2E1PA

Crystal structure of pro-tk-subtilisin
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
395
structure length
395
Chain Sequence
b'NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Crystal structure of unautoprocessed precursor of subtilisin from a hyperthermophilic archaeon: evidence for Ca2+-induced folding
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 131
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2e1pA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2e1pA02
1SIBE 3DW1X 4M1ZA 1NLUA 2Z30A 4H6XA 5AMXA 4HX2A 3T41A 1BH6A 2Z30B 2XRMA 1SVNA 1SIOA 3GCXP 1Y33E 1Y3FE 1BE8A 4DWWA 2Z2ZA 5JXIA 3CNQS 1GT91 2Z2YA 3PRKE 3DE2X 2Z2YB 1SCAA 3QTLA 1THMA 2HD4A 4RYDA 3F49S 3VHQA 1OYVA 4H6VA 3DDZX 2ZRQA 1TECE 2Z2XA 1SPBS 2XTJA 1SUPA 1SCNE 3D9QX 4KPGA 4BWGA 3BGOP 4LVNA 1EGQA 1GA1A 4DJ5X 1C9JA 1JEAA 1PTKA 4CFZA 3VSBA 5CW1A 1Y1KE 1SUBA 3AFGA 1WVMA 3A3PA 3A3PB 1KDYA 1GA4A 3DE3X 3AJ9A 1WMEA 1GCIA 3VV3A 1SBNE 4OV6B 1ITPA 4MZDA 2DUJA 1IAVA 1SCBA 3I2YX 3F7MA 3DVSX 1WSDA 1CNMA 3ZXYA 4WOCA 4KB5A 2W2QP 1HT3A 1KE1A 1OYOA 1GTL1 1Y4DE 2PKCA 1SBIA 3I34X 1AK9A 4AKTA 3VYVA 3UNXA 3DE1X 3H42A 2P4EA 3EE6A 2X8JA 2W2MA 2WUVA 3H42B 3WQBA 1VSBA 2X8JB 3SQOA 1MEEA 4DZTA 2SNIE 1DBIA 1EA7A 4C3VA 2ZWPA 2W2NP 3P5BP 1TO1E 1AH2A 5I9SA 3LPCA 1TO2E 2Z58A 1C9MA 3TECE 2Z58B 3DWEX 3DW3X 2DQKA 3CNQP 4KG7A 5FFNA 3QMPA 3GCXA 3DE6X 1Y9ZA 1T1EA 4CG0A 1DUIA 1SCJA 3LPDA 2W2OA 1SCJB 2ID4A 3QFHA 1P7WA 1LW6E 3PTLA 1PEKE 2ID8A 1KE2A 1UBNA 1SH7A 1AF4A 4H6WA 1SCDA 1SPBP 2SECE 1WMFA 4Z2AA 2GKOA 3TI7A 2PWBA 1R64A 1PJ8A 3WIUA 1R6VA 1IC6A 3GCWA 5AVJA 1BJRE 2SBTA 2XTJP 4NE7A 1GTJ1 3I37X 1KDZA 4CFYA 2G4VA 1SUCA 1WMDA 5FBZA 4C3UA 2WUWE 1S01A 4OV6A 4JP8A 1BFKA 1T1IA 4YN3A 4LVOA 3Q5GA 1TK2A 4YN3B 5JXGA 1TM7E 2DP4E 3DYBA 1GTG1 2TECE 3CO0S 1Y4AE 1KDVA 3BPSP 1TM3E 1V6CA 2B6NA 1TMGE 1YJCA 5AQEA 4NE9A 2V8BA 3LXUX 4J94A 5B1EA 3DE5X 3BX1A 2E1PA 4HVLA 1MPTA 1GNVA 1AV7A 1T1GA 1NDQA 2Z57A 2W2PA 2PYZA 2Z57B 1S02A 5SICE 1SELA 3DVRX 3SQOP 3EIFA 1GA6A 2WWTA 5JXHA 3A3OB 1SBCA 1SBHA 1PFGA 3D43A 3GT3A 1YU6A 5JXJA 3TI9A 1YJAA 1AQNA 1C9NA 1Y34E 1Q5PA 3LPAA 3ZXXA 1NDUA 1R0RE 2ZWOA 1ZVKA 1TM5E 4WOBA 1SIUA 1A2QA 4AKSA 1XF1A 2W2OP 4K8RA 1SUAA 1GNSA 4K8RB 1ST2A 1CSEE 1P8JA 1Y3DE 4OMDA 3WIVA 1C3LA 1ST3A 3DE4X 1V5IA 3VTAA 2HPZA 4OMCA 1V5IB 3A3NA 3Q40A 3A3NB 2QTWA 4NE9C 2QTWB 4NMXA 5ARBA 3DE0X 1TM1E 4NMXB 3GCWP 1SUEA 1S2NA 2Z56A 3L1KA 3HJRA 2ST1A 4FONA 2Z56B 3DE7X 5ARDA 1BE6A 1SN7A 3BGOS 2IXTA 2PQ2A 1ZVJA 3WHIA 4ZARA 2WV7A 3CO0P 2PRKA 2PWAA 2PMWA 1OT5A 1SUDA 2PMWB 1AVTA 5FAXA 3VV2A 2IY9A 3AJ8A 4ZOQI 3VV2B 3BPSA 3OSZA 1TM4E 5K7SA 2W2QA 3F7OA 3SICE 1AU9A 1SBTA 5JMOA 5B1DA 1P7VA 5AVKA 2W2MP 5ARCA 3DVQX 1Y3BE 1Y3CE 3GT4A 4GI3A 4I0WB 3A3OA 2W2NA 1Y48E 2W2PP 3P5BA 1BFUA 3I30X 3EDYA 4B5LA 2SICE 1YJBA
chains in the Genus database with same CATH superfamily
4BNYA 3BB1A 1WXIA 4HX2A 3O3MB 1V5GA 3AOGA 1Z4LA 4AL7A 3VU3A 1B16A 4PWDA 2OXIA 1T2EA 1YBVA 4FS3A 4FC7A 4BEBA 3BTSA 5MN4A 3X1YA 5M2UA 4MB0A 4TT3A 1THGA 2I34A 5KPJA 1E2MA 4EFKA 5I45A 2DHAA 3P0RA 3LRPA 2GD6A 4LF5J 1P81A 4PGGA 3RYIB 4PUOB 5DGHA 1XLTC 3CCJS 2QTZA 2I55A 3ONDA 5LQKA 3AJEA 1IWPB 3PQFA 3JSRA 2G72A 4NG5A 1Q8LA 3BD6A 2YKGA 1U3CA 3BZBA 4WUVA 2VUGA 1YQTA 3IELA 1JXAA 4LE2A 3G2JA 1AXRA 1SHUX 2CBZA 4DDKA 2Z4SA 3U1TA 3MC1A 3KE8A 3DEZA 2D9PA 1SBRA 1UCFA 5KREA 3F8WA 5KFQA 1TAQA 4NXMJ 4EHLA 5KTQA 4C20A 4HBZA 2HEGA 1I3KA 1FUKA 1Q83A 4Z4HA 4DB2A 2FQYA 1IUNA 5ILGA 4YMTA 2HLDD 3ICQB 2DD8S 1Q5VA 4J90A 1JR3A 1GSOA 5J4YA 2PZAA 1DL5A 4U00A 3LDGA 3HEAA 2ZYIA 2EWVA 3IMKA 2YZ7A 3PNQA 2VQEF 3HHKA 3PJXA 1EAYA 1G3OA 3OU6A 5DNCA 1DIRA 5A5VA 1GV0A 3V8VA 3EZ5A 4OIMA 3B3AA 4QTYA 4KKXB 5KINB 4MVJA 3MM5B 1NK7A 3H13A 4DPMA 3D8NA 3HJHA 5EXSA 4DV6B 3K9FC 3AQ4A 1JFVA 2BUCA 2AWNA 4MV1A 4RORA 2R7UA 3GO4A 4Q6WA 1E9CA 2G2ZA 3TRHA 3VRHA 5JSKA 1R5NA 3ABQB 1ZJ4A 2Q41A 4I9HA 1S6YA 4O5AA 1KEWA 5AVJA 3I4FA 4HADA 3KD2A 1QUEA 2Q2QA 4RK5A 3Q3IA 3KOAA 1X2EA 4C04A 3M8PA 1BX1A 1R50A 1SXJA 1SHZA 4IMPA 4C3UA 2IGTA 5EINA 4QUKA 4UUBA 3D3WA 1K75A 3L07A 3ZHQA 1P44A 3N6NA 2P68A 2P2GA 3TUPA 3AEKA 3DNFA 4C8OA 1BYUA 4ELTA 1W8IA 2XZTA 1ZK0A 2E18A 1UR5A 2IA0A 4GKKF 1EK2A 1QE3A 4P2MA 3C8MA 5JZOA 5IZCA 3WWZA 4BNKA 1NDQA 1QLJA 4C03A 2R8ZA 4FNGA 4WJLA 4BAUA 1JK9B 3H0CA 3KALA 4EBDA 4KO4S 2F3PA 5CYJA 4GX1A 3QEOA 1OYDA 2KM1A 2F7SA 3K4PA 1I0ZA 4V0MA 1OBFO 2QI9C 1SG0A 2AN3A 3I8OA 4TMVA 2WVEA 4B74A 1TEVA 3GDFA 4KBFA 4IJKA 1OZAA 3WK7A 5LL6P 1SI9A 5JPCA 3O2NA 1GDDA 3U19A 4WFNQ 4V3BA 4P98A 1P8JA 3S2FA 4BMNA 2ZCUA 2IHBA 2CEKA 4V1CB 4JVNA 1WQ1R 1PT6A 1IVNA 4G65A 1NN1A 2QT0A 2ALJA 1MVNA 3RS3A 1OJLA 2IYEA 3E8SA 3UCFA 4KGXA 1S1XB 4HDSA 4KEAA 4F93B 1R4MB 5F12A 3RUHA 1RQ7A 4BB5A 2NUBA 1D1QA 2D7JA 2JAPA 4F0KA 1P3JA 5KX5A 2A0WA 5IM5A 3QE9Y 1CQJB 1W36D 3UMSA 3G79A 3MQ4A 1WY5A 2G1UA 1GG2A 4KQCA 4G9EA 3NCPA 4K26A 3LX4A 4KXNA 4TTIA 1N4AA 5LLTA 4KPYA 2B8EA 4KXMA 1UBJS 5LSLA 1ZJYA 3IDFA 2FPKA 3F5DA 2R7RA 4W8OA 1CRQA 5AW6A 3DEFA 4RS4A 3NHSA 4ARCA 2DH9A 1JJ7A 4KFUA 4C7OB 5LDDC 5LZ5A 3SCKE 4LBPA 2PUFA 3HJUA 4EI7A 3NBKA 1NK6A 3CCMS 2KI5A 4PLHA 4JI8F 1L7EA 3I76A 2HW3A 4IEIA 3FBFA 3X0DA 4C8KA 4LS3A 4W92B 3OICA 1Z7YA 2BE9A 3ET6A 4JKYA 4D80A 4UHFA 3B7PA 2XKAA 2JGJA 2QQFA 3OC6A 1H0KA 2W6JA 2WTBA 2O3RA 1CJKB 1I3MA 3V8NA 3OV7A 3TZCA 3OTOB 1ZLXA 3GJRA 1ZU4A 5C37A 5KFKA 5AXDA 2QTNA 3IGNA 3MZ0A 3V4VB 4RWWA 3ZGZA 2C20A 4JGGA 4A8YA 2POCA 3FZGA 1Y5NB 3T1YF 1NVVQ 4X60A 4XPIB 2V6JA 3H05A 3W7VA 1AKVA 2YHSA 2R6JA 2C8VA 4AY6A 3T0GA 2XUQA 3HKBB 3VR5D 3GRUA 3R3XA 3HFSA 1HHTP 4IDBA 3TANA 4US2R 4HEJA 1KQKA 2NR0A 3PI6A 1O6ZA 1F9AA 2RDJA 4RSGA 3R41A 3AUFA 5FIUA 1N2CB 4ED8A 1GH8A 1Q0LA 4I50B 4BBZA 3MTJA 1QGUB 4MV7A 1XD2B 1VBXA 4PYAA 3JAMU 1XEWX 2OHGA 1E6MA 5IQQA 3HXQA 4AZ0A 3FJ1A 4MUXA 3TZXA 2V8HA 4BV2A 2D7DA 2ZJ0A 1XCLA 5BV7A 4QOIA 2IDJA 4I36A 1G59A 3DW3X 4BO7A 1BN7A 3S40A 2EDAA 3K31A 4M7WA 1JLLB 2P9ZA 5JXWA 2NG1A 3RU0A 1O94A 1ZNQO 2FOIA 1YI8A 4IAOA 3C8UA 4XR4A 4USHA 2QA2A 4ZVNA 4WCFA 4H6WA 1PEYA 2G4CA 1QG2A 2HC9A 1YSJA 1DC8A 2XITA 2PUCA 3VPCA 1FLDA 2MDTA 4NXNJ 1AB5A 1AZWA 2NTNA 5E38A 4KQHA 3IV6A 2L3MA 4OYXA 3N0VA 4D4MA 4LK2A 3FVQA 2ZH4A 1NONA 1S49A 1RHJA 1P9QC 1UBEA 2MLYA 3LX5A 1HMYA 2E2WA 4Q4HB 4NRUA 3SM3A 1JQLB 1WEZA 2PH1A 3J7YU 2GCGA 4BFWA 4MIBA 2HMYB 4G5SA 4UDYX 2HLTA 3HP6A 1V8PA 5EJ9A 1WEXA 1VJTA 1YJ8A 3MMSA 3HMJG 5TMDA 4YJ2A 4BMDA 1XNGA 3E27A 3OZVA 3LNCA 2VC0A 2DUUA 5FI0B 3C3KA 3ROPA 5C32A 2FAXA 3O8BA 5JAHA 1SURA 1JQGA 2ZB3A 1KNZA 5TDHA 3WXBA 1KK3A 3S2EA 1KOJA 4BKOA 1DRUA 4EBBA 1HETA 4N03A 4LCJA 3IB6A 4F4ZA 2YWKA 3QPAA 1PL7A 2EI5A 2ASLA 3S28A 1R8BA 2DTDA 2VCEA 5D4LA 4S1OA 1H0RA 2PANA 4W5WA 1L8AA 1TIPA 3BEDA 1F0KA 1JIUA 2ZE5A 3ZZYA 1YQQA 1GILA 5E1BA 4MXDA 1UKYA 3UKDA 2PI4A 4LC1A 3FNQA 3EPKA 3RW6A 1FSPA 1KU6A 3CN7A 1UBOS 2Z8XA 4WMLA 3PSAA 3V4FA 1X7YB 1U0FA 3MS7A 4XWWA 2QV7A 5AW3A 3SDEB 1W19A 4AMUA 3NWRA 4BO5A 3JU3A 3DXSX 2MZTA 1IRXA 1YB1A 1E5DA 1T36B 4WBNB 1XJ0A 3I05A 1DRVA 1MTZA 1UBRS 5EXXA 5EE0A 1H1LB 4PPZA 1THZA 1HLPA 2YMLA 5A4IS 1MOPA 4IDNA 1IOLA 3K92A 3NDRA 2Y0BB 2X22A 4GM0A 2ZH7A 1B6RA 3EUEA 3UWSA 2R7SA 3CMQA 1L3CA 3EEIA 4WVFA 2UUCB 3C2QA 4GVBA 4Q15A 4KC5A 8LDHA 4DIDA 4DARA 5DTQA 4OZNA 4JJ8A 5B1DA 3L7JA 2ZSIA 2QUJA 5I4MA 4UM5A 2EDCA 1ULTA 3FVWA 1T2UA 2F62A 1TE2A 4YRQA 5K9ZA 1RMYA 3H5SA 1R88A 1G5QA 1IJEA 5KYGA 4LOLA 1D1TA 3RSGA 4Y2KA 4HSGA 2SHKA 2RVJA 5GOZA 4NV0A 2JKVA 4JBWA 1NKSA 5TNXA 2ZYVX 1OFTA 3EGWB 2IIHA 1B0TA 1KQNA 2CD9A 2R84A 4HH3C 4RPCA 1CUJA 3KK0A 1LBQA 2W7TA 1W52X 4RAQA 3CUYA 5TB5A 2GCFA 2QLXA 4H1TA 4QJ4A 7FD1A 3K9BA 1X2BA 4ZT2A 3N86A 1USKA 5EPUA 4OI3A 3OOWA 4P31A 2WONA 3DI6A 2E1MC 4AB1A 5AK6A 4KTVE 5CD9A 2ZBUA 1CQNA 4OQYA 1Z5NA 4M0EA 1P18A 4BMVA 1FUEA 1W26A 3QBDA 5EZSA 3EDMA 4IUBS 3IWNC 4OZ1A 3D0HE 9MHTA 3IRVA 4LBZA 2UUTA 1GPUA 4F2PA 2AX1A 2JS7A 4LF8F 4USIA 1ECFA 5F1OA 5ILQA 4C2AA 4D9EA 1E1CA 4E4RA 3UW1A 1PT5A 3G6YA 4ER0A 4HLNA 4AKGA 4RLSA 1ZIPA 2AZ1A 1KEKA 2RHOA 3INTA 3MJEA 2A9QA 4P75A 4TZKA 2J5RA 2B0JA 1AMUA 3ER9A 1V9LA 2NTVA 3SQOA 5A4DA 3QJGA 3FSXA 2HPUA 2KHZA 3VOAA 2P65A 5D87A 2UVPA 5ETLA 2OFFA 5FULA 1EUDB 4LISA 2VG8A 3SD7A 2PKQO 3QJ5A 1KMHA 4YB7A 4REQA 5T4BA 3FYUB 1GGFA 1IFXA 5L40A 4BDPA 1T1EA 2C92A 3LDUA 3ZHOA 1Q77A 4F3TA 5KBYA 1R74A 4DJAA 5A76A 3PC7A 2A9RA 2GKSA 1KPHA 5LFAA 3ZY3A 2RC6A 1I8TA 2N3ZA 4DR5F 2BFCB 4PHTA 3DCYA 2V7TA 4HCJA 4EHHA 4RTOA 2V9CA 2O8NA 2I7VA 4CKEB 3TUZC 1WUIS 4EHFA 2J9FB 4HNSA 4C0AC 3CUWA 2G6BA 1UBHS 2QZPA 4JI7J 3E7WA 4CRJA 3UK1A 3ZDXB 1V6HA 1Z9BA 4DUYB 1G4HA 2CE2X 2N75A 4OYMA 3O74A 2PL3A 1J97A 1FMCA 2P7HA 5MFZA 5E9AA 2ZJPQ 1Q8KA 1ZH5A 1Q1AA 4ZPTR 2PO4A 4IIUA 1EVYA 1H2RS 4L4ZA 4IDKB 5IG2A 3ZE1B 3RBAA 2G36A 3PUXA 3DDCA 3LZDA 4CHTA 1FRIA 1E1MA 2XYQA 3RQSA 4KSYA 3RUCA 2BH2A 2ABWA 3UXYA 3VTFA 1RYDA 4TSFA 4H7IA 2XGJA 5JVDF 3USZA 4G4GA 2RQ4A 5K14A 2MZQA 2I1VB 5KNDH 2C78A 3P52A 4Q02A 4ZHQF 1JP7A 2XCAA 2ZDPA 3M30A 1AQNA 1XJQA 4D25A 1RTTA 4WZAE 4D02A 1H22A 5FNVB 2WF8A 1RWVA 3VTZA 3PC3A 1MAAA 4QJVA 1QRDA 1LI5A 4DM7A 2Z5GA 2FVSA 5F77A 2YPYA 2DKOB 2P9HA 1PJCA 4IINA 3VVCA 4NE2A 3M1LA 4MK8A 5EIOA 3ZZMA 4JA2A 3U4HA 3EXHB 3UWDA 2VV5A 4LDJA 3CJKA 1PJ7A 3BQ1A 1U7XA 2AWOA 3DO5A 1NN0A 5IBPA 2GZMA 3U4MA 1UDAA 4DL2A 5ARDA 1BYIA 3MMAB 3NXZA 1WDKA 3WO1A 4KLNA 2Z3ZA 2AOTB 2QX7A 5BWMA 3W5AA 4UUPA 1AZSB 2YQ3A 3G2PA 3P3DA 3GMGA 5A8WB 4HXFB 1OKKA 2UZAA 4MK9A 1ZGBA 3R6TA 1KBOA 1XMVA 2CHVA 5BOSB 5L3SB 2NREA 1RWKA 2YOGA 1T2CA 3ZVKA 4B09A 2GEVA 3NEPX 1RVDA 4U6PA 5ECGC 1MB2A 5G0TA 8OHMA 5JOQA 1K5PA 2V6BA 2ZR8A 1AF7A 4Y0NA 1Q6ZA 2UZ4A 1GMWD 1QD1A 1XCGB 3SV4A 2LCWA 1Y3BE 5DHQA 4EQ6A 5CDHA 3KKMA 3BH7B 3NY0A 4ENOA 2LECA 1E1NA 2NTJA 2AYMA 1H85A 4P22A 2CUYA 1TZBA 4GBJA 1CUCA 2R9LA 3QMVA 4GYYA 4WL0A 3HB7A 3JRXA 1FD2A 3EVNA 4PFKA 2PJDA 1M8FA 2XQJA 2C59A 2JEIA 2CNLA 1C9YA 5IXUA 2I2YA 2NQ2C 2H7CA 1S8AA 3FPFA 2ZQZA 4MVJF 1CLFA 2RIJA 3B5EA 4DR1F 3F49S 4CM3A 3BXXA 4LECA 2HCFA 4IDDA 3DDZX 4YJGA 1YWXA 1HD0A 5FH9A 1BMQB 4JYBA 4P2FA 1RAIA 4KLCA 3FGVA 3AI2A 4D9IA 3HFRA 5KFOA 1CKEA 1U24A 5U4QA 2RE1A 3RR7A 1Y4UA 1WP4A 2WJYA 2IPMA 2GCEA 3H4TA 4Y1EA 2J3KA 4GR4A 4USJC 2XOKA 4ZYXA 3KQHA 2W0MA 4CO2A 3LC1O 2HL6A 3DLEA 1T9HA 2AYYA 1YVDA 1NKEA 4DJDC 5F3ZA 2YMMA 3KG2A 4OI2A 3LRXA 3M2TA 3RFCA 3M33A 5DG7A 4P54A 1YL7A 1OXBB 1VIAA 3T1OA 3TE6A 3ILHA 4YDRA 3Q23A 4EQZA 1S8NA 4NCBA 3QXSA 3AX6A 1SU7A 1E0SA 2NNLD 4CDRA 1CC7A 3IPLA 4Z37A 2C8JA 5F8GA 4MVJM 5EZYF 2BISA 1U9IC 3GJSB 3NHMA 3MAHA 4WY5A 1GUZA 2VWQA 2J3EA 3SEFA 3SX0A 1QX3A 5IYZB 1I7LA 2HFJA 5DCLA 3D2LA 3GROA 3ORHA 1RYZA 2Q8PA 3UJ3X 2C0CA 3QG5A 1RRVA 4KLZA 5LOQA 3QATA 5FEMA 1FWKA 4IDGA 4K6KA 3H9JA 2ERCA 2IH5A 1OSCA 4JJAA 2V7QA 3HZOA 4LJ7A 1MJ5A 2PWBA 2QD4A 3C45A 2P4UA 2PL1A 1DAXA 2P75A 4KSEB 3H5IA 4OI6A 5IZHA 1T5IA 3CKMA 2I2XB 1DZIA 2JGNA 4ZO8A 3PD1A 5IUJC 1WDWB 4F85A 2NSBA 2AH5A 2N82B 4XQCA 3KHRA 2NZ2A 5EYPA 4BXOB 1B3TA 5I9IA 5IN4A 1T4CA 3SQDA 3ZHYA 3TIFA 4PZLA 1WCXA 2BBOA 4G5HA 2B5JB 1L5QA 3QF7A 2PX0A 1DFIA 3U02A 4A8XA 5KX5F 1Q79A 3RNLA 3PE6A 1IL0A 1U8YA 1NW3A 4L8VA 5EXPA 2D3UA 4E3ZA 2JFOA 4E5PA 2H06A 3DF7A 3MIIA 1EQMA 1CY6A 4GPD1 3UA3A 3HADA 5DGDA 2SKCA 4S04A 2OSBA 1QDEA 1QOQB 1TT5B 3ETOA 4XLLA 4P0PB 4NFSA 3DD5A 2MXYA 3GBSA 1CY8A 2ZH6A 4MJ3A 3OTHA 2FPGB 2OZLB 4UY85 3CCWA 2H9ZA 2ODEA 4RNNA 1SVOA 1Y34E 2OKCA 2WT8A 1F60B 3ZXXA 3E3LA 2F3QA 1MW8X 4TYYA 4MKZA 3WE7A 4B3IA 2YYZA 3Q8VA 5JNLA 3QPWA 4CW7A 5EHGA 4B3TB 2X0JA 3PUJA 2UUCJ 4LI0A 4AFNA 2PGAA 1ML3A 4Y34A 1DRJA 2WFLB 4NBNA 3FSYA 3PFBA 3VO9A 2A35A 3IBSA 1SBZA 2G17A 3KLNA 4EEZA 1FCAA 4ZVQA 3NO4A 2OKGA 3D0GE 1W35A 4MARA 3K9HA 4ZGGA 2C22A 1AQJA 3EIQA 4HT7A 1KJIA 4D8TA 4CGZA 1Q1KA 2O7NA 3ZJTA 1I1QB 3CIZA 4KR0A 3C14C 3HJNA 3ZQ6A 3WGNA 4DQUA 2C4MA 4CF4A 1DXHA 1YRXA 2ATCA 1OAOC 1VMAA 2CB0A 4DUPA 1HDEA 4HEA6 2WYUA 1Z6GA 3I9V6 1PR2A 2W6ZA 4RMHA 4BTEA 1B99A 4KVAA 1Q7YT 4IDCA 3ETEA 3WJAA 1AQLA 1BJTA 1I7PA 3CUNA 4A6XA 4G8DA 3MEEA 1U1CA 2PE8A 4BFYA 1ZQ1A 3CWJA 1YOVA 2BKLA 5I7UA 1D0VA 2EKQA 2HNZA 3PEUA 3TMYA 1X4DA 4OPMA 4L74A 4DZRA 1DUSA 3HI6A 5JEEA 3EGXA 4RA9B 1XTUA 1L5RA 4XWGA 1XZCA 3REOA 2PMCA 3WBKA 2A5DA 3DTYA 1N8KA 3AC0A 5C5DA 1S1UA 4F8RA 2PLWA 1ZN9A 3LA8A 3HKEA 5FFMA 1X9WA 1E9RA 2OP5A 4YI5A 3S81A 3HBMA 2NUTB 3GB9A 4RU1A 4JBIA 1FSFA 1QGYA 3K17A 1BC5A 2BI8A 2WU8A 2F3TA 4I5IA 1RT2B 1SHLA 1X74A 3PFKA 2I4LA 3X2SA 5D3GB 4CIYA 1IUPA 2HQGA 1IG0A 2JW5A 1EGQA 3MGKA 4IIVA 3U7JA 1W25A 2XH8A 5TQ2A 4QOHA 1DS6A 5C25A 1ORDA 3P5TL 4CT8A 4NLYA 3F71A 4GSLA 3SYMA 3FFIB 4P3NA 1QV9A 3P9RA 5HVFA 3OTGA 1FJGB 4AIIA 4RWEA 5IJZA 1QHFA 2IHJA 1BY9A 3FK4A 5BR8B 3W5DA 3M1VB 1S76D 1GNRA 2DR0A 2B1JA 1CVLA 2F65A 2ILVA 1HT3A 4ZP6A 2M6RA 5TVKA 4X1YB 2NZCA 3LF2A 1N48A 4WBSA 5DCWA 2NADA 2EWWA 3CW2A 4G24A 3T34A 1FA0A 2IMOA 5E4JA 3BR9A 2WA2A 4YJ2F 1V4NA 3V2GA 3LALA 3GU3A 4R5PB 4IOBA 2RK4A 3K0CA 3O83A 5E7JA 3ZDAA 3LYUA 3NVMB 3PEVA 4F91B 2P0EA 5CVVA 4PYDA 3PXAA 1C4AA 1TO2E 4BBAA 4BB9A 4FFWA 4AL4A 3IT1A 4NJOA 4GMGA 4PYOA 3DEAA 1VHWA 2GFHA 3T0IA 4XLTA 1P5ZB 3N07A 1SGWA 1KEZA 1W0CA 4RXMA 1C2YA 4E5MA 5SV2A 1ODLA 3FTPA 2CVOA 4QM6A 4DEVA 2WSFC 4DR2F 3F0TA 3A27A 5HJ2A 3TZYA 2BOAA 1T13A 4UBNA 4B8WA 3KDNA 3RYIA 4ZALA 2JAQA 1VECA 4PUOA 3IAUA 2F48A 5JS8A 1KHVA 5JJKA 2RJOA 2GFIA 4F8EA 3H1FA 4YB8A 1Q0ZA 2Q5EA 3V4RA 4FYHA 4RJLA 2XB4A 5CX1B 4L4RA 3W79A 4UULA 3R3TA 4HGOA 2FF5A 3PX3A 4LXHA 4K4ZA 4TLEA 1PJTA 5EWGA 4ZRDA 3G02A 2DY9A 2LBPA 4O6VA 3WB9A 2NUUG 4C3LA 5BSTA 3WLHA 3NWJA 5ALFA 4RIGA 4CQLB 1MC1A 1FYXA 3N0RA 1OW3B 3MM4A 3OCWA 1IWGA 3LQRA 5B2ZA 3R8CA 1WSAA 4FKMA 2J3IA 4BNUA 1EJBA 4KHPB 4KGKA 2PWPA 4HN4B 4MUBA 4KYZA 2FLNA 2W25A 4UU7A 3VR3D 4O23A 1UPAA 3MYRA 1CQZA 1HPZB 4X7MA 1JNXX 4B08A 2RH3A 4ENUA 2ZXUA 1DTWB 8RUCA 4PCLA 3MM5A 5BQFA 1BMFA 3KWMA 1NVDA 4B2LA 1GZVA 3V1NA 2WW4A 4P2SA 4K86A 1WR8A 4XQGA 5TSDA 1I1NA 3H25A 1N9GB 4TPKA 1GLGA 4D3YA 5HQLA 3B53X 3QT8A 3NIFB 1UXKA 3GPIA 4OL9A 1YS4A 1XL0A 2YX7A 3K0FB 1IXZA 2FHSA 1APSA 2XUGA 5D51S 5ICCA 3DMFA 2X0FA 3IEUA 1CVRA 1AS0A 3OJOA 4MYHA 2JEOA 4O4GB 4M21A 3A58B 1DQPA 3M4ZA 3E5MA 2BFBB 3DAOA 2GPYA 3CD7A 3OZUA 2IPXA 3UV3A 4YYZA 1FZTA 3N2LA 3P8BB 1KTQA 4FFOA 2I7DA 1T34A 1LW2A 3L0OA 4WKGA 4EFLA 5ESDA 1K7CA 4PNHA 3IN5A 4PCVA 2A5YB 1EX9A 4PVCA 4PEVA 1DQ9A 5JI3E 2UYHA 5AR1A 1WMBA 5BW6B 1NHVA 5T67A 4J91A 1U7ZA 3OPYI 2GAFA 1W96A 1N2BA 4CU5A 2H51B 2PKQP 1A88A 4W9MC 3OHPA 4CV1A 4PZCA 4URFA 2W2PP 1HBOA 3MPOA 1BLUA 3D67A 4CLRB 4PQGA 1HYSB 1SC3A 4H4OB 1IUKA 2CJFA 1N5VA 5KYNA 3ZDZB 2G4LA 4WLOA 4PQYA 4DQXA 1H98A 5C4GB 3NIBA 3Q2KA 3PQ7A 2GQ2A 1FFWA 1E4VA 1FP2A 3B9RA 4GGMX 1JDJA 4L08A 1PL0A 4AYXA 4CR8A 4X65B 2HIQA 4G97A 4NXMB 2C88A 1E3SA 3BWVA 4XR9A 4UQLA 2EJUA 2B4QA 3PRJA 4HVCA 3W5IA 1R4MA 1L4EA 2VIHA 3QBVA 1IN8A 3L9XA 3V00A 4RSRA 2X3UA 3VGVA 3HA7A 3V1LA 2HHCA 1YHYA 2WJIA 5CW1A 4NH4A 1TZKA 4TGLA 1WL8A 2XUOA 1A82A 3Q24A 5F0WA 1GPBA 1BGVA 2FRVA 2I6GA 1SM4A 4Z3OA 4QARA 2GBPA 2EW2A 1ZHHA 4UVHA 3Q1KA 2XYPB 1F2GA 4JHXA 3RVRA 4BJ3A 4TXHA 5KCZA 2OCKA 1H93A 5IAGA 1J0CA 2YJ5A 3RHTA 1M1UA 4H54A 4RUKA 4EO4A 4WERA 2DSTA 5AKKA 1WHWA 2A0FA 5DNAA 4P93A 3FSEA 1YVFA 3GIJA 2H7XA 4HGYA 4JN6B 3QJLA 2AJTA 4N8DA 5K3SA 1JR6A 1FHTA 1E2EA 1FRVA 2RAQA 3U2QA 5F73A 4RESA 2UVDA 3LT2A 3UUFA 1CEQA 2C77A 3D54A 4J8PA 3KFVA 4FXPA 3CRZA 3J7A1 1M33A 4TLRA 1QZ3A 4Q9JA 4M0UA 3ULHA 3BXHA 1OFVA 3QPCA 2FCRA 2GMHA 1FZQA 3E3MA 3CCFA 4H3HB 5CUQA 4ZT5A 4UMFA 2VL1A 1CJKA 4UAVA 4Z4QA 4IICA 4AWBA 3JD3A 3FGOA 4LXXA 5A5EA 1B8PA 4WGGA 4NBUA 1FSSA 1WABA 2HSZA 3TI7A 1XMSA 1CQMA 4BCAA 3LJKA 3F96A 1IC6A 2BJWA 1DWOA 2W9CA 4US1R 1I0IA 3QO9B 5DI9A 5KFWA 1KFDA 1EX7A 1P4RA 3JSYA 5EWMB 4ENPA 1SL1A 8GPBA 1Y5NA 4E6EA 4XPIA 4YWHA 3KXLA 4A8OA 4YRRA 2AUNA 2B99A 3PEYA 1M6WA 5HI7A 2J6IA 5IJ0B 5D4OA 1OI3A 4QDTA 1ZESA 4P3OA 2FUG1 3JQBC 2FSPA 2BMJA 5K20A 3OE7A 4CRWB 4DX6A 4DSOA 5JVGQ 1N25A 1MZPA 3K0HA 3IIMA 4YREA 5LSRA 3OSUA 3EX7C 3O4FA 4NE9A 2E9ZA 3BTVA 2QVXX 1N8SA 1X7ZB 3HR7A 3MCZA 3N1UA 1IEQA 3LPYA 3RKSA 1KIMA 4L1KA 4WADA 3L9WA 4WFZA 5L3QB 3M2VB 2GYVA 3MD3A 1A04A 1HKAA 4ZS6A 5KOIA 2K87A 4Q48A 2ODBA 4ND6A 3I42A 2RGWA 2QP9X 4LDNA 4MAAA 2P90A 3B2EA 1I6JA 1NDUA 3GEPA 2BFEB 1CE8B 3OI7A 2QHXA 2OO7A 3NWOA 3M70A 3QRPA 2VNHA 1H6CA 3WSWA 1KJWA 1S9EB 2DPGA 3C3EA 4QPPA 2BH9A 1QIDA 4GLBA 4QRIA 3S68A 4HWRA 2CJYB 4QUIA 2QYCA 2AYEA 5CXUA 3N58A 3R5JA 1M34B 1TB4A 4DV4F 3UN5A 1QE5A 1A77A 4OX9Y 3FZBA 4DJBA 4S0XA 3LIIA 3PD7A 2UXBB 4EYHB 2EIHA 2VT7A 3K5LA 3GHYA 5CK5A 1R15A 4RC9A 2BP7A 1I3OB 3SVLA 3SOZA 2VG7A 4OHFA 5FBHA 1R4ZA 1EWQA 2RH8A 1L3UA 2PD1A 4J9NA 3FRJA 1JW9B 1XI2A 1X8KA 4LF1A 4CLXA 2X2PA 4DBQA 1BCSB 2BJ9A 3LPEA 1NVTA 1N33F 4IXNA 5CLHA 4H77A 4J9RA 2ONCA 1VE7A 3LK6A 3H0EA 2MGZB 4BKQA 3K5IA 5CH5A 5ARCA 1NUPA 1J1UA 1IHYA 3CD5A 3RROA 2J6SA 3K0AB 2FLLA 4HZGA 2OMLA 4YX9A 2C2ZA 5TMBA 1X5TA 3IEKA 2QLLA 1GL6A 3IBTA 4EY3A 4JR2A 5A1TA 3GCGA 3IVRA 2D2FA 4UVIA 3OIYA 3SQGB 1FJGJ 4UCFA 3QBCA 4ITRC 4F4DA 4IDHA 4YDSA 1MT0A 2BDTA 4YMIA 3UBTA 1M90T 4CVNA 4MGZR 4MKAA 3PPVA 5GPBA 3IQIX 6REQB 3ND8A 4B6FA 4RW8A 4PO8A 4TQRA 1F7UA 5F0UA 4E98A 2LGJA 1X7YA 5I47A 3SDEA 4B3DA 4ENSA 5DASA 3PRYA 1ONPA 2B8JA 3EEYA 3DEHA 5HMXA 2MWMA 3V6MA 4IV5A 3LP5A 1RRPA 4WBNA 5DBGA 1BVUA 3HEMA 1KNQA 1VKJA 1Q3KA 1NT2A 4GG1A 4X8MA 5F3TA 3SMVA 1H2FA 1WKVA 3V2IA 1H1LA 1Z25A 4ZVMA 5LMUB 1JFRA 5DXFA 2AD9A 3WLMA 2EBHX 2Y0BA 1Z7EA 1L4KA 1FEZA 1JSXA 4TOIA 4ZITA 5L6MB 1IQUA 4CKYA 1GEHA 4ED4A 3CR8A 4GOLD 3U4QB 2V55B 1V96A 3V97A 4NLRA 2WYWA 1OXVA 5DIFA 3HCEA 4YECA 1YRHA 1UPBA 4QFCA 2FEAA 4P9NA 5BNFA 5U47A 1UMCB 1TW3A 4DZTA 5DYGA 2FR8A 4EP1A 4KACA 4ZKDA 5CXSA 4A8FA 1XKQA 1AH2A 2PUAA 2HWTA 3HWX1 1U6IA 3QY9A 1RB0A 3O73A 1V5FA 4U9HS 1DC3A 1LDYA 5FOSA 3BUSA 2WJWA 2IOQA 3AIMA 3PEFA 4Y0AA 3GEHA 1T1RA 3CNBA 2FPPA 4UMEA 4XYEA 5E6RB 2J6HA 1QS0B 3UFBA 1NGSA 2ID8A 1KE2A 3AJAA 3FE2A 3SFVA 5IAOA 1N2JA 1FCJA 4IWYA 2YY6A 2RHSB 1J23A 3AUYA 3GN2A 3U6BA 4D0LB 4JITA 2C61A 3JTPA 2QTVB 4KV8B 1P1CA 5IV4A 5HS6A 3Q1LA 4K9MA 3QU2A 4M8NE 3DYIA 1E4YA 2IVZA 3P9YA 3A4YA 3V7WA 2DERA 1L5GB 2ZJ6A 3M8RA 2NSCA 5DK6A 3DB1A 1OH5A 2D3TA 2FYTA 3IUMA 1P2DA 2RARA 2BAGA 3QPUA 2CE7A 2QMEA 3KZ1E 5C4IA 3S7ZA 2P6RA 2GHWA 1MC4A 1U3GA 4JMLA 1U2DA 4K05A 3AODA 1A7AA 3TRFA 3D5QA 3E22B 4RH3A 2KBEA 1KKHA 2ZIGA 3ND6A 5KFEA 3U1VA 4HDKA 1TV6B 3NAHA 4EWLA 3MBIA 1P62B 3TJZA 3WQRA 1YS2X 3TZEA 4RJKA 2PMEA 3OT4A 1E8DA 1X1CA 2OTLS 3WLOA 3H20A 2R8JA 2RBGA 1IWAA 4DV5F 4EB0A 2XMVA 3IP1A 4B3SJ 3KFXA 3U4IA 3GGGA 4IF4A 2HREA 1ACMA 4MA4A 3V5NA 5C18A 3THVA 2COKA 4FBMA 5CT8A 1H2UX 1IVZA 4KQ1A 1YIAA 1S2OA 3GFPA 3AHCA 3R4VA 3VNAA 3NGSA 1M0TA 3C7CB 4AJPA 3EQ2A 4CKEA 5T7BA 4HI0E 1HY3A 4NFHA 3T5MA 3W0LB 2RH5A 4R8UA 5CVEA 2RGGA 4K9PA 4K4YA 1PIWA 4FSHA 5ED4A 2QLBA 3H11B 1X60A 1E5VA 1OBOA 2W00A 4ID8A 5KFYA 5HANA 1J0BA 1HD1A 2N7YA 2YVKA 1ITZA 4CUZA 1Q21A 1HBUB 4W9NA 3DQPA 3P0IA 4JU8A 1IIBA 1NI5A 3CR3C 3KWJA 2FN8A 2GEUA 3IA7A 4IV8A 3ONNA 4HJRA 4X65J 3O94A 1YQWA 4P71A 3AEZA 3RYCA 2BQUA 1NXVA 3IOBA 3O9ZA 1DCFA 5J1TB 4FFPA 3PC4A 2R47A 2ZP1A 2KB2A 2PD4A 4DU8A 4A16A 4U6SA 3IP8A 2WWXA 5DZSA 3TD9A 5A6SA 3PQ8A 3GT4A 2RJNA 2G83A 2UVQA 5KJCA 5FTNA 3BICA 5HF8A 4HEA9 4UHHA 3I9V9 3C24A 3OPXA 4QUAA 4ZCMA 3ST7A 4ZJQA 1KOGA 1JFFA 3EVEA 1Y63A 4R7GA 2AR9A 2JHEA 2VRNA 3AAWB 3JW8A 2FRDC 3HEBA 4YXFA 2WDZA 1FIUA 2ASYA 1IZ9A 1PNTA 4KE7A 3WJ1A 3LUCA 3MJSA 5DHAA 3GP9A 3H1TA 3WWPA 2OV8A 4KWIA 4ZOSA 4ZDJA 1KDOA 2WD9A 4PAOA 2WA1A 4KQIA 4JBXA 1E3LA 3B4MA 4HNHA 1HEIA 1USWA 4ZVVA 4L76A 3OCJA 1RWPB 4OQ4A 5BN4A 1LWEB 2LMIA 2DHHA 1LTQA 1HI9A 2RF2A 2R25B 3VV3A 1TKTA 3N5CA 3M4XA 4G2NA 1SCUB 1NPDA 4R1SA 3MMCB 4ITSA 1WCIA 2IJFA 3IS9B 1TJ4A 4GC7A 4M1TA 4JZKA 1CG6A 4PR0A 2D1CA 3LUBA 3PNBA 4URHA 3FOBA 1C4CA 4CLFA 5KC9A 3IO3A 5L39A 2VBWA 2O52A 2AV6A 4EHJA 5F8MA 3SAJA 3TLCA 3M8YA 2QNIA 3CONA 3KSZO 3RS9A 1T5TA 5EZYA 1XTIA 5C51B 2AFIB 3DMHA 4XPCA 3JYHA 3LP0A 1WQ3A 3T4PA 3ZIAD 3G9ZA 5ETQA 3KO8A 1AIPA 3AG6A 3HCCA 5L1LA 3DH0A 4YLYA 4JI7B 1X1TA 4NLVA 1EIWA 3NBUA 3N8GA 3JASA 1F2DA 1E0KA 3Q12A 3ZVNA 1U9CA 3AUKA 1WTFA 3GX1A 4CH7A 2OXTA 3OX2A 2DNZA 3HCPA 2Y1JA 3R20A 3PSHA 4P4UA 4DV6F 5J1EB 2JA2A 5AOVA 2JC1A 2IOYA 2YNFA 2YXEA 1UFKA 3KJQA 3NLCA 2OUIA 3R2DJ 5IABA 1YSCA 2CFTA 5AK3A 2PGDA 2O8EA 2FFQA 4V38A 2UKDA 2IU0A 2VNIA 4HLBA 1P91A 4Q7MB 5EZQA 3H1BA 2QR3A 5GINE 3FRIA 4RW4A 4I56A 1L4HA 3LVRE 2OWEA 4RKRA 4Z8XA 4NZNA 4EI2A 3L01A 4LZPA 4D8WA 2C2XA 4KZPA 1LV8A 4RQAA 2XLJA 3JAKA 1VQLS 4JP1A 1QB8A 1WW8A 3SEQA 1H2VZ 4H4CA 2GOYA 2XVZA 4CMBA 2K7FA 1Y1RA 3NC1C 1HWUA 4Z4IA 1V25A 5DISB 2BSQA 1ORWA 3MCMA 4EZ6A 4F84A 1TMGE 3E5NA 4EF6A 4B79A 4D3XA 4TYQA 3ZNOA 1XU7A 2PBRA 5C53B 4C29A 1Z45A 1YMVA 2CNBA 1YH3A 3ZWBA 4I2PB 5AIBA 1Q16B 5KOYA 4YRSA 3ZCTA 5AXMA 1JN0A 1E18A 1XCOA 4IV0A 4R71A 2UXBJ 2ZQYA 2Z57B 2C9YA 4B6PA 1HBNA 4YROA 4C7JA 3GJSA 4C97A 2JIZA 1WOOA 5IYZA 3ZZZA 4CT9A 4P53A 1PKEA 4DLWA 3QVGB 1XVUA 4DL4A 1RXVA 3E4DA 4MYSA 4BO4A 2ZZKA 1MQAA 2W22A 2D06A 2PH3A 4I2VA 4HXGA 5FOWA 2AB0A 2NX2A 3MUEA 3B70A 1N88A 2YX4A 1F4LA 3R09A 3O3OB 4GOND 1WWHA 1C3LA 4NAUA 4RMIA 4LMZA 1KP3A 1PCAA 4DPOA 4NDAA 2OY0A 1RU2A 3KFLA 1UZHA 4TTQA 1C9DB 3Q72A 3GP5A 3A1TA 5JZVA 3OUZA 2OD9A 2ZJ1A 1SKSA 3WYNA 4BXOA 3G82B 2OD6A 4DSLA 4JROA 1L7AA 3DSRA 2IXTA 2PUWA 1ZA2A 3GRAA 1WM1A 5DF1A 4H4EA 4IMJB 3UGQA 4K4XA 3QSYB 3A28A 1JEDA 2PEHA 5JNVA 4OFWA 1BMTA 1G7CA 4Y00A 1RLUA 1DC4A 3WZMA 1UANA 1X3SA 4TMKA 4G2TA 1RQGA 1COWA 1E2QA 1XALA 1BVRA 3I12A 1UF9A 3DOIA 2GN4A 4QL3A 4UUNA 4B6EA 4A2CA 1LA2A 1ZMRA 1K7YA 1EP9A 2VF2A 2ZH8A 1KOOA 3GLIE 4C0BA 1HMVB 2OZLA 1DNPA 1KEEB 4U5QA 3O7WA 2IFXA 3QEBZ 3I31A 1OA0A 2A9PA 4LE1A 4L0QA 4NBLA 3LQ4A 5G2OA 5HDQA 5LMUJ 5G4KB 2ZB8A 1ECCA 2OGZA 4IFEA 2GILA 2CQ0A 1OWLA 1ISMA 1UIMA 3I9FA 3M32A 4YTEA 2WFLA 3H3JA 1RD4A 4OQQA 2IEBA 1W4AA 4XCXA 1JG6A 4FZ3A 3E8OA 2O57A 2JLUA 4Z4CA 1UZDA 3AHHA 4RZ2A 5LVAA 4I4NA 1OXKB 3ZW7A 7AT1B 2YWFA 3W8RA 3OTOF 1EQ0A 5AHKA 2IYZA 1JDVA 2HHVA 3BF7A 3QI2A 2IVFA 3OZBA 3E48A 3T3IA 1S89A 3UDEA 8MHTA 1GD1O 3L43A 3S7RA 5HLFA 2O50A 3TTTA 1Q91A 1SHKA 2VAPA 3SXPA 5CFRA 2HMWA 5FTLA 3QF4B 1I7SB 4L02A 3ORYA 4YCLA 5K0ZA 4OYHA 1MVOA 1R6XA 2IE8A 4U4AA 3NU1A 1Z2OX 5C2GA 2DM6A 1F1BB 3I5UA 1L5OA 2P41A 4QFMA 5LUAA 3O4VA 1PGZA 1DQ8A 1T95A 4OYPA 3CEDA 3A05A 1PILA 2VF5X 3WL5A 5A04A 2DPMA 5E6SB 3S5JA 1TPYA 3BXGA 3MCSA 1NW7A 2W2MA 3M8QB 4A8QA 5C3UA 4ECYA 1U0JA 1YOBA 2A9VA 3N2GB 4BUZA 3F1LA 3LT4A 3QW2A 5KJ1A 4I1UA 1R0YA 3LZCA 4EVRA 1MU2A 1EKSA 1OPXA 2DB1A 4LMRA 3IC5A 3JQ7A 4Y2VA 3DHNA 2GWRA 2IXDA 3TQHA 2IC3B 2V6MA 3K1TA 4L3OA 3PYGA 1KGSA 3IX7A 4WASA 4JNCA 2BKNA 1OXXK 3LTOA 1PEKE 2O4CA 2OV1A 4L5JA 3W9SA 3GAMA 3DMTA 1EUCA 4JLNA 4PX9A 1T9WA 1N2HA 1E1KA 1RT2A 4G56A 3OP1A 5M04A 5IWAJ 5HJYA 2R8XA 5SZHB 3V3TA 1B6SA 2VDQB 2QTCA 2GD1O 1YJTA 2CPXA 3S1TA 1HYEA 4W5HA 3FFIA 4JOSA 2AHRA 2Q99A 3LPNA 3WRXC 1RIFA 2WP8J 2JBAB 4AN0A 4RDIA 1L5MA 1Q95G 3LCJA 2OM6A 1RT4A 1CYEA 1T2FA 3SLGA 5ELLA 2IBKA 1T9BA 1IKWB 4D9BA 1JXVA 2HGLA 3E81A 5LL6d 1N4LA 4TVOA 3AUJB 4UNPA 4K6GA 2W6CX 2JGMA 3BGDA 3VH4A 1OI4A 5AKXA 4Z0TA 1RHKB 3V8BA 1F3FA 3G8YA 1YQUA 2YH2A 3BB4A 3MTBA 3NDJA 3QKSB 1H66A 4F2SA 1Z2AA 3ROKA 2XNCA 2ZKTA 3DVAA 1Q1GA 3MB8A 1D3AA 3HUTA 2FSIA 3I2GA 1MC8A 5C7PA 3AL3A 3FMOB 5DWDA 2D3ZA 1NK9A 2JEYA 2P6SA 3PNKA 5D3ZA 1WOYA 4I4IA 2I4TA 2W43A 3H5XA 3A3YA 3AR8A 4MIEA 1RT3B 4OSEA 5A3JA 3C8DA 3QT5A 2VAXA 3JQFC 2X42A 3AEQB 1TGVA 3CRMA 4X3OA 3A3NA 2CADA 2DY0A 3TAHA 3Q89A 1PZXA 5E2QA 3KJZA 3UGTA 5LMNF 5J2UA 2IS4A 1XU4A 3O0TA 2H17A 2EFJA 3UN2A 4RS3A 1BEEA 3UIEA 1APBA 2Z8QA 1TA9A 4Y0VA 5IVHA 5D4NA 4WBNF 5JBIA 2IM2A 2PWZA 1X4AA 2PXAA 4E4TA 2DAPA 2VQSA 1LJLA 4CQLA 5EN4A 3EQ6A 2FFAA 3KRTA 3OLQA 4QU6A 3PNSA 3KLHA 1ULUA 4YXWD 3JVEA 2B21A 3PPIA 2P3SA 1L2TA 1SBYA 5DW0A 4RTRA 3RAFC 3IULA 2ZUVA 1U0HA 3FFTA 2N1MA 3D0RA 1M2OB 1YVRA 3I32A 1C2PA 3V1UA 3G0BA 2EF0A 1O6BA 1L1RA 1NBME 1N0VC 5KG7A 1L1FA 3E5RA 1VC5A 4PTZA 3TRIA 3LMKA 3A1WA 5F76A 2CHQA 1X9HA 1NH8A 3GDOA 5B7GA 2YZMA 2V69A 1BX3A 1QE1B 3DZ8A 5BYKA 4IH5A 3PWKA 1MHPA 4QBUA 1YR2A 1XRNA 3BWCA 2OD7A 2WZBA 4TKUB 5ERYA 5BYRA 3RVJA 3HP7A 3TI0A 4O59O 2F1RA 3BWBA 3UE2A 1VG1A 3L7NA 3IT0A 1VR6A 3R5BA 1B64A 3K5WA 4N8OA 3ETMA 2R60A 3TOSA 4BECA 4DU7A 1BS9A 4DIEA 2DYAA 1JVNA 3HDHA 3PEEA 4S05A 3P6YC 1QHGA 2BFBA 1NQWA 1PJSA 3JYNA 3BZWA 3T7AA 1UMDB 3NM5A 2BL4A 2D0PB 5KO2A 3WIBA 4MV4A 1HYQA 2NO7A 2QIOA 4X9XA 3J80A 3KLIB 1XKLA 3D4OA 2WPDA 3T5GA 5B0BA 1HFJA 3BJYA 1N5QA 2CNWD 1EB8A 1TL7A 1EH5A 5CVTA 4FCCA 2K2QB 3TX0A 4FYMA 1E9SA 2XMTA 5GJBA 2C97A 4G4IA 1WC4A 3LLUA 2HDOA 3FHJA 2NPIA 3PT9A 3R76A 2H51A 4DDFA 4TV9A 4QIWD 1LRLA 3EVOA 5SY4A 3TBFA 3HKCA 3MMBA 2P7IA 3ZKAA 5AKHA 4PYNA 1CUYA 4FW9A 4EGSA 1P73A 3KLEA 4CLRA 3O44A 3BQNB 4FILA 4H4OA 1FJCA 3EJWA 3KVYA 5EQTA 3RUPA 2DHEA 1OB2A 1NSKL 2I66A 3CXRA 3E1SA 1KJ9A 2GXUA 2BANA 1M8JA 4CMEC 4XSGA 2NZUG 2P2SA 3KYIB 5DDQC 1ULBA 1QFYA 3DTVA 2DETA 2QQGA 5TF4A 3KCNA 3WG9A 3E35A 5JMWA 3P7MA 5GIPE 1KMIY 5LWHA 1RTIA 4DWOA 5HIKA 5EIBD 2RAVA 1UBMS 3OQJA 3TEJA 3JQAD 2JHAA 1UBLS 4DNXA 1X0VA 4DF8A 3HCRA 1R6DA 5H8WA 1RQPA 2WAYA 1Z2DA 4Z1MA 2EZUA 2CFOA 2ZRDA 2JFHA 4C01A 1Q7RA 4KXVA 2PUHA 3R9WA 4CJXA 1RBOB 2HQ1A 3LW5C 1SC4A 4LYFA 2GFFA 4PQUB 5AP9A 4IG4A 2XBLA 3P9CA 3IIIA 3RGIA 5TVGA 1OXUA 4DUYF 4F4WA 4RFVA 5TPWB 4E5YA 4MGKR 4O1HA 3A8JA 4BNDB 2H7YA 3W6PA 3ZN2A 4HFJA 3NT5A 1N6LA 4DXLA 4ZVSB 1ND5A 3O0DA 2O7VA 3RG6A 4NULA 2GJIA 2FX2A 1M2FA 1YL6A 3KKQA 3GSDA 3WX8A 2KFNA 3PIOQ 1B8NA 3DL2A 3LI2A 4MVJH 2E4VA 4UOQA 4KXFB 3OY7A 3G8SA 2OO5C 4HAOA 3IMCA 4ES6A 4EBEA 2PRSA 2JJ2A 2BFFB 5L3ZA 3FEZA 3J81A 2EKYA 1PFGA 4UOEA 3TVYA 4IIGA 5F5XA 1L9KA 1MZVA 1HLGA 1EVIA 3SM9A 4RY2A 1GZDA 1FUUA 4OZLA 1GAEO 5HQJA 4WOBA 1EFRA 4RV9A 3JQDA 2DBVO 1Q0TA 2R4FA 3AR9A 3OPQA 3HSKA 3GR6A 3D3JA 1FQJA 2GEBA 5LB4A 3L0CA 4DA0A 1B43A 1BA3A 4D2IA 3HCWA 2PGIA 3C7KA 2KXNB 3EBLA 1QKJA 2GHTA 2ZFHA 3A6LA 4WYWA 2ZDQA 4DV0F 4WE3A 4XASA 3U7GA 2AE1A 3I55S 4C2TA 3BWEA 1ELOA 1BQ3A 3VR4D 4FDLA 1GNLA 3OTEA 1VMIA 4A03A 4NV1A 1XB2A 4K4TA 3Q7SA 4M36A 1SOWA 4BO6A 4OYZA 4EGAA 1HI1A 4OYBA 4M76B 4D46A 2IP2A 1U1PA 4EKIA 1RR6A 5FWYB 2X15A 2VOEA 2OPQA 2VN8A 4I1IA 5J43A 2FGOA 1EWVA 2WTMA 2WT4A 1C30A 1RWNB 5JWOA 1WS6A 1FDOA 1EFVB 4LFCB 1KMMA 4GBED 4ARIA 5EHIA 1A9PA 4MQUA 2YXLA 5AW7A 5IPFA 2W9AA 3K7RA 3L5KA 2MYUA 2C9MA 3OZWA 3EFBA 1OX4A 3AERB 4HTAA 2B8WA 2R4QA 1S5PA 3EXEB 1WZ2A 3IR5B 2ZI6A 4G5GA 2EK6A 2VQ6A 5IBRA 2UYOA 5DKFA 1S9EA 1Q14A 4M5HA 2EW8A 4JWKA 3K2QA 2VH2A 2VYCA 2CJYA 2Z2YB 4EELA 3GIIA 3DGEC 2MQQA 2R7WA 1K3UB 1M1XB 1Y5MA 3LBNA 4O4IA 2JAHA 4ZVUB 3NCRA 2NO0A 1GYRA 4B4VA 1WHYA 2FA9A 2CKWA 3ZVLA 2LQ8A 4TYWA 2IGBA 1XNQB 3KZCA 2OHOA 2HWIA 2FCAA 2Q3MA 5FDFA 1CV2A 2BJDA 3FYDA 2ONZA 3GLRA 3VNQA 1P80A 4TXJA 3RREA 3R2CJ 2TMYA 4QYMA 1NNSA 2VPYB 1EVQA 4TMWA 3D6AA 2YPZA 4V2IA 1WRBA 2PN1A 1FJXA 4EEKA 2EARA 2IJNA 5TMPA 2ZT8A 2D13A 4JXJA 3GG2A 3GLKA 4KAFA 5G1PA 2AQ4A 4OB7A 5KSWB 4KMMA 4AZVA 2GWHA 5HBRA 4NG4A 5IAJA 2WAQD 4BGDA 2MGZA 1BOFA 3I34X 4TWJA 4OYLA 1WB4A 3IXLA 1NVFA 3X1KA 1JE1A 2CXRA 3EE6A 2XYHB 5K6TA 2GCNA 1TFYA 4FOSA 3VNSA 2G8LA 3EICA 4KP7A 4LOAA 4OYOA 1OCEA 2H4YA 3L4JA 1SVMA 1XRRA 2K3IA 3VHRA 3SQGA 5L95A 3D8SA 3POTA 2P2ZA 4FOPA 4LY9A 4L3VA 3HVUA 2J3HA 3DMDA 4INZA 5AW5A 2LD4A 5IYZF 4PGAA 4H7PA 3BYZA 4NBTA 1Z34A 2YZ2A 1U1LA 3WNZA 1DWPA 1S6OA 1WETA 3QA9A 3FWPA 4E03A 4G41A 2NZXA 1Y1LA 4LNUB 1RLIA 1WMFA 1W94A 1JDBC 3BM5A 4EB6B 5K8PA 2I2CA 4M8IA 1MJNA 3KK1A 1JEJA 3BBBA 1ZK1A 5FD1A 1KFCB 5HF5A 4YMHA 1FMJA 2HJGA 4WBFA 4ASUA 2FV8A 2RS2A 1BWRA 1NHUA 1U2PA 2OD2A 4BQNA 5HZKA 5JARA 1QYXA 2YDYA 3CFYA 3OEYA 2AMYA 1M2GA 1RAAB 1E7RA 4QIHA 2JDID 1RLTA 1H2TZ 1ODJA 2X5JO 4K0KJ 1TM3E 2V7PA 3NGXA 2EFQA 3TW4A 5A0YA 3V2UA 1LCIA 1F6WA 4F6RA 1YQHA 4CKBA 3OR1B 3CG4A 1K86A 2HWUA 4CM4B 2GM4A 3W05A 2QEXS 3VC1A 3V55A 2P2NA 1UMCA 2JZOA 4E2ZA 2TYSB 3DBHB 4PEOA 1RBZA 4II7A 1K6EA 2XCOA 1DO8A 4PAGA 1QSLA 1HFWA 1E98A 4D9HA 5TS2A 3PQEA 1ECPA 1NJ5A 3H5NA 5BYBA 3HT3A 4XFJA 3S2GA 4LRTB 1PF7E 2YHUA 2GZ2A 1VCNA 3EPLA 4HVAA 4JGIA 3PFOA 5E6RA 5EWEA 1I4WA 3RK4A 5JTTA 2P2YA 1TM5E 3OUYB 3BCRA 3GJXC 3HJVA 1ZQ9A 3FY4A 2CF6A 1EXVA 4DCMA 2AEJA 4BFCA 3QPIA 2VZEA 4EFNA 3KQLA 2BFMA 3SCZA 4BGEA 4B3TF 3C6UA 3WTCA 2XZLA 1UZLA 1KR2A 3Q86A 4JAVC 4J16A 3RVLA 4JT8A 1Z0SA 4ILRA 2NNWB 3RUAA 3V34A 1RNLA 3HKDA 2HJVA 4PC2A 2JH8A 4JYAJ 4AJEA 1RTZA 1CF2O 5JS7A 2EXXA 1D5WA 4BAGA 4EZIA 1LWCB 1NAQA 3OZFA 3GLGB 3ZQKA 1Y4ZB 2KVIA 2RNEA 4L2IB 1UWAA 3OSZA 1CPZA 4ALIA 2X1VA 2VH5R 2JRSA 2DPLA 3M34A 1TV6A 4G8JA 4WFXA 4D4HA 1UPPA 3CCVS 3RV4A 3IGFA 2ZJOA 1I32A 1XCBA 5FLYA 5JJBA 1PHRA 3R9XB 2XCPA 1XRJA 1I9CA 3BZQA 4CEJB 4HD8A 2GBFA 5CBPA 2APOA 1JG3A 3EG5A 1Q7CA 3HQ4O 3IT3A 4EK9A 2KJWA 5IVIA 2Z8ZA 1FYDA 3S55A 4ACAA 1N2XA 3JTEA 3WLSA 5CLQA 5ALPA 5H70A 3I30X 4OXNA 1ZAXA 3ZTYA 4QZVB 3QIDA 2LE0A 3IAHA 1YQEA 2YWHA 3QENA 4Y2YA 1D8AA 1E1RA 4A0HA 4M0KA 3R5XA 5AVQA 4UQOA 1I2ZA 2IDZA 3VDNB 4US0R 5DM6Q 3G0HA 5E0OA 3TRKA 3WWEA 2W37A 5AVYA 1MC5A 2LIPA 5IDQA 2BM9A 1SKWA 4U2CA 2ZRBA 4MRAA 2CYAA 3UENA 3VSAA 3KG0A 3C3LA 4U2KA 5LP6C 1ILEA 1F4VA 3KSMA 4RWXA 5GAEI 1OLUB 1D0EA 1SQEA 4BWGA 4DX7A 1U6KA 3H11A 2FEMA 4DLKA 5DSTA 1S6QB 4NJEB 2RQKA 3LIPA 3PC2A 1QO0A 1A3CA 2C5LA 2J85A 1M2HA 3ZTRA 1BE4A 3PIRA 1X94A 5DT2A 3EF0A 3NT4A 3B1FA 3THTA 2HZCA 1YJRA 5ITHA 1UVLA 5DQGA 1A97A 5K0SA 5F33A 3HSZA 5BR8F 4TM7A 1KS2A 5HFNA 1GRNA 2ET6A 1KI3A 4RCZA 4QBIA 1Z28A 1F0PA 3LCRA 4M5DB 5DEOA 1E79A 1DKPA 2DPJA 3G59A 2ZDOA 3B20A 4WZBB 3JS5A 3WBJA 3TBKA 1IZ0A 1T0BA 5IKXA 2RKIB 3DYAB 2FSGA 1KHTA 1FXLA 3W8NA 3ITHB 2XUHA 3QPBA 1PFUA 4GLOA 1KWGA 1UAGA 3B12A 3ISJA 1ROFA 3SCLE 5DO9A 2Q3HA 1J99A 2PL5A 2O8VA 1UDCA 2DNYA 4RLQA 3M6VA 1PZEA 1SCDA 4UHBA 1BHJA 5E3RA 1TTPB 3HM2A 4LV6A 1M2WA 3DHWC 1UA0A 1MO4A 4DW8A 4JVMA 5E4FA 1SC1B 5EGNA 4LRBA 1WHXA 1RWPA 1UWBB 2Q2NA 1S72S 1LWEA 1M6VB 1WMDA 2MZ1A 3DFFA 4PLGA 2G5GX 4P6QA 2D0OB 2VF4X 5J2UF 1FDTA 1ENPA 4MJLA 3LWLA 4CF3A 2NT3A 1SCUA 2JEGA 3F3KA 1PP4A 1JDZA 2Q79A 3IS9A 2VWGA 1U7TA 2PNJA 3BO3A 3SLKA 3TCKA 4B3SB 5LQMA 3ZQ4A 3ANNA 4GOMD 1QIGA 4XM1A 1DELA 2J67A 3Q8MA 1U7DA 4F0JA 2X6QA 4M53A 1LU9A 3OF2A 4G5YA 4GI2A 4N0PA 4Z7OB 4CU2A 4DZ6A 5IAAA 1T05B 1WC3A 4LE0A 1AHNA 3WL4A 3S5UA 4JI4B 3A1CA 3GVCA 4KH0B 5E7MA 3ROGA 3WOVA 1DXYA 2V34A 2Z3WA 4KHPF 1A2KC 1EFCA 4G6ZA 2AFIA 1K4MA 2V59A 3IAM1 3SJCA 4JLMA 1SOUA 4MW4A 2PBLA 3V4PB 2ZRPA 4RKUC 3A3OB 1WEHA 3MJ4A 4I1RA 1J42A 2Z43A 2GS9A 2XCIA 3EASA 3GELA 2EYQA 2WJ4A 4A2QA 3V4SA 3LGAA 4FSDA 4PC3A 1HMPA 1ZM7A 3KV3O 4A6EA 3VO8A 2OTJS 1XVTA 4AG3A 2ZPUA 3BQ0A 3COPA 4V1CA 3E82A 2P6PA 4LFCJ 1BWQA 4OZJA 1JKJB 2OBBA 4C11B 1S1XA 2Z09A 3A4IA 3HWRA 2X2OA 2RH9B 3K8WA 4IGFA 4J75A 4DOZA 4MA0A 3SF0A 4UF4A 1VCMA 1V3RA 1CQJA 1K4YA 3TZWA 4JH0A 5AI5A 3DONA 2EJCA 3NOOA 4I64A 3R75A 3CCCA 1Q2XA 4WKYA 3IPRA 2P9EA 4FKZA 2O2JA 2AD5A 1M1NB 5KT3A 2AW0A 1Q16A 1E2UA 1EB9A 2IV7A 2IXBA 3L82B 3CMAS 3PW2A 3H1PA 3K57A 4WZZA 1ATZA 4BMSA 1BX0A 1XNQJ 3LBAA 1N7JA 1FW8A 2CIMA 2BRUC 3BRWD 2ZAMA 3VO2A 1U0LA 3NVKI 4TV9F 5IFKA 2I99A 1MKYA 2VXOA 3LY5A 3JAMY 4M86A 4LF5F 4C7OA 3TOQA 2HJRA 4CQMD 1HT0A 2H1YA 2JFPA 3QVGA 4OXXA 1XTZA 3GGCA 3O92A 3ZYZA 4YBRA 1NM5A 2E7WA 1CJBA 3STYA 2IDMA 1VQKS 1BWEA 2X41A 1PHPA 4GW3A 4NDZA 3DZHA 3AFHA 5SY9A 5BR4A 2QN7A 3K30A 1GWNA 1ZGHA 1EVZA 2P5TB 1UIRA 1NDCA 2HQCA 4YNBA 4DM3A 1WU7A 3A9UA 3HKZD 4H6VA 5B57C 3NKVA 5IULC 4NXMF 4O4HB 3A8TA 1Q82T 2R7NA 4BZQA 4RJ2A 4W9RA 1STOA 2J9DA 3ABSB 3G82A 2BT4A 1P33A 4WY2A 3M7VA 1KYIA 4KU4A 3F47A 2IU6A 4IZIA 2IKSA 2W90A 2HLHA 2HRRA 3E2MA 3C6QA 3WZ0A 3W66A 1ABFA 4W5TA 1RWOB 2QLTA 5FEUA 1GCIA 3HKBA 1WVIA 2HHUA 1U5BB 2NO4A 1XHLA 4K3UA 2WI8A 2Y1IA 1MO6A 1U04A 4R0VA 1N2CA 4YWJA 3GVPA 4I50A 4WKPA 4WIIA 4K6FA 1QGUA 1XD2A 4LZLA 1HMVA 2VP3A 4AZTA 1LK5A 2Y8WA 1SY7A 2CNDA 1P2FA 2NV0A 2OELA 1PNQA 1IM8A 1VSBA 5ALMA 4YRIA 1U31A 2OXCA 2ZBEA 3GGSA 4BS2A 3SSSA 4QM7A 2QRUA 4RTSA 3CM0A 4Y18A 4O63O 1BD4A 4H4KA 4E7PA 3JZMA 3EAGA 1JLLA 4ZPVR 3BSYA 4YAOA 2QC3A 4RCVA 1SO8A 3U17A 5CMLA 4HDRB 3AGQA 1CJSA 1LW6E 3DXBA 4CM6A 4N9WA 2YIMA 4GAEA 1I6WA 4FGLA 2J0VA 4BKMA 2GZOA 3TFOA 3MXTA 3ZKWB 4A8MP 4QT4A 4FLFA 1UUFA 3QYJA 1XRPA 1CJTC 1FA9A 3TB6A 1UOOA 2X5KO 2JFNA 1LBIA 5J9FA 2W93A 2ZJBA 2B94A 2YVAA 2WIFA 4QBHA 4KB7A 2G77B 2VIIA 4Q4HA 3THOA 1Y3IA 3GE9A 2G5PA 4MJ7A 3SE0A 2YC4C 2EJVA 2AXNA 4IQFA 1ONOA 4YO7A 2VK4A 1O95C 1XKTA 4G0ZA 2Z8YA 3F6EX 3KQNA 2HRQA 4DZZA 1QJ4A 4F2DA 4LWZA 3Q2IA 2CXXA 1KS9A 2IDEA 2JGEA 3OQPA 1WXFA 3ACCA 3L06A 3KUEA 1X92A 3WDOA 3RHZA 4R6XA 5ISMA 1RTKA 2QGZA 2HH9A 2PK3A 2EJTA 5CBKA 3R3VA 1UJ2A 4QPJC 1G6KA 5AE1A 4WKNA 3O6QA 2G5CA 1H6DA 4EUFA 2N4DA 3IMGA 1XJCA 2OGWA 1G2PA 3N2GA 3PICA 2LDIA 3VDQA 2VBGA 4RPJA 1VJRA 4CEHB 4FNMA 4NQRA 5JPDA 2X0NA 3U3JA 3K2BA 5JIBA 4OHBA 2CPFA 4CO5A 1ESDA 2ZKIA 2UUAB 3LOQA 1DQYA 4L95C 5FQOA 1W4RA 3TIIA 2M52A 4AK9A 2FZKB 3FEXB 4R2HA 2KXFA 3O2IA 5I9NA 2Q7XA 2NXEA 3CH5A 2BW7A 3A3KA 1B7FA 3QBJA 2IHZA 3ZOZA 4FFBB 2CG4A 2XIJA 2H07A 1OB5A 4AX8A 4O4IF 4IJUA 1JR3E 1CEYA 1J9ZA 1V2HE 2AI2A 2G9QA 4MW6A 4FWTA 4F2RA 1T36A 1ZVJA 2WV7A 4JV2A 4XO0A 3EEOA 1PTJA 2BMEA 3UWPA 5HP1B 1OT5A 5DM7Q 1P7ZA 1YACA 3TP2A 3ENQA 3F73A 1TZCA 2ZJ4A 3N9UC 1ZEMA 2NUHA 4CMAA 4MVJE 4NR0A 1WHVA 2VL7A 1C8KA 3QBEA 5F51A 1AB6A 3TLXA 3EXCX 1E2HA 3EA0A 3IOCA 2B4VA 3PA6A 1TU3A 4KRGA 5BOVA 2BE7D 1Z2PX 2WC1A 3G8BA 5L4NA 5C5JA 3IHWA 4QPZA 4ODIA 4IFVB 1I36A 2A58A 2RKBA 2WFMA 2EZTA 1FSZA 2Q3BA 1BU8A 4MYUA 1SIBE 1FVXA 3HFVA 4YB5A 1OSDA 1PFQA 3RAEC 1SXJE 2CYBA 4N6GA 1Y0HA 2GNKA 4EU0A 1E6UA 1QUFA 4K28A 4QOGA 3EGWA 4G8CA 1XD8A 1F5CA 2ZIFA 2C7BA 2HCTA 4IDQA 4YAFA 5DPMA 3K70C 1E77A 5BR7A 3GJ7A 1DG3A 3KETA 2G7MC 5HOQA 3QLTA 4HDAA 5HSPA 3B60A 4CLTA 1BCRB 2ZHOA 2BSAA 3ZDFA 1UXGA 1M5TA 1UDRA 3F1KA 3ZWQA 5EIBC 3BGOP 1TJPB 3MSCA 2X8WA 3O7MA 2GN2A 1YT5A 5AO9A 2X6RA 5BWLA 5KT7A 2FC8A 3GV5B 2OBYA 2KXHA 1VIOA 1Y42X 1UWKA 5CZXA 2GYUA 1V1RB 4V0ME 5A03A 1EVLA 4JLVA 5E8JA 4RPKA 5CRIA 5HBMB 2JL9A 1U4SA 3DG9A 4R2XA 3I6BA 4UOHA 4CBVA 2XDAA 2JD0A 4R9UC 5EUBA 1T3GA 3QFCA 4B9AA 1P4SA 1QVZA 5MDHA 4KH1B 1JNZB 4Y2RA 5GADI 1OZFA 1T4GA 5HMWA 3ZCVA 1UJ5A 3EY4A 5G3YA 5DBOA 4ARSA 1XU9A 2PTGA 5IWAB 4NXNF 4DS5A 1KYYA 1T4BA 1EUDA 1ZNXA 4JGBA 3L7MA 5EKUA 2FW9A 3BMCB 2VF3A 5CHYA 1ISGA 1NAIA 1RRKA 4F2HA 1KR4A 3FYUA 2NGRA 5ESRA 1QE1A 2QR5A 4B8ZA 1WW2A 4B3MJ 1NOIA 3TL2A 3GIRA 2RQCA 1TL3B 3TJ9A 1QANA 1SB9A 1K92A 3BL6A 3U81A 2CF5A 2O1EA 4RVHA 3LSTA 1KRXA 1TVEA 3KEQA 2GNOA 4D4IA 4O0LA 3NI2A 2BFCA 2IRWA 3AINA 2UP1A 5K8TA 2R6ZA 4JI4J 3I09A 2II6A 1JLQB 4MVJI 4GSYA 4BFUA 4GZ6A 4DUZJ 2A1TR 1LPMA 2XNHA 5H9EJ 4P83A 4EG7A 4EX6A 3HVIA 3EHEA 1NV9A 2J9FA 3ZWXA 1U1GA 4QBGB 2FC9A 1GTJ1 3B8EA 4J9MA 4G0OA 4WYLA 3KLIA 3MLAA 1FXUA 3F6PA 1C7IA 1P2VA 3IB3A 2FW1A 5FBZA 5HMMA 3SSRA 4WFAQ 4LRSB 5HKKD 1Q8BA 2G40A 5HVHA 1SEVA 4RLFA 3OM9A 4ZDWA 4CG3A 3DBRB 3ZLJA 4M89A 1NUUA 3VKUA 3PNLA 2FK7A 2FDCA 3KR0A 1BFDA 3K9GA 1E2JA 1XRQA 3HH8A 6AT1B 4IDKA 2BPOA 2DGOA 5JROA 1IHOA 2J33A 1A95A 2R7KA 3AY0A 3AVPA 3ETLA 4GRAA 1MORA 1C0PA 1I2MA 5MF6A 4IFTA 1P19A 2PBZA 3R0JA 1C0IA 2DTEA 3K2YA 4IGEA 1YNSA 3K53A 3AUUA 4IMIB 1Y80A 3TNVA 2UXDJ 3DVRX 2BOPA 3LDAA 3KHUA 4AY4A 2F40A 1YFJA 3EK2A 4BLPA 3R5CA 3P9KA 4PXBA 3GTYX 5EFOA 1RQ0A 2KFYA 3I4CA 3FTFA 2IUSA 5FNVA 2L18A 4CR7A 2BN4A 3THRA 2JGKA 4RJJA 3OFGA 4M0FA 4MQFB 2EKPA 2DKOA 4TXNA 4LPKA 3QX7A 1TTTA 4R8SA 3DL0A 3LGHA 2EQAA 3PQ3A 3EXHA 5BV0A 1ZD5A 5L1JA 2KU7A 4MRNA 1JT9A 3DLJA 2AEEA 3U5TA 2Q0QA 2X7IA 2MDAA 2ZANA 4NBKA 2RSLA 4OO3A 3MMAA 4NA2A 2AOTA 5TPWA 3CJTA 1WOPA 4ZLPA 4JQYA 1AZSA 2KDOA 4LYGA 1M5UA 5IOLA 3RJTA 5A8WA 4G1BA 4BNDA 2C2BA 4LC0A 2H85A 1RYMA 3OA0A 2CDNA 5BOSA 1Q3HA 5L3SA 1UVMA 4UZFA 4C3OB 4ZVOB 3JQMA 5LSAA 4FOOA 2FW7A 4RUCA 2YUTA 1QIFA 2X1BA 2VO1A 3ANMA 1QRSA 5CM9C 3QE2A 3GRKA 3FGPA 4ZQCB 5D86A 1GITA 1XZKA 3JTMA 2QBYB 3TYXA 3BH7A 1USVA 1GAXA 2ZR9A 4B5LA 4ZI2A 4BN0A 4D8YA 2DQZA 4C6SA 3WGQA 4HDQB 1SVDA 3UV7A 3NM6B 2ZAYA 4IQ4A 2XTMA 3L8DA 2DK2A 4ZVKA 3UFXB 3BEOA 1QOZA 1T9ZA 1XAGA 4IGKA 3KKOA 2HA6A 2FJEB 4KDFA 2XMZA 3ZDEA 1GK8A 2A9OA 721PA 1QG6A 3EE3A 3I6ZA 2IP4A 2VDKB 1BMQA 1JHYA 1YA6A 2ODPA 1R3UA 4CLUA 3ABRB 2XGPA 2HYDA 3KHLA 2QO3A 1Z5VA 1LQ2A 3PVSA 3A1VA 4KPGA 3LBYA 2Y6UA 4DN0A 3JSAA 3VFDA 2K4MA 3DFIA 4KVFA 3CZ5A 3CZQA 4FYJA 4P32A 4TL6A 2J0SA 1S7GA 1FMTA 16PKA 2FW8A 2Z6QA 1SBNE 1DARA 1G8AA 3ODGA 5FWYA 4HMOA 2JNJA 4YJ3B 1AURA 1P2GA 3RC2A 4QPCA 1RPJA 2Q4EA 3WLKX 2KKHA 3W5JA 2Z04A 5ETJA 3U49A 3A10A 2CJPA 4H15A 1KY5A 1PJBA 4I4BA 5F4BA 1FRHA 2I54A 3I4PA 3UNXA 1OWOA 3DE1X 4CLHA 1QGAA 1WKJA 5KTTA 1D1PA 2E6UX 5KU1A 3CCES 1F2HA 4NYPA 4NYZA 3JD2A 3TUIC 4RQTA 3D4IA 2ZWIA 4L5YA 1ENOA 4XYBA 4JI7F 1J00A 2FHPA 1KJ8A 2F4VJ 3OQOA 3C98A 2IDKA 4KV9A 5GJWC 4FXOA 1A9RA 2N9UA 3ACDA 4ARVA 3MQFA 5LJIA 1T0JB 1VL5A 1HE3A 1RJFA 1Z12A 1NF8A 4G26A 3WICA 4X44A 4OYAA 4MI6A 2CZGA 4YONB 4DQSA 1NVVR 1TCVA 3T8YA 3CJ4A 2RB5A 4URQU 2CSXA 1RWBA 3S8SA 3B1YA 5EXTA 3E61A 5DTIA 5CFNA 2UUAJ 4MWSA 2HSWA 3H5RA 5CA0B 3EVCA 1XLUA 5LQRA 2PEBA 2B61A 4LVOA 2B5JA 3CRVA 4BRUA 1IPFA 1KI1A 3TJ8A 5F1YA 4DLTA 3K20A 5BV2P 4RDCA 3T5LA 1DQSA 1JYSA 1SKAA 2G7ZA 3WFZA 4TS1A 4TRNA 2AD1A 3RAPR 1LK0A 4WKRA 1PBUA 3AUSA 3OHMA 1WXDA 3VU8A 1IEVA 2GB4A 2KLBA 1L5SA 3KTDA 4JC5A 3IJPA 2Q46A 4Q5VA 3GILA 1TT5A 3NHLA 2ZK7A 5DO2A 1NSTA 2C0QA 3SYZA 2JIOA 4C0KA 2OBMA 4BOYA 3ZWMA 2XSZD 2FPGA 3CVKA 3AB2B 4N5MA 3BYPA 2G0AA 3DMYA 3H2BA 2P6MA 2D5AA 2VHEA 3ECAA 1RJJA 1RLOA 2IYLD 3IE1A 1KN6A 2F1JA 5FV4A 1GQRA 1F60A 3SKVA 3OZ7A 2CFCA 2OR3A 4F45A 3D2CA 1REQB 5CJ2A 3SFUA 3LUPA 4EG8A 3T9ZA 4DQPA 4YT4A 3OX4A 3EG9B 4LRQA 1YE5A 2WVDA 2VB6A 3HFZB 1QPBA 3MIZA 3H3XA 3AF2A 4DRYA 3SKYA 1OD6A 3ZIUA 4IJVA 4A9AA 5G0UA 1IHXA 5BUQA 2YH1A 4I3FA 4GX5A 2P62A 4PHHA 2G9VA 1PUIA 2OWDA 3IC1A 3CX3A 1T0UA 1QAYA 3CH7A 3K72B 9GPBA 3DOJA 4EA8A 1TUWA 4RZQA 1M5SA 4I8IA 3FWYA 4RH1A 3F8TA 4TTAA 4UEWA 1WOSA 1H73A 4UDNA 4URYR 2R6CA 3D6NB 2ILZA 3RADC 1UK7A 5H4HA 2BCGY 5CH7B 4I66A 2RIPA 1IY0A 4UHEA 2RGCA 2GLUA 2F1FA 1WD5A 5CIWA 4ZOQI 3OP4A 2W8ZA 1YASA 2ZJQQ 3CDEA 1VBKA 5FBLB 2RHQB 4PS0A 3ZE9A 3VF0B 3C3WA 1P9OA 1UT6A 3AYXB 3V9PA 1ULHA 2MIIA 4KOEC 1O0PA 3IKMB 3BH0A 4MKGA 4S1VA 1RI7A 3QEJA 5HMYA 2RMLA 3PXXA 2I4OA 4YALA 4I50F 3HYTA 1HR0J 5BSEA 4IFBA 3TTSA 1R0XA 1RQXA 3UK6A 5D77A 4EW3A 1ULRA 3F4BA 4C88A 4RA9A 421PA 5HIIA 3P4YA 1WJ9A 4ETZA 1XRLA 2V7XA 1SVNA 3H75A 1CULB 1UJNA 3C5WP 4FLEA 4MJKA 3D6TB 2NLWA 3H2KA 1YBTA 5K0NA 2QSYA 2R6HA 3BJEA 1RRFA 1N6HA 1AN9A 1VBMA 2CXSA 1HG1A 1TKXB 2NUTA 2ASVA 1FNCA 3RH0A 3R97A 5KKAA 3LA0A 4OLHA 3DN9A 3DZFA 5LZ9A 4WLUA 1MV8A 1P4GA 2FZCB 5D3GA 1DHMA 1DVRA 1LWCA 3GLGA 5L3RA 3QNWB 1Y4ZA 4IH6A 4DSNA 4JYMA 3UJCA 4GP7A 4TWBA 4B80A 4L2IA 1OS5A 2QPAA 2H18A 2XTNA 4WK2B 2XVAA 1NJFA 3O3CA 2C5EA 4H7FA 4YRTA 1H9CA 2ACWA 1LWOA 1N5RA 1SQSA 3HYLA 2YH0A 3M1VA 4DQQA 3AI7A 1L1QA 3K58A 4BV3A 2LPMA 1AXEA 3A2MA 4X1YA 4MYTA 4XI9A 3WMRA 1BJKA 4HAIA 1KIFA 4ZCLA 1R8QA 1JZQA 4URVR 4QWAA 4QQKA 2HS0A 3K89A 4W1PA 4CTNA 4KOAA 4R5PA 2YV4A 4OUDB 2ZYAA 2HMIB 5AXCA 4NLLA 4HTFB 4NONA 5EPOA 5B58C 3W78A 1VHTA 1RI3A 3ICVA 5K0TA 4BTLA 2Q9CA 1SEPA 3HO1A 1EP2B 4CCAA 3NEKA 3J7ZT 1I01A 1T2AA 2XPCA 2PT7A 4LQ3A 3UOGA 4HL6A 3BT7A 2I1QA 3KLMX 2P5VA 1LSJA 3DKKA 4IOLA 2QV6A 4K0KB 2GA7A 1AF4A 1DDOA 2CV1A 1WCYA 3IWLA 4DV7J 1JFTA 3V6KA 1T9GR 2GTPA 2L9DA 2CZVC 4O4RA 5CX1A 1KDZA 5JSHA 5HK4A 3BD8A 3FOWA 3EB9A 1GV1A 2X14A 4N8NA 3OZRA 5ALGA 2LXIA 1AMOA 4KDEA 4O1IA 3B13B 1O95D 1KAGA 2Z8YM 3SOPA 5BNIA 2ZH1A 3PW5A 3I9NA 1PRYA 1O03A 1LJ8A 4G1IA 4TS4A 1G5FA 2JEZA 3SDSA 1HFEL 3VHXB 3MECB 1V4BA 3O84A 3RF7A 2VONA 1ZRMA 4B7ZA 2P77A 3JRWA 3EUAA 2WJZB 5ETKA 2H1FA 1IB6A 1KZGB 5AFSA 1HO3A 2M6KA 9ATCB 5KFZA 1VJ5A 2UUCF 5IXYA 3IH5A 3DS8A 4UT4A 3IAXA 4A2WA 4DPWA 5CU7A 2QV0A 1PR5A 3IAS1 4UM7A 2JLRA 1GA6A 1E1DA 3PFHA 2DGTA 1HPZA 2WHOA 3QE3A 4CL8A 1LJUA 1O77A 4MS4B 2MQLA 4MQEB 3ITHA 2OMKA 4ZKEA 3D43A 3QAEA 4KE5A 1DTWA 4B47A 4HQKA 2MKSA 4JYAB 1KP6A 3I2FA 5BNZA 4XWTA 4G1QB 1U9YA 2QGNA 3NHYA 2GK6A 1L7PA 2MKHA 1SIUA 4MVJP 5ALQA 4EMSA 3ND7A 3FGZA 1N9GA 3TVZA 1CSEE 4E8UA 3EHDA 3T4XA 1E5TA 3BL8A 1Q78A 1C29B 2FUEA 4JD5A 3HRHA 2M2BA 3K0FA 3HNRA 2TMKA 4O4GA 3T5PA 2E5JA 3CMES 5FPYA 4LY0A 3DE7X 4ZVRB 3BBLA 2KI2A 3M9WA 4M1MA 3CG0A 4QDXA 2YV1A 5JTUA 2QEQA 4C3ZA 5F3WB 3AL0C 4PCQA 4JBYA 1HNWJ 3PR1A 3ONWA 3FYSA 2CV0A 2MLZA 1Z6AA 3VV2B 4HEQA 4ZPWR 2BEVB 2W2QA 2J6TA 2Y71A 3DC7A 3WADA 1XG5A 4NA1A 3U44B 2FG5A 4OSPA 5KG3A 1ZMTA 2BR3A 1WPXA 3KNZA 3G5TA 5F21A 2OSQA 4KH0A 3IR7B 4NLDA 4BQSA 1K6MA 3CC7S 2BKPA 3LAMA 1QXSA 3T3GA 2C42A 1AXGA 2GSWA 2E5FA 4UEOA 4BLVA 1F14A 3A3OA 4ID9A 3RWBA 1Y48E 4CT0A 1C1YA 1HYSA 1L5FA 3R6LB 3TOXA 3IBGA 2OG1A 5K3DA 821PA 3K70D 1PSZA 2Z2ZA 5BN3B 3T5DA 1IH8A 4BWJA 3N2IA 4FE4A 2QXUA 1F6TA 2WWHA 5JASA 2R4TA 4FUQA 2WOMB 5GGXA 1GXLA 4AMBA 2P9JA 3OOEA 4C11A 5J2TB 2H6EA 3KQTA 3R0QA 1E59A 3AY7A 3L1HA 1DLIA 4O3FA 4L85A 3U09A 4B3OB 1IHPA 4QWMA 1WB6A 4J49A 3D28A 1AKTA 4I1VA 1SIWB 4GX0A 4ZQBA 1Z4JA 3HVJA 4WBXC 5LIRA 1L8LA 2VXBA 4J0KA 3GLFB 2V4RA 2FY8A 2IE0A 2ZH3A 4YB6A 1RAGB 1FDSA 3CJ8A 2HN9A 2YY7A 5AVUA 3LHDA 1M1NA 2XYPA 4NA3A 3EPHA 4LTNA 3PX2A 4KSBA 1AZLA 4XIYA 3T3MB 3N4WA 1IEWA 3LQVA 4EI9A 4WINA 3Q4GA 4XDZA 4YCCA 2AXPA 2WZ1A 2WJAA 2X2FA 3MA0A 2IYAA 4F38A 3D1OA