2E1PA

Crystal structure of pro-tk-subtilisin
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of unautoprocessed precursor of subtilisin from a hyperthermophilic archaeon: evidence for Ca2+-induced folding
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 131
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2e1pA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2e1pA02
3DE7X 2W2OA 2Z58B 2W2QA 1SCBA 2E1PA 2PMWB 1GA6A 2W2MP 1WMEA 1Y4DE 4OV6A 2ZWOA 4LVNA 1BFKA 1SH7A 3Q5GA 2Z2YA 1BJRE 4B5LA 1GA1A 1Y48E 2XTJP 1V5IB 1SBCA 2PMWA 3DW3X 1C9MA 1Y3FE 3DE4X 1C3LA 2DQKA 3TI9A 2Z56B 5CW1A 5B1EA 1Y1KE 1YU6A 4WOBA 2WUWE 3UNXA 1PJ8A 1AK9A 3DE2X 4YN3B 1ZVKA 1EGQA 2PWAA 5AVJA 3WQBA 1UBNA 1AV7A 5AQEA 2P4EA 4DJ5X 1GT91 3DVRX 3F49S 1KE1A 1GTG1 5ARBA 2PQ2A 1SCJA 2ST1A 1SBHA 4GI3A 1AF4A 4H6VA 1NDUA 3ZXYA 1TK2A 3I2YX 1R0RE 3A3NB 3BGOP 3GCWP 3D9QX 1EA7A 1WMFA 4OMDA 1R6VA 3AFGA 2PRKA 4I0WB 4CG0A 1AH2A 1THMA 1ZVJA 2Z58A 1BH6A 2W2QP 3DE3X 1SBTA 3LPDA 3GCXP 1Y33E 3VV2B 1BE6A 2W2PP 3D43A 1SN7A 4K8RA 3QTLA 1OT5A 4RYDA 1YJCA 2Z30A 3I30X 1DUIA 1IAVA 5SICE 4KPGA 2G4VA 3EE6A 1SPBP 2QTWB 4OV6B 5B1DA 5JXJA 2WWTA 4OMCA 1SELA 2IY9A 2SICE 1MEEA 1TMGE 1R64A 1C9JA 3TECE 3DW1X 1AQNA 5I9SA 3WIUA 1S2NA 1HT3A 3SQOA 1TM1E 3PRKE 1VSBA 4NE9C 1GTJ1 3BPSP 4WOCA 1T1GA 4MZDA 1WMDA 2Z57A 3DE1X 1V6CA 4J94A 3T41A 3WIVA 3A3OB 1Q5PA 1SPBS 1AVTA 4CFZA 3OSZA 3VHQA 1SUAA 4DWWA 1P7VA 2X8JB 1YJAA 3VTAA 3TI7A 3BGOS 3BX1A 5FAXA 3CNQP 3GT3A 3A3PB 1OYOA 2ID8A 1NLUA 1IC6A 1PEKE 3HJRA 2V8BA 5JXIA 3Q40A 1PTKA 3DDZX 3CNQS 5JMOA 1Y34E 2B6NA 4AKSA 2IXTA 5JXGA 3DYBA 3GCWA 5AMXA 1TECE 1XF1A 2WUVA 1GNVA 2Z2XA 1GCIA 1WSDA 1SBIA 1CNMA 3A3PA 3DWEX 1TO1E 2Z56A 4JP8A 1OYVA 1GNSA 1CSEE 2PWBA 2DP4E 3H42B 4BWGA 3DVSX 4NE9A 3DE6X 3LPCA 1ST2A 3PTLA 2QTWA 4H6XA 1ITPA 4ZARA 1Y3DE 2XTJA 1SCAA 3VSBA 3LPAA 3QFHA 3EDYA 1SCDA 2W2OP 4YN3A 3L1KA 3DE5X 2GKOA 2W2MA 2Z30B 2TECE 2SECE 4CFYA 1T1IA 2W2PA 3QMPA 4K8RB 1KDVA 1KDZA 3VV2A 4LVOA 1SUDA 3SICE 5ARDA 1TM3E 5FFNA 4KG7A 5ARCA 3WHIA 2XRMA 1WVMA 2ZWPA 2PYZA 1DBIA 1TM7E 1BE8A 2Z57B 1AU9A 2Z2YB 3A3NA 4Z2AA 2W2NP 1SVNA 2WV7A 3F7MA 3GCXA 3ZXXA 1TM4E 3SQOP 3P5BP 4C3VA 4HX2A 4AKTA 1JEAA 2PKCA 1KE2A 4ZOQI 1Y4AE 1GTL1 2HD4A 1V5IA 5AVKA 3VV3A 1Y9ZA 3A3OA 1YJBA 1SUPA 2X8JA 4DZTA 1SUEA 3CO0S 3LXUX 3AJ8A 2SNIE 1T1EA 5K7SA 4KB5A 4H6WA 1A2QA 3AJ9A 1SIOA 1GA4A 1Y3CE 1P7WA 3I34X 3VYVA 3GT4A 3F7OA 1TM5E 2ZRQA 1C9NA 3DVQX 1S02A 1TO2E 4M1ZA 2W2NA 3H42A 4NE7A 1SIBE 4HVLA 1SCJB 2HPZA 2SBTA 1ST3A 1SUBA 1SUCA 1Y3BE 1PFGA 3BPSA 1S01A 3P5BA 4C3UA 1LW6E 1SCNE 5FBZA 4NMXB 3CO0P 5JXHA 2Z2ZA 3DE0X 4NMXA 1P8JA 1SBNE 1MPTA 3I37X 1SIUA 2ID4A 1BFUA 3EIFA 1KDYA 4FONA 2DUJA 1NDQA
chains in the Genus database with same CATH superfamily
4HMQA 3R5JB 1FJXA 3P2MA 3VKHA 4WBFA 4BPRA 4JR0A 3LWZA 4GI1A 4TLMB 3C6BA 4J0KA 5AXDA 4XFJA 3PCOB 1RWVB 3PGKA 5JPCA 2VC1A 4RD3A 3FCOA 4GGMX 2YHUA 3MFHA 1BGWA 4J7CA 1I4LD 4L0DA 2BD0A 1AKTA 1V25A 3ZE8A 2KM8C 2X5KO 1YBFA 2FW6A 1WDTA 3BEOA 1QAIA 3OD5A 1YKWA 1AS2A 4XWWA 2JD2A 2L17A 4N18A 1EQ0A 3KXKA 4YXFA 4TQGA 2D69A 1PLLA 3GVCA 2V58A 1FO1A 1WMSA 3MCTA 2JKVA 4DREA 3GEBA 2HQIA 3Q8XB 1EBUA 2OXFA 4S1TA 5A0YA 3SJ7A 1EK5A 3FCAA 3KB2A 1NNI1 2OZKA 5TPZA 4M37A 1UJ4A 3HCBA 5FKJA 3TKYA 1SGWA 4XD7D 5C8VA 3PWZA 3PVCA 5IWAB 4FYIA 1X7VA 3L79A 4BNXA 2GNPA 3BQ2A 3TTTA 1QR2A 4MKRA 3ZY6A 1R5BA 4CM6A 3O8OA 4KLAA 1D6SA 4BZPA 3Q88A 4UAUA 3GCWP 2O01C 4DNOA 4JT8A 4H7IA 4RL6A 4H7KA 4AZTA 3HMQA 1SKUA 4QW9A 1O57A 2K2WA 5HZKA 1YL7A 3TUZC 2CGEA 4OUDB 1H2XA 2FZCA 3MM6B 4M36A 2GD0A 5C1BA 5E4TA 4RF3A 5ALPA 2IS1A 5JJKA 3KHGA 4B3DA 4C2AA 4X4RA 2MDTA 2XVXA 1VBKA 2XGSA 3UI3A 2SCUB 2BBSA 2GNKA 3HV0A 2FJWA 3O4VA 2X15A 4NEQA 4F2RA 3KKZA 3UCXA 4CEIB 4EO6A 1ENYA 3UKDA 1BD3A 1QV7A 4NVRA 2QTGA 3JPWA 4KY3A 4KXQA 2CCJA 1VKJA 2HSEB 2CZ4A 5HJEA 1G3UA 3JYPA 2DUWA 3DTTA 3ESAA 3MG9A 4JJAA 1XDBA 3W5VA 5IANA 1WPXA 2QN2A 2XITA 3OF2A 4J4BA 4LOHA 3FFBA 1JR4A 3AG6A 1CB7A 3RBVA 4ARBA 1UWAA 2VHVA 2Y68A 2LCWA 3ZHQA 2XLBA 1DC3A 4FHZA 4WXEA 3HN7A 2XYPA 3ER6A 4PLTA 1HYHA 4BUCA 2QRNA 1HTWA 2Z2KA 1M2KA 2VA8A 4LJMA 4DDKA 3HABA 1PSDA 3TG8A 2C20A 3CIMA 2IUUA 2OP5A 4KDRA 2OUGA 4UTOA 2DKOB 4ENVA 1V9OA 5IEJA 3JYQA 2BDUA 4GWGA 1FDUA 4BUJA 2DCUB 2J0VA 1PZHA 2GD2A 1Z9BA 5ETQA 2WTMA 5HF8A 1OFHA 2YH2A 4EECA 4G5HA 4OLHA 2J76E 2G5PA 2C2HA 4LRXA 2CVEA 3Q7RA 4NBRA 1SUWA 4ITRC 2DPLA 5LMCA 2J9GA 1XNQB 2FOIA 2JW5A 5IMBA 5EIFA 1QH1B 2CL6X 2DFLA 4MEBA 2RIRA 3ZNJ1 4DT1A 4ECAA 2V8GA 4UBMA 1NASA 3L41A 4WP9A 3UMCA 5I7FA 2PUEA 2AKYA 4L4XA 3K30A 3QELA 3HBNA 5HQ8A 3HXMA 1KMIY 3VMMA 2PYZA 1ZH4A 3ICLA 4F46A 3QKSA 2FQQB 3THVA 2ARKA 5ETOA 3K0AB 4KN8A 2KW5A 4HPJB 1QM5A 1SXJE 1D2MA 2OO7A 3M7VA 1HFWA 4FS2A 2YKNA 1X5SA 3GJRB 2AW0A 4J0DA 4NBUA 2HIGA 4EY7A 4BX3A 3QVGB 1RP5A 4MB6A 2ZVSA 1I4DD 4LXUA 1N0UA 2WU0A 4JU8A 4KGKA 1ECPA 2JVRA 2W00A 4FSDA 3BB5A 1D09B 1TV6B 2RDJA 3L4BC 2E4ZA 1R9NA 1NTRA 5DGHA 3IGNA 2HNAA 4Q02A 4M49A 3QUQA 2JIDA 2P1ZA 5C7IO 2XHWA 1MT0A 5JXHA 2PWZA 2XZLA 5BV7A 4DV5B 3J7Z5 1CNFA 3ROEA 2BCJQ 4RWZA 2QL9A 3FCXA 2VZ0A 4Q24A 2HWKA 4EARA 4X65B 5EIBD 3AETA 2K1RA 1MH1A 5CM8B 1UJMA 2JBAB 4IJ5A 4OPMA 5T4EA 3D6NB 1W581 4KV8B 1OIAA 4KB7A 3A26A 1DC7A 1TKXB 4ETXA 1WW2A 2FFHA 1F06A 3K92A 1XR3A 3KTAB 3T4PA 1YK0A 1H2VZ 3QVJA 5F98A 1CP2A 1AT1B 3GV5B 1SJ4P 1I2CA 2DGXA 1KBRA 1I2BA 1YIAA 2AD5A 4DR4J 1HE3A 4CLRA 3DTVA 5JC8A 2H1IA 4L72B 4EBCA 1XC7A 2Q49A 4O4JF 3R7LA 2G1PA 3L92A 1YWGO 4XYBA 4BB6A 3HO6A 2ATCA 4NU5A 1QV9A 1YR1A 3M2PA 1XEZA 3QLVA 2Z56B 1FFDA 1I1OA 4TLRA 4JVOA 4O4IA 1WXWA 4FX2A 1NK6A 4V0ME 4GOOD 2GUGA 2AKEA 1KORA 3AIIA 4BGVA 3TZ6A 2YNFB 1V5FA 4FI3F 1QBKC 5TV2A 1X1RA 3LPYA 1KDPA 4ND5A 3A70A 4DIBA 3EXG1 4BNMA 1MXFA 1I3NA 4DSKA 3SQGB 1FVSA 2BFEB 3ZNNA 1D3WA 2O14A 2NW6A 1YJVA 4GR9A 1NY5A 4GNKA 3MPDA 3FCUB 3NMUF 2RGWA 3MUFA 2QMHA 2D74A 1CJKB 3FCYA 2C1EA 1A9ZA 3BGIA 2XTMA 1QPBA 2Y92A 4AKHA 3I9JA 1X7HA 1U80A 1FKPB 1HE2A 2XMJA 2GB4A 2OL4A 1E3MA 1QLWA 3GJ0A 3RS5A 1N1EA 1UDBA 1U2FA 5CFPA 1YJQA 1W8DA 1UWVA 4YGYA 4AQYJ 4RBTA 4IS2A 4JAVC 1Y00A 3WLLA 4HEQA 4ZP7A 2XCRB 3ND9A 4Q9NA 4NV1A 1S2NA 1E7SA 3EZ7A 2P9CA 3C15B 4BP3A 1YDGA 4WU3A 2QRGA 4A0SA 3RHZA 3SFUA 3ILJA 1UKCA 3FBFA 3G82A 4PF1A 1RXVA 2EWVA 3LVRE 1T9TA 1MOSA 4B40A 2V2QA 1U0FA 4R1MA 1M1KT 2NO6A 4REQB 1PFQA 1SUFA 5JXIA 4NY1A 1KI3A 1IJKA 1W36B 5IT9A 5ALGA 1OD6A 4C2BA 4DQVA 3FQKA 2JAUA 4HEA6 2DNYA 1UJCA 4NLUA 5CH5A 3EXHA 3PHBE 4XJSA 3U37A 5IJ9A 1U8EA 1UW9A 3DA8A 1TKZA 4AWAA 3CGIA 2QA1A 2YKMA 1M2VA 3E9QA 4GD3Q 1NMXA 2XUFA 5DXFA 2PWPA 1ITPA 2KWIA 1SZDA 2J3EA 4JSYA 3DGVA 3FMIA 3GU0A 3DUFB 4GRDA 3SF8B 1T9DA 4JI2B 1GSIA 4B2PA 4B74A 4NLDA 2ZH8A 2GCEA 3LP8A 5AKHA 1T2EA 5AXMA 3H8VA 4NENA 5EZ6B 2RMLA 1ZESA 4QT0A 2GKGA 1V41E 3PDHA 3WHIA 3J81Y 2ZWIA 2BJVA 4RW7B 5DM4A 3TOZA 1RHMB 3VQSA 1W94A 3R24A 4E46A 1VRWA 3PGLA 5KNLA 3FZEA 2M7SA 3R7NA 2ABWA 3DOLB 5KFFA 1PQ4A 3R5SA 1KEPA 2CQPA 2FP4B 5DRTA 1KE2A 5HBRA 1QFSA 4RF2A 4JOCA 2IUYA 2ZE2B 4XPZA 3VVUA 4AG5A 2XG8A 3UXMA 5JAZA 1LDGA 3NHKA 4FKBA 1A6LA 1N34J 4AQDA 4F06A 1ANKA 4ELTA 3FMFA 3AEKA 2XC9A 1CZNA 3N75A 1XZQA 5B1HA 1U11A 4A3SA 3B12A 1WUYA 2J0UA 1TM5E 4E94A 5KWVA 4H60A 3VPBA 5F9HA 2YHBA 5FRDA 4Q45A 5KB3A 5CVEA 3ET5A 4AECA 3Q23A 2NLOA 1AKRA 3SLRA 2CDNA 3TSWA 4CDIA 2ZYRA 2O7QA 8ATCA 4LOKA 3EUEA 2ZVQX 3FNFA 3R3WA 2H57A 3T9EA 2ALZA 3N8GA 5AFSA 4A4JA 3KJQB 3AESB 3G1WA 1CZRA 3B3JA 4M9RA 2NSDA 2RGYA 3GN1A 3RYTC 1FE0A 5KOHB 2G63A 3N7AA 3HT3A 4FPIA 2F00A 1KEKA 4GICA 3JAMY 5ALXA 2BE9B 3IP7A 1Y5NB 2NPFA 3O90A 3CH7A 4JLUA 1X60A 3LPNA 4YREA 4QFBA 1B4DA 3DDWA 2YNMC 4KQIA 3T3MB 1M76A 3H4DA 1F4VA 2X51A 3RSQA 3URMA 1DL5A 2FPIB 4L7VA 4RZSA 2P0YA 1VJGA 4DQXA 3LC2O 4UNNA 3ZYZA 3N0WA 3QJ5A 3TEHB 3IRWP 1RM4A 4UEQA 2H4YA 2AT1A 5HO4A 5KOIA 2Q3HA 1AV7A 3HPQA 4OZ5A 1R88A 4QQNA 2P35A 3IEMA 2P9QA 4Q93A 4A47A 1Q12A 2CHFA 1VLJA 2XNKA 2DVIA 4O5OA 1B0ZA 4MS4B 2J9FB 4OOEA 1W29A 4NYPA 1MFPA 3MFIA 1MF7A 2XXAB 4K4XA 4FF3A 1JDTA 3MMAA 1I9CA 1YTLA 1POWA 1GTZA 1YHZA 4W5RA 3UHFA 2H6EA 3HDJA 1DG9A 4LF5B 4XX0A 2XDQA 1Q19A 5CLLA 1H2TZ 3B7WA 1SH3A 3A37A 1CS0B 2Q9AA 1YQWA 4P7KA 4KQZA 2EEZA 3PO5A 3VALA 4DBZA 2YXDA 2EPIA 4WZBA 4EEZA 1ZP6A 1TYZA 1ZEJA 5HW0A 3O94A 3EC2A 4XOIA 5SICE 3MCVA 1RPAA 4IO9Q 4W6ZA 3BTOA 1NMEA 3ZU6A 5B1DA 4BJ6A 2Q2OA 4KQ6A 4BECA 4BMVA 4RVSA 2KRRA 2GV1A 4QULA 5LMZA 2XQKA 2HJHA 3UGQA 3A4YA 4D9EA 4ZPJA 1N8RT 1F8GA 4LJ7A 3RUBL 3WGNA 1C3VA 2H8GA 1R0CB 5FHQA 4RXTA 4Q47A 3C66A 3W2EA 3W8GA 4MWBA 3RRGA 1ID1A 2FSFA 5KFAA 5INTA 2YWEA 1DAHA 1JLLA 5ETTA 1UQUA 2QUHA 2FGKA 1ZR2A 5G3YA 1JR3D 4YP6A 1H6AA 3W9JA 2RH3A 1Z08A 1X77A 4TVKA 2V6JA 4K03A 4AP6A 3LT0A 2IA6A 1E32A 1TVKB 5IXJA 3LLCA 1U0NA 4O5AA 3TZYA 2VF5X 3WGKA 4RU9A 1QS0B 4OV1A 3T3FA 2Q29A 4XJXA 5BNWA 3IM8A 2GAIA 3CW2A 1LSJA 2H3EA 1H4SA 1GPBA 1Y7TA 2R0QC 1MT3A 2NXJA 3N79A 1OAOA 3BXXA 3TNJA 3EPIA 4GDFA 3BIWA 3MK31 3IC1A 3ZD9A 1EUDB 3ND7A 5AW5A 4NYZA 1T5IA 2TMGA 4U7UD 3PTLA 2DHDA 2D1RA 4AN4A 3GGPA 5JAOA 5E0KB 3O0TA 1WW8A 4E5DA 4GMGA 2JIMA 4OL9A 3OX2A 1VRQC 3JTPA 4DC0A 4FS8A 4PYLA 3HACA 5KNDH 3NTOA 3A25A 2G9RA 3WRXC 2WZQA 4CT9A 1GMWD 1WSRA 3U9LA 2AN9A 3UVJA 2YVUA 1I1NA 2V0CA 3VZIA 1OI2A 3W2VB 8ADHA 4ELUA 4DQSA 3R77A 1LQTA 1YKSA 2I71A 1X4DA 2RAFA 2N42A 4DR7F 1KJQA 3RFXA 3IPCA 5DCWA 3O26A 2G8LA 4LQLA 5HKBA 2C2ZB 4M1WA 5D6GA 2O8BA 1DQSA 3X3HA 2FSUA 1ITZA 3IG1B 4TLLB 3SVLA 5AJ3F 1NP6A 2PUCA 1ZZFA 3OT1B 4JBWA 2IBSA 5CNJA 1PVOA 5H9VA 2HQDA 1G5TA 4A0HA 4Y00A 2J0XA 4DR4B 2CNDA 3K0BA 3EZYA 4XSHA 1YB5A 1NLYA 5AESA 2XGOA 1KVRA 5K3SA 4QOFA 3PNMA 3C1OA 5A9TA 4BRUA 4JC5A 1T3OA 1R0WA 4E14A 3T19A 2CJYB 3W9HA 3VYVA 3OQOA 3KUEA 2M88A 3LO3A 3ONVA 4PAOA 1C50A 3NH6A 1HG1A 4WKPA 4FMBB 2M9MA 3GRKA 1W5AA 3QBVA 5KPDA 4E15A 4D98A 4CG2A 4ENRA 1KYVA 5ALEA 4RKRA 4RFLA 3ON5A 1CQIA 1H66A 3J81j 1IR1A 4PZ9A 2I6FA 3TBFA 2NT3A 1DQRA 4V1Ak 1YQDA 4DXDA 1ZMOA 5LJ5Y 2P2GA 4FQ5A 7MHTA 4D3GA 3CRQA 4ZK7M 3SCKE 2LVWA 5EWJA 2A5LA 2XCOA 5F78A 4QT4A 2IOHA 5LDDC 2IZ5A 3GFPA 2FNAA 1EGHA 4JOBA 1GZ4A 2CCKA 1UDXA 3QLUC 3UA4A 2IZ0A 3LT4A 1F1BB 3N6MA 1H9BA 3HCNA 2FPWA 2HHAA 3CRNA 3I2KA 1VSUA 2BI4A 2SHKA 1MN9A 3UMFA 1HMPA 2DHRA 4G1FA 4IFTA 1IBLB 8ATCB 1U9JA 3GLVA 4IYJA 2IOFK 5DETA 3MCOA 3BQMB 2RNEA 1N3LA 1Z4PX 2WWWA 3GJRA 4FYYB 2J0SA 2HNKA 5PNTA 1RFLA 3T5KA 1HNWB 4FXOA 4B34A 5HSPA 4WZQA 1BG6A 1GV1A 3TTXA 4L4ZA 4AICA 1TQ8A 3KUCA 1IBRA 4P3PA 5KG2A 1PJ7A 2QW8A 4USJC 3R8CA 5E4FA 1V2HE 3FBCA 3EW9A 2HHCA 2ST1A 5CVCA 1HE5A 4MTLA 1YX2A 3QMQA 3ZXYA 4GC5A 4UF4A 2V2ZA 5EFZA 4AZ0B 5IT9U 4KDFA 2QD1A 3GB0A 2YJGA 3CKYA 1M1UA 1ZYQA 2RAUA 4FXPA 3FKBA 5CHCB 4MVJG 2A0KA 2AOWA 2ZI5A 2DGDA 4WN3A 5CCEA 1QMPA 4YLGA 3IR7B 5KSPA 5CJPA 1HNVB 4PZEA 1L5KA 3N6XA 3REGA 2HL6A 1QG2A 1EAMA 1KBQA 1YZKA 3EJWA 3KMSA 5A06A 5LU9A 4PTLA 3I2HA 5C32A 1P61B 1HDOA 4Q4JA 1FTNA 1O97C 3LCJA 4HDSA 3LGNA 4EPRA 2JLAA 1NU6A 2IX3A 2J30A 3VBEA 3I9V1 3TDKA 3RIYA 5LM7E 3FYTA 1Z36A 5DGXA 2MPUA 1YKFA 2XE8A 2JJYA 4FPXA 4MITA 2YDYA 4DCOA 1B8PA 4ZVPA 3ZS9A 2YVKA 2R7TA 2ZJ4A 1PV4A 1AC5A 1X7GA 1NJ8A 2PMCA 4POOA 2FV8A 2PJDA 4RVDA 1GQSA 2ET6A 4KIWA 4YLEA 2ZI6A 2RGEA 4MCJA 3QEBZ 4EEXA 2CHEA 1RT1A 3CBGA 5EXDA 2V03A 5JHGB 3HDHA 4I1VA 1ZITA 5T7LB 1XMOJ 1GGHA 1JF8A 5C25B 1H2WA 5G4LA 3M1VA 2RI1A 3E0QA 3VH3A 1L7DA 2ADCA 1SQSA 2WVFA 2OPSB 3A4TA 4M87A 4JLSA 1OLXA 1O77A 1ZJYA 1XZJA 4B3JA 3CTPA 4YMWA 3VI4B 4C0XA 3S2EA 1VG9B 2PUVA 1UM8A 2QVXX 4NL5A 3BO3A 3WMFA 2PE8A 4IO1A 3DDKA 1MWQA 2FZCB 2X1LA 4BN0A 4X62J 5EYPB 2HRZA 2AJFE 4PSKA 2VTBB 1RYHA 3G5AA 5AI4A 5CGQB 3NGDA 1SMKA 4YRIA 3A31A 4ETIA 3OMXA 1T02A 4DR1B 3PTAA 2C82A 2JBHA 2HMIA 1QLHA 3E3AA 1RD4A 1W4RA 3I5AA 2VNSA 1NPDA 3A36A 4LZOA 3L93A 3SZLA 4EHHA 3FSXA 2IPAB 5BQPA 4Q03A 4DQDA 2CXEA 5LWQA 4ODIA 1PT9A 1AGRA 4W9NA 4ESOA 3ET6A 2VSOA 3AP1A 2DFNA 3MN1A 4R3UC 5FUBA 2V63A 1KVUA 1JHDA 2QTAA 3LK7A 3BR8A 1LRJA 4JUDX 4QO7A 4NPHA 4KXWA 2BFEA 2OR3A 4C7MA 1XU4A 3QWFA 4TWAA 4IOJA 2WHYA 4CCWA 2IAJB 1TK8A 3OTOB 4TGLA 3TOCA 3JQEA 1N36J 3BWMA 3H87A 4YI5A 5BJRA 4L3NA 3X1ZA 4WFBQ 3WR5A 3CG4A 1RBQA 5DNCA 1E89A 1PV2A 3CT4A 4CMBA 2JCYA 1IHDA 4IHJB 2I6GA 2QAGC 3MM7A 1ST3A 1ZTTA 3R5JA 3KWLA 1XR5A 3TMYA 3ISJA 1QO0D 1ZJWA 1W7WA 3KEQA 4JP1A 3VZHA 3DLTA 4ND6A 1ZO8A 2IPLA 3GFFA 4FNMA 2OPRA 1XTJA 3W4KA 5AVTA 2C2WA 2ZYDA 4DX8H 5C53B 4TWBA 4TWZA 4LMZA 3PIPQ 3DT8A 4FQ8A 2P9FA 1JYEA 4YJ2F 3CCMS 3UYKA 2FMUA 4ZKDA 1UWLA 2G04A 3ZWPA 1KYQA 1CY6A 3OEHA 2OBNA 4WSOA 1UDRA 2K2PA 3D6HB 5CDSA 1E2HA 2DQ4A 2XZPA 4N5DA 1PCXA 3Q5GA 2UYGA 4HXEB 3LA0A 4HDHA 1DC5A 2ZC4A 1C9EA 5EZQA 3OPXA 2TMDA 4J9VA 3ZN2A 2VTVA 4Z8XA 2B8EA 3D1HA 4BP1A 3AHIA 3UK1A 4UOGA 3EEFA 2I2BA 4UU7A 4CMIB 1ZWLA 3K4QA 2WF8A 4HI2A 3OWHA 2HZBA 3V3TA 3FCEA 3X1WA 3G13A 2RH9B 5FI5A 1HQCA 1FDTA 5EMLA 5CW2A 1E9RA 2LYVA 2B34A 4JV5B 4IG3A 4R7TA 3WAKA 4KFRA 1RZRA 3KMQA 4EG0A 1KU0A 1KIMA 4JBNA 1CUJA 1WKKA 1OX6A 1WDMA 2DPIA 1NF9A 1P4AA 3UD3P 1LBHA 2QAGB 3ITDA 5AE2A 4EL5A 3I55S 3UD4P 3KQVA 5JE8A 2C2OA 5E8RA 4R2MA 1SXPA 3AHPA 2G1AA 4QBUA 3JX9A 2LBPA 4G09A 5K8JB 3I2IA 1XRNA 4FMDB 5CBKA 2EC0A 1VLYA 3M6LA 4BMSA 2AVNA 3GWCA 3CUEF 3H16A 4NZ0A 1CY1A 5G4KA 3ZIUA 1O6XA 3CUTA 3CF2A 4EPVA 4P35A 4MGKR 1F12A 5LP1A 3GLQA 2BFMA 5GMOA 3B36A 2FUG9 1R12A 2YC4C 3DCNA 2YKAA 4K28A 4UATA 1RBYA 1ZOTA 2NXUA 2BJDA 1RMTA 2GI4A 2DSTA 3OXLA 4DV4B 1KQGB 2X7IA 1PC5A 1EEHA 4JP3A 3F5SA 4WOCA 5BT9A 3PL5A 1T1GA 4RCZA 3KS9A 2LQJA 2J9CA 1D4ZA 3VGTA 3H13A 3RRXA 1S9DA 2B92A 1C4WA 1E1QA 1CUDA 1OFGA 5BSEA 1HQUA 2PX4A 2G88A 5HUQA 2WM2A 5LVAA 4WAUA 3QUBA 1WKVA 5FDFA 3ABRB 3LNTA 1D2CA 3A8TA 3I09A 1CS4B 2OY0A 3Q72A 4KC5A 3CZQA 1YLXA 1YS4A 1Q15A 1F9HA 4ED0A 3GGDA 2MKHA 3TFOA 1TK3A 4QYIA 3PXUA 1NXSA 2KHZA 1UXHA 5JMTA 2EJVA 3U0BA 3Q8YA 2CT8A 1DTTA 3FETA 1XHLA 4KXFB 4ALMA 3QLHA 4W1PA 1E3IA 4BMPB 1NK0A 5AQ1A 4WP8A 2APOA 4EB0A 4YCSA 3Q8UA 4DR6F 3T0GA 4F26A 1JNZB 4LI0A 3KETA 2XNQA 2EATA 3O7WA 2M2IA 2AQ4A 1F3VA 3IR6A 3LP1B 2KJVA 2NZ4A 1N9GA 4ES1A 3JAKB 1RT5B 2QM7A 2HHJA 3L0CA 4IH4A 4Q4HB 3WLIA 2FR0A 4L6V3 1X1TA 4C9DA 2EBUA 3ZNQA 3V4MA 3EZGA 3IAM1 1S4FA 3FDZB 4MR7B 4QUAA 1DCMA 4FKYA 3IRXA 1EP4A 2IXGA 4Z2YA 3SG0A 1XEXB 2VR1A 1X0FA 1VCMA 3GYGA 2NMVA 3H7HB 4ZVSB 3DLIA 1JXLA 1FNCA 2IA5A 1TT7A 1S9HA 4A8TA 5DULA 3MEEB 5KCZA 1Z29A 2VFRA 5CYJA 5DMHA 4EG1A 2IE8A 1EKRA 4YROA 1V71A 1PJZA 1C7ZA 3QVXA 3MD0A 4NZ6A 5H02A 4LYDA 4IKAA 3W2HA 3RO7A 3OJFA 2Z09A 3QWIA 1CUUA 3EC7A 4F5ZA 2YWRA 3UQYS 3QIPB 1QB8A 1XRMA 3MWDB 3ZKWA 5JUWA 3H1FA 1TL3A 2WW4A 1EX1A 2XSJA 2QTCA 3MYRA 4EG5A 4KZKA 1SKQA 1K6IA 3J7AC 1QVRA 3BRWD 2WSEC 2RB5A 2XMAA 4UNIA 1N6OA 1PJ3A 5IG2A 4DV2J 1UZDA 3OI7A 1G21E 4LQDA 3CCWA 2O59A 2IK8A 1CFZA 2MLXA 4IG0B 5AJWA 4MV1A 4HATA 4IDGA 1RADA 2VQSA 2XMUA 2CDRB 1G6OA 3NNDA 1BFDA 1E94E 3P0HA 2KB0A 1TL1A 2ZAOA 1T0HB 3I31A 1T5BA 1GADO 3MPWA 1VK3A 4PZUA 2HAEA 2FZ5A 4NCBA 3USES 2ZSJA 3S2FA 4CO5A 1S72S 1NRIA 2IHVA 4O8CA 2PEYA 1FDBA 4LHSA 3ROFA 3SYTA 3TUIC 4DSOA 1B1AA 4R2JA 5ETNA 4ANEA 1A9PA 4EVIA 1RAGA 5DI9A 4MAMA 3OBBA 4I4BA 1JE1A 3GDHA 2A84A 1EDOA 2BV3A 4BO7A 4EPYA 4NR0A 2AJBA 4DLEA 2VK8A 1PWZA 5TMBA 3L7OA 4EFNA 5FA6A 3KQTA 3LOPA 2DPMA 1Z73A 4LDPA 3QG1A 2YNIA 2ZQYA 4WKBA 2OB2A 3LA6A 2N75A 1JQBA 4RHUA 3Q3JB 3UPFA 4YJ2B 2Y1OA 3D2LA 5JAQA 2AMJA 4OJMX 2HIYA 1NRKA 3I4PA 1T3TA 4NYOA 3TYXA 4NXMF 2NZWA 2VG8A 1C7JA 4EPXA 2GHPA 3AEQA 5IDYA 3MUTP 5CB0A 1XQXA 4BFCA 1B3BA 3UTDA 1NK8A 4CLHA 1L4GA 2QLMA 4KGXB 4RD2A 3PIDA 4PNEA 1B3RA 3DBOB 4OJ3A 2W2QP 1C3XA 3G71S 10MHA 4DIOA 2BFDA 3B89A 3ZDXB 4EATA 4IFEA 4P9NA 4IZHA 2W2PP 1SPXA 1HNZF 4LXTA 1AKNA 2AYGA 2J6TA 3LNCA 4J49A 3W04A 4DFJA 4R05A 3K5PA 2AHOB 3O2IA 4YP9A 3HDYA 1TZ2A 2BUCA 4BWFB 2WJ3A 1AQNA 1TVCA 5G3ZA 2O2EA 1C9DB 2J7PA 4CYMA 2ZJ5A 1BWSA 5FBRB 2PLFA 5AXLA 3SCIE 2OPPB 1GTJ1 4G4SO 4QUHA 3NBMA 5HCUA 3P3DA 5C81A 2YZGA 2QZZA 3QMWA 5GONA 4YVFA 4AURA 1IZ8A 3G2NA 2IKSA 2P75A 3VHQA 3HP6A 1V47A 1TAUA 4ND4A 4PCAA 4R2KA 5KQSA 3ZY2A 5BPFA 4DR3J 1ESCA 3ROTA 4MV5A 2RILA 1KSPA 2D2VA 1ISPA 5FJIA 2J7KA 3MGBA 4QDKA 1PJCA 2AN3A 1FK9A 2LFVA 4GLFA 1HRKA 1V9SA 4OHKA 3KVVA 1RCFA 2PSZA 3DDNA 5HVHA 2O1EA 3AL2A 1ZHFA 1L5ZA 3BCRA 1ST2A 4I7FA 2CNWA 4UFNA 2YY3A 1DJ0A 2D1CA 1SM4A 4V3BA 3EDYA 3L8DA 5J4HA 2Y2UA 2PGJA 4PXYA 4LCJA 3QKUA 3DE5X 4IDFA 4HLQB 2CJPA 2EQBA 3VDRA 2JFHA 1T03A 2JVJA 2IE0A 3TQSA 2BE2A 1AKUA 3JPYA 4JQCA 3ZWVA 4M9CA 3EQ7A 1IN0A 3QJGA 3OC0A 3A6HA 3KU4A 1ZU4A 3NKLA 1LEHA 5ADUS 3DLAA 5CRIA 1XGKA 4Z7YA 4BNIA 4XSVA 1XR6A 3Q8QB 3DU5A 2ODPA 1N0HA 3K0JA 4WFJA 5EPUA 4KRGA 2AZ3A 3TLKA 4RA6A 3R4VA 5ALZA 1EP2B 1Z35A 3OKCA 3M9OB 1W2WB 5BVGA 1IQPA 3M5WA 2PPLA 3DXBA 1JEDA 3L8MA 2XIJA 4J1NA 4XWTA 3GDOA 4FFPA 1IVSA 1G9TA 3FJ2A 5FTNA 3AKZA 1WXHA 2HNBA 2D8MA 2X8JA 5CVJA 3KXDA 3E82A 3JRXA 3CMAS 2IXEA 1QY7A 3F6CA 3U56A 1ZCJA 1ZWKA 5A4MS 1EX7A 3U4HA 1AUXA 4NSNA 4KN9S 2BRKA 4A1FA 4GL2A 4OHYA 5MDHA 4MS4A 4CLEA 2E6UX 2AI3A 2P6MA 5AUOB 3T3EA 2HXGA 5CM9C 3NIDB 3WG9A 5FBZA 4X4UA 3WMEA 3N8HA 1UFKA 2X1HA 4B81A 3HYTA 4FGWA 1OPXA 4DR2B 3BD9A 4LRYA 1YR3A 4B3SF 3RIHA 1ARZA 3BRSA 621PA 4F3RA 2VJLA 4LF8J 3N9UC 3DBHB 4DHEA 4J0IA 1WMEA 4DVJA 2O50A 1WMBA 1RWMA 3KUKA 3SS9X 4H4MB 3RIXA 3DXSX 3GZNA 3KZVA 2H85A 1L1RA 2GCOA 1GPYA 3P71T 3OFND 1GU0A 1SBCA 2VRWA 2V2KA 2DHGA 3R6DA 4I56A 1X80A 2DHCA 3ORFA 3CN9A 1ZPWX 4CM8A 1VA4A 1GL3A 3OA2A 1UBFA 3ZZRA 3PX0A 1TQ6A 2CKMA 1HG0A 2Z9BA 1FSZA 4RQTA 2OD7A 3AVVA 3AERA 2RHQB 4IOCQ 1S9GB 3PG9A 2MKSA 4QW8A 3ZZYA 5CAAA 4U00A 2B8QA 4MDFA 3BJZA 3IBYA 3BSNA 3MJCA 3G5TA 4OM8A 2NSYA 4CM1A 1M8JA 3X3UA 1XQVA 3GJXC 2HNYA 3DOCA 1GGKA 3OFNA 4JI0F 4YQZA 1M8FA 1M67A 3W6ZA 5HSGA 1CTQA 2G71A 4I1UA 4WTYA 3OX4A 3QMVA 2WD9A 4IDKA 5TARA 5ENZA 3GUYA 1GD1O 1TQ4A 2DY1A 1LPMA 3IBWA 3LP2A 4O3RA 4ZRDA 4O3FA 3QLHB 4RUHA 1TRHA 1VL6A 2Q21A 4EPWA 3LO5A 2OBLA 5IKEA 5K01A 3MB8A 3FK4A 1HNXF 2J45A 5EXPA 1LWXA 3DFFA 1XU7A 5HANA 3AX6A 3GFOA 1ZINA 5A2GA 4CIOA 3DB2A 3KR1A 3NGXA 4MQMA 3ZU4A 2HA5A 3CCZA 4QIGA 3VU1A 1G3IA 4I8IA 1O89A 2COKA 1QSLA 1FNNA 1YZNA 1XPRA 4BRSA 4R5MA 1RTTA 3GUHA 4DN6A 2PXXA 5KMGB 4LWOA 4M63A 1P1JA 4FW8A 1VSBA 4NE9C 1E1LA 4L51A 1YHYA 3DE1X 2RQMA 3C8HA 3UOGA 4D1YA 1RC8A 3THSA 4DC9A 3BB1A 3MS4A 4WK6A 4BQIA 2HDHA 3OQ2A 1VXOA 2HMAA 1S1WA 4DKXA 2GWRA 4CLDA 1XA3A 3BJIC 2DRDA 3C1AA 1O9GA 2G70A 3W3AD 3HJRA 4ZTUB 3JTOA 4WLFA 3DZDA 4RMHA 4QYMA 1N3BA 1FX0B 1JU3A 2XA1A 2UUCF 4I68A 3CRVA 3GLSA 1WBDA 4QODA 2DEJA 4DR5J 3IJRA 4ABTA 2HUPA 1L7RA 3JASA 3TFWA 2VAVA 2DH9A 1NI4B 3B2NA 5KYNA 5F77A 2Q50A 3K8WA 2OZEA 2I2AA 2YVLA 1TOAA 2XQJA 1GQRA 1QZUA 1D8TA 2ZT7A 4JIMA 3B85A 4H1VA 1LLDA 3WYBA 4YT2A 4EJ0A 3QU2A 4PYMA 2KZZA 1JB9A 4AB1A 4R8UA 2ORIA 4KGDA 1QYIA 2ZE7A 3EX7C 5ELMA 4GI7A 4H59A 4B6PA 2F8SA 4UQTA 4N3NA 3HSZA 5CA0F 1TL1B 1Y3HA 3P9NA 4E3ZA 2HC9A 4PZCA 2Z43A 3PDWA 1IE3A 3SJAA 3AQIA 1SG6A 1G16A 1RA7A 5EP4A 4Z1MA 1DBIA 4E21A 1RKXA 2X0FA 1GZSA 1FXWF 1IY9A 1RBOB 4CL0A 3QH4A 2VXCA 4O6VA 4NPOA 4OOFA 1CC7A 5BUQA 4XW2A 3HT0A 1L9KA 6NULA 1UEKA 4ZOQI 2I4NA 3ELDA 5LP6B 1KDOA 3WP0A 2FVCA 1MVOA 1OAAA 1Y1PA 3T7AA 4FNGA 4DLVA 2PAFA 5KHOC 3ZNPA 3G6WA 1WC5A 5JSHA 1E5DA 4F2GA 3UXEA 1QH8B 2XQFA 3JQBA 3VRHA 2GA9A 1SBZA 1Q1ZA 5ITHA 3DO6A 2HFVA 5DK4A 5K45A 4D46A 4EHIA 2G9OA 4MCAA 3X1KA 3IFSA 2W2NA 1BD4A 5CYFA 2J0SD 1X7WA 3I0RA 1LWOA 2FX2A 1SCJB 4KU4A 1JVSA 1SUBA 3MIIA 1E6YB 1Z6TA 3I96A 3IA0A 1C0EA 1I0IA 2A0UA 1JLLB 3FKSD 4C0QC 5JALA 2VDIA 3ZDRA 1P8JA 4RZQA 1KO5A 5B1IA 3CPWR 4L8WB 4LZLA 1GPDG 3GQBA 4WK4B 4FONA 4A8JB 4TNOA 2AMYA 3BO2A 5KFSA 1F2HA 3VX4A 4HDKB 1JDSA 4TRRA 2WVDA 3N8KA 2V6AA 3MPVA 4TLBA 4OXYA 5C4IA 5GAGI 2ORYA 2Q7OE 3AJAA 3BHMA 3R6GB 1RTHA 4HN9A 2YFHA 3BFVA 4HDSB 1HDRA 3SEZA 3P49B 1IR2A 1GA1A 2CN1A 3CJTA 3EIUA 5ALTA 3LLSA 2HNZA 4BNYA 5L3QB 4OZ3A 1KQSR 2F59A 1J90A 5CW1A 3CX3A 4TZTA 1DC8A 2I8CA 1EXMA 5KSZA 1OWNA 2FPMA 2R8JA 2R7NA 3R6TA 4CE6A 1H2HA 1RRGA 1IKXB 1TMOA 3UXHA 5CYPA 2PWAA 5IULC 3GIJA 2OGUA 1VQLS 2PL9A 3BKWA 4DOZA 2FPHX 4X0EA 4WKCA 3BV8A 3LUDA 2VG7A 2PCLA 1PZFA 2ADOA 3GY0A 1AK2A 3A1SA 1YI2S 4Q1AA 1E2PA 2EWMA 3FZGA 3GLFE 2G9QA 1V9CA 3LSYA 2ASYA 4D2IA 5KSOA 3BWEA 5DHQA 3U3ZA 1RWNB 1P9WA 1MNQA 5FDLB 2HPVA 2CADA 2XMWA 5HMLA 3K9WA 3E8OA 1KAEA 1NOKA 3GRYA 4R9UC 3NCQA 4JLMA 4RE5A 1A27A 2X8AA 4NRDA 2MT9A 1RJWA 4DQIA 2BE9A 2LIVA 3EE6A 1G4AE 1PDOA 5BSRA 3HO1A 2FFRA 5C25A 4UNSA 5CAEB 2VAXA 3DW1X 2CJXB 1A9RA 1NCLA 521PA 5KJEA 2WI8A 5C8YA 1K27A 3FAKA 4BGDA 1GN9A 4KO2S 1KK3A 3KSDO 5JYDA 3AD7C 1FSFA 1CZKA 2O2ZA 2QVYX 2R00A 1PIWA 5I42A 2VODA 1KKHA 2D5LA 2BQ3A 2HHSA 3BMOB 1C0UB 2ZPUA 5K8VA 4LRAA 4EHBA 2EGGA 4JLKA 2DG2A 5JS2A 1IMOA 3C70A 3TTYA 2QR2A 1V48A 4JJIA 1UZLA 2F1IA 1U48A 3TI7A 2IEZA 1JQGA 2W71A 1CZOA 3NRBA 3PCXA 3AEXA 5JNRA 3FLAA 1ES9A 5DBIA 2M8DB 4HACA 2YZNA 3V4LA 3HVUA 2LTAA 2N4CA 3RU3A 2VHCA 4BKPA 2DXEA 4F2HA 5IQ6A 1HNXJ 1K4MA 4RESA 1D1PA 3L7YA 2C29D 1HDCA 2TSYB 2ZR7A 3KT8A 3BKXA 5KYKA 1UK8A 2J5XA 4GX2A 4IKOA 3TAMA 2ZUCA 5DE3A 3DMTA 1MGOA 2R1ZA 1RHMA 2AR0A 4NESA 3IPLA 2RBGA 2CUTA 4TT3D 3OF3A 3TSOA 3VR4H 1KXJA 1Z15A 1YGYA 1OY6A 1R6YA 3H40A 2VHZA 3EDRA 4QPJC 4DMFA 1Z83A 1QGAA 3H86A 4ENOA 2QZ8A 4C7OA 1S1TB 3ZDDA 5AXAA 4FYWB 5EXXA 5B55A 2EP8A 2EKYA 5FFNA 3CZ9A 2FHKA 2XWQA 5AOBA 3E8XA 3Q83A 2O0KA 1RTHB 1N5OX 1NJ6A 1RMQA 3HKDB 5D5QA 1D2GA 4GG1A 3BSWA 3W2GA 5JHHB 4C8LA 2IHBA 4MKIA 3MT7A 4NOLA 3PPYA 4B4UA 3V1NA 2VDVE 1EWTA 4F3KA 1KZ6A 4USUA 2JL9A 4RUCA 2C22A 4OSOA 3ZXXA 3VZRA 4Y30A 5DHTA 1FMTA 4MJ3A 3H2IA 3HKBA 3CC8A 3ZXIA 1SC1A 4QWDA 4DCJA 5H4HA 2FPRA 2ZTSA 4FFBA 2IDKA 5IDXA 4LC9A 2YY6A 4IV8A 4ZQIA 1Z4UA 2NNLD 4GXNA 1FXRA 3CSKA 3G0OA 1AN0A 4M9XA 4Q3EA 3D7SA 1MRZA 5L4LA 1R7IA 1NN1A 3FPAA 3UPTA 1AXQA 2Z6QA 3T1HB 3BIXA 3OU2A 1RXWA 3LCCA 2RDMA 2CQ2A 4FFMA 3A8IA 1YHNA 2IYWA 3O2SB 2ORVA 2VK4A 1MVNA 3WIEA 3BAFA 1T3LA 3W1WA 3ETJA 3EXCX 1E7QA 3HY4A 1LTQA 4KR2A 2FETA 2W7OA 3D3JA 1QYWA 4X4SA 2CK3A 3LWBA 4NLRA 4L8YA 1UJNA 4CH7A 5E2QA 2ZM5A 4RELA 3MGJA 1NVWQ 4K4ZA 3DEYX 1IBMF 3O47A 3BERA 3OA0A 1RPTA 2A58A 3RHSA 3PC8A 4DR3B 4R5PA 3CV3A 3SYZA 2FDCA 3A8EA 2CPEA 3G2IA 2UUAB 3RFTA 2IIBA 3EY4A 1Z4NA 2ZRIA 1QC5A 4Z3OA 5KHLB 3WIDA 1U0EA 3N87A 4MS3A 1WG8A 4KAJA 3R3ZA 4KFBA 3JWPA 1NDCA 5AM5A 4BVGA 2YXNA 2RBEA 2GJ4A 3BM7A 3MD3A 3C6QA 3IJ5A 4WH0A 1YSJA 5IKOA 1EGQA 4AMGA 4XUDA 3NDIA 3EW7A 5FT9A 3MFYA 2BONA 3AR6A 2C2KB 3UUWA 4GDMA 5JS1A 1ISIA 5EKUA 2PO5A 1X9HA 4JEMA 5I7OA 2O3UA 3ILVA 4Z0NA 1NG9A 1PTJA 5L3RA 1CC8A 3PF9A 4NK4A 2DYAA 4NHEA 3UB2A 2R751 4GQAA 4EY5A 4ZT6A 4UFPA 4PWWA 1VQMS 2XDAA 4FMCF 2ZRPA 1KSHA 3JSYA 1W88A 4OMDA 1N36F 1Z62A 3W8NA 1K0FA 4A8XA 3N6RA 3ZLBA 3BGFA 4M99A 4W9RA 1KFSA 1EVKA 5GOTA 3SC4A 1H3NA 8LDHA 1X4CA 4B7UA 4W8HA 1JHVA 1PTJC 1QWSA 4XPIB 2JDIA 4BMCA 2LDIA 4LX8A 5L9AA 2QTMA 3IDZA 1Q7BA 1GWNA 3PJGA 5CQGA 4OV6B 2O06A 3CF4A 3AAWB 1W4CA 2DNRA 3BICA 2M32A 2ZIWB 4F96A 3CO9A 4QSHA 1OYDA 5I9NA 3ZQ6A 2MB0B 4J4HA 4YMGA 5FPSA 2ZANA 4QTTB 2YWCA 3ITHA 2JVKA 1HT3A 4ZI5A 9ABPA 1X15A 2CRLA 1X80B 1S2DA 4EDFA 1R8BA 3WKCA 4XQ0A 5CB6A 2XIQA 2P7IA 3KK3A 5B0DA 1ICIA 3QITA 1N92A 1F9FA 4TVSA 2NVOA 2ZRCA 4M8NE 2G76A 1U28C 2R2RA 2PZLA 2Q2WA 3PC8C 4UZBA 1CIVA 3IRXB 3JQGA 4CFZA 5ETMA 2VKRA 4CFSA 4V0MA 3O2NA 4LC1A 3HN6A 1IY1A 1P9QC 1C0TA 3HEAA 1MVLA 1X8XA 1IY8A 1TMJA 3A6FA 4UAJA 2RGNC 1WHWA 1U1EA 2HIQA 4PXCA 1XT6A 1NLFA 1OZGA 5RUBA 3OV7A 2HBYA 2FIUA 3FYCA 4AM8A 2QXYA 1AKQA 3QVGA 5IAKA 3MTBA 3I9FA 3VJMA 3KJNA 2ZSHA 4OQXA 4Z0HO 3DBLA 5TPWA 2SKEA 1CNMA 5LSOA 2GDZA 2HQBA 5MFZA 4O4LA 4Y6OA 4B2IA 2RQCA 2QORA 3MMNA 3ESBA 1ATZA 4DF3A 3L8FA 4YYZA 1CUVA 3Q2OA 3KKOA 4G89A 1EM8B 4D44A 1VTKA 1JW9B 4L4YA 2E87A 2MSTA 2JD1A 4Y9UA 1CQJB 3QPWA 4D9IA 4KBFA 1FYDA 3DPIA 1K8QA 4HFNA 2AH5A 4J3NA 1G17A 2HKEA 3DLEA 4BDTA 4LA4A 4QICA 2DQZA 1LA2A 2EFEB 4C29A 2B3TA 3ENWA 1E7WA 2EKLA 3V7NA 3AR5A 3WLTA 3N8DA 2C5SA 1MJ5A 2BH9A 3KOZA 2IVFB 2ZQZA 4D92A 2OWDA 1ZAWA 5FWYA 1B14A 5GMKa 4R1SA 4OXQA 3A12A 4V03A 2BX6A 2WM8A 1XKTA 3Q85A 4LDZA 4DSAA 2E0IA 2GN9A 4F0JA 2DD8S 5I8WA 3C1UA 4BVAA 3LLVA 1CPYA 2CLCX 2H48B 2C78A 2HW8A 1LQUA 2RKOA 5F3ZA 4KI0A 3Q7QA 3DVQX 5EUMA 4E88A 3NIWA 3RW6A 1RAOA 2C04A 2B4OA 5AW9A 2VG7B 5L3VA 3CLVA 1KRXA 4IRKA 1F9EB 3WMGA 3RCBA 5IUJC 1U2DA 2WTNA 1FFSA 4XKJA 4C03A 1NBWB 2YW2A 2C2OB 2JS7A 4EK2A 4C7KA 1S9FA 4KR7A 5A6WA 1Z3IX 3EXG2 2UUCB 2MKCA 2W6CX 1FLVA 3L0DA 1PNRA 5CT6A 5FUWA 3UGKA 3TYTA 4IUFA 4ZJZA 4N7JA 3GYXB 4FZJA 4ZHRA 2D2EA 3G5MA 3UC9A 4CEHB 2E1PA 4TUYA 2RS8A 1BQ4A 1KFCB 3V1KA 5JC1A 2VDNB 3KE8A 4NBLA 3ONQA 4DF4A 4WASA 5ALIA 4ZP6A 3WB2A 3M30B 1XZ8A 3NVMB 5CYOA 4QBKA 3MMSA 3D2WA 2PKRA 3OLXA 2GAJA 3CO5A 4RBUA 4YEDA 2EKDA 3UJBA 3ED1A 4RZ3A 1N2SA 4ID5B 2GZMA 3ZO7A 1FP7A 2EF0A 4JYBA 5K3EA 4HEHA 4EJ6A 1SUQB 4H4KC 1A9QA 3K1YA 4D96A 2A33A 5DP2A 3DDCA 5LUBA 1TVRB 2CQHA 3EYWA 3ESQA 3O9ZA 3JQMA 2O52A 1S7GA 2KFYA 3CLRD 3NIFB 4W6QA 3MOJB 1W34A 4ZQBA 4AG6A 3TB4A 3SHFA 3DDHA 2VJPA 2NQTA 3DAHA 3BB4A 1RXSA 2ID9A 5DV9A 1T9GR 4ZT2A 4MV7A 4EW3A 4PR0A 4ENPA 3I6MA 1GEHA 3C45A 1S4MA 4LAFA 4L9SA 2P5TB 4KH1A 1VG0B 4IRMA 4FOTA 4X8MA 4BFUA 2DJIA 3CRRA 1CR6A 3HYCA 3VZPA 4S2UA 4RIIA 4Q82A 4ETMA 4GO5X 4FR0A 4P72A 1L3BA 4GYJA 3K9HA 1RWQA 1GG2A 1AB6A 3ZYCA 2GMJA 4OG2A 3I9V6 2ZH1A 1K92A 3TKLA 1ROFA 3JQ6A 4RC9A 3QP9A 1PT8A 1Z07A 4TOIA 5BPHA 3NV7A 4YEAA 1X74A 3HBFA 4UPVA 4C9BA 4IMJB 1U6BA 2DPXA 3PHIA 1N78A 4KFCA 2ECOA 3FYSA 1GNKA 3LKZA 1XTBA 3DZGA 2AYYA 5T41A 3LL4A 1CUZA 1RP7A 2YYAA 3BIOA 2W6QA 1RAFB 3IP9A 3MWEA 1N33F 2XB4A 5HF5A 1Y80A 1XDZA 4X64B 1G59A 4NPAA 4B4VA 3ZHRA 3ZV7A 3EF3A 1IK6A 4U7HA 1MB9A 4OX8A 5BN5B 1OSCA 3ZCTA 4YV1A 4LRWA 1R3DA 1T3NA 1KKMA 3V80A 4CMCA 3GFBA 1Y34E 1EINA 5GQSA 1X2BA 3SZOA 5KFNA 3KJVB 2M70A 2H48A 2GXAA 4RY8A 3J80U 1FU7A 1FFEA 2W22A 1TECE 3PX6A 3CVWA 5K14A 1Y8QA 2GVZA 3HKCB 1UAGA 4G07A 2BKNA 2DAPA 4IJWA 1JNYA 2FE4A 5AJUA 1JXAA 4FOPA 3AVPA 5KNCD 2OCDA 3RJ9A 4R9SA 2UU9F 1U0OC 1KGSA 4WA8A 3MD9A 3VSBA 1PAUB 5DO9A 2G82A 3SSOA 5EJ8A 4QM6A 5G02A 3QKRB 1UP6A 4NXNF 4P33A 1RPNA 4HBZA 1G21B 1XMJA 5FLKA 3J7A1 2A0WA 3IEVA 3G88A 5ESXA 1U5BB 4OQPA 3RABA 3WNCA 4LF9F 2NSCA 4K6HA 4KYZA 1KF0A 3KZKA 1Z0JA 2BSXA 1GPWB 1OWXA 4Y9DA 1TNDA 4QVIA 1TA0A 3HFKA 3LT2A 4MMYB 2UYCA 2XS5A 1Z4QA 1E1CB 1M10A 1UEJA 3OHBA 1H4TA 2VAPA 4XGKA 1BDBA 2IYSA 4X8OA 2H1OA 2K5UA 3MEDA 1XYGA 3S44A 2J0UB 2XGJA 2V3WA 4G0OA 3EZLA 1UC4B 4U63A 4Q4JB 4XCVA 2TYSB 4UUWA 1KETA 2APJA 4JOQA 2N9UA 3HVRA 3ZD7A 4J43A 1Z4OA 1U2GC 1SJFA 2JFKA 4L75A 4HSEA 4KQMA 2Q0SA 5C4GB 4KV8A 1C3JA 3PKJA 5LM3A 3INTA 1UJ5A 1BDJA 4KOEC 4G0UA 3HJGA 4ZVTA 3I32A 4E5UA 3HN2A 3GA0A 1SCNE 4YA6A 1QTNB 2P2CB 3SN6A 4I4NA 3G0IA 4MR9A 4IHJF 3HS3A 1N2CE 3A1TA 1LDYA 2J6UA 2Q4RA 1N25A 2FI1A 2FDRA 3I37X 1H5NA 1WNEA 4GFDA 3CUKA 4KE5A 5G0WA 1N2CA 1YIJS 3KNZA 1P9YA 3K9QO 5IEBA 3TSYA 2H4JA 2O2YA 2HGZA 1VQ1A 1HBNA 2GAGC 1MDBA 2OV2A 3ZDAA 3ZZOA 2XGPA 3IXLA 3LX8A 1UKEA 2ZB4A 1N54B 4MWOA 5EEGA 1Y7PA 4D02A 2JI7A 2A3JA 3D4BA 3D67A 3KQKA 3AR9A 3ZNUA 3KYDA 5FV7A 2Z2YA 5IHPA 2X2OA 3LW5C 4DR6B 1DWUA 2K3KA 4A8WA 2HA7A 4QGGA 4Q39A 5EJFA 2NU9B 4HVAA 1XEFA 4DRXB 2UV8A 3SJUA 1QAOA 2AJLI 3GFVA 5IZCC 1IL0A 1X1DA 1MO3A 3QM1A 5KT5A 2WOMB 2Y0BB 1A98A 1CCWA 1OPRA 3N6NA 1Q6YA 1G5FA 4NICA 4WNIA 1NH7A 1X7YA 1VFNA 2DFDA 4UY8T 3K5WA 3DSRA 2XKBA 2CVFA 1E18A 5EERA 4RHFA 2GK6A 1JHOA 5ALRA 4G65A 1U7ZA 4GBGA 4N82A 5IS2A 4Q05A 3R5KA 3BGOP 1XAIA 3O4FA 4CETA 2HYDA 4OP2A 1YMUA 5JZSA 3OLVA 4F38A 4FFWA 3OZIA 1JALA 3GFSA 4IVQA 1UJ6A 4EHLA 1TYEB 1I7NA 5A6VA 3NS6A 2EKZA 2J5BA 1JDBB 4LG1A 4PWZA 2WPDA 3KDSE 3QLVC 4J9RA 3FVYA 1YQ9A 3KKFA 5JMPA 3MWGA 5IARA 1NBOA 4D0NA 3UMSA 2J59A 2RD2A 3ZZ0A 4GP9A 2D2FA 2KM8B 1Y1QA 3S70A 1KEUA 5A76A 5IFLA 3CMQA 4M0EA 2W25A 3LQKA 4PZYA 4RDXA 3WE7A 2QLFB 4MGEA 1VP3A 1N3YA 4ERXA 4B1FA 2ZIEA 2F1HA 2ONKA 4NFLA 4L50A 2QRVA 5ALHA 3GRFA 3NUZA 4NXNB 2PZGA 2ZT8A 2OEKA 3EGVA 3VCDA 4EA8A 1RACB 1H8EA 2WU4A 3BEDA 3DTYA 3EXFA 4R9NA 3K70B 4JB2A 3CZ4A 1C29B 4CIDA 1NI5A 4C4TA 2R00C 5K0TA 3H5SA 4G0QA 2QT1A 2A5DA 2WAOA 3BSSA 1N5LA 1YZVA 3GEPA 4RZRA 2L48A 2FEOA 3B78A 2HK8A 4L08A 3HYLA 4GKJB 5KOJA 2C92A 3DV0B 2B51A 2ZB2A 3P26A 1NVDA 4JHLA 3T1TA 2ETVA 5JCOC 3FN4A 4O02B 5MN6A 1OQ6A 5KDOA 1ZUD1 1YVRA 1X9WA 2BGLA 4I50B 4ZA2A 1AW0A 4RGYA 2Z56A 5CDUA 4MAAA 2BZSA 5LJLA 2C4TA 3EVTA 4Q0MA 3FHOA 3CMMA 4RKQA 3MFQA 1T0PA 2IS6A 1BCRA 5E3PA 4N77A 2G08A 1DRVA 3DBVO 2GS8A 2GF9A 1Z28A 2JFUA 2OB1A 1PK7A 5BURA 2MKJA 3QBEA 3PT5A 5BV0A 4TWRA 4NLYA 4ACAA 4A1OA 4ITSA 1RFGE 2WZCA 3Q0IA 3FEZA 1HNWF 2BE7A 1HY3A 2G0CA 2ZXEA 4YJ3B 2KXNB 4ESEA 4BNGA 1F60A 4Q7EA 3U40A 1XPOA 2J33A 1Z06A 3CKMA 1QQTA 1XXLA 1FUIA 1V8BA 1HOXA 2IHYA 1RWMB 4QHYA 3QQ5A 3RJMB 4E4TA 4BXOB 5EZYF 3RZAA 1N8KA 4NYIQ 2A5JA 4PG8A 2YR0A 3BXPA 2G9NA 5A4FS 1J2JA 5CA1B 4UREA 2V65A 5IKMA 1E9FA 5K7SA 3PXGA 4HT7A 2EZUA 4HAZA 3FUWA 2F7SA 3UHAA 3WMRA 2GBIA 1WZUA 1L7OA 4BP8A 4HACB 2BZ2A 4Q44A 3LXXA 3H0CA 1CSJA 2I03A 5FR1A 1GT8A 2H2HA 4BE7B 1F2UB 1W85B 1X7ZB 4NE7A 1A7KA 3WYNA 3H1PA 3CURA 4NDAA 5CFZA 1AUVA 2GMHA 2CNWD 1I1HA 4RIEA 4CV3A 3Q4GA 4F9GA 2B43A 2KJWA 1YXMA 3RBEA 4EELA 3D6AA 1R6XA 5KNCA 3BR9A 1NHUA 4LFCF 3NRCA 3CGGA 4URVR 2XO7A 5B0CA 3GEEA 1US8A 1F9EA 4G3IA 1DBVO 4LYGA 2YC2C 4DS4A 1WXIA 3I8OA 4GR4A 4DR7B 1M1XB 4EU0A 1TL4A 2LZ0A 4KWHA 3VKWA 1IMJA 1JFSA 2ZWOA 3KT6A 4PNPA 3KTDA 4B3RJ 3TD9A 5FBQB 2VDWB 3ZCXA 5LXTA 1RTIB 4ZHQF 1WZ2A 4WQMA 1Y8AA 3TZCA 1JSLA 1KZ7B 5K0SA 4J03A 3EFOB 2I33A 5L4SA 1SBYA 2VRCD 5B1EA 1P9OA 4WOBA 4KMOA 2IRUA 4Z4QA 1CRPA 2CJ9A 2XA9A 3VR4D 2QZPA 2ZYSA 4PPYA 2CNKB 2D9PA 1OMOA 1K66A 2F3QA 4UJ5A 4LF1A 3NHAA 4OQLA 4YAGA 1ZA1A 4S0MA 3N5FA 3Q7EA 1T6YA 5JRDS 4BNKA 2AYXA 2HO5A 3PJFA 2IYXA 4DAEA 1XRQA 3PRBA 3SWWA 4QXAA 1SU4A 2QY9A 5E2AA 4W7IA 1ZK1A 2C2XA 2CXPA 4K26A 2GX6A 1XD8A 1RHJB 4YB5A 2G1DA 4BLSA 3AGQA 1Q81T 1A8IA 4RX6A 4HK4A 1FX2A 1FWLA 3A27A 4NEGA 3HEBA 1U0HA 3AFHA 2PXHA 1GPNA 4KWTA 4K4YA 1XEWX 5LOVB 3WA7A 4GH5A 1Y8CA 2V1UA 2JFXA 3SSSA 3KZNA 3PVZA 4LZJA 1UFLA 1PR0A 2MQQA 2RGUA 3QEOA 3H1GA 4J1SA 4TMZA 1ACMB 4DV4J 3HYRA 2ZJ1A 3DBLB 4CUJA 4INZA 2YNFA 4QECA 4PHGA 1ZU5A 3AZOA 1LXCA 1YT5A 1J5EB 4G1BA 3A4IA 3M05A 5EDWA 3ANMA 3OCXA 3I52A 1QHSA 2JK0A 4FNIA 4C0LA 3W5SA 3QGMA 3AR3A 2R68A 4L2IB 4V0NA 2IEYA 2ZFUA 3TR0A 1HRDA 3JZMA 1KIFA 3M4ZA 5K2MA 4QJ3A 4UBLA 1K0VA 4CR7A 1N0IA 2ZVJA 4GWKA 4GI2A 4G2TA 1EK2A 3VHXB 4II3A 1DEXA 1ZM2A 4N3AA 4QOJA 4BGUA 1WXXA 4I3FA 2YXPX 3UMMA 1E0AA 4NEHB 5DGDA 1I36A 4NOJA 3VSEA 3C8YA 1SK9A 2EERA 3D6VA 5JLJA 4IQGA 1GHTA 2ZH7A 2XEXA 1VL5A 4E5SA 3OMWA 2MSKA 4L4RA 4W5QA 2GFQA 5JMOA 1T0JB 3BN4A 3FMPB 4EUHA 3WGZA 1NB2A 4RHYA 5K6RA 5FORA 3WGVA 2PGAA 1I6MA 3UN1A 4HWTA 1KR2A 3TZXA 2C5FA 4A15A 1D8AA 1E7MA 3UENA 3IAS1 2CJFA 3SX4A 5ER6A 4ZCQA 5P21A 3ZW9A 4MH0R 3TRKA 2ODAA 1NAIA 3E48A 1XIVA 1KAOA 2WPDD 1ADFA 4OQNA 2OP0A 2E49A 2HZ7A 5BV8A 2NTYC 2IIQA 4MYHA 4FXDA 1EUZA 3FB4A 4JUZA 3VHLB 1Q86T 3WOVA 4HGYA 1PGZA 3EZXA 4WADA 1Z8HA 2RJ3A 5GIOE 3T7KA 1D1TA 3I0SA 2W6JD 2VOOA 2ZRJA 1T95A 1D9DA 2ZJPQ 3UKOA 1UBMS 4KQ9A 2BEUB 3X2EA 2ONYA 3OZFA 3RJZA 2I91A 3Q3GE 4IEIA 3WTBA 5FOTA 4F4KA 2LEBA 4HEA9 1L7NA 5ENDA 4N0PA 2ZKLA 4OLOA 1QBGA 3OJEA 4ZN6A 4YR0A 4MW7A 1LF5A 5J3JA 5KVQA 5FCDA 3LGMA 3C3CA 3FVVA 2YN2A 3UH1A 3KUXA 5A8WA 4I66A 5B64A 4USTA 1F6TA 3FWNA 2IH4A 3B3AA 1MJGM 1KJJA 4H4OB 2VKQA 3EAGA 1Y8RA 2F1FA 3PHHA 2FDXA 4R1NA 5K0FA 1IAQA 3ROMA 5JQGB 4KFUA 3V6DA 2OQRA 1E5LA 3I92A 3PR4A 1XIQA 2XJ4A 4MYUA 1RIIA 2MZJA 2PVPA 3RWMB 2A0YA 5IDQA 3I8SA 1SJRA 1HT1E 1BVRA 1NP7A 3QVUA 3SGLA 3H2LA 4BEBA 1NVEA 1VIVA 1HKAA 5JAPA 1KZHA 1F7VA 3AWDA 1RI1A 4KR6A 2F1JA 2WIDA 1GUDA 2MKYA 4M9UA 1I51B 5C42B 4H6PA 2CNLB 4ZCKA 2HHXA 3D8BA 2PG3A 3ASYA 4B17A 1DRWA 3I0RB 4KGZB 3WLPA 3M4XA 3ILYA 2NUTA 2BEKA 2I67A 1NAQA 2QYHA 3CINA 2BOPA 1RLOA 4W8GA 2X8BA 4OKIA 4ZOLF 3U09A 1JIIA 1YMVA 2W2MP 1EK1A 4I3HA 1M2FA 1VBMA 3WY9A 4L0QA 1XTVA 3AHHA 1KC1A 3WWYA 1M6NA 1UADA 4RYLA 2PD4A 5KDDA 5DASA 4LXHA 1MHPA 3MW8A 3IBFB 2ZB8A 1TYCA 1YUBA 2VWHA 1QE1B 2CG4A 3FNNA 2RS2A 4B3OB 5B6IA 4YDSA 3T7RA 1QG4A 3RDPA 4ES2A 4CLRB 1XSEA 3GJ3A 1XZDA 4HHJA 4QOEA 2HS3A 2F7VA 3WKEA 1M0SA 4MVCA 4M0PA 3CH4B 1EUDA 3WBFA 2UU9J 1R6AA 3MRSA 5EWLB 4F56A 2ZJ2A 4IDCA 3SV4A 1VBZA 1S57A 3T5BA 3SHOA 1SBHA 4DS5A 4RDIA 4C7OB 4MV9A 1HKHA 4P52A 2Q6IA 3FKSA 1JSRA 1ZAYA 1AA1B 2DR3A 1S7HA 5G0VA 1KY2A 1EQ2A 1S9GA 1R2QA 1FZQA 2W4IA 1ODTC 4NYJQ 4BFYA 2XNDD 2F3TA 2GYWA 4WKYA 4CO1A 4RV9A 1LQ2A 3U48A 2QRPA 3FBEA 4UM9B 2B99A 2CVQA 3EDOA 1E3DA 1W2GA 4YBZA 3MYYA 4AX4A 4DNQA 4FN5A 4O0NA 1P91A 3GONA 2WJZB 1UVLA 4D9NA 4TZ0A 1V39A 5LUAA 1L4BA 3CE9A 1G8YA 1S6UA 1R8YA 3RR2A 1QAXA 1Z18A 1KRHA 2E7VA 2EHDA 2WVCA 4LY9A 2WHPA 2ZJAA 3J7TA 4HN4B 4V24A 2H08A 2XY6A 3O6VA 5B3JC 5CJ2A 4DUZJ 2W9BB 2B82A 2QTVB 1EXNA 3NGRA 1SU8A 2QNIA 4F1JA 2WSLA 3DFMA 1N0VC 1QTMA 1WMDA 1TEZA 1WG4A 3STWA 3G8TA 1DAXA 7ADHA 3WBJA 2AD9A 1BQNA 3CJRA 5K0CA 3A3OB 5JXSA 1UWCA 3K32A 3VR4A 3TMKA 3GG9A 4RZHA 2J4FA 2YNIB 3JRNA 1R0BG 4DPLA 3SEFA 4G5GA 3PTWA 4QVGA 1NUQA 2FSIA 5KOHA 3T5CA 2VK1A 1IKYA 4NZ9A 1NXIA 4RKUC 4OK6A 2PGOA 2H7YA 2ZPTX 4JLNA 1ACJA 4O33A 5H80A 5F5XA 4LYEA 1EM8A 1GK8A 2QM3A 5HATA 1EFUA 2ZGVA 1VPLA 1UPXA 2FW1A 4UOZA 3M1VB 1UANA 5J2PB 1N6NA 3EXIB 4RAOA 4DNFA 3QXCA 4GRIA 4P98A 3V42A 2FQWA 1WOPA 1BE1A 1M0TA 4G25A 1WUIS 1XI2A 4WW0A 3W6NA 3WYCA 5D3QA 3HJNA 1D3AA 1XCLA 4YFUA 3UWSA 5L7TA 1ILEA 4MMXB 3CF6R 5AW6A 1DIAA 3CVYA 4NU6A 3BGRA 4FLFA 3QPBA 4Q3LA 4II2A 2ZKUA 3MMPA 4GM0A 1LEOA 2BM9A 3WYDA 1DEOA 4NLTA 4NA3A 2QOEA 1DHRA 1M7GA 4BNWA 5DW0A 4PRFA 3M6AA 2BFFB 4ZHSA 1LLFA 2YYYA 2IUEA 1PF7E 3M2VB 1D4AA 3LUHA 3VYTB 4ABYA 3IWLA 3J7YI 3CNNA 1NKBA 3PI7A 1ADBA 2GIFA 4CF4A 1U8SA 1LW0B 3SXUB 2PO4A 1HQ2A 4GL4A 2I29A 4PYDA 4ZVSA 2JLRA 1SKAA 2IWHA 3YASA 3KYJB 2VZLA 4I6GA 3B5EA 4M76B 5FWDA 4OX9B 1ZM9A 4M1ZA 4HDKA 1SXGA 3AQ4A 5JSYA 4DDVA 2XOKD 4A8PA 5GPBA 2XHEA 3AKCA 2JRSA 4TYMA 2JFVA 2IC3B 5ETVA 4KN6A 3FSEA 3I58A 1DARA 4L74A 4RNOA 3OJ0A 3JARB 5TGTA 3C39A 4Z9FA 4CR6A 1FFAA 4WE1B 3M1IA 1T2NA 3DT9A 2RF2A 2AJCA 3DKIA 1MX9A 3H8WA 4I8DA 1JJ2R 4BJHB 1KJ9A 4WN9B 1R8PA 2XRZA 1JLFA 3MINB 4JJZA 5CDHA 2CJWA 3RRMA 3EVDA 1JPJA 3MT8A 5H68A 1FFXA 2JKZA 3TLMA 4MK9A 3AUJB 1WTFA 3QLEA 3RAFC 3EZ6A 4L3OA 2GHQA 3MAJA 3OQJA 4AKIA 1DINA 4EKDA 2IKQA 3PV8A 4CNYA 4ARVA 1TKCA 4LV8B 2YNGB 2PH3A 2AJDA 4EAAA 5KYYA 3P0FA 3MMBA 5EWFA 3GV7B 5A3JA 2QTLA 2PTGA 3SQXA 1NHVA 2R7SA 4AUMA 3DVAB 2FVQA 3RU9A 5HKKA 2VT6A 3AHDA 2VS1A 1XL1A 2HY7A 2CMDA 5ILQA 4CYUA 1WHSA 1E8MA 4YRAA 4A23A 4RR5A 3HR8A 4QIWD 5E9WA 1Z22A 4ENQA 1Z6AA 4FR2A 4JLBA 1TMMA 3H20A 1PS9A 2AW3A 3H65A 3DZ8A 3G8QA 3D6JA 4OJKA 4O3SA 4E5YA 5HFNA 3V4PB 3BMXA 4TV9A 2IRYA 3I6ZA 2WV9A 4H7PA 3AFMA 1QHNA 2BTOA 2Q5FA 2C4KA 3EBPA 3E3OA 2PUDA 4J76A 4OQ4A 3FFAA 4QPNA 5IASA 2ZH4A 3GSIA 2H7VA 4DPKA 4UE3S 4FCWA 4K40A 1KVSA 1JKJB 4U7WA 1KY3A 2UZIR 3QYJA 2XUAA 3Q3VA 3Q8PB 1DAEA 4U2EA 3OZBA 1XZAA 1UCFA 1ULZA 1VQPS 5JUMA 3LS2A 5DGIA 3PRDA 2CV0A 3ZLJA 2AX4A 2QJ3A 2OBXA 1V96A 3H2JA 3DF9A 5I9SA 3GLKA 1SU7A 4MWTA 3E0XA 1S1WB 1YZFA 3VAHA 4WESA 2CVZA 1UVKA 1JIJA 4FWIB 4MVJE 1KKLA 2XVMA 2GN6A 2Q8QA 4ZT7A 4HHHA 3D3QA 2OHXA 3NO4A 3ONFA 4WWHA 3FHTA 5THWA 1E9AA 1GEEA 1WG1A 1C1YA 2VBFA 3PGMA 4CM0A 2Q1SA 3B53X 7ABPA 3M9WA 4HRXA 4RVGA 5CYQA 4OHZA 1VLVA 3I2JA 1NBEB 1SIWB 2OFHX 1THGA 4GECA 3C5WP 2PS9A 3DDZX 3ZKWB 2XCLA 1XNRJ 1NMSA 3OP1A 1IN6A 3MEQA 3GEDA 1C3OA 2A1TR 5T4FA 5FWNA 2XI2A 2O1SA 4TRMA 2FFQA 3CDUA 4WZ6A 1AGYA 2BFDB 2LD4A 3C6MA 1U6KA 2NQ2C 2P9BA 2FJUA 2BFAA 3T5TA 3IT1A 3R5FA 1ADJA 2I4LA 4HGPA 2PKXA 3B1JA 1JLRA 2GEVA 4GX1A 2A3NA 3WYFA 4TPKA 2QN8A 2D3UA 5AYVA 1WI8A 1H98A 3DHEA 1BXGB 1P18A 3NWJA 1E99A 5MF6A 2XRYA 3JSBA 3HU2A 3L8ZA 1BMQA 3KO8A 2IJNA 1F2TA 2HWIA 4LSZB 1N6RA 1FVXA 1YQUA 2LDXA 2WJPA 5HVGA 3VV2A 4YK7A 4TS4A 3TTSA 2OCKA 2ZS8A 1QF9A 2HCRA 1XWFA 2WWVD 4ERNA 2GTPA 2CDBA 3DOEA 4B2LA 2VSXA 2COEA 3CZ5A 4J07A 2NVBA 3MUEA 3BH0A 4PTYA 3QUCA 1N9GB 5J2TB 5F1YA 4BLWA 2PMZD 2G5GX 1YJ8A 4X1KB 1VLHA 4P53A 5BP7A 4PLYA 2R7UA 2JGAA 4QJVA 4EG3A 5JYCA 4GZ6A 5CX1B 1CBUA 5BR4A 1WLYA 3QX3A 4DCVA 5E8JA 3MCZA 3WDKA 4MW1A 4WTOA 1AXGA 2HCFA 3JWGA 4MUBA 2CD9A 3DL2A 1MAWA 4AY2A 5A3QA 3RROA 1ORRA 3E5NA 1KI7A 1V5VA 1N1GA 5HM6A 3DEKA 1QPGA 3TVKA 3IMCA 2QRVB 2WNHA 5DYWA 3OFEA 2VPWA 3H5RA 1Z5ZA 4F3MA 3NBAA 1GQFA 4JB8A 3OZVA 1JDPA 3LCVB 1K98A 5I3PA 1MO5A 4Y0VA 4DDMA 2AG6A 3DE0X 1UMJA 3SDSA 5LLDA 2RB4A 1NQXA 2CZ9A 4I1RA 4XTTA 3DD5A 1CIPA 3OTGA 5E3HA 3RQIA 5K3CA 2UVUA 2YJ5A 4HC4A 3RK4A 4J6FA 1U0JA 4E2YA 1V8PA 3HJTA 3L1HA 5IABA 3DXZA 3NZEA 1KAGA 2BW2A 5AK0A 4P36A 4HAXA 4G4GA 3TJ9A 2A2ZA 5BUCA 1CUGA 1IKXA 5HQTA 2GERA 1S2MA 3JSMB 2ZI3A 6LDHA 1P1TA 1PJSA 1M7HA 4BBYA 2V6BA 3TAUA 2XZTA 2B30A 1QKJA 2Q99A 1KHHA 2JAQA 4ZJQA 2IIHA 2HEGA 8ABPA 2DTJA 1MX1A 1T3HA 3M8PA 1GCUA 4UZFA 2LPMA 4GRAA 4UUOA 4DY6A 3L7LA 4Z4IA 1ZY2A 4KVAA 4G0ZA 5HKOA 2JFBA 3G6VA 2LUOA 4BO3A 1S2IA 1B16A 2RFLA 2EFHB 4DKJA 1O95D 1H2RS 4N6GA 4XUEA 3V32A 2O23A 4U96A 3E01B 2UVWA 5ED4A 5ICCA 1TUGB 4RLEA 5LQKA 3IP5A 1MHTA 3ZQKA 3OWXA 2DSNA 2OKCA 4FBMA 3HKDA 3U0VA 3BGWA 2AEMA 2B4PA 2JHFA 5B1YA 1MC8A 3DF7A 1FRNA 2DFPA 1BMFA 1TL7B 2FG7C 2WHXA 4QX6A 5JCPA 1D2HA 1C4AA 3H18A 5JDCA 4K4WA 3B8EA 3NGMA 4S35A 5EE0A 5H9FK 1U5AA 2YWWA 2Q9CA 2DNHA 3JQBC 4YRZA 1SPBP 2BWJA 1WC4A 5I48A 2XTAA 3KSBC 3EVOA 3W90A 4RNFA 5CYMA 1AXEA 4HTJA 4C4YA 4C0BA 2JHPA 3CLUD 3CPEA 4ZVQA 2O2SA 1U9IC 3K71B 2YZ2A 1V95A 5DTEA 2M6RA 3VPAA 4BVHA 4AX8A 3V4ZA 5EJ6A 2XNJA 1YB1A 5DZ6A 3MT0A 2XUIA 3CVVA 1QRDA 2RKBA 5FL7A 1AUPA 1AHHA 3E3NA 3CVKA 1Y6RA 4PLHA 3AFNA 5ED0A 2AHRA 1EHIA 1NUHA 3V4VB 3V2HA 1XNGA 5DX0A 4CM5A 1S77D 1OC4A 4U9UA 4CQMA 4MKFA 5EIWA 1RA6A 2NLWA 1ZAKA 2C5EA 5C8XA 3BX1A 2CFXA 1PP4A 1C2TA 1OFUA 2ZBGA 4IRXA 5ALYA 4BV8A 3O83A 1J39A 2OYRA 3HCOA 3BFPA 2Z98A 4HRAA 4CODB 1RLDA 1Z0DA 1U1PA 1WX1A 1QUPA 1PWEA 4MVXA 5BR8F 1NONA 3NIGB 1UBHS 1CUHA 2FPGA 3CPHA 2VHGA 5TEWA 1ZX1A 3FYUC 4MVJF 2CJXA 4QUJA 1LBIA 2EARA 2D2XA 3PCRB 3CHYA 3HA7A 4XIJA 4Z4GA 4D3ZA 1F0XA 1KMCA 2WY2D 4CM7A 3R9WA 4CIAA 2QE6A 4NZPA 1FX0A 1G9XA 2C98A 2FUG6 2R86A 2AE1A 3DZJA 1L6IA 2AJ0A 4PO1A 4LMBA 1L7VC 2CC2A 3MJDA 3QXXA 2P9YA 3ISND 3HVIA 1X13A 3CLUC 4GPTA 2PUBA 4HZIA 2ILTA 2GZRA 4MNTA 2PYIA 1XRLA 3ZGVA 3ITKA 4QU0A 2W8LA 1B7YB 1LNZA 3EE3A 5DMXA 5KS2A 2XZOA 3RTDA 4EYIB 1AGPA 1C5KA 3EPHA 1OWMA 2P3SA 4F04A 1WSWA 4ISCA 3QTBA 4HWRA 1WDKA 4TXJA 4D0RA 1USWA 4CMKA 3LYUA 4DJEC 1D5WA 2WJHA 2RHHA 1TTHA 4JR2A 2IIPA 1KPIA 3ZX4A 4P93A 2I9KA 5BUZA 2UUBF 3SJCA 3PQ3A 3K3PA 5EPOA 2AOVA 1HYEA 4F72A 2IU3A 3FFIB 2IQ5A 1UIMA 1RSCA 4ZJYA 5JEEA 3OCJA 2VJNA 4ZFNA 2O8BB 1OFIA 3WP1B 2O3TA 5IZ4A 2C9DA 2GS9A 4XB6B 3NU1A 1IB6A 4QQ8A 4O8ZA 3R7BB 3RT7A 5M04A 3KSMA 3O82A 3I9OA 1OBVA 4NCXA 4V0SA 3DO5A 3IVGA 3RC3A 4G5FA 4N54A 4JLWA 1J42A 1E5XA 5GV7A 1CVRA 1TJPB 1C30B 3TR6A 3GEHA 4RFSB 2VLBA 2CYAA 3RU7A 3BZUA 3QE0A 4GNRA 4G23A 1CJUC 2Z3VA 3OAAD 1T2AA 4YCBA 2G07A 2VF8A 3H4VA 3Q15C 3UDVA 2OP1A 5EQTA 1N2ZA 2W2QA 5AVRA 2RIPA 4F4IA 4L8VA 2HEKA 4G1MB 4M0DA 4FMDF 5K0GA 3AERB 4R2LA 1Q74A 4R8VA 2GZHA 1U0HC 3OQPA 3ZW7A 2QDXA 3UJ9A 2P9TA 2HU8A 3RYFB 4A46A 2UXCB 3ZWBA 1M1NA 2P79A 3R75A 4USWA 4NLSA 4JVMA 2HDNB 5K51A 3JD2A 1WCWA 3M8KA 4LSWA 1RC0A 4UVHA 2Z2LA 4Y9TA 4TU8A 3K4PA 3U61B 3FWPA 1VQSA 4S1NA 4JKIA 1SKSA 4HQFA 4B47A 4DIKA 1HGXA 1M34B 5SZHB 2E4WA 4YO8A 2VL7A 3EPRA 3L7DA 1X8DA 2DB1A 4LF6F 2V0NA 5I8PA 1HBUA 4EFDA 4C3KA 4ZPBA 3SMQA 4LXXA 3G0HA 2HF9A 5DHUA 4BJ1A 4EGCB 4DLLA 2V7UA 3SZ2A 2J3DA 2W4DA 4TKUA 1HD1A 5EWGA 3M70A 4GRSA 2WU3A 2XTNA 1NNUA 4NATA 2XUGA 5CFRA 4F3QA 5I4MA 2BACA 1SL0A 1NMEB 5T3UA 2XBPA 2P5UA 1NJ2A 3TA2A 3WBBA 1YCDA 5HL7Q 4CKEB 2Z83A 1J0EA 1YCFA 3IEPA 4ZLJA 2HA3A 4MGHA 1IBLF 3OZXA 4MUKA 1LK5A 4MK8A 5E7QA 1WXQA 1O8BA 2ZB7A 2AF3C 3AT1B 5B2EA 1T3SA 4N5HX 4OQYA 5KJ6A 3KLHA 2HLTA 2BGNA 4YX9A 1T11A 4I08A 2H1CA 1XRSB 3N2IA 4QD3A 3QRQA 4KIAA 2JC1A 2QA4G 1NVVQ 3DI6A 5B2FA 5IJ0A 4ENWA 3B7GA 1YZHA 4YCNA 1YK9A 1N34B 4IRCA 1S6YA 3TTVA 4DUYB 1USGA 1XNJA 1UOQA 3HI4A 3IE0A 4JIGA 4N7TA 2C4NA 4MLCA 3L7PA 5KOXA 1DX9A 3R3VA 1N4LA 1FKOB 1CUXA 2W83A 3VC2A 1CQIB 5DS7A 1HDYA 3K6SB 1NK9A 3JXEA 3BTVA 2XT0A 3KE9A 4ZXFA 1MV8A 2R8XA 3FUXA 4MWGA 2J32A 4GR5A 3TEMA 3P27A 4KRFA 1C4KA 3RF6A 2HRRA 3DRSB 2VP3A 3HSYA 4QGHA 5FTWA 1JZQA 2DKNA 4Q3AA 3U7RA 4Z4HA 1O9BA 1ADCA 1RLCL 5M34A 4U9RA 5E38A 1X2EA 1B0AA 2X42A 4HNVA 1L5UA 4D3HA 2DH7A 2Z8ZA 2CYBA 5I7HA 1VC2A 3LQRA 2GLUA 4EMSA 2Q3JA 5K0BA 2G4LA 2BDPA 1GM5A 3TOQA 5THXA 1HMYA 2XW6A 1I8TA 5ERGB 4IDBA 4BJ3A 4V2UA 1EXVA 1WCV1 1OR8A 4HDNA 3BN7A 1M2EA 3GB9A 5ALUA 2KQUA 1D2NA 3H8SA 1FE4A 5A7HA 4N48A 1KMHA 5T4BA 4AJ2A 3NG1A 1SWVA 2CJAA 5FLXA 5L3ZA 4U3JB 1HLPA 5HCNA 5DDOC 3USZA 5CLHA 1QQBA 5JY6A 1FTWA 4UUBA 1XC9A 4Y2IA 2V6FA 2WV7A 4OYLA 4RABA 2C4HA 5JTUA 4J0FA 1U3VA 3AQOA 3TLGB 2GSWA 2IEIA 4BJ5A 4D57A 4HS9A 2F4VF 1VE9A 4IYRA 2NU7A 1WULS 3K9NA 2YBEA 3GBSA 2CYCA 1PR1A 4RHEA 3SR4A 1SIOA 3I6PA 3TEGA 3LJKA 4GOND 3GLGA 4A5OA 1G5PA 2P9HA 3DLLQ 5AJZA 4LF4F 2UZ3A 3TSZA 3FDFA 3LZDA 2OHJA 2C59A 4MKVA 4XDCA 1W5BA 1WOSA 4LOAA 4XCQA 4KI7A 1VQYA 4AS1A 3H9EO 3N28A 3P5BA 3G23A 3EVEA 2BFCB 3R0IA 3MA0A 3ZCRA 1RHRB 3RB6A 4PABA 1MX5A 3D9BA 1P72A 2HI0A 4DLNA 4M5KA 4CLOA 4NHOA 2G72A 2AYZA 2VUTA 2VQFJ 2VJMB 4X62B 4B3RB 5TPZD 1SVMA</