3BM7A

Crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
HHHENLYFQGMIGVVATLKVQPAKAAEFEKVFLDLAAKVKANEPGCLVYQLTRSKTEEGVYKVLELYASMDALKHHGGTDYFKAAGAAMGPTMAGAPVIEYLDAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein of unknown function with ferredoxin-like fold (NP_420935.1) from Caulobacter crescentus at 1.35 A resolution
rcsb
source organism Caulobacter crescentus
molecule tags Oxidoreductase
molecule keywords Protein of unknown function with ferredoxin-like fold
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bm7A00
2W4PA 4OJHA 3HHLB 1VQYA 1SB6A 3FGVA 3IWLA 2QIFA 2FIUA 2OMOA 2RILA 5B0DA 1LQ9A 2XMWA 1JWWA 3HFKA 2OD4A 4A48A 1URRA 1V3ZA 2BUNA 3I9ZA 2OFHX 3WDOA 3FRYA 3VTIA 2G9OA 1AFIA 1Y9OA 1N5SA 1FE4A 1TZ0A 1YJTA 2KT2A 1Y0HA 2N4CA 3BB5A 4NPOA 1YJVA 2GO8A 4OJGA 2EW9A 3QGPA 1N5QA 5F0WA 5K9FA 2XMMA 5IXUA 2CRLA 5B08A 2K1RA 2RSQA 1YG0A 4HI1A 4A47A 1Q4RA 3KG0A 2Q3PA 2FTRA 4F67A 2K7KA 1AW0A 1TL5A 1KVJA 2GGPA 4OJ1A 1P6TA 1YRXA 2XMVA 2IFXA 3DXSX 1N5VA 2BJEA 4HH1A 2AW0A 3BM7A 2OFGX 2GA7A 3QMQA 1X8DA 2QLXA 1TUVA 5A6WA 5B0FA 2KT3A 2K2PA 4U9RA 2BJDA 5T7LA 2OAUA 3HHLC 2GV1A 3LGNA 1FVQA 2N7YA 2AP6A 2VV5A 3FMBA 4FNHA 2GFFA 2PD1A 3KNGA 1WD6A 2ROEA 3BF4A 3HX9A 4ZA1A 1X7VA 2OKQA 3KG1A 1JK9B 4OJ3A 3UDCA 1MWZA 2IYGA 2L3MA 2FB0A 1AFJA 3HHLD 3BN7A 1FEEA 3CJKB 2RMLA 1CC7A 1TL4A 2HLUA 1XBWA 3HF5A 4HH0A 1P8GA 4NL5A 3E8OA 2KKHA 4HL9A 3BR8A 3KKFA 5F0UA 2QLWA 1CPZA 2K7JA 1VQSA 3IWXA 1OSDA 2ACYA 2OD6A 1OQ6A 4Y2IA 2PGCA 3TRGA 1K0VA 2HIQA 3GZ7A 2HFNA 2W4DA 2ZDOA 2XMKA 3HDSA 3MZIA 4FNIA 4QOTA 2JDJA 1S6UA 1N5TA 2ASYA 5B0AA 5B09A 2AJ1A 2VH7A 2HQIA 1IUJA 2LDIA 2ROPA 1FVSA 3HHLA 4Y2MA 5B0EA 5B0BA 2ROGA 5B0CA 4YEAA 1Y3KA 1MWYA 2W4CA 2GGPB 2RU9A 3DCAA 1R6YA 5B0GA 3T9NA 1GXUA 4DL0C 2XMTA 2QYCA 2N4DA 3MCSA 1CC8A 2GCFA 4HI2A 1S6OA 4DN9A 2HFOA 2OP5A 2XMUA 3K7RA 5A6PA 1U7LA 1ULRA 1APSA 3F44A 1YJRA 1Q53A 4EFAC 2IYIA 3LO3A 2BBEA 2K1RB 4ZOSA 2BYCA 3LGMA 2ZDPA 1YJUA 1X0PA 1Y3JA 4OIXA 3CJKA 3TNVA 2FHMA 2LQBA 4A4JA 5T7LB 1SI9A 2KYZA 3BGUA 1QUPA 1TR0A 3TOQA 4A46A 1KVIA 1KQKA 1FESA 2XMJA 4Y2KA 1Q8LA 1OQ3A 1RJJA 1GXTA 4DPOA 1OPZA 1FE0A 1Q8BA 1W2IA 2LQ9A 4Q2MA 4Q2LA 2HLTA 3BDEA 2AJ0A 5KAKA 2LXFA 1FD8A 1SQEA 4YDXA
chains in the Genus database with same CATH superfamily
1IKYB 4EBCA 3VAMA 4CRJA 5G0RA 1NK7A 4W90B 4PQUB 4P75A 1QE1B 4DL6A 5EN1A 2HIYA 2OMOA 3DOLA 2BABA 3G6YA 2XMWA 2NXUA 2ILZA 1RYRA 4OHVA 1IJFB 1YK9A 1U8WA 2M4MA 1RWOB 2M7SA 1FFWB 2NXEA 1UWAA 2EBGA 2ZD1A 3R27A 3UN3A 4B3SJ 4HACB 1YJTA 3DNCA 1U2FA 5C24B 1RWNB 4FZVA 1LWFB 4YFUA 5HVHA 1HW9A 5LSRA 1UFLA 2OEMA 4B3OB 4K50A 4C97A 1CJTA 1OY6A 4TU9A 1UMJA 3LP0A 3QNWB 2FC8A 3GIJA 2VJVA 1PYSB 3HZGA 1IKWA 4ATNA 2WSCC 2W9CA 3PHTA 2GMJA 2Y1JA 4A47A 5M2RA 2F8EX 1D9AA 1YVFA 2GQ2A 3DYAA 5J1NA 3Q8PB 4M95A 1U1QA 1H38A 3DLHA 5LMUF 3J7YU 3D3CJ 4HACA 4RNMA 2R2SA 2ZH6A 1W26A 5HMWA 1SJ4P 3NGKA 4X4UA 3B78A 2WHOA 3IRWP 3HM9A 3ZO7A 2DXDA 1YGYA 1E6YA 4F4YA 2H5EA 1C0UB 2OPQB 3RGIA 2E1CA 1TUVA 2F5GA 3AA8A 5ETOA 1B7YB 4WU2A 3T6JA 4C3MA 1NHVA 2F1FA 2J8SA 2W9AA 3K5NA 4DV6F 1PSDA 1S1XA 4RW6A 2Z4PA 1TUGB 1T9VA 4WIQA 1QSSA 3C6UA 1P9YA 4USKA 3ELHA 2PD1A 4RUHA 4JI6J 1LK5A 4K4YA 3NNAA 1MMNA 2OIHA 1PAUB 1SJ1A 1XMQJ 1IJEB 4WFNQ 3BBFA 5KFIA 2J8AA 9RUBA 2VG7B 3ZZYA 4YUDA 1FNXH 3F0NA 2IVMA 2ZHOA 1VQOS 2FLNA 3MM7B 3FUYA 1DFDA 3LOUA 3PKYA 1RK8A 4FXVA 5GAGU 2JC1A 4J9NA 1G1XA 4KHPJ 2CQ4A 4USUA 3UDLA 1CULB 2G4BA 3L7PA 2MYFA 2ATCB 3BREA 3TZWA 1S1WA 3HF5A 2E1PA 4RZRA 4Q0BB 4OI3A 2ERRA 3TUPA 5HQMA 1TL3A 5FD1A 4C98A 1VIXA 3PV8A 4JI1J 4N77A 2ZZNA 4IRCA 2W2MP 1KLNA 3GILA 3RR8A 2H5JB 2CVIA 5AE2A 5L1KA 1KKHA 1ZM2A 3GMGA 3RU0A 1EP4A 1OPIA 1Y10A 4FP9A 3ZTOA 3PEJA 4IRKA 4UW2A 1H73A 1VLYA 1YSJA 1KTVA 2CQ0A 1AYEA 1ZM9A 2DNLA 4GRSA 2VQFJ 3VGUA 1KOOA 2DNKA 3VGTA 2RT3A 1RU2A 4IFYA 3KYLA 2RKIB 4N47A 3KLIB 1MN7A 3OUYB 5HJYA 4DFKA 2FZGB 4LF4F 1MWYA 3JYTA 4OI0A 1S9EA 4UTGA 4JV2A 4B3MF 1KEKA 5CYQB 3FBFA 3TZYA 4ETZA 2HHTA 4LVOP 1C1BA 4ELVA 4LFBJ 4OZ5A 1UJ5A 4DQPA 4KT0C 3ADAC 5CYMB 4PYDA 1VQ5S 2XS7A 2MKYA 5HP1B 1KN6A 1Q53A 2FHJD 1U6BA 2KB2A 2NQPA 4DR6J 1WKLA 2CPDA 4B08A 1SC6A 2P8IA 3B4DA 3K59A 1HBOA 3J80U 1NMEB 2OGUA 3M2VB 3GFYA 2DNOA 3ZTQA 4C3KA 2FHMA 4CLLA 1UP1A 2YQ3A 2KG0A 3MM8A 2BMBA 1QUPA 2P5VA 1S12A 3WX4A 1YQHA 2E5LF 2QL5B 3CW2C 3MM5B 5GAHU 4QW9A 2BE9B 2FZCB 4PRFA 1VC6A 2EFOA 3RR7A 1HMVA 2YNIB 3SIPB 3RB4A 1D8YA 4CI0B 2E5LJ 3NCRA 2ZEJA 3NCPA 2ZZMA 1X5PA 3WQPA 2DYAA 3DLKB 3QAEA 4PG7A 4FF3A 1C1BB 5L46A 3KHHA 1L3KA 2F3JA 4QWBA 2FJBB 4RW8B 5A2QU 5IWAJ 1RE1B 1OO0B 3I0SA 3CCTA 4ED7A 2A2DA 2CA9A 1Q79A 2V8DA 5B0DA 5EGYA 4C7QA 2F40A 1HKAA 2V4JA 2Y1RI 3M32B 2M2BA 1B0VA 1LOUA 3DOLB 4I6WA 3DRYA 4EYIB 1YJVA 4IYQA 3BR9A 4U8YA 2ZNYA 4R5PA 4EWTA 1NHKL 4WCEQ 1WG4A 2E1MC 4QPXA 4DL7A 2CRLA 2N7CA 1S6PA 3GV5B 4ECTA 1N5YB 3FC9A 2UXBJ 4TU7A 1VIOA 5KG5A 2GVZA 3D0GE 4OV1A 1PBAA 2YXLA 4TLRA 1N48A 3G6ES 1VRTB 3FQKA 3CCVS 3QRRA 5HAOA 4C11B 2IM2A 4ZITA 4RW9A 3OL7A 3TANA 2UU9F 5BYQA 2XNRA 4ZN3A 4V19X 3MM6B 2B8PA 4DR5F 3SI8A 5DQIA 1T05B 2NUUG 2CYYA 2MKSA 2ZH7A 3T3FA 2QMUB 3MEDA 1KNZA 1JX4A 5F3ZA 2Z2LA 2W8LA 3PACA 3HHLC 1WORA 1ZS6A 2YWGA 1CLFA 1WF2A 2D9PA 2ZH1A 4CT8A 4Y6IA 2ZVSA 3OJUA 4DR1J 1TKDA 1SV5B 1S1XB 3IM8A 4RW6B 4DEZA 3D68A 1LKZA 2ROEA 2VPXB 2WK4A 5IS2A 2R8IA 4K4SA 3CVKA 4YB5A 5C25A 1RAAB 1FDBA 3W9IA 2D3O1 2Q66A 1JXLA 1JLGB 3H5XA 1NO8A 3HK2A 3NLCA 4KH1B 2HHUA 1F60B 1K47A 1WDDA 3OR1A 1REVA 3C3LA 5KFSA 4NOHA 2RJZA 3I87A 4HDGA 5AJ3J 3D54A 4DLGA 1WG1A 1S9GB 4PWUA 2Y8YA 3VAJA 1B0TA 1Z4UA 3B8HA 2KO1A 2QLWA 3WC2A 5C25B 2OD6A 2JHEA 1RA6A 2RNEA 4RNHA 3TRGA 4EUVA 5EWGA 1HQEB 2W4DA 1D3WA 5CD4H 4A8WA 3PTWA 3W2WA 2EEYA 1VQMS 4PWDA 2DGQA 3MMCA 4HHHA 2DTJA 4ZVPB 3FMWA 1A7GE 3QZ7A 2VPZB 1HHTP 2R8GA 4DR7J 1MROB 2VH7A 1JLEB 2J5AA 2DGOA 3C16A 3ENVA 4NMLA 2E5JA 5F3TA 4HYKA 1F0XA 2FVQA 2F4VJ 2H65B 1Y3KA 2V4RA 2GVDA 1P9QC 5D0GA 4M63A 2RDJA 2N4DA 3DM2B 2HAIA 3IRXA 2VQEF 2BANB 4LREA 5HQ8A 1U45A 2OP5A 3RRGA 2FYXA 1FJCA 3F44A 2E5GA 3EUNA 1HIYA 4QIVA 3ZZRA 2LP4A 4UF4A 1GMWD 1HNIA 1NDCA 2ZDPA 2FY1A 1U47A 4FXWA 3DRXA 1GT8A 3CJKA 1SL2A 3FJ2A 3ILOA 4ZPTR 2HHHJ 2GVDB 1N33J 1JLBA 2Y8WA 1T9XA 2IIHA 3KHLA 1BD6A 1VQKS 1KVIA 4KR0B 4B3SF 1RCXB 3CDUA 2GHPA 2DPIA 1WSVA 1Q8LA 2O5DA 2RDDA 4KB7A 4LSLB 1GXTA 4DI6A 4TQSA 3CCZA 1GMVA 2JLGA 1HBMA 1YJ9S 2IC3B 2IJNA 1XR6A 4B9TA 1S76D 3GFXA 3UR0A 4J9QA 2OH2A 1XNRF 1W25A 4UOCA 4XPCA 1HYSA 1SKWA 2HGMA 2WB4A 4OL8A 3SV4A 2B9EA 2VFTA 4NI2A 3BDPA 4O3PA 3DGVA 3OTOF 2FVCA 3FEXB 2OEJA 2IRXA 2RILA 4BCAA 4KGZB 3M4XA 5AE1A 1X9SA 1JWWA 1QD1A 3M05A 2W7AA 3V81A 1IBMF 1OIAA 4CLYA 5ETNA 2X1AA 4NCAA 2HBYB 4F4AA 1Y9OA 4ECZA 2KRBA 1JLFA 1LFPA 1TAUA 1GK8A 3AODA 2AYEA 2BW2A 3CJ2A 3T1YF 3AOAA 3DLKA 2EW9A 1H6KX 3PYEA 4NEYA 2HNZB 4R25A 3ZFVA 1TV6B 4A8XA 2VIHA 3EXYA 3L95X 4MFBB 4QR2A 5FLXU 5DQGA 4NI2B 3R5GA 1C0TA 2OUGA 2DGWA 1VHFA 2WSEC 3D67A 2Q3PA 3NGTA 2GC8A 1UWBB 3AHPA 4ZHRA 4LF8F 1LWXA 2QSWA 3M8ZA 5KG3A 4JI8J 5GMDA 1TELA 4BC7A 3M6WA 5KFLA 1FD2A 4LJMA 1N36J 1N32F 3BM7A 3U7JA 4J5OA 4X4NA 3GONA 2QLXA 2AEFA 4FYWB 3KNAA 4FYDA 1X4BA 5LL6d 1IKYA 2KT3A 5BYRA 1F5CA 2IRUA 4WJBA 1ZA1B 3PFEA 3QBCA 1XTZA 3T1YJ 3ZZZA 4F50A 4LF7F 4N56A 3WZ0A 3WBZA 3J7YI 3NEKA 3OVBA 3PW0A 1WD6A 3ZZOA 3UPFA 3TVZA 2RKIA 4K5RA 3OUYA 2QFJA 4DV4J 3KG1A 1TMMA 3H4DA 3HVAA 3KG4A 1PKUA 1R89A 2BOAA 3CJRA 5D3GB 1K8AT 2MDAA 3PEHA 3MGJA 3RRKA 4NRTA 4USWA 4Y65A 4ZJOA 4OX9F 1QTMA 2FZKB 2BJ1A 2WRMA 1S57A 3MEKA 3ETMA 5E0OA 2FVSA 4NZ6A 2LLZA 1MW7A 3ZNUA 2KFYA 3VR1A 5IV3A 4HL9A 5J2NB 2A6OA 3ISZA 1JLFB 1FRIA 2C2MB 1UVIA 4DG1A 3KK2B 3HSZA 4IOAQ 2D9OA 3V81B 3UE2A 4BDPA 1HLWA 1KC8T 1JJCB 1VISA 2CJQA 4PXBA 3S8SA 3SCJE 5L8RC 4EMDA 2C3MA 4F8RA 4NYZA 4O3SA 2HVIA 2XNQA 5I42A 2CNOB 3ILIA 5KFMA 1S9GA 5B0BA 3CCSS 2BQRA 1KD1T 1ZAXA 2VASA 2HYIB 2Z58B 2JEGA 4HT5A 4LRCA 5J2PA 4NLQA 3IBWA 2APOA 3UCGA 1H2TZ 4HHUA 4M5MA 4NZ7A 1R8PA 2V8VA 3OR1B 5KFRA 3TZXA 2AQ4A 4NLDA 3RW7A 4ELUA 3KUEA 3N5BA 3FK4A 4ZDNA 2V6AA 1RQ0A 3W9HA 3R1LA 2JJ4D 3MTKA 2HWIA 1YJRA 3Q8YA 2EFQA 1M1KT 3V4IB 5AXMA 1F1BB 4NEZA 1LWCA 3US5A 4CM2A 2OHDA 3M9OB 3BGRA 2V8HA 5BR8J 1FTRA 1R0AA 4OIXA 1KSPA 3HSDA 4NLUA 3C19A 3O1LA 4EYHB 1M5SA 2CZVC 2CFXA 3AT1B 2ZM6J 1GAOA 5M2PA 4MKBA 4LQ3A 4YHHF 3W3SA 4FN5A 2C3OA 2IJFA 2KM8C 2RIJA 1RWXB 3MCNA 4M5LA 1L3UA 2OPRA 1VQ6S 2O67A 3DKDA 5EDWA 3H40A 3PX6A 1B7FA 4HTIA 3SSSA 2AX0A 1RT2B 1SQEA 1UKUA 3I96A 3G6VA 1PJ5A 2IJRA 3M2UB 4RW7B 4ED8A 2G2ZA 1T3NA 5DZ7A 4B3TJ 4QIEA 4IQMA 2QL7B 1EETA 5HMYA 4WP9A 5KFHA 2BUNA 4FS2A 3MMAA 3UVJA 3VTIA 3HT0A 4DF8A 2J6UA 1XNQF 1FE4A 1TZ0A 3CO0P 3H42A 2N4CA 4H4KC 5IZHA 5DM6Q 3MR3A 4PUOB 3DLGB 5H1SV 3RJMB 2KN4A 4NLVA 4Z37A 1RTIB 1G6BA 4Q8EA 2ZC3A 2V68A 1S48A 4ID5A 4B02A 1URNA 2B6AA 2CPYA 1REVB 1SUQA 2IM1A 4U7UK 3PR5B 1WHYA 3OT9A 5ETTA 4OHXA 4LF7J 3CSKA 3IS9A 1UL3A 1AW0A 2AYGA 4O4GB 1NK4A 4NMXA 1HMVB 2GX8A 2NXNA 2YNIA 3GB0A 2IBOA 4ZVGA 1X0FA 2KXFA 1AA1B 3SZ2A 4ICLA 1Q8KA 1ZETA 2F4VF 3V6KA 5H9FJ 4IR1A 1TMJA 2Z56B 3V6DB 1UVJA 4AQYJ 2JC0A 2HHXA 1UJ4A 3QFHA 5HVFA 3LGNA 3Q8QB 1R8CA 3EGNA 5KT7A 1X4CA 1ZM3A 4EO6A 3QGHA 3MPDA 3IG1A 2HRTA 1ZA2B 2HK2A 2BEFA 4EI2A 1FJGJ 4GKJF 4K4UA 3PY8A 2CNNB 1KQFB 4AXIA 1M90T 1F3VA 5CYQA 1WI6A 1DBDA 4YP3A 1U1RA 1RWMB 4P74A 1M5VC 1QAJA 4I6AA 1B70B 3DI6B 2VC0A 4X4RA 1VQPS 3BGFA 1RKJA 4K2XA 3WHIA 1N5YA 1LXNA 4IO1A 4YY3F 1HI8A 4C3LA 4X64J 4X4VA 1QTNB 3H2LA 4NLSA 4F7VA 4TYBA 2D41A 1RLCL 1L3VA 2J6TA 3MCMA 1EHWA 1NH8A 3BSOA 2UUWA 2NSBA 4Q8FA 3NG8A 2M52A 3I5CA 3PNIA 4YN3B 1D09B 1RBLA 4Y34A 5F8JA 4H54A 1H72C 3FDSA 4OFZA 2FJWA 1VK8A 2COLA 2EKNA 2QV6A 1T9TA 2WVCA 3SQOP 3J81j 4ECXA 2BQ3A 3MOJB 1AROP 5DGAA 1YRUA 2PEHA 5IT9U 1X9WA 2Q6CA 5KOWA 4Y3CA 2EFVA 1JLCA 5L1IA 3PFOA 3GJTB 1CC8A 1I5OB 1SH3A 3QGGA 2VKZG 4NX9A 3ILJA 5ETKA 2W8KA 4EZ9A 1EKRA 5A6PA 4LF2A 1S0VA 4TLQA 1KLMA 1XN9A 1YKWA 4OQJA 1FERA 4K2JA 3OFHA 4ZP9A 5DRKA 3RG6A 1YJUA 2J9DA 2FJVA 2UV8A 2VQFF 2JZ5A 5FDLB 5J1PA 1C4CA 5C42A 1MLAA 1XMBA 2MZRA 5T7LB 2GJIA 3SSQA 4USMA 3G82B 5D6GA 3H5YA 4A8KA 1OJ4A 2HK3A 1NK9A 2V2KA 3DOMA 2IDEA 4WXOA 2XMJA 1JJ2R 1NXIA 3CCWA 1NEEA 2HPUA 3KXDA 1FK9A 4MH8A 4DPOA 4X66F 5K14B 1Q7YT 2NXCA 3NAIA 4ID5B 3VALA 4DSLA 1HQUB 3BDEA 5GAHI 4RW8A 3UD5A 1RT6B 2XM3A 3EVWA 3FVYA 3W63A 3G71S 2CPZA 2WONB 4MAKA 4LBHA 1IKWB 1HPZA 1VQYA 5C42B 2HZCA 5BJRA 4Q44A 4JV1A 3NNCA 1BQXA 4KKOA 4F3MA 2IDLA 5IM0B 2BX6A 2GIQA 2AKWB 3C66A 1P27B 3MM5A 4ECSA 3G86A 2HRYA 2V69A 1EQMA 3HD2A 3M6UA 1HHSA 3N4WA 3O8WA 4WFBQ 3G4SS 3N6MA 2LMIA 4NXNF 3F73A 2VODA 1FDNA 4Q7AA 4USIA 2RF2A 3TW0A 2XMMA 2EFGA 3OQ2A 3LWMA 3CCRS 5E7OB 4N8NA 3J7Z5 1PC5A 2K1RA 1EQ0A 4K8RA 1WHXA 5I3PA 1TVRA 3GP9A 4IDKB 4O44A 5D15A 4RW9B 1RADB 4DF4A 3D2WA 4X62J 2B6AB 3QWPA 3OTDA 6AT1B 1F5BA 3BGOP 3LH2S 1UJ6A 2LXUA 1LXJA 3AY0A 4DPYA 4F4XA 2NZ4A 5DLFA 4FF4A 1R27B 2VC1A 3PDNA 4DX8H 3PR4A 5LXYA 1FRLA 2V4QA 4RX6A 4OYPA 1RHUB 1FRMA 2MQNA 4H4MA 5H9EK 4LFBF 3I0RB 4J9SA 1XERA 3C15B 2U1AA 4IR9A 4I4BA 4M5HA 1NDKA 1RAOA 3DOKB 4QWCA 4GVBA 1QVGR 1M5OC 3PRVA 4UUXA 1RHMB 4JOUA 4LIWA 3VVTA 4F0HA 2DY1A 4I2PB 4WE1B 1EJ7L 2J0WA 3QQCD 1LW0B 3K57A 5JVHQ 4OJ3A 4P52A 1PBUA 3R7BB 5J2NA 2BR0A 1NB7A 3R2DJ 1T9WA 2QC3A 3DYAB 4CNYA 2EK6A 3MPYA 4I69A 4KYZA 4MT1A 4OYOA 4M5KA 1U49A 4M5IA 2XI3A 1EX8A 1HD0A 1WI8A 2Q79A 4WFYA 1UEKA 2MGZA 3TWZA 4QCLA 3IR6B 3DLLQ 2VDIA 4UY85 3SXLA 1WACA 4LUBA 4CWBA 1YBUA 3PG9A 4LF4J 5SUHA 4R8UB 4A8FA 1SH2A 2F9JA 3CUNA 2X1BA 3IWXA 3HZEA 1LW0A 3P5BP 1CVJA 4B3OA 2PGCA 2VICA 1DY3A 2CQPA 4ZPAA 3C6UB 1FHTA 2JEJA 2YKPA 5I3UA 5KFFA 1S49A 4QR0A 1V3RA 3I6PA 5KT3A 3HHDA 1HYSB 2PO4A 2OPPB 3HT3A 3M2RA 1TKZB 3W7BA 2HFZA 3EICA 1FVSA 1LEOA 2R7QA 3MD1A 4X4PA 3MMBB 2Z2MA 3R7NB 1DLOA 3MPVA 1DAXA 2LCWA 5HROA 1Q7LB 4KGMA 5KFTA 1BQMB 4ZLLA 4WZQA 2JFDA 4JUZA 3V5RA 4ZN1A 3OLAA 1GH8A 3H90A 3KLVA 2ZBCA 3J81U 4C0OC 4RW4B 1R8BA 2BM1A 4M5JA 2N82B 4EBDA 4WPAA 2GHVC 1PGZA 4DLEA 2VFUA 2VBYA 1Y7PA 1DTQB 2EWHA 1APSA 2DNNA 1FT8A 1Q95G 2WVFA 5K8PA 3THVA 1HWKA 3LA0A 3IM9A 3GR1A 3C6TA 2XBPA 1Q1KA 3I55S 4WFZA 4OZJA 4IG3B 3AD9C 1R43A 1RZMA 5C24A 2EI5A 4WYLA 3JSMA 2RS2A 1WG5A 2AD9A 3O6QA 4ERDA 1OY9A 1O6XA 3NOGA 4M1KA 4DX5A 4C8LA 2DVIA 4OZ2A 4U7CA 4ZLPA 2UP1A 1DJ0A 2QFIA 3PX0A 2CJKA 2V34A 2NLWA 1JXVA 2LQ9A 3CD7A 1JNRB 4Q2LA 4X64F 1U1OA 1HNZF 1VK3A 2Y9HA 2RQ4A 2BE2B 3L7UA 2HNZA 3MEGB 4C8YA 1X60A 3ET6A 2DGTA 5GADU 3ZZUA 3J81Y 1YLXA 4O3OA 1FA0A 3MEEA 4R8UA 3BV8A 3VWSA 1AZSB 4EGLA 5F8HA 4QWAA 4NZ0A 5DDOC 1RAFB 1DURA 3C6TB 4I0WA 1HQEA 4PG5A 1X4HA 4DOZA 2FD2A 1T94A 1RTDB 1VYAA 2EPIA 2JSXA 2IM3A 1TKXB 3I9ZA 4MK7A 5HK4A 5AJ3F 3V4IA 4ZPDA 2CG4A 4B3MJ 4NPOA 3BB5A 1UVNA 4PZVA 3JS9A 1SCJB 2FLPA 5F0WA 3GV7B 3DRSA 1E6YB 5HMZA 3NBPB 4QWDA 4AQYF 5F8LA 4JV0A 2LQ5A 2ZH8A 3HVTA 2KDOA 2HNDB 1UEVA 3JQMA 1DZ5A 2IC3A 4C6AA 1YBTA 1IKVB 1FEHA 1Q0NA 1TP7A 3OR2B 5CCLA 3R6GB 1VRUA 1HNXF 4GVBB 4DR3J 1JLGA 3T5KA 2E9TA 3UO0A 3QPIA 1F9HA 1HWJA 3RYLA 4F67A 2RU3A 3KJQB 4PKDB 2W9BA 2PT0A 4PG6A 1RB0A 4TN2A 5J2MA 4MMOA 1IBMJ 1KONA 1WWHA 2ZBRA 2HMIA 4X2BA 3JTOA 4ZIVA 2OSRA 5F8NA 1S1VB 1WKJA 4ZIWA 3RAMA 2FQQB 3RBZA 4WF9Q 4UOFA 3MR5A 5KFZA 1NM2A 1GTHA 2ZVIA 5DDPC 4A8YA 4ED3A 3T5LA 4IH5A 2ZH5A 2ALZA 4FBUA 2Z30B 4CO5A 5KG6A 4LF9J 3KK1B 2AP6A 2AIRB 1K1SA 2AWZA 2HKEA 3Q8SB 3VCDA 3FMBA 4N76A 2XY6A 1FRKA 1T9UA 2G1HA 1AB8A 4CO4A 3HCXA 3AJDA 3PYGA 1X9MA 4DV7J 3O44A 3TZZA 4ED2A 1QVFR 3P6YC 4WKRA 3QLHA 1FRXA 4KBIA 1U25A 3MUMP 2DNHA 2MZSA 3A8EA 2H5IB 3O5TB 4CYUB 1LNQA 1X4GA 2OPSA 2C2OB 3OTEA 1ZZNA 2XO6A 2C2EA 4RBUA 4B3RF 3K5LA 4PPZA 1WC0A 1XEZA 2BVZA 3CE8A 2UXBF 1W2BR 1O5JA 4C8OA 1HBUB 4OYWA 1NDPA 5HMXA 2ASLA 5LT5A 4EK2A 3DHXA 4UOGA 2HIQA 3OVAA 1RXOB 1HNIB 2YKOA 2XMKA 3LW5C 3OD2A 3R5DA 4CZCA 3TQEA 2R8HA 2XZDB 5IC6B 2B43A 3P4UB 5KFUA 3BQ1A 3ZZPA 2ABYA 3ENWA 3JTNA 2ZC4A 2ZH9A 3V6DA 3HHLA 5LMNJ 4Q43A 1RT7A 3BKTA 1H7WA 1ZH5A 3E2EA 2XWYA 5IC4B 3M2RB 2YH0A 5KFJA 2SXLA 4MIAA 5D0HA 3A3OB 3T9NA 3BYRA 4ZPBA 4F36A 4N5SA 4JI5J 1EIYB 5E41A 1RAIB 2M3DA 1U48A 1QY7A 1HI0P 2L9NA 1CJVA 2HVZA 1U7LA 1NPRA 1HNZJ 3CGIA 3CNQP 4K4TA 1J5EJ 4QYZJ 4MYTA 1N52B 2DK2A 2KJVA 2Z8QA 5DS7A 3QJJA 4ED0A 2V9WA 4QYZK 1RCOB 4RWWA 3C14A 3PZPA 3OSPA 2UUCF 3DN9A 1BUXA 1FFSB 4G1PA 3IS9B 1SJ3P 2VG6B 1PYTA 2Z2YB 4ANDA 1IBKJ 4J9RA 4EBEA 2O1PA 1VBYA 4BWJA 2LKZA 1IBLF 1RTDA 1T02A 3G96A 5LMNF 4RUBA 1RAJA 2B9YA 4OX7A 2FJEB 3QT7A 4WWSA 1SPBP 1PYOB 1W2IA 5E3AA 3PX4A 3RW6A 2VZ9A 3QJLA 2FVPA 5MAOA 5HANA 1YITS 4DL4A 3DLGA 2HBRB 3MZIA 1RA7A 2F4FA 2IVYA 3GYGA 2H3EB 3ONQA 4DUTA 5HO4A 3IP0A 5CQGA 1J5OA 1HWIA 1JXEA 3NGUA 1JLBB 5C2CA 3HJVA 4H4MB 3KLHA 1VBZA 2UUAJ 3MM9B 2L41A 4KC5A 1JLQB 5JJBA 4GKKF 1LWEA 2I8EA 4DV7F 2MKCA 3DRPB 1FWLA 1QSLA 1B99A 4UY8T 3L4BC 2OFHX 3W62A 1X5SA 5D0RA 1KWMA 4JI2F 4OHZA 3HKZD 3MAAB 3UCZP 2C2RA 4OYXA 3PHEA 3QRPA 3ICLA 2GO8A 3K17A 4IG3A 1U1MA 3Q8VA 2QLBB 3MDFA 1D8ZA 3AD7C 3WX8A 2KL8A 4K59A 3ILLA 3T1AA 1CS4A 1RWPB 3QSIA 4P7TA 2XCPA 4ELTA 1R31A 1DQ8A 3D3BJ 4LF6F 3MM7A 1BHNA 3CIZA 3ENAA 3LPEA 3NMAA 5BYSA 1QAIA 4B9VA 1NKBA 4RNNA 1TK0A 3FSXA 5DLGA 1YJ7A 2GVZB 1Z2ZA 1UW9A 4KFBB 4P72A 3Q23A 2MZJA 2DEIA 3ZC4A 1VRQC 2ZUAA 5FIIA 3TA1A 1WNEA 3KK3B 3KWMA 3N0VA 1LWCB 2YX4A 2WVEA 2GJFA 2HNYA 3CDBA 2DGSA 2BJ7A 2JVRA 1TKZA 4WP8A 2OPPA 4IOCQ 3G8SA 2VQEJ 2RRBA 2O3DA 1O51A 1FRHA 5GAGI 5I3UB 2Q6BA 2ASDA 1SH0A 2FGOA 4JI5F 1FI4A 1P1TA 1L5UA 4KV8A 3TX8A 3EXCX 3GLJA 3EVMA 1FJEB 3BF4A 4ZVOB 4GKJJ 1UZHA 2R3VA 3MUTP 2OKQA 1DQ9A 2PSZA 4CCHA 3BS9A 2DISA 1VGYA 2WB1D 5I42B 4WYWA 3BPDA 3R5JB 1D9DA 1EARA 2KU7A 3EPIA 3CDEA 4M5DA 3FFIA 4LSZB 3OW2R 5LMUJ 3LP0B 3NXZA 2XEXA 5GADI 4DS5A 2ZH2A 1C1CB 1XBWA 1Y00A 2HHPA 3JB9k 2CWXA 2KXHA 3JSRA 3OXFA 4TYAA 1CJVB 4WU3A 3TJ8A 2LECA 1VQ8S 1UVMA 1Q8IA 1CPZA 5KFPA 3MEDB 1Y5IB 2DCLA 2KI2A 4JI4F 1IQZA 2W2OP 5L39A 2MKHA 1WDTA 1K44A 1IBKF 1DRZA 2YNFB 1M5KC 2GAHC 3P8BB 2GIRA 2HQIA 4CO0A 5ETLA 2LDIA 2ROPA 4KO0B 4OI4A 3THPA 3D6FB 3JAMY 2WTFA 4FKXA 4DQQA 4LFAF 1TFWA 2GGPB 3DGPA 1U0SA 3A13A 4KY3A 3I31A 5ETPA 3KLIA 1RSCA 4JI2J 5CAAA 1ACMB 3TVKA 3LAMA 1R7IA 4CT9A 2QE5A 2NPIA 2MEWA 2UUAF 2YNFA 3G8QA 1N56A 2HZAA 3A8IA 4XAKA 4K4XA 1VHIA 3LO3A 2J0QD 3FBBA 1VBKA 2EXUA 2AJ4A 3HSGA 2IVFB 1PAEX 2A1BA 2OLWA 3TNVA 2ZM6F 2LQBA 4RW7A 1CQMA 3CCQS 1HBNB 4KTQA 2YKNA 4R0JA 1E6VA 1UCNA 3W2VA 3BZQA 1IQTA 4GVLA 3MCOA 2PMHA 3H2UB 4IFVB 2EFNA 2MY8A 3SV3A 1FKPB 1CQNA 3GCXP 2X3GA 5EHHA 4OI2A 2RQCA 1UEUA 4ECVA 3K5PA 3IC1A 2R2UA 2YKAA 1LFWA 2P6SA 2WONA 4I2QA 3TEHB 2W9BB 4DCPB 4IO9Q 2OSQA 1CJTB 1FWKA 4TXSA 3QWUA 3TJ9A 5HQLA 1RBOB 1AUSL 4FS1A 1NCLA 4URSA 5GMKa 2FGCA 2C3UA 4RNFA 1V5IB 1HBNA 3GJRB 2RVJA 3OXLA 3NS6A 3UFCX 3TA0A 2CQIA 1DLOB 4CO2A 5L9NA 5HROB 3ITHB 2AEJA 2ZE2B 4QIWD 5CYJA 4DV1F 4MK8A 2OD4A 3GQCA 3W5ZA 3HHNB 3BQ0A 2ATLA 1S1UA 2OI2A 1N5SA 3CB4A 3PXGa 4YS2A 1SC4B 2XY5A 1N33F 1ZAVA 4NLWA 3QGPA 2DH7A 4URGA 1H3DA 7FDRA 2F7VA 4A8OA 1CG2A 4USTA 3HHKA 1D0EA 3M30A 4ZS6A 1YG0A 2CIMA 3KDOA 2B51A 4O0IA 1O8BA 3CCJS 4PABA 2B9XA 3RBXA 2GNKA 5HVGA 3KG0A 2DHXA 5IT0A 4ZLJA 2MGZB 4QYRA 2XSJA 5C5JA 2JFKA 2N3LA 5E3PA 4KQZA 2YKMA 3I4PA 4DV0F 3D6TB 5F9LA 3TQ1A 5H9FK 2BJEA 2XZTB 2YWHA 2MQQA 2ZBPA 5SZTA 2HQFA 2OFGX 4LR8A 5J1EA 3FCWA 4TQRA 4GO7X 4DFJA 3W60A 2BKNA 1L3TA 1YTYA 2MQLA 2RHSB 1JJHA 2B4OA 2CQ2A 4NLPA 3TEGA 1DTTA 5T41A 3W65A 4Q0BA 1S59A 5AT1B 2NPFA 2YNGB 3H59A 2YX7A 1RAGB 3QT6A 3R9LA 3TI0A 3X1LB 3I56S 1T0TV 3MF5A 2DRBA 4DSKA 1CJKA 2MZQA 3E3XA 2GO9A 1R8HA 2DITA 2WSFC 2EVZA 5LJ5Y 1KS2A 2XB2D 4FPIA 4JI3F 4YB7A 3KLFA 4ID8A 1ITPA 4X65F 1QAXA 1UFKA 5I3QA 2CDQA 4N7TA 2ADCA 2HLUA 2HVDA 3Q83A 2LYVA 3M6XA 4L72B 4NL5A 4R0EA 2MKJA 4OZLA 4WFXA 2VG6A 4YR0A 5JMNA 2KKHA 2HBQB 2VG5A 2DGUA 1VFJA 3KDNA 3M7VA 1HI1A 3BO2A 3N01A 2ACYA 2BRKA 1OQ6A 5A8KA 3P49B 5ETVA 3EZOA 4CDIA 1U2CA 4ZK7M 4U67Q 2AV5A 1B64A 2G2OA 2LDYA 1UA1A 1MN9A 3H4BA 2H1YA 1M5HA 1S1TB 1S6UA 4ZP7A 2HFSA 2ASYA 2FLLA 1UZDA 2QT7A 1N54B 4P2SA 5B0AA 3Q24A 3W8PA 2R9LA 5B0EA 2GJ2A 4DFMA 2CQCA 3GE9A 1NK0A 4E0DA 4LR9A 1N34J 1RT4A 3O2IA 4YEAA 2AX1A 4NCBA 1VBXA 4ZPVR 2LA6A 4O4GA 4MTPA 1GXUA 3IBFB 3CJ3A 3MOZA 5F9NA 1OSCA 2QYCA 4ECYA 2CJ9A 4I64A 2B5JA 4DN9A 5KG0A 4TVAB 5K8OA 1ULRA 2BE7D 3MAHA 4J9KA 4JP8A 4PEOA 2F8MA 2UUTA 5A76A 2VOOA 1I94F 2RHQB 1X0PA 2CG8A 1WEZA 4IQXA 4ENOA 1HBUA 4AL5A 5ITHA 2OTLS 1A9NB 3A12A 2QJ3A 3P45B 4PQUA 3C15A 3PJ9A 1HWUA 3PRDA 6FDRA 2BKPA 3MPUB 5H9EJ 5D78A 4DHVA 3OL8A 3GSIA 2XI2A 1IN0A 1OQ3A 1JMTA 4DUYJ 2CPJA 4AFFA 4LMZA 3MMCB 1WJ9A 2B7CB 4K4WA 2L9WA 1D1UA 2HFUA 1FD8A 3H98A 5IV4A 4O0NA 2GMHA 4YDXA 5A2QY 2YWFA 5LJ3Y 1G3OA 2W4PA 3VGSA 1MMLA 2CQ1A 1FKAF 1RTHB 2C1EB 1FXRA 5CCMA 2JLFA 3M8PB 5MLCV 3R1HA 2RRAA 2QIFA 2BQUA 4AXJA 2FIUA 2RE1A 2D1CA 2ZHBA 4ZVFA 2H51B 1VOMA 2G2YA 2B0GA 4A48A 1WHWA 1RABB 4DPXA 4X4TA 4Q5VA 4IRDA 1BY9A 4L75A 4ED1A 3DMJA 4J9OA 3FBEA 1YJNS 3KJFB 1Y0HA 4C0BA 2BANA 2MJUA 2NSCA 2R8JA 2UVUA 2RUGA 3K0JA 4ICLB 1FKOB 3WIVA 3SFUA 7AT1B 2RS8A 2XLJA 1SQFA 3CD0A 4CNZA 1KDNA 2GMLA 4CTAB 3KHRA 2KTQA 2RB7A 2H4YB 4M5DB 4USJC 1TK8A 5CABA 4ILMA 3E51A 1FX4A 1MMDA 2W7PA 3MM8B 2ZHAA 4DV0J 1OYEA 2BV3A 2LFVA 2CDRB 5LM7E 3M6VA 2WW8A 3KJVB 3HSJA 2FJXA 1P6TA 2AJFE 1HNWJ 4WZMA 4U6PA 1U0HB 2Y3YA 2VD3A 1V3SA 1ZTWA 4GC7A 3FSYA 3O3LA 3W8GA 4ANEA 4DL5A 1QLNA 2WBMA 2DNGA 2DHHA 2E7WA 5T7LA 2BJDA 5GVQA 4PQAA 3UWTA 4KH0B 3MMAB 3CTRA 1KQSR 4P2XA 3K8VA 3V2UC 4UZCA 4DJBA 3NWRA 4GMKA 4PPDA 2XQCA 2ZNZA 1NSKL 3RB3A 2KFZA 3DLBA 3TAMB 3N5FA 4DSJA 3AB4B 3N9UC 3S01A 1SKSA 3RB6A 3F41A 2IYGA 3EM1A 2E9RX 1HFEL 1IVZA 2WZ1A 4DR2J 3PW4A 2DEJA 4B9MA 4E98A 5KT5A 3IR5B 1SL0A 1OYDA 1PJ6A 1X5TA 4ZVUB 4F2RA 3TJAA 1XR7A 4H4OB 3CJKB 2GQQA 1CS4B 2XGQA 1NJYA 1HNVA 1SQGA 2AMCB 1HL6A 2V4JB 4OYMA 2WBRA 4ES2A 5C2GA 1RKIA 4OZ0A 3HVRA 2CVEA 2DJWA 1N0VC 4XO0A 2XSFA 3LAKA 3Q2SC 4DQSA 1NK5A 2HQCA 1R3NA 2QA2A 1TK5A 1GX6A 1MWQA 2HFNA 1YBAA 2QA4G 3MTJA 3M9NB 3KHGA 2HMIB 2UV8G 1VC0A 1C2PA 1YZ6A 1DTQA 1WKKA 2DNPA 2F8HA 1T9YA 4AUKA 2QLJB 1EKSA 1S5ZA 4O23A 4DU8A 1NK6A 1UPMB 2XTJP 2LA4A 2XULA 4Y2MA 3KOAA 2R7SA 5DG9A 2WVBA 1GMWA 2CUYA 2IAJB 1AXQA 2E29A 2HVEA 3FKBA 1S6PB 3LF0A 2W4CA 4DV3J 1KQGB 1IKVA 3OR2A 3HI9A 4U7UD 1ROFA 4KSEB 4KGKA 1RGVA 2EG1A 2OEKA 3TP2A 3MUVP 5KT6A 2M5YA 3PVXA 3GU0A 1Q81T 2ILYA 3LGHA 2D69A 3D7SB 4OYIA 2AU0A 2E7VA 3DFEA 1J5EF 3W1YC 3MAQA 2IYIA 3NS5A 2AF6A 2YWWA 3D0IE 1VCTA 3C14B 3PJXA 4MK9A 3A4TA 4UUWA 3OVSA 2JL9A 1J27A 4LF1A 4C8ZA 4WXWA 2CADA 1KRPA 2VBZA 3H2VE 2XGPA 2HVHA 3MEEB 1N8RT 4B9UA 1LWFA 5KT2A 1TKTB 2VFVA 4J9VA 4PXCA 3UQSA 4WP3A 4OI1A 2DR8A 4OI6A 3MMJA 5F41A 3UN2A 3MPWA 2B4VA 1FE0A 2BACA 1S79A 2YTCA 4EO8A 4W92B 2E5HA 2YPZA 1FKPA 4Z2XA 1NDLA 3PIPQ 1RTJA 3D28A 3KLEB 3UW1A 1BE4A 1FKOA 3ETOA 2QSFA 1PG5B 2AGPA 1NJZA 3HHLB 2IA0A 2Q1LA 2UVVA 2E66A 3JSMB 5IQ6A 3Q2TC 2VKRA 2CXEA 2DB1A 5J1EB 1Q78A 3SDEA 3QFWA 1S1WB 3K5MA 4OLPA 3Q89A 3OSNA 1U09A 1CJUB 4DL3A 3NS7B 2A18A 4NXMF 4FF2A 3EJMA 3J80Y 4J90A 3NWGA 1S6QA 1PJ7A 2AZ1A 1RYSA 1N5QA 4XPEA 1NUEA 1RWKB 5FLXY 4LF6J 2FJDB 1UVKA 1WF0A 3BJYA 1FXLA 4K5SA 1U2RA 4OLOA 2BM0A 2LU1A 3DU5A 2WCXA 4CLSA 1WUUA 4RU2A 1HWLA 3MEGA 3CMES 4K4ZA 3MMBA 5E3CA 4LF9F 5IWAF 2G0CA 1TVRB 1ZBTA 1RTZA 1RAEB 2ACMA 2FTRA 2NYHA 2PFDA 2XWXA 3FZBA 4WFAQ 4RUCA 5LOQA 2W25A 4ZVRB 1YRXA 1XR5A 2J7UA 9ATCB 1YX2A 3CPWR 4DV1J 3PW2A 2FLOA 2OPRB 3W5XA 2HSEB 3M32A 4AT1B 1X5OA 1HR0J 1N34F 2ZJQQ 3HFVA 2DT9A 2QMWA 1S4FA 3M1VB 4YHHJ 1K0TA 3U1MA 4B9NA 2YWKA 4RLEA 4IUFA 4QU6A 4CP5A 4DV2J 5CH7B 3IWNC 5HBMB 2VV5A 3MWBA 1NJIT 3RTVA 3DRRA 5A8RB 4ECQA 4PG8A 4LFCF 1W7WA 4YR2A 2ALYB 4ZVQB 1RISA 5M2UA 1GXLA 3BYPA 2FHKA 2EK1A 4L73A 1S0MA 4OZ3A 4L74A 3DLJA 4WTYA 2HHHF 1QDUB 2HEKA 3E01A 3QT8A 1WC6A 4TU8A 3ENQA 5EWFA 1R0AB 4RUAA 4F4KA 5D4OA 2DRDA 3BSNA 3M2VA 4LQ9A 1CC7A 3DDIA 3IBCB 1RU1A 1P8GA 1TL7A 2IAJA 2R4FA 3D6MB 3K2YA 2QRRA 4CLUA 5JVGQ 2YNHA 4AL7A 4YY3J 5FDLA 1OSDA 4HDHA 3T41A 2MXYA 4DX7A 5KFCA 5HP1A 1PO6A 2C42A 4C4WA 3KK3A 2PMZD 1YDLA 3UDVA 3CJ4A 1VQ9S 5B09A 1QJHA 1IWAA 2QA1A 2VPWB 3OL6A 3DDNA 4LRAA 4V1Ak 3PO4A 3KMQA 1FJGF 4XTTA 2LEBA 3D6HB 2FY8A 2I2YA 3VAGA 4OMFG 3HXMA 1X31C 2C2KB 2RU9A 2DGXA 4NA3A 1SJRA 5B0GA 4F0KA 3V6HA 4KJIA 2KJWA 3SFGA 5KFWA 4O3RA 2R7UA 3MCSA 4BS2A 1P1LA 2PA3A 2W24A 3ZTPA 4Y00A 2Q43A 4P6QA 3FEYB 4BWMA 4ETXA 2B56A 2D3ZA 3I9V9 3EZ5A 1D9FA 2ZD1B 1H98A 1RP5A 1OY8A 3ZNJ1 4HR2A 3MM9A 2KT5A 3W2WB 1IKXA 3I5BA 4TKTA 4LBIA 3N6LA 2DPJA 4J7CA 3VHQA 2QGFB 3SCKE 4A4JA 2AJQA 4PAAA 2OJ3A 2WAQD 1KHVA 4A46A 2U2FA 2GS8A 2PI5A 3IAM9 3SYZA 2KFNA 3KLGB 1CJUA 3S6EA 3UNYA 4UQTA 4NYOA 2R7XA 2V63A 1U0HA 4Y28C 5KTQA 2CJXB 5AXLA 3M8YA 4NLOA 2LEPA 3KJVA 2WOMB 4OZNA 3GTYX 3C46A 2HBZB 3PM9A 2LQ8A 2V2ZA 3W5YA 2KYXA 3OFGA 2PI4A 2NR0A 2J7KA 1FNMA 1Y11A 2HURA 3FGVA 4GKKJ 2OPQA 1NKCA 1VJWA 4IH6A 3IFEA 2M8HA 2PFFB 4ZVHA 3RBEA 4JI8F 3H7HB 4CLKA 2V5HG 1KLMB 5GMEA 1KHWA 4Y0FA 4L3NA 3BKFA 2QA4S 3EGVA 4QWEA 1NK8A 5A8WA 2DRAA 2IRYA 2AJ2A 2MLXA 2QG9B 4DV2F 2MHNA 4ZPWR 4AE5A 3DMJB 3C2PA 3HVWA 4QQBA 4PWDB 3TUJC 3DHWC 4ZCKA 4CTAA 3MURP 1XC9A 5RUBA 2RH3A 1WOSA 4G1IA 4CLZA 2RSQA 4FDFA 5B08A 4DUZF 1S9FA 5CXTA 3SBMA 3W9JA 4KPYA 2E7XA 4JI0F 4PYAA 1Q4RA 3AXMA 5K8NA 2JVOA 3AH6A 2PA8D 1HQUA 5D0EA 5IFMA 1F5AA 2JLEA 3HD1A 1FK9B 4W4MA 2FJAB 4DPWA 3VZIA 4NWBA 5AXNA 1KP6A 1LWEB 1F9FA 1SBRA 2QN6B 2H48B 3OJSA 4HH1A 3M8PA 6FD1A 2EC2A 3NGDA 2VL1A 3JSBA 3QMQA 3D66A 4DBQA 2VOPA 1NLKL 3ZTRA 2IM0A 1WF1A 4FXDA 5E5NA 4Z7CA 4Z7YA 1U6FA 2XZWA 2LQJA 3LANA 2YKQA 4OYAA 1U1PA 1SIWB 1FFGB 1ZTTA 2CQBA 2XLIA 3CCMS 4KFBA 2HHQA 1MG7A 1A0OB 3PW5A 2LU2A 3SCIE 1A6LA 2MZTA 1UETA 4ZJLA 2FUG9 1NRKA 1CULA 1QUVA 2NS1B 2DXEA 2VFSA 1FEEA 1HNVB 1Q16B 4KAIA 4DMZA 2RQMA 4X65J 4FYVB 1WC5A 1HNWF 3FNNA 1TUWA 3ULHA 4C11A 4DPTA 3MFHA 4ES3A 4MKVA 4FYXB 1Y5LB 1J2VA 2LVWA 4L76A 2R7VA 1B0PA 1MSWD 1RT4B 5CHCB 1U1LA 1I51B 1BC6A 2RRNA 3BR8A 4LF5F 5LSLA 4LRBA 4ZCMA 3G9CA 2KHCA 1JLQA 2WW4A 2ZDOA 2DR9A 1U26A 2NCKL 2DO0A 2KVQE 3UCUP 1RTJB 2C3YA 4RO0A 2DH9A 2K06A 1N5TA 4KHMA 2R8KA 3FFIB 4B17A 5L38A 1J5OB 2ZZTA 1BQNA 5ETRA 4DR4F 3RAXA 3GIKA 5B0CA 1MROA 1RWWB 4OX8A 4DR6F 3PJWA 5IT9Y 1N32J 3BBCA 4OV6A 2F9DA 2CZ4A 3DC2A 2IBKA 1R6YA 1TU0B 5KG2A 3B6BA 4IG0B 3CULA 1Z1ZA 5A0YA 2HHWA 2CJAA 4ZP8A 1VQ4S 2KHDA 2I38A 1T03B 2VG5B 3QT5A 2XMAA 1U24A 3CJQA 4MIBA 2DR5A 4YMEA 1QSYA 3IXQA 1YZ7A 4LF8J 1EETB 3F56A 4G6VB 5D4LA 1NNDA 4ANCA 4CQ1A 1LV5A 3L7OA 1UPPA 2KG1A 3NAHA 4FF1A 4AL6A 3CJ8A 1FX2A 1CJKB 1KQKA 4F02A 2RD5C 2Z57B 4XDCA 4ZCLA 4WK3A 1NJXA 1RJJA 2CJYB 4FPRA 2YNGA 4V19J 4DL2A 2W1BA 1HARA 4Q2MA 4DR1F 4S0MA 1PC4A 2HLTA 2YX1A 4DDFA 3SQGA 5KAKA 1GTEA 3VVUA 3DLEB 3R5AA 3M9MB 1GX5A 3LPYA 4QW8A 1HA1A 1PIEA 1KTQA 2IMOA 4RJVA 1N4LA 3AQOA 1V5VA 5KFXA 5DGBA 4EEYA 1T05A 5BXIA 3UD4P 3MXHP 4F4WA 2CAJA 3I32A 3T5JA 2ZFHA 1VR6A 3JQKA 3HFKA 1VJQA 1JLAA 4G1QA 4DX6A 2X1FA 2X1GA 3GG1A 4USHA 1S6QB 2EG2A 2XSJB 3EZUA 4NLRA 3U02A 3WDOA 3PKMA 2B7BB 1JKHA 4O3NA 4C8NA 4ZLNA 4I67A 2FHOB 1TAQA 1S4EA 1NPKA 1WTBA 3NL0A 2JX2A 2HG4A 3TAMA 2CQGA 2YPYA 3GG0A 3S1TA 1XMQF 3MR7A 2N3OA 5ETQA 1TL3B 1RWVB 3OTOJ 2JOQA 2D7SA 2E1AA 2QYGA 1BWEA 1Y4ZB 1S1UB 1S7HA 2ZOFA 1KVJA 2A2CA 2XMVA 2YVSA 3CD5A 3AXKA 3IMQJ 4KGXB 4JBCA 1H74A 2CJBA 2PMWA 4ZPCA 3TA2A 1XMOF 1I6JA 3VAKA 2Y0BB 1O0PA 2JWNA 5A6WA 1I3OB 5AXKA 1VQLS 1IBLJ 2MB0B 4JV5J 3QAUA 3CJSA 1FWPA 3CF5Q 3CC4S 1FVQA 2AYMA 3FCHA 2OTJS 2ZBQA 2GFFA 4WKYA 3KNGA 3N6NA 1M1HA 1MNEA 1RT1A 3B4MA 3HX9A 5DO2A 1U4BA 3UNGC 3QSYB 1N6QA 5HJXA 4YQWA 5CYMA 1NPPA 2UXDJ 3IGNA 3V6JA 2HNYB 3AOCA 3BKUA 2L3MA 4RNOA 3JQJA 3HHLD 4CIOA 1X4EA 1S1TA 1EAYC 2J7WA 3NBPA 1CBKA 4C0HA 3CIMA 4F4ZA 1L3SA 2HS0A 3E8OA 5ADZA 1JB0C 3KKFA 3KUGA 5GAEI 4G65A 2Z2ZA 1K0VA 1IM4A 2GW8A 4P73A 4JYAJ 3EPGA 3H25A 2UVWA 2R2RA 2L9DA 4FNIA 2OELA 3EWGA 2JDJA 4JI0J 3UDEA 1HNXJ 4UOHA 2I0XA 3J7ZT 4DV5J 4IFYB 3AAWB 4DV3F 1TFYA 4MYUA 2AHOB 5CD4A 2IHR1 4DV5F 1S0OA 3EDQB 2ZWPA 3KLHB 1GQEA 2VFRA 4WTOB 4CLPA 1C4AA 4NLXA 1BMQB 2W2PP 2C2NA 2XMTA 2DIVA 4K7QA 4ECRA 1RHQB 2B4PA 2GCFA 3A8JA 4HI2A 4K0KF 2DHGA 3GFZA 4CLTA 2A6MA 2VG7A 2W2NP 2J76E 4U96A 5LSOA 4D3GA 3HKWA 4Q45A 3TAQA 3U27A 4CH0S 3CO9A 3LGMA 3M30B 4KKOB 5IM0A 4RU9A 4F25A 2YY3A 3NY0A 2L48A 4FYYB 2L08A 3GFHA 1XWLA 1NSQA 4L6V3 3K58A 1HPZB 4JI3J 1XNRJ 2J0XA 3JAMU 5FJ4A 2YQ1A 4NLYA 2PC6A 2D3UA 5EX3A 2R7TA 3CXCR 1SI9A 2KYZA 3TOQA 3QZ8A 3MI7X 3OLBA 2YNHB 5A0YB 2J9DE 3ISNC 5KFOA 1G7CB 3N79A 1BQMA 1Q8BA 4FVCA 5CZVA 4ZMMA 4ILLA 2AEMA 1JIHA 2V0NA 3U1NA 1F2GA 2DCUB 1KR4A 3BN4A 2BXJA 4ZOSA 2XS2A 4JV5F 1MU2A 1WSRA 3DDKA 2MQMA 4ITSA 3R7SB 2K3KA 4PG4A 3VAFA 1UVLA 1B4SA 2QZ8A 1HHQA 4DR2F 1R0CB 2W9CB 2B3TB 5KG7A 4F2SA 1FXDA 4HT7A 4X84A 3DRRB 5A8RA 4HKQA 3I5AA 3OPKA 3GV8B 3AD8C 2G13A 5F8IA 1QAYA 4DSEA 2ASJA 5DM7Q 1VQNS 3HMJG 3M8QA 5J2QA 7FD1A 2Y1IA 3A3NB 3DLEA 5CA5A 4UT4A 4JI7J 5IXUA 3JSYA 5KT4A 1ZOTA 4AYBD 1RTHA 2ZUGA 1QE1A 4KIAA 4DQIA 3GCWP 3UI3A 4CH1A 5K8MA 2F65A 2HS3A 4RR5A 4J9PA 1M5PC 1E6VB 4NASA 3W2VB 2VA3A 3P3DA 3EGWB 4I2PA 4WE1A 4I1TA 5E3QA 3IO1A 1RDRA 4R5PB 2IMWP 1GFWB 1SIZA 3AB2B 4X66J 4DCJB 2MSTA 4A8QA 5B0FA 2MTLA 3GJQB 2I5JA 4U9RA 1SVDA 1Q5VA 3NMRA 3WIUA 5HATA 1TQLA 3QGIA 3Q86A 1FNOA 4IG0A 2MQPA 2RAQA 4LRFA 4OZ1A 1RT3A 1X7VA 1SL1A 1S77D 2OO4A 5K5MA 5KG1A 2DIUA 1MWZA 1WTFA 3DOMB 4FKYA 5DDQC 5IQQA 5F8MA 5C7PA 5KFKA 1WHVA 1C0TB 3AA9A 1C1CA 3G87A 4PXEA 4DV6J 2KZMA 4QBUA 3KLEA 4NCGA 2FC9A 1VQ7S 3QO9B 4NA2A 4CM0A 4MFBA 5D4NA 5DZ6A 4DXLA 2VHGA 2BDPA 1RAHB 3RAQA 1AT1B 1VRUB 3ZZTA 1M1GA 2BRLA 2CNLB 2MQ8A 3CJ0A 3GJSB 3THTA 1HQ2A 1RT3B 2XHWA 4Y2IA 3MECB 4K0KJ 3D5MA 2V67A 3GZ7A 4DQRA 3DRSB 1HD1A 2CPHA 4CO1A 1ZM4A 4I2QB 4QOTA 5A8KB 1NU4A 5EUHA 4X4OA 4DR3F 3ZXWA 1KBRA 2MLYA 3B54A 4OHYA 2X3DA 4PXDA 2XG8A 1F6TA 3VQSA 3W61A 4DR4J 4BC9A 2AYBA 2ROGA 4RKUC 3POTB 2DR7A 1OS5A 1LK7A 4NRUA 2UXCF 4EZ6A 5KFAA 1XJWB 4DN0A 2ZBIA 1CSJA 4I6YA 5K14A 3VAIA 3DCAA 4KV8B 4NXNJ 2I9SA 4DL0C 2QX0A 4DS4A 2VUGA 3DXBA 2BE2A 4PUOA 3QATA 1H2UX 2XMUA 4PWWA 4C8MA 1U1NA 2DGVA 3QIPA 4ED6A 2BJ9A 3I0RA 4XDDA 2B9WA 2KVIA 2IY5B 4BBYA 3P5TL 3PYFA 2V50A 1PCAA 2BYCA 1U1KA 4M94A 3G2XA 4IH7A 1GEHA 3GIIA 1REGX 1JQGA 1OMSA 5IT4A 3AQPA 3GIRA 2WVDA 3I0SB 4X4QA 3NOCA 3T1HJ 2UUCJ 4OHWA 2HWHA 3SEOA 5KFGA 1R0BG 3M8RA 3BQ2A 4DCOB 3Q8UA 4NE9C 4PR6A 2B5JB 3OBIA 3W66A 1X4FA 3IRXB 4J9UE 2YKMB 3CMAS 2ZOMA 3SQGB 1XMOJ 3FZ2A 2I1RA 2M70A 2VONA 3CCLS 4LBPA 4H4OA 2PN6A 3TARA 3R5BA 2MSSA 3FRZA 2AJ0A 5T14A 4AD6A 2VBWA 3CCUS 1U6ZA 2RF2B 4RW4A 5JUMA 3TO8A 4QZVB 3C16B 3D9BA 2ZH4A 1VLOA 2EFPA 2MPUA 3RUBL 4A8SA 1SB6A 2H54B 3C8YA 3DRPA 1N36F 3T6BA 1TL1A 3VGVA 3T5HA 1HBOB 3BGLA 1SXLA 1T3OA 4ZKAA 3PW7A 1URRA 3NNHA 3IGVA 1WC1A 3UD3P 3R6LB 2YH1A 2G9OA 3H8YA 2CZ9A 4BHQA 4DZDA 2KT2A 2W01A 1Q86T 2CWKA 4OX9J 1EB0A 1WEXA 3IAS9 1T03A 4EU0A 4HHJA 5G4DA 1XNQJ 3DI6A 1S0NA 4DUZJ 2B4UA 2K3IA 3OHAA 2ADBA 2P2CB 1S9EB 2LEAA 2CQDA 3FQLA 4UZBA 3PIOQ 4J9LA 1U8SA 4KGVB 3KMSA 4I56A 2GZOA 5HL7Q 2CPEA 1V9OA 2CPIA 3ET6B 2JNJA 3BO3A 3NKYA 5D77A 2FHJA 3G6XA 3AFGA 1TL5A 1WC4A 1RUSA 2OMLA 2GIFA 1BGXT 2A10A 3BH6B 4OJ1A 4NA1A 2ZH3A 4DSFA 1I94J 1HR0F 1RACB 2GHWA 2IFXA 3DXSX 2CQ3A 4DUYF 2AW0A 2JEFA 4OYBA 1NHUA 3CWJA 1NKEA 1DTTB 1NBEB 1FRJA 2P6TA 2XY7A 2OAUA 3M2UA 2GV1A 4F0MA 3NCQA 1SJFA 3PO5A 2N7YA 4DZ6A 2NZCA 5D4PA 1F3FA 1X4DA 3CDWA 2DNZA 1ZPVA 3R5CA 1UTAA 3LUYA 1SC3B 4USVA 4I7FB 4CO3A 4OX6A 5BR8F 3MM6A 2HRUA 1WEYA 5ETMA 2XC9A 1VRTA 4TNOA 2M9KA 4MKAA 1AFJA 3D0HE 3K89A 2ZJRQ 1RTIA 4WBFA 2MQOA 1SKRA 4KHPF 1T8EA 3GPAA 5KFNA 2MLZA 2CPXA 1DARA 2D3OR 1RHJB 5I4MA 4IDKA 3BH7B 4O44B 2E5IA 5F0UA 2K7JA 3QIPB 4I7FA 1VQSA 4F26A 2RUSA 1C0UA 4ZVSB 4JI6F 1XIQA 3HDSA 4DU7A 4ECUA 3RRHA 3CC2S 5HLFA 2CQHA 2HZVA 4DWIA 1WOPA 4KRWA 2HGLA 2R7OA 1GMUA 4L3KA 5THWA 2NYIA 1IUJA 1RHKB 1VC5A 3QLHB 2NUHA 2C28A 2EBEA 3GYXB 3LQVA 3IR7B 4XK8C 3BSCA 1IWGA 3T1HF 3CJ5A 3PCOB 1LW2A 2J9EA 2P9CA 3LP1A 1R8AA 2MY7A 4M5GA 1TTHB 1VDHA 2V2QA 2ZITA 1S72S 1KVKA 2Y1LB 5J2MB 1NAQA 3H5UA 3N28A 4ES1A 4QR1A 5DG8A 3GIMA 3SCLE 3KFWX 1S6OA 2UVRA 2HFOA 1WC3A 3HLUA 3K7RA 5E33A 4CLWA 4LIRA 4B3TF 2MMYA 3M1VA 3MFIA 2RDIA 3K8WA 2BKOA 3R2CJ 1T95A 2HW3A 4M5NA 2BBEA 3K5OA 1FF2A 1Y3JA 1UFWA 2YQ0A 4UQGA 1T7PA 3CEDA 3G82A 3OV7A 2VBXA 3CD6S 2MHEA 2Z0GA 3Q22A 3RBDA 4RBTA 1RT7B 3OFEA 3CT9A 2M0GB 3CDAA 4Y2KA 1SUQB 5DETA 2DHAA 4DPUA 1OPZA 2VPYB 3HVTB 5J2PB 1AUDA 1SC1B 2KH9A 3EVOA 2XLKA 1NZ8A 2I6WA 1DHMA 3KTQA 4ED5A 3SSRA 4K4VA 3OHBA 2DY9A 4KO0A 1JLCB 3BSAA 2DNRA 2DD8S 3OFFA 3PYDA 2MKIA 5L9XA 5L1JA 3IWLA 4P9SA 4ECWA 2B8QA 4LSNA 2G1DA 4P71A 5HBMA 3M8SA 4B9SA 2HQ3A 3UR3C 1NSPA 2RQKA 2R2TA 1IKXB 2G0JA 1OWXA 4IFVA 1AZSA 1JJ4A 3H20A 2YBVA 3SDEB 1JNZB 2V8GA 2DNMA 5L1LA 3PRBA 2BA9A 2YKNB 3MD3A 3VF0B 2DBBA 4CLFA 5HSPA 2QTWA 4OJGA 3UN5A 2K8GA 4O3QA 4LFAJ 3HJFA 1ELOA 1RI7A 3TVYA 2J6SA 5HLFB 3NRBA 4ZVEA 3A3PB 1N6QB 2GQCA 3EX7B 1ZAWA 3EMTA 2P9EA 1SJQA 3B82A 2JH3A 2HHVA 3AJ1A 4YB6A 2O66A 2V9KA 4Y2CA 1RBAA 2HWTA 4HEA9 4JB8B 1Z2LA 2UUBF 2QMXA 2ZKTA 3KK1A 3VQTA 4DSIA 5KFQA 4KE5A 2M8DB 1TKTA 4ZCIA 4QU7A 4IOBA 2CNKB 1PILA 2DH8A 2GGPA 3DGPB 4LRDA 2DO4A 8AT1B 2UZAA 4MIWA 4URQU 2C22A 2HAFA 2HFVA 3BGRB 3V4MA 4F3OA 2GA7A 2HGNA 1X8DA 2VDHA 1V6HA 3EDRB 1IM6A 2R7RA 3R8YA 3LWLA 1RHRB 2HHSA 1BLUA 2K2PA 2FDNA 1HW8A 2H9ZA 3HHEA 4C9DA 3H5SA 2EKYA 2W2QP 1TL7B 5K20B 1WOOA 2DXFA 1FO1A 3IN5A 3LP2A 3QYYA 2R7WA 3VAHA 3ITHA 4JYAF 1TL1B 2HQDA 4JI4J 1UWBA 1HBMB 3Q8RB 1N88A 3DU6A 2KZZA 3QIDA 1JK9B 5KOXA 1YHQS 1BQNB 3UDCA 4DR7F 2PDAA 3LALA 4J37A 2DHSA 3I82A 3QO9A 3NGRA 3BN7A 3ZZ0A 2PE8A 2VA2A 1AFIA 4HVZA 2KM8B 3RB0A 3L9ZA 2EC0A 1TL4A 4HH0A 4LF5J 1CEZA 4PCQA 3T19A 5KFEA 2MZ1A 2G0IA 1UW4A 2A3JA 4O4RA 1M0SA 3T9ZA 3MAAA 4HTJA 3S7RA 5EWEA 4A8MP 3HULA 1VS3A 2KRRA 3EYZA 3VV2B 1IR2A 3BO4A 5KFVA 1VMBA 2C2DA 2AJ1A 3RZAA 1S7IA 2MJNA 2X51A 5G0RB 1K1QA 2OPSB 4MJKA 2GAGC 3HO1A 1G4CA 4QJVA 1IXKA 1RWUA 2ZOGA 3W64A 5F8GA 4ZP6A 1S99A 4C2MA 1GNKA 4FBTA 1H2VZ 3G8TA 1RT2A 4E2FB 1NSAA 4DFPA 1Q82T 3QJPA 1XK8A 3ISND 8ATCB 4NYPA 4YDDB 5KFBA 2A0FB 3CCES 1S97A 2K1RB 3MHYA 4H4KA 1U02A 2CPFA 3D4JA 4TY8A 5HN0A 2UU9J 2YWEA 3M8QB 5J2QB 3MECA 1VI7A 3OL9A 3GWCA 1Q5YA 2CKWA 1RT5B 3MR6A 1G2EA 1IR1A 4N8OA 2BW7A 3GR0A 4XIUA 4GO5X 1H7XA 3DM2A 2R42A 2UXCJ 4RPFA 1FESA 1R6VA 3NGSA 3GYNA 3TYTA 3U1LA 3IG1B 4ER8A 4JI1F 4G3IA 1Y5NB 2QEXS 1EZZB 2O01C 4RBVA 4OYZA 1FDAA 1K9MT 2BZ2A 2LXFA 1TV6A 2HQGA 3FCVA 3JTPA 3CC7S 1JLEA 5DQHA 4J91A 4F04B 3J7AN 4F3QA 2E44A 1K73T 2C3PA 2QLFB 2Y0SD 1RT5A 1WELA 3AJ2A 3L09A 4LR7A 5HI7A 3KUHA 3X3UA 5AE3A 3LP2B 4E8UA 3TAPA 2UUBJ 1LQ9A 2NXJA 4DR5J 4TY8B 5D8HB 2P9GA 1V3ZA 3D1HA 3AOBA 4W98A 1YWXA 3FRYA 2VF3A 2J9CA 4LVNP 1T11A 2BJ8A 2POKA 4OJHA 3TUZC 3HP6A 1TKXA 2VJUA 2DKOB 2WOMA 3A8KA 1RT6A 1ZPWX 5K9FA 4P7VA 2HS4A 3R3TA 3I4HX 3D1OA 4CYUA 1H0HB 5DJBA 3VZHA 4NLTA 4HI1A 4ALZA 4X4SA 1IR0A 3KLGA 2IPOB 4B9LA 1ICEB 4LSLA 2JEIA 2AT1B 2PEBA 3BBBA 1UAWA 3DOKA 5CZXA 4YR3A 4C48A 4NXMJ 4NLGA 2K7KA 3CJTA 3IA0A 5IOLA 4U8VA 3UVJB 2XYHB 4ZJQA 3QRQA 4GC6A 1EP4B 1NJWA 1N0UA 1F2HA 1BWVA 2M88A 3FBCA 4D3HA 1JLAB 1N5VA 4G1QB 4B3RJ 2UXDF 3JXOA 5KG4A 5E3RA 4C8KA 2QO3A 2V94A 5E2QA 1UA0A 1BXNA 1ZZFA 2H4WB 2BOPA 1NZAA 5ETSA 3BEGB 3SMZA 1IBCB 4P2FA 2BJ3A 5DG7A 4FNHA 4LSNB 3OTCA 3J7A1 1KFDA 4ZA1A 4DV4F 3KJNB 4LFCJ 4LT6A 2F63A 5EX0A 1NB2A 2XYPB 1MU2B 2FB0A 4FVMA 2XCAA 2PIIA 2X7IA 1XQIA 1FCAA 3TR5A 4RWXA 1QM9A 5JXSA 2DNQA 2HNDA 2RMLA 4QPTA 2KXNB 3L3CA 3E01B 2ZKUA 3OXGA 2E1RA 5U47A 4BLGA 1X4AA 2QL9B 2XHCA 3OTBA 4I68A 4KPCA 4QIFA 3BPSP 4U95A 1YRTA 2W7OA 1KFSA 1RT1B 2D74B 1NH7A 2FPHX 4ILRA 5B7WA 3Q0AA 2ZE2A 4ZVTB 4N41A 3D1QA 4WK1A 2MKKA 3ZTSA 2XS5A 4CH7A 5GAEU 4HLBA 1ZYQA 3KK2A 4TY9A 3H0PA 3KLFB 3POTA 2J0SD 4J9MA 1SKUB 1S10A 1S1VA 5KFDA 4Y2AA 2AZ3A 3WC0A 4M8LA 4ED4A 2C2ZB 2IA6A 4NCGB 1LW2B 3LP1B 3LTOA 1SV5A 1F9EB 3R97A 3HFZB 4DG1B 3CMQA 8RUCA 5KFYA 5A8WB 1YJWS 4KHRA 3A1YG 4YOEA 1B3TA 2DR6A 4RL1A 2AGQA 2XO7A 1FDDA 2E9ZA 4EFAC 3FSIA 2LXIA 2V2VA 1KOHA 2ZJPQ 3GSDA 4MKYA 2DNYA 3M8WA 3P96A 3EGZA 2VB6A 2AGOA 2V8PA 4YB1P 4X62F 1FJ7A 1FTCA 5LXRA 5DDRC 1JKHB 3EE3A 5D3GA 2I5JB 4P2MA 2XYGB 3BGUA 1TR0A 4WIIA 3TUIC 1I1GA 1RLDA 2JRSA 3HPOA 4IKAA 2FVRA 2NREA 4JI7F 3JYTB 3TX0A 3FEZA 4P10A 2ZWOA 1DQAA 4QIGA 4ZHRB 2VU5A 3NP5A 1YI2S 3MR2A 1YIJS
chains in the Genus database with same CATH topology
1IKYB 4EBCA 3VAMA 5G0RA 1NK7A 4W90B 4PQUB 1QE1B 4DL6A 5EN1A 2OMOA 3DOLA 2BABA 3G6YA 2XMWA 2NXUA 2ILZA 1RYRA 4OHVA 1IJFB 2M4MA 2ZD1A 2M7SA 2EBGA 3R27A 1AFIA 1YJTA 3DNCA 1U2FA 5C24B 4B3OB 4FZVA 1LWFB 4YFUA 4K50A 1HW9A 5LSRA 1UFLA 1BC6A 4C97A 4TU9A 1UMJA 3LP0A 3GIJA 2FC8A 3HZGA 1IKWA 4ATNA 2WSCC 2W9CA 2GMJA 2Y1JA 4A47A 5M2RA 2F8EX 1D9AA 1YVFA 2GQ2A 3DYAA 5J1NA 3Q8PB 4M95A 1U1QA 3DLHA 5LMUF 3J7YU 4RNMA 2R2SA 2ZH6A 5HMWA 1SJ4P 3NGKA 4X4UA 3B78A 2WHOA 3IRWP 3HM9A 1YGYA 1E6YA 4F4YA 2H5EA 1C0UB 2OPQB 2E1CA 1TUVA 4C3MA 3AA8A 3K5NA 5HP1A 4WU2A 3T6JA 1NHVA 2F1FA 2W9AA 4DV6F 1PSDA 1S1XA 4RW6A 2Z4PA 1QSSA 3C6UA 2PD1A 4RUHA 1LK5A 4K4YA 3NNAA 1MMNA 2OIHA 1SJ1A 1IJEB 4WFNQ 5KFIA 2J8AA 2VG7B 3ZZYA 4YUDA 1FNXH 2IVMA 2ZHOA 1VQOS 2FLNA 3MM7B 1DFDA 3LOUA 3PKYA 1RK8A 4FXVA 5GAGU 2JC1A 4J9NA 1G1XA 2CQ4A 3UDLA 2G4BA 3L7PA 2MYFA 3BREA 1S1WA 3HF5A 4Q0BB 4RZRA 4OI3A 2ERRA 1TL3A 5FD1A 4C98A 1VIXA 3PV8A 4N77A 2ZZNA 4IRCA 1KLNA 3GILA 3RR8A 2CVIA 5AE2A 5L1KA 1ZM2A 3GMGA 3RU0A 1EP4A 1OPIA 4FP9A 3PEJA 4IRKA 4UW2A 1YSJA 1VLYA 2CQ0A 1KTVA 1ZM9A 2DNLA 1KOOA 2DNKA 2RT3A 4IFYA 3KYLA 4LF4F 2RKIB 4N47A 3KLIB 3OUYB 4DFKA 1MWYA 3JYTA 4OI0A 1S9EA 4JV2A 4B3MF 1KEKA 5CYQB 4ETZA 2HHTA 4LVOP 1C1BA 4ELVA 4OZ5A 1UJ5A 4DQPA 4KT0C 5CYMB 1VQ5S 2XS7A 1KN6A 5HP1B 1Q53A 2FHJD 1U6BA 2KB2A 2NQPA 2CPDA 4B08A 1SC6A 3B4DA 3K59A 1HBOA 3M2VB 3GFYA 2DNOA 4C3KA 2FHMA 1UP1A 2YQ3A 2KG0A 3MM8A 2E5LF 1QUPA 2P5VA 3WX4A 1YQHA 3MM5B 4PRFA 4QW9A 5GAHU 2EFOA 3RR7A 1HMVA 2YNIB 3RB4A 1D8YA 4CI0B 3NCRA 3NCPA 2ZZMA 1X5PA 3QAEA 3DLKB 4PG7A 4FF3A 1C1BB 3KHHA 1L3KA 2F3JA 4QWBA 2FJBB 4RW8B 1OO0B 3I0SA 3CCTA 4ED7A 2A2DA 1Q79A 2V8DA 5B0DA 5EGYA 4C7QA 2F40A 2V4JA 2Y1RI 3M32B 2M2BA 1B0VA 1LOUA 3DOLB 4I6WA 3DRYA 4EYIB 1YJVA 4IYQA 3BR9A 2ZNYA 4R5PA 4EWTA 4WCEQ 1WG4A 2E1MC 4QPXA 4DL7A 2CRLA 2N7CA 1S6PA 3GV5B 4ECTA 1N5YB 4TU7A 1VIOA 5KG5A 3D0GE 4OV1A 4TLRA 1N48A 3G6ES 1VRTB 3FQKA 3CCVS 4C11B 3OL7A 2IM2A 3TANA 4RW9A 2UU9F 2XNRA 5BYQA 4V19X 3MM6B 4DR5F 3SI8A 5DQIA 1T05B 2NUUG 2CYYA 2MKSA 2ZH7A 3T3FA 3MEDA 1KNZA 1JX4A 5F3ZA 2Z2LA 2W8LA 3PACA 3HHLC 2YWGA 1CLFA 1WF2A 2D9PA 2ZH1A 4CT8A 4Y6IA 2ZVSA 3OJUA 1TKDA 1SV5B 1S1XB 4RW6B 4DEZA 2R8IA 1LKZA 2ROEA 2VPXB 2WK4A 5IS2A 4K4SA 3CVKA 4YB5A 5C25A 2Q66A 1FDBA 3MOJB 1JXLA 1JLGB 3H5XA 1NO8A 3HK2A 3NLCA 2HHUA 1F60B 3OR1A 1REVA 3C3LA 5KFSA 4NOHA 2RJZA 3I87A 4HDGA 3D54A 4DLGA 1WG1A 1S9GB 4PWUA 3VAJA 1B0TA 1Z4UA 3B8HA 2KO1A 2QLWA 3WC2A 5C25B 2OD6A 2JHEA 1RA6A 2RNEA 4RNHA 3TRGA 4EUVA 5EWGA 1HQEB 2W4DA 1D3WA 5CD4H 4A8WA 4PWDA 3W2WA 1VQMS 2DGQA 3MMCA 1HHTP 2DTJA 3FMWA 1A7GE 3QZ7A 2VPZB 2R8GA 1MROB 2VH7A 1JLEB 2J5AA 2DGOA 3ENVA 5F3TA 4NMLA 2E5JA 4HYKA 2FVQA 1F0XA 1Y3KA 2V4RA 1P9QC 4M63A 2RDJA 2N4DA 3DM2B 2HAIA 3IRXA 2VQEF 2BANB 5HQ8A 1U45A 1FJCA 2OP5A 3RRGA 3F44A 2E5GA 3EUNA 4QIVA 3ZZRA 1HNIA 2ZDPA 2FY1A 1U47A 4FXWA 3DRXA 1GT8A 3CJKA 1SL2A 3FJ2A 4ZPTR 1JLBA 3KHLA 1BD6A 1VQKS 1KVIA 4KR0B 4B3SF 3CDUA 2GHPA 2DPIA 4TQSA 1Q8LA 2O5DA 4KB7A 4LSLB 4DR4F 1GXTA 3CCZA 2JLGA 1HBMA 1YJ9S 2IC3B 2IJNA 1XR6A 1S76D 3GFXA 3UR0A 4J9QA 2OH2A 1XNRF 1W25A 4UOCA 4XPCA 1HYSA 1SKWA 2HGMA 2WB4A 4OL8A 3SV4A 2VFTA 3BDPA 4O3PA 3OTOF 2FVCA 3FEXB 2RILA 2IRXA 4BCAA 3M4XA 5AE1A 1X9SA 1JWWA 3M05A 2W7AA 3V81A 1IBMF 1OIAA 4NCAA 2X1AA 1Y9OA 4ECZA 2KRBA 1JLFA 1LFPA 1TAUA 3CJ2A 2AYEA 2BW2A 3T1YF 3DLKA 3ZFVA 2EW9A 1H6KX 4R25A 4A8XA 2HNZB 1M5PC 1TV6B 3EXYA 3L95X 4MFBB 4QR2A 5DQGA 1C0TA 2DGWA 1VHFA 2WSEC 2Q3PA 2GC8A 1UWBB 3AHPA 4ZHRA 4LF8F 2QSWA 5KG3A 4BC7A 3M6WA 5KFLA 1FD2A 4LJMA 1N32F 3BM7A 3U7JA 4J5OA 4X4NA 2QLXA 3KNAA 4FYDA 1X4BA 5LL6d 1IKYA 2KT3A 5BYRA 1F5CA 2IRUA 4WJBA 3PFEA 1XTZA 4LF7F 3ZZZA 4F50A 4N56A 3WZ0A 3WBZA 3J7YI 3OVBA 3PW0A 1WD6A 3ZZOA 3UPFA 3TVZA 2RKIA 4K5RA 3OUYA 2QFJA 3KG1A 3H4DA 3HVAA 3KG4A 1R89A 1K8AT 2MDAA 3PEHA 3MGJA 3RRKA 4NRTA 4Y65A 4OX9F 1QTMA 2WRMA 3MEKA 5E0OA 2FVSA 4NZ6A 2LLZA 1MW7A 2KFYA 3VR1A 4HL9A 5J2NB 3ISZA 1JLFB 1FRIA 1UVIA 4DG1A 3KK2B 4IOAQ 2D9OA 3V81B 3UE2A 4BDPA 1KC8T 2CJQA 4PXBA 3S8SA 3SCJE 5L8RC 2C3MA 4NYZA 4O3SA 2HVIA 2XNQA 5I42A 5KFMA 2BQRA 1S9GA 5B0BA 3CCSS 1KD1T 2HYIB 1ZAXA 2VASA 2JEGA 4HT5A 5J2PA 4NLQA 3IBWA 2APOA 3UCGA 1H2TZ 4NZ7A 1R8PA 2V8VA 3OR1B 5KFRA 2AQ4A 4NLDA 3RW7A 4ELUA 3N5BA 4ZDNA 1RQ0A 3R1LA 2JJ4D 3MTKA 2HWIA 1YJRA 2EFQA 1M1KT 3V4IB 5AXMA 3US5A 1LWCA 3M9OB 3BGRA 2V8HA 1R0AA 1FTRA 4OIXA 1KSPA 4NLUA 4EYHB 3O1LA 1M5SA 2CZVC 2CFXA 1GAOA 5M2PA 4MKBA 4LQ3A 4YHHF 3W3SA 4FN5A 2C3OA 2IJFA 2KM8C 2RIJA 1L3UA 2OPRA 1VQ6S 2O67A 5EDWA 3H40A 3PX6A 1B7FA 4HTIA 3SSSA 2AX0A 1RT2B 1SQEA 1UKUA 3I96A 3G6VA 3M2UB 4RW7B 4ED8A 1T3NA 4QIEA 4IQMA 1EETA 5HMYA 5KFHA 2BUNA 4FS2A 3MMAA 3VTIA 1XNQF 4DF8A 2J6UA 1FE4A 1TZ0A 4H4KC 4PUOB 2N4CA 5IZHA 5DM6Q 3MR3A 3DLGB 5H1SV 2KN4A 4NLVA 4Z37A 1RTIB 1G6BA 4Q8EA 2ZC3A 4ID5A 1S48A 4B02A 1URNA 2B6AA 2CPYA 1REVB 1SUQA 2IM1A 4U7UK 3PR5B 1WHYA 4OHXA 3CSKA 3IS9A 1UL3A 1AW0A 2AYGA 4O4GB 1NK4A 1HMVB 2GX8A 2YNIA 3GB0A 4ZVGA 2IBOA 1X0FA 2KXFA 3SZ2A 4ICLA 1ZETA 2F4VF 3V6KA 5H9FJ 4IR1A 3V6DB 1UVJA 2JC0A 2HHXA 1UJ4A 3LGNA 3Q8QB 1R8CA 3EGNA 5KT7A 1X4CA 1ZM3A 4EO6A 3QGHA 3IG1A 4GKJF 4K4UA 3PY8A 1KQFB 4AXIA 1M90T 5CYQA 1WI6A 1DBDA 4YP3A 1U1RA 1M5VC 1QAJA 4I6AA 3DI6B 1VQPS 2VC0A 4X4RA 1RKJA 3BGFA 1N5YA 4K2XA 1LXNA 4IO1A 4YY3F 1HI8A 4C3LA 4X4VA 3H2LA 4NLSA 4TYBA 2D41A 1L3VA 2J6TA 1NH8A 3BSOA 2UUWA 2NSBA 4Q8FA 3NG8A 2M52A 3I5CA 3PNIA 4Y34A 5F8JA 4H54A 3FDSA 4OFZA 2FJWA 1VK8A 2COLA 2QV6A 4ECXA 2BQ3A 1AROP 5DGAA 1YRUA 2PEHA 1X9WA 2Q6CA 5KOWA 4Y3CA 2EFVA 1JLCA 5L1IA 3PFOA 1CC8A 1SH3A 3QGGA 4NX9A 2VKZG 4EZ9A 2W8KA 5A6PA 1S0VA 4TLQA 1KLMA 1XN9A 4ZP9A 4OQJA 1FERA 5DRKA 3OFHA 5IWAF 2BOPA 1YJUA 2J9DA 2UV8A 2VQFF 2JZ5A 5FDLB 5J1PA 1C4CA 5C42A 1XMBA 2MZRA 5T7LB 3SSQA 2GJIA 5D6GA 4EEYA 3H5YA 4A8KA 1NK9A 2V2KA 3DOMA 4WXOA 4DSIA 2XMJA 1JJ2R 4X66F 3CCWA 1NEEA 2HPUA 4MH8A 1FK9A 1Q7YT 4DPOA 5K14B 3NAIA 4ID5B 3VALA 4DSLA 1HQUB 3BDEA 4RW8A 1RT6B 3FVYA 3G71S 2CPZA 2WONB 4MAKA 1IKWB 1HPZA 1VQYA 5C42B 2HZCA 5BJRA 4Q44A 4JV1A 3NNCA 1BQXA 4KKOA 4F3MA 5IM0B 2GIQA 3C66A 3MM5A 1P27B 4ECSA 3G86A 2HRYA 3M6UA 1HHSA 3N4WA 3O8WA 4WFBQ 3G4SS 3N6MA 2LMIA 4NXNF 3F73A 2VODA 1FDNA 4Q7AA 4USIA 2RF2A 3TW0A 2XMMA 2EFGA 3OQ2A 3LWMA 3CCRS 5E7OB 4N8NA 3J7Z5 1PC5A 2K1RA 1WHXA 5I3PA 1TVRA 4IDKB 4O44A 4RW9B 4DF4A 3D2WA 2B6AB 3QWPA 3OTDA 1F5BA 3LH2S 1UJ6A 2LXUA 1LXJA 3AY0A 4F4XA 2NZ4A 5DLFA 4FF4A 1R27B 2VC1A 3PDNA 4DX8H 3PR4A 5LXYA 1FRLA 2V4QA 4RX6A 1FRMA 2MQNA 4H4MA 4LFBF 3I0RB 4J9SA 1XERA 4IR9A 2U1AA 4I4BA 3DOKB 4QWCA 1QVGR 1M5OC 4UUXA 4JOUA 4LIWA 4I2PB 4WE1B 2J0WA 1LW0B 3K57A 5JVHQ 4OJ3A 2BR0A 1NB7A 3DYAB 4CNYA 2EK6A 3MPYA 4I69A 1U49A 2XI3A 1HD0A 1WI8A 2Q79A 4WFYA 2MGZA 4QCLA 3IR6B 3DLLQ 4UY85 3SXLA 1WACA 4LUBA 5SUHA 4R8UB 4A8FA 1SH2A 2F9JA 3CUNA 2X1BA 3IWXA 3HZEA 1LW0A 1CVJA 4B3OA 2PGCA 2CQPA 4ZPAA 3C6UB 1FHTA 2JEJA 2YKPA 5I3UA 5KFFA 1S49A 4QR0A 1V3RA 3I6PA 5KT3A 3HHDA 1HYSB 2PO4A 2OPPB 3HT3A 3M2RA 1TKZB 3W7BA 2HFZA 3MD1A 1FVSA 2R7QA 4X4PA 3MMBB 2Z2MA 1DLOA 3MPVA 1DAXA 2LCWA 5HROA 1Q7LB 4KGMA 5KFTA 1BQMB 4WZQA 2JFDA 4JUZA 3V5RA 3OLAA 1GH8A 3KLVA 2ZBCA 4C0OC 4RW4B