2E1PA

Crystal structure of pro-tk-subtilisin
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of unautoprocessed precursor of subtilisin from a hyperthermophilic archaeon: evidence for Ca2+-induced folding
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 131
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2e1pA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2e1pA02
3CNQP 1TO2E 1Y48E 3GT3A 1SH7A 1MPTA 3DE1X 1S02A 1SIUA 1GTG1 3CO0P 2PQ2A 2TECE 1P7VA 1KDVA 2XTJP 2SICE 1IC6A 3WQBA 2Z30A 2SNIE 2HPZA 3SQOP 3T41A 1BFKA 2PKCA 1S01A 1PJ8A 4NMXA 4K8RA 1EGQA 1PTKA 4CFZA 2Z2ZA 2XTJA 2Z56B 1A2QA 1ST2A 2HD4A 4I0WB 4NMXB 4J94A 1TO1E 3VTAA 3Q40A 1GTL1 4YN3A 1BE8A 1ZVKA 1Y3CE 1VSBA 4NE7A 2PRKA 2W2PA 1R0RE 3DVSX 1SBCA 3PRKE 3P5BP 3A3NA 1EA7A 1Y34E 3OSZA 4AKSA 2Z57B 1TM3E 1C9NA 1T1IA 1BJRE 1LW6E 2X8JB 4K8RB 1NLUA 1R6VA 4Z2AA 4DZTA 1V5IA 5AVJA 5SICE 2Z30B 4JP8A 2ST1A 1GT91 4CG0A 3VV2A 1HT3A 1OYOA 1SN7A 4FONA 1TM4E 3DDZX 3GCXP 1MEEA 3DWEX 5AQEA 4KG7A 3BPSP 2Z57A 1SUDA 2Z56A 3GCWP 1SBTA 1Y1KE 3DW3X 3I34X 5FBZA 3VHQA 3A3NB 2SBTA 2ZWPA 2PWBA 1WMDA 2W2OA 3TI9A 1SCAA 3SICE 1YJBA 3D9QX 1SBIA 2X8JA 1OT5A 3DVQX 1TK2A 1TM7E 2Z2YA 5FFNA 1AVTA 4H6WA 3DVRX 5I9SA 2WWTA 3VV3A 4DWWA 2P4EA 1GCIA 2B6NA 2PWAA 4DJ5X 5CW1A 1SPBP 2GKOA 5K7SA 1KDYA 1AV7A 3BX1A 3F7OA 2DP4E 3DE0X 4OMDA 5B1DA 3WIUA 4KPGA 1KE2A 3I37X 3I30X 3VV2B 3EE6A 5B1EA 5JXJA 3DYBA 2W2MA 1UBNA 1Y33E 1Y3BE 3A3PB 3QTLA 2W2PP 4NE9A 2SECE 1JEAA 3DE6X 3TECE 4WOBA 5ARCA 4YN3B 4WOCA 2W2OP 1BH6A 1YJCA 1R64A 2QTWA 3DE5X 4CFYA 3WIVA 2PMWA 3LPDA 3WHIA 3BGOS 3D43A 2W2QP 2XRMA 3I2YX 1TMGE 4H6XA 1SBNE 1TECE 3QFHA 4OV6B 1SVNA 2W2MP 2WV7A 1PFGA 3DE2X 4MZDA 2Z2XA 3H42B 1Y9ZA 1AF4A 2Z2YB 3LPCA 1NDQA 3HJRA 3QMPA 5JXIA 1GNSA 1NDUA 3UNXA 3VYVA 1SCJB 3TI7A 5AMXA 3BGOP 1SUBA 1SUEA 1BFUA 3AFGA 1THMA 5ARBA 1SIBE 1WVMA 1PEKE 1T1GA 3LXUX 3CO0S 2DUJA 1AU9A 1C9MA 1BE6A 2PYZA 4KB5A 1TM5E 1DBIA 3F7MA 4GI3A 3SQOA 4M1ZA 1SCBA 4HX2A 2WUVA 1S2NA 3A3OA 2W2NP 1SUCA 1WSDA 4LVOA 1TM1E 1SUPA 2W2QA 3A3PA 3L1KA 1C9JA 3LPAA 5AVKA 4LVNA 5JXHA 1P7WA 1Y3FE 1V5IB 4NE9C 1ZVJA 4ZOQI 1WMFA 3CNQS 3DW1X 1KE1A 4C3UA 1YU6A 3GT4A 1AH2A 4H6VA 1GNVA 2PMWB 1KDZA 3H42A 4HVLA 1GTJ1 3ZXXA 1IAVA 2E1PA 1SCJA 1T1EA 3EIFA 1SUAA 4OMCA 1WMEA 3Q5GA 5FAXA 2ZWOA 3BPSA 2IY9A 3GCWA 1CNMA 3F49S 2IXTA 2W2NA 1OYVA 1GA6A 2ZRQA 1ITPA 1AQNA 3PTLA 4ZARA 1SCNE 5JMOA 3AJ9A 3EDYA 1SBHA 3DE4X 2V8BA 1SIOA 1Y4AE 4C3VA 3P5BA 1SCDA 4BWGA 1CSEE 4RYDA 2Z58B 4AKTA 1SPBS 1C3LA 1ST3A 2ID8A 1Y3DE 3VSBA 3ZXYA 2G4VA 1YJAA 2ID4A 1GA1A 1DUIA 1SELA 5JXGA 1AK9A 2Z58A 2WUWE 1Y4DE 1GA4A 1XF1A 1Q5PA 4B5LA 1V6CA 3AJ8A 5ARDA 4OV6A 2DQKA 1P8JA 3DE3X 3DE7X 2QTWB 3A3OB 3GCXA
chains in the Genus database with same CATH superfamily
3KQVA 2F1KA 3LFTA 2QVBA 4I2NA 1ECJA 2VOPA 2CLFB 4HS9A 4R8SA 1BN7A 2O48X 1NU6A 1D4OA 3O91A 2FGCA 4EU0A 3WL7A 1NSTA 3MM7B 3WGJA 2O0HA 4W7IA 4HEA6 1NKCA 3MN1A 4MK8A 3L04A 4DB2A 5HCIA 3DMNA 3PZBA 4URVR 3OFND 2ZYIA 1EGVB 5HYVA 1EB0A 2MGZB 2ZYDA 1SXHA 1G7TA 4C22A 4RIGA 2WMYA 2C82A 5EG5A 4KU4A 4QJ4A 4PQFA 5LM7E 1C8VB 4C6RA 1RJ9B 4ZJPA 5CABA 1RLCL 3ORYA 4AYBD 5H0IA 2VSOA 4B2IA 5G4LA 4IJQA 4RAQA 4B6OA 3Q8XB 2VP2A 1JNZB 4L4YA 3UO0A 1U7OA 1WUTA 4IUFA 4X4VA 3VHXA 1V11B 5A7FA 2MINB 5LJIA 2Y0PA 3TD2A 1BJTA 3EEOA 3KKLA 4JLOA 4H18A 4E7OA 3AC0A 2I4LA 2QG9B 3M5PA 1K1QA 3QVXA 3GARA 3HX9A 3QXCA 4KRWA 2YC4C 4L2IA 1CF4A 2H0QA 4R2KA 1SK8A 1NLZA 2RARA 2FQ1A 1ACMB 1DLJA 4RCZA 4A8PA 5C2JB 3GCWP 4YIKA 2EFJA 3EAQA 1GZVA 2HDWA 4YTEA 3CW2A 5EWFA 1IVYA 1O2DA 3JQGB 2DGQA 1G1XA 1ZSYA 3BJIC 4ZQIA 3M1AA 3N9IA 3RREA 2P62A 4FVTA 3OQIA 1N54B 4CYMA 4EATA 3I12A 3L0PA 4RS3A 2PJUA 3TZHA 1RWWA 2X5XA 4DCPB 1PS0A 4GPAA 4EUEA 2BGRA 4ZYYA 4JZYA 4B6FA 5C5JA 3AHFA 4X92A 2CYCA 1VIMA 3EWNA 2QT7A 2VJOA 4UVDA 3SDEB 1RQNA 1DWQA 4HHJA 1JEQA 1Q5VA 4IAOA 3CF4G 2XSZA 4GEGA 4KSCA 2PH5A 3A28A 4QL3A 4CM1A 1BDIA 1CUVA 4W9MC 4YP1A 4RZHA 4FYWB 5E6RB 3RG6A 5BYKA 1R6YA 3GLHE 3ZY4A 1RHRA 3UC5A 1WCYA 1XAJA 4ND7A 1Z0DA 2QMEA 2P4SA 3GUUA 1ULTA 1VE6A 3M4XA 4XM2A 4PC7A 4ECUA 3IGFA 5LIRA 1I4OA 1XAHA 1U2GA 3JZDA 3TRIA 4CEIB 1DC3A 3ERCA 4DX8H 4NRUA 3A4MA 1ZICA 3PGLA 1H4TA 5LDHA 3DXSX 3VPFA 2MY8A 4F21A 1T15A 2B61A 4C43A 3D4NA 4K1LA 4P08A 3V2GA 6CHYA 5DRYA 3AHGA 1WKVA 3N2GB 1PKUA 2W2XA 3MMCB 1CRWG 4NMMA 4MWBA 5BV0A 1W93A 1JQLB 1GV0A 1UAGA 4BMNA 3GU0A 4O2LA 2P27A 2AJ8A 1OSCA 1W26A 2HJGA 4A8XA 2QMQA 3HYNA 1JZQA 3ZHCA 4ZXPA 3GZ7A 1QIIA 4F2PA 2UYQA 8LDHA 1G9TA 1R9MA 4BC7A 1ZUWA 5IQ6A 3AWIA 1S6QA 2PD4A 1BGVA 1C9KA 1W0KA 3QFSA 3F5QA 3KZCA 4LUCA 2O2GA 2FH5B 1T1RA 1S2NA 1YT5A 3Q41A 1J06A 1OX4A 1BKDR 2GQCA 2DH5A 1R8XA 2RHJA 5FNVB 3Q89A 2ZI7A 5CH3A 3WTBA 1RLJA 4IIDA 3Q7PA 1JBEA 1JPUA 4G26A 2ZJOA 5EN1A 4JH0A 3BCHA 2DETA 3ZI7A 3DW1X 1H0HA 3EQ7A 4X66B 1OJLA 1HEIA 4ZOSA 1ZONA 4R81A 4JBLA 5K6TA 4LF1A 1E1QD 5AVQA 2DLCX 3CRMA 2QTLA 3HN7A 2FSVC 1ESCA 2QLJB 1WW3A 1YJWS 4JBXA 4HJXA 5EHQA 1PQ4A 2NUBA 3TAMA 1J90A 3ORFA 3CQ9A 4AXBA 4BNIA 4IG3B 4NJMB 4Y2AA 1JBQA 3H13A 3FNIA 3OO0A 2UU9F 2HRDA 3PP8A 5DBFA 3QRQA 4UU1A 4R5HA 1KYWA 2Y0EA 2DPIA 1SIOA 1A8QA 4A91A 4ZT6A 2ID4A 2Q1TA 5JNSA 1JLGB 2V6JA 5IX8A 4OLJA 2FD2A 1V5FA 4AO6A 3TQTA 2BANB 1U1NA 4BKPA 5B0DA 4OQNA 2GXUA 4PAQA 5REQA 2XOEA 1B3TA 5HSPA 1A76A 4S35A 3LP2A 2NTNA 4TVSA 2O66A 3SVZA 3OFVA 1MKYA 2DHDA 4NY1A 3FPLA 4I56A 2HR1A 2UUWA 5EHZA 4UEJA 4F3TA 3QVTA 3UTCA 4PSUA 4YRIA 1MSWD 1S3SA 3SFUA 3PHBE 1RHRB 1UMBB 2Z30A 2V96A 5M29A 3T61A 1BFKA 4J7CA 4L3VA 2EW9A 1CB7A 1U6IA 3A1SA 2CJQA 4NI2A 2R2TA 4AG6A 4I9UA 5K6AC 1X7WB 2JVKA 2FG7C 5I7AA 4R8MA 1I3LA 1C3JA 1GSOA 2DKFA 1KNXA 3SCKE 2IVFA 3AXTA 3VTKA 3N39C 4K2AA 4L0CA 1UH5A 1HKAA 3ZIDA 2TMGA 2XCRB 2ZBQA 5HKAA 3DG9A 3OUYB 2FWIA 4LMRA 4TVKA 1Z33A 3C74A 3OESA 4PTZA 1T1IA 3AESB 4KQFA 1K7CA 5HX7A 2O8FB 4HEHA 4H77A 2OK7A 2DBYA 3HCXA 3CRZA 3D3WA 5AKJA 4F4IA 3WADA 1YULA 5J58A 2AC4A 1A9SA 2ZI9A 4BHTA 2Z09A 2W6PA 3KHHA 3UXHA 2YZ2A 2LCFA 2I4OA 3DPUA 4F7VA 5B0BA 1SUSA 2V9ZA 3BXOA 2ZJ5A 4I8DA 2RKIA 3CRNA 2OHIA 2J4DA 4ICLB 1YBHA 5JH7B 3ZHOA 2D1CA 1UAWA 4QICA 3LXMA 3SJ7A 1TU0A 4RA9B 2VQFF 3FLEA 1P5HA 5TX7A 4EMSA 1AVTA 5EJ9A 4IFEA 2HIQA 3OTEA 3NS6A 3MCZA 4QOIA 3LQVA 2XWPA 1O54A 2X5NA 3IEKA 3TYXA 3V4MA 3SBXA 5GAGU 1XFDA 4ZO7A 5JALA 5IC6A 1JFSA 1IN4A 1LI5A 1R31A 5U4XA 3G2NA 2Z83A 3CKYA 4E33A 2JHGA 4CTOA 1XD8A 4N39A 2J3EA 3EJWA 3KBBA 1KOJA 4OI1A 3VV2B 2XWQA 4OAPA 4HAXA 3EE6A 5A9SA 3U1LA 2ZZMA 1WCIA 2ZDGA 4DNOA 2W2PP 4DARA 4WDQA 4Q8EA 1OI2A 3J81A 1VRQC 1IHXA 1GDDA 1BH6A 1XAIA 4TM7A 2W7AA 4RTNA 5F73A 5IVPA 2R8EA 2DQ4A 2WVFA 1PL8A 4OKSA 5EPOA 1ZM7A 4WZBB 4D4JA 4CLYA 4C7XA 1UFRA 1ONNA 3IBCB 3L92A 3P4YA 3VNUA 2NSDA 2MGZA 3E2PA 5IKXA 3EIEA 2ZR7A 1NU8A 2IP2A 5LYJF 1ZTTA 4IJ5A 3FZYA 5FUMA 1HBNA 3K9WA 3BB1A 1VGYA 1L5UA 2FR1A 4FCWA 2P5UA 3MMCA 3T95A 2ZJZA 4GYKA 4QASA 1IKVA 2O3RA 4KO0A 3ZJ5A 2CVQA 3JATB 4FHDA 1G63A 4JY7A 1CUEA 2DX7A 3UCZP 1J5XA 4ZVVA 5JZMA 3L4JA 1ORIA 4YUZA 5DLEA 5CLIA 1C9YA 2ZROA 1SC1A 2I4NA 1DKLA 3T3PB 1CUHA 1QU2A 1MO6A 2XR1A 1HT1E 1ZS9A 3QKRB 3GOHA 3VR3D 5KSOA 4O0NA 2UAGA 1G0OA 2HJHA 3ZVRA 3QW4B 5LMUB 3USCS 1K3UB 1HNWJ 3FTEA 4CTAA 1AOXA 2PUJA 3WQQA 3KHGA 5CJ2A 4KEAA 4GQAA 1NVEA 3LH5A 2CHQA 1RWMB 3MGAA 1R0WA 5IC4B 3G9TA 3TNFA 2D06A 2ZE5A 1P62B 2WG2A 1EJ0A 1T0JB 3IAAA 1XPRA 3BICA 1XNHA 4C05A 4NAHA 3G17A 2GCIA 4CF5A 4R1MA 1TU0B 1Z2LA 3H8YA 3PHHA 1QH8A 4BUJA 4MWZA 4LBWA 4HADA 3FQLA 4D02A 2VTBB 3A1FA 4ZITA 5CHYA 3LCJA 1E7WA 4P6VF 4IBOA 1YRBA 1SQ0A 3FTNA 4DRXA 4KO0B 2A67A 2GGSA 2O8DB 3HFRA 1HWKA 2P9HA 1XTRA 3GE9A 1Q82T 1TJNA 4QTTB 3CH7A 2ZUDA 3FETA 2F7SA 1QCCA 2GMHA 5KYKA 1U6KA 2UZ4A 2BX6A 2UUCB 4LOAA 3BQMB 5A2GA 2V5UA 1QHNA 2JLQA 3HV2A 1DIGA 1L9KA 1CY6A 3DE3X 4KSYA 5HSGA 2Z0GA 3H2GA 1RQ7A 3L7LA 4HATA 5SZKB 3O1IC 3HI4A 1QB7A 5L9XA 3KL2A 3F8WA 1RTHB 5JW6A 2GM4A 2PQ2A 2VC2B 2QM7A 5CDFE 1KC1A 4EF6A 5CAEA 4QWDA 3A4VA 1J7JA 1BVHA 5KOWA 5JOQA 3GJQA 3NC4A 5LXTA 3ZDBA 2HS4A 7MHTA 4A8YA 4GKJF 4B3MJ 3OIFA 2JLGA 3DKIA 4UTZA 1GARA 3WLOA 1FL9A 3K8ZA 3JQBC 3EGVA 4K4WA 4PHGA 1ZVVA 4NH4A 1TMYA 2J46A 1GKIA 3QEMB 3CCTA 4BQFA 2X0IA 3FSGA 2A3JA 1UZUA 2GDZA 4DIDA 2OHGA 3FZGA 5CVEA 4A1OA 5BWMA 3NOQA 1ZCAA 4OK5A 1ISJA 1WHTA 2XKAA 1J1UA 1KGSA 5JROA 4I50F 4HH4A 5C5EA 2DY1A 4NZZA 3WIDA 4NCNA 3VJRA 1KYTA 1Q17A 4BPRA 3R5JA 3G6YA 3F6CA 4W1QA 1CUFA 4HNAB 3A10A 4ESEA 3MJ4A 3JSXA 1QUPA 2WTUA 4H3SA 3T99A 2NUPB 5A3VA 1I3KA 4QU0A 3BZUA 3NDJA 5BMVA 4PR3A 4DT1B 5CVVA 1PWXA 4KOEC 4WFJA 4LHZA 3RW7A 2RCYA 3OA0A 2XZOA 3GV0A 3DDCA 3E9MA 1K66A 5IKEA 3OP1A 4RL4A 2EG1A 4B3FX 1PEYA 2EX1A 5C25B 1MMFB 1L5QA 3GNQA 4DAOA 3VQTA 1RC8A 4G4JA 4RV5A 4DUGA 2L9NA 1GZ5A 3HC7A 3MSXA 3CUWA 1NP7A 4JI0J 4MRAA 3J7YI 1O89A 4L4RA 1GIAA 2HK8A 1TF5A 4MVYA 2WBRA 2V6IA 4BXOA 2AFIE 3WKDA 2JD2A 3KKOA 4MKFA 1GL9B 4RW7A 5ABPA 3M82A 4M2LA 4KHMA 1U28A 3OLBA 5A3RA 2J8ZA 3KZVA 3ZDFA 3CJ5A 1XG5A 5REQB 4XX0B 3JYOA 4Q4HB 5LWHA 2AEEA 4DSUA 4DW8A 3M2TA 4QR2A 2OECA 4TT3D 4Q24A 4FDLA 1QHSA 5FWXB 3E2MA 1PBAA 1QMGA 5KFSA 3RRJA 1A0OB 3LQ2A 3T0IA 2OXIA 2PRJA 3AV0B 2PWZA 3C8DA 3O6VA 1OAAA 4LDJA 1KHVA 5JVGQ 5K20B 1IBKJ 4DA0A 2FSHA 3R24A 2B2NA 4EDFA 5JY1A 4B9LA 3SZGA 3MEKA 2AMFA 3VZSA 3MERA 3PQ5A 4AURA 3DFMA 3OUYA 2YNGB 2YWEA 3ONEA 3F0NA 2OD7A 4AY6A 4DV3B 3AVUA 3T19A 1XMQF 3EHDA 2NSYA 4ZZIA 1HPZA 1P6TA 4B79A 1VPLA 4TKUA 4M5IA 4C8MA 1AS0A 4YR3A 2DNGA 4LS3A 3ET6B 1X7GA 1JEJA 3GIMA 1FNNA 3ICCA 4YASA 1U0GA 2BE9A 2ENWA 3FRIA 2PD3A 3BE4A 4D8UA 5EKXA 4CM4B 2DBQA 1CY4A 2PQMA 1X86B 1OOEA 3I0SA 4FQ5A 2J09A 1Y3FE 4TYQA 6AT1A 2HURA 3UMCA 2Y99A 1B8UA 1VI6A 5FNVA 1ZPDA 4RQUA 3POTB 3LF1A 2FU5C 4IXDA 4F2WA 4IFIA 3FOFC 2H5JB 4KN8A 3NAIA 2JI7A 3EVOA 2OQ2A 3ULKA 2WI8A 5DO9A 5DW3A 1ORTA 3HSKA 5EN4A 2XUKA 1Y3KA 1DG1G 2QWXA 4YUVA 2I1QA 2JL9A 4TT8A 1Z5GA 4WEOA 4TWZA 3IR5B 5IBPA 1Q84A 1VB5A 5KBYA 2Z43A 4IO1A 4N3BA 4DJFC 5JASA 3U3MA 2DY9A 1ZJZA 4MS3A 2G9OA 3C3AA 4I50A 4DWJA 5HP1A 2QGFB 3U37A 5BVGA 1EFLA 3MJVA 2IYLD 4IOBA 3C87A 2VO1A 3UH0A 4AZVA 1EFPA 1SCDA 2W58A 1JDVA 3U9SA 4O8CA 5I42A 1PBTA 2HFVA 4IVNA 1P9LA 2UUBJ 2HEGA 1Q1QA 1RQGA 4NLWA 3R2DJ 4NPOA 5I01A 1LDEA 2D5BA 3G2MA 2ESRA 3ZHUA 4P34A 3H1PA 1CZRA 1KIMA 4MQBA 1BQNB 2FJBB 4B3RF 5CA0A 3R6DA 4S3MA 4FXPA 2QT0A 2OL4A 4PU0A 5JCPA 3WLHA 1YL7A 1BEEA 2YPZA 5EEGA 4TN5A 4L7VA 4YJ3B 3U1BA 4CO3A 3K5WA 1XYVA 2J7PD 1RRPA 5FD8A 1XNJA 3VU8A 2AZDA 3FOZA 3DR5A 5JPDA 2B8WA 1QSSA 4OZNA 2OEMA 1X60A 1O97D 1NW4A 2ZXFA 2VG6A 4CTMA 3K05A 3ZKWA 1ZD1A 2FPLA 3V34A 3HBMA 3ZJUA 4X97A 4JLVA 1HL3A 4MWGA 4USJC 2HVZA 1JVSA 2C3MA 4MICA 3PC6A 4M8IA 4BVHA 2NSJA 1S1WA 2KM8B 4AX4A 4ND6A 2MDTA 1S4EA 4HYTA 1QFZA 1IR2A 4WKCA 4ZVSA 3ETDA 1KSJA 1MWQA 3AOGA 2JGRA 2BTQB 4GRIA 4Y2PA 4HN4B 1BZYA 1UOQA 1U6BA 3PVZA 2HSEA 2A5DA 2IXBA 5BWCA 3BGDA 2H11A 3S44A 5GJWC 5G2OA 5K3FB 3OPMA 3CF0A 5IULC 2FJUA 3D54A 1TFYA 1ZY2A 4OGGA 2A0FA 4P5PA 3SG0A 1SQGA 5K3SA 3PXBA 2W4MA 2UUPA 2YBVA 5DBOA 3AOCA 2PL5A 1WD5A 4AL6A 1UMJA 1V1JA 4HG2A 1CJSA 3D0KA 4XCQA 3K0EA 1G41A 2YTCA 5JS8A 3V8QA 2Z56A 1GZUA 2VNHA 2PY6A 2X7XA 3EXFB 2LQ5A 3DZBA 4L74A 1E59A 1W1WA 2E49A 3VNAA 4GPTA 4UMDA 3RBXA 4UPVA 3CDUA 4J9NA 3A8KA 3AM1A 3JWEA 4HJRA 2X2PA 4DQQA 3BWYA 2DBVO 3DZIA 4KK3A 3PDIA 4DUGD 4JLWA 4CMAA 4B5KA 1DIRA 3DRPA 1OGJA 4EFDA 2M4MA 2EJTA 1SZPA 4LJRA 1AM4D 5LQRA 3VR5A 5FXMA 4BCBA 3G7SA 3D2BA 1H2TZ 1JR2A 3ROPA 4V19X 1TGVA 1IOVA 1DKPA 3WNVA 5G53C 3L0DA 2RRBA 5EUMA 4Z1MD 1N5KA 2HPUA 5J3JA 4R3WA 1JFVA 3HJNA 4GOND 1FXWF 4PHFA 4YMSA 2R7UA 5JC1A 2RF2A 3PXUA 1TCBA 4NS4A 1HYHA 5HUJA 3BSFA 4QGHA 4FZ3A 4JLPA 4EB6B 4W5OA 1IQUA 3O1LA 1K68A 2WBLC 3PNKA 3ITEA 1R8AA 3LX4A 1PFGA 4CO1A 4CIVA 3KOOA 2O1SA 4BWMA 2ZRIA 3AO0B 3I28A 4E5VA 4QPPA 3RYIB 5JC8A 3K4QA 4P7KA 1J97A 3KLEA 2XV1A 4TTAA 5EX3A 4CMEA 2C07A 2ZC4A 4KH0B 3DAGA 4WZQA 3JQPA 1EGHA 1SD2A 2I0XA 4A1FA 4H3VA 5BSUA 1I1QB 5M04A 2RJNA 1NO8A 3MM8B 3NIGB 4IQGA 3DQZA 3KHTA 5HCNA 2C7QA 4G1VA 1PUXA 1LLQA 4IKPA 1BG6A 4NLSA 1XZFA 3ST7A 1E6EA 3L6OO 1SZDA 4QQNA 4YUXA 4G5QA 4MHTA 2QRZA 3UK7A 5EZYB 3IP0A 4RCVA 1AKVA 1XCBA 4KSEB 3WQHA 1JKHB 1PJAA 1E62A 3LGSA 4UULA 3ZY3A 3FSJX 4HSGA 3JYLA 1U0HC 2AD1A 3QIPA 1CZKA 3EXYA 3JWJA 4MV1A 1G9SA 4IIBA 4OI0A 3TAXA 1C0IA 5C42B 1KQGB 2Q6IA 1OI4A 1AV6A 3LPEA 3OQMA 4MGYR 1J23A 1M2VB 1UKYA 4H4OB 4OX9Y 1MQ8B 2IY9A 1VFJA 2AHOA 3FLBA 4ZOEA 2ZTLA 3GIKA 3LZ6A 1KJYA 4I4CA 2P6UA 3M32B 4MQ5A 4WOKA 4UKDA 5BXYA 4R0MA 4NLVA 4IEEA 1L6RA 2HW8A 1TUEA 3DOLB 1E6VB 1G64A 4KQ6A 4X20A 4KQMA 2QP3A 5BYRA 3WB1A 2QT9A 4XTTA 2HF2A 2Q4OA 3MPWA 4YMEA 2BQ3A 1ZM2A 1U28C 2MR6A 3LWNA 2GBGA 1SJ3P 1FW8A 1WDMA 4UQTA 1P8JA 4MP3A 3EDQB 1HHQA 1MU2B 3ABRB 1OV4A 3ASYA 1QGDA 2EL7A 4TUYF 4RK7A 4KACA 3FZNA 3K4HA 4GI7A 1WIWA 2K3IA 5E1DA 2R7QA 3CDAA 1MEOA 3CEPB 3D8BA 4RAOA 1E5DA 3NWEA 3OKPA 3BT7A 1QAXA 4Z0NA 5GWXA 3ILIA 4DL5A 3EFEA 2ZWMA 3LT2A 4PR0A 4LFCJ 1S01A 4XIGS 3L1VA 1SHJA 4PZZA 3HCEA 2G40A 4CMBA 3ZS9A 2H5JA 2DHRA 1FJGB 2UKDA 4G1QB 2R7XA 4HI1A 4KQZA 3NVMB 2X8WA 5FYDA 9GPBA 5FTNA 1HNXF 4WESB 1WVGA 5K14A 3TIXB 3G0OA 1NZAA 3TQOA 3WLSA 5E3CA 2VNKA 2F9DA 2EFGA 1Z18A 3VR5H 4BX2A 1USVA 4EA8A 4JHXA 4YCDA 5B0AA 2RHQB 1YCDA 3AERB 3ROEA 1P5FA 4EENA 1WG5A 3OOJA 2PV0A 1QRRA 1D6SA 4HDMA 3R6LA 1IJFB 1FVHA 4HAZA 2C9DA 4TTJA 5EHIA 3V7NA 3O2IA 1H93A 4CH0S 1DKMA 2WVEA 3O93A 1NXTA 3HLKA 3H7AA 3OHMA 1K6EA 3EVMA 5CB6A 3UZUA 3F6EX 4X45A 3WGOA 6LDHA 1FRHA 4LOIA 2UV8G 2C7BA 3HUTA 1D04A 3PGMA 1N3BA 5DLDA 1IKYB 3N8IA 2VDQB 1ZOOA 4U39A 3EMBA 3K2QA 5BN3A 1K5DA 1LWCB 4H0NA 2VH2A 4FMCF 1GTHA 4J9QA 4KTVE 1IY8A 1B26A 2OH2A 2PBRA 3MFYA 1GU7A 4I7FA 1SBZA 2CWXA 4KW7A 2C2MA 5JZ9A 3IVGA 2VBWA 3AAWB 3RADC 3EX7C 1RRFA 5J5VA 4CV1A 3IVCA 2OENG 4O2AF 3OL8A 1ANKA 2E5LB 4YHHB 2Y0BA 2ZJ3A 4OAOA 5BVHB 3NETA 3SYMA 1BDHA 3LBHA 1SEPA 1HRDA 3VH2A 1EDBA 2E37A 1ETHA 4DLPA 3OCCA 2DKOB 3IS9B 3T52A 4PNEA 2LPMA 4BWFB 3M83A 3O73A 1NM2A 1UEVA 2IHNA 3NRCA 2PJRA 2V8VA 3KK2B 1FX0B 1VRVA 2CVHA 4CMGA 3CJKA 4AJKA 1EDDA 1GKUB 3H5UA 3TJ9A 1XVTA 1J5EJ 4J03A 4L4XA 2HF9A 1V96A 3U62A 4B4DA 2PI5A 1R88A 4JYBA 2NSBA 4H17A 3WIEA 4CRWB 5DLQC 3FKQA 3GLHA 1Q78A 3W1YC 1XZNA 5FUWA 1T5BA 1RTDB 3UMSA 1C3OA 2CXQA 3BKUA 4Y6IA 2QMWA 1HQUB 2P79A 3SEAA 2YKNB 5L1LA 1XZQA 4QUAA 4JJ8A 2QW1A 4L6V3 4OQXA 2H2AA 3AFGA 5FA5A 2ICAA 4LZOA 2C97A 5IJAA 4RWEA 2OD9A 1LC0A 4DBVO 3HBAA 4DLGA 4J1SA 2G0CA 1WA5A 3IC5A 4AY3A 2X6QA 4X1KA 3G5TA 1FKPA 1F8XA 3QQCD 5H9FJ 1JJCB 3OHBA 4LFBJ 3HA3A 3WLIA 3WL5A 1LEHA 1COZA 1RT4A 4NCGA 3IS3A 3OZAA 1CLEA 4CN9A 3UPDA 1NSYA 4BKOA 2KRBA 5BSHA 2DQYA 3FOAA 3GHHA 3ZXXA 2NU6A 4CU2A 1WQ1R 4HH0A 2YNMD 2HHHF 4QJIA 4B7UA 4MIEA 3HVKA 4AL4A 1GH8A 1M5KC 1BEUB 1GPMA 4G9BA 1VKNA 3BIXA 3PO5A 3L7NA 4BVEA 2PZ8A 2ZXEA 4ZICA 5HG0A 3AY0A 2CNOA 3CPHA 5J2PB 5T7LA 2C2XA 4AKEA 3ORHA 5KTQA 4ZEVA 1V3RA 3CH4B 4EGSA 1LWFB 2C22A 4LTMA 2MQ8A 1CY8A 3UJ9A 3P94A 3JQQA 3TKLA 1ZM4A 3ZXUB 2VL7A 3EK2A 3GPIA 3CLTD 1GNLA 1P2VA 2VHWA 3IULA 3P26A 1YS4A 4BV8A 1VLQA 1IUKA 5A6VA 4EYKA 4UTGA 1K89A 2VUSA 4HMOA 1DHRA 4KQGA 2JLEA 3JYNA 4BMOB 3R5AA 3KK0A 3GSIA 2PX3A 3FZQA 5SY9A 2B4TO 4DR1F 4I55B 4A2CA 1TFUA 5IWAF 2UYYA 4PXYA 3WLKX 2VLIA 4DGQA 2CKDA 2PMFA 5KFFA 1AD2A 3NT5A 4P7VA 3HP6A 4MVJD 2P9JA 3LECA 4AJOA 4Y7DA 5ETSA 1ZM9A 1FDTA 2C7OA 2EARA 4EG6A 1ACMA 4XTRA 3DLAA 1SHUX 3UO8B 4MCJA 1THZA 1X3SA 2UVPB 1YRQA 3R7LA 1BE1A 3GIWA 1MGPA 2GK3A 3EY9A 1FKOA 2QZ8A 1ZVKA 1FFSA 4QZVA 2DHEA 2HSGA 4JUDX 1U7DA 3DNPA 4PUOA 2Y1EA 4J6EA 2H2HA 4RULA 1VJ1A 1XIQA 1BSVA 5CYJA 2AD9A 1VS3A 3J7Z5 4OBXA 4J3JA 1NVKA 4XQGA 3VR0A 4BLTA 3JQ6A 7ABPA 3KFLA 4H15A 2AMYA 2IDKA 2QLFA 4ZO4A 2ZUBA 3MQ4A 3GCXP 5EWEA 1I6MA 3DL0A 4N8SA 3AB3A 1FFYA 3GQBA 5CGZA 1E6YB 4NCAA 3QENA 4NSNA 3OZSA 1G2OA 4FOSA 5EXDA 3QG1A 4J0EA 2JGJA 4C1BA 2ILZA 2IIHA 5GAEI 3NWBA 1AKTA 3CUEF 2P78A 3ZC3A 4UUBA 4N3GA 4JVNA 4MDFA 2OG2A 1JB0C 4GU5A 1B14A 4MQEB 3MR2A 2IEBA 4B9NA 2ZOGA 2QRPA 1Z6GA 2YWHA 2ZJBA 3MB5A 4HDNB 3QGIA 4BATA 5DM7Q 4Y9SA 4ACBA 3N74A 2G5CA 3QK7A 4QDTA 4FS2A 1OYWA 3RJTA 2BXJA 3THYA 1WBBA 3I3OA 4YQEA 4TS9A 2N7CA 4H35A 1IR0A 3F1LA 3KHKA 3FFBA 4ITRC 2V68A 2R7OA 1T91A 3N58A 5CJJA 2B43A 4KO2S 1EQAA 3OT1B 1M1NB 3ED1A 1GPDG 5MDHA 3HCBA 3Q15C 2C4UA 2E7ZA 2HUPA 2AEMA 4LGMA 1YOVA 1SU8A 3GMSA 4GKVA 2AJFE 1PFUA 5IQQA 2F3RA 3MHPA 1XDBA 3TINA 3JALB 3KQLA 5ECYA 5BPFA 2XRMA 4G0NA 2G9UA 1JALA 3L4BA 3MWDB 1FNXH 4WCVA 2J9RA 5A8WA 4HLCA 3C15C 3Q98A 2ODBA 2UUBF 4KKXB 5GQSA 3TWOA 3PTZA 4YJHB 4YDXA 4I7FB 5IVIA 1SL0A 4TWJA 4ID3A 2XY7A 8ATCA 2ZYSA 3CCBA 4G0UA 4DZDA 3C16C 4QDUA 1A7JA 2FN9A 5D6GA 3I01M 2CPZA 3C1OA 4XQEA 3MNFA 2XB2D 4A9AA 5JZOA 4L8WB 3D0OA 4GWGA 4MPRA 4G0VA 1GAJA 2R8XA 1AZSC 1USWA 4IMRA 4HN9A 4P5EA 4ENPA 2ZSBA 2C28A 3DEHA 1SV5B 5TQ0A 1RCFA 1XT6A 3EVTA 1NU4A 1NMQA 2QLTA 1TYCA 1VIDA 4N7JA 4NA1A 3RB3A 4IUDS 4BC0A 3ZWCA 5K0CA 3OKAA 3D6JA 5D4NA 5BNIA 3PX7A 1XJ0A 3RABA 4YRJA 4G9EA 3HKDA 5IXSA 4J8PA 5JAPA 1UMDA 2F4VF 5GJBA 2VF7A 4RTJA 4I4TA 1JRLA 4NONA 2N42A 1VKRA 2ZR9A 4MVJP 5K1ZA 1VIAA 2O5EA 3EMVA 4Z4FA 3CV3A 3BWDD 2ZWOA 3G8QA 3HQ4O 5C1OA 4Q9HA 2CKWA 3D0QA 2WOMB 2EJCA 3FWZA 2VNAA 3F3KA 4WJBA 4DTCA 1FXLA 3R8FA 3TFWA 1SCNE 1N34F 2YL2A 3AM4A 5JBQA 3UEOA 2J4FA 3RGIA 4V2UA 4C8OA 3ZZ1A 2AYYA 4ZYLA 2KT2A 3H5LA 1IBSA 4FF2A 5FHQA 3KKPA 1FFBA 2PX2A 5DHFA 3SVTA 2CHEA 2EAUA 4XUCA 3I6QA 2QLXA 5BMVF 1ADJA 5HKKD 4N3AA 4A6PA 2M2IA 2A14A 5AXBA 3H9UA 2IJGX 4EOGA 1YCGA 2BJ9A 4W90B 1N8KA 4C8YA 3FBGA 4NDZA 1HA1A 3P9IA 3ANLA 3VYRB 1T0HB 3GLUA 5K51A 2ZH9A 1FSGA 4X6XA 2OFGX 1TA4A 3O1HB 5KFMA 5TF0A 4NCHA 2B8PA 4P3PA 4X4OA 3SJUA 5DYNA 1DCMA 2B21A 4QYRA 3LZCA 3H5WA 3LM8A 4F50A 3TLYA 3RVOA 1A2QA 4LF9J 2RKWA 3OFHA 3HYSA 2QN7A 4F0JA 4Z49A 4C1NA 3VISA 4K6FA 4HDRA 5BSFA 3MEQA 4F0HA 1M8PA 4RLEA 3FGOA 1E6YA 2J76E 3SHTA 4XYLA 3AFOA 3L8YA 1ZINA 3WHPA 2XWYA 2FVQA 1TAHA 3VGUA 5TE9A 3JQMA 4C7QA 4EITA 1O0CA 4JSYA 2BH2A 5AHRA 4OK3A 2CVOA 1QZTA 1D7OA 2FFJA 4R05A 5ETKA 3HCNA 4UTOA 2XEDA 2XY6A 3AR7A 3CS3A 3ECSA 3MMBB 3BTVA 1NA5A 2FDNA 2YR0A 2DNOA 5HOQA 3QXHA 1FJ2A 1C7QA 3OO1A 1OYOA 4Q1EA 1GTZA 1PJCA 4WIAA 3VVMA 4BO4A 4K9SA 3NGDA 5BORA 3EXG2 1NULA 4DCCA 3JQ9A 2C9YA 3EC2A 1MQ9A 4BO5A 1KQKA 3H3JA 2M6KA 4BVFA 4MMZB 2LXUA 4QAQA 1B41A 1UW9A 2IU0A 5EWMB 5ULLA 4C2MA 2HTFA 3TNJA 1O5TA 4BMDA 4BKRA 5GZ3A 4JT9A 5F76A 2ROGA 4LJKA 1HLPA 4F8JA 3KQKA 5IOLA 2CCJA 4OKIA 5D87A 5JYCA 3G85A 3CIMA 1YQXA 4GECA 3EW7A 3EPHA 3PQEA 4GVBB 1OB5A 2R1UA 4CO0A 2BQRA 2B35A 3H3FA 5KHAA 2P6SA 4A92A 4RY9A 3U7HB 3BGVA 1BW9B 1ZCBA 4WLOA 2A9PA 3AQPA 3MTJA 5D3MA 3EULA 3SDEA 2LZ0A 2CZCA 3ME5A 5KFUA 1MF7A 3VPGA 3ET5A 4CLOB 3D43A 4YVFA 3PHCA 4PQEA 2HTEA 5F9FA 2R1VB 3W78A 1T35A 4RIFA 4LRDA 2GFHA 2RE8A 2NAPA 1XN9A 4PLHA 4HT3B 4B73A 1E6UA 3EH2A 5BW6B 1DO0A 4DY4A 4ME6A 1U8UA 4KITB 4NXMJ 2C2OA 2FA9A 2I2DA 3AB2B 1TEXA 1PLLA 3PT9A 1SJ4P 3CCWA 4V02A 4TKTA 1A9YA 2UUAJ 4XTCS 2GEVA 1BQMB 1G8FA 1HHTP 1PEDA 4B81A 4MR8B 3C5EA 4DSOA 3RWMB 4C3MA 3PNSA 4ZZ2A 2JC0A 5ECWA 1MGOA 2YKPA 4RW6A 2IPXA 5FULA 2X5OA 4Y2RA 3KETA 1A69A 1PFQA 1T2DA 3LT1A 3ZUPA 1V41E 2IIBA 4J0IA 2X8AA 1G8PA 4NPAA 1JA1A 1DRVA 3V1NA 3CLSC 3WJ7A 2WQ7A 2QJ3A 4WY5A 5DWVA 4X7RA 1QWOA 2AGOA 4UUNA 3WAGA 2I55A 1U2GC 2ZSUA 2F40A 1VQ5S 2LDYA 4B2YA 1NGSA 1EEHA 1E64A 3CCMS 1K8AT 4MGZR 1V5IB 4TV9F 4WZ6A 2B4AA 3Q10A 4CODB 1Z16A 1JT9A 3IPXA 2ZZNA 4X71A 4GUDA 1GGJA 5MF6A 3MR5A 3B51X 2BTEA 3VU9B 1KSHA 1W85A 1YJVA 1JAYA 2Q21A 3GEEA 1TQ4A 3ROMA 2ZYRA 3EEYA 2R4QA 3ZLVA 3PVCA 1QF9A 4MTLA 1NQOA 4KNWA 3DL7A 3GYBA 2IYXA 3ILOA 5DBEX 2R86A 2IDLA 3RFCA 3MTBA 3RS2A 1WC5A 2ZJPQ 4ZARA 1SY7A 3TOXA 4O5OA 4CCHA 1M9NA 2H4YB 4KR0B 2FPMA 2NADA 2ID8A 2PYIA 3GCZA 4EYIB 3CW9A 1DCFA 1KEEA 3PNIA 4GRDA 5J1EA 2WQ6A 3FCHA 3RR7A 5KYXB 3K9BA 5DASA 2AG0A 3M2RB 1YF3A 3OWOA 3GZ4A 4UUOA 5F33A 1D9AA 1QHFA 2W2VA 4OV6A 3CU5A 2K1RB 5JADA 3MM9A 4MS3B 1JR6A 2W4DA 4RY2A 3CR7A 1KAOA 5CA1F 1EVJA 1G3UA 2OBLA 2VKTA 1OASA 5IJ0A 3M8SA 3GQVA 3OQPA 4AJ4A 1PGPA 3SE0A 4FYIA 5K8VA 3AHHA 1ZNWA 5DQHA 4RO0A 1D1TA 5L95A 5D84A 1RABB 1TVKB 2BA9A 2G0IA 3I2KA 3QOXA 1Q79A 5B08A 1NSPA 3RTEA 4BFVA 2GX6A 4H31A 3H11B 1U8ZA 1EX1A 1KP2A 5EC8A 3EXAA 2IE0A 1VECA 4MYSA 5I3CA 4EYSA 2MHNA 2QW0X 3QKWA 2PR7A 2OPQB 3R1HA 2P4UA 4NCBA 2EZUA 5IVDA 4UOZA 4LZJA 4JROA 1H98A 2FTKE 1RXOB 1E2HA 2YNMC 4D8XA 2B3DA 2BWJA 1YVPA 1WF6A 1ISPA 4W5NA 1ZRHA 2C9ZA 2FWNA 1Z2EA 3L7AA 4PYIA 4A8MP 4NLOA 2JJQA 3R3ZA 13PKA 5C42A 5JSFA 1ICIA 3SDSA 3KJEA 3QU5A 3GAZA 4ALZA 4AJ9A 3WYGA 4E21A 3W5JA 4P2SA 1GT91 4NP6A 1IUPA 2GCOB 3DLGA 4RVNA 3ES9A 5C8YB 3RTDA 3U44B 3L95X 2JGDB 5EZYF 3IHTA 2YWGA 3AB8A 5DW0A 5HJEA 1QO0D 1E0DA 1TW3A 1KGDA 5EHXA 2ZR8A 4QG3A 3C3LA 2Y8WA 3UCXA 4DMCA 1S1UA 1U0JA 4DILA 3SAJA 2R2AA 3NEYA 3OJFA 5TT0A 4CCYB 2A6MA 3NGSA 2OC9A 2I3BA 2R8BA 4FLEA 4U2KA 5JJIA 3GR0A 1H8ED 4EM6A 4RTPA 2E5LF 1HDXA 4ECTA 1ECFA 4RSRA 1VBYA 4P3OA 5CR9A 3NI2A 3U9TA 3U60B 4PW0A 5JQGA 4FFRA 4ZT7A 5D78A 1MJ5A 2CQPA 4BJ5A 3HHKA 3GXOA 4RVGA 2CBGA 4FZJA 3FMVA 2B7LA 4QKQA 4CXMA 1TKZA 3KLHB 1RT2B 2YINC 3PQ7A 1Q91A 2SECE 2FDCA 1CV2A 2DERA 4ZRMA 2AN9A 4EB3A 3O8DA 3R5DA 3M6VA 4GAEA 4I08A 3WIVA 2F8EX 4Q9LA 1IN5A 5A1JA 3AVQA 2CVZA 4JYPA 2CPIA 2UZ3A 1KDRA 1LUAA 1Q57A 2W2QP 1TEHA 2BR3A 1SHZA 4DWOA 1P9RA 5BOSB 3W06A 4LBPA 2QMOA 3M8QA 3PS9A 4GX0A 3VX3A 4OYLA 4M0UA 2QU7A 3BHIA 3FNHA 1YI1A 4P6QA 1WUJS 4DDHA 4W4MA 1ZUIA 4KLNA 4XIIA 1WO8A 4GPZA 4TZKA 1TUWA 2EZ8A 3RNLA 1SXJC 1YZFA 1GG8A 1QY7A 2VEDA 5AIBA 3SZLA 4D42A 1S7HA 5ESDA 2ZS8A 5HR5A 1EFKA 2IYTA 3WV5A 4XUDA 4PPFA 3NWPA 3ZV7A 1U63A 2RS2A 1A5TA 2ZIXA 3OUUA 4D57A 1GNRA 1U2PA 4DEVA 4FMBB 4MJXA 1HI8A 1WU7A 1UOOA 2R3VA 4G4GA 5BW5A 3Q7TA 2FQYA 1GNPA 4EVSA 1H69A 4XVRA 2UVUA 4EJ2A 1X8KA 3IRUA 4MDYA 2PA8D 2Z6UA 1W25A 4TMZA 5HMWA 4DV4F 1KK3A 3H4IA 4IOMA 4C03A 3I0NA 3HY3A 4YRKA 5KNCD 1YJRA 3AU9A 1GG5A 5F3RA 4ZRNA 4AWXA 4WEQA 3AFIA 4YH1A 3LHDA 3RUBL 5ECGC 3MM9B 1VM6A 2WIFA 5AWFC 4D96A 3PUJA 2G83A 1U0LA 5GINE 2XQVA 4O2RA 2E2WA 1WSWA 5E33A 1U49A 4QFBA 5H02A 3SMZA 3OSUA 5KFBA 2E87A 4UBKA 1XMSA 2HA6A 2NUHA 4ILRA 5EJGA 1ZOLA 2P2LA 1TQHA 4OL9A 2BEFA 3V3KA 3TOQA 1G3RA 4RYDA 3JRXA 5F8JA 4UHFA 2VP5A 3CWJA 2HQOA 3D8SA 4CQMB 3QE4A 4DOMA 4YGYA 1IXZA 4FI3F 1JHRA 1TTPB 3LUDA 4H0CA 3K0SA 3G96A 3EZ5A 2G9ZA 3PEFA 4EZ9A 4ECRA 3U0BA 3CISA 2X76A 1CQZA 3FMPB 5HE8A 1T9TA 3TMYA 3IQFA 5JFOA 1PZXA 3QE9Y 5HEKA 2GBLC 2RHDA 2W2LA 3NHRA 5C2CA 1PS9A 4DQPA 4LSNA 4WP3A 4QYZJ 2WNIA 4LZWA 3K73O 1YTLA 1R6TA 4POOA 2Y1FA 4KMRA 1UBFA 1E1KA 1QHHA 2J3JA 3QAEA 3RAXA 3R27A 2AZTA 3WFJA 4MUGA 4FW8A 4B08A 5FPHA 1HWJA 4Y2IA 1G98A 4BX0A 6YASA 1RWOA 2QYOA 4ZOLA 2ECPA 2ATLA 1WXDA 2K7ZA 1LFPA 2ILYA 3AOBA 1A8SA 4CZCA 3SIPB 3HO1A 2QUIA 2FHMA 1R00A 1BA2A 3UDEA 5EMMA 5KFVA 4FE3A 3V7YA 3KQOA 1OBOA 3L6RA 1S4MA 4WA8A 1L1EA 2G1HA 521PA 2C9BA 1YB7A 3BREA 1E9RA 4PIPA 5AVJA 3B5IA 2E4XA 5CVUA 1RWVB 4GBJA 2FX2A 4B45A 4UVHA 3NBQA 2IBKA 2H4ZA 2Q2WA 3S1SA 3QHAA 3SV4A 4TV9A 2NZWA 1Z47A 4KXWA 5A6SB 3T1VA 1OWXA 3E84A 3OCVA 4IDEA 1HG1A 4Q8FA 2O8FA 8AT1A 2JI6A 4YDRA 2RHSB 4GPEA 3PNLA 4WACA 3T8YA 4CF4A 3AJEA 5FFNA 3RRGA 2JF0A 2ADBA 1D1UA 1XQ9A 4K03A 2OD6A 3CCJS 3ZTWA 1BDJA 2JWNA 1GZSA 1K63A 8MHTA 1XEAA 2BGTA 1THGA 1JE1A 2ZUGA 3FUVA 5DYWA 3KVYA 3GQCA 1LZKA 5T6MA 1TKXA 1H9AA 4B9VA 1Y0BA 1L4NA 1CUYA 4X4UA 4B6EA 1YZ3A 3E82A 4ZIWA 4K05A 2XYPA 1U8CB 4OHCA 3FCVA 1ZSVA 4ZAZA 5GGXA 4X65F 4YX9A 3TAPA 2ZJ1A 3AINA 1U02A 4QAJA 3GVPA 1ZRNA 2CUNA 5HVGA 4YHBA 1R15A 2EI5A 1TQDA 1VGRA 4KFBA 4IWXA 3SDZA 3ZJYA 4LTDA 2BJWA 4U9HS 1JJFA 2PL9A 2O3DA 4P7TA 5JVDA 4M7PA 2PO5A 4X7PA 1TLFA 2I6SA 2MYFA 3H8JA 1RQPA 3HKCB 2DHSA 4E1VA 4EGLA 3FVVA 1VYVA 3ZDZB 1XEWX 2IOQA 4PX3A 3VCDA 2JHEA 3NBMA 3U48A 1XNRB 4WI1A 1EAMA 4LRCA 2CXHA 3RVKA 5KFGA 3FPSA 3AXSA 5H9FK 1PSWA 2IS6A 1BWRA 1Z6TA 3GLJA 4NRDA 2EYUA 3BMNA 4OU4A 4IGEA 2XGQA 1R5NA 4RWZA 1GXSA 5DZ7A 3TO8A 1F60B 1Y8CA 3BO2A 3IEUA 1CZLA 4EAQA 2A7QA 5IDYA 1P1TA 3AUYA 5HMZA 4KWIA 1CP3A 1RAFB 4HGOA 4I3HA 2YHUA 1EFRA 4WK3A 2WJ6A 5KQMA 4NTZA 5LMNJ 4XD7D 2E29A 3TJMA 3RBEA 2NO6A 2MMCA 2R2GA 3EQ8A 3RUAA 1U94A 2JLUA 1A4XA 1FDUA 2BE9B 3RSCA 5L40A 3B70A 2V69A 1S89A 1NK8A 4KPUA 4KGXB 2X41A 3E1KA 4YEDA 1QCZA 4BVGA 4OQDA 4ZOBA 4DV7B 2C2HA 3R5JB 1E3WA 3VPBA 1ENZA 3HKZD 1N33B 5L8RC 3U0VA 4NV1A 2VOJA 4QE3A 2DIVA 5FAXA 5AM0A 3PRBA 4G09A 1CNMA 1O95D 5AVRA 4XFDA 3PEHA 3BMCA 4LBIA 1ZIDA 4OJQA 2XJ4A 1C4XA 1TRKA 1K0UA 3HUEA 1K0VA 4Y9TA 1QK3A 4AQYJ 5HS6A 2WHPB 4D4HA 2B4QA 2LVBA 3TR6A 3UQZA 1Z4OA 3I0ZA 4RVCA 2VPYA 4Z9FA 5JSHA 1SOWA 2B2XA 3JSMB 1PDVA 5HIJA 5BQXA 1VQOS 2IIQA 2DO4A 2KL8A 1KVSA 1E1QA 5AO9A 4RADA 4JWKA 5U1PA 2D3O1 1PJRA 3V80A 5BWBA 5F8MA 2HY7A 2HADA 4F5WA 3NT2A 3G8DA 3OTWA 3OJCA 3Q11A 4HWOA 2XF2A 5LQCA 4ZFNA 2B7BB 1ECBA 2EKZA 4C6HA 2W6JA 1E9BA 1G21E 4TXHA 3BWEA 1N78A 3TANA 2JI9A 4EEYA 4NESA 3HFSA 4B6RA 2HYIC 4QOFA 4V0QA 4NHOA 4JC5A 3M49A 3MSCA 3M2RA 1U0EA 2C7RA 3KHUA 4K8RA 3GYXB 1B0UA 1YQGA 2J6HA 1RJEA 1HSOA 1KSPA 4HTFA 5ESWA 2X4DA 2NUAB 5F12A 5IM4F 5EP1A 2BJ3A 5ESXA 1HQDA 1EBBA 4OHWA 5ITSA 1HT2E 4GYYA 1T9CA 1R0BA 3THXB 4NF2A 3QWFA 4Y3CA 3RJ5A 3DVSX 3BR8A 4EG5A 3PA8A 2QLJA 2NUAA 3QYJA 3QH4A 3THWB 2QLBB 3AVWA 2CXSA 4Q02A 1BUXA 1ZH4A 3GEMA 1U1DA 1WVIA 3KALA 1DIAA 1KMHA 5I9IA 4MXDA 1X7YA 1UMCB 2YVUA 1C7EA 3ZZYA 1KY3A 1MA0A 2BFDB 1RTTA 1DBQA 2YJ5A 1ZEMA 3H2ZA 1WPQA 3BO4A 1SWVA 3IN5A 2GBFA 1CB0A 2XC9A 4FYVA 5JFTA 1J8YF 3SYRA 1JLLA 3M9XA 1XQXA 4FWBA 4Q44A 4B3CA 1RWNA 2MZQA 4I4IA 2O4CA 1N5SA 2NPOA 1JXVA 2E3JA 3SHVA 3ZTSA 4TLEA 4N49A 5IBQA 2UXBF 2BZ1A 1YR2A 2ODPA 3NTUA 1VG8A 1ECLA 1EXMA 3I1FA 2VRBA 5GMKa 2LCWA 4N41A 1WC4A 4RKQA 4ZVPB 5GVSA 2WFLA 1EWQA 3IB6A 4OFWA 1G21B 3GRVA 3GN1A 2G25A 1VLLA 3P9ZA 1G3MA 3D3QA 3DM5A 2PKYX 3OTOB 5K5MA 2DJ5A 4FMDB 4FOLA 2GD0A 1WNEA 1ENPA 3M9LA 2VDHA 2D0PB 4NCXA 1IUOA 1CEQA 2KPOA 2CQBA 3BHJA 2IODA 5KFAA 3NUGA 1B93A 1N3IA 4WKOA 2XQKA 3GVIA 3UFXB 3VYUB 4BWVA 3U3RA 3MEDA 3MGCA 1W0JD 4A8QA 4EAAA 1V9CA 3KTOA 3HA2A 3UKDA 1AXQA 5EUQB 4QYSA 1T34A 4UOCA 4NBSA 4TLDA 4FGUA 1O77A 1E8NA 1YE5A 1KR5A 9MHTA 1DQPA 1C3OB 1Z7EA 4F86A 5JSZA 5THQA 2M7SA 2N47A 3CRQA 4JL8A 4PIVA 4XSGA 3LWDA 1QHHB 4FZ5A 3N2EA 4TNOA 1EP4B 4Y1GA 2GRJA 5DCLA 1V43A 1XDUA 4DVGA 4I36A 4Z7QB 4ZC1A 5F7XA 3RS3A 2VA9A 4KMMA 1Q2XA 1PT5A 2G08A 2XDQA 2FQQB 2PFKA 1P74A 4C20A 5IM0A 4QGGA 1CUIA 3QWIA 5CRIA 1RABA 2HO5A 4YJFB 3ZX4A 1DLOA 4NU0A 2HK2A 2NG1A 1S6YA 4X94A 3T7SA 4V03A 3QLEA 3GLGA 1M1ZA 4RIIA 5T7LB 1BE6A 4OOEA 3NIBA 2IJNA 3A31A 1RGVA 2VPZB 4HX2A 2WUVA 4XWTA 3IB3A 4L3KA 1X5PA 2JLRA 2GMJA 2VPWA 5HLFB 5E4TA 1C9JA 3Q86A 3L0YA 1Q7TA 3QNWA 1AFIA 1Z0IA 4EVRA 4U7GA 2FPGA 3SWWA 4AO8A 3NTQA 2QENA 3EDMA 7YASA 1ABFA 1Q74A 3Q6MA 4LMZA 3W62A 2RRNA 2JFVA 3JZIA 2VOEA 4FCTA 5DDQC 3PJRA 3ESAA 4BPBA 2XVAA 2IS1A 6PFKA 4RESA 2ZB3A 5IDQA 2Y1KA 1UP6A 1EARA 4OXXA 2BOAA 3N75A 2ZRQA 2HM7A 3MYYA 4X6YA 4IYJA 3SV3A 3Q8YA 2HFSA 2N3OA 9ATCB 2N3ZA 3IPRA 5AK4A 3PB3A 5EKTA 4TYNA 1T9KA 2BM1A 2Y0CA 1QYXA 3SNHA 3O2QB 5DPMA 4LDNA 1G3OA 2A0KA 3GH3A 3W05A 5LZ4A 1PGJA 4LJ8A 1L5NA 2YV5A 3P0EA 4BMZA 5ENVA 3C6MA 3GIIA 3G79A 2BRKA 3S70A 2W2KA 3H9CA 4GICA 5TGZA 1HQCA 5IC5A 1FYDA 2PL1A 4YRRA 2H00A 3JARB 4EL0A 3X1XA 4TV9B 5D0EA 5JU6A 4D2IA 2FSPA 3OC6A 2A9KA 1N9KA 2ORWA 5GVQA 2TECE 4BUZA 4CQMA 3CT6A 2J5RA 1QQBA 5DN6D 1AS2A 1YS9A 1UC9A 1RJJA 1N0WA 3KCQA 1FD2A 1TK3A 2QX6A 4BVBA 2Z2ZA 4PVDA 3MOIA 2HK3A 3LGHA 3ICLA 3T7IA 4OQLA 3GR6A 4ZYXA 2BEUB 3N6LA 3QXXA 4KQWA 2D1RA 1WHSA 3UDVA 3ZI4A 3GT0A 3RC8A 2JAHA 3T9CA 3WO1A 4RZQA 3LKBA 2C2MB 4LR7A 3MJTA 1SCUB 1OE0A 4OFXA 2YKNA 2O6HA 2RKIB 4MHOA 1PGNA 3KFVA 5H9VA 4U5QA 1W36C 1D4AA 4OQJA 1OWLA 3FFXA 2J0EA 3P0HA 5JBIA 2BDTA 3KWFA 4FDAA 4JI5F 2DZDA 2QVZX 1SQEA 4XGKA 2IHVA 4ZDWA 4M7OA 4HDRB 1XIVA 1B00A 1RXWA 3C8UA 1PKXA 5IUNC 4ZYWA 3KDPA 3C45A 5JCOA 5A0FA 4Z3OA 3AD7C 3LQYA 5JAQA 1SFRA 2QLNA 3NLLA 1CUUA 2PNFA 3HCCA 3THWA 1E1CA 1M5HA 3JQDA 3W7BA 2AIRA 4N03A 3PYFA 4J4HA 3BDPA 1WJ9A 2CG8A 4HHHA 1DFHA 2VS1A 2X2EA 1QCYA 4P2MA 2YS6A 3R3JA 3ZV5A 5JRDS 3CPEA 3QIPB 2FLNA 1HZZC 1U2DC 3GFPA 2VTVA 2IX3A 5GZ6A 1CBUA 1Z83A 2WWYA 3G82A 4DX5A 3R0IA 1IUNA 2V58A 3OR2B 1T8RA 1NUHA 2QYSA 3ZWDA 1E3QA 3R8YA 1JWWA 4C7BA 1N6HA 2GEKA 4Y3UA 4S1VA 3CF2A 4LFCF 1BS1A 3UN2A 1O0BA 1Z2OX 3D31A 3ON5A 2G5PA 1ZOIA 4PYNA 4PC3A 4WPGA 1UEUA 5I5GA 1NBMA 1W4RA 3RRKA 1NK9A 3DLBA 2GZDA 5ISMA 1M2EA 3NEJA 1E0AA 3CNNA 4RVUA 3M1YA 4WOCA 3HPQA 3KYBA 3RYIA 2CZQA 2VT6A 3QMVA 1YHYA 4ZANA 4JUBA 4WNCA 4ANCA 4LDRA 1SCIA 2V94A 1Q7EA 3EIOA 5C52B 1FMLA 3DPIA 3HSSA 1N2EA 4UBJA 4X1YB 1BYIA 4V0SA 5JPCA 4LUBA 3I0SB 1NASA 3IHLA 4ESVA 3LQRA 3OZBA 1DBSA 4KAXA 2X1HA 3PI7A 3DV0B 2XMZA 3VAJA 3B9PA 4OQYA 1HNWB 1V1MB 1KAGA 2OO3A 4CQLB 1HRKA 5DCUA 1XMXA 2JA1A 5F8GA 3VUFA 3E9YA 2X1GA 1OZGA 3E2IA 3VNQA 2HH9A 4XQ0A 2P67A 2LDXA 3AUXA 4PQYA 1CQNA 3FKSA 2NO0A 2NQ2C 2I3ZA 1T13A 5CP8A 1Z4NA 2FPIA 4G1QA 2ZE7A 2PMCA 4X62J 3KYIB 3BYZA 1UXHA 2IGBA 1PYOA 1ZN9A 3FJYA 2AK2A 4WZAB 4UFPA 4WBFA 1EUYA 3MJRA 4OXNA 4JCCA 3L8FA 1ZNQO 2CNLB 4CHTA 1L3KA 2ZHOA 2CLIB 2WT4A 1U98A 1CIVA 2YY7A 4AJPA 3JQAB 5DOVA 3JB9k 4A0QA 4WKRA 2GHQA 2POCA 1IB6A 3OZVA 2NUUG 1Q95G 1WU8A 1M7HA 5L9AA 4FBGA 4JLKA 3P8ZA 2IX9A 1TUIA 3CMQA 1NJSA 3O4GA 1Q7CA 4U2GA 4ISBA 1NJXA 1Z2NX 4P54A 1U8YA 2L2QA 3FFWA 3PPXA 2ATIA 3TF5A 1SQ5A 2RB7A 4FLMA 1YMVA 3CDWA 1NI3A 3IQHX 5EWLA 3TUZC 2W4CA 3HABA 4BJ1A 2VTEA 4INZA 1QIFA 4LJAA 1HI9A 2BC9A 4AYXA 2KX7A 2BR4A 2C57A 1N1DA 1MX5A 3K2BA 4GOOD 2FG5A 3GSDA 4GYJA 3K7EA 2FN8A 1II8B 4MV0A 3U3XA 2WJVA 3GG1A 2CMDA 3GAAA 2ZBRA 1R9JA 4UC0A 4KMOA 5FEUA 3A6FA 2HBQB 4OX6A 3B8EA 4O2BB 7FD1A 2V65A 3BWCA 1LX6A 2UXCJ 4DMFA 3BC1A 4N6OA 1OLSA 4FI3C 1OX4B 1R3DA 1H6AA 4B6QA 3THYB 4PGHA 1ISGA 4DABA 1D2MA 5HVHA 3FPCA 4RV9A 3DMJA 5JI3E 4AF7A 4EBDA 3F47A 2QL6A 2XTNA 1UFWA 2I2AA 2CDRB 3WLRA 1IC6A 3WXMA 4IQMA 1I24A 4MDHA 4QWEA 3Q0IA 1FF9A 3OE5A 3AUAA 2PKCA 2OAUA 3AY6A 4O6VA 4GO5X 1XTZA 5A02A 3U17A 4WD3A 2VJPA 4GBMA 3A06A 4LZZA 3MECA 3ROQA 1B4DA 4FXOA 1U2SA 3UBTA 3HACA 2DTJA 2OKCA 1JGTA 3IDFA 5KX5F 1H2XA 3QWPA 4UAUA 1JHQA 2XJ9A 5EJ8A 1XERA 2RMLA 5JNUA 1Z6ZA 1MC5A 2PX8A 4BFCA 2WU8A 4DC9A 1APBA 3ZV4A 4EFNA 3C97A 3JSBA 2I8LA 1I01A 5ALFA 2H8KA 1ZVQA 2F9MA 1DARA 4ZP8A 3ETNA 1WLSA 1NVTA 4TT3A 2R6DA 8GPBA 2X13A 2F43A 5BYSA 1R18A 2GAFA 3KLVA 4JBHA 3O94A 4FHCA 1MRZA 3QBCA 2G2OA 3IOMA 1QOZA 4BFWA 2QL9A 2Z57A 2E9ZA 2IZ0A 1QE5A 2XT9A 3I34X 2IC5A 1R0CA 5IDVA 4U95A 3GCGA 2ONKA 5CA0F 3E01A 1RAGB 5C3MA 2HAEA 2X8JA 2Q6TA 2KXHA 3F7TA 5DTEA 4K6OA 1TFWA 2HBYA 3OR1B 5G0UA 5KFWA 2NOAA 1JJ4A 1F6TA 4ILKA 4YR9A 4B84A 5BSMA 3EJMA 4MEBA 3TVKA 3ISND 5C31A 4G8JA 1YRAA 3WA6A 3PDNA 3DMDA 3NGUA 1DXHA 5FOVA 4K59A 5K8PA 3BTUA 4LFAF 1LS1A 2OO5A 2O2SA 3K5HA 5DV9A 3N0XA 5J47A 1PT7A 1F14A 1JHZA 5IU6A 1N75A 1MVLA 3VR3A 2VNSA 2KXFA 2KI2A 2B5JA 1JNRB 1I7LA 3QBJA 2II6A 4ELTA 1N2CE 4NE9A 1OFHA 2QK4A 1EA5A 1YFJA 2QTWA 4CFYA 2QJRA 2WMNB 3PD0A 1G5QA 2AI3A 3PD1A 3RR8A 4CKEA 5I7VA 1U2FA 2IEIA 1E9AA 4HHEA 2AYEA 2GUWA 1NAIA 4K9RA 4D41A 2OTCA 3X1JA 3I58A 2G04A 4B4WA 3IIMA 2CV0A 5HMXA 2FMIA 5K05A 1KH1A 4FPXA 3X1ZA 3RRNA 4NYOA 2Z1MA 3GX1A 4H60A 3O8CA 1QCDA 3SEOA 3H0EA 3LQ1A 4IZOA 5CCMA 4EHIA 2X1LA 3P4XA 5LJ3Y 3SS9X 5JE8A 1IHOA 1EFPB 2O1WA 3OZFA 4OSEA 4N7TA 3CJTA 4FS8A 3VYSB 5H9WA 1J2EA 5KB3A 2WQZA 2OOSA 2Q9UA 3BH7A 3CH5A 1U3DA 4GI3A 1T6XA 3V2HA 2BRUA 3L0IB 2ACMA 4QECA 1JR3D 4AJIA 4LVOA 4M5GA 3C14C 4IRKA 3EZ2A 5AVKA 3WKAA 3T5BA 2ISQA 4XA8A 1VQ6S 3ABIA 4CLUA 3G87A 1CQMA 2MKYA 1ZN8A 1SZCA 1UPBA 3H05A 1NIPA 2JFWA 1XTVA 4ODIA 1NXWA 4NBWA 1DC4A 4GBED 4HVLA 1N4AA 1WTCA 2ZSJA 1H2UX 3EZFA 4AY2A 3HXKA 4B44A 5ADHA 3DFEA 1T1EA 2RHWA 5GM2A 4I1IA 4MRNA 3EXEA 1BWEA 4DCOA 4CDIA 1QYCA 4YCJA 2VQEJ 4BY9E 2AXNA 2ATCB 5I9BA 1HYEA 2OYSA 2Z2IA 2CWWA 3K72B 5DU2A 1EIWA 2LXFA 4IW3B 2CDQA 1C1XA 1VCNA 2AQHA 2OGWA 2OUKA 5KS2A 1Y1TA 2F55A 3ZFVA 4G89A 4EEKA 4ZVHA 1SKMA 4P82A 3I9V9 2Z58A 3AF0A 3E3OA 3QI7A 2R7KA 4MKZA 1JPVA 2C4TA 3QEOA 2WB1D 2IPOA 4NOKA 1TOAA 2RBEA 4M9CA 2K2QB 3KUGA 1IE3A 3LVBA 3G2HA 3FVRA 2BANA 3GCXA 2R79A 1V5EA 1GSAA 1PWEA 5A8RA 3U5TA 3W5UA 2VDLB 2QVYX 2ZM6J 3OCZA 5AI0A 1ULZA 3L6UA 3ZVMA 4OUDA 5EJIA 4DV7F 1EDEA 4DFMA 3COVA 5C8YA 4DLEA 4IRXA 3V7UA 4B33A 2PZGA 4HUJA 3C16A 4C98A 1T9WA 4D7AA 4K3VA 3TZZA 1XP5A 2CWKA 2FG6C 4CG2A 3TP2A 1Q0SA 3ZQ4A 1KY2A 4Y0VA 2B5WA 1P0FA 2VTDA 4WOJA 1UZDA 2W6ID 4UD6A 2JB9A 4R9NA 3CTMA 2C31A 2Q9CA 1C1XB 3MI7X 4J07A 2Z0MA 3AQ4A 4QYXA 5EXPA 3GMTA 1P73A 3OQJA 3W5ZA 5LP6F 1JH8A 2P9TA 4BZQA 5I7FA 6GPBA 1U04A 5C1DA 1AXGA 1O5JA 2J3DA 2C00A 1C1BB 4DPUA 4R2JA 2C3YA 2Z30B 1UMBA 2JFYA 2ACWA 4FC7A 4OATA 3WB0A 2JIRA 4LHYA 3JSRA 4I6GA 3KNGA 4NG5A 3NBFA 3K15A 2E9RX 4ND1A 4BIMA 2W42A 3OT5A 2P3SA 3DAFA 1U1CA 3VHLB 5DB4A 3BPSP 2VXBA 2I6TA 3F9CA 1UODA 1PAEX 2OQVA 821PA 3A9WA 4WE1A 3T3NA 4O3SA 3C6ZA 4MKBA 3FCWA 1U2QA 5JVDB 3HYCA 3V81A 1YTYA 4MAMA 4JU9A 2A5YB 3L49A 1GM5A 1G5FA 5KYGA 1VBXA 5IN4A 3TRJA 4PLCA 2F64A 2HLNA 2HFJA 5DP2A 2QVLA 4Z4CA 1GX5A 4U8YA 1LW2A 3K0AA 2XUPA 3V55A 1Z4QA 4DV6F 2ZUVA 2GKOA 5AT1A 2R4TA 2HZAA 2WOMA 2Q8NA 2DH8A 2YWFA 1NONA 4WU3A 3U3ZA 3VKVA 5K0FA 5AHOA 4MB0A 1XZDA 2JBAA 3RAFC 3E23A 2YNFA 4CT8A 3D3CJ 1OQ3A 1F2DA 5A5DA 3E9RA 4DY6A 2V54A 3ADDA 3T0FA 1YDHA 2XYGB 5JCXA 4C3ZA 2IELA 1EBFA 3MMNA 3ORRA 2PX5A 4PV7A 2WWRA 2HHPA 3IMGA 2BKAA 4IHJB 2FTRA 1K2WA 2V6BA 4URWR 3VKUA 3A1YG 4G6ZA 3IJ5A 1P5JA 2V7BA 3GNSA 4OFZA 4NCJA 2QA2A 2E5HA 1XO1A 4F4DA 3H2BA 3R5SA 2CQ3A 2JVJA 3T06B 3LU1A 3AW8A 2B99A 6FD1A 2GJFA 4PXCA 3O8RA 2E89A 4JCOA 4RJTA 4C0KA 2EGHA 3DMPA 4CV0A 3O5TB 2NVUA 3INNA 1SCJB 2Q1XA 2UUAB 2Q07A 3UICA 3EVZA 2IZZA 1WABA 3D81A 5K8OA 3MELA 3N5KA 4G0OA 2JLWA 2WE8A 1V8DA 4MINA 4UD2A 1LW0B 4A8KA 1R74A 4RZIA 1N33J 3R09A 3NL0A 4L2IB 3UK0A 1M72A 1NPTO 1VQ7S 4MCHA 3AOEA 1GKKA 1FDRA 3WG9A 1Q86T 1GUZA 1VJTA 4XAKA 3A0RB 1SU6A 2G72A 1XLTA 3SEFA 4AF6A 1Z5VA 3W7AA 3QF4A 4ZOQI 3OIDA 4X3OA 1YJUA 3DN9A 4IP0A 1S59A 3N2KA 3RFFA 2OLKA 2J3IA 2B98A 4ZPTR 4H1WA 4PINA 4K26A 2LIVA 4BNZA 1A1SA 2I76A 3TQHA 4GVPA 3QWUA 2Q41A 4LXTA 4QYIA 3QOYA 5LSAA 1T8EA 4CMEC 3UD5A 2YOGA 4IJVA 1TL1A 5SYAA 1SBRA 1F0YA 3B7PA 3F2IA 1ZHOA 4EZ6A 1YC2A 1DPFA 3M6IA 3I0RA 5TEVA 2IMOA 2BW0A 2BOPA 4MQ6A 1VQ1A 3DMGA 4IVPA 3R1LA 3ZGXA 1KZ1A 2ZT8A 1LFWA 4UPEA 1KH3A 1D1PA 1BHQ1 3GD7A 2EJVA 4LE0A 3CGIA 1ST3A 4G23A 4DRXB 2JEJA 2KMLA 1G2QA 1GL3A 5GOZA 4JXXA 4MJLA 3CJQA 1JDPA 5CYFA 3D0RA 3L07A 1E32A 2XCQA 3S8MA 3DOCA 1ISMA 4EHDA 2QTWB 1KHTA 3EE3A 1M10A 5K0NA 4IZ6A 2F8SA 3T4XA 2XF8A 2DE0X 3EW9A 3MS2A 2PIDA 4JP2A 1GTG1 2FJ0A 3CD0A 1B2LA 3B3FA 4YRZA 4F96A 4BE4A 1P77A 3MWLA 4R0NA 1Z4UA 1P6XA 2DAPA 2Z56B 2JBAB 1FEEA 3VC2A 4WCFC 1JEYA 4NHEA 3PY8A 2XIJA 5KX5A 3OJEA 2L0XA 1QYDA 2E18A 2ZQYA 1ZPWX 3NM4A 2XMAA 3D8TA 2NYAA 4FUQA 5DZSA 4J76A 5FLXA 1WOPA 3QP9A 3NOCA 3KAQA 3W3SA 3CCQS 4CMJA 5IH3A 2DPXA 2VG7B 5LUAA 4OJ3A 5AXMA 3RSGA 2DM6A 2JRSA 2C9OA 2YICA 3CVVA 4DBLC 1WXHA 1DJNA 4MV3A 2VRCA 3BWMA 1W2WB 4BRSA 1O94C 1XVUA 2DGVA 3LOQA 2DR2A 2N0SA 1C7FA 1CJUB 4ZOLB 4RWXA 3K1ZA 5LM3A 4U7PB 5FB3A 4NLTA 2WC1A 3O8BA 4NJMA 3LSYA 1F06A 1PT9A 2QB5A 3MYRA 5J23A 1V16A 3MD0A 4CH7A 2IWRA 4FWTA 5LB2A 1IXSB 3QRWA 1WE2A 1WD6A 1TAGA 5IF3A 4LGYA 3VSDA 5ALGA 5C8ZA 2XM3A 5AI9A 5AE1A 5LZ2A 1UVLA 3HN2A 4URGA 2X1FA 2PUBA 4EO7A 4DQ0A 1UXGA 3L7OA 1C0PA 3L5KA 2XCOA 2QORA 4L28A 3W2GA 2QM3A 3I32A 2HAIA 3COYA 1L7VC 2OV6A 2Q4TA 4L5JA 1M0EA 1V3QE 2H06A 2P11A 2DH6A 5JNVA 1NNI1 2P9GA 3MAAA 4EYOA 3K2IA 3LP1A 4YP7A 4CO4A 1DQRA 1FUYB 4BNJA 1WEZA 4RGBA 3CD6S 3HDSA 4F2SA 3D5TA 5JCJD 1YZYA 3P2OA 3FVYA 3TZKA 4DS5A 1QJHA 4MUFA 3T54A 1LS6A 1QVZA 4YN3B 3KLGB 2N46A 1OT3A 3JSMA 4DCTA 3VC3A 2WWFA 2X23A 3B6ZA 1EMDA 2V5HG 1GPYA 5AQ1A 1Q20A 3H25A 1M2FA 2QPOA 2I2WA 2VHJA 2FMHA 4NYPA 5EP4A 1TEZA 3CE6A 3P2YA 2JGDA 4Z1OA 4H1TA 1JB1A 1DXQA 1EINA 4KYUA 1J09A 4UOGA 4H7FA 2Q3BA 1MVOA 5AUOB 3BSSA 3EQ9A 5BY2A 5JD5A 1ULUA 2HGSA 2IYAA 1T3GA 4JC8A 2YTZA 3PEWA 1RYSA 4ZQGA 5IWCA 4M7RA 4E2FA 4US2R 5IJWA 5JXSA 4Y6PA 2XKBA 2COLA 3CVYA 2IT1A 3TE6A 4X54A 3AUTA 4C6SA 2C7GA 2REOA 5SYNA 2HBZB 1NVBA 3MRVA 2V7PA 3RC7A 2P65A 1BE4A 2K2PA 1JSXA 2R84A 5FA8A 2FWPA 3CUSA 3V1YA 2ZTUA 4YCCA 4OKNA 1EVZA 2E1MC 3ZZRA 2FZGA 4U6SA 2EHDA 4QVGA 1IOZA 3ZWPA 4FBLA 4RFSA 5TLSA 2C95A 2OCLA 2VCEA 4OHPA 4M0KA 1ZXXA 3DMTA 1Y4SA 2R2SA 2GV1A 1X6VA 5HJ2A 4JJIA 3EYAA 3WWOA 3S7ZA 1FRLA 4CEJB 4C3UA 3RUCA 1IDN1 4W8HA 3PQ2A 4FFWA 5KKCA 3UJBA 1WORA 2RQKA 4ETNA 1UJNA 4HZUA 4DA8A 2R11A 1B73A 4CLDA 2A92A 1Z2DA 2AP6A 3G88A 1QKKA 2YJGA 2FK7A 4PFKA 4G5XA 3WAKA 5DH9A 1CE8B 7REQB 1UBGA 3GCWA 3TB6A 1NXOA 4F6RB 1FVXA 2MKJA 4JUFA 1GCOA 4UXIA 5BXQC 2HMWA 2QAGC 4KKOB 5H8WA 4LVUA 4F6RA 1V2HE 4C4XA 1NBEB 4AP5A 4ZVGA 1MFPA 3M30B 5E38A 5L3SB 3J7ZT 2FRDC 5BWOA 2V8OA 1VQ8S 4HKTA 1Q5PA 2R751 1R6UA 4U7FA 1OA0A 3FYUA 3QKSA 3NHAA 5CLJA 1MNAA 1PX0A 5KSWB 1RMQA 2J87A 3IKTA 3Q7EA 3SXUA 4FFLA 3M32A 3CUYA 2DTXA 4CCYA 1M5VC 1YJ5A 2J0QD 1NXXA 1W88A 4EO6A 1P4AA 4GDMA 1P7VA 1F8UA 1G42A 1HYBA 5DM4A 1E1CB 3AKYA 1QK5A 5KMGA 5C25A 1YVDA 3Q2SC 3NR2A 3W9HA 5FOXA 3QG5A 2MZTA 1ZR4A 1UPCA 1KSGA 5A4KA 3DTTA 4JENA 3T1NA 2BP7A 1X7DA 1G4AE 1G20A 1KYVA 2Q1WA 1VB3A 2V59A 4KKVA 4N5IX 3OOEA 4CTKA 3OXGA 4U2CA 5G0RA 1LDYA 1JDUA 2DHCA 3ROGA 2C8JA 4IMPA 1TZKA 4DJJA 2GQ2A 1UJ2A 1Y89A 1F9AA 4NE7A 5CD1A 3P2KA 4N9WA 4NYJR 5KT7A 2DLNA 3CLRC 3TW8A 1S5ZA 1FNCA 5J2QA 2A3NA 2X8JB 3ESBA 4L6IA 4NAUA 4DA9A 1I32A 5TPZD 3PX6A 2WSSA 4Y8VA 3R23A 1NM5A 4IEFB 3CRVA 1WHSB 1C1DA 4EHJA 2O5DA 4PSKA 2E4VA 4BP3A 3MEEB 1UBTS 4AXXA 3LP6A 4FHEA 5FF9A 4ASUD 4WFZA 1I3OB 1C5KA 1H38A 5HIKA 1N5DA 1IPHA 1EIYB 3FYSA 5DI3A 4UBNA 1VCTA 1V5WA 3Q8VA 2HHWA 4FBMA 4DCMA 4IKAA 3F4KA 1E8DA 1SBIA 1ISHA 2X3DA 3QLHB 2OELA 3D0IE 4TYPA 3RSQA 3O3CA 4LX8A 1X8XA 4L50A 4PWWA 4OHOA 3ZQ6A 3A9TA 1OREA 2EKDA 1NVVR 1QMPA 1VMBA 4RXMA 5EHGA 1QP7A 2PWAA 1S2GA 3QOWA 3NHZA 2C03A 3NVKI 3E18A 2QT1A 1R1DA 3HL0A 3CCUS 5GP1A 4HI0E 2KYRA 3R3VA 2AF3C 2Q49A 4M49A 4BO8A 1CRLA 4ENUA 3CLUC 1RWKB 1TK9A 2C4WA 5ALUA 2ZUEA 1NUTA 5IT9A 4OLAA 3LVQE 4L15A 4KXVA 2ZULA 2A6OA 2UXCF 1QIDA 5EJ5A 1JDSA 3GO4A 1OU0A 1J7KA 1V16B 5TMEA 3ZKAA 1WC3A 1YSJA 3J81Y 1UVMA 4O63O 2A9VA 3TA1A 5IF9A 3NDIA 4E46A 3DPSA 1MXFA 2G4CA 2LQ9A 2FHJA 1UVJA 2WD8A 1XNRF 1KI4A 3RU3A 2FMTA 4Q3CA 3U6KA 2M0GB 5GONA 2BFNA 4P4LA 5EIXA 4II2A 1CUJA 3GLGE 5KOHA 1G18A 2IFTA 1QM9A 3DDIA 1HOXA 3DBHA 1PG0A 4DM4A 2UYGA 1IBLJ 2Q6CA 2ZFHA 1G8JA 2Y1OA 1SUEA 3S2GA 5B4VA 2ZJAA 1PJ5A 4GX2A 1LSUA 1JXAA 1PEKE 3WQPA 1T1GA 3O2SB 2RHMA 4I5IA 1H1TA 3O83A 3S3TA 4PSCA 3UAWA 4KB5A 3NXZA 2BF7A 1GUAA 1YRWA 3COSA 1GG2A 4ZT5A 5FBRB 5HQJA 2AN1A 4AP9A 1TDJA 4NMHA 1BXRA 3K94A 1KMHB 4AKGA 4YJKA 3NCRA 4F5YA 2A0FB 2FZCA 1FYEA 2QMZA 1E1YA 5LKAA 3USES 2WU4A 2YFYA 5A7GA 3LVFO 4DV3J 1MJGA 1N0HA 4QJVA 2QN1A 3UGKA 4FYYB 1OFUA 2JDIA 3NHJA 1TQLA 4NJEA 1UM9B 1AQUA 3DCIA 3KS9A 1TL5A 4IDCA 3O38A 4TWRA 3RGGA 5A62A 3LDGA 3CWQA 2KLHA 3OURA 4ND2A 1Z7GA 2QPLA 2ZJ6A 2EP8A 1CCWA 2VA8A 2C7PA 3VSEA 4AMYA 2VJLA 1J0DA 1JJ2R 2E4ZA 4M1SA 4KH1A 4ARZB 4BDTA 3C4VA 4FNMA 3ICEA 1YBVA 5EXTA 4YIHA 5HIIA 3V8NA 4DBLE 2AJTA 2MQOA 5ALXA 5DO2A 1WW2A 2RJZA 2HBQA 4MPTA 1ILWA 4BNHA 3TKAA 3M9MB 3ZCTA 4Z99A 1U2DA 1V8PA 4DIMA 2PUVA 2RI1A 4OHRA 4CNBA 4FYKA 1KO4A 1BWSA 4NLUA 1TA9A 3A3OB 2R0QC 5EWLB 4IQFA 2O06A 3DZJA 5FJ4A 3HZHA 1Q16A 3CFYA 3LS2A 3MMZA 2HCRA 2M9KA 3WYAA 4BLRA 1FNBA 1E1DA 3QKRA 4C9DA 3SS8A 3DOFA 2CPXA 3QYFA 5CAAA 3TOZA 5C7LO 1BWPA 2HPZA 4ZPJA 2QRJA 2XNKA 2J0UB 3IPCA 4Y2GA 3D3NA 2SKEA 4L75A 1T8UA 4CL0A 3HTXA 3NCHA 2H07A 5DFAA 1IULA 4ENVA 1A0OA 4OZ2A 1RLTA 1FFGB 1W4LA 2Y68A 5CH5A 1AF7A 1G7RA 1XTIA 1XRRA 1E2PA 5G3YA 1GEHA 1TKDA 3RUEA 2D7JA 1N7GA 4GKBA 2OV4A 5TJHA 4HDSB 5TF4A 4YN3A 4Q18A 3WZMA 4LFCB 3B12A 1MG0A 1IZYA 1E2LA 4WNIA 2I7DA 1N25A 3E15A 3MUNA 1IIBA 4YRFA 3T4UA 1TM3E 3MAQA 4J9MA 4DJTA 3VNBA 2J85A 3PKJA 1QONA 3KYDB 2HJVA 2CFTA 4DCVA 3KEMA 5LOVB 2YZNA 2HHSA 1IBCA 1SULA 4X93A 4M21A 2FHSA 3QF7A 5BMOA 1A8UA 4HR7A 5BV1A 1AZSB 3VF0B 5CDYA 4GE3A 3KLIA 2HYIB 3FJ1A 4DPTA 4DDWA 3HP7A 4PQUB 4BCDA 4FQ7A 3NHYA 1N4LA 3KDAA 3EGOA 3ZD6A 2RS8A 1QOQB 4AP6A 4YY3F 1Z4KA 1GPLA 4I2PB 3HVRA 3DHYA 4JJ6A 4COKA 1FC0A 2XSJA 3PFHA 5I3QA 1HETA 4YHHF 2OILA 3OT9A 3DNCA 1UDWA 2FP3A 3IWXA 3MTAA 4RTMA 1HW8A 3S6EA 4WIQA 3W66A 4LNUB 4KO8A 1W4AA 1X19A 4RHEA 2AG5A 3A3PB 4J75A 3OTCA 4P2XA 1LLCA 4DF4A 4ZV9A 1XZLA 4OJMX 4XPZA 4Q4HA 3K0BA 5IHPA 2RH8A 1MNEA 1NX9A 2FMUA 2OZLB 3CT4A 3OFJA 2DCUB 2JJ1D 4S1WA 3UOAB 1P9WA 5EGSA 1KIFA 4E98A 5AXAA 1PSDA 3WY9A 1ZA1B 2E4UA 2L9DA 4JV0A 1KSFX 5A3JA 2C5AA 4DN0A 1EX7A 1R0LA 3ZG6A 3MZ0A 1ACLA 2HCJB 3OZTA 2ZRLA 3ITHB 4MKXA 1MC1A 1GFZA 3EGEA 5H9EK 4YT5A 1O9HA 4JN6B 2VONA 2ZWAA 1GSHA 5ESRA 1B1AA 2LNDA 1J5EB 3BOSA 5KOIA 5JAZA 3U7GA 2VK1A 2WBMA 3TZQA 4N5NA 3PDHA 1ADBA 3QA9A 4Q7QA 5ILQA 5CYQB 1C7ZA 2HJRA 2PYZA 1DSSG 3VAMA 4URXR 2DNKA 3W5SA 2FXVA 3IPYA 1RCTE 5IRCD 1QTNB 4M1KA 1QGYA 2E21A 5AW9A 2TS1A 2XECA 2MDAA 3LWMA 4I8IA 5FLXY 4QPXA 1NE2A 3DOKB 2ZH5A 2A9OA 2PKQP 3L93A 3NTRA 2CG4A 2HWKA 4BJ6A 3PHIA 5FBHA 3KR9A 4D82A 2YQZA 1G6KA 3ZWOA 2WUFA 3U6BA 3L4BC 3SR4A 4DSKA 4N3CA 2RK4A 2XSZD 2VL1A 4F9TA 1T8YA 3I5CA 3FLMA 3V5NA 3FWNA 1KPIA 4B6SA 1DV1A 2I6FA 1DAPA 1K98A 2DGTA 5EWMA 3SHQA 3FUCA 3GFZA 4OY3A 5AH0A 2J0SA 4JI6J 1TKRA 3I04M</