1IBCB

Crystal structure of inhibited interleukin-1beta converting enzyme
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPAGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A combinatorial approach for determining protease specificities: application to interleukin-1beta converting enzyme (ICE).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords INTERLEUKIN-1BETA CONVERTING ENZYME
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1997-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1ibcB00
3R7NB 1F9EB 3KJFB 3R6LB 2H4WB 2H5IB 2H65B 3GJSB 5IC4B 2H51B 2XYGB 2XZTB 2CNKB 3GJTB 1GFWB 3R6GB 2QLBB 2H48B 1RHJB 3P4UB 2QL7B 2HBZB 2QL5B 1SC1B 1RWMB 2C2ZB 2CNLB 1RWNB 3P45B 2C1EB 4DCPB 2H5JB 1I51B 1SC4B 1PYOB 2XYHB 3EDRB 1RWVB 1QDUB 1QTNB 4LSZB 2P2CB 2C2KB 4ZVQB 3R7SB 1NMEB 2C2MB 1SC3B 2HBRB 2HBYB 2DKOB 1RWXB 2C2OB 3D6FB 3R5JB 1I3OB 2HBQB 2CJXB 3D6HB 5IC6B 1RWPB 1RWKB 2CDRB 3GJQB 2XYPB 3KJQB 4DCJB 3RJMB 1RHQB 4ZVPB 1PAUB 3EDQB 1ICEB 1RWWB 3GJRB 4ZVSB 2XZDB 1RHKB 2QLJB 1BMQB 2Y0BB 4JB8B 5K20B 2Y1LB 4ZVTB 2H54B 2CJYB 3IBFB 1RHUB 2H4YB 4ZVRB 2CNNB 1IBCB 2CNOB 3R7BB 4DCOB 3KJNB 3SIPB 4ZVOB 1RE1B 2QL9B 2QLFB 3D6MB 1RHMB 1RWOB 2FQQB 3NS7B 3QNWB 3IBCB 4ZVUB 1RHRB
chains in the Genus database with same CATH superfamily
1M5HA 5ETNA 2J7KA 1F9EB 3TA1A 1IKVB 4DX8H 4Z2XA 1O5JA 1TV6B 3GG1A 4HEA9 3PRVA 4IG3B 2DB1A 4GVBA 3CMQA 5CHCB 3OHBA 4LR9A 3G6YA 1NNDA 1R8PA 2LEBA 4MKVA 5KFHA 1D8ZA 3QFHA 2WCXA 3GJTB 3HHLC 1F3VA 3KDOA 3VZIA 4DLGA 1JLQA 4DHVA 1K8AT 1R43A 4A8WA 3CW2C 1M5KC 2XS7A 3TR5A 1SV5B 2EFVA 1VQYA 1DFDA 5E3PA 2ASDA 1U24A 3GIJA 5JVGQ 2Y8WA 2PFFB 4X2BA 2K2PA 4PG5A 4BS2A 2DR7A 1ZTTA 2W7PA 2ZH6A 3EGVA 2ZBRA 3H40A 3NNCA 3IC1A 4JI3F 1TQLA 2M8HA 5HVFA 1FI4A 4WU2A 3HM9A 2C1EB 1QUPA 1CS4A 3GR0A 4LF8F 1ZM4A 5DM6Q 2AD9A 1LW0B 1O6XA 2VG6A 4RW7A 2VONA 4HVZA 4C3MA 5KG3A 3HI9A 3DI6A 4LVOP 4K59A 1WKKA 2VU5A 3JTPA 4NWBA 4I2PB 3N6LA 1PYOB 2F8MA 4CLZA 1FTCA 3EGWB 3IBWA 4JI3J 4J9KA 1GMWD 3MM8B 1YHQS 2HHUA 3UDLA 5B0BA 3H2VE 2PEBA 4UUXA 5AXLA 1T3NA 2ATCB 1S6QA 2BE2A 3MTKA 1OMSA 1VC6A 3DGVA 5J1EA 4C3LA 4K2XA 2F9JA 2PE8A 1VBXA 5A2QU 1H7XA 2XCPA 4DFJA 3LF0A 4QU7A 2HHPA 1NMEB 2FTRA 4C48A 2FHMA 3QLHB 3LA0A 2HZAA 2RIJA 4ENOA 3PR5B 4ECYA 1SH2A 3QWPA 4X62F 3FEYB 2CWKA 2E9ZA 1RT4A 4X4QA 1WJ9A 3D6TB 2KVIA 1X31C 5BR8F 5HK4A 2HFOA 3O8WA 2CQ4A 1PBUA 3R5JB 2IJFA 3W2VB 1ZYQA 1MW7A 2QT7A 3ZZYA 4RJVA 5I42B 4DV2J 3W66A 2D3ZA 1T9TA 4P2MA 4X66F 1RYRA 2XULA 4NA2A 1UJ6A 1MNEA 3OL8A 2KT3A 3LP2A 4QWAA 3KJVB 5K5MA 4QR1A 3DRRA 1MROA 4TYBA 3OL6A 3OXFA 4F8RA 3RJMB 1D1UA 1JK9B 4DWIA 3NGUA 4O3QA 2AWZA 1TKTB 3R2DJ 2ZUGA 4R8UB 2E1AA 3DM2B 1Y7PA 3IR7B 4QOTA 4Y2IA 4Y0FA 3CUNA 5HO4A 5I3PA 5DG8A 4OHVA 2CPZA 3UI3A 5D3GA 4ZVGA 3QRRA 2GQQA 2ZITA 2ZHOA 4XAKA 3T1YJ 3BR8A 3CJKA 2B9XA 4ZPCA 5CYQB 4ES1A 2PMZD 5HVGA 4ZK7M 1RTZA 2NXCA 1UVLA 4DFKA 1TV6A 4FYXB 1FK9A 4IG3A 3U1LA 2V9WA 4GVBB 1BQNA 5D78A 1S1XA 1AZSB 3TWZA 1HPZA 2LKZA 4N41A 5AT1B 1UEKA 3R9LA 4CLFA 3VAHA 3QJPA 3W62A 2G0CA 2GVDB 4CLSA 1JLQB 2B4VA 2YQ1A 4RW6A 1AW0A 4I1TA 3TAPA 5CD4A 3SYZA 2MZSA 2C22A 1KQSR 2PT0A 1U6ZA 3HT0A 4DR1J 1XNQJ 2OFGX 4ED0A 4H4MB 2EK6A 4OYXA 3MMAB 2QL9B 3K8VA 3KNAA 3GR1A 4A8SA 4CH7A 3H5YA 4Y3CA 1OQ3A 2XHWA 2QN6B 1IKXB 4LRDA 4RKUC 1HIYA 1RU2A 1Y3JA 3SCJE 3OW2R 2FDNA 2MJNA 4OYWA 4F02A 1EKRA 1X5TA 2O1PA 3DLKA 3SXLA 2GZOA 4DUYJ 4WCEQ 1NDCA 1YITS 4C0HA 2DO0A 2V4JA 4N5SA 1F1BB 2Q43A 2W24A 2IJRA 2JFKA 3FC9A 1X4GA 3A8KA 2DNPA 1SB6A 2RF2B 4I2PA 1TVRB 1KLNA 1KC8T 2HS4A 1X4BA 1S10A 1V3RA 3ENQA 3V6DA 3FK4A 2GVZA 3TA0A 4RNFA 4AQYJ 1GX5A 1TKDA 3WZ0A 4O23A 3C3LA 2C3OA 5CD4H 4FBTA 2NS1B 3S7RA 4OX6A 2AEFA 5C24A 1N54B 1IKWA 3DYAB 1RCXB 1HL6A 1KRPA 2XWYA 4RW4A 1M5PC 1I6JA 2MYFA 3AB2B 4M8LA 4IG0B 2WB1D 4DU7A 2XY5A 1FDNA 5KG1A 1AROP 2HWTA 2W7AA 4CO5A 4I4BA 2J8SA 4NX9A 5ETKA 3D1HA 2HVDA 1PSDA 2HNYA 1WI8A 2KT2A 2D7SA 2GJFA 3DRSB 3JSRA 3QAEA 1FRKA 4KFBB 2CQCA 4OZ3A 4DCPB 4YR3A 3G82B 3W2VA 3RZAA 5FIIA 3SFUA 1NH7A 5EX0A 2W9CA 3G87A 5FDLA 1SC4B 4EGLA 2WVDA 2ZDPA 2DXDA 1EAYC 3KUHA 4C8KA 4WPAA 2ZJRQ 3VQSA 1YRUA 1MROB 1N5TA 4R0JA 1YQHA 1VRQC 3BB5A 1X4AA 2V2QA 4G65A 4KAIA 3RRKA 3R2CJ 1X4DA 3QT5A 4O4GA 1QD1A 1IUJA 2HHXA 1R8HA 5GAHU 1T03A 3GPAA 3NGRA 3R1LA 2VIHA 2NZCA 4QWCA 1KLMA 4BBYA 4ZLPA 1S6UA 2AX1A 4GMKA 2M9KA 4N8OA 3OV7A 3OLAA 6FD1A 3Q89A 4YN3B 1KTQA 3BGRB 3ZFVA 4UUWA 3CJKB 3TQEA 4B3OA 4NLWA 3SSSA 3QFWA 1WNEA 1LFWA 4USIA 3HKWA 1YLXA 1KVIA 4IRCA 3IN5A 4NMXA 1S7IA 2W2QP 2R7UA 1VIXA 4DR4J 1RTHA 3C19A 3LPYA 2ZZTA 3M6UA 1VC0A 3C16B 1H98A 1Z2ZA 2CPHA 3TZXA 4J5OA 3BDPA 1SH3A 2VQFF 1R8AA 1N5SA 3W63A 4IOBA 5A8WA 5C25A 1B7FA 2IA0A 3C14B 4CWBA 4ILRA 3D0GE 4H4KC 1TK8A 3VVTA 4C3KA 1RWUA 2FUG9 1FRMA 3AFGA 3CIZA 4YB5A 4OLPA 2E5LJ 1TL1B 3IS9B 5GMDA 4TY8A 1RHKB 3L3CA 4KTQA 2LDYA 2C3YA 4KH0B 1HNWJ 2Y0BB 5I4MA 1N34F 2ADBA 1JXEA 3WX8A 4NYZA 3HMJG 4B3TJ 4K0KJ 3P5BP 1T11A 1FJGF 1N56A 5LMNJ 2YNHB 2EVZA 3ENAA 3K8WA 2FPHX 1AFIA 4J9PA 3AODA 4DV0J 4MFBB 3PHTA 5CYMB 1LWCB 4BC7A 2LU1A 3PKYA 2UU9F 4NLXA 1H3DA 2RAQA 2B4UA 2HHTA 3NY0A 4DF4A 2KHDA 4B3MJ 4JP8A 1KOOA 5D4PA 4RUHA 2YKMA 1CJVB 4HH1A 2M7SA 2VASA 3J81j 1TAUA 2RILA 2HFNA 2FHOB 4A8QA 1RYSA 5CH7B 4PQUB 5KFXA 1RTJA 2RB7A 3HVAA 4A47A 1TKXA 1DARA 2LQ8A 1Y4ZB 1HBUA 3TAMB 2ASYA 2VICA 2NXEA 4F3MA 1VGYA 3HO1A 3EYZA 2O67A 2NCKL 2F7VA 5EDWA 1SKSA 2QEXS 1T9XA 2ZOMA 5IT0A 1HWIA 3NWGA 3CCUS 2VHGA 2DGXA 3ENVA 4J90A 2W9CB 4PWWA 2J0WA 3JTNA 3HHLA 3U27A 2MKSA 3PW0A 4B3SF 3BH7B 1FNOA 3GJSB 3MCOA 4NLUA 5AXKA 3QO9A 3CJTA 2LEAA 3KK1A 2XLIA 5DLFA 1XNQF 3I0SA 4ZLLA 2MJUA 3R6GB 4WFXA 2A6MA 2DK2A 4N77A 4Y2KA 1VIOA 4X66J 4DR6F 4TU9A 2VUGA 5D0GA 3IM8A 1BE4A 1RT5B 4EZ6A 1VC5A 3D54A 2B9WA 3IR5B 2HBZB 2W25A 1C0TA 1DBDA 1NEEA 1Z1ZA 2F8HA 2WB4A 4HHUA 4XTTA 4YQWA 2DHHA 1ZA2B 1JXLA 4QW8A 1LEOA 4B9LA 4KPYA 4USUA 1B7YB 4F4YA 2CQ0A 2RHSB 5IM0A 3NNAA 3BPDA 1YBAA 3P45B 5IXUA 4KSEB 3IWXA 1NPPA 1PILA 4ED2A 4K2JA 4W90B 4WWSA 4CP5A 1KFSA 2HVIA 3S6EA 4NLYA 1EKSA 3CCES 3VALA 1PBAA 3RG6A 2Q3PA 4EWTA 4F4ZA 5KG5A 1NKBA 1F5BA 2C3MA 3C16A 1QTNB 4FF3A 5EWGA 4ZP7A 1BY9A 2KM8B 1LFPA 2UUCF 2P2CB 2H9ZA 4X4NA 2KO1A 3BSCA 2DHSA 4ZVQB 3J7A1 3C14A 4PZVA 1NK6A 4EYIB 3R7SB 5BXIA 4DR5J 2NPFA 3PG9A 2QSWA 5BR8J 4ED5A 3DLGB 2KH9A 2XQCA 5J2PB 3QZ8A 2R7XA 4RR5A 1IBLJ 3V4IB 3K5OA 2MQ8A 4FYVB 3ZXWA 1J5EJ 2QLWA 2E5HA 3MEEA 4PYAA 4ZITA 2OPQB 1WF1A 2VF3A 4M5MA 1EETA 1X0FA 3GCXP 3MTJA 5CQGA 3IG1A 4DPUA 1DHMA 2LQBA 3IR6B 3T5JA 1UP1A 1YJTA 4C11A 3DI6B 2KFZA 1SJQA 5F8GA 2E44A 1EHWA 1FKPB 1FVSA 1FX4A 1RT3A 4LRBA 3LUYA 3SQOP 4RW8B 3ZZRA 4LF9J 2OH2A 3FZBA 2CQ1A 1FTRA 2ZJQQ 2N3LA 3QGIA 1LW0A 2VG6B 4U9RA 4DCJB 3UNGC 1TP7A 5KFMA 1YTYA 5J1EB 1S0OA 3D1QA 4OYZA 2KXHA 3JB9k 4JI8J 3OFFA 2MZRA 3BSAA 3VAIA 2FVPA 3VGSA 1DTTA 2XZDB 3MM8A 3FDSA 3QLHA 5K8OA 2IDLA 4F0KA 1CC8A 2KI2A 2MSTA 2UUWA 3DRXA 3K5PA 4M5LA 3OR1A 1MMDA 4IO1A 3RGIA 4OZNA 4A8KA 2HAIA 1WG5A 3Q2SC 2YPZA 1N0VC 3AH6A 3VTIA 3NS5A 1A7GE 2E1MC 4OZ5A 1B0TA 4Z7YA 2VG7B 4BHQA 4F2RA 2OELA 4KB7A 2J6UA 2AF6A 1XNRJ 3TJ8A 2WVFA 1P1LA 3I87A 3RR7A 3MXHP 3NXZA 2A2CA 4BC9A 4CTAA 4E2FB 2WHOA 2KHCA 1UVMA 3IA0A 4CLYA 3KG4A 2BQRA 4Z37A 1CJKA 2X3DA 4L73A 4NA3A 4HYKA 3QPIA 2MXYA 2CQBA 3OPKA 1Y5NB 3QBCA 1X7VA 2UVRA 2Q79A 4KGVB 3G86A 4TY9A 3F41A 5E3QA 3T1HJ 1U02A 3CWJA 4F4WA 2DR6A 2QLFB 5ETLA 1HQUA 3DM2A 3GE9A 5B0FA 4HHJA 4JV0A 5A0YB 5KT4A 5AJ3F 2J9CA 2G2OA 4TQRA 3FSIA 1WHYA 5ETRA 3NS7B 4C7QA 3RR8A 1TL3B 2AT1B 2LMIA 2C2EA 4JYAJ 1FFWB 4IDKA 4J9QA 2MB0B 4JV1A 2DISA 3FEZA 4O0IA 4DV6F 5HBMA 1F60B 1RB0A 2CG4A 5GVQA 3GU0A 2CQIA 2LCWA 2YWEA 3TX0A 3KHLA 1NO8A 4B9VA 3AXKA 4EI2A 1S99A 1FA0A 2EFGA 5HL7Q 3CPWR 1IKYB 3W1YC 3SV4A 1XMOF 2H51B 3BGFA 2XYGB 2JVRA 3A3PB 4I2QA 1HLWA 1S1TA 4F0HA 5F8HA 3MZIA 4JI7F 1K44A 2GX8A 4OZ1A 1RAAB 4DOZA 4F4AA 3OXLA 4WP9A 3EXCX 4GO5X 3T19A 4ELTA 4B3RF 2AYGA 3DLEB 1NJZA 2QG9B 2R42A 3LANA 2C3UA 2MQOA 2BKPA 4PWUA 4HLBA 4QIEA 2NUHA 3B8HA 3ZZOA 5BYSA 9ATCB 1QVFR 4RW6B 1ZZFA 4WZQA 1GK8A 2AJFE 2V34A 2P6TA 3D1OA 4M5DA 1HQEB 5FJ4A 4DSFA 2HGLA 1GXLA 1VQOS 3MM9B 4Y2MA 1TL4A 5KT3A 4RBUA 5AE2A 4ED6A 3ILOA 1VRUB 1ZOTA 3M8QB 1G7CB 4PABA 1S1WB 1NSQA 3WIVA 4XO0A 5HP1B 1DTQA 2DNKA 4OI3A 2AGQA 2XI2A 3SQGA 1MMNA 3DDKA 4EBDA 3EPGA 1NSPA 1JNRB 1CVJA 5D0HA 3M9OB 4DQSA 3TZWA 2FC9A 5L38A 1N5VA 3ET6B 4CO3A 2NLWA 2BE9B 2BX6A 4LFAF 3R97A 4DX6A 2VG5A 2VKRA 3W7BA 2R7TA 3MEGA 5K14A 1AZSA 2GVZB 1X5SA 4MYUA 1C1CA 4RW9B 2DO4A 1N33F 1NAQA 4WXWA 1X5PA 5CYJA 4Q5VA 4M94A 2N3OA 3RB4A 2V5HG 2G2YA 2ZZNA 2ZUAA 3H5UA 1QTMA 2CJXB 3RYLA 3ETOA 2BJ3A 4P72A 5FDLB 4QQBA 3V81A 4DV2F 1VK8A 4K4TA 1PJ5A 5KFYA 2HK3A 1FRIA 2CPJA 4K5SA 4EBEA 3OVSA 2MKCA 1K1SA 1HHSA 2FVQA 2M8DB 3HVTB 3KLIA 2N4CA 2E29A 5LMNF 4J9UE 1B0PA 1RBOB 2MKIA 3GJRB 4MAKA 1X4HA 2WOMA 4A46A 5L1LA 2CQ3A 3C6TA 3ETMA 4OL8A 3EZOA 1TL3A 4HR2A 4ZVTB 4P2XA 3LAKA 4RBVA 5KFSA 5IT9Y 3B54A 5KFLA 2IIHA 2WVEA 1RTDB 4YUDA 4WYLA 3KLHA 2LXUA 2JSXA 1H72C 3CJ0A 1IM6A 4WFBQ 1IKWB 3DYAA 3BH6B 4IH7A 1UVKA 4NYPA 5KFRA 1IBCB 3CCLS 3MCMA 1S1TB 1EQMA 2RE1A 2RD5C 2M0GB 4RUAA 2CNOB 2DY9A 2NREA 2DEJA 5IWAJ 1K1QA 3FRZA 4KFBA 3GTYX 1PG5B 4RBTA 2WTFA 3QJJA 1DQAA 3X3UA 2FGOA 2DHXA 4B3MF 2YQ0A 3CJ8A 5LMUJ 3RTVA 1LWEA 1AFJA 4DR3J 3M8RA 2R7OA 3O5TB 3HULA 1HQEA 5DDRC 1OY8A 3CC2S 4OYBA 2AIRB 5J2QB 2IM2A 4J91A 1PCAA 3MR5A 1WTBA 2HLUA 3ISZA 2ZVIA 4OV6A 3E2EA 3W9IA 2R7WA 1GFWB 2VPZB 1IWGA 3FMWA 1Z2LA 1TL7B 5DDOC 1MU2B 3FBEA 4OI1A 2ZOGA 2XMUA 2DD8S 4GO7X 2VBZA 4I0WA 4B17A 2MTLA 3PDNA 3FJ2A 2QA1A 3CVKA 2BJEA 1Q0NA 2LLZA 1CJVA 2PEHA 2LP4A 3LP0B 2X51A 4CO1A 2Z57B 2YTCA 3SSRA 4IYQA 3PCOB 5KFQA 2E9RX 3BM7A 2XBPA 3LAMA 4ICLB 4A8OA 3JYTB 1VQPS 3FNNA 1GMWA 2VPYB 2Z8QA 4CM0A 5D6GA 5F8IA 4HH0A 4ZJOA 4I6WA 3L09A 1RAJA 1X8DA 3M05A 3V6JA 2FY1A 2Y8YA 3QIDA 1T05B 3GCWP 3T6BA 3KLEA 2ZH2A 2WONB 2ZKUA 1D9AA 3H59A 1Q53A 2GFFA 1GTEA 1J5OA 2R8GA 3J81U 4WK3A 1VR6A 2HFSA 4DEZA 2CPFA 2GQ2A 2WOMB 3R5BA 3QATA 3QIPA 2VQEF 3OQ2A 2VPWB 4K5RA 3TUZC 3BPSP 4DN0A 3BQ2A 1TU0B 1Q7LB 1CEZA 2I9SA 2HBRB 3KFWX 3BR9A 4LF1A 4MYTA 3OL9A 3EJMA 1TMMA 3M9NB 2OEMA 5T7LA 1S0NA 2GIQA 4MTPA 5IWAF 2J0XA 4FF4A 2MLXA 2K7JA 2QV6A 5G4DA 1KQKA 2DHGA 4D3GA 1NB7A 4J7CA 2IY5B 3GFYA 2E5JA 5KFUA 3M6VA 4NLOA 5B0EA 4YDXA 3HZGA 1N88A 2MHEA 1AUDA 1RWPB 4B9UA 5BYQA 3I32A 2EKYA 2YX7A 2E1RA 3ELHA 1WHWA 2CA9A 3LP1A 3TAMA 5C42B 5LXYA 1IBKJ 4QCLA 1UWBA 2BM1A 2MSSA 3OTDA 5DS7A 4X65J 4RU9A 4X4UA 3E3XA 4O0NA 1NDKA 5KAKA 2C2NA 4DPWA 1N5YA 1RAGB 1RT7B 4JV5F 2ZH4A 1PC5A 1FDBA 3W8PA 4C9DA 3L4BC 1E6YB 4HKQA 2V6AA 3EWGA 4P2FA 3FBCA 3NWRA 4OX9J 2XLKA 2ZFHA 1X9WA 4Y34A 5DO2A 3HF5A 2FIUA 1FCAA 3GIKA 1IN0A 1VQSA 3BF4A 4C11B 2H4YB 3E01A 2F63A 4ZVRB 2GIFA 2BBEA 3AQOA 2OLWA 3A1YG 1WC5A 2JZ5A 2KRRA 4RW8A 1JLGB 1U48A 4LF6F 2OPQA 3MUVP 4HDHA 3FFIA 2XMKA 3UVJA 2WAQD 3GFHA 1WEYA 3HSJA 3MECB 2HIQA 1YIJS 1RAOA 1PKUA 1G4CA 2NUUG 2NYHA 1RQ0A 3DRPA 1U26A 3C6UB 3KJNB 2YNGA 2NXJA 4H4OA 3V4MA 1NXIA 4WYWA 1EARA 2BYCA 2YXLA 3VF0B 3J7ZT 4LFAJ 4E0DA 1QAIA 1ZBTA 4RZRA 1Y9OA 4AUKA 2FQQB 4QIGA 4EFAC 1MWQA 3FVYA 1NKEA 4IUFA 1N8RT 2YKAA 3OR1B 1Y3KA 4IOAQ 4R5PA 3NKYA 2WSEC 3QSIA 1X4EA 2QMXA 3D0IE 1VJWA 2BA9A 1DTTB 4URQU 3L7OA 4BCAA 3BQ0A 3PW4A 1KVKA 1HNIB 1RT6B 1T0TV 2B0GA 5AXNA 3R6LB 5DDPC 4C8LA 2R4FA 3KHHA 1UFWA 1S9FA 2W4DA 3DOLA 2FZKB 1F3FA 2OTLS 2J9DA 1JLAB 2HQFA 2AJ4A 1Q8BA 1FE0A 2VG7A 1JIHA 3AT1B 3MEEB 4USVA 1J5OB 3M1VB 1LV5A 1GMUA 2HQCA 1P9YA 4LSNB 4FF1A 5HQLA 3J80U 3T1AA 4DSKA 2HK2A 2B8PA 2F40A 5G0RA 3KLGA 3TRGA 1RBLA 1SC1B 2ZC3A 2X3GA 2AJ2A 3DMJA 1CJKB 5GAGU 4ZJQA 2YBVA 3FCHA 4DV1J 2DJWA 1HNVA 1CQMA 4ZHRA 2P9GA 5ETQA 3W9JA 1PIEA 1N5QA 1HQUB 2FHJA 3MEDB 2YWHA 1GAOA 2OTJS 3QT8A 2XYHB 4F2SA 4EO6A 4ZPAA 3OJUA 1IKYA 1KS2A 1BGXT 1FNMA 2BANB 2DNHA 4USJC 1BC6A 3MMBA 1HI1A 2VC0A 3N4WA 1HR0J 2BOPA 4OJ3A 2E5LF 3CCJS 1CG2A 2GW8A 4ZN1A 1VQ8S 3F44A 3SCKE 3GZ7A 5HROB 1N5YB 1VQLS 2C2MB 2IFXA 2MZQA 2EK1A 2DGTA 2DYAA 4HTJA 4M5GA 2HWIA 4L76A 5DM7Q 2IMOA 3KK2A 3OTEA 6FDRA 2OPPA 5A8RB 4LFCF 4OV1A 2HWHA 5MAOA 1ZTWA 1RWXB 2Y3YA 2OSRA 2VV5A 2B56A 2Z58B 1OSDA 2ASLA 4KV8B 4OMFG 3G6ES 4OYPA 1L3SA 1JLCB 2GCFA 1HW8A 1NK5A 4H54A 5SZTA 1QSYA 4PCQA 2XMTA 5A8KB 3M6XA 1WOOA 4OYOA 2ZWPA 4RWWA 5M2UA 2WVCA 2VFRA 3ZTQA 1WC3A 3DRPB 1FKAF 1RWWB 4O3NA 4DXLA 4DV5F 1VHFA 2D9OA 3AD9C 3MPDA 4WBFA 3TNVA 2PSZA 1LXNA 2DITA 3W61A 1URRA 4JB8B 2IYIA 2AZ1A 3OFHA 2W8KA 1TFWA 3TX8A 4P2SA 5LSOA 2EWHA 4OZLA 2CKWA 5CABA 2UUTA 4F67A 2YKNB 2GGPB 4AYBD 1SV5A 2Z56B 3JAMY 3Q8VA 4LR8A 1SL0A 4NASA 4QIFA 1EJ7L 3I56S 2KFYA 1Q8IA 3WDOA 2ZC4A 2ZH8A 2WW4A 3QGPA 4KQZA 3Q22A 4ZOSA 4MKBA 1RAEB 3CCVS 2MZTA 3T9ZA 1NHVA 1C0UA 2F1FA 2L9WA 1SBRA 2PC6A 2XO7A 5DETA 1TKZA 5KFBA 3AOBA 2FLPA 2HYIB 2OJ3A 4DR7J 3AAWB 4F50A 2DH8A 5I3UB 3IFEA 5KG6A 2EFQA 3DRRB 3K58A 2LXFA 1DQ9A 2AP6A 1HNXJ 2JHEA 5HP1A 4QPXA 2FJXA 2G4BA 3IBCB 2Q6BA 2CQGA 4DR7F 4NLSA 1R0CB 3RBXA 2K8GA 3BO2A 2CPDA 4Q7AA 3BBFA 3BN4A 1NK9A 5KTQA 1SUQB 2M88A 3EGNA 4TU7A 4UQGA 5LMUF 2A10A 2H5IB 3TZYA 2R2TA 1T9UA 1ULRA 1SL2A 2ZBIA 2D9PA 1FF2A 1YK9A 2XMWA 5B0GA 2G1HA 5DQIA 1S1VB 2L48A 4RW9A 2O5DA 3P8BB 5F3ZA 2XNQA 1H2VZ 3KLHB 1GX6A 1YBTA 3LGMA 5JUMA 4F3QA 1JKHB 3HHLD 4NCGA 2W4CA 3Q0AA 4NLGA 3W5YA 1U2RA 3RBZA 3EPIA 4BWMA 4LF5F 4KHPJ 3C15A 3RB0A 1T8EA 1RT4B 3LQVA 1FXDA 4PXBA 4PQUA 2DPJA 2XMAA 1H6KX 4JBCA 1YJNS 1UPPA 3K0JA 3ITHB 1V6HA 3VGUA 4KGZB 3MR2A 1UW4A 2HGMA 4YDDB 3MR7A 1TKTA 3TI0A 4LR7A 3SCIE 2QIFA 3OTOF 2DNMA 2ZJPQ 1N32F 2B4PA 4L75A 2WVBA 3TARA 1LKZA 1G6BA 2OEKA 5D3GB 1XJWB 4NPOA 4F0MA 1TUGB 2ZZMA 3HXMA 4B9MA 3PIOQ 1DLOA 1Q16B 1C4AA 1SCJB 3ISND 1Y00A 3EZ5A 2OFHX 4XPCA 3C2PA 5CYQA 3HSGA 2ZBQA 4OYIA 4K7QA 2ZH1A 1VJQA 1TUVA 3K89A 3I4HX 4ECQA 5KFCA 4LVNP 3KHRA 2JNJA 5K9FA 4U7UK 3TA2A 1TK5A 2CQ2A 2XG8A 3ZZUA 3CGIA 4MH8A 3MMCA 1FXLA 4KHPF 4NLQA 2COLA 5GAEI 1W2BR 4CLLA 1P27B 4ZPBA 1NZAA 2ADCA 4JI6J 1VDHA 2ROEA 3GV8B 4DLEA 3ADAC 2OIHA 4HT5A 4QU6A 2DNGA 4ZPDA 2YWFA 3TUPA 1ZM9A 3FCVA 4RUBA 1RDRA 1VQ7S 1UA1A 3OT9A 3CCQS 2HRUA 3KJQB 1KD1T 1TTHB 2HAFA 1LQ9A 1UEUA 2Y0SD 1NZ8A 4YB7A 3DLKB 3FRYA 4KO0A 3KHGA 3PZPA 3HLUA 1C0UB 2GHWA 3GONA 5IOLA 4M5HA 1WHVA 3KG1A 1ICEB 3N79A 4DR2F 1ZAXA 1WKJA 3PJXA 5HROA 2KM8C 3DKDA 1WHXA 2B7BB 4CLPA 4WKRA 4BWJA 4M5NA 1S49A 4MJKA 3UDEA 3LWLA 3H20A 1IQZA 1F5AA 2GMLA 2K3IA 5E3RA 3MAAB 1D0EA 2RU9A 1OY6A 5AE1A 1DURA 2DIVA 3BDEA 3I9ZA 2MGZA 2HVZA 1T03B 3MPWA 2N4DA 2LQ5A 2GJ2A 2OAUA 2OHDA 5ETMA 4ZP8A 5C24B 4DQPA 4X4OA 4K0KF 5GMKa 3BGRA 4RW4B 4M5JA 4FXDA 2VFSA 4FNIA 1M5SA 4Y6IA 1BHNA 3LH2S 3LP0A 4JI5J 4QWDA 2I38A 3TOQA 4QBUA 4ZCLA 5SUHA 3W2WB 2V8VA 4CNZA 3N9UC 4LREA 3QRQA 2Z30B 1U1LA 5D15A 5IQQA 1N6QB 4EUVA 2QGFB 4P7VA 4FS1A 1CC7A 1XEZA 4OI4A 2BJDA 5DLGA 2B6AB 4CT9A 3OFEA 4WFYA 3MM6B 4O44B 3W5XA 4PWDA 1NSKL 2QFIA 2VDIA 3QMQA 2WONA 4LRCA 3WC2A 4U7CA 1NJWA 4DR1F 2XS2A 4LFCJ 1PAEX 1NB2A 2W2PP 3G82A 3M32A 3MI7X 4USKA 3OTCA 2DRAA 3JAMU 4LF7F 4JI4J 1HARA 2OPSA 1TUWA 1VYAA 5IQ6A 4KR0B 2UP1A 1ZAVA 3DLBA 2DNRA 1H74A 1VBZA 2F9DA 2YWGA 1IR0A 1DLOB 4WTYA 1H2TZ 2WBRA 2CFXA 4YEAA 5E2QA 3DRYA 4NOHA 2RS8A 3K5LA 3N5FA 3NGTA 4YB6A 3KYLA 1NK4A 4IH5A 4FN5A 2AJ1A 3PO4A 4H4OB 2DNOA 4FVMA 3SDEB 2KFNA 4U7UD 4ZA1A 1MG7A 1N34J 2MQPA 2JC1A 4RX6A 2C2ZB 2CNLB 3I6PA 3W5ZA 1B3TA 4Q2MA 4W4MA 2MKHA 4M5IA 3OJSA 2H5JB 1T3OA 3PACA 3Q8YA 3QRPA 3LOUA 2QE5A 3J7AN 4ETZA 1HNIA 1RT6A 4DX5A 4MKYA 1NBEB 1W26A 4K4UA 3KTQA 4NLVA 4LSZB 4OJGA 4YB1P 2HSEB 3QZ7A 1VQMS 3DFEA 2HHHF 2J0SD 2I8EA 1BQMA 1OIAA 3JXOA 4JI1F 2YNHA 1GH8A 1OQ6A 2GMHA 5C2GA 3GIIA 3RRGA 3PIPQ 5DG7A 4DQIA 3HHLB 3IP0A 4O3SA 1N33J 2I5JA 2N7YA 2V67A 3H2UB 4NEZA 1FD8A 3NAHA 3CDUA 4U8VA 1M1HA 1AA1B 4CLTA 2IC3A 2J9EA 2MKYA 4V1Ak 3UD5A 4ALZA 3BEGB 3M4XA 2X1GA 4AT1B 1AUSL 1XMBA 3MFIA 1SQEA 1S76D 5E3AA 1VI7A 4FP9A 3QT6A 2E1PA 1U6FA 3OR2A 3PYFA 5AXMA 5H1SV 4LF4J 1RAFB 2VKZG 2PMHA 1VRTB 2FHJD 3A8JA 3MEDA 3N01A 4QR0A 1RTJB 5G0RB 2MY8A 5KFDA 3KLGB 1YX2A 3J7YI 1YG0A 3DHXA 4P52A 2HS3A 2RSQA 2UV8G 3CT9A 3NBPB 3AA8A 4G3IA 1WDDA 1RT2A 2CPIA 1F9FA 4FXVA 1M90T 1H73A 4B3SJ 1WKLA 4N76A 5CAAA 3Q8QB 2OMLA 5E41A 2UXDF 3DCAA 5ITHA 1UZHA 2JWNA 5J2MA 5IZHA 2K3KA 5A76A 2ZH9A 2B9YA 4JI0J 5E3CA 4LF5J 2HNZB 4EK2A 2Y1LB 4KKOA 4WTOB 4PXDA 3RAXA 1JNZB 2AV5A 3I9V9 1ZZNA 4JI2J 1F2GA 3KK2B 4U6PA 3DOLB 3I0SB 2OPPB 2LDIA 2PIIA 5A8RA 1HWUA 4B3RJ 3CC4S 2Z2MA 2ZWOA 1JLAA 4DL3A 3CCMS 1JLBB 2KYXA 1WACA 5HQ8A 1WTFA 2KXNB 3I4PA 3KDNA 1N36F 1Q8KA 2MMYA 3H25A 2OPSB 2IRXA 4WJBA 1HNWF 4ES3A 4K50A 2V68A 4CO2A 2QLXA 4QYRA 3QO9B 3ULHA 4Q44A 3V4IA 1KBRA 2B4OA 1SIZA 4JI5F 4KYZA 1PO6A 1FKOB 2AX0A 1FJ7A 3NG8A 1B0VA 1YZ6A 3MD3A 1U8WA 1HWJA 3T6JA 3ZTOA 2BJ1A 4Q8EA 1UVJA 2ZM6J 1S6PA 1T9VA 1GNKA 1WC4A 1X5OA 2DNNA 3PM9A 4WFZA 5KFKA 2UU9J 2KU7A 5KG7A 4ILLA 4WFAQ 2QTWA 5H9FJ 2IBKA 2JC0A 4ID5B 4DPTA 4KJIA 3AOAA 3EVOA 3H8YA 2PD1A 2M4MA 3D3BJ 4CRJA 2KN4A 2BANA 1HD0A 4ZVHA 5KOXA 3M9MB 1GEHA 4QIVA 2EBGA 2QYGA 1REVB 5T41A 4JI0F 3T3FA 3MPYA 3PY8A 8RUCA 3WHIA 3IGNA 5HVHA 2V2KA 1RJJA 2D3O1 2OMOA 1IVZA 4YHHJ 1S72S 1FE4A 1S1XB 3IAM9 4DFPA 2DY1A 5KT2A 2HQ3A 4ECTA 3DLLQ 4V19J 2HHSA 1KP6A 4A8FA 2OI2A 1UPMB 1S9EA 2DGQA 1LNQA 4P73A 1CULA 2BXJA 1S1UB 4NZ7A 4KPCA 5CZVA 3EGZA 2R7RA 1CLFA 2GGPA 3CXCR 4CT8A 2B5JA 2F4FA 2N82B 2X1AA 4GC7A 2PO4A 2J7WA 2ZDOA 3HJVA 1XR5A 4QZVB 4X4PA 4I67A 1IM4A 1U0SA 3POTA 2GMJA 1B64A 4YY3J 5J2PA 2IC3B 2VA2A 4LQ3A 2VOPA 1JLCA 3TZZA 4LIWA 1RSCA 5HMXA 4XIUA 4I69A 2XM3A 4OI0A 3DU5A 1TMJA 1RA7A 3F73A 5D8HB 4FPIA 3OR2B 1TKZB 5A8KA 4IH6A 5ETSA 2JEFA 5A0YA 4ZDNA 2BW7A 1NRKA 3GSDA 1ZM2A 1G3OA 3OBIA 3TVZA 1YJ9S 4PUOA 1RWVB 2HS0A 1QDUB 2VFTA 4TYAA 4ZP6A 2CJ9A 1WG1A 4IDKB 4PEOA 1Q86T 2C2KB 3DOKB 4LJMA 3UW1A 2YY3A 3CULA 2HFZA 3HVRA 5E0OA 1HHQA 4HI2A 2GC8A 4DZ6A 3M2VA 2NXUA 4TLRA 4NI2B 1R0BG 3HSZA 3I0RA 5J2MB 2YKNA 4RNNA 2FLNA 4YR0A 5KFEA 4FKXA 2XB2D 1Y5LB 4X4SA 1U45A 3PRBA 1DRZA 1FNXH 4S0MA 3HX9A 1Z4UA 2LQJA 1HYSB 1F2HA 1EB0A 2BW2A 5KG4A 3OVBA 2O66A 4DQQA 4FYYB 1KHVA 4DR5F 3IM9A 3IRXB 1JLBA 5AJ3J 4P10A 3CD7A 2XSJB 4K4XA 4PKDB 2FHKA 5LJ5Y 4DL6A 3W64A 2EXUA 3D6FB 3I5BA 3M2UA 4N8NA 1I3OB 4F7VA 4PPZA 3NCRA 5L8RC 3OSPA 1CSJA 2CYYA 2KDOA 3KNGA 4B9NA 3G9CA 3K57A 3DLJA 3N6NA 1XMOJ 1MN7A 2JVOA 3BS9A 4M5DB 3H98A 2W2NP 3H2LA 3ITHA 4ED4A 2WRMA 4NYOA 2HPUA 2J76E 4OFZA 1VQ5S 2LA6A 4LMZA 2X1FA 2FJWA 2BVZA 1RCOB 2K7KA 2FVSA 2F5GA 2QLJB 1SUQA 5FD1A 2VA3A 4KBIA 3UNYA 1M1GA 2DT9A 3THTA 4IR9A 1N52B 1FD2A 3NGKA 2GV1A 3JSYA 8ATCB 1JJHA 1LWFB 3CJ4A 3NGSA 4IFYA 2HZCA 2GHPA 3MFHA 1I5OB 1JJ2R 5KFJA 1KSPA 4CYUB 3DLHA 2JEJA 1R6YA 2Z0GA 2RMLA 3IBFB 1U25A 4OHYA 1KFDA 1J27A 3CCTA 2L9NA 2E5GA 3O2IA 3OVAA 3H42A 5F0WA 1HD1A 3GB0A 3GIMA 2BOAA 1S9EB 3MMCB 3FQKA 2QMWA 1S1UA 3C46A 4U8YA 2OD6A 2KZZA 2H3EB 1GQEA 2A1BA 4ETXA 1RI7A 1UTAA 2ZBPA 3G2XA 4JI1J 4DV6J 4QIWD 1H38A 4X65F 3B6BA 3K7RA 1KWMA 2FLLA 2EFPA 2HHHJ 2RRNA 2I6WA 2F4VF 1QSLA 1V5VA 1Q5YA 2HFVA 5B09A 3IO1A 2AMCB 3VAFA 2FJBB 4PR6A 3IWLA 5H9EK 2HMIB 2KG1A 1PC4A 3QNWB 5F8NA 3IGVA 5HMWA 3U1MA 2XCAA 1C1BB 2OPRB 4X84A 3HKZD 1L3UA 4L74A 2XNRA 4DL2A 4JI7J 4USMA 4ZVEA 1XR7A 5CCMA 2K1RA 1GXTA 3ICLA 4C2MA 2IPOB 5K8MA 3OHAA 3Q8UA 1I94J 3CD6S 1GMVA 5KG0A 3UPFA 1SH0A 4RLEA 2DCLA 5FLXY 2BKOA 1S1WA 5F41A 4UZBA 1RTIA 2YPYA 1TAQA 1Q78A 2HG4A 4JI8F 3TUIC 4LF9F 3MEGB 4HI1A 4BLGA 2RQCA 3DXSX 2XI3A 3W65A 5C5JA 4LQ9A 3SZ2A 3BV8A 1HI0P 4MIAA 2PMWA 4KIAA 5THWA 4ILMA 4UTGA 3RB3A 2RDDA 2LU2A 3M8PA 2EC2A 3Q8RB 5HJYA 4C8YA 3I82A 1AB8A 1SJ4P 1W25A 4C98A 1Y0HA 4HACA 1HBUB 1ZA1B 2R8KA 1O8BA 3O1LA 1C1CB 2MPUA 3IAS9 4FF2A 2YKPA 2Z2LA 4A8MP 1WDTA 4G6VB 1L3TA 4RUCA 4CLWA 3A8IA 2KXFA 3GYXB 3KLIB 5BYRA 2VJVA 3M2RA 2Y9HA 1SQGA 4KO0B 4CI0B 3ZZTA 1F0XA 4GKKF 1YJ7A 5I42A 1D9FA 5L1KA 4Q0BA 1QE1B 1J2VA 2EI5A 3MM6A 4KE5A 4O44A 4KT0C 4PPDA 5B7WA 3DOMB 2C28A 1FESA 1U4BA 5KFTA 2XY6A 2LVWA 3NP5A 4G1QB 3WBZA 4CZCA 2HGNA 5KFAA 1NDLA 5DQHA 3KK3A 3GG0A 3MAHA 1UJ5A 2DTJA 2UXCF 1SKUB 4NXNF 2CJKA 4A8YA 5D4LA 3EICA 3M8WA 1U7LA 3BBBA 1P1TA 1X4FA 1FFGB 4ZJLA 4ES2A 4RNMA 2FY8A 3C66A 5F8MA 3I96A 4ANCA 2C3PA 4OZJA 5IV3A 5KFGA 3AA9A 5IV4A 2FYXA 2HHVA 3D0HE 1H0HB 2MKKA 3W2WA 2J7UA 4ZIWA 1F9HA 1FXRA 2ABYA 5L9XA 4PG7A 2C2OB 3KUEA 3QGHA 2DRDA 5LJ3Y 2JJ4D 3QAUA 5U47A 1Q82T 2EFNA 1FEEA 3H4BA 2P9EA 3AD8C 4CO0A 5H9EJ 2BQ3A 4EEYA 1LWEB 5F9NA 4FYWB 1KNZA 3BYRA 2UVWA 1D3WA 1IR2A 2IRYA 3D68A 1VLOA 1DZ5A 1OO0B 2ZD1A 4MIWA 3EX7B 2V94A 4H4MA 1I94F 5C7PA 1Q8LA 1UFLA 2OD4A 3MCNA 3MEKA 4OLOA 4RL1A 4BDPA 1XMQJ 4F4KA 3TW0A 1JB0C 3P6YC 2KB2A 1WELA 3VGVA 3K59A 4QYZJ 4HT7A 2HRYA 5DGBA 2AEJA 2LYVA 1HBNB 2R2RA 4IOCQ 4CCHA 2CDQA 1SJRA 2OPRA 2VC1A 1HBOA 3HDSA 3EE3A 4Y28C 4E8UA 5H9FK 2PA3A 1BXNA 1X9MA 1Q1KA 1TL7A 2RUGA 3QIPB 3QGGA 4P7TA 1VISA 4TLQA 3ZNUA 3FSXA 4XK8C 2ZM6F 3K5MA 2AJQA 1TELA 2R8HA 3TANA 3AJDA 2OUGA 2VOOA 4J9VA 4GKJF 2YWWA 3MR3A 4LF6J 2J6SA 1WEZA 3KXDA 3T5LA 3UCZP 4LUBA 4B9SA 2HNDB 4PG8A 3ILLA 1MU2A 4I7FA 4ZVFA 2EG1A 4G1PA 3E51A 1R27B 3S1TA 4K4ZA 1VRTA 1JWWA 4ELVA 2AZ3A 3SSQA 1SIWB 3PFOA 3KK3B 5J1NA 4ZVOB 4JUZA 2G9OA 3ZTRA 1HNZF 1XERA 4YOEA 3D66A 3R3TA 2JH3A 4ZPWR 3UD4P 2XY7A 1N48A 4X4VA 2IRUA 3HHEA 1GTHA 3VQTA 3FBFA 3DRSA 4NMLA 3HHKA 4U67Q 3P49B 1WOPA 1X0PA 1NJYA 4ZVUB 1RHRB 2WBMA 4H4KA 1QUVA 2D1CA 2E1CA 2HQIA 4ZIVA 5HN0A 5GADU 1RT7A 3THPA 1YJUA 4CLUA 1A9NB 2EPIA 3W8GA 3DOMA 3MPUB 2Z4PA 5AE3A 3CD0A 4X4RA 2IMWP 3SV3A 4DSLA 4JI4F 1S12A 2RQKA 3FCWA 1R89A 2YH1A 4OHZA 3UCUP 4OI6A 2KZMA 2CJBA 1JMTA 5B0AA 1NPKA 1YWXA 1A6LA 1RKIA 2DR8A 1ACMB 1ZPWX 4ECZA 2XMMA 4RNHA 4UOHA 4V19X 3P4UB 4TKTA 4UW2A 1RAHB 2GJIA 5LSLA 2CVEA 4P71A 3HP6A 5L1JA 5ADZA 1SVDA 2GAGC 2PDAA 1YBUA 1M0SA 2DEIA 2M70A 3ONQA 2PFDA 1RADB 2AEMA 4DL5A 1U47A 4JI6F 1T9WA 3NBPA 4B3OB 5LXRA 5KFFA 2ZVSA 1UW9A 2DXEA 1UWBB 2UUAJ 3EM1A 2XC9A 4C8NA 2EC0A 5HSPA 1DY3A 4DMZA 3CCSS 1JLFB 2ZNYA 4ZCKA 2DVIA 2BQUA 5DDQC 1REVA 2ZBCA 4A8XA 4IR1A 2CQDA 2M52A 2OO4A 2YNIA 2EFOA 1VCTA 4QJVA 2LA4A 4YP3A 2UUBJ 1UVNA 2ZE2A 3Q86A 5KG2A 3LGHA 2B5JB 4Q45A 4JV2A 4DL4A 4NCAA 4KGKA 3LWMA 4AL7A 4TY8B 2X7IA 1HFEL 2HLTA 2W7OA 3NOCA 3AOCA 3E01B 4OX7A 3ZZPA 1UA0A 4R0EA 2J6TA 4NCBA 1HBNA 4F25A 2B3TB 3CDEA 3NL0A 3W3SA 4K4SA 3OL7A 3ZZZA 1YZ7A 7FDRA 3MD1A 2CXEA 4Y2AA 5DQGA 4ANEA 4X64F 1CS4B 3THVA 2PI5A 2IYGA 4WXOA 1U1KA 5CXTA 1NM2A 2V50A 1KHWA 2ACMA 3WQPA 3IRWP 4DI6A 1Y11A 3A3OB 3MM9A 3D6HB 3ILJA 3G71S 3QYYA 2YKMB 2OP5A 3G8TA 3BSNA 1EIYB 1VRUA 3M8QA 3GJQB 2R8JA 4IRKA 3UVJB 2NR0A 2D3UA 1Q79A 1U8SA 2LFVA 2MDAA 2XYPB 3HVWA 4C6AA 4X4TA 4IQXA 3DC2A 5DJBA 2L41A 1YI2S 3LALA 2QC3A 4NL5A 5KFVA 4PYDA 4R5PB 4LF8J 1ROFA 2GQCA 1WF2A 2YNGB 3M2VB 1HWLA 3ET6A 2BEFA 1TR0A 2KJWA 4DS5A 3RBDA 2M5YA 1QLNA 1TL5A 3SCLE 2UV8A 3CMAS 3DOKA 3D67A 2UZAA 5HLFA 3GQCA 2CJAA 5LL6d 4UOCA 2GHVC 4JI2F 5GMEA 4QW9A 1HYSA 4DV0F 2ACYA 3UDCA 2HZVA 3CO9A 3VWSA 2CJYB 1A0OB 2V2VA 4M1KA 3BN7A 3IWNC 4XPEA 4LF2A 4USWA 2O01C 2IM0A 3KK1B 1JX4A 2DGWA 4DV1F 3BKUA 2MZ1A 2F4VJ 4C8MA 3L9ZA 4J9RA 2JFDA 2B7CB 3D3CJ 3G8SA 1XQIA 1O0PA 2V8GA 3T5HA 4YHHF 2IA6A 2HHWA 2DHAA 3BREA 3HVTA 4W98A 3SFGA 1AT1B 3MM5A 4DV5J 4DR6J 3M1VA 4KHMA 2XLJA 2MZJA 2W1BA 4AXIA 1L3KA 2QYCA 4A4JA 4DN9A 2RRAA 1FO1A 2QX0A 2GO8A 2I2YA 1URNA 5HMYA 1KN6A 1OYDA 2IAJB 2QJ3A 2VD3A 4UOFA 2KG0A 1RWOB 4C8OA 3FMBA 5E5NA 3PX6A 3DHWC 3MR6A 2UUBF 1PJ6A 4DSEA 3BGLA 1RTDA 1JJCB 4CYUA 2A0FB 1VBYA 1SJ3P 1RZMA 2FVCA 3CSKA 1FK9B 4NI2A 1R6VA 2NSBA 2G13A 3CF5Q 4NXMF 3MURP 2A18A 2XTJP 5KOWA 4CNYA 2CJQA 2CZ4A 4L3KA 5ETTA 2V4QA 3T5KA 1T95A 3TAQA 2D41A 3HK2A 2QLBB 2XWXA 3VAKA 2XSFA 1G1XA 5LM7E 3DN9A 3MOZA 3V6HA 2ZKTA 2G1DA 2W9AA 4N47A 2E7VA 3K17A 4FS2A 1QY7A 3M30A 4YFUA 4FBUA 2YKOA 3NRBA 4UY8T 1AXQA 3M2UB 3MMAA 4ED7A 1VMBA 2RKIB 5DZ6A 4C0OC 4KV8A 1ZS6A 5BJRA 2F65A 5JMNA 1IKXA 1CJUA 4NA1A 3MPVA 4DV4F 4J9MA 2DH7A 1LWXA 2RJZA 3L95X 4AXJA 3LP2B 2W8LA 4WP3A 2Y1IA 2H5EA 2AYEA 2VBYA 2Y1RI 4OI2A 3V5RA 1KR4A 1YVFA 2CPEA 1Y5IB 3I5AA 5LT5A 2XGPA 4ECUA 3W60A 4DV7J 2FZGB 2HMIA 1WF0A 3EDRB 1R3NA 2CADA 2HQGA 2XMJA 2LQ9A 3M8YA 4QR2A 3UFCX 4GKJJ 3D4JA 5D77A 5CZXA 4RU2A 3MMJA 3EMTA 3MGJA 3VAGA 1RU1A 1G2EA 4OJHA 2VBWA 1Q4RA 2Q1LA 3AJ2A 2DH9A 2VFVA 2VB6A 3M8PB 4NLPA 3P3DA 1U0HB 2A3JA 4CH0S 4DR4F 1UJ4A 4EMDA 2W4PA 4IG0A 3O44A 4ELUA 2UXBF 1HPZB 5D4OA 2UUAF 1S4EA 2UVUA 1UKUA 3R5AA 3CJSA 3OXGA 2IDEA 4CDIA 2UXCJ 4DUZF 3PYGA 5GAEU 1WC1A 3A3NB 4OX9F 3QWUA 2XGQA 4RPFA 4TNOA 1Y10A 4CTAB 3BZQA 7AT1B 5KFWA 4Q0BB 1HBMA 2CDRB 1RAIB 1S6OA 3W9HA 2JLGA 1T05A 1N4LA 4P75A 3WIUA 2CWXA 4WKYA 5I3UA 2A6OA 3CMES 1HHTP 2AGOA 3TUJC 1WD6A 1RHQB 1OPZA 3D7SB 2PN6A 1SL1A 2UVVA 4ECVA 1WEXA 3SMZA 3CIMA 2EKNA 2D74B 2ZEJA 3CJRA 1IBLF 2V4JB 4CQ1A 3N0VA 1BMQB 2IAJA 1NJXA 4L3NA 4Q2LA 1TVRA 4LRFA 5K20B 4G1QA 3RUBL 3CJ5A 1W7WA 2RT3A 3EVMA 4DV3F 2H54B 4C97A 1WSVA 3BYPA 3V6DB 1V3SA 4I64A 4R25A 3Q8PB 5HBMB 2RVJA 4LBIA 1KQFB 2Z2YB 3DXBA 3T41A 4DJBA 2R7VA 1U1PA 2VH7A 1RLCL 1KLMB 3A8EA 3KMSA 2H1YA 2ROGA 1JKHA 3RU0A 3MDFA 1HNZJ 1UL3A 2CNNB 1RGVA 3AHPA 4B3TF 2XO6A 2MEWA 4L72B 4DV4J 2V69A 4HACB 4E98A 3UN3A 3NNHA 3CEDA 1IQTA 1QAJA 1ZM3A 5B0DA 1BD6A 1V5IB 3M30B 1U1RA 3CDBA 2FJDB 2DNZA 3DLEA 3PHEA 2R2UA 2AGPA 4M95A 4EU0A 1RE1B 1HKAA 2RKIA 3UN2A 1Q95G 3TVKA 2YH0A 2ILYA 4NZ6A 1TK0A 5C25B 4JOUA 4UT4A 1QSSA 1M5VC 1MSWD 3D2WA 1P9QC 3RAMA 2KYZA 2HEKA 3DNCA 1RK8A 5MLCV 2AKWB 4MFBA 1XIQA 1TL1A 2FLOA 4O4GB 2KRBA 1LWCA 4RWXA 1OSCA 4ZLJA 4LBHA 4NXMJ 3D5MA 4G1IA 4FYDA 1FJCA 1RLDA 4DSIA 1YDLA 2ALZA 2CPXA 2ATLA 2CNKB 5DG9A 1OWXA 1HBOB 2DNQA 1JLGA 2B8QA 3SQGB 3KLFB 3BO4A 2JDJA 3FFIB 2FJAB 3GFZA 2HNDA 2MLYA 3HFZB 3NS6A 4O4RA 2BACA 5B08A 2MGZB 4KH1B 1LW2A 3R5DA 4FDFA 1RHJB 2U2FA 3FQLA 4DPYA 2HIYA 5K8PA 3JQJA 5GAGI 2HKEA 1WC0A 5KFPA 3J81Y 2IM3A 5K14B 4WE1B 5J2NB 1Q5VA 3EUNA 1NJIT 4I7FB 1S9GB 1NUEA 3P96A 3HSDA 1VQ4S 1FFSB 2VPXB 4UZCA 4KY3A 4F26A 4PQAA 5A8WB 1D09B 4WZMA 3H7HB 1IXKA 2V9KA 3DDIA 2VL1A 1RBAA 3Q83A 1N0UA 2ZOFA 3HZEA 3NCPA 3FSYA 3O3LA 5HMZA 5KFOA 4YS2A 3MAQA 2SXLA 3IS9A 3TEGA 4O3OA 2VQEJ 3RW7A 1QAYA 4ER8A 1EP4A 1FWPA 5HAOA 3M32B 2ZHBA 3BQ1A 3AY0A 3D9BA 2MLZA 2G0IA 2E5IA 5CYMA 2DGVA 3PEJA 5IS2A 3OTOJ 1N32J 3KWMA 1HMVA 3K2YA 3HFVA 4CLKA 3SI8A 2J0QD 4OZ2A 5A2QY 3UQSA 3MCSA 3MUMP 4GKKJ 4N56A 1HNXF 1C4CA 4FNHA 1VK3A 3OTBA 2N7CA 2QSFA 2WSCC 2FJVA 3JSMB 2NSCA 4IFVB 2B51A 2HVEA 4OX8A 1I1GA 5ETOA 4ZCMA 1WC6A 1RT5A 4L6V3 3VAMA 4F3OA 4K4VA 4TVAB 1R7IA 2V8DA 4M5KA 5LOQA 4I68A 5ETPA 3J7Z5 1BUXA 1MN9A 2BE7D 4LSLB 2LECA 2DIUA 3KKFA 1N6QA 2BDPA 4LFBJ 3PX4A 1ELOA 1FRLA 1RWKB 1TKXB 4USTA 3WC0A 1RP5A 2WW8A 1YRXA 1KVJA 1FEHA 2A2DA 2CPYA 3UE2A 2DXFA 4NE9C 4ZKAA 1U1MA 4DPOA 4WF9Q 4DZDA 3DGPA 3MHYA 1U6BA 1T02A 1U09A 1E6VB 3JTOA 2V4RA 1PAUB 2BRKA 2IBOA 2BM0A 3C8YA 2RNEA 4UF4A 4UOGA 2FVRA 4LBPA 2XEXA 3JS9A 3BGOP 5CA5A 3FEXB 4WIQA 1VHIA 1D8YA 3LPEA 1SC6A 4NLDA 1XN9A 5RUBA 3MM7A 2RDJA 1T7PA 1F6TA 3L7PA 4IQMA 1IJFB 4Z7CA 2HVHA 4W92B 2E9TA 2R3VA 4FKYA 4Q8FA 3BJYA 3DLGA 4Y2CA 4DG1A 2ZH3A 1NHKL 1FRHA 5M2PA 4KHRA 4UY85 4AL5A 3LW5C 3UCGA 4EO8A 3ISNC 2YWKA 1UCNA 3ENWA 3GV7B 4F04B 4GRSA 1LK7A 4NEYA 4RO0A 4OHXA 3H5XA 1IBMF 1S59A 1KONA 2M3DA 3IG1B 2KJVA 1LW2B 2IJNA 4DCOB 5A6PA 1S0MA 2HW3A 2GAHC 5D0RA 1X4CA 5L46A 4EBCA 1XNRF 1OPIA 4XDCA 5HQMA 3PX0A 2P5VA 2J9DE 1K0VA 1FDAA 4PG4A 5KFZA 1RA6A 2YX4A 1BLUA 5J2NA 1UZDA 2RHQB 2RS2A 3AJ1A 3S8SA 2Q66A 2AW0A 1RT2B 4OQJA 4EZ9A 4MIBA 4ICLA 3JYTA 4AFFA 3KMQA 5F8JA 5FLXU 2O3DA 1DAXA 5JXSA 2ZE2B 3ILIA 4TXSA 2JX2A 1JLEA 1FERA 4KKOB 3U1NA 3KUGA 1RISA 3K5NA 1XMQF 1UMJA 1HR0F 1BQXA 2BJ8A 1U1NA 2GNKA 1FRXA 1BQMB 1NU4A 4U95A 4J9NA 2DGOA 3PVXA 2H48B 4OYAA 4DFMA 2NYIA 4TU8A 4LIRA 1EETB 2CZ9A 2F3JA 3VAJA 3G96A 2R7QA 3OUYB 2FZCB 1HMVB 3PYEA 4YY3F 3CCWA 2DR5A 1FWLA 4AQYF 2YNFB 2D69A 1EX8A 3ZTPA 4CH1A 2ZHAA 1RT3B 4N7TA 2W01A 4DBQA 5KT7A 4PXEA 3JSMA 3MM5B 3RB6A 3A13A 1RWNB 3HT3A 2RUSA 1SJ1A 1S6PB 3KLVA 2V8HA 1V9OA 3G4SS 2C42A 1I51B 2VFUA 5M2RA 1SXLA 4I6AA 1OS5A 4ID5A 2MY7A 2PA8D 4FPRA 4UQTA 1K0TA 1HWKA 4ERDA 5A6WA 1YGYA 2Q6CA 1MWYA 5HLFB 1YJWS 1N36J 2QFJA 2IVMA 1S1VA 3DU6A 3TP2A 5EN1A 4MKAA 2CRLA 1FWKA 3H90A 4DX7A 4DV7F 2VDHA 4ECWA 1S5ZA 2EW9A 1CJTA 3F0NA 2DPIA 2MQNA 2HNZA 3TJAA 1SC3B 4WIIA 2RDIA 2NXNA 2FD2A 1CJUB 3IXQA 1XTZA 7FD1A 2CZVC 2W2OP 5C2CA 2ERRA 4WFNQ 4DDFA 3CDAA 3FZ2A 1XWLA 2DGUA 4ZCIA 2BMBA 5E33A 2G2ZA 2IVYA 1WORA 3E8OA 1WOSA 3WX4A 3CCRS 4O3RA 3Q2TC 1UEVA 1YKWA 2DRBA 3BGUA 3R5GA 1FKOA 2KL8A 1YJVA 5GADI 1S77D 3HD1A 3FGVA 1P6TA 2CVIA 2HRTA 3HFKA 1NCLA 3MECA 5GAHI 2QA4S 4RW7B 1L5UA 2XZWA 2LEPA 3PRDA 2B43A 1W2IA 5IT4A 3H4DA 2BV3A 4X62J 1JXVA 4ZVSB 2C2RA 1U1QA 3VV2B 2V0NA 4ATNA 5EX3A 4TQSA 1KDNA 1U0HA 2P6SA 3TEHB 1LK5A 2W2MP 4C4WA 3GMGA 3NEKA 1S6QB 3AQPA 4QYZK 1VOMA 3NMRA 3VCDA 4PRFA 1JJ4A 4I2QB 2K06A 4A48A 1H2UX 3JQKA 3NLCA 2KKHA 3B82A 4CO4A 5DZ7A 2VG5B 4ZLNA 4O3PA 1JLEB 4KC5A 1QVGR 1VQKS 1FJGJ 4C8ZA 1UAWA 4QWEA 2WZ1A 3PKMA 2IVFB 2J8AA 3PJWA 3HJFA 4LF7J 1CULB 2V63A 1NSAA 3LO3A 3NMAA 3KOAA 2HFUA 3R7BB 3P5TL 3PV8A 3B4DA 1M1KT 1S0VA 3B78A 2L9DA 4ITSA 4M63A 1ZH5A 3ZC4A 2RQMA 1PYSB 3NAIA 3POTB 3ZTSA 1HBMB 3PFEA 1YJRA 3T1YF 1FJEB 3GILA 2QO3A 2L08A 4Q43A 2BZ2A 4ED1A 3U02A 2RQ4A 4HDGA 5EHHA 1DTQB 1TFYA 1MLAA 4WU3A 1UFKA 2BE2B 2JLFA 4P74A 1O51A 4TN2A 4HHHA 3R7NB 3KJFB 3OSNA 1IBKF 1CBKA 3UR0A 3Q8SB 1R0AA 3UD3P 4K8RA 1RABB 3UDVA 2H65B 4AL6A 3X1LB 2UXDJ 1CPZA 2AQ4A 2QMUB 1FRJA 2XZTB 2APOA 3TYTA 1VQ6S 3PNIA 4EYHB 4OYMA 3M8SA 3R27A 2BJ9A 3TVYA 2VBXA 2L3MA 2E7WA 2OGUA 2AYMA 3QQCD 1BQNB 1AYEA 1XC9A 2GO9A 2GA7A 2ILZA 5K8NA 2QL5B 3V6KA 4FVCA 2KVQE 3A12A 3T9NA 1FT8A 2B6AA 3D28A 3GYNA 3M6WA 6AT1B 5F8LA 3VGTA 3GV5B 3V81B 3FUYA 2VODA 2ZNZA 1RWMB 2EEYA 4WK1A 3IRXA 1FX2A 1IWAA 4RNOA 4IO9Q 3MOJB 2EG2A 5J2QA 1V3ZA 1FHTA 2BABA 2JLEA 3GSIA 4ED3A 1VQ9S 3PXGa 4CM2A 1OY9A 2OKQA 4J9OA 3LTOA 4PAAA 1WUUA 4AE5A 4DL0C 3V2UC 3C6TB 4XDDA 2BR0A 1SQFA 1VQNS 1C1BA 1TZ0A 3RAQA 1S97A 2R8IA 3KLFA 3VHQA 1VBKA 4OZ0A 5ETVA 3OFGA 1B70B 1R8CA 1X60A 3NCQA 2KT5A 4PXCA 3G6XA 4R8UA 5JVHQ 2C2DA 1X9SA 5EWEA 2NPIA 2AYBA 1XK8A 3QT7A 3SDEA 1K73T 1YRTA 3AB4B 3PJ9A 2PI4A 2HBYB 5B0CA 1LWFA 2MHNA 2GVDA 4IFYB 1FVQA 5F0UA 4NZ0A 4P9SA 2DKOB 1CQNA 2BJ7A 1S9GA 3SEOA 2GS8A 3VR1A 4DUYF 4ECXA 1WWHA 2KTQA 1RT1A 3EVWA 4DUZJ 5DGAA 1UVIA 3RW6A 2R9LA 2HBQB 5D0EA 2EBEA 1P8GA 4KGMA 3MUTP 1KEKA 1IJEB 2RRBA 2RH3A 4MT1A 2AHOB 2X1BA 4JV5J 3RBEA 3N28A 2HNYB 4URSA 2D3OR 4LT6A 2HHQA 1DQ8A 1EP4B 2FGCA 3M2RB 3H0PA 2W9BB 4ZVPB 4K4YA 1NK7A 4ZMMA 2Y1JA 1NKCA 1K47A 2I0XA 1QE1A 1S7HA 3VZHA 4DUTA 3TO8A 3ZNJ1 3CCZA 3UR3C 3GP9A 5JJBA 4YR2A 2K1RB 3BO3A 2JOQA 2I5JB 4LRAA 1NK8A 2XS5A 4JYAF 3HCXA 1BWVA 2YKQA 2YVSA 2GIRA 3DDNA 3PEHA 4B08A 3HD2A 1VFJA 3BKTA 5EUHA 4DR3F 1U1OA 1OJ4A 2FJEB 3S01A 1REGX 3PYDA 2FC8A 1SI9A 1R0AB 2RF2A 4ID8A 3B4MA 1RHUB 5E7OB 3J7YU 3CD5A 1RTIB 1ZPVA 1YSJA 2E7XA 4FZVA 3QJLA 4IFVA 4WE1A 3TJ9A 2I1RA 2WSFC 2V8PA 4I56A 1XBWA 2P8IA 4ZPTR 3LP1B 5C42A 5KFNA 3CTRA 3NOGA 1E6VA 4LSLA 1S57A 1FDDA 3CJ3A 3N5BA 1PJ7A 4NCGB 2VZ9A 3SIPB 1M5OC 1RKJA 5KT5A 4B02A 8AT1B 5F9LA 1UWAA 3C15B 2FB0A 3KG0A 5J1PA 2YX1A 1C2PA 4MK9A 1D9DA 3DGPB 4FXWA 1HI8A 2JEIA 3KLEB 3MM7B 4IRDA 2M2BA 5LSRA 3FKBA 2R2SA 2WK4A 1EZZB 4J9LA 3AXMA 4NRUA 4OIXA 2BKNA 1SJFA 4Y00A 1PGZA 3G8QA 3GLJA 5KFIA 4I6YA 2BRLA 4GC6A 4DS4A 3H5SA 2CAJA 1QM9A 2POKA 3R5CA 2PGCA 1WG4A 3PO5A 4P6QA 2H4WB 1RXOB 1S4FA 5CCLA 5IC4B 3BSOA 1T9YA 2QRRA 1WI6A 4Y65A 2NQPA 3PR4A 4DL7A 2DNYA 3CJ2A 2IHR1 5T7LB 1Q7YT 2YQ3A 4DG1B 4B9TA 4DU8A 5HJXA 2R7SA 3UWTA 1NDPA 1R31A 3I5CA 4HTIA 4F36A 3AD7C 2J5AA 2QL7B 3C6UA 2MQLA 2ROPA 2MKJA 2VJUA 4J9SA 1RTHB 2AJ0A 1QJHA 2BUNA 3JQMA 3N6MA 3ZO7A 2XMVA 1PYTA 3UN5A 3PW7A 5HANA 1F5CA 1ZAWA 4U96A 9RUBA 3HHNB 2HURA 5T14A 5KT6A 2AU0A 1OYEA 4DR2J 1GXUA 1RT1B 1NK0A 5L1IA 2IM1A 1IBMJ 1U2CA 3GYGA 1RUSA 3SBMA 5L39A 1IKVA 1GT8A 2JL9A 2QZ8A 3GWCA 4IKAA 4AD6A 3I55S 4KRWA 2LXIA 2UUCJ 1U2FA 1IR1A 2ZH5A 5I3QA 3Q23A 1SKWA 3OD2A 3I31A 3O6QA 2DNLA 4LFBF 4OJ1A 1KQGB 1E6YA 5IFMA 2DCUB 2W9BA 2ZD1B 1UETA 1NH8A 1NHUA 3US5A 1B4SA 3VVUA 1VLYA 3J80Y 4DSJA 3CE8A 5DRKA 4PG6A 3MF5A 1KTVA 5F3TA 1DJ0A 4DPXA 1ZETA 2QA4G 1U49A 4ECRA 2JRSA 4NRTA 3GIRA 5HATA 3EZUA 2OEJA 4NLRA 1NLKL 2XHCA 2YNFA 4DQRA 3TQ1A 4QWBA 3BKFA 3MWBA 1HW9A 2F8EX 3PW2A 4ECSA 3MAAA 1S79A 4NLTA 2DGSA 3M7VA 4J37A 4D3HA 1S48A 4CIOA 4X64J 3L7UA 1RACB 4LSNA 4ZHRB 3Q24A 3OUYA 3T1HF 4USHA 1NPRA 1L3VA 3CNQP 5IC6B 3CC7S 3R1HA 1MWZA 4WP8A 3DMJB 3GFXA 3HPOA 2OSQA 2NZ4A 4PUOB 1HA1A 2Z2ZA 3CB4A 3FBBA 5IM0B 2B9EA 4LF4F 1LOUA 1HNVB 5IT9U 4MMOA 4HL9A 1Q81T 2ALYB 1MMLA 3M8ZA 3OLBA 4ZS6A 4C0BA 4KGXB 4ZN3A 4DV3J 3CJQA 2MQMA 3BBCA 3EDQB 5L9NA 3JSBA 4ANDA 3RRHA 1VS3A 1HQ2A 1B99A 3I0RB 1J5EF 3PW5A 2G0JA 2QA2A 1KKHA 1JQGA 1CJTB 2CG8A 2VQFJ 4MK8A 3MMBB 4DF8A 1H7WA 4PWDB 5EWFA 4YMEA 2YNIB 1APSA 3EXYA 1SPBP 4QPTA 2ZH7A 2ASJA 1KOHA 1XR6A 2V2ZA 4GVLA 4URGA 1ITPA 2JEGA 1LXJA 3UO0A 2XSJA 4F4XA 1K9MT 4ED8A 3R8YA 3QSYB 2E66A 1C0TB 2HQDA 1QAXA 3A4TA 3PTWA 3KJVA 5D4NA 3G6VA 4NXNJ 3IMQJ 5HI7A 1EQ0A 2P9CA 2DBBA 4K4WA 1SKRA 4OHWA 3HHDA 2UXBJ 1FKPA 2CUYA 1T94A 2CIMA 3D6MB 3NGDA 4ZPVR 2CQHA 1JLFA 1RHMB 2CQPA 3LGNA 2MQQA 2U1AA 4MK7A 1R8BA 2RU3A 1BWEA 2DR9A 5EGYA 3CO0P 4ZP9A 3U7JA 3F56A 3CDWA 3ZZ0A 1WSRA
chains in the Genus database with same CATH topology
3R7NB 1F9EB 3KJFB 3R6LB 2H4WB 2H5IB 2H65B 3GJSB 5IC4B 2H51B 2XYGB 2XZTB 2CNKB 3GJTB 1GFWB 3R6GB 2QLBB 2H48B 1RHJB 3P4UB 2QL7B 2HBZB 2QL5B 1SC1B 1RWMB 2C2ZB 2CNLB 1RWNB 3P45B 2C1EB 4DCPB 2H5JB 1I51B 1SC4B 1PYOB 2XYHB 3EDRB 1RWVB 1QDUB 1QTNB 4LSZB 2P2CB 2C2KB 4ZVQB 3R7SB 1NMEB 2C2MB 1SC3B 2HBRB 2HBYB 2DKOB 1RWXB 2C2OB 3D6FB 3R5JB 1I3OB 2HBQB 2CJXB 3D6HB 5IC6B 1RWPB 1RWKB 2CDRB 3GJQB 2XYPB 3KJQB 4DCJB 3RJMB 1RHQB 4ZVPB 1PAUB 3EDQB 1ICEB 1RWWB 3GJRB 4ZVSB 2XZDB 1RHKB 2QLJB 1BMQB 2Y0BB 4JB8B 5K20B 2Y1LB 4ZVTB 2H54B 2CJYB 3IBFB 1RHUB 2H4YB 4ZVRB 2CNNB 1IBCB 2CNOB 3R7BB 4DCOB 3KJNB 3SIPB 4ZVOB 1RE1B 2QL9B 2QLFB 3D6MB 1RHMB 1RWOB 2FQQB 3NS7B 3QNWB 3IBCB 4ZVUB 1RHRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7N B;  1F9E B;  3KJF B;  3R6L B;  2H4W B;  2H5I B;  2H65 B;  3GJS B;  5IC4 B;  2H51 B;  2XYG B;  2XZT B;  2CNK B;  3GJT B;  1GFW B;  3R6G B;  2QLB B;  2H48 B;  1RHJ B;  3P4U B;  2QL7 B;  2HBZ B;  2QL5 B;  1SC1 B;  1RWM B;  2C2Z B;  2CNL B;  1RWN B;  3P45 B;  2C1E B;  4DCP B;  2H5J B;  1I51 B;  1SC4 B;  1PYO B;  2XYH B;  3EDR B;  1RWV B;  1QDU B;  1QTN B;  4LSZ B;  2P2C B;  2C2K B;  4ZVQ B;  3R7S B;  1NME B;  2C2M B;  1SC3 B;  2HBR B;  2HBY B;  2DKO B;  1RWX B;  2C2O B;  3D6F B;  3R5J B;  1I3O B;  2HBQ B;  2CJX B;  3D6H B;  5IC6 B;  1RWP B;  1RWK B;  2CDR B;  3GJQ B;  2XYP B;  3KJQ B;  4DCJ B;  3RJM B;  1RHQ B;  4ZVP B;  1PAU B;  3EDQ B;  1ICE B;  1RWW B;  3GJR B;  4ZVS B;  2XZD B;  1RHK B;  2QLJ B;  1BMQ B;  2Y0B B;  4JB8 B;  5K20 B;  2Y1L B;  4ZVT B;  2H54 B;  2CJY B;  3IBF B;  1RHU B;  2H4Y B;  4ZVR B;  2CNN B;  1IBC B;  2CNO B;  3R7B B;  4DCO B;  3KJN B;  3SIP B;  4ZVO B;  1RE1 B;  2QL9 B;  2QLF B;  3D6M B;  1RHM B;  1RWO B;  2FQQ B;  3NS7 B;  3QNW B;  3IBC B;  4ZVU B;  1RHR B; 
#chains in the Genus database with same CATH topology
 1M5H A;  5ETN A;  2J7K A;  1F9E B;  3TA1 A;  1IKV B;  4DX8 H;  4Z2X A;  1O5J A;  1TV6 B;  3GG1 A;  4HEA 9;  3PRV A;  4IG3 B;  2DB1 A;  4GVB A;  3CMQ A;  5CHC B;  3OHB A;  4LR9 A;  3G6Y A;  1NND A;  1R8P A;  2LEB A;  4MKV A;  5KFH A;  1D8Z A;  3QFH A;  2WCX A;  3GJT B;  3HHL C;  1F3V A;  3KDO A;  3VZI A;  4DLG A;  1JLQ A;  4DHV A;  1K8A T;  1R43 A;  4A8W A;  3CW2 C;  1M5K C;  2XS7 A;  3TR5 A;  1SV5 B;  2EFV A;  1VQY A;  1DFD A;  5E3P A;  2ASD A;  1U24 A;  3GIJ A;  5JVG Q;  2Y8W A;  2PFF B;  4X2B A;  2K2P A;  4PG5 A;  4BS2 A;  2DR7 A;  1ZTT A;  2W7P A;  2ZH6 A;  3EGV A;  2ZBR A;  3H40 A;  3NNC A;  3IC1 A;  4JI3 F;  1TQL A;  2M8H A;  5HVF A;  1FI4 A;  4WU2 A;  3HM9 A;  2C1E B;  1QUP A;  1CS4 A;  3GR0 A;  4LF8 F;  1ZM4 A;  5DM6 Q;  2AD9 A;  1LW0 B;  1O6X A;  2VG6 A;  4RW7 A;  2VON A;  4HVZ A;  4C3M A;  5KG3 A;  3HI9 A;  3DI6 A;  4LVO P;  4K59 A;  1WKK A;  2VU5 A;  3JTP A;  4NWB A;  4I2P B;  3N6L A;  1PYO B;  2F8M A;  4CLZ A;  1FTC A;  3EGW B;  3IBW A;  4JI3 J;  4J9K A;  1GMW D;  3MM8 B;  1YHQ S;  2HHU A;  3UDL A;  5B0B A;  3H2V E;  2PEB A;  4UUX A;  5AXL A;  1T3N A;  2ATC B;  1S6Q A;  2BE2 A;  3MTK A;  1OMS A;  1VC6 A;  3DGV A;  5J1E A;  4C3L A;  4K2X A;  2F9J A;  2PE8 A;  1VBX A;  5A2Q U;  1H7X A;  2XCP A;  4DFJ A;  3LF0 A;  4QU7 A;  2HHP A;  1NME B;  2FTR A;  4C48 A;  2FHM A;  3QLH B;  3LA0 A;  2HZA A;  2RIJ A;  4ENO A;  3PR5 B;  4ECY A;  1SH2 A;  3QWP A;  4X62 F;  3FEY B;  2CWK A;  2E9Z A;  1RT4 A;  4X4Q A;  1WJ9 A;  3D6T B;  2KVI A;  1X31 C;  5BR8 F;  5HK4 A;  2HFO A;  3O8W A;  2CQ4 A;  1PBU A;  3R5J B;  2IJF A;  3W2V B;  1ZYQ A;  1MW7 A;  2QT7 A;  3ZZY A;  4RJV A;  5I42 B;  4DV2 J;  3W66 A;  2D3Z A;  1T9T A;  4P2M A;  4X66 F;  1RYR A;  2XUL A;  4NA2 A;  1UJ6 A;  1MNE A;  3OL8 A;  2KT3 A;  3LP2 A;  4QWA A;  3KJV B;  5K5M A;  4QR1 A;  3DRR A;  1MRO A;  4TYB A;  3OL6 A;  3OXF A;  4F8R A;  3RJM B;  1D1U A;  1JK9 B;  4DWI A;  3NGU A;  4O3Q A;  2AWZ A;  1TKT B;  3R2D J;  2ZUG A;  4R8U B;  2E1A A;  3DM2 B;  1Y7P A;  3IR7 B;  4QOT A;  4Y2I A;  4Y0F A;  3CUN A;  5HO4 A;  5I3P A;  5DG8 A;  4OHV A;  2CPZ A;  3UI3 A;  5D3G A;  4ZVG A;  3QRR A;  2GQQ A;  2ZIT A;  2ZHO A;  4XAK A;  3T1Y J;  3BR8 A;  3CJK A;  2B9X A;  4ZPC A;  5CYQ B;  4ES1 A;  2PMZ D;  5HVG A;  4ZK7 M;  1RTZ A;  2NXC A;  1UVL A;  4DFK A;  1TV6 A;  4FYX B;  1FK9 A;  4IG3 A;  3U1L A;  2V9W A;  4GVB B;  1BQN A;  5D78 A;  1S1X A;  1AZS B;  3TWZ A;  1HPZ A;  2LKZ A;  4N41 A;  5AT1 B;  1UEK A;  3R9L A;  4CLF A;  3VAH A;  3QJP A;  3W62 A;  2G0C A;  2GVD B;  4CLS A;  1JLQ B;  2B4V A;  2YQ1 A;  4RW6 A;  1AW0 A;  4I1T A;  3TAP A;  5CD4 A;  3SYZ A;  2MZS A;  2C22 A;  1KQS R;  2PT0 A;  1U6Z A;  3HT0 A;  4DR1 J;  1XNQ J;  2OFG X;  4ED0 A;  4H4M B;  2EK6 A;  4OYX A;  3MMA B;  2QL9 B;  3K8V A;  3KNA A;  3GR1 A;  4A8S A;  4CH7 A;  3H5Y A;  4Y3C A;  1OQ3 A;  2XHW A;  2QN6 B;  1IKX B;  4LRD A;  4RKU C;  1HIY A;  1RU2 A;  1Y3J A;  3SCJ E;  3OW2 R;  2FDN A;  2MJN A;  4OYW A;  4F02 A;  1EKR A;  1X5T A;  2O1P A;  3DLK A;  3SXL A;  2GZO A;  4DUY J;  4WCE Q;  1NDC A;  1YIT S;  4C0H A;  2DO0 A;  2V4J A;  4N5S A;  1F1B B;  2Q43 A;  2W24 A;  2IJR A;  2JFK A;  3FC9 A;  1X4G A;  3A8K A;  2DNP A;  1SB6 A;  2RF2 B;  4I2P A;  1TVR B;  1KLN A;  1KC8 T;  2HS4 A;  1X4B A;  1S10 A;  1V3R A;  3ENQ A;  3V6D A;  3FK4 A;  2GVZ A;  3TA0 A;  4RNF A;  4AQY J;  1GX5 A;  1TKD A;  3WZ0 A;  4O23 A;  3C3L A;  2C3O A;  5CD4 H;  4FBT A;  2NS1 B;  3S7R A;  4OX6 A;  2AEF A;  5C24 A;  1N54 B;  1IKW A;  3DYA B;  1RCX B;  1HL6 A;  1KRP A;  2XWY A;  4RW4 A;  1M5P C;  1I6J A;  2MYF A;  3AB2 B;  4M8L A;  4IG0 B;  2WB1 D;  4DU7 A;  2XY5 A;  1FDN A;  5KG1 A;  1ARO P;  2HWT A;  2W7A A;  4CO5 A;  4I4B A;  2J8S A;  4NX9 A;  5ETK A;  3D1H A;  2HVD A;  1PSD A;  2HNY A;  1WI8 A;  2KT2 A;  2D7S A;  2GJF A;  3DRS B;  3JSR A;  3QAE A;  1FRK A;  4KFB B;  2CQC A;  4OZ3 A;  4DCP B;  4YR3 A;  3G82 B;  3W2V A;  3RZA A;  5FII A;  3SFU A;  1NH7 A;  5EX0 A;  2W9C A;  3G87 A;  5FDL A;  1SC4 B;  4EGL A;  2WVD A;  2ZDP A;  2DXD A;  1EAY C;  3KUH A;  4C8K A;  4WPA A;  2ZJR Q;  3VQS A;  1YRU A;  1MRO B;  1N5T A;  4R0J A;  1YQH A;  1VRQ C;  3BB5 A;  1X4A A;  2V2Q A;  4G65 A;  4KAI A;  3RRK A;  3R2C J;  1X4D A;  3QT5 A;  4O4G A;  1QD1 A;  1IUJ A;  2HHX A;  1R8H A;  5GAH U;  1T03 A;  3GPA A;  3NGR A;  3R1L A;  2VIH A;  2NZC A;  4QWC A;  1KLM A;  4BBY A;  4ZLP A;  1S6U A;  2AX1 A;  4GMK A;  2M9K A;  4N8O A;  3OV7 A;  3OLA A;  6FD1 A;  3Q89 A;  4YN3 B;  1KTQ A;  3BGR B;  3ZFV A;  4UUW A;  3CJK B;  3TQE A;  4B3O A;  4NLW A;  3SSS A;  3QFW A;  1WNE A;  1LFW A;  4USI A;  3HKW A;  1YLX A;  1KVI A;  4IRC A;  3IN5 A;  4NMX A;  1S7I A;  2W2Q P;  2R7U A;  1VIX A;  4DR4 J;  1RTH A;  3C19 A;  3LPY A;  2ZZT A;  3M6U A;  1VC0 A;  3C16 B;  1H98 A;  1Z2Z A;  2CPH A;  3TZX A;  4J5O A;  3BDP A;  1SH3 A;  2VQF F;  1R8A A;  1N5S A;  3W63 A;  4IOB A;  5A8W A;  5C25 A;  1B7F A;  2IA0 A;  3C14 B;  4CWB A;  4ILR A;  3D0G E;  4H4K C;  1TK8 A;  3VVT A;  4C3K A;  1RWU A;  2FUG 9;  1FRM A;  3AFG A;  3CIZ A;  4YB5 A;  4OLP A;  2E5L J;  1TL1 B;  3IS9 B;  5GMD A;  4TY8 A;  1RHK B;  3L3C A;  4KTQ A;  2LDY A;  2C3Y A;  4KH0 B;  1HNW J;  2Y0B B;  5I4M A;  1N34 F;  2ADB A;  1JXE A;  3WX8 A;  4NYZ A;  3HMJ G;  4B3T J;  4K0K J;  3P5B P;  1T11 A;  1FJG F;  1N56 A;  5LMN J;  2YNH B;  2EVZ A;  3ENA A;  3K8W A;  2FPH X;  1AFI A;  4J9P A;  3AOD A;  4DV0 J;  4MFB B;  3PHT A;  5CYM B;  1LWC B;  4BC7 A;  2LU1 A;  3PKY A;  2UU9 F;  4NLX A;  1H3D A;  2RAQ A;  2B4U A;  2HHT A;  3NY0 A;  4DF4 A;  2KHD A;  4B3M J;  4JP8 A;  1KOO A;  5D4P A;  4RUH A;  2YKM A;  1CJV B;  4HH1 A;  2M7S A;  2VAS A;  3J81 j;  1TAU A;  2RIL A;  2HFN A;  2FHO B;  4A8Q A;  1RYS A;  5CH7 B;  4PQU B;  5KFX A;  1RTJ A;  2RB7 A;  3HVA A;  4A47 A;  1TKX A;  1DAR A;  2LQ8 A;  1Y4Z B;  1HBU A;  3TAM B;  2ASY A;  2VIC A;  2NXE A;  4F3M A;  1VGY A;  3HO1 A;  3EYZ A;  2O67 A;  2NCK L;  2F7V A;  5EDW A;  1SKS A;  2QEX S;  1T9X A;  2ZOM A;  5IT0 A;  1HWI A;  3NWG A;  3CCU S;  2VHG A;  2DGX A;  3ENV A;  4J90 A;  2W9C B;  4PWW A;  2J0W A;  3JTN A;  3HHL A;  3U27 A;  2MKS A;  3PW0 A;  4B3S F;  3BH7 B;  1FNO A;  3GJS B;  3MCO A;  4NLU A;  5AXK A;  3QO9 A;  3CJT A;  2LEA A;  3KK1 A;  2XLI A;  5DLF A;  1XNQ F;  3I0S A;  4ZLL A;  2MJU A;  3R6G B;  4WFX A;  2A6M A;  2DK2 A;  4N77 A;  4Y2K A;  1VIO A;  4X66 J;  4DR6 F;  4TU9 A;  2VUG A;  5D0G A;  3IM8 A;  1BE4 A;  1RT5 B;  4EZ6 A;  1VC5 A;  3D54 A;  2B9W A;  3IR5 B;  2HBZ B;  2W25 A;  1C0T A;  1DBD A;  1NEE A;  1Z1Z A;  2F8H A;  2WB4 A;  4HHU A;  4XTT A;  4YQW A;  2DHH A;  1ZA2 B;  1JXL A;  4QW8 A;  1LEO A;  4B9L A;  4KPY A;  4USU A;  1B7Y B;  4F4Y A;  2CQ0 A;  2RHS B;  5IM0 A;  3NNA A;  3BPD A;  1YBA A;  3P45 B;  5IXU A;  4KSE B;  3IWX A;  1NPP A;  1PIL A;  4ED2 A;  4K2J A;  4W90 B;  4WWS A;  4CP5 A;  1KFS A;  2HVI A;  3S6E A;  4NLY A;  1EKS A;  3CCE S;  3VAL A;  1PBA A;  3RG6 A;  2Q3P A;  4EWT A;  4F4Z A;  5KG5 A;  1NKB A;  1F5B A;  2C3M A;  3C16 A;  1QTN B;  4FF3 A;  5EWG A;  4ZP7 A;  1BY9 A;  2KM8 B;  1LFP A;  2UUC F;  2P2C B;  2H9Z A;  4X4N A;  2KO1 A;  3BSC A;  2DHS A;  4ZVQ B;  3J7A 1;  3C14 A;  4PZV A;  1NK6 A;  4EYI B;  3R7S B;  5BXI A;  4DR5 J;  2NPF A;  3PG9 A;  2QSW A;  5BR8 J;  4ED5 A;  3DLG B;  2KH9 A;  2XQC A;  5J2P B;  3QZ8 A;  2R7X A;  4RR5 A;  1IBL J;  3V4I B;  3K5O A;  2MQ8 A;  4FYV B;  3ZXW A;  1J5E J;  2QLW A;  2E5H A;  3MEE A;  4PYA A;  4ZIT A;  2OPQ B;  1WF1 A;  2VF3 A;  4M5M A;  1EET A;  1X0F A;  3GCX P;  3MTJ A;  5CQG A;  3IG1 A;  4DPU A;  1DHM A;  2LQB A;  3IR6 B;  3T5J A;  1UP1 A;  1YJT A;  4C11 A;  3DI6 B;  2KFZ A;  1SJQ A;  5F8G A;  2E44 A;  1EHW A;  1FKP B;  1FVS A;  1FX4 A;  1RT3 A;  4LRB A;  3LUY A;  3SQO P;  4RW8 B;  3ZZR A;  4LF9 J;  2OH2 A;  3FZB A;  2CQ1 A;  1FTR A;  2ZJQ Q;  2N3L A;  3QGI A;  1LW0 A;  2VG6 B;  4U9R A;  4DCJ B;  3UNG C;  1TP7 A;  5KFM A;  1YTY A;  5J1E B;  1S0O A;  3D1Q A;  4OYZ A;  2KXH A;  3JB9 k;  4JI8 J;  3OFF A;  2MZR A;  3BSA A;  3VAI A;  2FVP A;  3VGS A;  1DTT A;  2XZD B;  3MM8 A;  3FDS A;  3QLH A;  5K8O A;  2IDL A;  4F0K A;  1CC8 A;  2KI2 A;  2MST A;  2UUW A;  3DRX A;  3K5P A;  4M5L A;  3OR1 A;  1MMD A;  4IO1 A;  3RGI A;  4OZN A;  4A8K A;  2HAI A;  1WG5 A;  3Q2S C;  2YPZ A;  1N0V C;  3AH6 A;  3VTI A;  3NS5 A;  1A7G E;  2E1M C;  4OZ5 A;  1B0T A;  4Z7Y A;  2VG7 B;  4BHQ A;  4F2R A;  2OEL A;  4KB7 A;  2J6U A;  2AF6 A;  1XNR J;  3TJ8 A;  2WVF A;  1P1L A;  3I87 A;  3RR7 A;  3MXH P;  3NXZ A;  2A2C A;  4BC9 A;  4CTA A;  4E2F B;  2WHO A;  2KHC A;  1UVM A;  3IA0 A;  4CLY A;  3KG4 A;  2BQR A;  4Z37 A;  1CJK A;  2X3D A;  4L73 A;  4NA3 A;  4HYK A;  3QPI A;  2MXY A;  2CQB A;  3OPK A;  1Y5N B;  3QBC A;  1X7V A;  2UVR A;  2Q79 A;  4KGV B;  3G86 A;  4TY9 A;  3F41 A;  5E3Q A;  3T1H J;  1U02 A;  3CWJ A;  4F4W A;  2DR6 A;  2QLF B;  5ETL A;  1HQU A;  3DM2 A;  3GE9 A;  5B0F A;  4HHJ A;  4JV0 A;  5A0Y B;  5KT4 A;  5AJ3 F;  2J9C A;  2G2O A;  4TQR A;  3FSI A;  1WHY A;  5ETR A;  3NS7 B;  4C7Q A;  3RR8 A;  1TL3 B;  2AT1 B;  2LMI A;  2C2E A;  4JYA J;  1FFW B;  4IDK A;  4J9Q A;  2MB0 B;  4JV1 A;  2DIS A;  3FEZ A;  4O0I A;  4DV6 F;  5HBM A;  1F60 B;  1RB0 A;  2CG4 A;  5GVQ A;  3GU0 A;  2CQI A;  2LCW A;  2YWE A;  3TX0 A;  3KHL A;  1NO8 A;  4B9V A;  3AXK A;  4EI2 A;  1S99 A;  1FA0 A;  2EFG A;  5HL7 Q;  3CPW R;  1IKY B;  3W1Y C;  3SV4 A;  1XMO F;  2H51 B;  3BGF A;  2XYG B;  2JVR A;  3A3P B;  4I2Q A;  1HLW A;  1S1T A;  4F0H A;  5F8H A;  3MZI A;  4JI7 F;  1K44 A;  2GX8 A;  4OZ1 A;  1RAA B;  4DOZ A;  4F4A A;  3OXL A;  4WP9 A;  3EXC X;  4GO5 X;  3T19 A;  4ELT A;  4B3R F;  2AYG A;  3DLE B;  1NJZ A;  2QG9 B;  2R42 A;  3LAN A;  2C3U A;  2MQO A;  2BKP A;  4PWU A;  4HLB A;  4QIE A;  2NUH A;  3B8H A;  3ZZO A;  5BYS A;  9ATC B;  1QVF R;  4RW6 B;  1ZZF A;  4WZQ A;  1GK8 A;  2AJF E;  2V34 A;  2P6T A;  3D1O A;  4M5D A;  1HQE B;  5FJ4 A;  4DSF A;  2HGL A;  1GXL A;  1VQO S;  3MM9 B;  4Y2M A;  1TL4 A;  5KT3 A;  4RBU A;  5AE2 A;  4ED6 A;  3ILO A;  1VRU B;  1ZOT A;  3M8Q B;  1G7C B;  4PAB A;  1S1W B;  1NSQ A;  3WIV A;  4XO0 A;  5HP1 B;  1DTQ A;  2DNK A;  4OI3 A;  2AGQ A;  2XI2 A;  3SQG A;  1MMN A;  3DDK A;  4EBD A;  3EPG A;  1NSP A;  1JNR B;  1CVJ A;  5D0H A;  3M9O B;  4DQS A;  3TZW A;  2FC9 A;  5L38 A;  1N5V A;  3ET6 B;  4CO3 A;  2NLW A;  2BE9 B;  2BX6 A;  4LFA F;  3R97 A;  4DX6 A;  2VG5 A;  2VKR A;  3W7B A;  2R7T A;  3MEG A;  5K14 A;  1AZS A;  2GVZ B;  1X5S A;  4MYU A;  1C1C A;  4RW9 B;  2DO4 A;  1N33 F;  1NAQ A;  4WXW A;  1X5P A;  5CYJ A;  4Q5V A;  4M94 A;  2N3O A;  3RB4 A;  2V5H G;  2G2Y A;  2ZZN A;  2ZUA A;  3H5U A;  1QTM A;  2CJX B;  3RYL A;  3ETO A;  2BJ3 A;  4P72 A;  5FDL B;  4QQB A;  3V81 A;  4DV2 F;  1VK8 A;  4K4T A;  1PJ5 A;  5KFY A;  2HK3 A;  1FRI A;  2CPJ A;  4K5S A;  4EBE A;  3OVS A;  2MKC A;  1K1S A;  1HHS A;  2FVQ A;  2M8D B;  3HVT B;  3KLI A;  2N4C A;  2E29 A;  5LMN F;  4J9U E;  1B0P A;  1RBO B;  2MKI A;  3GJR B;  4MAK A;  1X4H A;  2WOM A;  4A46 A;  5L1L A;  2CQ3 A;  3C6T A;  3ETM A;  4OL8 A;  3EZO A;  1TL3 A;  4HR2 A;  4ZVT B;  4P2X A;  3LAK A;  4RBV A;  5KFS A;  5IT9 Y;  3B54 A;  5KFL A;  2IIH A;  2WVE A;  1RTD B;  4YUD A;  4WYL A;  3KLH A;  2LXU A;  2JSX A;  1H72 C;  3CJ0 A;  1IM6 A;  4WFB Q;  1IKW B;  3DYA A;  3BH6 B;  4IH7 A;  1UVK A;  4NYP A;  5KFR A;  1IBC B;  3CCL S;  3MCM A;  1S1T B;  1EQM A;  2RE1 A;  2RD5 C;  2M0G B;  4RUA A;  2CNO B;  2DY9 A;  2NRE A;  2DEJ A;  5IWA J;  1K1Q A;  3FRZ A;  4KFB A;  3GTY X;  1PG5 B;  4RBT A;  2WTF A;  3QJJ A;  1DQA A;  3X3U A;  2FGO A;  2DHX A;  4B3M F;  2YQ0 A;  3CJ8 A;  5LMU J;  3RTV A;  1LWE A;  1AFJ A;  4DR3 J;  3M8R A;  2R7O A;  3O5T B;  3HUL A;  1HQE A;  5DDR C;  1OY8 A;  3CC2 S;  4OYB A;  2AIR B;  5J2Q B;  2IM2 A;  4J91 A;  1PCA A;  3MR5 A;  1WTB A;  2HLU A;  3ISZ A;  2ZVI A;  4OV6 A;  3E2E A;  3W9I A;  2R7W A;  1GFW B;  2VPZ B;  1IWG A;  3FMW A;  1Z2L A;  1TL7 B;  5DDO C;  1MU2 B;  3FBE A;  4OI1 A;  2ZOG A;  2XMU A;  2DD8 S;  4GO7 X;  2VBZ A;  4I0W A;  4B17 A;  2MTL A;  3PDN A;  3FJ2 A;  2QA1 A;  3CVK A;  2BJE A;  1Q0N A;  2LLZ A;  1CJV A;  2PEH A;  2LP4 A;  3LP0 B;  2X51 A;  4CO1 A;  2Z57 B;  2YTC A;  3SSR A;  4IYQ A;  3PCO B;  5KFQ A;  2E9R X;  3BM7 A;  2XBP A;  3LAM A;  4ICL B;  4A8O A;  3JYT B;  1VQP S;  3FNN A;  1GMW A;  2VPY B;  2Z8Q A;  4CM0 A;  5D6G A;  5F8I A;  4HH0 A;  4ZJO A;  4I6W A;  3L09 A;  1RAJ A;  1X8D A;  3M05 A;  3V6J A;  2FY1 A;  2Y8Y A;  3QID A;  1T05 B;  3GCW P;  3T6B A;  3KLE A;  2ZH2 A;  2WON B;  2ZKU A;  1D9A A;  3H59 A;  1Q53 A;  2GFF A;  1GTE A;  1J5O A;  2R8G A;  3J81 U;  4WK3 A;  1VR6 A;  2HFS A;  4DEZ A;  2CPF A;  2GQ2 A;  2WOM B;  3R5B A;  3QAT A;  3QIP A;  2VQE F;  3OQ2 A;  2VPW B;  4K5R A;  3TUZ C;  3BPS P;  4DN0 A;  3BQ2 A;  1TU0 B;  1Q7L B;  1CEZ A;  2I9S A;  2HBR B;  3KFW X;  3BR9 A;  4LF1 A;  4MYT A;  3OL9 A;  3EJM A;  1TMM A;  3M9N B;  2OEM A;  5T7L A;  1S0N A;  2GIQ A;  4MTP A;  5IWA F;  2J0X A;  4FF4 A;  2MLX A;  2K7J A;  2QV6 A;  5G4D A;  1KQK A;  2DHG A;  4D3G A;  1NB7 A;  4J7C A;  2IY5 B;  3GFY A;  2E5J A;  5KFU A;  3M6V A;  4NLO A;  5B0E A;  4YDX A;  3HZG A;  1N88 A;  2MHE A;  1AUD A;  1RWP B;  4B9U A;  5BYQ A;  3I32 A;  2EKY A;  2YX7 A;  2E1R A;  3ELH A;  1WHW A;  2CA9 A;  3LP1 A;  3TAM A;  5C42 B;  5LXY A;  1IBK J;  4QCL A;  1UWB A;  2BM1 A;  2MSS A;  3OTD A;  5DS7 A;  4X65 J;  4RU9 A;  4X4U A;  3E3X A;  4O0N A;  1NDK A;  5KAK A;  2C2N A;  4DPW A;  1N5Y A;  1RAG B;  1RT7 B;  4JV5 F;  2ZH4 A;  1PC5 A;  1FDB A;  3W8P A;  4C9D A;  3L4B C;  1E6Y B;  4HKQ A;  2V6A A;  3EWG A;  4P2F A;  3FBC A;  3NWR A;  4OX9 J;  2XLK A;  2ZFH A;  1X9W A;  4Y34 A;  5DO2 A;  3HF5 A;  2FIU A;  1FCA A;  3GIK A;  1IN0 A;  1VQS A;  3BF4 A;  4C11 B;  2H4Y B;  3E01 A;  2F63 A;  4ZVR B;  2GIF A;  2BBE A;  3AQO A;  2OLW A;  3A1Y G;  1WC5 A;  2JZ5 A;  2KRR A;  4RW8 A;  1JLG B;  1U48 A;  4LF6 F;  2OPQ A;  3MUV P;  4HDH A;  3FFI A;  2XMK A;  3UVJ A;  2WAQ D;  3GFH A;  1WEY A;  3HSJ A;  3MEC B;  2HIQ A;  1YIJ S;  1RAO A;  1PKU A;  1G4C A;  2NUU G;  2NYH A;  1RQ0 A;  3DRP A;  1U26 A;  3C6U B;  3KJN B;  2YNG A;  2NXJ A;  4H4O A;  3V4M A;  1NXI A;  4WYW A;  1EAR A;  2BYC A;  2YXL A;  3VF0 B;  3J7Z T;  4LFA J;  4E0D A;  1QAI A;  1ZBT A;  4RZR A;  1Y9O A;  4AUK A;  2FQQ B;  4QIG A;  4EFA C;  1MWQ A;  3FVY A;  1NKE A;  4IUF A;  1N8R T;  2YKA A;  3OR1 B;  1Y3K A;  4IOA Q;  4R5P A;  3NKY A;  2WSE C;  3QSI A;  1X4E A;  2QMX A;  3D0I E;  1VJW A;  2BA9 A;  1DTT B;  4URQ U;  3L7O A;  4BCA A;  3BQ0 A;  3PW4 A;  1KVK A;  1HNI B;  1RT6 B;  1T0T V;  2B0G A;  5AXN A;  3R6L B;  5DDP C;  4C8L A;  2R4F A;  3KHH A;  1UFW A;  1S9F A;  2W4D A;  3DOL A;  2FZK B;  1F3F A;  2OTL S;  2J9D A;  1JLA B;  2HQF A;  2AJ4 A;  1Q8B A;  1FE0 A;  2VG7 A;  1JIH A;  3AT1 B;  3MEE B;  4USV A;  1J5O B;  3M1V B;  1LV5 A;  1GMU A;  2HQC A;  1P9Y A;  4LSN B;  4FF1 A;  5HQL A;  3J80 U;  3T1A A;  4DSK A;  2HK2 A;  2B8P A;  2F40 A;  5G0R A;  3KLG A;  3TRG A;  1RBL A;  1SC1 B;  2ZC3 A;  2X3G A;  2AJ2 A;  3DMJ A;  1CJK B;  5GAG U;  4ZJQ A;  2YBV A;  3FCH A;  4DV1 J;  2DJW A;  1HNV A;  1CQM A;  4ZHR A;  2P9G A;  5ETQ A;  3W9J A;  1PIE A;  1N5Q A;  1HQU B;  2FHJ A;  3MED B;  2YWH A;  1GAO A;  2OTJ S;  3QT8 A;  2XYH B;  4F2S A;  4EO6 A;  4ZPA A;  3OJU A;  1IKY A;  1KS2 A;  1BGX T;  1FNM A;  2BAN B;  2DNH A;  4USJ C;  1BC6 A;  3MMB A;  1HI1 A;  2VC0 A;  3N4W A;  1HR0 J;  2BOP A;  4OJ3 A;  2E5L F;  3CCJ S;  1CG2 A;  2GW8 A;  4ZN1 A;  1VQ8 S;  3F44 A;  3SCK E;  3GZ7 A;  5HRO B;  1N5Y B;  1VQL S;  2C2M B;  2IFX A;  2MZQ A;  2EK1 A;  2DGT A;  2DYA A;  4HTJ A;  4M5G A;  2HWI A;  4L76 A;  5DM7 Q;  2IMO A;  3KK2 A;  3OTE A;  6FDR A;  2OPP A;  5A8R B;  4LFC F;  4OV1 A;  2HWH A;  5MAO A;  1ZTW A;  1RWX B;  2Y3Y A;  2OSR A;  2VV5 A;  2B56 A;  2Z58 B;  1OSD A;  2ASL A;  4KV8 B;  4OMF G;  3G6E S;  4OYP A;  1L3S A;  1JLC B;  2GCF A;  1HW8 A;  1NK5 A;  4H54 A;  5SZT A;  1QSY A;  4PCQ A;  2XMT A;  5A8K B;  3M6X A;  1WOO A;  4OYO A;  2ZWP A;  4RWW A;  5M2U A;  2WVC A;  2VFR A;  3ZTQ A;  1WC3 A;  3DRP B;  1FKA F;  1RWW B;  4O3N A;  4DXL A;  4DV5 F;  1VHF A;  2D9O A;  3AD9 C;  3MPD A;  4WBF A;  3TNV A;  2PSZ A;  1LXN A;  2DIT A;  3W61 A;  1URR A;  4JB8 B;  2IYI A;  2AZ1 A;  3OFH A;  2W8K A;  1TFW A;  3TX8 A;  4P2S A;  5LSO A;  2EWH A;  4OZL A;  2CKW A;  5CAB A;  2UUT A;  4F67 A;  2YKN B;  2GGP B;  4AYB D;  1SV5 A;  2Z56 B;  3JAM Y;  3Q8V A;  4LR8 A;  1SL0 A;  4NAS A;  4QIF A;  1EJ7 L;  3I56 S;  2KFY A;  1Q8I A;  3WDO A;  2ZC4 A;  2ZH8 A;  2WW4 A;  3QGP A;  4KQZ A;  3Q22 A;  4ZOS A;  4MKB A;  1RAE B;  3CCV S;  2MZT A;  3T9Z A;  1NHV A;  1C0U A;  2F1F A;  2L9W A;  1SBR A;  2PC6 A;  2XO7 A;  5DET A;  1TKZ A;  5KFB A;  3AOB A;  2FLP A;  2HYI B;  2OJ3 A;  4DR7 J;  3AAW B;  4F50 A;  2DH8 A;  5I3U B;  3IFE A;  5KG6 A;  2EFQ A;  3DRR B;  3K58 A;  2LXF A;  1DQ9 A;  2AP6 A;  1HNX J;  2JHE A;  5HP1 A;  4QPX A;  2FJX A;  2G4B A;  3IBC B;  2Q6B A;  2CQG A;  4DR7 F;  4NLS A;  1R0C B;  3RBX A;  2K8G A;  3BO2 A;  2CPD A;  4Q7A A;  3BBF A;  3BN4 A;  1NK9 A;  5KTQ A;  1SUQ B;  2M88 A;  3EGN A;  4TU7 A;  4UQG A;  5LMU F;  2A10 A;  2H5I B;  3TZY A;  2R2T A;  1T9U A;  1ULR A;  1SL2 A;  2ZBI A;  2D9P A;  1FF2 A;  1YK9 A;  2XMW A;  5B0G A;  2G1H A;  5DQI A;  1S1V B;  2L48 A;  4RW9 A;  2O5D A;  3P8B B;  5F3Z A;  2XNQ A;  1H2V Z;  3KLH B;  1GX6 A;  1YBT A;  3LGM A;  5JUM A;  4F3Q A;  1JKH B;  3HHL D;  4NCG A;  2W4C A;  3Q0A A;  4NLG A;  3W5Y A;  1U2R A;  3RBZ A;  3EPI A;  4BWM A;  4LF5 F;  4KHP J;  3C15 A;  3RB0 A;  1T8E A;  1RT4 B;  3LQV A;  1FXD A;  4PXB A;  4PQU A;  2DPJ A;  2XMA A;  1H6K X;  4JBC A;  1YJN S;  1UPP A;  3K0J A;  3ITH B;  1V6H A;  3VGU A;  4KGZ B;  3MR2 A;  1UW4 A;  2HGM A;  4YDD B;  3MR7 A;  1TKT A;  3TI0 A;  4LR7 A;  3SCI E;  2QIF A;  3OTO F;  2DNM A;  2ZJP Q;  1N32 F;  2B4P A;  4L75 A;  2WVB A;  3TAR A;  1LKZ A;  1G6B A;  2OEK A;  5D3G B;  1XJW B;  4NPO A;  4F0M A;  1TUG B;  2ZZM A;  3HXM A;  4B9M A;  3PIO Q;  1DLO A;  1Q16 B;  1C4A A;  1SCJ B;  3ISN D;  1Y00 A;  3EZ5 A;  2OFH X;  4XPC A;  3C2P A;  5CYQ A;  3HSG A;  2ZBQ A;  4OYI A;  4K7Q A;  2ZH1 A;  1VJQ A;  1TUV A;  3K89 A;  3I4H X;  4ECQ A;  5KFC A;  4LVN P;  3KHR A;  2JNJ A;  5K9F A;  4U7U K;  3TA2 A;  1TK5 A;  2CQ2 A;  2XG8 A;  3ZZU A;  3CGI A;  4MH8 A;  3MMC A;  1FXL A;  4KHP F;  4NLQ A;  2COL A;  5GAE I;  1W2B R;  4CLL A;  1P27 B;  4ZPB A;  1NZA A;  2ADC A;  4JI6 J;  1VDH A;  2ROE A;  3GV8 B;  4DLE A;  3ADA C;  2OIH A;  4HT5 A;  4QU6 A;  2DNG A;  4ZPD A;  2YWF A;  3TUP A;  1ZM9 A;  3FCV A;  4RUB A;  1RDR A;  1VQ7 S;  1UA1 A;  3OT9 A;  3CCQ S;  2HRU A;  3KJQ B;  1KD1 T;  1TTH B;  2HAF A;  1LQ9 A;  1UEU A;  2Y0S D;  1NZ8 A;  4YB7 A;  3DLK B;  3FRY A;  4KO0 A;  3KHG A;  3PZP A;  3HLU A;  1C0U B;  2GHW A;  3GON A;  5IOL A;  4M5H A;  1WHV A;  3KG1 A;  1ICE B;  3N79 A;  4DR2 F;  1ZAX A;  1WKJ A;  3PJX A;  5HRO A;  2KM8 C;  3DKD A;  1WHX A;  2B7B B;  4CLP A;  4WKR A;  4BWJ A;  4M5N A;  1S49 A;  4MJK A;  3UDE A;  3LWL A;  3H20 A;  1IQZ A;  1F5A A;  2GML A;  2K3I A;  5E3R A;  3MAA B;  1D0E A;  2RU9 A;  1OY6 A;  5AE1 A;  1DUR A;  2DIV A;  3BDE A;  3I9Z A;  2MGZ A;  2HVZ A;  1T03 B;  3MPW A;  2N4D A;  2LQ5 A;  2GJ2 A;  2OAU A;  2OHD A;  5ETM A;  4ZP8 A;  5C24 B;  4DQP A;  4X4O A;  4K0K F;  5GMK a;  3BGR A;  4RW4 B;  4M5J A;  4FXD A;  2VFS A;  4FNI A;  1M5S A;  4Y6I A;  1BHN A;  3LH2 S;  3LP0 A;  4JI5 J;  4QWD A;  2I38 A;  3TOQ A;  4QBU A;  4ZCL A;  5SUH A;  3W2W B;  2V8V A;  4CNZ A;  3N9U C;  4LRE A;  3QRQ A;  2Z30 B;  1U1L A;  5D15 A;  5IQQ A;  1N6Q B;  4EUV A;  2QGF B;  4P7V A;  4FS1 A;  1CC7 A;  1XEZ A;  4OI4 A;  2BJD A;  5DLG A;  2B6A B;  4CT9 A;  3OFE A;  4WFY A;  3MM6 B;  4O44 B;  3W5X A;  4PWD A;  1NSK L;  2QFI A;  2VDI A;  3QMQ A;  2WON A;  4LRC A;  3WC2 A;  4U7C A;  1NJW A;  4DR1 F;  2XS2 A;  4LFC J;  1PAE X;  1NB2 A;  2W2P P;  3G82 A;  3M32 A;  3MI7 X;  4USK A;  3OTC A;  2DRA A;  3JAM U;  4LF7 F;  4JI4 J;  1HAR A;  2OPS A;  1TUW A;  1VYA A;  5IQ6 A;  4KR0 B;  2UP1 A;  1ZAV A;  3DLB A;  2DNR A;  1H74 A;  1VBZ A;  2F9D A;  2YWG A;  1IR0 A;  1DLO B;  4WTY A;  1H2T Z;  2WBR A;  2CFX A;  4YEA A;  5E2Q A;  3DRY A;  4NOH A;  2RS8 A;  3K5L A;  3N5F A;  3NGT A;  4YB6 A;  3KYL A;  1NK4 A;  4IH5 A;  4FN5 A;  2AJ1 A;  3PO4 A;  4H4O B;  2DNO A;  4FVM A;  3SDE B;  2KFN A;  4U7U D;  4ZA1 A;  1MG7 A;  1N34 J;  2MQP A;  2JC1 A;  4RX6 A;  2C2Z B;  2CNL B;  3I6P A;  3W5Z A;  1B3T A;  4Q2M A;  4W4M A;  2MKH A;  4M5I A;  3OJS A;  2H5J B;  1T3O A;  3PAC A;  3Q8Y A;  3QRP A;  3LOU A;  2QE5 A;  3J7A N;  4ETZ A;  1HNI A;  1RT6 A;  4DX5 A;  4MKY A;  1NBE B;  1W26 A;  4K4U A;  3KTQ A;  4NLV A;  4LSZ B;  4OJG A;  4YB1 P;  2HSE B;  3QZ7 A;  1VQM S;  3DFE A;  2HHH F;  2J0S D;  2I8E A;  1BQM A;  1OIA A;  3JXO A;  4JI1 F;  2YNH A;  1GH8 A;  1OQ6 A;  2GMH A;  5C2G A;  3GII A;  3RRG A;  3PIP Q;  5DG7 A;  4DQI A;  3HHL B;  3IP0 A;  4O3S A;  1N33 J;  2I5J A;  2N7Y A;  2V67 A;  3H2U B;  4NEZ A;  1FD8 A;  3NAH A;  3CDU A;  4U8V A;  1M1H A;  1AA1 B;  4CLT A;  2IC3 A;  2J9E A;  2MKY A;  4V1A k;  3UD5 A;  4ALZ A;  3BEG B;  3M4X A;  2X1G A;  4AT1 B;  1AUS L;  1XMB A;  3MFI A;  1SQE A;  1S76 D;  5E3A A;  1VI7 A;  4FP9 A;  3QT6 A;  2E1P A;  1U6F A;  3OR2 A;  3PYF A;  5AXM A;  5H1S V;  4LF4 J;  1RAF B;  2VKZ G;  2PMH A;  1VRT B;  2FHJ D;  3A8J A;  3MED A;  3N01 A;  4QR0 A;  1RTJ B;  5G0R B;  2MY8 A;  5KFD A;  3KLG B;  1YX2 A;  3J7Y I;  1YG0 A;  3DHX A;  4P52 A;  2HS3 A;  2RSQ A;  2UV8 G;  3CT9 A;  3NBP B;  3AA8 A;  4G3I A;  1WDD A;  1RT2 A;  2CPI A;  1F9F A;  4FXV A;  1M90 T;  1H73 A;  4B3S J;  1WKL A;  4N76 A;  5CAA A;  3Q8Q B;  2OML A;  5E41 A;  2UXD F;  3DCA A;  5ITH A;  1UZH A;  2JWN A;  5J2M A;  5IZH A;  2K3K A;  5A76 A;  2ZH9 A;  2B9Y A;  4JI0 J;  5E3C A;  4LF5 J;  2HNZ B;  4EK2 A;  2Y1L B;  4KKO A;  4WTO B;  4PXD A;  3RAX A;  1JNZ B;  2AV5 A;  3I9V 9;  1ZZN A;  4JI2 J;  1F2G A;  3KK2 B;  4U6P A;  3DOL B;  3I0S B;  2OPP B;  2LDI A;  2PII A;  5A8R A;  1HWU A;  4B3R J;  3CC4 S;  2Z2M A;  2ZWO A;  1JLA A;  4DL3 A;  3CCM S;  1JLB B;  2KYX A;  1WAC A;  5HQ8 A;  1WTF A;  2KXN B;  3I4P A;  3KDN A;  1N36 F;  1Q8K A;  2MMY A;  3H25 A;  2OPS B;  2IRX A;  4WJB A;  1HNW F;  4ES3 A;  4K50 A;  2V68 A;  4CO2 A;  2QLX A;  4QYR A;  3QO9 B;  3ULH A;  4Q44 A;  3V4I A;  1KBR A;  2B4O A;  1SIZ A;  4JI5 F;  4KYZ A;  1PO6 A;  1FKO B;  2AX0 A;  1FJ7 A;  3NG8 A;  1B0V A;  1YZ6 A;  3MD3 A;  1U8W A;  1HWJ A;  3T6J A;  3ZTO A;  2BJ1 A;  4Q8E A;  1UVJ A;  2ZM6 J;  1S6P A;  1T9V A;  1GNK A;  1WC4 A;  1X5O A;  2DNN A;  3PM9 A;  4WFZ A;  5KFK A;  2UU9 J;  2KU7 A;  5KG7 A;  4ILL A;  4WFA Q;  2QTW A;  5H9F J;  2IBK A;  2JC0 A;  4ID5 B;  4DPT A;  4KJI A;  3AOA A;  3EVO A;  3H8Y A;  2PD1 A;  2M4M A;  3D3B J;  4CRJ A;  2KN4 A;  2BAN A;  1HD0 A;  4ZVH A;  5KOX A;  3M9M B;  1GEH A;  4QIV A;  2EBG A;  2QYG A;  1REV B;  5T41 A;  4JI0 F;  3T3F A;  3MPY A;  3PY8 A;  8RUC A;  3WHI A;  3IGN A;  5HVH A;  2V2K A;  1RJJ A;  2D3O 1;  2OMO A;  1IVZ A;  4YHH J;  1S72 S;  1FE4 A;  1S1X B;  3IAM 9;  4DFP A;  2DY1 A;  5KT2 A;  2HQ3 A;  4ECT A;  3DLL Q;  4V19 J;  2HHS A;  1KP6 A;  4A8F A;  2OI2 A;  1UPM B;  1S9E A;  2DGQ A;  1LNQ A;  4P73 A;  1CUL A;  2BXJ A;  1S1U B;  4NZ7 A;  4KPC A;  5CZV A;  3EGZ A;  2R7R A;  1CLF A;  2GGP A;  3CXC R;  4CT8 A;  2B5J A;  2F4F A;  2N82 B;  2X1A A;  4GC7 A;  2PO4 A;  2J7W A;  2ZDO A;  3HJV A;  1XR5 A;  4QZV B;  4X4P A;  4I67 A;  1IM4 A;  1U0S A;  3POT A;  2GMJ A;  1B64 A;  4YY3 J;  5J2P A;  2IC3 B;  2VA2 A;  4LQ3 A;  2VOP A;  1JLC A;  3TZZ A;  4LIW A;  1RSC A;  5HMX A;  4XIU A;  4I69 A;  2XM3 A;  4OI0 A;  3DU5 A;  1TMJ A;  1RA7 A;  3F73 A;  5D8H B;  4FPI A;  3OR2 B;  1TKZ B;  5A8K A;  4IH6 A;  5ETS A;  2JEF A;  5A0Y A;  4ZDN A;  2BW7 A;  1NRK A;  3GSD A;  1ZM2 A;  1G3O A;  3OBI A;  3TVZ A;  1YJ9 S;  4PUO A;  1RWV B;  2HS0 A;  1QDU B;  2VFT A;  4TYA A;  4ZP6 A;  2CJ9 A;  1WG1 A;  4IDK B;  4PEO A;  1Q86 T;  2C2K B;  3DOK B;  4LJM A;  3UW1 A;  2YY3 A;  3CUL A;  2HFZ A;  3HVR A;  5E0O A;  1HHQ A;  4HI2 A;  2GC8 A;  4DZ6 A;  3M2V A;  2NXU A;  4TLR A;  4NI2 B;  1R0B G;  3HSZ A;  3I0R A;  5J2M B;  2YKN A;  4RNN A;  2FLN A;  4YR0 A;  5KFE A;  4FKX A;  2XB2 D;  1Y5L B;  4X4S A;  1U45 A;  3PRB A;  1DRZ A;  1FNX H;  4S0M A;  3HX9 A;  1Z4U A;  2LQJ A;  1HYS B;  1F2H A;  1EB0 A;  2BW2 A;  5KG4 A;  3OVB A;  2O66 A;  4DQQ A;  4FYY B;  1KHV A;  4DR5 F;  3IM9 A;  3IRX B;  1JLB A;  5AJ3 J;  4P10 A;  3CD7 A;  2XSJ B;  4K4X A;  4PKD B;  2FHK A;  5LJ5 Y;  4DL6 A;  3W64 A;  2EXU A;  3D6F B;  3I5B A;  3M2U A;  4N8N A;  1I3O B;  4F7V A;  4PPZ A;  3NCR A;  5L8R C;  3OSP A;  1CSJ A;  2CYY A;  2KDO A;  3KNG A;  4B9N A;  3G9C A;  3K57 A;  3DLJ A;  3N6N A;  1XMO J;  1MN7 A;  2JVO A;  3BS9 A;  4M5D B;  3H98 A;  2W2N P;  3H2L A;  3ITH A;  4ED4 A;  2WRM A;  4NYO A;  2HPU A;  2J76 E;  4OFZ A;  1VQ5 S;  2LA6 A;  4LMZ A;  2X1F A;  2FJW A;  2BVZ A;  1RCO B;  2K7K A;  2FVS A;  2F5G A;  2QLJ B;  1SUQ A;  5FD1 A;  2VA3 A;  4KBI A;  3UNY A;  1M1G A;  2DT9 A;  3THT A;  4IR9 A;  1N52 B;  1FD2 A;  3NGK A;  2GV1 A;  3JSY A;  8ATC B;  1JJH A;  1LWF B;  3CJ4 A;  3NGS A;  4IFY A;  2HZC A;  2GHP A;  3MFH A;  1I5O B;  1JJ2 R;  5KFJ A;  1KSP A;  4CYU B;  3DLH A;  2JEJ A;  1R6Y A;  2Z0G A;  2RML A;  3IBF B;  1U25 A;  4OHY A;  1KFD A;  1J27 A;  3CCT A;  2L9N A;  2E5G A;  3O2I A;  3OVA A;  3H42 A;  5F0W A;  1HD1 A;  3GB0 A;  3GIM A;  2BOA A;  1S9E B;  3MMC B;  3FQK A;  2QMW A;  1S1U A;  3C46 A;  4U8Y A;  2OD6 A;  2KZZ A;  2H3E B;  1GQE A;  2A1B A;  4ETX A;  1RI7 A;  1UTA A;  2ZBP A;  3G2X A;  4JI1 J;  4DV6 J;  4QIW D;  1H38 A;  4X65 F;  3B6B A;  3K7R A;  1KWM A;  2FLL A;  2EFP A;  2HHH J;  2RRN A;  2I6W A;  2F4V F;  1QSL A;  1V5V A;  1Q5Y A;  2HFV A;  5B09 A;  3IO1 A;  2AMC B;  3VAF A;  2FJB B;  4PR6 A;  3IWL A;  5H9E K;  2HMI B;  2KG1 A;  1PC4 A;  3QNW B;  5F8N A;  3IGV A;  5HMW A;  3U1M A;  2XCA A;  1C1B B;  2OPR B;  4X84 A;  3HKZ D;  1L3U A;  4L74 A;  2XNR A;  4DL2 A;  4JI7 J;  4USM A;  4ZVE A;  1XR7 A;  5CCM A;  2K1R A;  1GXT A;  3ICL A;  4C2M A;  2IPO B;  5K8M A;  3OHA A;  3Q8U A;  1I94 J;  3CD6 S;  1GMV A;  5KG0 A;  3UPF A;  1SH0 A;  4RLE A;  2DCL A;  5FLX Y;  2BKO A;  1S1W A;  5F41 A;  4UZB A;  1RTI A;  2YPY A;  1TAQ A;  1Q78 A;  2HG4 A;  4JI8 F;  3TUI C;  4LF9 F;  3MEG B;  4HI1 A;  4BLG A;  2RQC A;  3DXS X;  2XI3 A;  3W65 A;  5C5J A;  4LQ9 A;  3SZ2 A;  3BV8 A;  1HI0 P;  4MIA A;  2PMW A;  4KIA A;  5THW A;  4ILM A;  4UTG A;  3RB3 A;  2RDD A;  2LU2 A;  3M8P A;  2EC2 A;  3Q8R B;  5HJY A;  4C8Y A;  3I82 A;  1AB8 A;  1SJ4 P;  1W25 A;  4C98 A;  1Y0H A;  4HAC A;  1HBU B;  1ZA1 B;  2R8K A;  1O8B A;  3O1L A;  1C1C B;  2MPU A;  3IAS 9;  4FF2 A;  2YKP A;  2Z2L A;  4A8M P;  1WDT A;  4G6V B;  1L3T A;  4RUC A;  4CLW A;  3A8I A;  2KXF A;  3GYX B;  3KLI B;  5BYR A;  2VJV A;  3M2R A;  2Y9H A;  1SQG A;  4KO0 B;  4CI0 B;  3ZZT A;  1F0X A;  4GKK F;  1YJ7 A;  5I42 A;  1D9F A;  5L1K A;  4Q0B A;  1QE1 B;  1J2V A;  2EI5 A;  3MM6 A;  4KE5 A;  4O44 A;  4KT0 C;  4PPD A;  5B7W A;  3DOM B;  2C28 A;  1FES A;  1U4B A;  5KFT A;  2XY6 A;  2LVW A;  3NP5 A;  4G1Q B;  3WBZ A;  4CZC A;  2HGN A;  5KFA A;  1NDL A;  5DQH A;  3KK3 A;  3GG0 A;  3MAH A;  1UJ5 A;  2DTJ A;  2UXC F;  1SKU B;  4NXN F;  2CJK A;  4A8Y A;  5D4L A;  3EIC A;  3M8W A;  1U7L A;  3BBB A;  1P1T A;  1X4F A;  1FFG B;  4ZJL A;  4ES2 A;  4RNM A;  2FY8 A;  3C66 A;  5F8M A;  3I96 A;  4ANC A;  2C3P A;  4OZJ A;  5IV3 A;  5KFG A;  3AA9 A;  5IV4 A;  2FYX A;  2HHV A;  3D0H E;  1H0H B;  2MKK A;  3W2W A;  2J7U A;  4ZIW A;  1F9H A;  1FXR A;  2ABY A;  5L9X A;  4PG7 A;  2C2O B;  3KUE A;  3QGH A;  2DRD A;  5LJ3 Y;  2JJ4 D;  3QAU A;  5U47 A;  1Q82 T;  2EFN A;  1FEE A;  3H4B A;  2P9E A;  3AD8 C;  4CO0 A;  5H9E J;  2BQ3 A;  4EEY A;  1LWE B;  5F9N A;  4FYW B;  1KNZ A;  3BYR A;  2UVW A;  1D3W A;  1IR2 A;  2IRY A;  3D68 A;  1VLO A;  1DZ5 A;  1OO0 B;  2ZD1 A;  4MIW A;  3EX7 B;  2V94 A;  4H4M A;  1I94 F;  5C7P A;  1Q8L A;  1UFL A;  2OD4 A;  3MCN A;  3MEK A;  4OLO A;  4RL1 A;  4BDP A;  1XMQ J;  4F4K A;  3TW0 A;  1JB0 C;  3P6Y C;  2KB2 A;  1WEL A;  3VGV A;  3K59 A;  4QYZ J;  4HT7 A;  2HRY A;  5DGB A;  2AEJ A;  2LYV A;  1HBN B;  2R2R A;  4IOC Q;  4CCH A;  2CDQ A;  1SJR A;  2OPR A;  2VC1 A;  1HBO A;  3HDS A;  3EE3 A;  4Y28 C;  4E8U A;  5H9F K;  2PA3 A;  1BXN A;  1X9M A;  1Q1K A;  1TL7 A;  2RUG A;  3QIP B;  3QGG A;  4P7T A;  1VIS A;  4TLQ A;  3ZNU A;  3FSX A;  4XK8 C;  2ZM6 F;  3K5M A;  2AJQ A;  1TEL A;  2R8H A;  3TAN A;  3AJD A;  2OUG A;  2VOO A;  4J9V A;  4GKJ F;  2YWW A;  3MR3 A;  4LF6 J;  2J6S A;  1WEZ A;  3KXD A;  3T5L A;  3UCZ P;  4LUB A;  4B9S A;  2HND B;  4PG8 A;  3ILL A;  1MU2 A;  4I7F A;  4ZVF A;  2EG1 A;  4G1P A;  3E51 A;  1R27 B;  3S1T A;  4K4Z A;  1VRT A;  1JWW A;  4ELV A;  2AZ3 A;  3SSQ A;  1SIW B;  3PFO A;  3KK3 B;  5J1N A;  4ZVO B;  4JUZ A;  2G9O A;  3ZTR A;  1HNZ F;  1XER A;  4YOE A;  3D66 A;  3R3T A;  2JH3 A;  4ZPW R;  3UD4 P;  2XY7 A;  1N48 A;  4X4V A;  2IRU A;  3HHE A;  1GTH A;  3VQT A;  3FBF A;  3DRS A;  4NML A;  3HHK A;  4U67 Q;  3P49 B;  1WOP A;  1X0P A;  1NJY A;  4ZVU B;  1RHR B;  2WBM A;  4H4K A;  1QUV A;  2D1C A;  2E1C A;  2HQI A;  4ZIV A;  5HN0 A;  5GAD U;  1RT7 A;  3THP A;  1YJU A;  4CLU A;  1A9N B;  2EPI A;  3W8G A;  3DOM A;  3MPU B;  2Z4P A;  5AE3 A;  3CD0 A;  4X4R A;  2IMW P;  3SV3 A;  4DSL A;  4JI4 F;  1S12 A;  2RQK A;  3FCW A;  1R89 A;  2YH1 A;  4OHZ A;  3UCU P;  4OI6 A;  2KZM A;  2CJB A;  1JMT A;  5B0A A;  1NPK A;  1YWX A;  1A6L A;  1RKI A;  2DR8 A;  1ACM B;  1ZPW X;  4ECZ A;  2XMM A;  4RNH A;  4UOH A;  4V19 X;  3P4U B;  4TKT A;  4UW2 A;  1RAH B;  2GJI A;  5LSL A;  2CVE A;  4P71 A;  3HP6 A;  5L1J A;  5ADZ A;  1SVD A;  2GAG C;  2PDA A;  1YBU A;  1M0S A;  2DEI A;  2M70 A;  3ONQ A;  2PFD A;  1RAD B;  2AEM A;  4DL5 A;  1U47 A;  4JI6 F;  1T9W A;  3NBP A;  4B3O B;  5LXR A;  5KFF A;  2ZVS A;  1UW9 A;  2DXE A;  1UWB B;  2UUA J;  3EM1 A;  2XC9 A;  4C8N A;  2EC0 A;  5HSP A;  1DY3 A;  4DMZ A;  3CCS S;  1JLF B;  2ZNY A;  4ZCK A;  2DVI A;  2BQU A;  5DDQ C;  1REV A;  2ZBC A;  4A8X A;  4IR1 A;  2CQD A;  2M52 A;  2OO4 A;  2YNI A;  2EFO A;  1VCT A;  4QJV A;  2LA4 A;  4YP3 A;  2UUB J;  1UVN A;  2ZE2 A;  3Q86 A;  5KG2 A;  3LGH A;  2B5J B;  4Q45 A;  4JV2 A;  4DL4 A;  4NCA A;  4KGK A;  3LWM A;  4AL7 A;  4TY8 B;  2X7I A;  1HFE L;  2HLT A;  2W7O A;  3NOC A;  3AOC A;  3E01 B;  4OX7 A;  3ZZP A;  1UA0 A;  4R0E A;  2J6T A;  4NCB A;  1HBN A;  4F25 A;  2B3T B;  3CDE A;  3NL0 A;  3W3S A;  4K4S A;  3OL7 A;  3ZZZ A;  1YZ7 A;  7FDR A;  3MD1 A;  2CXE A;  4Y2A A;  5DQG A;  4ANE A;  4X64 F;  1CS4 B;  3THV A;  2PI5 A;  2IYG A;  4WXO A;  1U1K A;  5CXT A;  1NM2 A;  2V50 A;  1KHW A;  2ACM A;  3WQP A;  3IRW P;  4DI6 A;  1Y11 A;  3A3O B;  3MM9 A;  3D6H B;  3ILJ A;  3G71 S;  3QYY A;  2YKM B;  2OP5 A;  3G8T A;  3BSN A;  1EIY B;  1VRU A;  3M8Q A;  3GJQ B;  2R8J A;  4IRK A;  3UVJ B;  2NR0 A;  2D3U A;  1Q79 A;  1U8S A;  2LFV A;  2MDA A;  2XYP B;  3HVW A;  4C6A A;  4X4T A;  4IQX A;  3DC2 A;  5DJB A;  2L41 A;  1YI2 S;  3LAL A;  2QC3 A;  4NL5 A;  5KFV A;  4PYD A;  4R5P B;  4LF8 J;  1ROF A;  2GQC A;  1WF2 A;  2YNG B;  3M2V B;  1HWL A;  3ET6 A;  2BEF A;  1TR0 A;  2KJW A;  4DS5 A;  3RBD A;  2M5Y A;  1QLN A;  1TL5 A;  3SCL E;  2UV8 A;  3CMA S;  3DOK A;  3D67 A;  2UZA A;  5HLF A;  3GQC A;  2CJA A;  5LL6 d;  4UOC A;  2GHV C;  4JI2 F;  5GME A;  4QW9 A;  1HYS A;  4DV0 F;  2ACY A;  3UDC A;  2HZV A;  3CO9 A;  3VWS A;  2CJY B;  1A0O B;  2V2V A;  4M1K A;  3BN7 A;  3IWN C;  4XPE A;  4LF2 A;  4USW A;  2O01 C;  2IM0 A;  3KK1 B;  1JX4 A;  2DGW A;  4DV1 F;  3BKU A;  2MZ1 A;  2F4V J;  4C8M A;  3L9Z A;  4J9R A;  2JFD A;  2B7C B;  3D3C J;  3G8S A;  1XQI A;  1O0P A;  2V8G A;  3T5H A;  4YHH F;  2IA6 A;  2HHW A;  2DHA A;  3BRE A;  3HVT A;  4W98 A;  3SFG A;  1AT1 B;  3MM5 A;  4DV5 J;  4DR6 J;  3M1V A;  4KHM A;  2XLJ A;  2MZJ A;  2W1B A;  4AXI A;  1L3K A;  2QYC A;  4A4J A;  4DN9 A;  2RRA A;  1FO1 A;  2QX0 A;  2GO8 A;  2I2Y A;  1URN A;  5HMY A;  1KN6 A;  1OYD A;  2IAJ B;  2QJ3 A;  2VD3 A;  4UOF A;  2KG0 A;  1RWO B;  4C8O A;  3FMB A;  5E5N A;  3PX6 A;  3DHW C;  3MR6 A;  2UUB F;  1PJ6 A;  4DSE A;  3BGL A;  1RTD A;  1JJC B;  4CYU A;  2A0F B;  1VBY A;  1SJ3 P;  1RZM A;  2FVC A;  3CSK A;  1FK9 B;  4NI2 A;  1R6V A;  2NSB A;  2G13 A;  3CF5 Q;  4NXM F;  3MUR P;  2A18 A;  2XTJ P;  5KOW A;  4CNY A;  2CJQ A;  2CZ4 A;  4L3K A;  5ETT A;  2V4Q A;  3T5K A;  1T95 A;  3TAQ A;  2D41 A;  3HK2 A;  2QLB B;  2XWX A;  3VAK A;  2XSF A;  1G1X A;  5LM7 E;  3DN9 A;  3MOZ A;  3V6H A;  2ZKT A;  2G1D A;  2W9A A;  4N47 A;  2E7V A;  3K17 A;  4FS2 A;  1QY7 A;  3M30 A;  4YFU A;  4FBU A;  2YKO A;  3NRB A;  4UY8 T;  1AXQ A;  3M2U B;  3MMA A;  4ED7 A;  1VMB A;  2RKI B;  5DZ6 A;  4C0O C;  4KV8 A;  1ZS6 A;  5BJR A;  2F65 A;  5JMN A;  1IKX A;  1CJU A;  4NA1 A;  3MPV A;  4DV4 F;  4J9M A;  2DH7 A;  1LWX A;  2RJZ A;  3L95 X;  4AXJ A;  3LP2 B;  2W8L A;  4WP3 A;  2Y1I A;  2H5E A;  2AYE A;  2VBY A;  2Y1R I;  4OI2 A;  3V5R A;  1KR4 A;  1YVF A;  2CPE A;  1Y5I B;  3I5A A;  5LT5 A;  2XGP A;  4ECU A;  3W60 A;  4DV7 J;  2FZG B;  2HMI A;  1WF0 A;  3EDR B;  1R3N A;  2CAD A;  2HQG A;  2XMJ A;  2LQ9 A;  3M8Y A;  4QR2 A;  3UFC X;  4GKJ J;  3D4J A;  5D77 A;  5CZX A;  4RU2 A;  3MMJ A;  3EMT A;  3MGJ A;  3VAG A;  1RU1 A;  1G2E A;  4OJH A;  2VBW A;  1Q4R A;  2Q1L A;  3AJ2 A;  2DH9 A;  2VFV A;  2VB6 A;  3M8P B;  4NLP A;  3P3D A;  1U0H B;  2A3J A;  4CH0 S;  4DR4 F;  1UJ4 A;  4EMD A;  2W4P A;  4IG0 A;  3O44 A;  4ELU A;  2UXB F;  1HPZ B;  5D4O A;  2UUA F;  1S4E A;  2UVU A;  1UKU A;  3R5A A;  3CJS A;  3OXG A;  2IDE A;  4CDI A;  2UXC J;  4DUZ F;  3PYG A;  5GAE U;  1WC1 A;  3A3N B;  4OX9 F;  3QWU A;  2XGQ A;  4RPF A;  4TNO A;  1Y10 A;  4CTA B;  3BZQ A;  7AT1 B;  5KFW A;  4Q0B B;  1HBM A;  2CDR B;  1RAI B;  1S6O A;  3W9H A;  2JLG A;  1T05 A;  1N4L A;  4P75 A;  3WIU A;  2CWX A;  4WKY A;  5I3U A;  2A6O A;  3CME S;  1HHT P;  2AGO A;  3TUJ C;  1WD6 A;  1RHQ B;  1OPZ A;  3D7S B;  2PN6 A;  1SL1 A;  2UVV A;  4ECV A;  1WEX A;  3SMZ A;  3CIM A;  2EKN A;  2D74 B;  2ZEJ A;  3CJR A;  1IBL F;  2V4J B;  4CQ1 A;  3N0V A;  1BMQ B;  2IAJ A;  1NJX A;  4L3N A;  4Q2L A;  1TVR A;  4LRF A;  5K20 B;  4G1Q A;  3RUB L;  3CJ5 A;  1W7W A;  2RT3 A;  3EVM A;  4DV3 F;  2H54 B;  4C97 A;  1WSV A;  3BYP A;  3V6D B;  1V3S A;  4I64 A;  4R25 A;  3Q8P B;  5HBM B;  2RVJ A;  4LBI A;  1KQF B;  2Z2Y B;  3DXB A;  3T41 A;  4DJB A;  2R7V A;  1U1P A;  2VH7 A;  1RLC L;  1KLM B;  3A8E A;  3KMS A;  2H1Y A;  2ROG A;  1JKH A;  3RU0 A;  3MDF A;  1HNZ J;  1UL3 A;  2CNN B;  1RGV A;  3AHP A;  4B3T F;  2XO6 A;  2MEW A;  4L72 B;  4DV4 J;  2V69 A;  4HAC B;  4E98 A;  3UN3 A;  3NNH A;  3CED A;  1IQT A;  1QAJ A;  1ZM3 A;  5B0D A;  1BD6 A;  1V5I B;  3M30 B;  1U1R A;  3CDB A;  2FJD B;  2DNZ A;  3DLE A;  3PHE A;  2R2U A;  2AGP A;  4M95 A;  4EU0 A;  1RE1 B;  1HKA A;  2RKI A;  3UN2 A;  1Q95 G;  3TVK A;  2YH0 A;  2ILY A;  4NZ6 A;  1TK0 A;  5C25 B;  4JOU A;  4UT4 A;  1QSS A;  1M5V C;  1MSW D;  3D2W A;  1P9Q C;  3RAM A;  2KYZ A;  2HEK A;  3DNC A;  1RK8 A;  5MLC V;  2AKW B;  4MFB A;  1XIQ A;  1TL1 A;  2FLO A;  4O4G B;  2KRB A;  1LWC A;  4RWX A;  1OSC A;  4ZLJ A;  4LBH A;  4NXM J;  3D5M A;  4G1I A;  4FYD A;  1FJC A;  1RLD A;  4DSI A;  1YDL A;  2ALZ A;  2CPX A;  2ATL A;  2CNK B;  5DG9 A;  1OWX A;  1HBO B;  2DNQ A;  1JLG A;  2B8Q A;  3SQG B;  3KLF B;  3BO4 A;  2JDJ A;  3FFI B;  2FJA B;  3GFZ A;  2HND A;  2MLY A;  3HFZ B;  3NS6 A;  4O4R A;  2BAC A;  5B08 A;  2MGZ B;  4KH1 B;  1LW2 A;  3R5D A;  4FDF A;  1RHJ B;  2U2F A;  3FQL A;  4DPY A;  2HIY A;  5K8P A;  3JQJ A;  5GAG I;  2HKE A;  1WC0 A;  5KFP A;  3J81 Y;  2IM3 A;  5K14 B;  4WE1 B;  5J2N B;  1Q5V A;  3EUN A;  1NJI T;  4I7F B;  1S9G B;  1NUE A;  3P96 A;  3HSD A;  1VQ4 S;  1FFS B;  2VPX B;  4UZC A;  4KY3 A;  4F26 A;  4PQA A;  5A8W B;  1D09 B;  4WZM A;  3H7H B;  1IXK A;  2V9K A;  3DDI A;  2VL1 A;  1RBA A;  3Q83 A;  1N0U A;  2ZOF A;  3HZE A;  3NCP A;  3FSY A;  3O3L A;  5HMZ A;  5KFO A;  4YS2 A;  3MAQ A;  2SXL A;  3IS9 A;  3TEG A;  4O3O A;  2VQE J;  3RW7 A;  1QAY A;  4ER8 A;  1EP4 A;  1FWP A;  5HAO A;  3M32 B;  2ZHB A;  3BQ1 A;  3AY0 A;  3D9B A;  2MLZ A;  2G0I A;  2E5I A;  5CYM A;  2DGV A;  3PEJ A;  5IS2 A;  3OTO J;  1N32 J;  3KWM A;  1HMV A;  3K2Y A;  3HFV A;  4CLK A;  3SI8 A;  2J0Q D;  4OZ2 A;  5A2Q Y;  3UQS A;  3MCS A;  3MUM P;  4GKK J;  4N56 A;  1HNX F;  1C4C A;  4FNH A;  1VK3 A;  3OTB A;  2N7C A;  2QSF A;  2WSC C;  2FJV A;  3JSM B;  2NSC A;  4IFV B;  2B51 A;  2HVE A;  4OX8 A;  1I1G A;  5ETO A;  4ZCM A;  1WC6 A;  1RT5 A;  4L6V 3;  3VAM A;  4F3O A;  4K4V A;  4TVA B;  1R7I A;  2V8D A;  4M5K A;  5LOQ A;  4I68 A;  5ETP A;  3J7Z 5;  1BUX A;  1MN9 A;  2BE7 D;  4LSL B;  2LEC A;  2DIU A;  3KKF A;  1N6Q A;  2BDP A;  4LFB J;  3PX4 A;  1ELO A;  1FRL A;  1RWK B;  1TKX B;  4UST A;  3WC0 A;  1RP5 A;  2WW8 A;  1YRX A;  1KVJ A;  1FEH A;  2A2D A;  2CPY A;  3UE2 A;  2DXF A;  4NE9 C;  4ZKA A;  1U1M A;  4DPO A;  4WF9 Q;  4DZD A;  3DGP A;  3MHY A;  1U6B A;  1T02 A;  1U09 A;  1E6V B;  3JTO A;  2V4R A;  1PAU B;  2BRK A;  2IBO A;  2BM0 A;  3C8Y A;  2RNE A;  4UF4 A;  4UOG A;  2FVR A;  4LBP A;  2XEX A;  3JS9 A;  3BGO P;  5CA5 A;  3FEX B;  4WIQ A;  1VHI A;  1D8Y A;  3LPE A;  1SC6 A;  4NLD A;  1XN9 A;  5RUB A;  3MM7 A;  2RDJ A;  1T7P A;  1F6T A;  3L7P A;  4IQM A;  1IJF B;  4Z7C A;  2HVH A;  4W92 B;  2E9T A;  2R3V A;  4FKY A;  4Q8F A;  3BJY A;  3DLG A;  4Y2C A;  4DG1 A;  2ZH3 A;  1NHK L;  1FRH A;  5M2P A;  4KHR A;  4UY8 5;  4AL5 A;  3LW5 C;  3UCG A;  4EO8 A;  3ISN C;  2YWK A;  1UCN A;  3ENW A;  3GV7 B;  4F04 B;  4GRS A;  1LK7 A;  4NEY A;  4RO0 A;  4OHX A;  3H5X A;  1IBM F;  1S59 A;  1KON A;  2M3D A;  3IG1 B;  2KJV A;  1LW2 B;  2IJN A;  4DCO B;  5A6P A;  1S0M A;  2HW3 A;  2GAH C;  5D0R A;  1X4C A;  5L46 A;  4EBC A;  1XNR F;  1OPI A;  4XDC A;  5HQM A;  3PX0 A;  2P5V A;  2J9D E;  1K0V A;  1FDA A;  4PG4 A;  5KFZ A;  1RA6 A;  2YX4 A;  1BLU A;  5J2N A;  1UZD A;  2RHQ B;  2RS2 A;  3AJ1 A;  3S8S A;  2Q66 A;  2AW0 A;  1RT2 B;  4OQJ A;  4EZ9 A;  4MIB A;  4ICL A;  3JYT A;  4AFF A;  3KMQ A;  5F8J A;  5FLX U;  2O3D A;  1DAX A;  5JXS A;  2ZE2 B;  3ILI A;  4TXS A;  2JX2 A;  1JLE A;  1FER A;  4KKO B;  3U1N A;  3KUG A;  1RIS A;  3K5N A;  1XMQ F;  1UMJ A;  1HR0 F;  1BQX A;  2BJ8 A;  1U1N A;  2GNK A;  1FRX A;  1BQM B;  1NU4 A;  4U95 A;  4J9N A;  2DGO A;  3PVX A;  2H48 B;  4OYA A;  4DFM A;  2NYI A;  4TU8 A;  4LIR A;  1EET B;  2CZ9 A;  2F3J A;  3VAJ A;  3G96 A;  2R7Q A;  3OUY B;  2FZC B;  1HMV B;  3PYE A;  4YY3 F;  3CCW A;  2DR5 A;  1FWL A;  4AQY F;  2YNF B;  2D69 A;  1EX8 A;  3ZTP A;  4CH1 A;  2ZHA A;  1RT3 B;  4N7T A;  2W01 A;  4DBQ A;  5KT7 A;  4PXE A;  3JSM A;  3MM5 B;  3RB6 A;  3A13 A;  1RWN B;  3HT3 A;  2RUS A;  1SJ1 A;  1S6P B;  3KLV A;  2V8H A;  1V9O A;  3G4S S;  2C42 A;  1I51 B;  2VFU A;  5M2R A;  1SXL A;  4I6A A;  1OS5 A;  4ID5 A;  2MY7 A;  2PA8 D;  4FPR A;  4UQT A;  1K0T A;  1HWK A;  4ERD A;  5A6W A;  1YGY A;  2Q6C A;  1MWY A;  5HLF B;  1YJW S;  1N36 J;  2QFJ A;  2IVM A;  1S1V A;  3DU6 A;  3TP2 A;  5EN1 A;  4MKA A;  2CRL A;  1FWK A;  3H90 A;  4DX7 A;  4DV7 F;  2VDH A;  4ECW A;  1S5Z A;  2EW9 A;  1CJT A;  3F0N A;  2DPI A;  2MQN A;  2HNZ A;  3TJA A;  1SC3 B;  4WII A;  2RDI A;  2NXN A;  2FD2 A;  1CJU B;  3IXQ A;  1XTZ A;  7FD1 A;  2CZV C;  2W2O P;  5C2C A;  2ERR A;  4WFN Q;  4DDF A;  3CDA A;  3FZ2 A;  1XWL A;  2DGU A;  4ZCI A;  2BMB A;  5E33 A;  2G2Z A;  2IVY A;  1WOR A;  3E8O A;  1WOS A;  3WX4 A;  3CCR S;  4O3R A;  3Q2T C;  1UEV A;  1YKW A;  2DRB A;  3BGU A;  3R5G A;  1FKO A;  2KL8 A;  1YJV A;  5GAD I;  1S77 D;  3HD1 A;  3FGV A;  1P6T A;  2CVI A;  2HRT A;  3HFK A;  1NCL A;  3MEC A;  5GAH I;  2QA4 S;  4RW7 B;  1L5U A;  2XZW A;  2LEP A;  3PRD A;  2B43 A;  1W2I A;  5IT4 A;  3H4D A;  2BV3 A;  4X62 J;  1JXV A;  4ZVS B;  2C2R A;  1U1Q A;  3VV2 B;  2V0N A;  4ATN A;  5EX3 A;  4TQS A;  1KDN A;  1U0H A;  2P6S A;  3TEH B;  1LK5 A;  2W2M P;  4C4W A;  3GMG A;  3NEK A;  1S6Q B;  3AQP A;  4QYZ K;  1VOM A;  3NMR A;  3VCD A;  4PRF A;  1JJ4 A;  4I2Q B;  2K06 A;  4A48 A;  1H2U X;  3JQK A;  3NLC A;  2KKH A;  3B82 A;  4CO4 A;  5DZ7 A;  2VG5 B;  4ZLN A;  4O3P A;  1JLE B;  4KC5 A;  1QVG R;  1VQK S;  1FJG J;  4C8Z A;  1UAW A;  4QWE A;  2WZ1 A;  3PKM A;  2IVF B;  2J8A A;  3PJW A;  3HJF A;  4LF7 J;  1CUL B;  2V63 A;  1NSA A;  3LO3 A;  3NMA A;  3KOA A;  2HFU A;  3R7B B;  3P5T L;  3PV8 A;  3B4D A;  1M1K T;  1S0V A;  3B78 A;  2L9D A;  4ITS A;  4M63 A;  1ZH5 A;  3ZC4 A;  2RQM A;  1PYS B;  3NAI A;  3POT B;  3ZTS A;  1HBM B;  3PFE A;  1YJR A;  3T1Y F;  1FJE B;  3GIL A;  2QO3 A;  2L08 A;  4Q43 A;  2BZ2 A;  4ED1 A;  3U02 A;  2RQ4 A;  4HDG A;  5EHH A;  1DTQ B;  1TFY A;  1MLA A;  4WU3 A;  1UFK A;  2BE2 B;  2JLF A;  4P74 A;  1O51 A;  4TN2 A;  4HHH A;  3R7N B;  3KJF B;  3OSN A;  1IBK F;  1CBK A;  3UR0 A;  3Q8S B;  1R0A A;  3UD3 P;  4K8R A;  1RAB B;  3UDV A;  2H65 B;  4AL6 A;  3X1L B;  2UXD J;  1CPZ A;  2AQ4 A;  2QMU B;  1FRJ A;  2XZT B;  2APO A;  3TYT A;  1VQ6 S;  3PNI A;  4EYH B;  4OYM A;  3M8S A;  3R27 A;  2BJ9 A;  3TVY A;  2VBX A;  2L3M A;  2E7W A;  2OGU A;  2AYM A;  3QQC D;  1BQN B;  1AYE A;  1XC9 A;  2GO9 A;  2GA7 A;  2ILZ A;  5K8N A;  2QL5 B;  3V6K A;  4FVC A;  2KVQ E;  3A12 A;  3T9N A;  1FT8 A;  2B6A A;  3D28 A;  3GYN A;  3M6W A;  6AT1 B;  5F8L A;  3VGT A;  3GV5 B;  3V81 B;  3FUY A;  2VOD A;  2ZNZ A;  1RWM B;  2EEY A;  4WK1 A;  3IRX A;  1FX2 A;  1IWA A;  4RNO A;  4IO9 Q;  3MOJ B;  2EG2 A;  5J2Q A;  1V3Z A;  1FHT A;  2BAB A;  2JLE A;  3GSI A;  4ED3 A;  1VQ9 S;  3PXG a;  4CM2 A;  1OY9 A;  2OKQ A;  4J9O A;  3LTO A;  4PAA A;  1WUU A;  4AE5 A;  4DL0 C;  3V2U C;  3C6T B;  4XDD A;  2BR0 A;  1SQF A;  1VQN S;  1C1B A;  1TZ0 A;  3RAQ A;  1S97 A;  2R8I A;  3KLF A;  3VHQ A;  1VBK A;  4OZ0 A;  5ETV A;  3OFG A;  1B70 B;  1R8C A;  1X60 A;  3NCQ A;  2KT5 A;  4PXC A;  3G6X A;  4R8U A;  5JVH Q;  2C2D A;  1X9S A;  5EWE A;  2NPI A;  2AYB A;  1XK8 A;  3QT7 A;  3SDE A;  1K73 T;  1YRT A;  3AB4 B;  3PJ9 A;  2PI4 A;  2HBY B;  5B0C A;  1LWF A;  2MHN A;  2GVD A;  4IFY B;  1FVQ A;  5F0U A;  4NZ0 A;  4P9S A;  2DKO B;  1CQN A;  2BJ7 A;  1S9G A;  3SEO A;  2GS8 A;  3VR1 A;  4DUY F;  4ECX A;  1WWH A;  2KTQ A;  1RT1 A;  3EVW A;  4DUZ J;  5DGA A;  1UVI A;  3RW6 A;  2R9L A;  2HBQ B;  5D0E A;  2EBE A;  1P8G A;  4KGM A;  3MUT P;  1KEK A;  1IJE B;  2RRB A;  2RH3 A;  4MT1 A;  2AHO B;  2X1B A;  4JV5 J;  3RBE A;  3N28 A;  2HNY B;  4URS A;  2D3O R;  4LT6 A;  2HHQ A;  1DQ8 A;  1EP4 B;  2FGC A;  3M2R B;  3H0P A;  2W9B B;  4ZVP B;  4K4Y A;  1NK7 A;  4ZMM A;  2Y1J A;  1NKC A;  1K47 A;  2I0X A;  1QE1 A;  1S7H A;  3VZH A;  4DUT A;  3TO8 A;  3ZNJ 1;  3CCZ A;  3UR3 C;  3GP9 A;  5JJB A;  4YR2 A;  2K1R B;  3BO3 A;  2JOQ A;  2I5J B;  4LRA A;  1NK8 A;  2XS5 A;  4JYA F;  3HCX A;  1BWV A;  2YKQ A;  2YVS A;  2GIR A;  3DDN A;  3PEH A;  4B08 A;  3HD2 A;  1VFJ A;  3BKT A;  5EUH A;  4DR3 F;  1U1O A;  1OJ4 A;  2FJE B;  3S01 A;  1REG X;  3PYD A;  2FC8 A;  1SI9 A;  1R0A B;  2RF2 A;  4ID8 A;  3B4M A;  1RHU B;  5E7O B;  3J7Y U;  3CD5 A;  1RTI B;  1ZPV A;  1YSJ A;  2E7X A;  4FZV A;  3QJL A;  4IFV A;  4WE1 A;  3TJ9 A;  2I1R A;  2WSF C;  2V8P A;  4I56 A;  1XBW A;  2P8I A;  4ZPT R;  3LP1 B;  5C42 A;  5KFN A;  3CTR A;  3NOG A;  1E6V A;  4LSL A;  1S57 A;  1FDD A;  3CJ3 A;  3N5B A;  1PJ7 A;  4NCG B;  2VZ9 A;  3SIP B;  1M5O C;  1RKJ A;  5KT5 A;  4B02 A;  8AT1 B;  5F9L A;  1UWA A;  3C15 B;  2FB0 A;  3KG0 A;  5J1P A;  2YX1 A;  1C2P A;  4MK9 A;  1D9D A;  3DGP B;  4FXW A;  1HI8 A;  2JEI A;  3KLE B;  3MM7 B;  4IRD A;  2M2B A;  5LSR A;  3FKB A;  2R2S A;  2WK4 A;  1EZZ B;  4J9L A;  3AXM A;  4NRU A;  4OIX A;  2BKN A;  1SJF A;  4Y00 A;  1PGZ A;  3G8Q A;  3GLJ A;  5KFI A;  4I6Y A;  2BRL A;  4GC6 A;  4DS4 A;  3H5S A;  2CAJ A;  1QM9 A;  2POK A;  3R5C A;  2PGC A;  1WG4 A;  3PO5 A;  4P6Q A;  2H4W B;  1RXO B;  1S4F A;  5CCL A;  5IC4 B;  3BSO A;  1T9Y A;  2QRR A;  1WI6 A;  4Y65 A;  2NQP A;  3PR4 A;  4DL7 A;  2DNY A;  3CJ2 A;  2IHR 1;  5T7L B;  1Q7Y T;  2YQ3 A;  4DG1 B;  4B9T A;  4DU8 A;  5HJX A;  2R7S A;  3UWT A;  1NDP A;  1R31 A;  3I5C A;  4HTI A;  4F36 A;  3AD7 C;  2J5A A;  2QL7 B;  3C6U A;  2MQL A;  2ROP A;  2MKJ A;  2VJU A;  4J9S A;  1RTH B;  2AJ0 A;  1QJH A;  2BUN A;  3JQM A;  3N6M A;  3ZO7 A;  2XMV A;  1PYT A;  3UN5 A;  3PW7 A;  5HAN A;  1F5C A;  1ZAW A;  4U96 A;  9RUB A;  3HHN B;  2HUR A;  5T14 A;  5KT6 A;  2AU0 A;  1OYE A;  4DR2 J;  1GXU A;  1RT1 B;  1NK0 A;  5L1I A;  2IM1 A;  1IBM J;  1U2C A;  3GYG A;  1RUS A;  3SBM A;  5L39 A;  1IKV A;  1GT8 A;  2JL9 A;  2QZ8 A;  3GWC A;  4IKA A;  4AD6 A;  3I55 S;  4KRW A;  2LXI A;  2UUC J;  1U2F A;  1IR1 A;  2ZH5 A;  5I3Q A;  3Q23 A;  1SKW A;  3OD2 A;  3I31 A;  3O6Q A;  2DNL A;  4LFB F;  4OJ1 A;  1KQG B;  1E6Y A;  5IFM A;  2DCU B;  2W9B A;  2ZD1 B;  1UET A;  1NH8 A;  1NHU A;  3US5 A;  1B4S A;  3VVU A;  1VLY A;  3J80 Y;  4DSJ A;  3CE8 A;  5DRK A;  4PG6 A;  3MF5 A;  1KTV A;  5F3T A;  1DJ0 A;  4DPX A;  1ZET A;  2QA4 G;  1U49 A;  4ECR A;  2JRS A;  4NRT A;  3GIR A;  5HAT A;  3EZU A;  2OEJ A;  4NLR A;  1NLK L;  2XHC A;  2YNF A;  4DQR A;  3TQ1 A;  4QWB A;  3BKF A;  3MWB A;  1HW9 A;  2F8E X;  3PW2 A;  4ECS A;  3MAA A;  1S79 A;  4NLT A;  2DGS A;  3M7V A;  4J37 A;  4D3H A;  1S48 A;  4CIO A;  4X64 J;  3L7U A;  1RAC B;  4LSN A;  4ZHR B;  3Q24 A;  3OUY A;  3T1H F;  4USH A;  1NPR A;  1L3V A;  3CNQ P;  5IC6 B;  3CC7 S;  3R1H A;  1MWZ A;  4WP8 A;  3DMJ B;  3GFX A;  3HPO A;  2OSQ A;  2NZ4 A;  4PUO B;  1HA1 A;  2Z2Z A;  3CB4 A;  3FBB A;  5IM0 B;  2B9E A;  4LF4 F;  1LOU A;  1HNV B;  5IT9 U;  4MMO A;  4HL9 A;  1Q81 T;  2ALY B;  1MML A;  3M8Z A;  3OLB A;  4ZS6 A;  4C0B A;  4KGX B;  4ZN3 A;  4DV3 J;  3CJQ A;  2MQM A;  3BBC A;  3EDQ B;  5L9N A;  3JSB A;  4AND A;  3RRH A;  1VS3 A;  1HQ2 A;  1B99 A;  3I0R B;  1J5E F;  3PW5 A;  2G0J A;  2QA2 A;  1KKH A;  1JQG A;  1CJT B;  2CG8 A;  2VQF J;  4MK8 A;  3MMB B;  4DF8 A;  1H7W A;  4PWD B;  5EWF A;  4YME A;  2YNI B;  1APS A;  3EXY A;  1SPB P;  4QPT A;  2ZH7 A;  2ASJ A;  1KOH A;  1XR6 A;  2V2Z A;  4GVL A;  4URG A;  1ITP A;  2JEG A;  1LXJ A;  3UO0 A;  2XSJ A;  4F4X A;  1K9M T;  4ED8 A;  3R8Y A;  3QSY B;  2E66 A;  1C0T B;  2HQD A;  1QAX A;  3A4T A;  3PTW A;  3KJV A;  5D4N A;  3G6V A;  4NXN J;  3IMQ J;  5HI7 A;  1EQ0 A;  2P9C A;  2DBB A;  4K4W A;  1SKR A;  4OHW A;  3HHD A;  2UXB J;  1FKP A;  2CUY A;  1T94 A;  2CIM A;  3D6M B;  3NGD A;  4ZPV R;  2CQH A;  1JLF A;  1RHM B;  2CQP A;  3LGN A;  2MQQ A;  2U1A A;  4MK7 A;  1R8B A;  2RU3 A;  1BWE A;  2DR9 A;  5EGY A;  3CO0 P;  4ZP9 A;  3U7J A;  3F56 A;  3CDW A;  3ZZ0 A;  1WSR A; 
#chains in the Genus database with same CATH homology
 3R7N B;  1F9E B;  3KJF B;  3R6L B;  2H4W B;  2H5I B;  2H65 B;  3GJS B;  5IC4 B;  2H51 B;  2XYG B;  2XZT B;  2CNK B;  3GJT B;  1GFW B;  3R6G B;  2QLB B;  2H48 B;  1RHJ B;  3P4U B;  2QL7 B;  2HBZ B;  2QL5 B;  1SC1 B;  1RWM B;  2C2Z B;  2CNL B;  1RWN B;  3P45 B;  2C1E B;  4DCP B;  2H5J B;  1I51 B;  1SC4 B;  1PYO B;  2XYH B;  3EDR B;  1RWV B;  1QDU B;  1QTN B;  4LSZ B;  2P2C B;  2C2K B;  4ZVQ B;  3R7S B;  1NME B;  2C2M B;  1SC3 B;  2HBR B;  2HBY B;  2DKO B;  1RWX B;  2C2O B;  3D6F B;  3R5J B;  1I3O B;  2HBQ B;  2CJX B;  3D6H B;  5IC6 B;  1RWP B;  1RWK B;  2CDR B;  3GJQ B;  2XYP B;  3KJQ B;  4DCJ B;  3RJM B;  1RHQ B;  4ZVP B;  1PAU B;  3EDQ B;  1ICE B;  1RWW B;  3GJR B;  4ZVS B;  2XZD B;  1RHK B;  2QLJ B;  1BMQ B;  2Y0B B;  4JB8 B;  5K20 B;  2Y1L B;  4ZVT B;  2H54 B;  2CJY B;  3IBF B;  1RHU B;  2H4Y B;  4ZVR B;  2CNN B;  1IBC B;  2CNO B;  3R7B B;  4DCO B;  3KJN B;  3SIP B;  4ZVO B;  1RE1 B;  2QL9 B;  2QLF B;  3D6M B;  1RHM B;  1RWO B;  2FQQ B;  3NS7 B;  3QNW B;  3IBC B;  4ZVU B;  1RHR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...