3BM7A

Crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
b'HHHENLYFQGMIGVVATLKVQPAKAAEFEKVFLDLAAKVKANEPGCLVYQLTRSKTEEGVYKVLELYASMDALKHHGGTDYFKAAGAAMGPTMAGAPVIEYLDAVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of unknown function with ferredoxin-like fold
publication title Crystal structure of protein of unknown function with ferredoxin-like fold (NP_420935.1) from Caulobacter crescentus at 1.35 A resolution
rcsb
source organism Caulobacter crescentus
molecule tags Oxidoreductase
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bm7A00
4EFAC 1K0VA 1WD6A 3IWLA 2ROPA 4FNHA 1GXUA 1TL5A 2BJDA 1CC7A 2GO8A 2OD4A 2W4DA 1TR0A 2ROGA 1OQ6A 2BYCA 2VV5A 2FHMA 1SI9A 2GV1A 3BR8A 4HH1A 5KAKA 3BGUA 5B0EA 4A46A 2AJ0A 1Q53A 3T9NA 2K7KA 2KYZA 5B0FA 2XMUA 2LQBA 3F44A 3FGVA 1FESA 1Y0HA 1P8GA 1N5SA 2IYIA 3HDSA 2GA7A 5A6PA 2RMLA 2ZDPA 1LQ9A 1MWZA 2W4PA 1R6YA 2HFNA 2IYGA 1X7VA 2XMVA 2QLWA 3MZIA 3FMBA 4ZOSA 3HHLA 4DL0C 3LGNA 4HI1A 4NPOA 4OJHA 2RU9A 4Y2KA 2K7JA 1Q8LA 1VQSA 3I9ZA 2QLXA 3MCSA 2OAUA 2N4CA 4NL5A 4QOTA 3BN7A 5B0BA 1N5TA 2G9OA 2OD6A 1Q8BA 1APSA 2FB0A 4YEAA 1YRXA 1X8DA 5K9FA 1Y3JA 1YJUA 2CRLA 2LQ9A 2ASYA 3HHLD 4HI2A 4Y2MA 3UDCA 3WDOA 5A6WA 2Q3PA 2N7YA 1Y9OA 1FVSA 3HHLB 3K7RA 1W2IA 4A47A 5B09A 1GXTA 1YJRA 2BBEA 4Q2LA 4DPOA 4OJGA 3KG1A 1JWWA 1KVIA 1IUJA 2QYCA 4OJ3A 1CC8A 2KT3A 1URRA 4FNIA 2PGCA 2GCFA 3FRYA 5F0UA 2W4CA 2HLUA 4OJ1A 1AFIA 1KVJA 2GGPA 1FVQA 2EW9A 1OSDA 1N5QA 1TZ0A 4U9RA 4HL9A 3TRGA 1Q4RA 3GZ7A 2ROEA 1ULRA 4Y2IA 4A48A 2GFFA 3CJKA 2KT2A 2RILA 1TUVA 2IFXA 1P6TA 2N4DA 1SB6A 2JDJA 2ZDOA 1N5VA 2AJ1A 2BJEA 2GGPB 5T7LA 2FTRA 3LGMA 3QMQA 1CPZA 1V3ZA 2HLTA 1X0PA 3KG0A 5B0CA 2PD1A 3HFKA 1VQYA 3BM7A 1AFJA 3IWXA 1FD8A 2K2PA 3E8OA 4OIXA 1RJJA 2HFOA 2XMWA 3CJKB 2LDIA 2K1RA 3QGPA 5F0WA 3BDEA 1S6OA 4HH0A 2RSQA 3LO3A 4A4JA 5B0GA 2OKQA 1OQ3A 2OMOA 1XBWA 5T7LB 3BB5A 1KQKA 5IXUA 2XMMA 2XMJA 1YJVA 3HX9A 3BF4A 1JK9B 1U7LA 3HHLC 2AP6A 1FE0A 2ACYA 2HIQA 5B08A 2K1RB 2FIUA 1MWYA 2OFGX 3KKFA 4YDXA 3HF5A 3VTIA 1AW0A 2VH7A 2BUNA 4F67A 2AW0A 2L3MA 2LXFA 5B0AA 2XMTA 1SQEA 4DN9A 3DCAA 3TOQA 3DXSX 1FEEA 1OPZA 5B0DA 1QUPA 2QIFA 1S6UA 3TNVA 1TL4A 1Y3KA 2KKHA 1FE4A 1YJTA 2OFHX 4Q2MA 2XMKA 3KNGA 2HQIA 4ZA1A 2OP5A 1YG0A
chains in the Genus database with same CATH superfamily
1DLOA 3CC4S 2Q66A 4YS2A 3DYAB 5D0EA 3ENQA 3CJQA 2D9OA 2AJ0A 4C98A 2FZKB 1ZETA 3K0JA 4O4RA 3K5LA 1X5SA 3MEKA 4NRTA 4PUOB 5A8KA 4FKXA 3JYTA 4K4YA 2VODA 1AUDA 1VQSA 4ES2A 2VF3A 4KGZB 4KSEB 3FSYA 4EK2A 2E1PA 4NLYA 1L3VA 2M88A 4NEYA 5BXIA 1IBLF 1XNQJ 1H7XA 1ZA1B 4ZVRB 4NRUA 1N8RT 1FKOB 3BPDA 4UY8T 4EBDA 3HFVA 2C3PA 3OLAA 4QWBA 5DG8A 2Z56B 3GPAA 3CULA 1WUUA 2VD3A 1TV6A 2C3OA 4C48A 1CS4A 5GADI 4LF6F 4O3NA 3KG0A 3AAWB 1T9YA 3L3CA 3BQ1A 3IXQA 2HFZA 1HKAA 3BPSP 1WG4A 1NCLA 1U7LA 1J5EF 1U1NA 3ETMA 3QJLA 4DCOB 3MEDA 4LFAF 1RT7B 1S6QA 4C8ZA 3D1QA 3DGVA 4PWDA 3GSDA 3HZGA 3KK2A 5HMXA 2ZH9A 4W90B 5JMNA 3RJMB 2FZCB 4KRWA 4DQPA 3UVJB 2CPXA 3OFHA 2GW8A 2FC9A 4J9PA 4M5NA 2C42A 3MMAA 4BC7A 5LJ5Y 2IM3A 4OJHA 2RU9A 3DOKA 4KO0A 3DLGA 2C2DA 1RUSA 3DOLB 2DGWA 5KFVA 4CO5A 3K7RA 3CCMS 4OJGA 4FS2A 4XK8C 1SKUB 3GV5B 4Y2AA 3CDEA 3F73A 1RWNB 3CJ5A 3KLEA 1U02A 4BWMA 2KXNB 3C2PA 3SQGB 2L9NA 2YH0A 3I5BA 3GLJA 2D74B 2HZAA 4NEZA 5KT2A 3UN2A 2ZH4A 2CYYA 3IG1B 3HKWA 3MM7B 1OYDA 5IXUA 3RBEA 1S4EA 4DV0F 2YTCA 1SKWA 4MKYA 1NNDA 1MWYA 1U8SA 2U1AA 2WRMA 4CLKA 4IUFA 3N01A 3IWNC 5JXSA 1D8YA 1YJTA 5E3PA 3HSJA 4TLRA 4OZ2A 2GO8A 4P6QA 4CO0A 1CULB 3GCWP 2QMUB 3JS9A 3DMJA 4I64A 3FBEA 3DLKB 2V2VA 2R3VA 2HS3A 2Z57B 2QYGA 4OZ5A 3UCZP 4J9MA 3HD2A 4ERDA 1Y11A 2M8HA 1YGYA 3H5YA 3EGNA 3ZTSA 2DR8A 4O3RA 2MJUA 4RU9A 4RW9A 1CJVA 3W1YC 4QYZK 4LF5F 1XMQF 4MIAA 3SZ2A 2D3OR 1NJWA 1T9XA 1XK8A 2A18A 3QO9A 1YQHA 2GJFA 5EN1A 2K2PA 1JLQB 2XS5A 2IY5B 3CMQA 2EFQA 5ETTA 1FHTA 3S6EA 1FFSB 4LF9F 5MAOA 2XMTA 1UJ6A 2V68A 8RUCA 1HBMA 5LMNJ 3DC2A 1FE4A 5LT5A 4NLSA 2OFHX 1NJZA 7FDRA 5HMYA 4Z7CA 4JV5F 3BKFA 4E8UA 4DLGA 3M30A 2R4FA 3BO4A 2BKOA 1Z2ZA 2HRTA 1U2CA 2O66A 2UZAA 2QC3A 1WORA 1RT3B 1O6XA 2QLWA 4KR0B 2BW7A 3O5TB 4ID5A 2YQ0A 1YRXA 1X8DA 1GTEA 1Q86T 3SCKE 2NQPA 3HVTB 2QL7B 2HNZB 1B7FA 3CJRA 4ZP6A 5LMUF 4F4WA 2F7VA 2W2OP 4HTJA 3G6VA 4RU2A 4KH1B 3JQKA 1RWPB 2J7UA 3TJ8A 2NPIA 1U1LA 1U2RA 5C42A 4KC5A 2HQDA 1KR4A 2GX8A 4LRFA 2HHHJ 2Z58B 1EP4B 1S9GA 2F40A 2HG4A 5GMKa 3KK1A 5E3AA 3HK2A 1AUSL 3NGKA 2CADA 3NAIA 3MR2A 1QVGR 2HGLA 4UQTA 4DU7A 3AODA 1XQIA 3EE3A 2RS8A 4G1PA 3H90A 1NRKA 4GKKF 3VCDA 5DDPC 4CLLA 2PN6A 4RX6A 1Y4ZB 3MWBA 4ZHRA 2N7YA 1Y9OA 4DWIA 1ZOTA 1WELA 2XCAA 4DFPA 4OHVA 3CGIA 3W9JA 1S0MA 1X4AA 1WF0A 2V4JB 4QR0A 2BKNA 5AXNA 3L09A 2HFSA 5ETKA 1B99A 2EK1A 4ZVUB 4ZJLA 5I3UB 2JLEA 2AU0A 1V3ZA 4CLYA 2CPHA 2OKQA 4AUKA 4LSLB 1YJWS 2M4MA 2WVCA 3DRPA 1X4FA 3PX6A 2PMHA 1BWEA 1S9EB 3N5FA 4DF4A 2QMWA 2W9BA 1TAQA 2RB7A 1ZBTA 1S1XB 1RWMB 3C6TB 1YG0A 4UZCA 1HBUA 1Q79A 1MMNA 2DB1A 1UJ5A 3TR5A 1KC8T 3R5BA 2QMXA 3MUMP 3FSIA 3TUZC 4WZMA 3TARA 4BBYA 5A76A 2UU9J 2E7XA 4F4YA 4X4NA 1HYSB 1R43A 5KFIA 5KFRA 1S49A 4MFBA 4FVMA 3HJFA 4I6YA 3K8WA 3Q8QB 2VFTA 4KJIA 2DISA 2EC0A 3CJKA 1LEOA 3PZPA 2P6TA 2BJEA 1HPZB 2PD1A 4B9TA 2M7SA 4IDKB 4N5SA 1T11A 3DLEB 2LA6A 1JLBB 3W5XA 4F4AA 1ZPVA 4ED3A 4GMKA 4JI2J 3CD7A 3H59A 2OPQA 1VHIA 3FKBA 1FNOA 1K47A 2H65B 1LWEB 1FX2A 3K5NA 3MHYA 3EYZA 4HH1A 3EZUA 1E6VB 3K5OA 2K7KA 5CZXA 4W98A 3H2VE 4F04B 2Q79A 3MUTP 2YNGB 4ZOSA 3ET6A 2ZNZA 1U25A 3KLHA 5K9FA 2CWKA 4HI2A 1ZAWA 1F3VA 4B3SJ 3KJNB 1GXTA 2Z2YB 4AT1B 4USUA 4RW8B 1OMSA 2KL8A 1GAOA 1URRA 1WI6A 3W2VB 3Q8PB 1EKRA 2R7VA 4Y0FA 2FLOA 4P2MA 4DR5J 4WZQA 2K3IA 4LT6A 4C7QA 2R7XA 3PX4A 3MPWA 2NXNA 2B0GA 1DQ9A 1YLXA 4UY85 4GC6A 1IKWA 2RF2B 1N34F 3AA9A 1UEVA 2VASA 1J5OB 4NWBA 1RBLA 4MK8A 2MGZA 3MURP 3TX0A 3EVMA 5GMDA 4L6V3 1IR1A 2MHNA 4PYDA 4XO0A 3PR5B 5KFKA 3FMWA 4IO1A 4ANEA 3S8SA 2R8KA 2YPYA 1WG5A 1ELOA 1U0SA 2VPYB 2A2DA 1ZM9A 3I56S 1C2PA 1DRZA 3M2RA 5ETLA 3BBFA 2WHOA 2DHAA 3IGVA 3R8YA 3L7PA 3TAQA 4O44A 3R5JB 1NU4A 1RHKB 5KT3A 4DSKA 1RYSA 2HZCA 1HWIA 2WOMA 3UCGA 2I38A 2ZKTA 3FQLA 5I42B 4XDDA 2RKIB 3ZZ0A 1VQOS 3EXCX 1WEZA 5L1IA 1D9FA 1YDLA 5KG1A 3BSNA 5GVQA 2DXDA 3CD0A 4PQAA 5DGAA 1HHSA 5K5MA 2G1HA 4C8OA 1HNZF 4NLWA 1FDDA 5IV4A 2F8MA 2G2YA 2HEKA 3VV2B 3IM9A 1UVIA 1RE1B 3IR6B 1RT2B 1IKYB 2RT3A 3HO1A 1U24A 3NLCA 3ZXWA 5F9LA 1QLNA 1S4FA 4JBCA 4TKTA 3T9NA 3HPOA 1IM4A 3PG9A 3KTQA 1X4GA 2XNRA 2YKMB 1R6YA 1SC4B 5IM0B 2NUHA 4Q0BB 4B9MA 2ZOFA 3I9ZA 3FZ2A 1N4LA 3QJPA 1ZTWA 4ILMA 3OUYA 2CRLA 2XGQA 4LF4F 4A8QA 3TP2A 9ATCB 2C3YA 4LIRA 2R7OA 2J9DE 2UV8A 4GKJF 4PG5A 3FEYB 1EHWA 1FFGB 5KFBA 2B5JB 1LV5A 4OYBA 4DV2F 3J7YU 2C22A 2O3DA 2YWGA 1OWXA 3MEEB 3NOCA 2ILZA 3ITHA 3P6YC 1L3SA 4M94A 2HFOA 2BR0A 3BQ2A 4HR2A 5AE3A 2F1FA 3CWJA 4YR0A 4KV8A 1LW2A 4U7CA 3DHXA 3MAHA 3OBIA 1Y5LB 4YR3A 1FF2A 1QTMA 2DITA 5HROA 3IBFB 2BUNA 3CPWR 4IH7A 4JI5J 4KHPJ 3BGOP 2IPOB 1KTVA 4PQUB 1T9VA 4RW4B 5F8LA 1HR0J 4ELTA 1OQ6A 2DGUA 1UEKA 1V5IB 4DPTA 1UVMA 2NCKL 4K0KF 2OSQA 5KFQA 2VL1A 2DGQA 3HHLA 3UCUP 2N82B 2ADBA 5D15A 2HZVA 3Q22A 1S0VA 2I8EA 2NYHA 3C6UA 5E5NA 3DM2B 3NG8A 3PNIA 1IQZA 3NBPA 1T95A 1HWKA 4ZVHA 1H73A 1TFYA 4C3LA 4NASA 1R6VA 4H4MB 1EAYC 3EXYA 4R8UB 1EJ7L 4O3OA 1Y10A 3BM7A 1GNKA 1FD8A 3A3PB 5F3TA 1O8BA 1S72S 1N33F 3UWTA 1UKUA 2XMMA 4YY3F 1LNQA 2G2ZA 3PJXA 1FE0A 3AD9C 3DHWC 2K1RB 1RADB 5A8WB 3BEGB 4P7VA 2ASDA 4BWJA 1FEEA 2AJ2A 2KVQE 1RT5B 3OTBA 2DHXA 3OVSA 3VGVA 5L9XA 4G1QA 3T6JA 1TR0A 3PYGA 1RTIA 4Q43A 3JAMY 2BQ3A 4OYZA 1TKTA 3A8EA 3QATA 2LQBA 1P8GA 4UTGA 3Q8SB 1M0SA 1FI4A 1AYEA 1A7GE 1IJFB 3BN7A 5CAAA 2ALZA 4YR2A 4CLZA 1YJUA 1WI8A 3IMQJ 3QRRA 2XZDB 1TKZA 1WEXA 2OPPB 1U6BA 3B8HA 4WP3A 1NK7A 4WTYA 2UUAJ 1CJTA 4J9RA 2HNDA 2EFVA 3FBBA 3W65A 3T6BA 2PFDA 3IP0A 4DV4F 1HNWF 1DTQA 4LF7J 2YKOA 3V6DB 2DCUB 1B0VA 1EKSA 2AX1A 4CLUA 1XBWA 3M9MB 1PJ6A 4NMXA 4DV6J 1SJFA 4PPDA 1YZ6A 1SUQB 4U7UK 2ZBPA 2AEJA 2H5EA 3P49B 2R8HA 4URQU 4CNYA 2B9YA 4FN5A 2XTJP 4ZA1A 1KLNA 3GONA 3VWSA 1SQGA 4DV5J 3DLBA 1H74A 1SBRA 1DLOB 4DR7J 3THPA 3MZIA 3RW6A 2BE9B 3W2WA 4KQZA 2UUBJ 4QOTA 1RAFB 5LSOA 2HFVA 5A8KB 3JYTB 3AOAA 5I4MA 2XG8A 3QGIA 2RH3A 3DNCA 2KHCA 3TWZA 3X3UA 4FF3A 1S79A 2R2RA 1L3UA 2OTLS 3MR7A 4QWEA 2OTJS 2FHKA 4LFBJ 5FLXY 2EFOA 4P75A 2WCXA 2L9DA 3QIDA 2YWFA 2AYMA 3FDSA 2EI5A 3LPYA 3EZOA 1G1XA 2EEYA 2UUTA 4B3TJ 2DYAA 1HFEL 1TV6B 3NOGA 1CS4B 3LO3A 1KQKA 2BM1A 4FXWA 4TU7A 2ZWOA 5B08A 1UFKA 3IRXA 1D0EA 4A8SA 3MPUB 5AJ3J 1ZA2B 6FD1A 4D3GA 2LXFA 1F9FA 3TNVA 1MU2A 1Y3KA 4DPYA 4RWWA 1NK4A 3MEDB 1S6QB 4PG8A 2F4VF 4M1KA 2UXBF 2LYVA 2CJXB 1TK8A 4PWDB 2CAJA 3KLGA 1VQ5S 2Z0GA 2QLBB 3V6HA 3KK2B 2XGPA 2XM3A 3MM8A 1U1MA 2E9TA 3FMBA 3SCLE 3SV3A 2Q6BA 2MTLA 1KFDA 2JFKA 1BY9A 2XO7A 3KYLA 2AGQA 3TA1A 2Z30B 3MMAB 2O67A 1REGX 4KFBA 3DOKB 3NS6A 5JJBA 4LVNP 2ZJPQ 4KO0B 4YB7A 3DLGB 3RTVA 3PHTA 3BQ0A 2NUUG 3ENVA 3UQSA 2DNNA 2FJXA 3CC2S 1UFLA 1RA7A 3QFWA 2QO3A 1RB0A 3BR9A 3KLEB 2UUCF 2E1MC 3QPIA 2BJ1A 4M5DA 3I6PA 4B9LA 1DZ5A 1SQFA 2VC1A 2A10A 4YB1P 2J0XA 4WE1A 2DNRA 3KKFA 2RAQA 5J2PA 3TJAA 1KQGB 4ANCA 2HNYA 4MYUA 1SPBP 5GAGU 2UVVA 3QT7A 2ASJA 3I5AA 1XR7A 3SI8A 2W4DA 2COLA 3PYEA 3MXHP 2I5JA 3IRWP 2XO6A 1RAAB 1VCTA 2NSCA 4J91A 3P8BB 3DDIA 1N5YA 1SC6A 1WC5A 1S6PA 4USHA 4YHHF 3DMJB 2W2NP 2UUWA 3PW7A 3CDBA 2H1YA 4C4WA 2EBEA 4Q2LA 4WP9A 5HJXA 4ECVA 4DS5A 4DPWA 3CXCR 5DQIA 1V3SA 2QYCA 1FRLA 1OSDA 1IBMJ 1TZ0A 5ETOA 2MYFA 3HVAA 2RILA 2E9RX 4RW9B 1CJVB 1Z4UA 5ETQA 2KG0A 4ZLLA 2PC6A 4JUZA 2ZJQQ 2IC3A 2WB1D 1KTQA 3LWLA 2HRUA 3QO9B 1VMBA 2Y0SD 2Z2ZA 3MEGA 2W9AA 1I6JA 1KONA 4D3HA 1IR0A 5F8IA 4ZP7A 5GAEU 1ZAXA 4OI1A 4K4UA 2M8DB 3CIZA 2GVZA 4OZ1A 2HQIA 2LMIA 2IM0A 4OQJA 1HBMB 2IBOA 4Q44A 1RA6A 3G82A 2GMHA 1T9UA 3TA0A 2QN6B 2ZOMA 3P45B 1LQ9A 5FJ4A 2MQQA 1VQ6S 2NYIA 3M30B 4OZJA 5HP1A 1V9OA 3CJ0A 1T05A 2DPIA 2FUG9 4ID5B 2B56A 4DUZF 5FD1A 4RBTA 1ULRA 1S0OA 1H3DA 1JJ2R 3I31A 4OHZA 3H40A 1QSYA 3FEXB 4ZPAA 4C8YA 2CNOB 5T41A 1S5ZA 3NNAA 2HVIA 1K44A 3CIMA 3JSRA 5C42B 2F8EX 3ZNJ1 5L39A 4HDGA 3ADAC 4IQXA 1MROA 4URGA 3PYDA 1PKUA 4EYIB 3NWGA 1S9GB 1Q7YT 2CQBA 3KK1B 4RL1A 1U1PA 2MB0B 2RDDA 4I2QA 4NZ0A 1XNQF 2KYXA 3MR6A 3TAMA 2CQ4A 3BSOA 2D1CA 4I0WA 1UVJA 5BR8J 1H98A 4P10A 3NXZA 3VQTA 1NJIT 2BE7D 3VAKA 4K4VA 4JI7J 3H4BA 3T19A 2DTJA 2JEFA 2BQRA 4N47A 2L9WA 1EIYB 1JLFA 3RRGA 4LFCF 4TU9A 4G1IA 1SKRA 1O0PA 4ZHRB 2HHVA 3CO0P 1AFIA 2QX0A 2R2SA 4A8FA 2F9DA 4J9QA 5IWAJ 3UN3A 3MFIA 1D09B 4JI1J 1OSCA 2YX1A 3VF0B 1AFJA 2FJWA 1Q8IA 1RU2A 3VGUA 2RSQA 3W66A 1OQ3A 4ZVSB 3EJMA 4O3SA 1RT6A 2MQMA 1JK9B 3R5DA 2CPDA 4FYYB 3A8JA 3L7OA 1GMUA 1KBRA 3QGHA 2RRAA 1R0AA 3DRPB 4NI2A 1PCAA 3U7JA 3EGZA 4JI0J 1NKEA 4TLQA 4F3QA 2W9BB 3MM6A 1YITS 2YVSA 2XCPA 5IFMA 3QLHA 2ZH7A 2HHSA 3HHKA 2IYGA 1XNRJ 3OL8A 2FQQB 5SZTA 1T7PA 1HBUB 3GIIA 4LF8J 1JXVA 3GFZA 1B7YB 5D4LA 2V2KA 4CH1A 2CZ4A 2K3KA 1S7IA 3UDLA 2V50A 5KOXA 3FRYA 1S1VA 4DR3F 1U1KA 5CH7B 3CCRS 2HPUA 1VBXA 3TRGA 2MQPA 2HVHA 1W7WA 2ZDOA 4MFBB 1X0PA 1SKSA 3CJKB 2LU2A 4TN2A 1GXLA 3MECA 4HH0A 3LP1B 5KFFA 3OR1A 2YQ3A 4CT9A 1GH8A 3VHQA 1JQGA 4AL5A 2CKWA 5EWGA 2R7SA 2AW0A 2HBZB 2IRYA 2QIFA 3M7VA 2RUSA 2P5VA 3D7SB 1R8HA 2MMYA 2XYPB 1D9AA 2IMWP 1H2VZ 4LBPA 1WTBA 2BOPA 2OPQB 2WB4A 1GT8A 2B9EA 1NM2A 4FPIA 2XWXA 4ZJQA 3LW5C 1FEHA 1VHFA 1EZZB 3L95X 3GYGA 2OD6A 5J1NA 4J9SA 1RWOB 5A2QU 1FJGJ 1T03A 4LQ9A 2CZ9A 3ET6B 3R2CJ 3CDAA 3UPFA 2FY1A 5A8RA 5KG3A 1H2UX 3MFHA 4ELVA 1QE1A 3KLHB 4AL7A 4JV1A 2RHSB 2HWIA 4Y6IA 4LR9A 1FD2A 5LMNF 1WC4A 1Y5IB 1OS5A 5AXLA 3MAAA 3HSGA 5HLFA 2FVRA 1WTFA 3J81U 1KNZA 4M5GA 2WTFA 4CT8A 4N41A 2FD2A 4OX9J 2HIQA 3PRVA 3EGVA 4KYZA 4U8VA 3ISNC 1IKWB 4X65J 5B0DA 2ZC3A 2HFUA 2ZVSA 4DQQA 4K59A 3R5AA 2MGZB 4FNHA 3UNGC 4ED0A 2LXIA 2BYCA 4Y28C 4MMOA 3DKDA 3PX0A 4IG0A 2BMBA 2DGTA 2YKQA 4FYWB 2V2QA 1T8EA 3E51A 3SQOP 1PSDA 3C66A 1WKLA 2N4CA 4LRCA 3AJ2A 2AX0A 1IBCB 2B6AA 4GO5X 2VG5A 2OJ3A 2HHHF 2AJ4A 2NZ4A 3PKYA 3D3BJ 3M2RB 4NCGA 4X4VA 2PA3A 4W92B 4XDCA 4DI6A 4O44B 2ZH3A 2AYEA 2HLTA 3VZIA 2IIHA 4RNOA 2WOMB 1B3TA 4DSIA 1DBDA 1AA1B 4ILLA 1T0TV 2VBXA 3OV7A 1PJ5A 3R6GB 3HHEA 2VKRA 3VAFA 5B0AA 1U4BA 2W9CA 2YPZA 3DRSA 3G8TA 3VAGA 3KHGA 1N0UA 2B9XA 4IRKA 5B0EA 2DD8S 1FNMA 1Q53A 5LL6d 2A3JA 1SJQA 4URSA 4O3QA 1MWZA 2LEPA 4IFVA 4PKDB 1X4BA 1V3RA 4KKOA 5CCLA 1PC5A 5B09A 4DV1J 3Q24A 3W5ZA 3NS7B 4HVZA 3AJ1A 3OUYB 2MKHA 4G6VB 3ZZRA 1FRIA 3GWCA 2W4CA 4TYAA 2MKCA 3W8GA 2VIHA 1FNXH 3HULA 2BEFA 2V63A 2HQGA 3D0IE 1VISA 1TTHB 1GMWA 2RDIA 1X9MA 3K5MA 3MMCA 1VC6A 4JI4J 3TVKA 2OEMA 4R5PA 3NWRA 2F3JA 4Q8FA 3PVXA 5L8RC 3ITHB 2HVDA 5E3QA 4ECRA 3Q0AA 1JXLA 4P73A 4O0IA 2Y8YA 4ETXA 3DCAA 4KV8B 1LW2B 4USWA 5HROB 3PCOB 4DL3A 8ATCB 2QGFB 1R0BG 3UD4P 4IQMA 4J9NA 3SSSA 2QT7A 2ZEJA 2KM8B 2P2CB 2V5HG 4OYPA 2VDIA 3RAXA 2I6WA 4C3MA 5K8NA 2JL9A 5HVHA 2E5JA 2QA1A 2W2MP 4JI8J 1F5BA 3WDOA 3HHLB 4FYXB 1S48A 4WU3A 4C8NA 2YWKA 1S0NA 4JP8A 1I1GA 3NNHA 3KLIA 3C6UB 5DQHA 4WKRA 2AMCB 3NBPB 4CM0A 2GIFA 2CG8A 4ZITA 3AA8A 3OXFA 4ECUA 1VQKS 2XWYA 5H9FJ 2XS7A 4I67A 3QT5A 4ZCIA 2XLKA 2Z4PA 5DZ6A 4KAIA 3I9V9 2XHWA 1TL7A 1QUPA 4ZN3A 1S6UA 1GX6A 3TVZA 4NCAA 4IO9Q 4A8XA 3OXLA 1HIYA 1ZZFA 3P5TL 4B3SF 2J0QD 2HHQA 2PMWA 2KYZA 1Y0HA 4CCHA 1QSLA 3NCRA 4G1QB 2RMLA 1KP6A 4DR5F 4K4SA 1FRXA 1RTIB 2DXEA 3J7Z5 1TKTB 2HVZA 3KJVA 3TANA 2DNZA 2CFXA 4EO6A 2BV3A 2B4VA 1F3FA 4WP8A 3MMJA 2VFUA 3CCWA 5I3QA 2AJQA 2QTWA 4J9UE 4HACA 3MI7X 3PDNA 3G71S 2GGPA 5FDLA 1TKZB 2CWXA 3CF5Q 2LQ5A 3GFXA 3GU0A 4M63A 4MKAA 1CJTB 7AT1B 5L1JA 1RLCL 2HNDB 1HBNA 2EFPA 2QSFA 2PFFB 3WX4A 2ADCA 3U02A 1U48A 4NLTA 5J2NA 5LSRA 5ETVA 2IAJA 2ILYA 5F8HA 2B4PA 3KUGA 5K20B 1JMTA 4PZVA 4C0BA 3OSNA 2DH7A 2ABYA 1JKHA 2HYIB 1PYOB 4DV7J 1VLYA 3EUNA 2J9CA 3T5JA 2KFZA 3O8WA 4ED5A 2BZ2A 4I7FA 2PEBA 5KFMA 3LWMA 3F0NA 2GZOA 5HVFA 3BBBA 3H98A 1U49A 4IOAQ 1HW9A 1FVQA 5EUHA 3M9OB 1WOOA 2CNKB 3V4MA 4TY8A 3SCJE 2V8VA 1DHMA 2SXLA 2LQ8A 4ZVEA 3RUBL 4DU8A 3IGNA 3CMES 2APOA 2DHSA 3MTKA 1HD0A 2JLGA 3NEKA 4B08A 1WDTA 1VI7A 1VC0A 3EVWA 3FEZA 2J9EA 1DARA 2WVEA 2H3EB 4ED7A 3IRXB 2DY1A 4ED2A 1YJ7A 2KKHA 1S12A 3GJSB 2FGCA 3OJUA 5LM7E 2OD4A 3RB0A 3HT3A 1MU2B 3MAQA 1S7HA 2QE5A 2J0SD 2I9SA 5ETPA 4NLXA 4LF6J 4TQRA 3ZZUA 5KG2A 3KLGB 2CQPA 2CDRB 2J6SA 3J80U 1RT1A 3NGTA 1GTHA 4YEAA 3MM8B 4PWUA 3CDWA 2FLLA 5T14A 5HSPA 4TU8A 1AB8A 4QW9A 1YBTA 3R7SB 4UUXA 4LFAJ 2DIUA 2HLUA 1KVJA 2V8HA 3QZ8A 2HIYA 4KFBB 2JOQA 2JRSA 1FXLA 4JI5F 4ZLNA 5DLGA 4A48A 3HJVA 4KHPF 2BXJA 3FCHA 3R2DJ 4ER8A 1XR6A 1FTRA 3QGPA 4OLOA 3W63A 4M5DB 1RHJB 4C0HA 1RT4A 4UQGA 2AEMA 2VFVA 1QD1A 3HI9A 4IR9A 3EDQB 3TOQA 4WE1B 4ZLJA 3W60A 5J2PB 2BX6A 3K17A 4HEA9 4Y00A 4FZVA 1QSSA 4UT4A 4CH7A 1E6YA 3BREA 3PM9A 2AJFE 2YX4A 2UXDJ 4YN3B 4KHMA 3DDNA 3FGVA 4F36A 2E5LJ 5A6PA 2C2RA 4CH0S 2XLJA 3Q89A 1JJCB 1NJYA 2KM8C 2AYGA 2ZM6F 5BYQA 4BHQA 4HI1A 5L9NA 1MNEA 3PHEA 5H9FK 4Y2CA 4X64F 2I5JB 4Y34A 1QAIA 4M8LA 9RUBA 1M5VC 2AGOA 3EPGA 1N5YB 1FA0A 2ZH1A 1S6PB 3L9ZA 3D6MB 3GE9A 4WXWA 2VBWA 3C14B 3D1HA 4C0OC 3OTEA 3TUJC 4AL6A 4TYBA 5HMZA 3DLJA 3LALA 4K50A 2BJ7A 4F7VA 5KOWA 2DR6A 4ZN1A 3HD1A 2P8IA 2DO0A 1VQ9S 1W26A 3DRRB 1FKPA 3A1YG 2IC3B 3PO5A 1H72C 3VTIA 4F0HA 3M8SA 4C8KA 3SDEA 3AQPA 2RVJA 4F3OA 4B9VA 3MEGB 4CI0B 3GIKA 1PIEA 1VYAA 2IDEA 1WD6A 4HKQA 3MM9A 1QAJA 2BJDA 2NXCA 2KTQA 5KAKA 4LF5J 2GVZB 1D3WA 1OYEA 2F4FA 2XSFA 2UUAF 2XI2A 4L74A 4P72A 4DSFA 1NDKA 4X62J 2VJUA 3G82B 3OFEA 5K8MA 2ZZNA 1JX4A 1APSA 4LF7F 4B3OA 4Z37A 2EBGA 3T9ZA 1UVLA 4ZPBA 5HP1B 1K1SA 2JSXA 1SJ1A 4ZP9A 2AV5A 4DR2J 4BCAA 3LGHA 4LF9J 2PEHA 1T05B 4I68A 2C2MB 3SYZA 2MJNA 4QBUA 1NSAA 4ZCMA 3FCVA 3D2WA 3BH6B 4I6AA 4FF2A 4I4BA 4X84A 1YJVA 2VG6A 4ZVQB 2H51B 4DR7F 1HNXJ 2EKYA 2XYGB 2FJAB 4H4KA 4E2FB 3R1LA 5HQMA 2GAGC 4L73A 2QA2A 2I0XA 2VC0A 1HI1A 2IJNA 1MROB 5L38A 4AXJA 2MZQA 2ROPA 1C1BA 3V5RA 4C97A 1RAEB 3Q86A 4NLRA 3RZAA 2KI2A 3JTOA 2HHTA 3C19A 1WC0A 2RU3A 2E66A 4I2QB 2QRRA 1UMJA 4LFBF 3TAMB 2LDYA 1VRUA 2VZ9A 3VAHA 4OZNA 4RO0A 1T02A 1KSPA 5IT9U 1Q5YA 5BJRA 1RSCA 4NYPA 4B3TF 1SH0A 2M9KA 3GFHA 2DO4A 3M6VA 4B02A 1NH8A 1NKCA 1G7CB 2ZNYA 3BBCA 1JLFB 3G6ES 4DHVA 2UP1A 1UW4A 2JFDA 2RRNA 5AXMA 3KUEA 1QJHA 2X1BA 3IC1A 1FDNA 2KZMA 3O6QA 1NH7A 2E29A 3FZBA 5JVGQ 1AW0A 2DGSA 1RT6B 3D54A 3VAMA 4ZVTB 2A0FB 4DR6J 1TL3A 1KRPA 4RLEA 4FF4A 1MN9A 1T9WA 3D0GE 1VBKA 1R0AB 4PXDA 3D0HE 4KHRA 1ITPA 3Q8YA 3D3CJ 3W9IA 2VV5A 1SI9A 4LJMA 3MM6B 1RBOB 5HBMA 2ZDPA 3OFGA 4QU7A 4I2PA 3B6BA 3QLHB 3TA2A 1FJEB 1VQPS 2B4OA 2J5AA 4CLWA 3NCPA 3Q2SC 4DR1F 2PA8D 2XZWA 1KLMA 1S1TA 4YP3A 2FLPA 4PABA 1NDCA 2OSRA 4H4OB 2YNIA 2GFFA 4TQSA 2MXYA 2X1GA 1S1VB 3MCNA 2FTRA 2UXCJ 5ETSA 2IM1A 1VRQC 2MLYA 5HAOA 2NS1B 3TUIC 3BB5A 4DV3F 2GC8A 1DURA 1X31C 1UWBA 2O5DA 1RU1A 3MECB 2OUGA 2DXFA 1XMOJ 3OR1B 2PSZA 4AD6A 2YWHA 4NLDA 1VJQA 1UJ4A 5CD4A 3CD5A 3DGPB 3I87A 1B70B 5ETNA 4P9SA 3LA0A 1LOUA 2FVPA 1XEZA 3U1NA 3CCTA 3RGIA 3AFGA 1NMEB 3KJQB 3OR2A 3CCJS 1IBMF 2GIRA 1RCXB 5CHCB 2E7WA 2M3DA 1S1WA 2ASYA 1CG2A 3DLKA 3NMAA 5G0RB 5H9EJ 1HWJA 1RAOA 1T03B 5F0UA 1N6QA 3WC0A 2GIQA 1WKKA 2ZZMA 1G2EA 5A8RB 1SV5A 3NY0A 2LKZA 1QE1B 1CSJA 1LW0B 1CQMA 2IMOA 4OZ0A 4ZJOA 2PO4A 5J2QA 5IQ6A 2WONA 1Q16B 3S01A 3MAAB 5E2QA 4DX6A 5HLFB 2VHGA 4ZS6A 3D66A 5KG6A 2NLWA 2P6SA 3MF5A 2HQ3A 2M2BA 4PRFA 3OJSA 4U6PA 1U8WA 3ENAA 3U1MA 4UF4A 1YX2A 1GXUA 3BGFA 1RAIB 2WSEC 3VQSA 4ETZA 3BGRA 4DLEA 2YQ1A 4K2XA 3CJTA 3TUPA 3GSIA 2FHJA 3VVTA 4IG0B 2G9OA 2CPIA 1RAHB 3A13A 4A47A 1NBEB 2BBEA 2EG2A 1WHVA 3DLHA 2B6AB 2B7BB 2VG5B 2O01C 3JTNA 4CO1A 2DNOA 1PBAA 1UAWA 3ZO7A 2P9GA 4OYOA 5C24A 1S99A 2DNLA 3K8VA 4NCGB 5K14A 3OTDA 2HHPA 4IH5A 3UR3C 4LIWA 2HGMA 2X7IA 3IR5B 2F8HA 5KFTA 2HHUA 1BQNA 4YB5A 4DG1A 1WHWA 3K57A 5KG4A 3PY8A 7FD1A 3PW5A 5BR8F 4FS1A 3PFOA 4OX6A 1B64A 1HQUA 2W2PP 4USIA 1ROFA 2U2FA 4JI7F 5A0YA 1FWPA 3KNGA 2C2NA 2MQ8A 3UD3P 2VJVA 3G6XA 2W9CB 2FHMA 5EX0A 3DRSB 3TZZA 1L5UA 4QR2A 1BWVA 4ELUA 2HVEA 2OH2A 2DNPA 2YNFA 5IWAF 4J9OA 1UZHA 3FQKA 4JI1F 2X1AA 4IFVB 4DF8A 2K8GA 3LQVA 4KKOB 3M6UA 3ETOA 1OPIA 4CO3A 1ZS6A 2ZBCA 4ED6A 1U0HA 2VONA 2G0IA 4RUHA 1C1CA 1HNZJ 3I0RA 2KXHA 3D1OA 1UZDA 4XTTA 4EWTA 2RRBA 3O2IA 1TL1A 4YB6A 4JI0F 3OTOJ 1VIXA 4EZ9A 1NPRA 4V1Ak 3IBWA 1O5JA 1QAXA 3KG4A 5HJYA 1R7IA 1R8PA 2E7VA 1R8CA 5DDOC 4LBIA 1CJKA 4R5PB 3PJWA 4C2MA 6FDRA 4G65A 1XNRF 4DN9A 2IHR1 1HHTP 1FJCA 2ZBQA 3AD7C 3RR8A 3BGLA 2VFSA 4DSJA 1IKVA 5JUMA 2QZ8A 1GMVA 4XIUA 5KT7A 4TXSA 4GKJJ 4ZPDA 1KWMA 3VGTA 1WSRA 2V0NA 4JI6J 5E3RA 4IRCA 4IR1A 1R0CB 2VICA 4M5MA 1QVFR 4N8NA 3NGRA 1BHNA 2LQ9A 4YQWA 1O51A 5A6WA 2QA4S 3CCVS 4Z2XA 1FDBA 3IS9A 2V8DA 1N36F 3I4PA 3R6LB 5CQGA 2HS4A 2AIRB 1FT8A 3BH7B 3ISZA 2HAFA 3KHLA 1SB6A 5L46A 5T7LA 3V2UC 2XS2A 5B0CA 1KFSA 4RNHA 2CPJA 3CC7S 3W64A 4RR5A 1V6HA 4U8YA 4K0KJ 1VBYA 2XMJA 3HX9A 3ZTRA 3A12A 1Q78A 2CQDA 2O1PA 2F63A 1C4AA 3L7UA 2NREA 1S10A 1I94J 3RRHA 2YWWA 4RPFA 1TELA 4J9KA 1JNRB 2DIVA 4UZBA 1W25A 4CTAA 1DQ8A 4WFNQ 1TL7B 1QY7A 4GC7A 2H5IB 5EDWA 4HHUA 3QYYA 3GB0A 3ENWA 3HHDA 3ILLA 2ZJRQ 1YBUA 2GHPA 2Y1IA 3MDFA 4PXEA 4YDDB 3I0SA 1FJ7A 3FJ2A 4WFBQ 3D67A 3KJVB 4F4ZA 1JLGA 2Z8QA 1IUJA 2CUYA 3PW4A 4P7TA 1F9EB 2KO1A 4HACB 2LQJA 4X65F 2GGPB 5FDLB 4N56A 3OL9A 3SFGA 2R2UA 4WK3A 3UO0A 4MKVA 4OYXA 5CYQA 3CO9A 3ZNUA 4B3MF 3PXGa 4ECSA 1HBNB 1EQMA 4UOGA 5J2NB 2IAJB 4QWAA 3CCSS 3R5GA 1XC9A 1HL6A 3NRBA 5D4NA 2QA4G 1JKHB 2CPEA 4LSZB 2ZUGA 5E41A 1FRKA 2DEJA 4NXMF 3CNQP 3OTCA 4K4WA 4DV4J 2HQCA 2J0WA 1HMVA 4I7FB 1YSJA 2F9JA 3ZZZA 2D7SA 2HBYB 2W24A 1HNVA 2QSWA 1KOHA 3HSZA 1YRUA 5F3ZA 4YMEA 2GMLA 5CYJA 2KFYA 4MJKA 1IQTA 2XEXA 1BQMA 4TY8B 3E8OA 3ISND 2EK6A 3DI6A 5CD4H 4ALZA 3BSCA 3O44A 4LR8A 1ZYQA 1TP7A 3BJYA 2G0JA 4F0MA 4OHXA 1YWXA 3GYXB 5F8GA 4DR4J 4DV1F 2HW3A 1S59A 3B78A 1F2HA 1TL5A 5IT4A 2YKNA 3EICA 2G4BA 2Y1RI 2IBKA 3OVAA 5GAGI 1HARA 2XC9A 3OD2A 4WIQA 3HCXA 2Y1LB 5IC6B 4I6WA 4BC9A 1HI8A 1RWUA 1A9NB 4JI4F 4DCJB 3SCIE 4J7CA 1URNA 1NAQA 2IRXA 2WSCC 4AQYF 4OI0A 5D78A 3GIRA 2GS8A 3K2YA 1LK5A 1CEZA 1PJ7A 2N3LA 4UW2A 2GAHC 2F4VJ 2UXBJ 5K8PA 2R8JA 3I4HX 4I56A 4EI2A 3ZC4A 3DOMA 3QIPA 1GQEA 2P9CA 1WKJA 4L3NA 2AP6A 5C7PA 1VRTA 1UA0A 5KFGA 2Z2MA 3P5BP 3JXOA 5GAHU 1U1RA 3AXMA 3M6WA 1RT4B 1RDRA 1P27B 3CUNA 3W9HA 4S0MA 4NLPA 1X5OA 1CVJA 2DJWA 1VOMA 3K89A 4JOUA 2K06A 2L48A 2IA6A 2ZH2A 4X66J 4DS4A 2KVIA 2DGVA 4DUYF 1E6YB 2UUCJ 1NB2A 4ECWA 1M5HA 2MPUA 3MOZA 3GP9A 4L75A 1W2IA 1YJRA 1XWLA 4DMZA 1TK0A 4O23A 3G2XA 4F2SA 3RRKA 3US5A 4JB8B 2XULA 3JTPA 4AYBD 3PIPQ 3N28A 2YX7A 4DSEA 4F26A 4QIVA 4RJVA 1N48A 1K8AT 2LCWA 2C2KB 3JSMA 3O3LA 5J1PA 1VK8A 3K5PA 4P52A 3LAMA 4YFUA 2YKPA 3CCUS 3QBCA 1MG7A 4YHHJ 1H0HB 3RU0A 5D0HA 2Q1LA 1FKPB 4OX7A 1K73T 3I5CA 2DK2A 4WFYA 2IDLA 2R9LA 3SDEB 3WHIA 2OPSA 3SSQA 2RQCA 2V9WA 5CA5A 2JLFA 1DQAA 3VALA 1WHXA 2RD5C 5HMWA 2WAQD 3MM9B 2W4PA 1Q81T 2GQQA 3CSKA 4QYZJ 2KXFA 2PIIA 2DNYA 3T3FA 1PG5B 3UDCA 1RWKB 4LSNA 2FVQA 1QM9A 4GO7X 3T1HF 2IVFB 3PR4A 2OPRA 1CC8A 2C3UA 1C0TA 2H54B 4OYAA 1IXKA 1T94A 2N3OA 2LXUA 3LF0A 4JYAF 1RBAA 3IAM9 4B3RJ 1YVFA 2GNKA 3GIMA 4K7QA 1WF2A 3EX7B 4WPAA 3GG1A 2LEAA 4NXNJ 4IFYA 2MKJA 4NLQA 3SIPB 5AE2A 3B82A 2CDQA 1HWUA 4ZIWA 3H25A 2VG6B 2W7OA 5KFXA 2J8AA 2UVWA 4J5OA 3MD3A 1VLOA 4PAAA 4DL4A 4RUAA 2H48B 3H4DA 4DUZJ 3QRQA 3LOUA 1NK8A 1FESA 4OYWA 3FUYA 1C1BB 1B4SA 3CJ8A 4PEOA 4Y2KA 3V6JA 1R31A 3PJ9A 3CT9A 1KHWA 1U6ZA 4WWSA 1VRUB 4OV6A 1NSKL 1PBUA 3HKZD 4RUCA 1KVIA 2GHVC 5E3CA 4OJ1A 2E1CA 1RHMB 1UETA 3FSXA 4EGLA 4WU2A 3H20A 2OHDA 1M90T 3DXBA 4QPXA 5DDRC 2XMWA 4ZP8A 1UA1A 1UL3A 4W4MA 2DNQA 4N7TA 2VG7A 2ZHOA 3C46A 2ZFHA 4HLBA 1REVA 2BRLA 4OV1A 1DAXA 3RG6A 4LFCJ 2GQ2A 1TL3B 3OFFA 1QTNB 4FPRA 4O3PA 2DNMA 4CRJA 3MTJA 1LWCA 2VA3A 5B7WA 2K7JA 5RUBA 2ALYB 2CNNB 5HBMB 3ILIA 1FVSA 4I2PB 4NA2A 1IWAA 1VQ7S 2CJKA 2MZJA 4FYVB 3DFEA 1HQ2A 3T1YJ 3U27A 1KLMB 5E7OB 2DH9A 5D4PA 1S1TB 2FVCA 2LEBA 4HTIA 5LSLA 1TFWA 1N32J 1D1UA 5C25A 1KDNA 2YNIB 1NK9A 2C28A 2HK2A 1ZZNA 3UFCX 1JLCA 3W5YA 2UXDF 4QIFA 5ETRA 1OO0B 3DRYA 4DFMA 1NK6A 2FJBB 3NNCA 2E5LF 2FY8A 2HKEA 1MWQA 2DRBA 1NK0A 5KTQA 2AWZA 4X4OA 3WIUA 3LP2A 1UWBB 1WF1A 2OO4A 3FNNA 2WSFC 1HD1A 4DX5A 3IWLA 4DN0A 3C16A 2LP4A 3RAMA 3TJ9A 2ZKUA 1NLKL 4DR3J 1N54B 2EKNA 1F5CA 2XY6A 1PYSB 5DZ7A 1X5PA 1VIOA 3AD8C 5IOLA 2B43A 2MLZA 3FFIA 4BS2A 4HYKA 4OHWA 3OR2B 3MUVP 1S1WB 3NCQA 2HBQB 1VJWA 2AZ3A 4OX8A 1ZAVA 1UW9A 4KPYA 4RW6A 5C2GA 3AB2B 5KT4A 1MSWD 3PRBA 5HK4A 2CJ9A 1TUVA 4TVAB 4IG3A 1N6QB 5LJ3Y 1U47A 1SV5B 5F0WA 4NOHA 3EMTA 5LXYA 2W2QP 2RS2A 4DQRA 3D9BA 5J2QB 2F5GA 1Q7LB 5ITHA 2KRRA 1I5OB 2WONB 1X60A 4X62F 2C2EA 2L3MA 3ZZTA 1OJ4A 4USTA 1IBKF 2QEXS 1DJ0A 2FPHX 4JI3J 3Q2TC 1F9HA 3M2UA 2R7WA 2EC2A 4QQBA 4DR2F 4B17A 5K8OA 2IYIA 4HT7A 3N9UC 4K5SA 2G1DA 4C11A 5IZHA 1JJHA 1SJ4P 3BGRB 2BANA 2QLXA 2ZOGA 1L3KA 2W8KA 2MHEA 1RABB 3HHLD 5HL7Q 5EWFA 2CQGA 2VBYA 5DG7A 2C1EB 3LAKA 3NGDA 3C8YA 2KT3A 3OPKA 2J7WA 3WQPA 1VQLS 2KU7A 1HNXF 3GZ7A 1VQMS 4F2RA 4KT0C 1U26A 2IFXA 4CIOA 2V8PA 1PYTA 1ZM4A 2AZ1A 1YHQS 4KE5A 4MT1A 5C24B 3J81j 4OHYA 2CQ1A 1BE4A 2YKAA 5K14B 4C9DA 2UVUA 2KZZA 1BQNB 5KFZA 4DG1B 1EX8A 1X9SA 2DR7A 4TNOA 4UOCA 1HQUB 2ZWPA 4Y65A 1KQFB 3J7A1 2DR9A 5A0YB 1J2VA 2V4QA 4V19J 1MLAA 2DPJA 4H4KC 3BYRA 1LWFA 3VGSA 3QGGA 4ZPVR 2CG4A 3RR7A 2VQEJ 3Q8UA 3KHHA 3OQ2A 2KN4A 2HURA 3NL0A 1MMLA 3AHPA 2YNFB 3I82A 3QJJA 3W3SA 3F41A 1M5OC 1RYRA 2QLFB 2VBZA 1KN6A 1U0HB 1C1CB 1X5TA 3I0RB 4DR6F 1CPZA 2H5JB 5ADZA 4RW7A 3J7ZT 1RWXB 3GV7B 1TL1B 1N88A 5L1LA 1KD1T 3KK3A 1RKJA 4DPUA 3BS9A 3BZQA 1OY8A 5KG0A 1M1KT 4IYQA 1CJKB 4QPTA 1S9FA 4X4SA 4WK1A 2XMKA 3W7BA 3M8ZA 2RDJA 1BUXA 2XY7A 4H54A 4WCEQ 3SXLA 2X51A 4NZ7A 2A2CA 3OHBA 3GCXP 4MK7A 2D9PA 3PV8A 1IKVB 3KFWX 2VKZG 1HI0P 4O4GA 1JLEA 1P9QC 1JLAA 2UXCF 2CQ2A 3ZZPA 3ILOA 3DU6A 1ZH5A 1XMBA 3GJRB 2AD9A 4EEYA 5HATA 5KFJA 4CQ1A 2PGCA 2GCFA 3N6LA 3IN5A 2JVRA 3QFHA 5ETMA 2R8IA 3UI3A 2FC8A 4QW8A 1XMOF 1AROP 2EXUA 3IS9B 2AJ1A 3C3LA 4MTPA 2DT9A 4Z7YA 1UTAA 1SL1A 4X2BA 2GMJA 4KBIA 5DLFA 5T7LB 1M1GA 2NXEA 3JAMU 3LP1A 1WDDA 2M0GB 2JHEA 3AQOA 2WBRA 2DRAA 3QAUA 5J1EA 2R8GA 4ICLA 1CC7A 5IS2A 1MMDA 5F8MA 2NXUA 4C6AA 3ZZOA 3F44A 4CTAB 3ICLA 3JSBA 3RB6A 1R8BA 1HNIA 3IBCB 2VB6A 4F0KA 3TZWA 1C0UA 5G4DA 2J9DA 5J2MA 1CLFA 1IM6A 5EGYA 4NX9A 1D8ZA 2B8QA 1U6FA 3I0SB 2Y1JA 4PXBA 1HW8A 5GADU 5U47A 5AXKA 4USMA 3I32A 4C8LA 1Q1KA 4YOEA 3POTA 4U9RA 1JLGB 3MR5A 4P74A 5KFUA 3RYLA 1U2FA 1CQNA 3DLLQ 5KFCA 2V2ZA 2ZHBA 3OLBA 2AQ4A 2IVYA 3TO8A 3H5XA 3ULHA 3PEJA 2VQFJ 3V81A 2QV6A 3MM5A 4CLTA 2MY7A 5CYQB 3CCES 1NHUA 4YDXA 3S1TA 1Z2LA 2AGPA 4F67A 4R25A 1RZMA 3ZTOA 2XNQA 1RTJA 4JV0A 3H5SA 3PRDA 1K0VA 5F9NA 4LRDA 3GJTB 4EBCA 3A4TA 4A46A 2DNKA 4P2SA 2IA0A 1HBOA 3LP0A 3A8IA 3ELHA 2CPYA 2DKOB 3PW2A 5FLXU 2BRKA 3CCLS 3FBFA 3MGJA 1ZM2A 1HMVB 5I3PA 4C8MA 4B9SA 3AJDA 1VGYA 1JB0C 1HNVB 4LREA 3HHNB 5EHHA 1EQ0A 4O0NA 1RK8A 2KT2A 1Y00A 3EWGA 1R8AA 3HLUA 5HI7A 2ZD1A 1VQYA 4FXVA 5KFDA 2ZUAA 3MPYA 3BDPA 3T5LA 4EBEA 1RACB 1BQMB 3EDRB 1IKXA 2MQNA 1LK7A 2GJ2A 3DI6B 2WW4A 3HVWA 1NSQA 3VZHA 3H7HB 1NZ8A 5BYRA 4UOFA 4DEZA 4M5KA 4CWBA 5KFHA 2RJZA 3P3DA 4K2JA 3KLVA 1FRHA 5D8HB 2VU5A 3D4JA 2WW8A 5CYMA 2HAIA 4QJVA 1T3OA 2DCLA 2YKNB 4WF9Q 2BVZA 3R1HA 3DU5A 1N5TA 4F3MA 2ACMA 3RBZA 3OTOF 1WHYA 4CO4A 2D3ZA 5FIIA 2NSBA 4F8RA 4OJ3A 4PR6A 4LMZA 4M5HA 4FDFA 2I1RA 3OL6A 1ACMB 4A8OA 4RNNA 4DJBA 1P6TA 4MAKA 4A8MP 4QCLA 4TY9A 3IAS9 4RBVA 2VDHA 1PC4A 2KB2A 1EB0A 3V4IA 4ED8A 2ZITA 4DL5A 2ACYA 1FFWB 4JI6F 3DOMB 3QIPB 4LRAA 3M9NB 5F8NA 3J7AN 1VRTB 4ID8A 4XAKA 3A3OB 2VUGA 4ATNA 1RWVB 1RI7A 1VFJA 1YIJS 1NXIA 1HWLA 4GVBA 1R3NA 3M8WA 2J6TA 1OY9A 1BGXT 1LWXA 1SIWB 5KFOA 1YJ9S 1U45A 2OAUA 3N4WA 4DOZA 1RLDA 3BO3A 1RTHA 2KJWA 3KG1A 2IRUA 1CJUA 3HT0A 5C2CA 4A8WA 1SJRA 3FVYA 2MY8A 2MKKA 4M5LA 2HBRB 3H2UB 2L41A 3KLFA 4RKUC 4OI3A 1I94F 3BYPA 2JX2A 3WZ0A 1TQLA 4WXOA 4OLPA 2EFNA 1RP5A 4OIXA 4DX7A 3CJ3A 3BSAA 3M2VA 5LXRA 4A4JA 4PG7A 2MKSA 2UU9F 4ZKAA 3JSMB 2ZM6J 1KOOA 1IJEB 1AZSA 4X64J 1YTYA 1LFPA 2E5IA 1SJ3P 3PACA 1RHUB 3WIVA 4MKBA 3HXMA 2C3MA 3BO2A 3Q23A 4KIAA 2DY9A 3EZ5A 3PTWA 2GVDA 3NGUA 5CABA 2OPSB 4USVA 4X4RA 2HMIA 3M05A 3PFEA 4PG6A 2FB0A 4G3IA 4JI2F 2D41A 5KT6A 3TX8A 4U96A 3KWMA 3N6MA 3VAJA 4LSNB 4DQSA 2QFJA 2OPRB 1RQ0A 1U1QA 2V6AA 1NHKL 2QG9B 4WFXA 1C0TB 3PIOQ 4ZVGA 1W2BR 1SL0A 1OIAA 2RHQB 1BXNA 3TQ1A 2CNLB 1Y5NB 3NGSA 4ES3A 4K5RA 3NMRA 4AFFA 5CCMA 2FIUA 1XERA 4QIEA 1SQEA 2NXJA 1TL4A 4IFYB 2BA9A 1HA1A 1YBAA 3QWPA 4ZVPB 5E33A 4R0JA 4N76A 1DTTA 3G9CA 4ZCLA 4CDIA 1N5SA 2FLNA 4KGVB 4ZCKA 3PO4A 2DHHA 4P71A 2OELA 4CYUA 3RAQA 2JH3A 2LA4A 3RB4A 4WKYA 1DTQB 1TK5A 1WNEA 2Y8WA 1SH3A 4CO2A 1FWLA 3IO1A 5A2QY 1WWHA 3G96A 3MOJB 3AY0A 1HQEA 4DR4F 1B0PA 2EWHA 4HDHA 1VC5A 4QU6A 1ZM3A 3MCMA 2WVFA 4ZPWR 3PYFA 3BKUA 4MH8A 1GEHA 3J81Y 5HVGA 1S1UA 1YJNS 2VG7B 3R7BB 4KGMA 3R7NB 4EFAC 3M8PA 2JEJA 1REVB 1NB7A 2RE1A 3W2WB 3M8QA 2KJVA 4M95A 2DNHA 2W8LA 3CJSA 2N7CA 2CVIA 2XZTB 4DX8H 4DL6A 3LTOA 1PAEX 1S77D 2CQHA 3H0PA 2UV8G 1LWCB 4NLUA 3UD5A 1MN7A 2E5GA 4E98A 1KVKA 1WC6A 2P9EA 4K8RA 3MMBA 3GIJA 3AH6A 1TKXA 2FVSA 3WC2A 3ONQA 3KDNA 4R0EA 1RAGB 1S6OA 5AE1A 1IBLJ 2B9WA 3ZTPA 3NAHA 2L08A 5C25B 4X66F 2H4WB 1G4CA 1P9YA 3QSIA 3M32A 1XN9A 2QFIA 1JLCB 1FO1A 4EYHB 1FK9A 5D3GA 3DXSX 4DR1J 1RGVA 2XSJA 2J7KA 2V4RA 5F41A 1SCJB 3LP2B 1BLUA 3VR1A 5DM6Q 1M5PC 1J5EJ 1NPPA 2PT0A 3C16B 3OSPA 2HS0A 3A3NB 3CE8A 4NYZA 1UPMB 2ERRA 3T41A 2FZGB 3UDEA 3KHRA 4DV3J 4K4XA 1TVRA 2MSSA 1XIQA 2DBBA 1TMMA 3GYNA 4NLVA 1LFWA 1X4HA 3FFIB 1HR0F 3M8RA 5JVHQ 2BE2A 3MR3A 3KNAA 2R42A 2BACA 3TQEA 4XPCA 1S97A 2M52A 4A8KA 3CCQS 8AT1B 3C14A 1PAUB 2OLWA 2AF6A 4RW6B 3W62A 3VVUA 2NR0A 2CVEA 1GMWD 3D6HB 3UR0A 1U1OA 2I2YA 1P1TA 3CB4A 4IG3B 2OMOA 2HNYB 2EG1A 1Q5VA 3FRZA 2MDAA 1Q82T 2KT5A 3DRRA 1SC3B 2J8SA 4HT5A 3E2EA 4L76A 1TU0B 3AOBA 3D6FB 4OYMA 4WJBA 4DV0J 2LVWA 1NO8A 2Y3YA 4LF1A 1NJXA 3WX8A 3K59A 3E01A 3M2UB 1X7VA 1KHVA 5EX3A 3C15A 3CMAS 1YKWA 3RBXA 2VPXB 2VOPA 3AT1B 2H9ZA 2G13A 3CTRA 1RTDA 1BMQB 2CJQA 4B3RF 2YNHA 4C11B 5M2UA 2G2OA 1PGZA 1RAJA 5IC4B 2BANB 3PEHA 4IOCQ 4KTQA 2CXEA 3IR7B 6AT1B 4NXNF 1TKDA 4RWXA 1IN0A 1Q4RA 4ED4A 4X4UA 3B54A 4DZ6A 4Q5VA 1LXNA 3M1VA 2J76E 3N79A 3G8QA 4MIBA 4P2XA 1SL2A 3T1AA 2V8GA 3V6KA 4E0DA 2CZVC 2PI4A 1XMQJ 5IQQA 3CW2C 2DRDA 2Z2LA 4DPXA 3IFEA 2KH9A 1EETA 2W01A 2OP5A 4QIWD 1MW7A 1NDPA 3DDKA 3M4XA 3KJFB 3BR8A 4DZDA 4LQ3A 2C2OB 1FRMA 4DV6F 2FJEB 3JQJA 1VBZA 2CQCA 2JWNA 2JJ4D 5HO4A 1LWFB 2YY3A 1WG1A 2ZE2A 4CP5A 3OL7A 2ATCB 1RCOB 4JV5J 4AE5A 1S57A 4IOBA 3R27A 3FK4A 3KXDA 2DVIA 4DV5F 4CM2A 4ZK7M 1FDAA 5HN0A 4FYDA 3Q83A 1R89A 4WFZA 4UOHA 2RIJA 2UUBF 2MSTA 2BW2A 3VAIA 2OGUA 1VQ8S 3BV8A 4ZDNA 1SXLA 2HQFA 2MKIA 2OIHA 2XBPA 1WOSA 5HQLA 4USKA 4RW7B 5LMUJ 1UPPA 1I51B 3N6NA 2RQMA 3TEGA 1OPZA 4PXCA 3DYAA 1U09A 2XB2D 4M5JA 2CQIA 1I3OB 1X9WA 3S7RA 3KK3B 5BYSA 5D77A 4PUOA 3BGUA 4OZLA 3ZFVA 2XMUA 4NA1A 4L72B 1AT1B 3CJ2A 4WIIA 4MYTA 3T1YF 1LXJA 5AJ3F 4V19X 1VR6A 2UVRA 1FKOA 2F65A 3TW0A 1N32F 2EPIA 1T9TA 3GTYX 4O4GB 1SIZA 4XPEA 1JLEB 2CA9A 1C4CA 1X4DA 4EZ6A 1JLAB 2JVOA 2XQCA 3IA0A 3UW1A 2HGNA 4WTOB 1VQ4S 1N5QA 1N52B 1SC1B 4U67Q 3QQCD 4OFZA 5MLCV 4GKKJ 2DHGA 2JDJA 3CJ4A 4RUBA 3KDOA 1K9MT 4H4OA 4OI6A 5HANA 1UEUA 3BDEA 5C5JA 4FXDA 3UE2A 2JEGA 1RT7A 2HK3A 1F1BB 1RISA 4MK9A 3SSRA 4B9UA 3H5UA 4NI2B 2QL5B 4YUDA 3QAEA 4ILRA 2EVZA 1GFWB 4CNZA 3TVYA 1HHQA 5HQ8A 3G86A 3UVJA 2NZCA 2OEKA 1J27A 1N36J 2D3O1 2POKA 2PI5A 1SVDA 1N56A 2M70A 5J1EB 2E44A 2AYBA 4ICLB 3DOLA 3DGPA 2HFNA 1JXEA 3QRPA 2CJYB 4DL0C 4NLGA 5B0BA 1HNIB 1Y3JA 4Y2MA 1C0UB 3HFZB 5J2MB 1K1QA 4F4XA 3SQGA 2AHOB 2XY5A 3J80Y 4HL9A 1A0OB 2FGOA 3T5KA 3IG1A 5G0RA 1WJ9A 3MM7A 2R7RA 3NS5A 1TMJA 1F5AA 4BLGA 1ZTTA 3POTB 3ZTQA 1ZPWX 4BDPA 4JI3F 4RZRA 1LW0A 1QAYA 2YH1A 2WZ1A 2AEFA 1X0FA 3D28A 2V94A 3KMSA 3GJQB 3V81B 2KHDA 1BQXA 3CEDA 2W7PA 3MM5B 4LBHA 2DGOA 1CULA 1UCNA 5DGBA 1RKIA 2KG1A 1VK3A 1D9DA 2IVMA 3TAPA 2JEIA 1RTJB 3ILJA 4QWDA 3RB3A 2OI2A 4QZVB 5KG5A 4B9NA 1YRTA 1Q8BA 1HBOB 3H2LA 4B3MJ 4ES1A 2B8PA 3LP0B 5DM7Q 4Q8EA 2XYHB 4J90A 5CXTA 3GQCA 5M2PA 1NHVA 1JLQA 3FCWA 4DL7A 3GILA 1R27B 2BKPA 2GO9A 3IWXA 4WYWA 2B51A 3HSDA 1FCAA 4IKAA 1QDUB 2MZRA 4NXMJ 3BF4A 2ZD1B 5DRKA 3CCZA 2B7CB 5CZVA 3HZEA 3CDUA 4QR1A 2HSEB 2VH7A 3IM8A 2M5YA 2VQEF 1IKXB 1BC6A 1FXRA 5GAHI 2ROGA 1RT3A 2GV1A 2XHCA 3T5HA 4X4PA 1N34J 4FF1A 2QL9B 4DL2A 1FKAF 4ECQA 1YZ7A 4USJC 5CYMB 4FKYA 4KY3A 1EARA 4NL5A 1DY3A 1Y7PA 3HVTA 4WBFA 2HNZA 5DG9A 2FYXA 4J9VA 1IVZA 2BOAA 3JSYA 1YK9A 4ZIVA 3QSYB 3DRXA 3J7YI 3EM1A 4F02A 1DFDA 2BJ3A 1TUWA 2E1AA 4KGXB 3P96A 4QYRA 2HRYA 1EP4A 1RJJA 3UNYA 4DDFA 4M5IA 5B0GA 2HHWA 3M6XA 4I1TA 2LECA 2KFNA 2IJFA 3LH2S 3V4IB 4FBTA 2JC0A 4QWCA 2E1RA 3AB4B 1IR2A 5DETA 5DQGA 4DSLA 1F60B 2X1FA 2KDOA 1FTCA 2ZHAA 4AQYJ 1RWWB 1F2GA 3CVKA 4C3KA 3SEOA 1UVNA 3R5CA 3TZXA 5B0FA 3U1LA 3TI0A 1YI2S 5EWEA 1M5KC 3AOCA 4ECTA 2MLXA 4GVBB 4OMFG 1GK8A 4KPCA 1Q8LA 4RBUA 1JNZB 3GR0A 2DR5A 2Q3PA 4LF2A 3JQMA 2MQOA 2V4JA 3W8PA 1PILA 1PO6A 1FRJA 1Q0NA 4FNIA 2GHWA 4Q45A 1RTHB 5I3UA 2QJ3A 3NKYA 5IT9Y 4ZMMA 4ZPCA 3MMCB 1NDLA 1CJUB 2Y9HA 1H2TZ 3L4BC 2YWEA 5D0RA 4LSLA 4F25A 3PKMA 3EPIA 3TZYA 3KLFB 4LF4J 4LF8F 1Q95G 3MPVA 1S9EA 4U95A 2WVDA 4KGKA 5KFAA 4NMLA 4DUYJ 1VS3A 4HHJA 4OI4A 4WYLA 3M2VB 1N0VC 1S1XA 2G0CA 4LVOP 3C6TA 1XJWB 4DV2J 4EMDA 1AZSB 2ZH8A 2X3GA 2LU1A 3G6YA 2ASLA 2BDPA 2ZVIA 3G4SS 5D6GA 3HDSA 2VPWB 2W7AA 4Q7AA 4I69A 2GVDB 2JC1A 1HYSA 4Y3CA 3KLIB 3QT6A 4ITSA 4LR7A 2HMIB 1NZAA 2R7QA 3BKTA 4GRSA 4DUTA 5KFNA 3TEHB 2VQFF 4ZLPA 1B0TA 2V69A 1HPZA 3GV8B 2FJDB 4OL8A 4Y2IA 2E9ZA 4K4TA 4N77A 5IT0A 2N4DA 3LANA 5H9EK 2ZH5A 2LFVA 3DN9A 1A6LA 4EO8A 2IJRA 2PE8A 4IDKA 2V67A 3DLEA 2BABA 1JLBA 5LOQA 1FJGF 2CPFA 1P1LA 4X4TA 4FP9A 1FERA 2OEJA 3OHAA 3N5BA 2YXLA 4FBUA 2LLZA 1LWEA 1E6VA 2ATLA 3GG0A 2Q6CA 4KH0B 4Q2MA 2JNJA 3T1HJ 1M5SA 1UWAA 2B3TB 1N33J 4ANDA 1VDHA 2YNGA 4YY3J 3Q8VA 5KG7A 1F6TA 1DTTB 4JYAJ 4OX9F 1T3NA 4HHHA 2ZZTA 3QNWB 4A8YA 1QUVA 4PPZA 5KFPA 4RW8A 4OZ3A 1RXOB 2R2TA 5KFWA 2ZC4A 3CD6S 3W2VA 4OYIA 3I55S 1M1HA 3FC9A 1G3OA 4GVLA 2D3UA 2EW9A 4CYUB 2ROEA 4ZVOB 4ZPTR 4FVCA 2DNGA 3LPEA 1F0XA 4NZ6A 3D6TB 4DXLA 2RF2A 3OXGA 2LDIA 3N0VA 4ECXA 1J5OA 3R3TA 2FJVA 3G87A 5IV3A 1HQEB 4NLOA 2WVBA 3GMGA 2CJBA 5DS7A 3LUYA 3FBCA 5THWA 2C2ZB 4DQIA 4DCPB 1HNWJ 2WBMA 5F8JA 3JB9k 3RW7A 2PMZD 1ICEB 1S1UB 1G6BA 3RBDA 3GFYA 1KQSR 2VOOA 3M8PB 1WEYA 1OY6A 4RNFA 2XMVA 2PDAA 1UFWA 2AKWB 3M8QB 1NSPA 3HM9A 3MCSA 1KKHA 1FXDA 3D5MA 2FHJD 1IWGA 4ENOA 3X1LB 4NYOA 5I42A 2CQ3A 4L3KA 2RKIA 3HP6A 2XI3A 1JJ4A 2J6UA 2MQLA 3K58A 4NCBA 3QT8A 3KOAA 1RHQB 4LUBA 3MMBB 2CPZA 4JV2A 1TKXB 1JIHA 1UP1A 5D4OA 1H38A 1RT2A 2DGXA 1FWKA 3HF5A 1IKYA 3EGWB 3WBZA 2JZ5A 1Z1ZA 3M32B 2YBVA 4PWWA 1FK9B 1VQNS 5D3GB 2YKMA 2XSJB 5IM0A 2W1BA 4Q0BA 5DDQC 1RT1B 3SFUA 5KFEA 2VPZB 4KB7A 1KEKA 4QIGA 3W61A 3LGNA 4NA3A 4NPOA 4NE9C 5DO2A 2A6OA 2FDNA 2A6MA 3H42A 2ZBRA 4ECZA 2IM2A 4F4KA 2Q43A 3MCOA 4CLFA 4U7UD 3EVOA 2B5JA 3PW0A 5L1KA 5D0GA 1TVRB 3MEEA 2FHOB 1AXQA 3OT9A 3UDVA 3Q8RB 4RNMA 2BE2B 2AT1B 1N5VA 1XR5A 1H7WA 2HHXA 5DJBA 1HLWA 3TYTA 4J37A 4JI8F 2CIMA 1H6KX 5E0OA 1WOPA 3HHLC 1KS2A 4DFJA 4MIWA 2MEWA 4PQUA 4DBQA 5GAEI 2OFGX 2HWTA 3NP5A 4RW4A 2BJ9A 2GQCA 5SUHA 2BQUA 2V34A 1WC1A 3B4DA 4PYAA 3KUHA 4K4ZA 1V5VA 1RTZA 2DEIA 2CQ0A 3A8KA 2RNEA 3B4MA 4IRDA 2GA7A 1RHRB 1NPKA 4LRBA 2EFGA 3SMZA 2WK4A 3DM2A 4X4QA 4ECYA 3E01B 3C15B 3R97A 1NK5A 3OVBA 1RTDB 4H4MA 2DH8A 2YNHB 2ZH6A 4UUWA 4R8UA 1S76D 2KRBA 3I96A 1XTZA 2XLIA 1CBKA 1IBKJ 4IH6A 2HWHA 3KMQA 3AXKA 3UN5A 1NEEA 2B4UA 3HFKA 5KFYA 1L3TA 2RQKA 2K1RA 3BN4A 2W25A 1NKBA 5A8WA 2RUGA 3M1VB 5AT1B 1RT5A 5KFSA 2NPFA 4PG4A 1K0TA 2BJ8A 1UVKA 1TAUA 2Y0BB 4DFKA 5GMEA 2ZBIA 2A1BA 2QLJB 4AXIA 2CJAA 3O1LA 4CZCA 2OMLA 1X4CA 2BM0A 2E5HA 1EETB 3G8SA 1Q8KA 1WSVA 2GJIA 3ZZYA 3SV4A 4B3OB 2VA2A 1TUGB 4P2FA 1WC3A 1BD6A 3GR1A 2MZTA 4J9LA 3SBMA 2R7UA 4N8OA 2OPPA 3THTA 4CLPA 2V9KA 3THVA 4DPOA 3MPDA 1JWWA 4DV7F 2ZE2B 2H4YB 2D69A 1GX5A 4ZVFA 1X4EA 3V6DA 2RQ4A 5KT5A 3OW2R 4WFAQ 5M2RA 4OI2A 1FX4A 4EU0A 3LGMA 3QMQA 2R7TA 3R9LA 1WACA 1SH2A 1LKZA 3D68A 4EUVA 2XMAA 1SUQA 4ED1A 5H1SV 3P4UB 3E3XA 3MD1A 4PCQA 3QZ7A 2MKYA 3HVRA 4F50A 5KFLA 4CLSA 3H8YA 3HMJG 2VFRA 2X3DA 1NUEA 3M8YA 2MZ1A 2MZSA 3QWUA 3F56A
chains in the Genus database with same CATH topology
3QWPA 4TLQA 1DLOA 4CTAA 3MM6A 4F3QA 2W9BB 3CC4S 1DQ8A 5E33A 4WFNQ 2Q66A 4R0JA 3DYAB 4N76A 1DTTA 1YITS 2YVSA 1QY7A 3ENQA 2D9OA 4GC7A 2XCPA 2AJ0A 3G9CA 5EDWA 4ZCLA 4C98A 1ZETA 3K0JA 1N5SA 3QYYA 5IFMA 4O4RA 2FLNA 3QLHA 2ZH7A 3K5LA 2HHSA 3GB0A 3ENWA 3HHKA 1X5SA 3MEKA 2IYGA 4NRTA 3HHDA 4PUOB 3OL8A 2ZJRQ 5A8KA 3JYTA 4K4YA 2GHPA 5SZTA 1T7PA 2Y1IA 3MDFA 2VODA 1HBUB 3GIIA 1AUDA 4ZCKA 1VQSA 4PXEA 4ES2A 4KSEB 3FSYA 4YDDB 3I0SA 3PO4A 3GFZA 4NLYA 1FJ7A 3FJ2A 1L3VA 5D4LA 2M88A 2V2KA 4CH1A 4WFBQ 3KJVB 1IBLF 1H7XA 4F4ZA 2CZ4A 1JLGA 3RAQA 4NRUA 2Z8QA 2K3KA 1N8RT 1IUJA 3UDLA 2JH3A 2LA4A 1FKOB 3RB4A 3PW4A 4WKYA 5KOXA 3FRYA 4P7TA 1S1VA 4DR3F 4UY8T 1DTQB 4EBDA 1U1KA 1TK5A 1WNEA 1SH3A 5CH7B 4CO2A 2C3PA 3CCRS 2HPUA 3IO1A 3OLAA 1VBXA 4QWBA 3TRGA 5DG8A 2MQPA 2HVHA 3CULA 2KO1A 5A2QY 2LQJA 2VD3A 1TV6A 2C3OA 4X65F 2ZDOA 4MFBB 1WWHA 5GADI 3G96A 4LF6F 2GGPB 4O3NA 5FDLB 1X0PA 3KG0A 3MOJB 3AY0A 4N56A 3OL9A 3SFGA 3AAWB 2R2UA 4WK3A 3L3CA 1SKSA 3BQ1A 1HQEA 3CJKB 1B0PA 2EWHA 2LU2A 4HDHA 4TN2A 3IXQA 1VC5A 1GXLA 3MECA 1ZM3A 3CO9A 4HH0A 3LP1B 5CYQA 4QU6A 2HFZA 4B3MF 1WG4A 5KFFA 3PXGa 3OR1A 4ECSA 1HBNB 2YQ3A 4CT9A 4ZPWR 1J5EF 1U7LA 1U1NA 3QJLA 1GH8A 3MEDA 4MH8A 4LFAF 5J2NB 4AL5A 1RT7B 2CKWA 5EWGA 1S6QA 2AW0A 2R7SA 2IRYA 2IAJB 3J81Y 4C8ZA 3D1QA 2QIFA 4QWAA 2P5VA 3CCSS 1S1UA 1YJNS 1R8HA 2VG7B 3GSDA 4PWDA 1XC9A 2MMYA 4KGMA 4EFAC 3HZGA 1HL6A 3M8PA 3NRBA 5D4NA 3KK2A 5HMXA 2ZH9A 4W90B 2JEJA 2QA4G 1D9AA 1REVB 1JKHB 2CPEA 1NB7A 2ZUGA 2IMWP 2RE1A 1H2VZ 1WTBA 3W2WB 2BOPA 2OPQB 3M8QA 5E41A 2KJVA 4KRWA 2WB4A 1GT8A 4DQPA 1FRKA 2CPXA 2GW8A 3OFHA 4M95A 4NXMF 2XWXA 3OTCA 2DNHA 2FC9A 2W8LA 2N7CA 4K4WA 2CVIA 3LW5C 1FEHA 1VHFA 4J9PA 3L95X 2C42A 3MMAA 4BC7A 4DX8H 5LJ5Y 2J0WA 2IM3A 4OJHA 2RU9A 3DOKA 1HMVA 4DL6A 4I7FB 4KO0A 1YSJA 2F9JA 3DLGA 2C2DA 2OD6A 5J1NA 1S77D 3DOLB 3ZZZA 4J9SA 2D7SA 2DGWA 5KFVA 4CO5A 1T03A 2CQHA 2W24A 3K7RA 2UV8G 4LQ9A 1HNVA 1LWCB 4NLUA 2QSWA 3CDAA 2E5GA 4E98A 3UPFA 1KOHA 3CCMS 4OJGA 4FS2A 2FY1A 5A8RA 5KG3A 1H2UX 4XK8C 3GV5B 4Y2AA 3MFHA 4ELVA 3CDEA 1QE1A 3KLHB 3F73A 4AL7A 3CJ5A 4JV1A 3KLEA 2P9EA 2HWIA 1YRUA 4Y6IA 5F3ZA 3MMBA 4YMEA 2GMLA 4BWMA 5CYJA 2KXNB 3C2PA 3SQGB 2L9NA 3GIJA 2YH0A 3AH6A 3I5BA 1TKXA 2D74B 2KFYA 1FD2A 4MJKA 5LMNF 5KT2A 2FVSA 3WC2A 1Y5IB 3ONQA 1IQTA 1OS5A 2XEXA 5AXLA 2ZH4A 1BQMA 4TY8B 2CYYA 3E8OA 3ISND 3IG1B 5HLFA 2FVRA 3HKWA 1WTFA 1KNZA 4R0EA 2EK6A 1S6OA 3MM7B 5AE1A 3DI6A 2B9WA 5CD4H 2WTFA 5IXUA 4CT8A 4ALZA 3RBEA 4DV0F 4N41A 2FD2A 3NAHA 2HIQA 2L08A 5C25B 2YTCA 4X66F 1SKWA 4MKYA 3BSCA 1NNDA 1XN9A 1MWYA 3M32A 1U8SA 3O44A 2U1AA 1JLCB 2WRMA 3ISNC 1ZYQA 1FO1A 1TP7A 3BJYA 4EYHB 1FK9A 1IKWB 4IUFA 3N01A 3IWNC 5D3GA 3DXSX 5B0DA 5JXSA 1D8YA 4OHXA 1YWXA 1RGVA 2ZC3A 2XSJA 3GYXB 2ZVSA 2J7KA 2V4RA 1YJTA 4DQQA 4K59A 5F8GA 3R5AA 5E3PA 5F41A 2MGZB 4DV1F 2HW3A 3B78A 4TLRA 3LP2B 1BLUA 3VR1A 4FNHA 1TL5A 2GO8A 5IT4A 3UNGC 4ED0A 2LXIA 2BYCA 2YKNA 4P6QA 4Y28C 5DM6Q 2G4BA 2Y1RI 4MMOA 2IBKA 4CO0A 1M5PC 3OVAA 5GAGI 1HARA 2XC9A 3PX0A 4IG0A 2PT0A 2DGTA 3DMJA 3OSPA 2HS0A 4I64A 2YKQA 3DLKB 1T8EA 3E51A 2HS3A 1PSDA 4I6WA 3CE8A 3C66A 4OZ5A 4BC9A 2N4CA 1HI8A 3AJ2A 3UCZP 4J9MA 4NYZA 2ERRA 2AX0A 2B6AA 4ERDA 4GO5X 3KHRA 2VG5A 1RWUA 1A9NB 4K4XA 1TVRA 4JI4F 2M8HA 1YGYA 3SCIE 3H5YA 2MSSA 3GYNA 2DBBA 4NLVA 2OJ3A 1LFWA 1X4HA 3EGNA 3FFIB 2DR8A 4O3RA 2HHHF 1URNA 1NAQA 2IRXA 2WSCC 2AJ4A 1HR0F 4AQYF 2MJUA 4RU9A 4RW9A 3M8RA 4OI0A 5D78A 2BE2A 3PKYA 3MR3A 5JVHQ 3M2RB 4NCGA 3KNAA 2NZ4A 4X4VA 4LF5F 2BACA 2PA3A 4W92B 4XDCA 1XMQF 4MIAA 3K2YA 1LK5A 4XPCA 1S97A 3SZ2A 1CEZA 2D3OR 2M52A 2N3LA 4A8KA 4UW2A 3CCQS 1NJWA 4O44B 1XK8A 2A18A 2ZH3A 2AYEA 3QO9A 1YQHA 2OLWA 2HLTA 3VZIA 5K8PA 2AF6A 4RNOA 4RW6B 2NR0A 2R8JA 3I4HX 4I56A 5EN1A 2CVEA 2K2PA 3ZC4A 2WOMB 3DOMA 1JLQB 3UR0A 1U1OA 2XS5A 3QIPA 2I2YA 1P1TA 3CB4A 4IG3B 2OMOA 4DSIA 1GQEA 2HNYB 1DBDA 2P9CA 2EFQA 2EG1A 4L3NA 4ILLA 2AP6A 1FHTA 2VBXA 3S6EA 3OV7A 1VRTA 3FRZA 1UA0A 3HHEA 5KFGA 2MDAA 2Z2MA 4LF9F 2VKRA 3VAFA 1Q82T 5B0AA 5GAHU 1U1RA 5MAOA 2XMTA 2KT5A 3M6WA 1UJ6A 3DRRA 1U4BA 1RT4B 1RDRA 1P27B 1HBMA 4HT5A 3CUNA 3DC2A 2W9CA 3E2EA 3DRSA 1FE4A 5LT5A 3G8TA 4NLSA 4NLPA 2OFHX 3KHGA 3VAGA 1X5OA 1CVJA 1NJZA 1N0UA 2DJWA 1VOMA 7FDRA 4JOUA 2B9XA 4IRKA 5HMYA 4JV5F 4WJBA 2L48A 5B0EA 2DD8S 4E8UA 4DLGA 3M30A 2R4FA 2LVWA 1FNMA 1Q53A 1NO8A 2A3JA 5LL6d 2ZH2A 3BO4A 2IA6A 1Z2ZA 4DS4A 1NJXA 1SJQA 2KVIA 2DGVA 2O66A 4URSA 2UZAA 3E01A 3K59A 4O3QA 3M2UB 4DUYF 1MWZA 2LEPA 1E6YB 1X7VA 4IFVA 1RT3B 1KHVA 2QLWA 5EX3A 4KR0B 4PKDB 1X4BA 4ECWA 3CMAS 1M5HA 1V3RA 3O5TB 4KKOA 2MPUA 5CCLA 2VPXB 4ID5A 1PC5A 2VOPA 3MOZA 1YRXA 1X8DA 2H9ZA 2G13A 3CTRA 1GTEA 1RTDA 2CJQA 4B3RF 1Q86T 2YNHA 4C11B 5B09A 5M2UA 1W2IA 3SCKE 3Q24A 1YJRA 1PGZA 1RAJA 1XWLA 4DMZA 2BANB 2NQPA 1TK0A 4HVZA 3PEHA 3HVTB 4O23A 3AJ1A 3OUYB 4IOCQ 2MKHA 4G6VB 4KTQA 4F2SA 2HNZB 3ZZRA 3RRKA 1FRIA 3IR7B 3GWCA 1B7FA 2W4CA 4NXNF 4TYAA 2MKCA 1TKDA 4RWXA 3US5A 1FNXH 4ZP6A 5LMUF 4F4WA 2F7VA 3D0IE 1IN0A 1Q4RA 4HTJA 4X4UA 2XULA 3JTPA 3G6VA 4AYBD 4RU2A 3PIPQ 3N28A 2YX7A 2RDIA 4DSEA 1X9MA 4F26A 4QIVA 3K5MA 4Q5VA 1N48A 1LXNA 1K8AT 2J7UA 2NPIA 3MMCA 1U1LA 1VC6A 3M1VA 2J76E 1U2RA 2LCWA 3N79A 5C42A 4KC5A 3G8QA 4MIBA 3TVKA 3JSMA 1KR4A 3O3LA 5J1PA 4R5PA 1SL2A 1VK8A 3K5PA 2F3JA 2GX8A 3LAMA 3T1AA 2V8GA 3V6KA 4E0DA 2CZVC 4Q8FA 3PVXA 5L8RC 4YFUA 3ITHB 1EP4B 2PI4A 5E3QA 4ECRA 1S9GA 3Q0AA 1JXLA 2F40A 4O0IA 2YKPA 2HG4A 5GMKa 3CCUS 3KK1A 5IQQA 5E3AA 3HK2A 1H0HB 4ETXA 3DCAA 3RU0A 4KV8B 2Z2LA 1LW2B 2Q1LA 1FKPB 4OX7A 3IFEA 1K73T 3I5CA 2KH9A 3NGKA 2DK2A 5HROB 4WFYA 3NAIA 4DL3A 1EETA 3MR2A 2OP5A 3UD4P 4QIWD 4IQMA 1MW7A 1QVGR 2R9LA 3SSSA 2HGLA 3SDEB 4J9NA 4UQTA 3DDKA 2QT7A 2KM8B 2OPSA 3M4XA 3SSQA 2RQCA 3BR8A 2V9WA 4LQ3A 5CA5A 2JLFA 1DQAA 2V5HG 3VALA 3RAXA 1WHXA 1FRMA 2RD5C 4G1PA 2RS8A 5HMWA 2WAQD 3MM9B 4DV6F 2W4PA 4C3MA 1Q81T 1NRKA 2FJEB 5K8NA 2GQQA 3CSKA 4GKKF 2JL9A 1VBZA 2E5JA 2QA1A 3VCDA 5DDPC 2CQCA 4QYZJ 2JWNA 2KXFA 1F5BA 2DNYA 2JJ4D 2PIIA 5HO4A 3T3FA 2PN6A 4RX6A 1LWFB 2YY3A 3UDCA 1Y4ZB 3MWBA 4ZHRA 3WDOA 1WG1A 2N7YA 1Y9OA 2ZE2A 3HHLB 4DWIA 3OL7A 4LSNA 1ZOTA 1S48A 4WU3A 2FVQA 1QM9A 2YWKA 4GO7X 4C8NA 4AE5A 1WELA 3T1HF 2IVFB 3PR4A 2OPRA 1S0NA 2XCAA 4DFPA 1CC8A 4IOBA 3R27A 4OHVA 1I1GA 2C3UA 3CGIA 1C0TA 2DVIA 4DV5F 1S0MA 4ZK7M 3NNHA 3KLIA 3C6UB 1X4AA 1WF0A 2V4JB 5DQHA 1IXKA 4QR0A 1FDAA 5AXNA 3L09A 5HN0A 4FYDA 4WKRA 1T94A 2EK1A 1R89A 2LXUA 3LF0A 3NBPB 4WFZA 2N3OA 4JYAF 2RIJA 5I3UB 2JLEA 2AU0A 1V3ZA 3IAM9 2UUBF 1YVFA 3AA8A 2MSTA 2GNKA 3GIMA 2BW2A 3VAIA 1WF2A 3OXFA 4ECUA 3EX7B 1VQKS 1VQ8S 2CPHA 2OKQA 4ZDNA 4LSLB 1SXLA 2M4MA 4AUKA 1YJWS 3GG1A 2MKIA 2OIHA 2XBPA 3DRPA 1X4FA 2XWYA 3PX6A 2LEAA 2PMHA 5H9FJ 2XS7A 4I67A 1BWEA 4IFYA 2MKJA 4NLQA 4RW7B 5AE2A 1S9EB 3N5FA 4DF4A 3B82A 4ZCIA 2XLKA 2CDQA 1HWUA 2Z4PA 4KAIA 2QMWA 3N6NA 3I9V9 2W9BA 1TAQA 2RQMA 2XHWA 1OPZA 4PXCA 3H25A 2VG6B 1U09A 3DYAA 1QUPA 2W7OA 2XB2D 2CQIA 1S6UA 5KFXA 2J8AA 2UVWA 4J5OA 1GX6A 1X9WA 2RB7A 3MD3A 3TVZA 3S7RA 4NCAA 4IO9Q 1ZBTA 1S1XB 3KK3B 4A8XA 3OXLA 3C6TB 4DL4A 1YG0A 3P5TL 1ZZFA 4RUAA 4B3SF 3H4DA 5BYSA 2J0QD 3LOUA 5D77A 4PUOA 3BGUA 2HHQA 4OZLA 1HBUA