2U1AA

Rna binding domain 2 of human u1a protein, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
88
structure length
88
Chain Sequence
MAPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Tertiary structure of RBD2 and backbone dynamics of RBD1 and RBD2 of the human U1A protein determined by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 1997-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2u1aA00
1YTYA 2KXNB 2FPHX 3THPA 3MOJB 2LYVA 5GAHU 2DNZA 1A9NB 1UAWA 3S7RA 1KQSR 2ERRA 1SXLA 1M5OC 1JJ4A 5IM0B 1P27B 3CC4S 4U67Q 2RS8A 3Q2SC 4WCEQ 2E5HA 3MI7X 2MKKA 1VQ9S 1FNXH 1H6KX 1M5KC 2M7SA 4W90B 2LMIA 2BOPA 2M0GB 1WF0A 2DHGA 1HA1A 2CPDA 3CUNA 3P5TL 2M2BA 4CQ1A 2LA4A 1KC8T 2DHSA 4PR6A 4YOEA 2KYXA 1Q81T 2N3OA 3NMRA 2ZJRQ 4TU9A 1FJ7A 3CCJS 5DETA 5LXYA 4F25A 2MJUA 5EN1A 5DM7Q 2DGTA 2E44A 2DNNA 5GAEU 1CVJA 5LJ3Y 3G8SA 1B7FA 2AYEA 2SXLA 2UP1A 3J7YU 1U1KA 2MQLA 5JVHQ 4PKDB 2FY1A 2HGMA 1O0PA 2N82B 2LA6A 1BY9A 3CCUS 2MKIA 1X4FA 1M5PC 2LEBA 1S79A 2V94A 1D8ZA 2MB0B 2DISA 2DNHA 2G1DA 4TU8A 1F9FA 2FHOB 2YTCA 2JX2A 4C4WA 1X5OA 4CH0S 2MKJA 2X1AA 1FO1A 2MKCA 1S72S 1X5SA 2M70A 2EVZA 5CA5A 4WIIA 2M52A 2DNPA 2OSQA 3TO8A 5D77A 2QA4S 2CPZA 2CQDA 2RQCA 2YKAA 5BJRA 3HHNB 5GAGU 1M90T 2ADBA 1DZ5A 1U1QA 2YWKA 2ZJQQ 2YH0A 1VQMS 2KG1A 2JRSA 3NNCA 2J76E 3CC2S 3H2UB 2MKHA 3SXLA 2MY8A 1R8PA 1OO0B 3S8SA 2DGQA 2DB1A 4OZ1A 2RU3A 2ADCA 1X4DA 1PGZA 2AYMA 3VAMA 2QEXS 2MYFA 5DDOC 3ULHA 2AD9A 3B4MA 1WF1A 2LEAA 2K8GA 2I2YA 2OIHA 1FJEB 2HGLA 1WHVA 2CQ3A 3R1HA 3MXHP 2LKZA 1UW4A 1ZZFA 5IQQA 1U1MA 2X1BA 1U6BA 3VALA 5MLCV 2CPFA 3CCLS 1VQPS 1P1TA 4Y00A 3CCMS 4CIOA 2E5IA 2DH9A 2DNKA 2MKSA 2KVIA 3EGNA 4A8XA 1WELA 3IRWP 3NS5A 3ZZZA 2L9WA 4WKRA 1WWHA 1YJWS 5D78A 1M5VC 3FEYB 3DLLQ 1Q82T 1WEZA 2L41A 2MZQA 5GADU 2CPIA 2OSRA 3UWTA 1RKJA 1U1OA 4TU7A 3DXBA 1XN9A 3CCRS 1K9MT 3FEXB 1YHQS 1NU4A 3UD4P 3CULA 4TLQA 2KU7A 2CPHA 3TYTA 1QVGR 3Q2TC 1IQTA 3L3CA 2DNGA 2DNYA 3H2VE 4LJMA 2MQQA 2JWNA 1X4CA 3RW7A 2DHXA 1H2UX 2RUGA 2CQ0A 2OTLS 1VQNS 1WHXA 3CXCR 5CXTA 4QPTA 2KM8B 1KD1T 1Q7YT 2MSSA 3NNAA 1H2TZ 1FHTA 3CTRA 3SDEB 1UFWA 3R1LA 5ITHA 1U1LA 2CPXA 5GMKa 2DGVA 4QU7A 2XS2A 2HYIB 2MSTA 2MQNA 2RT3A 1WEXA 2M4MA 1X4HA 4IUFA 2MZSA 2LQ5A 1NO8A 2GO9A 1VQKS 5DDQC 1YJ9S 3LQVA 2LCWA 1N88A 2PE8A 2RQ4A 2O3DA 3K0JA 2CQ4A 2CQCA 2E5GA 2KRBA 2VODA 5HL7Q 2F3JA 5IM0A 2MMYA 3RW6A 1A7GE 1KOHA 3I56S 2X1FA 2XNQA 2XB2D 2CPYA 2DK2A 2CQ2A 2DGSA 2GHPA 2L08A 2MXYA 3B4DA 3CCSS 2MY7A 3BO4A 1VBYA 1UP1A 3MD1A 1N54B 1WEYA 3OW2R 2AYGA 1PO6A 1VC6A 3N9UC 3MUTP 1X5PA 1AUDA 1SJRA 3CCQS 1WI8A 2LECA 2DO0A 2ZJPQ 3HI9A 2MZTA 4YB1P 2KI2A 1OIAA 1VBZA 3THTA 1JJHA 4ED5A 3BO2A 3U1LA 5DDPC 2VONA 3MDFA 4WF9Q 2LXIA 1U1PA 2KG0A 2XS5A 2J0QD 3PIPQ 2VOPA 3LPYA 2CQIA 3BO3A 2DIUA 1QVFR 3UD3P 1WI6A 5LXRA 2MGZA 2N3LA 2DNQA 1HD0A 2NZ4A 1D9AA 2M88A 1DHMA 3VAJA 3MUMP 1VQ6S 2A3JA 2DO4A 3MUVP 3G71S 1U1RA 5LSOA 3VAGA 3U1MA 2G0CA 2HZCA 2MZRA 2CPJA 3G6ES 3CPWR 2WBRA 1WHYA 2DGXA 2CQPA 4Z2XA 1SJ4P 1Q86T 3CF5Q 1VQ4S 2X1GA 1WG4A 1DRZA 4IOAQ 2B0GA 5GVQA 1N8RT 3CCVS 2XNRA 2DGWA 4J5OA 1OPIA 5DDRC 3PIOQ 1YITS 3MURP 1X0FA 1FXLA 1FT8A 1SJFA 4EGLA 1VC5A 2KN4A 2J8AA 4C0OC 3ZZYA 2LXUA 2MJNA 2DHAA 3UCZP 2KHCA 2CQBA 1U1NA 3P6YC 2XSFA 2MQMA 1K8AT 2D9PA 2KRRA 4FXWA 2K3KA 5FJ4A 3I55S 1WHWA 1K73T 2U2FA 1VBXA 2CQ1A 1ZZNA 2DGOA 4PRFA 4F02A 1WTBA 3NS6A 3S6EA 2FC9A 1YIJS 2F9JA 2MZJA 1YJNS 2CJKA 2OJ3A 2XS7A 4UQTA 4ZKAA 2KXHA 1NJIT 3IWNC 2EK6A 3CCES 2AYBA 3VAIA 5JVGQ 3UCGA 1VQ8S 4IOCQ 1WG1A 2M9KA 3G8TA 2RRBA 4LMZA 1N52B 2D9OA 2KM8C 2F9DA 2KT5A 1VQLS 3UCUP 4M5DB 2DH8A 3G4SS 3BEGB 1URNA 1OWXA 1SJQA 3J7ZT 2J0SD 3S01A 3G96A 2DNLA 5H1SV 3G9CA 1FJCA 4FXVA 2MPUA 2DNOA 2QFJA 2VOOA 4LIRA 2BZ2A 1R8HA 2E5JA 2YH1A 2CQHA 4QQBA 2MHNA 2KFYA 2RS2A 4Y0FA 2MGZB 1JJ2R 1U6FA 1WG5A 2CPEA 5HO4A 3V4MA 3CMAS 1H2VZ 1VQ5S 2KXFA 2FC8A 2HVZA 1W2BR 4ERDA 2G4BA 4V19X 2JVOA 1HD1A 3SDEA 3CD6S 3VF0B 1VQ7S 5IFMA 3UE2A 1YWXA 1KOOA 5LSLA 2DH7A 2HGNA 1X4EA 1X4BA 2N7CA 4P6QA 3CC7S 2RRAA 1M1KT 5DM6Q 3SMZA 3EX7B 4BS2A 1JMTA 3EGZA 2U1AA 2MQOA 3VAHA 4QU6A 2NLWA 4YUDA 3US5A 3VAKA 4WFBQ 2OTJS 2RVJA 3JB9k 2EK1A 2CQGA 4WFNQ 2I38A 4WFAQ 4F26A 2MQPA 1YI2S 2RNEA 4C7QA 2DNRA 1VQOS 3R27A 1G2EA 1WF2A 1X5TA 4W92B 3P3DA 1RK8A 1X4AA 2DITA 3VAFA 2DIVA 3TP2A 5CYJA 1QM9A 1ZH5A 1HL6A 3MD3A 2DNMA 1SJ3P 2MZ1A 4UY8T 3NNHA 1L3KA 2JVRA 5LJ5Y 3CMES 1X4GA 3BS9A 2D3OR 4RU2A 2DGUA 2KH9A 1VC0A 3P49B 1U2FA 2PEHA 2Q79A 1DBDA 4OZ0A 2M8DB 3D2WA 4IO9Q 4CH1A 2M8HA
chains in the Genus database with same CATH superfamily
2NXCA 3ITHB 4DL0C 3MWBA 4QOTA 4F8RA 3GFHA 1P27B 4KYZA 2V6AA 3Q89A 4FZVA 3OUYA 3VV2B 1OY6A 4Y2MA 4P9SA 1IXKA 3CUNA 4ECSA 4CQ1A 1VR6A 4PR6A 4QR2A 4DMZA 1K44A 1S5ZA 2XLIA 2MJUA 2UVRA 3OVAA 4KSEB 2B56A 2LA6A 3OQ2A 4OZLA 3AODA 4QIFA 3H5XA 4I4BA 1DTQB 4R8UB 2DR7A 1JJCB 3RBZA 4DX8H 2VFRA 3PYGA 1DQAA 1FRLA 4ED6A 5CA5A 1YKWA 5D0HA 2OGUA 5F9NA 1SV5A 4X65F 1LW0A 2EKYA 1CJUB 4K0KJ 3C14A 2ZOFA 1VQMS 1PYTA 4DOZA 5C42B 4NMXA 4ZVTB 2B9WA 1FKPA 3S8SA 4CLPA 2DEIA 3H25A 1D0EA 1I94J 4ECXA 2UV8A 3ULHA 1WUUA 1RACB 3GJQB 3MM6A 3EVOA 1FJEB 4USUA 5M2PA 5IQQA 1U1MA 3HLUA 3OUYB 1N5TA 1OYDA 2RB7A 1N6QA 1P1TA 1JIHA 2MKSA 1WACA 1OJ4A 3LGMA 3C66A 4BLGA 1VJWA 2B7BB 3GG1A 4M8LA 5KG5A 4QBUA 4ZVPB 2OSRA 3ISZA 3QPIA 3DXBA 3NGKA 2LDIA 2XO6A 2MQQA 2IRXA 3CIMA 2D3O1 2D3ZA 1SC1B 1GAOA 4ITSA 1VQNS 2K1RA 2RRNA 1FHTA 2Z8QA 1JNZB 1QSYA 4DZ6A 4ATNA 4AXIA 1YJ9S 3IMQJ 3GP9A 5B0BA 3V81A 2RQ4A 4TY9A 5C24A 1NMEB 2WVBA 3H98A 2ZWPA 1VDHA 2XB2D 5LT5A 1VLOA 3BSAA 4CLUA 1FKPB 2Y8WA 1WEYA 3GIKA 3MUTP 4YFUA 3J81j 2AZ3A 3HI9A 5HP1B 3MM6B 1NK9A 3TZYA 1LW2A 1U8WA 1JJHA 4ED5A 3AB2B 3OFGA 2ZH4A 1VIOA 1N6QB 1YQHA 4C8ZA 3K8VA 3K58A 2R7XA 3LPYA 3HM9A 2MLZA 2YKNA 4JI6F 1QVFR 3WC2A 3AJDA 2OEMA 4XDCA 2VFVA 4AQYJ 1EX8A 2EFPA 2O1PA 4X4RA 4E0DA 5DQGA 1WHYA 1SJ4P 3W5ZA 2HAIA 3SFUA 2HBYB 2DCLA 4OZJA 4ICLA 2C3MA 3M4XA 2K1RB 4B02A 5KFYA 2ZOMA 3FBBA 1LFPA 1WKJA 1NB7A 2K3KA 3V81B 3I55S 3C46A 3RAQA 4CM2A 5K8NA 3G6YA 5C24B 3PYDA 4ZVQB 4JI5J 3LWMA 2YBVA 2MQ8A 5DG9A 4UZCA 3OJUA 2DCUB 4ZKAA 5IWAF 4M5HA 1LK7A 2KKHA 2NS1B 1VOMA 3BYPA 2KM8C 3H42A 1PILA 3WIUA 1N32F 1LW2B 2UXBJ 2DVIA 1YX2A 3MAAA 2FVSA 1CJVA 4ETXA 2DNOA 3M8WA 2CRLA 2YKNB 5HATA 2BJ7A 2C3YA 2KZZA 3KJFB 2CZVC 1XR7A 3L7UA 4V19X 2JVOA 4X64F 3ZTRA 2P9GA 4JV2A 3JSMA 4TXSA 4QIWD 4OYWA 4FVCA 2GW8A 3KDNA 4ICLB 1Y00A 2VBYA 3CDWA 4EMDA 4NI2A 2FDNA 2ZH3A 3G82B 4K4UA 1GX5A 2Z2MA 1S10A 2C3UA 4UY8T 1GTEA 4KHMA 1U2CA 3DDNA 4O3NA 5C2CA 2CNNB 2YPYA 3GB0A 2PEHA 4RNOA 2M8DB 4C6AA 4IO9Q 3PW5A 3DLGA 5LSRA 4CH7A 4ZLLA 3BQ0A 4B9UA 1IKXB 2DNZA 4WK1A 1HNZF 1HARA 5HLFA 5CZXA 4F2SA 4O4RA 1T3OA 1RLDA 1RYSA 4NRUA 1T0TV 1CJVB 4OV1A 2BOPA 1RBAA 5LL6d 2RHQB 2E29A 3KG4A 2LA4A 4EYHB 4YOEA 3BGOP 1BQMB 2UU9J 2DKOB 4OI1A 2GJFA 2DGTA 2ZE2A 3JSMB 4EFAC 3OD2A 5IT9U 3D67A 4JI0J 2AX1A 5JVHQ 3OL7A 2OLWA 4AL6A 1TK5A 3T1HF 1S9EA 5L9NA 4QCLA 4JI7F 1X8DA 2JLEA 1YSJA 3MPDA 2HNYA 5L1JA 4CH0S 3GWCA 4NI2B 1ZTTA 3SV3A 4LF5J 4JI1F 1V3RA 3RBXA 4NLWA 4RX6A 2EVZA 1UJ4A 3AB4B 2OPSB 2HLUA 5IQ6A 4NLGA 3UN5A 3VHQA 3MM9B 3HHNB 1B7YB 1LKZA 1DZ5A 2H5EA 5D3GB 2BBEA 3NAIA 3H2UB 4X66J 2ZVSA 1JLEA 3FCVA 4XK8C 1U25A 4A8MP 3JTNA 2E7WA 1S77D 5HLFB 1HBUA 3C2PA 2ZZTA 5BR8F 1FK9A 1T03A 3R1HA 1T11A 5IS2A 3GFYA 2W2OP 4ZCLA 1TVRA 3D28A 1T94A 2DNKA 5E5NA 5E3PA 4WKRA 1PJ5A 2HK2A 1N33J 2ZE2B 3EGWB 2OAUA 3ZZUA 4DV4F 1S9EB 3FEXB 4UT4A 2EPIA 4LSNA 2DNYA 5B0GA 2HNYB 3RW7A 4FPRA 1S6PA 2ZH7A 1Z1ZA 2QYGA 3CTRA 3UD5A 1U1LA 1HW8A 2M4MA 4IUFA 3LQVA 3KJNB 1F3FA 1FD2A 1Y7PA 4FF1A 4A4JA 4LR9A 3QT8A 2QE5A 1JLEB 3W65A 1RT3A 3IC1A 1SJRA 2BUNA 4CRJA 4LRDA 4OZNA 4C8NA 2BE2B 1HBUB 1U7LA 2Q3PA 1T9UA 4NZ6A 1T03B 1N34J 4OZ2A 3GSDA 1W7WA 3TJ9A 3CCTA 2AGQA 2OPQB 5IXUA 2KG0A 1TVRB 5B0FA 1S4FA 7FDRA 1U45A 2GIFA 1MU2A 3M8QA 5LXRA 1IBMJ 2NZ4A 1R8BA 4Q2LA 4U7UK 2UXDF 2HHTA 2YWGA 2A3JA 2XZWA 3KUHA 4DV7F 3RU0A 2MZRA 2CPJA 1BHNA 5ETRA 2C28A 1NKBA 4LSNB 3RZAA 2BEFA 2OO4A 4JB8B 1OPIA 1QSLA 1S6PB 4IDKA 1HBNA 1WD6A 4X62J 3TARA 3ZZYA 3GSIA 1IVZA 1U1NA 4HHHA 2HS0A 2Y9HA 5ETPA 4OX9J 3W64A 4TYBA 1CC7A 2HKEA 1IKVA 1UVNA 2V4JA 2QIFA 3MMBA 4F02A 5GMDA 2CNKB 2CJKA 2M3DA 1RT3B 3J81U 2XQCA 1WG1A 2NPFA 2X3DA 2KT5A 2BYCA 4DX6A 3A4TA 4NOHA 3N5BA 4OX7A 2DH8A 1Q1KA 3G4SS 4PUOA 4EYIB 2PMHA 2RJZA 4RZRA 4DCOB 3RBDA 2DNLA 1RTIB 3JSRA 1PG5B 4NEYA 3HO1A 4F67A 2QJ3A 1AFIA 4Q2MA 1Q0NA 2V0NA 3M8QB 2F4VJ 1R8CA 3ILIA 3C16A 4GO7X 2I5JB 2QL5B 2XMWA 4RW9A 4PYAA 3R2DJ 3LANA 2HVZA 1W2BR 3UR0A 1F6TA 3SQGB 5KFVA 1KOOA 1AW0A 3M05A 2J9DE 3QGGA 1LXNA 4IQXA 4EK2A 2N7CA 2KVQE 2KT3A 2RRAA 3DGVA 3WX8A 3R5AA 4IDKB 2H9ZA 2CXEA 3DHWC 5KFZA 3UN2A 4V19J 3BSCA 1YI2S 4XAKA 3KLIA 5AE3A 4GKJJ 4DV0F 1SJ3P 2JC0A 1IKVB 4Y2KA 4MJKA 2V4JB 3TAPA 1SBRA 4L3NA 3CMES 1X4GA 2NXUA 4DL7A 4DR2F 1SIZA 5JMNA 3TUJC 2Q79A 5IT0A 2R2TA 4CDIA 3WZ0A 3GFZA 3MOJB 1J5OA 2ABYA 1H98A 3UDLA 1X9WA 2GQ2A 1U09A 4PUOB 2CFXA 4U67Q 3G8QA 3FRYA 4RL1A 1CPZA 3DOMA 2YQ1A 2BJDA 1LWFA 5HMZA 2AGOA 3W9JA 3C16B 2W01A 4RW9B 1NHVA 3CCJS 1S7IA 4ZPTR 1JWWA 4TY8A 2FY1A 4M5LA 1R6YA 5KFNA 1RGVA 5E33A 3NOGA 2FVCA 3NBPB 5HROB 3V5RA 3MR6A 4J90A 5E3AA 3FUYA 2YKQA 3I0SA 4XIUA 4RNFA 2HVDA 2XULA 4AD6A 4ED1A 3MTJA 4K4XA 3D1OA 4F0KA 4F36A 2FTRA 1TKTA 5A8KB 2R2SA 4F3QA 2MKHA 5ETVA 5E3RA 1E6YA 1J5OB 1X4DA 2DBBA 2CVIA 3D1HA 4WJBA 3ZTOA 3DOMB 1HWIA 2RQMA 3GJSB 1OYEA 3W2WA 1JKHA 2QYCA 1LWFB 3MM7B 4ECRA 4WYWA 1SL0A 1KEKA 1I1GA 2F8EX 3NCQA 3W1YC 1WWHA 3R2CJ 1FNOA 2F7VA 5D78A 1M5VC 3EJMA 2FJDB 1HPZB 3QT5A 2CWKA 4CLWA 2MZQA 4N56A 4ZN1A 3QGIA 4TY8B 4F3MA 1MROA 4NLXA 3HULA 1IQTA 2DNGA 4WBFA 5J2MA 1E6VB 2ZBIA 2DPJA 3MMAA 2CQ0A 1JLBA 5J1PA 3DC2A 1I6JA 3AY0A 4DUYF 5C2GA 3CIZA 3MCNA 2MQNA 1X4HA 5A0YA 1NRKA 2LCWA 2O3DA 3ENQA 2EW9A 4MAKA 3WBZA 4IO1A 1QTMA 1RE1B 2ZH6A 4J9MA 2HBZB 1NNDA 5HMYA 3CO9A 3B4DA 1NK8A 4HI1A 1DAXA 3CJRA 1E6YB 4DU7A 2AGPA 1QSSA 2R7QA 3HZGA 4UOFA 1YBTA 5EWGA 4UOCA 1JKHB 4QIGA 2LXIA 1T95A 1BUXA 1RHJB 2YNIB 4M5NA 2VOPA 3GCWP 5H9FK 3N4WA 3PRBA 2E66A 1RT2A 1XJWB 3MUMP 1RDRA 4RBTA 3U1MA 1RWXB 5BYSA 3R6GB 1JLQA 1FX4A 5CYMB 3B6BA 3HD1A 5J2MB 4CP5A 5A8WA 4KKOA 3MMAB 4M1KA 4UQGA 2LU2A 4DDFA 2HS3A 1NUEA 2XCAA 5A0YB 3PO4A 3NL0A 2JDJA 4MK8A 2VA2A 2MLXA 1JLCA 2C2NA 3NS6A 3I9ZA 2OMOA 4EUVA 1RP5A 5KT3A 2MZJA 2CJXB 4DV1J 3IR6B 3IWNC 3HF5A 3KK3A 2P6TA 2O66A 3I0RA 3BREA 2CYYA 4NX9A 3W2VA 1VQLS 3AAWB 4QW8A 2P6SA 3OR2B 3NP5A 4OYPA 3M9MB 4OJHA 4L6V3 2CQHA 5EWFA 4J9NA 4DR4J 2APOA 2PO4A 1RT2B 1KQKA 2FB0A 3NWGA 5B0AA 1JLQB 3VF0B 5IFMA 2I1RA 3MF5A 1GNKA 4ZP8A 4BS2A 3VAHA 3CE8A 3SCJE 1MLAA 4HACB 1KONA 3VAKA 1KFSA 1Q8LA 4KKOB 4JI8J 2XHWA 4K5SA 4NLOA 1MWZA 2I38A 2E7VA 4PPZA 4WTOB 3QZ7A 2WSFC 2Q1LA 3R5JB 1RT6A 2UUBF 1UPPA 4LFCF 4G6VB 4B3MJ 2DIVA 3M2UA 4URSA 4IFYA 2J7KA 1RTDA 2MZ1A 4NXMJ 3D6HB 2EWHA 3GLJA 2ASLA 4DSKA 2QMXA 4DSJA 3KLFB 5F8NA 4OZ3A 5C25B 2KXNB 2YPZA 2VZ9A 3I0RB 2BR0A 5KT4A 3V6HA 2VC1A 2VG5A 3OTDA 4DUZF 2ZBRA 3AXKA 3CC4S 3Q2SC 4ZCKA 2F1FA 3HKZD 3R9LA 2M0GB 1GMWA 2FD2A 3BDEA 4HT5A 5EN1A 1PAUB 1CBKA 2DNNA 5GAEU 1HWKA 4OHZA 3KLHA 5E3CA 2MQLA 1IUJA 3TA0A 3SBMA 5I3UB 1NPKA 3UR3C 3V4IA 4PYDA 3L7OA 3JS9A 5HVGA 2LQ8A 3ENVA 3GJTB 2V50A 4ZDNA 1PYOB 4QWAA 4IFYB 2M52A 8ATCB 2QA4S 2CNOB 3IBCB 4BDPA 1T9TA 4CLZA 4DHVA 2ADBA 4NZ0A 4MIAA 1SUQB 5HI7A 1I94F 4PPDA 3M8ZA 2W8KA 2DB1A 5KG7A 2IM0A 2ZBQA 4RW4A 2HZAA 2VDIA 2OIHA 1YBUA 1HNIB 4MYTA 2NUUG 3VQTA 5AXKA 3CCLS 2F5GA 4LF4F 1FDNA 1NBEB 2HBRB 3CJ4A 2GC8A 1WEZA 3HVRA 3UWTA 3BR9A 3JTOA 1HNVB 3POTA 4I56A 1YJTA 1FRKA 2AIRB 1RQ0A 1S57A 3V4IB 2JZ5A 4O4GA 3OTOF 2G1HA 2XZDB 2YWWA 1NDKA 4QIEA 2JOQA 1XQIA 1EARA 3C8YA 1MWYA 2KRBA 2XCPA 2MMYA 2OPPA 1FI4A 4FYYB 4DV3F 3QLHA 2VKZG 2ZDPA 3N9UC 4LREA 3I96A 2IJRA 3KHGA 3VGUA 2QTWA 1CJTA 2HRYA 3UI3A 4EBCA 2KI2A 4RPFA 4ZLPA 3THTA 4DWIA 3DLHA 1LWXA 4ED4A 4P52A 3FSXA 2OELA 1VRQC 3M32A 2V68A 4C8MA 1TAQA 1RTJA 4J9SA 4ZLJA 4WWSA 5HMXA 1V5VA 4O4GB 5KFDA 4CO5A 3P8BB 5KFTA 3TQ1A 1VC5A 2QLXA 4C0OC 2JEJA 5KFFA 3GU0A 1JXLA 3RAXA 3M8PB 1NK0A 1H73A 1N5YA 2ZUAA 7AT1B 4NE9C 2KRRA 2ASJA 1DY3A 3MECB 2IM2A 4KTQA 4DQQA 1XMQF 2ZKUA 3K57A 1VYAA 1J2VA 3QLHB 3TZWA 3HHLD 3UCGA 5J2PA 2UXBF 3Q8RB 1CJTB 3M6UA 4K50A 3UCUP 4QR1A 3J7ZT 3G96A 2VD3A 3G9CA 3GIIA 2BMBA 2YNGA 2G0JA 3DDIA 2GHWA 3MM5B 2B9XA 3V4MA 2HVIA 5EDWA 4A8YA 4P2XA 5GMEA 3D3CJ 3ILJA 1RTJB 1O5JA 3DRPA 1FFWB 2DH7A 3EICA 3PYEA 5DM6Q 4OYBA 3TI0A 4DL2A 2LU1A 4WFAQ 1RT7A 2FJWA 1R0BG 2CJAA 3EM1A 5G0RA 4CLKA 2HWHA 1X5TA 1G7CB 4ZS6A 1KBRA 4OI4A 3VTIA 4B9MA 1VCTA 2DNMA 1ZAWA 2JVRA 4JI2F 2HFNA 2BRKA 3PCOB 1UA1A 2HHUA 2D3OR 2BOAA 3M2RA 4CH1A 5F3ZA 5J2PB 3DDKA 1F2GA 1S1XA 2EEYA 2C2RA 2WOMB 4EI2A 2W7AA 3EVWA 3ZZRA 3DRRB 2MKYA 5DO2A 3M9NB 2LMIA 3PX6A 1U6ZA 3GE9A 2UU9F 5C7PA 1X9SA 2VFTA 5AXNA 3MCOA 1OY8A 3LOUA 3NMRA 2ZJRQ 2HHSA 4MT1A 1FJ7A 4TQRA 3I5AA 4LFAJ 4ECYA 4PKDB 2R8JA 5D4PA 4QPXA 4DFKA 4K8RA 1YK9A 1RT7B 5G0RB 4WFXA 4U96A 3DLBA 4DFPA 2L9DA 2PGCA 3IR7B 2XSJB 3A8EA 3HFVA 1TK0A 2HEKA 1KTVA 2XMAA 2CADA 3IBFB 4CLLA 4X66F 4IR9A 3M2RB 3L95X 3MGJA 3PFEA 1ZETA 4HHUA 3UNGC 1GTHA 1RWUA 5H9EJ 1S1XB 5FLXY 2PA3A 1VK3A 3B4MA 4NXNF 4F4XA 3DOLB 3CD0A 1UW4A 1ZZFA 2IA0A 3T9NA 2HRTA 1TKXA 1XWLA 1UEVA 1IN0A 1JXVA 4N76A 3W5YA 3DLLQ 5CZVA 4M5GA 2C2DA 2VQEF 5LMUF 3SSQA 1NHKL 2C1EB 2HQFA 4Q45A 4OHXA 1D1UA 3MHYA 2J6UA 4RUHA 4IRCA 3GR0A 2Q6CA 1NAQA 1W25A 2KM8B 1HNWJ 2AEFA 2E9TA 2JEIA 4USKA 5ETMA 4QU7A 2HYIB 1JQGA 4CTAA 2V2VA 1NO8A 5KG6A 2GZOA 3Q8PB 2G2OA 5ETQA 4NLUA 3KOAA 4F4KA 2IIHA 5L1LA 2X1FA 2XNQA 1JK9B 3J7A1 1U47A 1QE1A 4K2JA 3BO4A 3DRXA 3HXMA 2R7RA 3TEHB 2IMOA 4USTA 4GC6A 2ATLA 2UUCF 3H4DA 1UCNA 3ETMA 2MZTA 1VHIA 4YB1P 3HT3A 1RU2A 4EEYA 3D7SB 3MR3A 5DG8A 1VQSA 3D68A 3KK1A 5CAAA 3BO3A 3H5UA 1CULB 3QIPA 5M2RA 4B08A 1UJ5A 3Q0AA 2UZAA 1FJGJ 3HDSA 2CQPA 2WVCA 3HHDA 1VQ4S 1RBLA 4NWBA 1UEUA 1JXEA 5IOLA 2B4UA 3PIOQ 1YITS 4P74A 3TQEA 2FVRA 1XMOF 5K14B 1ZA2B 4NYOA 1CS4A 2KL8A 4MKAA 2J8AA 3AOCA 2MJNA 4CTAB 2EBEA 2GVDA 1DTTA 2CUYA 3T1YJ 2HBQB 3NGUA 4ZIWA 2DGOA 4CLTA 1RU1A 4PWDA 1RWPB 2ZNYA 1YJNS 1QE1B 2OJ3A 4UQTA 4DS4A 3GG0A 4GKKJ 1IBLF 4DQRA 4ZLNA 4MK9A 1F5CA 2AMCB 1FRJA 4O3RA 2J0SD 3DRSA 1UA0A 2KJVA 3I87A 5AXMA 3D5MA 2VUGA 1FJCA 3BM7A 1UWBB 2E5JA 1ZM3A 3QWPA 4Y0FA 2RS2A 1SB6A 1RAJA 4KHPJ 3C6TA 2HMIA 4BHQA 4MKVA 3SDEA 2YNFA 1X4EA 3NS7B 3CC7S 3A3NB 3D54A 3OSPA 3EGZA 3PR5B 4F04B 1HYSA 4DG1A 2AT1B 3K5OA 1UKUA 2RNEA 4JV5F 3MM8A 4A8OA 4NLTA 2GVDB 1MW7A 3L4BC 1DTTB 4OX8A 4ANEA 1WSVA 2XWXA 5IV4A 1L3KA 3ADAC 4DQSA 4PWDB 3MPUB 4CLYA 2GJIA 5D0RA 1EQ0A 2IM3A 1C0TA 3DKDA 3HVWA 1XNRF 4AL5A 2E5LF 1TMJA 1N5QA 2BKPA 1S1UA 3PJXA 5B7WA 1YG0A 3DRSB 2FUG9 3R97A 1Y11A 5GAHI 3DMJA 2NXJA 3UDCA 2CNLB 1QUVA 2YVSA 4PCQA 1ZPVA 3DYAA 2Z58B 1BQNA 4OYIA 4PG6A 4FF3A 2GGPA 2N3OA 2HMIB 5E2QA 2OEKA 2RD5C 4DI6A 5T14A 1VRTA 1LQ9A 2YNFB 2RE1A 2G2ZA 2CJYB 2RKIA 5L9XA 3ONQA 3CDEA 1GQEA 5J1NA 3D6FB 4ID5A 1SKRA 2LQ9A 2XG8A 1UMJA 2DISA 2DNHA 2G1DA 4RW8A 2WHOA 4LF9F 2A2DA 3MM8B 3SCLE 3FCWA 1GEHA 5AJ3J 5D77A 4ZVOB 3CSKA 1NK7A 3DLKA 3T6BA 2GAGC 1H3DA 4DR1F 1U1QA 2ZJQQ 3R5BA 1HR0F 3CC2S 1MNEA 2M5YA 4B9TA 1S1UB 5KFUA 3IR5B 1Y3KA 2K8GA 3L9ZA 3FZBA 3H8YA 2HGLA 2LKZA 2JEFA 2X1BA 3N5FA 4P7VA 4P7TA 1T9XA 3BH6B 1T9YA 1H72C 4CIOA 2DH9A 3K7RA 2KVIA 4NLRA 1BQNB 4U95A 2GGPB 5IZHA 2D1CA 1VRTB 3RB4A 3PHTA 4F4WA 4P75A 3OV7A 2UXCF 3UD4P 3TYTA 1EETA 3UNYA 3CJSA 3QRPA 2ZM6F 3VWSA 2GAHC 1NSAA 5AT1B 1JLAA 1R8AA 4K5RA 1KS2A 4M5JA 3HHLC 3LF0A 4ENOA 4KIAA 4R0EA 2CAJA 4LSLA 2LQ5A 2UUWA 2D69A 4B9LA 3DLKB 1QAYA 1Q79A 3PO5A 4Q0BA 5KFAA 2D41A 5L38A 4DQIA 3OL6A 4OX6A 4L72B 4ECWA 4WKYA 5I3PA 3CT9A 3DOKA 2MY7A 3M6XA 3OR1A 4I0WA 1CC8A 4B3TF 1N54B 5HJYA 2YX4A 2AJFE 1PIEA 4PQUA 2ZJPQ 3TZZA 2ZH9A 3Q8SB 2BE9B 3M2VA 2J0QD 4DF8A 4DLEA 2V4RA 1C1CA 2N3LA 3NXZA 2W25A 2OD4A 2M88A 2DO4A 3MUVP 1RYRA 1HWLA 2BM0A 3J7Z5 2X1GA 3LTOA 2B0GA 5FD1A 5GVQA 1EETB 2DGWA 1Q4RA 2XGQA 2VF3A 2Q43A 4DSFA 3R3TA 1L3TA 2IC3A 1RWNB 4EGLA 1JLAB 4NA2A 1HMVB 3FRZA 3BQ2A 1BGXT 1FRHA 3GV8B 4LVNP 5KG3A 2JJ4D 3JXOA 2KHCA 4A8SA 4LSLB 1PKUA 4FDFA 4Q0BB 3CDBA 4DQPA 4DR6J 4USJC 3W7BA 4B3RF 5IV3A 4EBDA 5EX3A 3DOKB 4WE1B 1S0MA 5B0CA 3TJAA 2M9KA 4QJVA 5D15A 2XTJP 3MEDA 2CG4A 1SJQA 1NSKL 3Q86A 4DFJA 2K7KA 5HBMA 1QDUB 2BQUA 2DXDA 2BZ2A 1U48A 4B3SJ 1K0TA 4OQJA 1C1CB 4G1PA 3U7JA 1UETA 3UE2A 3KLEA 1BQXA 3TA2A 1YRTA 2AJ1A 1SH3A 3I4HX 4M5MA 3AT1B 4YUDA 3LAKA 3ET6B 2EK1A 3LP2B 1FKAF 2J9DA 2IC3B 1DQ9A 3PR4A 1SKWA 3EWGA 4OL8A 1VQOS 1FXDA 3R27A 2BANB 2EFQA 4OMFG 1QM9A 2QLJB 4KPCA 1ZH5A 1HL6A 2P2CB 3NNHA 3THVA 1FVQA 5KTQA 4HTJA 3HT0A 1RT4A 1UTAA 4Q8FA 3K89A 2FPHX 2Y0BB 1JB0C 2H3EB 3GIMA 3MEDB 5IM0B 1RABB 2RHSB 4GVBA 4PQAA 4Z7CA 4OV6A 2R2RA 3PACA 3MI7X 2BQ3A 4MMOA 1S1VA 3P5TL 3Q8QB 4A48A 3RG6A 4DJBA 5DETA 4F25A 2IMWP 5DM7Q 3KLEB 4ANCA 1S9GA 1V5IB 1RCOB 5EHHA 2WVDA 2FHJD 2JFDA 4GO5X 2ZVIA 4PWUA 1FERA 3H5YA 3U27A 2HGMA 4YHHF 4KB7A 1R7IA 3RB6A 3TNVA 2N7YA 2VBWA 1FRMA 3D1QA 1R3NA 2ZZMA 2GS8A 1X5OA 1L3SA 4MIBA 2KDOA 4ALZA 2CG8A 2HK3A 2RQCA 4MYUA 2XWYA 2WB4A 4F0HA 2XYPB 4USIA 5HANA 2RDDA 3O3LA 1RT4B 4K4WA 1WC1A 3NNCA 5DG7A 2IVFB 5THWA 1K1SA 4KQZA 4LF6J 1OO0B 3OFFA 1RAIB 2QEXS 1FDAA 5ETKA 2I2YA 1B0TA 4EZ6A 2CQ3A 2NZCA 4DR7F 2CDQA 2FJVA 4EBEA 5HK4A 1S1VB 3LP0A 3C3LA 2HAFA 4LBHA 4P71A 3ZZZA 2BJ9A 6FD1A 1XIQA 3K5NA 1S9GB 3HCXA 1U1OA 1B4SA 1XN9A 2WK4A 4ES1A 4DUTA 2BE7D 3IG1A 3K5PA 3KYLA 5E41A 1REVA 4RUBA 1KWMA 2H5IB 4LFBJ 5ITHA 2DRAA 5KG0A 2WBMA 4DPXA 3FBFA 3KLVA 3I5CA 4URQU 4H4KC 2GO9A 2QT7A 3KJQB 2OFHX 3DU6A 1VHFA 3ITHA 1N0VC 1FX2A 3GCXP 5KFKA 1VGYA 5K8OA 2E5GA 3R5GA 2JL9A 3TAQA 4Y2AA 2DGSA 1NLKL 1ZM9A 4FYDA 1ZYQA 4TLRA 3OW2R 3SSSA 1QTNB 1X5PA 2BM1A 4KO0B 2GA7A 3GTYX 2DO0A 5LMNJ 3EDRB 2UV8G 2UUTA 4X65J 1IR2A 4DR5F 5DDPC 2VONA 3NG8A 2RAQA 1DQ8A 3LP0B 4DN0A 4DR3F 1RAOA 3WX4A 4C8OA 2DIUA 3BKUA 3IN5A 2XY6A 1B99A 1N8RT 3IG1B 4RUCA 3BN4A 5DZ6A 4JYAF 2FZGB 2AHOB 4B9NA 4PZVA 4G1QA 1FXLA 1FT8A 4Q7AA 2KN4A 4J9VA 4EO6A 4WIQA 1AZSB 4RBVA 1XNQF 2VPZB 2D9PA 3GMGA 4I69A 3P4UB 3BF4A 3IFEA 4J9KA 4N47A 5RUBA 4L76A 4HHJA 2PT0A 1WKKA 3OTCA 5DLFA 4CNZA 3VAIA 4DX5A 4IOCQ 1NDPA 3TOQA 2FLNA 3OVSA 3LW5C 1URNA 1U8SA 3DI6A 4KT0C 4XPEA 1K47A 2EG1A 2HHHF 3JQKA 5A76A 4LIRA 5IT9Y 6AT1B 1JJ2R 4MH8A 1H2VZ 4CLFA 2WAQD 3BB5A 4FF4A 2DRDA 2EC2A 3BPSP 4X4PA 4G1QB 1HIYA 2W7PA 1HQEA 2HW3A 3KTQA 2RVJA 1YJVA 3JB9k 2HQ3A 4KJIA 1DLOB 3DN9A 2YWHA 2RMLA 4JI6J 1TFYA 3Q83A 2VICA 2ZZNA 4A8KA 4J37A 3MR5A 2DYAA 4AUKA 4ILMA 1YJ7A 5HP1A 3BS9A 3IGVA 4RU2A 2L48A 2NCKL 1TL5A 2DPIA 2KH9A 1C4AA 4DL5A 3D2WA 3ZNJ1 1YTYA 4WYLA 3OL9A 1NSPA 1NJZA 1D9DA 5F8IA 1VFJA 1PYSB 3L7PA 4ZCMA 4BC7A 1HQ2A 3DI6B 3O6QA 1A6LA 4RNHA 1KLNA 3T1AA 3OXFA 5IWAJ 2DHHA 4TKTA 2ZNZA 1TKZA 4PEOA 4YN3B 2Z30B 3ELHA 3G8SA 1N32J 2AEMA 2IJFA 3D0IE 3R7NB 1HQEB 4EO8A 1IQZA 2V94A 4TU8A 4RNMA 2VA3A 3KMQA 1VIXA 5L39A 4IG0B 3SYZA 2M70A 5J2QA 3QAEA 4IH5A 4X64J 4M5IA 2YKAA 3BBCA 1IKWA 3S1TA 2JRSA 2UUAF 2MY8A 4LRCA 4PXCA 1BMQB 1RZMA 5ETOA 3VAMA 2FVPA 4JI3F 5KOXA 4ZPDA 1T8EA 1PBUA 1Z2LA 2K2PA 2VL1A 3EXYA 2GVZA 4JI4J 1WHVA 4KFBB 4PWWA 3G2XA 1NSQA 1RHQB 3T5JA 3DLEB 1OQ3A 4HTIA 4NCGA 5EX0A 1S9FA 4DL3A 4U8VA 1TKZB 2N4CA 3EZ5A 1C2PA 4RW6A 3G82A 1HNZJ 3AOBA 4X4NA 2ZHOA 3CULA 1JLFB 3D9BA 4FVMA 2QSFA 3MAQA 3A13A 5E7OB 2JWNA 5GADI 2RUGA 1NJYA 1L3VA 5F8GA 4DV5F 4D3GA 4X84A 3PW2A 2MDAA 3R1LA 4LF8F 3QT7A 4J91A 5J2QB 3FK4A 4ED2A 1VQKS 1EJ7L 2HNZA 2FJAB 2YY3A 1IKXA 2VC0A 4DX7A 1IKWB 3T1HJ 3D3BJ 2IYGA 2GQCA 2PIIA 4QWEA 1UWAA 5A6WA 3CCSS 3EPIA 1TP7A 4JI1J 3CCQS 3W3SA 1I51B 1EIYB 1BQMA 2GVZB 1XEZA 4M5DA 4NLVA 3JSBA 1KKHA 3U1LA 1LK5A 4NCGB 4F0MA 4R25A 2QV6A 1QY7A 4RWXA 3LAMA 3FQLA 2G2YA 4RW6B 3VAGA 2FLOA 4JOUA 3SZ2A 4Y3CA 1R6VA 1FWPA 3RYLA 3TZXA 2IYIA 2OPSA 4N8NA 1TUWA 2OH2A 2B4VA 3MM9A 2Y3YA 5D3GA 2R8HA 5KFLA 2PI5A 2CQBA 1F1BB 2MQMA 2AJ0A 2HNZB 3PM9A 4HDHA 5H9FJ 1S12A 3RRHA 4DV4J 2ILZA 1UL3A 9RUBA 3IGNA 3NWRA 3E8OA 4K2XA 1HNXF 3OXGA 3AOAA 2EK6A 4C48A 3BQ1A 3W5XA 5F3TA 5I42B 2Q6BA 3QFHA 4M5DB 3CD7A 3ZZTA 3KDOA 5H1SV 2XMMA 1N36F 2BW7A 2C42A 3JSYA 2MPUA 4KHPF 4DF4A 2ZFHA 3CMAS 2ZH2A 3JQJA 4WK3A 4BCAA 4FYXB 1S76D 3CJ0A 1VQ7S 5K20B 1KHWA 3D4JA 5FLXU 3SMZA 4ELUA 2U1AA 4H4MA 3CMQA 1S1WA 4OHWA 1KHVA 5F9LA 2HIQA 1RAFB 3LH2S 3A3PB 4I6AA 2KHDA 3ICLA 2MTLA 5DLGA 1X4AA 2UXDJ 4FNHA 4KV8B 4O44B 3MD3A 3KUEA 1ZOTA 5LJ5Y 3LGHA 2BE2A 4RWWA 3CD5A 1B0VA 4C0BA 3FZ2A 2IVYA 3AD9C 4ED7A 1VC0A 2HHQA 4OZ0A 3N6LA 2OPQA 1LEOA 1F5BA 5K5MA 3C6UB 1U0HA 1GK8A 3KHLA 2IY5B 4N77A 2ERRA 3RR8A 1WDDA 2HG4A 3MAHA 3HVTB 3NOCA 1KN6A 3VGVA 2H48B 1WC0A 1KVJA 1S99A 1VQ9S 1FNXH 4W90B 4LRFA 4BBYA 3GR1A 3A12A 2V4QA 1Q8BA 5D0GA 3IM9A 4AE5A 3FC9A 2VH7A 4V1Ak 2CDRB 2V8PA 2UP1A 3PW0A 4JV1A 4H4MB 4E98A 5F0UA 1S1WB 2CJ9A 1CG2A 1MMDA 4B17A 1F9FA 3J7YI 3MPWA 5CCLA 4J9UE 1KP6A 2IDEA 4ED8A 4WIIA 2DNPA 4KR0B 3H40A 2VJUA 2ZHBA 4I67A 5BJRA 1IM4A 4O0NA 2VU5A 2H4YB 4C3LA 4URGA 2FGCA 3EXCX 1RTIA 4UUXA 2W4CA 1QLNA 4P2FA 1U0HB 1CQNA 2GIRA 2MLYA 4G3IA 2MYFA 5DDOC 2AD9A 2I5JA 2XO7A 3SQGA 2RQKA 3C15A 1KDNA 3MTKA 5B0EA 4LR8A 2CPFA 1HBMA 4DR2J 2AX0A 4OLOA 2WW8A 2C2KB 2L9WA 4CI0B 1J27A 2GX8A 4IRDA 1AROP 3KHRA 2IJNA 2ZWOA 3PG9A 3UDVA 3DHXA 1NKEA 3E51A 2CPIA 3J80U 2V63A 3CJQA 4OYMA 1YHQS 2KFNA 1NM2A 1NCLA 2BRLA 2EC0A 5D8HB 1TV6A 1IBKJ 4RKUC 3WHIA 1BD6A 4QPTA 3EZOA 3O8WA 1RHMB 5SZTA 1HQUA 4IRKA 1YRUA 5KFSA 4DS5A 1GH8A 2R4FA 4Q43A 2CPYA 2CQ2A 3ISNC 1HBOA 1RWVB 2OMLA 5J2NA 3EGVA 2BV3A 1PO6A 5CCMA 2R3VA 2GIQA 4JUZA 5KFQA 2R7OA 4IFVA 2KT2A 3C15B 3PRDA 2JLGA 5K8MA 4FYVB 3PIPQ 3V6DA 1HBMB 4U9RA 2BJ1A 2HWTA 1NZ8A 3H20A 1VS3A 1RAHB 3NBPA 3ENWA 3V6JA 5HROA 1S97A 2O5DA 3J7AN 3W62A 3CPWR 2R9LA 3QO9A 1HFEL 3WQPA 5E0OA 4ILRA 3OVBA 5DDRC 4I6WA 3MURP 1TV6B 1SJFA 4ZJQA 4OJ3A 5K8PA 1S49A 5A8KA 1IM6A 1NK6A 3MCMA 3HFZB 1ZAXA 3QWUA 2ZKTA 5ETTA 3A8KA 4C97A 1HQUB 1RT1B 4UW2A 2AJ2A 4ILLA 2FIUA 2U2FA 3H7HB 5A8RA 3FDSA 4I1TA 4DBQA 1WTBA 1YIJS 3NEKA 1H74A 1HBOB 2B6AA 2XS7A 5J2NB 3ZXWA 3MM7A 5HJXA 2W24A 4DUYJ 4DV2F 2X3GA 4LMZA 4AXJA 2RF2B 4TQSA 4IFVB 3ZC4A 2B5JB 1WOPA 3HP6A 1APSA 4NEZA 1HPZA 2R7WA 1OMSA 3V6DB 5HQ8A 4D3HA 3HHLA 4AT1B 2YH1A 2MHNA 4HKQA 1E6VA 2DY9A 2FC8A 2KJWA 4XO0A 3MPYA 3M9OB 2ALZA 4WZMA 1GFWB 3QO9B 3T6JA 2BW2A 4O3QA 1HKAA 2MQOA 1HHQA 1O51A 1U26A 1S0OA 4J7CA 4JBCA 5HMWA 3BPDA 2ACMA 2MQPA 2FHMA 2DNRA 4Z37A 2RDJA 4K7QA 3TP2A 3N79A 3T3FA 4LUBA 1RA6A 4ECTA 1TU0B 5A8RB 5L1KA 2O01C 3ZZPA 1FA0A 2B51A 3DM2A 2ZD1B 4PG8A 2XBPA 4Y2IA 2A18A 2B6AB 1Q5VA 2YNIA 4WXWA 4H4OA 5GAHU 1S6OA 3KJVB 5KFPA 2JLFA 5M2UA 3SCIE 1WDTA 1WOOA 4LF7F 5HQLA 4FS1A 4CO2A 4WCEQ 2B8PA 4OZ5A 2LEPA 1EQMA 1VBKA 5CYMA 3HHLB 3HZEA 4FYWB 3NGTA 1MN7A 1D8YA 2XZTB 3CCWA 3NCRA 4DPOA 4YR3A 1SJ1A 3PHEA 5LXYA 1HWUA 3UQSA 4C8KA 2W1BA 3TEGA 4KGMA 3AQPA 4GC7A 2PFDA 3QGHA 3LP1B 3X3UA 4USWA 5C5JA 2B3TB 1X4FA 9ATCB 2HQIA 2BX6A 4CO3A 1FVSA 4R0JA 3I31A 1S72S 4I6YA 5ADZA 3K5LA 1J5EF 1HI8A 4I64A 1FTRA 5AE2A 2QL7B 3FNNA 2YWKA 4I2QA 3DM2B 1RWOB 4QR0A 4EU0A 1UVJA 3ZZOA 3OR2A 1XTZA 4O3SA 4KH1B 4H4OB 1IJEB 2UUBJ 2V9KA 4LFCJ 4DCPB 2VQFF 2HWIA 3W9IA 1BLUA 1RKIA 1ULRA 1WORA 1KR4A 3JTPA 4PAAA 2ILYA 4P2MA 2C2ZB 2ROGA 2X51A 3FSYA 1W26A 1VQPS 5D6GA 4HACA 3N6NA 1WELA 1NH7A 4K4ZA 1DARA 1SIWB 2V2QA 3SSRA 3CJ8A 4DUZJ 4U7UD 4TLQA 3Q2TC 3JQMA 4LFBF 1LWEA 1GXLA 4WFZA 3Q22A 4RJVA 3CXCR 3RUBL 3NNAA 4NA1A 1H2TZ 1L5UA 4FF2A 3NCPA 3KLFA 3Q8YA 2XEXA 5JXSA 2B43A 1WEXA 5C25A 1LOUA 1SC6A 2NPIA 2PE8A 3D0HE 4ZIVA 2QGFB 4M63A 2QLFB 4ZVSB 4I2QB 1DFDA 1A7GE 3PTWA 1KOHA 4I68A 4E2FB 4N41A 2L08A 5CYQA 2XMKA 3B78A 5D4NA 2QSWA 1ZM2A 3I9V9 5LMNF 5CD4H 3UVJA 3EMTA 4OHYA 2LECA 4ZHRB 1LXJA 5KFOA 3MEKA 1OIAA 4Y34A 3BO2A 2C2OB 2FZCB 1U1PA 2HIYA 4DV6F 4LF1A 3E01A 5I3UA 3UW1A 2KFZA 3BZQA 1N5VA 4XDDA 2KB2A 1TMMA 1DHMA 3BV8A 2QO3A 2E1CA 3W63A 2FZKB 4DEZA 2V8HA 2EFNA 1UW9A 5KG1A 1LWEB 5ETSA 3TUIC 1X0FA 3KNAA 4MKBA 4LF4J 3GIJA 2G0IA 2PN6A 1SUQA 2LXUA 1KVKA 1F5AA 5DZ7A 3HSZA 1ZZNA 4BWMA 1AXQA 3KG0A 1SQFA 1HNIA 5CYQB 1MG7A 3OTOJ 3UVJB 1SV5B 1LW0B 2NSCA 1YVFA 3C14B 3MFHA 5CH7B 4F7VA 4IH7A 1UEKA 3BEGB 1FXRA 1OWXA 1AB8A 4QYZJ 2QX0A 5L8RC 4BWJA 1HNVA 3E01B 4UF4A 5F8MA 2KFYA 2DRBA 4H4KA 5ETLA 4LIWA 4DV3J 1U0SA 3CD6S 2ZBPA 5KFXA 3BDPA 4K0KF 4P6QA 1G1XA 4CZCA 4IG3A 4B3OA 4N7TA 4HI2A 4A8QA 1CJKA 1SQGA 4F26A 1TL1A 4Y65A 1WF2A 4YQWA 3P3DA 3UO0A 3CCZA 4CYUA 4MFBA 4ELTA 5B0DA 3NKYA 2F65A 3PEJA 2VPXB 4ZPWR 1YJUA 4DSEA 3LALA 2F8HA 3FFIA 1WC4A 4K4YA 3QJLA 1IWAA 4OFZA 1XBWA 1EKSA 2WONA 2RS8A 4RLEA 4PXDA 1TL7A 2M7SA 2P9CA 2RH3A 2DHGA 1XMQJ 2DHSA 3R7SB 4TU9A 3MZIA 4ZPBA 2BQRA 1QAXA 2VBXA 1CVJA 3M8PA 3HMJG 1YRXA 5KOWA 1U1KA 3P45B 3JAMY 4IG3B 1NEEA 1HHTP 4B3OB 4RBUA 1URRA 2LEBA 3MECA 1CJKB 3GQCA 1TL1B 2YTCA 5D4OA 3HJVA 2C2EA 5F41A 3MMJA 5B08A 4ER8A 4CYUB 4MFBB 3CGIA 5D0EA 3UN3A 3PV8A 2J7WA 2Q66A 1FFSB 4WZQA 3K8WA 4DCJB 2HVHA 3QNWB 3FFIB 5KFWA 3MM5A 2DGQA 2RU3A 4AQYF 3OFEA 3PEHA 3OHBA 4JI4F 2WONB 4JI2J 1TL7B 3VALA 5MLCV 3MR2A 3OTBA 2K06A 4YR2A 2E5IA 1B3TA 2VG6A 1R0CB 3D6TB 3EZUA 4C2MA 2NYIA 1Q82T 3IS9A 2DT9A 3MAAB 4YY3J 1C1BA 1UZDA 1RBOB 2IRYA 3M6VA 4JI5F 2KU7A 4IH6A 2GMHA 1D9FA 3QQCD 3HHKA 3BGUA 4NA3A 3I32A 5CD4A 2XS2A 4TNOA 2AW0A 2H54B 2ZH5A 4LR7A 3H2LA 3OFHA 3AHPA 2WOMA 4KE5A 3VVUA 3C19A 1FWKA 4M95A 2VODA 5DS7A 2KTQA 4W4MA 3DRRA 2MXYA 4ED3A 4X4QA 4DPWA 4LBPA 1VK8A 1QAIA 1FCAA 3D6MB 2AYGA 4HR2A 2VPYB 3UFCX 4DZDA 4UOHA 1OSDA 3IP0A 1YJRA 1VBZA 3DLGB 4F4ZA 2VG6B 2CIMA 2MGZA 2DNQA 5ETNA 2FHKA 3IS9B 1U1RA 4Q8EA 4PG7A 1XMBA 1C1BB 4NXNJ 1P9YA 2WBRA 4Z2XA 2XSJA 3ZZ0A 1DRZA 4NCAA 4NYZA 1T7PA 1NDCA 1P8GA 2C3PA 1NPRA 5F8JA 2HPUA 2GMJA 2F8MA 3K5MA 3U1NA 4O0IA 1FRIA 1DURA 3OHAA 3QJPA 1OQ6A 4OLPA 2A2CA 3DU5A 2VQEJ 5LMUJ 2DD8S 2PA8D 1LV5A 3DOLA 2IBKA 1I3OB 1N5SA 1H7XA 2IVMA 1HI1A 1WC6A 3DFEA 3M6WA 5JVGQ 3H0PA 2K3IA 2NREA 4I2PA 4JI0F 4QYRA 3TVYA 2B9EA 2GCFA 3G6VA 3IRXA 3QFWA 1RISA 1EAYC 5AXLA 2QFJA 2PDAA 5B09A 3MMCA 3UPFA 3WDOA 2MGZB 1KFDA 2CPEA 4NRTA 5KFRA 4LF5F 1VQ5S 1ICEB 4ERDA 4QZVB 1FK9B 1ZPWX 3Q23A 3SV4A 2UUCJ 2AJQA 1MWQA 3PNIA 4MKYA 3EX7B 1JMTA 4QU6A 2OTJS 2OP5A 1NXIA 3QT6A 1Q95G 3FBEA 5KT7A 4YB7A 2BACA 4J9QA 2ZC3A 2HFZA 1KSPA 1U2FA 1Y4ZB 1XMOJ 3HX9A 3K17A 1AYEA 3M8RA 3THPA 4S0MA 3QBCA 4NLDA 1N33F 4I2PB 1MSWD 3M8YA 1CULA 3FJ2A 4F4YA 1SXLA 1JJ4A 3HD2A 3IRXB 1CEZA 4F2RA 5JUMA 3MMCB 3P5BP 3TRGA 2CPDA 3G6XA 1N4LA 1VJQA 2BKNA 2NYHA 2HHXA 4RW7A 1IBLJ 3IWXA 5K14A 2Y8YA 2CWXA 2R7UA 3KUGA 2A1BA 1M5HA 4NLSA 1MU2B 3N0VA 3TVKA 2CA9A 3LUYA 3FSIA 1GMUA 4OYOA 4ZVRB 1D8ZA 2L9NA 3SI8A 2QG9B 5F0WA 2B7CB 1FO1A 4L73A 4ETZA 1X5SA 2W8LA 2FHJA 5T7LA 3EPGA 2CPZA 3MPVA 1LFWA 1T9VA 1N34F 4ZITA 4FKXA 2DEJA 1HBNB 1C0UA 3I6PA 2YH0A 2ZUGA 2KG1A 1UFKA 5GAGI 3SXLA 1IBMF 1MN9A 3W9HA 4JV5J 1UWBA 1IR1A 4PG4A 3NAHA 3MMBB 5KT5A 4OI0A 3GIRA 1BE4A 2AEJA 3ZTPA 2C22A 3AJ1A 3VZHA 4L75A 3R6LB 3CNQP 4XPCA 1AFJA 1H0HB 3T5HA 1XNRJ 3EGNA 4X62F 5EWEA 3GV7B 2E5LJ 4RW7B 1WOSA 1M5SA 4OX9F 2I6WA 5I4MA 1RKJA 5GADU 3IAM9 4C98A 3CCRS 2HS4A 2H65B 1IBKF 2OHDA 3L3CA 4KAIA 3WC0A 1RTHA 1X4CA 3RRGA 1NDLA 1WHXA 5CXTA 4RO0A 1KD1T 1GMVA 2MSSA 3T5KA 2I9SA 3N01A 2MSTA 5T7LB 5A2QY 4ZVFA 1PSDA 2JHEA 1VISA 2AQ4A 2YKPA 3HVAA 4MTPA 5HSPA 2CQ4A 2DTJA 4ZVGA 2J5AA 1C0UB 4OYXA 5HL7Q 3JYTA 3FGVA 4PXEA 4CO4A 2F4VF 4IR1A 1T3NA 3KLIB 5KFEA 4LF9J 5FDLA 1BWEA 3VCDA 2GV1A 1KVIA 3FMBA 3HHEA 2CVEA 1H7WA 4USMA 4DR1J 3FQKA 3AD8C 3SCKE 1HR0J 3QIDA 3SEOA 3FCHA 4PG5A 1HD0A 2WCXA 1Q53A 1FDDA 4GKJF 3PKMA 4ZP7A 3G6ES 1ROFA 2W2PP 4O3OA 4ES3A 1WKLA 2VDHA 2FVQA 1RTZA 4H54A 3V6KA 1RTHB 3QAUA 3ILLA 5BYRA 1CSJA 3D66A 3KMSA 3ETOA 2ZH1A 3F56A 3P6YC 1WSRA 2Y0SD 3GILA 3ZTQA 3BH7B 3OXLA 2YQ0A 4USHA 2CQ1A 4PRFA 4KBIA 3TJ8A 2UXCJ 3JYTB 3S6EA 5KFHA 2XGPA 2UVVA 3A8IA 2PEBA 3I0SB 2EG2A 2ZM6J 5FDLB 4FBTA 2HLTA 4J9RA 1W2IA 4ZPCA 1F2HA 2F9DA 2V8VA 1TKTB 1RI7A 4WPAA 3RBEA 4X4TA 1Y3JA 4ZP6A 4FXVA 1OY9A 3FKBA 1WNEA 4ZVUB 2P5VA 2ZHAA 1WG5A 2O67A 2XHCA 4GRSA 1XR5A 4B3TJ 2GFFA 4C8YA 2G4BA 1M1HA 3O44A 4TVAB 2RU9A 2FLLA 2VFSA 3W2WB 3KWMA 4K4VA 1VI7A 4FBUA 4DLGA 3UDEA 2JEGA 4HYKA 1EZZB 2IDLA 2XMVA 2LLZA 5MAOA 4KPYA 3QGPA 1RK8A 1MROB 2HVEA 1GXTA 4OYZA 4TN2A 5I3QA 1JLBB 2QLWA 1FFGB 4E8UA 3LPEA 3TW0A 4ZK7M 3TX8A 1NK4A 2LYVA 2HRUA 1UAWA 2AU0A 1S7HA 2YWEA 4YR0A 2XI3A 1C4CA 5DGBA 3QSIA 1KRPA 4TYAA 4NZ7A 1RAGB 4B3RJ 3RAMA 1WF0A 1FD8A 4F3OA 2HNDA 3O2IA 3TANA 1KC8T 2JC1A 3A8JA 5KFGA 3CDUA 4UY85 1V6HA 4KGXB 1HMVA 1H38A 2AZ1A 3W8PA 3T41A 3J7YU 4QWDA 2FJXA 3EE3A 1O0PA 2N82B 1BY9A 2E1RA 4NPOA 1S79A 3PXGa 3NGRA 4C4WA 2XMTA 5L1IA 2X1AA 1A0OB 2MKCA 4WE1A 3W61A 1RWKB 4DU8A 2OSQA 3T5LA 5A8WB 2FGOA 2LQJA 1MMNA 2IM1A 2R2UA 3KFWX 2HHPA 2DR8A 4U7CA 2J76E 1U49A 1F9EB 1P1LA 4A8WA 5KFCA 1UZHA 1JLCB 1B0PA 5E3QA 1RHKB 1Q78A 4DPYA 1U02A 3W60A 3CVKA 1SI9A 3MXHP 5KFMA 4ID8A 4HT7A 1UVKA 3KK3B 2HNDB 3ET6A 4ZMMA 3LP2A 3PFOA 3W2VB 4WU2A 1YJWS 2OI2A 1EHWA 3VVTA 2DJWA 2F4FA 1F9HA 2BANA 1Y5LB 2PSZA 4HVZA 2RDIA 4KH0B 3MEEA 1QVGR 2PFFB 2HQCA 1VRUA 4ZPVR 1H2UX 4DV1F 3HSGA 3BGFA 4ZN3A 4N5SA 2CPXA 5GMKa 3HFKA 4ZA1A 4NL5A 3N28A 2W2MP 1WTFA 4OJGA 4ZVEA 4YHHJ 5JJBA 5IM0A 3I56S 1YZ7A 1RT6B 2QN6B 1NB2A 3M30A 2DK2A 2G13A 4DR4F 3M2UB 3HJFA 2CJQA 4UUWA 1RTDB 1VC6A 4Y28C 4NLYA 1AUDA 1WI8A 1P9QC 2DR9A 3IAS9 4R5PA 4HH1A 4JI8F 2J8SA 3ZNUA 5HN0A 4P72A 2PMWA 2Z4PA 2D7SA 2VB6A 1SQEA 4DFMA 2VG5B 2R8KA 4B3MF 2B9YA 4C3MA 3VAJA 4RU9A 2IFXA 3ZFVA 4DL6A 3EYZA 4X4SA 4X4VA 4NXMF 1Q86T 5DGAA 3MEEB 4DR7J 1VRUB 4J5OA 2HFUA 2FY8A 5L46A 1AUSL 1S4EA 2WTFA 3KLHB 1QJHA 5K9FA 2Z2LA 2V2ZA 3RB0A 1TUVA 3H59A 4FXWA 3R7BB 4C0HA 2KZMA 1VBXA 1AT1B 3BR8A 5HVHA 5CQGA 1CLFA 2C2MB 3M30B 1ZTWA 1X60A 3GJRB 4X4OA 2QZ8A 3CCES 1HWJA 4N8OA 1KLMA 1N52B 4K4TA 1XC9A 3GYGA 1NPPA 5HAOA 4R5PB 3O1LA 4QIVA 1B70B 4CNYA 1HW9A 2VOOA 1XERA 1R8HA 4P73A 1Z2ZA 1RCXB 4QQBA 4CLSA 3PDNA 5FIIA 4LSZB 4W98A 4RW4B 1FDBA 2ZITA 2KXFA 4KGVB 4CT9A 4ZP9A 3F73A 2ROEA 3BSOA 1YWXA 4O3PA 1TR0A 2NLWA 2R8GA 4DR5J 4WFBQ 2QL9B 4KY3A 2CQGA 1Y9OA 5DJBA 4DR3J 1FESA 3AQOA 1ZA1B 3GFXA 1G2EA 1QAJA 1PC4A 3POTB 5CYJA 1SH2A 2P9EA 2XY5A 4KO0A 5D4LA 4G65A 4JYAJ 5DQHA 2DGUA 3P49B 3G87A 1DBDA 1S0NA 4FS2A 3ILOA 2PI4A 4DXLA 4P2SA 1BXNA 2IAJA 4WP3A 1KLMB 3W66A 1S0VA 1XNQJ 1UVIA 2E1MC 3S7RA 4ZJLA 1KQSR 2ZOGA 1FE0A 3RRKA 2OEJA 2RUSA 2MKKA 2OPPB 2GQQA 1H6KX 1L3UA 1M5KC 4K59A 2VPWB 2HQGA 1HA1A 2ALYB 1RJJA 1S1TA 2KYXA 1O6XA 4ZOSA 3KHHA 2ATCB 4ZCIA 2A6OA 2Z56B 2W4DA 1D09B 2E1AA 2E44A 2WW4A 3DNCA 1AZSA 4NMLA 1B7FA 2EFOA 2SXLA 1ZBTA 5G4DA 2ACYA 4NLQA 4YDXA 2MKIA 2XMJA 2HHHJ 4L3KA 4HLBA 2FJEB 2FHOB 2JX2A 3M32B 2W9CA 4QWBA 2AWZA 2BDPA 3OT9A 3IWLA 2FQQB 4OJ1A 3K59A 1D3WA 2ZEJA 3IO1A 1Q8KA 4ZJOA 5LOQA 3Q24A 3TAMA 2BKOA 2W2QP 1FTCA 2DXEA 5J1EA 1N5YB 4C9DA 2WRMA 2IAJB 4P10A 1V3SA 1RLCL 2XYGB 2XY7A 4DSIA 4JV0A 4AYBD 1WF1A 1KQFB 2ZC4A 1K0VA 7FD1A 2PD1A 3BSNA 4YB6A 1TAUA 1SL1A 2Z57B 2J0WA 3F41A 3CCMS 1Q7LB 1S1TB 2GO8A 1F60B 3NS5A 3RR7A 1DLOA 1N56A 4YY3F 2QMWA 2MEWA 3QZ8A 2H4WB 2COLA 3OL8A 2V5HG 2VG7A 5AE1A 2YNGB 4DPUA 4O23A 4CO0A 2XMUA 2CPHA 3BYRA 2D3UA 3HK2A 3PX0A 2W9CB 1F0XA 1Q7YT 4LRBA 2YXLA 4A8FA 2HFOA 2OFGX 3BKFA 3VGTA 3DRPB 2RT3A 2MZSA 4NCBA 1SVDA 2YKOA 2EI5A 2QC3A 1TFWA 1IKYA 4OI3A 2F3JA 2H5JB 2A6MA 3RW6A 3TAMB 3AJ2A 1FKOA 5J1EB 4CM0A 4ZVHA 2BJEA 3ISND 4LVOP 2WSCC 4AFFA 1ZM4A 2J9CA 3DRYA 4WF9Q 3HSDA 1IR0A 1N0UA 2XS5A 1RA7A 4IKAA 1WI6A 2UUAJ 1UJ6A 1S48A 2OUGA 4K4SA 4A46A 1T9WA 2BA9A 4F50A 2VG7B 4JI3J 3BKTA 1RADB 4IG0A 1SKSA 4IOAQ 1WG4A 3CCVS 1Y10A 4ECUA 2LXFA 2WZ1A 2QRRA 4ELVA 5KG4A 2GHVC 1OS5A 4LQ9A 4Q5VA 2YX1A 2A10A 4L74A 4J9PA 4LQ3A 2AJ4A 1SH0A 3RGIA 2VASA 3RB3A 3R8YA 3CJ2A 5FJ4A 1IKYB 3I5BA 2YKMA 2J0XA 3V2UC 3KG1A 1YBAA 2F9JA 1FKOB 1U24A 1X0PA 4QW9A 4KFBA 2KYZA 3H5SA 3GPAA 3JAMU 4DV5J 2V8GA 3MCSA 3DLEA 1WJ9A 4X4UA 2AYBA 1RUSA 3QSYB 4LF8J 3G8TA 2RRBA 3WIVA 3A3OB 1RWWB 4LFAF 1CQMA 5U47A 3PJ9A 3S01A 1X7VA 2AF6A 2J6SA 2IPOB 5KFIA 1TTHB 1SKUB 3PJWA 2V69A 1NKCA 4C3KA 2DR6A 3QMQA 1JLFA 4IYQA 3HKWA 2I8EA 3FVYA 1U6FA 2VHGA 5KG2A 3OJSA 3I4PA 1YZ6A 2B4OA 4PABA 1RHRB 3CWJA 3BJYA 2BJ8A 3T19A 4ES2A 3LA0A 2H1YA 1M1KT 1TKXB 2E1PA 2X7IA 2W2NP 3US5A 3GZ7A 3DLJA 3CJKA 2IBOA 3OBIA 8AT1B 4C7QA 4YS2A 3PRVA 2K7JA 4JP8A 4AL7A 2V67A 4FKYA 1Q8IA 2YKMB 1Y5NB 3FEZA 1RHUB 2ZDOA 1PJ7A 3HSJA 1T05A 1UPMB 3NGSA 2POKA 4KC5A 3PX4A 1PCAA 2M8HA 4QYZK 2WSEC 1GMWD 4X2BA 3QATA 1A9NB 1YLXA 3KKFA 4USVA 4J9LA 1GX6A 2ASYA 2QA4G 2HFVA 2E5HA 4U6PA 4WP8A 1HNXJ 2MHEA 2AKWB 3J80Y 2WB1D 1HNWF 2M2BA 1G4CA 4HH0A 1Q81T 2Y1RI 3NRBA 2QA2A 1TK8A 4G1IA 3F44A 1VLYA 3P96A 3R5CA 1NZAA 3OLBA 4B9VA 2IA6A 2D74B 1HLWA 3KK1B 4ECQA 6FDRA 4WP9A 1RB0A 1N36J 3PVXA 3CCUS 3J81Y 3QIPB 3CJKB 4Z7YA 4LRAA 3BBBA 2YQ3A 2WVFA 4JI7J 1U4BA 1NJXA 3MEGA 2HURA 4CWBA 5IT4A 2CZ9A 1IWGA 4LT6A 1FE4A 3EDQB 2Y1JA 3VZIA 1M90T 5I42A 2NQPA 1FRXA 2DXFA 4Y6IA 1R0AA 1T05B 1CS4B 1NK5A 2I0XA 4EWTA 3CEDA 3DGPA 1ACMB 2OPRA 3SFGA 4NLPA 3AA8A 3D0GE 2HHWA 1G6BA 4FP9A 4OZ1A 2ADCA 5CABA 1JX4A 1PGZA 3EUNA 1FJGF 2AP6A 1RWMB 1TL3A 3FMWA 1FEHA 2XI2A 3BGRA 3DCAA 3QRQA 2V34A 3K2YA 1U6BA 2J7UA 2EXUA 5F8HA 1UVMA 2HQDA 5BR8J 4WTYA 4Y00A 3TVZA 4A8XA 3M7VA 2VFUA 3Q8VA 3FEYB 1QUPA 1Q5YA 3T1YF 2YWFA 4C8LA 2L41A 1VQYA 4ECVA 2UVUA 1K9MT 3AA9A 1TKDA 1NU4A 4KV8A 4O44A 2VIHA 1OPZA 3GONA 3H2VE 2EFGA 2DHXA 2NXNA 2VBZA 3C6TB 3HPOA 1K1QA 3SDEB 4GKKF 1UFWA 3MEGB 1SC3B 2DGVA 2NR0A 1HHSA 4KGKA 2XYHB 3C6UA 5DDQC 1N88A 1OSCA 1HYSB 3K0JA 1TL4A 4DG1B 2GJ2A 2CQCA 4IQMA 1R0AB 2E7XA 2XLKA 3HVTA 2Y1LB 3DGPB 2OPRB 2LDYA 4YMEA 4RUAA 4A47A 1EP4A 3MD1A 4B9SA 1T02A 1FNMA 2CKWA 1IJFB 2IHR1 1TL3B 2OD6A 3BGRB 3U02A 1C0TB 1GXUA 1Y5IB 3KNGA 3KXDA 3MDFA 1WC3A 2Z0GA 1RSCA 2LQBA 3KLGA 3IM8A 1KNZA 3BN7A 3E3XA 2ROPA 3TWZA 4PXBA 2R8IA 1D9AA 2L3MA 1EB0A 3ZO7A 3G71S 5LSOA 3DMJB 1SC4B 4FNIA 3CF5Q 4BC9A 4UTGA 4DV7J 3PKYA 2XNRA 1Y0HA 2N4DA 3DYAB 5BYQA 4WFYA 2Y1IA 4FN5A 2E9ZA 2WVEA 4Q44A 3RTVA 2RIJA 2A0FB 8RUCA 2F40A 2DHAA 4EZ9A 3NY0A 5T41A 3UCZP 3PW7A 2FJBB 2RKIB 1R43A 4CO1A 3PW4A 2AV5A 2R7TA 4ID5B 5HQMA 4FXDA 1K73T 3CO0P 4RW8B 1JLGA 4M94A 2W4PA 3OTEA 3SIPB 2YNHA 4DPTA 2KXHA 1RAAB 4UZBA 1EP4B 3AFGA 2JH3A 3QJJA 2LP4A 3LWLA 1S6QA 2CZ4A 3LGNA 5KFBA 3KLGB 2BXJA 1N48A 3MR7A 3TUPA 3AXMA 2B4PA 5AJ3F 2YX7A 1HD1A 4FPIA 5BXIA 5LSLA 1ZS6A 2HGNA 3IBWA 1X4BA 3L09A 5CHCB 5KT6A 3B8HA 2VV5A 3W8GA 3ZTSA 2QFIA 3CJ5A 2VJVA 2QA1A 4W92B 4XTTA 2FLPA 2XC9A 5KAKA 2FYXA 3MOZA 1JLGB 1S6UA 3EVMA 3DXSX 4DV0J 1VMBA 2YNHB 3CJTA 4NASA 4M5KA 4Y2CA 2V9WA 2XLJA 2Z2YB 1JNRB 4CCHA 1UFLA 2VKRA 4YDDB 3M1VA 4YP3A 4J9OA 1S6QB 1M5OC 2EFVA 5A2QU 3O5TB 3OR1B 2W9BA 2IRUA 1R89A 2XM3A 3OLAA 4PQUB 1TUGB 3GYNA 2Z2ZA 4LBIA 4DV2J 4HL9A 3LO3A 5LJ3Y 4KGZB 2AYEA 1FWLA 2R7SA 2J9EA 3M2VB 1RT1A 2OKQA 3CB4A 1LWCA 5H9EK 1I5OB 1M5PC 5GAEI 3QYYA 4UOGA 2MB0B 5SUHA 1YDLA 2MKJA 4OI2A 3CDAA 2BABA 2G9OA 2R42A 1PBAA 2QLBB 3TO8A 2P8IA 2CQDA 3B82A 3RJMB 2ZH8A 5IC6B 2PC6A 5GAGU 1QD1A 4DL4A 1WC5A 2RF2A 2B5JA 1FF2A 3MFIA 1KTQA 4C11A 3NGDA 1R8PA 3Q8UA 3VR1A 1F3VA 4I7FA 3GYXB 3TR5A 2AYMA 1X31C 3M1VB 2LEAA 3M8SA 1ITPA 4LF2A 4OIXA 3I82A 1AA1B 3OSNA 3N6MA 2GMLA 2LFVA 3H4BA 2C3OA 2W9BB 2JNJA 1U2RA 4HDGA 1V3ZA 3PY8A 3IRWP 1B64A 1BC6A 4CT8A 4ZPAA 3GV5B 2NSBA 2RILA 4OI6A 5HBMB 4TU7A 4LF7J 1PAEX 4DR6F 1LWCB 2LVWA 2E9RX 4LJMA 3NMAA 3H90A 2OTLS 2W9AA 1Z4UA 2ZD1A 1YGYA 1BWVA 4WXOA 1PC5A 4F4AA 1DJ0A 1IBCB 3ENAA 3KJVA 3TA1A 1R27B 5DRKA 4RR5A 3T9ZA 5F8LA 4B3SF 2GHPA 4C11B 1V9OA 1O8BA 1VBYA 1UP1A 4I7FB 1RT5A 2NUHA 4NYPA 3CW2C 4MK7A 1J5EJ 2DR5A 2RSQA 2F63A 2BVZA 3A1YG 1RAEB 2CQIA 3LP1A 1ZAVA 3KK2A 1XR6A 3UD3P 2V2KA 1SCJB 1TQLA 3QRRA 1P6TA 4GVBB 2HHVA 4IOBA 1VQ6S 2EKNA 2G0CA 4OYAA 2VQFJ 1PJ6A 2HZCA 1FEEA 2DGXA 3BGLA 5DQIA 5KFJA 4YB5A 3E2EA 1KQGB 2B8QA 1M1GA 2KO1A 1NJWA 1HI0P 2EBGA 4WU3A 3VGSA 2V8DA 1R31A 2XSFA 1K8AT 4OHVA 3NLCA 1SPBP 1WHWA 2CJBA 2JFKA 2J6TA 1REGX 2FC9A 4KHRA 2HZVA 2W7OA 1UVLA 4GVLA 2HFSA 2GNKA 1NJIT 1RT5B 1VQ8S 2QMUB 5EGYA 3F0NA 2UVWA 3IA0A 5EUHA 2D9OA 5HVFA 3AH6A 3X1LB 5IC4B 1Q16B 3CJ3A 3TX0A 2HSEB 4KRWA 3G86A 4YEAA 3KK2B 1NHUA 3AD7C 5HO4A 2PMZD 3VQSA 5LM7E 4DSLA 2R7VA 2ZBCA 3IXQA 2NXEA 4GMKA 1TELA 1SL2A 1M0SA 1RXOB 1G3OA 4MIWA 2DY1A 4WFNQ 4QWCA 4U8YA 2JSXA 1DTQA 1NH8A 4R8UA 4DV6J 4LF6F 5KT2A 3FBCA 1ELOA 4ANDA 4HEA9 1GT8A 1MMLA 2ASDA 1X9MA 3SQOP 3B54A 4ECZA 2DITA 3VAFA 3PZPA 2H51B 4ED0A 3PYFA 1XK8A 1REVB 5A6PA 1CJUA 2BJ3A 4ZHRA 1LNQA 4DN9A 3BBFA 1TZ0A 4RNNA 1S59A 1EKRA 3TUZC 5C42A 3R5DA 3OPKA
chains in the Genus database with same CATH topology
4ZK7M 1F5BA 5K5MA 3TX8A 3C6UB 5J2PB 3DDKA 3ITHB 1NK4A 2LYVA 1F2GA 1S1XA 2C2RA 4DL0C 2WOMB 3KHLA 2HRUA 3MWBA 1UAWA 2W7AA 4QOTA 4N77A 2AU0A 1S7HA 2YWEA 2ERRA 3RR8A 4F8RA 2HG4A 3GFHA 4YR0A 1P27B 3MAHA 2XI3A 3HVTB 1C4CA 5DGBA 1KN6A 3ZZRA 3DRRB 1KRPA 4TYAA 1KVJA 4NZ7A 5DO2A 4FZVA 1S99A 1VQ9S 3OUYA 1FNXH 3M9NB 2LMIA 3RAMA 3PX6A 1WF0A 4W90B 1FD8A 1U6ZA 4Y2MA 1IXKA 3GE9A 3CUNA 2UU9F 4ECSA 2HNDA 4F3OA 3O2IA 4CQ1A 3TANA 1X9SA 1KC8T 2VFTA 5AXNA 4PR6A 2JC1A 4BBYA 3GR1A 4QR2A 5KFGA 3CDUA 3LOUA 3NMRA 2ZJRQ 4UY85 2HHSA 4DMZA 2V4QA 1FJ7A 1Q8BA 1V6HA 2XLIA 1HMVA 2MJUA 4AE5A 4TQRA 3I5AA 1H38A 2UVRA 3OVAA 2VH7A 4KSEB 4ECYA 3J7YU 4QWDA 3PW0A 2FJXA 2UP1A 4PKDB 2R8JA 4JV1A 4H4MB 5D4PA 1O0PA 2B56A 2N82B 2LA6A 1BY9A 4E98A 4QPXA 3OQ2A 2E1RA 4DFKA 4OZLA 5F0UA 1S1WB 2CJ9A 4QIFA 1CG2A 4NPOA 1S79A 3H5XA 4I4BA 1DTQB 1RT7B 1MMDA 4B17A 4R8UB 3PXGa 5G0RB 2DR7A 4WFXA 1F9FA 3J7YI 3DLBA 3MPWA 4C4WA 5CCLA 2XMTA 5L1IA 4DFPA 2L9DA 2PGCA 4DX8H 2VFRA 2X1AA 2MKCA 1DQAA 1FRLA 3IR7B 4WE1A 2XSJB 4ED6A 4ED8A 5CA5A 3A8EA 4WIIA 2DNPA 2OSQA 1TK0A 4KR0B 1KTVA 5F9NA 3H40A 2ZHBA 1SV5A 3T5LA 5BJRA 4X65F 4I67A 1LW0A 1IM4A 2EKYA 5A8WB 2FGOA 2LQJA 1MMNA 2IM1A 4X66F 2R2UA 3KFWX 4IR9A 2ZOFA 2HHPA 1VQMS 3M2RB 3L95X 3MGJA 2DR8A 4U7CA 2J76E 4C3LA 4DOZA 4URGA 5C42B 2FGCA 3EXCX 1RTIA 2B9WA 1U49A 3PFEA 4UUXA 1FKPA 1ZETA 2W4CA 1QLNA 3S8SA 3UNGC 1GTHA 1P1LA 1RWUA 3H25A 4A8WA 1CQNA 5H9EJ 1S1XB 5FLXY 2GIRA 5KFCA 2PA3A 1D0EA 4G3IA 4ECXA 1VK3A 2MYFA 2UV8A 5DDOC 3ULHA 2AD9A 3B4MA 2I5JA 4NXNF 1JLCB 1B0PA 5E3QA 4F4XA 1Q78A 3MM6A 2XO7A 3DOLB 3SQGA 2RQKA 1FJEB 3CD0A 3CVKA 1SI9A 3MTKA 5M2PA 3MXHP 1UW4A 1ZZFA 2IA0A 5B0EA 5IQQA 3T9NA 1U1MA 3HLUA 5KFMA 3OUYB 1N5TA 4ID8A 4HT7A 1UVKA 2CPFA 2RB7A 1N6QA 1P1TA 3KK3B 1JIHA 2HNDB 1TKXA 1XWLA 1HBMA 1UEVA 2AX0A 4OLOA 2MKSA 2WW8A 1IN0A 1WACA 3LGMA 3C66A 2L9WA 4CI0B 3LP2A 3PFOA 3W2VB 4ZMMA 1VJWA 2GX8A 4WU2A 4N76A 2B7BB 1YJWS 4IRDA 1AROP 3DLLQ 3KHRA 2IJNA 5CZVA 3GG1A 4M8LA 5KG5A 2DJWA 3DHXA 4QBUA 2C2DA 1NKEA 3E51A 3NNAA 2CPIA 2BANA 1Y5LB 2OSRA 2PSZA 3ISZA 3QPIA 3DXBA 4HVZA 2VQEF 5LMUF 2RDIA 2KFNA 1YHQS 3SSQA 3NGKA 3MEEA 2LDIA 4Q45A 1QVGR 4OHXA 2BRLA 2EC0A 5D8HB 1D1UA 2PFFB 3MHYA 2J6UA 2MQQA 1VRUA 2IRXA 4ZPVR 3CIMA 4RUHA 1H2UX 2D3ZA 4IRCA 4DV1F 1TV6A 1GAOA 4ITSA 1VQNS 3GR0A 2Q6CA 4RKUC 1BD6A 1NAQA 1W25A 2K1RA 4QPTA 2KM8B 2RRNA 1FHTA 2E9TA 2Z8QA 3BGFA 2JEIA 1JNZB 4N5SA 1QSYA 2CPXA 5GMKa 4QU7A 4ATNA 2HYIB 3O8WA 3HFKA 4CTAA 4ZA1A 4NL5A 1NO8A 5KG6A 4AXIA 3Q8PB 1YJ9S 5SZTA 3N28A 1HQUA 5B0BA 3V81A 2RQ4A 4IRKA 4NLUA 4TY9A 1YRUA 5C24A 5KFSA 1WTFA 3KOAA 4OJGA 4ZVEA 4DS5A 3H98A 4F4KA 5JJBA 5IM0A 3I56S 5L1LA 2X1FA 2XNQA 2XB2D 1GH8A 2R4FA 4Q43A 5LT5A 1JK9B 1RT6B 3BSAA 3M30A 3J7A1 2CPYA 2DK2A 1FKPB 2CQ2A 1QE1A 1U47A 2G13A 4DR4F 3ISNC 3BO4A 3DRXA 1HBOA 3M2UB 3HXMA 2OMLA 5J2NA 3HJFA 2CJQA 4UUWA 1WEYA 2BV3A 2R7RA 1RTDB 1PO6A 3GIKA 2IMOA 1VC6A 5CCMA 3MUTP 4GC6A 4Y28C 4YFUA 2GIQA 4JUZA 4NLYA 1AUDA 5KFQA 1WI8A 2ATLA 2R7OA 2UUCF 3H4DA 3HI9A 2KT2A 4IFVA 5HP1B 1P9QC 3MM6B 2DR9A 2MZTA 3HT3A 4YB1P 1NK9A 1LW2A 3IAS9 4EEYA 3PRDA 3MR3A 5DG8A 1JJHA 4ED5A 4R5PA 1VQSA 4HH1A 3AB2B 3OFGA 2JLGA 4JI8F 2ZH4A 1VIOA 5K8MA 1N6QB 1YQHA 4C8ZA 5HN0A 3KK1A 3K8VA 3PIPQ 3V6DA 1HBMB 4U9RA 2Z4PA 2D7SA 3K58A 2R7XA 2HWTA 2VB6A 3LPYA 3HM9A 3BO3A 3H5UA 1SQEA 2YKNA 4JI6F 1QVFR 3H20A 1VS3A 3WC2A 3QIPA 5M2RA 4B08A 3NBPA 3ENWA 3V6JA 2VG5B 4DFMA 5HROA 1UJ5A 2R8KA 3Q0AA 4B3MF 4XDCA 1S97A 2B9YA 2VFVA 2UZAA 4C3MA 3VAJA 2O5DA 4RU9A 2EFPA 2O1PA 2IFXA 4X4RA 4E0DA 3ZFVA 4DL6A 3EYZA 5DQGA 4X4SA 3HDSA 4X4VA 4NXMF 3CPWR 1WHYA 1SJ4P 2CQPA 3HHDA 2R9LA 1Q86T 5DGAA 1VQ4S 3QO9A 2HAIA 3SFUA 1HFEL 3MEEB 4NWBA 1UEUA 2DCLA 1JXEA 5E0OA 4OZJA 2B4UA 4ILRA 1VRUB 4J5OA 3OVBA 5DDRC 3PIOQ 1YITS 4I6WA 4ICLA 1TV6B 3MURP 2FVRA 2C3MA 1SJFA 1XMOF 3M4XA 4OJ3A 2K1RB 5K8PA 4B02A 5K14B 1S49A 2ZOMA 4NYOA 5KFYA 4MKAA 5A8KA 1NK6A 2J8AA 2MJNA 2WTFA 3KLHB 1QJHA 1LFPA 5K9FA 2Z2LA 1ZAXA 3QWUA 4CTAB 2EBEA 2ZKTA 3RB0A 1DTTA 4C97A 1NB7A 1TUVA 1HQUB 1RT1B 3H59A 2K3KA 4FXWA 3V81B 3I55S 4UW2A 3C46A 3RAQA 5K8NA 3G6YA 5C24B 4C0HA 2KZMA 4ILLA 2FIUA 2U2FA 1VBXA 2DGOA 3FDSA 5A8RA 4I1TA 4PWDA 4DBQA 1WTBA 3BR8A 2ZNYA 3LWMA 1YIJS 5CQGA 1CLFA 5DG9A 3M30B 1ZTWA 1YJNS 1QE1B 2OJ3A 3OJUA 1HBOB 2B6AA 2DCUB 4UQTA 4ZKAA 4X4OA 5IWAF 2XS7A 5J2NB 2QZ8A 3CCES 4DS4A 1LK7A 3GG0A 2KKHA 3MM7A 1HWJA 2NS1B 1IBLF 4DQRA 1VOMA 2W24A 4MK9A 4DV2F 2X3GA 4LMZA 1F5CA 4AXJA 4N8OA 1KLMA 1N52B 2RF2B 4TQSA 2KM8C 1PILA 4IFVB 1FRJA 3ZC4A 4K4TA 1N32F 1XC9A 2B5JB 1LW2B 4O3RA 2J0SD 3DRSA 4R5PB 3HP6A 1UA0A 2DVIA 1APSA 1HPZA 2R7WA 2KJVA 3I87A 5AXMA 3D5MA 3O1LA 2VUGA 4QIVA 4CNYA 2FVSA 1HW9A 1FJCA 3V6DB 5HQ8A 4ETXA 3BM7A 4D3HA 2DNOA 3HHLA 2VOOA 1XERA 1UWBB