2U1AA

Rna binding domain 2 of human u1a protein, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
88
structure length
88
Chain Sequence
MAPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Tertiary structure of RBD2 and backbone dynamics of RBD1 and RBD2 of the human U1A protein determined by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 14
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 1997-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2u1aA00
2N82B 2JWNA 1OO0B 3CCUS 2CQCA 2EVZA 5JVGQ 3NS5A 3G6ES 2MMYA 2MPUA 2ZJPQ 5IFMA 2OTLS 2L08A 1VBYA 2HYIB 5LSOA 1WF1A 2KH9A 4LMZA 3S01A 3UD4P 1DRZA 2BOPA 2MKHA 2OTJS 1SJ3P 2RRBA 1WI8A 3MUTP 1VQ9S 1XN9A 1H6KX 2MKSA 3CCRS 1F9FA 3CC4S 1PGZA 3MD1A 1R8PA 5DDOC 2U1AA 1X4BA 1YJWS 4C7QA 4ED5A 2DHGA 2DITA 5GAHU 2DGXA 5LXYA 1QVGR 5GVQA 2QFJA 2CQHA 1X4AA 2KRBA 3I56S 1VC0A 4Z2XA 2CQBA 3N9UC 3EX7B 1M5PC 2Q79A 1KQSR 1SJFA 1WHVA 3CCJS 3THPA 2CPJA 3UCGA 2DGQA 2F9DA 1OPIA 2B0GA 4YB1P 2X1AA 5HO4A 4TU7A 2DNQA 2AYBA 2YH0A 1CVJA 3MI7X 2KRRA 2MZ1A 1N88A 2CPFA 1M5KC 1H2UX 2MZTA 2OSRA 4IUFA 1U6BA 3PIOQ 1VQ4S 2XB2D 3MDFA 1X5SA 2DNOA 1U1QA 2JVOA 3CMAS 2RRAA 4IO9Q 2A3JA 4M5DB 1VQKS 2E5IA 2MYFA 2DGSA 2MY8A 4LJMA 1U1RA 2PEHA 2RVJA 1JJ4A 2LCWA 3U1LA 3R27A 2KHCA 3V4MA 2CQGA 4J5OA 1AUDA 3P3DA 2J76E 2XNRA 2DGWA 4U67Q 1M5OC 2DB1A 1VQ8S 1M90T 2YH1A 2N7CA 1X5TA 2KM8C 2L9WA 3CCLS 5MLCV 2VOOA 3UCUP 3BEGB 4FXWA 1VQ7S 1M5VC 2MXYA 2MSTA 2LQ5A 3CCES 1YJ9S 3Q2TC 2NLWA 4W90B 5GMKa 4WFAQ 3JB9k 4IOAQ 2UP1A 2OJ3A 1P1TA 1VQMS 2MQMA 1D9AA 1U1MA 2GHPA 1X5OA 2MKKA 1X4EA 2MQNA 1S72S 2M7SA 3CTRA 4ERDA 1U6FA 3CMES 2DNRA 3D2WA 4YOEA 3MUVP 2ZJRQ 3CUNA 3CD6S 2G0CA 1VC5A 2MGZB 1X5PA 2LKZA 2KXFA 1B7FA 3BO3A 1ZZNA 2RT3A 3MUMP 1WEYA 1HL6A 4UY8T 2EK6A 1X4CA 1U2FA 4CH1A 2K8GA 3VAKA 2LXUA 4PKDB 2M70A 3VF0B 2FHOB 2N3LA 2CQIA 1JJHA 3RW7A 1UFWA 2FY1A 3J7YU 4WKRA 2RUGA 1JMTA 1HD0A 2KYXA 2K3KA 2M2BA 1Q81T 3DLLQ 2MGZA 2DH7A 2MKJA 1K73T 5GAEU 3CPWR 1OIAA 1SJRA 2PE8A 4UQTA 5LJ3Y 2E5HA 3B4MA 3SDEB 1NU4A 1FJCA 2MSSA 3TO8A 3G8SA 4F25A 3G96A 3FEXB 1KD1T 2LA4A 2MHNA 2DNKA 3CF5Q 1QVFR 2DHAA 2M8HA 1S79A 2KXNB 4CQ1A 2MZJA 2E44A 5DM7Q 1Q7YT 3BO4A 2AD9A 1IQTA 4A8XA 4W92B 2F9JA 1FHTA 3Q2SC 1WHXA 3UD3P 2DGTA 2KT5A 1DZ5A 2DNGA 5IM0B 3NNHA 1RK8A 2MQQA 2KG1A 1DBDA 1WHYA 2QA4S 3UE2A 3US5A 2MQLA 3S7RA 4Y00A 2RNEA 2DGOA 3SDEA 1H2TZ 4YUDA 2M88A 4BS2A 2DIVA 2DHXA 1QM9A 1UAWA 3NNAA 2M4MA 2ZJQQ 2MKIA 3SMZA 3I55S 3EGZA 1SJ4P 5JVHQ 1U1KA 2CQ0A 3P5TL 5ITHA 2KFYA 3U1MA 4Y0FA 1A9NB 1WG5A 1VQOS 1X4GA 3B4DA 2G1DA 5GADU 1H2VZ 5IM0A 2CJKA 1FJ7A 3P6YC 4P6QA 3S8SA 2AYGA 1VQ5S 2RS2A 2BZ2A 1N52B 3R1HA 3FEYB 1N8RT 2CQ2A 2XS7A 2XSFA 1DHMA 2MB0B 3BO2A 3G71S 4WIIA 2JRSA 2JX2A 1KOOA 3NMRA 2XS5A 4TU9A 3HHNB 3CULA 1ZZFA 2F3JA 1FT8A 2MJNA 3LQVA 2YKAA 3G9CA 4F26A 4QPTA 3VAHA 4CIOA 3G4SS 1VC6A 2AYMA 1O0PA 1WEZA 3HI9A 5DDPC 2J0QD 1R8HA 1N54B 2CPXA 3IRWP 1NJIT 3ZZZA 3G8TA 3VAJA 4C4WA 3NS6A 1SXLA 3EGNA 2FC9A 2YWKA 1WELA 2LXIA 2AYEA 2M8DB 4TLQA 4IOCQ 2VONA 1VBZA 1U1LA 1UW4A 2MZSA 1P27B 2XNQA 2LYVA 4ZKAA 2MZRA 3BS9A 1OWXA 2E5GA 4TU8A 1RKJA 1WF2A 2MKCA 2DNPA 5IQQA 2N3OA 2KM8B 3PIPQ 2L41A 3DXBA 1URNA 2KG0A 2MY7A 2QEXS 2X1GA 4FXVA 5DDQC 1VQ6S 2KN4A 3LPYA 2DO4A 1HD1A 4QQBA 4EGLA 2DH9A 2M52A 3VAMA 3P49B 2CPIA 2WBRA 4WFBQ 4CH0S 5DM6Q 1YIJS 2M9KA 2DH8A 1KC8T 3K0JA 2VOPA 3VAIA 1U1NA 2DGVA 5CXTA 2DK2A 4LIRA 2HZCA 2J0SD 2HGMA 2KI2A 2HVZA 3UCZP 2XS2A 2DNHA 1W2BR 2V94A 3L3CA 3H2VE 2D3OR 2ADBA 3CCVS 1JJ2R 2LMIA 5CYJA 2ERRA 1YTYA 1Q86T 2D9PA 2MQPA 5DETA 1X4HA 2CQPA 4PR6A 2ADCA 1G2EA 2RS8A 1WWHA 2MQOA 4QU7A 2SXLA 1WEXA 2GO9A 3CC2S 4WFNQ 1VQNS 4F02A 1L3KA 2DNLA 1FJEB 4OZ0A 1PO6A 5LJ5Y 3RW6A 3TP2A 2CPDA 2DNNA 2MJUA 4C0OC 1X4DA 5DDRC 2DNZA 2KVIA 1K8AT 1FO1A 2HGNA 5H1SV 4OZ1A 4QU6A 2CPYA 2LEBA 2KXHA 1Q82T 1K9MT 1FXLA 2DO0A 2RQCA 2RQ4A 5GAGU 2CPZA 2EK1A 4RU2A 1WI6A 2J8AA 1WG1A 5LSLA 2MZQA 2OSQA 5D78A 2D9OA 1YHQS 2RU3A 2OIHA 2DHSA 1X4FA 1KOHA 2JVRA 3MXHP 3CCMS 2CQ1A 3CCSS 3ZZYA 3TYTA 1ZH5A 1FNXH 3VAGA 2CQDA 5BJRA 1M1KT 3ULHA 2YTCA 2HGLA 1BY9A 4PRFA 1U1PA 2X1BA 1VQPS 5LXRA 2CQ3A 3MOJB 5FJ4A 1A7GE 2LA6A 3VAFA 1X0FA 1SJQA 1VBXA 1D8ZA 1WHWA 2FC8A 1WTBA 2LECA 3UWTA 2LEAA 1NO8A 2M0GB 5EN1A 1WF0A 2I38A 3CCQS 4V19X 2U2FA 2DIUA 3OW2R 3CXCR 1HA1A 2DGUA 3S6EA 3J7ZT 2G4BA 1U1OA 3MD3A 2FPHX 3SXLA 3THTA 1YWXA 2I2YA 2KU7A 3CC7S 1YITS 3MURP 1UP1A 2DISA 1VQLS 4WCEQ 2CPHA 2X1FA 5D77A 5CA5A 1YJNS 1WG4A 3IWNC 2DNMA 2VODA 3VALA 2CPEA 4WF9Q 3NNCA 1YI2S 2O3DA 2CQ4A 2E5JA 3H2UB 3R1LA 2NZ4A 5HL7Q 2DNYA
chains in the Genus database with same CATH superfamily
1HQEA 4C8ZA 3W7BA 4RX6A 5J1NA 5L38A 3NS5A 2V2KA 3R5JB 2UVUA 1UL3A 1XBWA 5LSOA 3HJFA 4AXJA 2H1YA 3S01A 4X65F 3MECB 4A8FA 3MUTP 4KV8B 3Q23A 3M1VA 3N01A 2AQ4A 3NCRA 1E6VB 1QAIA 4NXNF 2CJ9A 4EWTA 4F4ZA 2QFJA 2PMHA 2CQHA 4BWJA 4H4OB 2WB4A 3FRZA 2UUBF 2CZVC 3EYZA 2B51A 3D6FB 1G4CA 8RUCA 1IJEB 2ZH9A 1N88A 2CPFA 4M5KA 2OSRA 3VVUA 4HI1A 4ICLA 5LT5A 3R5BA 2JJ4D 4IO9Q 3KLFA 1HNXJ 3DOKB 1T3NA 1Q5YA 1LW2B 4QZVB 2YNHB 3VV2B 1P9QC 3VCDA 1GMVA 3K57A 3FBBA 1IR2A 2CDRB 4B3TJ 2HKEA 4GVBB 5U47A 3H7HB 3I31A 4DL0C 4I6WA 5KG2A 3Q2TC 2YXLA 5DS7A 2JFDA 2GQQA 2ASYA 3I5CA 1GFWB 2Y1LB 3B82A 3BSCA 5CZVA 3CGIA 3HXMA 3KHLA 2OMOA 1RZMA 4CT9A 3CO9A 3DYAA 1JLBB 2DY9A 1UPMB 1WEYA 2H4YB 2D69A 2KL8A 1KP6A 1EP4B 2VBZA 4NCGA 3OL9A 3FUYA 4AT1B 3M2RA 2CQIA 1LWEB 2IC3B 1TR0A 5KG0A 2UUCJ 1TELA 1EARA 1SCJB 1CC7A 4NASA 2E5HA 3U02A 1XIQA 3PX4A 1QVFR 2M8HA 4DEZA 1FFWB 5DM7Q 4WTYA 3UN2A 4L3KA 1VIOA 2ZBRA 1Q8IA 5DGBA 3UD3P 1N34F 3AD8C 9RUBA 3SDEA 4YS2A 1Q4RA 2KB2A 3NNAA 1GEHA 2IBOA 3PM9A 2DR6A 3MPYA 3SMZA 2DYAA 2BE2B 3UDCA 2WVCA 2CQ0A 3NY0A 4DSFA 3H90A 2KFYA 1N33F 3UNGC 3KHGA 2K2PA 5I42A 1H2VZ 3OFFA 3P6YC 4P6QA 1ITPA 1SL2A 2W1BA 3RBDA 3PW0A 3W8PA 1N5YA 2E1MC 4USJC 3SSQA 1TL7B 3FFIA 5DDPC 4ZIVA 4DCJB 2YQ3A 3GMGA 1Y0HA 2AP6A 4EBEA 2ZOFA 2LQBA 4NX9A 2E5GA 3BH7B 3SCLE 4I67A 2I9SA 3CIZA 3K5MA 2H5EA 2NYIA 4DBQA 3MR2A 2ZM6J 1UJ5A 2E7VA 4H4MA 2DRBA 4LIWA 4TNOA 3AAWB 5E3PA 2HZCA 1KKHA 4ZLPA 5DRKA 3IR6B 3T5HA 3L3CA 8AT1B 1HNWJ 2C2OB 2BXJA 3H59A 5B0CA 4OI0A 2HHPA 1HMVA 1AYEA 2ADCA 2HK3A 4U6PA 3NGRA 1U0SA 2FLNA 4IFYB 3DNCA 2P9GA 4ZCIA 4OZ1A 2LEBA 1S1VA 3D0GE 2RQCA 1U7LA 4OI6A 2V2QA 4RU2A 5GADI 1FWLA 3MPWA 1S7IA 2E9ZA 4QWCA 1IVZA 1RT7A 1XWLA 3GFXA 3TYTA 1T9YA 2YTCA 3P45B 3SIPB 5KFUA 4LSLB 1UA0A 4O44B 4ZPVR 1F5BA 2HBQB 3M8QA 4FVMA 1WOPA 1XTZA 3LUYA 1WF0A 4G6VB 1YJ7A 3OL8A 3OW2R 1NHKL 2XCPA 2M5YA 4LF5F 1HWLA 3THTA 1XEZA 4MIBA 2HFZA 4JI4J 2X1FA 4CLUA 1T94A 4LF9J 4Q2MA 1NH8A 5HL7Q 1ZM2A 3J7YI 2WOMA 2JWNA 3ISNC 3NRBA 4OL8A 5GAEI 9ATCB 1QE1A 5J2QB 3T1YF 3Q8RB 1KRPA 4IH5A 4AL7A 2EBEA 3CJ3A 1UFLA 2HMIB 3ZTOA 1GT8A 2MKSA 3M8RA 2LDIA 3CD0A 4LBHA 5LXYA 1MMLA 2GMLA 3UD5A 2XMUA 4AFFA 5CD4H 4B9TA 3CCJS 4LFBF 4F4WA 3EE3A 4G1QA 3W5XA 3ELHA 5AXNA 2AYBA 2YH0A 3D5MA 4MFBA 2QLWA 1IR1A 4EO8A 2GIQA 2X3DA 1RHJB 1LEOA 1Y9OA 1OMSA 4IDKA 2HFUA 2E5IA 3MPVA 3VGSA 1VGYA 4OIXA 4UF4A 5C25B 4F2RA 1L3TA 1OS5A 2X3GA 3V4IB 1GMWD 1CQMA 3QPIA 1ZA2B 1C4AA 2C3UA 1XR6A 2NREA 1AA1B 2B43A 1HNZF 3HHDA 4RW6A 1UA1A 5KT7A 3CJSA 4AL6A 3SEOA 1DTTB 2OKQA 1S49A 1J5OB 1WDDA 4DG1A 3MUMP 1Q79A 1VS3A 1OSCA 1X4CA 1SKRA 1NZAA 1S1WB 1P6TA 1XR7A 2V9KA 3J7YU 1HD0A 3TA2A 4RBTA 5GAEU 1PAEX 5J2NA 3FEXB 1H74A 2Z57B 2V6AA 4CLWA 1WKLA 1Q7YT 3BO4A 3BSOA 5I3UA 2CYYA 4Q0BA 4DX8H 4DV5F 5K14A 1NPKA 2LQ8A 4JI6F 4HKQA 2MQQA 2KG1A 1WHYA 5DG9A 1UVJA 4LQ3A 4QYZK 4EMDA 1QM9A 1UAWA 2HQCA 5C42A 2ZJQQ 4JI7J 1FWPA 2PA8D 3C66A 1OY9A 5T14A 4DR4F 5H9EJ 4JV0A 1VQOS 1IR0A 2VJUA 2OEMA 1PYOB 2ZD1B 2CJKA 3OFGA 2Z56B 1LOUA 3R1HA 3FEYB 1Y5LB 5K8PA 5LL6d 3PFOA 3BN7A 4FN5A 4WP3A 3QGPA 4HACB 3KLVA 3G9CA 1C0TA 4N5SA 3QT5A 2DXDA 3CIMA 4OHZA 3MHYA 1TP7A 1VISA 4OJ1A 2YWKA 1ZM4A 3RTVA 4IOCQ 2FZKB 1UW4A 4X62F 4X62J 3SFGA 2J9CA 2V8PA 4I0WA 4DR5J 3K7RA 3H20A 2JSXA 3M8YA 1V6HA 1S77D 1JKHA 3D6MB 2KM8B 3UDEA 2BQ3A 1EQ0A 1JK9B 2P8IA 3QAEA 3TVZA 4DV1F 3N5FA 1FJGF 3BBBA 3DOMB 7FDRA 4ZVEA 2EFOA 2WBMA 3DLEA 4ES2A 3VGUA 4KY3A 2BVZA 1P9YA 4CRJA 5KFCA 1CEZA 2FD2A 2E1CA 1RDRA 2LMIA 4NEZA 4QIWD 1CJTB 1Q86T 2C2EA 4NZ6A 4WBFA 3MAAB 1G2EA 2GO9A 1K44A 1JLEA 4FS2A 1NB2A 2FB0A 3TP2A 3FQKA 2BQRA 3MCNA 2DNZA 1W2IA 4WP8A 3BKFA 2HVIA 2RQ4A 5J2PA 3RRKA 4DV2F 3NP5A 4ZJLA 2MZQA 1S1UA 2X7IA 2QLXA 4K5RA 4ZA1A 3MXHP 3CCSS 4I1TA 1R43A 2CQDA 3SV3A 5JJBA 4EUVA 1FKPB 3QO9B 2HS0A 4DZ6A 4PRFA 3DGPB 1RSCA 1EETB 2GGPA 4R25A 1Y5IB 2Y3YA 4EBCA 2VBYA 3EDRB 1QTNB 4P2SA 3QNWB 1SH2A 3EGVA 3M8ZA 3A1YG 5L46A 3Q0AA 1XK8A 3G87A 4O3OA 1WD6A 3W66A 1BMQB 2UUAF 4QWEA 1WG4A 2VODA 1PC5A 7FD1A 3LALA 2NZ4A 3POTB 1M5SA 4Y2MA 1HBUB 5KOWA 4DL4A 1X8DA 2MPUA 3BPSP 2QA4G 4LR8A 4DCOB 2NQPA 1WF1A 3MMAA 1Y3KA 4OYMA 2Z2ZA 5A8WA 4QW8A 2NPIA 3DDNA 2Y8YA 4PYDA 2F63A 2PI4A 2FJDB 2DHGA 2DGXA 3H8YA 4JV1A 1X4AA 1FF2A 1VC0A 2OLWA 3GV5B 2I8EA 2VPYB 3MCSA 4ETZA 1I94J 2MZ1A 1U6BA 4FBTA 1C0UB 2LP4A 2E5LF 3HHLC 1SIWB 1QDUB 1AZSB 2V0NA 4HDGA 3QAUA 3BGRA 1MU2A 3E51A 2N7CA 1XMBA 5D0GA 4ECQA 4TY9A 5MLCV 1VLOA 3W61A 1OY8A 3BEGB 4FXWA 2RDIA 4M5DA 1VCTA 3C14A 2L48A 1YJ9S 4WE1A 4YQWA 1S59A 1RWVB 4PXDA 1RT5B 1D9AA 3OBIA 3C6UA 3KK2B 4NXMF 3KKFA 1T7PA 5L8RC 1S72S 3BSAA 2ZJRQ 4DPWA 3DMJA 2PMWA 1JXLA 1DQ8A 4A8WA 3BZQA 1DLOA 3E8OA 5G4DA 4LFAF 3FBCA 2YKQA 3HCXA 1Q16B 1JXVA 2WVFA 4USTA 3MM9A 4XTTA 3GIRA 4F4KA 2JZ5A 4G3IA 1BQNB 3CF5Q 1R7IA 4HL9A 3RAXA 4USVA 5C2CA 5K8NA 1QUVA 1PJ7A 4PUOB 2YNFA 3Q2SC 3R7BB 2YY3A 3F0NA 4PABA 1RACB 1T8EA 4JV2A 3D66A 3A4TA 5EWEA 3EGZA 2C3YA 4LR9A 1FXDA 4U7CA 5HBMB 2ZEJA 1FX2A 4USMA 4DV7J 1IN0A 3EXCX 5IM0A 4URQU 2WK4A 2IM3A 3CDWA 3MGJA 3V6DA 2ZZMA 4G65A 4I69A 1REVA 2CVIA 5E7OB 1ZM3A 1RKIA 5F8MA 3WIVA 5DGAA 3GJSB 3EGNA 2R2TA 4N8NA 2R7UA 4ILLA 2O01C 1P27B 1TFWA 2XNQA 4BHQA 2VV5A 3OD2A 2R8JA 4DF4A 3CDUA 2VF3A 4TU8A 3DFEA 1AT1B 5B0EA 2KT3A 2WW8A 2ASLA 2KG0A 1S6QB 4CTAB 3DLJA 2KN4A 2VBWA 3VGTA 1IKVA 1SUQA 5ETMA 1JLGA 4I7FB 3G6XA 1K0TA 5A8RA 1XNQF 3GJTB 2JH3A 1ELOA 1SKWA 3MEGA 1VJQA 3E01B 3MR5A 2VKRA 3WC2A 4L3NA 2HVZA 1UFKA 2CUYA 2ZH6A 3LTOA 3MMJA 2D9PA 3D6TB 1A0OB 3X3UA 4OI4A 2HK2A 4WU3A 1D8YA 1L3KA 2VG7B 2FJVA 4NI2B 4R5PA 1NK0A 1WKJA 2JFKA 4N8OA 4PZVA 5CAAA 3DRRA 4Y3CA 1URRA 3MWBA 2D41A 5E3CA 3M4XA 3M8PB 1EHWA 1TV6B 2PMZD 2UVRA 3TQ1A 4NLPA 3OXLA 2QMXA 1F3VA 3HVWA 1LWFB 5KFIA 2X51A 3TUPA 3BPDA 1VRUB 3M2VA 2XGQA 5B0BA 3ILJA 1NKEA 4QIFA 1N0VC 4KH1B 4LF1A 4ID5A 4JI5F 3ZZUA 4JI5J 1QLNA 4OV6A 3H4DA 4MMOA 1M1HA 5AXKA 3KG4A 4X84A 5ETPA 1RTZA 1UP1A 5E3QA 2J6UA 3M2UB 4P7VA 2HRUA 2CPEA 1T03A 4QIGA 2QO3A 3GSDA 3G4SS 4UTGA 4ED3A 2XYPB 3HFKA 4CM0A 2W25A 2MMYA 2HYIB 1SC4B 3N4WA 1MROB 4PG7A 1KN6A 3OSNA 2BM1A 2IHR1 1UVLA 4TY8A 3DHWC 5KFQA 2OPQB 3BGUA 3CCRS 2YPZA 1KFDA 5DJBA 2BQUA 4KQZA 1FRJA 1XMQF 2VDHA 4KR0B 2VQEJ 2RJZA 2Q43A 1M5PC 2Q79A 1KQSR 4ZCMA 2CWKA 4YB1P 4JI0F 5B0GA 2GC8A 4LF6F 4LF6J 1NKBA 4IUFA 1GMUA 1RTDB 2JVOA 2A3JA 2I5JA 3VHQA 3V6HA 2RF2A 4R8UA 1NK4A 2K3IA 1RWWB 4ECVA 4X4NA 2NUHA 1WORA 2QYCA 1RT2B 2VOOA 1E6YB 1S10A 5DLFA 3PW4A 4W90B 1Q7LB 3AT1B 2HFVA 1RTIA 1P1TA 2OJ3A 5D0HA 1U6FA 2DNRA 3CUNA 4L72B 4NLWA 4EK2A 2FVSA 2EI5A 2OPRB 3HT0A 2LKZA 4CO5A 3R6GB 3DLGB 1GXTA 3LPEA 3MFIA 4C8NA 3DRSA 5A2QU 3IRXB 2FGCA 1UFWA 2KVQE 1JMTA 5G0RB 1NNDA 3HVRA 4E0DA 3W63A 5E41A 2H65B 5CYMB 1N48A 5LM7E 3FBFA 1SQGA 3ETOA 1FJCA 2UZAA 4FF4A 1S12A 3GJRB 3HSGA 2XG8A 3UVJA 4NLYA 4RNOA 3PNIA 4I64A 2ZOMA 2ZVIA 4CNZA 1M0SA 2HLUA 3AB4B 2KT5A 3NNHA 2DNGA 4NMLA 1SC6A 5F8GA 5GMDA 2HVEA 2HNZA 4OYZA 1HW9A 2IAJB 2V4JB 4QWDA 2OFHX 2EBGA 1U1KA 4X4TA 4RU9A 4ZPWR 3RAQA 1Q53A 3OTOF 4ECXA 2FJBB 2HWIA 2C3PA 1H7XA 1RBLA 1K0VA 3AXMA 2IYIA 2CWXA 1HIYA 1KOOA 4K4XA 2W24A 1RT1B 3RG6A 3KK1A 2B5JB 2IJNA 4ELVA 2YKNA 2R7VA 3CEDA 4ILMA 2J5AA 3NS6A 2FC9A 2LXIA 3FKBA 1S4EA 2V8HA 1RA6A 3PX6A 4DPTA 2AT1B 3MM6A 1V3SA 2HVHA 5D8HB 1RKJA 5F41A 5AXMA 4DUZF 2HIYA 2ATCB 2GJFA 3PFEA 2QEXS 5LOQA 1VQ6S 2QA2A 4Y34A 3R8YA 4YB5A 4C9DA 4CDIA 4HTIA 4A8MP 3H98A 5KT6A 4JI3J 5C24A 2DK2A 4B3RJ 2KJVA 3GE9A 2WW4A 2ZVSA 2XS2A 4NLSA 2V4QA 5K5MA 4HHJA 1GH8A 2DXEA 4HTJA 1U0HB 3J7Z5 2ILYA 3DI6B 3BBCA 3CC2S 2DNLA 2DHHA 2QA1A 3KK3A 1KLMA 4LBIA 2HGNA 4I2QB 4UW2A 4XIUA 3ZZPA 1VFJA 2C22A 5KFOA 1LK5A 1UCNA 3D3BJ 1Z1ZA 4DOZA 1RADB 2CQ1A 2WZ1A 1XERA 2COLA 3BGLA 1F6TA 4S0MA 2DEIA 5LXRA 3IBWA 2DR8A 2NXEA 1RT3A 2ZC3A 1RBOB 1QAXA 4BDPA 1ZS6A 1N32J 1KQGB 1OJ4A 5A6WA 2VHGA 1YJVA 2NPFA 1S9GA 2PD1A 2VZ9A 4YR2A 1G7CB 3MM7A 2ZWOA 4J9KA 4ZPCA 3J81U 2CQ4A 3K8VA 5SZTA 1XMOJ 1UWBA 1KVKA 4USKA 4OZLA 3PVXA 4OX9J 3M9OB 1RAIB 3UD4P 3MM8B 4C8LA 2OTJS 5C2GA 3Q89A 1U25A 4EEYA 4ZVUB 2R2RA 1VQ9S 4ED0A 4K2JA 4OJGA 4Q8EA 1PGZA 1LV5A 1X4BA 1R0AA 1RAJA 1HNVB 5KFTA 2R8HA 2WSEC 3K58A 4IG0A 3I56S 4B9LA 1XJWB 1SJFA 5DLGA 3FCHA 4OLPA 3KHRA 3ITHA 3NMAA 5HO4A 1FKAF 3H5UA 2F65A 5IZHA 4O4RA 3DRXA 5HLFB 3ZXWA 1HHTP 3SCJE 3K5PA 3QJPA 5GAGI 3WX4A 3GSIA 2VICA 1F60B 2RKIB 3R27A 4J5OA 2MLYA 3Q8SB 1U09A 4ECTA 3DXSX 4DFPA 4M5NA 2OI2A 3DN9A 1SC1B 4AQYF 1X31C 4H4KA 3H4BA 1HQEB 2JEIA 4WP9A 4KBIA 2DT9A 1LK7A 5DZ7A 2QLBB 3OV7A 4ERDA 4DV3J 3LANA 2W9CA 2W8KA 5E3RA 2BACA 2HPUA 2PT0A 3M1VB 3R2CJ 1FTRA 4FF3A 3C15B 2C2NA 3W62A 2XHWA 1T9TA 4IKAA 2EK6A 2LXUA 2HHHF 4IQXA 2DPIA 3SCIE 3VF0B 2FHOB 1MN9A 3UDLA 3M6VA 5AT1B 1S6PB 1Q81T 1JLCB 5F8NA 4NMXA 4ENOA 2HFSA 3GLJA 4DSKA 2VFUA 3DU5A 5EHHA 4ICLB 1NU4A 4Q7AA 5AE2A 3G96A 4ECYA 3OHBA 4FBUA 1Z2ZA 2E44A 1IQTA 3OT9A 4A8XA 1HNIA 4I6AA 3Q24A 3W2WA 3MEKA 3FMWA 5A2QY 2KO1A 3R7NB 4GRSA 3W5YA 1GX6A 4DHVA 1Y3JA 1H38A 5CCLA 4WFZA 3I55S 1YBTA 2B4UA 5KFAA 3RJMB 4ZCLA 2GV1A 4CWBA 1N5TA 3CB4A 3BN4A 2C2RA 3D9BA 2FIUA 2FQQB 4ZN1A 2A2CA 1REGX 4IH7A 4P2FA 4IOBA 2QV6A 2FJEB 1T11A 2YWFA 4O0IA 4RW4A 2BANB 4B02A 4TYBA 3OL6A 1ZTWA 1S7HA 2DKOB 1RWPB 3KJVB 2PIIA 3GCXP 1N6QA 2RRNA 2W9BA 3I5AA 2VPWB 1HI1A 3VAJA 1NHUA 2HQDA 3B6BA 3L7PA 4DL2A 4OJ3A 4C3MA 2ROEA 1KWMA 3TZXA 1BHNA 4ZKAA 2HW3A 3PTWA 4UQGA 2OFGX 4DSIA 1UEUA 1FD2A 2EFVA 1RHQB 5RUBA 1RWUA 2AJ4A 5B08A 2DO4A 2RSQA 5IT0A 2DH9A 1HKAA 4MKYA 3CWJA 2K1RA 4WFBQ 5DM6Q 4HVZA 5FDLB 4PG5A 1KC8T 4QJVA 5H9EK 4O3RA 1FFSB 1PIEA 3MMBB 3KOAA 2EPIA 3GYGA 4M5JA 3CCVS 5KG4A 5I42B 1VHIA 5CQGA 4DFMA 2IA0A 2RS8A 4J9LA 4RBUA 1FRHA 4CH7A 4WTOB 1HBMA 1PO6A 2CPDA 3CDEA 1GAOA 2W2NP 5ETOA 3IP0A 1PYTA 4JYAJ 1TUVA 1K1QA 1IM4A 1QAJA 5LSLA 3SSRA 4RUCA 4OYIA 1YHQS 2OPSA 1ZM9A 2HGLA 3JSMA 3ADAC 3GIIA 5A0YA 2DCLA 5DG8A 4TXSA 3NWRA 1UTAA 3HD2A 2CNLB 2VKZG 4USUA 1RISA 2XO7A 2YNIB 4V19X 3CSKA 1HA1A 4H4MB 4PWUA 2I2YA 1YWXA 3BH6B 5L1JA 2CPHA 3AD9C 2F4VF 4UOHA 1TKXA 1T05B 2YKMA 1GX5A 3CDAA 4EZ9A 4FYYB 4MJKA 1S97A 3CCUS 3IM9A 2AZ1A 4HR2A 4RPFA 2GVDA 1T9WA 3T6JA 4J9PA 2GIRA 3H42A 2IM1A 1X0PA 3IGVA 4K4UA 4L74A 4DV6F 1N56A 1TKTB 4UOCA 1G3OA 1B7YB 3J81Y 2GAHC 4DR7F 3PDNA 1APSA 4LREA 1UJ6A 2FY8A 3QT6A 1HHSA 3MECA 2ZHOA 4FDFA 3R5DA 3RYLA 4JI2J 1CVJA 4KV8A 5F8JA 3FNNA 1M5KC 2Q1LA 3PO4A 2JHEA 1E6VA 2F8HA 2VC0A 2VD3A 2DNOA 3A8IA 4ZJQA 4B3OB 4KFBA 4H4OA 1Y00A 1HARA 1AUDA 4OYAA 1B70B 2DB1A 4CLTA 1VQ8S 2ASJA 1OPZA 1XQIA 3FZBA 5A76A 1IKWB 4FNHA 4IG3A 2IM0A 1LW2A 2MQMA 2GHPA 4N41A 4HT5A 2ZE2B 4R0JA 3C8YA 1X5PA 3BM7A 4LSNB 4GVBA 3PACA 2L3MA 3IA0A 4C48A 3GV7B 4WZMA 4QYRA 5HI7A 4UY8T 2OMLA 1OQ3A 2ZKTA 1ZPWX 1RT4A 5HJXA 3OR2B 4NCAA 1RCOB 2BJ1A 1PILA 2RQKA 1UMJA 2FLOA 4FPRA 4Q45A 3LP0B 1TMJA 2QJ3A 1JLBA 4LRDA 2XY7A 4JUZA 4ZJOA 3LO3A 3ZTRA 4F50A 2DHAA 2W9AA 1EP4A 1R27B 1QSSA 2OUGA 4WYWA 3TEHB 4W92B 2IC3A 2LEPA 4LF4J 3OVBA 4DX7A 2ZKUA 4HHHA 3Q8QB 1MG7A 2MTLA 2RAQA 3BGFA 1FDAA 2BV3A 2QRRA 2W2MP 1A9NB 2D74B 1HBOB 3ZFVA 2IVMA 4RW6B 4F3OA 4F67A 4ZLNA 1VQ5S 2XS7A 2KKHA 3EVMA 1DHMA 3LOUA 2VQFF 4O4GB 3K8WA 3BO2A 2FUG9 4DG1B 1RABB 2XSJB 1X9SA 4A4JA 4OI3A 3ZZZA 4FF1A 3BYRA 2H51B 4Y28C 4A8YA 2ZHBA 3KLIB 1WELA 1RI7A 1S9EB 4IRDA 1EAYC 1TK0A 2MZSA 5KFBA 2J7KA 3K17A 2XI3A 2AJ0A 1WF2A 3DRYA 1TL7A 3OTDA 3A8JA 2QG9B 1PAUB 4Q0BB 1RBAA 3HLUA 4IQMA 3Q86A 4J7CA 1G6BA 3QLHB 3IMQJ 4DL5A 2OO4A 1U1NA 3PEJA 1U8WA 2F5GA 1N5VA 3FBEA 1SJ1A 4PWWA 1IKXB 4P7TA 2GHVC 2V94A 2W7PA 1AFJA 4KRWA 5B7WA 4CLZA 1S0OA 1EX8A 2DEJA 4MIAA 2MKYA 4J9VA 4ECWA 1U49A 1RTJB 5AJ3J 4MYUA 2KHDA 2QMUB 5E2QA 1FD8A 2CPYA 4QOTA 4XDDA 5KFHA 2Y1JA 3K5NA 1CS4A 4CLLA 3HM9A 3HJVA 1Y7PA 1RAGB 2BMBA 2VU5A 2KFNA 2DHSA 5HSPA 4IFYA 3PR4A 3HO1A 5H9FK 3RBXA 1JKHB 1HBNB 2X1BA 3R5CA 4OHVA 1NDKA 2YWHA 3MMCB 4OYBA 3ET6A 1SJQA 4JV5F 2JC0A 4LRBA 1DAXA 5IWAJ 1S48A 4X4QA 3EMTA 4WK1A 3DDKA 4NE9C 3DLEB 3SXLA 3V81B 5BXIA 3TUIC 3AA9A 1YJNS 4PPDA 1RHUB 4LSLA 1IBKJ 1IUJA 2FZGB 3NNCA 2XLJA 1YI2S 1AFIA 4NLOA 1WC6A 3ZC4A 3K2YA 2CQCA 1Y5NB 3L7UA 4WYLA 4IH6A 5DQHA 5HROA 2DRAA 2L08A 1VBYA 2GAGC 1FK9A 2P9EA 4LMZA 1FRMA 2CA9A 2HHVA 2F1FA 1LWCB 4RKUC 2PGCA 2D3O1 2WTFA 2ZBPA 3DRPB 2XMAA 2V67A 2JC1A 2BEFA 4OZJA 2AJFE 1LNQA 2QT7A 5D15A 1QVGR 3AOCA 3N79A 4AYBD 5J2QA 3C19A 3N9UC 2UV8A 1ACMB 2CPJA 1NK6A 5LMUF 2AU0A 4F8RA 5LMUJ 2HMIA 3NOGA 2B4PA 3W2VB 2GGPB 1Q8KA 3PV8A 3BR8A 1U1QA 1FI4A 2GFFA 3T41A 3ZO7A 3E2EA 2MY8A 3U1LA 1M5HA 4RLEA 2E66A 2Z4PA 3RB6A 3HD1A 2F7VA 2L9WA 3NBPA 2PO4A 1DARA 1EKSA 1K1SA 4W4MA 2IJRA 4F4AA 3JB9k 4DDFA 1FRIA 5A8KB 1D1UA 2R7TA 3EZUA 3MMAB 3CTRA 4KB7A 4YOEA 3DDIA 3Q8PB 3LP2A 1DQ9A 2KXFA 4U96A 1YJTA 1RU1A 2ZH1A 3BO3A 3WDOA 4R0EA 1T9VA 1C1CB 2HS3A 3PW7A 2GMJA 3W9HA 1VHFA 2K8GA 4DLGA 5EWGA 3ETMA 2DTJA 2Z0GA 2V9WA 4GKJF 1PJ6A 3HT3A 1CJKB 1NXIA 1J27A 2MKJA 1DTTA 2BW7A 1O5JA 4YMEA 4C3LA 3W9JA 4UQTA 2Q6BA 3ILOA 3PG9A 1J2VA 3CJKA 1RAEB 1P8GA 1S1WA 3D28A 4AXIA 1RT6B 2R7XA 1NBEB 1YZ7A 1DZ5A 3TRGA 1MU2B 1F5CA 4KGXB 3QATA 4CO4A 3ILLA 2RNEA 1JWWA 2CKWA 1UVIA 2PDAA 2DHXA 2V69A 5HMXA 3OXGA 2M4MA 3C14B 2MKIA 1RCXB 2BOAA 2G2OA 3ZTQA 4ZLJA 4Y0FA 1JXEA 5KG3A 4HI2A 1BQMB 2CJAA 4ZVTB 1N52B 2BJ7A 5GMEA 4X64F 2MB0B 3UPFA 3FDSA 3NMRA 4QWBA 4XAKA 4JI8J 3N6NA 3QGGA 3OUYB 5B0AA 1NSQA 2XC9A 4NZ0A 4HYKA 2W7AA 2ZD1A 1CJVB 4KAIA 3MM9B 1V5IB 1HFEL 2WB1D 1R31A 3H0PA 3AQOA 1VBZA 4LR7A 2H54B 2WAQD 4Y2CA 3K59A 4LSZB 1XC9A 4DV4F 2MZRA 4HACA 4DV4J 3L95X 2R8KA 1UPPA 4RUHA 2WHOA 1MMDA 5IQQA 2FYXA 4KHPJ 3PIPQ 2MQ8A 4CZCA 2FVPA 4KJIA 2Q6CA 5DDQC 1FKOB 2YNFB 3TX0A 1JLFA 5J2MA 1HI0P 2CPIA 2WBRA 3TX8A 4QR1A 1JJCB 1AW0A 4ED4A 3Q83A 5J1EA 3ENVA 1ZYQA 5CXTA 5BYRA 4H4KC 2J0SD 2HGMA 1QD1A 2E9TA 6FDRA 3ENWA 2HNYB 5DQIA 2O67A 4PG8A 3DOMA 4LBPA 2MQOA 6FD1A 2VPXB 3PKMA 2B9EA 1REVB 1WOOA 2JLEA 1MWYA 2RILA 3W64A 4TKTA 1K8AT 1TK5A 2EFNA 3QWPA 1Q82T 4J9SA 3C16B 2XZDB 3HKZD 3BF4A 3VQSA 1WI6A 3MAAA 1HNXF 3L4BC 2IRUA 4ED1A 1WG1A 1TUWA 1S0VA 1NAQA 2WONB 2IA6A 1OYDA 2JVRA 2VL1A 4YR3A 1ZH5A 2QLJB 4NRUA 1M1KT 2BUNA 1WSRA 4B3TF 1SC3B 3RR7A 2CRLA 2B6AA 5I4MA 2LA6A 3M30A 2IM2A 2LEAA 1TVRA 3L7OA 1RHRB 3GYXB 3GV8B 3DLKA 2AWZA 4GC6A 1NJZA 1BUXA 3QRQA 2FPHX 2KU7A 1FKPA 3QJLA 2D1CA 5BR8J 3DGPA 4Z7CA 3A3PB 1ZETA 1NSPA 3IWNC 1PSDA 4RNHA 4IYQA 2YNGA 2VPZB 2EVZA 4ZPAA 2ZJPQ 4ZVGA 2VH7A 1HQUB 4R5PB 2UXCJ 2ZWPA 4ZOSA 4DQIA 2BOPA 2UUCF 2RRBA 1XN9A 1AROP 1GMWA 4CLYA 4WFYA 4C7QA 2DITA 1HBUA 4KPCA 2C1EB 3Q8YA 3OXFA 1D9FA 2LQ9A 5ADZA 5KFMA 1LXNA 5KG5A 2IRXA 1OPIA 2BJ3A 3QYYA 1VK8A 2NYHA 4FYVB 3CD7A 3KHHA 4YHHJ 1VQ4S 1MNEA 1LFPA 2EG1A 2ZHAA 2CJBA 1X5SA 4OHWA 1VQKS 2FZCB 4ID5B 4ER8A 2XWXA 1D3WA 3HULA 4DWIA 3CCWA 4TLRA 1JLAA 6AT1B 3GIKA 2F8EX 3Q8UA 5IS2A 3WHIA 2JEJA 2A0FB 1PJ5A 2AW0A 4M5IA 3WBZA 2EFPA 1ZAXA 4FYXB 4M5GA 5GMKa 1X5OA 3IS9B 3VWSA 3CD6S 2H3EB 1AUSL 2VFRA 4OX6A 4RO0A 2XO6A 2B4VA 2ZH4A 4P52A 3AOBA 1O51A 3N6MA 3KK2A 4ZCKA 3G2XA 4OZ5A 1SIZA 1YJRA 4DLEA 1MWZA 2RUGA 3HPOA 1D9DA 3A8EA 3W65A 5HN0A 2ZM6F 2QMWA 1N36J 2MSSA 3G6VA 3SQGA 2LA4A 2DXFA 3DCAA 4RW8B 3LGHA 1TL1B 5J1PA 2GQ2A 3TUZC 2RF2B 3GIJA 1HNWF 3ISZA 3TW0A 1JB0C 5IXUA 1QTMA 3NGSA 1TKDA 3RZAA 2GVZB 4F0MA 5L9NA 3NAHA 2Z2LA 1J5EJ 5AE1A 2MQLA 2KZZA 4M63A 4BBYA 4RZRA 1H2TZ 1Q1KA 1BQNA 1FRXA 4TYAA 4HLBA 2BE9B 1BE4A 2DBBA 1W25A 4B3MJ 1WG5A 3RUBL 1ROFA 1S99A 2RS2A 3QZ8A 4A8SA 1N8RT 1VJWA 5D6GA 2WVBA 4DS5A 2W4DA 4WIIA 2EW9A 3CJ8A 1Q8BA 4J9OA 3HHNB 1FT8A 2C2KB 2WRMA 1VC6A 3D0HE 4I56A 4B17A 4M5HA 4DSLA 4UUWA 1S4FA 4PQAA 1NPPA 4J9RA 3CJ2A 4C4WA 1BGXT 1X7VA 5D3GB 1FA0A 4YN3B 2XYGB 3PX0A 2V8GA 3LAMA 3TARA 3PRBA 4X66J 2MEWA 3AB2B 4USIA 1KTVA 1VRTA 4JI4F 1B4SA 4LF9F 4X4VA 1YBAA 4P2XA 5B0FA 2OEJA 1HD1A 2CDQA 1FDBA 2XTJP 3MR3A 1SH0A 2YKPA 4ZIWA 1YIJS 3R5AA 2V2VA 1Z4UA 2M9KA 2VOPA 5T7LA 1RXOB 3KMQA 3ENQA 4DUTA 2FJWA 1ZTTA 1S6QA 4CTAA 4EU0A 2HFNA 1FCAA 4L6V3 2N4CA 4I7FA 3QIPB 2QIFA 3U7JA 2Q66A 1SQFA 3V5RA 4DR3J 3M6UA 3ZTSA 5HMWA 4E8UA 1VQNS 1RYSA 4ZP8A 4OZ0A 2C3OA 3E01A 4LQ9A 1FXRA 2Y9HA 5HVFA 2GS8A 2KXHA 5DZ6A 4DL3A 1PC4A 3GG1A 2JDJA 4EBDA 2BJEA 2B56A 3O1LA 2J8AA 2QYGA 2OIHA 4RL1A 1U2RA 3M9NB 4M95A 3NOCA 3T5JA 1BY9A 2UXDJ 3AXKA 1S57A 1LW0B 4M1KA 1Q8LA 1RWKB 4K50A 1VK3A 3M8PA 1D8ZA 4CCHA 1WTBA 3UWTA 1TV6A 4WU2A 5EN1A 1KSPA 2QL7B 2I38A 3CCQS 4X4OA 4OYPA 3TAMB 3S6EA 1LWFA 5C24B 3CC7S 1VRUA 3D6HB 1H7WA 3KYLA 2DNMA 4FPIA 2GJ2A 3VALA 5E3AA 2N82B 3HK2A 4NLRA 3VZIA 3ZZRA 3G6ES 3C6TB 3GU0A 4X4RA 3FCWA 4YB6A 4G1PA 1KLMB 1W7WA 2BABA 3O2IA 3M2UA 4CYUB 1KHVA 2ZBIA 4ATNA 1BC6A 1B99A 1YJWS 4NCBA 3R3TA 2C2ZB 3T1AA 1WC0A 5D4NA 4OLOA 2FLPA 5ETVA 4DPUA 3UCGA 2R8IA 4PQUA 2F9DA 1K47A 2AMCB 2HEKA 2KDOA 2KT2A 2OPQA 2UVWA 4QBUA 1H2UX 1FTCA 2XB2D 2HHXA 5HAOA 1YBUA 1Q5VA 5KG6A 4JI7F 1B0TA 2P6SA 1IBCB 1CULA 3UR3C 2GMHA 4DPXA 1FWKA 1CSJA 1KQKA 3P8BB 2ZITA 4ZK7M 2XCAA 3OVAA 4A8KA 4FVCA 3NKYA 3MM7B 1V3ZA 4ELUA 4ECSA 1ULRA 1RTDA 3UCUP 1F5AA 1NJYA 1UWBB 4A48A 3J80U 4DR1J 3NCPA 2ZC4A 3D7SB 1U1MA 2PN6A 2HQFA 4PXEA 4C6AA 1KTQA 1RAAB 1RT2A 3QWUA 2ABYA 5KFYA 1E6YA 3KUEA 4DR5F 1R0AB 4X4PA 1UVNA 1FVSA 4E2FB 1U2FA 4A8QA 2FVCA 2ASDA 3KFWX 3GFZA 3DLLQ 2DH7A 2OPRA 1K73T 3W8GA 3DLGA 1CJUB 4F4YA 2QN6B 3G8SA 3KUHA 5EX3A 3KNAA 3BKUA 1GK8A 2EKYA 4ZITA 2XMTA 1SBRA 3IRXA 5EX0A 3QT8A 4BLGA 4C0BA 1HI8A 1WHXA 5G0RA 5KG7A 1FNMA 4UY85 4Y00A 2W8LA 1T0TV 3T6BA 4Y2KA 4V1Ak 3A13A 2ZH8A 1F9EB 3NL0A 3BJYA 2H9ZA 3K89A 1C1BB 4RW9A 5KT4A 2E9RX 4B3SJ 1NPRA 2C2MB 2O5DA 2W9CB 1RUSA 2V50A 5HQLA 3VVTA 3NGKA 1WSVA 1NB7A 2IAJA 2V4JA 4I6YA 1U26A 2JRSA 4TU9A 2CFXA 4Y2IA 1N54B 3HSDA 3CJQA 1TU0B 4CNYA 1MW7A 5K20B 2APOA 5E5NA 2W2QP 5HP1B 4EI2A 2HBYB 1PBAA 3I4HX 2MKCA 3NCQA 2N3OA 2B5JA 4OZ2A 4P75A 1URNA 3ISND 2LU2A 4QQBA 5IC4B 2FVQA 1U6ZA 2LVWA 2DH8A 2XY6A 3K0JA 3E3XA 3O5TB 2PC6A 4LIRA 3GFHA 2FHJD 5IOLA 2LDYA 2NXUA 3BDEA 4MAKA 1L3VA 2MQPA 5F3TA 1RGVA 3MEDA 2BJ9A 2SXLA 3HVTA 2ACMA 5LJ5Y 1JLQB 2D3UA 2PI5A 2VFTA 5K8MA 4C0OC 1X9WA 1FO1A 1KDNA 1B64A 1FEHA 1I94F 3G82B 2CZ9A 4NOHA 1VMBA 2VG6B 3DI6A 4KE5A 2J6SA 2OSQA 2OD6A 2V2ZA 1FNXH 4I2QA 4LUBA 2QSWA 2UXBJ 4CO2A 3KWMA 4ZVRB 4F3MA 3VAFA 1WHWA 2FC8A 2G2ZA 4OX8A 4UT4A 3MEEB 1UZDA 3D67A 1LKZA 3UDVA 1RLDA 1YITS 4WCEQ 3GILA 1H0HB 3LH2S 1SV5B 4WK3A 4DR2J 2E5JA 4F0HA 3R1LA 2E29A 5ETSA 2HWHA 4IFVB 4WWSA 3TQEA 4Q44A 4KSEB 4KO0B 3B8HA 3RAMA 4P72A 1KVJA 1NMEB 1HBMB 1DRZA 5L9XA 3D0IE 1WI8A 2V68A 1MLAA 2AGOA 5M2RA 3EXYA 3FGVA 4PWDB 1N4LA 4DCPB 4ZLLA 4K4SA 5GVQA 3HFZB 4Z2XA 3RU0A 2OPSB 3DC2A 3PKYA 3W1YC 4JP8A 3JSMB 2BBEA 2FHMA 1F1BB 3FEZA 3MI7X 4OZ3A 2RIJA 3TR5A 3HP6A 4KGKA 4GKKF 3ZTPA 1XNRJ 4GKKJ 1MMNA 2R7RA 3U27A 4DXLA 3RB3A 1U02A 2GIFA 4LFCJ 2J76E 4DV7F 3PYDA 4KIAA 5CYQB 2R7SA 5HLFA 2KM8C 4I2PA 1F0XA 2YKMB 2YQ0A 3OJSA 4BC7A 1VQ7S 4NYZA 2NSCA 1BWVA 2KTQA 4ED6A 2L9NA 2VUGA 2NLWA 1I3OB 4C8MA 1WC3A 2P9CA 3I87A 2ZFHA 1WC4A 1PG5B 4UUXA 4K8RA 3PHEA 3RBZA 1FERA 2RT3A 2CXEA 4FZVA 5AE3A 2BJDA 1U2CA 1JX4A 2YWWA 3I4PA 3TJ9A 5H9FJ 3MR7A 5AXLA 3G86A 4Y6IA 3PEHA 1I1GA 2J8SA 3J80Y 1NK5A 4X65J 2HVDA 3PRVA 2HHWA 4B9NA 1WJ9A 1BQXA 1OIAA 1UWAA 1L3UA 2C2DA 3C15A 3IG1B 2R9LA 2DNKA 4NXNJ 3SV4A 2FLLA 2NUUG 4KFBB 2E1RA 4P74A 3I0RA 5JUMA 2OELA 2F9JA 2UUBJ 1NH7A 2CJXB 3EUNA 3IAM9 3OJUA 1S6PA 1JLCA 3CJ4A 2QE5A 3KNGA 2DIVA 4Q2LA 4IG3B 1RU2A 3FRYA 4P9SA 1T02A 2RD5C 4M5LA 1X4GA 4RW7B 1WOSA 3S8SA 3OPKA 4C97A 4HDHA 2HHTA 4MK8A 1U48A 2HBRB 3OR1B 4RUBA 5FIIA 2IYGA 1FDNA 2YKAA 4F26A 1RT4B 3MCMA 1O0PA 2QTWA 3TWZA 2J0QD 1YSJA 3QRRA 2AYEA 4NA2A 3M32A 2BANA 1HQ2A 3UI3A 1G1XA 3KJVA 3SQOP 1BD6A 5KFXA 4FXVA 1S0NA 3C46A 5KFLA 2VA3A 1GQEA 2HS4A 3WX8A 3EZOA 4KHRA 4YEAA 1PYSB 2DVIA 4CH0S 3VAIA 2OPPB 1HPZB 4NYPA 5D0EA 4MIWA 1MN7A 2DNHA 3T9NA 3EGWB 3DOLB 3MPDA 4URGA 4L76A 2AJ2A 1JJ2R 1N34J 2I1RA 3AD7C 4L73A 4PR6A 2VQEF 2ZBQA 4CO3A 2XM3A 5FDLA 3BQ1A 2UUTA 3RW6A 5MAOA 4M8LA 5I3PA 4BCAA 5H1SV 3MMBA 1B3TA 1N33J 2ROGA 3M6XA 3OFEA 2EFQA 3HHLD 4CO0A 3GFYA 2J7WA 2J9EA 4NLGA 4RWXA 3RBEA 3TZZA 4U9RA 4IR1A 4EZ6A 2J0XA 3ZZYA 3VAGA 3UN3A 1EZZB 1VQPS 4ED8A 3AQPA 1YX2A 2P6TA 3M8SA 3CVKA 3H40A 3G6YA 3NAIA 1S6OA 2JOQA 2KZMA 3CXCR 3PZPA 3J7ZT 2E7WA 3TZWA 4DU7A 3AHPA 1VIXA 4ES3A 3KTQA 4LVNP 3ICLA 4QPXA 5KFWA 2YNIA 2IPOB 1VI7A 2LFVA 4L75A 4U7UK 3N0VA 4WFXA 2HURA 4ANCA 1SJ3P 5K8OA 2DR7A 2OP5A 1IKYB 4K2XA 1T05A 5ETQA 3CC4S 2P5VA 1AB8A 1CS4B 4N56A 1OYEA 1Y11A 2VJVA 2J7UA 4JB8B 2R2SA 3TAPA 2D7SA 1WTFA 4YDDB 4QIEA 5HQMA 2XLIA 4DUYF 1V5VA 4DUYJ 5HJYA 1UW9A 3M9MB 2MZTA 1MWQA 3ET6B 1TKTA 2XULA 1U4BA 4OYOA 4QW9A 4ECRA 3TA0A 3SBMA 3GR1A 4DQQA 4NYOA 4YB7A 1KS2A 1UETA 3KLHB 2R42A 2A6OA 4FKXA 3P96A 3MAHA 4PAAA 2DGWA 1TKZB 1TAUA 2XZTB 4ANEA 3JQKA 3H5SA 5F0WA 1DTQB 4B3OA 2UP1A 5HROB 1VQMS 2V4RA 4B9SA 2PA3A 1FK9B 2VG5B 3BREA 3NGTA 4LF5J 1FNOA 4KHMA 3D2WA 3MUVP 4XDCA 1VC5A 2MGZB 5F8IA 1OY6A 1B7FA 2IBKA 2NXCA 1WC1A 1IKWA 1Z2LA 3ONQA 2JLFA 3LP1B 3PR5B 4CH1A 4CLKA 1H98A 5F0UA 3JYTB 3T1YJ 2C42A 1JJHA 2YWGA 3CJTA 2FY1A 2HHQA 2ZE2A 3S1TA 4FNIA 1F3FA 2IDEA 4LSNA 2F8MA 4OZNA 1IXKA 4JI3F 4TVAB 1WC5A 5EGYA 4B3RF 3K5OA 5CABA 4KT0C 2C28A 2E1PA 4CQ1A 5SUHA 3OR2A 3PYFA 3N5BA 1T95A 5KFZA 2AD9A 4OHXA 4LFBJ 3TI0A 2PFDA 2DGTA 3AODA 3VTIA 3EPGA 3LP0A 2YX1A 2ATLA 2G0JA 3NBPB 4U8YA 2OD4A 2M88A 1I5OB 3MM5A 2VIHA 2H5IB 4DPOA 4Q5VA 2R7WA 1TL3B 3SSSA 5JVHQ 4F2SA 3DM2B 3UQSA 4P71A 5GADU 1RTHB 1W26A 3AH6A 3CO0P 3SYZA 4KKOB 2CG4A 4EYHB 3LP2B 4IRCA 3UO0A 2YPYA 2NSBA 1N5QA 2XLKA 4QPTA 3LA0A 2VFSA 2AYMA 4J37A 1HBOA 1WEZA 5KFRA 1HNZJ 2MLXA 2XGPA 1FVQA 1RAFB 3HHLB 5KFFA 1N32F 4E98A 4TLQA 1TL4A 2VONA 1RA7A 3HKWA 1KFSA 4O4GA 4NLQA 2XSJA 3NWGA 3CJKB 3O8WA 3HFVA 1R8CA 1KHWA 2GJIA 3IGNA 3BBFA 2F40A 3I5BA 3W5ZA 1H73A 3NLCA 1XMOF 3KLIA 2DR9A 1S9EA 2UUWA 4OX9F 3H25A 2DCUB 2V5HG 2KI2A 1F2HA 5KFDA 4MKVA 4DV5J 4DU8A 3KJNB 2ERRA 1S1TB 3IAS9 4JI6J 2B3TB 4ZMMA 3QLHA 1WWHA 4QU7A 4WFNQ 3BQ0A 2NS1B 2KYZA 2XMWA 2ZUAA 5LSRA 1NK7A 1IKXA 3O44A 1HYSB 4DR4J 1K9MT 2HLTA 3LF0A 5CCMA 3FSXA 1YDLA 3OSPA 3BKTA 4ZVOB 1RHKB 5M2UA 5ETKA 4Q8FA 1RTJA 2BDPA 3CT9A 3GPAA 3ULHA 1LQ9A 3PY8A 1T9XA 1JLFB 5J2MB 2ALZA 3QGHA 2IVFB 3TA1A 5ETNA 4WKYA 2ZBCA 3OL7A 2G4BA 5J1EB 1U1OA 3MD3A 2OAUA 4DV3F 1I51B 5CZXA 1HBNA 3IFEA 3JSRA 3MMCA 1HW8A 4F7VA 5THWA 3H2UB 4ZHRA 4ECUA 4DV1J 1FJGJ 5IC6B 2UVVA 5IFMA 3D4JA 1RAOA 3V81A 2GX8A 3GP9A 1VQYA 2HIQA 1YZ6A 2OEKA 5CD4A 1NJXA 2ZNZA 1TMMA 3AOAA 4NLUA 3KLFB 2KRBA 4AE5A 2QGFB 3N28A 3EX7B 3VZHA 5E33A 4DSEA 4Y2AA 1LWCA 4KGMA 1QY7A 4BC9A 2DNQA 3ZZOA 4F0KA 3DRPA 1IJFB 5D4OA 2KRRA 2OHDA 2B6AB 3PIOQ 3M30B 3EDQB 2GNKA 1TVRB 4QR2A 4DV2J 1S1XA 1R8AA 4LJMA 3R9LA 5D4PA 1RAHB 3DLKB 2LCWA 5HATA 2ZH7A 2XNRA 4Q43A 2Y8WA 5FLXU 3W2VA 3HX9A 1R8BA 3UW1A 3HF5A 2HNDA 3EICA 3DYAB 2YNGB 3CDBA 4ECZA 3RR8A 2QLFB 5I3QA 2MXYA 3GZ7A 4IOAQ 3IN5A 4NCGB 3M2RB 1X4EA 1YKWA 4WPAA 3T5LA 4A8OA 2UUAJ 1UEVA 3FSIA 4PXCA 1P1LA 3M05A 1HL6A 4OV1A 4NLVA 2NXJA 5A8KA 1FFGB 3RW7A 3JAMU 1Q95G 3GQCA 1NKCA 2M2BA 2ZH5A 5LJ3Y 3SDEB 2KFZA 3TO8A 1C1CA 1KD1T 2MHNA 1V9OA 4GO5X 2FDNA 1S79A 2MZJA 4N47A 2PFFB 3FC9A 1IQZA 3B54A 3HVAA 4WIQA 1JLAB 1CJKA 3SFUA 4NA1A 3UE2A 4ZP7A 2JL9A 1RQ0A 4OX7A 3HSJA 1YLXA 1N5YB 2E5LJ 1SJ4P 2YX7A 3FFIB 1FESA 1RT6A 1YVFA 2XBPA 4JYAF 4DQPA 2J9DE 5KFNA 3V6KA 1FJ7A 4QCLA 1VR6A 2CQ2A 3KLGA 2RDJA 4C0HA 1VOMA 3JQMA 4UZCA 4FYDA 3KLEA 1GXUA 4NXMJ 4O3NA 5ETRA 1NJIT 1BQMA 3G8TA 2M8DB 3FMBA 1SL1A 1QAYA 3FZ2A 1GNKA 3SQGB 3BS9A 1OWXA 4HT7A 4C11A 2XMJA 2B9WA 3I0SA 5DO2A 4DX5A 4LRAA 3OUYA 4LFAJ 4TN2A 2W4PA 3KG0A 4N76A 2Y1IA 1LWXA 1C2PA 3PCOB 1CJVA 1TTHB 1HMVB 3VAMA 3QZ7A 2BJ8A 3OTBA 1Y4ZB 3AJDA 1D09B 1CG2A 4FP9A 2A6MA 5T41A 1NSKL 4OI1A 4DN0A 1FKOA 1S1VB 1LXJA 1D0EA 1GXLA 1N5SA 4MTPA 4F36A 3F41A 4CT8A 2XZWA 4FKYA 1RHMB 2B7BB 2LQJA 1RT7B 2I6WA 2ILZA 4JI2F 3W9IA 4HEA9 1SH3A 2AHOB 2QL9B 2HNYA 4O3PA 3M8QB 2IRYA 1EKRA 3R7SB 1X4FA 1ZPVA 4C8KA 3HMJG 1VRTB 1TK8A 4AUKA 4NLXA 2W2OP 4PG6A 2CQ3A 4KC5A 3MOJB 3PJ9A 3C16A 4YY3F 2GW8A 4YY3J 1NO8A 4JI1F 2WOMB 4JI1J 3DOKA 5KG1A 2WONA 2YNHA 2U2FA 1QE1B 4OQJA 5T7LB 4DMZA 3PYGA 1FRKA 1RB0A 4C8YA 2DISA 1FE4A 5L1LA 4KPYA 1TAQA 3TJAA 5L1KA 5HVGA 2CAJA 3TZYA 2O3DA 4QWAA 2HSEB 4HH1A 2NZCA 1B0VA 1XNQJ 1KEKA 2BRLA 2OTLS 1JNRB 1FEEA 1Y10A 2KH9A 3P5BP 2E1AA 4J91A 4FYWB 4G1QB 2JEFA 5E0OA 4ZVPB 2CNKB 2K7KA 4IR9A 4MFBB 1F9FA 5KAKA 4UOGA 3MFHA 5KFGA 3FCVA 3UNYA 1RWNB 4IDKB 5HANA 1HQUA 4LF4F 3D1OA 1LWEA 1KR4A 4ANDA 2HQIA 2CIMA 2X1AA 1EJ7L 3EM1A 1PCAA 2IMWP 2EC2A 4MKBA 4DJBA 3OHAA 3AFGA 5HMYA 3NXZA 5IV3A 3GIMA 3MTKA 5KFKA 1RYRA 2RVJA 2CQGA 2GA7A 4U67Q 3R5GA 2AV5A 5F8LA 2YH1A 4WXWA 2FJXA 5ETTA 5A6PA 1M5VC 5EWFA 3HDSA 2LQ5A 2BE2A 4WFAQ 4LT6A 4LVOP 2MQNA 4IRKA 3LAKA 3CMES 2NCKL 1R6YA 4ID8A 2WCXA 4NLTA 3MF5A 1ZZNA 5FLXY 5J2NB 2JLGA 3CJ0A 4X4SA 4K5SA 3QBCA 4XO0A 2VA2A 3VAKA 5I3UB 2N3LA 2Y1RI 4PQUB 3IS9A 3I96A 5K14B 2BYCA 2EWHA 3CPWR 4HHUA 3L09A 1XMQJ 5C42B 2XMKA 1CULB 4DX6A 3R6LB 4DL6A 4KTQA 4JI0J 1WKKA 1NJWA 1DBDA 4ES1A 3JAMY 2XI2A 4BS2A 4MK9A 2HFOA 4OI2A 4O3SA 1LFWA 5AJ3F 4RW8A 3NS7B 1TL1A 4BWMA 2BE7D 2RQMA 1C0TB 5ITHA 5K9FA 3F56A 3DLBA 2G1DA 2GVZA 2AYGA 4NZ7A 3OVSA 1T3OA 4GC7A 1IM6A 2N7YA 3PW2A 3CULA 2F3JA 2MJNA 1DY3A 2UV8G 3GTYX 1WACA 4CIOA 2CNOB 3OTEA 1R8HA 1S0MA 3H5XA 3WC0A 2CPXA 2E7XA 4ZPBA 3MCOA 3O3LA 2MLZA 5IWAF 2DR5A 2NR0A 4EYIB 2IVYA 4G1IA 2ZH3A 4N77A 3KJQB 4U7UD 1GTEA 3KDNA 3F44A 2L41A 5IT9U 1IBKF 4O44A 3LPYA 2EFGA 2W01A 5D3GA 4I68A 4GO7X 2M52A 3PYEA 2QC3A 5HK4A 3C2PA 1JLEB 3D54A 4M94A 1KNZA 2AZ3A 3CE8A 4CLFA 4RW9B 3AY0A 3MTJA 3CNQP 3H2VE 2ADBA 2AKWB 4N7TA 1X4HA 5J2PB 1WEXA 3IBCB 1S1UB 4F02A 4OMFG 2W2PP 4AD6A 3SI8A 3QT7A 4LF7F 5HVHA 4LF7J 3BR9A 1WUUA 4KYZA 1X4DA 5DDRC 4MYTA 1NRKA 1F2GA 2IY5B 1FXLA 3QFWA 4OYWA 5C7PA 1SKUB 2AX1A 4J9NA 3QIPA 3OTOJ 3SZ2A 2EK1A 3VQTA 5D4LA 1TQLA 1UVKA 2GHWA 5D78A 2HRYA 2WVDA 1VYAA 3CW2C 2H48B 3QGIA 2LECA 4B9VA 2M0GB 3QMQA 3D1QA 1QJHA 2UU9F 2UU9J 2O1PA 3OQ2A 2YKOA 3JXOA 3M6WA 2DJWA 3FSYA 1NDLA 5C25A 3MPUB 1RJJA 1LW0A 2MDAA 2IDLA 3V4IA 1YRTA 5D77A 4DUZJ 3AJ1A 1S9FA 2NXNA 3NGDA 4X4UA 5A8WB 3UN5A 3BV8A 1OO0B 1SVDA 2CJYB 4NPOA 2ZDOA 4ETXA 3MEDB 1YRUA 3TANA 3TAMA 3HVTB 2Z58B 5HQ8A 1CC8A 2AF6A 4ZS6A 1XR5A 2V34A 2IMOA 4ZPTR 1ZBTA 1FRLA 2BKNA 2BW2A 2EEYA 2HWTA 2K7JA 2RMLA 4U95A 2V8DA 1J5OA 1R8PA 2U1AA 1V3RA 3C6TA 3KDOA 3I9V9 2AJQA 3Q22A 2CQBA 3KJFB 3Q8VA 3FVYA 4LF2A 2AEFA 4DI6A 2B0GA 3BGRB 4CYUA 5KFPA 3ZZ0A 2B9XA 3CMAS 2RRAA 4M5DB 1IBLF 4WE1B 3IC1A 4DFKA 1IBLJ 2DGSA 1U1RA 4ZVQB 2R7QA 3GWCA 1MSWD 2KHCA 4GMKA 3V4MA 3C6UB 3JTOA 4K4ZA 1RLCL 1NDCA 3JQJA 3TAQA 3DMJB 3KG1A 2A2DA 2R7OA 2CVEA 5B09A 1U8SA 3CJRA 3JTPA 4JI8F 1DLOB 5F8HA 2PSZA 2MKKA 4ELTA 1Q0NA 2B9YA 3TOQA 2HBZB 3FK4A 4C8OA 2DY1A 4KHPF 2FVRA 4UOFA 2ZNYA 2Z8QA 3NEKA 2GCFA 3QSIA 5KOXA 2AJ1A 3F73A 3RRHA 3TNVA 1H3DA 5KFVA 2V63A 4ZP6A 4C2MA 3FQLA 3R97A 4RUAA 2FGOA 2AIRB 4K4VA 2RUSA 5IM0B 3IBFB 2QA4S 4NA3A 4F04B 1CJUA 3BB5A 3V6DB 4I2PB 3D1HA 1BXNA 2A18A 3IXQA 1N0UA 3B4DA 4EO6A 1CJTA 5KT3A 3ILIA 4J90A 2BZ2A 3PRDA 4I4BA 2B7CB 4AQYJ 1S6UA 2HRTA 1TFYA 2CNNB 4OYXA 1EIYB 1C1BA 2ALYB 2G0IA 3T1HF 5JMNA 3T1HJ 3WIUA 5F9LA 3GCWP 2RU9A 1VBKA 2YVSA 3WQPA 2IJFA 1I6JA 1IKVB 1SUQB 2FHKA 2HZVA 1JLGB 1RWMB 1VRQC 5A8RB 2LU1A 3BSNA 1U1LA 2ZUGA 3MEGB 2K06A 3QO9A 5BR8F 2DPJA 2DNPA 2AGPA 2HHHJ 2YX4A 1EETA 3HZEA 3I0RB 3GJQB 2HQGA 4OHYA 2RB7A 1DQAA 5BYQA 4CI0B 5HP1A 3QSYB 2O66A 3QJJA 1UEKA 1R0CB 2UXCF 3DRRB 3K5LA 3UCZP 1W2BR 3EWGA 1BWEA 5CYJA 3KMSA 3JSBA 3H5YA 3POTA 5DETA 2CQPA 3ZNUA 5IT9Y 3A12A 1WNEA 2F4FA 1Q78A 2BX6A 5BYSA 4CLSA 3M2VB 3I32A 1NK8A 3OLBA 2KVIA 3RB4A 5KTQA 2DO0A 4YHHF 5DG7A 5GAGU 2WSCC 3M32B 2G2YA 4JBCA 1ICEB 3RB0A 3LWMA 3CCMS 1JIHA 1JLQA 1DURA 2GO8A 3EVOA 3TVYA 1HLWA 2QL5B 4NLDA 3G82A 5HMZA 2N4DA 4Z7YA 5FJ4A 1A7GE 1X0FA 1C0UA 1VBXA 2EXUA 5EUHA 1T03B 3M8WA 1OSDA 2CZ4A 4OFZA 2VG6A 1U24A 2VASA 1NSAA 5M2PA 4ZVSB 1AZSA 1SI9A 2Z2MA 4O0NA 3J81j 3RRGA 4J9QA 2CADA 4QIVA 2YQ1A 1R89A 4TY8B 4H54A 4DR6F 4F3QA 4DR6J 4WF9Q 4KH0B 2HG4A 2HHUA 1VQSA 4DS4A 3MEEA 1NEEA 3HHKA 1RT5A 3UFCX 3CD5A 3MZIA 4LRFA 1M1GA 3RGIA 2MKHA 1RWXB 3JTNA 4P10A 3JS9A 1SV5A 1TZ0A 4O3QA 1HWJA 1N36F 4ITSA 1YGYA 4IFVA 4ED5A 4CO1A 1OQ6A 2I5JB 4KO0A 4R8UB 4K4WA 2B8PA 1WHVA 4YR0A 4X2BA 3N6LA 2OH2A 3ZZTA 4PCQA 1T9UA 5B0DA 1J5EF 3O6QA 2ZZNA 3IWXA 4B08A 1O6XA 4PWDA 3M7VA 3DKDA 4FXDA 4K59A 4B3MF 3QIDA 4B9MA 3TVKA 1RTIB 2EC0A 4CLPA 3OTCA 4PUOA 3P3DA 2Y0SD 3MOZA 4NWBA 5D0RA 3H2LA 1NLKL 3V2UC 3CJ5A 4CM2A 1M90T 3LGMA 4P73A 1C4CA 1X5TA 2V8VA 3CCLS 1VDHA 3HZGA 3DLHA 3OFHA 3G8QA 4QYZJ 4ZVHA 3EVWA 2MSTA 4J9UE 3CCES 2YWEA 2AGQA 3DRSB 2I0XA 3OLAA 5HBMA 3PJXA 4XPCA 5CYQA 1TUGB 2R4FA 1SQEA 2J0WA 2QSFA 3BDPA 1SL0A 2F4VJ 3EPIA 4X66F 2BKOA 4NEYA 2P2CB 4V19J 5KT5A 1JNZB 4RR5A 1X9MA 1R6VA 2QFIA 1X60A 3UVJB 4DQRA 1YG0A 4WKRA 1HWKA 2R8GA 2KYXA 2K3KA 3X1LB 4DV6J 2IIHA 1A6LA 2BR0A 5LMNF 1SJRA 2PE8A 5LMNJ 2OGUA 2HNZB 4F25A 1F9HA 4K4TA 3T19A 1U47A 2BKPA 4USWA 2KXNB 2FJAB 3W60A 4DR7J 1SKSA 3FJ2A 1WDTA 3CMQA 2H5JB 4DR3F 1L3SA 5CH7B 2HQ3A 3S7RA 1B0PA 3IG1A 4Z37A 2RHQB 2VB6A 1NK9A 3KK1B 4URSA 1U45A 2YKNB 4RNFA 3VGVA 1SB6A 4WXOA 3R2DJ 3SCKE 3PHTA 3B78A 3IM8A 2LXFA 2L9DA 2XSFA 2VG7A 4NI2A 3I82A 4RWWA 3G71S 3DU6A 3MM6B 2XS5A 2UXDF 1ZZFA 1UZHA 2FHJA 5C5JA 4RW7A 3A3NB 2J9DA 4ZVFA 1FDDA 3I6PA 2GZOA 1QSYA 3IRWP 2DD8S 1HR0F 2Z2YB 4IO1A 1HR0J 1SXLA 3T3FA 4DN9A 2EG2A 2LYVA 4GVLA 3OR1A 4ZPDA 5ETLA 2XYHB 3DXBA 2MY7A 2XY5A 3P4UB 2QZ8A 4FF2A 4EGLA 4JOUA 1YK9A 3IR7B 3MM5B 3WZ0A 2DGVA 3KK3B 4ZN3A 3ENAA 5GAHI 4YP3A 5F3ZA 4DPYA 4ZP9A 2R3VA 1VLYA 2M3DA 4AL5A 2OPPA 1MROA 1HPZA 5L39A 3GG0A 2MJUA 3KXDA 4MK7A 4J9MA 3MR6A 3DOLA 4U8VA 1NZ8A 1KONA 5L1IA 1RT3B 2CPZA 2J6TA 1RP5A 2XQCA 2RU3A 3W3SA 2VQFJ 4ILRA 4RBVA 3CCZA 4A47A 1U1PA 4K4YA 3LGNA 1S9GB 2PEBA 2CG8A 4MH8A 2ZDPA 1SPBP 4MT1A 3AA8A 3TUJC 1YQHA 2DIUA 3VR1A 4DR1F 4PEOA 4M5MA 1EB0A 3BYPA 2DGUA 5KFSA 1FE0A 5CA5A 2VFVA 1NDPA 3BGOP 3J7AN 2AEMA 2A1BA 1GTHA 2XHCA 5JVGQ 4P2MA 3CCTA 4IG0B 1PBUA 1KLNA 1EQMA 1CLFA 1CBKA 4EFAC 3ITHB 2MHEA 3GB0A 3J7A1 4DZDA 4UZBA 5JXSA 1H6KX 2HZAA 1PKUA 2ZOGA 4B9UA 3MD1A 5DDOC 3AJ2A 5GAHU 3D3CJ 4DSJA 1HWIA 3A3OB 1S76D 1ZOTA 3QQCD 3T9ZA 3THPA 1QUPA 2DGQA 3NG8A 4TU7A 1RE1B 2R2UA 5FD1A 3KUGA 1IKYA 3TEGA 3UR0A 5CYMA 2ACYA 2H4WB 3MDFA 4PYAA 3IR5B 4DV0F 1YJUA 4DV0J 1IBMF 1IBMJ 2VDIA 4F4XA 3GYNA 1NM2A 2MYFA 2GQCA 2PEHA 1JJ4A 3V6JA 4KGZB 4B3SF 1S5ZA 3D68A 3IO1A 5KFEA 2LLZA 1M5OC 4NL5A 1BLUA 2G1HA 3QRPA 4HH0A 1L5UA 4JV5J 4C98A 4ZHRB 1IWAA 5EDWA 3QFHA 3HHEA 2D3ZA 1YRXA 3GR0A 3KLHA 4K7QA 3JSYA 1KVIA 4A46A 3MAQA 2M7SA 4QR0A 1NCLA 1TKZA 2G0CA 1JQGA 2G13A 1ZA1B 1DJ0A 3THVA 1KQFB 2CJQA 4NRTA 1KBRA 1IWGA 4USHA 1DTQA 2RH3A 3EZ5A 4PKDB 1RT1A 2M70A 2VG5A 3EJMA 2JEGA 1HNIB 4CP5A 3BQ2A 2KJWA 4YDXA 2MGZA 3W2WB 3B4MA 3HSZA 5IT4A 3LP1A 2AEJA 1S1XB 2VBXA 3JYTA 3LWLA 4RNMA 4ZDNA 2HHSA 2ZZTA 5KFJA 1FHTA 2QX0A 2G9OA 1RK8A 3PXGa 2EKNA 3US5A 3PO5A 2HNDB 4RW4B 2DGOA 4YUDA 2JNJA 4D3GA 3A8KA 1RWOB 1ZAWA 2WVEA 4YFUA 4DL7A 2B4OA 8ATCB 3NGUA 4WJBA 3P5TL 1N6QB 2W9BB 3U1MA 2ZH2A 1UVMA 2A10A 2RDDA 4FS1A 4KGVB 3T5KA 2ROPA 3DGVA 1U0HA 2WSFC 4ALZA 2HAIA 5IV4A 4RJVA 4W98A 5KT2A 2JX2A 2FTRA 1TL3A 4K0KF 2W4CA 2XMMA 3LQVA 4K0KJ 3VAHA 2UXBF 3DM2A 3HI9A 4ED2A 1UKUA 2BRKA 1RTHA 4D3HA 3L9ZA 4DFJA 4KKOA 2RHSB 4O23A 3PJWA 2K1RB 1QSLA 3TJ8A 1R3NA 2IFXA 2RE1A 4DQSA 4GKJJ 4PXBA 2X1GA 4DR2F 3C3LA 2XEXA 1CQNA 3HHLA 2POKA 3P49B 3U1NA 2BM0A 2YBVA 4XPEA 2HAFA 3DHXA 3ZNJ1 2BA9A 2D3OR 4TQRA 1YTYA 3IWLA 4PPZA 3KLGB 2XWYA 1ZAVA 1R0BG 2XMVA 1CPZA 1TL5A 1FJEB 5F9NA 3LW5C 3KLEB 2DNNA 3MM8A 2AX0A 1NUEA 3I9ZA 5A0YB 4QU6A 4ED7A 2VC1A 1XNRF 1DFDA 1S1TA 1HNVA 4LRCA 7AT1B 1UJ4A 3PW5A 2D9OA 1O8BA 5DQGA 1KOHA 4RNNA 4OJHA 4DF8A 4X64J 4XK8C 2Q3PA 4LFCF 4C11B 5BJRA 2C3MA 2Y0BB 2W7OA 3I0SB 2Z30B 1HYSA 4C3KA 4LF8F 4LF8J 2B8QA 1TKXB 5CHCB 1NHVA 1HWUA 4TQSA 3GONA 4Y65A 2DRDA 2RKIA 2GVDB 1HHQA 1AXQA 4WZQA 3MURP 1VQLS 4MKAA 5IQ6A 1H72C 1FX4A 4PG4A 2DNYA
chains in the Genus database with same CATH topology
1HQEA 4HH1A 2N82B 3HK2A 3W7BA 4C8ZA 1UWBA 1B0VA 4NLRA 4RX6A 5J1NA 3VZIA 3ZZRA 5L38A 3NS5A 3G6ES 2V2KA 4OZLA 3C6TB 3PVXA 3M9OB 1KEKA 4X4RA 2BRLA 2OTLS 2UVUA 4YB6A 1UL3A 1JNRB 1XBWA 5LSOA 1FEEA 2KH9A 3HJFA 2E1AA 4AXJA 4G1PA 3S01A 1KLMB 3UD4P 4X65F 3MECB 4G1QB 3MM8B 4C8LA 2BABA 2OTJS 2JEFA 5E0OA 3O2IA 4A8FA 1U25A 4EEYA 3MUTP 3M2UA 1VQ9S 2K7KA 2R2RA 4ED0A 1KHVA 4KV8B 3Q23A 4IR9A 3M1VA 3N01A 4MFBB 4OJGA 2ZBIA 2AQ4A 1F9FA 4Q8EA 3NCRA 1E6VB 1PGZA 5KAKA 1LV5A 4ATNA 1X4BA 1R0AA 1RAJA 1YJWS 1HNVB 5KFTA 4NCBA 3MFHA 2R8HA 3R3TA 5KFGA 1QAIA 3T1AA 2WSEC 4IDKB 3K58A 4NXNF 2CJ9A 4EWTA 4F4ZA 5D4NA 2QFJA 4IG0A 2PMHA 2CQHA 3I56S 4B9LA 4OLOA 2FLPA 4BWJA 1HQUA 1SJFA 4H4OB 5DLGA 2WB4A 3FRZA 3FCHA 4OLPA 3UCGA 3ITHA 3KHRA 3D1OA 1LWEA 2F9DA 2R8IA 2UUBF 2CZVC 4LF4F 1KR4A 2X1AA 2HQIA 2CIMA 3NMAA 5HO4A 1FKAF 3EYZA 2B51A 3H5UA 2KDOA 5IZHA 2KT2A 1IJEB 2IMWP 4O4RA 2OPQA 4MKBA 2ZH9A 2UVWA 1N88A 2CPFA 3DRXA 4QBUA 1H2UX 2OSRA 5HLFB 4HI1A 1FTCA 2XB2D 4ICLA 4DJBA 1HHTP 2HHXA 5LT5A 3R5BA 3SCJE 3K5PA 3OHAA 3QJPA 2JJ4D 4IO9Q 5HMYA 3KLFA 5GAGI 3DOKB 3WX4A 5KG6A 4JI7F 1T3NA 1LW2B 4QZVB 1B0TA 3GIMA 2P6SA 2YNHB 3MTKA 5KFKA 1F60B 1RYRA 1P9QC 2RVJA 2RKIB 3R27A 3UR3C 2CQGA 2GA7A 4J5OA 2GMHA 3VCDA 3Q8SB 3K57A 1U09A 1CSJA 1KQKA 4ECTA 4U67Q 2ZITA 4ZK7M 2XCAA 3DXSX 2AV5A 5F8LA 3OVAA 4DFPA 2YH1A 4WXWA 4A8KA 2FJXA 4FVCA 3NKYA 3MM7B 3DN9A 5U47A 1V3ZA 4AQYF 3I31A 5A6PA 4ELUA 4DL0C 4ECSA 4H4KA 1ULRA 1RTDA 4I6WA 3UCUP 1M5VC 1F5AA 5EWFA 1HQEB 5KG2A 3H4BA 2JEIA 3HDSA 1NJYA 1UWBB 2LQ5A 3Q2TC 4A48A 5DS7A 2BE2A 4WFAQ 2JFDA 2GQQA 2ASYA 4KBIA 3I5CA 2DT9A 3NCPA 2ZC4A 4LT6A 1U1MA 1LK7A 3B82A 4LVOP 2MQNA 3OV7A 4IRKA 2PN6A 4ERDA 3LANA 3LAKA 3CMES 2W9CA 2W8KA 3BSCA 5E3RA 4PXEA 5CZVA 3CGIA 3HXMA 3KHLA 2BACA 1R6YA 2HPUA 1KTQA 4ID8A 2WCXA 2OMOA 2PT0A 4CT9A 3CO9A 1RT2A 3M1VB 3QWUA 4NLTA 3MF5A 3DYAA 1JLBB 1FTRA 2ABYA 1ZZNA 5KFYA 4FF3A 1E6YA 4DR5F 5FLXY 5J2NB 1WEYA 2JLGA 3CJ0A 4X4PA 1R0AB 2XHWA 4X4SA 4K5SA 4IKAA 4XO0A 1UVNA 2VA2A 1FVSA 2EK6A 1U2FA 4A8QA 3VAKA 2LXUA 1EP4B 2HHHF 2VBZA 4IQXA 4NCGA 2DPIA 3OL9A 3M2RA 3SCIE 3VF0B 2FVCA 5I3UB 2FHOB 2ASDA 2N3LA 2CQIA 3KFWX 3GFZA 2Y1RI 4PQUB 3UDLA 1LWEB 2IC3B 1TR0A 3IS9A 3I96A 3M6VA 5K14B 2BYCA 5KG0A 1S6PB 2EWHA 1Q81T 3DLLQ 1JLCB 2DH7A 5F8NA 2OPRA 1K73T 3CPWR 3DLGA 1CC7A 4DSKA 2E5HA 2VFUA 3DU5A 3U02A 4ICLB 3L09A 5EHHA 1NU4A 4Q7AA 4F4YA 3G8SA 5AE2A 3G96A 4ECYA 3NNAA 3OHBA 3PX4A 5EX3A 4FBUA 3KNAA 1Z2ZA 1QVFR 5C42B 2M8HA 2EKYA 2XMKA 4DEZA 2E44A 5DM7Q 4WTYA 2XMTA 1SBRA 3IRXA 5EX0A 1IQTA 1VIOA 4DL6A 4A8XA 1Q8IA 1HNIA 4KTQA 4C0BA 1HI8A 5DGBA 1WHXA 3UD3P 1N34F 5G0RA 4I6AA 1NJWA 3Q24A 3W2WA 1CPZA 3MEKA 3FMWA 1DBDA 5A2QY 5KG7A 1FNMA 4ES1A 2KO1A 4UY85 3JAMY 4Y00A 2W8LA 3SDEA 4Y2KA 3T6BA 2XI2A 1GX6A 4DHVA 4BS2A 4MK9A 1Q4RA 2HFOA 2KB2A 4OI2A 1Y3JA 2ZH8A 1LFWA 5CCLA 5AJ3F 4WFZA 4RW8A 1H38A 4O3SA 2IBOA 3NL0A 3PM9A 1TL1A 3MPYA 3SMZA 2H9ZA 2B4UA 5KFAA 3I55S 3BJYA 1C1BB 4BWMA 2BE2B 4ZCLA 2GV1A 3UDCA 2CQ0A 4DSFA 2RQMA 1N5TA 1C0TB 5ITHA 4RW9A 2KFYA 5K9FA 3CB4A 3BN4A 3UNGC 2C2RA 1N33F 2FIUA 5KT4A 3F56A 3KHGA 2E9RX 3DLBA 2G1DA 2K2PA 5I42A 2O5DA 1H2VZ 2W9CB 2A2CA 3OFFA 4IH7A 3P6YC 4P6QA 2AYGA 4IOBA 4NZ7A 1SL2A 2QV6A 2FJEB 2YWFA 4O0IA 3NGKA 4RW4A 2BANB 3RBDA 3PW0A 1NB7A 4B02A 3OVSA 4TYBA 2IAJA 2V4JA 1T3OA 4GC7A 4I6YA 3OL6A 1ZTWA 1N5YA 1U26A 2JRSA 1S7HA 2N7YA 4TU9A 3PW2A 2E1MC 4USJC 3CULA 3KJVB 2CFXA 2PIIA 2F3JA 3SSQA 2MJNA 1N6QA 2RRNA 2W9BA 3FFIA 2UV8G 1WACA 4CIOA 3OTEA 5DDPC 4Y2IA 1R8HA 1S0MA 1N54B 3H5XA 3WC0A 2CPXA 2E7XA 4ZPBA 3I5AA 2VPWB 1HI1A 4CNYA 3VAJA 1MW7A 1NHUA 2YQ3A 3GMGA 3O3LA 5IWAF 2APOA 1Y0HA 3L7PA 2DR5A 4DL2A 5E5NA 2NR0A 2AP6A 4OJ3A 4C3MA 4EYIB 4EBEA 2IVYA 4G1IA 5HP1B 2ZOFA 2ROEA 2ZH3A 4N77A 4ZKAA 2LQBA 4NX9A 2HW3A 4UQGA 2E5GA 3I4HX 3SCLE 2OFGX 4I67A 4DSIA 1UEUA 1GTEA 2MKCA 1FD2A 3NCQA 2N3OA 2B5JA 3F44A 2L41A 1URNA 3ISND 2EFVA 2LU2A 1IBKF 4O44A 1RWUA 2I9SA 3LPYA 2AJ4A 2EFGA 2DO4A 3CIZA 5B08A 3K5MA 2RSQA 5IT0A 4QQBA 2H5EA 2DH9A 4I68A 5D3GA 2NYIA 4GO7X 2M52A 4DBQA 3MR2A 2FVQA 4MKYA 1U6ZA 1UJ5A 2K1RA 3CWJA 4WFBQ 3C2PA 5DM6Q 4HVZA 5FDLB 2LVWA 4PG5A 1JLEB 2DH8A 4H4MA 2XY6A 4LIWA 4QJVA 1KC8T 3E3XA 3O5TB 3D54A 4TNOA 2DRBA 3AAWB 2PC6A 4M94A 4LIRA 3GFHA 2FHJD 2HZCA 5E3PA 4ZLPA 4O3RA 5DRKA 1KNZA 3CE8A 3IR6B 3T5HA 4RW9B 3AY0A 3MMBB 3L3CA 3KOAA 2EPIA 3MTJA 3H2VE 2ADBA 3CCVS 2LDYA 2NXUA 3BDEA 2BXJA 4MAKA 5KG4A 1L3VA 3H59A 5B0CA 4OI0A 5I42B 2HHPA 2MQPA 1HMVA 1X4HA 5CQGA 4DFMA 2IA0A 5F3TA 5J2PB 2ADCA 1RGVA 2RS8A 3MEDA 4U6PA 2SXLA 1WEXA 4J9LA 1S1UB 4F02A 4OMFG 4RBUA 3HVTA 1FRHA 4CH7A 1HBMA 3SI8A 1PO6A 5LJ5Y 2FLNA 4IFYB 1JLQB 4LF7F 3DNCA 2D3UA 2PI5A 2VFTA 2CPDA 2P9GA 3BR9A 5K8MA 3CDEA 4C0OC 1GAOA 1X4DA 5DDRC 4MYTA 1X9WA 1FO1A