1IBCB

Crystal structure of inhibited interleukin-1beta converting enzyme
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPAGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords INTERLEUKIN-1BETA CONVERTING ENZYME
publication title A combinatorial approach for determining protease specificities: application to interleukin-1beta converting enzyme (ICE).
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1997-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1ibcB00
2C2KB 2P2CB 2HBZB 2HBRB 2H51B 4ZVQB 2CJYB 4ZVOB 2H5IB 2XYGB 3D6FB 4DCJB 3P4UB 1NMEB 5K20B 3KJFB 2DKOB 3D6HB 2QL9B 2C1EB 3GJRB 2C2ZB 1RHQB 2H4YB 1RWVB 2H54B 4JB8B 2XZDB 3R7NB 3R6LB 2QL7B 2H65B 3R7BB 1RWWB 4DCOB 2FQQB 3EDQB 3KJQB 2Y0BB 3R6GB 4ZVTB 3SIPB 1RWNB 1RHMB 2XZTB 2CNLB 1RWKB 1QDUB 4DCPB 2C2MB 1RHKB 3EDRB 2CJXB 3P45B 1I51B 1I3OB 3NS7B 1RWOB 1RWMB 1IBCB 1SC1B 3R7SB 1RHJB 1QTNB 2H5JB 1F9EB 4LSZB 4ZVPB 1RWPB 2QLJB 2QL5B 2CNKB 1PYOB 5IC6B 1BMQB 3GJQB 2CNOB 2XYPB 3IBCB 2XYHB 2HBYB 3GJSB 1RHUB 1RHRB 3D6MB 2Y1LB 4ZVRB 3GJTB 1SC4B 2CDRB 2HBQB 1RE1B 3KJNB 2H48B 1PAUB 1SC3B 2C2OB 1GFWB 2QLFB 1ICEB 3RJMB 5IC4B 3IBFB 3R5JB 2H4WB 1RWXB 4ZVUB 3QNWB 2CNNB 2QLBB 4ZVSB
chains in the Genus database with same CATH superfamily
1WF2A 1VBXA 1PYTA 4LSNB 4F4ZA 3I9ZA 2KFZA 1UJ6A 2MHNA 3HMJG 3ZTSA 4F04B 2M8DB 3AAWB 2XULA 3KJFB 4B9NA 1GK8A 4QIEA 1RLCL 3D7SB 1K44A 4CCHA 2HFZA 5F8MA 3OW2R 2RUSA 3FEXB 4P2XA 4JI1F 1ZZNA 4O23A 1M90T 4FYYB 3D2WA 2VKRA 1WI8A 3HM9A 2UXBJ 1NXIA 5CYMA 3HT0A 4DQSA 2C2DA 3U7JA 4CH1A 1PCAA 2VUGA 1P9YA 1KN6A 4NXMF 5DLGA 1C2PA 1RISA 4DR5J 4YR0A 4IFYB 3DLEA 4KH1B 4NCBA 2O01C 3KUGA 1FKAF 1HBOB 3T5JA 1X5OA 3DDIA 3NEKA 1BUXA 3N28A 1RDRA 4RNFA 4ILMA 2R2SA 4WFZA 3LANA 9RUBA 5DM6Q 1M5PC 2MLYA 5BYRA 4FP9A 4DU8A 2W8KA 3I32A 3KLHB 4NLGA 2CIMA 1APSA 4WP8A 4PR6A 3MAHA 2B9EA 2FLOA 5I4MA 4AXJA 1IUJA 1HPZB 3O3LA 1FDAA 2IFXA 1SH3A 2Z57B 3BPDA 2OTJS 2GVZB 2VIHA 5I3UA 2GJFA 2E1RA 1WF0A 2A10A 3HJFA 2YNGA 4TXSA 3C16B 5KG2A 3WX4A 2B0GA 2PMZD 2FHJD 1BQNA 1RUSA 1YX2A 1RHJB 3V2UC 2HZAA 2MEWA 1Y4ZB 1JJHA 4ED5A 2QA2A 5IC6B 3CULA 1U1RA 5E0OA 2DGSA 5D78A 2M0GB 4C11A 1U6FA 2CVIA 4C8YA 1WDDA 2GMLA 1FRLA 4TKTA 1F3VA 2DXDA 4Y2KA 1O51A 4DV1J 2GHPA 2RIJA 3BGFA 3DDNA 4B02A 3CJTA 3LP2A 2ZH1A 3M2RA 3BYRA 3T1YJ 3KG4A 4JI0J 4HTIA 3TR5A 2BUNA 4X4VA 3IC1A 2L9WA 4WFNQ 2ZWPA 4RW6B 2X51A 1AFJA 3H42A 2BJ8A 4C8LA 1PC5A 4C0HA 3QGHA 4BHQA 2BACA 3QRQA 4CYUB 2H65B 4USUA 2UXBF 3BO4A 5HANA 2PA8D 1C0UB 2QO3A 2XMVA 1TKTB 1KQFB 4JI7J 2DEJA 4CDIA 2KJVA 1RHKB 1RK8A 3GZ7A 3PKYA 2VPXB 4DR5F 4ED0A 5EWGA 3BSNA 4KHRA 2Z2ZA 3HVTB 2GO9A 1HNWJ 4OHXA 4R5PB 3RR8A 2VOPA 2YWKA 4MH8A 5HLFA 2JFKA 5L8RC 2NPFA 4C8OA 1U1KA 4Y2CA 3N5FA 2EFQA 3AY0A 2HSEB 1PAUB 1SC3B 3UI3A 3TP2A 4N8OA 5E3RA 4ZLJA 3EWGA 1BC6A 2CPHA 4RWWA 3EZUA 1H7XA 3OTBA 3FEYB 3DLBA 2W2MP 4W90B 3N0VA 4C98A 5HBMB 2G2ZA 1JLBB 2YQ1A 1TZ0A 2XSJA 5LXYA 1L3KA 3T1HF 1FK9B 2C22A 3MCSA 4RW4B 1YRUA 3RG6A 3DLGA 1UAWA 2HWTA 1H73A 4J9OA 1TL1B 3POTB 4RU9A 1LWXA 2O1PA 2JEFA 2RSQA 4J9QA 2CPZA 1IBCB 3MEGA 3NGUA 3CDBA 1UJ5A 1CJTB 3E2EA 6FDRA 4M5HA 4GKJF 3OXFA 3UD3P 2FLNA 3DI6A 3EM1A 2VZ9A 1SC6A 4ZPAA 1NDPA 3CDAA 4DV1F 4M94A 1FTCA 4EI2A 1CLFA 2FVRA 4RUCA 3T1YF 1OIAA 3RB4A 1IKVA 2HNDA 4JI0F 5IC4B 1JLEB 4GRSA 3MFIA 2VD3A 3NGTA 4H4OB 2CZ4A 2B4UA 2MKCA 4YB7A 1HQUB 1QAIA 5CYMB 3UVJA 1F9FA 5KFCA 2IM3A 3ETMA 1E6YA 4DF4A 3I82A 1X9MA 2DH8A 4LT6A 1U24A 4JI7F 4HKQA 2GCFA 2G4BA 3K8WA 3GONA 2YKOA 3AHPA 4DLGA 1FRHA 1NH7A 1ZPWX 1UVLA 3NGRA 4OJGA 4TN2A 4FN5A 2MTLA 2BJDA 1UEVA 2DK2A 2RE1A 2W7AA 1HNWF 2MLXA 2GS8A 4OX6A 2BJEA 4LSZB 3OTCA 3R27A 4XDCA 3C15B 1Q1KA 2DXEA 2P6TA 4DQPA 3IR5B 1T02A 4QWBA 1S48A 2C3OA 4OMFG 2E9TA 3MHYA 2WW8A 1RE1B 4O3OA 1S6UA 4X4RA 2YWGA 4C8MA 1HNVA 3GR0A 1RAJA 3DCAA 2DHAA 3TI0A 4UOCA 3GFXA 1CJUB 1K1QA 5KFFA 5EHHA 3D1HA 3CJ0A 3QT7A 3CIZA 2FHMA 1Q81T 2YNGB 2XQCA 2OPPB 4Y2IA 2FZGB 4M5JA 7AT1B 4DL0C 3LGMA 3IGVA 4QYRA 4DX6A 1BQNB 3PJ9A 3RBZA 1NB7A 5AE3A 2KT2A 1BQXA 1T8EA 2MZ1A 3AJDA 4KR0B 1VC5A 2X3GA 1WC4A 2ZKUA 4ER8A 2HVHA 1QY7A 2IM0A 4MKVA 4WPAA 2QLJB 2WB4A 4L74A 4PXBA 3CD7A 4CT8A 3DOLA 5C24A 3SXLA 1R27B 2H9ZA 4PPZA 2CPXA 3MM6A 3GG0A 1M5OC 3GIKA 4RR5A 4DSJA 1WG5A 1ZPVA 2E5LF 2IM2A 1NO8A 1OYDA 2HK2A 1F3FA 1RWXB 4IOBA 2B9WA 1WC1A 3D28A 2J6TA 1AROP 3SI8A 4XPEA 3GSIA 2OPRA 2YNHB 3CJKB 3CIMA 3M7VA 2C3PA 1N56A 4NMXA 2H4YB 3R6LB 2VPYB 3OR2B 2DH7A 4Y6IA 3MUMP 2CAJA 3DXBA 5HLFB 3QWPA 3JQMA 1T9TA 2L9NA 2QEXS 2LQ5A 4YQWA 4WZMA 3MURP 2IJRA 1KP6A 1U6ZA 2MKKA 4CLLA 1Q86T 2HS4A 2Y1JA 5E3PA 4AT1B 1RT4B 1LW2B 1RCXB 2PIIA 4ED2A 4ID5B 4OI6A 4EU0A 4NA2A 1HW8A 4JUZA 3TAMB 4ZP8A 4G1IA 2PA3A 2MKYA 3G82B 3QLHA 1IKXB 1NDCA 2CVEA 2NXNA 5K8PA 1PO6A 5F8NA 2MGZA 5IT9U 2PI5A 1DLOA 3DLGB 1HI8A 8ATCB 4KE5A 2XTJP 4YN3B 3M30B 3D6FB 1FRXA 1ZETA 4DR1J 3KLGA 3M8SA 4OLPA 2ZH2A 4HDGA 3AODA 1RWWB 2CPFA 3D66A 3QGGA 2MPUA 1RQ0A 1I1GA 4WBFA 4CI0B 2EG2A 4MMOA 3MF5A 2XGPA 3TZXA 2Z30B 3BO2A 1VQ8S 2FDNA 4HI1A 2HNDB 1PYOB 1XMQF 4QR0A 1MMDA 3SCLE 2BKNA 3MECA 4I2QA 4DFJA 3TUJC 1RHRB 4Y2MA 3D6MB 1B7YB 2GVDA 3KHRA 3OHAA 3C2PA 5A2QU 3K58A 2FTRA 4RBVA 1S99A 1VQKS 4B9SA 1RP5A 2VICA 5J2QB 2N4CA 2IC3B 4ED8A 1FKOA 1TKXA 3VALA 2XMAA 4UY85 5B0BA 1KTQA 3W2VB 1XK8A 4JI8J 3LP1B 1RAIB 1RADB 1UVMA 2C2NA 1OS5A 1FJGF 2V67A 4Q8EA 4KB7A 3NBPA 4TLQA 3VZIA 1IBMJ 3RW6A 2AEMA 1J5OA 1SVDA 1T03B 3KTQA 1NPRA 1HWUA 4LUBA 2YKQA 2GIQA 3PY8A 5KFSA 1OJ4A 2DRAA 1FX2A 2KRBA 2OEMA 3FFIB 2JVRA 1SUQA 5J2MB 1SKUB 2YWWA 3VGUA 3FBCA 1REGX 1HNVB 4M5DB 2F65A 1MMNA 2R7OA 2C2RA 1LNQA 2JWNA 3Q8QB 4P7VA 2HQCA 5K8OA 2WHOA 3OV7A 3CSKA 2MQLA 2ROEA 1CJVB 2VBZA 3SV4A 4QW9A 2ZDOA 5C5JA 1U8SA 3RGIA 3NGDA 2RU3A 2PEHA 2MZTA 3V4IA 4P7TA 1UFWA 3IP0A 4PG7A 2HNZA 1R31A 4CH7A 2DR7A 2UUCJ 4NLQA 1V5IB 1NJXA 4OHYA 1R8PA 2CQGA 4DR1F 2LEBA 4HYKA 2BOPA 2ZHAA 4DPOA 3OSNA 5J2PA 1U6BA 4NL5A 1RWVB 4DR2J 1YDLA 5IT9Y 2HVEA 2W9BB 3FBEA 2FQQB 4L73A 4OQJA 1U09A 1KNZA 3DOLB 1OY8A 4NA1A 4LRDA 4CO3A 4ICLA 4U8VA 1CPZA 3HD1A 2UUAJ 2DNRA 1VK3A 1TL3B 2YNFB 5KFAA 1F9EB 2CZVC 4LJMA 3C8YA 3CCES 3I96A 4DZ6A 3NS6A 3TAQA 1IQZA 2HHWA 1RAOA 4G6VB 5D0HA 3C6TA 2W2PP 5ETLA 1WORA 2OPRB 1VI7A 1WC0A 3QGIA 2ERRA 4KTQA 1YJNS 1P9QC 1R8HA 4PXEA 2J0QD 1S1TA 3A8IA 4P2SA 4WTYA 2EWHA 2ZEJA 1URRA 4GVBA 1EIYB 1NZ8A 5THWA 2VC0A 4C48A 4NXNJ 3MD1A 2G1HA 3RBEA 4Z2XA 4NZ0A 2ZUAA 5A2QY 1IBMF 3V5RA 3M1VB 4OLOA 2W9AA 1HBMA 1YRXA 1T94A 1GT8A 3QZ7A 3DLLQ 1VISA 3I4HX 4DL2A 3HHLC 2FHKA 2Z4PA 3WDOA 1S10A 2ROGA 1N8RT 2DJWA 1OQ6A 2Z56B 2JZ5A 2EFNA 2EPIA 4KKOA 1MG7A 2VA2A 2MKSA 4ILLA 5HMZA 1QTNB 1WHWA 3VGVA 3VWSA 5CH7B 3QLHB 2QL5B 2B7BB 3ZZUA 4QIFA 3BJYA 3QT6A 2HFOA 1DLOB 3LO3A 1IM6A 2UUBJ 4LQ3A 4Q0BB 3PFEA 3G2XA 2NREA 3T9ZA 1NSKL 2UUCF 4ECSA 1Q4RA 3MOZA 3WZ0A 2WB1D 2QFJA 1R6YA 4PWUA 3G86A 2J9CA 3X1LB 3N9UC 1N5TA 5C7PA 3I0RA 2HHUA 3PO4A 2RDIA 3V81A 3MM9B 5DZ6A 5JVHQ 4JI5J 4O3SA 5HQ8A 2ZBRA 4DR2F 5A8KA 1X4FA 1VQLS 3ETOA 1HD0A 3R5AA 1QM9A 2YWFA 2B5JA 4QPTA 5KFJA 4LF9F 4MYTA 2F9DA 4AL7A 4B9LA 2UUAF 1GX5A 2M9KA 1RT5A 4Q43A 3PO5A 2R42A 3P96A 1EX8A 2W4CA 1NK0A 2AZ3A 2B6AB 2CJXB 4X62J 3PRBA 1Q95G 3HK2A 1IM4A 3OTOJ 4TY8B 1D8YA 4P73A 1N5YA 1DY3A 1WUUA 1FKOB 1TKXB 2OTLS 5GAHU 3OT9A 4LVOP 4DV3F 4HT7A 3DU6A 2DNNA 2ZHBA 4NXNF 2PMWA 3BYPA 2DGUA 2V8PA 4WXWA 3Q83A 2WW4A 1IQTA 1S5ZA 4I4BA 3I4PA 4RPFA 3FK4A 2ZD1B 2X7IA 3BDPA 5K5MA 3AB4B 3UPFA 2ZH6A 3RZAA 1LKZA 1SUQB 1N5QA 3R8YA 4J90A 2HFVA 2OHDA 5IT4A 2QL7B 2NPIA 3QSIA 4NPOA 3OFGA 3EMTA 4LR7A 1T9WA 5EWFA 2KFNA 3RB0A 1FWKA 3HVRA 3IRXA 4YUDA 1FESA 2JFDA 3BKFA 3EYZA 1XBWA 1EQMA 1U47A 2YVSA 2AGPA 2V2KA 2DBBA 1K47A 3ILIA 5EDWA 5CZXA 5K14B 4DS5A 1CSJA 1S6PA 2I0XA 3OLBA 3CJ2A 1L3SA 4XDDA 1ZYQA 1RSCA 2MLZA 1Y7PA 3IBFB 5DG7A 1SI9A 2FLLA 3AD9C 3LPEA 4JI5F 3MEKA 3QRRA 3FVYA 3CCVS 1YJ7A 3RRKA 2D9PA 2XLIA 3NMRA 4LBIA 4X4PA 2CJQA 3PACA 2UXCJ 3H4DA 4ICLB 1FI4A 2ILZA 1VJWA 3UCZP 2R2UA 4ZPDA 1CULA 2CQ3A 1OO0B 5J1EA 2ZBIA 1BLUA 4C0BA 4MFBA 3TRGA 4GC7A 3IWNC 4X62F 3O6QA 2XGQA 1AYEA 3OTOF 3HSJA 5J2NA 2VFVA 2RF2B 1XWLA 3M6XA 3W2WA 4IG0A 3ENAA 2FJXA 3MPYA 3HSZA 3HO1A 5HN0A 2BE2B 3JYTA 4K5RA 1IBKJ 3N01A 3SMZA 9ATCB 3HLUA 3ULHA 3EICA 4C8ZA 3CCTA 1TL5A 4KH0B 4QCLA 2JVOA 3CDEA 2PD1A 3DOKA 2VOOA 3BR9A 1TV6B 2P2CB 3R5GA 5KFKA 1OMSA 1S6QB 2ZDPA 3NP5A 3DRSA 3F44A 4J9LA 2V8GA 2F63A 4FVMA 3Q2SC 3QIPA 2CJKA 5EGYA 2XY5A 4ES1A 2OELA 2UU9J 4LF8J 1HNZJ 3CD0A 4F0HA 1ZBTA 2VG7A 2WSEC 2UV8A 3EGWB 4HHJA 2WVDA 1IR1A 2DGVA 3GMGA 2HQFA 2XZTB 2KXFA 2ZUGA 1WOSA 2VH7A 1GMUA 3ZZZA 1GXLA 1T95A 1XMBA 3KMSA 4AL5A 3KK3B 1S9GB 1S97A 2X1AA 3Q8PB 4ZCLA 4M1KA 2IRXA 2RJZA 4K4SA 4F2RA 4FZVA 5KFWA 3DYAA 2APOA 4DN9A 3W3SA 2QYCA 3JTOA 3I5CA 3KJNB 3TO8A 1NKBA 5A8KB 5B0DA 2MSTA 1VS3A 2B5JB 3LUYA 2HRUA 1HR0J 2UXCF 1TKDA 5D0EA 4IH6A 2YWEA 2G2YA 3R3TA 4A8WA 3JAMU 2BE7D 4R8UA 4DBQA 3EJMA 1VBKA 1XTZA 3R5DA 2M2BA 4IH7A 5K9FA 4PQUB 3K5NA 2CPEA 4YFUA 4K4WA 4NEYA 4CQ1A 1SL0A 2XS7A 2K2PA 3ZZ0A 4ZKAA 2MKIA 4M5IA 1N5YB 1S1UB 3TA1A 3R6GB 4IO1A 1FFSB 4JV5J 4OI2A 1XEZA 3D3CJ 3M6VA 3DRXA 1RU1A 4BWJA 3QATA 2DNGA 1SJFA 4RBTA 2HHSA 1Q82T 3NKYA 1G2EA 3I5AA 2V50A 2EEYA 3BV8A 3BZQA 4AD6A 1JKHA 2IMOA 3DMJB 2V4JA 4L76A 2CQCA 3KNAA 1SIZA 2K7JA 1F5CA 4ZVEA 5ETMA 2NSCA 1KS2A 3GCXP 2F1FA 4LF4J 3TEHB 3PFOA 4NLPA 3PYGA 2K3KA 4F26A 4U7UK 1C4CA 2FHOB 1IBLJ 3PRDA 3D0GE 2W4PA 4Y2AA 1VQ9S 3IRXB 2Q3PA 4LF8F 1X9SA 1B99A 2P8IA 2BANA 2ZHOA 2RDDA 4M63A 4DCOB 1PJ6A 3ENWA 1YZ6A 1FWPA 5KFEA 4USMA 3BSOA 2J0WA 3DXSX 4S0MA 3QFHA 4PEOA 1W26A 1JXLA 4DXLA 1OQ3A 3BR8A 3CJ4A 2C2EA 1SJ4P 4Y28C 4ANCA 2I38A 2VJVA 1WDTA 2GA7A 1XIQA 4K5SA 4MK7A 2IVFB 4NA3A 3WC2A 1MNEA 3OVBA 3WQPA 1PG5B 1UFKA 5EX3A 2I5JA 3DOMA 1KFDA 1D8ZA 4F4WA 2QIFA 5F3TA 3HHNB 2ZM6F 1DAXA 2Z8QA 2E29A 1HARA 2R8KA 3ZZYA 3BN7A 4ZIVA 2F8EX 8RUCA 2E66A 2OMOA 1HR0F 1B0TA 2JNJA 2DR6A 1SL2A 1B0VA 3HFZB 2Y1IA 3NY0A 4K4UA 4ECRA 5KFXA 3GV7B 4RNMA 2DHGA 1SJRA 5IZHA 3MTJA 1KLMA 1C1BA 3TX8A 4ZP7A 4USVA 2U1AA 3IS9A 2XZDB 4ZVFA 1FFWB 4RO0A 1DQ9A 2DGQA 3IR6B 2YKNA 1VYAA 2KFYA 5KFQA 3GE9A 2WZ1A 4L3NA 2HEKA 1YJTA 1CQMA 2R8JA 3DOKB 4MT1A 3VAJA 3MEEB 3EGNA 4DV5J 2MKHA 1I6JA 3DRSB 4L75A 2J6SA 1V9OA 3SFUA 1HHQA 2OUGA 4J9PA 4IFVB 2NUUG 1IBLF 2CFXA 3SQGB 4LRAA 4EZ6A 3G6XA 3N6LA 4BWMA 1FX4A 3F56A 4ZVOB 1WG4A 1EETB 4LF2A 5LMUJ 4OI4A 1TFWA 2KXNB 2GIFA 1UVIA 2HYIB 2KZMA 2GQ2A 5DG9A 1TAQA 2HRYA 5LMNF 1X5TA 2OI2A 3CT9A 3BGRA 5HVHA 2OSRA 3DYAB 3JSYA 2HVIA 2OEJA 4OX7A 1LFWA 1Z1ZA 3SV3A 2W9CA 1RT3B 4DSKA 1QD1A 3KLIB 1TL7A 4USHA 1WTFA 4O0IA 1L3TA 3M2UB 3CCUS 4A8YA 3V6DB 5B0AA 5JUMA 2ACYA 4R8UB 4EBDA 5H9EK 1R0AA 3NGKA 4OFZA 3QAUA 1RAEB 3MR7A 2OO4A 4HACB 3QWUA 3GILA 2V69A 3I5BA 3H2UB 5F8GA 2BRLA 3FCWA 2DIVA 1VQPS 2IJNA 2IIHA 5GMKa 3IN5A 1JB0C 1IWGA 2DKOB 1VIOA 4WYWA 3CDWA 4P6QA 2DNYA 4ZK7M 3ZTOA 3I56S 4M5KA 2LLZA 3BH7B 3THPA 4MKYA 2E1MC 5C2CA 1P6TA 2RHQB 2W4DA 1WWHA 2QT7A 1OY6A 3GQCA 1RWKB 2V4JB 4DL4A 3M8QA 4ZCKA 2AP6A 2HGMA 2WSFC 5DGAA 1NJZA 2CG4A 3C14B 3KOAA 3PYEA 2OLWA 1KVKA 3PW5A 1PJ7A 1UVKA 1Q7YT 3VR1A 3CTRA 4DV5F 1LW0A 2J7UA 2BQUA 4RBUA 1F1BB 2KDOA 1XJWB 4MTPA 1TUVA 3PV8A 1NK8A 4RNNA 3EGVA 4ED4A 1YG0A 1N33J 4H4MB 4CTAB 1N6QB 5J1NA 3JS9A 4BLGA 2XSFA 2Y1RI 1NUEA 4N77A 5DG8A 2RRAA 5FDLA 2AU0A 2ABYA 5JMNA 4CP5A 1EARA 1ZM9A 2A0FB 2AHOB 5K8MA 5HJXA 4CLPA 5ETTA 2FVQA 4RNOA 4HHUA 2GMJA 2R7WA 3NS5A 2FIUA 2MSSA 2BM0A 2V8DA 1Y9OA 3GFHA 3MCNA 1DTTB 2FY1A 2ZVIA 3PKMA 2A6MA 2J8SA 3CCWA 3SBMA 3H20A 3MR3A 3CCSS 1AB8A 5CCMA 1TVRB 3OXLA 4N56A 2H48B 2YH0A 1KLMB 3TANA 1C1BB 4IDKA 3CXCR 4F4XA 3R5JB 3QJJA 4USTA 3UQSA 4QIWD 1UKUA 2DCLA 4OYBA 3KXDA 5KFOA 2VQFJ 7FDRA 2DR5A 1EHWA 1S9EA 5HP1B 4E8UA 2AX0A 1NPKA 2KL8A 3HP6A 2VQEJ 1I94J 1C1CA 4DI6A 4K0KJ 1U0SA 2ZWOA 3IBWA 4XK8C 2ZH3A 5E33A 2CNLB 2EKYA 1Z4UA 3ENQA 2M70A 1PILA 5IFMA 2RILA 4QIVA 1NJWA 3Q8RB 4LF5J 4KY3A 2E9ZA 4LR8A 3LTOA 3QGPA 4KJIA 2R7UA 1N33F 3ZC4A 2VV5A 3UO0A 2KH9A 2OPQA 3VV2B 5JVGQ 4B3SF 4USIA 5L1LA 1VC6A 3PNIA 4H4KA 2A3JA 2LQ8A 4KV8A 4YMEA 4ZP6A 1RAFB 4ETXA 2JC1A 2ADCA 3DRRB 1HMVA 4L72B 5LJ5Y 1S4EA 4BS2A 3DRPA 2BW7A 4NLVA 4RLEA 1RI7A 4PPDA 4I64A 2OD4A 1YJUA 3GIJA 4JB8B 4QR1A 2NXCA 1OSCA 1J2VA 4WCEQ 3C66A 2RMLA 4CIOA 2XHCA 3UR0A 4EBEA 1VCTA 3HDSA 1ZOTA 2C2MB 3G96A 3T19A 2LXUA 5BJRA 1F0XA 4AXIA 5KG4A 3WHIA 1R0AB 1A7GE 5KFIA 2XBPA 1GH8A 4V19X 4YDXA 3KWMA 3I9V9 4DFMA 2HWIA 3PX4A 4RU2A 3OVAA 2CQ0A 1N88A 5HJYA 4ZIWA 4WP9A 2LA6A 2R7TA 1E6VA 5KG0A 4HL9A 2I6WA 2KB2A 3MWBA 2ZOFA 5HO4A 2QN6B 3MZIA 5I42B 1FEEA 2BJ1A 5G0RA 1JLQA 1URNA 5GAEI 2D7SA 2XI3A 2R7QA 1ZTTA 3D1QA 1XERA 2AYEA 3FNNA 2BOAA 2VBYA 3C19A 2VQEF 4M5MA 2ZH4A 1I94F 4K0KF 5IXUA 5H9FK 1QAJA 4M5LA 1NU4A 4OYIA 2YTCA 1CQNA 4TYBA 1Q8KA 5CABA 3OTDA 2XHWA 4PWWA 2EFVA 5KT2A 5KFNA 2HQIA 4NLUA 2P9CA 3M32A 1HW9A 1XQIA 2W2NP 1KQSR 4ILRA 1BWEA 5JXSA 4ZMMA 3BQ2A 4X4NA 3EE3A 2ZNZA 2GJ2A 2V68A 1YBAA 4DSLA 1Q5YA 4G3IA 4Q2MA 4D3GA 2HBQB 4B9VA 1JLFB 3QBCA 3J80U 4DR4F 4KC5A 2O67A 1ITPA 3H25A 1A9NB 3I6PA 2LQJA 3R1HA 4WTOB 1PYSB 2DNOA 3ITHA 2AEFA 3GIMA 2JH3A 5BR8J 3K57A 2WK4A 3KMQA 3MFHA 3E3XA 4A8FA 4IRDA 1A6LA 4K4ZA 5CYQB 4YS2A 4PYAA 2LA4A 2O66A 3MAAA 3EDQB 4LRCA 4NOHA 3G9CA 3A8KA 1N48A 3QJPA 2D3ZA 3KG0A 4ZS6A 2R7VA 1VLYA 1M5VC 1HBNA 1XNQF 4IDKB 2AX1A 4B9UA 3T5LA 1RT6B 1Q53A 3M6WA 5M2PA 3S1TA 1UWAA 2XYPB 4GO5X 1IKYB 4I68A 4LVNP 5B08A 1KOHA 5HROB 2EFPA 3TUPA 2VFTA 2N82B 1TELA 1X8DA 1LWEA 2NLWA 1EAYC 1UTAA 1DBDA 2YX1A 1QSSA 3FZ2A 5H9EJ 3KG1A 3KFWX 2UXDF 1XR5A 1ZA2B 1HQEB 2FC9A 2CADA 3ET6A 1MWQA 2MZQA 1C1CB 1J5EJ 2NZ4A 2Y0SD 1RBAA 5AE1A 5HMYA 2CJYB 2AZ1A 3UCGA 1WJ9A 1SIWB 2J9DA 3H7HB 1SV5B 2NXUA 2X1FA 1NK4A 5T14A 3D6TB 1TFYA 4CWBA 5DZ7A 1WNEA 4LF7F 1S77D 3GFYA 1UW4A 5CD4A 2E1CA 2WBRA 1JJ4A 2KYZA 4F4YA 4LRFA 1RWOB 3VAMA 3MEDA 4EYHB 3DM2A 2BA9A 3IBCB 2KU7A 3VAHA 3CC7S 2JLGA 1RWUA 4EO8A 1HMVB 2R3VA 1GTEA 2CPIA 3DRPB 4WP3A 2RKIA 2XCAA 1WEXA 3DN9A 1O5JA 2DITA 3CB4A 4ANEA 5EWEA 2V9KA 3E01A 1KDNA 4RWXA 4B3MF 4OYPA 1ZAXA 3M8WA 1S0NA 5BR8F 2MYFA 2GC8A 4O3RA 3IAM9 3J80Y 4DMZA 2ZE2A 4F0KA 1FNXH 3LQVA 3OUYA 2PDAA 4N5SA 2C3YA 3Q89A 5F9LA 1VRTA 2BX6A 5LL6d 2MZSA 2DNMA 3L95X 1HLWA 3R1LA 4WFYA 5L9XA 5FJ4A 2GW8A 2ZH5A 1ZAWA 2QX0A 1E6VB 1NSPA 2H5JB 5F8IA 4IG3A 1X4BA 5K8NA 3CCZA 2GAHC 2XYHB 1U2RA 4ED7A 2W2OP 4KQZA 2R4FA 1AW0A 3L7UA 3VQSA 4KT0C 3P6YC 3RRHA 2HHTA 2QV6A 2LP4A 4TYAA 3JB9k 2FVSA 2QZ8A 3J7ZT 1J5EF 1HHSA 3FSYA 4JOUA 5HAOA 1W25A 3KK1A 4RW8B 5CYJA 2EK1A 3JSMB 4JV0A 2BKOA 3PW7A 2FZKB 2B3TB 2W1BA 1F5AA 3EXCX 4CZCA 1R89A 5A0YB 1MW7A 3M32B 4DV7J 1B0PA 1V3RA 4OZ3A 1SKSA 5GAEU 2AJQA 4FPIA 2VL1A 3KK2A 2A2CA 1Q8LA 3KHLA 2GGPB 4P75A 3RR7A 2ILYA 3R7SB 1KD1T 2IY5B 4U8YA 3GJQB 3R2DJ 3PYFA 4G1QB 3TA2A 2OPSA 2KHDA 4DR3J 4PUOA 2KKHA 3EVMA 1S76D 1HYSA 6FD1A 1FHTA 1SKWA 4E2FB 1HNXJ 2PO4A 1N4LA 1UVJA 3QJLA 2XO7A 5ETPA 1LFPA 4NRUA 2XY6A 3T5HA 5A8WA 1UFLA 1AFIA 1B3TA 1ZA1B 3MAAB 5HATA 4WKYA 3AD7C 2WTFA 4NLSA 4DU7A 5AE2A 3UD4P 2RAQA 2LEPA 2H1YA 1DTQB 2RVJA 4JP8A 1FKPB 1HBNB 4IRCA 3PJWA 4EFAC 3MTKA 4PWDA 3LWLA 4U96A 5HSPA 4AYBD 1R8CA 3EVWA 1WOOA 1SJQA 4ID8A 4PAAA 2B9YA 1DRZA 2VG5A 1UA1A 1VQ4S 2JEJA 5ETOA 3OR1B 2XO6A 2XZWA 2BEFA 4ZVPB 5KFTA 4WK1A 5KT3A 3SZ2A 3ET6B 1QE1B 1S12A 2AJ2A 3HCXA 5F3ZA 3AOAA 1U4BA 1XN9A 5KT4A 3F73A 5L46A 1NAQA 2KHCA 4GC6A 4RJVA 2ZJRQ 3DFEA 3ISND 4YB6A 2DR8A 2K1RA 3GV8B 3M9OB 2QMUB 2D3UA 4B3OA 4Y00A 2XI2A 3K7RA 2AYGA 1Z2ZA 4PG5A 3P4UB 1NMEB 2UV8G 2VG6A 5H9FJ 1SPBP 4N7TA 4DV7F 3MEDB 4IR9A 1MU2A 4HR2A 1VQNS 2L08A 2FJVA 3D3BJ 1GQEA 2DIUA 3DLKA 1H6KX 1KC8T 2VODA 3C3LA 2MQMA 5FD1A 4EMDA 2RUGA 1UPPA 3ZNUA 2WONB 2WRMA 4WE1A 1A0OB 1WC3A 3CJ5A 3F0NA 4DR3F 3H59A 1O0PA 2WOMA 4ZOSA 3E01B 3MUVP 4IQMA 4WU3A 1FVQA 4DUZJ 1Y5IB 1R7IA 2DY1A 1AZSB 5E2QA 3HFKA 3SEOA 1RTDB 2AF6A 1G7CB 1S4FA 5ETQA 3M9MB 2DNKA 3OUYB 2W7OA 1MROA 2JRSA 3TW0A 5B7WA 4ZPBA 4ZP9A 4WZQA 1U2CA 2YQ0A 3M05A 1YKWA 1VRTB 2FB0A 5IM0B 1Q8IA 4OJHA 4ERDA 2WCXA 3NGSA 3NCRA 2ASJA 3MMBA 4C9DA 1TL4A 3SCIE 2GZOA 4F7VA 4DOZA 4DPTA 3MR5A 1T05A 4CO0A 4ECWA 5AJ3J 2CPDA 1KHWA 4KGKA 1FE4A 3DKDA 3HKWA 1S49A 1U0HB 3PCOB 2K8GA 2JOQA 3VAFA 2HIYA 1VQ7S 3NG8A 2RS2A 4Y0FA 1BE4A 1XMOJ 2E5HA 1RTIA 1TMJA 2WVBA 1M0SA 3H5UA 1UP1A 3IWXA 2CJBA 5I3QA 3PVXA 2WVEA 1UCNA 2ZBCA 1EKSA 2VFSA 1NK9A 4AFFA 2I2YA 3CGIA 2R8HA 3NAIA 5C25A 5A8RA 3KK1B 3W8PA 4EBCA 1GMWA 2G0CA 3THTA 1T9YA 4I0WA 1NB2A 3D9BA 2ZVSA 3L7OA 1G6BA 3OD2A 3H2LA 3O44A 3LA0A 4NLXA 4U95A 3J7Z5 3N5BA 2XS5A 4ZN1A 2RU9A 2HBRB 3AA8A 5KG5A 3M9NB 4A8XA 3DLEB 2D74B 4O4GA 1S7IA 2RQ4A 5C42A 3R9LA 3E8OA 5HMWA 3BSAA 3PW0A 3N79A 4J5OA 3OPKA 4RUBA 2ASLA 1KVIA 1SBRA 5SUHA 3FCVA 1VC0A 3U27A 3C6UA 1Y3JA 3VHQA 2OPSB 2N3LA 2XB2D 2IA6A 2PFFB 1T3OA 3NNCA 2CPJA 4PUOB 1SCJB 2BZ2A 1YJWS 3IG1A 4FDFA 3ZTRA 2V4QA 4WFAQ 4IYQA 3ZNJ1 4WKRA 2VBWA 2V4RA 1B7FA 1U8WA 4KAIA 1U48A 4K8RA 1T9VA 1X4DA 2HFSA 3DHWC 4USWA 4MK8A 4NYPA 5I3UB 2J8AA 4FBTA 4J9SA 3VAKA 3NL0A 1CS4A 3NRBA 3IWLA 4PWDB 3VVTA 4LF6J 4ETZA 2LECA 3EUNA 2UVVA 3EXYA 5DDPC 2W8LA 3BQ0A 2DNQA 3OL6A 3IXQA 3KLVA 4OYAA 5AJ3F 2D3O1 3ZZTA 2VG5B 2Y8YA 4NLYA 2HKEA 4C11B 1T11A 2YKPA 2IA0A 1ULRA 1XMOF 2JC0A 3SCJE 3CF5Q 5C2GA 3LP2B 3M2RB 3DHXA 4CNZA 4I6WA 4R0JA 1MN7A 3CJRA 2EC2A 1N54B 4NCGA 2RB7A 1D3WA 2YH1A 3MMCA 2IVYA 4HTJA 3IO1A 4DS4A 1TUWA 3R2CJ 6AT1B 1KRPA 3HSGA 3LF0A 1D9FA 5GMDA 2XWYA 3HZEA 2E7XA 2VG6B 1FXRA 1U25A 3MM5A 3VAIA 2RQKA 3KUEA 1MU2B 3J7YI 1X7VA 1OYEA 4PZVA 3KLEA 1R8BA 2H5IB 3A8JA 4TVAB 4TU8A 2XYGB 2N7CA 4OHVA 2KVQE 4WE1B 3A4TA 1MLAA 4LBPA 5A76A 4U67Q 3TARA 5DM7Q 3CJSA 4J9MA 1WKKA 2NYHA 1R0CB 2J76E 1OPIA 5BYSA 3H0PA 1IXKA 3AQPA 1X5SA 3M4XA 3D4JA 4DPUA 3LP0A 2RQMA 2R7XA 2P9EA 3G6VA 2V2ZA 2Z2LA 4P74A 5DGBA 3DLJA 1NBEB 1OSDA 1RAGB 1S1WA 3AB2B 1YI2S 2XSJB 4LSNA 4NE9C 1BQMA 4WU2A 1ZS6A 4KPYA 3L7PA 4ZVHA 2AV5A 3TZYA 4YB1P 2VDIA 3K2YA 1JXEA 1T05B 4LF6F 3W9JA 1WEYA 4DWIA 1VHIA 1UJ4A 2Z58B 3MEGB 4EK2A 3JTPA 3TUIC 1MWYA 3DC2A 2HMIA 4CLYA 1V6HA 2VDHA 5LM7E 5GAHI 3UDEA 4ZJLA 4WFBQ 2YPYA 4DFKA 1RBLA 1YHQS 2XMKA 3DI6B 1Y5LB 1S6OA 1RKIA 5DQHA 1TR0A 2PMHA 1KBRA 3WIVA 2R2RA 3ELHA 2HQ3A 4IFYA 3BBCA 4F25A 4V19J 4J37A 1HBOA 3GPAA 4P9SA 1IKVB 2LCWA 2A1BA 3HHEA 2V5HG 5C25B 5A8RB 2V2VA 4ECYA 4DX8H 2RHSB 3NS7B 2LDYA 4HI2A 3UDLA 3UVJB 2CJ9A 4LIRA 1E6YB 1NK7A 3FDSA 4DQQA 4Y65A 4X2BA 1HPZA 2DCUB 1NH8A 2DT9A 2ROPA 1T9XA 2M4MA 1VQMS 4F50A 2F9JA 2GVZA 2V6AA 2J7WA 5H1SV 2DYAA 2C2KB 2A18A 3C16A 4XO0A 1WF1A 1RYRA 2GO8A 4JI4J 5E3QA 4O44A 3IR7B 1P8GA 3IG1B 3VVUA 4F4KA 4X4SA 1NLKL 1BXNA 2R8GA 4AQYJ 3N6NA 3U1NA 2EBEA 4P2MA 2BJ7A 2BQ3A 4F4AA 4LFAJ 1VIXA 2B7CB 1LOUA 1RGVA 2A2DA 1TQLA 3AQOA 2B4OA 3DRYA 1WG1A 2DHXA 3AD8C 2MY7A 1G1XA 4FKXA 1HBUA 4OI1A 4K4YA 4ZHRA 2J9EA 1EP4A 5D4PA 4CLKA 1QUPA 3ZTPA 3AOCA 4RW6A 3CC4S 2NUHA 3M6UA 5DJBA 4A48A 3HHKA 4CYUA 4QWEA 3NCPA 3ADAC 4U6PA 1C0UA 1IWAA 4QR2A 4P10A 3PW2A 5L1IA 4C6AA 5SZTA 2D69A 5ETRA 3S01A 3UNGC 4AE5A 5AT1B 2FUG9 2FPHX 4C3LA 4I2PA 5C24B 2RDJA 1IR0A 4CLSA 4Z37A 1VRQC 3L3CA 3D6HB 1X0PA 2E1PA 3MM6B 3GTYX 2D1CA 2P5VA 1WOPA 5B09A 2M8HA 4O0NA 2HLTA 2HHPA 2NSBA 1LXNA 3TOQA 4CO1A 2HWHA 3PHTA 4KPCA 1M1KT 1S9FA 1ELOA 1RT7A 3K5MA 3A3OB 2HURA 2KVIA 4ELVA 2DISA 1RKJA 4LSLA 4LFCJ 3DNCA 2CNKB 1M5HA 3VGSA 3W9IA 3MM5B 5KFBA 1SH0A 1LK7A 4WIIA 2B9XA 4BDPA 2M3DA 1LQ9A 5HBMA 1NRKA 1NHUA 4GO7X 4JI8F 3TVKA 4QYZK 1JLBA 3KLEB 1WHXA 1OY9A 4WFXA 1FRIA 1NKEA 2JJ4D 2PE8A 4ECQA 2JLEA 4NX9A 3W63A 3ZFVA 4RW4A 2QLFB 5LSLA 2IBOA 1V3ZA 2HRTA 3K8VA 4JI4F 1NKCA 2IVMA 3POTA 4QWDA 4PG6A 3UE2A 2VJUA 5ETNA 2QFIA 2R7SA 1CJTA 3CMAS 1S57A 4X4OA 1N34J 3US5A 1S1WB 3LPYA 4KSEB 4LFAF 1X4EA 4OZNA 5DDRC 3J7YU 1WC5A 2Y0BB 3FRZA 1BQMB 5F0UA 2GAGC 3Q22A 1RHMB 1F9HA 2CQHA 2MGZB 5CQGA 4CLFA 2CUYA 4DEZA 1I51B 3O5TB 2UVWA 1JLEA 3OJSA 2MQNA 2JLFA 4HHHA 4FPRA 4H4OA 2LU1A 2VKZG 3KLGB 2DPIA 1HQUA 3B8HA 3PHEA 2VFRA 5RUBA 2HMIB 1X31C 3DDKA 3HZGA 1PC4A 2ZZTA 3PX0A 2BM1A 1XR7A 3W62A 4YP3A 2AGOA 4U9RA 2B8PA 4FXDA 4RKUC 2AJ1A 2FZCB 1NSQA 4UT4A 3MECB 4LMZA 4I2QB 2YBVA 1HKAA 3H98A 3C15A 2GVDB 4UOGA 2NXJA 3WC0A 3MM7A 3KLFA 3MCMA 1LXJA 2I1RA 5HMXA 2HVDA 1ZAVA 1QDUB 4PYDA 1KWMA 3IAS9 4LFCF 1QTMA 5KFVA 3PDNA 1YZ7A 3MMJA 1FE0A 1ZM3A 1CJUA 1U2FA 3MI7X 2B8QA 4NYOA 3NBPB 1G3OA 2DGOA 4NLDA 3T1HJ 2FVPA 4DQIA 3A8EA 2OPPA 1J5OB 2ALYB 4F36A 2COLA 4MYUA 2FY8A 4PXDA 5D3GA 4O44B 4MKAA 5GAGU 4OZJA 2OKQA 2GQCA 3AA9A 5LSOA 1KQKA 4PG8A 3QT5A 4QU6A 2HS3A 3RU0A 1RAHB 4GKJJ 3V4MA 1D1UA 2G13A 1N34F 2B56A 3OL9A 3K89A 4QIGA 5D15A 4K4VA 3RYLA 4C7QA 3GR1A 1FTRA 3V4IB 1HBUB 2HNZB 5DO2A 4ZHRB 2ADBA 3UNYA 3PJXA 5CXTA 5KT6A 3THVA 3QT8A 1EP4B 4NZ7A 2MKJA 2B4PA 2UUBF 3M2VA 5ETSA 5D6GA 2WSCC 1FFGB 3BKUA 2Q66A 1X9WA 1PJ5A 1W2IA 2QC3A 1JQGA 1I5OB 2FLPA 5KAKA 1IR2A 1JMTA 5IWAJ 2BE9B 1CJKA 2FJDB 5M2UA 5J2PB 2YNHA 3UFCX 3CJKA 2DHSA 3WX8A 3WIUA 2MJNA 2HLUA 2DGXA 2Q6BA 4RNHA 4I2PB 1RXOB 2MB0B 3I0SA 3HKZD 2VB6A 2XLKA 1TU0B 3OR2A 2HPUA 2NYIA 1UA0A 1YBTA 1HL6A 5A6PA 3KKFA 1H3DA 4QWAA 1WEZA 1QSLA 2XMUA 3AOBA 1RT7B 1FJCA 1EZZB 1WACA 1UVNA 3C6TB 2X1BA 2EXUA 2LYVA 1KTVA 1RT4A 1HHTP 1LW2A 2ZKTA 4CM0A 3VF0B 2MQPA 1DZ5A 2QTWA 3FMWA 4LSLB 4ID5A 3G87A 3QFWA 1S1TB 4GVBB 3TAMA 1B4SA 3MPUB 3GFZA 2FVCA 3FRYA 1NJIT 3G82A 2HNYA 3HF5A 2QMXA 1IKXA 1CEZA 2YXLA 3S8SA 4CO5A 2MQ8A 4ZLPA 1HBMB 4N8NA 2BYCA 5KG1A 3BBBA 2FJEB 2LQBA 1HIYA 4NLRA 3M30A 2R8IA 2JEIA 1X60A 2U2FA 4I1TA 1RHUB 3MGJA 4YOEA 3M8RA 2FJWA 4FYXB 4UF4A 4OYZA 2QA4G 1L5UA 4KHMA 2IRUA 1NCLA 2XG8A 4KKOB 4H54A 4OYXA 1WI6A 1YITS 1DQ8A 3DGVA 1HD1A 3T1AA 3T5KA 5DQIA 2GFFA 4KBIA 3T9NA 4DDFA 1JLAA 1YGYA 3MM8A 4UY8T 1AUSL 3PXGa 5B0FA 1BHNA 1UMJA 2E5LJ 2UVUA 2XNQA 4CT9A 4DL5A 2UUTA 2D9OA 4FVCA 3I0RB 1NEEA 3V81B 2V2QA 3CNQP 5IWAF 5J2QA 2IC3A 1VJQA 4NLWA 3AJ2A 2X3DA 4LFBJ 1NPPA 3HVWA 3B54A 3DU5A 2F8HA 2MXYA 3W2VA 4OZLA 1RBOB 3LP1A 4JYAJ 3ZZPA 4JI2J 1TK0A 4AL6A 4I67A 4WK3A 5L1JA 1VBZA 5FIIA 4Q5VA 2VA3A 5IS2A 1RT5B 1T03A 4QQBA 3P3DA 5HQLA 3E51A 4IUFA 1U02A 3TVZA 3MM7B 3KLFB 3Q0AA 3FFIA 3HVAA 5J2MA 1FNOA 1YRTA 4FNIA 3GYGA 4UQTA 4X4QA 4ECUA 2Q79A 4M5DA 4TU7A 2HFNA 4WYLA 1RHQB 3JQKA 3RB3A 2G2OA 4HEA9 1CJVA 5E41A 4YR2A 1IBKF 3IM9A 1L3VA 4C2MA 4DFPA 2OSQA 3AH6A 2O3DA 2CYYA 1F2GA 2XS2A 1N52B 3HD2A 5BYQA 5D3GB 1CC7A 4TQSA 1JK9B 3OBIA 3HHLA 4J9VA 1GXUA 3FJ2A 2CNOB 3A1YG 4L6V3 1FT8A 2LDIA 2HW3A 4QYZJ 2DNLA 4EO6A 3W5XA 3LWMA 2D3OR 2V9WA 1R3NA 2OGUA 1SQFA 1KLNA 2UP1A 2MMYA 3GU0A 2W9BA 4CO2A 4LR9A 2UU9F 3TWZA 1HNZF 3FQKA 2DH9A 2FD2A 3TVYA 3GIIA 2DTJA 1SH2A 1XMQJ 3SSRA 3O1LA 3H5XA 2R9LA 3Q8UA 4WIQA 3M2VB 3LW5C 2YKMA 1TL3A 2YNFA 4MIBA 3GV5B 4DCJB 2GJIA 1S59A 4A47A 3M8PA 1S6PB 1GNKA 2CKWA 3LAKA 3FBFA 4ES3A 1CJKB 1ZZFA 3R7BB 1MN9A 1VHFA 1EQ0A 5MAOA 4DUYJ 2E7WA 3N4WA 2C3MA 3UN2A 4UUWA 1NJYA 4B9MA 4LFBF 4TQRA 2XM3A 3MPWA 2PT0A 3GG1A 2P9GA 4R0EA 5DS7A 1FJGJ 3I0SB 1QVGR 4JYAF 2EKNA 3H4BA 3TJ9A 3BBFA 4JI2F 4ZA1A 3TAPA 5DDQC 2Y3YA 3HXMA 4UUXA 3M1VA 4CO4A 4F02A 2LMIA 1CULB 3AXMA 3NXZA 5J1EB 2YNIA 3UN3A 4MFBB 4LBHA 4IR1A 4ZPWR 1NM2A 3PZPA 1JNRB 3NOGA 3BSCA 2BMBA 5J2NB 2XMTA 3D54A 1HI0P 1U26A 2J9DE 2GMHA 3W2WB 4IG0B 2CWKA 1AXQA 4ZLLA 1X4AA 3CEDA 5HL7Q 1N32J 4YHHJ 2C42A 5ETVA 4JV5F 5KFLA 3JYTB 3KNGA 2HNYB 2DRBA 4NMLA 5F0WA 1ZM2A 3MAQA 2XMWA 3QAEA 1ZM4A 3D5MA 3PM9A 2AW0A 2EI5A 4Q0BA 2MQQA 4OHZA 5L39A 1TKZA 2YWHA 2HHXA 3HFVA 2ZH8A 3KJVA 4JI3J 2QA1A 3B6BA 1BY9A 4MAKA 2JL9A 3U1MA 1HWKA 4OV1A 1SC1B 3CC2S 1TK8A 3O8WA 4LF4F 1QAXA 3QIPB 3MM9A 5HQMA 1Q78A 2FGCA 4FYVB 3GB0A 2I8EA 1QAYA 2VG7B 4A4JA 4DUTA 4W98A 1M1GA 4F3OA 1BWVA 1JLAB 3EZ5A 4MK9A 3ISZA 1LWCA 2HIQA 1R0BG 3MM8B 5F8JA 4I56A 1GTHA 2V8VA 5G4DA 4ZDNA 3AXKA 4P2FA 3JSRA 5AXKA 4YY3J 2BV3A 2B6AA 1O8BA 5T7LA 4OIXA 1VQ5S 1S79A 2BJ9A 4P72A 3D67A 5IOLA 2PFDA 4TY8A 4F2SA 3RUBL 4WXOA 3GJRB 3ISNC 2BJ3A 3N6MA 4EYIB 4DUYF 2CA9A 3EX7B 5KG7A 1IJEB 3SIPB 2DY9A 1OWXA 1LV5A 2QA4S 2B43A 1KFSA 1MMLA 3FGVA 2C3UA 3H8YA 2RD5C 1YVFA 2HZVA 4XIUA 3F41A 4RW9A 2ZD1A 4ZITA 1FVSA 2YX7A 3GLJA 4XTTA 4OI3A 4RL1A 4BBYA 2BDPA 3P49B 3KUHA 4OZ2A 4TLRA 2KYXA 3RJMB 3IGNA 1N32F 4YHHF 2E5GA 2CQDA 3FMBA 1UEUA 3GWCA 4A8KA 4QWCA 4BC9A 3W9HA 3CO9A 1P1LA 1JKHB 3MDFA 1MSWD 1GMWD 4UW2A 5HVGA 3W5YA 2H54B 3QRPA 3HHLB 2RT3A 2CQ1A 1YJVA 2CQ2A 5D4OA 4K50A 4JI3F 3K5PA 5K14A 2BR0A 2GQQA 4A46A 2GNKA 1S1XA 3OFEA 3P5TL 3GYXB 1YBUA 2DNHA 2J0XA 3Q86A 3ILLA 4ZCIA 1BMQB 3CDUA 4C0OC 2BANB 1KKHA 1X4CA 4HDHA 3DGPA 4LF9J 1GX6A 4Y3CA 2JEGA 2OFHX 1EJ7L 1Y5NB 3HPOA 2XEXA 1NK6A 1REVA 2E7VA 4K2XA 5LMUF 2VPZB 1SQEA 2YKMB 2F5GA 2ATCB 3QSYB 1WC6A 2CZ9A 4YY3F 3M8PB 1JNZB 3B4DA 2N7YA 3ZXWA 3QNWB 4OYWA 4ZPCA 3BGLA 3CVKA 3PR4A 3H2VE 2RF2A 1X5PA 3Q8SB 1RTJA 1M5SA 2I5JB 3DOMB 4D3HA 3CWJA 3L4BC 4XPCA 4DV3J 2ATLA 1RJJA 2CQPA 2BE2A 4N76A 4KYZA 2HG4A 3I31A 2QSFA 1ZTWA 3CJ8A 4ZJOA 1ACMB 2UUWA 2YNIB 3P45B 1X0FA 1TV6A 4F3QA 5E5NA 1S6QA 3HI9A 1LEOA 5CZVA 3IS9B 2VC1A 1F2HA 2OFGX 1H72C 4KGXB 1YJRA 4F67A 4ZPVR 2YKNB 3BO3A 3NAHA 2AJ0A 5LSRA 4DV4J 2HGLA 2XWXA 1HWJA 3MPDA 1UEKA 5IQ6A 2K06A 3ILOA 2CPYA 1U45A 3R97A 2VHGA 1HWLA 4B17A 4QW8A 5CAAA 4LRBA 2H51B 3W7BA 1TKZB 1U7LA 3KJVB 2Z2MA 2IRYA 2KTQA 4OYMA 2IYGA 1C4AA 2CQ4A 5KTQA 2RQCA 3HULA 3KK3A 2QL9B 2C1EB 3QO9A 4DL3A 1S9GA 3ZZRA 4X65J 3PYDA 2VF3A 3IRWP 2HZCA 1FDNA 5E3CA 5HVFA 2OMLA 4ZVTB 1YWXA 5D0GA 1P27B 3DLHA 1X4HA 4DCPB 1Y3KA 3H5YA 5DLFA 2EK6A 2ZJPQ 3KDOA 1H2TZ 1FWLA 4P52A 4OZ1A 1L3UA 5DRKA 5J1PA 1LWCB 4FKYA 3GP9A 3T41A 4IOAQ 4CLWA 5T7LB 3TNVA 3GCWP 2ZITA 2J0SD 4PQUA 4HT5A 3BGRB 2BKPA 2NCKL 1CC8A 1S1UA 1VGYA 2VPWB 3PEHA 5A6WA 3SSSA 5DDOC 1NNDA 3EPIA 2W9CB 2V8HA 2KG0A 5KT5A 4CRJA 1PSDA 1TL7B 1MWZA 3SSQA 1Y0HA 1YIJS 4Q44A 2E1AA 3OL8A 4CLTA 3LGNA 1FNMA 4DR7J 2AQ4A 5F8LA 4OI0A 1JLGA 1YJ9S 2CWXA 4Q2LA 7FD1A 4O3NA 3R7NB 2FGOA 3DMJA 1QVFR 4RW9B 5GMEA 1BD6A 3W8GA 3CUNA 2XNRA 3PTWA 2W01A 5KFPA 1B70B 4EEYA 2VBXA 4URQU 4KGZB 1RWPB 4DR6J 3IMQJ 1JX4A 5I3PA 1UETA 3TX0A 3BF4A 3K59A 4AUKA 4OX9J 3ZO7A 4O4RA 3UR3C 2VQFF 4DV4F 4XAKA 4OZ5A 2IHR1 3HJVA 3RRGA 2HAIA 2OAUA 1N0UA 2KN4A 2ALZA 1HFEL 4DPXA 4GKKJ 4CLUA 3M8QB 4KHPJ 5LOQA 1ICEB 4C4WA 3KYLA 3L09A 1K9MT 3AT1B 4NRTA 4DV6J 2YQ3A 5KFYA 3ILJA 1R43A 1LW0B 5LXRA 1YQHA 2FHJA 2IMWP 4X65F 2AJ4A 1S1XB 1TMMA 3RTVA 2QE5A 1T7PA 1RYSA 3D0HE 1GMVA 2DHHA 4MKBA 4B9TA 2XLJA 4MIWA 4RX6A 4LF5F 2DNZA 2H3EB 3NLCA 3DGPB 3B78A 4I6YA 4QBUA 1RWNB 4ENOA 3K5LA 3BGOP 3FZBA 1REVB 5FDLB 1TUGB 1WHYA 4KIAA 3EZOA 4ZCMA 4JI6J 3U02A 2AEJA 3CMQA 2LEAA 1FRMA 2LKZA 1HI1A 1S0VA 3GJSB 3VZHA 3TJ8A 1V5VA 3OSPA 5CD4H 4J91A 1RTJB 1HNIA 4NASA 2AT1B 4M8LA 1WSVA 3FSXA 2DXFA 1K1SA 4B3RJ 2IJFA 1JIHA 1RCOB 3UWTA 1WKJA 2D41A 3AJ1A 3TEGA 2VONA 2PI4A 1FXLA 1JWWA 2HBZB 2GHWA 4DR7F 1RACB 5KG6A 3V6HA 2L48A 5AXNA 4HH1A 4IO9Q 1RA7A 2JDJA 1U1QA 3MEEA 4ZPTR 1FO1A 4J7CA 4FS1A 3Q23A 3KJQB 1XC9A 2GX8A 4J9NA 2BBEA 2OIHA 2WVFA 4NYZA 4DR6F 1H2VZ 4IFVA 3SQGA 1S9EB 2G0IA 4OX9F 4DX5A 2DVIA 5HI7A 3PR5B 4W4MA 1EETA 4USKA 3SDEA 3RW7A 4GKKF 4KFBA 3W65A 2NS1B 4KHPF 3A13A 4PQAA 4LIWA 4DV6F 1CVJA 2BW2A 3G71S 1VLOA 2GHVC 3QO9B 5ITHA 4YR3A 5KFMA 1N36J 2H4WB 4ZVSB 3BS9A 3D0IE 4OJ3A 1Q0NA 4X66J 5B0CA 4RUAA 3EGZA 3CO0P 4ZVQB 4KO0A 2I9SA 2AJFE 1H74A 3TJAA 2ZM6J 2QLWA 2KT3A 1RT3A 3CW2C 2OPQB 3KLIA 1Q16B 4YEAA 3H40A 1AT1B 4USJC 5L1KA 3M2UA 3LOUA 2LQ9A 3FCHA 3P5BP 3V6DA 4KV8B 4IOCQ 1F5BA 4JI6F 3RAQA 1EB0A 1U1PA 4G65A 3CCJS 1NK5A 4ZJQA 4HACA 2V63A 4U7UD 2BXJA 4FS2A 2L41A 4K2JA 4FF2A 2AMCB 3H5SA 4U7CA 1KEKA 5LJ3Y 3J81U 3LH2S 3VQTA 3FBBA 2OJ3A 2CRLA 2QMWA 3HX9A 1RZMA 1JLCA 5E7OB 1RT1A 4B3RF 2VFUA 4DPWA 4DG1A 3SYZA 3HSDA 1JLGB 3BGUA 2ZJQQ 4NCAA 3G4SS 4GVLA 1KONA 3JSBA 4E98A 2R2TA 1RB0A 3C14A 4I69A 2ZNYA 4CH0S 5DQGA 2DR9A 2QJ3A 5D4NA 2W25A 4PRFA 4FF4A 3GYNA 2IPOB 1X4GA 4C8NA 2KZZA 2K7KA 4ZVGA 2ZFHA 1LWFA 5G0RB 1JLQB 3TZWA 4FXVA 2DGWA 3ICLA 1F6TA 1IVZA 4H4MA 3BB5A 4CTAA 1N6QA 4FYWB 5EX0A 2HAFA 1U1MA 4X84A 2LXIA 1S1VA 2W2QP 5CHCB 3TQ1A 1B64A 3QQCD 4RZRA 4H4KC 4ECXA 2HFUA 3C46A 3BEGB 4ANDA 5M2RA 4ELTA 3PEJA 5LMNJ 1FRKA 3MD3A 3TZZA 4F0MA 4TY9A 5F8HA 2F8MA 4Z7YA 3GJTB 3FQLA 2CDRB 3OXGA 3PG9A 1N36F 2F3JA 1W2BR 1VK8A 3U1LA 5GADI 4X66F 4W92B 2JX2A 1GAOA 2JHEA 5KOXA 2DD8S 4HVZA 4UZCA 4DHVA 1SXLA 3R5BA 3TQEA 1DTTA 4R25A 5KFUA 2AKWB 2RRNA 1JJ2R 1KOOA 2CQBA 3RBXA 5KFRA 2CXEA 4TNOA 2O5DA 1TVRA 1FJ7A 2G1DA 2EC0A 4URGA 1WTBA 5AXMA 1UZDA 3CCQS 2LU2A 1WD6A 1N5SA 4OX8A 3ITHB 1DARA 3K17A 1HNIB 5CCLA 1RWMB 3CE8A 4PKDB 2ASYA 3BREA 3OLAA 3W60A 3VAGA 3CCLS 3FSIA 1PIEA 3JAMY 4V1Ak 5B0GA 4Z7CA 1CG2A 3G6YA 4LF1A 1RLDA 4EGLA 5HP1A 1VFJA 1YLXA 2NQPA 4ED3A 3PW4A 3MR2A 2L3MA 2W24A 1GXTA 2DO0A 3D68A 3J81Y 3BM7A 2Z2YB 4Q7AA 4CNYA 3Q2TC 4IH5A 2NXEA 1UZHA 2XCPA 1LWEB 4DSFA 3UCUP 3VCDA 2BQRA 4ELUA 3HHDA 2PEBA 3O2IA 1VQOS 1R8AA 2DEIA 1RAAB 3JXOA 2DNPA 2HGNA 3SDEB 4K7QA 4KFBB 1ROFA 2M5YA 2M88A 1F60B 1VQ6S 1PBUA 1RABB 3MXHP 2QRRA 3DRRA 5KFHA 1G4CA 2P6SA 4LQ9A 4PXCA 5CA5A 1T0TV 4PG4A 4YDDB 1RTHA 3MMAA 4OV6A 4ALZA 4J9RA 2F7VA 3FUYA 4KO0B 4NEZA 4OZ0A 2KXHA 4DV0J 3NWRA 2R7RA 4KGMA 4UTGA 2QYGA 3AFGA 1TK5A 3DM2B 2QGFB 2HVZA 5IQQA 2HQDA 4Q45A 3CCMS 4X4UA 1K0VA 1EKRA 2E5IA 5D8HB 3CD5A 2RKIB 2NR0A 1RT2A 4DPYA 5MLCV 2PC6A 4YB5A 2E44A 1U1NA 2KM8B 1QUVA 1D0EA 3W61A 1NHVA 3UDVA 3MOJB 1Y11A 1HNXF 2BRKA 1JLCB 1RT1B 4C8KA 3EDRB 1WKLA 5I42A 2J6UA 1DJ0A 4A8SA 3V6JA 4DG1B 2ZE2B 3V6KA 1K8AT 1H2UX 3ENVA 2ZOMA 4QU7A 1UWBA 4GMKA 1WHVA 1NDKA 1T3NA 1H0HB 2IYIA 4O3QA 3IM8A 1TP7A 3GSDA 2AD9A 1Q7LB 4K4XA 1RTZA 4ZVUB 1FDDA 3BKTA 4IG3B 1VMBA 5KG3A 3PX6A 1H7WA 4CLZA 4ECZA 5KFZA 1LWFB 5ADZA 3LAMA 3G8SA 1VRUA 5K20B 1S1VB 4B3SJ 1UL3A 3JQJA 1M5KC 5EUHA 4PABA 1QSYA 3RAMA 3SFGA 1UPMB 5KOWA 2B4VA 3M8YA 2G0JA 3ZZOA 1JLFA 1KVJA 5D4LA 4C97A 3I55S 1WSRA 4JV1A 2WBMA 2Q1LA 4LREA 3G6ES 1WELA 2RH3A 2BABA 2RRBA 3Q24A 2HHVA 4IQXA 1KQGB 2C28A 2M52A 1KSPA 2KM8C 5LT5A 4ES2A 5JJBA 3X3UA 2ZBPA 3UW1A 2DB1A 4C3KA 4N41A 4ZVRB 2VASA 2L9DA 2ACMA 4DV0F 3MPVA 2M7SA 3EPGA 1S72S 3KK2B 1FF2A 3RB6A 3IA0A 2ZH9A 4HLBA 4IKAA 5CYQA 3ONQA 3MCOA 1U1LA 2OEKA 3T3FA 4EZ9A 4A8QA 2CNNB 1YTYA 2XC9A 1PAEX 1VQYA 3HHLD 1H38A 3TUZC 2EFGA 2FJBB 4FF3A 4CM2A 1TTHB 1RT6A 1HYSB 1M1HA 3FEZA 5IV3A 2K3IA 1IKYA 5HROA 3W66A 1QLNA 3M8ZA 2V34A 5GADU 3J7AN 4DUZF 2WAQD 5A8WB 3B4MA 1IKWA 4I7FA 2X1GA 1U1OA 3BN4A 4DN0A 1YK9A 1HQEA 4RW7A 2RS8A 2RNEA 1FJEB 2IAJA 2DPJA 1HQ2A 1D9AA 5D0RA 5HK4A 1HA1A 1Q5VA 4B08A 1SV5A 2H5EA 2ZC4A 4ATNA 1FERA 2YPZA 3I87A 2KJWA 1VOMA 5KFGA 2NZCA 2FYXA 4NZ6A 5D77A 1JXVA 3S6EA 2AYMA 4UOHA 3ZTQA 1FEHA 2XY7A 3KHHA 2MZJA 2J7KA 1ZH5A 2N3OA 4JV2A 1FXDA 1QJHA 2EW9A 3G8QA 3BH6B 4DR4J 2Z0GA 4J9KA 4DSIA 2ZZMA 2UVRA 1K73T 3K0JA 4QZVB 3QIDA 2K1RB 4BCAA 3P8BB 4OHWA 1RTHB 3MMAB 2Y9HA 4B3OB 1NDLA 2ZH7A 1C0TA 4NI2A 2IDEA 2E5JA 3PIPQ 1DHMA 1K0TA 1FCAA 3QMQA 4HH0A 3T6JA 4ECTA 2EBGA 3NCQA 4X64J 4UZBA 4QJVA 2YX4A 1NZAA 2HBYB 1Y00A 3CPWR 4NLOA 2QLXA 2GV1A 2CQIA 5B0EA 3W1YC 3DLKB 3FKBA 4NLTA 1HWIA 2PSZA 2DGTA 1UW9A 5AXLA 2KG1A 1KR4A 2SXLA 1XNQJ 4OYOA 1RT2B 1LK5A 2IDLA 4TU9A 4I6AA 2HK3A 2ZC3A 1DFDA 2J5AA 2LXFA 4QPXA 1SB6A 3TYTA 2WOMB 2G9OA 2ASDA 3QPIA 2MDAA 1S0OA 2MQOA 4UQGA 1FD2A 5GVQA 2LFVA 3OQ2A 2UXDJ 1PKUA 1DURA 1PBAA 3J7A1 1SL1A 2VU5A 1UWBB 4A8OA 2A6OA 2HS0A 2XMJA 3A12A 3J81j 2Q6CA 1MROB 4EUVA 2POKA 1W7WA 2HHHJ 1BGXT 1NSAA 1YSJA 3MMBB 3D1OA 4K59A 3W64A 4P71A 4NWBA 2LVWA 1T9UA 4RW8A 1IJFB 3OHBA 3JSMA 4RUHA 5U47A 2OP5A 2DO4A 4LF7J 4WF9Q 1CBKA 5A0YA 4FBUA 3NNHA 1VRUB 2AIRB 2BVZA 1RTIB 2W7PA 5BXIA 4DJBA 4DLEA 5T41A 4IRKA 5FLXU 1D9DA 2FC8A 1GEHA 3WBZA 3PIOQ 2F4VJ 1FDBA 3EVOA 4ZLNA 1AA1B 1SKRA 2GGPA 4FNHA 1P1TA 1N5VA 4ZN3A 4DV2J 4F3MA 1FA0A 3OJUA 5IT0A 5GAGI 4G1QA 2OH2A 4KRWA 2ZOGA 1Q8BA 2F4FA 5ETKA 2AYBA 1Y10A 3SCKE 1XNRJ 3KLHA 4FXWA 1R6VA 2FJAB 1RU2A 4B3MJ 1XR6A 3BDEA 1JJCB 2KT5A 1IN0A 3LALA 1FRJA 4L3KA 2B51A 1SJ3P 3CJQA 3UN5A 1RA6A 1Z2LA 4X64F 3A3PB 3OFFA 4O4GB 4DSEA 2DRDA 5C42B 4Q8FA 1O6XA 2PN6A 3OTEA 4MIAA 5L9NA 4K4TA 2MZRA 3CCRS 4B3TJ 1DTQA 1AUDA 2MJUA 1FKPA 3C6UB 2KI2A 8AT1B 2Q43A 1GFWB 2ZBQA 3OL7A 1N0VC 4OJ1A 4M95A 3SQOP 1PGZA 2GIRA 4ECVA 4ED1A 4M5NA 2MHEA 2MY8A 4MJKA 2HHQA 3UDCA 4O3PA 1DQAA 3CJ3A 3OR1A 1IKWB 4I7FB 2QG9B 3Q8YA 4DL6A 3W5ZA 3NWGA 4ITSA 4RW7B 5KT7A 2C2ZB 3RAXA 1SQGA 1QE1A 1KHVA 4UOFA 2IAJB 3OFHA 2N4DA 1D09B 2HHHF 5L38A 1CS4B 3A3NB 3RBDA 4J9UE 4JI1J 4BC7A 3BQ1A 4PCQA 1NHKL 3NMAA 2XMMA 3NOCA 2E9RX 3MR6A 4DQRA 1S0MA 5E3AA 2CJAA 4WJBA 4DL7A 4E0DA 4NXMJ 1TKTA 3QZ8A 1TAUA 1S7HA 3L9ZA 2WVCA 4X4TA 5IV4A 1V3SA 4N47A 1Q79A 2KRRA 2UZAA 3MUTP 1VQSA 2F4VF 2Y8WA 3UD5A 3B82A 3R5CA 2EG1A 3KHGA 4M5GA 2YY3A 2HQGA 3HVTA 3PRVA 4FYDA 4NCGB 4R5PA 2V94A 2QLBB 5EN1A 3K5OA 3NNAA 4WWSA 4DV2F 3MMCB 2CDQA 3GIRA 2WONA 3S7RA 3T6BA 2ZZNA 2JSXA 3JTNA 3OVSA 3H90A 2IM1A 1C0TB 3G8TA 4JBCA 5FLXY 1XNRF 4NI2B 2V0NA 3CMES 2YKAA 3VTIA 4EWTA 4DZDA 4C3MA 1AZSA 3FC9A 4FF1A 2EVZA 1RTDA 1VDHA 4URSA 4OL8A 1J27A 1VBYA 2QSWA 3CD6S 2EFOA 1I3OB 2IBKA 2CG8A 4Y34A 2OD6A 5DETA 4KGVB 2AGQA 4A8MP 5KFDA 5IM0A 1FK9A 4QOTA 3VGTA 5F41A 4B3TF 2PGCA 2F40A 4DF8A 1SJ1A 3LGHA 2AWZA 1TL1A 2Y1LB 4F8RA 3QYYA 1SC4B 3IFEA 4ED6A 3HT3A 4DX7A 2C2OB 1U0HA 1VR6A 1FD8A 3TA0A 5F9NA 1H98A 4AQYF 4G1PA 2KO1A 3Q8VA 3LP0B 1U49A 3BPSP 1OPZA 3KDNA
chains in the Genus database with same CATH topology
2C2KB 2P2CB 2HBZB 2HBRB 2H51B 4ZVQB 2CJYB 4ZVOB 2H5IB 2XYGB 3D6FB 4DCJB 3P4UB 1NMEB 5K20B 3KJFB 2DKOB 3D6HB 2QL9B 2C1EB 3GJRB 2C2ZB 1RHQB 2H4YB 1RWVB 2H54B 4JB8B 2XZDB 3R7NB 3R6LB 2QL7B 2H65B 3R7BB 1RWWB 4DCOB 2FQQB 3EDQB 3KJQB 2Y0BB 3R6GB 4ZVTB 3SIPB 1RWNB 1RHMB 2XZTB 2CNLB 1RWKB 1QDUB 4DCPB 2C2MB 1RHKB 3EDRB 2CJXB 3P45B 1I51B 1I3OB 3NS7B 1RWOB 1RWMB 1IBCB 1SC1B 3R7SB 1RHJB 1QTNB 2H5JB 1F9EB 4LSZB 4ZVPB 1RWPB 2QLJB 2QL5B 2CNKB 1PYOB 5IC6B 1BMQB 3GJQB 2CNOB 2XYPB 3IBCB 2XYHB 2HBYB 3GJSB 1RHUB 1RHRB 3D6MB 2Y1LB 4ZVRB 3GJTB 1SC4B 2CDRB 2HBQB 1RE1B 3KJNB 2H48B 1PAUB 1SC3B 2C2OB 1GFWB 2QLFB 1ICEB 3RJMB 5IC4B 3IBFB 3R5JB 2H4WB 1RWXB 4ZVUB 3QNWB 2CNNB 2QLBB 4ZVSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2K B;  2P2C B;  2HBZ B;  2HBR B;  2H51 B;  4ZVQ B;  2CJY B;  4ZVO B;  2H5I B;  2XYG B;  3D6F B;  4DCJ B;  3P4U B;  1NME B;  5K20 B;  3KJF B;  2DKO B;  3D6H B;  2QL9 B;  2C1E B;  3GJR B;  2C2Z B;  1RHQ B;  2H4Y B;  1RWV B;  2H54 B;  4JB8 B;  2XZD B;  3R7N B;  3R6L B;  2QL7 B;  2H65 B;  3R7B B;  1RWW B;  4DCO B;  2FQQ B;  3EDQ B;  3KJQ B;  2Y0B B;  3R6G B;  4ZVT B;  3SIP B;  1RWN B;  1RHM B;  2XZT B;  2CNL B;  1RWK B;  1QDU B;  4DCP B;  2C2M B;  1RHK B;  3EDR B;  2CJX B;  3P45 B;  1I51 B;  1I3O B;  3NS7 B;  1RWO B;  1RWM B;  1IBC B;  1SC1 B;  3R7S B;  1RHJ B;  1QTN B;  2H5J B;  1F9E B;  4LSZ B;  4ZVP B;  1RWP B;  2QLJ B;  2QL5 B;  2CNK B;  1PYO B;  5IC6 B;  1BMQ B;  3GJQ B;  2CNO B;  2XYP B;  3IBC B;  2XYH B;  2HBY B;  3GJS B;  1RHU B;  1RHR B;  3D6M B;  2Y1L B;  4ZVR B;  3GJT B;  1SC4 B;  2CDR B;  2HBQ B;  1RE1 B;  3KJN B;  2H48 B;  1PAU B;  1SC3 B;  2C2O B;  1GFW B;  2QLF B;  1ICE B;  3RJM B;  5IC4 B;  3IBF B;  3R5J B;  2H4W B;  1RWX B;  4ZVU B;  3QNW B;  2CNN B;  2QLB B;  4ZVS B; 
#chains in the Genus database with same CATH topology
 1WF2 A;  1VBX A;  1PYT A;  4LSN B;  4F4Z A;  3I9Z A;  2KFZ A;  1UJ6 A;  2MHN A;  3HMJ G;  3ZTS A;  4F04 B;  2M8D B;  3AAW B;  2XUL A;  3KJF B;  4B9N A;  1GK8 A;  4QIE A;  1RLC L;  3D7S B;  1K44 A;  4CCH A;  2HFZ A;  5F8M A;  3OW2 R;  2RUS A;  3FEX B;  4P2X A;  4JI1 F;  1ZZN A;  4O23 A;  1M90 T;  4FYY B;  3D2W A;  2VKR A;  1WI8 A;  3HM9 A;  2UXB J;  1NXI A;  5CYM A;  3HT0 A;  4DQS A;  2C2D A;  3U7J A;  4CH1 A;  1PCA A;  2VUG A;  1P9Y A;  1KN6 A;  4NXM F;  5DLG A;  1C2P A;  1RIS A;  4DR5 J;  4YR0 A;  4IFY B;  3DLE A;  4KH1 B;  4NCB A;  2O01 C;  3KUG A;  1FKA F;  1HBO B;  3T5J A;  1X5O A;  3DDI A;  3NEK A;  1BUX A;  3N28 A;  1RDR A;  4RNF A;  4ILM A;  2R2S A;  4WFZ A;  3LAN A;  9RUB A;  5DM6 Q;  1M5P C;  2MLY A;  5BYR A;  4FP9 A;  4DU8 A;  2W8K A;  3I32 A;  3KLH B;  4NLG A;  2CIM A;  1APS A;  4WP8 A;  4PR6 A;  3MAH A;  2B9E A;  2FLO A;  5I4M A;  4AXJ A;  1IUJ A;  1HPZ B;  3O3L A;  1FDA A;  2IFX A;  1SH3 A;  2Z57 B;  3BPD A;  2OTJ S;  2GVZ B;  2VIH A;  5I3U A;  2GJF A;  2E1R A;  1WF0 A;  2A10 A;  3HJF A;  2YNG A;  4TXS A;  3C16 B;  5KG2 A;  3WX4 A;  2B0G A;  2PMZ D;  2FHJ D;  1BQN A;  1RUS A;  1YX2 A;  1RHJ B;  3V2U C;  2HZA A;  2MEW A;  1Y4Z B;  1JJH A;  4ED5 A;  2QA2 A;  5IC6 B;  3CUL A;  1U1R A;  5E0O A;  2DGS A;  5D78 A;  2M0G B;  4C11 A;  1U6F A;  2CVI A;  4C8Y A;  1WDD A;  2GML A;  1FRL A;  4TKT A;  1F3V A;  2DXD A;  4Y2K A;  1O51 A;  4DV1 J;  2GHP A;  2RIJ A;  3BGF A;  3DDN A;  4B02 A;  3CJT A;  3LP2 A;  2ZH1 A;  3M2R A;  3BYR A;  3T1Y J;  3KG4 A;  4JI0 J;  4HTI A;  3TR5 A;  2BUN A;  4X4V A;  3IC1 A;  2L9W A;  4WFN Q;  2ZWP A;  4RW6 B;  2X51 A;  1AFJ A;  3H42 A;  2BJ8 A;  4C8L A;  1PC5 A;  4C0H A;  3QGH A;  4BHQ A;  2BAC A;  3QRQ A;  4CYU B;  2H65 B;  4USU A;  2UXB F;  3BO4 A;  5HAN A;  2PA8 D;  1C0U B;  2QO3 A;  2XMV A;  1TKT B;  1KQF B;  4JI7 J;  2DEJ A;  4CDI A;  2KJV A;  1RHK B;  1RK8 A;  3GZ7 A;  3PKY A;  2VPX B;  4DR5 F;  4ED0 A;  5EWG A;  3BSN A;  4KHR A;  2Z2Z A;  3HVT B;  2GO9 A;  1HNW J;  4OHX A;  4R5P B;  3RR8 A;  2VOP A;  2YWK A;  4MH8 A;  5HLF A;  2JFK A;  5L8R C;  2NPF A;  4C8O A;  1U1K A;  4Y2C A;  3N5F A;  2EFQ A;  3AY0 A;  2HSE B;  1PAU B;  1SC3 B;  3UI3 A;  3TP2 A;  4N8O A;  5E3R A;  4ZLJ A;  3EWG A;  1BC6 A;  2CPH A;  4RWW A;  3EZU A;  1H7X A;  3OTB A;  3FEY B;  3DLB A;  2W2M P;  4W90 B;  3N0V A;  4C98 A;  5HBM B;  2G2Z A;  1JLB B;  2YQ1 A;  1TZ0 A;  2XSJ A;  5LXY A;  1L3K A;  3T1H F;  1FK9 B;  2C22 A;  3MCS A;  4RW4 B;  1YRU A;  3RG6 A;  3DLG A;  1UAW A;  2HWT A;  1H73 A;  4J9O A;  1TL1 B;  3POT B;  4RU9 A;  1LWX A;  2O1P A;  2JEF A;  2RSQ A;  4J9Q A;  2CPZ A;  1IBC B;  3MEG A;  3NGU A;  3CDB A;  1UJ5 A;  1CJT B;  3E2E A;  6FDR A;  4M5H A;  4GKJ F;  3OXF A;  3UD3 P;  2FLN A;  3DI6 A;  3EM1 A;  2VZ9 A;  1SC6 A;  4ZPA A;  1NDP A;  3CDA A;  4DV1 F;  4M94 A;  1FTC A;  4EI2 A;  1CLF A;  2FVR A;  4RUC A;  3T1Y F;  1OIA A;  3RB4 A;  1IKV A;  2HND A;  4JI0 F;  5IC4 B;  1JLE B;  4GRS A;  3MFI A;  2VD3 A;  3NGT A;  4H4O B;  2CZ4 A;  2B4U A;  2MKC A;  4YB7 A;  1HQU B;  1QAI A;  5CYM B;  3UVJ A;  1F9F A;  5KFC A;  2IM3 A;  3ETM A;  1E6Y A;  4DF4 A;  3I82 A;  1X9M A;  2DH8 A;  4LT6 A;  1U24 A;  4JI7 F;  4HKQ A;  2GCF A;  2G4B A;  3K8W A;  3GON A;  2YKO A;  3AHP A;  4DLG A;  1FRH A;  1NH7 A;  1ZPW X;  1UVL A;  3NGR A;  4OJG A;  4TN2 A;  4FN5 A;  2MTL A;  2BJD A;  1UEV A;  2DK2 A;  2RE1 A;  2W7A A;  1HNW F;  2MLX A;  2GS8 A;  4OX6 A;  2BJE A;  4LSZ B;  3OTC A;  3R27 A;  4XDC A;  3C15 B;  1Q1K A;  2DXE A;  2P6T A;  4DQP A;  3IR5 B;  1T02 A;  4QWB A;  1S48 A;  2C3O A;  4OMF G;  2E9T A;  3MHY A;  2WW8 A;  1RE1 B;  4O3O A;  1S6U A;  4X4R A;  2YWG A;  4C8M A;  1HNV A;  3GR0 A;  1RAJ A;  3DCA A;  2DHA A;  3TI0 A;  4UOC A;  3GFX A;  1CJU B;  1K1Q A;  5KFF A;  5EHH A;  3D1H A;  3CJ0 A;  3QT7 A;  3CIZ A;  2FHM A;  1Q81 T;  2YNG B;  2XQC A;  2OPP B;  4Y2I A;  2FZG B;  4M5J A;  7AT1 B;  4DL0 C;  3LGM A;  3IGV A;  4QYR A;  4DX6 A;  1BQN B;  3PJ9 A;  3RBZ A;  1NB7 A;  5AE3 A;  2KT2 A;  1BQX A;  1T8E A;  2MZ1 A;  3AJD A;  4KR0 B;  1VC5 A;  2X3G A;  1WC4 A;  2ZKU A;  4ER8 A;  2HVH A;  1QY7 A;  2IM0 A;  4MKV A;  4WPA A;  2QLJ B;  2WB4 A;  4L74 A;  4PXB A;  3CD7 A;  4CT8 A;  3DOL A;  5C24 A;  3SXL A;  1R27 B;  2H9Z A;  4PPZ A;  2CPX A;  3MM6 A;  3GG0 A;  1M5O C;  3GIK A;  4RR5 A;  4DSJ A;  1WG5 A;  1ZPV A;  2E5L F;  2IM2 A;  1NO8 A;  1OYD A;  2HK2 A;  1F3F A;  1RWX B;  4IOB A;  2B9W A;  1WC1 A;  3D28 A;  2J6T A;  1ARO P;  3SI8 A;  4XPE A;  3GSI A;  2OPR A;  2YNH B;  3CJK B;  3CIM A;  3M7V A;  2C3P A;  1N56 A;  4NMX A;  2H4Y B;  3R6L B;  2VPY B;  3OR2 B;  2DH7 A;  4Y6I A;  3MUM P;  2CAJ A;  3DXB A;  5HLF B;  3QWP A;  3JQM A;  1T9T A;  2L9N A;  2QEX S;  2LQ5 A;  4YQW A;  4WZM A;  3MUR P;  2IJR A;  1KP6 A;  1U6Z A;  2MKK A;  4CLL A;  1Q86 T;  2HS4 A;  2Y1J A;  5E3P A;  4AT1 B;  1RT4 B;  1LW2 B;  1RCX B;  2PII A;  4ED2 A;  4ID5 B;  4OI6 A;  4EU0 A;  4NA2 A;  1HW8 A;  4JUZ A;  3TAM B;  4ZP8 A;  4G1I A;  2PA3 A;  2MKY A;  3G82 B;  3QLH A;  1IKX B;  1NDC A;  2CVE A;  2NXN A;  5K8P A;  1PO6 A;  5F8N A;  2MGZ A;  5IT9 U;  2PI5 A;  1DLO A;  3DLG B;  1HI8 A;  8ATC B;  4KE5 A;  2XTJ P;  4YN3 B;  3M30 B;  3D6F B;  1FRX A;  1ZET A;  4DR1 J;  3KLG A;  3M8S A;  4OLP A;  2ZH2 A;  4HDG A;  3AOD A;  1RWW B;  2CPF A;  3D66 A;  3QGG A;  2MPU A;  1RQ0 A;  1I1G A;  4WBF A;  4CI0 B;  2EG2 A;  4MMO A;  3MF5 A;  2XGP A;  3TZX A;  2Z30 B;  3BO2 A;  1VQ8 S;  2FDN A;  4HI1 A;  2HND B;  1PYO B;  1XMQ F;  4QR0 A;  1MMD A;  3SCL E;  2BKN A;  3MEC A;  4I2Q A;  4DFJ A;  3TUJ C;  1RHR B;  4Y2M A;  3D6M B;  1B7Y B;  2GVD A;  3KHR A;  3OHA A;  3C2P A;  5A2Q U;  3K58 A;  2FTR A;  4RBV A;  1S99 A;  1VQK S;  4B9S A;  1RP5 A;  2VIC A;  5J2Q B;  2N4C A;  2IC3 B;  4ED8 A;  1FKO A;  1TKX A;  3VAL A;  2XMA A;  4UY8 5;  5B0B A;  1KTQ A;  3W2V B;  1XK8 A;  4JI8 J;  3LP1 B;  1RAI B;  1RAD B;  1UVM A;  2C2N A;  1OS5 A;  1FJG F;  2V67 A;  4Q8E A;  4KB7 A;  3NBP A;  4TLQ A;  3VZI A;  1IBM J;  3RW6 A;  2AEM A;  1J5O A;  1SVD A;  1T03 B;  3KTQ A;  1NPR A;  1HWU A;  4LUB A;  2YKQ A;  2GIQ A;  3PY8 A;  5KFS A;  1OJ4 A;  2DRA A;  1FX2 A;  2KRB A;  2OEM A;  3FFI B;  2JVR A;  1SUQ A;  5J2M B;  1SKU B;  2YWW A;  3VGU A;  3FBC A;  1REG X;  1HNV B;  4M5D B;  2F65 A;  1MMN A;  2R7O A;  2C2R A;  1LNQ A;  2JWN A;  3Q8Q B;  4P7V A;  2HQC A;  5K8O A;  2WHO A;  3OV7 A;  3CSK A;  2MQL A;  2ROE A;  1CJV B;  2VBZ A;  3SV4 A;  4QW9 A;  2ZDO A;  5C5J A;  1U8S A;  3RGI A;  3NGD A;  2RU3 A;  2PEH A;  2MZT A;  3V4I A;  4P7T A;  1UFW A;  3IP0 A;  4PG7 A;  2HNZ A;  1R31 A;  4CH7 A;  2DR7 A;  2UUC J;  4NLQ A;  1V5I B;  1NJX A;  4OHY A;  1R8P A;  2CQG A;  4DR1 F;  2LEB A;  4HYK A;  2BOP A;  2ZHA A;  4DPO A;  3OSN A;  5J2P A;  1U6B A;  4NL5 A;  1RWV B;  4DR2 J;  1YDL A;  5IT9 Y;  2HVE A;  2W9B B;  3FBE A;  2FQQ B;  4L73 A;  4OQJ A;  1U09 A;  1KNZ A;  3DOL B;  1OY8 A;  4NA1 A;  4LRD A;  4CO3 A;  4ICL A;  4U8V A;  1CPZ A;  3HD1 A;  2UUA J;  2DNR A;  1VK3 A;  1TL3 B;  2YNF B;  5KFA A;  1F9E B;  2CZV C;  4LJM A;  3C8Y A;  3CCE S;  3I96 A;  4DZ6 A;  3NS6 A;  3TAQ A;  1IQZ A;  2HHW A;  1RAO A;  4G6V B;  5D0H A;  3C6T A;  2W2P P;  5ETL A;  1WOR A;  2OPR B;  1VI7 A;  1WC0 A;  3QGI A;  2ERR A;  4KTQ A;  1YJN S;  1P9Q C;  1R8H A;  4PXE A;  2J0Q D;  1S1T A;  3A8I A;  4P2S A;  4WTY A;  2EWH A;  2ZEJ A;  1URR A;  4GVB A;  1EIY B;  1NZ8 A;  5THW A;  2VC0 A;  4C48 A;  4NXN J;  3MD1 A;  2G1H A;  3RBE A;  4Z2X A;  4NZ0 A;  2ZUA A;  5A2Q Y;  1IBM F;  3V5R A;  3M1V B;  4OLO A;  2W9A A;  1HBM A;  1YRX A;  1T94 A;  1GT8 A;  3QZ7 A;  3DLL Q;  1VIS A;  3I4H X;  4DL2 A;  3HHL C;  2FHK A;  2Z4P A;  3WDO A;  1S10 A;  2ROG A;  1N8R T;  2DJW A;  1OQ6 A;  2Z56 B;  2JZ5 A;  2EFN A;  2EPI A;  4KKO A;  1MG7 A;  2VA2 A;  2MKS A;  4ILL A;  5HMZ A;  1QTN B;  1WHW A;  3VGV A;  3VWS A;  5CH7 B;  3QLH B;  2QL5 B;  2B7B B;  3ZZU A;  4QIF A;  3BJY A;  3QT6 A;  2HFO A;  1DLO B;  3LO3 A;  1IM6 A;  2UUB J;  4LQ3 A;  4Q0B B;  3PFE A;  3G2X A;  2NRE A;  3T9Z A;  1NSK L;  2UUC F;  4ECS A;  1Q4R A;  3MOZ A;  3WZ0 A;  2WB1 D;  2QFJ A;  1R6Y A;  4PWU A;  3G86 A;  2J9C A;  3X1L B;  3N9U C;  1N5T A;  5C7P A;  3I0R A;  2HHU A;  3PO4 A;  2RDI A;  3V81 A;  3MM9 B;  5DZ6 A;  5JVH Q;  4JI5 J;  4O3S A;  5HQ8 A;  2ZBR A;  4DR2 F;  5A8K A;  1X4F A;  1VQL S;  3ETO A;  1HD0 A;  3R5A A;  1QM9 A;  2YWF A;  2B5J A;  4QPT A;  5KFJ A;  4LF9 F;  4MYT A;  2F9D A;  4AL7 A;  4B9L A;  2UUA F;  1GX5 A;  2M9K A;  1RT5 A;  4Q43 A;  3PO5 A;  2R42 A;  3P96 A;  1EX8 A;  2W4C A;  1NK0 A;  2AZ3 A;  2B6A B;  2CJX B;  4X62 J;  3PRB A;  1Q95 G;  3HK2 A;  1IM4 A;  3OTO J;  4TY8 B;  1D8Y A;  4P73 A;  1N5Y A;  1DY3 A;  1WUU A;  1FKO B;  1TKX B;  2OTL S;  5GAH U;  3OT9 A;  4LVO P;  4DV3 F;  4HT7 A;  3DU6 A;  2DNN A;  2ZHB A;  4NXN F;  2PMW A;  3BYP A;  2DGU A;  2V8P A;  4WXW A;  3Q83 A;  2WW4 A;  1IQT A;  1S5Z A;  4I4B A;  3I4P A;  4RPF A;  3FK4 A;  2ZD1 B;  2X7I A;  3BDP A;  5K5M A;  3AB4 B;  3UPF A;  2ZH6 A;  3RZA A;  1LKZ A;  1SUQ B;  1N5Q A;  3R8Y A;  4J90 A;  2HFV A;  2OHD A;  5IT4 A;  2QL7 B;  2NPI A;  3QSI A;  4NPO A;  3OFG A;  3EMT A;  4LR7 A;  1T9W A;  5EWF A;  2KFN A;  3RB0 A;  1FWK A;  3HVR A;  3IRX A;  4YUD A;  1FES A;  2JFD A;  3BKF A;  3EYZ A;  1XBW A;  1EQM A;  1U47 A;  2YVS A;  2AGP A;  2V2K A;  2DBB A;  1K47 A;  3ILI A;  5EDW A;  5CZX A;  5K14 B;  4DS5 A;  1CSJ A;  1S6P A;  2I0X A;  3OLB A;  3CJ2 A;  1L3S A;  4XDD A;  1ZYQ A;  1RSC A;  2MLZ A;  1Y7P A;  3IBF B;  5DG7 A;  1SI9 A;  2FLL A;  3AD9 C;  3LPE A;  4JI5 F;  3MEK A;  3QRR A;  3FVY A;  3CCV S;  1YJ7 A;  3RRK A;  2D9P A;  2XLI A;  3NMR A;  4LBI A;  4X4P A;  2CJQ A;  3PAC A;  2UXC J;  3H4D A;  4ICL B;  1FI4 A;  2ILZ A;  1VJW A;  3UCZ P;  2R2U A;  4ZPD A;  1CUL A;  2CQ3 A;  1OO0 B;  5J1E A;  2ZBI A;  1BLU A;  4C0B A;  4MFB A;  3TRG A;  4GC7 A;  3IWN C;  4X62 F;  3O6Q A;  2XGQ A;  1AYE A;  3OTO F;  3HSJ A;  5J2N A;  2VFV A;  2RF2 B;  1XWL A;  3M6X A;  3W2W A;  4IG0 A;  3ENA A;  2FJX A;  3MPY A;  3HSZ A;  3HO1 A;  5HN0 A;  2BE2 B;  3JYT A;  4K5R A;  1IBK J;  3N01 A;  3SMZ A;  9ATC B;  3HLU A;  3ULH A;  3EIC A;  4C8Z A;  3CCT A;  1TL5 A;  4KH0 B;  4QCL A;  2JVO A;  3CDE A;  2PD1 A;  3DOK A;  2VOO A;  3BR9 A;  1TV6 B;  2P2C B;  3R5G A;  5KFK A;  1OMS A;  1S6Q B;  2ZDP A;  3NP5 A;  3DRS A;  3F44 A;  4J9L A;  2V8G A;  2F63 A;  4FVM A;  3Q2S C;  3QIP A;  2CJK A;  5EGY A;  2XY5 A;  4ES1 A;  2OEL A;  2UU9 J;  4LF8 J;  1HNZ J;  3CD0 A;  4F0H A;  1ZBT A;  2VG7 A;  2WSE C;  2UV8 A;  3EGW B;  4HHJ A;  2WVD A;  1IR1 A;  2DGV A;  3GMG A;  2HQF A;  2XZT B;  2KXF A;  2ZUG A;  1WOS A;  2VH7 A;  1GMU A;  3ZZZ A;  1GXL A;  1T95 A;  1XMB A;  3KMS A;  4AL5 A;  3KK3 B;  1S9G B;  1S97 A;  2X1A A;  3Q8P B;  4ZCL A;  4M1K A;  2IRX A;  2RJZ A;  4K4S A;  4F2R A;  4FZV A;  5KFW A;  3DYA A;  2APO A;  4DN9 A;  3W3S A;  2QYC A;  3JTO A;  3I5C A;  3KJN B;  3TO8 A;  1NKB A;  5A8K B;  5B0D A;  2MST A;  1VS3 A;  2B5J B;  3LUY A;  2HRU A;  1HR0 J;  2UXC F;  1TKD A;  5D0E A;  4IH6 A;  2YWE A;  2G2Y A;  3R3T A;  4A8W A;  3JAM U;  2BE7 D;  4R8U A;  4DBQ A;  3EJM A;  1VBK A;  1XTZ A;  3R5D A;  2M2B A;  4IH7 A;  5K9F A;  4PQU B;  3K5N A;  2CPE A;  4YFU A;  4K4W A;  4NEY A;  4CQ1 A;  1SL0 A;  2XS7 A;  2K2P A;  3ZZ0 A;  4ZKA A;  2MKI A;  4M5I A;  1N5Y B;  1S1U B;  3TA1 A;  3R6G B;  4IO1 A;  1FFS B;  4JV5 J;  4OI2 A;  1XEZ A;  3D3C J;  3M6V A;  3DRX A;  1RU1 A;  4BWJ A;  3QAT A;  2DNG A;  1SJF A;  4RBT A;  2HHS A;  1Q82 T;  3NKY A;  1G2E A;  3I5A A;  2V50 A;  2EEY A;  3BV8 A;  3BZQ A;  4AD6 A;  1JKH A;  2IMO A;  3DMJ B;  2V4J A;  4L76 A;  2CQC A;  3KNA A;  1SIZ A;  2K7J A;  1F5C A;  4ZVE A;  5ETM A;  2NSC A;  1KS2 A;  3GCX P;  2F1F A;  4LF4 J;  3TEH B;  3PFO A;  4NLP A;  3PYG A;  2K3K A;  4F26 A;  4U7U K;  1C4C A;  2FHO B;  1IBL J;  3PRD A;  3D0G E;  2W4P A;  4Y2A A;  1VQ9 S;  3IRX B;  2Q3P A;  4LF8 F;  1X9S A;  1B99 A;  2P8I A;  2BAN A;  2ZHO A;  2RDD A;  4M63 A;  4DCO B;  1PJ6 A;  3ENW A;  1YZ6 A;  1FWP A;  5KFE A;  4USM A;  3BSO A;  2J0W A;  3DXS X;  4S0M A;  3QFH A;  4PEO A;  1W26 A;  1JXL A;  4DXL A;  1OQ3 A;  3BR8 A;  3CJ4 A;  2C2E A;  1SJ4 P;  4Y28 C;  4ANC A;  2I38 A;  2VJV A;  1WDT A;  2GA7 A;  1XIQ A;  4K5S A;  4MK7 A;  2IVF B;  4NA3 A;  3WC2 A;  1MNE A;  3OVB A;  3WQP A;  1PG5 B;  1UFK A;  5EX3 A;  2I5J A;  3DOM A;  1KFD A;  1D8Z A;  4F4W A;  2QIF A;  5F3T A;  3HHN B;  2ZM6 F;  1DAX A;  2Z8Q A;  2E29 A;  1HAR A;  2R8K A;  3ZZY A;  3BN7 A;  4ZIV A;  2F8E X;  8RUC A;  2E66 A;  2OMO A;  1HR0 F;  1B0T A;  2JNJ A;  2DR6 A;  1SL2 A;  1B0V A;  3HFZ B;  2Y1I A;  3NY0 A;  4K4U A;  4ECR A;  5KFX A;  3GV7 B;  4RNM A;  2DHG A;  1SJR A;  5IZH A;  3MTJ A;  1KLM A;  1C1B A;  3TX8 A;  4ZP7 A;  4USV A;  2U1A A;  3IS9 A;  2XZD B;  4ZVF A;  1FFW B;  4RO0 A;  1DQ9 A;  2DGQ A;  3IR6 B;  2YKN A;  1VYA A;  2KFY A;  5KFQ A;  3GE9 A;  2WZ1 A;  4L3N A;  2HEK A;  1YJT A;  1CQM A;  2R8J A;  3DOK B;  4MT1 A;  3VAJ A;  3MEE B;  3EGN A;  4DV5 J;  2MKH A;  1I6J A;  3DRS B;  4L75 A;  2J6S A;  1V9O A;  3SFU A;  1HHQ A;  2OUG A;  4J9P A;  4IFV B;  2NUU G;  1IBL F;  2CFX A;  3SQG B;  4LRA A;  4EZ6 A;  3G6X A;  3N6L A;  4BWM A;  1FX4 A;  3F56 A;  4ZVO B;  1WG4 A;  1EET B;  4LF2 A;  5LMU J;  4OI4 A;  1TFW A;  2KXN B;  2GIF A;  1UVI A;  2HYI B;  2KZM A;  2GQ2 A;  5DG9 A;  1TAQ A;  2HRY A;  5LMN F;  1X5T A;  2OI2 A;  3CT9 A;  3BGR A;  5HVH A;  2OSR A;  3DYA B;  3JSY A;  2HVI A;  2OEJ A;  4OX7 A;  1LFW A;  1Z1Z A;  3SV3 A;  2W9C A;  1RT3 B;  4DSK A;  1QD1 A;  3KLI B;  1TL7 A;  4USH A;  1WTF A;  4O0I A;  1L3T A;  3M2U B;  3CCU S;  4A8Y A;  3V6D B;  5B0A A;  5JUM A;  2ACY A;  4R8U B;  4EBD A;  5H9E K;  1R0A A;  3NGK A;  4OFZ A;  3QAU A;  1RAE B;  3MR7 A;  2OO4 A;  4HAC B;  3QWU A;  3GIL A;  2V69 A;  3I5B A;  3H2U B;  5F8G A;  2BRL A;  3FCW A;  2DIV A;  1VQP S;  2IJN A;  2IIH A;  5GMK a;  3IN5 A;  1JB0 C;  1IWG A;  2DKO B;  1VIO A;  4WYW A;  3CDW A;  4P6Q A;  2DNY A;  4ZK7 M;  3ZTO A;  3I56 S;  4M5K A;  2LLZ A;  3BH7 B;  3THP A;  4MKY A;  2E1M C;  5C2C A;  1P6T A;  2RHQ B;  2W4D A;  1WWH A;  2QT7 A;  1OY6 A;  3GQC A;  1RWK B;  2V4J B;  4DL4 A;  3M8Q A;  4ZCK A;  2AP6 A;  2HGM A;  2WSF C;  5DGA A;  1NJZ A;  2CG4 A;  3C14 B;  3KOA A;  3PYE A;  2OLW A;  1KVK A;  3PW5 A;  1PJ7 A;  1UVK A;  1Q7Y T;  3VR1 A;  3CTR A;  4DV5 F;  1LW0 A;  2J7U A;  2BQU A;  4RBU A;  1F1B B;  2KDO A;  1XJW B;  4MTP A;  1TUV A;  3PV8 A;  1NK8 A;  4RNN A;  3EGV A;  4ED4 A;  1YG0 A;  1N33 J;  4H4M B;  4CTA B;  1N6Q B;  5J1N A;  3JS9 A;  4BLG A;  2XSF A;  2Y1R I;  1NUE A;  4N77 A;  5DG8 A;  2RRA A;  5FDL A;  2AU0 A;  2ABY A;  5JMN A;  4CP5 A;  1EAR A;  1ZM9 A;  2A0F B;  2AHO B;  5K8M A;  5HJX A;  4CLP A;  5ETT A;  2FVQ A;  4RNO A;  4HHU A;  2GMJ A;  2R7W A;  3NS5 A;  2FIU A;  2MSS A;  2BM0 A;  2V8D A;  1Y9O A;  3GFH A;  3MCN A;  1DTT B;  2FY1 A;  2ZVI A;  3PKM A;  2A6M A;  2J8S A;  3CCW A;  3SBM A;  3H20 A;  3MR3 A;  3CCS S;  1AB8 A;  5CCM A;  1TVR B;  3OXL A;  4N56 A;  2H48 B;  2YH0 A;  1KLM B;  3TAN A;  1C1B B;  4IDK A;  3CXC R;  4F4X A;  3R5J B;  3QJJ A;  4UST A;  3UQS A;  4QIW D;  1UKU A;  2DCL A;  4OYB A;  3KXD A;  5KFO A;  2VQF J;  7FDR A;  2DR5 A;  1EHW A;  1S9E A;  5HP1 B;  4E8U A;  2AX0 A;  1NPK A;  2KL8 A;  3HP6 A;  2VQE J;  1I94 J;  1C1C A;  4DI6 A;  4K0K J;  1U0S A;  2ZWO A;  3IBW A;  4XK8 C;  2ZH3 A;  5E33 A;  2CNL B;  2EKY A;  1Z4U A;  3ENQ A;  2M70 A;  1PIL A;  5IFM A;  2RIL A;  4QIV A;  1NJW A;  3Q8R B;  4LF5 J;  4KY3 A;  2E9Z A;  4LR8 A;  3LTO A;  3QGP A;  4KJI A;  2R7U A;  1N33 F;  3ZC4 A;  2VV5 A;  3UO0 A;  2KH9 A;  2OPQ A;  3VV2 B;  5JVG Q;  4B3S F;  4USI A;  5L1L A;  1VC6 A;  3PNI A;  4H4K A;  2A3J A;  2LQ8 A;  4KV8 A;  4YME A;  4ZP6 A;  1RAF B;  4ETX A;  2JC1 A;  2ADC A;  3DRR B;  1HMV A;  4L72 B;  5LJ5 Y;  1S4E A;  4BS2 A;  3DRP A;  2BW7 A;  4NLV A;  4RLE A;  1RI7 A;  4PPD A;  4I64 A;  2OD4 A;  1YJU A;  3GIJ A;  4JB8 B;  4QR1 A;  2NXC A;  1OSC A;  1J2V A;  4WCE Q;  3C66 A;  2RML A;  4CIO A;  2XHC A;  3UR0 A;  4EBE A;  1VCT A;  3HDS A;  1ZOT A;  2C2M B;  3G96 A;  3T19 A;  2LXU A;  5BJR A;  1F0X A;  4AXI A;  5KG4 A;  3WHI A;  1R0A B;  1A7G E;  5KFI A;  2XBP A;  1GH8 A;  4V19 X;  4YDX A;  3KWM A;  3I9V 9;  4DFM A;  2HWI A;  3PX4 A;  4RU2 A;  3OVA A;  2CQ0 A;  1N88 A;  5HJY A;  4ZIW A;  4WP9 A;  2LA6 A;  2R7T A;  1E6V A;  5KG0 A;  4HL9 A;  2I6W A;  2KB2 A;  3MWB A;  2ZOF A;  5HO4 A;  2QN6 B;  3MZI A;  5I42 B;  1FEE A;  2BJ1 A;  5G0R A;  1JLQ A;  1URN A;  5GAE I;  2D7S A;  2XI3 A;  2R7Q A;  1ZTT A;  3D1Q A;  1XER A;  2AYE A;  3FNN A;  2BOA A;  2VBY A;  3C19 A;  2VQE F;  4M5M A;  2ZH4 A;  1I94 F;  4K0K F;  5IXU A;  5H9F K;  1QAJ A;  4M5L A;  1NU4 A;  4OYI A;  2YTC A;  1CQN A;  4TYB A;  1Q8K A;  5CAB A;  3OTD A;  2XHW A;  4PWW A;  2EFV A;  5KT2 A;  5KFN A;  2HQI A;  4NLU A;  2P9C A;  3M32 A;  1HW9 A;  1XQI A;  2W2N P;  1KQS R;  4ILR A;  1BWE A;  5JXS A;  4ZMM A;  3BQ2 A;  4X4N A;  3EE3 A;  2ZNZ A;  2GJ2 A;  2V68 A;  1YBA A;  4DSL A;  1Q5Y A;  4G3I A;  4Q2M A;  4D3G A;  2HBQ B;  4B9V A;  1JLF B;  3QBC A;  3J80 U;  4DR4 F;  4KC5 A;  2O67 A;  1ITP A;  3H25 A;  1A9N B;  3I6P A;  2LQJ A;  3R1H A;  4WTO B;  1PYS B;  2DNO A;  3ITH A;  2AEF A;  3GIM A;  2JH3 A;  5BR8 J;  3K57 A;  2WK4 A;  3KMQ A;  3MFH A;  3E3X A;  4A8F A;  4IRD A;  1A6L A;  4K4Z A;  5CYQ B;  4YS2 A;  4PYA A;  2LA4 A;  2O66 A;  3MAA A;  3EDQ B;  4LRC A;  4NOH A;  3G9C A;  3A8K A;  1N48 A;  3QJP A;  2D3Z A;  3KG0 A;  4ZS6 A;  2R7V A;  1VLY A;  1M5V C;  1HBN A;  1XNQ F;  4IDK B;  2AX1 A;  4B9U A;  3T5L A;  1RT6 B;  1Q53 A;  3M6W A;  5M2P A;  3S1T A;  1UWA A;  2XYP B;  4GO5 X;  1IKY B;  4I68 A;  4LVN P;  5B08 A;  1KOH A;  5HRO B;  2EFP A;  3TUP A;  2VFT A;  2N82 B;  1TEL A;  1X8D A;  1LWE A;  2NLW A;  1EAY C;  1UTA A;  1DBD A;  2YX1 A;  1QSS A;  3FZ2 A;  5H9E J;  3KG1 A;  3KFW X;  2UXD F;  1XR5 A;  1ZA2 B;  1HQE B;  2FC9 A;  2CAD A;  3ET6 A;  1MWQ A;  2MZQ A;  1C1C B;  1J5E J;  2NZ4 A;  2Y0S D;  1RBA A;  5AE1 A;  5HMY A;  2CJY B;  2AZ1 A;  3UCG A;  1WJ9 A;  1SIW B;  2J9D A;  3H7H B;  1SV5 B;  2NXU A;  2X1F A;  1NK4 A;  5T14 A;  3D6T B;  1TFY A;  4CWB A;  5DZ7 A;  1WNE A;  4LF7 F;  1S77 D;  3GFY A;  1UW4 A;  5CD4 A;  2E1C A;  2WBR A;  1JJ4 A;  2KYZ A;  4F4Y A;  4LRF A;  1RWO B;  3VAM A;  3MED A;  4EYH B;  3DM2 A;  2BA9 A;  3IBC B;  2KU7 A;  3VAH A;  3CC7 S;  2JLG A;  1RWU A;  4EO8 A;  1HMV B;  2R3V A;  1GTE A;  2CPI A;  3DRP B;  4WP3 A;  2RKI A;  2XCA A;  1WEX A;  3DN9 A;  1O5J A;  2DIT A;  3CB4 A;  4ANE A;  5EWE A;  2V9K A;  3E01 A;  1KDN A;  4RWX A;  4B3M F;  4OYP A;  1ZAX A;  3M8W A;  1S0N A;  5BR8 F;  2MYF A;  2GC8 A;  4O3R A;  3IAM 9;  3J80 Y;  4DMZ A;  2ZE2 A;  4F0K A;  1FNX H;  3LQV A;  3OUY A;  2PDA A;  4N5S A;  2C3Y A;  3Q89 A;  5F9L A;  1VRT A;  2BX6 A;  5LL6 d;  2MZS A;  2DNM A;  3L95 X;  1HLW A;  3R1L A;  4WFY A;  5L9X A;  5FJ4 A;  2GW8 A;  2ZH5 A;  1ZAW A;  2QX0 A;  1E6V B;  1NSP A;  2H5J B;  5F8I A;  4IG3 A;  1X4B A;  5K8N A;  3CCZ A;  2GAH C;  2XYH B;  1U2R A;  4ED7 A;  2W2O P;  4KQZ A;  2R4F A;  1AW0 A;  3L7U A;  3VQS A;  4KT0 C;  3P6Y C;  3RRH A;  2HHT A;  2QV6 A;  2LP4 A;  4TYA A;  3JB9 k;  2FVS A;  2QZ8 A;  3J7Z T;  1J5E F;  1HHS A;  3FSY A;  4JOU A;  5HAO A;  1W25 A;  3KK1 A;  4RW8 B;  5CYJ A;  2EK1 A;  3JSM B;  4JV0 A;  2BKO A;  3PW7 A;  2FZK B;  2B3T B;  2W1B A;  1F5A A;  3EXC X;  4CZC A;  1R89 A;  5A0Y B;  1MW7 A;  3M32 B;  4DV7 J;  1B0P A;  1V3R A;  4OZ3 A;  1SKS A;  5GAE U;  2AJQ A;  4FPI A;  2VL1 A;  3KK2 A;  2A2C A;  1Q8L A;  3KHL A;  2GGP B;  4P75 A;  3RR7 A;  2ILY A;  3R7S B;  1KD1 T;  2IY5 B;  4U8Y A;  3GJQ B;  3R2D J;  3PYF A;  4G1Q B;  3TA2 A;  2OPS A;  2KHD A;  4DR3 J;  4PUO A;  2KKH A;  3EVM A;  1S76 D;  1HYS A;  6FD1 A;  1FHT A;  1SKW A;  4E2F B;  1HNX J;  2PO4 A;  1N4L A;  1UVJ A;  3QJL A;  2XO7 A;  5ETP A;  1LFP A;  4NRU A;  2XY6 A;  3T5H A;  5A8W A;  1UFL A;  1AFI A;  1B3T A;  1ZA1 B;  3MAA B;  5HAT A;  4WKY A;  3AD7 C;  2WTF A;  4NLS A;  4DU7 A;  5AE2 A;  3UD4 P;  2RAQ A;  2LEP A;  2H1Y A;  1DTQ B;  2RVJ A;  4JP8 A;  1FKP B;  1HBN B;  4IRC A;  3PJW A;  4EFA C;  3MTK A;  4PWD A;  3LWL A;  4U96 A;  5HSP A;  4AYB D;  1R8C A;  3EVW A;  1WOO A;  1SJQ A;  4ID8 A;  4PAA A;  2B9Y A;  1DRZ A;  2VG5 A;  1UA1 A;  1VQ4 S;  2JEJ A;  5ETO A;  3OR1 B;  2XO6 A;  2XZW A;  2BEF A;  4ZVP B;  5KFT A;  4WK1 A;  5KT3 A;  3SZ2 A;  3ET6 B;  1QE1 B;  1S12 A;  2AJ2 A;  3HCX A;  5F3Z A;  3AOA A;  1U4B A;  1XN9 A;  5KT4 A;  3F73 A;  5L46 A;  1NAQ A;  2KHC A;  4GC6 A;  4RJV A;  2ZJR Q;  3DFE A;  3ISN D;  4YB6 A;  2DR8 A;  2K1R A;  3GV8 B;  3M9O B;  2QMU B;  2D3U A;  4B3O A;  4Y00 A;  2XI2 A;  3K7R A;  2AYG A;  1Z2Z A;  4PG5 A;  3P4U B;  1NME B;  2UV8 G;  2VG6 A;  5H9F J;  1SPB P;  4N7T A;  4DV7 F;  3MED B;  4IR9 A;  1MU2 A;  4HR2 A;  1VQN S;  2L08 A;  2FJV A;  3D3B J;  1GQE A;  2DIU A;  3DLK A;  1H6K X;  1KC8 T;  2VOD A;  3C3L A;  2MQM A;  5FD1 A;  4EMD A;  2RUG A;  1UPP A;  3ZNU A;  2WON B;  2WRM A;  4WE1 A;  1A0O B;  1WC3 A;  3CJ5 A;  3F0N A;  4DR3 F;  3H59 A;  1O0P A;  2WOM A;  4ZOS A;  3E01 B;  3MUV P;  4IQM A;  4WU3 A;  1FVQ A;  4DUZ J;  1Y5I B;  1R7I A;  2DY1 A;  1AZS B;  5E2Q A;  3HFK A;  3SEO A;  1RTD B;  2AF6 A;  1G7C B;  1S4F A;  5ETQ A;  3M9M B;  2DNK A;  3OUY B;  2W7O A;  1MRO A;  2JRS A;  3TW0 A;  5B7W A;  4ZPB A;  4ZP9 A;  4WZQ A;  1U2C A;  2YQ0 A;  3M05 A;  1YKW A;  1VRT B;  2FB0 A;  5IM0 B;  1Q8I A;  4OJH A;  4ERD A;  2WCX A;  3NGS A;  3NCR A;  2ASJ A;  3MMB A;  4C9D A;  1TL4 A;  3SCI E;  2GZO A;  4F7V A;  4DOZ A;  4DPT A;  3MR5 A;  1T05 A;  4CO0 A;  4ECW A;  5AJ3 J;  2CPD A;  1KHW A;  4KGK A;  1FE4 A;  3DKD A;  3HKW A;  1S49 A;  1U0H B;  3PCO B;  2K8G A;  2JOQ A;  3VAF A;  2HIY A;  1VQ7 S;  3NG8 A;  2RS2 A;  4Y0F A;  1BE4 A;  1XMO J;  2E5H A;  1RTI A;  1TMJ A;  2WVB A;  1M0S A;  3H5U A;  1UP1 A;  3IWX A;  2CJB A;  5I3Q A;  3PVX A;  2WVE A;  1UCN A;  2ZBC A;  1EKS A;  2VFS A;  1NK9 A;  4AFF A;  2I2Y A;  3CGI A;  2R8H A;  3NAI A;  5C25 A;  5A8R A;  3KK1 B;  3W8P A;  4EBC A;  1GMW A;  2G0C A;  3THT A;  1T9Y A;  4I0W A;  1NB2 A;  3D9B A;  2ZVS A;  3L7O A;  1G6B A;  3OD2 A;  3H2L A;  3O44 A;  3LA0 A;  4NLX A;  4U95 A;  3J7Z 5;  3N5B A;  2XS5 A;  4ZN1 A;  2RU9 A;  2HBR B;  3AA8 A;  5KG5 A;  3M9N B;  4A8X A;  3DLE B;  2D74 B;  4O4G A;  1S7I A;  2RQ4 A;  5C42 A;  3R9L A;  3E8O A;  5HMW A;  3BSA A;  3PW0 A;  3N79 A;  4J5O A;  3OPK A;  4RUB A;  2ASL A;  1KVI A;  1SBR A;  5SUH A;  3FCV A;  1VC0 A;  3U27 A;  3C6U A;  1Y3J A;  3VHQ A;  2OPS B;  2N3L A;  2XB2 D;  2IA6 A;  2PFF B;  1T3O A;  3NNC A;  2CPJ A;  4PUO B;  1SCJ B;  2BZ2 A;  1YJW S;  3IG1 A;  4FDF A;  3ZTR A;  2V4Q A;  4WFA Q;  4IYQ A;  3ZNJ 1;  4WKR A;  2VBW A;  2V4R A;  1B7F A;  1U8W A;  4KAI A;  1U48 A;  4K8R A;  1T9V A;  1X4D A;  2HFS A;  3DHW C;  4USW A;  4MK8 A;  4NYP A;  5I3U B;  2J8A A;  4FBT A;  4J9S A;  3VAK A;  3NL0 A;  1CS4 A;  3NRB A;  3IWL A;  4PWD B;  3VVT A;  4LF6 J;  4ETZ A;  2LEC A;  3EUN A;  2UVV A;  3EXY A;  5DDP C;  2W8L A;  3BQ0 A;  2DNQ A;  3OL6 A;  3IXQ A;  3KLV A;  4OYA A;  5AJ3 F;  2D3O 1;  3ZZT A;  2VG5 B;  2Y8Y A;  4NLY A;  2HKE A;  4C11 B;  1T11 A;  2YKP A;  2IA0 A;  1ULR A;  1XMO F;  2JC0 A;  3SCJ E;  3CF5 Q;  5C2G A;  3LP2 B;  3M2R B;  3DHX A;  4CNZ A;  4I6W A;  4R0J A;  1MN7 A;  3CJR A;  2EC2 A;  1N54 B;  4NCG A;  2RB7 A;  1D3W A;  2YH1 A;  3MMC A;  2IVY A;  4HTJ A;  3IO1 A;  4DS4 A;  1TUW A;  3R2C J;  6AT1 B;  1KRP A;  3HSG A;  3LF0 A;  1D9F A;  5GMD A;  2XWY A;  3HZE A;  2E7X A;  2VG6 B;  1FXR A;  1U25 A;  3MM5 A;  3VAI A;  2RQK A;  3KUE A;  1MU2 B;  3J7Y I;  1X7V A;  1OYE A;  4PZV A;  3KLE A;  1R8B A;  2H5I B;  3A8J A;  4TVA B;  4TU8 A;  2XYG B;  2N7C A;  4OHV A;  2KVQ E;  4WE1 B;  3A4T A;  1MLA A;  4LBP A;  5A76 A;  4U67 Q;  3TAR A;  5DM7 Q;  3CJS A;  4J9M A;  1WKK A;  2NYH A;  1R0C B;  2J76 E;  1OPI A;  5BYS A;  3H0P A;  1IXK A;  3AQP A;  1X5S A;  3M4X A;  3D4J A;  4DPU A;  3LP0 A;  2RQM A;  2R7X A;  2P9E A;  3G6V A;  2V2Z A;  2Z2L A;  4P74 A;  5DGB A;  3DLJ A;  1NBE B;  1OSD A;  1RAG B;  1S1W A;  3AB2 B;  1YI2 S;  2XSJ B;  4LSN A;  4NE9 C;  1BQM A;  4WU2 A;  1ZS6 A;  4KPY A;  3L7P A;  4ZVH A;  2AV5 A;  3TZY A;  4YB1 P;  2VDI A;  3K2Y A;  1JXE A;  1T05 B;  4LF6 F;  3W9J A;  1WEY A;  4DWI A;  1VHI A;  1UJ4 A;  2Z58 B;  3MEG B;  4EK2 A;  3JTP A;  3TUI C;  1MWY A;  3DC2 A;  2HMI A;  4CLY A;  1V6H A;  2VDH A;  5LM7 E;  5GAH I;  3UDE A;  4ZJL A;  4WFB Q;  2YPY A;  4DFK A;  1RBL A;  1YHQ S;  2XMK A;  3DI6 B;  1Y5L B;  1S6O A;  1RKI A;  5DQH A;  1TR0 A;  2PMH A;  1KBR A;  3WIV A;  2R2R A;  3ELH A;  2HQ3 A;  4IFY A;  3BBC A;  4F25 A;  4V19 J;  4J37 A;  1HBO A;  3GPA A;  4P9S A;  1IKV B;  2LCW A;  2A1B A;  3HHE A;  2V5H G;  5C25 B;  5A8R B;  2V2V A;  4ECY A;  4DX8 H;  2RHS B;  3NS7 B;  2LDY A;  4HI2 A;  3UDL A;  3UVJ B;  2CJ9 A;  4LIR A;  1E6Y B;  1NK7 A;  3FDS A;  4DQQ A;  4Y65 A;  4X2B A;  1HPZ A;  2DCU B;  1NH8 A;  2DT9 A;  2ROP A;  1T9X A;  2M4M A;  1VQM S;  4F50 A;  2F9J A;  2GVZ A;  2V6A A;  2J7W A;  5H1S V;  2DYA A;  2C2K B;  2A18 A;  3C16 A;  4XO0 A;  1WF1 A;  1RYR A;  2GO8 A;  4JI4 J;  5E3Q A;  4O44 A;  3IR7 B;  1P8G A;  3IG1 B;  3VVU A;  4F4K A;  4X4S A;  1NLK L;  1BXN A;  2R8G A;  4AQY J;  3N6N A;  3U1N A;  2EBE A;  4P2M A;  2BJ7 A;  2BQ3 A;  4F4A A;  4LFA J;  1VIX A;  2B7C B;  1LOU A;  1RGV A;  2A2D A;  1TQL A;  3AQO A;  2B4O A;  3DRY A;  1WG1 A;  2DHX A;  3AD8 C;  2MY7 A;  1G1X A;  4FKX A;  1HBU A;  4OI1 A;  4K4Y A;  4ZHR A;  2J9E A;  1EP4 A;  5D4P A;  4CLK A;  1QUP A;  3ZTP A;  3AOC A;  4RW6 A;  3CC4 S;  2NUH A;  3M6U A;  5DJB A;  4A48 A;  3HHK A;  4CYU A;  4QWE A;  3NCP A;  3ADA C;  4U6P A;  1C0U A;  1IWA A;  4QR2 A;  4P10 A;  3PW2 A;  5L1I A;  4C6A A;  5SZT A;  2D69 A;  5ETR A;  3S01 A;  3UNG C;  4AE5 A;  5AT1 B;  2FUG 9;  2FPH X;  4C3L A;  4I2P A;  5C24 B;  2RDJ A;  1IR0 A;  4CLS A;  4Z37 A;  1VRQ C;  3L3C A;  3D6H B;  1X0P A;  2E1P A;  3MM6 B;  3GTY X;  2D1C A;  2P5V A;  1WOP A;  5B09 A;  2M8H A;  4O0N A;  2HLT A;  2HHP A;  2NSB A;  1LXN A;  3TOQ A;  4CO1 A;  2HWH A;  3PHT A;  4KPC A;  1M1K T;  1S9F A;  1ELO A;  1RT7 A;  3K5M A;  3A3O B;  2HUR A;  2KVI A;  4ELV A;  2DIS A;  1RKJ A;  4LSL A;  4LFC J;  3DNC A;  2CNK B;  1M5H A;  3VGS A;  3W9I A;  3MM5 B;  5KFB A;  1SH0 A;  1LK7 A;  4WII A;  2B9X A;  4BDP A;  2M3D A;  1LQ9 A;  5HBM A;  1NRK A;  1NHU A;  4GO7 X;  4JI8 F;  3TVK A;  4QYZ K;  1JLB A;  3KLE B;  1WHX A;  1OY9 A;  4WFX A;  1FRI A;  1NKE A;  2JJ4 D;  2PE8 A;  4ECQ A;  2JLE A;  4NX9 A;  3W63 A;  3ZFV A;  4RW4 A;  2QLF B;  5LSL A;  2IBO A;  1V3Z A;  2HRT A;  3K8V A;  4JI4 F;  1NKC A;  2IVM A;  3POT A;  4QWD A;  4PG6 A;  3UE2 A;  2VJU A;  5ETN A;  2QFI A;  2R7S A;  1CJT A;  3CMA S;  1S57 A;  4X4O A;  1N34 J;  3US5 A;  1S1W B;  3LPY A;  4KSE B;  4LFA F;  1X4E A;  4OZN A;  5DDR C;  3J7Y U;  1WC5 A;  2Y0B B;  3FRZ A;  1BQM B;  5F0U A;  2GAG C;  3Q22 A;  1RHM B;  1F9H A;  2CQH A;  2MGZ B;  5CQG A;  4CLF A;  2CUY A;  4DEZ A;  1I51 B;  3O5T B;  2UVW A;  1JLE A;  3OJS A;  2MQN A;  2JLF A;  4HHH A;  4FPR A;  4H4O A;  2LU1 A;  2VKZ G;  3KLG B;  2DPI A;  1HQU A;  3B8H A;  3PHE A;  2VFR A;  5RUB A;  2HMI B;  1X31 C;  3DDK A;  3HZG A;  1PC4 A;  2ZZT A;  3PX0 A;  2BM1 A;  1XR7 A;  3W62 A;  4YP3 A;  2AGO A;  4U9R A;  2B8P A;  4FXD A;  4RKU C;  2AJ1 A;  2FZC B;  1NSQ A;  4UT4 A;  3MEC B;  4LMZ A;  4I2Q B;  2YBV A;  1HKA A;  3H98 A;  3C15 A;  2GVD B;  4UOG A;  2NXJ A;  3WC0 A;  3MM7 A;  3KLF A;  3MCM A;  1LXJ A;  2I1R A;  5HMX A;  2HVD A;  1ZAV A;  1QDU B;  4PYD A;  1KWM A;  3IAS 9;  4LFC F;  1QTM A;  5KFV A;  3PDN A;  1YZ7 A;  3MMJ A;  1FE0 A;  1ZM3 A;  1CJU A;  1U2F A;  3MI7 X;  2B8Q A;  4NYO A;  3NBP B;  1G3O A;  2DGO A;  4NLD A;  3T1H J;  2FVP A;  4DQI A;  3A8E A;  2OPP A;  1J5O B;  2ALY B;  4F36 A;  2COL A;  4MYU A;  2FY8 A;  4PXD A;  5D3G A;  4O44 B;  4MKA A;  5GAG U;  4OZJ A;  2OKQ A;  2GQC A;  3AA9 A;  5LSO A;  1KQK A;  4PG8 A;  3QT5 A;  4QU6 A;  2HS3 A;  3RU0 A;  1RAH B;  4GKJ J;  3V4M A;  1D1U A;  2G13 A;  1N34 F;  2B56 A;  3OL9 A;  3K89 A;  4QIG A;  5D15 A;  4K4V A;  3RYL A;  4C7Q A;  3GR1 A;  1FTR A;  3V4I B;  1HBU B;  2HNZ B;  5DO2 A;  4ZHR B;  2ADB A;  3UNY A;  3PJX A;  5CXT A;  5KT6 A;  3THV A;  3QT8 A;  1EP4 B;  4NZ7 A;  2MKJ A;  2B4P A;  2UUB F;  3M2V A;  5ETS A;  5D6G A;  2WSC C;  1FFG B;  3BKU A;  2Q66 A;  1X9W A;  1PJ5 A;  1W2I A;  2QC3 A;  1JQG A;  1I5O B;  2FLP A;  5KAK A;  1IR2 A;  1JMT A;  5IWA J;  2BE9 B;  1CJK A;  2FJD B;  5M2U A;  5J2P B;  2YNH A;  3UFC X;  3CJK A;  2DHS A;  3WX8 A;  3WIU A;  2MJN A;  2HLU A;  2DGX A;  2Q6B A;  4RNH A;  4I2P B;  1RXO B;  2MB0 B;  3I0S A;  3HKZ D;  2VB6 A;  2XLK A;  1TU0 B;  3OR2 A;  2HPU A;  2NYI A;  1UA0 A;  1YBT A;  1HL6 A;  5A6P A;  3KKF A;  1H3D A;  4QWA A;  1WEZ A;  1QSL A;  2XMU A;  3AOB A;  1RT7 B;  1FJC A;  1EZZ B;  1WAC A;  1UVN A;  3C6T B;  2X1B A;  2EXU A;  2LYV A;  1KTV A;  1RT4 A;  1HHT P;  1LW2 A;  2ZKT A;  4CM0 A;  3VF0 B;  2MQP A;  1DZ5 A;  2QTW A;  3FMW A;  4LSL B;  4ID5 A;  3G87 A;  3QFW A;  1S1T B;  4GVB B;  3TAM A;  1B4S A;  3MPU B;  3GFZ A;  2FVC A;  3FRY A;  1NJI T;  3G82 A;  2HNY A;  3HF5 A;  2QMX A;  1IKX A;  1CEZ A;  2YXL A;  3S8S A;  4CO5 A;  2MQ8 A;  4ZLP A;  1HBM B;  4N8N A;  2BYC A;  5KG1 A;  3BBB A;  2FJE B;  2LQB A;  1HIY A;  4NLR A;  3M30 A;  2R8I A;  2JEI A;  1X60 A;  2U2F A;  4I1T A;  1RHU B;  3MGJ A;  4YOE A;  3M8R A;  2FJW A;  4FYX B;  4UF4 A;  4OYZ A;  2QA4 G;  1L5U A;  4KHM A;  2IRU A;  1NCL A;  2XG8 A;  4KKO B;  4H54 A;  4OYX A;  1WI6 A;  1YIT S;  1DQ8 A;  3DGV A;  1HD1 A;  3T1A A;  3T5K A;  5DQI A;  2GFF A;  4KBI A;  3T9N A;  4DDF A;  1JLA A;  1YGY A;  3MM8 A;  4UY8 T;  1AUS L;  3PXG a;  5B0F A;  1BHN A;  1UMJ A;  2E5L J;  2UVU A;  2XNQ A;  4CT9 A;  4DL5 A;  2UUT A;  2D9O A;  4FVC A;  3I0R B;  1NEE A;  3V81 B;  2V2Q A;  3CNQ P;  5IWA F;  5J2Q A;  2IC3 A;  1VJQ A;  4NLW A;  3AJ2 A;  2X3D A;  4LFB J;  1NPP A;  3HVW A;  3B54 A;  3DU5 A;  2F8H A;  2MXY A;  3W2V A;  4OZL A;  1RBO B;  3LP1 A;  4JYA J;  3ZZP A;  4JI2 J;  1TK0 A;  4AL6 A;  4I67 A;  4WK3 A;  5L1J A;  1VBZ A;  5FII A;  4Q5V A;  2VA3 A;  5IS2 A;  1RT5 B;  1T03 A;  4QQB A;  3P3D A;  5HQL A;  3E51 A;  4IUF A;  1U02 A;  3TVZ A;  3MM7 B;  3KLF B;  3Q0A A;  3FFI A;  3HVA A;  5J2M A;  1FNO A;  1YRT A;  4FNI A;  3GYG A;  4UQT A;  4X4Q A;  4ECU A;  2Q79 A;  4M5D A;  4TU7 A;  2HFN A;  4WYL A;  1RHQ B;  3JQK A;  3RB3 A;  2G2O A;  4HEA 9;  1CJV A;  5E41 A;  4YR2 A;  1IBK F;  3IM9 A;  1L3V A;  4C2M A;  4DFP A;  2OSQ A;  3AH6 A;  2O3D A;  2CYY A;  1F2G A;  2XS2 A;  1N52 B;  3HD2 A;  5BYQ A;  5D3G B;  1CC7 A;  4TQS A;  1JK9 B;  3OBI A;  3HHL A;  4J9V A;  1GXU A;  3FJ2 A;  2CNO B;  3A1Y G;  4L6V 3;  1FT8 A;  2LDI A;  2HW3 A;  4QYZ J;  2DNL A;  4EO6 A;  3W5X A;  3LWM A;  2D3O R;  2V9W A;  1R3N A;  2OGU A;  1SQF A;  1KLN A;  2UP1 A;  2MMY A;  3GU0 A;  2W9B A;  4CO2 A;  4LR9 A;  2UU9 F;  3TWZ A;  1HNZ F;  3FQK A;  2DH9 A;  2FD2 A;  3TVY A;  3GII A;  2DTJ A;  1SH2 A;  1XMQ J;  3SSR A;  3O1L A;  3H5X A;  2R9L A;  3Q8U A;  4WIQ A;  3M2V B;  3LW5 C;  2YKM A;  1TL3 A;  2YNF A;  4MIB A;  3GV5 B;  4DCJ B;  2GJI A;  1S59 A;  4A47 A;  3M8P A;  1S6P B;  1GNK A;  2CKW A;  3LAK A;  3FBF A;  4ES3 A;  1CJK B;  1ZZF A;  3R7B B;  1MN9 A;  1VHF A;  1EQ0 A;  5MAO A;  4DUY J;  2E7W A;  3N4W A;  2C3M A;  3UN2 A;  4UUW A;  1NJY A;  4B9M A;  4LFB F;  4TQR A;  2XM3 A;  3MPW A;  2PT0 A;  3GG1 A;  2P9G A;  4R0E A;  5DS7 A;  1FJG J;  3I0S B;  1QVG R;  4JYA F;  2EKN A;  3H4B A;  3TJ9 A;  3BBF A;  4JI2 F;  4ZA1 A;  3TAP A;  5DDQ C;  2Y3Y A;  3HXM A;  4UUX A;  3M1V A;  4CO4 A;  4F02 A;  2LMI A;  1CUL B;  3AXM A;  3NXZ A;  5J1E B;  2YNI A;  3UN3 A;  4MFB B;  4LBH A;  4IR1 A;  4ZPW R;  1NM2 A;  3PZP A;  1JNR B;  3NOG A;  3BSC A;  2BMB A;  5J2N B;  2XMT A;  3D54 A;  1HI0 P;  1U26 A;  2J9D E;  2GMH A;  3W2W B;  4IG0 B;  2CWK A;  1AXQ A;  4ZLL A;  1X4A A;  3CED A;  5HL7 Q;  1N32 J;  4YHH J;  2C42 A;  5ETV A;  4JV5 F;  5KFL A;  3JYT B;  3KNG A;  2HNY B;  2DRB A;  4NML A;  5F0W A;  1ZM2 A;  3MAQ A;  2XMW A;  3QAE A;  1ZM4 A;  3D5M A;  3PM9 A;  2AW0 A;  2EI5 A;  4Q0B A;  2MQQ A;  4OHZ A;  5L39 A;  1TKZ A;  2YWH A;  2HHX A;  3HFV A;  2ZH8 A;  3KJV A;  4JI3 J;  2QA1 A;  3B6B A;  1BY9 A;  4MAK A;  2JL9 A;  3U1M A;  1HWK A;  4OV1 A;  1SC1 B;  3CC2 S;  1TK8 A;  3O8W A;  4LF4 F;  1QAX A;  3QIP B;  3MM9 A;  5HQM A;  1Q78 A;  2FGC A;  4FYV B;  3GB0 A;  2I8E A;  1QAY A;  2VG7 B;  4A4J A;  4DUT A;  4W98 A;  1M1G A;  4F3O A;  1BWV A;  1JLA B;  3EZ5 A;  4MK9 A;  3ISZ A;  1LWC A;  2HIQ A;  1R0B G;  3MM8 B;  5F8J A;  4I56 A;  1GTH A;  2V8V A;  5G4D A;  4ZDN A;  3AXK A;  4P2F A;  3JSR A;  5AXK A;  4YY3 J;  2BV3 A;  2B6A A;  1O8B A;  5T7L A;  4OIX A;  1VQ5 S;  1S79 A;  2BJ9 A;  4P72 A;  3D67 A;  5IOL A;  2PFD A;  4TY8 A;  4F2S A;  3RUB L;  4WXO A;  3GJR B;  3ISN C;  2BJ3 A;  3N6M A;  4EYI B;  4DUY F;  2CA9 A;  3EX7 B;  5KG7 A;  1IJE B;  3SIP B;  2DY9 A;  1OWX A;  1LV5 A;  2QA4 S;  2B43 A;  1KFS A;  1MML A;  3FGV A;  2C3U A;  3H8Y A;  2RD5 C;  1YVF A;  2HZV A;  4XIU A;  3F41 A;  4RW9 A;  2ZD1 A;  4ZIT A;  1FVS A;  2YX7 A;  3GLJ A;  4XTT A;  4OI3 A;  4RL1 A;  4BBY A;  2BDP A;  3P49 B;  3KUH A;  4OZ2 A;  4TLR A;  2KYX A;  3RJM B;  3IGN A;  1N32 F;  4YHH F;  2E5G A;  2CQD A;  3FMB A;  1UEU A;  3GWC A;  4A8K A;  4QWC A;  4BC9 A;  3W9H A;  3CO9 A;  1P1L A;  1JKH B;  3MDF A;  1MSW D;  1GMW D;  4UW2 A;  5HVG A;  3W5Y A;  2H54 B;  3QRP A;  3HHL B;  2RT3 A;  2CQ1 A;  1YJV A;  2CQ2 A;  5D4O A;  4K50 A;  4JI3 F;  3K5P A;  5K14 A;  2BR0 A;  2GQQ A;  4A46 A;  2GNK A;  1S1X A;  3OFE A;  3P5T L;  3GYX B;  1YBU A;  2DNH A;  2J0X A;  3Q86 A;  3ILL A;  4ZCI A;  1BMQ B;  3CDU A;  4C0O C;  2BAN B;  1KKH A;  1X4C A;  4HDH A;  3DGP A;  4LF9 J;  1GX6 A;  4Y3C A;  2JEG A;  2OFH X;  1EJ7 L;  1Y5N B;  3HPO A;  2XEX A;  1NK6 A;  1REV A;  2E7V A;  4K2X A;  5LMU F;  2VPZ B;  1SQE A;  2YKM B;  2F5G A;  2ATC B;  3QSY B;  1WC6 A;  2CZ9 A;  4YY3 F;  3M8P B;  1JNZ B;  3B4D A;  2N7Y A;  3ZXW A;  3QNW B;  4OYW A;  4ZPC A;  3BGL A;  3CVK A;  3PR4 A;  3H2V E;  2RF2 A;  1X5P A;  3Q8S B;  1RTJ A;  1M5S A;  2I5J B;  3DOM B;  4D3H A;  3CWJ A;  3L4B C;  4XPC A;  4DV3 J;  2ATL A;  1RJJ A;  2CQP A;  2BE2 A;  4N76 A;  4KYZ A;  2HG4 A;  3I31 A;  2QSF A;  1ZTW A;  3CJ8 A;  4ZJO A;  1ACM B;  2UUW A;  2YNI B;  3P45 B;  1X0F A;  1TV6 A;  4F3Q A;  5E5N A;  1S6Q A;  3HI9 A;  1LEO A;  5CZV A;  3IS9 B;  2VC1 A;  1F2H A;  2OFG X;  1H72 C;  4KGX B;  1YJR A;  4F67 A;  4ZPV R;  2YKN B;  3BO3 A;  3NAH A;  2AJ0 A;  5LSR A;  4DV4 J;  2HGL A;  2XWX A;  1HWJ A;  3MPD A;  1UEK A;  5IQ6 A;  2K06 A;  3ILO A;  2CPY A;  1U45 A;  3R97 A;  2VHG A;  1HWL A;  4B17 A;  4QW8 A;  5CAA A;  4LRB A;  2H51 B;  3W7B A;  1TKZ B;  1U7L A;  3KJV B;  2Z2M A;  2IRY A;  2KTQ A;  4OYM A;  2IYG A;  1C4A A;  2CQ4 A;  5KTQ A;  2RQC A;  3HUL A;  3KK3 A;  2QL9 B;  2C1E B;  3QO9 A;  4DL3 A;  1S9G A;  3ZZR A;  4X65 J;  3PYD A;  2VF3 A;  3IRW P;  2HZC A;  1FDN A;  5E3C A;  5HVF A;  2OML A;  4ZVT B;  1YWX A;  5D0G A;  1P27 B;  3DLH A;  1X4H A;  4DCP B;  1Y3K A;  3H5Y A;  5DLF A;  2EK6 A;  2ZJP Q;  3KDO A;  1H2T Z;  1FWL A;  4P52 A;  4OZ1 A;  1L3U A;  5DRK A;  5J1P A;  1LWC B;  4FKY A;  3GP9 A;  3T41 A;  4IOA Q;  4CLW A;  5T7L B;  3TNV A;  3GCW P;  2ZIT A;  2J0S D;  4PQU A;  4HT5 A;  3BGR B;  2BKP A;  2NCK L;  1CC8 A;  1S1U A;  1VGY A;  2VPW B;  3PEH A;  5A6W A;  3SSS A;  5DDO C;  1NND A;  3EPI A;  2W9C B;  2V8H A;  2KG0 A;  5KT5 A;  4CRJ A;  1PSD A;  1TL7 B;  1MWZ A;  3SSQ A;  1Y0H A;  1YIJ S;  4Q44 A;  2E1A A;  3OL8 A;  4CLT A;  3LGN A;  1FNM A;  4DR7 J;  2AQ4 A;  5F8L A;  4OI0 A;  1JLG A;  1YJ9 S;  2CWX A;  4Q2L A;  7FD1 A;  4O3N A;  3R7N B;  2FGO A;  3DMJ A;  1QVF R;  4RW9 B;  5GME A;  1BD6 A;  3W8G A;  3CUN A;  2XNR A;  3PTW A;  2W01 A;  5KFP A;  1B70 B;  4EEY A;  2VBX A;  4URQ U;  4KGZ B;  1RWP B;  4DR6 J;  3IMQ J;  1JX4 A;  5I3P A;  1UET A;  3TX0 A;  3BF4 A;  3K59 A;  4AUK A;  4OX9 J;  3ZO7 A;  4O4R A;  3UR3 C;  2VQF F;  4DV4 F;  4XAK A;  4OZ5 A;  2IHR 1;  3HJV A;  3RRG A;  2HAI A;  2OAU A;  1N0U A;  2KN4 A;  2ALZ A;  1HFE L;  4DPX A;  4GKK J;  4CLU A;  3M8Q B;  4KHP J;  5LOQ A;  1ICE B;  4C4W A;  3KYL A;  3L09 A;  1K9M T;  3AT1 B;  4NRT A;  4DV6 J;  2YQ3 A;  5KFY A;  3ILJ A;  1R43 A;  1LW0 B;  5LXR A;  1YQH A;  2FHJ A;  2IMW P;  4X65 F;  2AJ4 A;  1S1X B;  1TMM A;  3RTV A;  2QE5 A;  1T7P A;  1RYS A;  3D0H E;  1GMV A;  2DHH A;  4MKB A;  4B9T A;  2XLJ A;  4MIW A;  4RX6 A;  4LF5 F;  2DNZ A;  2H3E B;  3NLC A;  3DGP B;  3B78 A;  4I6Y A;  4QBU A;  1RWN B;  4ENO A;  3K5L A;  3BGO P;  3FZB A;  1REV B;  5FDL B;  1TUG B;  1WHY A;  4KIA A;  3EZO A;  4ZCM A;  4JI6 J;  3U02 A;  2AEJ A;  3CMQ A;  2LEA A;  1FRM A;  2LKZ A;  1HI1 A;  1S0V A;  3GJS B;  3VZH A;  3TJ8 A;  1V5V A;  3OSP A;  5CD4 H;  4J91 A;  1RTJ B;  1HNI A;  4NAS A;  2AT1 B;  4M8L A;  1WSV A;  3FSX A;  2DXF A;  1K1S A;  4B3R J;  2IJF A;  1JIH A;  1RCO B;  3UWT A;  1WKJ A;  2D41 A;  3AJ1 A;  3TEG A;  2VON A;  2PI4 A;  1FXL A;  1JWW A;  2HBZ B;  2GHW A;  4DR7 F;  1RAC B;  5KG6 A;  3V6H A;  2L48 A;  5AXN A;  4HH1 A;  4IO9 Q;  1RA7 A;  2JDJ A;  1U1Q A;  3MEE A;  4ZPT R;  1FO1 A;  4J7C A;  4FS1 A;  3Q23 A;  3KJQ B;  1XC9 A;  2GX8 A;  4J9N A;  2BBE A;  2OIH A;  2WVF A;  4NYZ A;  4DR6 F;  1H2V Z;  4IFV A;  3SQG A;  1S9E B;  2G0I A;  4OX9 F;  4DX5 A;  2DVI A;  5HI7 A;  3PR5 B;  4W4M A;  1EET A;  4USK A;  3SDE A;  3RW7 A;  4GKK F;  4KFB A;  3W65 A;  2NS1 B;  4KHP F;  3A13 A;  4PQA A;  4LIW A;  4DV6 F;  1CVJ A;  2BW2 A;  3G71 S;  1VLO A;  2GHV C;  3QO9 B;  5ITH A;  4YR3 A;  5KFM A;  1N36 J;  2H4W B;  4ZVS B;  3BS9 A;  3D0I E;  4OJ3 A;  1Q0N A;  4X66 J;  5B0C A;  4RUA A;  3EGZ A;  3CO0 P;  4ZVQ B;  4KO0 A;  2I9S A;  2AJF E;  1H74 A;  3TJA A;  2ZM6 J;  2QLW A;  2KT3 A;  1RT3 A;  3CW2 C;  2OPQ B;  3KLI A;  1Q16 B;  4YEA A;  3H40 A;  1AT1 B;  4USJ C;  5L1K A;  3M2U A;  3LOU A;  2LQ9 A;  3FCH A;  3P5B P;  3V6D A;  4KV8 B;  4IOC Q;  1F5B A;  4JI6 F;  3RAQ A;  1EB0 A;  1U1P A;  4G65 A;  3CCJ S;  1NK5 A;  4ZJQ A;  4HAC A;  2V63 A;  4U7U D;  2BXJ A;  4FS2 A;  2L41 A;  4K2J A;  4FF2 A;  2AMC B;  3H5S A;  4U7C A;  1KEK A;  5LJ3 Y;  3J81 U;  3LH2 S;  3VQT A;  3FBB A;  2OJ3 A;  2CRL A;  2QMW A;  3HX9 A;  1RZM A;  1JLC A;  5E7O B;  1RT1 A;  4B3R F;  2VFU A;  4DPW A;  4DG1 A;  3SYZ A;  3HSD A;  1JLG B;  3BGU A;  2ZJQ Q;  4NCA A;  3G4S S;  4GVL A;  1KON A;  3JSB A;  4E98 A;  2R2T A;  1RB0 A;  3C14 A;  4I69 A;  2ZNY A;  4CH0 S;  5DQG A;  2DR9 A;  2QJ3 A;  5D4N A;  2W25 A;  4PRF A;  4FF4 A;  3GYN A;  2IPO B;  1X4G A;  4C8N A;  2KZZ A;  2K7K A;  4ZVG A;  2ZFH A;  1LWF A;  5G0R B;  1JLQ B;  3TZW A;  4FXV A;  2DGW A;  3ICL A;  1F6T A;  1IVZ A;  4H4M A;  3BB5 A;  4CTA A;  1N6Q A;  4FYW B;  5EX0 A;  2HAF A;  1U1M A;  4X84 A;  2LXI A;  1S1V A;  2W2Q P;  5CHC B;  3TQ1 A;  1B64 A;  3QQC D;  4RZR A;  4H4K C;  4ECX A;  2HFU A;  3C46 A;  3BEG B;  4AND A;  5M2R A;  4ELT A;  3PEJ A;  5LMN J;  1FRK A;  3MD3 A;  3TZZ A;  4F0M A;  4TY9 A;  5F8H A;  2F8M A;  4Z7Y A;  3GJT B;  3FQL A;  2CDR B;  3OXG A;  3PG9 A;  1N36 F;  2F3J A;  1W2B R;  1VK8 A;  3U1L A;  5GAD I;  4X66 F;  4W92 B;  2JX2 A;  1GAO A;  2JHE A;  5KOX A;  2DD8 S;  4HVZ A;  4UZC A;  4DHV A;  1SXL A;  3R5B A;  3TQE A;  1DTT A;  4R25 A;  5KFU A;  2AKW B;  2RRN A;  1JJ2 R;  1KOO A;  2CQB A;  3RBX A;  5KFR A;  2CXE A;  4TNO A;  2O5D A;  1TVR A;  1FJ7 A;  2G1D A;  2EC0 A;  4URG A;  1WTB A;  5AXM A;  1UZD A;  3CCQ S;  2LU2 A;  1WD6 A;  1N5S A;  4OX8 A;  3ITH B;  1DAR A;  3K17 A;  1HNI B;  5CCL A;  1RWM B;  3CE8 A;  4PKD B;  2ASY A;  3BRE A;  3OLA A;  3W60 A;  3VAG A;  3CCL S;  3FSI A;  1PIE A;  3JAM Y;  4V1A k;  5B0G A;  4Z7C A;  1CG2 A;  3G6Y A;  4LF1 A;  1RLD A;  4EGL A;  5HP1 A;  1VFJ A;  1YLX A;  2NQP A;  4ED3 A;  3PW4 A;  3MR2 A;  2L3M A;  2W24 A;  1GXT A;  2DO0 A;  3D68 A;  3J81 Y;  3BM7 A;  2Z2Y B;  4Q7A A;  4CNY A;  3Q2T C;  4IH5 A;  2NXE A;  1UZH A;  2XCP A;  1LWE B;  4DSF A;  3UCU P;  3VCD A;  2BQR A;  4ELU A;  3HHD A;  2PEB A;  3O2I A;  1VQO S;  1R8A A;  2DEI A;  1RAA B;  3JXO A;  2DNP A;  2HGN A;  3SDE B;  4K7Q A;  4KFB B;  1ROF A;  2M5Y A;  2M88 A;  1F60 B;  1VQ6 S;  1PBU A;  1RAB B;  3MXH P;  2QRR A;  3DRR A;  5KFH A;  1G4C A;  2P6S A;  4LQ9 A;  4PXC A;  5CA5 A;  1T0T V;  4PG4 A;  4YDD B;  1RTH A;  3MMA A;  4OV6 A;  4ALZ A;  4J9R A;  2F7V A;  3FUY A;  4KO0 B;  4NEZ A;  4OZ0 A;  2KXH A;  4DV0 J;  3NWR A;  2R7R A;  4KGM A;  4UTG A;  2QYG A;  3AFG A;  1TK5 A;  3DM2 B;  2QGF B;  2HVZ A;  5IQQ A;  2HQD A;  4Q45 A;  3CCM S;  4X4U A;  1K0V A;  1EKR A;  2E5I A;  5D8H B;  3CD5 A;  2RKI B;  2NR0 A;  1RT2 A;  4DPY A;  5MLC V;  2PC6 A;  4YB5 A;  2E44 A;  1U1N A;  2KM8 B;  1QUV A;  1D0E A;  3W61 A;  1NHV A;  3UDV A;  3MOJ B;  1Y11 A;  1HNX F;  2BRK A;  1JLC B;  1RT1 B;  4C8K A;  3EDR B;  1WKL A;  5I42 A;  2J6U A;  1DJ0 A;  4A8S A;  3V6J A;  4DG1 B;  2ZE2 B;  3V6K A;  1K8A T;  1H2U X;  3ENV A;  2ZOM A;  4QU7 A;  1UWB A;  4GMK A;  1WHV A;  1NDK A;  1T3N A;  1H0H B;  2IYI A;  4O3Q A;  3IM8 A;  1TP7 A;  3GSD A;  2AD9 A;  1Q7L B;  4K4X A;  1RTZ A;  4ZVU B;  1FDD A;  3BKT A;  4IG3 B;  1VMB A;  5KG3 A;  3PX6 A;  1H7W A;  4CLZ A;  4ECZ A;  5KFZ A;  1LWF B;  5ADZ A;  3LAM A;  3G8S A;  1VRU A;  5K20 B;  1S1V B;  4B3S J;  1UL3 A;  3JQJ A;  1M5K C;  5EUH A;  4PAB A;  1QSY A;  3RAM A;  3SFG A;  1UPM B;  5KOW A;  2B4V A;  3M8Y A;  2G0J A;  3ZZO A;  1JLF A;  1KVJ A;  5D4L A;  4C97 A;  3I55 S;  1WSR A;  4JV1 A;  2WBM A;  2Q1L A;  4LRE A;  3G6E S;  1WEL A;  2RH3 A;  2BAB A;  2RRB A;  3Q24 A;  2HHV A;  4IQX A;  1KQG B;  2C28 A;  2M52 A;  1KSP A;  2KM8 C;  5LT5 A;  4ES2 A;  5JJB A;  3X3U A;  2ZBP A;  3UW1 A;  2DB1 A;  4C3K A;  4N41 A;  4ZVR B;  2VAS A;  2L9D A;  2ACM A;  4DV0 F;  3MPV A;  2M7S A;  3EPG A;  1S72 S;  3KK2 B;  1FF2 A;  3RB6 A;  3IA0 A;  2ZH9 A;  4HLB A;  4IKA A;  5CYQ A;  3ONQ A;  3MCO A;  1U1L A;  2OEK A;  3T3F A;  4EZ9 A;  4A8Q A;  2CNN B;  1YTY A;  2XC9 A;  1PAE X;  1VQY A;  3HHL D;  1H38 A;  3TUZ C;  2EFG A;  2FJB B;  4FF3 A;  4CM2 A;  1TTH B;  1RT6 A;  1HYS B;  1M1H A;  3FEZ A;  5IV3 A;  2K3I A;  1IKY A;  5HRO A;  3W66 A;  1QLN A;  3M8Z A;  2V34 A;  5GAD U;  3J7A N;  4DUZ F;  2WAQ D;  5A8W B;  3B4M A;  1IKW A;  4I7F A;  2X1G A;  1U1O A;  3BN4 A;  4DN0 A;  1YK9 A;  1HQE A;  4RW7 A;  2RS8 A;  2RNE A;  1FJE B;  2IAJ A;  2DPJ A;  1HQ2 A;  1D9A A;  5D0R A;  5HK4 A;  1HA1 A;  1Q5V A;  4B08 A;  1SV5 A;  2H5E A;  2ZC4 A;  4ATN A;  1FER A;  2YPZ A;  3I87 A;  2KJW A;  1VOM A;  5KFG A;  2NZC A;  2FYX A;  4NZ6 A;  5D77 A;  1JXV A;  3S6E A;  2AYM A;  4UOH A;  3ZTQ A;  1FEH A;  2XY7 A;  3KHH A;  2MZJ A;  2J7K A;  1ZH5 A;  2N3O A;  4JV2 A;  1FXD A;  1QJH A;  2EW9 A;  3G8Q A;  3BH6 B;  4DR4 J;  2Z0G A;  4J9K A;  4DSI A;  2ZZM A;  2UVR A;  1K73 T;  3K0J A;  4QZV B;  3QID A;  2K1R B;  4BCA A;  3P8B B;  4OHW A;  1RTH B;  3MMA B;  2Y9H A;  4B3O B;  1NDL A;  2ZH7 A;  1C0T A;  4NI2 A;  2IDE A;  2E5J A;  3PIP Q;  1DHM A;  1K0T A;  1FCA A;  3QMQ A;  4HH0 A;  3T6J A;  4ECT A;  2EBG A;  3NCQ A;  4X64 J;  4UZB A;  4QJV A;  2YX4 A;  1NZA A;  2HBY B;  1Y00 A;  3CPW R;  4NLO A;  2QLX A;  2GV1 A;  2CQI A;  5B0E A;  3W1Y C;  3DLK B;  3FKB A;  4NLT A;  1HWI A;  2PSZ A;  2DGT A;  1UW9 A;  5AXL A;  2KG1 A;  1KR4 A;  2SXL A;  1XNQ J;  4OYO A;  1RT2 B;  1LK5 A;  2IDL A;  4TU9 A;  4I6A A;  2HK3 A;  2ZC3 A;  1DFD A;  2J5A A;  2LXF A;  4QPX A;  1SB6 A;  3TYT A;  2WOM B;  2G9O A;  2ASD A;  3QPI A;  2MDA A;  1S0O A;  2MQO A;  4UQG A;  1FD2 A;  5GVQ A;  2LFV A;  3OQ2 A;  2UXD J;  1PKU A;  1DUR A;  1PBA A;  3J7A 1;  1SL1 A;  2VU5 A;  1UWB B;  4A8O A;  2A6O A;  2HS0 A;  2XMJ A;  3A12 A;  3J81 j;  2Q6C A;  1MRO B;  4EUV A;  2POK A;  1W7W A;  2HHH J;  1BGX T;  1NSA A;  1YSJ A;  3MMB B;  3D1O A;  4K59 A;  3W64 A;  4P71 A;  4NWB A;  2LVW A;  1T9U A;  4RW8 A;  1IJF B;  3OHB A;  3JSM A;  4RUH A;  5U47 A;  2OP5 A;  2DO4 A;  4LF7 J;  4WF9 Q;  1CBK A;  5A0Y A;  4FBU A;  3NNH A;  1VRU B;  2AIR B;  2BVZ A;  1RTI B;  2W7P A;  5BXI A;  4DJB A;  4DLE A;  5T41 A;  4IRK A;  5FLX U;  1D9D A;  2FC8 A;  1GEH A;  3WBZ A;  3PIO Q;  2F4V J;  1FDB A;  3EVO A;  4ZLN A;  1AA1 B;  1SKR A;  2GGP A;  4FNH A;  1P1T A;  1N5V A;  4ZN3 A;  4DV2 J;  4F3M A;  1FA0 A;  3OJU A;  5IT0 A;  5GAG I;  4G1Q A;  2OH2 A;  4KRW A;  2ZOG A;  1Q8B A;  2F4F A;  5ETK A;  2AYB A;  1Y10 A;  3SCK E;  1XNR J;  3KLH A;  4FXW A;  1R6V A;  2FJA B;  1RU2 A;  4B3M J;  1XR6 A;  3BDE A;  1JJC B;  2KT5 A;  1IN0 A;  3LAL A;  1FRJ A;  4L3K A;  2B51 A;  1SJ3 P;  3CJQ A;  3UN5 A;  1RA6 A;  1Z2L A;  4X64 F;  3A3P B;  3OFF A;  4O4G B;  4DSE A;  2DRD A;  5C42 B;  4Q8F A;  1O6X A;  2PN6 A;  3OTE A;  4MIA A;  5L9N A;  4K4T A;  2MZR A;  3CCR S;  4B3T J;  1DTQ A;  1AUD A;  2MJU A;  1FKP A;  3C6U B;  2KI2 A;  8AT1 B;  2Q43 A;  1GFW B;  2ZBQ A;  3OL7 A;  1N0V C;  4OJ1 A;  4M95 A;  3SQO P;  1PGZ A;  2GIR A;  4ECV A;  4ED1 A;  4M5N A;  2MHE A;  2MY8 A;  4MJK A;  2HHQ A;  3UDC A;  4O3P A;  1DQA A;  3CJ3 A;  3OR1 A;  1IKW B;  4I7F B;  2QG9 B;  3Q8Y A;  4DL6 A;  3W5Z A;  3NWG A;  4ITS A;  4RW7 B;  5KT7 A;  2C2Z B;  3RAX A;  1SQG A;  1QE1 A;  1KHV A;  4UOF A;  2IAJ B;  3OFH A;  2N4D A;  1D09 B;  2HHH F;  5L38 A;  1CS4 B;  3A3N B;  3RBD A;  4J9U E;  4JI1 J;  4BC7 A;  3BQ1 A;  4PCQ A;  1NHK L;  3NMA A;  2XMM A;  3NOC A;  2E9R X;  3MR6 A;  4DQR A;  1S0M A;  5E3A A;  2CJA A;  4WJB A;  4DL7 A;  4E0D A;  4NXM J;  1TKT A;  3QZ8 A;  1TAU A;  1S7H A;  3L9Z A;  2WVC A;  4X4T A;  5IV4 A;  1V3S A;  4N47 A;  1Q79 A;  2KRR A;  2UZA A;  3MUT P;  1VQS A;  2F4V F;  2Y8W A;  3UD5 A;  3B82 A;  3R5C A;  2EG1 A;  3KHG A;  4M5G A;  2YY3 A;  2HQG A;  3HVT A;  3PRV A;  4FYD A;  4NCG B;  4R5P A;  2V94 A;  2QLB B;  5EN1 A;  3K5O A;  3NNA A;  4WWS A;  4DV2 F;  3MMC B;  2CDQ A;  3GIR A;  2WON A;  3S7R A;  3T6B A;  2ZZN A;  2JSX A;  3JTN A;  3OVS A;  3H90 A;  2IM1 A;  1C0T B;  3G8T A;  4JBC A;  5FLX Y;  1XNR F;  4NI2 B;  2V0N A;  3CME S;  2YKA A;  3VTI A;  4EWT A;  4DZD A;  4C3M A;  1AZS A;  3FC9 A;  4FF1 A;  2EVZ A;  1RTD A;  1VDH A;  4URS A;  4OL8 A;  1J27 A;  1VBY A;  2QSW A;  3CD6 S;  2EFO A;  1I3O B;  2IBK A;  2CG8 A;  4Y34 A;  2OD6 A;  5DET A;  4KGV B;  2AGQ A;  4A8M P;  5KFD A;  5IM0 A;  1FK9 A;  4QOT A;  3VGT A;  5F41 A;  4B3T F;  2PGC A;  2F40 A;  4DF8 A;  1SJ1 A;  3LGH A;  2AWZ A;  1TL1 A;  2Y1L B;  4F8R A;  3QYY A;  1SC4 B;  3IFE A;  4ED6 A;  3HT3 A;  4DX7 A;  2C2O B;  1U0H A;  1VR6 A;  1FD8 A;  3TA0 A;  5F9N A;  1H98 A;  4AQY F;  4G1P A;  2KO1 A;  3Q8V A;  3LP0 B;  1U49 A;  3BPS P;  1OPZ A;  3KDN A; 
#chains in the Genus database with same CATH homology
 2C2K B;  2P2C B;  2HBZ B;  2HBR B;  2H51 B;  4ZVQ B;  2CJY B;  4ZVO B;  2H5I B;  2XYG B;  3D6F B;  4DCJ B;  3P4U B;  1NME B;  5K20 B;  3KJF B;  2DKO B;  3D6H B;  2QL9 B;  2C1E B;  3GJR B;  2C2Z B;  1RHQ B;  2H4Y B;  1RWV B;  2H54 B;  4JB8 B;  2XZD B;  3R7N B;  3R6L B;  2QL7 B;  2H65 B;  3R7B B;  1RWW B;  4DCO B;  2FQQ B;  3EDQ B;  3KJQ B;  2Y0B B;  3R6G B;  4ZVT B;  3SIP B;  1RWN B;  1RHM B;  2XZT B;  2CNL B;  1RWK B;  1QDU B;  4DCP B;  2C2M B;  1RHK B;  3EDR B;  2CJX B;  3P45 B;  1I51 B;  1I3O B;  3NS7 B;  1RWO B;  1RWM B;  1IBC B;  1SC1 B;  3R7S B;  1RHJ B;  1QTN B;  2H5J B;  1F9E B;  4LSZ B;  4ZVP B;  1RWP B;  2QLJ B;  2QL5 B;  2CNK B;  1PYO B;  5IC6 B;  1BMQ B;  3GJQ B;  2CNO B;  2XYP B;  3IBC B;  2XYH B;  2HBY B;  3GJS B;  1RHU B;  1RHR B;  3D6M B;  2Y1L B;  4ZVR B;  3GJT B;  1SC4 B;  2CDR B;  2HBQ B;  1RE1 B;  3KJN B;  2H48 B;  1PAU B;  1SC3 B;  2C2O B;  1GFW B;  2QLF B;  1ICE B;  3RJM B;  5IC4 B;  3IBF B;  3R5J B;  2H4W B;  1RWX B;  4ZVU B;  3QNW B;  2CNN B;  2QLB B;  4ZVS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...