2E1PA

Crystal structure of pro-tk-subtilisin
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of unautoprocessed precursor of subtilisin from a hyperthermophilic archaeon: evidence for Ca2+-induced folding
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 131
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2e1pA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2e1pA02
4LVNA 2WWTA 1OYVA 5JXIA 2QTWB 2Z2XA 2ZWPA 3VTAA 5JXJA 4H6WA 3WIUA 1SIOA 3HJRA 3ZXYA 3GT3A 1BH6A 1SBTA 3A3OB 1SCJA 1EA7A 5B1EA 1UBNA 2HPZA 1SBHA 2PYZA 5B1DA 2PWAA 1KE1A 1KDYA 5CW1A 1GT91 2XTJA 3P5BA 4I0WB 1TM5E 5FBZA 1Q5PA 2Z30B 2IY9A 1SBIA 5FAXA 1PTKA 1SUCA 3VV2A 2W2MP 3F7OA 2SBTA 2XTJP 1YJAA 1SIBE 4LVOA 4M1ZA 2G4VA 5K7SA 3H42B 1TK2A 1AH2A 1SCBA 3AFGA 4H6XA 3DVRX 3Q40A 4OMCA 2X8JA 1GNVA 3QMPA 1SUEA 2W2NA 4OV6A 1WMEA 5AVKA 4RYDA 5ARDA 4DZTA 1VSBA 3H42A 4NE9A 1T1GA 4AKTA 1A2QA 1XF1A 1Y33E 1S2NA 1BFUA 3PRKE 4WOCA 3AJ8A 1AV7A 1TECE 3A3NB 1Y3CE 3DYBA 1C3LA 1GA1A 3PTLA 3F49S 2SECE 1IAVA 3LPAA 3LPCA 1OYOA 1Y3DE 3EE6A 3D9QX 3BGOS 1CNMA 2W2QA 3AJ9A 1ITPA 1GNSA 5AMXA 3DE2X 3GCXA 4C3VA 2ZWOA 4NMXA 1WVMA 1CSEE 2Z57B 4YN3A 4J94A 1MEEA 1ST2A 2HD4A 3GCXP 3VYVA 5JXGA 1WMFA 3DDZX 1Y3BE 3DVQX 3TECE 1V6CA 4FONA 3DE1X 3SQOA 5FFNA 3TI7A 1T1IA 3DE3X 1Y3FE 1OT5A 2X8JB 1THMA 1GA4A 3BPSP 1C9NA 2PKCA 1BJRE 4OV6B 1P8JA 3A3PB 3P5BP 3L1KA 3DE0X 3VHQA 3DW1X 1SIUA 3DE4X 1LW6E 1GTJ1 1Y48E 1GTG1 2WV7A 4MZDA 3I2YX 4B5LA 3I37X 3BGOP 2E1PA 3DWEX 4BWGA 1SPBS 2ID4A 4C3UA 3VV2B 3GCWP 3OSZA 1SBCA 5I9SA 4K8RA 1GTL1 4CFYA 1IC6A 1V5IA 2XRMA 2Z58B 1R64A 3LXUX 1KDVA 3GCWA 2QTWA 4Z2AA 5JXHA 1YJBA 2WUWE 2W2MA 3T41A 1SVNA 3GT4A 5AQEA 3DVSX 4KB5A 1SCJB 4WOBA 2Z30A 1T1EA 1WSDA 1SH7A 4GI3A 1NDUA 1P7VA 2Z56A 3QFHA 2W2OP 1TO2E 1TM1E 3F7MA 3A3NA 4CG0A 2GKOA 4DWWA 2W2QP 1BE8A 3VSBA 1ST3A 2DUJA 1BE6A 1PJ8A 2W2OA 1EGQA 3D43A 3TI9A 3A3OA 3DE5X 1SUAA 3I30X 1TM3E 4ZOQI 2PQ2A 4NE7A 1KDZA 1Y4DE 2B6NA 1SPBP 2PRKA 3CO0P 3LPDA 4H6VA 2Z2YB 4JP8A 2PMWB 1HT3A 3SQOP 1SUDA 1P7WA 1SCAA 2V8BA 3DE6X 3BX1A 5ARBA 4HVLA 2SNIE 2SICE 1R6VA 1S02A 3A3PA 3I34X 1DBIA 1AK9A 1C9MA 4DJ5X 2DQKA 2Z56B 4ZARA 4CFZA 5JMOA 1GA6A 1TMGE 2Z2YA 4HX2A 3VV3A 2PMWA 2P4EA 1AU9A 5AVJA 3WHIA 5SICE 4KG7A 3CNQS 1SCNE 1ZVKA 3CO0S 4AKSA 1NLUA 2DP4E 1BFKA 2PWBA 1JEAA 1DUIA 1V5IB 3Q5GA 1KE2A 1YJCA 2Z57A 2W2NP 3QTLA 1ZVJA 1AQNA 3SICE 2IXTA 1AF4A 2WUVA 2Z2ZA 4NE9C 2W2PP 1TM4E 1NDQA 1PFGA 3DE7X 1SUPA 4KPGA 2ST1A 3CNQP 1MPTA 1GCIA 3DW3X 1SN7A 1SELA 1Y4AE 2TECE 3WQBA 1C9JA 3ZXXA 1R0RE 3EIFA 5ARCA 2ID8A 1SCDA 1Y34E 2W2PA 1Y9ZA 1SUBA 1Y1KE 4NMXB 1TO1E 1SBNE 3WIVA 4YN3B 1AVTA 1WMDA 3EDYA 1PEKE 2ZRQA 1TM7E 4OMDA 1S01A 3BPSA 4K8RB 1YU6A 2Z58A 3UNXA
chains in the Genus database with same CATH superfamily
2CFOA 4RKFA 3E7FA 1XMOF 4N3CA 4F3MA 1FRLA 5LT5A 4FFPA 1B8VA 4LGCA 1NXIA 1PWEA 4HGRA 1BLUA 4CI0B 2HGSA 3RC1A 4AUKA 4KREA 2AOXA 2VG6B 4B08A 5C7PA 2W8BB 2HSDA 4YRKA 3DEIA 3PM9A 4WNAB 1W1WA 4RTRA 1X7GA 4A7PA 2Q9BA 2DWUA 1Z37A 4M5LA 3E82A 1EJ6A 1Y8QA 5FTNA 2ZOMA 3MZIA 4TS4A 4K81B 1EJ2A 3ZKAA 2QIOA 2Q8NA 3W8PA 2QA4G 2W7PA 2AFVA 2XJ4A 2B78A 2YNHA 2ZH2A 4YPVA 4DQPA 5L1KA 1KEWA 1JLQB 1TQDA 5CK4A 4PRYA 3RRFA 5HANA 4FZJA 1M90T 5A8RA 1VLJA 4DA6A 3WV4A 4B2PA 2F5GA 4NXMJ 3SSRA 3D4PA 4FBUA 4XCVA 4QVGA 1TW3A 2DNHA 3PX4A 3T5TA 1NDCA 2YNHB 3ITKA 4A5SA 1CIPA 3MF5A 5EIBC 1TRHA 4W4MA 1BOFA 4FZ3A 2UU9F 4BO6A 3W3AA 1JLQA 4KWEA 1YDEA 3VZSA 1U7WA 3MXHP 1Y3CE 1FO1A 4G1IA 1OFTA 1KU0A 1JQBA 3SE7A 4GP7A 5HVNA 3QEMB 4HZIA 2OEMA 1SKAA 3ZGXA 2EK6A 5CJ2A 3WGMA 1LRJA 2PMEA 4YMWA 1AA9A 1KH3A 3K9LA 4DMMA 3UUWA 3TX6A 2AG8A 3OPXA 2EQBA 1FA0A 4IVRA 4W5QA 1X0VA 4F3QA 2IXEA 1GKYA 3C48A 5CYOA 2XWYA 1XZIA 2WWFA 2GC8A 1S9DA 3ELYA 4M38A 4BS9A 2ZTVA 2B43A 3EG9B 4DR6B 2CD7A 5LMNJ 1XXHA 3JZAA 4ENRA 4ZEVA 2JIBA 1HW9A 3C41J 4O2AB 2YJGA 1NFRA 3OIUA 3KB1A 3O94A 3DRRA 4AJLA 3LFUA 3UJCA 4E08A 5IAJA 4DR2B 2E9ZA 4BTVA 2RGNC 4GF5A 1OE0A 2DKOA 3HGMA 2BHTA 3DW1X 4YAUA 3EAFA 3B3AA 4Q4AA 2QN6A 3RSCA 1QAOA 4HP8A 1HBNA 4X41A 1MAUA 1JH9A 2BJ7A 4IFVB 4YYZA 3FNHA 5AW0A 4D4LA 2E48A 1X4AA 5ER6A 3ZVRA 4TU9A 3T3HA 4TWJA 4F1WA 1YOBA 2H2AA 1N6QB 3LBHA 4NOJA 1U5AA 3CA8A 3B53X 1NVVR 4DZDA 4TKVA 4FT2A 4YCLA 3EVCA 4M1EA 3K9WA 3Q2OA 4A8MP 3SYKA 3DOLB 4KVGA 3ZWWA 3N3AC 3VAHA 3DFKA 1KAMA 4M1QA 1QD1A 5ETNA 1K9SA 3PIRA 1TAUA 4JI5F 1L7MA 3VSBA 4DPWA 4MKHA 5IANA 1PQUA 4LF4B 3PCXA 3OCXA 2JD2A 1OIVA 3QT7A 3FGPA 3H5VA 2J6IA 3LJKA 1FRVA 4OYLA 2CPJA 2HW8A 1TC2A 5DJ5A 5IWAF 2DBVO 3I12A 2IH2A 4F2PA 1DUVG 1S4FA 1A96A 2XUPA 1G5RA 2YN0A 3VU1A 3KOWA 4RNCA 3FHCB 2GAIA 2ZS9A 1Z4OA 3RRBA 5L3ZA 1TD9A 1A1SA 1YOVB 4EM6A 1S6OA 1BKDR 2CJ9A 2H4WA 4IJQA 3R7BA 4MQFA 1O6CA 4W8HA 2C2DA 1XA3A 2F1FA 5JRDS 1PJ5A 3SXJA 1NRKA 1EXWA 5K5EA 3WI7A 2CNOA 4FFDA 5AW3A 3M6FA 2WWVD 2ORED 3MOJB 5J4YA 2VPYA 3QO9B 4CTKA 3H1TA 4NE9C 2A0XA 3DJFA 2ZUFA 3ZE7A 3UY4A 1G7CB 4M0DA 2HMTA 2C98A 2GBFA 5A8WB 3OZRA 1QGUA 1PZFA 1V1JA 2H9ZA 5AHWA 3ZC3A 2IJNA 4QJ3A 4C3LA 1I1OA 4FZRA 1E6VB 4ZXFA 4BKRA 2ZTLA 2FUNB 3PQEA 4RW6B 1HF3A 3QA3E 2RB5A 3LHKA 5JQGF 5JH7F 1VQ4S 4TTRA 2A5GA 2FMXA 3HMJG 4GVXA 3NOCA 4EUSA 4G5OA 4IH1A 3HI9A 3ER9A 1KLMB 3GT3A 1O96B 1W2IA 4ZVLA 3C4JA 3A3OB 3IUNA 3DUFB 4NSNA 3RFCA 3ZOZA 1O94D 1NQWA 4FI3C 3E0XA 4ARCA 3V2HA 4EZBA 4FBLA 1SEPA 1T26A 3PNSA 3PA6A 2JFKA 1LDNA 5B5SA 2GRUA 2XI4A 2YC2C 1VHDA 4CMGA 3V4SA 1IVZA 1LW2A 2VH2A 4W5RA 4JI2J 4RJVA 4UQLA 5AFSA 5HYVA 1XTVA 4QU7A 5HUQA 2FCAA 4DC9A 1FTRA 1IJFB 1V9LA 1XNQJ 1GPWB 2GEDA 5H02A 4CKWB 1WMEA 2VDWB 5EJMA 2VK2A 5HK8A 1OZ0A 2O8DA 4DLSA 3K8OE 3NBPA 2DNQA 3DLBA 1T8TA 3U81A 4RNDB 3AV3A 4WWSA 3FW1A 3EFOA 1NXPA 3LUPA 3E8OA 1PJLA 1ZMBA 3AM1A 1TECE 4P7KA 5HQMA 1HWKA 2WINI 3KMSA 2IEIA 3GJQB 1ZXXA 3COWA 4ELUA 4PLCA 1Y6GA 1R74A 1PTJA 3LH5A 3T5LA 3UOWA 4MWGA 1I4DD 1OYEA 2P4UA 4O1HA 3ERCA 4R2WA 1XRSB 3OL8A 2Y66A 5FBVB 1K6EA 1JL3A 4LRUA 3WWPA 3JQAA 4K7QA 1BD3A 1H0RA 2PH3A 2QVBA 5F7XA 3HKWA 3QLHB 4JJ8A 1THTA 3GLGB 3UK7A 3RSOA 1M6VB 1P1CA 4DNPA 2PSEA 1R1DA 1SPXA 3DBOB 4AG6A 4LXGA 5D86A 3WLAA 3KSRA 1P8JA 1ZK3A 3L18A 3JAWB 2RE8A 2JAHA 1JHAA 1JJ4A 4ETWA 5LC1A 2DH6A 2WJPA 2I5JB 2H1CA 4X8LA 1IL0A 4INPA 3LP1B 1U45A 1DQSA 1ODJA 1EE1A 2IT1A 1FY2A 5H83A 1Q14A 1T1SA 3A6PC 4FCWA 2L82A 4NH0A 4G0QA 3R0ZA 2OORA 1FSSA 1E0KA 3AD7C 4HUQB 1S2GA 1UCFA 4QRIA 5A02A 4ED1A 2IHUA 5AJYA 3LF2A 2CL5A 4NZPA 1NR1A 2BBWA 3I4HX 4Q1DA 1JEQA 4NCJA 2G76A 4PSCA 4X62J 4P7GA 4P7VA 1BVRA 1N1EA 2I2DA 3DMGA 3PJDA 3WBFA 4DRYA 3UMJA 3AEKB 3K8QA 3W65A 1DIHA 1E3IA 2CCKA 3FWNA 1MOSA 1UVKA 5BN5B 3AESB 3DH0A 3TJMA 5EVCA 4V03A 1YQ9A 3T9CA 4AZWA 2NG1A 2EEZA 3M9XA 1H38A 4GVLA 1V8ZA 2FYXA 3FPKA 2OWEA 2HVZA 1JIIA 2Y6UA 3KDNA 3JAKB 3V7NA 4C0JA 2GYWA 3ACBA 5CCEA 3HTXA 1RYHA 5I4CA 5BSTA 3Q6IA 4UUBA 4LF6B 2VPWA 2C4KA 2Q3PA 4HGPA 4FE7A 2V8BA 5DBGA 1LVHA 1PVOA 2XMMA 5I3UA 2JCBA 1J1UA 2WG0A 4WNIA 1EDBA 1U1MA 3ZUGA 1YS6A 4J9SA 2V5VA 4P83A 5TQVA 5I4KA 5C2GA 2DCLA 2FPXA 1UVJA 4TV9F 3L6CA 3C8MA 1M6VA 3MJFA 3TSOA 4ZOLF 3I56S 2AJBA 2X2FA 1QIHA 1Y8AA 3P9PA 1MX3A 2GERA 3W6UA 4IZOA 4D4MA 1RLTA 3OX2A 4YREA 1T9DA 4ZPDA 2PKYX 3QXGA 4MYRA 3BV8A 3PENA 4X8OA 5EKTA 5EE1A 2A5YB 1S7IA 5SY4A 4RWZA 4OJGA 4BBZA 3DR5A 1T3OA 1MEJA 3QATA 3MEKA 5CT5A 2X1GA 3W2WB 3ADKA 4QEZA 3MLAA 2DGUA 4WU3A 5CYMB 5SZKB 3TVZA 2FX2A 3LW5C 1FJHA 2AOUB 2ZW9A 2AB0A 2XNSA 4ZO8A 1GZUA 4AY5A 2O2JA 3QPBA 3QJYA 1EP3B 3PRYA 4P34A 4DUGA 2ALZA 1LC0A 5IXYA 1JF8A 4ED2A 1GAXA 2AJTA 2GVZC 1YA8A 5JC8A 2W00A 4FDTA 3B7PA 4FIZA 1Q3TA 2ZBDA 4HF7A 3SHFA 1R4MA 4FHZA 3UCZP 2H00A 3E05A 1I6KA 3OMLA 2BVZA 1AN9A 3K5WA 1PUIA 3AF1A 3QF7A 2X7IA 3BTSA 5HTKA 4BB5A 4OXKA 5DN6A 2Z1NA 3VC2A 5KJEA 3E4CA 4O0IA 4WIIA 3R23A 3FG9A 2GYVA 3ESQA 3UT0A 1KI2A 2ZJ1A 4CM4B 5B30A 5AI9A 2PANA 2EJVA 1Z13A 3RGGA 3B1WA 4MS1B 1APBA 1J0DA 1M7HA 5U4XA 2X2EA 3LAMA 3STVA 4QDTA 4LFAJ 4MVXA 5ETVA 4QPXA 2DWQA 4LVOA 2YVLA 3ABQB 4OXYA 2F43A 4G65A 1RRGA 3HXPA 4ECRA 1WP4A 2ZZTA 5M2UA 1D9XA 1A82A 1M10A 2BVNA 1E6YA 1JXEA 4RQBA 2RAVA 4NBWA 3ND5A 4UOQA 1K8QA 3IV9A 1IR2A 4FUTA 4EB6A 1ZMXA 3COPA 4U7DA 3QHAA 3GZJA 3TBFA 1KP3A 2WTUA 4YV0A 2P9JA 4UMDA 4LE1A 1IU9A 3DOMA 1EUCB 2VNKA 5J4KA 1NATA 1RAFB 4WD3A 4GAEA 3RYCB 4PWYA 3KK1B 2WAAA 4LXHA 3MTJA 4EYOA 4ZZIA 1JMTA 1R27B 2BW2A 4CTAB 2WI8A 3DQPA 3ZD7A 1R3UA 2C0CA 3WISA 1U2GA 3RG8A 3BC1A 3G2MA 1V4BA 3VPHA 1VK8A 2L19A 1NJSA 4RPCA 4B6PA 4UBMA 4ZYYA 4S1PA 1C80A 3FTDA 4RVNA 3N7TA 4A2QA 2AN1A 1YO6A 3JTPA 1Q1GA 1NJ5A 2AOWA 1R4MB 1N1DA 3GN2A 1CLUA 3KQKA 1ZUD1 1XQXA 3EA4A 4H7JA 2ADMA 4RBUA 5EHHA 4LAFA 1E3JA 3WMRA 2OGTA 4E2ZA 2G83A 4OHPA 3RRGA 3O31A 5ENVA 1MOZA 1GPH1 3CG0A 1M2VA 2IYXA 1NKVA 2K1RA 3N5KA 4AE5A 1IJEB 1Z74A 3FMIA 1UBEA 2JIRA 1V8BA 1QVAA 3LRPA 2DY9A 2HFVA 7GPBA 4CF3A 3W0LB 3UG7A 1IULA 1WDMA 1EKSA 1T2AA 3FYTA 2X0RA 1VIYA 3VPDA 1LQUA 4CT8A 4P3PA 4J9QA 1J5EB 1USIA 3HEMA 3VDRA 1M8KA 3RUEA 3EAQA 5HCUA 1ZWKA 4BWVA 5FI0B 3CIZA 5DIFA 1Y00A 5J4LA 1J8MF 2WNHA 4JR0A 3DDHA 3MTBA 4P4SA 4OP2A 3OSUA 5GPBA 2J9YB 3PWTA 4FDVA 1FNOA 4ZV7A 3TEHB 1Z4PX 4M0LA 3A06A 4ZLPA 3W5UA 2YWEA 3D6HB 3SDEB 1LWFA 5AH0A 4A0QA 3KJVB 4HYKA 3OIFA 4AS1A 4PRLA 2O5RA 3HNOA 3ANNA 2BUNA 1U2GC 1Y82A 1KJ8A 5EC8A 2BC9A 1H2UX 3PCRB 1YJUA 3NIBA 3O4RA 4GGPA 1L4HA 5LJ3Y 4M0EA 5CFOA 4DDTA 4IFVA 1JLFB 2KBEA 1KEUA 4KTVE 2VHZA 2C2HA 1CUJA 3ET6B 4DDKA 3NS5A 4GC7A 1JGTA 2GUGA 4FS2A 1JFFB 1N5TA 1N6NA 4L3WA 2A3JA 2WZDA 3NNAA 2R65A 2JARA 3DZGA 3FNIA 4B3OB 4W9NA 3KSBC 3BAFA 1KZGB 4J6EA 3NEYA 1NMXA 4LK2A 4RMNA 3NOXA 2OCDA 4FFRA 4J1NA 1H05A 1G5PA 2AQHA 2DRIA 1ZX1A 1XD9A 2C2GA 1BDMA 4KE7A 5CHCB 4RW8A 1P75A 2R0QC 1IJEA 3OM0A 4ZRDA 4K0KB 2B1RA 3H5IA 2MR6A 5LZ7A 1D9ZA 3VSEA 1XBTA 5CVEA 3I9FA 2XLCA 4YJKA 1P44A 3EARA 3SC6A 3OOJA 3VU9B 3L1JA 2WHQA 1NUAA 2PS0A 1JDJA 2QW1A 3VJRA 1ZGZA 2HMSA 1H2VZ 1I6JA 3QEBZ 4HLDA 3LUDA 1U9IC 5SUHA 5CD1A 5HOEA 1YZ6A 3NHYA 1U1PA 4TT3D 3IKJA 3V1UA 3KDSE 2LQ8A 4EY3A 4DU7A 1I6MA 3A1DA 3PXGA 4GLJA 1GGNA 3CEJA 4ECQA 3IOBA 3SXUB 2VG5A 1KWKA 1THGA 3VQSA 2CIMA 2HU8A 3U37A 4BV2A 4J75A 4UFOA 1FKOA 2I2AA 1DKLA 3HYCA 3AR4A 4O3SA 1JQ3A 2GTHA 2RH4A 4N82A 4MRRA 2P6RA 5JBIA 1LLFA 1LK7A 3RKUA 5G02A 4PRZA 2O14A 4B4KA 4OL0A 3M4JA 4H4CA 1QVFR 2B6AB 1Y0BA 4X90A 4AU1A 3F6EX 4JC4A 1N77A 1U7DA 5GIPE 4I2PA 1J6UA 1GZHB 1NI4B 2CPIA 4R8MA 1JE0A 2BKLA 3QLVA 2FEAA 4R2KA 4R1MA 3K9GA 3EPIA 2GS8A 5A8WA 3T1YJ 2BFPA 1HBUA 2F48A 3T7KA 3ZX4A 3Q0TA 4Q2MA 1PRYA 1C7EA 1ISHA 4B33A 4PINA 3NNCA 1XFDA 4E33A 1U9IA 4DR4B 2WJ3A 4B6OA 1O87A 4R54A 3LBFA 3F9RA 2EJCA 3H42A 3T9EA 2DR8A 4FD3A 4QBIA 1RBZA 1MCZA 1XF1A 2P7IA 2ZRDA 1S2NA 1OLSA 2NM0A 3H6HA 7MHTA 1HQ2A 4BP8A 4H7HA 1KMHA 3HUDA 1SXJA 3TM5A 1XZLA 3IURA 1K86A 5F7JA 3C16B 4QYTA 2X51A 1KXJA 1RKUA 2MSLA 1HKAA 1BJTA 5AVOA 4P5DA 1T4GA 3UIEA 1XIQA 4X66J 1OYWA 1E9SA 4EATA 1BMQB 3SAJA 1DDOA 4MMOA 4EFAC 5GM2A 4F6CA 5H9EJ 1JLRA 3VQTA 3S1AB 3BRQA 3AVPA 2IQIA 2IM2A 1ZITA 4KQEA 5DLEA 4K3UA 2QTZA 1U8SA 1JSRA 3PC6A 2XD4A 1MGOA 1TGVA 1CJUC 4D41A 1A04A 5TPWA 4ZTBA 4I2PB 3PDWA 1OGIA 1PQWA 1YMQA 2IDMA 5ETSA 4YRSA 3IHLA 4MUJA 1KSGA 4L3OA 2ZRJA 4NEHB 1Y6ZA 3LXUX 2N3LA 1GFWA 5BYAA 2FGKA 1GILA 4YVFA 1IQZA 1SB6A 2WVDA 4U7TB 5A2GA 4L4ZA 4M8LA 3QU4A 1C9YA 1WDLA 3LY9A 1FPQA 3DZ8A 5DTIA 3FWKA 2ZRGA 4KAIA 2G1AA 2N4DA 3ZN2A 1N4LA 1EZZA 1RJDA 3QEAZ 4F8YA 2J59A 5J1EB 3F6YA 1KXZA 3AR9A 4G0PA 3OWOA 2AJFE 2NO1A 3QHQA 1U3DA 5HKOA 5IJ9A 3TNYA 5ANRB 3NKYA 2BZ0A 1YKWA 2VLBA 5AHXA 2YZMA 4LDJA 1QJHA 3TVDA 2CNLA 1V71A 1C1DB 2CQ2A 1HNVB 2O8VA 1K66A 1NM5A 2G72A 4B3GA 3OP4A 4A6XA 1TUVA 1XTRA 2HO5A 3TSCA 2PMWB 5CX1A 5BUZA 3UHAA 1JSZA 4P98A 4YHHJ 1HNXJ 2AJ1A 1VCIA 2BM0A 2QLJA 3ZCSA 3WLKX 1DEXA 5EUQB 5LWHA 1H7XA 1L8XA 3MEGB 4MUIA 1QPGA 5EXXA 4OKSA 4X6YA 4G0VA 2W2LD 2PU5A 2AIRA 4KIJA 5JMPA 5IH7A 1ZYUA 1CDZA 1OH5A 1Q7TA 4ZODA 2ZBQA 1UJCA 2KYRA 3FFAA 5KYYA 3QX3A 3MI7X 1P60A 3OPKA 1RYDA 4JCCA 3VAYA 2BFCB 3RC9A 3NGDA 3GGJA 1X3LA 1QF6A 1MORA 1Z0SA 2AX3A 4QFMA 1PG5A 4MGIR 4P80A 3BJEA 3H2KA 4BQIA 4AIRA 3USES 5ARCA 5FFFA 3K7RA 3I2KA 5CFZA 4C08A 4PO1A 1G42A 3I1YA 3THWB 3RVKA 2WSBA 3JD0A 4LGYA 4P3YA 4U7WA 1RWVB 2ZH7A 4P54A 1IN0A 2ZUBA 5JS7A 4GO1A 1JXOA 4BL5A 5JV5A 1M7GA 4KX3A 1U1QA 4C7QA 1NDHA 3FDZA 4PYDA 1P9WA 2KJQA 1OPIA 4CZ2A 4NX2A 5KAPA 5HQJA 3GIRA 1T9GS 2XNDD 2DULA 2JFZA 2R48A 3SZ3A 2DBRA 2P9CA 1P4HA 5T7BA 3O7MA 2R8HA 1QHEA 2F40A 4WRRA 1DEKA 3FGNA 5F41A 5LFAA 2RB4A 3AY3A 1E89A 3HFKA 3HKBB 3QOYA 1W4RA 1JUDA 1E1QA 3DHWC 4DOZA 3LV8A 3HFVA 4CN9A 4XA8A 5FTWA 2WJVA 4WOJA 5F78A 5EG5A 3OF2A 4NCKA 3Q8QB 1XQVA 3F0TA 3LX4A 1TU0A 4HJXA 2PT6A 5AW1A 3WRYC 2BKXA 3ND6A 1EIZA 1ELOA 3PU6A 2FXVA 3AOBA 3PCTA 2FFBA 4DAOA 3T9ZA 4C5CA 2WICA 5ITZB 2BMVA 3WMEA 1T7PA 1Z4NA 1TV6A 1RT1B 1MIHA 3T0IA 4MPJA 3AJ1A 5CFLA 3V4ZA 3RS4A 2VXBA 3GFBA 2C2KB 3PW7A 2K7KA 1LNQA 4NRTA 3AG6A 4QREA 2QWXA 1H66A 1NVAA 1NLYA 3V8PA 1RTDB 4JNCA 5K05A 1U1GA 4FS1A 2EW8A 5ALOA 1WX1A 1SC6A 1EX8A 1SUSA 5LQAA 2Q1TA 1NTOA 3GRAA 1P1TA 3PP8A 1UJ4A 3NHMA 1KERA 4X71A 2GO7A 721PA 1BGVA 3QVSA 2O2ZA 3L4SO 2RGGA 3ZVLA 3BXEA 5CVDA 5MAOA 1AZWA 4EA6A 2BHSA 3BCSA 5JEDA 2VF8A 5LP6F 3CVJA 4A0SA 5AKJA 4Q1VA 2LEPA 3KZ1E 2J87A 3PFGA 1XJCA 3U9SA 4IRUB 3EC2A 3LF1A 4WBFA 1JW9B 2JHCA 1LW6E 1DQ9A 5C1DA 3C3AA 4RTKA 3H65A 1RQ0A 3CE9A 2PUVA 3SFTA 4FPIA 5B3AA 4TSRA 4U7UK 1AA1B 4E4TA 2EFHB 3Q85A 1SK8A 4CM9A 5I3ZA 1TCCA 4Q4AB 4B46A 1YNSA 3IS9A 4Q39A 5LXRA 5K6AA 2EG2A 5GWXA 2B9XA 2Z3VA 2OYRA 3O3MB 2YXDA 3QU2A 4XI9A 5AQEA 3PGVA 2W4DA 2PXXA 4D0NA 2FIUA 3GJRA 2JDJA 4N3BA 3IJPA 3DEYX 4CKBB 1XDWA 2B94A 3FHLA 2XLIA 1S8AA 2XUDA 4NIMA 3A1SA 1KLNA 4YAIA 2QTVA 2LU2A 4BQOA 3TZLA 4CG0A 5H3HA 3ZDYB 2UKDA 2HRBA 4B74A 4DM3A 3L07A 4GC6A 3FVRA 3B1YA 1K7EB 5KFDA 4Z4HA 4DL9A 4WKBA 3FOAA 2WWYA 5FUVA 4BNTA 2O3RA 2B6NA 1RMYA 3G8BA 4NARA 2ZIEA 5CPBA 4YO8A 3BBBA 4X3OA 4NU0A 2ONJA 2W4MA 5ARBA 4WK6A 4LXTA 2PS9A 4RR5A 2R7WA 4FFBA 5IEBA 4GWKA 4AP5A 3MLBA 3CEPB 1WWHA 3W9YA 5IABA 3K15A 4GUDA 3OBBA 2C2NA 1G9SA 4YAKA 2F67A 3U1NA 3G87A 1N32B 1DEAA 4BZZA 2PZGA 1GAJA 3IBFB 4QBUA 4Y6PA 5DDPC 3OUUA 5DHQA 1FUYB 1P74A 1Z5NA 4FFBB 1TAGA 3V33A 1A1VA 2TSYB 5H68A 4Q2LA 4UBOA 4XX1A 1VQPS 3H75A 3R5SA 2ZJOA 1NT4A 4QNRA 3TPFA 1XZHA 4DX5A 4L5CA 4RL6A 3VZHA 2P9FA 2C77A 1GTHA 4KCGA 1LLDA 1EWKA 3JRXA 4CV1A 2CQGA 2DEJA 3MSCA 4IMRA 1UDXA 3HHNB 5JROA 5KVSA 3RSHA 1JQKA 4KO2S 1WPRA 3OKFA 3BA6A 4U1RA 3NM4A 3IGNA 3AI1A 3MS2A 2QLTA 4JX9A 3AJAA 4B8WA 1VGQA 3CF4A 4JUBA 2VUHB 4UTGA 5EP1A 3B85A 5IS2A 2FWIA 1CNEA 3N1UA 3WBBA 4ZT7A 1J0XO 5EP3A 4F9TA 3LP8A 3G2NA 2YY5A 2BGJA 2CCJA 2GK3A 1A7UA 5JS2A 1OBHA 3NHSA 1RU3A 2O50A 5D4OA 2X0IA 2R6ZA 2NQ2C 3DZKA 4WK3A 4ED0A 4C3MA 5JXJA 1OROA 5KYNA 2AXQA 3CC7S 3C39A 5TARA 1G7CA 1E61A 4PC1A 3P32A 1NXTA 3Q3JB 4WOPA 3MGAA 4EIWA 3ZZOA 5DLGA 4RWXA 2X6TA 4JZYA 1HQEA 2AFHA 1RLOA 1WD7A 5JJLA 3CRQA 2D9OA 5A05A 4MPDA 4GI7A 1E6CA 1C3XA 1Y9AA 5K7SA 1P6TA 3TOSA 1UPFA 2OO5A 4DG1B 3NDBB 1Z2PX 2ZYUX 1ULRA 3UO0A 4EO9A 1VIMA 2QS9A 3WP1B 4QBKA 3SFVA 1W34A 5DOVA 1REQB 2R5NA 2VQFJ 3DUFA 3RSZA 1YBHA 2VHGA 4NS4A 5E41A 1BEZA 4BYGA 2AJCA 3MEQA 3ETDA 3G8QA 4LFAF 4G24A 1YQTA 3UHFA 3ILYA 2EJTA 1GA1A 2Q3HA 1ULUA 3AW8A 2SCUA 2J6TA 3CD0A 2YZNA 2PGOA 2Q3FA 3BICA 1HM5A 3CCCA 3H18A 1Q1KA 1FNSA 2VYND 1QAXA 3D3EA 1NQTA 1QKIA 1RXWA 3RFXA 3SS7X 2H7YA 3FEYB 4FDUA 2XULA 1CU1A 2Z8XA 4C20A 1CQNA 4XQEA 4M8NE 4RM3A 2CUTA 1MR3F 4PAAA 3PITA 3UTDA 2RHGB 5J1TB 4NQZA 4DIEA 2HV8A 3O2QB 1W7AA 1MZVA 3IO1A 3FKSA 3O4FA 3PS9A 3ZNJ1 1NW9B 2YWXA 4LIPD 5B08A 2NNLD 3QXJA 2QVGA 2IJGX 3MMPA 3OL7A 5GY7A 2A67A 3U80A 4G3XA 1DFDA 4JWKA 2RONA 3DDSA 4UDYX 3AR7A 3TTSA 3HBLA 5ETQA 4K6MA 1NQXA 4IQ4A 3SE0A 1GTJ1 3K7EA 1GFWB 3EXFA 1JJHA 3A10A 3RLIA 4JP1A 2RI6A 4M0CA 4OB6A 4R01A 4TZTA 4BHQA 4PZLA 1KMHB 1BC6A 4XD7A 3PQFA 4LDPA 3K5HA 4WADA 3JQDA 2BLNA 2NACA 3M8WA 3EH1A 4LRAA 3C87A 4DV1J 1L4BA 1HLGA 1VJGA 1MB4A 2Q7OE 4BLOA 4UTXA 4QGGA 4J0JA 1XZCA 3AAWB 4O4IB 1SWVA 4ZRMA 2NSCA 1MLDA 4XDZA 1QRDA 3KJQA 1VQMS 1N5JA 2RH5A 4TXMA 4A8YA 3OJLA 4X65F 4DR7J 3JWEA 2V2ZA 5KVAA 5KFSA 5CFPA 5B53A 2QRRA 2WSFC 4S12A 3K5IA 3QX9A 2GN1A 3IDSA 3C1UA 4DR5J 2WHOA 3ZY6A 2CZGA 3GG9A 5D4NA 2PVSA 1RCXB 1XWIA 4QTYA 4Q1CA 2VI5A 3NXZA 4Q7JB 2GD2A 3PYDA 4CJXA 3G5AA 1ZMOA 3UJDA 2FRDC 3RIGA 1M1YA 1XZPA 2NZ2A 3W8NA 1RAAB 4LXXA 3ZUPA 2BE9A 2QLLA 1QRTA 5DNEA 3KR2A 1HPZB 1KI6A 5HMMA 4X4NA 4EW3A 1TK3A 2EFCB 4HYQA 2Q27A 5KYYB 2AUNA 3F0NA 1WKJA 3BRSA 4QIFA 4DLGA 1EGVB 5BQ3A 1J5EF 5AI4A 3EWGA 3PJEA 1BTOA 3IEKA 3PJFA 2J6UA 1AD2A 5LMUB 1WG4A 4AX4A 1ZSNA 1WULS 1MAVA 1OI3A 2Q2VA 1NMEA 4BFZA 1PWXA 5DBOA 1ZVJA 2GFQA 2HBYB 4XRGA 1S1XB 4YAGA 2B5JB 2FY8A 4HFMA 4D3FA 3SEAA 4I67A 3SP1A 3OHBA 3H11A 1CJSA 2XBPA 2Y67A 4L27A 3CLKA 3LK6A 4LJAA 2SKDA 4WQMA 5KQMA 4GOND 5KYWA 3R3TA 4ZV9A 4RIGA 2ZIGA 2GZDA 3JQ6A 3SOPA 2PT0A 2R11A 1YBTA 4TQAA 3G0IA 4JQZA 3DC2A 4YK7A 4QYMA 1P17A 1U8CB 1OY8A 4R51A 3KQUA 5IC4A 3ZHXA 1M2GA 4HEA6 4DDWA 3LUJA 1TL3B 3IOEA 2REXB 4WLUA 5AOAA 4W8OA 4KQ2A 2I62A 2R4UA 1BH6A 5DETA 3UJNA 3WYFA 4JWTA 4OKNA 1MBZA 4C22A 2A8YA 2KJWA 3E03A 2BI8A 1GDTA 2GK6A 3KV3O 3PNLA 3TUJC 2VAMA 3LQ4A 3U6BA 2QTRA 3SCZA 1HPZA 5AE3A 2X7HA 4BP9A 2XXJA 3JD1A 1Z2AA 2P9TA 1I4LD 2UZ1A 3QVUA 1P0IA 1ZH4A 1U1LA 2H2GA 1ISIA 2EFOA 1RQ7A 2GTPA 4M1YA 4Z1MD 1TJPB 1UP6A 5DASA 1EM8A 4GLLA 1IBLB 3QU7A 3FCVA 2DFDA 2A9OA 1I94B 1GGJA 4C29A 1IN8A 2RHQB 4KSBA 5IV3A 3QVOA 3IHWA 5JCJD 2JFXA 1F9AA 3WBJA 2EGHA 1N9ZA 3AINA 5DWQA 3MUEA 1DLJA 3NVKI 4ER0A 2TRSB 5E4JA 3K6JA 2YV4A 1T0TV 2J6HA 3CONA 4PZUA 3IAHA 4WE3A 4PQFA 4UHEA 2YXEA 4ZLJA 1QFYA 1NY5A 3J81j 2IE8A 1KKUA 2WCXA 5FDLA 2UXCF 2RK3A 2XKAA 4HDMB 4L8VA 4G3IA 2Y68A 1FD2A 3RBXA 2AL7A 1FJCA 2F43B 1KEKA 4ANEA 2PX8A 1VL5A 3TCXB 3INGA 1OFVA 3WBZA 4AP6A 2QE7D 4RANA 1FKAF 1BIFA 2C97A 2LNDA 2DKOB 1YJWS 1PFVA 2OG2A 2KZMA 2IYRA 5ICSA 1KNZA 5AXNA 4H17A 3WTBA 3AV0B 2DXEA 1Q20A 1RJJA 1U49A 2ZXEA 5HL7Q 3E01A 4FYHA 3EGCA 3CCMS 1L4LA 3EWAA 2IELA 3MUVP 1SIUA 5F9MA 2OCYC 1O58A 4BU1A 4F85A 1Y8CA 3ITEA 2A6MA 2C28A 3UC9A 5JUWA 3IR6B 4ZYZA 4ZC1A 1G20A 4NQRA 2E1PA 2ZGVA 3EBOA 3U09A 4HKQA 3EGDB 1T35A 3K9NA 3ZWMA 2P8SA 3IXMA 5ESWA 4I4TF 2Q2NA 2NR0A 3LSYA 1EXNA 1P2VA 1QCYA 3I23A 3T7TA 4GWLA 1XA0A 9LDBA 2QTVB 3CZMA 5ADHA 1PFKA 2D2VA 2E4ZA 3IA0A 2N1BA 4JYBA 3TARA 3EW9A 4CL3A 3NBFA 2A2ZA 4ZOLB 2H5JB 2B4QA 2Z0MA 4K0KJ 4F5YA 3MPOA 5ALRA 3T6KA 4PX3A 3LTOA 3FFTA 1IM4A 4FR0A 1ZESA 4UE3S 4MJXA 4ID9A 2XDYA 1R6YA 2MKYA 3CZ5A 3D6HA 2H5JA 2HRDA 5IAGA 2VHYA 1G5QA 2NZYA 2P9HA 1SWWA 4XASA 3OP1A 2RT3A 2M2IA 1S3SA 1OQ3A 2HIMA 1HG1A 2ATIA 5SY9A 4ZDWA 2O8FB 1SCAA 1TTPB 4AWXA 1ZNWA 2IHKA 1GQSA 3KMQA 3LPMA 5A7GA 4XAQA 3CD6S 2YKNB 1G1XA 1XKTA 3L0CA 3V81B 1PDWA 1WOYA 5DMHA 4KR6A 4DMLA 3UW1A 3UMCA 1E1RA 1W44A 2Q62A 3H7HB 1IXYA 3K3PA 5A4FS 3L3BA 3ITDA 5FHRA 5FPQA 1RRVA 1L1RA 1JTFA 4HDSA 4MUHA 1DJ0A 4DSZA 1CNFA 1JEAA 5CMLA 4J9VA 3PGLA 5KNCA 4WY8A 1S3IA 4NBTA 1ZCFA 1S8FA 5LIRA 1QVZA 2QT1A 3NDRA 3R4CA 4MITA 2FLPA 2WP0A 4I9FA 4XM1A 4X95A 4OI2A 3TZCA 1W2GA 2HGNA 3UJBA 1NZJA 5MFPA 2RK6A 3TIGA 4C2UA 3CSDA 3BH7A 1PVDA 3EIEA 2R2RA 2W6NA 3ZE2B 5KTNA 3BDIA 5KAKA 5DHPA 3UB2A 2I38A 2J3KA 4WZBB 1CUGA 2ZXUA 2IHYA 4M5IA 2PD6A 4KXFB 2XNCA 4OZ2A 1ZH5A 1T6BY 1JX4A 1IUPA 1KHTA 1JXMA 1XYVA 1GJRA 4OYXA 5KO2A 4D8YA 1U2RA 4UFNA 4W6QA 3NRCA 5JNSA 2WWIA 4MGKR 1PU2A 1QCDA 4XYEA 1VLHA 3HVJA 2X0JA 3HJRA 5GADI 2XE4A 4Y8VA 2F8HA 2ZBPA 3CW2C 5KHOC 3PFIA 2VPPA 3G6KA 2HRTA 4BWJA 1RM4A 3ST7A 1SBHA 3MWJA 5JU6A 5CGQB 2CD9A 3TR5A 3VYSB 4XB2A 5ILQA 2HIGA 2VCYA 5KTQA 4J4HA 2A5DA 4TN1A 3C14B 4X1YB 4CP5A 1LDEA 3IMGA 5EFZA 4BBYA 1QHHB 2C0PA 3GFVA 2W2MP 1YDLA 5I9MA 5EZSA 3OWXA 2QI9F 4FKZA 1G291 5C9ZA 4JJ6A 1CERA 2ZE5A 1H0KA 4BRUA 4UU8A 1SA0A 4Y6RA 1WUUA 2JBHA 3ZU6A 3HNPA 5DBIA 2HHHF 2JZ5A 1SC4A 2YNIB 5BSGA 1MVNA 2MJLA 4B1FA 2IS2A 2MYTA 5D4PA 3LO8A 1IBMB 1E1CB 4FYDA 1OV6A 3JY6A 1KFKB 4D0RA 1CE8A 2ZR7A 3RJTA 3WJ7A 1WC5A 2JGEA 2D74B 3AG5A 2PL1A 2AQIA 4EB0A 2HFJA 4KQIA 2HRRA 4DS3A 2YDXA 4EDFA 2QRLA 2SECE 4B3IA 1VRQC 4E2FB 1ECFA 2P6PA 1Z2DA 4G5QA 4EA7A 2NSHA 1Z15A 2F2TA 3D3WB 2XG8A 5FL7D 4WK2B 1EDDA 4FOPA 2ZCVA 4NMLA 1NZ8A 2B98A 2CYYA 2PX4A 4M22A 3BIWA 1CYEA 1IY8A 3B3FA 4C2MA 5TPZA 4KI7A 1BKYA 1G8YA 4ENVA 1X92A 4PEOA 3R5DA 1C0PA 4BCAA 4RXUA 5HRAA 4RY9A 1ETUA 1T24A 2C58A 2HB6A 2VPZA 2WM9B 2AQKA 1M1KT 3W78A 3HBMA 1EX1A 3CISA 4TLEA 3DTNA 4QQFA 1QNFA 4DQSA 2NXCA 3AKCA 3LIIA 2ILYA 4NOLA 4PFJA 3IPAA 3TAPA 5MGBA 5C52B 1US8A 2BUAA 2QJFA 1RI2A 2MHEA 3V6KA 1KVJA 4X85A 1NCLA 2Y05A 1C8KA 3P2EA 1WDTA 1NK8A 1J0EA 3S6EA 4QGAA 4OQMA 1ZRSA 1XMPA 3DEHA 4IILA 2OP0A 5LM7E 1EWQA 2XNRA 4DTCA 4V0SA 3UAXA 1BMQA 1PV2A 3C7KA 4R0JA 5JSZA 1RT5B 1GUBA 4ZPTR 5HF8A 4CCWA 3KOZA 2AN4A 4ZP7A 3EXG2 3KQMA 5CAAA 1DTTB 3DCNA 3BGIA 1Q17A 2UZAA 2DNOA 4QIHA 3UMSA 3LP5A 4H77A 3FYUB 5HROA 3V1MA 3AJDA 2O2YA 4RW9B 4A73A 3OC0A 1YJVA 2V8HA 4URZR 1SU8A 2FQYA 3AI7A 2ZATA 1VE6A 4A8TA 1UWCA 3N8KA 4WY5A 1X60A 4LF4F 1E4EA 3M2RA 1KVRA 3GU0A 1KEVA 4KFBA 3MCOA 3RH0A 2MJUA 5D5HA 2V94A 3FFIA 4I68A 2PUBA 3VC1A 3W5AA 2WTMA 4C0AC 3PXXA 4RVSA 1XX6A 3V6DA 4UBNA 2BMBA 2PJUA 2RJZA 2V7QA 1SKYB 2JKYA 3BX1A 2Q43A 3KLOA 1G7RA 3LRXA 1NQUA 1HQUA 4L0CA 3PX2A 4HXGA 4TV8F 2X8WA 3KSDO 2PGNA 2FP3A 5HVHA 4OBBA 1DMRA 2GQ0A 2Z56B 4ZTUB 5BV1A 2X40A 3KEGA 4I6EA 1GCGA 3TEGA 2JHGA 5DPMA 3TLKA 2ZI4A 4RHFA 1GNTA 1ZPVA 1WF3A 5EJ7A 2CFXA 4Z99A 3GEPA 4M60A 4P1ZA 1TUGB 3JAMU 3D31A 4IIGA 4PTZA 3EYAA 1NSQA 4HGQA 4YRMA 3F6BX 2ONYA 3DL7A 4S0XA 4EK9A 3VFDA 4YQFA 4ILMA 5U9CA 5GADl 2DTXA 4OM7A 1L4KA 3L7YA 1UK7A 2J6SA 4KXQA 4KK3A 4ND5A 2NGRA 1ABFA 5CA1B 1TUGA 3EIFA 1FVXA 3GY0A 3K9FC 4FM9A 4USIA 1W9MA 4O4LA 4QQRA 4BWMA 4DSNA 5BSEA 1AUSL 2O6HA 2JEJA 2Z2IA 2JLYA 1PV4A 1BCRB 4G1CA 1EU1A 5CCMA 2K7FA 1GYQA 3HFZB 3LZCA 2AJQA 3ZC4A 3S8SA 1HHTP 5ESRA 1L6RA 1U0BB 3QBCA 2C54A 3M2RB 2PNJA 1VPWA 4JI0F 4IGKA 3FIJA 1XI2A 4XYMA 1KD1T 2R97A 4I6AA 4WP8A 2ABWA 5CYPA 2ZR9A 5BMVA 4CM5A 3H5OA 5KQPA 4QPZA 1QR2A 1VCHA 3M6LA 1SBIA 4UU0A 2BYTA 4J9LA 1ZH2A 5BRJA 4CLOB 2O3UA 1L5QA 5IJXA 2Q6LA 3LO3A 3PV8A 3NC4A 1WB9A 3Q7QA 4P84A 3F3YA 1QGDA 2IJRA 5I48A 1WAMA 4JLSA 4D0LB 3I2GA 4MV5A 3KK1A 5CQGA 2FJWA 4ER3A 4PZCA 2W42A 2E9TA 5IT9U 4QT0A 4LUBA 1JFVA 4G97A 4CUKA 3SCJE 4R98A 4MIAA 5AD1A 4ZA1A 4MIOA 2C5GA 2J4FA 3EJ6A 2L41A 3K4QA 2F1RA 1DG3A 1QIMA 2R4TA 4FGWA 1YITS 3TIIA 2A0YA 2UVVA 2NZVG 3AYXB 2B2NA 2Y92A 3QJ5A 3ANMA 4MGHA 3K89A 1Q0TA 3E22B 5I4MA 4NXMF 2I6TA 3EZ7A 4BKUA 5ETTA 2CF5A 1BXRA 1W75A 1C4XA 2QY6A 1EUDA 2I3GA 3ZWVA 3I5XA 3M1IA 3DLKB 4CR8A 4DM7A 1M8JA 2RBGA 1GZ6A 3DE3X 5DEIA 4UTRA 2EZ9A 3C7AA 3L7OA 1FFBA 3I76A 2JIQA 4R8SA 5JXWA 4GMDA 4A46A 2BH2A 1TV6B 1OZGA 4DV5F 2X13A 2BEKA 1OPXA 4ZVSA 4EG4A 4UXHA 4F67A 3EB9A 4MKAA 4RBVA 1KY2A 5KTRA 3OSZA 1Z6XA 2ZVJA 2H2IA 1UH5A 3SHQA 2OFGX 4FSDA 4ZOLA 2W9BA 5DI3A 3ZVKA 1QTMA 3KVYA 3WYNA 1P7CA 4XJXA 1VL8A 2KQUA 4QDOA 3CF6R 1EJ7L 1WSDA 4CW7A 4QYRA 5UKDA 1FJGJ 2P69A 1ZSVA 6ABPA 3KUKA 5C7LO 3L77A 2GA9A 3RTEA 3GE9A 5I45A 2VXYA 1YS7A 5KOYA 4Y7DA 3S1LA 3ZYZA 3R6GA 2YVUA 3G2XA 4B83A 1NPRA 2LDYA 2RK4A 1D4AA 4HMPA 1VI6A 3ZCUA 2J7WA 3W3AD 2XY6A 2OV6A 3M32A 3PC8A 2MGZB 3SKXA 4EPRA 5CLGA 2HQIA 1YULA 4HNAB 2CXUA 1M8GA 3Q6MA 3I5AA 4DSJA 1GGHA 1WJGA 421PA 3AF6A 4Y6QA 4GSLA 4HEJA 4MKIA 2I1QA 4ETNA 4P32A 4MJKA 2GF2A 5LA6B 1JSXA 3D6MB 3S1TA 1C1XB 1RHKA 3PW5A 1FS5A 4J1TA 5LSLA 5GJVC 3QBVA 2I7CA 4ON9A 5SICE 1V6SA 4GXNA 5DIZA 3N2EA 4R8KA 4JI7B 4QWBA 1C8LA 4ANCA 2MMGA 3MF4A 1NJXA 2V96A 3OX1A 2PZMA 1JHZA 2WVCA 1V11A 4WKGA 3FD8A 5I3QA 5H4GA 1JQEA 2JKVA 4MIWA 1N5IA 3GR0A 3QRQA 3G0OA 1USVA 3ESZA 2OSRA 3NETA 1QFXA 2VT2A 5BR8F 1BFDA 2E2WA 1QOZA 5MN5A 3CCLS 4V0LA 3NZEA 5HIAA 3TF5A 4NF2A 1MRNA 1I0IA 2XE6A 2V2VA 3DOJA 3RTGA 1M2FA 3ILXA 5B0GA 1EHYA 3R7SA 3ORYA 5EMJA 4RVDA 4Z3OA 1E60A 4EITA 3RRKA 1YB5A 1LCIA 3B1JA 2P3SA 4EJSA 2PBFA 3AI3A 4WK0B 3TH5A 2ZSDA 3ZDQA 1FB5A 2VPXA 2NVOA 3FZYA 1NBMD 4KRWA 1JAHA 2DFPA 3D1QA 2HA6A 2JIOA 2W8ZA 4KR0B 2HJHA 3ZXYA 5HOQA 2FPHX 2ZEJA 4GM4A 1FX0B 4JUIA 3EOAI 3GC6A 3HUTA 1GGMA 4GOMD 5FDFA 4F4YA 1EMDA 3HADA 4A8JB 5DRKA 2OZLB 1M5RA 4GRAA 4X1KA 2GVZA 2FSGA 1GU0A 1PTKA 1XLUA 4AJJA 4EJ6A 1WZUA 3T7EA 2X5KO 1CJVC 3KR9A 1AROP 3WRYA 1G8MA 2Z6AA 2CFCA 2Q5JA 4KIUA 5CFRA 4D25A 2FHKA 1J20A 1LPSA 2IIBA 2DC1A 2F1KA 1AHIA 3MWEB 1QIIA 5LJ5Y 4MINA 4UTPA 3CLTD 4IQXA 2X86A 4A10A 2ZUSA 4UY8T 2WYIA 2ILZA 3MOGA 3BYZA 4OXNA 1XZNA 5FWXA 2VTBA 1TQ4A 2EFGA 2V7QD 4EG3A 1OXVA 1XAIA 2NVUA 5EE0A 2NU7B 3AWIA 4RMJA 1OYOA 1Y3DE 2CVEA 4Y2SA 2E21A 5BNTA 4DB2A 1X1TA 1N2CA 1CLFA 1F8UA 1RP1A 2YJNA 2LXNA 4DL5A 2W4QA 1ZQ1A 4ARUA 3T1QA 3G17A 1FNBA 2WRMA 1CTQA 1PJQA 3LX8A 1JEOA 2CLIB 3VMFA 3QKUA 4JJZA 1PC4A 2QAGA 2YVKA 5KKCA 2WW4A 4RULA 1OT3A 2PT7A 4DQXA 3DVQX 2VG5B 2G7ZA 1WHSB 4OF4A 2CCGA 3HCOA 2JA1A 4UUQA 3R5FA 4DF8A 7YASA 2DGDA 4TTIA 2GHPA 6REQB 1SOUA 1GFZA 2PXAA 3AYZB 5DP2A 2Z95A 1RSZA 1NHGA 2BZSA 4AW9A 1KFDA 3N9IA 3OPNA 2DFKB 3DWEX 5IJWA 1ESCA 3UDEA 1C5KA 3A58B 4XIGS 1HQYE 1XQWA 2W24A 1ZSYA 4UBJA 4WK4B 2BRUC 1N6HA 1M1ZA 1XCBA 2PFKA 3SLRA 4TV9A 2YVSA 3RSLA 2G2ZA 4NE2A 3ZE8A 2CPZA 2OT3B 3RADC 3L4KA 5E7QA 3T61A 4HMQA 1Y4UA 1XVTA 3IUEA 2VYVA 3QE2A 4BMZA 3U1TA 5LOVB 4IG9A 4OK3A 1NNSA 3NL0A 2I6GA 1T0JB 1J5PA 2GBGA 1MVOA 1E99A 3SLGA 5JPDA 3KKLA 1X77A 4ENTA 3BKXA 2WFMA 5AM0A 3TX8A 2J32A 3CEAA 1SQGA 3X2SA 1N0WA 2P79A 1Y7TA 2GGSA 3OLVA 3EX7C 4R1TA 2OQRA 3KLGB 3E15A 1UFOA 4D02A 1EQ2A 4GKJB 3IVMA 1HDIA 4XQ9A 4IDCA 2NUUG 1ZEMA 3DE6X 1F2VA 3HJCA 4DPOA 3OQBA 4CKEB 4HVLA 5CDFE 4XDGA 4L6CA 1W6RA 3IQDB 3UC5A 5JSZB 2CZQA 2PUGA 5BSWA 5L3QB 1E8NA 3QT5A 5AXKA 2CLHB 3W5IA 1KNQA 3D3KA 5D7BA 3N79A 1PQYA 1N5QA 2R8XA 2DQZA 3AEKA 3BHJA 4LXQA 2IBOA 5AJHA 2IXBA 2DTEA 4XFKA 1OWOA 3BD7A 4WP9A 5AKHA 4AF6A 2CUYA 1VKJA 2DECA 2JVIA 5J43A 3IAS1 1JMKC 3TQEA 3BGSA 4FT4A 2AYZA 5C34B 5K8NA 4GL2A 2FR1A 1U0FA 4IWYA 2Z2ZA 1WV1A 2W2PP 1YH3A 2QJOA 4IFYB 3SJAA 1FX2A 1LI7A 2YNMD 3B8EA 4C4XA 1IWPB 1PC5A 1U0TA 4IWXA 1UDWA 3GROA 1JJFA 3A4LA 4G9GA 4ZJOA 5KFVA 1D9FA 1GU7A 5F7ZA 2BFMA 3S2EA 2XMSA 1A5ZA 4OHKA 3HPRA 4W99A 1XR6A 3QELA 3NYWA 3I96A 1KTQA 2OXFA 4LVNA 5DO9A 1V48A 1DKMA 4AROA 1NK6A 2PLNA 1KIMA 2HDOA 1V37A 5DP1A 1JJVA 1KJZA 5IM0B 3O2JA 3DEFA 2WABA 5A62A 2H52A 5AM4A 4NYIR 1UBNA 2RIJA 2JIZA 4H7EA 4HN9A 4PNZA 4C8LA 5EHQA 2FVYA 4LF6J 2AFRA 4QJ4A 2KB0A 2IAJA 1A2BA 2WZ1A 3EFHA 3OZBA 4YXWD 5HRUA 4EKYA 4KO3S 3UEOA 4Y2KA 4OI4A 3IERA 1FTGA 3FOEC 4JI1J 3RR2A 4ITUA 4JBIA 3QBJA 2BR3A 3LGNA 4N5IX 2ZQ5A 1P77A 4ZEOA 3H5LA 4IDHA 5IUKC 2HVDA 1U94A 1YI2S 1EFLA 2DXIA 1CUFA 2AZDA 2BGUA 3PR3A 5KT2A 4HGYA 2QLJB 1J97A 3ROZA 2R85A 1WVIA 1MROA 3ZIAD 3MMCB 5KFGA 3OKCA 4E5MA 4BX9A 4I4BA 1V26A 1LWNA 3I0NA 2P6MA 3NIWA 4YUDA 3SDSA 3BD6A 1T0PA 3UNGC 3CCJS 3P5SA 3ZLVA 1Z0KA 3RB4A 1Y3IA 3FHTA 3KKZA 1M1UA 1DG9A 1JEYA 4IKEA 4E09A 4OZNA 4HTFA 2JFWA 2GW8A 3SSMA 3FVYA 1JWLA 3AEZA 3Q7IA 5LPNA 3RCBA 5HK4A 4Q9AA 1ZCAA 2CK3D 2BFEA 4BXOB 3CJ4A 1WDKA 4B8YA 4BVKA 1T9GR 4N8SA 3ISZA 4MZXA 1LV7A 2R7XA 1M0EA 4DG8A 2ACWA 3LCUA 3M6IA 3DE1X 1YHNA 3VZQA 2WJZB 3ZIUA 2RSLA 1NSTA 2JPDA 2WJWA 2X8JB 2WTBA 1G55A 4AJ2A 1GTZA 5LNK6 1CJTA 2AH5A 4IJ6A 4D4JA 3NGTA 4OJ3A 1EYZA 4ARZB 3HFGA 5E9QA 1DKUA 4RFVA 4Y9UA 5KFIA 4WWHA 1Q1ZA 4O63O 3R5BA 4CM6A 1G38A 3VHQA 3AKEA 2GSWA 4R84A 3TGWA 3OMWA 1PO7A 2QYHA 1NXWA 1RHUB 1MABB 3O47A 5KNBA 4GE0A 3JTMA 5PNTA 1EFUA 2R2AA 3DKIA 4JUCA 3BXZA 3E01B 2HWTA 3M9WA 5KDOA 3H1AA 4LCJA 1E6YB 3P8ZA 3DEJA 1ZHOA 3FAKA 1L7XA 3ZI7A 1OY1A 4N5MA 4K3VA 4HL9A 2PD1A 1ZNXA 1ZA2A 1XEFA 2P2YA 3B2NA 3AY0A 1VLOA 4Q7MB 4IR9A 3OZVA 2UZ3A 4I3GA 1TU0B 3AR3A 5JCOA 2M6RA 4L4XA 4RL1A 1XJWB 4ICLA 4I3FA 1G7SA 4J2TA 4C8YA 2UUAJ 1EBUA 4IOLA 3CNHA 2VJYA 3B70A 4Q8FA 2F7VA 3IBWA 3PC2A 3PJXA 3WA6A 3B13B 3UXYA 4OVKA 3ET4A 3WGYA 2XMTA 3MPWA 2GD0A 3WIDA 3EVZA 3IR5A 3ILSA 4MAKA 4JVLA 2LZ0A 4I9GA 1NVXQ 1A9TA 4H6VA 1BS2A 3LGXA 4OX6A 4MA4A 1Z62A 4WCFA 3UN5A 4LZJA 3ZHCA 1UMCB 3KLEB 5KNCH 2FUG6 2EBHX 3VRHA 1XV5A 1GZ3A 4QOGA 1XMQF 3AFNA 3TLJA 1KWMA 1EWRA 3FCOA 1PTJC 3MTAA 1TKBA 4S1OA 1UPXA 4IGIA 3VR3A 2CB0A 5HKLA 1P2UA 3VR4D 4ECUA 1KMMA 3K58A 2GO1A 2DBBA 1VTKA 4LJKA 2WA1A 1B4SA 4NICA 3CNBA 1YB2A 3MINB 1MX1A 1CS4B 4PSUA 3O73A 2A94A 5CA0B 1JLCA 1I51B 2B9WA 3KG0A 1XIVA 4Q9LA 4QPNA 3KD2A 3VUEA 3NVAA 3EFEA 1QX4A 3ZTRA 3OOSA 1I0ZA 3QEMA 3BB4A 3M8PA 4N54A 4MW1A 4R2JA 1KHWA 3QF4A 5KHAA 1KQKA 1C50A 1MN7A 1EKXA 1SUBA 4O0NA 4NMXB 3U3KA 5ALYA 3U40A 3A1NA 4ES6A 1J5XA 3GWCA 3Q4GA 4R05A 1B43A 5DGCA 4P82A 2EX1A 2GBCA 4ICLB 3L1VA 5KMGB 3VHXA 4FB5A 5D6OA 1ITZA 1KI1A 1JQJC 2OZPA 2VP2A 2D7JA 2FZ5A 4B82A 3ISTA 2QR3A 4PNHA 1CF2O 1XDBA 5AJXA 1G3QA 4OH1A 3E9EA 2WTNA 3JQFA 1YS4A 1ZS6A 3TRDA 3QWPA 5DDRC 1SCJA 2XHWA 1A27A 2PMCA 4HDAA 4PE5B 1NQ5A 3KETA 4QOTA 2FEMA 2GCPA 4LMBA 121PA 1G4HA 4HOYA 4MO9A 2GFFA 3UTCA 2JAXA 2J5BA 3OZXA 4IDDA 3JYTB 2QVZX 1QS0B 3WB0A 2XMBA 4QR0A 1WCIA 4UM7A 1JEEA 3ZNNA 5A71A 2FJBB 5G0SA 1EHWA 5B0FA 5FR2A 4EY8A 2HMAA 2PL9A 2PQ6A 1RBOB 4F3KA 4ROTA 2IIVA 3RRYA 1VISA 1OBVA 4DTIA 3JQAD 4JI6J 5LQSA 3QMPA 3WSWA 2RE1A 3IBCA 2CMFA 1RBYA 1F6DA 1E0AA 1R4NA 2KYZA 1OVMA 2HKIA 4HHHA 4O2LA 1CJVA 1KQFA 1RI5A 2P65A 2H9IA 2IVZA 4DSLA 2XUIA 4JX8A 4N6OA 3QFRA 2UYQA 4V3CA 4JC5A 1DIGA 2RDJA 2OYSA 4IZ6A 2C95A 4HX9A 3FBBA 1OXUA 3ED5A 3GSDA 3A6ZA 4KV9A 5TGTA 3ETJA 1E1CA 3V5NA 1XG5A 4YR3A 3RUAA 4K0RA 2C92A 1DTQB 3ZDEA 2R8ZA 1MMLA 1QC5A 1K7FB 4RKYA 1UKBA 3UH1A 3RYHA 1F6WA 4NMXA 4CTMA 2G5PA 4OYPA 4IIVA 1UMDB 5LU9A 3H9UA 2C4NA 3GLRA 2RSQA 3N5FA 2PWYA 5H9EK 4J1SA 4CMIA 2UP1A 3WL7A 5KKAA 1I3CA 3V4IA 3LM8A 1VRVA 5E3HA 1D7OA 5LDGA 2WJ4A 4Q1BA 2YS6A 3OURA 4JI5B 5EIEA 2HJRA 4QIVA 1JLHA 4IBOA 1HD1A 2C7PA 4J7AA 1TPZA 2H5LA 2NAFA 3RFUA 1UFRA 1ODIA 2I3BA 1RT6A 3TNJA 4R8UA 2VWPA 4DUPA 4B3HA 3IG1A 4YO7A 3Q7SA 4QTXA 4DJDC 3R3VA 5BYJA 3DZJA 4LZAA 2VK1A 2RUGA 5D0GA 3FMVA 2BW7A 4KMMA 3LL7A 4DG1A 3H0EA 1QYDA 2R8JA 4OI3A 2GF0A 3AOCA 1TTHB 1GZDA 1L5UA 2MCFA 3QJLA 2PZEA 3OQNA 1WTFA 4GMGA 1VZ2A 4CR7A 3U1BA 1LDGA 4K6KA 2XQGA 1NVUQ 2XX3A 4MDHA 4YGYA 4N3GA 4GI1A 3HWRA 4O4HB 5LYJB 5FV4A 3ZGZA 1UBRS 2COUA 6AT1B 3KYCA 3RRZA 2XMRA 1RWMA 1FBTA 3DAPA 1LWOA 3SC2B 3DTVD 1E9BA 5P21A 3OPYB 5F8HA 1GDDA 1SVLA 3WQHA 2RGXA 4NENA 2AI3A 4HQ6A 5A2QA 3TGLA 2MSCB 1KKHA 3IUQA 3EQ2A 5U47A 2AFIB 2XUJA 4DR2F 5IAEA 1SUDA 4K9MA 1MO4A 3OIWA 4ZIVA 5DI9A 1CPYA 3QAEA 1GAWA 4PICA 2BUCA 2ZYGA 2BI4A 2VYVD 3VR5A 3VM6A 5I9NA 4RV9A 1EP4B 3KQLA 2B8QA 3SVTA 1L5YA 4UNSA 3FCSB 2JLZA 3GSIA 3HN2A 2BMWA 1AHHA 1I7PA 2R42A 2HBYA 1PS9A 4GFDA 1UOEA 4UHDA 4KAFA 4HHEA 1FHTA 2V0NA 2ILVA 1E4EB 3EOBI 2EYQA 5AE1A 3T9FA 2ZYWX 1W5TA 3JASB 2V6JA 3SOZA 1U31A 1HTBA 3Q5GA 3FUYA 3PEHA 3LUCA 3RHSA 1X86B 2AF6A 1L7QA 1MQSA 1O3YA 2HA4A 5B3KA 1HMVB 1MMNA 4JT4A 5EPUA 4DR3B 1J1IA 3QPWA 1MC1A 2QW0X 2VDOB 4Q15A 1H7WA 2M6SA 3ZZ0A 2FN7A 1U3FA 2JASA 4AJOA 2BJDA 1TL3A 1SCDA 3HHDA 3L4BC 4BGIA 4UT4A 1H3EA 3DAGA 2ZWIA 2CQ1A 4K6GA 3JQAB 4HTAA 1Z2NX 1AZLA 1U1NA 1U2TA 1RT4A 3QLHA 4FJ2A 3VWSA 3UD4P 1C1DA 1E7MA 1AF7A 4HDOB 5FBRB 2FZKB 4KGVA 1H4QA 2DBYA 4G8DA 1F4PA 1Z6GA 1LJUA 4Y30A 1MQ9A 3SYMA 3NH9A 4MQEA 2KHDA 4B4VA 3VR2D 3UNYA 2XYGA 3D4IA 2ZSKA 2UXCJ 4FLEA 2ODAA 5AKKA 4DSKA 4MICA 2OA0A 4M55A 3CIFA 3VZIA 2VV5A 4EF4A 4MJ3A 2XGOA 3IPXA 5FOUA 3LLUA 3UG6A 1HYHA 2D5AA 1H2XA 1JB0C 5KFPA 5KINB 1DIAA 2W0SA 2RGNA 1RAAA 2PJDA 1LZLA 3R5KA 4QM7A 1S2DA 4OFZA 5CDYA 3TQTA 4DMFA 3EG5A 1E4OA 1RKBA 4BQPA 4M9RA 4KE8A 4AICA 4JV5J 2O66A 2QFJA 3AF5A 4ND8A 1BN6A 1B3BA 1VCNA 4CKCA 1V4NA 5IJ0A 5CXSA 3BA1A 4EGJA 3RT1A 5KYWB 3DMYA 3ULKA 1U6BA 4XQCA 4M8SA 1I3KA 4KIWA 3ZE6A 3ER8A 2P68A 3TXXA 4FSXA 3THTA 2QDKA 4NZMA 1LKZA 3ILVA 3FUUA 2P27A 3OZSA 2GCEA 1N34J 1TRKA 4DV3B 2E9SA 3OQJA 5ISMA 2JGMA 1NN3A 3UJ8A 3F5SA 2WMYA 4V0KA 4UUMA 3C46A 4TQRA 4YLYA 3IEIA 1IEVA 3QSIA 4I7FA 4NL4H 3AB4B 3K1TA 1AK1A 2FGCA 1TL4A 1YVDA 1RPZA 2BJ9A 3KLNA 4NYPA 3ZV6A 5BXIA 1Z6PA 4M8KA 3H16A 2JIPA 2JL1A 4QE3A 2PEZA 3K94A 2HL6A 5FLEX 3IKMB 2GPYA 2FKAA 5KG6A 2HK9A 3AB3A 5GMDA 1YFJA 1IN7A 2AN9A 5KCMA 3MMXA 5SV2A 1SJQA 1V39A 4BEBA 2OD6A 3WWZA 2AFHE 2XZOA 5BNWA 3OZCA 1RU1A 2IU6A 1LVUA 4LKOA 1X0PA 5FJ4A 1C0IA 2QX8A 3LC0A 3SBOA 2I4TA 4XEUA 1ZN2A 5J2NB 1RQLA 2O5DA 3TTXA 3GCZA 2DUMA 3M49A 4RTNA 3IEUA 2ZR8A 4Q66C 3KJFA 1HNWJ 1EDZA 3RYTC 3HV2A 3G2HA 1SH7A 3DGPA 4GECA 4HWPA 3DHEA 3TOCA 1ZM2A 3QITA 1FTNA 1K06A 3GNTA 3GJTA 4E6EA 5KTPA 1W36C 2GEFA 5FWNA 1D0EA 4EGCB 2AF4C 3IPCA 3FRHA 2DK2A 2WQZA 2PZAA 2JJ2D 1IZYA 4ND8B 3E35A 1EH5A 3V8RA 2IRUA 3P1JA 3KV1A 4JI6B 3WL5A 3KTAB 1IHPA 3Q2TC 4L7VA 2EZTA 1WKBA 5JCOC 4GH5A 5EUCA 4K05A 3OEWA 4YUYA 3NTVA 2PQ2A 4CTOA 1PL7A 3I87A 5EJ8A 3CEDA 2XTMA 4HWOA 4WX2B 1AB6A 1X2BA 5C1OA 1N56A 2Z4PA 4DJFC 2RIPA 1LX7A 2AEMA 1RJ9A 3HHKA 5AI6A 1F48A 4AYXA 4IJ5A 4GOKA 4IIXA 5D1NA 2ZYSA 5TQ0A 2E0IA 2ZH9A 1XMQB 4UOCA 1TYCA 4P73A 1G4AE 2VB6A 2D1FA 1M34E 2EL7A 2FJEB 3KJVA 3LYAA 4B0PA 2YC4C 2XS5A 4DLZA 2RH8A 4C0QC 5TQ2B 1E0SA 5FOTA 4D80A 2WM8A 4LYDA 5BV0A 4K9DA 4MIBA 1EVLA 3W34A 3CRZA 2I03A 3OVMA 1Z7EA 2W6JD 4HXFB 1UBJS 2MQLA 2AZTA 3G0BA 5IVKA 4URGA 2CJWA 2HJVA 4HH4A 3RQSA 3WLOA 3W05A 4LF9F 3T7JA 2MGZA 2WHXA 5FBHA 4XVCA 4GHWA 1ZN7A 4FFSA 2F7SA 2HCTA 3TLGA 1SZPA 5DMXA 1TF7A 5IKPA 2QT9A 1HNXB 3G6VA 2VZ9A 2OJ3A 2GZ2A 4NCBA 5L46A 5EXTA 2WHPA 1EIYB 1OGYA 2MKIA 1U28C 4RVGA 4B9UA 5EMHA 4NK4A 4RJ2A 2FQ1A 3OPVA 4RLHA 3DPIA 4KBFA 2XMAA 1IQTA 4ZEXA 4PUOA 2EX4A 3K8YA 2PSSA 5F52A 4L2IB 3KBBA 2OMEA 4QXQA 1BGXT 2AN3A 1V9CA 4MQ5A 5HA5A 1LW0A 3AP2A 1P6XA 1VQYA 2NT3A 5B6JA 4CM1A 2Y0CA 2NUAA 1W5EA 2OBNA 1JVBA 1M2VB 2OCAA 4J1TC 1HNIB 4ZCSA 2FMUA 1QYIA 1ZG3A 2HYDA 2XTJA 1NJ1A 5I42B 1N3IA 3EMTA 2GSDA 3OU6A 3C8UA 5M7EA 5K8MA 2HGZA 4LC9A 4BVAA 1PYSB 2QTFA 2NUAB 3CNNA 1KK3A 5BY2A 3OFSA 4O23A 4C30A 1EP2B 4Z9XA 2IPNA 3UA3A 1QIKA 5K3OA 1U3VA 1AO0A 2BEVB 3DVRX 3THRA 1TVKA 1A9NB 2PL5A 1USWA 3AO0B 1RWXB 2VNIA 3AL3A 4X2BA 1WI6A 3T95A 3K57A 1D2RA 4NE9A 1NG1A 1A2QA 2G5CA 2WTFA 4WOKA 4DQDA 4C04A 3ICCA 1QAMA 3NWPA 1KZ4A 2DM6A 4EW1A 3X1YA 4IL5A 1GD1O 5L3SB 2UXCB 2AVNA 3W2IA 3MMBA 1KSFX 1Q82T 3HXKA 3DZDA 1FXDA 4HH3C 1UC9A 1UOPA 3T06B 1Q57A 4HR7A 2IEBA 2WWGA 1L7NA 3J80Y 1XAJA 1C0EA 1DAEA 4XPEA 3DO6A 3FY4A 3RS7A 3EISA 4DSTA 4ENOA 2XDWA 3H0CA 1DWUA 1TJ3A 2H1WA 1M6YA 4QOEA 1Q8KA 2CHQA 2N47A 3T15A 5CVTA 4YHBA 4IH5A 2K5UA 1KFCB 2CAJA 2BEUB 2FRDA 4KC5A 3POTB 1L5ZA 3R7NB 4Y1RB 2C9CA 1UXHA 4E5UA 1NAHA 5EP4A 3LW7A 4IQ8A 5DBHX 2J4DA 4IIUA 2YYAA 3OFND 4R9SA 4ANFA 3OCWA 1RAHA 4EBCA 4JK3A 3Q41A 1KQFB 1QZZA 2X0EA 1HNXF 1EP9A 5SZTA 3RR8A 2VJMB 4Q4LA 7ADHA 2YWHA 4LBWA 4WFNQ 4JENA 2RG7A 1S2MA 2BKVA 1T36B 4FN4A 1TEXA 4UUPA 1U24A 2RRAA 1R5JA 2HWHA 4JBYA 4KLRA 4JYZA 3GXBA 3D54D 3VA7A 3OETA 3B1XA 1SL2A 2XT9A 3J7AC 2PXCA 4B44A 2OFXA 1U26A 4TQ9A 4QU9A 4XVRA 4Q5IA 2VHTA 3FBTA 4QJVA 3TDKA 2PX3A 4H35A 3KZVA 3L1UA 4YMHA 5JNLA 1L5WA 1N6PA 4ILRA 3V6DB 4QLAA 3IUYA 5C8XA 2RHOA 4RZ2A 3Q2KA 3ZBUA 3NVDA 4YV7A 3MZ0A 3AP3A 1NN0A 5AICA 3PNOA 1FYWA 2LW7A 3NPAA 1BX0A 3S81A 2NLOA 3CH4B 1Z5VA 3OE4A 1FZTA 3NV9A 1EJ0A 3FB1A 3WWOA 5DU2A 4LVOP 2OO7A 1PNQA 5MF6A 4C0BA 2VAWA 3OHAA 3CUYA 4C8NA 2JFNA 1E0JA 1P3Y1 1F5AA 2WMOB 3UJAA 3NP7A 1BMDA 1PUXA 4JB8A 1RGVA 1PL0A 1C4OA 3A9SA 4WJLA 2D1SA 3V4MA 2YKQA 3SJCA 2XCLA 3IP3A 1SXLA 3BH6B 4ZVRB 1XE3A 4AN4A 2O1XA 5LMCA 1Q0PA 4N49A 1PK7A 4DQLA 1HDYA 2Z6QA 1RTKA 5JC1A 2FHJA 5BT9A 1E5LA 1P1BA 2K7JA 3CJKB 4X66F 1T3LA 4OJTA 1ZUNB 4NBSA 2HHHB 1CB7A 4DIMA 2PIDA 3OAAD 3IAM9 5T6BA 3GJZA 4M1WA 5AI8A 1FD8A 2W01A 3FJ2A 4A0GA 2ZT6A 2GD6A 4O2AF 2GAAA 1LSOA 1GCIA 1VGVA 2ZI9A 3AQ4A 1OAKA 4X8HA 1ZBTA 4KBYA 5EPOA 3OLQA 4DLVA 2R8YA 4JQOA 5KT4A 5H1YA 1TNDA 3IRWP 1MWYA 2R1UA 2GCGA 4DV6F 2GF9A 4LJ9A 2V67A 1QAQA 3LCMA 2O7NA 2VN8A 1RM0A 2Q1UA 4RW9A 1OBCA 1JDZA 1DV1A 2IOQA 1XUOA 4EZ6A 2KMLA 1D4ZA 1Z5GA 5B7GA 4J0KA 1Q0UA 4MIEA 4FNOA 2ATLA 4N7BA 4L28A 3U44B 2VJVA 1IZ8A 3L1HA 2DR0A 4PLFA 3RTDA 3AKZA 1RPAA 4JFRA 1N88A 3FVTA 3WQPA 2Q1YA 2D0IA 4HWRA 2Y1EA 3KVVA 3BE6A 4NBUA 3T7DA 3A36A 4IJWA 1Z38A 1KP9A 5KFTA 3IM8A 4U95A 3C0KA 1TFWA 1A6LA 2ZWMA 1JR2A 2ZDOA 1NE2A 2C8LA 1O95C 2JCSA 4YECA 5KCZA 1QVWA 1W94A 1BXGA 2YY6A 5DGIA 2F00A 2WIGA 2DRBA 3G1TA 1FESA 4KMOA 1PLJA 2Y99A 4DJAA 4ZVNA 4KW7A 2QUIA 4YBRA 5GV7A 5IM4A 3WGOA 3H11B 4RYDA 4KNWA 3JSMA 5B4TA 1HQUB 5FWYA 1A95A 3MPUB 1G7TA 1QYVA 1U2QA 1Z7YA 5LLTA 1UK6A 4U7FA 2C3UA 1PX2A 1BFUA 3LQVA 1MXHA 2MPUA 3CT9A 2XI2A 4TT8A 5IDQA 2HA7A 2QP4A 3F49S 1B14A 4B71A 2KT3A 4AQYF 5T5QA 4MP3A 1O51A 5B64A 1FYEA 1FEEA 2FUEA 3CVKA 1SC1A 1EAYA 4ED5A 2XB9A 5JSYA 5B1SA 1DZ3A 4RNFA 4I5DA 1KO4A 3N53A 5KFYA 3I28A 4NZNA 1Z22A 3JX9A 3I2IA 1NSFA 4URXR 3UWOA 4U5XA 3QLTA 4RM2A 3CWCA 4IMIB 3C6KA 1E2UA 3NNDA 3EDQB 4LRQA 5HATA 1PZMA 4HPJB 3N2GB 2GHIA 1CV2A 4KNYA 1S1VB 1ETHA 1C9NA 5DGTA 2ZJ2A 3Q5DA 4ECZA 1GNKA 3IVAA 1NO8A 2OPBA 2WJAA 1Z8DA 4A47A 2QN9A 1RHRB 4I4NA 1J90A 2C4UA 2PCLA 4DZ6A 1R00A 3TQQA 1IE3A 2ZRHA 3CUWA 1CP2A 1NBWB 2KM1A 1HZJA 2VDMB 5AM3A 3SFUA 4NAUA 4Q9HA 4YCSA 4CHGA 3EUWA 4ECAA 3RIYA 3AQIA 4NABA 1JMVA 3B78A 2P6UA 4IDOA 1RAIB 4WXPA 1QWOA 2ZIFA 2UUTA 3RKRA 1M1XB 4DXLA 2BKNA 3E6AA 1XJQA 3TB6A 4ESEA 4A0HA 3QWIA 3RRXA 3GV5B 2WM3A 5FH9A 4EL5A 3BM5A 1KC3A 2CMDA 1RYEA 3QYFA 3SIWA 1R4AA 1YG0A 1JNRB 3THWA 3BMOA 5HEKA 2IVYA 3BB1A 5DW0A 1FFWB 2BFBB 3OXFA 2YY7A 3CX3A 5LQJA 4K9KA 4D96A 1SKUB 1WEYA 2G1UA 2Q79A 3C16C 3IE2A 3I72A 4ABTA 3R3XA 1RP5A 2RH3A 1X7XA 3M1VA 1JDPA 3KE8A 2EFQA 1FFWA 1QSSA 4BE7B 2B36A 1CB0A 1TD1A 5IK2A 5CIYA 2LD4A 1NOIA 3GWZA 3SQOP 3LYLA 2ZNYA 2LU1A 4NA1A 1O57A 2RC5A 3TWOA 1AGXA 3UN2A 1YL5A 1WXGA 2P6OA 2MZQA 1RJEA 3MTDA 2FSFA 4QO7A 4WTOA 4YBZA 1KKLA 1XNQB 3F98A 2H31A 1HDEA 2PX0A 3MJDA 5E4TA 3PRJA 3KKFA 1JEDA 3FSYA 3BWYA 1NC1A 5C5IA 3M33A 2PWBA 4E3WA 1YDMA 1GFIA 3EVAA 2JFUA 3KTOA 2B7LA 2XQVA 4MCAA 1JH8A 1S1UA 1QORA 2QM7A 2WVBA 4MUGA 3UO8B 3JYOA 3DN9A 1VS3A 4H2DA 1FEHA 2X7XA 4ZK6A 5I7RA 4DLYA 2VOEA 3DCJA 1M74A 1FDVA 5F8IA 2FSPA 5A2QY 3FWZA 4Q6WA 2HLTA 4QM6A 1QH9A 1WXEA 3BQ1A 4MV3A 3AUXA 4M37A 1B8UA 2DD8S 5F64A 3M8PB 2ZVSA 1YA4A 2P78A 2BRLA 2R79A 4UCFA 4IJKA 4F0JA 3M4YA 1CF4A 2WU3A 3SBXA 1CVJA 5JD4A 3SIPA 3WKCA 2IY5B 2OZEA 4L15A 1BH2A 5D4LA 4GEKA 2EIXA 1O89A 4YLEA 3BK2A 2PRYA 1B6GA 3FPFA 5BYQA 4O1IA 2JJMA 3GT0A 3NH6A 3X1MA 3JWIA 5FBZA 1XVLA 4BY9E 3NAGA 1Q83A 3TAQA 2UUCF 2VTDA 1VIVA 3DBLA 3WYGA 2J0SD 3AA8A 3FOZA 4EGFA 2BMJA 2R3VA 5JDCA 2X4LA 1DBPA 4N4AA 5FOWA 3QYYA 1LPOA 2O20A 5H3CA 1J2EA 1EVZA 5F3WB 3KT8A 5KJ6A 5K03A 4GXTA 1A8PA 4C4WA 3VHRA 1IXZA 5L3SA 3E61A 4NOMA 4FNMA 4DRZA 4ZOAA 3PIOQ 2IUFA 5KQLA 3U1LA 3EGEA 4PLZA 2J9FA 3V46A 1Z6TA 4XYBA 4LMRA 5HDQA 1AV7A 1KO1A 4WZBA 3Q8UA 2XDQA 4LYJA 1JHMA 4IX1A 2GCNA 5KVCA 4WJBA 5B7QA 2CE2X 1HNIA 4NYMQ 5AUQA 2KRRA 1G64A 1C3VA 4P0TA 1CSEE 3CCZA 5E2IA 1SVUA 4ID5A 3U4AA 3OR1B 4C88A 4BE9A 1CJKB 3WHLA 3DKDA 1JKFA 1Y3BE 3GLHB 4C4YA 1C30A 3SYZA 4KYTA 4JQYA 2P91A 4LOKA 1F7UA 2ZI3A 5H70A 2RGRA 1OI2A 3EEYA 4F0HA 1C0LA 2CNWD 1T36A 5JNTA 2AJ4A 1N9GB 2CSUA 2EFVA 1Z4MA 3MC1A 4LC0A 3ND7A 2I3AA 1FMCA 2XCUA 1P1FA 1OHHD 4H4KC 4K6FA 1R15A 4C7VA 2JLBA 4BV9A 2J5XA 3K2BA 2ID4A 4YCBA 3UWTA 5JASA 1J2YA 2H4XA 5D6GA 4AMUA 2ZH8A 5LXTA 2HA2A 2AF3C 3IQWA 4XQ0A 4Z0HO 3QKTA 2V6BA 3LQQA 1JR3D 2JDIA 3DYAB 4NFSA 4II2A 3DV9A 2CVHA 3B12A 1R0KA 1K6IA 4C0SA 1QYWA 1SXJC 5FYQA 1Q5VA 4V1CI 1DUSA 5JNRA 1EQUA 4DS4A 3QRPA 4OX9J 2YQZA 3TAUA 4ABYA 3T1VA 3O9ZA 1F5CA 2ZZMA 4G6ZA 1U65A 3LA8A 1SI9A 1RWKA 4EI2A 2W2QP 4G63A 1UT6A 3R7NA 2J5KA 2CWKA 4DCJB 1NJYA 1QDUB 5CCLA 3BQMB 3AEQA 2FR0A 1B99A 4Z0PA 2OKGA 1LPAB 4HLNA 5HILA 1U5BB 3VGPA 5LMNB 3UI3A 1ZVQA 1K27A 3GLGA 1NDKA 1IY9A 2RHBA 3IA2A 1GPAA 2VODA 1F3FA 2V03A 3ZHYA 2VSXA 2N3ZA 3AM3A 4ER6A 4EK2A 4B6QA 3K5NA 3AERA 1DG1G 2OM2A 2XIJA 3N76A 3U4CA 3R41A 3HBJA 2OKQA 3GLHA 4BASA 5KFQA 4LF8B 4WYWA 5JLJA 3NHFA 2ZDHA 1X1BA 4CL2A 4UBLA 3SQWA 4N48A 5AK4A 1TFYA 1VHWA 3KYCB 3UV7A 1XQ1A 2MHCA 2VICA 4CYUA 1Z18A 4AQDA 1IJBA 3HKCB 3P0FA 2GEUA 3FJ1A 3K9CA 2XY5A 3ZH9B 2FPIB 1RQGA 3CUVA 3VBEA 5EKXA 5DO2A 2D3ZA 1UEJA 3PXEA 1X4FA 2DQ4A 5DBFA 4M6WA 2A2DA 3KB8A 5J2UB 3PKZA 3RG6A 1IVSA 2FZGB 3MQFA 3DOKA 4WFKA 4PPQA 3VR2A 2H57A 3D2BA 5FT9A 4QNNA 1RPTA 1N33J 1A9YA 2PGJA 3T5HA 2Y3YA 4V0RA 1TO1E 1CJTC 1VSUA 4G8CA 1ZD3A 3U44A 1IOLA 3BO2A 3NI2A 3HB7A 1AFIA 3NBKA 4UOGA 5T8KA 2PI4A 1SC3B 2CDRA 3PVSA 3ZV5A 4XIYA 2DFVA 1A8HA 2XJ9A 4PWUA 1VOTA 4X1IB 4O1MA 3JZMA 4ALJA 1DXYA 1F3LA 1RYYA 4AG5A 1O9HA 5ALTA 5HG0A 2I4OA 5KSYA 1NMEB 4TUYF 4EA9A 3RZAA 1VJQA 3M5DA 1Q0LA 5I7WA 4JYAB 3KKEA 1HARA 1N52B 4IQGA 3GQVA 1E9RA 1CEXA 5BR1A 4W1SA 1JPVA 3PD1A 1X15A 3N74A 1EFRD 4HUTA 5J1EA 4QGHA 3N3BC 3IMCA 4USKA 2JFHA 3AHJA 3C4QA 2AOVA 4QOIA 1XXLA 2ZJAA 16PKA 4EELA 3B4MA 1VYUA 2JC0A 2PHZA 2PUTA 1DAPA 1HA1A 1O6ZA 2AQ4A 4O4HF 5REQB 4ED3A 2IYAA 4DSUA 2RS2A 1U1IA 1AZSA 3KLGA 1FJ2A 1OPRA 2PSDA 5HW0A 5FLKA 1C0TB 1S1MA 4WASA 3G96A 3SI7A 2CXNA 5ETRA 4GLBA 1R5BA 1B93A 4XXHA 5DLQC 4QULA 2RF2A 3OJOA 3GRFA 4W8GA 3GBSA 1XRQA 1I2ZA 1W48A 2PI5A 4F02A 4B9MA 1NK0A 2QB5A 1TU4A 1G2OA 3BWDD 1JFSA 4LHEA 4HPWA 3A3NB 2OPRA 3HSDA 5K0ZA 1TZ0A 2FLLA 1YZ7A 3F3SA 4R5MA 4XVUA 5P8WA 3AILA 2XBMA 3A2LA 3HD1A 4P52A 2RI1A 4AX8A 1RISA 4ES1A 4LVCA 4NAVA 3HU3A 2WOMB 1D4FA 1Y5IB 2V4JB 2V4QA 1C8VB 1N2BA 2C4HA 3A1VA 1UADA</