1KVIA

Solution structure of the reduced form of the first heavy metal binding motif of the menkes protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
MDPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the reduced and Cu(I) bound forms of the first metal binding sequence of ATP7A associated with Menkes disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 13
structure length 79
sequence length 79
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2002-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kviA00
3BN7A 3GZ7A 5B0GA 3FMBA 4HI1A 2ACYA 1ULRA 2IYGA 3LGMA 3QMQA 1K0VA 1CC8A 1Q8LA 2FTRA 2RU9A 1CPZA 2OKQA 1GXUA 1YG0A 2PGCA 2ZDOA 4Y2IA 1TL4A 2QIFA 2RSQA 1TR0A 2PD1A 3BR8A 2KT2A 3LO3A 1N5VA 2ASYA 2QLXA 2XMWA 3CJKB 2BYCA 1OQ6A 2BJEA 4HH1A 1URRA 2HFOA 5A6PA 4FNHA 3KG0A 2KT3A 2W4PA 3HFKA 3T9NA 2KKHA 3KNGA 4A47A 3HHLB 2N4CA 4EFAC 1FESA 2K2PA 4OJHA 2VV5A 1QUPA 2GV1A 1KVIA 2Q3PA 2KYZA 1N5TA 5T7LA 2XMUA 4YEAA 2HFNA 2GO8A 2G9OA 2L3MA 3DCAA 4Y2KA 2LDIA 4ZOSA 4A4JA 4OIXA 2FB0A 1S6OA 2GGPB 3BM7A 1S6UA 2RMLA 2XMTA 2CRLA 1OSDA 2HQIA 3HHLC 2FHMA 5F0WA 2OD4A 3BF4A 4DN9A 3KG1A 1X0PA 3HDSA 4Y2MA 1FVSA 1MWYA 3HF5A 4FNIA 1N5SA 1JK9B 2LQBA 2BUNA 2ROGA 1TZ0A 1V3ZA 1FE0A 1Q4RA 2IFXA 3MZIA 4OJGA 2VH7A 1KQKA 2AW0A 2N4DA 1YJTA 2AJ1A 2XMJA 1APSA 3BDEA 3VTIA 5B0CA 4OJ1A 5B0BA 3HX9A 2BBEA 1Y9OA 1Y3KA 2GCFA 3DXSX 2OFGX 3IWLA 2JDJA 3BGUA 1YJVA 4NPOA 3TOQA 1JWWA 2BJDA 4DPOA 1IUJA 1GXTA 2W4CA 5B0FA 3QGPA 3LGNA 4U9RA 3HHLD 2XMKA 3TRGA 2AJ0A 1P8GA 1FEEA 2QLWA 1Q8BA 1VQSA 2EW9A 3E8OA 2N7YA 4A48A 1CC7A 1U7LA 2FIUA 2K1RB 2W4DA 2OD6A 3HHLA 4QOTA 1OPZA 1SI9A 3IWXA 1P6TA 5B0AA 5IXUA 2GA7A 1VQYA 1X8DA 5B09A 1Y0HA 1FE4A 4DL0C 3F44A 4HL9A 1Q53A 2GGPA 1YJRA 1YRXA 2QYCA 2LXFA 3MCSA 3I9ZA 4F67A 1FVQA 3FGVA 1KVJA 4OJ3A 5A6WA 1TUVA 2OMOA 2AP6A 3CJKA 5KAKA 5B0DA 5B08A 2ZDPA 4YDXA 4NL5A 1AW0A 1N5QA 1Y3JA 1X7VA 2HIQA 2OP5A 4A46A 2HLTA 1WD6A 2ROEA 4ZA1A 1MWZA 1W2IA 3UDCA 3WDOA 1R6YA 5F0UA 1SQEA 1AFJA 5K9FA 4Q2LA 2IYIA 4HI2A 3K7RA 1FD8A 2ROPA 1AFIA 1LQ9A 2XMMA 2LQ9A 2XMVA 4Q2MA 1SB6A 3BB5A 5T7LB 1OQ3A 2GFFA 2K7KA 3FRYA 2K1RA 2OAUA 5B0EA 2OFHX 1RJJA 2HLUA 3TNVA 1TL5A 2RILA 4HH0A 1YJUA 3KKFA 1XBWA 2K7JA
chains in the Genus database with same CATH superfamily
2D3UA 4CLSA 4CYUB 4LF2A 4IR1A 3K8VA 1SC1B 1DARA 2E5IA 3HT0A 3HVTA 2I2YA 2KJWA 3PX4A 1RTZA 2ZDOA 3DMJA 4RBVA 4TY8B 1T05B 2PD1A 1HBOB 1YVFA 2C42A 1WOSA 3VHQA 3UD4P 3HLUA 2R3VA 1WC5A 4FDFA 1LK5A 4ZCIA 5F9NA 5ETPA 4DG1B 3MCOA 4HH1A 1URRA 2UXCJ 3EPGA 4NA1A 2XULA 4OZNA 4TY8A 3RBXA 2IM0A 4HVZA 3V81B 1WEXA 1RU1A 4WP9A 1GT8A 4YY3J 2P5VA 2PC6A 1WF1A 3BQ2A 1S0VA 5BR8F 5BXIA 4EFAC 2CQ4A 3VAFA 1N52B 2IAJB 2RRBA 4U96A 5KFKA 2B4VA 4BWJA 4NZ6A 1NK0A 2KDOA 1N5TA 2KYZA 3W2VB 1M0SA 4N8NA 4C48A 1YJWS 1JXLA 2UXDJ 3GSDA 2RDJA 1NB7A 2PI5A 1VQ8S 4CZCA 1L3SA 1S6OA 2L41A 4F4YA 3BM7A 2JL9A 1UCNA 2RMLA 3W63A 2UZAA 4O3SA 3K57A 5F8GA 1Q7LB 2IBKA 4ZLJA 2HNYB 4ECTA 1RTHA 4F0HA 1IXKA 1Q78A 5HMZA 1U8SA 2PIIA 3KUHA 3W8PA 1N33F 2B9XA 3H5UA 3NAIA 3VAKA 5JXSA 5EUHA 3JTPA 4LRCA 3BGRA 1RAGB 3VGSA 4NLRA 2GO9A 4P2XA 2YWGA 2FDNA 1B0VA 2HRYA 4V1Ak 3DRRB 2PE8A 3NCQA 2MGZB 2I0XA 2FVRA 3ET6A 2W2MP 5D15A 2YXLA 4P72A 2RUSA 4LF5J 3HSJA 5IWAF 1TKTA 2DBBA 3E01B 4M5DA 3SFUA 1UVKA 2IY5B 1FO1A 1R43A 1SC4B 3QAEA 4AQYJ 3Q86A 5B0FA 2AZ3A 3PG9A 1BGXT 2AV5A 4DUZF 2XSFA 1RABB 3IA0A 2C2ZB 3I32A 3EZOA 2UUAF 4ZPCA 2R7QA 1R89A 1SVDA 4PPDA 2J7UA 2H54B 2V63A 4USKA 3SDEB 3UNYA 1BUXA 4UUWA 3MDFA 2OTLS 3KMQA 2GA7A 3MFHA 2VKRA 1VOMA 2ZD1B 1B4SA 5C2CA 2WSEC 2FY8A 1NDPA 3M2RA 2KM8B 1RLCL 1S76D 4JI6J 4AL6A 2XY5A 4GRSA 1LEOA 4F02A 1DTQB 4PUOA 2CJBA 4B9NA 1QD1A 2A6MA 3P45B 1T7PA 4UOCA 3FZ2A 3H42A 1KVJA 3K17A 2F8MA 4NEZA 1XERA 1JLGB 2J7KA 4DR6J 2ZOMA 5G4DA 4M5LA 2ZHBA 1Y3JA 3RB0A 2XGQA 2ROEA 1JLCA 3KXDA 2OPRA 4EZ9A 2DISA 4M8LA 1VIOA 3W8GA 3M6WA 3PHTA 3HPOA 1I5OB 3QT6A 1VRUB 1I51B 1WELA 5HSPA 1XNQJ 3MEEA 2UU9J 2LQ8A 4WJBA 1Q82T 2VBZA 3L4BC 3PFEA 1MN7A 2DTJA 3LP0A 4PQAA 2H9ZA 4E0DA 1SB6A 2QC3A 2JC1A 3IG1B 3DHWC 4L6V3 4X84A 1N36F 5IOLA 3U1LA 3LAKA 1JLBB 2OTJS 2KTQA 1BXNA 3KDNA 3QQCD 5DM6Q 4H4KC 3KK2B 1S57A 1HD0A 1WDDA 2WVBA 1VQ7S 3P4UB 2E1MC 4C6AA 3BYRA 4L76A 2M88A 4LFCF 3BR9A 2Q6BA 1AZSA 4LRAA 5D0GA 2FZKB 4OX7A 1UWBB 2ZH2A 2FQQB 1BQXA 1VGYA 5DG7A 3NNHA 4ATNA 2CDQA 1R8PA 4RNFA 1U24A 4OHVA 3S6EA 2DO0A 2KFZA 4F25A 3OSNA 3ZTPA 1KTQA 4DX5A 5KG2A 2V6AA 1Q5YA 2XY7A 3GJTB 1CQNA 4DUYF 1QM9A 5EDWA 3Q8PB 3NNCA 4IOBA 2O3DA 1QAYA 1WDTA 2CQPA 2V2VA 4TXSA 1FWKA 2J0WA 3UCZP 4F26A 4X64J 3H0PA 1HNZJ 4RW9B 3MR3A 2AYEA 2N4CA 2FJDB 2W2QP 5D77A 5G0RB 2G0IA 4RUBA 4BHQA 5DGBA 4EEYA 2Q3PA 3A4TA 3M9NB 3EUNA 2QSFA 3TJAA 2CFXA 2MQLA 4TVAB 2DHSA 4KAIA 3SQGB 4WU2A 1NK5A 2JEIA 5AJ3J 1MSWD 3DCAA 4I7FA 3OTOF 4K50A 1CG2A 1BE4A 4EWTA 2J0SD 3IM9A 2CPYA 4RW9A 3ILOA 4KFBA 4J9QA 1GH8A 1LWEB 2POKA 1ICEB 4KJIA 1NUEA 5FJ4A 2YTCA 1L3UA 3NGKA 3SQGA 2FPHX 3KG1A 4OHYA 2KH9A 1RHQB 3G8SA 1S49A 2CA9A 2YWHA 2IMWP 3QRRA 1PSDA 2ZUGA 2QT7A 5E5NA 1R8AA 1RT7A 1TU0B 2ROGA 4ZIWA 4F4AA 4DV1F 2HEKA 3N28A 1Q79A 1RAJA 2AJFE 2ZH4A 2N4DA 3AD9C 2HHPA 3HHDA 1LFWA 4NLXA 4RUCA 4DV2F 1NPKA 2IA6A 2CNLB 3AA8A 1NEEA 2DGXA 4EI2A 4P2MA 4U7UD 1T94A 4WPAA 3DGPB 1WKLA 2QA4G 3P49B 4CO5A 3DRPA 5IM0A 1B99A 1GK8A 3MMAA 4MIBA 1KQFB 2HMIA 2ZVSA 1R31A 4FZVA 5IQ6A 2AZ1A 3LTOA 4OYZA 5J2PB 1WG1A 1RU2A 1RT2A 1T9YA 3HHLD 4ED1A 2GVZB 3CJTA 1REVA 1HNXF 3FEYB 1BQMA 2XB2D 2JOQA 4OI2A 4QOTA 4GO7X 4LSNA 1X4EA 2CQ2A 2AHOB 3BH7B 4TLRA 3RW7A 1Q1KA 3G8TA 3I0RB 3M4XA 2N3OA 3VAHA 4P9SA 5B09A 4B3TJ 1XNQF 3NNAA 1FJCA 1VR6A 4DPXA 1KVKA 1LWFA 2R8IA 4EMDA 2AGPA 1NMEB 4PG5A 1FDAA 3BS9A 1CULB 2F8EX 2BW7A 2CQDA 4F4ZA 4DV6J 2FLLA 4EBCA 1OPIA 2V4QA 2B4OA 1FDNA 4R5PA 2L9WA 3B54A 1F9FA 1R7IA 4PWWA 3OJSA 3PV8A 4IOCQ 3ENVA 4P6QA 3B4DA 5CD4H 4ED5A 1X4GA 2F1FA 1X7VA 2HHTA 1TK8A 4A46A 3D0GE 1KONA 5KTQA 3I96A 3N5FA 4F3QA 3I5BA 3V6HA 2Q66A 1PAUB 3ILJA 5E0OA 4NLTA 4WFZA 4CTAB 1IN0A 4ECXA 2BE7D 4IG0B 4DR3J 5KFWA 1T9VA 2HZVA 3PYGA 2KVQE 2JZ5A 1A6LA 2IRXA 1N32F 3TEHB 2J9DE 1Q95G 3V2UC 5F8LA 3A3NB 3Q8QB 3FRYA 8ATCB 2K1RA 3CXCR 1RE1B 1QE1A 3IBWA 2PT0A 3MM9B 1D9AA 3FNNA 1TL5A 4LBHA 4QWDA 1UFLA 2FJWA 3G71S 2CADA 1O6XA 2DNZA 2XSJA 3O3LA 2ZHAA 4TNOA 3WQPA 3FMBA 2ACYA 2IC3B 2GNKA 3GU0A 5IXUA 4LUBA 3R7NB 1Q8LA 2QX0A 3N6LA 4QR1A 1QAJA 4A8QA 2B43A 1EZZB 1GEHA 2CVEA 4P7VA 1XMQJ 1TQLA 1TMMA 1YBTA 3HFVA 2DPJA 3MHYA 3PACA 4XAKA 2XSJB 2MLXA 4LSLB 1N5VA 3MM6A 4YB6A 4M5DB 2RS8A 2WSFC 4NCBA 3L9ZA 2ZBCA 2ZHOA 1GTEA 3CNQP 1MG7A 2GC8A 5IQQA 1H74A 4FNHA 2BE2A 2W2OP 4WP8A 3TAQA 2MZSA 3BH6B 2WVFA 1SKWA 4AD6A 1YITS 3M8YA 3QGIA 2XI3A 4ZCLA 2GV1A 2KU7A 4I0WA 2HWIA 1IWAA 2ZVIA 1ITPA 2Y0SD 4A8SA 1EP4B 4R0JA 4KGVB 3RU0A 4ZKAA 1A0OB 3EVMA 2MKCA 5ETOA 3TA2A 1CBKA 1PJ6A 3L7OA 5GAGU 2W8KA 5KFOA 2QL7B 3M8WA 3O44A 1HNVA 4PABA 3DLGA 1L5UA 4CM2A 4X4RA 1Z2ZA 1DTTA 3MAQA 3THTA 2CJAA 3N0VA 3HHLC 4J9MA 4B9TA 3OFGA 2DRBA 3BF4A 1FJEB 1C4AA 3DFEA 1I94J 2JFKA 3HF5A 2G1DA 1HKAA 1WHVA 2NREA 1HI1A 4NLVA 2LQBA 5U47A 3H25A 2V2QA 2BUNA 2AJ2A 5GMEA 4EO8A 3MFIA 4KC5A 4FYXB 5KT2A 2UVUA 3R3TA 3J7Z5 1HYSB 1YJTA 4NOHA 3QT5A 4JI8F 1VQNS 2E1AA 1D9DA 5CD4A 5DRKA 3KHLA 5D4LA 3OL7A 2HURA 2RT3A 4WIIA 2VODA 2QLBB 4KGMA 3I0SA 2ZH9A 1X4CA 3NGRA 3W5ZA 3PY8A 4MFBA 2CPHA 2UUTA 4V19J 2QO3A 4R8UB 1WG4A 2M0GB 2Z56B 2IVYA 4DCPB 4MK8A 3LGNA 2DGQA 4C11B 2CAJA 1FXLA 1S1WB 4Y00A 1N5YB 5I4MA 3W9IA 2ZH7A 3E3XA 1CC7A 2VFTA 4RR5A 1ZAWA 3CJ2A 3PIPQ 4E2FB 4ZIVA 3CJ5A 2QMWA 4FPIA 4USHA 1U49A 1J5EF 3GB0A 5IT9U 1VHFA 2AIRB 5IT4A 4U8VA 1U0HA 1FE4A 2D9OA 3D6FB 2GZOA 3HZGA 2VQEF 2H3EB 3L09A 1YK9A 4LFAJ 1WUUA 2OEKA 2H5IB 2XLIA 4N5SA 5EX0A 1LWCA 2ZJRQ 4DR2F 2MQMA 3NOCA 2ZM6F 1H73A 2F3JA 3R5CA 5T41A 1NDCA 5AXNA 1WNEA 5CABA 3D2WA 4YHHJ 2PFFB 4CO2A 3SSQA 1L3KA 5HAOA 5B0DA 4NL5A 3J81Y 1G3OA 4IYQA 2WTFA 4A8MP 1N56A 1W26A 5CQGA 3OFFA 1XC9A 3RTVA 3QT7A 4ZA1A 1Q7YT 4PKDB 4GVBB 2X7IA 1S1VA 5FIIA 3J81U 4M5MA 3UCUP 4TU8A 3BO3A 4PG4A 4O23A 3TR5A 1NZAA 1R8HA 4DV0F 2YPZA 4DPUA 3AHPA 2ZITA 5KFRA 3T1AA 1UL3A 4FXDA 3W9HA 3QT8A 2HMIB 2MEWA 3QSIA 3JAMY 1X5TA 1SH3A 4OYPA 3TNVA 1QVFR 2AQ4A 3DMJB 3K5PA 4DQRA 4ITSA 4K4XA 3DYAB 3TA0A 1YGYA 3AJ2A 4DR3F 1I94F 2H5EA 3CJRA 5A2QU 1CJKB 2DXDA 2HRTA 2RHSB 1S7IA 2CNKB 3B4MA 2BKPA 4ZPTR 2IJFA 2OPSA 2CJYB 1N34F 1P27B 2GQCA 2A10A 3HKWA 3K5OA 1S59A 1E6VB 3MTKA 1TKXB 4MTPA 3ZTSA 1PJ7A 1OQ6A 2LVWA 3VR1A 1NAQA 2AD9A 4KT0C 2R8HA 4B17A 3HSDA 3M8RA 3LPYA 1IKVA 1OJ4A 4CWBA 2EG2A 2DIVA 1HMVA 3TAMB 2R7RA 3KG0A 4URGA 2OPSB 3GJRB 2R8KA 1TKZA 4CLTA 5SUHA 5GMDA 2JSXA 3FC9A 4U95A 4WTOB 2RU3A 1JLFB 3RBDA 4DDFA 1FNOA 4RWWA 4DL3A 2C3MA 5J2NA 3Q2SC 4JI7J 1OSCA 2VV5A 1QUPA 1IKVB 4U8YA 4UQGA 3SSSA 1RTDA 3BJYA 4G3IA 3WX8A 4WZQA 2FC9A 3BV8A 2HFNA 1NJXA 5D3GA 1PC5A 3CCRS 2L3MA 4MYUA 2WK4A 4J5OA 2HRUA 4CLLA 3VVTA 4IG0A 2XMAA 2U1AA 3POTA 2XMTA 3RGIA 2N3LA 5HQMA 2MHNA 1CULA 4PG7A 2HQIA 4ZP7A 4RNMA 1GAOA 5F0WA 1BQNB 1LWXA 3CJSA 1HQUA 5E33A 1MROB 1V3SA 2HBRB 2WVEA 2BMBA 2IJRA 3AXKA 3ILLA 4KHMA 4DCOB 1LW0A 5DETA 5K14A 3TZZA 3FUYA 2Y8WA 3V6DA 4OHZA 2IC3A 3VF0B 1KSPA 2JNJA 1FWLA 1P1LA 1RCXB 1RLDA 1YX2A 2GMHA 2VBXA 2W2NP 2YNGB 1RTHB 1WHYA 1MLAA 3MPUB 4KB7A 4U7CA 3M6UA 2XO7A 1FX2A 4WFYA 1VBKA 2DHGA 2GVDB 3JS9A 4LF8F 1MU2A 3UNGC 4G1QA 4WF9Q 4YUDA 4USIA 2GHVC 1QSLA 1NK9A 3GG0A 3SCIE 1GX5A 3QSYB 3FKBA 3QGPA 4FYWB 3W2VA 3EWGA 3OSPA 2BDPA 3D1HA 1FEEA 5KFBA 1Q8BA 1VQSA 2X3DA 5GAEU 4J9SA 2ACMA 1HBMA 5KFQA 2MKJA 3BBCA 3I4PA 1WOOA 1YRTA 3HKZD 1HI8A 1I3OB 3G4SS 4WCEQ 1ZPWX 3RAXA 3IP0A 2W8LA 2HPUA 3H2LA 5ETKA 1RAAB 3DOMB 2ZC3A 3A12A 4GO5X 2JJ4D 2JEGA 3JTNA 2XWYA 2R4FA 4DMZA 4RBTA 2HKEA 2ZD1A 4FN5A 1TFWA 2Z4PA 1OYEA 3NBPB 4OZJA 4URQU 4F4XA 3CWJA 2J6TA 1NHKL 3U7JA 3CCJS 1VQ9S 3C46A 3AAWB 2LA6A 1WD6A 2E5GA 5A0YA 1FJGJ 2D9PA 1UW4A 1BY9A 2DR5A 4XIUA 4QYRA 1H3DA 1OY6A 4QWCA 2XS5A 2DR6A 4NEYA 1RT6A 2YNHB 2WAQD 1FD8A 2P2CB 1ZOTA 1TTHB 2FVCA 1LQ9A 2D1CA 5EWGA 3TQ1A 3RBEA 3ZNJ1 2J8SA 1DTTB 1FKAF 4I2QA 3FCVA 4LMZA 5F8IA 2CQ1A 1ZM9A 1WTBA 1N48A 1I6JA 4OI6A 5KFIA 2ZZTA 4Q0BB 4C0HA 4DJBA 1JKHA 3FEXB 2UXBJ 1D8ZA 1V5IB 1NBEB 4HHHA 4HHUA 3M2RB 3J80U 3BREA 3R5AA 3HT3A 3H4BA 4F36A 1FHTA 3IBFB 2YNIA 2OMLA 1FRIA 3RB3A 2CDRB 2PGCA 1HNWF 1RA7A 4GKKJ 2DNRA 3CDWA 3BR8A 3HZEA 1U0HB 5D0RA 4UY85 1DFDA 4IH5A 3FSIA 2IIHA 2OUGA 2XMWA 3IMQJ 2D3OR 4M5GA 1V5VA 4PXCA 1Y00A 4Y6IA 2HFOA 4QBUA 3GILA 2YKMB 2Y8YA 2JX2A 3GIJA 1HWUA 3PYFA 1FJGF 3BKFA 3P5BP 2LEBA 4S0MA 1MMNA 2O1PA 7FD1A 4J9KA 3WZ0A 1S5ZA 4X64F 4C2MA 4JV0A 4ZP6A 5EX3A 3HFKA 1SIZA 1TKTB 1ZM4A 2F65A 2NYIA 1KP6A 5KFSA 5MAOA 2ZH8A 2ABYA 3I6PA 4O44B 2VJUA 4C8KA 4QU7A 3T5HA 4F3OA 2RDIA 4OJHA 3GCWP 6FD1A 4X4TA 1SC3B 5HLFB 5HQLA 1SXLA 1U25A 3IFEA 2KFNA 1VLYA 5F8JA 2RVJA 3QAUA 2LDIA 4QCLA 5M2PA 4C8YA 2KXFA 5CAAA 2FJEB 3FBFA 3LP1A 4JBCA 2G2YA 1WF2A 2DGWA 3H5SA 3T6JA 4LBIA 2RKIA 1ZAXA 4I56A 2EFPA 2FHMA 4A8XA 2YKQA 1S1XB 3T5JA 2MB0B 1F2GA 4EO6A 2EI5A 2VHGA 3QLHA 3TQEA 3M9OB 3THVA 1NSPA 1N5YA 4CT9A 1UMJA 4WKYA 4LR9A 3MCMA 3V4IB 2HQCA 3W62A 5A76A 5BYSA 4MKVA 3OTBA 4DV3F 3J7AN 1Y5LB 2GIRA 2J9CA 3UVJA 2QZ8A 1Y10A 1MW7A 2CQHA 2F40A 4DL5A 2VF3A 4FF4A 3KTQA 2AKWB 3ZZOA 1NK4A 3TA1A 5E3AA 4ALZA 1TK0A 2B5JA 3QYYA 3JYTA 1WJ9A 1LW2A 3C16B 4B9VA 1S1UB 4IKAA 3N9UC 3RAMA 3MR6A 1EJ7L 4C3KA 3BSOA 4A48A 3R8YA 1AROP 5GAHI 4Y65A 2BJ8A 4FS2A 5E3RA 1UVNA 4CNZA 1X0FA 1U1KA 3IWXA 3CJ4A 1YKWA 4L3KA 2VONA 2EBGA 1IJFB 2NPFA 4QJVA 1REVB 3C15A 2K3KA 3D68A 3MEKA 3I4HX 3O2IA 4HTJA 2YY3A 5D0EA 2W7PA 1JIHA 1X60A 4NCGB 1UWAA 2G2ZA 2UUBJ 1HLWA 1TKDA 2OPPB 2RNEA 3OVAA 4RUHA 2HG4A 2RD5C 3CSKA 3FSYA 5A6WA 2J8AA 4RU2A 3MEDB 4A8YA 3P5TL 3HHNB 1RUSA 3CCZA 3S7RA 1R8BA 3CD7A 4GKJJ 3D6TB 2DD8S 2AWZA 1SQEA 4LF5F 1TV6A 3IS9B 1FKPB 3NS7B 4ZLPA 5AE2A 4K2XA 3JSRA 2LU2A 1N34J 2A0FB 2VC0A 3ENQA 4Q2MA 1BD6A 4KH0B 1B3TA 3R2DJ 1NNDA 2J5AA 4UF4A 4RW8B 2BACA 4EBEA 2YWFA 4I7FB 1RKJA 1R3NA 1LNQA 1YJUA 4WXOA 4Y0FA 3GV7B 1S1TB 4FBTA 3OR1A 2E7WA 1YJ9S 2KG1A 4NLDA 2V2KA 1XQIA 4ZVUB 4DFJA 5ETMA 3BDPA 3MCNA 2Z2YB 4ID5B 2FTRA 1GX6A 2Q1LA 1AXQA 2HK3A 2PO4A 2DGSA 1NXIA 3TI0A 3UE2A 4M95A 1H72C 1IR1A 1TR0A 3EMTA 3VZIA 4DR7F 2MJNA 3LO3A 1IJEB 3I5CA 5IS2A 3CDBA 3RAQA 4KGKA 2BYCA 4DI6A 1JLAA 3A1YG 1FD2A 1WC4A 2G4BA 3M6VA 4B9LA 3IRWP 3DDNA 1YJ7A 2W25A 4C3LA 5BR8J 4USVA 1HD1A 5E3CA 1KDNA 4ICLA 3QZ7A 2VU5A 1S79A 2DXFA 4A47A 1TP7A 2VPXB 1M1GA 4C8LA 1KFSA 2I1RA 2J9DA 1IM6A 4AE5A 5GAEI 2BM0A 2VQFF 1KVIA 4PWUA 5BYRA 1IKYA 4ZLNA 4X65F 2KXNB 5M2RA 3CC2S 3ZTOA 2LEAA 5C5JA 3FCHA 4O0IA 3R2CJ 1RT6B 2YNHA 2XCPA 2UVRA 1MU2B 2L9DA 4OI1A 1VMBA 4G1QB 3AQOA 4AL5A 2FHJD 2P6TA 3QFHA 1HNIB 3EGZA 1UP1A 3ZXWA 3VAGA 2EC0A 1OS5A 1HWLA 1X0PA 4Y2MA 1TVRA 3IAM9 4DLGA 3L7PA 4ECRA 1SJ3P 3NS5A 1RB0A 3KJNB 4BLGA 3L3CA 1WI6A 4CH0S 3IN5A 2IAJA 1UEKA 3RUBL 2PSZA 3M6XA 2PEBA 2VH7A 3FFIA 3KLHA 3R1LA 3EDRB 2MZ1A 4RJVA 4I67A 3LGHA 4WE1B 5FLXU 4JI0J 1XN9A 5B0BA 2ZBIA 5KT5A 4E98A 4I68A 1HWKA 4RO0A 1O8BA 5A8KA 3I82A 4HACA 1TL1A 3MPDA 4PYAA 2QGFB 4NXNJ 1WSVA 2BQ3A 4NPOA 5L1KA 2UUCJ 4KV8A 1JWWA 1CVJA 1IUJA 1XWLA 5KFCA 2CYYA 2RF2B 4RL1A 2VC1A 3LAMA 2B9EA 5A8RB 2NS1B 1T3NA 1VC5A 3KJVB 4J7CA 3UN2A 3LP2A 2EW9A 2LCWA 2K3IA 2ZC4A 4OMFG 1FFWB 4QZVB 4QWEA 2FIUA 4B3OB 5I42B 2DPIA 4BS2A 3KJVA 5KG1A 3GP9A 5LXYA 2VQEJ 5H1SV 4LF4F 3MMBA 5HMYA 3HJFA 1TFYA 2CG4A 2HQ3A 4KFBB 4YP3A 2WONB 4HYKA 4J9UE 5HROA 2HS3A 5CCMA 3LP0B 2DEJA 3MUTP 1HNWJ 4DPWA 3IRXB 3SBMA 2GHWA 2OH2A 1JLEB 1NB2A 3C6UA 1QTMA 4NLGA 1O5JA 4N56A 5HO4A 1AW0A 2WBRA 1A7GE 4IDKA 1SL0A 3PRBA 4ECZA 2BEFA 3UN3A 4ER8A 3SFGA 3TYTA 2KG0A 1T03A 1A9NB 3KOAA 1LWCB 3BEGB 4JI0F 3MAHA 2IMOA 2QYGA 1XR6A 2OPQA 1RBLA 4Y2AA 4CRJA 2UUCF 2LA4A 5D4PA 4H4MA 5F0UA 3KJFB 2XTJP 2Y9HA 2V8GA 3PKYA 2DK2A 1T3OA 2IRUA 3QFWA 4C11A 2R7XA 3PNIA 1XR7A 3UVJB 3MAAA 4CQ1A 2HIYA 3H4DA 1K44A 3C66A 2M8DB 4OYOA 1M1HA 1ZA2B 4DR7J 3MMAB 2AYMA 1WF0A 2GFFA 2P9CA 3CCVS 4CH1A 3Q8YA 1S1VB 3JQJA 4H4MB 4WYLA 3B8HA 2RILA 3DDKA 4HT7A 1NDLA 4ZVSB 4P74A 1S9FA 1HR0F 3QLHB 4Q5VA 2OSQA 5K8MA 3CCMS 4KR0B 2WZ1A 3R5DA 3VCDA 4LFBJ 3DRSB 5CZXA 3K59A 2E1PA 3CJ0A 3OTCA 3PR4A 4NYPA 3W9JA 1GXUA 1CPZA 4NXMJ 2Y0BB 2QIFA 2QA2A 1KR4A 1E6YB 4PR6A 1FT8A 1EKSA 2HGLA 4K0KJ 4ES2A 4BCAA 5J1EB 2VPWB 2Z57B 4DUTA 1KFDA 1H0HB 1HW9A 2BJ3A 4OX9F 1JQGA 4RW7A 3HXMA 3OR2B 4NZ0A 2ATLA 4O3RA 1SPBP 1UKUA 4CO1A 2MQQA 3C3LA 2KT3A 2YQ1A 2FVQA 4LF7J 4QPXA 2B0GA 3CDUA 2ASJA 2FLOA 1KD1T 3KHRA 2ZJQQ 1U6BA 3KNGA 5HBMB 1QSYA 1RA6A 4CI0B 2ZBRA 1FESA 1UWBA 2I9SA 1BC6A 5MLCV 2AMCB 4O3NA 2QEXS 3H5XA 3UN5A 5KFMA 5ETQA 3EICA 1MROA 2QL9B 4ID8A 4LF6J 1GNKA 1FTRA 5HI7A 3LWMA 2DNKA 2VPYB 1DHMA 3MECB 2V0NA 1RTIB 3DOKA 2DNPA 3QIPA 2V4RA 4L74A 4LQ9A 4CLZA 4ZVTB 3HVTB 1NSAA 2OD4A 4LRBA 4AQYF 3EGWB 2W7OA 4MK9A 5HP1A 3JQMA 4CIOA 5J2QB 1S1TA 1FDDA 1F0XA 3MECA 2OJ3A 2AX0A 3VALA 3M2UB 3ADAC 4WU3A 4YB5A 2BVZA 1UA1A 1U1LA 2BM1A 4OX6A 1UETA 3PW5A 4X4PA 1RHMB 3D3BJ 5B0CA 2OIHA 3T3FA 3M8PB 1Y9OA 4TN2A 2BJ7A 5LOQA 1HMVB 3HP6A 2CZVC 3KHGA 2KFYA 5LMUF 4JI1J 2NQPA 5K14B 3GYXB 4CH7A 1VQPS 2EKYA 2OEJA 3BGUA 3CEDA 2D74B 4CLUA 2R2RA 4ED0A 2FVPA 2NCKL 4QW9A 4NWBA 1X5SA 4WYWA 3KK3B 3BQ0A 4GKJF 2BJDA 4DL2A 4C4WA 5HMXA 1NCLA 1OY9A 3TW0A 3H98A 4LF9J 1VRTA 3BPDA 4AYBD 1SBRA 1OYDA 1NM2A 4ILMA 3CD6S 4ID5A 4OLOA 5KFVA 3CTRA 2LXIA 2DGVA 2W4DA 3ISNC 5E3PA 1D3WA 5ETRA 2UVWA 2VB6A 4PUOB 3R1HA 2UXDF 5DG8A 2LKZA 3K5MA 3SCJE 2VG5A 3MGJA 2K06A 2XG8A 3AOBA 2BANA 3R6LB 4OZ3A 3HSGA 3T1YF 3BPSP 4YMEA 4KGXB 5AJ3F 3WBZA 5L1IA 4B9SA 1C1CA 5CA5A 1VLOA 5D0HA 2H1YA 2HFUA 3Q83A 3U27A 3DLEA 3TUPA 4Z37A 1SH2A 1PILA 2VUGA 3NGUA 1FF2A 1FVQA 2C28A 4C0OC 3UR0A 3GIRA 1U47A 3QJJA 1NZ8A 4WIQA 1SJQA 4XTTA 4TYBA 3NOGA 5LMUJ 4LSNB 4DSFA 3A8JA 3J7ZT 2ZOGA 4DSJA 4LF7F 3JSBA 1P9YA 2HLTA 3O5TB 4I2QB 4C8NA 2NSBA 2VIHA 3KLEA 3NKYA 2DNQA 2PN6A 3WDOA 4KTQA 4YN3B 4QIGA 3CE8A 1LWFB 3AB2B 3FZBA 4FXWA 1JXEA 3QWUA 5LJ5Y 2XMMA 4B08A 3ZZZA 4ZCKA 4FYYB 4GMKA 5T7LB 3NMRA 2RQKA 3C14A 2HK2A 1D9FA 4W90B 3KKFA 4NXNF 3MPYA 1VYAA 1DQ9A 3GZ7A 1RACB 2KT5A 3GLJA 1F5CA 5B0GA 1PYTA 3MM5B 4ICLB 3FFIB 2Z8QA 3I5AA 3UWTA 4KO0B 5L38A 1R0AA 3D0HE 1PGZA 1K0VA 1S9EA 2MKKA 3CDEA 3CIZA 3B6BA 2O67A 3HVWA 4QR0A 5KFAA 3CC4S 4WXWA 1K73T 2ZNZA 2YWEA 5LXRA 1N36J 4P71A 4N77A 5KG6A 4ZLLA 5SZTA 1TL1B 4TY9A 4KSEB 4DL7A 1RWVB 1U6ZA 2C1EB 2GIQA 4DHVA 3PYEA 4NI2B 4ECUA 1RYSA 3R27A 3DLGB 2YKAA 4MKAA 4OYWA 3TO8A 1M90T 1MWQA 2VL1A 3D6MB 1JB0C 1RSCA 3DRRA 1HI0P 5LSLA 1IKXB 2DNMA 3DDIA 1VFJA 2J76E 4TU9A 1HPZA 5D8HB 2ASDA 2EK6A 5DZ7A 1YHQS 2YKMA 1RXOB 2AGOA 1X31C 3H20A 1PKUA 4OX9J 4QPTA 4IRKA 3G82A 4LJMA 5C24A 3CF5Q 3MD1A 1ZTTA 1X4AA 1FRJA 5H9EJ 1VBXA 1HPZB 1FI4A 4ETXA 4TKTA 2DRDA 2MSSA 2DH8A 4OZ5A 4K5SA 2DCUB 2R7OA 3J7A1 1HBUA 2W9BB 3AODA 2MHEA 3G82B 3AT1B 3GSIA 5K8OA 4F50A 2C2RA 1M5PC 2V68A 2YQ0A 2PEHA 4NLSA 4Q7AA 1T03B 1XNRJ 1TL3B 1RWKB 2DNHA 3EM1A 3PEJA 5J1PA 2KM8C 1M5OC 1HR0J 3SV3A 1HIYA 2L48A 2X51A 5LL6d 2XO6A 2V8DA 3KWMA 1VIXA 4DV4F 2HZAA 1S1XA 2LECA 4ZMMA 2YKPA 1FERA 1EETA 1S6PA 3KLIA 3U1NA 4DX6A 5HL7Q 1LW2B 3C16A 1ZS6A 3CW2C 3M30B 2MLYA 3O8WA 5CYMA 5IWAJ 3NL0A 3GFZA 1U1RA 1TKXA 2ZWOA 2DJWA 3R7BB 4J90A 3BSCA 1BWEA 3GPAA 2F9JA 3E2EA 1VRUA 4CLPA 1QJHA 4MKBA 2FVSA 4X4VA 5ETLA 2XMKA 3DOLB 1TKZB 3CB4A 2EFQA 1ZBTA 1CS4B 1UPMB 2P9EA 4HT5A 1CJTA 2QLWA 2UV8A 4OFZA 4TLQA 1X4DA 1WC1A 2N7YA 2QLFB 5HBMA 1RWNB 3DC2A 2BE9B 1AA1B 2BW2A 1LXJA 2U2FA 1S4EA 2ZUAA 3GWCA 3QO9B 4PYDA 5B0AA 3RZAA 1JKHB 4NA3A 1H38A 2HFSA 1HBNB 2BQUA 2Q6CA 5KFLA 5L46A 4YDDB 2B4UA 3UPFA 3OLAA 4N7TA 3OQ2A 1S0MA 2EEYA 3WHIA 1I1GA 1SUQA 2W7AA 2XY6A 1U1OA 1VQOS 4NRTA 4MFBB 2DY1A 2XI2A 5DS7A 1VQ6S 2HVHA 2FHJA 2PMZD 4L73A 4P7TA 2G1HA 1WHXA 4O4GA 4TU7A 3QJPA 1HBNA 3FGVA 5DDQC 2DGOA 4Y2CA 4GVLA 4OJ3A 4B3SJ 1S7HA 1TUVA 2V8PA 4RUAA 2NXCA 5HANA 1G6BA 3CJQA 4YDXA 5H9EK 1F9EB 1VQ5S 9RUBA 4RW6A 2K8GA 5KFNA 3KDOA 4DV7J 3V6DB 4AUKA 3N6MA 4KYZA 3SI8A 2NXNA 1IR2A 3QWPA 1HWIA 1V9OA 1ELOA 2HBYB 4ELUA 1FA0A 1AFJA 1U1PA 2Z58B 4OV1A 4FYVB 2IVFB 3JSMB 5L1JA 4F0MA 1NJIT 4ZVFA 4DG1A 5HLFA 2OAUA 3B78A 3UQSA 1IBLJ 2DEIA 3OXGA 2LMIA 4QYZK 4CLWA 4PG6A 3T9NA 2B9WA 1CJUB 2VPZB 4IFYA 3BN7A 4NASA 1NHUA 2JC0A 3Q89A 1KC8T 1S6QA 4WFNQ 1ROFA 3C6TA 1N33J 3THPA 3J81j 1VC0A 1SH0A 1F1BB 2E5LJ 1CSJA 1Q16B 3M8PA 5L1LA 2BOAA 1TL4A 4P2FA 2DR7A 2BE2B 1YWXA 4Y28C 3M32A 1S6QB 1WORA 2D7SA 1FX4A 2QLXA 5DDPC 2DRAA 3L7UA 2FJVA 4USUA 2OELA 1KTVA 3IR7B 4X65J 1EHWA 2C2KB 2PA3A 4EK2A 1IR0A 2MQ8A 2VFVA 5C42B 1FJ7A 1RISA 3N5BA 4DV7F 4DOZA 3V6JA 1H6KX 2FY1A 4DPYA 3GFXA 4BWMA 1SKUB 3NS6A 3QPIA 3G6YA 8RUCA 2ZBQA 2CQCA 2EFVA 5AXLA 4ANDA 3HHLB 3ZZRA 1U0SA 5KFYA 4HDGA 2QN6B 2ZKUA 1SL1A 5A0YB 2VG6A 3KHHA 2HW3A 4RW8A 1KEKA 1N0VC 4L75A 3OLBA 1JJ2R 3DU6A 1VDHA 1HQEA 2NLWA 4O0NA 5AXMA 3MEEB 1CJVB 3MUVP 1S6UA 4ZP8A 2AYGA 4DR4J 1RTJA 1X5PA 4WTYA 3E01A 2N7CA 3CCUS 1IBLF 1FFGB 2HQDA 3VVUA 3BGFA 2MDAA 2HVEA 1RT5A 2YWKA 4LVNP 3G87A 4PWDB 2MZRA 3WIUA 2W9AA 4FNIA 1N5SA 2DHHA 2KXHA 4D3HA 3SZ2A 1DZ5A 4NCAA 2M8HA 4O4RA 4JI1F 1FE0A 2YBVA 1QUVA 2AW0A 4LT6A 1S9GA 2MYFA 5KFFA 5DJBA 3ZZ0A 3QZ8A 2NUHA 2OPPA 4OJ1A 3CGIA 2H4YB 3QNWB 3DM2A 2BJ9A 5HK4A 3KLFA 2VFRA 1KLMB 1YRUA 4MAKA 4ZS6A 3D54A 2VG7A 1YJVA 4NI2A 4A8WA 2H5JB 3ITHA 3PJXA 5DG9A 3T5KA 1C1CB 2VOPA 2EFOA 4FP9A 2W4CA 4USJC 2BX6A 1DRZA 1LOUA 3FCWA 5KT3A 1DLOA 2WVCA 3W65A 1WEYA 2NXEA 4O3OA 3PZPA 3J80Y 2HVZA 1VJWA 2GS8A 2HBZB 3HVAA 3PXGa 3UI3A 2MKIA 4EYHB 2XQCA 2FLNA 2IDEA 1P6TA 2DNLA 2QSWA 2WCXA 1T05A 3QGHA 1VK8A 1HNIA 1VQYA 3AD8C 3R97A 3ZZYA 3AH6A 1ZZFA 1BWVA 1V3RA 4QR2A 4FKYA 2LLZA 4OHXA 4JI2F 3SEOA 2FGCA 3NRBA 3TUJC 3F56A 2XYPB 3MR5A 1YRXA 2IDLA 4M5KA 2QYCA 2X1AA 1REGX 3LH2S 1IQZA 3W1YC 1JLQB 3T1HF 4DQSA 1MMLA 2OMOA 5A8KB 2BRKA 1RYRA 2BKNA 3MTJA 4OLPA 4UQTA 3CT9A 2IBOA 5DLFA 1EB0A 4M5JA 1CLFA 1GQEA 2J0QD 3HFZB 3I0SB 5JMNA 3DLLQ 4KV8B 3G9CA 1R27B 1SQGA 1XTZA 2V2ZA 3C6UB 1S48A 3H5YA 2V50A 4DF4A 1HFEL 5K9FA 1QLNA 4XK8C 3HMJG 2PDAA 4PPZA 1NJWA 1DTQA 2J9EA 2ZE2B 3JAMU 4J37A 2PI4A 1RDRA 1YI2S 2F4VJ 4ERDA 1OQ3A 2HGNA 3D67A 3G2XA 2WB4A 2FJBB 4KH1B 1HQ2A 2HLUA 5HN0A 1PC4A 5CXTA 1WOPA 2Y1LB 3PYDA 4YEAA 4NYZA 3GV5B 3MAAB 2CPFA 2GJ2A 4ZVRB 3TVZA 3NCPA 3ZTQA 3Q8RB 2UU9F 2NZCA 1GFWB 4ECSA 4DQPA 2DO4A 1ULRA 2IYGA 5JVHQ 3EXYA 2VBWA 5KFJA 2GQQA 2MTLA 2WONA 4A8KA 3TZYA 1HHTP 2HHSA 1RCOB 3P96A 1X4FA 2M7SA 3FSXA 3M30A 3MMCA 2QFJA 3NP5A 4CLKA 1R0BG 5AE3A 1SUQB 3TWZA 4ZVHA 2LFVA 2QFIA 1UPPA 4J9PA 4M63A 2MZJA 3W5YA 2VBYA 2VICA 2B3TB 1UJ6A 1RHJB 3NXZA 3OL9A 3QJLA 1FNXH 2JVRA 1VISA 3UDEA 4PXEA 1LV5A 4DPTA 2DYAA 2B4PA 1CEZA 2IM1A 3AB4B 4X66J 2XM3A 4I6AA 3RB4A 2VOOA 1VI7A 3TEGA 3M8QB 2R7TA 3N01A 1N6QA 4C0BA 2E7XA 2HAIA 4YR3A 3CMES 1NKEA 4QIWD 4NLYA 1K1SA 3NLCA 3MPWA 3H7HB 1X4HA 3LW5C 4XDCA 1NPRA 1IBCB 3JTOA 1R0CB 3BBBA 4DR1J 4DF8A 3VGTA 1B7FA 1YDLA 1NK7A 2DH9A 2W9CB 5ETTA 1V3ZA 1C0UB 1YJNS 2JRSA 1FXDA 2QE5A 5HVGA 1RQ0A 1U02A 4F8RA 1U48A 2ZEJA 3DHXA 1XJWB 3K2YA 4P10A 2R9LA 5GADI 2BZ2A 1Y4ZB 4H54A 4DR6F 2CPDA 3R9LA 1T0TV 1WKJA 3PTWA 4TQSA 1FDBA 2A2DA 2RB7A 3EXCX 2OPQB 1JLAB 1H2UX 3QIDA 4IQMA 3I9V9 4OYBA 1IBKF 4ZJQA 1GXTA 2CIMA 1ZPVA 3EVWA 3RG6A 5GADU 3G6ES 4CCHA 1YZ7A 3K0JA 2E9TA 4U9RA 2KRBA 4Z7CA 5H9FK 3T1YJ 2XS2A 1O0PA 1QY7A 2OEMA 3JB9k 4R5PB 3A3OB 4I2PB 4M5NA 1NRKA 1PBUA 3S01A 5EN1A 2MQNA 2VDHA 2GAHC 4Z2XA 4DR1F 4RBUA 5I3PA 2FYXA 2NPIA 3JSYA 2QTWA 4IO1A 2HHQA 4KKOA 5CZVA 1GMVA 3V6KA 1S0NA 4F4KA 2PFDA 1ZYQA 1QAIA 5HP1B 2B8PA 3ELHA 2FJXA 4PQUB 1WG5A 2HHWA 1CJVA 3JQKA 2HHVA 3PR5B 1VS3A 3GJQB 3H2VE 4TQRA 1UTAA 4D3GA 3PJWA 5EHHA 2A6OA 4JB8B 1LXNA 2LXFA 4ETZA 4DLEA 1IBKJ 3RR8A 1E6YA 4MJKA 4MYTA 5J1NA 3CJ8A 2VG5B 2YNGA 3GR1A 5I3UA 4K4SA 2B9YA 1RT4B 1K47A 4OV6A 1UW9A 4JI7F 1G7CB 2DGUA 5AXKA 1KOOA 4AT1B 3R7SB 5KAKA 4YY3F 1RWWB 2MXYA 3CULA 1U2RA 2UXBF 1NK8A 3C6TB 3PHEA 4RW4B 3KG4A 3GIMA 2DR8A 3M1VA 1S9GB 1W2IA 3TVKA 3IGVA 3IO1A 4UZBA 3OD2A 1BHNA 3Q24A 1F60B 2DY9A 1RT4A 3QRQA 3GIIA 2DITA 5KFZA 3W2WA 4CLYA 3GR0A 4LF8J 4B3MJ 3K7RA 2HNZA 1FCAA 2HNDA 4JP8A 3KLFB 5F8MA 4MIWA 3Q2TC 1GMWD 2ZKTA 2EBEA 2NYHA 2F7VA 5B0EA 2K7KA 4ZJLA 5IV3A 1RJJA 3PDNA 3K5NA 4LFBF 4NRUA 2KHDA 4ENOA 4LFCJ 1M5HA 2MY8A 8AT1B 5JJBA 3CC7S 4KBIA 2NZ4A 4DL4A 4K4ZA 4DR5F 3LGMA 2LEPA 4B3OA 3LANA 1W25A 2YKOA 2XZWA 3P6YC 3A8EA 2NUUG 3D0IE 2JFDA 3DLEB 2RSQA 5J2QA 2E44A 1U1MA 1UZDA 4F4WA 4ECWA 1JXVA 3OUYB 1RZMA 2ASYA 2IJNA 3EDQB 2GMJA 4ZPDA 1LK7A 5K5MA 3TUZC 3LF0A 2MQPA 1F5AA 3FQKA 3ITHB 1HNVB 2VASA 1XMBA 2CPIA 2FGOA 4L72B 2J6UA 4K4TA 1JNRB 2HBQB 1JLCB 2GAGC 4DR2J 2MGZA 1HBOA 2RRNA 1HNZF 2CZ9A 2UUWA 5C24B 4DS5A 3X3UA 2R2TA 2A3JA 2CQBA 2ZH1A 1ZAVA 5F41A 3OFHA 2ZH5A 4DZDA 2MSTA 4CDIA 5A8WA 1U1NA 2V69A 2KN4A 3ENAA 3ZZUA 4ZJOA 3PCOB 1S77D 4ZN3A 3E51A 3MM7A 2CJ9A 3OXLA 5T7LA 4AXIA 2YPYA 1RAHB 1D0EA 3K8WA 1IKXA 3MMJA 5BJRA 4Q0BA 3M2VB 3KUEA 2I38A 2JLFA 2GGPB 2CPZA 4DS4A 2KHCA 4GKKF 1T95A 2CQGA 1PBAA 2CRLA 3SSRA 3DXBA 1SIWB 5EWFA 3EZ5A 4B3TF 1H2TZ 2OHDA 2YNIB 2A18A 4K59A 4DN9A 2MLZA 2W2PP 1S12A 1FVSA 1MWYA 1NPPA 2QMXA 4NLWA 4UY8T 4IOAQ 4IG3A 1NSQA 4DBQA 5CYMB 4ED3A 3W64A 3TAPA 3TANA 4ED8A 1DURA 4BC9A 1DQ8A 2UP1A 1BLUA 3DRSA 2XMJA 3CMQA 3OXFA 1JMTA 5IC4B 4ZVPB 2B5JB 1ZM2A 1AUSL 1JLGA 4ZP9A 2BKOA 2CKWA 1J2VA 2PA8D 3MR2A 1XMOF 2ZJPQ 1RT3A 2OPRB 4LBPA 3MM8A 3GTYX 4R0EA 4GC6A 1J5OB 3F41A 1C0TB 1SV5B 5KFPA 4N41A 4QIVA 4C8OA 3D3CJ 3OJUA 1VJQA 3M9MB 4JI6F 4UTGA 4ECQA 2R8JA 2QG9B 4EGLA 2LQJA 3PEHA 2NXUA 1W2BR 5DQIA 1NKCA 1SI9A 4ZVEA 4ANEA 5DM7Q 1RTDB 2RKIB 5KFXA 2WBMA 1HBUB 4R25A 1U09A 1Y0HA 2GW8A 1HL6A 3LALA 3EVOA 3RRGA 1ZZNA 3BYPA 4HL9A 3FK4A 2EFGA 1YJRA 1FKOB 4IUFA 2V8VA 2ZE2A 2XLKA 3SDEA 5J2MB 1C1BA 2HFZA 2UUAJ 1RHKB 1YSJA 3I9ZA 1FRHA 4KE5A 4KY3A 4O3QA 2IHR1 4KQZA 3EX7B 2Y3YA 2P9GA 1Y5NB 3M05A 3W7BA 4NMXA 1TAUA 4G65A 4I6YA 4B3RF 3RJMB 4A8FA 1H98A 3OVSA 1M5KC 2OP5A 4WK1A 5D4NA 4L3NA 2MKHA 2E9ZA 3NG8A 1B64A 2P8IA 2ZZNA 5AT1B 5J2PA 3MMBB 3OTDA 4G1PA 2IYIA 3JYTB 2GVDA 2XWXA 2EK1A 1CS4A 4WK3A 4TYAA 5CCLA 1RWXB 3CCSS 1OIAA 3AFGA 4OYAA 4H4OA 4QIFA 4WBFA 2C3UA 2OFHX 3LWLA 1S72S 1NH8A 2RJZA 3UD5A 3OL6A 2E66A 1WACA 1FK9A 3ETOA 2K7JA 3JXOA 1Q8IA 3UCGA 4DXLA 4F7VA 3QATA 3WC2A 4LIRA 4B3MF 3C19A 1PCAA 1CC8A 2OSRA 4NA2A 2W9BA 1K8AT 4JV1A 2EKNA 3OL8A 1YG0A 4JUZA 1IBMF 3W60A 2AX1A 4I4BA 7AT1B 2BXJA 3RB6A 4KHPJ 4RPFA 4HKQA 3EE3A 3W3SA 1NJYA 2KRRA 3CJKB 4PQUA 4ZCMA 4DV5J 3BZQA 2JHEA 1TL7B 3BQ1A 2VQFJ 1S6PB 3NY0A 2XZDB 1TUGB 4ED2A 4JYAF 3M32B 3TX0A 3D5MA 1RHUB 2IRYA 5IM0B 2GHPA 1TV6B 2KKHA 2HYIB 1S0OA 3IBCB 1CJKA 2O01C 4LREA 3M2UA 5DO2A 1XMQF 5C42A 1KOHA 1ZM3A 2M4MA 2BOPA 1NH7A 3RR7A 2RE1A 5KG3A 1VQLS 1F6TA 3EGVA 2B8QA 4H4KA 4RU9A 2G9OA 1TUWA 2BRLA 4Y2KA 4QW8A 4G6VB 2V9WA 2YNFB 4OIXA 4PG8A 2ZH6A 2I8EA 2DNNA 4LRDA 3FVYA 3ETMA 1WTFA 1R8CA 1XK8A 2AEJA 1UVMA 4CO0A 5CYQA 1Q5VA 3LQVA 1N32J 4LIWA 4C3MA 1UEVA 4K4WA 1Y5IB 2AEMA 4P52A 3PX0A 4DSKA 3US5A 1EKRA 1JK9B 2W01A 4OHWA 6FDRA 1DJ0A 2H65B 1VCTA 4FS1A 5LSOA 1VQ4S 2NR0A 1MNEA 4PXBA 4OL8A 5C25A 3HX9A 1FRXA 3MEGA 2GCFA 2ILYA 2J0XA 1VC6A 3X1LB 2IM3A 2WOMA 2OFGX 4DV1J 2ZOFA 2JDJA 3IWLA 5LJ3Y 3QIPB 3KLGA 3HO1A 4EU0A 2AJQA 4DV3J 3NGDA 2KZZA 2XZTB 4IRDA 5DDOC 1BQNA 2RRAA 1N4LA 2EVZA 5I42A 4I1TA 2ALZA 4JI5J 3UDVA 4U6PA 3G96A 2VG6B 3DGVA 1FKPA 2QA1A 3SQOP 5KFDA 2JVOA 3DGPA 4K4YA 2RS2A 4DQIA 1Q0NA 3Q22A 4EYIB 4RNHA 1RK8A 1T9TA 4DV6F 2CVIA 2B56A 2C2NA 3HJVA 2AF6A 1JJCB 2FC8A 3CCWA 5B7WA 4FVCA 3KLEB 1UA0A 4LFAF 2VA2A 2MKYA 3CMAS 4DFPA 1VRQC 3DU5A 2AGQA 2JWNA 2X1FA 3KUGA 2KB2A 3Q8SB 3LOUA 2CJKA 1L3TA 2GGPA 1JX4A 4JI3F 4LF6F 4P2SA 4B9UA 2WW8A 3R5BA 4IH7A 1GTHA 1HHQA 1PAEX 4DZ6A 4WE1A 2VFUA 4F67A 1VK3A 1HARA 1SJ4P 1S97A 4DSLA 3LPEA 1HNXJ 1YQHA 2AP6A 1WKKA 2KJVA 1U2FA 1EAYC 5M2UA 2C3OA 1AT1B 5J2NB 3ILIA 3PM9A 3WIVA 1EIYB 5F9LA 4KHPF 1WC3A 4IRCA 4MK7A 4MMOA 4ZVGA 2E5HA 3AD7C 4M94A 3HD1A 3TVYA 3V5RA 1KLNA 4MKYA 3HI9A 4CO3A 4WWSA 4Q2LA 2QRRA 2DH7A 2GMLA 4NLPA 1SQFA 3VV2B 2XNQA 1RAOA 4K0KF 1F9HA 4CP5A 1S1WA 1UVJA 1FFSB 3MURP 5ADZA 1RAFB 3GQCA 1IKYB 3FEZA 3SMZA 5HQ8A 2LXUA 1SCJB 1YIJS 1RWUA 1BMQB 4RKUC 3FRZA 2AT1B 4K2JA 1KN6A 3PVXA 1U4BA 5F3TA 4KPYA 3UW1A 2HHUA 2QV6A 3DLKB 1S1UA 3MMCB 2JEJA 1IKWA 1ZH5A 1NO8A 2VDIA 5L8RC 3KYLA 3CCLS 2W24A 3QMQA 4YS2A 4MIAA 4FYDA 5E7OB 2QJ3A 2RU9A 3MOZA 3WX4A 2FUG9 3UFCX 5A8WB 4Y2IA 2ILZA 3DRXA 3ET6B 2HWHA 2E5JA 5ETVA 1IKWB 3TZXA 2D3ZA 5LMNJ 1SKSA 5D4OA 3M2VA 1KBRA 2YVSA 3IM8A 1D1UA 4EUVA 1B0TA 2M2BA 4KPCA 1LWEA 4U7UK 2KZMA 2WRMA 1C1BB 2XCAA 2R7WA 4A8OA 3RRHA 5E3QA 1DQAA 4LSLA 4GVBA 1TMJA 2PMWA 3MM6B 4O3PA 3N4WA 4V19X 4ES3A 4LRFA 2GQ2A 3DI6A 4QQBA 4XDDA 3CIMA 2K2PA 4E8UA 4ES1A 5L39A 1KHWA 3ISND 3LA0A 4RW6B 3N6NA 1UVLA 2XMUA 2Z2MA 3OTOJ 3V4IA 4J9LA 3NAHA 1O51A 2W1BA 4BC7A 2Y1IA 4Z7YA 4OYIA 2YKNB 3R5GA 1SKRA 2KL8A 3LP2B 5DDRC 5KG0A 3IS9A 4WFAQ 5LMNF 1SJFA 1M5VC 2YH0A 3IR6B 4DSEA 1YTYA 2AYBA 3PO5A 1K0TA 3DRPB 3DN9A 4YB7A 1OSDA 4ZPWR 1S10A 4DR4F 1T02A 2C3YA 3I87A 5KFTA 3J7YU 4YOEA 2FZGB 1PG5B 3SXLA 2F9DA 3C2PA 2VD3A 3M8QA 4Y3CA 1X9MA 4NLQA 4C8ZA 4IR9A 3OPKA 4DU8A 2IA0A 2GJFA 2IFXA 5G0RA 4DL6A 4W4MA 1KS2A 3QBCA 3S1TA 5LT5A 2VFSA 5T14A 3SCLE 1APSA 2RQMA 3VTIA 1H7XA 4USMA 2DHAA 5CYJA 3UDLA 3VAMA 2R2SA 2RH3A 2APOA 1G4CA 4M5IA 1YLXA 5IC6B 3OBIA 3LP1B 3J7YI 3C15B 3KK1B 2LQ5A 3IG1A 3T19A 4AFFA 4RWXA 1H2VZ 4RX6A 2C22A 1X4BA 2E1RA 1G1XA 4KRWA 4DPOA 1UEUA 3CJ3A 2HQFA 4JI3J 1WHWA 5IZHA 5ETNA 4UUXA 5A2QY 3KK1A 3DKDA 3A8IA 3PX6A 3EGNA 1KKHA 3E8OA 3Q8VA 2HVDA 4FF1A 5K20B 3HHLA 2HVIA 1PJ5A 3M8ZA 3G6VA 2M3DA 3D1OA 2JLGA 3A8KA 2G13A 2R2UA 1PIEA 1X8DA 2CJXB 3OT9A 3ZTRA 5DQGA 3HK2A 4ZITA 2LP4A 3PW4A 1RBOB 3N79A 2ZH3A 4ZDNA 2RQ4A 3D6HB 3TP2A 3CCES 1Q53A 3BO2A 1GMUA 3AJ1A 3PRVA 4LF9F 4USWA 4K4VA 4IQXA 1IWGA 2F5GA 2Z0GA 2V94A 2RAQA 3MCSA 5IT0A 1YZ6A 3CUNA 4ED7A 1IM4A 4WZMA 2D41A 4JV5J 4RNNA 1TELA 3HVRA 1N8RT 2Z2ZA 1BQMB 5J1EA 2FHOB 2MMYA 5B08A 5KT6A 2R42A 2RDDA 1N5QA 4CNYA 5KT7A 2HIQA 4DU7A 2MZQA 3ZZTA 4W92B 3BSNA 3G86A 6AT1B 5I3UB 3UDCA 1DAXA 2F8HA 3D66A 2W9CA 5KG7A 2XHCA 1JLFA 1EX8A 3NCRA 3Q23A 4HACB 4CT8A 2M70A 3BKTA 3BKUA 3VGUA 3PW0A 1AFIA 4I2PA 2LQ9A 3OTEA 4ZVQB 2VG7B 2BV3A 3BB5A 2B7BB 3FBEA 1HBMB 4O4GB 4DV2J 5D3GB 1TL7A 2G0CA 3GIKA 3IWNC 2JLEA 4I6WA 4QWBA 1N6QB 4N76A 4HH0A 5KFEA 2ZNYA 2AU0A 2YX7A 1HHSA 2HNDB 2ALYB 4DV0J 2C2OB 4HI1A 2HGMA 3M7VA 4RLEA 5CH7B 3TJ9A 1PO6A 2DR9A 4QIEA 1FRLA 2KYXA 1U2CA 2HSEB 1LW0B 3D1QA 2OGUA 4IFVA 2E9RX 4F3MA 1OMSA 1QVGR 1C0UA 3IC1A 5LSRA 2H4WB 4YFUA 4B3SF 1U6FA 3TZWA 1NLKL 2M5YA 4X66F 2CPJA 1WEZA 2UXCF 3M1VB 1GMWA 2KO1A 4IFVB 4X4OA 4DQQA 1M1KT 3ZO7A 5EGYA 2CNNB 4B3RJ 4M1KA 3D9BA 3VQSA 4IDKB 5HMWA 2MZTA 4I64A 2ZM6J 4NYOA 3KLHB 4EBDA 1IBMJ 2QMUB 3AQPA 3CCTA 4DUYJ 4LSZB 3DLBA 3RW6A 1WWHA 1URNA 1FTCA 3HHEA 2GO8A 3T41A 2XYHB 3A3PB 2Y1JA 2XHWA 4HR2A 4ZOSA 5KOWA 3I56S 1X9SA 3TARA 2JEFA 3FBCA 4X4NA 3KLGB 3UD3P 1KLMA 4DEZA 1OY8A 4NMLA 1Z4UA 3ISZA 5KFGA 1F3FA 1XIQA 2AEFA 2RUGA 4KKOB 4LF1A 5KT4A 2CQ0A 2E5LF 4ED4A 5I3QA 3S8SA 2O66A 5DQHA 2BANB 2AJ4A 2CPXA 2V4JB 3BGOP 5HATA 2EC2A 4ZN1A 5F3ZA 1T8EA 3POTB 4NLUA 1Q4RA 4OJGA 3H59A 3CPWR 3KMSA 3SV4A 2BBEA 2GJIA 3EYZA 1P9QC 1XMOJ 1RBAA 2SXLA 3DOLA 2D3O1 2HHXA 1RTJB 2HS4A 3MF5A 4JV5F 3EPIA 2IPOB 3H90A 2FJAB 2OO4A 2ZWPA 2FLPA 2XS7A 4PWDA 5LM7E 3WC0A 1RI7A 5FD1A 4C8MA 3QO9A 4OYXA 3ULHA 4W98A 3MM7B 3ZC4A 5L9NA 1RWPB 5DGAA 2XEXA 4ZHRA 2A1BA 2WW4A 1RWOB 2MKSA 4BBYA 7FDRA 4C7QA 1F5BA 1RGVA 4JI4J 4FF3A 3U02A 1U7LA 2A2CA 3C14B 3R5JB 5GAHU 2Q43A 1OPZA 1WI8A 3NMAA 2VZ9A 4OZ0A 2CXEA 3TUIC 3CO0P 2EWHA 4OI4A 4UW2A 4C98A 4LVOP 2HWTA 3KK2A 1WC0A 4LF4J 3MM5A 3GMGA 4HHJA 4J9RA 1AUDA 1CQMA 4NE9C 3MR7A 5ITHA 4MH8A 1T11A 3BSAA 5DZ6A 5IV4A 1NKBA 2X1BA 4XO0A 3U1MA 4P75A 2F4VF 2HFVA 3PKMA 2ZDPA 1UFKA 1C4CA 2UV8G 1EQMA 1RP5A 2IM2A 4DUZJ 1GXLA 2BA9A 3BO4A 3CD0A 1VQMS 1FWPA 2DKOB 2HS0A 4J91A 3T9ZA 1VHIA 3NWRA 4Y34A 1R6YA 4EZ6A 2UVVA 2CPEA 4DN0A 2ZFHA 4HI2A 1MN9A 2FD2A 2ROPA 4ELVA 2DIUA 3GCXP 3F73A 5HROB 2Z30B 4LR7A 3GYNA 3GV8B 3GYGA 4ILRA 5E2QA 4RW7B 3SYZA 3O6QA 2J7WA 1UJ5A 2YWWA 3K5LA 4DSIA 3I31A 1Z1ZA 1XNRF 1XBWA 3I0RA 4RNOA 1Q86T 2B7CB 1HW8A 1RT1B 2B51A 1VRTB 2BJ1A 2G0JA 3HD2A 3RBZA 5KOXA 5EWEA 1QSSA 2XBPA 4ILLA 2F63A 5IT9Y 5HVHA 2XNRA 2EPIA 1B7YB 2ZBPA 3DI6B 3P3DA 3HSZA 3F0NA 4NCGA 1JLBA 2OKQA 3IAS9 3KK3A 4OX8A 4CLFA 3GONA 1XR5A 4HTIA 1UAWA 4K5RA 4BDPA 4IG3B 1RT1A 2KT2A 4PEOA 4ELTA 2WB1D 1ACMB 2YKNA 3MEDA 1FEHA 3FDSA 1KNZA 2CWXA 4ECYA 2HHHJ 1RKIA 2H51B 1T9XA 3DOKB 4K8RA 4NZ7A 4R8UA 3B82A 2PMHA 3G6XA 4HEA9 5A6PA 3OHAA 2M52A 1DY3A 1J27A 2W4PA 4ZPBA 3M8SA 2C3PA 2LU1A 2CJQA 3PRDA 3EZUA 4F0KA 2R7SA 5ETSA 4K7QA 3SIPB 5JUMA 4YB1P 2GX8A 3C8YA 3ZZPA 1DBDA 4H4OB 1RT2B 1Z2LA 3NEKA 2ATCB 2Q79A 5KG5A 3CD5A 4AL7A 4X4UA 2RQCA 1K9MT 4USTA 4A4JA 1FRKA 1CJUA 4IFYB 2FB0A 4O44A 2HNZB 5FDLB 4J9NA 2HAFA 3OR2A 5HJXA 2C2EA 3IRXA 3OW2R 5KG4A 2V8HA 3D4JA 4J9VA 3NGSA 4KGZB 1R6VA 1JJHA 2YH1A 1KQGB 4OI3A 5FDLA 3UO0A 1K1QA 4CYUA 5IFMA 1WSRA 4QWAA 3TJ8A 5FLXY 1KWMA 3MZIA 3EJMA 2E1CA 3DNCA 1U26A 4KO0A 3NGTA 2AJ1A 3W61A 4JI5F 2CNOB 4Q8EA 3MWBA 3IGNA 1IVZA 1Y3KA 3CO9A 3PIOQ 3DRYA 3AJDA 1C2PA 5C2GA 4FBUA 1HWJA 1RAIB 2MJUA 3PJ9A 3OUYA 2GVZA 1N88A 2DNYA 3KLVA 1NHVA 4FPRA 4HDHA 2YQ3A 3TOQA 2HNYA 3RYLA 1HQUB 2JH3A 5C25B 2N82B 4ANCA 2CUYA 4KHRA 1VBZA 4F04B 2DT9A 2AJ0A 4UZCA 1D09B 2O5DA 1P8GA 3VQTA 3JSMA 3V81A 2DXEA 2CQ3A 3BGRB 2YNFA 4ZVOB 2UUBF 2V5HG 2K1RB 2OD6A 1H7WA 5F8HA 4NLOA 2G2OA 4ECVA 4XPEA 1FK9B 1NSKL 2V67A 1KHVA 4MT1A 5CYQB 1RT5B 4CO4A 2MQOA 4WFBQ 1JLQA 4DL0C 1IQTA 2H48B 4U67Q 4C9DA 3W2WB 3MOJB 2V9KA 1RHRB 1Y11A 2XGPA 3GFHA 3OV7A 2QA4S 1XEZA 3MXHP 2YX4A 5H9FJ 4J9OA 3TAMA 2C2MB 3HCXA 1VQKS 1HYSA 1YBUA 4M5HA 1VBYA 3UR3C 1AB8A 2LYVA 2F4FA 3ENWA 5KFUA 3MEGB 1F3VA 2X3GA 3FQLA 4JV2A 1RWMB 3CJKA 1UVIA 2COLA 3W5XA 2IVMA 2Y1RI 1F2HA 1N0UA 4ED6A 1SJ1A 2OI2A 4UOGA 2XC9A 4FXVA 3Q8UA 4ZPVR 4DWIA 2DVIA 4JOUA 4N8OA 3PW7A 1QE1B 3MM9A 3MD3A 4JI4F 2B6AA 5D78A 3CCQS 2HHHF 2RF2A 1ZTWA 4Q45A 2DNGA 5JVGQ 5A8RA 5BYQA 3DLKA 1RTIA 1QDUB 1U1QA 2CZ4A 2LDYA 1RT3B 2YX1A 3BN4A 3Q0AA 1EP4A 3HHKA 4OQJA 3TX8A 2B6AB 2C2DA 4CTAA 4ZK7M 3NBPA 1HQEB 2DNOA 1PYOB 2XMVA 2ADBA 1QTNB 1NDKA 4URSA 4ZHRB 3GFYA 4Q8FA 3VZHA 2D69A 4RW4A 2WHOA 3CVKA 1CJTB 2HQGA 1EARA 1UZHA 2VKZG 9ATCB 2ZZMA 4DFKA 2XYGB 4K4UA 2QLJB 1LKZA 1Q81T 4WFXA 5GAGI 3AA9A 1TVRB 3OR1B 5RUBA 4YHHF 2L9NA 4JYAJ 2BJEA 1KRPA 4WKRA 1TAQA 2DCLA 2VJVA 4OI0A 1SC6A 1HA1A 1P1TA 2RHQB 3DM2B 3HM9A 1EQ0A 2R7VA 1M5SA 3CDAA 3IR5B 2V4JA 3FJ2A 3ZNUA 1AYEA 1N54B 2I5JB 1S9EB 5KFHA 2L08A 1SL2A 4NXMF 4YQWA 3T6BA 1ZETA 1X9WA 4HLBA 5E41A 1DLOB 3AXMA 4C97A 3FBBA 3MI7X 1NU4A 4PZVA 1G2EA 1LFPA 4UOHA 1EETB 3KLIB 1FRMA 2I5JA 4LQ3A 2OLWA 3DOMA 4PXDA 2VA3A 1UJ4A 4B9MA 1S4FA 3ONQA 2P6SA 4Q43A 4OZ1A 4NX9A 3AY0A 4PCQA 5GMKa 3D7SB 4IO9Q 4FKXA 5DLGA 3PW2A 2ASLA 1J5EJ 4WP3A 1J5OA 2EXUA 1RADB 1Q8KA 2BABA 1D8YA 2E7VA 3HDSA 1RAEB 1QAXA 2CQIA 3ICLA 3W66A 4F2SA 2WVDA 4DFMA 4QU6A 1TK5A 1TZ0A 3GG1A 4IH6A 1KQKA 4X62J 3G8QA 2ADCA 3QGGA 4N47A 1AZSB 3P8BB 3BDEA 1JLEA 3V4MA 4DV4J 1T9UA 3PFOA 4JI8J 2M9KA 3RRKA 4UT4A 2X1GA 4UOFA 2R8GA 3DXSX 3GE9A 3H2UB 4X62F 1WC6A 1U45A 2KVIA 4LR8A 2HZCA 2NSCA 2FZCB 3OFEA 1UFWA 4KIAA 3VGVA 2WSCC 3H40A 1OO0B 1L3VA 5C7PA 1JNZB 3A13A 4FVMA 3ZFVA 1MMDA 1FKOA 5HJYA 2CWKA 5K8NA 3VAIA 3HULA 2DHXA 5D6GA 1Y7PA 2BQRA 2DB1A 3TRGA 3FMWA 2Z2LA 1PYSB 1S99A 1TL3A 3DLJA 2EG1A 3KJQB 4X4SA 1JJ4A 2R7UA 1R0AB 5F8NA 1FNMA 1NK6A 4X4QA 4Q44A 2V34A 3LUYA 1YBAA 3VWSA 3GJSB 4ZPAA 1B70B 4CM0A 2EFNA 2ERRA 2NXJA 3L95X 3F44A 4GC7A 3BBFA 3MPVA 4G1IA 4JI2J 4PRFA 3SCKE 1FXRA 3MM8B 4QYZJ 1ZA1B 1B0PA 1C0TA 1SV5A 3AOCA 5AE1A 2CG8A 4YR2A 3I55S 5GVQA 3PO4A 3KNAA 2QL5B 4X2BA 4OZLA 4B02A 3R6GB 3OVBA 3O1LA 3D28A 4RZRA 5THWA 4OYMA 4DX8H 3OHBA 1E6VA 4PAAA 5HVFA 5K8PA 3K58A 1KQSR 1RT7B 2DGTA 2MPUA 4AXJA 1NJZA 2BR0A 1MWZA 3MUMP 4XPCA 4FF2A 1V6HA 2KI2A 3VAJA 2FHKA 3AOAA 4DV5F 3BGLA 4OZ2A 4DX7A 2RIJA 1T9WA 3IXQA 3K89A 4YR0A 2GIFA 4DR5J 2XLJA 2WOMB 3T5LA 3QRPA 3DYAA 2I6WA 2E29A 2J6SA 5J2MA 3NWGA 1SJRA 1W7WA 3H8YA 4F2RA 3KFWX 1U8WA 5L9XA 4I69A 5CHCB 2MY7A 1X5OA 4DCJB 3T1HJ 4P73A 3DLHA 1OWXA
chains in the Genus database with same CATH topology
2D3UA 4IR1A 3K8VA 1DARA 2E5IA 3HVTA 2I2YA 2KJWA 3PX4A 4TY8B 2ZDOA 3DMJA 4RBVA 1T05B 2PD1A 1HBOB 1YVFA 2C42A 3UD4P 3HLUA 1LK5A 4ZCIA 5F9NA 4DG1B 4HH1A 1URRA 3EPGA 4NA1A 2XULA 4OZNA 4TY8A 2IM0A 4HVZA 3V81B 1WEXA 1GT8A 2P5VA 2PC6A 1WF1A 3BQ2A 1S0VA 5BR8F 4EFAC 2CQ4A 3VAFA 1N52B 2IAJB 2RRBA 5KFKA 2B4VA 4BWJA 4NZ6A 1NK0A 2KDOA 1N5TA 2KYZA 3W2VB 1M0SA 4N8NA 1YJWS 1JXLA 3GSDA 2RDJA 1NB7A 2PI5A 1VQ8S 4CZCA 1L3SA 1S6OA 2L41A 4F4YA 3BM7A 2JL9A 2RMLA 4O3SA 2UZAA 3K57A 5F8GA 1Q7LB 2IBKA 2HNYB 4ECTA 1RTHA 5HMZA 1IXKA 1Q78A 1N33F 1U8SA 2PIIA 2B9XA 3H5UA 3NAIA 3VAKA 5JXSA 5EUHA 3JTPA 3BGRA 4NLRA 2GO9A 2YWGA 2FDNA 1B0VA 2HRYA 3DRRB 2PE8A 3NCQA 2MGZB 2I0XA 2FVRA 5IWAF 1TKTA 2DBBA 3E01B 4M5DA 3SFUA 1UVKA 1R43A 1FO1A 3QAEA 5B0FA 1BGXT 2AV5A 4DUZF 2XSFA 3IA0A 3I32A 2UUAF 4ZPCA 2R7QA 1R89A 4PPDA 4YR3A 2J7UA 3SDEB 3OTOF 3KMQA 2OTLS 4UUWA 3MDFA 2GA7A 3MFHA 2VKRA 1VOMA 2ZD1B 2WSEC 3M2RA 2KM8B 1S76D 4AL6A 2XY5A 4F02A 1DTQB 4PUOA 2CJBA 4B9NA 1T7PA 4UOCA 3FZ2A 1KVJA 2F8MA 1XERA 1JLGB 2J7KA 2ZOMA 5G4DA 2ZHBA 1Y3JA 3RB0A 2XGQA 2ROEA 1JLCA 2OPRA 4EZ9A 2DISA 4M8LA 1VIOA 3HPOA 3M6WA 1VRUB 1WELA 3MEEA 4WJBA 1Q82T 2VBZA 3PFEA 2DTJA 4PQAA 3LP0A 4E0DA 2H9ZA 1SB6A 3IG1B 2JC1A 4L6V3 3DHWC 1N36F 4X84A 3U1LA 3LAKA 1JLBB 2OTJS 2KTQA 5DM6Q 4H4KC 3KK2B 1VQ7S 1HD0A 2E1MC 2M88A 4LFCF 3BR9A 2Q6BA 4OX7A 1UWBB 2ZH2A 1BQXA 1VGYA 5DG7A 3NNHA 4ATNA 2CDQA 1R8PA 4RNFA 1U24A 4OHVA 3S6EA 2DO0A 4F25A 3OSNA 1KTQA 5KG2A 2XY7A 1CQNA 4DUYF 1QM9A 5EDWA 3Q8PB 3NNCA 4IOBA 2O3DA 1QAYA 2CQPA 4TXSA 2J0WA 3UCZP 4F26A 4RW9B 3MR3A 2AYEA 2N4CA 2FJDB 5D77A 5G0RB 4BHQA 5DGBA 4EEYA 2Q3PA 4M94A 3M9NB 3EUNA 2QSFA 4DF8A 2CFXA 2MQLA 2DHSA 4KAIA 3SQGB 4WU2A 1NK5A 2JEIA 3DCAA 4I7FA 4K50A 1CG2A 2J0SD 4EWTA 4RW9A 2CPYA 4KFBA 4J9QA 1LWEB 2POKA 4KJIA 5FJ4A 2YTCA 1L3UA 3NGKA 3SQGA 2FPHX 3KG1A 4OHYA 2KH9A 3G8SA 1S49A 2YWHA 2IMWP 1PSDA 2ZUGA 2QT7A 5E5NA 1R8AA 1RT7A 2ROGA 4DV1F 3N28A 1Q79A 1RAJA 2AJFE 2ZH4A 2N4DA 4RUCA 2HHPA 3HHDA 1LFWA 4NLXA 4DV2F 2IA6A 3AA8A 1NEEA 2DGXA 1T94A 2QA4G 3P49B 4CO5A 3DRPA 5IM0A 3MMAA 4MIBA 1KQFB 2HMIA 2ZVSA 1R31A 4FZVA 5IQ6A 5J2PB 1WG1A 1RT2A 3HHLD 4ED1A 1REVA 1HNXF 3FEYB 1BQMA 2XB2D 2JOQA 4OI2A 4QOTA 4GO7X 4LSNA 1X4EA 2CQ2A 4TLRA 3RW7A 1Q1KA 3G8TA 3I0RB 3M4XA 2N3OA 3VAHA 5B09A 1XNQF 3NNAA 1FJCA 1LWFA 2R8IA 2AGPA 4PG5A 1FDAA 3BS9A 4F4ZA 2F8EX 2CQDA 2FLLA 4EBCA 1OPIA 2V4QA 2B4OA 1FDNA 4R5PA 2L9WA 1F9FA 1R7IA 3OJSA 3PV8A 4IOCQ 3ENVA 4P6QA 3B4DA 5CD4H 4ED5A 1X4GA 2F1FA 1X7VA 2HHTA 1TK8A 4A46A 3D0GE 1KONA 5KTQA 3I96A 3N5FA 4F3QA 3I5BA 3V6HA 2Q66A 5E0OA 4NLTA 4WFZA 4CTAB 1IN0A 4ECXA 4IG0B 5KFWA 2JZ5A 1A6LA 2IRXA 1N32F 2J9DE 3V2UC 5F8LA 3Q8QB 3CXCR 3FRYA 2K1RA 1T8EA 1QE1A 3IBWA 2PT0A 3MM9B 1D9AA 3FNNA 1TL5A 4QWDA 2FJWA 1UFLA 3G71S 2DNZA 2XSJA 3O3LA 2ZHAA 4TNOA 3FMBA 2ACYA 2IC3B 2GNKA 4LUBA 1QAJA 1Q8LA 3N6LA 4QR1A 4A8QA 2B43A 2CVEA 4P7VA 1TQLA 2DPJA 3MHYA 3PACA 4XAKA 2XSJB 4LSLB 1N5VA 3MM6A 4YB6A 4M5DB 2RS8A 2WSFC 2ZBCA 2ZHOA 1GTEA 5IQQA 2GC8A 4FNHA 2BE2A 3TAQA 2MZSA 1SKWA 1YITS 3QGIA 2XI3A 4ZCLA 2GV1A 2KU7A 4I0WA 2HWIA 2Y0SD 4A8SA 1EP4B 4R0JA 3RU0A 4ZKAA 4TQSA 2MKCA 3TA2A 3L7OA 5GAGU 2W8KA 5KFOA 3O44A 1HNVA 3DLGA 1L5UA 4X4RA 1Z2ZA 1DTTA 3MAQA 3THTA 2CJAA 3N0VA 3HHLC 4J9MA 4B9TA 3OFGA 2DRBA 3BF4A 1FJEB 1C4AA 3DFEA 2JFKA 3HF5A 2G1DA 1WHVA 2NREA 1HI1A 4NLVA 2LQBA 5U47A 3H25A 4EO8A 2BUNA 3MFIA 4KC5A 5KT2A 2UVUA 3R3TA 3J7Z5 1HYSB 1YJTA 4NOHA 4JI8F 1VQNS 2E1AA 1D9DA 5DRKA 3KHLA 5D4LA 3OL7A 2RT3A 4WIIA 2VODA 4KGMA 3I0SA 2ZH9A 1X4CA 3PY8A 4V19J 4MFBA 2CPHA 2UUTA 2QO3A 4R8UB 1WG4A 2M0GB 1I6JA 2IVYA 1FXLA 4MK8A 3LGNA 2DGQA 4C11B 1S1WB 4Y00A 1N5YB 5I4MA 2ZH7A 3E3XA 1CC7A 2VFTA 3PIPQ 1ZAWA 3CJ2A 3CJ5A 2QMWA 4USHA 1U49A 1J5EF 3GB0A 1VHFA 5IT4A 1FE4A 2D9OA 3HZGA 2VQEF 3L09A 2XLIA 4N5SA 5EX0A 1LWCA 2ZJRQ 4DR2F 2MQMA 2ZM6F 3R5CA 2F3JA 5T41A 1WNEA 3D2WA 2PFFB 4CO2A 3SSQA 1L3KA 5B0DA 3J81Y 4NL5A 1G3OA 4IYQA 2WTFA 4A8MP 1N56A 5CQGA 3OFFA 1XC9A 3RTVA 4ZA1A 1Q7YT 4PKDB 1S1VA 5FIIA 3UCUP 4TU8A 3BO3A 4PG4A 4O23A 3TR5A 1NZAA 1R8HA 4DV0F 3AHPA 2ZITA 5KFRA 3T1AA 1UL3A 4FXDA 2HMIB 3JAMY 1X5TA 1SH3A 3TNVA 1QVFR 2AQ4A 3DMJB 3K5PA 4DQRA 4ITSA 4K4XA 3DYAB 3TA0A 1YGYA 3AJ2A 4DR3F 1I94F 2H5EA 3B4MA 4ZPTR 2IJFA 2OPSA 1N34F 1P27B 2GQCA 2A10A 3HKWA 3K5OA 4MTPA 1E6VB 3MTKA 1TKXB 1OQ6A 2LVWA 3VR1A 1NAQA 2AD9A 4KT0C 2R8HA 4B17A 3M8RA 3LPYA 1IKVA 2R7RA 2EG2A 2DIVA 1HMVA 3TAMB 2R8KA 3KG0A 4URGA 2OPSB 1TKZA 5SUHA 2JSXA 2RU3A 1JLFB 3RBDA 4DDFA 1FNOA 4RWWA 4DL3A 2C3MA 5J2NA 3Q2SC 1OSCA 2VV5A 1QUPA 1IKVB 4UQGA 3SSSA 1RTDA 3BJYA 4G3IA 4WZQA 2FC9A 1NJXA 2HFNA 5D3GA 1PC5A 3CCRS 2L3MA 4MYUA 2WK4A 4J5OA 2HRUA 4IG0A 2U1AA 3POTA 2XMTA 2N3LA 2MHNA 4PG7A 2HQIA 4ZP7A 4RNMA 1GAOA 5F0WA 1BQNB 5E33A 1HQUA 1MROB 1V3SA 4KHMA 1LW0A 5DETA 5K14A 3V6DA 4OHZA 2IC3A 3VF0B 1KSPA 1P1LA 2VBXA 4XK8C 4DFMA 4KB7A 2GMHA 2YNGB 4U7CA 1NK7A 1RTHB 1WHYA 3M6UA 2XO7A 4WFYA 2DHGA 4LF8F 1MU2A 3UNGC 4G1QA 4WF9Q 4YUDA 4USIA 2GHVC 1QSLA 1NK9A 3GG0A 3SCIE 1GX5A 3QGPA 3W2VA 3OSPA 2BDPA 3D1HA 1FEEA 5KFBA 1Q8BA 1VQSA 5GAEU 4J9SA 1HBMA 5KFQA 2MKJA 3I4PA 3HKZD 1YRTA 1HI8A 3G4SS 4WCEQ 1ZPWX 3RAXA 2W8LA 2HPUA 3H2LA 2ZC3A 2JEGA 4GO5X 2JJ4D 3JTNA 2XWYA 2R4FA 4DMZA 4RBTA 4FN5A 2ZD1A 1TFWA 2Z4PA 3NBPB 4OZJA 4URQU 4F4XA 3CWJA 2J6TA 3U7JA 3CCJS 1VQ9S 3C46A 3AAWB 2LA6A 1WD6A 2E5GA 5A0YA 2D9PA 1UW4A 1BY9A 2DR5A 4XIUA 4QYRA 1H3DA 4QWCA 2XS5A 2YNHB 1RT6A 2WAQD 1FD8A 1ZOTA 2FVCA 1LQ9A 2D1CA 5EWGA 3TQ1A 3RBEA 1DTTB 1FKAF 4I2QA 4LMZA 5F8IA 2CQ1A 1ZM9A 1WTBA 1N48A 4OI6A 5KFIA 4Q0BB 4C0HA 4DJBA 1JKHA 3FEXB 1D8ZA 3H4BA 3M2RB 3BREA 3R5AA 3HT3A 1FHTA 2YNIA 2OMLA 1FRIA 3RB3A 2PGCA 1RA7A 2DNRA 3CDWA 3BR8A 3HZEA 4UY85 1DFDA 4IH5A 3FSIA 2D3OR 2XMWA 4PXCA 1Y00A 4Y6IA 2HFOA 4QBUA 3GILA 2YKMB 2JX2A 3GIJA 1HWUA 1FJGF 2LEBA 1MMNA 2O1PA 7FD1A 4J9KA 3WZ0A 4X64F 4C2MA 4JV0A 4ZP6A 5EX3A 3HFKA 1SIZA 1TKTB 1ZM4A 2NYIA 5KFSA 5MAOA 2G4BA 4C8KA 2ZH8A 2ABYA 3I6PA 4O44B 4QU7A 3T5HA 4F3OA 2RDIA 4OJHA 6FD1A 4X4TA 5HLFB 1SXLA 1U25A 3IFEA 2KFNA 1VLYA 5F8JA 2RVJA 3QAUA 2LDIA 4QCLA 5M2PA 4C8YA 2KXFA 2FJEB 3LP1A 4JBCA 1WF2A 2DGWA 3H5SA 3T6JA 2RKIA 1ZAXA 4I56A 2EFPA 2FHMA 4A8XA 2YKQA 1S1XB 3T5JA 2MB0B 1F2GA 4EO6A 2EI5A 3QLHA 3M9OB 3THVA 1N5YA 4CT9A 1UMJA 4WKYA 3V4IB 5BYSA 3OTBA 4DV3F 1Y5LB 2GIRA 2J9CA 4DL5A 2QZ8A 4FF4A 1MW7A 2CQHA 2F40A 3KTQA 3ZZOA 1NK4A 3TA1A 5E3AA 4ALZA 1TK0A 2B5JA 3QYYA 3JYTA 1LW2A 4B9VA 1S1UB 4IKAA 3N9UC 3RAMA 3MR6A 4C3KA 3BSOA 4A48A 5GAHI 1AROP 4Y65A 4FS2A 1UVNA 5E3RA 4CNZA 1X0FA 1U1KA 3IWXA 3CJ4A 2VONA 2EBGA 1IJFB 2NPFA 4QJVA 1REVB 3MEKA 2K3KA 3O2IA 4HTJA 3I4HX 4NCBA 2YY3A 2W7PA 1JIHA 4NCGB 1TKDA 2OPPB 2RNEA 3OVAA 4RUHA 2HG4A 2RD5C 3CSKA 3FSYA 5A6WA 2J8AA 4RU2A 3MEDB 4A8YA 3P5TL 3HHNB 3CCZA 3S7RA 1R8BA 3CD7A 2DD8S 2AWZA 1SQEA 4LF5F 1TV6A 3IS9B 1FKPB 4ZLPA 5AE2A 4K2XA 3JSRA 2LU2A 3ENQA 2VC0A 4Q2MA 1BD6A 1NNDA 2J5AA 4RW8B 2BACA 4EBEA 2YWFA 4I7FB 1RKJA 1R3NA 1YJUA 4WXOA 4Y0FA 3GV7B 4FBTA 1S1TB 3OR1A 2E7WA 1YJ9S 2KG1A 4NLDA 2V2KA 4DFJA 3BDPA 4ID5B 2FTRA 1GX6A 2Q1LA 1AXQA 4M95A 2PO4A 2DGSA 3TI0A 3UE2A 4DR7F 1TR0A 3VZIA 2MJNA