4HL9A

Crystal structure of antibiotic biosynthesis monooxygenase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
93
Chain Sequence
MLKVIAQDFIKPEAIDIVLPLYRELVEKTRQEPLLAYDLFVDQKDPGHFVFIEEWPDRAALDIHATEHFTRLVPLINAHQRQDGTVVLMDAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibiotic biosynthesis monooxygenase
publication title Crystal structure of antibiotic biosynthesis monooxygenase
rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 24
structure length 93
sequence length 95
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4hl9A00
3HX9A 4DPOA 5B0BA 5A6WA 3CJKB 5T7LA 1AW0A 3K7RA 5B0EA 1GXTA 1TZ0A 2RSQA 3GZ7A 1FE0A 2IFXA 1XBWA 2OFGX 2QYCA 2RILA 1WD6A 2BJDA 3LO3A 3FGVA 2LQBA 1X7VA 2N4CA 2ZDOA 4NPOA 1Y0HA 4YEAA 5F0UA 4OJ3A 1GXUA 2OKQA 1W2IA 3BF4A 5F0WA 4A46A 2GV1A 3FRYA 5B0AA 4Y2MA 2GO8A 1ULRA 5B0FA 1X8DA 2N4DA 4OJ1A 2XMMA 3DCAA 2KT2A 1OSDA 2FB0A 2EW9A 2BUNA 3WDOA 4HH0A 2GFFA 5K9FA 2W4DA 1YRXA 3DXSX 3FMBA 5B0DA 3MZIA 2QIFA 1APSA 3BGUA 3HHLA 3HHLC 4Q2MA 2IYIA 2IYGA 1VQSA 2XMKA 1TL4A 1TR0A 2ROGA 4EFAC 1YJRA 3HF5A 2Q3PA 2HIQA 4A47A 2GGPB 1SB6A 1Q53A 2XMTA 4Y2KA 3IWXA 4YDXA 3LGNA 3QGPA 1URRA 1IUJA 3IWLA 2KT3A 2XMWA 4Y2IA 1AFJA 1AFIA 4A4JA 2BBEA 2K1RA 3CJKA 2ZDPA 2FTRA 2HLTA 1FVSA 2XMJA 1N5VA 1VQYA 1SI9A 2GA7A 2PGCA 1Q4RA 2K2PA 1SQEA 3BDEA 3KG0A 4FNHA 1P8GA 2BJEA 2OP5A 2W4PA 1FEEA 3KNGA 2CRLA 2OD6A 5T7LB 1KVJA 2N7YA 2QLWA 3BM7A 1YJTA 2K7KA 2FIUA 4ZOSA 1TUVA 1S6UA 2OFHX 1YJUA 3TOQA 3BB5A 1CPZA 2FHMA 4OJGA 1Y3JA 3TNVA 2JDJA 2ACYA 2OD4A 1N5TA 4DN9A 4U9RA 4HL9A 1YJVA 2KYZA 1FE4A 1OQ3A 1OQ6A 1KQKA 3BN7A 4HI1A 1MWZA 2QLXA 2OMOA 2BYCA 1KVIA 2HFNA 4ZA1A 3TRGA 2XMVA 5KAKA 3E8OA 1S6OA 2ASYA 2HLUA 2AP6A 3I9ZA 2KKHA 2PD1A 4FNIA 2XMUA 1Y3KA 4F67A 2K7JA 5B08A 2ROEA 2RMLA 3HFKA 3UDCA 2AJ1A 4HH1A 3T9NA 3MCSA 3BR8A 3KKFA 2ROPA 3HDSA 1TL5A 2K1RB 3F44A 1Q8BA 5A6PA 3KG1A 1Y9OA 2VV5A 4HI2A 5B0GA 1U7LA 1YG0A 4DL0C 4NL5A 2AW0A 1V3ZA 3HHLD 1OPZA 1RJJA 1P6TA 4QOTA 4OJHA 2LXFA 2LDIA 1MWYA 4Q2LA 2L3MA 4A48A 1FESA 2OAUA 3VTIA 1FD8A 3LGMA 1JK9B 3QMQA 2RU9A 2G9OA 5IXUA 2GCFA 1QUPA 2GGPA 3HHLB 1Q8LA 1LQ9A 5B09A 1X0PA 1CC7A 2VH7A 2AJ0A 1FVQA 2LQ9A 5B0CA 1CC8A 4OIXA 2HFOA 1JWWA 2HQIA 1K0VA 2W4CA 1R6YA 1N5QA 1N5SA
chains in the Genus database with same CATH superfamily
3B82A 2W8LA 2W9AA 4O4GA 3EICA 4Y2CA 4QR2A 2FC9A 3IRXB 8AT1B 4KAIA 1U6BA 3FMBA 4PZVA 4O3PA 4B3MF 1APSA 5L38A 2G4BA 2QEXS 2C2ZB 2MQOA 3H25A 1PKUA 2B51A 3RAQA 2JRSA 5EDWA 3GPAA 1L5UA 3FC9A 2FVPA 1YJTA 5A8WA 3HT0A 3Q2TC 1N5YB 3OLBA 2J0SD 1N34F 1FRHA 2B8QA 1DQ9A 2QGFB 1N0VC 2H5JB 3GSIA 3KJQB 4M5NA 5SZTA 2RMLA 3S7RA 3AD7C 2BQRA 2J9EA 1RKIA 1PYTA 4JOUA 3NOCA 3E51A 1PYSB 1VRUA 1FD8A 4RUCA 4DL4A 4FYWB 2P6SA 4Y6IA 1RTHB 2DIVA 3UE2A 2V63A 2CXEA 1ZS6A 2AEFA 2QYCA 1WD6A 4XPCA 2FHJA 2WSCC 1D09B 3LOUA 3UR3C 1X4GA 1HNXF 2LP4A 3PJXA 1JLFB 1X5PA 1TKZA 4Y2KA 2NYHA 3D1QA 3EMTA 2JZ5A 3MM9A 3W61A 5GAEI 5JVGQ 2FHJD 4YUDA 3BR9A 1DTQA 3RZAA 4F3MA 4QW8A 4U96A 1RT2B 1JXLA 4PG8A 1S6UA 3J81Y 4IKAA 3E2EA 3M2VA 4DV0F 2FY8A 1URNA 4IH6A 3VHQA 2QJ3A 1LW0A 3TEHB 3FFIB 3BBCA 3QZ7A 1X5SA 4ANDA 1NO8A 1GK8A 5KAKA 2CWXA 1Y5NB 3GLJA 2CQ0A 3A3OB 1FK9B 4TLQA 1CJVA 2XZTB 1REGX 3F44A 4FS2A 4DPYA 3CDUA 4QYZJ 1KHVA 3BKFA 1NK5A 2VBWA 1QSYA 2CDQA 4WF9Q 3F73A 1NJXA 4PEOA 3MTKA 2XCAA 1HQEB 1X0PA 3VALA 2AKWB 3E01A 2FZGB 4AE5A 3KWMA 2GIFA 1M5KC 1TAUA 1OWXA 3OD2A 1KONA 5ITHA 3V81A 4EU0A 1W26A 4PAAA 1SUQB 1X4CA 5DZ7A 1MU2A 3UCUP 3PNIA 4G1QB 3ZZOA 2BRKA 1VGYA 2C28A 4DOZA 4DLEA 4TQSA 5D0HA 4LVOP 4I56A 1E6YB 2XMKA 3J7AN 2IM3A 4FYYB 4KHRA 2IMOA 3PYEA 4Q5VA 3W9JA 2FTRA 2ZNYA 2K2PA 2B8PA 2MEWA 4I1TA 2KT5A 3M2UA 2UUWA 2M70A 3BV8A 3OTEA 3Q8VA 1M5PC 3PO4A 4WU3A 4K2JA 2LQJA 4LVNP 3SCLE 3BGRA 5E3RA 1JMTA 2KN4A 3M2RA 2X51A 2ROPA 1S12A 1TKXA 3QRRA 2X1FA 3ENVA 2MZQA 5IXUA 1S79A 4F4KA 2E7WA 1S1WB 1TK8A 2MKHA 1S48A 2OFGX 3OR1A 2DGXA 4TYAA 4Y28C 3W5XA 4DV2F 4TXSA 3M8QA 1FTCA 3D1OA 3S01A 2RQ4A 2FJXA 4NWBA 1JLEB 5GAHI 1T9UA 2CQ2A 5HVHA 5K14B 5KG1A 2KT3A 2YWHA 4F25A 4ECVA 2YNGA 4NXMF 4LF1A 2VPZB 3H5XA 4GKJJ 1FJGJ 2JHEA 3QFHA 4DR5F 1VQPS 5FD1A 3NS7B 7AT1B 4WKRA 1PGZA 3LP1A 3KLFB 3GYNA 1XTZA 1FWKA 4DS4A 1LFWA 3QWUA 3W5YA 2R7XA 2VV5A 2H4WB 4JV1A 2HG4A 3V4MA 1HNZF 4RL1A 4AL6A 4RW4A 1S4EA 1WJ9A 1UWAA 3K58A 1J5EJ 1EX8A 3ZZUA 4J9NA 3N6LA 2DRAA 2QV6A 4ENOA 3N5FA 3OTOF 2RT3A 3ZZZA 3NMRA 2E1CA 2F63A 3IAS9 1Z1ZA 1OSDA 4WFAQ 3H5UA 2J7KA 2QMXA 4K4UA 3OHAA 5CCLA 4DSKA 3TUZC 1D1UA 3QBCA 4BDPA 1RWNB 3K5OA 3EJMA 4WFXA 4ZVSB 2XHWA 3DLKB 5LJ5Y 3LPEA 4J9PA 4LF6F 2FIUA 4RZRA 2VU5A 3EGVA 4B3SJ 4TYBA 4FXVA 1WF2A 3SCKE 4JI1F 4ZCLA 5CZVA 4USMA 3DXBA 1Y3KA 5KG3A 4QWDA 3T9NA 2ZJRQ 1R7IA 2HQGA 2PFDA 3K5MA 5J2QA 5E41A 1YBUA 2ZH6A 3PZPA 4DCJB 2JNJA 2BJ3A 5HATA 4ELTA 4LR7A 2CPEA 1RT4A 2BOPA 4BBYA 3ETMA 4HTIA 4CH0S 3OVAA 3J7YU 3MMAA 2KB2A 1IR2A 1NJZA 1RGVA 1HHTP 2YX7A 4IDKB 3D6FB 4KV8A 2CG4A 3E3XA 3H0PA 1NCLA 1T9XA 2IRUA 3DYAA 4UQGA 4DU8A 4CLZA 3ZZ0A 4NX9A 1VC6A 1C1CB 1GQEA 2YX4A 5KG5A 2PGCA 2Y1LB 1C2PA 2R8HA 4DUTA 2J0WA 1MN9A 5ETRA 3W2VA 4DUZF 4H4KC 2BA9A 1HBOB 4LUBA 2GVDA 1ZPVA 2E7XA 4PWDB 2ASLA 2ZBCA 2I1RA 4K5RA 1S7HA 4M5JA 2EVZA 1QAIA 5F9NA 4LF4J 3ET6B 3TJ9A 4CYUA 1NM2A 1XNQJ 4KH0B 1R31A 3FBEA 4W92B 3P8BB 1M1KT 2UU9J 2XYHB 4BS2A 1SKSA 1UVNA 1CC7A 1Y7PA 2E9ZA 1FX4A 4BHQA 1HR0J 1Q86T 3OUYB 1I94F 1IKWB 2MZTA 4G65A 4A8WA 1XWLA 3M6XA 3AT1B 2Q1LA 2UZAA 3IBWA 2LLZA 4OI4A 2NS1B 1W25A 4B3RF 4IG0B 3POTA 3P96A 3JXOA 1TMJA 5IOLA 4A8XA 1HQUB 2V50A 4ZLPA 2A6MA 2B4PA 4X4VA 4WZMA 3UNYA 4O4GB 3SCIE 1H7WA 1HHSA 4NLDA 1GFWB 3IXQA 3OQ2A 3FJ2A 4LREA 1KQKA 2FQQB 2RRAA 1NDLA 2ATLA 1MWZA 3PYDA 3DLBA 1P9QC 2YQ1A 1WORA 2MQ8A 2CNKB 4F67A 4NYPA 3B4MA 4ED7A 3C46A 1SIZA 4O3NA 4LF7J 1IBMF 4B9LA 4WXOA 1OPZA 4QIFA 5A8WB 2V94A 2Z0GA 3BBFA 3NCRA 5MAOA 4DL5A 3N9UC 1U2FA 5F3ZA 4NLUA 4PXBA 4J37A 4IRDA 4U7UD 2B3TB 2BKOA 2ALZA 1M5VC 2VKRA 5DDRC 1VCTA 3BSNA 4CTAA 4ZP6A 3VZHA 1N6QB 1VQ5S 4DJBA 4OJ1A 1OS5A 4NA1A 1VRUB 2UVUA 4DR4F 4B02A 1VQMS 1B99A 2AU0A 1RWMB 3GR1A 5DG7A 3F41A 3NMAA 1N33J 1T94A 2F5GA 4Y3CA 2KYXA 2M3DA 2GA7A 3GJQB 4WBFA 3GV5B 3DI6A 1D9FA 3AOBA 1QAXA 2EFNA 2P8IA 4JI2J 1Q16B 2W7OA 1XJWB 3ILLA 3MCNA 3I31A 1WKLA 3FCVA 5JXSA 5ETOA 2PI5A 1TKZB 3CDEA 2VASA 1RBLA 3K0JA 2XS7A 3MM9B 4PABA 2D3O1 1UEVA 4JI8F 1DTQB 2EWHA 1Q5VA 2HHTA 1VIOA 3VTIA 2OTLS 5J2NB 4ZHRA 4OYZA 2J8SA 2ZEJA 3UO0A 1LW0B 1N5SA 2YNFA 4OHYA 2Y8YA 1TQLA 3SV3A 2AYBA 1NK6A 3NGKA 5KT7A 3CCES 2YKMA 1CJVB 4MK9A 1T8EA 2D1CA 1UFWA 1RADB 3EZ5A 3DDNA 4XK8C 1QLNA 5AT1B 4I64A 1YRTA 1UFKA 3DC2A 3UN3A 3PRBA 4OZNA 3GIJA 4Q7AA 3NGRA 2BE9B 3E01B 1HNWF 1TFYA 4R8UA 2R2RA 2OP5A 1BQNA 1RWOB 3W2WA 1T9WA 2NXUA 1P9YA 1NUEA 1TUVA 3TVKA 1MU2B 2X7IA 2B56A 3NG8A 1VQ4S 3HSDA 1GMWD 2W2PP 2HFSA 3UW1A 3SCJE 2I0XA 2HHSA 2ZOFA 4UZBA 5L46A 4ECQA 1UZHA 2Z8QA 3KKFA 4G1PA 1KSPA 2E5GA 4CNYA 4C2MA 3TZZA 1SJ4P 1NJYA 2G2ZA 3BJYA 2ZWPA 3TEGA 5DDQC 3M2UB 3HHDA 5LMNF 2E5LJ 1FVQA 2HHPA 4P2MA 1Q8KA 9ATCB 1JKHA 4DUYF 2Q66A 2JEFA 4YN3B 5B0EA 1KNZA 2KFYA 4Z2XA 2AEJA 4JI4J 6FD1A 3H59A 1SV5A 2GAHC 3M2RB 1N36J 4K4VA 4LSLA 5K8PA 2VG7B 3T6JA 1SIWB 3MEDA 1SL1A 3QFWA 2YNHA 5A2QY 2R7WA 4X84A 4UW2A 2O3DA 3T1YJ 2DR9A 2B7CB 3T41A 3K5PA 1D9DA 1U26A 2JDJA 2YNIA 2MMYA 1MW7A 4EEYA 3I56S 3P49B 3H20A 1OQ6A 3M8QB 4PRFA 3RYLA 3C8YA 4JYAJ 2HSEB 2A6OA 2K7JA 4GVBA 4DV1J 5BR8J 3OJUA 4L3NA 2RRNA 4CNZA 1PJ5A 2BKPA 3R3TA 2YNGB 3KDOA 4YR0A 4C8MA 2L9WA 2LQ9A 2AJ4A 5L9NA 1TL7B 3MEGA 4FDFA 4DL7A 1N48A 3CSKA 3CMAS 2CPFA 5HJXA 5JUMA 5D78A 3PV8A 3CC7S 1L3UA 2A2DA 2CQ1A 4YMEA 4ANCA 2DRDA 3DHWC 4WP8A 2UVRA 2A18A 4RW4B 2J6UA 4TY8A 1OO0B 3JAMY 1UW4A 2XMWA 4NLWA 1CVJA 3DLHA 1BC6A 4C3MA 4F4AA 3FEZA 2JLEA 3FQKA 4X62J 5KFIA 3THPA 3MR7A 2ZM6J 4V19X 1S1XB 1SKUB 4ZPAA 3WQPA 1WKJA 5G0RA 1NPKA 4RX6A 2JX2A 2RAQA 9RUBA 3AH6A 2D7SA 2AJFE 5GMDA 2QA4S 2QLFB 3GP9A 1U0SA 4OZ5A 2B9XA 3HVAA 3NY0A 2WBRA 5HO4A 4J9UE 4QW9A 1NEEA 3EX7B 1HBMB 2HBYB 1ELOA 2R42A 2IFXA 1IQTA 3UPFA 1F1BB 1DTTB 2HVIA 1CQMA 2HRUA 2OEMA 3QIDA 4HR2A 2DNQA 5J2QB 4GC6A 1TL4A 3HKWA 4I2QA 4I67A 3CCTA 4CLSA 3I4PA 2GAGC 1RT4B 2CJAA 2HVDA 4ZCIA 4HHUA 3MMAB 1DAXA 5KFCA 1MMLA 1RWPB 3SFGA 4GO7X 3TZWA 2LU1A 3SZ2A 2DNYA 6AT1B 3BO4A 1U1QA 3IR7B 3DYAB 1OYDA 1JLCA 1F3FA 5AXNA 1YZ7A 1U45A 3CDBA 3D6TB 4JBCA 4QJVA 1YRUA 2VDHA 2C3UA 3AA8A 2MQLA 5DG8A 5LSRA 2WCXA 4NI2A 2EPIA 2P9EA 2DHHA 1CC8A 3JB9k 3KK3A 2R8GA 1V5VA 1RISA 4ECYA 1RHKB 2ZBPA 1CS4B 2HHUA 2FZCB 3FCHA 5DDOC 1PC4A 4CYUB 2C2NA 1TUGB 1NLKL 1G4CA 4HHHA 1VISA 1GH8A 3IP0A 4P72A 2KZMA 3MM6A 2IDLA 2MQNA 4X65J 2OHDA 1FEHA 3IO1A 1GMVA 2N7YA 1M90T 3US5A 1RWKB 5HQ8A 3RJMB 2E9TA 1Q1KA 4ECZA 2BX6A 3UDLA 1IWGA 4ED8A 5MLCV 3POTB 1KN6A 2MKJA 1ROFA 3RTVA 4EBCA 3JTOA 4DF8A 1D3WA 4G6VB 1MWYA 2J9DA 2HQCA 1TKTA 4MIBA 1Q81T 1VLYA 4O3OA 4U67Q 2XWXA 3M8SA 2ZH7A 4NLYA 2B43A 1H73A 1Q82T 2AWZA 2RRBA 2YH0A 3RU0A 3HVTB 3IAM9 3T6BA 5DGAA 3MMJA 3J7A1 4OJ3A 4KHPJ 1VRTA 2HHQA 2YWEA 2EK6A 1VLOA 2V8PA 3L7UA 2GO8A 5E3AA 4F4YA 1WHWA 2VFRA 1OSCA 3OJSA 3TZXA 2PT0A 2MLXA 1NPPA 1YDLA 2QA1A 2HNYA 4O3RA 4C0OC 3TAMA 2OPPB 3PJ9A 2V4QA 2R8JA 4OV1A 3DLLQ 4CTAB 5HLFA 1OY6A 2DY9A 3V2UC 3P6YC 3L3CA 1QY7A 4Q44A 5JVHQ 4UUXA 2HHXA 1PAEX 4JV0A 1RQ0A 3HP6A 2XMUA 5D4NA 3JSYA 3TA0A 3TQEA 2VBXA 1UPMB 4K4TA 3N6MA 4KPYA 2VONA 4ES2A 1LFPA 3DI6B 2KRBA 2AYGA 2DY1A 3WIUA 2XYPB 1U8WA 1D8YA 4ZIWA 5FDLB 1H98A 2RF2A 1KQSR 4UF4A 2ZZTA 4CDIA 4J90A 1D0EA 2DNPA 1JXEA 3H2UB 1QAJA 5HK4A 2XMAA 2R9LA 1TAQA 4MAKA 3FUYA 1ITPA 3IRWP 4LF8J 1UMJA 2NPIA 4ZHRB 3CJ5A 2ZZNA 3V4IA 2IHR1 3WX8A 2YNFB 2A1BA 1IR0A 4GKJF 1FJGF 2HQFA 1QTMA 3DOLA 2YKMB 2CQPA 1RAJA 3HPOA 3MPUB 4CWBA 1X4EA 1WTBA 4A8SA 1UZDA 4U8YA 4N7TA 2YY3A 4RUAA 2GNKA 4DX6A 1KP6A 4R8UB 4DL0C 3CCWA 1BQNB 1FF2A 3W2WB 3VGTA 3JTNA 2CVIA 2XCPA 2VH7A 2IDEA 1NH7A 1J5EF 5IM0B 5EWFA 3C15A 1Q78A 3V6JA 1D8ZA 5A6WA 3EGZA 4JUZA 4X4SA 4RNOA 3NRBA 4HKQA 2E1AA 3PY8A 5KFEA 3N0VA 4QIEA 4K4YA 1ZPWX 1YWXA 3LALA 2PMZD 2OPSA 2YVSA 4KRWA 1T3NA 4U8VA 5HMWA 3HVWA 1JKHB 2HZCA 3G8TA 3TO8A 1JLAA 3TARA 1SV5B 3HHNB 2IIHA 4B3SF 2HVHA 4LSLB 1RHUB 1RHRB 3R5JB 3T19A 5IWAJ 3M8PA 3MEDB 2MGZA 1UW9A 1U4BA 2YNHB 3LAMA 3A1YG 2MQPA 4WYLA 3HHLD 1YIJS 1F3VA 3QO9A 3HKZD 4MK7A 3BGOP 4KJIA 1KOHA 4C11A 3CD5A 4PPZA 3D3BJ 2YNIB 2O5DA 3Q24A 1KFSA 1F9EB 4WFZA 1M0SA 3LGHA 3J81U 2VG5A 2LECA 2EFOA 4GVBB 2EXUA 4A46A 3AD9C 2IAJA 3RW6A 4ED6A 3HD2A 3DLGA 4RUHA 2E44A 3JSRA 5F8LA 1HNIA 4HACA 4DQRA 3GCXP 3PDNA 1QJHA 4KC5A 2AEMA 4AD6A 4ZS6A 3SDEA 3OVSA 1WHVA 5D4PA 2AGQA 3M8YA 3RRHA 2HHWA 1MN7A 3S1TA 2UXCJ 4LRAA 1UVJA 1WSVA 2DNZA 3O8WA 4NLOA 4ILMA 1G2EA 1PSDA 4N8OA 5AE3A 2VPWB 1RAIB 1FNXH 4TY8B 4UOHA 3GYXB 3I9V9 1DARA 2V5HG 3HDSA 4LF4F 3C6UA 5GADI 3FVYA 1XNQF 2W7AA 2UU9F 1PILA 1VHIA 1YBAA 2C42A 4DBQA 4ZK7M 4CP5A 1U1OA 1S10A 4WZQA 4OIXA 4OLPA 2KM8B 2L9NA 2P9GA 1HR0F 4K59A 1RABB 1TZ0A 4AXIA 5DG9A 1VQ8S 5G0RB 1I6JA 2Z4PA 3OT9A 3LF0A 5LSOA 2N4DA 2BW7A 3D0IE 1KTVA 2W24A 1K9MT 2F4VJ 4USVA 2WW4A 3MTJA 2CZ9A 1XR6A 1XNRJ 5L1LA 1V3SA 3I6PA 4NYZA 3KNGA 2ZVIA 1KVJA 1Z2LA 1RTDA 5LMUJ 2BQ3A 4ES1A 1NXIA 1OMSA 2MJUA 1SC1B 1CEZA 2GS8A 1OQ3A 1Q7LB 2HIYA 1NSQA 3DOKA 3G6ES 1TU0B 4I2QB 1L3TA 3DN9A 1AA1B 4RW7A 4LF7F 4C4WA 1VQLS 2W1BA 3WIVA 2BVZA 2G9OA 3BGFA 3W7BA 5EHHA 3NAHA 1KTQA 5F3TA 5L1JA 1FERA 2C2EA 2PN6A 5H9EJ 4O3QA 5LJ3Y 3P4UB 1TFWA 4L3KA 1JLCB 3Q8RB 3AQOA 5EWEA 3KLGB 3FBBA 3BN4A 1RLDA 1FA0A 3HHKA 1FDAA 4OYMA 3PW0A 4NI2B 4YR2A 2QC3A 3BGLA 5DDPC 1YITS 1O51A 2APOA 1ACMB 3ZZRA 1WTFA 3ZTOA 3H2LA 4JI2F 2H48B 3HFVA 2JWNA 1TVRA 3WX4A 5CH7B 4JV5J 5B0BA 4IQXA 1S6QB 2MQMA 3MM6B 4HH1A 5B0GA 4J9KA 1X9WA 4DV3J 4NL5A 4O3SA 1OYEA 4IH5A 2M88A 1AXQA 5CQGA 4HHJA 2YPYA 2VICA 3PJWA 1L3KA 2HFOA 5I42A 2GHVC 2GMJA 2PA3A 1YJNS 1U8SA 1HI0P 2OH2A 4A8FA 1PYOB 3A8KA 1RWXB 4F4ZA 3NOGA 1RP5A 4ED4A 1RA6A 4P52A 1WSRA 5U47A 2G1HA 1U49A 5KG4A 2E7VA 5ETTA 1TKTB 3DM2A 4H54A 3RUBL 2ROGA 3KLIA 4IO9Q 1B0TA 4F4XA 4OX9J 4EI2A 3IA0A 2DCLA 3ENAA 1WI8A 4MYUA 1L3VA 2RDIA 2ZJPQ 4MMOA 3PW2A 3BB5A 4FYDA 4ZIVA 4MFBA 1DBDA 4DG1A 4H4OB 1RU1A 2XZWA 4N76A 2D9OA 1S4FA 5ETLA 4PYAA 2V6AA 2ZC4A 2ASYA 2WB4A 1U2CA 3SMZA 5RUBA 4FP9A 4I69A 2HNYB 4XIUA 2D3OR 2MDAA 3TAMB 3GTYX 2G13A 2LEBA 4C6AA 1U1PA 4C0HA 4CO0A 2ZBQA 1S5ZA 2IBKA 3W9IA 3WZ0A 4TVAB 2E5LF 1NZAA 5KFAA 1WEXA 1REVA 3GJTB 4L73A 1FI4A 2RILA 4YHHJ 2VDIA 2G0IA 4OLOA 2GQCA 4JI4F 3MPYA 3SIPB 4N77A 1N36F 2HMIA 1UA1A 4Q8EA 2X3GA 3IM8A 3PRVA 2IYGA 4KO0A 2Z57B 2LCWA 2CADA 2ZH3A 1DY3A 3AQPA 4Y2IA 2DR5A 2RF2B 3KG0A 3TJ8A 3HZGA 3T1YF 2V0NA 3RG6A 5C24A 2DGWA 3GIIA 3TA1A 3MF5A 4EK2A 1SKRA 2KKHA 3JQMA 3ISND 4JYAF 2B6AB 4DV1F 3MFHA 4CLYA 5BR8F 2RS8A 2PC6A 2RHSB 1ZZFA 5GAGU 2MY8A 1PG5B 1N5YA 3M8WA 4ZPDA 4LF9J 2XB2D 3D54A 2CQGA 1OY9A 4DPOA 5DM7Q 3CJKB 3N5BA 1F5BA 3QGIA 2UP1A 2W9BA 2ZH5A 2AJQA 1X8DA 3HHEA 3SV4A 2BUNA 2IA6A 3R2CJ 2UUBJ 3BH7B 3DXSX 2MQQA 4RBTA 4PQAA 1VR6A 3VAHA 4URGA 4IOCQ 5KT2A 2AYEA 4O44A 4FF3A 3IWLA 3TUJC 3TQ1A 5E2QA 3JTPA 2IM0A 1I3OB 4LRBA 3LWLA 2LA4A 3M6WA 4OMFG 2SXLA 3VV2B 3FCWA 1F5CA 2ZM6F 3H4DA 3Q86A 5EX0A 2PE8A 1ZH5A 2LMIA 4CI0B 5D3GB 2DNKA 3D3CJ 1RAHB 4ZVQB 1RT2A 4UUWA 3DHXA 4UTGA 4QOTA 3NLCA 4RW6A 3T5KA 3QWPA 1JLAB 3HVRA 3HHLB 1RCXB 5DETA 4EZ9A 3NNHA 2GIRA 1HPZA 3M8PB 1Y0HA 2XY5A 1LK5A 2CJBA 2MGZB 4F0HA 4Y2MA 2JJ4D 2HWHA 3BPDA 2YKNA 4RU2A 5CA5A 2CQIA 3VGVA 1BQMA 4DV7F 3QO9B 2MZRA 1HQEA 4ES3A 4C11B 1H38A 4DSLA 5FLXY 3R5GA 1S97A 4YP3A 5AE1A 3QGHA 4MH8A 4OYAA 4KT0C 3KUEA 2VG5B 1JLBA 3TX0A 3P5TL 5HAOA 4ZVPB 3DLGB 2VG6A 1E6YA 1C0UA 4XO0A 3W62A 1B3TA 2HURA 4F2RA 4FPRA 1HNIB 4E8UA 3TP2A 1FRKA 4HTJA 1RWVB 4BLGA 2AP6A 4HACB 4OYWA 1FDNA 3HM9A 1QD1A 3TA2A 3FRZA 5J1NA 2J9CA 4MIAA 4P7TA 3QPIA 4PUOB 1RA7A 3BS9A 3U1MA 2DRBA 2OIHA 2MY7A 3EXCX 3AY0A 2AIRB 4DR3J 3I55S 2HAFA 1RWWB 3C6UB 4URQU 2PDAA 2JH3A 3W65A 2VL1A 1LK7A 2HQDA 2HW3A 5A0YA 1VQSA 4ECXA 4ED3A 4MIWA 3W1YC 2VF3A 1ZTTA 5CCMA 4X65F 4B3TJ 2CKWA 3FSXA 4P7VA 1CPZA 1HNVA 2KVQE 4KE5A 2ACYA 1WC0A 1SPBP 4CT8A 2FZKB 2J76E 2WHOA 4CO2A 1B0VA 2ZNZA 1BWVA 4ED0A 1XEZA 3I82A 1D9AA 2I9SA 1Q8IA 2EBEA 4A8YA 3UQSA 2DXDA 3KUGA 2QTWA 2UUAJ 4DLGA 1RAAB 2XGQA 1S59A 5THWA 1CBKA 1RTDB 3MHYA 4WKYA 2X1BA 3G8QA 2K3KA 5FJ4A 3PO5A 1LQ9A 3BH6B 2RH3A 1WHYA 4USKA 3CF5Q 3J7Z5 3KLFA 4KFBB 2AMCB 2AGPA 5KT6A 3G2XA 2IJFA 2HHVA 1W2IA 3KXDA 1IBKJ 3Q8PB 5KFDA 4KHPF 2R2SA 2NZ4A 1YX2A 4RW7B 2VA3A 5F8JA 3IBFB 1FXLA 2I6WA 3SI8A 2WVDA 1U1RA 3FSYA 5LL6d 3TAPA 4CLPA 4JP8A 3GG0A 1BQXA 2E5JA 3G86A 5J1PA 1IXKA 1EP4A 3SBMA 2YBVA 3O1LA 3CJSA 2DGVA 1WC3A 2DCUB 1FCAA 2AJ1A 2U2FA 3ZNJ1 2HZAA 2OTJS 3R5CA 4DV5J 8ATCB 4YOEA 2KL8A 2AW0A 5F8HA 4QIGA 2AV5A 4YR3A 3RBDA 5KFMA 1CQNA 2GCFA 4ZN3A 3O6QA 4MTPA 1TVRB 1HWIA 3W8PA 3MPDA 2DGQA 2CNOB 1QVFR 3CCMS 1KHWA 2HFUA 5DQHA 3CE8A 3H5SA 2Y3YA 1RSCA 1S6PA 4M95A 3BGUA 4YB6A 2HVZA 4LF8F 3PYGA 4CO5A 2CJQA 1VFJA 2NXCA 5I42B 5G4DA 3G71S 2XYGB 4C8YA 1HHQA 1F2GA 4TKTA 4DPXA 1FTRA 1U1KA 3LP2B 2IY5B 2VOOA 5F41A 3SSSA 3LW5C 3TNVA 5M2UA 4DV4J 4FYVB 4EUVA 4TLRA 1A7GE 3A13A 3DM2B 4F3OA 2EI5A 3FZ2A 4C98A 4MT1A 3MR5A 3V6DB 3NNCA 1VQOS 4DFJA 4J9MA 3CMQA 1HWKA 3GIKA 4FVMA 4PWDA 4MFBB 5EWGA 4DMZA 4DG1B 2ZVSA 1AT1B 4DPWA 5EGYA 5HANA 3ZTQA 1SC6A 1NDPA 1BY9A 5ETMA 2JVRA 4U95A 3ZC4A 5CZXA 1B0PA 1T02A 1WEYA 1UTAA 2C22A 2PMHA 1XK8A 4DEZA 1YK9A 2OELA 5ETKA 4HDHA 5K8OA 2NSBA 3IWXA 4EO6A 4FF2A 4LSZB 1UJ5A 2FLNA 3PW7A 3MEEA 1REVB 4NLXA 4DL6A 1X9MA 2XLJA 2OD4A 2DXEA 2CJXB 1RDRA 3NWRA 7FDRA 2HMIB 4ECRA 2WONB 2QLXA 2BKNA 2VODA 4IG3A 4B9VA 3AFGA 2ZBIA 4KO0B 5KFGA 2ROEA 2E1MC 1CG2A 2BACA 3BEGB 3OPKA 3D5MA 1V3ZA 3OR2B 2W2QP 3H7HB 2MKIA 4FBUA 5C24B 3AD8C 2B0GA 4RLEA 3EE3A 4EO8A 1R0AA 2JOQA 4USTA 1F9HA 4NLTA 5DQIA 4S0MA 3CMES 4IRKA 4J9VA 4J9LA 4DSIA 1JJ4A 1N32J 3PACA 2EW9A 2CDRB 2FLPA 3MZIA 3RW7A 2MKYA 2BJ1A 4LRCA 4JI0F 2MJNA 3MPWA 1NKCA 1SI9A 2WZ1A 4OZ0A 4OL8A 2Q43A 3C14A 3ILIA 3D67A 4FF4A 4UOFA 1FFGB 1BHNA 2W9BB 1Y11A 1N6QA 4FYXB 1WF0A 1S0OA 3OTDA 1JQGA 2R7SA 2XS2A 4FNIA 4LT6A 2D3UA 3R97A 4WFNQ 3PCOB 4O44B 1LXNA 4UY85 4ZVOB 3NKYA 3KHRA 3CJQA 1TELA 1UPPA 4ETZA 1FKPB 2XI3A 4WIIA 5B0CA 3DOMA 3K59A 1K0VA 3HX9A 4OZ3A 3OL8A 5ETPA 1IKXA 1HMVA 4JV2A 4EYIB 1DLOA 2LFVA 2GVZA 1NNDA 4RW6B 5J2NA 2F4VF 1KR4A 5J2PA 3T1AA 4H4MA 3BO3A 3B54A 4PCQA 5ETNA 1SQEA 1P8GA 3O5TB 1H2TZ 1I51B 2H51B 1HPZB 1TP7A 5LMUF 4DX8H 3QATA 4DZ6A 2YKNB 5C42A 3OW2R 1BQMB 4X4TA 4RBVA 5AJ3J 3C6TA 2WTFA 2DEIA 2ZKUA 1Q5YA 2AT1B 2BE7D 3KOAA 4PG4A 2OI2A 5HSPA 1ZZNA 5C5JA 1JLBB 4I2PA 2KHCA 1UAWA 2GGPA 1U1LA 2XWYA 2CAJA 2VG6B 3M8RA 1C0UB 2OO4A 1I5OB 1QE1B 1Y10A 4YQWA 4I6AA 1UWBA 2HFZA 3ENQA 4P2XA 4NPOA 1HWUA 2W9CA 4ITSA 2M0GB 1NJIT 1KLNA 2IPOB 3QLHB 1JJHA 3G9CA 2N7CA 1DJ0A 1N54B 2Z56B 2YQ3A 2B4UA 1FRMA 2VQEF 1SB6A 2FDNA 4FS1A 3BPSP 3J7YI 1RCOB 3M30B 4F26A 1FWLA 2E9RX 2QL7B 2KHDA 2XSJA 2EK1A 4X4OA 1RWUA 2HGMA 1YZ6A 3OVBA 5K8MA 4U9RA 2KYZA 1CLFA 2VG7A 1YKWA 2NXEA 1VHFA 3G6YA 5A0YB 3R2DJ 3PX0A 3EVWA 1M1HA 2MYFA 4UOCA 1SL0A 3KFWX 3CJ0A 3MR3A 2R7TA 3ZZPA 3D6MB 3QRQA 2M4MA 4CO4A 4QU7A 1YG0A 3BYPA 4B17A 4DV3F 3DU5A 2M9KA 2E5IA 2OAUA 3Q8UA 4KQZA 3NS6A 1EIYB 3MFIA 1HNVB 4N47A 2ZHAA 4ZPCA 4E0DA 3EDRB 4CCHA 2FGCA 2HGNA 3VAJA 3GB0A 1RZMA 3IBCB 5KOWA 1VS3A 1TKDA 4LBHA 3L4BC 2MKCA 2M8DB 2J0QD 3DCAA 3AAWB 3NAIA 1NK4A 3GE9A 4EWTA 4ZJQA 2QT7A 1TL7A 2ZBRA 4OX9F 2BANA 3W66A 2J9DE 2ZE2A 5C25A 4LQ9A 2WVCA 3BQ2A 3K57A 2R7OA 4IUFA 2LQ5A 3VVTA 4WCEQ 2QFIA 3MCOA 1YJVA 1VIXA 2DISA 4PPDA 2QE5A 4C3LA 5HP1A 3H8YA 4F2SA 4HYKA 4ED1A 2V2VA 3GIRA 3RB4A 4F7VA 1EKRA 3HSJA 3M9MB 4A48A 3MCMA 1WF1A 1PIEA 1RACB 1EP4B 3UD5A 3PR5B 1IKVA 2VA2A 1S1XA 4IQMA 3TX8A 1J2VA 4EGLA 5KT4A 5HQMA 5KT3A 5LXRA 3W9HA 1KD1T 1FDDA 3R8YA 3SYZA 4YHHF 3HXMA 4MKBA 5GVQA 2QFJA 1IWAA 1TL1A 2DGSA 5K9FA 1OY8A 1LW2A 4HLBA 3MI7X 2XLIA 4C8ZA 3WC2A 1G7CB 1HBMA 2VFSA 2V9WA 1K8AT 1VQYA 1Q7YT 3D4JA 3M7VA 6FDRA 1C4CA 3BM7A 1WNEA 1DTTA 1V5IB 2FHMA 2HRTA 3P45B 3T9ZA 1DQAA 4IYQA 1S6PB 2U1AA 2DHGA 3BQ0A 5HI7A 4R5PA 3KLVA 4V19J 2EFPA 3UDCA 4DQSA 4GKKJ 4A8MP 2V8GA 1TUWA 4MKAA 4W4MA 3D68A 3KG1A 1FRJA 2QZ8A 2F65A 3LP0A 1UKUA 1UVKA 2HZVA 4LF9F 2PO4A 1MMNA 4OFZA 1HKAA 2HKEA 4TU7A 7FD1A 3FDSA 5LXYA 4AQYJ 1QAYA 1S57A 3JQJA 1X7VA 3PKYA 5E3QA 4KGVB 3FRYA 2RB7A 1VC5A 2ZD1B 1T9TA 2EKNA 3P5BP 1YRXA 2GQ2A 2UUBF 1L3SA 4Y65A 1SJ3P 2VC1A 4OHWA 4Q8FA 2X1GA 3PEJA 2IJNA 4ZN1A 4LFBJ 3RBEA 3BDEA 2HBZB 3TVZA 1CS4A 1FXDA 3V5RA 1TMMA 1A9NB 4NRTA 4B9MA 1ZTWA 5E3CA 3UVJA 4OYIA 1XMBA 4CO3A 4P75A 2HLUA 5EUHA 1U02A 2HK3A 4HT5A 3ETOA 2OSQA 2NQPA 2DGUA 3BR8A 4OYBA 4MKYA 3FEXB 2YKPA 2ADCA 1DURA 5J2MA 1K47A 2DNHA 3TVYA 3MEEB 4F3QA 3C66A 3H42A 5B7WA 1S9EA 1BXNA 2F4FA 4QU6A 1JIHA 2DH9A 4WK3A 1G1XA 5KG2A 1HWJA 1AUSL 4ZVTB 2CQCA 2BR0A 5T7LA 3RBXA 1OJ4A 1IJFB 4IG3B 2RU3A 2ZWOA 2N4CA 3H2VE 2GHWA 3K8VA 1Q79A 2WSEC 1B64A 4NXNJ 2FB0A 2N3LA 2PSZA 4FVCA 3VGUA 1R6VA 4CLKA 4NLRA 1K1QA 2E1RA 1HI1A 1FNOA 2JEGA 3G96A 1YHQS 2KM8C 2WW8A 1R0AB 2DB1A 3HVTA 4P71A 3M1VA 1N88A 1ZAVA 2HS0A 3OL6A 4WE1A 2OPRA 1RBAA 2KG1A 3D2WA 3OFHA 5IQQA 2MZ1A 1SVDA 2FVQA 2DJWA 2OPPA 2AHOB 4NCAA 2LXUA 3CXCR 1BE4A 1GTEA 2K3IA 3C14B 4WWSA 3LQVA 3CC2S 3UD4P 1X5OA 4W98A 2RIJA 3Q8SB 3EUNA 4J5OA 3G8SA 1FKOA 2IVYA 4FPIA 3T3FA 3EYZA 4DR3F 3GWCA 3N01A 5M2PA 5BYRA 2YKOA 2F8HA 2QRRA 5FDLA 4FXDA 5D6GA 4A47A 4K0KJ 2AZ3A 2F9JA 3KDNA 3PIPQ 3DOMB 2BBEA 4DL3A 2ZFHA 1K44A 1HL6A 2OD6A 4ZVFA 5H9EK 1U1MA 4B3TF 4JB8B 1IKXB 1RBOB 3H4BA 4AL7A 2GJIA 1HMVB 4YFUA 1UA0A 4QQBA 4IFYA 1DLOB 3CJ4A 2GVZB 2NUHA 1NK0A 1HNWJ 3KG4A 3B8HA 4P2SA 2ACMA 4ICLA 1TL3A 5J2PB 1LEOA 4H4MB 1KQGB 1H72C 2V8VA 2DR8A 1LWCA 2HYIB 1HW8A 1SKWA 2HNZA 1IM4A 1W7WA 3KJVA 3PTWA 4C8KA 1VBKA 4D3GA 2JLFA 2UUAF 2EG1A 1HBUA 2BZ2A 3AXMA 3KMSA 2IA0A 3HJVA 3AB4B 5C42B 2VJVA 4OHZA 1GMWA 2Z2ZA 2FGOA 2YWGA 3C6TB 4X4NA 1N8RT 5LMNJ 1IBKF 2W2NP 4F04B 5CD4H 3S6EA 4HH0A 4CO1A 4QIWD 2G2OA 1NSAA 1RI7A 3DRPA 4I2PB 2HFVA 2GGPB 5IM0A 1IUJA 2YKAA 3Q89A 2ZH8A 3JSBA 2VFTA 1WOPA 2V34A 5HMZA 2DH7A 1Q0NA 4DHVA 1UWBB 2K7KA 3ENWA 3OV7A 5BYQA 2W9CB 4KPCA 2QSWA 1WDDA 2H65B 2VPYB 2OUGA 1MWQA 4JI5J 4M94A 2XM3A 1DZ5A 3PKMA 2ALYB 2YXLA 3VAKA 2CQ4A 5A6PA 4OI3A 4DV5F 4J9RA 4DFKA 3DGVA 2XSJB 2GJFA 1HIYA 2VUGA 1JX4A 4DX5A 1F6TA 1AYEA 2DTJA 2ZC3A 3ZZTA 3HD1A 4NLVA 2NSCA 3OLAA 1XBWA 1RT1A 3DRYA 4YEAA 5F8IA 5C2GA 3CDAA 4BWMA 4K50A 4LBIA 5F8GA 3EDQB 2HIQA 4FN5A 4DSJA 4IH7A 2X1AA 4R0JA 4O23A 1JB0C 4J9SA 4Q0BA 2MTLA 4DV4F 2DXFA 4DR1J 3THVA 5DQGA 1WC1A 2ZH4A 4EYHB 2EKYA 3QZ8A 2BANB 2ZE2B 5C25B 4HI2A 2J7UA 3LWMA 3NS5A 1WELA 3W5ZA 3ZXWA 5H9FK 4NCBA 5FLXU 2HNDB 3D9BA 4NLSA 3VQTA 2FLLA 2IMWP 2M5YA 2E29A 1SXLA 2DR7A 1I1GA 3PYFA 4ECWA 5HP1B 3KJNB 2DO4A 4DV6J 2AGOA 1XIQA 3PXGa 4JI7J 5B0AA 3MXHP 3W64A 1ULRA 3QAUA 2CJYB 1EB0A 3M32A 1DRZA 2HHHJ 4EFAC 4ILRA 4ECSA 4ZVUB 1N4LA 1NBEB 2CZ4A 1RAGB 2F7VA 1RK8A 1IKVB 3MEKA 1M5HA 4OQJA 3VAIA 1PCAA 5I3UA 5BYSA 2XO6A 1X4AA 1ZYQA 2COLA 2MHEA 1O6XA 5HL7Q 1EJ7L 4C48A 2PEBA 1RAOA 2V8DA 2JC0A 4P6QA 4ID8A 1TL1B 1WG1A 3KYLA 4ELUA 4OI0A 1LW2B 1FRIA 1FXRA 2YWWA 1BGXT 2KXNB 2CPHA 2WOMB 5KFRA 3QSYB 1H0HB 3MD3A 5EX3A 2CYYA 4LBPA 5HROB 2J6SA 2Y0BB 5A8RA 4ELVA 1R6YA 3DMJA 5J1EB 2B4VA 4DXLA 3OBIA 2R7VA 4R5PB 2IRYA 1N52B 2CQHA 2H3EB 4NMLA 3BF4A 3LAKA 4O4RA 4BC9A 2QL5B 4RJVA 3A12A 3IWNC 2GFFA 1RT7A 1N32F 5CYMA 3LP0B 5KFNA 2NXNA 3HHLC 1NHVA 5CYQA 1CJUA 2PIIA 2CNLB 3HLUA 4LFCJ 1Q4RA 2JC1A 1UL3A 2FD2A 2FVCA 2RQKA 4OI6A 2CRLA 3DRRA 2KZZA 4LSNB 1JJ2R 3KLGA 2VOPA 1HD0A 4X64J 3MUMP 2XQCA 4ED2A 1DQ8A 3KHLA 5E5NA 1WG5A 3CJ3A 3L9ZA 1UCNA 2YKQA 1NK8A 4ZP9A 4ZDNA 2DPIA 4IFVB 3CD7A 2DHSA 2Z2YB 3CIZA 3MOJB 3JQKA 1Q8BA 2HK2A 1J27A 5L8RC 2ZUGA 2D69A 3M8ZA 3EZOA 4QPTA 2B4OA 3AJDA 4M5MA 2AJ0A 1FRXA 3UVJB 3RBZA 4L74A 1VJWA 5K8NA 2KFNA 1S6QA 2JFKA 1QDUB 1KQFB 2JVOA 1NRKA 3CW2C 4P9SA 4BC7A 5J2MB 4NEYA 1S1VB 4U7UK 3HSGA 1S9EB 2GHPA 4IRCA 2I8EA 4LQ3A 2DIUA 2DNOA 1GAOA 1RKJA 4FNHA 2AX0A 4ZVHA 5T7LB 1R8PA 3CCRS 1XR5A 3RAMA 5ETQA 2YQ0A 3I87A 2VIHA 3OXFA 3X3UA 2ZH9A 2UV8A 2V69A 4PYDA 4NE9C 2FJWA 1YTYA 4KSEB 5AJ3F 1T9VA 1V9OA 2ZKTA 4KGZB 4M5KA 4OX6A 4NYOA 4DN0A 3W63A 2QYGA 3PW4A 2HWIA 3M1VB 3K8WA 1F5AA 3CJRA 4WE1B 3UN5A 1JK9B 2OPRB 4H4OA 3R5BA 1KC8T 1Q8LA 1S49A 1QTNB 2J8AA 1KVKA 4ID5A 2H1YA 2Z2LA 5KFTA 2JL9A 1HYSA 1QSLA 1UVIA 3N79A 2B9EA 3GJSB 4WP9A 1C0TA 1X5TA 3ZO7A 1FFSB 1XMOJ 1XC9A 5A8KA 5KFHA 3CCVS 2DR6A 3TZYA 2BMBA 4IR9A 1FKOB 2M2BA 4RU9A 2BJ8A 3HT3A 4K4WA 5HQLA 3R7SB 2R7UA 3R6LB 1NJWA 4BCAA 4TU8A 3CT9A 3DGPB 1RT3B 4NCGA 4Y34A 1FJCA 3MECA 3ILJA 5IT9Y 1S9FA 4NLPA 2V2ZA 2C2DA 1RU2A 2IM1A 3QT7A 5JJBA 4RW9A 1IM6A 4J9OA 4RBUA 2CA9A 2RS2A 3LTOA 2IC3A 4IFYB 2AX1A 4UOGA 4U6PA 5FIIA 4C3KA 4DR7J 4BWJA 3AOCA 4WK1A 3IGVA 4OZ1A 4ICLB 1X0FA 2B6AA 1TL3B 5GAEU 2GMHA 4ECTA 3TUIC 1LWCB 2HNZB 3KJVB 3TW0A 1O0PA 3MOZA 2A2CA 2C3YA 1S7IA 1NZ8A 4OHVA 3B4DA 1HBUB 4QYRA 4XAKA 4IR1A 4O0NA 1YSJA 4Y2AA 3GYGA 3CJKA 1AZSA 4FKXA 3TR5A 2KFZA 3I0RA 1LKZA 2O1PA 4F8RA 5KTQA 3SFUA 1VBYA 4ETXA 5I3QA 3OXGA 3GIMA 1T11A 4DS5A 3RB0A 4ZJOA 1GEHA 2BYCA 3DRPB 1NK7A 5C7PA 2JSXA 1X4FA 1R8CA 4LIWA 3SEOA 2L48A 5F8MA 2WRMA 1V6HA 1YJ7A 4OHXA 1U2RA 4I68A 4PWWA 4OX8A 3EGWB 2RU9A 2VKZG 5AE2A 2VQFJ 1IR1A 2Y1RI 2RNEA 1X31C 3KLEA 3DNCA 1Y4ZB 3ULHA 3UDVA 1GXTA 5D3GA 2UV8G 3AHPA 3MUVP 5DZ6A 2O66A 4EBEA 2MLZA 3N28A 3NXZA 2LEAA 4J7CA 3A4TA 3HHLA 2IM2A 2Y8WA 3DRXA 3EZUA 2IRXA 1VBZA 3V6KA 4I4BA 1KRPA 1KOOA 4YDXA 1Z4UA 1URRA 3I0SA 2UUCJ 2K1RA 3Q8YA 4K4ZA 3G82A 4C7QA 2GQQA 1SJ1A 3NCQA 4P74A 1RT1B 2IVMA 2G1DA 2NZCA 4PXDA 4K2XA 5D0EA 3KK1B 3IS9B 3TRGA 3ITHA 3R5AA 2WAQD 4TQRA 1BMQB 1RTJB 2E5HA 3QQCD 4GKKF 3GFYA 2EFQA 4ZP8A 1U7LA 3QAEA 3MMCA 5CHCB 3BKTA 3PR4A 3ONQA 1W2BR 1FESA 2CJ9A 1CJKA 2RKIA 2B5JA 2XBPA 4Q0BB 3ADAC 4Y0FA 1EETA 3QNWB 5GAHU 4ZCMA 2MHNA 5DLGA 1KLMA 4AQYF 3IGNA 3GONA 1RT6A 3CO9A 2GV1A 5IT4A 3ISNC 3KMQA 1YJ9S 4NZ0A 1U1NA 2LDYA 5BXIA 4PUOA 1BD6A 3F0NA 4TNOA 5F8NA 4JI3J 3C19A 2C1EB 2FUG9 2EG2A 1GMUA 3NL0A 2RJZA 2QMUB 2FJBB 2ZOGA 3KHGA 4GRSA 3CJTA 4LFBF 2FVSA 3KK2A 1YJUA 2F40A 2NXJA 4G1IA 4M5HA 2FJEB 2LYVA 3MM7A 4HL9A 4DI6A 3M32B 2FLOA 2R8KA 1NHKL 2QLJB 1U25A 4HT7A 3AODA 5KFQA 4DPTA 5CD4A 3EXYA 5I3UB 5AXLA 1F2HA 2V4JA 3QJLA 2M52A 4NA3A 2VB6A 2BM0A 1UVLA 3RB3A 1KWMA 2GIQA 2EC2A 3DRSA 4LR9A 2AZ1A 1SBRA 4NXNF 2ZITA 3F56A 5B0DA 1WI6A 1SH0A 4LRDA 4OI2A 5A8RB 3QGPA 3UI3A 3WBZA 3Q8QB 4KFBA 3J80Y 4AL5A 3DMJB 3HULA 1FNMA 1H3DA 5L1IA 4ZOSA 3UN2A 5D0RA 4QBUA 4PQUA 4YB5A 4U7CA 2Z30B 1R0CB 1SH3A 2DPJA 3TUPA 3CIMA 1RT7B 5CYMB 4HI1A 4EMDA 2B7BB 3BSOA 5CYQB 2BW2A 4ZPBA 3GSDA 1CJUB 4OZ2A 2ZHBA 2BRLA 2IVFB 4CRJA 1XQIA 3TJAA 2R7QA 3DRRB 3VZIA 4USJC 3RB6A 1S72S 4QYZK 3ISZA 2ZJQQ 2XC9A 3T5JA 4ZKAA 4UQTA 3NGTA 1T3OA 1FE0A 1N33F 1XMQJ 1R3NA 2Z58B 1H7XA 3ZTPA 4YDDB 5GAGI 1FKAF 1VQ9S 1ZBTA 4USIA 5B0FA 1G3OA 3MURP 3R5DA 4YB7A 3M2VB 3NGUA 4KGXB 3EM1A 2W7PA 3R6GB 3CTRA 1S1UA 4P73A 3HF5A 1S9GA 1EHWA 3A8JA 4K0KF 2MKSA 2VHGA 2HLTA 4M5LA 1VJQA 5D15A 1Y00A 2I5JA 3D7SB 1T03A 4R25A 4ZLJA 3BO2A 2DGTA 3IM9A 1Y5LB 5E7OB 3VAGA 3ILOA 3V81B 3NGDA 4I7FA 4L72B 2DK2A 3CGIA 3DLEA 2YTCA 2O67A 3LP2A 3PRDA 3LGMA 3SQOP 2XG8A 2EEYA 4QWAA 1SQGA 2QG9B 2H4YB 3NBPA 4DCPB 4GMKA 3K17A 4CH1A 1FD2A 1WHXA 1S76D 4DQPA 3UWTA 4WTOB 1YQHA 3V6DA 5KT5A 2KT2A 1NKBA 3MAAA 3L7PA 1U47A 1BLUA 1PBAA 2DD8S 2CPDA 1S0VA 2BV3A 3FSIA 5JMNA 3BGRB 3UNGC 1NU4A 3B78A 1AFIA 1N56A 4DR2J 1N5VA 4ID5B 1HYSB 1GTHA 2G2YA 1TKXB 1RE1B 1IBLJ 2ILZA 2QX0A 1Y3JA 1C0TB 4I6YA 3UCGA 2C3PA 5A8KB 4JI5F 3N6NA 2XMVA 1ZA2B 4FF1A 4C8LA 1SC3B 4H4KA 3OR1B 1K0TA 4I6WA 5KFBA 2MZSA 2QMWA 1WWHA 4WJBA 1U48A 4DSFA 2XS5A 4F0KA 1EAYC 2ZZMA 3BSAA 2PEHA 3CC4S 1V3RA 2QN6B 1WKKA 3GU0A 4K4XA 5DGBA 2WONA 4PG7A 2WVFA 2W4CA 1HFEL 4NCGB 3MECB 2BEFA 3D28A 1MNEA 2VD3A 1LV5A 3OR2A 1WUUA 3K5LA 2QLBB 3EWGA 3GFHA 4RW9B 3ZTSA 3U27A 4X66J 1RTIA 1TR0A 3G87A 1P27B 4F36A 2IC3B 4MJKA 3LP1B 1P1LA 4PG5A 4A4JA 2EFGA 3OSPA 4P2FA 2A10A 3O3LA 3ZFVA 4Y00A 1YGYA 4OV6A 4JI6J 2DKOB 3L95X 3W3SA 4DR1F 3TAQA 2VBYA 2N3OA 4LR8A 2CNNB 1ZM4A 3JS9A 4ZP7A 1R89A 3C2PA 1Y9OA 1AZSB 1MMDA 5HMYA 3DLJA 4LIRA 1NAQA 2P2CB 3I0RB 1FFWB 2AQ4A 3RRGA 1M5SA 3CNQP 3GV7B 4CLFA 2C2KB 2LEPA 4QWCA 2ZDOA 4IOAQ 4DV6F 2HQ3A 2IJRA 3MGJA 4JI7F 4CQ1A 2FVRA 3WDOA 3CPWR 2HPUA 4GVLA 1KEKA 4L76A 1FKPA 2R2TA 3OFEA 1JXVA 4WFBQ 4X62F 2OPQA 2HHHF 1HW9A 1NH8A 3IG1A 3CB4A 4UZCA 4D3HA 3KLEB 1FEEA 2H54B 3ELHA 2BJ7A 4KTQA 4DV7J 4YY3J 2DNRA 4LFAJ 2XY7A 2H5IB 5KFZA 1VC0A 3WC0A 3OL9A 1T0TV 2RDJA 4PWUA 4CT9A 2W25A 4GC7A 1FDBA 3ZNUA 3D6HB 4DL2A 4KHMA 3C16A 2G0CA 4RWWA 2RUGA 3I0SB 2K1RB 3G82B 4KV8B 2KH9A 3D66A 1X9SA 2ERRA 2HQIA 3T5HA 2JEJA 1B4SA 4WU2A 3RR7A 3DDKA 2NYIA 3TI0A 3ITHB 5A76A 4NEZA 3FGVA 2DITA 3W2VB 1NDCA 5F0UA 1FO1A 1ZETA 2GVDB 5HBMA 3MMCB 2PI4A 5K20B 3PW5A 2RE1A 4Z7YA 4NRUA 1R0BG 2QL9B 2L9DA 3M4XA 1CJKB 2RKIB 2B5JB 4DDFA 5T14A 1J5OA 1EETB 1QE1A 3R9LA 2HBQB 2BJEA 4LFCF 1KLMB 3G6XA 2QLWA 3IC1A 5HJYA 2C3OA 3M6UA 3G6VA 1RT6B 5KFVA 4X64F 4WIQA 4XTTA 3DDIA 4DN9A 3QLHA 3CDWA 4YB1P 3K5NA 2VC0A 4USWA 3C3LA 3NNAA 3VCDA 2C2OB 3M30A 1O5JA 3CVKA 2VFVA 5IC4B 1A0OB 1CULA 5HVFA 3J7ZT 4Q2LA 5KFOA 3KK2B 1ZAWA 1FX2A 3MM7B 4KBIA 3HSZA 4Q43A 3TWZA 2DH8A 3PVXA 2HAIA 3KJFB 5F0WA 3PX6A 4B9NA 5C2CA 4A8OA 2XO7A 2BM1A 1EARA 4WXWA 5HMXA 2RQCA 3NWGA 2BE2A 4PXCA 2P5VA 3GILA 4DPUA 2GJ2A 2IBOA 4F4WA 2V4JB 3GV8B 2ASDA 2DO0A 4M1KA 4N41A 3I5BA 1JJCB 2K8GA 2O01C 3M9NB 2XLKA 3QJJA 3ZZYA 2YPZA 3DRSB 4N8NA 2WSFC 2UXBJ 4DU7A 4MK8A 2ASJA 1H6KX 2RDDA 5A2QU 1S6OA 3I9ZA 3SQGA 1NDKA 3PX4A 3AJ1A 2Y1JA 1NK9A 1S1TA 1T95A 4OI1A 1WC6A 1ICEB 3QSIA 4PQUB 3OFFA 2JLGA 2D3ZA 4DQQA 3T1HJ 5KFSA 2QO3A 4RNMA 2P9CA 1ZM2A 2UXDJ 2WK4A 4FKYA 5DS7A 3QJPA 1XMOF 4CM2A 3KLHA 3CD6S 2ADBA 2JFDA 4Q2MA 3UDEA 5GMEA 2DT9A 8RUCA 3JSMA 3CULA 3MAQA 1SC4B 2CFXA 3A3PB 3MMBA 4FZVA 2A0FB 1JLGA 4HEA9 2D74B 1JLQA 4DWIA 1UVMA 1LWFA 5KFPA 5DLFA 3JAMU 3WHIA 2OEKA 4ZVRB 2R3VA 1S1UB 1VQNS 5KFKA 1FWPA 2KTQA 1S9GB 2Y1IA 5ADZA 1T05A 3NGSA 4KGKA 5D77A 2L3MA 2F8EX 5IFMA 2I5JB 2KJVA 2CPXA 5I4MA 1IVZA 1P1TA 3R1LA 4OYXA 3QIPA 4ANEA 1SL2A 1T03B 1SJQA 2QA4G 3D0GE 4DR7F 1VOMA 2HS3A 2BJDA 2XULA 1LWEA 5M2RA 4I7FB 2MZJA 1LWXA 3EPGA 3DLEB 4LF5J 4OZLA 1YJRA 2Q3PA 1Q53A 5EN1A 1ZOTA 3NBPB 3VVUA 2GW8A 3VF0B 3HJFA 3FNNA 2DHXA 3MM5A 5IV3A 3U7JA 3TOQA 4DR6J 3K2YA 2ZD1A 2RQMA 4DFPA 1UEKA 1T9YA 4ZLNA 2VFUA 1HA1A 4FXWA 3SXLA 1NKEA 3MAAB 2CQ3A 3ZTRA 2W8KA 3CWJA 3E8OA 1UETA 5L9XA 5KFXA 5IV4A 4QIVA 3LUYA 4NASA 3Q22A 4W90B 3G4SS 2AF6A 3I96A 2CZVC 3AXKA 5CAAA 2V2QA 1X4DA 1AUDA 5KG6A 3GQCA 3ICLA 5KFJA 2K06A 2VQFF 4ZPTR 2OEJA 1Y5IB 1PJ7A 1GT8A 3MR2A 5IT0A 2G0JA 2Y0SD 3OXLA 4KH1B 2C3MA 4WFYA 4DFMA 4B3OA 2BXJA 2X3DA 3QT6A 2OJ3A 2WVEA 4B3MJ 2BQUA 2QIFA 4PR6A 2VZ9A 3HMJG 2KI2A 1H74A 3UFCX 2HBRB 4USHA 2MSSA 5D4LA 2HVEA 2UUCF 3UR0A 1IQZA 3T5LA 4CIOA 4FBTA 2BDPA 5IWAF 2FJDB 5GMKa 4RKUC 1YJWS 1YI2S 2FC8A 1C1BA 3S8SA 1N5TA 3EVOA 1IN0A 2FJVA 2AYMA 2LXIA 1BUXA 1N34J 3BZQA 4JI0J 4UY8T 1GXLA 5KOXA 4QR1A 2R2UA 2RD5C 1QSSA 3HCXA 3MEGB 4NLGA 1KVIA 1GX6A 1AROP 1RTIB 2FYXA 3RR8A 2L08A 4C97A 3MCSA 3GG1A 2KJWA 1MLAA 2VPXB 1TV6A 1P6TA 3VQSA 2KXHA 2FHKA 4ZJLA 3QMQA 3I4HX 1ZM9A 5F9LA 3MAHA 4IO1A 1WDTA 3DU6A 1VK3A 2W01A 3CJ2A 4XDDA 3CO0P 2POKA 2RSQA 3MM8A 3NP5A 2OKQA 2ABYA 2RUSA 3X1LB 2Q6CA 4KKOA 1HNXJ 1EQ0A 5KFYA 3J81j 2UXCF 2EFVA 4JI3F 3BSCA 2B9YA 1AFJA 3R27A 1FVSA 3AA9A 5LOQA 3GFZA 5LM7E 3M6VA 2D41A 4X4UA 4DV0J 2F8MA 1VYAA 1U0HA 5DRKA 3BDPA 4M5GA 3I5CA 1FJ7A 1CJTA 1VQ7S 1NB7A 2OPQB 5AXKA 3IG1B 1F60B 2NR0A 4ED5A 4ZPWR 1TL5A 1G6BA 4DF4A 4QWBA 1Z2ZA 3DFEA 4NZ7A 4UT4A 1DFDA 2D9PA 2J6TA 2GO9A 1ZA1B 1CSJA 2GMLA 1X60A 3BYRA 1VDHA 1KKHA 1UJ4A 2HGLA 3TANA 1XNRF 3C16B 1NMEB 1IJEB 5IT9U 1XR7A 4CLUA 1S0NA 2IYIA 5T41A 2MXYA 2E1PA 1E6VA 4NLQA 1X4HA 2MLYA 2FY1A 3IR6B 1WEZA 2F9DA 3R7BB 2BABA 2VQEJ 3RGIA 3QYYA 3KNAA 5HBMB 3IR5B 1FE4A 3KK3B 5B08A 2OLWA 1UP1A 3HFKA 3N4WA 4ZMMA 1J5OB 3AB2B 1F0XA 3VAMA 4RW8A 2MKKA 3VWSA 4V1Ak 1IKYA 1DHMA 3HK2A 2AD9A 1RYRA 4LF2A 3GCWP 1N5QA 1VI7A 3K7RA 2ZH1A 1R8HA 3NCPA 4XPEA 3QGGA 5LT5A 3CCUS 1U6ZA 2LQBA 1XMQF 3FBCA 1EQMA 4DV2J 4F0MA 1HQ2A 4PG6A 2LQ8A 1B7YB 3FQLA 4TU9A 2NUUG 1BWEA 1CULB 1VK8A 4ATNA 5CYJA 4LMZA 2P6TA 4C8NA 3FKBA 4DQIA 2M8HA 2R7RA 1YVFA 2DNGA 2Q79A 3FBFA 4NXMJ 1EZZB 4X4RA 5KFLA 4JV5F 3HI9A 5GADU 4IOBA 4DR5J 3OTBA 1HD1A 2WB1D 4M5DA 4KB7A 3M05A 3BN7A 2XY6A 1B70B 2OMOA 4EZ6A 3GJRB 3MDFA 2CQBA 1UFLA 2BE2B 4ILLA 2W2MP 1VRTB 3SSQA 1HNZJ 3GFXA 5DM6Q 2LU2A 2HWTA 1HBNA 4KY3A 2CQDA 3JYTA 3VGSA 4ER8A 3R1HA 3O44A 4RUBA 3GR0A 4C9DA 1AW0A 3UCZP 3OTOJ 3IMQJ 1PJ6A 2V9KA 3SQGB 4B9TA 2MB0B 2KU7A 1FHTA 2ZHOA 1S1TB 2BOAA 5HLFB 1QM9A 1U6FA 4M63A 3HFZB 2KG0A 1TK5A 2HNDA 2WBMA 4AYBD 2RVJA 5KG7A 2KDOA 3I32A 1R43A 5ETSA 2XEXA 3LGNA 4K8RA 2XMJA 1M5OC 4DR2F 1A6LA 4LF6J 4RO0A 1B7FA 4WPAA 1MROA 3RRKA 2OFHX 4USUA 1RT5A 1IBLF 2HRYA 1SCJB 4C8OA 4C0BA 1PBUA 2MPUA 4JI1J 3SSRA 3KLHB 1RHMB 5CXTA 3PEHA 1NHUA 5H9FJ 3JSMB 4ECUA 5ETVA 2CPJA 3BQ1A 3IRXA 1WOSA 1SH2A 1C4AA 4F02A 4NZ6A 2KVIA 4OX7A 4N56A 3MMBB 2DHAA 1R8AA 3H90A 1JLGB 4NA2A 2NPFA 2H9ZA 2J0XA 1JLQB 1ZM3A 1RTZA 1WC5A 3V4IB 3W60A 3LA0A 1LWFB 4I0WA 2PA8D 1UEUA 2MSTA 4QPXA 2WOMA 4CZCA 4RPFA 3OHBA 1FRLA 4OZJA 1T05B 3DOLB 3U1NA 2XHCA 2W4DA 1VRQC 1NSKL 5HROA 4M8LA 1UJ6A 4KYZA 1EKSA 4X4QA 4X66F 2OSRA 3V6HA 5E3PA 1VQKS 3PHTA 2I2YA 5J1EA 2ILYA 2CUYA 3QIPB 4DUZJ 1YLXA 1RHJB 3A8IA 1LWEB 5DJBA 2QA2A 3HZEA 2L41A 4RNNA 2DEJA 5E33A 4JI6F 1RTHA 2KRRA 3LANA 3U1LA 3A3NB 3UD3P 4Z37A 4M5IA 3C15B 1N0UA 3KUHA 1U09A 1H2VZ 5D8HB 1T7PA 1NPRA 2ZUAA 1U24A 4LSNA 1MSWD 5IQ6A 4LRFA 4L75A 1XERA 3MM5B 3FZBA 4URSA 2VJUA 1JLFA 2DYAA 2OPSB 3J80U 2NCKL 1VBXA 4K5SA 1I94J 3MUTP 4IFVA 3MR6A 1AB8A 1GNKA 1KDNA 1GXUA 3A8EA 3FFIA 4B3RJ 1KS2A 4A8KA 4B9UA 3CCJS 2BJ9A 2DNMA 2B9WA 1FK9A 3P3DA 2CVEA 3VR1A 2HS4A 3AJ2A 1JNZB 4RNHA 4HDGA 1HI8A 4CM0A 2KXFA 2LVWA 4YY3F 4LFAF 3K89A 1RLCL 5KFWA 5CABA 4B3OB 4WTYA 1S1VA 4P10A 1HARA 2C2RA 1K1SA 2GZOA 2QSFA 4DSEA 1HWLA 1SUQA 1FJEB 3MPVA 1IBMJ 2CPZA 4G1QA 2IAJB 2LXFA 5HVGA 3EPIA 4AUKA 2C2MB 1C1BB 1H2UX 1RYSA 3R7NB 3THTA 1Q95G 5DO2A 3RAXA 3FK4A 4TY9A 1S0MA 1S99A 5K5MA 3SDEB 4EBDA 4J9QA 1NB2A 1YBTA 4J91A 4QZVB 4WYWA 2I38A 3OTCA 4DR4J 1TV6B 3CEDA 2XNQA 1HLWA 4AXJA 1X4BA 2F3JA 3PG9A 4ZVEA 2YWKA 3GMGA 5D4OA 2R4FA 1SJRA 4MKVA 2XGPA 1JWWA 3U02A 3MM8B 1ZAXA 2F1FA 4OJGA 1SJFA 4KKOB 5L39A 4B9SA 4AT1B 1S1WA 3D0HE 4K4SA 3HO1A 3Q0AA 2M7SA 5H1SV 1PO6A 2N82B 4QCLA 4WP3A 2GC8A 2NLWA 4JI8J 3Q2SC 4ZCKA 3TYTA 1RJJA 3OSNA 4Q45A 1RUSA 2DBBA 1JLEA 1QVGR 3DGPA 5B09A 1RT3A 2CWKA 1U0HB 5K14A 2DVIA 3D1HA 4KGMA 1CJTB 3LO3A 5BJRA 2DNNA 4QR0A 3PIOQ 5HN0A 2CJKA 3NEKA 2GX8A 3I5AA 4DCOB 4E2FB 1WC4A 2V68A 2Z2MA 1GX5A 1LOUA 5I3PA 2CIMA 3EGNA 2XMTA 4N5SA 4MYTA 2XSFA 3DOKB 2CPYA 4ZVGA 2W4PA 3FMWA 2CPIA 2J5AA 2UUTA 2WVBA 4CH7A 3B6BA 3BKUA 4OYPA 3DKDA 3IN5A 3PFEA 3KTQA 1KBRA 2FPHX 2UXBF 1RB0A 1NSPA 4X2BA 2ZOMA 4ZA1A 3CCLS 2EC0A 3CD0A 2PD1A 3Q83A 1E6VB 1VMBA 4QWEA 3M9OB 4ZITA 2YH1A 2YWFA 2UVVA 4RR5A 1OPIA 3OL7A 3AOAA 3H40A 5IS2A 2HEKA 2R8IA 3KHHA 2YX1A 2PFFB 2W2OP 3CCSS 4NOHA 2Q6BA 5KFFA 3H98A 5E0OA 4DUYJ 2PMWA 4NMXA 2FHOB 3DLKA 4K7QA 3VAFA 1XN9A 3GZ7A 3W8GA 4PXEA 4OYOA 3MD1A 3O2IA 1TTHB 3T1HF 2LA6A 2DGOA 2XTJP 4RW8B 4Z7CA 1VQ6S 2UXDF 1OIAA 3BREA 4YS2A 1M1GA 1IKYB 1R27B 1RXOB 3LH2S 4XDCA 2ZDPA 1SQFA 4ZPVR 4G3IA 1PAUB 1QUVA 2AJ2A 3OFGA 5D0GA 2EBGA 4A8QA 1K73T 2XNRA 3QT8A 4KR0B 1WOOA 4DZDA 5KG0A 3PFOA 2XZDB 1LXJA 4LJMA 4IDKA 4E98A 4X4PA 4O0IA 2RHQB 2Y9HA 2NREA 4CLTA 5SUHA 4OJHA 1WACA 3PM9A 3IFEA 1KFDA 4ERDA 1LNQA 1FT8A 2LKZA 1QUPA 4ZLLA 1C1CA 2OGUA 3MWBA 5LSLA 3KLIB 4M5DB 1JNRB 3KK1A 2ZH2A 3IS9A 3QRPA 4R0EA 1MG7A 4RWXA 3Q23A 2KO1A 3L7OA 3EVMA 1HBOA 2J7WA 3CJ8A 1RTJA 2H5EA 1PC5A 1O8BA 2E66A 3PHEA 2XMMA 5L1KA 1WG4A 3LPYA 4LF5F 4F50A 1HBNB 2CG8A 3JYTB 2A3JA 1RAEB 3ET6A 4TN2A 1S77D 4ALZA 4GO5X 2VBZA 3BBBA 4PKDB 5AXMA 2ATCB 1F9FA 1RHQB 4CLLA 2XI2A 2V67A 4DR6F 4CLWA 5KFUA 4L6V3 2JEIA 2DNLA 2V4RA 3OUYA 2V8HA 3L09A 3CUNA 1IKWA 2HFNA 3CCZA 2FJAB 3FEYB 2UVWA 1IBCB 4B08A 4AFFA 4HVZA 5IC6B 2V2KA 1RAFB 1R8BA 4IG0A 4DX7A 2OMLA 2LDIA 1TK0A 4RNFA 1MROB 3QT5A 1RT5B 3H5YA 4KIAA 5IZHA 1HQUA 3CCQS
chains in the Genus database with same CATH topology
4WFZA 1M0SA 3B82A 3FDSA 2W8LA 5LXYA 3GV7B 2W9AA 4O4GA 2VG5A 2LEPA 4Y2CA 4QR2A 2LECA 1QAYA 4QWCA 2EFOA 1X7VA 2ZDOA 4IOAQ 4DV6F 3PKYA 2HQ3A 5E3QA 4A46A 3FRYA 2IAJA 2FC9A 2RB7A 3MGJA 4JI7F 3RW6A 3IRXB 1VC5A 4ED6A 2ZD1B 3DLGA 4CQ1A 2FVRA 4RUHA 3WDOA 3CPWR 2E44A 3JSRA 5F8LA 2HPUA 4KAIA 1KEKA 1U6BA 1YRXA 3FMBA 1HNIA 2GQ2A 4O3PA 1FKPA 4B3MF 2R2TA 2UUBF 3OFEA 5L38A 1L3SA 2G4BA 4WFBQ 4Y65A 2QEXS 4X62F 1SJ3P 2OPQA 2VC1A 4OHWA 4Q8FA 2X1GA 4DQRA 2HHHF 1HW9A 2MQOA 1NH8A 3IG1A 3PEJA 3PDNA 3H25A 2B51A 3RAQA 2IJNA 1QJHA 3CB4A 4KC5A 2JRSA 4D3HA 5EDWA 3RBEA 3BDEA 4ZS6A 3KLEB 1L5UA 3SDEA 1FEEA 3TVZA 3OVSA 1WHVA 5D4PA 2AGQA 4KTQA 1FXDA 3V5RA 2FVPA 1YJTA 3RRHA 1A9NB 4NRTA 5A8WA 2DNRA 2HHWA 2XY7A 3Q2TC 3S1TA 5KFZA 1N5YB 4B9MA 1ZTWA 5E3CA 3OLBA 1VC0A 1UVJA 3WC0A 2DNZA 3OL9A 2J0SD 3O8WA 4NLOA 2RDJA 4ILMA 1G2EA 1XMBA 4PWUA 1PSDA 4N8OA 4CO3A 1N34F 4CT9A 5AE3A 2W25A 1FRHA 2VPWB 4GC7A 1DQ9A 1FNXH 1N0VC 1FDBA 2HLUA 5EUHA 4DL2A 5SZTA 4TY8B 4KHMA 4HT5A 2RMLA 3S7RA 3GYXB 3I9V9 2BQRA 3ETOA 2OSQA 2NQPA 1DARA 2G0CA 2DGUA 2J9EA 3BR8A 2V5HG 4RWWA 3HDSA 2RUGA 3C6UA 3I0SB 3FEXB 2K1RB 4LF4F 1RKIA 5GADI 2YKPA 4JOUA 2ADCA 1DURA 3FVYA 3E51A 5J2MA 2DNHA 3TVYA 1XNQF 4KV8B 1VRUA 3MEEB 4F3QA 3C66A 2W7AA 2KH9A 1FD8A 5B7WA 1S9EA 2UU9F 1X9SA 1PILA 2C42A 1YBAA 4DBQA 4ZK7M 1S10A 1U1OA 4QU6A 4WZQA 4RUCA 4DL4A 1JIHA 2P6SA 4Y6IA 1RTHB 4OIXA 2ERRA 2DH9A 2HQIA 4OLPA 4WK3A 1G1XA 5KG2A 2DIVA 1HWJA 3T5HA 2KM8B 3UE2A 2L9NA 2JEJA 4WU2A 2P9GA 1HR0F 3RR7A 2CQCA 4K59A 2BR0A 5T7LA 3DDKA 2NYIA 1IJFB 1TZ0A 3ITHB 4AXIA 5DG9A 4IG3B 5G0RB 3TI0A 1VQ8S 2QYCA 1I6JA 1WD6A 4XPCA 2RU3A 3FGVA 2DITA 2N4CA 3H2VE 2Z4PA 3W2VB 5F0UA 2FHJA 2WSCC 1FO1A 2GHWA 1ZETA 3LF0A 5LSOA 3K8VA 1Q79A 3LOUA 2WSEC 1B64A 2N4DA 3UR3C 3D0IE 5HBMA 1X4GA 2FB0A 1KTVA 2W24A 3MMCB 2N3LA 2PSZA 1K9MT 4FVCA 1HNXF 2PI4A 3PJXA 3PW5A 2RE1A 4NRUA 1JLFB 1X5PA 4NLRA 1TKZA 1K1QA 2E1RA 1HI1A 1FNOA 3MTJA 2JEGA 3G96A 2L9DA 3M4XA 1YHQS 1XR6A 4Y2KA 2RKIB 2KM8C 2B5JB 4DDFA 5L1LA 3D1QA 1V3SA 5T14A 1J5OA 2JZ5A 3MM9A 1EETB 2WW8A 1QE1A 3I6PA 5GAEI 1R0AB 5JVGQ 2FHJD 4NYZA 2DB1A 3BR9A 1DTQA 2BJEA 3HVTA 3KNGA 4QW8A 3RZAA 1KLMB 4F3MA 4LFCF 3M1VA 1KVJA 1N88A 1Z2LA 1ZAVA 2QLWA 3G6XA 3IC1A 1RT2B 1RTDA 1JXLA 2HS0A 3OL6A 4PG8A 4WE1A 1S6UA 2C3OA 3J81Y 4IKAA 2OPRA 3M6UA 3G6VA 2BQ3A 3E2EA 4ES1A 1RT6B 5KFVA 3M2VA 4X64F 2MJUA 4DV0F 1URNA 4DN9A 1CEZA 4IH6A 3QLHA 3CDWA 1LW0A 4YB1P 3FFIB 3K5NA 1OQ3A 1Q7LB 3QZ7A 2KG1A 3D2WA 1X5SA 2VC0A 1NO8A 3OFHA 3C3LA 3NNAA 5IQQA 2MZ1A 5KAKA 3DOKA 3G6ES 1Y5NB 3VCDA 3M30A 2FVQA 2DJWA 4I2QB 1L3TA 2CQ0A 1O5JA 3DN9A 1FK9B 4TLQA 3CVKA 2OPPA 2VFVA 3F44A 4FS2A 4RW7A 3CDUA 4LF7F 4QYZJ 4C4WA 4NCAA 1KHVA 2LXUA 3CXCR 2VA2A 1NK5A 1VQLS 1GTEA 3J7ZT 2K3IA 4Q2LA 2VBWA 1QSYA 2CDQA 4WF9Q 3F73A 5KFOA 3KK2B 1NJXA 3LQVA 3CC2S 3MTKA 2BVZA 1ZAWA 2G9OA 3UD4P 2XCAA 1HQEB 1X5OA 3BGFA 3W7BA 5EHHA 2RIJA 3Q8SB 1X0PA 3NAHA 1KTQA 3EUNA 5F3TA 3VALA 3MM7B 4J5OA 3G8SA 4KBIA 5L1JA 3E01A 4Q43A 1FKOA 4AE5A 2DH8A 1FERA 3KWMA 2IVYA 2C2EA 1M5KC 1TAUA 2PN6A 5H9EJ 4O3QA 1OWXA 5LJ3Y 1KONA 3EYZA 3T3FA 3PVXA 2HAIA 5ITHA 4DR3F 3V81A 1TFWA 4EU0A 1JLCB 3GWCA 1SUQB 3Q8RB 1X4CA 3N01A 1MU2A 3AQOA 5EWEA 5F0WA 3KLGB 3UCUP 3PNIA 3PX6A 5M2PA 4G1QB 3ZZOA 2BRKA 3BN4A 1VGYA 2C28A 4B9NA 4DOZA 4A8OA 1FA0A 5BYRA 2XO7A 4DLEA 4TQSA 2BM1A 4LVOP 4I56A 1E6YB 4WXWA 2YKOA 3HHKA 2F8HA 2QRRA 1FDAA 2XMKA 5FDLA 5HMXA 2RQCA 3PW0A 4FXDA 5D6GA 4YR2A 4A47A 3NWGA 2IM3A 2F9JA 2BE2A 4PXCA 2P5VA 4KHRA 3GILA 2IMOA 2GJ2A 4Q5VA 3BGLA 3PIPQ 2BBEA 2IBOA 4F4WA 2FTRA 2V4JB 5DDPC 3GV8B 1YITS 2ZNYA 1O51A 2K2PA 4DL3A 2ZFHA 2ASDA 2DO0A 2APOA 1HL6A 2OD6A 4ZVFA 1U1MA 4M1KA 4I1TA 4B3TF 2KT5A 3ZZRA 1IKXB 4N41A 3H4BA 4AL7A 3M2UA 2GJIA 2UUWA 1HMVB 1WTFA 3I5BA 2K8GA 2O01C 4YFUA 3M9NB 1UA0A 2XLKA 3QJJA 3H2LA 4QQBA 2M70A 3ZZYA 4IFYA 4JI2F 1DLOB 3CJ4A 3DRSB 3OTEA 2JWNA 1TVRA 1M5PC 4N8NA 2NUHA 2WSFC 1NK0A 3WX4A 3KG4A 4WU3A 3B8HA 5CH7B 3PO4A 4P2SA 2LQJA 4ICLA 4LVNP 1H6KX 4MK8A 2ASJA 1TL3A 5J2PB 1S6OA 3I9ZA 3SCLE 3SQGA 5B0BA 3BGRA 4IQXA 1S6QB 4H4MB 1KQGB 2MQMA 2V8VA 3PX4A 3MM6B 5E3RA 1JMTA 4HH1A 2DR8A 3AJ1A 1LWCA 2KN4A 3M2RA 2X51A 2HYIB 2ROPA 1HW8A 2Y1JA 1SKWA 2HNZA 1IM4A 1NK9A 1S1TA 3KJVA 1T95A 5B0GA 4J9KA 4C8KA 1TKXA 4OI1A 1X9WA 4NL5A 2X1FA 4D3GA 4O3SA 4IH5A 2JLFA 2M88A 3ENVA 2UUAF 1AXQA 5CQGA 4HHJA 2MZQA 2EG1A 5IXUA 1HBUA 4PQUB 2BZ2A 1S79A 3PJWA 4F4KA 1L3KA 3KMSA 2HFOA 2IA0A 3AB4B 5I42A 2E7WA 3OFFA 2GHVC 1S1WB 2GMJA 5C42B 2JLGA 2MKHA 2PA3A 1TK8A 1YJNS 1S48A 4OHZA 1U8SA 2D3ZA 2FGOA 2YWGA 1HI0P 2OH2A 3C6TB 4DQQA 2OFGX 4A8FA 3OR1A 4X4NA 1N8RT 2DGXA 4F4ZA 4TYAA 4YUDA 4Y28C 1RP5A 5KFSA 2QO3A 4RNMA 1RA6A 4DV2F 2P9CA 4TXSA 1IBKF 1ZM2A 5CD4H 2WK4A 5U47A 3S6EA 5DS7A 4HH0A 4CO1A 3M8QA 4QIWD 1FTCA 3D1OA 3QJPA 1XMOF 1U49A 5KG4A 3S01A 2RQ4A 1RI7A 3DRPA 3KLHA 2ADBA 1TKTB 2JFDA 4Q2MA 2FJXA 3CD6S 2DT9A 3DM2A 4H54A 4I2PB 2ROGA 1JLEB 4NWBA 5GAHI 3KLIA 4IO9Q 1B0TA 4F4XA 2GGPB 5IM0A 3JSMA 3IA0A 2CQ2A 3CULA 5K14B 1IUJA 5KG1A 2KT3A 2YKAA 3MAQA 2YWHA 2DCLA 4F25A 4ECVA 2YNGA 2ZH8A 4NXMF 3JSBA 2VFTA 2VPZB 1WI8A 4MYUA 1L3VA 5HMZA 2CFXA 3H5XA 2DH7A 2RDIA 3MMBA 4DHVA 2ZJPQ 1UWBB 2K7KA 3ENWA 4FZVA 3OV7A 2JHEA 4MMOA 1JLGA 3BB5A 4HEA9 5BYQA 2D74B 3PW2A 4FYDA 2W9CB 2QSWA 4MFBA 4DR5F 1DBDA 1VQPS 2VPYB 1JLQA 4DWIA 4DG1A 4H4OB 2XZWA 5FD1A 1UVMA 1LWFA 5KFPA 2D9OA 5DLFA 1S4FA 4N76A 4M94A 4UY8T 4WKRA 1DZ5A 2ZC4A 3PKMA 1PGZA 3LP1A 1S1UB 2ASYA 2WB4A 1VQNS 3KLFB 5KFKA 3SMZA 3VAKA 2KTQA 1S9GB 4FP9A 4I69A 3GYNA 2HNYB 1XTZA 2Y1IA 4XIUA 2D3OR 2MDAA 5ADZA 4DS4A 3TAMB 2CQ4A 1LFWA 3QWUA 5A6PA 1T05A 2R7XA 2VV5A 4KGKA 4OI3A 4DV5F 4JV1A 2HG4A 3V4MA 2G13A 5D77A 2LEBA 4J9RA 2L3MA 4DFKA 2F8EX 1HNZF 2XSJB 4AL6A 1U1PA 4RW4A 2VUGA 4C0HA 4CO0A 5IFMA 1JX4A 3K58A 2IBKA 2I5JB 2KJVA 3WZ0A 2CPXA 5I4MA 2E5LF 2DTJA 1P1TA 3R1LA 3ZZUA 3QIPA 1SL2A 2ZC3A 4J9NA 1T03B 1SJQA 1NZAA 2QA4G 3N6LA 3ZZTA 5KFAA 1WEXA 2DRAA 3D0GE 4DR7F 4NLVA 2QV6A 1VOMA 1REVA 2HS3A 2NSCA 3OLAA 1XBWA 3N5FA 2RILA 2BJDA 3OTOF 1RT1A 2XULA 3DRYA 1LWEA 2RT3A 4YEAA 5M2RA 3ZZZA 5F8IA 4OLOA 3NMRA 2GQCA 4JI4F 4I7FB 2MZJA 2E1CA 3MPYA 3IAS9 3CDAA 1Z1ZA 4N77A 4BWMA 3EPGA 1OSDA 3DLEB 4WFAQ 1N36F 2HMIA 1UA1A 4Q8EA 4K50A 3H5UA 2X3GA 4OZLA 2J7KA 2QMXA 2IYGA 4K4UA 5F8GA 5CCLA 3OHAA 4KO0A 4DSKA 3TUZC 2LCWA 1D1UA 1YJRA 2Q3PA 2HIQA 4BDPA 1Q53A 5EN1A 4FN5A 2ZH3A 1ZOTA 3K5OA 3AQPA 4Y2IA 3NBPB 4DSJA 2GW8A 2DR5A 4WFXA 2RF2B 4IH7A 2X1AA 2XHWA 3VF0B 3KG0A 3DLKB 5LJ5Y 3HJFA 4R0JA 3FNNA 2DHXA 3HZGA 3MM5A 3T1YF 2V0NA 4J9PA 4O23A 4LF6F 2FIUA 3U7JA 3TOQA 1JB0C 4J9SA 3K2YA 2ZD1A 2RQMA 5C24A 4RZRA 4DFPA 4Q0BA 2DGWA 2VFUA 3GIIA 4DV4F 3THVA 4TYBA 3TA1A 1HA1A 4FXWA 4FXVA 5DQGA 3SXLA 3MF5A 1WF2A 3SCKE 1NKEA 2ZH4A 4JI1F 4EYHB 2CQ3A 2EKYA 4ZCLA 5CZVA 2W8KA 3QZ8A 3CWJA 3E8OA 3DXBA 1SKRA 1UETA 2KKHA 5L9XA 1Y3KA 5KG3A 3ISND 5KFXA 4JYAF 4QIVA 2B6AB 4QWDA 3LUYA 3T9NA 4DV1F 3MFHA 5BR8F 2BANB 2RS8A 2ZJRQ 2PC6A 3Q22A 4W90B 2ZE2B 5C25B 4HI2A 1R7IA 2J7UA 3G4SS 1ZZFA 3LWMA 5GAGU 2AF6A 3NS5A 1WELA 2MY8A 3K5MA 5J2QA 1N5YA 5E41A 2ZH6A 4NCBA 3I96A 4ZPDA 2CZVC 3PZPA 2XB2D 2HNDB 1X4DA 4NLSA 1AUDA 3VQTA 5KG6A 2FLLA