3BM7A

Crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
HHHENLYFQGMIGVVATLKVQPAKAAEFEKVFLDLAAKVKANEPGCLVYQLTRSKTEEGVYKVLELYASMDALKHHGGTDYFKAAGAAMGPTMAGAPVIEYLDAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of unknown function with ferredoxin-like fold
publication title Crystal structure of protein of unknown function with ferredoxin-like fold (NP_420935.1) from Caulobacter crescentus at 1.35 A resolution
rcsb
source organism Caulobacter crescentus
molecule tags Oxidoreductase
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bm7A00
2GFFA 3WDOA 2LDIA 1KVIA 2FB0A 1ULRA 1GXTA 3LGNA 2RMLA 4NPOA 5T7LA 3KNGA 2QLXA 2KT2A 3GZ7A 5B0DA 4Y2KA 2XMMA 5A6PA 2XMJA 2W4DA 1FVSA 2K1RA 1S6UA 2IYGA 4YDXA 3BB5A 1R6YA 4OJHA 1TL4A 2FTRA 4HL9A 1N5VA 4Q2LA 4A47A 3HFKA 1TL5A 5KAKA 1K0VA 2CRLA 1X0PA 1OQ6A 2HFOA 1KQKA 1APSA 2AJ0A 5B0CA 1Y9OA 3BF4A 2XMUA 3KG0A 3KKFA 4F67A 5B08A 2ZDOA 2LQBA 1CC8A 3BN7A 1W2IA 1X7VA 1Y0HA 1AFIA 1URRA 1S6OA 2GCFA 1TUVA 3I9ZA 4FNIA 4FNHA 1SB6A 2GGPA 2KYZA 2VH7A 5B0GA 2VV5A 1JK9B 2GV1A 2JDJA 3HHLD 2HFNA 1AW0A 2FHMA 2EW9A 4ZOSA 4Q2MA 3IWXA 1SI9A 2BJDA 3BR8A 3FGVA 3MCSA 4OIXA 1YRXA 2BJEA 3FRYA 5B0FA 4U9RA 5IXUA 2OFGX 1WD6A 2HQIA 2ROGA 2OP5A 4A4JA 2OD4A 1XBWA 2W4PA 1YJVA 5B09A 3BDEA 1JWWA 2PD1A 1YJRA 5T7LB 2LQ9A 1QUPA 4HH0A 1AFJA 2K1RB 3TOQA 1P8GA 2BBEA 3DCAA 1X8DA 3HHLA 1Y3KA 1V3ZA 1VQSA 3LO3A 5K9FA 5B0AA 1FD8A 1TR0A 1CPZA 1FE4A 2RSQA 4HI2A 4OJGA 1GXUA 1N5TA 1YJUA 3QGPA 2AW0A 2OMOA 1YJTA 2G9OA 3BM7A 2OAUA 2IFXA 2N4DA 2IYIA 3DXSX 1FE0A 3HF5A 3K7RA 1MWYA 3IWLA 1OQ3A 3UDCA 4HI1A 3HX9A 4QOTA 2KT3A 5F0UA 1FESA 1RJJA 1N5SA 3HHLC 2GGPB 2HLUA 3BGUA 2ACYA 2FIUA 3TRGA 2OD6A 1MWZA 1KVJA 4DPOA 2OFHX 4A48A 1Q4RA 2QLWA 1OSDA 4NL5A 1N5QA 1SQEA 1U7LA 2K7JA 2QYCA 2ROPA 4DN9A 5F0WA 4EFAC 2AP6A 5B0BA 2PGCA 2GO8A 4Y2MA 3CJKA 2K7KA 2GA7A 3HDSA 2ASYA 2KKHA 2W4CA 2QIFA 4OJ1A 2OKQA 2XMTA 3FMBA 3VTIA 1TZ0A 2K2PA 2XMKA 2ZDPA 1YG0A 4HH1A 3HHLB 1FVQA 1LQ9A 1Q53A 1Q8BA 5A6WA 3CJKB 2RU9A 3T9NA 3KG1A 2BYCA 2XMVA 3QMQA 1VQYA 4A46A 1CC7A 4Y2IA 2Q3PA 3E8OA 1FEEA 3F44A 2HLTA 1IUJA 1OPZA 4OJ3A 1Q8LA 4DL0C 2N4CA 2N7YA 2RILA 2L3MA 2ROEA 2XMWA 3LGMA 4ZA1A 2AJ1A 2LXFA 2HIQA 5B0EA 3MZIA 1P6TA 1Y3JA 4YEAA 3TNVA 2BUNA
chains in the Genus database with same CATH superfamily
1JLGA 1HBMB 3JAMU 5A8KA 3GYNA 4LRDA 4WFBQ 3GFZA 2JRSA 3CJSA 4ELTA 5D4NA 3H90A 1W26A 1T02A 1SCJB 2UUAF 2MLZA 4I68A 2KYZA 4ZDNA 3KDOA 2E5HA 2DRBA 1M5OC 4N47A 2H54B 4F3OA 2VIHA 4ZLLA 3RAXA 3DLGB 3LGHA 1TK0A 4GVBB 3HZEA 2VF3A 2BRLA 2GHPA 3PHEA 2E5IA 4NLWA 2LFVA 2ZFHA 3B82A 2MQOA 4KE5A 2IM2A 2WVEA 2AGPA 5GADU 2ZBRA 1RKJA 4KY3A 4TU8A 4I64A 2OHDA 2DCLA 5DDOC 1U7LA 3QNWB 3PR5B 4GO5X 3HCXA 1UPMB 1GNKA 3M6UA 2KG0A 1QE1B 3CTRA 4IRDA 1HD1A 3Q8UA 4UOHA 3QAEA 4NA1A 4IDKB 3EZUA 2QT7A 4DV4F 1X9SA 1U6FA 2ZNZA 2KDOA 4YDXA 2IRUA 2CPIA 4PXBA 5FJ4A 4TY8B 4WKRA 5HVFA 5CH7B 1NK0A 2XO7A 4AUKA 1YIJS 4GKKJ 1EP4A 5G0RA 5D4LA 1S6PB 4CLFA 4TLRA 2J0QD 4DS5A 2BDPA 1KP6A 1MROB 3ET6A 1V3ZA 3MM8B 2IC3A 4YB6A 2V63A 2EKYA 3HVTB 5HQMA 1VQPS 1IJEB 3KTQA 3IBCB 5D3GB 1S1TA 1CLFA 2JZ5A 5JJBA 3AH6A 3HSGA 4DCOB 2YKOA 1WKJA 1VQNS 3D67A 2YPYA 4K4TA 2DHGA 3T9NA 1VMBA 2FJEB 4QIVA 1V3SA 2H65B 2ZHBA 3VGVA 1ZS6A 3OT9A 1H72C 3F41A 2F8HA 3IFEA 2VPZB 1WC4A 2KHDA 2OPQA 4PWDB 2P6TA 2CQPA 1GQEA 1NKEA 2DGUA 2R7XA 5HI7A 4R8UA 4P52A 1YZ7A 4OX9J 2R42A 4QYRA 3M9MB 4FYYB 3JQMA 3GV7B 1B64A 2D9OA 3RAMA 2BJEA 4RZRA 1VQLS 2VBWA 3NLCA 2QX0A 1OYDA 3UD4P 4DR3F 2K3KA 2YWKA 3PM9A 4WFAQ 5J1EB 1M90T 5E0OA 3AJ2A 4CLZA 4NZ0A 5JMNA 4CRJA 4OYZA 2UUCJ 2ZE2A 1VDHA 2G0JA 2V9KA 5ETTA 4X84A 2WCXA 1S9GB 2E1AA 4LSLB 1VQ8S 3NGRA 3Q8QB 2BE7D 1AYEA 4U8YA 3T9ZA 1IBMJ 1U25A 2B5JA 4IFYA 4TKTA 3RB6A 4DR5F 2KKHA 2DXFA 3DLLQ 4C8NA 3GCXP 2WOMB 3NNCA 1F2GA 3HM9A 1CC7A 4B9TA 1F3VA 1Q8LA 4PUOB 2LDYA 3PW5A 3GIRA 5KFCA 3D66A 2IDLA 2HNYB 3HD2A 2C2ZB 2LU1A 2HGLA 3AJDA 4FF3A 5DDRC 1BGXT 1CS4A 4PPZA 1H2VZ 2CQ3A 2YWHA 2OPPA 3OVSA 4FNIA 5CXTA 5KFJA 2HMIB 2ZD1A 4C11B 1HBUB 3K5OA 5D77A 1N36J 2LQ9A 2LECA 4QJVA 4LIWA 3HT0A 2AW0A 3ZZ0A 1TL1A 2L9WA 2AJ2A 1HD0A 2XMAA 1VC6A 4MTPA 4NCGA 4RW7B 1YZ6A 1PJ5A 1ELOA 3KNAA 4JYAF 3GWCA 3H2LA 1F1BB 1UPPA 5K8NA 4WTOB 1VQYA 1OSCA 3I4PA 4PG7A 3IXQA 2HVIA 4DU8A 5HBMA 4A8QA 3AD7C 1M5SA 3PTWA 4OZ5A 3S7RA 1D0EA 1FKOB 2VKZG 1NSAA 2F8MA 1DJ0A 4F04B 2AJFE 3VGSA 2Z8QA 4RW4B 5HMZA 3MCOA 5J2MB 1NMEB 4KC5A 3TEHB 4HTJA 3FRYA 1VBZA 4U9RA 2M7SA 1YBAA 4BBYA 4ZVEA 4MKAA 4CM0A 4J91A 4ZN3A 3BPSP 5F9NA 2W9AA 2OO4A 1FJGJ 1BMQB 3TANA 1U1LA 5HL7Q 3IS9B 5AJ3J 4QOTA 1I3OB 4RWWA 4QZVB 5KFUA 5DQHA 4ICLB 1Q8IA 2V34A 1XK8A 2JHEA 3I0SA 5IWAJ 4IG3B 2NQPA 3Q8PB 2VG5A 1SQFA 5MLCV 5KT6A 4NASA 2HHWA 4TU9A 2ZH3A 3BYRA 2Y1LB 2EEYA 1RAHB 1QSYA 2IJFA 3TQEA 4ECUA 1Y3JA 1VLYA 2GO9A 3D4JA 1IBKF 3N9UC 2BW7A 3GU0A 1HIYA 3D0IE 2BANA 1KS2A 3SV3A 3EUNA 4FDFA 4X62F 3N6MA 1UVLA 2XB2D 2R7OA 5U47A 2VJUA 1YTYA 4F4WA 1S57A 4DUYJ 4Y3CA 2DXEA 3M05A 3Q24A 2JEGA 4FPRA 3AA8A 1HQ2A 1R8AA 3QRRA 2DH8A 1UCNA 2EK6A 3RBZA 1F5BA 3MD1A 1TK5A 5KG6A 4DSEA 4EU0A 2F4VJ 4M94A 5IQ6A 1FWPA 2PMZD 4DQQA 2RE1A 1HNWF 1HPZA 3FBEA 4K0KF 1TAUA 2BM1A 2QYCA 2EFNA 3FFIB 4UOFA 4DQRA 6FD1A 3THVA 2Q1LA 3LWLA 2BKNA 3K5PA 4J5OA 4FS2A 3J7A1 3O2IA 3CXCR 3OXFA 3L3CA 3IGNA 2R2SA 3CEDA 5DDPC 2KFNA 2QLBB 4PAAA 5LXYA 5HP1B 3QYYA 3LANA 3A8KA 2ZBIA 1KVKA 1EKRA 4F4KA 2WVCA 1IKVA 2G1HA 1BWEA 2N3LA 3C14A 2CPEA 2B8PA 1AW0A 1NK9A 2AEFA 2F63A 4KFBA 4LVOP 2ZZTA 4F50A 1J5OB 3MPDA 1NDLA 4O23A 1CJUB 2E5LF 2M9KA 1B7FA 2DGXA 2ZH9A 1U26A 1WEXA 2KZZA 1EZZB 1NZAA 4A8XA 2FGOA 2DNLA 2LQ5A 3BREA 4C48A 2N7CA 4UTGA 2W7PA 4N76A 1LFPA 1RISA 3VR1A 3EGWB 5J2QA 5KFZA 4KGZB 3B78A 4OX8A 2XMKA 2AIRB 4L3KA 4ETZA 4OYPA 4KIAA 5LMNJ 4W90B 4O0NA 1FRHA 1R0BG 3HSJA 3IRXA 3MZIA 1IM6A 2DY1A 5BR8J 1S7IA 1XR6A 4FXWA 4J7CA 2MSSA 1RP5A 1JX4A 1NH7A 1ZOTA 2KL8A 1VHFA 1I94F 3OL6A 1JLAA 4DV6F 2DHAA 3S6EA 4MKBA 1CC8A 5KFAA 1MSWD 1O6XA 4A8WA 4WZQA 3TUZC 1JLFA 4K4VA 2IPOB 2PD1A 1BC6A 2PEHA 1WI8A 4WCEQ 4KKOB 2H5IB 2R8KA 1U49A 2QZ8A 5KFMA 4DR2F 3MOZA 4PKDB 1H0HB 1TKZB 3V5RA 3A3NB 3KYLA 2O3DA 3R5AA 1MNEA 1VHIA 1BQMA 3GYXB 4DPWA 4AD6A 1WC0A 3W60A 1KTVA 1UAWA 3FEXB 2P9CA 3FDSA 4BCAA 4X2BA 2ZOGA 3PXGa 1TMMA 2F9DA 2VOOA 3NKYA 3BN4A 4U95A 4PG6A 2HIQA 3MM6A 1Z4UA 1HWIA 3M8WA 2QFIA 1KLNA 3HD1A 2Q79A 3HP6A 5L8RC 1FVSA 1QAJA 3AD9C 3RZAA 5GVQA 3E3XA 3W5ZA 2HZVA 2KFZA 1N5VA 1EX8A 1RTZA 4TY9A 2DXDA 4UZBA 1R3NA 1KLMA 2WVBA 3BH7B 1OMSA 1NRKA 3J81Y 1U1RA 1SL0A 3M6VA 4IH5A 1NBEB 4O44A 4IFVB 4C98A 3KLIA 4UY8T 5EWGA 3NCRA 2FC8A 1M1GA 1I5OB 3SBMA 4YFUA 4ED6A 2E9TA 3G6ES 4OZLA 4Y0FA 2VL1A 4NEYA 2HGMA 1X5SA 5L1KA 3CJ0A 5EN1A 4K4SA 3OL8A 2I38A 4ES1A 5EUHA 1SL1A 1HWUA 3CT9A 4ZVRB 4JI7J 1FDAA 3UN5A 5AXNA 1VR6A 3H7HB 3EPIA 3CCVS 5HMYA 4DFKA 3G8SA 2HBZB 4DL7A 3I9ZA 3EX7B 3MI7X 4QWDA 2DD8S 3M6WA 2XMJA 2HFSA 3W2VB 3Q23A 2ZC4A 1S1VA 2PSZA 4F0HA 1DLOB 4DUZF 4DR3J 4H4MB 4TQRA 4P73A 1GMVA 2C3UA 1S77D 3CCMS 1NCLA 2D3OR 3M8YA 1QDUB 4RPFA 4F25A 4FZVA 1LOUA 1VK3A 1BQXA 3IWNC 1F3FA 5H9FJ 1AFJA 2L41A 1FK9A 2E7WA 1KKHA 1NK5A 4FYWB 2LEPA 4NLTA 2NPIA 1RHKB 4X4VA 4LQ9A 1S72S 3C46A 4ED2A 2R7RA 2FIUA 1GMWD 2B6AB 3NMAA 4NL5A 4D3GA 4M95A 4PQAA 3ONQA 4NLPA 1U1NA 3JQKA 1J27A 1ICEB 4ZCKA 4NLUA 2OEJA 3MEKA 2AZ1A 1YJNS 2CPFA 1TTHB 4CWBA 1ZPVA 3DLEB 1E6YA 5DZ6A 5I3QA 3DHXA 5KFHA 2CQIA 2AEMA 3FSIA 3DU5A 4QR0A 2KFYA 4YY3F 4YB5A 1TL5A 1U09A 1X0PA 4DV5J 3BKTA 3D3CJ 2F3JA 4WFNQ 2A6MA 2X1GA 1WELA 1S97A 1OY6A 3EXCX 5FD1A 2BV3A 5HO4A 2R7WA 3DLGA 2YX7A 2ZBQA 3U1NA 1S12A 4GVBA 5KFTA 4LF6F 3NS7B 4CH0S 3E01A 2Q6BA 4FVCA 3W2WA 1BWVA 5K8PA 3W63A 4OX6A 3SCIE 4ZVPB 1M5HA 1C0UB 1FD8A 3QGPA 3T19A 3LAKA 3BYPA 3V81A 2P8IA 4MIWA 1GX6A 1RABB 4JB8B 5KG3A 3V6KA 4PXCA 4DI6A 5IM0A 2K06A 3GMGA 2FVPA 4ZP7A 1IXKA 1XMQJ 3J80U 3QFWA 1HNXJ 4IDKA 1RTJB 3D6TB 5CCMA 4J9KA 4I4BA 4DU7A 2UV8A 3JSBA 4UY85 4ECVA 1S99A 3OFHA 4V1Ak 4NPOA 3PIOQ 1S6UA 4TY8A 2R2TA 2NXEA 3D2WA 3QJJA 2B4OA 3MOJB 1Q8KA 3IR7B 4QW8A 3R27A 4CLYA 1S6PA 2RQ4A 4ZP6A 5IZHA 2VPYB 5KFYA 1IM4A 4Q8EA 1T3NA 3GIJA 1MROA 3CGIA 4OHWA 2RS2A 1WEYA 2V5HG 3DI6A 1LK5A 2YBVA 3HVTA 1NPPA 2PN6A 4OZJA 3AFGA 3I0RA 4HDHA 5D3GA 3K7RA 3BBBA 3BBCA 3RB4A 1TKXA 4XIUA 2FJVA 1HI8A 1G6BA 2YVSA 4RJVA 1KBRA 2WHOA 2Z30B 4DG1B 3QZ7A 4H54A 2BRKA 4QWAA 4AQYJ 4Q45A 1OWXA 3GIIA 2K2PA 2RIJA 1NKCA 1VISA 2VFUA 2ZH8A 4DMZA 4J9RA 3MGJA 5E7OB 2ZM6J 2Q43A 3W1YC 4Q43A 2XYPB 4EO6A 4I0WA 2XGPA 3TNVA 3OTDA 2QEXS 2LDIA 1GXTA 4JI3J 1TMJA 3AAWB 1RAEB 4WIQA 3FCVA 3PDNA 5CCLA 4DL6A 5E3CA 3CCSS 1B0VA 4M8LA 5IQQA 3CB4A 3V4IA 3OW2R 3DNCA 2IRYA 1R0AA 4CO5A 4P72A 3V4MA 2H5EA 4ALZA 4L75A 5J1EA 4F26A 3VALA 1RZMA 4OQJA 2WVDA 3H8YA 1P8GA 2G0IA 3QT5A 3FBCA 5DZ7A 3NWRA 4DFJA 2XZDB 5EX3A 3BSCA 4KO0A 3BM7A 1N8RT 1S9GA 4LSLA 3FQKA 4WWSA 4ZPWR 1R43A 2IY5B 3QJPA 4NRUA 5K5MA 4GVLA 2HG4A 3MCMA 3Q86A 1NB7A 2CA9A 2DVIA 2B8QA 3FMBA 4PUOA 2AYBA 4K4UA 3W65A 2HNYA 3LP0B 3M9NB 2XI2A 3ENWA 3JAMY 5C42B 4UUXA 1GFWB 5M2PA 5F8GA 2LEBA 1NNDA 4UQGA 4FF4A 3HJVA 3MUVP 5H1SV 4ECRA 3I5BA 4NLQA 1EHWA 2HMIA 2BVZA 2FJWA 3SFGA 1HBUA 2GZOA 2YH1A 4H4OA 3I32A 1RWPB 2BE2A 4FBUA 9ATCB 3PIPQ 1NJIT 4P2XA 4WE1A 1YGYA 1FKPA 1TELA 2C2OB 2CAJA 3SI8A 1TV6B 1X8DA 1IVZA 1SH2A 2XS2A 1NM2A 1NJZA 4B9MA 1RSCA 3R6LB 3B6BA 2KM8B 1UEKA 1W2BR 2YX4A 3MMCA 2ZNYA 3D68A 4TNOA 2LXUA 1YBUA 2VOPA 1XTZA 2V0NA 4YP3A 4TVAB 1U47A 4RW9B 2HBRB 1SKSA 4J9NA 2DB1A 5IFMA 3PEHA 1XNQF 5AT1B 5I4MA 2DH7A 5L46A 2J7WA 5IT4A 1NPRA 5D0HA 4CQ1A 1I94J 5ETMA 2DGWA 3BO2A 3AXMA 1S10A 1CSJA 2NUHA 3O5TB 2V2ZA 1T8EA 3VV2B 3KMSA 5F9LA 3KHLA 2J9DA 2A3JA 4RW4A 2JEJA 4IOCQ 3I4HX 5J2MA 3BGRA 1T94A 1HYSA 3M2RB 3NY0A 4W92B 2GJ2A 2HZCA 4Z37A 1TK8A 2FY1A 3O44A 2DHHA 4ZOSA 4N56A 4OI2A 4YR0A 4OV6A 4DR2J 3N01A 4C8LA 3DGVA 2LYVA 3C16B 2NXJA 2EI5A 5A8WB 2V9WA 3A12A 3G87A 3DLKB 3IG1B 2RKIA 3Q89A 1GXUA 4ICLA 2FJBB 1HQEB 2HHQA 1HQUB 3NGDA 2KHCA 2ACYA 1NJYA 1RT3B 1SQEA 5A8RB 4I7FA 2RUSA 3NNAA 1UWBB 2ZH4A 1R31A 1S0NA 5KT5A 2VQFF 4Z2XA 5ETNA 3OQ2A 1U1QA 1F5AA 3IGVA 3WDOA 2FB0A 4DV2F 2HWTA 1QVGR 4KHMA 1VRQC 3OXLA 3J7ZT 4ID5B 3ELHA 3CE8A 3ZTPA 2CJQA 5ETKA 5AE1A 4WU2A 1WC1A 3KG0A 2MZRA 5KG2A 2RRBA 2IAJB 5E3RA 2OSQA 2VV5A 2YXLA 3A8IA 2AT1B 2GW8A 1Y5IB 2B4PA 3VAIA 1U4BA 4BLGA 3R5BA 2F1FA 4YMEA 4P2MA 4USKA 2OEMA 5E3QA 2OAUA 2IFXA 2DR5A 1H38A 4ZPBA 4ILMA 4IOAQ 4NLRA 1S6QB 2OFHX 4JI4F 4LFBJ 1VCTA 2K7JA 3FFIA 2O1PA 2OELA 4KR0B 1EQ0A 3V6DA 2Z56B 5DGAA 1WDTA 3WHIA 1FXRA 4M5NA 2IM3A 4R25A 1UTAA 1J5EF 3RU0A 2IRXA 1SC4B 3N79A 4ENOA 3K5NA 3MTJA 1MLAA 2LXFA 5IC6B 4C0BA 4DOZA 1PO6A 3ILJA 4M5HA 4S0MA 4EBDA 2XMMA 4RLEA 4OMFG 3PY8A 1TL3B 2CQ4A 4G1IA 2GMLA 4F67A 3NRBA 2BKPA 1YKWA 3QFHA 1J5OA 1OO0B 3D0HE 3RTVA 5B0GA 5H9FK 1VBYA 4UT4A 2QLJB 1CJUA 5IXUA 4BHQA 1IQZA 3ZZTA 3GFHA 2RU3A 2HHHJ 4UOGA 1RAGB 1K73T 3ZZUA 2UVRA 5GAGU 2IA0A 2G9OA 4O3QA 3HKZD 2Z2ZA 3UD5A 3MURP 1IBCB 2EBEA 5AE3A 5HQLA 3H4DA 2VFTA 2WK4A 5F41A 3OL7A 3PACA 1AZSA 2WONB 4B3MF 3TEGA 3PYGA 4IUFA 1YSJA 3EDRB 1FVQA 4IQMA 1DBDA 4B3TF 1X60A 4DV1J 4K5SA 3M8ZA 2X7IA 5HLFB 1DTTB 2V8PA 4M5DB 1YQHA 2L08A 3IR6B 3BJYA 4EYHB 2CPXA 3KLEB 1SPBP 2M2BA 4LBHA 1UJ5A 2YY3A 4B3OB 4BC9A 3P96A 4HT7A 3Q22A 2ZDOA 1JQGA 3BN7A 3CCZA 5KG5A 3G6YA 2YNGB 2GX8A 2VH7A 2XZWA 4K8RA 4HACB 2G2OA 5D6GA 2X3DA 2HFVA 1JB0C 2LVWA 1RTHA 3IR5B 3H59A 2BBEA 1SIWB 3W9JA 1TKZA 2HSEB 2BX6A 4RO0A 2CJAA 4F4XA 3G9CA 4FPIA 4I2QB 1FEHA 4EBCA 5C5JA 5IV4A 3RAQA 3LOUA 2RD5C 3SEOA 3ZZOA 2IA6A 2OKQA 5MAOA 1FRKA 2AZ3A 2V2KA 3SDEA 4EEYA 4X64F 3W5XA 3CCQS 3M8PB 1TAQA 4FVMA 4WU3A 1Q7LB 4LF4J 2OI2A 4RUBA 3FQLA 4IO1A 4YEAA 2MXYA 4E2FB 1KVIA 2GC8A 1PYOB 2D69A 2R4FA 1ZM3A 1N0UA 1UW4A 2B43A 3JYTA 2E5JA 3NCQA 5DDQC 1RBLA 4DQIA 4QWBA 2D1CA 2MKKA 2F8EX 1S76D 1QTNB 5BYQA 3ILOA 4LT6A 4Q2MA 4IFVA 1MG7A 3ETOA 3MUTP 3HULA 1UA0A 1HHQA 3OJUA 2OD4A 1JKHA 3T5HA 2P9GA 3PRBA 4KB7A 2KRBA 1SUQA 4ED0A 1TU0B 3PV8A 2POKA 4XK8C 2E1CA 3KLVA 2VJVA 3KJVA 1XMOF 4DR4J 4I69A 1OQ3A 5J1PA 3RW7A 4ANCA 3BGUA 4IOBA 2QJ3A 1KNZA 4YOEA 1P9YA 1RHMB 4DCPB 3PCOB 1XNRJ 2UXCF 1NDCA 3KHHA 2KB2A 1RAAB 2CJBA 1RU2A 3QT6A 3OPKA 1QAIA 3R2CJ 1Q8BA 3CJ5A 4P2SA 1CBKA 4Y2IA 2VFVA 2QA2A 1LW2B 1U8WA 5KG0A 3W2VA 5EWFA 4ID8A 5L38A 2VPXB 2Z2MA 3LA0A 4I6AA 2JSXA 2QL9B 2OLWA 4AE5A 2BJ8A 1DLOA 1ZAWA 1M5KC 3ADAC 3SCLE 4DV7F 4Q2LA 4KHRA 2DNGA 2YQ3A 1ZA2B 3VHQA 3BF4A 2OH2A 3Q8RB 2OSRA 2JVRA 2XGQA 1IKXA 2AU0A 2J9EA 3UN3A 3DOMA 3W9HA 4RUCA 3LW5C 4NYOA 8AT1B 4GMKA 4L72B 2XCAA 1Y3KA 1CULA 5C25A 4OLOA 2B6AA 4KYZA 2YTCA 4Z7YA 1NK4A 1DTQA 3N5FA 2YKAA 2NPFA 4GRSA 2K3IA 1YDLA 1U0HB 4WK3A 3CC2S 4UF4A 5AE2A 2W2QP 4N7TA 2VFRA 1D3WA 1VS3A 1G3OA 4NI2B 1KD1T 2ERRA 2DK2A 4FXDA 3KG1A 2DHXA 1UFKA 3R8YA 2MB0B 1HNIB 3MMJA 1U24A 1U0SA 2KVIA 3OSPA 5B0DA 2NSCA 4DSJA 2G4BA 3SQOP 8ATCB 3AD8C 1TVRB 5HJXA 2FHJD 2XSJB 3W64A 5CYQB 1TP7A 5E2QA 4ES2A 3UW1A 1S0VA 2DYAA 5LSRA 4A8SA 3R5CA 3OBIA 1GEHA 3MCSA 1VQ7S 2ATCB 2ZC3A 1C0UA 1YJVA 3CSKA 2XHCA 3I96A 1DURA 3UVJB 1S4EA 2DR6A 1UVMA 2YWWA 3I5CA 4QIEA 1T9UA 1XNQJ 4EZ6A 3MEDB 1MMLA 4CYUB 3SIPB 1VQKS 1FF2A 3W62A 5L9NA 2FHOB 1RAIB 1TKDA 1FNXH 3I9V9 3H2VE 3L4BC 2HFUA 3HKWA 1RTJA 4RW8B 2E29A 1RT5B 5KFRA 2JWNA 1SV5A 2YQ1A 4KT0C 1CJTB 4RW6B 4HHJA 1NK6A 2RU9A 3NS5A 3P5TL 1RTIB 2Q3PA 2Y0BB 4E8UA 4DPXA 4QU7A 5D8HB 2VBZA 3H42A 2UVUA 1Q79A 1X4GA 4NA2A 2FJDB 4Q44A 3FC9A 1W2IA 1QM9A 3QSIA 1VQ4S 2P5VA 2HRTA 3BQ2A 3K2YA 4DL4A 2H9ZA 4OZ1A 2YWGA 2HQIA 5GAGI 4JI5F 2A18A 4B3SF 2CQCA 2R3VA 3WX4A 5DLGA 2VONA 3TOQA 2ILZA 2GVDB 3C66A 1F60B 1UL3A 1FE4A 1PJ6A 2XS7A 2XBPA 3CDBA 5D0GA 4DG1A 3OR1B 3I55S 1S9EA 3OLBA 1NZ8A 1PAEX 1VC5A 5F0WA 1NXIA 3JTPA 3ZXWA 3E51A 4ZHRB 1D9AA 4DV2J 2XSFA 1S59A 4U67Q 4XTTA 4QQBA 3D1OA 4LFAF 1YJ7A 3GR1A 2LU2A 2XM3A 2R9LA 2YQ0A 2EFPA 3CUNA 3GZ7A 4J9QA 4Y2KA 1D09B 1WOSA 2BA9A 5IT9Y 1BQNA 5C2GA 3CMQA 2BQ3A 1YX2A 1PC4A 3K89A 4CO0A 4EK2A 1SXLA 3QWPA 4RBUA 1URRA 1RK8A 2CJKA 3G6VA 3HHKA 2HBQB 2MZQA 2QMWA 3MMAA 4NLGA 3ZZZA 1C0TB 1RT4A 2GAHC 3WC0A 1B7YB 2UXDJ 2FJAB 4JI4J 1HKAA 1HFEL 2E7XA 4LF2A 4LBIA 3PRVA 4KV8B 2VDIA 2C2RA 4PQUB 2QLWA 4LUBA 1HNZJ 3BSNA 4KTQA 5J1NA 5LJ5Y 3JTOA 3GB0A 3QT7A 4G65A 5C42A 1T9VA 4ILLA 3D1QA 4X4NA 3G82A 2KTQA 4MK7A 5IT0A 4DSLA 1HBOB 1FNOA 1P6TA 3C3LA 3BPDA 3X3UA 4CTAA 3KNGA 1IKWB 3UWTA 2PFFB 2K1RA 3DMJB 3HFKA 4I56A 1V5VA 1UVIA 2XMUA 2U1AA 1WWHA 4ZK7M 1LNQA 3SXLA 1CVJA 2HAIA 3DOLA 5BYSA 3BR8A 4OI6A 1TV6A 2PFDA 2YKNB 2EFVA 4WIIA 2X51A 1QUVA 2OPSA 2C2KB 1YJUA 4O0IA 5KFLA 5A76A 3CPWR 2HNZB 2Z58B 1M0SA 5EGYA 2V4QA 2HHXA 1HI1A 3LTOA 4XPCA 1FNMA 1JLEB 3TA0A 2HEKA 2XWYA 2C28A 4JI1F 3KK1B 6AT1B 2F7VA 2VG6B 4J37A 2EFQA 3NEKA 1DQ9A 3R5JB 4RL1A 3SSRA 4NLSA 4F0MA 1FXDA 4N77A 1EETB 2OMLA 2P6SA 3H0PA 3DYAA 2QTWA 2C42A 3M2RA 4LMZA 3ULHA 4HL9A 3G96A 2QFJA 5I3UB 4K59A 3KUHA 4ZLNA 1HW8A 2GQQA 1FDNA 4G1PA 5HMXA 4HEA9 4KAIA 5A8WA 4U6PA 4IRCA 2VDHA 3DLKA 2BOPA 4MT1A 1FDBA 1NLKL 3Q0AA 1N34F 4TN2A 3HHLA 1C1BB 3EDQB 1HQUA 3RJMB 3TARA 1WG5A 1WHYA 2MGZB 1RT3A 2VU5A 3D6MB 2Y1RI 3TAMB 2UU9F 3G6XA 5D4PA 1NO8A 3ISNC 4QWCA 5DS7A 5KFVA 1UWBA 5F8NA 3VGUA 2B51A 1NAQA 3CJ3A 2RVJA 2KJVA 4CT8A 4J9PA 5HATA 2FC9A 4USTA 4RBVA 1TL7B 4KH0B 1HHTP 2DPIA 5KFEA 4QPXA 3I56S 5E3AA 2DR7A 2AJ1A 3HI9A 1M1KT 3PW2A 5LM7E 3OVBA 4ID5A 4QIWD 1IN0A 3P8BB 1ULRA 4UUWA 4PG8A 3MFHA 2W1BA 2IAJA 4DR7F 2AJ4A 2GCFA 2RB7A 4O3NA 1RGVA 2CQBA 2DPJA 1XMOJ 2XTJP 4ED1A 1FX2A 5DLFA 3UI3A 3QGIA 2OFGX 4J9MA 2VHGA 3V2UC 3KDNA 4OYAA 3I5AA 2UXCJ 5D0EA 2ZOFA 1GX5A 2C3YA 1PAUB 1XC9A 1S6QA 1G2EA 2BACA 2NCKL 1FESA 2CVIA 4K4ZA 2FQQB 3KLGB 4DR1J 5KTQA 4XDCA 5DG9A 3P4UB 1F9HA 1F9EB 1FJEB 4OZ3A 3WIUA 1LWXA 1N5YB 1C1CA 2KI2A 2ZKUA 2IVMA 4YB1P 3MMBB 2RS8A 1ZAXA 3LP1B 2ASLA 1E6VB 1MN7A 1D9DA 1ZM2A 5GAEI 2AJQA 4CNYA 4RUHA 1RHUB 4CO4A 3DLJA 5D15A 4WP3A 4XAKA 4F4YA 4ELUA 3K58A 2CQGA 1NEEA 1A9NB 1WI6A 4OYXA 1RT7B 2GGPA 2FVQA 4IR9A 1ITPA 3OLAA 1U6BA 2WTFA 3OR2B 2KZMA 1AXQA 1H6KX 4DZ6A 1KOHA 4ZMMA 1H74A 4HH0A 3CJTA 4YHHF 1UVJA 1RT1A 2XYGB 3G4SS 2MHEA 2PIIA 1KR4A 1TR0A 4BWJA 3SSSA 1N5TA 3MR5A 3HF5A 2OIHA 4B9VA 1XEZA 1HBNB 3BGOP 4O3SA 3R7SB 3DOKB 3MEGB 3MF5A 4EGLA 4O4GB 3U27A 4IG0B 1JNZB 2GO8A 2YNIB 2AF6A 1ZPWX 4ZP9A 2QIFA 3PVXA 4KGMA 1NSKL 3ICLA 3DRSB 5HLFA 1XJWB 4P2FA 1VGYA 4M5DA 1NJXA 2JVOA 1T3OA 2YNFA 1RTDA 3RR8A 2RNEA 4I2PB 1H7XA 4DXLA 2BQRA 3QJLA 3JSMB 3MR3A 4K5RA 1FO1A 2YNGA 4AL6A 4HACA 2VBXA 2MQ8A 3KLHB 3DHWC 1N6QA 2J9DE 5HMWA 2HRUA 4LFCF 4N8OA 5A8KB 3CMAS 4LF7F 1SJ4P 4I2QA 4CLWA 1VQSA 1RT2A 3N0VA 1QVFR 3JSYA 1RYSA 2MJNA 3IWLA 4JI2F 2AD9A 1NHKL 5HK4A 5KFGA 4MAKA 3TA2A 3ZTOA 3OUYA 5GAHI 2GMHA 2CPZA 2MLXA 4L76A 1SKUB 3CDEA 1H3DA 5EDWA 3D6FB 2W7OA 2XEXA 4ZCIA 3RG6A 3MECB 4B02A 2XYHB 1O5JA 3H98A 4XO0A 2FLNA 2M88A 1RWWB 3AHPA 3ILLA 1QSLA 2NZCA 1RAJA 3V6HA 1DRZA 3H20A 4PRFA 1VQ6S 5F8MA 3R97A 3GV8B 3SSQA 1NDPA 4UOCA 1JXLA 4KGKA 2WVFA 3OHBA 1GT8A 2R7UA 3MAAA 3CVKA 4JI5J 1DAXA 4N8NA 3W8GA 1M5VC 1S1UB 1SIZA 1H7WA 4YB7A 2UUBJ 1XR7A 4NLDA 4U7CA 3PO5A 3FGVA 3HMJG 4CDIA 1R8HA 3QWUA 4ZVHA 3TP2A 5BXIA 3GPAA 3WQPA 2QMXA 3HPOA 3FVYA 2EXUA 5DQGA 4CZCA 5CYJA 4ZCMA 4DR6J 2CXEA 4MYUA 1D9FA 2QE5A 4LFAJ 1S4FA 4PYDA 3TRGA 5G0RB 4A48A 1K1QA 2VPWB 4EFAC 1DY3A 2CPDA 2AMCB 2PGCA 2NLWA 2JC1A 1LW2A 4HH1A 3CJKB 2IC3B 1ZH5A 1ZTWA 2D3O1 1SKWA 2PC6A 3OFGA 2ZH1A 4JV2A 1PIEA 3AB4B 1FTCA 5ITHA 3MWBA 4NX9A 5EX0A 3DRXA 4B3RJ 2HAFA 1REVB 2NZ4A 3K8WA 1YBTA 5LSOA 3NCPA 2AYEA 4U7UK 4PABA 3TX0A 2HRYA 4OHYA 2QLFB 3T6JA 5K8OA 2OPQB 1YWXA 4DV3F 1XN9A 1U0HA 4CLLA 3MEEB 2KU7A 2JL9A 4OI3A 5ETPA 5HN0A 3TUJC 4OL8A 4NI2A 1OSDA 3NNHA 1XQIA 3TR5A 4GKJF 4KRWA 1T95A 3LWMA 2IBOA 2W4CA 5M2RA 3L95X 4X4UA 3M8QB 1DARA 4F4AA 4OZ2A 4NCAA 1LV5A 1KRPA 3X1LB 2RILA 4PXDA 2W7AA 2RJZA 1XERA 3PFEA 1BXNA 2GVZB 2VQEF 4QYZJ 1TVRA 4ATNA 2XSJA 3ENQA 1TUWA 4C4WA 1L3SA 2G13A 3UNGC 3M30A 4JBCA 4ECTA 5K14B 3G8QA 2MDAA 3GJSB 2XY5A 4H4KC 2DR8A 3KJNB 3Q83A 4L73A 3CD6S 3MEDA 4CYUA 2H48B 1CS4B 4J9OA 1V6HA 4OX7A 3KFWX 1S5ZA 3A4TA 3VAJA 3FUYA 2ZD1B 2OD6A 1RT5A 4DJBA 4ZIWA 3D5MA 1CJTA 4RW6A 1RTIA 2PA8D 1T7PA 4C7QA 2YWFA 2J0XA 1N0VC 3OTEA 3KK3A 5RUBA 3THPA 5EWEA 3F44A 2HIYA 3J7YU 4DL0C 2ABYA 2PMWA 1U1OA 2HVZA 4F2RA 1RLCL 1KC8T 4ANEA 3LP2B 2B3TB 3AQOA 4JI0F 4CO3A 1F0XA 2H3EB 1U1KA 1VOMA 2MQQA 3ETMA 1N34J 4CT9A 2H4WB 1WSRA 2IJNA 4OI4A 5KFIA 1WOOA 3OHAA 3T41A 4OIXA 5HBMB 4LF1A 1PCAA 1WHXA 4C8ZA 3A3OB 3UR0A 4F7VA 4LSZB 5H9EJ 3QIPA 3UE2A 3OR1A 4DPUA 4OYWA 1VQ9S 3MUMP 3TZYA 1VBKA 2IYIA 3K17A 2MJUA 3HVAA 3DGPB 2ZEJA 4OV1A 2CQDA 2V8VA 3GLJA 4ZHRA 5KFQA 2LLZA 1MN9A 1Q4RA 1R8PA 4ZVQB 3GR0A 2PDAA 2VC1A 2QC3A 3HVRA 1HNVB 3FBFA 5F3ZA 4DR7J 4ZPAA 3D1HA 4G1QA 1ROFA 2HFZA 1WF1A 2L3MA 1LWFB 1O8BA 2BJ1A 2MYFA 3I0SB 5A6PA 2UXBF 5HVGA 1QAXA 2RUGA 4A47A 3VGTA 3GCWP 1SH0A 1S6OA 4AT1B 3KLFB 2ZVIA 5GADI 1C0TA 1Q1KA 3FSXA 2HQFA 5B0FA 4ETXA 3HK2A 1N48A 1ACMB 2RH3A 5KFOA 3UCZP 2UUTA 2XNRA 4UZCA 2CJ9A 4DV0J 3NMRA 4NZ7A 4WBFA 5L1LA 2D7SA 3CULA 1N52B 5E33A 2XCPA 2ZBCA 4RNFA 3QT8A 2J6SA 4PPDA 2ZH5A 2GS8A 3J81U 4YQWA 4K50A 1TZ0A 2QL7B 1HBOA 5A2QY 3SFUA 2LKZA 2HVDA 1DHMA 2RDJA 3DMJA 2G1DA 1YK9A 1IKYB 1VRUB 2UUCF 1R8CA 1UMJA 2B9XA 2BXJA 3BQ1A 4FF1A 4DFPA 4YHHJ 1T9TA 2MZ1A 3ENVA 2P9EA 2Z0GA 2CPHA 5KT3A 1U48A 1YRXA 3VAGA 5F3TA 2QSFA 3PJWA 4C3KA 2N82B 4LRAA 3H40A 1RHJB 4DL5A 4C3LA 2HNZA 2CDQA 1YITS 1IKVB 4AFFA 2BKOA 1HWJA 5DETA 3C14B 4ZVSB 4YDDB 3THTA 4NXMF 4USJC 4DX6A 2HS0A 3KK1A 4KFBB 3WBZA 2LA4A 3T5LA 1UETA 2UUAJ 4MYTA 3MHYA 3QO9B 1RA6A 1X4FA 4JV0A 3IN5A 3BO4A 4RWXA 2DNYA 3C6UB 1N36F 2JJ4D 3BKFA 2ZH6A 1HMVA 3B54A 1SC1B 2XNQA 3C6TA 1KN6A 4XDDA 4NRTA 1K9MT 4USIA 5T7LA 3MPYA 5JVGQ 5I3UA 3DRPB 2MTLA 4LFCJ 5J2QB 3MM5A 3NXZA 4LF7J 3KMQA 2M0GB 2NSBA 4Q0BA 1HARA 4DX8H 3JSRA 3RB3A 4NWBA 4HLBA 4L3NA 1RBOB 4ED5A 2C2MB 4A8OA 1C1BA 2V67A 5HROB 3DCAA 2MGZA 5LJ3Y 5T14A 1FXLA 1M1HA 2NXUA 4DV4J 3HJFA 2GIFA 3DRRA 2HPUA 2ASJA 1JLAB 1LWCB 3DLHA 1CEZA 2DY9A 1D1UA 4WP8A 3NL0A 3GQCA 2UZAA 3DDKA 5F8LA 1JLFB 3JQJA 5B0BA 5BYRA 1TL7A 1RWKB 1X5OA 3R5GA 3IA0A 4X65F 2MQNA 4EO8A 3O1LA 2VA2A 4LR8A 3R7NB 3LUYA 1FJGF 2FLOA 1Y5NB 3GG1A 3VQTA 2QG9B 2J0SD 4I6YA 1WG1A 1BQMB 2LQJA 2OGUA 3ILIA 3GIKA 5I42B 2V2QA 2MKYA 3C19A 3TVKA 2W9BB 1RQ0A 1KQFB 2F40A 4C97A 2N3OA 5CAAA 1X4DA 1TUVA 2XI3A 1X5TA 2J5AA 3QPIA 2VZ9A 2FHMA 4ZLPA 1C4AA 5KFKA 1AB8A 2CNOB 3KHGA 2NREA 4M5LA 3I87A 4A4JA 3BDEA 1RLDA 4J90A 1ZYQA 3HFZB 1FJ7A 3KLGA 3DXSX 2N4DA 1KEKA 1N54B 1SKRA 2Y8YA 3U1MA 3HHNB 3QZ8A 2V4JA 2HLUA 2O66A 1N5YA 2DNRA 1N5QA 2MY8A 4O44B 1JLQA 5M2UA 2C2EA 3MCNA 3KLIB 3KHRA 3J7YI 4HT5A 1X4AA 1SJ3P 2ROEA 2J0WA 4DN0A 4I6WA 4USVA 4LVNP 2DNZA 5ADZA 3GSIA 3PKMA 3QIDA 3W66A 2E9RX 1FCAA 2HHTA 3MM9B 1KQKA 2QA1A 4W4MA 2W2MP 3OR2A 3T1AA 1HHSA 3EZ5A 4ZIVA 4DR5J 3LQVA 1JLCB 2V69A 2X1BA 2XLJA 3UDEA 3M2UA 4DEZA 1WORA 3IAM9 4DS4A 1HBNA 2AV5A 4GKJJ 4MKYA 3MEGA 1MWYA 3VAHA 4IG0A 2CPJA 1HBMA 1REGX 2R2UA 2MQMA 4RR5A 4NYPA 2VG7B 4DLGA 3DRSA 2XC9A 2VQEJ 3D28A 4FN5A 1JLBB 3VF0B 3TWZA 2ASDA 1MMDA 4QYZK 3SQGB 2VFSA 4I2PA 4UW2A 4LSNB 2EWHA 3EZOA 5KFXA 5HVHA 4QW9A 2HQ3A 3JSMA 1R89A 2MZTA 2DGTA 1R6VA 2NYHA 2H4YB 5J2NB 3QQCD 2ZUAA 4RKUC 3T6BA 4CM2A 3US5A 3KLHA 2C2NA 4TXSA 2X3GA 1RWXB 3PNIA 5ETSA 4JYAJ 1E6YB 3IM8A 2D9PA 4FYVB 2M4MA 1MMNA 3QAUA 4LF8F 2MEWA 5LMNF 3M8SA 1CJKB 4C8OA 9RUBA 1QE1A 3K5MA 5B0AA 4OJGA 2W9CB 2I2YA 5BR8F 1B70B 2GIQA 1MU2B 2IVFB 2AX1A 3BSAA 3GJQB 3MECA 5KFSA 2AQ4A 3UCGA 4OYBA 2RHQB 3E01B 1RWVB 3W2WB 3W3SA 4JI0J 3HVWA 5J2PB 1RYRA 2H51B 2DEJA 5C24B 2BJ3A 3AXKA 4KPCA 3V81B 3KJQB 5KT7A 5IM0B 1FWKA 1S1UA 3MM8A 1MWQA 3BV8A 4ANDA 3CJRA 2R7SA 1VIXA 4MMOA 1PJ7A 4RNHA 3L09A 5H9EK 2W24A 1RWUA 1N32F 2VB6A 1WKKA 5LXRA 4EMDA 4EBEA 4QCLA 1IBKJ 3UPFA 4DUTA 3VZIA 2XWXA 4C6AA 4X62J 3TX8A 2B9YA 3I6PA 2DISA 3TW0A 4AYBD 3EPGA 3CJKA 4PWDA 3EXYA 1GTHA 4PR6A 4CH1A 1Q82T 3DI6B 2DIVA 4USMA 1P27B 2UXBJ 5BJRA 1SBRA 4YR3A 2ZKTA 3I0RB 3K57A 4DQSA 1LWEB 1TKXB 4WF9Q 1VBXA 2M3DA 2M5YA 4F4ZA 4IO9Q 3EVWA 4P74A 2IYGA 2MQLA 1TL4A 5IV3A 3CDAA 1HNWJ 1REVA 1U1MA 3G8TA 4K0KJ 1F2HA 2O5DA 1WC5A 4AL7A 1Q5VA 1NK8A 3BGLA 4LR7A 2A2DA 3J7AN 4JI7F 2ATLA 3ISND 3POTB 4ED3A 2IM1A 2FYXA 2WW4A 3R7BB 3CNQP 1RACB 2V6AA 5DG7A 3MEEA 2WOMA 3W7BA 3A8EA 1YJTA 2E1PA 4LR9A 1KQGB 2Y1JA 1GAOA 3V4IB 2CJYB 4M1KA 1RHQB 5FLXY 1ZA1B 3S8SA 5AXMA 2KM8C 1R0AB 2DGOA 3CO9A 2HYIB 1ZAVA 5LT5A 4IRKA 3M8QA 1IR0A 5F8HA 4Y2MA 1VYAA 3FMWA 1XR5A 3CCLS 2COLA 1R0CB 2DNQA 5FDLB 2ADBA 2GVZA 2ADCA 1FWLA 4KO0B 3TO8A 1VK8A 4F3QA 4C11A 2E5LJ 4LF5F 1FRMA 3CC7S 1RT6B 1FFWB 4X4QA 5AXKA 2W4DA 3N6LA 2BEFA 2HURA 4WFZA 4K4WA 1WOPA 3FNNA 5KAKA 5DGBA 1HLWA 1SVDA 1FKAF 4Q7AA 5K14A 1FA0A 2L9DA 4B08A 2HNDB 4C2MA 1S48A 1FRIA 1EQMA 2GHVC 4LBPA 4RW7A 3TUPA 3HLUA 2PO4A 4ZJQA 1FT8A 4NXMJ 1VLOA 2H1YA 2I8EA 1D8YA 4OI0A 4CP5A 4LF9F 4KBIA 4A8KA 2RSQA 3FZBA 1FE0A 1GMUA 3PW0A 3MR7A 4H4OB 5F0UA 5JVHQ 1N5SA 2BE2B 2HK3A 3HHLC 4DV5F 4DV6J 2ZJPQ 3A13A 4L6V3 1FKOA 4KHPF 2MZSA 1X4EA 4WE1B 1VIOA 3M2VB 2FVSA 1FKPB 3AOCA 5KFNA 4ZCLA 1JJ2R 1WF2A 4JV1A 2XMVA 3BO3A 1T03B 2EFGA 1WKLA 1X4HA 2LP4A 3CD0A 3LP2A 1KHVA 2ZZMA 3MMCB 4WYWA 4ES3A 4RU9A 1WEZA 3R2DJ 3UCUP 4B9UA 2EG2A 2NUUG 2IDEA 2CZ9A 3AOBA 2DNMA 5GMEA 3IS9A 3V6JA 3KOAA 3H25A 1AFIA 3LPYA 1XMQF 2AEJA 2E1MC 1HNXF 2VC0A 3BSOA 2J6TA 1GH8A 4IG3A 3IBWA 2BABA 3H4BA 1QUPA 4U7UD 3DGPA 3D6HB 3WX8A 2YNHB 2MY7A 2NXNA 1WUUA 4HI2A 2FPHX 1KOOA 1VRTB 3BGRB 5CYMB 4DPYA 1HYSB 3F73A 3MPWA 4X65J 2MHNA 4ERDA 3CCTA 3K0JA 1MWZA 1T9WA 1KFSA 1HNVA 4P10A 2KG1A 1XWLA 2GA7A 1IR2A 2KXHA 1UFWA 4AXIA 4CH7A 4QR2A 2PA3A 1LWFA 3U02A 2RKIB 2D3UA 4KGXB 1LFWA 1UJ6A 1OPZA 4X4OA 4OHZA 2V50A 3PR4A 2VODA 3RB0A 3T3FA 2I6WA 4R0EA 4V19X 3CD7A 2CQ0A 2LMIA 2FTRA 2E66A 4I7FB 2CFXA 3GTYX 3M8RA 3KLFA 4PCQA 1DQ8A 1KDNA 4WXWA 2RQKA 4DX5A 2KYXA 4F36A 3P45B 1A6LA 2V4RA 4AQYF 3IWXA 3R6GB 3Q8VA 2J7UA 2VBYA 4IR1A 2Y0SD 2ZM6F 4MFBB 1P1TA 2Y3YA 2HVEA 2LA6A 3RBEA 3OXGA 2VKRA 3KUEA 2OMOA 4JI3F 4FP9A 3CCWA 2DJWA 2V2VA 2KT3A 3H5XA 1Z1ZA 3CCJS 1SC3B 5HP1A 3IC1A 3MM7B 4DUZJ 4DF8A 2CNLB 1VFJA 3HFVA 2ALZA 4CLUA 3T1HF 1N33F 3CJQA 3L7PA 2AGOA 1NJWA 3N4WA 2HBYB 4DSFA 1GMWA 3PYDA 1X4BA 2XMWA 4ZPDA 1IKYA 1G1XA 1VRUA 1FD2A 4MIBA 4IKAA 3NGUA 3AA9A 1R6YA 1X9WA 3V6DB 4XPEA 4NA3A 4HVZA 2Q66A 4N5SA 1EARA 3R1LA 2EW9A 3TZWA 3JS9A 2BJ9A 1U2CA 4UQTA 2RAQA 2GQCA 4NOHA 2ACMA 4GC7A 2E9ZA 2YKQA 3TUIC 2FZGB 2FUG9 3WIVA 2I9SA 4YY3J 2Q6CA 4FS1A 3QO9A 2VICA 3CO0P 2W25A 1K0TA 1UVNA 3EICA 3C6UA 1FJCA 2R7TA 1AUSL 2KJWA 4OHXA 4LF6J 4U8VA 3E8OA 2VA3A 4BS2A 3TI0A 3DRPA 5B0EA 4FBTA 5K8MA 5K20B 4FXVA 4YS2A 1AZSB 1I1GA 1IBLF 4KKOA 2CRLA 3VAFA 4LF8J 1APSA 4NEZA 1SQGA 2UUWA 2HFNA 1B3TA 4PG4A 3GJRB 2D74B 2HZAA 5HROA 2L9NA 4DF4A 4ILRA 3PX0A 1LWCA 3OTBA 4LJMA 2MLYA 1TUGB 4E98A 2DRAA 3S1TA 1RWOB 2HGNA 2DEIA 2XZTB 3OJSA 3PW7A 3PJXA 4OZ0A 4RNNA 3ZZPA 2H5JB 1RTHB 1RHRB 1Y10A 2L48A 4WPAA 2Y1IA 1UWAA 2QGFB 4RX6A 1YG0A 3MFIA 3MR2A 1PBAA 3Q8SB 3RR7A 2HLTA 1OIAA 5D78A 2N4CA 2PI5A 3UQSA 4F02A 4IQXA 5I42A 3VVUA 2BZ2A 4NCBA 3VVTA 1P9QC 4A8MP 2W9BA 4HTIA 4J9UE 3PG9A 2A6OA 2J6UA 1CQNA 5KFDA 1RI7A 3T5KA 1N32J 5ETRA 4NMLA 3GP9A 2R8JA 2C2DA 3SDEB 2WAQD 1IJFB 2JLEA 2DNOA 2X1FA 3LF0A 1WC6A 7FD1A 2RDDA 2GQ2A 4R0JA 2CPYA 1WC3A 3KK2B 4ITSA 2C3OA 2ZUGA 2ILYA 2LCWA 3JYTB 1PYTA 2B0GA 4JUZA 1RAOA 5HANA 5CD4A 2RQMA 2XULA 4WTYA 3CDWA 1BUXA 4ECYA 4Q5VA 4R5PB 2CJXB 3BKUA 5SUHA 2G0CA 1CJVB 4P75A 1JKHB 4NLYA 4H4MA 4Q8FA 1Q53A 1OY9A 1SUQB 2APOA 3KJVB 3ZNUA 5ETQA 5DQIA 1PBUA 3O8WA 3A1YG 3PEJA 1S0MA 1YHQS 4NLXA 4C0OC 3HT3A 3MM9A 2QLXA 4WFXA 1U6ZA 2CNKB 3M32B 3BEGB 2AYMA 1JLCA 4LFBF 4M5MA 2RDIA 3AQPA 4ED4A 1A7GE 3MTKA 4Y34A 2R8HA 2KO1A 3DXBA 3TJ9A 3EVMA 3AODA 2MKIA 5IT9U 1DQAA 2RHSB 3UDVA 3LO3A 1SJ1A 3DLEA 2OPRB 2VG7A 1LKZA 3I82A 3NGTA 1IKXB 3WZ0A 2KXFA 4PZVA 5GMKa 1KVJA 3DOMB 2JH3A 2AHOB 4LF5J 1JLBA 3OTCA 2R7VA 3AOAA 4YN3B 3SQGA 4JI6F 4QWEA 3W61A 4LSNA 4LRBA 4RBTA 3D3BJ 5A6WA 3P3DA 5HSPA 3EGZA 1CULB 2GNKA 1FFGB 5C25B 2HHHF 3RRKA 4DPTA 4DSIA 1SJRA 4WXOA 5J2NA 1LEOA 1PSDA 2VUGA 1FRXA 1DTQB 2IM0A 3NGKA 3D9BA 3SZ2A 3MDFA 4ECWA 1Q81T 1HA1A 3M4XA 4OYIA 2MSTA 2HFOA 3RBDA 2CQ2A 3I31A 2FJXA 4K2XA 5C2CA 2C1EB 4LF9J 1AROP 3FBBA 1V9OA 3W5YA 2HVHA 2O67A 3CJ8A 1CJKA 3H5SA 3MPUB 1X31C 5KOWA 4EYIB 1U02A 7FDRA 3MAHA 2W9CA 4DV1F 3OV7A 2JEFA 1YRUA 2RRNA 4PYAA 1MU2A 4J9SA 4KHPJ 3ZTRA 4NXNF 3BGFA 2ZVSA 1RBAA 1ZM4A 3QLHB 4M5KA 1RJJA 3T5JA 1ZZNA 1O0PA 1NHUA 3QATA 2AP6A 5DG8A 5J2PA 4ZPVR 4F0KA 1YJWS 1VJWA 1LXJA 3K5LA 4QIGA 1PKUA 5C24A 3DM2B 3TQ1A 2QYGA 4EUVA 1SL2A 3K59A 2YKMB 4FKYA 5I3PA 1LQ9A 1WG4A 3Q2TC 1SJFA 3QRQA 2IIHA 2HQGA 5KG4A 4B9SA 1F5CA 3OSNA 4ZA1A 2B7BB 2FVCA 2QMUB 2I5JB 2RRAA 4B9LA 3PKYA 1WDDA 2UV8G 4X4PA 2BW2A 3ITHB 1SV5B 1FRJA 3CD5A 2DH9A 5B0CA 3NGSA 4EZ9A 3EGVA 1Y0HA 4DFMA 4OI1A 3SV4A 5IOLA 1IWAA 3PO4A 4PWUA 2BJDA 3GYGA 4ECZA 2VQFJ 3S01A 1TKTB 5B09A 2GAGC 4LF4F 1HWKA 1NH8A 2QSWA 2YWEA 2MZJA 1HWLA 2PMHA 2KT5A 3UDCA 1WHVA 2EC0A 5L1IA 1AA1B 3TVYA 2I1RA 2R8IA 2ZITA 4DBQA 5KFBA 3EM1A 1G7CB 3DU6A 1T05B 1VJQA 2ZZNA 1LWEA 1NKBA 3IM9A 2R8GA 1DZ5A 2HW3A 1LK7A 4IH6A 1OPIA 3NAHA 3FZ2A 2AX0A 4DCJB 4ECXA 3HXMA 3CIMA 3GONA 3IMQJ 1S9EB 3Q8YA 4DR4F 1BD6A 4MK8A 1WACA 4HKQA 4GC6A 2HS3A 4O4RA 4Y65A 3VZHA 4RUAA 1S1XB 2W2NP 1XNRF 2LQBA 3CCRS 4Y28C 3POTA 4G3IA 1JNRB 4FNHA 4DZDA 1RUSA 1JXEA 3QRPA 5DJBA 2YH0A 1J5EJ 3EYZA 2HS4A 2WB1D 2EG1A 4OZNA 1BQNB 2WB4A 3T1HJ 4NLVA 3LP0A 1N33J 4C8KA 4QR1A 5LMUF 2ZWPA 4URGA 3FRZA 3HSZA 3TYTA 3H5YA 4ZPTR 5FDLA 3UN2A 3MMAB 2WBRA 4NMXA 2BJ7A 5D0RA 3OVAA 1RT4B 1RXOB 4OJ1A 2QA4G 4BWMA 3O3LA 1S79A 2JNJA 1RT6A 2DNPA 3TAPA 2KRRA 2BMBA 3G2XA 3CWJA 4KGVB 3FK4A 2MKCA 5HJYA 4USHA 1PILA 4QPTA 4QIFA 4A8YA 4ER8A 2R2RA 3VCDA 3LALA 2G2YA 2HNDA 2CVEA 5FIIA 4KPYA 3M1VB 2C3MA 4B3MJ 3G82B 4QBUA 1QLNA 4RW9A 3NG8A 1XBWA 4B3TJ 4CTAB 4OHVA 3J80Y 3LAMA 3GJTB 2K1RB 2WSEC 2WZ1A 4CLKA 3R9LA 4JI8F 1L3KA 1RAFB 4Y2CA 2QO3A 4AXJA 1NSPA 4DLEA 3CMES 3M2VA 3DOLB 4ELVA 1X4CA 1B4SA 4AL5A 4K4YA 1T03A 2IVYA 1JJHA 4CLPA 1TQLA 2OPSB 1QJHA 1RCOB 4WFYA 4ZVUB 2W8KA 2WBMA 1IBLJ 1VQ5S 2IMOA 1O51A 3GIMA 3GV5B 3C16A 3TAQA 4ZVOB 4DWIA 2R7QA 1BE4A 4W98A 2JFDA 3IG1A 1F9FA 4EI2A 3A3PB 2BQUA 1RE1B 4LIRA 1OY8A 1FI4A 3KXDA 5DM7Q 1HQEA 4KSEB 3OTOF 3IO1A 4ZLJA 1SI9A 4HYKA 5A0YB 3GFXA 5A8RA 3H5UA 4X64J 2YNHA 4I1TA 3DYAB 4H4KA 1FHTA 1VRTA 1S1WB 2MQPA 5CYMA 2VASA 2JLGA 2W8LA 3ZZRA 3VAMA 1WF0A 5KOXA 1NSQA 2Y8WA 4HHUA 5ETLA 4A8FA 4LRCA 5DM6Q 2RF2B 1X9MA 3D0GE 3C15B 3HHLB 4ZVFA 4P7TA 1TFWA 3LGMA 4JV5F 2ALYB 4F2SA 4C9DA 2B56A 4DL3A 4P7VA 2M52A 4OYMA 2DO0A 4L74A 2JX2A 1SJQA 2OEKA 1IR1A 3M9OB 3DN9A 3B4DA 3NBPB 2F5GA 4MFBA 2V8HA 3MXHP 3ZTSA 2WSCC 2HWHA 4HDGA 2HKEA 2V8DA 1S9FA 2ZHOA 1WTBA 4Y6IA 3O6QA 1NHVA 3VAKA 4ZVTB 3MM7A 3DDIA 1BHNA 4DV7J 3QGGA 1ZTTA 2CQ1A 4DQPA 1RCXB 2PEBA 4NYZA 3RRHA 1LW0B 2EK1A 2E1RA 4DDFA 1Q78A 3TJ8A 4X4TA 1TL3A 2FLPA 3HHDA 2XLKA 1ZETA 3KG4A 2BE9B 2DNKA 4M5GA 2OTJS 2B4UA 4FYXB 4OJ3A 2FGCA 2RT3A 2UXDF 1KONA 4DHVA 1UZHA 3FCWA 1K8AT 2HHSA 1UEUA 2F65A 3LGNA 4TLQA 3B4MA 2WSFC 2XLIA 4OJHA 1QSSA 3RGIA 1C1CB 2J8AA 4RNOA 5GMDA 2AWZA 1N4LA 1HNZF 2FHKA 3IP0A 3B8HA 2JDJA 3PW4A 2A1BA 5CABA 2FHJA 5KFPA 3EWGA 2WONA 3TA1A 1UEVA 3GFYA 3KWMA 3NP5A 3PX6A 1FTRA 1QD1A 3W9IA 3HO1A 2MMYA 4ZJOA 1F6TA 4JI6J 5LOQA 2CZVC 1EIYB 3OFEA 4BDPA 1KFDA 1DTTA 1QY7A 2B7CB 5CHCB 1U45A 2GGPB 4PEOA 1T9YA 3TJAA 3KLEA 1ZBTA 4CO2A 4OFZA 4ZP8A 1Q86T 4OYOA 3DC2A 3HSDA 4ZPCA 2FZCB 4HHHA 3CDUA 1ZM9A 4B9NA 4B3OA 1RT1B 5G4DA 2EC2A 2IMWP 1EAYC 2NYIA 1GTEA 6FDRA 3CJ4A 2DGQA 5AXLA 2XY7A 1RDRA 4DSKA 4WYLA 4CCHA 4PG5A 1PC5A 4X66F 1UVKA 5D4OA 1JLGB 1K0VA 2AJ0A 1I6JA 3EVOA 2Z57B 2LQ8A 4JP8A 3ZZYA 5THWA 5KT2A 2YNFB 1SB6A 2F9JA 1RTDB 3G71S 4NXNJ 2DNHA 4Y2AA 3PRDA 3IRWP 1WJ9A 2C3PA 2NS1B 2YKPA 4V19J 3QSYB 3SCKE 2KVQE 4TU7A 2MKSA 1I51B 2NXCA 2W2PP 1NK7A 2HHUA 3M8PA 3NOGA 5IC4B 1JMTA 4BC7A 1N6QB 7AT1B 4CLTA 3L7OA 1W7WA 2CG8A 2JFKA 1N88A 2HK2A 1Q16B 2CWXA 1RT2B 2E5GA 3J7Z5 2IHR1 4B3SJ 2W2OP 1U1PA 2N7YA 4C8YA 2B4VA 3L7UA 4N41A 2XO6A 2JC0A 3OUYB 1GXLA 3QGHA 3FKBA 1Y4ZB 2JOQA 3IAS9 2WRMA 3JXOA 3LH2S 1OS5A 2SXLA 2DITA 3LPEA 1UZDA 4PWWA 3RYLA 1JK9B 2DR9A 3HHLD 3T1YF 2O01C 4CLSA 3BBFA 3OFFA 2F4FA 2ZOMA 3KK2A 4FF2A 2OP5A 4QU6A 1EP4B 1JWWA 1FX4A 1R27B 1YJRA 4TYBA 2CUYA 3TZZA 2X1AA 5JUMA 2EVZA 3HZGA 4HR2A 4DL2A 5F8JA 3MAAB 2M70A 1JIHA 4M63A 3ET6B 4C8MA 1K44A 1Q0NA 1UP1A 4R5PA 1CJVA 2MKHA 1Y00A 5L39A 4K2JA 1UA1A 4DPOA 3DFEA 2ZWOA 1S1TB 2ASYA 3MAQA 2DHSA 3FCHA 4C3MA 1H2UX 2CG4A 4A46A 3GILA 2AKWB 1U2FA 5KG7A 3N5BA 1RU1A 3M32A 2A0FB 4NZ6A 2KT2A 5CD4H 3MPVA 4URQU 4DR1F 5E5NA 2FY8A 2ZH7A 1IWGA 3DLBA 1YI2S 5ETVA 2FD2A 4R8UB 1C2PA 4F8RA 2JLFA 2DIUA 5LMUJ 2FZKB 5F8IA 1WD6A 1KHWA 3G86A 1RA7A 2WW8A 2QN6B 5KG1A 1Y11A 3F0NA 2LEAA 2OPRA 4MIAA 1HR0F 1YRTA 1KSPA 2E44A 4ZVGA 3QBCA 3AT1B 1HNIA 4HI1A 5HAOA 3RRGA 1C4CA 2CIMA 5EHHA 1L3UA 1QTMA 2ZE2B 2NR0A 3RUBL 4ZJLA 3MD3A 5CYQA 2B9WA 3VQSA 1W25A 2ZJRQ 3GSDA 1L5UA 2B5JB 4IFYB 3QMQA 2J76E 2Z2YB 3ENAA 3J81j 2HHPA 2QL5B 3NAIA 1S0OA 1QAYA 1IQTA 1X0FA 2D3ZA 1HI0P 3L9ZA 1OJ4A 3BB5A 3UVJA 2U2FA 3NS6A 4WKYA 1WNEA 3VWSA 3K8VA 1EJ7L 2PT0A 3Q2SC 2ZBPA 2GJIA 1WHWA 3JB9k 5A2QU 1RWNB 4JI1J 2LXIA 4JI8J 2QV6A 2DGVA 2OPPB 3N28A 1ZZFA 2BR0A 1UW9A 2EFOA 4P9SA 4RW8A 2GMJA 3R1HA 3QLHA 3M30B 3HHEA 3HX9A 4JOUA 1TL1B 3ZNJ1 2I0XA 2UVWA 1Z2LA 3DM2A 5ETOA 2YKMA 2MKJA 4DN9A 2FLLA 3HDSA 2A10A 4NCGB 3NOCA 3FJ2A 3ISZA 2JEIA 5CZVA 4O3OA 3FEYB 3UO0A 4ZKAA 2I5JA 2OJ3A 1VC0A 5CQGA 2DCUB 3ZFVA 4FYDA 2BUNA 3OTOJ 3ITHA 1T0TV 4LQ3A 2GVDA 2UU9J 2BM0A 1OQ6A 3CF5Q 1H73A 4X4RA 3SYZA 1H98A 3BZQA 2PE8A 5DO2A 3CCES 3KK3B 2GJFA 4KQZA 2J9CA 1KWMA 1TKTA 3RBXA 5GAEU 3P49B 2C22A 4O3PA 4MK9A 2XG8A 5L9XA 4P6QA 1RB0A 5JXSA 4ZN1A 3BS9A 5K9FA 1CPZA 4GKKF 2XS5A 1CQMA 5E3PA 1B99A 3NWGA 5KFFA 1Q7YT 4U96A 1VQOS 2OTLS 4NLOA 1Q95G 1KQSR 1T05A 4O3RA 3EE3A 3C8YA 2DT9A 4JV5J 3C2PA 3AY0A 1NDKA 2K7KA 1H2TZ 4Y00A 5CZXA 2UUBF 3IBFB 3BR9A 4J9VA 3VTIA 1G4CA 3M7VA 3UR3C 3QIPB 4LRFA 1K47A 3W8PA 4F3MA 3OL9A 2G2ZA 2VG5B 2KH9A 2YPZA 2AGQA 3E2EA 2YX1A 4MJKA 4DR6F 1N56A 2V94A 1S1XA 2UVVA 2DO4A 3FSYA 2DGSA 4GO7X 5L1JA 1RADB 3KKFA 4KV8A 3BH6B 2BANB 4B17A 2GV1A 4G1QB 4PQUA 1NPKA 4ED8A 2DRDA 2XY6A 4P71A 3PZPA 3MR6A 2DKOB 4EWTA 2D41A 1WTFA 4IH7A 4OX9F 1PGZA 1WSVA 2KXNB 3PYEA 2CQHA 3PX4A 2EBGA 1NUEA 5DRKA 3BQ0A 1IKWA 2XHWA 3BDPA 4YUDA 2M8HA 3PYFA 4B3RF 3UD3P 3D54A 1HPZB 1EKSA 1YVFA 2E7VA 2QRRA 3CJ2A 1UKUA 1FDDA 5LL6d 3CW2C 5C7PA 1U2RA 2UP1A 2DTJA 5SZTA 1IBMF 2EPIA 2CYYA 4ED7A 5GAHU 2YKNA 3DRYA 4Z7CA 3M1VA 4X4SA 3ZO7A 3PFOA 1NU4A 2BOAA 4WP9A 3F56A 3AB2B 1JLEA 3SCJE 1VQMS 1AT1B 1OYEA 2VG6A 2XQCA 4PXEA 4TYAA 2FDNA 5IS2A 1DFDA 3EJMA 1EETA 2B9EA 1HL6A 4K7QA 3CCUS 2EKNA 4FKXA 1U8SA 1UJ4A 4C0HA 5KFWA 2IBKA 2ZJQQ 1SC6A 1L3VA 3U7JA 4X66J 3AJ1A 2DNNA 2GIRA 3DKDA 8RUCA 2IJRA 1RWMB 3SMZA 1L3TA 3IRXB 4JI2J 1P1LA 1Y5LB 4USUA 4RU2A 1JXVA 4WK1A 5LSLA 4M5JA 3ZTQA 5A0YA 2HWIA 2KN4A 3EGNA 3A8JA 3TAMA 2CWKA 1HMVB 3C6TB 1EB0A 3P5BP 1S1WA 5T7LB 1Q5YA 2M8DB 2CADA 3GE9A 2J8SA 1LXNA 3MM5B 4MH8A 4ZITA 4Q0BB 1B0TA 3TZXA 2K8GA 2RF2A 3C15A 4ECSA 4OLPA 3UDLA 2HQDA 1HW9A 2DBBA 1T9XA 2XMTA 1UFLA 5AJ3F 1S7HA 2ZDPA 3WC2A 2Y9HA 1YJ9S 3DRRB 3CC4S 4M5IA 1Z2ZA 5IWAF 3D7SB 4LREA 4J9LA 3R5DA 3H2UB 2ZHAA 4TQSA 2GFFA 1XIQA 2GHWA 3T1YJ 4CIOA 3MM6B 1CG2A 1AUDA 3JTNA 2CNNB 3N6NA 3UFCX 1Y9OA 2CKWA 1D8ZA 2A2CA 3NBPA 5T41A 3U1LA 1X7VA 1MW7A 2HHVA 2ROGA 2J7KA 1KLMB 1Y7PA 1M5PC 2W4PA 1NB2A 1K1SA 4CO1A 4CI0B 4K4XA 3MMBA 1V3RA 3LP1A 2Z2LA 4DUYF 1E6VA 1BLUA 1BY9A 5CA5A 1LW0A 1RKIA 1PYSB 3RW6A 1SH3A 3PJ9A 2ROPA 2ZH2A 4I67A 3EMTA 5HQ8A 1PG5B 2Z4PA 2F4VF 1T11A 3P6YC 4CNZA 1URNA 1TFYA 4RNMA 1VI7A 3PHTA 3TVZA 2OUGA 2W01A 3CIZA 1RT7A 1IUJA 1V5IB 4NE9C 2HQCA 3KJFB 4WJBA 5E41A 2V4JB 4DV3J 1JJ4A 1GK8A 3M6XA 1R8BA 1A0OB 2RMLA 2MPUA 4DV0F 3OD2A 2CDRB 5B7WA 4IYQA 4WZMA 4YR2A 3KUGA 1JLQB 4G6VB 4MKVA 3FEZA 2V68A 5B08A 1JJCB 4KH1B 3GG0A 1HR0J 5KT4A 1S1VB 3DOKA 3DDNA 1YLXA 4O4GA 4D3HA 2YNIA 1J2VA 3ZC4A 2PI4A 1XMBA 3UNYA 1X5PA 1FRLA 4USWA 1KTQA 4ECQA 2AYGA 1FK9B 4E0DA 1FFSB 4URSA 4DX7A 1S49A 2V8GA 2CZ4A 1FERA 2FVRA 3M2UB 1R7IA 2RQCA 4KJIA 2BYCA 2QA4S 1B0PA 3R3TA 1FEEA 2P2CB 5FLXU 2VD3A 4ZS6A
chains in the Genus database with same CATH topology
1JLGA 1HBMB 2MYFA 5A8KA 4EBDA 2XMMA 3I0SB 2I5JB 5A6PA 4RLEA 2UXBF 3GYNA 4WFBQ 2RRAA 4OMFG 3GFZA 4B9LA 3PKYA 3PY8A 1QAXA 2JRSA 2UV8G 2RUGA 4A47A 1TL3B 4X4PA 2BW2A 3ITHB 1SV5B 1FRJA 2CQ4A 2DH9A 3CD5A 4G1IA 5B0CA 5D4NA 4ELTA 2GMLA 4F67A 4EZ9A 3NRBA 1T02A 1SH0A 1Y0HA 4DFMA 2UUAF 1S6OA 3KLFB 4I68A 1J5OA 1OO0B 2KYZA 3D0HE 5B0GA 3RTVA 4OI1A 1VBYA 5GADI 3SV4A 1C0TA 1Q1KA 3FSXA 2E5HA 4ZDNA 2DRBA 1M5OC 3PO4A 4N47A 4PWUA 2BJDA 4F3OA 4ETXA 5B0FA 4ECZA 5IXUA 4BHQA 3RAXA 3HK2A 3DLGB 1N48A 1IQZA 3S01A 2RH3A 3GFHA 3ZZTA 5KFOA 3UCZP 1TKTB 5B09A 2RU3A 1TK0A 1K73T 3HZEA 4LF4F 1HWKA 3ZZUA 2UVRA 1NH8A 2QSWA 2YWEA 5GAGU 2BRLA 2UUTA 2MZJA 2IA0A 2XNRA 2GHPA 1HWLA 2PMHA 3PHEA 2G9OA 4O3QA 3HKZD 2E5IA 2KT5A 2CJ9A 4NLWA 3NMRA 4NZ7A 3UDCA 3MURP 5L1LA 1WHVA 2D7SA 1N52B 3CULA 2EC0A 2ZFHA 5E33A 3B82A 2MQOA 2EBEA 4KE5A 5L1IA 5AE3A 2IM2A 2AGPA 3TVYA 2XCPA 2I1RA 2ZBCA 5GADU 2VFTA 4RNFA 3H4DA 4TU8A 2WK4A 1RKJA 5F41A 4I64A 2R8IA 2J6SA 3OL7A 2DCLA 2ZITA 4PPDA 3PACA 5DDOC 1U7LA 2ZH5A 4DBQA 2WONB 5KFBA 4B3MF 3PR5B 4GO5X 1G7CB 3DU6A 1T05B 4IUFA 4YQWA 2ZZNA 1GNKA 4K50A 3M6UA 2KG0A 1TZ0A 1QE1B 1YSJA 3CTRA 1LWEA 4IRDA 1HD1A 1FVQA 1HBOA 1NKBA 2R8GA 1DZ5A 2HW3A 4IQMA 1DBDA 1LK7A 4IH6A 5A2QY 1OPIA 4B3TF 3NAHA 3SFUA 2LKZA 3FZ2A 2AX0A 4K5SA 4ECXA 3QAEA 4NA1A 5HLFB 1DTTB 4M5DB 4IDKB 3EZUA 1DHMA 1YQHA 2QT7A 2L08A 3HXMA 2RDJA 3CIMA 3IR6B 4DV4F 1X9SA 3BJYA 3DMJA 1U6FA 4EYHB 2CPXA 3KLEB 1S9EB 2G1DA 2ZNZA 2KDOA 4DR4F 1BD6A 2M2BA 4MK8A 1IKYB 1VRUB 1WACA 4YDXA 1UJ5A 4HKQA 2UUCF 4GC6A 2HS3A 2CPIA 2IRUA 2YY3A 4O4RA 4PXBA 4Y65A 4B3OB 1R8CA 4BC9A 5FJ4A 3VZHA 1UMJA 2B9XA 2BXJA 3P96A 4RUAA 3BQ1A 4TY8B 1S1XB 4HT7A 3Q22A 2ZDOA 4DFPA 4FF1A 4WKRA 1XNRF 2LQBA 3BN7A 5CH7B 1NK0A 2XO7A 3CCZA 4AUKA 2MZ1A 3ENVA 5KG5A 3CCRS 2P9EA 4Y28C 3POTA 3G6YA 2YNGB 2Z0GA 1JNRB 2CPHA 2GX8A 4FNHA 5KT3A 2VH7A 2XZWA 1YIJS 1EP4A 1JXEA 5G0RA 5D4LA 1S6PB 5D6GA 1U48A 5DJBA 1YRXA 4TLRA 3VAGA 2YH0A 1JB0C 2LVWA 5F3TA 1RTHA 3IR5B 2QSFA 3PJWA 2J0QD 3EYZA 3H59A 2HS4A 2WB1D 4DS5A 4C3KA 2N82B 2BDPA 3H40A 2EG1A 4OZNA 2BBEA 1BQNB 2WB4A 1MROB 1SIWB 4DL5A 4C3LA 2HNZA 1V3ZA 2CDQA 3MM8B 1YITS 1TKZA 2IC3A 4YB6A 4NLVA 2CJAA 3LP0A 1IKVB 4F4XA 4AFFA 4C8KA 2EKYA 4QR1A 3G9CA 1HWJA 3HVTB 5DETA 4I2QB 5LMUF 1VQPS 1IJEB 1FEHA 4YDDB 3KTQA 4URGA 3FRZA 3THTA 4EBCA 4NXMF 4USJC 5C5JA 5D3GB 1S1TA 3TYTA 3RAQA 2HS0A 1CLFA 2JZ5A 3KK1A 3H5YA 4ZPTR 4KFBB 5JJBA 3LOUA 2RD5C 5FDLA 3SEOA 3ZZOA 3WBZA 2LA4A 3T5LA 1UETA 3AH6A 3MMAB 2YKOA 2WBRA 4MYTA 1VQNS 3MHYA 3QO9B 3OVAA 1RT4B 1RA6A 1X4FA 4JV0A 4OJ1A 3IN5A 2OKQA 4K4TA 2IA6A 5MAOA 2QA4G 4BWMA 3O3LA 3BO4A 1S79A 1FRKA 2DHGA 2V2KA 4RWXA 3SDEA 2DNYA 3C6UB 3T9NA 1N36F 4EEYA 4X64F 1RT6A 1VMBA 2JJ4D 2FJEB 4QIVA 1V3SA 3CCQS 2DNPA 1TAQA 3M8PB 4FVMA 4WU3A 3TAPA 1Q7LB 2KRRA 2ZH6A 1HMVA 2ZHBA 2XNQA 3C6TA 1KN6A 3FQLA 4IO1A 3CWJA 4YEAA 4XDDA 2MXYA 4NRTA 1K9MT 1KVIA 2GC8A 3F41A 4USIA 2MKCA 5T7LA 2F8HA 3IFEA 3MPYA 5JVGQ 5I3UA 2VPZB 3DRPB 4USHA 1PILA 4QPTA 2KHDA 2R4FA 1ZM3A 1N0UA 1UW4A 2B43A 2OPQA 3JYTA 5J2QB 4PWDB 4QIFA 4A8YA 2P6TA 2CQPA 3MM5A 1GQEA 2R2RA 2DGUA 3VCDA 1NKEA 2E5JA 2R7XA 3LALA 5HI7A 2HNDA 3NCQA 4R8UA 3KMQA 2CVEA 5FIIA 4KPYA 2M0GB 3M1VB 5DDQC 2C3MA 4DQIA 4QWBA 2NSBA 4Q0BA 2D1CA 1HARA 2MKKA 2F8EX 1S76D 4QYRA 4DX8H 3M9MB 5BYQA 3JSRA 3RB3A 4NWBA 4LT6A 4Q2MA 3GV7B 1B64A 4HLBA 4IFVA 3ETOA 2D9OA 3RAMA 3MUTP 4QBUA 2BJEA 1UA0A 4RW9A 3NG8A 4RZRA 1VQLS 1QLNA 2VBWA 4L3NA 3OJUA 3NLCA 4ED5A 4A8OA 1C1BA 2OD4A 1XBWA 1JKHA 3T5HA 2P9GA 4CTAB 4OHVA 3J80Y 3UD4P 4DR3F 2K3KA 2YWKA 3LAMA 3PM9A 3PRBA 5HROB 4WFAQ 2K1RB 4KB7A 2WSEC 5J1EB 1M90T 3DCAA 2KRBA 2MGZA 5LJ3Y 5T14A 1FXLA 1SUQA 4ED0A 2NXUA 5E0OA 3HJFA 3PV8A 2POKA 4XK8C 3AJ2A 3DRRA 2E1CA 2HPUA 2ASJA 1JLAB 4JI8F 1LWCB 3KLVA 1XMOF 1L3KA 3KJVA 4NZ0A 3DLHA 1CEZA 4I69A 1OQ3A 2QO3A 4Y2CA 4AXJA 1D1UA 2ZE2A 5J1PA 4DLEA 3RW7A 3CMES 3M2VA 3NL0A 3GQCA 2UZAA 2V9KA 3DDKA 3BGUA 4X84A 4IOBA 2WCXA 5F8LA 1S9GB 2E1AA 4LSLB 1VQ8S 1KNZA 3DOLB 3Q8QB 4YOEA 1JLFB 4ELVA 2UXCF 3T9ZA 1X4CA 4AL5A 1U25A 2B5JA 5B0BA 5BYRA 4K4YA 3KHHA 1X5OA 4IFYA 4TKTA 2KB2A 3RB6A 2CJBA 4DR5F 2KKHA 3OPKA 1T03A 1QAIA 3DLLQ 2IVYA 1JJHA 4C8NA 3IA0A 4X65F 2WOMB 1Q8BA 3NNCA 1TQLA 1F2GA 3HM9A 3CJ5A 2OPSB 1QJHA 4WFYA 4P2SA 2MQNA 2W8KA 1CC7A 4Y2IA 2WBMA 4EO8A 4B9TA 1VQ5S 3O1LA 2VFVA 2IMOA 1Q8LA 2VA2A 2QA2A 4PUOB 1LW2B 2LDYA 3PW5A 1O51A 5KFCA 3LUYA 1FJGF 3GIMA 2FLOA 1Y5NB 3GG1A 3GV5B 5KG0A 2HNYB 3VQTA 3W2VA 5EWFA 2J0SD 4ID8A 5L38A 4I6YA 3TAQA 2VPXB 2Z2MA 4I6AA 1WG1A 4DWIA 2JSXA 2LU1A 2OLWA 2HGLA 1BQMB 2R7QA 2LQJA 4AE5A 4FF3A 1DLOA 1ZAWA 3GIKA 4DV7F 3SCLE 5I42B 5DDRC 1M5KC 2JFDA 1BGXT 4Q2LA 3IG1A 4KHRA 2DNGA 2YQ3A 1F9FA 4PPZA 3TVKA 2W9BB 1RQ0A 3BF4A 1H2VZ 1KQFB 2CQ3A 2F40A 2YWHA 4C97A 2BQUA 2OH2A 2OPPA 2N3OA 4LIRA 3Q8RB 3OVSA 1X4DA 5DM7Q 1HQEA 1TUVA 2OSRA 2XI3A 1X5TA 2J5AA 3QPIA 2JVRA 4FNIA 2XGQA 5CXTA 4KSEB 5KFJA 1IKXA 2AU0A 3OTOF 2HMIB 2VZ9A 2FHMA 2ZD1A 3IO1A 4C11B 1HBUB 2J9EA 3K5OA 1SI9A 3DOMA 5D77A 5A0YB 4ZLPA 4HYKA 1C4AA 5KFKA 3GFXA 5A8RA 3H5UA 3KHGA 2NREA 3I87A 3LW5C 4RUCA 4A4JA 2YNHA 4I1TA 4NYOA 3BDEA 3DYAB 2LQ9A 4H4KA 4GMKA 1FHTA 1ZYQA 1VRTA 1S1WB 2MQPA 2LECA 4QJVA 4L72B 5CYMA 2VASA 2JLGA 4LIWA 2XCAA 2W8LA 1Y3KA 3ZZRA 1FJ7A 3VAMA 2AW0A 3KLGA 5C25A 3ZZ0A 1WF0A 1TL1A 3DXSX 2L9WA 2N4DA 4OLOA 5KOXA 1HD0A 2B6AA 1KEKA 1N54B 1SKRA 2YTCA 3U1MA 3HHNB 1NK4A 3QZ8A 1DTQA 3N5FA 2YKAA 2NPFA 2V4JA 2K3IA 2HLUA 2O66A 1N5YA 1VC6A 4WK3A 2DNRA 4MTPA 4NCGA 3CC2S 4RW7B 4A8FA 1N5QA 5AE2A 2VFRA 1D3WA 2MY8A 4O44B 1VS3A 1G3OA 5DM6Q 1ELOA 1JLQA 3KNAA 5M2UA 3GWCA 2C2EA 2RF2B 1X9MA 1KD1T 3KLIB 3KHRA 2ERRA 4JYAF 3J7YI 3H2LA 2DK2A 3D0GE 3HHLB 4HT5A 4FXDA 3KG1A 5K8NA 4ZVFA 1VQYA 1OSCA 2DHXA 3I4PA 4P7TA 4PG7A 3IXQA 1X4AA 2HVIA 1SJ3P 1TFWA 2MB0B 2ROEA 1HNIB 3LGMA 5HBMA 4A8QA 4JV5F 3MMJA 2J0WA 1U24A 4DN0A 1M5SA 4I6WA 4F2SA 4C9DA 4LVNP 2B56A 2DNZA 5ADZA 3PKMA 4OZ5A 4DL3A 3S7RA 2KVIA 3OSPA 5B0DA 2NSCA 4P7VA 4DSJA 2M52A 3QIDA 1D0EA 1FKOB 2VKZG 2G4BA 2E9RX 2F8MA 1FCAA 1TVRB 1DJ0A 2HHTA 2FHJD 3MM9B 2DO0A 2XSJB 2AJFE 1KQKA 2Z8QA 5CYQB 2JX2A 1TP7A 5E2QA 4ES2A 2QA1A 4RW4B 3UW1A 3OR2A 3T1AA 5HMZA 1S0VA 1HHSA 3EZ5A 1SJQA 5LSRA 4A8SA 5J2MB 3R5CA 3M9OB 3LQVA 3DN9A 1JLCB 3B4DA 3OBIA 4KC5A 3NBPB 4HTJA 2X1BA 4MFBA 2V8HA 3MCSA 3FRYA 1VBZA 2XLJA 4U9RA 1VQ7S 2M7SA 3MXHP 2ZC3A 1YBAA 2WSCC 4BBYA 2HWHA 4ZVEA 4MKAA 1C0UA 1YJVA 4HDGA 3CSKA 3M2UA 3I96A 5F9NA 1DURA 2W9AA 4DEZA 2OO4A 2V8DA 3IAM9 4DS4A 1S9FA 3TANA 2ZHOA 1HBNA 2AV5A 1WTBA 4Y6IA 4MKYA 1UVMA 3O6QA 1NHVA 1U1LA 5HL7Q 3VAKA 3I5CA 3MEGA 4QIEA 3IS9B 3MM7A 4EZ6A 3MEDB 1MMLA 1MWYA 3VAHA 4QOTA 1VQKS 4RWWA 4QZVB 3QGGA 1FF2A 5KFUA 1ZTTA 4IG0A 5DQHA 4ICLB 2CPJA 5L9NA 2FHOB 1HBMA 1Q8IA 2R2UA 1TKDA 2MQMA 4NYPA 1FNXH 1XK8A 3I9V9 2JHEA 2VG7B 3I0SA 2CQ1A 4DQPA 3H2VE 4DLGA 4IG3B 4NYZA 3RRHA 3DRSA 1LW0B 2EK1A 2E1RA 4DDFA 2XC9A 1Q78A 4X4TA 2NQPA 1TL3A 3HKWA 1RTJA 3D28A 2FLPA 4RW8B 3Q8PB 2E29A 3HHDA 1RT5B 5KFRA 2JWNA 1SV5A 2VG5A 4FN5A 1ZETA 2XLKA 4KT0C 5MLCV 3KG4A 5KT6A 4RW6B 1JLBB 2HHWA 3VF0B 4HHJA 1NK6A 2DNKA 2ASDA 1MMDA 3SQGB 4TU9A 2ZH3A 2RU9A 3NS5A 3P5TL 1RTIB 2VFSA 4I2PA 4UW2A 4LSNB