1CJKA

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase/lyase/signaling protein
molecule keywords ADENYLATE CYCLASE, TYPE V
publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 55
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjkA00
1CJTA 2WZ1A 4OYOA 3R5GA 4OYXA 1AZSB 1WC1A 4USWA 2GVDB 4CM0A 1CJUA 2W01A 3UVJA 1WC6A 4CLLA 5D15A 5D0RA 1YK9A 2GVZB 3G82B 4P2XA 1CJVB 3C16A 1CS4B 3MAAB 1CULB 1Y11A 4CLKA 5IV3A 1WC3A 3C15B 4USUA 1AZSA 2GVDA 3ET6B 4OYIA 4NI2B 4CLYA 2GVZA 3G82A 4OYMA 2QV6A 4OZ3A 1WC5A 1Y10A 4OYPA 3MR7A 1CJVA 4OYBA 4OYWA 4WP8A 1CS4A 3MAAA 1CULA 3C15A 4CM2A 4P2MA 1U0HB 4WP3A 4USTA 3ET6A 1AB8A 1CJKB 3C14B 4OYAA 5D0GA 4WPAA 1TL7B 5D0EA 4NI2A 5IV4A 4USVA 1YBTA 4CLSA 1YBUA 4P2FA 4CLZA 4CLUA 1CJTB 1WC0A 4WP9A 5D0HA 4CLPA 1CJUB 1U0HA 3UVJB 1CJKA 3C14A 1TL7A 2BW7A 1WC4A 3C16B 1FX4A 4CLFA 4OYZA 4CLWA 1FX2A 4OZ2A 4CLTA
chains in the Genus database with same CATH superfamily
2CNNB 3TARA 3B4DA 2DGOA 3K59A 2DEJA 3I5BA 2EFVA 3DRRA 4F36A 3PVXA 1QTMA 4WU3A 2IY5B 1VS3A 4ZVEA 4ED0A 4WFNQ 2AJQA 1LWCA 4ZK7M 4KGKA 4DF8A 3L4BC 2WVDA 4NXNJ 3HKWA 3HLUA 1VBZA 1JK9B 1JJCB 1S1VB 3W64A 1FD2A 5M2PA 4Q0BB 3I96A 4DUYF 2A2CA 3GQCA 2RRNA 1MROB 2W4PA 3M05A 1NHKL 2YKMB 4X4PA 2OPRA 4A8FA 1L3UA 4C11B 2HGNA 1IQTA 3R6LB 3VAKA 2YNIA 1X31C 5DZ7A 2VJUA 3Q2SC 4EBDA 4J7CA 1MMDA 2AJ2A 3IMQJ 3DDNA 4JV1A 2Z0GA 3DLJA 4FBUA 1ZAVA 1APSA 3DRPB 3CDAA 2JLEA 3H2UB 1XMQF 3OL9A 2VF3A 3DOLA 4WJBA 2PFFB 2QT7A 4DXLA 1EKRA 4PABA 3DOMA 3EGNA 2C22A 4DL6A 1RT1A 4ZLLA 4ANDA 1EX8A 2GX8A 4JYAJ 1X4HA 3L3CA 1EP4B 2BBEA 3NY0A 3W5XA 4J5OA 2MZSA 4NZ7A 4DX7A 4DS5A 5AXLA 3UD3P 4GKKF 3LP1A 3D28A 2J76E 1SKSA 5KG7A 3DDKA 1SQGA 3NEKA 4CIOA 3HI9A 4BC9A 1HPZA 1XNRJ 4P9SA 4B3SF 1FTRA 4R5PA 2NZCA 4ECUA 5DETA 2HRUA 2ASLA 2MQNA 3DI6B 1N36J 4O44A 1YHQS 1SB6A 4FF1A 5BJRA 2Z4PA 3C66A 1WTFA 3KTQA 2Y3YA 6AT1B 3FBFA 3E2EA 3A8IA 4BWMA 2DO0A 1PBAA 4CTAA 2M9KA 1B70B 1UAWA 3WQPA 3RR8A 1WSVA 1JLAB 5F9NA 4U7CA 4DFKA 1IBKJ 3PY8A 5D3GA 3GP9A 2KL8A 2RQCA 1IKYA 2DTJA 4UOFA 1LWFB 5D0RA 1HBNA 2H4WB 3KK2B 3C3LA 1HYSA 4X4SA 2K7KA 2PD1A 1G2EA 4P10A 1PILA 3M8RA 4TU7A 2GA7A 3NWRA 2JFKA 1X4FA 4NLOA 2HQDA 2N82B 2ZH6A 3ZZRA 1S1XB 2ALYB 4DV5F 1UWAA 3NXZA 3LGMA 4I56A 1B3TA 4P6QA 4YP3A 3CTRA 1ZETA 2MYFA 3UQSA 2W8KA 4USMA 3VHQA 2R7QA 1YJRA 2E1RA 1HNIA 4KPYA 3ISZA 1EETA 1GAOA 3R2DJ 5HP1B 2HSEB 2NLWA 2GGPA 1RBOB 3GR1A 3NCRA 3THPA 4DG1B 1RK8A 2AHOB 3V81A 3IS9B 1SVDA 1RACB 5DQHA 4YOEA 2H54B 4BLGA 4HACB 2NSBA 2R7RA 1DARA 1VLOA 3M8PA 4OLPA 2KB2A 3BQ1A 2R2RA 3KUEA 2AEFA 4CT8A 1S99A 4HVZA 2AYEA 3U7JA 4ELVA 3M8QA 4ENOA 1ULRA 2FTRA 2CQDA 3PKMA 5I3PA 3ILOA 1RYSA 4BWJA 3W8GA 1GX6A 1RADB 2KFYA 1Y10A 5L8RC 1Z1ZA 2LP4A 2DITA 1RAIB 1VQMS 4RWXA 4DV7F 4TLRA 4OX9F 1W26A 2VQFF 2A6OA 3F0NA 4NLVA 1KVJA 3NNHA 3QJLA 4X66J 3KMQA 3P3DA 5A8WA 4MT1A 2OPPB 3BBCA 2QA4G 3JQJA 1C1CB 2FUG9 4IFVA 3NLCA 1FJ7A 5LJ3Y 1U09A 1KSPA 3DYAB 1SL2A 4AL7A 2ZDOA 3BEGB 4DZDA 1NPKA 1FX4A 4V1Ak 1FDAA 4S0MA 4OYXA 3ITHB 2P2CB 4IG0A 5E3AA 3I55S 4WTOB 2V8PA 3C6UA 1X9WA 1U6FA 3KLHA 2ZJRQ 5EUHA 2X3GA 1BD6A 2YNFA 2EFGA 5SZTA 3QZ8A 4OYPA 5IT0A 4TY8B 4YY3J 3PYFA 3WIUA 1U6ZA 3KLIB 4NEZA 2DY9A 1GH8A 4IG3A 1SC1B 2E1PA 5I3UA 1TELA 1XMOJ 2LVWA 1AW0A 5KFFA 4UTGA 5J1NA 1KLNA 4OJ3A 3KJFB 4I0WA 3TNVA 2WVEA 4MKAA 2UVVA 5MAOA 2MJUA 2RUSA 2K1RA 1ZH5A 3IN5A 1UZHA 4P73A 5K8PA 4R8UA 2ZBQA 1LFPA 2CYYA 1FXLA 2AX1A 1TKZA 1U45A 3HHKA 2HHWA 1HBUA 4KO0A 2EPIA 1LK7A 1FHTA 3OXFA 2C2NA 2R8KA 4NA2A 1VQNS 3KK3A 4RKUC 1BHNA 5HANA 4RO0A 2CPIA 3U02A 2DH7A 4RW7B 1Q53A 1AFJA 4IOCQ 3GG0A 1H2TZ 4X64F 2VA2A 1O5JA 3AB2B 3R3TA 1Y0HA 4KBIA 5BYSA 2IIHA 4CLYA 1MU2A 1RTHA 2BJDA 4KH0B 3CJKA 1ZOTA 2CPFA 1AA1B 1QJHA 1TV6A 2HNZA 2DPIA 3GFYA 3K5MA 4LF4F 2FVRA 3EXYA 4KE5A 4U7UD 1G6BA 3G6VA 2O66A 3PDNA 1XNQJ 2FZCB 1KTVA 4ILRA 2KHDA 5HMZA 4KIAA 1QAYA 2B9YA 1M1GA 4JP8A 2GS8A 2IA6A 4N77A 2XGQA 1RAAB 5H9EJ 4U7UK 2OH2A 4NXMF 5LSOA 2MKHA 5GVQA 2VFTA 2BJ8A 3AT1B 4QU7A 4QCLA 4DX8H 1S1VA 3BDEA 3VQTA 5IM0B 3H40A 5K9FA 2PIIA 2YKNB 2RHSB 2XTJP 4G1PA 1Y4ZB 3QAUA 3TAQA 3W2WB 4KH1B 5F8LA 4ELUA 3PEHA 3JSRA 1NK5A 4F4KA 4KV8B 1BXNA 3A1YG 1TUVA 5KT5A 3TANA 4WCEQ 2AZ1A 4IRCA 2VV5A 4K8RA 4JV5J 5J2QB 4O3QA 3DC2A 3TZXA 2IYIA 1SJ4P 1NK6A 5KG1A 2VG6A 5ETLA 2D1CA 2HFNA 2YTCA 2NXCA 4G1QB 2CIMA 3FCWA 1VQ5S 4UF4A 4DQPA 3CSKA 3M6VA 2C2OB 3TVKA 3A8EA 2XBPA 2EXUA 4KQZA 2ACMA 2B6AA 2HFSA 4WU2A 2D74B 1S1WB 4DPOA 4UUWA 3S8SA 1R8PA 3TA1A 4J9KA 1NH7A 2ZDPA 1RCOB 7FD1A 2K06A 3BO2A 3ZFVA 3G4SS 1FKOA 2HNDB 2UVRA 3H90A 2R2UA 1REVA 3BBFA 2DGVA 1VRTB 2ZBIA 2XG8A 5KFOA 3I0RA 1B99A 4ZA1A 4IO1A 1UKUA 1FO1A 3SBMA 2BJ3A 2GC8A 3M30A 4M63A 5DM7Q 1L3KA 1N5YA 2G2YA 1CBKA 1LXJA 3JTPA 4QW9A 5FJ4A 3TW0A 1TFWA 4K50A 3J81j 3JXOA 4NI2B 2KHCA 2LXIA 3VZHA 1UFWA 2E5IA 3MR7A 2W4CA 2ACYA 2X51A 5IQQA 1Q0NA 2D3O1 1HD0A 2CQ2A 2DHGA 2W9AA 3EPGA 3QJPA 1X7VA 4ED8A 4K4ZA 1T3OA 2J9DA 2M5YA 2FVCA 2O5DA 2C28A 2XYPB 1C0UB 3CD6S 3OR1B 3M1VA 4FXVA 2A10A 2KTQA 4NA3A 1MWQA 4Q8EA 1F9HA 5JVHQ 3LO3A 3K89A 3PYDA 1SJFA 1O0PA 1JLFB 1KD1T 1YRTA 1FCAA 2ZC3A 3M2RB 4C48A 4GO5X 2CA9A 5I3QA 1TL4A 1CJTA 1EQMA 1VQLS 1QAXA 4NL5A 1DURA 4C3MA 3SYZA 3SV3A 4HDGA 3M4XA 4UOGA 2M8DB 4C97A 1N48A 4X4RA 2XLKA 4KHRA 3E51A 4ZVPB 3OPKA 2HZAA 1RHJB 4QYZJ 4MFBB 4B3RF 4YDXA 1FRIA 4LBIA 1YJ9S 2JHEA 3VAHA 3RB3A 1IR0A 3FNNA 1UPPA 2H5IB 2XY6A 2A6MA 3PZPA 3UR0A 3DXSX 3PEJA 1VC5A 1LV5A 5B0DA 2V50A 1X4AA 3K5OA 2RRBA 2MZRA 2QX0A 4IDKA 5JXSA 4O4RA 5IC6B 4CLFA 1DFDA 3HJVA 4PG6A 3RB4A 4FYXB 3ZZOA 5K8OA 2V4JB 2L48A 2VA3A 4ED5A 5D78A 2OHDA 2UUAJ 1QTNB 2PEHA 3OV7A 2DNYA 2KU7A 3KYLA 3AD7C 4RNOA 4M8LA 4JI4F 3ETMA 5RUBA 3KHRA 4LQ9A 2W9CA 1OY8A 1CC8A 3A8KA 2E44A 1S0MA 3CDUA 3QT5A 3P8BB 3QZ7A 3QT6A 2DHSA 2C3PA 1JX4A 1U0SA 1GMUA 1I94F 1GT8A 4RWWA 1NAQA 2CJYB 1L3SA 3MHYA 2WSEC 2RAQA 1KLMA 4FYVB 5E5NA 2UZAA 3EDRB 5GAEI 4DV6J 5C2GA 4B9UA 1QVFR 3G6YA 3CD5A 1CC7A 2ZM6F 3KK1A 5A6PA 2Z2LA 3GFZA 3W62A 2BJEA 3C14A 4X65F 4ED1A 3W8PA 3JAMY 2B5JB 1OYEA 1IKXA 3NGKA 5DDOC 1F1BB 5LMNF 3J81U 3MXHP 2KG1A 4DWIA 2WCXA 2P6SA 2HQGA 3PFOA 4LQ3A 3PV8A 5D8HB 3FKBA 4ZN3A 4QBUA 5AT1B 5LOQA 1W25A 1K1SA 1KKHA 2PE8A 1FK9A 1SJQA 3C15B 1RLDA 2CNOB 4DV4J 3OW2R 1VRQC 3NBPA 2R8GA 4NLGA 3MMCB 2DT9A 1F5BA 3MUVP 4EYIB 1J27A 1R6YA 2IC3B 1FDDA 1DTQA 3ISNC 1URNA 4DMZA 4EMDA 1X9MA 3MFHA 4C2MA 1UVLA 1YRUA 4DU7A 3K5LA 2C2DA 4IH7A 3PRVA 1NU4A 4RLEA 2FJWA 2FC9A 5EWEA 1WDTA 1YJUA 1FRMA 2Z30B 4CO3A 2G2OA 1U1RA 4LIWA 1SC6A 2H9ZA 2PMHA 4BDPA 3AJ2A 1O51A 3JSMA 2X3DA 4HHUA 2HNYA 4LRDA 2HZVA 5LSRA 3AQOA 1FXDA 1H7XA 2HS4A 1O6XA 4M5MA 3C19A 4E0DA 1A0OB 1DZ5A 1XWLA 5DG9A 5J1EA 1TK5A 5E3PA 4YB5A 3J7YI 2E5LJ 2HS0A 2FVQA 2FLNA 5CCMA 2H5JB 4JI7F 4KKOB 3TQEA 2AEJA 1H2UX 4K5RA 3MZIA 3BSAA 2D3UA 2BEFA 4OI2A 4CLSA 1OPZA 2UXCF 1C1BA 4Y2IA 4RW4A 4J9PA 3LPEA 2OKQA 3GU0A 4RNFA 4O3PA 2N3LA 1FNOA 1P6TA 1MN7A 1OIAA 3HSZA 5L39A 2MKKA 3H5SA 4M1KA 1RAFB 2XYGB 4I1TA 1CJUA 1WI6A 4C0HA 1DQ8A 4DR3F 4DR7F 1Q5YA 3TRGA 1PO6A 1Q7LB 2FJXA 4B9VA 4N76A 4DR6F 3AD9C 2RQ4A 4RBVA 2XGPA 3QIPA 3PW4A 3HSGA 2KI2A 2HNDA 1SKWA 4Y00A 2DGTA 3LALA 4K0KJ 3NCPA 2EEYA 1T9UA 4FXWA 3ELHA 1D8YA 1N6QA 1S0OA 6FDRA 4ZVRB 4B17A 4DV3F 3GPAA 2JNJA 4CLUA 3N5FA 4C9DA 2CZ9A 4OX7A 1VRUB 4OFZA 1VOMA 4ECSA 3BKFA 2MQPA 1JKHA 4YMEA 1DHMA 5K8MA 2CPEA 2DR7A 2W24A 3OXLA 2JX2A 5C25B 4F0HA 3W5YA 1S1UA 3R7NB 1WHWA 4OX8A 4U8VA 5C7PA 4F04B 2G4BA 2HIYA 2VKRA 1UW4A 2XNRA 2UXDJ 1TL1B 2IM3A 1RTDB 3CVKA 1RWUA 2IPOB 2IRYA 4B9TA 1RT6B 3ONQA 2BOAA 4QWDA 1KQKA 3R5AA 3HP6A 1URRA 2KZMA 3TI0A 3JB9k 1VDHA 1S6UA 2UUCJ 3FCVA 2IM1A 4F8RA 5M2UA 1VQ7S 5KFQA 3LAKA 2W9BB 4IR9A 2WB4A 5C2CA 1IUJA 3MM6B 4U95A 2H48B 2DR9A 1S1TB 2ZBRA 2V6AA 2LCWA 3CCQS 3MDFA 2F9DA 3BGRA 1OJ4A 1BQNA 2KT5A 2RSQA 3HD2A 3KMSA 3HK2A 2HVHA 2V68A 1PC4A 1CJKA 1X5OA 3CMAS 3QBCA 3NP5A 3W9IA 2QRRA 3MEGA 5JUMA 3EZ5A 1R3NA 3BPDA 1D3WA 4RNMA 1TKTA 1JIHA 2CWKA 4CM0A 1B64A 2WVCA 4DU8A 4HL9A 3LP2A 4NLYA 5T7LA 2FVPA 1AUSL 4I64A 1FFWB 4WWSA 2LXUA 4DQSA 3OUYB 3DLGB 4B9NA 4USKA 5IWAJ 5J1PA 5HLFA 1KQFB 3MEDB 3KG1A 3HPOA 2LU1A 4ZKAA 4I2PB 3OTOF 1FRHA 4YDDB 2V63A 4G65A 2ABYA 3QYYA 2J5AA 2HQCA 3BJYA 2G0CA 2BE7D 1HNVB 2HS3A 3QO9B 4H4OB 1NB2A 3WHIA 5C24B 3KUHA 2CJXB 4NLSA 3QGGA 1N56A 1SC4B 1NK0A 4KFBB 1T03B 1IR2A 1R31A 2QLWA 1VQ6S 1JLCA 1IQZA 3CCRS 3CCSS 1E6VB 3NS6A 4EI2A 3PRBA 3IRXB 2DYAA 1HW9A 4QPTA 1VIXA 1UA0A 2A18A 2C3OA 2WK4A 2DGXA 1QUVA 4DUYJ 1VQ9S 4P7TA 5KT4A 2C3UA 1LW0A 4Z2XA 4N8NA 1NK8A 2X1GA 2DISA 2LQJA 3QT7A 5H9FK 4ID5B 2SXLA 3OXGA 1UW9A 4BC7A 3GLJA 3NKYA 4ECRA 1WC6A 4N7TA 1H98A 2BJ1A 4KGMA 1TL5A 1CS4B 3DM2B 3P6YC 1D9AA 1TKXA 2AZ3A 3KJQB 4TYBA 2IJNA 1Y3JA 2VBYA 4RUHA 3SCJE 1XMQJ 5E3RA 4IO9Q 1H74A 2G0JA 2XZTB 1RT7A 2I2YA 4UUXA 3D0GE 1LNQA 3G82A 5E2QA 4YR3A 2WTFA 1CJVA 3CD7A 4CYUA 3KLFB 4Y2AA 4DQQA 4DCJB 1BC6A 1KEKA 1OWXA 4X4VA 1IKVA 2YKOA 2BA9A 1LXNA 2A2DA 1NJXA 2QFJA 3J7A1 1S7IA 3W60A 2B51A 2XMJA 4GKKJ 1NJIT 1U6BA 3UD4P 1NM2A 3DU6A 3PCOB 4QWEA 4DL7A 1V3RA 2F4FA 1KN6A 4YR0A 2UVUA 4B3SJ 4Q44A 1TL7A 4FDFA 2XHWA 4YHHF 2QMUB 2F63A 5K14B 3I5CA 3OLBA 3E01A 1LEOA 5DDQC 3UN2A 4X66F 4F3OA 1WD6A 4HTIA 2UU9F 2QL7B 2APOA 1VBXA 4M5JA 2J8SA 3I0SA 1TAQA 2QEXS 3POTB 3M2VB 1UL3A 2B9EA 1RZMA 3BREA 2J6TA 1WSRA 3QRRA 4YS2A 3EMTA 4JI5F 2B9WA 1GMWA 2ZBPA 2XMUA 2JEGA 4DSJA 1TAUA 3V6DB 2M88A 2QSFA 2IAJA 1PAEX 5GAGU 3OTCA 5GAHU 3QNWB 5HO4A 2R42A 2HHUA 3IXQA 3L95X 4DFMA 2OAUA 4DV5J 1NZAA 3B54A 2YH1A 3V4IB 1WELA 1D09B 1JLQA 1AFIA 2XSFA 2HFVA 4ECQA 1M5VC 3N6MA 4ZP9A 1Y5IB 2ZJQQ 3EVOA 3HT3A 4DEZA 1KVKA 2WZ1A 2DIVA 4AYBD 1D0EA 3NOGA 1RT5B 4N56A 3HD1A 1K8AT 1KS2A 4X4OA 1HQEA 1G3OA 4DV2F 3D6HB 2XI3A 3DMJA 3UD5A 3PX0A 4CLKA 2M0GB 1K0VA 4UZBA 3LP0B 4A46A 3QLHB 2RQMA 1FRJA 4RW9B 1H3DA 3RAMA 3A12A 1FNXH 2CZVC 2ALZA 1FESA 2CJAA 2K2PA 2F8EX 3UNYA 4WP3A 4WXWA 2YPZA 2CQHA 2QLFB 1RAHB 1RISA 4ZJOA 2HMIB 2P6TA 4OZNA 3C8YA 1RKJA 4M5DB 4DV7J 4I67A 2DNOA 3MM9B 4G1IA 2VQFJ 3EGWB 4J9SA 3D54A 2UXBF 4DL4A 2VDIA 3QJJA 2WVFA 4QQBA 7FDRA 5IT9U 5B0AA 4IQMA 2E7XA 4EZ6A 3EVMA 2ZH8A 3JQKA 3A3OB 3OJUA 2WRMA 2I8EA 3W66A 5E3CA 3CC4S 1RGVA 2EBGA 3SV4A 2ATCB 1N5VA 3UDVA 1T7PA 2BE2A 3O8WA 3ENWA 3BKTA 2BKOA 1FJEB 3KLEB 3HM9A 1XR5A 1S4EA 4JI2F 3M8WA 5AXKA 2A1BA 4C7QA 4ZCKA 4ZVSB 3R7BB 3IM9A 1YJTA 3PJWA 3T9NA 4Q2LA 4QWBA 4GVBB 3NGUA 1RT2A 2Y1JA 1ZAXA 3O1LA 4AXIA 2IM0A 3HHEA 3EYZA 1ITPA 3P5TL 3GIKA 3HVTA 5LMUF 2NR0A 1EARA 5A8RA 3UE2A 2VOOA 3VQSA 1GK8A 3LTOA 1ZTWA 4USIA 3QSIA 1XJWB 4WE1A 2R2SA 1P9YA 2AT1B 1YZ7A 3M32A 3VV2B 1C2PA 1SIZA 5JVGQ 3OFGA 3PX4A 4RU9A 3SI8A 4DL2A 3MAQA 1UETA 1NBEB 1NKCA 4TN2A 2WOMB 4NYPA 1RYRA 2W4DA 3DGPB 2ZNZA 2HGLA 1BQMB 4CQ1A 3I5AA 3PIOQ 2IMWP 3MM5B 2VG5B 4JV2A 4CO0A 2ZH9A 4J9RA 3LPYA 2UUBJ 1RHMB 4GMKA 1S9EB 4PZVA 5C5JA 2GCFA 4QR2A 5FLXY 4U67Q 4HYKA 3HHLA 3M9MB 2CNLB 3M6UA 4K7QA 3FEZA 4E98A 3QWUA 2V4RA 4NCBA 1TL3B 2RT3A 1R0BG 4IOBA 4NZ6A 3P96A 3RBZA 2VASA 3IR6B 1HD1A 4DL5A 4LF4J 3FBBA 4RW8B 5LM7E 1SBRA 4R0EA 3KNGA 1XTZA 1ZAWA 4LBHA 4Z37A 4Y6IA 2BACA 1QM9A 3PRDA 1S6PA 2RB7A 5C42B 1EJ7L 4CLTA 4QWCA 1UVKA 5AE2A 3NWGA 3HHLC 4PKDB 3UWTA 1XN9A 2D41A 3T1YF 1U26A 2OPQB 3C6TB 2ZEJA 2VH7A 5B0CA 2EKYA 4NXMJ 3DLEA 1WKJA 3EPIA 2ADCA 3CE8A 4ECYA 1VQ4S 3T5KA 4PXBA 2EK1A 1C4CA 1V9OA 1RTJB 5HATA 5KFKA 1Y7PA 2RQKA 4U8YA 3SCLE 1RWOB 4C98A 4MIAA 3SEOA 1LW2B 2H1YA 2VONA 1LQ9A 3PNIA 3K58A 4OZ5A 2YWEA 1SQEA 2H4YB 1E6YB 2M4MA 1I3OB 4ILLA 5DZ6A 2WW4A 5F0UA 1VFJA 1DRZA 2R7SA 4ILMA 3EICA 1YGYA 1M5OC 2RD5C 3Q8UA 1S9GB 3HCXA 2B0GA 2L41A 3Q8RB 5BYQA 4P52A 3KLGB 2EWHA 5IOLA 4L76A 4HI2A 3PX6A 1GTHA 4ZCMA 1HKAA 1U7LA 2N4DA 2LQ9A 4F4AA 3ET6B 4KY3A 2MMYA 3FFIB 4U9RA 4CNYA 3ZNJ1 4OYMA 3G87A 3UR3C 3DCAA 1ZPWX 2ASYA 3PHEA 3MR5A 2CQCA 2OSQA 3Q8PB 4XK8C 2YNHA 1MN9A 2HFUA 5IV4A 1VQPS 4TKTA 1KWMA 2DJWA 1DQ9A 3IAM9 3LH2S 4A8MP 4JBCA 2FLLA 4DL0C 2HZCA 3GV7B 3D66A 5CH7B 4KGZB 2YX4A 2W2NP 3DRYA 5A0YA 4ZPCA 3TVZA 4O23A 1U2RA 2MQQA 2Q66A 2MHNA 3IAS9 2U1AA 3D1HA 3H2VE 4X4TA 4DX6A 2RMLA 1FI4A 3LA0A 3K5NA 4ZP7A 3QPIA 1LWEA 3M8SA 4F4ZA 5ETPA 1DBDA 3IRWP 3DOKB 3T41A 2KXNB 1DJ0A 3SDEA 4MK7A 1VLYA 2MQ8A 1EAYC 4AL5A 3ULHA 1SIWB 4MIBA 4ERDA 1V5VA 5G0RB 2Z2ZA 5J2NB 1R8AA 5KFHA 1WKKA 1GXUA 5KG2A 5HBMB 3B6BA 1X8DA 1ZZFA 1C0TB 4QOTA 3IFEA 1SKRA 1RWPB 1UJ4A 4DR5J 4JI1F 2YBVA 2VG7B 3BYRA 1WI8A 4B3RJ 1WHXA 4OZ1A 3EGVA 4CLZA 3OD2A 1U0HA 2IFXA 1UWBB 3G8QA 3NMRA 3OR2A 2MZTA 4JV0A 4EBCA 3OLAA 2EG1A 4LJMA 2YWWA 4ZLNA 1HNXF 1FTCA 2VDHA 1RT4A 1UPMB 3PW5A 3NGSA 3VAMA 2WBRA 1SJ1A 2EFQA 5E41A 3Q8QB 1WACA 4LREA 3S01A 3J80U 4GC7A 3J81Y 4ZPTR 4WF9Q 2V34A 1P27B 4DCOB 3VAJA 1U1NA 4OQJA 4JI4J 4A4JA 2AEMA 1M90T 4IYQA 2XNQA 1JNZB 4MK8A 2YQ3A 2HHVA 2KFNA 2GJ2A 4I7FB 1UZDA 5AE1A 3W2VA 1UP1A 3CCJS 1I94J 1TR0A 2CQ4A 1YTYA 1XR6A 1SC3B 2JC0A 2JH3A 3UVJB 2GAGC 2L3MA 3V6JA 2XY5A 2MZJA 2ZZMA 5ETNA 3IBFB 2IBKA 1TUGB 3RAXA 1R43A 4NLUA 2ZM6J 4OYOA 4OLOA 2F5GA 1IBLF 4LFAF 5GADU 4UY85 1PJ7A 3GWCA 4ES1A 3CWJA 2NXEA 1VQ8S 2GVDA 5LMNJ 1RTIA 3TUPA 1VQYA 2GVZA 1T9VA 1NXIA 3ILJA 3Q24A 3CCVS 2CJQA 3IG1B 4ICLB 2VU5A 2F65A 1HWLA 4U6PA 2NXNA 1TVRA 2WONB 1N33F 3QIDA 2CJKA 1OS5A 1CQMA 2CUYA 3P5BP 1YJWS 4ID8A 1Y5LB 1J5OA 1N34F 1V6HA 4IFYA 4P72A 1F3VA 4NEYA 3L9ZA 4YB1P 2NUUG 2POKA 4RL1A 5HQMA 3NG8A 1HNZF 1TK0A 2EC0A 2DH8A 4M5NA 3UDEA 3LANA 2CQPA 3VAIA 4AUKA 1T9XA 3HVAA 1FX2A 4ZHRA 1DAXA 1JLEA 3W1YC 2KJWA 4ZLJA 1U1KA 1ZM9A 3R27A 1T11A 4DX5A 5D15A 2HG4A 3BQ0A 2R2TA 3PTWA 4OL8A 3E8OA 2UP1A 3ZZPA 1TMMA 3V4MA 1NPPA 1T9TA 2IMOA 3MOZA 3RRGA 3SQGA 1FXRA 3TX0A 4F3QA 1JLBA 1ZA1B 5F8JA 1OY9A 3UCGA 4OYWA 2ZHOA 1F9FA 3FMWA 4MJKA 2BKNA 1NDKA 2WB1D 2HHSA 2KKHA 1H7WA 3CC2S 1X9SA 2OELA 4ECZA 1JQGA 2UXDF 5D6GA 1HR0F 4PQUA 1UTAA 3K5PA 4X4NA 3CD0A 1KFSA 2IVFB 2G1HA 3GTYX 3VR1A 2BQRA 2KG0A 3QATA 1SJRA 1Q78A 3IBWA 2UUCF 2QG9B 4JI7J 4L3KA 3N6LA 4YUDA 1YRXA 5AJ3F 5ETSA 1FE4A 5KFBA 2YY3A 4IOAQ 2CADA 2J7UA 2GNKA 1WTBA 2QMWA 1CG2A 1YLXA 4DCPB 4N5SA 2UXCJ 4ZJLA 5I42B 2M3DA 1LW2A 2VD3A 2RE1A 2FB0A 2DGWA 2E5GA 3THTA 5T14A 4X62F 1N32F 4HDHA 1Z2ZA 3MGJA 2LEBA 4FPIA 4LSLB 2DBBA 1QD1A 3PR4A 3F44A 3GJQB 3AAWB 2I0XA 4I2QB 1EHWA 3CCWA 2GZOA 1EIYB 3TEGA 4LSNB 4PUOA 2BANA 2LQ8A 1RAJA 2CQBA 2QA1A 3BBBA 1WC5A 4DR3J 4DR7J 2CQ3A 4NCAA 2IHR1 2NSCA 1CULA 2YXLA 2VHGA 2R7UA 1T05A 3K0JA 2DD8S 2WVBA 5HROB 3ETOA 4YQWA 4DR6J 1X5PA 2RJZA 4KRWA 4HTJA 1YZ6A 1HBOB 2DXDA 3U1MA 4OJHA 2NREA 4DJBA 4DF4A 4LRAA 1BQXA 4RJVA 4ZP6A 3GG1A 1Q5VA 3O44A 2VPYB 5KOWA 1RBAA 5HMWA 3Q0AA 2F9JA 5J2MA 1FVQA 2MB0B 1FKPB 4DV3J 3GYGA 2N3OA 1HHQA 2IVYA 3KFWX 3MEEB 4CH1A 3DXBA 3IR7B 1DTTA 2YNGB 4KGXB 4ZITA 1IKWB 2LFVA 4B3OB 1ZA2B 1TQLA 5U47A 2FHOB 1YQHA 4JI3F 1RP5A 2RHQB 3MAAB 3N79A 5CYMB 2OPSB 5J2PA 3GYXB 1RAEB 3KXDA 2ROPA 3MMBA 2ZH4A 1RABB 3NCQA 3TOQA 3MM8A 1SH2A 3KJVB 1U2FA 1MMLA 2FHJD 2M8HA 2GIRA 2C2KB 1VC6A 5L9XA 1PGZA 2YKAA 4F02A 2UVWA 2IDLA 2MGZB 4MK9A 3LWLA 3MUTP 4L3NA 3K8WA 3SQOP 2ZH5A 1XR7A 3Q86A 4F4YA 1WOSA 2J8AA 3OVBA 3MPYA 4NCGB 1QLNA 2ERRA 4FN5A 5CYQA 4KC5A 4N41A 2W01A 3G8SA 3CUNA 2FC8A 4DR4F 3N0VA 3MTJA 4ER8A 2VFRA 2Y1LB 3OFFA 5K5MA 2D9PA 2LKZA 2XWXA 2DB1A 2FLOA 1HBMA 2HHPA 1W2BR 3RGIA 5LL6d 2R8HA 4WFBQ 1X4EA 2MKCA 5L46A 1KOOA 4HKQA 4F4XA 2ZHAA 5E7OB 2HQFA 5BR8F 4KTQA 4P71A 4NE9C 2VFUA 4DPXA 3OTOJ 2QJ3A 1RT3B 3BGUA 4WPAA 4DLGA 2ROGA 1FKAF 4AXJA 1S12A 3SSRA 5F3ZA 2BX6A 2RF2B 4Q2MA 2ZHBA 1S49A 4NX9A 4TXSA 3B78A 4H4MB 4DI6A 4ZLPA 2FJVA 1OQ3A 2Z56B 1K9MT 2A3JA 3JYTB 4JI8F 4OYZA 4C8OA 4DUTA 5D4NA 4YEAA 1VHFA 4WFYA 2DHXA 1HIYA 1PJ5A 3MECA 1HWJA 3OSNA 3DLKB 2XZWA 2OD4A 4XTTA 4O4GB 4K4YA 1S6QB 2ZBCA 4ED7A 3VGVA 1Y11A 1VGYA 1HWKA 5KFJA 1AZSA 2COLA 2KO1A 3RTVA 1V3ZA 2IJRA 1VMBA 1NRKA 1RWMB 2OMLA 2J6UA 3AB4B 4HI1A 4C0OC 3N4WA 2ZE2B 1SUQA 2QLXA 1QE1A 3F73A 1Q86T 3TAMB 3A3NB 1PCAA 1Q8BA 2M52A 5DO2A 3HSDA 2FVSA 4DR1F 4ITSA 2MEWA 2V8VA 3M6XA 3AXMA 1WG5A 1TU0B 4QWAA 5MLCV 1S57A 3O5TB 5IXUA 3DHWC 5DRKA 2IM2A 2R9LA 3UFCX 1YX2A 1Q8KA 1X4BA 3AOAA 1IM6A 4OJ1A 3EGZA 2OGUA 5FDLA 5LJ5Y 2FPHX 2Y0SD 4FYWB 4ZVFA 4LSZB 3LF0A 1JLGB 2FZGB 2HBZB 4C8NA 3TJAA 3ZO7A 2DPJA 1S76D 1XEZA 2PT0A 3H59A 4M5IA 2NZ4A 4P2XA 4GKJF 3C16A 4YHHJ 2HGMA 2XSJB 2CAJA 1WOPA 1LOUA 3M8YA 2IDEA 1FWPA 2R8JA 2CZ4A 3I4PA 1HQUB 2UU9J 3H5YA 2J0XA 4A8WA 3BO4A 1JWWA 1RU2A 2N4CA 1RKIA 1H72C 3EX7B 4LT6A 2DGQA 3MM7B 2GO9A 1RI7A 3CJTA 2F40A 5A8KA 3QFHA 2QSWA 1R0AB 4RW6A 4JI5J 2XC9A 3MTKA 2YQ0A 1ZS6A 2HWIA 4LF9F 4V19X 3ENVA 4I68A 3AA9A 1FT8A 2K3IA 3GZ7A 2BR0A 2Z57B 1DLOA 3R1LA 4UZCA 3I82A 3PW0A 5CZVA 5E3QA 4Y2MA 3PKYA 5H9FJ 1VQOS 1F5CA 2ZH3A 4ZDNA 4B3TJ 3M2UB 3I4HX 2JVRA 2ZOFA 3K57A 3KG0A 2V67A 4A8YA 3BGLA 3L09A 4PQAA 5IT9Y 4M5HA 1RJJA 3CJSA 3MMAA 2MZQA 2VODA 2GHVC 2I5JB 2Z2MA 4WIQA 4C6AA 3OFEA 3DRSB 4DV2J 3O6QA 3S6EA 2H3EB 3GJSB 3PACA 4MKVA 4PWDB 4XPCA 1ZTTA 1SI9A 8AT1B 1D1UA 2XCPA 4LSLA 3QAEA 3ZNUA 4J9QA 2DXEA 4F2RA 3ADAC 2QGFB 4DHVA 5D0HA 4K4XA 3TZZA 2HBQB 3V6HA 3VGUA 2ZH1A 4V19J 3NGRA 4FF3A 2DNLA 2IJFA 3DRRB 2UUBF 2F8HA 1IBMJ 2MKYA 4ZJQA 4UW2A 2RKIA 3D7SB 3DRXA 1JXEA 2E9ZA 2Y0BB 4YB7A 2NYIA 2ZD1A 4FPRA 3EWGA 4Y2CA 4LF6F 2OFHX 2GJIA 2PGCA 2ZOGA 2QZ8A 1LWCB 3BKUA 2FJBB 2V5HG 4EFAC 2UXBJ 2U2FA 2DHAA 5KFLA 2CPJA 2P5VA 3QGIA 4J9UE 5IV3A 3IP0A 3MD3A 3NGDA 3Q8SB 4JI0F 2YQ1A 2VUGA 2MY7A 2OPRB 2KZZA 2QV6A 2B4VA 2AF6A 2BRLA 3VCDA 2LQ5A 4AQYF 4PXCA 2YNIB 2DNNA 2VPXB 2VC1A 1NSPA 5L1JA 2EC2A 4JI2J 5ITHA 2YWKA 5IS2A 3DOLB 1GMVA 2OPSA 2AV5A 2GHWA 4Q0BA 3SCKE 3AOCA 4DR2F 3DOMB 1MROA 1RT1B 3OBIA 4J9MA 3F41A 4B08A 2YKMA 3X1LB 3UN3A 3QRQA 4C11A 5A6WA 1W7WA 5HQLA 1SJ3P 4DPUA 1GXLA 2MZ1A 3OTDA 2K3KA 2ZOMA 2PC6A 5LMUJ 3LP1B 4MYTA 1HPZB 3GCXP 3DRPA 1FVSA 5DLGA 4LRFA 3PM9A 1FFSB 2X1BA 1KONA 2DGUA 3RB6A 4R5PB 4DPTA 3FZBA 1XERA 1M0SA 2VZ9A 2XB2D 4AL6A 2KH9A 5EX3A 5KTQA 4O44B 3OL6A 1EP4A 4WTYA 3V6KA 1RSCA 5EN1A 2DNMA 5B0EA 3P45B 3GV5B 4CTAB 3PIPQ 1RHUB 4NASA 2DNGA 1S9FA 5FIIA 2GJFA 3VZIA 4URSA 5D3GB 1X4GA 3RYLA 4WP9A 3UPFA 4ZIVA 1JNRB 3HFVA 4USJC 3V5RA 4CDIA 1IKYB 2WHOA 1BGXT 3JAMU 2C2MB 2ZZTA 3GB0A 1HBNB 5KG0A 1HYSB 3DI6A 4DQRA 4N47A 3UO0A 4ETXA 1BMQB 5EX0A 3WIVA 2XULA 3BR9A 3FBCA 3TYTA 2VBWA 4QIEA 3CMES 2V69A 4O3NA 2M7SA 5JJBA 3K7RA 5GAEU 4TU9A 2V8HA 1S5ZA 4LF8F 2VPZB 1PC5A 4I6YA 1Z2LA 5B09A 1JLAA 2VBZA 3MEKA 4X4QA 1M5KC 1VCTA 3TJ8A 2BABA 2N7CA 3CB4A 2PMZD 1HNIB 2BJ9A 1LWFA 4IR1A 2DNHA 4DFPA 1EETB 1Q82T 3T1YJ 3VGTA 3KK2A 3ZZ0A 1U8SA 2GGPB 5DGAA 3V81B 2R4FA 4J9NA 4NZ0A 2PMWA 1S1XA 1XIQA 3I32A 4C8YA 3M8PB 3DLHA 2P8IA 5BXIA 2CG4A 1JJ2R 1N54B 3UNGC 3OT9A 3GCWP 1OYDA 4DFJA 3M8QB 4BHQA 1KHVA 2QTWA 5HP1A 5KAKA 3PR5B 3A8JA 1VK3A 4K4UA 1PYOB 4G3IA 1YJ7A 4DG1A 4DR5F 3IS9A 5F8GA 4W92B 5B0BA 3D9BA 4KHMA 3T19A 1U1QA 4HACA 3MF5A 3RUBL 2G2ZA 2I38A 1BWEA 3FRYA 4WK1A 4LF1A 5DQGA 5KT3A 2HFOA 5CHCB 2H51B 4L6V3 2EFPA 2HHTA 2MJNA 3PHTA 5CD4H 3GR0A 2HVZA 5A8WB 2DCLA 1LK5A 3W65A 2DRAA 3UI3A 4MAKA 4IFVB 3I9V9 2CRLA 3VVTA 5DLFA 1EQ0A 1K0TA 1RWWB 4FZVA 1M5SA 3P4UB 4K4WA 1JXVA 1T95A 4I4BA 4K59A 4IG0B 3J7YU 2GQQA 4B3MF 2OPPA 4CT9A 3H42A 1C1CA 2XWYA 3UDCA 3C6UB 4EK2A 2HAIA 3I9ZA 1B7YB 3KLHB 4F0MA 3PJ9A 1XBWA 3DYAA 2LU2A 5LSLA 2J7WA 1YSJA 1SCJB 2ZFHA 4C3LA 2MQMA 2YNFB 4O3SA 5I4MA 4LF7F 4QYRA 4NRUA 3KDOA 2RH3A 4IG3B 2XYHB 5I3UB 2YWGA 3EVWA 3ITHA 2LMIA 5KFGA 2RU9A 3SFUA 2BM0A 2IRUA 1T9WA 2F4VF 4RUAA 3CJ3A 5A2QY 1EB0A 2DH9A 2V8DA 4M5LA 2K1RB 3NL0A 4ZIWA 3R5DA 4R8UB 2FJEB 3IWXA 3CPWR 1TKZB 2PI4A 4LR9A 3NRBA 1KC8T 4QJVA 1HBUB 2ZVIA 3NAIA 4KO0B 2RVJA 4TY8A 1H0HB 3KLIA 4ES2A 1HI8A 4O0IA 2QLBB 1IVZA 4DSFA 2VL1A 4ALZA 3KK3B 3PW2A 3D68A 3FRZA 1PG5B 5F0WA 1EZZB 3CCMS 3KWMA 2MHEA 3ILLA 4X4UA 4JI1J 4OV1A 1IJFB 1WJ9A 4ECXA 2DVIA 1D9DA 3CIMA 3EUNA 4CO2A 1MU2B 1GFWB 1CEZA 4B9SA 3SFGA 1RTHB 3HT0A 3KDNA 3CJKB 1I51B 2DK2A 3FQLA 1YI2S 1UEKA 2HNZB 1TV6B 1IBCB 4USHA 2YX7A 3FEYB 1KFDA 2QA4S 1UMJA 2XI2A 5A76A 2W25A 3BR8A 4RW7A 1LWXA 1HNXJ 1K44A 1X5SA 1NHUA 3HJFA 4OI4A 1U24A 3I31A 1MMNA 2E66A 5D0GA 4PPZA 4Q8FA 2C2EA 1RA7A 2R7OA 3W7BA 3CULA 4PXEA 2BZ2A 4DSIA 3A3PB 1HFEL 2PDAA 3R5CA 2MLXA 4C8LA 2CNKB 1GX5A 2AP6A 5F8HA 1UEUA 1NPRA 1PAUB 4AD6A 3B4MA 2X1FA 3T1HJ 1MWYA 2RDJA 4FF2A 4PYAA 4HEA9 1YBAA 2ZWPA 1Q95G 1FJCA 2VG6B 4PG7A 5CA5A 1ACMB 3EZOA 3IGNA 2M70A 5L38A 3WX8A 2BE9B 5IM0A 1R8HA 2MSSA 2QL9B 2JFDA 2YKNA 1KQGB 1IBLJ 4LFAJ 2B6AB 3CJ5A 2LYVA 1I6JA 3W2WA 4CH7A 4KV8A 4B9MA 5EDWA 2NXUA 3QGHA 1BY9A 1F6TA 3QQCD 2NQPA 4RBUA 2E1AA 1FKOB 3LQVA 1S97A 1OO0B 3IC1A 5DG7A 5J2QA 1REVB 3DDIA 1GTEA 5HSPA 2V4QA 3I0RB 4IH5A 3EDQB 4G1QA 3LGHA 3S7RA 5T41A 3M30B 1N33J 2XMMA 1N5YB 1PKUA 3CDBA 1X4DA 3J7ZT 4ZVGA 3DGVA 4DQIA 4EZ9A 1N34J 4J9VA 1IN0A 2MKSA 2B8QA 2OLWA 1S1WA 1NNDA 1HNZJ 1U4BA 5DG8A 2R7WA 2XEXA 1KP6A 3EXCX 9RUBA 1H6KX 1VRTA 3T5JA 4ZS6A 2OUGA 5HK4A 1ZM3A 3MD1A 1NB7A 2XMKA 3BH7B 2M2BA 3M1VB 2C3MA 1N0VC 1P8GA 4NI2A 1UVIA 3SXLA 1CSJA 3UDLA 2XMTA 4I6AA 3R2CJ 3GJRB 4QIVA 3CNQP 1G4CA 1CJTB 3WC2A 3TZWA 2D69A 2V8GA 4BBYA 2IA0A 1HR0J 1JXLA 3T6JA 1VIOA 2UUTA 1Q4RA 4GC6A 1C0UA 1OQ6A 4BS2A 3OR1A 2C2ZB 3D2WA 4DV0F 4F26A 5K8NA 4PEOA 2WW8A 1IJEB 5AJ3J 1RXOB 4HT7A 4CWBA 2HFZA 4HHHA 3OSPA 1JLFA 2CQ1A 3M2RA 2V0NA 2LECA 5HJYA 4PR6A 2HK2A 3CJ8A 2XS7A 1U1MA 2FIUA 2HLTA 3EM1A 2ZWOA 3AD8C 1Q16B 4E2FB 4DZ6A 4X62J 1VK8A 1N32J 2P9CA 2VQEF 2RS2A 3AJDA 1NHVA 2RILA 3GSIA 3N5BA 4PRFA 5DDRC 4QR1A 4USTA 4IDKB 2NCKL 1HMVB 2AIRB 1X0PA 4JB8B 5KFXA 4LFCF 2V2QA 4MFBA 3D1QA 2DCUB 3OL8A 3VWSA 5AXNA 5H1SV 1YBUA 3HFZB 1XQIA 5IC4B 3ISND 2E1MC 4EO8A 3GIJA 2MKJA 2AJ4A 2XCAA 4K4TA 3LAMA 4DLEA 2J9DE 2HVDA 3M6WA 5L1LA 1SL1A 3M9NB 1NDCA 4QZVB 3X3UA 2BRKA 2W9CB 4Y3CA 4KSEB 2KVQE 1WOOA 2AGPA 1WHVA 2ZKTA 4DBQA 2JEIA 3DU5A 3QGPA 3CF5Q 1NZ8A 1YG0A 3LOUA 2C3YA 5KFDA 1TK8A 3GMGA 4XIUA 1S4FA 2IRXA 1FD8A 3GIIA 2CDQA 3T5HA 2V4JA 1KLMB 4CO5A 5L9NA 4HH0A 4JI3J 3KK1B 1WG4A 1HI0P 2NYHA 3ZXWA 2KM8B 5KFTA 3C14B 2FHKA 5L1IA 4I69A 3D6TB 3HFKA 3T5LA 4NOHA 1IKXB 2JRSA 4ATNA 1SV5B 2L9WA 2L9NA 1WC0A 4A8XA 1SH3A 1U49A 5HVHA 2MXYA 4YFUA 1P9QC 1U02A 4CCHA 4F4WA 4C8ZA 3TUJC 2W2OP 2JEFA 1RHKB 4ZP8A 3PYEA 3D3BJ 1N88A 2R3VA 1FK9B 1Y00A 4ZPDA 4Y0FA 3CJQA 4G6VB 4JOUA 1T3NA 3NBPB 3PFEA 4R0JA 2AJ0A 5ETMA 1KQSR 4ZPAA 2B5JA 2QE5A 2BKPA 3ZZZA 2IYGA 2FLPA 1DTQB 2XHCA 2HK3A 1Q8LA 2OP5A 2DO4A 4DR4J 4PWUA 2J9CA 2E5JA 2UV8G 4A47A 2J0QD 2BW2A 4ZPWR 4ED4A 3C15A 1H73A 2W1BA 2QYGA 5B7WA 4OYAA 2JL9A 5ETQA 4TVAB 3MMCA 2QO3A 3SSQA 4FYYB 4H54A 1PBUA 1HHSA 3FSYA 3MCNA 3CO0P 3VAGA 2IC3A 3JSMB 4CLPA 2HNYB 4ELTA 5BR8J 4NRTA 2VFSA 1FEEA 4DDFA 1DY3A 1FDNA 3FZ2A 4IH6A 4LVNP 2OFGX 3Q8YA 2KXFA 1I1GA 1F3FA 4JI6F 5KFRA 1QVGR 4ED6A 2JLFA 3Q89A 5J1EB 2V2VA 4IQXA 4CLLA 1K73T 2I1RA 4TQRA 4F50A 1WEYA 2E7VA 4JI8J 2AMCB 5M2RA 3P49B 2GW8A 2V2KA 2HAFA 4RUCA 3TX8A 2E1CA 3ICLA 4LF2A 1RAGB 3UN5A 5K20B 1RHQB 4M5GA 1S59A 1C1BB 3H20A 2OEMA 4RW4B 5FLXU 4WIIA 4B3TF 4PAAA 1N8RT 3VF0B 4DN9A 3FUYA 4XDCA 1YITS 3HF5A 1X4CA 4FKXA 2BOPA 3FCHA 2MTLA 4KKOA 2DGSA 1CJUB 2W2QP 4OMFG 1F2HA 1WG1A 4P7VA 3CCLS 1D8ZA 4L74A 4DR1J 1Q8IA 1V3SA 4PWWA 2KT3A 3N01A 1GXTA 2UV8A 1NK7A 1BLUA 1WNEA 4ETZA 4WZQA 3QIPB 2W2MP 1S48A 4YB6A 2CPHA 1GEHA 1N5TA 3N9UC 3RBXA 4M5KA 4K5SA 2RU3A 3NGTA 4NWBA 2AU0A 1F9EB 4OI6A 2VBXA 2O3DA 1N6QB 1IBMF 4NLXA 1K1QA 2OIHA 3CW2C 4FKYA 2VICA 5DS7A 4GKJJ 1RDRA 3JSYA 3BPSP 1NK4A 4J37A 4PCQA 1UJ6A 1JB0C 3BS9A 3MI7X 2OD6A 1JKHB 2Q6BA 3ZZYA 1S1UB 4Z7YA 2LDIA 5HAOA 2LQBA 1AT1B 4EU0A 3BSNA 5HVFA 4AT1B 4DL3A 3TAPA 3HHNB 1XK8A 2NPIA 3QSYB 3BO3A 3VVUA 5D4OA 1FJGF 3N6NA 3W3SA 3TVYA 1U47A 2Q79A 2BMBA 2ASJA 3TZYA 1VRUA 2ADBA 4LF9J 4C4WA 1NUEA 2J0WA 2QMXA 5C25A 2VB6A 3HXMA 3QWPA 2ZUAA 1Q81T 2JSXA 3D3CJ 3IWNC 1H2VZ 1HWIA 3M7VA 3BGRB 1PSDA 1TL1A 1RTDA 4A8QA 2HRTA 1RCXB 1BQNB 2HRYA 1RT6A 1RAOA 1R8CA 1KVIA 4EYHB 2B8PA 4ZVOB 5E0OA 1CJKB 1L3VA 2EFNA 3MEGB 3NS5A 3CMQA 1KDNA 2W9BA 4J9OA 1JJHA 4UOHA 1TKTB 3U1LA 4P2FA 3HO1A 1FNMA 2KXHA 3MM6A 1U48A 4A8KA 3LP2B 1U25A 5T7LB 1UVMA 1S1TA 2JVOA 3R8YA 2W7AA 5D4LA 4FP9A 1VQKS 5HLFB 1T8EA 3A4TA 1TKDA 5IZHA 1NKEA 4USWA 3BDPA 4EUVA 3RU0A 1Q7YT 4OHYA 1HMVA 2CPXA 2DRDA 1WWHA 2PI5A 1SXLA 4DSEA 4GO7X 2ILZA 4K2JA 3GIMA 4F2SA 2Q6CA 3HX9A 4H4KA 3G96A 4QIWD 4LF6J 3TWZA 3K2YA 1YKWA 2EW9A 1JLCB 1UFKA 2VJVA 3KNAA 3MURP 3J7Z5 3G71S 3OUYA 2KRRA 2MKIA 3DLGA 1QSLA 3WX4A 3FJ2A 3CJ0A 3MEDA 3WZ0A 1NH8A 2IBOA 4I2PA 2MQLA 4WBFA 3BQ2A 2CJBA 5GMDA 2F7VA 5D0EA 1HNVA 1SH0A 4JI0J 3KLVA 3QO9A 4H4OA 4DUZF 4J91A 1LW0B 5C24A 3MPWA 1VBKA 4H4KC 5KFEA 5KFCA 1J5EF 4KFBA 1T03A 3EJMA 2DR8A 3O3LA 3MAHA 4URQU 4AQYJ 1NO8A 1CLFA 1TMJA 3H8YA 3TQ1A 3HSJA 4LFBF 1E6VA 1TKXB 3W61A 3IRXA 1HNWF 1S79A 1T94A 3BN7A 2E7WA 2Z8QA 3R5GA 1GMWD 2OEJA 2B4PA 4NLTA 2QIFA 1RT7B 3FDSA 4A48A 3G2XA 4DR2J 3G82B 4CO4A 2VKZG 1CJVB 2HHHF 4EO6A 4CYUB 3QT8A 4ZMMA 3D6FB 3DLLQ 2OSRA 4ID5A 1T0TV 5AXMA 1SV5A 2DNRA 2HYIB 1IKVB 3I56S 1NMEB 4ANEA 2EI5A 2D3OR 3HMJG 4UOCA 4O3OA 3ZC4A 4C8MA 2QN6B 4NLRA 2P9GA 1CS4A 3DM2A 1ZBTA 3WBZA 1CVJA 3WC0A 2KM8C 4D3GA 4KJIA 1PYSB 2W7PA 1TL7B 5HN0A 3VGSA 3NAHA 1ROFA 1P1TA 2KN4A 3E01B 5F8MA 3IR5B 3KLFA 1DQAA 3G86A 4F3MA 5CQGA 2NXJA 3MPVA 2XY7A 2AYMA 4L75A 3MR2A 4DSLA 3MCSA 4RBTA 2Y8YA 4CLWA 3I0SB 4C8KA 4OIXA 3BB5A 3T6BA 2AW0A 3DNCA 4IKAA 5G4DA 4Y2KA 1KRPA 3TR5A 5K14A 1QAJA 3L7OA 4CRJA 2OO4A 3C2PA 2GO8A 2UUWA 4P2SA 3BGOP 2IAJB 2AKWB 2EK6A 3MCMA 4USUA 1RUSA 4QIFA 3KG4A 3HULA 3TUZC 2AYGA 2ZITA 4RPFA 3AH6A 3OQ2A 4LF8J 2DXFA 4NPOA 2QLJB 5B0GA 2YVSA 4XO0A 2K7JA 3POTA 1JLQB 3M2VA 3MPDA 3OFHA 1YVFA 3ZZUA 1AXQA 1KTQA 1L5UA 1YDLA 2ZKUA 2XMAA 1UCNA 2FJAB 1JMTA 2AGQA 4W98A 3FVYA 2RNEA 3V6DA 2CJ9A 2B7CB 2EG2A 4KAIA 2CVEA 1VYAA 2GV1A 2AQ4A 2CPYA 1HQEB 1ICEB 3EZUA 1U1PA 3DMJB 3HZGA 3ZTOA 4C0BA 2B3TB 1RBLA 3V4IA 4NYOA 1XC9A 3QRPA 2E29A 4KHPF 2PO4A 5D4PA 1T02A 1OSDA 2H65B 4ZOSA 5DM6Q 1R89A 2DY1A 3AFGA 2X7IA 2JEJA 5B0FA 3D6MB 3KOAA 4NYZA 4DV1F 2AYBA 1RT5A 2X1AA 2CG8A 2JWNA 3CEDA 3MR6A 3D67A 2CFXA 2JJ4D 5EHHA 1WEZA 5KG3A 2KVIA 1ZZNA 8RUCA 4FVMA 4DS4A 1M1HA 2EBEA 4KT0C 3RZAA 3LP0A 2J6SA 1Y3KA 4ZVHA 3RRKA 1WF0A 1B0VA 2B4OA 3QLHA 1M1KT 4RW9A 2Y1IA 1X0FA 2ZC4A 4USVA 1F5AA 3D4JA 1GQEA 2AWZA 4J9LA 4PG5A 4D3HA 2KYZA 3R5BA 3ZTQA 2YKPA 1KBRA 2LLZA 4OJGA 2RIJA 4UQGA 2HMIA 1HL6A 2Y1RI 5KFSA 5KT6A 2HVEA 2BE2B 1S7HA 4M5DA 4OV6A 1S0VA 1WHYA 3MM9A 2FD2A 1VC0A 4FS2A 4NXNF 4DSKA 2GMHA 4WKYA 4NA1A 2NPFA 4ES3A 4B3MJ 3CDWA 2DRBA 3HHLD 4TQSA 4CNZA 1IR1A 4WFZA 2OTLS 1RT2B 5F9LA 2HPUA 1O8BA 3CCZA 4LF7J 2MLZA 4Q7AA 4LUBA 1VBYA 1SQFA 2LXFA 4ED2A 3HVTB 3T1HF 5A8RB 3KLEA 3H5UA 1NDPA 4OHXA 5IQ6A 2J7KA 4A8SA 1R0CB 4WE1B 1S0NA 5KFVA 2Z2YB 3M32B 2F4VJ 4LF5J 4PYDA 4OI3A 4OZJA 3FQKA 3CT9A 2FY1A 3JTNA 2XLJA 4GVBA 4JYAF 5HMYA 2G13A 2HBYB 1NKBA 2AX0A 1VQSA 4FF4A 2O1PA 1M5PC 4ECVA 1N4LA 4IRDA 1WUUA 5HJXA 4MKYA 3KHGA 1XNRF 3CC7S 2CQGA 4HR2A 4TY9A 4ED3A 3HHLB 1Y5NB 1G7CB 3SCIE 1N36F 2G1DA 2R8IA 1TZ0A 4RNNA 2WOMA 2YH0A 3DGPA 4QIGA 3IBCB 1BQMA 1EKSA 2RDDA 1TUWA 3RR7A 3MM5A 2HHXA 2VG5A 1IBKF 1WKLA 1S6PB 5ADZA 3NNCA 2Q43A 4WK3A 2GQCA 3BGFA 1S9EA 4GVLA 1U2CA 4NLQA 3OTBA 3G6XA 3CJ2A 3B82A 2Y9HA 2DR6A 1WC4A 1TL3A 3DLEB 2XQCA 2FJDB 3J7AN 3BZQA 1OPIA 2MDAA 4LIRA 2DHHA 3H4BA 3CO9A 2JC1A 1YK9A 3IGVA 5KFMA 1GNKA 4RW8A 4XDDA 5C42A 2F8MA 2NUHA 5ETTA 2XMWA 2I6WA 3RRHA 5KG6A 2BJ7A 2OPQA 3C6TA 1PYTA 2B9XA 2HQIA 4QU6A 4OYBA 5HI7A 4WP8A 1UVNA 4ZPBA 3ENQA 4NLPA 4RNHA 1KOHA 2BQUA 2ASDA 1D9FA 4OI0A 1AB8A 3M9OB 3HVRA 2DNQA 3R1HA 4F67A 1RTJA 3ZZTA 3I87A 1QSSA 3AA8A 3JQMA 1X60A 3DFEA 2DNPA 3OL7A 4O0NA 1MSWD 5HVGA 4P74A 3W5ZA 3AJ1A 1VHIA 2RDIA 2QL5B 1IXKA 1E6YA 4F25A 3GYNA 4PG4A 2CPZA 5BYRA 2XM3A 2A0FB 1Q1KA 5KG5A 1NEEA 4RZRA 3FBEA 2F1FA 3Q83A 4B9LA 5LXRA 1RTZA 1S9GA 2YNHB 2YKQA 3ZTRA 3R9LA 3KLGA 1S10A 2V9WA 4M95A 2W8LA 3SIPB 2AD9A 8ATCB 2Q1LA 2FGOA 3OHBA 4X84A 1IM4A 1NJYA 2FHMA 4LR8A 3ET6A 2CPDA 5DGBA 5A0YB 3FFIA 2ZH7A 5KFAA 2EFOA 3CIZA 4X2BA 3BH6B 3SSSA 2ZH2A 1N5SA 5CD4A 2KT2A 1U1OA 2C42A 5H9EK 2RS8A 3HZEA 4ZPVR 1XMBA 3RW6A 1LWEB 2Y8WA 3KHHA 4ANCA 3SMZA 3MFIA 2R7VA 1RE1B 4ECWA 3FEXB 2D9OA 3TO8A 3SDEB 2BVZA 4UY8T 2PSZA 2W7OA 3G6ES 1K47A 2OMOA 2XS5A 4GRSA 1HARA 3THVA 5KFPA 2RRAA 3US5A 3MMJA 4YY3F 2ZZNA 1FFGB 3GIRA 4K2XA 3JS9A 1XMOF 4OZ0A 2QC3A 2XO6A 4NMLA 2KDOA 2PA8D 4DV0J 4Q43A 5EGYA 3FSIA 1VJWA 4IRKA 1B0PA 3D5MA 3DOKA 2E9TA 4WYWA 9ATCB 3ZTPA 1U0HB 3VAFA 1QUPA 1RLCL 5LXYA 3TUIC 3SZ2A 4DN0A 1Z4UA 5G0RA 1ELOA 5J2NA 3OR2B 2QFIA 5D77A 2VQEJ 5THWA 1J2VA 1RWNB 2VC0A 4KPCA 4RU2A 4RX6A 3LW5C 1X5TA 2LA4A 5HBMA 5LT5A 2AJFE 3AOBA 3CXCR 1C0TA 2GHPA 4EWTA 1JJ4A 2VG7A 1RT4B 4OX6A 1NLKL 4LFCJ 2HVIA 3I6PA 4P75A 1SKUB 5DJBA 4FVCA 4OX9J 1N52B 2GMJA 1UWBA 3B8HA 4Y34A 3CGIA 5HL7Q 4U96A 4K4SA 3NMAA 4TU8A 3CJRA 2HURA 3M8ZA 1AROP 3GE9A 4Z7CA 1XNQF 2LEAA 4OYIA 3IA0A 4BCAA 3H0PA 5KFZA 1Y9OA 4DOZA 4Q45A 4AFFA 3RG6A 2DNKA 3W2VB 4M94A 3TEHB 4P2MA 1LFWA 4KB7A 2WSFC 1FWKA 2HW3A 1F0XA 2VPWB 4MTPA 3A13A 3OHAA 3EE3A 4QR0A 1RA6A 5HQ8A 2L9DA 5KFWA 5CZXA 4FS1A 3T1AA 4UT4A 3F56A 3D1OA 2HLUA 3LGNA 5F41A 3RJMB 4FBTA 2DR5A 1QSYA 3H98A 4L72B 5GMEA 2GFFA 4LRCA 1R8BA 4ZN1A 4I7FA 4ZVUB 2GVDB 3RW7A 3G8TA 3UVJA 2CXEA 1RTIB 5GAGI 2GVZB 4ECTA 4JV5F 2BM1A 5GAHI 3L7PA 2GIFA 4TLQA 1IWAA 3Q22A 3DN9A 4MH8A 1BE4A 2G9OA 4PXDA 1TVRB 5KT2A 3LWMA 2B43A 2HEKA 3JSBA 3VALA 4QYZK 3RBDA 2HIQA 3H5XA 5CAAA 2B56A 3CCTA 1J5OB 4IFYB 3ZTSA 2LEPA 2BDPA 2W2PP 4EEYA 3UW1A 2AGOA 3FC9A 1Q79A 4XAKA 5JMNA 4Q5VA 4ZHRB 1YJVA 3AQPA 1JLEB 3IG1A 4ICLA 5CXTA 4PG8A 4LR7A 4WZMA 2XZDB 3MPUB 2WONA 4A8OA 3R7SB 4X64J 1TFYA 1M5HA 3IM8A 1B7FA 2VIHA 1VJQA 4FNHA 4N8OA 4CH0S 2BXJA 2OJ3A 2O67A 2J0SD 5B08A 4FYDA 1NDLA 1TP7A 3SQGB 1JLBB 4F7VA 1ZM4A 2PN6A 2QYCA 1W2IA 2MPUA 3GILA 2K8GA 5DQIA 4YN3B 3T9ZA 3PO4A 2AJ1A 4JI6J 4PQUB 4LBPA 2HWHA 4NLDA 3BM7A 3TA2A 2OI2A 2PA3A 1RB0A 1RHRB 1A6LA 1HQ2A 3H4DA 4DPYA 2HBRB 3O2IA 4CM2A 2Q3PA 4WXOA 2CKWA 2ZJPQ 1VI7A 4LRBA 1CPZA 1VISA 2HQ3A 3T3FA 3H7HB 4FXDA 5CCLA 2JOQA 3Q8VA 1RWXB 2P9EA 1SPBP 1N0UA 2BW7A 2FGCA 3PJXA 3CDEA 1TTHB 3FGVA 1PIEA 4ZVTB 2C2RA 5KT7A 5EWFA 3BN4A 4EGLA 4E8UA 3KUGA 4PUOB 2BANB 3BSCA 1FE0A 4TNOA 1CULB 1WORA 4R25A 1T05B 2V9KA 5I42A 3GV8B 1QY7A 2ZVSA 1FEHA 1NK9A 4HHJA 2DKOB 3R97A 3UCUP 1AYEA 3BYPA 5KFUA 2J9EA 2ROEA 4I2QA 2FQQB 1C4AA 2OTJS 1WF1A 2D7SA 4LSNA 2YX1A 2XLIA 4MKBA 5J2MB 4OHVA 3H25A 5DDPC 1YBTA 4RUBA 4Y65A 2F3JA 2IVMA 4MIWA 4CZCA 1NSQA 5HROA 1DTTB 2UUAF 4WFAQ 4I6WA 3NNAA 3GFHA 3TJ9A 1HBOA 7AT1B 4C3KA 3GFXA 1FRXA 4W90B 5J2PB 1ZPVA 5L1KA 4CP5A 3K8VA 1SL0A 3MWBA 3MMBB 4ZCLA 2E9RX 3U1NA 3GONA 3MM8B 2LA6A 1FKPA 1OMSA 3FSXA 3MEEA 2YNGA 4LMZA 4WFXA 1IKWA 1FJGJ 4B3OA 1I5OB 4DV6F 5KG4A 1FA0A 5AE3A 4OZ3A 5SUHA 5ETOA 3MAAA 3PYGA 3MR3A 1V5IB 5CYMA 1IWGA 4ZVQB 2FZKB 3KJVA 2FYXA 1AUDA 3KKFA 3IWLA 5F3TA 5CYQB 1QDUB 3MOJB 1UVJA 2D3ZA 2MGZA 2FY8A 2HKEA 4DV4F 4QW8A 4TYAA 3NOCA 1HBMB 2WAQD 3CCUS 1ZYQA 5IT4A 3OTEA 3NS7B 2YWHA 2JZ5A 3BSOA 3K17A 5F8NA 3DHXA 1HLWA 4NCGA 1CQNA 1F2GA 1WC3A 1RWKB 2HWTA 1T9YA 1YIJS 1U1LA 4XPEA 2H5EA 5A2QU 2E5HA 5GMKa 2HHQA 4B02A 3DLBA 1NSAA 3W63A 3W9HA 3PW7A 2V2ZA 3PG9A 4OI1A 5EWGA 2VOPA 3BV8A 4UQTA 2C1EB 3MECB 1S72S 3DKDA 2B4UA 4MMOA 3PO5A 3G9CA 1RT3A 1KHWA 4KR0B 4IUFA 1HI1A 2FHJA 4DUZJ 1R6VA 1WDDA 3OVAA 1F60B 3AHPA 4PPDA 2MSTA 5ETKA 2ZNYA 1AZSB 3HHDA 1J5EJ 2RF2A 4Y28C 3ENAA 3FK4A 2ATLA 1MLAA 1FRKA 2E5LF 4H4MA 5FD1A 4URGA 5KFNA 3RAQA 3JYTA 1SUQB 1QE1B 4LFBJ 3U27A 2ILYA 3FMBA 1HNWJ 1MG7A 1MNEA 2N7YA 3DLKA 2DEIA 1HHTP 4O4GA 4X65J 2XO7A 1S6QA 1VR6A 2HHHJ 5KFIA 3CCES 4WKRA 1P1LA 2KRBA 4CO1A 2BQ3A 2L08A 4AE5A 2CDRB 4OZLA 2GIQA 1S6OA 2QA2A 1REGX 1OY6A 1BWVA 2BV3A 1NJWA 2CQ0A 4OHWA 2ZE2A 5FDLB 2VFVA 2BUNA 5KOXA 1S77D 2MQOA 3TAMA 2XMVA 3AODA 1UA1A 4W4MA 1BUXA 2GQ2A 4DPWA 2GAHC 1RQ0A 2MY8A 2Z58B 4RR5A 3CJ4A 2O01C 3C16B 3V2UC 2R7TA 4OZ2A 1RWVB 2JDJA 3GSDA 4KYZA 4F0KA 1KR4A 1U8WA 2XS2A 5CYJA 2MLYA 2CWXA 2EVZA 1WC1A 3HDSA 2CVIA 2YWFA 4HT5A 4OHZA 3Q23A 3R6GB 4ZCIA 3GJTB 5ETRA 3BF4A 4K0KF 2LDYA 6FD1A 2NS1B 4HLBA 2DIUA 2OEKA 1PJ6A 1A9NB 2EKNA 1JLGA 4O3RA 3ILIA 3IO1A 1UJ5A 2FDNA 4YR2A 1B4SA 1RU1A 5A8KB 4RW6B 4L73A 3RBEA 3AY0A 1QAIA 3W9JA 2WBMA 4NLWA 2GMLA 2XSJA 3KJNB 1KNZA 3OJSA 3JTOA 3VTIA 1NCLA 2PFDA 2CQIA 2BYCA 5ETVA 1HQUA 1HWUA 1DLOB 1FRLA 3AXKA 3QFWA 5HMXA 4LVOP 4QPXA 4MYUA 2KJVA 2KYXA 4CI0B 3MM7A 1R27B 1L3TA 5F8IA 3RB0A 2DNZA 1HW8A 1G1XA 1N5QA 1FF2A 1LKZA 1R0AA 3LUYA 5IFMA 2ZUGA 1WF2A 3R5JB 1ZM2A 1FDBA 3MCOA 4EBEA 3WDOA 1UEVA 3MMAB 4KGVB 3QMQA 3E3XA 2JLGA 4LF5F 1MW7A 4FNIA 1FWLA 1FERA 1OSCA 3C46A 1R7IA 5E33A 1H38A 2V94A 3TA0A 4KHPJ 1UFLA 3KHLA 3M2UA 1MWZA 3S1TA 2YPYA 3OVSA 3J80Y 4K4VA 3HVWA 4WYLA 3MUMP 3H2LA 4DV1J 4NMXA 1NSKL 1YJNS 2I5JA 3TP2A 3UCZP 1A7GE 2RUGA 1YWXA 1WEXA 3DRSA 3HKZD 2RKIB 5GADI 2WSCC 2ZD1B 2R7XA 2G0IA 5CABA 3D0IE 4PWDA 1HA1A 3PXGa 4JUZA 1NJZA 1B0TA 2PEBA 2B7BB 4J90A 3L7UA 2I9SA 5IWAF 2KFZA 5KFYA 4HH1A 3N28A 3D0HE 3Q2TC
chains in the Genus database with same CATH topology
1CJTA 2WZ1A 4OYOA 3R5GA 4OYXA 1AZSB 1WC1A 4USWA 2GVDB 4CM0A 1CJUA 2W01A 3UVJA 1WC6A 4CLLA 5D15A 5D0RA 1YK9A 2GVZB 3G82B 4P2XA 1CJVB 3C16A 1CS4B 3MAAB 1CULB 1Y11A 4CLKA 5IV3A 1WC3A 3C15B 4USUA 1AZSA 2GVDA 3ET6B 4OYIA 4NI2B 4CLYA 2GVZA 3G82A 4OYMA 2QV6A 4OZ3A 1WC5A 1Y10A 4OYPA 3MR7A 1CJVA 4OYBA 4OYWA 4WP8A 1CS4A 3MAAA 1CULA 3C15A 4CM2A 4P2MA 1U0HB 4WP3A 4USTA 3ET6A 1AB8A 1CJKB 3C14B 4OYAA 5D0GA 4WPAA 1TL7B 5D0EA 4NI2A 5IV4A 4USVA 1YBTA 4CLSA 1YBUA 4P2FA 4CLZA 4CLUA 1CJTB 1WC0A 4WP9A 5D0HA 4CLPA 1CJUB 1U0HA 3UVJB 1CJKA 3C14A 1TL7A 2BW7A 1WC4A 3C16B 1FX4A 4CLFA 4OYZA 4CLWA 1FX2A 4OZ2A 4CLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJT A;  2WZ1 A;  4OYO A;  3R5G A;  4OYX A;  1AZS B;  1WC1 A;  4USW A;  2GVD B;  4CM0 A;  1CJU A;  2W01 A;  3UVJ A;  1WC6 A;  4CLL A;  5D15 A;  5D0R A;  1YK9 A;  2GVZ B;  3G82 B;  4P2X A;  1CJV B;  3C16 A;  1CS4 B;  3MAA B;  1CUL B;  1Y11 A;  4CLK A;  5IV3 A;  1WC3 A;  3C15 B;  4USU A;  1AZS A;  2GVD A;  3ET6 B;  4OYI A;  4NI2 B;  4CLY A;  2GVZ A;  3G82 A;  4OYM A;  2QV6 A;  4OZ3 A;  1WC5 A;  1Y10 A;  4OYP A;  3MR7 A;  1CJV A;  4OYB A;  4OYW A;  4WP8 A;  1CS4 A;  3MAA A;  1CUL A;  3C15 A;  4CM2 A;  4P2M A;  1U0H B;  4WP3 A;  4UST A;  3ET6 A;  1AB8 A;  1CJK B;  3C14 B;  4OYA A;  5D0G A;  4WPA A;  1TL7 B;  5D0E A;  4NI2 A;  5IV4 A;  4USV A;  1YBT A;  4CLS A;  1YBU A;  4P2F A;  4CLZ A;  4CLU A;  1CJT B;  1WC0 A;  4WP9 A;  5D0H A;  4CLP A;  1CJU B;  1U0H A;  3UVJ B;  1CJK A;  3C14 A;  1TL7 A;  2BW7 A;  1WC4 A;  3C16 B;  1FX4 A;  4CLF A;  4OYZ A;  4CLW A;  1FX2 A;  4OZ2 A;  4CLT A; 
#chains in the Genus database with same CATH topology
 2CNN B;  3TAR A;  3B4D A;  2DGO A;  3K59 A;  2DEJ A;  3I5B A;  2EFV A;  3DRR A;  4F36 A;  3PVX A;  1QTM A;  4WU3 A;  2IY5 B;  1VS3 A;  4ZVE A;  4ED0 A;  4WFN Q;  2AJQ A;  1LWC A;  4ZK7 M;  4KGK A;  4DF8 A;  3L4B C;  2WVD A;  4NXN J;  3HKW A;  3HLU A;  1VBZ A;  1JK9 B;  1JJC B;  1S1V B;  3W64 A;  1FD2 A;  5M2P A;  4Q0B B;  3I96 A;  4DUY F;  2A2C A;  3GQC A;  2RRN A;  1MRO B;  2W4P A;  3M05 A;  1NHK L;  2YKM B;  4X4P A;  2OPR A;  4A8F A;  1L3U A;  4C11 B;  2HGN A;  1IQT A;  3R6L B;  3VAK A;  2YNI A;  1X31 C;  5DZ7 A;  2VJU A;  3Q2S C;  4EBD A;  4J7C A;  1MMD A;  2AJ2 A;  3IMQ J;  3DDN A;  4JV1 A;  2Z0G A;  3DLJ A;  4FBU A;  1ZAV A;  1APS A;  3DRP B;  3CDA A;  2JLE A;  3H2U B;  1XMQ F;  3OL9 A;  2VF3 A;  3DOL A;  4WJB A;  2PFF B;  2QT7 A;  4DXL A;  1EKR A;  4PAB A;  3DOM A;  3EGN A;  2C22 A;  4DL6 A;  1RT1 A;  4ZLL A;  4AND A;  1EX8 A;  2GX8 A;  4JYA J;  1X4H A;  3L3C A;  1EP4 B;  2BBE A;  3NY0 A;  3W5X A;  4J5O A;  2MZS A;  4NZ7 A;  4DX7 A;  4DS5 A;  5AXL A;  3UD3 P;  4GKK F;  3LP1 A;  3D28 A;  2J76 E;  1SKS A;  5KG7 A;  3DDK A;  1SQG A;  3NEK A;  4CIO A;  3HI9 A;  4BC9 A;  1HPZ A;  1XNR J;  4P9S A;  4B3S F;  1FTR A;  4R5P A;  2NZC A;  4ECU A;  5DET A;  2HRU A;  2ASL A;  2MQN A;  3DI6 B;  1N36 J;  4O44 A;  1YHQ S;  1SB6 A;  4FF1 A;  5BJR A;  2Z4P A;  3C66 A;  1WTF A;  3KTQ A;  2Y3Y A;  6AT1 B;  3FBF A;  3E2E A;  3A8I A;  4BWM A;  2DO0 A;  1PBA A;  4CTA A;  2M9K A;  1B70 B;  1UAW A;  3WQP A;  3RR8 A;  1WSV A;  1JLA B;  5F9N A;  4U7C A;  4DFK A;  1IBK J;  3PY8 A;  5D3G A;  3GP9 A;  2KL8 A;  2RQC A;  1IKY A;  2DTJ A;  4UOF A;  1LWF B;  5D0R A;  1HBN A;  2H4W B;  3KK2 B;  3C3L A;  1HYS A;  4X4S A;  2K7K A;  2PD1 A;  1G2E A;  4P10 A;  1PIL A;  3M8R A;  4TU7 A;  2GA7 A;  3NWR A;  2JFK A;  1X4F A;  4NLO A;  2HQD A;  2N82 B;  2ZH6 A;  3ZZR A;  1S1X B;  2ALY B;  4DV5 F;  1UWA A;  3NXZ A;  3LGM A;  4I56 A;  1B3T A;  4P6Q A;  4YP3 A;  3CTR A;  1ZET A;  2MYF A;  3UQS A;  2W8K A;  4USM A;  3VHQ A;  2R7Q A;  1YJR A;  2E1R A;  1HNI A;  4KPY A;  3ISZ A;  1EET A;  1GAO A;  3R2D J;  5HP1 B;  2HSE B;  2NLW A;  2GGP A;  1RBO B;  3GR1 A;  3NCR A;  3THP A;  4DG1 B;  1RK8 A;  2AHO B;  3V81 A;  3IS9 B;  1SVD A;  1RAC B;  5DQH A;  4YOE A;  2H54 B;  4BLG A;  4HAC B;  2NSB A;  2R7R A;  1DAR A;  1VLO A;  3M8P A;  4OLP A;  2KB2 A;  3BQ1 A;  2R2R A;  3KUE A;  2AEF A;  4CT8 A;  1S99 A;  4HVZ A;  2AYE A;  3U7J A;  4ELV A;  3M8Q A;  4ENO A;  1ULR A;  2FTR A;  2CQD A;  3PKM A;  5I3P A;  3ILO A;  1RYS A;  4BWJ A;  3W8G A;  1GX6 A;  1RAD B;  2KFY A;  1Y10 A;  5L8R C;  1Z1Z A;  2LP4 A;  2DIT A;  1RAI B;  1VQM S;  4RWX A;  4DV7 F;  4TLR A;  4OX9 F;  1W26 A;  2VQF F;  2A6O A;  3F0N A;  4NLV A;  1KVJ A;  3NNH A;  3QJL A;  4X66 J;  3KMQ A;  3P3D A;  5A8W A;  4MT1 A;  2OPP B;  3BBC A;  2QA4 G;  3JQJ A;  1C1C B;  2FUG 9;  4IFV A;  3NLC A;  1FJ7 A;  5LJ3 Y;  1U09 A;  1KSP A;  3DYA B;  1SL2 A;  4AL7 A;  2ZDO A;  3BEG B;  4DZD A;  1NPK A;  1FX4 A;  4V1A k;  1FDA A;  4S0M A;  4OYX A;  3ITH B;  2P2C B;  4IG0 A;  5E3A A;  3I55 S;  4WTO B;  2V8P A;  3C6U A;  1X9W A;  1U6F A;  3KLH A;  2ZJR Q;  5EUH A;  2X3G A;  1BD6 A;  2YNF A;  2EFG A;  5SZT A;  3QZ8 A;  4OYP A;  5IT0 A;  4TY8 B;  4YY3 J;  3PYF A;  3WIU A;  1U6Z A;  3KLI B;  4NEZ A;  2DY9 A;  1GH8 A;  4IG3 A;  1SC1 B;  2E1P A;  5I3U A;  1TEL A;  1XMO J;  2LVW A;  1AW0 A;  5KFF A;  4UTG A;  5J1N A;  1KLN A;  4OJ3 A;  3KJF B;  4I0W A;  3TNV A;  2WVE A;  4MKA A;  2UVV A;  5MAO A;  2MJU A;  2RUS A;  2K1R A;  1ZH5 A;  3IN5 A;  1UZH A;  4P73 A;  5K8P A;  4R8U A;  2ZBQ A;  1LFP A;  2CYY A;  1FXL A;  2AX1 A;  1TKZ A;  1U45 A;  3HHK A;  2HHW A;  1HBU A;  4KO0 A;  2EPI A;  1LK7 A;  1FHT A;  3OXF A;  2C2N A;  2R8K A;  4NA2 A;  1VQN S;  3KK3 A;  4RKU C;  1BHN A;  5HAN A;  4RO0 A;  2CPI A;  3U02 A;  2DH7 A;  4RW7 B;  1Q53 A;  1AFJ A;  4IOC Q;  3GG0 A;  1H2T Z;  4X64 F;  2VA2 A;  1O5J A;  3AB2 B;  3R3T A;  1Y0H A;  4KBI A;  5BYS A;  2IIH A;  4CLY A;  1MU2 A;  1RTH A;  2BJD A;  4KH0 B;  3CJK A;  1ZOT A;  2CPF A;  1AA1 B;  1QJH A;  1TV6 A;  2HNZ A;  2DPI A;  3GFY A;  3K5M A;  4LF4 F;  2FVR A;  3EXY A;  4KE5 A;  4U7U D;  1G6B A;  3G6V A;  2O66 A;  3PDN A;  1XNQ J;  2FZC B;  1KTV A;  4ILR A;  2KHD A;  5HMZ A;  4KIA A;  1QAY A;  2B9Y A;  1M1G A;  4JP8 A;  2GS8 A;  2IA6 A;  4N77 A;  2XGQ A;  1RAA B;  5H9E J;  4U7U K;  2OH2 A;  4NXM F;  5LSO A;  2MKH A;  5GVQ A;  2VFT A;  2BJ8 A;  3AT1 B;  4QU7 A;  4QCL A;  4DX8 H;  1S1V A;  3BDE A;  3VQT A;  5IM0 B;  3H40 A;  5K9F A;  2PII A;  2YKN B;  2RHS B;  2XTJ P;  4G1P A;  1Y4Z B;  3QAU A;  3TAQ A;  3W2W B;  4KH1 B;  5F8L A;  4ELU A;  3PEH A;  3JSR A;  1NK5 A;  4F4K A;  4KV8 B;  1BXN A;  3A1Y G;  1TUV A;  5KT5 A;  3TAN A;  4WCE Q;  2AZ1 A;  4IRC A;  2VV5 A;  4K8R A;  4JV5 J;  5J2Q B;  4O3Q A;  3DC2 A;  3TZX A;  2IYI A;  1SJ4 P;  1NK6 A;  5KG1 A;  2VG6 A;  5ETL A;  2D1C A;  2HFN A;  2YTC A;  2NXC A;  4G1Q B;  2CIM A;  3FCW A;  1VQ5 S;  4UF4 A;  4DQP A;  3CSK A;  3M6V A;  2C2O B;  3TVK A;  3A8E A;  2XBP A;  2EXU A;  4KQZ A;  2ACM A;  2B6A A;  2HFS A;  4WU2 A;  2D74 B;  1S1W B;  4DPO A;  4UUW A;  3S8S A;  1R8P A;  3TA1 A;  4J9K A;  1NH7 A;  2ZDP A;  1RCO B;  7FD1 A;  2K06 A;  3BO2 A;  3ZFV A;  3G4S S;  1FKO A;  2HND B;  2UVR A;  3H90 A;  2R2U A;  1REV A;  3BBF A;  2DGV A;  1VRT B;  2ZBI A;  2XG8 A;  5KFO A;  3I0R A;  1B99 A;  4ZA1 A;  4IO1 A;  1UKU A;  1FO1 A;  3SBM A;  2BJ3 A;  2GC8 A;  3M30 A;  4M63 A;  5DM7 Q;  1L3K A;  1N5Y A;  2G2Y A;  1CBK A;  1LXJ A;  3JTP A;  4QW9 A;  5FJ4 A;  3TW0 A;  1TFW A;  4K50 A;  3J81 j;  3JXO A;  4NI2 B;  2KHC A;  2LXI A;  3VZH A;  1UFW A;  2E5I A;  3MR7 A;  2W4C A;  2ACY A;  2X51 A;  5IQQ A;  1Q0N A;  2D3O 1;  1HD0 A;  2CQ2 A;  2DHG A;  2W9A A;  3EPG A;  3QJP A;  1X7V A;  4ED8 A;  4K4Z A;  1T3O A;  2J9D A;  2M5Y A;  2FVC A;  2O5D A;  2C28 A;  2XYP B;  1C0U B;  3CD6 S;  3OR1 B;  3M1V A;  4FXV A;  2A10 A;  2KTQ A;  4NA3 A;  1MWQ A;  4Q8E A;  1F9H A;  5JVH Q;  3LO3 A;  3K89 A;  3PYD A;  1SJF A;  1O0P A;  1JLF B;  1KD1 T;  1YRT A;  1FCA A;  2ZC3 A;  3M2R B;  4C48 A;  4GO5 X;  2CA9 A;  5I3Q A;  1TL4 A;  1CJT A;  1EQM A;  1VQL S;  1QAX A;  4NL5 A;  1DUR A;  4C3M A;  3SYZ A;  3SV3 A;  4HDG A;  3M4X A;  4UOG A;  2M8D B;  4C97 A;  1N48 A;  4X4R A;  2XLK A;  4KHR A;  3E51 A;  4ZVP B;  3OPK A;  2HZA A;  1RHJ B;  4QYZ J;  4MFB B;  4B3R F;  4YDX A;  1FRI A;  4LBI A;  1YJ9 S;  2JHE A;  3VAH A;  3RB3 A;  1IR0 A;  3FNN A;  1UPP A;  2H5I B;  2XY6 A;  2A6M A;  3PZP A;  3UR0 A;  3DXS X;  3PEJ A;  1VC5 A;  1LV5 A;  5B0D A;  2V50 A;  1X4A A;  3K5O A;  2RRB A;  2MZR A;  2QX0 A;  4IDK A;  5JXS A;  4O4R A;  5IC6 B;  4CLF A;  1DFD A;  3HJV A;  4PG6 A;  3RB4 A;  4FYX B;  3ZZO A;  5K8O A;  2V4J B;  2L48 A;  2VA3 A;  4ED5 A;  5D78 A;  2OHD A;  2UUA J;  1QTN B;  2PEH A;  3OV7 A;  2DNY A;  2KU7 A;  3KYL A;  3AD7 C;  4RNO A;  4M8L A;  4JI4 F;  3ETM A;  5RUB A;  3KHR A;  4LQ9 A;  2W9C A;  1OY8 A;  1CC8 A;  3A8K A;  2E44 A;  1S0M A;  3CDU A;  3QT5 A;  3P8B B;  3QZ7 A;  3QT6 A;  2DHS A;  2C3P A;  1JX4 A;  1U0S A;  1GMU A;  1I94 F;  1GT8 A;  4RWW A;  1NAQ A;  2CJY B;  1L3S A;  3MHY A;  2WSE C;  2RAQ A;  1KLM A;  4FYV B;  5E5N A;  2UZA A;  3EDR B;  5GAE I;  4DV6 J;  5C2G A;  4B9U A;  1QVF R;  3G6Y A;  3CD5 A;  1CC7 A;  2ZM6 F;  3KK1 A;  5A6P A;  2Z2L A;  3GFZ A;  3W62 A;  2BJE A;  3C14 A;  4X65 F;  4ED1 A;  3W8P A;  3JAM Y;  2B5J B;  1OYE A;  1IKX A;  3NGK A;  5DDO C;  1F1B B;  5LMN F;  3J81 U;  3MXH P;  2KG1 A;  4DWI A;  2WCX A;  2P6S A;  2HQG A;  3PFO A;  4LQ3 A;  3PV8 A;  5D8H B;  3FKB A;  4ZN3 A;  4QBU A;  5AT1 B;  5LOQ A;  1W25 A;  1K1S A;  1KKH A;  2PE8 A;  1FK9 A;  1SJQ A;  3C15 B;  1RLD A;  2CNO B;  4DV4 J;  3OW2 R;  1VRQ C;  3NBP A;  2R8G A;  4NLG A;  3MMC B;  2DT9 A;  1F5B A;  3MUV P;  4EYI B;  1J27 A;  1R6Y A;  2IC3 B;  1FDD A;  1DTQ A;  3ISN C;  1URN A;  4DMZ A;  4EMD A;  1X9M A;  3MFH A;  4C2M A;  1UVL A;  1YRU A;  4DU7 A;  3K5L A;  2C2D A;  4IH7 A;  3PRV A;  1NU4 A;  4RLE A;  2FJW A;  2FC9 A;  5EWE A;  1WDT A;  1YJU A;  1FRM A;  2Z30 B;  4CO3 A;  2G2O A;  1U1R A;  4LIW A;  1SC6 A;  2H9Z A;  2PMH A;  4BDP A;  3AJ2 A;  1O51 A;  3JSM A;  2X3D A;  4HHU A;  2HNY A;  4LRD A;  2HZV A;  5LSR A;  3AQO A;  1FXD A;  1H7X A;  2HS4 A;  1O6X A;  4M5M A;  3C19 A;  4E0D A;  1A0O B;  1DZ5 A;  1XWL A;  5DG9 A;  5J1E A;  1TK5 A;  5E3P A;  4YB5 A;  3J7Y I;  2E5L J;  2HS0 A;  2FVQ A;  2FLN A;  5CCM A;  2H5J B;  4JI7 F;  4KKO B;  3TQE A;  2AEJ A;  1H2U X;  4K5R A;  3MZI A;  3BSA A;  2D3U A;  2BEF A;  4OI2 A;  4CLS A;  1OPZ A;  2UXC F;  1C1B A;  4Y2I A;  4RW4 A;  4J9P A;  3LPE A;  2OKQ A;  3GU0 A;  4RNF A;  4O3P A;  2N3L A;  1FNO A;  1P6T A;  1MN7 A;  1OIA A;  3HSZ A;  5L39 A;  2MKK A;  3H5S A;  4M1K A;  1RAF B;  2XYG B;  4I1T A;  1CJU A;  1WI6 A;  4C0H A;  1DQ8 A;  4DR3 F;  4DR7 F;  1Q5Y A;  3TRG A;  1PO6 A;  1Q7L B;  2FJX A;  4B9V A;  4N76 A;  4DR6 F;  3AD9 C;  2RQ4 A;  4RBV A;  2XGP A;  3QIP A;  3PW4 A;  3HSG A;  2KI2 A;  2HND A;  1SKW A;  4Y00 A;  2DGT A;  3LAL A;  4K0K J;  3NCP A;  2EEY A;  1T9U A;  4FXW A;  3ELH A;  1D8Y A;  1N6Q A;  1S0O A;  6FDR A;  4ZVR B;  4B17 A;  4DV3 F;  3GPA A;  2JNJ A;  4CLU A;  3N5F A;  4C9D A;  2CZ9 A;  4OX7 A;  1VRU B;  4OFZ A;  1VOM A;  4ECS A;  3BKF A;  2MQP A;  1JKH A;  4YME A;  1DHM A;  5K8M A;  2CPE A;  2DR7 A;  2W24 A;  3OXL A;  2JX2 A;  5C25 B;  4F0H A;  3W5Y A;  1S1U A;  3R7N B;  1WHW A;  4OX8 A;  4U8V A;  5C7P A;  4F04 B;  2G4B A;  2HIY A;  2VKR A;  1UW4 A;  2XNR A;  2UXD J;  1TL1 B;  2IM3 A;  1RTD B;  3CVK A;  1RWU A;  2IPO B;  2IRY A;  4B9T A;  1RT6 B;  3ONQ A;  2BOA A;  4QWD A;  1KQK A;  3R5A A;  3HP6 A;  1URR A;  2KZM A;  3TI0 A;  3JB9 k;  1VDH A;  1S6U A;  2UUC J;  3FCV A;  2IM1 A;  4F8R A;  5M2U A;  1VQ7 S;  5KFQ A;  3LAK A;  2W9B B;  4IR9 A;  2WB4 A;  5C2C A;  1IUJ A;  3MM6 B;  4U95 A;  2H48 B;  2DR9 A;  1S1T B;  2ZBR A;  2V6A A;  2LCW A;  3CCQ S;  3MDF A;  2F9D A;  3BGR A;  1OJ4 A;  1BQN A;  2KT5 A;  2RSQ A;  3HD2 A;  3KMS A;  3HK2 A;  2HVH A;  2V68 A;  1PC4 A;  1CJK A;  1X5O A;  3CMA S;  3QBC A;  3NP5 A;  3W9I A;  2QRR A;  3MEG A;  5JUM A;  3EZ5 A;  1R3N A;  3BPD A;  1D3W A;  4RNM A;  1TKT A;  1JIH A;  2CWK A;  4CM0 A;  1B64 A;  2WVC A;  4DU8 A;  4HL9 A;  3LP2 A;  4NLY A;  5T7L A;  2FVP A;  1AUS L;  4I64 A;  1FFW B;  4WWS A;  2LXU A;  4DQS A;  3OUY B;  3DLG B;  4B9N A;  4USK A;  5IWA J;  5J1P A;  5HLF A;  1KQF B;  3MED B;  3KG1 A;  3HPO A;  2LU1 A;  4ZKA A;  4I2P B;  3OTO F;  1FRH A;  4YDD B;  2V63 A;  4G65 A;  2ABY A;  3QYY A;  2J5A A;  2HQC A;  3BJY A;  2G0C A;  2BE7 D;  1HNV B;  2HS3 A;  3QO9 B;  4H4O B;  1NB2 A;  3WHI A;  5C24 B;  3KUH A;  2CJX B;  4NLS A;  3QGG A;  1N56 A;  1SC4 B;  1NK0 A;  4KFB B;  1T03 B;  1IR2 A;  1R31 A;  2QLW A;  1VQ6 S;  1JLC A;  1IQZ A;  3CCR S;  3CCS S;  1E6V B;  3NS6 A;  4EI2 A;  3PRB A;  3IRX B;  2DYA A;  1HW9 A;  4QPT A;  1VIX A;  1UA0 A;  2A18 A;  2C3O A;  2WK4 A;  2DGX A;  1QUV A;  4DUY J;  1VQ9 S;  4P7T A;  5KT4 A;  2C3U A;  1LW0 A;  4Z2X A;  4N8N A;  1NK8 A;  2X1G A;  2DIS A;  2LQJ A;  3QT7 A;  5H9F K;  4ID5 B;  2SXL A;  3OXG A;  1UW9 A;  4BC7 A;  3GLJ A;  3NKY A;  4ECR A;  1WC6 A;  4N7T A;  1H98 A;  2BJ1 A;  4KGM A;  1TL5 A;  1CS4 B;  3DM2 B;  3P6Y C;  1D9A A;  1TKX A;  2AZ3 A;  3KJQ B;  4TYB A;  2IJN A;  1Y3J A;  2VBY A;  4RUH A;  3SCJ E;  1XMQ J;  5E3R A;  4IO9 Q;  1H74 A;  2G0J A;  2XZT B;  1RT7 A;  2I2Y A;  4UUX A;  3D0G E;  1LNQ A;  3G82 A;  5E2Q A;  4YR3 A;  2WTF A;  1CJV A;  3CD7 A;  4CYU A;  3KLF B;  4Y2A A;  4DQQ A;  4DCJ B;  1BC6 A;  1KEK A;  1OWX A;  4X4V A;  1IKV A;  2YKO A;  2BA9 A;  1LXN A;  2A2D A;  1NJX A;  2QFJ A;  3J7A 1;  1S7I A;  3W60 A;  2B51 A;  2XMJ A;  4GKK J;  1NJI T;  1U6B A;  3UD4 P;  1NM2 A;  3DU6 A;  3PCO B;  4QWE A;  4DL7 A;  1V3R A;  2F4F A;  1KN6 A;  4YR0 A;  2UVU A;  4B3S J;  4Q44 A;  1TL7 A;  4FDF A;  2XHW A;  4YHH F;  2QMU B;  2F63 A;  5K14 B;  3I5C A;  3OLB A;  3E01 A;  1LEO A;  5DDQ C;  3UN2 A;  4X66 F;  4F3O A;  1WD6 A;  4HTI A;  2UU9 F;  2QL7 B;  2APO A;  1VBX A;  4M5J A;  2J8S A;  3I0S A;  1TAQ A;  2QEX S;  3POT B;  3M2V B;  1UL3 A;  2B9E A;  1RZM A;  3BRE A;  2J6T A;  1WSR A;  3QRR A;  4YS2 A;  3EMT A;  4JI5 F;  2B9W A;  1GMW A;  2ZBP A;  2XMU A;  2JEG A;  4DSJ A;  1TAU A;  3V6D B;  2M88 A;  2QSF A;  2IAJ A;  1PAE X;  5GAG U;  3OTC A;  5GAH U;  3QNW B;  5HO4 A;  2R42 A;  2HHU A;  3IXQ A;  3L95 X;  4DFM A;  2OAU A;  4DV5 J;  1NZA A;  3B54 A;  2YH1 A;  3V4I B;  1WEL A;  1D09 B;  1JLQ A;  1AFI A;  2XSF A;  2HFV A;  4ECQ A;  1M5V C;  3N6M A;  4ZP9 A;  1Y5I B;  2ZJQ Q;  3EVO A;  3HT3 A;  4DEZ A;  1KVK A;  2WZ1 A;  2DIV A;  4AYB D;  1D0E A;  3NOG A;  1RT5 B;  4N56 A;  3HD1 A;  1K8A T;  1KS2 A;  4X4O A;  1HQE A;  1G3O A;  4DV2 F;  3D6H B;  2XI3 A;  3DMJ A;  3UD5 A;  3PX0 A;  4CLK A;  2M0G B;  1K0V A;  4UZB A;  3LP0 B;  4A46 A;  3QLH B;  2RQM A;  1FRJ A;  4RW9 B;  1H3D A;  3RAM A;  3A12 A;  1FNX H;  2CZV C;  2ALZ A;  1FES A;  2CJA A;  2K2P A;  2F8E X;  3UNY A;  4WP3 A;  4WXW A;  2YPZ A;  2CQH A;  2QLF B;  1RAH B;  1RIS A;  4ZJO A;  2HMI B;  2P6T A;  4OZN A;  3C8Y A;  1RKJ A;  4M5D B;  4DV7 J;  4I67 A;  2DNO A;  3MM9 B;  4G1I A;  2VQF J;  3EGW B;  4J9S A;  3D54 A;  2UXB F;  4DL4 A;  2VDI A;  3QJJ A;  2WVF A;  4QQB A;  7FDR A;  5IT9 U;  5B0A A;  4IQM A;  2E7X A;  4EZ6 A;  3EVM A;  2ZH8 A;  3JQK A;  3A3O B;  3OJU A;  2WRM A;  2I8E A;  3W66 A;  5E3C A;  3CC4 S;  1RGV A;  2EBG A;  3SV4 A;  2ATC B;  1N5V A;  3UDV A;  1T7P A;  2BE2 A;  3O8W A;  3ENW A;  3BKT A;  2BKO A;  1FJE B;  3KLE B;  3HM9 A;  1XR5 A;  1S4E A;  4JI2 F;  3M8W A;  5AXK A;  2A1B A;  4C7Q A;  4ZCK A;  4ZVS B;  3R7B B;  3IM9 A;  1YJT A;  3PJW A;  3T9N A;  4Q2L A;  4QWB A;  4GVB B;  3NGU A;  1RT2 A;  2Y1J A;  1ZAX A;  3O1L A;  4AXI A;  2IM0 A;  3HHE A;  3EYZ A;  1ITP A;  3P5T L;  3GIK A;  3HVT A;  5LMU F;  2NR0 A;  1EAR A;  5A8R A;  3UE2 A;  2VOO A;  3VQS A;  1GK8 A;  3LTO A;  1ZTW A;  4USI A;  3QSI A;  1XJW B;  4WE1 A;  2R2S A;  1P9Y A;  2AT1 B;  1YZ7 A;  3M32 A;  3VV2 B;  1C2P A;  1SIZ A;  5JVG Q;  3OFG A;  3PX4 A;  4RU9 A;  3SI8 A;  4DL2 A;  3MAQ A;  1UET A;  1NBE B;  1NKC A;  4TN2 A;  2WOM B;  4NYP A;  1RYR A;  2W4D A;  3DGP B;  2ZNZ A;  2HGL A;  1BQM B;  4CQ1 A;  3I5A A;  3PIO Q;  2IMW P;  3MM5 B;  2VG5 B;  4JV2 A;  4CO0 A;  2ZH9 A;  4J9R A;  3LPY A;  2UUB J;  1RHM B;  4GMK A;  1S9E B;  4PZV A;  5C5J A;  2GCF A;  4QR2 A;  5FLX Y;  4U67 Q;  4HYK A;  3HHL A;  3M9M B;  2CNL B;  3M6U A;  4K7Q A;  3FEZ A;  4E98 A;  3QWU A;  2V4R A;  4NCB A;  1TL3 B;  2RT3 A;  1R0B G;  4IOB A;  4NZ6 A;  3P96 A;  3RBZ A;  2VAS A;  3IR6 B;  1HD1 A;  4DL5 A;  4LF4 J;  3FBB A;  4RW8 B;  5LM7 E;  1SBR A;  4R0E A;  3KNG A;  1XTZ A;  1ZAW A;  4LBH A;  4Z37 A;  4Y6I A;  2BAC A;  1QM9 A;  3PRD A;  1S6P A;  2RB7 A;  5C42 B;  1EJ7 L;  4CLT A;  4QWC A;  1UVK A;  5AE2 A;  3NWG A;  3HHL C;  4PKD B;  3UWT A;  1XN9 A;  2D41 A;  3T1Y F;  1U26 A;  2OPQ B;  3C6T B;  2ZEJ A;  2VH7 A;  5B0C A;  2EKY A;  4NXM J;  3DLE A;  1WKJ A;  3EPI A;  2ADC A;  3CE8 A;  4ECY A;  1VQ4 S;  3T5K A;  4PXB A;  2EK1 A;  1C4C A;  1V9O A;  1RTJ B;  5HAT A;  5KFK A;  1Y7P A;  2RQK A;  4U8Y A;  3SCL E;  1RWO B;  4C98 A;  4MIA A;  3SEO A;  1LW2 B;  2H1Y A;  2VON A;  1LQ9 A;  3PNI A;  3K58 A;  4OZ5 A;  2YWE A;  1SQE A;  2H4Y B;  1E6Y B;  2M4M A;  1I3O B;  4ILL A;  5DZ6 A;  2WW4 A;  5F0U A;  1VFJ A;  1DRZ A;  2R7S A;  4ILM A;  3EIC A;  1YGY A;  1M5O C;  2RD5 C;  3Q8U A;  1S9G B;  3HCX A;  2B0G A;  2L41 A;  3Q8R B;  5BYQ A;  4P52 A;  3KLG B;  2EWH A;  5IOL A;  4L76 A;  4HI2 A;  3PX6 A;  1GTH A;  4ZCM A;  1HKA A;  1U7L A;  2N4D A;  2LQ9 A;  4F4A A;  3ET6 B;  4KY3 A;  2MMY A;  3FFI B;  4U9R A;  4CNY A;  3ZNJ 1;  4OYM A;  3G87 A;  3UR3 C;  3DCA A;  1ZPW X;  2ASY A;  3PHE A;  3MR5 A;  2CQC A;  2OSQ A;  3Q8P B;  4XK8 C;  2YNH A;  1MN9 A;  2HFU A;  5IV4 A;  1VQP S;  4TKT A;  1KWM A;  2DJW A;  1DQ9 A;  3IAM 9;  3LH2 S;  4A8M P;  4JBC A;  2FLL A;  4DL0 C;  2HZC A;  3GV7 B;  3D66 A;  5CH7 B;  4KGZ B;  2YX4 A;  2W2N P;  3DRY A;  5A0Y A;  4ZPC A;  3TVZ A;  4O23 A;  1U2R A;  2MQQ A;  2Q66 A;  2MHN A;  3IAS 9;  2U1A A;  3D1H A;  3H2V E;  4X4T A;  4DX6 A;  2RML A;  1FI4 A;  3LA0 A;  3K5N A;  4ZP7 A;  3QPI A;  1LWE A;  3M8S A;  4F4Z A;  5ETP A;  1DBD A;  3IRW P;  3DOK B;  3T41 A;  2KXN B;  1DJ0 A;  3SDE A;  4MK7 A;  1VLY A;  2MQ8 A;  1EAY C;  4AL5 A;  3ULH A;  1SIW B;  4MIB A;  4ERD A;  1V5V A;  5G0R B;  2Z2Z A;  5J2N B;  1R8A A;  5KFH A;  1WKK A;  1GXU A;  5KG2 A;  5HBM B;  3B6B A;  1X8D A;  1ZZF A;  1C0T B;  4QOT A;  3IFE A;  1SKR A;  1RWP B;  1UJ4 A;  4DR5 J;  4JI1 F;  2YBV A;  2VG7 B;  3BYR A;  1WI8 A;  4B3R J;  1WHX A;  4OZ1 A;  3EGV A;  4CLZ A;  3OD2 A;  1U0H A;  2IFX A;  1UWB B;  3G8Q A;  3NMR A;  3OR2 A;  2MZT A;  4JV0 A;  4EBC A;  3OLA A;  2EG1 A;  4LJM A;  2YWW A;  4ZLN A;  1HNX F;  1FTC A;  2VDH A;  1RT4 A;  1UPM B;  3PW5 A;  3NGS A;  3VAM A;  2WBR A;  1SJ1 A;  2EFQ A;  5E41 A;  3Q8Q B;  1WAC A;  4LRE A;  3S01 A;  3J80 U;  4GC7 A;  3J81 Y;  4ZPT R;  4WF9 Q;  2V34 A;  1P27 B;  4DCO B;  3VAJ A;  1U1N A;  4OQJ A;  4JI4 J;  4A4J A;  2AEM A;  1M90 T;  4IYQ A;  2XNQ A;  1JNZ B;  4MK8 A;  2YQ3 A;  2HHV A;  2KFN A;  2GJ2 A;  4I7F B;  1UZD A;  5AE1 A;  3W2V A;  1UP1 A;  3CCJ S;  1I94 J;  1TR0 A;  2CQ4 A;  1YTY A;  1XR6 A;  1SC3 B;  2JC0 A;  2JH3 A;  3UVJ B;  2GAG C;  2L3M A;  3V6J A;  2XY5 A;  2MZJ A;  2ZZM A;  5ETN A;  3IBF B;  2IBK A;  1TUG B;  3RAX A;  1R43 A;  4NLU A;  2ZM6 J;  4OYO A;  4OLO A;  2F5G A;  1IBL F;  4LFA F;  5GAD U;  4UY8 5;  1PJ7 A;  3GWC A;  4ES1 A;  3CWJ A;  2NXE A;  1VQ8 S;  2GVD A;  5LMN J;  1RTI A;  3TUP A;  1VQY A;  2GVZ A;  1T9V A;  1NXI A;  3ILJ A;  3Q24 A;  3CCV S;  2CJQ A;  3IG1 B;  4ICL B;  2VU5 A;  2F65 A;  1HWL A;  4U6P A;  2NXN A;  1TVR A;  2WON B;  1N33 F;  3QID A;  2CJK A;  1OS5 A;  1CQM A;  2CUY A;  3P5B P;  1YJW S;  4ID8 A;  1Y5L B;  1J5O A;  1N34 F;  1V6H A;  4IFY A;  4P72 A;  1F3V A;  4NEY A;  3L9Z A;  4YB1 P;  2NUU G;  2POK A;  4RL1 A;  5HQM A;  3NG8 A;  1HNZ F;  1TK0 A;  2EC0 A;  2DH8 A;  4M5N A;  3UDE A;  3LAN A;  2CQP A;  3VAI A;  4AUK A;  1T9X A;  3HVA A;  1FX2 A;  4ZHR A;  1DAX A;  1JLE A;  3W1Y C;  2KJW A;  4ZLJ A;  1U1K A;  1ZM9 A;  3R27 A;  1T11 A;  4DX5 A;  5D15 A;  2HG4 A;  3BQ0 A;  2R2T A;  3PTW A;  4OL8 A;  3E8O A;  2UP1 A;  3ZZP A;  1TMM A;  3V4M A;  1NPP A;  1T9T A;  2IMO A;  3MOZ A;  3RRG A;  3SQG A;  1FXR A;  3TX0 A;  4F3Q A;  1JLB A;  1ZA1 B;  5F8J A;  1OY9 A;  3UCG A;  4OYW A;  2ZHO A;  1F9F A;  3FMW A;  4MJK A;  2BKN A;  1NDK A;  2WB1 D;  2HHS A;  2KKH A;  1H7W A;  3CC2 S;  1X9S A;  2OEL A;  4ECZ A;  1JQG A;  2UXD F;  5D6G A;  1HR0 F;  4PQU A;  1UTA A;  3K5P A;  4X4N A;  3CD0 A;  1KFS A;  2IVF B;  2G1H A;  3GTY X;  3VR1 A;  2BQR A;  2KG0 A;  3QAT A;  1SJR A;  1Q78 A;  3IBW A;  2UUC F;  2QG9 B;  4JI7 J;  4L3K A;  3N6L A;  4YUD A;  1YRX A;  5AJ3 F;  5ETS A;  1FE4 A;  5KFB A;  2YY3 A;  4IOA Q;  2CAD A;  2J7U A;  2GNK A;  1WTB A;  2QMW A;  1CG2 A;  1YLX A;  4DCP B;  4N5S A;  2UXC J;  4ZJL A;  5I42 B;  2M3D A;  1LW2 A;  2VD3 A;  2RE1 A;  2FB0 A;  2DGW A;  2E5G A;  3THT A;  5T14 A;  4X62 F;  1N32 F;  4HDH A;  1Z2Z A;  3MGJ A;  2LEB A;  4FPI A;  4LSL B;  2DBB A;  1QD1 A;  3PR4 A;  3F44 A;  3GJQ B;  3AAW B;  2I0X A;  4I2Q B;  1EHW A;  3CCW A;  2GZO A;  1EIY B;  3TEG A;  4LSN B;  4PUO A;  2BAN A;  2LQ8 A;  1RAJ A;  2CQB A;  2QA1 A;  3BBB A;  1WC5 A;  4DR3 J;  4DR7 J;  2CQ3 A;  4NCA A;  2IHR 1;  2NSC A;  1CUL A;  2YXL A;  2VHG A;  2R7U A;  1T05 A;  3K0J A;  2DD8 S;  2WVB A;  5HRO B;  3ETO A;  4YQW A;  4DR6 J;  1X5P A;  2RJZ A;  4KRW A;  4HTJ A;  1YZ6 A;  1HBO B;  2DXD A;  3U1M A;  4OJH A;  2NRE A;  4DJB A;  4DF4 A;  4LRA A;  1BQX A;  4RJV A;  4ZP6 A;  3GG1 A;  1Q5V A;  3O44 A;  2VPY B;  5KOW A;  1RBA A;  5HMW A;  3Q0A A;  2F9J A;  5J2M A;  1FVQ A;  2MB0 B;  1FKP B;  4DV3 J;  3GYG A;  2N3O A;  1HHQ A;  2IVY A;  3KFW X;  3MEE B;  4CH1 A;  3DXB A;  3IR7 B;  1DTT A;  2YNG B;  4KGX B;  4ZIT A;  1IKW B;  2LFV A;  4B3O B;  1ZA2 B;  1TQL A;  5U47 A;  2FHO B;  1YQH A;  4JI3 F;  1RP5 A;  2RHQ B;  3MAA B;  3N79 A;  5CYM B;  2OPS B;  5J2P A;  3GYX B;  1RAE B;  3KXD A;  2ROP A;  3MMB A;  2ZH4 A;  1RAB B;  3NCQ A;  3TOQ A;  3MM8 A;  1SH2 A;  3KJV B;  1U2F A;  1MML A;  2FHJ D;  2M8H A;  2GIR A;  2C2K B;  1VC6 A;  5L9X A;  1PGZ A;  2YKA A;  4F02 A;  2UVW A;  2IDL A;  2MGZ B;  4MK9 A;  3LWL A;  3MUT P;  4L3N A;  3K8W A;  3SQO P;  2ZH5 A;  1XR7 A;  3Q86 A;  4F4Y A;  1WOS A;  2J8A A;  3OVB A;  3MPY A;  4NCG B;  1QLN A;  2ERR A;  4FN5 A;  5CYQ A;  4KC5 A;  4N41 A;  2W01 A;  3G8S A;  3CUN A;  2FC8 A;  4DR4 F;  3N0V A;  3MTJ A;  4ER8 A;  2VFR A;  2Y1L B;  3OFF A;  5K5M A;  2D9P A;  2LKZ A;  2XWX A;  2DB1 A;  2FLO A;  1HBM A;  2HHP A;  1W2B R;  3RGI A;  5LL6 d;  2R8H A;  4WFB Q;  1X4E A;  2MKC A;  5L46 A;  1KOO A;  4HKQ A;  4F4X A;  2ZHA A;  5E7O B;  2HQF A;  5BR8 F;  4KTQ A;  4P71 A;  4NE9 C;  2VFU A;  4DPX A;  3OTO J;  2QJ3 A;  1RT3 B;  3BGU A;  4WPA A;  4DLG A;  2ROG A;  1FKA F;  4AXJ A;  1S12 A;  3SSR A;  5F3Z A;  2BX6 A;  2RF2 B;  4Q2M A;  2ZHB A;  1S49 A;  4NX9 A;  4TXS A;  3B78 A;  4H4M B;  4DI6 A;  4ZLP A;  2FJV A;  1OQ3 A;  2Z56 B;  1K9M T;  2A3J A;  3JYT B;  4JI8 F;  4OYZ A;  4C8O A;  4DUT A;  5D4N A;  4YEA A;  1VHF A;  4WFY A;  2DHX A;  1HIY A;  1PJ5 A;  3MEC A;  1HWJ A;  3OSN A;  3DLK B;  2XZW A;  2OD4 A;  4XTT A;  4O4G B;  4K4Y A;  1S6Q B;  2ZBC A;  4ED7 A;  3VGV A;  1Y11 A;  1VGY A;  1HWK A;  5KFJ A;  1AZS A;  2COL A;  2KO1 A;  3RTV A;  1V3Z A;  2IJR A;  1VMB A;  1NRK A;  1RWM B;  2OML A;  2J6U A;  3AB4 B;  4HI1 A;  4C0O C;  3N4W A;  2ZE2 B;  1SUQ A;  2QLX A;  1QE1 A;  3F73 A;  1Q86 T;  3TAM B;  3A3N B;  1PCA A;  1Q8B A;  2M52 A;  5DO2 A;  3HSD A;  2FVS A;  4DR1 F;  4ITS A;  2MEW A;  2V8V A;  3M6X A;  3AXM A;  1WG5 A;  1TU0 B;  4QWA A;  5MLC V;  1S57 A;  3O5T B;  5IXU A;  3DHW C;  5DRK A;  2IM2 A;  2R9L A;  3UFC X;  1YX2 A;  1Q8K A;  1X4B A;  3AOA A;  1IM6 A;  4OJ1 A;  3EGZ A;  2OGU A;  5FDL A;  5LJ5 Y;  2FPH X;  2Y0S D;  4FYW B;  4ZVF A;  4LSZ B;  3LF0 A;  1JLG B;  2FZG B;  2HBZ B;  4C8N A;  3TJA A;  3ZO7 A;  2DPJ A;  1S76 D;  1XEZ A;  2PT0 A;  3H59 A;  4M5I A;  2NZ4 A;  4P2X A;  4GKJ F;  3C16 A;  4YHH J;  2HGM A;  2XSJ B;  2CAJ A;  1WOP A;  1LOU A;  3M8Y A;  2IDE A;  1FWP A;  2R8J A;  2CZ4 A;  3I4P A;  1HQU B;  2UU9 J;  3H5Y A;  2J0X A;  4A8W A;  3BO4 A;  1JWW A;  1RU2 A;  2N4C A;  1RKI A;  1H72 C;  3EX7 B;  4LT6 A;  2DGQ A;  3MM7 B;  2GO9 A;  1RI7 A;  3CJT A;  2F40 A;  5A8K A;  3QFH A;  2QSW A;  1R0A B;  4RW6 A;  4JI5 J;  2XC9 A;  3MTK A;  2YQ0 A;  1ZS6 A;  2HWI A;  4LF9 F;  4V19 X;  3ENV A;  4I68 A;  3AA9 A;  1FT8 A;  2K3I A;  3GZ7 A;  2BR0 A;  2Z57 B;  1DLO A;  3R1L A;  4UZC A;  3I82 A;  3PW0 A;  5CZV A;  5E3Q A;  4Y2M A;  3PKY A;  5H9F J;  1VQO S;  1F5C A;  2ZH3 A;  4ZDN A;  4B3T J;  3M2U B;  3I4H X;  2JVR A;  2ZOF A;  3K57 A;  3KG0 A;  2V67 A;  4A8Y A;  3BGL A;  3L09 A;  4PQA A;  5IT9 Y;  4M5H A;  1RJJ A;  3CJS A;  3MMA A;  2MZQ A;  2VOD A;  2GHV C;  2I5J B;  2Z2M A;  4WIQ A;  4C6A A;  3OFE A;  3DRS B;  4DV2 J;  3O6Q A;  3S6E A;  2H3E B;  3GJS B;  3PAC A;  4MKV A;  4PWD B;  4XPC A;  1ZTT A;  1SI9 A;  8AT1 B;  1D1U A;  2XCP A;  4LSL A;  3QAE A;  3ZNU A;  4J9Q A;  2DXE A;  4F2R A;  3ADA C;  2QGF B;  4DHV A;  5D0H A;  4K4X A;  3TZZ A;  2HBQ B;  3V6H A;  3VGU A;  2ZH1 A;  4V19 J;  3NGR A;  4FF3 A;  2DNL A;  2IJF A;  3DRR B;  2UUB F;  2F8H A;  1IBM J;  2MKY A;  4ZJQ A;  4UW2 A;  2RKI A;  3D7S B;  3DRX A;  1JXE A;  2E9Z A;  2Y0B B;  4YB7 A;  2NYI A;  2ZD1 A;  4FPR A;  3EWG A;  4Y2C A;  4LF6 F;  2OFH X;  2GJI A;  2PGC A;  2ZOG A;  2QZ8 A;  1LWC B;  3BKU A;  2FJB B;  2V5H G;  4EFA C;  2UXB J;  2U2F A;  2DHA A;  5KFL A;  2CPJ A;  2P5V A;  3QGI A;  4J9U E;  5IV3 A;  3IP0 A;  3MD3 A;  3NGD A;  3Q8S B;  4JI0 F;  2YQ1 A;  2VUG A;  2MY7 A;  2OPR B;  2KZZ A;  2QV6 A;  2B4V A;  2AF6 A;  2BRL A;  3VCD A;  2LQ5 A;  4AQY F;  4PXC A;  2YNI B;  2DNN A;  2VPX B;  2VC1 A;  1NSP A;  5L1J A;  2EC2 A;  4JI2 J;  5ITH A;  2YWK A;  5IS2 A;  3DOL B;  1GMV A;  2OPS A;  2AV5 A;  2GHW A;  4Q0B A;  3SCK E;  3AOC A;  4DR2 F;  3DOM B;  1MRO A;  1RT1 B;  3OBI A;  4J9M A;  3F41 A;  4B08 A;  2YKM A;  3X1L B;  3UN3 A;  3QRQ A;  4C11 A;  5A6W A;  1W7W A;  5HQL A;  1SJ3 P;  4DPU A;  1GXL A;  2MZ1 A;  3OTD A;  2K3K A;  2ZOM A;  2PC6 A;  5LMU J;  3LP1 B;  4MYT A;  1HPZ B;  3GCX P;  3DRP A;  1FVS A;  5DLG A;  4LRF A;  3PM9 A;  1FFS B;  2X1B A;  1KON A;  2DGU A;  3RB6 A;  4R5P B;  4DPT A;  3FZB A;  1XER A;  1M0S A;  2VZ9 A;  2XB2 D;  4AL6 A;  2KH9 A;  5EX3 A;  5KTQ A;  4O44 B;  3OL6 A;  1EP4 A;  4WTY A;  3V6K A;  1RSC A;  5EN1 A;  2DNM A;  5B0E A;  3P45 B;  3GV5 B;  4CTA B;  3PIP Q;  1RHU B;  4NAS A;  2DNG A;  1S9F A;  5FII A;  2GJF A;  3VZI A;  4URS A;  5D3G B;  1X4G A;  3RYL A;  4WP9 A;  3UPF A;  4ZIV A;  1JNR B;  3HFV A;  4USJ C;  3V5R A;  4CDI A;  1IKY B;  2WHO A;  1BGX T;  3JAM U;  2C2M B;  2ZZT A;  3GB0 A;  1HBN B;  5KG0 A;  1HYS B;  3DI6 A;  4DQR A;  4N47 A;  3UO0 A;  4ETX A;  1BMQ B;  5EX0 A;  3WIV A;  2XUL A;  3BR9 A;  3FBC A;  3TYT A;  2VBW A;  4QIE A;  3CME S;  2V69 A;  4O3N A;  2M7S A;  5JJB A;  3K7R A;  5GAE U;  4TU9 A;  2V8H A;  1S5Z A;  4LF8 F;  2VPZ B;  1PC5 A;  4I6Y A;  1Z2L A;  5B09 A;  1JLA A;  2VBZ A;  3MEK A;  4X4Q A;  1M5K C;  1VCT A;  3TJ8 A;  2BAB A;  2N7C A;  3CB4 A;  2PMZ D;  1HNI B;  2BJ9 A;  1LWF A;  4IR1 A;  2DNH A;  4DFP A;  1EET B;  1Q82 T;  3T1Y J;  3VGT A;  3KK2 A;  3ZZ0 A;  1U8S A;  2GGP B;  5DGA A;  3V81 B;  2R4F A;  4J9N A;  4NZ0 A;  2PMW A;  1S1X A;  1XIQ A;  3I32 A;  4C8Y A;  3M8P B;  3DLH A;  2P8I A;  5BXI A;  2CG4 A;  1JJ2 R;  1N54 B;  3UNG C;  3OT9 A;  3GCW P;  1OYD A;  4DFJ A;  3M8Q B;  4BHQ A;  1KHV A;  2QTW A;  5HP1 A;  5KAK A;  3PR5 B;  3A8J A;  1VK3 A;  4K4U A;  1PYO B;  4G3I A;  1YJ7 A;  4DG1 A;  4DR5 F;  3IS9 A;  5F8G A;  4W92 B;  5B0B A;  3D9B A;  4KHM A;  3T19 A;  1U1Q A;  4HAC A;  3MF5 A;  3RUB L;  2G2Z A;  2I38 A;  1BWE A;  3FRY A;  4WK1 A;  4LF1 A;  5DQG A;  5KT3 A;  2HFO A;  5CHC B;  2H51 B;  4L6V 3;  2EFP A;  2HHT A;  2MJN A;  3PHT A;  5CD4 H;  3GR0 A;  2HVZ A;  5A8W B;  2DCL A;  1LK5 A;  3W65 A;  2DRA A;  3UI3 A;  4MAK A;  4IFV B;  3I9V 9;  2CRL A;  3VVT A;  5DLF A;  1EQ0 A;  1K0T A;  1RWW B;  4FZV A;  1M5S A;  3P4U B;  4K4W A;  1JXV A;  1T95 A;  4I4B A;  4K59 A;  4IG0 B;  3J7Y U;  2GQQ A;  4B3M F;  2OPP A;  4CT9 A;  3H42 A;  1C1C A;  2XWY A;  3UDC A;  3C6U B;  4EK2 A;  2HAI A;  3I9Z A;  1B7Y B;  3KLH B;  4F0M A;  3PJ9 A;  1XBW A;  3DYA A;  2LU2 A;  5LSL A;  2J7W A;  1YSJ A;  1SCJ B;  2ZFH A;  4C3L A;  2MQM A;  2YNF B;  4O3S A;  5I4M A;  4LF7 F;  4QYR A;  4NRU A;  3KDO A;  2RH3 A;  4IG3 B;  2XYH B;  5I3U B;  2YWG A;  3EVW A;  3ITH A;  2LMI A;  5KFG A;  2RU9 A;  3SFU A;  2BM0 A;  2IRU A;  1T9W A;  2F4V F;  4RUA A;  3CJ3 A;  5A2Q Y;  1EB0 A;  2DH9 A;  2V8D A;  4M5L A;  2K1R B;  3NL0 A;  4ZIW A;  3R5D A;  4R8U B;  2FJE B;  3IWX A;  3CPW R;  1TKZ B;  2PI4 A;  4LR9 A;  3NRB A;  1KC8 T;  4QJV A;  1HBU B;  2ZVI A;  3NAI A;  4KO0 B;  2RVJ A;  4TY8 A;  1H0H B;  3KLI A;  4ES2 A;  1HI8 A;  4O0I A;  2QLB B;  1IVZ A;  4DSF A;  2VL1 A;  4ALZ A;  3KK3 B;  3PW2 A;  3D68 A;  3FRZ A;  1PG5 B;  5F0W A;  1EZZ B;  3CCM S;  3KWM A;  2MHE A;  3ILL A;  4X4U A;  4JI1 J;  4OV1 A;  1IJF B;  1WJ9 A;  4ECX A;  2DVI A;  1D9D A;  3CIM A;  3EUN A;  4CO2 A;  1MU2 B;  1GFW B;  1CEZ A;  4B9S A;  3SFG A;  1RTH B;  3HT0 A;  3KDN A;  3CJK B;  1I51 B;  2DK2 A;  3FQL A;  1YI2 S;  1UEK A;  2HNZ B;  1TV6 B;  1IBC B;  4USH A;  2YX7 A;  3FEY B;  1KFD A;  2QA4 S;  1UMJ A;  2XI2 A;  5A76 A;  2W25 A;  3BR8 A;  4RW7 A;  1LWX A;  1HNX J;  1K44 A;  1X5S A;  1NHU A;  3HJF A;  4OI4 A;  1U24 A;  3I31 A;  1MMN A;  2E66 A;  5D0G A;  4PPZ A;  4Q8F A;  2C2E A;  1RA7 A;  2R7O A;  3W7B A;  3CUL A;  4PXE A;  2BZ2 A;  4DSI A;  3A3P B;  1HFE L;  2PDA A;  3R5C A;  2MLX A;  4C8L A;  2CNK B;  1GX5 A;  2AP6 A;  5F8H A;  1UEU A;  1NPR A;  1PAU B;  4AD6 A;  3B4M A;  2X1F A;  3T1H J;  1MWY A;  2RDJ A;  4FF2 A;  4PYA A;  4HEA 9;  1YBA A;  2ZWP A;  1Q95 G;  1FJC A;  2VG6 B;  4PG7 A;  5CA5 A;  1ACM B;  3EZO A;  3IGN A;  2M70 A;  5L38 A;  3WX8 A;  2BE9 B;  5IM0 A;  1R8H A;  2MSS A;  2QL9 B;  2JFD A;  2YKN A;  1KQG B;  1IBL J;  4LFA J;  2B6A B;  3CJ5 A;  2LYV A;  1I6J A;  3W2W A;  4CH7 A;  4KV8 A;  4B9M A;  5EDW A;  2NXU A;  3QGH A;  1BY9 A;  1F6T A;  3QQC D;  2NQP A;  4RBU A;  2E1A A;  1FKO B;  3LQV A;  1S97 A;  1OO0 B;  3IC1 A;  5DG7 A;  5J2Q A;  1REV B;  3DDI A;  1GTE A;  5HSP A;  2V4Q A;  3I0R B;  4IH5 A;  3EDQ B;  4G1Q A;  3LGH A;  3S7R A;  5T41 A;  3M30 B;  1N33 J;  2XMM A;  1N5Y B;  1PKU A;  3CDB A;  1X4D A;  3J7Z T;  4ZVG A;  3DGV A;  4DQI A;  4EZ9 A;  1N34 J;  4J9V A;  1IN0 A;  2MKS A;  2B8Q A;  2OLW A;  1S1W A;  1NND A;  1HNZ J;  1U4B A;  5DG8 A;  2R7W A;  2XEX A;  1KP6 A;  3EXC X;  9RUB A;  1H6K X;  1VRT A;  3T5J A;  4ZS6 A;  2OUG A;  5HK4 A;  1ZM3 A;  3MD1 A;  1NB7 A;  2XMK A;  3BH7 B;  2M2B A;  3M1V B;  2C3M A;  1N0V C;  1P8G A;  4NI2 A;  1UVI A;  3SXL A;  1CSJ A;  3UDL A;  2XMT A;  4I6A A;  3R2C J;  3GJR B;  4QIV A;  3CNQ P;  1G4C A;  1CJT B;  3WC2 A;  3TZW A;  2D69 A;  2V8G A;  4BBY A;  2IA0 A;  1HR0 J;  1JXL A;  3T6J A;  1VIO A;  2UUT A;  1Q4R A;  4GC6 A;  1C0U A;  1OQ6 A;  4BS2 A;  3OR1 A;  2C2Z B;  3D2W A;  4DV0 F;  4F26 A;  5K8N A;  4PEO A;  2WW8 A;  1IJE B;  5AJ3 J;  1RXO B;  4HT7 A;  4CWB A;  2HFZ A;  4HHH A;  3OSP A;  1JLF A;  2CQ1 A;  3M2R A;  2V0N A;  2LEC A;  5HJY A;  4PR6 A;  2HK2 A;  3CJ8 A;  2XS7 A;  1U1M A;  2FIU A;  2HLT A;  3EM1 A;  2ZWO A;  3AD8 C;  1Q16 B;  4E2F B;  4DZ6 A;  4X62 J;  1VK8 A;  1N32 J;  2P9C A;  2VQE F;  2RS2 A;  3AJD A;  1NHV A;  2RIL A;  3GSI A;  3N5B A;  4PRF A;  5DDR C;  4QR1 A;  4UST A;  4IDK B;  2NCK L;  1HMV B;  2AIR B;  1X0P A;  4JB8 B;  5KFX A;  4LFC F;  2V2Q A;  4MFB A;  3D1Q A;  2DCU B;  3OL8 A;  3VWS A;  5AXN A;  5H1S V;  1YBU A;  3HFZ B;  1XQI A;  5IC4 B;  3ISN D;  2E1M C;  4EO8 A;  3GIJ A;  2MKJ A;  2AJ4 A;  2XCA A;  4K4T A;  3LAM A;  4DLE A;  2J9D E;  2HVD A;  3M6W A;  5L1L A;  1SL1 A;  3M9N B;  1NDC A;  4QZV B;  3X3U A;  2BRK A;  2W9C B;  4Y3C A;  4KSE B;  2KVQ E;  1WOO A;  2AGP A;  1WHV A;  2ZKT A;  4DBQ A;  2JEI A;  3DU5 A;  3QGP A;  3CF5 Q;  1NZ8 A;  1YG0 A;  3LOU A;  2C3Y A;  5KFD A;  1TK8 A;  3GMG A;  4XIU A;  1S4F A;  2IRX A;  1FD8 A;  3GII A;  2CDQ A;  3T5H A;  2V4J A;  1KLM B;  4CO5 A;  5L9N A;  4HH0 A;  4JI3 J;  3KK1 B;  1WG4 A;  1HI0 P;  2NYH A;  3ZXW A;  2KM8 B;  5KFT A;  3C14 B;  2FHK A;  5L1I A;  4I69 A;  3D6T B;  3HFK A;  3T5L A;  4NOH A;  1IKX B;  2JRS A;  4ATN A;  1SV5 B;  2L9W A;  2L9N A;  1WC0 A;  4A8X A;  1SH3 A;  1U49 A;  5HVH A;  2MXY A;  4YFU A;  1P9Q C;  1U02 A;  4CCH A;  4F4W A;  4C8Z A;  3TUJ C;  2W2O P;  2JEF A;  1RHK B;  4ZP8 A;  3PYE A;  3D3B J;  1N88 A;  2R3V A;  1FK9 B;  1Y00 A;  4ZPD A;  4Y0F A;  3CJQ A;  4G6V B;  4JOU A;  1T3N A;  3NBP B;  3PFE A;  4R0J A;  2AJ0 A;  5ETM A;  1KQS R;  4ZPA A;  2B5J A;  2QE5 A;  2BKP A;  3ZZZ A;  2IYG A;  2FLP A;  1DTQ B;  2XHC A;  2HK3 A;  1Q8L A;  2OP5 A;  2DO4 A;  4DR4 J;  4PWU A;  2J9C A;  2E5J A;  2UV8 G;  4A47 A;  2J0Q D;  2BW2 A;  4ZPW R;  4ED4 A;  3C15 A;  1H73 A;  2W1B A;  2QYG A;  5B7W A;  4OYA A;  2JL9 A;  5ETQ A;  4TVA B;  3MMC A;  2QO3 A;  3SSQ A;  4FYY B;  4H54 A;  1PBU A;  1HHS A;  3FSY A;  3MCN A;  3CO0 P;  3VAG A;  2IC3 A;  3JSM B;  4CLP A;  2HNY B;  4ELT A;  5BR8 J;  4NRT A;  2VFS A;  1FEE A;  4DDF A;  1DY3 A;  1FDN A;  3FZ2 A;  4IH6 A;  4LVN P;  2OFG X;  3Q8Y A;  2KXF A;  1I1G A;  1F3F A;  4JI6 F;  5KFR A;  1QVG R;  4ED6 A;  2JLF A;  3Q89 A;  5J1E B;  2V2V A;  4IQX A;  4CLL A;  1K73 T;  2I1R A;  4TQR A;  4F50 A;  1WEY A;  2E7V A;  4JI8 J;  2AMC B;  5M2R A;  3P49 B;  2GW8 A;  2V2K A;  2HAF A;  4RUC A;  3TX8 A;  2E1C A;  3ICL A;  4LF2 A;  1RAG B;  3UN5 A;  5K20 B;  1RHQ B;  4M5G A;  1S59 A;  1C1B B;  3H20 A;  2OEM A;  4RW4 B;  5FLX U;  4WII A;  4B3T F;  4PAA A;  1N8R T;  3VF0 B;  4DN9 A;  3FUY A;  4XDC A;  1YIT S;  3HF5 A;  1X4C A;  4FKX A;  2BOP A;  3FCH A;  2MTL A;  4KKO A;  2DGS A;  1CJU B;  2W2Q P;  4OMF G;  1F2H A;  1WG1 A;  4P7V A;  3CCL S;  1D8Z A;  4L74 A;  4DR1 J;  1Q8I A;  1V3S A;  4PWW A;  2KT3 A;  3N01 A;  1GXT A;  2UV8 A;  1NK7 A;  1BLU A;  1WNE A;  4ETZ A;  4WZQ A;  3QIP B;  2W2M P;  1S48 A;  4YB6 A;  2CPH A;  1GEH A;  1N5T A;  3N9U C;  3RBX A;  4M5K A;  4K5S A;  2RU3 A;  3NGT A;  4NWB A;  2AU0 A;  1F9E B;  4OI6 A;  2VBX A;  2O3D A;  1N6Q B;  1IBM F;  4NLX A;  1K1Q A;  2OIH A;  3CW2 C;  4FKY A;  2VIC A;  5DS7 A;  4GKJ J;  1RDR A;  3JSY A;  3BPS P;  1NK4 A;  4J37 A;  4PCQ A;  1UJ6 A;  1JB0 C;  3BS9 A;  3MI7 X;  2OD6 A;  1JKH B;  2Q6B A;  3ZZY A;  1S1U B;  4Z7Y A;  2LDI A;  5HAO A;  2LQB A;  1AT1 B;  4EU0 A;  3BSN A;  5HVF A;  4AT1 B;  4DL3 A;  3TAP A;  3HHN B;  1XK8 A;  2NPI A;  3QSY B;  3BO3 A;  3VVU A;  5D4O A;  1FJG F;  3N6N A;  3W3S A;  3TVY A;  1U47 A;  2Q79 A;  2BMB A;  2ASJ A;  3TZY A;  1VRU A;  2ADB A;  4LF9 J;  4C4W A;  1NUE A;  2J0W A;  2QMX A;  5C25 A;  2VB6 A;  3HXM A;  3QWP A;  2ZUA A;  1Q81 T;  2JSX A;  3D3C J;  3IWN C;  1H2V Z;  1HWI A;  3M7V A;  3BGR B;  1PSD A;  1TL1 A;  1RTD A;  4A8Q A;  2HRT A;  1RCX B;  1BQN B;  2HRY A;  1RT6 A;  1RAO A;  1R8C A;  1KVI A;  4EYH B;  2B8P A;  4ZVO B;  5E0O A;  1CJK B;  1L3V A;  2EFN A;  3MEG B;  3NS5 A;  3CMQ A;  1KDN A;  2W9B A;  4J9O A;  1JJH A;  4UOH A;  1TKT B;  3U1L A;  4P2F A;  3HO1 A;  1FNM A;  2KXH A;  3MM6 A;  1U48 A;  4A8K A;  3LP2 B;  1U25 A;  5T7L B;  1UVM A;  1S1T A;  2JVO A;  3R8Y A;  2W7A A;  5D4L A;  4FP9 A;  1VQK S;  5HLF B;  1T8E A;  3A4T A;  1TKD A;  5IZH A;  1NKE A;  4USW A;  3BDP A;  4EUV A;  3RU0 A;  1Q7Y T;  4OHY A;  1HMV A;  2CPX A;  2DRD A;  1WWH A;  2PI5 A;  1SXL A;  4DSE A;  4GO7 X;  2ILZ A;  4K2J A;  3GIM A;  4F2S A;  2Q6C A;  3HX9 A;  4H4K A;  3G96 A;  4QIW D;  4LF6 J;  3TWZ A;  3K2Y A;  1YKW A;  2EW9 A;  1JLC B;  1UFK A;  2VJV A;  3KNA A;  3MUR P;  3J7Z 5;  3G71 S;  3OUY A;  2KRR A;  2MKI A;  3DLG A;  1QSL A;  3WX4 A;  3FJ2 A;  3CJ0 A;  3MED A;  3WZ0 A;  1NH8 A;  2IBO A;  4I2P A;  2MQL A;  4WBF A;  3BQ2 A;  2CJB A;  5GMD A;  2F7V A;  5D0E A;  1HNV A;  1SH0 A;  4JI0 J;  3KLV A;  3QO9 A;  4H4O A;  4DUZ F;  4J91 A;  1LW0 B;  5C24 A;  3MPW A;  1VBK A;  4H4K C;  5KFE A;  5KFC A;  1J5E F;  4KFB A;  1T03 A;  3EJM A;  2DR8 A;  3O3L A;  3MAH A;  4URQ U;  4AQY J;  1NO8 A;  1CLF A;  1TMJ A;  3H8Y A;  3TQ1 A;  3HSJ A;  4LFB F;  1E6V A;  1TKX B;  3W61 A;  3IRX A;  1HNW F;  1S79 A;  1T94 A;  3BN7 A;  2E7W A;  2Z8Q A;  3R5G A;  1GMW D;  2OEJ A;  2B4P A;  4NLT A;  2QIF A;  1RT7 B;  3FDS A;  4A48 A;  3G2X A;  4DR2 J;  3G82 B;  4CO4 A;  2VKZ G;  1CJV B;  2HHH F;  4EO6 A;  4CYU B;  3QT8 A;  4ZMM A;  3D6F B;  3DLL Q;  2OSR A;  4ID5 A;  1T0T V;  5AXM A;  1SV5 A;  2DNR A;  2HYI B;  1IKV B;  3I56 S;  1NME B;  4ANE A;  2EI5 A;  2D3O R;  3HMJ G;  4UOC A;  4O3O A;  3ZC4 A;  4C8M A;  2QN6 B;  4NLR A;  2P9G A;  1CS4 A;  3DM2 A;  1ZBT A;  3WBZ A;  1CVJ A;  3WC0 A;  2KM8 C;  4D3G A;  4KJI A;  1PYS B;  2W7P A;  1TL7 B;  5HN0 A;  3VGS A;  3NAH A;  1ROF A;  1P1T A;  2KN4 A;  3E01 B;  5F8M A;  3IR5 B;  3KLF A;  1DQA A;  3G86 A;  4F3M A;  5CQG A;  2NXJ A;  3MPV A;  2XY7 A;  2AYM A;  4L75 A;  3MR2 A;  4DSL A;  3MCS A;  4RBT A;  2Y8Y A;  4CLW A;  3I0S B;  4C8K A;  4OIX A;  3BB5 A;  3T6B A;  2AW0 A;  3DNC A;  4IKA A;  5G4D A;  4Y2K A;  1KRP A;  3TR5 A;  5K14 A;  1QAJ A;  3L7O A;  4CRJ A;  2OO4 A;  3C2P A;  2GO8 A;  2UUW A;  4P2S A;  3BGO P;  2IAJ B;  2AKW B;  2EK6 A;  3MCM A;  4USU A;  1RUS A;  4QIF A;  3KG4 A;  3HUL A;  3TUZ C;  2AYG A;  2ZIT A;  4RPF A;  3AH6 A;  3OQ2 A;  4LF8 J;  2DXF A;  4NPO A;  2QLJ B;  5B0G A;  2YVS A;  4XO0 A;  2K7J A;  3POT A;  1JLQ B;  3M2V A;  3MPD A;  3OFH A;  1YVF A;  3ZZU A;  1AXQ A;  1KTQ A;  1L5U A;  1YDL A;  2ZKU A;  2XMA A;  1UCN A;  2FJA B;  1JMT A;  2AGQ A;  4W98 A;  3FVY A;  2RNE A;  3V6D A;  2CJ9 A;  2B7C B;  2EG2 A;  4KAI A;  2CVE A;  1VYA A;  2GV1 A;  2AQ4 A;  2CPY A;  1HQE B;  1ICE B;  3EZU A;  1U1P A;  3DMJ B;  3HZG A;  3ZTO A;  4C0B A;  2B3T B;  1RBL A;  3V4I A;  4NYO A;  1XC9 A;  3QRP A;  2E29 A;  4KHP F;  2PO4 A;  5D4P A;  1T02 A;  1OSD A;  2H65 B;  4ZOS A;  5DM6 Q;  1R89 A;  2DY1 A;  3AFG A;  2X7I A;  2JEJ A;  5B0F A;  3D6M B;  3KOA A;  4NYZ A;  4DV1 F;  2AYB A;  1RT5 A;  2X1A A;  2CG8 A;  2JWN A;  3CED A;  3MR6 A;  3D67 A;  2CFX A;  2JJ4 D;  5EHH A;  1WEZ A;  5KG3 A;  2KVI A;  1ZZN A;  8RUC A;  4FVM A;  4DS4 A;  1M1H A;  2EBE A;  4KT0 C;  3RZA A;  3LP0 A;  2J6S A;  1Y3K A;  4ZVH A;  3RRK A;  1WF0 A;  1B0V A;  2B4O A;  3QLH A;  1M1K T;  4RW9 A;  2Y1I A;  1X0F A;  2ZC4 A;  4USV A;  1F5A A;  3D4J A;  1GQE A;  2AWZ A;  4J9L A;  4PG5 A;  4D3H A;  2KYZ A;  3R5B A;  3ZTQ A;  2YKP A;  1KBR A;  2LLZ A;  4OJG A;  2RIJ A;  4UQG A;  2HMI A;  1HL6 A;  2Y1R I;  5KFS A;  5KT6 A;  2HVE A;  2BE2 B;  1S7H A;  4M5D A;  4OV6 A;  1S0V A;  1WHY A;  3MM9 A;  2FD2 A;  1VC0 A;  4FS2 A;  4NXN F;  4DSK A;  2GMH A;  4WKY A;  4NA1 A;  2NPF A;  4ES3 A;  4B3M J;  3CDW A;  2DRB A;  3HHL D;  4TQS A;  4CNZ A;  1IR1 A;  4WFZ A;  2OTL S;  1RT2 B;  5F9L A;  2HPU A;  1O8B A;  3CCZ A;  4LF7 J;  2MLZ A;  4Q7A A;  4LUB A;  1VBY A;  1SQF A;  2LXF A;  4ED2 A;  3HVT B;  3T1H F;  5A8R B;  3KLE A;  3H5U A;  1NDP A;  4OHX A;  5IQ6 A;  2J7K A;  4A8S A;  1R0C B;  4WE1 B;  1S0N A;  5KFV A;  2Z2Y B;  3M32 B;  2F4V J;  4LF5 J;  4PYD A;  4OI3 A;  4OZJ A;  3FQK A;  3CT9 A;  2FY1 A;  3JTN A;  2XLJ A;  4GVB A;  4JYA F;  5HMY A;  2G13 A;  2HBY B;  1NKB A;  2AX0 A;  1VQS A;  4FF4 A;  2O1P A;  1M5P C;  4ECV A;  1N4L A;  4IRD A;  1WUU A;  5HJX A;  4MKY A;  3KHG A;  1XNR F;  3CC7 S;  2CQG A;  4HR2 A;  4TY9 A;  4ED3 A;  3HHL B;  1Y5N B;  1G7C B;  3SCI E;  1N36 F;  2G1D A;  2R8I A;  1TZ0 A;  4RNN A;  2WOM A;  2YH0 A;  3DGP A;  4QIG A;  3IBC B;  1BQM A;  1EKS A;  2RDD A;  1TUW A;  3RR7 A;  3MM5 A;  2HHX A;  2VG5 A;  1IBK F;  1WKL A;  1S6P B;  5ADZ A;  3NNC A;  2Q43 A;  4WK3 A;  2GQC A;  3BGF A;  1S9E A;  4GVL A;  1U2C A;  4NLQ A;  3OTB A;  3G6X A;  3CJ2 A;  3B82 A;  2Y9H A;  2DR6 A;  1WC4 A;  1TL3 A;  3DLE B;  2XQC A;  2FJD B;  3J7A N;  3BZQ A;  1OPI A;  2MDA A;  4LIR A;  2DHH A;  3H4B A;  3CO9 A;  2JC1 A;  1YK9 A;  3IGV A;  5KFM A;  1GNK A;  4RW8 A;  4XDD A;  5C42 A;  2F8M A;  2NUH A;  5ETT A;  2XMW A;  2I6W A;  3RRH A;  5KG6 A;  2BJ7 A;  2OPQ A;  3C6T A;  1PYT A;  2B9X A;  2HQI A;  4QU6 A;  4OYB A;  5HI7 A;  4WP8 A;  1UVN A;  4ZPB A;  3ENQ A;  4NLP A;  4RNH A;  1KOH A;  2BQU A;  2ASD A;  1D9F A;  4OI0 A;  1AB8 A;  3M9O B;  3HVR A;  2DNQ A;  3R1H A;  4F67 A;  1RTJ A;  3ZZT A;  3I87 A;  1QSS A;  3AA8 A;  3JQM A;  1X60 A;  3DFE A;  2DNP A;  3OL7 A;  4O0N A;  1MSW D;  5HVG A;  4P74 A;  3W5Z A;  3AJ1 A;  1VHI A;  2RDI A;  2QL5 B;  1IXK A;  1E6Y A;  4F25 A;  3GYN A;  4PG4 A;  2CPZ A;  5BYR A;  2XM3 A;  2A0F B;  1Q1K A;  5KG5 A;  1NEE A;  4RZR A;  3FBE A;  2F1F A;  3Q83 A;  4B9L A;  5LXR A;  1RTZ A;  1S9G A;  2YNH B;  2YKQ A;  3ZTR A;  3R9L A;  3KLG A;  1S10 A;  2V9W A;  4M95 A;  2W8L A;  3SIP B;  2AD9 A;  8ATC B;  2Q1L A;  2FGO A;  3OHB A;  4X84 A;  1IM4 A;  1NJY A;  2FHM A;  4LR8 A;  3ET6 A;  2CPD A;  5DGB A;  5A0Y B;  3FFI A;  2ZH7 A;  5KFA A;  2EFO A;  3CIZ A;  4X2B A;  3BH6 B;  3SSS A;  2ZH2 A;  1N5S A;  5CD4 A;  2KT2 A;  1U1O A;  2C42 A;  5H9E K;  2RS8 A;  3HZE A;  4ZPV R;  1XMB A;  3RW6 A;  1LWE B;  2Y8W A;  3KHH A;  4ANC A;  3SMZ A;  3MFI A;  2R7V A;  1RE1 B;  4ECW A;  3FEX B;  2D9O A;  3TO8 A;  3SDE B;  2BVZ A;  4UY8 T;  2PSZ A;  2W7O A;  3G6E S;  1K47 A;  2OMO A;  2XS5 A;  4GRS A;  1HAR A;  3THV A;  5KFP A;  2RRA A;  3US5 A;  3MMJ A;  4YY3 F;  2ZZN A;  1FFG B;  3GIR A;  4K2X A;  3JS9 A;  1XMO F;  4OZ0 A;  2QC3 A;  2XO6 A;  4NML A;  2KDO A;  2PA8 D;  4DV0 J;  4Q43 A;  5EGY A;  3FSI A;  1VJW A;  4IRK A;  1B0P A;  3D5M A;  3DOK A;  2E9T A;  4WYW A;  9ATC B;  3ZTP A;  1U0H B;  3VAF A;  1QUP A;  1RLC L;  5LXY A;  3TUI C;  3SZ2 A;  4DN0 A;  1Z4U A;  5G0R A;  1ELO A;  5J2N A;  3OR2 B;  2QFI A;  5D77 A;  2VQE J;  5THW A;  1J2V A;  1RWN B;  2VC0 A;  4KPC A;  4RU2 A;  4RX6 A;  3LW5 C;  1X5T A;  2LA4 A;  5HBM A;  5LT5 A;  2AJF E;  3AOB A;  3CXC R;  1C0T A;  2GHP A;  4EWT A;  1JJ4 A;  2VG7 A;  1RT4 B;  4OX6 A;  1NLK L;  4LFC J;  2HVI A;  3I6P A;  4P75 A;  1SKU B;  5DJB A;  4FVC A;  4OX9 J;  1N52 B;  2GMJ A;  1UWB A;  3B8H A;  4Y34 A;  3CGI A;  5HL7 Q;  4U96 A;  4K4S A;  3NMA A;  4TU8 A;  3CJR A;  2HUR A;  3M8Z A;  1ARO P;  3GE9 A;  4Z7C A;  1XNQ F;  2LEA A;  4OYI A;  3IA0 A;  4BCA A;  3H0P A;  5KFZ A;  1Y9O A;  4DOZ A;  4Q45 A;  4AFF A;  3RG6 A;  2DNK A;  3W2V B;  4M94 A;  3TEH B;  4P2M A;  1LFW A;  4KB7 A;  2WSF C;  1FWK A;  2HW3 A;  1F0X A;  2VPW B;  4MTP A;  3A13 A;  3OHA A;  3EE3 A;  4QR0 A;  1RA6 A;  5HQ8 A;  2L9D A;  5KFW A;  5CZX A;  4FS1 A;  3T1A A;  4UT4 A;  3F56 A;  3D1O A;  2HLU A;  3LGN A;  5F41 A;  3RJM B;  4FBT A;  2DR5 A;  1QSY A;  3H98 A;  4L72 B;  5GME A;  2GFF A;  4LRC A;  1R8B A;  4ZN1 A;  4I7F A;  4ZVU B;  2GVD B;  3RW7 A;  3G8T A;  3UVJ A;  2CXE A;  1RTI B;  5GAG I;  2GVZ B;  4ECT A;  4JV5 F;  2BM1 A;  5GAH I;  3L7P A;  2GIF A;  4TLQ A;  1IWA A;  3Q22 A;  3DN9 A;  4MH8 A;  1BE4 A;  2G9O A;  4PXD A;  1TVR B;  5KT2 A;  3LWM A;  2B43 A;  2HEK A;  3JSB A;  3VAL A;  4QYZ K;  3RBD A;  2HIQ A;  3H5X A;  5CAA A;  2B56 A;  3CCT A;  1J5O B;  4IFY B;  3ZTS A;  2LEP A;  2BDP A;  2W2P P;  4EEY A;  3UW1 A;  2AGO A;  3FC9 A;  1Q79 A;  4XAK A;  5JMN A;  4Q5V A;  4ZHR B;  1YJV A;  3AQP A;  1JLE B;  3IG1 A;  4ICL A;  5CXT A;  4PG8 A;  4LR7 A;  4WZM A;  2XZD B;  3MPU B;  2WON A;  4A8O A;  3R7S B;  4X64 J;  1TFY A;  1M5H A;  3IM8 A;  1B7F A;  2VIH A;  1VJQ A;  4FNH A;  4N8O A;  4CH0 S;  2BXJ A;  2OJ3 A;  2O67 A;  2J0S D;  5B08 A;  4FYD A;  1NDL A;  1TP7 A;  3SQG B;  1JLB B;  4F7V A;  1ZM4 A;  2PN6 A;  2QYC A;  1W2I A;  2MPU A;  3GIL A;  2K8G A;  5DQI A;  4YN3 B;  3T9Z A;  3PO4 A;  2AJ1 A;  4JI6 J;  4PQU B;  4LBP A;  2HWH A;  4NLD A;  3BM7 A;  3TA2 A;  2OI2 A;  2PA3 A;  1RB0 A;  1RHR B;  1A6L A;  1HQ2 A;  3H4D A;  4DPY A;  2HBR B;  3O2I A;  4CM2 A;  2Q3P A;  4WXO A;  2CKW A;  2ZJP Q;  1VI7 A;  4LRB A;  1CPZ A;  1VIS A;  2HQ3 A;  3T3F A;  3H7H B;  4FXD A;  5CCL A;  2JOQ A;  3Q8V A;  1RWX B;  2P9E A;  1SPB P;  1N0U A;  2BW7 A;  2FGC A;  3PJX A;  3CDE A;  1TTH B;  3FGV A;  1PIE A;  4ZVT B;  2C2R A;  5KT7 A;  5EWF A;  3BN4 A;  4EGL A;  4E8U A;  3KUG A;  4PUO B;  2BAN B;  3BSC A;  1FE0 A;  4TNO A;  1CUL B;  1WOR A;  4R25 A;  1T05 B;  2V9K A;  5I42 A;  3GV8 B;  1QY7 A;  2ZVS A;  1FEH A;  1NK9 A;  4HHJ A;  2DKO B;  3R97 A;  3UCU P;  1AYE A;  3BYP A;  5KFU A;  2J9E A;  2ROE A;  4I2Q A;  2FQQ B;  1C4A A;  2OTJ S;  1WF1 A;  2D7S A;  4LSN A;  2YX1 A;  2XLI A;  4MKB A;  5J2M B;  4OHV A;  3H25 A;  5DDP C;  1YBT A;  4RUB A;  4Y65 A;  2F3J A;  2IVM A;  4MIW A;  4CZC A;  1NSQ A;  5HRO A;  1DTT B;  2UUA F;  4WFA Q;  4I6W A;  3NNA A;  3GFH A;  3TJ9 A;  1HBO A;  7AT1 B;  4C3K A;  3GFX A;  1FRX A;  4W90 B;  5J2P B;  1ZPV A;  5L1K A;  4CP5 A;  3K8V A;  1SL0 A;  3MWB A;  3MMB B;  4ZCL A;  2E9R X;  3U1N A;  3GON A;  3MM8 B;  2LA6 A;  1FKP A;  1OMS A;  3FSX A;  3MEE A;  2YNG A;  4LMZ A;  4WFX A;  1IKW A;  1FJG J;  4B3O A;  1I5O B;  4DV6 F;  5KG4 A;  1FA0 A;  5AE3 A;  4OZ3 A;  5SUH A;  5ETO A;  3MAA A;  3PYG A;  3MR3 A;  1V5I B;  5CYM A;  1IWG A;  4ZVQ B;  2FZK B;  3KJV A;  2FYX A;  1AUD A;  3KKF A;  3IWL A;  5F3T A;  5CYQ B;  1QDU B;  3MOJ B;  1UVJ A;  2D3Z A;  2MGZ A;  2FY8 A;  2HKE A;  4DV4 F;  4QW8 A;  4TYA A;  3NOC A;  1HBM B;  2WAQ D;  3CCU S;  1ZYQ A;  5IT4 A;  3OTE A;  3NS7 B;  2YWH A;  2JZ5 A;  3BSO A;  3K17 A;  5F8N A;  3DHX A;  1HLW A;  4NCG A;  1CQN A;  1F2G A;  1WC3 A;  1RWK B;  2HWT A;  1T9Y A;  1YIJ S;  1U1L A;  4XPE A;  2H5E A;  5A2Q U;  2E5H A;  5GMK a;  2HHQ A;  4B02 A;  3DLB A;  1NSA A;  3W63 A;  3W9H A;  3PW7 A;  2V2Z A;  3PG9 A;  4OI1 A;  5EWG A;  2VOP A;  3BV8 A;  4UQT A;  2C1E B;  3MEC B;  1S72 S;  3DKD A;  2B4U A;  4MMO A;  3PO5 A;  3G9C A;  1RT3 A;  1KHW A;  4KR0 B;  4IUF A;  1HI1 A;  2FHJ A;  4DUZ J;  1R6V A;  1WDD A;  3OVA A;  1F60 B;  3AHP A;  4PPD A;  2MST A;  5ETK A;  2ZNY A;  1AZS B;  3HHD A;  1J5E J;  2RF2 A;  4Y28 C;  3ENA A;  3FK4 A;  2ATL A;  1MLA A;  1FRK A;  2E5L F;  4H4M A;  5FD1 A;  4URG A;  5KFN A;  3RAQ A;  3JYT A;  1SUQ B;  1QE1 B;  4LFB J;  3U27 A;  2ILY A;  3FMB A;  1HNW J;  1MG7 A;  1MNE A;  2N7Y A;  3DLK A;  2DEI A;  1HHT P;  4O4G A;  4X65 J;  2XO7 A;  1S6Q A;  1VR6 A;  2HHH J;  5KFI A;  3CCE S;  4WKR A;  1P1L A;  2KRB A;  4CO1 A;  2BQ3 A;  2L08 A;  4AE5 A;  2CDR B;  4OZL A;  2GIQ A;  1S6O A;  2QA2 A;  1REG X;  1OY6 A;  1BWV A;  2BV3 A;  1NJW A;  2CQ0 A;  4OHW A;  2ZE2 A;  5FDL B;  2VFV A;  2BUN A;  5KOX A;  1S77 D;  2MQO A;  3TAM A;  2XMV A;  3AOD A;  1UA1 A;  4W4M A;  1BUX A;  2GQ2 A;  4DPW A;  2GAH C;  1RQ0 A;  2MY8 A;  2Z58 B;  4RR5 A;  3CJ4 A;  2O01 C;  3C16 B;  3V2U C;  2R7T A;  4OZ2 A;  1RWV B;  2JDJ A;  3GSD A;  4KYZ A;  4F0K A;  1KR4 A;  1U8W A;  2XS2 A;  5CYJ A;  2MLY A;  2CWX A;  2EVZ A;  1WC1 A;  3HDS A;  2CVI A;  2YWF A;  4HT5 A;  4OHZ A;  3Q23 A;  3R6G B;  4ZCI A;  3GJT B;  5ETR A;  3BF4 A;  4K0K F;  2LDY A;  6FD1 A;  2NS1 B;  4HLB A;  2DIU A;  2OEK A;  1PJ6 A;  1A9N B;  2EKN A;  1JLG A;  4O3R A;  3ILI A;  3IO1 A;  1UJ5 A;  2FDN A;  4YR2 A;  1B4S A;  1RU1 A;  5A8K B;  4RW6 B;  4L73 A;  3RBE A;  3AY0 A;  1QAI A;  3W9J A;  2WBM A;  4NLW A;  2GML A;  2XSJ A;  3KJN B;  1KNZ A;  3OJS A;  3JTO A;  3VTI A;  1NCL A;  2PFD A;  2CQI A;  2BYC A;  5ETV A;  1HQU A;  1HWU A;  1DLO B;  1FRL A;  3AXK A;  3QFW A;  5HMX A;  4LVO P;  4QPX A;  4MYU A;  2KJV A;  2KYX A;  4CI0 B;  3MM7 A;  1R27 B;  1L3T A;  5F8I A;  3RB0 A;  2DNZ A;  1HW8 A;  1G1X A;  1N5Q A;  1FF2 A;  1LKZ A;  1R0A A;  3LUY A;  5IFM A;  2ZUG A;  1WF2 A;  3R5J B;  1ZM2 A;  1FDB A;  3MCO A;  4EBE A;  3WDO A;  1UEV A;  3MMA B;  4KGV B;  3QMQ A;  3E3X A;  2JLG A;  4LF5 F;  1MW7 A;  4FNI A;  1FWL A;  1FER A;  1OSC A;  3C46 A;  1R7I A;  5E33 A;  1H38 A;  2V94 A;  3TA0 A;  4KHP J;  1UFL A;  3KHL A;  3M2U A;  1MWZ A;  3S1T A;  2YPY A;  3OVS A;  3J80 Y;  4K4V A;  3HVW A;  4WYL A;  3MUM P;  3H2L A;  4DV1 J;  4NMX A;  1NSK L;  1YJN S;  2I5J A;  3TP2 A;  3UCZ P;  1A7G E;  2RUG A;  1YWX A;  1WEX A;  3DRS A;  3HKZ D;  2RKI B;  5GAD I;  2WSC C;  2ZD1 B;  2R7X A;  2G0I A;  5CAB A;  3D0I E;  4PWD A;  1HA1 A;  3PXG a;  4JUZ A;  1NJZ A;  1B0T A;  2PEB A;  2B7B B;  4J90 A;  3L7U A;  2I9S A;  5IWA F;  2KFZ A;  5KFY A;  4HH1 A;  3N28 A;  3D0H E;  3Q2T C; 
#chains in the Genus database with same CATH homology
 1CJT A;  2WZ1 A;  4OYO A;  3R5G A;  4OYX A;  1AZS B;  1WC1 A;  4USW A;  2GVD B;  4CM0 A;  1CJU A;  2W01 A;  3UVJ A;  1WC6 A;  4CLL A;  5D15 A;  5D0R A;  1YK9 A;  2GVZ B;  3G82 B;  4P2X A;  1CJV B;  3C16 A;  1CS4 B;  3MAA B;  1CUL B;  1Y11 A;  4CLK A;  5IV3 A;  1WC3 A;  3C15 B;  4USU A;  1AZS A;  2GVD A;  3ET6 B;  4OYI A;  4NI2 B;  4CLY A;  2GVZ A;  3G82 A;  4OYM A;  2QV6 A;  4OZ3 A;  1WC5 A;  1Y10 A;  4OYP A;  3MR7 A;  1CJV A;  4OYB A;  4OYW A;  4WP8 A;  1CS4 A;  3MAA A;  1CUL A;  3C15 A;  4CM2 A;  4P2M A;  1U0H B;  4WP3 A;  4UST A;  3ET6 A;  1AB8 A;  1CJK B;  3C14 B;  4OYA A;  5D0G A;  4WPA A;  1TL7 B;  5D0E A;  4NI2 A;  5IV4 A;  4USV A;  1YBT A;  4CLS A;  1YBU A;  4P2F A;  4CLZ A;  4CLU A;  1CJT B;  1WC0 A;  4WP9 A;  5D0H A;  4CLP A;  1CJU B;  1U0H A;  3UVJ B;  1CJK A;  3C14 A;  1TL7 A;  2BW7 A;  1WC4 A;  3C16 B;  1FX4 A;  4CLF A;  4OYZ A;  4CLW A;  1FX2 A;  4OZ2 A;  4CLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...