1CJKA

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE, TYPE V
publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 55
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjkA00
1CJVB 2W01A 5IV3A 1CJKA 1CJVA 4CLSA 4OZ3A 1WC3A 4P2MA 5D0EA 1YK9A 1WC0A 1YBUA 5D15A 1WC1A 5IV4A 4OZ2A 1CS4B 4CLTA 5D0GA 1CS4A 4OYIA 1Y11A 4WP8A 4OYXA 4OYMA 4CM2A 1AB8A 4OYPA 4P2XA 1CULB 1CJTB 1WC4A 4WP9A 1CULA 1CJTA 4USVA 1CJUB 4CLKA 4P2FA 1CJUA 4USUA 2GVZB 1AZSB 4OYOA 1WC5A 3C15B 1TL7B 4WP3A 1Y10A 3C15A 1TL7A 4CLPA 4WPAA 3UVJB 3MAAB 3G82B 4USWA 4CLLA 3UVJA 4CLFA 5D0HA 3C14B 3G82A 3MAAA 1YBTA 1FX4A 3C14A 1U0HB 4OYWA 2QV6A 4CLUA 1U0HA 1FX2A 2WZ1A 4OYZA 4CM0A 2BW7A 2GVZA 1AZSA 2GVDB 3C16B 1WC6A 2GVDA 5D0RA 3ET6B 3C16A 4USTA 3MR7A 3ET6A 4CLZA 4CLWA 4CLYA 3R5GA 4NI2B 4OYBA 4NI2A 4OYAA 1CJKB
chains in the Genus database with same CATH superfamily
2QMXA 2SXLA 2YKPA 3BN7A 2JJ4D 2LVWA 3SZ2A 2V63A 4ZLLA 4AUKA 1S10A 4K4XA 6AT1B 2QLFB 4N41A 1R8HA 2LKZA 5I42A 4E2FB 3Q83A 4CM2A 2DR5A 4XK8C 5DO2A 1J5EJ 5E7OB 1QLNA 1AUDA 3WIVA 2NPFA 3TX8A 1WF0A 3MM7B 4EBDA 3V81B 3KHGA 2R2TA 4HDGA 3HFVA 1Y10A 3TEHB 1KFSA 3VAHA 1KOOA 1W2IA 4RNOA 2XCPA 3P5BP 4G65A 2G9OA 2VU5A 2C3UA 4OZ0A 5KFOA 2DH9A 1S1VB 1RKJA 1NK9A 3BYRA 2H5IB 1T11A 3OD2A 2VICA 2UUWA 1RWMB 3JAMU 1XR5A 5LSLA 1SJFA 1GXLA 4MK7A 2WTFA 4BWJA 3S01A 3K0JA 3F0NA 1HBMA 1RTHB 3KK2A 2BJEA 1B70B 2DHGA 2KG0A 1IBCB 2AIRB 1QM9A 2BQ3A 1RHKB 2DNPA 2YWKA 1HBNA 2BE7D 2O01C 3QT7A 2CJ9A 1N5TA 4I2QB 1FT8A 2DXDA 1NNDA 2DEIA 4PWWA 2YH1A 1QUVA 2LXIA 3UD4P 4RNNA 4DV0F 3RW6A 3FDSA 5A2QY 3W5XA 4KGVB 4HEA9 3JB9k 2GV1A 1S6OA 2CQPA 2OHDA 3R9LA 3HXMA 3CPWR 1KVIA 4DF4A 4X84A 2K7JA 4UQGA 5A8WA 4PXDA 1UW9A 2NREA 4GKKF 2R7OA 1FA0A 3TW0A 4ATNA 5MAOA 4WWSA 1EHWA 2BQRA 4USHA 5CCLA 2Z58B 1IQTA 5E0OA 5IQQA 2BJ1A 2FLLA 4KAIA 1E6YA 2HQDA 4RBUA 4YB6A 4X4RA 2ZE2B 3FJ2A 4DL7A 1IWGA 3OL9A 3QGHA 3NOGA 5GMDA 4LF9J 1HWJA 3DMJB 4JI0J 4NI2B 1VRUA 1MMLA 1RYRA 3D1HA 3RAQA 4OI2A 4ED6A 3HVTA 3A3PB 5B0BA 1FE4A 5CYMA 4PKDB 5KFBA 3OUYB 3T1HJ 4KO0B 3NS5A 3H59A 3VR1A 2EG1A 2MSTA 1RWNB 3OLAA 3HKWA 4BS2A 4M5KA 2LDIA 3N6LA 1Q4RA 2VV5A 1VQ6S 3DRXA 4FYWB 3JSRA 5KFXA 3MI7X 3ENQA 1MN7A 3VF0B 5DQHA 5D3GA 1PO6A 4DHVA 4ECQA 1JLFA 4Q0BB 1GX5A 1RI7A 2BBEA 4FKYA 3BSCA 4ZVQB 2HFUA 3ZZOA 1UEVA 5KFLA 3AQOA 1R6YA 1RWOB 2YH0A 3FBCA 2CPHA 4U67Q 3PW5A 5A6PA 1OY6A 2G0IA 3FBBA 3W9HA 4ZP7A 2DO0A 3HK2A 2OPPB 1JLAB 1Z1ZA 3P96A 4ECSA 4DV4J 1L5UA 1VQ9S 1NZAA 2K3IA 3HT0A 1OPZA 1U6ZA 4CYUB 3GJSB 5LXRA 2B6AA 1VQYA 4K0KF 2VDIA 3HHDA 2L9DA 4HTIA 1XMQF 3LPYA 1CC8A 3QNWB 1KFDA 2QG9B 4MKBA 1FRXA 2FLNA 1S1WA 2Z4PA 2VG7B 2M2BA 3QIPA 4DEZA 4FP9A 4ECXA 4NYPA 5L39A 4C8OA 1H2TZ 4Z7YA 4DI6A 1V3ZA 4DSJA 1UFKA 1R7IA 1CQNA 1AUSL 3GR0A 2J6UA 2IYIA 4KKOB 4GKJJ 3GMGA 1KLMB 2ASYA 5B0GA 1V5IB 4X2BA 3THTA 2K7KA 4RJVA 5EX0A 3CJSA 1IUJA 4QPTA 3PYGA 2R7QA 2HQ3A 2HBZB 5EGYA 2V4RA 1X4CA 1K8AT 5KFTA 3GV5B 5K14B 3W5YA 4DL5A 2EKYA 3AOCA 2DISA 2E7XA 5GMKa 5KFKA 3V5RA 2UXCJ 4PQAA 4ZCKA 2AEFA 3R6GB 2KKHA 2ZD1A 2ZM6F 2E1MC 1TK5A 3ADAC 3MR5A 3DNCA 3LALA 2B43A 5IV4A 5HO4A 2PFFB 4C3LA 5AE1A 1RT7B 3RRKA 1R8AA 2HNYB 3GILA 3UNGC 3VAJA 2V4JB 1CULA 1VLOA 5HVHA 3QMQA 3T9NA 4DV6F 4WZQA 1S9EB 3PZPA 1REGX 4TN2A 3M2RA 3E51A 2VBWA 3K8VA 5FLXY 4ZLJA 1UFLA 1PG5B 1N32J 3GPAA 4DX7A 2J8SA 1WD6A 2FJWA 3T41A 3W64A 2KRBA 2AWZA 1KD1T 3TO8A 1VC0A 1U2RA 3DOLA 1IKWA 4XIUA 3I9V9 1ZBTA 3CCMS 2CNNB 2QA1A 4J9PA 4NXMF 2GW8A 5HSPA 3C46A 1CBKA 2KJVA 2HHQA 4IFVB 1B0VA 4OHXA 2JEIA 3V4IB 4JI8F 2YWFA 4F04B 1N33J 4KC5A 4FF2A 2CPDA 4ZKAA 2F1FA 4BCAA 2EBEA 4E98A 4IH7A 2JLFA 1SJ1A 2NZCA 3GLJA 4ZVGA 1IM6A 3MM9B 2MGZA 2WVCA 4WJBA 2DR6A 2FJBB 3E8OA 4WPAA 2X1BA 3V6KA 1UL3A 2R7WA 3WX8A 2WVBA 4BC9A 3SQGB 3GQCA 1UPMB 2HBYB 1WEXA 2DNHA 5HROA 1XTZA 2C2MB 2LEBA 3UI3A 1KSPA 3KNGA 3E2EA 1TAUA 3T5KA 5B7WA 2HWIA 3J7Z5 4HI2A 4CTAA 2H48B 4O44A 3JQMA 3CMQA 1VIOA 3I55S 1N52B 3R27A 4G1PA 3DXSX 1U4BA 3WZ0A 1BWEA 4ID8A 2BJ3A 1HR0J 3TAMA 5ETKA 1APSA 2R4FA 2M52A 3Q8YA 2DNOA 1RWWB 5ETLA 4QPXA 3NBPB 2FC9A 3A1YG 4B9MA 4MK8A 5IC6B 1VQ5S 5J2NB 3HZEA 1M0SA 3AXKA 4RL1A 4IQXA 4F2RA 1CQMA 3FCVA 5J2QA 4M5DA 1YBAA 3D3CJ 4K4UA 4WP3A 2A2DA 5IWAF 5BJRA 4TY8A 3DDKA 2E7VA 2ZHBA 3ZTRA 2HRUA 2RD5C 4IR9A 3VAIA 1HBOA 5I3QA 1YJ7A 3CB4A 3UQSA 2ZC4A 2YPYA 2Y0BB 1U0HB 4ETZA 4USJC 1UWBA 1RBOB 3M2VB 3M8PB 2VB6A 2XC9A 3PYEA 4CZCA 1ZZNA 5KAKA 3WX4A 2WK4A 4DFMA 2WONA 1Q8BA 2IC3B 1HNVB 2XMKA 4X4UA 4EYIB 2KO1A 2HWTA 2NXJA 5EWEA 4K4VA 3AT1B 1R43A 3GIMA 4ICLA 2ILYA 2JWNA 3K17A 2K2PA 4CP5A 4IG0B 3ISND 3LGNA 9RUBA 3MCMA 5FD1A 3POTB 1FE0A 3AA8A 3QATA 1BQMB 2W9AA 3LAMA 3CJTA 2VJUA 5K5MA 4WFZA 3H4BA 1SI9A 3VGTA 2CXEA 2GAHC 1U1RA 2YPZA 2YNGA 4K4YA 3MECA 3D66A 2KFZA 1VQSA 1T3OA 2HLUA 3ETOA 1H38A 2H51B 2NQPA 3R7BB 3G86A 2ZBCA 4HACA 3OXLA 1FERA 3G9CA 3DLJA 3C15A 1PBUA 3OQ2A 4EUVA 3HP6A 1SJRA 5B09A 4YY3F 5H1SV 2YKMA 3DKDA 2B3TB 4F25A 4WF9Q 2BMBA 5C42A 1Q7YT 1UCNA 3M6XA 2W1BA 4NOHA 4L75A 3KG1A 1VQKS 3R1HA 2MQQA 4ZCMA 1Q1KA 3AODA 1LK7A 2YBVA 4C97A 3KNAA 3UN5A 3B6BA 3D6TB 1ZPWX 1JJ2R 1OQ3A 4F50A 1CS4B 4M5GA 3RYLA 1F6TA 1U6FA 3DM2A 2V9KA 4WP8A 2MQ8A 2IVMA 3C19A 1WKKA 5G0RA 4ED2A 4JI1J 2MMYA 4M5MA 2I2YA 2BACA 1KQGB 2PA3A 3AXMA 4LSZB 1OYDA 4O3OA 2NPIA 4UOGA 5C24B 5IT4A 2Z8QA 1IBKF 4ITSA 5CD4H 2XEXA 3TANA 5G4DA 1IWAA 4ZPVR 2EFNA 1VCTA 1FDBA 4LF8F 3RBZA 5F8HA 1VDHA 3PEJA 2E9RX 3C14A 3H98A 2LEAA 4R5PB 1ZTTA 2GIQA 2W7OA 3Q8UA 4RUCA 1N34J 1PYTA 1VR6A 3D28A 4I6WA 2BE9B 2A1BA 2XMJA 3FRYA 1S1TA 3MM8B 5HP1B 1NK0A 1T9VA 4Y00A 2AT1B 3IR7B 4JI3F 3PX6A 2HEKA 1S72S 2RB7A 4DU8A 3M8QA 4I69A 4X64F 2DR8A 4OJ1A 4W92B 4ZLPA 2J9EA 3OLBA 3CD6S 5KFRA 3P4UB 3IRWP 4ZHRA 4A8QA 4DV5F 4LVOP 3HDSA 2LFVA 3I0RA 1H72C 5AXKA 4ETXA 1TZ0A 1X4DA 4F0HA 1T7PA 1RWVB 2NUHA 1Q8KA 3O6QA 3UVJB 1FK9A 1UVNA 4K5SA 2GIRA 3EZ5A 2VFTA 3GZ7A 3UDLA 5D4OA 1OY8A 2A10A 2E1CA 2W4CA 3BGOP 3NEKA 3MEGB 4RW7A 2ZC3A 3G8QA 5FJ4A 2VQFF 4CCHA 1W2BR 2ZVIA 3ZTSA 4OYAA 4PR6A 2ZH9A 3GIIA 3A8JA 2CJQA 2HQGA 4DLEA 2WAQD 4A8YA 3KDNA 4ANDA 2D41A 1N36J 2J7UA 2HHVA 5K8NA 2QYCA 1YG0A 1U1KA 2XSJB 2NZ4A 3O2IA 2W7PA 3K58A 3UR3C 3MM5B 1RP5A 2H5JB 2GIFA 3MDFA 3L7PA 2HFNA 4LRBA 1UJ5A 2DCLA 2EXUA 1RA6A 3PYDA 5IOLA 3GJRB 2E5HA 2FVSA 4C6AA 2R7RA 2LU1A 2ALYB 5KFGA 1DTTB 1C4CA 3SXLA 2E7WA 1G1XA 3PDNA 1XMOJ 4YEAA 2XMWA 2CQ4A 2NS1B 2M7SA 3W63A 2GGPA 3J7ZT 2ZH8A 4O3RA 3QSIA 2AJ2A 3SI8A 1M5KC 1YRUA 3N5BA 3M9OB 1VBKA 3W2WB 4ED3A 2WBMA 1QJHA 4J9KA 1SKUB 2GO9A 1LW2B 3JTNA 3ZZUA 2V5HG 4LFAF 3CIZA 2IM2A 4OX8A 4U7UD 5CQGA 2XG8A 4A8KA 2CJAA 1NB7A 4WE1B 2DGSA 5EHHA 1PKUA 1GNKA 4NYOA 4RKUC 5HJYA 1X9WA 3JYTB 2P9EA 1CJTA 3UDCA 2AD9A 1O6XA 1CJUB 1JXLA 3ENVA 1U8SA 3J80Y 1S57A 3IP0A 1HYSA 1IKYA 3VHQA 2QA4G 1C0TA 3KLHB 5GADI 2QFIA 5K8OA 3U1MA 1VRTA 4M5JA 4U95A 2CFXA 4IRCA 2ZFHA 4ILMA 4CM0A 1NAQA 1FESA 1OSCA 2HRYA 3CJ3A 1X4BA 2R2SA 1YJWS 1PJ6A 1UVKA 2UUAJ 4XO0A 1RKIA 2Z2MA 4NXNJ 5J1PA 4U9RA 4KGZB 4LUBA 3MUTP 4TLQA 2YNFB 2DPIA 1EX8A 3K5PA 2B4VA 3HHEA 4LSLB 2RUSA 5HQMA 3BGRA 2FIUA 4ED5A 3CCWA 2MJNA 3H7HB 3IG1A 2M3DA 1KRPA 2DYAA 4M94A 2XM3A 4TXSA 3DLGB 1IKXA 4PG8A 4DL6A 4OZJA 4X4VA 2R8JA 2KYXA 1FCAA 1N8RT 3IAM9 2Z56B 3FMWA 4Z7CA 4FYDA 2DR9A 3GFHA 3NOCA 1GXTA 2WW8A 2C2DA 4F3MA 2OPQB 4QR1A 4B9LA 2QLXA 1Y4ZB 1SL2A 2HHTA 4DPOA 2E1RA 4WZMA 5DGAA 4DR3F 2AEMA 1Q5YA 5KT6A 2VF3A 1LXNA 1OJ4A 1Q8LA 5E2QA 4UZCA 4LSNA 1U26A 2QC3A 3JQJA 3OPKA 1DBDA 2ZJRQ 4PG7A 3PY8A 2FZGB 2XNQA 1IR2A 5ADZA 2C2ZB 4UUXA 1DQ9A 3HULA 1FEHA 3TJAA 4ECZA 1BY9A 4KTQA 1YKWA 1XC9A 5D15A 5IXUA 2ZEJA 3MFIA 1CVJA 5F0UA 5I42B 3O5TB 3LUYA 2CPJA 2JLGA 1NB2A 3EYZA 2EKNA 2OPSA 4UY85 1YGYA 3MM6A 3T9ZA 3MUMP 4PABA 4A4JA 3KUEA 3JSBA 3MOZA 1PAEX 1NCLA 5LXYA 5A76A 1TL7A 4O4GA 3DLKA 3T1HF 4USMA 1QE1A 1G3OA 5ETVA 3SEOA 2JX2A 1WNEA 4EGLA 2ZWOA 2NXNA 1CPZA 4QYZK 2VBYA 4B9UA 1UP1A 1HBMB 3KK2B 2FVCA 1NKEA 1S6QA 4YB7A 3T19A 4JI4F 2P6TA 4MKAA 1FVQA 4DUZJ 4F4KA 4LMZA 4DS5A 4F7VA 3BPDA 2HIYA 2F65A 4ALZA 2DNQA 4IQMA 4PG5A 2EFPA 5KFJA 4I68A 1Y9OA 6FD1A 2J8AA 2G2YA 3OR1A 3M6VA 1U49A 1M90T 4KR0B 4DFKA 4YDXA 4RW6A 5CABA 2RS2A 4QR0A 4ZP8A 4YP3A 1AZSB 2ZZTA 4RNHA 5A8WB 3GCXP 3IM8A 4ZVSB 2MZRA 4J9LA 1U8WA 1FJCA 2I38A 4DSFA 3KJFB 3IWNC 2WOMA 1E6YB 3KG4A 3MAQA 3IGVA 1S6UA 4DQQA 1U47A 2IVFB 1YTYA 5DRKA 4HVZA 4NRUA 4IOAQ 1NPPA 3CXCR 1EARA 1VRUB 4JI5J 4K7QA 2AP6A 3KJNB 3HVTB 5CYMB 1JXEA 4L3NA 5DDOC 4ZVFA 5AXNA 3MTJA 2CKWA 1U1LA 4GKJF 3AD8C 2HVDA 3FC9A 1VS3A 3S1TA 3ZZ0A 5AE3A 1T02A 4KHRA 2F9JA 2W2QP 1LKZA 1VBYA 2LP4A 2RUGA 1NK5A 3M32A 4WYLA 3PEHA 1F5CA 5D3GB 4XPEA 1GT8A 3D67A 2HS4A 2JHEA 3KHRA 3K5LA 1YWXA 1JLFB 4R25A 2RS8A 4IH5A 1KKHA 1RT1A 1TMJA 4K2XA 2Y1JA 4CT8A 4NLXA 1RACB 2HG4A 1K47A 2KM8C 2VC1A 1B7FA 2HSEB 2H9ZA 3TX0A 1V5VA 4Y2KA 1VQ8S 3Q2TC 2GAGC 1FX4A 3ICLA 4B3MJ 4MYUA 1SQGA 3IBFB 3V4MA 4OQJA 3O3LA 2MKIA 3N9UC 1JNZB 3N6NA 2L9WA 4BDPA 2B4UA 3B54A 4IRKA 1X8DA 4CO1A 2RDDA 1FF2A 4A8WA 4YQWA 4WYWA 2V8PA 2J0QD 2B6AB 2UZAA 4ID5A 2JL9A 3DRSA 1N32F 1EZZB 1X4GA 3RB6A 2ASJA 4A46A 1S1WB 3BO3A 3VV2B 2AZ3A 1RT3B 1AB8A 3QIPB 1Q81T 5DM6Q 2V8DA 1VMBA 2EC0A 4F4WA 3PX0A 4YR2A 4OZ1A 1TK8A 4YN3B 5DQGA 1SXLA 2YVSA 4DV0J 1GMVA 1ZM3A 3CUNA 1EQMA 4QIVA 2ERRA 4O23A 1XERA 1GX6A 3ZTQA 2XZDB 2CZ4A 3NS6A 2Y1LB 1XEZA 3PNIA 3T6JA 5GADU 4R8UA 1N33F 1KHWA 1ITPA 3QJLA 5KG2A 3BB5A 3KLFA 3BYPA 2EG2A 2R7VA 5THWA 2OP5A 2ZOMA 2ZD1B 4ZK7M 2R7XA 3NGDA 3Q24A 2HGMA 2PA8D 4X4NA 2BRKA 4HKQA 4D3HA 4Y2CA 1HQEA 4P7VA 3PFOA 1NLKL 2ZJQQ 1JLEA 2NXCA 1CULB 3TZZA 3DGPA 3W3SA 4LFCF 3NP5A 4HR2A 1BXNA 3M2RB 2BJDA 1HWKA 1PCAA 1VQOS 1S99A 5C2CA 2X7IA 4IOCQ 3FZBA 2PEHA 2YNHA 4YOEA 1HR0F 1FRHA 8AT1B 1U48A 1M1KT 4ZIWA 2H4YB 1FVSA 4OZLA 2VASA 1FJGJ 1IKWB 5KFAA 2CG4A 5L1KA 2B9EA 1WORA 3MCSA 3G8TA 2UVRA 3JSYA 2M8DB 1RGVA 1QTMA 1S6PA 4URSA 2DGTA 2FB0A 3H40A 3KMSA 1QD1A 4JP8A 2XI3A 4UY8T 1XR6A 2C3YA 1QSSA 2IAJA 2YQ1A 4R0EA 4K0KJ 2HGLA 3PW4A 3MZIA 1UW4A 2KDOA 3I0SA 3SV4A 2A18A 2ZNYA 2BJ8A 3KUHA 4OHVA 1R6VA 3OSNA 2VUGA 4DL3A 2MGZB 2DNRA 4F4AA 4C8MA 2CWXA 3M9NB 2VFSA 3OL7A 2FPHX 3ILIA 2QGFB 4WBFA 4FBUA 5HROB 3N79A 3LTOA 1FRKA 2MKHA 3IFEA 3BKTA 2BX6A 4O0IA 4FXWA 5A8KA 4CLYA 1ZZFA 4GO5X 3ENWA 1X60A 4O44B 3I4PA 3EVOA 1NJXA 3THVA 3W5ZA 3TA2A 1BHNA 1T0TV 1FD2A 1HKAA 3I31A 3LP2A 3ZZPA 1H7XA 1F2GA 1AT1B 4JV5J 3CJRA 4NCAA 3TAMB 2QYGA 2FQQB 2B9XA 5HN0A 1F9EB 1RISA 1S49A 2MSSA 2IMOA 2C2NA 1A7GE 2DT9A 2M9KA 4YB1P 2BKPA 2P8IA 4ES2A 4DOZA 1UPPA 1QTNB 1OQ6A 4W98A 3MEKA 1VQ4S 5ITHA 5J2QB 3PIPQ 4DR5J 4M5DB 2PT0A 5CAAA 4FF3A 4ELTA 4F4YA 1HBOB 1SH0A 2XWYA 4DV6J 1FXDA 1S76D 1UWBB 2K1RA 2ZH2A 1BGXT 5A0YA 3M05A 5GVQA 3DFEA 1Y3KA 2WONB 3TR5A 3DI6A 4ZPWR 3LANA 2IRUA 2DITA 2VDHA 4ZCLA 4JI1F 1LWXA 4LBPA 1FO1A 3H2VE 4EZ6A 2V68A 2HURA 4NA1A 3D9BA 2NXEA 4RX6A 3T1YJ 3TRGA 2RRAA 3D6FB 5L46A 3TOQA 3BSOA 4UOFA 1KP6A 5HK4A 1O8BA 3M4XA 2KHDA 1N88A 2HNDA 5J2MA 2RU3A 2YNGB 3MECB 1ICEB 4AXIA 1N34F 3R8YA 4XDDA 5I3UA 3GSDA 4HACB 3EVMA 3C6TA 1S9GA 3KDOA 4K50A 1DJ0A 4YB5A 4Z37A 1TKDA 4CIOA 3C15B 3H42A 4WU3A 1TL5A 2PD1A 2YKMB 3N6MA 3OTDA 1SCJB 1S7HA 2VG6B 4DQIA 5ETTA 4F36A 3PG9A 5C42B 1RCXB 2XQCA 5B0AA 2P9GA 1AXQA 3MMAA 4ZVHA 5H9EK 4KJIA 3L95X 2QO3A 4IYQA 4Q8FA 2M88A 3W9IA 4X65J 1JIHA 5F8JA 4ZS6A 3MPUB 2EI5A 1L3VA 1MWQA 3QIDA 4QBUA 3DM2B 1N0VC 1KNZA 1RT2A 4FZVA 3IBWA 5G0RB 4P9SA 2EBGA 3IC1A 4Y65A 5LMUF 4LJMA 3J81j 1M1GA 3CO9A 3M8WA 2IM1A 4F0KA 2U2FA 4QWEA 3HO1A 1RHJB 1PBAA 3WBZA 1Y5NB 2QMWA 4GO7X 1X4AA 2VIHA 3PCOB 1B0TA 2V34A 3P3DA 2ZUAA 3C14B 1VC6A 3LGMA 1N36F 1SL1A 2YY3A 1DFDA 4FBTA 1YJNS 4LRAA 3C16A 2BJ9A 1TK0A 1ACMB 1RT6A 3OVAA 1JWWA 4Q5VA 1S1TB 2IVYA 4Y3CA 3Q8RB 3NCQA 1T95A 4B9TA 1Q82T 3UE2A 2VQEJ 2RQCA 2KL8A 2ZH4A 1TUGB 4TU7A 1RE1B 4U7UK 3D0HE 1WELA 2VJVA 3ISZA 2AJ0A 1U02A 3VZIA 3GU0A 3CCVS 1E6VA 1XMOF 3IXQA 1SC3B 3FEZA 4USKA 1VLYA 1SQFA 2RDJA 2BW2A 2HHSA 3OVBA 3W61A 5JMNA 4QWBA 4OI1A 1NSKL 1UWAA 2GZOA 4IOBA 4Z2XA 3NY0A 4ZHRB 2J0SD 3I0RB 4C8KA 5F8IA 3KLGB 2QL9B 2GCFA 2UXBJ 1DURA 4C9DA 1FK9B 1ROFA 1MWZA 2CQGA 4ED4A 1T8EA 2V8HA 3FSXA 4NMXA 2QV6A 2FD2A 5F8GA 2CNLB 2LA4A 2F7VA 2GVZA 3HHLC 2FJDB 4RW7B 2X1AA 3D7SB 4A8XA 1EP4A 1S4EA 1I94F 4OV1A 1S79A 2JEFA 5BYQA 1T9XA 1XNRJ 4JV1A 1NK8A 1FKOA 2AV5A 2OPRA 3D6HB 3FCHA 3L7OA 2ZBPA 3CDAA 5D0GA 2KTQA 5F9LA 3TUJC 1A0OB 4OX9J 3VAMA 3BH6B 2M8HA 3CJ0A 1NSQA 5HMXA 1HQUA 3SFGA 2HMIA 2UUAF 4WKRA 2QIFA 2VBXA 4EEYA 3U7JA 3OSPA 2U1AA 2ZZNA 2EPIA 3DYAA 2KI2A 2HWHA 4N47A 4Y6IA 5KFNA 4AXJA 5AE2A 1WEYA 2J6SA 1KN6A 3GONA 3FGVA 1RCOB 2GGPB 3HMJG 2IPOB 2P6SA 1EIYB 2W2MP 1PYOB 2KYZA 2P9CA 1T9TA 2WSFC 1UAWA 2W2OP 5ETRA 5D4LA 3KMQA 2YXLA 2BOPA 4CLZA 1LWCA 2MQPA 4NLWA 5T7LA 4A8FA 2AKWB 3KHHA 4TQRA 4UZBA 3NAIA 1WOOA 2FHOB 2ZVSA 4GC7A 2IIHA 3IS9A 3J7YI 4ECRA 3K5NA 5D4PA 3M1VA 2BR0A 1TR0A 2HVEA 4HT7A 3ONQA 3VGSA 5HVGA 3EGNA 1SC1B 1U24A 2OO4A 3I32A 3PR4A 4TNOA 3SFUA 4QU7A 1LWEA 5H9FK 3L7UA 4JI3J 1CJTB 1NK6A 4QU6A 3PTWA 3HCXA 3LQVA 3GP9A 3ITHA 1D8ZA 4LR9A 5E33A 4X64J 1HYSB 3EE3A 4MMOA 1IKYB 1VQMS 2RNEA 1C0TB 4FNIA 4IDKA 3T5JA 4FKXA 1ZETA 2XY7A 1VRTB 2E5IA 2J0WA 5CH7B 3DXBA 4UT4A 2O66A 5KFEA 3AA9A 4P6QA 1DRZA 2UUBJ 4F4XA 2VPZB 2VPYB 2NLWA 1WC6A 2W2NP 2MZSA 5AXLA 3LWLA 3E3XA 4JI2F 4DSIA 2DB1A 1HHSA 1XWLA 1QDUB 2HNZA 4DDFA 3RU0A 2XULA 4Q44A 4HH1A 5D0EA 3IG1B 5ETNA 1RYSA 2EWHA 5CCMA 2Y3YA 3S8SA 5BYSA 1IKXB 2QA4S 4ZA1A 2FGCA 4ZP6A 3QZ8A 1Y11A 1WACA 3KG0A 2WSEC 4NLTA 1FRLA 3GCWP 1MROB 3ZO7A 1KR4A 2LXFA 1TKZB 2AZ1A 3H5XA 4I2QA 2JVOA 4DUZF 3EXYA 2MKYA 3EGWB 4DX8H 1RDRA 2BKOA 1V3RA 2GQQA 2KT3A 4AFFA 5LJ3Y 1X9SA 4GMKA 2QE5A 1L3KA 4EFAC 5BXIA 2HFVA 1RAGB 2Y8WA 4DR2J 1UKUA 3UR0A 5D77A 4DCJB 4YR0A 2Q3PA 2X51A 4IO1A 2ZOFA 1M5SA 4DFPA 2OD6A 2AX1A 2NUUG 3Q89A 2CVIA 4TKTA 2KT5A 5HJXA 3NMAA 3F56A 3G96A 3BH7B 4UQTA 1SVDA 1NKBA 4WTOB 5EN1A 3BS9A 2ACYA 2VONA 1F1BB 3H2LA 1RB0A 2RDIA 2V6AA 2R3VA 1T3NA 1N48A 3QWPA 2OPSB 2WVFA 5F9NA 2Q66A 4NLDA 1R0AA 2X1FA 3MM6B 4QIEA 4NLVA 1RTIA 2DD8S 2KZZA 1TL7B 4O4GB 4TVAB 3DLKB 3DRPB 5DLFA 1V6HA 1QE1B 5F3TA 3CCSS 4CLFA 3U1NA 1HI0P 2C42A 1N56A 2WW4A 2H3EB 3UD5A 5DG8A 3TUIC 3TI0A 3BPSP 1XIQA 4L6V3 2QEXS 1QVGR 2YKQA 1S6QB 4PRFA 2JEJA 1ZS6A 3BM7A 4DSLA 2KH9A 2IBKA 2OTLS 2B51A 3RBXA 4Y0FA 5GAHI 4U6PA 2ZKUA 4KFBB 2ZHOA 1JLAA 2JC0A 2MQMA 1HWUA 5IQ6A 1X0FA 1RAEB 1BQXA 1PJ5A 4B3MF 1ZM4A 3I96A 3G6VA 1JLBA 2IDEA 2CQ3A 1NSAA 2DRDA 1LWFA 1NK4A 3IRXA 3Q8QB 1IBLF 4RW6B 3PACA 3CD0A 3BREA 1D09B 1Y00A 4USUA 4HT5A 4HHHA 2HS0A 3A3NB 5KFIA 2F3JA 3I5CA 2B5JA 4HYKA 1S59A 2GC8A 1Q5VA 2WOMB 1HD0A 1SJ4P 5HLFA 1I3OB 4P73A 3TZWA 1FTRA 1IQZA 4DBQA 1S77D 2AMCB 4F3OA 2YQ0A 1JXVA 3DU6A 1MNEA 4RUHA 2CAJA 1XMBA 4RBVA 4C11A 2DXEA 1PSDA 4NCGA 2EFGA 4DR3J 3GFZA 3IR5B 4MK9A 2XO6A 4ENOA 1A9NB 1RAJA 5B0FA 5A8RB 3RTVA 1DTQA 3HI9A 4K8RA 2CUYA 5K14A 4IFYB 1IBMJ 1I6JA 2MLZA 2LEPA 1FKAF 4DL0C 1D1UA 4DWIA 4FXDA 2KG1A 1WC4A 2XMTA 1UJ4A 5T41A 2RQMA 4IG3A 4ZVEA 1RT1B 2DEJA 1NXIA 2CPZA 2HBRB 2IYGA 3OJSA 4ZDNA 2B7CB 3UN3A 3W2VA 1SH3A 3KYLA 4DR1F 4LRDA 2RRBA 1JLCA 2AU0A 4HL9A 4OYWA 3GFXA 2JFDA 1PYSB 1H3DA 1D0EA 1S9EA 2HVIA 2QRRA 3IBCB 4G6VB 1VBZA 5DDQC 1FD8A 4CH0S 1OIAA 2OD4A 4LRFA 2DO4A 5KT2A 3EZUA 2YNIA 4DF8A 2A0FB 1U09A 2OJ3A 2DGUA 3GTYX 4ID5B 2MQLA 3MEDA 5L1IA 3FVYA 2GJIA 3DRSB 1NHKL 3K8WA 1N5VA 5K20B 1QY7A 4JI4J 3RZAA 5D6GA 3EWGA 2MKSA 4MTPA 4X4OA 1U25A 3J7YU 4RUAA 1WG1A 2KT2A 1QAXA 1GTHA 4B3TF 3HM9A 2YTCA 4RUBA 2AW0A 1FJGF 4WFNQ 4IFVA 3QSYB 3V6HA 5LOQA 4NLSA 3RR8A 2HVHA 2W8KA 2L08A 2UV8A 2MB0B 3R3TA 4JI6J 2J9CA 3NCRA 5HAOA 4Y2MA 2RSQA 3CVKA 5SZTA 4R8UB 2WB1D 5L9NA 2D3O1 1FDNA 3CSKA 3KLFB 4ANEA 4DV2F 3TWZA 3D2WA 3K89A 2NSBA 2IA0A 3PW0A 1M5PC 2DIUA 2CRLA 1RAIB 2FVRA 4IH6A 1DLOA 5LT5A 2EFQA 2HZCA 1HQEB 2DGOA 2MQOA 1JLEB 4DXLA 1N0UA 3AFGA 4C8LA 2RE1A 3QGIA 3T5HA 1MSWD 3DGPB 1MMNA 1NBEB 2YKNA 3UFCX 5HBMA 4PG6A 4G1QA 1VJWA 3J81Y 3AY0A 1LFPA 4QIFA 4Q45A 4ZVUB 1FRIA 1JB0C 2YNHB 4JV5F 4PXCA 3CD7A 4J9SA 2F8EX 1JJCB 3P6YC 2R9LA 4PQUA 4NMLA 4WK1A 3K7RA 3A8KA 1NU4A 4LF1A 2XBPA 5DDRC 4ZOSA 1FI4A 2R42A 1G7CB 4DR5F 4RWXA 2Z30B 4R0JA 3Q0AA 3CO0P 1S6PB 4DCOB 4HHUA 1K0TA 4XAKA 1P9YA 3FCWA 4K4SA 2UVVA 2IAJB 4MKVA 2HQFA 2B9WA 5KFYA 3HF5A 4NX9A 2XZWA 3I0SB 3OFEA 2IM0A 2OLWA 2JVRA 1HI1A 3G8SA 3J7A1 3VQTA 2EW9A 4QYZJ 5KOWA 1QSYA 2JH3A 1RXOB 2Y1IA 4CT9A 3T1YF 2VKZG 1WTFA 3KWMA 3HJVA 2MKKA 1R8PA 2DTJA 2W8LA 1FNMA 2B0GA 1U0SA 2UV8G 5B0DA 5A8KB 2OTJS 2AF6A 4DR4J 3WDOA 4AQYJ 1RTDA 4J9OA 2A3JA 5F0WA 5JVGQ 4CO3A 1YVFA 3LP2B 5IC4B 4ANCA 3W62A 2XGPA 1YBUA 3OHAA 2DHAA 4OX7A 4PUOA 3CD5A 1X5OA 4DJBA 2CQIA 1F9FA 2ZBIA 1HIYA 3NAHA 4NRTA 3M8ZA 5GAHU 3BR9A 2AX0A 4OYPA 4QQBA 5A2QU 3DRRA 3GG0A 4KGXB 4B3SJ 3FMBA 3ZC4A 3JS9A 4GVBA 3CE8A 4QOTA 3TUZC 1GEHA 1QAYA 3MPYA 2NXUA 2OSQA 1OO0B 4DR6J 3TUPA 3CJ4A 4B9VA 2LQBA 3PKMA 5KG1A 4X65F 3FFIA 5KFFA 4LFCJ 1K9MT 2QZ8A 2K1RB 4I56A 3FNNA 2EC2A 9ATCB 4J91A 5A0YB 1TELA 1VISA 2J7WA 3DI6B 4L3KA 3M8YA 2NCKL 4TU9A 1BD6A 2J9DA 2KRRA 2V50A 3W7BA 2HS3A 1EETA 4FDFA 2CNOB 1NHUA 2MHEA 4QW9A 2XGQA 3M30A 3MR6A 1GMWA 3I5BA 1TKXB 2FHKA 2H5EA 1LQ9A 2H1YA 2DNZA 2YKOA 7FD1A 2CIMA 2WVEA 1VRQC 3MURP 4NLRA 2WSCC 2HNDB 3UCUP 3HPOA 3IWLA 5J2MB 2N3LA 3JTOA 2PI4A 2RHSB 1SIZA 1RHUB 3TAPA 3TA1A 1T05B 2AYEA 4LFBJ 5I3UB 2DH8A 3C6TB 1S9GB 4CH1A 2ZBRA 4OL8A 5IZHA 2VQEF 4C0HA 5K9FA 5J1EA 3BSNA 2MHNA 4CLPA 1K1QA 2J7KA 1YJ9S 4U8YA 5E3CA 3OV7A 3A13A 4P71A 2I9SA 1GMWD 1Q95G 2R8IA 2OFHX 3MF5A 3AJ2A 1HLWA 2C3MA 4MH8A 4ZP9A 3T3FA 3JAMY 3MMAB 3TQEA 3B78A 3CJ5A 1CJKA 2AGQA 2XWXA 1HA1A 2CQDA 2O5DA 1RU2A 3N4WA 2UXBF 1R27B 4MYTA 1HPZA 1NPRA 4ERDA 3GB0A 3IN5A 1RT2B 2DGWA 3UPFA 1U1OA 3AHPA 4NE9C 1H0HB 4D3GA 2RU9A 2KXFA 1C1BB 1H74A 3CC4S 2QSFA 1IM4A 2MY8A 4QWCA 2RVJA 2BOAA 2MLXA 1DHMA 3ZNJ1 2CQ1A 4N7TA 1LNQA 2GMHA 1QAIA 1HNZJ 2Z0GA 1XNRF 4EMDA 4CLLA 2DNLA 1FFSB 1YJTA 4NWBA 1VQ7S 1MU2A 5KG3A 1HBUA 1P1LA 2C1EB 1AROP 3C16B 1XQIA 5ETQA 2PN6A 2ZJPQ 3BJYA 3R2DJ 1RT6B 4OX9F 5L9XA 2L9NA 3CGIA 3PJXA 2FJAB 1DY3A 5FDLA 3EPIA 2XSFA 1RK8A 2PDAA 1HD1A 2QLBB 3AH6A 1WC3A 2WCXA 3B4MA 2I1RA 3TYTA 1FRMA 1NSPA 1E6VB 1PILA 4ES1A 1RLDA 4DSEA 3R97A 5KOXA 1GK8A 2PMZD 5IT9U 2HK3A 2E1AA 3TJ9A 1S1UA 2E66A 2IRXA 4I64A 2VC0A 4X4QA 2BKNA 3BSAA 1JLQA 4NLUA 1NEEA 4JUZA 1P6TA 3QO9A 4JV2A 2RIJA 4ZN3A 3D1OA 2HAFA 2N7CA 3LH2S 1TL1A 4P2SA 4JV0A 1REVA 2AJ1A 4I2PA 3G6ES 4USTA 1C0UA 4PXBA 1NZ8A 1ULRA 2FLPA 5ETPA 4M1KA 4XPCA 3NRBA 3M8RA 3LA0A 5LMNJ 1S1XA 2VL1A 3OTOJ 4C8YA 1VK3A 3T6BA 2OPRB 3MCNA 2R8GA 1WC1A 2M5YA 1IXKA 1RTJA 3U27A 1RWUA 3B8HA 4KGKA 1BUXA 2V94A 3G87A 2M0GB 1V3SA 3MMBA 2UUBF 2XY6A 3TZXA 2DKOB 3ZZYA 3PKYA 3R1LA 2XI2A 1HQUB 1KBRA 2HMIB 1Q7LB 5C2GA 4RU9A 4URGA 3R5AA 5EWFA 4DN0A 3CJ2A 3DYAB 3CWJA 5LMUJ 2D74B 2XMVA 2HRTA 2GMLA 2CZ9A 4OHYA 3G82A 1UTAA 1LOUA 1RQ0A 1XR7A 4EK2A 1JKHA 1P9QC 2GVDA 4KV8A 1WKJA 1J2VA 1RAFB 4RZRA 5KFPA 3GJTB 3ZZRA 4J5OA 1LWCB 3QBCA 4Y2AA 1TL4A 2J6TA 5T7LB 3QYYA 3QFHA 4RW8A 1T03A 2JNJA 4LF6J 5CYQA 2GNKA 3WQPA 1RBLA 4HTJA 3IS9B 3RRHA 1AYEA 3FQLA 1SC6A 3M1VB 4UOHA 2RF2A 4CH7A 3NWGA 1GFWB 2QMUB 3RAXA 3ILLA 2XMMA 2CPFA 5KFVA 2G1HA 1H2UX 1NDPA 1LWEB 1RTZA 1HWIA 1KWMA 4DR2F 1RHRB 3MPWA 4P2XA 1ZTWA 4LIWA 1IVZA 4LF4F 3ITHB 1IJEB 2CNKB 2VA3A 4B02A 4IDKB 4A8MP 2JEGA 4X4SA 3KJVA 1SUQB 5IM0A 5EDWA 3MAAA 4DL4A 4ZPCA 2GMJA 1U1PA 2HZVA 3MPVA 3H90A 2FDNA 4KPCA 2EEYA 1WOSA 4Q43A 1TU0B 3LP1A 3QFWA 2CVEA 2HNZB 2CJKA 3LPEA 2VFUA 2ZH7A 4DQRA 1TL3A 2Q6BA 2L3MA 2XTJP 3M8SA 4QW8A 1PC4A 3UN2A 3SDEA 4I7FA 2CJYB 4PYDA 2B4OA 3R5BA 3OFHA 1I94J 1YJUA 2HK2A 3WC0A 3VALA 5BYRA 2CPXA 4K4ZA 1UA1A 3ZXWA 5D8HB 4NLQA 2VH7A 3LP0A 1HARA 3QAUA 3N0VA 2HHHF 2FVPA 3S7RA 4CLKA 3G71S 2ZH1A 4E0DA 2DHXA 1URNA 1WSRA 1WHVA 2Y1RI 4WXOA 2W9BB 2RHQB 5EWGA 4O4RA 3TNVA 1JK9B 5H9EJ 3BQ0A 2F4FA 4KGMA 2POKA 2FJVA 3MPDA 2E5LJ 3RB0A 1NUEA 2FHMA 4LVNP 3FSIA 1TMMA 3DHWC 1AZSA 4B3OA 3BBFA 4ZIVA 1J5OA 2HBQB 1GH8A 1S48A 1WI6A 2OAUA 1FFGB 4ECWA 4WKYA 3SSSA 2VOOA 2H54B 4I4BA 2Y9HA 4KHPJ 4PYAA 2JDJA 3IM9A 4PWDA 1NDCA 1JLGA 2N82B 5HVFA 3UD3P 4CNYA 4DPXA 1QSLA 3DLLQ 3OJUA 1R0AB 2C3PA 4DUYF 1HMVA 4A8OA 1YHQS 3IO1A 2GHPA 2CQ0A 1RTIB 3CCZA 4KE5A 4A48A 3I56S 4TLRA 3V6JA 3ULHA 3MFHA 4J9NA 1VK8A 1DZ5A 2UXDJ 5KFUA 3PW7A 1ZA2B 2BA9A 2LQ8A 3GIJA 2GHWA 2BM0A 5C5JA 1IBMF 1KDNA 2LU2A 3QQCD 4KH0B 1MG7A 2KVIA 1K73T 3LF0A 4AE5A 4H4KC 4QIWD 5HATA 3DHXA 4ZJQA 5C25A 3PRVA 3PIOQ 2BABA 4USIA 4DU7A 4P7TA 4NZ7A 3UNYA 4EZ9A 1WHWA 5C7PA 4JI2J 3CMES 2XS5A 1RABB 3H5YA 3RGIA 3CTRA 2I8EA 2D3ZA 2C2OB 2FVQA 1FEEA 1UVJA 1JLBB 4OJHA 4IUFA 4I1TA 1LWFB 3G6XA 3MGJA 1NH8A 3IRXB 3KHLA 3DCAA 3GSIA 2ADCA 5KG5A 2UVWA 4J9MA 3F41A 4OLPA 1T9WA 4CO4A 1Y5LB 3GIRA 2B5JB 1RT3A 4B17A 1X4EA 1BQNA 1JJ4A 5I4MA 3AJ1A 1FNXH 4NEYA 4H4KA 4C8ZA 5HLFB 2HIQA 1TAQA 1S0MA 1X31C 2V69A 3OTEA 3DDIA 2MKJA 1GXUA 1HBNB 5A6WA 1WG5A 5HI7A 4ZMMA 3CCES 4C11B 1UFWA 4ZPBA 4NCGB 4RNFA 4WIIA 3KKFA 1F9HA 3HVRA 3L4BC 4MIAA 4K2JA 3OHBA 1W7WA 3R6LB 2AYMA 1T94A 1DTQB 5J2PA 3SCKE 2F4VF 2GFFA 2CG8A 1NMEB 1EJ7L 2D1CA 4JI7F 4JI6F 4WXWA 2CYYA 3EZOA 2XY5A 3HVAA 3MEEA 4P72A 2UUCJ 1R89A 2V2ZA 3TJ8A 1EB0A 2LECA 4E8UA 1R3NA 4IG3B 3KLVA 3BF4A 2W25A 3BDEA 2YX7A 2ZBQA 4WFXA 2XLIA 3I5AA 2OMLA 2A2CA 3CEDA 4LQ9A 3W2VB 2MXYA 1F2HA 1T9YA 3QWUA 2N4DA 3DDNA 1JLCB 3VTIA 5IT9Y 1UEUA 2MZQA 1M1HA 1ZM9A 3HX9A 1KTQA 5D0RA 2X3GA 1M5VC 2YWWA 3KJQB 3ET6A 3RB4A 2QL5B 2YNIB 5DS7A 4ED8A 4ILRA 5H9FJ 1WHYA 2HPUA 3NNAA 2ZH5A 3MEDB 1P8GA 4PZVA 1TUWA 1N5QA 2YX1A 1Z2LA 2G0JA 3W8GA 3CNQP 2DY9A 3HD2A 3OTBA 3Q2SC 1ZM2A 1KC8T 2BYCA 1WDTA 2B56A 5KFMA 4AL7A 3D0IE 3C6UA 3CULA 2CWKA 1RLCL 1VC5A 3J80U 4WK3A 4AL5A 5E3AA 3H25A 4N8OA 4DR7J 1RT5A 1R0CB 3BGLA 4TYBA 4EI2A 2PIIA 5T14A 4CNZA 1IBLJ 4EYHB 4FVCA 5F8MA 2HFZA 1AFJA 2HHUA 4JOUA 4DPTA 3ISNC 3SCJE 2E44A 2JZ5A 4OJGA 1VHFA 2FTRA 2XZTB 5KFZA 5CXTA 4J9VA 5L38A 1KTVA 1SV5A 3D3BJ 1TVRA 4I6AA 3AD9C 2JLEA 1WTBA 2JRSA 4OYBA 2QTWA 3VWSA 3KK3A 2I5JA 2RT3A 4B9SA 3IMQJ 4ZLNA 4AL6A 3HKZD 3DLHA 1FKPA 3LW5C 4OI6A 3HT3A 1DLOB 2HYIB 1RAHB 1UA0A 4ECYA 1N6QA 5LJ5Y 4K59A 3QJPA 2FC8A 4MT1A 2BE2A 3DOKA 4QWAA 1NJWA 3CC7S 2YKNB 2QL7B 4NZ0A 2C28A 4BWMA 2K06A 5HBMB 4OMFG 4DR4F 3J7AN 4FS2A 4AQYF 3OVSA 4G1QB 3BEGB 1I51B 4CO5A 4V19X 1WC5A 5F41A 4MJKA 2ILZA 1RSCA 2D9OA 4ECTA 3K57A 4RWWA 1DARA 1S5ZA 3BQ2A 2HAIA 4FPRA 4PQUB 4H4MA 2UU9J 3BR8A 2CDQA 3Q8VA 1UMJA 1IR1A 4GRSA 2WRMA 1YSJA 4DR1J 3QT5A 4YHHJ 4ZVOB 3OL8A 3R5CA 4P10A 4B3SF 4BHQA 2FLOA 4ILLA 2R7SA 3TAQA 2C2KB 1YI2S 1V9OA 1OS5A 4DR6F 3PV8A 1YJRA 2RKIA 4XDCA 2VG5A 5KFDA 2ZUGA 3TVYA 2ZH3A 4PWUA 5KG0A 2D3UA 5LM7E 1EKSA 3IA0A 1IN0A 1X0PA 4OHWA 1OPIA 3VVUA 1JJHA 3FQKA 4IKAA 1LEOA 5DGBA 1HQ2A 4J9UE 2XYPB 1FDAA 4B3TJ 2HLTA 2QFJA 2V2QA 3OT9A 3DOLB 3M9MB 2EVZA 4IRDA 2L41A 1ZAVA 2AGPA 3RG6A 3MD3A 8RUCA 2IA6A 2H65B 1U1QA 4URQU 2RAQA 2AGOA 4LFBF 1RTDB 3ETMA 3R7SB 2CPEA 4B08A 1X5SA 3EICA 4NASA 1WHXA 2VG6A 1B0PA 2PO4A 1WKLA 2AYBA 1H98A 1B7YB 2QN6B 4G1IA 2F8HA 2ZOGA 3QLHA 4PUOB 4DV2J 1NJZA 3Q22A 3BZQA 4NPOA 4OZ5A 3M2UA 4FYXB 2OH2A 3HSGA 2W4PA 2DVIA 4FN5A 1JNRB 2OIHA 1UVMA 1GMUA 3DRRB 3QGPA 1U1NA 2MY7A 4KY3A 1LFWA 1WG4A 3FEXB 2V8VA 4GVBB 5DETA 1KQSR 2HHWA 2BANA 2CA9A 3DLBA 2ROPA 4X4TA 3N28A 3BDPA 3JXOA 1PC5A 1KQFB 5GAGI 3FFIB 4CTAB 2BM1A 5DM7Q 3Q86A 4O0NA 2KZMA 4ER8A 3NMRA 4KYZA 4ZVTB 4C0OC 3G4SS 1FNOA 3OTCA 3JTPA 2FUG9 1EETB 1K1SA 3BO2A 2W01A 3M30B 2AHOB 3DOMA 1VFJA 4F0MA 2VKRA 4M8LA 4ED1A 4QR2A 1OWXA 3DLEA 3MMCA 1HNZF 4N76A 4GVLA 1WJ9A 1KONA 2WBRA 2ZDOA 4M63A 2DY1A 4TY8B 4J37A 3PO4A 3KLEA 1S0NA 3PRBA 3W8PA 4Q8EA 1KVKA 4UTGA 3TVZA 2PGCA 4ECVA 4P2FA 5FIIA 1WF1A 2X1GA 2F63A 5J1EB 1RT4A 1Y5IB 3GFYA 5BR8J 5KG4A 4OV6A 5D78A 4F4ZA 3PVXA 1VBXA 2VZ9A 1UEKA 1YIJS 3MD1A 2K8GA 5AJ3J 4ICLB 1NH7A 1LXJA 2CPYA 4ECUA 3KLGA 4EU0A 1Q53A 4QZVB 5HMZA 2H4WB 3D1QA 1FXRA 4KPYA 2OMOA 3MR3A 4DG1A 3ZNUA 1CJKB 2DRAA 2J76E 1FFWB 2GS8A 3OFFA 1NHVA 5U47A 3RB3A 5HL7Q 1Q86T 1HPZB 4F3QA 3BV8A 3BN4A 4IO9Q 1YRTA 3OW2R 4CLTA 3CF5Q 2HFSA 2F9DA 1M5OC 5B08A 3GYGA 3GE9A 2JSXA 4H4OA 2D9PA 3QT8A 3DC2A 3O8WA 1P27B 2APOA 4L72B 3IAS9 3A3OB 2DGVA 1HNIA 4ZVPB 3I6PA 2FY8A 1VGYA 1SKRA 2GA7A 4B3RF 2D7SA 4F02A 3O1LA 1S7IA 1PIEA 4M5LA 5LMNF 3EX7B 2VPWB 3OTOF 3CDWA 2WHOA 3UWTA 1MU2B 2GQCA 2P2CB 4RW4A 2VOPA 1HBUB 2AYGA 2FJEB 4U7CA 3CCRS 3A12A 3P45B 4LQ3A 4Y34A 1TV6A 4LREA 2IMWP 1UVLA 3VVTA 4KQZA 5JUMA 4CRJA 3MMJA 3Q23A 5FDLB 5DQIA 1A6LA 3T1AA 3LOUA 1D9FA 1JX4A 3FBEA 2G13A 1O51A 3AQPA 1QVFR 1WSVA 1U45A 4JB8B 4JYAJ 3IGNA 1NK7A 4N56A 2N7YA 2RRNA 4MKYA 4KIAA 3BKUA 1G4CA 4QJVA 2L48A 4I6YA 1CLFA 3NGUA 1FWLA 2C2RA 3MHYA 3SYZA 2JOQA 1S1UB 4YS2A 1N5YA 2DBBA 2B9YA 2DGQA 2QX0A 2PEBA 3EUNA 3VGVA 3V6DA 1Q16B 4LF7J 2C2EA 2MZTA 1JLQB 4N8NA 4LF6F 1YLXA 3QO9B 1N5SA 2DNMA 4RPFA 2MTLA 2VODA 2CPIA 1HHQA 2E5GA 1TL1B 2F8MA 3BBCA 3FUYA 3Q8SB 4B9NA 3W65A 1G2EA 1REVB 2GQ2A 2XMAA 1X4HA 4I2PB 3RAMA 2XHCA 2V9WA 1RWPB 1C0UB 3RR7A 3OR2A 3D6MB 4C0BA 2MZ1A 1NRKA 3E01A 1F0XA 3HZGA 3R5JB 3M8QB 3R2CJ 5MLCV 2B8QA 2XS7A 1S1XB 1D3WA 2AQ4A 2MZJA 1YK9A 2OEKA 2O1PA 3D5MA 4FYYB 3HD1A 3KLIA 1RTJB 5KG6A 1J5EF 5D4NA 4HLBA 3OFGA 4EO8A 3MMBB 1KVJA 3FZ2A 3PO5A 2UP1A 1PJ7A 4OYMA 2DCUB 3DN9A 4NZ6A 2IJFA 3R7NB 3CJKA 2LMIA 2N3OA 2Y8YA 4NCBA 3FRZA 1FTCA 3FEYB 5KTQA 4ED7A 4CO0A 4ZN1A 3CC2S 2DGXA 4F26A 1ZOTA 1Q8IA 1D9AA 2KJWA 2CQBA 3GYNA 4DPWA 1XNQJ 1KHVA 1R31A 2YKAA 3JSMA 3H5UA 2XCAA 5IFMA 4ZPTR 4U96A 3G82B 1VQPS 2MQNA 3RUBL 5DJBA 1I1GA 2NYHA 1MROA 1BWVA 4RLEA 4IR1A 1TKZA 4QWDA 3G6YA 1HHTP 1LK5A 1JKHB 4ES3A 2KB2A 2GVDB 4KV8B 3IR6B 1S0VA 3MR7A 3ZTOA 3TARA 1HNWJ 1TKTA 1IR0A 1YITS 3R5DA 5KT3A 1RAOA 3I4HX 5DZ7A 4DQSA 4RW8B 1W25A 1T03B 4W4MA 5CYQB 2XLJA 1CJVA 3NNCA 3KK1A 4OHZA 1P1TA 1CEZA 5F8LA 4Q7AA 4RW9A 2RF2B 5CA5A 4FF1A 1UZDA 2Y0SD 2EK6A 1HFEL 1C1CA 2CDRB 4M95A 4MFBA 2E5LF 3PW2A 1WEZA 2EFVA 1EAYC 4AT1B 1IKVA 1GQEA 3MTKA 3HHLA 2FZCB 3H20A 4C3MA 1YX2A 1RADB 1B3TA 3SSRA 3KJVB 2DIVA 4DV7J 2OI2A 4RNMA 1LW0A 1NJYA 3EGVA 5IM0B 2KXNB 5SUHA 2PFDA 1RHQB 3MAAB 4KHPF 4LF9F 1HNXJ 1F3VA 4JI0F 1DQAA 4C4WA 3ZZZA 1RHMB 5E41A 4ELUA 4OZNA 3LP1B 3DRPA 5GAGU 5LL6d 2ZH6A 5GAEI 1YQHA 3I87A 2W9CA 1TL3B 5IV3A 4DV1J 3CCUS 2LQ5A 3AB2B 1X5PA 5ETMA 3SDEB 2XS2A 4I7FB 4X66J 1FJ7A 5DG9A 2ADBA 2UXDF 5JXSA 3QGGA 3HHLD 2C22A 1SKWA 2IJNA 2V2VA 1SL0A 4LF5J 2QSWA 3LP0B 4PPDA 3K5OA 4DX5A 1NO8A 4V19J 4O3QA 4KFBA 4K4TA 1WI8A 4L76A 2JFKA 1O5JA 2FJXA 1R8CA 5DDPC 3MM7A 2LYVA 3V81A 2IFXA 3HHNB 3CJQA 4CQ1A 3S6EA 5L1LA 2UUTA 1S1VA 4ZITA 4DV4F 2HFOA 5JJBA 3NGKA 4B3OB 3BGRB 1J5OB 1H6KX 4C98A 4X62J 1RWKB 4PXEA 3L09A 1VQLS 3M6UA 4DFJA 2XB2D 3CDBA 1ZAXA 4PEOA 5LSOA 1RTHA 4I67A 5B0CA 4DV3J 3FSYA 5EX3A 4RR5A 3TVKA 2R7UA 1D9DA 3CT9A 3AJDA 1AA1B 3MAHA 1I5OB 1KLNA 4PWDB 1JLGB 1TP7A 3M6WA 4LT6A 1O0PA 3D4JA 4ED0A 1Y0HA 2OGUA 3M7VA 5CD4A 1H2VZ 3NLCA 1HMVB 4W90B 5A8RA 2OELA 2ZHAA 4IFYA 2V67A 2AJ4A 4KSEB 4OYOA 2XYHB 4MIWA 1ZPVA 4OIXA 3BGUA 4LSNB 5KFQA 3PX4A 4FVMA 4LF4J 3V2UC 3K5MA 4YMEA 2ROEA 1RA7A 3BKFA 3UDVA 1D8YA 1T9UA 3W1YC 2BVZA 1S4FA 2DH7A 4DX6A 4DPYA 2UXCF 3DU5A 3B4DA 3BQ1A 5C25B 4PG4A 2M4MA 2BRLA 2ZE2A 4RO0A 2UUCF 5J1NA 4I0WA 2ATCB 3PJ9A 4NEZA 3DMJA 2W2PP 4J7CA 4NI2A 4NA3A 2XLKA 3EM1A 3SIPB 3OBIA 1B99A 1MN9A 5LSRA 4EBEA 3OUYA 4OFZA 4KO0A 1UZHA 2C3OA 2HQIA 6FDRA 1HI8A 2Q6CA 2ABYA 2GO8A 1R8BA 3ILJA 3GIKA 4DZDA 2FHJA 4OYXA 2GX8A 5K8MA 3HJFA 1M5HA 3BGFA 4QYRA 4LIRA 2HW3A 3X1LB 2PI5A 4Q2LA 4Q0BA 4V1Ak 1VYAA 4C7QA 3DRYA 4ZJLA 2HHHJ 2QA2A 5RUBA 3NXZA 1BE4A 1BQNB 2IHR1 3VQSA 3LO3A 4EBCA 4OLOA 3A8EA 2EK1A 1VOMA 1WUUA 2R7TA 3Q8PB 1ZYQA 5E3QA 3GR1A 4C3KA 5K8PA 5EUHA 1N4LA 1J27A 2OPPA 1MWYA 3GWCA 3SSQA 3NNHA 1EQ0A 3RW7A 2Z2LA 4KT0C 3RBEA 4DR7F 3OR1B 4GKKJ 3K2YA 2BQUA 2FHJD 3L3CA 4CYUA 5J2PB 2PC6A 2RQ4A 3H0PA 4F67A 3UCZP 1FWKA 2W7AA 2ZZMA 1FJEB 4ZPDA 1HL6A 3QPIA 1KOHA 3MEEB 1NM2A 2VG7A 3U1LA 5HANA 2DNYA 2MDAA 1W26A 3FKBA 4J9RA 2ALZA 3LGHA 4J90A 3ENAA 4DUYJ 2CQCA 4KKOA 3QJJA 5ETSA 2ZDPA 5E5NA 1KLMA 2BEFA 2MKCA 3KOAA 1YBTA 3RBDA 5HQLA 3ELHA 2MEWA 2ZITA 2MJUA 1C4AA 3ET6B 2DHSA 1X4FA 3N01A 1N54B 1NPKA 2XO7A 4KH1B 1KEKA 2NSCA 4L74A 2D69A 2N4CA 1SC4B 3SBMA 5AT1B 1RAAB 4F8RA 3M32B 4OX6A 4OZ3A 3KXDA 1Y3JA 2I6WA 5HMYA 4AD6A 2F5GA 3OXGA 4RU2A 4N77A 5ETOA 2WB4A 3TZYA 3MXHP 3NGSA 4ZCIA 1TUVA 2HKEA 4M5HA 2O3DA 1RT7A 2Z57B 3HSZA 1NDLA 2HNYA 2UU9F 2E29A 1RBAA 3C6UB 2V4JA 4OI4A 4YHHF 4UOCA 2KFYA 3SV3A 1RT5B 3U02A 3PR5B 1CG2A 2LLZA 2Q43A 4EWTA 2DNKA 1RJJA 1XMQJ 1DQ8A 1Y7PA 1ZA1B 4PCQA 1YZ7A 1X9MA 4FYVB 4DMZA 4C2MA 3FK4A 1SKSA 5KFWA 3HHKA 3NGTA 2DNNA 4FF4A 3A4TA 1SV5B 1FXLA 1NKCA 3WIUA 1RU1A 2Q1LA 1TVRB 3AAWB 3US5A 3UO0A 2RH3A 2ZNZA 3KK3B 1LV5A 2I5JB 1K0VA 3MWBA 3AD7C 2XHWA 2KFNA 4TYAA 3TA0A 3I9ZA 4DS4A 1XK8A 3VCDA 4C8NA 1FKPB 2R2UA 2VA2A 4DL2A 1N6QB 2KM8B 5GAEU 2HGNA 2DNGA 3D68A 1H7WA 4PAAA 2BE2B 4DZ6A 3V4IA 4DSKA 3DOKB 3VZHA 3P49B 2V8GA 2F4VJ 3K59A 2OFGX 3SQOP 3SMZA 4JI7J 3EDQB 2J0XA 5KFCA 3MM9A 2ZM6J 1XN9A 1OYEA 2BV3A 2A6MA 5CZVA 4KB7A 4YUDA 5B0EA 3P5TL 4H4MB 3SQGA 4HHJA 4CLUA 2KXHA 4WFYA 2QLJB 7FDRA 1IJFB 2VHGA 1HWLA 4CO2A 4DCPB 2D3OR 2KVQE 4NLOA 2YQ3A 2WVDA 2XNRA 2NR0A 3C2PA 2G0CA 1FHTA 1Q78A 7AT1B 1SIWB 1GTEA 4OI0A 4XTTA 2IBOA 3NCPA 4UW2A 2RKIB 1MMDA 2VG5B 1Q0NA 3EMTA 2JC1A 5GMEA 2FYXA 2FGOA 1OSDA 1B64A 3C3LA 4PPZA 2Q79A 3NBPA 1HW9A 3BBBA 3ILOA 2DRBA 5M2UA 1TKXA 2I0XA 2W4DA 3CIMA 5HMWA 1F3FA 2OEMA 4WFBQ 5J2NA 2ASLA 4L73A 3NWRA 3X3UA 4NXMJ 3I82A 3AOBA 2XYGB 1U2CA 1T05A 4USWA 3A8IA 4JI8J 1U2FA 2ATLA 1U0HA 3M8PA 3M2VA 2BW7A 1Z4UA 4UUWA 2Z2YB 4O3SA 1L3TA 2IC3A 1HNVA 2FZKB 2OSRA 2X3DA 4K5RA 3L9ZA 3H8YA 2O67A 4P2MA 3G2XA 4IG0A 3QLHB 5BR8F 2HHXA 3POTA 5F8NA 3D0GE 1ELOA 2KHCA 2W24A 3M2UB 4A47A 2AEJA 1BQMA 2CZVC 2YWEA 4ZJOA 1MW7A 5E3RA 2NYIA 4GC6A 4DQPA 5AJ3F 2M70A 4MAKA 3EVWA 2VFVA 1S0OA 2ZWPA 5JVHQ 2QT7A 3SCIE 4G3IA 4USVA 4WTYA 3HLUA 2BANB 3MCOA 3WHIA 1SQEA 2E9TA 2VFRA 3EDRB 1UVIA 3OXFA 1FRJA 4O3NA 1TTHB 1XBWA 1C1BA 3OL6A 4NLPA 4YR3A 3KTQA 2RQKA 1Z2ZA 2QLWA 3AB4B 2YWGA 1F60B 5DLGA 2COLA 2YX4A 4BC7A 3GV8B 1F5AA 2BJ7A 1EKRA 4YDDB 3F73A 3DOMB 5IWAJ 2DJWA 4CLSA 1F5BA 2ROGA 4C48A 5DZ6A 3DLEB 3IWXA 4LR8A 2V4QA 4LBHA 3MMCB 2R2RA 2DPJA 4NA2A 4NLGA 2PE8A 4OZ2A 4X4PA 1CS4A 3CCTA 4RBTA 3KLEB 1GAOA 4LRCA 1S97A 2G4BA 1BMQB 4M5IA 3MR2A 2R8KA 1AFIA 4S0MA 2J5AA 2XMUA 3LWMA 3MUVP 2UVUA 2MPUA 1QUPA 2PMHA 2G2ZA 1AW0A 2IDLA 5C24A 1RT4B 1BLUA 2RILA 2GHVC 3PFEA 2IY5B 2OUGA 4JYAF 3CW2C 3KUGA 5CZXA 1RWXB 3GYXB 2AJQA 4CWBA 3NGRA 2K3KA 4NYZA 4R5PA 3RJMB 4OYZA 2ZKTA 4TQSA 1X5TA 2AJFE 1JMTA 2VD3A 5F3ZA 4FNHA 3QT6A 3NL0A 3UDEA 1SJ3P 2HZAA 3R5GA 3PHTA 2RJZA 4DG1B 2KN4A 1FWPA 1YDLA 3MM8A 5HP1A 1SBRA 4LF7F 2E9ZA 2B8PA 3F44A 2ASDA 3EXCX 4KHMA 1DAXA 4YFUA 4KRWA 4YY3J 5KT5A 3JQKA 1VIXA 3RRGA 3GG1A 3VAGA 4WFAQ 4P75A 1X7VA 4CI0B 1U7LA 2J9DE 2VPXB 4H4OB 4N5SA 1HNIB 4DPUA 2LCWA 2PSZA 4DN9A 1OY9A 3PM9A 1WDDA 1VJQA 1PAUB 5KT7A 3UVJA 3TEGA 4NXNF 3ZFVA 3CCQS 4RW4B 3CCJS 1VQNS 1FX2A 2IRYA 1TV6B 3ZZTA 4AYBD 2BXJA 1QAJA 4HH0A 5KFHA 3VAFA 1BC6A 1WF2A 3MEGA 4A8SA 4TU8A 4OJ3A 2B4PA 4Y2IA 4BLGA 1IBKJ 3HSJA 4J9QA 1XJWB 1XNQF 4LF8J 2OEJA 1SPBP 3NG8A 3FBFA 3B82A 3O44A 5CHCB 1Q79A 1URRA 5I3PA 4FPIA 1SB6A 2LDYA 3W60A 2CJXB 2DHHA 1SJQA 3QAEA 3QZ7A 4OYIA 5L8RC 2HQCA 1K44A 2LQ9A 5DG7A 2XSJA 1UETA 1SH2A 3HFZB 4JBCA 2E1PA 3PHEA 3H2UB 1N5YB 3PYFA 2GJ2A 3LAKA 3MM5A 2OKQA 3C66A 4OI3A 3V6DB 2DK2A 1HNWF 4NLYA 3EPGA 4BBYA 3WC2A 2G2OA 3J81U 2HVZA 4P52A 4FS1A 1L3UA 2ACMA 2LXUA 1OMSA 3P8BB 1FDDA 4U8VA 1DTTA 3SCLE 4Y28C 1HW8A 4HI1A 4ELVA 4M5NA 5CYJA 2WZ1A 4WCEQ 3VAKA 1UJ6A 3OR2B 2IJRA 1TFYA 3T5LA 1CC7A 1U1MA 1YRXA 1TFWA 1SUQA 1RUSA 2Z2ZA 4CLWA 3E01B 5IS2A 5AXMA 2MLYA 4HDHA 3W2WA 4DV5J 4QIGA 3ZTPA 1WOPA 1JQGA 1MLAA 5E3PA 1LW2A 3PXGa 3KLIB 2CQHA 4DV7F 1L3SA 2RMLA 3QRPA 4LF2A 1KQKA 5HQ8A 4CDIA 4QCLA 3GV7B 5L1JA 3W9JA 4DUTA 3CMAS 2P5VA 5FLXU 1HNXF 3HVWA 4WE1A 4O3PA 3CJKB 1VI7A 3QRQA 4Q2MA 1PGZA 2PMWA 4UF4A 2BDPA 2VQFJ 3JYTA 2E5JA 3HSDA 1VHIA 1CJUA 3NS7B 2V2KA 2GVZB 3TP2A 2QJ3A 4DV1F 3QRRA 2CQ2A 3JSMB 2B7BB 3KLHA 4X66F 1EP4B 5D0HA 1U6BA 1B4SA 5M2PA 4B3RJ 1KS2A 4H54A 3H4DA 3CCLS 4WU2A 2R8HA 4MIBA 2G1DA 4LF5F 2W9BA 3PJWA 2GJFA 1TKTB 1FKOB 4P74A 1ZH5A 2A6OA 4EO6A 2V0NA 1YJVA 2DXFA 4LR7A 2YNFA 5KFSA 1CJVB 3NKYA 3KK1B 1WWHA 4WIQA 4LSLA 2IM3A 4RW9B 2VBZA 1WC0A 1YZ6A 5IT0A 3CDEA 4K4WA 2CJBA 1C1CB 3KFWX 3W66A 3EJMA 3D54A 4MFBB 3PRDA 2DR7A 4DLGA 3DLGA 8ATCB 5KG7A 4KBIA 3THPA 1TQLA 3BO4A 1IKVB 4X62F 4WP9A 2BZ2A 2KU7A 2BUNA 2LA6A 1RZMA 3HHLB 4LBIA 3TQ1A 1G6BA 3UCGA 4DV3F 3AOAA 2MYFA 2F40A 3N5FA 1ZAWA 2FY1A 1LW0B 1S12A 4LFAJ 1H73A 2OPQA 2CADA 2YWHA 1CSJA 3CDUA 3UW1A 3DGVA 5KT4A 3MOJB 4NL5A 4ZPAA 4JI5F 4ZVRB 3GJQB 3HFKA 5M2RA 3VGUA 1NJIT 1C2PA 4TY9A 1R0BG 3H5SA 3C8YA 3EGZA 3CJ8A 4F2SA 2HHPA 2LQJA 4FXVA 2EFOA 1S9FA 1NDKA 2W9CB
chains in the Genus database with same CATH topology
1CJVB 2W01A 5IV3A 1CJKA 1CJVA 4CLSA 4OZ3A 1WC3A 4P2MA 5D0EA 1YK9A 1WC0A 1YBUA 5D15A 1WC1A 5IV4A 4OZ2A 1CS4B 4CLTA 5D0GA 1CS4A 4OYIA 1Y11A 4WP8A 4OYXA 4OYMA 4CM2A 1AB8A 4OYPA 4P2XA 1CULB 1CJTB 1WC4A 4WP9A 1CULA 1CJTA 4USVA 1CJUB 4CLKA 4P2FA 1CJUA 4USUA 2GVZB 1AZSB 4OYOA 1WC5A 3C15B 1TL7B 4WP3A 1Y10A 3C15A 1TL7A 4CLPA 4WPAA 3UVJB 3MAAB 3G82B 4USWA 4CLLA 3UVJA 4CLFA 5D0HA 3C14B 3G82A 3MAAA 1YBTA 1FX4A 3C14A 1U0HB 4OYWA 2QV6A 4CLUA 1U0HA 1FX2A 2WZ1A 4OYZA 4CM0A 2BW7A 2GVZA 1AZSA 2GVDB 3C16B 1WC6A 2GVDA 5D0RA 3ET6B 3C16A 4USTA 3MR7A 3ET6A 4CLZA 4CLWA 4CLYA 3R5GA 4NI2B 4OYBA 4NI2A 4OYAA 1CJKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJV B;  2W01 A;  5IV3 A;  1CJK A;  1CJV A;  4CLS A;  4OZ3 A;  1WC3 A;  4P2M A;  5D0E A;  1YK9 A;  1WC0 A;  1YBU A;  5D15 A;  1WC1 A;  5IV4 A;  4OZ2 A;  1CS4 B;  4CLT A;  5D0G A;  1CS4 A;  4OYI A;  1Y11 A;  4WP8 A;  4OYX A;  4OYM A;  4CM2 A;  1AB8 A;  4OYP A;  4P2X A;  1CUL B;  1CJT B;  1WC4 A;  4WP9 A;  1CUL A;  1CJT A;  4USV A;  1CJU B;  4CLK A;  4P2F A;  1CJU A;  4USU A;  2GVZ B;  1AZS B;  4OYO A;  1WC5 A;  3C15 B;  1TL7 B;  4WP3 A;  1Y10 A;  3C15 A;  1TL7 A;  4CLP A;  4WPA A;  3UVJ B;  3MAA B;  3G82 B;  4USW A;  4CLL A;  3UVJ A;  4CLF A;  5D0H A;  3C14 B;  3G82 A;  3MAA A;  1YBT A;  1FX4 A;  3C14 A;  1U0H B;  4OYW A;  2QV6 A;  4CLU A;  1U0H A;  1FX2 A;  2WZ1 A;  4OYZ A;  4CM0 A;  2BW7 A;  2GVZ A;  1AZS A;  2GVD B;  3C16 B;  1WC6 A;  2GVD A;  5D0R A;  3ET6 B;  3C16 A;  4UST A;  3MR7 A;  3ET6 A;  4CLZ A;  4CLW A;  4CLY A;  3R5G A;  4NI2 B;  4OYB A;  4NI2 A;  4OYA A;  1CJK B; 
#chains in the Genus database with same CATH topology
 2QMX A;  2SXL A;  2YKP A;  3BN7 A;  2JJ4 D;  2LVW A;  3SZ2 A;  2V63 A;  4ZLL A;  4AUK A;  1S10 A;  4K4X A;  6AT1 B;  2QLF B;  4N41 A;  1R8H A;  2LKZ A;  5I42 A;  4E2F B;  3Q83 A;  4CM2 A;  2DR5 A;  4XK8 C;  5DO2 A;  1J5E J;  5E7O B;  1QLN A;  1AUD A;  3WIV A;  2NPF A;  3TX8 A;  1WF0 A;  3MM7 B;  4EBD A;  3V81 B;  3KHG A;  2R2T A;  4HDG A;  3HFV A;  1Y10 A;  3TEH B;  1KFS A;  3VAH A;  1KOO A;  1W2I A;  4RNO A;  2XCP A;  3P5B P;  4G65 A;  2G9O A;  2VU5 A;  2C3U A;  4OZ0 A;  5KFO A;  2DH9 A;  1S1V B;  1RKJ A;  1NK9 A;  3BYR A;  2H5I B;  1T11 A;  3OD2 A;  2VIC A;  2UUW A;  1RWM B;  3JAM U;  1XR5 A;  5LSL A;  1SJF A;  1GXL A;  4MK7 A;  2WTF A;  4BWJ A;  3S01 A;  3K0J A;  3F0N A;  1HBM A;  1RTH B;  3KK2 A;  2BJE A;  1B70 B;  2DHG A;  2KG0 A;  1IBC B;  2AIR B;  1QM9 A;  2BQ3 A;  1RHK B;  2DNP A;  2YWK A;  1HBN A;  2BE7 D;  2O01 C;  3QT7 A;  2CJ9 A;  1N5T A;  4I2Q B;  1FT8 A;  2DXD A;  1NND A;  2DEI A;  4PWW A;  2YH1 A;  1QUV A;  2LXI A;  3UD4 P;  4RNN A;  4DV0 F;  3RW6 A;  3FDS A;  5A2Q Y;  3W5X A;  4KGV B;  4HEA 9;  3JB9 k;  2GV1 A;  1S6O A;  2CQP A;  2OHD A;  3R9L A;  3HXM A;  3CPW R;  1KVI A;  4DF4 A;  4X84 A;  2K7J A;  4UQG A;  5A8W A;  4PXD A;  1UW9 A;  2NRE A;  4GKK F;  2R7O A;  1FA0 A;  3TW0 A;  4ATN A;  5MAO A;  4WWS A;  1EHW A;  2BQR A;  4USH A;  5CCL A;  2Z58 B;  1IQT A;  5E0O A;  5IQQ A;  2BJ1 A;  2FLL A;  4KAI A;  1E6Y A;  2HQD A;  4RBU A;  4YB6 A;  4X4R A;  2ZE2 B;  3FJ2 A;  4DL7 A;  1IWG A;  3OL9 A;  3QGH A;  3NOG A;  5GMD A;  4LF9 J;  1HWJ A;  3DMJ B;  4JI0 J;  4NI2 B;  1VRU A;  1MML A;  1RYR A;  3D1H A;  3RAQ A;  4OI2 A;  4ED6 A;  3HVT A;  3A3P B;  5B0B A;  1FE4 A;  5CYM A;  4PKD B;  5KFB A;  3OUY B;  3T1H J;  4KO0 B;  3NS5 A;  3H59 A;  3VR1 A;  2EG1 A;  2MST A;  1RWN B;  3OLA A;  3HKW A;  4BS2 A;  4M5K A;  2LDI A;  3N6L A;  1Q4R A;  2VV5 A;  1VQ6 S;  3DRX A;  4FYW B;  3JSR A;  5KFX A;  3MI7 X;  3ENQ A;  1MN7 A;  3VF0 B;  5DQH A;  5D3G A;  1PO6 A;  4DHV A;  4ECQ A;  1JLF A;  4Q0B B;  1GX5 A;  1RI7 A;  2BBE A;  4FKY A;  3BSC A;  4ZVQ B;  2HFU A;  3ZZO A;  1UEV A;  5KFL A;  3AQO A;  1R6Y A;  1RWO B;  2YH0 A;  3FBC A;  2CPH A;  4U67 Q;  3PW5 A;  5A6P A;  1OY6 A;  2G0I A;  3FBB A;  3W9H A;  4ZP7 A;  2DO0 A;  3HK2 A;  2OPP B;  1JLA B;  1Z1Z A;  3P96 A;  4ECS A;  4DV4 J;  1L5U A;  1VQ9 S;  1NZA A;  2K3I A;  3HT0 A;  1OPZ A;  1U6Z A;  4CYU B;  3GJS B;  5LXR A;  2B6A A;  1VQY A;  4K0K F;  2VDI A;  3HHD A;  2L9D A;  4HTI A;  1XMQ F;  3LPY A;  1CC8 A;  3QNW B;  1KFD A;  2QG9 B;  4MKB A;  1FRX A;  2FLN A;  1S1W A;  2Z4P A;  2VG7 B;  2M2B A;  3QIP A;  4DEZ A;  4FP9 A;  4ECX A;  4NYP A;  5L39 A;  4C8O A;  1H2T Z;  4Z7Y A;  4DI6 A;  1V3Z A;  4DSJ A;  1UFK A;  1R7I A;  1CQN A;  1AUS L;  3GR0 A;  2J6U A;  2IYI A;  4KKO B;  4GKJ J;  3GMG A;  1KLM B;  2ASY A;  5B0G A;  1V5I B;  4X2B A;  3THT A;  2K7K A;  4RJV A;  5EX0 A;  3CJS A;  1IUJ A;  4QPT A;  3PYG A;  2R7Q A;  2HQ3 A;  2HBZ B;  5EGY A;  2V4R A;  1X4C A;  1K8A T;  5KFT A;  3GV5 B;  5K14 B;  3W5Y A;  4DL5 A;  2EKY A;  3AOC A;  2DIS A;  2E7X A;  5GMK a;  5KFK A;  3V5R A;  2UXC J;  4PQA A;  4ZCK A;  2AEF A;  3R6G B;  2KKH A;  2ZD1 A;  2ZM6 F;  2E1M C;  1TK5 A;  3ADA C;  3MR5 A;  3DNC A;  3LAL A;  2B43 A;  5IV4 A;  5HO4 A;  2PFF B;  4C3L A;  5AE1 A;  1RT7 B;  3RRK A;  1R8A A;  2HNY B;  3GIL A;  3UNG C;  3VAJ A;  2V4J B;  1CUL A;  1VLO A;  5HVH A;  3QMQ A;  3T9N A;  4DV6 F;  4WZQ A;  1S9E B;  3PZP A;  1REG X;  4TN2 A;  3M2R A;  3E51 A;  2VBW A;  3K8V A;  5FLX Y;  4ZLJ A;  1UFL A;  1PG5 B;  1N32 J;  3GPA A;  4DX7 A;  2J8S A;  1WD6 A;  2FJW A;  3T41 A;  3W64 A;  2KRB A;  2AWZ A;  1KD1 T;  3TO8 A;  1VC0 A;  1U2R A;  3DOL A;  1IKW A;  4XIU A;  3I9V 9;  1ZBT A;  3CCM S;  2CNN B;  2QA1 A;  4J9P A;  4NXM F;  2GW8 A;  5HSP A;  3C46 A;  1CBK A;  2KJV A;  2HHQ A;  4IFV B;  1B0V A;  4OHX A;  2JEI A;  3V4I B;  4JI8 F;  2YWF A;  4F04 B;  1N33 J;  4KC5 A;  4FF2 A;  2CPD A;  4ZKA A;  2F1F A;  4BCA A;  2EBE A;  4E98 A;  4IH7 A;  2JLF A;  1SJ1 A;  2NZC A;  3GLJ A;  4ZVG A;  1IM6 A;  3MM9 B;  2MGZ A;  2WVC A;  4WJB A;  2DR6 A;  2FJB B;  3E8O A;  4WPA A;  2X1B A;  3V6K A;  1UL3 A;  2R7W A;  3WX8 A;  2WVB A;  4BC9 A;  3SQG B;  3GQC A;  1UPM B;  2HBY B;  1WEX A;  2DNH A;  5HRO A;  1XTZ A;  2C2M B;  2LEB A;  3UI3 A;  1KSP A;  3KNG A;  3E2E A;  1TAU A;  3T5K A;  5B7W A;  2HWI A;  3J7Z 5;  4HI2 A;  4CTA A;  2H48 B;  4O44 A;  3JQM A;  3CMQ A;  1VIO A;  3I55 S;  1N52 B;  3R27 A;  4G1P A;  3DXS X;  1U4B A;  3WZ0 A;  1BWE A;  4ID8 A;  2BJ3 A;  1HR0 J;  3TAM A;  5ETK A;  1APS A;  2R4F A;  2M52 A;  3Q8Y A;  2DNO A;  1RWW B;  5ETL A;  4QPX A;  3NBP B;  2FC9 A;  3A1Y G;  4B9M A;  4MK8 A;  5IC6 B;  1VQ5 S;  5J2N B;  3HZE A;  1M0S A;  3AXK A;  4RL1 A;  4IQX A;  4F2R A;  1CQM A;  3FCV A;  5J2Q A;  4M5D A;  1YBA A;  3D3C J;  4K4U A;  4WP3 A;  2A2D A;  5IWA F;  5BJR A;  4TY8 A;  3DDK A;  2E7V A;  2ZHB A;  3ZTR A;  2HRU A;  2RD5 C;  4IR9 A;  3VAI A;  1HBO A;  5I3Q A;  1YJ7 A;  3CB4 A;  3UQS A;  2ZC4 A;  2YPY A;  2Y0B B;  1U0H B;  4ETZ A;  4USJ C;  1UWB A;  1RBO B;  3M2V B;  3M8P B;  2VB6 A;  2XC9 A;  3PYE A;  4CZC A;  1ZZN A;  5KAK A;  3WX4 A;  2WK4 A;  4DFM A;  2WON A;  1Q8B A;  2IC3 B;  1HNV B;  2XMK A;  4X4U A;  4EYI B;  2KO1 A;  2HWT A;  2NXJ A;  5EWE A;  4K4V A;  3AT1 B;  1R43 A;  3GIM A;  4ICL A;  2ILY A;  2JWN A;  3K17 A;  2K2P A;  4CP5 A;  4IG0 B;  3ISN D;  3LGN A;  9RUB A;  3MCM A;  5FD1 A;  3POT B;  1FE0 A;  3AA8 A;  3QAT A;  1BQM B;  2W9A A;  3LAM A;  3CJT A;  2VJU A;  5K5M A;  4WFZ A;  3H4B A;  1SI9 A;  3VGT A;  2CXE A;  2GAH C;  1U1R A;  2YPZ A;  2YNG A;  4K4Y A;  3MEC A;  3D66 A;  2KFZ A;  1VQS A;  1T3O A;  2HLU A;  3ETO A;  1H38 A;  2H51 B;  2NQP A;  3R7B B;  3G86 A;  2ZBC A;  4HAC A;  3OXL A;  1FER A;  3G9C A;  3DLJ A;  3C15 A;  1PBU A;  3OQ2 A;  4EUV A;  3HP6 A;  1SJR A;  5B09 A;  4YY3 F;  5H1S V;  2YKM A;  3DKD A;  2B3T B;  4F25 A;  4WF9 Q;  2BMB A;  5C42 A;  1Q7Y T;  1UCN A;  3M6X A;  2W1B A;  4NOH A;  4L75 A;  3KG1 A;  1VQK S;  3R1H A;  2MQQ A;  4ZCM A;  1Q1K A;  3AOD A;  1LK7 A;  2YBV A;  4C97 A;  3KNA A;  3UN5 A;  3B6B A;  3D6T B;  1ZPW X;  1JJ2 R;  1OQ3 A;  4F50 A;  1CS4 B;  4M5G A;  3RYL A;  1F6T A;  1U6F A;  3DM2 A;  2V9K A;  4WP8 A;  2MQ8 A;  2IVM A;  3C19 A;  1WKK A;  5G0R A;  4ED2 A;  4JI1 J;  2MMY A;  4M5M A;  2I2Y A;  2BAC A;  1KQG B;  2PA3 A;  3AXM A;  4LSZ B;  1OYD A;  4O3O A;  2NPI A;  4UOG A;  5C24 B;  5IT4 A;  2Z8Q A;  1IBK F;  4ITS A;  5CD4 H;  2XEX A;  3TAN A;  5G4D A;  1IWA A;  4ZPV R;  2EFN A;  1VCT A;  1FDB A;  4LF8 F;  3RBZ A;  5F8H A;  1VDH A;  3PEJ A;  2E9R X;  3C14 A;  3H98 A;  2LEA A;  4R5P B;  1ZTT A;  2GIQ A;  2W7O A;  3Q8U A;  4RUC A;  1N34 J;  1PYT A;  1VR6 A;  3D28 A;  4I6W A;  2BE9 B;  2A1B A;  2XMJ A;  3FRY A;  1S1T A;  3MM8 B;  5HP1 B;  1NK0 A;  1T9V A;  4Y00 A;  2AT1 B;  3IR7 B;  4JI3 F;  3PX6 A;  2HEK A;  1S72 S;  2RB7 A;  4DU8 A;  3M8Q A;  4I69 A;  4X64 F;  2DR8 A;  4OJ1 A;  4W92 B;  4ZLP A;  2J9E A;  3OLB A;  3CD6 S;  5KFR A;  3P4U B;  3IRW P;  4ZHR A;  4A8Q A;  4DV5 F;  4LVO P;  3HDS A;  2LFV A;  3I0R A;  1H72 C;  5AXK A;  4ETX A;  1TZ0 A;  1X4D A;  4F0H A;  1T7P A;  1RWV B;  2NUH A;  1Q8K A;  3O6Q A;  3UVJ B;  1FK9 A;  1UVN A;  4K5S A;  2GIR A;  3EZ5 A;  2VFT A;  3GZ7 A;  3UDL A;  5D4O A;  1OY8 A;  2A10 A;  2E1C A;  2W4C A;  3BGO P;  3NEK A;  3MEG B;  4RW7 A;  2ZC3 A;  3G8Q A;  5FJ4 A;  2VQF F;  4CCH A;  1W2B R;  2ZVI A;  3ZTS A;  4OYA A;  4PR6 A;  2ZH9 A;  3GII A;  3A8J A;  2CJQ A;  2HQG A;  4DLE A;  2WAQ D;  4A8Y A;  3KDN A;  4AND A;  2D41 A;  1N36 J;  2J7U A;  2HHV A;  5K8N A;  2QYC A;  1YG0 A;  1U1K A;  2XSJ B;  2NZ4 A;  3O2I A;  2W7P A;  3K58 A;  3UR3 C;  3MM5 B;  1RP5 A;  2H5J B;  2GIF A;  3MDF A;  3L7P A;  2HFN A;  4LRB A;  1UJ5 A;  2DCL A;  2EXU A;  1RA6 A;  3PYD A;  5IOL A;  3GJR B;  2E5H A;  2FVS A;  4C6A A;  2R7R A;  2LU1 A;  2ALY B;  5KFG A;  1DTT B;  1C4C A;  3SXL A;  2E7W A;  1G1X A;  3PDN A;  1XMO J;  4YEA A;  2XMW A;  2CQ4 A;  2NS1 B;  2M7S A;  3W63 A;  2GGP A;  3J7Z T;  2ZH8 A;  4O3R A;  3QSI A;  2AJ2 A;  3SI8 A;  1M5K C;  1YRU A;  3N5B A;  3M9O B;  1VBK A;  3W2W B;  4ED3 A;  2WBM A;  1QJH A;  4J9K A;  1SKU B;  2GO9 A;  1LW2 B;  3JTN A;  3ZZU A;  2V5H G;  4LFA F;  3CIZ A;  2IM2 A;  4OX8 A;  4U7U D;  5CQG A;  2XG8 A;  4A8K A;  2CJA A;  1NB7 A;  4WE1 B;  2DGS A;  5EHH A;  1PKU A;  1GNK A;  4NYO A;  4RKU C;  5HJY A;  1X9W A;  3JYT B;  2P9E A;  1CJT A;  3UDC A;  2AD9 A;  1O6X A;  1CJU B;  1JXL A;  3ENV A;  1U8S A;  3J80 Y;  1S57 A;  3IP0 A;  1HYS A;  1IKY A;  3VHQ A;  2QA4 G;  1C0T A;  3KLH B;  5GAD I;  2QFI A;  5K8O A;  3U1M A;  1VRT A;  4M5J A;  4U95 A;  2CFX A;  4IRC A;  2ZFH A;  4ILM A;  4CM0 A;  1NAQ A;  1FES A;  1OSC A;  2HRY A;  3CJ3 A;  1X4B A;  2R2S A;  1YJW S;  1PJ6 A;  1UVK A;  2UUA J;  4XO0 A;  1RKI A;  2Z2M A;  4NXN J;  5J1P A;  4U9R A;  4KGZ B;  4LUB A;  3MUT P;  4TLQ A;  2YNF B;  2DPI A;  1EX8 A;  3K5P A;  2B4V A;  3HHE A;  4LSL B;  2RUS A;  5HQM A;  3BGR A;  2FIU A;  4ED5 A;  3CCW A;  2MJN A;  3H7H B;  3IG1 A;  2M3D A;  1KRP A;  2DYA A;  4M94 A;  2XM3 A;  4TXS A;  3DLG B;  1IKX A;  4PG8 A;  4DL6 A;  4OZJ A;  4X4V A;  2R8J A;  2KYX A;  1FCA A;  1N8R T;  3IAM 9;  2Z56 B;  3FMW A;  4Z7C A;  4FYD A;  2DR9 A;  3GFH A;  3NOC A;  1GXT A;  2WW8 A;  2C2D A;  4F3M A;  2OPQ B;  4QR1 A;  4B9L A;  2QLX A;  1Y4Z B;  1SL2 A;  2HHT A;  4DPO A;  2E1R A;  4WZM A;  5DGA A;  4DR3 F;  2AEM A;  1Q5Y A;  5KT6 A;  2VF3 A;  1LXN A;  1OJ4 A;  1Q8L A;  5E2Q A;  4UZC A;  4LSN A;  1U26 A;  2QC3 A;  3JQJ A;  3OPK A;  1DBD A;  2ZJR Q;  4PG7 A;  3PY8 A;  2FZG B;  2XNQ A;  1IR2 A;  5ADZ A;  2C2Z B;  4UUX A;  1DQ9 A;  3HUL A;  1FEH A;  3TJA A;  4ECZ A;  1BY9 A;  4KTQ A;  1YKW A;  1XC9 A;  5D15 A;  5IXU A;  2ZEJ A;  3MFI A;  1CVJ A;  5F0U A;  5I42 B;  3O5T B;  3LUY A;  2CPJ A;  2JLG A;  1NB2 A;  3EYZ A;  2EKN A;  2OPS A;  4UY8 5;  1YGY A;  3MM6 A;  3T9Z A;  3MUM P;  4PAB A;  4A4J A;  3KUE A;  3JSB A;  3MOZ A;  1PAE X;  1NCL A;  5LXY A;  5A76 A;  1TL7 A;  4O4G A;  3DLK A;  3T1H F;  4USM A;  1QE1 A;  1G3O A;  5ETV A;  3SEO A;  2JX2 A;  1WNE A;  4EGL A;  2ZWO A;  2NXN A;  1CPZ A;  4QYZ K;  2VBY A;  4B9U A;  1UP1 A;  1HBM B;  3KK2 B;  2FVC A;  1NKE A;  1S6Q A;  4YB7 A;  3T19 A;  4JI4 F;  2P6T A;  4MKA A;  1FVQ A;  4DUZ J;  4F4K A;  4LMZ A;  4DS5 A;  4F7V A;  3BPD A;  2HIY A;  2F65 A;  4ALZ A;  2DNQ A;  4IQM A;  4PG5 A;  2EFP A;  5KFJ A;  4I68 A;  1Y9O A;  6FD1 A;  2J8A A;  2G2Y A;  3OR1 A;  3M6V A;  1U49 A;  1M90 T;  4KR0 B;  4DFK A;  4YDX A;  4RW6 A;  5CAB A;  2RS2 A;  4QR0 A;  4ZP8 A;  4YP3 A;  1AZS B;  2ZZT A;  4RNH A;  5A8W B;  3GCX P;  3IM8 A;  4ZVS B;  2MZR A;  4J9L A;  1U8W A;  1FJC A;  2I38 A;  4DSF A;  3KJF B;  3IWN C;  2WOM A;  1E6Y B;  3KG4 A;  3MAQ A;  3IGV A;  1S6U A;  4DQQ A;  1U47 A;  2IVF B;  1YTY A;  5DRK A;  4HVZ A;  4NRU A;  4IOA Q;  1NPP A;  3CXC R;  1EAR A;  1VRU B;  4JI5 J;  4K7Q A;  2AP6 A;  3KJN B;  3HVT B;  5CYM B;  1JXE A;  4L3N A;  5DDO C;  4ZVF A;  5AXN A;  3MTJ A;  2CKW A;  1U1L A;  4GKJ F;  3AD8 C;  2HVD A;  3FC9 A;  1VS3 A;  3S1T A;  3ZZ0 A;  5AE3 A;  1T02 A;  4KHR A;  2F9J A;  2W2Q P;  1LKZ A;  1VBY A;  2LP4 A;  2RUG A;  1NK5 A;  3M32 A;  4WYL A;  3PEH A;  1F5C A;  5D3G B;  4XPE A;  1GT8 A;  3D67 A;  2HS4 A;  2JHE A;  3KHR A;  3K5L A;  1YWX A;  1JLF B;  4R25 A;  2RS8 A;  4IH5 A;  1KKH A;  1RT1 A;  1TMJ A;  4K2X A;  2Y1J A;  4CT8 A;  4NLX A;  1RAC B;  2HG4 A;  1K47 A;  2KM8 C;  2VC1 A;  1B7F A;  2HSE B;  2H9Z A;  3TX0 A;  1V5V A;  4Y2K A;  1VQ8 S;  3Q2T C;  2GAG C;  1FX4 A;  3ICL A;  4B3M J;  4MYU A;  1SQG A;  3IBF B;  3V4M A;  4OQJ A;  3O3L A;  2MKI A;  3N9U C;  1JNZ B;  3N6N A;  2L9W A;  4BDP A;  2B4U A;  3B54 A;  4IRK A;  1X8D A;  4CO1 A;  2RDD A;  1FF2 A;  4A8W A;  4YQW A;  4WYW A;  2V8P A;  2J0Q D;  2B6A B;  2UZA A;  4ID5 A;  2JL9 A;  3DRS A;  1N32 F;  1EZZ B;  1X4G A;  3RB6 A;  2ASJ A;  4A46 A;  1S1W B;  3BO3 A;  3VV2 B;  2AZ3 A;  1RT3 B;  1AB8 A;  3QIP B;  1Q81 T;  5DM6 Q;  2V8D A;  1VMB A;  2EC0 A;  4F4W A;  3PX0 A;  4YR2 A;  4OZ1 A;  1TK8 A;  4YN3 B;  5DQG A;  1SXL A;  2YVS A;  4DV0 J;  1GMV A;  1ZM3 A;  3CUN A;  1EQM A;  4QIV A;  2ERR A;  4O23 A;  1XER A;  1GX6 A;  3ZTQ A;  2XZD B;  2CZ4 A;  3NS6 A;  2Y1L B;  1XEZ A;  3PNI A;  3T6J A;  5GAD U;  4R8U A;  1N33 F;  1KHW A;  1ITP A;  3QJL A;  5KG2 A;  3BB5 A;  3KLF A;  3BYP A;  2EG2 A;  2R7V A;  5THW A;  2OP5 A;  2ZOM A;  2ZD1 B;  4ZK7 M;  2R7X A;  3NGD A;  3Q24 A;  2HGM A;  2PA8 D;  4X4N A;  2BRK A;  4HKQ A;  4D3H A;  4Y2C A;  1HQE A;  4P7V A;  3PFO A;  1NLK L;  2ZJQ Q;  1JLE A;  2NXC A;  1CUL B;  3TZZ A;  3DGP A;  3W3S A;  4LFC F;  3NP5 A;  4HR2 A;  1BXN A;  3M2R B;  2BJD A;  1HWK A;  1PCA A;  1VQO S;  1S99 A;  5C2C A;  2X7I A;  4IOC Q;  3FZB A;  2PEH A;  2YNH A;  4YOE A;  1HR0 F;  1FRH A;  8AT1 B;  1U48 A;  1M1K T;  4ZIW A;  2H4Y B;  1FVS A;  4OZL A;  2VAS A;  1FJG J;  1IKW B;  5KFA A;  2CG4 A;  5L1K A;  2B9E A;  1WOR A;  3MCS A;  3G8T A;  2UVR A;  3JSY A;  2M8D B;  1RGV A;  1QTM A;  1S6P A;  4URS A;  2DGT A;  2FB0 A;  3H40 A;  3KMS A;  1QD1 A;  4JP8 A;  2XI3 A;  4UY8 T;  1XR6 A;  2C3Y A;  1QSS A;  2IAJ A;  2YQ1 A;  4R0E A;  4K0K J;  2HGL A;  3PW4 A;  3MZI A;  1UW4 A;  2KDO A;  3I0S A;  3SV4 A;  2A18 A;  2ZNY A;  2BJ8 A;  3KUH A;  4OHV A;  1R6V A;  3OSN A;  2VUG A;  4DL3 A;  2MGZ B;  2DNR A;  4F4A A;  4C8M A;  2CWX A;  3M9N B;  2VFS A;  3OL7 A;  2FPH X;  3ILI A;  2QGF B;  4WBF A;  4FBU A;  5HRO B;  3N79 A;  3LTO A;  1FRK A;  2MKH A;  3IFE A;  3BKT A;  2BX6 A;  4O0I A;  4FXW A;  5A8K A;  4CLY A;  1ZZF A;  4GO5 X;  3ENW A;  1X60 A;  4O44 B;  3I4P A;  3EVO A;  1NJX A;  3THV A;  3W5Z A;  3TA2 A;  1BHN A;  1T0T V;  1FD2 A;  1HKA A;  3I31 A;  3LP2 A;  3ZZP A;  1H7X A;  1F2G A;  1AT1 B;  4JV5 J;  3CJR A;  4NCA A;  3TAM B;  2QYG A;  2FQQ B;  2B9X A;  5HN0 A;  1F9E B;  1RIS A;  1S49 A;  2MSS A;  2IMO A;  2C2N A;  1A7G E;  2DT9 A;  2M9K A;  4YB1 P;  2BKP A;  2P8I A;  4ES2 A;  4DOZ A;  1UPP A;  1QTN B;  1OQ6 A;  4W98 A;  3MEK A;  1VQ4 S;  5ITH A;  5J2Q B;  3PIP Q;  4DR5 J;  4M5D B;  2PT0 A;  5CAA A;  4FF3 A;  4ELT A;  4F4Y A;  1HBO B;  1SH0 A;  2XWY A;  4DV6 J;  1FXD A;  1S76 D;  1UWB B;  2K1R A;  2ZH2 A;  1BGX T;  5A0Y A;  3M05 A;  5GVQ A;  3DFE A;  1Y3K A;  2WON B;  3TR5 A;  3DI6 A;  4ZPW R;  3LAN A;  2IRU A;  2DIT A;  2VDH A;  4ZCL A;  4JI1 F;  1LWX A;  4LBP A;  1FO1 A;  3H2V E;  4EZ6 A;  2V68 A;  2HUR A;  4NA1 A;  3D9B A;  2NXE A;  4RX6 A;  3T1Y J;  3TRG A;  2RRA A;  3D6F B;  5L46 A;  3TOQ A;  3BSO A;  4UOF A;  1KP6 A;  5HK4 A;  1O8B A;  3M4X A;  2KHD A;  1N88 A;  2HND A;  5J2M A;  2RU3 A;  2YNG B;  3MEC B;  1ICE B;  4AXI A;  1N34 F;  3R8Y A;  4XDD A;  5I3U A;  3GSD A;  4HAC B;  3EVM A;  3C6T A;  1S9G A;  3KDO A;  4K50 A;  1DJ0 A;  4YB5 A;  4Z37 A;  1TKD A;  4CIO A;  3C15 B;  3H42 A;  4WU3 A;  1TL5 A;  2PD1 A;  2YKM B;  3N6M A;  3OTD A;  1SCJ B;  1S7H A;  2VG6 B;  4DQI A;  5ETT A;  4F36 A;  3PG9 A;  5C42 B;  1RCX B;  2XQC A;  5B0A A;  2P9G A;  1AXQ A;  3MMA A;  4ZVH A;  5H9E K;  4KJI A;  3L95 X;  2QO3 A;  4IYQ A;  4Q8F A;  2M88 A;  3W9I A;  4X65 J;  1JIH A;  5F8J A;  4ZS6 A;  3MPU B;  2EI5 A;  1L3V A;  1MWQ A;  3QID A;  4QBU A;  3DM2 B;  1N0V C;  1KNZ A;  1RT2 A;  4FZV A;  3IBW A;  5G0R B;  4P9S A;  2EBG A;  3IC1 A;  4Y65 A;  5LMU F;  4LJM A;  3J81 j;  1M1G A;  3CO9 A;  3M8W A;  2IM1 A;  4F0K A;  2U2F A;  4QWE A;  3HO1 A;  1RHJ B;  1PBA A;  3WBZ A;  1Y5N B;  2QMW A;  4GO7 X;  1X4A A;  2VIH A;  3PCO B;  1B0T A;  2V34 A;  3P3D A;  2ZUA A;  3C14 B;  1VC6 A;  3LGM A;  1N36 F;  1SL1 A;  2YY3 A;  1DFD A;  4FBT A;  1YJN S;  4LRA A;  3C16 A;  2BJ9 A;  1TK0 A;  1ACM B;  1RT6 A;  3OVA A;  1JWW A;  4Q5V A;  1S1T B;  2IVY A;  4Y3C A;  3Q8R B;  3NCQ A;  1T95 A;  4B9T A;  1Q82 T;  3UE2 A;  2VQE J;  2RQC A;  2KL8 A;  2ZH4 A;  1TUG B;  4TU7 A;  1RE1 B;  4U7U K;  3D0H E;  1WEL A;  2VJV A;  3ISZ A;  2AJ0 A;  1U02 A;  3VZI A;  3GU0 A;  3CCV S;  1E6V A;  1XMO F;  3IXQ A;  1SC3 B;  3FEZ A;  4USK A;  1VLY A;  1SQF A;  2RDJ A;  2BW2 A;  2HHS A;  3OVB A;  3W61 A;  5JMN A;  4QWB A;  4OI1 A;  1NSK L;  1UWA A;  2GZO A;  4IOB A;  4Z2X A;  3NY0 A;  4ZHR B;  2J0S D;  3I0R B;  4C8K A;  5F8I A;  3KLG B;  2QL9 B;  2GCF A;  2UXB J;  1DUR A;  4C9D A;  1FK9 B;  1ROF A;  1MWZ A;  2CQG A;  4ED4 A;  1T8E A;  2V8H A;  3FSX A;  4NMX A;  2QV6 A;  2FD2 A;  5F8G A;  2CNL B;  2LA4 A;  2F7V A;  2GVZ A;  3HHL C;  2FJD B;  4RW7 B;  2X1A A;  3D7S B;  4A8X A;  1EP4 A;  1S4E A;  1I94 F;  4OV1 A;  1S79 A;  2JEF A;  5BYQ A;  1T9X A;  1XNR J;  4JV1 A;  1NK8 A;  1FKO A;  2AV5 A;  2OPR A;  3D6H B;  3FCH A;  3L7O A;  2ZBP A;  3CDA A;  5D0G A;  2KTQ A;  5F9L A;  3TUJ C;  1A0O B;  4OX9 J;  3VAM A;  3BH6 B;  2M8H A;  3CJ0 A;  1NSQ A;  5HMX A;  1HQU A;  3SFG A;  2HMI A;  2UUA F;  4WKR A;  2QIF A;  2VBX A;  4EEY A;  3U7J A;  3OSP A;  2U1A A;  2ZZN A;  2EPI A;  3DYA A;  2KI2 A;  2HWH A;  4N47 A;  4Y6I A;  5KFN A;  4AXJ A;  5AE2 A;  1WEY A;  2J6S A;  1KN6 A;  3GON A;  3FGV A;  1RCO B;  2GGP B;  3HMJ G;  2IPO B;  2P6S A;  1EIY B;  2W2M P;  1PYO B;  2KYZ A;  2P9C A;  1T9T A;  2WSF C;  1UAW A;  2W2O P;  5ETR A;  5D4L A;  3KMQ A;  2YXL A;  2BOP A;  4CLZ A;  1LWC A;  2MQP A;  4NLW A;  5T7L A;  4A8F A;  2AKW B;  3KHH A;  4TQR A;  4UZB A;  3NAI A;  1WOO A;  2FHO B;  2ZVS A;  4GC7 A;  2IIH A;  3IS9 A;  3J7Y I;  4ECR A;  3K5N A;  5D4P A;  3M1V A;  2BR0 A;  1TR0 A;  2HVE A;  4HT7 A;  3ONQ A;  3VGS A;  5HVG A;  3EGN A;  1SC1 B;  1U24 A;  2OO4 A;  3I32 A;  3PR4 A;  4TNO A;  3SFU A;  4QU7 A;  1LWE A;  5H9F K;  3L7U A;  4JI3 J;  1CJT B;  1NK6 A;  4QU6 A;  3PTW A;  3HCX A;  3LQV A;  3GP9 A;  3ITH A;  1D8Z A;  4LR9 A;  5E33 A;  4X64 J;  1HYS B;  3EE3 A;  4MMO A;  1IKY B;  1VQM S;  2RNE A;  1C0T B;  4FNI A;  4IDK A;  3T5J A;  4FKX A;  1ZET A;  2XY7 A;  1VRT B;  2E5I A;  2J0W A;  5CH7 B;  3DXB A;  4UT4 A;  2O66 A;  5KFE A;  3AA9 A;  4P6Q A;  1DRZ A;  2UUB J;  4F4X A;  2VPZ B;  2VPY B;  2NLW A;  1WC6 A;  2W2N P;  2MZS A;  5AXL A;  3LWL A;  3E3X A;  4JI2 F;  4DSI A;  2DB1 A;  1HHS A;  1XWL A;  1QDU B;  2HNZ A;  4DDF A;  3RU0 A;  2XUL A;  4Q44 A;  4HH1 A;  5D0E A;  3IG1 B;  5ETN A;  1RYS A;  2EWH A;  5CCM A;  2Y3Y A;  3S8S A;  5BYS A;  1IKX B;  2QA4 S;  4ZA1 A;  2FGC A;  4ZP6 A;  3QZ8 A;  1Y11 A;  1WAC A;  3KG0 A;  2WSE C;  4NLT A;  1FRL A;  3GCW P;  1MRO B;  3ZO7 A;  1KR4 A;  2LXF A;  1TKZ B;  2AZ1 A;  3H5X A;  4I2Q A;  2JVO A;  4DUZ F;  3EXY A;  2MKY A;  3EGW B;  4DX8 H;  1RDR A;  2BKO A;  1V3R A;  2GQQ A;  2KT3 A;  4AFF A;  5LJ3 Y;  1X9S A;  4GMK A;  2QE5 A;  1L3K A;  4EFA C;  5BXI A;  2HFV A;  1RAG B;  2Y8W A;  4DR2 J;  1UKU A;  3UR0 A;  5D77 A;  4DCJ B;  4YR0 A;  2Q3P A;  2X51 A;  4IO1 A;  2ZOF A;  1M5S A;  4DFP A;  2OD6 A;  2AX1 A;  2NUU G;  3Q89 A;  2CVI A;  4TKT A;  2KT5 A;  5HJX A;  3NMA A;  3F56 A;  3G96 A;  3BH7 B;  4UQT A;  1SVD A;  1NKB A;  4WTO B;  5EN1 A;  3BS9 A;  2ACY A;  2VON A;  1F1B B;  3H2L A;  1RB0 A;  2RDI A;  2V6A A;  2R3V A;  1T3N A;  1N48 A;  3QWP A;  2OPS B;  2WVF A;  5F9N A;  2Q66 A;  4NLD A;  1R0A A;  2X1F A;  3MM6 B;  4QIE A;  4NLV A;  1RTI A;  2DD8 S;  2KZZ A;  1TL7 B;  4O4G B;  4TVA B;  3DLK B;  3DRP B;  5DLF A;  1V6H A;  1QE1 B;  5F3T A;  3CCS S;  4CLF A;  3U1N A;  1HI0 P;  2C42 A;  1N56 A;  2WW4 A;  2H3E B;  3UD5 A;  5DG8 A;  3TUI C;  3TI0 A;  3BPS P;  1XIQ A;  4L6V 3;  2QEX S;  1QVG R;  2YKQ A;  1S6Q B;  4PRF A;  2JEJ A;  1ZS6 A;  3BM7 A;  4DSL A;  2KH9 A;  2IBK A;  2OTL S;  2B51 A;  3RBX A;  4Y0F A;  5GAH I;  4U6P A;  2ZKU A;  4KFB B;  2ZHO A;  1JLA A;  2JC0 A;  2MQM A;  1HWU A;  5IQ6 A;  1X0F A;  1RAE B;  1BQX A;  1PJ5 A;  4B3M F;  1ZM4 A;  3I96 A;  3G6V A;  1JLB A;  2IDE A;  2CQ3 A;  1NSA A;  2DRD A;  1LWF A;  1NK4 A;  3IRX A;  3Q8Q B;  1IBL F;  4RW6 B;  3PAC A;  3CD0 A;  3BRE A;  1D09 B;  1Y00 A;  4USU A;  4HT5 A;  4HHH A;  2HS0 A;  3A3N B;  5KFI A;  2F3J A;  3I5C A;  2B5J A;  4HYK A;  1S59 A;  2GC8 A;  1Q5V A;  2WOM B;  1HD0 A;  1SJ4 P;  5HLF A;  1I3O B;  4P73 A;  3TZW A;  1FTR A;  1IQZ A;  4DBQ A;  1S77 D;  2AMC B;  4F3O A;  2YQ0 A;  1JXV A;  3DU6 A;  1MNE A;  4RUH A;  2CAJ A;  1XMB A;  4RBV A;  4C11 A;  2DXE A;  1PSD A;  4NCG A;  2EFG A;  4DR3 J;  3GFZ A;  3IR5 B;  4MK9 A;  2XO6 A;  4ENO A;  1A9N B;  1RAJ A;  5B0F A;  5A8R B;  3RTV A;  1DTQ A;  3HI9 A;  4K8R A;  2CUY A;  5K14 A;  4IFY B;  1IBM J;  1I6J A;  2MLZ A;  2LEP A;  1FKA F;  4DL0 C;  1D1U A;  4DWI A;  4FXD A;  2KG1 A;  1WC4 A;  2XMT A;  1UJ4 A;  5T41 A;  2RQM A;  4IG3 A;  4ZVE A;  1RT1 B;  2DEJ A;  1NXI A;  2CPZ A;  2HBR B;  2IYG A;  3OJS A;  4ZDN A;  2B7C B;  3UN3 A;  3W2V A;  1SH3 A;  3KYL A;  4DR1 F;  4LRD A;  2RRB A;  1JLC A;  2AU0 A;  4HL9 A;  4OYW A;  3GFX A;  2JFD A;  1PYS B;  1H3D A;  1D0E A;  1S9E A;  2HVI A;  2QRR A;  3IBC B;  4G6V B;  1VBZ A;  5DDQ C;  1FD8 A;  4CH0 S;  1OIA A;  2OD4 A;  4LRF A;  2DO4 A;  5KT2 A;  3EZU A;  2YNI A;  4DF8 A;  2A0F B;  1U09 A;  2OJ3 A;  2DGU A;  3GTY X;  4ID5 B;  2MQL A;  3MED A;  5L1I A;  3FVY A;  2GJI A;  3DRS B;  1NHK L;  3K8W A;  1N5V A;  5K20 B;  1QY7 A;  4JI4 J;  3RZA A;  5D6G A;  3EWG A;  2MKS A;  4MTP A;  4X4O A;  1U25 A;  3J7Y U;  4RUA A;  1WG1 A;  2KT2 A;  1QAX A;  1GTH A;  4B3T F;  3HM9 A;  2YTC A;  4RUB A;  2AW0 A;  1FJG F;  4WFN Q;  4IFV A;  3QSY B;  3V6H A;  5LOQ A;  4NLS A;  3RR8 A;  2HVH A;  2W8K A;  2L08 A;  2UV8 A;  2MB0 B;  3R3T A;  4JI6 J;  2J9C A;  3NCR A;  5HAO A;  4Y2M A;  2RSQ A;  3CVK A;  5SZT A;  4R8U B;  2WB1 D;  5L9N A;  2D3O 1;  1FDN A;  3CSK A;  3KLF B;  4ANE A;  4DV2 F;  3TWZ A;  3D2W A;  3K89 A;  2NSB A;  2IA0 A;  3PW0 A;  1M5P C;  2DIU A;  2CRL A;  1RAI B;  2FVR A;  4IH6 A;  1DLO A;  5LT5 A;  2EFQ A;  2HZC A;  1HQE B;  2DGO A;  2MQO A;  1JLE B;  4DXL A;  1N0U A;  3AFG A;  4C8L A;  2RE1 A;  3QGI A;  3T5H A;  1MSW D;  3DGP B;  1MMN A;  1NBE B;  2YKN A;  3UFC X;  5HBM A;  4PG6 A;  4G1Q A;  1VJW A;  3J81 Y;  3AY0 A;  1LFP A;  4QIF A;  4Q45 A;  4ZVU B;  1FRI A;  1JB0 C;  2YNH B;  4JV5 F;  4PXC A;  3CD7 A;  4J9S A;  2F8E X;  1JJC B;  3P6Y C;  2R9L A;  4PQU A;  4NML A;  4WK1 A;  3K7R A;  3A8K A;  1NU4 A;  4LF1 A;  2XBP A;  5DDR C;  4ZOS A;  1FI4 A;  2R42 A;  1G7C B;  4DR5 F;  4RWX A;  2Z30 B;  4R0J A;  3Q0A A;  3CO0 P;  1S6P B;  4DCO B;  4HHU A;  1K0T A;  4XAK A;  1P9Y A;  3FCW A;  4K4S A;  2UVV A;  2IAJ B;  4MKV A;  2HQF A;  2B9W A;  5KFY A;  3HF5 A;  4NX9 A;  2XZW A;  3I0S B;  3OFE A;  2IM0 A;  2OLW A;  2JVR A;  1HI1 A;  3G8S A;  3J7A 1;  3VQT A;  2EW9 A;  4QYZ J;  5KOW A;  1QSY A;  2JH3 A;  1RXO B;  2Y1I A;  4CT9 A;  3T1Y F;  2VKZ G;  1WTF A;  3KWM A;  3HJV A;  2MKK A;  1R8P A;  2DTJ A;  2W8L A;  1FNM A;  2B0G A;  1U0S A;  2UV8 G;  5B0D A;  5A8K B;  2OTJ S;  2AF6 A;  4DR4 J;  3WDO A;  4AQY J;  1RTD A;  4J9O A;  2A3J A;  5F0W A;  5JVG Q;  4CO3 A;  1YVF A;  3LP2 B;  5IC4 B;  4ANC A;  3W62 A;  2XGP A;  1YBU A;  3OHA A;  2DHA A;  4OX7 A;  4PUO A;  3CD5 A;  1X5O A;  4DJB A;  2CQI A;  1F9F A;  2ZBI A;  1HIY A;  3NAH A;  4NRT A;  3M8Z A;  5GAH U;  3BR9 A;  2AX0 A;  4OYP A;  4QQB A;  5A2Q U;  3DRR A;  3GG0 A;  4KGX B;  4B3S J;  3FMB A;  3ZC4 A;  3JS9 A;  4GVB A;  3CE8 A;  4QOT A;  3TUZ C;  1GEH A;  1QAY A;  3MPY A;  2NXU A;  2OSQ A;  1OO0 B;  4DR6 J;  3TUP A;  3CJ4 A;  4B9V A;  2LQB A;  3PKM A;  5KG1 A;  4X65 F;  3FFI A;  5KFF A;  4LFC J;  1K9M T;  2QZ8 A;  2K1R B;  4I56 A;  3FNN A;  2EC2 A;  9ATC B;  4J91 A;  5A0Y B;  1TEL A;  1VIS A;  2J7W A;  3DI6 B;  4L3K A;  3M8Y A;  2NCK L;  4TU9 A;  1BD6 A;  2J9D A;  2KRR A;  2V50 A;  3W7B A;  2HS3 A;  1EET A;  4FDF A;  2CNO B;  1NHU A;  2MHE A;  4QW9 A;  2XGQ A;  3M30 A;  3MR6 A;  1GMW A;  3I5B A;  1TKX B;  2FHK A;  2H5E A;  1LQ9 A;  2H1Y A;  2DNZ A;  2YKO A;  7FD1 A;  2CIM A;  2WVE A;  1VRQ C;  3MUR P;  4NLR A;  2WSC C;  2HND B;  3UCU P;  3HPO A;  3IWL A;  5J2M B;  2N3L A;  3JTO A;  2PI4 A;  2RHS B;  1SIZ A;  1RHU B;  3TAP A;  3TA1 A;  1T05 B;  2AYE A;  4LFB J;  5I3U B;  2DH8 A;  3C6T B;  1S9G B;  4CH1 A;  2ZBR A;  4OL8 A;  5IZH A;  2VQE F;  4C0H A;  5K9F A;  5J1E A;  3BSN A;  2MHN A;  4CLP A;  1K1Q A;  2J7K A;  1YJ9 S;  4U8Y A;  5E3C A;  3OV7 A;  3A13 A;  4P71 A;  2I9S A;  1GMW D;  1Q95 G;  2R8I A;  2OFH X;  3MF5 A;  3AJ2 A;  1HLW A;  2C3M A;  4MH8 A;  4ZP9 A;  3T3F A;  3JAM Y;  3MMA B;  3TQE A;  3B78 A;  3CJ5 A;  1CJK A;  2AGQ A;  2XWX A;  1HA1 A;  2CQD A;  2O5D A;  1RU2 A;  3N4W A;  2UXB F;  1R27 B;  4MYT A;  1HPZ A;  1NPR A;  4ERD A;  3GB0 A;  3IN5 A;  1RT2 B;  2DGW A;  3UPF A;  1U1O A;  3AHP A;  4NE9 C;  1H0H B;  4D3G A;  2RU9 A;  2KXF A;  1C1B B;  1H74 A;  3CC4 S;  2QSF A;  1IM4 A;  2MY8 A;  4QWC A;  2RVJ A;  2BOA A;  2MLX A;  1DHM A;  3ZNJ 1;  2CQ1 A;  4N7T A;  1LNQ A;  2GMH A;  1QAI A;  1HNZ J;  2Z0G A;  1XNR F;  4EMD A;  4CLL A;  2DNL A;  1FFS B;  1YJT A;  4NWB A;  1VQ7 S;  1MU2 A;  5KG3 A;  1HBU A;  1P1L A;  2C1E B;  1ARO P;  3C16 B;  1XQI A;  5ETQ A;  2PN6 A;  2ZJP Q;  3BJY A;  3R2D J;  1RT6 B;  4OX9 F;  5L9X A;  2L9N A;  3CGI A;  3PJX A;  2FJA B;  1DY3 A;  5FDL A;  3EPI A;  2XSF A;  1RK8 A;  2PDA A;  1HD1 A;  2QLB B;  3AH6 A;  1WC3 A;  2WCX A;  3B4M A;  2I1R A;  3TYT A;  1FRM A;  1NSP A;  1E6V B;  1PIL A;  4ES1 A;  1RLD A;  4DSE A;  3R97 A;  5KOX A;  1GK8 A;  2PMZ D;  5IT9 U;  2HK3 A;  2E1A A;  3TJ9 A;  1S1U A;  2E66 A;  2IRX A;  4I64 A;  2VC0 A;  4X4Q A;  2BKN A;  3BSA A;  1JLQ A;  4NLU A;  1NEE A;  4JUZ A;  1P6T A;  3QO9 A;  4JV2 A;  2RIJ A;  4ZN3 A;  3D1O A;  2HAF A;  2N7C A;  3LH2 S;  1TL1 A;  4P2S A;  4JV0 A;  1REV A;  2AJ1 A;  4I2P A;  3G6E S;  4UST A;  1C0U A;  4PXB A;  1NZ8 A;  1ULR A;  2FLP A;  5ETP A;  4M1K A;  4XPC A;  3NRB A;  3M8R A;  3LA0 A;  5LMN J;  1S1X A;  2VL1 A;  3OTO J;  4C8Y A;  1VK3 A;  3T6B A;  2OPR B;  3MCN A;  2R8G A;  1WC1 A;  2M5Y A;  1IXK A;  1RTJ A;  3U27 A;  1RWU A;  3B8H A;  4KGK A;  1BUX A;  2V94 A;  3G87 A;  2M0G B;  1V3S A;  3MMB A;  2UUB F;  2XY6 A;  3TZX A;  2DKO B;  3ZZY A;  3PKY A;  3R1L A;  2XI2 A;  1HQU B;  1KBR A;  2HMI B;  1Q7L B;  5C2G A;  4RU9 A;  4URG A;  3R5A A;  5EWF A;  4DN0 A;  3CJ2 A;  3DYA B;  3CWJ A;  5LMU J;  2D74 B;  2XMV A;  2HRT A;  2GML A;  2CZ9 A;  4OHY A;  3G82 A;  1UTA A;  1LOU A;  1RQ0 A;  1XR7 A;  4EK2 A;  1JKH A;  1P9Q C;  2GVD A;  4KV8 A;  1WKJ A;  1J2V A;  1RAF B;  4RZR A;  5KFP A;  3GJT B;  3ZZR A;  4J5O A;  1LWC B;  3QBC A;  4Y2A A;  1TL4 A;  2J6T A;  5T7L B;  3QYY A;  3QFH A;  4RW8 A;  1T03 A;  2JNJ A;  4LF6 J;  5CYQ A;  2GNK A;  3WQP A;  1RBL A;  4HTJ A;  3IS9 B;  3RRH A;  1AYE A;  3FQL A;  1SC6 A;  3M1V B;  4UOH A;  2RF2 A;  4CH7 A;  3NWG A;  1GFW B;  2QMU B;  3RAX A;  3ILL A;  2XMM A;  2CPF A;  5KFV A;  2G1H A;  1H2U X;  1NDP A;  1LWE B;  1RTZ A;  1HWI A;  1KWM A;  4DR2 F;  1RHR B;  3MPW A;  4P2X A;  1ZTW A;  4LIW A;  1IVZ A;  4LF4 F;  3ITH B;  1IJE B;  2CNK B;  2VA3 A;  4B02 A;  4IDK B;  4A8M P;  2JEG A;  4X4S A;  3KJV A;  1SUQ B;  5IM0 A;  5EDW A;  3MAA A;  4DL4 A;  4ZPC A;  2GMJ A;  1U1P A;  2HZV A;  3MPV A;  3H90 A;  2FDN A;  4KPC A;  2EEY A;  1WOS A;  4Q43 A;  1TU0 B;  3LP1 A;  3QFW A;  2CVE A;  2HNZ B;  2CJK A;  3LPE A;  2VFU A;  2ZH7 A;  4DQR A;  1TL3 A;  2Q6B A;  2L3M A;  2XTJ P;  3M8S A;  4QW8 A;  1PC4 A;  3UN2 A;  3SDE A;  4I7F A;  2CJY B;  4PYD A;  2B4O A;  3R5B A;  3OFH A;  1I94 J;  1YJU A;  2HK2 A;  3WC0 A;  3VAL A;  5BYR A;  2CPX A;  4K4Z A;  1UA1 A;  3ZXW A;  5D8H B;  4NLQ A;  2VH7 A;  3LP0 A;  1HAR A;  3QAU A;  3N0V A;  2HHH F;  2FVP A;  3S7R A;  4CLK A;  3G71 S;  2ZH1 A;  4E0D A;  2DHX A;  1URN A;  1WSR A;  1WHV A;  2Y1R I;  4WXO A;  2W9B B;  2RHQ B;  5EWG A;  4O4R A;  3TNV A;  1JK9 B;  5H9E J;  3BQ0 A;  2F4F A;  4KGM A;  2POK A;  2FJV A;  3MPD A;  2E5L J;  3RB0 A;  1NUE A;  2FHM A;  4LVN P;  3FSI A;  1TMM A;  3DHW C;  1AZS A;  4B3O A;  3BBF A;  4ZIV A;  1J5O A;  2HBQ B;  1GH8 A;  1S48 A;  1WI6 A;  2OAU A;  1FFG B;  4ECW A;  4WKY A;  3SSS A;  2VOO A;  2H54 B;  4I4B A;  2Y9H A;  4KHP J;  4PYA A;  2JDJ A;  3IM9 A;  4PWD A;  1NDC A;  1JLG A;  2N82 B;  5HVF A;  3UD3 P;  4CNY A;  4DPX A;  1QSL A;  3DLL Q;  3OJU A;  1R0A B;  2C3P A;  4DUY F;  1HMV A;  4A8O A;  1YHQ S;  3IO1 A;  2GHP A;  2CQ0 A;  1RTI B;  3CCZ A;  4KE5 A;  4A48 A;  3I56 S;  4TLR A;  3V6J A;  3ULH A;  3MFH A;  4J9N A;  1VK8 A;  1DZ5 A;  2UXD J;  5KFU A;  3PW7 A;  1ZA2 B;  2BA9 A;  2LQ8 A;  3GIJ A;  2GHW A;  2BM0 A;  5C5J A;  1IBM F;  1KDN A;  2LU2 A;  3QQC D;  4KH0 B;  1MG7 A;  2KVI A;  1K73 T;  3LF0 A;  4AE5 A;  4H4K C;  4QIW D;  5HAT A;  3DHX A;  4ZJQ A;  5C25 A;  3PRV A;  3PIO Q;  2BAB A;  4USI A;  4DU7 A;  4P7T A;  4NZ7 A;  3UNY A;  4EZ9 A;  1WHW A;  5C7P A;  4JI2 J;  3CME S;  2XS5 A;  1RAB B;  3H5Y A;  3RGI A;  3CTR A;  2I8E A;  2D3Z A;  2C2O B;  2FVQ A;  1FEE A;  1UVJ A;  1JLB B;  4OJH A;  4IUF A;  4I1T A;  1LWF B;  3G6X A;  3MGJ A;  1NH8 A;  3IRX B;  3KHL A;  3DCA A;  3GSI A;  2ADC A;  5KG5 A;  2UVW A;  4J9M A;  3F41 A;  4OLP A;  1T9W A;  4CO4 A;  1Y5L B;  3GIR A;  2B5J B;  1RT3 A;  4B17 A;  1X4E A;  1BQN A;  1JJ4 A;  5I4M A;  3AJ1 A;  1FNX H;  4NEY A;  4H4K A;  4C8Z A;  5HLF B;  2HIQ A;  1TAQ A;  1S0M A;  1X31 C;  2V69 A;  3OTE A;  3DDI A;  2MKJ A;  1GXU A;  1HBN B;  5A6W A;  1WG5 A;  5HI7 A;  4ZMM A;  3CCE S;  4C11 B;  1UFW A;  4ZPB A;  4NCG B;  4RNF A;  4WII A;  3KKF A;  1F9H A;  3HVR A;  3L4B C;  4MIA A;  4K2J A;  3OHB A;  1W7W A;  3R6L B;  2AYM A;  1T94 A;  1DTQ B;  5J2P A;  3SCK E;  2F4V F;  2GFF A;  2CG8 A;  1NME B;  1EJ7 L;  2D1C A;  4JI7 F;  4JI6 F;  4WXW A;  2CYY A;  3EZO A;  2XY5 A;  3HVA A;  3MEE A;  4P72 A;  2UUC J;  1R89 A;  2V2Z A;  3TJ8 A;  1EB0 A;  2LEC A;  4E8U A;  1R3N A;  4IG3 B;  3KLV A;  3BF4 A;  2W25 A;  3BDE A;  2YX7 A;  2ZBQ A;  4WFX A;  2XLI A;  3I5A A;  2OML A;  2A2C A;  3CED A;  4LQ9 A;  3W2V B;  2MXY A;  1F2H A;  1T9Y A;  3QWU A;  2N4D A;  3DDN A;  1JLC B;  3VTI A;  5IT9 Y;  1UEU A;  2MZQ A;  1M1H A;  1ZM9 A;  3HX9 A;  1KTQ A;  5D0R A;  2X3G A;  1M5V C;  2YWW A;  3KJQ B;  3ET6 A;  3RB4 A;  2QL5 B;  2YNI B;  5DS7 A;  4ED8 A;  4ILR A;  5H9F J;  1WHY A;  2HPU A;  3NNA A;  2ZH5 A;  3MED B;  1P8G A;  4PZV A;  1TUW A;  1N5Q A;  2YX1 A;  1Z2L A;  2G0J A;  3W8G A;  3CNQ P;  2DY9 A;  3HD2 A;  3OTB A;  3Q2S C;  1ZM2 A;  1KC8 T;  2BYC A;  1WDT A;  2B56 A;  5KFM A;  4AL7 A;  3D0I E;  3C6U A;  3CUL A;  2CWK A;  1RLC L;  1VC5 A;  3J80 U;  4WK3 A;  4AL5 A;  5E3A A;  3H25 A;  4N8O A;  4DR7 J;  1RT5 A;  1R0C B;  3BGL A;  4TYB A;  4EI2 A;  2PII A;  5T14 A;  4CNZ A;  1IBL J;  4EYH B;  4FVC A;  5F8M A;  2HFZ A;  1AFJ A;  2HHU A;  4JOU A;  4DPT A;  3ISN C;  3SCJ E;  2E44 A;  2JZ5 A;  4OJG A;  1VHF A;  2FTR A;  2XZT B;  5KFZ A;  5CXT A;  4J9V A;  5L38 A;  1KTV A;  1SV5 A;  3D3B J;  1TVR A;  4I6A A;  3AD9 C;  2JLE A;  1WTB A;  2JRS A;  4OYB A;  2QTW A;  3VWS A;  3KK3 A;  2I5J A;  2RT3 A;  4B9S A;  3IMQ J;  4ZLN A;  4AL6 A;  3HKZ D;  3DLH A;  1FKP A;  3LW5 C;  4OI6 A;  3HT3 A;  1DLO B;  2HYI B;  1RAH B;  1UA0 A;  4ECY A;  1N6Q A;  5LJ5 Y;  4K59 A;  3QJP A;  2FC8 A;  4MT1 A;  2BE2 A;  3DOK A;  4QWA A;  1NJW A;  3CC7 S;  2YKN B;  2QL7 B;  4NZ0 A;  2C28 A;  4BWM A;  2K06 A;  5HBM B;  4OMF G;  4DR4 F;  3J7A N;  4FS2 A;  4AQY F;  3OVS A;  4G1Q B;  3BEG B;  1I51 B;  4CO5 A;  4V19 X;  1WC5 A;  5F41 A;  4MJK A;  2ILZ A;  1RSC A;  2D9O A;  4ECT A;  3K57 A;  4RWW A;  1DAR A;  1S5Z A;  3BQ2 A;  2HAI A;  4FPR A;  4PQU B;  4H4M A;  2UU9 J;  3BR8 A;  2CDQ A;  3Q8V A;  1UMJ A;  1IR1 A;  4GRS A;  2WRM A;  1YSJ A;  4DR1 J;  3QT5 A;  4YHH J;  4ZVO B;  3OL8 A;  3R5C A;  4P10 A;  4B3S F;  4BHQ A;  2FLO A;  4ILL A;  2R7S A;  3TAQ A;  2C2K B;  1YI2 S;  1V9O A;  1OS5 A;  4DR6 F;  3PV8 A;  1YJR A;  2RKI A;  4XDC A;  2VG5 A;  5KFD A;  2ZUG A;  3TVY A;  2ZH3 A;  4PWU A;  5KG0 A;  2D3U A;  5LM7 E;  1EKS A;  3IA0 A;  1IN0 A;  1X0P A;  4OHW A;  1OPI A;  3VVU A;  1JJH A;  3FQK A;  4IKA A;  1LEO A;  5DGB A;  1HQ2 A;  4J9U E;  2XYP B;  1FDA A;  4B3T J;  2HLT A;  2QFJ A;  2V2Q A;  3OT9 A;  3DOL B;  3M9M B;  2EVZ A;  4IRD A;  2L41 A;  1ZAV A;  2AGP A;  3RG6 A;  3MD3 A;  8RUC A;  2IA6 A;  2H65 B;  1U1Q A;  4URQ U;  2RAQ A;  2AGO A;  4LFB F;  1RTD B;  3ETM A;  3R7S B;  2CPE A;  4B08 A;  1X5S A;  3EIC A;  4NAS A;  1WHX A;  2VG6 A;  1B0P A;  2PO4 A;  1WKL A;  2AYB A;  1H98 A;  1B7Y B;  2QN6 B;  4G1I A;  2F8H A;  2ZOG A;  3QLH A;  4PUO B;  4DV2 J;  1NJZ A;  3Q22 A;  3BZQ A;  4NPO A;  4OZ5 A;  3M2U A;  4FYX B;  2OH2 A;  3HSG A;  2W4P A;  2DVI A;  4FN5 A;  1JNR B;  2OIH A;  1UVM A;  1GMU A;  3DRR B;  3QGP A;  1U1N A;  2MY7 A;  4KY3 A;  1LFW A;  1WG4 A;  3FEX B;  2V8V A;  4GVB B;  5DET A;  1KQS R;  2HHW A;  2BAN A;  2CA9 A;  3DLB A;  2ROP A;  4X4T A;  3N28 A;  3BDP A;  3JXO A;  1PC5 A;  1KQF B;  5GAG I;  3FFI B;  4CTA B;  2BM1 A;  5DM7 Q;  3Q86 A;  4O0N A;  2KZM A;  4ER8 A;  3NMR A;  4KYZ A;  4ZVT B;  4C0O C;  3G4S S;  1FNO A;  3OTC A;  3JTP A;  2FUG 9;  1EET B;  1K1S A;  3BO2 A;  2W01 A;  3M30 B;  2AHO B;  3DOM A;  1VFJ A;  4F0M A;  2VKR A;  4M8L A;  4ED1 A;  4QR2 A;  1OWX A;  3DLE A;  3MMC A;  1HNZ F;  4N76 A;  4GVL A;  1WJ9 A;  1KON A;  2WBR A;  2ZDO A;  4M63 A;  2DY1 A;  4TY8 B;  4J37 A;  3PO4 A;  3KLE A;  1S0N A;  3PRB A;  3W8P A;  4Q8E A;  1KVK A;  4UTG A;  3TVZ A;  2PGC A;  4ECV A;  4P2F A;  5FII A;  1WF1 A;  2X1G A;  2F63 A;  5J1E B;  1RT4 A;  1Y5I B;  3GFY A;  5BR8 J;  5KG4 A;  4OV6 A;  5D78 A;  4F4Z A;  3PVX A;  1VBX A;  2VZ9 A;  1UEK A;  1YIJ S;  3MD1 A;  2K8G A;  5AJ3 J;  4ICL B;  1NH7 A;  1LXJ A;  2CPY A;  4ECU A;  3KLG A;  4EU0 A;  1Q53 A;  4QZV B;  5HMZ A;  2H4W B;  3D1Q A;  1FXR A;  4KPY A;  2OMO A;  3MR3 A;  4DG1 A;  3ZNU A;  1CJK B;  2DRA A;  2J76 E;  1FFW B;  2GS8 A;  3OFF A;  1NHV A;  5U47 A;  3RB3 A;  5HL7 Q;  1Q86 T;  1HPZ B;  4F3Q A;  3BV8 A;  3BN4 A;  4IO9 Q;  1YRT A;  3OW2 R;  4CLT A;  3CF5 Q;  2HFS A;  2F9D A;  1M5O C;  5B08 A;  3GYG A;  3GE9 A;  2JSX A;  4H4O A;  2D9P A;  3QT8 A;  3DC2 A;  3O8W A;  1P27 B;  2APO A;  4L72 B;  3IAS 9;  3A3O B;  2DGV A;  1HNI A;  4ZVP B;  3I6P A;  2FY8 A;  1VGY A;  1SKR A;  2GA7 A;  4B3R F;  2D7S A;  4F02 A;  3O1L A;  1S7I A;  1PIE A;  4M5L A;  5LMN F;  3EX7 B;  2VPW B;  3OTO F;  3CDW A;  2WHO A;  3UWT A;  1MU2 B;  2GQC A;  2P2C B;  4RW4 A;  2VOP A;  1HBU B;  2AYG A;  2FJE B;  4U7C A;  3CCR S;  3A12 A;  3P45 B;  4LQ3 A;  4Y34 A;  1TV6 A;  4LRE A;  2IMW P;  1UVL A;  3VVT A;  4KQZ A;  5JUM A;  4CRJ A;  3MMJ A;  3Q23 A;  5FDL B;  5DQI A;  1A6L A;  3T1A A;  3LOU A;  1D9F A;  1JX4 A;  3FBE A;  2G13 A;  1O51 A;  3AQP A;  1QVF R;  1WSV A;  1U45 A;  4JB8 B;  4JYA J;  3IGN A;  1NK7 A;  4N56 A;  2N7Y A;  2RRN A;  4MKY A;  4KIA A;  3BKU A;  1G4C A;  4QJV A;  2L48 A;  4I6Y A;  1CLF A;  3NGU A;  1FWL A;  2C2R A;  3MHY A;  3SYZ A;  2JOQ A;  1S1U B;  4YS2 A;  1N5Y A;  2DBB A;  2B9Y A;  2DGQ A;  2QX0 A;  2PEB A;  3EUN A;  3VGV A;  3V6D A;  1Q16 B;  4LF7 J;  2C2E A;  2MZT A;  1JLQ B;  4N8N A;  4LF6 F;  1YLX A;  3QO9 B;  1N5S A;  2DNM A;  4RPF A;  2MTL A;  2VOD A;  2CPI A;  1HHQ A;  2E5G A;  1TL1 B;  2F8M A;  3BBC A;  3FUY A;  3Q8S B;  4B9N A;  3W65 A;  1G2E A;  1REV B;  2GQ2 A;  2XMA A;  1X4H A;  4I2P B;  3RAM A;  2XHC A;  2V9W A;  1RWP B;  1C0U B;  3RR7 A;  3OR2 A;  3D6M B;  4C0B A;  2MZ1 A;  1NRK A;  3E01 A;  1F0X A;  3HZG A;  3R5J B;  3M8Q B;  3R2C J;  5MLC V;  2B8Q A;  2XS7 A;  1S1X B;  1D3W A;  2AQ4 A;  2MZJ A;  1YK9 A;  2OEK A;  2O1P A;  3D5M A;  4FYY B;  3HD1 A;  3KLI A;  1RTJ B;  5KG6 A;  1J5E F;  5D4N A;  4HLB A;  3OFG A;  4EO8 A;  3MMB B;  1KVJ A;  3FZ2 A;  3PO5 A;  2UP1 A;  1PJ7 A;  4OYM A;  2DCU B;  3DN9 A;  4NZ6 A;  2IJF A;  3R7N B;  3CJK A;  2LMI A;  2N3O A;  2Y8Y A;  4NCB A;  3FRZ A;  1FTC A;  3FEY B;  5KTQ A;  4ED7 A;  4CO0 A;  4ZN1 A;  3CC2 S;  2DGX A;  4F26 A;  1ZOT A;  1Q8I A;  1D9A A;  2KJW A;  2CQB A;  3GYN A;  4DPW A;  1XNQ J;  1KHV A;  1R31 A;  2YKA A;  3JSM A;  3H5U A;  2XCA A;  5IFM A;  4ZPT R;  4U96 A;  3G82 B;  1VQP S;  2MQN A;  3RUB L;  5DJB A;  1I1G A;  2NYH A;  1MRO A;  1BWV A;  4RLE A;  4IR1 A;  1TKZ A;  4QWD A;  3G6Y A;  1HHT P;  1LK5 A;  1JKH B;  4ES3 A;  2KB2 A;  2GVD B;  4KV8 B;  3IR6 B;  1S0V A;  3MR7 A;  3ZTO A;  3TAR A;  1HNW J;  1TKT A;  1IR0 A;  1YIT S;  3R5D A;  5KT3 A;  1RAO A;  3I4H X;  5DZ7 A;  4DQS A;  4RW8 B;  1W25 A;  1T03 B;  4W4M A;  5CYQ B;  2XLJ A;  1CJV A;  3NNC A;  3KK1 A;  4OHZ A;  1P1T A;  1CEZ A;  5F8L A;  4Q7A A;  4RW9 A;  2RF2 B;  5CA5 A;  4FF1 A;  1UZD A;  2Y0S D;  2EK6 A;  1HFE L;  1C1C A;  2CDR B;  4M95 A;  4MFB A;  2E5L F;  3PW2 A;  1WEZ A;  2EFV A;  1EAY C;  4AT1 B;  1IKV A;  1GQE A;  3MTK A;  3HHL A;  2FZC B;  3H20 A;  4C3M A;  1YX2 A;  1RAD B;  1B3T A;  3SSR A;  3KJV B;  2DIV A;  4DV7 J;  2OI2 A;  4RNM A;  1LW0 A;  1NJY A;  3EGV A;  5IM0 B;  2KXN B;  5SUH A;  2PFD A;  1RHQ B;  3MAA B;  4KHP F;  4LF9 F;  1HNX J;  1F3V A;  4JI0 F;  1DQA A;  4C4W A;  3ZZZ A;  1RHM B;  5E41 A;  4ELU A;  4OZN A;  3LP1 B;  3DRP A;  5GAG U;  5LL6 d;  2ZH6 A;  5GAE I;  1YQH A;  3I87 A;  2W9C A;  1TL3 B;  5IV3 A;  4DV1 J;  3CCU S;  2LQ5 A;  3AB2 B;  1X5P A;  5ETM A;  3SDE B;  2XS2 A;  4I7F B;  4X66 J;  1FJ7 A;  5DG9 A;  2ADB A;  2UXD F;  5JXS A;  3QGG A;  3HHL D;  2C22 A;  1SKW A;  2IJN A;  2V2V A;  1SL0 A;  4LF5 J;  2QSW A;  3LP0 B;  4PPD A;  3K5O A;  4DX5 A;  1NO8 A;  4V19 J;  4O3Q A;  4KFB A;  4K4T A;  1WI8 A;  4L76 A;  2JFK A;  1O5J A;  2FJX A;  1R8C A;  5DDP C;  3MM7 A;  2LYV A;  3V81 A;  2IFX A;  3HHN B;  3CJQ A;  4CQ1 A;  3S6E A;  5L1L A;  2UUT A;  1S1V A;  4ZIT A;  4DV4 F;  2HFO A;  5JJB A;  3NGK A;  4B3O B;  3BGR B;  1J5O B;  1H6K X;  4C98 A;  4X62 J;  1RWK B;  4PXE A;  3L09 A;  1VQL S;  3M6U A;  4DFJ A;  2XB2 D;  3CDB A;  1ZAX A;  4PEO A;  5LSO A;  1RTH A;  4I67 A;  5B0C A;  4DV3 J;  3FSY A;  5EX3 A;  4RR5 A;  3TVK A;  2R7U A;  1D9D A;  3CT9 A;  3AJD A;  1AA1 B;  3MAH A;  1I5O B;  1KLN A;  4PWD B;  1JLG B;  1TP7 A;  3M6W A;  4LT6 A;  1O0P A;  3D4J A;  4ED0 A;  1Y0H A;  2OGU A;  3M7V A;  5CD4 A;  1H2V Z;  3NLC A;  1HMV B;  4W90 B;  5A8R A;  2OEL A;  2ZHA A;  4IFY A;  2V67 A;  2AJ4 A;  4KSE B;  4OYO A;  2XYH B;  4MIW A;  1ZPV A;  4OIX A;  3BGU A;  4LSN B;  5KFQ A;  3PX4 A;  4FVM A;  4LF4 J;  3V2U C;  3K5M A;  4YME A;  2ROE A;  1RA7 A;  3BKF A;  3UDV A;  1D8Y A;  1T9U A;  3W1Y C;  2BVZ A;  1S4F A;  2DH7 A;  4DX6 A;  4DPY A;  2UXC F;  3DU5 A;  3B4D A;  3BQ1 A;  5C25 B;  4PG4 A;  2M4M A;  2BRL A;  2ZE2 A;  4RO0 A;  2UUC F;  5J1N A;  4I0W A;  2ATC B;  3PJ9 A;  4NEZ A;  3DMJ A;  2W2P P;  4J7C A;  4NI2 A;  4NA3 A;  2XLK A;  3EM1 A;  3SIP B;  3OBI A;  1B99 A;  1MN9 A;  5LSR A;  4EBE A;  3OUY A;  4OFZ A;  4KO0 A;  1UZH A;  2C3O A;  2HQI A;  6FDR A;  1HI8 A;  2Q6C A;  2ABY A;  2GO8 A;  1R8B A;  3ILJ A;  3GIK A;  4DZD A;  2FHJ A;  4OYX A;  2GX8 A;  5K8M A;  3HJF A;  1M5H A;  3BGF A;  4QYR A;  4LIR A;  2HW3 A;  3X1L B;  2PI5 A;  4Q2L A;  4Q0B A;  4V1A k;  1VYA A;  4C7Q A;  3DRY A;  4ZJL A;  2HHH J;  2QA2 A;  5RUB A;  3NXZ A;  1BE4 A;  1BQN B;  2IHR 1;  3VQS A;  3LO3 A;  4EBC A;  4OLO A;  3A8E A;  2EK1 A;  1VOM A;  1WUU A;  2R7T A;  3Q8P B;  1ZYQ A;  5E3Q A;  3GR1 A;  4C3K A;  5K8P A;  5EUH A;  1N4L A;  1J27 A;  2OPP A;  1MWY A;  3GWC A;  3SSQ A;  3NNH A;  1EQ0 A;  3RW7 A;  2Z2L A;  4KT0 C;  3RBE A;  4DR7 F;  3OR1 B;  4GKK J;  3K2Y A;  2BQU A;  2FHJ D;  3L3C A;  4CYU A;  5J2P B;  2PC6 A;  2RQ4 A;  3H0P A;  4F67 A;  3UCZ P;  1FWK A;  2W7A A;  2ZZM A;  1FJE B;  4ZPD A;  1HL6 A;  3QPI A;  1KOH A;  3MEE B;  1NM2 A;  2VG7 A;  3U1L A;  5HAN A;  2DNY A;  2MDA A;  1W26 A;  3FKB A;  4J9R A;  2ALZ A;  3LGH A;  4J90 A;  3ENA A;  4DUY J;  2CQC A;  4KKO A;  3QJJ A;  5ETS A;  2ZDP A;  5E5N A;  1KLM A;  2BEF A;  2MKC A;  3KOA A;  1YBT A;  3RBD A;  5HQL A;  3ELH A;  2MEW A;  2ZIT A;  2MJU A;  1C4A A;  3ET6 B;  2DHS A;  1X4F A;  3N01 A;  1N54 B;  1NPK A;  2XO7 A;  4KH1 B;  1KEK A;  2NSC A;  4L74 A;  2D69 A;  2N4C A;  1SC4 B;  3SBM A;  5AT1 B;  1RAA B;  4F8R A;  3M32 B;  4OX6 A;  4OZ3 A;  3KXD A;  1Y3J A;  2I6W A;  5HMY A;  4AD6 A;  2F5G A;  3OXG A;  4RU2 A;  4N77 A;  5ETO A;  2WB4 A;  3TZY A;  3MXH P;  3NGS A;  4ZCI A;  1TUV A;  2HKE A;  4M5H A;  2O3D A;  1RT7 A;  2Z57 B;  3HSZ A;  1NDL A;  2HNY A;  2UU9 F;  2E29 A;  1RBA A;  3C6U B;  2V4J A;  4OI4 A;  4YHH F;  4UOC A;  2KFY A;  3SV3 A;  1RT5 B;  3U02 A;  3PR5 B;  1CG2 A;  2LLZ A;  2Q43 A;  4EWT A;  2DNK A;  1RJJ A;  1XMQ J;  1DQ8 A;  1Y7P A;  1ZA1 B;  4PCQ A;  1YZ7 A;  1X9M A;  4FYV B;  4DMZ A;  4C2M A;  3FK4 A;  1SKS A;  5KFW A;  3HHK A;  3NGT A;  2DNN A;  4FF4 A;  3A4T A;  1SV5 B;  1FXL A;  1NKC A;  3WIU A;  1RU1 A;  2Q1L A;  1TVR B;  3AAW B;  3US5 A;  3UO0 A;  2RH3 A;  2ZNZ A;  3KK3 B;  1LV5 A;  2I5J B;  1K0V A;  3MWB A;  3AD7 C;  2XHW A;  2KFN A;  4TYA A;  3TA0 A;  3I9Z A;  4DS4 A;  1XK8 A;  3VCD A;  4C8N A;  1FKP B;  2R2U A;  2VA2 A;  4DL2 A;  1N6Q B;  2KM8 B;  5GAE U;  2HGN A;  2DNG A;  3D68 A;  1H7W A;  4PAA A;  2BE2 B;  4DZ6 A;  3V4I A;  4DSK A;  3DOK B;  3VZH A;  3P49 B;  2V8G A;  2F4V J;  3K59 A;  2OFG X;  3SQO P;  3SMZ A;  4JI7 J;  3EDQ B;  2J0X A;  5KFC A;  3MM9 A;  2ZM6 J;  1XN9 A;  1OYE A;  2BV3 A;  2A6M A;  5CZV A;  4KB7 A;  4YUD A;  5B0E A;  3P5T L;  4H4M B;  3SQG A;  4HHJ A;  4CLU A;  2KXH A;  4WFY A;  2QLJ B;  7FDR A;  1IJF B;  2VHG A;  1HWL A;  4CO2 A;  4DCP B;  2D3O R;  2KVQ E;  4NLO A;  2YQ3 A;  2WVD A;  2XNR A;  2NR0 A;  3C2P A;  2G0C A;  1FHT A;  1Q78 A;  7AT1 B;  1SIW B;  1GTE A;  4OI0 A;  4XTT A;  2IBO A;  3NCP A;  4UW2 A;  2RKI B;  1MMD A;  2VG5 B;  1Q0N A;  3EMT A;  2JC1 A;  5GME A;  2FYX A;  2FGO A;  1OSD A;  1B64 A;  3C3L A;  4PPZ A;  2Q79 A;  3NBP A;  1HW9 A;  3BBB A;  3ILO A;  2DRB A;  5M2U A;  1TKX A;  2I0X A;  2W4D A;  3CIM A;  5HMW A;  1F3F A;  2OEM A;  4WFB Q;  5J2N A;  2ASL A;  4L73 A;  3NWR A;  3X3U A;  4NXM J;  3I82 A;  3AOB A;  2XYG B;  1U2C A;  1T05 A;  4USW A;  3A8I A;  4JI8 J;  1U2F A;  2ATL A;  1U0H A;  3M8P A;  3M2V A;  2BW7 A;  1Z4U A;  4UUW A;  2Z2Y B;  4O3S A;  1L3T A;  2IC3 A;  1HNV A;  2FZK B;  2OSR A;  2X3D A;  4K5R A;  3L9Z A;  3H8Y A;  2O67 A;  4P2M A;  3G2X A;  4IG0 A;  3QLH B;  5BR8 F;  2HHX A;  3POT A;  5F8N A;  3D0G E;  1ELO A;  2KHC A;  2W24 A;  3M2U B;  4A47 A;  2AEJ A;  1BQM A;  2CZV C;  2YWE A;  4ZJO A;  1MW7 A;  5E3R A;  2NYI A;  4GC6 A;  4DQP A;  5AJ3 F;  2M70 A;  4MAK A;  3EVW A;  2VFV A;  1S0O A;  2ZWP A;  5JVH Q;  2QT7 A;  3SCI E;  4G3I A;  4USV A;  4WTY A;  3HLU A;  2BAN B;  3MCO A;  3WHI A;  1SQE A;  2E9T A;  2VFR A;  3EDR B;  1UVI A;  3OXF A;  1FRJ A;  4O3N A;  1TTH B;  1XBW A;  1C1B A;  3OL6 A;  4NLP A;  4YR3 A;  3KTQ A;  2RQK A;  1Z2Z A;  2QLW A;  3AB4 B;  2YWG A;  1F60 B;  5DLG A;  2COL A;  2YX4 A;  4BC7 A;  3GV8 B;  1F5A A;  2BJ7 A;  1EKR A;  4YDD B;  3F73 A;  3DOM B;  5IWA J;  2DJW A;  4CLS A;  1F5B A;  2ROG A;  4C48 A;  5DZ6 A;  3DLE B;  3IWX A;  4LR8 A;  2V4Q A;  4LBH A;  3MMC B;  2R2R A;  2DPJ A;  4NA2 A;  4NLG A;  2PE8 A;  4OZ2 A;  4X4P A;  1CS4 A;  3CCT A;  4RBT A;  3KLE B;  1GAO A;  4LRC A;  1S97 A;  2G4B A;  1BMQ B;  4M5I A;  3MR2 A;  2R8K A;  1AFI A;  4S0M A;  2J5A A;  2XMU A;  3LWM A;  3MUV P;  2UVU A;  2MPU A;  1QUP A;  2PMH A;  2G2Z A;  1AW0 A;  2IDL A;  5C24 A;  1RT4 B;  1BLU A;  2RIL A;  2GHV C;  3PFE A;  2IY5 B;  2OUG A;  4JYA F;  3CW2 C;  3KUG A;  5CZX A;  1RWX B;  3GYX B;  2AJQ A;  4CWB A;  3NGR A;  2K3K A;  4NYZ A;  4R5P A;  3RJM B;  4OYZ A;  2ZKT A;  4TQS A;  1X5T A;  2AJF E;  1JMT A;  2VD3 A;  5F3Z A;  4FNH A;  3QT6 A;  3NL0 A;  3UDE A;  1SJ3 P;  2HZA A;  3R5G A;  3PHT A;  2RJZ A;  4DG1 B;  2KN4 A;  1FWP A;  1YDL A;  3MM8 A;  5HP1 A;  1SBR A;  4LF7 F;  2E9Z A;  2B8P A;  3F44 A;  2ASD A;  3EXC X;  4KHM A;  1DAX A;  4YFU A;  4KRW A;  4YY3 J;  5KT5 A;  3JQK A;  1VIX A;  3RRG A;  3GG1 A;  3VAG A;  4WFA Q;  4P75 A;  1X7V A;  4CI0 B;  1U7L A;  2J9D E;  2VPX B;  4H4O B;  4N5S A;  1HNI B;  4DPU A;  2LCW A;  2PSZ A;  4DN9 A;  1OY9 A;  3PM9 A;  1WDD A;  1VJQ A;  1PAU B;  5KT7 A;  3UVJ A;  3TEG A;  4NXN F;  3ZFV A;  3CCQ S;  4RW4 B;  3CCJ S;  1VQN S;  1FX2 A;  2IRY A;  1TV6 B;  3ZZT A;  4AYB D;  2BXJ A;  1QAJ A;  4HH0 A;  5KFH A;  3VAF A;  1BC6 A;  1WF2 A;  3MEG A;  4A8S A;  4TU8 A;  4OJ3 A;  2B4P A;  4Y2I A;  4BLG A;  1IBK J;  3HSJ A;  4J9Q A;  1XJW B;  1XNQ F;  4LF8 J;  2OEJ A;  1SPB P;  3NG8 A;  3FBF A;  3B82 A;  3O44 A;  5CHC B;  1Q79 A;  1URR A;  5I3P A;  4FPI A;  1SB6 A;  2LDY A;  3W60 A;  2CJX B;  2DHH A;  1SJQ A;  3QAE A;  3QZ7 A;  4OYI A;  5L8R C;  2HQC A;  1K44 A;  2LQ9 A;  5DG7 A;  2XSJ A;  1UET A;  1SH2 A;  3HFZ B;  4JBC A;  2E1P A;  3PHE A;  3H2U B;  1N5Y B;  3PYF A;  2GJ2 A;  3LAK A;  3MM5 A;  2OKQ A;  3C66 A;  4OI3 A;  3V6D B;  2DK2 A;  1HNW F;  4NLY A;  3EPG A;  4BBY A;  3WC2 A;  2G2O A;  3J81 U;  2HVZ A;  4P52 A;  4FS1 A;  1L3U A;  2ACM A;  2LXU A;  1OMS A;  3P8B B;  1FDD A;  4U8V A;  1DTT A;  3SCL E;  4Y28 C;  1HW8 A;  4HI1 A;  4ELV A;  4M5N A;  5CYJ A;  2WZ1 A;  4WCE Q;  3VAK A;  1UJ6 A;  3OR2 B;  2IJR A;  1TFY A;  3T5L A;  1CC7 A;  1U1M A;  1YRX A;  1TFW A;  1SUQ A;  1RUS A;  2Z2Z A;  4CLW A;  3E01 B;  5IS2 A;  5AXM A;  2MLY A;  4HDH A;  3W2W A;  4DV5 J;  4QIG A;  3ZTP A;  1WOP A;  1JQG A;  1MLA A;  5E3P A;  1LW2 A;  3PXG a;  3KLI B;  2CQH A;  4DV7 F;  1L3S A;  2RML A;  3QRP A;  4LF2 A;  1KQK A;  5HQ8 A;  4CDI A;  4QCL A;  3GV7 B;  5L1J A;  3W9J A;  4DUT A;  3CMA S;  2P5V A;  5FLX U;  1HNX F;  3HVW A;  4WE1 A;  4O3P A;  3CJK B;  1VI7 A;  3QRQ A;  4Q2M A;  1PGZ A;  2PMW A;  4UF4 A;  2BDP A;  2VQF J;  3JYT A;  2E5J A;  3HSD A;  1VHI A;  1CJU A;  3NS7 B;  2V2K A;  2GVZ B;  3TP2 A;  2QJ3 A;  4DV1 F;  3QRR A;  2CQ2 A;  3JSM B;  2B7B B;  3KLH A;  4X66 F;  1EP4 B;  5D0H A;  1U6B A;  1B4S A;  5M2P A;  4B3R J;  1KS2 A;  4H54 A;  3H4D A;  3CCL S;  4WU2 A;  2R8H A;  4MIB A;  2G1D A;  4LF5 F;  2W9B A;  3PJW A;  2GJF A;  1TKT B;  1FKO B;  4P74 A;  1ZH5 A;  2A6O A;  4EO6 A;  2V0N A;  1YJV A;  2DXF A;  4LR7 A;  2YNF A;  5KFS A;  1CJV B;  3NKY A;  3KK1 B;  1WWH A;  4WIQ A;  4LSL A;  2IM3 A;  4RW9 B;  2VBZ A;  1WC0 A;  1YZ6 A;  5IT0 A;  3CDE A;  4K4W A;  2CJB A;  1C1C B;  3KFW X;  3W66 A;  3EJM A;  3D54 A;  4MFB B;  3PRD A;  2DR7 A;  4DLG A;  3DLG A;  8ATC B;  5KG7 A;  4KBI A;  3THP A;  1TQL A;  3BO4 A;  1IKV B;  4X62 F;  4WP9 A;  2BZ2 A;  2KU7 A;  2BUN A;  2LA6 A;  1RZM A;  3HHL B;  4LBI A;  3TQ1 A;  1G6B A;  3UCG A;  4DV3 F;  3AOA A;  2MYF A;  2F40 A;  3N5F A;  1ZAW A;  2FY1 A;  1LW0 B;  1S12 A;  4LFA J;  1H73 A;  2OPQ A;  2CAD A;  2YWH A;  1CSJ A;  3CDU A;  3UW1 A;  3DGV A;  5KT4 A;  3MOJ B;  4NL5 A;  4ZPA A;  4JI5 F;  4ZVR B;  3GJQ B;  3HFK A;  5M2R A;  3VGU A;  1NJI T;  1C2P A;  4TY9 A;  1R0B G;  3H5S A;  3C8Y A;  3EGZ A;  3CJ8 A;  4F2S A;  2HHP A;  2LQJ A;  4FXV A;  2EFO A;  1S9F A;  1NDK A;  2W9C B; 
#chains in the Genus database with same CATH homology
 1CJV B;  2W01 A;  5IV3 A;  1CJK A;  1CJV A;  4CLS A;  4OZ3 A;  1WC3 A;  4P2M A;  5D0E A;  1YK9 A;  1WC0 A;  1YBU A;  5D15 A;  1WC1 A;  5IV4 A;  4OZ2 A;  1CS4 B;  4CLT A;  5D0G A;  1CS4 A;  4OYI A;  1Y11 A;  4WP8 A;  4OYX A;  4OYM A;  4CM2 A;  1AB8 A;  4OYP A;  4P2X A;  1CUL B;  1CJT B;  1WC4 A;  4WP9 A;  1CUL A;  1CJT A;  4USV A;  1CJU B;  4CLK A;  4P2F A;  1CJU A;  4USU A;  2GVZ B;  1AZS B;  4OYO A;  1WC5 A;  3C15 B;  1TL7 B;  4WP3 A;  1Y10 A;  3C15 A;  1TL7 A;  4CLP A;  4WPA A;  3UVJ B;  3MAA B;  3G82 B;  4USW A;  4CLL A;  3UVJ A;  4CLF A;  5D0H A;  3C14 B;  3G82 A;  3MAA A;  1YBT A;  1FX4 A;  3C14 A;  1U0H B;  4OYW A;  2QV6 A;  4CLU A;  1U0H A;  1FX2 A;  2WZ1 A;  4OYZ A;  4CM0 A;  2BW7 A;  2GVZ A;  1AZS A;  2GVD B;  3C16 B;  1WC6 A;  2GVD A;  5D0R A;  3ET6 B;  3C16 A;  4UST A;  3MR7 A;  3ET6 A;  4CLZ A;  4CLW A;  4CLY A;  3R5G A;  4NI2 B;  4OYB A;  4NI2 A;  4OYA A;  1CJK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...