2U1AA

Rna binding domain 2 of human u1a protein, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
88
structure length
88
Chain Sequence
MAPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure of RBD2 and backbone dynamics of RBD1 and RBD2 of the human U1A protein determined by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
total genus 14
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 1997-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2u1aA00
2MGZA 1VC5A 2DHSA 2GO9A 2KG0A 1K9MT 4RU2A 2DGXA 2E5JA 1WG5A 2CQHA 3CCQS 3MUVP 2YWKA 3UCZP 1M1KT 2WBRA 2HVZA 4M5DB 2YTCA 4WFNQ 2EVZA 4PRFA 1FHTA 1DRZA 1X5SA 2NLWA 2KN4A 3OW2R 2JVOA 3NS6A 1A7GE 2AYMA 1HA1A 1F9FA 3S6EA 2AYBA 3D2WA 2KRRA 3BO4A 2KRBA 1M5PC 1N52B 3CXCR 1SJ3P 1OIAA 2DNGA 5CYJA 3MOJB 2OSQA 2DNPA 1FJ7A 3G6ES 3THPA 4IUFA 1FNXH 2RNEA 1M5OC 2KXNB 2DB1A 1DHMA 1YJ9S 3S8SA 1URNA 5LSOA 2VONA 1PGZA 3CF5Q 4LJMA 2MKIA 1H2UX 2FC8A 4Z2XA 2JRSA 1AUDA 2KYXA 3UWTA 1WG4A 2RRAA 2YH0A 1FXLA 2RS2A 1SJRA 3P5TL 2L41A 1FT8A 2HGLA 2OIHA 1X4HA 3R1LA 2MQPA 2KVIA 5MLCV 3LQVA 2UP1A 2XS7A 2OTLS 1N88A 3G8SA 1N8RT 3DLLQ 2MY8A 2DGWA 1YHQS 2E5GA 2K8GA 3CD6S 3CMAS 3NMRA 1G2EA 3FEYB 2MQOA 2CQCA 4U67Q 3EX7B 2KXFA 2CQBA 4EGLA 2J76E 2MQQA 2CQ0A 3VALA 3MUTP 1HD0A 2N82B 2OTJS 2HZCA 2DNYA 5CXTA 2E5HA 3H2UB 3CUNA 1WHYA 1FO1A 3VAIA 3G96A 3UE2A 5DDOC 2LQ5A 1WELA 1VQ7S 1VQLS 1RKJA 2RS8A 1U6BA 2CQGA 2DGOA 1CVJA 5LXRA 3CCRS 2MJUA 2PEHA 2L9WA 5H1SV 3TO8A 2MJNA 2DITA 1VQ9S 2E44A 3N9UC 1QVFR 4W92B 1S79A 2DNRA 1DZ5A 2DH8A 2ADCA 1U6FA 4WCEQ 2D3OR 2L08A 3CCMS 1OWXA 2DISA 3UD3P 1M5KC 4FXVA 1X4BA 1OPIA 3CC7S 4WKRA 2DGSA 2CQPA 2JWNA 3I55S 1VBZA 2BZ2A 4P6QA 3VAJA 1VBYA 2DGVA 3P49B 1M5VC 4YOEA 1ZH5A 4IO9Q 2LXIA 1WEYA 2JVRA 1L3KA 3CMES 4QU6A 2DIUA 1Q82T 2D9PA 1WTBA 3CCLS 3G9CA 2DH9A 1JMTA 2DHGA 1VC0A 1D9AA 3CULA 5IFMA 1X4CA 4CQ1A 1JJ4A 3U1MA 2DK2A 1ZZFA 2LMIA 2J0SD 1JJHA 3UCUP 5DM7Q 2CPJA 1XN9A 4F02A 2ZJPQ 2MKJA 2MKSA 2OSRA 3CC2S 2M70A 4LMZA 5GMKa 1H2TZ 3S01A 1U1RA 5GADU 4TU7A 1WG1A 1U2FA 1SJQA 4TU8A 3ZZZA 2MQLA 3G71S 2RRBA 4WF9Q 2LEAA 4YB1P 2QEXS 5GVQA 3P6YC 2HGMA 2QA4S 4CH1A 2XS5A 2CQ3A 2DNKA 3EGNA 2X1AA 3BS9A 3THTA 3VAHA 4IOCQ 1WI6A 3UCGA 1KQSR 3CPWR 2SXLA 3S7RA 2LXUA 2CQIA 1UFWA 5LJ5Y 4WIIA 1JJ2R 4ERDA 1WEZA 2DNHA 3MD1A 2CPZA 2J0QD 2RQ4A 3IWNC 2MPUA 1X4DA 1X5TA 4OZ1A 1H6KX 2CQDA 5DDPC 3ULHA 2DGTA 4C7QA 2M8DB 1A9NB 2N7CA 2AD9A 3PIPQ 2DH7A 2ZJQQ 1K73T 2CPYA 2I38A 2MMYA 2F9JA 1WHWA 1VBXA 2B0GA 2KM8B 3R1HA 2LYVA 1WHXA 1WI8A 5HL7Q 2DO0A 5LSLA 2CPXA 3LPYA 3CCSS 1VQ5S 1WHVA 1Q81T 2VOOA 1KC8T 2M0GB 3NS5A 2MHNA 2M2BA 2JX2A 4YUDA 2O3DA 1YIJS 1KOHA 4W90B 3SMZA 2LA4A 3RW6A 2A3JA 1WWHA 2QFJA 3I56S 1P27B 4TLQA 2MZTA 2MSSA 5CA5A 3CTRA 2HYIB 2CQ1A 3J7YU 3BO2A 3B4MA 1B7FA 1VQNS 2DNLA 4QQBA 4PR6A 4FXWA 3V4MA 1SXLA 2XB2D 2MKHA 5DDQC 2M4MA 4F25A 2LECA 2EK1A 2YKAA 3MI7X 1R8PA 4ZKAA 3H2VE 3R27A 3K0JA 1X5PA 2DNQA 1YTYA 1R8HA 2G1DA 3UD4P 5EN1A 2MKKA 3B4DA 3ZZYA 5DDRC 2LA6A 2KHCA 2M52A 5DM6Q 4A8XA 1RK8A 2J8AA 3L3CA 1YITS 4TU9A 1YJWS 1N54B 2RT3A 2U2FA 1YWXA 2CPDA 3HI9A 3BEGB 1BY9A 1NU4A 4UY8T 4OZ0A 2MYFA 3TP2A 2KFYA 2MGZB 1H2VZ 2AYEA 2KU7A 5IM0A 1KOOA 5JVHQ 2XS2A 4PKDB 1Q7YT 2DHXA 1DBDA 2MKCA 1ZZNA 2GHPA 4CIOA 1KD1T 1U1LA 1SJFA 2FPHX 5IQQA 2X1GA 3VAGA 2FY1A 3CCVS 3RW7A 3PIOQ 2MZJA 1HD1A 2CQ4A 2EK6A 4QPTA 2M7SA 2ERRA 1FJCA 1PO6A 2MSTA 2VODA 4BS2A 1U1NA 2CJKA 2LCWA 1OO0B 1NJIT 1X5OA 2KM8C 1U1QA 3SDEB 2DNNA 1QVGR 2XNRA 2MZSA 5DETA 2N3OA 3U1LA 2VOPA 2E5IA 4UQTA 1O0PA 2PE8A 4LIRA 1X4GA 1VQ8S 2DNOA 3DXBA 3Q2SC 5IM0B 5HO4A 2AYGA 3P3DA 2FHOB 1Q86T 3IRWP 3VAFA 1M90T 2CQ2A 2DIVA 3SDEA 4Y00A 5GAEU 3EGZA 1U1PA 2MQNA 3G4SS 1X0FA 3HHNB 3JB9k 2X1BA 4Y0FA 2K3KA 4C0OC 1X4FA 2RVJA 5FJ4A 4F26A 1U1OA 3CC4S 3MUMP 2M8HA 4IOAQ 3BO3A 1VQKS 1X4EA 1U1MA 3NNHA 4CH0S 2KG1A 3VAKA 2DO4A 4V19X 3MXHP 2DHAA 2F3JA 1WEXA 2MY7A 1WF2A 1UW4A 5LJ3Y 2KXHA 3J7ZT 2RU3A 1K8AT 2D9OA 1S72S 1UP1A 5JVGQ 2F9DA 2N3LA 2M9KA 2X1FA 2NZ4A 1HL6A 2I2YA 2LEBA 2OJ3A 3NNAA 1SJ4P 2ZJRQ 2XSFA 2DGUA 2FC9A 2G0CA 3Q2TC 1IQTA 5GAHU 2DGQA 5D77A 5BJRA 2KI2A 4C4WA 2RUGA 2KT5A 2MB0B 2M88A 5D78A 5LXYA 4ED5A 1NO8A 1P1TA 1D8ZA 3MDFA 2MZRA 1VQMS 2DNZA 3TYTA 1X4AA 2XNQA 4WFAQ 4QU7A 3CCJS 2RQCA 3NNCA 2MQMA 2BOPA 2HGNA 1YJNS 2CPEA 2MZQA 1VQPS 1QM9A 1VQ4S 1UAWA 2U1AA 3US5A 2ADBA 1VC6A 1FJEB 4J5OA 2MXYA 1W2BR 3VF0B 1WF0A 1VQOS 1YI2S 1VQ6S 5GAGU 3SXLA 3MURP 2KH9A 2Q79A 2MZ1A 2LKZA 4WFBQ 3VAMA 3CCES 2CPHA 3G8TA 2V94A 2CPFA 1U1KA 2CPIA 3FEXB 5ITHA 3MD3A 1WF1A 2G4BA 3CCUS 2YH1A 2DNMA
chains in the Genus database with same CATH superfamily
2MGZA 1TVRA 3D6MB 2FZGB 1C1CB 2KG0A 4RU2A 2RF2A 1JK9B 2Y1RI 3GFZA 4KGZB 4OI2A 4ZN3A 1RWWB 3OR2A 2MLZA 1R0BG 2OD6A 2YWKA 3L7OA 4JI4F 3R7SB 3DRRB 3KK3A 2H4YB 4M5DB 2VA3A 4NCAA 4Q0BB 1LWXA 4WFNQ 1SQEA 1UJ6A 3TJAA 1HNZF 4PRFA 2XSJA 1A6LA 4OI4A 3IM8A 4H4MA 4RPFA 2KN4A 3V2UC 1HQUA 3GYNA 5KG5A 4I67A 2BA9A 2AW0A 5HK4A 2HKEA 2AEJA 3BYRA 2QTWA 6FD1A 1T8EA 3HF5A 1YG0A 4PABA 1HA1A 3W63A 4CO3A 1UETA 1UFLA 3TNVA 2J9CA 1J27A 4HT7A 2FHJA 3MM9A 4N7TA 4DPYA 2NSBA 5A2QU 4CWBA 4DPOA 4IR1A 1M5PC 1RZMA 2BE7D 2LFVA 1WDDA 3OPKA 5HMXA 5AXNA 1IKYA 2KRBA 2GFFA 3I9V9 1HWJA 2RJZA 3PDNA 3CVKA 4OI3A 3TX8A 3VVUA 4AYBD 4F67A 1ZTTA 4NZ6A 3PYFA 1CJUB 2E7WA 4RW4B 2E5LJ 4JV5F 1IR2A 1X9MA 2DJWA 5DLGA 1TUWA 3TVKA 4ZCLA 1NRKA 2Q43A 1IBCB 2B3TB 4M63A 3THPA 4EZ6A 1KVJA 1F3VA 4C8LA 4K5RA 4WFXA 4LFBJ 3AJDA 3HHLB 5L46A 3PKYA 1C0TA 2KXNB 2OI2A 1XIQA 4MKVA 2DRAA 3ZTRA 1DHMA 1YJ9S 3D6FB 4JI5J 5L1LA 2UV8G 2UXCF 1VHIA 5HQLA 2VONA 3QJLA 4OLPA 4LJMA 4F4AA 2R9LA 4ZVPB 2VD3A 3GP9A 5EWFA 1P9QC 3ITHB 3DNCA 3BGOP 4MH8A 1KBRA 2J7WA 1IUJA 4URGA 3TZXA 3ENWA 2GS8A 2KYXA 3D0IE 3W1YC 3AFGA 4ZCMA 1WG4A 4F04B 2RRAA 2BQ3A 1N6QB 2Z56B 3H4BA 4RW6B 2MDAA 3TQ1A 2HGLA 3KHLA 4MIBA 3PJWA 4KC5A 1S6OA 1K44A 4ZHRA 4H54A 4YHHJ 4W98A 2HS4A 5MLCV 4NI2A 2VUGA 2B43A 3M6WA 2BACA 2UP1A 4A8FA 4IQXA 4USKA 1LWFB 3GIRA 1N8RT 1DY3A 2MY8A 4OX8A 4EZ9A 3QSYB 1KDNA 2DGWA 2E5GA 2CZVC 3OTDA 3V5RA 3W3SA 3C2PA 4WXOA 1S0OA 1RT4A 3QT6A 4WTOB 5T7LA 3D6TB 3CD6S 4WP8A 2VDIA 4YEAA 3FEYB 2KXFA 2YQ0A 1R0CB 2HHQA 4ZPVR 1PKUA 4MYUA 5J2QA 2DBBA 5DGAA 4JB8B 4B3TF 4YMEA 4DV2F 1CQMA 4K4SA 4NLXA 3UDVA 3MM5B 3BQ1A 2AP6A 4BBYA 2DNYA 5A0YA 2ZBIA 3PCOB 1CJTA 1F9HA 1EP4A 3VCDA 3RBZA 1FO1A 4RUBA 3UD5A 4YFUA 3T5HA 3KLGA 3G96A 5HQ8A 5DDOC 4C0BA 3SI8A 1XK8A 5IV4A 4AL6A 1ZM9A 3H4DA 2V4JA 4CLZA 1RTDB 3TOQA 1HNIA 1V3RA 4USJC 2E1CA 1OY6A 3CCZA 3M8PA 2B4UA 3NOGA 2BW7A 1PYOB 3HHLC 4RU9A 4KGVB 4ILRA 5JMNA 1K47A 5F3TA 4U7CA 3RRGA 4ECYA 1NEEA 4PYDA 2UUCF 4TYBA 3J80Y 4MT1A 2MJNA 3TO8A 2ZNZA 4O44A 4F0MA 1UKUA 1L3VA 1FEEA 1QVFR 4C9DA 2DNRA 2PO4A 3MEDA 1DZ5A 2Z2MA 1U6FA 4WCEQ 3LP2B 3MMCA 1TL7B 3DLEA 4GMKA 4CLKA 4E2FB 2GHWA 2NUHA 2C2MB 2DISA 5A8RA 4X2BA 3W9HA 4WFYA 2DXFA 2WVDA 1T94A 5KFBA 3QRPA 1D3WA 3CJ3A 3DLKA 4R5PA 1Z2ZA 1M5KC 4FXVA 2R3VA 1TMMA 1X4BA 2EXUA 2HNZB 5DZ7A 1RAJA 3HZGA 5T14A 3OTOF 2CQPA 3MEDB 4CO5A 1I1GA 2J6UA 4HH0A 2V2KA 4DV2J 4JI6J 4NWBA 3N01A 5SZTA 4K4WA 2ZEJA 2DGVA 1VFJA 1XNRJ 4IG3B 4LQ9A 2ZBQA 4USUA 4IO9Q 3FRZA 3P49B 3PM9A 1KFDA 2HFVA 1Q53A 3I5AA 3RJMB 5I4MA 4LFCF 4ZVQB 4I2QB 3CMES 4C8KA 1DTQA 2FQQB 2GVZB 2QX0A 1OYEA 1XMQJ 4ANEA 1X9WA 1AA1B 1N5QA 2L3MA 3K8VA 3LH2S 4J37A 1VIOA 2EFQA 1T9XA 4C11B 3WX8A 1WTBA 2XNRA 1H7XA 4DR3F 1HBUA 2WVCA 3QT7A 3GYGA 1LXNA 4X4SA 1V3ZA 5DQGA 3M8RA 3C14A 3CULA 4ZCIA 3IRXB 1T9TA 7FD1A 4QR2A 4OL8A 2V68A 3PEJA 2DK2A 5AE1A 1N5YB 4B3RJ 1BWVA 2HVHA 2J0SD 5KFHA 3JSBA 1EKRA 1JJHA 4DCOB 3MMBB 5D8HB 1ZA2B 1I51B 1OQ3A 1VMBA 3PFOA 2W25A 3CD5A 2CPJA 4NLQA 5LMUF 4DV7J 4LVOP 5HMYA 3GV8B 1FKPA 2IBOA 3NEKA 2M70A 4LMZA 1B3TA 5ETNA 1LW2B 1H2TZ 3GFXA 3S01A 1REVB 4NA2A 3R97A 4Z7CA 1BLUA 3BSAA 1WD6A 6AT1B 5GADU 3J7YI 1CJVA 1TKXA 2JH3A 3N5BA 4EI2A 4EWTA 4M5GA 2XHCA 2EPIA 3EVWA 4DV0J 2P6SA 2QGFB 4ZIWA 2OAUA 2RRBA 3OFHA 4MAKA 4X4TA 2D7SA 3DDIA 2HIYA 5GVQA 1CEZA 5T41A 5JXSA 1YBAA 2D3O1 4IRCA 2XS5A 3UVJA 3EZ5A 1U26A 4M5LA 2VDHA 4JBCA 5CZXA 4CRJA 4G6VB 3J81U 1KHVA 1OS5A 2QV6A 1UJ4A 3PW7A 4LF9F 4QYZJ 3BS9A 2QL9B 3D3BJ 1APSA 1HI1A 5CD4H 3T3FA 4N8NA 4RWXA 1T03A 3A8JA 1VISA 3BN7A 1JNZB 3MMBA 3T6BA 1WI6A 4P52A 1XR6A 1F2HA 1KQSR 4F4KA 1UW9A 2EFPA 2QC3A 3CPWR 4DSKA 1IKWA 1PJ5A 1EZZB 1MN9A 1S7HA 2V67A 1I94F 2B9XA 4KFBB 2QL7B 5M2UA 1N5SA 2BYCA 2F8EX 2CJQA 4ID8A 2GJ2A 3K59A 1J5EJ 1RE1B 5BXIA 4JV2A 3FFIA 1JJ2R 2F4VF 4MIAA 3W9IA 3M30B 1SCJB 1WEZA 4ED4A 2AGQA 2CPZA 3QT8A 4DPXA 2DEIA 1RUSA 3IWNC 1U2RA 5F8GA 9RUBA 2CDQA 4I2QA 1X5TA 3O2IA 3TZWA 3OTBA 2GQQA 4JI4J 1QLNA 3EDQB 3C19A 4CCHA 4G65A 4ZP6A 4UZCA 4YDDB 2IFXA 4OJGA 2LQBA 2J7UA 3OTEA 3ULHA 1KQFB 3SCJE 2HHUA 1OYDA 4CI0B 5J1NA 4DCJB 2FTRA 1PBUA 2JC0A 3DI6A 3IM9A 2E9RX 4ZJLA 1KONA 5LOQA 3E51A 4DV0F 1JLGB 1V9OA 2RU9A 3X3UA 5J2QB 2HK3A 3DM2A 4IFVB 4YB6A 3ZZTA 4Z37A 1K73T 2VKZG 4K2JA 3T1AA 1IBKJ 1ZS6A 2PGCA 4JV1A 2I38A 3N6MA 2AIRB 3RUBL 4CO1A 2QLBB 2A6OA 3CJTA 3SSQA 4ETZA 4O44B 4D3GA 2CXEA 1WHXA 3I0SB 3ILLA 1RI7A 3KUHA 2I1RA 4DX7A 4RNMA 1T95A 5C24B 5LSLA 1TL3B 4UQGA 2EC0A 2DHHA 2RE1A 3M8PB 2H4WB 4H4OA 2VOOA 2CA9A 2LEPA 1FWLA 2B6AA 2VBWA 4P75A 4DX6A 4P2FA 3MM9B 1Y11A 2OHDA 3NS5A 4FP9A 2KVQE 3M8QB 5D15A 3W65A 2MHNA 3NGDA 4YUDA 1NK5A 2O3DA 2AT1B 4RW6A 5B0EA 1YIJS 1WC5A 3D1OA 4B9NA 4HKQA 4ETXA 2H5JB 4TQRA 2BQUA 3GJRB 3HLUA 2A3JA 4Y2CA 4DL4A 2QFJA 3I56S 4AQYJ 1XQIA 4OV1A 2I0XA 3GR0A 4BC7A 4WP9A 5DG8A 2VV5A 3UNGC 1L5UA 1CJKA 2W01A 3LOUA 4KHRA 1QAJA 3H5XA 3J7YU 2RH3A 4IKAA 1RT5B 3W8PA 3KLVA 1U47A 4PUOA 2IY5B 4ECVA 2ZD1B 4PR6A 1PC5A 3DHXA 1URRA 4X4OA 4TY8B 2MKHA 3AD7C 2M4MA 1VOMA 5L8RC 1IKYB 2VKRA 4LBHA 5MAOA 2LECA 4ZVTB 2FVQA 1S49A 6FDRA 2YKAA 4M5MA 4DFJA 2UXBF 4ZKAA 1MSWD 2HVEA 1FNMA 2GNKA 2NUUG 1UPPA 4P74A 3A8IA 3SCKE 5F3ZA 3PR4A 4FS1A 1RTJB 3H98A 3DXSX 1N34J 4I68A 2V4QA 4HTJA 5CCLA 3NWRA 4QIGA 1NK4A 4KPCA 4ECTA 4CO4A 1D8YA 2O66A 4ZLJA 4RZRA 3MR5A 1FE4A 1LFWA 1YITS 2XMUA 5DZ6A 1YJWS 1CG2A 1SH3A 3ITHA 3DOKB 4B3SF 2R7XA 4WE1B 2PN6A 2U2FA 4IDKA 4OYIA 4CLSA 2WCXA 3HI9A 1X8DA 1ZOTA 2WSFC 1BMQB 1D09B 1SV5A 2CVEA 3NWGA 4UUWA 3P4UB 3DRYA 3IGNA 3KTQA 5DRKA 3V6DA 1HQEB 3E01B 5CHCB 2I5JA 3CJQA 5CABA 4LR8A 2V0NA 1XR5A 2FYXA 3VTIA 2XHWA 3FCVA 5FD1A 2XY5A 4WZMA 1RU2A 4NA1A 2P6TA 5JVHQ 1SL1A 1Q7YT 2DHXA 3M7VA 2MKCA 2K06A 5A6WA 2MTLA 2R7QA 2OFHX 3D67A 2CYYA 2IPOB 4MYTA 3O44A 5BYRA 1OY8A 3KLGB 3BGLA 4DSEA 1R43A 3LP0A 3P96A 2O67A 4ANDA 1JLAA 1B99A 3MPVA 3N6LA 1FX2A 4H4KC 2NSCA 2YWWA 3PO4A 1FRIA 1FE0A 2H9ZA 2FHKA 3M2RB 3NAHA 3RW7A 1VDHA 4V1Ak 4OYOA 1PBAA 5KFYA 1D9FA 3MOZA 2HK2A 3D3CJ 5HI7A 5HP1A 1HW9A 4DPWA 1MLAA 1SUQB 2GAHC 3TRGA 3POTA 2F8MA 3T9NA 2M7SA 4X64J 1FJCA 3TJ9A 2VF3A 1ULRA 2QA2A 1YRXA 1S9EB 1OO0B 1WUUA 4QIWD 4UT4A 2ZOGA 5K20B 5C42A 4DV4F 3K89A 4RW4A 3PW2A 2X3GA 4OZ2A 2QO3A 3SDEB 2K1RA 2DNNA 1QE1A 1WC1A 5DETA 3TEHB 1NSQA 2LQ9A 2X51A 2QA1A 5K14A 4X62F 4FBUA 4OJ3A 1O0PA 1RXOB 2BKOA 4LIRA 4O23A 4N8OA 1RWKB 5HROB 3B82A 5IM0B 5KG6A 5HO4A 1XTZA 3KHHA 3Q86A 4ZMMA 1MWQA 2GMHA 2BJ8A 5CZVA 1UZDA 2BW2A 5KFUA 4ANCA 3TVZA 1Q86T 2CNKB 3OL8A 2FVCA 2PMHA 2R7WA 3VAFA 1M90T 3M8WA 4FKXA 1HFEL 2A2CA 5IWAJ 3MM8B 4WXWA 5GAEU 1NCLA 3G4SS 5IT9Y 1HLWA 4DV6J 4PQUA 1GTEA 3DDKA 4M5DA 2DR7A 2E5LF 4C0OC 4LF6J 5KFNA 4Q0BA 1X4FA 1S0NA 2GIQA 1FJGJ 2RVJA 2ZH9A 2YNGB 2EKNA 2PA3A 2E1AA 1EJ7L 3T19A 3MUMP 3KOAA 2CNLB 5BR8F 2C2DA 3KLHB 3A8EA 4OYPA 2R7SA 3AAWB 1PYSB 3HCXA 2QJ3A 1SL0A 4EMDA 4IOBA 4NLTA 1EX8A 3HT3A 3BBFA 2VG7B 1AFIA 5KT6A 1A9NB 1QY7A 7FDRA 2AGOA 4C8OA 1WEXA 4KRWA 5FDLA 1ZM3A 4DSFA 1XC9A 2B51A 4CDIA 2D3UA 2YKQA 2GO8A 3S1TA 5KT4A 2J9DA 1DJ0A 3FMWA 2R7RA 2RU3A 5A8WB 1FCAA 1KEKA 4DLEA 1DQ8A 4M8LA 2YWGA 4EO8A 5JVGQ 2N3LA 1MWZA 4DV6F 5B0DA 3KJVB 2NZ4A 2EC2A 3EGWB 3MMAB 2PFFB 1DARA 2F7VA 4KO0A 1JX4A 2G2YA 1MU2B 2B8QA 2G2OA 3IG1B 1N36J 3D54A 2G0CA 4KPYA 1FKOB 3CIMA 3PR5B 5GAHU 3TA0A 5FLXY 1TK8A 3W64A 2A18A 2BRKA 3GG0A 5KFVA 1Q95G 2HS3A 4MJKA 4KHPF 2KI2A 2WVFA 4NLPA 2RUGA 5HANA 3PRBA 4I7FA 1TQLA 3EUNA 2NR0A 3GR1A 2KT5A 2MB0B 4ED5A 1NO8A 3H5YA 1VRTA 2A6MA 1D8ZA 1ZAXA 3C16A 2GGPA 3GV7B 1RACB 2MLXA 4RR5A 2AJ0A 3JSYA 2IM1A 5HVGA 2DNZA 3Q8PB 4CLUA 3BN4A 5K14B 2R8GA 4DSLA 4PEOA 2JEIA 3J7Z5 1GK8A 1O5JA 2FGCA 2VC0A 4WFAQ 2YKNA 1LK5A 1RT7B 5A8WA 1ZAVA 4QPXA 3EPGA 3CCJS 1SH0A 4IQMA 3J7A1 3NNCA 1SKWA 3K17A 1QAIA 2V9KA 1KN6A 3SCIE 3BM7A 3BH7B 1NDKA 2JHEA 2MZQA 3IAS9 3R8YA 1VQPS 1TFYA 4KV8B 1IQZA 2H48B 4C8NA 5LSRA 1UAWA 3KNAA 1L3TA 3US5A 1N33F 2NQPA 5LM7E 3EJMA 2CJYB 4RW7B 1S1VB 3BF4A 5C7PA 5C5JA 2O5DA 3CB4A 1W2BR 3VF0B 1WF0A 4CYUB 1VQOS 1YI2S 2D1CA 2ZUGA 5L1JA 4W4MA 1QAYA 1LWCB 1H98A 2VPXB 4XAKA 2Q79A 4Z7YA 2LKZA 4J9PA 3SV3A 3GTYX 3W61A 3LP0B 2CWXA 3HXMA 5D0RA 2PIIA 5ETQA 1AXQA 2MKYA 3IS9A 4X4NA 3N5FA 2DPJA 4D3HA 3CWJA 2P2CB 1EHWA 3OL7A 3IN5A 4WYWA 5ITHA 1WJ9A 3IA0A 5F8IA 3KMQA 1LWEB 1XMOJ 2JNJA 1T05B 2XMAA 2R7VA 1RT7A 2EFOA 3UI3A 4KB7A 2WONB 3Q8VA 4USHA 2YH1A 3MAAB 3MM7B 1K1QA 1TR0A 4J9VA 3ZTOA 1ZYQA 1YJTA 4PWDB 2Z57B 4K4VA 1K9MT 1F5CA 3CJKA 1WG5A 2RMLA 4DL3A 2MQ8A 3OL6A 2C3YA 3I31A 4UOHA 1P8GA 4Y6IA 1F60B 1ZTWA 1RTZA 2HVZA 1REGX 4DXLA 2J0WA 2EVZA 1WOSA 3NKYA 1RSCA 2WW4A 3K7RA 3QLHB 4JI0J 4N41A 3GCWP 2RKIA 3Q8RB 4XTTA 3RB6A 1XNQJ 1S1WB 3ZZRA 4DR2J 4HHJA 3GMGA 1A7GE 2HMIA 1TTHB 2NREA 1F9FA 1KR4A 3MPUB 4MFBB 3S6EA 2DRDA 1ITPA 3D2WA 1DQAA 1UCNA 2KRRA 4TNOA 1LW0A 1TV6B 2HWIA 1G6BA 3EZOA 1SQGA 3DGPA 4NPOA 2YX1A 2W9BA 1RP5A 1VGYA 1R6VA 1U4BA 5CYJA 4F2RA 4O3NA 3GCXP 3PTWA 4XO0A 2H3EB 2OSQA 3CGIA 5C42B 4Q44A 4BCAA 1S9EA 2F1FA 4IUFA 4OJHA 1U0HA 4ELUA 2XY7A 4RUAA 2RNEA 3FFIB 3M1VA 2QSWA 1E6VA 3IGVA 3KG4A 2DB1A 4UY85 1NDCA 1Z1ZA 3W2VB 3C15A 1S1XA 2QFIA 4UW2A 3QRQA 5LSOA 1DTTA 3QO9B 4PCQA 5ETOA 1ROFA 1GAOA 3MCOA 2YWHA 2FC8A 2IM3A 3QWPA 4LBPA 1RHQB 1JLAB 2HFSA 2Z2LA 2JRSA 2ZBRA 3ADAC 5F0WA 1RA6A 3OJUA 2ASYA 3IMQJ 4PQUB 3UWTA 4K4YA 4B3OB 1B0TA 1RTIA 1Q78A 2YH0A 2B6AB 1FXLA 2RS2A 2GC8A 2ZE2B 4LUBA 5E2QA 4WPAA 3T6JA 4FKYA 4K2XA 2L41A 1WSVA 4DFKA 4DL2A 4KR0B 3M6UA 1S0MA 4QJVA 2O1PA 3FNNA 5E3CA 2MQPA 4GKKF 1YX2A 2QYCA 1FRMA 4J91A 1BQNB 3DMJB 3PKMA 3FKBA 4MKBA 1J5OB 1CJVB 1TKXB 3LUYA 2KKHA 4FPIA 4QR0A 1RHRB 2NXNA 2W2MP 3LP1B 2UUAJ 4JI7F 2QG9B 5IT4A 1YKWA 4RX6A 4WE1A 2QYGA 1FK9B 2K8GA 2FIUA 2VASA 3RZAA 2RIJA 1T03B 2QLFB 3NMRA 4OYXA 3RW6A 2CQCA 3VWSA 3EX7B 3M8SA 4L72B 2J76E 2MQQA 1KQKA 2CQ0A 3AQOA 5KFSA 3NGKA 2W2PP 2IJNA 3BKFA 4ALZA 2VIHA 1UL3A 3CJ0A 1PILA 3HO1A 1QAXA 3BKUA 5DJBA 1QD1A 3KJQB 4P7TA 3OR1B 2QMWA 3KYLA 3PV8A 4JI3J 5H9FK 1WKJA 2B4VA 2Y3YA 2N4DA 2YWEA 1Y7PA 3LO3A 4KBIA 3H40A 2E5HA 2W9AA 2C3OA 2DVIA 2Y1IA 2ROGA 5D4NA 1IWAA 1VQYA 2IMWP 3HVRA 3T1YJ 2LQ5A 1Q8IA 1Z4UA 3NCRA 1BE4A 1S77D 4PPDA 1GXTA 2ZBCA 3G87A 5ETKA 3TA1A 3KG0A 2MZ1A 2CQGA 2VJUA 2BKPA 1NAQA 5LXRA 5J2MB 1S6UA 4K59A 1FX4A 4FS2A 1TELA 5C24A 3H8YA 2L9WA 1N32F 2YNIB 4EBEA 1S12A 1CULA 4EFAC 4MMOA 1TUGB 1UJ5A 3IC1A 1VQ9S 3N9UC 2CNOB 1XBWA 1HPZA 1Q0NA 3UFCX 3WX4A 2ADCA 3MEEB 1R27B 1VRUA 2HRYA 2BJ7A 2WRMA 3HSGA 4YQWA 2OPQA 3C46A 1OWXA 4ZPBA 2ZH3A 3HHLD 2HQFA 5AE2A 1ZPVA 3DYAB 5B0AA 2R2UA 2OEKA 2AJ4A 3FBCA 5GMEA 5HMWA 2ASDA 4ZPDA 3JQMA 4ECSA 3LP1A 3FBEA 3U7JA 2ACYA 2VG5A 4DQRA 3DLHA 4LF4F 2HHTA 5ETSA 1HBNB 2DGSA 2VG6A 2J6SA 2JWNA 3G82B 2ZM6J 3AQPA 2ALYB 3VAJA 4UOFA 1C4AA 2MEWA 2GZOA 3BREA 4CP5A 1M5VC 1HNVB 2BE9B 2HNYB 2LXIA 2V63A 4IFYA 4B9TA 1FRLA 1G1XA 5F8LA 4HL9A 1N5VA 1SI9A 3BKTA 1T9VA 4ZVFA 2XCAA 1V3SA 3QGHA 4TQSA 2YKPA 3G9CA 4ZLNA 3MEKA 3RB3A 2DHGA 1XMQF 2UUAF 1Y0HA 1SC1B 1VC0A 2HHPA 2HQIA 3ZFVA 2WZ1A 2R7UA 2IC3A 2VB6A 3BBBA 1MN7A 1DTTB 3QO9A 1V6HA 2LMIA 2OPQB 2FZKB 2G0IA 4WBFA 3EPIA 4L3NA 4DR1F 3RB4A 4ILMA 4RNOA 3DRPA 2NPIA 4X4PA 4JP8A 2Q6BA 1B4SA 3H59A 2FVPA 2VA2A 2C2RA 1HR0J 3MR2A 5IZHA 4M95A 3CDEA 3LWLA 3TUJC 1W2IA 1YRTA 3NGUA 4NLDA 3VGTA 3ZNJ1 3C6TB 4EYHB 2MKJA 3I5BA 2OSRA 4J9LA 3ONQA 5LMUJ 1T9WA 3U27A 4LF7F 4C2MA 1HBUB 3EVOA 2ASJA 2E9ZA 5D0GA 3ELHA 1IN0A 1U2FA 5ETRA 4OZNA 3SQGA 4CM0A 3QT5A 4TU8A 2QL5B 4B3MJ 2B9YA 2WOMA 3EXYA 3DLGA 1JLQA 2P8IA 1SPBP 4MKAA 2V9WA 3P6YC 3W8GA 4IG3A 5E3AA 3KKFA 4F0KA 2ZH2A 1T0TV 2IRYA 1VLOA 1KWMA 4O3OA 3OVBA 2DNKA 3K5OA 4AE5A 3MTJA 5K8PA 2PI5A 1GXLA 4B3OA 3GONA 3LP2A 2HG4A 3HVAA 3AA8A 2YX7A 5L38A 1VR6A 1WTFA 1ZM4A 3DRPB 3OXFA 3UCGA 3CJSA 1NBEB 3OR2B 1JLCA 1Q1KA 3WZ0A 3BSOA 4E0DA 1N5YA 2HQDA 4TXSA 1HNXF 1RU1A 4QW9A 1VS3A 3MR6A 2BM0A 1HWLA 3CJRA 3GG1A 3QATA 3S7RA 2JLFA 2OMLA 2GIFA 2LXUA 4DU8A 2CQIA 1J5OA 1UFWA 2FD2A 3M1VB 1M5SA 2G13A 4WIIA 3WC0A 3HK2A 3T41A 1RQ0A 1R8AA 1U0SA 4HHHA 1Y9OA 3GZ7A 2ZH1A 4B3TJ 4ERDA 3MD1A 1HBMA 5K8OA 2W9CA 1YLXA 4C11A 4ER8A 2J0QD 2ABYA 4ELTA 2JEGA 2W7PA 2HVIA 1X4DA 2Q6CA 4ID5B 4OZ1A 1SIWB 3PHEA 1RTIB 4I6AA 4HACB 5DDPC 4OZJA 3OR1A 1Q7LB 3OV7A 1K1SA 2X3DA 2UUCJ 2WVEA 5J2PA 3LALA 3SEOA 3G6YA 4OHYA 1QSYA 2M8DB 2CDRB 2R7OA 2VBYA 1WOOA 3AY0A 3KXDA 4IH5A 3Q89A 4MIWA 4YR0A 1NK7A 1HHTP 2AD9A 2ZFHA 3PIPQ 1GT8A 4ZITA 1EIYB 4LSNA 3J81j 2CPYA 2OGUA 2BXJA 2FLLA 2NS1B 4LF7J 1XERA 3W7BA 2HEKA 2HLUA 3LAMA 3M9OB 1WHWA 1WACA 4DLGA 4I56A 1B7YB 1GTHA 4QZVB 1VBXA 4ELVA 1JLFB 3IBFB 4M94A 2LYVA 3R5GA 4MKYA 1R8BA 2DO0A 1RT1A 2HNYA 1HNVA 3IWXA 1O8BA 1LWFA 1C1CA 4IFYB 2YX4A 3A12A 1CLFA 1PAUB 3EICA 1QTMA 4FYVB 1WHVA 4N5SA 1KC8T 2M0GB 1PYTA 5CCMA 3MR3A 1HYSA 4G1IA 4ZHRB 3OFEA 3R6LB 2GJFA 3GFYA 3FMBA 2ZOFA 2M2BA 2JX2A 3JTNA 1HHQA 4GKJJ 4UOGA 3G86A 4H4MB 2BQRA 4W90B 4J7CA 4NA3A 5G0RB 1YJUA 4DX5A 7AT1B 2J5AA 2Y0BB 1HW8A 1X0PA 2AJ2A 2GMLA 3WIVA 2VJVA 4EEYA 2QIFA 2MZTA 2KYZA 2OPSB 2EWHA 5CA5A 4FVMA 1CULB 2ZM6F 3AJ2A 2HYIB 2HFZA 2BJEA 4X66J 4BWJA 2CQ1A 1TK0A 4L73A 3I87A 1QUPA 3C15B 3BO2A 1E6YA 3GJQB 3F41A 1B7FA 1KP6A 2QSFA 2L9DA 1D9DA 4KE5A 2E66A 5H9EK 3V4MA 4R8UA 3TAMB 1SXLA 3I6PA 3KWMA 2YNHB 2R8HA 2XB2D 3OQ2A 1ELOA 2K3IA 3OFGA 4NE9C 2ZHOA 2HBZB 2UXDJ 2B4PA 2HWHA 4K0KF 3J80U 4BLGA 4C8ZA 3R27A 1KVIA 1FRKA 3ILOA 4U8VA 3R5JB 2AMCB 5EN1A 2MKKA 3B4DA 3ZZYA 3OJSA 2IAJA 2G9OA 2KFZA 2RQMA 2YQ3A 3CDBA 4PXDA 2LXFA 3DOMA 3OLAA 3QLHA 1TAQA 5DM6Q 1R8CA 4QYRA 3L3CA 3JSMB 3C66A 5RUBA 1TL1B 3W5YA 1N54B 1SH2A 3TAQA 9ATCB 2BANB 4I4BA 2HBQB 3LF0A 2J8SA 2CAJA 3BEGB 1BY9A 4A8YA 4UY8T 1TKTA 3M9NB 2ZZNA 4PYAA 4ED6A 3TP2A 2KFYA 1TVRB 2GQCA 1G4CA 3BYPA 2QEXS 4G3IA 3OHBA 2C3MA 2KJWA 2WVBA 5I42B 4A8MP 2HAIA 5FLXU 4NI2B 1NHUA 4JI3F 3ZTPA 2ZVSA 2J7KA 1JKHA 2RDDA 2Z0GA 4F4XA 2IHR1 4B17A 5IM0A 2HHHF 5H9FJ 1RAHB 4NCBA 4PKDB 2A0FB 1SKSA 2OPPB 3TWZA 3HVWA 1RAOA 3C16B 1IBMF 1RTDA 5IQQA 2QZ8A 1FF2A 4FXDA 1QUVA 3H0PA 3VAGA 1NZ8A 5A8KA 2R42A 2HMIB 1HIYA 5KFWA 3K58A 1JLBA 4N47A 4DUTA 5HLFB 2QMXA 3QAEA 1YSJA 1S1WA 3PG9A 3WQPA 3ZZUA 1S1UB 2MZJA 4DV1J 1UA1A 5C25A 1T9YA 4ZPAA 5G4DA 5KG0A 2DY9A 4MK8A 2UU9J 4IH6A 2ZZMA 2EK6A 4QPTA 4E8UA 4KV8A 2HFUA 5KFCA 1RT3A 3R5BA 2ERRA 1U0HB 2MSTA 4NLRA 2HHWA 2VODA 4FYXB 3TA2A 2LCWA 2W4DA 4L75A 3KJNB 1S1VA 2CJKA 4OZ3A 1X5OA 3DN9A 3OTCA 2RUSA 3JAMU 5I3UA 1BUXA 3BDPA 1FFSB 2KT3A 1QVGR 1RADB 2R8JA 2MZSA 1TK5A 2E1MC 3MMJA 5J1EB 2AEMA 2VOPA 2GW8A 4UQTA 1FXRA 2DNOA 3Q2SC 1LKZA 3I4HX 2BX6A 4B9UA 3HDSA 2FVRA 2IA6A 5LMNF 3PEHA 3B8HA 1S4EA 3IRWP 3BJYA 2CQ2A 5F9NA 4DEZA 4ILLA 4Y00A 3EYZA 1SC4B 1VK3A 2GCFA 3QWUA 3VGUA 3JYTB 3JB9k 4I1TA 4A8OA 4LRAA 2K3KA 4KYZA 3HHDA 3PX4A 1TKZB 4NZ0A 5EWGA 2EBEA 2CKWA 2W2OP 2Z30B 1KNZA 1DLOB 3DOLA 1OSDA 3MEGB 5L1IA 3T5KA 4RLEA 2M8HA 2RF2B 3LGNA 4CTAA 3M32A 3P8BB 4ZP8A 1X4EA 5EHHA 4DWIA 1NHKL 1FNOA 4CH0S 1UVLA 3NNHA 5IOLA 3HD2A 1PAEX 3MXHP 5DLFA 3HKZD 1JLEB 4OHXA 4O3PA 4ES2A 4LF2A 4JV0A 1WNEA 4NLUA 1OSCA 2MY7A 3I9ZA 4C8YA 4P73A 1UW4A 2XZDB 4UF4A 5JUMA 4F4YA 3LTOA 1FVQA 3J7ZT 1K8AT 2D9OA 1QE1B 2F63A 2K1RB 2C42A 2MLYA 4YS2A 4DL7A 2F9DA 1OMSA 2M9KA 2RB7A 3QMQA 4Y2KA 1HL6A 3DGVA 3Q22A 2VU5A 3V4IA 3BBCA 2LEBA 1XWLA 2OJ3A 1N34F 2X7IA 2VZ9A 8ATCB 3K8WA 1F5AA 3Q0AA 4F3OA 4QR1A 5IXUA 5EUHA 5C25B 4IG0A 1N0UA 4LRCA 5A2QY 3HMJG 3IR6B 2HFOA 3OFFA 1OJ4A 3MM8A 2DGQA 5H9EJ 2EFVA 2XMMA 4DSJA 3X1LB 4C4WA 4LBIA 2BV3A 4OHZA 3IG1A 3AOAA 2M88A 2VC1A 5D78A 5LXYA 3LWMA 1U8WA 4C8MA 4ZJQA 2AQ4A 3V4IB 3MDFA 5HROA 2MZRA 2R7TA 4LREA 2DXEA 1Q8BA 3TYTA 2R2SA 4DR4J 4X84A 1IR0A 5BYSA 5J1EA 2IM0A 1FKAF 2H1YA 4AQYF 1IXKA 4QU7A 2ZBPA 2HW3A 2MQMA 2WSEC 2HGNA 2YPZA 2ROPA 1YJNS 4OJ1A 1AZSA 4O4GA 3HHNB 4HHUA 3RAXA 4LRBA 1KLMA 3CE8A 1VIXA 4USWA 4CLLA 3TAMA 4R8UB 3CSKA 8RUCA 2IBKA 4OI0A 2U1AA 4M5JA 1YK9A 3KLFB 2H5EA 1VC6A 1R7IA 2WHOA 2XWYA 4J5OA 3BQ2A 1FJEB 2BMBA 2EBGA 4P2XA 3CO0P 3ZXWA 4HEA9 5IQ6A 3WBZA 5GAGU 4Q45A 3KHGA 3SXLA 3NGRA 4DCPB 1UA0A 2KH9A 4KGMA 1F6TA 1RT6B 3DOMB 3GB0A 1RKIA 1RWVB 2DY1A 2V69A 3K2YA 1H74A 1FEHA 4RW7A 3KK2B 2XI2A 4DQSA 4H4KA 3PX6A 5KOXA 3UDLA 4O0IA 1NB7A 4K50A 4JV5J 2F65A 3A4TA 4X65J 3PVXA 2CPHA 1KLMB 1ZBTA 4DL5A 2CPFA 2C2ZB 3CCWA 2RILA 1IBKF 3FEXB 3MAQA 3GE9A 2HZVA 3BDEA 2Z4PA 4LQ3A 4ZLPA 4U7UD 2AEFA 1HQ2A 2D3ZA 1YQHA 3CCUS 4ZP9A 1C1BB 2VFRA 3K5PA 4NMXA 2R2TA 1RYRA 4C3MA 1VC5A 1R6YA 3FUYA 1FFGB 4ZVSB 3KMSA 2PSZA 2E5JA 3R7NB 3AB4B 2CQHA 2CJAA 1Q5VA 3U1NA 1EARA 4B02A 1HWKA 1GMWD 1IBMJ 5E3QA 2K2PA 1WC6A 2NZCA 3V6DB 1M1KT 2CG8A 3JSMA 2F8HA 4ZVUB 1TAUA 1FI4A 1RAFB 3W60A 4KAIA 4K0KJ 1VQKS 2H51B 2HQ3A 2HURA 3SQOP 1WC4A 2JLGA 1X5SA 4ECUA 1FKOA 3OW2R 1CSJA 2JVOA 2W24A 3Q83A 3UVJB 4X4UA 1TKDA 4M5KA 2DR9A 4OX6A 2PMZD 2VH7A 2AYMA 1I5OB 2VFSA 4ZPTR 3FEZA 1I94J 2DKOB 4FF4A 3F0NA 4OX7A 2AGPA 3DLJA 1MMNA 4ZLLA 3BO4A 1XR7A 1N52B 1WORA 4F0HA 3CXCR 1SJ3P 4FF3A 4LFAJ 2XGPA 3MOJB 1RWXB 4F4ZA 2IA0A 1RCOB 3K5NA 2VQFJ 3HSDA 3QGPA 3O6QA 2AX1A 2AJQA 4CO2A 4HVZA 1I6JA 1JKHB 2KL8A 1FNXH 1OPZA 3PFEA 2JJ4D 4C48A 3I0RA 1M5OC 2KTQA 1SC3B 4YB7A 1FA0A 4A8WA 3VVTA 1FRHA 1URNA 1UVJA 2FY8A 1TKTB 3DU5A 3M2RA 4RW9B 4ZJOA 1CJKB 3W9JA 3WIUA 1PGZA 3E2EA 1H2UX 1GEHA 3AXKA 3DOKA 4RNFA 2HQCA 5GAEI 1ZA1B 5M2RA 4RNNA 2KDOA 3WC2A 3ET6A 3PJ9A 4CLPA 3KLEA 4OZ5A 2PEBA 5KT7A 4U7UK 3R5AA 5HVHA 4ID5A 2FJXA 3MPYA 3UN2A 4DV7F 4GVBB 3LANA 4X64F 4NLYA 3HX9A 1ZETA 1FT8A 2OIHA 3M2VA 4N77A 3R1LA 1KLNA 2CJ9A 3RAQA 2VFUA 1KTQA 2JZ5A 2KVIA 4WWSA 4EU0A 5HJYA 4FF1A 2ZITA 4OX9F 3TX0A 1J2VA 1NPKA 4RJVA 2XS7A 1S99A 2H65B 2PC6A 5E5NA 1HMVA 3G8SA 2OTLS 1T3OA 4GKJF 1V5VA 3D6HB 4URQU 4RBVA 2OFGX 2VBXA 1YJ7A 1CS4A 2CJBA 1RBLA 4A4JA 4CLYA 4NYOA 4RL1A 2YVSA 4ZPCA 5A8RB 1Y5NB 5GMDA 2E1PA 2XI3A 1N5TA 1U25A 1VYAA 2B9EA 1RT3B 2CNNB 2EG1A 4OFZA 5SUHA 2MQOA 4U67Q 2QLJB 4EGLA 3DI6B 3B6BA 1Y10A 4WTYA 3VALA 4DUZF 1EQMA 5K8NA 1HD0A 3GILA 5HQMA 1JLGA 1N48A 2OTJS 4JI1F 2ZC4A 5JJBA 4Q8EA 2FJDB 2HZCA 2VPYB 5G0RA 3CMAS 3T1HJ 5KT3A 4QIFA 2E7XA 5CXTA 3QAUA 4OZLA 4Y65A 1WHYA 1XJWB 4F36A 2ZHAA 2YXLA 5E7OB 3UE2A 5L9XA 1S0VA 1VQ7S 3EXCX 1VQLS 1IWGA 4I2PA 1YRUA 2RS8A 1RKJA 4Q2LA 2BJDA 1IM4A 4DMZA 1RLCL 2Y1JA 2OELA 3OVAA 2KZMA 1CVJA 4DR7F 2G1HA 4HI2A 2RAQA 1RT1B 2PEHA 3A8KA 2W9CB 5H1SV 3Q8YA 4DQQA 5EGYA 2GJIA 3QZ8A 3PX0A 2E44A 2OPSA 2O01C 2C22A 4DQPA 4B9VA 1S79A 1YGYA 4W92B 1NNDA 2DH8A 4DR7J 1NHVA 2W7OA 3HM9A 2D3OR 4HDHA 1AT1B 1P6TA 3VR1A 3CJ2A 4XIUA 3GFHA 1KQGB 1KKHA 3C3LA 1RAIB 1NDLA 5KFEA 3CJ4A 3FJ2A 3CC7S 4BHQA 4OMFG 1NK8A 1QSSA 4WKRA 1UEUA 3D4JA 1MROA 4ZVGA 4DF4A 2WOMB 4AT1B 4BC9A 4NLOA 3MM6B 4DR5J 1U48A 4JI1J 1VBZA 3Q8SB 2C2OB 4P6QA 2JSXA 1VBYA 2K7KA 2P9EA 3RRHA 4ZIVA 1RWUA 3H5UA 3VGSA 1ZH5A 2OD4A 4DR1J 2ZE2A 3GLJA 2HNDA 4C0HA 1PJ6A 5ETVA 1T7PA 5IC4B 5KAKA 3GSDA 1D0EA 2DIUA 3TVYA 5L39A 5D3GA 1HBNA 2VG6B 2D9PA 3A3OB 3UPFA 4K8RA 3CCLS 2DH9A 2XMJA 2YNHA 3LW5C 1JMTA 1LEOA 1U02A 2LLZA 2XBPA 3I82A 3KDOA 3PRDA 2EG2A 2XWXA 1D9AA 2ZD1A 3DM2B 1RBOB 3L95X 4IFVA 2IVFB 3ZTQA 4Y2MA 4CQ1A 1HARA 3W2WA 1FKPB 2F5GA 4DL0C 2BDPA 3MCNA 3MCSA 2C2KB 3MMCB 1RAAB 1X7VA 2COLA 4RBUA 4CLWA 4YHHF 1NPRA 5F8JA 5HATA 5DM7Q 1HPZB 3H7HB 2J9EA 3JSRA 3CO9A 1XN9A 3RR7A 1HNWF 1OQ6A 2MKSA 4YN3B 2IC3B 3CC2S 2LU2A 3TAPA 1WC0A 2BABA 3MGJA 1CJUA 1HR0F 4Q2MA 2V4JB 3M8QA 5F41A 2UXDF 4QCLA 4TU7A 1WG1A 3H90A 4Q7AA 4DUYJ 4QW8A 3TARA 1IKXA 1SJQA 1TUVA 3GSIA 2FHMA 3ZZZA 3G82A 1MWYA 2HNDB 1CJTB 2IJFA 3G71S 2IVMA 2UVVA 4WF9Q 4YB1P 1CPZA 1WKLA 1AROP 4CH1A 4QWDA 1SQFA 2ACMA 4KY3A 3N6NA 1LW2A 2FJWA 4PPZA 5F8HA 3EGNA 2EI5A 4K4XA 4A8QA 4QIEA 2X1AA 3CMQA 4NLSA 3ZC4A 1C0UA 2VQFF 2ZWPA 2V2VA 4YDXA 4RWWA 1TL7A 3DLEB 5B0GA 5B08A 3V6JA 1SL2A 4IR9A 1S9GA 4PG7A 4WK3A 3L7PA 2C3PA 4IOCQ 4A8SA 5E0OA 3T1YF 1UZHA 2J0XA 3OSNA 3CJ8A 3D0HE 4N76A 1NXIA 5IV3A 1HMVB 1UEVA 1JLQB 3DHWC 3C14B 2EKYA 5LJ5Y 3F73A 3DMJA 4OI6A 3HHLA 2A2DA 2BM1A 1CC7A 4I2PB 4USMA 5B09A 2DNHA 1S10A 1YZ7A 3O8WA 5HSPA 5J2MA 1G3OA 5CQGA 5ETMA 2MPUA 1Y4ZB 3PYGA 2B7BB 2XMKA 2V8GA 1VCTA 2YKOA 4LF1A 1U1RA 3R2DJ 2QA4G 1H6KX 2CQDA 3HULA 4F3MA 3ET6B 3BZQA 1KSPA 5KOWA 1C2PA 2E1RA 1EP4B 2WB1D 5KT5A 1N32J 3J7AN 4JI8F 4DN0A 1WKKA 3IBWA 4TYAA 4C7QA 5AJ3J 3TUZC 3TUPA 2JFKA 1Y3KA 2N7CA 2ZDPA 3QPIA 3DLKB 3W2WB 4R5PB 3TI0A 3HD1A 1FXDA 1R3NA 1AYEA 4QWCA 1NKEA 1HHSA 4KT0C 1X9SA 5KFTA 5KFOA 1NUEA 4G1QA 2XY6A 3WHIA 2MMYA 2F9JA 3IFEA 4LRFA 4X65F 4V19J 1CBKA 2M3DA 2RHSB 1MNEA 2KM8B 1CS4B 4BWMA 3ISND 5J2NA 1WI8A 5HL7Q 3OXLA 3R1HA 2OKQA 4U95A 1S5ZA 3LPYA 4C3LA 4HH1A 1HI8A 1DURA 3KUEA 1MMLA 4RUHA 1N4LA 4HLBA 1Q81T 1VQ5S 4OQJA 3MAAA 2RHQB 3MM7A 2OO4A 1C1BA 5DQHA 1LK7A 4B3RF 1IKXB 3AJ1A 2UVRA 3NS7B 3DC2A 3AD8C 2HNZA 3W5ZA 4JI7J 3FK4A 2BR0A 2APOA 1KS2A 2V6AA 3FSYA 4DR3J 3AODA 4J9NA 3L7UA 2RKIB 1W25A 1KOHA 3SMZA 1T9UA 1VRQC 3SCLE 1HKAA 1WWHA 3V81A 3QJJA 2DXDA 2GQ2A 2POKA 4FYDA 1P27B 1HBOA 4CH7A 1EKSA 3AHPA 2AWZA 1RWPB 4TLQA 4YY3F 4QWEA 1XNRF 4AXIA 1RHKB 4KJIA 3CTRA 5KFKA 3EVMA 1FDAA 2WK4A 1P9YA 1S1TB 4NCGA 3BPSP 2YNFA 3MR7A 1Q4RA 3UO0A 4ZK7M 3K5MA 4DR5F 2C3UA 1VQNS 2DNLA 4QQBA 3KFWX 3KLIB 4FXWA 2WTFA 4I7FB 5ETPA 4DX8H 1JXLA 3HJFA 3DGPB 1O51A 1PJ7A 5DDQC 4F25A 2DR6A 2EK1A 3LGMA 4O4GB 2Z58B 4ZN1A 1GX6A 3TQEA 3NBPB 5FDLB 5F8NA 1X5PA 2DNQA 2BJ1A 1R8HA 4DV5F 4DFPA 1C4CA 3GJTB 3UD4P 2BE2B 3MFIA 1BHNA 2LA6A 2GV1A 2KHCA 4WYLA 2JEFA 2XSJB 1JB0C 3A13A 3HFZB 4A8XA 4P7VA 1VRTB 2J8AA 3UN5A 2VG5B 1UTAA 3ENVA 3J81Y 4TU9A 3ZZ0A 2CRLA 3CDWA 5BYQA 3MFHA 3EDRB 1FK9A 1HQUB 4L6V3 1FDNA 1YWXA 1RT2A 1RWMB 2HIQA 5KT2A 1NU4A 1WSRA 2ZUAA 4FNIA 3SBMA 1BWEA 2OLWA 2MYFA 4PWDA 3MEEA 4XDDA 4OYMA 2CG4A 1YDLA 3MCMA 3VQSA 2V2QA 3C8YA 4J9OA 5THWA 2ALZA 4DR2F 2KU7A 1AB8A 2HSEB 3DU6A 2Y8WA 2XG8A 4AXJA 2XGQA 3MMAA 2DTJA 3H25A 3LAKA 2DCUB 2HRUA 1HNIB 4CO0A 2GHPA 4CIOA 4ECWA 1KD1T 3MAHA 1JQGA 2BEFA 4Y3CA 3KJFB 5AT1B 2FPHX 3IP0A 1SJFA 4DPTA 4Y2AA 4P9SA 3IWLA 2QMUB 2FJVA 3AOCA 3GPAA 2OH2A 1F2GA 4CT9A 1RAGB 2PDAA 2ZC3A 3MZIA 4KHMA 1UVNA 2VG7A 1FDBA 3RRKA 2HBRB 4DFMA 2B9WA 4KKOB 1HD1A 1VLYA 4U8YA 5C2CA 1NKBA 1KTVA 2CQ4A 1QSLA 4IYQA 1LWCA 4O3RA 3PO5A 3BGRB 1RHJB 1PO6A 2YPYA 3ZNUA 5A8KB 3MPDA 4WK1A 2KFNA 3KJVA 1BD6A 2RRNA 1A0OB 3M05A 5KG4A 5J1PA 1NDPA 1GQEA 1LXJA 3JQKA 4USTA 5A6PA 2KM8C 4RBTA 2N3OA 3CC4S 5KFPA 1LQ9A 2E5IA 4F4WA 5KG2A 2G2ZA 5A76A 4KHPJ 1S57A 2CJXB 3IXQA 1X4GA 4A46A 3D7SB 4MFBA 4N56A 1UVMA 3FQKA 2Y8YA 3JXOA 4DV1F 1RCXB 4LF5J 5KFGA 3CJ5A 1YVFA 3P3DA 2AYGA 2ZVIA 3DRSA 2C1EB 1FVSA 1G7CB 4URSA 1Y5IB 3NXZA 1W26A 2KO1A 4J9KA 3P5BP 5AXLA 4KTQA 2FJAB 3SDEA 4JI2J 2JEJA 3EGZA 5HN0A 3DCAA 4B08A 2X1BA 4IDKB 3RBDA 4Y0FA 3N79A 3VZHA 4ZVHA 1SKUB 2JDJA 1BC6A 5KFIA 5IC6B 3BGUA 4F26A 3KHRA 5FJ4A 1IR1A 4NYPA 3PYDA 1SC6A 2ZWOA 1FDDA 2JL9A 4JOUA 4IOAQ 5ADZA 3W2VA 5HBMA 5LL6d 4QWAA 4PG8A 2VQEJ 3PZPA 1C0TB 1PIEA 2DO4A 2VQEF 1OY9A 2XULA 2DHAA 2AX0A 4UZBA 3P45B 2PFDA 3M8ZA 4K7QA 4NX9A 3W66A 3NBPA 2D69A 1ACMB 3G2XA 2RSQA 3M2UB 2OEMA 3R5DA 1ZPWX 4NXMF 4FNHA 2N7YA 1FJGF 1NPPA 4NLVA 1R89A 1UP1A 2AJFE 4NZ7A 1F3FA 3TW0A 4X4QA 1S72S 1SIZA 2YY3A 1FRJA 3M2UA 2JFDA 4NRTA 4JI2F 5HBMB 1XMBA 2X1FA 4K4ZA 1U6ZA 5F8MA 3L4BC 1NB2A 1S1TA 5KFFA 3NY0A 4Y28C 2I5JB 4CYUA 2XSFA 1MG7A 4RW8B 2DGUA 5KFMA 4KKOA 4NXMJ 1XEZA 3N4WA 3BSCA 4K4TA 3RBEA 5D77A 3RTVA 4X62J 1YZ6A 2HHXA 3PW0A 1GH8A 3DRRA 3KK3B 1NSPA 1TKZA 4FYYB 2P9GA 3K5LA 5I3QA 4PG6A 4DS4A 5CH7B 2ILYA 1MU2A 3MPWA 1P1TA 2B5JA 2BJ3A 1KHWA 3BV8A 4M5IA 3FVYA 4JUZA 3CJKB 3TUIC 5BR8J 1MMDA 1SKRA 2XTJP 4FDFA 2GIRA 4DBQA 3QFWA 4NLWA 2WONA 2LQ8A 1MW7A 3AB2B 2GX8A 3QSIA 4LF6F 1PG5B 5J2NB 4DZ6A 4DL6A 3CD7A 3F56A 3QJPA 2HVDA 5GAGI 1BQXA 1HQEA 2HFNA 1EETB 2XMWA 1ZM2A 2AKWB 2CPEA 3E01A 4M5NA 4TY8A 4YB5A 3VQTA 3N0VA 2L48A 2W8KA 2LDIA 1KRPA 2IDLA 1D1UA 3H2LA 2HBYB 3HHEA 3QIPA 1H0HB 4GO5X 2ZH5A 1NJYA 3M32B 3N28A 5DS7A 1DFDA 4R25A 3UW1A 2QE5A 5DG9A 4DQIA 1Y3JA 1DLOA 1PSDA 1B0PA 1U24A 3PJXA 3FSIA 2Q66A 2FZCB 1RDRA 4C97A 2BE2A 3V81B 2BUNA 4PWWA 2W8LA 3G8TA 5KFDA 4NXNF 2DD8S 1QJHA 2AHOB 4Y2IA 2ATLA 1TP7A 2HLTA 1U1KA 5B7WA 4UUXA 4EYIB 2UUTA 1FTRA 1WF1A 3MD3A 4ZCKA 3SV4A 4F50A 3HFKA 4RNHA 5KFAA 1S6PB 3KLIA 2DNMA 2HHVA 1Z2LA 2DHSA 1E6YB 1NSKL 2GO9A 1TL3A 3BPDA 4KFBA 3ZTSA 2DGXA 2GGPB 3FCHA 4DOZA 3KLHA 3CDAA 1TFWA 2JOQA 3DOLB 3MEGA 3ZO7A 2IYIA 2YNGA 1Q16B 4ZP7A 5KFLA 3MUVP 3D66A 3H20A 3CCQS 3M9MB 5I42A 3UCZP 2WBRA 2J6TA 4ZA1A 1IKVB 1RABB 2YTCA 3BGRA 1TL4A 3HFVA 4G1QB 1T3NA 2UXBJ 3C6UB 2XLJA 1QTNB 4DDFA 4J90A 4I69A 1FHTA 1FERA 1T11A 1RT2B 1TL5A 1Q79A 2NLWA 4IG0B 3FDSA 1DRZA 4JYAJ 1NKCA 2GA7A 1TL1A 5L9NA 3NS6A 2Y0SD 1K0TA 1SBRA 1KVKA 1S76D 1S48A 1S6QB 2F40A 1F0XA 2AYBA 2CFXA 2LP4A 2YKMA 2XCPA 4R0EA 5AE3A 1SB6A 2BVZA 4O3QA 4XPCA 3OSPA 1VBKA 1NK6A 4B3SJ 2YBVA 2VBZA 3R7BB 1OIAA 2DNGA 2UZAA 3NAIA 3OD2A 3GU0A 2DNPA 1FJ7A 1M0SA 2OPRA 4CNYA 4EUVA 3G6ES 3AOBA 2PMWA 3HSJA 1EB0A 1RGVA 2GVDB 2M5YA 3CNQP 4J9RA 4DSIA 2ZH6A 3HZEA 5KG3A 2W2QP 5LMNJ 1NK9A 1HBOB 4HYKA 3WDOA 2IVYA 4I6YA 3S8SA 2BJ9A 3IR7B 4ZPWR 1FWKA 4NCGB 1ICEB 4CM2A 1R0AA 4P71A 5D4OA 4XDCA 3E3XA 2MKIA 3CF5Q 5KG7A 4B3MF 3IRXA 2IRUA 4Z2XA 1FD8A 5KFQA 4CT8A 4DV3J 2XO6A 4KH1B 2DYAA 1AUDA 2EFGA 4U96A 4ZOSA 1RTHB 1C0UB 4HACA 4DN9A 3DRXA 2ZDOA 4ZVEA 2AV5A 3SSRA 1NK0A 1SJRA 3P5TL 4WKYA 1HWUA 3HKWA 3ICLA 1RAEB 1X4HA 4YY3J 4CLTA 2ZHBA 5HMZA 3LQVA 4WU3A 4B9MA 1ZAWA 1Y00A 3QQCD 4PZVA 5ETLA 5GAHI 3QIDA 3SQGB 1TU0B 4RUCA 1Q5YA 1N88A 2HZAA 5CAAA 1CQNA 3KNGA 2C2EA 3DLLQ 5KFJA 5I3UB 2IRXA 1YHQS 1YBUA 4PWUA 5HJXA 3KUGA 1FFWB 3FZ2A 5M2PA 1RT5A 4PUOB 1S9GB 3VGVA 2QN6B 2E7VA 5KFZA 1NJZA 1G2EA 3MECA 4WFZA 2L9NA 3POTB 2CQBA 3O5TB 5J2PB 4ECQA 2AJ1A 3DLBA 3GWCA 3RBXA 3MUTP 3FBFA 3H5SA 1VI7A 4F3QA 3GIJA 2HHHJ 2XEXA 2BKNA 4A8KA 3ZZPA 4YR3A 3NP5A 2N82B 4O3SA 1RTJA 4HI1A 3QNWB 3B78A 1T02A 3D1HA 1J5EF 3I96A 3IAM9 1TMJA 3H2UB 1RJJA 4DHVA 3CUNA 3R2CJ 2AF6A 3VAIA 1HBMB 1NZAA 1WELA 2Q1LA 4X4VA 4K5SA 1RWOB 4ECZA 5D3GB 4LVNP 1U6BA 2OPPA 3PXGa 2XO7A 4DZDA 1UEKA 2XMVA 3JTOA 2GMJA 4ICLB 4L74A 5D6GA 2DGOA 5AJ3F 4JI8J 1S97A 4B9LA 3CCRS 5CYQB 2MJUA 3Q8UA 5L1KA 2DITA 4YP3A 2XLKA 1S59A 2V5HG 3OXGA 1JLFA 3ENAA 1KFSA 4ECXA 4IO1A 4DJBA 5EX3A 4FN5A 3R5CA 2L08A 4ATNA 3CCMS 1AFJA 3UD3P 2Z8QA 1JIHA 3R3TA 5DQIA 4DUYF 4IH7A 1H7WA 2HRTA 2QLWA 3QGIA 4MK7A 2F4VJ 1OPIA 4P2MA 3ZZOA 4LRDA 1HI0P 1NJWA 2VPWB 3I55S 2GVZA 2IAJB 4X66F 4AUKA 1HNWJ 2BZ2A 4P72A 2XZWA 3R6GB 3SZ2A 2W4PA 4DI6A 4PAAA 4YOEA 4ZS6A 2E29A 2FDNA 4KH0B 3GIIA 1WEYA 3B54A 2JVRA 2HHSA 2W2NP 3DLGB 2GHVC 3I0SA 4GVBA 1L3KA 2UUWA 4TVAB 2LQJA 4QU6A 1BGXT 4HTIA 1IJFB 4R0JA 1N56A 2DR8A 2ILZA 1MROB 2KHDA 1Q82T 1Q8KA 1B64A 2HPUA 3UDEA 2F4FA 2PI4A 4LF9J 4BDPA 1AUSL 1B70B 4ED0A 4RO0A 4ED1A 4UOCA 1RHMB 4E98A 4U6PA 1SJ1A 5IFMA 1X4CA 1JJ4A 4XK8C 3U1MA 1NJXA 4KIAA 1R0AB 1IKWB 3M6VA 3HVTA 1ZZFA 3NLCA 4GVLA 1VRUB 2DPIA 1U09A 1UPMB 1VJWA 4LFCJ 4UTGA 4GRSA 3UCUP 4OYAA 1F1BB 3IR5B 2B56A 3GQCA 2AZ3A 4JI6F 4F02A 2YNIA 2ZJPQ 3IBCB 1X60A 3OTOJ 2FJEB 5GMKa 2EFNA 2OEJA 4CZCA 1YJVA 2PA8D 1IM6A 3ETOA 4DV3F 1FRXA 5IT0A 1JXVA 2W4CA 3QGGA 3HT0A 3NCQA 4PXBA 2AU0A 5KFXA 3MM6A 5K9FA 1BQNA 2MQLA 2NCKL 3AA9A 3GJSB 2QT7A 3MWBA 1FD2A 4EBCA 2LEAA 1S6QA 4FPRA 2V50A 4NYZA 3JS9A 2FLPA 2HGMA 3PNIA 1S4FA 2WW8A 3EMTA 2VPZB 2QA4S 4WJBA 2FVSA 3A3NB 1LOUA 1JLCB 2CQ3A 4NEZA 4ES1A 1GFWB 5E3PA 1UFKA 1EQ0A 1N6QA 2A10A 3FC9A 3THTA 3L09A 1U49A 4LSNB 2RD5C 5HVFA 3VAHA 4LF8J 2CADA 3UNYA 4EO6A 4U9RA 1WC3A 3G8QA 1GXUA 4PG5A 4OIXA 2UVWA 3EE3A 1M5HA 2SXLA 2P9CA 3HHKA 4P2SA 4P10A 4Y34A 2V34A 1E6VB 1VK8A 3T1HF 1GNKA 1NM2A 2CIMA 3O3LA 1HNXJ 3ENQA 4OV6A 3TANA 1XNQF 3NGTA 3FQLA 3UQSA 1LWEA 2LU1A 1M1GA 2RQ4A 4AD6A 4DS5A 3PRVA 4NRUA 2FLOA 3DKDA 3SYZA 1REVA 5IT9U 4FF2A 1IVZA 3IS9B 2NXEA 3TZYA 3C6TA 3BR9A 2KZZA 3BSNA 4KGKA 4LSZB 3CDUA 2YKMB 4MK9A 3G6XA 1RT6A 2DGTA 3PHTA 1NH7A 2ASLA 3PACA 1S9FA 3KG1A 4ZDNA 2CZ4A 2NXUA 3MM5A 3HVTB 3ILJA 1I3OB 3CT9A 4G1PA 1RLDA 2DH7A 4PXEA 1FTCA 3LGHA 2ZJQQ 1LV5A 1XMOF 1Q8LA 3FSXA 2BOAA 4Q8FA 1SVDA 3I0RB 4KGXB 2DEJA 4TN2A 4NL5A 2DRBA 3DDNA 4MTPA 4OYBA 2VICA 4NXNJ 4ENOA 3BH6B 2B0GA 4J9QA 2UV8A 3O1LA 4S0MA 1DTQB 1O6XA 1WDTA 3H42A 4YR2A 1L3UA 2R8KA 3QYYA 5F9LA 2B8PA 4I0WA 2YKNB 2CPXA 1RYSA 1H38A 4DUZJ 2UVUA 4NASA 2HQGA 3R9LA 1JXEA 3CCSS 2ZKUA 1DAXA 2UXCJ 2ZH8A 2Z2ZA 3NCPA 4WZQA 2R2RA 4KQZA 1RTHA 1YBTA 1NMEB 3PYEA 4CNZA 2FGOA 2BBEA 3M2VB 1EAYC 1RISA 3D28A 3G6VA 4AFFA 2HAFA 5A0YB 2Y9HA 3OLBA 5E33A 3RAMA 2KB2A 3DYAA 4I6WA 4WU2A 4OX9J 3C6UA 2B7CB 2LA4A 1S1XB 3D0GE 1IKVA 4L3KA 3T9ZA 5KTQA 4A48A 4LFAF 2FUG9 3TR5A 4DF8A 3FRYA 3NMAA 2MSSA 4RKUC 3I4PA 1LNQA 3NGSA 4RW9A 5DG7A 3EWGA 3OUYB 5T7LB 3CCTA 4LR7A 2NYHA 5CYQA 5D4PA 5E3RA 3TEGA 3B4MA 3HJVA 3GIMA 5D4LA 2DT9A 4J9MA 4LF4J 2EW9A 3KK1B 2VHGA 3MTKA 2LVWA 3JQJA 5EX0A 3E8OA 2ZKTA 5AXMA 2W9BB 3NRBA 4TLRA 1EETA 1WOPA 5ETTA 2DR5A 3HPOA 2I8EA 2PT0A 1HNZJ 3MI7X 1R8PA 3H2VE 2W1BA 3K0JA 2ATCB 4JI5F 1B0VA 1YTYA 4PG4A 1W7WA 2AZ1A 4I64A 1PCAA 2G1DA 5D0HA 3RGIA 1N36F 1YJRA 3A3PB 5C2GA 4LFBF 2NYIA 5DDRC 3GV5B 2W7AA 2V4RA 2QLXA 2M52A 3I5CA 4NEYA 3HP6A 2RQKA 1RK8A 2VL1A 3MECB 3CEDA 4GC6A 4FZVA 2J9DE 3M8YA 1RT4B 2WAQD 2WSCC 3MF5A 4OI1A 3BR8A 1JWWA 2RT3A 2K7JA 4ECRA 2FLNA 1UWBA 2VFTA 4LR9A 3MHYA 2C2NA 2CPDA 5D0EA 5FIIA 3RU0A 3KLFA 3T5LA 3PW5A 1K0VA 4J9UE 2R8IA 4LSLB 4OLOA 3IO1A 4OZ0A 4DU7A 4Q5VA 1IBLF 1U7LA 3NL0A 3QZ7A 3AXMA 2MGZB 4RW8A 1RB0A 1H72C 1H2VZ 2V8VA 4DG1B 4FYWB 2AYEA 2I6WA 2XLIA 4OHWA 2FJBB 3K57A 3Q23A 3SSSA 2OPRB 1KOOA 5EWEA 3EZUA 5F0UA 1UWAA 3BGFA 4ICLA 3UDCA 1L3SA 2XS2A 1DBDA 4OHVA 3W5XA 3RB0A 1ZZNA 3RR8A 3F44A 3QBCA 1U1LA 2G0JA 2V8PA 2IMOA 4QOTA 4O4RA 2X1GA 4L76A 2D74B 3KK2A 5IWAF 2FY1A 3CCVS 3OBIA 4FVCA 3PY8A 3AD9C 5EDWA 1T05A 2XYGB 2FB0A 2ZOMA 1CC8A 2V2ZA 3RYLA 3T5JA 2V8DA 2IM2A 3PIOQ 4LF5F 1GMUA 3AH6A 3VHQA 4GKKJ 1U8SA 3FBBA 3V6HA 3Q24A 2UUBJ 4O0NA 2XMTA 5GADI 4DR4F 2H54B 4DPUA 4NOHA 2GVDA 4M1KA 2OUGA 4BS2A 1U1NA 3AT1B 4F8RA 2XYPB 1NJIT 4LIWA 4WIQA 4DV4J 2Q3PA 5HAOA 4M5HA 1BQMB 1U1QA 2EEYA 8AT1B 1GX5A 4HDGA 3U1LA 2XC9A 4ITSA 4NLGA 1AZSB 2A1BA 1AW0A 1FESA 2PE8A 1VQ8S 1S6PA 3DXBA 2PD1A 4EK2A 1JJCB 1IJEB 2FHOB 2IIHA 2LDYA 3EM1A 3BQ0A 1H3DA 2IYGA 2MHEA 2DIVA 1S7IA 2FHJD 2XYHB 2ROEA 5K5MA 4CTAB 3D5MA 1DQ9A 2JC1A 3FGVA 3KLEB 1BQMA 2MQNA 2HWTA 4EBDA 3V6KA 3HSZA 1X0FA 1U1PA 2CUYA 2BANA 2NXJA 3U02A 3VZIA 4B9SA 2WBMA 3FCWA 3UN3A 4X4RA 4DR6F 4ED2A 1QDUB 4ED7A 5KFRA 1U1OA 2NXCA 1F9EB 1JNRB 5U47A 4PXCA 3D9BA 5B0BA 4AL7A 3OT9A 2P5VA 1RHUB 2Y1LB 1UMJA 1TZ0A 3KDNA 5LT5A 4NMLA 4ES3A 3BO3A 5HP1B 1U1MA 1PC4A 4AL5A 2C28A 2KG1A 3GIKA 4K4UA 3VAKA 1RA7A 4V19X 2ZH4A 1NLKL 3OHAA 2F3JA 2R4FA 4GO7X 4ZVOB 4C98A 4KO0B 2BRLA 4JYAF 2RDIA 4JI0F 1WF2A 4PQAA 4HT5A 4TY9A 3I32A 3DFEA 3CD0A 5LJ3Y 2XQCA 3ISZA 3PW4A 2KXHA 3QRRA 3EGVA 1FWPA 3QFHA 2YQ1A 4USIA 1LW0B 1LFPA 1TV6A 3A1YG 3ISNC 5DO2A 2ZH7A 1UVIA 3TZZA 2B4OA 1U45A 2YNFB 2I2YA 5CYMB 3ETMA 3OUYA 1JLEA 2CVIA 1BXNA 3NNAA 2CWKA 1SJ4P 5CD4A 3FZBA 2KT2A 1N0VC 2ZJRQ 4DV5J 3TJ8A 2FC9A 1NSAA 3Q2TC 1VJQA 1S1UA 1IQTA 3CIZA 1UVKA 5DGBA 4TKTA 4C6AA 4F7VA 1JLBB 3THVA 4OYWA 5BJRA 4USVA 5B0CA 4Q43A 1P1LA 4A47A 3GYXB 2I9SA 4LT6A 2V8HA 1F5BA 5I3PA 3OL9A 3JYTA 5CYMA 2KJVA 1VHFA 2H5IB 2D41A 2RDJA 1VQMS 4IRDA 3M6XA 4QWBA 1X4AA 1RBAA 2XNQA 3DRSB 3M4XA 3NOCA 3OVSA 4CLFA 2YWFA 4ED8A 2UU9F 2UUBF 4DR6J 4QYZK 2OP5A 2B5JB 4KSEB 2NPFA 2RQCA 2Z2YB 4C3KA 1N33J 2BOPA 2XM3A 5KG1A 4QBUA 1V5IB 3LA0A 3Q8QB 2E9TA 4QIVA 2GAGC 4HR2A 2HS0A 3SIPB 1GMWA 4FBTA 1QM9A 3CW2C 1R31A 1SV5B 3D68A 4LSLA 2QRRA 3JTPA 4WP3A 3UR3C 1VQ4S 1SUQA 2ZNYA 3SFUA 2N4CA 5K8MA 4ED3A 2ADBA 1U2CA 1UWBB 4OYZA 3L9ZA 3NG8A 2MXYA 4J9SA 5AXKA 1X31C 3ILIA 1VQ6S 2DCLA 2ZZTA 2WB4A 1H73A 3MURP 2CZ9A 3SFGA 4GC7A 4XPEA 4LF8F 3W62A 5E41A 3RG6A 2VFVA 1RWNB 3QIPB 2XZTB 3LPEA 4WFBQ 2JLEA 5B0FA 3VAMA 4IRKA 3VV2B 3CCES 5HLFA 1M1HA 2OMOA 2V94A 1NH8A 4ZVRB 1IBLJ 3JAMY 2CPIA 3BB5A 1VQSA 2IJRA 1GMVA 3UR0A 1Y5LB 4F2SA 5IS2A 2G4BA 2IDEA 3M30A 1HWIA 1HYSB 3D1QA 4DG1A 3KK1A 4H4OB
chains in the Genus database with same CATH topology
2MGZA 1TVRA 1C1CB 2KG0A 4RU2A 2RF2A 1JK9B 2Y1RI 3GFZA 4OI2A 4IRDA 3OR2A 2OD6A 2YWKA 3L7OA 4JI4F 3DRRB 3KK3A 4M5DB 2VA3A 4Q0BB 4NCAA 4WFNQ 1SQEA 1UJ6A 1HNZF 4PRFA 2XSJA 1A6LA 4OI4A 4H4MA 3V2UC 2KN4A 4I67A 1HQUA 3GYNA 5KG5A 2BA9A 2AW0A 6FD1A 1T8EA 3HF5A 1YG0A 4CO3A 1HA1A 1T05B 1UETA 1UFLA 3TNVA 2J9CA 4HT7A 2FHJA 3MM9A 4IR1A 2NSBA 4DPOA 1M5PC 5HMXA 3OPKA 3G6VA 3W3SA 5AXNA 1IKYA 2KRBA 2GFFA 3I9V9 1HWJA 2RJZA 3PDNA 3CVKA 4OI3A 3TX8A 4AYBD 4F67A 1ZTTA 4NZ6A 4RW4B 2E7WA 4JV5F 2DJWA 5DLGA 3TVKA 4ZCLA 1NRKA 2Q43A 2B3TB 4M63A 3THPA 4EZ6A 1KVJA 4C8LA 4K5RA 4WFXA 3HHLB 3PKYA 1C0TA 2KXNB 2DRAA 1DHMA 1YJ9S 5L1LA 2UV8G 2UXCF 2VONA 4OLPA 4LJMA 2R9LA 2VD3A 5EWFA 1P9QC 3ITHB 3DNCA 4MH8A 2J7WA 1IUJA 4URGA 3ENWA 4ZCMA 2KYXA 3D0IE 1N6QB 1WG4A 2RRAA 2BQ3A 3H4BA 4RW6B 2MDAA 3TQ1A 2HGLA 3KHLA 4MIBA 3PJWA 4KC5A 1S6OA 4ZHRA 4H54A 2HS4A 5MLCV 2VUGA 2B43A 3M6WA 2BACA 2UP1A 4A8FA 4IQXA 1LWFB 1N8RT 2MY8A 4OX8A 2DGWA 2E5GA 2CZVC 3OTDA 3V5RA 3C2PA 4WXOA 1S0OA 1RT4A 3CD6S 5T7LA 4YEAA 3FEYB 2KXFA 2HHQA 4ZPVR 5J2QA 4MYUA 4B3TF 2DBBA 5DGAA 4YMEA 4DV2F 1CQMA 4NLXA 3MM5B 3BQ1A 2AP6A 4BBYA 2DNYA 5A0YA 2ZBIA 1EP4A 3VCDA 1FO1A 4YFUA 3T5HA 3KLGA 3G96A 5HQ8A 5DDOC 4C0BA 3SI8A 1XK8A 4AL6A 1RTDB 1ZM9A 3H4DA 2V4JA 3TOQA 1HNIA 1V3RA 4USJC 2E1CA 3CCZA 3M8PA 2B4UA 4RU9A 3HHLC 4ILRA 5F3TA 4U7CA 3RRGA 4ECYA 1NEEA 2UUCF 4TYBA 3J80Y 3TO8A 2MJNA 2ZNZA 4O44A 1UKUA 1L3VA 1FEEA 1QVFR 4C9DA 2DNRA 2PO4A 3MEDA 1DZ5A 2Z2MA 1U6FA 4WCEQ 3LP2B 3MMCA 3DLEA 4GMKA 2GHWA 2NUHA 2DISA 5A8RA 4X2BA 4WFYA 5KFBA 1T94A 1D3WA 3CJ3A 3DLKA 4R5PA 1Z2ZA 1M5KC 4FXVA 1X4BA 5T14A 2HNZB 1RAJA 3HZGA 3OTOF 2CQPA 3MEDB 4CO5A 1I1GA 2J6UA 4HH0A 2V2KA 4NWBA 3N01A 5SZTA 4K4WA 2DGVA 1VFJA 3P49B 4IG3B 4LQ9A 4IO9Q 3FRZA 3PM9A 1KFDA 1Q53A 3I5AA 5I4MA 4LFCF 4I2QB 3CMES 4C8KA 1DTQA 1X9WA 1N5QA 2L3MA 3K8VA 3LH2S 4J37A 1VIOA 2EFQA 4C11B 1WTBA 1H7XA 4DR3F 1HBUA 4X4SA 1LXNA 1V3ZA 5DQGA 3M8RA 3CULA 4ZCIA 3IRXB 7FD1A 4OL8A 4QR2A 2HVHA 3PEJA 2DK2A 5AE1A 1N5YB 2J0SD 5KFHA 3JSBA 1JJHA 3MMBB 5D8HB 3PFOA 1OQ3A 1VMBA 2W25A 3CD5A 2CPJA 4NLQA 5LMUF 4LVOP 5HMYA 3GV8B 1FKPA 2IBOA 4LMZA 2M70A 1LW2B 1H2TZ 3GFXA 3S01A 1REVB 4NA2A 3J7YI 1U1RA 1BLUA 3BSAA 1WD6A 5GADU 1TKXA 2JH3A 3N5BA 4EWTA 2EPIA 2P6SA 2OAUA 2RRBA 3OFHA 4MAKA 4X4TA 2D7SA 5GVQA 1CEZA 5T41A 5JXSA 1YBAA 4IRCA 2XS5A 3EZ5A 1U26A 4JBCA 5CZXA 4LF9F 4G6VB 3PW7A 1KHVA 1OS5A 2QV6A 1UJ4A 4QYZJ 3BS9A 1APSA 1HI1A 5CD4H 3T3FA 4N8NA 4RWXA 1T03A 3BN7A 1JNZB 3MMBA 3T6BA 1WI6A 1XR6A 1KQSR 4F4KA 2EFPA 3CPWR 4DSKA 1IKWA 1S7HA 1I94F 2B9XA 4KFBB 5M2UA 1N5SA 2BYCA 2CJQA 2F8EX 4ID8A 2GJ2A 3K59A 4JV2A 3FFIA 1JJ2R 2F4VF 4MIAA 3M30B 1WEZA 2AGQA 2CPZA 3IWNC 1U2RA 5F8GA 2CDQA 4I2QA 1X5TA 3O2IA 3OTBA 2GQQA 1QLNA 4CCHA 4ZP6A 4YDDB 2IFXA 4OJGA 2LQBA 2J7UA 3OTEA 3ULHA 1KQFB 3SCJE 2HHUA 4CI0B 5J1NA 2FTRA 2JC0A 3DI6A 2E9RX 1KONA 3E51A 4DV0F 1JLGB 1V9OA 2RU9A 3X3UA 5J2QB 3DM2A 4IFVB 4YB6A 3ZZTA 4Z37A 1K73T 2VKZG 3T1AA 2PGCA 4JV1A 2I38A 3N6MA 4CO1A 3SSQA 4ETZA 4O44B 4D3GA 1WHXA 3I0SB 1RI7A 2I1RA 4RNMA 1T95A 5C24B 5LSLA 1TL3B 4UQGA 2EC0A 2RE1A 3M8PB 4H4OA 2VOOA 2LEPA 2B6AA 2VBWA 3MM9B 3NS5A 4FP9A 3M8QB 2MHNA 3NGDA 4YUDA 1NK5A 2O3DA 4RW6A 5B0EA 1YIJS 3D1OA 4B9NA 4HKQA 4ETXA 4TQRA 2BQUA 3HLUA 2A3JA 4Y2CA 4DL4A 2QFJA 3I56S 4OV1A 2I0XA 3GR0A 4BC7A 5DG8A 2VV5A 3UNGC 1L5UA 3LOUA 4KHRA 1QAJA 3H5XA 3J7YU 2RH3A 4IKAA 1RT5B 3KLVA 1U47A 4PUOA 4ECVA 2ZD1B 4PR6A 1PC5A 3DHXA 1URRA 4X4OA 4TY8B 2MKHA 5L8RC 2M4MA 1VOMA 5MAOA 1IKYB 2VKRA 2LECA 2FVQA 1S49A 6FDRA 2YKAA 4DFJA 2UXBF 4ZKAA 1FNMA 2GNKA 2NUUG 5F3ZA 3SCKE 3PR4A 4FS1A 1RTJB 3H98A 3DXSX 4I68A 2V4QA 4HTJA 5CCLA 4QIGA 1NK4A 4ECTA 1D8YA 4CO4A 2O66A 4RZRA 3MR5A 1FE4A 1LFWA 1YITS 2XMUA 1YJWS 1CG2A 1SH3A 3ITHA 3DOKB 4B3SF 2R7XA 4WE1B 2PN6A 2U2FA 4IDKA 2WCXA 3HI9A 1X8DA 1ZOTA 2WSFC 1SV5A 2CVEA 4UUWA 3NWGA 3DRYA 3IGNA 3KTQA 5DRKA 3V6DA 1HQEB 3E01B 5CHCB 2I5JA 2V0NA 1XR5A 3VTIA 2XHWA 5FD1A 2XY5A 4WZMA 4NA1A 2P6TA 5JVHQ 1SL1A 1Q7YT 2DHXA 5A6WA 2MKCA 2R7QA 2OFHX 4MYTA 2CYYA 3O44A 5BYRA 3KLGB 3BGLA 4DSEA 1R43A 3LP0A 3P96A 2O67A 1JLAA 3MPVA 3N6LA 4H4KC 2NSCA 3PO4A 1FRIA 1FE0A 2H9ZA 2FHKA 3M2RB 3NAHA 3RW7A 5KFYA 1D9FA 3MOZA 5HI7A 5HP1A 1HW9A 1SUQB 3TRGA 3POTA 2F8MA 3T9NA 2M7SA 1FJCA 1ULRA 2QA2A 1YRXA 1S9EB 1OO0B 4QIWD 2ZOGA 5C42A 4DV4F 4RW4A 3PW2A 2X3GA 2QO3A 3SDEB 2DNNA 2K1RA 1QE1A 5DETA 2LQ9A 2X51A 2QA1A 5K14A 4X62F 4FBUA 4OJ3A 1O0PA 4LIRA 4O23A 4N8OA 5HROB 3B82A 5IM0B 5KG6A 5HO4A 1XTZA 3KHHA 4ZMMA 2GMHA 5CZVA 2BW2A 5KFUA 3TVZA 1Q86T 3OL8A 2FVCA 2PMHA 2R7WA 3VAFA 1M90T 1HFEL 2A2CA 5IT9Y 3MM8B 4WXWA 5GAEU 3G4SS 4PQUA 1GTEA 3DDKA 4M5DA 2DR7A 2E5LF 4C0OC 4Q0BA 5KFNA 1X4FA 1S0NA 2GIQA 2RVJA 2ZH9A 2YNGB 2PA3A 2E1AA 3T19A 3MUMP 3KOAA 5BR8