 1CS4A 1FRLA 4LIRA 4PEOA 4ZVOB 3CF5Q 5IT9U 2GJIA 2DRBA 4JV1A 2OTLS 2OSQA 2FJAB 5H9EJ 2C2ZB 2MKYA 2YKOA 3AJDA 2BJDA 3CEDA 3MTJA 4LF2A 4PQUB 1NK4A 4W90B 1NHVA 3OFHA 4BC7A 4LF7F 2PN6A 1SVDA 3H8YA 4JYAJ 3QGGA 3VCDA 4F0MA 1TL5A 2DH7A 4FXVA 4USMA 2QYCA 1MMLA 3OLBA 4J9QA 1TAUA 1RHJB 1OQ3A 2B4UA 1RI7A 4O3OA 1T02A 5KFIA 4CLTA 3M6XA 4AE5A 1YHQS 4ELTA 2N7YA 2LP4A 1SH2A 5LJ3Y 1XERA 4F8RA 4PWDA 1NDLA 1WG4A 3DRSB 4OFZA 2R2UA 2DHAA 2Z2LA 1SL1A 4RWWA 4RBUA 4WIQA 4CYUA 1VK8A 1YDLA 4OHXA 4WZMA 1MU2A 3OJUA 3CC4S 3MMBB 4LRBA 4NLSA 3T1HJ 1PC4A 3P6YC 5KT5A 5AXLA 1T8EA 4CO2A 2QLWA 2G2ZA 4ZA1A 1Y3JA 3M7VA 2AYGA 1Q1KA 1WTBA 3GQCA 3CGIA 1U47A 4AXIA 1PGZA 4LFBF 2AIRB 1FRIA 4OHVA 3F73A 5ETMA 3DHXA 1VRTB 3R5CA 1DY3A 1R7IA 4L74A 2VV5A 3TVKA 1PAUB 2ZWOA 4TY8A 1KD1T 1YRTA 2CVIA 2WZ1A 4YDDB 1GTHA 5HMYA 1DLOA 1KSPA 5K8NA 2YNHA 4OJGA 4LRFA 3OTOF 4I68A 3LANA 4B9NA 1F9EB 3KLEB 3QJJA 3QYYA 2J0QD 4CQ1A 4QR0A 4ZJOA 3NNCA 2IDLA 1SIWB 1YGYA 5HATA 2C1EB 3TJ9A 3GFYA 5EWGA 5EDWA 4EBDA 1IBMJ 3I9V9 1BWEA 4YN3B 2H54B 3GG0A 1GMUA 3CDWA 5BXIA 3OL8A 1MMNA 3DCAA 2QSFA 3HX9A 2LXIA 4K4VA 2FLPA 3FSYA 3EUNA 3ZZUA 3RB3A 3BS9A 4HVZA 3G6XA 2HHUA 3GIJA 4C0HA 4DV1F 4C3LA 4CH0S 1KQSR 3D66A 2Q1LA 2F3JA 3GR0A 4DUZF 4PUOA 4Q5VA 3IS9B 1EJ7L 4B02A 2YWFA 3G6YA 1SJFA 1N33J 4MKAA 4ANDA 3C6TA 3SCJE 5J2PA 4DPUA 4JI6J 3MPDA 2A6MA 3DOKB 3IXQA 3RU0A 3EICA 3HVTA 3QNWB 4LSLA 4OIXA 1G7CB 4BWMA 5GAHU 4ED7A 1IWGA 2CZ9A 2N82B 4MIWA 1NBEB 3JTNA 1Y9OA 1TMJA 2KG1A 1LW2B 3A13A 4CWBA 1OSDA 3OVBA 4MFBA 1NSQA 3LP2B 3DLKA 4OI2A 1NJWA 3KG0A 4GC7A 1HNXJ 4G3IA 1U6FA 1M5VC 2KL8A 4USKA 4QCLA 2UXCF 4DSKA 3OHBA 1RCXB 2WSCC 1RT3B 4U67Q 4DV3J 1XMQJ 4ICLB 2HVIA 1S9GA 4RW9A 4LFBJ 1F3VA 1SV5B 1U7LA 3DM2B 4J9VA 3V2UC 2ADBA 1NK7A 5CXTA 4M94A 2BANB 1N5SA 2E44A 2RD5C 1IR0A 1WKKA 2HHQA 2OELA 3O3LA 1FNMA 4HKQA 2GV1A 1UVMA 1X8DA 4FPRA 2MXYA 1CJKA 2VJUA 1N36F 3CSKA 2AGOA 1RT1A 3HHDA 3RRHA 4H4OB 3HKWA 3IAM9 4NCAA 1APSA 2AGPA 3BDPA 1VQLS 3DLGA 2KYXA 3ONQA 5C2CA 1EQ0A 3EWGA 1X5TA 1VC0A 4KV8A 1F2HA 2MZTA 2YKNB 3N5FA 4HHHA 4IH7A 3MFIA 2H5IB 1X4HA 1CJKB 3AH6A 4JP8A 4USUA 3ZZPA 5F0UA 4MKVA 4RJVA 4M5HA 3UE2A 4BBYA 2W9AA 2X1FA 3NNAA 2QL5B 4HTJA 3MEGA 1SUQA 1IWAA 1IVZA 4D3HA 4S0MA 3T19A 5KTQA 4OYOA 1HWJA 4NRTA 2XNRA 3AA9A 1Q53A 1ZA1B 2DXEA 2GVDB 1PAEX 1RU1A 3NGTA 4UUXA 3MPVA 4ZPBA 3UDVA 1PSDA 2IVYA 2JNJA 4YY3J 5AJ3J 2UUBF 1SCJB 1YVFA 3HHEA 4DQSA 3GIIA 5HVHA 4DZDA 2W9BA 3HVAA 3HVWA 4PXCA 3OFGA 5F8LA 4CM2A 4FZVA 3T5KA 5L8RC 3BQ2A 1FRKA 2NS1B 2VFSA 1OY8A 2FJDB 2EXUA 3CW2C 3DDKA 3EPGA 2J9CA 2LQ8A 1RT4A 2V69A 3MCMA 4DPTA 3UNGC 2UUAJ 4C2MA 3QO9B 1NDPA 1VLOA 2HS3A 1S6UA 1LV5A 2V4JA 4KO0B 4ZVPB 1FWLA 4C3MA 3M2VB 5LL6d 5DDPC 3GIMA 1E6YA 3VQTA 4EU0A 4JUZA 5CD4H 4Q44A 1CC7A 2GGPB 5ETPA 2EG1A 1WNEA 3TEGA 1VQYA 2A1BA 5H9FJ 1O0PA 3TZYA 3PW0A 4RW4A 4YR0A 3M8YA 1RWOB 2MSTA 3T3FA 1WSVA 4M5GA 5DZ7A 3VAIA 1FVQA 1CJUA 1WHWA 3ELHA 4JI0F 3ZNUA 4ZPTR 3PO5A 2DRDA 3JAMU 3OTCA 4WIIA 3H42A 1FFWB 3VGVA 5DLFA 1K44A 2KVIA 2YH1A 1YI2S 3MM7B 1CULB 1SJQA 1JB0C 4ILLA 3TUJC 4K4ZA 3I0SB 4DR7J 1HARA 2XZWA 3AXKA 4NLYA 4DV7F 1LEOA 1FXDA 4NLDA 4TU7A 4J9OA 1KQFB 3FFIA 2W7OA 2CDRB 2AMCB 2F5GA 4MIBA 3W5XA 4AYBD 4OX6A 3TVZA 2RSQA 5IWAF 2RILA 3HVTB 2DGSA 4NA3A 2J8AA 1R6VA 4IFYB 5K5MA 1WF1A 3RBXA 4N5SA 3PW5A 2J9EA 4LF6J 1NSPA 5CYQB 1F5BA 4IR1A 2KZMA 3Q2SC 3IBFB 3OJSA 1SQGA 1T03B 1FT8A 4IH6A 4CLPA 2I5JA 2YX4A 5KOWA 3QGIA 3CD0A 3MI7X 2LDIA 4DS4A 2R3VA 1N5VA 2KVQE 6FDRA 1WEZA 1UTAA 4E0DA 2DNYA 1SH3A 3AA8A 3O44A 4LVOP 5KFEA 2ZH5A 4F2RA 4DQQA 4FYWB 1IUJA 1IQTA 4ZVQB 4IDKB 5KG3A 2XG8A 3THTA 2IAJB 3W60A 5CYMB 3ULHA 3ZZOA 4KHMA 1MN9A 1XEZA 4M5DB 5T14A 2ZWPA 1FO1A 1WKJA 4FYYB 1RT2B 2FHMA 3W9IA 4CH1A 4KIAA 4NL5A 4CRJA 1HLWA 4JI7J 2FJBB 2MY7A 5B0AA 4X66F 2HHHJ 3R7BB 4FP9A 5A8RB 1W25A 2J7KA 4GVLA 2JX2A 1N32F 2XQCA 1XR5A 5HBMA 4ANCA 3OR1B 3V4IA 2MEWA 1SL2A 1U0HA 1GX5A 1X7VA 1WWHA 2JFDA 4DR2F 1C1CB 1C1BB 5KT7A 3V6DA 3CJ3A 3NY0A 4OI4A 5J1EA 4ECYA 3TI0A 4KGMA 1U6ZA 1UJ4A 2MMYA 4RLEA 3LOUA 2O67A 3EVWA 1HNWF 1P1LA 2X1GA 4C8MA 1Q7LB 2KO1A 3UWTA 4RU9A 3EMTA 2YY3A 4GKKF 1NMEB 5DQGA 5A2QY 3LF0A 5KFTA 2HNZB 4LSZB 3CULA 1M0SA 2SXLA 2V8GA 2W2OP 1D8ZA 3KJQB 4X84A 2B3TB 4EGLA 5FLXU 3J81Y 2ASLA 2YPZA 1N5YA 2IM0A 2H65B 3CCTA 2C2KB 5KFVA 2BR0A 3HZGA 2NXUA 4OJ1A 3R1LA 5DRKA 3W61A 2DNGA 1MLAA 2MLYA 3I32A 2IFXA 3D6TB 3MAAB 5BYSA 5LMNJ 3FZ2A 4DF4A 1JLAA 3D6MB 3NOGA 4F4AA 2C2DA 1FWKA 1WHXA 3NWRA 5K8OA 2FVRA 2JVRA 2YNFA 5F9NA 4WF9Q 4R25A 3QZ7A 1LWEB 2G13A 2AYMA 2W7AA 2GHVC 2BABA 3KFWX 4CO3A 1FEEA 3M8WA 2HBQB 3HULA 2I0XA 5G0RA 1UA1A 2VG5A 3KXDA 3A8JA 1RT1B 4X66J 2Q3PA 5L1IA 2QC3A 5JUMA 3H40A 1WC5A 3H2VE 3PX0A 1GXUA 2IRYA 3QATA 1SC1B 4HACB 2OH2A 2CQ2A 3RW7A 4TU9A 3M1VB 1AUDA 1S9EB 3AB4B 3KMSA 4K4YA 3SMZA 4HH0A 3CVKA 2XS7A 2GO9A 1YRUA 2VKZG 2MDAA 4NZ7A 4ZCKA 1YTYA 5DQIA 3MAHA 2LDYA 2E1RA 3JSMA 3PJ9A 3JTOA 5AE2A 4ZLJA 1M90T 2XTJP 1S6QA 2RQ4A 4I2QB 4KGKA 3X1LB 3TA2A 3VGSA 4O4RA 1PYSB 2QRRA 2XSJB 5JXSA 4QPTA 3L09A 4DPYA 1PBUA 3ZZ0A 4KFBA 1S57A 1VFJA 1WTFA 1GXLA 3MMAB 3RAXA 2C42A 1U2RA 1QAJA 4DV1J 3QRQA 2JVOA 2XLJA 4LBHA 1N0VC 2J6TA 3DI6A 3SQOP 5C24B 4DUZJ 1S77D 3OTOJ 1S7IA 2HGNA 4ILRA 5E3RA 5ETNA 1LK5A 3NP5A 1TKXB 2D3ZA 2NSCA 2BJEA 2DGXA 2W2MP 3AODA 3IWXA 3G6ES 2QYGA 1U6BA 3W2WB 1YRXA 1Q0NA 5F8NA 4KAIA 3GIRA 4X2BA 2Y8WA 3F41A 3OQ2A 5LT5A 3BO4A 1GEHA 3VALA 2VQFJ 3VAFA 2WONA 2K3KA 1FK9A 1ZBTA 2H4YB 1J2VA 3A8EA 4ZITA 4R5PA 4UOFA 4B3OA 1S59A 1I51B 1KOOA 1F5AA 3GMGA 4P7VA 2H9ZA 2L9WA 4ED4A 3G96A 1PKUA 3SIPB 4Q43A 4M5DA 3BR8A 3OVSA 2XMUA 3M8PB 3OPKA 1H72C 3M30B 2UUTA 1U0SA 4GC6A 5CZXA 2DY9A 5JVGQ 4U8VA 2AJ2A 3PX6A 2P9EA 2RVJA 2XMWA 3DLJA 2OPQB 2UXDJ 2K3IA 1S48A 1X60A 2H51B 5D0HA 4R5PB 3KJVA 4B08A 1KLNA 1UVLA 4I4BA 2PFDA 3PCOB 2QLBB 1AT1B 3AOCA 3R9LA 3VVUA 2R8KA 3V6DB 3QGHA 2AQ4A 2XYHB 4NA1A 3GU0A 3KUGA 2ZH2A 4DF8A 3QLHA 3CJKB 4JI4J 1RP5A 5HROB 1W7WA 4GO5X 4I2PB 4ZDNA 1AZSB 4WKYA 3BO3A 3MOJB 4DV3F 1F60B 2BANA 1KKHA 2O66A 2XY6A 1W26A 1HBMB 3PTWA 2AYBA 3WBZA 5K9FA
chains in the Genus database with same CATH topology
1RE1B 4ZVOB 1NMEB 3P45B 4LSZB 2C2ZB 3KJQB 1QDUB 2P2CB 3EDQB 2HBZB 3KJFB 3RJMB 2H48B 3D6HB 2H65B 2CNLB 2C2KB 2H5IB 2H4WB 1GFWB 2QL5B 3D6FB 1RHJB 3D6MB 2QL7B 2HBQB 2XZDB 1RWVB 1SC1B 2HBRB 1RHMB 4DCPB 4ZVTB 1RWXB 4ZVPB 1IBCB 1RHRB 1PAUB 3P4UB 4DCJB 2QLFB 1SC3B 1RWOB 1RWWB 3R5JB 3GJQB 1F9EB 4ZVRB 1QTNB 2C1EB 4DCOB 5IC6B 1BMQB 2H54B 1RWPB 1RWNB 2DKOB 3GJSB 5IC4B 1SC4B 1RHUB 2CDRB 3GJRB 2XYGB 2CJYB 2QL9B 2Y1LB 2H4YB 4ZVUB 3IBFB 4JB8B 1I51B 2XZTB 3NS7B 3R6LB 1RWKB 2FQQB 3SIPB 3R6GB 2H5JB 3QNWB 4ZVQB 3GJTB 2H51B 3R7NB 1ICEB 3EDRB 1RWMB 1RHQB 3KJNB 4ZVSB 2CJXB 2QLBB 1RHKB 3IBCB 2HBYB 2XYHB 2C2MB 3R7BB 2XYPB 2QLJB 1I3OB 2CNKB 2Y0BB 1PYOB 3R7SB 2CNNB 2C2OB 5K20B 2CNOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE1 B;  4ZVO B;  1NME B;  3P45 B;  4LSZ B;  2C2Z B;  3KJQ B;  1QDU B;  2P2C B;  3EDQ B;  2HBZ B;  3KJF B;  3RJM B;  2H48 B;  3D6H B;  2H65 B;  2CNL B;  2C2K B;  2H5I B;  2H4W B;  1GFW B;  2QL5 B;  3D6F B;  1RHJ B;  3D6M B;  2QL7 B;  2HBQ B;  2XZD B;  1RWV B;  1SC1 B;  2HBR B;  1RHM B;  4DCP B;  4ZVT B;  1RWX B;  4ZVP B;  1IBC B;  1RHR B;  1PAU B;  3P4U B;  4DCJ B;  2QLF B;  1SC3 B;  1RWO B;  1RWW B;  3R5J B;  3GJQ B;  1F9E B;  4ZVR B;  1QTN B;  2C1E B;  4DCO B;  5IC6 B;  1BMQ B;  2H54 B;  1RWP B;  1RWN B;  2DKO B;  3GJS B;  5IC4 B;  1SC4 B;  1RHU B;  2CDR B;  3GJR B;  2XYG B;  2CJY B;  2QL9 B;  2Y1L B;  2H4Y B;  4ZVU B;  3IBF B;  4JB8 B;  1I51 B;  2XZT B;  3NS7 B;  3R6L B;  1RWK B;  2FQQ B;  3SIP B;  3R6G B;  2H5J B;  3QNW B;  4ZVQ B;  3GJT B;  2H51 B;  3R7N B;  1ICE B;  3EDR B;  1RWM B;  1RHQ B;  3KJN B;  4ZVS B;  2CJX B;  2QLB B;  1RHK B;  3IBC B;  2HBY B;  2XYH B;  2C2M B;  3R7B B;  2XYP B;  2QLJ B;  1I3O B;  2CNK B;  2Y0B B;  1PYO B;  3R7S B;  2CNN B;  2C2O B;  5K20 B;  2CNO B; 
#chains in the Genus database with same CATH topology
 3ITH B;  1MU2 B;  1S0V A;  1V5V A;  1YG0 A;  4ICL A;  3TAM A;  2AEF A;  2R42 A;  3D4J A;  3KLI A;  3PYD A;  3BH6 B;  5ETT A;  3HLU A;  4PYA A;  4DWI A;  1QDU B;  9RUB A;  1YKW A;  3I82 A;  3KNA A;  3DLK B;  4CO1 A;  4PWD B;  1QVF R;  2HBZ B;  1M1G A;  3D0I E;  3M6U A;  2VDH A;  1MNE A;  1KHW A;  2CNL B;  4NPO A;  2X1B A;  4ZPC A;  4RO0 A;  3FJ2 A;  4CT9 A;  5D77 A;  1RJJ A;  5GAH I;  2G2O A;  4URS A;  5B0E A;  5M2R A;  3MUR P;  1LOU A;  3G8T A;  3BGU A;  3PEH A;  1VIX A;  2V50 A;  4UQT A;  2LQJ A;  1QM9 A;  2DHG A;  2C2R A;  1T05 A;  4FKY A;  3PY8 A;  1OPZ A;  4U7C A;  2OGU A;  3CJK A;  4LF6 F;  2J9D A;  3DU5 A;  4C6A A;  5DGA A;  2LMI A;  2CQP A;  2I2Y A;  4WFX A;  2VQF F;  1S1X A;  4DOZ A;  3BJY A;  2MKC A;  2ACY A;  4XIU A;  4X64 F;  1J5E F;  4B3T F;  3FK4 A;  3UVJ A;  3Q2T C;  3MPY A;  2IA6 A;  3BYR A;  1R6Y A;  4RUH A;  1RA7 A;  4K50 A;  4R0J A;  4UT4 A;  2LEB A;  2VFT A;  1YBT A;  2PA8 D;  3MTK A;  4DCP B;  5L1J A;  1QE1 A;  4UZB A;  4OI6 A;  3WX8 A;  2KXF A;  1RWX B;  3KK1 B;  4K4S A;  3JB9 k;  1XN9 A;  3TX8 A;  1RZM A;  1U8W A;  1JJ4 A;  2HQF A;  3AOA A;  3IG1 B;  3CME S;  1REG X;  2R4F A;  4Q2M A;  2UUC J;  1VI7 A;  4CO4 A;  4DLG A;  3W8G A;  2YKQ A;  5HN0 A;  1FFS B;  5CD4 A;  3CCJ S;  1XNQ F;  4R0E A;  5J1P A;  5D8H B;  4CH7 A;  4DQR A;  4G1P A;  2R7S A;  5DS7 A;  3OTE A;  3CXC R;  1IKY B;  1YLX A;  1WOO A;  2QG9 B;  1JXE A;  2X3D A;  1FKO B;  3R97 A;  1GH8 A;  3WIV A;  2YBV A;  4I7F A;  3HI9 A;  1AXQ A;  2D3U A;  2M2B A;  3PXG a;  3RB4 A;  3POT B;  1UW4 A;  2CQ0 A;  4URG A;  1SJ4 P;  4DR6 J;  3NGS A;  3BQ1 A;  1Q81 T;  3V4M A;  3ZZR A;  2DKO B;  2F7V A;  4J9U E;  2MZQ A;  3OSP A;  2UU9 F;  2YKP A;  1GMV A;  1JXV A;  2NCK L;  1TL1 A;  3DDI A;  1S1W A;  3PG9 A;  3US5 A;  3KLH B;  5JMN A;  4C8Y A;  1DJ0 A;  4K2X A;  2E5J A;  4PYD A;  3W1Y C;  3Q0A A;  1HD1 A;  4RBT A;  4NLQ A;  3CO9 A;  2E5L J;  2EBE A;  3NMA A;  1SC6 A;  3HJF A;  1PC5 A;  1Z2L A;  2AX0 A;  2V0N A;  3ZZT A;  3MM6 A;  3KYL A;  3D28 A;  1GXT A;  3J80 U;  2C3Y A;  4EYI B;  4QR1 A;  1TL1 B;  2DT9 A;  1FE4 A;  1B70 B;  1Y5N B;  4MFB B;  3RG6 A;  1RTJ B;  2QIF A;  1U1K A;  1FFG B;  1VK3 A;  4JI7 F;  3BPD A;  4H4M B;  1R0C B;  3MR6 A;  1FHT A;  2CJ9 A;  3N6N A;  4OI3 A;  4ETX A;  3OL7 A;  4IOC Q;  1RCO B;  3L7O A;  4WKR A;  1EHW A;  3DGP B;  1NPP A;  5LSR A;  3VAK A;  3GB0 A;  2F8H A;  3TP2 A;  3Q83 A;  3CTR A;  4OV1 A;  5LJ5 Y;  2HFN A;  2E5I A;  1IBL J;  3WC0 A;  1HQU B;  2H5E A;  2V8H A;  1R89 A;  2E9Z A;  4PQU A;  2MJN A;  1YZ6 A;  1B99 A;  2WVD A;  3FFI B;  4QW9 A;  2VFU A;  1X4B A;  2DNQ A;  2XCP A;  5ETV A;  4MT1 A;  4DL4 A;  3IS9 A;  2FHJ A;  4P73 A;  2ZD1 B;  1S1T A;  3MFH A;  3DGV A;  2FGC A;  3Q24 A;  2UV8 A;  1NCL A;  3UDE A;  2QT7 A;  4YR2 A;  2ZVS A;  1UVK A;  1RGV A;  5K14 A;  2GML A;  2PEB A;  1HBU B;  3GFZ A;  5DG8 A;  1Q7Y T;  3P5B P;  1UJ5 A;  2C2O B;  4ENO A;  5F8M A;  4CZC A;  1WF2 A;  3TYT A;  5K20 B;  4RZR A;  2KFY A;  1QVG R;  4B3M J;  3IR7 B;  1FX4 A;  1VQ6 S;  3GYN A;  3N6M A;  1X4A A;  2RML A;  3UPF A;  5IT9 Y;  3Q8S B;  2KRR A;  2N3L A;  3M6W A;  3RJM B;  3OUY A;  4JV5 F;  3M2V A;  2V2Z A;  1XBW A;  4OLP A;  1I94 J;  2VG5 B;  2V63 A;  3MWB A;  3P5T L;  2FJW A;  4OI1 A;  1RT6 A;  1TQL A;  4LT6 A;  3J7A 1;  2RKI B;  3JS9 A;  5HLF B;  2ZJQ Q;  2IMW P;  2F4V J;  4DV0 F;  2P9G A;  2B9Y A;  2QMX A;  3HSZ A;  4ZLN A;  4ERD A;  2HQD A;  3OTD A;  4NLU A;  1XWL A;  3B82 A;  2WB1 D;  2ZH6 A;  4DFP A;  5THW A;  4QWD A;  1FI4 A;  1K1Q A;  2AEM A;  1NJI T;  2NR0 A;  3TVY A;  2B4O A;  2HRY A;  4P2M A;  3PO4 A;  3BPS P;  4C0B A;  2ZHA A;  2VB6 A;  4AL6 A;  4FXD A;  3I9Z A;  5CCL A;  4X4N A;  2QJ3 A;  3W66 A;  1JLG A;  3R1H A;  2U1A A;  1RHM B;  5ETS A;  1U1N A;  2XLK A;  4ZVT B;  4NLR A;  2HNZ A;  3TZZ A;  3LP0 B;  4C7Q A;  5F3T A;  1PBA A;  2ZFH A;  2HFZ A;  3IMQ J;  3KDN A;  3U1M A;  1U49 A;  4TQR A;  4JI5 J;  5KFM A;  4ILM A;  2VPW B;  4ED0 A;  4KGX B;  1QLN A;  1BE4 A;  3HCX A;  1S1V B;  2KDO A;  2ZOM A;  1N5T A;  3IFE A;  1VLY A;  1DQA A;  3UCZ P;  1SC3 B;  1N6Q A;  4AL5 A;  4ED2 A;  2FTR A;  3D3C J;  1URR A;  1VBK A;  3OFE A;  3FMB A;  4CLU A;  2DRA A;  2IJR A;  3MR5 A;  3OUY B;  2FHJ D;  1UPP A;  1D9A A;  4W98 A;  3K0J A;  2PE8 A;  5J2M B;  1FKP A;  2DIT A;  4ECT A;  5SUH A;  3QRR A;  1RWP B;  5F41 A;  2AZ3 A;  4ZLP A;  2FJX A;  2DGV A;  2PSZ A;  2DGQ A;  3PDN A;  4C4W A;  4TY9 A;  3I0S A;  2A6O A;  4OV6 A;  1VR6 A;  2GJF A;  4AD6 A;  3CCR S;  1RT7 B;  1IQZ A;  2KI2 A;  5B0D A;  1HYS A;  3UR3 C;  2NZ4 A;  2ZKT A;  4I2Q A;  3MXH P;  1LK7 A;  1FDD A;  1JLQ B;  4DPW A;  3JSM B;  2IVM A;  2Y9H A;  2VBX A;  2B6A B;  1UVN A;  2GO8 A;  1LW0 A;  3MZI A;  2HMI B;  4KKO B;  2PMW A;  1IKV A;  3PRD A;  4EYH B;  2DNM A;  2NLW A;  5AE3 A;  3MED A;  4R8U B;  2RIJ A;  4H4M A;  4A8O A;  5HQ8 A;  4LF8 J;  3R6G B;  4F0K A;  4YUD A;  2WOM A;  5CAB A;  1BWV A;  2AZ1 A;  4XPE A;  2ZH8 A;  2XMK A;  1WG1 A;  1X5P A;  5A8K B;  4A8Y A;  1U09 A;  5MLC V;  2VOP A;  1X4F A;  3WDO A;  1VS3 A;  2FD2 A;  3OW2 R;  2Z30 B;  1JWW A;  2XMJ A;  1JKH B;  4JI8 F;  1XR6 A;  1JLF B;  5A6P A;  1V9O A;  2C3U A;  3P3D A;  1C0U A;  3M8Q B;  4ECS A;  4NI2 B;  1HNV B;  1VGY A;  3DLE B;  2Z2Z A;  5HI7 A;  1IM6 A;  1SJ3 P;  3TEH B;  2ZM6 J;  1S6Q B;  1FF2 A;  1U1M A;  4LUB A;  1VRU B;  4WFY A;  5IQQ A;  2CJK A;  3ZNJ 1;  3VVT A;  3E01 A;  3W5Z A;  5LXY A;  4RNO A;  3ZZY A;  3L7P A;  4DU8 A;  2FJV A;  2HHX A;  1AZS A;  3R7S B;  2AF6 A;  1UZD A;  4C0O C;  1NKC A;  3DRP A;  3GG1 A;  4QU7 A;  1MSW D;  2B8P A;  1M5H A;  5LSO A;  1YX2 A;  2D7S A;  3KUE A;  2BE2 B;  4P2S A;  2C3P A;  3DGP A;  2U2F A;  2EI5 A;  3DLG B;  2AEJ A;  4HDH A;  4KGV B;  2UVR A;  1LWE A;  2Z4P A;  2DTJ A;  3JYT B;  1AFI A;  3CDU A;  4I6Y A;  4OYZ A;  4OX9 F;  4AUK A;  4IG3 A;  3D6H B;  4MMO A;  1U2F A;  3AD8 C;  2VIH A;  1S9F A;  1SKU B;  2HNY B;  3JTP A;  2JC1 A;  1HMV B;  4AQY F;  1RAF B;  3CC7 S;  3FVY A;  4ZP6 A;  1X0F A;  1WUU A;  1M5S A;  4FVC A;  2CWX A;  1JJ2 R;  1ZPW X;  3PIO Q;  3I96 A;  4OZL A;  4JI5 F;  2D41 A;  1WEX A;  2VC0 A;  3DHW C;  1T95 A;  3MCS A;  2CA9 A;  3ILI A;  2KT3 A;  1JLE B;  4B9L A;  5D3G A;  4QOT A;  1NDK A;  2W7P A;  1S4F A;  2OMO A;  2E5G A;  4P71 A;  2ZM6 F;  1N56 A;  4B3R J;  3D5M A;  4RNN A;  2HK3 A;  2M52 A;  3UD5 A;  3ISN C;  5C2G A;  2XGQ A;  3IR6 B;  3C3L A;  4P10 A;  4AT1 B;  3HHL C;  4EUV A;  2DGO A;  4C8N A;  4OLO A;  4YY3 F;  5AJ3 F;  3W2W A;  3KK2 A;  4QU6 A;  2N4D A;  3Q8V A;  1NK8 A;  3L95 X;  5D4O A;  2V8P A;  5E5N A;  3OL6 A;  4IFY A;  3FBE A;  5I3U A;  2V68 A;  5A8R A;  4PXD A;  4QZV B;  2LFV A;  3GCX P;  5KFP A;  3MR7 A;  2K8G A;  2OD6 A;  3D1O A;  3DI6 B;  3R5A A;  5C24 A;  1SQE A;  1IKV B;  3WZ0 A;  4DXL A;  3HM9 A;  1FA0 A;  1NSK L;  1C2P A;  1YK9 A;  1J27 A;  1RAH B;  1PJ5 A;  2VAS A;  3CDB A;  4K7Q A;  4LF1 A;  3CCZ A;  4LSN B;  2R8I A;  1D1U A;  3D0G E;  4G1Q A;  2ZDP A;  4HTI A;  3K7R A;  4DG1 A;  4C8K A;  3QAU A;  1SKR A;  3F44 A;  2JWN A;  3O8W A;  3ISN D;  3IWN C;  2OI2 A;  4LF9 F;  2I1R A;  3LGH A;  5KG7 A;  4C11 B;  4OYI A;  1Y7P A;  3RBZ A;  5GAG I;  4DJB A;  2E5H A;  5AXK A;  3S6E A;  3ZC4 A;  2RB7 A;  3I56 S;  4FS2 A;  2VQE J;  2I5J B;  1UP1 A;  5IXU A;  3H7H B;  4I56 A;  2R2R A;  1VC5 A;  2NYH A;  5ETR A;  2GW8 A;  1UVJ A;  5ADZ A;  2BZ2 A;  3HO1 A;  1QAY A;  5I3U B;  1XJW B;  3TAQ A;  3U7J A;  3QLH B;  3D68 A;  4ID5 B;  4RNH A;  3HSG A;  4LF4 F;  3EPI A;  1YJ7 A;  2L3M A;  3MF5 A;  3I5C A;  3NS7 B;  3ZTR A;  2RHS B;  3CWJ A;  3A3O B;  2YX7 A;  1B0T A;  3C19 A;  5BYR A;  4NZ6 A;  5FJ4 A;  1P8G A;  3ET6 B;  1IKX B;  4GO7 X;  3KHR A;  2W9B B;  1CUL A;  2HHP A;  1LKZ A;  4NLX A;  4I69 A;  2RS2 A;  3KLI B;  2MKS A;  1TKT A;  1O6X A;  3B78 A;  1OJ4 A;  3QT5 A;  2GIF A;  1U26 A;  3S7R A;  3FUY A;  1EAY C;  3D3B J;  4K5S A;  1VC6 A;  3EGW B;  4JI1 J;  5L9N A;  2MQP A;  2FC8 A;  4O23 A;  3Q22 A;  4B3R F;  2V4R A;  4K59 A;  1ZET A;  2DO4 A;  4CO5 A;  4DL2 A;  1KFD A;  3IBC B;  4WJB A;  4Y2A A;  2HBY B;  5KFG A;  4PXB A;  4K4X A;  1YJN S;  2WW8 A;  3C16 A;  3IC1 A;  2GQQ A;  4Y2K A;  5A6W A;  1ZM3 A;  5IZH A;  1U45 A;  1GNK A;  2QLJ B;  3B8H A;  2C3O A;  5KFH A;  4RX6 A;  5K8P A;  3KLG B;  2IJF A;  3NAI A;  4LRE A;  4YB5 A;  4I67 A;  2HLU A;  1NZ8 A;  2CNK B;  3RBD A;  2POK A;  2Y0B B;  2XI3 A;  1T3O A;  3DOL B;  3B54 A;  3H2L A;  1TVR B;  2VG6 B;  3T1A A;  4Z7C A;  3X3U A;  4ZKA A;  2ZH1 A;  3C2P A;  2KFZ A;  3FKB A;  2X1A A;  1SIZ A;  2CNO B;  3TWZ A;  2E9T A;  1IXK A;  2NZC A;  1ITP A;  3FEX B;  3HT0 A;  1WSR A;  3CJT A;  3EVM A;  2YX1 A;  3M9M B;  1X4D A;  4ZMM A;  2V2Q A;  2DNH A;  3GFX A;  2GAH C;  1UEV A;  3PAC A;  1OY9 A;  1KP6 A;  2Q6B A;  3EDQ B;  1WDT A;  1DTT B;  4B9V A;  2OD4 A;  4OYB A;  5KFF A;  2KXH A;  1I6J A;  1S6O A;  3I5B A;  3OBI A;  1KRP A;  2M8H A;  2WVC A;  5I3P A;  1IBM F;  1DBD A;  4USH A;  3MEG B;  3I31 A;  3C14 A;  3MM8 B;  3K5L A;  4F50 A;  3V6H A;  4ELU A;  1HNW J;  2R7U A;  3D6F B;  3GON A;  3G82 B;  2DCL A;  2R7T A;  3FNN A;  3UNY A;  1L3U A;  1O5J A;  2FIU A;  3JQM A;  1YZ7 A;  3NCQ A;  1B3T A;  2CZ4 A;  2V67 A;  1LQ9 A;  1Y11 A;  3NBP A;  5IOL A;  2FLN A;  4EZ9 A;  2E7W A;  3JYT A;  5IV4 A;  4IOA Q;  4BCA A;  5KFJ A;  1RQ0 A;  2EVZ A;  4KH1 B;  3Q8U A;  1R43 A;  2ZIT A;  4OJH A;  3KK3 A;  2FC9 A;  4DU7 A;  2GVZ B;  2E9R X;  2CQ4 A;  4NA2 A;  1RWV B;  5FD1 A;  2CVE A;  1EKS A;  1TKX A;  2QFI A;  4HAC A;  4PZV A;  1LWF A;  1NXI A;  4C98 A;  4J9N A;  1YIJ S;  4JV2 A;  1H98 A;  4WP8 A;  5E3A A;  4FVM A;  2PI4 A;  2KT5 A;  2V2V A;  3D1H A;  3C6T B;  4ATN A;  4DSF A;  2UP1 A;  3E01 B;  4K0K J;  2M88 A;  4CO0 A;  5KFO A;  4LVN P;  4N47 A;  6FD1 A;  1XMB A;  4PUO B;  1RT3 A;  4MJK A;  2ASD A;  1Q82 T;  3DRR B;  3CCL S;  5E33 A;  2R7W A;  2DPI A;  1YBU A;  1FDN A;  4HI1 A;  3CCV S;  4RUC A;  2QLF B;  4MAK A;  3IRX B;  3MEE B;  1EKR A;  2JHE A;  4Y28 C;  4MIA A;  2DNP A;  4LJM A;  4RWX A;  2HHV A;  2KB2 A;  3GJQ B;  8AT1 B;  3K59 A;  2R7X A;  1F0X A;  5FLX Y;  1HBM A;  1XQI A;  2M9K A;  2QMU B;  3BRE A;  2UXC J;  1JXL A;  2Q66 A;  3FEY B;  4DMZ A;  1PYT A;  2MHE A;  3NGK A;  5KT3 A;  3NLC A;  3FQK A;  1HIY A;  2RF2 B;  2GIR A;  2KKH A;  2XS5 A;  2J0W A;  4KYZ A;  3D67 A;  1VRQ C;  3PW4 A;  3QT7 A;  3KK2 B;  4DLE A;  2WRM A;  4CTA B;  2YPY A;  5KFW A;  5F8I A;  4TQS A;  1UMJ A;  1M5O C;  5KFQ A;  3I87 A;  3HFZ B;  2ZKU A;  4YP3 A;  1TUW A;  4WXW A;  2BOA A;  2F65 A;  4J37 A;  2VZ9 A;  2AHO B;  2XO7 A;  4H4K A;  4IRD A;  2X7I A;  4C48 A;  3N79 A;  2DNN A;  3BGR A;  2NPF A;  3VHQ A;  5H1S V;  1LFW A;  1YJR A;  3MM6 B;  1TL3 A;  3R6L B;  1RT7 A;  5C42 A;  5DET A;  3LAK A;  1ZZN A;  1T11 A;  1YJT A;  3H5S A;  3KG1 A;  5D4N A;  1QD1 A;  3DMJ A;  4HH1 A;  1DQ8 A;  4KTQ A;  1P9Q C;  3AQP A;  2VG7 A;  4UW2 A;  2OO4 A;  3VQS A;  3T1Y J;  3OR2 B;  1Z2Z A;  2I9S A;  1Q4R A;  1U4B A;  3MEC A;  5DDQ C;  2Z2M A;  2P9C A;  1NDC A;  2YKN A;  2V9K A;  4M5L A;  2OPR B;  1OWX A;  4KPY A;  2LVW A;  2ADC A;  4U9R A;  2LQ5 A;  4B9S A;  3EVO A;  2EKN A;  3T6J A;  2QFJ A;  4P6Q A;  3GV5 B;  1JX4 A;  1MRO A;  4DSE A;  1L3S A;  4MTP A;  2Y8Y A;  3KLV A;  3BKT A;  3JSB A;  4Q2L A;  4EI2 A;  5HSP A;  2EFG A;  3MDF A;  3RB6 A;  4GVB A;  1CPZ A;  2CG4 A;  3ADA C;  4G65 A;  1A7G E;  1KWM A;  5GAE U;  3FRY A;  1T0T V;  1IJE B;  4Y00 A;  3NS5 A;  4OZ2 A;  1KTV A;  1QSS A;  3V6K A;  3W62 A;  2BQR A;  3HD2 A;  2D74 B;  4JI2 F;  4HT7 A;  4OYA A;  4A4J A;  2EFN A;  1TV6 B;  1C4C A;  1UPM B;  2CZV C;  3K2Y A;  4YB6 A;  1KTQ A;  2CQG A;  4ZVE A;  4A48 A;  2ZC3 A;  3PX4 A;  3LTO A;  4OZN A;  2H48 B;  3ET6 A;  3VTI A;  5HL7 Q;  2MKJ A;  1CJU B;  3TX0 A;  2H4W B;  3L3C A;  3BN4 A;  4PG8 A;  1EZZ B;  3W65 A;  2BX6 A;  2W4D A;  5CYQ A;  2YNG B;  3VZH A;  1NZA A;  2HND A;  2ZDO A;  2VON A;  1ZM4 A;  2NXJ A;  1WJ9 A;  2KT2 A;  1A9N B;  4USW A;  1SKS A;  3GTY X;  2DNR A;  1S5Z A;  2V4J B;  3ETM A;  2LEP A;  4KO0 A;  4ZCL A;  2QL7 B;  5G0R B;  4LFC F;  2JH3 A;  2P6T A;  2DGU A;  3GSD A;  2XUL A;  1EP4 B;  3PJW A;  5AXM A;  4CP5 A;  4QWE A;  2YKM B;  1G6B A;  2QZ8 A;  4NLO A;  4DS5 A;  4DR6 F;  4LFA J;  2KG0 A;  4PR6 A;  2O3D A;  5B7W A;  3J7A N;  3QT8 A;  3J80 Y;  2BBE A;  3KJV B;  3ZXW A;  3QID A;  3PFE A;  4W92 B;  1KEK A;  3IRW P;  4UZC A;  4RUB A;  5D3G B;  3R27 A;  1NU4 A;  4DG1 B;  1KNZ A;  3K5N A;  1CJV B;  1YIT S;  3T1Y F;  2DR9 A;  3LWM A;  4DL6 A;  3RRK A;  4FYD A;  1U1L A;  5MAO A;  1NB7 A;  3RAM A;  2OP5 A;  3R5B A;  2HRT A;  3GWC A;  2DBB A;  2ROP A;  5CHC B;  3CCS S;  1UWA A;  3EGN A;  1UFL A;  4F04 B;  2BJ1 A;  3W2V A;  1X31 C;  4I6A A;  5A2Q U;  1RYR A;  3HDS A;  1Y4Z B;  4IG0 B;  4IG3 B;  1NPR A;  2DNK A;  2EEY A;  1B4S A;  3BZQ A;  3EGV A;  3QSI A;  4O3P A;  4F0H A;  2VHG A;  4Q0B A;  1JNR B;  1XNR F;  2HHH F;  2CPF A;  2UUC F;  4KSE B;  3VZI A;  1ZH5 A;  1NRK A;  3K5O A;  1LXJ A;  2MTL A;  2PO4 A;  2XMT A;  3HHL D;  3HHK A;  1RWN B;  2LXF A;  2RUG A;  2DXF A;  3GJS B;  3K8V A;  3PHE A;  4MYU A;  1RTD B;  5T7L B;  5DM6 Q;  2CYY A;  3J7Z 5;  2C22 A;  3TAN A;  1MWZ A;  1UET A;  4DR2 J;  5ETK A;  3UN2 A;  4K4T A;  2XMA A;  3NGR A;  1JLE A;  4F02 A;  1DRZ A;  2X51 A;  2WK4 A;  1VQ8 S;  4O0N A;  2QMW A;  3U27 A;  1EIY B;  4ELV A;  2A0F B;  2HWI A;  3FGV A;  1UCN A;  3ILL A;  2QL9 B;  1RSC A;  2VF3 A;  4CLF A;  3SEO A;  1C4A A;  2IAJ A;  2RDI A;  5KFC A;  5KG2 A;  1N54 B;  4IDK A;  1VQN S;  4LR9 A;  3I6P A;  4QW8 A;  1FXR A;  3M8Q A;  1BXN A;  1D9D A;  4QIV A;  2DO0 A;  1VIO A;  5IM0 B;  3EYZ A;  1JLF A;  1Q86 T;  2VBZ A;  1HBN A;  1X5O A;  2GQC A;  2MHN A;  4HDG A;  1NM2 A;  4CNZ A;  4YME A;  4ZP7 A;  2C2E A;  2YH0 A;  2LU1 A;  3Q8Q B;  2F1F A;  1RTZ A;  2UUB J;  3SXL A;  2F63 A;  1K0T A;  2CPD A;  2B9X A;  2HWH A;  1RHQ B;  1KVI A;  2B4V A;  3JSR A;  3N28 A;  3HF5 A;  3PYG A;  4O44 B;  4PWU A;  5CYJ A;  2OUG A;  2HGL A;  4URQ U;  3PR5 B;  3TW0 A;  4PAB A;  1FXL A;  5D0E A;  2CQC A;  5GMD A;  2LEC A;  1KLM B;  4U95 A;  4E98 A;  5HP1 B;  1XNR J;  2D9P A;  1HPZ B;  1RAB B;  4ZPV R;  1OS5 A;  4NAS A;  1NND A;  1VRU A;  2UV8 G;  2W1B A;  2DXD A;  5U47 A;  2BKO A;  1RAE B;  4N8O A;  4Y0F A;  2R9L A;  3PVX A;  1NJY A;  4UF4 A;  5K14 B;  2WAQ D;  2Y1R I;  1BY9 A;  3CD6 S;  4MKB A;  1N4L A;  3LP2 A;  2IM2 A;  1HHS A;  1EET B;  1RK8 A;  4WP3 A;  4PWW A;  3VAM A;  5HQM A;  3CJ8 A;  5J2N A;  4IRC A;  5DM7 Q;  3DKD A;  2R7Q A;  2R7O A;  1VOM A;  5HAO A;  2FZC B;  4NYZ A;  5D4L A;  4A8W A;  1EAR A;  1NJX A;  2DR5 A;  4LF7 J;  2KHC A;  4ZS6 A;  4ANE A;  3O6Q A;  2WVB A;  3M1V A;  4HLB A;  4C8L A;  2VPZ B;  3BKF A;  2V8D A;  2BV3 A;  6AT1 B;  2A2D A;  1VIS A;  3KJF B;  4OMF G;  2HVD A;  5CZV A;  3IN5 A;  3H5U A;  5EX3 A;  4RW8 A;  2MQ8 A;  4V1A k;  1OYE A;  1HI8 A;  2QV6 A;  1VYA A;  2MZ1 A;  3KK3 B;  1K9M T;  1ACM B;  1JLB A;  3TUP A;  4F3Q A;  4N77 A;  2EKY A;  1LW0 B;  3KHL A;  1NK5 A;  1S1V A;  1JNZ B;  3EE3 A;  4RNF A;  1KN6 A;  1FEH A;  3W7B A;  2D3O R;  3KG4 A;  5D6G A;  2ZOG A;  4F4K A;  3LP1 A;  3MEC B;  1RTH A;  1CSJ A;  3I4H X;  2PT0 A;  3NGD A;  2C2N A;  2HQI A;  3I0R B;  5AE1 A;  3EZU A;  1X4E A;  2QA4 S;  2Z2Y B;  3TO8 A;  3GPA A;  4K2J A;  3NRB A;  3A1Y G;  1JLG B;  2IRX A;  1C0T B;  4J90 A;  3A12 A;  5EHH A;  1FWP A;  4HHJ A;  4WE1 B;  1LNQ A;  3SV4 A;  3GYX B;  1SPB P;  4X4S A;  3HVR A;  4IQX A;  1R0B G;  3S01 A;  1HBO A;  5KFL A;  4CLK A;  4GVB B;  3KWM A;  4HR2 A;  3RUB L;  3CCU S;  2FGO A;  2L9D A;  3VAH A;  2RRA A;  1WF0 A;  4G6V B;  4B17 A;  4FF4 A;  3ISZ A;  5CA5 A;  1RTI A;  3VF0 B;  2W2N P;  3QWU A;  4RNM A;  2MGZ B;  5H9E K;  1S0M A;  2EK6 A;  1KVJ A;  3BSN A;  1T03 A;  4TY8 B;  2FLL A;  2GFF A;  2XLI A;  1D09 B;  3BDE A;  3R2D J;  3ENW A;  1IKY A;  1DTQ A;  2ZBI A;  3K17 A;  4Q8F A;  3M05 A;  1WEY A;  1JJC B;  1GTE A;  2HFU A;  2W9C A;  4N41 A;  2XWX A;  5FDL A;  4NCG A;  4NLT A;  4QIE A;  1JIH A;  2HGM A;  4E2F B;  3MM5 B;  4DR4 F;  1CLF A;  2IM1 A;  1FRH A;  2RDJ A;  3MMC B;  4JI4 F;  4Q8E A;  1NEE A;  2WHO A;  4BWJ A;  2DGT A;  1NO8 A;  2JDJ A;  5HAN A;  1HWL A;  3IR5 B;  3QWP A;  2B7C B;  2J9D E;  3CJ4 A;  1K1S A;  2HAF A;  1FRX A;  5CQG A;  1C0U B;  2N4C A;  3N01 A;  3KLF B;  4JI3 J;  3EGZ A;  5IT0 A;  1FNX H;  3NMR A;  2AJ4 A;  2ALZ A;  4Q45 A;  3HSJ A;  3PV8 A;  4OYX A;  1HR0 J;  1M1K T;  4ZVU B;  2RAQ A;  2ZJR Q;  3ZFV A;  4TYA A;  2WBR A;  4USI A;  5JJB A;  1NPK A;  2AJ0 A;  2RQM A;  2QTW A;  1E6Y B;  3MCO A;  1TKZ A;  1IKW A;  4C8O A;  1SQF A;  3JQJ A;  2RS8 A;  5KFZ A;  1QY7 A;  1M5K C;  4WTY A;  3RBE A;  1NK9 A;  5ETO A;  2V2K A;  1HNX F;  1V5I B;  2XHW A;  2ZVI A;  4PG7 A;  1YBA A;  5CCM A;  2VU5 A;  5EN1 A;  4NCB A;  1ICE B;  3BKU A;  4ZN1 A;  2MKI A;  2YNF B;  3MOZ A;  2CPJ A;  3MAQ A;  2VIC A;  4DQI A;  2Z8Q A;  4DV5 F;  3JAM Y;  1UKU A;  1VBZ A;  3MR3 A;  1S49 A;  3ZTO A;  3SYZ A;  1REV B;  5B0G A;  3C14 B;  2RJZ A;  4N8N A;  4ZVH A;  5A76 A;  4DUY J;  2GIQ A;  1XMO J;  2HS0 A;  1LFP A;  3CMA S;  2ZD1 A;  4IRK A;  3J81 U;  3M2U A;  4YHH J;  2XM3 A;  5KG4 A;  1J5O B;  4DL0 C;  3UO0 A;  1D0E A;  4DBQ A;  3CJR A;  3NKY A;  4LBP A;  4MK7 A;  1PYO B;  1PJ7 A;  2W25 A;  4LRA A;  1SJR A;  4H4K C;  3UCU P;  2CNN B;  2HNY A;  2EBG A;  5HO4 A;  4JI3 F;  2DCU B;  2K7K A;  3MM9 B;  3EZO A;  5E3Q A;  2EFP A;  3R8Y A;  3CCE S;  1NK6 A;  1N8R T;  3FZB A;  1UAW A;  2HQC A;  3DDN A;  1Y00 A;  3P8B B;  1Q8I A;  3SBM A;  2N7C A;  2OPR A;  2UVW A;  4J9P A;  1R8H A;  1UWB B;  4YS2 A;  1R31 A;  1HNI B;  2YWK A;  4ES3 A;  4DR4 J;  4FN5 A;  5IM0 A;  2VBY A;  3F56 A;  4UOH A;  4DPX A;  4KGZ B;  4NOH A;  4ECQ A;  3MM8 A;  2BQ3 A;  4QWA A;  1U25 A;  3JXO A;  4C9D A;  3IA0 A;  2OSR A;  1ULR A;  4FBU A;  2M4M A;  4U8Y A;  2GVD A;  1O51 A;  2L08 A;  3UN3 A;  5GAG U;  2CPZ A;  1RKJ A;  5CYM A;  2OTJ S;  4OZ0 A;  2G1D A;  1L3V A;  2K06 A;  1UFW A;  2JEG A;  1HQE B;  1FJC A;  1QTM A;  2ILY A;  2BJ9 A;  1REV A;  2UUA F;  2E5L F;  5L39 A;  2ZZN A;  2VA2 A;  1JLC A;  3Q23 A;  2VD3 A;  1NHU A;  3UFC X;  4FKX A;  3U1L A;  5HVG A;  2X3G A;  2BXJ A;  2ZC4 A;  4RL1 A;  2QN6 B;  2W8L A;  4HYK A;  2B4P A;  5L46 A;  1FTR A;  2EC2 A;  4DI6 A;  4WBF A;  3H2U B;  2VDI A;  3J7Y I;  3BQ0 A;  3R3T A;  1HWI A;  4CTA A;  1T7P A;  1BQX A;  3ZTS A;  4LSL B;  3G6V A;  1FX2 A;  1TKZ B;  2BE2 A;  2UXB J;  5C7P A;  3DOK A;  4F4Z A;  2YQ1 A;  5A0Y B;  2HVH A;  1YSJ A;  1UW9 A;  3MEK A;  4KC5 A;  2PA3 A;  2HMI A;  2G2Y A;  2HAI A;  2Y1I A;  4ZVG A;  2A18 A;  1R3N A;  5KG1 A;  4WU2 A;  3MM7 A;  5IC6 B;  5KFA A;  2XB2 D;  2KFN A;  5CH7 B;  2C28 A;  4WYW A;  4V19 J;  4JI0 J;  2QA1 A;  3K58 A;  1N88 A;  2LQ9 A;  3FBC A;  4AL7 A;  4KBI A;  4Y3C A;  2QEX S;  4FF2 A;  2R8G A;  5IC4 B;  3KOA A;  2FPH X;  2R8H A;  2QLX A;  5EWE A;  3K5M A;  3BN7 A;  1SI9 A;  1S1U B;  1N48 A;  1QSY A;  3SCL E;  2E1C A;  4MK8 A;  3LGM A;  1RKI A;  5FDL B;  4ECX A;  1IKW B;  1LXN A;  3O1L A;  3NGU A;  4I64 A;  5A0Y A;  1CBK A;  4FDF A;  4DEZ A;  5IT4 A;  3BGL A;  2JLG A;  1B0P A;  1MRO B;  2HFO A;  1RA6 A;  3BGO P;  1QUP A;  1BUX A;  2HND B;  1Z1Z A;  2VFR A;  3QZ8 A;  4OJ3 A;  4F25 A;  3FC9 A;  5DJB A;  4DX5 A;  3PYF A;  4KKO A;  3G86 A;  7FD1 A;  5I4M A;  4F67 A;  5E41 A;  3BSC A;  3T1H F;  3K5P A;  5ETL A;  1ZPV A;  3VWS A;  4KH0 B;  4LR8 A;  1CQM A;  3DOM A;  3KLF A;  3L9Z A;  4FS1 A;  1X9S A;  3MAA A;  5H9F K;  2AWZ A;  1NH8 A;  2OPQ A;  1SH0 A;  1N34 F;  3D0H E;  5BJR A;  1IJF B;  4NLP A;  2ZUG A;  4B9T A;  4X65 J;  1PG5 B;  4L75 A;  4P9S A;  3EDR B;  5M2U A;  4ALZ A;  2W4P A;  2HIY A;  4U96 A;  4CLL A;  3LPY A;  1N32 J;  2D1C A;  2NPI A;  5IQ6 A;  1H74 A;  4DN9 A;  1RBO B;  2AJ1 A;  1FKP B;  1EX8 A;  1M1H A;  2B56 A;  2BMB A;  1RT5 A;  3QQC D;  1KDN A;  4NCG B;  5CAA A;  3RTV A;  4M5I A;  1FCA A;  3ZO7 A;  3GE9 A;  5SZT A;  4X4V A;  3U02 A;  3CPW R;  2DEJ A;  3AD9 C;  5E3C A;  2FVS A;  3IM8 A;  4EMD A;  2R2T A;  3ILJ A;  2MB0 B;  1R8C A;  1WC4 A;  3MCN A;  4EWT A;  4XDD A;  3C15 A;  4I7F B;  2BOP A;  4J9M A;  4IO1 A;  2HZC A;  4RUA A;  2F9D A;  1VRT A;  3EXC X;  2BYC A;  3FCH A;  3GLJ A;  3TA1 A;  2G0C A;  2ROE A;  3CB4 A;  5LMU J;  4A8F A;  1JLC B;  4KB7 A;  1RT5 B;  4OL8 A;  5DO2 A;  3F0N A;  3P45 B;  2IIH A;  2OAU A;  4ZOS A;  3OLA A;  1D8Y A;  1S0O A;  1AB8 A;  2BUN A;  4A47 A;  2JJ4 D;  4F4Y A;  4ECV A;  2FY1 A;  1CQN A;  2IMO A;  1YWX A;  2CUY A;  4ZPD A;  2AKW B;  2CQH A;  4CDI A;  3A3N B;  1DHM A;  3SDE A;  3O5T B;  4MK9 A;  2CXE A;  3BO2 A;  3D2W A;  2XO6 A;  1WDD A;  4AFF A;  3I0R A;  4DFM A;  2GMJ A;  2DNZ A;  4PAA A;  4JI6 F;  2GQ2 A;  2HG4 A;  2JLE A;  2VPY B;  3V81 B;  4HL9 A;  3M9N B;  2ZOF A;  3DRR A;  2Y3Y A;  5I3Q A;  2GC8 A;  4ECU A;  4WP9 A;  2J6U A;  1HNZ J;  3HJV A;  2M3D A;  3VV2 B;  1WHY A;  3KTQ A;  4ITS A;  1BHN A;  2DHH A;  2ZBQ A;  5LMN F;  3LW5 C;  4A8S A;  1CJT B;  1IBK F;  4LQ9 A;  3GYG A;  4N7T A;  5I42 A;  3PHT A;  3OL9 A;  1TKD A;  3WHI A;  4USJ C;  3DRX A;  2BRL A;  4RU2 A;  2KZZ A;  1YQH A;  4DL5 A;  3BF4 A;  3M6V A;  2RU3 A;  4NXM F;  3MPU B;  2ATL A;  4H54 A;  2V8V A;  1HWU A;  1N34 J;  1JMT A;  4O4G B;  3E2E A;  1X0P A;  1EET A;  1A0O B;  1JLQ A;  4LF4 J;  2W4C A;  4X62 J;  3CJ2 A;  4L6V 3;  2B51 A;  2CPE A;  4ZP8 A;  4DCJ B;  2B9E A;  4QIG A;  4TN2 A;  1OMS A;  2BM0 A;  2HQG A;  3FEZ A;  3E3X A;  2PMZ D;  4BHQ A;  3M8R A;  3AQO A;  5KFB A;  4G1Q B;  4NWB A;  1JKH A;  2COL A;  2VUG A;  4LSN A;  3CC2 S;  1NAQ A;  2QA4 G;  3M32 A;  4W4M A;  4A46 A;  4EBC A;  2JEF A;  5F8J A;  4JYA F;  1N0U A;  4LF5 F;  3TAP A;  4XO0 A;  1TL4 A;  4KY3 A;  1PIL A;  3BBC A;  4QWC A;  2MPU A;  1WG5 A;  1VQ7 S;  3CO0 P;  1H7W A;  2FZG B;  5C25 A;  3C46 A;  2KH9 A;  1HR0 F;  3THP A;  2AT1 B;  1G4C A;  2DYA A;  4XPC A;  3CCQ S;  3CJ5 A;  2VBW A;  2B0G A;  1IR1 A;  5HJY A;  4EEY A;  1S0N A;  4L76 A;  2Z56 B;  4UY8 T;  3W3S A;  1RHU B;  2OKQ A;  1AFJ A;  2W01 A;  3DYA B;  4C97 A;  3FDS A;  1RTI B;  3RRG A;  2WSE C;  1HBN B;  2WSF C;  2XYG B;  3GJR B;  2CQ3 A;  1Q16 B;  3H5Y A;  1H7X A;  4DDF A;  4ZJL A;  3G82 A;  4JV5 J;  2VPX B;  2YWG A;  3OR2 A;  4NXN F;  1K0V A;  2PI5 A;  2RHQ B;  3TQE A;  1D3W A;  1OYD A;  1WOR A;  3DXS X;  1RYS A;  1AA1 B;  2UXD F;  3R5G A;  4HEA 9;  4TNO A;  4YB7 A;  3R2C J;  2UVU A;  2HEK A;  1ZTT A;  4AQY J;  1N5Y B;  1TEL A;  2F4V F;  4DV0 J;  4NLV A;  1FTC A;  1TU0 B;  2K1R B;  3AHP A;  2Z58 B;  1TKT B;  1UEU A;  2IRU A;  3PKM A;  1DFD A;  2FHO B;  2GHP A;  3CJS A;  3PM9 A;  5GAE I;  1YJ9 S;  2IA0 A;  2E7V A;  2I38 A;  1VQ4 S;  2WCX A;  2YWW A;  2HYI B;  4DN0 A;  2CJX B;  5J1E B;  3BBF A;  4O3N A;  3C15 B;  4FYX B;  4EZ6 A;  3DYA A;  2OEM A;  3POT A;  4M1K A;  1HW9 A;  5D4P A;  1RT6 B;  1GMW D;  4X4T A;  3Q8P B;  4J9R A;  3FQL A;  2UVV A;  3CDE A;  4LF5 J;  1Z4U A;  4Y65 A;  2EWH A;  4EBE A;  4DFK A;  2EK1 A;  1S99 A;  5C25 B;  4DV5 J;  2ZZM A;  2XHC A;  3W2V B;  3PJX A;  2NUU G;  3H59 A;  2HIQ A;  4OZ3 A;  1B0V A;  3LP0 A;  3M4X A;  4DUY F;  1U1R A;  5F8G A;  2FJE B;  2IC3 B;  4TXS A;  1H0H B;  4ZPA A;  5A8W B;  4YHH F;  3IG1 A;  2HSE B;  1CS4 B;  1RBA A;  3OXL A;  1FVS A;  4RW9 B;  3BB5 A;  5J2N B;  3AXM A;  3PRB A;  4M5K A;  4CYU B;  2NRE A;  4QBU A;  4M5J A;  1QAX A;  1IN0 A;  2DIS A;  2O5D A;  3GIK A;  1OY6 A;  2LCW A;  3K8W A;  1F3F A;  2F40 A;  3LAL A;  4EK2 A;  3KDO A;  2RRN A;  3BM7 A;  4XAK A;  4C3K A;  5LOQ A;  1VQM S;  4CLS A;  4FF1 A;  2FVC A;  2RRB A;  3BBB A;  1FJG F;  3C8Y A;  1NKE A;  1FKA F;  3IGN A;  2IC3 A;  5E7O B;  4RW7 B;  4JI2 J;  4USV A;  1HHT P;  5A8K A;  3M2R B;  4WU3 A;  3THV A;  1U1O A;  4QIW D;  2OIH A;  3RR8 A;  3GZ7 A;  4Y34 A;  3FBB A;  1TR0 A;  1RAO A;  3RYL A;  3H25 A;  1FRJ A;  2OEK A;  1RBL A;  1S72 S;  1V3S A;  1F6T A;  1BQN B;  1FD8 A;  1TAQ A;  2DHS A;  2KU7 A;  3NG8 A;  4OX7 A;  1RDR A;  4P7T A;  2KM8 C;  4CLY A;  3N0V A;  3T9Z A;  2MZR A;  4ZPW R;  2BJ7 A;  4RBV A;  3CUN A;  4RW7 A;  4NXN J;  2HFS A;  1VCT A;  1GT8 A;  1T9T A;  2QO3 A;  4IQM A;  2GNK A;  2IHR 1;  2YNI B;  4FXW A;  4OZ5 A;  3L4B C;  4L73 A;  5D0G A;  4NRU A;  4QQB A;  2N3O A;  3DRY A;  4DFJ A;  1YJW S;  2JC0 A;  1CVJ A;  1J5E J;  1TL7 A;  1N5Q A;  3G8Q A;  4M5M A;  4J5O A;  1BC6 A;  4K4U A;  3EXY A;  3HFK A;  1KOH A;  2XGP A;  3TRG A;  4IO9 Q;  3FRZ A;  2FVQ A;  1XNQ J;  3O2I A;  4IKA A;  3M8P A;  1IBC B;  1N36 J;  3QRP A;  2R7V A;  3AT1 B;  3DLL Q;  1RHR B;  4JI8 J;  5HP1 A;  2BW7 A;  2D9O A;  5LSL A;  1SUQ B;  3Q8R B;  4F4X A;  1WOP A;  2DK2 A;  1HA1 A;  2IM3 A;  2MLZ A;  3CD5 A;  2Q6C A;  3OFF A;  2IVF B;  2H3E B;  2NSB A;  3BGR B;  4JI1 F;  3H5X A;  1S1W B;  1WC0 A;  2B5J B;  1Q8B A;  2BW2 A;  3GV8 B;  4LIW A;  3LWL A;  1S79 A;  1X4C A;  2M7S A;  2PII A;  4K5R A;  1TFW A;  5DG9 A;  3TUZ C;  1OQ6 A;  1GAO A;  3TOQ A;  2R7R A;  3SSQ A;  3OV7 A;  2D69 A;  2CKW A;  3B6B A;  3CJQ A;  3SQG A;  4DX6 A;  5KG6 A;  4H4O A;  4N76 A;  2CQ1 A;  1SL0 A;  2E1M C;  1NKB A;  4GKJ F;  3ZZZ A;  2ZH3 A;  1N33 F;  5B0F A;  3QAE A;  2ILZ A;  2LKZ A;  3AJ1 A;  2L41 A;  1T9Y A;  1HQE A;  1Q95 G;  2B43 A;  1JJH A;  2HVZ A;  2YWH A;  4HI2 A;  3RGI A;  3SCK E;  3UW1 A;  3ZTQ A;  2Z57 B;  2YXL A;  1RAC B;  1E6V A;  1BGX T;  1BQM A;  4ER8 A;  4JBC A;  1X9W A;  2Y0S D;  3CMQ A;  1F5C A;  2OPS A;  1TL3 B;  4TVA B;  1HHQ A;  2ACM A;  2XZT B;  1I1G A;  2F9J A;  3NWG A;  1H3D A;  4QJV A;  4OX8 A;  4X65 F;  3MR2 A;  2WVF A;  1KFS A;  9ATC B;  2RUS A;  1RWK B;  2G0J A;  3E8O A;  3PFO A;  4M8L A;  2M5Y A;  4IYQ A;  4NYP A;  2JLF A;  4OYM A;  2H5J B;  5AXN A;  1OIA A;  3R5D A;  4WFB Q;  4B3S F;  2YKM A;  4ZIV A;  1X9M A;  4NZ0 A;  2D3O 1;  2ZBC A;  2OJ3 A;  5EX0 A;  1X5S A;  3BEG B;  3GJT B;  2BJ8 A;  4ES1 A;  1JQG A;  5HVF A;  3E51 A;  8RUC A;  3QJL A;  1RWM B;  1QUV A;  3VGT A;  1P1T A;  2XY7 A;  2IJN A;  2J5A A;  1Q8K A;  4ZVS B;  4WK1 A;  2QX0 A;  3KUH A;  2XS2 A;  2DIU A;  1RHK B;  1WC1 A;  3S1T A;  7FDR A;  3S8S A;  5KT6 A;  2F8E X;  2KXN B;  4WFA Q;  2C2M B;  1SKW A;  2BJ3 A;  4ES2 A;  1SV5 A;  3HT3 A;  3TJA A;  1IBL F;  2XYP B;  1X4G A;  2EFV A;  4C11 A;  1S9G B;  2WVE A;  3LUY A;  4I6W A;  4YDX A;  5GVQ A;  3W63 A;  4CM0 A;  2NXC A;  4DR7 F;  4DSI A;  4V19 X;  3KKF A;  1HW8 A;  3UD3 P;  4DL3 A;  3C66 A;  4DV7 J;  3CDA A;  4NI2 A;  4Q7A A;  2LXU A;  1HYS B;  3QPI A;  4KRW A;  5RUB A;  1CEZ A;  1PO6 A;  2R8J A;  2KTQ A;  3RB0 A;  4N56 A;  3AOB A;  2ZJP Q;  1RE1 B;  1TK8 A;  4XK8 C;  1ZZF A;  2FY8 A;  2MQL A;  4OHY A;  4NMX A;  2HKE A;  2P8I A;  3U1N A;  1KHV A;  3TZX A;  5DGB A;  4ED8 A;  2ASJ A;  3NNH A;  4I2P A;  3WQP A;  4F26 A;  5DQH A;  3PZP A;  5LMU F;  1TUV A;  1YJU A;  2M0G B;  3A3P B;  3UQS A;  4DUT A;  3KLE A;  3W9J A;  1HD0 A;  2K2P A;  3MED B;  3P96 A;  2AW0 A;  1IBK J;  1WKL A;  1VDH A;  4OQJ A;  1RAA B;  3MMJ A;  1F2G A;  3PEJ A;  2B6A A;  2MGZ A;  3PKY A;  2MQQ A;  2PDA A;  5HBM B;  2Q79 A;  3VR1 A;  2V9W A;  3OHA A;  2CG8 A;  4DHV A;  4ZCM A;  4OHZ A;  4L72 B;  4IFV B;  2KJV A;  2OPP B;  4NLW A;  3SV3 A;  1QJH A;  2CQD A;  2C3M A;  2J0S D;  3G4S S;  3NCP A;  3DMJ B;  3PYE A;  5G4D A;  1QAI A;  3A4T A;  2QSW A;  1W2I A;  1C0T A;  2CQI A;  3MMB A;  5DG7 A;  5D15 A;  3MM5 A;  2V4Q A;  1P9Y A;  4NLG A;  3QMQ A;  1P27 B;  2ZNY A;  2MQM A;  3D7S B;  1ARO P;  1GQE A;  2BM1 A;  4IFV A;  3T6B A;  3AB2 B;  3DRS A;  3FMW A;  1RAG B;  2W9C B;  3NEK A;  2P5V A;  3IGV A;  4M5N A;  2RH3 A;  3UI3 A;  3SQG B;  1NK0 A;  3AD7 C;  3QT6 A;  1UZH A;  2FDN A;  5B09 A;  4B9M A;  5EGY A;  4FF3 A;  1IM4 A;  3BH7 B;  4O3S A;  3OR1 A;  3V4I B;  3R5J B;  5IV3 A;  4C8Z A;  4IG0 A;  3VGU A;  3DXB A;  4WK3 A;  1RXO B;  1WOS A;  5GMK a;  1QTN B;  4X62 F;  1ZA2 B;  2HFV A;  4LMZ A;  2EW9 A;  3DRP B;  5J2Q B;  5B0B A;  1L3T A;  2L9N A;  2AGQ A;  4YEA A;  2KRB A;  5KAK A;  2HQ3 A;  3KHH A;  1U02 A;  3WIU A;  1NSA A;  1NLK L;  4KQZ A;  4KFB B;  4P2X A;  3TUI C;  2MKK A;  5C42 B;  1VHI A;  4A8K A;  1V3R A;  2OPP A;  2XY5 A;  4P2F A;  4DR3 J;  2CPH A;  5KT2 A;  4F2S A;  5KG0 A;  4BC9 A;  4WYL A;  1SB6 A;  3QGP A;  4YR3 A;  4RPF A;  4X64 J;  2GMH A;  4B3T J;  3QJP A;  1WAC A;  2ROG A;  3LQV A;  4JB8 B;  4RW4 B;  1S9E A;  4F7V A;  1S1X B;  2O1P A;  2PC6 A;  2FHK A;  1HQU A;  2F8M A;  2OEJ A;  4Y2I A;  2FQQ B;  2L48 A;  3FSI A;  3H4B A;  1BLU A;  3J7Z T;  4ZHR B;  5KFR A;  3B4M A;  4AXJ A;  2XCA A;  1TFY A;  1TTH B;  1MWQ A;  2FB0 A;  3ENQ A;  4Y2M A;  3UCG A;  3EX7 B;  4IUF A;  3G71 S;  1ZOT A;  2VA3 A;  4MH8 A;  3LPE A;  3NBP B;  3C6U B;  4KHP J;  2DR6 A;  2HPU A;  2OHD A;  3W8P A;  4P75 A;  4LFA F;  4Z37 A;  2JEJ A;  4J7C A;  2IPO B;  4UQG A;  1VQS A;  4DV6 F;  2CJA A;  3FCV A;  1YJV A;  5D0R A;  2YQ3 A;  3G2X A;  3Q86 A;  2OFG X;  4KJI A;  1HPZ A;  3AFG A;  2RU9 A;  4M63 A;  1VBY A;  2RT3 A;  4NX9 A;  1DUR A;  3KMQ A;  1LWX A;  1T9V A;  4QR2 A;  1SJ1 A;  2UU9 J;  4X4P A;  1PIE A;  3EZ5 A;  3WC2 A;  5E3P A;  1HMV A;  3MGJ A;  3MD3 A;  1R27 B;  4HHU A;  4PCQ A;  3CD7 A;  3CT9 A;  2AYE A;  2HZV A;  4NE9 C;  2AP6 A;  3OXF A;  5T41 A;  2VL1 A;  5HJX A;  1N6Q B;  2DB1 A;  2LU2 A;  1XC9 A;  4F36 A;  2IY5 B;  2ZBP A;  1RT4 B;  4NML A;  1U0H B;  2YVS A;  2P2C B;  3KLG A;  3A8K A;  2DR7 A;  2BKN A;  2E29 A;  1MN7 A;  2R2S A;  1A6L A;  7AT1 B;  5F3Z A;  1RB0 A;  1TZ0 A;  1DAX A;  3J7Y U;  2XMV A;  4OX9 J;  2AU0 A;  2E66 A;  4WE1 A;  4YFU A;  1J5O A;  1KR4 A;  3NS6 A;  1H73 A;  2CPY A;  2V5H G;  3DM2 A;  5HMW A;  3I55 S;  1GK8 A;  2ZE2 A;  3HSD A;  3PW7 A;  4KPC A;  1F9F A;  4CIO A;  1MG7 A;  2GZO A;  5KFX A;  2Z0G A;  1H2T Z;  5GME A;  4OZJ A;  1ELO A;  4OZ1 A;  1OSC A;  3I4P A;  2FLO A;  5K8M A;  2XSF A;  2I6W A;  3DOM B;  4PRF A;  2WON B;  2OML A;  2XZD B;  4DV6 J;  3QBC A;  3PR4 A;  3T5H A;  2CWK A;  4IH5 A;  2V94 A;  2HBR B;  2YNI A;  3GP9 A;  1LW2 A;  2HRU A;  2BAC A;  4JV0 A;  4ED3 A;  2JZ5 A;  1S12 A;  4UUW A;  2RE1 A;  2HHT A;  2XNQ A;  1HWK A;  4Q0B B;  5KG5 A;  4RW8 B;  1VJW A;  2WB4 A;  1HFE L;  3ENV A;  4ZHR A;  4CLW A;  1D9F A;  3FCW A;  2ZHO A;  2QGF B;  4LR7 A;  5F0W A;  2J6S A;  2M8D B;  1MWY A;  2LA4 A;  3UDL A;  5GAD U;  4TKT A;  3M2R A;  3VAG A;  2H1Y A;  1KON A;  1FDA A;  4GKJ J;  3MMA A;  2MKH A;  1S76 D;  4LF9 J;  2BE7 D;  3HHL A;  3SCI E;  2ZNZ A;  1R0A B;  3KK1 A;  4PG5 A;  2GCF A;  2UXB F;  3EM1 A;  2NXE A;  3SSR A;  4ZP9 A;  4DCO B;  1HNV A;  3DLE A;  4A8M P;  2ZUA A;  5KT4 A;  3TAM B;  1F9H A;  4MYT A;  5EWF A;  2HLT A;  3NOC A;  1S4E A;  3MMC A;  2WTF A;  4PG4 A;  1ZAW A;  1NB2 A;  3TZW A;  4PG6 A;  1KBR A;  5J2M A;  2GGP A;  3HHN B;  2WOM B;  4WWS A;  4CLZ A;  4B3S J;  2CJY B;  2A2C A;  5I42 B;  2VQE F;  2GX8 A;  1WC3 A;  2GVZ A;  1K47 A;  1KQG B;  4U7U D;  4WFN Q;  1DLO B;  5J2P B;  2AV5 A;  1T3N A;  3PW2 A;  2HWT A;  1FJE B;  2VC1 A;  4FPI A;  3M9O B;  4F4W A;  1Q5Y A;  4A8X A;  4WZQ A;  1RTJ A;  1Y3K A;  2EG2 A;  2HW3 A;  4U6P A;  8ATC B;  2VG7 B;  1IR2 A;  1UJ6 A;  4JOU A;  4ECW A;  2DGW A;  1HI1 A;  1Q78 A;  2OPS B;  2XWY A;  4P74 A;  3K89 A;  4GRS A;  1HI0 P;  3WX4 A;  4Y2C A;  1DAR A;  4ECZ A;  4F3M A;  3CNQ P;  1B7Y B;  1UEK A;  4U7U K;  2RNE A;  1AUS L;  1P6T A;  5KFD A;  2DR8 A;  1RU2 A;  1HL6 A;  1H38 A;  2ERR A;  4YB1 P;  3V6J A;  2M70 A;  4J9S A;  2BKP A;  3Q89 A;  1KS2 A;  1PJ6 A;  3OVA A;  1RLC L;  5J2Q A;  1U1P A;  2ALY B;  3TAR A;  4CT8 A;  4G1I A;  1FK9 B;  2EPI A;  2RQK A;  3ENA A;  2HHW A;  1RTD A;  1U48 A;  2CPI A;  2FUG 9;  2K7J A;  2CFX A;  2CQB A;  2YNH B;  3V5R A;  2IDE A;  3DLH A;  3DOL A;  1TK0 A;  2VFV A;  1B7F A;  4BLG A;  4EFA C;  4PPD A;  2ZZT A;  4Z2X A;  3HXM A;  1EB0 A;  2E7X A;  1FKO A;  2DNO A;  3MM9 A;  2BRK A;  4I1T A;  1NH7 A;  4O3R A;  2PFF B;  3GFH A;  1AW0 A;  1R8P A;  2LQB A;  3OD2 A;  4DL7 A;  2PEH A;  4LBI A;  3IP0 A;  3J81 j;  1FJ7 A;  3B4D A;  1NHK L;  4DSJ A;  4TLR A;  3N4W A;  3QFH A;  2ZE2 B;  3ICL A;  2KM8 B;  2G0I A;  3UD4 P;  4CNY A;  2DNL A;  3RR7 A;  4DX7 A;  4F3O A;  1HBU A;  2PD1 A;  2IBO A;  3PIP Q;  4LF8 F;  4DR1 F;  1UVI A;  2EFQ A;  1WI8 A;  1VJQ A;  3CCM S;  3IO1 A;  4J9K A;  1S1T B;  5DDO C;  1WI6 A;  2YQ0 A;  3SFG A;  1FER A;  3T41 A;  2P6S A;  2YWE A;  4NXM J;  4M95 A;  4GKK J;  1XR7 A;  3UVJ B;  3NCR A;  2MQO A;  4FNH A;  3GIL A;  1S6P A;  2GA7 A;  1URN A;  5E0O A;  2W2Q P;  1I5O B;  3TNV A;  3OSN A;  1JK9 B;  1V3Z A;  2XI2 A;  1RAI B;  2JFK A;  4ETZ A;  4DR5 F;  4RR5 A;  1VQK S;  1T05 B;  1PCA A;  2YNG A;  1HNZ F;  2XMM A;  1Y5L B;  3AJ2 A;  4DX8 H;  2BE9 B;  2PMH A;  1VQ5 S;  1NUE A;  5BR8 F;  4NYO A;  3QIP B;  5KFN A;  2PGC A;  4X4O A;  3BR9 A;  4K4W A;  2BQU A;  2WBM A;  1KC8 T;  2HZA A;  1T9U A;  1EQM A;  1FES A;  2BDP A;  4DSL A;  4RKU C;  2AX1 A;  2OLW A;  5ETQ A;  2DD8 S;  1S10 A;  3TQ1 A;  3V81 A;  3M8Z A;  4X4U A;  2CJQ A;  1WD6 A;  1G3O A;  3OXG A;  3RW6 A;  2J76 E;  3K57 A;  1TUG B;  2ABY A;  1RWW B;  3JQK A;  3N9U C;  3IBW A;  3SDE B;  3LGN A;  4OHW A;  4ZVR B;  3G9C A;  2JL9 A;  5A8W A;  2DHX A;  2W8K A;  2XEX A;  3GSI A;  3MUT P;  2ZH9 A;  1I94 F;  1KLM A;  3NXZ A;  1XMO F;  4YOE A;  2CDQ A;  3JSY A;  4HT5 A;  2B8Q A;  5KFS A;  3LH2 S;  3D9B A;  5KFY A;  4E8U A;  2BEF A;  1L3K A;  1O8B A;  2MQN A;  3D1Q A;  5T7L A;  4CCH A;  3N5B A;  3T9N A;  1GX6 A;  4QIF A;  3AAW B;  3IWL A;  4X4R A;  2W2P P;  2J8S A;  3MUM P;  2VG6 A;  2G9O A;  3QO9 A;  4TYB A;  5F9L A;  5KFK A;  1C1B A;  1C1C A;  4QYZ J;  2MY8 A;  2WW4 A;  1WC6 A;  2V6A A;  2V34 A;  4L3N A;  4UY8 5;  2ZHB A;  1U24 A;  2FZK B;  3BV8 A;  2DVI A;  4PXE A;  2KN4 A;  4WPA A;  1SXL A;  3A8I A;  1R8A A;  3ETO A;  3PNI A;  1CC8 A;  2F4F A;  3OT9 A;  1H2V Z;  4LRD A;  4XTT A;  4ZVF A;  5KOX A;  1FNO A;  4TU8 A;  2OFH X;  4DR3 F;  4KR0 B;  1K8A T;  3BYP A;  2VOO A;  2LEA A;  1FD2 A;  2CAJ A;  2YKA A;  3MD1 A;  5FII A;  3HMJ G;  2UZA A;  2ATC B;  1Q79 A;  3M8S A;  2ZH7 A;  4DR1 J;  2XBP A;  1DTT A;  1U8S A;  1ROF A;  1CJV A;  2GAG C;  3FSX A;  4FNI A;  3G8S A;  1T9W A;  2AJQ A;  2A3J A;  3DC2 A;  4D3G A;  1QE1 B;  1RAJ A;  2LA6 A;  3H0P A;  2IBK A;  1G1X A;  1DTQ B;  1FRM A;  2HVE A;  1UWB A;  3RAQ A;  2XC9 A;  4KV8 B;  2QE5 A;  4DR5 J;  1WEL A;  1EP4 A;  2VKR A;  1JLB B;  1NJZ A;  3DLB A;  5JVH Q;  1S7H A;  1HQ2 A;  4UST A;  5D78 A;  4QWB A;  3SSS A;  2JRS A;  1VQP S;  5BR8 J;  1FE0 A;  4KHP F;  3C16 B;  2RF2 A;  1GMW A;  1I3O B;  5HMX A;  4ECR A;  1B64 A;  2FVP A;  4DV2 J;  1HBO B;  2KYZ A;  4IR9 A;  2DIV A;  1RT2 A;  2BA9 A;  4J91 A;  2NYI A;  4QPX A;  4RW6 B;  4IOB A;  3M32 B;  3BSA A;  1G2E A;  2DH9 A;  2DPJ A;  2RQC A;  3SZ2 A;  4O0I A;  3IM9 A;  1XMQ F;  1T9X A;  3GR1 A;  1ZYQ A;  2G4B A;  3TR5 A;  1RUS A;  3IRX A;  2ASY A;  2HS4 A;  3MEE A;  3L7U A;  2XSJ A;  4PQA A;  4EO6 A;  2MSS A;  1RWU A;  1TV6 A;  1VBX A;  4WFZ A;  4BS2 A;  1TL7 B;  4OYW A;  2O01 C;  1U1Q A;  2EFO A;  3LP1 B;  2KJW A;  3CCW A;  3HHL B;  3KHG A;  4DV4 F;  3UN5 A;  5DLG A;  1R0A A;  2JEI A;  3CIZ A;  3D54 A;  4O4G A;  4X4Q A;  1HKA A;  3QIP A;  1Y5I B;  3VAJ A;  4RW6 A;  1ZM9 A;  1GFW B;  4ED5 A;  2IYG A;  1ZM2 A;  3MPW A;  4K8R A;  5J1N A;  4XDC A;  5BYQ A;  3DNC A;  5EUH A;  2CJB A;  2E1A A;  4LFC J;  2LLZ A;  4ID5 A;  5HRO A;  1LWF B;  1VHF A;  1BQN A;  1ZAV A;  3CE8 A;  4WXO A;  3NL0 A;  2APO A;  1FJG J;  3HZE A;  3KNG A;  1DQ9 A;  4ZCI A;  1SBR A;  3GV7 B;  1CJT A;  2BVZ A;  5L38 A;  1S1U A;  1S97 A;  1KQK A;  3H4D A;  1V6H A;  3UDC A;  2ZH4 A;  4TLQ A;  1TP7 A;  3GCW P;  1Y0H A;  1Q5V A;  2CIM A;  4ZN3 A;  5ITH A;  1CG2 A;  1F1B B;  4KHR A;  2NQP A;  3T5L A;  3FBF A;  1UFK A;  1ZTW A;  2VOD A;  3HKZ D;  1JLA B;  5HK4 A;  5DZ6 A;  4ID8 A;  2E1P A;  3H90 A;  3HPO A;  1H6K X;  4BDP A;  2I8E A;  4P52 A;  5C5J A;  4DV2 F;  3G87 A;  3N6L A;  2JSX A;  1Q8L A;  4L3K A;  5HQL A;  1ZS6 A;  4DZ6 A;  3M30 A;  5IFM A;  1AYE A;  1E6V B;  1XTZ A;  1LWC B;  2CRL A;  2GJ2 A;  3DU6 A;  1QSL A;  4B9U A;  2CPX A;  4MKY A;  4Y6I A;  1H2U X;  1RIS A;  3P4U B;  2HHS A;  4WCE Q;  4ZK7 M;  5L1L A;  2GS8 A;  3DN9 A;  4PPZ A;  4YQW A;  4KE5 A;  4ZLL A;  4J9L A;  1M5P C;  1XIQ A;  2FYX A;  2ZBR A;  1Y10 A;  3SFU A;  4FBT A;  2DEI A;  4O44 A;  1BD6 A;  4DV4 J;  4QYZ K;  4ZIW A;  1VQ9 S;  2MZS A;  3LAM A;  3AY0 A;  4LRC A;  4P72 A;  3ZTP A;  4WTO B;  4A8Q A;  1K73 T;  1TVR A;  3CJ0 A;  2CAD A;  4OI0 A;  4FYV B;  2ZEJ A;  2DJW A;  1BMQ B;  2IYI A;  2VH7 A;  5HMZ A;  3OTB A;  1VQO S;  1RAD B;  1FDB A;  3W9H A;  2MZJ A;  3MHY A;  1MW7 A;  3I5A A;  5IWA J;  2QA2 A;  3MUV P;  2J7W A;  1SC4 B;  3H98 A;  4DQP A;  3HD1 A;  4UOG A;  1TK5 A;  5B0C A;  4ED6 A;  2GHW A;  3W5Y A;  3NAH A;  2UUW A;  3DFE A;  4GMK A;  1U2C A;  5AT1 B;  4O3Q A;  2K1R A;  3IAS 9;  3RZA A;  5LXR A;  3EJM A;  5B08 A;  1VMB A;  1LWC A;  1BQM B;  2J7U A;  4DPO A;  4EO8 A;  2MYF A;  2Y1L B;  3P49 B;  1RLD A;  1UA0 A;  1N52 B;  3H20 A;  5KFU A;  3Q8Y A;  4UOC A;  2DH8 A;  4QYR A;  2G1H A;  2J0X A;  3KLH A;  3SI8 A;  1R8B A;  2EC0 A;  1RTH B;  3HK2 A;  5L1K A;  3C6U A;  1HNI A;  1IKX A;  1DZ5 A;  2AD9 A;  3T5J A;  4NEY A;  1T94 A;  2RKI A;  5GAD I;  2RDD A;  5HLF A;  4K0K F;  3TJ8 A;  5IS2 A;  2Y1J A;  3PRV A;  4CI0 B;  2KHD A;  3HFV A;  3TA0 A;  3QFW A;  2B9W A;  3R7N B;  1OO0 B;  3W64 A;  2VJV A;  1TMM A;  3CIM A;  3KJN B;  2B5J A;  5E2Q A;  2MLX A;  2Q43 A;  2W24 A;  4R8U A;  3LA0 A;  5DDR C;  5M2P A;  1S6P B;  3BGF A;  3HP6 A;  4OYP A;  2HK2 A;  2YTC A;  1W2B R;  4KT0 C;  2A10 A;  4LQ3 A;  1WHV A;  2AJF E;  4PKD B;  1OPI A;  2MJU A;  4I0W A;  4B3M F;  1UL3 A;  3ILO A;  3M2U B;  1MMD A;  3UR0 A;  1L5U A;  4B3O B;  4ZJQ A;  1ZAX A;  2HUR A;  4NEZ A;  3LO3 A;  2JOQ A;  4Z7Y A;  5F8H A;  5L9X A;  2DY1 A;  2B7B B;  2NXN A;  1XK8 A;  2LYV A;  2NUH A;  3BSO A;  1KVK A;  3ITH A;  4ED1 A;  3QSY B;  4UTG A;  5LM7 E;  1CS4 A;  1FRL A;  4LIR A;  4PEO A;  4ZVO B;  3CF5 Q;  5IT9 U;  2GJI A;  2DRB A;  4JV1 A;  2OTL S;  2OSQ A;  2FJA B;  5H9E J;  2C2Z B;  2MKY A;  2YKO A;  3AJD A;  2BJD A;  3CED A;  3MTJ A;  4LF2 A;  4PQU B;  1NK4 A;  4W90 B;  1NHV A;  3OFH A;  4BC7 A;  4LF7 F;  2PN6 A;  1SVD A;  3H8Y A;  4JYA J;  3QGG A;  3VCD A;  4F0M A;  1TL5 A;  2DH7 A;  4FXV A;  4USM A;  2QYC A;  1MML A;  3OLB A;  4J9Q A;  1TAU A;  1RHJ B;  1OQ3 A;  2B4U A;  1RI7 A;  4O3O A;  1T02 A;  5KFI A;  4CLT A;  3M6X A;  4AE5 A;  1YHQ S;  4ELT A;  2N7Y A;  2LP4 A;  1SH2 A;  5LJ3 Y;  1XER A;  4F8R A;  4PWD A;  1NDL A;  1WG4 A;  3DRS B;  4OFZ A;  2R2U A;  2DHA A;  2Z2L A;  1SL1 A;  4RWW A;  4RBU A;  4WIQ A;  4CYU A;  1VK8 A;  1YDL A;  4OHX A;  4WZM A;  1MU2 A;  3OJU A;  3CC4 S;  3MMB B;  4LRB A;  4NLS A;  3T1H J;  1PC4 A;  3P6Y C;  5KT5 A;  5AXL A;  1T8E A;  4CO2 A;  2QLW A;  2G2Z A;  4ZA1 A;  1Y3J A;  3M7V A;  2AYG A;  1Q1K A;  1WTB A;  3GQC A;  3CGI A;  1U47 A;  4AXI A;  1PGZ A;  4LFB F;  2AIR B;  1FRI A;  4OHV A;  3F73 A;  5ETM A;  3DHX A;  1VRT B;  3R5C A;  1DY3 A;  1R7I A;  4L74 A;  2VV5 A;  3TVK A;  1PAU B;  2ZWO A;  4TY8 A;  1KD1 T;  1YRT A;  2CVI A;  2WZ1 A;  4YDD B;  1GTH A;  5HMY A;  1DLO A;  1KSP A;  5K8N A;  2YNH A;  4OJG A;  4LRF A;  3OTO F;  4I68 A;  3LAN A;  4B9N A;  1F9E B;  3KLE B;  3QJJ A;  3QYY A;  2J0Q D;  4CQ1 A;  4QR0 A;  4ZJO A;  3NNC A;  2IDL A;  1SIW B;  1YGY A;  5HAT A;  2C1E B;  3TJ9 A;  3GFY A;  5EWG A;  5EDW A;  4EBD A;  1IBM J;  3I9V 9;  1BWE A;  4YN3 B;  2H54 B;  3GG0 A;  1GMU A;  3CDW A;  5BXI A;  3OL8 A;  1MMN A;  3DCA A;  2QSF A;  3HX9 A;  2LXI A;  4K4V A;  2FLP A;  3FSY A;  3EUN A;  3ZZU A;  3RB3 A;  3BS9 A;  4HVZ A;  3G6X A;  2HHU A;  3GIJ A;  4C0H A;  4DV1 F;  4C3L A;  4CH0 S;  1KQS R;  3D66 A;  2Q1L A;  2F3J A;  3GR0 A;  4DUZ F;  4PUO A;  4Q5V A;  3IS9 B;  1EJ7 L;  4B02 A;  2YWF A;  3G6Y A;  1SJF A;  1N33 J;  4MKA A;  4AND A;  3C6T A;  3SCJ E;  5J2P A;  4DPU A;  4JI6 J;  3MPD A;  2A6M A;  3DOK B;  3IXQ A;  3RU0 A;  3EIC A;  3HVT A;  3QNW B;  4LSL A;  4OIX A;  1G7C B;  4BWM A;  5GAH U;  4ED7 A;  1IWG A;  2CZ9 A;  2N82 B;  4MIW A;  1NBE B;  3JTN A;  1Y9O A;  1TMJ A;  2KG1 A;  1LW2 B;  3A13 A;  4CWB A;  1OSD A;  3OVB A;  4MFB A;  1NSQ A;  3LP2 B;  3DLK A;  4OI2 A;  1NJW A;  3KG0 A;  4GC7 A;  1HNX J;  4G3I A;  1U6F A;  1M5V C;  2KL8 A;  4USK A;  4QCL A;  2UXC F;  4DSK A;  3OHB A;  1RCX B;  2WSC C;  1RT3 B;  4U67 Q;  4DV3 J;  1XMQ J;  4ICL B;  2HVI A;  1S9G A;  4RW9 A;  4LFB J;  1F3V A;  1SV5 B;  1U7L A;  3DM2 B;  4J9V A;  3V2U C;  2ADB A;  1NK7 A;  5CXT A;  4M94 A;  2BAN B;  1N5S A;  2E44 A;  2RD5 C;  1IR0 A;  1WKK A;  2HHQ A;  2OEL A;  3O3L A;  1FNM A;  4HKQ A;  2GV1 A;  1UVM A;  1X8D A;  4FPR A;  2MXY A;  1CJK A;  2VJU A;  1N36 F;  3CSK A;  2AGO A;  1RT1 A;  3HHD A;  3RRH A;  4H4O B;  3HKW A;  3IAM 9;  4NCA A;  1APS A;  2AGP A;  3BDP A;  1VQL S;  3DLG A;  2KYX A;  3ONQ A;  5C2C A;  1EQ0 A;  3EWG A;  1X5T A;  1VC0 A;  4KV8 A;  1F2H A;  2MZT A;  2YKN B;  3N5F A;  4HHH A;  4IH7 A;  3MFI A;  2H5I B;  1X4H A;  1CJK B;  3AH6 A;  4JP8 A;  4USU A;  3ZZP A;  5F0U A;  4MKV A;  4RJV A;  4M5H A;  3UE2 A;  4BBY A;  2W9A A;  2X1F A;  3NNA A;  2QL5 B;  4HTJ A;  3MEG A;  1SUQ A;  1IWA A;  1IVZ A;  4D3H A;  4S0M A;  3T19 A;  5KTQ A;  4OYO A;  1HWJ A;  4NRT A;  2XNR A;  3AA9 A;  1Q53 A;  1ZA1 B;  2DXE A;  2GVD B;  1PAE X;  1RU1 A;  3NGT A;  4UUX A;  3MPV A;  4ZPB A;  3UDV A;  1PSD A;  2IVY A;  2JNJ A;  4YY3 J;  5AJ3 J;  2UUB F;  1SCJ B;  1YVF A;  3HHE A;  4DQS A;  3GII A;  5HVH A;  4DZD A;  2W9B A;  3HVA A;  3HVW A;  4PXC A;  3OFG A;  5F8L A;  4CM2 A;  4FZV A;  3T5K A;  5L8R C;  3BQ2 A;  1FRK A;  2NS1 B;  2VFS A;  1OY8 A;  2FJD B;  2EXU A;  3CW2 C;  3DDK A;  3EPG A;  2J9C A;  2LQ8 A;  1RT4 A;  2V69 A;  3MCM A;  4DPT A;  3UNG C;  2UUA J;  4C2M A;  3QO9 B;  1NDP A;  1VLO A;  2HS3 A;  1S6U A;  1LV5 A;  2V4J A;  4KO0 B;  4ZVP B;  1FWL A;  4C3M A;  3M2V B;  5LL6 d;  5DDP C;  3GIM A;  1E6Y A;  3VQT A;  4EU0 A;  4JUZ A;  5CD4 H;  4Q44 A;  1CC7 A;  2GGP B;  5ETP A;  2EG1 A;  1WNE A;  3TEG A;  1VQY A;  2A1B A;  5H9F J;  1O0P A;  3TZY A;  3PW0 A;  4RW4 A;  4YR0 A;  3M8Y A;  1RWO B;  2MST A;  3T3F A;  1WSV A;  4M5G A;  5DZ7 A;  3VAI A;  1FVQ A;  1CJU A;  1WHW A;  3ELH A;  4JI0 F;  3ZNU A;  4ZPT R;  3PO5 A;  2DRD A;  3JAM U;  3OTC A;  4WII A;  3H42 A;  1FFW B;  3VGV A;  5DLF A;  1K44 A;  2KVI A;  2YH1 A;  1YI2 S;  3MM7 B;  1CUL B;  1SJQ A;  1JB0 C;  4ILL A;  3TUJ C;  4K4Z A;  3I0S B;  4DR7 J;  1HAR A;  2XZW A;  3AXK A;  4NLY A;  4DV7 F;  1LEO A;  1FXD A;  4NLD A;  4TU7 A;  4J9O A;  1KQF B;  3FFI A;  2W7O A;  2CDR B;  2AMC B;  2F5G A;  4MIB A;  3W5X A;  4AYB D;  4OX6 A;  3TVZ A;  2RSQ A;  5IWA F;  2RIL A;  3HVT B;  2DGS A;  4NA3 A;  2J8A A;  1R6V A;  4IFY B;  5K5M A;  1WF1 A;  3RBX A;  4N5S A;  3PW5 A;  2J9E A;  4LF6 J;  1NSP A;  5CYQ B;  1F5B A;  4IR1 A;  2KZM A;  3Q2S C;  3IBF B;  3OJS A;  1SQG A;  1T03 B;  1FT8 A;  4IH6 A;  4CLP A;  2I5J A;  2YX4 A;  5KOW A;  3QGI A;  3CD0 A;  3MI7 X;  2LDI A;  4DS4 A;  2R3V A;  1N5V A;  2KVQ E;  6FDR A;  1WEZ A;  1UTA A;  4E0D A;  2DNY A;  1SH3 A;  3AA8 A;  3O44 A;  4LVO P;  5KFE A;  2ZH5 A;  4F2R A;  4DQQ A;  4FYW B;  1IUJ A;  1IQT A;  4ZVQ B;  4IDK B;  5KG3 A;  2XG8 A;  3THT A;  2IAJ B;  3W60 A;  5CYM B;  3ULH A;  3ZZO A;  4KHM A;  1MN9 A;  1XEZ A;  4M5D B;  5T14 A;  2ZWP A;  1FO1 A;  1WKJ A;  4FYY B;  1RT2 B;  2FHM A;  3W9I A;  4CH1 A;  4KIA A;  4NL5 A;  4CRJ A;  1HLW A;  4JI7 J;  2FJB B;  2MY7 A;  5B0A A;  4X66 F;  2HHH J;  3R7B B;  4FP9 A;  5A8R B;  1W25 A;  2J7K A;  4GVL A;  2JX2 A;  1N32 F;  2XQC A;  1XR5 A;  5HBM A;  4ANC A;  3OR1 B;  3V4I A;  2MEW A;  1SL2 A;  1U0H A;  1GX5 A;  1X7V A;  1WWH A;  2JFD A;  4DR2 F;  1C1C B;  1C1B B;  5KT7 A;  3V6D A;  3CJ3 A;  3NY0 A;  4OI4 A;  5J1E A;  4ECY A;  3TI0 A;  4KGM A;  1U6Z A;  1UJ4 A;  2MMY A;  4RLE A;  3LOU A;  2O67 A;  3EVW A;  1HNW F;  1P1L A;  2X1G A;  4C8M A;  1Q7L B;  2KO1 A;  3UWT A;  4RU9 A;  3EMT A;  2YY3 A;  4GKK F;  1NME B;  5DQG A;  5A2Q Y;  3LF0 A;  5KFT A;  2HNZ B;  4LSZ B;  3CUL A;  1M0S A;  2SXL A;  2V8G A;  2W2O P;  1D8Z A;  3KJQ B;  4X84 A;  2B3T B;  4EGL A;  5FLX U;  3J81 Y;  2ASL A;  2YPZ A;  1N5Y A;  2IM0 A;  2H65 B;  3CCT A;  2C2K B;  5KFV A;  2BR0 A;  3HZG A;  2NXU A;  4OJ1 A;  3R1L A;  5DRK A;  3W61 A;  2DNG A;  1MLA A;  2MLY A;  3I32 A;  2IFX A;  3D6T B;  3MAA B;  5BYS A;  5LMN J;  3FZ2 A;  4DF4 A;  1JLA A;  3D6M B;  3NOG A;  4F4A A;  2C2D A;  1FWK A;  1WHX A;  3NWR A;  5K8O A;  2FVR A;  2JVR A;  2YNF A;  5F9N A;  4WF9 Q;  4R25 A;  3QZ7 A;  1LWE B;  2G13 A;  2AYM A;  2W7A A;  2GHV C;  2BAB A;  3KFW X;  4CO3 A;  1FEE A;  3M8W A;  2HBQ B;  3HUL A;  2I0X A;  5G0R A;  1UA1 A;  2VG5 A;  3KXD A;  3A8J A;  1RT1 B;  4X66 J;  2Q3P A;  5L1I A;  2QC3 A;  5JUM A;  3H40 A;  1WC5 A;  3H2V E;  3PX0 A;  1GXU A;  2IRY A;  3QAT A;  1SC1 B;  4HAC B;  2OH2 A;  2CQ2 A;  3RW7 A;  4TU9 A;  3M1V B;  1AUD A;  1S9E B;  3AB4 B;  3KMS A;  4K4Y A;  3SMZ A;  4HH0 A;  3CVK A;  2XS7 A;  2GO9 A;  1YRU A;  2VKZ G;  2MDA A;  4NZ7 A;  4ZCK A;  1YTY A;  5DQI A;  3MAH A;  2LDY A;  2E1R A;  3JSM A;  3PJ9 A;  3JTO A;  5AE2 A;  4ZLJ A;  1M90 T;  2XTJ P;  1S6Q A;  2RQ4 A;  4I2Q B;  4KGK A;  3X1L B;  3TA2 A;  3VGS A;  4O4R A;  1PYS B;  2QRR A;  2XSJ B;  5JXS A;  4QPT A;  3L09 A;  4DPY A;  1PBU A;  3ZZ0 A;  4KFB A;  1S57 A;  1VFJ A;  1WTF A;  1GXL A;  3MMA B;  3RAX A;  2C42 A;  1U2R A;  1QAJ A;  4DV1 J;  3QRQ A;  2JVO A;  2XLJ A;  4LBH A;  1N0V C;  2J6T A;  3DI6 A;  3SQO P;  5C24 B;  4DUZ J;  1S77 D;  3OTO J;  1S7I A;  2HGN A;  4ILR A;  5E3R A;  5ETN A;  1LK5 A;  3NP5 A;  1TKX B;  2D3Z A;  2NSC A;  2BJE A;  2DGX A;  2W2M P;  3AOD A;  3IWX A;  3G6E S;  2QYG A;  1U6B A;  3W2W B;  1YRX A;  1Q0N A;  5F8N A;  4KAI A;  3GIR A;  4X2B A;  2Y8W A;  3F41 A;  3OQ2 A;  5LT5 A;  3BO4 A;  1GEH A;  3VAL A;  2VQF J;  3VAF A;  2WON A;  2K3K A;  1FK9 A;  1ZBT A;  2H4Y B;  1J2V A;  3A8E A;  4ZIT A;  4R5P A;  4UOF A;  4B3O A;  1S59 A;  1I51 B;  1KOO A;  1F5A A;  3GMG A;  4P7V A;  2H9Z A;  2L9W A;  4ED4 A;  3G96 A;  1PKU A;  3SIP B;  4Q43 A;  4M5D A;  3BR8 A;  3OVS A;  2XMU A;  3M8P B;  3OPK A;  1H72 C;  3M30 B;  2UUT A;  1U0S A;  4GC6 A;  5CZX A;  2DY9 A;  5JVG Q;  4U8V A;  2AJ2 A;  3PX6 A;  2P9E A;  2RVJ A;  2XMW A;  3DLJ A;  2OPQ B;  2UXD J;  2K3I A;  1S48 A;  1X60 A;  2H51 B;  5D0H A;  4R5P B;  3KJV A;  4B08 A;  1KLN A;  1UVL A;  4I4B A;  2PFD A;  3PCO B;  2QLB B;  1AT1 B;  3AOC A;  3R9L A;  3VVU A;  2R8K A;  3V6D B;  3QGH A;  2AQ4 A;  2XYH B;  4NA1 A;  3GU0 A;  3KUG A;  2ZH2 A;  4DF8 A;  3QLH A;  3CJK B;  4JI4 J;  1RP5 A;  5HRO B;  1W7W A;  4GO5 X;  4I2P B;  4ZDN A;  1AZS B;  4WKY A;  3BO3 A;  3MOJ B;  4DV3 F;  1F60 B;  2BAN A;  1KKH A;  2O66 A;  2XY6 A;  1W26 A;  1HBM B;  3PTW A;  2AYB A;  3WBZ A;  5K9F A; 
#chains in the Genus database with same CATH homology
 1RE1 B;  4ZVO B;  1NME B;  3P45 B;  4LSZ B;  2C2Z B;  3KJQ B;  1QDU B;  2P2C B;  3EDQ B;  2HBZ B;  3KJF B;  3RJM B;  2H48 B;  3D6H B;  2H65 B;  2CNL B;  2C2K B;  2H5I B;  2H4W B;  1GFW B;  2QL5 B;  3D6F B;  1RHJ B;  3D6M B;  2QL7 B;  2HBQ B;  2XZD B;  1RWV B;  1SC1 B;  2HBR B;  1RHM B;  4DCP B;  4ZVT B;  1RWX B;  4ZVP B;  1IBC B;  1RHR B;  1PAU B;  3P4U B;  4DCJ B;  2QLF B;  1SC3 B;  1RWO B;  1RWW B;  3R5J B;  3GJQ B;  1F9E B;  4ZVR B;  1QTN B;  2C1E B;  4DCO B;  5IC6 B;  1BMQ B;  2H54 B;  1RWP B;  1RWN B;  2DKO B;  3GJS B;  5IC4 B;  1SC4 B;  1RHU B;  2CDR B;  3GJR B;  2XYG B;  2CJY B;  2QL9 B;  2Y1L B;  2H4Y B;  4ZVU B;  3IBF B;  4JB8 B;  1I51 B;  2XZT B;  3NS7 B;  3R6L B;  1RWK B;  2FQQ B;  3SIP B;  3R6G B;  2H5J B;  3QNW B;  4ZVQ B;  3GJT B;  2H51 B;  3R7N B;  1ICE B;  3EDR B;  1RWM B;  1RHQ B;  3KJN B;  4ZVS B;  2CJX B;  2QLB B;  1RHK B;  3IBC B;  2HBY B;  2XYH B;  2C2M B;  3R7B B;  2XYP B;  2QLJ B;  1I3O B;  2CNK B;  2Y0B B;  1PYO B;  3R7S B;  2CNN B;  2C2O B;  5K20 B;  2CNO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...