2E1PA

Crystal structure of pro-tk-subtilisin
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Crystal structure of unautoprocessed precursor of subtilisin from a hyperthermophilic archaeon: evidence for Ca2+-induced folding
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 131
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2e1pA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2e1pA02
1PEKE 1SVNA 3DVSX 2SICE 5JXGA 5FAXA 1EA7A 1GT91 1IC6A 4YN3A 1NDQA 1TM1E 4DJ5X 4DZTA 4NE9C 4BWGA 1AK9A 5FBZA 4YN3B 3SQOP 1SUCA 1Q5PA 2Z2XA 1TM5E 3BGOS 1PFGA 3DWEX 3D43A 1T1EA 2Z56B 1BFUA 2Z30B 3T41A 4OMDA 3TI7A 2DP4E 2IXTA 4JP8A 4HX2A 4OMCA 1ST3A 2Z2ZA 3I34X 1BJRE 4NMXA 1WMDA 3SQOA 5B1DA 2WV7A 3P5BP 5I9SA 1DBIA 1IAVA 1SUDA 3A3PA 4NMXB 3TI9A 3CNQP 4I0WB 3DE7X 2B6NA 1SBNE 1Y9ZA 2DUJA 1SBCA 3AJ8A 1CNMA 1HT3A 1T1GA 3D9QX 2ZRQA 1OYOA 1AVTA 1SUBA 2WWTA 5ARDA 2W2MP 1Y1KE 3DW1X 3DVRX 1A2QA 3P5BA 1TO1E 1SIOA 1BE8A 2Z57A 4AKTA 2HPZA 3WIVA 1SIBE 4KPGA 4NE9A 1AF4A 3H42A 4OV6A 2W2MA 4FONA 3VV3A 1XF1A 3DE5X 1C9JA 2WUWE 1P8JA 3H42B 2PWAA 1GA4A 1SCDA 1C3LA 5ARBA 3LPAA 1SUAA 2G4VA 2ST1A 3CNQS 1SBTA 3ZXXA 3VSBA 5AMXA 1YJBA 4ZARA 4J94A 3I30X 1PTKA 1KDYA 3A3OA 1SPBS 3GT4A 4C3UA 2P4EA 3WQBA 3TECE 1NLUA 2Z2YA 1KE1A 1AH2A 3QTLA 1OT5A 1UBNA 3ZXYA 2SNIE 3A3OB 1SCNE 2ID8A 3OSZA 2Z2YB 2Z56A 2Z30A 3SICE 1GCIA 1Y34E 4RYDA 1V6CA 1GTJ1 1NDUA 3PTLA 1KE2A 1SCAA 2Z58A 3F49S 4Z2AA 2E1PA 1MPTA 1V5IA 1WMEA 1R6VA 3LPCA 1GNSA 5K7SA 5JXHA 5SICE 1Y3CE 2Z58B 2IY9A 1DUIA 1WMFA 5JXIA 1V5IB 2GKOA 1KDVA 3F7OA 1AQNA 4C3VA 1WSDA 1SBHA 1BE6A 2QTWB 3Q40A 2TECE 4H6VA 3GCWP 4DWWA 3WHIA 1P7WA 1S2NA 3CO0P 1EGQA 1R64A 3VV2B 1S02A 1CSEE 1GA6A 1Y48E 1BFKA 5AVKA 2W2QA 1GA1A 4NE7A 1PJ8A 5FFNA 5B1EA 1SCBA 2ZWOA 1Y4DE 3VHQA 3VYVA 1TO2E 1ZVKA 4CFYA 1MEEA 3F7MA 3GCXP 2PMWA 3GCWA 1TM3E 5JXJA 3BGOP 1C9NA 3I37X 4GI3A 2PMWB 2V8BA 1BH6A 3EDYA 3BPSP 1C9MA 1AV7A 1YJAA 3AJ9A 3PRKE 4KG7A 1Y3DE 3GCXA 1SIUA 3DE6X 3CO0S 3UNXA 1AU9A 4KB5A 2ID4A 1R0RE 3AFGA 1Y3FE 1WVMA 1Y33E 1SELA 2SECE 1SBIA 4ZOQI 3BPSA 2W2OP 3DE1X 3DE4X 1T1IA 1YU6A 1ST2A 1Y4AE 1TMGE 3DW3X 2XRMA 1GTL1 2HD4A 1Y3BE 3BX1A 3DVQX 3DE3X 5AVJA 5JMOA 3Q5GA 2XTJP 2PWBA 4B5LA 2QTWA 3LXUX 2W2OA 2W2QP 4LVOA 2PRKA 3VTAA 3QFHA 2SBTA 2PYZA 3EE6A 1S01A 2DQKA 4MZDA 3VV2A 2PQ2A 4K8RA 1SH7A 1SUEA 1TK2A 1ZVJA 1SUPA 3GT3A 2XTJA 1KDZA 2W2NP 3EIFA 1GNVA 1JEAA 4AKSA 4K8RB 3I2YX 1SN7A 1VSBA 3LPDA 1SCJA 1YJCA 3A3PB 1P7VA 1SPBP 5AQEA 4H6XA 4H6WA 3QMPA 5CW1A 3DE2X 1SCJB 1OYVA 4M1ZA 1TM4E 2WUVA 2W2PP 2W2NA 5ARCA 2X8JA 1THMA 4WOBA 2ZWPA 2PKCA 3A3NA 3DDZX 2Z57B 1TM7E 4CFZA 2X8JB 4CG0A 3WIUA 1TECE 3A3NB 4OV6B 2W2PA 1LW6E 1GTG1 4LVNA 3HJRA 3DE0X 4HVLA 4WOCA 3DYBA 1ITPA 3L1KA
chains in the Genus database with same CATH superfamily
3DPUA 3K0CC 2XMAA 3TVYA 1OIXA 5C2JB 4PONA 4DILA 5KREA 2DRAA 2WHQA 1Q15A 9ATCA 1CLEA 5FBZA 1Q22A 3HO1A 4D5GA 3VU3A 4EEXA 1PILA 4BS2A 4L50A 5DHAA 1U2GC 4KR0A 2KM1A 1BFUA 2AEEA 2CHEA 4TVKA 2PI5A 4EMDA 2HHUA 2UZ0A 2CZ9A 3AM1A 1FQJA 4TQ9A 1ZS9A 1CJMA 2WTAA 3AQIA 5D1NA 5BNIA 1U0FA 1WF3A 1SOAA 1M7GA 1Y80A 1IR1A 2A84A 2FQWA 5KFCA 1SUDA 3MJTA 1JF8A 3CNQP 3KD3A 4F21A 5C42B 1H3NA 4O0LA 3X1MA 4MW0A 2EQ5A 3G8SA 1YBVA 2Q3FA 1K8YB 2ZH2A 2GVZB 1CEEA 4HNUA 1ZN8A 2PKEA 3L1IA 4FMPA 3A6EA 1ZOOA 1B1CA 4OL9A 4CVNA 2DR3A 2GN0A 2JFXA 3PTWA 1IG3A 5ITWA 3H3XA 1DAHA 1G8MA 1XD8A 4R3UC 1DFIA 1P3JA 3JD0A 2IYYA 3ZU2A 3VAFA 5FJ4A 1Q1QA 3CTRA 3LOUA 4U2CA 5DCLA 4RWEA 1T4MA 3IR7A 1HBMA 3V2UA 2RMLA 2WUWE 1BDBA 4O4LB 3UATA 1SUAA 4CO1A 3MM6B 3PGXA 3EPKA 1G4UR 2WWIA 3KFXA 3HCDA 1BEEA 5JWRA 4M53A 3U4HA 3TG8A 4P7BA 4KRYA 3A14A 2XF8A 2PJRA 1RCXB 1PJBA 3MTAA 2KI2A 3M9MB 4FYKA 3SC2A 3IBYA 1I2DA 1B74A 3ZPXA 4JB0A 2PUDA 2PRIA 3VDNB 1FDWA 1KGSA 5I9IA 2XV1A 1BROA 4A8QA 3AH6A 4O0NA 5EGYA 3IB3A 4B3FX 2B4UA 3I12A 5BQPA 5DJBA 3UDVA 1ISJA 4ESHA 5ITHA 3GDOA 3ETCA 4F04A 5JVHQ 4ZGGA 3HEBA 2VG6B 3D3EA 1KS2A 3LCRA 3CJSA 5D4NA 3MMXA 2BJWA 3QG1A 2Y0DA 3ICQB 3C7DB 2OL4A 1FE4A 1YJTA 3JQ7B 2R6ZA 1LUAA 4CKCA 3GVPA 2BZ0A 4MJLA 8GPBA 1JG6A 1P81A 3WICA 3CO0P 3LBNA 3T7CA 3FBEA 4PICA 4PSCA 4B32A 1YE3A 2UV8A 1OREA 1R9NA 2Q46A 5DM1A 1CY6A 3BVPA 1NXOA 1KFKB 3K89A 1H4QA 2A9PA 2Q5IA 5HVNA 2D69A 1UEXC 1IPEA 3KG4A 1S10A 1EK2A 3CWJA 1GYPA 3H6GA 1KYYA 4KH0A 4YT8A 3E0XA 2ZI4A 3CJ5A 3E18A 4YX9A 2P6MA 2W8ZA 2E87A 3LBAA 1LU9A 2N46A 4EPWA 2IM2A 3TA1A 3C15B 4EA6A 4X71A 4NYZA 1RHUB 2O3DA 2P9QA 3SJ7A 1Z38A 3D3KA 3SZLA 3PUIA 1EDBA 4L4YA 1HNXB 3MM5A 2VF5X 1Q19A 2I7VA 5KO2A 2YTCA 2IW3A 2HRDA 1NRJB 3DKDA 2FJ0A 4FJ1A 4BY9E 1GTEA 4LFBJ 1M8JA 3KJHA 3KWMA 5DG8A 1RUSA 1G7CA 1TEHA 3I73A 2XRMA 3HM2A 4ND1A 2Z6QA 4F9GA 4WINA 3U80A 5DNDA 1FFHA 4D3SA 2G77B 2ZDOA 1YI8A 3FFIB 3UMYA 2H7XA 1QZXA 2QOEA 4TTAA 2C9CA 3JRWA 3OP1A 2FJXA 1NT2A 1K6XA 1OXKB 1WJGA 4L8WB 3EGDB 1AV6A 5THXA 2VTVA 3PGMA 4MVJA 2P1ZA 1FE0A 1OBCA 1IQUA 4ESVA 3FX2A 1WZUA 5MFPA 4CIDA 1D6JA 1QYDA 4KWHA 1ZNYA 1SHJA 5TF0A 3M6WA 1V96A 3OL6A 1Z0FA 2AI3A 1RYDA 3NO4A 4PQEA 5AHKA 5HZHA 3R0IA 2CJXA 3DFEA 3ZZYA 5IQ6A 3HVTA 4IGAA 4QARA 4UHJA 2B8PA 1LRJA 1M2KA 3G96A 2PKCA 1PG0A 3FDZB 4HGQA 1YIOA 2UXBJ 1HI0P 3BKXA 5JHHB 1XMQJ 3KTOA 2HK9A 2DPJA 4ZC1A 2DUWA 2Q4RA 2QN9A 1BMDA 4MDFA 3IQXA 4LRFA 4BDPA 3M82A 4DEVA 1R6YA 1HD1A 3HYTA 3B3FA 1SCKA 3I4FA 3ZGZA 3DZFA 1BMFA 1XJWA 2AFHE 5AUNB 1UJBA 4AURA 1MB2A 3KSUA 5TX7A 1DLIA 1Y8AA 2VP4A 4V03A 3NTLA 4OI6A 1L5UA 1NNSA 1U5AA 1QFZA 2HGZA 3FRJA 2C92A 3FG9A 2DVMA 2BUAA 2X9LA 1U4NA 1Q0PA 1HE5A 4J90A 3BGSA 5E7QA 4FF3A 1JEQB 5H0IA 4QW8A 4TM7A 2FHOB 4AZ0B 1OPZA 5CMLA 2Y1IA 3QPUA 3PJDA 3W9YA 3CLSD 5KC8A 2Y77A 4S04A 1ZD3A 3R5JB 1KR2A 1AGYA 2FK8A 3PACA 5JSQA 1E61A 5L7TA 4XQGA 1CQMA 1SUBA 3OZFA 5CLGA 2VICA 1IM2A 1NF2A 3K31A 1RT2A 3N75A 3AF2A 4AJHA 2ZB4A 4PWYA 4ZPWR 1WG5A 3WC0A 4E70A 1WG4A 1DZ5A 5K99A 3QAUA 2E85A 2YY5A 1M1YA 2WSMA 1CFJA 1Y6FA 1W0KD 3MIIA 4B76A 1SCDA 2G4VA 2FHKA 3FWHA 4J7AA 3GX1A 1YQQA 4HDNA 1A1SA 3CZAA 1D1QA 1V6SA 1X7ZA 2R6R1 4PLZA 2OFWA 1ZA2A 1NURA 1QP7A 2IEYA 2XCIA 3HU5A 4BNYA 1WB9A 1I3OB 3A6KA 5A4IS 1NSYA 3TMKA 3C3YA 1J0AA 2ZSDA 4LG1A 2ZUSA 1U6KA 4ZI3A 3L0OA 2D5CA 4D0GA 3OIYA 4C7QA 1QRAA 5KFAA 2MU1A 3SZUA 2IY8A 3D31A 1RW4A 1FS5A 1XZCA 4GW3A 4PG4A 5KYKA 2NTEA 1YULA 5DB4A 3LO5A 3M70A 5IFMA 3ECAA 1ISHA 3Q2OA 2OHHA 1U98A 1PYGA 2ON6A 2GIQA 3VGVA 1DFDA 4Y6GB 3G9ZA 3U3ZA 5GMEA 4R7ZA 2V2VA 1WVGA 4Q19A 5HXAA 3RS0A 3PXXA 4XUDA 2VJCA 4IH6A 3E7WA 3DOIA 1CJUC 2K5UA 1T8PA 1DZIA 4I4TA 5HEKA 5DGBA 3A6PC 1SOWA 4MW2A 5A8KB 3INNA 1Q16B 3ILXA 3C7KA 2LCQA 4XASA 5EWFA 2BMFA 5IVKA 1N36B 2R7QA 3VGSA 4W7SA 4WVFA 3UGTA 1RFGE 3ZCUA 1YJVA 4WXPA 1GRVA 2EHDA 2QYCA 4C0LA 6GPBA 1ZXBA 4GI3A 4KPUB 4DSAA 5E6UA 1DWUA 3G0GA 6Q21A 1LDYA 2C5EA 3FUVA 5KVCA 1CF4A 1YFKA 1N3BA 1QVZA 2JD2A 5IQQA 4RKWA 5HF6A 2NO4A 5FORA 3DE6X 3S7ZA 2BZ1A 4UOQA 3ZI4A 1N6LA 3A36A 1RT5A 5EIBD 4Y2RA 1G291 4X65J 2VOJA 2Q50A 4PPFA 4KV9A 4X4QA 3DH0A 2RAFA 2IY5B 3PX4A 2QYGA 4PHGA 1VE1A 2CJ9A 1SUIA 4TY8B 4J0FA 4HMQA 4B48A 4V2UA 1H2EA 2JI8A 2DGTA 4GPBA 2KS6A 4NQRA 3FNNA 4RVGA 4K28A 1QE1B 1ORDA 4IX1A 1EFAA 1GPWB 1AQUA 1IWPB 1JLFB 4R6XA 1W96A 4DB4A 5FA6A 2C28A 4MW5A 1UJCA 5MAOA 3RGIA 3H9UA 3HKZD 3MINB 3G2MA 3AEYA 3A10A 4IIJA 3AIOA 5AQEA 1IH8A 3TQTA 4LF8F 3RNOA 3FLMA 1CUBA 1QV9A 1EFRD 5TT1A 2OM2A 3CGIA 2GILA 3HCBA 2GO1A 4FEYA 2GXSA 2FG6C 3CBGA 1RC1A 4HH0A 3IXQA 5D3QA 1T10A 3A3KA 4I46A 2EQBA 1Y63A 2WP0A 2POCA 1F5AA 1LY1A 4FUTA 4GX1A 3EY9A 1JKMA 1UJ2A 1Y1SA 1TV6B 5JBNA 1JQ3A 1Q21A 2ACWA 3FVTA 4TZ6A 2WMDA 3VAIA 4QREA 1GXUA 2YVUA 3N0VA 5L6LB 3D02A 3B6JA 2AOUB 5A4MS 3J7Z5 5JSYA 1J0XO 2G06A 5U1PA 4OHUA 3VVLA 3IEMA 1QGOA 2F9FA 3DDHA 5CFZA 1YR7A 4G85A 2LKCA 3CLTC 2Q3JA 1RJJA 5IAEA 1F14A 2LLZA 4O4GB 1O5IA 4JQYA 5L3SB 2HBRA 4BC9A 3CJ2A 2B3DA 2HLPA 2CKDA 1G16A 4Y2KA 3D8BA 1B23P 1UEVA 3M1YA 3BV8A 2HFNA 3F3SA 3S1AB 4MCHA 4Q4HA 3QMQA 4DARA 3WLMA 3CB4A 3I56S 4Q0BB 1AVTA 5H9EJ 2CFRA 4R1OA 2J0QD 5EMLA 2JVIA 4N7MA 2AD9A 5TGTA 4TXSA 1VQSA 2DPMA 1HXHA 2PA8D 2WU0A 3RIHA 4K2HA 3ILLA 1UBEA 3AILA 5KFOA 1S8FA 2OHIA 5C24A 1SQ6A 4L15A 4AMYA 1Q1AA 2BBSA 3VZIA 4PLYA 2HBYB 5HF9A 4AP6A 1HRKA 3OPXA 2KN4A 4YJ2A 5EWMB 3L7PA 3F5FA 4NLUA 1GT8A 2H4XA 4B87A 3E9DA 3WK6A 1LWCB 4Z0PA 1P2UA 4KDCA 1T5LA 4EEZA 2I2DA 4BTVA 4YO7A 2CLCX 3ZS8A 2LW7A 3D4LA 4EA7A 1H1TA 1KVTA 5A76A 2F1RA 4KFSA 5CT9A 2ZB2A 1TL7A 2RB7A 4Y7CA 5I51A 3HPOA 4IHJA 4QOFA 1ZUWA 4IOKA 4RQTA 5HQMA 4XGNA 4DV6B 3H1TA 2Z58B 1YFLA 5P21A 1X31C 2Q5QA 1LJLA 1SBZA 5JWOA 3QU4A 2D3ZA 4AZ3B 1W59A 2HF8A 1F3FA 1UWAA 4ECVA 3KLNA 1K0FA 5C2CA 1Y8RB 1GYRA 1TFYA 2DHDA 4ZEOA 2A3JA 2OBXA 3H7IA 1DAFA 2RSQA 3L4EA 4DQUA 3BK7A 3UPUA 1G2OA 4TV8B 1GA1A 1NHUA 2ZH1A 4B43A 3QKIA 4M4SA 5ALIA 5BUCA 2C2EA 3W60A 3OU6A 2VQEF 3JQAB 2FJVA 1ZVQA 4BX8A 3VC3A 1JZSA 1NQ5A 5BSWA 3L1HA 1JJHA 4BO7A 3B13B 5C53B 3RC3A 3C3CA 1V1RB 3W2VA 4M3NA 5HANA 1UM9B 1T03A 3HB1A 3R7WB 9GPBA 3ZV7A 3EMKA 4IXTA 3SC4A 1LXNA 1H6KX 5FBWB 1FXUA 3LF2A 1PZFA 1D0SA 5HF5A 5ALSA 3ZZMA 1RLOA 2IZ1A 5HHTA 2B0CA 4YJFA 2O23A 4XIIA 2DNOA 5IF9A 1N52B 4MS1B 2IPMA 3P0FA 4B2YA 4AMVA 1WKKA 1THGA 4KJZA 4E1AA 2MY7A 3DE4X 3OCVA 1ZMXA 5GMDA 3BN3A 1IY1A 1EU1A 1YJ8A 3H5WA 1CUXA 2J30A 4J49A 1E7SA 1NT4A 1HLPA 3ZE7A 1TUGB 3ZQUA 2BPOA 2EFJA 1I7LA 2BJ1A 3LLCA 1HBOB 3MHYA 3DUFA 1N7JA 3PZPA 3ZC4A 3RPEA 1ISFA 4HLUA 3IUSA 4LVOA 3TLXA 4B9NA 5CPFA 1GSOA 4PQYA 3GMDA 4PYQA 2Z08A 2A5LA 3W9HA 7AT1B 1GV1A 1R4AA 4QZVB 1EINA 3BREA 1UBHS 4QUDA 3QEAZ 1GKLA 3TQ1A 1V5GA 4IH4A 2Q3EA 2INGX 1AROP 2VPYB 2R8XA 2BY4A 3NH6A 2FDNA 2RHDA 3PYFA 3EOAI 2XDAA 2IDKA 2RUGA 4Q1BA 1YR1A 4KTTE 2P5UA 2P4HX 4ECXA 2R7RA 5TGDA 2PMCA 4P92A 5JZOA 2E66A 5A6WA 4NYPA 4HGNA 3KQSA 2MYNA 1MB9A 4FR2A 1TOAA 1WMAA 2XKAA 1NLZA 3C7TA 3DL7A 4V3CA 3QOXA 3UV7A 3AU9A 2XGOA 1OXXK 1D2HA 3SMVA 4Z4HA 5C8YF 3U3OA 1IQPA 3QRQA 5GAEI 2ODWA 1XTQA 2IWHA 1FNBA 1PZGA 3GOQA 3UDLA 3ZTPA 3AESB 1KF0A 3DYIA 1P5ZB 3LGNA 1NU4A 4OV1A 5BV1A 1A9QA 3EYAA 2L9NA 1XEFA 2I1RA 1ODCA 2IP1A 4QUGA 5E1OA 3V1LA 4PPYA 4DR2J 4RJKA 5BSMA 2G82A 4YWJA 3BXFA 3ZWAA 2WD9A 2W6PA 3OLXA 3X1KA 2RE8A 2DM6A 2G25A 1G3QA 3MGAA 4EKIA 5F7ZA 1L2TA 1NVTA 2JHFA 4G0MA 2V96A 4MRSA 4KGZB 3KETA 5DIZA 2D74B 4DPKA 3KLFB 1A9ZA 1N75A 1Z08A 5TVGA 2XLBA 1Y00A 1OWPA 3F6YA 4AUMA 4DR3F 4DWVA 1U3CA 1KVUA 2YKGA 4A6DA 1IB6A 5CK4A 4X54A 2H5JB 3IDAA 4ZYTA 2HRTA 4DMCA 3NBPB 4JEIA 3OMXA 3OOWA 4R51A 5D00A 1FNCA 1NH8A 5L3VA 2H5EA 3D7RA 3NV9A 1YZQA 1D1PA 2HQBA 1W0KA 2VNIA 4RGBA 3IQFA 3K15A 1N32J 1R0CB 3DCNA 3RNLA 6ABPA 2O2IA 3LS2A 3KUHA 4ZDWA 1MHTA 5DZSA 4AYXA 2VC1A 5JH7A 1RJGA 2ECQA 1F2UA 2FUCA 3KXLA 3D6JA 4ECUA 2WWGA 1M7HA 5ED4A 3CY6A 3ZBPA 1Y9JA 1FVOA 3LUKA 1UXIA 4WVLA 1RADA 2FEPA 3LZDA 4TLDA 1X1BA 2QRPA 1GTZA 4B8YA 3TIVA 3NS6A 4I0WA 2P6UA 3DRXA 4B8ZA 3DQQA 2ZAMA 3KR1A 8ATCB 1II0A 4GUAA 5AVUA 2NU9B 1HQUB 1Y3HA 3SJBA 1T0TV 2I66A 1I4EB 2KBEA 4CW7A 4I2QB 1BWSA 1VIMA 1YSCA 3M30B 2BKOA 2V7VA 4MVJF 3G1UA 4G0NA 3HULA 3HDSA 2RCNA 3FZYA 3GFSA 4IBOA 3O1IC 5A4FS 1L7PA 4EBCA 1Q95A 3AFOA 1GADO 5B1EA 5HM8A 1DQZA 1IFXA 3TNJA 4UXJA 3OZSA 3H8SA 1WUIS 2HPAA 1KPGA 2PUBA 2CVPA 2VUUA 4RBTA 3D59A 1JKIA 2RHBA 4DY4A 3GYXB 4OU4A 5DBOA 1ZBTA 4GH5A 2PH7A 2W43A 2WPDD 3L6EA 4MVXA 3EVGA 2AW0A 1I3LA 1Z26A 2AJTA 3J80U 3CRMA 2HSEB 1SIUA 4DPTA 4OHBA 3T15A 4XWYA 2CXRA 3PEVA 2WV9A 4ZYUA 2NW6A 2PZ8A 3CCTA 3Q8VA 1K9VF 2H1LA 1R4ZA 4USIA 5BUQA 4EJ6A 5ADZA 1MG0A 3C7CB 3TSYA 5B7WA 3EG9B 1IBLF 1JTEA 3PHHA 3RU3A 1HLDA 3NHMA 2FPRA 2JIQA 5ICGA 4ZITA 4TPKA 1LDMA 5KSPA 2VLIA 4I1SA 5E2AA 2O2ZA 4WZBB 4I8IA 2OCKA 4LXXA 3BMNB 4DOMA 2G1AA 1Z8DA 4M9RA 4LF7B 3EBOA 3IERA 3HHLD 2JGFA 3CUWA 4NXNB 2ORED 2XCPA 4IIYA 4XW2A 3CUEF 5IDYA 2X6TA 1Q0SA 1V5EA 3US5A 2MSLA 5AKXA 5IG2A 1C50A 4M1WA 4DV4B 5BSVA 1MCZA 4RQAA 1T3OA 4LBVA 4ETXA 4UQGA 3NVDA 4LMRA 3WLRA 3QUAA 4IUCS 3UAXA 1QLWA 5HQ3A 2QZZA 3AD7C 4GC9A 4M7OA 4MRMB 2IEDA 3AHIA 3DDZX 2GAAA 5K6AA 4L3NA 3JVEA 1WF1A 1EFRA 1AHNA 1VG1A 2Q9CA 2HKEA 1V2HE 1NDLA 3FEXB 3QHQA 2RBGA 4OJGA 4CKXA 1BHSA 3R1IA 4DV3B 3K0FA 3BPDA 2ZVIA 3KKEA 3VQTA 1ECFA 1Z4PX 2W1BA 3OHSX 1XRRA 3OA0A 5CBPB 2BUCA 2XGSA 2HGSA 3FTCA 3UDEA 3PXCX 3M3DA 2H2DA 3QFTA 4H0CA 1BQMB 2JIMA 4ADSG 4AKHA 4I6EA 2ZCJA 2GERA 4M9SA 3UB3A 5CBKA 3OESA 3OFGA 2ZJ7A 3OTBA 4F0KA 1FKPA 4USTA 5KYUA 3AKEA 5DW0A 2PFFB 4UW2A 1S1VA 3A9TA 2BE9A 5B0BA 4GUDA 4D3ZA 3G9UA 3Q87B 5LQMA 4LF4F 3ADKA 1XIQA 3VOAA 2VNSA 1HM5A 1U7XA 3N2GA 4RLFA 3GH3A 3IV9A 1I51B 3MEEA 3L7IA 2Z04A 4JC0A 1NUHA 3LWZA 4QQRA 2QN3A 2JFPA 3KUXA 4ECTA 4PQUB 1Y1KE 3OURA 4I4TF 1DTTA 1L4KA 2HNZA 4JUDX 3C66A 1O5TA 4J4TA 1C2PA 3WLNA 1FNMA 1RMTA 2J0QA 5IK2D 4MFBA 2ERYA 3MTBA 1OH5A 4PZDA 5KFSA 3NCQA 4XAQA 3EPRA 5E9AA 3NX4A 1MIHA 4K4WA 1ZBQA 3DOKA 4HUQA 4GOMD 3F6EX 2OEKA 2A30A 3L01A 3ENWA 2ZGVA 1NUPA 1B99A 3CWCA 3QPAA 4U6SA 2G0IA 2YJGA 1LVGA 3PC6A 1KZYC 1I4OA 2FJPA 3RTAA 3PJRA 3NWOA 3N2KB 1YBAA 3EMDA 3ODPA 3GV7B 1FC0A 4S1OA 4FDVA 4S0MA 4X1YA 1PL7A 2C95A 3SR4A 4C0JA 4GO7X 1WD5A 3PLRA 5DSXA 1R8JA 4LJAA 1CU1A 3EZ9A 1D5WA 1G3RA 3Q22A 5JQGB 2NXJA 4D0NA 4MUNA 1T7PA 2P9BA 1EXWA 4YMVA 1NBMD 2JIZD 5LPNA 1JUDA 3OUZA 1IXSB 1C3VA 1EG7A 3GAFA 3TWZA 1BXRA 2VYND 2NZUG 4OZ5A 2MYPA 1I8TA 4DG1B 4JC8A 4TMZA 4DWWA 3ICCA 2R4QA 1YQDA 3BGRB 4WNIA 1VQKS 4IIJF 4IJQA 3L7NA 2W4IA 4Q39A 3RB8A 1RT9A 2HSZA 5IANA 1FERA 1UPPA 1J97A 1G4HA 3FTQA 5EJAA 2QM0A 1WLYA 2WAOA 3LVQE 3WAJA 1RT4A 3GEEA 1KQFB 4BZPA 1QWOA 1ADYA 4BP1A 4HWGA 1F7UA 3PXGA 3RAMA 4GU5A 5LLSA 3BMXA 3TAMA 4IRCA 5G40A 4QFMA 5EZ6B 1K0TA 3DLEA 2HXYA 2X5JO 4LSZA 4MQEB 4YRNA 4KGXA 1QX3A 1XLWA 2ZJ3A 4KQKA 1CULC 1YITS 2HWKA 4TS9A 3BMOB 3W5XA 5F0WA 2RHCA 3AUXA 4ZCLA 2Z2IA 1LC3A 4ZAZA 5HROA 3OFFA 3DM2A 1W4AA 1CUHA 4CV3A 1RKUA 2O07A 2NZ4A 2HAIA 2E5WA 3D6MA 2AG6A 5LMUJ 5ERYA 3SX2A 4C6TA 1AGPA 4R8VA 5HCUA 5JQWA 3MQFA 3VF0B 3U3XA 1NXIA 1HPZA 4MX8A 5DM60 4BMOB 2IXDA 5LJ5Y 4WSOA 4WZAA 1XK7A 5LDDC 2BH2A 1QE5A 5KHAA 4PX2A 8LDHA 1HQEB 1HOTA 2ZSIA 1X60A 3ITHB 2GR9A 3F2VA 2VD3A 4IV8A 4NCJA 4ZRDA 1TK8A 4Q1DA 4S1WA 4EB3A 1X38A 5AKGA 4JASB 1XDWA 1VFPA 3QWAA 1IBRA 3BO2A 2FRXA 4G41A 1PR9A 4I68A 2CA9A 4EFKA 4NZPA 3OOJA 1IBKB 3V46A 2I5JB 3ISND 4BO8A 4RA9A 5ALTA 4DCUA 4OI4A 4W9RA 3L4BA 5AKJA 1HZJA 1OYWA 1UMDA 1A4UA 3NMAA 4MKYA 2WOMA 4V0NA 3TIXB 4C7XA 3IA7A 4FBTA 2LCIA 4PLWA 2EK1A 4LSNB 4Y2AA 5JC1A 4DL3A 2PZFA 1P1HA 3BTOA 4YJ2F 3CVWA 2PA3A 4O3OA 3LNTA 4CEJB 4GRAA 4EYIB 3L7DA 4F91B 3V7YA 2ZXUA 2VQFB 3VPXA 3V1MA 2UAGA 5KTMA 5FEUA 5HO4A 3JAWB 2NYIA 4QXAA 2CLKB 4BBJA 3C1AA 4RTJA 3OFEA 3GA0A 4NONA 4B3MF 1UA0A 2F1HA 2G1DA 4BL5A 4KQXA 1FX1A 4BGIA 2JLYA 1V3UA 5DYTA 4I50B 3KZXA 4IQ0A 2KPOA 4IHJF 1C0TB 2IP2A 2Z2XA 2VHYA 5LMNB 1ZDMA 2Z56B 1I2BA 1KFCB 4HGOA 2UYHA 2NLOA 4US2R 2IQ5A 2C2MA 3ZHTA 4MUEA 4TU7A 4RSGA 1XMXA 3H5SA 3I5AA 3RSZA 3JATB 3QV2A 3EF1A 2ODTX 3EAGA 2Z2KA 2QSUA 5JU6A 2VK4A 5LYJA 1T1SA 1N2IA 1GGMA 4UTVA 4WTYA 1DBIA 3G2QA 5AI6A 3FHJA 1RBYA 5AW8A 4TOIA 2X0JA 4O3FA 2JEIA 4KIFA 5G1NA 1GV0A 1PS0A 4HHJA 3H9JA 3T1VA 4HAXA 2ASYA 1X9SA 4DS3A 4PQAA 3R8FA 3O8DA 3EUWA 3KB8A 1U2DC 3RCBA 4L72B 1FNSA 3KG0A 4JJ8A 3N2NA 2XMRA 1WPGA 4ZP7A 3EWNA 1RFLA 5DLDA 5I7FA 1CY0A 1X5OA 1FKOA 4FPXA 3VNSA 3QSYB 5FWYB 3NU1A 4FYVA 2IXAA 5F3DA 4J9VA 1EB8A 1U2ZA 4N3BA 4XGRA 1CY4A 2FUEA 4D80A 2QO3A 5TSDA 1E2FA 1VQ1A 2PS1A 1FMTA 3PYXA 3CH6A 3FWZA 4MV6A 4DLKA 5DK4A 1K0VA 2I8LA 4FZVA 4FVCA 1V1JA 2PS9A 4ZHQF 5JCOC 4K6OA 2VP9A 5D01A 4MGHA 1CX9B 3AZQA 2GPWA 1GTJ1 1B14A 2G9ZA 4YUDA 2EFDB 2WZ1A 2EJBA 2R2SA 3LRPA 1WHTB 1NIJA 4KV8B 5T67A 1TEZA 1YRXA 1TM2A 3OXLA 1RLIA 4BWJA 1VC5A 1X4HA 4K59A 3VO1A 3CXCR 1KSPA 1HPLA 3EXG1 4QJ4A 3HKBB 1U94A 1WEZA 2EU8A 5ICEA 3T19A 3I82A 2B6AB 2BMBA 4C3VA 2JJ8A 1Z6TA 3P2JA 2M6SA 4MVJD 3NYQA 5AXDA 3VMFA 4NDNE 2RH4A 4X92A 3G9QA 2IBTA 4N77A 4CQ1A 3TLAA 1HTTA 3W1EA 4FMCF 4NQZA 4BO9A 5EG5A 4I1PA 3PNBA 5DWDA 4B3BA 2O05A 2ZOFA 2YV2A 3Q88A 4ELUA 3CJQA 3GMSA 1KORA 2KBFA 5EWLA 2FPUA 3C97A 3UJ6A 1UDXA 1S2MA 4OBXA 1M5TA 4M49A 3NOVA 3IUYA 3I72A 4DLAA 2AZXA 1BMFD 4CQMA 1KKHA 1TRKA 3GPIA 1PL6A 3L92A 1KOHA 3BC1A 1N5YB 2FJEB 2QI9C 1Y3FE 1R3NA 1SELA 4N48A 2QL7A 3TB6A 1FESA 4LBPA 3KQOA 3E7DA 2WUGA 1D09A 4OP2A 3A4VA 4I1UA 1RLCL 1TUBA 1Q8KA 3I9MA 2A5DA 4C30A 3PRBA 1KKLA 2AZTA 2OUGA 1QRSA 2NXWA 2QZJA 4I5EA 2M9KA 2FZCA 1GO2A 1B26A 1R6DA 5AYVA 3OOEA 2G71A 3A7DA 4NMLA 3MD1A 1ZJ5A 1Q2XA 1JLLB 3DMPA 3WA6A 4FFVA 3AUJB 1UEIA 3HHLA 2BRLA 3RSLA 2MY8A 2J46A 4R6WA 4RTMA 4MUMA 2H1FA 3OV7A 2F5GA 1H38A 5ALXA 2MSTA 3L18A 1OYEA 1V5WA 1WAMA 2GBGA 5CDGA 3GRFA 1ZMOA 2E0IA 1SHUX 4HDSB 3C7AA 1KDOA 1IXKA 1Y6RA 3LUJA 1S1TA 2UXCB 3W90A 4NJMA 4HDOB 1NPDA 3CH5A 4CLSA 2ZT6A 1BFDA 3I5MA 2XSJB 1EFLA 1PCXA 2ZAGA 1OJ4A 4CFZA 2W58A 4QATA 1PW7A 3K1JA 3P9NA 1R4MB 3Q2TC 2FH5B 4WLEA 3BYZA 3LTOA 2VG5B 2IOFA 4EZ6A 5C32A 5KJ1A 5HL7Q 3ROFA 4KO8A 4CT0A 3PFWO 2WSEC 1C8KA 4M9UA 5JH7F 1EKSA 3KUDA 2QL9A 1E99A 1K8XB 2OBFA 3R5CA 1NX6A 1R0YA 2V0CA 3AP1A 5F0UA 4WJBA 4YHHF 1RJ9B 3U7FB 4B3TB 2GEUA 3OQIA 5IDQA 4A8FA 1A8PA 3CIOA 3ZLTA 1IHUA 2XE7A 1TW2A 3SXPA 1HDZA 3S0JA 2XX3A 5B58C 2PV0A 4W9NA 1CD5A 3PHJA 3QNMA 2XYRA 1JQBA 3KJVB 4EEKA 1GTVA 4LF9J 4MJKA 2XO7A 3FDIA 3TOSA 3ZDQA 2M88A 4FCCA 1R37A 1N34B 4RD1A 1CUFA 2Q62A 4MEJA 5F3RA 4BNDB 1QIEA 3QIPB 3W5UA 2HNDA 1E0AA 5LA6B 1M2OB 4NCBA 4N8NA 2PGNA 1ZH6A 5LVAA 1P2GA 4Y2XA 4R5HA 2N7YA 5TQ2A 4RTQA 3FCOA 4DMLA 4U2EA 1XDUA 2IFXA 4DCTA 4UUAA 2FVRA 1EFPA 3FHLA 3MCOA 1YTUA 2Y1KA 2OMKA 3E0QA 4PCLA 2HNBA 5NULA 1P5JA 1FE8A 5B3JA 5EQJB 4BATA 5F7OA 1S9EB 4XPIA 3DB1A 5IKPA 1YGPA 3DT9A 4UXIA 4URXR 3VSBA 1U7LA 4EJSA 2HK2A 2VT2A 1QIMA 3STUA 4CCAA 3CZ5A 3HK2A 5GPBA 2ZB3A 2DNYA 5J4YA 1DQRA 1T29A 3NG8A 4V38A 5CCEA 1E96A 4UAUA 3WQBA 2JL9A 4F4ZA 2UXDB 1WNFA 3NV7A 1ZMBA 2V7WA 3M6AA 1L4GA 1T05A 3A3OB 1MN6A 2Y1WA 5DLFA 3ZNUA 4AY2A 4HEA1 2PVCA 3NBMA 3SM3A 1E8DA 3WV5A 4QPCA 1XMJA 3F49S 1PE0A 5H02A 3I3OA 3S99A 1EHWA 1VE9A 3CKYA 1SGWA 2DHSA 3W1YC 2JJ2A 2R84A 4JBLA 5FTKA 4MCAA 4BP9A 3B6KA 1M2VB 2VDWA 2EW1A 2ZSAA 1LFAA 2YN0A 3TK1A 2P2DA 3B2NA 4OK5A 4FDMA 2BVNA 4XPZA 1RTIA 3HN7A 4QVGA 2OAP1 2R60A 2J5KA 4FXWA 4JI0B 1Y48E 4P3PA 3MRTA 2WDPA 1ORRA 2HA2A 1NN0A 4G0PA 5DNWA 4UOHA 3M2PA 1OIVA 2IBOA 5FKJA 4RTOA 3IX7A 3K6KA 3WJ7A 5K05A 2QF7A 1FQOA 3UMVA 1VL1A 4AUEA 2OORA 5IULC 2BEFA 4P93A 1M6WA 2V9WA 3ZVRA 3PDUA 3G6ES 2NSJA 5H80A 4QHSA 3GVIA 1VCIA 4TTJA 5CAAA 2B3TA 2CNBA 3VPBA 2E21A 2JBHA 1MX5A 4EPRA 1A3CA 4UEQA 3HXTA 4QGAA 1OQAA 2LWIA 4MB0A 3RSOA 1EARA 3QIDA 1EZZB 2AN1A 2WJWA 1QK5A 1VIAA 3ZWWA 4BO5A 3R2CJ 3RUBL 2C8VA 1ZRMA 4HNHA 3BTVA 3IVRA 4KQ2A 4QGGA 1GH8A 4QBGB 5JCPA 3RVJA 1XF9A 1KC3A 2DFKB 4OIMA 5D4LA 2Y1CA 3IBFA 1JFVA 3QBJA 3AODA 4ND2A 2B5WA 2DJ5A 4G36A 4DR5B 2R4TA 5G3ZA 4ZV4A 3ZU3A 1JEYA 4IFBA 4C0QC 1JT9A 2RGAA 2ZJZA 4ALKA 5A8RA 5DT2A 1VXRA 2YKOA 5CK5A 3R0XA 3RI3A 1E3IA 3BMQB 1P3Y1 4I1RA 3C5CA 5F1YA 5H1YA 1VCOA 4IMJB 2AZ3A 3PRVA 4BECA 1GARA 1U6IA 3V4FA 5B1HA 4TYYA 1TZKA 2GM9A 1ZPWX 2QVCA 4ZVGA 4EW6A 4NA1A 5KG3A 3DLAA 4I67A 1W48A 4UZEA 3ZCVA 2VPXA 4OJMX 1WZIA 4HL9A 3VAYA 5E7IA 4I4CA 5CCBA 4XIUA 3RSFA 1XJ0A 4LXQA 4JDPA 4N3NA 1FU4A 4QU0A 2Y71A 3ZWVA 4FYDA 1S7CA 1MROA 1WV1A 3OXGA 1NSPA 4WFXA 1RLJA 1VKJA 1NG9A 4YAGA 1EYZA 1JNYA 3GT0A 4CGYA 5F51A 3BR8A 2I6SA 3ZCQA 4D4GA 3AF1A 2AHOB 2AN5A 2G1JA 2BM8A 4KK3A 1RWWA 5C8YA 1IL0A 3IVCA 3ZVKA 2ZRFA 4A10A 5CB4B 1E4EA 3KJEA 2CPIA 1Y4ZA 3AG6A 3GYBA 1Z8HA 3COYA 3JU3A 4L3KA 5HRUA 3MERA 1UK9A 2IHNA 3QF4B 2Y1EA 1W36D 1BDMA 3FGOA 5IZCA 4GIBA 4C0AC 4WWHA 1RCFA 4LFAF 3TI9A 7FD1A 2RQ4A 2R5WA 521PA 1DEOA 4IYRA 1S1WA 1EM8A 4ZAGA 4WACA 4AECA 4OSEA 1CE8A 4P4SB 4JYAJ 4XDGA 2G9RA 4LGVA 5HNKA 3BDVA 2MYTA 2BBOA 4KO2S 4UEOA 4YY3J 5AK3A 2G40A 2QTCA 5BMVB 3G02A 4PNHA 2P35A 3NWBA 3UCXA 3VNBA 3WL6A 3AXKA 1AUPA 3AXTA 4X7MA 4HTJA 1TAQA 4K3VA 3EZXA 3UXHA 2CXUA 4J9PA 1PLJA 3IXLA 3X2SA 5E6RA 1HNVA 3ILOA 3VZRA 4FOTA 4P7TA 5IJWA 2OC4A 3EIOA 4O1IA 3DBRB 4QR1A 4CMIB 1G55A 5JAMA 4G1FA 4HDQB 4ZMMA 2Z2YB 3PGA1 1JTVA 5ER6A 5AHOA 3VRHA 1CERA 3S44A 3OD5A 1GGVA 3RBXA 2FTKE 4RPGA 1TPZA 1DG1G 1AM4D 2RGYA 4YT2A 1N6QB 3AT1A 4MRRA 4DR6B 2EW9A 4QBIA 5FUQA 1EE1A 1DMRA 4E3ZA 5JXIA 2OQ2A 3DFMA 3D7NA 4OOFA 1PYTA 1J33A 1GKYA 2CVQA 1L6IA 4HPWA 1JMTA 3H18A 3MRVA 5F8JA 3T1HJ 4LW8A 1OFIA 4B02A 3LGMA 2FW0A 3HSDA 1XEWY 3ZCXA 3M2VB 1DDOA 2GJSA 1ADCA 5EJ2A 4IOMA 3WGOA 1KJ9A 1BFKA 4RX6A 3GUVA 4C8ZA 4R9VA 1ZMRA 2VUIB 1W44A 3QO9B 1NWHA 1YKWA 2P67A 1G8JA 2AJLI 3IUNA 3P19A 3GJRB 2WE7A 4PHHA 4ZJYA 1U0HC 2QN7A 2DNKA 5LZ7A 1XTZA 5CZVA 1A8HA 2B9VA 2PMBA 5JECA 2WAMA 1LWNA 3PJ9A 1C3OA 2CEAA 5K4GA 4MKIA 3EQ6A 1QNLA 5I4KA 2GMHA 2IRXA 4CF4A 1PG5B 1R3UA 3R7LA 4ZZ3A 4W7HA 5JDIA 2FN7A 2AE1A 3K6JA 4ZJPA 3AOBA 2W93A 4M1YA 3JQMA 3K0EA 2Q1SA 2YIMA 3C14C 2PMDA 2UZ3A 3QA3E 4DPWA 2AH5A 3OLCX 1VPLA 1ZU4A 4DWOA 4DV7B 4P2BA 2UUBB 3CINA 4Y9SA 1UC5B 4B6GA 2W6IA 3AVQA 1GRCA 5K8IA 1JB9A 5KQRA 2BFOA 2PR7A 1T2VA 4A8MP 4O3MA 4FFBA 3LYLA 4R71A 3MURP 2YCLA 3KJNB 1CCWA 2MQ8A 3V5RA 3DEHA 4AMUA 2G1KA 1Z75A 2PH5A 1Q7CA 1VRVA 3PNPA 5BSUA 3KT8A 1OLOA 2HFOA 5LYJF 3OT9A 2AOTA 1FPMA 3DTVA 1NIPA 1NHGA 1W94A 1RE0A 2Q5EA 1IWGA 4PHCA 2RI6A 4C11B 4E32A 2GEDA 2PD6A 3PK0A 2R1VB 1VPEA 1CG2A 4CLDA 3PHIA 3TEMA 2M6KA 1RYBA 2QBYA 2PX2A 2DZDA 1R9GA 3NEKA 1ZW6A 4TLLB 3I05A 2R8GA 1A98A 2QY9A 3QMPA 4AXXA 4EH1A 5C3MA 2WHPB 1NP6A 2CPJA 5GINE 4CHGA 5EXSA 3LX4A 3HC7A 3T7EA 2RMKA 2IYEA 4IIDA 1GNRA 4EYSA 4ED8A 3UMCA 2JJMA 3KTQA 5GAHU 4MWBA 1BQNA 1VLJA 4R9UC 2KJQA 3CKLA 5LDHA 1G98A 3SKXA 2ZSJA 3BM5A 4HSGA 4WAUA 1FK8A 5DSTA 3QLUC 2LIVA 5K03A 1CY8A 4R05A 3WMWA 3RWMB 2UU9F 4KPFC 1XA3A 5CZXA 2LTAA 5FOTA 4RIHA 3OQ6A 1JI3A 3S2EA 3T38A 4AN4A 1E98A 1IBMF 3CCMS 4LZZA 2DAPA 4N54A 4YN3A 3TRJA 4IGFA 3VTIA 2P1DA 3EY4A 1GXLA 4FD2A 3PR4A 1LV7A 1TT7A 4BMNA 2PLFA 3C41J 3KKMA 3I9KA 2XYPB 3U4DA 5CQGA 1TLFA 4E2ZA 4AZTA 2PT5A 2FFQA 2Z2ZA 3MTGA 4GOLD 3KKQA 3IC1A 2EERA 1ZBDA 2PSHA 2NUAB 5EZQA 3EXHB 3SI8A 2FVXA 3PFGA 1Q6YA 3QW4B 3CNLA 2DHEA 3D7SA 3FKBA 2B4TO 4IOBA 2VDPB 2CLEB 2ZRQA 3A6LA 4IKEA 2HYIB 3W34A 5H70A 3OIWA 4IEEA 3VAJA 2CFCA 4D3HA 3T1YJ 4QTXA 1WXEA 2ADMA 1HNIB 4DDWA 1CK4A 1I6LA 3HDVA 1RAEB 3RG8A 1W49A 1XMOF 1B1AA 4WCVA 2O8NA 2KLBA 3F6RA 1TA9A 5HUHA 4PRZA 1M7BA 1U49A 4OJTA 4WADA 2VHGA 3JAMA 5T4FA 3J7AC 5JSZB 2R42A 2FZEA 3D1QA 1KP6A 1P8AA 3RJMB 4RVCA 2QAJA 3H5LA 5FL7A 4OGGA 5K4AA 1SJ1A 3EVBA 2HWHA 3KZKA 2IU6A 1KDTA 3ETMA 1SO8A 4ACAA 4D3YA 1RWOA 1E6KA 3WIEA 2EARA 2D0PB 4URGA 1FFDA 1CUZA 4LDPA 1XEZA 3ADPA 1X1RA 1K5GA 3BD6A 4QQFA 4NLVA 4EF4A 1W9HA 4EOGA 4F5DA 3AU8A 1NJ1A 2E9SA 4C01A 2FK7A 4EL5A 5JVGQ 4NPOA 3KSDO 5K8MA 4OXIA 3HXQA 4Y0NA 4EMSA 4JI4J 4C7OB 2CQ1A 4KDFA 5FB3A 5ALKA 2OZEA 2G08A 3JAMY 4Z99A 5IVHA 1YUNA 1KC8T 3FBFA 3G0OA 3U1LA 2GZAA 3VU9A 4V1CB 1DUIA 2XDQB 4OSOA 1TTHB 2JVOA 4DCOB 1KMHA 3HJTA 1C7ZA 2W2KA 1JHOA 1TI7A 2IRUA 1UETA 3R23A 3ROZA 4EUFA 4LRWA 5DO9A 2V3VA 3FYUA 1JQGA 4I1YA 3A9VA 2GHPA 4MR7B 3CR3C 4J0HA 4UMVA 3OSPA 4UUNA 4Y6OA 4DN6A 5A0VA 2EHJA 5H9EK 2AC2A 5ADWA 4XFJA 2FX3A 1JDTA 5AXNA 3ZV6A 5A5VA 2O2EA 1CUDA 2CCJA 2O2SA 4H18A 3C8MA 5I47A 3CIZA 4DZ6A 1U09A 2WFMA 4DR4B 3FPGA 2NV6A 2GN8A 4RLHA 3E9YA 3E01A 1TMJA 1T0IA 3GCWA 4FDTA 3AERA 2ANBA 3MR2A 3CJ8A 3GB0A 3WWYA 3AAWB 4LPKA 1N25A 1WXDA 3WLHA 4C06A 1S7HA 4KVGA 1NFRA 2IIQA 1XN1A 2D06A 5B08A 3FJ1A 1YJ5A 2X9GA 1XNRJ 1XP8A 2B7CB 3WQRA 2BSAA 2GBIA 1N78A 5BOSA 2Q29A 3PX3A 5C7IO 1P7YA 4Q4JA 4E09A 1GL7A 1Y3IA 1VHWA 3CNOA 1N57A 5EUBA 2C03A 2A18A 3STYA 5BXQC 4X44A 3PFCA 4PZYA 1Y4AE 4AE5A 1JVNA 1ZLXA 2COEA 1W88A 1S9DA 3OG9A 1ODKA 1XFDA 2G1PA 1RT1A 2CUYA 1Y5LB 4BNLA 4LFCJ 2B4PA 1W75A 5GAJA 2FPPB 3I09A 3GAAA 3DVAA 2JOQA 1LLFA 1PKXA 4UUOA 1T9DA 4BCBA 3TD9A 1S9FA 2A0YA 3IFEA 2QC3A 1M6VA 1T9KA 4K8RA 2ZVJA 2FW9A 1KL7A 2QUIA 2HJVA 4LQCA 4PZZA 3EB9A 2CNLB 4L8LA 5H3HA 2WKQA 4NV1A 3TLKA 1BKSB 3JZIA 1WSAA 4NCKA 5DN9A 4DA9A 4B45A 1Z4UA 3R40A 1I0LA 1P5HA 4GMXA 1O95C 1FFGB 2W4PA 5C18A 4WH0A 5EC8A 3DOOA 4RKFA 5A6SA 4RNNA 2VKQA 4M37A 2Y6UA 4YEDA 5DG9A 2HEKA 1ZM4A 3CJKA 3JQ8A 1WTBA 3B36A 2VZ0A 3PE3A 3ZJYA 4FR5A 2NN3C 4HWRA 3RT1A 3V4RA 2I7DA 3TOCA 1EPUA 4E51A 3JR7A 5DCUA 2YH0A 1RZVA 2G70A 5C4MA 3IPRA 2J6SA 3ZCPA 3RFFA 4HAYA 1FO1A 3EVNA 4DC9A 4IMPA 3L8ZA 1K97A 5LDGA 1I30A 4MK8A 2GBFA 4MRPA 2X2FA 3VHXA 1K7FB 1PZHA 2FZKA 1LW2A 4KT0C 1OLSB 3FW1A 3LT4A 4BJ5A 5CCXA 3SV4A 1QHNA 4ZVUA 3OLAA 1EUCB 1X7GA 3I5XA 4PX9A 4J8PA 4FJ0A 1Z45A 3I9FA 4DQ0A 2QENA 2CHVA 5DASA 3HVJA 1Q82T 1W2WB 5KTTA 3ZIAA 2C54A 3Q3IA 3A25A 5HQJA 2Q5OA 2XXAB 1W1IA 3JYOA 1J5EB 5FADA 3BERA 2AJ8A 5DGXA 3QX3A 4XB2A 4PGFA 3P20A 3MXOA 1B6TA 1FMJA 5IWAJ 2Q5JA 4LQDA 2R0QC 2B4AA 4OL0A 4DDTA 4U9IS 3NOGA 1ZISA 2VNAA 5KPJA 4JL5A 1E8MA 1HNWJ 1SCQA 1VZ2A 2HDHA 1GAWA 1L3KA 4MA0A 5JYBA 1O51A 1GZ4A 3JASB 3H4DA 3D3BJ 5LMCA 3OTDA 4CEIB 4FK8A 1BE0A 4ARIA 4L22A 3NPAA 4E12A 4RIFA 1GDDA 4HOYA 2D1TA 4MGEA 4B31A 5AMXA 3JWHA 2EP8A 1E20A 3B2EA 3EXFB 1V25A 3R7FA 2QJOA 1J2JA 2A3RA 2Z2LA 3TSWA 4RPKA 1GR1A 3SCKE 1AXEA 1L8OA 1X1TA 4UF4A 2R751 4H3KB 4URUR 3KJFA 1V2GA 2R8OA 3IVGA 5KOXA 4ZHQA 3H2BA 1CZLA 4W1PA 3G8DA 2B2CA 3RBAA 2Q2QA 5HE9A 1TIKA 1V3RA 4DL0C 1U7WA 2D41A 4HWOA 5EYPA 4KB7A 3G2LA 3L40A 4IMRA 2HZBA 2DOKA 1AX9A 4G56A 1FJGJ 1DRVA 4KGDA 4CE6A 2CWKA 2CQCA 5BMOA 4LIWA 2OXCA 5KDDA 1Q3KA 2HQIA 2Q3DA 4F2WA 1YGYA 4Q7AA 4JJ4A 5DNCA 2JVJA 3V1TC 3T3MB 4ENUA 3D6VA 1S6QA 4BN0A 2DHAA 5LP6B 1DC8A 4Z9FA 3QEJA 1X9MA 1Z36A 2ZCVA 3JQ9A 2AXEA 4YJ3B 3THVA 2JI4A 1NQXA 3NT2A 3QJ5A 2QVXX 2ZRDA 1CJTB 1AB5A 4UUMA 3RIXA 1LQUA 2M8DB 4C5AA 1R66A 3V48A 2CSXA 2IM0A 1QH9A 1WCWA 3HMQA 4L3OA 3PNIA 1JKJB 4NICA 4U7TB 4BO2A 2ZYDA 1VGRA 2X2PA 3EMBA 3ZC3A 4E08A 2P0EA 3JS5A 3MEDB 4I8DA 2Q6IA 4JT8A 5AFSA 4TKMA 3IOYA 1T9XA 1OJLA 2BCJQ 4OKNA 4WECA 1RM0A 1FSPA 5HFNA 4R2HA 5F98A 2EYQA 5FNZA 2CLDX 4A3SA 4I9GA 1TL5A 3W2IA 3ZY6A 4FEEA 2GEBA 4IAOA 3N5FA 1R0BG 1S2IA 1DAPA 1DBWA 5G0VA 2QSWA 2DLCX 3QE2A 5DGHA 4ZI2A 3C3WA 5JSHA 3ZWPA 3FFTA 2ZUFA 3R5TA 3DLJA 3LHKA 3GEBA 1S6OA 2J9FB 4CMKA 4PWDA 2LD4A 2NU7B 2WJVA 4TLEA 3PW2A 3AUFA 3JQ7A 3BA6A 2WAQD 1RRPA 4EUNA 3HTXA 4QOGA 5AI0A 3JSBA 3JTPA 4EPYA 1H23A 1A76A 1VQMS 2P9YA 3HJAA 4R69A 3TLEA 3AKDA 4BU0A 1A2OA 2E5LJ 5L3ZA 2IWRA 1N7GA 5AKLA 3HWX1 1RS0A 2RCYA 2XNQA 3VSCA 3WLJA 4WXEA 4CF7A 3F9IA 3NGRA 2WD7A 2XDWA 2X8JA 4FGUA 1YZNA 4USUA 5JJ5A 3C15A 3VX4A 1RHUA 5EDWA 1T9GS 4GM4A 3S68A 4LF5F 2VFAA 2A5YB 1QMPA 3GLRA 1WUYA 4XB1A 4DA6A 3WNCA 4WYWA 2PN6A 1JLGB 4EYHB 4H3VA 2FUG1 4HVLA 3OTOJ 1QCDA 1BOOA 1C7IA 4CM3A 4LF6F 3ORHA 4BKRA 4HDAA 1JIVA 4PSVA 5G1OA 2HQCA 2VKRA 4HMOA 3UNYA 2G0JA 2ADBA 4XA8A 2QRVB 1OI3A 4KODA 4KQGA 3RR8A 3ZNNA 1HI1A 3ZNJ1 1AK9A 1UADA 1RWVA 3H2HA 3NBUA 5A3VA 3A1SA 1QBKC 1NVDA 1L7BA 2DH6A 3H2YA 3WGGA 2IEBA 1KK2A 4N5DA 2H51B 1A7UA 2HIGA 4TLCA 4L28A 5GADU 4POAA 3SI7A 2C2GA 1EKRA 4TWIA 3EGDA 1RK8A 5J2MB 5D0HA 3DAOA 5JE8A 3D54A 4EYQA 2Q8QA 3VOSA 4PYOA 1XTRA 4MKFA 3NYRA 4RKRA 2GZ3A 3FOFC 2QAIA 5HOEA 3JYPA 4GDFA 1KTIA 1UP7A 2GAOA 1NVMB 1HWLA 3C1TA 2JFBA 5JD4A 4JNCA 3OTIA 5ALFA 4NBRA 3FDZA 4QDUA 3H9CA 1YBFA 3NRJA 2X6RA 5HP4A 4LN1A 1MABA 2YFQA 3VO8A 3PO5A 2VHVA 3R77A 4U02A 3DOEA 3ULHA 5I7UA 1AT1B 1I1QB 1C9JA 2MR6A 4QA9A 4CQMD 4YV7A 4G9GA 2ZVQX 4CI9A 1U3VA 4F3KA 4J94A 5A4AA 1RQNA 1KSFX 3UA4A 2X1BA 1SKSA 4NLTA 4NZYA 3MS2A 2NO1A 1ONBA 3N7UA 3NHAA 3PEUA 1ZICA 2RIRA 3MTJA 3VAZA 3F4KA 1H0KA 1GN9A 4XWKA 3TGPA 3I2IA 3MGKA 5IAOA 5GQSA 4QJVA 5HJ7A 3Q8SB 1JEQA 3G0CA 4OHFA 2ZB7A 2E49A 4AZ0A 5BN3B 5E4FA 4PSKA 1X0FA 5ICMA 4GKVA 5DYYA 5KFXA 1CUCA 5CLLA 4INZA 1LPNA 4UTGA 5GOZA 3RF7A 5C7YA 1JQLB 5CLFA 4V1Ak 1YHYA 1N3LA 3MF5A 4HR2A 4DNFA 4XK8C 1XVIA 4TLBA 1OKKA 2FJDB 2BDTA 2IYTA 1VMKA 5LUBA 1PQPA 1SUWA 5J63A 3G5MA 3MIZA 3BHJA 1FMFA 5K5EA 3VAMA 1ZX1A 4QJBA 4P81A 1SZPA 4DGQA 4QD3A 1ULHA 2YVAA 4ZD6A 1S02A 4P34A 1STOA 1I0ZA 3GIDA 1JA0A 4I4LA 4P2SA 2OMLA 3PUVA 5A0TA 3DTTA 4RVFA 4QYIB 1K1SA 1F1BB 4R7GA 3MOSA 4AN0A 1SH0A 2P2NA 4EJ0A 1BS2A 3KVVA 1GD1O 4KW7A 4D97A 3UGJA 5LXTB 2X40A 4CIVA 5KX5B 3H2KA 2UVDA 1OH8A 1C7QA 1RHKB 4YRGA 1NPYA 1B7GO 1ZNQO 2POKA 1C9DB 5AESA 3V4IB 3N2IA 3ROQA 2XVMA 5KFVA 4Z86A 1O89A 1FJ2A 1Z5OA 3MF4A 5BYRA 2B20A 4ZVMA 3PHGA 1IOVA 2W6MA 2D9OA 1MX3A 1PFQA 3DV0B 1F5SA 3VPGA 5A4DA 4MVCA 1YQHA 3DE1X 2OV3A 1DARA 2X77A 3OO0A 4HLNA 2GJKA 3DFKA 3IR6B 1Z34A 2B1GA 4RWXA 3REQA 3OZTA 5JJKA 4RJIA 4W5TA 1TGVA 2DRDA 3HEAA 3UPDA 2QRMA 2M70A 5K3AA 1SZCA 4XJXA 3JD2A 4KN8A 4S3MA 5AW2A 2PZGA 1E3MA 1U4OA 3LFTA 3D1LA 1UOPA 4B17A 4DMFA 4IDAA 4RQBA 3DRPB 2IYQA 4RVNA 5AJTA 4LMPA 1U1GA 2HMVA 4UAVA 3E9CA 2V7TA 2WRZA 1Q16A 2W2NP 2VDLB 2DTJA 4IUFA 2O06A 3CUUA 3I2YX 2PZEA 5ABPA 2JH3A 4OQLA 3MCAA 4RD4A 3RVSA 4KQEA 1HIYA 1S9HA 4KPUA 3Q86A 4LNUA 4YCMA 1NE2A 4DM3A 5L51A 3MZ0A 4GKKJ 1FD2A 2J76E 4TYBA 1U8WA 3PR5B 1HFEL 4Q01A 3BQ0A 4K0RA 4XI9A 1VE3A 3BD8A 1YKSA 2GAIA 3JXEA 3IBCB 4B75A 4CT4B 2EF0A 1D8YA 1WTAA 4MPJA 3N6XA 1CR0A 3V9PA 2C04A 5G0RB 3GNSA 3TA2A 1VL2A 3ZDEA 3NNNA 2CNWA 1YBTA 3ID6C 5C37A 1CUIA 3ND6A 3IE2A 3RSSA 2D7SA 1JDSA 2HK8A 3SYNA 4MWSA 1L1FA 4EQZA 2FE1A 2QGFB 4IDKB 4BLOA 1RT7B 3T9NA 1XTKA 3UY4A 3OHPA 2JIOA 1C2YA 3E8OA 1KYQA 1SB8A 4EI2A 1QE1A 2XYQA 3P0RA 4LR8A 3LYUA 2JJ2D 4X64F 3NM4A 2DP4E 3K53A 1YRHA 1BW9A 5HKBA 5DG7A 5IZ4A 1AO0A 3AOEA 1OTYA 1NVKA 5AVRA 4BLWA 3QPDA 3ILHA 4YASA 3L0YA 1GPUA 1VOTA 2QXYA 3OTCA 4R98A 3KUGA 4IJ6A 3IVMA 7REQA 3KHLA 5EUCA 2RH3A 4F7VA 3HZHA 4PKDB 4FYWB 3KLIB 3SSNA 1NQVA 4WT7A 1E1YA 4RU9A 3OFKA 1U99A 4G0OA 3RU2A 1PAUA 3STWA 1OYOA 1F2TA 1BX1A 2W7OA 1TZCA 1SH3A 4JV5J 5JMWA 3DVRX 4WJZA 1EX1A 3PNVA 1A9XB 1DBRA 1CS4B 1XRMA 4FN5A 2VAWA 3UC5A 4OGWA 1RACB 2WM3A 1L5NA 5JAQA 2QUKA 1U1DA 3QPVA 3RFUA 5IJ0A 1TV6A 1Q78A 5EMJA 3KEFA 1UC9A 4CLLA 3NW9A 1E6MA 2VF2A 5CEJA 1KJQA 1D07A 4YMEA 2YHBA 1I01A 2D1QA 3IJRA 4RPFA 3L7KA 4WKNA 4ED7A 4C1NA 4ZN6A 1USUA 1PTKA 4DV0F 2AOUA 1VE5A 3B9RA 4P6QA 4X62J 1C81A 1VPDA 5FEMA 1YZTA 1US8B 4B3RB 1XKTA 4GBJA 2JHCA 5DNAA 2PANA 1MO5A 3L1VA 3BXHA 2DRBA 4O4GA 1SV5B 2ZYGA 1OVMA 3C8ZA 2N1MA 3HB5X 1R89A 2AYXA 3S2GA 2RS2A 4Z4EA 1U7UA 3ZXWA 2FPIB 2FMUA 2WABA 3UT6A 2GCOA 1S77D 2DPGA 4L2IB 1U1IA 3D1OA 3LPCA 3HV0A 4DJTA 3S1AA 2XTNA 3M6IA 4DR7B 1SXJE 3NM5A 3TRGA 4KE6A 4I4BA 5KSWB 4EABA 4HB2A 5FPSA 1MO3A 3WL7A 3UMFA 2G4CA 4LGMA 1TCVA 2Y1RI 2YKPA 1E3WA 2YYZA 1ZOPA 2R5FA 3QPIA 1CY1A 5FFNA 5C7LO 3LX8A 2HF2A 1L8QA 1XVLA 3COJA 3I55S 4B71A 5IAKA 1YL6A 5DNVA 1CBUA 4HZUA 5EWMA 2G1UA 3UUFA 4B3IA 3K30A 3AFNA 1T4BA 2WWHA 1CEZA 1LWCA 5L45A 1EZ1A 3V9AA 3QKSA 2AG1A 3EVZA 3LC0A 2R9LA 1M5VC 1YE8A 4QEDA 1OPIA 3NRCA 2ZQZA 8ADHA 3L8FA 5ECYA 4NXMB 4PHTA 2W0SA 4UUWA 3PTAA 1UWBB 5G41A 2O4UX 1JFTA 4NJEB 3WY9A 1WEXA 1Q7EA 3TL6A 4YPOA 2XQJA 3QUCA 4J0JA 5L9NA 3CX7A 2IVFB 2ZB8A 4AZ3A 2Y67A 2O0HA 5KFZA 3DJYA 1CUSA 3NWPA 2V3CC 5EMMA 1RXCA 3MGJA 2Y76A 1OV4A 3O2JA 2W2QP 1Y8RA 3HXLA 4WK6A 1V11B 5JZ9A 4IQGA 4AL6A 4P7JA 3FSJX 3WLEA 1WU7A 2I1VB 3L05A 2ZQYA 4BKOA 1IKYA 2JASA 3B1KA 4BLPA 3TS1A 1CTQA 2LUOA 4FDLA 4ZEXA 4KMSA 2GGPB 1P4SA 1H9BA 3OJEA 2B61A 2I6FA 4L5BA 3ITDA 4P7KA 1FQWA 1V1RA 3E61A 3UJBA 2QR2A 5AK6A 1QGUB 1G0NA 1KIFA 2XMSA 3WNBA 2O57A 4U95A 4IH9A 1QQBA 3BMCA 3R7WA 2Q43A 2AMVA 4LZJA 2ZKTA 1CB0A 2HRUA 5T41A 1LS1A 1TM7E 1ORVA 4UDOA 5DE3A 3MTKA 3K05A 1JXLA 4O4RA 1HYBA 3EODA 3ZWKA 6YASA 3D8SA 3W5YA 2ZG6A 4WCFC 4MS1A 4E6EA 3KE8A 3TLGB 2H85A 3CURA 1W8IA 4P4UA 2V9PA 4WOCA 3RVKA 2MB0B 5CYMA 1BN6A 1RI4A 2HIQA 1XN4A 2XCQA 3OT1A 4WFIA 4CJXA 4E6PA 1JQDA 3KHHA 4RJTA 1AKNA 3IUJA 4JP3A 3V4MA 2HVDA 4I1IA 1TUGA 1KAOA 4ZZ1A 3C16B 1TKDA 3PVZA 4ITRC 1BX3A 1HBOA 4J1TC 3CTMA 2ZBVA 4X24A 5C1IA 1Q20A 4UFOA 2JPDA 1IDOA 2OD9A 1YA8A 3RAEC 5IFLA 2BGRA 4PLCA 3IS3A 4KU4A 3UA3A 1W1WA 4BQNA 4DAOA 3ZZZA 3PGLA 1F6TA 3I9V6 3DD1A 4QZVA 2P6NA 2LDYA 2LDBA 3WDOA 2DHHA 2P7IA 3IAS9 3REGA 4LHXA 3B7PA 4LRSB 4X0EA 1QPGA 3T1TA 1PT5A 3W3SA 2C2ZB 2VPYA 3BF4A 3MFIA 2W2MP 2NWQA 5A3RA 5REQB 4PCQA 4YB8A 3M6VA 4Z6KA 4TSRA 1VBYA 4P3YA 1EQUA 3KEMA 4WN3A 2UVUA 2W11A 5M2UA 3UUWA 1NYQA 4EKGA 1YVPA 3DZKA 1R8HA 2LGJA 4EWLA 1H73A 2C7BA 4HNAB 2E48A 2Q3BA 3ZE2B 2GTHA 1JR3A 1ZN7A 3DC7A 2RU3A 3NTQA 1W85B 4YMTA 3DOFA 2F6RA 3WK7A 2ZI7A 3KQNA 3AR5A 3GR1A 4C9DA 5GMOA 2REBA 5EJ6A 4LOIA 1A7AA 3GHYA 3BSOA 2V69A 3RG6A 4ED9A 2QE7D 3KT0A 2G0TA 4D45A 4XTTA 2PVPA 4LRBA 3IP3A 2W6ID 1VBMA 3VNVA 3C2QA 5DM2A 4P58A 5L95A 3K9BA 3F67A 3HDQA 1ZXXA 3DMHA 4PYKA 1YRUA 4OJHA 2XUHA 4EENA 1F20A 5HVFA 4QBHA 4NMMA 3RW9A 2PD4A 5G4KB 3WI7A 2BT4A 2PX4A 1L8AA 3NVMB 4CT5A 2CRLA 3DTVD 2U2FA 1URPA 5LWQA 2EKLA 4UJ5A 4C2BA 2FEXA 4X95A 1XOIA 2AX3A 3FCWA 3KLFA 4CDMA 2R6AA 2JEGA 1ZIPA 5L4SA 1LDEA 1DHTA 3H17A 1VFJA 3FMGA 2YNMA 3C45A 1JE0A 1PNRA 4I64A 1CR6A 4IFYA 4Y67A 1RCOB 3WQQA 2O8FB 2H5JA 1DDIA 1WMBA 3NBPA 4MP3A 2EV9A 3GJ6A 5SY4A 4RPIA 2MHCA 3S8MA 1KWKA 2PMWA 5SUHA 4YUYA 3BQNB 1UT8A 1R0CA 1X87A 1NVVR 1W87A 2OXTA 2O0JA 5F7XA 1HNXF 3JWIA 2ZI9A 2V9CA 1BJTA 2BFAA 4QELA 1VCNA 4NOJA 2FMHA 3ESYA 2C3PA 1U7TA 3U62A 3FB1A 5KQPA 3RYHB 4A8OA 3K9CA 4FW9A 2WZQA 1RABA 2JL1A 2ZOSA 4QIWD 3M6XA 5D4PA 4OVKA 3EZUA 3MJHA 1GHTA 2UZ1A 1Z0DA 4CG1A 2NU6B 1KP9A 2QUBA 3OJSA 4LYGA 4MUXA 5BXYA 5KFHA 3DW3X 2QTMA 1RJDA 3PNLA 4DV1B 3CULA 1GM5A 5F2OA 1U0OC 4RZ3A 5FV7A 1J25A 1M6EX 5KWEA 3LOPA 4TKTA 4PPZA 3KK2B 3KB2A 4E94A 3LE8A 1YUBA 2PRKA 1N5TA 4BV2A 1GPJA 4ZDKA 1H05A 1Z68A 1LFPA 3CR8A 2BDPA 1C3XA 4YONB 3VJRA 3BD9A 1ZZNA 3QJPA 2JH8A 2WLTA 4FDUA 3PYEA 2XTJA 3CUSA 1RISA 1N0IA 4QOSA 2WZCA 2BFFB 4F96A 2XTZA 2OYCA 2Y0SD 4LJSA 1RYMA 1QFMA 4QXMA 4CIBA 1WHXA 4RW8B 1VGYA 2OLJA 4H3HB 4FHZA 3O4RA 1UQRA 5FL7D 4F9FA 3DAPA 2J3LA 2BYCA 4BEJA 2C3UA 2KE5A 4YP5A 3MUMP 3E15A 3FPCA 4RY0A 3CSKA 3BYPA 2HSEA 5FLKA 1H2FA 2R7AA 1M2WA 2IYIA 2JLUA 3JW8A 3QH4A 1EWYA 3PWTA 2ZE2B 1MOPA 4I4IA 4ARSA 3M1VB 3EA5A 4GKJB 1UW4A 1PO6A 1RJFA 1CLUA 1BSVA 3EG9A 4NDAA 2RD5C 1NMEB 2B5VA 2WW8A 1KY4A 1E1CA 3U4QA 3IQIX 2P9TA 4YCBA 2ZYUX 2YZNA 1I13A 1I2MA 4JBXA 3ETGA 5J2UB 2I2WA 5I8WA 4PYJA 4KWTA 3IGFA 4KQ9A 3E3MA 3EVTA 4ZPXA 3SQOP 1K4KA 4WZBA 3BMNA 3QT5A 1POXA 2NV2B 4ETNA 1RT6B 4JJ7A 1KY3A 1YK1A 1DLJA 4KXXA 5EJ9A 4Y2IA 3I53A 4UTZA 2H0RA 4EBEA 3GVHA 5DM7Q 4CKEA 3S7TA 2B21A 1C5KA 1QHHA 1HEUA 2DH9A 5B1DA 3L7AA 2ZUDA 2J6BA 2L9WA 2VHTA 2BISA 3VPHA 3BBBA 2ZHBA 3W7VA 3DXFA 4UBJA 2H2HA 2LMIA 2BGUA 5TE9A 3FR7A 1QYRA 1E3LA 5B7PA 5ICSA 4JR2A 3MG9A 4KFUA 4PYRA 1XT6A 4I66A 3QAEA 4IKPA 2WU8A 4N8EA 3IKMB 4XDYA 1L3SA 4Z51A 4D8UA 2OP1A 1UXHA 4LY0A 4KO0A 1BYIA 2HHSA 1TQ6A 1FSFA 3OLVA 2LZ0A 1JXMA 3OA2A 3ANLA 2PGIA 1YMUA 2A0KA 2I55A 5JO9A 4OX9B 4DWJA 2E9ZA 2Y6VA 1NXXA 1VKZA 5GGYA 1J70A 2XY5A 3IDOA 1JXQA 3RHZA 3MCZA 1A0OA 2ZDQA 4TL9A 3ONFA 2JFZA 1R8QA 1V4VA 1DXQA 3HABA 2OGTA 1NQWA 2HJGA 1E2KA 3FAKA 4LTDA 4OI0A 4X8HA 5CRIA 1VR6A 4CO3A 4HAWA 4CKWB 3BO3A 4BFVA 3RU9A 3PKMA 1Z0UA 2B1RA 3VMMA 2Y66A 4KYTA 5KKCA 2Q99A 4C7KA 4Y8VA 1CIPA 4NC9A 4I1VA 2AD1A 2MMCA 3A4NA 3DTYA 4BDTA 1NM5A 4Q7MB 2HA4A 2YWKA 3CUTA 3LQ1A 5HOQA 1HMPA 2ZIXB 4A8TA 3AX6A 4O4JB 4PQUA 2GT1A 2QD5A 2WU4A 4F2DA 1XVTA 2CXQA 2II6A 2RHQB 3UM9A 1CUVA 1RHMB 1GQOA 4EHIA 2RD2A 3L5KA 4IIHA 3O1HB 2P9ZA 1UZUA 1C1DB 1RCTE 5CTJA 1S2NA 1N36F 3D6HB 3EIEA 4Z9XA 3M6MD 5EWGA 2E44A 4BNIA 2QN6A 4BUCA 4X1OA 1ZM9A 4HXFB 4M0LA 2QXUA 2HNKA 1QHFA 1OXMA 4KHPB 3OX4A 1NUTA 4A5SA 1U80A 2PKRA 1EK0A 3THYB 2GF9A 3Q85A 5FV4A 1HORA 2DHGA 2Y9MB 2GO8A 4ALLA 1E63A 3N2KA 1ML3A 3RR2A 3A8TA 4ZICA 3EM1A 4KE9A 4AUKA 2WK1A 5CA0A 5A0YB 3IL2A 2JLSA 3EC7A 1OR8A 5A1TA 2MJUA 3TLZA 3NP7A 3GYNA 2HS0A 4EUEA 5JY1A 1WZEA 2QJTA 3GCDA 1T9YA 1W2GA 2FW6A 3HPRA 3V3KA 3GTYX 2W9AA 3S70A 3LUGA 3WAGA 2OAGA 3NZEA 4XM2A 3C6BA 1C4WA 3WGLA 3N58A 3ZIAD 3P5TL 2VG7B 3ZKAA 3O0DA 4DG1A 4J37A 1PGQA 4ZCRA 3ESQA 1JSZA 5BR8B 4QT4A 2CJAA 1E6CA 2G88A 4R8MA 1YVUA 4N39A 3FPLA 1DZ3A 4YNBA 4ILLA 1KI4A 1Z6AA 2V6GA 1KH1A 1W5AA 4CMCA 4YQFA 4M98A 4CL2A 1XU7A 4NI5A 4FVMA 2BUNA 4FMDF 4HLDA 2IK8A 2FZGB 4HO1X 1SUQB 4F8JA 2R3VA 1Z4IA 3NAHA 1QJCA 1OYVA 5CYOA 3J80A 2NR0A 1FS4A 4XSVA 1N33B 4N9WA 2XUPA 5KOHA 3ZDBA 5LQDA 4U2DA 2X76A 1K8ZB 1I6WA 1DJLA 3BMOA 1BVHA 3JSYA 4P5EA 4BHQA 4CRWB 2FKNA 2W2TA 3LDAA 1X9WA 3O3LA 2NT4A 4LV8B 3L0DA 4UVGA 1UFOA 3H19A 3LP1A 3VUFA 1SXHA 3YASA 2YKNA 1SHTX 5JI2E 1HLWA 4WYLA 2CLMB 1KBRA 1VA5A 4YDSA 2A5FA 2YRFA 1A04A 5GONB 2IYOA 1UJ6A 3K72B 4WJKB 3KJGA 2V68A 4JJ6A 4BWGA 4II2A 4NBKA 3J80Y 4J03A 2XE8A 1HQEA 3SDEB 4MMYB 4BC0A 4YBRA 3EA4A 2G36A 3G6WA 4DUZJ 821PA 4BRZA 4DE5A 2YWJA 2Q1UA 4RM2A 5JJCA 2X1VA 1XQ9A 2DFNA 1U9IA 2MIIA 1RXWA 1VHDA 1LPAB 4ROSA 1UFKA 1ZHOA 1RTDB 4ZALA 4NI2A 2I5JA 3FPFA 2EJTA 2QTHA 2OFFA 1H5UA 1XRNA 4HQ0A 4YACA 4HQRA 3S29A 1F8XA 3T9AA 5IV3A 2KYZA 4LSNA 1EGHA 2MMYA 4BV9A 4FC6A 1EGMB 2XC9A 4CEJA 4A9AA 4ZKDA 1K92A 1XIVA 3P96A 1I94J 3TE6A 4E1VA 4DUYB 3MWLA 1QAQA 4DSFA 1ZINA 1MAVA 5ITZB 2QV7A 1YCDA 3I42A 3X2EA 4LBHA 1KQOA 3FNIA 4HN2A 4ZQHA 1RE1B 3WDMA 1D4ZA 3G9TA 4J7CA 2MQQA 2YWRA 3FI9A 3QKWA 3DZGA 2ZC3A 1C0TA 1RAHB 2ZH3A 2FA9A 2XECA 3QOFA 3TDKA 1WPRA 2J09A 4WGFA 3WG9A 2WWYA 2Z56A 1S4EA 4ZZ0A 2QE7A 4EYKA 1VZ3A 3QVWA 1ML4A 1T1RA 3TRHA 4DV6F 3Q8KA 1SG6A 4TKZA 2J6UA 3JATA 3ZQKA 4AXJA 3HCOA 1K88A 1LVUA 1XCOA 1J23A 2Y1XA 3WGNA 1G3IA 4F3MA 4BX0A 5G4DA 5FI5A 2FUKA 3H4VA 5DBIA 3QGGA 2QM3A 4CO5A 4C6SA 4IH5A 3TZWA 2RGXA 4XX0A 1YIAA 4CL3A 4FFNA 4TV8F 3Q40A 5LSRA 4QOHA 4L72A 1ZC3A 4QGSA 2F59A 1PNTA 3P8ZA 5EPUA 4J0EA 3IQWA 4REQB 1EUQA 5BW4A 4M89A 4CR6A 2C5FA 3GI1A 1ZM2A 3O9MA 4POOA 2AN4A 2CHGA 3GJ3A 4CLOB 3LAKA 5B2FA 2PAAA 3IUQA 4TWRA 4P6VF 2EG1A 1DBQA 4BLQA 3QOYA 3DN9A 2ZKIA 2EGGA 4FZ3A 5G1PA 1S1CA 4D9BA 3CMQA 2HJRA 1EEXB 1RZUA 5AUOB 2QPTA 4NBNA 2ZT7A 2V6FA 2V7QD 1JFSA 5EWJB 5CHCB 4Y9RA 1CJSA 3PR1A 4R3NA 1P0QA 3VUEA 1OZAA 1RLMA 4D1YA 2MQNA 3IP5A 1QC5B 1ETUA 3ASUA 4PGMA 3FSRA 4UOGA 5J2TB 3W5JA 2FG7C 2Y8EA 4EJFA 4X1IA 2V4UA 1PJCA 4EY7A 1EDDA 4NA3A 3WISA 4M83A 3PWSA 4AMBA 3N6RA 5K14B 4I6AA 2LA4A 4BE4A 2EJCA 2AN9A 2IYVA 3WWEA 1X15A 1FLVA 2EG2A 3M4YA 3DLHA 4DR1B 1BQ4A 1BVYF 3CA8A 3H2VE 1IOZA 1XR6A 4A16A 2EATA 3D54D 1BYUA 3E2PA 4UHBA 4DLTA 4ZOLB 4ZJOA 2ZIGA 4IQ8A 4JI2J 3C3DA 4P3KA 2IDEA 4DDKA 5KQMA 2FGKA 3U60B 3LNCA 3K32A 3REOA 2XMQA 1UR5A 3EXAA 2W2LD 1LBHA 1CUGA 2Q6TA 1KDZA 4NEQA 2GK7A 3OM0A 3M2UB 1KMIY 5ESRA 3I9JA 4FVTA 1X7YA 4CGZA 3I31A 4D2IA 1Z2NX 4WK0B 2RI1A 5EIWA 5ETKA 3QELA 2Z43A 2XWQA 1K3UB 5B6PA 5CVDA 1VC6A 4PLFA 1X70A 1U02A 5JS1A 4RNDB 1EFVA 3KWFA 5KINB 1JMKC 3L1JA 3B6MA 4UMDA 2R96A 4P4GA 3DRSB 2NXCA 4KFTA 2V7UA 3UMBA 3RQIA 5FUXA 3K3PA 3BB4A 2J3QA 2F7VA 3RBZA 1P1CA 4J9NA 3EAFA 3C3EA 3A1UA 3FTDA 1RAIB 2G2OA 5CDFA 3GP3A 1ADJA 2OXIA 3L0SA 5ISMA 1TK9A 4EVRA 4Q03A 3RC9A 3ILJA 3E51A 3N8KA 1F8GA 4TYMA 3A1FA 5AUPB 4YMGA 2NPOA 1UCNA 1ZU5A 3UTCA 2VDOB 1KU0A 3DWEX 4N4AA 4NX2A 2DFLA 5HMWA 4WKYA 2DGOA 1E69A 1PGJA 1KAGA 4YOEA 2KX7A 2YPZA 1U6JA 1JLLA 3SLGA 3F6PA 1G5HA 3LU1A 4DJJA 2BEKA 1OKKD 4D3GA 2IVYA 3KUUA 5KJ6A 4RBNA 3RBVA 3A1EA 4TWZA 1NX9A 1S3GA 4KR6A 1V45E 5AICA 4ZVOA 4JI3J 4YMIA 1QM5A 4TTQA 3ICWA 1F2HA 2O2DA 5K2MA 1E9FA 4X2BA 1KYVA 2ZJFA 4HDSA 3UAWA 1RPZA 1NI4B 3ACCA 1T36B 3BXGA 5HKLA 4YP6A 2VT3A 1FUYB 3AW9A 4P9NA 3IGVA 3V4ZA 4EZBA 1REQB 4JSRA 2Q5CA 4R2MA 2J07A 5KT6A 3OJLA 1EFHA 3N7TA 2XSJA 4DN9A 5KFDA 3Q8WA 4GXTA 2AW3A 3GJXC 4OCZA 4ZJUA 1XXLA 2A1IA 1QH8A 2X14A 2BQUA 1R4MA 3C5VA 3KELA 4MH0R 2A57A 4DV2J 2NTYC 4YK7A 5FO1A 4D42A 4D9IA 5BT8A 2JBAB 1MTOA 3MFYA 1KZ9A 2E6UX 4TMFA 4TQRA 4KO3S 1S0VA 4PAQA 2LBPA 2NSCA 2V3WA 4IUYA 3BJZA 4FPRA 4RW6A 1KE1A 1UPCA 2GF2A 1S5ZA 2Q6LA 1PX2A 1GPYA 1CQJB 2YJ6A 4OFZA 2ET6A 3G89A 2YHSA 4DVJA 4PC2A 3R97A 2IZ6A 1V48A 3KJQB 3H04A 4GP9A 1OMSA 2RC5A 4E5NA 3FUCA 1B0AA 5CB8A 3G82B 4ILMA 3M5CA 3DAFA 3K8ZA 4W5OA 3EG5A 4YP0A 4H9GA 1E3QA 4RU2A 4O8CA 4IFEA 5M29A 3PHCA 1G1AA 4LXHA 2WWXA 1NF9A 2HBZB 1KDVA 3QIPA 1X7XB 5LA6A 1G1XA 1M2OA 1WSDA 4WEOA 4IGIA 4ID5B 1TMOA 2NSLA 2PEZA 2PQMA 1QV7A 2IBKA 3FPKA 1ZAKA 1M5SA 4C6AA 2JJQA 1D8AA 2E5IA 1P9OA 1JYEA 4BX9A 2SKCA 3P9KA 2O8DB 3O83A 3GVCA 5HVGA 5ICCA 1R10A 2W24A 5ESDA 4ZP1A 4NBWA 2XVXA 1VIOA 3HRIA 2FVSA 3V42A 3FJ2A 3EBPA 1JLBB 1UH5A 1S9EA 2IUEA 2I91A 3WTBA 1N6NA 3RT7A 3DOMB 5H3CA 1WUHS 3HFVA 3SDSA 5EGNA 3O74A 3TTXA 5JBQA 1JDZA 3N8IA 2F4VJ 1J6UA 2P4UA 1YD7A 3K1ZA 1A9NB 3BHIA 4R4JA 1H98A 2CNWD 3IRVA 1NLKL 2HT6A 4DNQA 4XM1A 3R44A 3QEMB 3CDAA 2CMFA 4GWGA 4WFZA 2XB6A 2HK7A 1W25A 3KP1A 2R2RA 2G5GX 1Y3JA 2C83A 3FZGA 1SOMA 2GZ1A 3P3DA 1FSSA 2OV1A 3PUHA 1EAYC 1E2IA 1O1YA 4MYCA 1XNHA 2C2BA 2Q6CA 1H6CA 4OI3A 3WS7A 1XQXA 4YXFA 5TF4A 3BH0A 3BE5A 4OB6A 4LF7F 4ZOBA 4NXNF 3BIWA 3AYZB 1FRQA 3SC6A 4AQYJ 1M2VA 1SQSA 4FWBA 3WRXC 2FPGB 3SVLA 1QGED 3T4PA 2L48A 3CDWA 1GUZA 3OF2A 3FGNA 1CZNA 4DV4F 2HTEA 5ALOA 3W2WB 2L2QA 5IDWA 4HLCA 3ELYA 4QO7A 3GN2A 4X90A 1JAHA 6REQA 5ALPA 2O7SA 4NZOA 1JI0A 2HPHA 3O7MA 3HVRA 4AC9A 1VQ4S 2WMOB 2AYYA 5EMKA 1Z07A 3ET5A 2B2NA 3R3SA 3R3WA 1PBAA 1BRTA 4FYJA 1K66A 3AVXA 5TPWA 3KYLA 1HDEA 1SAYA 4RTKA 5EKTA 4KFRA 1YF3A 5BSKA 2Z3VA 3OIUA 3FOAA 4KWCA 5B64A 1F51E 4LZLA 5HK8A 3CZCA 3RQSA 9RUBA 5J9FA 4RZIA 5EHZA 1SVNA 1FW6A 4DA7A 4DCSA 4GO1A 5BQXA 4R25A 1RP5A 1JLSA 2O7NA 4OYLA 2CMKA 2MZQA 3I83A 3NFRA 1ZNZA 2ECPA 4RWZA 5CFPA 2LU2A 1XWWA 1XPOA 2DXFA 2W01A 1SPXA 2WTFA 1CUWA 5CTAA 1ZESA 3BMQA 3WWPA 3A3YA 5JMNA 4OX7A 3T9FA 4HNRA 1B8UA 5C42A 2LV8A 4F8YA 1I9CA