1KVIA

Solution structure of the reduced form of the first heavy metal binding motif of the menkes protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
MDPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the reduced and Cu(I) bound forms of the first metal binding sequence of ATP7A associated with Menkes disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 13
structure length 79
sequence length 79
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2002-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kviA00
2VH7A 2K7KA 1OSDA 1FEEA 1YJRA 2KYZA 5IXUA 2RILA 2AW0A 3TOQA 3FGVA 4HL9A 3F44A 2FTRA 3BF4A 3T9NA 4A47A 3BN7A 5B0FA 4YEAA 1Q53A 2QLXA 2IFXA 2IYGA 2HQIA 2XMJA 1GXUA 1SI9A 2ASYA 2VV5A 3E8OA 1TL5A 1TZ0A 1MWZA 1W2IA 1VQYA 4ZA1A 4A48A 1YRXA 2LQBA 1OQ6A 2KKHA 2L3MA 2OD4A 4HI2A 2BBEA 3FRYA 1KQKA 2RSQA 1TUVA 2ROPA 3QGPA 2OKQA 1FD8A 2FIUA 2PGCA 1Y0HA 3BDEA 2GCFA 3DCAA 4Q2LA 1S6OA 1FVSA 2HIQA 3I9ZA 3KG0A 1N5SA 1OPZA 1FE0A 1V3ZA 2GGPA 1APSA 5A6PA 2N4CA 4ZOSA 2RMLA 3HDSA 4EFAC 4OIXA 1GXTA 2KT2A 2OD6A 1JK9B 2GV1A 1MWYA 1FVQA 1KVJA 1VQSA 1XBWA 2OAUA 2XMMA 1Q4RA 2OMOA 2AJ0A 2QYCA 3KKFA 2Q3PA 3MCSA 4U9RA 5F0UA 1TL4A 3WDOA 1X7VA 4Y2KA 1CPZA 4OJHA 1N5VA 2BJDA 2KT3A 2XMVA 2GGPB 5B0AA 3BGUA 5T7LB 3MZIA 1Y3JA 4Y2IA 2PD1A 4HH0A 3CJKA 3HHLD 1RJJA 3HF5A 1U7LA 4OJ1A 3K7RA 3HHLA 3HHLC 4DN9A 2OFGX 2QLWA 3KNGA 3UDCA 1LQ9A 1AFJA 1Q8LA 3GZ7A 4Y2MA 2XMKA 4NL5A 2HFOA 2FB0A 4F67A 5B0CA 2ZDOA 2JDJA 5KAKA 2ROEA 3TRGA 1YJUA 5B0EA 1QUPA 2RU9A 1ULRA 4YDXA 5B0DA 2AJ1A 1AFIA 2W4DA 2HFNA 1TR0A 2HLUA 4DPOA 1OQ3A 1P6TA 1FE4A 1YJVA 2XMUA 4HH1A 2OFHX 3QMQA 1KVIA 1R6YA 2LXFA 4A46A 2W4PA 2K7JA 1CC7A 1SQEA 2BYCA 3BM7A 2ACYA 4DL0C 2AP6A 2G9OA 3IWXA 2CRLA 2ROGA 3HX9A 4HI1A 1S6UA 2K1RA 1WD6A 5B0BA 2GA7A 2EW9A 2K2PA 4FNHA 4Q2MA 2N4DA 4A4JA 2XMTA 1CC8A 4FNIA 3KG1A 4OJ3A 1AW0A 3LO3A 1X0PA 2ZDPA 1IUJA 1YG0A 2QIFA 1JWWA 5K9FA 5F0WA 2LQ9A 3VTIA 4NPOA 1Y3KA 1N5QA 1X8DA 2BJEA 4OJGA 2GFFA 5B0GA 2LDIA 1K0VA 3LGMA 1P8GA 3LGNA 5B09A 1FESA 1SB6A 3HHLB 5A6WA 2IYIA 1URRA 2K1RB 2OP5A 3BR8A 2GO8A 3TNVA 2HLTA 5B08A 3IWLA 2W4CA 1N5TA 3DXSX 5T7LA 1Q8BA 4QOTA 2XMWA 3HFKA 2FHMA 1Y9OA 1YJTA 3FMBA 2BUNA 3BB5A 3CJKB 2N7YA
chains in the Genus database with same CATH superfamily
2A18A 5KG2A 2IDLA 4QIFA 1NH8A 4OX8A 3UN5A 1S72S 2CZ4A 4J5OA 5CZVA 3W64A 1IM6A 1XJWB 3T1YF 4RW7B 4ED5A 2RD5C 2ZKTA 4OZ0A 4RNHA 2XMJA 3UD5A 1GXUA 2BRLA 1TZ0A 4H4MB 2IC3A 2XCAA 3QNWB 3IRWP 3M2UA 3PX6A 2BANA 2MKSA 1RT5B 4TKTA 3KHLA 4OYZA 2AV5A 2HHPA 1RE1B 1WG4A 1NHVA 2L3MA 4P72A 4ZVEA 2JOQA 3W9JA 4ED7A 1KQKA 2XYHB 3EM1A 1S1WA 2MPUA 4ZCLA 3CMES 1YSJA 3KLIB 4NLDA 1NK8A 1W25A 2KRBA 3CJ3A 2V4JA 3NOGA 5K8NA 3OLBA 3RW6A 1F5BA 2JWNA 1MW7A 1GMWD 2H3EB 1ZA2B 1FXLA 1WKKA 2FJDB 2MY7A 4YN3B 2XZDB 4OV1A 3KLEA 4KT0C 2HBRB 2VFUA 3PG9A 5A2QY 4QPTA 2H5JB 1MROA 1VRTA 4EFAC 4N41A 1QM9A 2SXLA 4JI8F 1F2GA 4Q7AA 1FVQA 3MUTP 1SUQA 4FZVA 5BYSA 3I55S 3V5RA 2LXIA 1Q4RA 3GYNA 3M6XA 4GMKA 2HS3A 1TFYA 4OHYA 3HKWA 1C0UA 2HWHA 4KGVB 4DG1B 2ZBRA 3P5BP 2FZKB 1MMLA 3MM7A 1VGYA 2HNZA 1IN0A 3IBFB 1RWVB 3DLGB 4WP3A 3G8TA 4F4KA 2FGCA 1M5KC 4HH0A 2CPEA 4WFXA 1JNZB 4IO9Q 3V6JA 3HF5A 4RW8A 4KHPJ 2I38A 4NCGA 4CLPA 5AJ3J 2FJBB 3M4XA 3MECB 1JJ4A 2FHJD 3TUIC 4CRJA 1H98A 4OYIA 2H48B 1HNIA 3C6UA 4OI4A 3JTNA 1VRUB 4M5DB 3HM9A 2WBMA 4R8UB 3AQOA 4N8NA 4OYAA 5B0CA 2OMLA 5LMNJ 5E3QA 4LR8A 2UUBF 4LF6J 2C2ZB 1KEKA 1P27B 3SI8A 4C4WA 5GVQA 1GAOA 2HLUA 3BREA 1U1LA 4A8OA 3P8BB 1I94F 4ATNA 3PW7A 2E1MC 2E7XA 5K14A 4TXSA 3MMJA 1H74A 2AYMA 3A8KA 1VQ7S 4ZCIA 3GG1A 3LQVA 4Y65A 5ETPA 3SEOA 1M90T 5I4MA 3CDAA 3M2VB 2PFDA 4MAKA 1P9QC 4EO6A 2WB4A 3M6VA 3IFEA 3KLHB 2DNQA 4BS2A 4J9PA 3HT0A 1AYEA 3R5AA 2ZHAA 2IVMA 4JYAF 2PI5A 3PJWA 3RR7A 1TL7B 3CJ5A 4KBIA 2UXBF 2MZJA 5EHHA 5KOWA 4L72B 1C2PA 2V50A 3LO3A 1NDKA 1PYSB 2CXEA 4G1IA 1R8BA 2OGUA 5DRKA 4NPOA 5E41A 3H5YA 1NO8A 1BQNB 2K06A 2IY5B 5HMXA 1N54B 5ETMA 4L74A 4NCGB 3EXYA 3NGDA 1T0TV 4WIQA 5CAAA 1VIXA 2FVPA 1NDPA 1JJHA 2CUYA 4JB8B 3CC2S 5D4OA 1G4CA 4PYAA 1NJWA 1AZSA 1RACB 3HFKA 5D4LA 4DR6J 2GIQA 5ETLA 2RH3A 2ABYA 2CQBA 2XHCA 3GG0A 4FXWA 2IPOB 4B3RJ 2J9DA 5DS7A 3KNAA 2VG7B 4DV3F 1MN9A 1DY3A 2AW0A 3VV2B 5J2MB 1CJKA 1C4CA 1FD2A 1Q8IA 3B82A 2B4PA 3T9NA 5C2CA 4CLWA 5IV3A 3W8PA 5EWEA 2ZEJA 1RABB 1F5AA 4LBHA 5L9NA 2IFXA 2VG5B 1YBAA 4M63A 2CNNB 3D7SB 3LPYA 3J80U 2HNDA 4AE5A 1T7PA 2XS7A 4FVMA 5LMUJ 1NSPA 2EG1A 1S1UB 1K1QA 1VS3A 5F3TA 1SUQB 4ZVQB 4ZJQA 3NWRA 4I68A 3SIPB 2GQ2A 3A3NB 3KLEB 3D6HB 2NXEA 4OZ5A 2OKQA 1FD8A 4WKRA 1X4CA 5DZ7A 3W3SA 2IRYA 3DCAA 2G0JA 5HLFB 1FVSA 4DJBA 3J7YU 2CPJA 5L1JA 4YY3J 2X1AA 1X4FA 2IHR1 1X31C 4M5HA 2GGPA 2YKMA 1NH7A 2D7SA 2IC3B 5EDWA 3MDFA 5HJXA 3CEDA 1LW0B 2DD8S 1RT5A 1KQGB 4KY3A 4ELTA 1C1BB 3MHYA 2XZTB 3T1HJ 3AA9A 2XMMA 2FJXA 2YKNA 1NAQA 1JLFB 2QJ3A 1XN9A 2VFSA 4GKKJ 3CWJA 3EZOA 2JZ5A 1HNXJ 2RE1A 1UEKA 1EKRA 2CQ3A 2B5JB 2ZHBA 2G1HA 2IM3A 1PIEA 2XMVA 1O0PA 2X51A 2Y8YA 4QWDA 2NZ4A 5T14A 2C2NA 4Q5VA 2GAGC 5FJ4A 2VB6A 4QWCA 1R31A 1RHUB 1RUSA 2W2MP 5HQLA 2RKIB 5HI7A 4X2BA 4EUVA 1T11A 1AUSL 2B4OA 1ACMB 3ETMA 2HGNA 2KM8B 3NGUA 4ES3A 3BQ2A 2C22A 3KLFA 4J9QA 1N8RT 2OEKA 4TY9A 5L9XA 1VBZA 3DOKA 2UU9J 3KK2B 3BGLA 4DV2F 2GC8A 1Q86T 2HURA 4P2FA 2FHKA 1FKPB 1WI6A 2VBZA 4WXOA 3ZZTA 5F3ZA 1REVA 2B6AB 1LWXA 2RHQB 2W25A 3M6UA 4LFCJ 3BEGB 2CQDA 4FYDA 3OTEA 1NNDA 1NB7A 3EGVA 3PZPA 1OQ3A 1NK5A 3O3LA 4HH1A 2M52A 1F9EB 2HBZB 2X1FA 4NRTA 4CQ1A 1UKUA 3MMCA 2W4PA 3GIIA 2MLXA 3ULHA 3GV8B 3HVWA 4NMLA 1PJ7A 4RUBA 4DSJA 1EJ7L 1DTTB 1AA1B 3UDVA 4DL0C 3ZTRA 3DRYA 4AQYF 4Z7YA 2VOPA 2VA2A 2DR5A 2K1RA 2KM8C 4KB7A 2YNIB 4C3MA 2J0QD 3A1YG 1XK8A 2DGTA 1NEEA 3B4DA 3LP0A 3MMAB 1WDTA 4KHRA 1S57A 1Q7YT 1TUWA 2BM1A 2EK6A 2HNDB 5LJ5Y 4CTAA 4FBUA 4ETZA 1UMJA 4QU6A 4M5MA 1GFWB 4USMA 2HK2A 4H4KC 4DSEA 2B0GA 3VF0B 3VALA 4IOCQ 1HW9A 1ZM3A 3RTVA 2YKOA 4WXWA 4MKVA 1XMQJ 1HBMB 2JRSA 4C0BA 1CJKB 1S76D 1AB8A 2GMJA 2OI2A 1DTQB 1RBLA 3EWGA 3FC9A 4UQTA 5IOLA 4R0EA 1RWKB 5DM6Q 1IQZA 3MMBB 4L73A 4USJC 5CHCB 3SDEB 1PKUA 2DKOB 3PRBA 3GSIA 3PJXA 3PYGA 3D28A 4M5NA 3U1NA 3X3UA 2JC0A 3LPEA 3MECA 2QGFB 1SL1A 4YHHJ 1WEYA 1EKSA 1VQPS 1LXNA 4UW2A 1GXLA 2MSSA 4TY8A 4UT4A 4X65J 4DV6F 4QU7A 1CQMA 1U0HB 1H0HB 4MKBA 3ZZRA 3ADAC 3KOAA 1FEEA 2D3ZA 5D77A 2MLYA 2J9EA 1DTQA 2KO1A 2H5IB 2OPPB 2Z8QA 3A8IA 4LF1A 3ENAA 3BN7A 1GMWA 2ZH3A 4EYIB 1NDCA 3PFOA 1F5CA 2QLXA 2E7VA 3UD3P 1HNXF 1WHVA 1XC9A 3DYAB 5KFKA 2DHHA 2HHHF 1BMQB 1V5VA 4HYKA 2HKEA 2KXHA 2V9KA 3RZAA 3DDKA 1QDUB 5L39A 3MR5A 2BACA 4KH1B 3UDEA 1RTZA 1WC3A 2MQOA 2ZJPQ 1JJ2R 3MEGA 4B3SF 2ROPA 4I6YA 5AXMA 2QA4S 4U7UD 1VI7A 2YWWA 1F3FA 5GADU 1LWCA 2V34A 1S1VA 1D09B 1LK5A 2CQIA 3OQ2A 3OPKA 1V3ZA 1F9HA 4KRWA 1DARA 4FXVA 2N4CA 4PG6A 5A6PA 2MGZB 2XULA 1KOHA 2HS0A 2XYPB 4ELUA 4PYDA 4A8SA 2CQGA 4ANCA 1T95A 2B8PA 2PA8D 3MTKA 3Q24A 2ZHOA 2DXEA 8AT1B 1SC3B 1PBUA 1RKIA 2K3IA 5KFTA 5HL7Q 5JUMA 1XNRF 4CH7A 2CPYA 3T1YJ 2QMUB 1XMBA 2E5GA 1NZ8A 2Z2LA 3ILJA 2LQ5A 2ZITA 1HD0A 3CE8A 4DHVA 4ZITA 3BSOA 1IKYA 3CC7S 2BE2B 4LF4J 5D0HA 1ZPVA 1N5VA 2LVWA 2HHSA 4Y6IA 2RF2B 1HL6A 1UTAA 1OYEA 3BR9A 2XLIA 1VDHA 3KXDA 3JYTA 1FEHA 2BJ9A 1SC4B 3Q89A 4PG7A 4CYUB 1QSSA 4KQZA 4G65A 3EYZA 4X4SA 2JLGA 4DQRA 2F65A 2QL5B 4KV8B 4PUOB 3HO1A 3GZ7A 1P9YA 2FUG9 1RT2B 2WRMA 2BZ2A 1W7WA 3BBFA 4QR2A 3QFWA 3G71S 1UA1A 1YRUA 3MM7B 4O3SA 3FVYA 5D78A 1YJ9S 1XNQJ 2JLEA 2MTLA 2IAJB 2YWKA 4P75A 4IH7A 2WSCC 1DURA 3AOCA 3GB0A 3MCNA 3R7NB 4ZLJA 3G6ES 5L1LA 2VL1A 2RIJA 3KJNB 1AXQA 4NZ6A 3VAIA 1AFIA 1BY9A 2MY8A 2W4DA 2FPHX 3C2PA 4PQUA 3C8YA 4DPOA 1FJGF 3UCGA 3ZTQA 4WKYA 3AJDA 5KFBA 3J81Y 2AMCB 1J2VA 2C3MA 4LF2A 4QJVA 4LUBA 2XO7A 5ETTA 3K58A 2BQUA 3JQJA 3W65A 1CEZA 3R9LA 4DV6J 1TMMA 1JLEA 4HHJA 3SFUA 2I8EA 1Q8KA 2MQPA 5DM7Q 2QE5A 4CLTA 2YKQA 4WFBQ 3GFYA 2C2MB 2NZCA 4C98A 3PW5A 2NPFA 3FK4A 4QR0A 3A3PB 3TZXA 4JI5J 3H90A 1K0VA 1CULA 3MM6A 1HBNA 3CCWA 1VC0A 4ED1A 4FNHA 2Y8WA 1U2FA 5KFAA 2CJBA 2BANB 2DB1A 4FNIA 2LCWA 3VGTA 4AXIA 1HNZF 2CPHA 1F2HA 2DGQA 4B02A 4PWUA 6FD1A 3D6FB 2AZ3A 2QRRA 2J0WA 4KR0B 5A8RA 1E6VA 2UUBJ 4JV0A 5E3PA 5K8PA 3GQCA 1BLUA 2LDIA 2IJNA 2PN6A 2ZJRQ 4Z7CA 4DCPB 3I82A 3CO9A 5F9NA 5KT5A 3M8SA 2NQPA 1FNMA 1HBUB 2RDJA 2LXUA 4YB1P 1MMDA 2RF2A 1UL3A 4H54A 5KG3A 4C7QA 4EBDA 1WTBA 1N34F 4C8OA 1TTHB 1RT4A 1OIAA 2MQ8A 3A3OB 5IV4A 5EX0A 3EX7B 3UE2A 3R6GB 2W01A 2P6SA 4DV5J 4RUCA 2QG9B 2M0GB 4I2QB 2LLZA 9ATCB 3UO0A 4OZLA 1TL5A 3HHNB 2E5HA 2HRYA 2MGZA 1VBYA 1VQYA 4OYBA 1SKUB 1UEVA 1VQ9S 1ZAVA 4O4RA 2VA3A 4ZDNA 4DR1F 3OL8A 1LWCB 3RBZA 2BBEA 2M8HA 3KLHA 4DFJA 1S4EA 1NKBA 3QGPA 5KFPA 3CCSS 3K17A 1D9AA 3OVBA 1HPZA 1WG1A 3ITHA 2AYEA 4F7VA 4ECRA 1XMOJ 3IN5A 4OX9J 5IT9U 2MJUA 3I31A 3M2VA 1OPZA 2I9SA 1RQ0A 2OSRA 1RTDB 1GMVA 2EBGA 3LOUA 4OYWA 4XTTA 4YB6A 4ZHRA 3TVKA 3QATA 1VQ4S 3N79A 4ECYA 2OTLS 1FJCA 1FRHA 3R5CA 1PJ5A 1PAEX 2PMZD 2CNLB 1NLKL 3ONQA 4NLYA 4ZKAA 3CCLS 1VC5A 2FVCA 3GFXA 4FYVB 3OXGA 1YJNS 3PYFA 2AX1A 2P9GA 2PSZA 1RT3A 4DQQA 1T8EA 1QAIA 2RQMA 1QSYA 1JQGA 2DNRA 2F1FA 3OTOJ 1VQNS 3NMAA 4KH0B 1W26A 2XNQA 2F9JA 3DXBA 5JXSA 2AYGA 4QQBA 4OYPA 3ZZPA 1N88A 3IGVA 3CD6S 2XWYA 1WEXA 3QJJA 2KTQA 1XERA 2HVIA 2YNGB 3C14A 3H42A 4NLPA 4YS2A 2FVRA 2F8MA 4OZNA 2DH8A 3AXKA 4RPFA 1RXOB 5EX3A 2QSWA 4DU8A 1UFWA 2R8IA 1QE1B 1UEUA 4ECUA 4ED0A 2MKJA 1S0OA 1U0SA 3ISND 4LQ9A 2ZJQQ 5E5NA 2DHXA 3IP0A 5FDLB 2JJ4D 4CO1A 5ADZA 2DNYA 1HBOA 2AJ1A 2M3DA 4MFBB 1VJQA 3T9ZA 4WTOB 4DV1F 5HP1B 1VK3A 3KTQA 4AYBD 5I42B 1JXEA 1FXDA 3C66A 4MJKA 2E9TA 4LFBF 1FE4A 3JSMB 2ZH9A 1NDLA 2Y1LB 3QJPA 3PEHA 2CJQA 1BC6A 1R6YA 1V3SA 1YBTA 3S7RA 2E1PA 3G87A 4GRSA 4K7QA 3BM7A 2WCXA 2ACYA 1WUUA 3AH6A 3WQPA 1LW2A 1IM4A 3D54A 3D5MA 4RNOA 3MFHA 4GC6A 2M8DB 1EQ0A 2XS5A 2PFFB 1NSKL 3DRSB 5IZHA 2XQCA 4EBCA 1S99A 2ASDA 1VISA 4K0KF 2PEHA 3AQPA 4ILRA 1RHJB 2XMTA 5ETQA 1LOUA 2F4VF 4JV5F 3UPFA 2V2KA 3KJVB 2ASLA 2AJQA 1CJVB 1NPPA 2WOMA 2LQ9A 4OFZA 3FQKA 4QZVB 4BWMA 4CDIA 2EPIA 2A6MA 3RAXA 2BQ3A 1RA7A 2GFFA 2XSJB 3ZFVA 5BR8F 1GTEA 2GHVC 1M5SA 4H4MA 2RQCA 2GHWA 2H65B 2RQKA 1FDAA 1FESA 2V4QA 4F4YA 2DNZA 4EYHB 1N0UA 2FJWA 4FF3A 4ZJLA 3OR2A 1LFWA 5A8WB 2DR8A 3G82A 1IKWA 3DXSX 1SJFA 3FUYA 5IC4B 2IDEA 2PMHA 3HSDA 3LANA 4NEZA 4DX8H 3W9IA 4ECXA 2CQ2A 2DYAA 3ITHB 4CLYA 4IH5A 2DVIA 1YJRA 2OO4A 1FTCA 2BXJA 1L3VA 1JLFA 2F7VA 5F8LA 5LMUF 1D1UA 1TKDA 2OPSB 4QIGA 1UFLA 3Q8QB 2COLA 3E8OA 2XCPA 2RUSA 4RW9B 1IKXB 4OX7A 1RI7A 4ZA1A 3IS9A 1HI1A 4LSLB 3V4IB 1ZA1B 1OQ6A 1WELA 2CNKB 2VD3A 3K2YA 3NLCA 4GO5X 4P7TA 2LYVA 3PHEA 1UVJA 2UV8A 1M5VC 4AL6A 3GCWP 1NUEA 4DL3A 4JI8J 3AJ1A 1L3KA 1H2TZ 3PR4A 5IQQA 1J5OA 2VONA 2HPUA 3J7AN 1N5SA 2HHTA 4YHHF 2AQ4A 5EN1A 3RAMA 2WAQD 5IT4A 2HS4A 3MUVP 1S6PB 1QVGR 2HZAA 4L6V3 4X65F 2DTJA 3CJTA 1YITS 1RT3B 2BJ7A 4WYLA 1L5UA 4I0WA 4QYZJ 1UJ4A 1KR4A 2VFRA 2ZBCA 4M8LA 2J6UA 4BHQA 4ZLPA 4ZPDA 5M2RA 3LWLA 3GLJA 2OMOA 3BGFA 3QAEA 4ICLB 4IO1A 3DMJB 2R7RA 4JBCA 3A8EA 1REGX 2RT3A 1X7VA 2YPZA 3DOLA 4OZJA 1SL2A 4X4VA 3VGUA 4DZDA 1B99A 2A1BA 4NLGA 4EBEA 4NE9C 2DEIA 4W98A 1IBLJ 5HBMA 1Y00A 3QBCA 3MTJA 4ZVHA 1QJHA 1DBDA 5KG7A 5DG9A 7FD1A 4LF5F 4OJ1A 1RWPB 2HEKA 1SC1B 1RCXB 3ILLA 3BQ1A 2U2FA 1UVKA 3T41A 1T3NA 2JEFA 2DNKA 2L41A 2ZKUA 2ZM6J 3RU0A 1R89A 2HHQA 1TMJA 1TKTB 4CH0S 2P5VA 1BQXA 2IRXA 3DU5A 3JQMA 3M2RB 3PRDA 2E44A 3B78A 2VKZG 1NHKL 4F4XA 4C3LA 4B3TJ 4C8LA 4DR4J 1WHXA 2IA0A 3R1LA 2RU9A 3V4IA 3W5XA 1G3OA 3KJFB 5A8KA 5KFNA 4XIUA 2EXUA 4A8YA 3H7HB 4RW4A 4M5JA 2ZH8A 4ZPBA 1WC4A 1WSVA 1NSQA 3QMQA 4YDDB 1RHKB 3QIPB 3W63A 1JXVA 4YB5A 5EUHA 4NZ0A 1HW8A 3MM8A 2F40A 1SQEA 2BYCA 4CLFA 2M4MA 4UOCA 4DN0A 2F5GA 3E01A 4HACA 1YIJS 3BH6B 1WF1A 4OMFG 3LA0A 1HWJA 2WVEA 3D68A 1FFWB 2WOMB 2YX4A 4CI0B 4I69A 3C6TA 3J7ZT 2VBWA 2X3GA 3MEDA 3GIKA 2V8VA 1HYSA 1FCAA 3JS9A 1CJUB 1RTHB 2QIFA 3T19A 2BE2A 3W1YC 3M9OB 1IKYB 1T9YA 1SJRA 2BVZA 1L3TA 2RRNA 2OSQA 3N5BA 1WF2A 5GAHU 4TYAA 4RU9A 2V9WA 4C0OC 3LGNA 2QL7B 2VASA 5B09A 2FC8A 4MKYA 3AT1B 1Y7PA 3CTRA 2YX1A 3CW2C 1WG5A 4P52A 2YH1A 2DISA 2HLTA 1S77D 3S6EA 3PDNA 5H9EK 3GIMA 3BB5A 2HVHA 1SH0A 4R0JA 1X5OA 3C15A 3D67A 4LBPA 2WVBA 4DZ6A 3K8VA 3G8SA 1TK8A 3PX0A 5CD4A 2G2ZA 4K2XA 2QN6B 1RADB 4NLRA 3U27A 1XTZA 3D9BA 2KJWA 4PQUB 5IQ6A 4E98A 4K4UA 1Q53A 2WVDA 1IVZA 1QUVA 2MEWA 3JQKA 2VV5A 4DX5A 5C7PA 3JSMA 3IO1A 2PO4A 2UUCF 3AHPA 5LXRA 3ENQA 4ECQA 2NPIA 2HHWA 5I3UB 3AD7C 3ELHA 1C1BA 1CBKA 2G0IA 4O44A 2HZCA 3BSAA 3H2VE 3ZNUA 1X4EA 3PW4A 4KGKA 1RAGB 1S49A 2X3DA 3FEXB 4CO2A 2RRBA 3FRYA 5HSPA 4UY8T 2C1EB 4KV8A 2XI3A 3Q83A 1VQMS 3RG6A 4K4VA 2DRBA 1D8ZA 3H5XA 1GK8A 3HFZB 1IWAA 3T5JA 2PGCA 2I5JA 2BW7A 1R0AA 3THPA 2YQ3A 4NI2B 3FCVA 4RX6A 4USIA 2V94A 3CJ2A 1APSA 1N34J 4DLGA 2BJ8A 3HULA 3NS5A 4ITSA 4NLSA 1FT8A 4F50A 4A8QA 2MZQA 3D0HE 4JI1F 4NRUA 4OIXA 1CS4B 2KT2A 3VCDA 3W61A 3W5ZA 3PNIA 1U1PA 3IBWA 2MQLA 4USUA 2R2TA 2FJVA 2AJ4A 1NJZA 2ZH6A 4H4OA 1XBWA 3PVXA 1QD1A 4Y0FA 3PW0A 3U7JA 4FKXA 2HQDA 2QYCA 5E2QA 4EO8A 4LF9F 3MPDA 5HROB 4U7CA 3KK3B 3HJVA 2VJUA 5CYMA 5C24B 4LT6A 4JOUA 2HQGA 4Q8EA 4MYTA 1SKRA 1MNEA 3CDEA 5T7LB 3MZIA 1U4BA 2KFNA 2UU9F 4YQWA 3HHLD 4OHVA 3PX4A 1GH8A 3CMAS 1U7LA 4JI3F 1UW4A 3HHLA 3CGIA 2NREA 1TAUA 3IG1B 1Q8LA 3VZHA 3RBXA 1JLGA 4Y2MA 5G4DA 1KSPA 2VPXB 5A8KB 4NL5A 2MZTA 3K5OA 1SIWB 2CADA 3IR6B 3F0NA 1ELOA 2NUHA 3CO0P 1CJTA 1ZM9A 4ZP8A 4U95A 2GIRA 2XC9A 2AJFE 1U2CA 3HVAA 4DEZA 3J80Y 4DV4F 4LFAJ 5KT2A 5E33A 5DDRC 5A76A 2EK1A 1FKAF 5KOXA 3DLHA 2ERRA 1RBOB 4D3GA 1CJTB 3DRPA 4DSIA 1MU2B 3DI6A 2L48A 3L95X 4RBUA 2Z56B 3GYXB 3UW1A 7FDRA 1N36J 4MIAA 1JNRB 4PG8A 1NHUA 1VQOS 4JP8A 3OHBA 1CC7A 4TQSA 1KDNA 1T9VA 2HG4A 4X4OA 2XY7A 3QRPA 3B8HA 3Q86A 1PC5A 2CG4A 2JFKA 1NSAA 1J27A 4OLOA 3ZZOA 1ZAXA 5H1SV 4X4QA 3SDEA 5J2QB 2H1YA 1YTYA 1RTIB 3X1LB 3KUGA 2XMAA 3CCJS 2FHOB 3SMZA 1RAJA 2ZH1A 1J5EJ 4K5RA 3DLKA 2BQRA 1T05A 1C0UB 1WKJA 1JLAA 2OEJA 2DY9A 2D1CA 4QWAA 1YG0A 1LV5A 4IRKA 1UVMA 2W9CA 1SKWA 1T05B 2O67A 1WC5A 5C2GA 2V0NA 2YKNB 3LP1A 4OL8A 3ISNC 1RISA 3QLHA 4IRCA 4GVBA 2IRUA 3NS6A 2HIYA 2FZGB 1U0HA 1S6QB 3TP2A 1LWFB 5B08A 1LNQA 2IMOA 2W4CA 4P9SA 3TA1A 4DPYA 3W2WA 1VMBA 1RAOA 3MCMA 3OBIA 2KJVA 4IR9A 2Z2YB 4BLGA 2K7KA 4U8VA 1S7HA 3ILIA 3I5BA 4TLRA 5J2PB 2UXCJ 1OO0B 3TX0A 1QAXA 1DQAA 4Q45A 1FWPA 3FGVA 3F44A 1YKWA 3MPUB 2U1AA 2XLJA 3GTYX 4X66J 1KQFB 4YUDA 3K59A 5I42A 2ZVSA 4IG0B 4K50A 2R42A 4PEOA 3UFCX 3N01A 1N56A 3AD8C 1OJ4A 3QIDA 1S59A 1YRXA 3FZ2A 1KN6A 2W7PA 2I2YA 1H38A 1H7XA 1SH3A 2MMYA 2D9PA 1N4LA 1FRIA 4JI4F 2QO3A 3JTOA 4LF8F 2XLKA 2JEJA 1EZZB 4PPZA 3ZTPA 2VDIA 4FYXB 5F41A 4DPWA 4I1TA 2QLBB 4DDFA 1GX5A 4N76A 2YWGA 4G1PA 1HARA 3FZBA 2XTJP 4DUZJ 2YH0A 3UVJA 3FFIB 5GAGI 1AZSB 5MAOA 1UVLA 1T9TA 2RMLA 2XBPA 4X64J 3GR1A 1CJVA 2GZOA 3LWMA 1FNXH 3KK3A 5HROA 2UVUA 4LF4F 4E8UA 2G2OA 2KVQE 4LFAF 2EBEA 3RYLA 4LRDA 4NA1A 4EEYA 1RP5A 1SJ4P 2RDIA 1UCNA 4LRFA 1HI8A 5KFIA 4X4RA 2R2UA 2GS8A 2XGQA 4O3QA 5B0AA 1LW2B 3TJAA 2GGPB 1LFPA 2YKMB 2VQEJ 2J7KA 2XB2D 5F8JA 1TKZA 5KFDA 2CPIA 1XNQF 1S7IA 2BJ1A 3H59A 1U8WA 4DR6F 3HJFA 2WW4A 3C16B 1K9MT 1YX2A 3P5TL 2BABA 2OFGX 4B3RF 3A4TA 1WWHA 1PO6A 3N6NA 2AIRB 1RAAB 2EKYA 3DM2B 3CCQS 1TVRA 3TAMA 2W9BA 3M32B 3KHGA 2MHNA 1HD1A 4IG0A 1I94J 4IFVB 5CYQB 2DITA 2N3LA 2JDJA 4C0HA 3KLVA 4K4TA 2NSCA 2YNHA 1Q0NA 3TRGA 2ZBPA 3QIPA 2Y0BB 2YQ1A 3Q22A 5B0DA 2QEXS 4O0NA 2YNFB 2NXUA 2HW3A 1SCJB 4NLVA 4B08A 4A8KA 1TQLA 3IBCB 1YJ7A 2JH3A 4ID5A 2HAIA 4J90A 3H5UA 4JI7F 3CIMA 3RBEA 3M8QB 4JYAJ 3SCJE 5KT3A 1JKHA 4UF4A 3AOAA 4IR1A 1T3OA 3NAIA 2KB2A 4OI6A 2MKIA 3B54A 5J2PA 4I56A 2HNYA 1RWNB 2AP6A 2DHGA 3IC1A 1PYOB 3IWXA 4Y2CA 1IKVB 4DOZA 1JKHB 2ILYA 2I6WA 4YR2A 3G6YA 4HI1A 2LECA 4ES2A 2V2ZA 1BQMB 5LM7E 4J91A 1V9OA 3CCTA 2DGXA 3JSRA 5BR8J 1FRXA 1KVKA 4CP5A 2F3JA 4V19J 3V81B 3ET6A 5HVFA 3T5HA 4DUYF 3LP1B 3LP0B 3MMAA 3U1MA 3VTIA 2R3VA 2N82B 2ZOFA 1BXNA 1UA0A 4QR1A 2VUGA 1U25A 2F63A 3R5JB 2KZZA 2BE9B 2WB1D 1HPZB 1XQIA 2IYIA 4P74A 2Q1LA 2BEFA 4BBYA 2OH2A 2KDOA 2DR6A 3TNVA 2FC9A 1S1TB 1N5TA 1S9EA 5KFYA 3OFEA 2QC3A 3BYPA 1YJTA 5H9FJ 3H40A 4F3OA 2DGOA 2V4RA 3QT6A 2LEPA 2DEJA 2CQ4A 5K20B 2C3UA 2MKKA 1YK9A 3DLJA 1Q1KA 4NOHA 3B6BA 2D74B 2KYXA 3DLBA 4A47A 1SXLA 4LFCF 3MR3A 3UD4P 4WF9Q 1D9DA 3LP2A 1UJ6A 2DHAA 4YEAA 2MQQA 2KZMA 2IM1A 3QT7A 3KK2A 2WBRA 4CM0A 1IBCB 4PCQA 2J5AA 2R8HA 1N33F 2YNHB 3P45B 3M9NB 5DG7A 1U8SA 2RAQA 4CO5A 4A8MP 4J9LA 4WU2A 1RGVA 4HLBA 3MURP 2E9ZA 2RKIA 1U45A 3HKZD 1NPKA 1RAIB 5IT0A 1A0OB 1WI8A 1D3WA 2RS8A 3R5BA 5BJRA 4LVNP 1PGZA 2MKCA 2JC1A 1KHVA 1M5PC 2AF6A 3I32A 1Y0HA 2CVIA 3V2UC 4GC7A 3OTCA 4C8ZA 1S6OA 1X5TA 1VBKA 1WC1A 1XR6A 2B5JA 1HBUA 2GMLA 4URGA 4X4UA 4P71A 3MM5A 3GV7B 4TLQA 2VFTA 2WVCA 3IRXA 1NM2A 4ZOSA 4BCAA 3DDNA 3PIPQ 4WFNQ 4KFBA 3DMJA 4XO0A 1ZM4A 1E6VB 1JJCB 4IH6A 4CT8A 2OAUA 3RB0A 4A8XA 4G1QB 2AJ0A 3BPDA 3KJVA 1OMSA 1IBKJ 3QT5A 4I6AA 2UXDJ 2OUGA 3KK1B 1FKOB 2BJDA 5HMWA 2IJFA 3MOZA 4KGXB 2PD1A 3MR6A 3CJKA 3DRSA 3IA0A 3M8PB 1FNOA 3DHWC 2PDAA 1ZZFA 3KDOA 3VVUA 1T03A 2QLWA 1SVDA 2C3PA 1V3RA 4DPXA 3KNGA 1B3TA 2ZOMA 1S1WB 2KI2A 4ALZA 5J1PA 3Q8YA 5KFMA 4DV1J 3CNQP 3HI9A 5DDQC 1RLDA 5GMEA 4LFBJ 3SV3A 2GJIA 2AKWB 1X4GA 2P9EA 2CPDA 4JI1J 3QO9A 1RAEB 5B0EA 3KLGA 3EVOA 4U96A 5J2MA 3FBBA 4QW9A 2A6OA 3BGRA 4O4GA 2JNJA 1FA0A 2QSFA 3GWCA 4RW7A 5GMDA 1PAUB 4JI6F 3D1HA 5D8HB 1HHQA 1P6TA 4CWBA 2C42A 5FDLA 2CAJA 3HZEA 1JLCB 3CIZA 3BKFA 3OSPA 4KKOB 4K0KJ 2GO9A 2F4VJ 1E6YB 4F4AA 3MCOA 3V6DB 3LALA 3NAHA 4J37A 3CF5Q 3PHTA 4EK2A 4C2MA 1JXLA 2WW8A 3HX9A 5DO2A 1HR0F 2KVIA 4FPIA 2K8GA 4K4SA 4J9OA 1EP4A 1KLMA 1URNA 4K5SA 1ITPA 1MU2A 1ZBTA 1RU2A 2JFDA 2YKAA 3DI6B 3DRPB 2J7UA 4QIWD 4X84A 3ZNJ1 2YPYA 5IWAF 1X0PA 1R8CA 4W92B 4WZMA 4K4XA 4O3NA 1JWWA 5F8HA 2LA4A 1TL7A 3LP2B 3O2IA 1Y3KA 1RSCA 3W2VA 3MEEB 2HVZA 4CTAB 1LK7A 2EC2A 4XPCA 1M1KT 1B7FA 2QFIA 5DZ6A 4F3MA 1OYDA 3GPAA 1HWKA 3CPWR 2J0XA 4OHWA 1I51B 1RTJB 3PY8A 2CG8A 4B3MF 3T5LA 2L9WA 3OVAA 2XY6A 3DRRA 1HQEB 1Y9OA 3FMBA 3M30A 2J8SA 4C6AA 2D41A 5GAEI 5E3CA 2HMIB 3CCVS 2HBQB 3RUBL 3JXOA 1CG2A 5HO4A 1MLAA 2EFVA 3W2VB 5HVGA 5IXUA 1CLFA 2GNKA 2AJ2A 4G6VB 4FVCA 4LJMA 3Q8VA 4DV7F 4ECZA 2E1RA 2PE8A 4ECVA 3US5A 1VRUA 2WSEC 4C97A 3N5FA 4N77A 3NGTA 2Q79A 2OJ3A 5D4NA 4LF6F 2LQ8A 2CQ1A 1REVB 2B6AA 3AB2B 4AUKA 1T94A 4ED4A 5IM0A 4RZRA 3BO2A 2ZZNA 5IFMA 1A9NB 1N0VC 3W2WB 2LEAA 1QVFR 4LRAA 4QIVA 4DR2F 1TUVA 3OTBA 4NLXA 2VPWB 1FHTA 1FFSB 1R3NA 5HBMB 4Z2XA 4LRBA 4AL7A 1TKTA 2NUUG 3BDEA 1U1KA 2GCFA 4IRDA 3TW0A 2LU2A 1BHNA 1YI2S 2DIVA 4WYWA 1TV6B 3SZ2A 4GKKF 3BSCA 1FE0A 4I2PA 4ANDA 3LF0A 3VAJA 1L3SA 4WP9A 2VBYA 1LEOA 3O5TB 1SKSA 4RW8B 4R25A 2ZC4A 4QYRA 1QLNA 5D3GA 1MWYA 4K59A 1F0XA 4JI6J 4NMXA 1TP7A 4CLKA 2Z57B 1RZMA 1VRTB 1NJYA 1C0TA 2FLOA 2NYHA 1X60A 4OI3A 3KKFA 4NLTA 4DPTA 1PC4A 5D4PA 5BYQA 4ZIVA 3BGRB 4RJVA 4RNMA 4FPRA 2MB0B 4F25A 1T03B 3B4MA 3NG8A 3QO9B 2KXNB 4URSA 4WFZA 3KLGB 3R5GA 3K5LA 1WACA 2WZ1A 5FD1A 2I1RA 2W8KA 1GMUA 2VBXA 2HQFA 1FKOA 3M8RA 3VR1A 2LMIA 4I6WA 1S0NA 2DGVA 3I0RB 2CPZA 2KH9A 4G1QA 2GVDB 2XMKA 4RR5A 5IWAJ 3TARA 1FJGJ 2B7BB 4K2JA 5D15A 2FB0A 4DF8A 4U6PA 2ZDOA 2MSTA 3OL7A 3ILOA 5KAKA 2ROEA 2E5LJ 1YJUA 1QUPA 1H73A 4YFUA 3DOKB 2CJYB 4J9UE 3I5AA 4LSLA 4O3OA 2PI4A 2QMXA 1VLOA 2CQHA 4I2QA 1ZYQA 1N32F 4FF2A 3GCXP 2E9RX 4C11B 4AQYJ 1N5YA 2XMUA 4NLUA 4LQ3A 4ZCKA 1HNVA 1I1GA 2RNEA 4JUZA 1VOMA 2HHUA 4IYQA 3RB6A 2NR0A 3C15B 2CJAA 2PC6A 2ZUAA 3EDQB 4GO7X 4ELVA 2BE7D 5J1EB 4G3IA 1RCOB 3P3DA 4GVLA 3W62A 1YRTA 2J9DE 2AEJA 2BKNA 2PA3A 3AAWB 1SQGA 4ZN1A 2ZD1B 2QX0A 1S1XB 3QZ8A 4MIWA 5L38A 2VQFJ 2ZZMA 1VLYA 1RT1B 4USKA 3FCHA 4C11A 1N5YB 3E2EA 2RU3A 3H8YA 4M5IA 1AT1B 1BQNA 4OJ3A 2CYYA 5ETKA 2ZDPA 3D0GE 4MTPA 2AU0A 3M8ZA 1V6HA 1WHYA 4O3RA 5LSOA 4FXDA 2Y1IA 4RBTA 3MM9A 2JEGA 3VAHA 2BJEA 2DRDA 2VU5A 3BKUA 5KFHA 3SYZA 4DL7A 1SJ3P 3MEDB 4A8FA 3GSDA 1HYSB 4OI1A 4X4TA 4DFMA 4B9LA 1B64A 3AA8A 3MGJA 4NXMF 1NK4A 2I5JB 4LREA 2GJ2A 3TUJC 5FLXY 3EZ5A 4M95A 1URRA 3GV5B 1W2BR 4E0DA 1BD6A 3BR8A 2PT0A 3W5YA 2Z0GA 3J7YI 1UP1A 1MG7A 5BXIA 2ALZA 4WWSA 3R27A 4QYZK 4LSNA 2IBOA 2VPZB 4X62J 2C3OA 3Q8RB 1VC6A 5RUBA 3MD1A 2UVWA 2VF3A 2AGOA 1UVNA 1VBXA 2KYZA 1WEZA 3A13A 4ZVTB 3GIJA 3KFWX 3CUNA 2DPIA 4Q43A 2HFSA 2RDDA 5KFQA 2L9DA 4ED3A 3QYYA 3NGRA 5DDPC 3O44A 2CDQA 4BDPA 2ZNZA 4EMDA 4DU7A 4X4NA 2VOOA 4NLOA 3SSSA 1X9MA 1PJ6A 2CIMA 4L3KA 5IS2A 1W2IA 2CQ0A 1M1HA 3Q2SC 4N8OA 4A48A 7AT1B 3HPOA 3VZIA 5HP1A 4IUFA 1XMOF 1HBOB 4DR3F 2KKHA 3GYGA 4OX9F 2H5EA 1TK0A 1G6BA 1SJ1A 2OD4A 2N3OA 3QWUA 2R7WA 1R8PA 4WE1B 5HATA 4USWA 5J2QA 3OV7A 2BOPA 2BOAA 2JX2A 2DBBA 1XIQA 5CH7B 5DLGA 4ILMA 2V68A 2B9YA 2IVYA 1BQMA 2W8LA 3EGZA 2BKOA 3HVRA 2FVQA 4CT9A 2M88A 4UTGA 2FY8A 2ZH5A 3JYTB 3C14B 4PXEA 1IR0A 1ROFA 3F56A 1R7IA 4Q44A 5L1IA 5KG6A 2LEBA 1VQ5S 3O8WA 1B4SA 1CJUA 2QTWA 2P8IA 1FI4A 1HWLA 2C2RA 4B9MA 4F04B 2D9OA 2OPQA 5E0OA 2JSXA 4C9DA 4ZP6A 3VGVA 1IJEB 1UFKA 4PAAA 3SQGA 2OHDA 2KU7A 2IMWP 1NB2A 4ED6A 4Y34A 3GJSB 4B9TA 3M1VB 3PTWA 2HWIA 2KT3A 4OJHA 4ZVFA 4IOAQ 2ZVIA 5FIIA 3BGUA 4P10A 1YVFA 2Z2ZA 2A10A 3JAMY 3NCPA 2EVZA 1TU0B 3TO8A 3H0PA 4C48A 3HD2A 1S1VB 4DFPA 1M5HA 1IBMJ 2HMIA 2MYFA 2YY3A 2Q6CA 3HHLC 1HMVB 2DNOA 4ZLLA 4FYWB 2VQFF 2VHGA 1KWMA 1GEHA 3L7PA 3OR2B 5A8WA 3MAQA 2I0XA 3K5NA 1ZH5A 3IXQA 2E1CA 1AFJA 5C42A 3AXMA 3ISZA 3JB9k 1JLQB 4MK8A 1WDDA 4RNNA 1RLCL 4ER8A 4DBQA 4CO4A 3N9UC 3M2UB 2NYIA 3S01A 1KS2A 3QJLA 2BM0A 1WF0A 3OVSA 4PRFA 1TKXB 3R8YA 3TA0A 3K89A 2CPFA 4NXMJ 4Q8FA 2HHHJ 1VHFA 1R43A 2HRTA 2POKA 3AB4B 3OFHA 5LMNF 3I5CA 3R3TA 1UPMB 3TJ8A 3FBCA 4A46A 2ASJA 1S1XA 2JVOA 1J5EF 2ZD1A 1R0AB 3TEHB 1EP4B 1N48A 1EETA 2E5IA 4M1KA 3UVJB 5LJ3Y 4YY3F 4DQIA 3MF5A 5GMKa 1FX2A 3G82B 2ROGA 4KKOA 5KFVA 4CO3A 3NXZA 4C8YA 5FLXU 2CDRB 3R2CJ 2JVRA 4TNOA 2XO6A 4B9NA 4XDDA 1B7YB 2QT7A 3BKTA 4KTQA 1KTVA 3HXMA 2RS2A 1AW0A 1JLCA 1S12A 3EXCX 4WPAA 1WOOA 1X4DA 3IAM9 4P6QA 3NOCA 5K9FA 3HMJG 3PIOQ 2EWHA 1TUGB 2OELA 4N5SA 4NWBA 2UXBJ 1UWAA 2A3JA 3DLEB 5A0YA 1X5PA 2HAFA 3GR0A 3I87A 3PV8A 1HHTP 2Y3YA 4LVOP 3CJQA 3KWMA 4NASA 4HHUA 1WOSA 3H5SA 3CCUS 4CLSA 4DS5A 3HSJA 4IG3B 5DG8A 3EUNA 1IQTA 4JI2J 3NBPA 1Q8BA 5GAEU 3QLHB 4PZVA 5J2NB 1ZPWX 3HK2A 3GJTB 3CJKB 3P4UB 2VH7A 3DGPA 4JV1A 1R0CB 2HQ3A 3R7BB 3H4BA 2EI5A 2CJ9A 1DHMA 2IIHA 3FRZA 3SSRA 4HL9A 1TK5A 3WBZA 3KUEA 2J76E 4F2SA 1WHWA 1ICEB 3CJSA 4OYXA 4GVBB 4RW6B 2V8PA 3BS9A 4EGLA 3KK1A 5L1KA 2ASYA 4MT1A 4URQU 4H4KA 5C25B 3NNAA 2L08A 2XS2A 5H9EJ 1KP6A 1G7CB 3GFZA 1SIZA 3MWBA 3R7SB 4ZJOA 2AHOB 3GP9A 4QW8A 1VRQC 2E29A 3TVZA 3TZYA 1Q78A 3NEKA 1FK9B 2CZVC 3L3CA 1S9GB 1RTIA 2HSEB 3TJ9A 2Q6BA 3PJ9A 4CNZA 3EPIA 3TI0A 2BDPA 3KG0A 2HYIB 4DQPA 2M7SA 2YKPA 3Q0AA 2Y0SD 4FF1A 2R8JA 2PEBA 4NXNF 4HKQA 4B3OB 3PXGa 4B9UA 2DNGA 3QGIA 4ZPVR 5HAOA 3AY0A 3LTOA 2MZ1A 2KL8A 3OFFA 3EMTA 3GE9A 1VQSA 3IM8A 2FHJA 2UUTA 3L7UA 3EJMA 1Q5YA 4WCEQ 1PSDA 3THVA 3BBCA 5LL6d 3HHEA 3UI3A 3LH2S 2HZVA 3FSXA 1Q7LB 1DJ0A 1VHIA 4PXCA 2GJFA 1HMVA 1KOOA 4OLPA 4YR0A 2ZC3A 2CJXB 4BWJA 5JVGQ 3T1HF 3TAPA 4J9MA 2WK4A 2JLFA 2RQ4A 1RJJA 3NP5A 5ETSA 5HLFA 1JLQA 2M70A 3DFEA 4Y2AA 4DN9A 2KG0A 4DR2J 4PKDB 2J0SD 2VFVA 4DPUA 3NCRA 3Q2TC 3GJQB 2YWHA 2R7XA 1BUXA 4ZVOB 4F26A 2G2YA 3DN9A 4MFBA 1SV5A 2GQCA 3RJMB 4F67A 3TUPA 4RW4B 3OUYB 1S0MA 4P73A 2DNLA 1VCTA 3SQGB 2AWZA 5KFFA 1QSLA 1X4BA 4DLEA 1UZDA 3HSZA 3P96A 4AFFA 1Z2LA 1HQ2A 1BWVA 1RHMB 2DGSA 4USHA 2CKWA 4TN2A 4ID8A 1PILA 3DYAA 3HD1A 5L8RC 2V63A 3J7A1 2UUWA 2DCUB 5THWA 4NA3A 3WZ0A 1HWUA 1U09A 2MDAA 4HEA9 2ZWOA 3TYTA 5G0RA 1LXJA 2NSBA 3VHQA 5HQMA 2YWFA 5SUHA 5DDOC 1FO1A 4M5DA 4B17A 4UOGA 3V6DA 4B9SA 4CIOA 3ZZUA 1LKZA 2GX8A 2W2OP 3TR5A 2B4VA 2CRLA 2VG6A 4ERDA 1YWXA 3D3CJ 4WFAQ 3VAFA 3BPSP 4DV0F 2XWXA 2ZE2A 3OD2A 4Q0BB 1ZAWA 2YNFA 3I4HX 3LW5C 5CQGA 5I3QA 2K2PA 3M8WA 1NRKA 3MR7A 9RUBA 3TZZA 4LRCA 4USVA 4DF4A 2E5JA 5EGYA 3C46A 1XNRJ 1Q79A 4DG1A 2HVEA 1Q95G 2XEXA 3MEKA 4FP9A 4M5KA 2P2CB 2HNZB 2KN4A 4NZ7A 4KIAA 4TU7A 2E5LF 1I3OB 1X8DA 3OSNA 5CYQA 1SQFA 3DHXA 4N7TA 3L4BC 2DXFA 4S0MA 4ZVPB 4KC5A 2MHEA 2Z58B 1YDLA 5GAHI 3PO4A 1QAJA 5A2QU 1CULB 3MM6B 2EEYA 3PRVA 3QFHA 4PR6A 3OTOF 2GVZA 3D0IE 1NBEB 2GO8A 5KT4A 3IWLA 4OHXA 3N28A 5M2PA 3MAHA 1TVRB 3TAMB 4O23A 2W9BB 1Q82T 4OX6A 2Y1RI 2JHEA 4DS4A 3ZZYA 5AJ3F 3W8GA 4OZ2A 3MM9B 4J9KA 1XEZA 4IDKA 4OI0A 2V5HG 1UPPA 4TVAB 3WIUA 4PABA 3TOQA 4CZCA 4DR5F 4LF7F 4ES1A 4ANEA 3O1LA 4XK8C 4DV4J 4ECTA 1EHWA 3SCIE 1U02A 3NCQA 3M8YA 4AD6A 3TAQA 1NK6A 3EGNA 1C1CB 1IXKA 1F6TA 4DL4A 1OY9A 2DGWA 4U7UK 4RUAA 4W90B 1PCAA 2OPSA 3RB3A 5CD4H 4IFYB 5J1EA 2BV3A 2RJZA 4V19X 5HANA 4YOEA 3SCKE 3MM5B 3PM9A 2ZH7A 1FJEB 4B3OA 1HNVB 3IR7B 4KHMA 4Q2LA 1WC0A 1N6QB 4PG4A 4CYUA 3W7BA 3G9CA 3V4MA 5KFJA 2D3O1 3PR5B 2V8GA 1S79A 1MN7A 1RAHB 1WC6A 1Y11A 4OI2A 5C5JA 1RYSA 4B3SJ 4LF9J 2UXDF 4RW6A 1JK9B 1DFDA 5EWFA 4JV5J 1MWQA 3FSIA 3D66A 1DLOB 1P1TA 1ZOTA 5D0GA 3VWSA 3HCXA 1SL0A 4CLLA 2KHDA 4QPXA 1PG5B 3FSYA 1U1QA 2AYBA 3R6LB 3QQCD 1H2VZ 1PBAA 2ZFHA 4KO0B 3L9ZA 2BMBA 4WU3A 4Y2KA 2ZM6F 2F8EX 1NJIT 1HQUA 1RB0A 2XGPA 1Y3JA 1RKJA 3CB4A 8ATCB 2QFJA 3I4PA 1LW0A 2DR9A 2GVDA 4DV0J 2CNOB 4NCBA 4KGZB 1GT8A 1S6QA 3OR1B 2APOA 3K5MA 1LQ9A 3KMSA 1KONA 2YWEA 4PWDA 3UCUP 4ICLA 4DSFA 4KPYA 4IKAA 3FBFA 3SQOP 4F0MA 5HMYA 4X66F 2VG5A 4O3PA 2HFOA 5AT1B 3Q8PB 2D3OR 2MXYA 1KFDA 5DETA 4DI6A 2DNHA 4KYZA 3DLKB 1HLWA 2FZCB 4EZ9A 4MK9A 3CXCR 2GQQA 1JLAB 1U6ZA 2FDNA 3UNGC 4KFBB 4WFYA 1Z4UA 1Y4ZB 1YJVA 5F8NA 4F02A 5H9FK 2FLNA 1IWGA 2VIHA 1B0VA 1HI0P 4L75A 1VQKS 4Q0BA 2M5YA 5JVHQ 1TV6A 3LAKA 2ALYB 2DHSA 3DKDA 3SBMA 3TVYA 1WNEA 3A12A 3H25A 3ZTOA 3FQLA 1IBMF 2EKNA 5LSLA 1VQ6S 2GIFA 3ETOA 3W66A 4F36A 4KAIA 4R5PA 3LAMA 5KT6A 3NNCA 5DJBA 4A4JA 4ID5B 4HDGA 3KJQB 3JTPA 4K8RA 4XAKA 3K57A 1WKLA 1RT6A 1K73T 2R7TA 3DLLQ 1H6KX 3BH7B 3WHIA 5J1NA 5ETVA 1DRZA 4ZS6A 2H4YB 4JI0J 3QWPA 2H9ZA 1M1GA 5HMZA 3CCZA 3TA2A 4BC9A 1HQEA 2WONA 3SFGA 1V5IB 2H4WB 2YNIA 2K1RB 1JLBB 1TL1A 4HVZA 1RTDA 2OP5A 4QIEA 2FJAB 3G6XA 4GKJF 1RWOB 4ZPCA 4MYUA 5T7LA 2X1GA 5AXLA 5C42B 4P7VA 2N7YA 3FEZA 4Y3CA 1RTJA 5HN0A 2CJKA 2UUCJ 2RVJA 5ETOA 5HVHA 5DQGA 3OTDA 2O5DA 5BYRA 3ZC4A 3CVKA 3EPGA 3RW7A 1AROP 3GILA 4DV2J 1RWXB 4DQSA 2CVEA 3VAGA 4R8UA 4XDCA 4IFYA 4DR4F 1KLMB 1U49A 2YQ0A 2W2NP 2ZZTA 1R8AA 2O1PA 2BJ3A 2VPYB 1LWEB 2G0CA 1CS4A 3MAAB 4PPDA 1U48A 2AZ1A 1NK9A 4F0HA 3DOMB 4ETXA 2ZWPA 2ZH2A 4HI2A 1U6BA 1XR7A 2B51A 4MK7A 4MH8A 4Y00A 1RDRA 4QCLA 1IKVA 4Y28C 2FLPA 1KC8T 2FYXA 5J2NA 3BGOP 2B56A 2E7WA 2G1DA 3CSKA 3QPIA 4F2RA 1UVIA 4DL5A 3IM9A 1K44A 3UN2A 3UR3C 1FRKA 1YBUA 2EFQA 3I9ZA 2G4BA 3MD3A 1HQUB 1RT7B 3NKYA 5KFEA 3G86A 2ZH4A 2QZ8A 2ATLA 4U8YA 5AXNA 4J9RA 5I3UA 1Z1ZA 1EAYC 2GV1A 3HHKA 4DUYJ 1A7GE 5KFWA 3CDBA 3DLGA 2DR7A 2WSFC 3HFVA 4P2XA 1Q16B 2AD9A 4C3KA 2ZOGA 2IM2A 3MCSA 3V6KA 1VQ8S 4DX7A 2AX0A 1WJ9A 3EDRB 1N33J 1XMQF 5IT9Y 1CPZA 2YNGA 3QSIA 4ZVRB 3VGSA 2DO4A 1F60B 5L46A 3WX4A 4PUOA 1HNWF 1TFWA 3PACA 3KG4A 2QV6A 1KFSA 2OIHA 1QY7A 1XR5A 1N6QA 1QE1A 5SZTA 2DO0A 1HA1A 2V8DA 3HVTA 4IG3A 4RUHA 1VJWA 5CCLA 1K0TA 2HFVA 4DFKA 1BWEA 1N32J 3PFEA 5KTQA 4KO0A 4KHPF 2IJRA 2J9CA 1KTQA 2RRAA 3J7Z5 1EQMA 3RB4A 1OS5A 3DOMA 2LKZA 3POTA 3PYEA 2EFGA 2HFNA 4ZVGA 5F9LA 2DNPA 3P6YC 1OY8A 1RK8A 2HBYB 2DJWA 4HT7A 2MZSA 2DIUA 3ZZ0A 2LP4A 5CYJA 1U1NA 4AL5A 2AT1B 2EFOA 2UZAA 4HACB 2K7JA 4LR7A 4WP8A 1SBRA 2E1AA 3C3LA 1RT1A 4L76A 2OEMA 1VYAA 1X4AA 4IQXA 5ETRA 1CQNA 1RBAA 3MM8B 4WK1A 1S6UA 2VDHA 2MZRA 1WD6A 3GFHA 3NRBA 1C4AA 3T6JA 2BRKA 2GA7A 2EW9A 5F8IA 2IVFB 4Q2MA 1OY6A 2B9XA 3JSBA 3OJSA 3RGIA 1H3DA 5AE1A 3BO4A 3GONA 2M9KA 2XG8A 1I6JA 1R8HA 4PQAA 3W9HA 2C2OB 4R5PB 3IWNC 3DU6A 3H2LA 3NS7B 4FN5A 4ZP7A 6FDRA 1U1OA 1EIYB 1MSWD 2R7VA 4X62F 3HHDA 2ZNYA 1P8GA 3D6TB 2L9NA 4CLUA 2LA6A 5CA5A 1ZS6A 3TWZA 3I96A 5D0RA 2AGPA 4TY8B 4FF4A 1G2EA 4AXJA 3I56S 1FXRA 2VKRA 3M7VA 2XY5A 4F0KA 2DGUA 1S1UA 2KT5A 4K4YA 4DL6A 5G0RB 5LSRA 1FWKA 2GVZB 3GJRB 4LIWA 4FS2A 1S48A 2ADBA 5LOQA 2XHWA 3E51A 4IQMA 3RRKA 4ZPWR 1S1TA 1S9EB 1SJQA 2H51B 4ZPTR 5A8RB 4WBFA 3SXLA 2C3YA 2UUAF 4ZVSB 4PXDA 3NY0A 3UR0A 4K4ZA 5DGBA 2W9CB 5LXYA 1KNZA 5F8GA 2HQIA 4ECSA 4ED2A 2MQNA 3VQSA 2C28A 1S6PA 3GMGA 2OPQB 1RHQB 3J81j 3CCRS 2HWTA 3WIVA 2FVSA 2X7IA 2XSFA 4ZVUB 2RHSB 4F3QA 4I4BA 2LQJA 5E3AA 3L7OA 3RRGA 1NKCA 3T5KA 4DUZF 4UY85 1JLEB 1M0SA 1KD1T 1IR2A 4BC7A 2RSQA 2WHOA 4NXNJ 4HTIA 3ZXWA 4X64F 1PYTA 1U26A 2Z4PA 1DZ5A 4LSNB 2VG6B 2Y9HA 2FIUA 2R7SA 2R2SA 3MI7X 3VQTA 2J6SA 4LF7J 1HR0J 4N47A 2BW2A 1NKEA 2FGOA 5JJBA 4DR1J 4I64A 1GNKA 4ZP9A 2HNYB 3AOBA 1VFJA 2ATCB 3A8JA 5MLCV 1SPBP 4TU9A 3EE3A 3HDSA 4AT1B 1IBKF 4KE5A 2V67A 4O44B 2DRAA 2YTCA 4B9VA 1P1LA 1HBMA 2KRRA 2VQEF 1KRPA 5CZXA 4DR7F 2R2RA 2BX6A 3M32A 3FBEA 4DUTA 4Z37A 5KFGA 5F0UA 3SSQA 2V2QA 1TL4A 4FS1A 4IFVA 1FDNA 5F8MA 3RRHA 4A8WA 1DLOA 1RHRB 4ZIWA 4DL2A 4X4PA 1NZAA 1IKWB 1TAQA 3N4WA 1EARA 5E3RA 3DM2A 3IGNA 3QT8A 3HP6A 3T3FA 3NWGA 3UWTA 2KFZA 2W2QP 3H98A 2CQCA 2GAHC 2OLWA 4CLZA 5HJYA 2B9WA 3G6VA 4PG5A 4I7FB 5K14B 1XWLA 1R6VA 4P2MA 4PXBA 1TKZB 1O51A 2NXNA 2Z30B 3KLIA 4HR2A 3MMCB 3DRRB 3M30B 4FKYA 4WIIA 1RU1A 5AXKA 2G13A 3POTB 4YMEA 4UQGA 1IBLF 1D9FA 1HIYA 2WVFA 1C1CA 4D3HA 1VQLS 4ILLA 1OPIA 4OV6A 4JI7J 3K5PA 3NNHA 1T9XA 1YGYA 1NK0A 3PYDA 3MUMP 1ZZNA 4RL1A 4DV5F 1ULRA 3DRXA 1U2RA 2DY1A 3MOJB 1JIHA 3MFIA 4HDHA 2AGQA 1FKPA 2R4FA 2ZBQA 3C6TB 2OPRB 1NCLA 3TEGA 1KVIA 1HKAA 3BDPA 2LXFA 3AODA 2V8HA 3D2WA 1ZETA 4NI2A 3DGVA 3MPVA 2V2VA 4IDKB 4NX9A 2N7CA 2V69A 4LF8J 1JB0C 2B8QA 2DH9A 4LBIA 2MKHA 4ECWA 3H20A 2VODA 3K0JA 5DQIA 1U6FA 1TL3B 2NXCA 4F8RA 2BKPA 1S9FA 1NJXA 2D69A 3FDSA 5B0BA 1B70B 1CC8A 2R8KA 5KG0A 2WTFA 2DPJA 1ZM2A 2OPPA 1YLXA 2UVRA 5F0WA 2X1BA 1BE4A 5D0EA 4EWTA 2QMWA 4JV2A 4M94A 1N5QA 1TELA 5D3GB 3EGWB 4OJGA 3N6MA 3M05A 4DR5J 2QLFB 4L3NA 3M6WA 3JAMU 3OL6A 5LT5A 1NMEB 4CO0A 1TL3A 3PKYA 1YZ6A 3EVWA 1K47A 3ZO7A 4FYYB 1D8YA 3DGPB 1Y10A 2M2BA 3OT9A 2NS1B 5KFOA 1NK7A 1FWLA 2MKYA 1VIOA 2FHMA 5B7WA 2W1BA 1VK8A 1LWFA 2YVSA 1SH2A 1OSDA 2RILA 4MKAA 5JMNA 3F41A 3EZUA 1R0BG 1IJFB 1O8BA 3MAAA 3CD0A 4USTA 5IM0B 1TKXA 1S0VA 3GU0A 1F9FA 3MMBA 1RAFB 2IYGA 2RUGA 1SI9A 4ZN3A 5GADI 2VJVA 4DV3J 4ZHRB 4EZ6A 2ILZA 3D1OA 3DC2A 1AUDA 1FFGB 5DLFA 1CSJA 3R5DA 4QWEA 2CA9A 3W60A 3R1HA 4DCJB 2HVDA 2RB7A 4RLEA 1DTTA 4LF5J 1WOPA 2VG7A 4UZCA 1N52B 3HLUA 2K3KA 1IR1A 1UJ5A 2F8HA 2WONB 4NYZA 3T1AA 5KG4A 2O66A 2QLJB 2HQCA 4RU2A 3I0SB 1JLBA 1TL1B 3QZ7A 4V1Ak 3V6HA 3OLAA 4DSLA 2HRUA 2QYGA 2A2CA 2PMWA 3BQ0A 3VAKA 2DH7A 3Q8UA 2D3UA 1D0EA 3NL0A 3IS9B 5DGAA 1FRJA 1KHWA 3KHRA 4WK3A 5KFLA 3KUHA 3CJ0A 2E66A 1S97A 2IBKA 1NXIA 4NYPA 2ZBIA 3E3XA 4NLWA 2UP1A 3KLFB 1Y5IB 3QSYB 2Q3PA 2JL9A 3D3BJ 4U9RA 6AT1B 3ICLA 1UWBB 3G2XA 3CMQA 3WDOA 1QTMA 2EC0A 3RR8A 3GIRA 2J7WA 2AEMA 1S5ZA 1S4FA 4UUWA 3EVMA 2QA2A 2QA1A 4OZ1A 1RT4B 1VR6A 2CPXA 3IG1A 1FX4A 1T9UA 1WTFA 2W9AA 4OHZA 4J9NA 4QBUA 3K7RA 5K8MA 1BGXT 2HHVA 1E6YA 2W2PP 3RAQA 2GHPA 3QGHA 3UDCA 2R7QA 4WE1A 2UXCF 3CDUA 2VC0A 3KDNA 1Q5VA 1YHQS 3OW2R 1G1XA 1FK9A 1DAXA 1U24A 3DOLB 4LSZB 3OL9A 3OXFA 4H4OB 1RA6A 2XSJA 2CWXA 3IR5B 3PEJA 1I5OB 2A0FB 2KHCA 1GTHA 5CYMB 1HBNB 5C24A 5KFCA 2B4UA 1UETA 1TR0A 2W7AA 1O6XA 1EB0A 3CT9A 3IMQJ 4DX6A 4DR3J 2FLLA 1EX8A 3OR1A 5C25A 2OFHX 3UN3A 1R27B 2DXDA 1HWIA 4JI2F 2DT9A 3ET6B 4NA2A 4DCOB 3TUZC 2QA4G 2BA9A 3HT3A 3BV8A 4YP3A 1B0PA 3U02A 1NPRA 3HVTB 1KLNA 1HNWJ 1N36F 3VVTA 1O5JA 2W7OA 2BR0A 1MMNA 3DLEA 2F4FA 3AFGA 5A0YB 2XM3A 1FJ7A 3U1LA 3WC2A 5E7OB 3HZGA 1M5OC 3THTA 4TU8A 2F9DA 3BN4A 3TX8A 4HHHA 1RWUA 5DQHA 4KJIA 5KFXA 2R8GA 2EFNA 1IKXA 4W4MA 2MLZA 2B3TB 3KG1A 2VICA 1JMTA 3M8QA 2Q66A 2CFXA 1GX6A 4O4GB 2ACMA 4NEYA 4C8KA 3I6PA 1ZTTA 2XZWA 4UUXA 4DSKA 4JI5F 3CULA 3ZZZA 2IAJA 3UQSA 1JX4A 2HHXA 3DNCA 1OWXA 5B0GA 5EWGA 3F73A 1C0TB 5ETNA 5CABA 4WZQA 3LGMA 4ED8A 4GKJJ 4ZMMA 1SB6A 3C16A 2HK3A 5A6WA 4WJBA 5K5MA 1X9SA 4LMZA 2ZE2B 3S1TA 3G8QA 5AE2A 1CVJA 3UNYA 3QGGA 3NMRA 1FRMA 3NGKA 1FTRA 1U1RA 1RWMB 1RT2A 2NLWA 2MJNA 1OSCA 3BYRA 5D6GA 1T02A 1RYRA 1KQSR 2XNRA 3KMQA 3M8PA 1UZHA 2DNNA 2HGMA 3QAUA 3C19A 3BJYA 8RUCA 3KYLA 3PW2A 3MPYA 1EETB 1F1BB 2PIIA 3ZTSA 4ENOA 3JSYA 2ADCA 2CQPA 4UOHA 2FTRA 3BF4A 2YX7A 5B0FA 1LWEA 5U47A 4YR3A 5HQ8A 3G96A 3CC4S 4B3TF 2A2DA 3CD5A 4DXLA 4FBTA 5I3PA 3P49B 1Y5LB 2OPRA 5KFRA 1QTNB 3FFIA 3CD7A 1MWZA 1QAYA 3OUYA 3OXLA 3CDWA 3SCLE 4C8MA 2LQBA 2JEIA 1F3VA 1RTHA 1X5SA 5AE3A 4TQRA 3Q8SB 4LR9A 1X0FA 4P2SA 1K1SA 2FY1A 2XI2A 1X4HA 4M5GA 3I0SA 5HK4A 2NXJA 3H2UB 3E01B 4MMOA 2ZUGA 3QRQA 2V6AA 4YB7A 4QWBA 4C8NA 3K8WA 4ZK7M 4ZCMA 2P6TA 2KG1A 3AD9C 2HIQA 2IA6A 1Z2ZA 3BBBA 3MEGB 2IM0A 1HHSA 2EFPA 3FKBA 3O6QA 3PO5A 4MIBA 3FNNA 3OHAA 2KXFA 2J8AA 4JI4J 4OYOA 1U47A 3R97A 2YXLA 3FJ2A 5K8OA 4K4WA 5CXTA 1GXTA 2OD6A 1B0TA 2YBVA 5GAGU 1UWBA 3CCMS 3RBDA 4KSEB 4RNFA 1S10A 1KVJA 1A6LA 4F4ZA 3WC0A 3M1VA 2UVVA 2UUAJ 3QRRA 4OQJA 3FEYB 2C2KB 5KFZA 3V81A 4ZLNA 1RT6B 3BZQA 4EU0A 2O01C 3D6MB 4M5LA 4PWWA 4XPEA 2B43A 3M2RA 3CCES 2DCLA 1YQHA 3TQEA 1RT7A 2W24A 3TZWA 3D4JA 4I2PB 3OJUA 3KHHA 4Y2IA 3G4SS 3I0RA 2EG2A 3S8SA 4E2FB 2CWKA 2VZ9A 4TYBA 1HNIB 3C6UB 2R7OA 4J9VA 1RWWB 4N56A 3TQ1A 2P9CA 1HFEL 1L3UA 4LIRA 3OFGA 3DDIA 4HTJA 5KFSA 4B3MJ 4KGMA 4I67A 3UCZP 1Q81T 2R7UA 3CJRA 2HFZA 1FDDA 1UW9A 4DMZA 4O0IA 2Y1JA 5T41A 4CCHA 2B7CB 5IC6B 1YJWS 4JI3J 2KFYA 4CH1A 2HFUA 2MQMA 4DV7J 1T9WA 1K8AT 1H7WA 4WTYA 2FQQB 2HGLA 4YDXA 1H2UX 1SV5B 1MROB 2CZ9A 4RWXA 4UZBA 2LFVA 3T6BA 3MR2A 2B9EA 2Q43A 3N0VA 1KKHA 3ENVA 2GW8A 2DNMA 4DR7J 2LDYA 1FERA 4J7CA 3J81U 4U67Q 3L09A 3Q23A 1J5OB 2NCKL 1DQ9A 2H54B 2V4JB 4FDFA 1FDBA 2O3DA 1H72C 4CNYA 3BSNA 3VAMA 3D1QA 2R9LA 2OTJS 3NGSA 1WORA 2J6TA 2DK2A 2FD2A 2G9OA 2UV8G 2VC1A 1WSRA 3NBPB 4UOFA 4PWDB 2C2EA 3CJ8A 3EICA 4JI0F 5ITHA 1UAWA 3LUYA 3MPWA 1SC6A 2N4DA 1X9WA 1KBRA 3SV4A 3MEEA 3PCOB 1YZ7A 5KG1A 4DWIA 4CM2A 4RKUC 5KT7A 1IUJA 1FRLA 3ENWA 3FCWA 1ZTWA 3H4DA 4OYMA 4RO0A 2FJEB 5CCMA 2Z2MA 4NCAA 2QL9B 1DQ8A 1Y5NB 2AEFA 4HT5A 4RW9A 4OZ3A 4NLQA 5M2UA 5KG5A 3UDLA 1GQEA 4RWWA 3BO3A 3TANA 1HNZJ 3R2DJ 1S9GA 4J9SA 3HHLB 1U1MA 3AJ2A 4ZPAA 3HSGA 4KPCA 2GMHA 2LU1A 4I7FA 3FMWA 4RBVA 5KFUA 2C2DA 4IOBA 3I9V9 3LGHA 3IRXB 4NYOA 4QOTA 1NU4A 2XMWA 3CJ4A 1JLGB 3IAS9 3N6LA 4F4WA 2BUNA 3WX8A 4EI2A 3M9MB 2XYGB 3PKMA 3MXHP 1FF2A
chains in the Genus database with same CATH topology
2A18A 5KG2A 4QIFA 1NH8A 4OX8A 1S72S 2CZ4A 4J5OA 5CZVA 3T1YF 4ED5A 4RW7B 2RD5C 2ZKTA 4OZ0A 4RNHA 2XMJA 1GXUA 2BRLA 1TZ0A 4H4MB 2IC3A 2XCAA 3IRWP 3M2UA 3PX6A 2BANA 2MKSA 1RT5B 4TKTA 3KHLA 2AV5A 2HHPA 4ZVEA 1WG4A 1NHVA 2L3MA 4ED7A 2JOQA 1KQKA 3CMES 1S1WA 2MPUA 4ZCLA 1YSJA 3KLIB 4NLDA 1NK8A 1W25A 2KRBA 3CJ3A 2V4JA 5K8NA 3OLBA 3RW6A 1F5BA 2JWNA 1MW7A 1FXLA 2MY7A 2FJDB 3KLEA 4OV1A 4KT0C 2VFUA 5A2QY 4QPTA 1MROA 1VRTA 4EFAC 4N41A 1QM9A 2SXLA 4JI8F 1F2GA 4Q7AA 1FVQA 3MUTP 1SUQA 4FZVA 5BYSA 3I55S 3V5RA 2LXIA 1Q4RA 3GYNA 3M6XA 4GMKA 2HS3A 1TFYA 4OHYA 3HKWA 1C0UA 2HWHA 4DG1B 1MMLA 3MM7A 1VGYA 2HNZA 1IN0A 3DLGB 3G8TA 4F4KA 2FGCA 1M5KC 4HH0A 2CPEA 4WFXA 1JNZB 4IO9Q 3V6JA 3HF5A 4RW8A 2I38A 4NCGA 2FJBB 3M4XA 3MECB 1JJ4A 2FHJD 3TUIC 1H98A 1HNIA 3C6UA 4OI4A 3JTNA 1VRUB 4M5DB 3HM9A 2WBMA 4R8UB 3AQOA 4N8NA 5B0CA 3V6DB 2OMLA 5E3QA 2UUBF 1KEKA 1P27B 3SI8A 4C4WA 5GVQA 1GAOA 2HLUA 3BREA 1U1LA 4A8OA 1I94F 4ATNA 3PW7A 2E1MC 2E7XA 5K14A 4TXSA 3MMJA 2AYMA 1VQ7S 4ZCIA 3GG1A 3LQVA 4Y65A 1M90T 3SEOA 5I4MA 3CDAA 3M2VB 4EO6A 4MAKA 1P9QC 2WB4A 3M6VA 3IFEA 3KLHB 2DNQA 4BS2A 4J9PA 3R5AA 2ZHAA 2IVMA 4JYAF 2PI5A 3PJWA 2UXBF 3CJ5A 4KBIA 2MZJA 5EHHA 5KOWA 4L72B 1C2PA 3LO3A 4G1IA 1R8BA 5DRKA 4NPOA 5E41A 3H5YA 1NO8A 1BQNB 5HMXA 1N54B 3NGDA 4NCGB 3EXYA 1VIXA 2FVPA 1JJHA 3CC2S 5D4OA 1NJWA 5D4LA 3HFKA 2GIQA 2RH3A 2ABYA 2CQBA 3GG0A 4FXWA 2J9DA 5DS7A 3KNAA 2VG7B 4DV3F 2AW0A 5J2MB 1FD2A 1C4CA 1Q8IA 3B82A 3T9NA 2B4PA 5EWEA 1F5AA 5L9NA 2IFXA 2VG5B 1YBAA 4M63A 3LPYA 2HNDA 4AE5A 1T7PA 2XS7A 4FVMA 2EG1A 1S1UB 1K1QA 1VS3A 5F3TA 1SUQB 4I68A 2GQ2A 3KLEB 4OZ5A 2OKQA 1FD8A 4WKRA 1X4CA 3W3SA 2IRYA 3DCAA 5HLFB 1FVSA 4DJBA 3J7YU 2CPJA 5L1JA 2X1AA 1X4FA 2IHR1 2GGPA 2YKMA 1NH7A 2D7SA 2IC3B 5EDWA 3MDFA 3CEDA 1LW0B 2DD8S 1RT5A 1KQGB 4ELTA 1C1BB 3MHYA 3AA9A 2XMMA 2FJXA 2YKNA 1NAQA 1JLFB 2VFSA 1XN9A 3CWJA 2JZ5A 2RE1A 2CQ3A 2B5JB 2ZHBA 2IM3A 2XMVA 1O0PA 2X51A 4QWDA 2NZ4A 5T14A 4Q5VA 5FJ4A 2VB6A 4QWCA 1R31A 4X2BA 2RKIB 5HI7A 4EUVA 2B4OA 2HGNA 2KM8B 4ES3A 3BQ2A 2C22A 3KLFA 4J9QA 1N8RT 4TY9A 5L9XA 1VBZA 3DOKA 3KK2B 3BGLA 4DV2F 2GC8A 1Q86T 2FHKA 1FKPB 1WI6A 2VBZA 4WXOA 3ZZTA 5F3ZA 1REVA 2B6AB 2W25A 3M6UA 3BEGB 2CQDA 3OTEA 1NNDA 1NB7A 3PZPA 1OQ3A 1NK5A 3O3LA 4HH1A 2M52A 2X1FA 4NRTA 4CQ1A 1UKUA 3MMCA 2W4PA 3GIIA 3GV8B 3ULHA 3HVWA 4NMLA 4DSJA 1DTTB 4DL0C 3DRYA 4AQYF 2VOPA 2VA2A 2DR5A 2K1RA 2KM8C 4KB7A 2YNIB 4C3MA 2J0QD 3A1YG 1XK8A 2DGTA 1NEEA 3B4DA 3LP0A 3MMAB 1Q7YT 4KHRA 2BM1A 2EK6A 2HNDB 5LJ5Y 4CTAA 4FBUA 4ETZA 1UMJA 4QU6A 4H4KC 4DSEA 2B0GA 3VF0B 3VALA 4IOCQ 1HW9A 1ZM3A 3RTVA 2YKOA 4WXWA 1HBMB 2JRSA 4C0BA 1S76D 2GMJA 4UQTA 3Q8RB 1DTQB 5DM6Q 4R0EA 1IQZA 3MMBB 4USJC 5CHCB 3SDEB 3PRBA 3PJXA 3U1NA 3D28A 3X3UA 2JC0A 3MECA 1SL1A 1WEYA 1VQPS 1LXNA 4UW2A 1GXLA 2MSSA 4TY8A 4DV6F 4QU7A 1CQMA 1H0HB 4MKBA 3ZZRA 3KOAA 1FEEA 2D3ZA 5D77A 2J9EA 1DTQA 2KO1A 2OPPB 2Z8QA 4EYIB 3BN7A 2ZH3A 3PFOA 1F5CA 2QLXA 3UD3P 1HNXF 1WHVA 1XC9A 3DYAB 5KFKA 2HHHF 4HYKA 2KXHA 2V9KA 3RZAA 3DDKA 5L39A 3MR5A 2BACA 1JJ2R 2MQOA 2ZJPQ 3MEGA 4B3SF 2ROPA 4I6YA 5AXMA 2QA4S 1VI7A 5GADU 1LWCA 1S1VA 1LK5A 2CQIA 3OQ2A 3OPKA 1V3ZA 4KRWA 4PG6A 1DARA 4FXVA 2N4CA 5A6PA 2MGZB 2XULA 1KOHA 2HS0A 4ELUA 4A8SA 2CQGA 1T95A 2PA8D 3MTKA 3Q24A 2ZHOA 5HL7Q 2K3IA 1RKIA 5KFTA 1XNRF 4CH7A 2CPYA 2Z2LA 1XMBA 2E5GA 2LQ5A 2ZITA 1HD0A 3CE8A 4DHVA 3CC7S 3BSOA 1IKYA 2BE2B 1ZPVA 1N5VA 2LVWA 2HHSA 4Y6IA 3BR9A 1HL6A 2RF2B 2XLIA 3JYTA 1FEHA 4PG7A 1QSSA 4KQZA 3EYZA 4X4SA 2JLGA 4DQRA 4KV8B 4PUOB 3HO1A 3GZ7A 2FUG9 1RT2B 2WRMA 2BZ2A 4QR2A 3G71S 1UA1A 1YRUA 3MM7B 4O3SA 3FVYA 5D78A 1YJ9S 2JLEA 2YWKA 2IAJB 4IH7A 2WSCC 1DURA 3G6ES 3GB0A 5L1LA 2AYBA 3VAIA 2VL1A 2RIJA 4NZ6A 1AXQA 1AFIA 1BY9A 2MY8A 2W4DA 2FPHX 3C2PA 4PQUA 3C8YA 4DPOA 1FJGF 3UCGA 5KFBA 4WKYA 3J81Y 1J2VA 2C3MA 4QJVA 4LUBA 2XO7A 3K58A 2BQUA 1CEZA 1JLEA 4HHJA 3SFUA 2I8EA 2MQPA 5DM7Q 2QE5A 4WFBQ 2YKQA 3GFYA 4C98A 3PW5A 1K0VA 2NPFA 4QR0A 3MM6A 1HBNA 3CCWA 1VC0A 4ED1A 4FNHA 1U2FA 5KFAA 2CJBA 2BANB 2DB1A 4FNIA 2LCWA 4AXIA 1HNZF 2CPHA 2DGQA 4B02A 4PWUA 6FD1A 2QRRA 2J0WA 4KR0B 5A8RA 1E6VA 4JV0A 5E3PA 5K8PA 3GQCA 1BLUA 2LDIA 2IJNA 2PN6A 2ZJRQ 3I82A 3CO9A 5F9NA 5KT5A 3M8SA 2NQPA 1FNMA 1HBUB 2RDJA 2LXUA 4YB1P 1MMDA 2RF2A 1UL3A 4H54A 5KG3A 4C7QA 4EBDA 1WTBA 1N34F 4C8OA 1RT4A 1OIAA 5EX0A 3EX7B 3UE2A 2P6SA 4RUCA 4I2QB 2M0GB 2LLZA 4OZLA 1TL5A 3HHNB 2E5HA 2HRYA 2MGZA 1VBYA 1VQYA 1UEVA 1VQ9S 1ZAVA 4O4RA 2VA3A 4ZDNA 4DR1F 3OL8A 1LWCB 2BBEA 2M8HA 3KLHA 4DFJA 1NKBA 3QGPA 5KFPA 3CCSS 1D9AA 3OVBA 1HPZA 1WG1A 3ITHA 2AYEA 4ECRA 3IN5A 2MJUA 3I31A 3M2VA 1OPZA 2I9SA 1RQ0A 2OSRA 1RTDB 2EBGA 3LOUA 4YB6A 4ZHRA 3TVKA 1VQ4S 3N79A 4ECYA 2OTLS 1FJCA 1FRHA 3R5CA 2PMZD 3ONQA 4ZKAA 1VC5A 4NLYA 3CCLS 2FVCA 3GFXA 3OXGA 1YJNS 2AX1A 2P9GA 2PSZA 1RT3A 4DQQA 1T8EA 1QAIA 2RQMA 1QSYA 2F1FA 2DNRA 1VQNS 3NMAA 2AYGA 2XNQA 2F9JA 3DXBA 5JXSA 4QQBA 3ZZPA 1N88A 3IGVA 3CD6S 2XWYA 1WEXA 3QJJA 2KTQA 1XERA 2HVIA 2YNGB 4NLPA 2FVRA 2F8MA 4OZNA 2DH8A 5EX3A 2QSWA 1UFWA 2R8IA 1QE1B 1UEUA 4ECUA 4ED0A 2MKJA 1S0OA 3ISND 4LQ9A 2ZJQQ 5E5NA 2DHXA 5FDLB 2JJ4D 4CO1A 5ADZA 1HBOA 2DNYA 2AJ1A 2M3DA 4MFBB 3T9ZA 4DV1F 5HP1B 2E9TA 3KTQA 1VK3A 4LFBF 4AYBD 5I42B 1JXEA 1FXDA 3C66A 4MJKA 1FE4A 3JSMB 2ZH9A 3QJPA 3PEHA 2CJQA 1BC6A 1R6YA 1V3SA 3S7RA 3BM7A 2WCXA 2ACYA 3AH6A 1LW2A 1IM4A 3D54A 3D5MA 4RNOA 3MFHA 4GC6A 2M8DB 2PFFB 2XS5A 3DRSB 5IZHA 4EBCA 1S99A 2ASDA 4K0KF 2PEHA 3AQPA 4ILRA 2F4VF 2XMTA 4JV5F 1LOUA 3UPFA 2V2KA 3KJVB 2ASLA 2AJQA 2WOMA 2LQ9A 4OFZA 3FQKA 4QZVB 4BWMA 2BQ3A 2EPIA 3RAXA 1RA7A 2GFFA 2XSJB 3ZFVA 5BR8F 1GTEA 2GHVC 1M5SA 4H4MA 2RQCA 2GHWA 2RQKA 1FDAA 1FESA 2V4QA 4F4YA 2DNZA 4EYHB 1N0UA 2FJWA 4FF3A 3OR2A 1LFWA 5A8WB 2DR8A 1IKWA 3DXSX 1SJFA 3LANA 2PMHA 4DX8H 4ECXA 2DVIA 2CQ2A 4FYDA 3ITHB 4IH5A 1YJRA 2OO4A 1FTCA 2BXJA 1L3VA 1JLFA 2F7VA 5F8LA 5LMUF 1D1UA 1TKDA 2OPSB 4QIGA 1UFLA 3Q8QB 2COLA 3E8OA 2XCPA 4RW9B 1IKXB 4OX7A 1RI7A 4ZA1A 3IS9A 1HI1A 4LSLB 3V4IB 3NLCA 1OQ6A 1WELA 2VD3A 3K2YA 4GO5X 4P7TA 2LYVA 3PHEA 1UVJA 2UV8A 1M5VC 4AL6A 4DL3A 3AJ1A 1H2TZ 1L3KA 3PR4A 5IQQA 1J5OA 2VONA 2HPUA 1N5SA 2HHTA 4YHHF 2AQ4A 5EN1A 3RAMA 2WAQD 5IT4A 2HS4A 3MUVP 1S6PB 1QVGR 4L6V3 4X65F 2DTJA 1YITS 1RT3B 4WYLA 4QYZJ 4I0WA 1UJ4A 1KR4A 2VFRA 2ZBCA 4M8LA 2J6UA 4BHQA 4ZLPA 4ZPDA 5M2RA 3LWLA 4ICLB 2OMOA 3BGFA 3QAEA 4IO1A 2R7RA 3DMJB 4JBCA 3A8EA 2RT3A 1X7VA 3DOLA 4OZJA 1SL2A 4X4VA 2A1BA 4NLGA 4EBEA 5HBMA 1Y00A 4ZVHA 3MTJA 5KG7A 1QJHA 1DBDA 5DG9A 4LF5F 7FD1A 4OJ1A 3BQ1A 2U2FA 1UVKA 1T3NA 2JEFA 2DNKA 2L41A 2ZKUA 3RU0A 1R89A 2HHQA 1TKTB 4CH0S 2P5VA 1BQXA 2IRXA 3DU5A 3PRDA 3M2RB 4FP9A 2E44A 3B78A 2VKZG 4F4XA 4C8LA 4C3LA 1WHXA 2IA0A 3R1LA 2RU9A 3V4IA 5KFNA 1G3OA 5A8KA 4XIUA 4A8YA 4RW4A 2ZH8A 4ZPBA 3QMQA 4YDDB 3QIPB 4YB5A 5EUHA 4NZ0A 1HW8A 3MM8A 2F40A 1SQEA 2BYCA 2M4MA 4UOCA 4DN0A 3E01A 1YIJS 1WF1A 4OMFG 1HWJA 2WOMB 2YX4A 4CI0B 4I69A 3C6TA 3J7ZT 2VBWA 2X3GA 3MEDA 3GIKA 2V8VA 1HYSA 1FCAA 1RTHB 2QIFA 3T19A 2BE2A 3M9OB 1IKYB 1SJRA 2BVZA 1L3TA 2RRNA 2OSQA 3N5BA 1WF2A 5GAHU 4TYAA 4RU9A 2V9WA 4C0OC 3LGNA 2VASA 5B09A 2FC8A 4MKYA 1Y7PA 3CTRA 2YX1A