3IBCB

Crystal structure of caspase-7 incomplex with acetyl-yvad-cho
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase, apoptosis
molecule keywords Caspase-7
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3ibcB00
2H5JB 4LSZB 1RWKB 3NS7B 2P2CB 5IC6B 2CNLB 1QDUB 2C2ZB 2H4WB 1GFWB 2C2KB 4ZVSB 3R7NB 2H5IB 2HBRB 2C1EB 1ICEB 2QLJB 4DCOB 4ZVPB 2QL9B 4JB8B 2HBQB 1BMQB 3KJFB 4DCJB 1RWOB 1RHKB 3P4UB 3IBCB 3R7SB 1RWPB 1RWMB 1RHRB 1RHQB 2H4YB 1RHMB 2QLBB 1SC4B 1RWVB 1SC3B 2QL5B 2XYGB 3RJMB 2CJXB 2XZDB 2H48B 3KJNB 2C2MB 5IC4B 1QTNB 1RWNB 3R5JB 1RE1B 3D6MB 1RWXB 3P45B 1RWWB 2XYPB 1RHJB 3SIPB 2CJYB 2HBYB 3GJTB 1I51B 1PYOB 4ZVQB 3QNWB 2FQQB 1RHUB 2XZTB 3R7BB 5K20B 2C2OB 4ZVUB 1I3OB 1IBCB 3GJRB 1NMEB 3R6GB 4ZVTB 3EDQB 4ZVOB 2CNKB 3IBFB 2Y0BB 3GJSB 1SC1B 2CNNB 3GJQB 2DKOB 4ZVRB 1PAUB 2HBZB 3R6LB 2XYHB 2H54B 3KJQB 2H51B 3D6FB 2QLFB 1F9EB 2QL7B 3D6HB 4DCPB 2CDRB 2H65B 2CNOB 3EDRB 2Y1LB
chains in the Genus database with same CATH superfamily
4TLQA 4ES2A 2AD9A 4DX7A 1EB0A 2H3EB 2NZCA 2JZ5A 2WTFA 4X4TA 3FFIB 2FC8A 4GKJF 4QPTA 4KJIA 1OSCA 2HNZB 1ZA2B 1RUSA 2GJ2A 1WORA 2VQFJ 3OXGA 3DLLQ 1S79A 2ZFHA 3KXDA 2CZVC 4P2XA 1N0VC 4PYAA 3G8TA 3DFEA 4PXBA 2CJXB 1Y5IB 3MXHP 1E6VA 1VHFA 4FYXB 1RTDB 1HNWF 5HMWA 1QTMA 3ZZPA 1RT5A 3DRPB 1EKSA 1H7WA 5LXRA 3KLEA 1JLCA 1VMBA 1CQNA 1HPZA 3UVJB 4PQAA 2PO4A 4EO8A 2G0IA 2WOMB 3CXCR 4DV4J 4RNFA 1SL2A 3GFHA 5KFBA 3D67A 2IBKA 4LVNP 4NXMJ 4ITSA 4PUOA 2BOAA 4NA3A 1RABB 1XWLA 1MN9A 3NBPB 4FXDA 4C8OA 3HT3A 2HHPA 3WC0A 2V8HA 4GRSA 2AJ1A 4YFUA 2BMBA 4WJBA 2QYCA 2C2DA 1XC9A 1WSRA 1K73T 3MR6A 3C14B 5J2NA 2D74B 2ZH2A 3KK1A 4ANDA 4LT6A 5KFNA 1IWAA 2ERRA 4DSLA 2W7PA 2Z2ZA 3MAHA 2KT5A 3M6XA 3ZZZA 1XNQF 1M1GA 1FJGF 3FSXA 2D9OA 1Q53A 3UNGC 1N48A 1RB0A 5A6PA 5KG3A 2MKJA 4FVMA 2ZBIA 3PEJA 4ZJLA 3UCGA 5DZ6A 5JXSA 3JQKA 5BYRA 1PGZA 4G1IA 1EP4B 4OZ1A 1QSYA 2OPQA 2M2BA 4RNNA 2YKMA 2NXNA 3D0HE 2N7CA 1D9AA 3NOCA 4OV6A 2CPHA 1FERA 4EYHB 5D78A 4CYUA 4R0EA 3AOAA 4Y00A 2QIFA 2WVBA 5U47A 3PKMA 2GNKA 2ZHAA 1SJFA 2BA9A 3A8EA 2KFZA 2MJNA 3GFYA 3IRXB 4C48A 4ED2A 4NXNF 3T9NA 2BJ7A 3F0NA 3T9ZA 1CULA 1HA1A 2FIUA 4DV2F 1JJHA 2R7SA 4OIXA 2VB6A 4K59A 3PRBA 3BSOA 3FZBA 3HVTA 3SCKE 3DRSA 3ZXWA 4PWDA 4EZ9A 2OSQA 4X64F 2K7JA 2HRUA 1RCXB 5FJ4A 1Y5LB 2KVIA 4O23A 5SUHA 5DQIA 3FFIA 4DV1F 3BN7A 4DSIA 2E29A 2HNZA 3PX6A 4Q43A 3GJRB 1X5OA 3C15B 3I4PA 4M5KA 2HFUA 4DR5F 3ITHB 3R1LA 3R5DA 3QGHA 4IKAA 1R0CB 2KM8C 1RTDA 1TUGB 2WVCA 5C25B 2YWHA 1FVSA 3DRPA 3QMQA 5KFLA 5IS2A 3QRQA 3MUMP 3VQTA 4TLRA 3UVJA 3NCPA 2MKYA 4C3KA 3EE3A 1S5ZA 2VBXA 4XK8C 2PMHA 2D3O1 2WOMA 2EW9A 4B3MF 1IBLJ 1CS4B 2RE1A 2Z2MA 1K47A 2IDEA 3HVAA 2J8SA 2VPXB 4MKVA 2Y1RI 2XGPA 4JV5J 4FVCA 5H1SV 2Q6BA 1UPMB 3NBPA 1TK5A 1WWHA 1HNZF 1XIQA 3JXOA 3J7YI 3AB2B 5IC4B 2B7BB 5CH7B 5L1KA 4NCAA 1S1TB 1X5SA 1XR7A 3R1HA 4LVOP 3CCMS 2D1CA 2DO0A 1L5UA 2YX7A 3C14A 3VR1A 3U27A 5A8KA 2KM8B 1SBRA 2XMUA 1U1OA 4IFVB 4FKYA 3IBFB 1KTQA 4LBHA 1LWFB 2YKNB 1TL3B 1A6LA 4FXWA 1NJWA 4O3SA 2W7OA 2MKKA 3PW2A 3CC4S 1KLNA 3T5JA 1XMOJ 4NX9A 2OEKA 3JQMA 1LV5A 2M88A 3JAMU 2BJ1A 3W7BA 4EO6A 1EP4A 4LF7F 4OYXA 4YDDB 2LQ9A 4PCQA 3NL0A 1UL3A 3DLKB 3J7YU 1JJCB 2DEJA 4RR5A 1F3FA 1RWUA 2OAUA 4C3LA 4ED0A 3G2XA 4IUFA 4IYQA 3BV8A 4JI3F 2HZCA 1UETA 4ZCMA 4JUZA 2XLJA 1Z2ZA 3IRXA 4ZVQB 2XZTB 3LA0A 3GWCA 3UN3A 2A6MA 3O8WA 1N34F 1C4CA 4N77A 5ETSA 3C46A 1SQGA 3AXKA 5D6GA 5C2GA 4OMFG 1S7HA 5EDWA 5KT7A 1WC4A 1RBOB 4N5SA 1QE1B 4TVAB 2Z56B 2W2NP 1QUVA 3T3FA 2E5LF 2VPYB 2IRXA 3I56S 1X5TA 2CVIA 3C15A 4I0WA 1CC7A 2QX0A 1K9MT 3ITHA 2JOQA 2ROEA 4DR7F 3FBCA 4CLTA 2YWGA 2XGQA 2OFHX 4KPYA 4X4QA 3O44A 5C25A 4CO4A 4CLYA 4DR2F 1I94F 2UU9J 2CPYA 3AY0A 3N4WA 3M8RA 3R7BB 2VA2A 3OV7A 4ZP8A 2JDJA 2KRRA 1CS4A 2XQCA 2AQ4A 4IR9A 3H7HB 4FNIA 4I64A 4OI0A 2ZHBA 2D3ZA 1OQ3A 1MN7A 1R0BG 3TX0A 3C6UB 4MIBA 5IC6B 2CNLB 2ILZA 4K5RA 1S1TA 2IJFA 4B9MA 3OPKA 4A8FA 4PWWA 2OMOA 1S6PA 1F2HA 4DQRA 1KHVA 1EAYC 4IFVA 1DLOB 3BF4A 2QC3A 1RHQB 3DKDA 1LWFA 2YKNA 1TL3A 5DG9A 1M5SA 1Z4UA 2C3UA 3CO9A 5F0UA 1NBEB 5L39A 4H54A 4HDHA 2AYMA 4I56A 1JJ2R 4G1QB 3QQCD 2W2OP 2CPJA 1IR1A 2RKIB 5HMZA 5H9EJ 2PA3A 2HAIA 1PKUA 3PJ9A 1VI7A 1M90T 4ZVEA 2AYEA 2AEFA 3HZGA 1NDLA 4P72A 2AZ1A 3DLKA 2JHEA 4Y2CA 2DITA 1BLUA 4ZVFA 3D6HB 1FD2A 1T95A 5I3UA 3DNCA 4KSEB 3TVYA 2YPYA 4R25A 3DOMB 3KK3B 4ZN1A 3P96A 4WP3A 4EWTA 2ASJA 1RAAB 2MSTA 4JI2J 3OJSA 1S57A 2PSZA 3GILA 1RHKB 2XCAA 4NYZA 1VQ6S 4ED3A 4F0HA 1VQ4S 4K4ZA 1RT4B 1KWMA 3HFVA 1UEVA 2CADA 1T3NA 2AYBA 1UVIA 1DTQB 4F4KA 2GMHA 2Z4PA 4LR9A 3A4TA 5GAGI 3NKYA 1Y11A 4I67A 1U24A 1UA1A 3PY8A 1EZZB 4ZCKA 2J9DE 1QE1A 3NXZA 3MEKA 1QAIA 2E1RA 4I2PB 2IMOA 2R7VA 3FVYA 4P7VA 4WKRA 4DV4F 2UUWA 2V67A 1LFWA 3Q8PB 1RAFB 4ZPTR 3EMTA 2M7SA 3M8QB 3LGMA 4W92B 5MLCV 1NEEA 4CM0A 1LEOA 4DV7J 3SYZA 5B0EA 2XO7A 1QDUB 2LQ5A 2HFNA 4FYYB 2P9EA 3I9V9 4RU2A 4KTQA 3QSIA 3DOKB 1RWOB 4DSEA 4DBQA 4RW8B 1VBKA 2BE9B 3EGVA 5GAGU 4QYZJ 2XYGB 2QRRA 3C6UA 1Q81T 4WFYA 3G4SS 3J81Y 1KRPA 3MMCB 4Q5VA 1YRUA 3UN2A 3T6BA 3J80U 5FDLB 4X66J 5FLXY 2KZMA 4NCGB 3SEOA 4D3GA 3IN5A 4IR1A 2MSSA 2DD8S 1XMBA 2YY3A 2EEYA 2W8KA 1DLOA 2YX1A 1WEYA 4Q8EA 4EMDA 3I31A 1VFJA 2RILA 2ALYB 3TAPA 4LF6J 4I2QB 1JJ4A 3QRPA 2HQ3A 3O6QA 2CIMA 3A3PB 4Y2MA 1HKAA 4AXJA 2F63A 2V8PA 4M5NA 2V9WA 3T5LA 4G1QA 1FESA 3B54A 2RKIA 4HI1A 1VQKS 1LNQA 2NUHA 1OYDA 5FIIA 9ATCB 2R7TA 1G3OA 2KYXA 2KJVA 3MUVP 4H4OB 1WOSA 5E41A 4ZJOA 2IA0A 2XY7A 3UNYA 4IG3A 1VQ9S 2WW4A 4ED5A 5FD1A 3KK3A 1VQNS 2AP6A 2OPPB 3A3NB 1KBRA 4J9QA 1IBCB 3JSBA 1F1BB 2JC0A 3RAMA 3FEXB 1X9SA 3M9NB 1GMVA 2FJEB 2WB4A 4DX6A 2FLNA 3PDNA 1SB6A 1RT4A 1G2EA 1FK9A 1P9QC 5CHCB 2DNRA 3VQSA 3WHIA 4G65A 3BREA 2DK2A 4QIGA 3TO8A 1DTQA 4M5MA 4UQTA 5IT0A 2LDYA 2HVEA 1RJJA 1F5CA 3CCES 3R7NB 2MKIA 3EM1A 3RBEA 3H2VE 4I2PA 3ICLA 4WFZA 1YK9A 1EJ7L 3EVMA 2G2YA 1JB0C 3HHDA 2N3LA 2PA8D 2JVOA 1XN9A 1O51A 5HROB 4DV3J 4J7CA 3EZOA 3M8QA 3DRRB 2BX6A 1HFEL 1T8EA 2BW2A 5KG2A 4JV5F 4N76A 4KHRA 2FVSA 5HMXA 1HHSA 1RA6A 3IWLA 8RUCA 2RDDA 5EUHA 1BY9A 5IQQA 5CD4H 3ILIA 3DRYA 3S8SA 1J2VA 3AD7C 4YUDA 3DOKA 4S0MA 1WKLA 4ZVUB 2EFOA 3CCWA 4J37A 4MK8A 1SV5B 1KQGB 4GMKA 2V34A 2D3OR 3C2PA 4RW8A 5B0DA 2L9NA 1V6HA 3HVWA 2B9WA 5K9FA 3P5TL 4DU7A 3SZ2A 5D4PA 1WC0A 3M2RB 2L08A 5DLGA 2GVZB 4JV0A 3MMCA 1R0AB 1S97A 2CAJA 2I1RA 2QA1A 2BOPA 1JXEA 2OMLA 1XMOF 3LPEA 5FDLA 2G0JA 4LRBA 2K3KA 4C8ZA 4PG7A 4NCGA 2F8EX 1YTYA 4Y6IA 2HWHA 5IQ6A 4B17A 4WCEQ 2OSRA 1RWMB 4E98A 1GMUA 5B0AA 4ECZA 2V50A 2Q43A 3OR2A 3UD5A 3HX9A 4I2QA 4J9MA 3TJAA 2GCFA 3W2WB 3W5XA 4BC9A 4ECVA 2VJUA 1UA0A 2GHPA 3G96A 3D6MB 3DCAA 3OTBA 4KR0B 4OLPA 3OSNA 2MYFA 2K7KA 2R9LA 3TARA 1XR6A 1FEHA 4P75A 3HLUA 2CJQA 1FO1A 4F04B 1HL6A 4X4OA 2H5EA 3HFZB 3DLBA 4IH7A 3CDWA 2J8AA 1RU1A 4FF3A 1LW0B 1SIWB 3V5RA 4QU6A 5H9FJ 4H4OA 1R8PA 1NM2A 2B9YA 2CDRB 2NYHA 4LFCF 1U26A 1Q7YT 4KRWA 4OX6A 3UD4P 1GFWB 4OZ2A 2DRBA 1DHMA 1TVRB 1XTZA 1DURA 2CQ4A 4FF2A 3ZTRA 4JI5J 1VISA 4MH8A 3ZNJ1 2FLLA 2OPPA 1SL0A 1HNXJ 2MZQA 5IXUA 2LU2A 1X4DA 5E3PA 3G87A 5EHHA 4MT1A 3KUEA 2YKOA 2DNOA 3LH2S 1WUUA 1HWKA 5KG6A 4K50A 5F0WA 1VRQC 4H4KC 3TZYA 3A8KA 3MHYA 4ENOA 3CJRA 2J7UA 5DJBA 2VBZA 3VAGA 1PO6A 3N6MA 1NXIA 1X9MA 4HHJA 1YJVA 4CT9A 4Q44A 3D7SB 3C16B 1I3OB 1HMVB 2IDLA 4FBUA 1HNIB 2OFGX 3H2UB 5B0GA 3K57A 2B43A 5HROA 2CPZA 3PHTA 3BSAA 3DRRA 3PNIA 5K8NA 2WCXA 4LIRA 3RUBL 2I2YA 2PN6A 1UWAA 3DM2B 4OZ0A 2Q6CA 2HYIB 2WZ1A 5B0FA 3VTIA 4J9UE 4AL5A 3CDEA 1S9GB 3D1HA 5LMUJ 5B7WA 3K5OA 2P9GA 4CH1A 4DL2A 1UJ6A 4CO5A 4ETZA 4UOCA 3OL6A 5D8HB 1URNA 1X4AA 2Z8QA 1SV5A 3K89A 1NK8A 4PABA 3GYXB 4A8XA 4C98A 3RRGA 3M2RA 2C3YA 2QA4S 2R2SA 3IR7B 2I5JB 2GVZA 1R0AA 2E9TA 1YHQS 5HATA 3UI3A 3TI0A 2GIFA 3SV4A 5A2QU 3RW6A 2FGCA 3DDKA 4A8KA 2VG5B 2BUNA 3BZQA 4MFBB 2W8LA 2QLWA 2UVRA 1IBMJ 3NRBA 4ZHRB 2NQPA 2QL7B 3W2WA 3ULHA 4LR7A 4B08A 4YHHJ 5F9LA 4IQXA 3VAHA 1VYAA 3ISNC 1EQMA 4PXEA 5ETPA 3R97A 4G3IA 5IWAF 3VGUA 3HKWA 4NLGA 1BC6A 4JI2F 5CYMA 1SJRA 3T5KA 3J7A1 1LW0A 1N32F 1XK8A 3L7UA 4DV5J 1CG2A 1H73A 1U2RA 5E3QA 4RWWA 4K4YA 3I5BA 3WX8A 4NLVA 3GSDA 1K0TA 4L73A 1VHIA 1TVRA 3QGPA 3T1YF 5I3PA 2IHR1 5KT6A 4RNMA 2LQBA 5CD4A 4RL1A 1D9DA 4KGVB 1FVQA 2C42A 2YNIB 4TU7A 2I0XA 3CCRS 4Y2KA 1MG7A 4IDKB 2P9CA 3SCLE 4DMZA 2XY6A 4JI7F 1MLAA 1VRUB 2EFNA 1RADB 4UOHA 3T19A 3CDUA 2PI4A 1T9TA 1WTBA 1ZZFA 1TFYA 3BSCA 3KHHA 4DV7F 1NSPA 3FRZA 2QLJB 1FFSB 3KJFB 4YB1P 2AEJA 1ZM3A 4J9SA 3BBFA 3C16A 3NEKA 1HMVA 2DHHA 3LOUA 1JNRB 1U0HB 2CZ4A 3OLAA 2HHUA 3BJYA 2D41A 3R27A 4ECUA 2XZDB 1NDKA 4JOUA 4ECYA 1RLDA 3V6JA 2VG6B 1FEEA 3EJMA 1SL1A 2WSCC 3H90A 2J0QD 4K5SA 3THVA 3DM2A 2R7RA 1ZTTA 2XTJP 3AD9C 4H4KA 4LBIA 1S9GA 3G6ES 1WF1A 5L1LA 5HSPA 1YITS 2BQ3A 1QAXA 5F8GA 4LFBJ 4ZLPA 1QJHA 5GADI 1KSPA 1HWUA 2XMTA 4ELUA 2GIQA 1PJ7A 2R2RA 5K5MA 4QWCA 1S6OA 1T9XA 3FK4A 4WXWA 4TY9A 1XMQF 1N36J 2I5JA 4KV8B 3VGTA 3EYZA 4Y34A 1FDBA 1WC6A 2YWKA 2ZVSA 4A47A 2FVQA 4I69A 5GMKa 4MIAA 4GO5X 5KAKA 2PC6A 2CPIA 3F73A 4Y2IA 3PKYA 5I3QA 2CXEA 1DAXA 2VG5A 2CQGA 4MFBA 4UUXA 1S9FA 3GIRA 4B3TJ 2QL5B 1VC0A 4ZHRA 3JTNA 3CMES 4DL5A 1RTHA 4PQUB 3BKFA 5LSRA 1NK0A 3MAAB 1TUVA 4OYAA 3L95X 5IOLA 2HSEB 3KHLA 1DRZA 2ZJPQ 5GADU 3K5NA 3A13A 3W5YA 4ZIWA 3ZZTA 2JEFA 3E2EA 1NZAA 2AV5A 3KG1A 4B9SA 2CG4A 2B6AB 1U8SA 1C1CB 3NAIA 2L9WA 2HAFA 4WK1A 1B64A 2DNYA 2F65A 3IBWA 1RYSA 4O4GB 4IOCQ 2PMZD 4ZDNA 1WSVA 4ETXA 1KONA 2GS8A 3EPIA 1HWLA 4XPEA 3QGIA 3KLFB 1UFLA 3V81B 1TP7A 3K0JA 3LQVA 5DDOC 3MD3A 5HN0A 2IC3B 2ZH3A 3G6YA 2YNIA 4OJ3A 1RAGB 3O5TB 5F8NA 5A6WA 1RU2A 3GTYX 1WOPA 3NCRA 2ZJQQ 2APOA 4F26A 5HL7Q 3KDOA 4DV3F 2BZ2A 5HVGA 5J1EB 4UZBA 2WW8A 2VA3A 1VRUA 4GC7A 4DLGA 2KTQA 1NLKL 1TFWA 4EBDA 2QA4G 3HFKA 2KB2A 4UZCA 1XNRF 3H59A 1P8GA 4J9PA 2IM0A 2AF6A 3JYTB 5KFTA 2YWWA 2CPXA 2Y0BB 4OYZA 2CNNB 1NDCA 2GJIA 1U0HA 3SV3A 3MZIA 2RQMA 3VGVA 2EXUA 2OPRB 2FZCB 2RUGA 3GSIA 1REGX 4V1Ak 1N5TA 3JSMB 2VG6A 2QE5A 1BHNA 3BGRB 4ZN3A 3I82A 1NRKA 2PEBA 1X4HA 1H98A 2CA9A 2GQCA 3FEYB 3FKBA 1OO0B 3VGSA 3B6BA 1UVMA 3EZ5A 4LF4J 2ZH8A 4WZMA 3Q0AA 1HD0A 3FMBA 1NKCA 3PEHA 2CQ0A 1DY3A 2FVCA 4KGMA 3AXMA 5DM7Q 2FZGB 1K0VA 1N4LA 1HIYA 3QWUA 4CM2A 5B09A 4TQRA 4C9DA 4I6WA 1VC6A 2W9AA 1YJUA 4PWUA 4KV8A 3MWBA 2CKWA 1U0SA 3GJTB 2HHSA 2BDPA 4CP5A 1RTZA 2FQQB 2J7KA 3QT8A 1BWEA 4A4JA 4L3NA 2VBYA 1R89A 1OWXA 3ELHA 3JQJA 4U9RA 4PPDA 2B7CB 2R7OA 4OV1A 2VKRA 4C6AA 9RUBA 4E0DA 2I38A 3TZWA 3D6FB 1VCTA 4WFAQ 5KFUA 2OPSB 1LXNA 2IM1A 4PQUA 5M2PA 2NLWA 4XTTA 3MAAA 2MZJA 5KFQA 4JI0J 2RQ4A 3FDSA 3BYRA 2W1BA 4JI5F 1WHXA 1XBWA 1WDDA 1HNXF 5B0BA 1IM4A 4M5GA 4J91A 3B8HA 1SKWA 3HM9A 2B6AA 3CT9A 2RU9A 1IJEB 1C1CA 2JJ4D 1KFDA 2UXDJ 3C8YA 1S6UA 5KFMA 2ROGA 5L8RC 4O4GA 4LFAJ 2QG9B 3V6HA 2O3DA 3MMJA 4CNYA 3BO2A 2OLWA 2HBYB 1F0XA 4C8YA 3KLFA 3V81A 4O4RA 3RG6A 2IC3A 2E44A 5JJBA 3VCDA 1TMMA 3MPDA 1VGYA 4M5DB 2VG7B 2QLXA 4G6VB 4N47A 5J1EA 4DN0A 4NLQA 3Q8RB 2V4JB 4CH0S 1HNWJ 3WBZA 3G8QA 1O5JA 3PXGa 2OP5A 3W66A 3UPFA 3JYTA 5LMUF 3OJUA 4DX5A 3SCJE 1FF2A 2EFGA 5AXNA 3AA9A 3H25A 1NHVA 5F3TA 1VRTB 3ONQA 2OPRA 2KO1A 1LXJA 3FEZA 4KYZA 1XQIA 5LXYA 3HVRA 3NWRA 2XG8A 3PV8A 3JSMA 3DMJB 1MWQA 2MLZA 5M2RA 3P45B 2R8KA 2XYPB 4J9VA 2GVDB 5KOWA 3AAWB 4OYMA 2V5HG 6FDRA 1T7PA 1J5OB 2GGPA 3R6GB 1NMEB 4DDFA 2DPJA 4PG4A 5F9NA 4ZP6A 3GFZA 3P49B 2QLFB 2BM1A 4NPOA 3ZZRA 1ZYQA 5E3CA 2DCLA 4KKOB 1NDPA 4RUBA 2V94A 4YHHF 3OTOJ 2SXLA 1U1QA 1G6BA 1NCLA 2VD3A 3Q8SB 1CEZA 1KKHA 1S9EB 1HI0P 4LSLB 4C8NA 2R7WA 2E9RX 1Q5YA 5IFMA 2O01C 3UWTA 3D9BA 1IQZA 4C8MA 4B3OB 2POKA 3CWJA 2VDHA 3ZZYA 1S0MA 2KDOA 4N8NA 2R3VA 3O3LA 4QIEA 1WKJA 2OHDA 2W24A 1GX5A 5IT4A 3L3CA 2WHOA 3ZTSA 1VDHA 5AXMA 4P7TA 3O2IA 2NXJA 3HD2A 3CCTA 2RSQA 5KFZA 3TWZA 1N52B 1RT7B 4JYAF 4C0HA 2I6WA 4R0JA 1D8YA 3M2UB 2ILYA 3NCQA 1EETB 4X4SA 2ZD1B 1AUSL 3FZ2A 3CCUS 2OTLS 3AQPA 2PIIA 1B7YB 4K4VA 4B02A 3ADAC 2N4DA 4JB8B 4NLPA 1FDAA 4X64J 4IOAQ 3W63A 1T3OA 1GQEA 4WKYA 4J9LA 2KZZA 1H7XA 1Q16B 3LW5C 2JEIA 4DV1J 3DLJA 1PG5B 2PI5A 2ZHOA 2RRAA 4M5DA 2VG7A 5GAEI 2MLYA 3CCLS 4QOTA 2AJ0A 2RRNA 4CNZA 4DQPA 4RZRA 1GK8A 4F4YA 2RQCA 1LK5A 2V4JA 4XO0A 4UY85 1TK0A 2P6SA 2F8HA 4KHMA 4HHHA 2XMVA 4ZP7A 1VQ8S 1F2GA 5BJRA 5KFHA 1GMWD 1N0UA 2RUSA 4GVLA 4NMLA 2KG0A 4OZLA 3DYAB 1SUQB 4K2XA 4ZJQA 3TEGA 1QAYA 1YVFA 1VRTA 2UP1A 4DX8H 2L48A 1AXQA 4LRDA 3RB0A 3DMJA 1IWGA 4BWMA 3IC1A 4WP9A 5E3AA 1N36F 2GVDA 3NGDA 2W2MP 3BSNA 3TA0A 3IGNA 4QW8A 1M5PC 3L7OA 3KOAA 3DLGB 1J5OA 4ID5B 4EI2A 4I7FB 4ERDA 5GAEU 2HRYA 3M9OB 1VQ7S 5HQLA 3GE9A 2FDNA 4USHA 5B08A 5KT5A 3W62A 1LKZA 1RYRA 1Q1KA 4KKOA 4DL3A 4NYOA 4ZKAA 4AUKA 1RWWB 2BABA 4ATNA 2RRBA 1FDDA 3MAQA 1KVIA 5KFPA 4FNHA 2C22A 4OZ3A 1S9EA 3RAXA 2B4PA 2Q3PA 3ENWA 2KI2A 4LSLA 2DNGA 4DUYJ 3RBZA 1L3SA 3ZO7A 2AJFE 3SSSA 2DNQA 1V3SA 4USIA 3EDRB 3LP0A 3FQLA 3BH7B 4M8LA 3Q23A 5CYJA 1REVB 3PACA 4FF4A 2B8QA 2G9OA 1WOOA 2CQ2A 2KXNB 2OELA 3H5YA 1XEZA 4GC6A 1S12A 1KTVA 1LWXA 3QZ7A 3BYPA 1JLGB 1VIOA 3D2WA 2HFVA 3NG8A 2QGFB 2LEPA 2CJAA 1FD8A 1WC5A 3P5BP 1RT7A 2BACA 3R5AA 4P2MA 2K3IA 5L9NA 3M2UA 2RU3A 1EETA 2XS7A 2ZD1A 2A18A 3OTEA 2VL1A 1U1MA 2LMIA 2ZH7A 2J6SA 2JFKA 1FDNA 2BKPA 3KUGA 4DFKA 1Z1ZA 5KFAA 3M8PB 1RKJA 5J2QB 2B8PA 1SVDA 3RB6A 1YJWS 4QIVA 2OIHA 3THPA 3TOQA 2F8MA 1YX2A 3M30B 4WYWA 4NZ7A 2UUTA 4P9SA 2DGSA 2XULA 5H9EK 3HJVA 3HULA 2P5VA 1NJIT 5CZVA 3A8IA 5EX3A 3HMJG 4ECQA 3BO4A 2DHSA 3UE2A 3W64A 2HURA 4ZVSB 2BKOA 3LALA 4DL7A 4PYDA 3HSJA 1FKAF 4DCOB 1ZH5A 4NL5A 3RRKA 3QSYB 4KPCA 5JVHQ 3MR3A 1I94J 1KEKA 1CJUB 3RTVA 4LF4F 1W26A 3T41A 1WHVA 4ELTA 5J1PA 3OUYB 4RUHA 1L3TA 4IH5A 4A8QA 1UEKA 3M6UA 1ITPA 3DYAA 1SUQA 4IFYB 1WC3A 3KG4A 2FVPA 3CGIA 1RAEB 3KJNB 4K4SA 2QZ8A 5E33A 1YBAA 1Q0NA 2IIHA 5A76A 4EEYA 3U7JA 2J6TA 3PIOQ 1QY7A 1I51B 3TUPA 3N6NA 4NE9C 2IY5B 2VF3A 3ZTQA 3H4DA 4CLWA 1ZM4A 3RR7A 3DLGA 4QCLA 4I7FA 2Z58B 2UXBF 3EXYA 3TW0A 4YY3F 1RSCA 3GV7B 4ZA1A 2DVIA 2ZH4A 1C4AA 3BR9A 3THTA 5CXTA 4KY3A 2M0GB 4U7UD 2MQLA 3EGZA 1ROFA 4MK7A 1NPKA 2HVHA 2FHJD 2N3OA 4JI0F 1YZ6A 5LSOA 3RYLA 3FSIA 1TAUA 2VFSA 2DNHA 4J9KA 4CIOA 5BXIA 3RJMB 4LRAA 2VIHA 3BGOP 2UXDF 5T14A 1FT8A 1UFKA 2VV5A 3SQOP 4OX9F 4RW7B 1UP1A 1REVA 3ILJA 4JI8F 4QYZK 2DR5A 2HFZA 1B70B 2BQUA 1LW2B 1NKEA 2JWNA 2QTWA 3GIKA 1JLGA 5D0RA 1HI8A 4ER8A 5A8RB 5IV3A 4A46A 4YB5A 3P3DA 4DJBA 4L3KA 4Y0FA 3V4IB 2E1PA 1XR5A 1UWBB 2WRMA 5HANA 2HS0A 1PC4A 4K0KJ 2AHOB 3MM5B 2GIRA 4I4BA 2KVQE 3Q2SC 4JI4F 1VBYA 2RT3A 2MHNA 2E66A 2HG4A 3C19A 1VQPS 2CQ1A 2CWKA 3M8PA 5J2QA 2F7VA 4Z7YA 2UVVA 3MECA 2BEFA 5THWA 2OEJA 3M30A 2VPZB 1WEXA 4P73A 1PBAA 2DIVA 2R8IA 3D1OA 4DUZJ 3ZTOA 2DGTA 3W1YC 4Z7CA 2G2OA 2FJBB 3SDEB 2X51A 3HSGA 2W2QP 4DFPA 4KAIA 2FC9A 1V3RA 4QW9A 2RMLA 4X4RA 3K2YA 1C0TB 1CJUA 1U09A 1W7WA 3U1LA 1VQ5S 3KLIB 3T1AA 3OUYA 3P8BB 2LXUA 2BW7A 2VFVA 3HHLD 4IRCA 4M1KA 4IFYA 1N5YB 4OHVA 3KTQA 3R5GA 1S0VA 3ENVA 3MR7A 1R27B 2JEJA 4B9LA 4LF2A 2Y1IA 3CJ0A 4F7VA 1OJ4A 1ELOA 1KNZA 4AYBD 3OTOF 4FYWB 4HTIA 3RBXA 3M8WA 3FQKA 1FWPA 2B4VA 4OYOA 4WU3A 4FS1A 4X4UA 2ZC3A 2JVRA 1QSSA 1TKTB 1VOMA 4DF4A 3M32B 5ADZA 4RO0A 1DQAA 2JNJA 3M8ZA 5E0OA 2AGPA 3AHPA 3ZNUA 1LWEB 2DGQA 4FF1A 3IWNC 1JIHA 2DGVA 3DXSX 2MEWA 1Q78A 2FY8A 1S77D 3N9UC 1PYSB 5CZXA 4USMA 4DSJA 4CRJA 2QSWA 4ZCIA 1QAJA 1FTRA 2LQ8A 1WI8A 5BYQA 3Q89A 2KKHA 1U48A 4F2SA 4X65J 3KLHA 1R31A 3CD0A 3T5HA 4KIAA 3KHRA 2LEBA 5ETRA 3D68A 1A9NB 1DQ9A 4RW7A 1VQOS 4ED7A 1R8CA 3AB4B 3EX7B 1Q4RA 4DR1J 2OH2A 1H0HB 3CJTA 1IKYB 2R42A 1LW2A 2UUAF 3AFGA 2ZZMA 2V8GA 1IXKA 5A8RA 2WVFA 2I8EA 3UFCX 3D54A 4FYVB 3V4IA 1Y5NB 2VC1A 2MTLA 1UWBA 3HHNB 1X60A 2BJ8A 1KVKA 1BQNB 3K7RA 3MM5A 5LT5A 2DTJA 3RZAA 3IXQA 3UCZP 3NNHA 5GAHI 3CCQS 1KN6A 3NGTA 2E5IA 2R8JA 3H5UA 2DY9A 1NJZA 2DB1A 2YH1A 2EG1A 4QIFA 1CC8A 1N6QB 3VALA 1EQ0A 4DCPB 1K1SA 1TL4A 2WVEA 4J5OA 2Y1LB 4I6YA 1D3WA 2C3OA 4HL9A 1H6KX 3SDEA 4ED8A 2HHXA 3H40A 5E5NA 4LF1A 1Q82T 5DQHA 2F9JA 3BQ0A 4XAKA 5HAOA 5D15A 1C0TA 4QWEA 4BC7A 1UAWA 3KLIA 5T7LB 4GVBB 5CABA 4JI6J 1N5YA 4O44B 4DPUA 5L46A 2KHCA 1LK7A 1B7FA 3KNAA 4URQU 5GAHU 2B56A 1TELA 1T94A 2W4CA 3EVWA 4P2SA 3UD3P 2HFSA 4WIIA 3BGLA 3V6DB 3GLJA 4I68A 4Z37A 4DUTA 2WSFC 4IQMA 3OVBA 3WDOA 4CQ1A 5KFEA 4GO7X 1TKTA 4QPXA 2MMYA 5T41A 4DUYF 3M32A 1CJVB 1S1UB 5BYSA 2XMKA 1R7IA 2OD4A 3AOCA 1LWEA 2BJ9A 2JX2A 2P6TA 3K59A 2XMWA 1TL5A 4MMOA 4L75A 1KQFB 3PYDA 2DNPA 5ETNA 1TQLA 1YJ7A 2HHQA 1S72S 4HACB 2Y9HA 2J0XA 3DN9A 2FB0A 2CUYA 1RAJA 2DHAA 2AJQA 4OHZA 3BKTA 3CB4A 1A0OB 2MGZB 2M5YA 2Y1JA 3KMQA 4IRDA 2YKAA 3CJQA 5ETKA 4OHYA 2EFQA 1X7VA 2KG1A 2FHMA 3MOJB 2IJNA 3CC2S 1BQXA 3GIJA 1APSA 2EKYA 4DSKA 3NS5A 1U1LA 1C0UB 3R3TA 3S1TA 4LFCJ 2BVZA 4RW4B 2D3UA 2XWYA 1JWWA 4ECRA 2HK3A 3M2VB 1IKYA 2JLGA 3OXFA 3R5BA 3GQCA 4DL4A 1Y7PA 1IBKJ 3BQ2A 1PJ6A 1GX6A 1PCAA 2NXUA 3Q86A 5HJYA 2PGCA 3HT0A 3NS7B 1GXUA 2KYZA 3CO0P 1BQNA 4CT8A 4GKKJ 1KDNA 3AD8C 1H2TZ 2UXCJ 2XS2A 4ICLB 2G1DA 1AW0A 4NLUA 2W4PA 4DSFA 2FPHX 1CLFA 1UVJA 1T11A 2V68A 3HI9A 5F3ZA 1PILA 3W60A 4USJC 4EBEA 1N6QA 3TYTA 3KUHA 4O0IA 8ATCB 5D4OA 5KFVA 1NK7A 1WDTA 5CCMA 3M9MB 4A8MP 4K4UA 5HQ8A 2IA6A 1U6FA 3M4XA 3WIVA 4OHWA 2DO4A 2QV6A 2A2DA 4XPCA 2E7VA 4K4WA 4OLOA 2YXLA 1OPZA 4A8SA 4Q7AA 4FN5A 3LPYA 5T7LA 2DIUA 4RBTA 1DQ8A 3BPSP 4DS4A 3LP2B 2HNYB 4DWIA 3OLBA 4MIWA 4AT1B 2DR7A 3HCXA 1FWKA 1VLOA 2IVYA 4Q45A 5KFCA 3RB4A 4BDPA 5L1IA 3RR8A 1M1HA 3CULA 3TAQA 1BQMB 5DG7A 1IKXB 3TQEA 3V6DA 2GAHC 2DNNA 1RAIB 2HQIA 1AA1B 1FRXA 1NZ8A 4PR6A 4MK9A 4N41A 1Q8IA 1HHTP 2QJ3A 3PRVA 1FX4A 1CJVA 1S1UA 1UFWA 3RW7A 2YNHB 2KU7A 2XS5A 2J76E 4Q2MA 2DNZA 4JV1A 3VZHA 5IT9Y 4HACA 5AE3A 1HYSB 3TNVA 3BKUA 3K8VA 2CQHA 2CNKB 2FZKB 4LREA 1ZBTA 3PYFA 4IG0B 5IWAJ 1TKXB 3GJQB 3H20A 2RB7A 3K17A 2MGZA 2DHXA 2H54B 2H51B 4OI4A 1S0NA 3OHAA 4QWBA 2J9EA 3UO0A 1ZM9A 2E5JA 2DT9A 4F25A 1R8AA 3QJPA 1N32J 4YR2A 2MZ1A 1X4EA 2VFUA 1H2UX 4ZCLA 4K0KF 1ICEB 2DNKA 1C0UA 1KOOA 3NLCA 3MTKA 3EVOA 1HR0J 3M2VA 4HT7A 2HMIB 2VFRA 3HF5A 1RHRB 1NH7A 3F44A 3TX8A 3T1YJ 1NK5A 2B51A 1R43A 1X5PA 1ACMB 2ZNZA 1NSAA 5AXLA 4DUZF 4HH1A 1UW4A 1FKOB 1ZTWA 2ZH6A 4CI0B 5E7OB 2QT7A 4WF9Q 3CD5A 2NREA 4ELVA 3BEGB 2V4RA 4JI7J 1JLFB 1B99A 1RHUB 5LJ5Y 1UW9A 3A8JA 3L7PA 3NGSA 2ZH9A 3CJ2A 5F8HA 4IOBA 1VQYA 4ICLA 2ALZA 3K5PA 2MQMA 4M63A 4ZOSA 3BH6B 3D28A 2Z57B 2ACYA 4BLGA 1D8ZA 3CJ3A 3KJQB 4A8OA 1ZZNA 4KFBB 4NLDA 1QVGR 1U1RA 1S0OA 1YRXA 4FPIA 1QSLA 2MQOA 2MDAA 2Q66A 3X1LB 3DHWC 1Q95G 4HT5A 1G1XA 3FSYA 3Q83A 3Q8VA 1B4SA 1UCNA 4AQYF 1NK9A 2H4YB 4Y2AA 2CG8A 2LKZA 3D1QA 5KFSA 3LP2A 1FJEB 1AUDA 2HNYA 4AD6A 3BS9A 3AOBA 1RAHB 1RE1B 3K5MA 2EPIA 5AT1B 3SCIE 2RD5C 1H3DA 1WG1A 4QR0A 1XMQJ 2C2OB 1Q79A 2XSFA 2QYGA 2D69A 2YNGB 3NOGA 2DNMA 2XCPA 5DDRC 2FJVA 2DGUA 1BQMA 5DGAA 5KFGA 4FXVA 1IKXA 1DZ5A 2DKOB 3ISZA 1QLNA 4X65F 1UJ4A 1RK8A 3EGNA 2V2KA 2ABYA 1VK8A 2YNHA 3BDPA 2ZJRQ 3VAJA 1KLMB 2C1EB 3MCOA 3KK2B 1FJ7A 3Q2TC 2NCKL 1HYSA 2XZWA 1NO8A 2QMWA 2XHWA 4TKTA 4DR1F 1SC6A 2AMCB 4IG0A 2GA7A 1TKXA 3HKZD 3DOMA 3FRYA 1YGYA 4OYWA 2ZOMA 1CSJA 1UZDA 1EARA 2EVZA 2IRYA 3J7ZT 2R2UA 3OVSA 3DRXA 4U7CA 3FNNA 3UN5A 2X1GA 1RTJB 2P8IA 4YR3A 2YQ1A 4CYUB 2A3JA 4X4VA 5EWFA 3R2CJ 3DLHA 3PCOB 2GQ2A 1WF2A 2EWHA 1WACA 2M70A 1M1KT 2HMIA 2RQKA 2HQDA 2W01A 3CIMA 3EZUA 1SJ4P 2XYHB 3G9CA 2MZTA 3N5BA 2V2VA 1V5VA 2X3GA 2LCWA 1B3TA 1FKOA 1ZOTA 1YG0A 2B3TB 2JSXA 2BJDA 3TUIC 1MWZA 1UEUA 2N82B 3H42A 1JLFA 3W8PA 2FY1A 5KFYA 3QRRA 2IVFB 1YSJA 5KFKA 2ZBPA 3P4UB 5AJ3J 2Q1LA 2VH7A 2NSCA 4QBUA 5HO4A 2WAQD 4OI3A 7AT1B 4WFXA 4WBFA 1XNRJ 1MWYA 3HXMA 1HW8A 2KFYA 4BCAA 1QVFR 1KD1T 3MGJA 4FYDA 4KFBA 3GG1A 3CPWR 1S1VB 2XNRA 4JI6F 1YBUA 4U8YA 2E1MC 1N5VA 1YWXA 2MY8A 2WBRA 4K8RA 4QR1A 4OYBA 2OUGA 4HVZA 1NPRA 3HHLC 3OFEA 5J2PB 4KGXB 1L3VA 3QJLA 1P1LA 4LR8A 1TKZB 3GV8B 3G6VA 5E3RA 2CQIA 3BGUA 4NLSA 2HQFA 1GNKA 3OL7A 4LMZA 2VOPA 4RX6A 3K8WA 4OFZA 3JTPA 4O3PA 1CJKB 4EUVA 4HLBA 2KHDA 1WJ9A 5ETMA 4ILRA 1CJTB 2EI5A 3ZFVA 3VAFA 1FFGB 2Y0SD 2ASDA 2VKZG 1MU2B 5HVHA 1OMSA 2YNGA 2YH0A 2M8HA 1V3ZA 4ED4A 2HPUA 5J1NA 3RGIA 3IR5B 2DR9A 3HHLB 3VVTA 2ATLA 5DETA 1CBKA 4C0OC 5A8KB 1D1UA 3O1LA 4UQGA 5DQGA 1ZA1B 2DH9A 2AGOA 2CVEA 3VAKA 1KLMA 2W25A 3KK2A 2YWFA 5K20B 3RBDA 1Q7LB 3CJ4A 3J80Y 2HHTA 3DXBA 2AX1A 2ADBA 1HLWA 1IM6A 1KS2A 2UV8G 2HBZB 4Q2LA 2GMLA 3OL8A 4X62F 1IBKF 4DL0C 1FE4A 1BXNA 3U1MA 1RTJA 4QWAA 4Q8FA 1BMQB 4GKKF 2OKQA 2FHJA 5I4MA 7FD1A 4OJGA 8AT1B 2X1BA 2WB1D 2BANB 2UXCF 2FLPA 1HW9A 2O5DA 1U6BA 1KR4A 3CJ8A 2MB0B 1GEHA 4ECTA 5M2UA 5DLFA 3TJ9A 2AEMA 2GHVC 4F4AA 1PJ5A 2CRLA 3MF5A 4A8WA 2MKHA 2CQ3A 2IYGA 4LRCA 3QNWB 3OXLA 3UQSA 2E9ZA 3PM9A 3IGVA 1VJQA 2AJ4A 3D3BJ 4V19J 1J27A 3NGKA 3GYNA 3S7RA 3GR0A 3C3LA 3PG9A 2X7IA 1FHTA 2FVRA 3JSYA 3TAMB 1RBAA 2AKWB 4NMXA 1S1VA 4DFJA 4ANEA 4O3QA 4HR2A 1LOUA 3RAQA 5MAOA 3DDIA 5J2PA 1G4CA 3ETMA 3H98A 1TKZA 4UF4A 4DCJB 5KG0A 1EIYB 3CW2C 4OJHA 3I5CA 1NU4A 3CEDA 3F56A 4W90B 3PVXA 4DR6F 1RHMB 1D9FA 1K44A 3QO9B 3MDFA 3TVZA 1M5KC 3PW7A 1TZ0A 4OYIA 2DCUB 1CJKA 2ZZNA 2LQJA 4F3OA 4Y3CA 1HBMB 4ZLNA 2VFTA 2GJFA 3GIMA 1CJTA 2MZRA 5JVGQ 4LF5F 2DPIA 3MM6B 2FD2A 1U2FA 3E3XA 1N8RT 1VR6A 1XERA 1MU2A 5D77A 4ED1A 2IFXA 5IT9U 1MNEA 3IM8A 2DJWA 2ZWPA 3HHLA 2X1FA 1S6PB 4ZMMA 2HGLA 2VDIA 5KT3A 1SXLA 1YIJS 3D4JA 1H2VZ 3HK2A 1JK9B 4WXOA 4MKAA 2X1AA 2F1FA 1S59A 1T9YA 2QL9B 3ENQA 1X4GA 2OO4A 3ENAA 2L41A 2OEMA 3WQPA 2AIRB 1M5VC 4ZPVR 1E6YB 4RPFA 6AT1B 4EZ6A 1HR0F 3FJ2A 4IO1A 1YZ7A 3VHQA 3DU5A 4LF9J 2VASA 3SBMA 4JYAJ 4K7QA 1AB8A 4L74A 5IV4A 1FXLA 4QIWD 3ISND 1F6TA 1KC8T 1AFJA 2EK1A 2H1YA 3CJSA 3CTRA 5I3UB 3D66A 5G4DA 1SKSA 1AT1B 2BANA 3CDBA 3KLGB 1X8DA 1N56A 2DH8A 1SCJB 2HLTA 5KFFA 4Q0BB 2ZOGA 3QT6A 1P1TA 3SSQA 3IM9A 1PBUA 2N7YA 2M3DA 2HNDB 4O3NA 1Q8LA 4DQSA 1HNIA 2IJRA 3Q8UA 1Y3JA 4ZIVA 5K8OA 2B9XA 1R3NA 2J0WA 1SJ3P 2V63A 4ZVPB 2XBPA 2COLA 4M5JA 3BBBA 2PEHA 2G1HA 1MROB 4C0BA 2W9CB 3TA1A 2B4OA 2F4FA 5GVQA 4EBCA 1NSKL 3K5LA 2J5AA 3NAHA 1CVJA 4ES3A 3J81U 3TA2A 1FFWB 2NUUG 3TAMA 4CDIA 4ECSA 3TP2A 2F3JA 2FHKA 1DFDA 1Q5VA 1X0FA 5EWGA 1U25A 5FLXU 1RT6B 2JRSA 1OPIA 5C42B 3SI8A 3IA0A 1Q8BA 4R8UB 2CDQA 3QBCA 3QZ8A 1KOHA 5A8WB 1F3VA 3WX4A 5HK4A 3TVKA 3QO9A 4PRFA 3MMBB 5GMDA 2DGWA 3BGFA 2G2ZA 1JQGA 4DV0F 5J2MB 1HBMA 1G7CB 4ECWA 2KFNA 1ZPWX 4JBCA 3LWLA 3GU0A 3BQ1A 3MM6A 2BR0A 3C6TB 3NGUA 3W61A 4LJMA 2IM2A 2RF2B 4UOGA 3MCMA 3MI7X 2XO6A 2FYXA 4JP8A 3HSDA 4IH6A 3OQ2A 2J6UA 4TY8B 1LQ9A 2PFDA 3I96A 1AYEA 1N5SA 1OSDA 2V2ZA 1JMTA 3HO1A 1YI2S 2RHQB 3WC2A 2QMXA 3DHXA 4DPTA 4WYLA 2C3PA 5A2QY 1GT8A 2OI2A 1FJCA 1E6YA 3FCWA 4UT4A 3CVKA 5CQGA 3N5FA 1YLXA 2YVSA 2B5JB 2DGOA 4KO0B 3TQ1A 1F9EB 4ILLA 3MMAB 5HP1B 3DOLB 3EICA 5ITHA 1WF0A 2OD6A 2XNQA 1S76D 5C24B 4U67Q 1CQMA 4IDKA 2OTJS 1PIEA 1RQ0A 1R6VA 5L1JA 4OQJA 2LXFA 2CPDA 3EWGA 3TUZC 4FDFA 3AJ1A 4IG3B 5AJ3F 3KLGA 4NEZA 3M7VA 4Q0BA 5D3GB 1KHWA 1HWJA 4B9VA 1JLQB 2BRKA 3CCZA 2HNDA 1KVJA 1SJQA 4HI2A 3S6EA 1S4FA 2XHCA 2VQFF 3MEDB 1I5OB 1FK9B 3GCWP 2VONA 3AT1B 4MAKA 3QGGA 3GV5B 1UMJA 2ZNYA 2NZ4A 4MYUA 2FJXA 1NAQA 1MROA 5KG7A 2CJ9A 4ZVOB 2W9CA 2V8DA 2QEXS 4MKYA 2YPZA 3R6LB 3BM7A 5F8JA 3J81j 2XI2A 4NEYA 3GONA 3EXCX 1FRMA 2YX4A 4LQ3A 3G86A 2DISA 1RT6A 2OGUA 1Z2LA 4F50A 2XC9A 3A1YG 4NXMF 2JC1A 1FI4A 1NJYA 5C42A 1IJFB 2EBEA 3PO5A 1JKHB 4R8UA 1OY6A 1X31C 2ROPA 4HYKA 5A8WA 4ES1A 4N56A 2PD1A 1HBUB 3MPYA 3PW0A 3OBIA 1UTAA 4PPZA 3NWGA 2V6AA 3MMBA 2VPWB 2UXBJ 1FNXH 4RNOA 2CQDA 4YY3J 1JLEB 3PX0A 4ZS6A 5J2MA 3MFIA 1RWNB 5DZ7A 2HZVA 2FJDB 3VAIA 3FBBA 4TQSA 3EGWB 4KQZA 1X4CA 2CYYA 2DR6A 3C6TA 3OFHA 2ZKTA 4URGA 1ULRA 4ZVTB 3AJ2A 1F9FA 1QD1A 1SC1B 2RF2A 1TR0A 2ZM6J 2Z0GA 2Y3YA 2FHOB 4QU7A 4A48A 2UV8A 1HHQA 3HJFA 1YJRA 4TY8A 2VU5A 2FLOA 1W2IA 2C2ZB 3BB5A 2LP4A 2NS1B 2MLXA 2ZDPA 4HEA9 1SH2A 3CJKB 3OR2B 2R8GA 3AJDA 2DEIA 3D0GE 4F67A 4OX9J 4ED6A 2MPUA 4YN3B 1OQ6A 4E2FB 3WIUA 5HLFB 3KLVA 1RACB 2ZE2B 4JI8J 3FC9A 2EBGA 4X4PA 3DI6B 1RI7A 2HWIA 2CFXA 4C11B 2B5JA 1QUPA 3KDNA 3I5AA 4KO0A 3MCSA 2C2MB 3MMAA 5HP1A 1N88A 2CQCA 1N5QA 3DOLA 3QIDA 2R7XA 4ZLLA 2UVUA 3QAEA 5C24A 3HHKA 4CLKA 3NS6A 4TYBA 3WZ0A 4CCHA 1Y3KA 4JI4J 3QAUA 4RW9B 4J9RA 2ACMA 2DGXA 2BE7D 5D3GA 2YKPA 1ZAVA 4AFFA 1JLQA 1SH3A 5AE2A 1S6QB 3MOZA 1ZAXA 3AH6A 4EK2A 2HZAA 3N6LA 4ZVHA 3G8SA 5KFXA 2C2KB 2AZ3A 3MEDA 3PYEA 5SZTA 2F40A 2LXIA 2UVWA 4ECXA 4YB7A 3R9LA 4YEAA 2KT2A 4NOHA 3W3SA 4MKBA 2GC8A 3BGRA 2E5HA 1AZSB 3CMQA 2BQRA 3CDAA 5CYQB 3MEEB 4C3MA 2ADCA 4G1PA 3QFWA 3GMGA 2G0CA 3MPVA 4M5HA 3LUYA 1IBLF 3HP6A 1U8WA 1IR0A 3FCVA 2ZUAA 3W2VB 4PZVA 3I9ZA 3H5SA 1SIZA 4C7QA 1JKHA 2L9DA 4KC5A 4NCBA 1Y0HA 4NA2A 3M6VA 4EYIB 1FWLA 1Y4ZB 2HS3A 4P10A 1HBUA 5D0EA 3OD2A 4L76A 3JS9A 3J7AN 1WHWA 4YMEA 1RA7A 3GYGA 5E2QA 4DZ6A 4ZP9A 2W7AA 1YDLA 1U1NA 1JLEA 2ZBQA 4DR4J 5LOQA 3A12A 2MQ8A 5LL6d 3VVUA 3M1VB 4DL6A 3OT9A 4PAAA 4USUA 1DTTB 3GR1A 2O66A 4DN9A 4QJVA 4TXSA 5KFJA 2OPSA 3GPAA 3Q8YA 2NPFA 2QA2A 1NB2A 4RNHA 2E7XA 3EUNA 3TJ8A 2BXJA 5CAAA 2DY1A 2MJUA 4LF9F 4B9TA 3TUJC 3MR5A 4TU8A 1BD6A 1S48A 3MEGB 1TL7B 2XB2D 3M8SA 3H4BA 4P6QA 2WSEC 2O67A 3CJKA 2AJ2A 3QWPA 5KFIA 1HI1A 2ZC4A 1PAEX 1FNMA 3ZZOA 3IFEA 1RKIA 2MQNA 2MQPA 2IVMA 1NUEA 3SXLA 3HSZA 5HLFA 3ZTPA 2ZE2A 1VQSA 5HMYA 1RXOB 1WC1A 3DI6A 2PFFB 4C11A 1OS5A 2C3MA 4EGLA 5EWEA 2UUAJ 1S49A 3FUYA 2KRBA 1L3UA 3RU0A 4PXCA 1O8BA 3FGVA 5CYMB 3MFHA 1RTIB 3B78A 2CJBA 3VZIA 4NA1A 5F8MA 2W9BB 2KT3A 4C8LA 1VS3A 1ZPVA 4YQWA 2A0FB 4HKQA 4K4XA 3ZZUA 5K8PA 1R6YA 2ZKUA 2V9KA 2YTCA 2HIYA 4RW9A 3PZPA 5KFRA 1VLYA 2KJWA 3TANA 3L09A 4OI2A 3H8YA 1JX4A 5CCLA 2YKQA 1TTHB 4V19X 3G71S 1S6QA 4W98A 4F4WA 2R4FA 5KG4A 1F9HA 2FJAB 2H9ZA 3VWSA 3SIPB 1T9UA 4TYAA 3F41A 4RUCA 2VQEJ 2GX8A 3PIPQ 2ZOFA 2GFFA 2XI3A 4B3RJ 4AL7A 1AZSA 3UW1A 4NZ0A 5CYQA 1FRKA 2B9EA 2ZEJA 3MEEA 1NHKL 2VC0A 2UU9F 1K8AT 4CLFA 2H65B 3CD7A 4TN2A 1F5AA 1D09B 1T9VA 1FRHA 2C28A 1WI6A 1L3KA 2E1AA 4CH7A 1FTCA 3IS9B 5DS7A 1WG5A 3PO4A 1EKRA 5K8MA 1S7IA 3DGPB 2HW3A 1UVKA 3W2VA 3PW4A 4JI1J 2LLZA 3GB0A 4UTGA 3UDEA 2GW8A 4L72B 4O3OA 4YDXA 2X3DA 1SC3B 1GXTA 2QMUB 3N28A 3QIPB 2NPIA 3CCVS 3NY0A 4ANCA 2ASYA 5KTQA 2IBOA 2QFJA 1HBOB 4ZPDA 2V2QA 2EFVA 4OZNA 3M1VA 5EN1A 1TMJA 1DTTA 3CF5Q 2NXCA 2XWXA 4LRFA 3KMSA 4NASA 4B3OA 1OY8A 3PJXA 2V4QA 5LM7E 3L4BC 1J5EJ 3AODA 4YB6A 2CQPA 3L9ZA 4RU9A 4Z2XA 4XIUA 2HVIA 4H4MB 4B3SJ 1U2CA 4DU8A 3IAS9 5LMNJ 1HD1A 2WBMA 1EX8A 2EG2A 2HVZA 4F3QA 3MEGA 1TL7A 2RDJA 2RH3A 2ZBCA 3IMQJ 5D4LA 1VQMS 1WD6A 2HBQB 1FKPB 3KWMA 1OY9A 2DRDA 3KFWX 1RTHB 5D4NA 4KHPJ 1RWPB 2BBEA 1JLAB 4J9OA 4X2BA 4K2JA 2A6OA 2VJVA 2LVWA 2R7UA 2A2CA 2HHHJ 5K14B 3UCUP 4CLPA 1SH0A 2DH7A 5AE1A 4YR0A 1RTIA 4E8UA 4P71A 5HQMA 1RT2B 2D7SA 2W9BA 2G4BA 1VQLS 5A0YB 2AGQA 2LFVA 3B82A 1NNDA 4QQBA 3VV2B 1T0TV 4DPOA 1GTEA 3MR2A 3QT5A 1VK3A 3NGRA 2XEXA 3QFHA 1WNEA 2XSJB 1ZM2A 1S99A 1OIAA 2HQCA 3BPDA 2HS4A 2HHVA 1YQHA 1S4EA 3PRDA 1TV6B 4MTPA 2C2EA 1WG4A 4ZVGA 4D3HA 2V0NA 2GMJA 4KH0B 1VC5A 2Q79A 1OYEA 2PMWA 3PJWA 1B0TA 1LWCB 4WWSA 3DU6A 3RB3A 4OX7A 3K58A 2LU1A 1RZMA 5DRKA 5DM6Q 5C2CA 3MCNA 4C4WA 4ID5A 1IVZA 1BUXA 1RWXB 2JLEA 4CLZA 5F8LA 5CA5A 1NPPA 3ZZ0A 2QO3A 1R8HA 3IS9A 4DI6A 3DGPA 1URRA 2VBWA 2YNFB 1U45A 3EDQB 3MPUB 5D0HA 5HI7A 1B0PA 4OZJA 3MTJA 1VBXA 3OL9A 3TR5A 3MM9B 5G0RB 3QIPA 2ZM6F 3CCSS 1YRTA 4ZLJA 5KFDA 3JTOA 5F41A 1TU0B 2ZZTA 1R8BA 4WFBQ 2MQQA 2L3MA 3QATA 4X66F 3OVAA 1HBOA 4USTA 4KT0C 1C2PA 2H5IB 4CZCA 5IZHA 4OI1A 3OTDA 1RLCL 1V5IB 2KN4A 2GV1A 3BBCA 4LF6F 1LFPA 1KQKA 4AE5A 5LJ3Y 4FBTA 1BGXT 2QLBB 3OW2R 2UUBJ 4M95A 3T1HJ 1SPBP 2BE2B 4H4MA 1KP6A 1T02A 3X3UA 2A10A 2Y8YA 2EFPA 3V6KA 1FKPA 3ETOA 7FDRA 4L6V3 4Y28C 3Q24A 1JLAA 3GFXA 1VIXA 4ZVRB 3BO3A 1U4BA 3LP1B 3W8GA 1BWVA 1WHYA 5K14A 2H5JB 4YS2A 4DPYA 3VAMA 2NYIA 2DR8A 2D9PA 4DS5A 4DHVA 3GZ7A 5GMEA 3CD6S 1RT2A 4BBYA 1FRIA 4ID8A 2ZBRA 3UDLA 4WIQA 5A0YA 1IKWB 5BR8J 4P52A 4USVA 4X84A 5KG1A 3I32A 5RUBA 2HRTA 1ZAWA 3W9HA 4C8KA 2HLUA 5L38A 4EU0A 2M4MA 2XSJA 2LECA 3CCJS 4UOFA 1QTNB 3ZC4A 1S1XB 1TV6A 4DPWA 1N33J 1GXLA 3IAM9 1IR2A 4CO3A 4P74A 2ZVIA 2XLIA 4PG5A 1RGVA 2CWXA 2J0SD 3LAKA 3PW5A 1O6XA 2UZAA 3R5CA 3M05A 3LGHA 1Q8KA 5C7PA 1LWCA 3H0PA 3M6WA 5I42B 2IM3A 3TEHB 3BDEA 4AQYJ 4KH1B 4I6AA 2CNOB 3I6PA 3R8YA 2LA4A 3PHEA 1TUWA 2BJ3A 3W65A 3I87A 3QYYA 4DR4F 3SFUA 4F36A 3V4MA 2IYIA 1CPZA 4NWBA 2UUCJ 1NHUA 2YNFA 1ZETA 4WZQA 4AL6A 4RWXA 1SQFA 3DDNA 3MM9A 4DQIA 1IUJA 3JB9k 1JLBB 4IRKA 5G0RA 3LANA 2H48B 2RVJA 2GGPB 3D6TB 3ILLA 3PTWA 1P9YA 3PYGA 4DV6J 1HQUB 4O3RA 4K4TA 2PDAA 2Z2YB 4PKDB 2PT0A 4LF8J 1UVNA 2F4VJ 3MM7B 5ETLA 2VUGA 2IPOB 1P6TA 3N0VA 1P27B 1NKBA 4MYTA 1TL1B 3D3CJ 4XDDA 2VOOA 1IKVB 1HQ2A 2NXEA 5KOXA 1PC5A 3G82B 4BWJA 2FTRA 2CJKA 1QM9A 2IAJB 2RS2A 1UVLA 3B4DA 3IP0A 1RP5A 2BE2A 2HFOA 2GO9A 3SQGB 2DNLA 4ZPWR 1NK4A 4ALZA 3LF0A 4FS2A 2H4WB 2ASLA 1X9WA 5AXKA 1FCAA 2KXFA 3CIZA 1RT1B 2AU0A 4X4NA 1U7LA 2C2RA 3OSPA 5JUMA 1AROP 2J7WA 1DARA 2FUG9 4FZVA 1HQEB 4F4ZA 1M5OC 3LO3A 4PG6A 3H2LA 4QYRA 1U1PA 1YJTA 1SKUB 3LP1A 4EFAC 4TU9A 4F3MA 4F0KA 3HHEA 1DJ0A 2HK2A 3CUNA 2RNEA 1FNOA 3KG0A 1YKWA 1YJ9S 5ETOA 5ETVA 4KGKA 3AQOA 4DFMA 2HGNA 4NRUA 2K8GA 2XMAA 5DDQC 2HGMA 2ATCB 4HHUA 1VBZA 2J9CA 1IKWA 2VQEF 3OR1B 4F8RA 3MURP 4WE1B 1GH8A 2Z30B 2CZ9A 1D0EA 1EHWA 4LQ9A 4DR3J 1S10A 4B3RF 4USWA 3SSRA 4F02A 3H5XA 1U47A 4RW6B 1NK6A 5H9FK 4RUAA 1JNZB 1S1XA 2E7WA 3SMZA 2JH3A 1T05B 1MSWD 2JLFA 4GKJJ 4KB7A 1X4BA 4LIWA 3CE8A 1U1KA 3CJ5A 3ET6B 2WONB 1KQSR 1JXVA 4NZ6A 1GAOA 1DBDA 3VF0B 4RJVA 4NYPA 1RT3B 4JI1F 4CO0A 2ZITA 5I42A 1U6ZA 3W9IA 1GTHA 2ZWOA 4QZVB 1XJWB 3UDCA 2HEKA 4A8YA 1UKUA 3QT7A 1HWIA 3R2DJ 2DXDA 5EX0A 4F4XA 4DEZA 2BM0A 1H72C 4J90A 1MMNA 6FD1A 1WEZA 4NLOA 3NNCA 5KFOA 3FBFA 2HQGA 2ZH5A 3E01B 4RKUC 1H74A 2LDIA 1O0PA 4W4MA 3D0IE 1Y9OA 2B0GA 2LYVA 4LBPA 2FJWA 2YBVA 3FCHA 1J5EF 4OYPA 1JLBA 1FXDA 4CTAB 1T03B 4LSZB 3KNGA 4U95A 4B3SF 1X4FA 2YQ0A 1MW7A 1HQUA 1TK8A 5LMNF 4R5PB 3IO1A 1Y00A 2JL9A 3BN4A 4MJKA 3MM7A 2QFIA 2W2PP 3PR4A 1IBMF 3B4MA 1VJWA 3KJVB 4F0MA 2WVDA 3UR0A 1TL1A 2BRLA 1XNQJ 1IKVA 4KHPF 1FJGJ 1SC4B 2DHGA 2N4CA 1RDRA 4KE5A 4ZPBA 1U49A 3POTB 2V69A 3G82A 2KH9A 4CLLA 4J9NA 2IAJA 5JMNA 5KG5A 4NRTA 5C5JA 3P6YC 3SQGA 2HHHF 3R5JB 5HJXA 3I4HX 2GHWA 1WTFA 4X62J 3OTCA 3I0RB 1K1QA 1RT1A 1YJNS 3LP0B 1W2BR 4DV5F 4ZITA 4NI2B 2BKNA 3EPGA 4OX8A 3NMRA 1HQEA 1SQEA 3G6XA 4USKA 1PAUB 2RS8A 4DOZA 2QSFA 2K1RB 2M52A 1FRJA 3LGNA 4FKXA 1UZHA 2JFDA 3UR3C 2R8HA 3PX4A 4DLEA 3KKFA 4NXNJ 5KT4A 4C2MA 2HWTA 1F5BA 2RIJA 4WK3A 4DXLA 3QLHB 1AFIA 4DQQA 3N01A 4DV2J 1WELA 2VZ9A 2K06A 3OR1A 2HKEA 4ZK7M 4WE1A 4N7TA 2MKSA 1F60B 3W5ZA 2XLKA 3IG1B 5LSLA 4RW6A 4M94A 4WP8A 1MMDA 1M5HA 2G13A 4UY8T 1FXRA 4CLSA 4M5IA 2YWEA 3KYLA 2AYGA 1T05A 3UDVA 1RHJB 4ZPCA 4GVBA 5EGYA 2BV3A 1NH8A 5DO2A 3CC7S 3ET6A 4O44A 2WONA 3D5MA 1JXLA 4HDGA 4U7UK 2E1CA 4DR5J 3DC2A 3PR5B 4AXIA 1Y10A 1RT3A 2LA6A 2RDIA 1HBNB 3MUTP 1RISA 4CO2A 3LAMA 4BHQA 1FX2A 5IM0B 1HNVB 3QPIA 4OI6A 4DR6J 1RAOA 4HTJA 2I9SA 1RWKB 1U02A 2M9KA 2NSBA 5B0CA 2XMMA 2RAQA 4LFBF 1NSQA 2J9DA 4B3MJ 3PFEA 3OFFA 4M5LA 2EC2A 2RJZA 1C1BB 2JEGA 5KFWA 2O1PA 1TAQA 1BE4A 3E01A 3IBCB 3SFGA 2VODA 4LF5J 4ILMA 2HIQA 4Y65A 1HNZJ 3HD1A 2DRAA 4KGZB 2IMWP 2UUBF 2CQBA 4CTAA 3T1HF 1T03A 4HH0A 2CPFA 3TRGA 3M8YA 3BR8A 5HBMB 3MM8B 3C66A 3NP5A 3GG0A 3I55S 2M8DB 4R5PA 4LSNB 1SKRA 4NLTA 4B3TF 4WTOB 4U6PA 4B9UA 4C97A 4BS2A 5ETTA 3IR6B 1Q86T 3KJVA 1I1GA 4DG1B 3OHBA 2B4UA 3HZEA 2AX0A 3Q22A 2VHGA 3FMWA 2MKCA 3POTA 2R2TA 1S1WB 4RLEA 4RW4A 4QWDA 3JAMY 2C2NA 2MY7A 3E8OA 2DXEA 4CO1A 2DXFA 2RHSB 1MMLA 1V9OA 2BJEA 4LF7J 2LEAA 3DLEB 1RCOB 3I0RA 2U2FA 1PYTA 3U1NA 2XM3A 2Z2LA 5KT2A 2OJ3A 4WPAA 4I1TA 2BYCA 3CSKA 5D0GA 3R7SB 5DGBA 3N79A 4NI2A 5BR8F 2XMJA 3NNAA 3GCXP 4FP9A 2CPEA 3I0SB 3JSRA 2K1RA 4ZPAA 3IWXA 2KL8A 4JI3J 4OL8A 1X0PA 4RBUA 1WKKA 4WTYA 4UW2A 2K2PA 2GO8A 3IRWP 2W4DA 1N33F 3E51A 2ZH1A 2YQ3A 1N34J 3QLHA 1FA0A 4TNOA 4OJ1A 2MHEA 2E5GA 3OFGA 3AA8A 1IQTA 1SI9A 1UJ5A 1KFSA 2HVDA 1FE0A 3S01A 4YP3A 3TZXA 1E6VB 3IG1A 2AT1B 2DBBA 1RT5B 2FGOA 3MECB 5DG8A 4LUBA 3KLEB 2P2CB 2KXHA 1JLCB 1HPZB 2HBRB 2E5LJ 1A7GE 3ILOA 4U8VA 3KHGA 1HARA 3A3OB 3Q8QB 2MZSA 3QJJA 4KBIA 4URSA 4PG8A 3GP9A 4PUOB 4F2RA 4DZDA 2UUCF 4N8OA 3PFOA 2QN6B 1HBNA 3CNQP 4DR7J 3MD1A 4XDCA 2A1BA 5IM0A 1GMWA 1HNVA 4DR2J 1ZS6A 5ETQA 3RRHA 3W9JA 2WK4A 4FPRA 1PSDA 1M0SA 2CJYB 2VICA 4PEOA 3NMAA 4NLXA 3GIIA 5L9XA 1PYOB 4O0NA 2MXYA 4DV0J 2IRUA 2V8VA 4DV6F 5J2NB 3KK1B 4LF8F 1C1BA 3T6JA 2F4VF 4QR2A 4RBVA 3HDSA 3LTOA 4NLYA 1B0VA 5DDPC 4OZ5A 1FRLA 2F9DA 4WU2A 3FBEA 3U02A 2XY5A 3MPWA 5HBMA 3MM8A 4OHXA 1RBLA 2DYAA 4LSNA 2AW0A 5HVFA 2OPQB 3TZZA 2YKMB 2Y8WA 3HPOA 2GZOA 3CMAS 4DG1A 1IN0A 1TKDA 1RWVB 1T9WA 4WFNQ 4NLWA 2U1AA 1S1WA 4NLRA 2EKNA 4JV2A 4DF8A 2EK6A 5F8IA 3KLHB 3J7Z5 4CLUA 1YBTA 4CWBA 1UPPA 3US5A 3DGVA 2PE8A 1I6JA 2GAGC 3DLEA 4P2FA 2R7QA 2GQQA 1H38A 4DPXA 2F5GA 4B9NA 4U96A 1NJXA 1CULB 1W25A 3GJSB 2ZUGA 4PXDA 2HHWA 4LFAF 4IO9Q 2EC0A 4UUWA 2AWZA 2NR0A 1N54B 3LWMA 1NB7A 2ZDOA 3I0SA 3HVTB 1SJ1A 4YOEA 3V2UC 3DRSB 4DR3F 4PWDB
chains in the Genus database with same CATH topology
2H5JB 4LSZB 1RWKB 3NS7B 2P2CB 5IC6B 2CNLB 1QDUB 2C2ZB 2H4WB 1GFWB 2C2KB 4ZVSB 3R7NB 2H5IB 2HBRB 2C1EB 1ICEB 2QLJB 4DCOB 4ZVPB 2QL9B 4JB8B 2HBQB 1BMQB 3KJFB 4DCJB 1RWOB 1RHKB 3P4UB 3IBCB 3R7SB 1RWPB 1RWMB 1RHRB 1RHQB 2H4YB 1RHMB 2QLBB 1SC4B 1RWVB 1SC3B 2QL5B 2XYGB 3RJMB 2CJXB 2XZDB 2H48B 3KJNB 2C2MB 5IC4B 1QTNB 1RWNB 3R5JB 1RE1B 3D6MB 1RWXB 3P45B 1RWWB 2XYPB 1RHJB 3SIPB 2CJYB 2HBYB 3GJTB 1I51B 1PYOB 4ZVQB 3QNWB 2FQQB 1RHUB 2XZTB 3R7BB 5K20B 2C2OB 4ZVUB 1I3OB 1IBCB 3GJRB 1NMEB 3R6GB 4ZVTB 3EDQB 4ZVOB 2CNKB 3IBFB 2Y0BB 3GJSB 1SC1B 2CNNB 3GJQB 2DKOB 4ZVRB 1PAUB 2HBZB 3R6LB 2XYHB 2H54B 3KJQB 2H51B 3D6FB 2QLFB 1F9EB 2QL7B 3D6HB 4DCPB 2CDRB 2H65B 2CNOB 3EDRB 2Y1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5J B;  4LSZ B;  1RWK B;  3NS7 B;  2P2C B;  5IC6 B;  2CNL B;  1QDU B;  2C2Z B;  2H4W B;  1GFW B;  2C2K B;  4ZVS B;  3R7N B;  2H5I B;  2HBR B;  2C1E B;  1ICE B;  2QLJ B;  4DCO B;  4ZVP B;  2QL9 B;  4JB8 B;  2HBQ B;  1BMQ B;  3KJF B;  4DCJ B;  1RWO B;  1RHK B;  3P4U B;  3IBC B;  3R7S B;  1RWP B;  1RWM B;  1RHR B;  1RHQ B;  2H4Y B;  1RHM B;  2QLB B;  1SC4 B;  1RWV B;  1SC3 B;  2QL5 B;  2XYG B;  3RJM B;  2CJX B;  2XZD B;  2H48 B;  3KJN B;  2C2M B;  5IC4 B;  1QTN B;  1RWN B;  3R5J B;  1RE1 B;  3D6M B;  1RWX B;  3P45 B;  1RWW B;  2XYP B;  1RHJ B;  3SIP B;  2CJY B;  2HBY B;  3GJT B;  1I51 B;  1PYO B;  4ZVQ B;  3QNW B;  2FQQ B;  1RHU B;  2XZT B;  3R7B B;  5K20 B;  2C2O B;  4ZVU B;  1I3O B;  1IBC B;  3GJR B;  1NME B;  3R6G B;  4ZVT B;  3EDQ B;  4ZVO B;  2CNK B;  3IBF B;  2Y0B B;  3GJS B;  1SC1 B;  2CNN B;  3GJQ B;  2DKO B;  4ZVR B;  1PAU B;  2HBZ B;  3R6L B;  2XYH B;  2H54 B;  3KJQ B;  2H51 B;  3D6F B;  2QLF B;  1F9E B;  2QL7 B;  3D6H B;  4DCP B;  2CDR B;  2H65 B;  2CNO B;  3EDR B;  2Y1L B; 
#chains in the Genus database with same CATH topology
 4TLQ A;  4ES2 A;  2AD9 A;  4DX7 A;  1EB0 A;  2H3E B;  2NZC A;  2JZ5 A;  2WTF A;  4X4T A;  3FFI B;  2FC8 A;  4GKJ F;  4QPT A;  4KJI A;  1OSC A;  2HNZ B;  1ZA2 B;  1RUS A;  2GJ2 A;  1WOR A;  2VQF J;  3OXG A;  3DLL Q;  1S79 A;  2ZFH A;  3KXD A;  2CZV C;  4P2X A;  1N0V C;  4PYA A;  3G8T A;  3DFE A;  4PXB A;  2CJX B;  1Y5I B;  3MXH P;  1E6V A;  1VHF A;  4FYX B;  1RTD B;  1HNW F;  5HMW A;  1QTM A;  3ZZP A;  1RT5 A;  3DRP B;  1EKS A;  1H7W A;  5LXR A;  3KLE A;  1JLC A;  1VMB A;  1CQN A;  1HPZ A;  3UVJ B;  4PQA A;  2PO4 A;  4EO8 A;  2G0I A;  2WOM B;  3CXC R;  4DV4 J;  4RNF A;  1SL2 A;  3GFH A;  5KFB A;  3D67 A;  2IBK A;  4LVN P;  4NXM J;  4ITS A;  4PUO A;  2BOA A;  4NA3 A;  1RAB B;  1XWL A;  1MN9 A;  3NBP B;  4FXD A;  4C8O A;  3HT3 A;  2HHP A;  3WC0 A;  2V8H A;  4GRS A;  2AJ1 A;  4YFU A;  2BMB A;  4WJB A;  2QYC A;  2C2D A;  1XC9 A;  1WSR A;  1K73 T;  3MR6 A;  3C14 B;  5J2N A;  2D74 B;  2ZH2 A;  3KK1 A;  4AND A;  4LT6 A;  5KFN A;  1IWA A;  2ERR A;  4DSL A;  2W7P A;  2Z2Z A;  3MAH A;  2KT5 A;  3M6X A;  3ZZZ A;  1XNQ F;  1M1G A;  1FJG F;  3FSX A;  2D9O A;  1Q53 A;  3UNG C;  1N48 A;  1RB0 A;  5A6P A;  5KG3 A;  2MKJ A;  4FVM A;  2ZBI A;  3PEJ A;  4ZJL A;  3UCG A;  5DZ6 A;  5JXS A;  3JQK A;  5BYR A;  1PGZ A;  4G1I A;  1EP4 B;  4OZ1 A;  1QSY A;  2OPQ A;  2M2B A;  4RNN A;  2YKM A;  2NXN A;  3D0H E;  2N7C A;  1D9A A;  3NOC A;  4OV6 A;  2CPH A;  1FER A;  4EYH B;  5D78 A;  4CYU A;  4R0E A;  3AOA A;  4Y00 A;  2QIF A;  2WVB A;  5U47 A;  3PKM A;  2GNK A;  2ZHA A;  1SJF A;  2BA9 A;  3A8E A;  2KFZ A;  2MJN A;  3GFY A;  3IRX B;  4C48 A;  4ED2 A;  4NXN F;  3T9N A;  2BJ7 A;  3F0N A;  3T9Z A;  1CUL A;  1HA1 A;  2FIU A;  4DV2 F;  1JJH A;  2R7S A;  4OIX A;  2VB6 A;  4K59 A;  3PRB A;  3BSO A;  3FZB A;  3HVT A;  3SCK E;  3DRS A;  3ZXW A;  4PWD A;  4EZ9 A;  2OSQ A;  4X64 F;  2K7J A;  2HRU A;  1RCX B;  5FJ4 A;  1Y5L B;  2KVI A;  4O23 A;  5SUH A;  5DQI A;  3FFI A;  4DV1 F;  3BN7 A;  4DSI A;  2E29 A;  2HNZ A;  3PX6 A;  4Q43 A;  3GJR B;  1X5O A;  3C15 B;  3I4P A;  4M5K A;  2HFU A;  4DR5 F;  3ITH B;  3R1L A;  3R5D A;  3QGH A;  4IKA A;  1R0C B;  2KM8 C;  1RTD A;  1TUG B;  2WVC A;  5C25 B;  2YWH A;  1FVS A;  3DRP A;  3QMQ A;  5KFL A;  5IS2 A;  3QRQ A;  3MUM P;  3VQT A;  4TLR A;  3UVJ A;  3NCP A;  2MKY A;  4C3K A;  3EE3 A;  1S5Z A;  2VBX A;  4XK8 C;  2PMH A;  2D3O 1;  2WOM A;  2EW9 A;  4B3M F;  1IBL J;  1CS4 B;  2RE1 A;  2Z2M A;  1K47 A;  2IDE A;  3HVA A;  2J8S A;  2VPX B;  4MKV A;  2Y1R I;  2XGP A;  4JV5 J;  4FVC A;  5H1S V;  2Q6B A;  1UPM B;  3NBP A;  1TK5 A;  1WWH A;  1HNZ F;  1XIQ A;  3JXO A;  3J7Y I;  3AB2 B;  5IC4 B;  2B7B B;  5CH7 B;  5L1K A;  4NCA A;  1S1T B;  1X5S A;  1XR7 A;  3R1H A;  4LVO P;  3CCM S;  2D1C A;  2DO0 A;  1L5U A;  2YX7 A;  3C14 A;  3VR1 A;  3U27 A;  5A8K A;  2KM8 B;  1SBR A;  2XMU A;  1U1O A;  4IFV B;  4FKY A;  3IBF B;  1KTQ A;  4LBH A;  1LWF B;  2YKN B;  1TL3 B;  1A6L A;  4FXW A;  1NJW A;  4O3S A;  2W7O A;  2MKK A;  3PW2 A;  3CC4 S;  1KLN A;  3T5J A;  1XMO J;  4NX9 A;  2OEK A;  3JQM A;  1LV5 A;  2M88 A;  3JAM U;  2BJ1 A;  3W7B A;  4EO6 A;  1EP4 A;  4LF7 F;  4OYX A;  4YDD B;  2LQ9 A;  4PCQ A;  3NL0 A;  1UL3 A;  3DLK B;  3J7Y U;  1JJC B;  2DEJ A;  4RR5 A;  1F3F A;  1RWU A;  2OAU A;  4C3L A;  4ED0 A;  3G2X A;  4IUF A;  4IYQ A;  3BV8 A;  4JI3 F;  2HZC A;  1UET A;  4ZCM A;  4JUZ A;  2XLJ A;  1Z2Z A;  3IRX A;  4ZVQ B;  2XZT B;  3LA0 A;  3GWC A;  3UN3 A;  2A6M A;  3O8W A;  1N34 F;  1C4C A;  4N77 A;  5ETS A;  3C46 A;  1SQG A;  3AXK A;  5D6G A;  5C2G A;  4OMF G;  1S7H A;  5EDW A;  5KT7 A;  1WC4 A;  1RBO B;  4N5S A;  1QE1 B;  4TVA B;  2Z56 B;  2W2N P;  1QUV A;  3T3F A;  2E5L F;  2VPY B;  2IRX A;  3I56 S;  1X5T A;  2CVI A;  3C15 A;  4I0W A;  1CC7 A;  2QX0 A;  1K9M T;  3ITH A;  2JOQ A;  2ROE A;  4DR7 F;  3FBC A;  4CLT A;  2YWG A;  2XGQ A;  2OFH X;  4KPY A;  4X4Q A;  3O44 A;  5C25 A;  4CO4 A;  4CLY A;  4DR2 F;  1I94 F;  2UU9 J;  2CPY A;  3AY0 A;  3N4W A;  3M8R A;  3R7B B;  2VA2 A;  3OV7 A;  4ZP8 A;  2JDJ A;  2KRR A;  1CS4 A;  2XQC A;  2AQ4 A;  4IR9 A;  3H7H B;  4FNI A;  4I64 A;  4OI0 A;  2ZHB A;  2D3Z A;  1OQ3 A;  1MN7 A;  1R0B G;  3TX0 A;  3C6U B;  4MIB A;  5IC6 B;  2CNL B;  2ILZ A;  4K5R A;  1S1T A;  2IJF A;  4B9M A;  3OPK A;  4A8F A;  4PWW A;  2OMO A;  1S6P A;  1F2H A;  4DQR A;  1KHV A;  1EAY C;  4IFV A;  1DLO B;  3BF4 A;  2QC3 A;  1RHQ B;  3DKD A;  1LWF A;  2YKN A;  1TL3 A;  5DG9 A;  1M5S A;  1Z4U A;  2C3U A;  3CO9 A;  5F0U A;  1NBE B;  5L39 A;  4H54 A;  4HDH A;  2AYM A;  4I56 A;  1JJ2 R;  4G1Q B;  3QQC D;  2W2O P;  2CPJ A;  1IR1 A;  2RKI B;  5HMZ A;  5H9E J;  2PA3 A;  2HAI A;  1PKU A;  3PJ9 A;  1VI7 A;  1M90 T;  4ZVE A;  2AYE A;  2AEF A;  3HZG A;  1NDL A;  4P72 A;  2AZ1 A;  3DLK A;  2JHE A;  4Y2C A;  2DIT A;  1BLU A;  4ZVF A;  3D6H B;  1FD2 A;  1T95 A;  5I3U A;  3DNC A;  4KSE B;  3TVY A;  2YPY A;  4R25 A;  3DOM B;  3KK3 B;  4ZN1 A;  3P96 A;  4WP3 A;  4EWT A;  2ASJ A;  1RAA B;  2MST A;  4JI2 J;  3OJS A;  1S57 A;  2PSZ A;  3GIL A;  1RHK B;  2XCA A;  4NYZ A;  1VQ6 S;  4ED3 A;  4F0H A;  1VQ4 S;  4K4Z A;  1RT4 B;  1KWM A;  3HFV A;  1UEV A;  2CAD A;  1T3N A;  2AYB A;  1UVI A;  1DTQ B;  4F4K A;  2GMH A;  2Z4P A;  4LR9 A;  3A4T A;  5GAG I;  3NKY A;  1Y11 A;  4I67 A;  1U24 A;  1UA1 A;  3PY8 A;  1EZZ B;  4ZCK A;  2J9D E;  1QE1 A;  3NXZ A;  3MEK A;  1QAI A;  2E1R A;  4I2P B;  2IMO A;  2R7V A;  3FVY A;  4P7V A;  4WKR A;  4DV4 F;  2UUW A;  2V67 A;  1LFW A;  3Q8P B;  1RAF B;  4ZPT R;  3EMT A;  2M7S A;  3M8Q B;  3LGM A;  4W92 B;  5MLC V;  1NEE A;  4CM0 A;  1LEO A;  4DV7 J;  3SYZ A;  5B0E A;  2XO7 A;  1QDU B;  2LQ5 A;  2HFN A;  4FYY B;  2P9E A;  3I9V 9;  4RU2 A;  4KTQ A;  3QSI A;  3DOK B;  1RWO B;  4DSE A;  4DBQ A;  4RW8 B;  1VBK A;  2BE9 B;  3EGV A;  5GAG U;  4QYZ J;  2XYG B;  2QRR A;  3C6U A;  1Q81 T;  4WFY A;  3G4S S;  3J81 Y;  1KRP A;  3MMC B;  4Q5V A;  1YRU A;  3UN2 A;  3T6B A;  3J80 U;  5FDL B;  4X66 J;  5FLX Y;  2KZM A;  4NCG B;  3SEO A;  4D3G A;  3IN5 A;  4IR1 A;  2MSS A;  2DD8 S;  1XMB A;  2YY3 A;  2EEY A;  2W8K A;  1DLO A;  2YX1 A;  1WEY A;  4Q8E A;  4EMD A;  3I31 A;  1VFJ A;  2RIL A;  2ALY B;  3TAP A;  4LF6 J;  4I2Q B;  1JJ4 A;  3QRP A;  2HQ3 A;  3O6Q A;  2CIM A;  3A3P B;  4Y2M A;  1HKA A;  4AXJ A;  2F63 A;  2V8P A;  4M5N A;  2V9W A;  3T5L A;  4G1Q A;  1FES A;  3B54 A;  2RKI A;  4HI1 A;  1VQK S;  1LNQ A;  2NUH A;  1OYD A;  5FII A;  9ATC B;  2R7T A;  1G3O A;  2KYX A;  2KJV A;  3MUV P;  4H4O B;  1WOS A;  5E41 A;  4ZJO A;  2IA0 A;  2XY7 A;  3UNY A;  4IG3 A;  1VQ9 S;  2WW4 A;  4ED5 A;  5FD1 A;  3KK3 A;  1VQN S;  2AP6 A;  2OPP B;  3A3N B;  1KBR A;  4J9Q A;  1IBC B;  3JSB A;  1F1B B;  2JC0 A;  3RAM A;  3FEX B;  1X9S A;  3M9N B;  1GMV A;  2FJE B;  2WB4 A;  4DX6 A;  2FLN A;  3PDN A;  1SB6 A;  1RT4 A;  1G2E A;  1FK9 A;  1P9Q C;  5CHC B;  2DNR A;  3VQS A;  3WHI A;  4G65 A;  3BRE A;  2DK2 A;  4QIG A;  3TO8 A;  1DTQ A;  4M5M A;  4UQT A;  5IT0 A;  2LDY A;  2HVE A;  1RJJ A;  1F5C A;  3CCE S;  3R7N B;  2MKI A;  3EM1 A;  3RBE A;  3H2V E;  4I2P A;  3ICL A;  4WFZ A;  1YK9 A;  1EJ7 L;  3EVM A;  2G2Y A;  1JB0 C;  3HHD A;  2N3L A;  2PA8 D;  2JVO A;  1XN9 A;  1O51 A;  5HRO B;  4DV3 J;  4J7C A;  3EZO A;  3M8Q A;  3DRR B;  2BX6 A;  1HFE L;  1T8E A;  2BW2 A;  5KG2 A;  4JV5 F;  4N76 A;  4KHR A;  2FVS A;  5HMX A;  1HHS A;  1RA6 A;  3IWL A;  8RUC A;  2RDD A;  5EUH A;  1BY9 A;  5IQQ A;  5CD4 H;  3ILI A;  3DRY A;  3S8S A;  1J2V A;  3AD7 C;  4YUD A;  3DOK A;  4S0M A;  1WKL A;  4ZVU B;  2EFO A;  3CCW A;  4J37 A;  4MK8 A;  1SV5 B;  1KQG B;  4GMK A;  2V34 A;  2D3O R;  3C2P A;  4RW8 A;  5B0D A;  2L9N A;  1V6H A;  3HVW A;  2B9W A;  5K9F A;  3P5T L;  4DU7 A;  3SZ2 A;  5D4P A;  1WC0 A;  3M2R B;  2L08 A;  5DLG A;  2GVZ B;  4JV0 A;  3MMC A;  1R0A B;  1S97 A;  2CAJ A;  2I1R A;  2QA1 A;  2BOP A;  1JXE A;  2OML A;  1XMO F;  3LPE A;  5FDL A;  2G0J A;  4LRB A;  2K3K A;  4C8Z A;  4PG7 A;  4NCG A;  2F8E X;  1YTY A;  4Y6I A;  2HWH A;  5IQ6 A;  4B17 A;  4WCE Q;  2OSR A;  1RWM B;  4E98 A;  1GMU A;  5B0A A;  4ECZ A;  2V50 A;  2Q43 A;  3OR2 A;  3UD5 A;  3HX9 A;  4I2Q A;  4J9M A;  3TJA A;  2GCF A;  3W2W B;  3W5X A;  4BC9 A;  4ECV A;  2VJU A;  1UA0 A;  2GHP A;  3G96 A;  3D6M B;  3DCA A;  3OTB A;  4KR0 B;  4OLP A;  3OSN A;  2MYF A;  2K7K A;  2R9L A;  3TAR A;  1XR6 A;  1FEH A;  4P75 A;  3HLU A;  2CJQ A;  1FO1 A;  4F04 B;  1HL6 A;  4X4O A;  2H5E A;  3HFZ B;  3DLB A;  4IH7 A;  3CDW A;  2J8A A;  1RU1 A;  4FF3 A;  1LW0 B;  1SIW B;  3V5R A;  4QU6 A;  5H9F J;  4H4O A;  1R8P A;  1NM2 A;  2B9Y A;  2CDR B;  2NYH A;  4LFC F;  1U26 A;  1Q7Y T;  4KRW A;  4OX6 A;  3UD4 P;  1GFW B;  4OZ2 A;  2DRB A;  1DHM A;  1TVR B;  1XTZ A;  1DUR A;  2CQ4 A;  4FF2 A;  3ZTR A;  4JI5 J;  1VIS A;  4MH8 A;  3ZNJ 1;  2FLL A;  2OPP A;  1SL0 A;  1HNX J;  2MZQ A;  5IXU A;  2LU2 A;  1X4D A;  5E3P A;  3G87 A;  5EHH A;  4MT1 A;  3KUE A;  2YKO A;  2DNO A;  3LH2 S;  1WUU A;  1HWK A;  5KG6 A;  4K50 A;  5F0W A;  1VRQ C;  4H4K C;  3TZY A;  3A8K A;  3MHY A;  4ENO A;  3CJR A;  2J7U A;  5DJB A;  2VBZ A;  3VAG A;  1PO6 A;  3N6M A;  1NXI A;  1X9M A;  4HHJ A;  1YJV A;  4CT9 A;  4Q44 A;  3D7S B;  3C16 B;  1I3O B;  1HMV B;  2IDL A;  4FBU A;  1HNI B;  2OFG X;  3H2U B;  5B0G A;  3K57 A;  2B43 A;  5HRO A;  2CPZ A;  3PHT A;  3BSA A;  3DRR A;  3PNI A;  5K8N A;  2WCX A;  4LIR A;  3RUB L;  2I2Y A;  2PN6 A;  1UWA A;  3DM2 B;  4OZ0 A;  2Q6C A;  2HYI B;  2WZ1 A;  5B0F A;  3VTI A;  4J9U E;  4AL5 A;  3CDE A;  1S9G B;  3D1H A;  5LMU J;  5B7W A;  3K5O A;  2P9G A;  4CH1 A;  4DL2 A;  1UJ6 A;  4CO5 A;  4ETZ A;  4UOC A;  3OL6 A;  5D8H B;  1URN A;  1X4A A;  2Z8Q A;  1SV5 A;  3K89 A;  1NK8 A;  4PAB A;  3GYX B;  4A8X A;  4C98 A;  3RRG A;  3M2R A;  2C3Y A;  2QA4 S;  2R2S A;  3IR7 B;  2I5J B;  2GVZ A;  1R0A A;  2E9T A;  1YHQ S;  5HAT A;  3UI3 A;  3TI0 A;  2GIF A;  3SV4 A;  5A2Q U;  3RW6 A;  2FGC A;  3DDK A;  4A8K A;  2VG5 B;  2BUN A;  3BZQ A;  4MFB B;  2W8L A;  2QLW A;  2UVR A;  1IBM J;  3NRB A;  4ZHR B;  2NQP A;  2QL7 B;  3W2W A;  3ULH A;  4LR7 A;  4B08 A;  4YHH J;  5F9L A;  4IQX A;  3VAH A;  1VYA A;  3ISN C;  1EQM A;  4PXE A;  5ETP A;  3R97 A;  4G3I A;  5IWA F;  3VGU A;  3HKW A;  4NLG A;  1BC6 A;  4JI2 F;  5CYM A;  1SJR A;  3T5K A;  3J7A 1;  1LW0 A;  1N32 F;  1XK8 A;  3L7U A;  4DV5 J;  1CG2 A;  1H73 A;  1U2R A;  5E3Q A;  4RWW A;  4K4Y A;  3I5B A;  3WX8 A;  4NLV A;  3GSD A;  1K0T A;  4L73 A;  1VHI A;  1TVR A;  3QGP A;  3T1Y F;  5I3P A;  2IHR 1;  5KT6 A;  4RNM A;  2LQB A;  5CD4 A;  4RL1 A;  1D9D A;  4KGV B;  1FVQ A;  2C42 A;  2YNI B;  4TU7 A;  2I0X A;  3CCR S;  4Y2K A;  1MG7 A;  4IDK B;  2P9C A;  3SCL E;  4DMZ A;  2XY6 A;  4JI7 F;  1MLA A;  1VRU B;  2EFN A;  1RAD B;  4UOH A;  3T19 A;  3CDU A;  2PI4 A;  1T9T A;  1WTB A;  1ZZF A;  1TFY A;  3BSC A;  3KHH A;  4DV7 F;  1NSP A;  3FRZ A;  2QLJ B;  1FFS B;  3KJF B;  4YB1 P;  2AEJ A;  1ZM3 A;  4J9S A;  3BBF A;  3C16 A;  3NEK A;  1HMV A;  2DHH A;  3LOU A;  1JNR B;  1U0H B;  2CZ4 A;  3OLA A;  2HHU A;  3BJY A;  2D41 A;  3R27 A;  4ECU A;  2XZD B;  1NDK A;  4JOU A;  4ECY A;  1RLD A;  3V6J A;  2VG6 B;  1FEE A;  3EJM A;  1SL1 A;  2WSC C;  3H90 A;  2J0Q D;  4K5S A;  3THV A;  3DM2 A;  2R7R A;  1ZTT A;  2XTJ P;  3AD9 C;  4H4K A;  4LBI A;  1S9G A;  3G6E S;  1WF1 A;  5L1L A;  5HSP A;  1YIT S;  2BQ3 A;  1QAX A;  5F8G A;  4LFB J;  4ZLP A;  1QJH A;  5GAD I;  1KSP A;  1HWU A;  2XMT A;  4ELU A;  2GIQ A;  1PJ7 A;  2R2R A;  5K5M A;  4QWC A;  1S6O A;  1T9X A;  3FK4 A;  4WXW A;  4TY9 A;  1XMQ F;  1N36 J;  2I5J A;  4KV8 B;  3VGT A;  3EYZ A;  4Y34 A;  1FDB A;  1WC6 A;  2YWK A;  2ZVS A;  4A47 A;  2FVQ A;  4I69 A;  5GMK a;  4MIA A;  4GO5 X;  5KAK A;  2PC6 A;  2CPI A;  3F73 A;  4Y2I A;  3PKY A;  5I3Q A;  2CXE A;  1DAX A;  2VG5 A;  2CQG A;  4MFB A;  4UUX A;  1S9F A;  3GIR A;  4B3T J;  2QL5 B;  1VC0 A;  4ZHR A;  3JTN A;  3CME S;  4DL5 A;  1RTH A;  4PQU B;  3BKF A;  5LSR A;  1NK0 A;  3MAA B;  1TUV A;  4OYA A;  3L95 X;  5IOL A;  2HSE B;  3KHL A;  1DRZ A;  2ZJP Q;  5GAD U;  3K5N A;  3A13 A;  3W5Y A;  4ZIW A;  3ZZT A;  2JEF A;  3E2E A;  1NZA A;  2AV5 A;  3KG1 A;  4B9S A;  2CG4 A;  2B6A B;  1U8S A;  1C1C B;  3NAI A;  2L9W A;  2HAF A;  4WK1 A;  1B64 A;  2DNY A;  2F65 A;  3IBW A;  1RYS A;  4O4G B;  4IOC Q;  2PMZ D;  4ZDN A;  1WSV A;  4ETX A;  1KON A;  2GS8 A;  3EPI A;  1HWL A;  4XPE A;  3QGI A;  3KLF B;  1UFL A;  3V81 B;  1TP7 A;  3K0J A;  3LQV A;  5DDO C;  3MD3 A;  5HN0 A;  2IC3 B;  2ZH3 A;  3G6Y A;  2YNI A;  4OJ3 A;  1RAG B;  3O5T B;  5F8N A;  5A6W A;  1RU2 A;  3GTY X;  1WOP A;  3NCR A;  2ZJQ Q;  2APO A;  4F26 A;  5HL7 Q;  3KDO A;  4DV3 F;  2BZ2 A;  5HVG A;  5J1E B;  4UZB A;  2WW8 A;  2VA3 A;  1VRU A;  4GC7 A;  4DLG A;  2KTQ A;  1NLK L;  1TFW A;  4EBD A;  2QA4 G;  3HFK A;  2KB2 A;  4UZC A;  1XNR F;  3H59 A;  1P8G A;  4J9P A;  2IM0 A;  2AF6 A;  3JYT B;  5KFT A;  2YWW A;  2CPX A;  2Y0B B;  4OYZ A;  2CNN B;  1NDC A;  2GJI A;  1U0H A;  3SV3 A;  3MZI A;  2RQM A;  3VGV A;  2EXU A;  2OPR B;  2FZC B;  2RUG A;  3GSI A;  1REG X;  4V1A k;  1N5T A;  3JSM B;  2VG6 A;  2QE5 A;  1BHN A;  3BGR B;  4ZN3 A;  3I82 A;  1NRK A;  2PEB A;  1X4H A;  1H98 A;  2CA9 A;  2GQC A;  3FEY B;  3FKB A;  1OO0 B;  3VGS A;  3B6B A;  1UVM A;  3EZ5 A;  4LF4 J;  2ZH8 A;  4WZM A;  3Q0A A;  1HD0 A;  3FMB A;  1NKC A;  3PEH A;  2CQ0 A;  1DY3 A;  2FVC A;  4KGM A;  3AXM A;  5DM7 Q;  2FZG B;  1K0V A;  1N4L A;  1HIY A;  3QWU A;  4CM2 A;  5B09 A;  4TQR A;  4C9D A;  4I6W A;  1VC6 A;  2W9A A;  1YJU A;  4PWU A;  4KV8 A;  3MWB A;  2CKW A;  1U0S A;  3GJT B;  2HHS A;  2BDP A;  4CP5 A;  1RTZ A;  2FQQ B;  2J7K A;  3QT8 A;  1BWE A;  4A4J A;  4L3N A;  2VBY A;  1R89 A;  1OWX A;  3ELH A;  3JQJ A;  4U9R A;  4PPD A;  2B7C B;  2R7O A;  4OV1 A;  2VKR A;  4C6A A;  9RUB A;  4E0D A;  2I38 A;  3TZW A;  3D6F B;  1VCT A;  4WFA Q;  5KFU A;  2OPS B;  1LXN A;  2IM1 A;  4PQU A;  5M2P A;  2NLW A;  4XTT A;  3MAA A;  2MZJ A;  5KFQ A;  4JI0 J;  2RQ4 A;  3FDS A;  3BYR A;  2W1B A;  4JI5 F;  1WHX A;  1XBW A;  1WDD A;  1HNX F;  5B0B A;  1IM4 A;  4M5G A;  4J91 A;  3B8H A;  1SKW A;  3HM9 A;  2B6A A;  3CT9 A;  2RU9 A;  1IJE B;  1C1C A;  2JJ4 D;  1KFD A;  2UXD J;  3C8Y A;  1S6U A;  5KFM A;  2ROG A;  5L8R C;  4O4G A;  4LFA J;  2QG9 B;  3V6H A;  2O3D A;  3MMJ A;  4CNY A;  3BO2 A;  2OLW A;  2HBY B;  1F0X A;  4C8Y A;  3KLF A;  3V81 A;  4O4R A;  3RG6 A;  2IC3 A;  2E44 A;  5JJB A;  3VCD A;  1TMM A;  3MPD A;  1VGY A;  4M5D B;  2VG7 B;  2QLX A;  4G6V B;  4N47 A;  5J1E A;  4DN0 A;  4NLQ A;  3Q8R B;  2V4J B;  4CH0 S;  1HNW J;  3WBZ A;  3G8Q A;  1O5J A;  3PXG a;  2OP5 A;  3W66 A;  3UPF A;  3JYT A;  5LMU F;  3OJU A;  4DX5 A;  3SCJ E;  1FF2 A;  2EFG A;  5AXN A;  3AA9 A;  3H25 A;  1NHV A;  5F3T A;  1VRT B;  3ONQ A;  2OPR A;  2KO1 A;  1LXJ A;  3FEZ A;  4KYZ A;  1XQI A;  5LXY A;  3HVR A;  3NWR A;  2XG8 A;  3PV8 A;  3JSM A;  3DMJ B;  1MWQ A;  2MLZ A;  5M2R A;  3P45 B;  2R8K A;  2XYP B;  4J9V A;  2GVD B;  5KOW A;  3AAW B;  4OYM A;  2V5H G;  6FDR A;  1T7P A;  1J5O B;  2GGP A;  3R6G B;  1NME B;  4DDF A;  2DPJ A;  4PG4 A;  5F9N A;  4ZP6 A;  3GFZ A;  3P49 B;  2QLF B;  2BM1 A;  4NPO A;  3ZZR A;  1ZYQ A;  5E3C A;  2DCL A;  4KKO B;  1NDP A;  4RUB A;  2V94 A;  4YHH F;  3OTO J;  2SXL A;  1U1Q A;  1G6B A;  1NCL A;  2VD3 A;  3Q8S B;  1CEZ A;  1KKH A;  1S9E B;  1HI0 P;  4LSL B;  4C8N A;  2R7W A;  2E9R X;  1Q5Y A;  5IFM A;  2O01 C;  3UWT A;  3D9B A;  1IQZ A;  4C8M A;  4B3O B;  2POK A;  3CWJ A;  2VDH A;  3ZZY A;  1S0M A;  2KDO A;  4N8N A;  2R3V A;  3O3L A;  4QIE A;  1WKJ A;  2OHD A;  2W24 A;  1GX5 A;  5IT4 A;  3L3C A;  2WHO A;  3ZTS A;  1VDH A;  5AXM A;  4P7T A;  3O2I A;  2NXJ A;  3HD2 A;  3CCT A;  2RSQ A;  5KFZ A;  3TWZ A;  1N52 B;  1RT7 B;  4JYA F;  4C0H A;  2I6W A;  4R0J A;  1D8Y A;  3M2U B;  2ILY A;  3NCQ A;  1EET B;  4X4S A;  2ZD1 B;  1AUS L;  3FZ2 A;  3CCU S;  2OTL S;  3AQP A;  2PII A;  1B7Y B;  4K4V A;  4B02 A;  3ADA C;  2N4D A;  4JB8 B;  4NLP A;  1FDA A;  4X64 J;  4IOA Q;  3W63 A;  1T3O A;  1GQE A;  4WKY A;  4J9L A;  2KZZ A;  1H7X A;  1Q16 B;  3LW5 C;  2JEI A;  4DV1 J;  3DLJ A;  1PG5 B;  2PI5 A;  2ZHO A;  2RRA A;  4M5D A;  2VG7 A;  5GAE I;  2MLY A;  3CCL S;  4QOT A;  2AJ0 A;  2RRN A;  4CNZ A;  4DQP A;  4RZR A;  1GK8 A;  4F4Y A;  2RQC A;  1LK5 A;  2V4J A;  4XO0 A;  4UY8 5;  1TK0 A;  2P6S A;  2F8H A;  4KHM A;  4HHH A;  2XMV A;  4ZP7 A;  1VQ8 S;  1F2G A;  5BJR A;  5KFH A;  1GMW D;  1N0U A;  2RUS A;  4GVL A;  4NML A;  2KG0 A;  4OZL A;  3DYA B;  1SUQ B;  4K2X A;  4ZJQ A;  3TEG A;  1QAY A;  1YVF A;  1VRT A;  2UP1 A;  4DX8 H;  2L48 A;  1AXQ A;  4LRD A;  3RB0 A;  3DMJ A;  1IWG A;  4BWM A;  3IC1 A;  4WP9 A;  5E3A A;  1N36 F;  2GVD A;  3NGD A;  2W2M P;  3BSN A;  3TA0 A;  3IGN A;  4QW8 A;  1M5P C;  3L7O A;  3KOA A;  3DLG B;  1J5O A;  4ID5 B;  4EI2 A;  4I7F B;  4ERD A;  5GAE U;  2HRY A;  3M9O B;  1VQ7 S;  5HQL A;  3GE9 A;  2FDN A;  4USH A;  5B08 A;  5KT5 A;  3W62 A;  1LKZ A;  1RYR A;  1Q1K A;  4KKO A;  4DL3 A;  4NYO A;  4ZKA A;  4AUK A;  1RWW B;  2BAB A;  4ATN A;  2RRB A;  1FDD A;  3MAQ A;  1KVI A;  5KFP A;  4FNH A;  2C22 A;  4OZ3 A;  1S9E A;  3RAX A;  2B4P A;  2Q3P A;  3ENW A;  2KI2 A;  4LSL A;  2DNG A;  4DUY J;  3RBZ A;  1L3S A;  3ZO7 A;  2AJF E;  3SSS A;  2DNQ A;  1V3S A;  4USI A;  3EDR B;  3LP0 A;  3FQL A;  3BH7 B;  4M8L A;  3Q23 A;  5CYJ A;  1REV B;  3PAC A;  4FF4 A;  2B8Q A;  2G9O A;  1WOO A;  2CQ2 A;  2KXN B;  2OEL A;  3H5Y A;  1XEZ A;  4GC6 A;  1S12 A;  1KTV A;  1LWX A;  3QZ7 A;  3BYP A;  1JLG B;  1VIO A;  3D2W A;  2HFV A;  3NG8 A;  2QGF B;  2LEP A;  2CJA A;  1FD8 A;  1WC5 A;  3P5B P;  1RT7 A;  2BAC A;  3R5A A;  4P2M A;  2K3I A;  5L9N A;  3M2U A;  2RU3 A;  1EET A;  2XS7 A;  2ZD1 A;  2A18 A;  3OTE A;  2VL1 A;  1U1M A;  2LMI A;  2ZH7 A;  2J6S A;  2JFK A;  1FDN A;  2BKP A;  3KUG A;  4DFK A;  1Z1Z A;  5KFA A;  3M8P B;  1RKJ A;  5J2Q B;  2B8P A;  1SVD A;  3RB6 A;  1YJW S;  4QIV A;  2OIH A;  3THP A;  3TOQ A;  2F8M A;  1YX2 A;  3M30 B;  4WYW A;  4NZ7 A;  2UUT A;  4P9S A;  2DGS A;  2XUL A;  5H9E K;  3HJV A;  3HUL A;  2P5V A;  1NJI T;  5CZV A;  3A8I A;  5EX3 A;  3HMJ G;  4ECQ A;  3BO4 A;  2DHS A;  3UE2 A;  3W64 A;  2HUR A;  4ZVS B;  2BKO A;  3LAL A;  4DL7 A;  4PYD A;  3HSJ A;  1FKA F;  4DCO B;  1ZH5 A;  4NL5 A;  3RRK A;  3QSY B;  4KPC A;  5JVH Q;  3MR3 A;  1I94 J;  1KEK A;  1CJU B;  3RTV A;  4LF4 F;  1W26 A;  3T41 A;  1WHV A;  4ELT A;  5J1P A;  3OUY B;  4RUH A;  1L3T A;  4IH5 A;  4A8Q A;  1UEK A;  3M6U A;  1ITP A;  3DYA A;  1SUQ A;  4IFY B;  1WC3 A;  3KG4 A;  2FVP A;  3CGI A;  1RAE B;  3KJN B;  4K4S A;  2QZ8 A;  5E33 A;  1YBA A;  1Q0N A;  2IIH A;  5A76 A;  4EEY A;  3U7J A;  2J6T A;  3PIO Q;  1QY7 A;  1I51 B;  3TUP A;  3N6N A;  4NE9 C;  2IY5 B;  2VF3 A;  3ZTQ A;  3H4D A;  4CLW A;  1ZM4 A;  3RR7 A;  3DLG A;  4QCL A;  4I7F A;  2Z58 B;  2UXB F;  3EXY A;  3TW0 A;  4YY3 F;  1RSC A;  3GV7 B;  4ZA1 A;  2DVI A;  2ZH4 A;  1C4A A;  3BR9 A;  3THT A;  5CXT A;  4KY3 A;  2M0G B;  4U7U D;  2MQL A;  3EGZ A;  1ROF A;  4MK7 A;  1NPK A;  2HVH A;  2FHJ D;  2N3O A;  4JI0 F;  1YZ6 A;  5LSO A;  3RYL A;  3FSI A;  1TAU A;  2VFS A;  2DNH A;  4J9K A;  4CIO A;  5BXI A;  3RJM B;  4LRA A;  2VIH A;  3BGO P;  2UXD F;  5T14 A;  1FT8 A;  1UFK A;  2VV5 A;  3SQO P;  4OX9 F;  4RW7 B;  1UP1 A;  1REV A;  3ILJ A;  4JI8 F;  4QYZ K;  2DR5 A;  2HFZ A;  1B70 B;  2BQU A;  1LW2 B;  1NKE A;  2JWN A;  2QTW A;  3GIK A;  1JLG A;  5D0R A;  1HI8 A;  4ER8 A;  5A8R B;  5IV3 A;  4A46 A;  4YB5 A;  3P3D A;  4DJB A;  4L3K A;  4Y0F A;  3V4I B;  2E1P A;  1XR5 A;  1UWB B;  2WRM A;  5HAN A;  2HS0 A;  1PC4 A;  4K0K J;  2AHO B;  3MM5 B;  2GIR A;  4I4B A;  2KVQ E;  3Q2S C;  4JI4 F;  1VBY A;  2RT3 A;  2MHN A;  2E66 A;  2HG4 A;  3C19 A;  1VQP S;  2CQ1 A;  2CWK A;  3M8P A;  5J2Q A;  2F7V A;  4Z7Y A;  2UVV A;  3MEC A;  2BEF A;  5THW A;  2OEJ A;  3M30 A;  2VPZ B;  1WEX A;  4P73 A;  1PBA A;  2DIV A;  2R8I A;  3D1O A;  4DUZ J;  3ZTO A;  2DGT A;  3W1Y C;  4Z7C A;  2G2O A;  2FJB B;  3SDE B;  2X51 A;  3HSG A;  2W2Q P;  4DFP A;  4KAI A;  2FC9 A;  1V3R A;  4QW9 A;  2RML A;  4X4R A;  3K2Y A;  1C0T B;  1CJU A;  1U09 A;  1W7W A;  3U1L A;  1VQ5 S;  3KLI B;  3T1A A;  3OUY A;  3P8B B;  2LXU A;  2BW7 A;  2VFV A;  3HHL D;  4IRC A;  4M1K A;  4IFY A;  1N5Y B;  4OHV A;  3KTQ A;  3R5G A;  1S0V A;  3ENV A;  3MR7 A;  1R27 B;  2JEJ A;  4B9L A;  4LF2 A;  2Y1I A;  3CJ0 A;  4F7V A;  1OJ4 A;  1ELO A;  1KNZ A;  4AYB D;  3OTO F;  4FYW B;  4HTI A;  3RBX A;  3M8W A;  3FQK A;  1FWP A;  2B4V A;  4OYO A;  4WU3 A;  4FS1 A;  4X4U A;  2ZC3 A;  2JVR A;  1QSS A;  1TKT B;  1VOM A;  4DF4 A;  3M32 B;  5ADZ A;  4RO0 A;  1DQA A;  2JNJ A;  3M8Z A;  5E0O A;  2AGP A;  3AHP A;  3ZNU A;  1LWE B;  2DGQ A;  4FF1 A;  3IWN C;  1JIH A;  2DGV A;  3DXS X;  2MEW A;  1Q78 A;  2FY8 A;  1S77 D;  3N9U C;  1PYS B;  5CZX A;  4USM A;  4DSJ A;  4CRJ A;  2QSW A;  4ZCI A;  1QAJ A;  1FTR A;  2LQ8 A;  1WI8 A;  5BYQ A;  3Q89 A;  2KKH A;  1U48 A;  4F2S A;  4X65 J;  3KLH A;  1R31 A;  3CD0 A;  3T5H A;  4KIA A;  3KHR A;  2LEB A;  5ETR A;  3D68 A;  1A9N B;  1DQ9 A;  4RW7 A;  1VQO S;  4ED7 A;  1R8C A;  3AB4 B;  3EX7 B;  1Q4R A;  4DR1 J;  2OH2 A;  1H0H B;  3CJT A;  1IKY B;  2R42 A;  1LW2 A;  2UUA F;  3AFG A;  2ZZM A;  2V8G A;  1IXK A;  5A8R A;  2WVF A;  2I8E A;  3UFC X;  3D54 A;  4FYV B;  3V4I A;  1Y5N B;  2VC1 A;  2MTL A;  1UWB A;  3HHN B;  1X60 A;  2BJ8 A;  1KVK A;  1BQN B;  3K7R A;  3MM5 A;  5LT5 A;  2DTJ A;  3RZA A;  3IXQ A;  3UCZ P;  3NNH A;  5GAH I;  3CCQ S;  1KN6 A;  3NGT A;  2E5I A;  2R8J A;  3H5U A;  2DY9 A;  1NJZ A;  2DB1 A;  2YH1 A;  2EG1 A;  4QIF A;  1CC8 A;  1N6Q B;  3VAL A;  1EQ0 A;  4DCP B;  1K1S A;  1TL4 A;  2WVE A;  4J5O A;  2Y1L B;  4I6Y A;  1D3W A;  2C3O A;  4HL9 A;  1H6K X;  3SDE A;  4ED8 A;  2HHX A;  3H40 A;  5E5N A;  4LF1 A;  1Q82 T;  5DQH A;  2F9J A;  3BQ0 A;  4XAK A;  5HAO A;  5D15 A;  1C0T A;  4QWE A;  4BC7 A;  1UAW A;  3KLI A;  5T7L B;  4GVB B;  5CAB A;  4JI6 J;  1N5Y A;  4O44 B;  4DPU A;  5L46 A;  2KHC A;  1LK7 A;  1B7F A;  3KNA A;  4URQ U;  5GAH U;  2B56 A;  1TEL A;  1T94 A;  2W4C A;  3EVW A;  4P2S A;  3UD3 P;  2HFS A;  4WII A;  3BGL A;  3V6D B;  3GLJ A;  4I68 A;  4Z37 A;  4DUT A;  2WSF C;  4IQM A;  3OVB A;  3WDO A;  4CQ1 A;  5KFE A;  4GO7 X;  1TKT A;  4QPX A;  2MMY A;  5T41 A;  4DUY F;  3M32 A;  1CJV B;  1S1U B;  5BYS A;  2XMK A;  1R7I A;  2OD4 A;  3AOC A;  1LWE A;  2BJ9 A;  2JX2 A;  2P6T A;  3K59 A;  2XMW A;  1TL5 A;  4MMO A;  4L75 A;  1KQF B;  3PYD A;  2DNP A;  5ETN A;  1TQL A;  1YJ7 A;  2HHQ A;  1S72 S;  4HAC B;  2Y9H A;  2J0X A;  3DN9 A;  2FB0 A;  2CUY A;  1RAJ A;  2DHA A;  2AJQ A;  4OHZ A;  3BKT A;  3CB4 A;  1A0O B;  2MGZ B;  2M5Y A;  2Y1J A;  3KMQ A;  4IRD A;  2YKA A;  3CJQ A;  5ETK A;  4OHY A;  2EFQ A;  1X7V A;  2KG1 A;  2FHM A;  3MOJ B;  2IJN A;  3CC2 S;  1BQX A;  3GIJ A;  1APS A;  2EKY A;  4DSK A;  3NS5 A;  1U1L A;  1C0U B;  3R3T A;  3S1T A;  4LFC J;  2BVZ A;  4RW4 B;  2D3U A;  2XWY A;  1JWW A;  4ECR A;  2HK3 A;  3M2V B;  1IKY A;  2JLG A;  3OXF A;  3R5B A;  3GQC A;  4DL4 A;  1Y7P A;  1IBK J;  3BQ2 A;  1PJ6 A;  1GX6 A;  1PCA A;  2NXU A;  3Q86 A;  5HJY A;  2PGC A;  3HT0 A;  3NS7 B;  1GXU A;  2KYZ A;  3CO0 P;  1BQN A;  4CT8 A;  4GKK J;  1KDN A;  3AD8 C;  1H2T Z;  2UXC J;  2XS2 A;  4ICL B;  2G1D A;  1AW0 A;  4NLU A;  2W4P A;  4DSF A;  2FPH X;  1CLF A;  1UVJ A;  1T11 A;  2V68 A;  3HI9 A;  5F3Z A;  1PIL A;  3W60 A;  4USJ C;  4EBE A;  1N6Q A;  3TYT A;  3KUH A;  4O0I A;  8ATC B;  5D4O A;  5KFV A;  1NK7 A;  1WDT A;  5CCM A;  3M9M B;  4A8M P;  4K4U A;  5HQ8 A;  2IA6 A;  1U6F A;  3M4X A;  3WIV A;  4OHW A;  2DO4 A;  2QV6 A;  2A2D A;  4XPC A;  2E7V A;  4K4W A;  4OLO A;  2YXL A;  1OPZ A;  4A8S A;  4Q7A A;  4FN5 A;  3LPY A;  5T7L A;  2DIU A;  4RBT A;  1DQ8 A;  3BPS P;  4DS4 A;  3LP2 B;  2HNY B;  4DWI A;  3OLB A;  4MIW A;  4AT1 B;  2DR7 A;  3HCX A;  1FWK A;  1VLO A;  2IVY A;  4Q45 A;  5KFC A;  3RB4 A;  4BDP A;  5L1I A;  3RR8 A;  1M1H A;  3CUL A;  3TAQ A;  1BQM B;  5DG7 A;  1IKX B;  3TQE A;  3V6D A;  2GAH C;  2DNN A;  1RAI B;  2HQI A;  1AA1 B;  1FRX A;  1NZ8 A;  4PR6 A;  4MK9 A;  4N41 A;  1Q8I A;  1HHT P;  2QJ3 A;  3PRV A;  1FX4 A;  1CJV A;  1S1U A;  1UFW A;  3RW7 A;  2YNH B;  2KU7 A;  2XS5 A;  2J76 E;  4Q2M A;  2DNZ A;  4JV1 A;  3VZH A;  5IT9 Y;  4HAC A;  5AE3 A;  1HYS B;  3TNV A;  3BKU A;  3K8V A;  2CQH A;  2CNK B;  2FZK B;  4LRE A;  1ZBT A;  3PYF A;  4IG0 B;  5IWA J;  1TKX B;  3GJQ B;  3H20 A;  2RB7 A;  3K17 A;  2MGZ A;  2DHX A;  2H54 B;  2H51 B;  4OI4 A;  1S0N A;  3OHA A;  4QWB A;  2J9E A;  3UO0 A;  1ZM9 A;  2E5J A;  2DT9 A;  4F25 A;  1R8A A;  3QJP A;  1N32 J;  4YR2 A;  2MZ1 A;  1X4E A;  2VFU A;  1H2U X;  4ZCL A;  4K0K F;  1ICE B;  2DNK A;  1C0U A;  1KOO A;  3NLC A;  3MTK A;  3EVO A;  1HR0 J;  3M2V A;  4HT7 A;  2HMI B;  2VFR A;  3HF5 A;  1RHR B;  1NH7 A;  3F44 A;  3TX8 A;  3T1Y J;  1NK5 A;  2B51 A;  1R43 A;  1X5P A;  1ACM B;  2ZNZ A;  1NSA A;  5AXL A;  4DUZ F;  4HH1 A;  1UW4 A;  1FKO B;  1ZTW A;  2ZH6 A;  4CI0 B;  5E7O B;  2QT7 A;  4WF9 Q;  3CD5 A;  2NRE A;  4ELV A;  3BEG B;  2V4R A;  4JI7 J;  1JLF B;  1B99 A;  1RHU B;  5LJ5 Y;  1UW9 A;  3A8J A;  3L7P A;  3NGS A;  2ZH9 A;  3CJ2 A;  5F8H A;  4IOB A;  1VQY A;  4ICL A;  2ALZ A;  3K5P A;  2MQM A;  4M63 A;  4ZOS A;  3BH6 B;  3D28 A;  2Z57 B;  2ACY A;  4BLG A;  1D8Z A;  3CJ3 A;  3KJQ B;  4A8O A;  1ZZN A;  4KFB B;  4NLD A;  1QVG R;  1U1R A;  1S0O A;  1YRX A;  4FPI A;  1QSL A;  2MQO A;  2MDA A;  2Q66 A;  3X1L B;  3DHW C;  1Q95 G;  4HT5 A;  1G1X A;  3FSY A;  3Q83 A;  3Q8V A;  1B4S A;  1UCN A;  4AQY F;  1NK9 A;  2H4Y B;  4Y2A A;  2CG8 A;  2LKZ A;  3D1Q A;  5KFS A;  3LP2 A;  1FJE B;  1AUD A;  2HNY A;  4AD6 A;  3BS9 A;  3AOB A;  1RAH B;  1RE1 B;  3K5M A;  2EPI A;  5AT1 B;  3SCI E;  2RD5 C;  1H3D A;  1WG1 A;  4QR0 A;  1XMQ J;  2C2O B;  1Q79 A;  2XSF A;  2QYG A;  2D69 A;  2YNG B;  3NOG A;  2DNM A;  2XCP A;  5DDR C;  2FJV A;  2DGU A;  1BQM A;  5DGA A;  5KFG A;  4FXV A;  1IKX A;  1DZ5 A;  2DKO B;  3ISZ A;  1QLN A;  4X65 F;  1UJ4 A;  1RK8 A;  3EGN A;  2V2K A;  2ABY A;  1VK8 A;  2YNH A;  3BDP A;  2ZJR Q;  3VAJ A;  1KLM B;  2C1E B;  3MCO A;  3KK2 B;  1FJ7 A;  3Q2T C;  2NCK L;  1HYS A;  2XZW A;  1NO8 A;  2QMW A;  2XHW A;  4TKT A;  4DR1 F;  1SC6 A;  2AMC B;  4IG0 A;  2GA7 A;  1TKX A;  3HKZ D;  3DOM A;  3FRY A;  1YGY A;  4OYW A;  2ZOM A;  1CSJ A;  1UZD A;  1EAR A;  2EVZ A;  2IRY A;  3J7Z T;  2R2U A;  3OVS A;  3DRX A;  4U7C A;  3FNN A;  3UN5 A;  2X1G A;  1RTJ B;  2P8I A;  4YR3 A;  2YQ1 A;  4CYU B;  2A3J A;  4X4V A;  5EWF A;  3R2C J;  3DLH A;  3PCO B;  2GQ2 A;  1WF2 A;  2EWH A;  1WAC A;  2M70 A;  1M1K T;  2HMI A;  2RQK A;  2HQD A;  2W01 A;  3CIM A;  3EZU A;  1SJ4 P;  2XYH B;  3G9C A;  2MZT A;  3N5B A;  2V2V A;  1V5V A;  2X3G A;  2LCW A;  1B3T A;  1FKO A;  1ZOT A;  1YG0 A;  2B3T B;  2JSX A;  2BJD A;  3TUI C;  1MWZ A;  1UEU A;  2N82 B;  3H42 A;  1JLF A;  3W8P A;  2FY1 A;  5KFY A;  3QRR A;  2IVF B;  1YSJ A;  5KFK A;  2ZBP A;  3P4U B;  5AJ3 J;  2Q1L A;  2VH7 A;  2NSC A;  4QBU A;  5HO4 A;  2WAQ D;  4OI3 A;  7AT1 B;  4WFX A;  4WBF A;  1XNR J;  1MWY A;  3HXM A;  1HW8 A;  2KFY A;  4BCA A;  1QVF R;  1KD1 T;  3MGJ A;  4FYD A;  4KFB A;  3GG1 A;  3CPW R;  1S1V B;  2XNR A;  4JI6 F;  1YBU A;  4U8Y A;  2E1M C;  1N5V A;  1YWX A;  2MY8 A;  2WBR A;  4K8R A;  4QR1 A;  4OYB A;  2OUG A;  4HVZ A;  1NPR A;  3HHL C;  3OFE A;  5J2P B;  4KGX B;  1L3V A;  3QJL A;  1P1L A;  4LR8 A;  1TKZ B;  3GV8 B;  3G6V A;  5E3R A;  2CQI A;  3BGU A;  4NLS A;  2HQF A;  1GNK A;  3OL7 A;  4LMZ A;  2VOP A;  4RX6 A;  3K8W A;  4OFZ A;  3JTP A;  4O3P A;  1CJK B;  4EUV A;  4HLB A;  2KHD A;  1WJ9 A;  5ETM A;  4ILR A;  1CJT B;  2EI5 A;  3ZFV A;  3VAF A;  1FFG B;  2Y0S D;  2ASD A;  2VKZ G;  1MU2 B;  5HVH A;  1OMS A;  2YNG A;  2YH0 A;  2M8H A;  1V3Z A;  4ED4 A;  2HPU A;  5J1N A;  3RGI A;  3IR5 B;  2DR9 A;  3HHL B;  3VVT A;  2ATL A;  5DET A;  1CBK A;  4C0O C;  5A8K B;  1D1U A;  3O1L A;  4UQG A;  5DQG A;  1ZA1 B;  2DH9 A;  2AGO A;  2CVE A;  3VAK A;  1KLM A;  2W25 A;  3KK2 A;  2YWF A;  5K20 B;  3RBD A;  1Q7L B;  3CJ4 A;  3J80 Y;  2HHT A;  3DXB A;  2AX1 A;  2ADB A;  1HLW A;  1IM6 A;  1KS2 A;  2UV8 G;  2HBZ B;  4Q2L A;  2GML A;  3OL8 A;  4X62 F;  1IBK F;  4DL0 C;  1FE4 A;  1BXN A;  3U1M A;  1RTJ A;  4QWA A;  4Q8F A;  1BMQ B;  4GKK F;  2OKQ A;  2FHJ A;  5I4M A;  7FD1 A;  4OJG A;  8AT1 B;  2X1B A;  2WB1 D;  2BAN B;  2UXC F;  2FLP A;  1HW9 A;  2O5D A;  1U6B A;  1KR4 A;  3CJ8 A;  2MB0 B;  1GEH A;  4ECT A;  5M2U A;  5DLF A;  3TJ9 A;  2AEM A;  2GHV C;  4F4A A;  1PJ5 A;  2CRL A;  3MF5 A;  4A8W A;  2MKH A;  2CQ3 A;  2IYG A;  4LRC A;  3QNW B;  3OXL A;  3UQS A;  2E9Z A;  3PM9 A;  3IGV A;  1VJQ A;  2AJ4 A;  3D3B J;  4V19 J;  1J27 A;  3NGK A;  3GYN A;  3S7R A;  3GR0 A;  3C3L A;  3PG9 A;  2X7I A;  1FHT A;  2FVR A;  3JSY A;  3TAM B;  1RBA A;  2AKW B;  4NMX A;  1S1V A;  4DFJ A;  4ANE A;  4O3Q A;  4HR2 A;  1LOU A;  3RAQ A;  5MAO A;  3DDI A;  5J2P A;  1G4C A;  3ETM A;  3H98 A;  1TKZ A;  4UF4 A;  4DCJ B;  5KG0 A;  1EIY B;  3CW2 C;  4OJH A;  3I5C A;  1NU4 A;  3CED A;  3F56 A;  4W90 B;  3PVX A;  4DR6 F;  1RHM B;  1D9F A;  1K44 A;  3QO9 B;  3MDF A;  3TVZ A;  1M5K C;  3PW7 A;  1TZ0 A;  4OYI A;  2DCU B;  1CJK A;  2ZZN A;  2LQJ A;  4F3O A;  4Y3C A;  1HBM B;  4ZLN A;  2VFT A;  2GJF A;  3GIM A;  1CJT A;  2MZR A;  5JVG Q;  4LF5 F;  2DPI A;  3MM6 B;  2FD2 A;  1U2F A;  3E3X A;  1N8R T;  1VR6 A;  1XER A;  1MU2 A;  5D77 A;  4ED1 A;  2IFX A;  5IT9 U;  1MNE A;  3IM8 A;  2DJW A;  2ZWP A;  3HHL A;  2X1F A;  1S6P B;  4ZMM A;  2HGL A;  2VDI A;  5KT3 A;  1SXL A;  1YIJ S;  3D4J A;  1H2V Z;  3HK2 A;  1JK9 B;  4WXO A;  4MKA A;  2X1A A;  2F1F A;  1S59 A;  1T9Y A;  2QL9 B;  3ENQ A;  1X4G A;  2OO4 A;  3ENA A;  2L41 A;  2OEM A;  3WQP A;  2AIR B;  1M5V C;  4ZPV R;  1E6Y B;  4RPF A;  6AT1 B;  4EZ6 A;  1HR0 F;  3FJ2 A;  4IO1 A;  1YZ7 A;  3VHQ A;  3DU5 A;  4LF9 J;  2VAS A;  3SBM A;  4JYA J;  4K7Q A;  1AB8 A;  4L74 A;  5IV4 A;  1FXL A;  4QIW D;  3ISN D;  1F6T A;  1KC8 T;  1AFJ A;  2EK1 A;  2H1Y A;  3CJS A;  3CTR A;  5I3U B;  3D66 A;  5G4D A;  1SKS A;  1AT1 B;  2BAN A;  3CDB A;  3KLG B;  1X8D A;  1N56 A;  2DH8 A;  1SCJ B;  2HLT A;  5KFF A;  4Q0B B;  2ZOG A;  3QT6 A;  1P1T A;  3SSQ A;  3IM9 A;  1PBU A;  2N7Y A;  2M3D A;  2HND B;  4O3N A;  1Q8L A;  4DQS A;  1HNI A;  2IJR A;  3Q8U A;  1Y3J A;  4ZIV A;  5K8O A;  2B9X A;  1R3N A;  2J0W A;  1SJ3 P;  2V63 A;  4ZVP B;  2XBP A;  2COL A;  4M5J A;  3BBB A;  2PEH A;  2G1H A;  1MRO B;  4C0B A;  2W9C B;  3TA1 A;  2B4O A;  2F4F A;  5GVQ A;  4EBC A;  1NSK L;  3K5L A;  2J5A A;  3NAH A;  1CVJ A;  4ES3 A;  3J81 U;  3TA2 A;  1FFW B;  2NUU G;  3TAM A;  4CDI A;  4ECS A;  3TP2 A;  2F3J A;  2FHK A;  1DFD A;  1Q5V A;  1X0F A;  5EWG A;  1U25 A;  5FLX U;  1RT6 B;  2JRS A;  1OPI A;  5C42 B;  3SI8 A;  3IA0 A;  1Q8B A;  4R8U B;  2CDQ A;  3QBC A;  3QZ8 A;  1KOH A;  5A8W B;  1F3V A;  3WX4 A;  5HK4 A;  3TVK A;  3QO9 A;  4PRF A;  3MMB B;  5GMD A;  2DGW A;  3BGF A;  2G2Z A;  1JQG A;  4DV0 F;  5J2M B;  1HBM A;  1G7C B;  4ECW A;  2KFN A;  1ZPW X;  4JBC A;  3LWL A;  3GU0 A;  3BQ1 A;  3MM6 A;  2BR0 A;  3C6T B;  3NGU A;  3W61 A;  4LJM A;  2IM2 A;  2RF2 B;  4UOG A;  3MCM A;  3MI7 X;  2XO6 A;  2FYX A;  4JP8 A;  3HSD A;  4IH6 A;  3OQ2 A;  2J6U A;  4TY8 B;  1LQ9 A;  2PFD A;  3I96 A;  1AYE A;  1N5S A;  1OSD A;  2V2Z A;  1JMT A;  3HO1 A;  1YI2 S;  2RHQ B;  3WC2 A;  2QMX A;  3DHX A;  4DPT A;  4WYL A;  2C3P A;  5A2Q Y;  1GT8 A;  2OI2 A;  1FJC A;  1E6Y A;  3FCW A;  4UT4 A;  3CVK A;  5CQG A;  3N5F A;  1YLX A;  2YVS A;  2B5J B;  2DGO A;  4KO0 B;  3TQ1 A;  1F9E B;  4ILL A;  3MMA B;  5HP1 B;  3DOL B;  3EIC A;  5ITH A;  1WF0 A;  2OD6 A;  2XNQ A;  1S76 D;  5C24 B;  4U67 Q;  1CQM A;  4IDK A;  2OTJ S;  1PIE A;  1RQ0 A;  1R6V A;  5L1J A;  4OQJ A;  2LXF A;  2CPD A;  3EWG A;  3TUZ C;  4FDF A;  3AJ1 A;  4IG3 B;  5AJ3 F;  3KLG A;  4NEZ A;  3M7V A;  4Q0B A;  5D3G B;  1KHW A;  1HWJ A;  4B9V A;  1JLQ B;  2BRK A;  3CCZ A;  2HND A;  1KVJ A;  1SJQ A;  4HI2 A;  3S6E A;  1S4F A;  2XHC A;  2VQF F;  3MED B;  1I5O B;  1FK9 B;  3GCW P;  2VON A;  3AT1 B;  4MAK A;  3QGG A;  3GV5 B;  1UMJ A;  2ZNY A;  2NZ4 A;  4MYU A;  2FJX A;  1NAQ A;  1MRO A;  5KG7 A;  2CJ9 A;  4ZVO B;  2W9C A;  2V8D A;  2QEX S;  4MKY A;  2YPZ A;  3R6L B;  3BM7 A;  5F8J A;  3J81 j;  2XI2 A;  4NEY A;  3GON A;  3EXC X;  1FRM A;  2YX4 A;  4LQ3 A;  3G86 A;  2DIS A;  1RT6 A;  2OGU A;  1Z2L A;  4F50 A;  2XC9 A;  3A1Y G;  4NXM F;  2JC1 A;  1FI4 A;  1NJY A;  5C42 A;  1IJF B;  2EBE A;  3PO5 A;  1JKH B;  4R8U A;  1OY6 A;  1X31 C;  2ROP A;  4HYK A;  5A8W A;  4ES1 A;  4N56 A;  2PD1 A;  1HBU B;  3MPY A;  3PW0 A;  3OBI A;  1UTA A;  4PPZ A;  3NWG A;  2V6A A;  3MMB A;  2VPW B;  2UXB J;  1FNX H;  4RNO A;  2CQD A;  4YY3 J;  1JLE B;  3PX0 A;  4ZS6 A;  5J2M A;  3MFI A;  1RWN B;  5DZ7 A;  2HZV A;  2FJD B;  3VAI A;  3FBB A;  4TQS A;  3EGW B;  4KQZ A;  1X4C A;  2CYY A;  2DR6 A;  3C6T A;  3OFH A;  2ZKT A;  4URG A;  1ULR A;  4ZVT B;  3AJ2 A;  1F9F A;  1QD1 A;  1SC1 B;  2RF2 A;  1TR0 A;  2ZM6 J;  2Z0G A;  2Y3Y A;  2FHO B;  4QU7 A;  4A48 A;  2UV8 A;  1HHQ A;  3HJF A;  1YJR A;  4TY8 A;  2VU5 A;  2FLO A;  1W2I A;  2C2Z B;  3BB5 A;  2LP4 A;  2NS1 B;  2MLX A;  2ZDP A;  4HEA 9;  1SH2 A;  3CJK B;  3OR2 B;  2R8G A;  3AJD A;  2DEI A;  3D0G E;  4F67 A;  4OX9 J;  4ED6 A;  2MPU A;  4YN3 B;  1OQ6 A;  4E2F B;  3WIU A;  5HLF B;  3KLV A;  1RAC B;  2ZE2 B;  4JI8 J;  3FC9 A;  2EBG A;  4X4P A;  3DI6 B;  1RI7 A;  2HWI A;  2CFX A;  4C11 B;  2B5J A;  1QUP A;  3KDN A;  3I5A A;  4KO0 A;  3MCS A;  2C2M B;  3MMA A;  5HP1 A;  1N88 A;  2CQC A;  1N5Q A;  3DOL A;  3QID A;  2R7X A;  4ZLL A;  2UVU A;  3QAE A;  5C24 A;  3HHK A;  4CLK A;  3NS6 A;  4TYB A;  3WZ0 A;  4CCH A;  1Y3K A;  4JI4 J;  3QAU A;  4RW9 B;  4J9R A;  2ACM A;  2DGX A;  2BE7 D;  5D3G A;  2YKP A;  1ZAV A;  4AFF A;  1JLQ A;  1SH3 A;  5AE2 A;  1S6Q B;  3MOZ A;  1ZAX A;  3AH6 A;  4EK2 A;  2HZA A;  3N6L A;  4ZVH A;  3G8S A;  5KFX A;  2C2K B;  2AZ3 A;  3MED A;  3PYE A;  5SZT A;  2F40 A;  2LXI A;  2UVW A;  4ECX A;  4YB7 A;  3R9L A;  4YEA A;  2KT2 A;  4NOH A;  3W3S A;  4MKB A;  2GC8 A;  3BGR A;  2E5H A;  1AZS B;  3CMQ A;  2BQR A;  3CDA A;  5CYQ B;  3MEE B;  4C3M A;  2ADC A;  4G1P A;  3QFW A;  3GMG A;  2G0C A;  3MPV A;  4M5H A;  3LUY A;  1IBL F;  3HP6 A;  1U8W A;  1IR0 A;  3FCV A;  2ZUA A;  3W2V B;  4PZV A;  3I9Z A;  3H5S A;  1SIZ A;  4C7Q A;  1JKH A;  2L9D A;  4KC5 A;  4NCB A;  1Y0H A;  4NA2 A;  3M6V A;  4EYI B;  1FWL A;  1Y4Z B;  2HS3 A;  4P10 A;  1HBU A;  5D0E A;  3OD2 A;  4L76 A;  3JS9 A;  3J7A N;  1WHW A;  4YME A;  1RA7 A;  3GYG A;  5E2Q A;  4DZ6 A;  4ZP9 A;  2W7A A;  1YDL A;  1U1N A;  1JLE A;  2ZBQ A;  4DR4 J;  5LOQ A;  3A12 A;  2MQ8 A;  5LL6 d;  3VVU A;  3M1V B;  4DL6 A;  3OT9 A;  4PAA A;  4USU A;  1DTT B;  3GR1 A;  2O66 A;  4DN9 A;  4QJV A;  4TXS A;  5KFJ A;  2OPS A;  3GPA A;  3Q8Y A;  2NPF A;  2QA2 A;  1NB2 A;  4RNH A;  2E7X A;  3EUN A;  3TJ8 A;  2BXJ A;  5CAA A;  2DY1 A;  2MJU A;  4LF9 F;  4B9T A;  3TUJ C;  3MR5 A;  4TU8 A;  1BD6 A;  1S48 A;  3MEG B;  1TL7 B;  2XB2 D;  3M8S A;  3H4B A;  4P6Q A;  2WSE C;  2O67 A;  3CJK A;  2AJ2 A;  3QWP A;  5KFI A;  1HI1 A;  2ZC4 A;  1PAE X;  1FNM A;  3ZZO A;  3IFE A;  1RKI A;  2MQN A;  2MQP A;  2IVM A;  1NUE A;  3SXL A;  3HSZ A;  5HLF A;  3ZTP A;  2ZE2 A;  1VQS A;  5HMY A;  1RXO B;  1WC1 A;  3DI6 A;  2PFF B;  4C11 A;  1OS5 A;  2C3M A;  4EGL A;  5EWE A;  2UUA J;  1S49 A;  3FUY A;  2KRB A;  1L3U A;  3RU0 A;  4PXC A;  1O8B A;  3FGV A;  5CYM B;  3MFH A;  1RTI B;  3B78 A;  2CJB A;  3VZI A;  4NA1 A;  5F8M A;  2W9B B;  2KT3 A;  4C8L A;  1VS3 A;  1ZPV A;  4YQW A;  2A0F B;  4HKQ A;  4K4X A;  3ZZU A;  5K8P A;  1R6Y A;  2ZKU A;  2V9K A;  2YTC A;  2HIY A;  4RW9 A;  3PZP A;  5KFR A;  1VLY A;  2KJW A;  3TAN A;  3L09 A;  4OI2 A;  3H8Y A;  1JX4 A;  5CCL A;  2YKQ A;  1TTH B;  4V19 X;  3G71 S;  1S6Q A;  4W98 A;  4F4W A;  2R4F A;  5KG4 A;  1F9H A;  2FJA B;  2H9Z A;  3VWS A;  3SIP B;  1T9U A;  4TYA A;  3F41 A;  4RUC A;  2VQE J;  2GX8 A;  3PIP Q;  2ZOF A;  2GFF A;  2XI3 A;  4B3R J;  4AL7 A;  1AZS A;  3UW1 A;  4NZ0 A;  5CYQ A;  1FRK A;  2B9E A;  2ZEJ A;  3MEE A;  1NHK L;  2VC0 A;  2UU9 F;  1K8A T;  4CLF A;  2H65 B;  3CD7 A;  4TN2 A;  1F5A A;  1D09 B;  1T9V A;  1FRH A;  2C28 A;  1WI6 A;  1L3K A;  2E1A A;  4CH7 A;  1FTC A;  3IS9 B;  5DS7 A;  1WG5 A;  3PO4 A;  1EKR A;  5K8M A;  1S7I A;  3DGP B;  2HW3 A;  1UVK A;  3W2V A;  3PW4 A;  4JI1 J;  2LLZ A;  3GB0 A;  4UTG A;  3UDE A;  2GW8 A;  4L72 B;  4O3O A;  4YDX A;  2X3D A;  1SC3 B;  1GXT A;  2QMU B;  3N28 A;  3QIP B;  2NPI A;  3CCV S;  3NY0 A;  4ANC A;  2ASY A;  5KTQ A;  2IBO A;  2QFJ A;  1HBO B;  4ZPD A;  2V2Q A;  2EFV A;  4OZN A;  3M1V A;  5EN1 A;  1TMJ A;  1DTT A;  3CF5 Q;  2NXC A;  2XWX A;  4LRF A;  3KMS A;  4NAS A;  4B3O A;  1OY8 A;  3PJX A;  2V4Q A;  5LM7 E;  3L4B C;  1J5E J;  3AOD A;  4YB6 A;  2CQP A;  3L9Z A;  4RU9 A;  4Z2X A;  4XIU A;  2HVI A;  4H4M B;  4B3S J;  1U2C A;  4DU8 A;  3IAS 9;  5LMN J;  1HD1 A;  2WBM A;  1EX8 A;  2EG2 A;  2HVZ A;  4F3Q A;  3MEG A;  1TL7 A;  2RDJ A;  2RH3 A;  2ZBC A;  3IMQ J;  5D4L A;  1VQM S;  1WD6 A;  2HBQ B;  1FKP B;  3KWM A;  1OY9 A;  2DRD A;  3KFW X;  1RTH B;  5D4N A;  4KHP J;  1RWP B;  2BBE A;  1JLA B;  4J9O A;  4X2B A;  4K2J A;  2A6O A;  2VJV A;  2LVW A;  2R7U A;  2A2C A;  2HHH J;  5K14 B;  3UCU P;  4CLP A;  1SH0 A;  2DH7 A;  5AE1 A;  4YR0 A;  1RTI A;  4E8U A;  4P71 A;  5HQM A;  1RT2 B;  2D7S A;  2W9B A;  2G4B A;  1VQL S;  5A0Y B;  2AGQ A;  2LFV A;  3B82 A;  1NND A;  4QQB A;  3VV2 B;  1T0T V;  4DPO A;  1GTE A;  3MR2 A;  3QT5 A;  1VK3 A;  3NGR A;  2XEX A;  3QFH A;  1WNE A;  2XSJ B;  1ZM2 A;  1S99 A;  1OIA A;  2HQC A;  3BPD A;  2HS4 A;  2HHV A;  1YQH A;  1S4E A;  3PRD A;  1TV6 B;  4MTP A;  2C2E A;  1WG4 A;  4ZVG A;  4D3H A;  2V0N A;  2GMJ A;  4KH0 B;  1VC5 A;  2Q79 A;  1OYE A;  2PMW A;  3PJW A;  1B0T A;  1LWC B;  4WWS A;  3DU6 A;  3RB3 A;  4OX7 A;  3K58 A;  2LU1 A;  1RZM A;  5DRK A;  5DM6 Q;  5C2C A;  3MCN A;  4C4W A;  4ID5 A;  1IVZ A;  1BUX A;  1RWX B;  2JLE A;  4CLZ A;  5F8L A;  5CA5 A;  1NPP A;  3ZZ0 A;  2QO3 A;  1R8H A;  3IS9 A;  4DI6 A;  3DGP A;  1URR A;  2VBW A;  2YNF B;  1U45 A;  3EDQ B;  3MPU B;  5D0H A;  5HI7 A;  1B0P A;  4OZJ A;  3MTJ A;  1VBX A;  3OL9 A;  3TR5 A;  3MM9 B;  5G0R B;  3QIP A;  2ZM6 F;  3CCS S;  1YRT A;  4ZLJ A;  5KFD A;  3JTO A;  5F41 A;  1TU0 B;  2ZZT A;  1R8B A;  4WFB Q;  2MQQ A;  2L3M A;  3QAT A;  4X66 F;  3OVA A;  1HBO A;  4UST A;  4KT0 C;  1C2P A;  2H5I B;  4CZC A;  5IZH A;  4OI1 A;  3OTD A;  1RLC L;  1V5I B;  2KN4 A;  2GV1 A;  3BBC A;  4LF6 F;  1LFP A;  1KQK A;  4AE5 A;  5LJ3 Y;  4FBT A;  1BGX T;  2QLB B;  3OW2 R;  2UUB J;  4M95 A;  3T1H J;  1SPB P;  2BE2 B;  4H4M A;  1KP6 A;  1T02 A;  3X3U A;  2A10 A;  2Y8Y A;  2EFP A;  3V6K A;  1FKP A;  3ETO A;  7FDR A;  4L6V 3;  4Y28 C;  3Q24 A;  1JLA A;  3GFX A;  1VIX A;  4ZVR B;  3BO3 A;  1U4B A;  3LP1 B;  3W8G A;  1BWV A;  1WHY A;  5K14 A;  2H5J B;  4YS2 A;  4DPY A;  3VAM A;  2NYI A;  2DR8 A;  2D9P A;  4DS5 A;  4DHV A;  3GZ7 A;  5GME A;  3CD6 S;  1RT2 A;  4BBY A;  1FRI A;  4ID8 A;  2ZBR A;  3UDL A;  4WIQ A;  5A0Y A;  1IKW B;  5BR8 J;  4P52 A;  4USV A;  4X84 A;  5KG1 A;  3I32 A;  5RUB A;  2HRT A;  1ZAW A;  3W9H A;  4C8K A;  2HLU A;  5L38 A;  4EU0 A;  2M4M A;  2XSJ A;  2LEC A;  3CCJ S;  4UOF A;  1QTN B;  3ZC4 A;  1S1X B;  1TV6 A;  4DPW A;  1N33 J;  1GXL A;  3IAM 9;  1IR2 A;  4CO3 A;  4P74 A;  2ZVI A;  2XLI A;  4PG5 A;  1RGV A;  2CWX A;  2J0S D;  3LAK A;  3PW5 A;  1O6X A;  2UZA A;  3R5C A;  3M05 A;  3LGH A;  1Q8K A;  5C7P A;  1LWC A;  3H0P A;  3M6W A;  5I42 B;  2IM3 A;  3TEH B;  3BDE A;  4AQY J;  4KH1 B;  4I6A A;  2CNO B;  3I6P A;  3R8Y A;  2LA4 A;  3PHE A;  1TUW A;  2BJ3 A;  3W65 A;  3I87 A;  3QYY A;  4DR4 F;  3SFU A;  4F36 A;  3V4M A;  2IYI A;  1CPZ A;  4NWB A;  2UUC J;  1NHU A;  2YNF A;  1ZET A;  4WZQ A;  4AL6 A;  4RWX A;  1SQF A;  3DDN A;  3MM9 A;  4DQI A;  1IUJ A;  3JB9 k;  1JLB B;  4IRK A;  5G0R A;  3LAN A;  2H48 B;  2RVJ A;  2GGP B;  3D6T B;  3ILL A;  3PTW A;  1P9Y A;  3PYG A;  4DV6 J;  1HQU B;  4O3R A;  4K4T A;  2PDA A;  2Z2Y B;  4PKD B;  2PT0 A;  4LF8 J;  1UVN A;  2F4V J;  3MM7 B;  5ETL A;  2VUG A;  2IPO B;  1P6T A;  3N0V A;  1P27 B;  1NKB A;  4MYT A;  1TL1 B;  3D3C J;  4XDD A;  2VOO A;  1IKV B;  1HQ2 A;  2NXE A;  5KOX A;  1PC5 A;  3G82 B;  4BWJ A;  2FTR A;  2CJK A;  1QM9 A;  2IAJ B;  2RS2 A;  1UVL A;  3B4D A;  3IP0 A;  1RP5 A;  2BE2 A;  2HFO A;  2GO9 A;  3SQG B;  2DNL A;  4ZPW R;  1NK4 A;  4ALZ A;  3LF0 A;  4FS2 A;  2H4W B;  2ASL A;  1X9W A;  5AXK A;  1FCA A;  2KXF A;  3CIZ A;  1RT1 B;  2AU0 A;  4X4N A;  1U7L A;  2C2R A;  3OSP A;  5JUM A;  1ARO P;  2J7W A;  1DAR A;  2FUG 9;  4FZV A;  1HQE B;  4F4Z A;  1M5O C;  3LO3 A;  4PG6 A;  3H2L A;  4QYR A;  1U1P A;  1YJT A;  1SKU B;  3LP1 A;  4EFA C;  4TU9 A;  4F3M A;  4F0K A;  3HHE A;  1DJ0 A;  2HK2 A;  3CUN A;  2RNE A;  1FNO A;  3KG0 A;  1YKW A;  1YJ9 S;  5ETO A;  5ETV A;  4KGK A;  3AQO A;  4DFM A;  2HGN A;  4NRU A;  2K8G A;  2XMA A;  5DDQ C;  2HGM A;  2ATC B;  4HHU A;  1VBZ A;  2J9C A;  1IKW A;  2VQE F;  3OR1 B;  4F8R A;  3MUR P;  4WE1 B;  1GH8 A;  2Z30 B;  2CZ9 A;  1D0E A;  1EHW A;  4LQ9 A;  4DR3 J;  1S10 A;  4B3R F;  4USW A;  3SSR A;  4F02 A;  3H5X A;  1U47 A;  4RW6 B;  1NK6 A;  5H9F K;  4RUA A;  1JNZ B;  1S1X A;  2E7W A;  3SMZ A;  2JH3 A;  1T05 B;  1MSW D;  2JLF A;  4GKJ J;  4KB7 A;  1X4B A;  4LIW A;  3CE8 A;  1U1K A;  3CJ5 A;  3ET6 B;  2WON B;  1KQS R;  1JXV A;  4NZ6 A;  1GAO A;  1DBD A;  3VF0 B;  4RJV A;  4NYP A;  1RT3 B;  4JI1 F;  4CO0 A;  2ZIT A;  5I42 A;  1U6Z A;  3W9I A;  1GTH A;  2ZWO A;  4QZV B;  1XJW B;  3UDC A;  2HEK A;  4A8Y A;  1UKU A;  3QT7 A;  1HWI A;  3R2D J;  2DXD A;  5EX0 A;  4F4X A;  4DEZ A;  2BM0 A;  1H72 C;  4J90 A;  1MMN A;  6FD1 A;  1WEZ A;  4NLO A;  3NNC A;  5KFO A;  3FBF A;  2HQG A;  2ZH5 A;  3E01 B;  4RKU C;  1H74 A;  2LDI A;  1O0P A;  4W4M A;  3D0I E;  1Y9O A;  2B0G A;  2LYV A;  4LBP A;  2FJW A;  2YBV A;  3FCH A;  1J5E F;  4OYP A;  1JLB A;  1FXD A;  4CTA B;  1T03 B;  4LSZ B;  3KNG A;  4U95 A;  4B3S F;  1X4F A;  2YQ0 A;  1MW7 A;  1HQU A;  1TK8 A;  5LMN F;  4R5P B;  3IO1 A;  1Y00 A;  2JL9 A;  3BN4 A;  4MJK A;  3MM7 A;  2QFI A;  2W2P P;  3PR4 A;  1IBM F;  3B4M A;  1VJW A;  3KJV B;  4F0M A;  2WVD A;  3UR0 A;  1TL1 A;  2BRL A;  1XNQ J;  1IKV A;  4KHP F;  1FJG J;  1SC4 B;  2DHG A;  2N4C A;  1RDR A;  4KE5 A;  4ZPB A;  1U49 A;  3POT B;  2V69 A;  3G82 A;  2KH9 A;  4CLL A;  4J9N A;  2IAJ A;  5JMN A;  5KG5 A;  4NRT A;  5C5J A;  3P6Y C;  3SQG A;  2HHH F;  3R5J B;  5HJX A;  3I4H X;  2GHW A;  1WTF A;  4X62 J;  3OTC A;  3I0R B;  1K1Q A;  1RT1 A;  1YJN S;  3LP0 B;  1W2B R;  4DV5 F;  4ZIT A;  4NI2 B;  2BKN A;  3EPG A;  4OX8 A;  3NMR A;  1HQE A;  1SQE A;  3G6X A;  4USK A;  1PAU B;  2RS8 A;  4DOZ A;  2QSF A;  2K1R B;  2M52 A;  1FRJ A;  3LGN A;  4FKX A;  1UZH A;  2JFD A;  3UR3 C;  2R8H A;  3PX4 A;  4DLE A;  3KKF A;  4NXN J;  5KT4 A;  4C2M A;  2HWT A;  1F5B A;  2RIJ A;  4WK3 A;  4DXL A;  3QLH B;  1AFI A;  4DQQ A;  3N01 A;  4DV2 J;  1WEL A;  2VZ9 A;  2K06 A;  3OR1 A;  2HKE A;  4ZK7 M;  4WE1 A;  4N7T A;  2MKS A;  1F60 B;  3W5Z A;  2XLK A;  3IG1 B;  5LSL A;  4RW6 A;  4M94 A;  4WP8 A;  1MMD A;  1M5H A;  2G13 A;  4UY8 T;  1FXR A;  4CLS A;  4M5I A;  2YWE A;  3KYL A;  2AYG A;  1T05 A;  3UDV A;  1RHJ B;  4ZPC A;  4GVB A;  5EGY A;  2BV3 A;  1NH8 A;  5DO2 A;  3CC7 S;  3ET6 A;  4O44 A;  2WON A;  3D5M A;  1JXL A;  4HDG A;  4U7U K;  2E1C A;  4DR5 J;  3DC2 A;  3PR5 B;  4AXI A;  1Y10 A;  1RT3 A;  2LA6 A;  2RDI A;  1HBN B;  3MUT P;  1RIS A;  4CO2 A;  3LAM A;  4BHQ A;  1FX2 A;  5IM0 B;  1HNV B;  3QPI A;  4OI6 A;  4DR6 J;  1RAO A;  4HTJ A;  2I9S A;  1RWK B;  1U02 A;  2M9K A;  2NSB A;  5B0C A;  2XMM A;  2RAQ A;  4LFB F;  1NSQ A;  2J9D A;  4B3M J;  3PFE A;  3OFF A;  4M5L A;  2EC2 A;  2RJZ A;  1C1B B;  2JEG A;  5KFW A;  2O1P A;  1TAQ A;  1BE4 A;  3E01 A;  3IBC B;  3SFG A;  2VOD A;  4LF5 J;  4ILM A;  2HIQ A;  4Y65 A;  1HNZ J;  3HD1 A;  2DRA A;  4KGZ B;  2IMW P;  2UUB F;  2CQB A;  4CTA A;  3T1H F;  1T03 A;  4HH0 A;  2CPF A;  3TRG A;  3M8Y A;  3BR8 A;  5HBM B;  3MM8 B;  3C66 A;  3NP5 A;  3GG0 A;  3I55 S;  2M8D B;  4R5P A;  4LSN B;  1SKR A;  4NLT A;  4B3T F;  4WTO B;  4U6P A;  4B9U A;  4C97 A;  4BS2 A;  5ETT A;  3IR6 B;  1Q86 T;  3KJV A;  1I1G A;  4DG1 B;  3OHB A;  2B4U A;  3HZE A;  2AX0 A;  3Q22 A;  2VHG A;  3FMW A;  2MKC A;  3POT A;  2R2T A;  1S1W B;  4RLE A;  4RW4 A;  4QWD A;  3JAM Y;  2C2N A;  2MY7 A;  3E8O A;  2DXE A;  4CO1 A;  2DXF A;  2RHS B;  1MML A;  1V9O A;  2BJE A;  4LF7 J;  2LEA A;  3DLE B;  1RCO B;  3I0R A;  2U2F A;  1PYT A;  3U1N A;  2XM3 A;  2Z2L A;  5KT2 A;  2OJ3 A;  4WPA A;  4I1T A;  2BYC A;  3CSK A;  5D0G A;  3R7S B;  5DGB A;  3N79 A;  4NI2 A;  5BR8 F;  2XMJ A;  3NNA A;  3GCX P;  4FP9 A;  2CPE A;  3I0S B;  3JSR A;  2K1R A;  4ZPA A;  3IWX A;  2KL8 A;  4JI3 J;  4OL8 A;  1X0P A;  4RBU A;  1WKK A;  4WTY A;  4UW2 A;  2K2P A;  2GO8 A;  3IRW P;  2W4D A;  1N33 F;  3E51 A;  2ZH1 A;  2YQ3 A;  1N34 J;  3QLH A;  1FA0 A;  4TNO A;  4OJ1 A;  2MHE A;  2E5G A;  3OFG A;  3AA8 A;  1IQT A;  1SI9 A;  1UJ5 A;  1KFS A;  2HVD A;  1FE0 A;  3S01 A;  4YP3 A;  3TZX A;  1E6V B;  3IG1 A;  2AT1 B;  2DBB A;  1RT5 B;  2FGO A;  3MEC B;  5DG8 A;  4LUB A;  3KLE B;  2P2C B;  2KXH A;  1JLC B;  1HPZ B;  2HBR B;  2E5L J;  1A7G E;  3ILO A;  4U8V A;  3KHG A;  1HAR A;  3A3O B;  3Q8Q B;  2MZS A;  3QJJ A;  4KBI A;  4URS A;  4PG8 A;  3GP9 A;  4PUO B;  4F2R A;  4DZD A;  2UUC F;  4N8O A;  3PFO A;  2QN6 B;  1HBN A;  3CNQ P;  4DR7 J;  3MD1 A;  4XDC A;  2A1B A;  5IM0 A;  1GMW A;  1HNV A;  4DR2 J;  1ZS6 A;  5ETQ A;  3RRH A;  3W9J A;  2WK4 A;  4FPR A;  1PSD A;  1M0S A;  2CJY B;  2VIC A;  4PEO A;  3NMA A;  4NLX A;  3GII A;  5L9X A;  1PYO B;  4O0N A;  2MXY A;  4DV0 J;  2IRU A;  2V8V A;  4DV6 F;  5J2N B;  3KK1 B;  4LF8 F;  1C1B A;  3T6J A;  2F4V F;  4QR2 A;  4RBV A;  3HDS A;  3LTO A;  4NLY A;  1B0V A;  5DDP C;  4OZ5 A;  1FRL A;  2F9D A;  4WU2 A;  3FBE A;  3U02 A;  2XY5 A;  3MPW A;  5HBM A;  3MM8 A;  4OHX A;  1RBL A;  2DYA A;  4LSN A;  2AW0 A;  5HVF A;  2OPQ B;  3TZZ A;  2YKM B;  2Y8W A;  3HPO A;  2GZO A;  3CMA S;  4DG1 A;  1IN0 A;  1TKD A;  1RWV B;  1T9W A;  4WFN Q;  4NLW A;  2U1A A;  1S1W A;  4NLR A;  2EKN A;  4JV2 A;  4DF8 A;  2EK6 A;  5F8I A;  3KLH B;  3J7Z 5;  4CLU A;  1YBT A;  4CWB A;  1UPP A;  3US5 A;  3DGV A;  2PE8 A;  1I6J A;  2GAG C;  3DLE A;  4P2F A;  2R7Q A;  2GQQ A;  1H38 A;  4DPX A;  2F5G A;  4B9N A;  4U96 A;  1NJX A;  1CUL B;  1W25 A;  3GJS B;  2ZUG A;  4PXD A;  2HHW A;  4LFA F;  4IO9 Q;  2EC0 A;  4UUW A;  2AWZ A;  2NR0 A;  1N54 B;  3LWM A;  1NB7 A;  2ZDO A;  3I0S A;  3HVT B;  1SJ1 A;  4YOE A;  3V2U C;  3DRS B;  4DR3 F;  4PWD B; 
#chains in the Genus database with same CATH homology
 2H5J B;  4LSZ B;  1RWK B;  3NS7 B;  2P2C B;  5IC6 B;  2CNL B;  1QDU B;  2C2Z B;  2H4W B;  1GFW B;  2C2K B;  4ZVS B;  3R7N B;  2H5I B;  2HBR B;  2C1E B;  1ICE B;  2QLJ B;  4DCO B;  4ZVP B;  2QL9 B;  4JB8 B;  2HBQ B;  1BMQ B;  3KJF B;  4DCJ B;  1RWO B;  1RHK B;  3P4U B;  3IBC B;  3R7S B;  1RWP B;  1RWM B;  1RHR B;  1RHQ B;  2H4Y B;  1RHM B;  2QLB B;  1SC4 B;  1RWV B;  1SC3 B;  2QL5 B;  2XYG B;  3RJM B;  2CJX B;  2XZD B;  2H48 B;  3KJN B;  2C2M B;  5IC4 B;  1QTN B;  1RWN B;  3R5J B;  1RE1 B;  3D6M B;  1RWX B;  3P45 B;  1RWW B;  2XYP B;  1RHJ B;  3SIP B;  2CJY B;  2HBY B;  3GJT B;  1I51 B;  1PYO B;  4ZVQ B;  3QNW B;  2FQQ B;  1RHU B;  2XZT B;  3R7B B;  5K20 B;  2C2O B;  4ZVU B;  1I3O B;  1IBC B;  3GJR B;  1NME B;  3R6G B;  4ZVT B;  3EDQ B;  4ZVO B;  2CNK B;  3IBF B;  2Y0B B;  3GJS B;  1SC1 B;  2CNN B;  3GJQ B;  2DKO B;  4ZVR B;  1PAU B;  2HBZ B;  3R6L B;  2XYH B;  2H54 B;  3KJQ B;  2H51 B;  3D6F B;  2QLF B;  1F9E B;  2QL7 B;  3D6H B;  4DCP B;  2CDR B;  2H65 B;  2CNO B;  3EDR B;  2Y1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...