3BM7A

Crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
HHHENLYFQGMIGVVATLKVQPAKAAEFEKVFLDLAAKVKANEPGCLVYQLTRSKTEEGVYKVLELYASMDALKHHGGTDYFKAAGAAMGPTMAGAPVIEYLDAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein of unknown function with ferredoxin-like fold (NP_420935.1) from Caulobacter crescentus at 1.35 A resolution
rcsb
source organism Caulobacter crescentus
molecule tags Oxidoreductase
molecule keywords Protein of unknown function with ferredoxin-like fold
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bm7A00
1R6YA 1CC7A 1FVQA 2K7KA 3GZ7A 3CJKB 3KNGA 3HDSA 2LQBA 2RSQA 2ZDPA 3K7RA 1N5QA 1S6UA 1OPZA 1TL5A 5A6PA 4F67A 2G9OA 2L3MA 3I9ZA 2AJ1A 4HH1A 2GO8A 2HFNA 4HH0A 1VQSA 5B09A 2GV1A 5T7LA 1SI9A 3WDOA 1FEEA 5B0EA 2QLWA 3TRGA 4YEAA 2BJDA 2GFFA 3LGMA 1SB6A 3HHLA 2AP6A 2JDJA 2HLUA 4A47A 2OFGX 2OP5A 1X0PA 5B0BA 2XMVA 1YJRA 2FB0A 4DL0C 2FIUA 2Q3PA 1KVIA 2ASYA 4A48A 1APSA 2W4CA 5T7LB 2FTRA 1OQ3A 3F44A 2K2PA 2LXFA 2XMWA 1N5VA 1TZ0A 1Q53A 1FVSA 1Y3JA 2KYZA 4Q2LA 1Y3KA 1JK9B 2RMLA 1Q4RA 1YJTA 2ZDOA 3KKFA 3BR8A 5B0DA 1JWWA 3BM7A 2N4DA 2QYCA 2BUNA 2IYIA 3BDEA 2OFHX 4FNHA 2KKHA 2XMTA 1KVJA 2GA7A 1X8DA 4YDXA 2OAUA 3HFKA 3BF4A 4A46A 4HL9A 2GGPB 4NPOA 2FHMA 2LQ9A 2IFXA 2XMMA 3FGVA 2QIFA 4U9RA 1LQ9A 1OQ6A 4NL5A 3DXSX 4DN9A 5KAKA 3KG1A 5K9FA 4HI1A 1K0VA 3HHLD 2OKQA 3MZIA 1YJVA 2RU9A 4FNIA 2BYCA 2OD4A 5B08A 2GGPA 3VTIA 3MCSA 2HLTA 2W4DA 3E8OA 4EFAC 2VV5A 1TL4A 2N7YA 5IXUA 1XBWA 3BB5A 3HHLB 2PD1A 1AW0A 3HF5A 1URRA 1GXTA 2K7JA 3QGPA 3IWXA 4Q2MA 4Y2IA 2IYGA 5B0GA 1QUPA 3BN7A 3QMQA 5F0UA 1S6OA 2QLXA 1N5SA 3FRYA 1P8GA 2CRLA 3BGUA 2AW0A 3DCAA 2XMKA 4Y2MA 1YJUA 3T9NA 1YRXA 1RJJA 1WD6A 2HFOA 2OMOA 2XMJA 4OJGA 5F0WA 1SQEA 1FE4A 3KG0A 1W2IA 1KQKA 2BBEA 2XMUA 4ZOSA 1AFJA 3CJKA 3LO3A 2ROEA 2LDIA 1GXUA 4QOTA 1YG0A 1IUJA 2W4PA 4OJ3A 3TOQA 2AJ0A 2VH7A 1MWZA 1AFIA 5B0FA 1P6TA 2EW9A 5B0CA 1TR0A 4OIXA 3LGNA 5B0AA 1Y0HA 2KT3A 2GCFA 4HI2A 1OSDA 2KT2A 2HQIA 1ULRA 1TUVA 2RILA 1U7LA 4OJ1A 2ROPA 1N5TA 4Y2KA 1Q8BA 1FE0A 4ZA1A 5A6WA 1VQYA 2PGCA 1MWYA 1FESA 2OD6A 2K1RB 1CC8A 2N4CA 3FMBA 3TNVA 3IWLA 4A4JA 1FD8A 3HX9A 3HHLC 2HIQA 1X7VA 1CPZA 1Y9OA 2BJEA 3UDCA 1V3ZA 4OJHA 1Q8LA 2ACYA 2ROGA 4DPOA 2K1RA
chains in the Genus database with same CATH superfamily
1BD6A 1R6YA 3GIKA 5G4DA 2K7KA 2VBXA 3DOMB 1YGYA 2C42A 3T5LA 4DV4F 2CQ0A 3N9UC 2ERRA 2G4BA 3KNAA 2KZZA 3HSDA 5DLFA 4DU7A 4M94A 1OPZA 5AE2A 1H3DA 2RNEA 1NAQA 4H4OB 4ICLB 5CQGA 1ITPA 2HFSA 2AJ1A 1R89A 1S1XA 2HZCA 1T94A 3EZUA 1IKXB 3GFZA 5HBMA 5LM7E 2DNZA 3K17A 3VZHA 1OSCA 5F9NA 5LSLA 2ZH9A 1Q7YT 1RADB 4GKKJ 3JB9k 4LF7J 2DGXA 1REVA 2GIRA 3AQPA 2YWEA 5ETKA 3Q23A 1RKIA 4ED1A 4FYYB 2CFXA 1T03B 1SJ1A 1XEZA 1T7PA 3H0PA 4L72B 3OLAA 3OSNA 4DQIA 3NNHA 4JYAF 2ABYA 1QY7A 1XWLA 2F63A 2AF6A 3NAIA 2KM8C 5J2NB 2J0SD 3G86A 2FTRA 4CYUB 5LSOA 2KZMA 3GILA 1SKSA 4JI1F 4N47A 4FPIA 1IBCB 3QRPA 4F3OA 1IQZA 4M5DA 3KLEA 1ZS6A 2R2TA 5KT3A 1FNMA 4NRTA 1X5TA 2EEYA 2KL8A 2BUNA 3SCKE 4DFPA 2AYEA 2I2YA 3UCGA 2IY5B 4HEA9 3RG6A 3TAPA 1VI7A 4DSFA 4DCJB 3CJ4A 2RE1A 4HYKA 1KONA 3N4WA 4I2PA 4NPOA 2OH2A 1KSPA 2IFXA 5HJXA 1Q5YA 4TYAA 4H4KA 1LKZA 4KGXB 6AT1B 2EWHA 2F4VF 4ZMMA 3GV5B 1NH8A 5KOXA 1HW8A 2OKQA 3PIOQ 1S1VA 2HSEB 4OYAA 3Q8SB 1HPZA 3PX4A 4DSKA 4K50A 1OY8A 2HHUA 1LEOA 2KXFA 2HLTA 2Z4PA 4LR9A 3GIIA 3MXHP 3I6PA 4EFAC 2W9BB 3VAJA 4ILLA 4O3SA 3OR2A 1U2RA 5IXUA 4DV2J 1SV5A 2Y3YA 4DMZA 2DNYA 4ZPDA 2FVRA 5J1EA 2ZKTA 4J91A 3G8TA 4UF4A 4CDIA 2M9KA 3A3OB 1XC9A 2YKMA 4OV6A 5CYMB 1T9UA 4WWSA 2C2ZB 4X4TA 3Q8UA 4CH7A 1QDUB 2B6AA 2IJNA 2OI2A 4ECQA 4U8YA 2BDPA 1T9VA 4DN0A 4JI1J 4LF8J 2DRDA 4PPDA 3MFIA 3GMGA 3HJVA 3RGIA 3NGDA 3FSIA 1TU0B 3G6XA 2IMWP 5I42B 4LFBF 3KLGA 2RS8A 1EZZB 3K59A 4QIVA 3OFHA 3PW5A 4JI0J 2XMJA 3DLJA 3AXKA 4P75A 5J2NA 1RE1B 4QIWD 4X4PA 3A13A 3MM8B 3LP1A 3MI7X 3CJKA 2LLZA 1HBUA 3B4DA 3HSGA 4TU8A 4GKKF 4UQGA 4XDCA 1IJEB 1SJQA 3RBDA 1RWUA 2RJZA 2Y8WA 3VR1A 2DGOA 1WDTA 4CLFA 1FKOA 1N5YA 1M5KC 2KTQA 3QRQA 4YHHF 2GCFA 1OO0B 2DH8A 2KT2A 3W64A 4YR2A 5KT7A 1U8WA 1Q7LB 1EX8A 4AXJA 4NZ7A 2QEXS 4Q0BB 4KO0A 3M32B 5GADI 4XPCA 2P6SA 5K14B 4ECXA 1M5PC 3NKYA 5HAOA 1HYSA 1JXVA 1X9MA 3BQ1A 5K8OA 1FFGB 2RDIA 3MPWA 2MKHA 3M2VB 2V8PA 1ZTWA 3P8BB 4ZITA 4PWUA 2HIYA 3H4BA 1HHSA 2ALYB 2XO7A 4X4UA 3FMWA 3CJSA 2ROGA 4DZ6A 1BXNA 1TL7B 3NGRA 3NY0A 1JJ4A 1U1MA 1HW9A 1FRKA 1FDNA 1JLGA 4ZS6A 2QN6B 1YVFA 4O23A 3PZPA 2U2FA 1HLWA 2XHCA 3FSYA 3M2RA 4G1PA 4MYTA 1HYSB 3GFYA 2CPYA 2QC3A 2AV5A 2MSTA 3Q0AA 3HI9A 4RR5A 4E8UA 2QZ8A 2HEKA 2QX0A 4FF2A 4MIAA 4HH1A 4UOFA 4I64A 5CAAA 3EDQB 2KT5A 3A8EA 5HJYA 3PV8A 2W25A 1MW7A 3RB4A 3C46A 1IM4A 3NS6A 3LGMA 4OZ1A 2AP6A 2OFGX 4RBTA 5KTQA 1MMLA 1HNIA 3MF5A 1NSKL 3KK3B 1H2UX 1WF2A 3FCVA 1DQ8A 1O6XA 1WWHA 2VFTA 3DLKA 2A2CA 1YX2A 3FZBA 3H20A 4M5HA 5BYSA 1DAXA 4YHHJ 5CXTA 2UVUA 1TZ0A 4KC5A 2HQ3A 3T1HF 1R8CA 1RBAA 1RTZA 1TFYA 2KG0A 3P96A 1JJ2R 4G3IA 3CDAA 3IBWA 3R3TA 2A0FB 2QYCA 4CH0S 3MEGB 2QLBB 1VC6A 3TUIC 1BQXA 3GFXA 4I0WA 5AXMA 4CO2A 1HD1A 3V2UC 4CLUA 3AODA 1VQKS 2HGNA 5KFYA 1N52B 1RAEB 2MLYA 2OAUA 3PFEA 1HNVB 1S9GB 4M1KA 5J1EB 5F8MA 4KR0B 4DR2F 4HL9A 3GJQB 5LJ5Y 1NK8A 3HULA 1KKHA 1VOMA 3BYPA 1UWBA 3IMQJ 4ID8A 2KG1A 2W9BA 4C8KA 3Q2TC 2Z8QA 1R31A 1UVIA 1UJ4A 4M5IA 4MTPA 4DV3F 5E3QA 1K44A 4FZVA 4C11B 1WKJA 2ZE2B 5L46A 5KT2A 4PG4A 2Q6CA 5IZHA 1S10A 3E2EA 2BYCA 1CS4B 1VRTA 3QWUA 3EDRB 3OTBA 2AIRB 1CQNA 2B9XA 4ZP8A 1VRQC 3OTCA 3BB5A 1BQNA 4A8FA 4LF9F 4R5PB 1XNRJ 3IM8A 1T9WA 1WKKA 4Y34A 4Q2MA 4USKA 2R2RA 4F4YA 4ANDA 4OYIA 3R5BA 4B9LA 2WCXA 3UVJB 3K5NA 3AD9C 1X5OA 3FBFA 4USVA 5D15A 3SIPB 4EWTA 4ZJQA 4G1QB 3ISND 3K57A 3PRDA 4O44A 4J9RA 1WTFA 2ZNZA 2F4VJ 4Y2MA 2N3LA 1XK8A 3CW2C 5ETPA 3DLGB 1J2VA 1F60B 1WD6A 5DO2A 3JS9A 3HHNB 2CQ2A 1JKHA 2WRMA 1WHYA 3PM9A 2HFVA 4EI2A 2BBEA 2CPXA 4X4VA 1VBXA 2UXDJ 2GIFA 2DJWA 5HLFB 1GH8A 3GIMA 1SKUB 3CCVS 1GXUA 4ALZA 1T03A 3ENVA 2NR0A 1OYEA 2BE2A 2J9EA 1KOOA 3CDEA 3P45B 1HARA 5HLFA 3W8PA 1CJKA 1MWZA 3DM2A 1MSWD 2YX4A 4P10A 4WE1A 1J27A 2CQ4A 4P7TA 1ZOTA 1N36J 1WTBA 3I87A 4PUOA 5D4NA 3NCQA 3MM6B 2DY1A 2MGZB 3GONA 3HVWA 4DV5J 3CVKA 2HVDA 2LYVA 4WF9Q 3MMCB 2FC8A 2J0XA 1WEXA 4I1TA 3F56A 3OBIA 1RCXB 3QT6A 1TK8A 2PGCA 2YWHA 1XMOF 3DOKB 1SC4B 5KFZA 5H9EJ 3GG0A 3MPVA 3H40A 2VQEJ 1WKLA 2OEMA 3G2XA 4UW2A 1HQUB 3R9LA 5JVHQ 5D8HB 1V5IB 4LF6F 1VC5A 4DEZA 3BSAA 1FX2A 4OJHA 3MAAB 2EC2A 3LP0B 3HD2A 3B54A 2DNQA 4AD6A 3ILJA 1S7HA 2HFZA 1XTZA 3ZTOA 4UUXA 4E98A 3HT3A 4J90A 3K0JA 1T3NA 3Q89A 1KQFB 1N34F 5DQGA 2X1FA 3KJVB 3FQKA 1C0UB 3M2UA 4OHWA 2Q66A 1TKXB 4ZVOB 3WDOA 5T14A 3C6UB 3G6VA 2D7SA 5B0EA 2N7CA 2R8IA 1UPPA 4RNFA 2FLLA 1IM6A 1UA0A 1WF1A 4CO3A 1HBNA 5J2MA 2GVDB 2J6UA 4RPFA 4R0JA 2HHVA 3OR1B 4OYXA 3SBMA 4DL0C 2E5JA 2IM2A 4NMLA 2YKPA 4AYBD 4B3TJ 3ZZTA 1AUSL 1E6YB 2B4PA 4B3RF 4HKQA 1U26A 3G96A 3OL8A 1M0SA 1Q79A 1S9EA 2RF2B 4RUCA 2RU3A 1G7CB 1WG4A 1CJVB 1E6YA 2ZWPA 3AJDA 3CJ5A 5GVQA 4D3HA 2ASDA 4DQPA 3TO8A 2M52A 5C25A 3OFEA 1IBLJ 2JEFA 4WZMA 4NLSA 5FDLA 3OT9A 3ZO7A 2GVDA 3KKFA 5DG8A 3KK1B 1JLBA 2R2SA 3NMAA 1U1LA 2XWXA 3JQJA 1NJWA 2OPPA 2HKEA 1FWKA 3EGVA 2VA3A 5M2RA 2GHVC 2L41A 3O6QA 1U1RA 4B3SF 3I0RA 4URSA 3VAFA 2V4RA 2F4FA 4MJKA 4GC7A 3D2WA 5HO4A 1WC3A 5KFOA 2WONB 4LF8F 3CO0P 4RW8A 1J5OA 4WZQA 3GV8B 2ZH4A 3L3CA 2QV6A 4ZPTR 3ZZUA 5E41A 3CEDA 1OJ4A 2M88A 3FZ2A 1MNEA 2B4VA 2QGFB 1OYDA 3Q8VA 3WC2A 1EARA 3DN9A 4DSJA 3QT7A 1C0TA 2DPJA 3H98A 2KXHA 2BM1A 3BSOA 2OJ3A 3R8YA 4E0DA 1NBEB 2E44A 2DR8A 3W2VA 3LAKA 4WIIA 3EX7B 4L74A 4AE5A 1KNZA 1RHUB 2VFUA 4OHXA 3CMES 4C8LA 1C1CB 3W5XA 2OEJA 3IG1A 2EBGA 4M5NA 2OELA 4LF6J 1JLFB 3BN7A 2VG7A 2RH3A 3QMQA 3W61A 3HM9A 2J8AA 3PKYA 3VAKA 5DG7A 4DI6A 2I0XA 2GVZA 4CLTA 2YNIB 4PYAA 4IG3A 3DCAA 2VD3A 1F6TA 2WAQD 1VQ8S 4PUOB 5KT4A 4WP9A 2YNGA 3PW4A 1PBAA 3W65A 1F1BB 1FE4A 3NBPA 3HT0A 2JJ4D 3S8SA 3V6DA 1HBMA 1AFJA 4PXBA 2XYPB 3R5JB 4DX6A 4OLPA 5EWEA 2W9AA 3Q8QB 3OD2A 1ACMB 4USUA 3NAHA 5LOQA 4Q8FA 4GC6A 4RBVA 2MYFA 4MKAA 3OTOJ 2XC9A 1ZZNA 3DRSA 8RUCA 2O3DA 1TAUA 3ZTSA 2JRSA 5KFEA 4ZP9A 3AA8A 2XMAA 2VZ9A 4I6AA 4NLOA 5HVFA 1VDHA 3CDUA 2E1PA 2E5IA 3I55S 1KHVA 2AJQA 1FESA 1HBOB 4DV1J 2MKYA 1QUVA 2DEIA 2NYIA 2DB1A 2GAGC 2CPEA 3OXFA 5CCLA 4EBDA 1I6JA 3ZZPA 4F3QA 1C1CA 1HWLA 4RWXA 5KFLA 4NLTA 2PFDA 3TA2A 2XHWA 3QZ8A 2BKNA 5J2PA 4YS2A 2GQ2A 4KE5A 4NCBA 3DLEB 3G87A 1FXRA 3C6TA 3M4XA 5J2PB 2LQBA 3K7RA 4RW6B 5DLGA 1X4BA 2GMJA 1RLCL 1RAIB 1TL5A 2QSWA 4OI4A 1D8YA 2KXNB 1AZSB 1WUUA 4BDPA 3GWCA 2FJAB 3BS9A 1RA7A 5IV4A 2UXDF 1JNZB 1SI9A 1ZZFA 5KFWA 3TA1A 4TU9A 1S6QB 2ATCB 1QSYA 1TFWA 3IWNC 1F2GA 4RZRA 3A12A 4MT1A 4RJVA 3SDEB 2X7IA 4C8OA 2KRRA 2ZVIA 2PA3A 2P9EA 3MAQA 2BACA 3R5GA 5IT9Y 2F5GA 4DPYA 1NK6A 1JLBB 3UI3A 5T7LB 1SH2A 4YR0A 2F65A 3KK3A 2DRAA 2IIHA 2XMWA 4P71A 3GSDA 2MKKA 1FVSA 1HNIB 3CD5A 2DNNA 1Q5VA 2DGUA 1VISA 4XTTA 3SSSA 3SV4A 4OX6A 4LF9J 1FK9B 4IOCQ 4FS2A 1V9OA 3CGIA 5ETVA 3CDBA 1FHTA 2FVCA 1RTHA 3JXOA 1LW2A 1LWFA 4DV0F 1DURA 3H7HB 1L3UA 3FRZA 3I4PA 1FRMA 2PMHA 4H4MB 5A8WB 2OSRA 4CWBA 3MR3A 5BR8J 2LQ9A 2V63A 2YNFA 3AHPA 3I96A 1N4LA 3TZWA 2MY8A 2AJ2A 3GE9A 4FYWB 4C8NA 4Y0FA 4JV1A 1P1LA 4K4VA 1CEZA 3HZEA 4DPTA 1C0UA 3M2UB 3TX0A 4KV8B 3VTIA 3IG1B 3NCRA 1WDDA 1H0HB 4N7TA 3RR8A 1KDNA 2R9LA 1FNOA 3Q86A 1XJWB 4IO1A 2H4WB 4LR7A 2J9DA 4IG0A 5IWAF 2XGQA 2B9YA 3G6YA 2ZBQA 3UDLA 4PRFA 3LW5C 3EJMA 2JEJA 3KLVA 4KHPJ 1U02A 2P9GA 1DQ9A 4XO0A 4F8RA 1BWEA 3K5LA 4QWCA 3CCJS 1U2FA 1QVFR 2V94A 3D68A 3MUVP 2KO1A 4NCGA 4RU2A 1QLNA 2P8IA 4A8MP 1YRXA 2SXLA 1WHXA 1FRXA 3PTWA 1D09B 1R27B 3J7Z5 3I0RB 3P6YC 3VVTA 4W90B 1N5YB 2YNHA 1R3NA 2W2MP 2LKZA 2LDYA 1L3KA 4YY3J 1CQMA 5A0YA 3TA0A 3MOJB 3PXGa 5IT9U 5E3CA 1RZMA 3MR6A 1HBUB 5JMNA 2LEPA 5U47A 3H2LA 3ET6B 4C4WA 2D9OA 4QIEA 5IS2A 1JLCB 4OL8A 1Y0HA 1H7WA 1VIOA 4LQ9A 2XSJA 4OJ1A 3RRHA 2Y1IA 1VCTA 4NA2A 1ZM4A 4UZBA 1C4AA 3D6MB 3IBCB 2RQCA 2JEGA 1FRHA 1Q8BA 4QIFA 1UMJA 3OR1A 4WU2A 2OPSB 3B82A 3T6BA 3TZXA 2MHEA 2Q1LA 1AYEA 2FYXA 1UJ6A 4RLEA 4BLGA 2JLGA 4ECWA 4IH5A 1NB2A 3IGVA 2FGOA 3TUZC 1JB0C 1VJWA 2EFPA 1PAUB 3FMBA 1F2HA 4USHA 3PYEA 2E9RX 2VFRA 1HIYA 3VGTA 5LMNJ 3BSCA 2WSFC 5LMUF 2XY7A 3AT1B 4Y2AA 3OR2B 2LU2A 1U4BA 3UDCA 1Y00A 3MR7A 2FJVA 1KWMA 2OTJS 1S6QA 1PG5B 2KRBA 1HPZB 2NPIA 3IAS9 5IQQA 4JI8F 3RAQA 2CQIA 1I94F 2OPRA 4K7QA 2UU9J 1U6BA 4QYZK 1AZSA 3ZNJ1 5HMXA 4PG5A 1X4EA 1SUQB 2I5JA 2ZKUA 3CCSS 1VQ6S 1F0XA 3LWLA 3CXCR 2PI5A 4K0KF 1Q0NA 2QYGA 3O2IA 4UOCA 4C0HA 3BN4A 1VQSA 1O51A 1RAJA 3FC9A 4KHRA 1ZAWA 5IM0A 1RTIB 5D0EA 2QLWA 3BREA 1R6VA 4L76A 1FRIA 4CQ1A 3DOLB 3AB2B 3HHLA 4WKYA 1X4DA 4QWAA 4JI7J 4ZDNA 1TV6B 2MXYA 2OP5A 3MPYA 1UP1A 5A8KA 4Q44A 4ETXA 4X4QA 2X1BA 1BGXT 1NK5A 2MGZA 3UCZP 2HMIA 1IKYA 4OHYA 2ASYA 4ZHRA 2ZITA 2MY7A 3VHQA 2DHSA 4B17A 1A9NB 4CLLA 1RKJA 2LQ5A 4MK7A 1NKBA 1VFJA 2XLKA 1XNQJ 2R7UA 3K8VA 4LFCF 4OZ2A 1Y3KA 3TVZA 3IM9A 4N76A 4F7VA 4NLDA 1VGYA 1D0EA 1ZYQA 1UL3A 1RTJA 2Y1RI 5GAHI 4F4ZA 1JKHB 3AA9A 4LF7F 3G4SS 2FHMA 3CIZA 4ICLA 3SMZA 5BYQA 5ITHA 3HFVA 5H9EK 3U1NA 1G6BA 1BQMB 2QIFA 5KFHA 1HQ2A 4DL6A 1FJEB 3I0SB 2VC1A 3W66A 1KEKA 4X64F 2BE9B 1OIAA 3D4JA 3HK2A 2J8SA 4EGLA 1WEZA 2KU7A 4LRAA 7FD1A 3M2RB 2DGTA 3MR5A 3V81A 2V0NA 2O1PA 2MJNA 2YXLA 2C3UA 4IH7A 1XBWA 4GO5X 2N82B 2UXCJ 2VOOA 2BJ9A 3HF5A 1VBZA 4X4NA 2EK1A 3QGPA 2ZH6A 1RT5B 2WZ1A 2R7VA 1UFLA 3HZGA 4DV0J 4OQJA 3RRGA 1M1GA 4Y00A 3SFGA 4DL5A 1ZAXA 1HL6A 3FEYB 3QIPB 2ZOFA 2QL5B 1M1HA 4LSLB 4OYPA 2OTLS 3C2PA 4UOGA 3GJSB 5THWA 2Z57B 3T9NA 1T11A 4KIAA 5KFXA 3NNAA 3KG4A 2ZH7A 1NDCA 5DETA 2LEBA 4FKXA 1K1QA 3VVUA 2EVZA 4LUBA 1IBLF 1YRUA 2VASA 3VV2B 1JLQB 1C2PA 4TLRA 2BW7A 2JVRA 2PEHA 4FXVA 4CT8A 2ZH5A 2DO4A 2DHGA 3Q8YA 4B02A 4ZCKA 2AJ0A 3EZOA 1AFIA 4YB6A 2XULA 4ZPVR 4ZCIA 1V6HA 1N0VC 2DIVA 2VDIA 5HROA 4W98A 1Q86T 2DNKA 2RRBA 2Z2MA 4HLBA 2L9WA 5EX0A 1LNQA 3IRXB 3MM7B 3Q83A 4PXEA 4C8YA 4LFBJ 3QT8A 3VGSA 1CLFA 4MFBA 2ZBIA 1W7WA 1U1PA 1H2TZ 2CJQA 3R6GB 2C2DA 2FLPA 4WXWA 3TUPA 4PG6A 3TYTA 5HN0A 4ED8A 1N34J 5L1LA 3KWMA 4O4RA 4ZPBA 2VIHA 3FCHA 4DPXA 4FS1A 3NNCA 2HHTA 2KHDA 4GMKA 1A7GE 2AX0A 1GAOA 4IFVA 4AQYF 3BKUA 4IYQA 1F9EB 3BJYA 2R8JA 1SJFA 3M8QA 1B0PA 3NP5A 3GV7B 4EBEA 4KFBB 3Q24A 1XMBA 2QLFB 2HFUA 4ZP7A 4DPOA 4YEAA 4DPUA 1UVJA 2KFNA 3S01A 3S6EA 5M2UA 2FDNA 4YP3A 3PG9A 1Z1ZA 4CNYA 2KN4A 2RDJA 4KBIA 4P52A 1LWCB 3BBFA 2B3TB 2G9OA 1X9WA 3G82A 2E7WA 3J7ZT 1M5HA 3LA0A 2BJ3A 1YZ7A 2ZUAA 1DTQA 1RT5A 2CWXA 1TUWA 2NYHA 2YX7A 3CO9A 4ZVQB 1IN0A 4QQBA 3SQGB 1FEEA 2NZCA 4TKTA 3U1MA 4IUFA 2ZH1A 4WYLA 5GMEA 3NOCA 2CUYA 1E6VA 2P6TA 2IM3A 4U7UK 3MMBB 2Y0BB 4DV6J 1RT3A 2X3DA 2CPJA 5HP1B 1S7IA 5B0BA 1N36F 1RB0A 1X4GA 1RT6B 3GPAA 5K20B 1Q8KA 4UOHA 3K89A 1U2CA 4RU9A 3J81Y 2DIUA 4OZ5A 2HHPA 3BBBA 2ZHAA 2IAJB 3L7PA 1H2VZ 1OQ3A 1WSRA 2EG1A 3N6NA 5GAGU 2HHHJ 4ZKAA 2YWKA 1Q53A 4LRFA 3V4MA 2QMWA 3J7YI 5K8PA 3BO2A 3GTYX 1J5EJ 4DR3J 4EO6A 5FLXY 2CA9A 3CD7A 3D6HB 4K4ZA 4J9UE 1OS5A 2OFHX 2YKOA 1F9FA 3LP1B 3BPDA 4JUZA 3BGLA 2D3OR 4P74A 4LF1A 3M1VA 3CT9A 3WC0A 3EICA 2QMUB 4TY9A 1S79A 2GGPB 2GZOA 3A3NB 4UTGA 4LSZB 5ETLA 4ZVPB 4LVOP 5AE1A 3OVSA 4ECTA 4P2XA 1HQEA 1QSSA 3QATA 2MJUA 1AUDA 4NCAA 3M8SA 4NEZA 4NL5A 4ZLPA 4CIOA 3KJFB 3TQ1A 4X4OA 4RO0A 4WK1A 2MEWA 4DV4J 2RU9A 2NXUA 4DS4A 4PWDA 1FRJA 2HAFA 1Z2ZA 2JSXA 4GRSA 1HNZJ 1HNWJ 1U0SA 4F2SA 1EETB 3HHLB 2FVPA 2ZM6J 3FEZA 1T05A 1JX4A 2K3KA 5FD1A 1JJHA 5MLCV 1T9XA 2J5AA 1NK0A 2E9ZA 2WVFA 4EYIB 2ZD1A 4CO1A 4ENOA 2D69A 2DR5A 4B3SJ 4JP8A 3ONQA 1NMEB 1CSJA 2DNMA 9RUBA 4R5PA 3JSMB 1QUPA 2R7RA 4BS2A 2VOPA 4NXMJ 1RAFB 3PKMA 1RT7B 4FXDA 2XGPA 3FRYA 3KHLA 2HBQB 2VPXB 2ZBCA 3RB6A 1K1SA 4E2FB 3TAMB 2HURA 1URNA 2VL1A 1Y5LB 4NLPA 4B9TA 1RHJB 2BANA 1R8AA 3HVAA 4J9QA 3TQEA 1Y11A 3JTNA 1ZH5A 3O1LA 2CG8A 2W01A 4CM2A 2W4PA 3MD1A 3BGOP 3I82A 4P2MA 2KB2A 3L4BC 4JI3J 2Z2LA 5EWGA 1T02A 2XS5A 1P6TA 3RJMB 1AA1B 4OIXA 1GMWA 3LGNA 5B0AA 4MFBB 2UZAA 3J80Y 5C25B 3CJ3A 2BRLA 2YKNB 5SZTA 5AJ3J 4DX7A 1REGX 2QFJA 1TAQA 3DC2A 4ZA1A 4YR3A 2IA0A 3DLKB 2DKOB 1VQYA 2NREA 4FVMA 1OY9A 1AROP 3D5MA 4OZLA 1RA6A 2JLFA 2AKWB 3HD1A 3PFOA 4PQAA 2ZJPQ 3H2UB 1CC8A 3TNVA 2DPIA 2DO0A 1IKXA 3VGVA 5HBMB 1HNXJ 3RYLA 3BPSP 4M63A 1SC6A 2KHCA 3KXDA 5D4OA 4ZCLA 3KHHA 1HWJA 2MMYA 2QT7A 1B0VA 2AEFA 3W9IA 4AXIA 4KGKA 2R2UA 1NK7A 4I56A 4RUHA 3A8KA 1S9FA 4LSLA 5BR8F 4NCGB 2F7VA 1QAYA 4MAKA 1RT1A 5I4MA 1X31C 1JQGA 4OZJA 3PX0A 1T9YA 4IR9A 3DI6A 4F67A 3D6TB 1U25A 3ULHA 2JC0A 3W1YC 4K4WA 4FBTA 2BV3A 4QPXA 2CZVC 1JLGB 3QFHA 3QNWB 2GV1A 4KRWA 2UUTA 3T41A 1TMJA 2HG4A 2R7SA 3TJ8A 2AJFE 3M6UA 1KD1T 1HHTP 4Q8EA 1S1UA 2BJDA 2GFFA 4LF2A 4I6WA 4L3NA 3TZYA 5J2QB 4DR7J 2FJBB 4RKUC 2L9DA 2NCKL 4A47A 3TARA 1X0PA 2BR0A 2YY3A 3D0GE 2HGLA 2DITA 3MMAA 4NYZA 3R7NB 4ECRA 1EQ0A 4K5RA 2LVWA 1KVIA 1JNRB 3D7SB 4MIWA 4F0KA 4DFJA 3CJ2A 1OPIA 2VPYB 1SCJB 3SV3A 3I0SA 2KJVA 3F44A 4IOBA 4WTOB 4M95A 2WVEA 2H51B 2O01C 1XMQJ 4EZ6A 3E51A 3F41A 4JI2F 5B0DA 4DUZJ 4JI0F 1FXDA 3IXQA 3D1QA 1NUEA 1FCAA 3DU6A 4C2MA 1I5OB 1FFSB 3KLIB 4ZPWR 1B7YB 3MM5B 2UV8G 4OI0A 2B51A 4JI4J 1F5CA 1NEEA 5DJBA 3MEDA 2M8DB 4Q45A 4KPCA 4HR2A 1BC6A 1WG1A 2A3JA 2BABA 3OHBA 3DLLQ 2IRYA 1QE1B 2GJIA 5HATA 3ZTRA 4FF1A 1SC1B 2RHQB 4C8ZA 2AYGA 1OWXA 1SKRA 2UUAF 2HVHA 5F8JA 2QG9B 1SL2A 4HVZA 3MGJA 2UVVA 1S1WA 2C2OB 5ETSA 2MQOA 3MDFA 3PRVA 4BC9A 2FJDB 2RKIB 1HR0J 1FD2A 1KTVA 2WBRA 3DOLA 5A8RB 1TKDA 1SL0A 3ITHB 3OTEA 2HMIB 4ILMA 1ZM2A 5IM0B 4ED4A 1X4FA 2ZZNA 2HNZB 3P5TL 2VG6A 3NGUA 1C1BA 1CJUA 1D8ZA 1UTAA 3ZZ0A 2BX6A 4C3KA 1VRUA 1YDLA 1KFDA 5B0GA 4ECZA 2FVSA 2V8GA 3M7VA 3DRYA 1WORA 1SJRA 2AYMA 5RUBA 1CJTA 3HHDA 4C98A 1N33J 4IQMA 3ZTQA 3C6TB 3T9ZA 3W62A 5DQIA 3K5OA 4HHHA 2I8EA 3EGNA 1NLKL 1RYSA 3LUYA 2OMOA 1LWEB 4K4UA 3HJFA 2CQHA 1MU2A 1WSVA 3OV7A 3CCMS 1ELOA 3T5KA 2RQ4A 1GNKA 2J7KA 2CIMA 4DSEA 4EBCA 4CH1A 2VG6B 2UP1A 3IP0A 3AH6A 1IUJA 4JV0A 1PBUA 2DNLA 2RVJA 3IAM9 3JAMU 4DCPB 3UW1A 5B0FA 4C9DA 2ZH3A 2QA4S 3DYAA 2JNJA 2RHSB 3HHEA 1TKTA 1OSDA 3IR5B 5E3PA 4YDDB 4XIUA 2CAJA 2NUUG 3M8WA 1XR7A 1RHMB 5HVHA 3KUHA 4LSNA 1VC0A 1RDRA 2MQPA 1U8SA 2F8MA 3D6FB 2DD8S 3HMJG 1U47A 2Z30B 2ZEJA 3ILIA 3LQVA 1MWYA 5HL7Q 3JSYA 1Y5NB 4K8RA 3V5RA 2XSJB 2DGQA 3FSXA 3QFWA 4NLUA 5KT5A 2PO4A 5HVGA 2DNGA 1WNEA 1YJ7A 1RHRB 1FD8A 2E5LF 3ET6A 3HHKA 3PJWA 1HR0F 1LK7A 3KLIA 3E01A 3LANA 1VQ4S 3US5A 4B3OB 1B7FA 2ACYA 3KYLA 2FD2A 2F9JA 5HI7A 2YQ0A 2K1RA 2ZVSA 1S1XB 1CC7A 2BZ2A 1K9MT 2QRRA 2C2NA 3PRBA 4XK8C 5IQ6A 2HS3A 5FLXU 3PEHA 4QWBA 2ZDPA 1UEUA 4JI6F 3UN2A 1IBMJ 4I7FB 4ZPAA 5EGYA 1HI1A 3NMRA 3I9ZA 3U02A 2B7CB 2IRUA 2V9KA 3EGWB 1MMDA 3GJTB 3R5DA 4HH0A 4Y6IA 3KDOA 4OX7A 1S4FA 2B7BB 1GMUA 3JQMA 2HVIA 1K8AT 3I5CA 3TI0A 2GJFA 3HSJA 1B4SA 1UZHA 3W2VB 2DTJA 2HBYB 1WOSA 2HZVA 2BE7D 4HT7A 1IVZA 3OJSA 1CBKA 3J7YU 5KFRA 1Q78A 4DL4A 2F3JA 2HQFA 4NZ0A 4DG1B 3RAXA 4B3RJ 1TTHB 2C3OA 2RD5C 4B3TF 2MZRA 2WTFA 1S57A 3H8YA 4RW9A 4K4TA 5DGAA 2K2PA 5BYRA 3X3UA 1U09A 1O8BA 2C28A 3MOZA 1WI6A 1SH3A 2W2OP 4K2XA 4WFXA 3BKFA 4DL3A 1IBKF 2Y8YA 4WKRA 2ZDOA 3KHRA 3BR8A 4LT6A 3T19A 2AZ3A 4N77A 3WQPA 4WFAQ 1FFWB 2RAQA 1KVJA 2FZGB 2RUSA 1X4CA 3EVOA 2AEJA 4ECVA 1FTRA 1N8RT 1OMSA 2HQDA 2LP4A 1S0OA 3ENQA 1WHWA 2CQBA 1VQPS 3QSYB 1LOUA 4LF4J 2F8HA 4R8UB 4QIGA 2AQ4A 4J9LA 1PJ5A 4LSNB 4JOUA 5DRKA 1K0VA 3HHLD 5G0RB 1YJVA 1FO1A 4YFUA 4F36A 3SYZA 5B08A 1DTTA 5AE3A 4V19X 3CIMA 1O5JA 3DDIA 4BCAA 2E5GA 4NX9A 3LPEA 4QBUA 5DQHA 1TL4A 1HBNB 2A6MA 2VBWA 2DR6A 3LF0A 5EUHA 3DHXA 3OVAA 1XMOJ 5KOWA 2VONA 2CNNB 3DU5A 3OJUA 2J7UA 5A2QU 3RBXA 1MU2B 3AQOA 1WC5A 3PO5A 5KFMA 3DLEA 3K5PA 3TAMA 1B3TA 4IFYB 1XN9A 1S1VB 2AW0A 3R5AA 2BQ3A 1MWQA 2GS8A 2NSCA 2XS7A 3D0IE 5ETRA 1L3TA 2EFGA 1U24A 1RK8A 4GVBA 4IRCA 4RW6A 4TNOA 2XCPA 2XMUA 1T95A 2I38A 2W2NP 5DM6Q 5KFUA 3OFGA 4RNOA 5B7WA 2HNZA 1HMVB 5LSRA 4Y2CA 2CNLB 2DYAA 4NI2B 1FJGF 3S7RA 1X0FA 2D3O1 4NOHA 1JJCB 2W7AA 2C3PA 4JI7F 4ED0A 1BWVA 3HXMA 1NJIT 1QJHA 2E7XA 1UWAA 4DR1J 3CCWA 5I3PA 3DRSB 4ZJLA 3NGKA 2PMZD 1TVRA 2OGUA 3IS9A 3L7UA 4LR8A 5KG6A 4DJBA 3H5XA 2FLOA 3RRKA 5A76A 1NO8A 4EEYA 2YX1A 2Z0GA 1YIJS 3GJRB 2M3DA 3PYFA 4H54A 3R5CA 5K8MA 2UUBF 3PNIA 3DGPA 2IJRA 2ZM6F 1JLEB 4I4BA 3Q22A 1WOPA 2HIQA 3W5YA 3V6HA 3QRRA 2BJEA 1JLAB 4J9VA 4KGVB 1F3FA 2QA2A 4NXNJ 1S0VA 1QAIA 2IC3B 1TVRB 1BHNA 1IR2A 1NHUA 3VZIA 1SXLA 1FF2A 1V5VA 4QR0A 4EYHB 3PVXA 5KFAA 2Y1JA 3UD4P 2GVZB 5J1NA 2ADCA 3C14A 4DR4F 1RWVB 2M8HA 4QR2A 4WP3A 4CRJA 2KVIA 3D3CJ 4QYRA 4C0OC 4CLYA 4NI2A 5IC4B 1ZM9A 4P6QA 4IG3B 1Q95G 3DFEA 3MMAB 1RT6A 4M5GA 1TQLA 1HMVA 3CJ0A 1U1KA 1UETA 4RW4B 4OX9F 2VKZG 1XMQF 3NGTA 1JIHA 2V69A 2VG7B 3M8PB 1LV5A 3KK2B 4DR3F 1MROA 2J0QD 4W92B 4X4SA 1ZETA 4PQUB 4QW9A 3QZ7A 2XMVA 1Z2LA 2EXUA 5GAHU 4LRBA 4IDKA 3MHYA 4K4SA 3NEKA 3K2YA 4M8LA 3LWMA 1VK8A 1L3VA 1RT1B 1C4CA 4LIRA 3A3PB 2VQFF 5KFDA 1UWBB 3OXLA 1GQEA 2ZC3A 2IVMA 1S1TA 1WJ9A 2IVYA 3UD5A 5CA5A 3ETOA 1PC5A 4FVCA 1PJ6A 1I51B 2YNFB 1N54B 2FHJA 4DXLA 4H4MA 5ETNA 4IFVB 2EPIA 3MM9B 2V67A 1DTTB 4BBYA 2H54B 2GW8A 4O3OA 2PIIA 3FGVA 3OUYA 2FZKB 4DQRA 2CQDA 1RSCA 5FDLB 1HI0P 3KG1A 1EHWA 4QWDA 2UUCF 2XM3A 4DUYJ 1QTMA 4FF3A 2DK2A 1VQOS 5LT5A 3I4HX 1IQTA 5F8NA 5HROB 5F8IA 1GX6A 5ETTA 2YQ3A 2E66A 5HQLA 3OUYB 5JJBA 2Y9HA 3EZ5A 1S12A 4X4RA 3TUJC 5HK4A 1H73A 1WHVA 2HAIA 3MM9A 2HYIB 1XR5A 1RYRA 1IKWA 3K8WA 3DXBA 2HNYB 1H98A 1DLOB 5KFFA 1U1QA 2GHWA 2B8QA 3N5FA 4A8YA 4RW9B 1L5UA 1RT4B 2LXIA 4XPEA 2DCUB 3KJQB 3OQ2A 5CH7B 2VJUA 1IBKJ 1TL3B 1S1TB 1S99A 2V50A 2WVDA 2XI2A 4X66F 3KMQA 2FHOB 1MLAA 5EDWA 1VJQA 3MAHA 4QCLA 2WSCC 3MAAA 4ED2A 2DGWA 3JTOA 4H4KC 4KKOB 3KG0A 4PAAA 4URQU 3QIPA 7FDRA 1GXLA 2VG5A 2W2QP 1VMBA 3BGRB 2VF3A 3B8HA 3TWZA 2VDHA 3HVRA 2HGMA 2DY9A 2HK2A 2MQNA 4X62F 3V4IB 2JEIA 3KTQA 4QU6A 3DOKA 2ZJQQ 2CJAA 4KTQA 2YPZA 4UT4A 1U45A 1VQ7S 1N88A 2DHXA 1HQUA 4RW4A 4LVNP 3V81B 4DR5F 4P7VA 4HI2A 2D1CA 1HBOA 1I3OB 2CQ1A 5K8NA 5L38A 3G71S 2CPFA 2ROPA 2P2CB 5CYJA 2XG8A 4B3MF 1N5TA 5JXSA 2HHQA 3FUYA 5FIIA 5F3ZA 1TL1A 3GG1A 1B0TA 4PPZA 3M05A 3DM2B 2CPDA 4EUVA 2DGVA 1Q1KA 2VICA 4JV5F 3FCWA 1FKPA 4YQWA 4CO4A 2GX8A 2YWWA 3D54A 3ENAA 3EMTA 4DV2F 3IWLA 4RNNA 3UCUP 1S6PB 1SVDA 1X4HA 1NNDA 5T41A 1QE1A 2KDOA 1MG7A 3P3DA 4HHUA 3ZZRA 4TYBA 3PX6A 2B0GA 3WX4A 3CCRS 1RTDB 1YJWS 5D6GA 1GTEA 1S6PA 3DGPB 2P5VA 4CZCA 2AGPA 2G2OA 2G1DA 1FVQA 4IR1A 1HBMB 1TELA 3OW2R 3THPA 1RGVA 4FXWA 3C3LA 3O44A 4FPRA 1RAHB 1TL1B 1D3WA 2CPIA 3BH6B 1RT2A 2K3IA 1N5QA 3IS9B 4ZCMA 3BKTA 2XY5A 4I2QB 3CE8A 2VBZA 1EKRA 3GQCA 1S49A 2AGQA 2CADA 2YNIA 2EI5A 1EAYC 3CWJA 3LALA 5D3GA 5B09A 1J5EF 3H5YA 4MIBA 3FKBA 3SZ2A 1NB7A 3ISZA 2XI3A 2KH9A 1R7IA 3T5HA 5KFCA 1A6LA 2IMOA 1WC6A 1RTIA 3LAMA 1NHKL 3PACA 2V8HA 1UW4A 3HFZB 5J2QA 1Q8IA 4MMOA 1IWGA 4GKJF 1S0NA 4DDFA 2A18A 2CNOB 4HHJA 3ADAC 2DR9A 2CPZA 4B3MJ 4DSIA 3WX8A 1RACB 2MKCA 3GYNA 2GIQA 4DR5J 4ZVGA 1HWKA 1TL3A 3HSZA 2MHNA 5LXRA 4I2PB 4TU7A 4KFBA 2AGOA 2L08A 2AYBA 1RWPB 1Y4ZB 2NXCA 3W2WB 1BMQB 3ITHA 2IRXA 4ANEA 1RHQB 5D78A 1X8DA 4YDXA 3CJQA 5KT6A 4O0IA 3FBCA 4J9MA 1N56A 1S76D 4IH6A 2OPPB 3J81U 4U9RA 3IFEA 1LXNA 3QPIA 3CPWR 2ZJRQ 1KR4A 3HCXA 3Q8PB 3NWGA 4X66J 2BEFA 1TMMA 1OQ6A 2DNHA 5KG5A 3DXSX 1WC4A 5KFPA 4WFBQ 5CD4H 4HI1A 2DXDA 1QSLA 3KOAA 5L9XA 2OMLA 2DR7A 2OHDA 4CLZA 2IPOB 1VBYA 3VGUA 1B70B 1ZPWX 4JV5J 1NSAA 4P2SA 3WBZA 2HPUA 3N6MA 1S48A 4O4GA 4R8UA 3TW0A 2N7YA 3EXYA 1X4AA 3HKWA 3NCPA 4LBPA 4EZ9A 4NLQA 3FQLA 4QW8A 3KHGA 1U0HB 1AW0A 1DRZA 1FA0A 1HA1A 1URRA 2B4UA 3BV8A 3DRPB 2CDQA 2E7VA 4KGMA 4WFYA 3G9CA 4JI4F 2QL7B 3IWXA 2FUG9 5J2MB 2GHPA 2RB7A 4RW7B 3ZNUA 2HBRB 4M5KA 2ZH8A 4CNZA 1UCNA 4ED3A 1RWMB 1YITS 1R8BA 3U7JA 2YH0A 2OIHA 5F0UA 2ZOGA 3CMQA 4BHQA 2HRTA 1N5SA 2RQMA 1QAJA 2DVIA 3W9HA 4OYBA 2R8GA 2XSFA 5F8LA 2IM0A 3GIJA 3G8QA 4DSLA 4YOEA 2LA4A 2MKJA 2QFIA 4C6AA 9ATCB 2XTJP 1DZ5A 4F3MA 1VLYA 4NA3A 4CTAA 2BJ7A 2H3EB 4OI3A 2HQCA 3KJNB 2PT0A 4WXOA 5D0HA 1R0AA 4YY3F 1RT7A 1VYAA 3DDNA 2GQQA 3GR1A 2MQQA 2XQCA 3CJTA 1YBUA 5CYQA 3AOAA 4NLXA 4MYUA 3TOQA 1TK0A 1FRLA 2FLNA 5CZVA 1Y5IB 4B9SA 2HS4A 1W25A 1LFWA 1GK8A 4MKVA 1DARA 1RWOB 3KLFA 3P4UB 4GKJJ 4USWA 1EETA 2MKSA 4C8MA 2AU0A 2PA8D 2HWIA 2Z56B 2YH1A 3MD3A 1YHQS 3HP6A 1FKOB 1IWAA 2FPHX 2NXJA 3MM6A 3O5TB 3WHIA 4L73A 2GNKA 2K1RB 2N4CA 4PCQA 4WE1B 3N01A 3BYRA 2CQPA 1RTHB 2L48A 4XAKA 3D3BJ 5HQ8A 5GAEU 1SJ4P 3ICLA 2PSZA 3HHLC 1NJXA 1F3VA 5HMZA 1PAEX 2R3VA 4KQZA 3VWSA 2W8KA 1NJZA 2M4MA 3MTKA 5I42A 1RBLA 1RI7A 2CQGA 3CJKB 2AD9A 2L9NA 2F40A 3GR0A 4PWWA 5A6PA 4FP9A 3N5BA 1IKVB 1IKYB 1SQFA 5C7PA 4QU7A 4ITSA 4DR6F 1YJ9S 3GLJA 4HACB 2HFNA 2RS2A 4CO0A 3CUNA 2IAJA 1VIXA 2A2DA 3QLHA 3FBBA 1XERA 3CCES 1Q81T 3CCTA 4U8VA 4B9MA 1YQHA 3SDEA 3JSBA 2DT9A 1AT1B 1UVLA 2BANB 2ASLA 3PDNA 2HLUA 4DL7A 3M9MB 3T5JA 3LPYA 1M5OC 1S4EA 4DX5A 1UEVA 1YJRA 2ZC4A 2LXUA 3CCZA 3DMJA 4QWEA 4ZLNA 2UXBJ 1SV5B 1UVKA 5DZ6A 2BOAA 3JQKA 2MLXA 3W9JA 1Q16B 3N28A 4V19J 2ZHBA 1APSA 4A8XA 1DTQB 3DGVA 4G1IA 2DNPA 2AMCB 3W5ZA 1PJ7A 4LF5F 3G82B 1UVMA 1NHVA 4IFYA 2OO4A 2ZWOA 2CYYA 3DMJB 5E7OB 2Y1LB 4LBIA 1WI8A 4X62J 4DUTA 1U1NA 3BDEA 5F8HA 2NUHA 2V8VA 3AFGA 4KYZA 2COLA 2OPQB 3CF5Q 3BF4A 3UDEA 2YPYA 3AOBA 2B56A 3M8QB 4M5DB 4OYMA 2PN6A 3KLEB 5LL6d 2V9WA 1JMTA 1IR0A 4JI8J 2EBEA 4J9KA 4DF4A 1P1TA 4DR6J 1P9QC 4KY3A 1HQEB 3TZZA 4TLQA 2BXJA 3M8YA 2GGPA 2LFVA 3POTA 3PW0A 1JLCA 2W4DA 5D0GA 4J7CA 4O3RA 3W3SA 3PCOB 2IA6A 4IQXA 4DX8H 3RB0A 2W2PP 2VBYA 5C42B 2FJWA 2MQLA 2IDEA 1GXTA 4PXDA 4HDGA 4UZCA 3GCWP 3VQTA 4A8OA 4Q43A 1FJ7A 3BR9A 1FKPB 4DR2J 2J76E 3SEOA 5H9FJ 2FGCA 1YI2S 2FY1A 1GMWD 3M30B 6FDRA 3KLHB 2NSBA 1DFDA 4ES2A 3RTVA 4DLEA 1FJGJ 3NOGA 4U67Q 2FHKA 2YNGB 4B9UA 2IM1A 2IJFA 1YSJA 4X2BA 2KVQE 2FY8A 2HFOA 2I1RA 3KLFB 4OJGA 5F0WA 5A2QY 3T1HJ 2ZH2A 1KQKA 2V2QA 3R97A 1KOHA 5KFTA 5AXLA 1MN7A 2DBBA 5HSPA 5ETOA 5CYQB 1JLFA 1R43A 4OHZA 3TVYA 4DR7F 1G1XA 4BWMA 3JTPA 1FDDA 1NDKA 1YG0A 2H4YB 3EXCX 2NPFA 4DV6F 4A8SA 5BXIA 5IOLA 1N6QA 4FYVB 2KI2A 1T9TA 2C3YA 1S1UB 3Q2SC 1B64A 2XB2D 1N6QB 1DJ0A 3KUGA 2BVZA 3IA0A 3BEGB 3QSIA 4IO9Q 4Z7CA 1IJFB 1C0TB 2KT3A 3KMSA 2QA1A 2O66A 3AD7C 3QBCA 4PZVA 4DLGA 4F4XA 4ZVSB 2EC0A 3QQCD 4WPAA 1RWXB 4ID5B 2QE5A 3WZ0A 2IDLA 1QM9A 5KG7A 1YTYA 2EKNA 3M32A 4DFKA 4OZ0A 3ELHA 5IV3A 2WSEC 4ERDA 2OD6A 5LJ3Y 1JXEA 2H48B 1CVJA 4B3OA 5DS7A 3H4DA 5IC6B 4AQYJ 1F5BA 3GCXP 5KFIA 4NLRA 3FVYA 4N41A 4NE9C 1FT8A 5KG0A 3E3XA 4C48A 4MH8A 1RAAB 1QTNB 4U96A 3QIDA 3TJ9A 1S0MA 2H9ZA 2M0GB 1S9EB 2VQFJ 3R7SB 3WIVA 1PYTA 2OEKA 3H2VE 4YMEA 1SPBP 2GO8A 4YB5A 5DG9A 3THVA 4RBUA 2DNRA 1VLOA 2E5LJ 2E29A 2JH3A 1WC0A 1JLQA 4J5OA 4NLVA 3UN3A 2BOPA 2XS2A 3HO1A 2DISA 2W9CA 2XY6A 4FYDA 2VKRA 4KSEB 2QSFA 1CULB 3EVWA 4QZVB 3VQSA 2F1FA 2OPQA 1S72S 2R7XA 4DCOB 4HTJA 1TKXA 5LXYA 4B9VA 2FIUA 3RW7A 3W8GA 5GAGI 4A48A 3OXGA 1X60A 5CHCB 4QPTA 1RCOB 2ZBPA 3BH7B 2HK3A 4USTA 5DDQC 2ZUGA 2K06A 1DHMA 4DR4J 1Y3JA 2X51A 1H74A 3K58A 2VB6A 2CJYB 1JK9B 1CJTB 2RMLA 4V1Ak 3LP0A 4A8QA 2D3UA 2MZ1A 3M9NB 2AWZA 2GC8A 3PYGA 4F2RA 2UV8A 1MROB 3GP9A 4PG8A 1N0UA 2WB4A 3G6ES 2B8PA 2DXEA 1R0CB 2HHSA 5E2QA 4A46A 2CG4A 2B5JA 2R7OA 4LIWA 2P9CA 2HQGA 4KH0B 5AXKA 1BE4A 1RT2B 3CMAS 3QLHB 1S1WB 1RU2A 2ZHOA 3GYGA 4L75A 1N33F 3LGHA 4ZVHA 5GADU 5CABA 4ED6A 4OI6A 5KG4A 1W2BR 5DDOC 1LWXA 4I67A 3I5BA 2VPZB 3E8OA 3PIPQ 3CSKA 3BQ2A 1S97A 1VBKA 2QO3A 4DV1F 3BBCA 4Y3CA 2IVFB 1RTJB 1WF0A 3CNQP 2J9DE 1JLEA 4G6VB 3CULA 2IHR1 2EFQA 4C7QA 3EPIA 4ZK7M 2DNOA 4CLWA 3KDNA 3POTB 3SCIE 3LH2S 4I6YA 3NBPB 1S6OA 3SCJE 2HHHF 4LF4F 2HHWA 2KM8B 1KLMB 2BA9A 4DHVA 3T6JA 2XMKA 3CCUS 1FI4A 4WU3A 2HBZB 3OPKA 5I3QA 4G1QA 4CO5A 1YZ6A 3R7BB 1EKSA 1GX5A 3V6JA 3JAMY 3A8JA 2YKAA 2MZTA 2EFOA 2MTLA 2A10A 3DOMA 5CZXA 4CLPA 1N32F 3CC7S 1WC1A 2WOMB 3CDWA 3J7A1 2MZQA 4OYWA 5KFSA 2V6AA 3OL9A 1KN6A 2XNQA 4JYAJ 2FC9A 1NZAA 1ZM3A 2V4JB 3MPDA 2EW9A 3RBZA 1TR0A 3T1AA 2JOQA 4ED5A 4GVBB 3AXMA 4P73A 4ZVUB 2HQIA 1PILA 4NZ6A 3I56S 1U7LA 1VS3A 4IG0B 4EO8A 4CTAB 1RAGB 2JFDA 4WK3A 2JL9A 6FD1A 4URGA 2RRAA 1ZTTA 2ZE2A 2J7WA 4IOAQ 4K0KJ 1GFWB 2H1YA 4RW8B 1GEHA 1KVKA 1WELA 2CQ3A 3GYXB 3N6LA 3Q8RB 4QR1A 1EP4A 2W24A 2HNYA 3AAWB 3QJJA 5EHHA 4U6PA 4O3NA 4USJC 4TQRA 3UNGC 3MCOA 3RZAA 4OV1A 1HWIA 2CJBA 1XNRF 3UR0A 3M6WA 2W7PA 8AT1B 3DLHA 3O8WA 3MECB 4HACA 3NG8A 3PJ9A 3SI8A 1X7VA 4NYOA 1EQMA 3RU0A 4CI0B 2MPUA 1QAXA 3NS5A 1BLUA 5LMNF 1P9YA 2V2VA 5L39A 4J37A 3ILLA 2HHXA 1H7XA 4N8NA 4UY8T 4WFNQ 5D4LA 3RB3A 1VQLS 2NS1B 4FKYA 4DV3J 1KRPA 3PJXA 2HS0A 2ILYA 4G65A 4RWWA 4ER8A 1R8PA 2UUWA 3DRRA 1OY6A 3H25A 2B9EA 5D0RA 3U27A 2APOA 2WBMA 2W1BA 2X3GA 1KBRA 2DCLA 1NSQA 2ZZTA 5T7LA 4ZIVA 3BQ0A 1X5SA 2EG2A 1VHIA 2CPHA 2OSQA 5H9FK 2C1EB 3EVMA 2VODA 1YKWA 3JSRA 1SB6A 4LQ3A 1A0OB 5HQMA 2YNHB 4N56A 4A8KA 4LRDA 2MLZA 2LQ8A 5DM7Q 4LRCA 1U48A 2KYXA 2Q3PA 5D77A 2CDRB 3UD3P 4K2JA 4UQTA 1RAOA 1QD1A 8ATCB 2A1BA 4Z2XA 4EU0A 3FFIA 2XLIA 5C2CA 2J6TA 1FJCA 2KYZA 4P9SA 1NDPA 3I9V9 2XCAA 3UO0A 1TL7A 2R42A 4PQUA 1JWWA 3BM7A 2G2YA 3NXZA 3SXLA 3SQGA 2FZCB 2GA7A 4PABA 2CNKB 4JB8B 3ZZZA 3QGGA 1FX4A 2O5DA 1PC4A 3PR4A 3BDPA 2MZJA 3UE2A 4KV8A 1RWNB 2B43A 2H65B 4OLOA 1T05B 2D9PA 2XZTB 2XMMA 2ZBRA 1U1OA 3C14B 4J9SA 1KTQA 3I31A 3U1LA 5IT4A 2ZZMA 5K14A 4RL1A 2ASJA 2ADBA 2B4OA 4Q0BA 5C5JA 2NLWA 1FNXH 2HVEA 3DRPA 3GU0A 2FQQB 3FK4A 1RP5A 3M30A 3E01B 3M6VA 4HTIA 2AEMA 3KLHA 4ILRA 3J80U 2RDDA 4I69A 1EJ7L 1YRTA 1YBAA 3M1VB 2QMXA 4O4GB 4NXNF 3R2CJ 2BKPA 2ALZA 1I94J 1R0BG 5AXNA 4TVAB 5C42A 3AOCA 2KFYA 3UPFA 1Y7PA 1RXOB 4JI5F 4KHMA 4XDDA 3TEGA 3F73A 1DQAA 1UFKA 2V2ZA 4ATNA 1VQ9S 2DXFA 1YJUA 2VFSA 3JYTA 5KFJA 3OSPA 4M5LA 3TVKA 1FWPA 3QJPA 2M7SA 3ZC4A 1AB8A 1HD0A 2W8LA 5F9LA 1J5OB 5IT0A 2VPWB 4AT1B 4OX9J 1YBTA 3TX8A 3CB4A 4ZIWA 5ETMA 1RBOB 2YKMB 2V8DA 4K5SA 2JLEA 4A8WA 2E1CA 4LF5J 5EWFA 5A8KB 4DPWA 3B6BA 4KPYA 2BJ1A 1E6VB 2XWYA 4R25A 1TV6A 3A4TA 4RUBA 4DV7J 1YK9A 1ROFA 1YLXA 1PCAA 4F26A 3UR3C 2V4QA 2UXBF 3V4IA 2Y0SD 3EM1A 3QT5A 2VC0A 3QO9B 2Z2YB 2XBPA 4NRUA 5DZ7A 4NLYA 1GT8A 1LWEA 3BGRA 3DHWC 5EX3A 4C97A 4TXSA 3FDSA 3ENWA 4JI5J 3X1LB 2G1HA 4Y2KA 2NZ4A 3HKZD 3H59A 5DGBA 5HANA 4OX8A 3R1LA 1D1UA 1HNZF 4USMA 2XEXA 4OZNA 4U95A 1NSPA 2UUBJ 1V3RA 1FTCA 3ZTPA 2W7OA 4ECUA 1S9GA 1S59A 1C1BB 4MKYA 1S5ZA 4USIA 5DDRC 3RR7A 2ATLA 1L3SA 1DLOA 3MEKA 3HVTB 1AXQA 3MEEB 5DDPC 2CZ9A 3MEGA 1HFEL 4TN2A 2KFZA 5A8RA 4CCHA 4I2QA 1Q8LA 2BM0A 2JHEA 3VAIA 4B9NA 2JC1A 1RISA 4KHPF 3JYTB 3GZ7A 1NZ8A 3I5AA 3KNGA 1MMNA 2UUCJ 2RT3A 1K73T 3THTA 4O3QA 1MN9A 2RSQA 4N5SA 2OPSA 4P72A 1D9FA 3VAHA 4FYXB 4UY85 3MPUB 1TKZB 1ICEB 1NPRA 2L3MA 4AL7A 1Q82T 2EK6A 4DOZA 1RTDA 1UJ5A 3CC4S 2RF2A 3DLBA 3CJRA 4K4YA 1SBRA 1VR6A 3GIRA 3H5UA 1IXKA 1HHQA 4ZN1A 2ZNYA 1NKEA 2V5HG 2J0WA 4NLGA 3UWTA 3V6DB 4X84A 1F5AA 1NK9A 3L9ZA 4DQSA 2GJ2A 1SH0A 3D67A 1NM2A 4LMZA 4DQQA 3MUTP 3SQOP 3OHAA 3BO4A 1RQ0A 1TK5A 2QTWA 3AY0A 4MK8A 2LA6A 4WIQA 4IRDA 2PFFB 3TAQA 4ZLLA 3VALA 2G13A 4EMDA 3KJVA 2POKA 1K0TA 1FERA 4CP5A 4EK2A 1VHFA 2XZDB 4WJBA 3SFUA 2HNDB 2PDAA 2Z58B 4ES1A 2N4DA 1UKUA 2E1MC 4C0BA 1VQNS 3TANA 2XMTA 2VG5B 4OI2A 3VCDA 3ZZYA 1FEHA 2A6OA 4AL5A 2QA4G 3M9OB 2OLWA 3HFKA 4KKOA 2EFNA 3PHTA 4LJMA 3QAEA 1NPKA 1ZBTA 2HWTA 3M8RA 4NYPA 2V34A 2R7TA 3PY8A 3R2DJ 3PHEA 1LQ9A 3C19A 2GQCA 4KGZB 1GTHA 1M5VC 3R6LB 3D28A 5K5MA 1RT4A 5JVGQ 4NXMF 1FKAF 4FNIA 1IBMF 2IBOA 1FWLA 2G0JA 1EB0A 2M70A 3MCSA 1G2EA 3OL7A 3N79A 1BQMA 4X65F 2VV5A 1SL1A 2XNRA 1G3OA 4DFMA 4RW7A 2PD1A 1HWUA 2IC3A 3M6XA 4C3MA 4NWBA 2DHAA 3MMJA 1JLAA 2RUGA 2D3ZA 1U0HA 3ETMA 1W26A 4HDHA 1WOOA 5I3UA 2BE2B 1BY9A 2PMWA 2QLXA 4YB1P 1FK9A 1U6FA 4F02A 4KT0C 4DR1F 1K47A 4CT9A 1TKZA 1UW9A 4ED7A 3DYAB 2HZAA 3F0NA 3CC2S 2CQCA 1SKWA 3D0HE 1QVGR 1UVNA 4YUDA 4F4WA 1N32J 1GMVA 5L1KA 2C2RA 2ROEA 2LDIA 3MCNA 3A1YG 3FJ2A 4QOTA 1PO6A 2CJKA 3UVJA 2X1GA 4LFAF 4F25A 4BC7A 5H1SV 5HMWA 1S77D 3OVBA 1NK4A 4MK9A 2VH7A 1VK3A 3W2WA 3EGZA 5B0CA 3P5BP 4LREA 2BQRA 3BO3A 2J9CA 3EUNA 1XNQF 3N0VA 1UZDA 2RILA 2R8KA 1ULRA 3IR6B 4ZLJA 2Q43A 1PGZA 4IDKB 4RNHA 1T8EA 2DRBA 1HKAA 2UXCF 1SUQA 2I5JB 2O67A 4KAIA 1RABB 1CS4A 1VRTB 2K8GA 3EE3A 2OPRB 3SSQA 2XZWA 1D9AA 1VRUB 2HRYA 4PKDB 4DBQA 3MURP 1NPPA 5L1IA 2H5JB 3T1YF 3GFHA 1B99A 4WYWA 2BW2A 4ELVA 2G0CA 3QO9A 1Y10A 4L3KA 5F8GA 3D66A 3FBEA 4S0MA 1WEYA 3T3FA 3HX9A 1T0TV 4YB7A 1CPZA 1Y9OA 1SJ3P 4ES3A 2PC6A 2LCWA 4OMFG 2AZ1A 2CJXB 3UN5A 4F0MA 5D3GB 4ZP6A 2R4FA 3RAMA 4NMXA 1IKVA 2AX1A 2V2KA 3IC1A 3IBFB 1KLMA 2WVBA 3IRWP 3HDSA 2IBKA 2Z2ZA 2MZSA 3QWPA 4TY8B 1S6UA 4DV5F 4M5JA 4WBFA 3EYZA 2B9WA 3OTDA 1CJKB 1YWXA 1H38A 3NLCA 4AL6A 3CTRA 2MQMA 3MFHA 3AJ2A 1UPMB 3B78A 1ZAVA 5LMUJ 1WACA 3AD8C 3QYYA 5ETQA 3SCLE 2WW8A 1M5SA 4M5MA 4DL2A 3ISNC 4Y65A 4P2FA 3J81j 2E1RA 5A0YB 3L09A 1NRKA 1HI8A 2HWHA 3DLGA 2PI4A 4H4OA 4DWIA 4RNMA 2X1AA 4O44B 3FNNA 4F4AA 3LTOA 1KP6A 2CVEA 3OL6A 2WVCA 1M90T 3OFFA 5L8RC 4Q2LA 3PW2A 3ZXWA 1FDAA 1Q4RA 2E5HA 2XYHB 3I32A 1RT3B 3LP2B 5GMKa 1NXIA 2IYIA 3M8ZA 4ZVEA 2ACMA 1BQNB 2KKHA 2HVZA 2CZ4A 1RWKB 3OLBA 4PEOA 3S1TA 1R0AB 4ZVFA 2AJ4A 5E0OA 3M2VA 4LBHA 2V68A 1ZA1B 4Y28C 5JUMA 3QJLA 4JI6J 3ZFVA 2NQPA 1LWCA 1RUSA 4F50A 7AT1B 2D74B 3EPGA 5K9FA 3C16B 1R8HA 2R7WA 2E9TA 3VF0B 2OD4A 2YQ1A 4W4MA 2RQKA 2J6SA 1JXLA 5KFNA 3PR5B 4OZ3A 3H42A 4Q5VA 3PW7A 1RU1A 2CVIA 2JVOA 3D1HA 3QGIA 4OYOA 3PEJA 4DUZF 4JI2J 5A8WA 2RIJA 4MKBA 1CG2A 3H90A 1LW2B 1LWFB 3TP2A 5HMYA 2K7JA 5C24B 1X9SA 3DDKA 4KJIA 4Y2IA 2I6WA 5M2PA 3D1OA 3H5SA 4R0EA 5G0RA 4X64J 4WTYA 4F4KA 4ZVRB 1DBDA 4DZDA 1UA1A 3KK1A 1PYSB 5MAOA 2AT1B 2CRLA 4OFZA 4ANCA 2R7QA 2YKNA 2D41A 3ZZOA 3MM7A 3W60A 1YJNS 1IR1A 4HT5A 1RJJA 3DRRB 2F9DA 1CJVA 3BZQA 4ZVTB 3L95X 3W63A 2ILZA 1KFSA 2VJVA 3KLGB 3MUMP 4ZN3A 4D3GA 5ADZA 3AJ1A 5FJ4A 1TKTB 3MWBA 3J7AN 3C15B 5C24A 2B6AB 3WIUA 4JI3F 1VQ5S 5KFVA 4OJ3A 5CYMA 3HVTA 1G4CA 1Z4UA 2C3MA 3MEEA 1V3SA 2I9SA 5KG3A 4WCEQ 3R1HA 2GAHC 4OI1A 1H6KX 3C6UA 2PE8A 5F41A 2G0IA 4JV2A 1SQGA 5L9NA 3P49B 1VQMS 4DG1A 1U6ZA 1EP4B 4DS5A 1KQSR 1LK5A 3C16A 3NRBA 2EKYA 5IWAJ 3O3LA 2V4JA 1UAWA 4QJVA 4ECSA 3JSMA 5KFKA 2LEAA 1SIZA 2QL9B 3DNCA 4IRKA 2ZD1B 2HRUA 2MDAA 1TP7A 2WOMA 2HW3A 2OUGA 2EFVA 2XYGB 3TR5A 1PKUA 2VQEF 1NJYA 5F3TA 3PO4A 4K4XA 3R27A 4GO7X 3KK2A 4Z37A 1KC8T 4IKAA 1CJUB 4FDFA 3CJ8A 4I7FA 5D4PA 5AT1B 4DU8A 4ECYA 3AB4B 3LP2A 2FJXA 4RX6A 3UDVA 1T3OA 5KFBA 3NGSA 4ZJOA 2UU9F 4PWDB 1PYOB 4KO0B 2WHOA 2JZ5A 1O0PA 1LXJA 3VAMA 2UUAJ 4LFCJ 1X5PA 3RUBL 3MMCA 4PR6A 3KFWX 1BUXA 2R8HA 1UFWA 1UEKA 1M1KT 3MTJA 2Q6BA 2MB0B 2C2EA 4DF8A 2BJ8A 2F8EX 4FN5A 3TRGA 4WP8A 3VAGA 3V6KA 2LU1A 5GMDA 2H5IB 2GO9A 2NXNA 2E1AA 3C66A 2JDJA 3MM8A 1TUGB 4KB7A 5L1JA 2VHGA 5KFGA 5IFMA 1FDBA 2FB0A 1SC3B 3L7OA 4DV7F 3W7BA 2BMBA 1NH7A 3DKDA 3GB0A 4JBCA 1WG5A 4OHVA 2XLJA 2W4CA 4TY8A 3RW6A 3ILOA 2FJEB 4BWJA 2U1AA 3NWRA 4ZHRB 2LXFA 2YTCA 1N5VA 2WB1D 2VUGA 4FBUA 4GVLA 1YJTA 2YWFA 3MMBA 5HP1A 2CJ9A 5KG1A 2AHOB 1N48A 2XO6A 1RLDA 1HNWF 4NLWA 3QGHA 2VU5A 4FNHA 2MSSA 1PSDA 5E5NA 2B5JB 4L6V3 3CCLS 3HPOA 2C22A 2YWGA 1U49A 1XIQA 3QAUA 5CD4A 3BGFA 1NDLA 2DH7A 3HLUA 3TJAA 1F9HA 1ZPVA 2VFVA 2PEBA 1DY3A 4NASA 5KFQA 5KG2A 3BSNA 5KAKA 4DN9A 2JFKA 1LFPA 2FVQA 5E33A 3LOUA 2CWKA 1XR6A 4PYDA 3FFIB 2CKWA 3MZIA 4J9OA 1D9DA 2KJWA 2VA2A 4DUYF 2UVRA 4C11A 3DRXA 1SIWB 3UFCX 2GMHA 4K59A 2DH9A 2WONA 3SSRA 3UQSA 5SUHA 4C3LA 4F04B 4U7CA 2W9CB 4FF4A 2ZFHA 3UNYA 1IKWB 4J9NA 4NA1A 2C2KB 3K5MA 3D9BA 2RKIA 4ZPCA 2MKIA 3C15A 1HNVA 3T1YJ 1HNXF 1I1GA 5EN1A 3OTOF 1CULA 4Q7AA 2MQ8A 5J1PA 1LW0A 1RWWB 2IYGA 3A8IA 4AFFA 1FXLA 2WW4A 4WFZA 2C2MB 5E3AA 4CYUA 2GMLA 2M5YA 1RHKB 2N3OA 1P27B 1P8GA 3BGUA 4CM0A 4NEYA 5AJ3F 3IRXA 3GSIA 5CCMA 1KHWA 4CLKA 2WK4A 1SQEA 3MEDB 1W2IA 5I3UB 3KUEA 4ZOSA 1REVB 4KH1B 3MM5A 2YKQA 2YBVA 3TEHB 2LMIA 3LO3A 4LFAJ 3CCQS 2DEJA 2ZOMA 1NCLA 3IGNA 4B08A 2CXEA 2QLJB 1LW0B 3MECA 4UUWA 1ZA2B 3NS7B 3EWGA 3IO1A 5E3RA 2BRKA 2LQJA 2Q79A 4ELUA 1H72C 5C2GA 2QJ3A 2RRNA 3PYDA 3G8SA 3IN5A 1TUVA 1NKCA 4QYZJ 1XQIA 4F0HA 3RBEA 3CD6S 4ETZA 4N8OA 2G2ZA 4ELTA 1FE0A 1NU4A 3CD0A 4I68A 5A6WA 1KLNA 3NL0A 3B4MA 2H5EA 2JX2A 4Z7YA 4ID5A 4O3PA 3MCMA 2BQUA 4OYZA 2FHJD 4PG7A 1EIYB 4O0NA 4YN3B 4CLSA 5GAEI 4RUAA 2DHHA 4TQSA 4J9PA 1KS2A 2LECA 4U7UD 1KQGB 2BKOA 4A4JA 5BJRA 2YVSA 3FEXB 2DGSA 3M8PA 4X65J 2JWNA 2M2BA 2UVWA 3MR2A 4AUKA 1V3ZA 3DI6B 4PXCA 3C8YA 2HNDA 1PIEA 2NXEA 3IR7B
chains in the Genus database with same CATH topology
1BD6A 1R6YA 3GIKA 5G4DA 2K7KA 2VBXA 3T5LA 1YGYA 2C42A 2HYIB 4DV4F 2CQ0A 3N9UC 2ERRA 2G4BA 3KNAA 2KZZA 5DLFA 4M94A 1OPZA 5AE2A 1H3DA 2RNEA 1NAQA 4H4OB 4ICLB 5CQGA 2AJ1A 1R89A 1S1XA 2HZCA 1T94A 3EZUA 1IKXB 3GFZA 5HBMA 3VZHA 2DNZA 5F9NA 1OSCA 5LSLA 2ZH9A 1Q7YT 3JB9k 2DGXA 1REVA 2GIRA 3AQPA 2YWEA 3Q23A 1RKIA 4ED1A 2CFXA 1T03B 1SJ1A 1XEZA 1T7PA 4L72B 3OLAA 3OSNA 4DQIA 3NNHA 4JYAF 2ABYA 1QY7A 1XWLA 3NAIA 2AF6A 2KM8C 5J2NB 2J0SD 3G86A 2FTRA 5LSOA 2KZMA 3GILA 1SKSA 4JI1F 4N47A 4F3OA 1IQZA 4M5DA 3KLEA 2R2TA 5KT3A 1FNMA 4NRTA 1X5TA 4DFPA 2BUNA 3SCKE 2AYEA 2I2YA 3UCGA 4HEA9 3TAPA 1VI7A 4DSFA 3CJ4A 2RE1A 4HYKA 1KONA 3N4WA 4I2PA 4NPOA 2OH2A 1KSPA 2IFXA 4TYAA 4H4KA 1LKZA 2EWHA 2F4VF 4ZMMA 3GV5B 1NH8A 5KOXA 1HW8A 2OKQA 3PIOQ 1S1VA 3Q8SB 3PX4A 1HPZA 4DSKA 4K50A 2KXFA 2HLTA 2Z4PA 3GIIA 3MXHP 3I6PA 4EFAC 2W9BB 3VAJA 4ILLA 4O3SA 3OR2A 1U2RA 5IXUA 1SV5A 4DMZA 2DNYA 4ZPDA 2FVRA 5J1EA 2ZKTA 3G8TA 2M9KA 1XC9A 2YKMA 5CYMB 4X4TA 4CH7A 2B6AA 4ECQA 2IJNA 2BDPA 4DN0A 4PPDA 3MFIA 3GMGA 3NGDA 2IMWP 3FSIA 4LFBF 3G6XA 5I42B 3KLGA 2RS8A 3K59A 4QIVA 3OFHA 3PW5A 2XMJA 3DLJA 5J2NA 4QIWD 4X4PA 3MM8B 3LP1A 3MI7X 3CJKA 2LLZA 1HBUA 3B4DA 4TU8A 4GKKF 4UQGA 4XDCA 1IJEB 1SJQA 3RBDA 1RWUA 2RJZA 3VR1A 2DGOA 1N5YA 1M5KC 1FKOA 2KTQA 4YHHF 2DH8A 1OO0B 2GCFA 2KT2A 4YR2A 5KT7A 4AXJA 1Q7LB 2QEXS 4Q0BB 4NZ7A 4KO0A 3M32B 5GADI 4XPCA 2P6SA 5K14B 1M5PC 3NKYA 1HYSA 1X9MA 3BQ1A 5K8OA 2RDIA 3MPWA 2MKHA 3M2VB 1ZTWA 4PWUA 3H4BA 1HHSA 2XO7A 4X4UA 3FMWA 2ROGA 1JJ4A 1U1MA 1HW9A 1FRKA 1FDNA 1JLGA 4ZS6A 1YVFA 4O23A 3PZPA 2U2FA 3FSYA 3M2RA 4G1PA 4MYTA 1HYSB 3GFYA 2CPYA 2AV5A 2MSTA 3Q0AA 3HI9A 4E8UA 2QZ8A 4FF2A 4MIAA 4HH1A 4I64A 2KT5A 3A8EA 3PV8A 2W25A 1MW7A 3RB4A 3C46A 1IM4A 3NS6A 3LGMA 4OZ1A 2AP6A 2OFGX 4RBTA 5KTQA 1MMLA 1HNIA 3MF5A 3KK3B 1H2UX 1WF2A 1DQ8A 2VFTA 1WWHA 3FZBA 3DLKA 2A2CA 3H20A 5BYSA 5CXTA 1DAXA 2UVUA 1TZ0A 4KC5A 2HQ3A 3T1HF 1R8CA 1TFYA 2KG0A 3P96A 1JJ2R 4G3IA 3CDAA 3IBWA 3R3TA 2QYCA 4CH0S 3MEGB 1VC6A 3TUIC 1BQXA 3GFXA 4I0WA 5AXMA 4CO2A 1HD1A 3V2UC 1VQKS 2HGNA 5KFYA 1N52B 3PFEA 5J1EB 2OAUA 5F8MA 1HNVB 1S9GB 4M1KA 4A8QA 4DR2F 4KR0B 4HL9A 5LJ5Y 1NK8A 1VOMA 4ID8A 1UWBA 2KG1A 2W9BA 4C8KA 2Z8QA 1R31A 1UVIA 1UJ4A 4MTPA 4DV3F 5E3QA 4FZVA 4C11B 5KT2A 2ZE2B 4PG4A 2Q6CA 5IZHA 1S10A 3E2EA 2BYCA 1VRTA 3QWUA 3OTBA 1CQNA 2B9XA 4ZP8A 3OTCA 3BB5A 1BQNA 4A8FA 4LF9F 4R5PB 4Y34A 4Q2MA 2R2RA 4F4YA 3R5BA 4B9LA 2WCXA 3K5NA 1X5OA 4EWTA 3K57A 4J9RA 4G1QB 3ISND 3PRDA 4O44A 1WTFA 2ZNZA 4Y2MA 2N3LA 1XK8A 3DLGB 1J2VA 1F60B 1WD6A 5DO2A 3HHNB 2CQ2A 1JKHA 2WRMA 1WHYA 3PM9A 2BBEA 2CPXA 4X4VA 1VBXA 2DJWA 5HLFB 1GH8A 3GIMA 1T03A 3CCVS 1GXUA 4ALZA 2NR0A 3ENVA 2BE2A 2J9EA 1KOOA 3CDEA 1HARA 5HLFA 1MWZA 3DM2A 1MSWD 2YX4A 4WE1A 2CQ4A 4P7TA 1ZOTA 1WTBA 3I87A 4PUOA 5D4NA 3NCQA 3MM6B 2MGZB 3HVWA 3CVKA 2LYVA 4WF9Q 3MMCB 2FC8A 2J0XA 1WEXA 4I1TA 3F56A 3OBIA 1TK8A 3NNCA 2PGCA 2YWHA 1XMOF 3DOKB 5H9EJ 5KFZA 3GG0A 3MPVA 3H40A 4UW2A 1HQUB 5JVHQ 5D8HB 4LF6F 1VC5A 4DEZA 3BSAA 4OJHA 3LP0B 2DNQA 1S7HA 2HFZA 1XTZA 4UUXA 4E98A 3HT3A 3K0JA 1T3NA 1KQFB 1N34F 5DQGA 2X1FA 3KJVB 3FQKA 1C0UB 3M2UA 4OHWA 2Q66A 1TKXB 3WDOA 5T14A 3C6UB 3G6VA 2D7SA 5B0EA 2N7CA 2R8IA 4RNFA 2FLLA 1UA0A 1WF1A 4CO3A 1HBNA 5J2MA 2J6UA 4R0JA 2HHVA 3OR1B 4DL0C 2E5JA 2IM2A 4NMLA 2YKPA 4AYBD 3ZZTA 1E6YB 2B4PA 4B3RF 4HKQA 1U26A 3G96A 3OL8A 1M0SA 1Q79A 1S9EA 2RF2B 4RUCA 2RU3A 1G7CB 1WG4A 1E6YA 4D3HA 3CJ5A 5GVQA 2ASDA 4DQPA 3TO8A 2M52A 5C25A 3OFEA 2JEFA 4WZMA 4NLSA 5FDLA 3KK1B 5DG8A 3KKFA 2R2SA 3NMAA 1JLBA 1U1LA 2XWXA 1NJWA 2OPPA 2VA3A 5M2RA 2GHVC 2L41A 3O6QA 1U1RA 4B3SF 3I0RA 4URSA 3VAFA 2V4RA 4MJKA 4GC7A 3D2WA 5HO4A 5KFOA 2WONB 4LF8F 4RW8A 1J5OA 4WZQA 3GV8B 2ZH4A 3L3CA 2QV6A 4ZPTR 3ZZUA 5E41A 3CEDA 2M88A 3FZ2A 1MNEA 2B4VA 4DSJA 3WC2A 3DN9A 2DPJA 1C0TA 3H98A 2KXHA 2BM1A 3BSOA 2OJ3A 4E0DA 2E44A 2DR8A 3W2VA 3LAKA 4WIIA 3EX7B 4AE5A 1KNZA 2VFUA 4OHXA 3CMES 4C8LA 1C1CB 3IG1A 2EBGA 1JLFB 3BN7A 2VG7A 2RH3A 3QMQA 3HM9A 3VAKA 2J8AA 3PKYA 5DG7A 2I0XA 2YNIB 4IG3A 3DCAA 2VD3A 2WAQD 1VQ8S 4PUOB 5KT4A 2YNGA 3PW4A 1FE4A 3NBPA 3S8SA 2JJ4D 3V6DA 1HBMA 1AFJA 4PXBA 2W9AA 4OLPA 5EWEA 3Q8QB 3NAHA 4Q8FA 4GC6A 4RBVA 2MYFA 4MKAA 2XC9A 3DRSA 2O3DA 1TAUA 2JRSA 5KFEA 4ZP9A 3AA8A 2VZ9A 4I6AA 4NLOA 3CDUA 2E5IA 3I55S 1KHVA 2AJQA 1FESA 1HBOB 1QUVA 2NYIA 3OXFA 2DB1A 5CCLA 2CPEA 4EBDA 1I6JA 3ZZPA 4F3QA 1C1CA 1HWLA 4RWXA 5KFLA 4NLTA 3TA2A 2XHWA 3QZ8A 5J2PA 2GQ2A 4KE5A 4NCBA 3DLEB 1FXRA 3C6TA 3M4XA 5J2PB 2LQBA 3K7RA 4RW6B 5DLGA 1X4BA 2GMJA 2QSWA 1TL5A 4OI4A 1D8YA 2KXNB 4BDPA 3GWCA 2FJAB 3BS9A 1RA7A 2UXDF 1JNZB 1SI9A 1ZZFA 5KFWA 3TA1A 4TU9A 1S6QB 1QSYA 1TFWA 3IWNC 1F2GA 4RZRA 3SDEB 4C8OA 2KRRA 3MAQA 2PA3A 2P9EA 5IT9Y 2BACA 1NK6A 1JLBB 3UI3A 5T7LB 1SH2A 4YR0A 3KK3A 2DRAA 2XMWA 2MKKA 3GSDA 1FVSA 1HNIB 3CD5A 2DNNA 2DGUA 3SSSA 3SV4A 4OX6A 1FK9B 4IOCQ 4FS2A 1V9OA 3CGIA 3CDBA 1FHTA 2FVCA 1RTHA 1LW2A 1LWFA 4DV0F 1DURA 1L3UA 3FRZA 3I4PA 1FRMA 2PMHA 4H4MB 5A8WB 2OSRA 3MR3A 2LQ9A 2YNFA 3AHPA 3I96A 1N4LA 4Y0FA 2MY8A 3GE9A 2R7SA 4C8NA 4JV1A 4K4VA 1P1LA 1CEZA 3HZEA 1C0UA 3M2UB 4KV8B 3VTIA 3IG1B 3NCRA 1H0HB 3RR8A 2R9LA 1FNOA 4IO1A 5IWAF 2XGQA 3CC4S 4PRFA 2J9DA 4IG0A 3G6YA 2B9YA 3UDLA 3LW5C 2JEJA 3KLVA 2P9GA 1DQ9A 4XO0A 4F8RA 1BWEA 3K5LA 4QWCA 3CCJS 1U2FA 1QVFR 2V94A 3MUVP 2KO1A 4NCGA 4RU2A 1QLNA 4A8MP 1YRXA 2SXLA 1WHXA 1FRXA 1R27B 3J7Z5 3I0RB 3P6YC 4W90B 1N5YB 2YNHA 1R3NA 2LKZA 2LDYA 1L3KA 1CQMA 5A0YA 3TA0A 3MOJB 3PXGa 5E3CA 3MR6A 1HBUB 2LEPA 5U47A 3H2LA 4C4WA 2D9OA 4QIEA 5IS2A 1JLCB 4OL8A 1Y0HA 1H7WA 1VIOA 4LQ9A 2XSJA 4OJ1A 3RRHA 2Y1IA 4NA2A 1ZM4A 1C4AA 2RQCA 2JEGA 1FRHA 1Q8BA 4QIFA 1UMJA 3OR1A 4WU2A 2OPSB 3B82A 3T6BA 5LJ3Y 2MHEA 2Q1LA 4ECWA 2JLGA 1UJ6A 4RLEA 4IH5A 3IGVA 2FGOA 3TUZC 1JB0C 1VJWA 2EFPA 3FMBA 2E9RX 4USHA 2VFRA 3BSCA 2WSFC 5LMUF 2XY7A 4Y2AA 3OR2B 2LU2A 1U4BA 3UDCA 1Y00A 2FJVA 2OTJS 1S6QA 2KRBA 2NPIA 1HPZB 3IAS9 5IQQA 4JI8F 3RAQA 2CQIA 1I94F 2OPRA 1U6BA 5HMXA 4PG5A 1X4EA 1SUQB 2I5JA 2ZKUA 3CCSS 1VQ6S 1F0XA 3LWLA 3CXCR 2PI5A 4K0KF 3O2IA 4UOCA 4C0HA 3BN4A 1VQSA 1O51A 1RAJA 4KHRA 1ZAWA 5IM0A 1RTIB 2QLWA 3BREA 1FRIA 4CQ1A 3DOLB 3AB2B 3HHLA 4WKYA 1X4DA 4QWAA 4ZDNA 1TV6B 2MXYA 2OP5A 3MPYA 1UP1A 5A8KA 4Q44A 4ETXA 4X4QA 2X1BA 1BGXT 1NK5A 2MGZA 3UCZP 2HMIA 1IKYA 4OHYA 2ASYA 4ZHRA 2ZITA 2MY7A 2DHSA 4B17A 1A9NB 1RKJA 1NKBA 2LQ5A 4MK7A 2XLKA 1VFJA 2R7UA 3K8VA 4LFCF 1Y3KA 3TVZA 4N76A 4NLDA 1VGYA 1D0EA 1ZYQA 1UL3A 1RTJA 2Y1RI 5GAHI 4F4ZA 1JKHB 3AA9A 4LF7F 3G4SS 2FHMA 3CIZA 4ICLA 3SMZA 5BYQA 5ITHA 3U1NA 1G6BA 1BQMB 2QIFA 5KFHA 4DL6A 1FJEB 3I0SB 2VC1A 1KEKA 4X64F 1OIAA 3HK2A 4EGLA 1WEZA 2KU7A 7FD1A 3MR5A 3M2RB 2DGTA 3V81A 2V0NA 2O1PA 2MJNA 4IH7A 2C3UA 2N82B 1XBWA 4GO5X 2VOOA 3HF5A 1VBZA 4X4NA 2EK1A 3QGPA 2ZH6A 1RT5B 2R7VA 1UFLA 3HZGA 3RRGA 4OQJA 4Y00A 3SFGA 4DL5A 1ZAXA 1HL6A 3FEYB 3QIPB 2ZOFA 2OTLS 4LSLB 3C2PA 5THWA 3T9NA 4KIAA 5KFXA 3NNAA 3KG4A 2ZH7A 5DETA 2LEBA 1K1QA 2EVZA 4LUBA 1IBLF 1YRUA 2VASA 1JLQB 1C2PA 4TLRA 2JVRA 2PEHA 4FXVA 4CT8A 2ZH5A 2DO4A 2DHGA 4B02A 4ZCKA 2AJ0A 1AFIA 4YB6A 2XULA 4ZPVR 4ZCIA 1V6HA 1N0VC 2DIVA 1Q86T 5HROA 2DNKA 2RRBA 2Z2MA 4HLBA 2L9WA