1K8AT

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1k8aT00
2MZSA 1NO8A 2DK2A 3RW7A 4F26A 2DNHA 2YH1A 2E5HA 2RS2A 1VQ6S 3TYTA 2DNOA 2I38A 2CPFA 2M52A 3VF0B 1YJWS 4WCEQ 3NS6A 1VQ8S 1DBDA 2K3KA 3BO4A 2SXLA 1U6FA 4WFAQ 3UD4P 2HVZA 3TP2A 4CH0S 2LEBA 2CQDA 1VQOS 2HGMA 1YWXA 1O0PA 1VC6A 2E5JA 2MKSA 1KC8T 1UP1A 2LXUA 2ADCA 5FJ4A 1U1OA 4RU2A 2KI2A 2MJUA 2AD9A 2CJKA 2X1FA 3L3CA 1X4EA 2PE8A 2D3OR 2XNRA 2OTJS 1R8HA 1FJ7A 2MQNA 4WFBQ 3U1MA 3P49B 5LSOA 4IOAQ 2M8DB 4OZ0A 1OWXA 1H2TZ 2DGOA 1WWHA 3SDEA 2M88A 2DNQA 1VQKS 1WEXA 3LQVA 2VOPA 3UCUP 2I2YA 5HL7Q 4P6QA 2JWNA 2AYBA 2HYIB 4WF9Q 4CQ1A 4TU7A 1VBXA 2CPEA 4QU6A 1H6KX 3H2VE 2KH9A 4TU8A 2MJNA 2YWKA 2RVJA 3NNHA 1H2UX 2AYMA 5H1SV 2MMYA 4Z2XA 2DNGA 1RK8A 1VQ7S 2F3JA 3K0JA 1WF1A 1WTBA 1X4CA 1VQ4S 2G0CA 2ADBA 4YUDA 2E44A 1VQLS 3CCLS 3I55S 2MXYA 2RRAA 3THPA 2KM8C 2DNNA 2MKCA 4PR6A 4C4WA 1U1NA 1X4FA 3VALA 2MZTA 2FPHX 2ERRA 4C0OC 3FEYB 1WHXA 1FT8A 1PGZA 2CQ4A 1VBYA 2N82B 2DHXA 4J5OA 3H2UB 4W90B 1M5PC 3B4MA 2MQLA 2U2FA 2GO9A 2QFJA 1U1RA 1XN9A 2MY8A 2A3JA 2M9KA 3DXBA 3JB9k 2MSTA 1QVGR 5IQQA 3CMES 2LEAA 2G4BA 2NLWA 1IQTA 2Q79A 4A8XA 5BJRA 2MZQA 2CQ1A 3EGNA 2B0GA 3UCGA 1WEZA 2JX2A 2X1BA 2YH0A 3MI7X 2X1GA 3UWTA 3CCVS 2DGUA 2FY1A 5IFMA 1YJNS 1WG1A 2LECA 1N54B 2GHPA 4QPTA 2CPYA 3UCZP 1WI6A 1SJ4P 1M5VC 1SJ3P 1OIAA 1RKJA 2M4MA 2MGZB 2KT5A 2M70A 2RUGA 2DNMA 1DHMA 3N9UC 1K9MT 4PKDB 1VQ9S 2N7CA 1HL6A 1YHQS 2MSSA 2DH7A 5MLCV 1X4GA 4WFNQ 2LA6A 1X4DA 1U6BA 4Y00A 2VODA 2LA4A 1ZH5A 2K8GA 1WHWA 5IM0B 2BOPA 2MQOA 2DHAA 3PIPQ 1WI8A 5LXRA 5HO4A 5DDPC 2WBRA 1YITS 2OIHA 3VAJA 1ZZFA 4LJMA 2XS2A 5CA5A 1VC5A 2KXFA 4TLQA 1VQ5S 2MQQA 1N8RT 2MZRA 2YKAA 2X1AA 1CVJA 1ZZNA 3CTRA 3CD6S 4FXWA 2MZ1A 1L3KA 1P27B 2KG0A 2CQ3A 4QU7A 1B7FA 2VOOA 1NU4A 5D78A 2N3LA 3CCSS 4IOCQ 1R8PA 1M5KC 2LMIA 2EK6A 3CC4S 2LKZA 2YTCA 5DM6Q 4YOEA 5DDOC 2DO4A 2KM8B 3TO8A 3CPWR 1YIJS 3EGZA 2HGNA 1D9AA 5GADU 4IUFA 2CQPA 2DHGA 3CC7S 2KHCA 2KXHA 2XNQA 3CMAS 3R1HA 1S79A 2RQCA 1YTYA 2CPHA 2RU3A 2DHSA 3S7RA 3RW6A 1WEYA 1VBZA 1VQPS 3SXLA 2EK1A 2DGTA 2G1DA 4OZ1A 1FHTA 2CPDA 2MPUA 1WHVA 5JVGQ 2OSQA 1VC0A 1PO6A 2MKKA 3VAKA 4CIOA 3THTA 4V19X 1AUDA 5LJ5Y 1W2BR 1SJRA 2D9OA 1X5SA 2HGLA 3CCES 5LXYA 3MD3A 2DNPA 3UE2A 1D8ZA 1X4HA 2DH9A 2OSRA 2RQ4A 1Q7YT 5LSLA 2RS8A 3S8SA 3MD1A 1JJ4A 3G9CA 2XS5A 1Q82T 1YI2S 2MQPA 1U1LA 2F9JA 5DDQC 3R27A 5D77A 3P3DA 2J0SD 2OJ3A 1JJ2R 2QA4S 5EN1A 3DLLQ 2QEXS 2KN4A 1WF0A 1X4BA 1G2EA 2KG1A 3B4DA 3CF5Q 2DNKA 2XSFA 1OO0B 4CH1A 4QQBA 2CQIA 4F25A 1X5TA 4PRFA 3J7YU 2RT3A 4W92B 2VONA 2CPXA 2ZJRQ 1K73T 3I56S 1KD1T 3CCMS 2UP1A 1JMTA 1X4AA 3SDEB 2O3DA 2E5GA 4TU9A 2LQ5A 1A7GE 2DISA 2DNLA 1Q81T 1KQSR 2E5IA 1M1KT 2DH8A 4BS2A 1HA1A 3ZZZA 3PIOQ 3G8SA 3MOJB 1WG5A 1N52B 4ZKAA 3Q2TC 2LYVA 1N88A 1URNA 3G4SS 3D2WA 4C7QA 2PEHA 3CCRS 1WHYA 4F02A 3VAIA 2KYXA 1FJEB 3IRWP 3CULA 1DRZA 2CPZA 5CXTA 1U1KA 1U1QA 2CPIA 3CXCR 2L9WA 4M5DB 1X0FA 3Q2SC 2KU7A 2KVIA 2RNEA 1SJFA 2HZCA 3US5A 3G71S 2MHNA 4UY8T 2LCWA 3MUMP 4U67Q 2MKJA 2M7SA 5DDRC 2XS7A 1OPIA 1UAWA 2KXNB 2RRBA 3MUTP 2MY7A 3S6EA 3MXHP 3HHNB 2KFYA 4WIIA 2J76E 2KRBA 4ED5A 2FC8A 2DGXA 3MUVP 2MGZA 2CQGA 2M8HA 1KOOA 1M90T 3BS9A 2MQMA 3SMZA 4Y0FA 1F9FA 1X5OA 3BO3A 2AYEA 4FXVA 2DGSA 1SXLA 2OTLS 2DIUA 5IM0A 2L08A 3MURP 1P1TA 1KOHA 3ZZYA 1U2FA 3R1LA 2FHOB 3EX7B 2JRSA 1DZ5A 2MKHA 5GAGU 1U1MA 4YB1P 2FC9A 1UFWA 2MYFA 2U1AA 3BEGB 1FO1A 2CQHA 5GAEU 1QVFR 2DNZA 1FNXH 3VAFA 5CYJA 2DNRA 5GMKa 3IWNC 3FEXB 2J8AA 2DNYA 3P5TL 3NMRA 2D9PA 3HI9A 2ZJQQ 3G6ES 3P6YC 3VAGA 2CQ0A 3CUNA 1QM9A 3VAHA 3NNAA 1UW4A 2DB1A 3NS5A 3BO2A 1A9NB 1SJQA 2MKIA 1FXLA 2DITA 2L41A 3CCQS 3G8TA 3OW2R 2F9DA 3NNCA 2EVZA 5LJ3Y 3MDFA 2LXIA 1NJIT 2JVRA 5GAHU 4LIRA 5ITHA 2NZ4A 4WKRA 2DGVA 4ERDA 2JVOA 4UQTA 3S01A 1K8AT 2DIVA 3LPYA 1VQMS 2DGQA 2DGWA 5DM7Q 1WF2A 2CQ2A 2M0GB 1X5PA 3UD3P 4LMZA 3V4MA 2ZJPQ 2V94A 1YJ9S 2CPJA 2CQCA 1JJHA 2MZJA 3ULHA 1U1PA 1BY9A 1HD1A 1S72S 2BZ2A 2KRRA 3G96A 2MB0B 1WG4A 1WELA 2AYGA 2J0QD 3CC2S 3CCUS 5GVQA 5JVHQ 4EGLA 1VQNS 2DO0A 3U1LA 3CCJS 1Q86T 2N3OA 1M5OC 4IO9Q 2XB2D 2CQBA 1HD0A 5DETA 3VAMA 3J7ZT 2M2BA 1FJCA 1H2VZ
chains in the Genus database with same CATH superfamily
1VMBA 2VFRA 1FKPA 4EFAC 3EYZA 4KRWA 5IT4A 1BUXA 2D3O1 2I38A 3SBMA 1EKSA 2K3KA 2FJDB 3UD4P 3OTEA 1VK3A 1Q78A 1VC6A 3FSXA 2LXUA 4R5PB 2AD9A 4HT5A 2G2OA 5LSOA 1HQEA 3JYTB 3PX0A 1M1GA 4NXNF 4E98A 2R2RA 3MAAA 5J1NA 1NK7A 4Z37A 4CQ1A 4GVBA 3OVBA 2BANB 1RT2B 2YNFB 4ZMMA 3OJSA 2BXJA 4IO1A 3VGTA 4DDFA 3GJQB 2MMYA 5KAKA 5KFQA 1J5OA 3B54A 2F3JA 4IG3A 2IHR1 2Z2LA 4IOBA 5IC4B 3FBBA 2D41A 5F3ZA 4V19J 1NZ8A 2CA9A 1RT3A 4Y2MA 3BSOA 5JUMA 1S7HA 1ZA2B 3M6WA 4A8MP 4RBVA 5F8LA 3AXKA 5IC6B 1PJ7A 1NK5A 1JLFB 3HCXA 1WEZA 4ECZA 2DGUA 1IN0A 2W4PA 3D67A 3GPAA 4F4ZA 1HWUA 2ZUGA 1LWFA 3PW0A 4O0NA 4DR7J 3AT1B 4YEAA 3CD0A 1YRUA 4PKDB 3AA8A 1YGYA 3ILJA 1KNZA 4NXMF 3NEKA 1NZAA 3NWGA 5DDPC 3DHXA 4LJMA 3GE9A 5J2PA 3CJTA 2WB4A 2O66A 3OL9A 3ZNJ1 4KH1B 1S7IA 4MK8A 3AA9A 2XULA 2VU5A 2CQ3A 4DV3J 1RSCA 1RWUA 2CNNB 4HT7A 4U96A 2J7WA 1K0VA 4PPDA 1D8YA 3PEJA 5EX3A 2DHSA 2QLFB 3TZWA 1VBZA 4KH0B 1RWPB 4WE1A 1TVRA 2BM1A 4RNHA 4OHZA 2VFSA 4L75A 1PO6A 3THTA 1AUDA 5M2RA 2YBVA 5D3GB 4F2SA 3MPYA 4DCPB 3HT0A 1VBKA 1TUVA 4KO0A 1N0UA 2R7XA 3KJVB 2HQIA 2VBWA 2P9CA 3MHYA 5L1LA 1N48A 2XI3A 3P3DA 5J2MA 5T14A 3CF5Q 3I4PA 4PQUB 5L1JA 1GX5A 1NJZA 2JH3A 4XDCA 4NOHA 2JDJA 1ZPWX 1VYAA 2CPXA 3K5OA 2QMXA 5F3TA 1JMTA 1X4AA 1YVFA 1F0XA 4EMDA 1HYSB 1FWLA 2D1CA 2DNLA 4GMKA 1HA1A 3NKYA 3TZXA 3IRXA 1FFSB 3CWJA 1KN6A 5KFCA 3W66A 2FZGB 1NK6A 5KFGA 1FK9B 2G1HA 3CXCR 4NLWA 3US5A 4DUYF 3R5BA 3MUMP 4ZCLA 1S6UA 3GTYX 2BYCA 5DDRC 3NGUA 4RW4B 3GCXP 4OFZA 3VQSA 8AT1B 3PV8A 1N0VC 4OX7A 3HDSA 2ZBIA 3SCLE 4ED6A 1ZOTA 3A4TA 4WP8A 3BS9A 4ELTA 4X62F 4N77A 2JEFA 1SXLA 3MEEA 2GNKA 1TV6B 5FLXY 3U02A 1NRKA 5ETQA 3W9JA 4NMLA 4CLYA 3DOLB 2ZC4A 4YB1P 1R3NA 4QIVA 4Q44A 5KOWA 3MOZA 3IR5B 4KPCA 3ENWA 2DNRA 2J0WA 3V6HA 5B7WA 1GAOA 4E0DA 1FWKA 2RH3A 1SQGA 3MF5A 2DBBA 4WJBA 2ZH1A 4WP9A 4LFCF 4CT9A 2RILA 2R7UA 2IMWP 2HBZB 4I69A 1RP5A 1MLAA 1WF2A 4JYAJ 5FD1A 4DG1A 1UVNA 1HD1A 2FD2A 3OSPA 5CD4A 1IKWB 4ANEA 5GMEA 2DXFA 1R27B 3D3CJ 1CLFA 1UA1A 3KHHA 4FYVB 3QAUA 4YB6A 2C3OA 2HHQA 4NEZA 3RZAA 1KVIA 3SZ2A 5AE3A 2M52A 5IV3A 3NS6A 5F8HA 1HBOA 2LEBA 4RW6A 4N47A 2RMLA 1Z4UA 2MKSA 4WBFA 1KC8T 4USWA 2N4CA 3Q8RB 3FEZA 2MQNA 2UUAJ 2XGQA 3W5YA 2VC1A 3M8PB 1H2TZ 4IH7A 2K3IA 5AXMA 3IS9A 2EBEA 3RB0A 3LP1B 1NK9A 1L3TA 5B0CA 3JTNA 4HEA9 1RISA 3EPIA 2CADA 2IMOA 1H2UX 5EX0A 3UVJA 2V67A 2M5YA 3TUZC 4ZVFA 2G2ZA 4ZJLA 2QC3A 2ADBA 4EEYA 3HD1A 4ZPAA 3THPA 2DNNA 2MTLA 1QUVA 4C0OC 3PW2A 4B3RJ 3U27A 3DRRA 3J7YI 3RUBL 3HULA 1FKOB 4MYTA 2NXJA 2ACMA 4NYOA 2V34A 3D68A 1S1XB 4M5GA 1ZBTA 3S1TA 4ZVGA 4DCOB 3HK2A 4FNIA 3HFVA 5DGAA 3GJRB 4LRDA 4CT8A 1WG1A 1HMVA 4N56A 1C0TA 2KZMA 4QPTA 3C3LA 1VRUB 4ECXA 4J9MA 2LEPA 2JFKA 1B64A 2N7CA 1X4GA 3PO5A 1X4DA 4M8LA 3QLHA 4DL5A 2BE2A 3GFYA 4ZK7M 3GP9A 3C16A 2OIHA 3WX4A 5EGYA 2QA1A 4RWXA 2NR0A 3DLEA 4OJ3A 1LKZA 1OSCA 2MZRA 4FDFA 1N8RT 3CTRA 4HH1A 4Y2KA 1UZHA 3LTOA 2VFUA 4DV6F 1VIXA 4NLUA 2N3LA 1LOUA 3EXCX 1RWMB 2W9BB 3I6PA 3C14B 4N5SA 3TO8A 1HNXF 5GADU 2EC2A 5SUHA 3CC7S 2UUCJ 3W2VB 2F7VA 2BJ9A 1FJGF 3M8SA 2ZH6A 2UU9F 2DVIA 3R5GA 5HJXA 2VKZG 3VGUA 4DFPA 4V19X 3A8IA 3QGGA 3OFEA 3AQOA 4R5PA 4UT4A 4PXDA 2VA2A 1HBUB 2MDAA 3IR7B 1T11A 2ZOFA 5HVFA 1JB0C 2GAGC 4WYWA 3JYTA 1T3OA 1K0TA 1OYEA 1Y3KA 3IMQJ 1G2EA 4X4SA 2BANA 3OFGA 1RT2A 2YNFA 2R7VA 2KJVA 2EW9A 2VBYA 3AOBA 2R8GA 4W92B 4GC7A 2XWXA 3VVTA 6FD1A 3ZXWA 3MFIA 1NXIA 1RWXB 3W2WB 2OI2A 1W2IA 1SKRA 3BN7A 1ELOA 4ZKAA 3Q2TC 4AL6A 1XNQJ 5I42B 1FJEB 3IRWP 2XYGB 3X1LB 5J1PA 1U1KA 2CPIA 4J90A 3OFHA 4OZ5A 1UEVA 2KU7A 4JI4J 2H3EB 1WD6A 3OL6A 3J80Y 5GADI 1JLFA 2XY5A 4O3RA 2VPWB 3PNIA 4NYPA 1U8SA 4CNZA 3BYPA 3MUTP 4ID8A 1BD6A 2CNKB 1HPZB 3TW0A 4YY3F 3D6MB 4DLEA 2W2OP 2CQGA 4NLVA 2HLUA 3DNCA 2NXUA 4DFJA 2AZ3A 3BO3A 4FXVA 2F8MA 2H5EA 3CCWA 1RAIB 1JNZB 2C2ZB 1QTNB 2XWYA 1FO1A 2XEXA 3ZFVA 3FCWA 4TXSA 5HVGA 3OLBA 3LH2S 3QZ8A 4NX9A 5KFHA 3VZHA 2F40A 3PYEA 2IM0A 1UW4A 1EQ0A 1B0PA 4QIWD 2F8EX 3E3XA 3GIKA 3QRRA 2VD3A 5GAHU 2ATCB 4LRFA 3QT8A 1NJWA 1WC5A 2YY3A 1F2HA 3GQCA 1RWOB 4CLWA 4YR0A 2Y1IA 3D6FB 2UVVA 1GTEA 3C66A 1NHVA 2DY1A 1V5VA 3G96A 1S0OA 1WG4A 2C22A 4BC7A 4ED3A 4A8QA 3C46A 4O44B 4JBCA 5D3GA 2N3OA 1M5OC 2F4VJ 3EGWB 2M2BA 3RGIA 5C42B 2GIFA 4DF8A 2MZSA 2DK2A 1IBCB 3KJVA 3G2XA 1VK8A 3QATA 1YQHA 4A47A 1VQOS 9ATCB 5CZVA 1TK5A 1YX2A 4TN2A 3RRHA 4PQUA 2CJKA 1FDBA 3I96A 4IR9A 5K20B 3NGKA 1RAOA 2DNQA 3N5FA 1HYSA 4D3GA 1X31C 4Q2LA 3GFZA 4TU7A 2C2OB 1HR0J 1KBRA 4TU8A 2A2CA 2MJNA 1YK9A 4RPFA 4OJ1A 4O4GB 5LMUJ 1FK9A 3HT3A 3VZIA 1VR6A 2E9TA 4QOTA 2XYHB 5GAHI 3F56A 4O23A 4RW4A 1YJRA 4A48A 3HHLB 3KJNB 2DHXA 1NSPA 2D3UA 2GIRA 2GO9A 1AXQA 3NAIA 3T1HJ 2I1RA 3KFWX 3T41A 3AFGA 2PN6A 4UZCA 2CDQA 1TV6A 3VHQA 1SUQB 3DOLA 2HAIA 4ALZA 3IWXA 1UKUA 2M4MA 2RUGA 2DNMA 3N9UC 3T5KA 6FDRA 5D4NA 3SCKE 4MTPA 4I2PB 1PKUA 2RB7A 4KBIA 1P9YA 4LSLB 4HI2A 4OV1A 1EQMA 4USVA 3H90A 2FHJD 2KZZA 3PCOB 1IKWA 3T1YF 5B0FA 3LA0A 2IM1A 3QO9B 1XNRF 2BVZA 3RTVA 4N41A 4KAIA 1U45A 3PR4A 3CMAS 2CPHA 5JMNA 4DV5F 2J7UA 3VGSA 1SCJB 4GVLA 4LFAJ 4CP5A 4OZ1A 1F3VA 1WHVA 4DQSA 4LF4F 1U26A 1FEHA 1OS5A 1CJVB 3ZTOA 3C15B 5A2QY 5I3UB 2HHVA 5KT2A 1NDPA 1YSJA 3CCTA 5IOLA 3MD3A 2C3UA 1QAJA 4USMA 4CI0B 4LSZB 4OYOA 2RQ4A 3SQOP 3M8PA 2HNDB 3WC0A 3MCNA 3HFKA 1OMSA 1NKCA 2FZCB 2R3VA 3LP1A 4HR2A 3QRQA 4KFBA 3B4DA 1LWXA 1UWBB 4ZN3A 2O1PA 2CQIA 2YKMB 1Q4RA 3BZQA 4ILRA 2E5GA 3PKMA 1M1KT 1SC3B 4PQAA 3IBWA 2WW4A 2OMLA 1LK7A 1CS4B 4U8VA 3TJAA 3BBFA 1FKOA 1DRZA 3W61A 1X0FA 3I9V9 3LAMA 2HZCA 4LVOP 1UVMA 1C0UB 3UN3A 4RR5A 1S1XA 4ZP9A 2GMHA 2HAFA 1RACB 3BGOP 4IRDA 1PYTA 1F9HA 1VRUA 2ZWOA 1AROP 3KG4A 1ITPA 2QT7A 3SSSA 2Y9HA 2VQEJ 2E5LJ 4KC5A 4HDHA 2ZH8A 4A8SA 3ZZYA 3EX7B 1LWCB 3TAPA 2B51A 2A2DA 4HACB 4DBQA 1YDLA 3PJWA 1IBMJ 1N34J 4AD6A 1SH0A 2GGPB 2I0XA 3FEXB 1NSQA 3J7Z5 3P6YC 3TUJC 4DEZA 1K1SA 5A76A 3MWBA 1Q8IA 3H25A 2EVZA 2W9BA 1Q79A 5HANA 3C14A 5ITHA 4YS2A 3I5CA 3GZ7A 1ROFA 2AX0A 3W2VA 2CG8A 2IRYA 5DM7Q 4M95A 2CQ2A 5FIIA 5A8KB 1HFEL 1RT7B 4HYKA 2ZBCA 1UETA 2IYIA 4DF4A 3AD9C 2ZUAA 1Q86T 5KFFA 3HX9A 3TZZA 4UUWA 3DMJB 4DV2F 1HBUA 4KGKA 1SPBP 1UVKA 2ZEJA 2DHHA 5HATA 3DC2A 5HJYA 4A4JA 2UVRA 5M2PA 2H48B 3Q8YA 2V2KA 2IYGA 4ZPDA 4DR7F 2V4QA 1SKWA 1UCNA 3OVSA 1KVJA 4DCJB 5FJ4A 4DX5A 4EYHB 4DV4J 5CYQB 4HKQA 1ZM4A 4WFBQ 4EBCA 1ZAVA 2ZZMA 4FF3A 4U6PA 1UVJA 1XTZA 2FJAB 3CO9A 3W2WA 3MM6B 3ET6B 3UPFA 3UCUP 1S1TA 3EWGA 3BSAA 1REVB 1RLDA 1HNVB 1ZA1B 3L4BC 2RVJA 5I42A 2KFNA 4EO6A 3SCIE 4LF8F 3PR5B 4DV3F 4BCAA 1XC9A 4DQRA 2CRLA 1SH3A 1TL3B 3QNWB 4PWDB 1XMQJ 2AW0A 3CCLS 3I55S 3D1HA 3KJFB 3VALA 2MZTA 3M8WA 2QV6A 2NSCA 4ECWA 1PGZA 4ZIWA 1HPZA 2AU0A 1M5PC 3MR3A 1DLOB 3JB9k 2EI5A 1IQTA 1TUWA 3OFFA 4KY3A 2DY9A 2XQCA 2X1BA 1S1VA 3GMGA 5D0GA 4JI5J 1IKXB 1OIAA 1FTCA 2KT5A 1FFGB 1HL6A 2BKPA 2B56A 4ZVEA 1N36J 4BHQA 4B9LA 2VA3A 4F50A 1YITS 1TL5A 3UNYA 1RHQB 3MAHA 4TLQA 3KLGB 2O01C 5C25B 2DT9A 2YKAA 3M2UB 4ID5B 1TMJA 4FXWA 1L3KA 3DDNA 1HI0P 4XAKA 1P27B 4DHVA 1T95A 1B7FA 2ROPA 5GAEI 1U7LA 4O44A 3AAWB 2HGNA 2ZZNA 2DHGA 1TL4A 1HKAA 5C42A 1S79A 4OZ3A 2G9OA 3W5ZA 1O51A 1VJWA 2OSQA 5DLGA 1YRXA 3UW1A 5KFOA 3CD5A 3KNGA 2JEGA 2C28A 1D1UA 2OSRA 5LSLA 3S8SA 3G9CA 2CWKA 5B0EA 2PSZA 3VCDA 3CJ4A 2WK4A 1KTVA 2XGPA 1FRLA 2XMTA 2FJVA 3FGVA 1V6HA 1LV5A 3Q86A 4LF9J 3POTA 3EM1A 4O4GA 4NCAA 4NA1A 1RTDB 2RT3A 1KFSA 2KHDA 5LOQA 2J7KA 1FVSA 5HP1B 2Y8WA 4K8RA 4J9NA 3BDEA 3JTOA 3JAMU 3UFCX 2UXCJ 1RT4B 1YG0A 3ENAA 3HHLA 2P8IA 5HAOA 2APOA 4M5KA 3CCRS 4F02A 4WFZA 2CPZA 5CXTA 4Q43A 5EDWA 3JQJA 2JZ5A 2J9EA 4DR4J 3IGVA 3A3PB 1F9EB 3HVRA 3IA0A 1SUQA 4WIIA 1M5SA 3ZTPA 3QGHA 2GAHC 3PDNA 1CQNA 3MTKA 3JSMB 1C1BB 2V4RA 1IBLJ 1KOHA 4BBYA 1IWGA 4G1IA 4I2PA 3QGIA 1ICEB 4I0WA 2IVYA 4LSLA 4DSKA 2DNYA 3NMRA 2R4FA 1TFWA 3HHLD 2OP5A 1SJQA 1PIEA 2LXIA 1LW2B 3QO9A 2GS8A 4KJIA 2FTRA 5F0WA 2D69A 2DIVA 5KFRA 4X66J 3KYLA 2NXEA 3V2UC 2O67A 1RWNB 1U1PA 4B9TA 1WOSA 1UJ5A 1QAIA 1CJVA 3C15A 4NLGA 5KFXA 5I3UA 4DSLA 2DO0A 1XR6A 5A6PA 5DETA 4DR1J 4CM0A 2Z30B 1TKTB 3VGVA 4Q0BB 3KUEA 2HNDA 4ZHRB 2V6AA 5KFUA 2AEMA 4CH0S 1RTIB 3V81B 4ZLNA 2GQ2A 2V8PA 3KTQA 1PAUB 2HRYA 2BMBA 1UWBA 2HBQB 2HHUA 2YKMA 3H0PA 3AJDA 1PJ6A 2G2YA 3OUYB 4Q8FA 2AMCB 1OWXA 3X3UA 3Q8UA 1N5TA 2IM2A 4WXOA 1EB0A 4P2FA 4RJVA 3JS9A 3R2CJ 3CDEA 2JWNA 2CWXA 5T7LB 2DRBA 1S6PB 1CS4A 3W3SA 3M05A 2YWKA 1OQ6A 1EAYC 4C9DA 3Q8PB 2QYCA 4ECRA 4Y34A 2CZVC 3K5NA 3KUHA 2RJZA 1FWPA 1KTQA 3Q22A 1C0UA 5IV4A 2HHTA 1G7CB 1FD8A 2E44A 3UDVA 3UDCA 2DRDA 3E01B 2VH7A 2DCLA 1R31A 3V5RA 1VBYA 1VCTA 3CJ0A 1UZDA 1NMEB 2B9YA 1QAYA 2VG5B 1SC4B 2Q66A 2FY1A 1YZ6A 1LWCA 2C1EB 2QL5B 3KDOA 2IC3B 1N54B 4HACA 1M5VC 1Q1KA 1TAUA 2RDDA 2GGPA 3QIDA 1KEKA 4WFNQ 2LA6A 2H9ZA 4RX6A 2OH2A 2UV8A 5IM0B 1Q0NA 4ZITA 2EC0A 2KJWA 1NBEB 4K4XA 3BV8A 3R7NB 4DR5J 4UTGA 2X7IA 2F5GA 5KFMA 5A8KA 1RT7A 4IH5A 2HLTA 2C3PA 1XJWB 3R9LA 5GAGI 4U7CA 4EU0A 2ALYB 3B78A 5DQHA 1D9AA 4JI4F 3RRGA 2PD1A 1RBAA 1RAJA 4JI1F 4CLZA 3DMJA 3HKZD 4ECYA 2JLFA 2FJEB 2PC6A 4KGMA 2EK1A 4ZLJA 1U09A 1S0NA 4RW9B 2MKKA 4CIOA 1PC4A 5ETRA 4I6AA 3H4BA 1VISA 3QGPA 1W2BR 1D0EA 4M94A 3RAXA 4RO0A 5F8MA 5CYQA 2J0XA 2WSEC 1UEKA 1UJ6A 1DY3A 5RUBA 1YI2S 3V6KA 3EPGA 2G0JA 3SSQA 2W8KA 3MM6A 2OJ3A 4P7VA 3ET6A 3OJUA 4I1TA 5E5NA 1REVA 2LDIA 4LT6A 2DNKA 4LQ3A 1R8CA 4OHWA 3ISND 1IJFB 1BQNB 3HXMA 2NXNA 4HVZA 5E3AA 1T03B 4K50A 2UP1A 1WNEA 1TL3A 3H42A 3FKBA 4PWDA 3NL0A 2Y0BB 4CRJA 3EDRB 4ANCA 4JI7J 5U47A 4FNHA 2DR6A 3VAIA 4P7TA 1X9WA 1DLOA 1H38A 4ILLA 3AH6A 2MKJA 4YHHJ 3ZC4A 4JB8B 3MR6A 1L3VA 2JEIA 4PCQA 1S99A 1JLAA 3DM2B 3MEGB 1M90T 3AB2B 3ZNUA 3KG0A 2DIUA 1IXKA 1RKIA 4OLPA 4HDGA 3M30B 3O3LA 4HHHA 3KLGA 5A2QU 5C2GA 5C25A 2KB2A 2ZVIA 3M2UA 3MPVA 3LP2B 4DLGA 3T6JA 3QFHA 1QM9A 2ZM6F 1HR0F 1VLOA 3F73A 4TNOA 3DFEA 2UUTA 2VPXB 5LMUF 4JI0J 4NEYA 3MDFA 2LVWA 3HVWA 1GH8A 2J9DA 2NZ4A 5JXSA 1R7IA 2JEJA 2P9EA 2MQ8A 4LSNB 1R0AB 1RTJB 3GWCA 1Z2ZA 1YJ9S 1Y10A 1D3WA 3M9NB 3BKUA 1N5QA 3G86A 3ILOA 4OZLA 4KGVB 2DD8S 4P2SA 2HHHJ 2FVPA 3H2LA 1K47A 2GC8A 1FEEA 1FJCA 1YRTA 2V9KA 4QZVB 1TK0A 2V8DA 4L3NA 2YH1A 1ZM3A 2AP6A 1X9MA 3TYTA 2DNOA 3QAEA 2CPFA 4DPOA 3BO4A 1B3TA 4RUCA 2CDRB 3HFZB 2QLJB 1HNWJ 1S49A 2V8VA 4RU2A 1L3SA 3I4HX 1FJ7A 1R6YA 1RTDA 3U1MA 3PVXA 2XMKA 1NH8A 2B9WA 2YWHA 3H5SA 4IQMA 5HP1A 2J9DE 1B4SA 3T19A 1RT4A 4GKJJ 3IG1A 3EMTA 5IS2A 4ETZA 2GMLA 3VQTA 4NCGB 3NG8A 4R25A 2EKNA 1WF1A 1S6OA 3M7VA 4I64A 2W2NP 2HS4A 4OZ2A 4I4BA 3B4MA 1OJ4A 4IYQA 2FIUA 3MMCB 3PW5A 3N5BA 3SI8A 1QVGR 3JSMA 2PMHA 1C1BA 3M4XA 1DTQB 2HQDA 4A8XA 3KHRA 3HPOA 2MKYA 2MZQA 1QSLA 1RTHB 4KHPF 2ROEA 4PXCA 5THWA 2C2MB 2HFOA 3CCVS 3C19A 3CE8A 3TUPA 2Q6BA 4M63A 3K2YA 1DHMA 2YVSA 3PG9A 3HM9A 4ZJQA 4Y00A 2HHPA 1ZH5A 2Y3YA 4UOFA 3PJ9A 2ZH7A 1LW2A 3NY0A 2EFQA 4LF1A 2XO7A 1JKHB 3AD8C 3GCWP 4ENOA 3CCSS 2ZBPA 1M5KC 4K5SA 1IJEB 2KDOA 4G1QB 1TKTA 4Q0BA 2YNHB 4ZHRA 3TJ8A 3FQLA 4PG4A 1I94J 4NRUA 1RTIA 3V81A 2UUWA 4YDDB 2VQEF 3CB4A 2E5LF 3PJXA 1X4HA 4DSIA 2ZHBA 2ZKUA 3CGIA 3OUYA 2VPYB 4A8OA 5DDQC 4I67A 1IBMF 2QA4S 1N34F 4X64F 3DLLQ 1HWKA 3ONQA 5T7LA 1S6PA 4ZDNA 2HQ3A 3D4JA 4K5RA 4XPCA 3J81Y 4MKBA 1N6QB 4BWMA 4DJBA 3MMBB 3R2DJ 1MMLA 3E01A 3MOJB 2AIRB 4ZCKA 4QPXA 2A6OA 3OR2B 2E7XA 7FD1A 4C8KA 3MCMA 4AQYF 2NUUG 4UY8T 2BUNA 3PY8A 1JLQB 1TR0A 3TOQA 2VG5A 2XG8A 2CZ9A 1P8GA 3S6EA 3DDIA 2IC3A 4XDDA 2FZKB 2D74B 3MMJA 4F4AA 4NL5A 2QJ3A 4I6YA 5IM0A 3MURP 1NNDA 2FHOB 4DV4F 1DZ5A 5BXIA 1WTFA 2FJWA 3CVKA 2U1AA 5BYQA 3QT6A 4OYXA 1WUUA 1Q8BA 1TKXA 5AE2A 3NNAA 2VV5A 4C8NA 1TL1B 2C2KB 1E6YB 2AX1A 2OMOA 4ZVSB 3RBZA 2Q43A 1UA0A 1RYSA 1GTHA 4MJKA 3D28A 4JI6J 3TJ9A 1XMQF 2Y0SD 4MH8A 4NLDA 1AB8A 4NYZA 3EGVA 2FJBB 4C3MA 1FX4A 1BY9A 3W62A 4RW9A 3MECB 4B3MJ 2LQJA 3I9ZA 5JVHQ 4EGLA 4NLSA 2E9ZA 4W4MA 1HD0A 4F7VA 3NOCA 4CO4A 2CUYA 4AE5A 3E8OA 1VQ8S 1U6FA 4WFAQ 4C8YA 1T94A 2DPJA 5H9EK 3OPKA 1XMOF 1RBOB 2Z2YB 2KI2A 4USTA 2X1FA 1BQNA 1L3UA 1WSVA 3RBXA 1S4FA 3P49B 1Q8LA 4DR3J 1RT6A 2AWZA 4TQRA 2PA3A 1T03A 1DQ8A 1LFPA 1ZAXA 4OJHA 1NK4A 3T5LA 1H6KX 2V8GA 1UL3A 3OTBA 1S1UB 3NOGA 3Q89A 2BJ1A 3GJTB 2E1AA 4KKOB 1G4CA 1H0HB 2ZOMA 1SI9A 3PKYA 4PZVA 2ZHOA 1VQLS 3JQKA 3EUNA 2MKCA 3VR1A 4ES2A 1N33F 1WHXA 4LQ9A 3DHWC 3I32A 1BGXT 2N82B 4J9RA 3N6LA 4JV1A 2YKPA 3GG1A 1G1XA 4PG7A 1H74A 2LQ9A 3DM2A 3MEGA 1M1HA 2HZAA 4F04B 2Q79A 2CQ1A 2JX2A 2NPIA 2XZDB 5DRKA 4DSFA 5IT9Y 2LECA 3M30A 2OFHX 4M5IA 2W9CA 1S9EB 4LR9A 2FLOA 3GV7B 5HN0A 3LP2A 2VQFJ 4S0MA 4G65A 3N28A 1KHWA 1AUSL 1ZYQA 2RIJA 3K7RA 3HP6A 4OHYA 1VC5A 2KXFA 2IPOB 1JXLA 2BJ8A 4C8OA 1WC3A 4GO5X 5KFEA 4LBPA 4UF4A 1K1QA 1R0AA 3ZZ0A 1RTJA 2ZD1B 1F3FA 2UXCF 4ED8A 4IOCQ 2QLWA 5H9EJ 5L38A 1Q95G 2ZDPA 3W60A 4FZVA 4MKYA 4DQPA 1I6JA 3IM8A 4DR4F 2KXHA 1T05B 3R1HA 2RQCA 2JOQA 1U6ZA 4L74A 1X9SA 1FDNA 4UZBA 2FYXA 1VC0A 1TELA 1TMMA 4KGZB 1PCAA 2HFNA 1JX4A 2R7TA 1ZPVA 4NLPA 3TANA 5HK4A 2LU1A 2ZBRA 3AJ2A 1LK5A 1IKYB 3H8YA 3KUGA 5EN1A 3JSRA 1CG2A 3JTPA 2AJFE 1F5AA 2C2NA 2XHCA 4F25A 1DURA 1R43A 5KG6A 4NCGA 3OL7A 4XPEA 4F3QA 2CNLB 1SC1B 2B4PA 3MM5B 5IT0A 5H9FK 3MCSA 2B4VA 1RWKB 4X66F 2DH8A 1T0TV 3G6VA 4MMOA 1NH7A 3CCZA 2LYVA 4NXNJ 1RT5B 4PG6A 3F0NA 3MMCA 4KE5A 1TP7A 1G3OA 2W7AA 2WVDA 1DTQA 1W25A 2M7SA 5KT4A 2UZAA 1RTHA 4DR1F 4DSEA 1NSAA 2QLBB 2MY7A 3NBPB 2FB0A 3MGJA 5E33A 3AY0A 2P6TA 4PWUA 2ZBQA 3D54A 2RDIA 2PFDA 2A18A 2E29A 2BV3A 3LUYA 4MKAA 2OTLS 2W7PA 5E3RA 3K8WA 3GYGA 1FNXH 1EHWA 5LMNF 1JKHA 1GEHA 1B0VA 2VJVA 2CQ0A 2HIYA 3LW5C 1U48A 1XR5A 3CCQS 2CIMA 1Q7LB 1ACMB 5DG7A 4TYAA 4Q7AA 4DU7A 3KLFB 3BQ0A 2DGVA 5L9XA 2XCPA 1MNEA 4NXMJ 4N7TA 4B9SA 2UVUA 3LPYA 3MPUB 2B5JB 2DGWA 3T6BA 4WFYA 4G1QA 2RD5C 4LMZA 2H5JB 4K2JA 2VBZA 1Y00A 1Q53A 2YNHA 3GYNA 3FMWA 5HSPA 4B3TF 4A8WA 3HHLC 3U1LA 2HS3A 3LF0A 4ELVA 3KDNA 4DPTA 3DRSB 1SC6A 1UW9A 2BQ3A 1RXOB 2R8IA 5H9FJ 1U24A 3IAM9 2RAQA 2EG1A 1O0PA 4MT1A 2ASDA 4DMZA 1A6LA 2R2UA 3BGRB 3L3CA 2Q1LA 4X84A 3AXMA 2D3OR 1FRHA 1R6VA 2YNGA 5D6GA 1N6QA 1HI8A 1H72C 2M88A 3MMBA 4DR5F 4K4SA 7FDRA 1IVZA 4WF9Q 2QSWA 1MWQA 3GJSB 3BQ1A 2GJ2A 2AYMA 1RBLA 1VRTB 1IM6A 2UXDJ 4Z2XA 3OR2A 3FNNA 1JLQA 5DZ6A 4F3OA 2FGOA 1F5BA 2OUGA 1FVQA 2EFVA 1EETB 4MK9A 3ZO7A 4JP8A 5AJ3J 2CQ4A 2VBXA 2EBGA 2IIHA 2HFSA 3ILLA 2MY8A 1NKEA 5HMYA 3FBCA 4DPXA 1W26A 4OHXA 2GVZB 2YX1A 1T9XA 3RR8A 2HIQA 1MMNA 3SSRA 2WVCA 4O3OA 2X1GA 4PG5A 3MR5A 3K17A 5B0BA 2OKQA 4NZ7A 2HS0A 1M5HA 1FE0A 2BABA 3KLHB 1EARA 4G3IA 2PEBA 1RKJA 1PBUA 2RKIB 2MGZB 1LNQA 3R7BB 3HSGA 1OY8A 2DEJA 3PX6A 3CDUA 1SIWB 4LR8A 1K9MT 2ILYA 3H5YA 1YKWA 1TL1A 1PG5B 1E6YA 5HROB 3BN4A 5HO4A 1ZZFA 4TY9A 2PFFB 3KG1A 5HBMB 3M9OB 1BWEA 3FC9A 3CD6S 5E3QA 3K5MA 4JI7F 4FYDA 1TUGB 3EZUA 3OV7A 3BGFA 3MECA 1H7XA 3MTJA 4H4OB 2COLA 2KHCA 2HFUA 1UPPA 1ZAWA 5E41A 2NCKL 4CWBA 4WU2A 4R8UB 5AXKA 3I0RB 2LLZA 2ZVSA 1QE1B 4ZLLA 1JLEB 3OXGA 5F8NA 2QLXA 4RW7B 1I3OB 2R2SA 1FRJA 1RUSA 3CT9A 3Q8QB 2YWWA 2WVFA 2UUBJ 2GO8A 1FE4A 2P5VA 3MD1A 1JJ4A 2NZCA 1Q82T 2VPZB 1JLCB 3LGNA 4CH7A 5CH7B 3KLVA 1VIOA 3CJRA 4DPUA 1FRMA 3I5BA 1S1UA 2QL7B 3PM9A 1MN9A 3J7YU 4KKOA 2VONA 2RRNA 1WDTA 3CCMS 4PUOB 3A12A 5HMZA 1HWJA 4WYLA 3VWSA 5DQGA 3D2WA 3WBZA 4KV8B 2L9WA 4M5DB 2KVIA 3TX0A 5K8MA 2HHHF 2E1RA 3ISNC 4NMXA 2DRAA 3A13A 3TA2A 1VQYA 4IFVB 1UAWA 3PO4A 4PEOA 4DR6F 3D0HE 2GQQA 4BC9A 2FC8A 2DGXA 3MUVP 2IY5B 2GJIA 1S9EA 5KTQA 1BXNA 1TL7B 2H5IB 1F9FA 4FP9A 3W5XA 4FF2A 2L08A 3N6NA 3QYYA 1U2CA 3R1LA 1GMUA 2CXEA 2W7OA 3M6XA 2AJ0A 4FPIA 2A10A 3BBBA 3QJJA 2KFZA 3VAFA 2CJBA 4DV0J 4DR2J 3W1YC 2HHSA 3QWUA 2ZJQQ 1FKPB 4O3PA 3SV3A 2ZD1A 2HWHA 3WZ0A 1NLKL 5HLFB 4OI3A 2KT3A 3LALA 2VDIA 4BLGA 2KL8A 4YR2A 4DFMA 1T05A 1ZTWA 4M5JA 5IWAJ 2Y1RI 3V4MA 4R0EA 2HEKA 3GYXB 3WDOA 2MB0B 1NAQA 3WIVA 2UVWA 3CCUS 4KQZA 2DTJA 3BSNA 4U8YA 4J7CA 1N5VA 3RW7A 3KLEB 4YDXA 1HARA 2RS2A 1HNXJ 1VQ6S 2R8HA 1AA1B 2WW8A 4JI3F 4X65J 4IG3B 1JLGB 1ULRA 1IKYA 1FJGJ 2CQDA 1NPPA 2LU2A 2PI5A 2IA0A 4IFYB 2E1PA 1H7WA 1FCAA 3ADAC 4DX7A 1QLNA 2V4JB 3KNAA 5DG9A 1FERA 4I6WA 4OZ0A 3MM5A 2D7SA 3BREA 1WEXA 3M2RB 3AOAA 3KK2B 2BW7A 2KH9A 2W2MP 4AL7A 2LDYA 3NNHA 1RT5A 3FVYA 5H1SV 3NRBA 3TVYA 1NDLA 3BKFA 3ZZUA 4ZLPA 2BJ3A 2DNGA 5HQLA 2Y1LB 4OYAA 2MXYA 2FPHX 3NBPA 3MEDB 3H2UB 1GX6A 4J9VA 4HLBA 1SKUB 1WKJA 1C1CB 3BKTA 2MSTA 3HJVA 2X51A 2LEAA 3LGMA 1UVLA 2B0GA 1VQSA 4N8NA 1JXEA 3GLJA 4C8MA 5ETTA 1QD1A 3LWLA 5KOXA 4ED4A 3CO0P 1BQXA 1WC6A 1Z2LA 5K14B 3TA0A 3ETOA 3K58A 1HHSA 2FY8A 2H4WB 4Q2MA 3FSYA 3UN5A 1W7WA 3W9IA 4LRCA 3BYRA 3PIPQ 2FLLA 4CLLA 1CSJA 1ZS6A 2HRUA 2W4CA 2Z0GA 2HK3A 3BSCA 2A6MA 3KLFA 3OLAA 3OTCA 4NI2B 1TQLA 3ILIA 1CVJA 1ZZNA 2B5JA 3N0VA 4Q45A 2HVDA 3NGSA 3NWRA 1RA6A 4ETXA 2EEYA 4UQGA 1KHVA 5KT6A 5D78A 5E3PA 3KHGA 4YOEA 2KM8B 3RG6A 3GSIA 1KP6A 4IUFA 2GA7A 4ZOSA 2XNQA 1TAQA 2N7YA 3DRSA 3S7RA 2ALZA 4FS2A 5ETVA 3DN9A 1SH2A 5F9NA 4USIA 5ADZA 1NDCA 4X4RA 5A6WA 4KT0C 4WIQA 1MWZA 2ZZTA 4ITSA 2ZHAA 1RWWB 1SJRA 4C11B 4A8KA 2JLEA 2DNPA 3BGRA 1D8ZA 1F6TA 4ER8A 3C2PA 1O5JA 3R27A 1C4CA 4RNMA 2R9LA 3F44A 3N79A 4Q8EA 1AW0A 1O8BA 2N4DA 4J37A 2GHWA 3DGVA 2ZH4A 4M5LA 5EWFA 1CULB 1UFKA 4OYZA 1GMWA 5IT9U 2CJYB 2XLIA 3JQMA 1RAHB 1VRTA 2XY7A 2K7KA 1GNKA 4EBDA 3SDEB 2NXCA 2DISA 1M0SA 2BW2A 1EETA 3G8SA 3D5MA 3HHEA 3I5AA 1N88A 4ZPCA 4B3SJ 1RWVB 1JNRB 1DTTB 1WHYA 2V63A 2KYXA 2EXUA 3P8BB 1JIHA 2W1BA 2GVZA 3QPIA 4ZJOA 1Y3JA 2LCWA 2HMIB 4U67Q 4JOUA 2UXBJ 4M1KA 4DSJA 3C6TB 3KLHA 2FVCA 4P73A 3ZZPA 2RKIA 4X4OA 2MGZA 4GC6A 2H51B 3NCRA 3GONA 1FESA 2MQMA 4KB7A 3SMZA 1OY9A 3HJFA 1RB0A 1DAXA 3UD5A 1GMWD 3NCPA 5C5JA 3UDEA 1KFDA 5HROA 4FVMA 2B43A 1U1MA 1AFJA 5E0OA 4ZA1A 4DUZF 4Y2CA 2YKOA 5KT7A 4CTAB 5CYJA 3GV8B 1XQIA 5HBMA 4RLEA 3HI9A 4C98A 3NS5A 2NQPA 4PG8A 3A3NB 2ZWPA 2YWGA 3D6HB 1KDNA 5KFLA 2FHJA 3H7HB 1VJQA 2OLWA 4ZCIA 4H4OA 4KSEB 1KKHA 5KG2A 4X4NA 4ECQA 1V9OA 4R8UA 2O5DA 5C24B 1RADB 2DR9A 5KT5A 2XMVA 2KRRA 3I0RA 1D9FA 1QE1A 1WELA 1JLEA 4EUVA 3PHEA 5IZHA 4RW7A 4WKYA 1XWLA 1NB7A 2KTQA 3UVJB 2HSEB 3T1YJ 2F4FA 3QIPB 4OI2A 4JV5J 4K0KJ 1JLCA 2SXLA 2XMMA 3TP2A 2VZ9A 2NSBA 3MFHA 1SB6A 2QG9B 4J9LA 2VQFF 3IAS9 2J6TA 1RDRA 4LF4J 3KMQA 1I5OB 1WOPA 3RB4A 4Y2IA 4U95A 2J8SA 3O6QA 4YMEA 1S76D 2M8DB 3H5UA 2CJ9A 4PUOA 4TVAB 1FXDA 4CLUA 4TY8B 2CNOB 2VOPA 2WB1D 2AYBA 5A8WB 1SQFA 1HQUB 3H2VE 1UPMB 4L72B 1EX8A 1YBTA 4RNOA 2R8KA 4PYAA 1KONA 4Z7CA 1FRXA 4KV8A 2YNIB 4M5DA 3PXGa 4QYZK 2FUG9 1REGX 2VICA 3PACA 1RHKB 4IFVA 5D4OA 4PR6A 2ASLA 4JI2F 4DQIA 4YR3A 2BR0A 1B7YB 4FYWB 3JXOA 4DL6A 3M8YA 3CJ3A 1TL7A 3MPWA 5L8RC 2NLWA 2QMUB 3KK1B 3I87A 4KGXB 2OPPB 5BJRA 4LF7J 2DXDA 2LP4A 5F8GA 4OLOA 3K59A 4LF6J 1YJNS 1NK8A 2BJEA 2GHPA 2AEJA 4X4VA 1DQ9A 1JJCB 3B8HA 3PFEA 1HHQA 2PT0A 2MSSA 4C2MA 4EZ9A 3BGUA 1KWMA 4LBHA 2LA4A 4KPYA 4ECSA 5HLFA 4HL9A 3HKWA 3RRKA 3EVOA 3FRYA 3N4WA 4BDPA 2BE9B 1QDUB 2HQFA 4B9NA 2MQQA 1Y5IB 5B08A 2QL9B 2HVIA 4RKUC 2R7QA 3R6GB 3FDSA 2QSFA 3R6LB 2YX4A 5CQGA 4LRAA 3ITHB 2RHSB 5ETKA 3EGZA 1RAGB 3H20A 4LBIA 2JC1A 2L48A 3KLEA 1JK9B 2IJFA 4M5HA 3FQKA 2Z2ZA 2F8HA 3SXLA 3H5XA 5KFBA 1S0MA 2MPUA 4HTIA 2KKHA 1JLGA 3A8EA 4WFXA 4KTQA 5LJ5Y 4IFYA 1RLCL 4YB7A 1N5YB 4OIXA 3CCES 1S48A 2V4JA 4CYUB 4QYZJ 4HTJA 5L9NA 4AXIA 3T9NA 4IDKB 2IDEA 1SV5B 1XK8A 4DV2J 4DZDA 1TZ0A 3M2RA 4MIBA 3L95X 2ZH5A 1HNZJ 1FD2A 5KFDA 3KK2A 1LXJA 1GMVA 3CJ5A 2ZJRQ 2XLKA 2AQ4A 3CDAA 4LIWA 3QZ7A 3NAHA 3SFGA 4TU9A 3OQ2A 2E5IA 3GFXA 4BS2A 5HQMA 2VASA 2BQRA 1N52B 3MEDA 2PGCA 3G4SS 1RI7A 4FF1A 5I3PA 4Y3CA 3BBCA 2ZNYA 4IQXA 1C1CA 4H4KA 3G71S 4X2BA 1PC5A 4C0HA 1SL1A 2OGUA 4LF8J 4OYBA 2YQ1A 3RYLA 4CO1A 3CEDA 2BJDA 3Q23A 4DV1J 2J76E 2KRBA 5G0RB 2E7VA 2VDHA 1N32J 1BQMB 2A0FB 2OEKA 5K14A 3BR9A 1EIYB 2XI2A 2OEMA 5FLXU 5KFIA 3D7SB 4OI4A 3V4IB 5GAEU 4NI2A 2DNZA 2WSFC 5CABA 3LGHA 3OTOJ 3DOKB 5DJBA 2EFOA 4LR7A 3BH7B 4P10A 4FN5A 2W25A 4C8ZA 3PRBA 1QY7A 2D3ZA 1FRKA 3NGTA 4LIRA 3RAQA 2FVRA 2UXDF 3J7AN 2QYGA 1IWAA 4QIGA 3HF5A 5K9FA 1Q5VA 3IWLA 5AJ3F 3K5LA 2XMAA 2BRLA 4Y2AA 2JNJA 4P52A 3QJLA 2MLYA 4DU8A 5GVQA 4ZP6A 1U4BA 5D8HB 4C11A 5AT1B 3M1VB 5F8IA 3GB0A 2BOAA 1H2VZ 2P6SA 3UI3A 1U0HB 3D0GE 4F26A 1F2GA 5D0EA 3J81j 1VHFA 3FZBA 1YJWS 3EZOA 4WCEQ 1DBDA 4V1Ak 3QT7A 4DWIA 4EO8A 2OPQB 2NYIA 5DZ7A 4QR0A 3TVZA 1NHUA 1U1OA 2GW8A 1CULA 4F0MA 2PE8A 4Y28C 2OTJS 1P6TA 3B82A 2WHOA 1U49A 5ETLA 2RQMA 4J9OA 1S57A 4NZ0A 3SDEA 4LREA 1VQKS 2HQCA 1NHKL 1T9VA 1NPRA 1DTTA 5CZXA 2AJQA 5J1EB 3NS7B 1RAFB 4C48A 2HW3A 4QWBA 3DDKA 4WU3A 1EJ7L 2HMIA 1WTBA 4YUDA 2RRAA 3VTIA 1FDDA 1S6QB 3UR0A 1FT8A 3BF4A 3C6TA 1Y7PA 3DKDA 1GT8A 4F4YA 3ICLA 1MN7A 1PYOB 1X60A 3TR5A 4MFBB 1VOMA 2K1RB 3MI7X 2OEJA 2UUBF 3PTWA 1SBRA 4RZRA 1B99A 2VC0A 3UCZP 4ICLB 3M2VB 1SJ4P 1SJ3P 3FBEA 1EP4B 1U25A 4CTAA 3NMAA 3RU0A 3V6JA 4W98A 1MROB 5SZTA 2KYZA 1Y0HA 4ECVA 2OFGX 4B9VA 1KLNA 3VAJA 1MSWD 4JYAF 4ZVRB 1TK8A 1Q16B 3HVTB 4NLQA 2WSCC 3MM8B 1CJTB 3KKFA 5C24A 1WOOA 2YQ0A 4NLOA 1R8PA 3SYZA 8RUCA 3PEHA 3RBDA 2E66A 4X4UA 5D0HA 3LPEA 1FNOA 4KFBB 2KVQE 3R5CA 3NGRA 3HSJA 1U47A 4L76A 3QIPA 4KIAA 1NJYA 2VUGA 2YKQA 4PXBA 3MM9B 5DGBA 2UUAF 1K44A 3GILA 1WDDA 3BPDA 2D9OA 5LXYA 2EWHA 2XY6A 3EVMA 3D0IE 2V0NA 3DXSX 3OHBA 4X4QA 2FHKA 3QRPA 4J9KA 3LANA 4TY8A 2J0SD 4DV0F 4DR2F 4NCBA 2E9RX 5A8WA 1HQUA 5B09A 2HWIA 4UW2A 1NK0A 5EWGA 1U2RA 2YNIA 4B3RF 2ILZA 3BH6B 4MIAA 3LWMA 3L7OA 3JAMY 1ZTTA 4QR1A 2AJ2A 2HVHA 5KFJA 3A1YG 5IWAF 2XZTB 1V3RA 2XM3A 5ETPA 4ZVUB 3CMQA 2PEHA 2HNYB 4OJGA 5KG5A 3HLUA 1NSKL 3ZZRA 1PAEX 2HZVA 3Q2SC 2RNEA 3PYGA 2XZWA 2MHNA 3RB6A 2V50A 3KK1A 2OD6A 1GXUA 2OPPA 3J80U 3NP5A 4OYWA 1NM2A 5DQIA 2M3DA 2RRBA 4ZVHA 1NDKA 2E7WA 1QSSA 2AGOA 3EJMA 4USUA 4I56A 3WIUA 2DKOB 4ZPTR 4X65F 1J5EJ 2XMUA 2M8HA 1G6BA 1SL0A 2FVSA 1RABB 4CZCA 2DGSA 2H1YA 2DXEA 3OR1B 2ZDOA 3QT5A 2JRSA 2XBPA 5GAGU 1UFWA 3PZPA 3UO0A 2HNZB 5KFTA 3OTDA 2IFXA 1S97A 3CUNA 4OYMA 1SL2A 4RBTA 4K59A 2UUCF 1FXRA 4DPWA 2DITA 2GHVC 4FBTA 1KVKA 3ITHA 2DR7A 1NJIT 2FJXA 3KWMA 4WKRA 4ERDA 1LQ9A 1FTRA 4OI6A 2JC0A 2PA8D 2BEFA 4MKVA 1APSA 2FHMA 5LSRA 3D66A 3I82A 5DS7A 2ZKTA 2VG7B 2MZJA 3M32B 1ZETA 3ULHA 1AYEA 3ZZOA 2AJ1A 2CFXA 3QJPA 2J0QD 4QWCA 4CO5A 1VS3A 1S1TB 3CCJS 1N5YA 4F36A 5L1IA 2IJRA 2DNHA 1VHIA 4CYUA 2IBOA 3IM9A 5L46A 4IRCA 3FFIB 4IDKA 3FCHA 4CLSA 2CJQA 4JI1J 1SV5A 4RU9A 1PILA 5D15A 3H98A 2LQ8A 1YWXA 4CLPA 1URRA 2E5JA 2ADCA 2W8LA 1R89A 2AEFA 2V2VA 2IA6A 2MJUA 9RUBA 2XNRA 1R8HA 1TU0B 4IOAQ 1S10A 1D9DA 2QX0A 3GR0A 4MAKA 5E3CA 1XNQF 4JUZA 2VB6A 2RE1A 2L9DA 4QIFA 1XERA 4PABA 2I2YA 4RUAA 2QRRA 2R7RA 1VBXA 4QU6A 1S1VB 4DUTA 4OX8A 4CO2A 4P75A 3Q0AA 2L9NA 1PBAA 1YJTA 1RK8A 2KT2A 8ATCB 1X4CA 2B7BB 1RHJB 1U8WA 4ZVOB 2XMWA 2Z57B 2IDLA 2Z8QA 1CJKB 4YN3B 2ERRA 4ATNA 5E2QA 2RSQA 1T7PA 2MQLA 3CJQA 4F4WA 1PYSB 2HBRB 4YP3A 7AT1B 5G0RA 3AQPA 1RCXB 2OPRB 1BQMA 4NA2A 3HHDA 4QIEA 3UCGA 3O1LA 3THVA 3NXZA 1HNVA 3N01A 3PX4A 1QSYA 3ENVA 4DZ6A 1KQGB 5KG3A 3V4IA 5B0DA 3CIMA 2VJUA 3PW4A 2B9EA 2HWTA 4OYPA 3DOKA 2B6AB 3VV2B 1LXNA 1WHWA 1YBAA 1D09B 2DHAA 3AOCA 2GQCA 4TYBA 5CA5A 2LFVA 2Q6CA 1AZSB 4WTOB 3C8YA 1RT1B 5A8RB 1VRQC 3MAQA 2F4VF 2WZ1A 4QU7A 4B3SF 5KFSA 3M6UA 2LMIA 4OMFG 2B7CB 5M2UA 4DFKA 1IKXA 2ZM6J 2V5HG 1IR1A 5KFKA 3M1VA 1FFWB 3POTB 1YTYA 4ZN1A 5E7OB 1U0HA 3V6DB 1RHRB 1MWYA 2UXBF 1T9YA 2NUHA 4WXWA 2XHWA 2OPQA 5BR8J 5C2CA 4CLKA 3DLBA 2PDAA 1NJXA 3I0SB 1DJ0A 4E8UA 2F1FA 5HI7A 1AFIA 3OD2A 1GXTA 4TKTA 4ID5A 4PYDA 1I1GA 3TX8A 4DL7A 3M8RA 1JJ2R 2KN4A 1KQFB 2R7WA 2XSFA 4C0BA 4CH1A 4QQBA 5J1EA 1NEEA 1HHTP 4IRKA 1J27A 2V8HA 4X4TA 2V2ZA 3HZEA 3I56S 1HQ2A 3CIZA 3O5TB 5K8PA 5IQ6A 2GZOA 4CLTA 2B8PA 4MYUA 4NWBA 1S6QA 3T1HF 5FDLB 3PIOQ 1WG5A 2IRXA 4UOGA 4RNFA 2Z56B 1FX2A 3PW7A 2VFTA 1SJFA 2MLZA 1FA0A 2YX7A 2XS7A 1OPIA 4NLYA 4MFBA 2K1RA 4ZPVR 3ZTQA 2FQQB 4ZPBA 1VLYA 5A0YB 4ZS6A 2B4OA 3AB4B 5KFYA 1I51B 2PMZD 4ICLA 3M2VA 4JV5F 4K0KF 1H98A 4Z7YA 1EP4A 4I68A 2Y8YA 1TKZB 3OBIA 1KOOA 2XO6A 3TVKA 1MROA 5K8OA 1N56A 3WC2A 2WONB 3DI6B 3O8WA 4FXDA 1U2FA 4J9SA 2R42A 5AXLA 3ZZTA 4F2RA 3HVTA 5CYMB 4KHPJ 3MM8A 1CJTA 3ENQA 3G6ES 3DU5A 3BQ2A 5LT5A 2Y1JA 2L41A 4GKKJ 3NNCA 2J9CA 2JVOA 4LFAF 1ZM2A 3KJQB 1T3NA 2I9SA 1X5PA 2IVFB 1JJHA 4URGA 3RB3A 2LQBA 2BZ2A 3MM9A 1RHUB 3QBCA 4IKAA 2G13A 4I7FB 4KYZA 3U7JA 3W9HA 4R0JA 3J7ZT 2ACYA 5J2NB 4LF7F 5KFWA 3R5JB 4WK1A 4C8LA 3B6BA 4LF6F 4C6AA 1KRPA 1V3ZA 1MU2B 2CVIA 2HVZA 3QWPA 3PYFA 3KXDA 2AT1B 3FMBA 2B9XA 2IM3A 2X3GA 2J6UA 3IGNA 3H4DA 4UOHA 4A46A 5ETNA 4J9PA 1WWHA 3EICA 1Y5LB 3LQVA 2V68A 1UEUA 5D4PA 2HYIB 2WCXA 4DV7J 1WSRA 2F65A 4PPZA 5D4LA 1HBMB 3UQSA 2GFFA 2HNYA 4J91A 2Q3PA 1QUPA 4X64J 5HMWA 4B17A 1PSDA 4FKYA 2JFDA 4IG0B 4DX8H 3UN2A 4O0IA 1LWEB 1U02A 4P72A 3MMAB 2G0IA 2W24A 4W90B 2U2FA 1DQAA 2A3JA 1FNMA 4K4UA 4FBUA 4KHRA 3EXYA 3EGNA 1OSDA 3OR1A 4NZ6A 3UWTA 5D0RA 4JI8J 2Z4PA 2XYPB 3D6TB 4AQYJ 5L39A 4LF5J 2ROGA 2GCFA 2HNZA 2HPUA 4L6V3 2M70A 3IO1A 1VQ9S 1TFYA 1WKLA 2DH7A 4NE9C 4RUHA 5T41A 1U6BA 1HNZF 2VODA 2K8GA 5KFPA 2BOPA 3H40A 4QCLA 1VDHA 2FGCA 4RW8B 1IKVB 2RDJA 3R8YA 4EK2A 4K7QA 3DOMB 1AT1B 1YZ7A 5KG4A 3P45B 3AODA 4WP3A 2KG0A 2VG7A 3E51A 2POKA 3M32A 3D1QA 3CJKB 2HG4A 3HSZA 3KK3B 2EK6A 1HNIB 3PYDA 4CLFA 1QTMA 1SJ1A 1C4AA 5LL6d 4ZCMA 3T1AA 3FFIA 4DV1F 3FRZA 3TARA 4M5MA 4U9RA 4KHMA 2AKWB 1N32F 3GV5B 5CCLA 2PIIA 5KFNA 1KLMB 3T5JA 2VHGA 2HQGA 4C3KA 2RS8A 3D1OA 4FS1A 4NLRA 4EWTA 3K8VA 2B8QA 4UY85 4P9SA 5EHHA 4ANDA 2J5AA 4FF4A 3OTOF 4FYXB 2KG1A 4RUBA 3SFUA 2QTWA 4N8OA 4DN9A 3IR6B 1OO0B 1JLAB 1X5TA 2H4YB 2GMJA 1XMOJ 5HMXA 2LQ5A 3FBFA 4LFBJ 3CDWA 1CJKA 4AUKA 3KLIB 1YJ7A 1S12A 1NB2A 4OQJA 1URNA 3TI0A 4AL5A 6AT1B 4UUXA 4ZIVA 2OPRA 4DQQA 4JI5F 2NREA 4K4ZA 3KHLA 2EFPA 4ES3A 2KFYA 1N36F 1HWIA 4ED5A 4YQWA 3SEOA 3GFHA 2VIHA 3DLGB 1N33J 4Y0FA 2B6AA 2AYEA 4RBUA 3IC1A 4F0HA 1DARA 4F0KA 3LAKA 3TQEA 2FC9A 4RL1A 2CQHA 3GSDA 3R7SB 2XCAA 2RQKA 2XSJB 1IBKJ 1AZSA 5GMKa 1RT1A 5HVHA 2J8AA 1JQGA 2D9PA 2W01A 3MEKA 5K8NA 5A8RA 3VAHA 2PO4A 2DB1A 5B0AA 2HURA 2MKIA 2ZC3A 5LJ3Y 4OX9J 2GV1A 4OX6A 1S59A 4UQTA 2CAJA 1NUEA 2BDPA 3SQGB 3V6DA 3NGDA 3WHIA 4DL3A 1XEZA 2CPJA 3BDPA 1P1LA 1RU1A 5DG8A 1S72S 1A0OB 3FUYA 1RQ0A 1H3DA 4OZJA 3BR8A 4O3NA 1BWVA 1NKBA 3L09A 4URSA 3M6VA 3I0SA 2CQBA 3TA1A 3IG1B 4F4XA 4LUBA 4NA3A 4H4KC 4YFUA 2E5HA 3OVAA 1JWWA 3VF0B 2WOMB 1S1WB 4LF9F 4URQU 5AE1A 1VGYA 5ETOA 2HGMA 4AXJA 3EVWA 1IM4A 3D3BJ 4ZP8A 2C42A 2NPFA 4LSNA 1NCLA 2AGQA 4ECTA 2HBYB 4CO3A 5FDLA 3DLKB 4E2FB 2CZ4A 4WZMA 3GG0A 4OYIA 2EFGA 2ZNZA 1Y11A 3BB5A 3K0JA 1VQ4S 1JXVA 2KM8C 4C4WA 1X4FA 4PXEA 3FEYB 5A0YA 1F60B 1KR4A 4J5OA 2L3MA 1IBLF 2V9WA 3T9ZA 2QFJA 1U1RA 2IAJB 4USJC 2GVDB 2BJ7A 1TKZA 2LXFA 2G4BA 1VI7A 2H65B 2WONA 3DI6A 1BE4A 1MMDA 2HFVA 2YH0A 5B0GA 5IFMA 4OV6A 2RF2B 5I3QA 1J2VA 1YBUA 4B08A 1WC0A 5CYMA 2CJAA 2CG4A 3MR2A 2EKYA 2I8EA 1YHQS 2BBEA 2MQOA 2H54B 3MZIA 3G87A 1WI8A 2WBRA 1KSPA 3G6YA 4CM2A 4XK8C 3A3OB 3Q8SB 1F1BB 3M8ZA 3LO3A 1RTZA 3K89A 4K4VA 2YQ3A 3TNVA 1GQEA 4U7UD 3AJ1A 4HH0A 1NU4A 3LP0B 4B3OB 4A8FA 3Q83A 3CC4S 2LKZA 3N6MA 5LMNJ 4C3LA 2DO4A 3CPWR 4I7FA 1SKSA 2BA9A 4HHJA 2ZH2A 1N5SA 3AHPA 5J2NA 3G6XA 1NPKA 2WBMA 5J2QB 2DGTA 1X7VA 1FHTA 2CPDA 2VFVA 5JVGQ 1C2PA 1MU2A 2J6SA 4OI1A 2QMWA 2AJ4A 1J5EF 3W65A 3T5HA 1Y5NB 4WPAA 4M5NA 2I5JB 4B3TJ 2AZ1A 2QN6B 2PI4A 3TZYA 3KOAA 3I31A 1T8EA 2MQPA 2EFNA 2F9JA 3RBEA 1SIZA 3TAQA 1XIQA 3FCVA 1T9UA 2QE5A 1TTHB 2QGFB 1HBMA 5ETMA 2VF3A 4IR1A 3TAMB 4DPYA 3CSKA 2XLJA 5DO2A 1FF2A 2WVBA 2VG6B 2IJNA 3W64A 3FSIA 5F41A 4A8YA 2FDNA 4IG0A 1OY6A 2O3DA 1T02A 1CC7A 1LWEA 1YJUA 3MMAA 2OHDA 4K4YA 3GIMA 2YPYA 1CC8A 4C7QA 1YLXA 1FRIA 3DCAA 1FKAF 1HBNB 4NLXA 2W2QP 1TKXB 1LW0B 1IQZA 3IBFB 1BMQB 4IH6A 3HHNB 1UVIA 2W2PP 1WC1A 2ASYA 1XMBA 4AYBD 2EG2A 3WX8A 3G8QA 2Z58B 4HHUA 2PMWA 5ETSA 1X5OA 2GJFA 1HLWA 1R8AA 4RW8A 2MYFA 1IKVA 3BEGB 1UJ4A 5F9LA 4H4MB 4DL4A 3MM7B 2BQUA 3LOUA 3W63A 4DS4A 1FI4A 3DOMA 2ABYA 5I4MA 3P5TL 4OHVA 3VAGA 2DEIA 1BLUA 1JLBB 4CNYA 1X0PA 2WVEA 2BX6A 3R5DA 2WRMA 1YJVA 3CJKA 1UTAA 3G8TA 1IR2A 2YPZA 3KK3A 4JV2A 4B9UA 1HIYA 3S01A 3QFWA 3DYAB 1WKKA 1HNIA 5EWEA 3CNQP 2HHWA 1CPZA 2BE7D 2M0GB 3UD3P 2FLPA 1RHMB 2CQCA 1RT6B 3M8QB 2AYGA 2YKNB 3DGPB 3M9MB 4DUYJ 1VQNS 1WORA 3K57A 3IFEA 2XB2D 1ZM9A 4DS5A 3AD7C 4RWWA 1KLMA 4DI6A 3TEHB 1EZZB 1NO8A 3HD2A 4LF2A 1Y4ZB 4TQSA 3CJ8A 1F5CA 2HHXA 1GXLA 3TWZA 4XO0A 4X62J 5KG7A 1UP1A 2CJXB 2HVEA 1R0CB 1S9GB 2DGOA 3QQCD 3O44A 2QFIA 4K2XA 3A8KA 2JL9A 5HL7Q 3KLIA 3PFOA 1OQ3A 5CCMA 4YHHF 3HZGA 2Z2MA 2W9CB 4LFCJ 1R8BA 4PWWA 2BM0A 2RUSA 1VQ7S 1HI1A 2G0CA 4U7UK 3EE3A 1WJ9A 3IXQA 1IR0A 1WC4A 1EKRA 4B9MA 1Z1ZA 1XN9A 2AHOB 2DR5A 4USHA 4NASA 4K4TA 2CYYA 2M9KA 3CJSA 3DLGA 5BR8F 3CMES 3QMQA 1CJUB 1FDAA 4FPRA 1X8DA 2OPSB 3OSNA 2ZE2B 4J9UE 1O6XA 1CEZA 1WI6A 4F4KA 2P9GA 4B02A 2XSJA 3ETMA 3C6UB 4JI0F 2DJWA 2GIQA 4DR6J 5MLCV 3UDLA 3ZTSA 3R5AA 2P2CB 2DYAA 2R2TA 5LXRA 1RGVA 4GO7X 2XS2A 3DLHA 3DRPB 4RNNA 3OXLA 2OELA 4WWSA 1B0TA 2JHEA 1S4EA 3SQGA 3CJ2A 2MZ1A 2MLXA 5JJBA 1R0BG 4X4PA 3L7PA 4I2QB 5C7PA 4OL8A 2YTCA 5DDOC 2YWEA 2DCUB 5MAOA 5DLFA 3R97A 1CQMA 3BJYA 3RW6A 1WEYA 4ZVPB 3RJMB 4ELUA 1MW7A 1WACA 1HNWF 3QSIA 1VQPS 2F63A 3OT9A 4HI1A 3CW2C 1E6VB 2WOMA 1S1WA 3G82B 4CO0A 3VAKA 4K4WA 3DU6A 1S9FA 4QBUA 1RAEB 1RCOB 5EUHA 4P2MA 3UE2A 4Y6IA 2DH9A 4TLRA 1S0VA 5KG1A 2QA2A 4GKJF 3F41A 5D77A 3DLJA 2QEXS 4AFFA 1SQEA 3DLKA 4JI3J 4D3HA 1HWLA 4JV0A 4GKKF 1HQEB 5CD4H 4BWJA 3J81U 4F67A 3MAAB 4OZNA 1A7GE 1Q81T 5KFZA 2VL1A 3ZZZA 2MHEA 4QYRA 4GVBB 2A1BA 4DL2A 2B4UA 4DV6J 1BHNA 5KFVA 1IUJA 2IAJA 3L9ZA 2GVDA 4WTYA 1J5OB 3W7BA 2C2RA 2R7OA 1XBWA 2KO1A 2UU9J 1RT3B 3MXHP 2RF2A 3E2EA 3U1NA 3NLCA 1UMJA 1MG7A 3QSYB 3TEGA 1OYDA 1LWFB 2GX8A 1CBKA 4USKA 3MR7A 5KFAA 4QR2A 4EBEA 1Q8KA 1GK8A 3BM7A 4F8RA 4DV7F 3BO2A 3IN5A 2ATLA 3LP0A 4H54A 4B3OA 2ZFHA 2YXLA 2F9DA 4CCHA 1SVDA 3OXFA 2JVRA 4FKXA 2FLNA 3P96A 5J2PB 1QJHA 2BACA 1K8AT 2ZOGA 1I94F 2DGQA 4MK7A 4L73A 1Y9OA 3HSDA 2V94A 2YNGB 3VVUA 5J2QA 2JJ4D 1Q5YA 2K2PA 1UFLA 3SCJE 3CC2S 3IBCB 4DL0C 4DX6A 1RYRA 1PJ5A 5KG0A 1N4LA 4IO9Q 2YWFA 4ED7A 3OHAA 2I5JA 4Y65A 2I6WA 5LM7E 3O2IA 4JI8F 5HQ8A 4WE1B 1TVRB 3MCOA 2ZITA 3GR1A 4YY3J 4LF5F 4ILMA 2XMJA 2IRUA 2CVEA 2X3DA 4QWAA 2AGPA 3H59A 2K06A 4UOCA 1V3SA 4KO0B 3IP0A 1DFDA 1X4EA 3TAMA 1BC6A 3UNGC 2VG6A 3TRGA 3D9BA 5J2MB 2DPIA 4P6QA 4GRSA 4ZP7A 1L5UA 1V5IB 2CPEA 2C3YA 2W4DA 2WAQD 2AV5A 1LEOA 1LFWA 1HBNA 1P9QC 1LW0A 3NCQA 2FVQA 2XTJP 1U1NA 3IRXB 3BPSP 2HKEA 4P2XA 4XTTA 4F3MA 1TKDA 4KR0B 4ES1A 3TUIC 3DXBA 2QO3A 5IQQA 1B70B 4ZVQB 1HW8A 1RAAB 2CPYA 2WTFA 4H4MA 4ED1A 3MM7A 2BKOA 4OI0A 4XIUA 3JSYA 1OPZA 4C97A 4P74A 4WK3A 4FVCA 3ZTRA 2HFZA 3RR7A 1JLBA 2R8JA 1VFJA 1U0SA 2IVMA 3MEEB 4JI6F 4FYYB 5K5MA 4AT1B 3RAMA 1GFWB 4QWEA 3K5PA 4NLTA 4QW9A 3DYAA 3EZ5A 1VQ5S 4ED0A 2X1AA 4B3MF 3Q24A 4LFBF 3KMSA 2ZH9A 4DUZJ 3UR3C 2VOOA 2DR8A 1RA7A 3M8QA 4P71A 2B3TB 3MPDA 3DRYA 5DM6Q 2W9AA 2YKNA 3DGPA 1YIJS 2CQPA 2V69A 4WZQA 3GIJA 5G4DA 2RU3A 4O3SA 3BGLA 3W8PA 1RJJA 2EPIA 2HK2A 3JSBA 4DG1B 2G1DA 4O4RA 2V2QA 4DXLA 3R3TA 4YB5A 3Q8VA 4ZVTB 1RU2A 5BYSA 4DR3F 2ASJA 2CKWA 1X5SA 2HGLA 5L1KA 2OAUA 4QWDA 4L3KA 4O3QA 1S9GA 2JLGA 1HW9A 3W8GA 1Q7YT 3P4UB 2XS5A 3FK4A 1U1LA 5CHCB 4G1PA 1HBOB 4G6VB 4RW6B 5F0UA 2UV8G 1IBKF 4ZPWR 1WF0A 1X4BA 2QA4G 4J9QA 4EI2A 3PRVA 2OO4A 2XC9A 3FJ2A 1XR7A 4CDIA 2BRKA 4PRFA 1QAXA 4OX9F 1K73T 4Q5VA 1KD1T 1H73A 1RE1B 3IS9B 1KQSR 2AF6A 3HMJG 2OD4A 5AXNA 3ELHA 2NYHA 4NRTA 4EZ6A 5KT3A 3CULA 3OL8A 1U1QA 2NS1B 1XNRJ 5IXUA 3T3FA 1CJUA 2E1MC 4NPOA 4DV5J 2BKNA 2KXNB 2OPSA 2QIFA 3DRXA 3J7A1 3PHTA 2ZE2A 3SIPB 5GMDA 2HRTA 3DRRB 3TQ1A 4LRBA 1T9TA 3C6UA 4DOZA 4JI2J 5BYRA 1P1TA 2C3MA 2E1CA 4QW8A 2MKHA 1HMVB 3DRPA 1C0TB 3L7UA 1QVFR 4DN0A 4N76A 1S77D 3IWNC 2RU9A 2QZ8A 1KQKA 4ECUA 5F8JA 3QLHB 2K7JA 1A9NB 2BE2B 4MIWA 4PAAA 4EYIB 1FXLA 1S5ZA 4QJVA 3OW2R 2MEWA 3GIIA 3C16B 3HO1A 4I2QA 3SV4A 2RHQB 3EDQB 3HHKA 4ED2A 3DLEB 2JSXA 3ISZA 3P5BP 3FZ2A 1VQMS 3A8JA 4LVNP 1UWAA 3WQPA 3PRDA 2ZJPQ 2C2EA 1KS2A 3CDBA 2C2DA 1RZMA 5CAAA 1E6VA 3G82A 3CD7A 2IBKA 3GIRA 2ZH3A 2R7SA 1T9WA 3GU0A 2VKRA 3HVAA 3VAMA
chains in the Genus database with same CATH topology
5J2NB 4LF7F 1VMBA 2VFRA 3RW7A 3KLEB 1TKTB 5KFWA 1FKPA 4YDXA 4EFAC 3EYZA 4WK1A 1HARA 2RS2A 4C8LA 4KRWA 5IT4A 4LF6F 1VQ6S 2R8HA 4Q0BB 2I38A 2HNDA 1KRPA 2WW8A 4JI3F 1V3ZA 2K3KA 2FJDB 4IG3B 4ZHRB 1JLGB 1MU2B 1ULRA 2CVIA 2HVZA 3OTEA 5KFUA 4CH0S 1IKYA 3UD4P 2CQDA 1VK3A 1Q78A 1RTIB 3V81B 2LU2A 2PI5A 3QWPA 2IA0A 4IFYB 1VC6A 3FSXA 2GQ2A 1H7WA 1FCAA 2LXUA 3KTQA 4R5PB 3FMBA 2HRYA 1UWBA 2B9XA 2AD9A 2IM3A 2X3GA 1QLNA 2V4JB 3KNAA 2HHUA 2YKMA 5DG9A 4HT5A 2J6UA 1FERA 3OUYB 5LSOA 3IGNA 3H4DA 1HQEA 3JYTB 4Q8FA 4I6WA 3PX0A 4A46A 4OZ0A 1OWXA 3X3UA 4J9PA 1N5TA 2IM2A 4NXNF 3MM5A 1WWHA 4E98A 2D7SA 2R2RA 1Y5LB 4WXOA 3BREA 5J1NA 1WEXA 3LQVA 3M2RB 1NK7A 4Z37A 1UEUA 5D4PA 3CDEA 2HYIB 2JWNA 2WCXA 4CQ1A 5T7LB 3OVBA 3KK2B 2DRBA 2BANB 1S6PB 4PPZA 1RT2B 5D4LA 2KH9A 3W3SA 3M05A 2YNFB 4ZMMA 2YWKA 1HBMB 3OJSA 2BXJA 1OQ6A 4C9DA 3Q8PB 3UQSA 2GFFA 2LDYA 4IO1A 1RT5A 4AL7A 3NNHA 2QYCA 2HNYA 3FVYA 4DDFA 5H1SV 4ECRA 3NRBA 2Q3PA 3TVYA 2MMYA 4Y34A 1QUPA 2CZVC 3ZZUA 4ZLPA 5KAKA 5KFQA 3K5NA 2RJZA 1J5OA 5HMWA 2DNGA 4B17A 1PSDA 2F3JA 1KTQA 3Q22A 4IG3A 1C0UA 2IHR1 2HHTA 2JFDA 4IG0B 2Z2LA 1G7CB 1FD8A 4IOBA 2E44A 4DX8H 2MXYA 1LWEB 4O0IA 2D41A 3UDCA 5F3ZA 4V19J 3MMAB 3E01B 2VH7A 2FPHX 2W24A 3NBPA 2DCLA 1RT3A 1R31A 3MEDB 4Y2MA 3V5RA 1VBYA 3BSOA 3H2UB 4W90B 5JUMA 1GX6A 1S7HA 2U2FA 3M6WA 1DQAA 4HLBA 4A8MP 3CJ0A 2A3JA 4RBVA 1FNMA 1C1CB 2MSTA 2X51A 5F8LA 2LEAA 3LGMA 4K4UA 1NK5A 4FBUA 2B9YA 4KHRA 1JLFB 1QAYA 2VG5B 3EXYA 1UVLA 3EGNA 2B0GA 1WEZA 1VQSA 4N8NA 1JXEA 1OSDA 3OR1A 4NZ6A 3UWTA 4ECZA 2Q66A 2DGUA 4C8MA 2Z4PA 2FY1A 1LWCA 1IN0A 2W4PA 2IC3B 4F4ZA 1N54B 1HWUA 5L39A 2ZUGA 1LWFA 3PW0A 3LWLA 1M5VC 5KOXA 1Q1KA 2ROGA 1TAUA 2GCFA 2HNZA 2HPUA 4YEAA 3CD0A 4L6V3 2M70A 3IO1A 1BQXA 1YRUA 2GGPA 4PKDB 1VQ9S 1TFYA 3QIDA 1Z2LA 2DH7A 5K14B 3TA0A 4RUHA 1KEKA 5T41A 4WFNQ 2LA6A 3ETOA 2H9ZA 1YGYA 3AA8A 1HNZF 1U6BA 2VODA 3K58A 1KNZA 1HHSA 4RX6A 2K8GA 2OH2A 5KFPA 4Q2MA 4NXMF 2UV8A 5IM0B 3FSYA 3H40A 2BOPA 4QCLA 1NZAA 3PIPQ 2FLLA 3NWGA 5DDPC 2EC0A 1CSJA 2HRUA 3DHXA 2FGCA 2KJWA 4LJMA 4RW8B 2W4CA 2Z0GA 3BSCA 1IKVB 3KLFA 3GE9A 4ERDA 3OLAA 2RDJA 4K4XA 5J2PA 3OTCA 2WB4A 1TQLA 1CVJA 1ZZNA 2B5JA 2O66A 3N0VA 4Q45A 3OL9A 5KFMA 5KG4A 5A8KA 1RT7A 4IH5A 1RA6A 4MK8A 4ETXA 3AA9A 2XULA 2HLTA 2KG0A 2VG7A 3E51A 4UQGA 2CQ3A 2POKA 3M32A 2C3PA 1KHVA 5KT6A 5GAGI 3D1QA 5D78A 3CJKB 2HG4A 4U7CA 3KK3B 4EU0A 5E3PA 1RWUA 2EK6A 3KHGA 4YOEA 3B78A 2KM8B 5DQHA 4HT7A 1D9AA 4JI4F 4IUFA 3RRGA 1HNIB 2PD1A 2GA7A 1RAJA 2J7WA 4JI1F 4PPDA 2XNQA 4ZOSA 1QTMA 1D8YA 3DMJA 1K0VA 3PEJA 1SJ1A 1TAQA 5EX3A 2N7YA 3DRSA 3HKZD 2DHSA 3S7RA 2ALZA 4FS2A 4ECYA 1C4AA 2JLFA 2FJEB 3DN9A 1SH2A 5F9NA 1VBZA 5LL6d 4ZCMA 4WE1A 2PC6A 4USIA 3T1AA 1TVRA 2BM1A 2EK1A 4KGMA 5ADZA 3FFIA 4RNHA 4OHZA 1U09A 4DV1F 2VFSA 3FRZA 3TARA 1S0NA 4X4RA 4RW9B 4U9RA 4KHMA 1PO6A 2MKKA 4CIOA 1PC4A 5A6WA 3THTA 4KT0C 1AUDA 1MWZA 4I6AA 4ITSA 5M2RA 1N32F 2ZHAA 3H4BA 3GV5B 5D3GB 3QGPA 4F2SA 1W2BR 3MPYA 1SJRA 5CCLA 1D0EA 4C11B 4M94A 2PIIA 3RAXA 5KFNA 1KLMB 2JLEA 4A8KA 3T5JA 1TUVA 2DNPA 3BGRA 4KO0A 5F8MA 1D8ZA 5CYQA 1N0UA 2R7XA 4C3KA 2J0XA 2WSEC 2RS8A 3D1OA 3KJVB 1UJ6A 2HQIA 2VBWA 2P9CA 4FS1A 4NLRA 4EWTA 3K8VA 1YI2S 3MHYA 3C2PA 3V6KA 1O5JA 5L1LA 3R27A 3EPGA 1N48A 3SSQA 2W8KA 4UY85 5EHHA 2XI3A 1C4CA 3P3DA 3MM6A 4RNMA 2R9LA 2OJ3A 2J5AA 3F44A 4P7VA 5J2MA 3OJUA 5T14A 3N79A 4I1TA 4Q8EA 1O8BA 2N4DA 1AW0A 5E5NA 4J37A 3OTOF 1REVA 2GHWA 4FF4A 2KG1A 3CF5Q 2LDIA 4LT6A 2DNKA 2ZH4A 3SFUA 5EWFA 3I4PA 4N8OA 4LQ3A 4PQUB 4DN9A 1GX5A 5L1JA 1R8CA 3IR6B 1NJZA 1OO0B 2JH3A 4OHWA 3ISND 1IJFB 1BQNB 2XLIA 4XDCA 3HXMA 1JLAB 1X5TA 4NOHA 1VRTA 2JDJA 1ZPWX 4HVZA 2CPXA 2GMJA 3K5OA 2XY7A 5E3AA 1T03B 2QMXA 4K50A 2K7KA 1GNKA 5F3TA 1JMTA 1X4AA 1YVFA 4EBDA 1TL3A 2UP1A 1F0XA 5HMXA 1WNEA 3SDEB 1HYSB 2D1CA 2LQ5A 2DISA 2DNLA 4PWDA 1M0SA 3NL0A 4GMKA 2BW2A 1HA1A 1EETA 3CDWA 3NKYA 4AUKA 3IRXA 3D5MA 3HHEA 3KLIB 3G8SA 3CWJA 5U47A 3I5AA 1N88A 4OQJA 1KN6A 4ZPCA 1URNA 4FNHA 1JNRB 1DTTB 1WHYA 5KFCA 3VAIA 2KYXA 4P7TA 3TI0A 1JIHA 4AL5A 1X9WA 1NK6A 5KFGA 1FK9B 1DLOA 3CXCR 1H38A 4UUXA 2OPRA 4NLWA 3QPIA 4DQQA 3US5A 4DUYF 4JI5F 4ILLA 1Y3JA 2LCWA 3R5BA 2HMIB 3MUMP 3AH6A 4ZCLA 4U67Q 4JOUA 2NREA 2MKJA 1S6UA 2BYCA 5DDRC 4K4ZA 3ZC4A 3MR6A 4RW4B 3KHLA 2EFPA 4M1KA 4ES3A 4OFZA 3VQSA 4DSJA 1L3VA 2JEIA 3PV8A 4PCQA 3C6TB 2KFYA 1N0VC 1N36F 3KLHA 1HWIA 1S99A 4OX7A 2FVCA 3HDSA 2ZBIA 4ED5A 3ZZPA 2RKIA 3SCLE 4X4OA 4YQWA 1JLAA 2MGZA 1ZOTA 4ED6A 3SEOA 4GC6A 3GFHA 3NCRA 3DLGB 3DM2B 3MEGB 1M90T 1FESA 3BS9A 2MQMA 4KB7A 3SMZA 4Y0FA 3AB2B 4ELTA 4X62F 2B6AA 3HJFA 4N77A 2JEFA 2AYEA 4RBUA 1DAXA 3KG0A 1SXLA 3MEEA 2DIUA 3NCPA 1IXKA 1TV6B 1RKIA 2GNKA 3IC1A 5C5JA 3U02A 5FLXY 1NRKA 1KFDA 4OLPA 4NMLA 5HROA 1DARA 3DOLB 2ZC4A 3LAKA 4FVMA 4DQIA