2DNKA

Solution structure of rna binding domain in bruno-like 4 rna binding protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
GSSGSSGCLRQPPSHRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of RNA binding domain in Bruno-like 4 RNA binding protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Bruno-like 4, RNA binding protein
total genus 14
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dnkA00
2G1DA 2HVZA 1KC8T 1G2EA 1W2BR 2CPXA 2X1FA 2YH0A 1S79A 2LA4A 3G4SS 2M8HA 1U1NA 5GAEU 2OJ3A 2L41A 2LEBA 1Q86T 3SDEB 3CTRA 2XSFA 2AYBA 1URNA 4F26A 4M5DB 3CXCR 3P6YC 3CCLS 4F25A 3UD3P 2Q79A 3SDEA 4YUDA 2AD9A 2ADBA 2CQPA 3SMZA 1X5SA 1R8PA 4UQTA 3NNAA 3ZZYA 2GO9A 2VOPA 4PRFA 2RU3A 3THTA 3CCUS 3BO3A 2MKSA 2MJNA 4EGLA 4TU8A 2KXFA 2E44A 1X4DA 3VALA 2KG1A 1X4GA 3P3DA 2FY1A 1OO0B 2X1GA 4PKDB 5D77A 5LSOA 4W92B 2GHPA 1WF1A 3CC7S 2MYFA 1UP1A 2JX2A 2OSRA 1WI8A 2JRSA 1X4EA 1NJIT 2CJKA 2FHOB 3CCRS 3ULHA 2YKAA 3U1LA 3Q2SC 4C0OC 3TO8A 3R1HA 2RNEA 2CPYA 3BO2A 1WG4A 2ZJPQ 3VAKA 1U1OA 3UCZP 2M0GB 1M5PC 2MZQA 3G9CA 2J0QD 1M5OC 3CCQS 3R27A 1ZH5A 2CPHA 1DZ5A 2A3JA 5GVQA 5DDQC 4LJMA 1U2FA 2MZ1A 2UP1A 2JVOA 1ZZNA 2LMIA 1DBDA 1YWXA 2CQ0A 1U6FA 3G96A 2MZTA 2LYVA 3TP2A 2L08A 2RS2A 1FO1A 1WWHA 2CQDA 3MXHP 2DNYA 2DGSA 2ADCA 2XB2D 3H2VE 2CPIA 3MDFA 3I56S 3EX7B 2VODA 2X1BA 2KXHA 2HGMA 3FEYB 3CULA 2LEAA 2RRBA 3UCUP 3UWTA 4ZKAA 2EK6A 4ERDA 5LJ5Y 2E5IA 1YIJS 5LXYA 2KYXA 3NMRA 2CQ2A 5EN1A 1WEXA 3PIOQ 3G8TA 2MGZA 5BJRA 1FT8A 2CQHA 4YOEA 2OSQA 5LXRA 1X4HA 2KN4A 1OIAA 3UD4P 2DNMA 5DM6Q 2G4BA 5IFMA 1X5OA 3L3CA 1H2TZ 4W90B 1P1TA 2CQBA 3JB9k 2E5JA 2MKJA 1Q82T 3VAJA 1RKJA 1QM9A 2ERRA 1NO8A 2MZRA 1HD0A 4CIOA 2M8DB 1KQSR 2MQNA 1K9MT 1KOHA 5FJ4A 3CMAS 4TU7A 4CH0S 3VAHA 4Y00A 1BY9A 5GAGU 3N9UC 1WEYA 4OZ0A 1VBXA 1JJ4A 4IUFA 3CCSS 4YB1P 1YITS 2DISA 2QA4S 1VQ8S 1YTYA 3NS5A 2CQ1A 1P27B 3NNHA 1YHQS 3PIPQ 4RU2A 2DGQA 2DGVA 4QU6A 2JVRA 1CVJA 3BEGB 1VQKS 2RQ4A 3J7YU 4IOCQ 2DGOA 3CCJS 3H2UB 1JJ2R 1HD1A 2PEHA 1VC5A 5LSLA 2HGNA 2MZSA 3R1LA 1FHTA 2CPDA 3UE2A 5H1SV 1VQLS 3LPYA 4TLQA 3B4DA 2YTCA 2VONA 1FJEB 2NZ4A 2DNLA 2RQCA 1U6BA 1WHVA 3VAMA 4WF9Q 5DETA 5IQQA 3CC2S 3K0JA 1SJQA 3CCVS 1KOOA 1YJNS 2OTJS 2ZJRQ 2CQGA 5DDRC 3D2WA 3OW2R 1VQOS 2DNPA 2AYEA 3TYTA 2MQLA 3HHNB 1WF2A 2DHXA 3MD1A 4QPTA 4A8XA 2XNRA 1B7FA 2LCWA 5JVHQ 1WHWA 2CQ4A 1FNXH 1N88A 3EGNA 2XS2A 3G6ES 2CQ3A 3VAFA 3S8SA 4WFBQ 2RVJA 2MQQA 1NU4A 2MKHA 2FC9A 4QQBA 4TU9A 2PE8A 2RS8A 5GMKa 3MUVP 2XS7A 5LJ3Y 1X5TA 1U1RA 1SJFA 1H6KX 2DH8A 3I55S 1UW4A 1FXLA 2JWNA 1D9AA 2M70A 4P6QA 4ED5A 2N7CA 1X0FA 5GAHU 3S7RA 1KD1T 1A7GE 5JVGQ 3NNCA 2DHAA 4C7QA 3MURP 2HZCA 2CPEA 3VAIA 2BOPA 3MUTP 2DO0A 2AYMA 2M52A 2NLWA 2OIHA 4WIIA 1U1PA 2KXNB 2I38A 2MQPA 2F3JA 2MHNA 2LKZA 2DNKA 2MGZB 3CPWR 1S72S 3ZZZA 5CYJA 5IM0A 1VQPS 2J8AA 3MUMP 2X1AA 3G8SA 2DNHA 2FC8A 3CC4S 4LIRA 4F02A 2M4MA 4WFAQ 4IO9Q 3VF0B 2MJUA 1WEZA 2CQCA 2CQIA 3DXBA 1VQ7S 2BZ2A 1SJ3P 1X4FA 1IQTA 1WHXA 4Y0FA 1OWXA 5HL7Q 2I2YA 3HI9A 2KU7A 1N8RT 2J0SD 2KM8B 2EK1A 2MKIA 2L9WA 1N52B 1VQ9S 3DLLQ 3CD6S 2D3OR 2KT5A 3IRWP 3B4MA 2EVZA 3U1MA 4WCEQ 2DNGA 1YI2S 1F9FA 1JJHA 1O0PA 2DIUA 3SXLA 1VC6A 3RW7A 1WF0A 1FJ7A 1Q81T 1SJRA 2DITA 1ZZFA 1M5KC 5IM0B 2CPFA 2DH7A 1OPIA 1SJ4P 1H2VZ 1X5PA 2MPUA 2DIVA 1FJCA 1D8ZA 2DNNA 2AYGA 2N3OA 4CQ1A 2KRRA 1AUDA 5GADU 2DGWA 4WFNQ 2MB0B 2DNOA 2QFJA 1X4AA 2RT3A 1U1LA 2MSSA 1WI6A 2XNQA 4Z2XA 2LECA 5MLCV 2MMYA 5CXTA 2D9PA 5DM7Q 2DNRA 1WTBA 1QVFR 2SXLA 4LMZA 4WKRA 2MQOA 2RRAA 1Q7YT 2G0CA 2M7SA 1M5VC 1X4CA 2DNZA 1U1QA 2D9OA 2DNQA 2LA6A 4J5OA 1A9NB 3V4MA 3CF5Q 2DB1A 2KH9A 2HGLA 2YWKA 1VQMS 4PR6A 1VQ6S 2B0GA 2M2BA 1RK8A 1U1KA 3P5TL 2KFYA 1HL6A 2F9JA 1VBYA 2N3LA 2QEXS 2MY7A 2J76E 2CPZA 2K3KA 4FXWA 2F9DA 2MY8A 2KM8C 2DGTA 3Q2TC 1N54B 3CUNA 1DHMA 1VQNS 1XN9A 2DHGA 4V19X 3J7ZT 2V94A 2KG0A 1UAWA 2M9KA 2U2FA 1WELA 2K8GA 2KVIA 1M90T 3MOJB 4FXVA 3IWNC 1SXLA 2CPJA 2HYIB 1YJ9S 1K8AT 5ITHA 2E5GA 1QVGR 1M1KT 1WG1A 3BS9A 4IOAQ 2MKKA 2YH1A 2DO4A 2WBRA 3UCGA 1VBZA 2DH9A 2MKCA 3FEXB 1VC0A 2DK2A 1YJWS 4BS2A 2KHCA 4C4WA 2KI2A 2DGUA 5CA5A 3S6EA 3CMES 3EGZA 1L3KA 4CH1A 1VQ4S 4U67Q 1K73T 1X4BA 3US5A 3BO4A 2MSTA 1PGZA 1R8HA 5D78A 2LXUA 2ZJQQ 1UFWA 4QU7A 1PO6A 4OZ1A 3MI7X 2XS5A 2LQ5A 1WHYA 2RUGA 2LXIA 1DRZA 3S01A 2N82B 2DHSA 2O3DA 1HA1A 2M88A 2OTLS 5DDPC 2MQMA 1U1MA 2KRBA 2DGXA 3THPA 2MXYA 3CCES 2E5HA 1WG5A 3CCMS 1VQ5S 3LQVA 2FPHX 3G71S 4UY8T 3MD3A 2VOOA 3VAGA 1H2UX 2MZJA 3P49B 2U1AA 3RW6A 5DDOC 1JMTA 5HO4A 3NS6A
chains in the Genus database with same CATH superfamily
2G1DA 1RUSA 2UVRA 2A6MA 1CC8A 8ATCB 1TK5A 5EWGA 4JI2J 2VA2A 4AD6A 4ILMA 1S79A 3QWPA 4OJHA 5FLXU 4O3NA 2C2NA 1REVB 1WC1A 2Q43A 2YWGA 1CJVB 3TEGA 4CO3A 2E9RX 1S0OA 3C15A 3BZQA 5IC6B 4EI2A 2R2UA 2EFPA 2LEBA 1WKJA 5HQ8A 3NKYA 3CTRA 3G86A 4DV1J 2AYBA 3QT7A 1URNA 4M5DA 1V3SA 1UEUA 3SIPB 4KB7A 1PJ5A 4USKA 5L8RC 4HVZA 2C2OB 3CCTA 4F25A 2ADBA 4M5KA 4F4KA 2IHR1 1RAEB 2CQPA 2HBQB 4LF6F 4PUOA 4DV7J 2PFFB 2BACA 5EGYA 4B9SA 4OI4A 1D9FA 3UO0A 2AWZA 3FCWA 1S1UB 2YKMA 3I4PA 1UVJA 2XMKA 5L1LA 3ITHA 2R2SA 4DV3F 2RU3A 4XPEA 1NDPA 3HFVA 4ED8A 4DFJA 2ROPA 2YWHA 3LAKA 4FBTA 2CZ9A 4MAKA 4GKJF 1RCOB 1YRTA 4C97A 3QIDA 3CJ3A 2KKHA 2MJNA 3W64A 2HBYB 1VS3A 2AZ1A 4X4QA 1NJYA 4OX8A 4YEAA 5H9FJ 2RKIA 2ZNYA 3R8YA 3QBCA 3CJSA 1FX4A 4TN2A 4QWBA 2BQRA 3P3DA 2NPIA 1YRXA 1W26A 3T1YF 3MPWA 3ENVA 4FZVA 3EXYA 5DS7A 2GHPA 1VQSA 1WF1A 3DLEB 3GJRB 4XDCA 4HACB 2K7KA 1NKCA 4M5NA 4DCPB 3EJMA 4C3MA 3PM9A 4PPDA 2JFKA 2W2NP 3GJTB 5FDLB 3U7JA 4DCOB 2VL1A 4OYZA 1FESA 1XBWA 3NBPA 1CJKB 3SCLE 4CLPA 1IJFB 2H48B 3IM8A 3U1LA 3D67A 1RWKB 2VUGA 3KHHA 1KRPA 5A76A 1UWBA 4DR1F 2RNEA 3UDVA 3VCDA 3BO2A 2OKQA 5E3RA 2DPIA 1GQEA 2ASJA 1WG4A 3SCKE 4NLGA 2W24A 2ZZTA 1RWXB 1LFPA 2PMWA 2VH7A 4YQWA 4DBQA 4K4XA 2M0GB 2AEFA 4XPCA 4CLYA 1FXDA 3DMJA 2HQDA 5KG5A 3VZHA 1R0AA 4OJ3A 6FD1A 1ZYQA 4U8VA 1S7IA 3Q8YA 5LM7E 4C8OA 3ZO7A 2AEMA 4DR2J 1ZS6A 1S1TA 3GFXA 4DV2F 2X3DA 5KG0A 1IUJA 4J9LA 4IG3B 1QTNB 2IY5B 2H3EB 2VF3A 1VMBA 1RT7B 1N32J 3ZTOA 1PC4A 2W9AA 1WOSA 2BJ9A 3S1TA 2ZVSA 4Y34A 5KFZA 5B0DA 3OL7A 2HW3A 1NLKL 3AJ2A 4YR0A 4DR3J 3RAXA 3HVRA 4GKKF 2HZAA 4HL9A 3KUEA 2MZTA 3MCSA 1KHWA 2C28A 3G6VA 1FWLA 4L74A 2VPXB 2UUBJ 4ZPVR 4DR4J 3AXKA 2HPUA 2CPIA 4GKJJ 3GB0A 4ZDNA 3OLAA 3HX9A 3IBWA 3MM6B 2VODA 2HHWA 3PW4A 2ABYA 2OLWA 5KFJA 3GZ7A 1SPBP 4ZVOB 3EVOA 3TUIC 3FEYB 4RLEA 4EMDA 2GIQA 4ZITA 5HROA 3QSIA 4KGKA 3CULA 3RJMB 4JI8F 3TOQA 2HQCA 3IWLA 2YPZA 3UCUP 2WK4A 2AW0A 3IR7B 2HS0A 5EX0A 5C2CA 2EPIA 3IP0A 4ZVHA 2R8HA 4JI7F 1B3TA 1OQ6A 1OSCA 2OELA 5M2UA 1I1GA 4PXDA 5ETMA 1HNIB 1WEXA 3NXZA 4KGVB 4A8KA 4P7VA 3G8TA 1HW9A 1UMJA 3IRXB 4WYWA 3UNYA 1FT8A 2QSFA 5D6GA 4LBPA 3ITHB 4ID5A 4PZVA 1J5EF 1OIAA 3I82A 2DNMA 4L6V3 2E5LJ 3FRZA 4DHVA 3OHAA 1H2TZ 3WBZA 2BUNA 4IFVB 3DLJA 1IJEB 2CQBA 2QA2A 3N5BA 2MKJA 5HP1A 4URQU 2RQKA 2FZGB 3GYNA 3JQJA 3M30B 4NI2B 1Q82T 1JJCB 1H7XA 4KV8B 2HNZB 3SQGB 4ES1A 4DN9A 4BWMA 1PCAA 3NRBA 2RU9A 4P2FA 1QY7A 4JBCA 5KFVA 3ENWA 3H0PA 1IBMF 1SB6A 2GHWA 3R6LB 2KB2A 2ZBRA 4FPIA 4WFYA 4ED6A 2M8DB 4E0DA 4MFBA 2IYIA 4MIBA 5FIIA 4LF5F 1F3FA 1CJVA 2YQ1A 2KT3A 2XBPA 2Z57B 3BPSP 3LANA 5K14B 3AJ1A 3OTOF 3G6YA 1IKWA 1KOHA 3B6BA 5FD1A 4DS5A 7FDRA 1D09B 2XCAA 2WVFA 4CNZA 4CH0S 5HJXA 5J2PA 1IVZA 1R7IA 2B7BB 3AB4B 4U96A 4F4XA 3N9UC 2H5EA 2UUAF 4PXBA 4G1QA 3OV7A 3R5GA 2XY7A 4USUA 4OX9J 4OZ5A 3CCSS 2XGPA 2AJFE 2VU5A 3M8SA 1FJGF 3MR5A 2GNKA 3KLEA 1VQ8S 1YTYA 1AZSA 1LW0B 1P27B 3NNHA 1JLAB 3T41A 1N0UA 1N36F 1UKUA 2DGQA 4MKYA 4ZHRA 3DM2A 3BEGB 4ZJQA 4X4SA 2X3GA 4KBIA 1TL3B 2DGOA 3TX8A 5HQLA 5LMNF 4AUKA 1SKWA 4DSJA 1CEZA 4TQSA 3OLBA 2QYCA 2VFUA 1VC5A 3R1LA 3WQPA 4A8SA 3RBDA 3CD0A 2DVIA 1KVIA 4OJ1A 1VQLS 4DN0A 3L7UA 4H4KA 5A6PA 3LWLA 1JXVA 3QGGA 1ZM2A 2B9XA 1FJEB 1GXTA 3UN3A 4DU7A 3BSOA 4JI6F 4LBHA 4WF9Q 2PFDA 2VBXA 4I7FA 3M2RA 1GXUA 2GGPA 3E51A 5B0AA 1S77D 5KFQA 2OFHX 2Y3YA 3CC2S 1AUDA 4NXNJ 4OZNA 2RH3A 5J1PA 4DV4J 4NCGA 3NNCA 3DLGB 5T7LB 4UUWA 3Q23A 1HQEB 1VRTA 2A18A 4LRDA 1HQ2A 1RTHA 2OPPA 1N6QA 4C0BA 3CDUA 1VI7A 2G0IA 4RBTA 2W9CA 5KFKA 2E7VA 2CNKB 1YZ7A 9ATCB 2HMIB 3K5NA 2DHXA 5SZTA 2LQ9A 1MMLA 1D8YA 3AA9A 2GQ2A 5KFRA 5KG1A 3DLKA 6AT1B 4XIUA 3PRVA 2LCWA 1K0TA 4PXCA 4RU9A 2R7WA 5DGBA 4DV5F 5DQGA 2JNJA 1CBKA 3EMTA 4IFVA 4LR7A 2WVDA 4O44A 2LDYA 4CNYA 5KFHA 3K59A 1B64A 4QYZK 3HZGA 4C8MA 3R5CA 3OTOJ 1MSWD 3DDIA 4F8RA 4YDXA 1MU2B 1JLGA 2RVJA 1NPPA 3AOAA 4KJIA 3H5YA 1D3WA 5BYQA 1U26A 1TR0A 3Q22A 3OD2A 4NPOA 5CH7B 2L9DA 1MG7A 2IM1A 1KTQA 4RW7A 1X5TA 4WTOB 5K8MA 4EUVA 2GC8A 1VRUA 4LFAF 1H6KX 3PW5A 3MEDA 2HQIA 4YR2A 2P8IA 4ELTA 4C8ZA 5F8NA 1EQ0A 1HYSA 1HR0F 5J2PB 1UEVA 1D9AA 4TVAB 4GMKA 4QR0A 2AGQA 2XYGB 1RP5A 3I5BA 3MMBA 4BLGA 3ET6A 4P6QA 3RB0A 3PYEA 2XMJA 2DJWA 3Q8VA 4M5LA 4UZCA 4CWBA 3S7RA 4EWTA 4C8LA 4R5PA 2KZMA 4DX5A 1FERA 1XTZA 2HSEB 3QLHB 3FSYA 4KH1B 2VG7B 2V2VA 2VG5A 1G1XA 2HNDB 2DHAA 4RBVA 9RUBA 3W5YA 5E3AA 5LL6d 4XAKA 4DUZF 2HURA 2WOMA 1GFWB 3D7SB 1KQKA 1U0SA 1UEKA 2OMLA 2CPEA 3PEHA 4RNMA 3J81Y 2BOPA 4KAIA 2DO0A 1QDUB 1RT5B 4ZCLA 5DG9A 4DL4A 1OQ3A 3L7PA 4FNIA 4B3OB 4WIIA 3K5MA 4NYZA 5L1JA 4F3MA 3PFOA 2MQPA 3WC2A 1BC6A 2MHNA 3IAM9 4F36A 2LKZA 1XJWB 5K5MA 4FS1A 3MEDB 2ZM6J 5U47A 3LGHA 4K2XA 5DG7A 3D4JA 1S72S 3FCHA 1RHUB 4DSLA 1VQPS 3MEGA 4ZVUB 3RBZA 1F1BB 4P73A 3LGMA 4MT1A 1JLFA 1EETB 3D66A 4F4AA 2J6TA 4LIRA 2AX0A 2F65A 3THVA 1LQ9A 4ANEA 4DV6F 1CLFA 2YKQA 2WZ1A 3K58A 2EKYA 3LGNA 3FSIA 1IKVA 1WEZA 2DY1A 3W2WA 3IN5A 4HH0A 4LF4J 2BZ2A 1WJ9A 4NLVA 4Y0FA 2DEJA 2AMCB 1NPKA 4DV1F 1Y00A 2HRTA 1RHRB 5HL7Q 3PV8A 3PYFA 1HBNA 3QO9A 3DLKB 4B17A 3RR8A 2GZOA 2KU7A 4YR3A 2KHDA 3CD7A 3NGTA 4MYUA 2ZVIA 1Q8LA 2I0XA 1U09A 4CLFA 3BSAA 2KM8B 4CI0B 4ZCMA 3DYAA 2L9WA 1N52B 3K57A 2L48A 3CB4A 4N8NA 2OPPB 4RWWA 5GAHI 1APSA 3CD6S 2D3OR 1RHQB 3MXHP 2HIQA 5BXIA 4NOHA 3U1MA 3PVXA 2DNGA 2GW8A 3I31A 5HLFB 1YJTA 3JYTB 1VC6A 3GPAA 1RXOB 1JB0C 4UF4A 3RW7A 5L1KA 2BJ1A 2BR0A 4I2PB 1RT1B 1V3ZA 2B9YA 1KTVA 5F8IA 2AX1A 4MTPA 3SZ2A 3EPIA 5KFGA 4QWEA 1NBEB 5HVGA 4HLBA 1R6VA 5KT7A 4WK3A 2K06A 2A2CA 5C24A 2NREA 2E1AA 3JXOA 2JL9A 3I0RB 5HMWA 2DIVA 3C66A 1SV5A 1UL3A 4LT6A 1D8ZA 4I6WA 5J1NA 3JQKA 1CJTB 3FC9A 2GVZB 1FRKA 1ZPWX 3NCQA 4P2SA 2OD6A 4WTYA 2AYGA 2HRYA 4H54A 2ZH5A 2K3IA 2KRRA 3H2LA 2YNHB 4CQ1A 4IOBA 1CG2A 3V81A 3QYYA 1LW0A 4NRTA 4QIGA 2XG8A 2YNGA 4X65F 4NRUA 1JQGA 5LMUJ 2WOMB 1HNIA 1X4AA 1QAXA 2L9NA 4J37A 1S1XA 2BE2B 2FY8A 5F41A 1HMVA 1V3RA 2VG7A 4H4MA 3HD2A 3M2VB 4QIWD 1DTQA 1U6ZA 1S6OA 2B56A 3HHDA 2MMYA 4CTAB 1FXRA 3OPKA 4L73A 1AUSL 5MLCV 2LECA 3P8BB 5CZVA 5T14A 2HZVA 4KYZA 4A8FA 3RBXA 3PG9A 3SQOP 1I94J 2WHOA 4L75A 2RRAA 1NDLA 3P45B 1M5VC 3K8WA 3MM9B 5E7OB 5IV3A 3FMWA 2POKA 3DU5A 1U1QA 2H9ZA 2VHGA 4NMXA 2D41A 5AE2A 2IJRA 1A9NB 1LK7A 3HD1A 3M9MB 1FRLA 1EETA 1KLMA 1Z4UA 1FDAA 1VQMS 1T9XA 3AOCA 4DDFA 5IT9U 2DY9A 3FBBA 1B0TA 2E9TA 4ZPTR 2B0GA 5AXMA 3U27A 2HVEA 3WX4A 3O5TB 1U1KA 4KV8A 2YNGB 2RF2A 2V34A 3H4DA 4G3IA 2KFYA 3D54A 2B6AB 2XLKA 4FXWA 2J76E 2JDJA 3KNGA 4OLPA 1Y10A 5J2MA 1ZTTA 3R7NB 1O6XA 3ZZTA 4F3QA 4ZOSA 3J80U 2GX8A 1VQYA 5G0RA 1HR0J 4OX9F 4NLXA 3Q2TC 1DHMA 5D3GA 1Q95G 1QD1A 1XN9A 2GO8A 3FQKA 2HHUA 3GU0A 3K89A 2NXEA 1MWZA 2W4PA 1OY9A 3DI6A 1B0PA 2VPYB 2YNFA 4N77A 4RL1A 3RU0A 3BGOP 2ZHBA 2K8GA 2QIFA 2KVIA 4F2RA 1FRIA 2P9GA 3MOJB 2B51A 2ATLA 3JYTA 1ELOA 1MMNA 2FB0A 4X4RA 3HFKA 3FK4A 2F4FA 1QJHA 2V8GA 5J2QA 2CYYA 4DR5J 2CPJA 5L39A 4YY3F 2L3MA 1YQHA 2HYIB 1MW7A 2FJAB 2GGPB 1M1KT 2VD3A 3MM6A 3EPGA 3OL9A 4BWJA 4OYPA 2MKKA 1NKEA 4WKYA 2ATCB 2YH1A 5EX3A 5FDLA 1DQ9A 4EK2A 3FBEA 3D68A 4HHUA 3KUGA 7AT1B 1BQMA 3KK3A 3AH6A 1PIEA 2MKCA 1VC0A 2CJ9A 2JH3A 2YQ0A 3V81B 2J0XA 2AHOB 4DQIA 2KHCA 4OYBA 4NZ7A 4WK1A 1XWLA 2CXEA 4ZP7A 3UN5A 5KOWA 3EGZA 2LEPA 4WP3A 3R6GB 5KFAA 5C5JA 2Z2LA 1SKRA 2FLPA 3R2DJ 1VQ4S 5A2QU 3P96A 1K73T 1X4BA 1TMMA 5KFCA 2XMVA 1IBKF 1IBKJ 3UI3A 2W9BA 2XLIA 3H25A 1HWIA 2LQJA 5D78A 1Q4RA 1VGYA 1UFWA 1PBUA 3MAAA 1I94F 1X7VA 2G13A 1U0HA 2ZD1A 4XK8C 4QU7A 4L72B 2NYIA 3AFGA 4LRCA 1S6UA 2RUGA 1KLNA 1AT1B 1BWEA 1S48A 3IC1A 1DRZA 4NYPA 4JYAJ 4YB6A 3J81U 2M88A 2BBEA 2WW8A 3PACA 3FEZA 4LFCJ 4HKQA 4WU3A 4Z7YA 1JLCB 1YJUA 3TJ8A 2KRBA 2DGXA 3THPA 4JI0J 1O8BA 4ZP6A 1WG5A 1AROP 2LVWA 3CCMS 3CIZA 2V4QA 4GC7A 1RAIB 1T02A 1C0UA 1T94A 2FPHX 2RJZA 3A1YG 3BGUA 3BH6B 4ES2A 2DR5A 3ET6B 1TFYA 2DBBA 1PAUB 2UXDJ 2WONA 2ZBIA 2VOOA 3GSDA 4ZHRB 4M1KA 3N79A 5I4MA 1I51B 4YB7A 2W4CA 2NS1B 1E6YB 1AZSB 3LP2B 4ZP9A 2FZKB 4OYOA 3ZZPA 1C1BB 3KLIA 4J9NA 4RZRA 1JLEB 4RW8A 4CTAA 1LK5A 2QV6A 5HO4A 1EJ7L 1R8BA 4IFYB 2EK1A 3NS6A 4ZVRB 4EYHB 3IGVA 4B9MA 1K1SA 3KUHA 2OO4A 3BSNA 1OSDA 2YH0A 1BUXA 3CCWA 2LA4A 3JSRA 1Y7PA 2GIFA 1U1NA 2OJ3A 2JZ5A 4KHMA 4LSLA 5AJ3F 4ER8A 3RB3A 1Q86T 4AXIA 4PYAA 4MYTA 1XNQF 2ACYA 1E6VB 3QAEA 4J7CA 4F0KA 1S49A 1T3OA 3IBFB 4O3OA 3IWXA 2WB4A 4KHPJ 4IDKA 3P6YC 3ISNC 4KGZB 4O4RA 3CCLS 3UD3P 2Q79A 2H1YA 3SDEA 4YUDA 5A0YB 2J6UA 4JI7J 1RB0A 3BJYA 4K4VA 2BV3A 1K1QA 3OVBA 3SMZA 1R8AA 1RTDB 2J9DA 3ZNJ1 1KVJA 1R8PA 2XYPB 3PO4A 2EG1A 2XSJA 2DCUB 2RD5C 2VOPA 1RT7A 4I6AA 4PRFA 1SH0A 1FCAA 1T0TV 4XTTA 5KFNA 2XO6A 2IAJB 2W9BB 2GJ2A 3FUYA 3EZUA 3P5BP 4IRDA 3KOAA 1HNXF 1MWYA 2R7OA 1RWMB 2XS5A 1SC6A 2CNOB 3C16A 4WXOA 5L38A 1RT1A 2VQFJ 4DUYJ 2XY6A 1H0HB 3TANA 3SI8A 4P7TA 1RABB 2IIHA 1X4GA 4MIWA 3QWUA 4FDFA 4HHJA 4KE5A 1OO0B 3O3LA 2X1GA 4NLWA 4PKDB 1ZM4A 4DU8A 2K1RA 2IDLA 3ZZRA 5DZ7A 3RRHA 2HS3A 3U1NA 1NH8A 1R27B 1UWBB 2BYCA 3A8KA 5AXNA 5CYMB 1CC7A 1C0UB 2MYFA 1XMOF 1UP1A 1Y4ZB 1YRUA 5B08A 1AFIA 2PN6A 1WI8A 2LXFA 2FZCB 2OPSB 4DV7F 3IR6B 2KJWA 2Z30B 1DLOA 2J7KA 3CSKA 3DOKB 4Q43A 4FS2A 2CJKA 1LWFB 2Q1LA 3BN4A 2E1MC 1IKXA 1URRA 2GCFA 2BKNA 2YWEA 3KDNA 5C42A 2W9CB 3Q2SC 2VJVA 4NA3A 3TO8A 3R5DA 1ZOTA 3M9OB 2CPYA 1S0VA 4N76A 4HTJA 3MM5B 5CABA 1WOPA 2ZNZA 5B0EA 3M32A 3VAKA 1U1OA 4KY3A 2PI4A 1M5PC 5IT9Y 3JSYA 4X64J 3O8WA 5KFFA 3HSJA 3UVJB 1ZH5A 1S1TB 1AFJA 3EYZA 2LQBA 1MNEA 4ZLLA 1KR4A 1DZ5A 2IPOB 2ZOMA 3TR5A 4W4MA 3KLHA 4EBDA 5DDQC 3C6TA 2FUG9 3L7OA 3VZIA 3I87A 3D0HE 2UP1A 1WC4A 5DZ6A 2BJEA 2K2PA 2AU0A 5E0OA 5I42A 4K0KF 2LMIA 2HVDA 4RUAA 1U7LA 5HBMB 2FGOA 1Y5NB 2CQ0A 2F5GA 3PTWA 4O4GB 1HPZA 4RWXA 2HFSA 1VDHA 2KDOA 3EZOA 3HT0A 3KLEB 2LYVA 5J2NA 2RS2A 1S6QB 1FO1A 5AXLA 3W62A 4DJBA 5C2GA 4DSIA 2R8JA 2CVIA 3N6NA 4JYAF 1E6VA 4DV5J 4AFFA 2Z4PA 5CD4A 3M8RA 3H2VE 3AD7C 5DG8A 3VHQA 3EX7B 4CO4A 3I0SB 5KFLA 1G3OA 1RLDA 1WC3A 1WTFA 3GLJA 4ANCA 2G2OA 4U95A 4IR1A 2X1BA 4MH8A 2DYAA 2KXHA 4ZVPB 4B3RJ 5K8NA 3H4BA 2R8KA 4RW6A 1Q78A 3TAPA 5IOLA 4AQYJ 5B0GA 4UY85 3UWTA 1UA0A 1NKBA 4ZKAA 5DRKA 2EK6A 3DRPA 3OR1B 3J7A1 4LVNP 2MDAA 1TL7A 4ZN1A 5HVHA 3DC2A 5LXYA 5BR8J 3PKYA 2MTLA 2DRAA 3CWJA 1EAYC 2ZDOA 4NLQA 4LREA 2UXDF 3QRPA 1IKYB 3VQSA 1HPZB 2CQHA 2EWHA 4OFZA 1TAQA 1RT4A 2CADA 2YVSA 1X4HA 5JXSA 1RYSA 5F3TA 4Z37A 5DM6Q 2PIIA 4J9SA 1QE1A 1X5OA 4AYBD 5IFMA 5LT5A 4O44B 4B3SJ 4NXMF 4W90B 1H74A 2AF6A 4NZ6A 3TVZA 3OR2A 3MR7A 3CGIA 1RT2A 3VAJA 1Y5LB 2W2QP 3T1HJ 1FNOA 2R42A 3PRDA 4ZIWA 1RKJA 2ERRA 5E2QA 1NO8A 1B7YB 2B7CB 2Z58B 5KOXA 1SBRA 2KT2A 3HVAA 3M1VB 5KT2A 5KT3A 2W01A 1F2GA 2Z0GA 5D4OA 1R0BG 1SQGA 3RB6A 4Y3CA 1K47A 1K9MT 4PWDB 1RU1A 1FWPA 2ILZA 4OL8A 4QZVB 4TU7A 1H72C 4LF9F 4Y00A 3T1AA 5A2QY 4DQRA 2W2PP 2OD4A 4OZ0A 2V50A 1BMQB 4QWDA 1WKLA 1H73A 3PX0A 2QN6B 4M63A 4X4NA 1MN9A 4B9TA 1BGXT 2DISA 3Q0AA 4B3TF 2ROGA 2QA4S 3D3CJ 1IBMJ 2IC3A 2P6TA 1MLAA 1FKPA 1RACB 1OS5A 3TAMA 4FVCA 3PIPQ 3HSZA 2E1RA 2DGVA 2HK3A 2Z2YB 2JVRA 1PC5A 5HANA 1CVJA 4QU6A 5I42B 1EP4B 3J7YU 3H2UB 1JJ2R 1FDBA 4IG3A 3L95X 3C16B 1RA7A 3MMCA 4AXJA 2CPDA 2LU2A 3TZYA 3DN9A 3LPYA 2YTCA 4FP9A 3NS7B 3TNVA 3LTOA 2XM3A 2ZBCA 4LQ9A 1U6BA 1WHVA 2NR0A 3DMJB 1R0AB 1HNVA 1WDDA 2OEKA 4U8YA 5IQQA 4LFBF 3TUJC 1SJQA 3J7YI 2IYGA 2C3PA 3HJFA 3CCVS 2DXFA 2VKZG 3BYPA 4PWWA 1TL4A 3QFHA 5I3QA 5DDRC 4UOCA 2WSFC 3QSYB 4NXNF 4EBCA 1T8EA 3QJJA 5D8HB 1N36J 1RU2A 5HATA 1VBKA 4WP9A 1EARA 2ZWPA 1W7WA 2EFOA 3V4IB 4QIFA 5LMUF 1LWFA 2ZBPA 1MN7A 2FHJD 3ILIA 4GRSA 3D0GE 3PXGa 1TVRB 3V6DA 1NJWA 2YKPA 4R0EA 3T9ZA 4N41A 1S6PA 4PG5A 4A8XA 4ZMMA 1IM6A 2HHQA 3BDEA 4DPOA 1P9QC 2OPQA 3OR2B 4JV0A 2UUAJ 3MTKA 1WHWA 3OBIA 2F8MA 2IRYA 5JUMA 2IJNA 3EGNA 3W66A 4ID8A 4YDDB 3G6ES 2WVBA 1RKIA 4H4OB 5I3UA 2XS2A 1FDDA 1GMWD 5K8OA 3EE3A 4IRKA 2KO1A 4K2JA 3HLUA 5EDWA 3B54A 3IRXA 1IBLF 3AT1B 1B99A 3F56A 2MQQA 1NU4A 3EWGA 4B9NA 2YXLA 2FC9A 1J27A 4QQBA 4ZCIA 4RKUC 3CJTA 3KLGB 3MUVP 2XS7A 1KWMA 1JNRB 3IBCB 4NLOA 2OGUA 3BBFA 5LJ3Y 3D1HA 5AJ3J 4F3OA 2IAJA 3H8YA 2DH8A 4OHVA 3NEKA 1YKWA 1H38A 3CVKA 3VGTA 4YP3A 3M8WA 2DR9A 2ZC4A 3HHKA 1K0VA 4DV0F 3RBEA 2RUSA 3AY0A 5HAOA 4IQMA 2V8VA 4B08A 5B0BA 5E41A 3VGVA 4JI4J 3CJ5A 3J7Z5 1X0FA 4ZP8A 5KFEA 4MFBB 4PUOB 1GXLA 1SIZA 2DD8S 4OHZA 2JHEA 2AP6A 5KG4A 3K5LA 2ZZMA 1OJ4A 2JLFA 3TUZC 2BE2A 4C7QA 3MURP 1S9EA 1Q8BA 1UJ6A 1HWJA 1PKUA 2H4YB 2B9EA 2OHDA 2O67A 4LF4F 1JWWA 3T5LA 3DOMB 1N4LA 3VAIA 3MPVA 4NI2A 3MUTP 2CWKA 2ZHOA 3DDNA 4QBUA 4LVOP 2UVWA 3QT5A 1TKTB 2M52A 5KG6A 4IH7A 2CJBA 1WSRA 4PPZA 1XMOJ 1U1PA 4A48A 1SV5B 3POTA 2CRLA 5CYQB 3C14B 2MGZB 4KPYA 4ECZA 3CPWR 3ZZZA 2G2ZA 1CJUB 4RW7B 5CYJA 4JV2A 2CNLB 2QL9B 2OPRB 3EM1A 1NXIA 2DNHA 2G2YA 5GMEA 2DKOB 3NWRA 3G8SA 4I2QB 4DFPA 1T03B 1N34F 1C1BA 3W1YC 1N34J 1IM4A 3IR5B 2W7AA 5B0FA 4F02A 2M4MA 4ZPDA 4ATNA 4USMA 3DM2B 1O5JA 1TKZA 3VF0B 5HROB 1EIYB 3IFEA 2HHXA 2HFVA 2M5YA 3GYGA 2R9LA 1SJ3P 3PW7A 4KT0C 5GMDA 4EBEA 2GVDB 1IQTA 2V9WA 2CJQA 3DYAB 2I2YA 2C1EB 5B09A 3ISND 2DTJA 2B5JB 5DO2A 3P4UB 1YZ6A 1BWVA 2D3O1 2W2OP 2EFVA 2J0SD 1KSPA 3CJKB 2UVUA 2H4WB 3ZZ0A 1TUVA 2HNYB 1Q5YA 5ETKA 3JSMB 3KYLA 3HHLB 2D3ZA 1GMWA 2HBZB 4JI1F 1HWKA 4NASA 1VIXA 2UV8G 4NCGB 2K1RB 2HFOA 2DXEA 3B4MA 3Q89A 3OHBA 1TKZB 3IRWP 1YI2S 4QW9A 1QAYA 3FKBA 4XDDA 2B4VA 1O0PA 2DIUA 3H42A 3HCXA 4I4BA 4HI2A 2BKOA 3SXLA 2XY5A 1TP7A 3LH2S 3NG8A 3GYXB 4KPCA 3PX6A 1RTIA 2ZC3A 3GJQB 3A8IA 4JI2F 2HKEA 1TL1B 1H7WA 1CJUA 3HXMA 4OI0A 2R7XA 3BKUA 2DT9A 2GIRA 4W98A 1S59A 3QRQA 2V69A 1FKAF 2Y1RI 1ZETA 4OJGA 4A46A 4DSKA 3MR6A 3MM5A 2VQEJ 2AJ1A 2KYZA 4OZLA 1F9HA 3NCPA 5HVFA 2B6AA 2FHMA 2I6WA 4ANDA 3FBFA 2N3OA 3TJ9A 4LF5J 4RW9A 4USTA 3F44A 2DGWA 2MB0B 1IR1A 1NZ8A 1PYTA 2DNOA 2RSQA 1BQMB 3BF4A 2QFJA 2RAQA 1U1LA 3OXLA 3KDOA 3N4WA 4JP8A 1R43A 3DLBA 4FF4A 1S76D 2XNQA 3MMAA 3BREA 1UA1A 4XO0A 1FFWB 3PDNA 4C3KA 5CXTA 4HYKA 4TQRA 3DKDA 4LMZA 2H54B 3TVKA 1REVA 3LP1A 3KTQA 5JJBA 5C25A 4DV3J 2PMZD 2V8DA 1VLYA 3A3PB 3HF5A 4JV1A 1VOMA 2LFVA 3ONQA 1HNWJ 3KJQB 4NZ0A 5CCLA 1KKHA 4DQPA 3JAMY 2NXJA 3KK1B 1X4CA 2DNZA 3PW2A 5T41A 3ILOA 2DNQA 2NCKL 2ZOFA 4P2MA 3V4MA 1UFLA 2KH9A 2HGLA 2K7JA 3N5FA 3Q86A 2JSXA 4I2QA 2YWKA 4DMZA 2BDPA 3RZAA 3FZ2A 2R7QA 4KGXB 3BBCA 1RT6B 1RK8A 2W1BA 5J2NB 2W7PA 2KJVA 1P6TA 5G0RB 2XHWA 4B3MJ 2UU9J 2Y8WA 2EEYA 1RLCL 2MY7A 3UNGC 4GC6A 4LF9J 4OYXA 4UOHA 1N5QA 1BE4A 1V5IB 3UQSA 3WHIA 2C3YA 4DX7A 4RR5A 2GV1A 1FRJA 1U25A 2ZWOA 2APOA 3LWMA 4M95A 4X84A 4QW8A 3BYRA 5EUHA 4DR4F 3HP6A 4V19X 3ZZOA 2HIYA 4B02A 1GNKA 3VGSA 1C1CB 4CT9A 1RI7A 5THWA 3W9HA 3N6LA 4CLWA 3AQOA 1S4EA 2D74B 4ETXA 4X65J 1RTHB 4OV6A 4ED7A 4DSFA 4LF8J 3PKMA 3MOZA 3MM9A 4O23A 2XO7A 3V6JA 1XMBA 3VVUA 4PEOA 4P74A 1YJ9S 4ZPBA 5ITHA 4IOAQ 1QVGR 1FEHA 5I3PA 3TZWA 2N4DA 1NUEA 1RBLA 5ETTA 3JTNA 5IQ6A 1U4BA 2KFNA 5F8LA 3ELHA 3O2IA 3H59A 1RE1B 1FX2A 5F0WA 4WE1A 1GT8A 2B5JA 3PRBA 3ZXWA 1S97A 3NL0A 4FBUA 3UCGA 2GJIA 1S12A 2CDRB 2Y0SD 2DH9A 3C6UB 4K4WA 3HKWA 3DLEA 3D6MB 4LRFA 1RWUA 1D1UA 3KNAA 1YJWS 1Z2LA 1KFSA 4C4WA 2F63A 2KI2A 1O51A 2V9KA 3DXSX 2DGUA 3MCMA 3W61A 5CCMA 2BOAA 3S6EA 4EYIB 1V6HA 3GR0A 3MEEA 3WC0A 1TK8A 1L3KA 1REGX 4X66J 5DLFA 1D0EA 3PJWA 4U67Q 4F0MA 3O44A 4ALZA 2C3OA 1GX5A 1YSJA 3US5A 4A8YA 2AQ4A 2UU9F 2FD2A 1ULRA 2G0JA 4NE9C 4WXWA 1RWNB 1R8HA 4V1Ak 4ZA1A 4AL5A 4WP8A 2VFVA 4F04B 3V4IA 1HNWF 4C8KA 1NMEB 1WC5A 3G82B 1BQNB 4K5RA 2VICA 1HQEA 1VRTB 2V2KA 2IMOA 4DPUA 3M6XA 1WKKA 3FGVA 5HLFA 1NK8A 2J9EA 3W5ZA 2D7SA 3QT6A 2ZUAA 4C11B 2PSZA 4OZ3A 2O3DA 1HA1A 1WNEA 4FF1A 5D0HA 1RT3A 2A0FB 4WZMA 2OAUA 1FJGJ 1YVFA 2C3UA 3R5AA 2MQMA 1H98A 2KL8A 2QT7A 4G1IA 5KTQA 3HMJG 2C3MA 1U1MA 5EN1A 2HQFA 2QYGA 3CW2C 1VQ5S 2EC2A 3FDSA 2F4VJ 1VCTA 3BH7B 2EFQA 3M2UB 4CO2A 4QYZJ 3EICA 1H2UX 3W7BA 5DGAA 2J9CA 2IA0A 2CAJA 5MAOA 2E1CA 1KNZA 3P49B 2U1AA 3CO9A 2RF2B 1U8WA 5DDOC 3CNQP 1LWEA 3IG1B 3JSBA 2R2RA 1GK8A 3IMQJ 3QMQA 4PG6A 1WOOA 3OSNA 4K0KJ 4DL0C 4F4WA 1YGYA 1S9FA 4LFCF 1BQXA 1UTAA 2GAGC 1XR6A 5A8RA 1XNQJ 4ZVGA 4QWCA 4OHWA 3OUYA 2XLJA 2HVZA 1KC8T 2IVFB 2DPJA 4RX6A 1G2EA 1TTHB 1DARA 3R3TA 2C22A 2RHQB 2O01C 2YY3A 4JI5J 2HHHF 2CPXA 1YJRA 3AD8C 2X1FA 1UFKA 4H4OA 1G6BA 4P9SA 3M2UA 4ZVEA 5C25B 2QLJB 2VPWB 3UR0A 3TZXA 3QZ7A 4URSA 1WUUA 4NLDA 2M8HA 3KK2A 3G4SS 3M1VA 1RTDA 4NCAA 4DEZA 2FTRA 3T5KA 3NOCA 3SDEB 3AB2B 2YNIA 1S0MA 4Y2KA 5K8PA 1NK0A 2YNFB 1TVRA 3ICLA 1PJ6A 4M5DB 1EKSA 5H9EK 1JX4A 2HMIA 2PDAA 3JTOA 3QZ8A 3OL8A 4QR1A 4QJVA 4O3QA 2AD9A 1QSSA 2FVCA 2YPYA 4KKOB 2N4CA 3DLGA 5T7LA 4BBYA 3GQCA 4JI8J 2AJ2A 4Q5VA 3HHLD 4RBUA 4UQTA 2GO9A 2GMLA 4J9MA 1Q1KA 1GMVA 1SH3A 2BE7D 2NXUA 3GIJA 1UVMA 1Q5VA 3THTA 1PYOB 1QUPA 1YLXA 4J9QA 5HMXA 1TV6B 3BO3A 2JJ4D 1XNRJ 2MKSA 2WVCA 1SL2A 1TMJA 4JUZA 4EGLA 4CLLA 1U45A 4TU8A 1JLBA 2BM0A 1QAJA 1XMQJ 3VALA 1UETA 1VHIA 1ZAWA 1RHMB 2HWIA 3CDWA 3TA2A 3VR1A 3RYLA 2VFTA 3GILA 2F8HA 4AL6A 1KFDA 2EC0A 2HK2A 5ADZA 4LRAA 3A12A 5IWAJ 3TX0A 3PNIA 2W8KA 5LSOA 1L3VA 3ZTRA 2VDIA 1JKHA 4QIEA 4MJKA 4DG1A 3CC7S 3NBPB 5C42B 3RAMA 4DL5A 2OSRA 3TA0A 3GCWP 1ROFA 4BC9A 1YBTA 2JRSA 2QJ3A 2WTFA 1GH8A 3OTBA 1HIYA 1NJIT 3LAMA 1UW9A 3IS9A 2QX0A 2FHOB 2J9DE 3CCRS 1IBCB 2BANB 2YKAA 3ULHA 5GAEI 1S5ZA 5B0CA 4YHHF 3LPEA 2JEIA 3HHEA 4O4GA 1RTJA 3RB4A 4ILLA 2FJXA 1K44A 4ENOA 2QG9B 4RNFA 2VZ9A 4OMFG 2NXNA 3AOBA 4UZBA 2ZJPQ 4X62J 3UCZP 2MZQA 2XCPA 4Q8EA 3G9CA 1KN6A 2J0QD 2I1RA 4PYDA 4USJC 3DI6B 3CCQS 4X4VA 2CPHA 3G87A 1S4FA 3JTPA 1X31C 2EG2A 1FFSB 3PZPA 3M30A 4LJMA 1CULB 1LXNA 3OFEA 3K7RA 2IA6A 2CG4A 3BGRB 3RG6A 4ZLJA 2JVOA 3H40A 4WIQA 2NPFA 1ZZNA 4O3SA 3KHRA 1DBDA 3BBBA 3H5SA 5KAKA 2FHKA 2FVSA 4U9RA 3LUYA 3NAIA 5AXKA 1HWUA 2Y1JA 2VBZA 2IC3B 2L08A 3QPIA 3TP2A 2F7VA 2F40A 1WWHA 2CQDA 5A8WB 3J81j 2DNYA 1EX8A 1HKAA 3DOKA 3GIKA 2OMOA 2MEWA 3QQCD 3RRKA 4OHYA 2E7WA 3OR1A 1Q7LB 1RHKB 3GSIA 3I56S 4LSLB 2JLGA 4DF4A 1M5SA 4FXDA 4ED2A 1YX2A 4RNHA 3QJLA 2CNNB 2BJ7A 2HGMA 3CIMA 5IV4A 5F8MA 1MROB 1SQFA 2ACMA 4RO0A 3WX8A 2N7YA 2R7VA 1T9YA 2LEAA 3CD5A 2RRBA 5F8GA 4J9KA 1WC0A 1QTMA 1DTQB 2IRXA 4QPXA 5LJ5Y 2ZFHA 4IFYA 5DJBA 1C1CA 5IS2A 2ZKUA 2WBMA 3OXGA 1L3UA 1PSDA 2HAIA 2MGZA 5G4DA 4YFUA 1VHFA 4B9VA 1M1HA 4YOEA 3C14A 4IO1A 2OSQA 1SC4B 1X0PA 2Z56B 3GJSB 5LXRA 3HM9A 2V4JA 2R7RA 3UD4P 2G4BA 1N33J 5I3UB 3M6WA 5BYRA 3W9JA 3L9ZA 3V5RA 4PG7A 1WORA 4DV0J 1P1TA 2HHHJ 1HBUA 3BR8A 4OI2A 4UOFA 4KC5A 1HBOA 3ZTQA 3CJ4A 3DU6A 3HPOA 2LLZA 1U2RA 3AD9C 2XZWA 3KKFA 4DL6A 5CAAA 1QM9A 1T3NA 2IRUA 3TJAA 4L76A 1RAJA 2XHCA 5E33A 2HQGA 2MZRA 4JB8B 1NCLA 2P9CA 3CMQA 2FLLA 2FQQB 3IAS9 3OQ2A 3PFEA 4CIOA 1KQSR 2Q6CA 2MQNA 4U7UD 3E3XA 2VB6A 1TUWA 3M05A 1N0VC 3ZTPA 3V6HA 4V19J 3CMAS 2ZOGA 2NYHA 3G82A 3H90A 3B82A 2COLA 3HHLA 2QTWA 1T9TA 4P72A 5KG3A 1NNDA 3EDQB 2HNYA 4DV2J 2VC1A 1WEYA 4FYVB 3IS9B 1LOUA 4MK7A 1VBXA 2PI5A 1UCNA 3FQLA 3M6UA 4C8NA 4TYBA 4DPTA 1KVKA 1YITS 3MMCB 4DQQA 1HHSA 3NWGA 5GADI 3NS5A 2CVEA 1NHVA 4U7UK 5KG7A 1JLQA 3FBCA 1YHQS 4CO1A 2VA3A 2ASDA 4Y2AA 5KFMA 3ADAC 4LBIA 4NLPA 4K4ZA 1VQKS 1Y3KA 2BXJA 3MGJA 2GMHA 2G9OA 1LXJA 3Q83A 1KQFB 3LF0A 2FYXA 2V6AA 3QGIA 1UVIA 2EI5A 4RNNA 1RWOB 3BDPA 3PY8A 4C3LA 3OJUA 4B3MF 4USWA 3C46A 4TLQA 1F60B 2X51A 1JLCA 2VONA 2NZ4A 3ZC4A 3HFZB 5D0GA 3VAMA 3K5OA 5DETA 3MZIA 1IQZA 2GQCA 3BKFA 4HT5A 1S7HA 2RDJA 3K0JA 2XSJB 2CJYB 5ETSA 5IT4A 4HI1A 4B3OA 1KOOA 3OVSA 2OTJS 3H98A 2ZJRQ 2CQGA 3FRYA 4BHQA 2W2MP 3D2WA 3OW2R 1SL1A 2NQPA 3RUBL 2MLXA 2DNPA 1RJJA 4FYWB 1GTHA 3GTYX 3M8PB 5A0YA 4ZLPA 3TYTA 4AT1B 3CJQA 1WF2A 3DOLB 2QRRA 3MEKA 5RUBA 1DLOB 2C2ZB 2UUTA 2VG5B 3BN7A 3SSQA 3TEHB 1B0VA 2MLYA 2XNRA 4OQJA 3GIMA 1NK5A 1B7FA 4K59A 3W2VA 5JVHQ 2KTQA 1RISA 3CDAA 2XGQA 4Q2MA 1V5VA 5KFYA 2CQ4A 3KK2B 3IA0A 2CJXB 1SUQB 1N88A 2XTJP 1EP4A 1OMSA 2CQ3A 4I56A 4NLYA 3WDOA 4NA2A 3VAFA 4NLSA 2C2DA 2V4JB 3BKTA 4WJBA 4DWIA 4CDIA 3U02A 4E98A 4ZVTB 3ENQA 4OI3A 4WFBQ 3RR7A 1HLWA 1AXQA 3Q8SB 2YX7A 4KSEB 4MMOA 2MKHA 3BQ2A 4IYQA 1GMUA 2D3UA 3DRXA 2Y1IA 5AE3A 2W7OA 2PE8A 2BJ8A 1IWAA 2RS8A 5GMKa 2FJWA 1SJFA 1KONA 4A8WA 1U1RA 5KFBA 2BE9B 2XQCA 3T1HF 1TV6A 1S1VB 2FGCA 3MM8A 2J5AA 2ILYA 3DFEA 3WIVA 5CYQA 3G6XA 1FXLA 4C0HA 1A6LA 4H4KC 3SBMA 1N48A 2R7UA 3FFIB 2XYHB 5D4NA 5HI7A 2M70A 3C19A 2ZEJA 2B4PA 3SFUA 4ED5A 3ILLA 1NK7A 2FVRA 1T9VA 1C4CA 3UW1A 4ED0A 1A7GE 4UUXA 2HBRB 1ZBTA 1DTTB 1OY8A 4C8YA 3GFHA 4GVBA 4NWBA 2WSEC 2FJBB 2HNDA 5A8WA 2HZCA 3N28A 4CO5A 4C9DA 5IWAF 1PILA 1R3NA 3GV8B 4RW9B 1SKUB 2AYMA 3TQEA 2IJFA 2NLWA 2VV5A 4TNOA 5HBMA 4PG8A 3TI0A 4NEYA 2BM1A 3MR3A 2HFUA 2KXNB 4LRBA 2I38A 4ID5B 2F3JA 3I0RA 2C2KB 3J80Y 3CCZA 3C6TB 2WSCC 2YKNA 4ECYA 1XNRF 3DRSA 2VBYA 4M5IA 4Z7CA 3PCOB 3BPDA 3PR4A 2J8AA 3MUMP 4DLEA 3CJ2A 2UXBF 2QZ8A 1U8SA 2NSBA 2FC8A 3SV3A 2OEMA 1LWEB 3QNWB 3CC4S 2CIMA 1HNXJ 1WDTA 1OY6A 5KFOA 4KTQA 4FN5A 1DY3A 2VQEF 2RB7A 2QA1A 1JLAA 2CQCA 3DXBA 4G6VB 5KG2A 1FD2A 5H9EJ 2V2QA 1ZA2B 3T5JA 4QCLA 2HEKA 2WRMA 1OWXA 1JK9B 4Q7AA 3UR3C 3W5XA 3HSGA 1Z2ZA 1CQNA 3GG1A 3QGPA 2QO3A 4CYUA 1FDNA 1HMVB 2HFNA 3MECA 3TA1A 3GCXP 2D1CA 4DR2F 4JI4F 1RWPB 2JEFA 2LDIA 1G7CB 2KVQE 2MHEA 3M8PA 5A8KB 3LALA 4KHRA 4YB5A 3OSPA 2A10A 1UWAA 2B8QA 3GV7B 2PEBA 4WCEQ 4PWUA 3CJ0A 1UJ4A 3HK2A 1WF0A 3K8VA 2HHPA 1N5TA 3UFCX 1FJ7A 3FCVA 3I32A 1PJ7A 3AA8A 2OPRA 2QLFB 4MK8A 1Q81T 4D3GA 3MEGB 1EQMA 2V67A 2FHJA 4NA1A 4WBFA 3JAMU 4MKVA 2DH7A 1I6JA 1OPIA 3SCJE 1SJ4P 1H2VZ 3HJVA 4CLZA 4PXEA 3TZZA 5A6WA 4JI3J 3ISZA 1X5PA 4UT4A 4U7CA 3M8QA 3M8ZA 3ZZUA 4LSNB 5HN0A 5J1EB 5HP1B 1FJCA 1NSAA 1T7PA 2CA9A 3BB5A 5J2MB 1NB2A 1ZTWA 1RAGB 4Y28C 3OFGA 3DHXA 4A8OA 2A2DA 4NL5A 1RT5A 4KH0B 4TY8A 4BCAA 4DS4A 1JLQB 4FPRA 1F5BA 4WFNQ 2QA4G 5A8KA 3D3BJ 4DPWA 2RT3A 1CPZA 2MSSA 4GO7X 2XC9A 1CS4A 4F67A 3OVAA 2V0NA 1TL7B 4FKYA 4CYUB 3LW5C 4UQGA 4DV4F 3R5BA 1NJXA 2DNRA 1TZ0A 2PT0A 1WTBA 1NDCA 1QSYA 4WKRA 1FNMA 3JB9k 2M7SA 3CT9A 2DEIA 1J5EJ 4CP5A 2Y8YA 2QE5A 5ETNA 1GAOA 4DLGA 2P2CB 1FVQA 2D9OA 2Z8QA 3DRRB 4R8UA 2LA6A 3D6HB 2XMAA 4LIWA 4I69A 1VRUB 1RHJB 1FTRA 3R5JB 2NUUG 4KO0B 4LR9A 3CF5Q 4ECVA 1VISA 3KLGA 2CZ4A 2VKRA 5IXUA 4ZPCA 1Q53A 2YBVA 3WIUA 2FJEB 2IVYA 1V9OA 5E3CA 4EFAC 2UXCJ 2M2BA 1RAOA 2HNZA 3SQGA 4WZQA 3CDEA 4ECUA 3P5TL 1LWCB 1FD8A 5DQHA 3VAHA 2YKNB 2BABA 4LF2A 4TKTA 2F9JA 4DX8H 2N3LA 3EGWB 2QEXS 1S99A 4LUBA 2PMHA 3W65A 4B3RF 2GVZA 2K3KA 4DFMA 1F3VA 1IXKA 1SUQA 4TXSA 4Q45A 3K5PA 3I9V9 2R2TA 1TL5A 5ETPA 2OPQB 4JI5F 4GVLA 1N54B 4EU0A 3CUNA 4CO0A 1VQNS 2XMWA 3NOGA 3MTJA 3MM7B 1VJQA 2C2MB 4HEA9 4I1TA 2FDNA 4LFAJ 3VGUA 3V6KA 1ITPA 2M3DA 1T05A 4ZCKA 2KG0A 1UAWA 1FTCA 2M9KA 4GVBB 3SSSA 4DPYA 3T9NA 3GP9A 1D9DA 3IGNA 1M90T 3FJ2A 1J2VA 3C15B 3HVTA 5KT5A 1U49A 3VQTA 1EHWA 4DL7A 4FXVA 4N7TA 1NZAA 2Z2ZA 3IWNC 2EFNA 1U2CA 4JV5F 2HS4A 1TFWA 1TKXA 3M4XA 2WAQD 4ZJOA 2PA3A 3LP1B 5KFSA 1K8AT 1WG1A 1ICEB 3BS9A 4PQUB 3JSMA 1RBOB 2I8EA 2HWHA 1R89A 4G1PA 4C48A 1TELA 4YY3J 4O0IA 2HQ3A 4ELVA 4X4TA 4RUHA 4IRCA 2W25A 1P9YA 2GMJA 4J9RA 1BLUA 4B9UA 2CG8A 4X64F 2VG6A 3KLIB 3Q8RB 2NSCA 3FEXB 1MU2A 1GTEA 3OFHA 2DK2A 3MCOA 5M2PA 2Q3PA 2BEFA 2R3VA 4BS2A 2D69A 2GJFA 2YKOA 1PG5B 5HMYA 1J5OA 1NEEA 1XK8A 4DFKA 2HHTA 4RJVA 4OHXA 4PABA 1RAHB 1TQLA 1CSJA 4N47A 5L9NA 3CMES 4QWAA 2RDDA 2E5LF 2PO4A 1XR5A 5CZXA 4ETZA 3VWSA 3C2PA 4WYLA 4EEYA 4ZPAA 2HHSA 3TVYA 4U6PA 4DI6A 3I6PA 3W8GA 1HW8A 2LXUA 1VQ6S 1X8DA 4DCJB 5F9LA 1VRQC 2RILA 1NJZA 3H5XA 1NHUA 3M32B 4NMLA 4HR2A 1XC9A 1HBMA 3MI7X 1HI8A 1MMDA 1WHYA 2Y1LB 2RE1A 1TKTA 5CD4H 2DHHA 4X4PA 5J2QB 4F2SA 3M9NB 2XEXA 4HH1A 3S01A 2N82B 1HQUB 3DDKA 3M7VA 4DL2A 3EGVA 1TAUA 2DHSA 4I7FB 1VK8A 4ICLA 2J6SA 2RHSB 1X9MA 3OFFA 1DFDA 5DDPC 1DAXA 1SC3B 3DNCA 4DPXA 4DR7J 3NCRA 4P10A 1RBAA 1DQAA 1RTZA 2MXYA 1GX6A 2YNIB 3MFHA 3LA0A 3FVYA 4OV1A 2RIJA 3G71S 3UPFA 3QJPA 1G4CA 3NLCA 2ZHAA 1JKHB 4DG1B 1N32F 2HRUA 2J0WA 5LOQA 3T5HA 4CLUA 3PX4A 1TKDA 4J90A 4UY8T 4ECQA 2Q6BA 1KHVA 2E66A 2IMWP 3VAGA 1RZMA 4DR5F 1B70B 2ASYA 2B43A 1HYSB 4GKKJ 4LF6J 2OI2A 3A3NB 4OYIA 1X9SA 1LWCA 4WFXA 3RW6A 1ZM9A 1JMTA 2ROEA 1LW2A 4QR2A 1F2HA 1C0TB 2R8GA 1KDNA 2HAFA 2AEJA 1KLMB 3R97A 4AE5A 2QSWA 4ZS6A 3MAQA 1LFWA 2AJ0A 3HULA 4ECSA 4K8RA 2ZITA 1RSCA 3B8HA 2LU1A 3EUNA 4RW6B 1W2BR 1NK6A 1C2PA 4F4ZA 2KFZA 2QLXA 2HFZA 5ETLA 1S57A 5GAEU 3GV5B 2L41A 2BQ3A 3NGSA 3W63A 3MPDA 1S6PB 3GWCA 1XEZA 3MMAB 2XSFA 3MPUB 4DX6A 1HI1A 2C42A 2QLBB 4F26A 3PO5A 4FKXA 1WC6A 5KFWA 3CXCR 5KFIA 3QLHA 1T95A 3T1YJ 1N6QB 1RYRA 3QAUA 4ITSA 3VTIA 2ZZNA 1X5SA 2V2ZA 1NRKA 2VFSA 3GONA 1SJ1A 3MMBB 3OXFA 2HLTA 4I68A 1XMQF 3ZZYA 2WB1D 3L4BC 3FZBA 3NNAA 4EO8A 3BGRA 3LP0A 3HSDA 2IVMA 5ETRA 2AJ4A 3CCUS 1C4AA 3TRGA 1SL0A 1KQGB 4NYOA 2UV8A 1VK3A 2YQ3A 4JI0F 4TLRA 4DV6J 4J9PA 2BKPA 5D0EA 1Y9OA 2H5IB 1LW2B 2KXFA 1HI0P 3GFZA 3EVMA 2E44A 1IR0A 4USVA 2JEJA 1SC1B 1X4DA 1ZM3A 2RQMA 1F9EB 1NSQA 1WD6A 4L3NA 1E6YA 1VR6A 3LP2A 1FFGB 1N5YB 2FY1A 2W8LA 4X4UA 5D77A 4LFBJ 4W92B 4ZJLA 1RTJB 1FKPB 1BHNA 5M2RA 2YX1A 3KMSA 4CLTA 4ZPWR 1IKXB 3BQ0A 4EZ6A 3MCNA 2J7UA 2JX2A 5KFPA 1N56A 2QC3A 3M2VA 4RW4A 3W60A 2OPSA 4OYAA 4Q0BA 5HSPA 4P71A 2AKWB 1X4EA 2IM2A 1HBNB 3QO9B 2JC1A 3HKZD 3E8OA 4NEZA 3OT9A 4C0OC 5CYMA 4LQ3A 3R1HA 4OZJA 4PQUA 1FI4A 3PHEA 4TY8B 4DZ6A 2QGFB 4S0MA 2Y0BB 5KT4A 1U48A 1I5OB 1Q0NA 4TYAA 4CLSA 1HBMB 2XWYA 2MKYA 1M1GA 1SQEA 4MIAA 4JI1J 3ZTSA 2PD1A 5E3QA 5SUHA 5F9NA 2FLNA 3CJRA 1M5OC 3J7AN 4NX9A 4NLRA 1T03A 3CE8A 1W2IA 2F1FA 3AODA 3R27A 3HHLC 4C6AA 2ZH3A 3KFWX 4CM2A 1VJWA 2B4OA 1HBOB 5F8JA 2A3JA 4OX7A 4UOGA 1OPZA 2RRNA 5GVQA 2EXUA 4K4SA 1U2FA 4KFBB 3PJ9A 2MZ1A 4WFZA 3POTB 3NY0A 2BMBA 2F4VF 1H3DA 4A4JA 1L3SA 4K4UA 5IT0A 2VIHA 1R8CA 1YWXA 3FMBA 4LF7F 3D9BA 5K20B 1U6FA 3C6UA 3N6MA 3W3SA 3G96A 4ED4A 3QATA 4OZ2A 1Q16B 3R9LA 2W4DA 4LF1A 2PGCA 2DGSA 3MECB 2UXBJ 1FF2A 2ADCA 1R0CB 2XB2D 4PCQA 1S1WB 2WCXA 5KT6A 1B4SA 3MDFA 2AV5A 3IO1A 3KLVA 3KJFB 1EKRA 1I3OB 4DR7F 1KBRA 4G65A 4A47A 4Q8FA 4MKBA 4QYRA 2QL5B 3UDEA 1IKVB 4Q2LA 4UTGA 3FFIA 3W2WB 4RUCA 3ILJA 2G1HA 3C3LA 4PAAA 2Q66A 4KIAA 5K14A 4UW2A 4KR0B 3F73A 1HFEL 1RA6A 4J9VA 3F41A 4URGA 1NK9A 1M5HA 8RUCA 3GIIA 2XI2A 4X66F 4ERDA 5A8RB 5F8HA 2E5IA 1YIJS 3E01B 4I6YA 2ZH8A 2KYXA 5E5NA 1T05B 2CQ2A 3NMRA 1RDRA 3HZEA 1FWKA 1JLEA 2BRKA 2VFRA 4RW8B 3PIOQ 4DL3A 1YJ7A 3HDSA 1Z1ZA 1ACMB 1JLGB 2H65B 5BJRA 2P5VA 1A0OB 4USIA 1R31A 3LP0B 1U02A 1XERA 2KN4A 1W25A 3Q24A 1QE1B 1NHKL 2HHVA 4OLOA 2XWXA 2VPZB 3L3CA 1DURA 4O0NA 4ZN3A 2E5JA 3FSXA 4KKOA 4GO5X 3PR5B 2E7XA 1IKYA 2V8HA 2ZH4A 4K5SA 4TY9A 4Y2CA 1AB8A 1RT6A 3WZ0A 5GAGI 4IR9A 2EBGA 2JEGA 4RNOA 1PBAA 2UZAA 3MF5A 3GE9A 4DZDA 3UVJA 2BJ3A 3DOLA 3K17A 2UUWA 3PYDA 4NLTA 2IBKA 1HD0A 4IKAA 4KO0A 4C11A 1N5SA 1IN0A 4YN3B 2ZH2A 2NXCA 3DGVA 2DCLA 1NAQA 1NM2A 1Y0HA 3KG4A 1T11A 4F0HA 5FJ4A 3H5UA 5L9XA 2ZD1B 2F8EX 2YWWA 4OI6A 1BY9A 2WW4A 5GAGU 3PEJA 4I64A 4HDHA 2E29A 1S9GA 4DF8A 1JNZB 1JXEA 2WVEA 4PG4A 3MM8B 1S1VA 1S10A 4Y6IA 3CJKA 1L3TA 1UVLA 1JJ4A 3R2CJ 3X3UA 4IUFA 1VLOA 4H4MB 4LF8F 5D0RA 4YB1P 1S1XB 3DLHA 3GMGA 1DJ0A 3MEEB 3C8YA 3HVWA 1XQIA 3MMJA 2CQ1A 1HHTP 2OH2A 1U24A 3BQ1A 1SVDA 3EZ5A 4RU2A 1MWQA 1HWLA 3G8QA 4A8QA 4DR1J 1CJTA 2RQ4A 2BQUA 1N5YA 4IOCQ 1N5VA 3CCJS 2UXCF 3PW0A 1WACA 1HD1A 3M8QB 3O6QA 1CULA 2PEHA 1SI9A 3MFIA 1GEHA 2GA7A 3MPYA 3D1QA 3NAHA 2HGNA 2MZSA 3W2VB 5LSLA 5EWFA 2AGOA 1FKOA 1N33F 1FHTA 3UE2A 5H1SV 1HNZF 4ZVQB 3KMQA 4I67A 3B4DA 4AQYF 1HNZJ 4M5MA 2BVZA 2DNLA 3IXQA 5E3PA 2H51B 2RQCA 3D5MA 3DGPA 1WSVA 2IM0A 1LV5A 1RGVA 3SCIE 1UZDA 2FVQA 3OTEA 4K7QA 2XI3A 3QFWA 1YJNS 4PWDA 4N56A 3DCAA 4ELUA 4KRWA 2V4RA 2UUBF 2GFFA 3HVTB 1VQOS 2AYEA 1RQ0A 2B9WA 2CUYA 2MQLA 2V5HG 2YWFA 1SCJB 3F0NA 3HHNB 2AJQA 4J9OA 4IDKB 4IG0B 3B78A 2R7TA 1P8GA 3MD1A 1AA1B 1F5AA 4P75A 4QPTA 2GAHC 4DR3F 4RW4B 1DTTA 2QMWA 2Y9HA 1DQ8A 4A8MP 3CJ8A 4WWSA 4C98A 1VFJA 2OFGX 1RADB 3CDBA 4CH7A 2ZE2B 1FNXH 1JIHA 1TL3A 1TUGB 2FJDB 4O3PA 1YBAA 4CCHA 1FE0A 2CKWA 4IH5A 4Y2IA 3UDLA 3S8SA 3KHGA 4JI3F 2B8PA 3R7SB 1JXLA 3ENAA 4JV5J 2HG4A 3G2XA 3PJXA 4YS2A 5HQMA 2HWTA 2PA8D 2VBWA 2RKIB 1SIWB 5EHHA 5KFDA 3I4HX 4DUZJ 1JLFB 1YG0A 3KG1A 3O1LA 3IM9A 4TU9A 4CRJA 4LSZB 4NLUA 2BJDA 3PHTA 4FYXB 2BW7A 1Q8IA 1LEOA 4CLKA 2BA9A 1FRHA 1FVSA 2XMMA 4G1QB 3T6BA 2UVVA 1LNQA 4NCBA 2JFDA 1F0XA 1S9GB 3I55S 1UW4A 2AZ3A 2JLEA 2HLUA 4Y2MA 4DUTA 3KK1A 2C2RA 2JWNA 4OIXA 1FK9A 4YHHJ 4DSEA 3H20A 1P1LA 3T6JA 2HVIA 1S1UA 2YKMB 3K2YA 4OYWA 5EWEA 3OL6A 1NK4A 1RWVB 5H9FK 2HVHA 3L09A 2N7CA 5CQGA 3SYZA 5GAHU 4QOTA 1KD1T 2R4FA 3DOMA 3D6TB 1IWGA 1S1WA 3GFYA 4MK9A 5L46A 1SH2A 3D28A 3KLFB 2KG1A 3SV4A 2Z2MA 2GHVC 2JC0A 5JVGQ 1CS4B 2ZH9A 5F0UA 3V6DB 2E9ZA 5ETVA 2QMXA 1UVNA 3D0IE 4BDPA 5AE1A 4E2FB 5ETQA 4D3HA 2J7WA 2GS8A 1NSPA 3KWMA 4IH6A 1S0NA 2OIHA 2ZBQA 3UN2A 3A8JA 3BGLA 1RCXB 5JMNA 1RWWB 1KP6A 3M2RB 3RGIA 2DR6A 2XMTA 3DGPB 2DNKA 3KLHB 1Q8KA 5C24B 2QFIA 4USHA 5IM0A 2OP5A 2V63A 2E1PA 1HHQA 1LWXA 1C0TA 1TL1A 2VJUA 1FKOB 2X1AA 4OX6A 2V8PA 2I5JB 5ETOA 3TW0A 1NB7A 4M94A 4I0WA 3N01A 4OI1A 5DQIA 2EW9A 3DRRA 4R8UB 4WFAQ 4IO9Q 3HO1A 2CDQA 1MROA 2JOQA 2MJUA 4F50A 2EBEA 3NGRA 2RDIA 2CQIA 3TQ1A 1VQ7S 1X4FA 3GIRA 1WHXA 3TUPA 3KK3B 2BANA 4MKAA 4JI6J 3NGKA 3LOUA 1X60A 2IM3A 3HI9A 4Q44A 3KJNB 4Y65A 1XR7A 1NH7A 1N8RT 2MQ8A 4L3KA 3TWZA 4IG0A 4B9LA 2MKIA 2CZVC 1CQMA 1S6QA 4ES3A 4ICLB 1VQ9S 1FEEA 3V2UC 1R6YA 3OTDA 1AW0A 2IBOA 4HACA 3DLLQ 1HARA 2RMLA 2DRDA 4LR8A 2KT5A 1RAAB 4KQZA 2EVZA 1EZZB 3SSRA 5C7PA 4P2XA 4ECTA 1F9FA 1JJHA 5KFTA 3QIPB 3R7BB 2CJAA 2FJVA 1BQNA 1QSLA 2VDHA 4ILRA 2A1BA 3MAAB 3Q8UA 3OJSA 1JLBB 3VV2B 4K4YA 1NSKL 2VASA 1L5UA 1SJRA 1FA0A 3KJVB 2VC0A 3D6FB 1IBLJ 3W8PA 2DITA 1Y5IB 1ZZFA 4ED3A 1M5KC 5HMZA 5IM0B 2CPFA 1RT2B 3DRSB 2QMUB 8AT1B 3NGDA 1UVKA 2X7IA 3AQPA 2P9EA 1FE4A 4ECXA 3A13A 3FNNA 2FLOA 2MPUA 4ECWA 4N5SA 2EKNA 3KHLA 1UJ5A 2O66A 2UUCJ 2DNNA 5D4PA 4DQSA 4DOZA 4M5GA 3GR1A 4P52A 1RT4B 2J8SA 5GADU 3KG0A 4F4YA 1YK9A 2DR7A 3RAQA 2VG6B 1CJKA 3NGUA 5DLGA 4PQAA 2VQFF 4DUYF 2MLZA 3DRYA 2ALYB 3LO3A 5B7WA 3E01A 2BX6A 5FLXY 4FVMA 1WI6A 4EO6A 1ZA1B 3KLFA 2PC6A 2P6SA 3DRPB 4FYYB 4Z2XA 1BD6A 2ZUGA 2D9PA 5DM7Q 2AIRB 2O5DA 2OEJA 3RRGA 1QVFR 2SXLA 2CFXA 2EFGA 2GVDA 2QLWA 1IR2A 3CO0P 2ZH1A 1T9WA 3BV8A 2MQOA 2ZH6A 1Q7YT 2G0CA 3JS9A 2B4UA 1IKWB 1FK9B 1ZAVA 2GQQA 5KFXA 3VVTA 1QAIA 1QUVA 5HK4A 4J5OA 4FF3A 3MR2A 2DB1A 4DR6F 3BGFA 1NDKA 4C2MA 3AHPA 4PR6A 1UPPA 3A8EA 4RUBA 3MM7A 4R0JA 4M5JA 3I5CA 1HBUB 1VYAA 1HL6A 1ZAXA 3AJDA 1X9WA 4WPAA 4DXLA 1VBYA 4IQXA 3D1OA 2KM8C 2CPZA 2ASLA 4FF2A 2F9DA 2MY8A 3UDCA 4YMEA 3EVWA 4LSNA 4OYMA 2DGTA 5KFUA 4CZCA 4KFBA 5J1EA 1TU0B 2AT1B 2BRLA 2BW2A 1UPMB 2IDEA 3A3OB 3M8YA 3Q8QB 3GG0A 1F5CA 2DHGA 3OTCA 2DRBA 2AGPA 4KGMA 3J7ZT 2V94A 3AXMA 1RAFB 4N8OA 1RTIB 1LKZA 2U2FA 4I2PA 1WELA 4B3TJ 2ALZA 4R5PB 3NP5A 1FRXA 4LF7J 4ECRA 3QIPA 3SFGA 4ED1A 2YX4A 2O1PA 3N0VA 7FD1A 3KXDA 1SXLA 2UUCF 4K4TA 2ZH7A 2E5GA 2ZDPA 4QIVA 2NZCA 4CM0A 2V68A 3I0SA 3CEDA 3QGHA 4ZVSB 2KZZA 3OUYB 2C2EA 2LQ8A 3AAWB 3I96A 4Q0BB 2XULA 2DO4A 2WBRA 4R25A 3BM7A 4ZIVA 5BYSA 3ETOA 1Q79A 1VIOA 2DXDA 3IG1A 3UD5A 3ZFVA 4BC7A 5CHCB 4CT8A 1M0SA 3HT3A 1VBZA 3TARA 5HJYA 3T19A 3E2EA 4O3RA 2YNHA 3ETMA 4HDGA 1Y3JA 3TAQA 1NPRA 2A6OA 1F6TA 2WONB 4FNHA 1U47A 3TAMB 5CA5A 1TK0A 5BR8F 2ZE2A 3EXCX 5K9FA 3MHYA 1FRMA 4M5HA 4ZLNA 6FDRA 4B3SF 4NXMJ 4CH1A 3I5AA 2I5JA 3H7HB 3BO4A 1XIQA 2R8IA 1KS2A 2CWXA 2MSTA 4ZK7M 5LSRA 1PGZA 1EB0A 3KJVA 4ZVFA 4X4OA 3RTVA 5D4LA 2FVPA 1RT3B 2ZJQQ 2R7SA 1KEKA 5F3ZA 4X2BA 1T9UA 2XZTB 1HQUA 3NMAA 1PO6A 2IFXA 4OZ1A 4AL7A 1TKXB 3X1LB 5LMNJ 2B3TB 1SKSA 1YDLA 2LQ5A 4DR6J 3ZNUA 2LXIA 3PYGA 2FIUA 5AT1B 3BR9A 4EZ9A 3W9IA 1U0HB 3M6VA 1HNVB 3Q8PB 4RPFA 3A4TA 4J9UE 3QRRA 4K50A 2QL7B 1S9EB 3SEOA 2OTLS 1YBUA 3I9ZA 3MAHA 2XZDB 2OUGA 5D15A 2H5JB 1Y11A 4HHHA 1YJVA 2E5HA 2ZKTA 1ZPVA 5IZHA 3CCES 2ZM6F 5D3GB 2NUHA 3LQVA 5IC4B 4HTIA 4FYDA 4E8UA 4HT7A 4J91A 1AYEA 1OYDA 1PYSB 2DR8A 5L1IA 1J5OB 3MD3A 2XMUA 3T3FA 2MZJA 3JQMA 1BXNA 1PAEX 4WU2A 4F7VA 1UZHA 1OYEA 2I9SA 1QLNA 4KHPF 2LP4A 3EDRB 3MWBA 3BSCA 3QT8A 4JOUA 4WE1B 4X62F 3DHWC 4M8LA
chains in the Genus database with same CATH topology
2G1DA 2UVRA 1CC8A 1TK5A 5EWGA 2VA2A 4ILMA 1S79A 3QWPA 4OJHA 4O3NA 1REVB 2YWGA 2Q43A 4CO3A 2E9RX 1S0OA 3BZQA 2R2UA 2EFPA 2LEBA 5HQ8A 3NKYA 3CTRA 3G86A 2AYBA 1URNA 4M5DA 1V3SA 1UEUA 4KB7A 5L8RC 4HVZA 4F25A 3CCTA 2ADBA 4F4KA 2IHR1 2CQPA 4PUOA 4LF6F 2PFFB 2BACA 5EGYA 4B9SA 4OI4A 1D9FA 2AWZA 1S1UB 2YKMA 3I4PA 1UVJA 2XMKA 5L1LA 3ITHA 2R2SA 4DV3F 2RU3A 4XPEA 4DFJA 4ED8A 2ROPA 2YWHA 3LAKA 4FBTA 4MAKA 4GKJF 1YRTA 4C97A 3QIDA 3CJ3A 2KKHA 2MJNA 1VS3A 4X4QA 1NJYA 4OX8A 4YEAA 5H9FJ 2RKIA 2ZNYA 4TN2A 4QWBA 2BQRA 3P3DA 2NPIA 1YRXA 3T1YF 3MPWA 3ENVA 4FZVA 3EXYA 5DS7A 2GHPA 1VQSA 1WF1A 3DLEB 4XDCA 1NKCA 2K7KA 4C3MA 3PM9A 4PPDA 2JFKA 3U7JA 5FDLB 2VL1A 1FESA 1XBWA 3NBPA 3SCLE 1NJWA 1IJFB 1KRPA 3U1LA 2VUGA 1UWBA 4DR1F 2RNEA 3VCDA 3BO2A 2OKQA 5E3RA 2DPIA 1GQEA 2ASJA 1WG4A 3SCKE 4NLGA 2W24A 4YQWA 1LFPA 2VH7A 4K4XA 4DBQA 2M0GB 4XPCA 1FXDA 3DMJA 5KG5A 1R0AA 3VZHA 4OJ3A 6FD1A 1ZYQA 4C8OA 1S1TA 3GFXA 4DV2F 5KG0A 1IUJA 4J9LA 4IG3B 1VMBA 1RT7B 1PC4A 2W9AA 5KFZA 3S1TA 5B0DA 2ZVSA 4Y34A 3OL7A 2HW3A 3AJ2A 4YR0A 3RAXA 3HVRA 4GKKF 4HL9A 2MZTA 3MCSA 1KHWA 2C28A 3G6VA 2VPXB 4ZPVR 2HPUA 2CPIA 3GB0A 4ZDNA 3OLAA 3HX9A 3IBWA 3MM6B 2VODA 2HHWA 3PW4A 2ABYA 2OLWA 5KFJA 3GZ7A 3TUIC 3FEYB 4RLEA 3CULA 2GIQA 5HROA 4KGKA 4JI8F 3TOQA 3IWLA 3UCUP 2WK4A 2AW0A 3IR7B 2HS0A 5EX0A 2R8HA 2EPIA 4ZVHA 4JI7F 1OQ6A 1OSCA 5M2UA 1I1GA 4PXDA 4A8KA 1HNIB 1WEXA 4P7VA 3G8TA 1HW9A 1UMJA 3IRXB 4WYWA 1FT8A 2QSFA 5D6GA 3ITHB 4ID5A 1J5EF 1OIAA 3I82A 2DNMA 4L6V3 3FRZA 4DHVA 3OHAA 1H2TZ 3WBZA 2BUNA 4IFVB 3DLJA 1IJEB 2CQBA 2QA2A 3N5BA 2MKJA 5HP1A 4URQU 2RQKA 3JB9k 3GYNA 2R7VA 3M30B 1Q82T 4KV8B 1H7XA 2HNZB 3SQGB 4ES1A 4DN9A 4BWMA 3NRBA 2RU9A 1QY7A 4JBCA 5KFVA 3ENWA 1IBMF 1SB6A 2GHWA 2KB2A 4ED6A 4WFYA 2M8DB 4E0DA 4MFBA 2IYIA 4MIBA 5FIIA 4LF5F 2KT3A 2XBPA 1JX4A 3LANA 5K14B 3AJ1A 3OTOF 3G6YA 1IKWA 1KOHA 5FD1A 4DS5A 7FDRA 2XCAA 4CNZA 4CH0S 5J2PA 1R7IA 2B7BB 3AB4B 4F4XA 3N9UC 2H5EA 2UUAF 4PXBA 4G1QA 3OV7A 2XY7A 4OZ5A 3CCSS 2XGPA 2AJFE 3M8SA 1FJGF 3MR5A 2GNKA 3KLEA 1VQ8S 1YTYA 1LW0B 1P27B 3NNHA 1JLAB 1N0UA 1N36F 1UKUA 2DGQA 4MKYA 4ZHRA 3DM2A 3BEGB 4X4SA 2X3GA 4KBIA 1TL3B 2DGOA 3TX8A 5LMNF 1SKWA 4AUKA 4DSJA 1CEZA 4TQSA 3OLBA 2QYCA 2VFUA 1VC5A 3R1LA 4A8SA 3RBDA 2DVIA 3CD0A 1KVIA 4OJ1A 1VQLS 4DN0A 4H4KA 5A6PA 3LWLA 3QGGA 1ZM2A 2B9XA 1FJEB 1GXTA 3BSOA 4JI6F 4WF9Q 1S77D 2VBXA 4I7FA 3M2RA 1GXUA 2GGPA 3E51A 5B0AA 5KFQA 2OFHX 3CC2S 1AUDA 4OZNA 2RH3A 5J1PA 4NCGA 3DLGB 5T7LB 4UUWA 3Q23A 1HQEB 1VRTA 2A18A 1RTHA 1N6QA 2OPPA 4C0BA 3CDUA 1VI7A 2W9CA 4RBTA 5KFKA 2HMIB 3K5NA 2DHXA 5SZTA 2LQ9A 1MMLA 1D8YA 3AA9A 2GQ2A 5KFRA 5KG1A 3DLKA 4XIUA 2LCWA 1K0TA 4PXCA 4RU9A 2R7WA 5DGBA 4DV5F 5DQGA 4IFVA 4CNYA 4O44A 5KFHA 3K59A 2LDYA 1B64A 3HZGA 4C8MA 3R5CA 1MSWD 4F8RA 4YDXA 1MU2B 1JLGA 2RVJA 4KJIA 3H5YA 1D3WA 5BYQA 1U26A 1TR0A 3Q22A 4NPOA 5CH7B 2L9DA 2IM1A 4RW7A 1KTQA 5K8MA 1X5TA 4F3OA 4LFAF 4EUVA 2GC8A 1VRUA 1H6KX 3PW5A 3MEDA 2HQIA 4YR2A 4ELTA 4C8ZA 5F8NA 1HYSA 1HR0F 5J2PB 1UEVA 1D9AA 2AGQA 4GMKA 4QR0A 1RP5A 3I5BA 3MMBA 4P6QA 3RB0A 2XMJA 2DJWA 3S7RA 4EWTA 4C8LA 4R5PA 2KZMA 1FERA 1XTZA 3QLHB 3FSYA 2VG7B 2VG5A 1G1XA 2HNDB 2DHAA 4RBVA 5E3AA 5LL6d 4XAKA 4DUZF 2WOMA 1KQKA 2OMLA 3PEHA 2CPEA 4RNMA 3J81Y 2BOPA 4KAIA 2DO0A 1RT5B 4ZCLA 4DL4A 1OQ3A 3L7PA 4FNIA 4B3OB 4WIIA 3K5MA 4NYZA 5L1JA 4F3MA 3PFOA 2MQPA 3WC2A 1BC6A 2MHNA 3IAM9 2LKZA 5K5MA 4FS1A 3MEDB 5U47A 4K2XA 5DG7A 1S72S 3FCHA 4DSLA 1VQPS 3MEGA 3LGMA 1JLFA 1EETB 2J6TA 4LIRA 2AX0A 3THVA 1LQ9A 4DV6F 1CLFA 2YKQA 3K58A 2EKYA 3LGNA 3FSIA 1IKVA 1WEZA 3W2WA 3IN5A 4HH0A 2BZ2A 4NLVA 4Y0FA 4DV1F 1Y00A 3PV8A 5HL7Q 1HBNA 3QO9A 3DLKB 4B17A 3RR8A 2KU7A 4YR3A 2KHDA 3CD7A 4MYUA 2KM8B 1Q8LA 2I0XA 1U09A 3BSAA 4CI0B 4ZCMA 3DYAA 2L9WA 1N52B 3K57A 2L48A 3CB4A 4N8NA 2OPPB 4RWWA 5GAHI 1APSA 3CD6S 2D3OR 2HIQA 4NOHA 3U1MA 3PVXA 2DNGA 2GW8A 3I31A 5HLFB 1YJTA 3JYTB 1VC6A 1JB0C 3RW7A 5L1KA 2BR0A 4I2PB 1RT1B 1V3ZA 2B9YA 1KTVA 5F8IA 2AX1A 4MTPA 3SZ2A 3EPIA 5KFGA 4QWEA 4HLBA 5KT7A 4WK3A 2A2CA 5C24A 2NREA 2E1AA 2JL9A 3I0RB 5HMWA 2DIVA 3C66A 1SV5A 1UL3A 4LT6A 1D8ZA 4I6WA 5J1NA 4WTYA 3NCQA 1FRKA 1ZPWX 2AYGA 4P2SA 2OD6A 2HRYA 4H54A 2ZH5A 2K3IA 2KRRA 3H2LA 2YNHB 4CQ1A 4IOBA 1CG2A 3V81A 3QYYA 1LW0A 4NRTA 4QIGA 2XG8A 2YNGA 4X65F 4NRUA 2WOMB 1HNIA 1X4AA 1QAXA 2L9NA 4J37A 1S1XA 2BE2B 5F41A 1HMVA 1V3RA 2VG7A 4H4MA 4QIWD 3M2VB 1DTQA 1U6ZA 1S6OA 2B56A 3HHDA 2MMYA 5MLCV 1FXRA 3OPKA 2LECA 5CZVA 5T14A 4A8FA 2WHOA 2RRAA 1M5VC 3K8WA 3MM9B 5E7OB 3FMWA 2POKA 3DU5A 1U1QA 2H9ZA 2D41A 5AE2A 1A9NB 1LK7A 3M9MB 1FRLA 1EETA 1KLMA 1Z4UA 1FDAA 1VQMS 4DDFA 2E9TA 1B0TA 4ZPTR 2B0GA 5AXMA 3U27A 3WX4A 3O5TB 1U1KA 4KV8A 2YNGB 2RF2A 3H4DA 4G3IA 2KFYA 3D54A 2B6AB 2XLKA 4FXWA 2J76E 2JDJA 3KNGA 4OLPA 5J2MA 1ZTTA 4F3QA 3ZZTA 4ZOSA 2GX8A 1VQYA 5G0RA 4OX9F 4NLXA 3Q2TC 1DHMA 5D3GA 1XN9A 2GO8A 3FQKA<