2E1PA

Crystal structure of pro-tk-subtilisin
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Crystal structure of unautoprocessed precursor of subtilisin from a hyperthermophilic archaeon: evidence for Ca2+-induced folding
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 131
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2e1pA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2e1pA02
1C9JA 3VYVA 3WHIA 3QTLA 1HT3A 1SIOA 3A3OB 1AH2A 1Y3DE 5AQEA 1OYVA 3P5BA 2SECE 1DUIA 5JMOA 1S2NA 1SCNE 1BE8A 1SBIA 1XF1A 3DVQX 3GCXP 3VSBA 3DVRX 2W2OP 3DDZX 3ZXXA 1SVNA 5I9SA 4KB5A 2V8BA 1BJRE 2W2PP 5SICE 3VV2A 1Y9ZA 1KDYA 4H6VA 1KE1A 1GA4A 1SN7A 3T41A 2DP4E 2GKOA 3OSZA 1IAVA 4LVOA 1SUCA 4HVLA 2E1PA 1GNVA 1EGQA 1GTG1 3A3NB 5AVKA 1S01A 2Z30A 1DBIA 1WVMA 1AQNA 3BPSP 1P7WA 1SBHA 4AKTA 3GCWP 3Q40A 4OMCA 1Y3BE 4GI3A 3ZXYA 3GT3A 3HJRA 4H6XA 3PRKE 3AJ9A 1T1EA 1ZVKA 3BGOP 2W2MA 1AV7A 2PRKA 2TECE 2HPZA 5ARCA 4H6WA 4MZDA 1ST3A 1NLUA 2W2QP 1UBNA 1Y4DE 1KE2A 2PMWB 1JEAA 1Y4AE 2DQKA 3A3OA 1SCBA 4RYDA 1Y3FE 5FBZA 4DZTA 1PEKE 3WIVA 3BX1A 1P7VA 3TI7A 2WV7A 3DE3X 1T1IA 1WMFA 1Y3CE 3D9QX 2B6NA 4NMXA 4C3VA 2ID4A 2WWTA 1SBTA 1WMDA 4OV6B 1P8JA 4I0WB 1SUPA 2SICE 1AK9A 1CSEE 4CG0A 2Z56A 3VTAA 1IC6A 5ARBA 1AVTA 1TO2E 1SH7A 4NMXB 2W2OA 1Y33E 2P4EA 3EDYA 3A3NA 1SPBP 3VV3A 1LW6E 2PQ2A 3CNQP 3P5BP 1YJAA 1SCJB 1BH6A 2Z2YB 3PTLA 1BE6A 2Z56B 3EIFA 2SNIE 4Z2AA 2W2NA 4OMDA 1KDVA 2HD4A 3CO0S 1TM4E 3DE2X 3SQOA 2Z2ZA 2Z57A 3I2YX 3LPDA 1ST2A 1SBCA 4K8RB 3D43A 2PWBA 1C3LA 1OYOA 2PMWA 1TM3E 2Z58B 1A2QA 5CW1A 1Q5PA 3DE1X 1EA7A 4JP8A 1TK2A 2Z57B 1Y34E 3QMPA 1GT91 1GA1A 2ZRQA 4J94A 5B1DA 1GTJ1 3EE6A 3TECE 1AF4A 2W2QA 5JXIA 2X8JA 4NE9A 1KDZA 1V5IB 4OV6A 4LVNA 3DYBA 2WUVA 3DE4X 2IY9A 2W2MP 3TI9A 1ZVJA 1MEEA 2XTJA 3L1KA 3GT4A 4ZARA 4C3UA 5AVJA 1PTKA 5AMXA 4NE9C 1YJBA 1SUEA 1SCDA 1TECE 5K7SA 4AKSA 2X8JB 3DE7X 1Y1KE 1SUAA 2SBTA 3LXUX 2QTWA 4ZOQI 1WMEA 1GCIA 3I30X 4KG7A 1R64A 1SCJA 2PKCA 2Z2YA 4YN3B 4B5LA 1S02A 1NDUA 2PWAA 1SIBE 1ITPA 4BWGA 1BFKA 1YU6A 3A3PB 3GCXA 1TO1E 5JXHA 1SUDA 4HX2A 1TM5E 1SELA 1VSBA 2W2PA 4M1ZA 2QTWB 4K8RA 3Q5GA 3F7MA 4KPGA 3DE0X 1PJ8A 3QFHA 2ST1A 1TMGE 2Z58A 3DE6X 3I34X 3DVSX 2Z2XA 2ZWPA 3WQBA 1THMA 1OT5A 3BPSA 4NE7A 2ZWOA 1T1GA 3BGOS 3GCWA 1BFUA 1V6CA 5ARDA 1SBNE 3AJ8A 2W2NP 2XRMA 3LPAA 1TM1E 2DUJA 2IXTA 5JXGA 3H42A 1V5IA 1C9MA 1PFGA 3SQOP 3F49S 1R0RE 1SCAA 3VV2B 3LPCA 4WOBA 1YJCA 4WOCA 1GTL1 3CO0P 4FONA 5JXJA 3WIUA 1WSDA 3H42B 2PYZA 2ID8A 2G4VA 2Z30B 4YN3A 3DW1X 1AU9A 3SICE 3I37X 1GA6A 4DJ5X 3VHQA 5FAXA 3A3PA 3DWEX 4CFZA 1R6VA 4DWWA 1NDQA 1SIUA 1SUBA 1SPBS 1CNMA 5B1EA 2XTJP 1TM7E 3AFGA 2WUWE 3CNQS 3F7OA 3UNXA 3DW3X 4CFYA 3DE5X 1MPTA 1C9NA 1Y48E 1GNSA 5FFNA
chains in the Genus database with same CATH superfamily
1J7JA 1LNZA 5J2TF 2YYZA 1RAOA 2QAIA 3DO6A 4IQ8A 3CUNA 3CW2A 2HHHB 4LYHA 5JAOA 3O7MA 1OQ6A 2XQJA 3PF9A 3I5YA 2H4WA 1G2QA 3QFWA 1C14A 1L5LA 3KDSE 2HA2A 1UBEA 3PDNA 3VV2A 4NCGB 3UUWA 3R6TA 2GS9A 3T9DA 4KMMA 1LW2A 3Q8KA 1X1DA 2XYPB 1DNPA 2CMKA 1MDFA 2OILA 2IP4A 4PE5B 2V5VA 3MMBA 1XMBA 4RQTA 3WK8A 2CJAA 2E4XA 2Q1XA 2HQ3A 4WZ6A 3IPLA 2FZCB 3FFWA 4QBTA 4DIFA 4JV0A 2P90A 3GT3A 1WMAA 5MAOA 2X42A 4DRYA 3TQTA 3CRVA 3F6YA 3HMJG 4DXAA 2HDOA 1ZNQO 1T03B 5DG8A 3ZN2A 1SBRA 5B12A 3P9NA 2Y1IA 1ZGCA 2JH3A 2R6ZA 3O2SB 5G0VA 3VPFA 4NLQA 1BCSB 4X8MA 4FD2A 5GJBA 2WYVA 3JAMY 4RVGA 5BN3A 2D1QA 2H48A 3B89A 4DR6F 3V48A 2DIUA 1NPTO 1YWGO 1NQOA 5FPKA 1XRLA 1B8VA 4TKLA 4KLRA 4CNYA 4TTPA 3CW9A 2BEUA 5A9RA 2PQMA 1SVUA 2XHCA 3SEZA 4R3WA 2C5HA 2ZREA 1SUPA 2VDNB 3F6BX 1TXGA 2EBEA 4RKRA 1NBMA 3QT8A 5LLTA 4Q3OA 1R27B 1IC6A 2WILA 3VU1A 1I4EB 5AHKA 2WPDD 3KLMX 1JQAA 4R1MA 5CX1A 4WJBA 3K0FA 1W19A 4KV8B 1H2WA 3DEKA 3RS3A 3QU4A 4MIKA 3C16B 1EVIA 4LJKA 3QWBA 4MUKA 5C1PA 1Q8IA 4TOIA 5JHGB 4LAFA 1VSVA 4JB0A 1XCJA 4UMVA 4FMDF 3W2IA 4YRFA 1YH3A 4MK9A 5IXJA 3GGGA 1FU8A 4UQPA 1G21A 1LDBA 3NGXA 4ITUA 2Q66A 5DWVA 1I1QB 4WEQA 4Y2TA 5E2BA 2WSMA 4DUZF 4ZOBA 1CUVA 3CVKA 1Z8NA 2CV2A 4HF7A 1RU2A 3VAHA 1M6EX 3UA4A 3IKTA 4G01B 2BGMA 3U81A 2H85A 2V8GA 4Z4IA 4PG8A 3IAHA 2R8BA 5AW6A 1NA5A 4BXOA 4DFKA 5B3KA 1X4CA 3DHNA 5BY2A 2GWRA 1MOSA 1V5IB 5LOVB 4ZIWA 3KSDO 4EELA 1KYYA 4PKDB 2AGPA 1XMIA 4RJJA 2J6IA 1COZA 1RPJA 2P9HA 1M6NA 5D86A 4WU3A 2YASA 5DM4A 5JTTA 3VZIA 5ICEA 1R7IA 1KSPA 3FGVA 2DJIA 2VK1A 3DV0B 3SJBA 4JOUA 4YP7A 3Q8PB 3UJDA 4ILEA 1M33A 4HFMA 4ZA1A 3NGMA 4BP1A 3TUIC 3PUJA 4RVHA 2NVBA 3W4IA 4JBIA 5KPJA 2CMDA 3ZD8A 2VT7A 4EY8A 4E03A 4G0ZA 1TO1E 2CNDA 3UIEA 2I1LA 1RI2A 4ZI5A 4M7PA 1CD5A 2DPLA 4PTYA 3AUKA 3HF5A 4NTZA 5A1TA 3RVQA 2VG8A 3C1OA 2V8PA 2HS0A 4UEJA 1JHVA 2ZAMA 2ZJOA 1RQLA 4B3OA 4V0MA 1YD7A 4ZQBA 2ZJ8A 2G8NA 4P0TA 4PN3A 4YTEA 2P8JA 1BQNB 1TQ4A 1XZMA 3G6ES 4RW6B 1E3DA 4KRGA 4KWTA 2DPJA 4A91A 1JKHA 2G5CA 3B1FA 4TLAA 1WS6A 1USKA 3CUWA 2YBEA 4BJ3A 2G1PA 4OHFA 1NTRA 3L05A 4FYKA 5AOBA 1FNSA 1CTQA 3ZKWA 1WE2A 3E8MA 3HYNA 3PCRB 5U4QA 2K7KA 3ZGVA 3KQUA 1IKYB 1M1KT 4JI6F 5AWFC 4EH1A 4EG0A 4QQFA 1Q8KA 3TZHA 4D3ZA 1DAMA 1SHLA 3WGTA 2LYVA 4U3JA 1E6YB 3OD2A 3DWEX 2JLYA 1QIHA 5FOQA 2YNFA 2BT4A 4RANA 1R6AA 3NVMB 4WXEA 3DOLA 3ZYZA 1E20A 2EC0A 1VBFA 2HIAA 4JDUA 5DI9A 5A06A 1OHHD 4XWWA 5DOVA 1FC0A 1C9NA 3A37A 4O2AB 1H8HA 3L7PA 1CDEA 2G6BA 4V03A 4U9IS 2EFGA 2G08A 2OSVA 2GGPB 1IN6A 3OLCX 1PK7A 3RGIA 2R3SA 2JG3A 3LCUA 3N3AC 5HIKA 3L8DA 4MKBA 3NANA 3T95A 4P31A 4LJ7A 3WMEA 5LOQA 2PWYA 2QTFA 2GHTA 1M6WA 3KKNA 2FQQB 4D92A 3E2MA 2F8LA 1V26A 3L6DA 2F5GA 1K5HA 1CF4A 3D3QA 3D8HA 3A6HA 2W6CX 1WDMA 1CVLA 2IM1A 1QFJA 2G77B 4LDAA 2AMYA 1WHVA 4PNZA 3UV6A 2V6JA 4MUMA 3OE7A 5J1NA 1SD1A 3WX0A 4WFBQ 1DZ5A 3G2QA 2XQCA 1PR3A 5C1BA 1MCZA 5E9AA 5JS8A 1RHJA 3DT8A 3ED1A 4XYLA 1T0BA 5B57C 3CUVA 2H0RA 4Q4DA 2WI8A 3KQTA 3TTTA 4UVHA 4J03A 4GZ5A 2WZBA 1H9BA 4TVOA 1IKWA 3O3MB 3FDZA 1YFKA 1N7GA 4DZTA 5EZYB 5KAPA 3LE8A 4RVDA 3UPUA 1D03A 2W58A 3QXCA 2KL8A 1AQIA 2EKYA 4KKOA 4GQAA 1XEWX 2N82B 3M6WA 3HVUA 3FIJA 1F3VA 2ZPTX 2IFXA 2B0CA 3IWNC 4D0NA 5EE5B 3PVZA 5H3CA 3HADA 1Z4JA 4ANDA 1FXRA 4DZZA 1QAOA 3OZWA 4JI7J 1VSTA 4FNAA 2OV2A 1A77A 4OKSA 2IKQA 1NSFA 3UJ6A 4LC1A 1Y5LB 5JSQA 1KOGA 5JLJA 4NL4H 2RKBA 3L0SA 1G3OA 5KTNA 1S9HA 3NLCA 5K8MA 1A9RA 4PC6A 2BFOA 4OLOA 4HRVA 3I9V6 3C5WP 5F9NA 2C2NA 4L51A 2F3RA 1AKTA 1G1XA 4LRWA 3QFCA 3ZZUA 3U1LA 4OZ2A 4Z86A 5I4BA 4DVGA 2LLZA 3OX3A 4ND3A 4RD4A 1A82A 2E82A 3OT9A 4C6TB 4LZAA 1XCLA 5I42A 1GCAA 1VPTA 1PZFA 4UDXX 3T7IA 4PAMA 3U0VA 3QLVA 3QOFA 3SQGB 1MB0A 1Q2UA 3MCMA 3K05A 4L4UA 2JEYA 2WHRA 5JT1A 5DXJA 2IKSA 4C4XA 3GVCA 2R0QC 1SU4A 3SCIE 3W66A 2H65B 3W8DA 1ZTTA 4A46A 4G1VA 4UJ5A 3WP1B 4DA4A 4ZI7A 4ES3A 1G2PA 3KZKA 4W9NC 2OPQB 5BSHA 4OYRA 5FJ4A 3VHLB 3JQAA 3A7DA 4N5MA 2ZROA 4BWGA 3D0HE 4ATNA 3S1LA 1YOVB 2A4MA 2P0AA 4J2TA 1QV9A 4GL2A 2YXBA 1AKYA 2BGLA 2H11A 4BWFB 1NNLA 1E1YA 2OUKA 1RJGA 2PTGA 4MW0A 2XUOA 2GIRA 5E4TA 1OPZA 2VYQA 1M8FA 2CUZA 1XQ6A 3DZJA 4C1BA 2AZXA 1KOHA 1R4AA 3FRZA 1Z6GA 4M8SA 1CS4A 3WOHA 4B6JA 3NM6B 2OLEA 3MAQA 2WE7A 4S0MA 4E32A 4LR7A 1G1AA 2DISA 4FGJA 4IDCA 4JUIA 1U6KA 3PZPA 1Z2EA 4UNRA 4URGA 3OKFA 1PBTA 1RMTA 2UVVA 2ZXFA 1UXKA 3K58A 2Y1EA 2KBFA 4Y2MA 2UZAA 1XFDA 2QPTA 3OCUA 2ZRIA 3CUYA 4JU9A 5CH8A 1A1SA 2A67A 1WNFA 1M0TA 4G4GA 1EFVB 2FQWA 3H5UA 3QHPA 1N33J 2AG0A 3W8RA 2MKSA 1TTTA 3NHZA 4CFZA 1P62B 4ARCA 2Y8EA 1X7YB 3RB6A 3KKMA 5D4NA 5IN5A 1PNVA 3TMAA 3C3LA 3HKBA 4LSNB 2ZI6A 4DLGA 1CS0B 3IE0A 1NHKL 1XZDA 3I23A 2FH5B 1CRLA 5FI0B 3HXKA 4N0EA 3FWYA 4RTMA 2IXBA 5B64A 2VPYB 2HCFA 3ADBA 1E9CA 2BYTA 4CH1A 1HE4A 4ZZ0A 4G9GA 1E2IA 4RHFA 2OSRA 1YFLA 2W2KB 2WOMA 2YJTD 4UHKA 2PKQP 4YRJA 3D1QA 2QTMA 5KTKA 4QT4A 2JHAA 3ZZOA 2ZBGA 1GQEA 1QWSA 3NM5A 4KAFA 4FS1A 4M1WA 1FJ2A 5EVJA 5KIAA 2QMHA 2XVMA 3D3BJ 3KNGA 2DBZA 4IFYA 3DMTA 5B3JA 1PFYA 2FGKA 3ULHA 1WEXA 4CTJA 5DNDA 2Q7OE 1MW9X 3FDXA 2DLDA 1VLOA 2HK3A 2XG8A 3KELA 1A7JA 4KR6A 2MYFA 5K3DA 1F1BB 3AIKA 1RZRA 3ZQJA 3CZRA 3P4UA 4RDXA 4TLDA 3EF0A 4OI1A 1SC1A 2IYSA 1OLUA 1PAEX 4RD2A 2J4CA 2OCGA 3WKAA 3GJ4A 5DNYB 5I4KA 5ALYA 2ZBQA 3HJBA 3R7NB 2JGRA 2TYSB 3E9CA 5T7BA 3IN5A 5ALLA 3FBBA 2VDUE 4QE3A 3IUPA 5EWJA 5ALIA 4JI7F 4DMGA 3QEOA 1IN8A 2JCXA 4J29A 1RT7B 4IHQA 2N1MA 2MQQA 1R8PA 1SB6A 4CT0A 5CVTA 4B76A 1U3CA 2Q4TA 4JKYA 3GFXA 1Y33E 3UD5A 1JXOA 2HMYB 3KYDB 4DSOA 2IS6A 2LQ9A 4CMEC 1BVYF 3ENWA 1N3BA 2C4HA 5EYPB 1XNHA 1NPYA 2Q5LA 5G4DA 4P22A 1HNZB 4RTSA 2O1WA 4OMUA 3NCHA 8RUCA 2D54A 2H1WA 4S1VA 1P1RA 2EFOA 1MTOA 1ZK4A 1ZW1A 1N4AA 2IZ7A 4HDQB 2VUHB 5AJUA 4E14A 4YAIA 3DGVA 4GBJA 1YU9A 1TL1A 1Y6JA 4LUCA 4L8WB 1U98A 3QMMA 3EJWA 5LJ5Y 2QJWA 4YROA 3HJGA 2R7WA 4XX1A 3QA9A 3IE2A 1OXKB 3C8YA 3PGMA 1Z6XA 4AYXA 1U4OA 3P9QA 5JXIA 3HXTA 1C7ZA 2R8GA 1HFWA 2CD9A 1XRSB 4JYAJ 2ZBPA 2VDJA 4KBIA 1RAAB 3OOSA 4CU2A 4OM7A 4ONEA 5KSWB 3X2FA 1BEEA 2HFJA 3S27A 5JQGB 1YIJS 4HOYA 2HURA 1WB9A 1IM2A 2CFRA 3OEYA 4P35A 2O5EA 3VO1A 5T6BA 2EU8A 2JLEA 4B3MB 2GO1A 4COKA 4JHLA 2O7QA 2E5IA 2PV0A 2QWXA 5FWXA 3PX3A 2C54A 1Y6QA 5IYZF 3EVTA 3WGOA 2ALYB 5EZSA 2HMAA 1BY9A 1W36B 4EG8A 4N39A 5DYGA 2JSXA 3R7WB 4CKEA 2WKRA 4ZOEA 2JIQA 2CPEA 5TGZA 2JLQA 4F5WA 2NM0A 5BRNA 1UK9A 1VB3A 3G8BA 3OSPA 5H3HA 3ILIA 5A0TA 1JFVA 1IG3A 2IWHA 1J70A 4LN1A 1RLCL 1XJ0A 4MYCA 2RGAA 1LU9A 4AY3A 3MCAA 1C0KA 2NSBA 3LUAA 5BYJA 5JBQA 4GRIA 2P2ZA 1X4GA 3I4PA 3FYCA 2Q4DA 3IE1A 2B5VA 4QUBA 1NKBA 2HVDA 3ZQUA 4O44A 2JOQA 3BK1A 4B4WA 1T3ZA 4QYWA 2OO5C 4HQ6A 1DQAA 4Q3NA 4GC6A 3FHLA 3TRKA 5D0EA 5IF9A 4ZMBA 4MRMA 1M2KA 1P5JA 3U1TA 3RVMA 4RL6A 4G85A 4UVEA 3YASA 1N33F 3ZGXA 1Z16A 1MP0A 2NPOA 4Z7OB 2AYGA 1XTUA 2R4FA 2WHPB 3ZHBA 1P45A 5EKUA 2W6PA 1O7JA 2YC2C 1POWA 3SCLE 4ED5A 4AIIA 2NYIA 3CCMS 2Q45A 2ZJFA 4XRRA 3EG9B 2R48A 4DWWA 2YXPX 1JZSA 4QFBA 1ZBDA 2FHKA 3NWEA 1F4VA 3VVCA 4CUKA 3LTEA 3WLTA 2Y3YA 1Q5VA 3BAZA 1Y1QA 5A6SA 3ESYA 4GO1A 1EQ2A 4JOSA 1K63A 3FMFA 2VHXA 3MR7A 4J4TA 4AS1A 4DR5F 4WBNF 2FX2A 3U4MA 2VF5X 5KJCA 3GCDA 5LBIA 2B0GA 2PR7A 2LU2A 3LP0B 5LZ2A 3DMNA 3KTQA 1H2YA 4XAKA 1KYQA 1GZ4A 2ZANA 2F64A 2HSEB 4A3SA 2C3OA 1MXHA 4L3NA 3IAS6 1Z6YA 5DTJA 3C14B 4P75A 4AO8A 3LO5A 1E5TA 4BNDB 4YJDA 2FMFA 5GIPE 2HPAA 4LNUA 3A3NB 3SF8A 4KXXA 4E12A 1PGPA 4M8IA 4Y2YA 2RGCA 4BYMA 2XMBA 3FCVA 4EVIA 1LWOA 5E95A 3DRSA 2X0FA 4UVGA 1IG0A 1IEXA 1GO2A 3AZOA 4K7JA 3DTVB 3HXLA 5DB4A 5K45A 2OMEA 1VHLA 1KGDA 3MMCA 4RQUA 1SHUX 5C25A 3GLHE 5G4LA 4R7GA 4LFBB 1FVOA 3LUJA 4BGIA 4DSNA 2EBWA 3JYTB 2QE7D 1Y4DE 3CPEA 4DIKA 4AL6A 4Q7LA 4ECXA 3IAXA 4JI3J 2XMTA 5DI3B 4GO5X 4K3VA 3K6SB 3ENZA 1GJRA 3BSOA 3QBTA 1OX6A 4V0SA 4MWBA 2LQJA 2YKMB 1AGPA 3R3VA 5KTOA 4KKVA 3T3NA 4PEVA 3L6EA 3T9CA 2BFWA 5KREA 5BYBA 5FAKA 2Q46A 2JIPA 3ESCA 5EAIA 3JCZA 3G82C 3L0PA 2HJWA 1EVZA 1YSCA 1HIYA 3TAPA 1NVAA 4L57A 1P7CA 4DV6J 1K08A 3E3LA 3BSNA 1UZHA 1LW6E 3SIRA 3DEFA 1K2WA 2QUBA 3H0PA 3VAIA 1IKXA 5SYMA 2R6GA 1UXJA 2B20A 3KE8A 3B48A 3GZNA 3UGKA 1QDLB 3E0XA 4P9NA 4X1IB 3A0RB 2R4QA 2XDYA 3ZD9A 3OJ0A 4RKEA 2IOQA 4YAUA 4R3NA 2HBYB 3D0KA 3NB0A 1K66A 2ORED 3QWFA 1CQZA 4GRAA 2ZU0C 3ELDA 2H4XA 2V54A 4ANFA 5HMXA 2QTCA 5C2JB 3PEHA 2QUIA 3DXFA 4J16A 4L50A 3PTWA 2OCYC 3BDEA 4NWBA 1VFNA 4IDGA 4Y6RA 1JQ3A 1TL7C 4JYAF 1AZTA 1DX6A 3W2WB 4DW8A 1S9FA 4W4MA 3EH1A 4W5JA 1AT1B 2OFHX 4EJSB 5B6IA 3PJXA 3NALA 3SFVA 4JELA 1E6CA 2WICA 1Y80A 5A4AA 4LF6F 2HF8A 3G5MA 2KH9A 2G2ZA 4MVJA 2P3SA 1PFUA 4EA7A 1QM5A 1QSYA 4V19J 4MUAA 1VCIA 2AJCA 5K7SA 3P9IA 2AFHE 1ZMBA 4AQDA 3ZDYB 5BMVB 3BXGA 5LQSA 3QF4B 2R84A 1HURA 1UR5A 5D4PA 5EHIA 5CRIA 2P5UA 4GSLA 4ZI3A 4EMUA 3O92A 4HUQB 3ISJA 3GCXA 3HUFA 2DR6A 3BJZA 3HB9A 2VHEA 3T3GA 1RE1B 3A1WA 2CWKA 3E1KA 4LOLA 5KOHB 5LUAA 2PFSA 1R5NA 1MX1A 2FR8A 4BZPA 2I2FA 3MYRA 2GTPA 3BO3A 3FTFA 1RTJA 3R3TA 1U0LA 2C96A 4K0KJ 3BFKA 4NXNB 3NHYA 5BQ3A 2HRRA 1THMA 1GPYA 3L1IA 2A57A 4NE7A 3SZMA 1XCBA 3TLXA 3MCWA 3RU3A 1WZCA 4FS8A 2PUJA 1KHVA 1NUTA 4C0QC 4ELVA 2W1BA 3IGFA 5J1SB 4YXWD 3B9QA 1FUEA 1PFGA 2IYRA 2IS2A 4XCVA 5CYPA 4Z0NA 1HFKA 2J08A 3EWGA 2FPGB 2XEXA 3OZSA 4HDNA 2GD0A 3TEGA 3HRIA 3ETDA 4EMTA 2YINC 1E1KA 1HA3A 4KPCA 1YZ7A 3OFFA 1NU4A 4MIBA 2ZUDA 2Z30B 3HHLC 2D2FA 4JVNA 1SL0A 1IOZA 3FOBA 4BFCA 2ZFHA 2Z98A 4DLLA 4Q4JA 4QUAA 2QTRA 2OGUA 2FJAB 1XRJA 2XB2A 2VNJA 4QPJC 3LY8A 1QRRA 4BLUA 3H3JA 3PXCX 2E49A 4JGBA 4OXNA 1O03A 4R9VA 3MWEB 4YPVA 1DI0A 4NVRA 2HVZA 3RVNA 3ZNOA 3UHFA 1MJGA 2LUOA 4XR9A 3EX7C 1D7OA 2JFBA 4IV5A 2J45A 1X92A 5DYIA 4K1XA 3SXLA 2AJTA 3IX7A 1W0CA 3ESXA 1UMCB 1RAHB 1KQOA 1VMIA 4PO1A 2IS1A 4Q4CA 5TX7A 4IOJA 3WYAA 2CXOA 2VZ9A 1U0BB 1ZZFA 2OD4A 1NAIA 4H6VA 3SXPA 5IC5A 1EUDB 5AYVA 1Q0NA 2CFCA 1UAGA 1NEEA 4U95A 1RYEA 4TMVA 4DCSA 2V7VA 1Y5NA 4W5HA 1W85B 5F5NA 2NUPA 5BYKA 3K0SA 5LU8A 4JEIA 3WNZA 1RJWA 2PX4A 4LWPA 2JAHA 2JVIA 4HEA6 3AQPA 3OPNA 3W9UA 2G25A 1FLDA 4PONA 1YRUA 3EZUA 4JBWA 2X5OA 4YXFA 4HV4A 2XW6A 4USKA 2HDWA 4JI3F 4RVFA 5AUPB 2G1UA 4F3NA 2PKXA 4C05A 1ST3A 2QTZA 4B73A 1FRNA 1QSGA 5ILOA 2W7TA 3QP9A 3ZNQA 3WWCA 4GVBB 1GNRA 2I66A 3O0DA 2XC9A 3U2QA 2YKNB 1UJ4A 1L3UA 4R2MA 4ZP9A 3U62A 3BR9A 1U4BA 1UBHS 3OBBA 3HHPA 4BNWA 4DV6F 1JDNA 1NHUA 3OX2A 1YRAA 5EWFA 4IIYA 4W63A 4EPYA 3P7MA 4K9DA 3NJ4A 3Q2TC 1C5KA 4XCQA 3K9LA 5BUQA 3EGXB 2C2HA 5B1SA 4MQ5A 1RWOB 5IDVA 1VHIA 3AHHA 2AYEA 1WORA 1SC4A 3AFHA 3EVFA 3PTLA 2RSQA 5KFIA 3RAPR 3CCSS 4MR9A 1F8FA 4USMA 4GKKB 1OSNA 5K03A 1TM4E 2IEGA 3FOAA 4TT3D 4RYLA 3D5EA 4GXQA 1OYEA 2M2IA 4YDRA 3FLBA 2IDZA 2J9FA 3CLSC 4TWJA 3G6WA 3D9BA 1SAYA 3NBAA 1M2OA 2FVCA 2LXIA 4QWCA 4F96A 1TV6B 3RUHA 3OY7A 4KDEA 2B2NA 2XSFA 4ZQHA 3I76A 4K5SA 1JXQA 3GRKA 4MI3A 1WMSA 5KTQA 4Y0VA 2XSZA 1P8AA 3FNQA 3MN1A 1GQSA 2IODA 3AETB 5GADU 1PK8A 3QE2A 2PKEA 2W0MA 4HNUA 1H3DA 4URUR 3D3WB 3NAZA 3RS5A 4LT6A 3D6HA 2E4YA 2JIZD 1EX8A 4WRRA 1I3KA 5ALMA 5HOEA 2QP3A 4GNRA 2DR0A 4WNYA 1SCDA 2FWAA 3EZ2A 2BSXA 2HQDA 3U56A 3CJTA 2F1IA 4DN0A 3WO0A 2Q3JA 2FSUA 1C0UA 4AZ3A 5B4UA 2LFVA 3O2IA 4E7PA 5FBKA 1AKVA 3I6YA 2TMKA 4Z9AA 1E7YA 3MM5A 3Q0AA 4RBVA 3NDIA 2D5LA 1NVMB 3R5SA 3PO5A 1MLAA 3HDGA 3D28A 3P32A 4AWBA 1VE9A 3BICA 4K0KF 4FZ5A 1EZ1A 3H8YA 4CQ1A 4JYBA 4GE0A 1GQFA 4ECEA 1HR0J 5AM4A 1MMFB 2P2YA 2CLSA 3AL2A 1V8DA 3W6ZA 2IYEA 1OT5A 4WKCA 4DV2B 2EC5A 1MJFA 2GZRA 1HI1A 4P2GA 1UT6A 4O2BF 5CABA 1X1RA 2ORWA 4LXUA 3FDJA 4PG4A 4WMLA 2XUAA 1JEQA 4UOGA 3KDAA 1T11A 1MROB 5DLYA 4M53A 3NNDA 1X3SA 4FI3F 3GIIA 2J0EA 4ELUA 3BE6A 3RE1A 4OREX 1WXHA 2DPGA 4FFBA 4N3BA 4R2IA 4GQBA 3W4JA 1PGJA 3ITHA 2OSQA 4UTVA 3X1WA 4NASA 1OW3B 1MN6A 2H3HA 2BOPA 4B6GA 1VYUA 3O8QB 1NLZA 3H90A 2OZEA 3MCNA 2IZ0A 2OCBA 3HGMA 5DDPC 2OT3B 1NW4A 4EO6A 4LXIA 1R6BX 3KHSA 4PSVA 4IOKA 4QR2A 1YK9A 3KJXA 1WCYA 3O4GA 3VZPA 3IVMA 1YUBA 4WACA 2CUTA 3HL0A 4RJIA 2I78A 4HNSA 4R9SA 4CFYA 3DE5X 3BKUA 2FPPB 3C3BA 4FFDA 4AJNA 1JSRA 3C15C 3O83A 4OU4A 4S1NA 2QLFA 1U8UA 2QJTA 2ODBA 5DETA 4OSPA 4GFDA 2QN7A 3FBTA 2GK3A 3TIFA 3AERA 2WE8A 1NT4A 3LQVA 2ACVA 4Q43A 4ZCPA 3QSYB 4MO9A 1LW7A 4OZ0A 2OKGA 4E5NA 1OROA 2XX3A 1U0HB 1XKLA 2GCEA 1BMDA 1IN5A 2QGFB 2FQ1A 3LG2A 4XWKA 2MKJA 4AO7A 1S3SA 3RSZA 3MXTA 2ZU6A 4FPXA 2APJA 3RTVA 1VGVA 3OURA 2HBRB 5L6MB 3AKEA 3NCQA 3PWTA 5EI5A 4IIUA 2BGRA 2DR9A 2X23A 1W0KA 1E0SA 1U3GA 3AEQB 3WNVA 1UEKA 5LXRA 1GDTA 5JO0A 1ZJJA 4HBZA 3ZXYA 1WKVA 2AFIA 1M5RA 1KH2A 5DT9A 1E1QD 1N8KA 3VU9B 4IKEA 4H6WA 2CVIA 5I8PA 3PX6A 1J5OA 3AIIA 4DANA 3D8SA 4GKJB 4NQZA 3IQDB 2R4TA 1CY6A 2DNGA 4XR4A 4Y6GB 2CW5A 1FKPA 3GLIB 1X15A 3QX8A 1VG1A 5EDWA 4QXPA 4TL9A 3PNKA 3JQKA 4CQMD 2EZ8A 3FOEC 2V4JB 3OLYA 4PPNA 1CJVB 2VDWB 1XJQA 4OQJA 2SICE 1GGEA 4TLQA 2K1RB 1TCVA 4NFLA 1SKSA 4RLSA 1NVDA 4KPUB 3CVUA 4L5IA 1M1YA 3MPVA 3RHZA 2JIMA 4E22A 2F1RA 2P2SA 3VZCA 3X2EA 3AIMA 1Z39A 4QRDA 1BDMA 4UEOA 3AOEC 4UQTA 1NSTA 4O4HB 1SVSA 4EYKA 2V6AA 4LI3X 4MEBA 3HJHA 2YHAA 3AZQA 3KYCA 3MM6A 4ESOA 4TU9A 3IR6A 2DGOA 1RWQA 1Q1GA 2G63A 4Q3DA 4GMFA 2PGXA 3JQGB 3K1YA 5HP1B 5EMNA 4X62J 1JHQA 3LS2A 4RK4A 3A1YG 1JLEA 5DCYA 2KYXA 3PUVA 4Z0PA 1ZN9A 3LZDA 1CJUC 4PG6A 3D5MA 3WGYA 1FDNA 3EC1A 2W2QA 1TADA 1ZG3A 4JVLA 2I8AA 3ZHUA 3KXPA 1N2XA 4M83A 3MWGA 1U6FA 1CUGA 2AN3A 4WESA 1E6LA 1TKXA 3L82B 3R6GB 1UDWA 2Q79A 3FVWA 1IBCB 1QLNA 2XZPA 4I19A 3M8QB 1ZU5A 2YJ3A 3FEYB 4LMPA 2QL6A 2OMKA 4FYDA 1ZR4A 1CUJA 4GC5A 5U4XA 5L51A 3UCXA 4YUZA 3ZTPA 2JZ5A 3OLQA 1GPJA 1ZJ6A 2HQOA 2FJXA 1UDRA 5J4LA 4HS4A 1JKMA 3HSSA 4IIEA 2NU6A 2P3QA 3M5CA 1HR0F 5D5HA 3AESA 3E51A 1K47A 4B6EA 4Y2JA 4CLRA 1SOVA 2D9OA 1WHTB 2M5YA 5ER6A 4UT4A 5C8ZA 4JD5A 5E3CA 4QGHA 4FWTA 5HUHA 2HXSA 1FXWA 4OY3A 1PKXA 4TSFD 2EL7A 5CTAA 1FS4A 2SCUB 5KCMA 2NUHA 1B0UA 1GFWB 2Q3MA 3KYLA 3G0IA 3KDOA 1ZIPA 4QJIA 4EBCA 4BO7A 2PD3A 2DGQA 4RETA 3ZCRA 5DS7A 5HQ8A 3S5UA 1QVZA 1E5DA 2B8TA 3MC1A 4IMJB 1AJEA 2ASEA 2CLDX 3ED5A 4Y2IA 1CF9A 3Q7IA 2Z6AA 1GPBA 3K5WA 4XWTA 2J9CA 2XUQA 3TJRA 3VZSA 1XL1A 1N6QA 3HI9A 5GM1A 5K6TA 2YWWA 4DL6A 3PENA 3HFJA 1ZCAA 2OQVA 1AE1A 4Q0BB 2X13A 3NHAA 1ZH5A 4JP1A 1I2DA 4KE8A 5KYXA 4JQYA 8GPBA 4Y2CA 2XZTA 3I01M 3UVEA 4F5EA 1UPTA 3J81k 8ABPA 5KCZA 2V3VA 1BG6A 2HF2A 4RJLA 3PFFA 4MTLA 1Z34A 2EPIA 4I2PA 4LJ6A 2E5LB 4B3SJ 3RUEA 1V25A 4MW5A 1WUIS 1TRHA 3ZTSA 1CWUA 3F3MA 2MPUA 1TO6A 1NR5A 4IFVB 1B8NA 2XNHA 4Z5XA 3STYA 1L7MA 1E2MA 4WTOA 4DR6J 3O8OA 4F9GA 2XGPA 4ALZA 1T8SA 5JCJD 5J4YA 2BDTA 4HMOA 2IGBA 1NJWA 3DOKA 3AY3A 3E9ZA 1FQJA 4RGYA 3AFMA 1LEOA 2PC6A 1RYYA 4YX9A 1I6KA 4QBFA 1RWMB 2XE4A 3D68A 4IDQA 4K40A 5L3QB 3Q0EA 4TV9F 3IODA 3ZE0B 3WTBA 4ZV9A 1SK9A 4E6EA 4AAYA 3RSLA 3VC2A 2CYAA 2PH1A 4MGZR 2HEGA 2I2BA 2HPVA 4N47A 4JI2J 1T8RA 1V1JA 3ILHA 2HHCA 2OV1A 3RUPA 1KYWA 2D5BA 3KL4A 2ROGA 5JRDS 4NA3A 5AI8A 1L5FA 4IRDA 1L3VA 1E62A 4HNRA 3TD2A 3T0GA 3F5FA 1U45A 2RAPA 2HFUA 2VFSA 3JTNA 1C1HA 5LDGA 1A6LA 4PZ9A 2W22A 3H5AA 4L8YA 5HJ2A 1GQ2A 1O95D 4DUZJ 1Q7CA 4KYVA 4G86A 4KACA 1UMJA 2FG7C 3MR2A 2O48X 1UZMA 5GIOE 5FLXA 4M2LA 3BH6B 2ZAOA 4XZ3A 1TD9A 1T4CB 2ISSD 3KFXA 1DAXA 1H2HA 1I2CA 3DNPA 2ZUTA 5AVVA 3ZY3A 4NFSA 4BVKA 4L5YA 1P81A 4D6XA 2V34A 5DRTA 4EGSA 3T19A 5H9FJ 1O58A 3IESA 3MM8A 4B3TJ 5IANA 1TQHA 2WB2A 3IDZA 1PT5A 1NH8A 4BE4A 3QQPA 1SXGA 2QYOA 2ATVA 2ATXA 2XGMA 3DKKA 1I6JA 3RYHA 5KOXA 1X13A 2PR2A 2NQTA 2F40A 4TQRA 3CRMA 2J8ZA 3NJ8A 3O8BA 4LVUA 1A0OB 2CNNA 3BO4A 4IZOA 1ZM9A 1OXXK 1XEXA 3OBIA 4C11B 1JQLB 5EEHA 5H8WA 2C3PA 3WISA 1CQMA 3LGHA 1U5BA 2X9NA 3T4XA 4EG4A 3K0HA 5K3FB 4NU0A 4XFJA 1U3VA 2BZGA 4FNGA 4KT0C 4QL3A 3FLEA 4X62F 1EJ6A 1CY4A 1Z0KA 4KGZA 4YAEA 5E38A 1IBKJ 3HT3A 2QJRA 1O8BA 2QIPA 3UAOA 2YPYA 3W9SA 1FYDA 3LTNC 4LBIA 1JJFA 5TY0A 2EBHX 4NENA 5D6OA 4WFZA 4YCBA 1KZ4A 2DO0A 1S1XA 5J3JA 2FW9A 4UD2A 3V4ZA 2DWUA 2P3OA 5ALVA 2BY4A 2ZBCA 4HHHA 3RRNA 3DRPB 1VI7A 1VQNS 2XF8A 2UVDA 2DUNA 3CD7A 3EBLA 2HFOA 2NNWB 4FF4A 1S0MA 4KP7A 1N5KA 1BXGB 2QNIA 5KAMA 4NBRA 4KNYA 3DPSA 5B3AA 2J85A 1PQPA 4XVHA 1WCIA 4LF9B 4X6YA 4KXNA 4GX0A 3LPLA 4R9UC 4G1CA 4LDQA 1Y5RA 2MMCA 4LOHA 4FD3A 3JQ9A 3GZJA 4I4TA 1OHHA 5ENVA 4Q7MB 3AOCA 2W93A 3R2JA 1R6UA 1E3MA 2XSJB 4IIDA 3FBEA 3IO3A 1T5SA 3AUUA 2DQ4A 2RD5C 4OJNA 1KFCB 4KUGA 2XZDB 3LFHA 3THRA 4IFTA 3B1WA 1FDIA 4Q66C 1DRJA 4UMEA 3R9XA 4UHJA 1ZAWA 2VP2A 1RM4A 3DYIA 3PQ4A 4BDSA 2BVNA 5IJXA 3ILXA 5REQB 5AO9A 3WK5A 1ILWA 4LECA 2EFCB 1GSOA 3GOQA 1J0AA 2VDOB 3EXHA 3NBXX 1BWVA 2D3OR 1WNEA 2QL7A 3MMSA 1U6IA 3OU7A 5FOSA 5JZMA 2GHWA 3EZXA 4LKRA 5TEWA 1IZZA 3MEQA 9ATCB 1Z7WA 2EC2A 2X2EA 4N9QA 4ECYA 1TC2A 4NESA 3KB1A 3LUYA 2V1XA 3P52A 5EWMA 3OW2R 4JLUA 4JJZA 1Z2PX 4YJ3A 1YOBA 2QRLA 4DXLA 3PFNA 2AA3A 3KTFA 3UCFA 1ZO8A 4GSYA 2BR3A 3RIYA 1H94A 1WHYA 2AK3A 2QGZA 4B3SF 1G3RA 1X4HA 2KDOA 1R4NB 3JB9k 4KAJA 4TWBA 5BWOA 3T4EA 4DDVA 1RSCA 1E2LA 5GONA 1RZVA 1CQPA 1TJ3A 1P73A 1B14A 2BMDA 2IHYA 4J9OA 4QA9A 1F3FA 4PQUA 4K9OA 6GPBA 4O4LB 1S9EB 1CFJA 1XPRA 5DK4A 4NV3A 3REQB 1X9SA 4GL4A 3MSCA 1DJQA 3PFBA 2CJWB 2MQ8A 4I50B 3AHDA 2UYGA 1VG8A 1XMQB 5BW4A 3N75A 5DBOA 1YZGA 3G5UA 5KFEA 4HB2A 1KQFB 1WPGA 1OAOC 4C4SA 3MMJA 5CYQA 3FPCA 2LU1A 1TKTB 4JI2F 2QIOA 3IRUA 2ZH6A 4BOYA 3TVZA 1T0PA 1GA4A 2MZ1A 2CE7A 2QA4S 2HZVA 1R43A 1XDDA 5CW2A 5FOUA 1CDOA 1J2JA 4NJMA 1XCMA 4XSHA 1JLLB 4M89A 3BS4A 1DBIA 2Q41A 2YHIA 2KG1A 3I9FA 4Y3CA 3JYOA 2CPHA 2E7VA 3Q40A 1OXVA 1M72A 1VMBA 1FNMA 1QYVA 3DC7A 5FX2A 1LBSA 4DIDA 1J0BA 3TP2A 3FHOA 2RT3A 2GFIA 5K0CA 1UOQA 4CYMA 1QGDA 2QM7A 4Y65A 2F43B 1BA3A 1QCYA 2YXEA 5IRCD 4ZRDA 1RCXB 1DAPA 2F9LA 3H2YA 4B3TF 4JI0J 2C9ZA 5H1YA 3LPNA 1DSSG 1J22A 1WSWA 4OGKA 2PZKA 1G3IA 1ZHHA 2Q6OA 1P1CA 1SWWA 1KAMA 2OM2A 3PY8A 3OLZA 4RKQA 2QRUA 4AFNA 4CM5A 4F04A 3I0ZA 1P8JA 2F9FA 2Z9DA 1JHRA 1Q0SA 3FW1A 4A0RA 1IEWA 4CG0A 1DJ0A 4J8PA 3V2GA 4RFSA 3UB3A 3UJ3X 4JX8A 4ID8A 4QIVA 4ALNA 2RRAA 4LSZA 4GLJA 3CH5A 3G85A 1ACLA 5KS2A 4X8OA 5FUXA 1A69A 3NEJA 1KAOA 3TM5A 4FLFA 1OMOA 3BF8A 3MT0A 4G8CA 2I71A 3SM3A 1BN6A 1IBKF 3H9GA 4KFBA 4NAVA 3K7RA 3W5DA 2CL5A 3QNWA 4GDMA 3LPDA 2B7CB 2FOIA 2VBCA 2EKQA 2BJEA 3CJQA 3D4OA 4YY3J 4YLEA 1G5TA 1PLKA 4HACA 2IY7A 1TM3E 3ZHCA 1YJTA 3E9YA 4HQLA 2QRGA 2A4KA 3W9YA 5AXDA 4KH0B 4QUJA 4A5SA 2DT5A 1XWIA 3DMFA 4BWYA 4LS3A 2HVIA 1KDZA 4YMEA 1Z15A 2EX1A 2EF0A 2IEZA 4GOKA 3LP2B 4UPEA 3R7SB 2PUTA 3ZC3A 4PQFA 1O6ZA 3IUYA 2HRYA 3AR4A 3WHLA 5T64A 821PA 3Q8QB 4DG1A 1NVFA 4MP6A 1VRCA 4DA0A 3AJDA 3ONQA 4DR2F 5JO9A 5HAOA 1V16A 4IDHA 1Z2LA 3CN7A 5E4FA 3A3PB 3HHDA 1P3Y1 4XRGA 3NS6A 2YH1A 3ZQ4A 1O6BA 2Z1NA 1G6Q1 2RHGB 4QC2A 4FB4A 2Q8NA 1FA0A 5ITWA 1OWXA 3KAQA 1NAHA 4AKGA 4KVAA 4QDZA 4KAXA 1YCFA 4KTTE 2QMYA 2IH4A 4BGUA 5G02A 1QE3A 1EDDA 3I5MA 3RROA 1LLUA 4I9GA 3SC4A 5JXGA 4CLOA 4ZJUA 1PLLA 2QUZA 4E1AA 2WF8A 4LJ4A 3NL0A 3DLEB 1VCHA 1D9FA 2DKFA 1R37A 1F38A 3DH0A 3UWTA 3DVLA 4Z4EA 4HWOA 1ENYA 4QPXA 2Y6VA 1STOA 3EDOA 2VZLA 5LBUA 3VUFA 2HSJA 3C3EA 4JKOA 1JR4A 3V8NA 1L3IA 4KTVE 1VKJA 4L02A 2VUTA 3SP1A 5BQXA 4J9RA 4RR5A 5BSGA 1UZUA 1Z7EA 1RW4A 4NC9A 5DP2A 5L4SA 1Z06A 4KRYA 4LJSA 1MO5A 1C3XA 4WADA 3TOSA 3ZE6A 4OHKA 3I4CA 4MVWA 4BCCA 3U48A 3M2UB 1DKRA 3GLUA 1KLNA 4OQDA 4BLPA 2L69A 2N42A 1G66A 1RIFA 1Z2ZA 5DLDA 3FUYA 3HDYA 3TSCA 3CF4G 5K8JB 1XRNA 2W7PA 2R7QA 2GCOA 3VF0B 3D4NA 3L06A 3SVLA 3LIIA 3N5CA 1C7JA 3T5JA 1NFFA 3ICEA 3FOZA 1SBZA 1II0A 1XN1A 3P2MA 1KZ9A 4F93B 4MLCA 5FQOA 2I67A 4AJIA 4UTNA 4B33A 3HKEB 3DBHB 5AD1A 3D5QA 3RR8A 4IICA 5HJEA 2PH7A 2W2PP 2YJ6A 5A2QU 4JSYA 1Z4QA 4BJ1A 1YDLA 3DMGA 3AF1A 3BWCA 2DNMA 2IK8A 4WOJA 3GDOA 3EM1A 2GI4A 1RPTA 4IQFA 5JSHA 2HBZA 2HQCA 5A7GA 1YK1A 2O1SA 4AI6A 3PC3A 1NE7A 3LD9A 3KOXA 5IJWA 5E8JA 2XNKA 4JB8B 2G17A 2R5NA 3HVIA 1WA5A 4IINA 4HT7A 5LP6C 3W7BA 1Q1QA 3DFMA 3PE6A 5BSTA 3M3DA 2EIXA 4QBIA 2YIMA 6LDHA 1CJTA 1RAEB 4K81B 1YO6A 2EWVA 3CC8A 1N5YB 3D7LA 2PT6A 4JI0F 4YP6A 3UVJA 3GJTB 4HYQA 1XMOJ 1H69A 4OHBA 1KE2A 3H9EO 4QEZA 5J2UF 3FJ1A 4R5PB 3OCYA 4Z49A 2A9FA 5HVFA 2GKSA 1N7HA 3NY0A 1QF9A 3GFFA 3Q7EA 3MJDA 2CQDA 1Z45A 1Z74A 3H4BA 3AT1A 3ZGOA 1M2JA 4FYIA 1EP4B 1YJRA 1HI9A 3FZBA 1QVGR 1RJEA 4L9AA 3IG1A 3GC6A 1A50B 3JQFA 3FTEA 2COLA 4HHJA 2BKPA 1VBXA 1BMQA 2OP0A 5C31A 3CDWA 4DV4B 1V9OA 4ESEA 1A71A 5CGZA 3KIPA 3OL6A 3ETMA 2B4KA 4TLMB 3PRBA 5CQGA 5J2QA 5IBQA 5EE9A 1ZWLA 4IDEA 1Z73A 4DJTA 1YLXA 4UW9A 3CNLA 1Q0PA 1XD2A 3BTUA 4PSKA 1YS2X 4RVNA 4YY3F 3ZWMA 4FM9A 3BC1A 3PEVA 5FBHA 1Z7BA 2G9OA 2ZUSA 1RACA 3M4YA 4Z2YA 4KQXA 3D43A 4QGAA 2CFXA 4B31A 4A0GA 3FTCA 2OHDA 4WGFA 4X1KB 4DIEA 4KXFB 5HIAA 1ZNZA 3R7LA 1OR8A 5IJ9A 1VYHA 4P74A 3TOCA 3QLUC 2BF4A 4J94A 4L28A 1R6DA 5E6SB 1L5WA 4TYYA 5TS2A 4GMDA 2NYUA 3TEFA 1FVXA 3BE4A 2OCLA 3PI6A 2QL9B 1KU0A 3V33A 3FROA 4ZYYA 1YA4A 4AQ7A 3N0TA 5HK4A 1N6NA 2R2RA 2DUWA 2GGSA 2C4UA 3FCHA 1JJVA 2IBTA 1YV9A 3PGXA 2W4DA 2BI8A 5FOTA 3AEUA 1CEYA 1GSAA 1R64A 3HS3A 4K28A 5J47A 1M54A 1PILA 4U6PA 3DXSX 3REFA 1I3OB 1NU6A 2KE5A 2IUYA 2QMZA 3PNYA 1F51E 1ZH6A 1MT0A 1RLMA 2WSSD 4WBFA 3SZ3A 1U1OA 4BNNA 2PBFA 2WM3A 3U4DA 2XWSA 3VYUB 2YKQA 2X1HA 1A8IA 3IR5B 3H2SA 4K8RA 4AXJA 2IFTA 4KSEB 3S2YA 4JC4A 3GRAA 3A4LA 4XQEA 3OU6A 4DR5J 3NU1A 1BDBA 4D3HA 1HTBA 3BWMA 3D7MA 1W46A 1RADA 1K44A 1ENPA 4LISA 4HXFB 1M1ZA 4G5XA 5FPYA 3WQBA 4FCCA 1RJ9A 4IVNA 3HSYA 2AUNA 3LC2O 3NUZA 3DC2A 4IGIA 5I8ZA 2P78A 3NUGA 4QSMA 3IDFA 1CQXA 2IT1A 1T2UA 4H35A 4DQKA 1W25A 3VJLA 3FNHA 5C8YA 4HH0A 1M8GA 3FGPA 1A9SA 4JLDA 2XUGA 1FMJA 4TY8B 5CG1A 2VJNA 1R8AA 3FWKA 5TGTA 5IASA 1S96A 2XTAA 2OQ2A 1JSCA 2QE7A 3NAGA 4NOKA 4EKYA 1F7UA 1RMYA 4FGKA 3W9JA 2ZGVA 2FPIB 3SJ7A 3WO1A 3ZLUA 5ICGA 3ZHQA 2X2OA 2OPRB 4Y28C 1IK6A 3OESA 1OFUX 5J2TA 4WZAB 3Q3CA 1XXLA 2YN0A 4KHPB 1GXSA 1YTYA 3IJEB 5FI1B 1QNFA 4UC0A 3AONB 2HAFA 3OTOB 4M76B 4ECQA 4MRRA 1UWKA 3A3OB 2N75A 2DFDA 1FFGB 3G1TA 2A5JA 3P5BA 2O5DA 2RE8A 1FW6A 5DM0A 5AVXA 4ZJPA 3K5NA 1ZNWA 3PICA 2YS6A 3TAQA 4BFVA 1Q16B 1ATIA 1FFEA 1S2GA 2C92A 5AW7A 1RHUB 3CPWR 3S6JA 3ENQA 3M8KA 4TYWA 1YI8A 3GFZA 3MFHA 4QG3A 4EP1A 1FNXH 3O6QA 5A05A 4BATA 2UZ1A 1ZESA 5TE9A 3EXIA 2JFNA 2P35A 4J37A 3H86A 1VDZA 5CVDA 1P18A 2AWNA 3OQ6A 2GERA 2O3JA 1A27A 4AY5A 1CUEA 2Q5FA 2AG5A 4RF3A 2DEUA 1REQB 4KO3S 3DBLA 4JBXA 2YY3A 4RIIA 5HF6A 3DVAA 4V0LA 1EP1B 1XMOF 1X3LA 2HL6A 4L73A 3AYXB 2B61A 2R7MA 1HRKA 3SBMA 2H4YB 3HBLA 3OKCA 2R3VA 3UD4P 4F26A 5INTA 1H4QA 1UL1X 1I10A 3B7WA 4P3XA 2X0DA 3EQ8A 4JLPA 1U0RA 4M36A 2PMCA 2XCUA 5I9BA 1QYCA 4LF6J 2AD1A 5KJEA 1YC2A 3PIDA 2QJOA 3V8BA 1HE5A 4RMGA 3FWHA 2IMOA 3PKMA 1YDMA 3DLTA 3Q8RB 2D8AA 2PFKA 2FC8A 3GUZA 1EKXA 1A72A 3ETEA 1Y7HA 2W71A 3TZLA 2K4MA 5C37A 1NJ6A 1T7PA 3B4DA 4BN0A 3TCXB 4TYAA 2XGOA 2ONZA 7YASA 4KCGA 2LMIA 2RS2A 3ETNA 4FQ8A 4HI0E 4Q9AA 3GO4A 1EUCA 4H4CA 1TJ4A 4L8GA 2XBLA 2RK6A 3FSJX 2BKXA 1MFPA 2MTLA 1DEHA 2HJHA 2Y0DA 3KK1B 1UBSB 2FPMA 2FRXA 2BD0A 1VLMA 2BMFA 4YXWA 3TRGA 4G1PA 1XERA 1RAGA 4MARA 4YMWA 5JLAA 3ZR4B 1J21A 4DFJA 2DKNA 2Y9MB 2WTXA 3MFIA 2ACEA 3N2LA 4UUWA 1R00A 2ADMA 1Y81A 1ZH4A 1GDDA 1E63A 3PT5A 1Y34E 4K59A 4ZVQB 5KNBH 1QHYA 4K3UA 4RBNA 3TQ1A 3JTEA 2IHR1 3ISVA 1RPAA 5GJCA 2YBDA 5KSOA 4LRTB 3QEAZ 4A0FA 1G98A 3WWEA 5HS6A 3RQIA 2GESA 3QX9A 2O2SA 1GPMA 4RNHA 4P5DA 2HJSA 2YIDA 2RF2A 5LUBA 4RTLA 3GAZA 1MRNA 1AXRA 1ZU4A 2VZEA 1KS2A 4ES6A 5EP1A 5CVEA 4DNFA 2RUSA 4KH1A 3Q2OA 1CW2B 5CM9C 3VH2A 1SUQB 4ZXFA 1RTZA 1F0NA 1G19A 5E3PA 2WVHA 2JWNA 5DDOC 2DFNA 3SV4A 6AT1B 4RVUA 2G3YA 4V3CA 2B82A 1Y5IA 3Q5GA 3WJ7A 1PYOA 2VFUA 1KWKA 4LVCA 4B5KA 4ZDNA 2WD7B 2GPBA 2VATA 2H4ZA 3F46A 3RASA 4P3KA 2XLKA 3WYFA 1TCAA 3QRWA 1NKCA 3ZUGA 1AYEA 2CPDA 2AX4A 4ID3A 2OKCA 3NMUF 5CM2Z 2CQIA 1E92A 2XUHA 4OKIA 3ECCA 2CKWA 1IBMB 1R3NA 1PC4A 3K2BA 4AECA 4ER0A 1I5EA 2EGHA 4FB5A 1NSPA 5G40A 4EK9A 3DEYX 3FYDA 1V1MB 3SF0A 2KT5A 4JBCA 2FFHA 1M90T 1U2SA 4FXDA 3AILA 4CUJA 1JWBB 2JJYA 5LOVF 3TDNA 4L8FA 2GEDA 2R4UA 2H92A 2XMCA 1CIJA 1ZVMA 4E2XA 2FZWA 1T8PA 2P91A 4PUOB 3QSGA 1FP4B 1SKWA 4QM7A 2BBOA 2EGGA 3AW8A 4C6SA 3DRXA 5JD3A 1G6OA 4PYDA 3OIYA 3JXEA 1L4BA 2DR2A 2IITA 5C5IA 1TM7E 1UINA 3RNOA 5HVHA 1Z4KA 1Y0HA 4JLOA 1XT6A 4WPGA 1CEXA 1V45E 3LKBA 4LCJA 5LKAA 1NRIA 4HDOB 1GTZA 2ZRPA 1M5PC 3GGPA 4IH6A 7ABPA 3H04A 3IV7A 3MWJA 4MW7A 2AH5A 1NRKA 3CTMA 3M3HA 4YAWA 3CLKA 1O5TA 4JBGA 3VJMA 4R9RA 2M88A 2W2OP 3S7ZA 1U81A 3PXEA 3ADKA 5F8LA 3KUKA 3OVAA 4TT3A 3NC4A 5FULA 4USWA 4D4HA 4DR3J 3UV7A 3FSGD 1IN7A 2RGXA 4FDLA 4DY4A 1KI9A 3ZQ6A 1VJCA 2B9EA 2C59A 4RA6B 5IXSA 4C0XA 4OA8A 4KBFA 2HREA 4ERDA 4TLCA 4W1PA 1JLCB 5CR9A 1U0EA 5K5EA 3F74A 1KTQA 4E07A 1OYDA 1F2UB 1T6XA 3MUTP 3KZMA 4CF3A 3GFPA 3IEKA 1JLBA 1XTQA 1VZ3A 3EEIA 4WIIA 2RB5A 3TIVA 1KOFA 2JIZA 2NUAA 2XBMA 5IT9A 2M9MA 4HUJA 4EEKA 4H7PA 4BMNA 3ROMA 5FBZA 2FUCA 3BRWD 3A9CA 2MLZA 2IJNA 4MUGA 3DM9B 2B9WA 4P6QA 5BMOA 1EJBA 3W05A 1EEHA 3R74A 2CQBA 1SNYA 4O2AF 2PBLA 3STUA 2GRAA 3N5BA 3ROEA 3CMMA 4R2XA 2XTNA 4KOAA 1TGYA 4YT2A 1SXJC 1NK7A 3W3ZB 1PR1A 3SEQA 4WH0A 2D8MA 1T2NA 3JZFA 3HWRA 3H2JA 3HXOA 1MQSA 3JR7A 2H5JA 5FHQA 4IG0A 2A3NA 2M1ZA 3BCUA 3P9RA 2KM1A 2YQZA 2WUEA 4G1EB 2GFQA 2QVGA 1QQAA 1E1RD 2GVZC 4BFZA 1ZISA 3NOGA 2XYHB 4B6SA 3UBMA 3MECA 4NA2A 3FZNA 1LWEA 5B09A 2WZQA 2QM0A 5P8WA 2REOA 3LYHA 1N2ZA 3UJNA 1CR6A 1Y1RA 5CW1A 1KWMA 5J40A 1FSFA 4IWNA 3IC1A 2NCKL 4DYHA 1WEZA 4K46A 3LP8A 3B5EA 1GTJ1 4HXGA 1ULBA 2RK3A 3RS7A 4A1FA 5I3UA 2HWKA 5EZYF 2PJDA 4C98A 4I1OA 4BNMA 2DTXA 2VYVD 2IPMA 3TNVA 5KSPA 2N47A 3DP9A 4F02A 5FXMA 2EEZA 1VIVA 1A1VA 2PH5A 1JAZA 4QZVB 1JDTA 3Q89A 1HBUB 1B73A 1B0AA 2PKCA 5M2QA 3RU2A 2OOSA 2QSWA 5KT7A 3FMOB 4ES1A 2ZOMA 1Z0ZA 1XAGA 1SOWA 2KKHA 4B7UA 4HX2A 1JDZA 3WFIA 2OO4A 2BEWA 4Y6LA 1O08A 2V7EA 2QR5A 3ROTA 1UA0A 4I5IA 3F4KA 1QQ5A 3QFRA 5KJ1A 2ZJ6A 2JJMA 2DEJA 4WX2B 2YH2A 4FDMA 3MTIA 3T3IA 1Q12A 1WPXA 3UMSA 1Y3IA 3QLTA 4EDHA 3V34A 1UBUS 2IF0A 2ZS8A 3BPSA 4CR6A 1LWFA 2ZXEA 4D8VA 2CK3D 1H1LA 3UK2A 3OJFA 4K9SA 1RAJA 1MQAA 4DBVO 3AR9A 2UAGA 3QENA 1DC7A 3MPYA 2VJBA 4KMOA 3FPKA 1OX5A 4L9RA 4C3MA 3H2ZA 1E1QA 1N2OA 4QIGA 2DKOB 1I51B 2BRLA 3O93A 1XKQA 4M49A 2B9XA 2WWHA 3H42B 4FGZA 5HCUA 5IULC 4Q03A 5ABPA 4OV1A 2C98A 3H87A 1G7CB 3ELBA 3IP0A 2O7SA 1UJ5A 2V2KA 3IHWA 3L9ZA 4L0MA 3LXXA 3F90A 2IHUA 3I73A 4FK8A 5M34A 1FIUA 2JGAA 3MIIA 3CWCA 1I5RA 1NN1A 3KJNB 4AQYJ 2DHGA 2FR1A 1K0FA 2R7RA 5BNIA 1CZHA 1I4OA 3U37A 1F9AA 1U2PA 3Q9NA 4BFWA 3EXFA 4TQAA 3UH1A 3VSCA 4GYKA 3KP1A 3FPHA 3MBIA 1Q53A 1ODTC 5G0RA 4LHEA 3QGHA 2FHOB 1ZQ9A 3O9VA 4WERA 3ZOKA 3S8YA 1YMVA 5IVHA 1TA9A 5AKGA 4OLJA 3OQJA 1XF1A 1E1CB 2J3JA 1PVOA 1YRHA 3UB2A 4DR3F 1VB5A 4NI2A 2UXBB 2LCIA 1KRHA 2XIJA 1L0BA 4MO2A 2OZLA 3PEFA 1CQIB 3K6KA 4KU4A 1SQ6A 4KN9S 5C53B 2VUSA 4G6VB 4PO8A 4R54A 4Q1AA 1H3EA 2AHRA 4K9QA 2OTLS 5T67A 3KZ1E 2ERRA 1YJXA 2PK3A 3WLOA 3LQ2A 1KK2A 2BIFA 2YMMA 1K8XB 1SMKA 4NCIA 3GG1A 3RKUA 1HNXB 1H2ZA 1H73A 2V7GA 3HXPA 4FSDA 3K5PA 4KBYA 4PSCA 1S72S 4LZPA 1TMOA 4IGAA 2PSEA 3D2BA 4XPIB 5C80A 1WP4A 1OX4A 4HGNA 2MR6A 1XCGB 3DB1A 3TWZA 4IRUB 3KK2B 1I1OA 1PO6A 3KDNA 1WXEA 3WIBA 4MYUA 2LW7A 4F2HA 5BV7A 1XA3A 1MVLA 1C4XA 2XYRA 4OLPA 2AF4C 3O91A 5SZIA 1YX2A 4UQOA 4CU5A 3P2IA 4HQFA 2MINB 5BN5A 2IPOB 4AZ0A 2XHZA 3DLKA 3SVTA 4TLLB 1RJFA 5EJ5A 1EZZA 5HBRA 5F1KA 5JJBA 5DYYA 4ZVRB 1PYSB 2GB4A 2JCSA 4I7FA 4PHFA 2FPLA 3PKJA 4H4KC 2WJ6A 1RKJA 1WKKA 4MYDA 2R8OA 2VB6A 2Q4BA 1WULS 2WYWA 2XLJA 4TSFA 2ILVA 2ASJA 1OXSC 1GGVA 4XKJA 3ITDA 1U1RA 1ISHA 4RZRA 4BLSA 4ABTA 3SHQA 2M32A 2ZBFA 2P0YA 5LT5A 1P1HA 3LNCA 5FNZA 1I2AA 4NJEA 4B87A 2IHVA 1H85A 2W2LD 2BR5A 4YR2A 3CS3A 1EYZA 3LGSA 1VQ4S 2NZVG 4EI7A 1RT6B 3VUEA 5EPUA 7REQB 1IQPA 2C42A 2B4VA 1H2FA 1ESCA 4DQLA 2GJIA 1AF4A 1FUUA 1M76A 3SS8A 1HEYA 2FQYA 2VFTA 4YMGA 3F5DA 4USJC 5DX8A 1CB7A 2WUVA 1UP7A 4AMGA 1JNXX 4EGAA 1YTUA 1ULZA 2XTJA 4MYTA 3EGWB 4NECA 1PTKA 4TZTA 1NJIT 4N56A 4PQRA 5IYZA 4G4IA 2LVBA 3T1VA 4Q21A 2C2OB 2R7KA 2JATA 3LXUX 2QTWA 1PNOA 2Q0HA 2FXIA 4YCAA 3WWPA 2VHWA 4UDOA 3VZQA 4QEDA 3L1UA 2FE1A 4ZPAA 4NDAA 1DKUA 4YVFA 1F2HA 1EHYA 2EW8A 5ES4B 5J59A 3LRXA 2FSVA 3OHBA 3CD5A 1F0YA 3QJLA 2GPWA 2AOWA 3VGTA 3BEGB 3Q98A 4LIPD 1HNZF 2DH7A 1Z8HA 4BJ5A 2AOVA 4E4RA 3LWNA 3UWDA 2GPTA 1M74A 1J2VA 1LY1A 5K8TA 1Q20A 2HNBA 4J2OA 3I2GA 4L4XA 4X61A 4JP3A 4LVOP 2AJ0A 1A2BA 1SJ9A 1JI0A 4LSWA 2R2TA 3Q0TA 1KDPA 5JSYA 4CT5A 3FMIA 3X2SA 1S0OA 4MYRA 2QSFA 3ZDEA 1O95A 5JARA 2QX9A 4F4DA 1FKOA 2FMIA 3DLCA 3PEYA 1X9MA 3K20A 1KRWA 4BS2A 1MB9A 5CIQA 2PKQO 5E0KB 2CRLA 4CGZA 1YIAA 5KVCA 3MA0A 4KXQA 3WS7A 5IDWA 2WIFA 5I5GA 4Y7DA 4RNCA 4XGRA 2D7SA 5JQGF 4UEQA 3TLBA 4RHCA 1CVJA 1MRZA 4AQYF 1EXMA 3NIWA 3O4RA 5FO1A 1PFWA 3U3XA 4YCLA 2YS7A 1WNTA 1AKEA 2P7IA 1H3NA 4EQ6A 4B3MF 3E3MA 2Y9PB 3AR2A 3TW8B 4H7DA 2ODEA 4WBNA 3WAJA 2A5YB 1KP6A 3A13A 1RQNA 3U4QB 4J91A 2AF3C 2OLKA 1P2UA 3M70A 4LR8A 3QELA 4MEAA 5HFAA 4ECVA 1AC5A 2CLEB 3HBAA 5BSRA 2ZD1A 3WC2A 5CB4B 3MR6A 2YWXA 3IFEA 5F2EA 5CEEA 2QN1A 1KI1A 2C2MB 4Y2VA 4B4KA 2VICA 2BM1A 5E6RA 3D02A 1UMKA 2YV4A 1LBIA 3L7YA 3RC7A 4OQEA 1L5KA 3FMVA 2QBYB 4S24A 4NRDA 3GLJA 1YL5A 4LCEA 2Z4SA 5AOCA 4P7KA 3PUYA 3LLUA 2QTVA 2WU0A 1UCFA 4EYEA 2Y0CA 1ICEB 3M32B 4N3CA 2PGOA 5AHRA 5D3KA 2JGFA 4I5GA 1MABB 1WVMA 4H1TA 4LDZA 3HEAA 4KQ1A 1KJZA 4S35A 3SEOA 5BV0A 2K06A 4YO7A 4YIHA 3U5TA 1ZCFA 3IRXB 1XN9A 1UJBA 2B7BA 3ZU4A 2PMDA 3DGPB 5EVCA 3KFLA 3ACCA 1E2GA 4XWOA 2FFJA 2CMHA 3WB0A 3PVXA 4WZAE 4LRAA 1FDOA 3QJ5A 1XELA 1R89A 5AIAA 3NDJA 1LJ8A 4OFXA 2HYIB 3BA1A 5F4BA 1WOSA 1A7AA 1UXHA 3BVPA 1RLDA 1LLFA 4GSKA 1DG3A 5ITZB 3NNCA 1FBTA 2VPXB 4C4RA 2BTQB 3KVRA 2R8HA 2Y1LB 4RENA 4EVQA 1WCV1 5JRZA 5I7UA 3BA6A 4GPBA 3V9AA 3VR5D 1LZKA 1AN0A 3PHTA 4JJIA 4E09A 4QAJA 4NAHA 4RLFA 3SJCA 2PN1A 4WNCA 1HD0A 1GN8A 2XB8A 3A14A 4DEVA 1SH0A 5F9LA 1EMDA 2F62A 3PNPA 2H51A 5I9NA 3K1TA 3RAXA 2BGKA 1IPFA 1Y00A 1CJKA 5L1IA 3SHFA 2CBGA 2KPOA 5E9WA 2HD4A 1GMVA 5ERGB 3CKYA 4CFSA 4UU7A 4FZRA 3GWCA 3ZD7A 5AXNA 2F8HA 1C7QA 3S7TA 1BZYA 3U3RA 3TG8A 5K20B 2OFFA 1HNWB 1PQYA 4FXPA 1VC0A 2VSQA 3F97A 3TZKA 2FI1A 4PEOA 2D1TA 3CURA 2VJCA 2PJUA 1IN0A 4G1IA 3OSNA 3IA7A 1CBKA 3E7FA 2J46A 1VI2A 4YP1A 5KYTA 3W62A 2BFEB 1AGNA 3HRHA 4FWBA 1SUSA 5B1DA 1JL3A 3I6IA 1TZMA 2C1EB 2CIMA 1WMBA 2QXYA 2JFVA 4K9MA 5ETNA 3A2LA 3LQRA 3CEHA 3NH9A 2A1UA 4BGEA 3OL8A 4OM8A 1H9AA 4XUEA 5D51S 4MW4A 3JSRA 1Y6ZA 2I6GA 3WWYA 1MAWA 3HX9A 2GA8A 3ILVA 3CCFA 4IIJB 5CLQA 1P9NA 1YI1A 4ZDKA 5HRAA 5C7OO 4CKWB 1P3DA 4D1YA 1QG0A 3NHPA 3FFIB 4DM3A 2O4UX 2XT6A 2J9EA 1NHWA 2CZCA 3NXKA 4RJVA 3OXLA 3QU5A 1J2EA 2XDWA 1ZH8A 3ZXWA 2R6CA 2CVEA 4ZAVA 4I14A 1RYDA 3JAMU 4OI3A 2WPDA 2VDQB 4CKBA 2LV8A 1DHRA 4RK1A 2JHPA 3QKRA 4AVYA 1BXRB 2CNLB 4O63O 2BGJA 4QQ8A 3AHCA 3EVDA 2EV9A 2VT3A 3HR8A 4N82A 1EFRD 2O2XA 3I2KA 4MS1B 5H16A 3O1HB 2W25A 4NG5A 3TLGB 2IHKA 3BYZA 4AE5A 3SBOA 3UPDA 1XZFA 4ID5B 3H11A 5ARDA 4DA9A 3Q9SA 4YJHB 1I7DA 1E3EA 2CZ4A 3MGCA 2IYTA 1GP2A 4I1PA 1ACMA 3B3AA 4XIJA 3IQXA 5DJBA 4UBMA 2XOEA 5LDHA 1KWGA 4IMPA 3GEGA 1R8SA 1HO3A 1AO3A 1Q8LA 4OL9A 2CPFA 4ALMA 5CEFA 1OVMA 3G6KA 1JLSA 3OCWA 1RM3A 1ZSNA 1VQOS 1V11B 3HCCA 5TPWA 3CF5Q 4ZT2A 2YX4A 1MTZA 2FSPA 4J7AA 1X0PA 1SHTX 5C32A 4XPEA 5U1PA 4I4IA 5CYOA 2YJZA 5A4FS 4JI1B 4U2EA 4CO1A 2GFHA 1SPBS 5GADI 1CERA 4RCYA 1TKZA 1GZ6A 4L5AA 3PPYA 2AR7A 2ABWA 1OSDA 1BO6A 1SOMA 3MM9B 1UEIA 1M0WA 4H54A 5ALDA 4W4TA 1P74A 7ADHA 5BN4A 2QE5A 1FJHA 5TV2A 2QMUA 3G82B 1E8MA 1R66A 2D13A 1RMQA 4QDOA 3QUCA 3PL1A 1UMDB 1T8WA 1EM8B 1A4RA 1XU4A 3SR0A 4UE2A 4ZEOA 2QRVA 3I2FA 1JB1A 2FN9A 4ZT3A 1YBUA 4QIFA 2QYTA 4HRYA 4EHJA 2TMDA 3PHBE 1P7WA 2YVUA 3W1EA 4RULA 3GCWP 4O33A 4ZP6A 5F9FA 1Y89A 4KHRA 4U8GA 2JNWA 3N0VA 2YRXA 4YH1A 1K97A 1JP7A 4KIGA 4ILKA 4YCJA 3IMFA 1UZDA 3QXGA 2CJXB 2IVFA 3DDIA 3KWJA 4FMBB 1MNQA 1TL7B 2GRJA 4P3OA 4G0WA 1N3YA 2Z83A 1H9CA 2DQKA 5B7WA 4MS3A 2FK7A 1PEKE 2L9WA 1X7WA 4X66J 3WJ1A 2NO4A 1UWBB 3B70A 1IOWA 4Q4AA 2HGMA 1GQYA 1DZ3A 3KEQA 3AX6A 5DBHX 1W2BR 1JXVA 3ZVKA 2G7MC 3G7UA 1NN5A 4H4EA 4BRUA 3DLJA 5CAEA 3OUTA 3PITA 3K32A 1P2SA 3KS9A 4F06A 4BNTA 3UWMA 4W82A 3JQJA 4DU7A 3RGGA 1Y8QB 1NMXA 3AD8C 2F9MA 5KFUA 3LW7A 4KN6A 3L1HA 1NQVA 4XWAA 1JN0A 3CPJB 4N7JA 1ZBQA 2UV8A 1B8UA 1S2MA 3GLRA 4DR2J 3CKKA 1FQKA 5CB0A 1TW2A 1VJTA 4X4TA 3I83A 2QVZX 3KT0A 5GAEU 4YGYA 2HNDB 2FSGA 1ZBTA 3IAM1 2YWBA 3F44A 1BX0A 3ZJTA 1DBSA 4WKBA 3QXJA 1RT4A 1FFHA 1XA4A 2YHSA 3I64A 3F6PA 3AKYA 3VPXA 2CYYA 2OBXA 1DURA 3NHRA 4GM4A 4E0DA 2JDJA 4NZYA 2HWYA 5ALSA 3LAWA 5CCMA 2PI4A 3A10A 3BEDA 3RRKA 4MW2A 4U6NA 1G55A 5F7ZA 4D9IA 3ZWDA 2J8AA 3QWAA 5F1PA 1T9DA 2BJ3A 1V3QE 2R8ZA 2PUEA 4E2FB 4M1MA 2DRAA 1U0GA 2IA6A 4E4YA 1JMTA 5DNAA 1GAXA 1BHQ1 4JOCA 2WJPA 2ONYA 3STHA 2JGMA 2X8JB 5CNMA 2I4RA 2A92A 3H5RA 5AVWA 5ESXA 2LEAA 4NBKA 3A25A 1R0AB 4QXAA 4DSZA 1I0LA 2MT9A 1VP3A 1P1FA 3IFSA 3C5EA 3DB2A 4ZHRB 2IOFK 4CT4B 4EO8A 1J00A 4DCMA 4DMMA 2C2ZA 1S77D 1A88A 2JKZA 2O8NA 4KX3A 3WC0A 1V2HE 3EX7B 3EPLA 3K73O 4O2BA 3W5AA 2DU8A 4QFMA 1HLDA 4E5KA 4U6SA 3BF7A 2E6UX 3TE7A 3OL7A 4ENWA 5K3BA 4IQ4A 3C46A 3FKQA 3H0KA 3S4YA 3EDRA 1RABA 2VTBB 1WF2A 1WCWA 3M89A 3VNUA 4Z8YA 1DRWA 3MJFA 4PZZA 1U2ZA 5DOZA 1KEVA 1VPDA 2WFZA 2PZAA 3N2EA 3AODA 2IXTA 3J81j 1N6KA 2VK8A 3RRZA 5BW5A 3NIFB 4K05A 1OY1A 5J2NA 4F4HA 1V1RB 1JPJA 1ZGGA 1M5KC 3NHWA 4P9SA 4AB1A 3ZLJA 1A5ZA 5FBLB 2DWPA 1TRKA 1C3JA 1KI6B 3TW0A 2XCPA 2F1JA 2JKVA 4WPAA 1Y3KA 2XB9A 5FT9A 1F9HA 1E96A 2JLRA 4CM8A 1UFKA 3NDBB 2PQ6A 3C6TA 4M9SA 2CE2X 1LI7A 2IAJA 4F2RA 1S8NA 2WMOB 4ECSA 3FQLA 2DWOA 5ENZA 3OUYB 2H3EA 4IWXA 4D99A 5KUTA 2AMVA 2I7CA 1S4FA 2GA7A 5BOVA 1AZSC 1TJ5A 2IA0A 1D2CA 4Y2UA 4MGEA 3KFVA 4KNWA 1DBVO 5DDRC 1NJGA 3DU6A 5L45A 2DITA 1T5HX 4Y8VA 4DCCA 1AA1B 2WFLA 1ZIXA 3QUTA 1G41A 4UF4A 3V00A 2EGUA 4EENA 1RWVA 4HDRA 2FDCA 1KMHB 1P0FA 3HBJA 3FE2A 4DV2F 3FNIA 2A5DA 1IUOA 4WE1A 4M0LA 3P5SA 1X5TA 4DV0B 1M10A 2ROPA 2CV1A 3NNHA 2VA8A 5BNFA 2BKLA 4ZPTR 1U28C 3K31A 3KOAA 2NIPA 4GNKA 1XZKA 4DQDA 4FTWA 4NS4A 4EITA 3AVYA 1NV9A 2VIIA 1C8VB 3K8VA 5C81A 1F2TA 2R65A 5DX0A 3MG9A 1JKJB 1M1UA 2TECE 3QFTA 3LT1A 3T1NA 3C2PA 1F20A 1XLTC 1NM5A 4ZVMA 4X66F 1UVMA 3W2VB 1UP1A 2RGWA 5JSUA 3M9MB 3DFEA 3N7AA 3W3SA 1PL7A 1UJMA 4HZUA 2JNJA 4X4UA 4BJHB 1J0XO 4CLHA 4FSHA 1YKFA 1E6VB 1GEHA 3Q2SC 5ETPA 2I3GA 2VJPA 5JJ5A 5L38A 3R3SA 2J0UB 2YRWA 2WSSA 4K4TA 2D06A 4MW9A 4FBUA 1NRXA 3MWLA 2X1VA 3NX4A 1JPVA 2CPZA 1G8MA 2CLLB 4FZVA 4UU1A 5A8KA 16PKA 3R5FA 4D4MA 1IZYA 2CZVC 3L07A 4LOJA 1Z1ZA 4XIIA 3JSXA 4NABA 2H2FA 3VYSB 3KWMA 1XO1A 1IHPA 1EVLA 3STTA 4D97A 3UKDA 2CQHA 4YCDA 2OY0A 3NI2A 4BKUA 2CQ0A 5L3SB 3LWLA 2Y0BA 2Z57A 4DG9A 4EKIA 4ZLNA 3R0XA 4TQ9A 5FDLB 1U7DA 5KYUB 4WK1A 1JLGA 2HKIA 2KXHA 1EX1A 5AUOB 1XV5A 5IKMA 1R0CB 1GT91 5AXBA 3PW4A 3SMVA 1RWXA 1N0WA 3MZIA 4GKJF 3ZWVA 2KFYA 4ZHQB 5IDQA 4UREA 4NE9A 4HD8A 4R8RA 4ZVVA 3RU9A 1EUYA 2ZKTA 2ID7A 1ZVJA 4OSOA 3HNPA 1WAMA 4TLRA 2P2GA 1JFFB 3N0RA 1XDUA 2Y27A 3PNMA 4GXRA 4KR0A 1Y8ZA 1RQ0A 3RYFB 2RI1A 3QOYA 3ESBA 3LX5A 2ZIXB 3EK2A 3Q8VA 4IEEA 4B3FX 3HSGA 4FF1A 5AOAA 5BVHB 1RK8A 4I8XA 4CL0A 4DBQA 3BTOA 1M73E 4QQNA 3JS5A 2AMLA 1WI6A 4BQOA 2MLYA 1LZLA 3C15B 1QX3A 3RV4A 1SKBA 2J0SD 4ZQFA 4ND4A 1VKRA 3ROPA 1K5GA 3ETOA 2OBFA 2Q6VA 5CFMA 4YRBA 4PV7A 1KMQA 4GGMX 4MA5A 3USCS 3COJA 4RW0A 2O1XA 4NLYA 1NMSA 3OEED 3BXPA 1T1GA 4UOEA 4HAVA 1ULRA 5C5JA 2QR3A 5EIBC 3P8BB 3SYLA 5HX7A 1F6TA 3T3OA 2H1HA 1IZ0A 4Q1EA 1HHTP 1P61B 3EWAA 3TNYA 3QKSA 4ZYZA 4H1HA 3EFOB 4YPFA 1NX6A 4E08A 1TB4A 2D5CA 3M8RA 5IC4A 3THWA 2Q4OA 1DX9A 1XC7A 3RB0A 1P91A 2UZ4A 2CDQA 4OQFA 3L43A 1ULHA 3GZ7A 4J4HA 4RZ2A 2VRBA 4TTAA 2IYGA 1EQ0A 1DEOA 5I9LA 2C8KA 3UN3A 5HPYB 3EDCA 2QC3A 3FFTA 4RPIA 4M95A 3IQHX 3TFWA 4MKIA 5KQMA 2WMDA 5EL0A 3L4BC 4LF9J 2I1VB 1O96A 3ZDFA 2AIRA 1W4AA 5EJ2A 2C0CA 1VPEA 4JI5B 2WUWE 5EJGA 4EZ6A 1GYRA 1WD5A 4RPCA 2D74B 3Q7TA 4IOAQ 5EE0A 1V8OA 4OX9J 1NJFA 4F6CA 4IRCA 4QOTA 1Y9EA 2X5NA 2P4SA 4TV9A 1B7YB 3TA2A 2ID9A 2O8DB 3T9EA 1SJFA 4MOWA 3LF2A 2H1FA 3GJXC 3SZOA 2HHHJ 3EPJA 4IIXA 5CDFE 5K8NA 4HRXA 2LPMA 4AL5A 1E9FA 5EZ6B 1YT5A 1EXVA 3R1HA 2HFKA 1TJYA 3BT7A 1UT5A 4NIMA 4AYTA 2L18A 3NTUA 5DT2A 3FXAA 3DM5A 5M3BA 4EI2A 4X2BA 4EF4A 1AGXA 2O8BB 4TKVB 4G5RA 1TNDA 4NYJR 4RCZA 1KY4A 1OC2A 2NU8B 5D8DA 1GEGA 4MUFA 1AG9A 1FL9A 3PXDA 3EC2A 4DCOB 1M0EA 2Q4RA 3PPXA 4BU0A 5BORA 1U7TA 2X76A 2VHTA 1MW8X 3BGRB 2VDKB 3E01A 5JCPA 2W4IA 4XIFA 4U9UA 1NT2A 1XA0A 1CJUB 3TAMB 2QQ5A 3QPBA 4DCPB 4NRTA 3GLIE 3QM1A 4PAWA 3ICQB 2IUFA 2LXUA 1V37A 1QCCA 4GZLA 1FX2A 5FUYA 3U7GA 4RAOA 1ACJA 2VJKA 4B0OA 4AZTA 3HYCA 4P86A 2P77A 4M63A 2J4FA 5G0TA 4F45A 3GV8B 4BC7A 1W36D 1YS4A 4CF4A 2GUGA 1GM5A 1KFJB 3M05A 1S1WA 1ODJA 4GEGA 1MG5A 5AI9A 1XMJA 2RS8A 4OLHA 2QIFA 1F14A 3PPWA 3TDMA 5IMBA 3PNSA 3HFVA 3ZCSA 3ROGA 1TT7A 4RWEA 1HOTA 1BE1A 3TNFA 4BX3A 1H65A 3T7SA 2HT1A 2Q6KA 4R98A 4NMXB 4QLOA 5ALQA 2GJ8A 3J81A 2O8EA 2G28A 1ZLXA 2BELA 1YQEA 1U2DC 1VGQA 1TU0A 2QPAA 2CJYA 3QMWA 1S6OA 5EX3A 2ZPUA 3ZVLA 1U25A 5EHGA 3KSRA 1DG9A 2FCAA 3Q8XB 3QFSA 5CXTA 1KVTA 4I2VA 4N76A 2O8CA 1WBBA 1RT1B 4J1QA 1W5FA 5BVGB 2RQKA 4JBYA 1A96A 2FZ4A 5T4FA 2HADA 4KWHA 4N7RA 3EGIA 4YP9A 4FQ7A 1AROP 5FBWB 1HETA 4YDXA 5KJ6A 1N34B 4X6XA 1U6ZA 4BQFA 4LTDA 3KQKA 4F3QA 1JZQA 5BQ5A 3RBAA 3CLVA 4PYJA 2M4MA 1TTHB 1CUCA 1JG7A 4EBFA 4XVQA 1Y9JA 1N5QA 2ZM5A 4QJ5A 1H4SA 1CZKA 4BE7B 2XYGA 1SR8A 3KG4A 1EX6A 4ZPCA 3WA6A 3AF5A 3V6MA 2YVLA 2OCIA 2C3YA 3K0CA 3N0XA 4KQ2A 2X7XA 3STXA 1WHXA 3A2MA 3HFRA 3S55A 1ZFNA 3MILA 1NI4A 4UOQA 5CH3A 3MTQA 2P5VA 3I6BA 3R23A 2J6BA 5LXTB 1B76A 3GUVA 4ANCA 3PFWO 3FLAA 1ZOTA 3S29A 3ER9A 1OU4A 1DTWA 3CLUC 1NQTA 5J1EB 2QVXX 1GAWA 5AW3A 3KKFA 2A6PA 3WRYA 5AJTA 4CMAA 1JG2A 2OHGA 4XOIA 4K6HA 1X7XB 5DM2A 2FVQA 3ILOA 3NRBA 3SIPB 3H9QA 3LY5A 1JDVA 1GKKA 5IWAB 3ZTYA 3UFCX 2CPJA 2FB0A 2GA9A 5F8HA 1QG4A 3DN9A 3I0MA 2DRDA 3FSGA 3ETJA 1DKOA 3TBHA 1KNZA 4EGJA 2VJUA 5LZ5A 3DTVD 3V8PA 4PG5A 1JF8A 4AY2A 1IY9A 4GE3A 4UW2A 2IVZA 1OLSB 1VE7A 4MV1A 2RK4A 2YWDA 5BR4A 4JDPA 1RA7A 3COWA 4B43A 4F3KA 2ZT6A 1VBYA 3MMZA 4ZICA 2ZUUA 4NEHB 1Z75A 4C7OB 3Q83A 3ROKA 3BS9A 4A8MP 5T7LA 3VGVA 4LF9F 5LZ9A 3BRWA 1LW0A 4C5BA 3CZPA 4ZT5A 2A14A 1ID8A 3KETA 3DQZA 3KAKA 3HMQA 1ZS9A 4FYWA 1GSHA 4GPTA 2H8GA 4OX9F 4FT2A 3UNXA 1DC5A 3C74A 4PR3A 3K9HA 2H2WA 4M6WA 4A16A 1GNSA 1ZICA 2JGDA 4KQ6A 4MJ7A 2GSWA 1BAPA 3IBYA 3H5YA 2Y1CA 3M2RB 2Q5IA 4RTRA 1PNQA 2HHHF 1FXUA 3IP9A 1E2PA 5H9EK 3U5ZB 2ODNA 2ZITA 1T9GS 3HCOA 2Y93A 1E1RA 1KF0A 5DWQA 4CL3A 1T3TA 3RSSA 4QU6A 4LQDA 4H77A 2GV1A 4KQ9A 1V3ZA 2MQNA 4MCAA 3DF9A 5CVCA 3RJTA 2VAPA 1E4EB 3H1TA 4KAAA 1S01A 1H23A 3A6KA 2RGYA 1OWMA 3ASUA 1PNTA 2QRRA 1GDHA 3NETA 4KC5A 5EIEA