3BM7A

Crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
HHHENLYFQGMIGVVATLKVQPAKAAEFEKVFLDLAAKVKANEPGCLVYQLTRSKTEEGVYKVLELYASMDALKHHGGTDYFKAAGAAMGPTMAGAPVIEYLDAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Protein of unknown function with ferredoxin-like fold
publication title Crystal structure of protein of unknown function with ferredoxin-like fold (NP_420935.1) from Caulobacter crescentus at 1.35 A resolution
rcsb
source organism Caulobacter crescentus
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bm7A00
2ASYA 4Y2IA 2OD4A 2RSQA 3MCSA 1FEEA 1TZ0A 2BJDA 4HL9A 2K1RB 1Q8BA 1VQYA 2OKQA 5B0GA 1OSDA 4FNHA 2KT2A 5F0WA 3TNVA 2W4CA 1X7VA 2AW0A 1OQ6A 1SB6A 2K7JA 2N4CA 3DXSX 1SI9A 3HHLC 3IWLA 2PD1A 2XMUA 3I9ZA 2ACYA 1R6YA 2K2PA 1U7LA 2L3MA 4HI1A 3E8OA 3UDCA 1Q8LA 2XMTA 5F0UA 2GO8A 3F44A 3QMQA 4Q2MA 1RJJA 2OP5A 2RMLA 3GZ7A 1FE0A 1N5TA 1TUVA 1LQ9A 2AP6A 3KG0A 5B0DA 1AW0A 2KKHA 2QLXA 3KKFA 2ROEA 2OFHX 1X0PA 2XMWA 2GCFA 1CC8A 1Y9OA 1MWZA 1K0VA 1MWYA 1Y0HA 3TOQA 2K7KA 4A48A 1URRA 4Q2LA 4EFAC 2FIUA 1W2IA 2HFNA 2KYZA 1X8DA 2W4PA 3BDEA 1APSA 4U9RA 1CC7A 2HLUA 2HQIA 2OFGX 1OQ3A 2IYIA 3KNGA 1JWWA 1Q53A 1V3ZA 3BN7A 1Y3JA 4A47A 5A6PA 5B0EA 2GA7A 2BUNA 2RILA 2LQ9A 2FB0A 4QOTA 3FRYA 1FESA 1VQSA 1SQEA 2QYCA 3HFKA 1YJVA 2GGPA 1GXUA 3HF5A 1YJRA 1ULRA 5IXUA 2G9OA 3LGMA 2ZDOA 3VTIA 1TR0A 2OAUA 1TL4A 5B0AA 4FNIA 3HX9A 1KQKA 3HHLA 2GFFA 2HIQA 1XBWA 2HLTA 2ROGA 3QGPA 2XMMA 2LQBA 1IUJA 2N4DA 4Y2MA 3WDOA 3BGUA 2Q3PA 2VV5A 1YG0A 4HH0A 2HFOA 2ROPA 5T7LA 4DN9A 1AFIA 2BBEA 2XMJA 4OJ1A 2W4DA 1YRXA 3CJKA 1P8GA 3BB5A 2FHMA 2GGPB 4A46A 4A4JA 4OJ3A 2ZDPA 4NL5A 2AJ1A 1OPZA 1N5VA 1Q4RA 1AFJA 4DL0C 1QUPA 1TL5A 4ZA1A 1GXTA 4YDXA 2PGCA 4NPOA 3K7RA 2LXFA 3HHLB 4OJHA 3T9NA 3HHLD 1YJTA 4OJGA 5B0FA 5K9FA 2QIFA 2XMKA 4OIXA 2RU9A 5B0CA 1CPZA 2CRLA 2OD6A 4F67A 2IYGA 5KAKA 2OMOA 3MZIA 1N5QA 2JDJA 1KVIA 1FVQA 5T7LB 2AJ0A 2BJEA 2BYCA 2K1RA 3FMBA 3IWXA 4HH1A 4ZOSA 4Y2KA 3TRGA 2LDIA 5B09A 1FVSA 5B08A 3CJKB 3DCAA 3FGVA 5B0BA 1KVJA 3BR8A 1FD8A 1S6OA 3LGNA 3LO3A 1S6UA 4HI2A 5A6WA 2QLWA 2FTRA 1FE4A 4YEAA 4DPOA 1N5SA 3BM7A 3KG1A 1JK9B 1Y3KA 1YJUA 2VH7A 1P6TA 3HDSA 1WD6A 2IFXA 2N7YA 3BF4A 2EW9A 2XMVA 2KT3A 2GV1A
chains in the Genus database with same CATH superfamily
5E3RA 2CWXA 3OFFA 1U8WA 2BJDA 5D0GA 3MECB 3FVYA 5A8RB 3HD1A 3R2CJ 3FBCA 1RI7A 4DX8H 3DYAA 4ZVTB 2Z0GA 2C2MB 2GCFA 3V4IB 2KHDA 1VQ9S 1R8CA 1S79A 2PDAA 3EM1A 2PT0A 4B3SJ 5I3PA 3BDEA 3R7NB 4ZPVR 2MQQA 1M5OC 1RHUB 1UZHA 5DLFA 2XYGB 3Q2SC 1UWBB 2VL1A 4ECRA 3GJQB 2XCPA 1QUVA 2Y9HA 2DR8A 1UA0A 3IG1B 2ZVSA 3IM9A 2VG6B 4GO7X 2B6AA 2LP4A 2BM0A 2FJDB 3QZ7A 3A12A 4LRFA 3OXFA 4OYZA 5EWFA 3WBZA 2AT1B 4ZPDA 3C15B 3BKUA 1N33J 1ZAXA 2GQQA 1Z2LA 3DU6A 2DGXA 2QFJA 1FWPA 2VFUA 3BSNA 2VH7A 1B3TA 1T05B 3KTQA 1Q81T 4B3RF 2ZHOA 1I6JA 3RBDA 3M8QB 3C46A 1FFSB 1IBKJ 2C2ZB 3RW6A 4IG0B 4DLEA 2P8IA 2QEXS 1KHVA 3TUJC 4ECVA 4N7TA 4JI1J 1NK8A 1X8DA 3E3XA 2CJAA 3CD5A 2HVEA 4EU0A 4PG4A 3MD3A 1M5HA 4YR0A 2FJAB 3UVJB 3RBXA 3GP9A 5BR8J 3FSYA 4ZPTR 2ZE2A 2AYEA 2UZAA 3RG6A 4O3RA 1F2GA 3JAMY 1XNRJ 2PMWA 3C19A 2M9KA 3CWJA 4ZVPB 4LRAA 3UD3P 4I2PB 2VASA 1BD6A 1HBUA 4B3TF 1UA1A 2ZBPA 1DLOB 2DNHA 2H5IB 3TA1A 3ZZTA 4HH1A 1FVSA 2NSBA 1HPZB 4DMZA 3LP0A 1S76D 3O2IA 1FA0A 4YUDA 1F5AA 2DY9A 2ZH5A 5AXLA 3KHLA 3CCVS 2OD4A 3A1YG 2V9WA 4NOHA 1KOHA 5KT7A 1WF1A 5ETVA 4ETXA 1GFWB 2VDIA 4MKYA 3HKZD 1LNQA 4DV4F 3QMQA 2BX6A 2RS8A 3D54A 3MAAA 3GYNA 2ROEA 2YBVA 1Y9OA 5CQGA 1DARA 4K0KJ 4I7FA 2R7WA 4NYPA 1RSCA 3ISNC 1ZA2B 1S6QA 4USMA 1LWCB 1IKWA 4DN0A 1EJ7L 1FCAA 4P52A 3I6PA 1Q0NA 1SJRA 3HI9A 4H4KC 2MGZA 2HHSA 1NB2A 4JI8J 2R2TA 4ANEA 2YKQA 4O44B 4Q8FA 3ZNUA 2Q1LA 4O3OA 2ZKUA 5KG4A 4H4OA 2BRLA 1Q7YT 2NUHA 4W98A 1IM4A 4DUYF 4NA1A 2IJFA 2CKWA 3MM5B 2WRMA 4ED7A 4LFBJ 2FYXA 8ATCB 4DEZA 1RAFB 3QRQA 3SMZA 4C48A 1D1UA 1WHVA 1AZSB 3M6WA 1E6VB 5E3PA 2QLBB 2DHGA 2EVZA 2R7SA 2PMHA 2CPDA 4MYUA 4L3NA 3HJFA 5GAGU 1S1TB 4ZITA 1FKOB 3TAMA 1QSSA 2XMUA 2DPJA 4F2SA 2I2YA 1NDKA 3NXZA 3T5JA 2HURA 3AA8A 4GVLA 2KXHA 4U9RA 1CC7A 3DLEA 1NUEA 2RF2A 4PQUB 2DGVA 2B8PA 4OZJA 4TU7A 2N82B 3X1LB 4DPXA 1VIOA 1PGZA 5HMWA 3ELHA 1FFGB 3NNHA 1Q8IA 1KQKA 5CCLA 3ISZA 1TL1A 4P9SA 5F8GA 4HEA9 1KHWA 4DV1F 1UJ4A 1RQ0A 1SUQB 3M8YA 4OJ1A 2VQFF 4DSJA 2H1YA 5CA5A 3S8SA 1KVIA 3H42A 3POTA 5GADI 3NL0A 1WEXA 4UZCA 2DKOB 4Z37A 2VG5A 1KNZA 2GVZB 1HNVB 4NA3A 2OEKA 2HHXA 1C4AA 2XLIA 4YMEA 2CVIA 3DNCA 1RBOB 1JLFB 1RWVB 3GIJA 2BM1A 4WF9Q 3QZ8A 3MM6B 2F8EX 2V4JB 4MIWA 2V8PA 2XMWA 1NKCA 2VC0A 1RZMA 1U0SA 4FS1A 2DCLA 3FQLA 1S0NA 3FRYA 4X66J 1VQLS 3J7Z5 3FKBA 3EX7B 2I9SA 4WE1A 3J7YU 2MKKA 3NGTA 4CDIA 4QIFA 3AHPA 4YS2A 2N4DA 1C1BB 5T14A 2M4MA 4J9MA 2VICA 3P8BB 2C2OB 1KQGB 5E3QA 1NBEB 5LJ5Y 2YH0A 4ZCMA 1UVKA 3DCAA 2JFDA 2DRDA 3A3PB 2KRBA 3J81Y 3OBIA 3BSCA 4ID5A 3NGUA 2ZWPA 2QFIA 1D8ZA 4K5RA 4OI1A 4F0MA 4PPDA 1R8HA 1KC8T 2LECA 2NZCA 2E9ZA 3VGSA 4ED4A 4C8OA 3PYGA 3RR7A 2DK2A 2G0CA 1HNWJ 3H8YA 3MEGB 1S4FA 1N5YB 2V94A 2Q43A 2QA4G 1C2PA 2OPRA 3BN7A 2RDDA 1KS2A 3KLVA 2GHWA 4NLOA 4RW6B 4FVCA 4IUFA 3OJSA 3HX9A 4Q43A 1NXIA 3I0RB 3KUEA 3M2UB 4U8YA 4LF8F 1A0OB 1UVLA 2BKPA 4LFCF 2FHMA 4MKVA 5AT1B 2CNOB 4WFBQ 2KM8C 2J7UA 2DIUA 3PRVA 3D7SB 2G1HA 4DR4F 4WKYA 1YIJS 2DO0A 4C8LA 2VPWB 4X62F 4DV0F 4EO8A 2QGFB 2CPZA 1YRUA 2XC9A 2A6MA 2XZWA 2JC1A 1F9EB 1PBUA 5DM7Q 1JMTA 5KFQA 4DG1B 2VF3A 2AX1A 2VA3A 1WI6A 5EWGA 3VAFA 4RX6A 2ZJQQ 1HNXF 2PI5A 1FJGF 4ZK7M 4NE9C 2BA9A 4KB7A 1VS3A 5L38A 2QG9B 4ELVA 5IT9U 4C97A 5K8PA 4DQPA 4ILLA 1X0PA 2W9CA 2AEJA 2OEMA 1TMJA 3AD8C 3HVTA 2GJIA 1IKXA 3W65A 1FESA 1RKJA 1VI7A 3H2VE 5JVHQ 7AT1B 2H48B 3CJ3A 1FJEB 2RKIA 1VYAA 1U6BA 2LQ5A 4K4SA 1MROA 2H65B 2NREA 1OYDA 3H59A 1HHQA 4OJGA 5D3GA 5U47A 3IM8A 2E5IA 1RBLA 5L1KA 4JI2F 3LGNA 3W62A 4WFAQ 3PV8A 1U1OA 2W9BB 4R8UA 4J37A 4PR6A 2ACYA 4QU6A 2HQDA 2K3KA 4KPYA 4IDKA 3ZTSA 2EFQA 4JI6F 3MMAA 2L48A 3MPWA 1OY9A 4FVMA 4TYBA 2YWHA 2KM8B 4ZIVA 5SUHA 3G9CA 4UT4A 1LWFA 1TK0A 2CJXB 1WSRA 2I5JA 3BQ2A 3D3CJ 1PJ7A 2MQLA 4WK1A 2MSTA 3M32B 2Z30B 1S1UA 3ICLA 4D3HA 4P2MA 4Y2CA 1YBUA 2U1AA 1AFJA 3Q22A 3DOLB 2MLXA 2OPSA 4C2MA 2YQ0A 3O8WA 1RT1A 4OYPA 3QFHA 5HJYA 1FK9A 2HVDA 1K9MT 2MQOA 3AJ2A 1Y5LB 2KJWA 4X65J 4K5SA 3E01A 4TY9A 2VC1A 4FBUA 1UEKA 2W4CA 3AAWB 5LXYA 1KOOA 4QBUA 2HQ3A 3GONA 5ETLA 1FE0A 1RT4B 5F8HA 3TX8A 2BQRA 4DR5F 2DH8A 2YX4A 5A0YA 4L76A 1OQ3A 5JVGQ 3CNQP 4ENOA 2NXEA 1RT6A 4L72B 1D0EA 3MUMP 2X1BA 4DR7J 2FLNA 4F4XA 4OYBA 5KFLA 4RBVA 5E41A 3QRPA 3D68A 1RK8A 3CJQA 3TJ9A 4PG5A 2C3PA 5F8IA 1KVKA 3QYYA 2OD6A 1TKZB 1N6QB 3CD6S 2LDIA 3ZNJ1 1REVB 3MM8A 4IO9Q 2W2QP 2UXBF 4QWBA 4XIUA 4K4WA 1FNMA 5D4OA 4N56A 1Q86T 4ANCA 4JV0A 5J2NB 1I94F 2AW0A 1M5SA 1KD1T 2HHTA 2Q6BA 2XLJA 5KFHA 2DR9A 4RKUC 3KG0A 2HQGA 4JV5J 1N54B 1VQ8S 9RUBA 2YWKA 3VQSA 3AOBA 4LJMA 2OFGX 1KSPA 2HS3A 3QT5A 1S0VA 2FVPA 5HMXA 1HMVB 1R43A 3HHLA 2M8DB 5A2QY 3DDNA 2HHHJ 4MKBA 2HKEA 5CD4H 1K0TA 2DNZA 1UJ5A 2B5JB 3QNWB 4NLRA 1OS5A 2JEIA 4ZJLA 2UVVA 3CJ2A 3GG1A 3PJ9A 4BHQA 2GIRA 4KHPJ 1QD1A 2MKIA 4ZJQA 5LSOA 1L3UA 1SH0A 2LU1A 5LT5A 1LW2A 2CQ0A 2XGPA 2YNFB 2QX0A 2N7CA 3SIPB 4CNZA 3R5AA 4F8RA 3NMAA 2PFDA 2IC3A 1RTJB 4U95A 4FF4A 3L7UA 3TX0A 4LF6F 1SJFA 2XGQA 5I4MA 2VB6A 3U7JA 3W66A 1R8AA 4E0DA 4PUOB 2V2VA 4ZLLA 2MLZA 4PWUA 3BYRA 1R27B 2YNIA 2Y0SD 3UE2A 4DSIA 4MAKA 2DGUA 1AB8A 2J0XA 5JXSA 2OPPB 4WJBA 3SQOP 2RJZA 4OI0A 4AQYJ 5A8KB 2W2NP 6FDRA 2BE2B 3HPOA 1X5PA 1SIZA 4J90A 4F50A 5T41A 2VFSA 2DNKA 4K4XA 2HQCA 4QIEA 1FDNA 5KFOA 3IP0A 2K3IA 5KFJA 3U02A 3I87A 3A8KA 4EZ6A 2YKMA 2DB1A 2IBOA 4JP8A 1QLNA 1Z2ZA 2UUTA 1N5QA 5C2CA 3TRGA 2J7KA 1OJ4A 5B08A 3I56S 4X4SA 5HQLA 1EETB 1JLBA 3ZO7A 3CEDA 2ADBA 2CVEA 4FDFA 1JK9B 4CTAB 2D3OR 2W01A 4HL9A 3QSYB 2CQCA 1NNDA 3W7BA 3N6LA 4R25A 1VHIA 1XMQF 4IR9A 3K5OA 1R6YA 2OPQB 2C3MA 1DQ9A 1RT2A 1U45A 4H4MB 2V2KA 3QLHA 3CC4S 4L74A 4LR7A 4NMXA 2CJ9A 4OV6A 3PW5A 4W92B 1V3ZA 1IKYB 4DR6J 2RQ4A 3AA9A 4YB5A 2V0NA 1XJWB 4RWXA 5BJRA 4KGXB 4YN3B 5GAEI 3MR5A 5HROA 1T9WA 1CULB 2CDQA 1BWVA 2AJ2A 2LLZA 2QTWA 4LR8A 1D8YA 3MCMA 3KDNA 1D9AA 3PTWA 3PHEA 2GVDB 4AFFA 4WFYA 3MMBA 2UUCF 4KIAA 5I3QA 4KGVB 1O51A 4FYVB 1W7WA 3EMTA 1S72S 1UVMA 2WSFC 5HI7A 3QWPA 3BQ0A 1VC5A 3VAKA 5FJ4A 1AYEA 1U24A 3TR5A 2CUYA 2GHPA 3MXHP 3NCRA 2V50A 4HHUA 4DWIA 2PA8D 4LSNA 3TW0A 1VGYA 3G82A 3FZBA 1V5IB 3G6YA 5EGYA 4FYDA 1BLUA 3EDRB 1GT8A 2UVUA 3I9ZA 1XR7A 1RBAA 3L9ZA 3RRKA 1JLEA 3BYPA 4FN5A 1CC8A 1WELA 2WBRA 2LA4A 4QQBA 2AJQA 5B7WA 2B9YA 2M3DA 3SCJE 4HDHA 3U1MA 1C0UB 1CLFA 1HBNB 2Z57B 4G1QB 1RA6A 3KK2A 2JEGA 2VHGA 1M5VC 3A8IA 4GKKJ 4UUWA 1J5EF 3H40A 2AJ1A 1F9HA 2HNDA 2BZ2A 1DRZA 5K9FA 3K89A 1K44A 2C3UA 3HHKA 1SKRA 2DNMA 1F60B 3CB4A 2DT9A 1ICEB 3MOZA 3V4MA 1S1XA 3JSMB 3TWZA 4AD6A 4X4VA 1X4CA 2A3JA 1SL2A 5EWEA 4XDDA 1SC4B 3ISND 1WC4A 2ZVIA 2B9EA 4CQ1A 3BH6B 2V63A 3HCXA 1U0HA 2H4WB 2OEJA 1IM6A 1IKVB 4NMLA 4EMDA 2EEYA 1YVFA 3KLFA 2ABYA 2MMYA 4CP5A 2YNHA 4C8YA 2HQIA 3DLGB 2V67A 1NH7A 2IM3A 2DR7A 5LJ3Y 2PC6A 1TTHB 1AT1B 1JLCA 3CUNA 1S0OA 3D1QA 3GFHA 1FJCA 4NLXA 2JL9A 1S10A 3M6UA 1KQFB 3EVMA 1RYSA 2YQ1A 1JLGB 5KG1A 3QFWA 4UQGA 3AY0A 2VBXA 2GS8A 3P49B 1GTEA 4JI5F 2EG2A 1EX8A 1S7HA 4ZVGA 3DRXA 3H5UA 5E3AA 2XHCA 4ZP7A 2RRNA 4Z7CA 4U67Q 3RW7A 2CPEA 2DIVA 3HLUA 4EK2A 4ECQA 1DTTB 2HGMA 2BRKA 4DS5A 2HEKA 4L3KA 4M5GA 4TKTA 4QWDA 3KKFA 2IHR1 4ZPCA 1GEHA 4JUZA 3ET6A 2ZD1A 3MPUB 4DCJB 4DR3F 3MF5A 4OX9J 3C6TB 4DR1J 5HN0A 1C0TA 3D1OA 3CO0P 3GQCA 1RHKB 4ZP6A 3PW7A 2OIHA 3GWCA 3HULA 4RU9A 3BS9A 3L7OA 5D0EA 2F4FA 3OR1B 4C0OC 5BR8F 2GMLA 2EWHA 5J1EA 4C11B 3SQGA 2HK3A 4J9PA 3JYTA 4DCOB 2JSXA 4NZ6A 4CZCA 3EGZA 4ZPWR 3T5HA 2XS2A 3IBWA 4EZ9A 1P27B 4HTJA 1YK9A 3I0SA 2MZSA 5AXMA 3BSAA 1W2BR 2KFYA 5IV3A 2BJ3A 2EFVA 2R4FA 2OSQA 3R27A 3UI3A 5F0WA 2GZOA 4MKAA 1IJEB 1I51B 1NMEB 2J0WA 4DR2F 3W61A 1E6YA 2EFOA 2RMLA 3BKTA 5D4NA 4A8KA 3T5LA 4DZDA 2F7VA 4N77A 3Q2TC 2F9JA 1URRA 1QAJA 4WYLA 2E9TA 4P2FA 2BOAA 1BHNA 1YI2S 2FY1A 3CCQS 1S1WA 3CC2S 2M8HA 3V81A 3L09A 4YB1P 1F9FA 3UR3C 3HKWA 2XHWA 3NBPB 3NP5A 2F8MA 5M2RA 4PEOA 4YHHF 2JLGA 3TJ8A 1C1CB 4DPUA 3AXMA 2CNLB 3R6LB 5J1NA 4KQZA 1DBDA 2AYMA 4YQWA 4HYKA 2C22A 2XI3A 2P9CA 4ELTA 1WWHA 3ENQA 4Q45A 2H4YB 1P1TA 2CWKA 1U6ZA 4KT0C 1NK5A 3ZZZA 1TKXB 4OX8A 3V6DB 3W64A 5B0BA 2VPZB 3NOCA 1MMNA 1Q5YA 4AUKA 4NXMF 1NHVA 4ID8A 2MZTA 4LVOP 1EKSA 4S0MA 1CS4B 3K8VA 4QIGA 2KI2A 4DQQA 4ZVHA 3T1YF 2YTCA 3M8ZA 3N6NA 3LA0A 3C66A 2I38A 4HACA 4MK7A 4F0HA 3UCZP 2HLUA 2JX2A 2UUWA 3FRZA 1SBRA 2IM2A 5KFVA 2VG5B 1V6HA 1TUWA 1QDUB 3NS6A 1N32J 1S4EA 5HSPA 1KRPA 2XBPA 4HH0A 2CZVC 4DN9A 4X64F 1TELA 4DBQA 5LSRA 3TANA 1UKUA 1GXLA 2PGCA 3B4DA 1T95A 3RB6A 2HBZB 2R9LA 1M1KT 2L9DA 1YHQS 3GSIA 1R8BA 2F8HA 1V3SA 2KT5A 2B51A 3MEDA 1T7PA 4QWCA 2FC8A 2J9EA 3DOKA 4DL6A 4LT6A 4IG3A 4BBYA 4LF9J 3AQPA 2WONA 4O23A 1S12A 1FDBA 5KT3A 4LFAF 1EHWA 2M88A 3FC9A 3W9JA 3R5GA 1FT8A 3CMAS 3IC1A 3ADAC 4AE5A 4WIQA 1T9XA 5IC4B 5LMNF 3KJNB 3I4PA 4DL5A 2YKOA 5KFPA 2YVSA 2UUBJ 2EXUA 2DPIA 4LF4J 1VR6A 3FQKA 3TYTA 3GLJA 4F26A 4LF7J 1VRTB 1YRXA 3IGNA 1WORA 2V34A 2PO4A 3N5BA 4WCEQ 3FCWA 1RADB 3RRGA 2DEJA 4CLWA 4JV1A 4CRJA 3HZEA 1U1RA 4AT1B 1PCAA 1FRXA 5KG5A 5LOQA 3U1LA 3W3SA 4RBUA 2EKYA 3DI6A 3PRBA 3PFEA 5IWAF 5GAEU 3B4MA 4RO0A 3BF4A 2GX8A 2X3DA 4Y2IA 4DL7A 4PYAA 4RW4B 4KV8A 2FZCB 4RNNA 4YR2A 1VQ7S 1Y5NB 3DRRA 2W8LA 4DL3A 4NRTA 2BANB 5KFAA 3TVYA 2Y8YA 4PWDA 1W2IA 3ITHB 5D4LA 3ZZOA 1S59A 1KLNA 4IH6A 1WKJA 1HNWF 1LKZA 3OXGA 1CJKA 2LDYA 5HVGA 1RYRA 4KFBA 4P10A 1PSDA 5LSLA 2HLTA 2ZWOA 2PEHA 3V2UC 2NYHA 1N8RT 2AZ3A 3MEKA 2CDRB 2DXEA 1FNOA 3KG4A 1URNA 1H2VZ 3HSZA 3G96A 3Q8SB 2FQQB 1PBAA 3SV4A 3KJFB 2VU5A 3A3NB 2MHNA 3DXBA 5CHCB 1RABB 3G8TA 2XNQA 1VMBA 2IY5B 3GV5B 4U8VA 1HW8A 4MT1A 1U1MA 2WK4A 2R7OA 3M8SA 1VC0A 1WKKA 4WWSA 2OGUA 5C24A 5F8NA 3AOCA 4M5DB 1RWKB 1N36J 2VQEJ 1RT3A 5AXNA 1DHMA 3TQ1A 2AKWB 1RWWB 3MWBA 4O0NA 2UU9F 2D7SA 1DQ8A 3UNGC 2KXFA 3N79A 1BQMB 4EI2A 2R8KA 2MZ1A 1R3NA 4J9RA 5ETOA 2LA6A 1OIAA 2YX1A 1OO0B 1FRMA 2VIHA 4IQXA 4M5MA 1K1SA 2FY8A 4NA2A 4KE5A 3GJTB 1YJ7A 2ZUGA 3GIIA 2H51B 4QR0A 1CQMA 4DOZA 5CYQA 4CI0B 4JI3J 3M8PB 1VBKA 4TU9A 3FMBA 4MFBA 3KK1B 2VOPA 3HP6A 3UCGA 2IDLA 3AJDA 4JB8B 3OUYA 2QA1A 2IA0A 4FYXB 2DNOA 4CO1A 2ZBIA 1HI8A 3P5BP 3CMQA 3CT9A 2FHJA 4DV6J 2HYIB 3WQPA 4JI4F 1WEYA 3AT1B 3F44A 3MM7B 4PRFA 2Z4PA 5D8HB 4ERDA 3D66A 2QLXA 2ZKTA 1UPPA 1H7XA 2RUGA 1RT1B 3CJ4A 2Q6CA 1G7CB 1SC3B 3MGJA 3J7ZT 4G1PA 3HFKA 1O0PA 1XWLA 2G9OA 2E1MC 3F0NA 4V19X 2W9AA 3IRXA 3TZXA 1QSLA 3CJTA 3C6UA 4USHA 4ZP9A 2NXJA 4QPTA 5L8RC 4TLQA 1RTDB 3EYZA 3NKYA 1IBLJ 4DLGA 1OPZA 1RAAB 3J81j 1L3KA 3OTOJ 5ETRA 2VKRA 2LQJA 2WVDA 3D0IE 1QE1B 2LCWA 4KJIA 2B8QA 3O44A 2AYBA 2GC8A 1NDPA 3EICA 2ZOFA 2NPFA 4ITSA 1NH8A 1FD8A 3LP2A 5KG2A 5GMKa 1NK0A 5AJ3J 2OHDA 2H9ZA 4YEAA 4UY8T 4RJVA 2N7YA 1AUDA 2HFZA 1ZM3A 2DISA 1VBXA 5L9XA 4ER8A 2R8HA 2E66A 2E5HA 3JS9A 2J6UA 3ENAA 3FBBA 1HHTP 2ILZA 3HZGA 2NQPA 1G4CA 4DUZJ 2HVIA 3OLAA 3R6GB 1SJQA 2HZVA 1UETA 4GC6A 4Q2LA 4PXEA 2DGTA 2BR0A 2D3ZA 3NWRA 4HHHA 4X2BA 4JYAF 3ZC4A 4MH8A 2QYCA 3QJJA 4CT8A 3VTIA 3Q8RB 2HIQA 3TP2A 5I3UA 4NLWA 2D1CA 5ETSA 4A4JA 2J6TA 3PZPA 1S9FA 1NJZA 3RB0A 3OR2B 3EPGA 2R3VA 4HKQA 1UZDA 1R0AB 2BYCA 2POKA 2CJKA 3BBCA 2XMAA 3OLBA 2Z8QA 4DSLA 3N01A 4KGKA 1HWJA 2G2OA 1KN6A 4OYAA 1PJ6A 2MPUA 4UTGA 4KR0B 1RT7A 1PAEX 3GYXB 5AE2A 1FKAF 2ASDA 4K2JA 2XSJB 4ZHRB 2HGLA 4PPZA 4F2RA 3W5ZA 3RBEA 2MZRA 2YKNA 2XWYA 1R6VA 2HFVA 3HSGA 2DXDA 1T8EA 1JWWA 1BQNB 5HBMA 3EGNA 4E98A 1U48A 2N3OA 3NLCA 3QIPA 2IJRA 3W2VA 1NPRA 3OSNA 1H73A 2UV8A 1RE1B 1HL6A 3MM9A 3KMSA 2C2KB 3R7SB 1SIWB 4B08A 4RNHA 4I64A 2DEIA 1WJ9A 1TL3B 2HHHF 1KDNA 2PA3A 4CH0S 3IXQA 2MZQA 1JIHA 1SC6A 4IFYB 4CLFA 2J8AA 5CYMA 4W4MA 2CZ9A 3US5A 2J7WA 2DHAA 3PXGa 4CLPA 4CLZA 2D9OA 4LF5F 2DTJA 4B9NA 4IH7A 3DFEA 3QGGA 3MUTP 4R5PB 2XS5A 2FGCA 2E1CA 2LQ8A 4YB7A 3GR0A 2R7VA 2Z56B 3CCJS 4FXWA 2DNGA 2WBMA 3VZHA 2KU7A 3BJYA 5FIIA 2ZZTA 3V6JA 1W26A 2EPIA 1XNQJ 2FVQA 4USTA 4LF2A 3QO9B 1TR0A 2XZTB 2XNRA 2DNPA 4RW7A 1IQTA 2WTFA 3K8WA 1M5PC 1SH3A 1NZAA 1QY7A 1B7FA 4NI2B 4ZCKA 1Y5IB 3KLGB 4RW9A 2HNYB 5HVFA 1H72C 1T9TA 3W1YC 2DR6A 4URGA 3VZIA 2WOMA 3R97A 3LWLA 5AXKA 1WI8A 3KLEB 3EZ5A 4ZP8A 4IRKA 1VQPS 2PIIA 4KHMA 1WD6A 5HROB 4NCGB 4Q0BB 3GPAA 2KT3A 5KFUA 4KKOA 1GMWD 1T02A 3HO1A 1SB6A 4WFXA 1BMQB 5ETPA 3EWGA 3UN2A 2Z2LA 4FPRA 1MMDA 2WW8A 3KOAA 1NPPA 2DGOA 1OYEA 2CXEA 2HFSA 5C25A 1TFWA 1LOUA 3KLIB 5B0EA 1S9EA 2R8GA 2QA2A 4BWMA 1RACB 5FDLB 1VFJA 2W2OP 2DCUB 3MFHA 1LWEB 3AXKA 3BKFA 1JNRB 4IRCA 3NG8A 1U4BA 1V5VA 5KFBA 2W25A 3CJKA 5M2PA 4ILMA 4CO0A 1S9GA 1J5OA 3HJVA 3BQ1A 4FKXA 1JJ4A 4FYWB 2JFKA 3MECA 6FD1A 2BJ1A 4DF8A 3KYLA 2KL8A 5A8RA 1MSWD 3G8QA 3PEHA 4EBCA 3OTDA 3M2RA 4TLRA 4IH5A 3CCMS 3V4IA 1FEEA 3KLHB 1CG2A 4USWA 1HD1A 2FLPA 2HK2A 4B3RJ 1IWGA 1VQ5S 2J9DA 4ES1A 4K4VA 4I6YA 1W25A 2R2SA 4OI4A 1UWBA 1WNEA 1X4GA 5DGBA 1BQXA 1FXRA 3H7HB 1U1PA 2B4OA 1RUSA 3G2XA 1WC0A 3IG1A 1PYTA 2VG6A 1NZ8A 1SKWA 3JB9k 5IXUA 3SCKE 2ZDOA 1UPMB 3C15A 2HBYB 2FVSA 3BO4A 3IFEA 1BWEA 2LEAA 3B82A 2AF6A 3HD2A 1NKBA 2WSEC 5J2MB 5ETKA 3VAHA 1T05A 3QATA 1YJTA 1D9FA 3KLFB 3DHXA 3CCUS 1VQNS 3PR5B 2J6SA 4EWTA 2R42A 2YNHB 2QC3A 4DFJA 3QGHA 3ZZYA 3M8QA 3S7RA 4B3TJ 4URQU 2N3LA 1R0CB 2A2DA 4ZKAA 4K8RA 2FTRA 4IG0A 3JQJA 2FPHX 4CLYA 4LSLB 3MHYA 4U7CA 2OKQA 2VBZA 2ZH1A 3TZWA 1OQ6A 1S49A 5MLCV 2XSFA 4XAKA 3CIZA 4WXOA 3W2WB 1IR0A 1JLQB 1VIXA 3JSBA 2DNRA 3TUZC 4DV4J 4O4GA 2IVYA 3C16B 5HK4A 3KNGA 1CVJA 3UCUP 2RAQA 3VHQA 3K57A 4I2PA 2ZJPQ 2XZDB 5B0AA 1YSJA 2GFFA 3SCIE 1VLOA 1DLOA 3PG9A 3CJRA 3FFIB 1HPZA 5ETTA 4ATNA 2DNLA 3T9NA 5K8OA 4WXWA 1N56A 2QJ3A 2OMOA 3WIVA 4DUYJ 4X4QA 2VG7B 1YQHA 2CZ4A 1C0TB 3R1LA 2CPFA 3N4WA 1DURA 3NS5A 1CJTB 4X84A 1KQSR 4ZVFA 3L4BC 5DDPC 5I42A 2KFNA 4FNHA 2KT2A 4OYOA 5CYJA 5DJBA 3R5JB 1LWCA 1X5OA 3HM9A 3V6HA 2RQMA 2YWGA 1AROP 2HFNA 4P73A 4ED0A 2U2FA 1B0PA 1FNXH 1RCOB 1RWNB 4O44A 3HK2A 4M94A 5CXTA 3HF5A 1I5OB 4ICLB 4C3LA 4DV3F 2VFRA 1RTHB 3IN5A 1HQUB 3H4DA 3GU0A 3MEEB 5LMUJ 4QW8A 1YG0A 3CDAA 3QT6A 1UW9A 4OHZA 3DMJB 2QLFB 1AZSA 4DV1J 2G4BA 1E6VA 3IO1A 2VQFJ 4WZMA 1XR5A 1S48A 4UOCA 1S1TA 1FKOA 1EAYC 1S6OA 1EKRA 5CH7B 1N5SA 3BM7A 5HJXA 1X4BA 3IWXA 4EYIB 4DL2A 1UL3A 2UXCF 4PQUA 5D0RA 2Z58B 2CPHA 4ZVQB 4ZLNA 5CZVA 4USKA 4N47A 4LUBA 3FCHA 3DGVA 3K2YA 4CIOA 3W60A 3GTYX 1SUQA 3GFYA 4RWWA 3C2PA 1M1HA 1UP1A 1YJRA 4OYIA 3FEYB 2M0GB 5KFMA 2GMHA 4WPAA 4P7VA 5DO2A 1HARA 3MTJA 3DOMB 1VQKS 1GXTA 5IT9Y 2GVZA 1HNVA 2WHOA 1Q1KA 4NASA 4QWEA 4UUXA 1VQMS 3AJ1A 1FVQA 3BGOP 2HG4A 3BR8A 2MQPA 1HWUA 4H4KA 1S1VB 4Z7YA 2B3TB 3MM6A 3IGVA 3IS9B 3O3LA 2K06A 1BGXT 1EARA 3T3FA 1JKHB 2WSCC 5F8MA 3OSPA 4HLBA 4WYWA 2APOA 5IV4A 3HT3A 2FDNA 4TQSA 1LXJA 4DXLA 1JLAB 3EZUA 2B4VA 1ZS6A 4M5KA 3TOQA 2B4UA 5BYSA 1ZPWX 1FKPB 5KFYA 1C1BA 3RJMB 1Q5VA 3PYDA 1IBMJ 4J9NA 5IC6B 5D0HA 4F25A 1S5ZA 1GTHA 4X4RA 5HQMA 3OD2A 3AOAA 1N32F 4KTQA 4DPYA 3JTNA 2C3OA 2FJEB 2ZDPA 4NL5A 4OI2A 4ZA1A 4LF8J 4FYYB 1MLAA 4LFCJ 3R1HA 5KG6A 3QIDA 3EGVA 3SDEB 1QAXA 2CQHA 1L5UA 1FRIA 4DR4J 4LMZA 3UFCX 3GMGA 2RS2A 3BPDA 4X62J 4DV0J 1KLMB 3BN4A 1MN9A 2ADCA 2E5LF 1FX2A 1M0SA 3MEGA 1N5YA 4EO6A 4UZBA 2GQ2A 1JNZB 1K47A 4HI1A 3MUVP 2EFGA 5F0UA 2GO8A 3GCXP 4Y00A 3D4JA 5HAOA 1HNXJ 1FJGJ 1O5JA 5GMDA 4RW6A 4AXIA 1AA1B 1X4AA 1TAQA 4N8NA 4MIBA 3OVBA 2PE8A 4DV5J 4LF9F 2FIUA 3ULHA 2UXDF 1YDLA 1HBOB 1X4FA 1EZZB 3I0RA 2BOPA 3LPYA 1CSJA 1XMOF 3M2UA 2DHSA 1UWAA 4OZ0A 4NLUA 4RUHA 4YR3A 1LW0B 4K4UA 2RVJA 1JXEA 1Y4ZB 2QYGA 3LP1B 3DU5A 2BBEA 5KG0A 2ZBCA 2Z2YB 4IOBA 3LALA 4DG1A 4LF4F 2E1RA 2WB1D 4UOFA 2Y0BB 2ACMA 2JDJA 2AGOA 4RNFA 3U27A 1KKHA 4H54A 4K4ZA 1B7YB 2MLYA 5E33A 4JI2J 1UCNA 1RTIB 2FHJD 5CAAA 4ECUA 1HI1A 3FSXA 2GO9A 3CE8A 1M90T 2ZBQA 5CZXA 2P6TA 2LYVA 1NLKL 3OL9A 3T1HF 5DQIA 3CCLS 4JI6J 1B64A 1Z1ZA 3ETOA 1FI4A 3N0VA 1CJUB 3OJUA 4TQRA 4A47A 1VISA 3CCSS 1U26A 3BREA 3PX4A 5K5MA 2CPIA 5JMNA 5HMYA 1JXVA 3ILJA 2F3JA 3PYFA 1ZTTA 1SV5B 2D9PA 2FD2A 2YKAA 2MB0B 4DI6A 1IUJA 1N48A 3QT8A 5E2QA 2HNZB 1U8SA 1RLCL 4DX7A 3QJPA 5C24B 4AL5A 3JXOA 5JJBA 1EB0A 4OZ2A 3GIRA 4C9DA 2CIMA 1H2UX 4OZ3A 4UY85 3THTA 3M30B 1NSKL 2IMWP 2MKSA 3MZIA 2W9BA 2BJEA 3OTCA 4C6AA 4IOCQ 4PG7A 4ZVRB 2HVHA 2OO4A 3SXLA 3UNYA 2MKHA 5AE1A 3DGPB 3QSIA 4P6QA 4FF2A 3PCOB 3OT9A 4CLLA 3MMCB 4KSEB 1TUVA 1VRUB 2AP6A 2HSEB 2E29A 1TVRB 4A8MP 1Y0HA 3LWMA 3VAMA 4AL7A 3M32A 3T5KA 4XPCA 1JJHA 4OLPA 1NSAA 5A8WB 2FB0A 1PYOB 1HBMB 5H1SV 1N0VC 4G6VB 1LEOA 3DOLA 4P2XA 3SSSA 3Q86A 1YBTA 3QBCA 5F9LA 1TQLA 4LIRA 3RAXA 3DHWC 3WDOA 2DHHA 1N52B 1U2FA 4WBFA 4B9VA 2DGWA 2QL5B 2OI2A 2E5GA 5B0FA 1I1GA 2JVOA 3I9V9 4O3SA 1ZAVA 2IYGA 4J9KA 1QVGR 1ZYQA 2HFUA 1U09A 4JI3F 2RB7A 4LR9A 5F3TA 3EDQB 1NO8A 1U6FA 2CPJA 1RT4A 4RW8B 3I5BA 2GHVC 2H54B 4NZ7A 2AU0A 3CDBA 2UXBJ 2UUAF 2OELA 2LVWA 1VQ4S 3TZYA 1JQGA 3W63A 1X4HA 1I94J 5DM6Q 2RRAA 3H5XA 1AW0A 3JSYA 3OQ2A 1DFDA 3MDFA 2EFNA 4A48A 2MEWA 5C42B 4DL4A 3G4SS 5EDWA 2HHVA 1HQEB 1VBZA 2ZHBA 2DD8S 4I68A 1FO1A 4CH1A 2NLWA 1Q7LB 2YPYA 1RAJA 1VLYA 2XMMA 2E9RX 2YNGB 2IM1A 3THPA 1TKZA 1N6QA 2QN6B 5K20B 1REVA 3N28A 4C8NA 4FBTA 3GIMA 3P45B 2XMKA 1IBLF 1KFDA 5T7LB 3NGDA 5J2NA 3CC7S 5KG3A 5HP1B 2XCAA 4NLPA 3ZZPA 3GV8B 1SQFA 3NNAA 5L1LA 4NCBA 2RNEA 4PAAA 1LV5A 4IFVB 2CNKB 4CNYA 4EBEA 2XQCA 1Q8BA 1NCLA 3KUHA 2EC0A 1H7WA 4LF6J 2R8IA 2L3MA 4ECTA 4LRDA 4HTIA 1FTRA 3FBFA 4TVAB 4OMFG 2DY1A 2CQ4A 1HMVA 1U49A 3MD1A 2QMXA 2I8EA 1A9NB 1Y3JA 2B5JA 1KTVA 5KFZA 1NDCA 1NSQA 2X1AA 3SFUA 2IPOB 1HNIB 3F73A 3BH7B 2F1FA 1RT7B 5ETNA 4DV7F 1HYSB 2EK1A 1U1QA 5G0RB 2MJNA 3PACA 4BS2A 1RTJA 3K7RA 3ZTOA 4BC9A 4GMKA 4DX5A 1Q78A 4OYMA 4WP8A 4PUOA 1CJVB 1HR0F 1GMVA 1GX6A 1WACA 1O6XA 3LO3A 4TN2A 1TKTB 3KG1A 2X1FA 1FWLA 3CO9A 1N34F 4BLGA 3SFGA 4B3OA 3R2DJ 1PG5B 2QT7A 2HMIB 1X0FA 5KTQA 2OPPA 2WVFA 2XWXA 1V9OA 2JWNA 5A8KA 4K50A 2BVZA 2ZM6F 3KHRA 4R0EA 2AGPA 1XMQJ 3DM2B 3WZ0A 4KO0B 4USJC 4NXNF 4YB6A 2KN4A 3CCZA 2BE2A 4X4OA 1U47A 3CVKA 4WK3A 4NLDA 2EI5A 3UDVA 4YY3F 4ZCIA 3GFZA 1VBYA 1K73T 3K5MA 4TU8A 3LGMA 1TL4A 1TV6B 3WC0A 3ZXWA 5JUMA 2AQ4A 1TL7B 2YWEA 4A8YA 4X4TA 2PI4A 3BPSP 2GGPB 4OJ3A 1EETA 5M2UA 1Q4RA 1ZM9A 3VGUA 4DV2F 1SKSA 1WG1A 4CTAA 3DRSA 2UUCJ 4USUA 2J8SA 1X4EA 3M05A 1EQMA 3M2VB 2V2ZA 1KVJA 4ECYA 3R8YA 5J2PB 2ATLA 5HLFB 4HR2A 3DLKB 2XY6A 2OPQA 2D3O1 1RU1A 1SPBP 2OMLA 3OXLA 4QR2A 4J9SA 3TUIC 4IR1A 1U02A 1IKYA 5K14B 3ZZ0A 4WFNQ 3LW5C 4Y65A 2X51A 4C8KA 4FKYA 4J91A 3EJMA 1Y11A 5E0OA 2LU2A 2RQCA 1ROFA 1EIYB 1NHUA 2E7XA 1GMUA 2VFVA 2YWWA 1M5KC 1JB0C 3NAIA 2GVDA 2ZJRQ 3IAM9 5ETMA 4Q7AA 1TFYA 2CG4A 2BJ7A 4P75A 3D28A 2KG0A 4K59A 1F1BB 3M9MB 4DPWA 2RDJA 1Z4UA 4V19J 4P7TA 3A8JA 3NRBA 3OL6A 3SYZA 4O3NA 1J5EJ 4J9LA 5C7PA 4N5SA 1FTCA 2AJ0A 4A8QA 4ZOSA 1HNZF 3MCOA 5KFRA 4PWWA 1NKEA 3C14B 5J2QB 1ZOTA 5IQ6A 1HWKA 1S9GB 1C0UA 2IVFB 2LKZA 2GJFA 4RR5A 3HFZB 2QSFA 1RKIA 1HBNA 2MZJA 1IWAA 3EUNA 4G1QA 1REGX 3M1VB 1NK9A 4YOEA 3RRHA 2JJ4D 2FZGB 5FLXY 4NX9A 4CLTA 2DH9A 1ZM4A 1ULRA 1MU2B 3M2RB 2HBQB 1PKUA 3KK3B 1ACMB 3IAS9 2AGQA 3L95X 2IIHA 1DQAA 4PYDA 2A0FB 5KFFA 1HKAA 1RWOB 1EP4A 3BZQA 1RT5B 3JSMA 1N5VA 3ILLA 1F0XA 5K8MA 1U2CA 1V3RA 2RHSB 2DO4A 3C3LA 1H98A 2AEMA 2J9CA 4AL6A 4JI5J 4LQ9A 3HVRA 1YX2A 1WEZA 1IKVA 1SXLA 3HHEA 3PRDA 1KFSA 4ED8A 3VAIA 4KRWA 1S99A 3DXSX 1A6LA 3DLGA 3QQCD 4WIIA 2XY7A 1I3OB 3GZ7A 3WX4A 4KAIA 1SVDA 2PMZD 4LRCA 1B0TA 3DC2A 3HFVA 2V8GA 1PYSB 3HSDA 3VGVA 3QPIA 2VPYB 4TY8B 1YZ7A 2UP1A 3AFGA 4DR3J 1JLGA 3MR2A 4G3IA 5HO4A 5IM0B 3OTEA 3BR9A 3QGPA 3M7VA 2W2PP 2NXCA 2V4RA 4E2FB 1XMBA 4OYXA 5C2GA 5D78A 1VHFA 6AT1B 4ZLJA 3QGIA 2MSSA 4P71A 2M70A 4K2XA 2RUSA 4IOAQ 5DLGA 1WC1A 1RAOA 1FHTA 2VKZG 4PKDB 4O4GB 2B9WA 3A13A 1YGYA 3Q8PB 3BGRB 3NCQA 4I6AA 3A4TA 2DNQA 2IAJB 1DTTA 2CNNB 1TUGB 5DG8A 1FE4A 1X5TA 4PQAA 3UQSA 2F65A 3WX8A 4LIWA 2K1RB 4PABA 5DQHA 4OHVA 4USIA 1YLXA 3KJVB 8RUCA 3C6TA 5BYQA 4M5JA 5EHHA 3BBBA 1NK4A 4M95A 5CCMA 5L9NA 1RHQB 2VOOA 4DR2J 2MQMA 5IT0A 4IYQA 3ILOA 4GKJJ 2FVCA 2OJ3A 4ALZA 1VQ6S 3OR1A 2DBBA 3DYAB 3NEKA 3PO4A 3MI7X 4ZPAA 1UVNA 4C11A 1JX4A 2B0GA 1FD2A 4OI3A 3DDIA 4RLEA 5I42B 2OTLS 3VGTA 4Q5VA 2HVZA 5DG7A 4YHHJ 3LTOA 4DQSA 3CTRA 4Y2AA 1F5BA 4NPOA 4OZ1A 4PG6A 4OZ5A 2GAGC 4I67A 5KFCA 4IO1A 1UFLA 1JJ2R 4M5IA 1GMWA 4PG8A 2B6AB 2BE9B 2PEBA 1WF0A 1N0UA 3TJAA 2ZEJA 3GR1A 5KFNA 5LM7E 2RSQA 3B8HA 1YJNS 5DRKA 1K1QA 4NXMJ 2PD1A 4B3SF 3OHAA 2MY8A 4RUBA 1RLDA 3MR3A 3NBPA 3PW4A 4ZIWA 2FGOA 1C1CA 3T1YJ 1H3DA 2CA9A 4FS2A 4F7VA 3CCES 3KJQB 4BCAA 4I4BA 1BE4A 4ZCLA 2LQBA 3J80U 2ZHAA 1WC6A 2RDIA 3CJSA 1TKXA 2VPXB 3V6DA 2RH3A 1MNEA 3TVZA 3VAGA 1N33F 1U1LA 2HRUA 5LMUF 4X64J 2ZE2B 2AIRB 4CWBA 4CO4A 2VDHA 2RU9A 1ZPVA 3IBCB 1CS4A 3R5CA 2J0SD 2AEFA 3PVXA 5HQ8A 1HBUB 2XTJP 3DRPA 3CJ8A 1ZH5A 2ILYA 1RHRB 1R89A 2G2YA 1IBKF 3O1LA 1H0HB 3LP0B 4ECSA 1MN7A 3IRWP 1XC9A 3LH2S 5KFIA 2G0IA 3ZTRA 5H9FK 4JI1F 3CXCR 3TAPA 1VC6A 4ED1A 4OFZA 3RBZA 4LFAJ 1SL1A 1X4DA 1T03A 2AV5A 3Q24A 2DGQA 3MR6A 3MAAB 1UMJA 1Y7PA 1XNRF 4OX6A 4RNOA 4I7FB 5FLXU 5LMNJ 5DQGA 2W4DA 1S6QB 1IKWB 2JLFA 2O01C 5F8LA 1CPZA 2MGZB 2AJFE 2DR5A 3L3CA 1ZZNA 1H2TZ 2IVMA 4O3PA 4Z2XA 3TZZA 4H4OB 4B9UA 3MAHA 2YPZA 3MCNA 3G86A 2GIFA 5B0GA 5IWAJ 5DZ6A 2HS0A 1X7VA 2COLA 2K2PA 3H98A 3H2UB 4QZVB 2BACA 4K0KF 2KG1A 1DAXA 1QTMA 5BYRA 2W4PA 3TAMB 5D6GA 3BEGB 4F36A 2HW3A 2J9DE 1VRTA 2IA6A 3N6MA 2VBYA 4JI8F 1IJFB 5C5JA 1GH8A 1VCTA 3CW2C 3JQKA 1IBMF 3DLEB 3E2EA 2RF2B 2DNNA 4LFBF 4TXSA 4M5LA 1CQNA 3PR4A 2J5AA 3TA2A 4OJHA 1TL1B 3AH6A 2IDEA 4RW4A 3CF5Q 5DZ7A 3IMQJ 3OV7A 3PIOQ 4M1KA 2BMBA 2BANA 3OL8A 2ASYA 5KT2A 3POTB 3JAMU 3D6MB 3ITHA 2JC0A 1FXLA 5EX0A 2OP5A 2VJUA 5HL7Q 4B9MA 3RAMA 2A18A 2ZOMA 1ZTWA 3IWNC 2D3UA 2CQ2A 5F3ZA 2BJ9A 1FRLA 2KJVA 4DV5F 2UU9J 3HHNB 3BBFA 2ZH8A 4ZLPA 4G1IA 4RPFA 2HHWA 2L9WA 2RIJA 4WE1B 3PNIA 3KDOA 2YQ3A 3D67A 1TK5A 2CQBA 2CRLA 2E1PA 4UW2A 2VA2A 3GILA 3IR5B 1B99A 1SH2A 4HVZA 1Y10A 3O5TB 4FZVA 3UN3A 4J7CA 3OW2R 3PJWA 4NRUA 4M5DA 1B4SA 2ALYB 4F4AA 3ILIA 1YWXA 2M2BA 3CPWR 1VOMA 4B9SA 4LQ3A 2K7JA 2HZAA 1IBCB 3HXMA 4I6WA 1BQMA 5AE3A 2D69A 3S6EA 3D9BA 4ID5B 2ZC4A 4EBDA 4JI4J 4NLSA 2JH3A 3NGKA 1R0BG 4X66F 4EUVA 5KFDA 2MQ8A 4DCPB 2ZNYA 3DRYA 5ITHA 2O66A 1F3VA 2VODA 2AD9A 4DPTA 4QW9A 2VONA 3K59A 2P9GA 2H3EB 2V5HG 3VR1A 1XBWA 3M8PA 4Y6IA 2ASJA 2C42A 2F4VJ 2OPRB 4C98A 2HFOA 1KR4A 2G2ZA 1CEZA 2C2EA 3KK1A 2H5JB 1NU4A 3FZ2A 1TL5A 4I56A 1PO6A 5HMZA 3R5DA 4L6V3 1NJYA 3S1TA 3MURP 4QYRA 2LXIA 1RAGB 2V2QA 5J1PA 2V8HA 3MM7A 5IOLA 4DFKA 1TKDA 2HHUA 1J2VA 2KZMA 3UD4P 3LF0A 1UFKA 3EZOA 2LMIA 3E8OA 2I1RA 2Y1IA 1T9YA 2KVQE 4A8OA 1RU2A 3KWMA 4EYHB 4FPIA 4KBIA 1RTDA 3QT7A 3G6ES 3SSQA 1SC1B 3JTPA 2W9CB 1NJWA 4JYAJ 1QE1A 2HGNA 4Y2MA 3HVTB 2GNKA 1IKXB 4LSZB 1JJCB 2BDPA 3I5AA 2FC9A 4KHRA 4K7QA 1HW9A 2WCXA 4HHJA 1PIEA 1F3FA 3B6BA 3OL7A 5H9EK 2RKIB 4ZJOA 1G1XA 2F63A 1TK8A 1MROB 2YWFA 5KOXA 3H5SA 4GVBA 1ZA1B 1YJUA 5D3GB 4G65A 4KH0B 3LQVA 2MQNA 2XULA 2IRXA 3DLJA 3B78A 2P6SA 2CAJA 1IQZA 1PJ5A 2KKHA 3TQEA 4EGLA 1XR6A 2KO1A 3F41A 2KYZA 3HSJA 4R8UB 2KB2A 2ZOGA 3J81U 2IRYA 4IDKB 1H38A 3IA0A 3ONQA 2KRRA 3MMAB 3GIKA 3H20A 2OAUA 5L1IA 1MMLA 4V1Ak 3DLHA 3OR2A 5KFEA 1GX5A 1R0AA 1B70B 1RWMB 1XERA 3TA0A 1LWFB 3W5XA 2I5JB 2XLKA 3KMQA 1YBAA 3RTVA 1RHMB 3EPIA 2NZ4A 3E51A 1S6PA 2FLOA 1NJIT 3D2WA 1OY8A 5B0CA 1S1UB 1WF2A 4WP9A 1AUSL 2QA4S 3B54A 3A8EA 3BDPA 2V9KA 2XSJA 2FJXA 4ZHRA 2OPSB 2FJBB 4GC7A 4K4YA 2AMCB 3HVWA 4O0IA 4QJVA 2HHPA 1FK9B 3HHLC 1X31C 4JI7J 1BQNA 2DGSA 2QV6A 1NB7A 4C8ZA 4A8WA 4LF5J 1LK5A 2XO6A 1WOOA 3E01B 1HIYA 1YTYA 1S77D 3R3TA 2FZKB 1RCXB 3DKDA 2R7XA 2BE7D 4FP9A 5A6PA 3VCDA 5E7OB 2R7TA 2DNYA 4CLSA 2IBKA 1TL3A 4BC7A 4ES2A 4B3OB 3EXCX 5A0YB 2R2RA 2G1DA 4IFYA 5GADU 2ZFHA 3K0JA 4QYZK 1RT6B 2XMJA 2R7RA 4ECZA 2X1GA 2FLLA 3TEHB 3FBEA 3Q8QB 4DQRA 4FXVA 2SXLA 4RUAA 1Q16B 3GYGA 2ZC3A 4L73A 2NSCA 5B09A 4L75A 2HBRB 1OY6A 2W7OA 2A1BA 5E3CA 1KEKA 4X65F 3WC2A 3ZTQA 1CBKA 2IFXA 4R5PA 4OV1A 4F04B 1KONA 4RUCA 3MM8B 3VQTA 3PJXA 4RU2A 2LFVA 1UW4A 3NOGA 1BXNA 1WDTA 5GAHI 4OI6A 3Q8VA 4Q2MA 2F40A 4C3KA 3DDKA 4KPCA 4CYUA 3SV3A 2ZH7A 3QO9A 3DRSB 3D5MA 4DR7F 3IR6B 3QRRA 2W7PA 4OZLA 4NI2A 4O4RA 3KLGA 2HNYA 3QWUA 2EKNA 4Y3CA 2R7QA 3FDSA 5IQQA 3C8YA 2ROGA 5SZTA 4KH1B 4NYZA 2QL7B 2V8VA 2HRYA 3AB2B 1DTQA 3KLEA 4WZQA 2Y1JA 3HHLB 4NCGA 2QSWA 4Q0BA 2B4PA 2CQPA 3PDNA 5DETA 5IZHA 3G71S 3GB0A 3KUGA 4KGZB 3PX0A 4ED3A 3FCVA 5RUBA 4K4TA 2FJWA 4DUTA 4PZVA 1IR1A 2JVRA 3GE9A 1DY3A 3NMRA 2JHEA 2WB4A 1LW2B 3DLBA 1IXKA 4I0WA 2NR0A 4JV5F 3KLIA 4Q8EA 2E1AA 3Q89A 1YZ6A 3Q83A 1R7IA 1AXQA 1U2RA 2IC3B 2XO7A 3A3OB 1RA7A 2HRTA 2HZCA 3JTOA 4MYTA 5FDLA 5KOWA 1ZAWA 1LWEA 2R2UA 2B43A 4N76A 3D6FB 1HD0A 1ZBTA 2QL9B 4ES3A 3PYEA 3UWTA 3M8WA 4P72A 5E5NA 3S01A 4UQTA 2YNIB 3SEOA 2MXYA 4TYAA 4JBCA 2O3DA 2FVRA 3SI8A 2J76E 4QCLA 4KHPF 4B3MJ 2ZBRA 1PAUB 1MG7A 4URSA 2EFPA 3WIUA 4DFMA 1NDLA 2Y3YA 2NXNA 1WC3A 3KLHA 3R7BB 3PEJA 1RP5A 3UDLA 4Y0FA 3D6TB 2AX0A 4F0KA 3MTKA 4OX7A 2QO3A 2YKMB 5L46A 1HHSA 2OSRA 1RWPB 3PO5A 1O8BA 3TAQA 2B7BB 3K17A 2ZH4A 1LK7A 1UJ6A 4B17A 1JLBB 2P9EA 4XO0A 1EP4B 4F4ZA 4GRSA 1OSCA 4IRDA 1L3TA 1HA1A 4C7QA 2UV8G 1GK8A 3JSRA 1MWZA 1T0TV 2FHOB 4AQYF 3TARA 1RB0A 1F2HA 3FK4A 3CJ5A 4DDFA 1X60A 1RT2B 2RE1A 5J2MA 4JI0J 1WHYA 3QLHB 4U96A 2ZITA 4FNIA 2BKOA 5D4PA 2KZZA 1HWIA 1GQEA 2PSZA 3M6XA 3MPVA 7FD1A 1TMMA 2CPXA 3BB5A 3D0GE 2W2MP 4F4WA 2ZH9A 2FJVA 3HVAA 5L39A 4F67A 4LSLA 3LGHA 2M52A 5DDOC 4B9TA 3MMBB 5MAOA 3M9NB 2ZUAA 2K8GA 2Y1LB 2Z2ZA 3BO3A 3W2WA 5KT6A 1JLQA 5A2QU 2KDOA 4RNMA 4CO2A 3VWSA 4FF1A 3EVOA 5IFMA 2WVCA 4NLVA 3MPYA 5KFTA 3OHBA 5G4DA 3C16A 3H4BA 4LSNB 1YKWA 1PILA 3G82B 3I96A 4QPXA 4I2QA 2WW4A 2O67A 4DR6F 2YXLA 2PN6A 1UEUA 2MYFA 1B0VA 3DN9A 3FFIA 4TNOA 1JLEB 2WVEA 2CJYB 1TP7A 3UD5A 2Q79A 3ETMA 2E44A 1P1LA 2QLJB 2OLWA 1KBRA 2B56A 2MDAA 2ROPA 4F4YA 3AQOA 2VG7A 4DV3J 1IVZA 1T9UA 1CJTA 3KK2B 4ED6A 4C0HA 4B02A 3MAQA 2V4QA 1NK7A 2A10A 4DFPA 3Q23A 3I32A 4Y2KA 1ZETA 3CDWA 4NZ0A 2HNDB 3QJLA 1HLWA 5GMEA 1Y3KA 3P96A 1PC5A 3CMES 4MK8A 1A7GE 1OPIA 4MJKA 2BQ3A 1S7IA 2N4CA 1S1XB 4Y28C 3UDCA 2XMTA 4ILRA 3KNAA 2HWHA 3Q0AA 3LPEA 4ICLA 4M5HA 2UXCJ 3RAQA 2RRBA 3VF0B 2GW8A 1RTHA 3SSRA 1HQUA 2IM0A 4DSEA 3WHIA 4A8SA 3MEEA 4C0BA 3P3DA 1U0HB 5D77A 1SQEA 2O5DA 2JZ5A 2NUUG 4CM2A 3DMJA 4A8FA 4GKJF 4GKKF 2WZ1A 2KFZA 3TUPA 4LBPA 1J27A 4C3MA 3NGRA 2L41A 4NYOA 3L7PA 1HI0P 1UEVA 3IBFB 2IJNA 1JLCB 1SJ3P 2DHXA 4PXCA 2LXFA 1D9DA 2CQ3A 2CQGA 3UN5A 3RUBL 1XTZA 1LWXA 1ZM2A 3CCRS 1WG4A 2BQUA 2QRRA 4DPOA 2IRUA 5THWA 1VJQA 3UVJA 3VALA 2LXUA 4ZVSB 1NAQA 1TZ0A 1YJ9S 1JXLA 3FEZA 1WDDA 2AZ1A 2HWTA 2I6WA 1QAYA 2H5EA 3PY8A 3R5BA 2DXFA 4CM0A 2RU3A 1SL0A 3THVA 2AYGA 4WP3A 2YY3A 1RDRA 4QR1A 1XEZA 2IYIA 2W1BA 1NSPA 2GA7A 2BUNA 3T19A 3MFIA 3EE3A 3DRPB 2V8DA 3CD7A 3DOMA 3W9HA 3ET6B 3PIPQ 2ZD1B 1MW7A 2CPYA 4WTYA 1QAIA 2BW2A 3T1AA 3V6KA 1N4LA 4FXDA 3FUYA 4NLTA 5KG7A 3MMJA 5H9FJ 1QUPA 4J9QA 3IR7B 3M9OB 3OPKA 1S1VA 4OHXA 2C1EB 3IS9A 4P74A 1ZZFA 4OQJA 1T03B 1UVJA 1JKHA 1WHWA 2GIQA 1ITPA 5J1EB 2JEJA 2NS1B 2J0QD 4UOHA 1NK6A 3SQGB 1QTNB 3JYTB 1GNKA 5DDRC 1JLAA 2MTLA 3MCSA 2BKNA 2BABA 4M63A 2KHCA 4CO3A 4XPEA 1FKPA 2UVRA 4I1TA 4PCQA 2E5LJ 1LXNA 2CQIA 3N5FA 1WKLA 3OFEA 1UAWA 3I0SB 3EVWA 1RJJA 3CULA 1N5TA 4OX9F 3MM5A 1H74A 2EK6A 4DR1F 3RR8A 1MWYA 4LRBA 1G3OA 3TI0A 4LBIA 2YH1A 1X9SA 2CJBA 1E6YB 4QOTA 2MY7A 4HDGA 3NGSA 2UXDJ 3G6XA 2BV3A 2A6OA 1XMOJ 2BW7A 1D3WA 3SDEA 3RU0A 2ATCB 1KWMA 2XYHB 1XIQA 3SBMA 1S1WB 5GAHU 3V81B 3PW0A 2BJ8A 2EBGA 1WG5A 2QMUB 3MR7A 2G0JA 1KLMA 3UPFA 4EEYA 3GV7B 3KXDA 1SKUB 1WOPA 2NPIA 1ELOA 3ZTPA 4F3OA 1T94A 3VV2B 3HMJG 4R0JA 3FGVA 4KY3A 1X9WA 1S6UA 3VVUA 2C28A 1S57A 2XY5A 2NXUA 4QIVA 2W8KA 2VBWA 2BEFA 3FNNA 1HBOA 3G6VA 4U7UK 3U1NA 3W8PA 1FFWB 2VFTA 4P2SA 1N88A 3CCWA 3H2LA 3ZZUA 3W8GA 3NAHA 3VAJA 3F56A 1HFEL 1K0VA 1SQGA 1LW0A 3LP1A 3T1HJ 3RZAA 3K5PA 1T11A 4KGMA 2V69A 4X4UA 4RL1A 1T3OA 4HACB 5F8JA 2L9NA 2O1PA 1JLFA 3BGUA 2ASLA 2QMWA 1FJ7A 1BC6A 5KT5A 2CFXA 2Q66A 2E7VA 2V4JA 3MPDA 1FRJA 4N41A 1VDHA 4KYZA 3P4UB 1RTIA 3CIMA 3T6BA 1SJ1A 4ANDA 2P2CB 2YKPA 2Z2MA 1R31A 1VJWA 1P6TA 4LVNP 2GV1A 2M7SA 3OVSA 3NNCA 1M1GA 1CJUA 3MEDB 2L08A 3D0HE 5DGAA 2WAQD 4OHWA 3BGLA 3DLLQ 4ECWA 3QAUA 4DQIA 3DOKB 1SV5A 4OYWA 2ZH2A 2CG8A 4F3QA 1U1KA 4IG3B 3T6JA 1Q53A 2HNZA 2WONB 3M4XA 2RILA 1VQSA 3JQMA 3GFXA 4JV2A 2VZ9A 2KTQA 4N8OA 3FJ2A 2XS7A 3CSKA 3M30A 4XTTA 3V5RA 3OFGA 3J7A1 2NYIA 2HIYA 4A46A 4WKRA 3PW2A 2MKJA 2QIFA 1YITS 3DGPA 2DJWA 3I4HX 1GAOA 4RBTA 2JEFA 2QE5A 5FD1A 5L1JA 2R7UA 4YFUA 5HVHA 1LFPA 3MMCA 1Q82T 1VRUA 2XMVA 4UF4A 3M6VA 1TVRA 3EGWB 1SCJB 2GMJA 2A2CA 1T9VA 3ZZRA 3IWLA 3HT0A 3DI6B 2XG8A 2CJQA 1QSYA 5A8WA 2UUAJ 1HBMA 4KV8B 4XK8C 2K7KA 1MWQA 1G2EA 2KVIA 1APSA 3AD7C 3Q8UA 3DRRB 4YP3A 2UUBF 1RAEB 4C8MA 2JLEA 1YRTA 4LF7F 1QJHA 2ALZA 4BDPA 4PWDB 4AXJA 2VV5A 1IR2A 2CADA 1CJKB 4ED5A 2F9DA 2F4VF 4KFBB 4A8XA 2DYAA 3KHGA 2MKCA 3HHLD 3LOUA 3ZFVA 4RW8A 4USVA 4J9UE 4X4PA 3W5YA 1FERA 1OMSA 1OWXA 1FF2A 3NS7B 4MTPA 4ECXA 4MIAA 4J5OA 9ATCB 3K5NA 3CCTA 3I55S 1WTBA 5CD4A 1D09B 3TNVA 1YJWS 5C42A 2IMOA 1U7LA 2KH9A 1HQEA 1QM9A 3PKMA 1LQ9A 1FRKA 3Q8YA 4DU8A 4WTOB 4ZVUB 2X3GA 3GG0A 2M5YA 5H9EJ 2YNGA 2G13A 4BWJA 4GVBB 1RT3B 4FF3A 3RGIA 3H5YA 4CCHA 2EG1A 2AJ4A 3SCLE 4U6PA 2CQDA 3LANA 2Q3PA 7FDRA 8AT1B 4ZS6A 5T7LA 5HP1A 2GQCA 3UW1A 4DV7J 2BXJA 3EXYA 4AYBD 4DU7A 1BUXA 4YDXA 2ZH6A 3BO2A 2VUGA 2WVBA 3X3UA 3AD9C 4J9VA 4DSFA 4ZVEA 4IFVA 3HHDA 4X4NA 1UVIA 4XDCA 4QIWD 3PM9A 5KFWA 2UVWA 1WUUA 2QLWA 1RGVA 3I82A 5CYQB 1HR0J 4ZPBA 1FWKA 2JRSA 3AODA 3PKYA 4NLYA 1N36F 1U25A 4MFBB 2VQEF 1FX4A 2NCKL 5KFSA 4DF4A 1PC4A 1G6BA 1N34J 5HATA 3OUYB 4GO5X 3BSOA 4B9LA 4DR5J 3K5LA 4NCAA 1RAIB 1S6PB 1HNIA 3QAEA 4EFAC 4OL8A 2B9XA 2ZM6J 4E8UA 4NXNJ 1HYSA 3NCPA 5G0RA 1U1NA 4DSKA 2XEXA 2RQKA 4NLGA 2AHOB 4YY3J 1Q95G 5ADZA 1KTQA 1TAUA 3G87A 4F02A 2C2DA 3LUYA 2DRBA 2YX7A 4F4KA 3FSIA 1AFIA 3ENVA 3I5CA 1C4CA 1CJVA 5IS2A 2DH7A 3FEXB 3IRXB 1TKTA 4OLOA 1F5CA 1RWUA 4D3GA 3C6UB 2P5VA 3CDUA 1S97A 5KFKA 4DV2J 2HAFA 2ZH3A 2HMIA 3UR0A 4O3QA 2C3YA 4DV6F 3HDSA 2EW9A 1VK8A 3UO0A 4ZMMA 3DM2A 4KO0A 2Y1RI 3KFWX 4Y34A 4CLKA 1FEHA 1SI9A 3LP2B 3D1HA 4QYZJ 3H25A 2CQ1A 2XYPB 1L3VA 2ZNZA 2OFHX 2PFFB 2DRAA 2JOQA 4JI7F 5LL6d 1TV6A 4Q44A 1HQ2A 1TL7A 4QWAA 2D41A 2ERRA 4ELUA 3GJRB 2GGPA 4JOUA 4NWBA 3D6HB 4WU3A 1IN0A 3T9ZA 4IKAA 1SJ4P 5GAGI 3P6YC 5DDQC 1H6KX 3OTOF 3M2VA 1WC5A 5GVQA 3M8RA 1NEEA 3GJSB 4KC5A 5J2PA 5HLFA 4PXDA 3DLKA 4ZVOB 4CYUB 4LBHA 3RB3A 5I3UB 2C2NA 2W24A 5AJ3F 5DG9A 2HHQA 3VVTA 2LEPA 5K14A 1WHXA 1S0MA 1FDDA 2JNJA 3D3BJ 3FMWA 2HQFA 1HNZJ 3W9IA 4DUZF 2CYYA 1TU0B 1Q79A 1DTQB 2RHQB 5EUHA 2E5JA 2C2RA 3PX6A 3P5TL 1X5SA 3CJ0A 3BV8A 1QVFR 2AWZA 2W7AA 1X9MA 4NEYA 4CLUA 2YNFA 2OTJS 3GSDA 2ZZMA 4MMOA 4MK9A 2LQ9A 2YKNB 3TEGA 1P9YA 1YJVA 1GXUA 2HPUA 2DITA 1EQ0A 3SZ2A 3BGFA 2LEBA 1RXOB 4DS4A 4WFZA 5HBMB 1FXDA 4W90B 3CDEA 1RAHB 4ETZA 1FDAA 3OFHA 3QIPB 5D15A 3OVAA 2B7CB 4LREA 3W2VB 2GJ2A 1NRKA 4YDDB 4ZN3A 4OIXA 3K58A 3MM9B 3C14A 5J2QA 4WU2A 1WOSA 5F9NA 5A76A 5HANA 5A6WA 3J7YI 2OUGA 2KYXA 2V6AA 4DHVA 1BY9A 1NPKA 3ENWA 5IT4A 1XN9A 1VQYA 2F5GA 1UTAA 3RB4A 3M1VA 1OSDA 3NY0A 2MHEA 1VRQC 4QU7A 5LXRA 3LAKA 2QZ8A 5CYMB 3RYLA 2I0XA 3CGIA 1DJ0A 5B0DA 1MU2A 4U7UD 5EX3A 4I69A 3KK3A 2DVIA 2XM3A 2V68A 3T41A 1XQIA 3TVKA 2RD5C 3UDEA 1R8PA 2GAHC 4M5NA 1RT5A 3AB4B 2R8JA 4OHYA 1FRHA 2Y8WA 3CD0A 3PFOA 3I31A 1Y00A 3R9LA 2XB2D 1Q8KA 1KP6A 1RWXB 4DZ6A 1UFWA 3N9UC 1L3SA 4H4MA 3H90A 3MOJB 1RTZA 4RW7B 2FUG9 2OH2A 4B3MF 3PHTA 3GCWP 4OZNA 3J7AN 3OTBA 4C4WA 2EBEA 4RW9B 4RZRA 1F6TA 1LFWA 4M8LA 1RHJB 1CULA 2KXNB 2WOMB 4ZN1A 3J80Y 1WSVA 3H0PA 4TY8A 2FHKA 2XI2A 5KFGA 1NJXA 2E7WA 4CT9A 1Q8LA 1T3NA 5F41A 1NM2A 5K8NA 2RT3A 5DS7A 2X7IA 4J9OA 4KKOB 3G8SA 5IM0A 1XNQF 3LAMA 4ZDNA 2VJVA 2D74B 1NHKL 2VD3A 4DX6A 5ETQA 4ED2A 1VQOS 1RISA 1P9QC 4HT7A 5C25B 4CH7A 4NLQA 2ZZNA 4PXBA 4JI0F 5KFXA 4CO5A 4UOGA 1DZ5A 3BGRA 1XK8A 1P8GA 2EC2A 1S9EB 5CABA 5BXIA 2HS4A 5EN1A 2IAJA 3O6QA 4DL0C 4I2QB 4HT5A 1K8AT 3TO8A 5KT4A 1WTFA 5KAKA 4IQMA 3NWGA 2K1RA 3KHHA 1VK3A 3CJKB 4DJBA 2HWIA 2HAIA 1J5OB 3KJVA 4NEZA 4HI2A 4LF1A 1HWLA 2MKYA 4F3MA 2MJUA
chains in the Genus database with same CATH topology
1KONA 5E3RA 3OFFA 2BJDA 4RUCA 4P6QA 4FF2A 3MM8B 3MECB 3VQTA 3K8VA 3PJXA 4RU2A 3FVYA 5A8RB 1UW4A 4QIGA 2KI2A 1RI7A 5GAHI 4DX8H 3DYAA 4DQQA 3MMCB 4OI6A 4ZVHA 4Q2MA 2Z0GA 4KSEB 3T1YF 2F40A 1TUVA 1VRUB 2YTCA 2AP6A 4C3KA 3N6NA 2E29A 3DDKA 3SV3A 1TVRB 2ZH7A 3C66A 2GCFA 2I38A 3QO9A 3V4IB 2KHDA 4A8MP 3DRSB 1VQ9S 1R8CA 1S79A 2PDAA 1Y0HA 3LWMA 3VAMA 2PT0A 3D5MA 5I3PA 4AL7A 4DR7F 4MK7A 3BDEA 3UCZP 2HLUA 3IR6B 3M32A 4XPCA 2JX2A 1JJHA 3T5KA 2UUWA 3FRZA 4OLPA 1SBRA 4ZPVR 2IM2A 2MQQA 5KFVA 2W7PA 1M5OC 5A8WB 2FB0A 2VG5B 1V6HA 5DLFA 4OZLA 1HBMB 5H1SV 1N0VC 3Q2SC 4O4RA 3KLGA 1UWBB 3NS6A 2HNYA 3QWUA 4G6VB 3DOLA 2VL1A 4Y3CA 3SSSA 4ECRA 2XCPA 1QUVA 2R7QA 3FDSA 5IQQA 1KRPA 3C8YA 5F9LA 2ROGA 2XBPA 1TQLA 4LIRA 5SZTA 3RAXA 3DHWC 4NYZA 3WDOA 1N52B 2V8VA 4HH0A 2DR8A 2CZVC 2HRYA 1UA0A 4DN9A 1U2FA 2ZVSA 3IG1B 4X64F 4B9VA 2VG6B 4GO7X 3AB2B 4DBQA 2B6AA 1DTQA 2DGWA 2BM0A 5LSRA 3KLEA 2FJDB 3TANA 1UKUA 4WZQA 3QZ7A 2E5GA 1GXLA 2PGCA 3OXFA 5EWFA 3WBZA 2Y1JA 3HHLB 4ZPDA 4NCGA 5B0FA 2QSWA 1I1GA 1T95A 2JVOA 3B4DA 3I9V9 4O3SA 4Q0BA 1ZAVA 2B4PA 3RB6A 2IYGA 2CQPA 3PDNA 5DETA 5IZHA 3G71S 3GB0A 2R9LA 1M1KT 2L9DA 4J9KA 1QVGR 1ZYQA 1YHQS 3PX0A 1ZAXA 4ED3A 1R8BA 2F8HA 1V3SA 2GQQA 1Z2LA 3DU6A 1U09A 2KT5A 4K4TA 2DGXA 4JI3F 2B51A 2RB7A 3MEDA 2QFJA 2FJWA 5F3TA 2VFUA 5AE1A 2JVRA 1T7PA 3BSNA 1NO8A 2VH7A 1T05B 3KTQA 1U6FA 2CPJA 3GE9A 1Q81T 1RT4A 4RW8B 3I5BA 2GHVC 4QWCA 3NMRA 4B3RF 4NZ7A 2ZHOA 2FC8A 2AU0A 2J9EA 2JHEA 2WB4A 1LW2B 3CDBA 3DLBA 1I6JA 3DOKA 4DL6A 1IXKA 3RBDA 3M8QB 2UUAF 3C46A 4I0WA 2NR0A 2LVWA 4JV5F 3KLIA 4Q8EA 1VQ4S 2E1AA 4LT6A 4IG3A 4BBYA 1R7IA 3RW6A 1AXQA 3AQPA 1X4HA 1U2RA 2IC3B 2WONA 4O23A 2XO7A 1FDBA 1RA7A 4IG0B 5DM6Q 5KT3A 2HZCA 4DLEA 4LFAF 2RRAA 3H5XA 1AW0A 3JTOA 4MYTA 5FDLA 2M88A 5KOWA 3JSYA 1ZAWA 1LWEA 3OQ2A 2QEXS 1KHVA 3TUJC 1FT8A 3MDFA 2R2UA 3CMAS 4ECVA 2EFNA 3IC1A 1DFDA 4A48A 4AE5A 1NK8A 1X8DA 2B43A 3E3XA 2CJAA 5C42B 4N76A 1HD0A 1ZBTA 4ES3A 4DL4A 3UWTA 3CD5A 3G4SS 5EDWA 2HHVA 4EU0A 1HQEB 1VBZA 5E5NA 2ZHBA 4PG4A 3MD3A 3S01A 2DD8S 4UQTA 1M5HA 2YNIB 4I68A 3SEOA 1FO1A 2MXYA 2FJAB 4YR0A 5LMNF 3I4PA 4CH1A 2NLWA 1Q7LB 4DL5A 2YKOA 3FSYA 1RAJA 4TYAA 2ZE2A 2O3DA 4JBCA 4ZPTR 5KFPA 2AYEA 2YVSA 1VLYA 2FVRA 2UZAA 2DPIA 2XMMA 4O3RA 3SI8A 1F2GA 2E9RX 2YNGB 2IM1A 2J76E 4QCLA 3FQKA 1TKZA 3THPA 3TYTA 3JAMY 1N6QA 4F26A 1VRTB 2M9KA 4KHPF 1YRXA 1REVA 3N28A 3IGNA 3CWJA 4C8NA 3UD3P 2PO4A 3N5BA 4I2PB 4WCEQ 4URSA 3GIMA 4FBTA 2VASA 1BD6A 1HBUA 4B3TF 1UA1A 3RRGA 2EFPA 2XMKA 1IBLF 4JV1A 4DFMA 3HZEA 1DLOB 1KFDA 2DNHA 1U1RA 3TA1A 3ZZTA 5T7LB 3KLHA 1FRXA 3PEJA 4HH1A 3NGDA 5KG3A 5J2NA 5HP1B 1RP5A 1FVSA 3CC7S 2NSBA 5KG5A 2XCAA 1HPZB 4DMZA 4NLPA 3UDLA 4Y0FA 3U1LA 3LP0A 3W3SA 3ZZPA 3GV8B 4RBUA 2AX0A 1S76D 2EKYA 3DI6A 3MTKA 3PRBA 4OX7A 3O2IA 1FA0A 3PFEA 4YUDA 2QO3A 3NNAA 1F5AA 5IWAF 2YKMB 5GAEU 5L1LA 4NCBA 3B4MA 2ZH5A 3BF4A 2RNEA 5AXLA 3KHLA 3CCVS 1LV5A 1HHSA 2GX8A 2OD4A 3A1YG 2OSRA 4IFVB 2V9WA 4NOHA 1KOHA 4Y2IA 4CNYA 3PO5A 4DL7A 1O8BA 4EBEA 4RW4B 5KT7A 3TAQA 2B7BB 2ZH4A 4KV8A 1LK7A 1Q8BA 4RNNA 1WF1A 4ETXA 4YR2A 1UJ6A 4MKYA 2EC0A 4B17A 1H7WA 3HKZD 1VQ7S 2R8IA 1JLBB 1Y5NB 2L3MA 1EP4B 2P9EA 3DRRA 4XO0A 4DV4F 4F4ZA 2W8LA 3QMQA 4DL3A 4ECTA 1OSCA 4IRDA 1L3TA 4NRTA 1HA1A 2RS8A 4HTIA 1FTRA 4C7QA 2UV8G 3D54A 2BANB 3GYNA 2ROEA 5KFAA 4OMFG 1Y9OA 2CQ4A 3JSRA 5CQGA 1MWZA 1HMVA 3TVYA 2FHOB 4PWDA 4AQYF 1U49A 1W2IA 3ITHB 3TARA 3MD1A 5D4LA 2QMXA 1DARA 2I8EA 3ZZOA 4I7FA 1A9NB 2R7WA 4NYPA 3ISNC 1Y3JA 3CJ5A 4DDFA 2B5JA 1KLNA 1KTVA 1RT2B 2RE1A 1S6QA 4IH6A 5KFZA 1HNWF 1LWCB 2X1AA 1LKZA 5J2MA 1IKWA 3SFUA 1WHYA 3OXGA 2LDYA 4DN0A 3QLHB 1RYRA 1HNIB 1FCAA 4KFBA 3F73A 2ZITA 1PSDA 4FNIA 5D4PA 2F1FA 3I6PA 2KZZA 1HWIA 1GQEA 2PSZA 5LSLA 2HLTA 1RT7B 2PEHA 1SJRA 3HI9A 4H4KC 3V2UC 2MGZA 4DV7F 2HHSA 1N8RT 3M6XA 3MEKA 2R2TA 1HYSB 3MPVA 7FD1A 2EK1A 2CPXA 2YKQA 1U1QA 5G0RB 1FNOA 3KG4A 4O44B 4Q8FA 2Q1LA 3BB5A 4O3OA 1URNA 2MJNA 1H2VZ 2ZKUA 3PACA 4H4OA 2BRLA 5KG4A 3G96A 4BS2A 1Q7YT 3Q8SB 2NUHA 3D0GE 1IM4A 4DUYF 4NA1A 3SV4A 2IJFA 4F4WA 2CKWA 3MM5B 1RTJA 2WRMA 3K7RA 2ZH9A 2FJVA 4ED7A 3HVAA 4BC9A 2MHNA 4GMKA 5L39A 4F67A 3DXBA 1Q78A 4LSLA 4DEZA 2M52A 5DDOC 5CHCB 4PUOA 3SMZA 1HR0F 3G8TA 4B9TA 1D1UA 2XNQA 3MMBB 1VMBA 1GX6A 1WHVA 1WACA 5MAOA 4TN2A 3LO3A 3M6WA 3M9NB 1E6VB 3GV5B 2K8GA 1HW8A 1TKTB 5E3PA 3KG1A 2X1FA 3BO3A 3W2WA 1U1MA 2DHGA 2EVZA 1JLQA 2WK4A 3CO9A 5KT6A 2R7OA 2KDOA 4RNMA 1N34F 2PMHA 3M8SA 2R7SA 2CPDA 4MYUA 3SFGA 4L3NA 4CO2A 1VC0A 3VWSA 3HJFA 4FF1A 4B3OA 5GAGU 5IFMA 1S1TB 4NLVA 1FKOB 3MPYA 5KFTA 2QT7A 5G4DA 3OHBA 2HMIB 1X0FA 3TAMA 5KTQA 1QSSA 2XMUA 2OPPA 3H4BA 2XWXA 1V9OA 2DPJA 4LSNB 4F2SA 5C24A 5F8NA 1PILA 2I2YA 4M5DB 2JWNA 3I96A 5A8KA 1RT3A 2BVZA 4I2QA 4QPXA 5AXNA 4R0EA 2ZM6F 3KHRA 3T5JA 2AGPA 1DHMA 3DM2B 4KO0B 4USJC 3WZ0A 3TQ1A 2O67A 3AA8A 4YB6A 2KN4A 3CCZA 3MWBA 2BE2A 4X4OA 4DR6F 2KXHA 2PN6A 3CVKA 1U47A 4WK3A 1UEUA 4NLDA 2UU9F 2EI5A 2MYFA 4U9RA 1CC7A 2D7SA 1B0VA 1DQ8A 3DLEA 3UNGC 3DN9A 2KXFA 2RF2A 4YY3F 4ZCIA 4PQUB 3GFZA 2DGVA 3FFIA 4TNOA 3N79A 1VBYA 1K73T 1BQMB 4OZJA 2R8KA 1JLEB 2MZ1A 1R3NA 2N82B 4TU7A 4J9RA 3X1LB 3K5MA 1VIOA 4TU8A 4OV1A 2LA6A 5HMWA 1PGZA 3LGMA 1OIAA 1TP7A 2YX1A 1TL4A 1OO0B 1TV6B 3WC0A 3NNHA 1Q8IA 1KQKA 1FRMA 5CCLA 3ISZA 4IQXA 1TL1A 2Q79A 5F8GA 4HEA9 2E44A 1KHWA 1K1SA 1P1LA 2OLWA 4NA2A 5JUMA 4DV1F 1UJ4A 1RQ0A 2B56A 2MDAA 2ROPA 3AQOA 4F4YA 2VG7A 2AQ4A 1SUQB 2YWEA 4OJ1A 4A8YA 4KE5A 4X4TA 2PI4A 2VQFF 2GGPB 4OJ3A 1EETA 4DSJA 5M2UA 2ZUGA 1Q4RA 3GIIA 4QR0A 1ZM9A 1CQMA 4DOZA 5CYQA 3KK2B 4DV2F 4CI0B 4ED6A 4C0HA 4B02A 3MAQA 1SKSA 1WG1A 3M8PB 4CTAA 5CA5A 3DRSA 2V4QA 1NK7A 2A10A 4DFPA 3Q23A 3I32A 1X4EA 3S8SA 1KVIA 4TU9A 3M05A 3FMBA 3POTA 3M2VB 4Y2KA 5GADI 1ZETA 1WEXA 3CDWA 4MFBA 3NL0A 3KK1B 1KVJA 4ECYA 4NZ0A 3HP6A 5J2PB 2VOPA 2ATLA 3UCGA 4Z37A 5HLFB 2HNDB 2VG5A 1KNZA 3OUYA 3DLKB 3QJLA 2XY6A 2OPQA 2QA1A 2IA0A 1HNVB 1Y3KA 4NA3A 2HHXA 2DNOA 1C4AA 3P96A 4CO1A 2ZBIA 1HI8A 2XLIA 4YMEA 2CVIA 3DNCA 1PC5A 1JLFB 3CMES 2OMLA 3CT9A 4MK8A 1A7GE 1OPIA 4MJKA 2BQ3A 2FHJA 3OXLA 4QR2A 4J9SA 3TUIC 4IR1A 2HYIB 3GIJA 2N4CA 2BM1A 4WF9Q 4JI4F 1WEYA 1S1XB 4Y28C 1IKYA 5K14B 3ZZ0A 3UDCA 4WFNQ 3LW5C 4Y65A 2XMTA 2X51A 4ILRA 3F44A 3MM7B 3KNAA 4PRFA 4C8KA 3QZ8A 2HWHA 2Z4PA 5D8HB 3Q0AA 4ERDA 3MM6B 2QLXA 2F8EX 2V4JB 4MIWA 2ZKTA 5E0OA 2XMWA 2LU2A 4ICLA 2RQCA 1NKCA 2VC0A 3RAQA 1ROFA 2RRBA 1H7XA 2RUGA 3VF0B 1RT1B 2GW8A 1NHUA 1RTHA 3SSRA 1HQUA 3CJ4A 2E7XA 2IM0A 4DSEA 4FS1A 4A8SA 3MEEA 2VFVA 2DCLA 2Q6CA 4C0BA 3FQLA 3P3DA 1S0NA 1M5KC 1G7CB 5D77A 3MGJA 3J7ZT 1JB0C 3FRYA 4G1PA 1SQEA 3NAIA 2O5DA 1VQLS 2JZ5A 3HFKA 1O0PA 1XWLA 2NUUG 3J7Z5 3EX7B 2ZJRQ 3DMJA 4A8FA 2I9SA 2G9OA 2E1MC 4WE1A 3J7YU 2MKKA 4GKJF 3IAM9 4Q7AA 4V19X 4GKKF 2W9AA 3IRXA 1TFYA 2CG4A 4QIFA 1QSLA 2KFZA 3D28A 2KG0A 4K59A 3C6UA 4USHA 3AHPA 4ZP9A 3M9MB 4QPTA 2N4DA 1C1BB 4C3MA 2RDJA 5L8RC 1Z4UA 2L41A 4TLQA 5T14A 4V19J 1RTDB 2M4MA 3EYZA 3NKYA 4NYOA 4J9MA 4P7TA 3L7PA 4DLGA 1HI0P 3NRBA 3OL6A 1UEVA 1OPZA 3SYZA 1L3KA 2IJNA 1JLCB 1SJ3P 2DHXA 4PXCA 4O3NA 2VKRA 2LQJA 3D0IE 2LXFA 4J9LA 1D9DA 1QE1B 2LCWA 4N5SA 4KJIA 3O44A 2CQ3A 1KQGB 2AYBA 2GC8A 5E3QA