1KVIA

Solution structure of the reduced form of the first heavy metal binding motif of the menkes protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
MDPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title Solution structures of the reduced and Cu(I) bound forms of the first metal binding sequence of ATP7A associated with Menkes disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 13
structure length 79
sequence length 79
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2002-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kviA00
1KQKA 3HFKA 4HH0A 1Q53A 4A4JA 2OD6A 2PD1A 4Q2LA 5B09A 2FTRA 1JWWA 2BJEA 2QIFA 3LO3A 2ROEA 3E8OA 3MCSA 4OIXA 1QUPA 2FB0A 2LXFA 1AFJA 1TL4A 3LGNA 2N4DA 4EFAC 5B0FA 1Q8LA 1N5QA 1S6OA 1SQEA 2GO8A 1Q4RA 1W2IA 4Y2MA 4A46A 2ZDOA 2BUNA 1U7LA 1YJUA 2OFGX 3HF5A 2LDIA 2VH7A 1WD6A 1JK9B 3LGMA 4NL5A 4Q2MA 2BYCA 2LQ9A 3T9NA 1FVQA 1K0VA 1YJVA 1Q8BA 2K7KA 3KKFA 4Y2KA 3VTIA 4HI2A 2LQBA 1Y9OA 2K7JA 2VV5A 4HH1A 2QLWA 2HLUA 1OSDA 3IWXA 4F67A 1N5TA 2GGPB 2XMJA 3HHLD 3CJKA 3HDSA 1SB6A 1SI9A 3BR8A 5F0UA 3HX9A 4FNHA 4U9RA 2GFFA 2RSQA 2OFHX 3KNGA 2W4CA 3TRGA 1YRXA 3F44A 3TNVA 3BGUA 2BJDA 2GV1A 3CJKB 4OJHA 2AJ1A 1KVJA 1FE0A 1X8DA 2KT2A 1Y0HA 2PGCA 4A47A 2RILA 1FESA 1VQYA 3BB5A 2HIQA 3BN7A 5B0GA 3UDCA 3MZIA 2HLTA 4QOTA 1CC7A 1FEEA 4OJ3A 2ASYA 5IXUA 1IUJA 2BBEA 3FGVA 2GGPA 3KG1A 5F0WA 4DPOA 2IYGA 2IYIA 1YG0A 1S6UA 1OQ6A 1FD8A 1N5VA 2IFXA 5B0AA 3DCAA 3KG0A 3QGPA 1GXUA 2AP6A 2XMUA 2W4PA 2ZDPA 5B0CA 1AW0A 1P8GA 1LQ9A 2XMMA 4A48A 2AW0A 1TUVA 3WDOA 2QLXA 5A6PA 2OMOA 4ZOSA 3FRYA 2OAUA 2ROGA 1YJTA 2FHMA 5KAKA 2JDJA 2AJ0A 1Y3KA 2HQIA 5K9FA 3BDEA 2XMVA 3TOQA 1YJRA 2CRLA 2OD4A 4OJGA 2ACYA 1VQSA 2KKHA 5B0BA 1ULRA 1X0PA 1APSA 3I9ZA 2HFOA 1MWYA 2Q3PA 3HHLC 3FMBA 2RMLA 1R6YA 2G9OA 3BM7A 3GZ7A 2EW9A 1FE4A 2KYZA 2QYCA 4HI1A 1Y3JA 2K1RA 1OPZA 2GCFA 5B08A 2RU9A 1V3ZA 2ROPA 1OQ3A 2XMWA 2W4DA 5T7LA 1RJJA 2XMKA 2XMTA 3DXSX 3HHLA 4NPOA 2K1RB 1GXTA 2KT3A 2N7YA 2K2PA 1KVIA 2FIUA 5T7LB 4ZA1A 1MWZA 5A6WA 1AFIA 3HHLB 1TL5A 3K7RA 1URRA 4FNIA 1XBWA 1TR0A 2GA7A 1CC8A 4YDXA 5B0EA 4DL0C 1TZ0A 3BF4A 4OJ1A 4HL9A 4DN9A 1X7VA 2OP5A 3IWLA 2OKQA 1CPZA 2HFNA 4YEAA 1N5SA 2L3MA 2N4CA 4Y2IA 1P6TA 3QMQA 5B0DA 1FVSA
chains in the Genus database with same CATH superfamily
1D8ZA 2I1RA 3H5SA 1H72C 5GAHU 2BDPA 1WI8A 1F60B 4NLUA 2YKMB 1U1PA 4DV7F 4WP8A 5KT2A 3TW0A 4N8NA 3BDPA 4U7CA 5A76A 3KKFA 1FJCA 1XK8A 1W25A 1CULA 1D3WA 4FNHA 1CJTA 4WBFA 4PKDB 3R5AA 2YX4A 1FXDA 3R8YA 2E5JA 3AJ1A 2C3PA 1S9GB 2X3GA 4OI6A 1UVJA 3X3UA 4ZHRB 1QSYA 4CLFA 4HT7A 1NPPA 1ZM4A 3J7A1 3T6JA 1BWEA 1EJ7L 3BYRA 4I67A 3QGHA 2I6WA 1WNEA 2OSQA 3DMJA 4C98A 1V5IB 3R6LB 3SDEB 3GSIA 2RU9A 2VC1A 3MFIA 3J7ZT 4JI8F 5ETKA 2WOMB 5IOLA 2B4PA 1BHNA 3K5NA 4OJ1A 2CJBA 3MUMP 4EGLA 4LRCA 1ZM2A 1VQLS 1K9MT 2R7XA 4Y0FA 1H2TZ 1DBDA 4HH0A 1UWBB 2DJWA 1DQAA 4C8NA 2DGWA 2VD3A 3W8GA 5KFKA 3B78A 1LWEA 4PUOA 3IG1B 3H5YA 5D4OA 4DZDA 2ZE2B 2B5JA 1PJ6A 3HHKA 1T9UA 5A8RA 3J81Y 1FRIA 1S5ZA 3FJ2A 3SSSA 3G82A 3Q23A 1HWUA 1VC6A 1G1XA 4ILLA 2O1PA 5J2PB 1Y7PA 1H98A 1OIAA 5AXKA 2L9WA 3HVAA 5IT4A 1DURA 1FRHA 1OJ4A 3B54A 4TU8A 3V6DA 1BD6A 1RT2A 3PV8A 5JVHQ 3HVTB 2K1RA 5LSRA 4U67Q 3RR7A 1UKUA 2DEJA 5AJ3J 2OPRA 4KYZA 2XMTA 1XWLA 3Q8VA 4I0WA 1Q8IA 5KFXA 2L41A 4CNZA 4M5HA 1WELA 2J6TA 2L9DA 4J9PA 4JP8A 3O8WA 1VRUB 3ZFVA 4LFAF 4F7VA 2CQ1A 1TKTB 2UVRA 4WYWA 1FCAA 4F25A 2BYCA 2ZH4A 2R2UA 4WFYA 1AUDA 1YGYA 2DBBA 2R7UA 2EXUA 2R42A 1CULB 2VA3A 1CJTB 4DV3F 5D4LA 3MMJA 3EE3A 1YBAA 3R5BA 3U27A 1RTHB 2YNIB 3BKFA 4DPOA 2OSRA 4LF7F 3SEOA 3TVYA 1XMQF 1LQ9A 1N88A 5F9NA 2CJ9A 2NXEA 4X66J 3IGNA 4JUZA 1MN9A 2SXLA 4USKA 3P4UB 2QMXA 4Y28C 4WE1B 3FBFA 2CPXA 5D15A 3DMJB 2OH2A 4U7UK 2G0IA 4F8RA 3H25A 1U6FA 5BXIA 1URRA 1LWFA 4DV6F 4NXMF 1V3RA 1BE4A 3DOLA 3D28A 3U02A 3O6QA 2YNFA 2DRBA 2G2ZA 4DV1F 4PXCA 3MCSA 2KL8A 3LO3A 2Z2ZA 2AV5A 1FK9B 4HHHA 2MXYA 1Y5LB 4USVA 1YZ6A 2CG8A 3TANA 2ZBIA 1YJVA 2AEMA 1YKWA 5D77A 2OLWA 1D0EA 1BLUA 1LWEB 4PUOB 3TX0A 1S9FA 2RU3A 1F3FA 2UU9J 1KDNA 2DITA 1I3OB 2YX7A 2FLLA 4DX7A 4P10A 3DDIA 2HZVA 1P9QC 5A8RB 1YWXA 3G82B 1P8GA 4F2SA 3AXMA 2FVCA 2KTQA 5D3GA 3NGTA 4YR0A 1N56A 3NNCA 3JS9A 4IO1A 4O44B 4EO8A 5AE1A 3V6DB 5KFYA 1E6YB 2MY7A 4C8ZA 2K1RB 2AHOB 4DQIA 1KVIA 3OXGA 2OPRB 2HGNA 4JI4F 2HFUA 2GNKA 1U6BA 1QUVA 1CLFA 1FNOA 1FKAF 5E3PA 5KTQA 2FTRA 4X84A 2B9YA 1BMQB 2IDEA 4I6AA 2V8HA 2QLBB 2N82B 1QTMA 4CO2A 1MROA 2J76E 5KFIA 2FLPA 4C8KA 3GJTB 1NJZA 2HS4A 2NSCA 3SMZA 2O67A 1EQMA 3DDNA 2BR0A 3A3OB 3EZUA 4AYBD 3AD8C 3JTNA 1WC1A 3SI8A 1S6UA 2BZ2A 3GIIA 3RB3A 2CPIA 3VAGA 2ZM6J 1FHTA 4E0DA 2Y1LB 5GVQA 2I2YA 4K4XA 4BWMA 1UZHA 1S0OA 4PR6A 2DR9A 5IZHA 3HXMA 5E3CA 3VTIA 2GZOA 4PWUA 4LF8J 1Q8KA 3UDVA 2XZTB 3MAQA 2IA0A 1LWFB 2ZH5A 4EEYA 3DOLB 4DR5F 2YNFB 2DIUA 2W7OA 2VFSA 4DDFA 2BV3A 1XJWB 2KHCA 1TL3A 3OTBA 4O0IA 2AMCB 2RRNA 3PTWA 4RPFA 4FS1A 2GFFA 4NZ0A 2JC0A 3Q86A 1QLNA 2E7WA 4GVLA 3UN2A 4ECWA 4QCLA 1K1SA 4DQQA 4PABA 2OGUA 3GJQB 1TMMA 3OT9A 1TKDA 3ET6A 3UQSA 2B43A 4QWAA 4K4WA 1U47A 2AP6A 1Z2LA 1IKXA 3N6NA 1VHFA 4LF5F 2B9EA 2AU0A 3DFEA 7FDRA 4F2RA 5C2GA 4KHPJ 4ZLLA 1FE4A 3HD2A 2ZFHA 1QJHA 2G4BA 2HNZA 1YJ7A 4IOCQ 1XC9A 4RBVA 1A9NB 2YPYA 1M5OC 2K2PA 3K57A 3OXLA 3CE8A 1UFWA 3CCES 1RACB 1AFIA 2HK3A 2VFRA 4DF4A 5LMUF 2H54B 2E5LF 6AT1B 2Z4PA 1RAJA 2I8EA 5JMNA 4KHRA 3JAMU 4X4NA 3FZ2A 2JC1A 2VPWB 1H3DA 3DGVA 3NS7B 3MWBA 3RG6A 4PYAA 4RUAA 3HHEA 4KGMA 2JEGA 1TVRA 3EICA 5KOWA 2VG5A 1PIEA 4RUBA 4ECXA 1UVMA 1VBXA 1N32F 2DCUB 3NCPA 1HHQA 4LFBF 2DHXA 1KC8T 3ZZZA 4ID5A 2IC3A 1Q95G 4KRWA 4K4YA 1NB7A 4I4BA 1IJEB 1F6TA 3DM2A 3GJRB 1Y00A 3AHPA 2MJUA 4EBCA 2J7WA 4X4QA 2CNNB 3M30A 1U1LA 1SH2A 3QMQA 3F56A 4WPAA 2FVPA 3MR3A 1X4EA 1CVJA 4KPCA 4OYIA 1R8CA 3PW4A 3KUEA 3AOBA 4CDIA 3ENWA 1J2VA 2IY5B 2DRDA 4PQUB 4F26A 1KTQA 2B8PA 3CO0P 4ID8A 1TL3B 1SKWA 3QT7A 1IN0A 2N3OA 2DKOB 4QIVA 1N52B 2IM1A 3CJ5A 4OI0A 1V3SA 3BO2A 1F5AA 4UUXA 1S1UA 2A3JA 1KWMA 2IFXA 1LK5A 3Q8UA 5FDLA 1MNEA 3AXKA 3ET6B 3M8QA 3HFZB 1WC3A 3TEHB 3Q8YA 1IKXB 4UOCA 1VQ6S 2HQIA 1I5OB 4J90A 1PYTA 4J9UE 2KO1A 3C6TA 5BJRA 1KKHA 3P45B 4CNYA 2A10A 4H54A 3ZXWA 2HNZB 3LAMA 2QG9B 1FJEB 3IS9A 1MU2B 1TTHB 1IKVB 1WTFA 3AD9C 3DLEA 3CMQA 4TNOA 1X9WA 1RWKB 1FRXA 2KM8B 4OYWA 2YQ0A 4IH7A 4DJBA 2LA6A 3LPYA 4IFYA 1LXNA 1B70B 1B7FA 3CJ4A 2HGMA 2YBVA 4OHZA 2DYAA 2BKPA 2JLGA 2HMIB 2DR5A 1TKZB 2DXEA 4ZIVA 4XO0A 2VQEF 5B0GA 1D8YA 1ITPA 3AJ2A 2CPFA 4IG3B 2ZC3A 2FGOA 1DARA 5SZTA 2VG5B 2W4PA 3H2VE 3MEEB 2A18A 2HRUA 4DL7A 3UWTA 3R1LA 4ID5B 5ETSA 2M8HA 5T7LA 3NY0A 3AY0A 1IKYA 4JYAJ 2COLA 1KHVA 8RUCA 3AH6A 3DM2B 3SXLA 1OWXA 2FJEB 3OR2A 3MPWA 1YK9A 3M30B 1H0HB 5LXYA 1I94J 1FERA 1X4FA 2B4OA 2A1BA 3I55S 4K5SA 1SIZA 1HD1A 1S0VA 4FYYB 2AYMA 4M8LA 4UT4A 4YOEA 4IYQA 4DL4A 2YWHA 2KG1A 1CC7A 4QZVB 3C46A 2WSEC 2KJVA 1S1UB 1EP4A 2AW0A 5E3QA 5FDLB 4ZVEA 2GQ2A 1KTVA 3SQOP 2FHMA 4ILMA 2Y0SD 3M8QB 2PSZA 2CYYA 5CCMA 2CQ2A 1U1NA 2IVYA 1CBKA 1JLFA 1SUQB 4MK7A 4B9TA 4ZLJA 4UQTA 2ZJQQ 3KG4A 4JI5J 3C6TB 3TO8A 2IMOA 1HMVA 4O3OA 2UUAJ 4M94A 2YNHA 2F63A 4DL0C 1WHWA 1TR0A 1FTCA 3P8BB 2JJ4D 3VZHA 1RBLA 2WBRA 3IS9B 4Q5VA 3QSYB 1EIYB 1UPMB 3DLEB 1HARA 2OD6A 5DM6Q 4F50A 1ELOA 3EXCX 1X0FA 1TK5A 1CEZA 4WZMA 2Z2MA 2I0XA 4O3RA 2DPIA 3BO3A 2O01C 4DG1A 3W5XA 2E7VA 2V4JA 1M90T 3W8PA 3IA0A 2BOPA 2Z57B 2UXDJ 3AQOA 1S77D 1VLYA 1Y0HA 1LXJA 3BN7A 4DCOB 2V67A 4L6V3 2Z0GA 2VODA 2M5YA 1V5VA 2WVCA 4A48A 1X31C 2G0JA 1E6VA 3R27A 4CO0A 4ZMMA 4X64J 5ETTA 1FKOA 2R7VA 2KZMA 5D78A 2HVEA 1VFJA 3N6LA 3ISND 3PDNA 3PO4A 3MPDA 3PIOQ 2RQ4A 2HNYA 4DFKA 5T7LB 1MWZA 1UA1A 5B0EA 1IKYB 3CTRA 4B02A 1FFSB 1WTBA 3KK1A 3OL9A 1GH8A 4PWDA 4OZ2A 4AUKA 4LFCJ 3OFGA 3VGVA 2J9EA 3PJXA 1CSJA 3OR2B 3OVSA 3SIPB 5B0FA 2CDQA 3SCJE 4B3SF 3PXGa 2ALZA 1VDHA 3IXQA 4JV5F 4MKBA 2DNLA 3M1VA 4A8XA 3M8PA 4FYWB 3NS5A 1IBLF 4ZJQA 2M52A 4J9OA 2Z8QA 1OS5A 4CT9A 5KG1A 1WC5A 3SSRA 1RCOB 3GJSB 4DBQA 3VQSA 3NXZA 4P74A 3W5ZA 4URQU 1HW9A 4H4OB 1YIJS 4MK8A 2H3EB 5KFOA 1NPRA 4ZCIA 3A3NB 2BJ7A 1EP4B 5K14A 3C3LA 3BDEA 1IQZA 3B6BA 4HEA9 2YH0A 2DNOA 2NLWA 2UVVA 1JLFB 2DT9A 2RQKA 4PXDA 4TY8B 3P5BP 4XAKA 2DRAA 4NWBA 4YMEA 1HMVB 4L3NA 2R7RA 5AXNA 2R8HA 2YNHB 1K1QA 1HKAA 5C5JA 1C0TA 2DH8A 2KH9A 2CJAA 4Q2LA 4AE5A 4F4XA 5JJBA 2X51A 4ZVPB 5F8NA 1Q8LA 1UL3A 2OFGX 4GRSA 4JI3F 2DGSA 2MZTA 3M32B 1QSLA 2ZITA 4DG1B 4DV5J 3G6YA 2V4JB 3W7BA 3G8TA 2CQBA 3EVMA 2J0XA 1RZMA 1O51A 3EDQB 4EZ6A 1OPIA 3UDLA 1WDDA 2DPJA 5F8IA 4GC7A 4A8WA 2B0GA 1NDLA 2IJRA 1U1QA 1E6VB 1Y3KA 2JL9A 2HEKA 4X4TA 5CH7B 2Q3PA 1M1HA 1N4LA 5I42A 3ZNJ1 1C0UA 3CJQA 3ENQA 4CLYA 2GCFA 2VBZA 4J9KA 4B17A 4LRAA 2P6SA 4FPIA 1NO8A 3BF4A 3F73A 1DFDA 2HNYB 1UA0A 4LUBA 2FD2A 2PC6A 4ZVTB 2C42A 3KK1B 4PWDB 2VBXA 2KFNA 3NLCA 1I51B 4Y65A 2RUSA 3AB2B 4FVMA 4NL5A 2GAHC 4J9NA 4JI7J 4M5JA 3GCWP 2WONA 3M1VB 3M8PB 3R5GA 4F4YA 3IC1A 4OX6A 5F0UA 3GB0A 3H8YA 1J5EF 1LFPA 3D2WA 4LQ3A 4JBCA 4J9VA 2NYIA 3CD6S 1HQUB 4YDDB 2QL5B 1U26A 5F0WA 2PFDA 1NCLA 4GKKJ 2OPQA 5F41A 3KYLA 3ILJA 2JWNA 4MFBA 2CZ4A 4KE5A 3DRPA 2RUGA 2XMVA 1NZAA 5K14B 3UCZP 1OYEA 3AODA 1X60A 2ZUAA 2HHQA 1F5CA 2H48B 1U1MA 1XBWA 2R7SA 2L48A 1KOHA 3HVWA 2LDYA 3OL8A 3G87A 3R2CJ 5GAGI 2HVIA 3QT6A 1C0TB 3A8IA 5E2QA 1RHKB 4QR1A 3JTPA 2O5DA 4NXNJ 5LSOA 3H40A 2BABA 2V69A 2J9CA 3GILA 5GMEA 2KDOA 2C1EB 4ZPCA 1X4AA 2GJIA 3CJRA 2H5EA 4RJVA 1EAYC 2PMZD 3TZZA 4IRDA 2XY6A 2XS7A 3TJ8A 4EI2A 3RR8A 1RHUB 2JH3A 2MMYA 3QIDA 3QGPA 2FUG9 2KI2A 2CJYB 2OAUA 2QN6B 2OD4A 2ACYA 3LOUA 3QRQA 3BM7A 4K4VA 4DR7J 4C9DA 4NLDA 2XMKA 5IM0A 3QO9A 1HQ2A 5H9FJ 2D1CA 1X4BA 3AB4B 4ES3A 2HS0A 2F8MA 3KHLA 4HDHA 4WP3A 3B82A 2IIHA 4ZK7M 2PN6A 3ZTPA 4Q0BB 2GO9A 2GIFA 4U8YA 1NJXA 3SBMA 2DCLA 3C16A 5KFBA 2V2VA 4HHUA 3AA9A 4LMZA 3IR7B 2WONB 1TUWA 2BACA 3QT8A 1VQMS 2DVIA 5AJ3F 2H5JB 3B4DA 3HULA 4CH0S 5IT0A 3C66A 1S7IA 4W98A 1S1WA 3KG1A 2M2BA 2X3DA 1H73A 2AGPA 4W90B 1T03A 2OPQB 3R1HA 4FXWA 2V0NA 3RZAA 2E1AA 2R4FA 3FQLA 2CJQA 3DRYA 3NOGA 4DX6A 4MFBB 4XIUA 2NSBA 3GYNA 3KLEA 3DRPB 4FN5A 3Q89A 5L46A 2VB6A 4USTA 2EBGA 1SCJB 2R2SA 3OQ2A 2XYHB 2J7UA 1HBOA 3BQ2A 3I56S 1QDUB 4NLOA 1LK7A 2FVSA 4A4JA 5DLFA 2VDIA 1VR6A 4B3MF 2EC0A 1L5UA 2V8GA 1SQEA 1KQFB 3CD7A 4NMLA 4AXJA 2HBRB 4WFXA 3DN9A 3PJ9A 1UEKA 3TUZC 1EB0A 2JZ5A 1SPBP 2F5GA 2XZWA 5HBMB 3FDSA 4C8LA 2EC2A 1R8AA 1RAOA 2LQ5A 2XEXA 4CM2A 5K20B 1RYSA 3BREA 3O3LA 4DR4J 2KVIA 3LH2S 1N5VA 2HPUA 3ZTRA 3I0SA 2I38A 4JV2A 2F4VJ 3CMES 1SQGA 4YB5A 3W9JA 4B9VA 1TL7A 4RW6A 5KFDA 4ICLA 2RH3A 1M5VC 2LKZA 1NDPA 1UP1A 3T3FA 1GT8A 3PYDA 4A8YA 3BH6B 5DZ6A 2UU9F 5HMWA 5IM0B 3QO9B 1GEHA 3C2PA 3RB4A 5J1NA 2WB1D 3QLHA 4ZCLA 4OI2A 3G8SA 4J7CA 4J5OA 1S6PA 2EFPA 2PA3A 3DRRA 1QAXA 1XQIA 4C0BA 5LJ5Y 1MMDA 2FC8A 1EZZB 3M4XA 3VGSA 4ZPDA 3TJAA 3VAJA 3CJTA 3JYTA 2R3VA 2XYGB 2MQOA 1TP7A 3T1AA 4R0EA 3VAFA 1R0AA 2EG2A 2HAFA 2QX0A 3C16B 2BW7A 5DLGA 3TNVA 3WHIA 3TVZA 5A8KA 3OL7A 2GVDA 3R7BB 2ASYA 4KO0A 1CJKA 3FKBA 1S1WB 1Y5NB 5KFGA 4WFAQ 5EWGA 3TA2A 3QRPA 4FBUA 1T03B 2GQQA 5I3QA 3C19A 5EUHA 2RMLA 4NI2A 1X4GA 3R9LA 2E29A 4HYKA 2GMLA 1NSKL 5DETA 3MPUB 3NEKA 3DXSX 3ISZA 4NLQA 3NG8A 3K89A 1MLAA 1Z1ZA 1D1UA 4RBUA 4HTIA 2IJFA 5EGYA 1RBAA 3EVWA 1ZZNA 2B4UA 1RXOB 4DZ6A 2RQCA 3TVKA 1TAQA 3I87A 5DS7A 1WHXA 3A1YG 2ZM6F 1RYRA 1BWVA 2F7VA 2ZOGA 1RP5A 2ILZA 5FIIA 4P7VA 2Z2LA 1R31A 4DN0A 3BBBA 3L4BC 4DOZA 3L95X 1YRXA 2PT0A 4MIAA 4QIGA 1JLGB 2Y3YA 2RILA 3VGUA 4LF8F 3NRBA 4NLRA 4QOTA 4ZPWR 1IBKJ 5J1EA 4L74A 4PAAA 3M2UA 2L9NA 2LEAA 4N56A 3AOCA 1J5OA 3I0SB 3DHWC 3HT0A 5F8JA 3KHRA 4CLLA 1YITS 4AL7A 1LFWA 2RD5C 1ZBTA 5KT6A 3HHLC 1R6YA 1TL7B 2EW9A 4RW6B 2KXFA 3WQPA 1OPZA 4IQMA 2R7WA 4C8YA 2LU1A 4CIOA 1LW0A 3VV2B 2Q1LA 4PG5A 3SV4A 1TFWA 3DU6A 4X2BA 1AROP 3IGVA 2OKQA 3D0GE 5HAOA 1FRLA 4DR3J 3TA0A 4EWTA 3D5MA 1XNRJ 1HWLA 2QIFA 3GMGA 3OTDA 5KFFA 1S6PB 1TK8A 3NCQA 1G3OA 3DRRB 2VFVA 1SL1A 3MCMA 1X5TA 3KLVA 4Y2CA 3MI7X 1JNZB 2DB1A 1W26A 2DGXA 1N34J 4KHPF 3JYTB 5E41A 2GIRA 3CJKA 4AT1B 3LTOA 3F44A 1RWPB 3FVYA 5T41A 4NLSA 2WVFA 4X65J 2DY1A 2F1FA 2LP4A 2XMAA 4PG7A 3CCSS 4RW7A 5LMNJ 5LJ3Y 3DOMA 4BC7A 2AIRB 3K58A 1R8PA 2GVDB 3QNWB 4KO0B 1A0OB 2GJFA 1CJKB 3P6YC 3IN5A 3UFCX 1HPZA 2D3O1 5ETNA 4EU0A 2Q79A 1CJUA 3P49B 3PY8A 2DNRA 4QR2A 4NA2A 1WEYA 3I5CA 3E3XA 2BQUA 2QGFB 4M5DA 1SKUB 4JV0A 2ROPA 2EKYA 4CLKA 4ED6A 4WFNQ 1CC8A 3FBCA 4ZPTR 4BDPA 4F3OA 3THTA 1LWXA 4WYLA 2VIHA 2MLZA 3J7YI 2CQIA 5KFAA 3V6HA 4V19J 4J37A 2BRKA 3IBCB 2UP1A 3PCOB 4HI2A 2MZQA 4Q7AA 1B3TA 4KT0C 4OI1A 1LEOA 3HHLD 2GMHA 3BR8A 4OZLA 5G0RB 1KVJA 2BX6A 4QU7A 1FKPA 3PX0A 2GC8A 4E8UA 5DDQC 1NK7A 2LXUA 3E01A 1T9TA 3M2UB 1X4HA 2QEXS 3HZGA 3EX7B 1J5OB 4RW9A 1UZDA 1YJTA 5KT7A 3HSJA 4USJC 2E1RA 2KU7A 3MMBA 3DGPA 4C97A 1KFSA 2J9DE 4H4MB 1VS3A 4O3QA 2RS2A 1TKXB 2AWZA 4URGA 2J0QD 7FD1A 1JX4A 2GHPA 4CM0A 2CPJA 2WCXA 5HP1A 4NLPA 3GE9A 1U02A 4F02A 2HSEB 3LW5C 3TAQA 1UEUA 3LAKA 1GMUA 2RT3A 2ZDOA 3M9OB 4MTPA 4O4GA 1Q8BA 1XN9A 4Q44A 5DG9A 1UWAA 2QA4S 4M1KA 2XY7A 3CJKB 2U2FA 1YRUA 2GGPA 5EWEA 3J7YU 4EBEA 4RW7B 1EARA 2YWFA 5CYQA 4QWBA 1WJ9A 1HPZB 5C2CA 2XSFA 1YJRA 4ZCKA 1CJUB 3CPWR 4FF3A 5DJBA 4QW9A 1Q82T 2G2YA 1Q81T 2QMUB 3OTOJ 3KMQA 4I2QA 4R25A 5E0OA 3L3CA 3OV7A 3MM8B 2HWIA 4DU8A 1DAXA 1RAAB 3PX6A 5AT1B 1PJ5A 4HDGA 2IBOA 2MKIA 4RUCA 3GIJA 1ACMB 4F04B 4UOGA 1PAUB 1U1OA 4WU2A 3F41A 2MEWA 1O8BA 1IM6A 1AUSL 3CCUS 5HVHA 1WF0A 4WKYA 2XLJA 3H2LA 3PRBA 4E98A 5A2QU 2Y1JA 2VF3A 1NMEB 1PYSB 2WBMA 5B7WA 5L1IA 4G1QB 2ZZTA 2YWGA 5D6GA 4K7QA 3PW7A 1FWKA 2KXNB 2XSJA 4JYAF 2ZKTA 3HHNB 2W9AA 1IBCB 1IUJA 1FKPB 4I56A 2IYGA 1X5PA 3WC0A 4TN2A 2N7CA 3LANA 5A6PA 1IM4A 1I94F 3D66A 5CABA 3RRKA 2ACMA 3B8HA 4TLRA 4RW9B 4ECRA 3W9IA 2HBQB 3OTEA 3TYTA 4DL3A 4U8VA 1G2EA 4DPUA 4N77A 3UI3A 4FBTA 3LWLA 2CADA 1RE1B 1PC4A 1HWIA 3MOZA 3HZEA 1NH8A 4DV2J 3DGPB 3LUYA 2FVQA 4IOAQ 2R7QA 4XK8C 1D9FA 4WTYA 2OP5A 2N4CA 1XMOJ 1VQKS 3PX4A 4Y2IA 1VMBA 3D9BA 3RB6A 3DNCA 1FA0A 2DHAA 3FEZA 3D4JA 3TZWA 4ZVUB 4IH6A 2WTFA 5DG8A 1P1LA 1RWWB 3SCIE 5HK4A 5ITHA 3MM6A 4LIRA 4HH1A 4O4GB 1Q5YA 1ZETA 3HX9A 3ZTQA 3V2UC 4K4UA 4JI5F 5CD4A 4OJHA 2FZGB 2UUAF 2ZNYA 2MGZB 3EJMA 4EO6A 1UVKA 1NSQA 3CDUA 2IDLA 3VQTA 5KFRA 4Y3CA 3C14B 4U95A 2H1YA 1CJVA 1S48A 3S01A 4U6PA 5JUMA 5M2RA 1VQNS 3CCTA 2XM3A 3HP6A 1SJQA 5M2PA 4OX7A 4HI1A 3A8EA 1U1RA 2F40A 1RKJA 4JI6J 2BE7D 3ILOA 3U1NA 4ED2A 1R8HA 2UXDF 4I2QB 3M6UA 3DKDA 3PYFA 3TAMA 1KSPA 2CQ4A 3GYGA 1FVSA 1S1XA 3N28A 3JQKA 1JKHA 2P9GA 1RTDA 1U2FA 3RUBL 4OYBA 3NS6A 3MUVP 4M5LA 3UR0A 4ZLPA 2QL7B 4KGKA 4X64F 1Y9OA 2FJBB 3K8VA 3HFVA 3CCWA 4U9RA 2NZ4A 2OFHX 1FDDA 4EZ9A 4MYUA 2AJ1A 4K8RA 4TU7A 5HL7Q 2IRUA 2XSJB 1NHKL 2J8SA 4OJ3A 3MMAA 2NZCA 5C7PA 2HG4A 1N8RT 3CCVS 5MAOA 4LFCF 4IRKA 2HURA 2GX8A 3TX8A 2IRYA 3I4PA 1XNQJ 1TK0A 4YHHJ 4K2JA 3GFXA 2OTLS 2WVDA 4ZIWA 3TAPA 4FP9A 1VQ9S 3BR9A 2GIQA 3TQ1A 1H2UX 4IOBA 2VL1A 4UOHA 4JI0J 4CLUA 3CF5Q 4M63A 1U48A 1UAWA 4EYIB 5D4NA 3CVKA 3JB9k 2AZ3A 1FXRA 5D0EA 4TKTA 5J2QA 3TA1A 4WXOA 2HS3A 1T9VA 2DNGA 2LQ9A 3DLHA 1J27A 3I31A 4NLGA 4NYZA 5I3UB 4A8QA 3MM6B 1RA6A 4J9SA 1DHMA 1VYAA 2CQDA 3H0PA 1YRTA 5HLFA 2H9ZA 2B7BB 1S0MA 2MQ8A 3W9HA 3HSGA 2GHWA 5KFNA 5DG7A 3WZ0A 3MTJA 2QA4G 1SL0A 1O0PA 2FJXA 2FPHX 2AJ2A 4C2MA 1K47A 4PG6A 2CQGA 2HAIA 5F8HA 4I64A 4ED5A 3OFEA 1NHVA 4ANEA 1RLDA 2CQ3A 2UUCJ 4NPOA 4WIIA 1S1VB 1DY3A 4LRDA 3IBFB 1JLCA 4DV5F 3ONQA 4IG0A 2O3DA 4F4ZA 4HL9A 4J9RA 2BE2A 4DSJA 3TAMB 2VDHA 1GX5A 1S1XB 2RKIA 1JKHB 1S6OA 2GO8A 3C15A 1GFWB 1SC1B 1IXKA 1RTDB 3O2IA 4ECSA 4P6QA 4UOFA 4PXEA 4Y6IA 3X1LB 3N5FA 1I1GA 5C24A 1KBRA 3OPKA 4NX9A 4ZP9A 5K8NA 1M1GA 2QSWA 4P72A 4WZQA 1MW7A 4C7QA 2KG0A 3P5TL 4ZP8A 4DL2A 1J5EJ 2IAJA 2MKHA 3H90A 3MMAB 2ALYB 3PRVA 3BYPA 1BC6A 2LMIA 4B3TJ 1P9YA 3GFZA 3D1HA 1D9AA 4FKXA 2ZKUA 2FJAB 1VC0A 4LRBA 5F8LA 2JFKA 2R2TA 4MIBA 2QFJA 1IBMJ 4JI7F 2BKOA 2K06A 2V9WA 5K5MA 2BQ3A 2RDDA 4OX9J 3BN4A 2HWHA 1NBEB 3CJ8A 4Y00A 1LV5A 4I68A 3E51A 2AT1B 3D7SB 3WBZA 4KBIA 1NDKA 4C4WA 3D3CJ 4PYDA 2ADCA 3NOCA 2VKRA 3PJWA 3S8SA 4GKKF 1FX2A 5FJ4A 4PXBA 3ILIA 2QZ8A 3V5RA 2ZVSA 3OBIA 2LQBA 4WCEQ 1B99A 1FXLA 3N01A 3FCVA 3HJFA 3EMTA 3KLGA 4I7FB 2F3JA 1C1CB 1TU0B 3BB5A 1FT8A 2HZCA 2RHQB 2RHSB 4Z2XA 3M8ZA 2Y8WA 4X4RA 2IM2A 1OY8A 1UJ5A 2C3MA 2P5VA 3Q8SB 1HLWA 1LKZA 5FLXU 4WFBQ 2W2OP 1QD1A 3HSZA 1S9EA 1PYOB 1N5YA 4DMZA 1FI4A 4OJGA 2DGVA 4NXNF 2N3LA 3J80Y 2NXCA 4NLTA 3MEDA 2DGUA 2DISA 2FYXA 2CA9A 3GQCA 2CNLB 4P75A 1YBTA 4L76A 3FEYB 5KFTA 3KJVB 2OJ3A 3OR1A 2GA7A 5HJXA 3ENVA 1GQEA 5KG0A 1WEZA 4IG0B 4RNMA 5DQGA 1U8SA 2QL9B 1WG5A 4OZ1A 3DYAB 2LQ8A 3H4DA 3LP2A 2BE2B 1XR7A 2QV6A 2P6TA 1ZYQA 5C25A 2RKIB 4F0MA 4ECQA 3M8YA 3F0NA 2W1BA 3BBFA 3M8SA 3WIVA 3ZC4A 2M3DA 2ZNZA 2CJXB 5KFEA 4JI1J 4DR7F 2XTJP 1S72S 5C24B 2OTJS 2DXDA 4RNHA 2HFZA 1S99A 3AQPA 2MY8A 1GK8A 1QM9A 2P2CB 5THWA 3KNAA 5HVFA 1X9MA 3CMAS 2RQMA 2AJ4A 5BYQA 2M88A 5HROA 3KDNA 2OPPB 3CCQS 2E7XA 2A6OA 5IFMA 4N7TA 4ED7A 2ZWPA 2CAJA 5A8WA 4X4VA 4WP9A 5AXMA 3QZ7A 2YKPA 1YLXA 1K8AT 4X4SA 4FNIA 2JHEA 3AAWB 1KQKA 1NH7A 4OYAA 5EWFA 3U1MA 2UV8A 2BUNA 4LREA 5HO4A 4O3SA 4ED0A 1T8EA 3S7RA 4B3MJ 4P7TA 2XI2A 2ASLA 4LF6J 4K5RA 3PHEA 2UV8G 1NJWA 5L1KA 4TYAA 3MEGA 3KLGB 3R6GB 2NPFA 3H42A 2HHSA 2HQGA 2VFTA 2YKOA 5B0AA 2VOOA 2CPYA 2XMUA 2XLKA 3UCUP 3MD1A 3TZYA 2VUGA 1KLNA 1QTNB 1R89A 5IT9U 5CHCB 5DRKA 2XS5A 4YN3B 2JLEA 1ZAWA 2F8HA 2FGCA 4ZVSB 3RBEA 3PZPA 2WK4A 1RHJB 3GU0A 4DUZJ 2Q66A 3NWGA 2HRTA 1L3TA 3MMCA 4ECVA 3EZ5A 4M5NA 5IC4B 2FY1A 2JRSA 2C3OA 4OMFG 1X7VA 3OR1B 3JSMA 4EBDA 1LNQA 3BKUA 3KHGA 1NK5A 2XI3A 4DR4F 1RSCA 2LU2A 2EFNA 3LP2B 1KQGB 2F4VF 3I4HX 3LGMA 2B5JB 5CD4H 1Z2ZA 2BEFA 3TARA 1NK8A 5GAEI 2OO4A 1SI9A 4NOHA 2RSQA 4K4ZA 4OHWA 3BGRA 2V94A 1RT2B 2AYGA 5BR8J 3KG0A 1WKJA 3EGNA 2KFZA 2D3ZA 2GW8A 1RTIA 1EKSA 2EFOA 3I0RA 2XS2A 5ETOA 2KRBA 1QE1A 2HHUA 2IBKA 4BHQA 1WF2A 3LQVA 1SH0A 2DEIA 1NAQA 3HHLA 5I4MA 3VR1A 2IVFB 3RAXA 5A8WB 2ZH8A 2D9PA 2RAQA 2ZOMA 3G6XA 2ZD1A 4OYOA 4U96A 2POKA 3OJUA 3IWLA 2ASDA 3NL0A 4I2PA 4GKJJ 1Q79A 1WC4A 3VAKA 1S49A 3KFWX 4F4KA 1U7LA 4G1IA 4B9SA 1FVQA 1DLOA 1SJRA 5DM7Q 1D09B 2CNKB 4UW2A 4NLYA 1KLMA 1VHIA 1W2BR 2E9ZA 4ZVFA 1GMVA 3ZZUA 4DR1J 3IRWP 2DNKA 1FX4A 3MM5A 1VJQA 3MEGB 4O3PA 5KFZA 2ATLA 1YG0A 2F65A 2KT5A 3MM7A 4P2FA 1SJFA 1NU4A 1FNMA 2HQFA 1V6HA 4KFBA 4OX8A 2KFYA 2QLFB 1JLAA 2E1PA 5GAEU 1NHUA 2V2QA 4FXDA 4DV4J 1UVNA 1S1TA 3IAM9 3MMCB 2FZKB 2Z58B 1T9YA 4DPWA 3MR2A 3Q8PB 4EUVA 2ZH1A 1SJ1A 4DQRA 2I9SA 4G65A 3V6KA 1F9EB 1Q78A 4M5MA 1QSSA 1IBKF 1JWWA 3W2VA 2XCAA 5KFCA 4DXLA 3HM9A 5DGBA 3IWNC 3A13A 1SV5A 3FSXA 3M6WA 1WUUA 2WW8A 3UN3A 2A6MA 5JVGQ 4QIWD 3UVJA 3BGUA 2BJDA 1FEHA 5D3GB 5J1PA 3QQCD 4RWWA 3PW0A 4G1PA 5H1SV 3BGRB 3PR4A 1RWUA 2NXNA 2F9JA 4ZPVR 4DR3F 4UY8T 3LALA 1XNRF 4V19X 3EYZA 1S79A 4ETXA 2DXFA 3ZTSA 3ZTOA 3J81U 1PBAA 2CKWA 3T5KA 5L38A 1RTIB 3W62A 4RW4A 3K5PA 1BUXA 1QE1B 2YXLA 3D0IE 2QA1A 1EQ0A 1N34F 2DNZA 3HHLB 1DQ8A 4K59A 1K44A 4F4AA 1G7CB 2C3UA 1MROB 3MCNA 3H5UA 4X65F 2WVBA 5LMNF 4DU7A 3PRDA 2J6SA 2Y0BB 4I2PB 3WIUA 2HWTA 2UUTA 2EK1A 2ZH2A 4DFMA 1HNZJ 3W2WA 2HGLA 3UD3P 2FC9A 3QZ8A 3I6PA 3K59A 4ILRA 2AKWB 4DS4A 2PO4A 3PKYA 1GXLA 1SC3B 1KLMB 3TP2A 2J9DA 3OVBA 3DOKA 2PA8D 3D3BJ 4CO4A 2M8DB 3IM9A 3MM5B 3ICLA 4IFVA 4GVBA 4RWXA 2FY8A 3CT9A 1H6KX 1SL2A 4YFUA 4FPRA 2FJWA 2FZCB 1T0TV 3GCXP 4DR6J 4OYXA 2AX0A 3BJYA 1RWOB 3SFGA 3QJJA 1FDBA 4KFBB 3MUTP 2V2ZA 2KKHA 3PYEA 2MKSA 3DLGA 4A8OA 1VIXA 3GZ7A 4PEOA 1TUGB 3US5A 2C2DA 4MKVA 2KT3A 2NREA 1A7GE 4ZA1A 5FD1A 1M1KT 1Q5VA 4N8OA 1S1TB 4ETZA 2DH9A 3LGHA 4A8SA 1RHRB 5KT5A 3HJVA 2X1AA 3LGNA 3CJ0A 1MSWD 5G4DA 2B8QA 3PACA 5GMDA 3CC2S 4XDDA 3GV5B 2CPZA 1SV5B 2QLWA 1FWPA 1M5HA 2DNNA 4WKRA 3BSAA 1YBUA 1S6QA 2FHJD 3OFFA 2ZZMA 3UVJB 5EX3A 5CYMA 1YI2S 5J2NA 5IXUA 1CQNA 3FK4A 4DCPB 4ED4A 2ZH6A 3OFHA 1XEZA 2OPSA 1DTTA 4FF2A 3K2YA 3M2VA 2LXIA 3QIPA 3SV3A 2GVZA 2ZBPA 1SH3A 2QYCA 4OLPA 3D6HB 5HJYA 3GG1A 2HQ3A 3MOJB 2HNDA 1NPKA 2PEBA 4RW4B 4ECYA 3DLBA 3DRXA 2JX2A 1R6VA 2IPOB 5ETPA 1IVZA 5E3RA 2DD8S 3R7SB 4PQAA 1MN7A 4CRJA 1FJGJ 1VISA 2IMWP 1QUPA 4ECTA 2EKNA 1QY7A 3D0HE 4FVCA 4DUYJ 5GADI 3OJSA 1N36J 4A8FA 1YJ9S 4MMOA 2UUBJ 5KG7A 1TVRB 2CWKA 2OELA 1SBRA 2FVRA 4NCGA 3W2WB 2R8JA 4TQSA 3OLAA 4X62J 2V50A 3LF0A 2KT2A 3OTOF 3M9MB 2YY3A 2GHVC 3KTQA 3GSDA 3DOKB 2IC3B 1NZ8A 2CPHA 5LOQA 1VK3A 3VVUA 4IFVB 4GVBB 1S9GA 4OYMA 3D1QA 3CWJA 2AJ0A 1S4FA 3VZIA 4ZHRA 1X0PA 3D6TB 2CVEA 1RT6A 3DLGB 1HBMA 2CUYA 2DR6A 5KT4A 3S6EA 4LSNA 1EX8A 3K17A 3K0JA 2V4RA 4ATNA 2EFGA 2BMBA 2BM1A 3SDEA 2HHVA 2C22A 4DR2J 1RAFB 1FRJA 4AFFA 2AJFE 2PD1A 2BJEA 3G6ES 3IR6B 3U1LA 2LLZA 4A8MP 3D6MB 4I1TA 2HKEA 1G6BA 4ZJOA 3BSOA 4P73A 2R8IA 1HNVA 1OSDA 3MR7A 1NK0A 2UZAA 5DDOC 4UQGA 3TRGA 1JJCB 4CLWA 4YR3A 2R7OA 2KZZA 2XLIA 2W2PP 4DV2F 1S6QB 1XR5A 3FGVA 4CH1A 5CYMB 4HHJA 5J2NB 3Q8QB 1XMOF 2ERRA 3JQJA 1NB2A 1KOOA 5GADU 3M6VA 2ZJRQ 4KGVB 1HNWJ 4ED1A 1HWKA 2OMOA 4DUTA 1RLCL 2MZJA 2OPSB 2IM0A 3DI6A 4JOUA 1RTJA 4D3HA 3QIPB 3CDEA 5MLCV 1U4BA 1N6QA 3SQGA 2GVZB 2MHEA 3ZZPA 3QAUA 2N7YA 4S0MA 3I32A 3MCOA 2HNDB 2CG4A 2J7KA 4CLPA 1BXNA 3J7AN 2VOPA 2R7TA 4F3MA 4OZ0A 4IFYB 2NXUA 2E1CA 3Q83A 4BC9A 3HO1A 4WFZA 1TL4A 3A4TA 4DCJB 5DO2A 4WF9Q 5F8GA 2H4YB 2P8IA 1TV6A 3MPVA 4LVNP 1UW4A 1RB0A 1N5TA 3DHXA 3IFEA 4NCGB 1TKTA 5F3TA 2YKNA 2GV1A 4N41A 4JI6F 1SC4B 3FC9A 3KDOA 4NRUA 2ZBQA 2LEPA 9RUBA 4G6VB 1C2PA 1S76D 4BLGA 2BE9B 1D9DA 1RTHA 3M2RA 2YNIA 2VBYA 2C2NA 2VASA 4DV0J 3ZZOA 1L3UA 2CPDA 1HR0J 1F5BA 4PG8A 2HHTA 2LQJA 1RT6B 1YDLA 4DL6A 4CO5A 1HBMB 1S57A 4IH5A 2CWXA 3VALA 5KFWA 3H7HB 4LSNB 4RNFA 4TU9A 4WE1A 1W7WA 2G1HA 3QRRA 4L73A 1P6TA 2KB2A 4KPYA 2DGQA 2GAGC 5KOXA 2W7AA 1W2IA 4PG4A 3RBXA 3JTOA 1XNQF 4YHHF 3T9NA 1NUEA 4DX8H 3ADAC 3VWSA 3RJMB 3Q0AA 1HNXJ 3M05A 4P2MA 2R9LA 4YB1P 1FK9A 4DEZA 4NRTA 1HNVB 3BGOP 1VQPS 3D1OA 3KLIA 3PHTA 1FF2A 1U1KA 1VJWA 2AEJA 5K8MA 3W66A 4JI0F 2X7IA 1X4CA 1L3SA 2PFFB 4ECZA 3MPYA 3RAMA 2OHDA 3CC4S 5DZ7A 2JEIA 1FWLA 1ZAXA 2MTLA 2YTCA 3VVTA 5KFQA 2D7SA 3BPDA 1U24A 3DI6B 3POTA 2AD9A 3RRGA 1RTJB 1N6QB 3SQGB 4N47A 4ER8A 1OY9A 3KJQB 3JAMY 4DX5A 1S0NA 4O44A 4RZRA 1RK8A 2L3MA 1GMWD 1IKWA 2OEMA 2ZH7A 1E6YA 1U45A 4OL8A 2BKNA 2MJNA 2NPIA 4MK9A 1VIOA 4CTAA 1VK8A 2XB2D 2MZ1A 1BQNA 2UXCJ 4JV1A 4B08A 1FJ7A 1SVDA 3CCRS 1TV6B 2HHHJ 3RYLA 2PMWA 4J9MA 3KNGA 3RTVA 3N4WA 2UUCF 3W1YC 2YKNB 4BBYA 4B3OA 3R5DA 1FKOB 3L7PA 3W63A 5B0CA 1NNDA 1AB8A 3WDOA 2PI4A 2CDRB 1VOMA 3FRYA 2JDJA 1NM2A 2V34A 4B9LA 2GS8A 4Q43A 3M2RB 3FMBA 3ULHA 1WACA 4IO9Q 3G71S 4Z7YA 3MR5A 4B3RJ 5I3PA 1TL5A 1T11A 3OUYA 4TXSA 1YTYA 5F8MA 1VRTA 1X9SA 2A0FB 3BH7B 3EGWB 4NZ6A 2F8EX 4CH7A 4ITSA 1PG5B 3O1LA 4KGXB 2PI5A 1GX6A 5ETLA 2BM0A 3T5JA 3CJSA 3GR1A 4CI0B 1ZOTA 4B3TF 2AGQA 2VV5A 4FF4A 3FNNA 3CDWA 1JJHA 1ROFA 1DRZA 1IBMF 3ENAA 3KLIB 3TEGA 2V68A 1N48A 4OX9F 1WHVA 2DNHA 3FZBA 4J9LA 4FF1A 3BQ1A 3CW2C 3CUNA 5D8HB 1HW8A 4QW8A 2DHSA 1WOOA 4R8UA 4NE9C 2JVRA 2E5HA 2BANA 2W7PA 4C11A 1HHSA 3POTB 5E7OB 2XQCA 3ZZRA 4DPTA 4BCAA 1RT7A 2OI2A 4RL1A 2Y1IA 5A6WA 1JB0C 4ALZA 2J8AA 4YDXA 3PKMA 4B9NA 3GFYA 3HLUA 3OD2A 4LRFA 1N33J 2W2MP 1IKWB 4XTTA 4CLSA 4OZNA 2YH1A 3ETOA 5L9XA 3LA0A 1WG4A 3W60A 4CTAB 3G6VA 2LDIA 1WD6A 3G86A 1BQNB 3ZZYA 1RT1A 4NYOA 3KMSA 3A8JA 3TWZA 4DWIA 3NGDA 3ZO7A 3TJ9A 1WWHA 2BJ9A 2DHGA 4A47A 1KEKA 2WSFC 5KG4A 4C0HA 4GO7X 4M5GA 4B3OB 2IYIA 1VCTA 5KG2A 2EWHA 1OQ6A 3T5LA 1ICEB 5I42B 1NDCA 1C0UB 2ZDPA 4H4KC 2QLXA 4LF4J 2ZHBA 1VQ7S 2PDAA 2XO7A 4M95A 4P71A 3GIKA 1BQMA 5ETRA 3HSDA 2KHDA 3CEDA 1WDTA 1UMJA 4NCBA 1B0TA 4OYPA 4JI1F 1ZM9A 4LBHA 3P3DA 2K3KA 5B0DA 4USUA 1H7WA 2RDIA 3OUYB 2WRMA 1RDRA 1VRTB 2HYIB 2HK2A 1B64A 1S97A 3OSNA 3DLKA 4OHXA 1OMSA 3RBZA 4A46A 3ELHA 1WORA 3N6MA 5E33A 4F4WA 2MSSA 3BEGB 1M5SA 3A12A 3TI0A 5K8PA 2ZH9A 4ZLNA 4TVAB 4FS2A 3D68A 2V9KA 3CULA 3H5XA 4PQUA 1U0SA 5EN1A 4UZBA 5KG5A 2UXBJ 1PO6A 4OFZA 3CD5A 1HQEA 4R5PA 3IR5B 3MM9A 2CRLA 3ETMA 3IM8A 3GFHA 1OYDA 4LT6A 4R8UB 1JJ4A 4C8OA 2BANB 3NGUA 3L7UA 2UVUA 4C11B 1RJJA 2I5JA 5ETVA 5ETMA 4FYVB 4O3NA 4LF6F 3CCZA 5KFPA 3FBBA 3K7RA 1RT7B 1V9OA 4B9MA 3N9UC 1PCAA 2VQFJ 4LR8A 4KIAA 4KH0B 3GIRA 4KGZB 4ZJLA 1MU2A 1IKVA 1VBKA 1YHQS 2CZ9A 1R0CB 1RT1B 1ZH5A 4CO3A 4DUZF 4Z37A 2W4CA 2B6AA 2PGCA 3BPSP 2VG7A 4F36A 2W25A 1RT5A 1HI0P 4OHYA 1RT4A 2HMIA 2H65B 2JEFA 3EZOA 2LECA 1UJ4A 5D0RA 1TKZA 5D0HA 3MFHA 3Q24A 4KTQA 2YWKA 4IG3A 3UN5A 4ES2A 3EXYA 2C2EA 1BQMB 2E44A 3WX8A 2X1BA 3CO9A 3MEEA 1NSAA 3VHQA 4ZP6A 4FZVA 4X4UA 2M7SA 1U0HA 1PC5A 1F9FA 1N0UA 4KY3A 4MT1A 2ZC4A 1H74A 2ZEJA 1UETA 4G3IA 5KG6A 4MIWA 5BR8F 4L72B 4Y34A 3DLKB 2GMJA 1NKBA 3T41A 2AGOA 4UUWA 1EETA 1RWVB 2K7JA 2ILYA 4O23A 2VU5A 1ZA1B 3NNHA 5BYRA 1HHTP 3RW6A 3UDCA 3KLEB 3AA8A 3QJPA 1MG7A 4GKJF 3V4MA 2CQPA 2VG6A 1RWXB 1HQEB 3C8YA 1FRKA 2F9DA 4R5PB 3MM9B 2GJ2A 3UW1A 1HBOB 5HI7A 3P96A 1R27B 1R7IA 3HMJG 2ZZNA 1GXTA 2V6AA 2DO4A 2I5JB 1RAHB 1H2VZ 1NK9A 4OI4A 2FHJA 2QE5A 4Y2AA 3KHHA 2XHWA 1SUQA 2RVJA 4DR1F 1RQ0A 2PMHA 1WF1A 1Q7LB 2ZH3A 1K0TA 4LF9J 3PO5A 4BS2A 2DR8A 1UJ6A 3MR6A 3NAHA 3GV7B 4WTOB 3OHBA 1K0VA 2H51B 7AT1B 3UDEA 1T7PA 1HD0A 2HQCA 1SKRA 2AYBA 4X4PA 1P27B 2IHR1 2OIHA 4DV4F 1Q1KA 5C42A 1T9XA 2HLTA 2B6AB 4K0KF 3BGLA 4RU9A 4QYZJ 3D67A 4ICLB 2VG7B 4YY3J 1RT5B 1Y10A 4CLZA 5CA5A 4PCQA 1RT4B 2LCWA 4KHMA 5EHHA 2DY9A 2ZUGA 4UY85 3I9V9 5K9FA 3TQEA 2QTWA 2AX1A 2V8VA 3HT3A 3IBWA 3D6FB 4KR0B 3KXDA 3QLHB 3QSIA 2J0WA 3KLFA 4M5IA 2WAQD 4OYZA 3BBCA 2FIUA 2NCKL 1YZ7A 1RUSA 5HQMA 2HFNA 2HVDA 1RAGB 1U0HB 1WC0A 1AA1B 1BQXA 4HVZA 1R0BG 1R0AB 4FDFA 1YJWS 3CCJS 2YNGA 1VRQC 1YJUA 3VGTA 3R97A 4C48A 3QGGA 2HRYA 4AQYJ 5A8KB 4IDKA 5F3ZA 1F2GA 3QYYA 2QRRA 4C3LA 1EETB 1WG1A 3EDRB 4C3MA 2UUWA 2EFQA 4CCHA 1TQLA 4U7UD 4E2FB 2NUHA 2DO0A 4DSFA 2W24A 1UPPA 3ISNC 4NI2B 1IR0A 2IM3A 5ADZA 3AT1B 1REVA 3FEXB 4QBUA 2VG6B 4H4OA 5D0GA 1HNZF 4ES1A 5L9NA 4HACA 2E1MC 3CJ3A 5B08A 4I6WA 4FYXB 1VQ4S 1AXQA 1S59A 1FRMA 1AYEA 1CPZA 3WX4A 1WI6A 2VKZG 1UVIA 1T94A 2MB0B 4OIXA 4TY8A 1GTHA 2MQNA 3MDFA 1NK6A 4W92B 2NR0A 3MGJA 1JLQA 1NKCA 4WWSA 1H7XA 2QT7A 4QU6A 4DR6F 4IKAA 2U1AA 4AL5A 3BSNA 3QGIA 3M8WA 5J1EB 2W2NP 3PR5B 3TUJC 3VAHA 4USWA 2ZJPQ 1JXEA 3DC2A 1YVFA 2BVZA 5HQ8A 5IQ6A 2EPIA 2YKQA 4P2SA 3SFUA 3CDAA 4PZVA 2IJNA 5HN0A 3M32A 1RCXB 3LWMA 2W9CA 4PWWA 3BKTA 1FDNA 3ZZ0A 5C42B 4PPDA 4ZPBA 1C1BA 3GP9A 2KVQE 1RWNB 2RE1A 2HHPA 2X1FA 1LW0B 2XWYA 3SZ2A 3FBEA 1NKEA 4QWCA 2XMWA 1YSJA 2HQDA 3MTKA 3IAS9 2ASJA 3KLFB 5KFJA 3G8QA 4I69A 2UVWA 3D54A 1VLOA 4P52A 5KG3A 3GYXB 1F0XA 2LVWA 1KFDA 4MH8A 2YNGB 5IWAJ 3MEKA 4ZKAA 5M2UA 3O5TB 1RKIA 4F67A 3DOMB 1HA1A 2WSCC 4IDKB 3CD0A 2VPYB 4JI2J 2VBWA 4TLQA 3KOAA 3ITHA 5DDRC 2CQCA 1G4CA 3HK2A 1VBZA 2PE8A 1U8WA 1RHQB 1RGVA 4M5DB 1FJGF 1B7YB 3Q2SC 1HQUA 4JB8B 3IP0A 1ZM3A 5B0BA 4DUYF 1REVB 3PYGA 1N36F 4LBIA 1FNXH 2UUBF 3GIMA 1VC5A 5CZVA 1XERA 4HTJA 2RRBA 3Q22A 4HACB 3HPOA 2XZDB 3VAIA 4X62F 2CQHA 1QAJA 2QFIA 4ZPAA 1KS2A 2YPZA 2JSXA 2KN4A 2V5HG 3FRZA 4NA3A 3WC2A 3HF5A 1HI8A 1NJIT 3NMRA 1JLQB 1F9HA 4Y2KA 3A8KA 1RTZA 3IWXA 4DHVA 3E01B 2HVZA 3I5BA 4TYBA 3W65A 5LL6d 5RUBA 2EI5A 1HYSA 5LSLA 3GPAA 1ZAVA 1GMWA 4IR9A 1QVFR 1FD8A 1ZPVA 1U2RA 3K5MA 2W9CB 4DR2F 2BJ8A 3QT5A 2NUUG 3MMBB 1NRKA 3OTCA 1C1BB 1T3OA 1VGYA 1BY9A 4ED3A 2P9CA 3FFIA 4QPXA 4Q8EA 2NXJA 2APOA 4CT8A 3T1HJ 1VQSA 2FLOA 3AJDA 1TL1A 3CCMS 1ZPWX 5A0YA 2VPXB 1V3ZA 5HP1B 2QLJB 1YJNS 1UFLA 3HI9A 4C0OC 3T1YJ 4ZN3A 4PRFA 3O44A 2W8LA 3OL6A 2IVMA 1RU2A 2R8KA 1CG2A 4EYHB 2EEYA 4RUHA 4EFAC 4ELUA 3NMAA 4HKQA 4HLBA 1HNWF 1JK9B 2BW2A 2XNRA 5L8RC 2GGPB 5J2MA 3UD5A 4Q0BA 4DFJA 3CSKA 5CYQB 2O66A 1K73T 3CNQP 4WIQA 1A6LA 3UE2A 1JLBA 4NCAA 1F3VA 1TFYA 3ITHB 2EBEA 1U09A 1TMJA 1S7HA 4DV7J 4RR5A 1RI7A 4N5SA 3G4SS 6FDRA 2MHNA 1PILA 5CQGA 2MQMA 2EFVA 4LF1A 3TZXA 1Q7YT 4QYZK 2JEJA 3RGIA 5T14A 4QIEA 4YS2A 1GAOA 1YQHA 2JLFA 2Z2YB 4DN9A 4DQPA 4MAKA 4ZDNA 2MLXA 2VFUA 1CS4A 4Q45A 3OXFA 2HFSA 4F3QA 1XIQA 5EX0A 4J91A 3KJNB 3LP0A 2JFDA 4ZP7A 1SJ4P 5CAAA 2RRAA 2C2KB 4Q2MA 3J7Z5 4ZITA 4JI8J 2M9KA 2LA4A 3BZQA 4DV0F 2XMJA 1X5OA 2WVEA 4DLGA 2QA2A 2RB7A 1HR0F 3RAQA 3RBDA 2AQ4A 3NBPA 2XYPB 5CCLA 4KH1B 2OEKA 1FTRA 5HBMA 3PFOA 1HNIA 4OLOA 2DNMA 3CC7S 4HR2A 2C2RA 1HYSB 2G2OA 1T02A 2MQQA 3LP1A 2V63A 4EK2A 4QWEA 4Z7CA 2RNEA 2MZSA 3PIPQ 3FFIB 2OEJA 4MJKA 1PKUA 3UR3C 2FJVA 1JJ2R 3N79A 2B9WA 1TL1B 1NLKL 1SQFA 3VF0B 2W4DA 1HNXF 1RISA 4NYPA 1KR4A 5A0YB 2VONA 5DGAA 3CIMA 1JNRB 3SSQA 1QVGR 3HKZD 1U2CA 4RNOA 4KSEB 3NGSA 4NLWA 5H9EJ 3NKYA 3QFHA 3Q8RB 3GTYX 4KB7A 3EGVA 2XNQA 1WSVA 3MECA 3AFGA 4DF8A 1X5SA 1GNKA 4ANCA 3HDSA 3NNAA 3W5YA 1RBOB 2R8GA 3GWCA 5J2MB 2YWEA 1CJVB 2XGQA 3FQKA 1R3NA 2RF2A 2XBPA 2D3OR 5HVGA 4FKYA 3DLJA 1JLBB 3QATA 2ZVIA 4LFAJ 4NZ7A 1UW9A 3PEHA 4LR9A 4YR2A 2MQPA 2XULA 2WB4A 5KAKA 3FMWA 4ZVOB 3NP5A 5DQHA 1ULRA 1XMBA 2HFOA 2QO3A 1MMLA 2UXCF 5GAGU 4O0NA 2MSTA 2OUGA 3PW5A 5AE3A 4QJVA 1OQ3A 2ABYA 3H98A 4DV3J 4HT5A 3KK2A 5HATA 1HL6A 1ZTTA 1U25A 2JNJA 5IC6B 5SUHA 2HHHF 2B4VA 5CXTA 1C4AA 4YEAA 1N5SA 4LF7J 3LPEA 1NK4A 3KWMA 1XMQJ 2W8KA 2YKAA 1CS4B 5EDWA 5F9LA 2BOAA 3LP0B 3I96A 1QAIA 3EUNA 1RAIB 3QPIA 4R0JA 3EWGA 2KRRA 2WHOA 5HMZA 2E5GA 5DDPC 4DV6J 4NXMJ 1FE0A 3UO0A 3NBPB 4B3RF 4X66F 3CDBA 4DV1J 1FEEA 3JSBA 2ZOFA 1HNIB 2DNQA 1GXUA 2BA9A 1AW0A 4C8MA 3PEJA 1JLGA 2Q6CA 3LP1B 1FD2A 3TOQA 4H4KA 2ZBRA 2B9XA 2E66A 2KYZA 3UPFA 1FO1A 4K2XA 5J2QB 1ZZFA 1Y5IB 3MURP 4CYUA 2MDAA 4LIWA 1SJ3P 1LOUA 1PAEX 2RDJA 4ERDA 5LT5A 2Y8YA 2VA2A 1ZA2B 3CJ2A 3GONA 4DS5A 3KK3A 2VJVA 5HLFB 2K7KA 3W64A 2Q6BA 2K8GA 1O5JA 3G96A 3MECB 4ZS6A 4OZ3A 1Q16B 4JI4J 1URNA 5KFHA 2XY5A 2J6UA 3ZZTA 1RA7A 3OLBA 4UZCA 3CIZA 3MZIA 2G0CA 3U7JA 5ETQA 3PW2A 2A2DA 2XCPA 3JQMA 6FD1A 2RF2B 2VICA 2LYVA 1DZ5A 3S1TA 1S12A 1N33F 2VPZB 4CLTA 1JLCB 1KHWA 3N5BA 1UCNA 2DNPA 2MKYA 1JXLA 1Y11A 4YB7A 4OZ5A 3KK2B 8ATCB 3C15B 4RX6A 1OSCA 3UD4P 5A2QY 2D74B 3RW7A 5BYSA 2V8DA 2HBYB 1YX2A 3QBCA 2LXFA 1I6JA 4L75A 2YQ3A 2Y9HA 4NLVA 1N5QA 1Q4RA 4WJBA 1M5PC 2LEBA 4LF4F 4XDCA 4NEZA 3QWUA 4WK1A 2IAJB 1SB6A 4ELTA 4KQZA 1SKSA 4ELVA 1IWGA 4LJMA 1GTEA 4X4OA 2C28A 4DR5J 2J0SD 3CGIA 2Q43A 3KLHA 3K5OA 5G0RA 2E9TA 3UCGA 4DL5A 2M0GB 3C6UA 3H4BA 2HIYA 1U49A 4V1Ak 2FHKA 4ANDA 2HZAA 2HHXA 5HMYA 1R43A 2NS1B 4QPTA 1Y4ZB 3A3PB 3J81j 1KD1T 2V4QA 2M4MA 5JXSA 3HVRA 4DLEA 4KC5A 4ZN1A 1MWYA 4P2XA 4CYUB 2DR7A 4H4MA 2XHCA 4LF5J 3HHDA 1TKXA 2UXBF 5E5NA 3ZNUA 2XGPA 1KNZA 3QAEA 1MMNA 3DLLQ 4IQXA 4FYDA 2HHWA 1JLEA 3BV8A 4TQRA 3KK3B 3V81A 4K50A 5HQLA 1DQ9A 3UNYA 2L08A 1IWAA 3MAAA 3QJLA 2XWXA 4RLEA 2R2RA 5LMUJ 1S9EB 2HIQA 2E5LJ 2B56A 1N5YB 1TAUA 2G13A 4L3KA 4XPEA 2W9BA 5L1LA 3V6JA 1WSRA 2VQFF 3MEDB 4RNNA 3TUIC 4LBPA 4GO5X 1APSA 2BRLA 3V4IA 5AE2A 4QR0A 4D3GA 2G9OA 1HFEL 4F0HA 1Y3JA 1JIHA 3MXHP 2AZ1A 1LW2A 4B9UA 3DRSA 2DNYA 4KV8A 3RB0A 2K3IA 3DU5A 2WW4A 5C25B 1RADB 1JQGA 5IQQA 1N32J 4DSIA 3IO1A 4KKOA 2DTJA 3E8OA 2RS8A 2FB0A 3MM8A 4LFBJ 1WKKA 3BQ0A 2VZ9A 1UTAA 2VC0A 1WOPA 4NA1A 2RIJA 4DSEA 5IV4A 5HMXA 2EK6A 4QWDA 5IS2A 4AXIA 1HBUA 2FJDB 1JXVA 2Y1RI 4O4RA 3R5JB 5HROB 5H9FK 4G1QA 2BBEA 5H9EK 4LF2A 2CQ0A 1RWMB 9ATCB 2QYGA 2XMMA 2B51A 3KLHB 4LSLA 4ZOSA 5KFLA 2ROGA 3C6UB 3W3SA 4KAIA 1P1TA 1REGX 2W01A 2ZWOA 1HBNA 1ZS6A 4DPXA 2D69A 4CP5A 1HI1A 3CXCR 2WZ1A 1B4SA 4ZVGA 2CNOB 2KM8C 1IJFB 2D9OA 3GR0A 3EPGA 1EKRA 1Q86T 1IR1A 1TZ0A 2M70A 1EHWA 3VCDA 1T3NA 1HIYA 3GG0A 1FFGB 2DK2A 1HWJA 1AZSA 1SC6A 4J9QA 1WEXA 4ZVHA 5HANA 2FLNA 2CZVC 2DH7A 2N4DA 2JOQA 2KXHA 4LSZB 4N76A 2GQCA 2CFXA 2ADBA 1N54B 4QYRA 1VQ5S 1WOSA 1M5KC 2AEFA 4IRCA 1JLEB 4P9SA 5L39A 5KFUA 3TUPA 2PEHA 4RBTA 2MYFA 3V81B 3NAIA 4Q8FA 4OZJA 4CWBA 4DQSA 3THVA 3MAAB 4LVOP 3M7VA 4OV1A 4DSKA 2Z56B 3I82A 3VAMA 4FXVA 1S4EA 3T19A 2FQQB 4LR7A 2RJZA 1IQTA 2W9BB 4K4TA 4IUFA 4LF9F 4K0KJ 3EPIA 2VHGA 2MGZA 2QMWA 5CZXA 3V4IB 3C14A 3JSMB 2VJUA 2ZHAA 1RU1A 1RHMB 1LW2B 2VQEJ 1T05A 3DRSB 1KONA 4KV8B 4WU3A 3OSPA 2KJWA 3J80U 3Q2TC 1WKLA 1Q53A 5B09A 1B0VA 2ROEA 1XR6A 2QJ3A 4NMXA 4C3KA 3KUHA 3I5AA 4KKOB 4YY3F 4AD6A 1VQOS 1LWCA 1VBYA 3MHYA 5DQIA 1KQSR 2BJ3A 3QFWA 1Z4UA 1PJ7A 4ZVRB 5IV3A 1UEVA 5LXRA 4C6AA 2B7CB 4YB6A 2H5IB 2BJ1A 1HBUB 2C3YA 3BS9A 1QAYA 3IRXA 1AT1B 3I0RB 3H20A 4RW8A 2XG8A 3RRHA 3OHAA 3L09A 3FCHA 1PGZA 1TELA 4LSLB 2DHHA 4EMDA 3I9ZA 4QIFA 4IR1A 2ZD1B 1HBNB 4WK3A 4AQYF 1T9WA 2MPUA 2E9RX 3GLJA 2C2MB 5CYJA 4XPCA 3R2DJ 3SYZA 3AOAA 3EM1A 4M5KA 3M9NB 3AD7C 1RT3A 1WHYA 1OO0B 1DLOB 1AZSB 1F2HA 3ILLA 2OMLA 5AXLA 4YP3A 1KVKA 3EGZA 1H38A 4CZCA 1NJYA 3PNIA 3KJFB 2EVZA 3G2XA 4ED8A 1VI7A 3K8WA 1NSPA 3MM7B 4AL6A 3KUGA 4DFPA 5FLXY 3RU0A 4MKYA 3N0VA 4NLXA 5E3AA 5I3UA 4CQ1A 4OI3A 1JLAB 4DPYA 5KFVA 3H59A 1UFKA 1TUVA 2DGOA 3B4MA 4GC6A 4NASA 2F4FA 4KJIA 2YX1A 2FHOB 2H4WB 3H2UB 2FDNA 4F0KA 1VQ8S 3PG9A 2QSFA 5KFSA 3SCKE 3M6XA 1RAEB 3W2VB 2YVSA 2XO6A 2JVOA 3CB4A 1T05B 1WC6A 3M8RA 3FCWA 2V8PA 3L7OA 1KP6A 1S1VA 2A2CA 3GV8B 1AFJA 1NEEA 4Y2MA 1CQMA 1C4CA 3IMQJ 2BQRA 3UNGC 2QC3A 1MWQA 3G9CA 1LWCB 5U47A 2ZHOA 2C2OB 2HLUA 2MZRA 2HVHA 2ATCB 1L3VA 2XC9A 2V2KA 1S10A 4PPZA 4QQBA 3BSCA 1X8DA 4MYTA 4YUDA 4ENOA 2AF6A 3IRXB 2G1DA 2PIIA 3DCAA 4B3SJ 1M0SA 4DI6A 4JV5J 4ECUA 1FFWB 4RW8B 2HW3A 1DJ0A 3L9ZA 4LQ9A 2MKJA 3JSYA 1IBLJ 4K4SA 3FSIA 3BGFA 2ZBCA 5IWAF 1JMTA 4USHA 5L1JA 4RO0A 2IA6A 4NEYA 3BO4A 3NWRA 1DTQA 2B3TB 3NGKA 4A8KA 1B0PA 4JI2F 3THPA 3NCRA 4UF4A 2C2ZB 3T6BA 4DSLA 4TY9A 1L3KA 4OQJA 3EVOA 2D3UA 3MAHA 2YKMA 3JSRA 3W61A 3HKWA 1RT3B 3PFEA 1PBUA 5GMKa 4ZCMA 2VH7A 3FUYA 2AJQA 1ZTWA 2CVIA 3OVAA 1O6XA 3E2EA 3JXOA 2CPEA 3R5CA 2CXEA 4RU2A 3SCLE 2EG1A 1FESA 1VQYA 5IT9Y 2D41A 4WXWA 5K8OA 4I7FA 1KRPA 2IRXA 3NGRA 1C1CA 3DXBA 2CIMA 2Z30B 4JI3J 3PM9A 5LM7E 5GAHI 3QWPA 2MKCA 1BGXT 2DIVA 1OY6A 4CO1A 2LFVA 2WOMA 4RKUC 1Q0NA 3T9ZA 4YQWA 3R7NB 4OHVA 1FDAA 4USMA 1R8BA 4GMKA 1XTZA 4OV6A 1U6ZA 2P9EA 1KN6A 3HD1A 1UWBA 4MKAA 2MLYA 1NXIA 8AT1B 3T5HA 3K5LA 3HFKA 5KT3A 2MKKA 4W4MA 2X1GA 5HSPA 4I6YA 3KJVA 2CJKA 5KFMA 2NYHA 4ZVQB 3IG1A 2HBZB 3DYAA 2YQ1A 2KYXA 3T1HF 1X4DA 2ZE2A 2AYEA 3PVXA 3MD3A 2NQPA 4UTGA 2HFVA 4BWJA 2E5IA 1DTTB 3M2VB 3T1YF 5J2PA 3HCXA 2W2QP 1IR2A 5D4PA 3OW2R 2MQLA 1RABB 3R3TA 3HVTA 1PSDA 2J5AA 1F1BB 1SXLA 4URSA 3TR5A 1SIWB 1UVLA 4USIA 3FSYA 2OPPA 3MF5A 2BXJA 2DGTA 3DDKA 3CCLS 1N0VC 1DTQB 1VRUA 2YWWA 1T95A
chains in the Genus database with same CATH topology
1D8ZA 1Q78A 2I1RA 1QSSA 1LK7A 2FVSA 2UVWA 3D54A 4A4JA 3H5SA 1IBKF 5KG3A 1JWWA 3W2VA 3GYXB 1F0XA 5DLFA 5GAHU 2BDPA 4B3MF 2XCAA 1WI8A 1F60B 2LVWA 5KFCA 4NLUA 1L5UA 2V8GA 3HM9A 2EC0A 1SQEA 1KQFB 5DGBA 3CD7A 2YKMB 4NMLA 4AXJA 4DV7F 1U1PA 3IWNC 4WFXA 1KFDA 3DN9A 4MH8A 2YNGB 3TUZC 5KT2A 1SV5A 2JZ5A 4N8NA 3TW0A 3BDPA 3FSXA 3M6WA 4U7CA 3MEKA 4ZKAA 5M2UA 3KKFA 1FJCA 1XK8A 3O5TB 2WW8A 2XZWA 5HBMB 1RKIA 3FDSA 4F67A 5JVGQ 1HA1A 1W25A 4QIWD 2WSCC 1D3WA 4IDKB 4FNHA 4C8LA 3CD0A 4PKDB 3R5AA 2VPYB 3BGUA 2BJDA 2YX4A 1FXDA 2VBWA 1FEHA 2E5JA 1R8AA 4TLQA 2LQ5A 3KOAA 5D3GB 2XEXA 3ITHA 3AJ1A 5J1PA 2C3PA 1S9GB 2X3GA 5DDRC 2CQCA 4RWWA 4OI6A 3BREA 3PW0A 1RYSA 4G1PA 5H1SV 3O3LA 3BGRB 2KVIA 3LH2S 3PR4A 1UVJA 1RWUA 3X3UA 4ZHRB 1QSYA 3HK2A 4HT7A 2F9JA 1N5VA 2HPUA 3I0SA 1VBZA 2I38A 4JV2A 2PE8A 1ZM4A 3J7A1 4ZPVR 3CMES 3T6JA 4DR3F 3V6DA 4UY8T 1BWEA 1RGVA 4M5DB 1FJGF 3LALA 4YB5A 1XNRF 4V19X 3Q2SC 1HQUA 3EYZA 1S79A 4ETXA 4B9VA 4I67A 1ZM3A 2CKWA 3T5KA 3QGHA 4RW6A 5B0BA 1WNEA 2OSQA 3DMJA 4DUYF 5KFDA 1REVB 4C98A 4ICLA 1N36F 5L38A 1FNXH 3SDEB 1RTIB 4RW4A 2RH3A 1M5VC 2UUBF 2LKZA 3K5PA 1QE1B 3GIMA 1UP1A 3T3FA 1GT8A 2RU9A 2VC1A 3D0IE 3MFIA 1VC5A 2QA1A 5CZVA 1XERA 4HTJA 2RRBA 4JI8F 3J7ZT 1N34F 3Q22A 4A8YA 3HPOA 2WOMB 2DNZA 2UU9F 5HMWA 3VAIA 2B4PA 3HHLB 1DQ8A 3QO9B 5IM0B 4X62F 3K5NA 4K59A 4OJ1A 2CJBA 3MUMP 4EGLA 2CQHA 1ZM2A 1VQLS 1K9MT 3C2PA 1G7CB 2C3UA 3RB4A 1MROB 5J1NA 1QAJA 2R7XA 2WB1D 3H5UA 3QLHA 1H2TZ 1DBDA 4ZPAA 4Y0FA 4X65F 4ZCLA 1KS2A 4HH0A 4OI2A 1UWBB 3G8SA 5LMNF 2JSXA 2DJWA 4J5OA 3PRDA 1DQAA 2J6SA 1S6PA 2EFPA 4I2PB 2KN4A 2HWTA 2V5HG 4C8NA 2PA3A 2UUTA 3DRRA 1QAXA 2DGWA 3FRZA 4NA3A 1MMDA 4C0BA 2FC8A 5LJ5Y 3WC2A 2EK1A 3HF5A 2VD3A 1HI8A 5KFKA 1NJIT 3B78A 3M4XA 2ZH2A 4DFMA 4ZPDA 3NMRA 1JLQB 3VAJA 1LWEA 4PUOA 3W2WA 2HGLA 3IG1B 4Y2KA 3JYTA 2FC9A 3UD3P 3QZ8A 2MQOA 1TP7A 3I6PA 3IWXA 3T1AA 3K59A 4R0EA 3H5YA 3VAFA 2EG2A 4ILRA 4DS4A 1R0AA 2PO4A 4DHVA 5D4OA 3E01B 2HVZA 2ZE2B 3PKYA 3I5BA 4TYBA 3TNVA 5DLGA 1GXLA 2B5JA 1KLMB 3TP2A 3TVZA 5A8KA 5LL6d 2J9DA 3HHKA 5A8RA 3J81Y 3OL7A 1FRIA 2EI5A 3OVBA 1HYSA 3DOKA 2PA8D 5LSLA 2ASYA 3FJ2A 4KO0A 3SSSA 4CO4A 2M8DB 3Q23A 1ZAVA 1HWUA 4IR9A 1VC6A 1G1XA 1QVFR 1FD8A 1ZPVA 1U2RA 3MM5B 3ICLA 3K5MA 2W9CB 4DR2F 4IFVA 4ILLA 1S1WB 1Y5NB 2O1PA 5KFGA 4RWXA 2NUUG 5J2PB 4WFAQ 3CT9A 1H6KX 3MMBB 5EWGA 1SL2A 4YFUA 4FPRA 1NRKA 2FJWA 3OTCA 1C1BB 1T3OA 1VGYA 3TA2A 1BY9A 4ED3A 2AX0A 2P9CA 4FBUA 1Y7PA 3FFIA 4QPXA 3BJYA 1T03B 4Q8EA 1H98A 3QJJA 3SFGA 1FDBA 1OIAA 2GQQA 4KFBB 5AXKA 2APOA 2L9WA 3HVAA 4CT8A 2KKHA 1DURA 1FRHA 2FLOA 1VQSA 5IT4A 3MUTP 2MKSA 1BD6A 1RT2A 3DLGA 5I3QA 5EUHA 4TU8A 4A8OA 2RMLA 1VIXA 5JVHQ 3PV8A 3GZ7A 1TL1A 1X4GA 2E29A 3CCMS 3HVTB 3US5A 2K1RA 5LSRA 4U67Q 1ZPWX 2GMLA 4HYKA 2C2DA 3RR7A 1UKUA 5DETA 5A0YA 2OPRA 1V3ZA 2VPXB 5HP1B 2XMTA 3DXSX 3ISZA 1YJNS 1UFLA 2KT3A 4NLQA 2NREA 1XWLA 3NG8A 1A7GE 3HI9A 4I0WA 4ZA1A 4C0OC 1Z1ZA 1Q8IA 5FD1A 5KFXA 1M1KT 4N8OA 2L41A 1D1UA 1S1TB 4CNZA 4RBUA 4PRFA 4HTIA 4ETZA 2DH9A 1WELA 3O44A 2W8LA 2IJFA 2J6TA 2L9DA 3OL6A 2IVMA 4J9PA 4A8SA 5EGYA 2R8KA 3O8WA 1VRUB 1CG2A 3ZFVA 5KT5A 4EYHB 2X1AA 1ZZNA 2B4UA 2RQCA 3LGNA 3CJ0A 4LFAF 3TVKA 4RUHA 1MSWD 4EFAC 5G4DA 4ELUA 2CQ1A 3NMAA 4HKQA 1TAQA 3I87A 1TKTB 2UVRA 4HLBA 4WYWA 1WHXA 3A1YG 1FCAA 3PACA 5DS7A 2ZM6F 1JK9B 1RYRA 1HNWF 2F7VA 4F25A 2BYCA 2ZH4A 3CC2S 4XDDA 2R2UA 2BW2A 2ZOGA 1RP5A 2ILZA 4WFYA 5FIIA 1AUDA 4P7VA 1YGYA 3GV5B 2CPZA 2DBBA 2XNRA 1SV5B 2QLWA 2Z2LA 1R31A 5L8RC 2R7UA 2GGPB 4DN0A 1M5HA 5J2MA 2DNNA 4Q0BA 4WKRA 3BSAA 4DFJA 3CSKA 4DOZA 3L95X 1YRXA 2PT0A 5CYQB 4MIAA 2VA3A 1S6QA 2FHJD 3OFFA 2O66A 4QIGA 4DV3F 5D4LA 2ZZMA 1JLGB 3MMJA 2RILA 1K73T 1YBAA 3R5BA 4LF8F 5EX3A 1A6LA 1RTHB 1JLBA 3NRBA 4NLRA 4QOTA 5CYMA 4ZPWR 3U27A 3UE2A 5J2NA 1YI2S 4NCAA 2YNIB 5J1EA 1TFYA 5IXUA 3ITHB 3M2UA 2L9NA 4DPOA 2EBEA 2OSRA 1U09A 2LEAA 1CQNA 4N56A 4LF7F 3SEOA 2ZH6A 3TVYA 1XMQF 3OFHA 1S7HA 1J5OA 1XEZA 1LQ9A 1N88A 2OPSA 5F9NA 2CJ9A 3I0SB 3IGNA 1RI7A 1DTTA 3DHWC 4FF2A 3K2YA 4N5SA 5F8JA 4JUZA 3M2VA 2LXIA 3KHRA 2SXLA 1YITS 3G4SS 3QIPA 4AL7A 1LFWA 2RD5C 1ZBTA 5KT6A 3SV3A 6FDRA 2MHNA 2QMXA 3HHLC 4Y28C 1R6YA 4WE1B 1PILA 2EW9A 4RW6B 1SH3A 2CPXA 2QYCA 5CQGA 3DMJB 4OLPA 2KXFA 1OPZA 4IQMA 2MQMA 2EFVA 3GG1A 2R7WA 4C8YA 2OH2A 2HQ3A 4U7UK 3MOJB 2HNDA 4ECYA 4RW4B 4F8RA 1Q7YT 2LU1A 4CIOA 1LW0A 3H25A 1U6FA 2JEJA 2Q1LA 4PG5A 3SV4A 1TFWA 5T14A 3DLBA 4QIEA 1URRA 1LWFA 1GAOA 3DRXA 3DU6A 1YQHA 2JLFA 4DV6F 4X2BA 1AROP 4DN9A 4DQPA 4NXMF 2JX2A 1V3RA 3DOLA 3IGVA 4MAKA 2OKQA 4ZDNA 3D0GE 3D28A 2VFUA 3O6QA 2DD8S 5E3RA 3U02A 4PQAA 4Q45A 1FRLA 2YNFA 3TA0A 4EWTA 2DRBA 3D5MA 4DV1F 1HWLA 4PXCA 3OXFA 2QIFA 3LO3A 3MCSA 2IMWP 4F3QA 1QUPA 4ECTA 3GMGA 2AV5A 1FK9B 1QY7A 5EX0A 3OTDA 3D0HE 3LP0A 2MXYA 2JFDA 4FVCA 1Y5LB 5KFFA 4ZP7A 1SJ4P 1S6PB 5GADI 3OJSA 2RRAA 1TK8A 3NCQA 1G3OA 4Q2MA 3J7Z5 3DRRB 4A8FA 1YJ9S 3TANA 2VFVA 1SL1A 4MMOA 2ZBIA 1X5TA 1YJVA 3KLVA 4Y2CA 5KG7A 5D77A 3MI7X 2OLWA 1JNZB 1TVRB 1D0EA 2DB1A 1SBRA 2FVRA 4NCGA 1BLUA 2M9KA 1LWEB 2DGXA 4PUOB 2LA4A 3BZQA 3W2WB 4DV0F 3JYTB 2R8JA 2XMJA 1X5OA 5E41A 1S9FA 2GIRA 4TQSA 3CJKA 2RU3A 2QA2A 2RB7A 3OLAA 4DLGA 1HR0F 3RAQA 2DITA 3F44A 3RBDA 2AQ4A 3NBPA 3FVYA 5T41A 2YX7A 3LF0A 4NLSA 5CCLA 2KT2A 2FLLA 3OTOF 3M9MB 2F1FA 1FTRA 4PG7A 3CCSS 5HBMA 3PFOA 2YY3A 1P9QC 2GHVC 1HNIA 4RW7A 4OLOA 3KTQA 5LJ3Y 2DNMA 3DOMA 3GSDA 5A8RB 3CC7S 2C2RA 4BC7A 1YWXA 1HYSB 3K58A 1R8PA 3DOKB 1T02A 2IC3B 4KO0B 2MQQA 2CPHA 3P6YC 3IN5A 3UFCX 3LP1A 1HPZA 1P8GA 4F2SA 2FVCA 1VK3A 2KTQA 4EU0A 4IFVB 4QWEA 5D3GA 2RNEA 2Q79A 1S9GA 4YR0A 1N56A 3D1QA 3P49B 3PY8A 3CWJA 2AJ0A 2MZSA 3NNCA 2DNRA 3PIPQ 1S4FA 4QR2A 3VZIA 4ZHRA 4NA2A 1X0PA 1WEYA 3I5CA 3FFIB 4IO1A 2CVEA 1RT6A 3E3XA 4O44B 2BQUA 4EO8A 5AE1A 4MJKA 3UR3C 2FJVA 3DLGB 3V6DB 1JJ2R 1HBMA 3N79A 2B9WA 4M5DA 5KFYA 4JV0A 1E6YB 1TL1B 2MY7A 3VF0B 2ROPA 4C8ZA 2W4DA 5KT4A 2EKYA 1HNXF 2K1RB 3S6EA 1RISA 4LSNA 4NYPA 4ED6A 4DQIA 1KVIA 1KR4A 3OXGA 2OPRB 5A0YB 2HGNA 4WFNQ 2VONA 3K0JA 2V4RA 4ATNA 2EFGA 1CC8A 5DGAA 4ZPTR 2BM1A 4JI4F 2GNKA 3CIMA 1U6BA 1QUVA 3SDEA 1CLFA 1JNRB 2C22A 2HHVA 4BDPA 4F3OA 1FNOA 3SSQA 3THTA 1QVGR 1FKAF 5E3PA 1FRJA 4AFFA 3HKZD 4RNOA 2AJFE 2PD1A 5KTQA 2FTRA 2BJEA 3G6ES 4WYLA 3IR6B 4X84A 2B9YA 3J7YI 2CQIA 3U1LA 4KSEB 5KFAA 3V6HA 4I6AA 2V8HA 4V19J 2LLZA 4NLWA 5H9EJ 4J37A 4A8MP 3NKYA 2N82B 1QTMA 4CO2A 2BRKA 4I1TA 3Q8RB 1MROA 2J76E 4KB7A 1G6BA 2UP1A 3BSOA 2R8IA 2XNQA 4HI2A 3MECA 5KFIA 2MZQA 2FLPA 4Q7AA 1HNVA 1OSDA 4C8KA 4KT0C 4DF8A 4OI1A 1NK0A 1X5SA 1GNKA 2UZAA 3HHLD 2GMHA 5DDOC 4UQGA 3HDSA 3BR8A 3NNAA 1NJZA 4OZLA 2HS4A 2NSCA 3TRGA 2R8GA 3GWCA 5G0RB 4YR3A 2KZZA 5J2MB 2R7OA 2YWEA 1KVJA 3SMZA 2O67A 2XLIA 2XGQA 3DDNA 2BR0A 4QU7A 1FKPA 3FQKA 4DV2F 1R3NA 3EZUA 1S6QB 2RF2A 1XR5A 2XBPA 2D3OR 3PX0A 2GC8A 4AYBD 3FGVA 4CH1A 3JTNA 3SI8A 4E8UA 5DDQC 1NK7A 3DLJA 2LXUA 3E01A 5CYMB 1JLBB 4HHJA 1S6UA 2BZ2A 3GIIA 5J2NB 4NZ7A 3Q8QB 1XMOF 3RB3A 2CPIA 1X4HA 3M2UB 3VAGA 3HZGA 2ERRA 2QEXS 1KOOA 5GADU 3M6VA 3PEHA 2ZJRQ 4ED1A 1HWKA 4YR2A 3EX7B 2OMOA 2MQPA 1J5OB 4RW9A 2MZJA 1YJTA 2WB4A 2XULA 2OPSB 5KAKA 2IM0A 3FMWA