1K8AT

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1k8aT00
1H2UX 2N3OA 2LKZA 2MQQA 1SJQA 2DGTA 2ADBA 2M4MA 4IO9Q 2X1BA 1VQKS 1PO6A 2MKKA 4QQBA 3G8TA 3S6EA 2U2FA 3P49B 2HGNA 1HL6A 5LSOA 3CXCR 2RS8A 2DB1A 1K9MT 2MQPA 2MQNA 4YOEA 1X5TA 2FPHX 4F26A 1A9NB 1X4EA 3TP2A 3K0JA 5JVHQ 2CPXA 3JB9k 2UP1A 4WIIA 4A8XA 2DISA 2EK1A 1IQTA 4QPTA 1S79A 1DHMA 2GHPA 2G0CA 2KXHA 2MPUA 3EGNA 4CIOA 1SJFA 3VALA 1VC5A 1JMTA 2DGVA 2MZRA 2N3LA 4TLQA 5DDPC 1SJ4P 1M5OC 1Q81T 3B4MA 2CPDA 3P5TL 1VQPS 4C4WA 1X4GA 2MY7A 4TU9A 2LXIA 2YWKA 3ULHA 2MGZB 3UCUP 4PR6A 2MMYA 2CQBA 5D78A 3D2WA 1ZZNA 1D9AA 1WELA 2K8GA 4PRFA 2KHCA 5LJ3Y 1UP1A 2JWNA 1H2TZ 2QEXS 5FJ4A 2MYFA 2AYMA 5GAGU 3ZZZA 3R1HA 1OWXA 3SMZA 3CCRS 3FEYB 2DH7A 1PGZA 4PKDB 2JRSA 4CH0S 3CTRA 2RS2A 2DHAA 2RVJA 2MQOA 3CCJS 1DRZA 4LIRA 2X1GA 3MUMP 1FXLA 1WG5A 2M88A 4F25A 3OW2R 2FC9A 1OO0B 1WHVA 2A3JA 2DHXA 1VC0A 4CQ1A 2DGWA 4RU2A 1WTBA 3SDEA 3VAHA 2AYEA 2M9KA 2CPZA 2ZJPQ 2E5GA 2B0GA 3LPYA 3R1LA 1WEZA 3VAGA 3CPWR 2G1DA 2EVZA 2D9PA 1U1OA 1Q7YT 1NO8A 1WHYA 1U1RA 2GO9A 2CQCA 1RK8A 3RW6A 4J5OA 2KYXA 4C7QA 2PE8A 1VQOS 2XSFA 1VQ4S 4OZ0A 3LQVA 5BJRA 1U6FA 1U1MA 3H2VE 2ZJRQ 1YIJS 1D8ZA 2CPYA 3Q2TC 2CQGA 1X4BA 2RUGA 1N54B 1Q82T 2XS2A 2HZCA 3CUNA 3S7RA 2DNQA 2CJKA 2LYVA 2DNNA 1X4HA 2HGLA 1HA1A 2FC8A 4U67Q 3L3CA 2DH9A 2LQ5A 1VQ6S 1M1KT 3G4SS 2ZJQQ 1N88A 2DH8A 2Q79A 1YTYA 1UFWA 3CCES 3DLLQ 1FO1A 1YWXA 1N52B 3H2UB 2DNRA 5GAHU 2ERRA 3TO8A 2KFYA 2CQ1A 1X5OA 1VQ9S 2F9JA 3NMRA 3VAMA 3BO2A 5EN1A 2QA4S 3IRWP 2MZ1A 3P3DA 2EK6A 2CQ4A 3THPA 1P27B 1WF2A 2N82B 4WFBQ 2CQ2A 3RW7A 2CQPA 5CXTA 2LMIA 2E5IA 3NS5A 3MOJB 3G6ES 3MUVP 3CC2S 3CC7S 1JJHA 2MZSA 2DK2A 2J0QD 5IQQA 2KRRA 2AYGA 1R8PA 2HGMA 1NU4A 4BS2A 4IOAQ 3CCMS 2PEHA 3G9CA 3NNAA 2RU3A 1S72S 2XNRA 3CULA 2MZTA 3UCZP 2J76E 1YI2S 5H1SV 2O3DA 2KG0A 2HVZA 4IOCQ 2RQ4A 2U1AA 2F3JA 4F02A 1N8RT 2D9OA 1H6KX 2RQCA 3S8SA 1VBZA 2CQIA 2MKCA 2LEAA 3BS9A 2L9WA 1WI8A 3G96A 3U1MA 2MZJA 3EGZA 1X5PA 2JVRA 2RT3A 1ZZFA 2M8HA 2CPHA 5DDOC 1DBDA 2G4BA 2DNKA 1U1NA 4WCEQ 2YKAA 5CA5A 5IM0B 3G8SA 1F9FA 3Q2SC 2NZ4A 2OJ3A 3BEGB 5IM0A 1WHXA 2AYBA 3NS6A 2MGZA 2RRBA 3B4DA 2M0GB 4M5DB 2LXUA 5LXRA 5HO4A 2DIUA 1YJNS 3CCLS 5GMKa 2DGUA 1OIAA 2KU7A 1VC6A 1WF1A 2CPJA 1YJ9S 1RKJA 2KT5A 2LCWA 3SDEB 5DM7Q 1CVJA 2YH0A 2MSTA 4YB1P 2M2BA 3BO3A 1K73T 1VBXA 5DDQC 3BO4A 3UD4P 1U1QA 2J8AA 1HD0A 2KRBA 4IUFA 2CQ0A 3US5A 1ZH5A 2LA4A 1Q86T 1KQSR 3THTA 4ED5A 2OSRA 2MZQA 2DNGA 3PIOQ 3MUTP 2OIHA 1AUDA 2DGQA 3V4MA 2FY1A 2CQDA 2DO4A 3MURP 3TYTA 2CPFA 2K3KA 2MHNA 3G71S 2WBRA 5JVGQ 1M5KC 4Y00A 2VOPA 2DO0A 2KXFA 1WEYA 4FXVA 1QVFR 1SXLA 2LEBA 2DGSA 1U1KA 5ITHA 5HL7Q 1YITS 2DGXA 1X4AA 2MB0B 2OSQA 1JJ2R 3IWNC 2RNEA 3I55S 1H2VZ 1M5VC 3ZZYA 1KOHA 2VONA 2KXNB 2KVIA 4C0OC 2E5JA 3PIPQ 1G2EA 3VAIA 5LSLA 5LXYA 3CF5Q 5GADU 2DITA 4Y0FA 2HYIB 2F9DA 2XNQA 4WFAQ 3DXBA 1M90T 4V19X 2MQLA 2X1AA 3I56S 2DNPA 2YH1A 4Z2XA 1UW4A 1R8HA 2X1FA 1A7GE 2E5HA 2JVOA 4TU7A 2N7CA 3CMES 3CD6S 2DNMA 2NLWA 2KM8B 2KH9A 2OTJS 3MXHP 4CH1A 2LA6A 2CPEA 3VAJA 3UD3P 3CCUS 2I2YA 2DGOA 2M52A 1FHTA 2DHSA 1U1PA 1VQ8S 2DNHA 2XB2D 1NJIT 1QM9A 2YTCA 3CMAS 1WG4A 2J0SD 3P6YC 4UY8T 3U1LA 3VF0B 2MJNA 3N9UC 2DNOA 3J7ZT 4UQTA 1FNXH 2M7SA 1URNA 3S01A 5CYJA 5DM6Q 2OTLS 1L3KA 1O0PA 1U1LA 1W2BR 1FJCA 3UE2A 3EX7B 2ADCA 2VODA 2XS5A 2MXYA 3MD1A 2MKHA 1SJ3P 3MDFA 2KN4A 1WHWA 2MKJA 3MI7X 1U6BA 1X4FA 2MJUA 1UAWA 3UWTA 4LMZA 4W92B 1K8AT 2MY8A 2BZ2A 2MKSA 2AD9A 3NNCA 3CCQS 5DETA 2DNZA 5MLCV 3CCVS 3R27A 2DIVA 2CQHA 1WF0A 2RRAA 1HD1A 2M70A 4WFNQ 1SJRA 2I38A 5LJ5Y 1B7FA 2SXLA 4QU6A 4TU8A 2VOOA 1VQLS 4W90B 2CPIA 1M5PC 3NNHA 3MD3A 2DHGA 1QVGR 2MSSA 5DDRC 2V94A 5GAEU 1FT8A 2QFJA 1KC8T 1XN9A 3VAKA 1KOOA 2DNLA 2FHOB 5IFMA 3CCSS 1X4CA 3HI9A 1OPIA 1VBYA 1U2FA 1BY9A 2BOPA 4WF9Q 1VQ5S 4ERDA 1FJ7A 3CC4S 2KI2A 2L08A 5D77A 2MKIA 2KG1A 2JX2A 1VQ7S 1P1TA 1VQMS 3SXLA 4OZ1A 1YHQS 3FEXB 2M8DB 4YUDA 1YJWS 2XS7A 2MQMA 3J7YU 1WWHA 3VAFA 1DZ5A 4QU7A 1WG1A 3HHNB 4LJMA 1X0FA 1WEXA 1VQNS 4FXWA 4P6QA 2L41A 1JJ4A 2CQ3A 4WKRA 4ZKAA 2LECA 2KM8C 1KD1T 1WI6A 3UCGA 2D3OR 1FJEB 2E44A 4EGLA 5GVQA 2DNYA 1X5SA 1X4DA
chains in the Genus database with same CATH superfamily
1H2UX 2QMUB 5BYSA 1BQMA 1RBAA 1KLMA 3PCOB 5HN0A 4RUCA 3KK2B 2DGTA 4M5KA 2DCLA 2VH7A 5KFJA 2ADBA 4KO0B 1FI4A 4OZJA 4ZPVR 4YMEA 2ATLA 1HNXF 2IMWP 2W7PA 5K5MA 4PQAA 1PO6A 3K5OA 3MMAB 3BGOP 4CLTA 2XSJB 3H8YA 4DV5J 4ED6A 2GQQA 2YBVA 1G7CB 3G8TA 3HULA 1NK9A 3JQKA 5KFVA 2HK3A 1XTZA 5EX3A 1FX2A 1RTDB 3MM9A 2HGNA 1HL6A 1OY8A 2WBMA 1T94A 2RS8A 2YNIB 4DR1J 2VQFJ 2IYGA 5HATA 1CS4A 1N5YA 4JI7J 1YG0A 1Y5LB 4I6AA 2AGPA 3TAMB 2NPIA 4OYMA 4IRCA 4K4ZA 1ZS6A 4P10A 4R0JA 3RYLA 4JI1J 4NE9C 4QW9A 2R8HA 1RT2B 4ZHRB 3N6LA 3LF0A 1X9SA 3DM2A 4P2MA 4DOZA 2R7SA 3V81A 3ZFVA 4ALZA 3JB9k 1T11A 4DEZA 2M5YA 4NI2A 5E5NA 4DG1A 3IAS9 4A8XA 3HPOA 5GAEI 3I4PA 1FCAA 2VF3A 3A3NB 1S79A 4ELUA 1DHMA 2ZC4A 1RAAB 3HMJG 4OJ3A 1D09B 2EC0A 2H54B 2HQFA 1RXOB 1ROFA 1VI7A 5IOLA 5A8RA 4QYZK 1FRJA 1RWOB 3DMJA 1JMTA 3Q8UA 1VC5A 1HYSB 2VOOA 3GR1A 4TLQA 1HBUB 1CJTB 3MOJB 5KOWA 1T0TV 1YDLA 2H4WB 2EFGA 5DRKA 5F3TA 3SQOP 4DX7A 2CPDA 3D1OA 3VGUA 1TVRB 4RW6B 2DPJA 4WIQA 2LXIA 3ULHA 4J9LA 1NK5A 3GJTB 2NYIA 2HNZA 1TZ0A 2J5AA 3HVAA 4LF6F 4J9MA 4PR6A 1T3OA 2CQBA 3L9ZA 3PFOA 5D78A 5I3PA 3D2WA 1ZZNA 1DJ0A 4HVZA 5F8GA 4MYTA 5SZTA 3KLGA 4JI1F 2V69A 3D5MA 3TX0A 1B0VA 1SC4B 4XIUA 3PW7A 1WOPA 3QATA 3RB0A 4I1TA 3FDSA 4P71A 5KFDA 4Y28C 1R43A 4KSEB 1AZSA 1OQ6A 2Y1RI 2QEXS 2GS8A 1MU2B 3LW5C 4PCQA 1UA0A 1S1TB 1RDRA 3E01A 4G1IA 4ICLB 4RW7A 3Q8QB 3F0NA 4FKYA 2XLIA 3BSNA 4DR3J 2IY5B 2D3UA 5KFAA 2J9CA 4ED4A 4C8ZA 1B0PA 2VC0A 3AQPA 3OSPA 3W2WA 3NY0A 4GVLA 3WX8A 3TRGA 3UW1A 1X9WA 1SH2A 2B6AB 2XSJA 3AODA 4LRCA 4TLRA 4ZLNA 2MQOA 1S1WA 2W8LA 2R2TA 4PXBA 2K3IA 3SQGB 1BMQB 1S9GB 4F4KA 1JLGB 3V4IB 5LOQA 3WBZA 2BE7D 1NNDA 2GIFA 2V8DA 2R9LA 2R2SA 1JLGA 3CDUA 3KHGA 1Y10A 7AT1B 3U02A 3M2UA 4MK7A 4F25A 1UEKA 2H4YB 3DKDA 3OW2R 4X4TA 3PW5A 4LSNB 4C8OA 1RWXB 2A3JA 5JJBA 5F8MA 3WIVA 4USIA 1JXEA 3NGDA 2DR7A 4MKYA 2VA3A 4Q0BB 4D3GA 2OPQA 1DAXA 5DZ6A 3QT7A 3ILLA 2WVFA 2M9KA 5J2QA 3PKMA 2ZJPQ 4WYWA 4P2XA 4OV1A 3HO1A 3NKYA 2B0GA 4URGA 1MU2A 4LF9F 5KT3A 1M5HA 3DU5A 3SEOA 2BJ7A 2R7QA 3FFIA 2FJBB 2WVBA 3A3PB 1M5SA 2CYYA 2HBQB 5BYRA 3QAUA 3KLEB 3DNCA 1NB7A 3L95X 5KT2A 1RTHB 1E6YA 2G1DA 4NLVA 1UJ6A 5EHHA 1U8SA 2RKIA 3ZZRA 2YNGA 1FKOB 2NCKL 1UPMB 5L1JA 2E1PA 2C3OA 2PE8A 3HVTB 3Q23A 2ASDA 2YX1A 2QSWA 4NCBA 2LQ9A 1MW7A 1YGYA 3KJFB 2XSFA 1HI0P 3PX0A 4FVCA 4LFBJ 2XMVA 2RHSB 2ZC3A 3W5XA 1FDNA 3QIPA 1LQ9A 1FDDA 1VQSA 3LQVA 3HHLC 1EKSA 5E3AA 5BJRA 5LT5A 1BLUA 2HMIB 3NLCA 5KG4A 1V5IB 2OLWA 2GMHA 3ILIA 1YIJS 3BDEA 2GJ2A 4OZ2A 2CVEA 1NH8A 1TV6A 3OLBA 2J9EA 2LFVA 2XMAA 4M94A 3J81Y 2RUGA 2R7TA 1HR0F 2KT2A 1HFEL 3M8ZA 4NI2B 3CUNA 1B0TA 2FGCA 2DNQA 4ES3A 3W1YC 2CJKA 5KFEA 4NLRA 1RKIA 1TU0B 2JL9A 4DN9A 1SBRA 2QLFB 4LF8J 1HI1A 2HGLA 1HA1A 2FC8A 2XMJA 4KGKA 3W5YA 4N56A 3LH2S 3SYZA 4O3RA 4P7TA 3PHEA 1ZBTA 2EFVA 2QRRA 3ETMA 2ZJQQ 1N88A 1UTAA 4PQUB 3HT3A 2Y1JA 1RBLA 3PVXA 5ETQA 1ZA1B 3CCES 2DT9A 1F9HA 1FO1A 4ZVFA 1FJGJ 5IXUA 3H2UB 1N52B 1GT8A 4DFMA 3CDAA 3M2RA 5GAHU 3TO8A 1VQ9S 4BHQA 2C3YA 3QMQA 3MCMA 1JXVA 2OPPA 2YQ0A 3B8HA 2RDJA 2YQ1A 2QA4S 2CVIA 3IRWP 2YNHB 5U47A 2EK6A 2KYZA 3MPUB 3M8SA 1TUVA 2FLOA 2HSEB 2XY6A 1XMQF 3AOCA 3MECB 1BQMB 1W26A 2YNHA 4B3TJ 1JNRB 3W7BA 2LMIA 2VKZG 3OHAA 1NAQA 1EETA 1RUSA 4YHHJ 3MUVP 3JAMU 4LSLA 3CC2S 3W9IA 4OI1A 4HH0A 5JUMA 2YXLA 3CC7S 4DBQA 3H25A 2MZSA 1XERA 3IR7B 2J0QD 3ITHB 1FRIA 4C3KA 2KRRA 2B3TB 4DFPA 1TK5A 3KJNB 4P2FA 2AYGA 3R2DJ 1S6QB 1FKAF 2HGMA 2AEFA 3N6MA 4DUTA 2ZH3A 4QYZJ 3MR2A 1R0AA 2RIJA 1CULA 2UU9F 4BS2A 4IOAQ 2QL9B 2WRMA 3DRPA 3AH6A 1FKPA 3GZ7A 4HT7A 2VFUA 3CCMS 3HF5A 3IR6B 3SCLE 1RAHB 3NNAA 2OMOA 1S72S 2BDPA 3CULA 4KHPF 4AT1B 2LU2A 3HLUA 1YI2S 3GTYX 2HS0A 2O3DA 4ZITA 2HVZA 1JK9B 4ECUA 4DL6A 2QX0A 1FE4A 3PJXA 5F0UA 2QJ3A 2RQ4A 5T41A 2U1AA 1WC4A 4CTAA 3TZZA 5DGBA 2F3JA 2N4DA 1IKXA 1FEEA 1RT6A 3IM9A 3OTOF 3HP6A 1RWMB 2V2ZA 3MPYA 1I94J 4F02A 4QBUA 2GQ2A 1MLAA 1ZPVA 3FC9A 3MGJA 2D9OA 4I64A 1H6KX 2VG5A 1LWCA 4USMA 4LRDA 3L09A 4MIAA 4LRBA 3U1MA 2MZJA 3PW0A 8RUCA 3TWZA 3M2VB 1X5PA 1YKWA 4WE1B 2GA7A 4DR5J 1ZZFA 2HFSA 4MJKA 4UY85 2OPSB 1OPZA 3E51A 3HKZD 3PRBA 3QFHA 1VRTA 4PYAA 4KC5A 5CH7B 3TA1A 4H4OB 3LO3A 1RHMB 3DC2A 5A6WA 2YKMA 1TL3B 3M32A 2CNKB 2ZDOA 3K5NA 3NCRA 1TQLA 3OD2A 3QO9B 4C2MA 4MMOA 5K20B 5EDWA 1FNMA 3SCKE 3KK1B 2OJ3A 3BEGB 3N0VA 2CDQA 4ELTA 4IRDA 3OTDA 2ILYA 4LT6A 1UJ4A 2OI2A 4RL1A 4NA3A 1RJJA 4DPTA 3JS9A 1S7IA 2F8HA 5KT6A 2XMTA 5HO4A 2CUYA 1Q79A 2VPWB 2FJEB 3G8QA 4ZP6A 4F3OA 1OIAA 3B78A 3FKBA 2CPJA 2XI2A 1JLQB 4L72B 2VV5A 5AXMA 2LCWA 1IBLJ 1UVMA 3T6JA 2YVSA 5J1EB 4DXLA 4DL7A 2AP6A 3CO0P 1VMBA 4KGXB 1S1VB 2GO8A 3Q8SB 3KHHA 2JFKA 2MSTA 3A13A 2DR9A 2Z56B 3KDNA 3MM8B 1JLEB 5KG0A 1LWFA 4N8OA 1IR1A 1TL7B 4RBVA 5HQMA 4P75A 3BO3A 5LMNF 3KJVB 1RI7A 4FF2A 2AF6A 5G0RA 3V4IA 4JI8F 4Z37A 4USJC 5I42B 3O2IA 4WTOB 1PC4A 2BA9A 3DGVA 4FS1A 1ZH5A 4DR7F 1B7YB 2FHKA 1KQSR 1WKJA 2PSZA 2D74B 3GU0A 3KG0A 4OZNA 2WW4A 3PIOQ 4A8YA 1WKKA 2BMBA 3T9ZA 3TEGA 1R27B 3V4MA 1AW0A 2CNLB 3FVYA 4OYIA 3NGTA 2WBRA 3NCPA 3ENAA 4M1KA 2VOPA 3UVJB 2ZH8A 4HHUA 4NA1A 4B3RJ 2DXFA 1K44A 3FMWA 1EJ7L 3ZZPA 2J6SA 2KT3A 2LEBA 1JNZB 1RWUA 2DEJA 3J81U 1U1KA 1L5UA 1S0VA 3OTEA 3V6KA 4YR3A 4A8WA 5C25B 5AJ3J 1ICEB 3J81j 4QIWD 1JJ2R 1FESA 1TKZA 2A1BA 1CG2A 2RNEA 3UPFA 5KFHA 2J0WA 1M5VC 3GMGA 4MK9A 4TY8B 3MMBB 4OIXA 1REGX 1Y0HA 2CJAA 1UJ5A 3ZZYA 4TKTA 1R3NA 3MR3A 2YPZA 1KOHA 1HW9A 3QNWB 4B9UA 1SC6A 3D7SB 3PDNA 1YRUA 2FD2A 1RLCL 2W4CA 3M8QA 4U7UK 4DU7A 2WSFC 3JTPA 1G3OA 2FJXA 5HVFA 3UN3A 2D3O1 4C0OC 1VRUB 2HHHJ 4R25A 3RGIA 4NCAA 2FJAB 1FTCA 1RT4B 5LMUJ 5LSLA 3G6XA 2DXEA 3JAMY 1Q7LB 5GADU 3LWMA 1I94F 3H7HB 2VA2A 3CVKA 3E3XA 3A8IA 1UVLA 3F56A 2H51B 2F9DA 4WFAQ 3DXBA 4XDDA 1XR6A 1U2RA 3PX6A 2C2MB 5B0CA 1RWPB 4P72A 2YH1A 4Z2XA 4N7TA 1MSWD 4TYBA 1R6VA 4YB6A 2DTJA 2X1FA 4JI4F 2ASYA 5T14A 3EUNA 2JVOA 1TKTA 1V3SA 2H65B 1Q8KA 2HRYA 1EX8A 1FRMA 4F36A 2VFSA 1XR7A 3T1YJ 1XWLA 2KH9A 3MXHP 2QYGA 3H2LA 2ZZTA 2WVEA 2YWEA 4CH1A 3VAJA 5LM7E 3BV8A 2XCAA 2W8KA 4J9KA 1FHTA 4NEZA 2DHSA 3CIMA 1TKXB 4QJVA 1U1PA 1VQ8S 3NBPA 1NJIT 1CLFA 1O51A 1CC8A 2A6MA 1I5OB 3DDNA 2J0SD 3NS7B 4UY8T 1EB0A 2HNDA 4NLPA 3BGLA 5EUHA 2VPXB 4E0DA 2IM0A 2QL7B 1SL2A 3N5BA 2CDRB 5A0YA 1URNA 1UCNA 3P5BP 2GV1A 2OTLS 2HZAA 2QA4G 3GWCA 1Y3KA 1IR2A 1O0PA 2RDIA 4CLWA 2ZZMA 4RW4A 1JB0C 1YK9A 3T9NA 2QLWA 3BKTA 2K7KA 4WK3A 4TY9A 3SBMA 1FJCA 1JLCA 4LIWA 3QQCD 3R5GA 3UI3A 2RB7A 2ADCA 4B3TF 1HNVA 4WP9A 5ETPA 3MD1A 4RW8A 4ECWA 1HNXJ 4C8LA 1RT1A 2C2ZB 1HKAA 4ZLPA 1J2VA 3PEHA 4IR9A 4ZVUB 2FJWA 3QGIA 2UXCJ 2OHDA 4DL0C 1X4FA 2VBWA 2OP5A 1N36F 1NDCA 1IM4A 1UMJA 2NUUG 4OI6A 5G4DA 1K8AT 4M5MA 2BZ2A 2MKSA 3BM7A 4GO5X 2AZ1A 2HNZB 4EUVA 1SH0A 3CCQS 1QJHA 2Q3PA 3IGNA 1Q95G 5DETA 5DQIA 4DR6F 4B3OA 4DQSA 4ZVPB 4PWDB 1F5BA 3CJ2A 1RTZA 3UN5A 4BC7A 2HVHA 3GJQB 2LDYA 1U25A 1WF0A 3K5MA 2RRAA 2O5DA 4TN2A 2ZD1A 3HHKA 3R5CA 2P6SA 2UV8A 4OZLA 2UU9J 4JI7F 3K5PA 3M8RA 3QJJA 1LWCB 4ECYA 5DGAA 2RH3A 4NLXA 1PG5B 1NHUA 2IM1A 3BR9A 3FCVA 4C3MA 4F3MA 5D6GA 1SKWA 2UUCF 5HMYA 1IKVA 5B7WA 1C4CA 4H4MA 4KHMA 1LXNA 1LK5A 2W2PP 5I42A 2WSEC 7FDRA 4CCHA 5M2UA 4U8YA 2CPIA 1RISA 4ANCA 3MD3A 2RD5C 4DFKA 2DHGA 3LWLA 4DV2J 1U24A 2FHJA 3M8PB 5L1LA 1QVGR 4FXDA 1BWVA 1CJKB 5GAEU 4YHHF 1U7LA 1TMMA 2IDEA 1FT8A 2ZNYA 3ENQA 3QBCA 1E6YB 5CYQB 4L74A 4ZLLA 5B08A 2QFJA 1SKSA 1NUEA 3NOGA 3MR7A 2X3DA 1ZAVA 4I6YA 2Y0SD 4NL5A 1XMOF 4DQPA 3MR5A 1FFSB 1TMJA 2FHOB 4LVNP 4TVAB 4G1QA 1JLAA 4C8NA 1XC9A 3DRPB 3QGPA 3EXYA 4K5RA 4E98A 3ILJA 2HHVA 1BY9A 3FUYA 4IR1A 2W2QP 4X84A 3KUEA 4J9PA 2OPQB 2HAIA 1QE1A 1WSVA 4NZ6A 4DV0F 3VHQA 4ERDA 2KB2A 3BN7A 2FLNA 1CC7A 2BQ3A 1C1BA 1DQAA 2R8KA 2G0JA 2GJIA 2JHEA 2YX7A 4PZVA 2HNYA 1F1BB 3IG1B 3I5CA 4YQWA 4DSKA 3QWPA 4EEYA 1HNWF 1HIYA 1SI9A 2W9BB 3L4BC 2ZHBA 1VQMS 3AFGA 5L9NA 1SL0A 4U6PA 2WW8A 3FEXB 2K1RA 5K8OA 4LF8F 3QRQA 3BREA 4ED2A 4IRKA 4ECVA 4PXEA 2MLZA 2PDAA 4OYZA 3QJLA 1RAGB 1WWHA 3W63A 3VAFA 2YQ3A 2E7XA 2HPUA 3RR7A 5E3PA 3SZ2A 5KT4A 5FDLB 2OEKA 3AHPA 4FXWA 4P6QA 1AYEA 4YN3B 3GPAA 4WKYA 3EPIA 4OX9J 4B9TA 1S5ZA 1Z2ZA 1UETA 3CJ5A 3OL6A 3TX8A 2KM8C 1NK6A 2CZ4A 2EI5A 3UCGA 3HM9A 2FVQA 1H7XA 2Y1LB 4G1QB 6FD1A 3MEKA 4X64J 3TR5A 4N8NA 4DV6J 1UFLA 3N79A 2O66A 2RAQA 4DL2A 1F9EB 4X4QA 2XHCA 1GFWB 2UUAF 2JEIA 2EFQA 1SJQA 4NCGB 4C3LA 1Y3JA 5D4NA 2M4MA 1XEZA 4IO9Q 2E9RX 4F4ZA 2W24A 4HHHA 1NB2A 5K8NA 1OSCA 2A10A 3IA0A 1VK3A 1P6TA 2WOMA 2MKKA 1OMSA 1F6TA 3T1YF 1IVZA 1IKVB 2U2FA 3AA9A 4Y2IA 4AXIA 5KFPA 3EGVA 4N76A 3P49B 3TARA 1NPKA 3CCZA 4DV7J 5E2QA 3CE8A 5E3CA 4TY8A 2W9CA 1UVKA 2DB1A 3BKUA 3HHLB 3M1VB 4CLKA 2VPYB 3CSKA 3MZIA 5EWEA 4YR0A 2CA9A 4GKJF 1I3OB 1S77D 3PEJA 2CZ9A 2C2OB 4AXJA 3J80U 3GJRB 3U7JA 4B3OB 1X5TA 2FPHX 5DS7A 4CO1A 2JLFA 2XI3A 3A4TA 1SPBP 4DR6J 1X4EA 2K2PA 2HFZA 4ZVRB 3K0JA 1RQ0A 2GVDA 3M6XA 5JVHQ 3NGSA 2ZE2B 2DISA 4WFZA 1RWVB 1S57A 1IQTA 3IAM9 2B8PA 2IDLA 1S4EA 5HVGA 2GHPA 1UZHA 1Q78A 4IG3A 1NJXA 2R42A 3KMQA 2A18A 3UDCA 3MEDA 3NAHA 3WIUA 4CIOA 2BOAA 1OYEA 1U0HA 1YQHA 2RF2B 1ZA2B 2UUBJ 2DGVA 2OMLA 2MZRA 2WONA 2H1YA 2ASLA 4ED8A 4ZOSA 4L6V3 1SJ4P 1OYDA 1GTEA 3B4MA 3BZQA 4TNOA 4C4WA 1L3UA 1QSSA 1ZETA 1VQ6S 2A2DA 2MY7A 4YB7A 3KHRA 1PJ7A 2HWTA 5HBMB 2AWZA 2J7KA 4URSA 3J7A1 2P9GA 2P6TA 4IFVB 1G1XA 4K4WA 1JLBB 2COLA 3GLJA 4RKUC 1C0UA 3BJYA 4PRFA 1J27A 3D4JA 4ZCMA 2AV5A 2V5HG 2OEJA 5LJ3Y 3KLFB 3UNYA 3EZUA 1S99A 1GAOA 3PYGA 1HW8A 2JWNA 4JBCA 1DQ9A 4Q7AA 4ZP7A 3OTCA 2XM3A 4USHA 4DUZF 2MYFA 4LR8A 2HW3A 1NZAA 2C3MA 5GAGU 2LP4A 3D1HA 1RAEB 3W60A 2DEIA 2QO3A 3ZZZA 3CCRS 3PV8A 3FEYB 3M2VA 2DH7A 4OI0A 3I82A 3I0SB 1PIEA 3MMJA 1GMVA 2HFVA 5A8RB 5BXIA 2C42A 1YJWS 3AB2B 1TL4A 3HVWA 4PG4A 2RS2A 1KLNA 4EU0A 5I3QA 4DR2J 1C0TA 2JFDA 5A2QY 2KJWA 3LAMA 1WUUA 4ANDA 4UQGA 3PY8A 2A0FB 4F3QA 3X1LB 2VBZA 1R0CB 1DRZA 4X4UA 5GMEA 1P9QC 2ZVSA 4QYRA 1HNIB 2Z30B 5CYQA 3QT6A 4JYAJ 3OTBA 2E5LF 4LQ3A 2HQGA 2W25A 2BJ8A 1NMEB 2FY8A 2CNOB 5D4LA 1FXLA 4G65A 2HS3A 4OYOA 4NRUA 4RW6A 1WHVA 1R6YA 4O4GB 4Y2KA 4X66J 2HEKA 4EWTA 3TAMA 1S76D 5KFNA 2Q66A 1ZM4A 3BH6B 4RU2A 2AGOA 3R9LA 1WTBA 2BRKA 2P9CA 3GB0A 2V8HA 3SDEA 3VAHA 1T3NA 2UVVA 4C98A 5RUBA 4E8UA 5A0YB 1NDPA 3G2XA 2E5GA 3LPYA 3R1LA 1WEZA 4IFYB 1GX6A 4NLGA 5JMNA 4RNOA 2QMWA 4FBTA 3CPWR 3A3OB 4IYQA 2K1RB 1U1OA 4G1PA 4F67A 4L76A 1NO8A 4USTA 4CT9A 5HQLA 2CQCA 5GMDA 1RK8A 1F2HA 1PC5A 2CIMA 1XBWA 2QT7A 2VB6A 3D9BA 2KYXA 1BUXA 2L48A 4IG0B 4C8MA 4ZN1A 2BR0A 4QPXA 3C6UA 5L8RC 2CG4A 4S0MA 1U4BA 3D3CJ 4QWCA 1VQ4S 2UV8G 3TUIC 4V19J 4ILLA 2O01C 4O3NA 3I9ZA 3R7SB 3ZTOA 1RACB 3DLJA 4KHPJ 1R89A 2FTRA 1U6FA 4MFBA 5IWAF 1VIXA 5HMZA 1U1MA 2BKOA 2GAGC 3P4UB 4LUBA 2DPIA 1D8YA 3H2VE 3IGVA 4OX8A 3AD9C 2QLXA 4PABA 1DURA 3TANA 2CPYA 2Q1LA 3DHXA 3M8WA 2G0IA 2CQGA 4O23A 2HNDB 3Q2TC 1ITPA 1KEKA 3I87A 2GHVC 4NLWA 2E9ZA 4WJBA 3TJAA 1Q82T 2XS2A 4Y6IA 3NBPB 3UQSA 1XNRF 3S7RA 3OUYB 2LYVA 1YJUA 2BKNA 2IRUA 1RHJB 2ZBQA 2C22A 1NK0A 1TAQA 5F8HA 3CCTA 3QGGA 4C0BA 4FS2A 5HROA 2QLBB 3LA0A 3MM8A 3CCWA 4UTGA 3OBIA 2LQ5A 4IFYA 4IH6A 4EK2A 2YKPA 4YEAA 4PG8A 3UR0A 4GVBB 5DO2A 1IJEB 2OPSA 2POKA 2ZUAA 4TYAA 1WSRA 4ZS6A 3G4SS 3W2WB 5B0EA 2DH8A 4ILRA 3MCNA 2Q79A 4M5HA 2H5EA 5J1PA 1YTYA 2FLPA 3DLLQ 1E6VA 2HZVA 1IBLF 4I7FB 4O3PA 3EVOA 4CNYA 2XMKA 3RW6A 2ERRA 2EBEA 4UF4A 3FJ2A 1FTRA 2CQ1A 4WFXA 2KFYA 5KFKA 1NJYA 3QGHA 4HR2A 5J2NA 1TFYA 2LVWA 4KB7A 1KQFB 3RAQA 1RTIB 4NMXA 5EN1A 3P3DA 5HQ8A 3KLGB 3OVSA 5DJBA 1XMOJ 1P27B 3LANA 4OHVA 1GXUA 1W7WA 1LOUA 4WFBQ 2CQ2A 3H4BA 2VG7A 2CQPA 4P73A 4JV0A 2E5IA 4MKAA 3G6VA 2VJUA 3T5KA 2A6OA 5CXTA 3MEGA 1RGVA 4NX9A 4WU2A 2WB4A 1PYTA 2F8MA 1DY3A 2FLLA 2OD6A 3AOAA 5KG1A 4B9VA 4YS2A 4Z7CA 1NKBA 4ELVA 4I6WA 1Q5YA 1SV5A 4KH0B 1E6VB 2XMWA 3HJFA 1XK8A 2J8SA 2W9AA 4PWWA 1NU4A 3NEKA 3OR1A 3FZ2A 3EWGA 3LTOA 4LF5J 4K4UA 4I0WA 5KFWA 3G9CA 2J9DA 4M5DA 2RU3A 2XNRA 2V4JB 2JNJA 2WTFA 2YNGB 3UCZP 4G3IA 2RSQA 1ZTWA 2CJXB 2XMMA 2Z8QA 4OZ5A 4OMFG 3WDOA 4CLSA 1IBKJ 1YRTA 4AQYF 4IOCQ 2BM0A 3EJMA 3DM2B 4RBTA 3ZNUA 2Z4PA 1S6OA 4ZHRA 3ZC4A 1H7WA 3IG1A 2WVCA 4OHZA 4DPUA 3UN2A 3JSBA 4ER8A 2ZH4A 4DLGA 1H38A 1N8RT 1RWNB 2RQCA 3TVYA 4MTPA 2OFGX 3D6FB 4L3KA 1HBOA 2V8PA 4OLPA 3BS9A 3NGRA 4ZDNA 4DPYA 2L9WA 5C7PA 5GAHI 1KN6A 2WONB 4JI5J 2W4DA 5HK4A 1HBOB 4DR1F 1U0SA 2JVRA 1D9DA 5CZVA 4I2QA 1F60B 4MKVA 2RUSA 4GO7X 2VJVA 2UVUA 2HAFA 4WFYA 3D3BJ 4K50A 2PEBA 1RHQB 1V9OA 3NGUA 1ZM2A 2B5JB 4W98A 5CA5A 3MFIA 2VC1A 1HWJA 4HLBA 1CJKA 2NSBA 4K2XA 3Q8RB 3GFYA 3ZTSA 2HVDA 1WHXA 5IM0A 1SH3A 2PA8D 2AEJA 1Q8LA 2RMLA 2ROPA 2V4JA 2VBXA 1Z2LA 4QR2A 2RRBA 3HDSA 4M5DB 3UDEA 1NXIA 3K57A 4F4WA 4LF4J 3GFXA 1H98A 5LXRA 1F5CA 2BW7A 4ZJLA 2DD8S 4X65F 4IH5A 5GMKa 2PIIA 2DGUA 3Q24A 1RHKB 3AY0A 1AROP 4ZPWR 5H9EJ 1YJ9S 2KT5A 4OI2A 3DLEB 4KKOB 1RSCA 5SUHA 4MYUA 4LF4F 4EBDA 1RT7A 3CD7A 2E1CA 4LFAF 1ELOA 4XTTA 2B4UA 3C14A 3TVKA 1B99A 2BBEA 3ZTPA 2GJFA 4OX6A 4DZ6A 1LK7A 5DG9A 2M2BA 4JI8J 4NLQA 4A8QA 3THVA 4DV1J 3VVTA 4A8FA 4XPCA 4ATNA 2GAHC 3QO9A 4KHRA 1IKYB 4ID5B 4YDDB 5KFOA 3UDLA 3ET6B 1U1QA 3BDPA 2J8AA 1HD0A 2EEYA 3QFWA 3H0PA 2CQ0A 3US5A 2R4FA 2PO4A 3K8VA 4J91A 4LBPA 1SJ1A 2HQIA 3CNQP 3FRZA 3L7UA 4DV4F 3NL0A 4XPEA 2OSRA 2MZQA 2DNGA 4WBFA 3MUTP 5A2QU 5GAGI 2B9WA 1S9EB 1SC3B 4Q0BA 1GH8A 4CRJA 4LFBF 5KFGA 2DGQA 1N32J 2DO4A 1RT3B 5HLFA 2CPFA 1LEOA 2MHNA 4O44A 5C24A 5JVGQ 1J5OA 4B9SA 5DLGA 3H59A 5I3UA 3V6JA 3CO9A 1WEYA 4WP3A 4FXVA 1RAJA 1SXLA 3NP5A 2DGSA 1F5AA 5IT4A 5ITHA 4UZCA 2MQ8A 1X4AA 1NSPA 2XTJP 3DHWC 1NBEB 2OSQA 4H4KC 3SCJE 1X8DA 3NWRA 3EGWB 2FDNA 3MMCA 3N5FA 1LW2B 2E7VA 3HXMA 3VWSA 2Q6CA 4FYVB 5HJXA 3TZXA 4LR7A 2ZHAA 4K4XA 4NYOA 1KBRA 4H4KA 4M5LA 2KXNB 1JLAB 3N4WA 2AJ4A 3FK4A 1N33F 1F2GA 4WYLA 4CI0B 1R0BG 2E5JA 3R7NB 3PYEA 3VTIA 5F3ZA 5HMXA 1G2EA 2DYAA 2V2QA 3FCHA 5ETOA 5JXSA 3VAIA 4F8RA 3R2CJ 3FSYA 5K14B 1N36J 1YZ6A 2RE1A 4KO0A 4RX6A 1S6PA 4ZPAA 3DCAA 2KTQA 3VQSA 4L73A 3RU0A 1TR0A 2Y8WA 1VBKA 2QC3A 4Y0FA 2IJFA 1QUPA 3RG6A 3AA8A 2GMJA 1YJ7A 2X1AA 3GIIA 1N34F 2OD4A 5H9FJ 4DCPB 4DUYF 3W61A 3CDEA 1NPPA 1R8HA 4WE1A 1N0VC 1SIWB 1GMUA 3POTA 4HACA 1A7GE 3LP1B 5KG5A 1S12A 4U8VA 3OFHA 3MMBA 3RJMB 3K8WA 2XGPA 4FN5A 1FEHA 2KO1A 3BSOA 2QGFB 4HT5A 4M63A 1EP4B 4DR3F 2KM8B 3AXKA 3TAQA 3MEEA 3LP0B 2QA1A 3O1LA 3W65A 3MPWA 4JUZA 1RADB 4ANEA 2PI4A 3M6VA 3IS9A 4A48A 5KFCA 3V6HA 3T1HF 2FQQB 2M3DA 4O3OA 4RNHA 2AMCB 1FXDA 1VYAA 2UZAA 2OH2A 1S6PB 2VZ9A 3RB4A 3PJWA 2ZH6A 1RT2A 2E5LJ 3CMAS 1WG4A 1T05A 4ES1A 4LF6J 2PFFB 3U1LA 2MJNA 1S1UA 1RT7B 2CRLA 3J7ZT 3Q83A 4UQTA 3U1NA 4MH8A 1MMDA 4J37A 2M7SA 4USKA 4LF5F 2B7BB 3S01A 2BANB 3UR3C 1VQPS 3NXZA 2BW2A 2FZCB 2JOQA 3LP1A 1OSDA 2J9DE 1W2BR 2UUBF 2BACA 1DTQB 3ITHA 5A8KB 3H40A 1U1LA 1RTDA 1NHKL 1X60A 5L9XA 1O6XA 1S0NA 1BD6A 1SQEA 2MXYA 2XS5A 5E41A 2KZMA 4PG6A 1RTJB 2Y1IA 5A76A 4LREA 4ZA1A 5GADI 1VGYA 2F5GA 2I5JB 3H5YA 1IKWA 3G82B 2V68A 3TW0A 4CZCA 3DYAA 3OR2A 2JEFA 4DL5A 1XJWB 3T5HA 4IFVA 2NPFA 2MY8A 2HS4A 3HT0A 4W92B 4PEOA 3J7Z5 3S1TA 2DNZA 1UWBB 2OPPB 1TL5A 4QWDA 1KP6A 3CCVS 3R27A 2CXEA 4B9NA 3J7AN 1FWLA 4DHVA 4TXSA 2HRTA 1HBNB 3MM5B 1S9EA 2CQHA 4CDIA 3NRBA 4RW9A 3G6YA 2BJEA 2GIQA 2VBYA 4K8RA 1JLQA 1UVIA 3TAPA 2BJ9A 4WFNQ 5L1IA 1K1QA 4P2SA 3CJRA 5T7LA 5A8WA 4YB5A 4LF9J 5D15A 1LXJA 5BR8J 1S1UB 1N5QA 4NA2A 1T9UA 3GV7B 3SCIE 4K7QA 3QSYB 4W90B 3NNHA 1M5PC 1SKUB 2R7RA 4B9MA 3C66A 4IDKA 4BDPA 1IKYA 4ID5A 1DTTB 2DCUB 2MSSA 3HKWA 1IM6A 4KV8B 2C2DA 4NXMF 1FF2A 1O8BA 2J0XA 3H5SA 2FHMA 3KDOA 2P2CB 3EMTA 4Y3CA 2DNLA 4LFAJ 4QOTA 4USWA 2IRXA 4C8YA 4P9SA 3JSRA 5KFRA 2ROEA 2IVFB 3SSQA 3CCSS 5C42A 4LR9A 3N01A 4ZPBA 1GEHA 1U2CA 3MOZA 4KR0B 5C5JA 2Z2LA 1TL1A 2ZVIA 5DQGA 1U2FA 4HHJA 3F41A 1IQZA 2XZTB 3RBXA 3TA2A 4ED7A 4LFCJ 2DRAA 1KVIA 1RCXB 2Z2MA 2QSFA 4ED0A 3WHIA 4RUHA 2F4VJ 2YWWA 4NYZA 5HANA 4PWDA 1D1UA 2NZCA 1EAYC 2MKIA 2KG1A 1ZPWX 1P1LA 2RU9A 3JTNA 3LOUA 4JI2J 2WK4A 4ES2A 2D3ZA 8ATCB 3SXLA 4OZ1A 2OPRB 4DX5A 3OUYA 1YHQS 2M8DB 4YUDA 4M5IA 4HYKA 3Q8VA 1DQ8A 4X4VA 2RJZA 5CZXA 2E29A 3J7YU 1Y5IB 2V4RA 1T03A 1FKPB 4DL3A 1JLCB 4I2QB 1UVJA 1TAUA 1EP4A 2HHSA 4B3SJ 1DLOB 1X0FA 4Y2AA 3HHNB 3D6MB 4DCOB 2XBPA 1JJ4A 5F8LA 4PUOA 4ZKAA 1RU2A 3CDWA 2FB0A 4W4MA 2NQPA 1WI6A 5AE3A 2ZWOA 2D3OR 1EQMA 4IH7A 3FZBA 3VQTA 4R5PB 5L46A 1NSKL 4U7UD 1TTHB 2IYIA 2RILA 1IXKA 1FRLA 4LSNA 5GVQA 1UWBA 2VD3A 1EETB 2QA2A 2DBBA 2VUGA 2MDAA 3MAAB 4N5SA 2DKOB 3WZ0A 3J7YI 2KHDA 2N3OA 3MR6A 5AXLA 2Z2ZA 2LKZA 5KG3A 4DSLA 4QCLA 1T9WA 2XC9A 3JSYA 1FERA 3PW4A 2V9WA 3FNNA 5F9NA 2WZ1A 9RUBA 3OV7A 4AL7A 1RYRA 3GCXP 1TP7A 1VQKS 4NXNJ 2FYXA 3PX4A 4IOBA 2DRBA 1AFIA 1C1CA 1S49A 4RWWA 1HHQA 5HVHA 4MIWA 4OHWA 3QRRA 4QIEA 3UNGC 3LPEA 4BWJA 2DJWA 5LSOA 4X62J 3CXCR 4RJVA 4JV5J 1LW2A 1RAOA 2LU1A 4B17A 1SKRA 1S1XB 2BX6A 4I2PA 1LV5A 4BLGA 2D41A 2HRUA 4FNHA 1HWIA 1A0OB 2PMWA 4EO8A 2EFNA 1BGXT 4O4GA 2MHEA 5B0BA 1CQMA 1T03B 2MQPA 2MQNA 3SFGA 3GIMA 1QDUB 3RRHA 4WTYA 3IBWA 2VG7B 4C0HA 4F26A 1BE4A 2EPIA 3HHEA 1A9NB 5D8HB 1S10A 3BKFA 4HEA9 4DV6F 5KFQA 2CPXA 2GVZB 2UP1A 2FGOA 1RT4A 2C3PA 4BWMA 3BPDA 2G9OA 2EK1A 3C46A 3RB3A 1HWUA 3DI6A 1HHTP 4L75A 3DLKB 5ETSA 2PI5A 3OVBA 2KXHA 2MPUA 5HJYA 3K89A 4KKOA 2JSXA 4ZPTR 5A8KA 3QZ8A 3KHLA 1ACMB 4WK1A 3T5JA 3PKYA 1MNEA 2R7WA 4EYIB 2N3LA 3DMJB 3RRGA 3BQ1A 2R8GA 1HYSA 2BXJA 3AD7C 1FVQA 1TFWA 1FD8A 4C97A 1M5OC 2XCPA 3PYFA 5K8PA 1Q81T 5D3GB 4Y65A 2F4FA 2CJQA 2FIUA 2O67A 4GVBA 4RPFA 3UDVA 3KUHA 2X51A 3DDIA 3HVTA 1T9VA 2YWKA 1VLYA 5J2PB 1Q8BA 2Z2YB 3E2EA 4JI3F 3UCUP 1WNEA 2MMYA 5THWA 1GNKA 3M4XA 1C0UB 1NK8A 2E9TA 2CWKA 3QRPA 5B0FA 1WELA 3R5AA 2K8GA 2PN6A 3R6GB 2KHCA 1WKLA 3HD2A 3CJKA 4KPYA 4DJBA 3AJDA 4M95A 3QSIA 4KGVB 5H9FK 1CJVB 1UP1A 1Y7PA 3DGPB 3H90A 4ID8A 4OYAA 5D0HA 3C6TB 3KLIA 2ACMA 4FP9A 3I0RA 1M1HA 1MMNA 2AYMA 2FVPA 3SV4A 5KFFA 2HHTA 3R5JB 1OWXA 3R1HA 2XEXA 2CJYB 3L7PA 1VDHA 5A8WB 1PGZA 4LF7F 3FBFA 3PRDA 4PKDB 1PAUB 2XO6A 1X31C 2R2RA 1QSYA 2H9ZA 1U0HB 2UXBF 3ENWA 4CH0S 5C2CA 4ILMA 3CTRA 3AD8C 2GMLA 1WACA 2G1HA 2YWHA 4NXNF 4ZCIA 4C11B 3GQCA 4IG3B 2IHR1 4CO0A 3R8YA 1URRA 2RVJA 2AJQA 4BCAA 3IXQA 2FJVA 1YJVA 4LIRA 4DQIA 5DZ7A 4HDHA 4G6VB 1TK8A 2X1GA 5IQ6A 1JLBA 2AJFE 5KTQA 3MUMP 1T9XA 2NS1B 1CBKA 1DARA 2I5JA 4ZCKA 4J9NA 2C28A 4B3RF 1WG5A 2ATCB 2B5JA 4JV2A 3DRSA 2FC9A 1RHRB 1VISA 2Y8YA 2DHXA 1WJ9A 3CMQA 1N5TA 4CQ1A 2DGWA 6AT1B 5K8MA 5ADZA 3OVAA 2AYEA 4NYPA 4WXWA 4ECRA 5KG6A 3KYLA 1SUQA 4UUWA 3BQ2A 1FRXA 1FX4A 3EVWA 1IUJA 2Q6BA 3K59A 1HARA 5J2MA 1EQ0A 1NDLA 4FBUA 4CLLA 3TZYA 1VK8A 3GILA 3O8WA 1PAEX 4Q5VA 1U26A 1PBUA 2EVZA 1I51B 1JKHA 2D9PA 2IC3B 2IFXA 1J5EJ 2GO9A 2RQMA 5CHCB 4DV3F 2UVWA 3FGVA 4NLYA 1JIHA 2ZM6J 5LMNJ 4K4VA 3HHDA 4J5OA 2PD1A 4C7QA 1HWKA 3KNAA 2ZFHA 3MEEB 3VR1A 2AU0A 4F0HA 1T7PA 2CFXA 5D3GA 2AJ0A 1YLXA 2KFNA 3NAIA 1RAIB 3T3FA 1MROA 2DHHA 3HHLA 1HWLA 4OZ0A 3KOAA 3OXGA 5BR8F 3D1QA 1KHVA 5FDLA 3GSDA 1TL1B 3T5LA 2V4QA 2ZJRQ 4RR5A 4K4YA 1R7IA 2ZUGA 4EO6A 4Q43A 4I67A 3EXCX 4IQMA 1X4BA 2R7UA 1JWWA 1N54B 1IKXB 1BQNB 3QLHA 3O3LA 3IP0A 3HSDA 4GKKJ 3W8GA 1IBMJ 1JKHB 2IC3A 1FK9B 4IDKB 5DQHA 1QAXA 3L3CA 4I4BA 4U67Q 3GR0A 4FZVA 2DH9A 3D0HE 2ZBCA 4NPOA 4USVA 5BYQA 5J2MB 2EKYA 3I5BA 1FFGB 2IAJB 4ITSA 1FVSA 2JJ4D 2VFRA 3LGNA 3MF5A 5KFTA 5KG2A 1WC0A 2YKNA 3OPKA 1UFWA 2NXEA 1U02A 3MM9B 3RUBL 3Q89A 1Z4UA 2DNRA 2ZWPA 4F4XA 2ZZNA 4I69A 3OJSA 1Q0NA 1B70B 1B64A 3C6UB 5B0AA 3JQMA 4K2JA 2F9JA 3OTOJ 2ZITA 4HTJA 3PM9A 3I96A 3H5XA 4K4SA 4DCJB 2EWHA 2HFUA 2CQ4A 1K0VA 4PG7A 1WF2A 3K58A 3QPIA 4AQYJ 3RW7A 3DN9A 3ICLA 3KK3A 2MKYA 3NS5A 3G6ES 2OUGA 4F2RA 1S48A 2HNYB 3CJ4A 4NRTA 3DOLB 5CYMA 3BSCA 3PG9A 4FYYB 2MEWA 1M1GA 1JJHA 2DK2A 1UW9A 4RBUA 3LGHA 4OFZA 5F8NA 2W01A 1D3WA 1R8PA 5AE1A 5IV4A 2D69A 1FRKA 1GX5A 4R8UA 3OL7A 3P96A 4NLUA 1WOOA 3N28A 2C2RA 3FMBA 4C48A 3O6QA 4DF4A 3DRRB 2PEHA 4OJGA 1FFWB 3MM7B 1SL1A 2MZTA 4K5SA 2V8VA 4UOCA 3OXFA 4PPDA 5D4PA 3KK1A 1U09A 4LF1A 2KG0A 3T1HJ 3NGKA 3M30B 2FJDB 3AB4B 1XNQF 2IVYA 1CJUA 3BBCA 1RLDA 2E1RA 2I0XA 2CADA 3HSZA 4O44B 4P52A 4QWBA 3FBCA 5J2NB 4AE5A 4X64F 2C3UA 3JXOA 4A8MP 3ZZOA 3S8SA 2VQFF 1VBZA 2MKCA 4RW4B 3MCSA 2LEAA 3AXMA 1FRHA 3PTWA 3ZTRA 2IM3A 1WI8A 4ZIVA 5A6PA 3EYZA 4DV4J 1UA1A 1PILA 2VKRA 5IT0A 1LWEB 4MT1A 3EGZA 4CYUA 3P8BB 4J7CA 2RT3A 2JLEA 1FWPA 5DDOC 3C15A 4AL5A 2AQ4A 2HHQA 2G4BA 2DNKA 3GSIA 5KFXA 3TVZA 4KYZA 1U1NA 3ET6A 1NDKA 2AIRB 2YKAA 5IM0B 3G8SA 3JSMB 2HWIA 3KFWX 2NZ4A 2QV6A 4NLOA 4DSJA 4OYBA 1QLNA 1YSJA 2AYBA 1V6HA 1RT1B 3NS6A 2L3MA 3WQPA 4ZVQB 2MGZA 4AL6A 1VRQC 4CO5A 2M0GB 3EE3A 3CJTA 3UFCX 4AYBD 2VHGA 2KL8A 2J6UA 4XDCA 4BBYA 1C1BB 2LXUA 2VG6A 3DOKA 2DIUA 3D28A 3D66A 4FVMA 4O0NA 1YJNS 5T7LB 3TJ9A 2UXDJ 2KU7A 1ULRA 1WF1A 1W25A 2BUNA 1HQUB 2V0NA 5E3RA 3SIPB 3VCDA 1RKJA 4RW9B 3V2UC 4CM2A 2XLJA 3O5TB 3TUZC 1HBNA 2LXFA 3MM5A 5DM7Q 1CVJA 1C1CB 1ZAXA 2IVMA 2NXCA 3GYXB 4OL8A 3PFEA 2J7UA 4WZQA 3BGRB 1HNZF 4WZMA 1VS3A 4ZP9A 5HROB 2YWGA 3GIRA 5ETKA 1VBXA 5DDQC 3BO4A 2YNFB 1EKRA 2PMHA 5I4MA 4AD6A 5ETMA 2FVRA 4KGZB 2I1RA 4F50A 2KRBA 1A6LA 2BJ1A 1S1WB 1HQEA 3IC1A 5M2RA 3R5DA 4IUFA 2R8JA 2B4VA 2OEMA 4QIVA 4ZIWA 1XQIA 2LA4A 2ROGA 4DL4A 4X4NA 3PNIA 3V6DB 1RBOB 2J6TA 2UXBJ 2D1CA 1QE1B 4RZRA 4UUXA 5F0WA 3A8JA 3O44A 3EZ5A 4ED5A 6FDRA 4B3MJ 4ZVOB 3TNVA 3GFZA 4CLFA 3RBEA 1AUDA 2UVRA 3FEZA 4JV1A 3IMQJ 4KJIA 2B8QA 1AXQA 1GXTA 2VG6B 4KT0C 2FY1A 1AZSB 2CG8A 1I6JA 3D0GE 2G13A 2ZBRA 2K3KA 4DMZA 3EZOA 2FZGB 4DR7J 2ZBPA 4JI0J 1CJVA 3EICA 4KPCA 3CCUS 2XZWA 2X7IA 2D7SA 1LFWA 3K7RA 3TQEA 3HZGA 5ETNA 3TUPA 2I8EA 1RA7A 3N6NA 1KKHA 4L3NA 3R97A 1NLKL 1R8AA 3PO4A 1HNZJ 1EARA 3BQ0A 3IBCB 1MWZA 1WORA 2HKEA 2EW9A 3OT9A 4ZLJA 5HL7Q 3ILOA 2AZ3A 4X4PA 3KXDA 5L39A 1YITS 2ZH5A 1CPZA 2AD9A 2WHOA 4GMKA 1NK4A 1T9YA 1ZOTA 3IWNC 2R7VA 1V3ZA 4JI0F 3I55S 3M1VA 1KVJA 3OR1B 2IRYA 3FBBA 2HMIA 2B4OA 3RRKA 4X4SA 3KLHB 1SQGA 1DFDA 2ILZA 3PACA 5D0EA 4EZ9A 3HSGA 2DY9A 2VDHA 1IBCB 2VONA 2W7OA 2KFZA 1TKDA 2DVIA 2BRLA 3EDQB 3EDRB 2BJ3A 4Y2MA 3PIPQ 1YJRA 2OO4A 4DG1B 2ABYA 5KOXA 4ZPDA 1N48A 2DITA 1GMWA 1NJZA 3D0IE 2BQRA 2HBYB 2HYIB 2ZOMA 1JLEA 2AJ1A 2IPOB 1JXLA 3PR5B 3EVMA 1IBKF 1M90T 4X2BA 5IT9Y 4HTIA 2GFFA 1RZMA 1N4LA 1PYOB 3I56S 1L3TA 3CT9A 1HPZA 1UW4A 3DU6A 1R0AB 1NSQA 4EZ6A 2NSCA 1VLOA 4ZPCA 2IIHA 1HI8A 5HI7A 1P8GA 2E5HA 2RF2A 4DSEA 4OJHA 4QW8A 2N7CA 4TU7A 4TQRA 5ETRA 5H9EK 2NLWA 2LQBA 1T9TA 5E0OA 3IRXB 3FQKA 2OKQA 1HQEB 4F7VA 1U6ZA 1T95A 2QZ8A 4ZN3A 2CPEA 2VPZB 1PBAA 3D6HB 3I6PA 2I6WA 2I2YA 1FJ7A 1XNRJ 4RNFA 4DQRA 2B4PA 4JI6J 1QAJA 1KLMB 4CP5A 2JEJA 2XWYA 3W66A 2YTCA 5I3UB 3OSNA 1CQNA 2ZKTA 3CJ0A 3LP2B 5KFBA 4Q8EA 3P6YC 3W64A 4HDGA 3VF0B 3C19A 5IZHA 4EYHB 3QYYA 1PJ5A 2GHWA 2CZVC 4AFFA 3M9OB 4FPRA 1D0EA 1FNXH 2ZKUA 3VGTA 4CYUB 1OJ4A 4J90A 5CYJA 3OLAA 3AJ1A 1KONA 2W1BA 1SV5B 2L9DA 3D68A 4JP8A 4RNNA 3IWXA 2DY1A 5KFLA 3VGSA 3MAQA 5HP1B 1TKZB 3RBZA 1Z1ZA 4LQ9A 3OXLA 4DPXA 2WOMB 2VODA 2MKHA 1JLFB 2C1EB 3MDFA 4RWXA 2XGQA 1YVFA 2KN4A 2QIFA 3CJKB 3T19A 1U6BA 2MJUA 1HNIA 4OLOA 3UWTA 4Q8FA 1XNQJ 2YKMB 3M32B 4UOFA 3NNCA 2IBOA 3X3UA 4R0EA 1U47A 5MLCV 2UUAJ 3Q8PB 5IC4B 3ZZUA 4I56A 1Y4ZB 2XWXA 3GV8B 2FVSA 2ALYB 1GXLA 3AOBA 3NWGA 2DIVA 4ECQA 5ETTA 2B43A 1HD1A 5KFUA 3KMSA 4ZVEA 2NXUA 1X9MA 3CIZA 2APOA 1WTFA 1UPPA 2PFDA 3CGIA 4V1Ak 4PXDA 4DLEA 1SJRA 1N5VA 2I38A 2WB1D 3FRYA 3CJQA 4DUYJ 5J1NA 5MAOA 1B7FA 3TUJC 4LSLB 1QAYA 1Q4RA 1SQFA 4ECTA 2EG2A 4X4OA 3A8EA 3JTOA 1D9FA 1GMWD 5F9LA 5DDRC 1CEZA 2WVDA 3Q86A 1YZ7A 2YNFA 3IR5B 4HI2A 1HBMB 5AXKA 2R7OA 3VZIA 3KJVA 2ZM6F 3HK2A 1BC6A 2RDDA 1TL7A 3OFFA 1KC8T 4B02A 1XN9A 4DR2F 2HIYA 1JLFA 1KOOA 5ETLA 1Q5VA 3RTVA 1QTMA 5HAOA 2HHHF 4URQU 1XMBA 2H5IB 2P8IA 5CD4A 1S7HA 1UEVA 3HI9A 3M2RB 2CWXA 4KFBA 1OPIA 3W5ZA 4DS4A 1WDTA 1VBYA 1S0OA 1M0SA 3KLVA 3DFEA 3I0SA 3L7OA 1VQ5S 1HLWA 2H3EB 4CWBA 1HQ2A 2XY7A 3CC4S 2L08A 1ZM3A 1HHSA 4YR2A 3KWMA 5FLXY 1S4FA 4I68A 1V3RA 3MMAA 4KAIA 1ZTTA 3LP2A 1GQEA 4CLZA 3SV3A 1REVB 4A8OA 4UZBA 3KK3B 2JX2A 2FVCA 5G0RB 2HIQA 3HFVA 4MK8A 1WC5A 2HURA 5CQGA 2W9BA 3DDKA 1Q1KA 1S9GA 2ACYA 2AEMA 2LQJA 1B4SA 1RTJA 2Z0GA 3PHTA 4M5JA 3LALA 1KQGB 3TOQA 4J9RA 1VRTB 4DV1F 3B6BA 4DV2F 2IBKA 3MM6A 2LDIA 2B6AA 4Z7YA 3C15B 4NWBA 4KQZA 2B51A 4LJMA 2G2ZA 3JYTA 2BEFA 2UUWA 4DR5F 4NOHA 1UZDA 2W9CB 2ASJA 2L41A 3KLHA 2V34A 4C8KA 2CQ3A 2Z57B 4DS5A 3R6LB 4ECXA 1Q53A 2LECA 2N7YA 2QG9B 5HSPA 1KD1T 2IA6A 1MROB 5DG7A 3DOKB 1AFJA 2GGPB 2RRNA 2GIRA 4QZVB 3C6TA 4UOGA 2E44A 1AA1B 2DNYA 3LGMA 1U45A 3MEGB 1X5SA 4LMZA 1X4DA 2GC8A 1RT6B 3RB6A 4ZJOA 1SVDA 4FNIA 5KT5A 1FK9A 3TQ1A 2GVDB 2MQQA 3DLGB 3BB5A 1LFPA 5LL6d 4NCGA 4F0KA 1RTHA 1KWMA 2QMXA 3CD5A 1AUSL 4WWSA 3VZHA 4EMDA 8AT1B 3UVJA 2X1BA 3CD0A 4U9RA 3GV5B 4NASA 2C2NA 1VJWA 2F63A 4DDFA 1K0TA 3OHBA 4QQBA 3S6EA 3DLBA 3DRRA 4DX8H 5ETVA 4FF1A 4TQSA 1NM2A 2YX4A 1TK0A 1XIQA 2V9KA 1BXNA 2VU5A 4I7FA 4NMLA 2VL1A 1VFJA 2N4CA 4OQJA 1N34J 3PR4A 3TJ8A 3V6DA 3I32A 2PA3A 1C4AA 2YPYA 1UEUA 2W2MP 1HMVB 3W2VA 3GG1A 1N5SA 1K9MT 3GJSB 5D4OA 2DXDA 2HVIA 1TUGB 4YOEA 3KLFA 2GVZA 4RU9A 3M30A 3KG4A 3OQ2A 4P74A 3TP2A 3DLHA 1NK7A 4GC6A 1SC1B 4WIIA 3W9HA 3KLEA 3FBEA 1V5VA 3FFIB 4QPTA 5AE2A 2XLKA 4OI4A 1KFSA 1S1VA 2G0CA 3CJ8A 4F04B 3CB4A 3HFZB 2W2OP 4J9OA 3BF4A 3EGNA 3GYGA 3UO0A 4OX7A 1SJFA 1WOSA 2MLYA 3GONA 1TKTB 1S6QA 3BBFA 4OYWA 3VALA 3CW2C 2V6AA 2NXJA 1RB0A 4A46A 5DDPC 1SB6A 1SIZA 2B7CB 4QR0A 3Q0AA 2ZNZA 1Q16B 3CWJA 2IAJA 1X4GA 3P5TL 1UFKA 3A12A 3MM6B 4MIBA 4LRFA 4NLDA 4NZ7A 3C8YA 4KBIA 4TU9A 2MGZB 3DRSB 3UD3P 2AW0A 4IG0A 3BSAA 4QIGA 1H0HB 5B09A 2XYPB 3SI8A 2Y0BB 3I5AA 1TKXA 2H5JB 3D54A 3DYAB 4YDXA 2HFNA 1D9AA 4JI6F 3T41A 4Q45A 3G82A 4J9SA 1KFDA 3H5UA 2ZH7A 2L9NA 1PYSB 5CABA 3PRVA 3RAMA 1HMVA 1H2TZ 1I1GA 1Y11A 3W2VB 5C24B 1J5OB 2XYHB 1PSDA 4LVOP 5HLFB 3VGVA 3NMAA 5FJ4A 2DR6A 3ETOA 3SMZA 4X62F 1P9YA 2JC0A 4Q44A 4NLTA 3GG0A 2B9YA 4WP8A 2ZD1B 2JRSA 2R8IA 2E1MC 4ICLA 1KQKA 4MAKA 4F4AA 4B3SF 2K06A 1RT5A 2H48B 2DHAA 2NUHA 3BGUA 5AJ3F 1KS2A 2KVQE 3AT1B 4ZVSB 4ZMMA 3CCJS 3AJ2A 2AX0A 2XY5A 2OPRA 1IBMF 2HLTA 2ZBIA 3NOCA 1IWAA 5IS2A 4AUKA 2C2KB 4CO4A 2CJ9A 2HWHA 3M8PA 2CKWA 2M88A 2OGUA 2BQUA 4KH1B 4FYWB 5B0GA 4RW8B 3KTQA 4DWIA 2Y9HA 1OO0B 4NEYA 2VFTA 4DN0A 1FNOA 1VC0A 3M8QB 1X7VA 2ZH1A 3CDBA 3DLEA 1SUQB 1WDDA 3QT5A 1QSLA 4LFCF 1LKZA 1G6BA 2CPZA 1FJGF 2UXDF 3HCXA 1F3FA 1RU1A 4FDFA 4X65J 1RAFB 3MHYA 2VG5B 4JV5F 2HK2A 1MWYA 2IA0A 3MPDA 1VJQA 4K0KJ 2F40A 3EPGA 4CO3A 7FD1A 3HSJA 3ZO7A 3VAGA 2AT1B 2OELA 1VHFA 2XO7A 4PAAA 4D3HA 4DV3J 5DLFA 4HL9A 4K4TA 4F2SA 1OY9A 4P7VA 3QWUA 1Q7YT 1MN9A 3ISND 3KJQB 5AT1B 1WHYA 4ECSA 1U1RA 3MCOA 4FF4A 3W3SA 4ECZA 3SQGA 4NXMJ 5HBMA 4EFAC 1U49A 3G86A 1HNVB 4ZP8A 4RUAA 3IRXA 3BR8A 1VQOS 5C2GA 1IWGA 5HP1A 5KFSA 1CULB 3MWBA 1S1XA 2QFIA 1YX2A 3I4HX 4CH7A 1VOMA 2NXNA 4O0IA 4PUOB 2HHPA 4MFBB 3ZXWA 3D6TB 4LBHA 5KFZA 1SCJB 2J7WA 2QN6B 1D8ZA 2XQCA 3OL8A 5EX0A 2JZ5A 4DUZJ 2AGQA 4RO0A 4LF2A 1KNZA 2B9XA 3HX9A 3IN5A 2IJNA 4CLPA 4KE5A 2ZH2A 2HZCA 2V2KA 3OL9A 4N77A 2JLGA 3MECA 1O5JA 3R7BB 2O1PA 1W2IA 1H73A 2JEGA 2DNNA 1VR6A 1X4HA 2F65A 4H4OA 3FSIA 3DOMA 2Q43A 3BGRA 3MTKA 4ED1A 1TELA 4H4MB 3U27A 5EGYA 1M1KT 2ZH9A 2X3GA 4F0MA 1H74A 4CO2A 4JI4J 3HVRA 1OS5A 3P45B 1YJTA 4DX6A 2LEPA 2HFOA 3ISZA 1G4CA 1YWXA 3QIPB 1DLOA 3MPVA 4E2FB 4YFUA 5C42B 1N56A 2HQDA 1B3TA 1FD2A 1X5OA 4H54A 1UWAA 3GIKA 1T05B 4CT8A 3Q22A 4QIFA 3BO2A 3VAMA 3NMRA 3PYDA 2UXCF 3KG1A 2MZ1A 4ZVTB 2LQ8A 3IFEA 3K2YA 5LMUF 1NKCA 4OHXA 3THPA 4HKQA 3DLGA 5B0DA 2N82B 2V67A 4DU8A 1RYSA 1C2PA 3J80Y 5E33A 2Y3YA 3BYRA 1KTQA 4B9LA 3PJ9A 4N41A 2HHXA 3JQJA 1NZ8A 2VDIA 4KRWA 3ZZTA 5LSRA 1APSA 1RT5B 4LRAA 2G2YA 2JH3A 2XULA 2YKQA 3G87A 1CJTA 3AQOA 5IQQA 4RNMA 2XMUA 2YNIA 4DI6A 2XHWA 1AT1B 5L38A 3PZPA 5K9FA 1N6QB 1S6UA 3JYTB 2Z58B 2EG1A 4CNZA 9ATCB 1RWKB 2JDJA 2RQKA 2YY3A 1LW0A 4Q2MA 5D0GA 3M2UB 1WC3A 2BKPA 2BABA 5IT9U 2J76E 4ZVGA 2V50A 2YWFA 3R5BA 5H1SV 2K7JA 2E1AA 3GE9A 3V81B 4LBIA 3CJ3A 5CCLA 4GKKF 5IV3A 1IKWB 4DR4F 1KVKA 3MAAA 1PCAA 4DPOA 3RR8A 3GCWP 1LWXA 2GZOA 4Q2LA 1MG7A 3I9V9 3OJUA 4OI3A 1FDBA 2HHUA 2IJRA 2CQIA 3NCQA 2V63A 4U7CA 4GKJJ 1LNQA 4N47A 3G96A 5AXNA 2GW8A 1K47A 3BH7B 1RP5A 3A8KA 3KNGA 2DR5A 3C16A 1S1TA 3E01B 3MEDB 1BWEA 2M8HA 3ZNJ1 1H72C 2CPHA 3DRYA 1DBDA 1RWWB 1PJ6A 4B08A 1RHUB 2ZOGA 4DZDA 4CM0A 4IQXA 2EC2A 4A47A 2FUG9 3RBDA 1R31A 1BHNA 4M5GA 4WCEQ 2HG4A 1F9FA 1YRXA 1EZZB 1HBMA 3Q2SC 2HVEA 2BE2B 4CLYA 1JJCB 1NPRA 1TL3A 4J9QA 3LUYA 4CLUA 2OAUA 2KKHA 4FPIA 1VRUA 4QR1A 3B4DA 1LW0B 3K5LA 3FSXA 3GIJA 1TV6B 2W4PA 4OYXA 1QY7A 3HJVA 4WPAA 3CCLS 4B3MF 1Q8IA 1HQUA 4UOHA 3NG8A 1VC6A 2BANA 4FYXB 2FHJD 3HZEA 3SDEB 2VFVA 3SSSA 2AKWB 2YH0A 2PMZD 1KTVA 4O4RA 1L3VA 5C25A 3IWLA 2CAJA 2XG8A 4FKXA 4YB1P 2NREA 5KFMA 1IN0A 2RKIB 2ZHOA 1K73T 4WXOA 2YKOA 2JC1A 3TEHB 5E3QA 5FIIA 5KAKA 2VQEJ 1RCOB 2UUTA 4EBEA 3B82A 3IBFB 3UD4P 4F4YA 4EBCA 5J2PA 4O3SA 3RAXA 1WC6A 2EFOA 3OFGA 1NEEA 1JX4A 1TVRA 1Y5NB 3B54A 3MFHA 2GGPA 1OY6A 1Q86T 4K0KF 3I31A 2KZZA 1CS4B 1QUVA 3F73A 2C2EA 1N5YB 3KKFA 1GTHA 3ADAC 3THTA 4A8KA 3D67A 1IR0A 4HH1A 2OIHA 3M9NB 3BN4A 3TA0A 2IM2A 2BJDA 2WSCC 2WAQD 4M5NA 2PGCA 3Q8YA 2VASA 3BYPA 2CQDA 3HHLD 2DRDA 3DOLA 3DLKA 5CYMB 1YBTA 3DRXA 3TYTA 5F8IA 3MURP 3DI6B 3G71S 1M5KC 4Y00A 2AJ2A 2F8EX 1CJUB 1GK8A 1EHWA 2DO0A 3CJSA 2KXFA 4JYAF 2ZOFA 2NR0A 1NSAA 2AX1A 5KG7A 3H42A 3R3TA 2GCFA 3K17A 1T8EA 5FLXU 4RUBA 1QAIA 1QVFR 4KV8A 3H4DA 4DPWA 1LWFB 1J5EF 1NCLA 1REVA 4OYPA 3OFEA 2DGXA 4OZ3A 4A4JA 2MB0B 2WCXA 2HBZB 3V5RA 3W62A 3ENVA 3M6WA 4I2PB 2GQCA 1H2VZ 3MTJA 1PKUA 2R2UA 1IJFB 2P9EA 3ZTQA 4R8UB 3C3LA 4GC7A 1N0UA 2HBRB 3H98A 4PG5A 2UUCJ 3WC2A 4C9DA 2R7XA 2YKNB 4O3QA 5CCMA 5E7OB 3ZZ0A 2R3VA 5CAAA 4PQUA 1R8CA 1KR4A 4KFBB 1UVNA 4XAKA 3HD1A 3KLIB 1RE1B 2KVIA 1VIOA 3DGPA 1FDAA 4YY3J 1FA0A 1S97A 4X66F 1KSPA 2ZE2A 1S0MA 5LXYA 3CF5Q 4ED3A 4DSIA 1MMLA 2MLXA 3KK2A 4KTQA 5EWFA 2G2OA 2E66A 1S9FA 4OHYA 2QYCA 2XNQA 1BQNA 3QLHB 1OQ3A 3AAWB 3W8PA 3ELHA 4V19X 5HMWA 4X4RA 2MQLA 1F3VA 3BGFA 3BPSP 4C11A 2EFPA 4PXCA 1JQGA 2DNPA 3E8OA 1UKUA 3QZ7A 4DF8A 1L3SA 1YBUA 1HBUA 1DTQA 1LWEA 2RHQB 3KUGA 4JOUA 1N6QA 3CEDA 5F41A 1R8BA 2I9SA 3LAKA 4HACB 4BC9A 4MKBA 1K1SA 3RZAA 4XO0A 3CMES 3CD6S 1NRKA 2DNMA 4DQQA 3T6BA 4LF7J 2OTJS 2DR8A 3PO5A 2AHOB 4J9VA 4NZ0A 5FD1A 4YP3A 1TUWA 2BYCA 1WC1A 2LA6A 3F44A 1NHVA 1X0PA 4GRSA 4CTAB 2HQCA 1UL3A 2DGOA 2M52A 3MAHA 3SFUA 2ZEJA 5CD4H 1F0XA 5K14A 2V8GA 4YY3F 2DNHA 2XB2D 1RA6A 1XMQJ 1RTIA 1QM9A 3QJPA 1NJWA 1KHWA 4JI3J 3C14B 3QAEA 4M8LA 3N9UC 4KIAA 2DNOA 2OFHX 4DV7F 1HNWJ 2CJBA 3M8YA 3C16B 2KJVA 4OX9F 4EI2A 5DM6Q 2CNNB 4U95A 1L3KA 2LLZA 3POTB 1MN7A 4ZVHA 2E7WA 2F1FA 3BBBA 4OV6A 3UE2A 3VVUA 3EX7B 3A1YG 4HI1A 3VV2B 1AB8A 4KGMA 3DOMB 4DV5F 4XK8C 1SJ3P 1FKOA 5F8JA 1XR5A 1WHWA 1Y9OA 2MKJA 3MI7X 3OR2B 2BE2A 4ZK7M 1UAWA 2FZKB 4ZCLA 5DG8A 2V2VA 4Y2CA 2BVZA 3IM8A 4JI2F 1N33J 1VCTA 3W9JA 1HR0J 1RT3A 3UD5A 4R5PA 1MWQA 3QIDA 4IO1A 4FF3A 2F4VF 5J1EA 2ZDPA 5KT7A 4LSZB 1S59A 5M2PA 2HLUA 2M70A 3SSRA 1EIYB 5J2QB 4JI5F 2ALZA 5D0RA 1NH7A 3GYNA 4RW7B 3M6UA 3PXGa 4QWAA 1BQXA 2BM1A 1FWKA 1QD1A 1HPZB 1KDNA 2QE5A 4ENOA 3PW2A 1RABB 5LJ5Y 1U48A 2SXLA 4QU6A 4TU8A 1WD6A 4IKAA 4OJ1A 4ZJQA 1VQLS 1KRPA 2NYHA 2EKNA 1NKEA 2VQEF 5L1KA 5EWGA 4DR4J 2PC6A 2GX8A 2EBGA 2V94A 4PYDA 2A2CA 3JSMA 1U8WA 3C2PA 3IS9B 3VAKA 1ZYQA 1H3DA 1Y00A 3TZWA 5KFIA 2KDOA 5IFMA 1X4CA 3M7VA 2VIHA 5IWAJ 1FXRA 2QL5B 1N32F 1ZM9A 4RLEA 2BOPA 4DSFA 3ONQA 4WF9Q 4FYDA 2QLJB 2P5VA 2KI2A 2GNKA 3HFKA 4ETXA 3I0RB 5D77A 4UW2A 3ISNC 2HQ3A 2W2NP 1FE0A 4Y34A 3WC0A 2VICA 4UT4A 4A8SA 2W7AA 3M9MB 4DFJA 1VQ7S 1P1TA 3H20A 1DTTA 2EXUA 2BE9B 3GFHA 2B9EA 3T1AA 4C6AA 3DXSX 3QT8A 2IMOA 4JB8B 2B56A 3GP9A 2XS7A 2MQMA 3FCWA 3LP0A 1VQYA 3MM7A 4ETZA 1C0TB 3M05A 1DZ5A 4QU7A 1T02A 1WG1A 4PPZA 1WEXA 1VQNS 2HHWA 4K59A 5IC6B 3FQLA 4J9UE 2XYGB 4WU3A 2BV3A 1CSJA 4WKRA 2QTWA 1VHIA 4DV0J 4PWUA 3TI0A 3MMCB 3WX4A 3EM1A 4U96A 2PT0A 4QWEA 1FJEB 1QTNB 5KFYA 4KY3A 1ZAWA 3IO1A 4EGLA 1YBAA 2F7VA 2MTLA 4USUA 2XZDB 4NLSA
chains in the Genus database with same CATH topology
1H2UX 5BYSA 1BQMA 1KLMA 5HN0A 4RUCA 1U49A 3KK2B 2DGTA 5KFJA 2DCLA 2VH7A 2ADBA 4V19J 4KO0B 4OZJA 4ZPVR 1HNXF 4YMEA 2ATLA 2IMWP 2W7PA 5K5MA 4PQAA 1PO6A 3K5OA 3MMAB 2XSJB 3H8YA 4ED6A 1NK9A 2GQQA 1G7CB 3G8TA 5KFVA 1XTZA 5EX3A 1RTDB 3MM9A 2HGNA 1HL6A 2WBMA 1T94A 2RS8A 2YNIB 2IYGA 1N5YA 1YG0A 1Y5LB 4I6AA 2AGPA 3TAMB 2NPIA 4IRCA 4K4ZA 3RYLA 4R0JA 4QW9A 2R8HA 1RT2B 4ZHRB 3N6LA 3LF0A 1X9SA 3DM2A 4DOZA 2R7SA 3V81A 3ZFVA 4ALZA 3JB9k 4DEZA 2M5YA 5E5NA 4DG1A 3IAS9 4A8XA 3HPOA 5GAEI 3I4PA 1FCAA 1S79A 4ELUA 1DHMA 2ZC4A 3HMJG 4OJ3A 2EC0A 1ROFA 1VI7A 5A8RA 1FRJA 3DMJA 1VC5A 1JMTA 1HYSB 3GR1A 4TLQA 1HBUB 5KOWA 2EFGA 5DRKA 5F3TA 2CPDA 3D1OA 1TVRB 4RW6B 2DPJA 2LXIA 3ULHA 4J9LA 1NK5A 3HVAA 2NYIA 2HNZA 1TZ0A 2J5AA 4LF6F 4J9MA 4PR6A 1T3OA 2CQBA 3PFOA 5D78A 5I3PA 3D2WA 1ZZNA 1DJ0A 4HVZA 5F8GA 4MYTA 5SZTA 3KLGA 4JI1F 3D5MA 4XIUA 1B0VA 3RB0A 4I1TA 3FDSA 5KFDA 4Y28C 1R43A 4KSEB 2QEXS 1OQ6A 2Y1RI 1MU2B 3LW5C 4PCQA 1UA0A 1S1TB 1RDRA 3E01A 4G1IA 4ICLB 4RW7A 3Q8QB 3BSNA 2XLIA 2D3UA 5KFAA 2J9CA 4C8ZA 1B0PA 2VC0A 3AQPA 3OSPA 3W2WA 3TRGA 3UW1A 1X9WA 1SH2A 2B6AB 2XSJA 2MQOA 4TLRA 2W8LA 1S1WA 2R2TA 4PXBA 2K3IA 3SQGB 1S9GB 4F4KA 1JLGB 3V4IB 3WBZA 1NNDA 2V8DA 2R9LA 2R2SA 1JLGA 3CDUA 3KHGA 3U02A 3M2UA 4MK7A 4F25A 3OW2R 3PW5A 4C8OA 4X4TA 4LSNB 2A3JA 5JJBA 5F8MA 4MKYA 4USIA 1JXEA 3NGDA 2DR7A 2VA3A 4Q0BB 4D3GA 2OPQA 1DAXA 2M9KA 5J2QA 3PKMA 2ZJPQ 4WYWA 4OV1A 3HO1A 3NKYA 2B0GA 1MU2A 5KT3A 1M5HA 3DU5A 3SEOA 2R7QA 3FFIA 2FJBB 1M5SA 2CYYA 5BYRA 3KLEB 3QAUA 3DNCA 1NB7A 3L95X 5KT2A 1RTHB 1E6YA 2G1DA 4NLVA 1UJ6A 5EHHA 1U8SA 2RKIA 3ZZRA 2YNGA 1FKOB 5L1JA 2C3OA 3HVTB 2PE8A 3Q23A 2ASDA 2YX1A 2QSWA 4NCBA 2LQ9A 1MW7A 1YGYA 1HI0P 2XSFA 3PX0A 4FVCA 2XMVA 2ZC3A 1FDNA 3QIPA 1LQ9A 1FDDA 1VQSA 3LQVA 3HHLC 5BJRA 5E3AA 5LT5A 1BLUA 2HMIB 3NLCA 5KG4A 1YIJS 2OLWA 2GMHA 3BDEA 2GJ2A 2CVEA 1NH8A 1TV6A 3OLBA 2J9EA 4M94A 3J81Y 2RUGA 2R7TA 1HR0F 2KT2A 1HFEL 3CUNA 1B0TA 2FGCA 2DNQA 4ES3A 2CJKA 5KFEA 4NLRA 1RKIA 2JL9A 4DN9A 1SBRA 1HI1A 2HGLA 1HA1A 2FC8A 2XMJA 4KGKA 4N56A 4O3RA 3LH2S 3SYZA 4P7TA 3PHEA 1ZBTA 2EFVA 2QRRA 2ZJQQ 1N88A 4PQUB 3HT3A 2Y1JA 3PVXA 3CCES 2DT9A 1FO1A 4ZVFA 5IXUA 3H2UB 1N52B 1GT8A 4DFMA 3CDAA 3M2RA 5GAHU 3TO8A 1VQ9S 4BHQA 2C3YA 3QMQA 2OPPA 3B8HA 2RDJA 2QA4S 2CVIA 3IRWP 2YNHB 5U47A 2EK6A 2KYZA 3M8SA 1TUVA 2FLOA 2XY6A 1XMQF 3MECB 1BQMB 2YNHA 1JNRB 3W7BA 2LMIA 2VKZG 3OHAA 1NAQA 1EETA 3MUVP 3CC2S 4LSLA 4OI1A 4HH0A 5JUMA 3CC7S 4DBQA 3H25A 2MZSA 1XERA 3IR7B 2J0QD 3ITHB 1FRIA 4C3KA 2KRRA 2B3TB 4DFPA 1TK5A 2AYGA 1S6QB 1FKAF 2HGMA 3N6MA 2ZH3A 4QYZJ 3MR2A 1R0AA 2RIJA 4BS2A 2UU9F 4IOAQ 2WRMA 3DRPA 3AH6A 1FKPA 3GZ7A 4HT7A 2VFUA 3CCMS 3HF5A 3IR6B 3SCLE 3NNAA 2OMOA 1S72S 2BDPA 3CULA 4KHPF 2LU2A 3HLUA 1YI2S 2HS0A 2O3DA 2HVZA 1JK9B 4ECUA 4DL6A 1FE4A 3PJXA 5F0UA 2RQ4A 5T41A 2U1AA 4CTAA 4OI0A 5DGBA 2F3JA 2N4DA 1IKXA 1FEEA 1RT6A 3OTOF 3HP6A 4F02A 3MPYA 4QBUA 2GQ2A 4I64A 1ZPVA 3MGJA 2D9OA 1H6KX 2VG5A 1LWCA 3L09A 4MIAA 3U1MA 2MZJA 3PW0A 3M2VB 1X5PA 4WE1B 4UY85 2GA7A 1ZZFA 4MJKA 2OPSB 1OPZA 3E51A 3HKZD 3PRBA 1VRTA 4KC5A 5CH7B 3TA1A 4H4OB 3LO3A 5A6WA 3DC2A 2YKMA 1TL3B 3M32A 2ZDOA 3K5NA 3NCRA 1TQLA 3QO9B 4C2MA 4MMOA 5EDWA 1FNMA 3SCKE 3KK1B 2OJ3A 3BEGB 3N0VA 2CDQA 4ELTA 4IRDA 3OTDA 2ILYA 4LT6A 1UJ4A 4NA3A 1RJJA 2F8HA 5KT6A 2XMTA 5HO4A 1Q79A 2VPWB 2FJEB 3G8QA 4ZP6A 4F3OA 1OIAA 3B78A 2CPJA 2XI2A 1JLQB 4L72B 2VV5A 5AXMA 2LCWA 1UVMA 3T6JA 2YVSA 5J1EB 4DL7A 2AP6A 1VMBA 3Q8SB 1S1VB 2GO8A 3KHHA 2JFKA 2MSTA 2DR9A 3MM8B 1JLEB 5KG0A 1LWFA 4N8OA 4RBVA 5LMNF 3BO3A 3KJVB 1RI7A 2AF6A 5G0RA 3V4IA 4JI8F 4Z37A 4USJC 5I42B 3O2IA 1PC4A 2BA9A 4FS1A 1ZH5A 4DR7F 2FHKA 1KQSR 2PSZA 2D74B 3KG0A 4OZNA 3PIOQ 4A8YA 3T9ZA 1R27B 3V4MA 1AW0A 3FVYA 2WBRA 3NCPA 4M1KA 2VOPA 2ZH8A 4NA1A 3ZZPA 3FMWA 2J6SA 2KT3A 2LEBA 1JNZB 1RWUA 1U1KA 1S0VA 1L5UA 3OTEA 3V6KA 4YR3A 4A8WA 5C25B 1JJ2R 4QIWD 1FESA 1TKZA 2A1BA 1CG2A 2RNEA 3UPFA 5KFHA 2J0WA 1M5VC 3GMGA 4MK9A 4TY8B 3MMBB 4OIXA 1Y0HA 2CJAA 1UJ5A 3ZZYA 4TKTA 1R3NA 3MR3A 1KOHA 1HW9A 1SC6A 3PDNA 1YRUA 2FD2A 4U7UK 2W4CA 3M8QA 2WSFC 3JTPA 1G3OA 2FJXA 4C0OC 1VRUB 4R25A 4NCAA 2FJAB 1FTCA 1RT4B 5LSLA 3G6XA 3JAMY 1Q7LB 5GADU 3LWMA 1I94F 2VA2A 3CVKA 3E3XA 1UVLA 3F56A 2F9DA 4WFAQ 3DXBA 4XDDA 1XR6A 1U2RA 3PX6A 5B0CA 2YH1A 4Z2XA 1MSWD 4TYBA 4YB6A 2X1FA 2DTJA 4JI4F 2ASYA 5T14A 3EUNA 2JVOA 1TKTA 1V3SA 2HRYA 1FRMA 2VFSA 1XR7A 1XWLA 2KH9A 3MXHP 3H2LA 2YWEA 4CH1A 3VAJA 2XCAA 2W8KA 4J9KA 1FHTA 2DHSA 3CIMA 1TKXB 4QJVA 1U1PA 1VQ8S 3NBPA 1NJIT 1CLFA 1O51A 1CC8A 3DDNA 2J0SD 4UY8T 2HNDA 4NLPA 3BGLA 5EUHA 2VPXB 4E0DA 2IM0A 1SL2A 3N5BA 5A0YA 1URNA 2GV1A 2OTLS 2QA4G 3GWCA 1Y3KA 1O0PA 2RDIA 2ZZMA 4RW4A 1JB0C 3T9NA 2QLWA 4WK3A 2K7KA 4TY9A 1FJCA 1JLCA 4LIWA 2ADCA 3UI3A 2RB7A 4B3TF 1HNVA