1KVIA

Solution structure of the reduced form of the first heavy metal binding motif of the menkes protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
MDPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
publication title Solution structures of the reduced and Cu(I) bound forms of the first metal binding sequence of ATP7A associated with Menkes disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 79
sequence length 79
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2002-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kviA00
2OP5A 5A6PA 1Y3KA 1VQYA 1YJVA 3K7RA 1AFJA 1WD6A 4DN9A 1X8DA 4HI2A 1TL5A 2Q3PA 1CC8A 1N5SA 2FHMA 2OD4A 2XMTA 3WDOA 2OMOA 3UDCA 4F67A 1FEEA 3HHLB 1X7VA 1X0PA 2N7YA 3TOQA 4U9RA 1OSDA 1P8GA 2GO8A 1Q8BA 3DXSX 3FMBA 1VQSA 1GXUA 5F0UA 2ACYA 5T7LB 2XMVA 3FRYA 3LO3A 1JK9B 4HI1A 1APSA 2KT3A 3IWXA 2QLXA 3KG1A 1Y0HA 2HLUA 2ZDPA 2CRLA 3HX9A 3KG0A 3HDSA 1TZ0A 3BR8A 3HHLC 5B09A 2ROPA 2GGPA 1SI9A 2K7JA 3HHLD 1RJJA 5F0WA 4Y2MA 2IYIA 4DL0C 4OJ3A 1KVJA 1S6OA 1S6UA 2AJ0A 2K2PA 3IWLA 1Q8LA 4FNIA 5B0EA 4OIXA 2GV1A 3DCAA 2HQIA 2K1RA 1R6YA 3HF5A 1K0VA 2PD1A 3QMQA 4YDXA 2BJEA 2G9OA 2HFNA 2N4DA 2ROEA 2ROGA 3BF4A 4NL5A 4ZA1A 2W4DA 2OAUA 3LGNA 1FVQA 1URRA 3QGPA 4NPOA 4A4JA 2KYZA 4Q2LA 4ZOSA 3VTIA 5B0BA 1OPZA 1Q53A 2HIQA 4QOTA 5B0DA 4HH0A 5K9FA 3BN7A 2QYCA 2KKHA 3TNVA 1N5TA 3HHLA 3F44A 3HFKA 2PGCA 2K7KA 3CJKB 1Y9OA 2AP6A 2BBEA 1KVIA 2GA7A 2IYGA 4A47A 1Y3JA 3FGVA 3BDEA 2HLTA 2AW0A 4A48A 2JDJA 4DPOA 2KT2A 1AFIA 1CC7A 1FD8A 3LGMA 1CPZA 2XMJA 4Q2MA 1KQKA 4A46A 2XMUA 5KAKA 2ZDOA 1TL4A 1U7LA 1FE4A 5IXUA 1V3ZA 1OQ3A 2HFOA 4OJ1A 1Q4RA 4FNHA 4HL9A 3E8OA 1YG0A 5B08A 2BUNA 3BB5A 2BJDA 3KKFA 1YJTA 1JWWA 1GXTA 2W4CA 1TR0A 2FTRA 2OKQA 2ASYA 3KNGA 1YRXA 2GCFA 2QLWA 2XMMA 3I9ZA 2AJ1A 1ULRA 2FB0A 1AW0A 1N5QA 4HH1A 5B0GA 2N4CA 2OFGX 3MCSA 5B0FA 1W2IA 2LDIA 4EFAC 1SQEA 2RILA 1N5VA 2XMWA 5B0CA 1QUPA 1XBWA 1YJRA 5B0AA 1OQ6A 4YEAA 2QIFA 5T7LA 2XMKA 4OJHA 4OJGA 3MZIA 2RMLA 2IFXA 1TUVA 2FIUA 1MWYA 3T9NA 2GGPB 2L3MA 1P6TA 3GZ7A 1FESA 1FE0A 2LQBA 2LXFA 2EW9A 2W4PA 1YJUA 3CJKA 2OD6A 3TRGA 2K1RB 2VH7A 1LQ9A 2LQ9A 2RU9A 1IUJA 2RSQA 1FVSA 1MWZA 2GFFA 2VV5A 1SB6A 3BM7A 4Y2IA 3BGUA 4Y2KA 2BYCA 5A6WA 2OFHX
chains in the Genus database with same CATH superfamily
1RT6A 5DDRC 3PW5A 4YQWA 5K14A 3WDOA 4X4OA 4K4XA 3MGJA 2AHOB 1S1UA 3DXSX 4ICLA 3FRYA 1T05B 5KFAA 2ZJPQ 3Q8YA 2ZH1A 2V8DA 3SQGB 3CMQA 2DNPA 5I3UB 1DTQA 3MPDA 1FKAF 3VGSA 5L1JA 2E9ZA 2H54B 2DJWA 4DUYJ 3BF4A 4U7UK 1S1VA 4ANEA 2YXLA 2FZCB 4LR9A 5L38A 1VQ6S 3GIKA 2VKRA 2KZMA 3QQCD 1T03A 1VLOA 1LW0A 2QT7A 4JV1A 4DMZA 1T9UA 3UFCX 3TZYA 1QSYA 3DLJA 2WHOA 1EX8A 4UT4A 3J7A1 3ULHA 2XULA 2LQ5A 4DDFA 1X4DA 1HD0A 2A3JA 4ZP7A 3A3PB 3O5TB 1K1QA 1P9QC 1O51A 3T3FA 4O0NA 3GV8B 2J0SD 4Z7YA 5IT4A 2AIRB 4ANDA 2L3MA 4JOUA 3Q8RB 4V19J 1XN9A 4X4VA 2OPRA 1HNVB 4USUA 3ISNC 1WI8A 1RA7A 8AT1B 1W2BR 2JL9A 1RT2A 1WKJA 2B4VA 3SEOA 1VHFA 1S1WB 1B0VA 1YRUA 4NMXA 2R8IA 4C7QA 1AYEA 4RW8B 2OPSA 4K2JA 1HW8A 2F1FA 3HJVA 3MHYA 4L75A 1VRTB 2K7JA 3D3BJ 4LVNP 1SKRA 3KLIA 1R0AB 3ZFVA 1XC9A 4X4SA 2LQ8A 2YY3A 4HHHA 3AODA 4LJMA 1RTIA 3LWLA 2YX1A 2VPXB 2FJAB 4P2XA 4Y65A 2C3OA 4DL2A 1I94J 2RIJA 3OQ2A 1S99A 2JDJA 5G0RA 2F65A 1U0HB 4P2MA 1U1OA 1U7LA 3CCUS 5IOLA 4B9SA 2K3IA 8ATCB 2Q6BA 2DR9A 3DGPB 3E01A 2V50A 2QIFA 4X66J 1SL0A 2X1FA 4TKTA 3TR5A 3K17A 2BABA 1VJWA 2W9CA 3GJQB 5AXNA 4K0KF 1RT3A 4C11B 4PQUB 5CZXA 3MPWA 1W7WA 2V8VA 1KVKA 2FUG9 4KE5A 4FXDA 3QSIA 1LW2B 4CT8A 2CDRB 1RYRA 3WIUA 2WONB 2M0GB 1GMUA 4HTJA 4IQXA 1SI9A 3MD1A 5IT9U 1UFLA 3BPSP 1H3DA 4GVBA 5EWGA 4WTYA 2CQ1A 2ZH2A 2M8DB 3R6LB 1XMOF 2OLWA 3VZIA 3WX8A 1C1CA 4RWWA 4DLGA 4MIBA 1FE4A 3BO2A 1UVNA 3KNGA 5HVGA 3M2VB 4C98A 3NL0A 1X4EA 4CLKA 2NCKL 1BC6A 2JNJA 4G65A 1VQ9S 4NXNF 2OEJA 4Y34A 1X31C 4CM0A 1P1TA 3EXYA 3GQCA 1IKXB 1TL3A 3I32A 2E7VA 2BM1A 4ZPVR 1A6LA 2V2KA 1JKHA 4URQU 4EU0A 2DR5A 3SFGA 4F4WA 2LU2A 1DFDA 4ECTA 1S4FA 3W60A 1H73A 4KT0C 2PA8D 1SC1B 2HHHJ 4ZVRB 1NB2A 4DSEA 4ZVFA 3MCOA 4PG5A 4UW2A 3AJ1A 4ZPDA 3H5XA 4EGLA 4YDXA 2HHTA 2JLGA 1DQAA 3RBDA 2MEWA 2HNDA 1WNEA 4AL5A 3I0SA 2H4YB 1SKWA 4WK1A 1X4AA 4GKJF 2OKQA 4IG3B 2XNRA 3EJMA 2JC1A 3AD7C 1D3WA 2VFSA 5B0CA 1U02A 5LM7E 3RBZA 2HGNA 4I6YA 1IBLJ 2HHSA 1UMJA 1FE0A 1Q79A 3PO5A 2VB6A 3KK3B 2DITA 3EZUA 1J5OA 4M5IA 2KFNA 1B7FA 4KKOA 2XMTA 3NWGA 1MNEA 4ECXA 2AWZA 4NOHA 5L9XA 4JI7J 5E5NA 4CLZA 2QLFB 2ZDPA 2E5HA 3NS5A 3W66A 2G4BA 3RAMA 4PWWA 1VQOS 5IQQA 1JXLA 1HQEB 4X66F 3FQLA 5KG6A 4NZ7A 2E1PA 3DLKB 5DDPC 3C46A 3IR7B 4G3IA 1UVLA 1RWNB 3K5LA 2BBEA 3G82A 3D66A 1PYTA 1UEVA 3ENAA 1YLXA 4BC7A 5SUHA 2HURA 1IBKJ 2BE2A 3TQEA 1TUGB 3S8SA 2NR0A 4OYPA 2RB7A 1L5UA 3CCJS 4PWDB 3CCMS 4RBTA 2GHWA 3QGIA 4H4KA 3NY0A 3CTRA 5HQLA 2UVVA 4O0IA 1PC4A 5J2NB 3CJSA 1JLQB 2DNRA 2ZH3A 1VS3A 3HO1A 3RUBL 3TUJC 2ZUGA 3KK1B 3U27A 5CXTA 1Q82T 4LSNA 3PIPQ 5HBMB 3PNIA 4FYWB 4OI1A 3ADAC 1V6HA 4A8QA 5IQ6A 2CQBA 1NPPA 3IO1A 3V4IB 5HQMA 5A2QY 2IVFB 4IR9A 1U1QA 1KEKA 1S9EB 3OTBA 2UUBF 3PRDA 2N4DA 4F67A 4NXMJ 1H2UX 4N8OA 3IM9A 3KDNA 2VA2A 5FLXU 4DV1F 2QN6B 4WYWA 4CH0S 4DL7A 1LNQA 3GFXA 3GCWP 5CYJA 2I1RA 1S1XB 2R2SA 2V9KA 3RYLA 4K4ZA 1MSWD 2VOPA 4B17A 4F4ZA 2X3GA 1SVDA 1ZETA 1IQZA 1TVRA 1Z2ZA 3L9ZA 4RBVA 4E8UA 2U1AA 4KC5A 2OEKA 3OPKA 2HHHF 4USMA 3FEXB 3L7UA 3MUVP 4Q43A 3GJSB 3W7BA 1SJQA 5E3RA 1Y5IB 1IUJA 3DRRA 4O4GB 3UVJB 3Q8UA 4NLPA 1N5YB 1F1BB 2KJVA 3L4BC 4YB5A 1SH3A 1Z2LA 1EZZB 3KHLA 4ZVPB 3CJ3A 5KFXA 1RAHB 1A9NB 1PBUA 2JJ4D 5A8RA 1ZA2B 3J81U 2VPYB 1XMBA 4FNIA 2M52A 2DISA 1FA0A 5DO2A 1IBLF 2WSEC 2DNLA 3AHPA 2LMIA 1F5BA 3M30B 4DV6J 3LPYA 1B64A 3FGVA 1X0FA 2BDPA 3CCSS 2IBKA 4DPWA 3IP0A 4LF7F 3IAM9 3HHKA 1RWMB 1F5AA 1D9AA 1DJ0A 3LA0A 1IWAA 4OV1A 4JI7F 2H51B 5KT6A 4A8SA 3J7AN 3QO9B 3BGOP 4B9LA 2LECA 1FJGJ 1XK8A 4J7CA 3VHQA 2MGZB 2B6AA 1VQLS 1WHVA 3B6BA 3LO3A 1HNZJ 1KOOA 1UVIA 3TQ1A 3GJRB 2Q1LA 4CNZA 1FI4A 3FEZA 2MKCA 1R31A 1SJFA 4ZOSA 4P72A 1S10A 4J91A 4QOTA 2V69A 5BXIA 4RJVA 1U6BA 4C6AA 2VD3A 1PAUB 2WCXA 3N79A 5DZ6A 2C42A 2BZ2A 5DG9A 3P5BP 3IC1A 4IO9Q 2VG7A 1VBZA 4ED2A 1H74A 2HS4A 4CI0B 5EWFA 2GMHA 4GO5X 2AYGA 3OSPA 2MQMA 2QJ3A 2PEHA 2POKA 4ZN1A 2CXEA 2J9EA 3CD7A 4ZCLA 1S49A 2B43A 2FC9A 5L9NA 5D77A 4NXMF 3GG1A 2CQ3A 1QAXA 2FHKA 1N32J 3HP6A 1JJCB 4PCQA 2APOA 1LFWA 4WE1B 4NI2A 3P6YC 5C42A 3FNNA 1TMJA 2MKIA 4IKAA 5HP1B 2UVRA 3R5BA 1T95A 3EGNA 3J80U 4G1QB 3P4UB 3G2XA 2R7WA 3R5CA 1FRHA 2FGCA 1LWEA 3WC2A 5C7PA 4CIOA 5JVHQ 2DY1A 2YKPA 1FKOB 3UN5A 1KVIA 1HQUA 2XZTB 2HLTA 2HMIB 2K8GA 2C2EA 3SDEA 1T02A 2ATLA 2QC3A 3EE3A 4Z37A 3M9NB 2ERRA 2E66A 4W4MA 2LEPA 4M5HA 3NMRA 4B9NA 4CT9A 3GFYA 2VJVA 3DFEA 3PJ9A 5D0HA 3D7SB 3H42A 9ATCB 4OHVA 2RQCA 2C3YA 2KVQE 4ZP8A 4USIA 8RUCA 5A6PA 2JFDA 2DT9A 1KONA 1HQ2A 2YNGA 3VV2B 4DV6F 2LDYA 3N4WA 3ZZOA 3M2RA 1GXUA 3VGUA 5GADU 5T7LB 3ILJA 5F8LA 2NQPA 3WIVA 4DWIA 2UP1A 2MJUA 2B9EA 3N6NA 1KDNA 4O3OA 2C28A 3C6UB 2ZBIA 2HVEA 2ZH8A 1WG1A 1PCAA 4ZHRB 2YH0A 4J9NA 3K2YA 2HVZA 1NKBA 3AA9A 3NMAA 2Q43A 1IR0A 4A8YA 4USTA 3KXDA 4ES1A 5DQHA 1FDAA 2ZD1B 4NA2A 5THWA 4QBUA 4P74A 3CCVS 4WFNQ 1FJGF 5LJ5Y 2LCWA 1Z1ZA 2JVOA 1WF2A 1H6KX 2PE8A 4WIIA 3IAS9 2JOQA 1GT8A 1Y5NB 3DI6A 4TVAB 2CQ2A 7AT1B 1TUVA 3HSDA 3H2UB 1I6JA 3R2DJ 1RK8A 3IMQJ 3GONA 2MHNA 2Y1LB 2FZGB 1DRZA 2RNEA 2QL7B 3C8YA 1M5HA 4C8YA 2OMOA 3HD2A 3IGNA 4X4QA 4ED0A 3PYDA 5HROA 1RACB 1BWEA 1FK9B 5CHCB 4C3LA 3PJXA 2C2OB 4USKA 1PO6A 2HNYA 3QJPA 1KS2A 1RHJB 1N34J 1QAIA 3VAMA 4YB6A 3DHXA 1FVQA 3MMAB 4FYYB 3CO0P 3CO9A 3W5ZA 3CPWR 2LA4A 1S97A 2VUGA 1JLAB 2CZ9A 4MKBA 4F0MA 1X5OA 1UJ4A 1QTNB 3D67A 4C8LA 3UI3A 3ITHA 3W2WA 4KH0B 4J9UE 2HS0A 2XMUA 1N32F 2QV6A 4PG6A 3ILIA 2UVWA 1VHIA 2UXDJ 1YVFA 2FTRA 2ILZA 2RKIA 5KFOA 4WYLA 4HH1A 3PW0A 4A8WA 4NYPA 2OPPB 3T5KA 2FD2A 4M5MA 1B70B 2FLOA 5BR8J 4PPDA 3CCRS 3PX0A 1H38A 4F3QA 4MJKA 4YN3B 3T5LA 3MEDA 5I42A 1FEEA 3TO8A 5H9EK 1U1PA 1D9DA 4F04B 4OI3A 2HQCA 4MYUA 1BD6A 4N7TA 5KOWA 4OZLA 1EQMA 3PYFA 3CVKA 2FVPA 4FYVB 4G6VB 4U8YA 3NS6A 2DGTA 2AZ1A 5ETNA 3M6UA 4NL5A 3G6YA 5CABA 4KQZA 3R1HA 5ETMA 1KC8T 2O66A 4EK2A 2FJXA 5DQGA 4PG8A 3LGMA 4UUXA 3ZTQA 3V6DA 4FF2A 3SIPB 2MXYA 2HK2A 4I6AA 2GIRA 2CA9A 2BANB 1NH7A 4I64A 3I6PA 2ZKTA 4DFPA 3EM1A 1R8HA 3NWRA 2MKHA 3NCQA 1WD6A 4C8MA 3C16B 2GAGC 2HIYA 4ENOA 1C2PA 4KO0A 3BKUA 4X4TA 3PHTA 4UF4A 3GP9A 2QG9B 2YVSA 1BLUA 2JEJA 3KLHA 5K8NA 1HNIB 3RR7A 2HIQA 4EEYA 1UA1A 4WJBA 1AROP 2DHXA 4U95A 5CQGA 2MZQA 3BDEA 4LBHA 2B9WA 3RTVA 5J2QB 1SKSA 4EO6A 2EFGA 4RNNA 3JB9k 3FVYA 1L3TA 2M7SA 3PM9A 3IR6B 4X62J 4N41A 2AJ1A 2XLIA 2V2VA 4EZ9A 3Q89A 2V63A 3I87A 2AX0A 2LVWA 4UZCA 1UWBB 4IG0B 5CD4A 2R9LA 3GZ7A 4HACB 4PUOA 2GHPA 2X1AA 4AYBD 2Y3YA 4LF4F 1N34F 1UJ5A 3GIIA 2CQIA 1X4GA 4ED7A 3ZZRA 4QU6A 2DGXA 1ZM4A 1U6ZA 5KFVA 4Q7AA 3FBEA 5HMZA 3QT6A 3M6XA 4P7TA 2B4PA 1EKRA 2EFOA 2HQFA 4KFBA 5KT3A 2JEIA 2UXDF 1FF2A 2K2PA 4UUWA 2C2NA 4UOFA 2KYZA 2QYCA 1WC6A 4ZPBA 1LWCB 3ZTRA 4PPZA 1R3NA 5LJ3Y 3BBBA 5BR8F 2QEXS 4ALZA 3JYTB 3MEKA 4RR5A 4TYAA 2B5JB 5CA5A 1PKUA 1JWWA 4EBCA 3QLHA 4QWCA 5KFCA 3FCVA 5A8KA 3MM9A 3KLGB 4EFAC 2M5YA 3DXBA 3TZWA 2R7RA 1X4FA 3M8QA 2P9GA 1DARA 3CT9A 3KMQA 2YQ3A 5DLGA 4LSZB 3LH2S 2RSQA 3VQTA 2DGUA 2XZDB 3RAXA 2AJFE 4CDIA 2V2QA 1FRXA 4M5KA 3BGFA 1RISA 4DR2J 3W61A 2R3VA 4F0KA 1VQ4S 5KFMA 1WOPA 5GAGU 3TI0A 2OPQA 4GKKJ 3GE9A 4F8RA 3GCXP 1TL1A 4I67A 1CJTB 2W2PP 5F3TA 4WP9A 1S0VA 1BQNB 2WB4A 1TKXB 2GS8A 4DL4A 5FDLA 2WOMA 1UJ6A 3T5JA 2DNNA 3C2PA 2GVDB 4I6WA 4RNMA 1HYSA 2V4JB 2EEYA 3D28A 4WTOB 1NU4A 5KAKA 4AFFA 1GXTA 3TAPA 2GCFA 4RW6A 3HPOA 2N4CA 5HANA 2DO0A 3NG8A 5J2PA 4NLSA 1X4CA 4H4KC 2ZHOA 4DV7J 1LKZA 4OZ0A 4CLLA 3IA0A 1JLGB 2VBWA 4ANCA 3CJ8A 4KAIA 3AOCA 1GAOA 4ZMMA 4DR3J 1VQ5S 4H4OA 4XTTA 4Y0FA 1IKVB 2YBVA 5ETKA 1RABB 3UCGA 3BREA 2FHJA 4LRAA 4F4YA 3KJNB 4NA3A 1MWQA 1O5JA 1KWMA 2J7UA 4C8ZA 2H5EA 2XCAA 2NUHA 5AE2A 3NGTA 4X62F 2K1RA 3CULA 2VODA 1J2VA 1YITS 2XBPA 1S0MA 2GJIA 4TU9A 2C2KB 1NZAA 1TMMA 1HBNB 4R5PA 4WZMA 2MKJA 4JB8B 3EVOA 2P9CA 3CIZA 5E3QA 2HVHA 2WVEA 2M9KA 2LA6A 3BYRA 1RAJA 2Z58B 1HHQA 5ITHA 2OELA 3CUNA 3KKFA 1L3UA 3R97A 1S1UB 4TLQA 4DOZA 3OTCA 3FFIA 3D6FB 1GEHA 3H59A 2DNZA 2FIUA 1DTQB 5E7OB 3TAMB 5D4LA 2BQUA 4CLSA 4YY3J 2XY7A 1S76D 1NEEA 2CJAA 3FMBA 1VQSA 1T03B 4A8MP 4ETZA 1LW0B 3SSQA 3GU0A 3HVTB 2J8AA 2WTFA 1GQEA 3CC7S 4V1Ak 3TANA 3HVWA 1S7HA 2Y0BB 4WF9Q 3I96A 1I3OB 4QW9A 4WP3A 3OVAA 5EHHA 4ID5A 4RU2A 3UNGC 4JI2J 1S72S 1RT2B 1RKIA 2BUNA 4DL5A 4HHJA 2VQEJ 2OPSB 2CPDA 4DR2F 3BDPA 3EPIA 4GKKF 3OW2R 2MJNA 3CDEA 3LP0A 5DRKA 5AT1B 1F6TA 1YJNS 3KLIB 3QT7A 4OQJA 1VGYA 2B4OA 1M5VC 5J1PA 4LF5J 1RTIB 1GMWA 1TFWA 3CDUA 1WC5A 1UVMA 5G0RB 3AH6A 3H0PA 3TEGA 4PYDA 1OO0B 4OX9J 2AJQA 2VG5A 3ENVA 1NKEA 1T9YA 3TJAA 4A8XA 5IV3A 3TX0A 2PD1A 2GJFA 2X7IA 1CULA 1HNXJ 3D1OA 2J6TA 3M2UA 3E01B 1FRIA 4G1PA 4DV7F 1RU1A 2HRUA 3MOZA 1TKTA 4FVMA 4DCOB 2W9CB 4DR3F 1RT3B 1HBOA 3H7HB 3QWPA 4ZP6A 1VI7A 5IS2A 4X4RA 4LFAJ 4C9DA 4CH1A 2P5VA 4LUBA 4NRUA 4DF8A 1Y4ZB 2KJWA 4DPYA 3KLFA 3MZIA 3D9BA 3GSDA 4YB1P 1XNRJ 4C0HA 3W62A 4GVBB 3LAMA 1QJHA 2RUSA 1DQ8A 1X60A 1VBKA 4KH1B 1M1GA 1X9SA 2VG6A 4KHRA 1U48A 1C1CB 4EO8A 3CCES 4CLPA 2KT3A 2EK1A 1WF1A 3P45B 2FDNA 2I5JA 4JI8F 3W3SA 2UU9J 1NJYA 5E33A 3BGRA 1S6UA 5B0EA 1HNWJ 1M5SA 2CJQA 5CAAA 3ILOA 2KN4A 5LT5A 5KFUA 2V0NA 4K7QA 1HBMA 3VR1A 1VBYA 3QJLA 2DH8A 2IYGA 2KI2A 1TL3B 4RUBA 1I1GA 1VQMS 4Q2MA 2C2ZB 1MG7A 2VF3A 4OZNA 1B99A 1TR0A 2ZZNA 2CJKA 3FQKA 4OX7A 1N5VA 3DRSA 2M88A 5K20B 3HSGA 1YZ7A 5HMXA 2WVBA 3Q8QB 5GAHU 2BACA 1FVSA 4Y2KA 4WZQA 3WC0A 1CS4A 1LXJA 3H5SA 2KT5A 2JFKA 4HR2A 3CDBA 5HMWA 2AEFA 2HPUA 3TVZA 1OYEA 4WFYA 3T5HA 4JI2F 2DNKA 3ETMA 3HCXA 1D09B 1E6YA 1N52B 1WKLA 4KHPF 3I0SB 1LWFA 1VDHA 2VQEF 1JXEA 2FVRA 2IVYA 1RI7A 4I2PA 3DLBA 2XB2D 4ZVEA 4KTQA 3W5YA 5BYRA 2D7SA 4F4AA 3IGVA 2FYXA 3D6HB 2V4RA 1Q5VA 2DCLA 2UZAA 3PG9A 3M32A 1LXNA 4MAKA 4QW8A 4WPAA 5HI7A 4MIWA 2MQPA 3IBWA 5LL6d 4PG4A 4AT1B 4LF5F 2V34A 2WBRA 2F8MA 2GVZA 1HARA 3I55S 2XHCA 3O3LA 2W25A 1HPZA 1ZM2A 1XBWA 3TA1A 3UN2A 1FNMA 4OX9F 1PJ5A 2DGOA 4RNFA 5L1LA 3FCWA 2E1RA 4O4RA 2D3UA 2EFNA 2MTLA 1U8SA 4DF4A 3I5AA 3C14A 1X7VA 4PXEA 4U9RA 2A1BA 4A8OA 4OHWA 2ZJRQ 3G82B 3SZ2A 1V3SA 2DEJA 1RT4A 5EUHA 4EBDA 1RTHA 2BE2B 4LFAF 3QJJA 2HGLA 4MT1A 4QWDA 6FD1A 2YKNB 4IQMA 4KR0B 4PG7A 1QDUB 3HK2A 3M7VA 1NJIT 1F3VA 1XNRF 1RYSA 2MY8A 4JI4J 2U2FA 2UUWA 3LANA 4FDFA 2LXIA 1EP4A 1CJUB 2ZDOA 5IXUA 4TY9A 2K3KA 1YJTA 4LSNB 4TNOA 2XYGB 3M8YA 3CCLS 3WX4A 4YHHJ 4QPTA 3X3UA 1BMQB 2QA4S 4IRDA 3H2LA 2XS2A 1C4CA 2UU9F 1HNWF 1TELA 3KHHA 2ZZMA 2OFHX 2XMJA 3IRXB 2HKEA 6AT1B 5IM0A 3BV8A 2KHCA 5IFMA 3VALA 1DBDA 3MUTP 4C8OA 1RLDA 5LSLA 4J9RA 3UCZP 2CRLA 3RAQA 4JI6J 4XIUA 2CWXA 1JXVA 2ZBRA 4KHMA 2A0FB 4PKDB 4PZVA 3AOAA 4HH0A 2HZAA 2DIUA 2JRSA 2JC0A 5EX3A 1XIQA 3OL7A 3UD4P 4ZPCA 3M9MB 4DCJB 2MSTA 1RAOA 4OJ1A 2UUAJ 4QYZJ 2IM0A 2B3TB 2LDIA 2HWHA 1S6PA 5B0AA 1XR6A 1RBLA 1HKAA 3DLGB 3NBPB 4I2QA 1QAJA 4QR0A 4DR7J 1HBUB 5I3UA 2MLYA 4ILRA 4YUDA 3FZ2A 4WFZA 2BYCA 3A1YG 4ZP9A 2DNHA 5DQIA 4J9MA 5A8WB 4YMEA 2CQGA 4B08A 3RB4A 2GIFA 4O44A 3H20A 4QIEA 4M63A 3PW4A 2J0WA 2MQNA 3NGDA 1FEHA 1LOUA 3EWGA 1SC4B 2WVDA 2IRYA 3PVXA 2X1BA 4LIWA 4IFYA 2HFNA 4DEZA 2XY5A 3MM6A 3E3XA 1RAGB 2Y1IA 2JEFA 3EMTA 5D6GA 1BWVA 1TKDA 2P9EA 2QL5B 2RRNA 1F9HA 3B78A 1KNZA 4F50A 3MR5A 2IPOB 2B6AB 1AB8A 4W98A 3TZZA 1VBXA 2B4UA 1S1WA 4YR3A 1SUQA 1Y10A 3ZZPA 3LAKA 1H72C 1F0XA 3MAHA 2EXUA 2UXCJ 3R3TA 3G6VA 3T1HJ 6FDRA 1GX6A 2KB2A 4RW9A 4OYZA 1SL2A 4QU7A 1N6QA 4JI4F 3AQOA 2UV8A 2HHPA 2XSJA 3W9HA 2JHEA 1N8RT 2VG7B 2N3OA 3PV8A 4I4BA 1NO8A 3MPVA 2YNHA 2ATCB 3RB3A 2HZCA 5DM6Q 1K0VA 4KRWA 4YHHF 1RBAA 4OL8A 5E3AA 2YKQA 3ZXWA 2MMYA 4ZVTB 2IAJA 2ZBCA 4U6PA 2AEMA 3Q8SB 5AXKA 4J9OA 2AW0A 4IOAQ 2GMJA 2XLJA 1CC7A 2KG0A 3GIJA 4RW4B 4JI0J 4FNHA 3ELHA 3QRPA 4X65J 2RS2A 4NI2B 4J90A 2ZEJA 1RWPB 3GYNA 5C42B 2OFGX 1ZPVA 2AQ4A 5A2QU 1P9YA 1WC3A 4UQTA 1HD1A 2RMLA 4IOCQ 2WONA 5JMNA 3H4DA 3W64A 4OI4A 2PN6A 2NREA 5KTQA 1NSAA 3F41A 5I3PA 2WB1D 5DLFA 2V94A 2J6SA 4TU7A 4UTGA 4DZDA 4Q44A 4DQPA 2ASJA 2YKAA 2QTWA 3HULA 3MTKA 1FJCA 2JZ5A 1HQUB 2G0JA 3DDIA 1R43A 4GC6A 4L72B 1ZZNA 3SDEB 4WKRA 3HX9A 3KG0A 2NXUA 4ZIWA 2UUAF 1Q8IA 2F5GA 1Q8LA 2HBRB 3U1LA 2D3O1 2PI4A 3M2VA 2BA9A 3GJTB 4ZVUB 4CCHA 2AYMA 4DR7F 3U7JA 1QLNA 3CF5Q 2PA3A 2EKYA 5E2QA 4RUCA 1N48A 2QSFA 2HSEB 3A3OB 3BN4A 2I8EA 1TV6B 2MPUA 4HL9A 5KFIA 1YZ6A 4RZRA 3Q24A 2B51A 1FRLA 2IY5B 3M2RB 5F8HA 2DNOA 3W63A 2ZITA 1PAEX 1R89A 3J7YI 4Y2AA 1S9FA 1FESA 5D78A 1QSLA 3D4JA 1SIZA 4WBFA 1U0SA 4ECWA 1U1LA 2GJ2A 2P6TA 2DO4A 4RNOA 1H7XA 2ZZTA 4WFBQ 2XYPB 4NASA 3CCTA 2N7YA 3EZOA 2IM3A 3CEDA 1WC1A 3E51A 5AE3A 4OMFG 4QR2A 3DKDA 4K4SA 4AXIA 4OJ3A 1RADB 4L76A 2GV1A 2XWXA 2EC2A 1BE4A 3DI6B 3NNCA 3K0JA 2UVUA 1N0UA 2SXLA 1SJRA 4DBQA 5LSOA 1S7IA 4FF4A 1WG4A 1REVA 3HHLA 5AXLA 3SCKE 2IJRA 3Q2SC 1B3TA 2PGCA 2UXCF 1Y9OA 2ZOFA 4DV3F 2DCUB 3AFGA 2DHAA 5HN0A 4USHA 3T1HF 1VIOA 3PO4A 2QA2A 1Q7LB 1YBAA 2CZVC 5HROB 2Y1RI 2BJ8A 1UP1A 2C3MA 1W2IA 4OJHA 1N36J 4UY8T 3BO3A 4B3SJ 2ACMA 9RUBA 1FKPA 2HNYB 2OD6A 2COLA 2YWWA 3MCNA 3UNYA 3MMCB 1T0TV 5J1EB 5ETPA 3UDEA 1Y3KA 1YQHA 1ROFA 4RUHA 1TK5A 2XM3A 4B3MJ 3OUYA 5JJBA 1HQEA 2W9BB 4RNHA 3BQ0A 2DBBA 2LU1A 2OMLA 3D1HA 4RO0A 1Q8BA 3DLKA 4LQ9A 3DNCA 1UKUA 4DV5J 1ICEB 4L3KA 1JLBA 4NEYA 3ITHB 3IWXA 3NCRA 4LF2A 1KTVA 4JI0F 4F0HA 1S0OA 4X65F 2BMBA 3TA0A 2CG4A 2RKIB 1UPPA 2C3UA 4AQYJ 3RW7A 4MK8A 2KKHA 4KV8B 1CQMA 1IR2A 1RKJA 3DU6A 2IA6A 2NUUG 5J2NA 2BE7D 4KGKA 2DKOB 2ZH4A 5M2PA 1PBAA 4RW7A 2CJYB 3MEDB 5I42B 2VPWB 4PEOA 3OTOJ 2W4CA 4PQAA 4DUTA 4DX5A 5B0FA 5HBMA 2W7OA 3UD5A 5SZTA 1G3OA 5C25B 1S59A 1OQ6A 3PKMA 3NAHA 4B3OA 2FHJD 3MCMA 3IWNC 3OJSA 4Z2XA 1YX2A 4NZ6A 2Z4PA 3NP5A 3PEJA 1AFJA 1X8DA 3RRHA 4Q5VA 4FYXB 5F8MA 5KFJA 4OZ2A 4DL6A 3V81A 4ATNA 2ZE2A 3AXKA 2YNIA 2G2OA 1S1XA 3V6DB 1GNKA 2CPEA 4P6QA 3OL6A 2VL1A 2ROGA 4C97A 3T41A 1NHKL 1NKCA 4G1IA 1GK8A 1KRPA 3SCLE 4M5LA 1VK8A 3D2WA 3BSOA 1FCAA 2BXJA 2ZC3A 1OY8A 1DHMA 4DR5J 1IVZA 3LPEA 4RLEA 1N5YA 2CJ9A 3D0GE 1T9XA 4ED4A 2CYYA 4KO0B 3T19A 4DFMA 1VRUB 2Z57B 2DGVA 5I4MA 1RWKB 2Z8QA 1YI2S 3JTNA 3KLHB 1RTJA 3R27A 1RSCA 5ETVA 1CC8A 4LR7A 3C6TA 1UWAA 3L7PA 4GMKA 2CPHA 4FP9A 1YHQS 2FLNA 3GFHA 1H98A 2ABYA 3BSCA 3MF5A 4GRSA 1NZ8A 3P49B 2R2UA 3TAQA 2OSQA 1VRQC 1BY9A 1JLCA 2Y8YA 1N36F 4DQRA 4NZ0A 4B3SF 2WAQD 3M8RA 1HI1A 3HT3A 4PUOB 3MTJA 2KHDA 2AP6A 2KXHA 4CLYA 1JLFA 2R7UA 1VQ8S 2PO4A 3QO9A 3NCPA 4QWEA 1ZOTA 2R8JA 4B3MF 2DH7A 2KFYA 5ETQA 4Y2CA 2HEKA 4DV5F 1KLMA 1VJQA 2RUGA 3OT9A 4P71A 3NKYA 2GZOA 1NDKA 1GMWD 2G2ZA 3MPYA 2ZVIA 1HW9A 3DYAA 4M94A 4TYBA 1T9TA 1KFSA 1FTRA 2PMHA 2CAJA 3JSMB 4J5OA 3MM8A 3KUGA 2CQDA 4L6V3 4ZVOB 3OTOF 3A12A 2ZBQA 2V2ZA 5A8KB 2RHSB 2QA1A 3MM9B 2ALYB 2V5HG 3WHIA 3M8QB 1HHSA 3O2IA 5E3PA 2IHR1 1KD1T 4USWA 2D1CA 3MUMP 2W2QP 4NLTA 4CLFA 2J9CA 1XEZA 4URGA 1ZPWX 2H9ZA 4DUYF 2ZH5A 2D74B 4WE1A 1KBRA 4PXCA 4ECYA 1VFJA 1FJ7A 1YBTA 2HYIB 4EUVA 4IDKA 3IS9A 5KG3A 1TL1B 3A8IA 5KG2A 3BGUA 4K4TA 1CJKA 5KG4A 1WTFA 4NLDA 2BX6A 4I0WA 1K9MT 1JLEA 1VCTA 1R8AA 2LXUA 1HMVA 1VLYA 2ZVSA 1CG2A 2L9DA 3KJVA 1U2RA 3SSSA 4DSFA 3OVBA 1QM9A 2HMIA 4URSA 2ROPA 2GGPA 4MH8A 5D0EA 1UFKA 4RW6B 3AXMA 3JQJA 3I0RA 3QGPA 3V4MA 2E7XA 3PRBA 5J2PB 3BEGB 4TN2A 1UPMB 3TNVA 3THPA 3GIMA 5HQ8A 4A47A 2E1AA 3GIRA 3JAMY 5F8NA 3BQ2A 3M1VA 4H4OB 1LK7A 4CO0A 1OY6A 1UTAA 2MKKA 1ZYQA 2YWFA 1V5IB 3OXFA 5D3GB 2MKSA 2XMMA 2BQRA 1B0PA 2ZUAA 5B0GA 3PIOQ 4DFKA 2XI2A 1X5SA 4IO1A 4ZLPA 5T7LA 2OTJS 1CJVA 3PY8A 1I94F 5A76A 1SQGA 4DX6A 1JJHA 2CQ0A 2HG4A 3JSBA 2K1RB 2YKMB 5A6WA 3LP1B 3POTA 2Z2LA 4EI2A 3M05A 3W8PA 3PEHA 4ZHRA 3EGVA 3MEGA 1X0PA 2VBYA 3MECB 2E5LJ 3SV3A 4ZLJA 3R5AA 2I38A 2HLUA 1Q81T 1JIHA 4M5DA 5DGBA 5HVHA 4ZVHA 3MR2A 3I31A 1HLWA 4NLWA 3FFIB 2O3DA 1PYOB 1WC0A 4KB7A 4ZCKA 1N5TA 2H65B 5KG0A 1SPBP 1N4LA 4QIGA 3CGIA 5JVGQ 5GMEA 3HI9A 3O1LA 2MSSA 1WUUA 3VQSA 4QWAA 2KU7A 4BWMA 4CO3A 2XS5A 1SKUB 1AT1B 4A8FA 2IC3A 3C15A 1C0UB 4ECSA 1H7WA 2QFJA 3QIPA 5KFDA 3KLVA 4K4UA 4DFJA 2HVIA 2R4FA 5E3CA 2IJFA 2DD8S 1IXKA 3K8VA 2FY8A 1WC4A 4NLVA 3ENWA 3HD1A 2CVEA 2A6OA 4ID5B 4B02A 3NNAA 3UWTA 2RF2A 1U1MA 2IBOA 1IBMJ 1NM2A 3NGUA 1YJ9S 1NHUA 2Y1JA 2G0IA 5C5JA 3PX6A 3CJTA 5KFHA 2KL8A 3PZPA 2QX0A 4X2BA 4JV5J 1TL7A 1XMQJ 1FT8A 1PJ7A 3EVMA 4UOHA 3WZ0A 2Q6CA 4IH7A 3ZZYA 4DV4J 2AYBA 2NSBA 5IV4A 5EWEA 4RU9A 3MM7B 2NYHA 4DR1J 2MLXA 2G1HA 2WSFC 2FHOB 1WDTA 1DLOB 3DU5A 3NAIA 1YJRA 2BR0A 2VKZG 4YB7A 2VG5B 4UQGA 2BV3A 2WW8A 2BOPA 2BRKA 1CULB 3M2UB 2Z2MA 2YH1A 1EETA 1TKTB 2A10A 2B8QA 2EG1A 1Q95G 1HBOB 3KG1A 2H5JB 4NMLA 3RW6A 2KZZA 4ZN3A 2R8GA 4ZS6A 5K8OA 1RT5B 1RHMB 4ILLA 4R25A 4IRCA 1TKZA 1U47A 4I56A 2CNOB 2XG8A 1Q8KA 3KLFB 3OR2B 4DG1B 2BANA 1KQGB 4WU3A 4N47A 1NJWA 1NB7A 2W7AA 4NLYA 4OX6A 5FIIA 2GQQA 5U47A 1U4BA 3N6LA 2E44A 5JUMA 5IC6B 2VG6B 4ECVA 2E5LF 3CJRA 2D3OR 4QCLA 2OGUA 4ZDNA 4DXLA 1S1TB 1Y11A 2GHVC 4RPFA 3BGRB 5IT0A 1IBKF 2QLJB 4OI6A 2OP5A 1NUEA 2LKZA 3B82A 2B7CB 1FX4A 2RJZA 3AD9C 1HNIA 3IRWP 4NLXA 4BC9A 4DCPB 1VYAA 2OI2A 2ZC4A 4X4NA 2OJ3A 1U8WA 5DZ7A 3BR8A 1RWXB 5J2QA 2CADA 4LRDA 2LEBA 1XTZA 2VONA 2FLPA 2YPYA 1JNRB 5T41A 1Y00A 4IG0A 1VC5A 1QD1A 1EB0A 1UAWA 2GA7A 1N54B 5MLCV 1FDNA 4HACA 1CS4B 7FDRA 2KTQA 4C4WA 2D9PA 4BS2A 1DURA 5CD4H 3PKYA 2CUYA 4FS1A 4Q0BA 4X64J 2KFZA 4MTPA 1GXLA 1E6YB 4KGZB 3M8PA 1FJEB 3ZZUA 1KHWA 3B4DA 2VICA 4F3MA 2IFXA 1LWFB 2V67A 1IBMF 3HJFA 2CZ4A 4U96A 4M5NA 2M70A 3OR1B 1WEXA 3MMJA 2RQ4A 4MFBA 4JV5F 4NCAA 3OFEA 3M32B 1XMQF 2DXDA 2MLZA 1O6XA 3GWCA 2NS1B 4DV4F 3VAHA 1YIJS 4ILMA 4NWBA 5HK4A 4Q8EA 2HFVA 4V19X 4OYOA 1RHRB 3PHEA 1HPZB 2BE9B 4WFAQ 2BRLA 4OHZA 4NLUA 4LBIA 3TARA 3OD2A 1B4SA 1R0CB 1TP7A 4CYUA 2AEJA 4C8KA 1HL6A 1CPZA 2F63A 2ADCA 4JYAJ 2KRRA 2RRBA 2DNQA 3C14B 3DOLA 1CSJA 4PABA 2VU5A 1RT4B 1XJWB 1RWOB 5F8GA 1RGVA 2R42A 4TXSA 1RTHB 4ZIVA 3RJMB 2YPZA 2UXBJ 2QO3A 3I56S 1QY7A 1U24A 4J9VA 3BJYA 1WSVA 4KIAA 3BZQA 4HI2A 1FD2A 1OYDA 1CJTA 3B8HA 1CQNA 2YNFA 4MKYA 3K5MA 1WACA 1OSDA 3L09A 1FDBA 3JXOA 1JK9B 3BS9A 1EP4B 4WU2A 2DR6A 2W8KA 4EMDA 5D4OA 5KFWA 3TX8A 3QT8A 3TA2A 3QWUA 1K8AT 5KOXA 4O3NA 3H4BA 5KG7A 3G9CA 4IYQA 1S6QA 2DR7A 3VTIA 1Q53A 1WOSA 1UCNA 5KG5A 2Q79A 1HNZF 2DY9A 4CLTA 3W9JA 3N6MA 1MU2B 2XGPA 4X84A 1JLGA 3CD6S 5IM0B 4K0KJ 3E8OA 1CVJA 3Q23A 3CC4S 3B54A 2KVIA 1KTQA 3VVUA 1IKWA 2YWHA 3HSJA 2XMKA 3L7OA 1GX5A 1RAEB 4OHXA 4OJGA 1MWYA 4F36A 1NHVA 3KK2A 3DOKA 4OFZA 3L3CA 1U2FA 2PIIA 2BVZA 3FBBA 2BW2A 3CIMA 4DQIA 2C3PA 1Q16B 5HAOA 4CRJA 4U8VA 1WKKA 2GO8A 1XMOJ 3DLEA 5KFQA 2HBZB 5ETSA 1APSA 3SFUA 1Y0HA 4TY8A 1IBCB 3PYGA 1T9WA 1TZ0A 3F73A 1U09A 3HHLD 1FX2A 4WIQA 4X64F 3ZTSA 4H54A 2IRUA 3T6BA 5ETTA 4F2SA 1S6PB 2QRRA 1BXNA 1QSSA 2C22A 4I2QB 2MZJA 2BQ3A 4NXNJ 2J7WA 2QSWA 4USVA 1G7CB 3TAMA 3CWJA 2W9AA 1MMDA 3PCOB 2AX1A 1J5EJ 1GTHA 1YG0A 1SJ3P 4DI6A 1KQFB 3DN9A 2DIVA 1ZAXA 4O44B 2PC6A 3KLEA 3EXCX 2R7XA 3FUYA 5CH7B 4HDHA 2EKNA 4N77A 3VZHA 3HVTA 3MAAA 2F9DA 2W2MP 1TQLA 3D68A 4K50A 2VPZB 4MYTA 4IFYB 2GFFA 5LXRA 2QLBB 1VIXA 4CNYA 3NS7B 3MM6B 2W01A 4ZJOA 4LRFA 2R7QA 1JJ4A 3PDNA 2W7PA 2YQ0A 1U1NA 2XC9A 1YJWS 2OHDA 2Z2YB 7FD1A 5RUBA 2ZWPA 3S7RA 2HNZA 4OYXA 4QYZK 2ZFHA 4JYAF 1YGYA 3GR0A 4CLWA 4LFBJ 1S57A 1YSJA 4S0MA 3UR0A 1SUQB 3GG0A 4GKJJ 4XDCA 3RBXA 5M2UA 2UXBF 1URNA 5I3QA 2VFTA 4R0EA 3CW2C 3DDKA 4EWTA 4H4MA 1AA1B 2NPIA 4NLGA 4RW9B 1N6QB 2XYHB 4BLGA 3ET6A 4ER8A 1HI0P 1RHQB 2XSJB 1YK9A 4MIAA 4YDDB 1FO1A 2LXFA 4K4YA 1N56A 2YNHB 2CQHA 2OSRA 2LQ9A 1I5OB 2Y8WA 1WELA 1XNQJ 4PWUA 2LP4A 3D1QA 2QFIA 4C48A 3QRRA 1NH8A 2WZ1A 4DU7A 5D0RA 2IAJB 4JUZA 5F8IA 3QFWA 1RT1B 1WORA 2PFFB 1KSPA 4R8UA 4B9UA 4OIXA 1EKSA 3QMQA 3GV5B 1R7IA 3KJQB 5GADI 4DV0J 2CNLB 5B0BA 1NSKL 1WDDA 3DHWC 4Y00A 3M8WA 1RCXB 2ZJQQ 2ASLA 1ZH5A 2BJ1A 2E1CA 2G1DA 3K57A 3FSIA 1NK7A 2LFVA 3UE2A 2C2MB 2W8LA 2XY6A 2KT2A 4KJIA 1BGXT 2ZOMA 3EDQB 1JQGA 4HTIA 4DS4A 4OYAA 2JVRA 4HEA9 2OUGA 1UW4A 1RTDA 5C2GA 3ISZA 4JV2A 4EZ6A 4NCGA 1NRKA 3BH6B 3SXLA 3ICLA 4HT7A 3P3DA 1RT7A 4IFVA 3UDCA 5GAEI 4Y2IA 4DQSA 2EBGA 2IA0A 2RH3A 4ZVSB 3ISND 5ETLA 2UUBJ 3DRPA 2I2YA 4P10A 4DQQA 3UDVA 3SYZA 1C0TA 4RWXA 3D0HE 2VHGA 4DV1J 1N0VC 4CTAA 2B0GA 1GFWB 2J9DA 1D0EA 4LQ3A 3OVSA 1J5EF 1T7PA 5CYMA 5J2MA 3L95X 4ELVA 2DHHA 3Q0AA 1RQ0A 2EPIA 5DJBA 4ZA1A 2XNQA 2BM0A 2GX8A 3QGGA 5HJYA 3TJ9A 3VAKA 3KYLA 5DG8A 5H9FJ 3G8QA 3B4MA 4A46A 2F3JA 3J81j 3CSKA 2LQJA 2V68A 4Y28C 2C1EB 3C66A 1U25A 1NK8A 5HATA 2R2RA 1YTYA 4WWSA 4DLEA 3K59A 1NAQA 4LFBF 3TVYA 2G13A 1RA6A 2IM2A 1RWVB 1SJ4P 2Z0GA 4FKYA 4FKXA 1Q7YT 3OLBA 2XMAA 1FXLA 3G87A 3CJ5A 1REVB 3HHLB 2WW4A 3FSYA 1IKYA 1MROA 1EARA 5H1SV 5CYQA 1FWPA 2OIHA 2CJBA 3KJFB 3UR3C 1CEZA 2HFUA 4ED1A 3UO0A 4LF7J 4IUFA 3ETOA 3GLJA 3OJUA 1FFGB 1ZBTA 4AUKA 1FKPB 5HLFA 4EBEA 2XHWA 3AB4B 4TQSA 1QE1A 1XNQF 2J6UA 2CPJA 4DV2J 3V6KA 3OUYB 2C2RA 4DHVA 1JLBB 4YP3A 5HMYA 5GMKa 2XMWA 3GYGA 2E29A 3HFZB 3TYTA 1WI6A 3FZBA 2DPIA 2LQBA 2DK2A 1NSQA 2KDOA 2PMWA 3TRGA 2EI5A 3JTPA 3M6WA 4P73A 4DV0F 4ECRA 4Z7CA 1DY3A 3FKBA 2YKNA 3FBCA 4F26A 2Q3PA 4ELUA 3TOQA 2MQQA 5D8HB 3DM2B 5C24A 3BSNA 2RDJA 3TUIC 4I68A 2M3DA 1QUVA 1RE1B 3UN3A 1FNXH 4ZVGA 1UZDA 2IIHA 2CDQA 3SMZA 2NXEA 5B09A 4ZJLA 4RW7B 5EX0A 1WHXA 3R1LA 2FVSA 3D5MA 1CJUA 1S5ZA 1RT6B 2W4DA 1IN0A 5K14B 4ZK7M 3W2VA 3ZZ0A 3N01A 1F9EB 2B56A 3BN7A 4ICLB 1IJEB 4O23A 3NGSA 4B3OB 2NXNA 4OYWA 5KT7A 3OSNA 2Y9HA 5E0OA 5E41A 2KYXA 2RE1A 2H4WB 1MLAA 2VBZA 3IRXA 2YX4A 3BB5A 1C1BA 4K4WA 1PILA 3FRZA 1O8BA 3V81B 2VC0A 2F9JA 1S1VB 3IG1A 3CJ2A 2ZE2B 3I82A 4LF9J 2YNIB 2J8SA 1VOMA 4QR1A 3BQ1A 1BHNA 4NLRA 1QVFR 3OHBA 3PTWA 3W9IA 3U1MA 4DSIA 3K7RA 2CPYA 4ES2A 3OXGA 3PFEA 2DPJA 2RVJA 3UQSA 3PW7A 2AU0A 2ALZA 2AJ2A 2VDIA 1VQPS 4XO0A 3RRKA 3BSAA 4KPYA 3M8ZA 2QA4G 2OPRB 3LP2A 2AGOA 1VISA 3HF5A 4NA1A 2VOOA 5D4PA 3CD5A 1OPZA 3G71S 3R7BB 2QMWA 2UUTA 3DLGA 3NBPA 2RDIA 1RTJB 1HBUA 4Q45A 4AL6A 2E5JA 4DPOA 4QZVB 2FJVA 3QNWB 4LSLA 3VGVA 4KGMA 5A8WA 1X4BA 3I9ZA 3C6TB 1B0TA 1G2EA 2IDLA 3A4TA 5KFLA 4RBUA 4DPXA 4OHYA 1AZSA 4OV6A 2RU3A 2O5DA 3ZTOA 3TEHB 3BM7A 3JS9A 3A3NB 4D3HA 3O6QA 2ZH7A 4QIFA 1RHKB 1JLCB 2R8KA 4NYOA 2DGQA 3MURP 3AB2B 1Q86T 5LOQA 2ACYA 1JLFB 1ZA1B 2FLLA 4DV2F 1ITPA 1X9WA 5HO4A 2JWNA 1S9GA 2AJ0A 4LRBA 1KLMB 2HQIA 4FZVA 3BBFA 2G9OA 2DRDA 3HKWA 4DN0A 4ECUA 3KFWX 5GAGI 2P6SA 3WQPA 5DDQC 1WEZA 4F25A 2GMLA 1ZZFA 1F2HA 3ZNJ1 2F4VJ 1YRTA 3P5TL 2BOAA 1H0HB 4MK7A 3DYAB 3AD8C 2BJ3A 5HJXA 2L08A 1DTTA 2BJ7A 3RB6A 1KR4A 2L9WA 1HWJA 4X4PA 4WCEQ 3EX7B 2GQCA 3MM8B 4ZPWR 4ZCMA 4OYIA 2NLWA 4LF1A 4CO1A 2VIHA 4MKAA 4NLQA 3OXLA 1RLCL 2A6MA 2F8EX 3MMBA 3DLHA 5GMDA 2L9NA 3Q83A 5KT4A 1X9MA 4F3OA 2FQQB 4L3NA 2E5IA 2ZM6J 1TL5A 1RBOB 4AE5A 3P96A 2AT1B 1EQ0A 5M2RA 2ZH9A 2MZTA 1HWIA 4AD6A 1R6VA 1X4HA 3VAGA 5A0YA 3CB4A 2CJXB 3G96A 5L46A 2RQKA 2K06A 2J76E 1V3RA 5F0WA 1TAQA 4RW4A 4LBPA 4K8RA 1HWKA 3KUHA 2RHQB 3RU0A 4YY3F 2YX7A 1JKHB 3HVRA 3MAQA 4LF9F 4NPOA 5DETA 1FNOA 4O3SA 4OX8A 4IDKB 3EICA 3IS9B 3DOMA 3RRGA 2DNYA 3MXHP 1CJKB 1XERA 1KQKA 1JLEB 4N56A 2DTJA 3CJQA 1HMVB 3LGHA 3GTYX 2YWKA 2QMUB 3LTOA 5F41A 2QGFB 1U49A 2ZHBA 3KJVB 4ED5A 3RG6A 2FZKB 2NXCA 2GGPB 5F3ZA 4HDGA 2HNDB 2BKPA 1G6BA 4WXWA 1RXOB 3UD3P 1UZHA 3I0RB 3MR7A 2L48A 1N5SA 3FMWA 2D41A 1P27B 4I7FA 3FBFA 1TAUA 4P52A 1KFDA 2J9DE 3VAIA 3M1VB 4M5GA 3FCHA 4MKVA 4FF3A 1HR0J 1TV6A 1N88A 2PDAA 4CWBA 3MM5A 1ZAWA 1NCLA 1J5OB 1E6VA 2MB0B 2AGPA 4KKOB 2BEFA 1NPRA 4OI2A 3DMJA 1CJVB 1F9FA 3NGKA 5DG7A 4KBIA 3TVKA 3V2UC 1Y3JA 3H2VE 3W65A 2HHVA 2RT3A 2LYVA 3POTB 5HVFA 4IH6A 3PXGa 1M1KT 2HFOA 2MQOA 4LF6J 3MEGB 1CLFA 5DGAA 2G2YA 1HNXF 3HM9A 1TTHB 1W25A 4OYMA 4YEAA 4DS5A 3M9OB 4IR1A 4M5DB 2JSXA 3CJKA 1WEYA 2KXNB 1QTMA 5GAEU 1RTZA 1S79A 5K8PA 5KFPA 1RWWB 1QVGR 2XCPA 1RUSA 4BCAA 2F4VF 3O8WA 4OZ5A 3LF0A 2PT0A 2DB1A 3CCWA 2J7KA 2WK4A 3VF0B 2CVIA 4DL0C 2X1GA 3UCUP 3GB0A 5KT2A 5LMNJ 2IC3B 3M6VA 1K0TA 4JV0A 3C15B 4GC7A 3MR3A 5F9NA 3CC2S 3QIPB 4F7VA 1HI8A 2FGOA 2WVFA 2HAIA 1M1HA 1AFIA 4GVLA 3VCDA 2ZM6F 4LF4J 3MMCA 1FTCA 3SQOP 5J1EA 1FWKA 3BKTA 3LQVA 1BQMA 5HL7Q 2XO6A 2W9BA 2FB0A 3MCSA 2PFDA 5IT9Y 3THVA 2XQCA 3CJ0A 1TUWA 2RF2B 2CQCA 4XPCA 4TQRA 2GIQA 2MQLA 1YJUA 3HHDA 4DR4J 5AJ3J 1SJ1A 2HHQA 3MEEA 2N82B 3R2CJ 4DSLA 3PR4A 1YBUA 2CKWA 1SH0A 3Q86A 1YJVA 3OLAA 1RDRA 1MN9A 3H5YA 4C0OC 1TVRB 5F9LA 4CO2A 1NDCA 1TFYA 1M5OC 1ZTTA 5CCMA 1TL7B 2ZKUA 1ZM3A 4LFCJ 4KV8A 3G6ES 4OLOA 1K44A 2VQFJ 2E9RX 3KWMA 3G6XA 5LSRA 4DX7A 3Q8VA 1RJJA 3DRRB 1SV5A 1PJ6A 1NK4A 2BJEA 4U67Q 4JI5J 2CPFA 2FC8A 4KSEB 4WK3A 5C25A 2P2CB 4F4KA 2GW8A 2O1PA 3CDWA 2QZ8A 3K8WA 4OYBA 3K5PA 4C3KA 1HA1A 2M8HA 2M2BA 5A8RB 1T05A 1PGZA 2NPFA 3SV4A 2DVIA 2OEMA 3D3CJ 1JX4A 3SQGA 3QAUA 4HHUA 4USJC 1EETB 1YWXA 3R5DA 2BJ9A 4WXOA 1WOOA 2I9SA 3WBZA 3EPGA 2IRXA 3H25A 2HBQB 4FBUA 1HR0F 5BJRA 1UVJA 1N33J 5EN1A 4DUZJ 1TKZB 1XQIA 1K47A 1MWZA 4P75A 3THTA 2QYGA 1IJFB 2FJDB 3JAMU 1NK6A 3QRQA 3M8SA 2V4QA 3DRXA 1JMTA 5GAHI 4XAKA 3RR8A 1NMEB 2E5GA 1NK5A 1KQSR 4LF6F 4OZ3A 1PC5A 4C3MA 1V9OA 4NRTA 1M90T 3ZNUA 2HQDA 3GR1A 3OBIA 1U1RA 1HNVA 2L41A 1SCJB 1UL3A 2DYAA 5K9FA 2R7VA 2HWIA 2F40A 4FBTA 5K8MA 1VRUA 3PRVA 4PR6A 1WHYA 4RW8A 3JQMA 4LF8J 5LXYA 3V6HA 3ZZTA 2KRBA 2NYIA 1VRTA 5KFZA 2PSZA 4PAAA 5B08A 2HHUA 1HFEL 1R0AA 1N5QA 2W2OP 2ZNZA 2D9OA 2DHGA 4U7UD 3E2EA 1SC6A 1PYSB 4NCBA 2J0QD 3JQKA 5GVQA 1VQ7S 1OMSA 1FXDA 5LMNF 3P8BB 2XI3A 1U0HA 4L73A 2DR8A 3QYYA 3PW2A 1YJ7A 4BHQA 1EHWA 3GYXB 4BDPA 1P8GA 3D6MB 3Q22A 2YWEA 4IH5A 2PEBA 3A8EA 3DGPA 3TWZA 2HS3A 2QLXA 4QYRA 2P8IA 2AGQA 3MWBA 3OL9A 2IMWP 1BQXA 1VMBA 3MDFA 4Q0BB 4RX6A 1EJ7L 1Q1KA 4C11A 3M8PB 4PQUA 1IR1A 2ZOGA 4UOGA 5L8RC 4J37A 3EVWA 4O3RA 1AUSL 3R9LA 3IN5A 3GFZA 4JBCA 4DR4F 5AJ3F 4JI6F 4PRFA 1LFPA 1LW2A 4A48A 2KXFA 2F8HA 1KHVA 3CNQP 2EC0A 3AJ2A 1IWGA 4YR0A 4MFBB 3KHRA 4NX9A 2PMZD 3JSMA 4LFCF 1LWEB 2RQMA 3OFFA 2VQFF 2H48B 2H1YA 3R5JB 1FRKA 4FVCA 4F2RA 1NDLA 5FLXY 2VV5A 1SB6A 3G8TA 2HGMA 4JI5F 2B8PA 3BKFA 4DU8A 1R27B 3JTOA 4KPCA 4ZJQA 4CYUB 3AAWB 1HWUA 2WVCA 1OY9A 3HFVA 1KLNA 1AXQA 1RHUB 4B9MA 2RS8A 3KMSA 2J5AA 3DOLB 3RZAA 2UV8G 5IC4B 1IKXA 1MN7A 1MMLA 2DRBA 4FXVA 4I69A 2YTCA 5IWAJ 2YNGB 2HVDA 1RAAB 3N9UC 4TU8A 5KFTA 2FVCA 3G8SA 5KFRA 3HFKA 2X51A 1N33F 3I4HX 5KFSA 4DUZF 3QFHA 3QATA 5MAOA 2VA3A 5D4NA 2FPHX 1G1XA 4K5SA 2YNFB 1SQFA 4NEZA 3IXQA 2BJDA 4CO4A 3R8YA 1YRXA 1AW0A 2F4FA 3J81Y 4HVZA 2XZWA 5JXSA 2ZNYA 4ZLNA 3A8JA 1LK5A 1T9VA 4EYHB 4LIRA 3N5BA 1XWLA 3HLUA 4DJBA 3R5GA 1S6QB 2FJWA 4ED6A 3IM8A 4IG3A 1M0SA 1K73T 1GTEA 4LF8F 3CDAA 5KFNA 1NBEB 2ZHAA 1LWXA 2IYIA 2Z30B 1T3NA 3TUZC 1R6YA 4DPUA 5D3GA 1IKWB 3KK3A 4WP8A 4A4JA 4QQBA 3KK2B 3DOKB 5L1IA 1NJZA 2V6AA 3OFGA 1WWHA 1RP5A 1RAIB 3HMJG 2YKMA 2V8GA 3LP1A 3HHNB 1OQ3A 2CQ4A 2DEIA 4GO7X 4YS2A 4QWBA 3GILA 2AMCB 4KYZA 1DZ5A 3AA8A 1X5PA 3DLEB 4EYIB 1ULRA 1CBKA 2FJBB 2RDDA 4TY8B 1M5KC 2KO1A 2NSCA 3MECA 1KP6A 1R8BA 1D1UA 2EVZA 5ETOA 2R7SA 4JI8J 3W2WB 3ZZZA 3LW5C 1F2GA 3O44A 2D69A 3K5OA 2FHMA 2DGSA 4UY85 4PXDA 3GSIA 3CCQS 4PWDA 3Q8PB 1GH8A 3FEYB 4DL3A 1Q5YA 5K5MA 4Y2MA 1KVJA 4D3GA 4ZPTR 3KLEB 3MFIA 1ZS6A 1JLQA 2CFXA 3A8KA 2VBXA 2Z56B 4YFUA 3KK1A 1R8CA 1NSPA 3MAAB 4OI0A 5IZHA 4FYDA 4OLPA 4IRKA 1C0UA 4C0BA 4CH7A 4LREA 3KDOA 3V4IA 1L3KA 1U45A 4FXWA 1HIYA 2D3ZA 2JEGA 1RCOB 1VK3A 1S9EA 4M1KA 4HLBA 3JSYA 2HNZB 5G4DA 2JH3A 3J80Y 4A8KA 2V8PA 2HFZA 4ZKAA 2VZ9A 1F60B 4KHPJ 5IWAF 4J9SA 4CZCA 4KGXB 1B7YB 2B9XA 3KTQA 3H40A 3R7SB 1XR7A 1SL1A 1T94A 5DS7A 3FK4A 1EIYB 4XK8C 2MKYA 4HI1A 1LV5A 4H4MB 4J9QA 5CZVA 1ELOA 1WSRA 1XR5A 4DSKA 3MM7A 3ET6B 3NEKA 1UEKA 3CD0A 4O4GA 1RWUA 3UVJA 1NK9A 2ASDA 4K2XA 2HHXA 1DLOA 2BW7A 2JLFA 1L3VA 1FRMA 5DDOC 1U26A 3EZ5A 1TL4A 2GO9A 1V3ZA 3V5RA 2LEAA 4DZ6A 3UPFA 3MPUB 2XTJP 5AE1A 2DXFA 4KY3A 3T6JA 1F3FA 3OV7A 1RB0A 2KM8C 4R8UB 3M30A 2CNNB 1K1SA 3ZO7A 4OZJA 2Y0SD 2RU9A 1RT5A 1D8ZA 2CPXA 3QSYB 2CQPA 1SC3B 3KOAA 3OR2A 4DG1A 2O01C 5F0UA 1VQNS 2A18A 1OWXA 3G4SS 3DRYA 3HDSA 2BKOA 1UVKA 1RTDB 1Y5LB 4JI3J 1IM4A 2OAUA 4NCGB 3GV7B 4K4VA 1VC0A 2EG2A 3DGVA 2I6WA 2MGZA 1S1TA 3S01A 3NNHA 1RT7B 3BH7B 4IFVB 4HYKA 3CCZA 4KFBB 1OPIA 4AL7A 2GAHC 1A7GE 3DRPB 3OFHA 3H5UA 4P7VA 2XWYA 3MOJB 4MK9A 1C0TB 4BWJA 4QIWD 2VFVA 3CXCR 1NLKL 4WFXA 4CTAB 4AQYF 4MMOA 4N76A 2XSFA 3X1LB 5L39A 2DGWA 2DXEA 3FC9A 5ADZA 3UDLA 5CYMB 2VFRA 5J2MB 1LEOA 1D8YA 3QZ7A 3CMAS 2DHSA 1U1KA 5BYSA 3LUYA 4BBYA 1IM6A 2VDHA 4C8NA 3QLHB 3HT0A 1S77D 3N5FA 4ZITA 1H2TZ 4B9TA 2PI5A 4M8LA 4LT6A 3U02A 2N3LA 5HSPA 4J9LA 2YWGA 2QL9B 2R2TA 1KN6A 3RB0A 2ROEA 4NLOA 1YDLA 3D6TB 3GMGA 2HAFA 2KH9A 4DR6J 3LALA 4O3QA 1Z4UA 4ECZA 2AJ4A 2OPQB 1T8EA 2FVQA 3DDNA 1FWLA 3T1YJ 3OR1A 4OZ1A 5HP1A 4Y6IA 5KFFA 1PSDA 3AT1B 1AUDA 1IKYB 1MROB 5FDLB 4G1QA 2XLKA 2WOMB 4K59A 5CYQB 1FERA 1L3SA 3K58A 1HYSB 3R7NB 1FKOA 2AZ3A 4DR5F 2HRYA 3RBEA 4IOBA 3BBCA 2OO4A 4L74A 5H9FK 3PFOA 3EDRB 2OH2A 3QBCA 5HLFB 2XO7A 3AJDA 3HHEA 1QE1B 3HZGA 2E1MC 1Y7PA 2QE5A 2VJUA 3S1TA 2ZBPA 4B3RJ 1YKWA 1GMVA 3LOUA 1R8PA 3ONQA 4P9SA 5CCLA 3I4PA 1S6OA 1QAYA 3DCAA 5KG1A 2R7TA 1VC6A 1IQTA 4ECQA 3NRBA 4ITSA 3R6GB 4LMZA 5T14A 2CPIA 3T9ZA 3HKZD 4O3PA 1Q4RA 1NDPA 1PIEA 3C6UA 2ASYA 5C24B 4R0JA 1UETA 3NOCA 4R5PB 4F4XA 1JB0C 3KNAA 2ZD1A 5L1KA 5LMUJ 2EFPA 4JI3F 3W8GA 3EUNA 3W5XA 4LVOP 3EGWB 3W2VB 3MR6A 5EDWA 2OD4A 4ZVQB 2JX2A 2DRAA 4CQ1A 2R7OA 4LR8A 1DAXA 1H2VZ 2GC8A 2Z2ZA 2AKWB 4ELTA 3SCIE 2FY1A 3QPIA 3PJWA 2VFUA 1MU2A 2EK6A 3NLCA 2MZ1A 1DQ9A 2HK3A 1SXLA 3IFEA 5KFBA 1C1BB 3IG1B 1SH2A 2MZSA 1FHTA 1URRA 2IJNA 3AY0A 5B0DA 1HHTP 2HW3A 2MZRA 3NXZA 4ED8A 1S4EA 3FJ2A 3KUEA 4B9VA 4RKUC 1FK9A 4N8NA 3TJ8A 2UUCJ 5H9EJ 3J7YU 4P2SA 1V5VA 2IMOA 2QLWA 3UW1A 2HWTA 2FJEB 1QUPA 3MMAA 1JJ2R 3IBCB 4YOEA 4CM2A 4PYAA 4CP5A 2XS7A 2O67A 3BR9A 3PR5B 3LP2B 1JLAA 2XGQA 2MY7A 2QMXA 3VGTA 1S12A 3HZEA 4DR6F 1FRJA 3C3LA 1S0NA 2W24A 4ZCIA 2BKNA 4AXJA 1Q78A 2ZH6A 2J0XA 3OTEA 3LP0B 3FDSA 3T1YF 2OPPA 3CMES 4LSLB 1VQKS 3IR5B 3IWLA 2I0XA 4ED3A 3EGZA 2GNKA 4Q2LA 2WBMA 3QZ8A 1AZSB 4DSJA 4QPXA 4ETXA 3J7ZT 4B3TJ 2DNGA 3K89A 2KG1A 3TW0A 2RAQA 1PG5B 4RL1A 3FSXA 4E98A 1FFSB 3QIDA 4P2FA 4ERDA 2RILA 2CIMA 4NE9C 4B3RF 4F02A 2HQ3A 3AQPA 1FFWB 3T9NA 3Q2TC 1ZTWA 2RD5C 2ILYA 2EW9A 2EFQA 1S9GB 5C2CA 2VH7A 1OJ4A 4ID8A 1T11A 3HXMA 3J7Z5 3H98A 1VQYA 2AD9A 4W92B 4QIVA 2ZWOA 3CE8A 3VVTA 4YR2A 5FD1A 1BUXA 4JI1J 3BO4A 3AOBA 3I5BA 3W1YC 1P1LA 3MI7X 1SBRA 1WF0A 5EGYA 4DV3J 1DTTB 1U2CA 3EYZA 3MD3A 1MMNA 3F0NA 4WKYA 4N5SA 2N7CA 2Q66A 1HWLA 2KM8B 2CNKB 3C16A 3H8YA 2X3DA 2GQ2A 3MMBB 3F56A 1A0OB 1Q0NA 3ZC4A 2YQ1A 5LMUF 2HQGA 2I5JB 1FD8A 3OHAA 5KFEA 4C2MA 4PXBA 1NK0A 1EAYC 1RU2A 4DPTA 3U1NA 3TUPA 1WJ9A 2M4MA 5A0YB 2C2DA 4LRCA 2MHEA 1HBMB 3OL8A 3I9V9 1RT1A 4M95A 1UW9A 1U6FA 4ZLLA 3NOGA 2EFVA 1X5TA 2B9YA 1JNZB 2VC1A 5B7WA 2MQ8A 3MFHA 5KT5A 1OSCA 3D54A 5J1NA 3HVAA 3VAJA 3DOMB 1F5CA 1G4CA 4XPEA 3LWMA 3TP2A 3ZTPA 4CO5A 5D15A 3DRSB 2UUCF 2V9WA 1UWBA 2E7WA 3NGRA 3BYPA 1FXRA 2NXJA 1RZMA 4JP8A 2RRAA 2NZCA 2H5IB 5KFKA 3VAFA 4Q8FA 5D0GA 1KKHA 1TU0B 3N28A 2YKOA 3D0IE 1OS5A 4ZPAA 5F8JA 1SIWB 5FJ4A 3QAEA 5KFGA 2AF6A 3US5A 3KG4A 1NNDA 4HKQA 1OIAA 2HFSA 1M5PC 1ACMB 4M5JA 4I2PB 4I7FB 2OTLS 2XEXA 2MDAA 1NPKA 2JLEA 3K5NA 1ZM9A 3PACA 1WTBA 2B7BB 1P6TA 5KFYA 4U7CA 4DX8H 1C4AA 1LWCA 2CG8A 1UEUA 3C19A 1J27A 3QGHA 3MM5B 3JYTA 1D9FA 1E6VB 5ETRA 1TK0A 1R0BG 4DR1F 2GVZB 3SSRA 3DMJB 2B5JA 4B3TF 4W90B 3KLGA 2XMVA 1W26A 2HRTA 4HT5A 2W1BA 3HHLC 4QJVA 4RUAA 2CPZA 1MW7A 2G0CA 2ADBA 2HHWA 3ENQA 2E9TA 3DLLQ 1FDDA 3KHGA 4J9KA 3T1AA 3HSZA 1REGX 3F44A 2DNMA 3CJ4A 3IBFB 1TK8A 3CJKB 3TZXA 1ZAVA 3BGLA 3RGIA 2HBYB 3H90A 4J9PA 1I51B 2WSCC 3V6JA 2CWKA 4FS2A 2A2DA 1O0PA 3BPDA 4JI1F 2IVMA 2EBEA 1T3OA 2W2NP 4TLRA 2A2CA 1BQNA 1TKXA 4UOCA 3A13A 3I5CA 1RAFB 2W4PA 2IDEA 3G86A 4FPRA 2GVDA 4ES3A 2R8HA 4E0DA 2V4JA 2VASA 4XDDA 4FPIA 4DN9A 3DC2A 4UZBA 1VR6A 1WG5A 4NYZA 3JSRA 3S6EA 3VWSA 2AYEA 3SI8A 4CLUA 1BQMB 3N0VA 4K5RA 3ILLA 4Y3CA 4E2FB 3LGNA 2V8HA 1IKVA 4KGVB 3PYEA 2WRMA 1NJXA 2AV5A 2K7KA 4FN5A 4X4UA 2MYFA 3GPAA 4FF1A 1NXIA 5BYQA 3SBMA 1KOHA 3MEEB 2H3EB 2IM1A 2EWHA 3QT5A 3SCJE 3M4XA 3OTDA 2DH9A 3PX4A 1SQEA 3DM2A 1WHWA 1UA0A 2HZVA 5DM7Q 1HBNA 2LLZA 1SV5B 5AXMA 1UFWA 1LQ9A 2F7VA 1S48A 2NZ4A 4I1TA
chains in the Genus database with same CATH topology
2IJFA 2DD8S 1SH0A 1YJVA 3OLAA 1IXKA 1RT6A 1RDRA 3K8VA 5DDRC 3H5YA 4YQWA 3PW5A 4C0OC 1TVRB 5K14A 3WDOA 5F9LA 4X4OA 4K4XA 2XY7A 4CO2A 1TFYA 1S76D 1NEEA 3MGJA 4NLVA 1M5OC 1ZTTA 2CJAA 1S1UA 3DXSX 5CCMA 3ENWA 3FMBA 2ZKUA 1VQSA 4ICLA 1T03B 2CVEA 4A8MP 4ETZA 1ZM3A 1LW0B 3FRYA 4ID5B 1T05B 3SSQA 4KV8A 5KFAA 3G6ES 3HVTB 4OLOA 2ZJPQ 4B02A 2ZH1A 2V8DA 3NNAA 3SQGB 3UWTA 2RF2A 2DNPA 2E9RX 5I3UB 2J8AA 1DTQA 3KWMA 3G6XA 1U1MA 5LSRA 1FKAF 1RJJA 2IBOA 3DRRB 1SV5A 2WTFA 1GQEA 3CC7S 5L1JA 2E9ZA 3TANA 3HVWA 1S7HA 2DJWA 1NK4A 2BJEA 3BF4A 4WF9Q 4U67Q 1YJ9S 1NHUA 4U7UK 2Y1JA 2CPFA 3I96A 5C5JA 3PX6A 1S1VA 2FC8A 4KSEB 4WK3A 5KFHA 4QW9A 5C25A 5L38A 4F4KA 3OVAA 3PZPA 2GW8A 2O1PA 3CDWA 2QZ8A 1VQ6S 3GIKA 3K8WA 3K5PA 4C3KA 5EHHA 4X2BA 2VKRA 2KZMA 1HA1A 1T03A 2M8HA 2M2BA 1FT8A 1LW0A 2QT7A 4JV1A 5A8RB 4ID5A 4DMZA 1T05A 1PGZA 2NPFA 3SV4A 2DVIA 4RU2A 3UFCX 1QSYA 3UNGC 3DLJA 3WZ0A 2WHOA 1S72S 1JX4A 3J7A1 3SQGA 3ULHA 2Q6CA 4IH7A 3ZZYA 3QAUA 1RT2B 2AYBA 2NSBA 5EWEA 4RU9A 4USJC 1RKIA 2XULA 2LQ5A 3MM7B 1EETB 2BUNA 4DDFA 4DL5A 2WSFC 4HHJA 1X4DA 1HD0A 2A3JA 4ZP7A 1YWXA 3R5DA 4WXOA 3O5TB 2FHOB 2OPSB 2I9SA 2CPDA 4DR2F 3BDPA 1DLOB 3DU5A 3NAIA 1YJRA 2BR0A 3EPIA 1K1QA 1P9QC 2VKZG 3WBZA 1O51A 3T3FA 4YB7A 3EPGA 2IRXA 4GKKF 3OW2R 3GV8B 2J0SD 5IT4A 2MJNA 3CDEA 3LP0A 5DRKA 2L3MA 3H25A 2VG5B 4UQGA 4FBUA 2BV3A 4JOUA 1HR0F 1YJNS 5BJRA 2WW8A 3Q8RB 1UVJA 2BOPA 4V19J 5EN1A 1TKZB 1XN9A 3KLIB 4OQJA 4X4VA 1MWZA 1VGYA 2OPRA 2B4OA 2BRKA 1HNVB 3ISNC 3M2UB 3THTA 1WI8A 1M5VC 2Z2MA 1RA7A 5J1PA 1W2BR 2JL9A 1RTIB 1RT2A 2B4VA 3SEOA 1VHFA 2YH1A 1EETA 1IJFB 2FJDB 1S1WB 1TFWA 1B0VA 1NK6A 1YRUA 3CDUA 1TKTB 3M8SA 2R8IA 2V4QA 4C7QA 2A10A 4RW8B 1UVMA 2OPSA 1HW8A 2EG1A 2F1FA 5G0RB 3DRXA 1JMTA 5GAHI 3AH6A 3MHYA 1HBOB 3KG1A 4NMLA 3RW6A 4XAKA 3RR8A 2E5GA 1OO0B 1VRTB 2KZZA 1NK5A 2R8GA 1KQSR 4ZS6A 4LF6F 2AJQA 2K7JA 2VG5A 3ENVA 1PC5A 5K8OA 4C3MA 1NKEA 4LVNP 1V9OA 1RT5B 4NRTA 1M90T 4ILLA 4R25A 1SKRA 4IRCA 4A8XA 1TKZA 2PD1A 3KLIA 1R0AB 3ZFVA 1XC9A 3GR1A 4X4SA 3OBIA 2YY3A 1U47A 1U1RA 4I56A 1HNVA 2L41A 3D1OA 2J6TA 3M2UA 2XG8A 3E01B 1UL3A 4LJMA 3KLFB 1FRIA 5K9FA 1RTIA 4DSLA 3LWLA 3OR2B 4DG1B 2R7VA 2HWIA 4G1PA 2YX1A 2VPXB 2FJAB 2F40A 4DV7F 2HRUA 2BANA 4Y65A 2C3OA 1KQGB 4WU3A 3MOZA 4DL2A 4FBTA 1TKTA 4FVMA 1VRUA 5K8MA 4N47A 1NJWA 1NB7A 4PR6A 1WHYA 4RW8A 2RIJA 2W7AA 2W9CB 3OQ2A 1S99A 2JDJA 5G0RA 1RT3B 4NLYA 5LXYA 4DR3F 4OX6A 1HBOA 3V6HA 3ZZTA 5FIIA 3QWPA 2KRBA 2GQQA 4ZP6A 5U47A 1U1OA 1U4BA 1U7LA 2NYIA 3CCUS 1VI7A 3N6LA 5IS2A 1VRTA 5KFZA 2E44A 2PSZA 4X4RA 5JUMA 4B9SA 5B08A 4C9DA 2K3IA 2VG6B 4CH1A 2HHUA 2Q6BA 2P5VA 1HFEL 4LUBA 4NRUA 4DF8A 1N5QA 4ECVA 1R0AA 2DR9A 2D3OR 2E5LF 4QCLA 2ZNZA 1Y4ZB 2D9OA 4ZDNA 2DHGA 3E01A 2QIFA 1S1TB 1SL0A 2KJWA 3KLFA 2X1FA 2GHVC 3MZIA 4TKTA 3GSDA 3TR5A 4YB1P 4C0HA 3E2EA 1SC6A 3BGRB 4NCBA 2BABA 2J0QD 5GVQA 5IT0A 1VQ7S 1VJWA 2W9CA 1IBKF 1FXDA 5AXNA 3LAMA 4K0KF 5LMNF 1QJHA 4OI6A 1DQ8A 1RT3A 2OP5A 2XI3A 4C11B 4PQUB 2LKZA 3QYYA 5CZXA 2DR8A 3MPWA 3PW2A 3B82A 2B7CB 2RJZA 1HNIA 4BHQA 3IRWP 4NLXA 1X9SA 3GYXB 4BC9A 4BDPA 2V8VA 2VG6A 4KHRA 1U48A 2FUG9 1C1CB 1P8GA 4KE5A 4EO8A 3Q22A 2YWEA 3CCES 4FXDA 2ZC4A 4IH5A 4X4NA 2OJ3A 1LW2B 3A8EA 4CT8A 3DGPA 2KT3A 2HS3A 1RYRA 2QLXA 2WONB 2EK1A 2M0GB 1WF1A 4QYRA 2AGQA 4HTJA 3MWBA 2FDNA 4IQXA 2I5JA 4JI8F 3OL9A 3BR8A 3W3SA 2IMWP 1SI9A 1BQXA 3MD1A 1VMBA 1NJYA 3MDFA 5E33A 4Q0BB 3BGRA 5J2QA 1S6UA 5B0EA 1UFLA 1M5SA 2CJQA 2LEBA 1H3DA 4RX6A 1Q1KA 1XTZA 2VONA 5EWGA 4WTYA 2KN4A 2CQ1A 4C11A 3M8PB 2ZH2A 5LT5A 2M8DB 5KFUA 4PQUA 2ZOGA 2FLPA 5L8RC 1XMOF 1JNRB 2V0NA 2OLWA 1Y00A 1HBMA 4J37A 5T41A 3VR1A 3VZIA 4O3RA 4IG0A 1VBYA 3QJLA 1VC5A 2DH8A 3IN5A 1C1CA 3GFZA 4JBCA 4DR4F 4RWWA 1UAWA 2GA7A 2IYGA 2KI2A 1N54B 1TL3B 5AJ3F 5MLCV 1FDNA 4JI6F 1I1GA 1VQMS 4PRFA 1LFPA 1LW2A 4A48A 2KXFA 2F8HA 4DLGA 1KHVA 2EC0A 4MIBA 4Q2MA 7FDRA 2KTQA 3AJ2A 4C4WA 2D9PA 4BS2A 1DURA 1FE4A 3BO2A 5CD4H 4OZNA 4YR0A 4MFBB 3PKYA 3KHRA 4FS1A 1UVNA 4Q0BA 1TR0A 4NX9A 3KNGA 2PMZD 3JSMA 2ZZNA 3M2VB 4C98A 2CJKA 3FQKA 4LFCF 2KFZA 3NL0A 1LWEB 4MTPA 4OX7A 1X4EA 1GXLA 1N5VA 1E6YB 3M8PA 1FJEB 1BC6A 3ZZUA 2RQMA 1KHWA 3OFFA 2VQFF 3B4DA 3DRSA 1VQ9S 4NXNF 4F3MA 4Y34A 2IFXA 2M88A 1LWFB 1IBMF 1P1TA 3EXYA 3HJFA 5HMXA 3GQCA 1IKXB 1FRKA 2CZ4A 4FVCA 3Q8QB 5GAHU 2BACA 1TL3A 4F2RA 3I32A 1FVSA 2BM1A 4Y2KA 2VV5A 1SB6A 4ZPVR 3WC0A 1A6LA 2V2KA 5FLXY 2HGMA 3G8TA 4JI5F 1LXJA 3H5SA 2M70A 2KT5A 3OR1B 2JFKA 1WEXA 1JKHA 3CDBA 4URQU 5HMWA 4EU0A 2DR5A 2HPUA 3MMJA 3SFGA 2RQ4A 4F4WA 2LU2A 4MFBA 3TVZA 1R27B 1DFDA 4JV5F 4NCAA 3OFEA 4ECTA 3JTOA 4WFYA 1S4FA 3M32B 1XMQF 3AAWB 3GWCA 4KT0C 1HWUA 2PA8D 2NS1B 3T5HA 4JI2F 2DNKA 1KLNA 1E6YA 1AXQA 1N52B 4B9MA 2RS8A 4DV4F 3KMSA 3VAHA 4KHPF 4DSEA 3I0SB 2J5AA 1LWFA 4ZVFA 1YIJS 3DOLB 2VQEF 4PG5A 1JXEA 4UW2A 3RZAA 3AJ1A 2UV8G 4NWBA 2FVRA 1IKXA 4ZPDA 4Q8EA 4V19X 1MMLA 2IVYA 2DRBA 1RI7A 4FXVA 4I2PA 3DLBA 4EGLA 3H5XA 4I69A 4YDXA 2XB2D 2YTCA 4ZVEA 3PHEA 2YNGB 1HPZB 4KTQA 5BYRA 2D7SA 2HHTA 4WFAQ 2BRLA 3N9UC 4TU8A 3IGVA 4OHZA 5KFTA 2JLGA 1DQAA 4NLUA 2FVCA 3G8SA 3RBDA 5KFRA 2V4RA 3HFKA 3TARA 2DCLA 2UZAA 2X51A 1N33F 3I4HX 5KFSA 4DUZF 1TP7A 3M32A 1LXNA 4MAKA 4QW8A 5HI7A 4MIWA 2HNDA 5MAOA 2MQPA 2VA3A 3IBWA 5D4NA 1WNEA 5LL6d 2FPHX 1G1XA 4PG4A 4C8KA 1HL6A 1CPZA 4LF5F 4AL5A 2WBRA 4K5SA 2ADCA 2KRRA 2YNFB 2RRBA 2F8MA 2DNQA 3I0SA 3IXQA 3DOLA 2BJDA 1SKWA 4CO4A 1CSJA 4WK1A 1X4AA 1HARA 4GKJF 2OKQA 4IG3B 1YRXA 2XNRA 1AW0A 3I55S 2JC1A 3J81Y 4HVZA 1D3WA 2VFSA 2XZWA 3O3LA 5JXSA 5B0CA 2W25A 1RT4B 1HPZA 1ZM2A 1XBWA 3TA1A 5F8GA 2ZNYA 2HGNA 1RGVA 4TXSA 1FNMA 4I6YA 2HHSA 1RTHB 1LK5A 4OX9F 1UMJA 2QO3A 2DGOA 3I56S 1QY7A 1U24A 4RNFA 1FE0A 1Q79A 3PO5A 3BJYA 4EYHB 4LIRA 3N5BA 5L1LA 4KIAA 3BZQA 1XWLA 2VB6A 1FD2A 3HLUA 4HI2A 4DJBA 3KK3B 2E1RA 4O4RA 2D3UA 3B8HA 2DITA 1S6QB 3EZUA 2EFNA 1J5OA 1CQNA 2KFNA 1B7FA 1U8SA 2YNFA 2FJWA 4KKOA 4DF4A 2XMTA 3I5AA 4ED6A 4MKYA 1X7VA 3K5MA 4PXEA 1WACA 3NWGA 4U9RA 2A1BA 1OSDA 1MNEA 3L09A 4IG3A 4A8OA 4OHWA 2ZJRQ 4ECXA 1FDBA 1M0SA 3SZ2A 1K73T 2AWZA 1GTEA 4NOHA 4LF8F 5L9XA 1JK9B 1V3SA 5E5NA 3BS9A 1EP4B 1RT4A 5EUHA 3CDAA 2ZDPA 2E5HA 4EBDA 1RTHA 2BE2B 4WU2A 5KFNA 2ZHAA 4LFAF 3NS5A 2W8KA 5D4OA 5KFWA 3TX8A 3TA2A 2G4BA 3RAMA 2IYIA 1VQOS 5IQQA 1T3NA 3QJJA 3TUZC 3QWUA 1R6YA 2HGLA 1K8AT 5KOXA 4QWDA 6FD1A 4O3NA 1JXLA 3H4BA 5D3GA 5KG7A 3G9CA 2YKNB 4IQMA 1IKWB 1HQEB 4KR0B 3KK3A 4PG7A 4IYQA 4X66F 4A4JA 1S6QA 2DR7A 3FQLA 3VTIA 5KG6A 1Q53A 3HK2A 1NJIT 4NZ7A 4QQBA 3DLKB 1XNRF 5DDPC 1RYSA 3C46A 5KG5A 3IR7B 2MY8A 3KK2B 4G3IA 2Q79A 1HNZF 1UVLA 3DOKB 5L1IA 1NJZA 2U2FA 2BBEA 3K5LA 3OFGA 1WWHA 2UUWA 3N6MA 1RP5A 1UEVA 1MU2B 2XGPA 3LANA 4X84A 4BC7A 2LXIA 1EP4A 5SUHA 1JLGA 3HMJG 2YKMA 3CD6S 5IM0B 2BE2A 2V8GA 3LP1A 2ZDOA 5IXUA 3HHNB 1OQ3A 2CQ4A 4GO7X 4QWBA 3GILA 3E8OA 4TY9A 3S8SA 2NR0A 1CVJA 2K3KA 1YJTA 4LSNB 4TNOA 3Q23A 3CC4S 2RB7A 1L5UA 3AA8A 1DZ5A 3CCJS 1X5PA 2KVIA 3DLEB 1KTQA 3CCLS 4EYIB 1ULRA 3WX4A 4QPTA 3X3UA 1IKWA 2QA4S 2YWHA 4PWDB 2FJBB 3CCMS 4RBTA 4TY8B 2GHWA 3QGIA 4IRDA 1M5KC 2XMKA 2KO1A 2NSCA 3H2LA 4H4KA 3L7OA 3MECA 1R8BA 2XS2A 1C4CA 1GX5A 4OJGA 4OHXA 1D1UA