1IBCB

Crystal structure of inhibited interleukin-1beta converting enzyme
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPAGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTERLEUKIN-1BETA CONVERTING ENZYME
publication title A combinatorial approach for determining protease specificities: application to interleukin-1beta converting enzyme (ICE).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1997-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1ibcB00
2C2ZB 5IC4B 4DCPB 1RHUB 2CNNB 2C2OB 1IBCB 1RHKB 5K20B 5IC6B 3IBFB 2QLJB 3RJMB 3EDQB 4DCJB 2C2KB 3IBCB 2H5IB 2Y0BB 4ZVPB 1RWPB 3SIPB 2H48B 1ICEB 2H4YB 2CNOB 3GJQB 2QLFB 4ZVTB 2HBZB 1RHQB 2CNKB 4ZVUB 2CNLB 3P45B 3R7NB 3D6FB 1RWNB 1RWOB 1RHRB 1GFWB 3KJQB 2HBRB 3R6LB 2QL5B 1I51B 3R5JB 1RWKB 2HBYB 1I3OB 2XZTB 3R6GB 1QTNB 2C1EB 2H54B 2Y1LB 3GJTB 1RE1B 3NS7B 1SC1B 1BMQB 2XYGB 3D6MB 2CJXB 2QL7B 2XZDB 2CJYB 3EDRB 3QNWB 1SC4B 4ZVQB 1PAUB 2FQQB 2CDRB 2QL9B 2QLBB 2HBQB 1F9EB 4JB8B 4LSZB 2C2MB 3KJNB 1SC3B 3R7BB 1PYOB 2H4WB 3GJSB 1RHJB 1NMEB 3KJFB 1RHMB 4ZVSB 1RWXB 1RWWB 1QDUB 3GJRB 1RWMB 3R7SB 3D6HB 4DCOB 2DKOB 2H65B 2XYPB 2XYHB 2H5JB 2P2CB 4ZVRB 2H51B 4ZVOB 1RWVB 3P4UB
chains in the Genus database with same CATH superfamily
3A8KA 1RHUB 4PG6A 1WC4A 3CO9A 1C1CA 1OYEA 3TJAA 1ZM3A 4KB7A 3K57A 1Y00A 1H2VZ 5F8LA 3G6YA 5DM6Q 1WJ9A 2YPYA 3JYTB 4BWJA 3QT5A 4N7TA 1NK9A 2CPJA 4NXMF 4KQZA 3BREA 2MQPA 1FO1A 4B3SJ 1Q8LA 1T9WA 3FEXB 4CLYA 3H40A 2W2MP 1KFDA 4EZ6A 3WQPA 5GAGI 2OH2A 2DRAA 3BQ0A 3KUGA 2NUUG 1RWWB 2BM1A 5T7LA 1NK4A 1FNMA 2ZFHA 3DU5A 5DQIA 5IT9U 3LW5C 4K0KF 2BKOA 4ZVRB 1L5UA 2AEFA 5HMWA 3SBMA 1X0PA 4YB7A 4KGXB 4O23A 5IZHA 2B9YA 4F2SA 3PR4A 2VH7A 1TMJA 2KHDA 4F3OA 1N32J 3MI7X 3DDIA 3VQTA 3LP2B 5KFDA 3NGRA 2C3YA 5DO2A 4M95A 4DSKA 1TK5A 1RHRB 2W24A 2R42A 2RDIA 4NLWA 1Q8BA 3CDEA 4CT9A 5DZ6A 3K5PA 5KFPA 4MMOA 4JI0F 2YX7A 3B8HA 2Q79A 2MKYA 5DQHA 3T9ZA 4M5MA 1JLEB 2XO7A 3L7OA 4JV5J 1M1HA 4F2RA 1OO0B 1S4EA 2EK6A 7AT1B 1PAUB 5I3PA 4CLFA 4ITSA 1C1BA 3EPIA 1RA7A 2CG4A 1OSDA 2B3TB 2QG9B 5GAEI 2DNQA 5HL7Q 2R2SA 5J1NA 4JP8A 4B3OB 2YNFA 2A0FB 3KG1A 1FNXH 3UN3A 2I9SA 1R89A 2JC0A 2CPYA 2LA4A 5D78A 3NNAA 2C22A 2LEPA 3T19A 5KG5A 4F67A 4MFBB 5KFJA 4OYZA 2FVQA 1MN9A 1T7PA 1FI4A 2KI2A 4LFAJ 2VG5B 4DR2J 2HQGA 3SFUA 5HMZA 3TAMB 1HQUA 2M4MA 1APSA 1Q5YA 2LQ5A 4LRCA 1IKXB 3HHEA 5LMNJ 3GPAA 4PPDA 2E1RA 3R5DA 2XMUA 2F40A 3BEGB 5JMNA 3T6JA 5A8KA 2I0XA 3MEGB 2QMWA 4OI1A 3RAXA 2GGPA 4QU7A 2AGPA 1UETA 4DBQA 2UU9J 5CD4A 4PQUA 3PG9A 2X1AA 1C2PA 4DSJA 1PC4A 2ZH7A 2MZJA 4OZJA 5BXIA 2BRLA 1Y5IB 1LXJA 3HVAA 4O3RA 5BR8J 3I0SB 4DF4A 2J9DE 4DHVA 3ISNC 5LT5A 3OFGA 1D9FA 1VJWA 2M8HA 2V67A 3NNHA 4U95A 2XS5A 2UUAJ 1X4EA 3DLKB 4K2XA 1TUVA 3P4UB 3NNCA 2YQ1A 2QZ8A 5DDRC 3GONA 3MMCB 4U67Q 2KH9A 2KVQE 1WF2A 1S1XB 5HQLA 4DR4J 2R7SA 2J8AA 5KG1A 5HMYA 4ANCA 3LANA 4R8UA 4OJ3A 2QLFB 1WKJA 4ETZA 1LXNA 3EM1A 4KFBB 1MMLA 4CP5A 1MROB 4ZPBA 4CO5A 2WBRA 1M1GA 4HYKA 2FHMA 1Q5VA 3LP0B 3D0GE 5C24A 3IS9A 5D3GB 5D15A 1RBLA 4KO0A 1S97A 1VQNS 4UW2A 4LF5J 1RT1B 1QE1B 4P74A 2ALZA 1EB0A 2MYFA 2L9DA 3V6HA 3M9MB 1NKCA 1JLGB 2WONB 3BO3A 3DFEA 1WDTA 4Z2XA 3CJKB 4TKTA 1KOOA 1UL3A 2HRUA 3CF5Q 2DH9A 3GR0A 2NXCA 3OPKA 4RR5A 5J2QB 1H72C 3LWMA 3TANA 1RTZA 2XSFA 2HGMA 1GTHA 3Q8SB 1DLOA 1NHKL 4HACA 3I0RA 1YITS 1CS4B 1LWXA 1MWQA 2OMLA 2ZH5A 1QD1A 4LR7A 1HYSA 1RHQB 1EP4A 2VFUA 1YRUA 1KQFB 3BKFA 3IO1A 3L3CA 2E9RX 1CG2A 2YPZA 1WC3A 1ZZNA 3HVTB 2ASYA 4IDKB 3EVOA 3DHWC 1PJ6A 3D4JA 2L9WA 5L38A 2CQPA 4KGVB 2XULA 3N6MA 1XR5A 2B4PA 4A8OA 1S12A 4Q5VA 1O8BA 4DG1B 3IR6B 4KPYA 3PEHA 3GIJA 2XGPA 2MLZA 3GG0A 1UZDA 5B0EA 1NPKA 4IG0B 3GV8B 2NCKL 3N01A 3UI3A 5MLCV 1ROFA 3JQMA 4CLUA 1YJVA 4USTA 1B64A 4B08A 3UDLA 3GWCA 1DBDA 1U1NA 2IVYA 1RT2B 3GMGA 4Z7CA 2J0WA 1CJTA 3GR1A 3MEKA 5F8NA 4I2QB 2Y1IA 1ZA1B 2YQ3A 4ZCKA 2BJ1A 4DQRA 2FHOB 4QIVA 1G4CA 3MEEA 3OT9A 2XMWA 3CXCR 1TKZB 3DMJB 4GO7X 4BLGA 2W7AA 4W90B 1WKLA 3P45B 3TAPA 1N34F 2HK2A 1LFWA 1FWLA 3IA0A 3K5NA 2LA6A 2DO4A 2AX0A 2W7OA 4V19X 4MTPA 4XPEA 1U0HB 2HBYB 3CDUA 4OLPA 1SBRA 1HNVB 3K8WA 2CQDA 1LKZA 5FLXU 4WTYA 3JAMU 2YWHA 2AW0A 3FFIA 2RT3A 1U25A 3MECB 2W25A 2CQHA 2JFKA 1Q82T 1BQMA 1PG5B 1B0PA 2P9GA 3EZUA 3MUTP 2GJFA 4CNZA 4HVZA 1TKXB 3BR9A 2VUGA 1SVDA 1UVNA 2IM2A 3N6NA 1FWKA 3FNNA 3VQSA 3ZTOA 3AFGA 2XI3A 2Z8QA 4P2SA 1T05A 4ZJOA 2WOMB 2YNHA 4UUXA 1WD6A 2FUG9 4K4TA 1AZSB 2ZM6J 1XEZA 2HVDA 3GSIA 2M70A 2MKJA 4HTJA 3M2UA 3K5OA 4F02A 5LSLA 4YFUA 2EC0A 3HK2A 3DRYA 4K4WA 4QW9A 4MKAA 3WIVA 1C0TA 5J1PA 4QYRA 3RW7A 3PNIA 1MSWD 2B6AA 3V6DA 2VA3A 1N0VC 1S9EB 1IN0A 4ES3A 1I6JA 3R1HA 1KVKA 3TQ1A 1TL1A 3RR7A 1TVRA 1QUVA 4FKXA 4C98A 4RX6A 4DMZA 3T3FA 2C2ZB 5A8WB 1C4CA 2ZJPQ 1R0CB 4RZRA 3ADAC 3CSKA 2H5IB 4O3PA 4RNNA 4Z7YA 2GVZA 2ILZA 3JSMA 3IBWA 4JI8F 3OL7A 4J9VA 4DQIA 2GZOA 4DV7J 2XBPA 1JXEA 3CO0P 3V6JA 1SL0A 2AMCB 3KOAA 1IXKA 1FA0A 1LQ9A 4I56A 4DL3A 4I68A 1JJ2R 3GJTB 3SZ2A 2JZ5A 1GAOA 3GFYA 3BGFA 1CJVA 3D5MA 1JLAA 4IR9A 2X3GA 3NBPB 3OTBA 3BM7A 3AOBA 4EBEA 1S1UB 3FQLA 5B0DA 5A0YB 3B82A 4NASA 4DR3F 3FMWA 3CCMS 1FXLA 2R7RA 1F5AA 3Q8YA 1SPBP 4NRTA 1EJ7L 4HHUA 2VBYA 2JNJA 3PY8A 2VOPA 4OYPA 4K4SA 3QFWA 2Y8WA 3IR5B 5AXNA 2SXLA 1F1BB 1U09A 2F8EX 3MPUB 3V4MA 5LSOA 2ZOGA 1QLNA 1RHKB 4CYUB 1U1RA 2DGTA 4X4TA 2MKCA 1XQIA 1ZPVA 4OI6A 3PO4A 4DFKA 2VFVA 5ETTA 3BSNA 1AFJA 3JSYA 3NGDA 3IR7B 2HAFA 1SB6A 3RTVA 1X5OA 3K5LA 3PX0A 2KRRA 1N48A 2CWKA 4LF8F 3LF0A 1IQTA 2HIQA 4K7QA 2XZTB 2UXCJ 1AW0A 3R1LA 2AHOB 1RTJA 3KLGB 2MQLA 1HMVA 1RBOB 1RT4A 2DGUA 4P7TA 3HCXA 4BWMA 3OFHA 3W9IA 1KRPA 1S1VB 2AJQA 4NYPA 3FCWA 1U1MA 2ZC3A 2CQ1A 1N5SA 2H4WB 1X4GA 4F7VA 5KFLA 2Z2ZA 4ZMMA 1DQAA 4OQJA 2RRNA 4PZVA 1SQGA 2IRUA 3QO9A 5IQ6A 2FLLA 1JQGA 1VR6A 4B9LA 4QIFA 2XLJA 1LEOA 4DV1J 3UQSA 3K5MA 3M8YA 2C2OB 5J2NB 5KFZA 5GMDA 2BJEA 2VG6A 3FCHA 3ILJA 1R8BA 3OBIA 5CYMA 2ZBIA 3S01A 4B3RJ 3MOJB 1IR1A 2V4QA 1A7GE 3LP1A 4NA2A 2XWXA 3PFEA 1NEEA 1B0TA 5KFXA 4DV5J 4NLQA 4B3TJ 4NRUA 3HX9A 2VPXB 4RW4A 1PSDA 4IFVB 5EX0A 3J7YU 2VPZB 3KJQB 2BE2A 1X4FA 5HMXA 3JTPA 2MQQA 2LFVA 3MD3A 3ILIA 2VA2A 3BN7A 2CJQA 3EGZA 1LW0A 4XK8C 1U1LA 3ZZUA 3DOMB 4WP3A 3DCAA 3UDEA 5ADZA 3CTRA 3E8OA 5FDLB 5AT1B 2B8PA 2B4VA 2XY7A 4LMZA 4QIWD 3VTIA 3M05A 3PW4A 3N4WA 4PRFA 4I2PA 4M5DB 2DB1A 2DRBA 3I87A 3QSYB 2XYPB 5HJYA 3DYAA 1YJNS 1BQXA 1PAEX 2CPXA 2P6TA 2RKIB 1YJTA 1IKYA 3PTWA 3D54A 5DG8A 4ZJQA 4LRFA 4C6AA 4P71A 1D9DA 1ICEB 2V4JA 4CO4A 3KMQA 3OR1B 3TR5A 3BR8A 4RW8B 1NDLA 2W8LA 1IVZA 1RTHA 5JXSA 1JKHB 3O44A 3CCQS 4YHHJ 2K3IA 3HZGA 4R5PB 4OI3A 3CCVS 3DRXA 1KTQA 1UVKA 4L74A 2M7SA 4LT6A 3KYLA 2P8IA 3N28A 3OXFA 3J7A1 2QSWA 2IHR1 4J9UE 4X64J 5KFTA 3QBCA 1NK8A 5K8NA 3FEZA 4USVA 5CYQB 2OFGX 2KDOA 3Q8UA 3J81U 4OYOA 1NHVA 2IYGA 4JBCA 2ZDOA 1JLBA 3JS9A 3VGUA 2D1CA 4N47A 2UXBJ 5GMKa 3H5YA 5A6WA 3KLIB 3HF5A 3POTA 2V2KA 2PE8A 1VRTB 1U1PA 1KBRA 3PDNA 1DZ5A 4PUOB 3CJ2A 2MJUA 1RCOB 4EMDA 4DQPA 1Q0NA 4OYIA 2KVIA 2ZH3A 2XMTA 4ZPDA 3DOKA 2DNHA 3DRRB 4ZJLA 1AT1B 5A76A 2CJKA 3GP9A 3N6LA 3LTOA 2X7IA 2ZEJA 3J80U 4WIQA 5I3UB 3CULA 4ZKAA 2XEXA 1WSRA 5CYJA 2RQ4A 4UOHA 2YKMA 4A8XA 2XO6A 4QYZJ 3GB0A 1TL7B 3NWGA 4NZ6A 3J81j 1B3TA 3L95X 4WE1B 3MM7A 1CVJA 4JI2F 2QMUB 1O51A 3F56A 2CJBA 2HQFA 3CCSS 2BABA 5L8RC 2CXEA 4OL8A 1WG1A 3CPWR 1S9GA 2DT9A 2WSCC 3WBZA 3TO8A 2W01A 2JEJA 1HBOB 3CJ4A 5J2PB 4X4RA 6AT1B 2GJIA 4RLEA 5F8HA 5J2MB 4K0KJ 1HWUA 5LMUF 4IQMA 1O0PA 5F0UA 3ONQA 3QFHA 3SV4A 1A6LA 2IC3A 3CIZA 4LF1A 4DL5A 2MQOA 3ENQA 1UP1A 2HFOA 3R6LB 1VQPS 5RUBA 5KG0A 2JLEA 3KWMA 4W98A 1I3OB 2GVDA 2JRSA 2RF2A 1U1OA 2EKNA 2WK4A 4J9MA 4N77A 2R7WA 2VKZG 3OSNA 1FE4A 1RT3A 4BBYA 3M2VA 3TVKA 1OWXA 4TU7A 4JI0J 2BBEA 4WU2A 1RYSA 3P49B 4KH0B 1N5YB 4AYBD 1YRXA 4DR6J 2M5YA 3QPIA 4QIEA 4F3MA 4KHPF 2VQEF 3U27A 4IQXA 4OJGA 4DV4F 3PKMA 1R6YA 5BYQA 3MM8B 1BHNA 3HSGA 1IBCB 1JWWA 4OZNA 2C3PA 2ROEA 2GX8A 1JJHA 3A12A 3MXHP 4C9DA 3I4PA 4LBIA 1TL3A 1FJEB 4ZP7A 4LFCF 3DU6A 4ED6A 3CCES 1KLMB 2AZ3A 2WSEC 1OPZA 2QFIA 4D3HA 4DSEA 1Z2LA 2YNGA 3TZZA 3ENAA 1S59A 5IQQA 5EWGA 1BQNA 1Y3KA 2FPHX 4WK1A 4EYIB 2F8MA 2YWGA 2QLXA 4NLOA 3M2RA 3L7UA 2HVZA 5CD4H 1TMMA 4DV2F 3K58A 1YDLA 2OD6A 2QEXS 1V6HA 3SQGB 4ED7A 5IV3A 4ED4A 2DCLA 2DH7A 4ANEA 1U6FA 4EGLA 3G86A 4DUTA 1NJZA 4AL7A 2OTJS 3MPVA 4I4BA 2JVOA 6FD1A 3B78A 4CRJA 2C2KB 3MM6A 1MWYA 4ZVPB 1T03B 3HKWA 4KGKA 3EMTA 1T95A 4WP8A 1IKVB 2V50A 4EK2A 2YH0A 2W1BA 4TY8B 3CCWA 3N5FA 3QZ7A 1KEKA 3AODA 3ET6B 1JMTA 1IM6A 4C3KA 1YJUA 3M32A 1R31A 4O4RA 4H4OB 4X65F 1SI9A 3HXMA 3KUEA 5HN0A 3IXQA 5E41A 3GCXP 1S6PB 3A4TA 1MWZA 5HROB 1IJEB 3IN5A 3LH2S 4C0HA 2BMBA 2KXNB 3ETOA 1QUPA 2M9KA 3AOAA 4RU2A 3RBEA 4K5RA 3DRPA 2RUGA 1VK8A 2G2YA 1ELOA 3TUPA 3BQ2A 3AJ2A 4I69A 3PJ9A 3X3UA 1ZM9A 4MIBA 1FXDA 2Q1LA 3PCOB 5B0CA 3HHLD 4UZBA 3ZTRA 4ELUA 2WVDA 3BZQA 5KG6A 4ECVA 2VG7B 3BYRA 3UNYA 4YB1P 2CZ4A 3D66A 2LP4A 2Z2MA 3SCJE 4PWDB 2MKSA 2GIFA 4NCAA 3QLHB 3R5GA 2JX2A 3QQCD 3Q23A 1NH8A 3EXCX 1M1KT 3Q89A 3V4IB 3FK4A 3SV3A 2K1RB 3PZPA 4YP3A 4FPRA 5DDOC 2Y9HA 4LF7F 4QBUA 3C16B 1NMEB 3W2WA 1EHWA 2E1CA 4WKRA 2CZVC 4C7QA 4X4UA 4ECYA 2BA9A 3ZNUA 3PFOA 2QLWA 3Q8PB 5KFGA 4DV6J 1VLOA 1J5EF 3MEDB 2XM3A 3KLHB 1P6TA 2RSQA 2D3UA 4ZPWR 2D9PA 4HHHA 3ITHB 3U1MA 4DJBA 1D0EA 1FEEA 1TUGB 5L9XA 8ATCB 1RYRA 1IUJA 5E0OA 3IWNC 1XMOF 2NSCA 4ZVTB 3CC2S 5K8PA 1N0UA 2B4OA 3L9ZA 2HS4A 1JB0C 2D3ZA 1QVFR 4OJHA 1NO8A 1RWKB 2VODA 3I6PA 1N34J 4Y00A 1KNZA 4K5SA 3Q86A 3JYTA 3G2XA 1YSJA 1IKWB 2CUYA 3VAMA 3GV7B 3W8GA 4CH0S 2DGWA 4AT1B 3R2CJ 3PXGa 1HHQA 2BW7A 1FERA 5HLFB 2IFXA 3MMAB 4S0MA 4X4VA 4ER8A 3CCRS 2LU1A 4LBPA 1WHWA 4CH7A 4FBUA 3DXBA 2VBWA 4OZ5A 4MKYA 2R7OA 2PT0A 1RKJA 3DC2A 4WFBQ 3DXSX 2FIUA 3AJDA 1SJ4P 2VJUA 2PGCA 1QM9A 3LP2A 1OS5A 1Y11A 4ANDA 4NYOA 3CT9A 3SCIE 2WZ1A 2DXDA 3GYXB 3SSSA 3W5YA 1CBKA 2NXJA 1WKKA 2J9DA 3JXOA 3KK2B 3CMQA 1UKUA 3NS7B 2YXLA 4DR2F 3PYEA 4I6YA 1JLEA 2OO4A 1RWXB 2DRDA 2VBZA 1L3VA 3FZ2A 4QR0A 3D3BJ 1G1XA 1NXIA 2KJWA 4AD6A 3RW6A 1NJYA 3ENVA 4LRDA 4B3OA 2WAQD 1T9XA 1CC7A 1Y5NB 2H3EB 4RW9A 2GAGC 2UVVA 4MFBA 2B51A 1HR0F 2Y0BB 1RT7A 2H48B 3ZZPA 2A10A 3TAMA 3SQOP 4IRCA 4A8YA 3H25A 1VRQC 3TI0A 2YKOA 3VCDA 5HVFA 3I56S 4JI8J 1FRMA 2OI2A 3A13A 2FJBB 3ISZA 3MEGA 3FZBA 3IC1A 3S8SA 1HNIA 2OD4A 5IT9Y 3BGRB 1BLUA 2PC6A 4ILLA 4A4JA 3W9JA 1Y5LB 2D3OR 2FHJA 4OV6A 2DNNA 4NMXA 2GJ2A 2AZ1A 4ZVSB 2K7KA 1TTHB 1IWGA 1TP7A 2B9EA 2I8EA 2VV5A 3I0SA 2AYGA 4DR3J 4LVNP 3ISND 4P2MA 1ZPWX 2C28A 4DUZF 1Q53A 2YWEA 3DM2B 3IMQJ 1H73A 4IR1A 3NCRA 1AA1B 2BQ3A 3IRWP 2BKNA 1PYSB 4B3MF 3CWJA 3MMCA 1S1XA 2YWKA 1VCTA 2W9CB 3PW7A 3W9HA 3E01B 3BB5A 2IY5B 3KJVA 1YHQS 4KFBA 5IT4A 1U48A 1MROA 4KHRA 4OZ3A 4C0OC 3EPGA 4DL2A 4PWWA 1X4AA 3LP0A 4LF8J 1YBUA 1XJWB 2Q6BA 4X66F 2YTCA 4L3KA 4G3IA 1RT1A 1QE1A 3UFCX 1ACMB 2IAJB 1UPMB 1HBNB 2VASA 1JLGA 3CJTA 1FJGF 2WONA 2YKNB 4X84A 2WVFA 3W8PA 3MAQA 5KOWA 2HEKA 3CJKA 2XHWA 1CJUB 5J2QA 1SV5A 3C15B 3TNVA 5B0BA 4YR3A 2Z57B 3Q83A 2VU5A 2V2ZA 3QRRA 1MMDA 1LNQA 1VK3A 5CZXA 4M5KA 2BOPA 3M30B 3AD7C 3T1YF 5H9FJ 4YQWA 5JVGQ 2FJDB 2HAIA 2ZVSA 4QZVB 1VHFA 3EZ5A 1XERA 2CVEA 1D9AA 3ZTSA 1IWAA 3A1YG 2B43A 2RH3A 2HHSA 4RW7B 4B02A 4QWCA 2F3JA 3EX7B 3HVTA 2X1BA 2ZE2B 3M6XA 4IDKA 3SDEB 3N9UC 1FVSA 4LF4F 2AYMA 5GMEA 1VQSA 3DI6B 4DG1A 4NA3A 2FJVA 2ZD1B 2PI5A 4NZ0A 5B08A 3UD5A 2AJFE 3VAKA 2W9BA 3HHLB 4IG0A 4RBVA 4GVLA 2KKHA 1XK8A 1SH2A 3RUBL 1HD1A 2LQJA 2F5GA 1RT2A 2XHCA 1MW7A 3GYGA 3KXDA 1S99A 2M88A 5HQ8A 4ZN1A 3EXYA 4NCGB 2CNKB 5IM0B 2AIRB 1GQEA 4FNHA 1U7LA 1TKZA 2VJVA 3DMJA 1RA6A 1V9OA 4DX6A 5A8RB 3TJ8A 2IA0A 3OTDA 2EFVA 2A6OA 2V4RA 2W4DA 3HKZD 4LVOP 3KKFA 1RACB 1B7FA 1U0HA 2MSTA 4URQU 1HNVA 4FXDA 3PIPQ 2HS3A 2MMYA 2VL1A 2N4CA 4MKVA 3ICLA 4QWDA 2JEIA 2DGXA 3W62A 2BM0A 1FESA 5HATA 3TARA 3LUYA 2H5JB 2FVSA 2LQBA 4RUBA 4A8SA 3ZZTA 5G0RB 5LXRA 4WFAQ 2ZC4A 2HG4A 3WHIA 3QRQA 2DJWA 2W4CA 5LM7E 3CJ0A 2AV5A 3UD3P 2GIQA 5HQMA 3C6TB 2EXUA 3D1QA 2Q66A 5SZTA 1HHSA 5F3TA 4OYAA 3MR2A 1MG7A 2WOMA 3KHLA 2OJ3A 2KN4A 2KXHA 1UJ4A 3FEYB 5H9EJ 1SC6A 5L1KA 1ZAWA 2HGLA 3R97A 1X5SA 2E9TA 4WF9Q 3IAS9 3NKYA 2DXEA 2PN6A 2NREA 3R5CA 4IRDA 4CO3A 4A8FA 1HW9A 1TFYA 3CCJS 4O44A 1A0OB 3ZTQA 4G1IA 3M8WA 1TKTA 1KONA 5ETOA 2HFSA 3KJFB 4F4ZA 2XC9A 1NDPA 4Y34A 1C1BB 3NOCA 4DLGA 2G2OA 2MKHA 3QT6A 4F4YA 2QC3A 5DZ7A 3IM9A 2YNFB 4NZ7A 3KK1A 2DBBA 2AT1B 3K17A 3PRDA 2DISA 3PRBA 1KFSA 4EZ9A 4XO0A 4F25A 2DEIA 4TN2A 1RLCL 4TYAA 2QA4G 3R5BA 1VLYA 5A8WA 1NPRA 4NLYA 1EKSA 3G9CA 1HQUB 2VC0A 2HQDA 1Q4RA 3D1OA 4JI3J 5K9FA 5FLXY 2E5IA 5LMUJ 4I7FB 2GHWA 4WTOB 4ES2A 1KVIA 2CPZA 3BGUA 5J1EA 5L1LA 2OUGA 2EVZA 1N36F 1YK9A 2QA2A 1G7CB 2KYZA 5A8KB 4PXCA 2MZ1A 4X62J 1SKSA 1KVJA 5M2RA 2GGPB 3MCMA 1QY7A 4PQUB 5IXUA 4USJC 3PW0A 2JL9A 4WJBA 2XS7A 1QAXA 1HW8A 2C2MB 2XS2A 5HO4A 2VHGA 3AAWB 5EGYA 2PEBA 1FKPB 1B4SA 3NBPA 3GFZA 4DLEA 4ECXA 3FSXA 1VIXA 1FJCA 5A0YA 4FZVA 2Z2YB 3IAM9 3MR6A 1J5OB 4J5OA 1IQZA 2A18A 4V1Ak 1JIHA 1QAJA 2AU0A 1RWUA 4KHPJ 2VQEJ 2HLUA 1AB8A 3EZOA 4FF4A 4ZVFA 3FDSA 5AE2A 4DV4J 1CPZA 1KDNA 4K4ZA 1LWEB 1WELA 3IG1A 4CYUA 3RRHA 3J7ZT 4J9NA 4IOAQ 2HNZB 2ROPA 3D6FB 4NI2A 5DJBA 3IGNA 4NL5A 5BJRA 2QYCA 5KFVA 1YJ7A 3QZ8A 3CGIA 3CCTA 3A3PB 4LFCJ 2OFHX 1S48A 1F0XA 2YQ0A 2DK2A 3Q8VA 2LXUA 3QAEA 1FDDA 1U2RA 3IS9B 2V8PA 1X7VA 2N82B 3CD5A 2RHSB 3NAIA 4L75A 2HFVA 4H54A 4H4KC 4A46A 3KLGA 5ETSA 3S7RA 4FBTA 1VMBA 2EBEA 4K8RA 2IJNA 3I82A 1YI2S 1S1VA 4P9SA 3D6HB 4B3TF 1RSCA 2ZH2A 1PIEA 4DV2J 5HP1B 4JI7J 2VIHA 2N7CA 3HPOA 1TV6B 3VV2B 4DCPB 4URGA 2EWHA 2FVCA 2Q3PA 1YTYA 4FDFA 1VJQA 3TX0A 2JOQA 1FK9A 2RUSA 2IM1A 2JLGA 2ILYA 2F65A 2XMJA 2ZOFA 3OJSA 3BO4A 5J2NA 3QYYA 4F4WA 5M2UA 3TA2A 4U6PA 2OPRB 4LIWA 2I6WA 5F9LA 2FLNA 3BJYA 4UOGA 3BPDA 2DIUA 3BGLA 4NWBA 4Q0BA 4WYLA 3ZO7A 3BBBA 2FY1A 2MKKA 5KTQA 2LXFA 3PW2A 1NHUA 4MYTA 1PKUA 2WRMA 4FVMA 3VR1A 2QA4S 3W2VB 4UY8T 1K73T 4CO0A 3DOMA 2V34A 3VGSA 4AL6A 1VC5A 4PKDB 2OPPB 5FDLA 3HJFA 2J6UA 1T02A 1Q8KA 3RB4A 3HFZB 4OYWA 1WHXA 1MMNA 4KGMA 2LVWA 4M5DA 4ZLNA 5GAEU 3W63A 2Z2LA 3U1LA 4ZVOB 2KG0A 3G87A 3W66A 1FTCA 1CJTB 2HWTA 3K89A 1LW2B 3GJQB 2RKIA 3EUNA 4X64F 4DS4A 1F3FA 4LQ9A 4MH8A 3GLJA 3OR1A 1SJ1A 3A8EA 4YY3F 3KFWX 4RW8A 3TEHB 1RT5B 1JKHA 2NYIA 2RAQA 4OLOA 5D6GA 4JYAF 1RJJA 3OXGA 2UXBF 2J0SD 4LREA 3P3DA 4XAKA 3AT1B 2WTFA 3GFXA 3SMZA 2ASLA 2JC1A 2ZVIA 3CDAA 1R8AA 3QJPA 4ED2A 1VDHA 4ZITA 3CC7S 5E5NA 5B0GA 2MZQA 4NXNF 3NEKA 1DFDA 1R0BG 3O2IA 3S1TA 4USMA 1L3SA 4LF7J 3TRGA 5EUHA 5CYQA 1HL6A 4O3NA 3HVRA 3FMBA 3D0HE 3MR3A 3MR5A 3ZNJ1 3MM9A 1HNZJ 2MZSA 1EX8A 1J5EJ 1WEXA 2IVMA 3KLIA 3IBCB 3OSPA 1S72S 4FS1A 1RAFB 1VRTA 2ZBQA 4M1KA 1ZTWA 2HBZB 4NX9A 3EYZA 4Q45A 2HVEA 1UPPA 1T05B 4YB6A 4C8MA 4RU9A 2JEGA 1WTFA 3DRRA 1XMOJ 3CCUS 1P1TA 2DIVA 5KT2A 4NLVA 3TP2A 1S6UA 4GRSA 2PIIA 3PJXA 1RE1B 3U02A 1HA1A 4KV8B 5KFKA 4CLWA 2QFJA 1YVFA 4B9SA 1RT6B 2GA7A 1W2BR 1TL7A 3D0IE 3MURP 2FLOA 2RQKA 2P9EA 1VQYA 2ABYA 3UR3C 5KFUA 2B8QA 2XMAA 3NL0A 2LDYA 2LQ8A 2MHNA 5D4LA 2I38A 4JI1F 1ZAVA 1T9UA 3E3XA 4PG7A 2VZ9A 2R9LA 2XCPA 1HWIA 4EYHB 4ZVEA 2VC1A 1SUQB 3IWXA 2BYCA 4WFYA 2OEMA 1N56A 5KFRA 3LQVA 5J2PA 1PGZA 2MGZA 1FT8A 1R8CA 4DSFA 4ZVUB 2LECA 2RRBA 2EKYA 5J2MA 1RP5A 1QSLA 4H4MA 2VQFF 4DR6F 2HNDB 1K0TA 1XNRF 1OPIA 4F04B 3BDEA 2JDJA 4B9TA 2O66A 1S9FA 1U8WA 4HTIA 3H90A 2I5JA 4NLXA 2EFQA 3J81Y 4DZ6A 2R7TA 3P5TL 4BS2A 4C2MA 4TQSA 1CJVB 3I31A 1VISA 1GXTA 4C11B 2EBGA 5KG4A 2EEYA 1RADB 3G71S 1N5YA 3G8SA 3NWRA 3TWZA 4DSIA 1QSSA 2KU7A 1UTAA 1NJIT 1SL1A 3J80Y 3QT8A 4Y0FA 3M8PB 2FVRA 8AT1B 2IJRA 4DOZA 3G82B 3MM8A 3LPYA 3DLGB 3QIPB 1YKWA 4LQ3A 1Y9OA 4HKQA 2CNLB 4ILRA 2CADA 1HR0J 2VB6A 1R0AB 4PQAA 2HNYB 1TK0A 3AD8C 1C0UB 1WC1A 4ZOSA 3VGTA 5KFQA 2H9ZA 2PI4A 1NPPA 4KTQA 2ZWPA 3FBEA 1VS3A 2PO4A 4ZS6A 2NYHA 2A2CA 4HT7A 3UPFA 1R3NA 3THTA 3RBZA 4A48A 5CAAA 1VC0A 4WZQA 1Y7PA 3ZTPA 3T5LA 4P2XA 5C5JA 3NGTA 3TA1A 1QDUB 1G6BA 1T9VA 3N0VA 1FKOB 3NS5A 2QTWA 3OR2B 2C3MA 2MY8A 4EBDA 3ILOA 3MAAA 4JI5F 3H42A 2K3KA 2Z56B 3MCSA 3G8TA 1XIQA 2MZRA 3NP5A 5KG2A 1HNWF 1D8ZA 4DUZJ 1ULRA 4NLDA 3MR7A 3NCPA 3PR5B 1FTRA 3M9OB 2DHAA 4B3MJ 4RBTA 4F0MA 1JLFB 2UUWA 4RW4B 1S1WB 1IKVA 3CDWA 3HSZA 3FQKA 4DV3F 1MNEA 1DHMA 2UV8A 4OHXA 1TK8A 3PJWA 2YY3A 2QJ3A 9RUBA 1SC1B 2RU9A 4ZLPA 2DNRA 2CJYB 2OPQB 3ET6A 5KFOA 1QJHA 2YNIB 2CPDA 2HBQB 4H4OA 2GQ2A 4DWIA 3DHXA 1TZ0A 2FGCA 1TL5A 2QYGA 4ECTA 3I32A 4MKBA 5D4OA 4FXVA 5HROA 2KG1A 4U7UK 4X66J 4AXJA 2ZHAA 1NU4A 2KM8B 2HQ3A 3PO5A 2MKIA 1KS2A 1FJGJ 1AROP 2M8DB 2L9NA 3RJMB 1GTEA 3LWLA 3UCZP 1HIYA 1QAIA 4J9QA 4DX7A 2UP1A 4FP9A 4URSA 2E5GA 4ED8A 5IWAF 1HBMB 2LYVA 1IBLJ 4EI2A 3MTJA 2EFGA 2NZ4A 4EUVA 2BANB 3K8VA 3KHGA 1WF1A 2PFDA 2AGQA 2VONA 2CZ9A 3T1YJ 2VG7A 4DV6F 2HWHA 1F3VA 1BY9A 4O3SA 4KKOB 1O6XA 2G1DA 4Y2CA 4RJVA 2C2DA 5LJ3Y 1BMQB 4PWDA 3K0JA 2FC8A 2BR0A 3QLHA 4K4XA 3M4XA 4Y65A 4P75A 4OZ2A 1SIWB 2DNOA 3PV8A 1LWCB 4M8LA 3QMQA 2BQRA 2FZGB 2F7VA 3RB0A 2OHDA 3V4IA 4PXEA 2CJ9A 2OP5A 4KPCA 1Q86T 2HFZA 1NK5A 1U6BA 4LF4J 7FDRA 3C16A 2K2PA 5JJBA 4OYMA 1FFGB 3T1HF 1FRIA 1W26A 2R8IA 2HHTA 4GVBA 3MEDA 1GX5A 3UWTA 3KLHA 1M5HA 1ZZFA 4DU8A 4OX8A 1CEZA 2QN6B 3HT3A 1M5VC 3C3LA 1SJFA 3ITHA 3EGNA 2KT2A 4HEA9 2HZAA 3C14B 4ES1A 2R2UA 1GMWD 4ALZA 2Y3YA 4BC9A 5C42B 2ZDPA 1F9FA 4CWBA 3M6VA 4ED0A 3B6BA 3MPYA 1IM4A 4CM2A 1KHWA 2L08A 1Q81T 4PXBA 3CW2C 1IR0A 3OL9A 2YKMB 3OTCA 1H98A 2J6TA 4E0DA 1S1TB 1RB0A 3NXZA 2EFOA 2B5JB 5HAOA 1IKWA 1YBAA 4Q43A 4FYWB 4WFZA 1JX4A 1K1QA 2HURA 1YRTA 1ZBTA 1KQGB 1TR0A 1H2TZ 3AXMA 4TVAB 2DR8A 4D3GA 4TXSA 3HT0A 1UJ5A 1WG4A 5HLFA 1FF2A 4X4QA 3M7VA 4N5SA 3SFGA 3MMAA 3UN5A 4NEYA 4C8ZA 2XSJB 1BE4A 2LMIA 2WBMA 2RNEA 2R7QA 1E6YB 1TAQA 4DEZA 3PYFA 1WOPA 2D7SA 2ZWOA 1V5IB 3RRKA 5EDWA 3D6TB 2YKPA 5KFBA 4J9RA 1BXNA 3H2UB 4RKUC 1S57A 5IT0A 3D67A 1RAOA 2ACYA 4DV0J 4MT1A 3QATA 2V9KA 2MLYA 1Y3JA 1V3ZA 3CMES 3HFVA 4OFZA 3ZXWA 2V69A 3BQ1A 3KHRA 3X1LB 2RF2B 5L9NA 2ZH1A 4PAAA 2DPJA 1S5ZA 3FRYA 1M90T 1X31C 1YX2A 3H0PA 5F8MA 4FYYB 1OMSA 4Y6IA 2DR9A 4X4SA 1VFJA 3R7SB 4KH1B 2CPHA 1YZ7A 3TQEA 1XNQF 3ENWA 3FBFA 2NLWA 3W7BA 2DGQA 4DQSA 2ZUAA 1VI7A 4ZPCA 4DUYF 2VF3A 5KT5A 2N4DA 1YJWS 2RDJA 1T3OA 1BWVA 1ZS6A 4J9KA 3M8QB 3CDBA 5FJ4A 4DR7J 2B9XA 5F9NA 3IRXA 2WB1D 3K2YA 1CSJA 4IOCQ 2H5EA 1T3NA 2CFXA 2HHVA 1M5KC 5KFHA 3QJLA 1U24A 1N36J 3FGVA 4Y2AA 2UV8G 4PABA 2RS2A 5F3ZA 3H8YA 1IBKF 2V9WA 2E5HA 3EJMA 3DRSA 2U2FA 3GIKA 3BGRA 3AA8A 1N54B 2D69A 2CYYA 2M2BA 2R2TA 4DDFA 1JNZB 1FEHA 1MU2A 4L72B 4X4OA 3I5BA 3ULHA 1RDRA 1XMQF 3V81B 1GXUA 3OUYB 1UA0A 1RABB 2L3MA 2HZVA 2YKAA 3UDCA 3PYDA 3UCGA 3SIPB 3BF4A 2AGOA 4Q44A 3DM2A 4KIAA 1W25A 3MM6B 1F9HA 2E7XA 3PX6A 4F4KA 3P8BB 5KOXA 1RQ0A 4MYUA 1D3WA 1KOHA 2ZZTA 5DG7A 5D0HA 2W9CA 1NRKA 1VHIA 2IBOA 4ZIVA 4NMLA 3E01A 3UD4P 5CCMA 3W1YC 1YZ6A 1Z2ZA 3PEJA 2FQQB 2G1HA 3ZC4A 4YS2A 2GV1A 2VFTA 4ED3A 3BV8A 3SI8A 3CUNA 1KHVA 2B4UA 4GMKA 5KFWA 2RIJA 4I64A 3TEGA 1BGXT 4YDXA 3OL6A 3FSIA 1B0VA 1DQ9A 5DS7A 1GXLA 4M5JA 5THWA 4Z37A 1H2UX 2WCXA 1SJ3P 3WC2A 3U7JA 5D8HB 3K59A 4WKYA 4KAIA 2V8HA 1HBNA 5D0EA 4WU3A 2ZNYA 4HI1A 2BE9B 4ED1A 2MHEA 1GMUA 2YKNA 5KFCA 4CIOA 1NKBA 4WXOA 3TA0A 1VQ9S 1Y0HA 3B4DA 4DCJB 4A8WA 1ZM2A 2DO0A 4JV2A 3A3OB 1CJUA 1E6VB 4C3LA 3C15A 1TQLA 1U47A 2WB4A 2FB0A 4OI2A 2DNMA 4W4MA 4U7UD 1SL2A 2LKZA 2LCWA 3R2DJ 3KNAA 1N5VA 1IJFB 4C4WA 3M30A 2RRAA 5C25B 3JTOA 1ZOTA 3SSRA 5KT6A 5I3QA 2V94A 1M5OC 4DPXA 2OKQA 4RW7A 1IBMF 4FKYA 3BS9A 1NDCA 2ZE2A 3AQPA 1AXQA 3MDFA 3SDEA 4AXIA 4NLTA 2NUHA 4DCOB 5BYRA 3W60A 9ATCB 2KFZA 3W2WB 4ZP9A 3DI6A 1XWLA 1KWMA 4USIA 5T14A 1RTIA 4J9PA 2ZD1A 1RLDA 1JLQB 1X4CA 4GKKF 4WK3A 2J8SA 5K20B 3HHLA 1F5CA 1T9TA 2J7UA 3RB6A 2MSSA 1WUUA 2E1MC 2W7PA 1PCAA 3GE9A 3DLJA 4G1QB 3TVYA 1XR6A 4OMFG 4USHA 4NCGA 1FVQA 5IM0A 4CLTA 2APOA 3RAQA 3FJ2A 4QWEA 1FKAF 2CQGA 2HHPA 3AHPA 5A8RA 1H0HB 4YN3B 4O0NA 4YY3J 4LR8A 1SQEA 2PEHA 2HVHA 4O3OA 4ZVQB 2I1RA 4A8QA 4ECUA 4ZP8A 4JYAJ 3E51A 1W2IA 2V8DA 3H4BA 2FC9A 3NLCA 1JLCA 1EKRA 4LBHA 2IMWP 3JB9k 2R7VA 3WDOA 1S77D 2F1FA 1WNEA 4DS5A 4IG3B 1UWBB 3F0NA 1REVB 2DTJA 2RVJA 4NXNJ 2DH8A 3LGHA 3RR8A 2QGFB 5ETKA 4DQQA 2O5DA 2BZ2A 1UFWA 1NJWA 2UXDF 2VFRA 2N3LA 1HWLA 3H5UA 1R7IA 5G0RA 2J7WA 3J7AN 4UUWA 4F0HA 4J9LA 4C8OA 3KG0A 3LGMA 3M9NB 4TU9A 1RK8A 3VAIA 4UTGA 4C8LA 2DEJA 1TELA 3HULA 2F4VF 4OZ1A 1D1UA 4KC5A 1HBUB 3C6TA 3BGOP 4IH7A 1WEZA 2QMXA 5DGAA 3D28A 4MJKA 1N6QA 4HDHA 4ZHRB 2DGSA 2BE7D 1H3DA 1X9MA 1LK7A 2GO8A 4NCBA 4NA1A 4FN5A 2DHXA 5E3PA 4CCHA 5DGBA 1NSAA 1F9EB 1HHTP 2GHVC 4O0IA 3H5SA 2F4FA 3FC9A 1PBUA 3M8SA 5D77A 2QO3A 3OLAA 5E3RA 3R5AA 4JI3F 2CKWA 2PMWA 5DLGA 2CQ4A 2E7VA 4P72A 5E33A 3QWPA 2E5JA 4QPXA 3CC4S 4FYDA 2H51B 3A8IA 1Q79A 5DDPC 1XC9A 4TLRA 2IJFA 2A6MA 4JI1J 1X9SA 4X62F 2KT5A 2V68A 2HMIA 2V2QA 2CG8A 2G4BA 1Y4ZB 5KFEA 4BDPA 2QA1A 1DTQB 4RW9B 2GMLA 2E5LF 4IUFA 1RT7B 5L39A 2QSFA 3HHNB 1TL4A 3PHTA 2LEBA 5KT4A 1KSPA 1P9YA 5ETRA 4U9RA 1M5PC 4I7FA 2FJAB 5AXLA 5KT7A 2M3DA 1KQSR 5I42B 4LJMA 2VQFJ 2D74B 4RNMA 1RI7A 4U7CA 2EG2A 1S6QB 2KZZA 2CPIA 1XNRJ 3MPWA 4HL9A 1H7XA 4UZCA 4LF2A 2QL9B 1HNIB 2QLBB 1GH8A 2MQNA 5DG9A 2NR0A 2PSZA 5DETA 2OPSA 2W8KA 1V3RA 1GMVA 1PO6A 1S0MA 2P5VA 3PM9A 4U8YA 4ICLB 1JNRB 1FXRA 2HRYA 1NZAA 5DLFA 3KLFB 1EZZB 2UVRA 1FKPA 1VGYA 3IGVA 4G1PA 4ELTA 4GKJJ 2XNRA 2YKQA 4LSNB 1DTTB 5E3CA 1J5OA 1N5TA 3DKDA 4RW6A 1XN9A 3G96A 1H38A 3ZZYA 2DNLA 4U8VA 3HLUA 5HANA 4XIUA 5ETPA 4DL7A 4NEZA 3L09A 2W2OP 1FRKA 5KFNA 1LWEA 3E2EA 3TZWA 1Z4UA 3DGPB 3OV7A 1NDKA 4XDCA 2HNZA 2X51A 3CCLS 3OW2R 4X4NA 1OYDA 4JI7F 2KJVA 4N8OA 3KJVB 5AJ3F 1FRLA 4LIRA 1SC4B 1HFEL 3D9BA 1Z1ZA 3C66A 3S6EA 4PG5A 5KFMA 1FDNA 3HP6A 4MK8A 1FWPA 5K14A 2J76E 3MHYA 4M5HA 2ASJA 3KLEA 1DAXA 3BPSP 4CLKA 4N41A 1DY3A 2ZH6A 2HYIB 3O6QA 1U1QA 4ID8A 5HVHA 1KKHA 4ZK7M 3R27A 1QSYA 3UCUP 2KZMA 2CRLA 5HP1A 2DITA 3SCKE 4CTAA 3CB4A 3ZZZA 3SEOA 3PACA 4JI5J 1TV6A 3P96A 3OTOF 2L41A 1SV5B 1BWEA 3JSRA 3QGPA 3KUHA 3D2WA 1KQKA 2BEFA 2HHXA 4I0WA 1RWNB 1AUDA 1HNWJ 2V8GA 4WPAA 1SJQA 1U0SA 4OZ0A 2G2ZA 3VAFA 4C8YA 2HVIA 2LDIA 4J90A 2OPRA 3FCVA 1ZA2B 4ECZA 2XY6A 2E7WA 2ZZMA 1R8HA 3NG8A 4QWBA 1M0SA 2AJ1A 3VZIA 4O4GB 5HBMB 4DV3J 5D0GA 1WORA 2HFNA 2Y1JA 3EWGA 4NPOA 3R7BB 1V3SA 3UNGC 2ATLA 4ERDA 1HQ2A 1XMBA 1BUXA 4P6QA 2LEAA 3W2VA 3GJRB 2PA8D 4WIIA 5AE1A 2RB7A 1HWJA 2EFPA 2YWFA 2V2VA 4DXLA 2C2NA 2OPPA 2XG8A 3HSDA 4XTTA 1X8DA 4DL0C 2C2RA 2C3UA 2W9BB 2BKPA 4K50A 1NUEA 2RJZA 2VDIA 1NKEA 2OEKA 2B56A 1GEHA 3M6UA 2FJXA 5C7PA 4KT0C 2BW2A 4IFYB 3KMSA 2R8HA 4RNFA 3M1VB 4Q8FA 4I67A 1LW2A 4TYBA 1K0VA 4UQGA 2CQ2A 3MMBB 2VPYB 4C0BA 1VBZA 4OX6A 4ECQA 1BC6A 5C2CA 5IWAJ 4Q2LA 1LWFB 4Q2MA 1TU0B 1IR2A 3EVMA 2E66A 1HNZF 4WFXA 1RT5A 2XMMA 3TW0A 4AFFA 1CULB 4LFBF 2JSXA 3GIIA 1JJCB 2VBXA 3EICA 2VKRA 4KR0B 3UE2A 3MGJA 2FVPA 4ZPTR 5EWEA 1X4DA 1O5JA 2OELA 1YIJS 2V6AA 3F41A 3NGUA 2G0CA 4DR5F 4EBCA 4PXDA 3T1HJ 2EFNA 3H5XA 2K8GA 3BSCA 2ERRA 5HVGA 4R0JA 2WVCA 2XCAA 2IPOB 3B4MA 4FPIA 3OFEA 5KT3A 4OZLA 2BJ3A 4FYVB 1NK7A 2AEJA 1ZH5A 3HDSA 2A2DA 2HHHF 1J27A 1SXLA 2CIMA 1NZ8A 2B7BB 1UVLA 3GU0A 4MIAA 1WI8A 2J9CA 4HLBA 3EDRB 3FBBA 3QNWB 1VQKS 3W61A 1EETB 4KBIA 2BJ9A 4KV8A 4W92B 4O44B 1EARA 1VQMS 1SKWA 1TKTB 1RT6A 3DLBA 1K44A 2EW9A 4K2JA 4P73A 4GC6A 2IBKA 2VOOA 2AYEA 1RAGB 1WDDA 4CT8A 4KRWA 4DI6A 3CJ3A 2XMVA 3L7PA 2AEMA 3KK1B 5BYSA 6FDRA 4DPYA 5LSRA 2LU2A 3HHKA 3OFFA 2B9WA 1S6OA 3RBDA 3HO1A 2R8GA 1N8RT 4LSLB 1HPZB 2H1YA 1SUQA 3CJ8A 4LRAA 3W65A 4ECSA 5D0RA 2IIHA 1WHYA 2V63A 1U02A 2KO1A 1GFWB 4QPTA 1RAIB 4ZCIA 5HSPA 4EFAC 2E1PA 1VBKA 5J1EB 1T9YA 2HNDA 3MM5B 3D6MB 1X9WA 1CJKB 3MZIA 4OYBA 5F8GA 2CJAA 1URRA 3BKTA 3NGKA 2RQMA 1I1GA 1WC5A 3QSIA 2AQ4A 3HI9A 1I94F 1RAEB 1WEYA 4OI4A 5U47A 4TU8A 2OAUA 3DLLQ 3QT7A 2VG5A 3WX8A 2AJ4A 4QCLA 4C11A 3EGWB 3M8RA 1KD1T 5A2QU 1XNQJ 1VRUB 1IKXA 4RPFA 4JI6J 4QU6A 4C8KA 2GFFA 4DUYJ 4QW8A 1XR7A 3M8PA 3DLEB 3HD2A 4J7CA 3G82A 3IG1B 5CABA 2HBRB 3DLGA 3QIPA 4DFMA 1DJ0A 1VQ8S 4DN9A 4NI2B 4WP9A 3R6GB 1N52B 3GYNA 1R0AA 2HNYA 8RUCA 1R27B 1C0UA 3PIOQ 1MN7A 1WHVA 2WW4A 4YUDA 2RILA 1NSQA 4F4AA 4ZCMA 2AF6A 1FRXA 3H4DA 1IBKJ 3AQOA 4M63A 4OHWA 5FIIA 1RGVA 4ZPAA 3IWLA 3DLKA 2HHUA 3JQJA 4YR0A 2E9ZA 2ZBRA 2AX1A 1AUSL 2BUNA 4UOCA 4OJ1A 2R7UA 1FKOA 5EN1A 4OHYA 1CC8A 3OR2A 2J5AA 1RAJA 2O01C 4O3QA 2ACMA 3EDQB 2Z30B 3GFHA 4QR1A 5GADU 3NS6A 1XMQJ 1HQEB 1FK9B 2KM8C 5CQGA 1UEVA 3WX4A 1D8YA 4F0KA 5D3GA 5E3AA 2GS8A 2HK3A 1JXLA 1RAHB 1N5QA 2DNGA 1P8GA 5F0WA 2IA6A 4Q0BB 2KHCA 2Y0SD 3QJJA 1JLFA 2NXUA 2BOAA 1S1WA 2IMOA 2LQ9A 3DOLB 1P1LA 4LF9F 2KFNA 2F63A 3AA9A 1U4BA 3AD9C 4RWXA 2LLZA 4ID5B 2OPQA 4QR2A 4I1TA 1P9QC 2YNIA 4RBUA 3FVYA 1RWMB 1T0TV 2IDLA 3HD1A 1IBLF 1WF0A 5KFYA 2EC2A 2DNPA 3RAMA 1CS4A 3LAMA 3UVJB 4FXWA 3R8YA 3KK3B 3P6YC 3Q8RB 1QAYA 2DR6A 1JJ4A 4F26A 1RTDB 5CXTA 2M0GB 4EO6A 4QIGA 1I5OB 3T5KA 2XMKA 4OX9J 3C6UB 1HBMA 1Q16B 3V6KA 2M52A 2K06A 4OX7A 2GHPA 1FD2A 2UZAA 2BANA 2ZNZA 1SH3A 1NBEB 2MQMA 3THPA 2UUCF 4PG4A 3PX4A 4GC7A 4KKOA 4ECRA 4NYZA 1OJ4A 1PYOB 4UQTA 2DHHA 1RHMB 4AQYF 3RRGA 2E44A 3CCZA 4BHQA 1WC0A 3H20A 3LA0A 1IBMJ 3AOCA 1LWCA 4I2QA 2OSQA 2GIRA 1Q1KA 4B9MA 2D3O1 2UUBJ 1C1CB 4RUAA 2FZKB 1X0FA 5IC6B 4FVCA 3D3CJ 3ELHA 3MM9B 2J9EA 3OJUA 4GKKJ 3FKBA 2QT7A 2JEFA 1OY9A 2HW3A 5K8OA 4LF6J 3LALA 3FUYA 3EGVA 4LUBA 3TAQA 4YOEA 2QL5B 3C14A 1U49A 2YX4A 5C42A 4CLLA 4CLZA 3DDKA 4U96A 1DQ8A 3GILA 5DDQC 3B54A 2XYGB 3MECA 2DVIA 4UF4A 1C4AA 5T7LB 1S0OA 4YB5A 1U26A 4LSZB 4ZLLA 5IFMA 5GADI 2ZUGA 4Y2KA 1L3KA 4AUKA 4DZDA 1YQHA 4J9SA 4KY3A 3TOQA 1TKXA 5L1JA 1S1TA 1WOOA 2B5JA 1H7WA 4NXMJ 1SJRA 2C42A 1V5VA 2HGNA 4FF3A 4DV0F 1RWVB 4PR6A 3OQ2A 4K4UA 2IVFB 1U8SA 3BSOA 5T41A 3J7YI 4JV0A 3OHAA 2CAJA 1S76D 2BRKA 2NPIA 5C2GA 3M6WA 2VICA 3PVXA 5LXYA 3MPDA 2UXDJ 4FS2A 2JVRA 1AZSA 4EO8A 4Q7AA 2MGZB 4NLPA 1REGX 2XSJA 2YWWA 2N7YA 2NPFA 1E6YA 4HDGA 1K9MT 1UJ6A 1NNDA 4H4MB 4USWA 3UN2A 2F4VJ 4MAKA 3PRVA 4B9NA 3UW1A 3MFIA 2OMOA 2CJXB 3US5A 1JXVA 2I5JB 1VIOA 1S9EA 4JB8B 2PA3A 1EAYC 2DHGA 2XZWA 3JSBA 2W2QP 2OGUA 5KAKA 2BX6A 2XYHB 4J91A 4DR7F 1SIZA 4KGZB 4E98A 1F2GA 2ZBPA 3LOUA 3PHEA 1N33F 3RYLA 1R6VA 1HNXF 4ENOA 2KXFA 1F6TA 3D7SB 2H4YB 3CEDA 4RWWA 2G13A 3HVWA 2ZOMA 3MWBA 5H1SV 1FDBA 1RUSA 3QGHA 5IV4A 4M5LA 3M8QA 2FGOA 1EIYB 3DNCA 3R5JB 2RD5C 2HWIA 2E5LJ 1RBAA 1WI6A 2HKEA 3OTEA 1U2CA 1BD6A 1RAAB 2MDAA 1T8EA 1S1UA 1H6KX 3QAUA 5K8MA 1WWHA 1HKAA 1JK9B 4ZVHA 3VWSA 2MLXA 5AXKA 3GSDA 4DX8H 2DNYA 3AB2B 3N5BA 2W4PA 4N56A 2EI5A 2CQ3A 1W7WA 1R8PA 3IP0A 4HT5A 3SSQA 4RNOA 4ZP6A 1TAUA 2D9OA 4KSEB 2BV3A 4C8NA 3NAHA 2VFSA 3KHHA 1U6ZA 2HRTA 3H7HB 4QYZK 3MF5A 3SCLE 3BBFA 4QOTA 3THVA 1ZETA 2P2CB 1FX4A 1RZMA 1U1KA 3GQCA 4IO1A 4DR1F 4DPWA 4R8UB 3MAAB 3NCQA 2CWXA 1UAWA 1UMJA 1FDAA 4NOHA 3V81A 3OUYA 4OHZA 4IH5A 1U2FA 4QJVA 2ADBA 1L3TA 2R2RA 5C24B 1YBTA 2GW8A 1S0VA 4FF2A 2NS1B 3C2PA 3ETMA 4KO0B 3R3TA 4ZDNA 3RB3A 1KLNA 3L4BC 3V2UC 3R9LA 4EU0A 1I51B 1FX2A 4NE9C 4TLQA 3I55S 3OXLA 3UO0A 2ZZNA 4J9OA 2CVIA 3WC0A 1LOUA 1ZTTA 4GO5X 1HLWA 1VQ4S 2J6SA 3UDVA 3QGGA 5ETLA 5AJ3J 1FRJA 4F8RA 1RHJB 5HJXA 3WIUA 4RL1A 2J7KA 4CNYA 3BH7B 3VF0B 2FHKA 2A1BA 3OVSA 2DGOA 1PJ7A 2MY7A 2Y8YA 1DLOB 3AJ1A 4HACB 3I0RB 2K7JA 5LL6d 1UVJA 4V19J 3OVBA 2RS8A 1HYSB 1EP4B 4UOFA 5EHHA 1NJXA 4RUCA 3FSYA 2DNKA 2GMHA 4M5IA 2CNOB 4IFVA 1N88A 1F2HA 1HI0P 4F50A 1F5BA 1PJ5A 4A8KA 3OTOJ 1E6VA 4JV1A 1UEUA 3H2VE 4XPCA 3CD7A 3ZZOA 2JLFA 2W2PP 5JUMA 4C97A 2PMZD 2CPFA 2YH1A 1QVGR 5LOQA 3CNQP 4JI4F 2E29A 5C25A 2IDEA 1S0NA 1UVMA 5D4NA 3GIMA 3AXKA 2KT3A 3LAKA 4YDDB 4ZLJA 5DRKA 5ETMA 4A8MP 2C2EA 2AYBA 5IOLA 4LR9A 4CLSA 2PD1A 4HH1A 2RMLA 2MXYA 2JHEA 2V5HG 4ZN3A 2H65B 3WZ0A 2NZCA 3BO2A 2GC8A 3KTQA 3VAGA 2DR7A 3MEEB 5F8IA 2KFYA 3C46A 2HFUA 3MMJA 3VVUA 3LGNA 4DF8A 2BQUA 4HR2A 5E2QA 2DNZA 3RBXA 2J0QD 1XTZA 1JLQA 4GVBB 4CDIA 2KRBA 4PYAA 1K47A 3HHDA 1B70B 2UVWA 3M8ZA 5CA5A 4QWAA 1NSPA 4R5PA 4AE5A 3O1LA 3VAHA 2X1GA 1FFSB 1RCXB 5GAHU 5KFAA 2KYXA 2ZBCA 4B3SF 4L3NA 2OTLS 2FDNA 1VQ7S 3DN9A 2YBVA 5KFSA 3FFIB 4G1QA 3A3NB 3EE3A 4PWUA 2ZHBA 2BDPA 1LFPA 1UCNA 2BJDA 4ZPVR 5LJ5Y 1BQMB 3NOGA 3MUMP 2JFDA 4G6VB 4DFJA 3NMRA 2HS0A 2AWZA 4J37A 4M5NA 3GJSB 3VALA 2LXIA 1KN6A 4JOUA 4ZIWA 4I6WA 4K4YA 5ETNA 3HMJG 3O5TB 2W9AA 1OIAA 4LFBJ 5L46A 1N32F 3T5JA 2ATCB 4PUOA 4HI2A 1VQLS 4ETXA 2MEWA 3D68A 4IG3A 4AL5A 1UWBA 2YNHB 1XBWA 1REVA 2PFFB 1G2EA 2CQ0A 2XGQA 4M5GA 2V8VA 1GMWA 1FJ7A 4DR5J 1RISA 3R7NB 5I3UA 2L48A 2FZCB 3G4SS 5AXMA 3QGIA 3M2UB 4HH0A 4JV5F 4IRKA 1B7YB 3KLVA 1GT8A 3TJ9A 1C0TB 1FNOA 2H54B 1HBUA 4WE1A 3U1NA 2HHHJ 2MJNA 2F9DA 2B6AB 2DPIA 3ZZ0A 4CLPA 4ZHRA 3V6DB 1NCLA 4CQ1A 1WTBA 4C3MA 3D1HA 3MD1A 1DRZA 3DLHA 1TL1B 1TVRB 4IH6A 3N79A 3NY0A 4E2FB 2DR5A 3HSJA 1HBOA 5I4MA 4LFAF 4OYXA 1UWAA 1YLXA 2YVSA 4FYXB 2WW8A 5MAOA 2BJ8A 1OY6A 2GVZB 5LMNF 3JSMB 4MK7A 5SUHA 5G4DA 1NK6A 1S7HA 1WG5A 1NLKL 2ALYB 3MAHA 2CQCA 4OHVA 2R8KA 3CD6S 2UU9F 1DTQA 1Y10A 1B99A 3KG4A 1WACA 3QIDA 2F8HA 2GNKA 1NH7A 2F9JA 2RHQB 2HSEB 1KTVA 3Q22A 1JLAB 2AJ0A 3UR0A 3IRXB 5BR8F 5CH7B 4YR2A 2NXNA 1F60B 2EK1A 3BN4A 2CQBA 2IRYA 4FF1A 4GKJF 5EWFA 2XWYA 5I42A 1NM2A 3O3LA 1S6QA 2AKWB 4OI0A 2UUAF 1FE0A 2FLPA 3GG1A 3DRSB 5CZVA 5GAHI 2XQCA 2PDAA 3C19A 5KFFA 3G6XA 5HI7A 1I94J 4DR4F 2QX0A 3MUVP 1HD0A 1X5TA 4DPUA 4E8UA 1YJRA 2ASDA 4ICLA 1FCAA 1MU2B 1PYTA 4R25A 3KLFA 2P6SA 5KG7A 1SH0A 2WVEA 1NB7A 3VZHA 3Q2TC 3OD2A 5K5MA 3T9NA 2GMJA 4P7VA 3T6BA 3CJRA 3OLBA 2GCFA 1KLMA 4DL4A 4LSNA 1DTTA 4R0EA 3MCNA 2OSRA 2FJEB 3AB4B 2FY8A 4DFPA 2CPEA 2V0NA 1RTJB 4G65A 3MOZA 4PG8A 1HMVB 3OVAA 4RO0A 4LF5F 1RT4B 2CA9A 2R7XA 2BJ7A 2KB2A 3DGPA 2QL7B 3MFHA 4NLUA 2IM3A 2NSBA 3H98A 5DM7Q 2FYXA 1YGYA 3QO9B 3QWUA 1U45A 3CIMA 3SQGA 2Z4PA 1J2VA 3KDOA 1EQ0A 4TY9A 4P10A 1T11A 3TVZA 1HARA 2KL8A 3TYTA 2VG6B 1LV5A 3EVWA 3VHQA 3H59A 5CYMB 2RDDA 3LP1B 1GK8A 2RE1A 1T03A 3LPEA 3CJ5A 4YMEA 4CO2A 1VYAA 2ZJRQ 2BXJA 3SXLA 3IM8A 2BE2B 4TY8A 2BACA 3W5XA 4USUA 1X60A 1LW0B 3CMAS 2RQCA 2QRRA 4ZCLA 1FD8A 5DQGA 4Q8EA 1M5SA 1N4LA 2FD2A 1RXOB 3I4HX 1OQ3A 1G3OA 2XNQA 1KR4A 2EG1A 1S6PA 2GAHC 4F3QA 2PMHA 3I9V9 4Y28C 2AD9A 2DY9A 3NRBA 2J0XA 1FFWB 1KC8T 4I2PB 2MPUA 2C3OA 3NGSA 2QE5A 5A6PA 4WXWA 3DYAB 4DPOA 4O4GA 5HBMA 4L73A 4CM0A 1HWKA 4P52A 4LF9J 2G0IA 3MCOA 2XY5A 1UFLA 5IS2A 2HZCA 2WHOA 3VGVA 1IKYB 2IYIA 1NAQA 2MTLA 2CNNB 3W3SA 1RTIB 2JH3A 1R43A 2V4JB 4IKAA 2XLKA 3W64A 2WSFC 2W2NP 4ZA1A 1EQMA 4PYDA 1Q95G 3BDPA 1RTHB 2HQCA 1GX6A 4FNIA 2AJ2A 1RWPB 3A8JA 2GQQA 4ED5A 1YG0A 2A3JA 1RWOB 1OSCA 4B9VA 3G8QA 2X1FA 4A47A 3KDNA 3G6ES 4WZMA 4HHJA 4IFYA 1HI1A 1S79A 3TZYA 3G6VA 1UA1A 4K59A 1UW9A 2R3VA 5E3QA 1MLAA 4XDDA 2KTQA 1SKUB 3M1VA 2ZKUA 3MMBA 1SKRA 1AYEA 1DARA 3CJSA 2K1RA 2O3DA 3J7Z5 1NSKL 5AE3A 1VQ6S 3GTYX 4DL6A 3SYZA 1LWFA 3Q8QB 2VDHA 2MB0B 4K4VA 3TUJC 1JLBB 2UUCJ 2IM0A 1PBAA 3IFEA 4MIWA 3P5BP 2HHQA 3POTB 4OV1A 3RU0A 4USKA 1CULA 1JLCB 3H2LA 4AQYJ 4WBFA 1A9NB 2DGVA 4X4PA 5IC4B 1VC6A 3TUIC 3QRPA 3DOKB 1L3UA 3IBFB 3CE8A 1Q7LB 1CQNA 3T41A 2P9CA 4DU7A 2HLTA 2ZH8A 3NMAA 4TQRA 2POKA 1CQMA 1WOSA 2XI2A 2ZM6F 2FTRA 4DX5A 1ITPA 1X4BA 3F73A 2ROGA 2DCUB 4WYWA 4EWTA 1ZYQA 2C1EB 3BSAA 3MM7B 4KE5A 2COLA 4I6AA 5CHCB 4B17A 1N6QB 4NLRA 5H9FK 1UEKA 4CI0B 5JVHQ 1H74A 2DD8S 4L76A 1S9GB 2Q6CA 4IO9Q 4Y2IA 2ZH9A 2HPUA 5EX3A 1EETA 2DY1A 1TFWA 2XB2D 2DYAA 3LO3A 1UZHA 4PCQA 3OL8A 2MZTA 1YWXA 2YX1A 1WSVA 4UY85 5GVQA 3HJVA 3GCWP 3PKYA 1VBXA 2QLJB 4JI2J 2IC3B 4DV7F 5ETQA 4C48A 2ADCA 2HMIB 5ITHA 1T94A 4WFNQ 2NXEA 3CD0A 2GVDB 3BKUA 3PYGA 1RU1A 4LSLA 1HPZA 3KK2A 4N8NA 4DSLA 2EPIA 2ZKTA 1RU2A 5B09A 3ZZRA 3GIRA 1VQ5S 4Y3CA 3Q24A 1RT3B 2UUTA 3M2VB 2RU3A 3HZEA 3K7RA 3JAMY 3BBCA 4MK9A 2XZDB 2E1AA 2ZH4A 4JUZA 1OY8A 4IOBA 4F4XA 4JI6F 3MM5A 3RZAA 1VOMA 3FBCA 1CJKA 2FHJD 4DPTA 2R4FA 5L1IA 3TUZC 2DKOB 4CH1A 3F44A 2BVZA 1AFIA 2Q43A 2OPSB 1PILA 1UFKA 3O8WA 4NLSA 1Q8IA 2GQCA 2MQ8A 3CVKA 4KHMA 1S4FA 3RGIA 1K1SA 4B9UA 3DDNA 2R8JA 2IRXA 1TL3B 3W5ZA 2B0GA 4QQBA 3AH6A 1N33J 2ZJQQ 1HNXJ 1S10A 4RW6B 1VRUA 2G9OA 1S7IA 3TZXA 5B7WA 2UXCF 2YNGB 5E7OB 3OHBA 3DLEA 3KNGA 1OQ6A 1BQNB 2FJWA 4PPZA 1QTNB 2Y1LB 3M2RB 2O67A 5B0AA 2XLIA 4Y2MA 4OIXA 2CDRB 1D09B 4CZCA 5H9EK 1SC3B 2VD3A 5F41A 4ILMA 2X3DA 2WVBA 3C8YA 2G0JA 2U1AA 5B0FA 3T5HA 3JTNA 5K14B 4ATNA 4DV1F 3V5RA 1CLFA 2JWNA 2HIYA 4TNOA 4BCAA 2HHWA 3KLEB 1K8AT 1TUWA 4WWSA 4B3RF 3I5AA 5D4PA 1NK0A 1ZAXA 4DV5F 3DGVA 5GAGU 1VQOS 2D41A 4WCEQ 1NB2A 4P2FA 1VBYA 1X4HA 4DR1J 2VPWB 4CTAB 2NQPA 2HQIA 5KFIA 1X5PA 2ZITA 1S49A 2DHSA 2N3OA 1FRHA 2OEJA 3M32B 5HK4A 1HQEA 2OLWA 3ZFVA 1UW4A 3T1AA 4F36A 2AP6A 3MTKA 2OIHA 1ZM4A 1HI8A 2Y1RI 3BH6B 1UVIA 4LRBA 4UT4A 3AY0A 1FHTA 3RG6A 2CDQA 2IAJA 3ILLA 5F8JA 1DURA 4ZVGA 3DRPB 5A2QY 1Q78A 3DOLA 3PW5A 3Q0AA 3HM9A 2DXFA 3VAJA 4H4KA 5KG3A 4ID5A 2QIFA 3HHLC 2GO9A 1PC5A 4X65J 4KJIA 4OX9F 1URNA 2CQIA 4PEOA 5FD1A 1LK5A 3GV5B 1YJ9S 3JQKA 3GZ7A 1SCJB 3FRZA 2UVUA 2ZHOA 3BYPA 4YHHF 2Z0GA 2I2YA 1GNKA 3UVJA 1TKDA 4RNHA 3VVTA 3KK3A 4NLGA 4EEYA 1KP6A 1RTDA 4M94A 2JJ4D 5CCLA 5M2PA 5ETVA 4CO1A 3HFKA 2UUBF 4L6V3 3C6UA 4IYQA 4RUHA 3CJQA 4ECWA 2B7CB 1QTMA 2QV6A 3TX8A 2O1PA 3KJNB 7FD1A 4N76A 4JI4J 1P27B 4X2BA 1RKIA 3Q2SC 4BC7A 4LF6F 4DN0A 1Q7YT 1WC6A 3I5CA 4YEAA 4ELVA 2Z58B 4KYZA 3I9ZA 2XTJP 1SQFA 3I96A
chains in the Genus database with same CATH topology
2C2ZB 5IC4B 4DCPB 1RHUB 2CNNB 2C2OB 1IBCB 1RHKB 5K20B 5IC6B 3IBFB 2QLJB 3RJMB 3EDQB 4DCJB 2C2KB 3IBCB 2H5IB 2Y0BB 4ZVPB 1RWPB 3SIPB 2H48B 1ICEB 2H4YB 2CNOB 3GJQB 2QLFB 4ZVTB 2HBZB 1RHQB 2CNKB 4ZVUB 2CNLB 3P45B 3R7NB 3D6FB 1RWNB 1RWOB 1RHRB 1GFWB 3KJQB 2HBRB 3R6LB 2QL5B 1I51B 3R5JB 1RWKB 2HBYB 1I3OB 2XZTB 3R6GB 1QTNB 2C1EB 2H54B 2Y1LB 3GJTB 1RE1B 3NS7B 1SC1B 1BMQB 2XYGB 3D6MB 2CJXB 2QL7B 2XZDB 2CJYB 3EDRB 3QNWB 1SC4B 4ZVQB 1PAUB 2FQQB 2CDRB 2QL9B 2QLBB 2HBQB 1F9EB 4JB8B 4LSZB 2C2MB 3KJNB 1SC3B 3R7BB 1PYOB 2H4WB 3GJSB 1RHJB 1NMEB 3KJFB 1RHMB 4ZVSB 1RWXB 1RWWB 1QDUB 3GJRB 1RWMB 3R7SB 3D6HB 4DCOB 2DKOB 2H65B 2XYPB 2XYHB 2H5JB 2P2CB 4ZVRB 2H51B 4ZVOB 1RWVB 3P4UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2Z B;  5IC4 B;  4DCP B;  1RHU B;  2CNN B;  2C2O B;  1IBC B;  1RHK B;  5K20 B;  5IC6 B;  3IBF B;  2QLJ B;  3RJM B;  3EDQ B;  4DCJ B;  2C2K B;  3IBC B;  2H5I B;  2Y0B B;  4ZVP B;  1RWP B;  3SIP B;  2H48 B;  1ICE B;  2H4Y B;  2CNO B;  3GJQ B;  2QLF B;  4ZVT B;  2HBZ B;  1RHQ B;  2CNK B;  4ZVU B;  2CNL B;  3P45 B;  3R7N B;  3D6F B;  1RWN B;  1RWO B;  1RHR B;  1GFW B;  3KJQ B;  2HBR B;  3R6L B;  2QL5 B;  1I51 B;  3R5J B;  1RWK B;  2HBY B;  1I3O B;  2XZT B;  3R6G B;  1QTN B;  2C1E B;  2H54 B;  2Y1L B;  3GJT B;  1RE1 B;  3NS7 B;  1SC1 B;  1BMQ B;  2XYG B;  3D6M B;  2CJX B;  2QL7 B;  2XZD B;  2CJY B;  3EDR B;  3QNW B;  1SC4 B;  4ZVQ B;  1PAU B;  2FQQ B;  2CDR B;  2QL9 B;  2QLB B;  2HBQ B;  1F9E B;  4JB8 B;  4LSZ B;  2C2M B;  3KJN B;  1SC3 B;  3R7B B;  1PYO B;  2H4W B;  3GJS B;  1RHJ B;  1NME B;  3KJF B;  1RHM B;  4ZVS B;  1RWX B;  1RWW B;  1QDU B;  3GJR B;  1RWM B;  3R7S B;  3D6H B;  4DCO B;  2DKO B;  2H65 B;  2XYP B;  2XYH B;  2H5J B;  2P2C B;  4ZVR B;  2H51 B;  4ZVO B;  1RWV B;  3P4U B; 
#chains in the Genus database with same CATH topology
 3A8K A;  1RHU B;  4PG6 A;  1WC4 A;  3CO9 A;  1C1C A;  1OYE A;  3TJA A;  1ZM3 A;  4KB7 A;  3K57 A;  1Y00 A;  1H2V Z;  5F8L A;  3G6Y A;  5DM6 Q;  1WJ9 A;  2YPY A;  3JYT B;  4BWJ A;  3QT5 A;  4N7T A;  1NK9 A;  2CPJ A;  4NXM F;  4KQZ A;  3BRE A;  2MQP A;  1FO1 A;  4B3S J;  1Q8L A;  1T9W A;  3FEX B;  4CLY A;  3H40 A;  2W2M P;  1KFD A;  4EZ6 A;  3WQP A;  5GAG I;  2OH2 A;  2DRA A;  3BQ0 A;  3KUG A;  2NUU G;  1RWW B;  2BM1 A;  5T7L A;  1NK4 A;  1FNM A;  2ZFH A;  3DU5 A;  5DQI A;  5IT9 U;  3LW5 C;  4K0K F;  2BKO A;  4ZVR B;  1L5U A;  2AEF A;  5HMW A;  3SBM A;  1X0P A;  4YB7 A;  4KGX B;  4O23 A;  5IZH A;  2B9Y A;  4F2S A;  3PR4 A;  2VH7 A;  1TMJ A;  2KHD A;  4F3O A;  1N32 J;  3MI7 X;  3DDI A;  3VQT A;  3LP2 B;  5KFD A;  3NGR A;  2C3Y A;  5DO2 A;  4M95 A;  4DSK A;  1TK5 A;  1RHR B;  2W24 A;  2R42 A;  2RDI A;  4NLW A;  1Q8B A;  3CDE A;  4CT9 A;  5DZ6 A;  3K5P A;  5KFP A;  4MMO A;  4JI0 F;  2YX7 A;  3B8H A;  2Q79 A;  2MKY A;  5DQH A;  3T9Z A;  4M5M A;  1JLE B;  2XO7 A;  3L7O A;  4JV5 J;  1M1H A;  4F2R A;  1OO0 B;  1S4E A;  2EK6 A;  7AT1 B;  1PAU B;  5I3P A;  4CLF A;  4ITS A;  1C1B A;  3EPI A;  1RA7 A;  2CG4 A;  1OSD A;  2B3T B;  2QG9 B;  5GAE I;  2DNQ A;  5HL7 Q;  2R2S A;  5J1N A;  4JP8 A;  4B3O B;  2YNF A;  2A0F B;  3KG1 A;  1FNX H;  3UN3 A;  2I9S A;  1R89 A;  2JC0 A;  2CPY A;  2LA4 A;  5D78 A;  3NNA A;  2C22 A;  2LEP A;  3T19 A;  5KG5 A;  4F67 A;  4MFB B;  5KFJ A;  4OYZ A;  2FVQ A;  1MN9 A;  1T7P A;  1FI4 A;  2KI2 A;  4LFA J;  2VG5 B;  4DR2 J;  2HQG A;  3SFU A;  5HMZ A;  3TAM B;  1HQU A;  2M4M A;  1APS A;  1Q5Y A;  2LQ5 A;  4LRC A;  1IKX B;  3HHE A;  5LMN J;  3GPA A;  4PPD A;  2E1R A;  3R5D A;  2XMU A;  2F40 A;  3BEG B;  5JMN A;  3T6J A;  5A8K A;  2I0X A;  3MEG B;  2QMW A;  4OI1 A;  3RAX A;  2GGP A;  4QU7 A;  2AGP A;  1UET A;  4DBQ A;  2UU9 J;  5CD4 A;  4PQU A;  3PG9 A;  2X1A A;  1C2P A;  4DSJ A;  1PC4 A;  2ZH7 A;  2MZJ A;  4OZJ A;  5BXI A;  2BRL A;  1Y5I B;  1LXJ A;  3HVA A;  4O3R A;  5BR8 J;  3I0S B;  4DF4 A;  2J9D E;  4DHV A;  3ISN C;  5LT5 A;  3OFG A;  1D9F A;  1VJW A;  2M8H A;  2V67 A;  3NNH A;  4U95 A;  2XS5 A;  2UUA J;  1X4E A;  3DLK B;  4K2X A;  1TUV A;  3P4U B;  3NNC A;  2YQ1 A;  2QZ8 A;  5DDR C;  3GON A;  3MMC B;  4U67 Q;  2KH9 A;  2KVQ E;  1WF2 A;  1S1X B;  5HQL A;  4DR4 J;  2R7S A;  2J8A A;  5KG1 A;  5HMY A;  4ANC A;  3LAN A;  4R8U A;  4OJ3 A;  2QLF B;  1WKJ A;  4ETZ A;  1LXN A;  3EM1 A;  4KFB B;  1MML A;  4CP5 A;  1MRO B;  4ZPB A;  4CO5 A;  2WBR A;  1M1G A;  4HYK A;  2FHM A;  1Q5V A;  3LP0 B;  3D0G E;  5C24 A;  3IS9 A;  5D3G B;  5D15 A;  1RBL A;  4KO0 A;  1S97 A;  1VQN S;  4UW2 A;  4LF5 J;  1RT1 B;  1QE1 B;  4P74 A;  2ALZ A;  1EB0 A;  2MYF A;  2L9D A;  3V6H A;  3M9M B;  1NKC A;  1JLG B;  2WON B;  3BO3 A;  3DFE A;  1WDT A;  4Z2X A;  3CJK B;  4TKT A;  1KOO A;  1UL3 A;  2HRU A;  3CF5 Q;  2DH9 A;  3GR0 A;  2NXC A;  3OPK A;  4RR5 A;  5J2Q B;  1H72 C;  3LWM A;  3TAN A;  1RTZ A;  2XSF A;  2HGM A;  1GTH A;  3Q8S B;  1DLO A;  1NHK L;  4HAC A;  3I0R A;  1YIT S;  1CS4 B;  1LWX A;  1MWQ A;  2OML A;  2ZH5 A;  1QD1 A;  4LR7 A;  1HYS A;  1RHQ B;  1EP4 A;  2VFU A;  1YRU A;  1KQF B;  3BKF A;  3IO1 A;  3L3C A;  2E9R X;  1CG2 A;  2YPZ A;  1WC3 A;  1ZZN A;  3HVT B;  2ASY A;  4IDK B;  3EVO A;  3DHW C;  1PJ6 A;  3D4J A;  2L9W A;  5L38 A;  2CQP A;  4KGV B;  2XUL A;  3N6M A;  1XR5 A;  2B4P A;  4A8O A;  1S12 A;  4Q5V A;  1O8B A;  4DG1 B;  3IR6 B;  4KPY A;  3PEH A;  3GIJ A;  2XGP A;  2MLZ A;  3GG0 A;  1UZD A;  5B0E A;  1NPK A;  4IG0 B;  3GV8 B;  2NCK L;  3N01 A;  3UI3 A;  5MLC V;  1ROF A;  3JQM A;  4CLU A;  1YJV A;  4UST A;  1B64 A;  4B08 A;  3UDL A;  3GWC A;  1DBD A;  1U1N A;  2IVY A;  1RT2 B;  3GMG A;  4Z7C A;  2J0W A;  1CJT A;  3GR1 A;  3MEK A;  5F8N A;  4I2Q B;  2Y1I A;  1ZA1 B;  2YQ3 A;  4ZCK A;  2BJ1 A;  4DQR A;  2FHO B;  4QIV A;  1G4C A;  3MEE A;  3OT9 A;  2XMW A;  3CXC R;  1TKZ B;  3DMJ B;  4GO7 X;  4BLG A;  2W7A A;  4W90 B;  1WKL A;  3P45 B;  3TAP A;  1N34 F;  2HK2 A;  1LFW A;  1FWL A;  3IA0 A;  3K5N A;  2LA6 A;  2DO4 A;  2AX0 A;  2W7O A;  4V19 X;  4MTP A;  4XPE A;  1U0H B;  2HBY B;  3CDU A;  4OLP A;  1SBR A;  1HNV B;  3K8W A;  2CQD A;  1LKZ A;  5FLX U;  4WTY A;  3JAM U;  2YWH A;  2AW0 A;  3FFI A;  2RT3 A;  1U25 A;  3MEC B;  2W25 A;  2CQH A;  2JFK A;  1Q82 T;  1BQM A;  1PG5 B;  1B0P A;  2P9G A;  3EZU A;  3MUT P;  2GJF A;  4CNZ A;  4HVZ A;  1TKX B;  3BR9 A;  2VUG A;  1SVD A;  1UVN A;  2IM2 A;  3N6N A;  1FWK A;  3FNN A;  3VQS A;  3ZTO A;  3AFG A;  2XI3 A;  2Z8Q A;  4P2S A;  1T05 A;  4ZJO A;  2WOM B;  2YNH A;  4UUX A;  1WD6 A;  2FUG 9;  4K4T A;  1AZS B;  2ZM6 J;  1XEZ A;  2HVD A;  3GSI A;  2M70 A;  2MKJ A;  4HTJ A;  3M2U A;  3K5O A;  4F02 A;  5LSL A;  4YFU A;  2EC0 A;  3HK2 A;  3DRY A;  4K4W A;  4QW9 A;  4MKA A;  3WIV A;  1C0T A;  5J1P A;  4QYR A;  3RW7 A;  3PNI A;  1MSW D;  2B6A A;  3V6D A;  2VA3 A;  1N0V C;  1S9E B;  1IN0 A;  4ES3 A;  1I6J A;  3R1H A;  1KVK A;  3TQ1 A;  1TL1 A;  3RR7 A;  1TVR A;  1QUV A;  4FKX A;  4C98 A;  4RX6 A;  4DMZ A;  3T3F A;  2C2Z B;  5A8W B;  1C4C A;  2ZJP Q;  1R0C B;  4RZR A;  3ADA C;  3CSK A;  2H5I B;  4O3P A;  4RNN A;  4Z7Y A;  2GVZ A;  2ILZ A;  3JSM A;  3IBW A;  4JI8 F;  3OL7 A;  4J9V A;  4DQI A;  2GZO A;  4DV7 J;  2XBP A;  1JXE A;  3CO0 P;  3V6J A;  1SL0 A;  2AMC B;  3KOA A;  1IXK A;  1FA0 A;  1LQ9 A;  4I56 A;  4DL3 A;  4I68 A;  1JJ2 R;  3GJT B;  3SZ2 A;  2JZ5 A;  1GAO A;  3GFY A;  3BGF A;  1CJV A;  3D5M A;  1JLA A;  4IR9 A;  2X3G A;  3NBP B;  3OTB A;  3BM7 A;  3AOB A;  4EBE A;  1S1U B;  3FQL A;  5B0D A;  5A0Y B;  3B82 A;  4NAS A;  4DR3 F;  3FMW A;  3CCM S;  1FXL A;  2R7R A;  1F5A A;  3Q8Y A;  1SPB P;  4NRT A;  1EJ7 L;  4HHU A;  2VBY A;  2JNJ A;  3PY8 A;  2VOP A;  4OYP A;  4K4S A;  3QFW A;  2Y8W A;  3IR5 B;  5AXN A;  2SXL A;  1F1B B;  1U09 A;  2F8E X;  3MPU B;  3V4M A;  5LSO A;  2ZOG A;  1QLN A;  1RHK B;  4CYU B;  1U1R A;  2DGT A;  4X4T A;  2MKC A;  1XQI A;  1ZPV A;  4OI6 A;  3PO4 A;  4DFK A;  2VFV A;  5ETT A;  3BSN A;  1AFJ A;  3JSY A;  3NGD A;  3IR7 B;  2HAF A;  1SB6 A;  3RTV A;  1X5O A;  3K5L A;  3PX0 A;  2KRR A;  1N48 A;  2CWK A;  4LF8 F;  3LF0 A;  1IQT A;  2HIQ A;  4K7Q A;  2XZT B;  2UXC J;  1AW0 A;  3R1L A;  2AHO B;  1RTJ A;  3KLG B;  2MQL A;  1HMV A;  1RBO B;  1RT4 A;  2DGU A;  4P7T A;  3HCX A;  4BWM A;  3OFH A;  3W9I A;  1KRP A;  1S1V B;  2AJQ A;  4NYP A;  3FCW A;  1U1M A;  2ZC3 A;  2CQ1 A;  1N5S A;  2H4W B;  1X4G A;  4F7V A;  5KFL A;  2Z2Z A;  4ZMM A;  1DQA A;  4OQJ A;  2RRN A;  4PZV A;  1SQG A;  2IRU A;  3QO9 A;  5IQ6 A;  2FLL A;  1JQG A;  1VR6 A;  4B9L A;  4QIF A;  2XLJ A;  1LEO A;  4DV1 J;  3UQS A;  3K5M A;  3M8Y A;  2C2O B;  5J2N B;  5KFZ A;  5GMD A;  2BJE A;  2VG6 A;  3FCH A;  3ILJ A;  1R8B A;  3OBI A;  5CYM A;  2ZBI A;  3S01 A;  4B3R J;  3MOJ B;  1IR1 A;  2V4Q A;  1A7G E;  3LP1 A;  4NA2 A;  2XWX A;  3PFE A;  1NEE A;  1B0T A;  5KFX A;  4DV5 J;  4NLQ A;  4B3T J;  4NRU A;  3HX9 A;  2VPX B;  4RW4 A;  1PSD A;  4IFV B;  5EX0 A;  3J7Y U;  2VPZ B;  3KJQ B;  2BE2 A;  1X4F A;  5HMX A;  3JTP A;  2MQQ A;  2LFV A;  3MD3 A;  3ILI A;  2VA2 A;  3BN7 A;  2CJQ A;  3EGZ A;  1LW0 A;  4XK8 C;  1U1L A;  3ZZU A;  3DOM B;  4WP3 A;  3DCA A;  3UDE A;  5ADZ A;  3CTR A;  3E8O A;  5FDL B;  5AT1 B;  2B8P A;  2B4V A;  2XY7 A;  4LMZ A;  4QIW D;  3VTI A;  3M05 A;  3PW4 A;  3N4W A;  4PRF A;  4I2P A;  4M5D B;  2DB1 A;  2DRB A;  3I87 A;  3QSY B;  2XYP B;  5HJY A;  3DYA A;  1YJN S;  1BQX A;  1PAE X;  2CPX A;  2P6T A;  2RKI B;  1YJT A;  1IKY A;  3PTW A;  3D54 A;  5DG8 A;  4ZJQ A;  4LRF A;  4C6A A;  4P71 A;  1D9D A;  1ICE B;  2V4J A;  4CO4 A;  3KMQ A;  3OR1 B;  3TR5 A;  3BR8 A;  4RW8 B;  1NDL A;  2W8L A;  1IVZ A;  1RTH A;  5JXS A;  1JKH B;  3O44 A;  3CCQ S;  4YHH J;  2K3I A;  3HZG A;  4R5P B;  4OI3 A;  3CCV S;  3DRX A;  1KTQ A;  1UVK A;  4L74 A;  2M7S A;  4LT6 A;  3KYL A;  2P8I A;  3N28 A;  3OXF A;  3J7A 1;  2QSW A;  2IHR 1;  4J9U E;  4X64 J;  5KFT A;  3QBC A;  1NK8 A;  5K8N A;  3FEZ A;  4USV A;  5CYQ B;  2OFG X;  2KDO A;  3Q8U A;  3J81 U;  4OYO A;  1NHV A;  2IYG A;  4JBC A;  2ZDO A;  1JLB A;  3JS9 A;  3VGU A;  2D1C A;  4N47 A;  2UXB J;  5GMK a;  3H5Y A;  5A6W A;  3KLI B;  3HF5 A;  3POT A;  2V2K A;  2PE8 A;  1VRT B;  1U1P A;  1KBR A;  3PDN A;  1DZ5 A;  4PUO B;  3CJ2 A;  2MJU A;  1RCO B;  4EMD A;  4DQP A;  1Q0N A;  4OYI A;  2KVI A;  2ZH3 A;  2XMT A;  4ZPD A;  3DOK A;  2DNH A;  3DRR B;  4ZJL A;  1AT1 B;  5A76 A;  2CJK A;  3GP9 A;  3N6L A;  3LTO A;  2X7I A;  2ZEJ A;  3J80 U;  4WIQ A;  5I3U B;  3CUL A;  4ZKA A;  2XEX A;  1WSR A;  5CYJ A;  2RQ4 A;  4UOH A;  2YKM A;  4A8X A;  2XO6 A;  4QYZ J;  3GB0 A;  1TL7 B;  3NWG A;  4NZ6 A;  3J81 j;  1B3T A;  3L95 X;  4WE1 B;  3MM7 A;  1CVJ A;  4JI2 F;  2QMU B;  1O51 A;  3F56 A;  2CJB A;  2HQF A;  3CCS S;  2BAB A;  5L8R C;  2CXE A;  4OL8 A;  1WG1 A;  3CPW R;  1S9G A;  2DT9 A;  2WSC C;  3WBZ A;  3TO8 A;  2W01 A;  2JEJ A;  1HBO B;  3CJ4 A;  5J2P B;  4X4R A;  6AT1 B;  2GJI A;  4RLE A;  5F8H A;  5J2M B;  4K0K J;  1HWU A;  5LMU F;  4IQM A;  1O0P A;  5F0U A;  3ONQ A;  3QFH A;  3SV4 A;  1A6L A;  2IC3 A;  3CIZ A;  4LF1 A;  4DL5 A;  2MQO A;  3ENQ A;  1UP1 A;  2HFO A;  3R6L B;  1VQP S;  5RUB A;  5KG0 A;  2JLE A;  3KWM A;  4W98 A;  1I3O B;  2GVD A;  2JRS A;  2RF2 A;  1U1O A;  2EKN A;  2WK4 A;  4J9M A;  4N77 A;  2R7W A;  2VKZ G;  3OSN A;  1FE4 A;  1RT3 A;  4BBY A;  3M2V A;  3TVK A;  1OWX A;  4TU7 A;  4JI0 J;  2BBE A;  4WU2 A;  1RYS A;  3P49 B;  4KH0 B;  1N5Y B;  4AYB D;  1YRX A;  4DR6 J;  2M5Y A;  3QPI A;  4QIE A;  4F3M A;  4KHP F;  2VQE F;  3U27 A;  4IQX A;  4OJG A;  4DV4 F;  3PKM A;  1R6Y A;  5BYQ A;  3MM8 B;  1BHN A;  3HSG A;  1IBC B;  1JWW A;  4OZN A;  2C3P A;  2ROE A;  2GX8 A;  1JJH A;  3A12 A;  3MXH P;  4C9D A;  3I4P A;  4LBI A;  1TL3 A;  1FJE B;  4ZP7 A;  4LFC F;  3DU6 A;  4ED6 A;  3CCE S;  1KLM B;  2AZ3 A;  2WSE C;  1OPZ A;  2QFI A;  4D3H A;  4DSE A;  1Z2L A;  2YNG A;  3TZZ A;  3ENA A;  1S59 A;  5IQQ A;  5EWG A;  1BQN A;  1Y3K A;  2FPH X;  4WK1 A;  4EYI B;  2F8M A;  2YWG A;  2QLX A;  4NLO A;  3M2R A;  3L7U A;  2HVZ A;  5CD4 H;  1TMM A;  4DV2 F;  3K58 A;  1YDL A;  2OD6 A;  2QEX S;  1V6H A;  3SQG B;  4ED7 A;  5IV3 A;  4ED4 A;  2DCL A;  2DH7 A;  4ANE A;  1U6F A;  4EGL A;  3G86 A;  4DUT A;  1NJZ A;  4AL7 A;  2OTJ S;  3MPV A;  4I4B A;  2JVO A;  6FD1 A;  3B78 A;  4CRJ A;  2C2K B;  3MM6 A;  1MWY A;  4ZVP B;  1T03 B;  3HKW A;  4KGK A;  3EMT A;  1T95 A;  4WP8 A;  1IKV B;  2V50 A;  4EK2 A;  2YH0 A;  2W1B A;  4TY8 B;  3CCW A;  3N5F A;  3QZ7 A;  1KEK A;  3AOD A;  3ET6 B;  1JMT A;  1IM6 A;  4C3K A;  1YJU A;  3M32 A;  1R31 A;  4O4R A;  4H4O B;  4X65 F;  1SI9 A;  3HXM A;  3KUE A;  5HN0 A;  3IXQ A;  5E41 A;  3GCX P;  1S6P B;  3A4T A;  1MWZ A;  5HRO B;  1IJE B;  3IN5 A;  3LH2 S;  4C0H A;  2BMB A;  2KXN B;  3ETO A;  1QUP A;  2M9K A;  3AOA A;  4RU2 A;  3RBE A;  4K5R A;  3DRP A;  2RUG A;  1VK8 A;  2G2Y A;  1ELO A;  3TUP A;  3BQ2 A;  3AJ2 A;  4I69 A;  3PJ9 A;  3X3U A;  1ZM9 A;  4MIB A;  1FXD A;  2Q1L A;  3PCO B;  5B0C A;  3HHL D;  4UZB A;  3ZTR A;  4ELU A;  2WVD A;  3BZQ A;  5KG6 A;  4ECV A;  2VG7 B;  3BYR A;  3UNY A;  4YB1 P;  2CZ4 A;  3D66 A;  2LP4 A;  2Z2M A;  3SCJ E;  4PWD B;  2MKS A;  2GIF A;  4NCA A;  3QLH B;  3R5G A;  2JX2 A;  3QQC D;  3Q23 A;  1NH8 A;  3EXC X;  1M1K T;  3Q89 A;  3V4I B;  3FK4 A;  3SV3 A;  2K1R B;  3PZP A;  4YP3 A;  4FPR A;  5DDO C;  2Y9H A;  4LF7 F;  4QBU A;  3C16 B;  1NME B;  3W2W A;  1EHW A;  2E1C A;  4WKR A;  2CZV C;  4C7Q A;  4X4U A;  4ECY A;  2BA9 A;  3ZNU A;  3PFO A;  2QLW A;  3Q8P B;  5KFG A;  4DV6 J;  1VLO A;  1J5E F;  3MED B;  2XM3 A;  3KLH B;  1P6T A;  2RSQ A;  2D3U A;  4ZPW R;  2D9P A;  4HHH A;  3ITH B;  3U1M A;  4DJB A;  1D0E A;  1FEE A;  1TUG B;  5L9X A;  8ATC B;  1RYR A;  1IUJ A;  5E0O A;  3IWN C;  1XMO F;  2NSC A;  4ZVT B;  3CC2 S;  5K8P A;  1N0U A;  2B4O A;  3L9Z A;  2HS4 A;  1JB0 C;  2D3Z A;  1QVF R;  4OJH A;  1NO8 A;  1RWK B;  2VOD A;  3I6P A;  1N34 J;  4Y00 A;  1KNZ A;  4K5S A;  3Q86 A;  3JYT A;  3G2X A;  1YSJ A;  1IKW B;  2CUY A;  3VAM A;  3GV7 B;  3W8G A;  4CH0 S;  2DGW A;  4AT1 B;  3R2C J;  3PXG a;  1HHQ A;  2BW7 A;  1FER A;  5HLF B;  2IFX A;  3MMA B;  4S0M A;  4X4V A;  4ER8 A;  3CCR S;  2LU1 A;  4LBP A;  1WHW A;  4CH7 A;  4FBU A;  3DXB A;  2VBW A;  4OZ5 A;  4MKY A;  2R7O A;  2PT0 A;  1RKJ A;  3DC2 A;  4WFB Q;  3DXS X;  2FIU A;  3AJD A;  1SJ4 P;  2VJU A;  2PGC A;  1QM9 A;  3LP2 A;  1OS5 A;  1Y11 A;  4AND A;  4NYO A;  3CT9 A;  3SCI E;  2WZ1 A;  2DXD A;  3GYX B;  3SSS A;  3W5Y A;  1CBK A;  2NXJ A;  1WKK A;  2J9D A;  3JXO A;  3KK2 B;  3CMQ A;  1UKU A;  3NS7 B;  2YXL A;  4DR2 F;  3PYE A;  4I6Y A;  1JLE A;  2OO4 A;  1RWX B;  2DRD A;  2VBZ A;  1L3V A;  3FZ2 A;  4QR0 A;  3D3B J;  1G1X A;  1NXI A;  2KJW A;  4AD6 A;  3RW6 A;  1NJY A;  3ENV A;  4LRD A;  4B3O A;  2WAQ D;  1T9X A;  1CC7 A;  1Y5N B;  2H3E B;  4RW9 A;  2GAG C;  2UVV A;  4MFB A;  2B51 A;  1HR0 F;  2Y0B B;  1RT7 A;  2H48 B;  3ZZP A;  2A10 A;  3TAM A;  3SQO P;  4IRC A;  4A8Y A;  3H25 A;  1VRQ C;  3TI0 A;  2YKO A;  3VCD A;  5HVF A;  3I56 S;  4JI8 J;  1FRM A;  2OI2 A;  3A13 A;  2FJB B;  3ISZ A;  3MEG A;  3FZB A;  3IC1 A;  3S8S A;  1HNI A;  2OD4 A;  5IT9 Y;  3BGR B;  1BLU A;  2PC6 A;  4ILL A;  4A4J A;  3W9J A;  1Y5L B;  2D3O R;  2FHJ A;  4OV6 A;  2DNN A;  4NMX A;  2GJ2 A;  2AZ1 A;  4ZVS B;  2K7K A;  1TTH B;  1IWG A;  1TP7 A;  2B9E A;  2I8E A;  2VV5 A;  3I0S A;  2AYG A;  4DR3 J;  4LVN P;  3ISN D;  4P2M A;  1ZPW X;  2C28 A;  4DUZ F;  1Q53 A;  2YWE A;  3DM2 B;  3IMQ J;  1H73 A;  4IR1 A;  3NCR A;  1AA1 B;  2BQ3 A;  3IRW P;  2BKN A;  1PYS B;  4B3M F;  3CWJ A;  3MMC A;  1S1X A;  2YWK A;  1VCT A;  2W9C B;  3PW7 A;  3W9H A;  3E01 B;  3BB5 A;  2IY5 B;  3KJV A;  1YHQ S;  4KFB A;  5IT4 A;  1U48 A;  1MRO A;  4KHR A;  4OZ3 A;  4C0O C;  3EPG A;  4DL2 A;  4PWW A;  1X4A A;  3LP0 A;  4LF8 J;  1YBU A;  1XJW B;  2Q6B A;  4X66 F;  2YTC A;  4L3K A;  4G3I A;  1RT1 A;  1QE1 A;  3UFC X;  1ACM B;  2IAJ B;  1UPM B;  1HBN B;  2VAS A;  1JLG A;  3CJT A;  1FJG F;  2WON A;  2YKN B;  4X84 A;  2WVF A;  3W8P A;  3MAQ A;  5KOW A;  2HEK A;  3CJK A;  2XHW A;  1CJU B;  5J2Q A;  1SV5 A;  3C15 B;  3TNV A;  5B0B A;  4YR3 A;  2Z57 B;  3Q83 A;  2VU5 A;  2V2Z A;  3QRR A;  1MMD A;  1LNQ A;  1VK3 A;  5CZX A;  4M5K A;  2BOP A;  3M30 B;  3AD7 C;  3T1Y F;  5H9F J;  4YQW A;  5JVG Q;  2FJD B;  2HAI A;  2ZVS A;  4QZV B;  1VHF A;  3EZ5 A;  1XER A;  2CVE A;  1D9A A;  3ZTS A;  1IWA A;  3A1Y G;  2B43 A;  2RH3 A;  2HHS A;  4RW7 B;  4B02 A;  4QWC A;  2F3J A;  3EX7 B;  3HVT A;  2X1B A;  2ZE2 B;  3M6X A;  4IDK A;  3SDE B;  3N9U C;  1FVS A;  4LF4 F;  2AYM A;  5GME A;  1VQS A;  3DI6 B;  4DG1 A;  4NA3 A;  2FJV A;  2ZD1 B;  2PI5 A;  4NZ0 A;  5B08 A;  3UD5 A;  2AJF E;  3VAK A;  2W9B A;  3HHL B;  4IG0 A;  4RBV A;  4GVL A;  2KKH A;  1XK8 A;  1SH2 A;  3RUB L;  1HD1 A;  2LQJ A;  2F5G A;  1RT2 A;  2XHC A;  1MW7 A;  3GYG A;  3KXD A;  1S99 A;  2M88 A;  5HQ8 A;  4ZN1 A;  3EXY A;  4NCG B;  2CNK B;  5IM0 B;  2AIR B;  1GQE A;  4FNH A;  1U7L A;  1TKZ A;  2VJV A;  3DMJ A;  1RA6 A;  1V9O A;  4DX6 A;  5A8R B;  3TJ8 A;  2IA0 A;  3OTD A;  2EFV A;  2A6O A;  2V4R A;  2W4D A;  3HKZ D;  4LVO P;  3KKF A;  1RAC B;  1B7F A;  1U0H A;  2MST A;  4URQ U;  1HNV A;  4FXD A;  3PIP Q;  2HS3 A;  2MMY A;  2VL1 A;  2N4C A;  4MKV A;  3ICL A;  4QWD A;  2JEI A;  2DGX A;  3W62 A;  2BM0 A;  1FES A;  5HAT A;  3TAR A;  3LUY A;  2H5J B;  2FVS A;  2LQB A;  4RUB A;  4A8S A;  3ZZT A;  5G0R B;  5LXR A;  4WFA Q;  2ZC4 A;  2HG4 A;  3WHI A;  3QRQ A;  2DJW A;  2W4C A;  5LM7 E;  3CJ0 A;  2AV5 A;  3UD3 P;  2GIQ A;  5HQM A;  3C6T B;  2EXU A;  3D1Q A;  2Q66 A;  5SZT A;  1HHS A;  5F3T A;  4OYA A;  3MR2 A;  1MG7 A;  2WOM A;  3KHL A;  2OJ3 A;  2KN4 A;  2KXH A;  1UJ4 A;  3FEY B;  5H9E J;  1SC6 A;  5L1K A;  1ZAW A;  2HGL A;  3R97 A;  1X5S A;  2E9T A;  4WF9 Q;  3IAS 9;  3NKY A;  2DXE A;  2PN6 A;  2NRE A;  3R5C A;  4IRD A;  4CO3 A;  4A8F A;  1HW9 A;  1TFY A;  3CCJ S;  4O44 A;  1A0O B;  3ZTQ A;  4G1I A;  3M8W A;  1TKT A;  1KON A;  5ETO A;  2HFS A;  3KJF B;  4F4Z A;  2XC9 A;  1NDP A;  4Y34 A;  1C1B B;  3NOC A;  4DLG A;  2G2O A;  2MKH A;  3QT6 A;  4F4Y A;  2QC3 A;  5DZ7 A;  3IM9 A;  2YNF B;  4NZ7 A;  3KK1 A;  2DBB A;  2AT1 B;  3K17 A;  3PRD A;  2DIS A;  3PRB A;  1KFS A;  4EZ9 A;  4XO0 A;  4F25 A;  2DEI A;  4TN2 A;  1RLC L;  4TYA A;  2QA4 G;  3R5B A;  1VLY A;  5A8W A;  1NPR A;  4NLY A;  1EKS A;  3G9C A;  1HQU B;  2VC0 A;  2HQD A;  1Q4R A;  3D1O A;  4JI3 J;  5K9F A;  5FLX Y;  2E5I A;  5LMU J;  4I7F B;  2GHW A;  4WTO B;  4ES2 A;  1KVI A;  2CPZ A;  3BGU A;  5J1E A;  5L1L A;  2OUG A;  2EVZ A;  1N36 F;  1YK9 A;  2QA2 A;  1G7C B;  2KYZ A;  5A8K B;  4PXC A;  2MZ1 A;  4X62 J;  1SKS A;  1KVJ A;  5M2R A;  2GGP B;  3MCM A;  1QY7 A;  4PQU B;  5IXU A;  4USJ C;  3PW0 A;  2JL9 A;  4WJB A;  2XS7 A;  1QAX A;  1HW8 A;  2C2M B;  2XS2 A;  5HO4 A;  2VHG A;  3AAW B;  5EGY A;  2PEB A;  1FKP B;  1B4S A;  3NBP A;  3GFZ A;  4DLE A;  4ECX A;  3FSX A;  1VIX A;  1FJC A;  5A0Y A;  4FZV A;  2Z2Y B;  3IAM 9;  3MR6 A;  1J5O B;  4J5O A;  1IQZ A;  2A18 A;  4V1A k;  1JIH A;  1QAJ A;  2AU0 A;  1RWU A;  4KHP J;  2VQE J;  2HLU A;  1AB8 A;  3EZO A;  4FF4 A;  4ZVF A;  3FDS A;  5AE2 A;  4DV4 J;  1CPZ A;  1KDN A;  4K4Z A;  1LWE B;  1WEL A;  3IG1 A;  4CYU A;  3RRH A;  3J7Z T;  4J9N A;  4IOA Q;  2HNZ B;  2ROP A;  3D6F B;  4NI2 A;  5DJB A;  3IGN A;  4NL5 A;  5BJR A;  2QYC A;  5KFV A;  1YJ7 A;  3QZ8 A;  3CGI A;  3CCT A;  3A3P B;  4LFC J;  2OFH X;  1S48 A;  1F0X A;  2YQ0 A;  2DK2 A;  3Q8V A;  2LXU A;  3QAE A;  1FDD A;  1U2R A;  3IS9 B;  2V8P A;  1X7V A;  2N82 B;  3CD5 A;  2RHS B;  3NAI A;  4L75 A;  2HFV A;  4H54 A;  4H4K C;  4A46 A;  3KLG A;  5ETS A;  3S7R A;  4FBT A;  1VMB A;  2EBE A;  4K8R A;  2IJN A;  3I82 A;  1YI2 S;  1S1V A;  4P9S A;  3D6H B;  4B3T F;  1RSC A;  2ZH2 A;  1PIE A;  4DV2 J;  5HP1 B;  4JI7 J;  2VIH A;  2N7C A;  3HPO A;  1TV6 B;  3VV2 B;  4DCP B;  4URG A;  2EWH A;  2FVC A;  2Q3P A;  1YTY A;  4FDF A;  1VJQ A;  3TX0 A;  2JOQ A;  1FK9 A;  2RUS A;  2IM1 A;  2JLG A;  2ILY A;  2F65 A;  2XMJ A;  2ZOF A;  3OJS A;  3BO4 A;  5J2N A;  3QYY A;  4F4W A;  5M2U A;  3TA2 A;  4U6P A;  2OPR B;  4LIW A;  2I6W A;  5F9L A;  2FLN A;  3BJY A;  4UOG A;  3BPD A;  2DIU A;  3BGL A;  4NWB A;  4Q0B A;  4WYL A;  3ZO7 A;  3BBB A;  2FY1 A;  2MKK A;  5KTQ A;  2LXF A;  3PW2 A;  1NHU A;  4MYT A;  1PKU A;  2WRM A;  4FVM A;  3VR1 A;  2QA4 S;  3W2V B;  4UY8 T;  1K73 T;  4CO0 A;  3DOM A;  2V34 A;  3VGS A;  4AL6 A;  1VC5 A;  4PKD B;  2OPP B;  5FDL A;  3HJF A;  2J6U A;  1T02 A;  1Q8K A;  3RB4 A;  3HFZ B;  4OYW A;  1WHX A;  1MMN A;  4KGM A;  2LVW A;  4M5D A;  4ZLN A;  5GAE U;  3W63 A;  2Z2L A;  3U1L A;  4ZVO B;  2KG0 A;  3G87 A;  3W66 A;  1FTC A;  1CJT B;  2HWT A;  3K89 A;  1LW2 B;  3GJQ B;  2RKI A;  3EUN A;  4X64 F;  4DS4 A;  1F3F A;  4LQ9 A;  4MH8 A;  3GLJ A;  3OR1 A;  1SJ1 A;  3A8E A;  4YY3 F;  3KFW X;  4RW8 A;  3TEH B;  1RT5 B;  1JKH A;  2NYI A;  2RAQ A;  4OLO A;  5D6G A;  4JYA F;  1RJJ A;  3OXG A;  2UXB F;  2J0S D;  4LRE A;  3P3D A;  4XAK A;  3AT1 B;  2WTF A;  3GFX A;  3SMZ A;  2ASL A;  2JC1 A;  2ZVI A;  3CDA A;  1R8A A;  3QJP A;  4ED2 A;  1VDH A;  4ZIT A;  3CC7 S;  5E5N A;  5B0G A;  2MZQ A;  4NXN F;  3NEK A;  1DFD A;  1R0B G;  3O2I A;  3S1T A;  4USM A;  1L3S A;  4LF7 J;  3TRG A;  5EUH A;  5CYQ A;  1HL6 A;  4O3N A;  3HVR A;  3FMB A;  3D0H E;  3MR3 A;  3MR5 A;  3ZNJ 1;  3MM9 A;  1HNZ J;  2MZS A;  1EX8 A;  1J5E J;  1WEX A;  2IVM A;  3KLI A;  3IBC B;  3OSP A;  1S72 S;  4FS1 A;  1RAF B;  1VRT A;  2ZBQ A;  4M1K A;  1ZTW A;  2HBZ B;  4NX9 A;  3EYZ A;  4Q45 A;  2HVE A;  1UPP A;  1T05 B;  4YB6 A;  4C8M A;  4RU9 A;  2JEG A;  1WTF A;  3DRR A;  1XMO J;  3CCU S;  1P1T A;  2DIV A;  5KT2 A;  4NLV A;  3TP2 A;  1S6U A;  4GRS A;  2PII A;  3PJX A;  1RE1 B;  3U02 A;  1HA1 A;  4KV8 B;  5KFK A;  4CLW A;  2QFJ A;  1YVF A;  4B9S A;  1RT6 B;  2GA7 A;  1W2B R;  1TL7 A;  3D0I E;  3MUR P;  2FLO A;  2RQK A;  2P9E A;  1VQY A;  2ABY A;  3UR3 C;  5KFU A;  2B8Q A;  2XMA A;  3NL0 A;  2LDY A;  2LQ8 A;  2MHN A;  5D4L A;  2I38 A;  4JI1 F;  1ZAV A;  1T9U A;  3E3X A;  4PG7 A;  2VZ9 A;  2R9L A;  2XCP A;  1HWI A;  4EYH B;  4ZVE A;  2VC1 A;  1SUQ B;  3IWX A;  2BYC A;  4WFY A;  2OEM A;  1N56 A;  5KFR A;  3LQV A;  5J2P A;  1PGZ A;  2MGZ A;  1FT8 A;  1R8C A;  4DSF A;  4ZVU B;  2LEC A;  2RRB A;  2EKY A;  5J2M A;  1RP5 A;  1QSL A;  4H4M A;  2VQF F;  4DR6 F;  2HND B;  1K0T A;  1XNR F;  1OPI A;  4F04 B;  3BDE A;  2JDJ A;  4B9T A;  2O66 A;  1S9F A;  1U8W A;  4HTI A;  3H90 A;  2I5J A;  4NLX A;  2EFQ A;  3J81 Y;  4DZ6 A;  2R7T A;  3P5T L;  4BS2 A;  4C2M A;  4TQS A;  1CJV B;  3I31 A;  1VIS A;  1GXT A;  4C11 B;  2EBG A;  5KG4 A;  2EEY A;  1RAD B;  3G71 S;  1N5Y A;  3G8S A;  3NWR A;  3TWZ A;  4DSI A;  1QSS A;  2KU7 A;  1UTA A;  1NJI T;  1SL1 A;  3J80 Y;  3QT8 A;  4Y0F A;  3M8P B;  2FVR A;  8AT1 B;  2IJR A;  4DOZ A;  3G82 B;  3MM8 A;  3LPY A;  3DLG B;  3QIP B;  1YKW A;  4LQ3 A;  1Y9O A;  4HKQ A;  2CNL B;  4ILR A;  2CAD A;  1HR0 J;  2VB6 A;  1R0A B;  4PQA A;  2HNY B;  1TK0 A;  3AD8 C;  1C0U B;  1WC1 A;  4ZOS A;  3VGT A;  5KFQ A;  2H9Z A;  2PI4 A;  1NPP A;  4KTQ A;  2ZWP A;  3FBE A;  1VS3 A;  2PO4 A;  4ZS6 A;  2NYH A;  2A2C A;  4HT7 A;  3UPF A;  1R3N A;  3THT A;  3RBZ A;  4A48 A;  5CAA A;  1VC0 A;  4WZQ A;  1Y7P A;  3ZTP A;  3T5L A;  4P2X A;  5C5J A;  3NGT A;  3TA1 A;  1QDU B;  1G6B A;  1T9V A;  3N0V A;  1FKO B;  3NS5 A;  2QTW A;  3OR2 B;  2C3M A;  2MY8 A;  4EBD A;  3ILO A;  3MAA A;  4JI5 F;  3H42 A;  2K3K A;  2Z56 B;  3MCS A;  3G8T A;  1XIQ A;  2MZR A;  3NP5 A;  5KG2 A;  1HNW F;  1D8Z A;  4DUZ J;  1ULR A;  4NLD A;  3MR7 A;  3NCP A;  3PR5 B;  1FTR A;  3M9O B;  2DHA A;  4B3M J;  4RBT A;  4F0M A;  1JLF B;  2UUW A;  4RW4 B;  1S1W B;  1IKV A;  3CDW A;  3HSZ A;  3FQK A;  4DV3 F;  1MNE A;  1DHM A;  2UV8 A;  4OHX A;  1TK8 A;  3PJW A;  2YY3 A;  2QJ3 A;  9RUB A;  1SC1 B;  2RU9 A;  4ZLP A;  2DNR A;  2CJY B;  2OPQ B;  3ET6 A;  5KFO A;  1QJH A;  2YNI B;  2CPD A;  2HBQ B;  4H4O A;  2GQ2 A;  4DWI A;  3DHX A;  1TZ0 A;  2FGC A;  1TL5 A;  2QYG A;  4ECT A;  3I32 A;  4MKB A;  5D4O A;  4FXV A;  5HRO A;  2KG1 A;  4U7U K;  4X66 J;  4AXJ A;  2ZHA A;  1NU4 A;  2KM8 B;  2HQ3 A;  3PO5 A;  2MKI A;  1KS2 A;  1FJG J;  1ARO P;  2M8D B;  2L9N A;  3RJM B;  1GTE A;  3LWL A;  3UCZ P;  1HIY A;  1QAI A;  4J9Q A;  4DX7 A;  2UP1 A;  4FP9 A;  4URS A;  2E5G A;  4ED8 A;  5IWA F;  1HBM B;  2LYV A;  1IBL J;  4EI2 A;  3MTJ A;  2EFG A;  2NZ4 A;  4EUV A;  2BAN B;  3K8V A;  3KHG A;  1WF1 A;  2PFD A;  2AGQ A;  2VON A;  2CZ9 A;  3T1Y J;  2VG7 A;  4DV6 F;  2HWH A;  1F3V A;  1BY9 A;  4O3S A;  4KKO B;  1O6X A;  2G1D A;  4Y2C A;  4RJV A;  2C2D A;  5LJ3 Y;  1BMQ B;  4PWD A;  3K0J A;  2FC8 A;  2BR0 A;  3QLH A;  4K4X A;  3M4X A;  4Y65 A;  4P75 A;  4OZ2 A;  1SIW B;  2DNO A;  3PV8 A;  1LWC B;  4M8L A;  3QMQ A;  2BQR A;  2FZG B;  2F7V A;  3RB0 A;  2OHD A;  3V4I A;  4PXE A;  2CJ9 A;  2OP5 A;  4KPC A;  1Q86 T;  2HFZ A;  1NK5 A;  1U6B A;  4LF4 J;  7FDR A;  3C16 A;  2K2P A;  5JJB A;  4OYM A;  1FFG B;  3T1H F;  1FRI A;  1W26 A;  2R8I A;  2HHT A;  4GVB A;  3MED A;  1GX5 A;  3UWT A;  3KLH A;  1M5H A;  1ZZF A;  4DU8 A;  4OX8 A;  1CEZ A;  2QN6 B;  3HT3 A;  1M5V C;  3C3L A;  1SJF A;  3ITH A;  3EGN A;  2KT2 A;  4HEA 9;  2HZA A;  3C14 B;  4ES1 A;  2R2U A;  1GMW D;  4ALZ A;  2Y3Y A;  4BC9 A;  5C42 B;  2ZDP A;  1F9F A;  4CWB A;  3M6V A;  4ED0 A;  3B6B A;  3MPY A;  1IM4 A;  4CM2 A;  1KHW A;  2L08 A;  1Q81 T;  4PXB A;  3CW2 C;  1IR0 A;  3OL9 A;  2YKM B;  3OTC A;  1H98 A;  2J6T A;  4E0D A;  1S1T B;  1RB0 A;  3NXZ A;  2EFO A;  2B5J B;  5HAO A;  1IKW A;  1YBA A;  4Q43 A;  4FYW B;  4WFZ A;  1JX4 A;  1K1Q A;  2HUR A;  1YRT A;  1ZBT A;  1KQG B;  1TR0 A;  1H2T Z;  3AXM A;  4TVA B;  2DR8 A;  4D3G A;  4TXS A;  3HT0 A;  1UJ5 A;  1WG4 A;  5HLF A;  1FF2 A;  4X4Q A;  3M7V A;  4N5S A;  3SFG A;  3MMA A;  3UN5 A;  4NEY A;  4C8Z A;  2XSJ B;  1BE4 A;  2LMI A;  2WBM A;  2RNE A;  2R7Q A;  1E6Y B;  1TAQ A;  4DEZ A;  3PYF A;  1WOP A;  2D7S A;  2ZWO A;  1V5I B;  3RRK A;  5EDW A;  3D6T B;  2YKP A;  5KFB A;  4J9R A;  1BXN A;  3H2U B;  4RKU C;  1S57 A;  5IT0 A;  3D67 A;  1RAO A;  2ACY A;  4DV0 J;  4MT1 A;  3QAT A;  2V9K A;  2MLY A;  1Y3J A;  1V3Z A;  3CME S;  3HFV A;  4OFZ A;  3ZXW A;  2V69 A;  3BQ1 A;  3KHR A;  3X1L B;  2RF2 B;  5L9N A;  2ZH1 A;  4PAA A;  2DPJ A;  1S5Z A;  3FRY A;  1M90 T;  1X31 C;  1YX2 A;  3H0P A;  5F8M A;  4FYY B;  1OMS A;  4Y6I A;  2DR9 A;  4X4S A;  1VFJ A;  3R7S B;  4KH1 B;  2CPH A;  1YZ7 A;  3TQE A;  1XNQ F;  3ENW A;  3FBF A;  2NLW A;  3W7B A;  2DGQ A;  4DQS A;  2ZUA A;  1VI7 A;  4ZPC A;  4DUY F;  2VF3 A;  5KT5 A;  2N4D A;  1YJW S;  2RDJ A;  1T3O A;  1BWV A;  1ZS6 A;  4J9K A;  3M8Q B;  3CDB A;  5FJ4 A;  4DR7 J;  2B9X A;  5F9N A;  3IRX A;  2WB1 D;  3K2Y A;  1CSJ A;  4IOC Q;  2H5E A;  1T3N A;  2CFX A;  2HHV A;  1M5K C;  5KFH A;  3QJL A;  1U24 A;  1N36 J;  3FGV A;  4Y2A A;  2UV8 G;  4PAB A;  2RS2 A;  5F3Z A;  3H8Y A;  1IBK F;  2V9W A;  2E5H A;  3EJM A;  3DRS A;  2U2F A;  3GIK A;  3BGR A;  3AA8 A;  1N54 B;  2D69 A;  2CYY A;  2M2B A;  2R2T A;  4DDF A;  1JNZ B;  1FEH A;  1MU2 A;  4L72 B;  4X4O A;  3I5B A;  3ULH A;  1RDR A;  1XMQ F;  3V81 B;  1GXU A;  3OUY B;  1UA0 A;  1RAB B;  2L3M A;  2HZV A;  2YKA A;  3UDC A;  3PYD A;  3UCG A;  3SIP B;  3BF4 A;  2AGO A;  4Q44 A;  3DM2 A;  4KIA A;  1W25 A;  3MM6 B;  1F9H A;  2E7X A;  3PX6 A;  4F4K A;  3P8B B;  5KOX A;  1RQ0 A;  4MYU A;  1D3W A;  1KOH A;  2ZZT A;  5DG7 A;  5D0H A;  2W9C A;  1NRK A;  1VHI A;  2IBO A;  4ZIV A;  4NML A;  3E01 A;  3UD4 P;  5CCM A;  3W1Y C;  1YZ6 A;  1Z2Z A;  3PEJ A;  2FQQ B;  2G1H A;  3ZC4 A;  4YS2 A;  2GV1 A;  2VFT A;  4ED3 A;  3BV8 A;  3SI8 A;  3CUN A;  1KHV A;  2B4U A;  4GMK A;  5KFW A;  2RIJ A;  4I64 A;  3TEG A;  1BGX T;  4YDX A;  3OL6 A;  3FSI A;  1B0V A;  1DQ9 A;  5DS7 A;  1GXL A;  4M5J A;  5THW A;  4Z37 A;  1H2U X;  2WCX A;  1SJ3 P;  3WC2 A;  3U7J A;  5D8H B;  3K59 A;  4WKY A;  4KAI A;  2V8H A;  1HBN A;  5D0E A;  4WU3 A;  2ZNY A;  4HI1 A;  2BE9 B;  4ED1 A;  2MHE A;  1GMU A;  2YKN A;  5KFC A;  4CIO A;  1NKB A;  4WXO A;  3TA0 A;  1VQ9 S;  1Y0H A;  3B4D A;  4DCJ B;  4A8W A;  1ZM2 A;  2DO0 A;  4JV2 A;  3A3O B;  1CJU A;  1E6V B;  4C3L A;  3C15 A;  1TQL A;  1U47 A;  2WB4 A;  2FB0 A;  4OI2 A;  2DNM A;  4W4M A;  4U7U D;  1SL2 A;  2LKZ A;  2LCW A;  3R2D J;  3KNA A;  1N5V A;  1IJF B;  4C4W A;  3M30 A;  2RRA A;  5C25 B;  3JTO A;  1ZOT A;  3SSR A;  5KT6 A;  5I3Q A;  2V94 A;  1M5O C;  4DPX A;  2OKQ A;  4RW7 A;  1IBM F;  4FKY A;  3BS9 A;  1NDC A;  2ZE2 A;  3AQP A;  1AXQ A;  3MDF A;  3SDE A;  4AXI A;  4NLT A;  2NUH A;  4DCO B;  5BYR A;  3W60 A;  9ATC B;  2KFZ A;  3W2W B;  4ZP9 A;  3DI6 A;  1XWL A;  1KWM A;  4USI A;  5T14 A;  1RTI A;  4J9P A;  2ZD1 A;  1RLD A;  1JLQ B;  1X4C A;  4GKK F;  4WK3 A;  2J8S A;  5K20 B;  3HHL A;  1F5C A;  1T9T A;  2J7U A;  3RB6 A;  2MSS A;  1WUU A;  2E1M C;  2W7P A;  1PCA A;  3GE9 A;  3DLJ A;  4G1Q B;  3TVY A;  1XR6 A;  4OMF G;  4USH A;  4NCG A;  1FVQ A;  5IM0 A;  4CLT A;  2APO A;  3RAQ A;  3FJ2 A;  4QWE A;  1FKA F;  2CQG A;  2HHP A;  3AHP A;  5A8R A;  1H0H B;  4YN3 B;  4O0N A;  4YY3 J;  4LR8 A;  1SQE A;  2PEH A;  2HVH A;  4O3O A;  4ZVQ B;  2I1R A;  4A8Q A;  4ECU A;  4ZP8 A;  4JYA J;  3E51 A;  1W2I A;  2V8D A;  3H4B A;  2FC9 A;  3NLC A;  1JLC A;  1EKR A;  4LBH A;  2IMW P;  3JB9 k;  2R7V A;  3WDO A;  1S77 D;  2F1F A;  1WNE A;  4DS5 A;  4IG3 B;  1UWB B;  3F0N A;  1REV B;  2DTJ A;  2RVJ A;  4NXN J;  2DH8 A;  3LGH A;  3RR8 A;  2QGF B;  5ETK A;  4DQQ A;  2O5D A;  2BZ2 A;  1UFW A;  1NJW A;  2UXD F;  2VFR A;  2N3L A;  1HWL A;  3H5U A;  1R7I A;  5G0R A;  2J7W A;  3J7A N;  4UUW A;  4F0H A;  4J9L A;  4C8O A;  3KG0 A;  3LGM A;  3M9N B;  4TU9 A;  1RK8 A;  3VAI A;  4UTG A;  4C8L A;  2DEJ A;  1TEL A;  3HUL A;  2F4V F;  4OZ1 A;  1D1U A;  4KC5 A;  1HBU B;  3C6T A;  3BGO P;  4IH7 A;  1WEZ A;  2QMX A;  5DGA A;  3D28 A;  4MJK A;  1N6Q A;  4HDH A;  4ZHR B;  2DGS A;  2BE7 D;  1H3D A;  1X9M A;  1LK7 A;  2GO8 A;  4NCB A;  4NA1 A;  4FN5 A;  2DHX A;  5E3P A;  4CCH A;  5DGB A;  1NSA A;  1F9E B;  1HHT P;  2GHV C;  4O0I A;  3H5S A;  2F4F A;  3FC9 A;  1PBU A;  3M8S A;  5D77 A;  2QO3 A;  3OLA A;  5E3R A;  3R5A A;  4JI3 F;  2CKW A;  2PMW A;  5DLG A;  2CQ4 A;  2E7V A;  4P72 A;  5E33 A;  3QWP A;  2E5J A;  4QPX A;  3CC4 S;  4FYD A;  2H51 B;  3A8I A;  1Q79 A;  5DDP C;  1XC9 A;  4TLR A;  2IJF A;  2A6M A;  4JI1 J;  1X9S A;  4X62 F;  2KT5 A;  2V68 A;  2HMI A;  2V2Q A;  2CG8 A;  2G4B A;  1Y4Z B;  5KFE A;  4BDP A;  2QA1 A;  1DTQ B;  4RW9 B;  2GML A;  2E5L F;  4IUF A;  1RT7 B;  5L39 A;  2QSF A;  3HHN B;  1TL4 A;  3PHT A;  2LEB A;  5KT4 A;  1KSP A;  1P9Y A;  5ETR A;  4U9R A;  1M5P C;  4I7F A;  2FJA B;  5AXL A;  5KT7 A;  2M3D A;  1KQS R;  5I42 B;  4LJM A;  2VQF J;  2D74 B;  4RNM A;  1RI7 A;  4U7C A;  2EG2 A;  1S6Q B;  2KZZ A;  2CPI A;  1XNR J;  3MPW A;  4HL9 A;  1H7X A;  4UZC A;  4LF2 A;  2QL9 B;  1HNI B;  2QLB B;  1GH8 A;  2MQN A;  5DG9 A;  2NR0 A;  2PSZ A;  5DET A;  2OPS A;  2W8K A;  1V3R A;  1GMV A;  1PO6 A;  1S0M A;  2P5V A;  3PM9 A;  4U8Y A;  4ICL B;  1JNR B;  1FXR A;  2HRY A;  1NZA A;  5DLF A;  3KLF B;  1EZZ B;  2UVR A;  1FKP A;  1VGY A;  3IGV A;  4G1P A;  4ELT A;  4GKJ J;  2XNR A;  2YKQ A;  4LSN B;  1DTT B;  5E3C A;  1J5O A;  1N5T A;  3DKD A;  4RW6 A;  1XN9 A;  3G96 A;  1H38 A;  3ZZY A;  2DNL A;  4U8V A;  3HLU A;  5HAN A;  4XIU A;  5ETP A;  4DL7 A;  4NEZ A;  3L09 A;  2W2O P;  1FRK A;  5KFN A;  1LWE A;  3E2E A;  3TZW A;  1Z4U A;  3DGP B;  3OV7 A;  1NDK A;  4XDC A;  2HNZ A;  2X51 A;  3CCL S;  3OW2 R;  4X4N A;  1OYD A;  4JI7 F;  2KJV A;  4N8O A;  3KJV B;  5AJ3 F;  1FRL A;  4LIR A;  1SC4 B;  1HFE L;  3D9B A;  1Z1Z A;  3C66 A;  3S6E A;  4PG5 A;  5KFM A;  1FDN A;  3HP6 A;  4MK8 A;  1FWP A;  5K14 A;  2J76 E;  3MHY A;  4M5H A;  2ASJ A;  3KLE A;  1DAX A;  3BPS P;  4CLK A;  4N41 A;  1DY3 A;  2ZH6 A;  2HYI B;  3O6Q A;  1U1Q A;  4ID8 A;  5HVH A;  1KKH A;  4ZK7 M;  3R27 A;  1QSY A;  3UCU P;  2KZM A;  2CRL A;  5HP1 A;  2DIT A;  3SCK E;  4CTA A;  3CB4 A;  3ZZZ A;  3SEO A;  3PAC A;  4JI5 J;  1TV6 A;  3P96 A;  3OTO F;  2L41 A;  1SV5 B;  1BWE A;  3JSR A;  3QGP A;  3KUH A;  3D2W A;  1KQK A;  2BEF A;  2HHX A;  4I0W A;  1RWN B;  1AUD A;  1HNW J;  2V8G A;  4WPA A;  1SJQ A;  1U0S A;  4OZ0 A;  2G2Z A;  3VAF A;  4C8Y A;  2HVI A;  2LDI A;  4J90 A;  2OPR A;  3FCV A;  1ZA2 B;  4ECZ A;  2XY6 A;  2E7W A;  2ZZM A;  1R8H A;  3NG8 A;  4QWB A;  1M0S A;  2AJ1 A;  3VZI A;  4O4G B;  5HBM B;  4DV3 J;  5D0G A;  1WOR A;  2HFN A;  2Y1J A;  3EWG A;  4NPO A;  3R7B B;  1V3S A;  3UNG C;  2ATL A;  4ERD A;  1HQ2 A;  1XMB A;  1BUX A;  4P6Q A;  2LEA A;  3W2V A;  3GJR B;  2PA8 D;  4WII A;  5AE1 A;  2RB7 A;  1HWJ A;  2EFP A;  2YWF A;  2V2V A;  4DXL A;  2C2N A;  2OPP A;  2XG8 A;  3HSD A;  4XTT A;  1X8D A;  4DL0 C;  2C2R A;  2C3U A;  2W9B B;  2BKP A;  4K50 A;  1NUE A;  2RJZ A;  2VDI A;  1NKE A;  2OEK A;  2B56 A;  1GEH A;  3M6U A;  2FJX A;  5C7P A;  4KT0 C;  2BW2 A;  4IFY B;  3KMS A;  2R8H A;  4RNF A;  3M1V B;  4Q8F A;  4I67 A;  1LW2 A;  4TYB A;  1K0V A;  4UQG A;  2CQ2 A;  3MMB B;  2VPY B;  4C0B A;  1VBZ A;  4OX6 A;  4ECQ A;  1BC6 A;  5C2C A;  5IWA J;  4Q2L A;  1LWF B;  4Q2M A;  1TU0 B;  1IR2 A;  3EVM A;  2E66 A;  1HNZ F;  4WFX A;  1RT5 A;  2XMM A;  3TW0 A;  4AFF A;  1CUL B;  4LFB F;  2JSX A;  3GII A;  1JJC B;  2VBX A;  3EIC A;  2VKR A;  4KR0 B;  3UE2 A;  3MGJ A;  2FVP A;  4ZPT R;  5EWE A;  1X4D A;  1O5J A;  2OEL A;  1YIJ S;  2V6A A;  3F41 A;  3NGU A;  2G0C A;  4DR5 F;  4EBC A;  4PXD A;  3T1H J;  2EFN A;  3H5X A;  2K8G A;  3BSC A;  2ERR A;  5HVG A;  4R0J A;  2WVC A;  2XCA A;  2IPO B;  3B4M A;  4FPI A;  3OFE A;  5KT3 A;  4OZL A;  2BJ3 A;  4FYV B;  1NK7 A;  2AEJ A;  1ZH5 A;  3HDS A;  2A2D A;  2HHH F;  1J27 A;  1SXL A;  2CIM A;  1NZ8 A;  2B7B B;  1UVL A;  3GU0 A;  4MIA A;  1WI8 A;  2J9C A;  4HLB A;  3EDR B;  3FBB A;  3QNW B;  1VQK S;  3W61 A;  1EET B;  4KBI A;  2BJ9 A;  4KV8 A;  4W92 B;  4O44 B;  1EAR A;  1VQM S;  1SKW A;  1TKT B;  1RT6 A;  3DLB A;  1K44 A;  2EW9 A;  4K2J A;  4P73 A;  4GC6 A;  2IBK A;  2VOO A;  2AYE A;  1RAG B;  1WDD A;  4CT8 A;  4KRW A;  4DI6 A;  3CJ3 A;  2XMV A;  3L7P A;  2AEM A;  3KK1 B;  5BYS A;  6FDR A;  4DPY A;  5LSR A;  2LU2 A;  3HHK A;  3OFF A;  2B9W A;  1S6O A;  3RBD A;  3HO1 A;  2R8G A;  1N8R T;  4LSL B;  1HPZ B;  2H1Y A;  1SUQ A;  3CJ8 A;  4LRA A;  3W65 A;  4ECS A;  5D0R A;  2IIH A;  1WHY A;  2V63 A;  1U02 A;  2KO1 A;  1GFW B;  4QPT A;  1RAI B;  4ZCI A;  5HSP A;  4EFA C;  2E1P A;  1VBK A;  5J1E B;  1T9Y A;  2HND A;  3MM5 B;  3D6M B;  1X9W A;  1CJK B;  3MZI A;  4OYB A;  5F8G A;  2CJA A;  1URR A;  3BKT A;  3NGK A;  2RQM A;  1I1G A;  1WC5 A;  3QSI A;  2AQ4 A;  3HI9 A;  1I94 F;  1RAE B;  1WEY A;  4OI4 A;  5U47 A;  4TU8 A;  2OAU A;  3DLL Q;  3QT7 A;  2VG5 A;  3WX8 A;  2AJ4 A;  4QCL A;  4C11 A;  3EGW B;  3M8R A;  1KD1 T;  5A2Q U;  1XNQ J;  1VRU B;  1IKX A;  4RPF A;  4JI6 J;  4QU6 A;  4C8K A;  2GFF A;  4DUY J;  4QW8 A;  1XR7 A;  3M8P A;  3DLE B;  3HD2 A;  4J7C A;  3G82 A;  3IG1 B;  5CAB A;  2HBR B;  3DLG A;  3QIP A;  4DFM A;  1DJ0 A;  1VQ8 S;  4DN9 A;  4NI2 B;  4WP9 A;  3R6G B;  1N52 B;  3GYN A;  1R0A A;  2HNY A;  8RUC A;  1R27 B;  1C0U A;  3PIO Q;  1MN7 A;  1WHV A;  2WW4 A;  4YUD A;  2RIL A;  1NSQ A;  4F4A A;  4ZCM A;  2AF6 A;  1FRX A;  3H4D A;  1IBK J;  3AQO A;  4M63 A;  4OHW A;  5FII A;  1RGV A;  4ZPA A;  3IWL A;  3DLK A;  2HHU A;  3JQJ A;  4YR0 A;  2E9Z A;  2ZBR A;  2AX1 A;  1AUS L;  2BUN A;  4UOC A;  4OJ1 A;  2R7U A;  1FKO A;  5EN1 A;  4OHY A;  1CC8 A;  3OR2 A;  2J5A A;  1RAJ A;  2O01 C;  4O3Q A;  2ACM A;  3EDQ B;  2Z30 B;  3GFH A;  4QR1 A;  5GAD U;  3NS6 A;  1XMQ J;  1HQE B;  1FK9 B;  2KM8 C;  5CQG A;  1UEV A;  3WX4 A;  1D8Y A;  4F0K A;  5D3G A;  5E3A A;  2GS8 A;  2HK3 A;  1JXL A;  1RAH B;  1N5Q A;  2DNG A;  1P8G A;  5F0W A;  2IA6 A;  4Q0B B;  2KHC A;  2Y0S D;  3QJJ A;  1JLF A;  2NXU A;  2BOA A;  1S1W A;  2IMO A;  2LQ9 A;  3DOL B;  1P1L A;  4LF9 F;  2KFN A;  2F63 A;  3AA9 A;  1U4B A;  3AD9 C;  4RWX A;  2LLZ A;  4ID5 B;  2OPQ A;  4QR2 A;  4I1T A;  1P9Q C;  2YNI A;  4RBU A;  3FVY A;  1RWM B;  1T0T V;  2IDL A;  3HD1 A;  1IBL F;  1WF0 A;  5KFY A;  2EC2 A;  2DNP A;  3RAM A;  1CS4 A;  3LAM A;  3UVJ B;  4FXW A;  3R8Y A;  3KK3 B;  3P6Y C;  3Q8R B;  1QAY A;  2DR6 A;  1JJ4 A;  4F26 A;  1RTD B;  5CXT A;  2M0G B;  4EO6 A;  4QIG A;  1I5O B;  3T5K A;  2XMK A;  4OX9 J;  3C6U B;  1HBM A;  1Q16 B;  3V6K A;  2M52 A;  2K06 A;  4OX7 A;  2GHP A;  1FD2 A;  2UZA A;  2BAN A;  2ZNZ A;  1SH3 A;  1NBE B;  2MQM A;  3THP A;  2UUC F;  4PG4 A;  3PX4 A;  4GC7 A;  4KKO A;  4ECR A;  4NYZ A;  1OJ4 A;  1PYO B;  4UQT A;  2DHH A;  1RHM B;  4AQY F;  3RRG A;  2E44 A;  3CCZ A;  4BHQ A;  1WC0 A;  3H20 A;  3LA0 A;  1IBM J;  3AOC A;  1LWC A;  4I2Q A;  2OSQ A;  2GIR A;  1Q1K A;  4B9M A;  2D3O 1;  2UUB J;  1C1C B;  4RUA A;  2FZK B;  1X0F A;  5IC6 B;  4FVC A;  3D3C J;  3ELH A;  3MM9 B;  2J9E A;  3OJU A;  4GKK J;  3FKB A;  2QT7 A;  2JEF A;  1OY9 A;  2HW3 A;  5K8O A;  4LF6 J;  3LAL A;  3FUY A;  3EGV A;  4LUB A;  3TAQ A;  4YOE A;  2QL5 B;  3C14 A;  1U49 A;  2YX4 A;  5C42 A;  4CLL A;  4CLZ A;  3DDK A;  4U96 A;  1DQ8 A;  3GIL A;  5DDQ C;  3B54 A;  2XYG B;  3MEC A;  2DVI A;  4UF4 A;  1C4A A;  5T7L B;  1S0O A;  4YB5 A;  1U26 A;  4LSZ B;  4ZLL A;  5IFM A;  5GAD I;  2ZUG A;  4Y2K A;  1L3K A;  4AUK A;  4DZD A;  1YQH A;  4J9S A;  4KY3 A;  3TOQ A;  1TKX A;  5L1J A;  1S1T A;  1WOO A;  2B5J A;  1H7W A;  4NXM J;  1SJR A;  2C42 A;  1V5V A;  2HGN A;  4FF3 A;  4DV0 F;  1RWV B;  4PR6 A;  3OQ2 A;  4K4U A;  2IVF B;  1U8S A;  3BSO A;  5T41 A;  3J7Y I;  4JV0 A;  3OHA A;  2CAJ A;  1S76 D;  2BRK A;  2NPI A;  5C2G A;  3M6W A;  2VIC A;  3PVX A;  5LXY A;  3MPD A;  2UXD J;  4FS2 A;  2JVR A;  1AZS A;  4EO8 A;  4Q7A A;  2MGZ B;  4NLP A;  1REG X;  2XSJ A;  2YWW A;  2N7Y A;  2NPF A;  1E6Y A;  4HDG A;  1K9M T;  1UJ6 A;  1NND A;  4H4M B;  4USW A;  3UN2 A;  2F4V J;  4MAK A;  3PRV A;  4B9N A;  3UW1 A;  3MFI A;  2OMO A;  2CJX B;  3US5 A;  1JXV A;  2I5J B;  1VIO A;  1S9E A;  4JB8 B;  2PA3 A;  1EAY C;  2DHG A;  2XZW A;  3JSB A;  2W2Q P;  2OGU A;  5KAK A;  2BX6 A;  2XYH B;  4J91 A;  4DR7 F;  1SIZ A;  4KGZ B;  4E98 A;  1F2G A;  2ZBP A;  3LOU A;  3PHE A;  1N33 F;  3RYL A;  1R6V A;  1HNX F;  4ENO A;  2KXF A;  1F6T A;  3D7S B;  2H4Y B;  3CED A;  4RWW A;  2G13 A;  3HVW A;  2ZOM A;  3MWB A;  5H1S V;  1FDB A;  1RUS A;  3QGH A;  5IV4 A;  4M5L A;  3M8Q A;  2FGO A;  1EIY B;  3DNC A;  3R5J B;  2RD5 C;  2HWI A;  2E5L J;  1RBA A;  1WI6 A;  2HKE A;  3OTE A;  1U2C A;  1BD6 A;  1RAA B;  2MDA A;  1T8E A;  1S1U A;  1H6K X;  3QAU A;  5K8M A;  1WWH A;  1HKA A;  1JK9 B;  4ZVH A;  3VWS A;  2MLX A;  5AXK A;  3GSD A;  4DX8 H;  2DNY A;  3AB2 B;  3N5B A;  2W4P A;  4N56 A;  2EI5 A;  2CQ3 A;  1W7W A;  1R8P A;  3IP0 A;  4HT5 A;  3SSQ A;  4RNO A;  4ZP6 A;  1TAU A;  2D9O A;  4KSE B;  2BV3 A;  4C8N A;  3NAH A;  2VFS A;  3KHH A;  1U6Z A;  2HRT A;  3H7H B;  4QYZ K;  3MF5 A;  3SCL E;  3BBF A;  4QOT A;  3THV A;  1ZET A;  2P2C B;  1FX4 A;  1RZM A;  1U1K A;  3GQC A;  4IO1 A;  4DR1 F;  4DPW A;  4R8U B;  3MAA B;  3NCQ A;  2CWX A;  1UAW A;  1UMJ A;  1FDA A;  4NOH A;  3V81 A;  3OUY A;  4OHZ A;  4IH5 A;  1U2F A;  4QJV A;  2ADB A;  1L3T A;  2R2R A;  5C24 B;  1YBT A;  2GW8 A;  1S0V A;  4FF2 A;  2NS1 B;  3C2P A;  3ETM A;  4KO0 B;  3R3T A;  4ZDN A;  3RB3 A;  1KLN A;  3L4B C;  3V2U C;  3R9L A;  4EU0 A;  1I51 B;  1FX2 A;  4NE9 C;  4TLQ A;  3I55 S;  3OXL A;  3UO0 A;  2ZZN A;  4J9O A;  2CVI A;  3WC0 A;  1LOU A;  1ZTT A;  4GO5 X;  1HLW A;  1VQ4 S;  2J6S A;  3UDV A;  3QGG A;  5ETL A;  5AJ3 J;  1FRJ A;  4F8R A;  1RHJ B;  5HJX A;  3WIU A;  4RL1 A;  2J7K A;  4CNY A;  3BH7 B;  3VF0 B;  2FHK A;  2A1B A;  3OVS A;  2DGO A;  1PJ7 A;  2MY7 A;  2Y8Y A;  1DLO B;  3AJ1 A;  4HAC B;  3I0R B;  2K7J A;  5LL6 d;  1UVJ A;  4V19 J;  3OVB A;  2RS8 A;  1HYS B;  1EP4 B;  4UOF A;  5EHH A;  1NJX A;  4RUC A;  3FSY A;  2DNK A;  2GMH A;  4M5I A;  2CNO B;  4IFV A;  1N88 A;  1F2H A;  1HI0 P;  4F50 A;  1F5B A;  1PJ5 A;  4A8K A;  3OTO J;  1E6V A;  4JV1 A;  1UEU A;  3H2V E;  4XPC A;  3CD7 A;  3ZZO A;  2JLF A;  2W2P P;  5JUM A;  4C97 A;  2PMZ D;  2CPF A;  2YH1 A;  1QVG R;  5LOQ A;  3CNQ P;  4JI4 F;  2E29 A;  5C25 A;  2IDE A;  1S0N A;  1UVM A;  5D4N A;  3GIM A;  3AXK A;  2KT3 A;  3LAK A;  4YDD B;  4ZLJ A;  5DRK A;  5ETM A;  4A8M P;  2C2E A;  2AYB A;  5IOL A;  4LR9 A;  4CLS A;  2PD1 A;  4HH1 A;  2RML A;  2MXY A;  2JHE A;  2V5H G;  4ZN3 A;  2H65 B;  3WZ0 A;  2NZC A;  3BO2 A;  2GC8 A;  3KTQ A;  3VAG A;  2DR7 A;  3MEE B;  5F8I A;  2KFY A;  3C46 A;  2HFU A;  3MMJ A;  3VVU A;  3LGN A;  4DF8 A;  2BQU A;  4HR2 A;  5E2Q A;  2DNZ A;  3RBX A;  2J0Q D;  1XTZ A;  1JLQ A;  4GVB B;  4CDI A;  2KRB A;  4PYA A;  1K47 A;  3HHD A;  1B70 B;  2UVW A;  3M8Z A;  5CA5 A;  4QWA A;  1NSP A;  4R5P A;  4AE5 A;  3O1L A;  3VAH A;  2X1G A;  1FFS B;  1RCX B;  5GAH U;  5KFA A;  2KYX A;  2ZBC A;  4B3S F;  4L3N A;  2OTL S;  2FDN A;  1VQ7 S;  3DN9 A;  2YBV A;  5KFS A;  3FFI B;  4G1Q A;  3A3N B;  3EE3 A;  4PWU A;  2ZHB A;  2BDP A;  1LFP A;  1UCN A;  2BJD A;  4ZPV R;  5LJ5 Y;  1BQM B;  3NOG A;  3MUM P;  2JFD A;  4G6V B;  4DFJ A;  3NMR A;  2HS0 A;  2AWZ A;  4J37 A;  4M5N A;  3GJS B;  3VAL A;  2LXI A;  1KN6 A;  4JOU A;  4ZIW A;  4I6W A;  4K4Y A;  5ETN A;  3HMJ G;  3O5T B;  2W9A A;  1OIA A;  4LFB J;  5L46 A;  1N32 F;  3T5J A;  2ATC B;  4PUO A;  4HI2 A;  1VQL S;  4ETX A;  2MEW A;  3D68 A;  4IG3 A;  4AL5 A;  1UWB A;  2YNH B;  1XBW A;  1REV A;  2PFF B;  1G2E A;  2CQ0 A;  2XGQ A;  4M5G A;  2V8V A;  1GMW A;  1FJ7 A;  4DR5 J;  1RIS A;  3R7N B;  5I3U A;  2L48 A;  2FZC B;  3G4S S;  5AXM A;  3QGI A;  3M2U B;  4HH0 A;  4JV5 F;  4IRK A;  1B7Y B;  3KLV A;  1GT8 A;  3TJ9 A;  1C0T B;  1FNO A;  2H54 B;  1HBU A;  4WE1 A;  3U1N A;  2HHH J;  2MJN A;  2F9D A;  2B6A B;  2DPI A;  3ZZ0 A;  4CLP A;  4ZHR A;  3V6D B;  1NCL A;  4CQ1 A;  1WTB A;  4C3M A;  3D1H A;  3MD1 A;  1DRZ A;  3DLH A;  1TL1 B;  1TVR B;  4IH6 A;  3N79 A;  3NY0 A;  4E2F B;  2DR5 A;  3HSJ A;  1HBO A;  5I4M A;  4LFA F;  4OYX A;  1UWA A;  1YLX A;  2YVS A;  4FYX B;  2WW8 A;  5MAO A;  2BJ8 A;  1OY6 A;  2GVZ B;  5LMN F;  3JSM B;  4MK7 A;  5SUH A;  5G4D A;  1NK6 A;  1S7H A;  1WG5 A;  1NLK L;  2ALY B;  3MAH A;  2CQC A;  4OHV A;  2R8K A;  3CD6 S;  2UU9 F;  1DTQ A;  1Y10 A;  1B99 A;  3KG4 A;  1WAC A;  3QID A;  2F8H A;  2GNK A;  1NH7 A;  2F9J A;  2RHQ B;  2HSE B;  1KTV A;  3Q22 A;  1JLA B;  2AJ0 A;  3UR0 A;  3IRX B;  5BR8 F;  5CH7 B;  4YR2 A;  2NXN A;  1F60 B;  2EK1 A;  3BN4 A;  2CQB A;  2IRY A;  4FF1 A;  4GKJ F;  5EWF A;  2XWY A;  5I42 A;  1NM2 A;  3O3L A;  1S6Q A;  2AKW B;  4OI0 A;  2UUA F;  1FE0 A;  2FLP A;  3GG1 A;  3DRS B;  5CZV A;  5GAH I;  2XQC A;  2PDA A;  3C19 A;  5KFF A;  3G6X A;  5HI7 A;  1I94 J;  4DR4 F;  2QX0 A;  3MUV P;  1HD0 A;  1X5T A;  4DPU A;  4E8U A;  1YJR A;  2ASD A;  4ICL A;  1FCA A;  1MU2 B;  1PYT A;  4R25 A;  3KLF A;  2P6S A;  5KG7 A;  1SH0 A;  2WVE A;  1NB7 A;  3VZH A;  3Q2T C;  3OD2 A;  5K5M A;  3T9N A;  2GMJ A;  4P7V A;  3T6B A;  3CJR A;  3OLB A;  2GCF A;  1KLM A;  4DL4 A;  4LSN A;  1DTT A;  4R0E A;  3MCN A;  2OSR A;  2FJE B;  3AB4 B;  2FY8 A;  4DFP A;  2CPE A;  2V0N A;  1RTJ B;  4G65 A;  3MOZ A;  4PG8 A;  1HMV B;  3OVA A;  4RO0 A;  4LF5 F;  1RT4 B;  2CA9 A;  2R7X A;  2BJ7 A;  2KB2 A;  3DGP A;  2QL7 B;  3MFH A;  4NLU A;  2IM3 A;  2NSB A;  3H98 A;  5DM7 Q;  2FYX A;  1YGY A;  3QO9 B;  3QWU A;  1U45 A;  3CIM A;  3SQG A;  2Z4P A;  1J2V A;  3KDO A;  1EQ0 A;  4TY9 A;  4P10 A;  1T11 A;  3TVZ A;  1HAR A;  2KL8 A;  3TYT A;  2VG6 B;  1LV5 A;  3EVW A;  3VHQ A;  3H59 A;  5CYM B;  2RDD A;  3LP1 B;  1GK8 A;  2RE1 A;  1T03 A;  3LPE A;  3CJ5 A;  4YME A;  4CO2 A;  1VYA A;  2ZJR Q;  2BXJ A;  3SXL A;  3IM8 A;  2BE2 B;  4TY8 A;  2BAC A;  3W5X A;  4USU A;  1X60 A;  1LW0 B;  3CMA S;  2RQC A;  2QRR A;  4ZCL A;  1FD8 A;  5DQG A;  4Q8E A;  1M5S A;  1N4L A;  2FD2 A;  1RXO B;  3I4H X;  1OQ3 A;  1G3O A;  2XNQ A;  1KR4 A;  2EG1 A;  1S6P A;  2GAH C;  4F3Q A;  2PMH A;  3I9V 9;  4Y28 C;  2AD9 A;  2DY9 A;  3NRB A;  2J0X A;  1FFW B;  1KC8 T;  4I2P B;  2MPU A;  2C3O A;  3NGS A;  2QE5 A;  5A6P A;  4WXW A;  3DYA B;  4DPO A;  4O4G A;  5HBM A;  4L73 A;  4CM0 A;  1HWK A;  4P52 A;  4LF9 J;  2G0I A;  3MCO A;  2XY5 A;  1UFL A;  5IS2 A;  2HZC A;  2WHO A;  3VGV A;  1IKY B;  2IYI A;  1NAQ A;  2MTL A;  2CNN B;  3W3S A;  1RTI B;  2JH3 A;  1R43 A;  2V4J B;  4IKA A;  2XLK A;  3W64 A;  2WSF C;  2W2N P;  4ZA1 A;  1EQM A;  4PYD A;  1Q95 G;  3BDP A;  1RTH B;  2HQC A;  1GX6 A;  4FNI A;  2AJ2 A;  1RWP B;  3A8J A;  2GQQ A;  4ED5 A;  1YG0 A;  2A3J A;  1RWO B;  1OSC A;  4B9V A;  3G8Q A;  2X1F A;  4A47 A;  3KDN A;  3G6E S;  4WZM A;  4HHJ A;  4IFY A;  1HI1 A;  1S79 A;  3TZY A;  3G6V A;  1UA1 A;  4K59 A;  1UW9 A;  2R3V A;  5E3Q A;  1MLA A;  4XDD A;  2KTQ A;  1SKU B;  3M1V A;  2ZKU A;  3MMB A;  1SKR A;  1AYE A;  1DAR A;  3CJS A;  2K1R A;  2O3D A;  3J7Z 5;  1NSK L;  5AE3 A;  1VQ6 S;  3GTY X;  4DL6 A;  3SYZ A;  1LWF A;  3Q8Q B;  2VDH A;  2MB0 B;  4K4V A;  3TUJ C;  1JLB B;  2UUC J;  2IM0 A;  1PBA A;  3IFE A;  4MIW A;  3P5B P;  2HHQ A;  3POT B;  4OV1 A;  3RU0 A;  4USK A;  1CUL A;  1JLC B;  3H2L A;  4AQY J;  4WBF A;  1A9N B;  2DGV A;  4X4P A;  5IC4 B;  1VC6 A;  3TUI C;  3QRP A;  3DOK B;  1L3U A;  3IBF B;  3CE8 A;  1Q7L B;  1CQN A;  3T41 A;  2P9C A;  4DU7 A;  2HLT A;  2ZH8 A;  3NMA A;  4TQR A;  2POK A;  1CQM A;  1WOS A;  2XI2 A;  2ZM6 F;  2FTR A;  4DX5 A;  1ITP A;  1X4B A;  3F73 A;  2ROG A;  2DCU B;  4WYW A;  4EWT A;  1ZYQ A;  2C1E B;  3BSA A;  3MM7 B;  4KE5 A;  2COL A;  4I6A A;  5CHC B;  4B17 A;  1N6Q B;  4NLR A;  5H9F K;  1UEK A;  4CI0 B;  5JVH Q;  1H74 A;  2DD8 S;  4L76 A;  1S9G B;  2Q6C A;  4IO9 Q;  4Y2I A;  2ZH9 A;  2HPU A;  5EX3 A;  1EET A;  2DY1 A;  1TFW A;  2XB2 D;  2DYA A;  3LO3 A;  1UZH A;  4PCQ A;  3OL8 A;  2MZT A;  1YWX A;  2YX1 A;  1WSV A;  4UY8 5;  5GVQ A;  3HJV A;  3GCW P;  3PKY A;  1VBX A;  2QLJ B;  4JI2 J;  2IC3 B;  4DV7 F;  5ETQ A;  4C48 A;  2ADC A;  2HMI B;  5ITH A;  1T94 A;  4WFN Q;  2NXE A;  3CD0 A;  2GVD B;  3BKU A;  3PYG A;  1RU1 A;  4LSL A;  1HPZ A;  3KK2 A;  4N8N A;  4DSL A;  2EPI A;  2ZKT A;  1RU2 A;  5B09 A;  3ZZR A;  3GIR A;  1VQ5 S;  4Y3C A;  3Q24 A;  1RT3 B;  2UUT A;  3M2V B;  2RU3 A;  3HZE A;  3K7R A;  3JAM Y;  3BBC A;  4MK9 A;  2XZD B;  2E1A A;  2ZH4 A;  4JUZ A;  1OY8 A;  4IOB A;  4F4X A;  4JI6 F;  3MM5 A;  3RZA A;  1VOM A;  3FBC A;  1CJK A;  2FHJ D;  4DPT A;  2R4F A;  5L1I A;  3TUZ C;  2DKO B;  4CH1 A;  3F44 A;  2BVZ A;  1AFI A;  2Q43 A;  2OPS B;  1PIL A;  1UFK A;  3O8W A;  4NLS A;  1Q8I A;  2GQC A;  2MQ8 A;  3CVK A;  4KHM A;  1S4F A;  3RGI A;  1K1S A;  4B9U A;  3DDN A;  2R8J A;  2IRX A;  1TL3 B;  3W5Z A;  2B0G A;  4QQB A;  3AH6 A;  1N33 J;  2ZJQ Q;  1HNX J;  1S10 A;  4RW6 B;  1VRU A;  2G9O A;  1S7I A;  3TZX A;  5B7W A;  2UXC F;  2YNG B;  5E7O B;  3OHB A;  3DLE A;  3KNG A;  1OQ6 A;  1BQN B;  2FJW A;  4PPZ A;  1QTN B;  2Y1L B;  3M2R B;  2O67 A;  5B0A A;  2XLI A;  4Y2M A;  4OIX A;  2CDR B;  1D09 B;  4CZC A;  5H9E K;  1SC3 B;  2VD3 A;  5F41 A;  4ILM A;  2X3D A;  2WVB A;  3C8Y A;  2G0J A;  2U1A A;  5B0F A;  3T5H A;  3JTN A;  5K14 B;  4ATN A;  4DV1 F;  3V5R A;  1CLF A;  2JWN A;  2HIY A;  4TNO A;  4BCA A;  2HHW A;  3KLE B;  1K8A T;  1TUW A;  4WWS A;  4B3R F;  3I5A A;  5D4P A;  1NK0 A;  1ZAX A;  4DV5 F;  3DGV A;  5GAG U;  1VQO S;  2D41 A;  4WCE Q;  1NB2 A;  4P2F A;  1VBY A;  1X4H A;  4DR1 J;  2VPW B;  4CTA B;  2NQP A;  2HQI A;  5KFI A;  1X5P A;  2ZIT A;  1S49 A;  2DHS A;  2N3O A;  1FRH A;  2OEJ A;  3M32 B;  5HK4 A;  1HQE A;  2OLW A;  3ZFV A;  1UW4 A;  3T1A A;  4F36 A;  2AP6 A;  3MTK A;  2OIH A;  1ZM4 A;  1HI8 A;  2Y1R I;  3BH6 B;  1UVI A;  4LRB A;  4UT4 A;  3AY0 A;  1FHT A;  3RG6 A;  2CDQ A;  2IAJ A;  3ILL A;  5F8J A;  1DUR A;  4ZVG A;  3DRP B;  5A2Q Y;  1Q78 A;  3DOL A;  3PW5 A;  3Q0A A;  3HM9 A;  2DXF A;  3VAJ A;  4H4K A;  5KG3 A;  4ID5 A;  2QIF A;  3HHL C;  2GO9 A;  1PC5 A;  4X65 J;  4KJI A;  4OX9 F;  1URN A;  2CQI A;  4PEO A;  5FD1 A;  1LK5 A;  3GV5 B;  1YJ9 S;  3JQK A;  3GZ7 A;  1SCJ B;  3FRZ A;  2UVU A;  2ZHO A;  3BYP A;  4YHH F;  2Z0G A;  2I2Y A;  1GNK A;  3UVJ A;  1TKD A;  4RNH A;  3VVT A;  3KK3 A;  4NLG A;  4EEY A;  1KP6 A;  1RTD A;  4M94 A;  2JJ4 D;  5CCL A;  5M2P A;  5ETV A;  4CO1 A;  3HFK A;  2UUB F;  4L6V 3;  3C6U A;  4IYQ A;  4RUH A;  3CJQ A;  4ECW A;  2B7C B;  1QTM A;  2QV6 A;  3TX8 A;  2O1P A;  3KJN B;  7FD1 A;  4N76 A;  4JI4 J;  1P27 B;  4X2B A;  1RKI A;  3Q2S C;  4BC7 A;  4LF6 F;  4DN0 A;  1Q7Y T;  1WC6 A;  3I5C A;  4YEA A;  4ELV A;  2Z58 B;  4KYZ A;  3I9Z A;  2XTJ P;  1SQF A;  3I96 A; 
#chains in the Genus database with same CATH homology
 2C2Z B;  5IC4 B;  4DCP B;  1RHU B;  2CNN B;  2C2O B;  1IBC B;  1RHK B;  5K20 B;  5IC6 B;  3IBF B;  2QLJ B;  3RJM B;  3EDQ B;  4DCJ B;  2C2K B;  3IBC B;  2H5I B;  2Y0B B;  4ZVP B;  1RWP B;  3SIP B;  2H48 B;  1ICE B;  2H4Y B;  2CNO B;  3GJQ B;  2QLF B;  4ZVT B;  2HBZ B;  1RHQ B;  2CNK B;  4ZVU B;  2CNL B;  3P45 B;  3R7N B;  3D6F B;  1RWN B;  1RWO B;  1RHR B;  1GFW B;  3KJQ B;  2HBR B;  3R6L B;  2QL5 B;  1I51 B;  3R5J B;  1RWK B;  2HBY B;  1I3O B;  2XZT B;  3R6G B;  1QTN B;  2C1E B;  2H54 B;  2Y1L B;  3GJT B;  1RE1 B;  3NS7 B;  1SC1 B;  1BMQ B;  2XYG B;  3D6M B;  2CJX B;  2QL7 B;  2XZD B;  2CJY B;  3EDR B;  3QNW B;  1SC4 B;  4ZVQ B;  1PAU B;  2FQQ B;  2CDR B;  2QL9 B;  2QLB B;  2HBQ B;  1F9E B;  4JB8 B;  4LSZ B;  2C2M B;  3KJN B;  1SC3 B;  3R7B B;  1PYO B;  2H4W B;  3GJS B;  1RHJ B;  1NME B;  3KJF B;  1RHM B;  4ZVS B;  1RWX B;  1RWW B;  1QDU B;  3GJR B;  1RWM B;  3R7S B;  3D6H B;  4DCO B;  2DKO B;  2H65 B;  2XYP B;  2XYH B;  2H5J B;  2P2C B;  4ZVR B;  2H51 B;  4ZVO B;  1RWV B;  3P4U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...