4HL9A

Crystal structure of antibiotic biosynthesis monooxygenase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
93
Chain Sequence
MLKVIAQDFIKPEAIDIVLPLYRELVEKTRQEPLLAYDLFVDQKDPGHFVFIEEWPDRAALDIHATEHFTRLVPLINAHQRQDGTVVLMDAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Antibiotic biosynthesis monooxygenase
publication title Crystal structure of antibiotic biosynthesis monooxygenase
rcsb
source organism Rhodospirillum rubrum
total genus 24
structure length 93
sequence length 95
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4hl9A00
2FB0A 5B0EA 3KG0A 3BR8A 1YG0A 2OKQA 2W4CA 3IWXA 1FESA 2CRLA 3T9NA 4A47A 1JK9B 4Y2MA 1S6OA 3FMBA 3TNVA 5B0CA 1XBWA 4FNHA 3LO3A 5B09A 1ULRA 2QLXA 3VTIA 2OAUA 1YJTA 2ACYA 2KKHA 2AJ1A 1Q8BA 2ROGA 3HHLD 4Q2MA 2FTRA 1VQSA 3BDEA 2JDJA 5A6WA 1Q53A 2VV5A 1X7VA 2K1RB 2AP6A 2N4DA 5T7LA 2N7YA 4ZOSA 3E8OA 5K9FA 3HHLC 2GGPB 1RJJA 2XMTA 3LGMA 3MZIA 1N5TA 1W2IA 1X0PA 1U7LA 1OQ6A 2N4CA 1TL4A 1FEEA 1FVSA 3FRYA 4QOTA 2QLWA 4YDXA 4A48A 3BGUA 2OD4A 2HQIA 1YJVA 2IYIA 2ZDOA 2GO8A 4U9RA 2GFFA 4Y2IA 2RSQA 3TRGA 5F0WA 1AW0A 3DXSX 3QGPA 4ZA1A 1VQYA 1FE0A 1YRXA 3GZ7A 3HX9A 5A6PA 5B08A 2RU9A 2IFXA 1MWZA 2KT3A 2XMKA 1YJRA 1OPZA 2XMVA 3IWLA 3LGNA 4A4JA 1URRA 4Q2LA 1LQ9A 2BBEA 2PGCA 2XMMA 4EFAC 1Q8LA 1K0VA 1TR0A 4FNIA 4DPOA 3BB5A 3HHLA 1KQKA 3WDOA 2HIQA 2HFOA 1SQEA 1Y3KA 2LDIA 2G9OA 4NPOA 2RMLA 3BN7A 1X8DA 3BM7A 3F44A 5B0FA 2BUNA 1P6TA 5B0BA 4HI1A 2K1RA 1OQ3A 2L3MA 2XMUA 4YEAA 5B0GA 3FGVA 2RILA 2OFHX 4HL9A 1FE4A 5IXUA 1APSA 2GGPA 2Q3PA 1AFIA 2KYZA 1CPZA 1CC8A 5B0DA 2HFNA 2OD6A 2HLTA 3I9ZA 4HH1A 2W4PA 3CJKB 4OJGA 1MWYA 1CC7A 3TOQA 2LXFA 1KVJA 2BYCA 2ZDPA 1N5SA 2OP5A 1P8GA 1SB6A 2LQBA 2QIFA 3QMQA 3K7RA 2K7KA 3UDCA 1N5QA 2GCFA 3KKFA 1V3ZA 1Y3JA 4OIXA 2ROEA 2FHMA 2QYCA 2VH7A 1SI9A 2K7JA 3HDSA 3HF5A 1AFJA 2KT2A 3MCSA 4OJHA 4HH0A 3BF4A 1IUJA 3HFKA 2FIUA 5F0UA 1R6YA 3HHLB 4HI2A 2HLUA 4A46A 1N5VA 2W4DA 2ASYA 1GXUA 2IYGA 5T7LB 2GV1A 1JWWA 2EW9A 2ROPA 2OMOA 2AJ0A 2GA7A 2PD1A 3KG1A 5B0AA 4NL5A 4DN9A 1GXTA 1Y0HA 2LQ9A 3KNGA 4DL0C 4F67A 1OSDA 4Y2KA 5KAKA 1KVIA 1Q4RA 1WD6A 1S6UA 2XMJA 2K2PA 1TL5A 1FVQA 2BJDA 2OFGX 2AW0A 1Y9OA 3DCAA 4OJ1A 3CJKA 2BJEA 1TZ0A 1YJUA 2XMWA 1FD8A 1TUVA 1QUPA 4OJ3A
chains in the Genus database with same CATH superfamily
3HPOA 2DHSA 1TL1B 1GTHA 4JYAF 4RU2A 1C0TA 1T7PA 2YWWA 4A8KA 3SCKE 4R25A 1HA1A 4WTYA 3S8SA 4ZPDA 2HRUA 1NCLA 1REGX 2CVIA 5L1JA 3R5GA 2DR7A 5AJ3F 4NOHA 5J1EB 1PO6A 1ZAXA 3JSMA 4KJIA 1WF0A 1WDTA 2FUG9 2NXNA 4QZVB 2HMIA 2V9WA 1XNQF 4KFBA 3ENVA 2C42A 3PXGa 3I0SB 9RUBA 2UXDJ 2DT9A 2J9DE 4IO9Q 4KR0B 7AT1B 2JJ4D 3G82B 1RI7A 3C66A 4B9LA 4R8UA 2ASYA 3OTCA 1XEZA 4L3KA 1RACB 1HWKA 3A13A 3T6BA 5A8KB 4IQXA 3CJKA 4EU0A 5KFRA 2BE9B 1NXIA 2V34A 4O0NA 3RG6A 5IT9U 1H72C 1FXRA 1LK5A 3OSPA 2B6AA 1FX4A 1NKCA 5HAOA 3D0GE 4V19X 3T9ZA 5HBMB 3IS9A 4ETZA 4X2BA 1PC5A 1OY9A 2CQBA 2AYBA 1MROB 4PXEA 3IA0A 1JLGA 4DSLA 3B54A 4NA3A 3G87A 2IHR1 2XGQA 3RW6A 4DR2F 1M5KC 3GJRB 3RGIA 3A3NB 4DPTA 1OQ3A 4YEAA 4FF2A 2X3DA 4J9PA 5IXUA 5EUHA 1GX5A 3NRBA 4PWDB 1HIYA 4JI2F 2I2YA 1HHQA 3D1QA 2KXNB 1GX6A 1U48A 1RAJA 4JI7J 4XO0A 4HVZA 4ZPCA 1BXNA 3W5ZA 1X60A 1Q86T 3D54A 1KEKA 1AXQA 4V19J 3TVZA 3BSAA 2YWGA 3OXGA 2DITA 5B0CA 3R1HA 3TZXA 3RR7A 3T5LA 1Q8BA 1Q8IA 3JXOA 1YWXA 1F9EB 4K4SA 1I94J 2WHOA 3V4MA 4ZVEA 4B3OA 2NCKL 2RE1A 2NREA 3GR1A 4QPXA 1NK0A 1DAXA 1SJRA 3GJSB 3MD1A 1LW2A 4WXWA 1XR5A 1JLFA 3EJMA 3UW1A 5F9NA 1UEKA 5LM7E 3DDKA 3NMRA 1CS4B 1AT1B 4OMFG 1S6QB 1MMNA 3CCUS 2DR9A 1VQ6S 3BH6B 1HPZA 3VVUA 3J81U 2B4VA 1U6FA 5JVGQ 2ZHAA 1UVMA 1NKBA 1RHRB 2BV3A 1Q7LB 1B0PA 4MK9A 4HHHA 3W2VB 3OUYB 3CCMS 1UTAA 3CTRA 2OHDA 2RF2A 4RL1A 4N41A 2PIIA 1KQFB 1UW4A 3NGKA 1VQNS 2D9OA 3QZ8A 2PFFB 3UI3A 1FI4A 2XZDB 3QBCA 2Z2YB 3DLKB 2VZ9A 1F3VA 2YVSA 2VG5B 4NCBA 2C2NA 5KFWA 2NUUG 1D0EA 1DURA 1D8ZA 3N0VA 3T5JA 3BQ2A 4Q2MA 3HHLD 5AE2A 2DK2A 2IRYA 2HNDB 2OELA 4ECQA 2J0SD 1WORA 3TZZA 4ED6A 2FVPA 1HYSB 3W8PA 5ETQA 2D41A 3T5KA 3EE3A 1IR1A 5D15A 1N5YA 3CDEA 4DV1F 5C5JA 3MEEB 2ASDA 1VQYA 2YNGA 4F3OA 2BA9A 2UXCF 2GQQA 1H38A 2G2ZA 4NLXA 3P4UB 2LEPA 3MM8A 3J7AN 1S4FA 1X5OA 2QG9B 3ZZ0A 4M94A 3MF5A 2CJYB 3EGVA 2F5GA 4LJMA 1GTEA 1JXEA 1P8GA 4O3QA 4WIQA 4LVNP 4NMXA 2IIHA 2ZE2B 5KOXA 4J9RA 4KGMA 3VALA 2PFDA 4HHUA 3D3CJ 2GJFA 4C0HA 5HN0A 2GA7A 5KFJA 3OFGA 2L9WA 5D0EA 4U96A 3MAAB 2MPUA 2XLKA 1S12A 3EGZA 5A76A 4NI2A 2RKIB 1FKOA 1VBKA 2IDEA 1IM4A 2RH3A 4ECRA 3R8YA 2VBYA 1LWCA 1KNZA 3CO9A 1OYDA 5T7LA 3DDNA 4KGZB 4OYIA 4DSEA 1SKSA 2QLWA 1VR6A 5ETLA 2GFFA 4E2FB 3EXCX 4Y65A 1SH2A 4IYQA 2R2SA 2IA6A 2Q6BA 5CHCB 2P6TA 2HIQA 4ZN3A 1N56A 3HULA 4CYUA 1RDRA 4K0KJ 4F3MA 1SV5A 1SUQB 4IG3A 4TKTA 1U1KA 5DM7Q 2HZCA 3AHPA 3M8QA 3Q83A 1FFGB 2L08A 4OYMA 5I3UB 4DQIA 4LREA 3FBCA 4NLPA 2BW7A 4U6PA 1HNIB 1L5UA 1UWBB 1JIHA 3Q2SC 2IBKA 1C0UA 2MZJA 1XTZA 1RAOA 4AFFA 4UOCA 1RB0A 4ZK7M 2VB6A 2W9BB 2BABA 4ZVPB 2AEJA 3HVRA 2UUAJ 1R6VA 4JUZA 4K4UA 2R9LA 3R5CA 4LF6F 3LW5C 3ZZZA 2X51A 2OIHA 2RUGA 5G4DA 4WPAA 4CH1A 4MKVA 2UXDF 3AD7C 2WCXA 1QUVA 1L3SA 3MM6B 4NRUA 2GS8A 2NSCA 2IM0A 2BYCA 1NBEB 2ZDPA 4ERDA 1ZM2A 3TWZA 2A2DA 4O23A 3EX7B 5KOWA 4YP3A 2EC2A 5HQMA 3DRXA 4B3TJ 1H98A 1HL6A 3KG1A 3OVAA 4GKJJ 1EJ7L 4O44B 5DDPC 1EIYB 4DJBA 5KT6A 2ABYA 4UOGA 4DL3A 3MM9A 2W4CA 4TVAB 1WHYA 3G71S 4JI3J 1AZSA 1T02A 2V8DA 1SXLA 4D3GA 2DO4A 2HHUA 4BCAA 1RT4A 1T94A 4DV7F 3I5AA 4JI1F 2C3PA 2DHXA 2JLEA 2ZOGA 1O6XA 3CVKA 4HTIA 3UN2A 1NK6A 3J7A1 1S72S 1RTDA 2XEXA 4R5PB 2NQPA 1HMVB 5CYJA 3SXLA 4ES2A 4NA2A 2LU2A 4PG6A 4A8SA 2RQMA 2WVBA 2YQ3A 1TU0B 2HHPA 4FXVA 2CUYA 3RR8A 1AROP 2ZOFA 1FFWB 2D7SA 4LFCJ 4ZHRB 2UUBJ 3RAQA 4X4UA 1Y5IB 2QLJB 1KLNA 4TY8B 2FJVA 3I9V9 1SB6A 4P74A 4YN3B 3UDCA 4QYZJ 4O4GA 4QR0A 1J27A 2VOOA 3QATA 6AT1B 3GONA 4DZDA 5F3TA 2IDLA 3AB2B 3EPGA 2RD5C 3CJSA 4AE5A 2GVZB 1TZ0A 2JX2A 4TU8A 2CZ4A 2B0GA 4NLRA 2MYFA 1FRMA 1N36J 5KT7A 5CD4H 5T14A 4ED1A 2QL9B 4CO5A 4LBHA 4L6V3 3QYYA 3HKWA 4USUA 2CJQA 3FRYA 2JEGA 1FD2A 1FWKA 4LSLB 3HT0A 3TA1A 3TR5A 2FDNA 3TAMA 1MWQA 5KFPA 4K2XA 3WC2A 3L95X 2YKOA 5L1LA 5CZXA 1DLOA 4J9MA 1S48A 3PVXA 2R2RA 2YNFB 2NPIA 3WQPA 1KVKA 2UXBF 3O6QA 1PJ7A 4OYOA 1NJYA 1DRZA 3VGSA 4ED3A 2EFGA 1NSAA 2ZWOA 2NYHA 5C42A 2N7CA 3M30A 5HSPA 4ZJQA 1VQKS 3KOAA 1VRQC 1NRKA 2CA9A 3PKMA 2CPYA 2D1CA 3I5CA 1EQ0A 2AGQA 5FLXY 3I82A 2EFOA 5A2QU 4DV3J 1BGXT 3BO2A 1Z2ZA 3NAIA 3LQVA 4KV8B 2DH8A 2YTCA 4ZJLA 3TA0A 3UVJA 1R3NA 4USHA 2GQCA 3H5XA 2VD3A 2IA0A 2CQCA 5HJYA 3CJ4A 1M5OC 2VHGA 3TO8A 2HQGA 2D3O1 3MZIA 1U8SA 4WTOB 5KG2A 1FRHA 3GLJA 1VK3A 2KDOA 3LP0A 4JI6J 2VKZG 3PNIA 4ILRA 1S6PA 1FE0A 1RHMB 2VBXA 2DHHA 2CPZA 3RU0A 4J9NA 4L76A 1REVA 1DQ8A 1XIQA 3CSKA 3UR0A 5KT2A 1F0XA 4C4WA 4P2FA 4JV2A 1U09A 3PDNA 2KTQA 4NYOA 3H0PA 1FKPA 2LKZA 4U8VA 1M5VC 1F5AA 2LXUA 3GYGA 2HS3A 4N7TA 3ZNUA 3HVTA 4DSKA 5HMXA 4DUTA 2UVWA 1U47A 4GC7A 2W9AA 1F60B 1UFKA 2XM3A 2I0XA 1Y00A 4LSNB 2N3OA 2XO7A 2HHTA 3TVKA 3IP0A 3UO0A 2VPZB 5HLFB 3T9NA 1S6OA 2Y1RI 1SBRA 2R8KA 1FCAA 2CWKA 2AEFA 4EMDA 3VV2B 2IVMA 2UP1A 4PUOB 4X4SA 3GU0A 5IS2A 4YB5A 1WI6A 4OHWA 1BQNB 5LSOA 2PI4A 2C2EA 3BGUA 4OYZA 4ZCMA 4CCHA 4PQUB 1ZPVA 4FYYB 4CLWA 4A4JA 3UN5A 4N76A 1GMWD 1AB8A 1KWMA 3QIPA 2RMLA 2DISA 3AOCA 2HGMA 4ZCLA 2JEIA 3O44A 3H4BA 5DLGA 1APSA 3SZ2A 4DR3F 4RW4A 1YRUA 1HNWF 1U4BA 3RBXA 2AYGA 4FS1A 4DV0J 4PYAA 2M4MA 5J2PA 7FD1A 1JLFB 1N6QA 3OHBA 1VQ4S 1SH0A 2MQQA 2W4DA 4ER8A 3W1YC 1U6ZA 2ZVIA 1IJEB 2MKJA 1TL5A 2A2CA 1XR7A 1F1BB 1H6KX 4J91A 4X62J 4JI5F 3PW2A 3U7JA 3VZHA 2LQ5A 2ZBIA 1IR2A 1ULRA 3MR5A 2HQFA 3G9CA 2OPRA 2CJ9A 1KTVA 2DGXA 2RF2B 3ISNC 4ZVGA 5IFMA 3QJLA 2FVRA 3KJNB 3X3UA 2C2ZB 2MZRA 2XMTA 3DHWC 5KFLA 2JHEA 2VU5A 4EO8A 4F4KA 5IQ6A 1R0AA 2Y1LB 5F8MA 3C14A 4KHPJ 3H25A 1QE1A 3R6LB 2NZ4A 2A3JA 4K5SA 3ZZYA 3BKFA 1F2GA 1NZAA 4J9UE 4CLUA 4LF5F 5DETA 1VBZA 1V6HA 3H59A 3T6JA 3MOJB 1NM2A 4ZS6A 4XPCA 4K4XA 3VGTA 3EWGA 1RAEB 1X9MA 1NK4A 2J76E 4MKBA 5HQLA 1WG4A 2W1BA 1O8BA 2QYGA 2KZMA 1RCOB 2EBEA 1K73T 3QRQA 3MM8B 1J5EJ 4RW6B 1KFSA 2EKNA 3KLEB 1TL3B 1QD1A 1RTJA 4NLWA 2XSJB 2FLNA 4RW7A 1JLCB 3HD1A 4UZBA 3TI0A 2LECA 2XWXA 4ED2A 1Y5NB 3K89A 1LWEA 4B3SF 4DL5A 2QV6A 3MFIA 2RDJA 3NGTA 4NLOA 4NZ0A 1C4AA 2ZWPA 2LLZA 4NI2B 1FKOB 2CJAA 3GP9A 1FKAF 2LDIA 3FZ2A 4CO4A 1XWLA 2KYXA 3S7RA 1ZETA 4R0EA 2VQEF 2I1RA 2CXEA 2KXFA 5IT0A 4USJC 3FFIA 3WZ0A 1T11A 4ECUA 4YFUA 2VPXB 2R4FA 2A0FB 1TKDA 1PJ5A 3ZZPA 2Z30B 4O3SA 1U1OA 1KQGB 4KBIA 3M1VB 3ISZA 4CYUB 1HQUB 4OHZA 5KFFA 4IG3B 2F4VJ 3M2RA 3KK1A 5E41A 1EP4A 4NZ6A 1IKVB 2J5AA 4YY3F 3R2CJ 5GAEI 4KKOB 3RRKA 2R7UA 5K8OA 1NDLA 4CRJA 1S5ZA 5ADZA 3OR1A 1TL4A 1VS3A 3A1YG 2XCAA 2DNHA 5LT5A 2GO8A 2OPPA 1N32F 5EGYA 1FRIA 1UA1A 3BBFA 3LP1A 5B08A 1RE1B 5J2QA 2B9XA 5HP1A 4BDPA 3KLIB 1ZH5A 2XQCA 3M05A 1S97A 3KJQB 2YKNA 4N8NA 1QLNA 2GGPA 4IFVA 5DM6Q 4DHVA 3SFUA 2CNKB 2QSFA 4EGLA 2MKSA 2FJBB 1ZM3A 2QFIA 1ZYQA 2GCFA 2OTLS 4CLSA 2FHMA 2P9CA 4QYRA 1AFJA 3W5XA 5ETTA 4DUZJ 3A8JA 2UUCJ 2XLIA 4CT8A 3FUYA 1TK0A 2IYGA 4DUYJ 1GXTA 2ZD1B 4ECZA 1OSDA 4ELUA 1WC3A 2Q6CA 1CBKA 3M8PA 3PW4A 2XULA 3GG1A 2GZOA 1HI8A 1UWAA 2H65B 4FXDA 2XYHB 1H73A 5K14A 3VTIA 5KFNA 1HR0F 2BE2A 1E6VA 4JV5J 4ZVUB 3D7SB 3R7NB 1VQMS 2E9RX 1TAUA 2FHJA 4X84A 2M8HA 2L41A 5ITHA 1LFWA 4BC7A 2VFVA 2XY6A 4C7QA 4G1IA 3WDOA 4QWCA 1AZSB 3OJSA 4LF2A 4HKQA 1RTHA 1CG2A 4QYZK 2ZZMA 3VQTA 1T9XA 5GAGI 4GVBB 3HO1A 4HR2A 1WKLA 3Q8UA 2ZC3A 1RT2B 2CDRB 3P5BP 2OEKA 1V3ZA 1NHUA 3UFCX 4IH6A 3W62A 3NOCA 5A0YB 2YNIB 2D3OR 5HVHA 3CCTA 3NGSA 2XMJA 2ZH8A 1QTMA 3W7BA 2C1EB 2HNZB 4YQWA 2HHWA 3ENAA 5LXRA 1VGYA 1SIWB 3KG0A 1UJ5A 3QJPA 2IAJB 4WKRA 4PG5A 1FT8A 4Q44A 4NA1A 3A3PB 1U8WA 1U1LA 1QVFR 4O4GB 1RAFB 2EVZA 1HD1A 4KO0A 1DTQA 1CJTA 2YWEA 3J7ZT 2JOQA 3ONQA 1OQ6A 3EXYA 1HWLA 1ZS6A 4WFXA 4RO0A 4LQ9A 4ZVHA 2WK4A 1P9QC 4ZPAA 3GIKA 5IT9Y 1HQEA 4N8OA 4KC5A 4WU2A 4OJGA 1D3WA 5D8HB 3AJ1A 3FCHA 4NLSA 4X4PA 1QAJA 4K5RA 1SL0A 2ZNZA 3LWMA 1FX2A 3PYEA 1DLOB 3LPYA 2GAGC 2ZBPA 3E51A 2ZH2A 1JNZB 2E1RA 2KT5A 1JNRB 3G96A 1RABB 2QTWA 3EVMA 3J7YI 3QPIA 1HWIA 2F7VA 3BO4A 2F4FA 4RNHA 4YB6A 5FDLA 1XNRJ 1MSWD 4OI6A 1X7VA 4E98A 5H9EK 2HVZA 2DY1A 2QT7A 2LEBA 2QLFB 3Q23A 2D3ZA 4CTAB 1SJ4P 3N4WA 3R27A 4FZVA 2BBEA 1SQGA 4WK3A 4A8XA 3D9BA 1Y3KA 2K3IA 3HKZD 2Z58B 2D74B 4Z37A 1K1SA 5FIIA 1M5HA 2YH1A 2ZH9A 3PFOA 1F2HA 4A8OA 1VQ9S 1T9VA 2HPUA 2R7TA 1PIEA 1KLMA 3CT9A 3LP0B 4NX9A 2E5LF 3MCSA 5GVQA 2FIUA 2C2DA 2YWKA 1RWMB 1X0FA 5ETSA 3ILOA 3UCUP 2H48B 2EW9A 1OSCA 2DR8A 3NWGA 2RHQB 1C4CA 5KG4A 2HG4A 2PA3A 5C7PA 2BM1A 2Z56B 2Y3YA 3FKBA 5E3AA 3K8WA 2LA6A 3EZ5A 3WC0A 3R5JB 3FMWA 5IM0A 3POTA 3VAJA 4AL5A 3UE2A 2OAUA 3MOZA 1FKPB 3BDEA 5L9XA 2Z4PA 2E5IA 5BR8J 4ZVQB 2LP4A 5KFYA 2ZVSA 3QGIA 3SV4A 1DTTB 3QWPA 3TJ8A 4G3IA 1LXNA 5F8JA 3CJ5A 3M6VA 1MU2A 4IFYA 2JSXA 1UETA 2EFQA 1JLBA 3NGUA 1UZHA 2HBZB 1OPIA 3NS5A 4DR7J 4GKKF 1N0VC 2EC0A 2HWHA 2J9DA 5LL6d 1G3OA 3ZZOA 4C0OC 2RILA 4RU9A 1X4HA 2PDAA 1IVZA 3N5BA 2CPDA 1VQ8S 1RYSA 2RAQA 1GXLA 1M5SA 4MIWA 3QRRA 4ED0A 3CPWR 3FCVA 3N5FA 4M5DA 2ZKUA 2CQ0A 3PR4A 2J0WA 4NEYA 4DCOB 3H90A 4C8NA 1MG7A 5A8RB 3KNAA 4U8YA 3ZZUA 4P6QA 2E66A 4EBDA 4ANDA 1N48A 5I3QA 1IQZA 4DV2F 5A6WA 5L46A 1IBKJ 4IR9A 5KFQA 1SIZA 2RVJA 2ZJRQ 4NLYA 2FGCA 1YIJS 3DOKA 2WAQD 1URRA 3FJ2A 2ZUAA 1I5OB 3T1HF 3K8VA 1RT7B 2UUTA 2E5HA 2Q3PA 3ZFVA 4AYBD 4RX6A 1ZOTA 3SV3A 1N5SA 1VMBA 3K7RA 1EZZB 2CADA 5HATA 3C14B 5DQGA 3V6KA 1QE1B 1RHUB 1FK9A 2B9YA 3VCDA 4X65J 1NK5A 2DGOA 2D3UA 3DRRA 3PIPQ 5MAOA 1TFWA 3BO3A 4F67A 2R2TA 3QT8A 1SCJB 3F56A 2MJNA 4N77A 4LF8J 3N6LA 5D0RA 3AOAA 4OX9J 1Q1KA 3BGFA 3CCQS 3FMBA 3UN3A 1XBWA 1X4CA 4FYDA 4ZCIA 5LMNJ 1N88A 2AJ4A 1WKJA 2XMAA 5C25B 2R8JA 1DHMA 5GADU 4QJVA 1B7FA 2POKA 2CQPA 4U9RA 4HT5A 4O0IA 2RQCA 4NE9C 4ENOA 1IBMJ 2R3VA 1TR0A 5D78A 1NDPA 1A0OB 2B4OA 1X8DA 3P96A 3TJAA 5C24A 1YTYA 5CH7B 2ZM6J 4JI4J 5BYRA 4AQYF 3C46A 4Y00A 3B4MA 1TVRA 2JEFA 3GIIA 4C11A 5J1NA 2K7KA 2R7OA 4DL6A 4OL8A 5JMNA 2EG1A 1DQAA 1TKXA 1UEVA 4N5SA 2P2CB 3OTBA 2AJ0A 2ACMA 3IAS9 3PW7A 1BD6A 2W9CA 3BGLA 4O4RA 2V8PA 2HBQB 2NYIA 4N47A 5E3CA 2XGPA 3TW0A 1S59A 1TUVA 2WB4A 2FB0A 2B8QA 5EX3A 1N54B 1CJUB 3FFIB 1FNMA 2G0IA 2Y9HA 1T9UA 1HBNA 2QO3A 1RUSA 5E2QA 1RLCL 3IC1A 2DRBA 2ERRA 2M3DA 2JL9A 3L7OA 2N4DA 2BOPA 1U1PA 3QAUA 5EX0A 4YDXA 2EBGA 2BE7D 3PJWA 2CZVC 3R1LA 4K50A 2LMIA 4OX7A 2KO1A 2LU1A 4FF3A 3SYZA 3P3DA 4JI0J 2HFOA 3KK1B 1T9YA 4OI2A 3F44A 1F3FA 4DR1J 1HNZF 3QO9B 3B4DA 3CCWA 3SCIE 3MURP 3FGVA 1E6YB 2ASJA 2HFNA 3W63A 2RQKA 3OR1B 4XDCA 2QRRA 2DXDA 4DR4J 3AQOA 3A4TA 4DV5J 3IM9A 4OYBA 3LP1B 3CCLS 4AUKA 2OPSA 3GYXB 1JXLA 2GNKA 1JLAB 4P72A 3ILIA 3UDVA 2GIQA 3DMJA 3K5PA 4M63A 1TV6B 1CQMA 2VODA 3NCRA 1QUPA 3I0SA 3U1LA 3UNYA 4JI8J 2XCPA 5AXNA 1W2BR 4HHJA 5FD1A 1DFDA 2GHWA 4B3MF 2UVVA 1LNQA 4P2XA 1NSPA 1UVKA 4ZLLA 4ID5B 4UUWA 4RW8B 3D6FB 1WNEA 3HFVA 2W2MP 4OI0A 3C19A 3CUNA 3OTOF 3M7VA 2IFXA 5L9NA 2CJXB 1B0TA 1PYSB 3PY8A 5HMYA 2BE2B 2QMWA 1E6VB 3VAKA 5KFZA 1NJIT 4DG1B 1TL7B 1NB2A 4DLEA 2VQFJ 2VONA 2GHVC 3CMES 1VK8A 1O5JA 5D6GA 2K7JA 3I0RB 3SCJE 3PRDA 2C3OA 2HZAA 1QAYA 2XY5A 1RTHB 1SJ1A 2LQ9A 1SKRA 4PCQA 1D9DA 2BVZA 4KSEB 4PWDA 1T9TA 4ZMMA 4H4OB 2C2KB 2NLWA 3TEHB 3ZTQA 2ADBA 1HFEL 4DZ6A 2YX4A 4GO5X 4OI4A 2IRXA 2IC3B 4P7VA 3V4IB 1I51B 5FLXU 4FYVB 1FHTA 3ZTPA 4URSA 2OPQB 5A2QY 2F8EX 4CO3A 1PYTA 3G8TA 4E0DA 4LFAF 1X5PA 5K5MA 2D69A 2CNNB 5HANA 4KTQA 3ET6A 3GJTB 1YBTA 1FERA 2P8IA 3FEYB 3BM7A 1TMJA 3SIPB 1ICEB 4KO0B 1QSLA 1DTQB 2KM8C 2RB7A 1U26A 3TP2A 3M8SA 1X4FA 1A9NB 2AGPA 4C0BA 1V5IB 4OZLA 2KHCA 4C98A 1KR4A 1H2VZ 2JC1A 4Q5VA 3MFHA 2W8LA 5F0UA 1CS4A 1T9WA 5KFOA 4ECWA 4BC9A 1M5PC 5B7WA 1QM9A 1Y0HA 2SXLA 8AT1B 5HL7Q 4LF4F 3UPFA 4GMKA 1U0HB 2V2ZA 2HVHA 1RZMA 4ZVSB 3HSZA 3ITHA 3C16B 5F3ZA 2ZH1A 3OD2A 3PX6A 2BACA 2F40A 2JNJA 2FLOA 2HHHF 3WHIA 1D09B 4RKUC 3RBZA 4JYAJ 5GMEA 2AQ4A 2CJBA 1DBDA 2GIFA 2XLJA 3DLKA 2K3KA 3MPUB 3V81B 3UDEA 5KFVA 4B9TA 1IKYB 2FHKA 3DXSX 1L3TA 5AJ3J 5CYQB 3ENWA 3MPVA 1UA0A 1X9WA 5AXKA 4WYWA 3CD5A 3JYTA 3GIMA 4QCLA 3C8YA 5DJBA 5FDLB 1KP6A 4Y2CA 5L1KA 3MMCB 1HYSA 1XNQJ 4LT6A 3WX8A 3HCXA 3I56S 3VGVA 1WELA 2G4BA 2VPWB 3BH7B 1IM6A 4J9LA 2W2QP 1N4LA 3WIVA 2MZ1A 2AIRB 1HHSA 3M9MB 3LUYA 4OQJA 1K8AT 2OMOA 3PYGA 1RBOB 2PN6A 5C2GA 5KFCA 4NLDA 4MTPA 3U1NA 3CF5Q 1OMSA 1NAQA 1KLMB 4DU7A 2KL8A 2ZE2A 1KONA 4TQRA 2QGFB 1M90T 2E7VA 2O5DA 1MMDA 4Q43A 3IRWP 1N5TA 4ECXA 2MLXA 2HQIA 3MAAA 4ZP9A 2H5JB 1PAUB 4DR2J 1OIAA 1ROFA 2AHOB 3HHKA 4G6VB 2F63A 1RLDA 4LF9F 4LMZA 3GSDA 3FVYA 2CWXA 3U02A 4DV6F 4IRDA 5IV3A 4JI2J 2VBWA 4M5JA 1FJGF 4NXNF 2Q79A 2B4UA 1ZBTA 2X3GA 3GV5B 2O01C 1J2VA 2KJWA 2I9SA 2HRYA 5RUBA 4MKAA 5DRKA 4LF1A 4PZVA 4OZ3A 5I3UA 2V9KA 1S1TB 1YGYA 1WOSA 4OLPA 5D4OA 3TX8A 2ZZNA 5G0RA 4XDDA 1WWHA 3M8RA 1IBCB 1HNIA 5BYSA 3FBEA 1UWBA 3G8SA 3GIJA 2HVIA 4TQSA 5EHHA 1SC3B 1RU2A 3OTDA 1GT8A 5MLCV 4YHHF 1KOOA 2Y8WA 2A6OA 4WP3A 3H8YA 1CJVB 4QR2A 2QA2A 2W9BA 1GMWA 4J9VA 4ES1A 4X4NA 2HHQA 4L3NA 2UVRA 1F6TA 3TARA 1VLYA 1YZ7A 2MQOA 4X4OA 4B9MA 3A8EA 1IJFB 1N5VA 4FYWB 1RWPB 1MN9A 2VG6A 3MM6A 4P71A 4QWAA 2FHJD 3W9HA 1JB0C 1WOPA 3EPIA 1N0UA 2H5EA 1FESA 1EAYC 1ZAWA 3GFXA 1WSRA 2QLXA 4KH0B 4ANEA 1NJWA 4K8RA 4LRAA 3NMAA 2N7YA 4QW9A 3D0IE 3HJFA 3LGMA 3DRRB 3NS6A 5DQHA 3CC4S 2O66A 4MFBA 3VVTA 1XQIA 1TP7A 4B02A 2PE8A 4DV1J 2E29A 4ZPTR 4EZ6A 3C6UB 2UXCJ 4F4ZA 2A1BA 4DI6A 5KT3A 1Q0NA 2J0QD 3LOUA 1WTFA 3H2LA 4NEZA 4ZPVR 3SSSA 2NPFA 2WVEA 4R5PA 1HMVA 3KKFA 4OHXA 4P9SA 2YWFA 1RCXB 4LFBF 4TYBA 3R5BA 3SQGB 2CDQA 4HI2A 5KFIA 4LVOP 1SJ3P 3DRSA 1Z1ZA 4ZHRA 2RNEA 1S0VA 3TUPA 2NR0A 2UVUA 4X4QA 3KHRA 2HGLA 3D6MB 4TY8A 3TA2A 1DY3A 4C11B 4AXIA 3W2WB 2DY9A 4EBCA 1KD1T 2GHPA 2MB0B 2K1RB 2HFUA 1OWXA 3BDPA 1VBYA 1X9SA 5JUMA 3BPDA 3PEHA 2HBRB 2GVZA 3WIUA 2IMWP 2MQMA 4BBYA 1OPZA 4C8MA 2MLZA 1WEYA 3KMSA 4DQRA 3RYLA 2UV8G 3ULHA 5B0BA 3O2IA 2XMUA 3DU5A 5J2NB 1CPZA 3ETMA 1HWUA 1ZZNA 3K17A 3BKTA 3M9OB 1EHWA 4LSLA 3PHTA 5LXYA 3EM1A 3QMQA 1NLKL 3I32A 2ASLA 3NAHA 5IOLA 1XC9A 2H3EB 3J80U 2NSBA 2YNFA 3KUGA 5BYQA 2P6SA 5HI7A 2V2VA 2XZTB 3BZQA 4PXDA 3OLAA 4ZLJA 1RWKB 4ZVOB 2HFZA 4WFZA 4OFZA 5CCMA 2ZH5A 3FBFA 5DDRC 2MLYA 2KXHA 1FNXH 3GV8B 5E3PA 2OPSB 4F4YA 1RT3A 4PAAA 4ED4A 4KV8A 4LF6J 3DMJB 4DN0A 1YDLA 2DB1A 5F8IA 3L4BC 4WFBQ 5KG6A 3HHEA 4OX8A 1G2EA 2HHXA 3IR5B 5DO2A 2ATLA 2XZWA 4URGA 4ELVA 3Q8RB 2HIYA 5KFTA 2W4PA 3OL8A 3J7Z5 2ALZA 4W4MA 1VRTB 4MIBA 5EN1A 2BQRA 1HBOA 3BN4A 3CB4A 2MKHA 5KT5A 5D4PA 4OZ2A 2ADCA 1AA1B 1RHKB 1S9EA 2E7WA 5KFMA 2J8SA 3MPDA 1H7XA 1YJ7A 1GH8A 5K8NA 1UAWA 2XTJP 5CABA 4NLVA 1WF2A 3GWCA 4F26A 5IQQA 2VA3A 4DV7J 3ZTOA 2H54B 4JI1J 1R8CA 3IRXB 3NNAA 3GE9A 2HFSA 2J6UA 1W2IA 4DFMA 2NXJA 2N4CA 4A48A 4A8MP 3W5YA 4OZ0A 4DFPA 4LSNA 2UU9F 3HX9A 2PSZA 1IXKA 5ETVA 3TYTA 1UVLA 2B7BB 1KTQA 3PFEA 3Q8QB 5HLFA 4KGKA 4LRFA 5HMWA 2IM3A 4PUOA 3AB4B 5AE1A 1BQNA 1NK9A 1WC6A 1CEZA 1I3OB 3V6DA 3RB6A 2NUHA 4M95A 4WK1A 3AXKA 4PQUA 3T19A 1WG5A 2VPYB 1JKHB 3EUNA 2JVOA 4KY3A 4ECYA 2XS5A 3ET6B 4WP9A 5K8PA 4HTJA 1YK9A 4OZ1A 1C2PA 5KFHA 3NWRA 2UUWA 3DOLA 2KG0A 4LF7F 1RT5A 4RNFA 1WC5A 2FJDB 4G1QA 1WSVA 2J6TA 4F0KA 2HWIA 4CWBA 1S9FA 1L3KA 2KM8B 2R7WA 4CZCA 1VDHA 3MMBB 1B70B 2CAJA 1NZ8A 1OYEA 3HLUA 1Y7PA 2J9EA 2LEAA 3ITHB 1K0VA 1G4CA 4FBTA 4DLGA 1N34F 4KPYA 1U1MA 4FXWA 4HI1A 3HD2A 3EVOA 4WZQA 4Y28C 2UXBJ 4FDFA 5EDWA 5DG7A 4JB8B 3K5LA 3JSYA 1YRTA 3TOQA 4EBEA 2Z8QA 2DNOA 3FRZA 9ATCB 2V4RA 4WFAQ 5DDOC 4UF4A 1URNA 3JYTB 1OY6A 3DLGB 2JFKA 2B3TB 2VBZA 2EFPA 3PX4A 4LIWA 1VRUB 1BWVA 5KFXA 1NH8A 4AXJA 5IV4A 2KKHA 2BRKA 4XIUA 3KJVB 3HVAA 2MKIA 3OL7A 4RW6A 2P9GA 2IYIA 4OI1A 2XI2A 3CMAS 4DS5A 2WONA 3KLEA 1KKHA 3LH2S 1HARA 1TL3A 3DRYA 2IPOB 4NPOA 2XSJA 1JLCA 1FEHA 4J5OA 4HL9A 3VAMA 4HH1A 4DPXA 4MYUA 2NXCA 4RWWA 2IY5B 5LJ5Y 5ETRA 1V5VA 3RB0A 2K8GA 3BS9A 4RUBA 3F73A 1RK8A 2CQHA 5D3GB 3QZ7A 1JLQA 4DL0C 1R8PA 1KVIA 3HVWA 4LRCA 4WCEQ 2BJDA 2QL7B 1RAGB 1RAAB 2R42A 4OJ3A 3N01A 1OS5A 5GMDA 4RR5A 3DFEA 2BJ7A 3CC2S 3L3CA 3M1VA 2ZZTA 2IBOA 5KG1A 4P52A 4B3RF 2CJKA 1HQUA 1YJVA 3MM7A 1XJWB 3MEDA 4MIAA 1FJCA 1EETB 3AXMA 3R6GB 4RBVA 3K0JA 1S77D 4ETXA 4I4BA 2WSEC 2PGCA 4TU9A 2RDDA 1BLUA 1FRJA 4UQTA 1IKVA 4I68A 1YKWA 3RJMB 5CAAA 3B6BA 5G0RB 4KKOA 1RQ0A 2F8MA 4DR3J 2HAIA 3UDLA 1HNWJ 3H5YA 3OR2A 4P2MA 3SDEB 1VBXA 8ATCB 3H98A 1P27B 1YJWS 4OIXA 2AF6A 2XS7A 1WHVA 2GJIA 3JSRA 2AD9A 3KYLA 2CQGA 2I8EA 4CLTA 2FC8A 2HLUA 3KLIA 3CJ8A 2PI5A 3MEGB 4Z7CA 2W7AA 2YNHB 4FVMA 1HBMA 1S1WB 3CCSS 4JI5J 3S6EA 2AGOA 3MR7A 5HVFA 3D3BJ 2V68A 2DIUA 2OO4A 1VQ5S 3TQEA 4ZPWR 2WB1D 1M1GA 3BBCA 1H74A 2H9ZA 2CPHA 3V6JA 3K5MA 2ZD1A 2DGSA 2VG6B 2EEYA 1R0CB 4F50A 1EARA 1CSJA 1RKIA 2CQ3A 1IKWB 2ZH4A 5AT1B 2GVDB 4Y3CA 2EPIA 3DLJA 4KQZA 4LF5J 3OFEA 1PC4A 4OI3A 3PRBA 1NMEB 1KRPA 2RS2A 2VASA 1FDAA 5A8WB 4MFBB 3Q86A 2BW2A 1Y11A 3IMQJ 2M70A 1X4BA 4F36A 4WBFA 2BZ2A 3ILLA 3ADAC 5DQIA 4CLPA 1U1RA 2R7RA 4NL5A 4GVBA 4I7FB 1R7IA 2QA4G 4Z7YA 4J7CA 4QBUA 3UR3C 2ZKTA 2M2BA 1WTBA 3Q2TC 3L09A 1RT2A 2MKCA 3M9NB 2XO6A 2MZTA 4PWUA 3CCZA 2KN4A 1F9HA 2HVDA 5I3PA 3DN9A 4Y2MA 5A0YA 3O8WA 4Q0BA 1VIXA 3KWMA 2HNYB 1WHXA 4C3MA 2YNIA 1DQ9A 1IKXA 3F41A 5L8RC 1S99A 2RJZA 2YPZA 3DRSB 4QOTA 2VC0A 4B3SJ 2HNZA 3MR2A 4DXLA 3BR9A 3D6TB 2IAJA 3BJYA 1UW9A 4DPWA 1BWEA 3D4JA 1YI2S 3W66A 3CJTA 3D28A 4ECTA 2VQEJ 4I6YA 4EWTA 2PMWA 4TLQA 4YS2A 2LXFA 3I4PA 1VJWA 3L7UA 2V4JB 4MT1A 1QDUB 3OQ2A 4ELTA 2Y1IA 2QLBB 3H7HB 4NLUA 2B9WA 4H4MB 3EZOA 4K59A 3P49B 4I2PA 2W25A 3FZBA 4ECSA 1RBLA 3PEJA 3R5DA 1HNVB 3QLHB 3NNHA 3KNGA 2M8DB 3Q8YA 1HQ2A 1S7IA 3H20A 3M2UB 1GK8A 2OI2A 2CFXA 2DVIA 2JRSA 4IUFA 3P6YC 4IG0B 2WSCC 1CULB 4DF4A 2FZCB 2JDJA 3MECB 3CJ0A 1EKSA 1CLFA 4YY3J 3QSYB 1UFWA 3VWSA 3NP5A 4X4VA 1C1CB 2BDPA 3PR5B 1N32J 1SH3A 4MK8A 4LR8A 2W2OP 3EGNA 4U7UD 4ALZA 1FFSB 2JLFA 2L9NA 3G6ES 3S1TA 4L72B 1XMQF 1U2RA 2QSWA 1C1BB 4ZVTB 3QAEA 4PEOA 1S10A 1QSSA 1LFPA 1D8YA 1RT3B 1U2CA 3ZZRA 2AX1A 4ZP8A 4CTAA 5THWA 1M0SA 3QJJA 1NDKA 3R2DJ 4EYHB 1B99A 2KVIA 2CNLB 2MKKA 3MPYA 2XNRA 4LIRA 5LMUF 3G2XA 1B3TA 2XYGB 5J1PA 3NS7B 4C9DA 2DR5A 1UMJA 4ID8A 1NH7A 1U25A 5ETPA 2V50A 4P75A 2FPHX 5F8HA 1HBOB 2BKPA 5JVHQ 1HR0J 2YX7A 3QFHA 3AQPA 5E3RA 1RT1A 2BJ8A 1ZZFA 1S9EB 3JAMY 3M32B 4EUVA 5KG5A 2OD4A 2ZDOA 4ICLB 2WTFA 2RSQA 2BJ3A 5I42A 3GZ7A 4A8QA 1FTCA 3DGPB 4J9OA 2HFVA 1K1QA 3N9UC 4OHYA 2RRBA 3GCXP 1G1XA 4MYTA 2LQ8A 2HURA 1FRLA 1VISA 1YVFA 1SC1B 4D3HA 1DTTA 2EKYA 3PJ9A 3AJDA 5GAEU 3W64A 3NNCA 4F02A 2DEJA 4F3QA 2ROEA 1SI9A 3TUIC 3FEZA 3D68A 4OZNA 3VHQA 2PC6A 2ZITA 4Y2KA 4UUXA 1TKTB 1VQLS 3V6DB 3RRHA 2V6AA 2BANB 4WYLA 2E1PA 2FGOA 4DL7A 2H1YA 3K57A 1RWOB 1SJFA 3E2EA 2AJ1A 4R0JA 4A8WA 2VC1A 3JSBA 4NYPA 4JOUA 1Y10A 3NG8A 3MMAB 3MEKA 3QT7A 1F5BA 4OZJA 5A8RA 4IDKA 1N52B 3DOLB 1VQOS 1RT5B 3V5RA 1UPPA 4NZ7A 2FY8A 4M5IA 3IAM9 5HQ8A 1HWJA 4M5GA 4G1QB 3WX4A 5E7OB 1ITPA 2CQIA 5M2UA 1VC5A 2PA8D 2O3DA 1FE4A 3GSIA 1T95A 1RWNB 4ECVA 4YOEA 4BLGA 3QT6A 4WFYA 1T05B 4EZ9A 2BKNA 2ZBCA 4NCGB 3NXZA 3PZPA 4CI0B 1UCNA 2CYYA 3CIZA 4C8YA 5CCLA 1RT7A 3L7PA 2C3UA 5SZTA 4F8RA 5D0GA 1FDBA 2W7PA 5GAGU 3IWXA 2JWNA 4MAKA 2ZJPQ 4DV4F 2DGWA 3OT9A 2VDIA 2F65A 4IRCA 3RTVA 1HLWA 2F9JA 4J9KA 4B9VA 4CH7A 4X4TA 1RJJA 3AODA 2HZVA 4W92B 1Q5YA 4QPTA 1T0TV 3VR1A 3TVYA 4DX7A 3M6UA 1U2FA 2KT3A 1YJRA 3IWLA 1NKEA 4USWA 2ZH3A 1HNXF 3SSRA 4ED5A 1GNKA 1FWLA 1MN7A 1U45A 2KRRA 2DGUA 5C25A 3ZTSA 4CQ1A 4ZIVA 1U1QA 5E3QA 1YHQS 2BMBA 5IWAF 2VDHA 2VH7A 1S1UB 3LANA 2DKOB 2RT3A 3FBBA 2E5LJ 2WONB 2XYPB 3HFKA 1S7HA 2J7KA 2J8AA 1R8AA 1RA6A 3H2UB 5KG3A 3I55S 3Q22A 1KFDA 3MCMA 1FXDA 1RKJA 3I6PA 4FF1A 2RQ4A 1UVJA 3C15A 3OXFA 3TUZC 4L74A 5B09A 4DS4A 2V2QA 4FPIA 2AP6A 2V63A 4DX5A 5BJRA 5BXIA 2B56A 1HD0A 1JXVA 1JLQB 4MH8A 1RAHB 4EYIB 3O5TB 2RS8A 3T3FA 1VC0A 3LF0A 2MJUA 5KFBA 1CJUA 4FNIA 2N82B 4WKYA 4GKKJ 2QA1A 4UOHA 3J7YU 2XSFA 4YB7A 3KDNA 1RWUA 3DNCA 2W24A 2IJRA 3NBPA 1FJ7A 2VUGA 2QIFA 3MM7B 1KQSR 3FNNA 3MEDB 2I5JB 2C2RA 3KMQA 2EFNA 1QY7A 2MHNA 3BYRA 3JS9A 4ZIWA 2BQUA 4A46A 2XBPA 3GIRA 1V3SA 3QO9A 3M2VA 5I4MA 2J6SA 5JJBA 1RYRA 2IRUA 4DBQA 1E6YA 1Q79A 4CP5A 3LAMA 4O3PA 4IR1A 4P2SA 2KH9A 2FQQB 5B0EA 2MGZA 2MSTA 3OR2B 4ZLPA 2UV8A 3KTQA 4J9SA 3AJ2A 4X64F 4DV2J 4L75A 1JLAA 5E5NA 2WW4A 5HMZA 4FF4A 2DNLA 2OH2A 2DR6A 1GAOA 1TV6A 2M5YA 1HBMB 3TRGA 1AW0A 3C6TA 5L38A 3MI7X 5E33A 3RZAA 4IRKA 1HBUB 2DNRA 2MTLA 1LXJA 3T1HJ 3D67A 1S49A 3R9LA 4ID5A 2Y8YA 4PABA 2W01A 1BQMB 4RW8A 2W8KA 1SC4B 2E5JA 1HI1A 4DR6F 3AAWB 4CO1A 5D77A 1BHNA 4ILMA 3CJQA 3ZO7A 3MTJA 3W9IA 4QIEA 2HWTA 3BGOP 4U95A 1GXUA 2MZSA 1N33F 3BEGB 1TMMA 3BYPA 1XMOF 3BGRA 3BSOA 1QJHA 4OJ1A 4DG1A 1TK8A 1TL7A 4EK2A 1ELOA 4JP8A 4QWDA 1S0NA 4ZCKA 3I0RA 2DNMA 4FS2A 2DXEA 5U47A 3IR7B 2Q66A 3J80Y 3N6MA 1UZDA 1U1NA 3T1YF 4LBPA 4H4OA 3CCVS 5AXMA 1DARA 2A18A 4CLFA 2AJQA 3KLFB 2IC3A 2Z2MA 3V4IA 2EWHA 4Q0BB 2DNZA 5DG8A 4FN5A 4IH5A 4AT1B 2X1AA 2DNQA 4AQYJ 1IKXB 1ZM9A 3THVA 2EK1A 2AU0A 2OPQA 5D4NA 3P8BB 1BC6A 4KPCA 1O0PA 2B5JA 2RRAA 4NLGA 2M0GB 3K59A 4K4YA 1N8RT 3T41A 4ZP7A 2BR0A 5F8GA 3CXCR 3CCES 1WEZA 4RW9A 2RRNA 3PV8A 3H42A 1JLEB 1O51A 1W7WA 2RIJA 1FVQA 1UJ6A 1NK7A 3OVBA 4QWBA 1RT6A 5H9FJ 1RSCA 2EI5A 3IWNC 4I2PB 3OFFA 1FVSA 1U0HA 1EKRA 2MHEA 4TNOA 4HYKA 3GFHA 1AUDA 1KHWA 2YX1A 1YRXA 2XHCA 2RU9A 3C16A 5CQGA 3OW2R 3UD5A 3ZC4A 3O3LA 3BN7A 1B0VA 1HNZJ 1D1UA 4EI2A 1CC8A 4IOBA 1NJXA 2LQJA 4LRBA 3IM8A 1CJKB 2YKMB 3V81A 4UY85 3DXBA 1LWXA 1IKYA 1N5QA 3DLHA 3G8QA 5CYQA 2ZNYA 4X66F 3HSDA 1S76D 1R6YA 1PBUA 1RWVB 2OJ3A 3OLBA 4E8UA 3OVSA 3MMCA 3EDQB 1LOUA 2CPEA 1KC8T 3H4DA 4F25A 3IG1B 1LV5A 4B9SA 1S9GB 2MQNA 2CQ2A 3DLLQ 2FJEB 1EQMA 3P5TL 4B3MJ 1YJTA 2Z57B 4PYDA 2R7VA 2JC0A 1T03A 2N3LA 4ZOSA 3BSNA 1F9FA 3LTOA 2DCLA 1WKKA 2VFSA 2ILZA 3OTOJ 4DSIA 2L9DA 4OYAA 2AZ1A 3PRVA 1TKZA 1WJ9A 4Q7AA 1UP1A 2DTJA 1H2TZ 4MKYA 1SQFA 1RT1B 3SQOP 2AKWB 3QGGA 4MJKA 3PYDA 4DPYA 3KXDA 1YQHA 3ZNJ1 3PW0A 2J0XA 3DYAB 4HDHA 2JEJA 2M52A 1Q8KA 4KB7A 2VL1A 5I42B 2WOMB 2E1CA 2P9EA 3FDSA 3B78A 3BF4A 3G6VA 2HVEA 1DZ5A 5C2CA 2YKPA 1K44A 2GAHC 1S6UA 4IOCQ 4F0HA 4BWMA 3RRGA 1PYOB 2YBVA 1NPRA 1S1XB 3MGJA 1KHVA 1QSYA 3TNVA 1SVDA 1Q95G 1QAIA 2AX0A 4ITSA 4ILLA 1VI7A 1U49A 1NHKL 2FVQA 4CNZA 2V8HA 1B4SA 4Y2IA 3DM2B 2H4YB 4LFAJ 1LEOA 2YKQA 2B51A 1X5SA 3D2WA 4TLRA 3TX0A 2H5IB 3TUJC 2W7OA 5CA5A 2IVFB 4LQ3A 4K7QA 2EFVA 1S1TA 3IBFB 3R97A 3WBZA 4RNNA 3DGVA 4KE5A 2BOAA 2O67A 4ZVRB 4DL4A 3KHLA 4IDKB 2E9ZA 1CJVA 4NYZA 3D1OA 1GQEA 1UKUA 4JI7F 1S1VB 2FD2A 1SJQA 3JTOA 1VCTA 4OYPA 4HLBA 4UZCA 1G7CB 1MLAA 4LF4J 3CD0A 1S0OA 2HQDA 2DNPA 1R8BA 3DKDA 2KZZA 3QT5A 3EDRB 2KI2A 2Y0BB 2ROGA 2HHHJ 2ILYA 5KFGA 4QR1A 1A7GE 1I94F 2C3MA 3HHNB 1XMBA 3QQCD 4YR0A 3MAHA 4ATNA 4GRSA 4ZA1A 1WC1A 1DJ0A 1KQKA 4JBCA 4PXBA 2BEFA 3BV8A 4M5NA 1P6TA 4FKYA 4LUBA 4B9NA 4M5KA 5HROA 1RHJB 3KLGA 4RPFA 2M9KA 2C2OB 3IBCB 3RW7A 3ZZTA 1ZTTA 2IVYA 3C6UA 3JB9k 3HI9A 3RAXA 1RXOB 3M6XA 5AXLA 2G2YA 1C0TB 3MCNA 2GMHA 3CC7S 4LBIA 3GMGA 2C22A 4UOFA 2B43A 3KUHA 4YMEA 2CG8A 2V94A 3QGHA 3DCAA 5E0OA 2FZKB 1R0BG 2X7IA 4Y6IA 3H5UA 1PILA 1YG0A 2KFNA 3JSMB 4DFJA 3SQGA 1X5TA 3MUVP 5EWGA 5EWEA 2HMIB 1Q78A 4KFBB 4WF9Q 3MXHP 4DU8A 2O1PA 2DD8S 2CQ4A 4WJBA 4BWJA 2RHSB 3PHEA 4EFAC 2LCWA 4RLEA 4W90B 2C3YA 3K5OA 3W2WA 2YXLA 3C15B 2B7CB 1KOHA 2K06A 4R8UB 4LF9J 2K1RA 1FDNA 3TQ1A 1Q5VA 3KFWX 4B17A 2R8GA 3CJKB 4DV6J 5H9EJ 3W9JA 2FJWA 1FJGJ 3CE8A 4NXNJ 2GMLA 2B6AB 3PG9A 1GMVA 4CM2A 1NPKA 4U67Q 4PG4A 4U7UK 3IS9B 3Q89A 5J2NA 1RU1A 3VAIA 3THTA 1WHWA 5SUHA 1JLGB 1H0HB 4I0WA 1JQGA 3PACA 2QN6B 3NBPB 3HK2A 5HJXA 2JZ5A 4ZJOA 4BHQA 3RBEA 3DU6A 3KK2A 2KVQE 1YBAA 5J2MA 1U7LA 3M2VB 2IM2A 2J7WA 2MZQA 2OSRA 3TAPA 2WVFA 5LOQA 4NWBA 3L9ZA 4YHHJ 5F41A 4QIGA 4F7VA 1NEEA 1T3OA 2MGZB 2OUGA 1U02A 4UQGA 3DDIA 3BREA 1NO8A 5ETMA 4F4XA 2DGVA 4WU3A 4K0KF 2ZBQA 1PSDA 1AFIA 4IH7A 4DOZA 2XB2D 3HT3A 1MMLA 5CYMA 1J5OA 3C6TB 4C8KA 1H3DA 3A8KA 1TELA 2V67A 4B3OB 4AL7A 4WE1A 4KT0C 4EEYA 2QEXS 2XMWA 4M5HA 1LW2B 3I87A 1VRTA 2M7SA 3T5HA 5KFAA 4AD6A 1ZA2B 3BBBA 3FK4A 1K0TA 4A8FA 3BQ0A 2EK6A 3N79A 2OGUA 2UUAF 3W3SA 2B4PA 1PGZA 4IO1A 3E8OA 1HPZB 2Q1LA 2AMCB 2OSQA 4EO6A 1KSPA 3O1LA 1T8EA 4OLOA 3BGRB 1UVNA 4NLTA 4DF8A 3UCZP 3H2VE 3CMQA 4DCPB 4MK7A 2ALYB 4RBTA 3IRXA 3KDOA 8RUCA 1NU4A 4M1KA 4PG8A 4CT9A 5KG0A 3AD9C 5AE3A 3IBWA 5B0DA 4G1PA 1MWYA 4J9QA 1UJ4A 2HHVA 4DMZA 4LFBJ 4Z2XA 1PAEX 4B3TF 4S0MA 4GKJF 1XR6A 1VQ7S 2K2PA 5H9FK 2OFGX 1N5YB 4QIWD 2YNGB 4FVCA 3R7BB 1FJEB 4JI3F 4CH0S 1PKUA 1JKHA 2VOPA 2DYAA 2B5JB 3R5AA 5EWFA 2ACYA 2QJ3A 1P1TA 3BQ1A 5IZHA 2ZFHA 2G2OA 1RGVA 1VJQA 2E44A 4PR6A 4RW9B 1SL2A 2C28A 2KG1A 2BX6A 2AJ2A 4H54A 4ED7A 2VF3A 2GW8A 1XERA 4KHRA 3PYFA 4GO7X 1RT6B 2ZH7A 2ZC4A 3JAMU 4LFCF 1TAQA 3DOMA 5D4LA 4I69A 3ENQA 2UUBF 3HSJA 3MMBA 2ATCB 2ZOMA 3FC9A 4KIAA 3HDSA 4PQAA 1LWFA 3Q8PB 1YJNS 1LWCB 4PKDB 4QW8A 3ISND 1FNOA 1YX2A 5T7LB 5KG7A 4HACA 1K9MT 1RADB 2DIVA 3PJXA 1WOOA 3HXMA 1Y9OA 3W61A 2ZEJA 2DRAA 3CD7A 1T3NA 2DNYA 3N6NA 3LO3A 1N36F 4DX6A 4QQBA 2FTRA 1WDDA 4ZITA 4F4WA 3AFGA 1SV5B 1V9OA 1LW0A 3LP2A 3SBMA 1JJ4A 4RUCA 5F9LA 4NRTA 3DLGA 3VZIA 2E9TA 1EB0A 4C6AA 2MSSA 3M8QB 2HS0A 2HK3A 1VRUA 2E5GA 2FLLA 2Y0SD 1VFJA 5DG9A 1RBAA 3DC2A 2F1FA 1RHQB 5DS7A 2L3MA 3KJVA 1T03B 1WF1A 1C0UB 2HLTA 3OFHA 2WVCA 3OTEA 2LQBA 3QSIA 3UD3P 5HK4A 3NCQA 4IOAQ 4K4TA 1JJHA 2BRLA 5LSRA 4B9UA 1TKZB 4DV3F 1OJ4A 3PM9A 1RWWB 3GFZA 1YJUA 1B64A 4CO2A 1LKZA 3G86A 4Y34A 2MQLA 2FC9A 1IBLJ 4RWXA 2VFTA 3MPWA 1JX4A 2H4WB 1RAIB 3IGNA 1L3VA 3LGHA 4ES3A 1XK8A 2KU7A 5D3GA 4A8YA 1P9YA 5T41A 2I6WA 2ZUGA 5IT4A 4JI6F 4DFKA 1MW7A 2UU9J 3OV7A 4DEZA 2LA4A 3AD8C 2VG7A 2HSEB 3BB5A 5DGBA 2MXYA 3HZGA 2FZGB 4OYXA 4NXMJ 5DZ6A 1AYEA 1Q81T 4TU7A 2QC3A 2WZ1A 2HYIB 4DPUA 2NXUA 3LALA 3MMJA 3MM9B 1EETA 2JLGA 1RT4B 2AV5A 3K2YA 1PBAA 1X4DA 3CJ2A 3MWBA 4CO0A 2B9EA 4IQMA 3OL9A 2CIMA 5KFSA 4X4RA 2AW0A 4LF7J 1RTDB 2A6MA 2IM1A 4XAKA 3BR8A 3DLBA 3SDEA 2DRDA 3D0HE 4FKXA 2CRLA 4I56A 1QTNB 3AA8A 1FA0A 1Q53A 4LR9A 3DI6A 1VHIA 3AOBA 2B8PA 2QA4S 3VF0B 3MEGA 2YNHA 3UWTA 3CCRS 1S1WA 2F3JA 2VA2A 2GIRA 2FJAB 3IFEA 2QZ8A 1I6JA 3N28A 4O3OA 5A6PA 4DPOA 3NKYA 4DWIA 2X1BA 2J9CA 1N34J 2FVSA 2CPXA 2XI3A 5B0GA 2OFHX 1R43A 1UL3A 1RTIA 1WACA 4YUDA 2J7UA 3CDBA 4DV0F 1IKWA 1RP5A 1V3RA 2GVDA 4OJHA 1YZ6A 2QE5A 4HH0A 1IUJA 1Q82T 3GFYA 2WW8A 4FYXB 2FLPA 4F04B 1R8HA 4U7CA 2BXJA 3R3TA 3MTKA 2VFUA 5HROB 4QU7A 1H2UX 3KLGB 4X62F 5A8WA 2BJ1A 3TAMB 1LK7A 2OEMA 1AUSL 3M8YA 4OHVA 4PPZA 5GMKa 4WWSA 3CEDA 4KYZA 3MAQA 3KLHA 4UTGA 3LWLA 4I7FA 1BY9A 2FYXA 2HS4A 2OLWA 5F8NA 5F0WA 3CO0P 5C42B 3D6HB 2YY3A 3M30B 4KHPF 3HZEA 4I64A 2X1FA 2VJVA 2XMVA 4RUAA 1QAXA 1H7WA 1TUWA 2GMJA 3G6XA 1NDCA 2HNYA 1EX8A 4RBUA 3CNQP 2G0JA 3CCJS 3KK3A 4DQPA 3GCWP 2VJUA 2R8HA 1KVJA 2JFDA 4ANCA 3UVJB 3UNGC 5FJ4A 3GPAA 2ZHOA 2XWYA 3ZXWA 5ETNA 2DPJA 5LJ3Y 5M2RA 2DJWA 3QIDA 2DH9A 2V8VA 2NS1B 4YR2A 1J5EF 1NSKL 4DDFA 2FVCA 2QFJA 4CLZA 2UZAA 1S6PB 2V4JA 3KJFB 1JK9B 3IR6B 4CNYA 2DH7A 3EMTA 3HFZB 1SKUB 4H4MA 3E3XA 4K4WA 2WVDA 1REVB 1SPBP 1UFLA 3NEKA 2DEIA 1VLOA 1HNVA 3QLHA 3VAFA 3J81Y 2IMOA 4B3RJ 1FEEA 4I67A 2XG8A 3K58A 3M2UA 4F0MA 1WI8A 4KRWA 4IG0A 1LQ9A 3HMJG 1CULA 1W26A 2L48A 5KTQA 2WBRA 3HVTB 3MECA 1WG1A 4URQU 3DRPA 3NGDA 4N56A 2QL5B 3KK2B 3EICA 3Q24A 1C1CA 2HEKA 2CPJA 3VGUA 5J2MB 3UD4P 2ZHBA 3AH6A 3MHYA 2CNOB 1YBUA 2KT2A 3PTWA 4ZKAA 2V69A 3Q8SB 3PO5A 1Z2LA 4Q8EA 2R7SA 2ROPA 4J90A 2ZJQQ 4DL2A 1I1GA 2YWHA 3EZUA 1C1BA 5KAKA 1Q4RA 3IN5A 3C2PA 4Y0FA 2A10A 5LSLA 3I4HX 1FD8A 2F4VF 5K8MA 2WSFC 3QIPB 3T1AA 3GTYX 5CYMB 3OJUA 1J5OB 2PEHA 2Z0GA 3ELHA 3W60A 2GO9A 4RW4B 3NOGA 3TZWA 5F8LA 4WE1B 1YLXA 2DHGA 5H1SV 3OHAA 2DNKA 2HK2A 4DSJA 5J2PB 2AYEA 1IN0A 1N6QB 3M6WA 4I2QA 2Z2ZA 2CVEA 3Q8VA 2MY7A 1UVIA 4PXCA 4XPEA 4DCJB 6FD1A 4JV1A 2IJNA 3M32A 2LDYA 3B82A 1WC4A 3I9ZA 4MMOA 1JMTA 2R8IA 2D9PA 4ICLA 4CLKA 3GG0A 3W65A 3RB4A 2NXEA 2R7XA 3DGPA 1WEXA 1IBLF 4DUZF 3C3LA 4M8LA 3E01A 3TJ9A 3LAKA 2UUCF 2OPRB 4PRFA 4RUHA 3TEGA 4DUYF 1GMUA 5KFUA 3D66A 2Z2LA 1NB7A 2HGNA 3M8WA 4G65A 2RU3A 4DR5J 3V2UC 1R0AB 4UY8T 2HQCA 3AT1B 2JH3A 2LVWA 4A47A 2MY8A 2R2UA 5M2PA 2VV5A 4JV5F 3MD3A 4ZN1A 1IWGA 1NUEA 3HHLC 2RUSA 3M8ZA 2Y1JA 4NXMF 4Q8FA 3JTNA 2PO4A 1TKTA 2BANA 4M5LA 5K20B 4WZMA 2CG4A 3HHLA 3A12A 1KBRA 4QWEA 2MKYA 4I6WA 3US5A 3MDFA 2KFYA 4Y2AA 2E1AA 4USMA 2I38A 3K5NA 3VQSA 4W98A 4LRDA 1U6BA 2KYZA 3MMAA 4RJVA 5DZ7A 3MM5A 2ZBRA 1Y3JA 3PX0A 2XY7A 1RTJB 2HAFA 1TUGB 1FWPA 4RW7B 3LPEA 2G13A 2AT1B 3HSGA 2V4QA 2RDIA 3CDWA 1WD6A 1LWEB 3DOMB 2CPIA 1YJ9S 3X1LB 3THPA 1T05A 1CQNA 1ACMB 4NCGA 2E1MC 2GX8A 1OO0B 1LWFB 4TXSA 2DHAA 1SKWA 4YB1P 2V2KA 4V1Ak 4HACB 3OBIA 3G6YA 3TANA 2MDAA 1JJCB 1YITS 1RA7A 4OX6A 4RNMA 3QGPA 2GC8A 1MWZA 5L1IA 2E7XA 4B08A 3DLEA 3FSXA 3S01A 1XMQJ 2DCUB 1FF2A 1LW0B 3LP2B 5DGAA 2VICA 3M2RB 4C3KA 1TL1A 4PWWA 3HF5A 1EP4B 2U1AA 2IJFA 3RBDA 4CLYA 2HRTA 3CULA 1BE4A 1ZA1B 3RAMA 4O3NA 2OPPB 5LMUJ 4OZ5A 5J1EA 7FDRA 5J2QB 1S1UA 5HP1B 2C2MB 1XNRF 4KGXB 4Q45A 4NCAA 3I96A 4FP9A 2YKNB 3FSYA 5HVGA 2GGPB 3KHHA 4IFVB 1PCAA 4LSZB 5IC6B 4C2MA 4CIOA 3HJVA 1PG5B 3ICLA 4K4VA 4ZPBA 5KFKA 3QNWB 3B8HA 1Q7YT 3G82A 1S57A 2G1HA 1HHTP 3V6HA 2HW3A 1D9FA 4F2SA 1ZTWA 4P10A 3PO4A 1NJZA 5A8KA 5ETKA 4J37A 2QMUB 2X1GA 2XHWA 3KG4A 3M8PB 4CDIA 4OV1A 3CGIA 3SCLE 2MQPA 2XS2A 4TY9A 5ETOA 4HEA9 5K14B 3SI8A 2AYMA 1L3UA 2VG7B 5HBMA 2HHSA 2H51B 4GC6A 1S4EA 2F9DA 1MROA 1M1HA 4C3LA 1X4GA 2QMXA 3QWUA 2AZ3A 5IC4B 3HHDA 4YDDB 4PPDA 2OTJS 1X31C 1PJ6A 3IXQA 2I5JA 3PW5A 4BS2A 5BR8F 3CWJA 1Y4ZB 3EYZA 2NZCA 4ZLNA 4ZVFA 3IO1A 1Q16B 3LA0A 2PMHA 3OXLA 3LGNA 4CLLA 4Q2LA 4K2JA 4DR7F 3CW2C 4OYWA 5KFDA 1NPPA 2HQ3A 4WIIA 4DQSA 3DI6B 2DO0A 1XN9A 4M5MA 2MEWA 3W8GA 4C8ZA 3U1MA 3DHXA 5GADI 5DLFA 2MMYA 1HBUA 2WRMA 3NL0A 5L39A 1CJTB 1ZM4A 3I5BA 2W2PP 1OY8A 1BQMA 4IKAA 1TFYA 3GQCA 5CZVA 5HO4A 3FCWA 2YH0A 2BJEA 3AY0A 2G1DA 1RTIB 1VYAA 4DV4J 2DGTA 1S6QA 3VAGA 4O3RA 2V0NA 1D9AA 4AL6A 1HQEB 4XTTA 1U24A 1IBKF 1KN6A 2BKOA 4KH1B 3HM9A 3H40A 4K4ZA 1NNDA 2PEBA 1QVGR 4FBUA 4ZP6A 3W2VA 3OUYA 2DPIA 3BKUA 3TZYA 4TYAA 2XMMA 1Q8LA 4I1TA 1CVJA 1HNXJ 1BUXA 2QX0A 2V8GA 5B0FA 2OEJA 2BUNA 1RISA 3JTPA 3RUBL 3KLHB 2VG5A 3SSQA 3RB3A 3JQJA 3OPKA 1MNEA 4WFNQ 2EG2A 1SC6A 3H5SA 2OP5A 3P45B 2CKWA 3NGRA 4DR5F 1ZPWX 2CQ1A 5IWAJ 3BSCA 4NASA 5KT4A 4H4KC 2HNDA 2Q43A 3KLFA 4YR3A 3CIMA 4X65F 4UT4A 3A8IA 1P1LA 1HI0P 2MQ8A 3GILA 1BQXA 3QRPA 4USTA 2JVRA 2VFRA 4LF8F 1A6LA 3MEEA 2ZH6A 4C8LA 1JJ2R 1WC0A 4H4KA 3KK3B 1VOMA 3JQMA 2F8HA 4OX9F 2PT0A 4LR7A 2BJ9A 1SL1A 5LMNF 2COLA 1B7YB 3UQSA 3HP6A 4USVA 1Y5LB 1JLEA 2OMLA 3FSIA 3GV7B 1KS2A 1UEUA 2FHOB 1IBMF 3PIOQ 2KFZA 3SEOA 2KHDA 2CZ9A 2VKRA 3D5MA 3PCOB 4USIA 3SFGA 2ZM6F 2AWZA 3GYNA 4JI4F 1GEHA 4P73A 3U27A 2RKIA 1CC7A 2R7QA 4KGVB 2KRBA 4RZRA 2U2FA 5IM0B 3POTB 1TTHB 4DQQA 5GAHU 2YQ1A 1S0MA 5D0HA 4HT7A 3G4SS 3CDUA 3FEXB 1TQLA 3DRPB 4P7TA 1WUUA 3KLVA 1MU2B 5KFEA 4IFYB 1CJKA 2YKMA 2GJ2A 5B0AA 1FTRA 1JLBB 2OKQA 3CDAA 2M88A 1NK8A 2LYVA 2FY1A 4X64J 2G0CA 1VQSA 2YPYA 1SUQA 4XK8C 1RWXB 4F2RA 4WXOA 1FXLA 4USKA 3ILJA 2PMZD 3GR0A 4UW2A 2DXFA 1R89A 3MR3A 3GB0A 3IG1A 3NY0A 3FQLA 1S9GA 4JI0F 3KUEA 1SQEA 4M5DB 4DR1F 4ED8A 4DSFA 4TN2A 2LXIA 4F4AA 1VQPS 3MUMP 1BMQB 4DR6J 1ZAVA 3I31A 4DR4F 4DV5F 4WP8A 4I2QB 1R27B 3AA9A 1N33J 1JWWA 5DDQC 1XMOJ 2YKAA 3CD6S 1IQTA 3R7SB 3DOKB 4GVLA 3PKYA 4JI8F 2KJVA 4KHMA 2LFVA 3DYAA 4QIFA 2XNQA 2KB2A 4FNHA 2W2NP 2WOMA 3EVWA 2HBYB 1UPMB 3ZTRA 3E01B 4FPRA 1X0PA 1YSJA 5CD4A 3T1YJ 1F5CA 1VIOA 1S1XA 3IGVA 2WBMA 4HDGA 2HKEA 2FJXA 4QIVA 1FK9B 2AJFE 2YQ0A 3Q0AA 1VHFA 1HW9A 4C48A 1IR0A 1R31A 3F0NA 1HKAA 4O44A 2OD6A 3QFWA 1KDNA 3NLCA 4DX8H 2VQFF 3DM2A 2BM0A 2DBBA 3FQKA 3BPSP 2QYCA 4KAIA 5JXSA 3HHLB 3CJRA 1HW8A 1VC6A 4ZDNA 1K47A 4CM0A 1M1KT 2PD1A 3MR6A 3A3OB 2VIHA 2CQDA 3VAHA 2GQ2A 3KHGA 3GJQB 2EXUA 3EGWB 3ETOA 3MM5B 3M4XA 3JQKA 3TAQA 1FO1A 6FDRA 1S1VA 1NSQA 2CPFA 3CJ3A 5C24B 3SMZA 5K9FA 1X4AA 1GFWB 3MCOA 1TK5A 3OL6A 1TVRB 4QU6A 5CXTA 4C97A 2XC9A 2XMKA 1RTZA 4PG7A 4RNOA 1NHVA 4OV6A 1TKXB 3J81j 2G9OA 1U0SA 3NCPA 1G6BA 4L73A 2AEMA 2W9CB 3D1HA 2APOA 1FDDA 3MUTP 3UCGA 2DNGA 2V5HG 1X4EA 2P5VA 1FRXA 2DGQA 4C8OA 4X66J 1HBNB 1FRKA 1IWAA 4NMLA 3DLEB 3OSNA 2GV1A 1S79A 1W25A 2BQ3A 4DN9A 4NLQA 4JV0A 4I6AA 5GAHI 2DNNA 1Z4UA
chains in the Genus database with same CATH topology
3FMWA 5IM0A 3S6EA 3POTA 3HPOA 2DHSA 1FJEB 2AGOA 4CH0S 4JI3F 3VAJA 1JKHA 4AL5A 2VOPA 2B5JB 3R5AA 1TL1B 3UE2A 2OAUA 5EWFA 2ACYA 2DIUA 2OO4A 3MOZA 1FKPB 1VQ5S 1P1TA 3BDEA 4ZPWR 1GTHA 5L9XA 3BQ1A 2Z4PA 2WB1D 5IZHA 4RU2A 4JYAF 1C0TA 2E5IA 1T7PA 2H9ZA 2ZFHA 4A8KA 1RGVA 2CPHA 3V6JA 3SCKE 5KFYA 2ZVSA 4R25A 1HA1A 3K5MA 2ZD1A 3QGIA 2DGSA 3SV4A 1DTTB 2E44A 3QWPA 4WTYA 4PR6A 2VG6B 4RW9B 4G3IA 1SL2A 3S8SA 1LXNA 4ZPDA 2C28A 2HRUA 2KG1A 5F8JA 3CJ5A 3M6VA 4F50A 1MU2A 2CVIA 4IFYA 5L1JA 1CSJA 1RKIA 2JSXA 2DR7A 1UETA 2CQ3A 4H54A 4ED7A 1IKWB 1JLBA 2EFQA 5AJ3F 2ZH4A 2GW8A 4NOHA 5J1EB 1PO6A 1ZAXA 3JSMA 4Y3CA 1OPIA 4KJIA 3NS5A 2EPIA 3DLJA 4GKKF 1XERA 4KHRA 1N0VC 2EC0A 2HWHA 2J9DA 4GO7X 4KQZA 5LL6d 1RT6B 1WF0A 3OFEA 2FUG9 1PC4A 2ZH7A 1G3OA 4OI3A 3ZZOA 3PRBA 2ZC4A 4C0OC 4QZVB 2HMIA 1TAQA 2RILA 3DOMA 4I69A 5D4LA 1KRPA 2V9WA 4LFCF 1XNQF 3ENQA 2VASA 4KFBA 4RU9A 2RS2A 2UUBF 1FDAA 3ENVA 3MMBA 1X4HA 2PDAA 5A8WB 2C42A 2ZOMA 4MFBB 3PXGa 3I0SB 3N5BA 2DT9A 2CPDA 2BW2A 2J9DE 4KIAA 1VQ8S 1RYSA 4IO9Q 1GXLA 1M5SA 4KR0B 4MIWA 3HDSA 4PQAA 4ED0A 2M70A 2JJ4D 3CPWR 1X4BA 1LWFA 1RI7A 3C66A 3Q8PB 1YJNS 2BZ2A 1LWCB 3N5FA 4M5DA 2ZKUA 4PKDB 4QW8A 5DQIA 3ISND 2CQ0A 1FNOA 4R8UA 4B9LA 2ASYA 3OTCA 5T7LB 1XEZA 1U1RA 5KG7A 3PR4A 2R7RA 2J0WA 4NL5A 4I7FB 1R7IA 2QA4G 1K9MT 2DIVA 3PJXA 1HWKA 4QBUA 3UR3C 3HXMA 2ZKTA 2M2BA 1WTBA 3Q2TC 3T6BA 4C8NA 5A8KB 4IQXA 5A8RB 3KNAA 1Y9OA 3L09A 3CJKA 4EU0A 1RT2A 2DRAA 2MKCA 5KFRA 3M9NB 3ZZUA 4P6QA 3CD7A 1T3NA 2E66A 2MZTA 4EBDA 2DNYA 4PWUA 3CCZA 3N6NA 2KN4A 5I3PA 3DN9A 4Y2MA 1N48A 3LO3A 1N36F 5I3QA 1FXRA 1LK5A 1IQZA 3OSPA 2B6AA 5A0YA 3O8WA 4QQBA 4DV2F 1NKCA 1VIXA 2FTRA 3KWMA 4Q0BA 4F4WA 2HNYB 5A6WA 1WHXA 4C3MA 4IR9A 2YNIA 1DQ9A 1SV5B 1LW0A 1V9OA 3D0GE 3LP2A 1JJ4A 4RUCA 5F9LA 1IKXA 5KFQA 3T9ZA 4NRTA 5HBMB 3F41A 4V19X 3DLGA 5L8RC 1S99A 2RJZA 1SIZA 3VZIA 3IS9A 2E9TA 4ETZA 4X2BA 3DRSB 1PC5A 4QOTA 2RVJA 2VC0A 2CQBA 2AYBA 1MROB 2ZJRQ 4PXEA 2MSSA 2HNZA 4NLYA 3M8QB 2FGCA 3IA0A 2HS0A 1JLGA 1YIJS 3MR2A 3DOKA 4DSLA 1VRUA 4NA3A 2E5GA 2IHR1 3BR9A 2WAQD 2XGQA 3RW6A 1URRA 2IAJA 3BJYA 2FLLA 2Y0SD 4DR2F 1M5KC 3FJ2A 1VFJA 1BWEA 1YI2S 5DG9A 3DC2A 3T1HF 2F1FA 3D28A 3K8VA 4ECTA 5DS7A 1RT7B 2UUTA 1OQ3A 2E5HA 2L3MA 4YEAA 4FF2A 4J9PA 3KJVA 5IXUA 2Q3PA 3ZFVA 1T03B 1WF1A 1C0UB 4AYBD 5EUHA 4I6YA 1GX5A 4RX6A 1ZOTA 2HLTA 3OFHA 4EWTA 4TLQA 3NRBA 4PWDB 4JI2F 2LXFA 3I4PA 1VJWA 2I2YA 2V4JB 3OTEA 3SV3A 1N5SA 3D1QA 2KXNB 1VMBA 1GX6A 2LQBA 3K7RA 3OQ2A 4ELTA 2Y1IA 1U48A 3UD3P 4NLUA 2B9WA 5DQGA 3NCQA 4H4MB 3V6KA 4IOAQ 1QE1B 4K4TA 4K59A 1JJHA 1RAJA 2BRLA 1FK9A 2B9YA 3VCDA 4XO0A 5LSRA 4B9UA 3P49B 1TKZB 4I2PA 2DGOA 2W25A 1NK5A 2D3UA 3FZBA 3DRRA 4HVZA 3PIPQ 4ECSA 5MAOA 4ZPCA 3PEJA 3R5DA 1HNVB 4DV3F 3QLHB 1TFWA 3NNHA 3PM9A 3BO3A 4F67A 2R2TA 3KNGA 2M8DB 3F56A 2MJNA 1Q86T 4N77A 3D54A 1KEKA 3N6LA 3H20A 3GFZA 1YJUA 3M2UB 2CFXA 2DVIA 4CO2A 1B64A 2JRSA 4IUFA 3P6YC 1LKZA 1AXQA 3G86A 4IG0B 4Y34A 2MQLA 4V19J 2FC9A 3TVZA 3BSAA 4RWXA 2WSCC 1Q1KA 2VFTA 2YWGA 3BGFA 3MPWA 3OXGA 1JX4A 2DITA 3FMBA 5B0CA 3CCQS 1XBWA 1X4CA 3R1HA 4DF4A 3RR7A 3T5LA 1Q8BA 1Q8IA 4FYDA 2JDJA 3MECB 3IGNA 4ZCIA 1L3VA 1N88A 2AJ4A 1YWXA 3CJ0A 1CLFA 4ES3A 1XK8A 5C25B 2R8JA 1DHMA 5GADU 1UFWA 4K4SA 2KU7A 2WHOA 3V4MA 3VWSA 4ZVEA 4B3OA 3NP5A 5D3GA 2RE1A 2NREA 4X4VA 4QJVA 1B7FA 3GR1A 1C1CB 2POKA 4QPXA 4A8YA 2CQPA 5T41A 4U9RA 2BDPA 1NK0A 3PR5B 1DAXA 2ZUGA 5IT4A 4HT5A 4JI6F 4O0IA 2RQCA 4DFKA 1MW7A 1SJRA 1SH3A 4MK8A 3EGNA 1LW2A 3MD1A 1XR5A 4WXWA 2LA4A 4DEZA 3OV7A 1JLFA 2VG7A 4ALZA 3UW1A 5F9NA 1TR0A 3BB5A 2JLFA 5D78A 2L9NA 3DDKA 5DGBA 3G6ES 3NMRA 3S1TA 4L72B 2B4OA 1X8DA 4OMFG 3P96A 1XMQF 2MXYA 3HZGA 1U2RA 1S6QB 2QSWA 5C24A 1MMNA 1YTYA 5CH7B 3CCUS 1C1BB 2DR9A 1VQ6S 3QAEA 1HPZA 5BYRA 4AQYF 1S10A 1Q81T 3C46A 4TU7A 1QSSA 2B4VA 2HYIB 1LFPA 4Y00A 1U6FA 3B4MA 5JVGQ 1D8YA 1RT3B 1TVRA 2ZHAA 1UVMA 1NKBA 2JEFA 3GIIA 2NXUA 2BV3A 4C11A 3LALA 3MMJA 5J1NA 3MM9B 3ZZRA 2AX1A 2K7KA 2R7OA 4DL6A 4OL8A 1Q7LB 1B0PA 4MK9A 3W2VB 3OUYB 4ZP8A 4CTAA 2EG1A 5THWA 1M0SA 1EETA 3CCMS 3QJJA 3CTRA 2JLGA 1RT4B 4EYHB 2RF2A 2AV5A 1DQAA 1TKXA 2KVIA 4N41A 3K2YA 1UEVA 1X4DA 2PIIA 3CJ2A 1KQFB 1UW4A 3NGKA 4N5SA 3MWBA 2MKKA 2D9OA 3QZ8A 1VQNS 3OTBA 2PFFB 4CO0A 3MPYA 2AJ0A 3UI3A 3IAS9 3PW7A 4IQMA 1BD6A 2W9CA 3BGLA 2CIMA 4O4RA 3OL9A 3DLKB 2VZ9A 5KFSA 2YVSA 2VG5B 2XNRA 4X4RA 4LIRA 2AW0A 4NCBA 5LMUF 1RTDB 5KFWA 2NUUG 2NYIA 1D0EA 4N47A 5E3CA 2XGPA 3TW0A 1TUVA 1DURA 5J1PA 1D8ZA 2WB4A 4C9DA 3N0VA 2FB0A 2IM1A 4XAKA 3BR8A 5EX3A 3SDEA 2DR5A 3DLBA 3D0HE 2CRLA 1N54B 1UMJA 4I56A 3T5JA 3FFIB 1NH7A 1U25A 1FNMA 4ID8A 3BQ2A 2FPHX 5F8HA 1HBOB 1HBNA 2QO3A 3HHLD 4Q2MA 5E2QA 5JVHQ 5AE2A 3AA8A 3IC1A 2DRBA 2YX7A 2DK2A 2IRYA 1FA0A 1Q53A 2HNDB 3AQPA 2ERRA 5E3RA 2M3DA 3DI6A 2JL9A 3L7OA 1RT1A 2QA4S 4ECQA 2N4DA 2J0SD 4ED6A 1ZZFA 2FVPA 1S9EB 3VF0B 1HYSB 3MEGA 3JAMY 2BOPA 3M32B 1U1PA 2D41A 3T5KA 4EUVA 2YNHA 3QAUA 5EX0A 3UWTA 5KG5A 4YDXA 2OD4A 2ZDOA 2EBGA 1S1WA 3CCRS 4ICLB 2F3JA 1N5YA 2VA2A 2GIRA 2WTFA 2FJAB 2RSQA 3CDEA 3IFEA 4DV1F 5C5JA 3MEEB 2ASDA 1VQYA 2QZ8A 2CZVC 2YNGA 3PJWA 5I42A 3GZ7A 1I6JA 3N28A 3R1LA 4O3OA 5A6PA 4K50A 2LMIA 4OX7A 3NKYA 4DPOA 4A8QA 2BA9A 4DWIA 4F3OA 1FTCA 2UXCF 2GQQA 2KO1A 1H38A 2LU1A 4J9OA 4FF3A 3SYZA 3P3DA 2X1BA 4NLXA 2J9CA 2HFOA 3KK1B 2FVSA 2CPXA 4OI2A 1K1QA 3N9UC 3F44A 2LEPA 4OHYA 3MM8A 2RRBA 1HNZF 3QO9B 2XI3A 3B4DA 1S4FA 3CCWA 3SCIE 1G1XA 4MYTA 3MURP 1X5OA 5B0GA 3FGVA 1E6YB 2OFHX 1FRLA 2ASJA 3ZZ0A 1YVFA 4M94A 4B9SA 2HFNA 4D3HA 3MF5A 1DTTA 1R43A 1UL3A 2RQKA 3OR1B 4LJMA 1RTIA 1WACA 2EKYA 4XDCA 1GTEA 4YUDA 1JXEA 2J7UA 1P8GA 2QRRA 4O3QA 5GAEU 3CDBA 4DV0F 3NNCA 4F02A 4F3QA 3AQOA 2ROEA 1IKWA 4LVNP 1RP5A 1SI9A 1V3RA 3CCLS 3LP1B 3TUIC 4AUKA 4OJHA 4HH0A 2QE5A 2ZE2B 5KOXA 1IUJA 4KGMA 4J9RA 3FEZA 3VALA 1Q82T 3GFYA 2WW8A 4OZNA 2OPSA 3GYXB 1JXLA 2FLPA 2GNKA 1JLAB 1R8HA 4U7CA 2PC6A 4C0HA 5HN0A 2GA7A 5KFJA 2BXJA 3R3TA 2GIQA 2L9WA 3DMJA 2ZITA 3OFGA 3K5PA 3MTKA 4Y2KA 2VFUA 5HROB 4QU7A 4M63A 1TKTB 4UUXA 1H2UX 1VQLS 3KLGB 1TV6B 1CQMA 4X62F 5A8WA 2MPUA 2XLKA 3V6DB 3RRHA 2VODA 2BANB 3NCRA 3TAMB 3EGZA 1QUPA 3I0SA 2RKIB 3U1LA 1FKOA 1LK7A 4WYLA 2FGOA 2XCPA 5AXNA 4OHVA 4HHJA 4DL7A 1W2BR 1IM4A 2RH3A 5FD1A 1DFDA 4ECRA 2GHWA 3K57A 4PPZA 1SJFA 2UVVA 4B3MF 3E2EA 2AJ1A 5GMKa 2VBYA 4R0JA 3CEDA 4A8WA 1LWCA 2VC1A 1UVKA 3MAQA 3KLHA 4ID5B 1KNZA 3CO9A 4UUWA 5T7LA 3LWLA 3JSBA 3DDNA 4NYPA 4RW8B 4JOUA 3NG8A 1WNEA 4I7FA 3MMAB 3MEKA 1BY9A 1F5BA 4DSEA 1SKSA 2QLWA 4OZJA 4FBUA 2HS4A 2OLWA 5A8RA 4OI0A 4IDKA 1N52B 2GFFA 5F8NA 3DOLB 3CUNA 3EXCX 5F0WA 4Y65A 3OTOF 1VQOS 1RT5B 5C42B 2YY3A 3V5RA 3M30B 4KHPF 3HZEA 4I64A 2X1FA 2IFXA 5L9NA 2XMVA 4NZ7A 1SH2A 4IYQA 2R2SA 4RUAA 2IA6A 1B0TA 2Q6BA 5CHCB 2P6TA 3IAM9 5HQ8A 1QAXA 2HIQA 1H7WA 1HWJA 4G1QB 3PY8A 1N56A 2GMJA 3WX4A 3G6XA 5HMYA 5E7OB 2HNYA 2CQIA 5M2UA 1RDRA 2BE2B 1VC5A 2PA8D 4F3MA 1SV5A 1SUQB 2QMWA 1E6VB 4RBUA 2O3DA 1FE4A 3VAKA 4IG3A 1T95A 4TKTA 5KFZA 3CCJS 1NJIT 3KK3A 1U1KA 5DM7Q 4DG1B 4ECVA 4YOEA 2HZCA 4DQPA 3AHPA 2R8HA 1KVJA 2JFDA 4DLEA 3M8QA 2VONA 4WFYA 1T05B 3UNGC 4EZ9A 1VK8A 1O5JA 2GHVC 2L08A 2ZBCA 5D6GA 3CMES 5FJ4A