3IBCB

Crystal structure of caspase-7 incomplex with acetyl-yvad-cho
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, apoptosis
total genus 15
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3ibcB00
2QLBB 1RWWB 3GJSB 3R7NB 2CNOB 3GJQB 2QLFB 3IBFB 1NMEB 1F9EB 2C2KB 4ZVUB 1IBCB 2QLJB 1QDUB 1RWKB 2H65B 1RWOB 1GFWB 2XYHB 5IC6B 2QL9B 1RWNB 2QL5B 4ZVOB 1SC1B 3NS7B 1RWVB 1ICEB 5K20B 2CNKB 2H54B 3D6MB 1RHRB 2CJXB 3R7BB 2Y0BB 3D6HB 1PYOB 1RHJB 3P45B 4DCOB 3KJQB 4ZVTB 4DCPB 4ZVSB 1RWMB 1RHMB 2C2MB 1RE1B 3QNWB 2HBZB 3GJRB 3R7SB 2H51B 2XZTB 3RJMB 2Y1LB 3D6FB 2QL7B 2HBQB 4ZVQB 2H48B 3R6GB 4LSZB 3GJTB 4DCJB 3R5JB 1I3OB 2HBRB 5IC4B 1QTNB 2CDRB 3R6LB 1PAUB 4ZVRB 2CNLB 2C2ZB 2C2OB 1I51B 3P4UB 3IBCB 2CJYB 1RWPB 1RWXB 1SC4B 3SIPB 2XYGB 3EDRB 2XZDB 1SC3B 3KJFB 2H4WB 3KJNB 1RHQB 1RHUB 3EDQB 2XYPB 2H4YB 4JB8B 2DKOB 1RHKB 2HBYB 2H5IB 1BMQB 2C1EB 2CNNB 2FQQB 2H5JB 4ZVPB 2P2CB
chains in the Genus database with same CATH superfamily
2EFPA 2YKMB 3BJYA 2MY8A 2YNHB 1HWLA 3CMES 1D9DA 3C2PA 2ZKTA 2N3LA 2UXDF 1SL2A 5KFIA 1AT1B 2AGQA 5KFBA 2E9TA 3MURP 4S0MA 2GX8A 2QL5B 1Z4UA 4ID8A 4YY3F 3PRVA 2DR6A 1LW2A 3GSIA 1JLGA 1S6UA 2R7WA 1VDHA 5KFYA 3VALA 4OYXA 3GJTB 2EI5A 4J9RA 1IJEB 2PEBA 1SKRA 2M3DA 3UNGC 4X65F 2FZKB 3MPVA 1LW2B 4YP3A 1ROFA 4EO8A 1HNXF 3JTNA 5C2GA 1CBKA 4RW7A 4FDFA 4OZ2A 3MEDA 4LF7F 3OL9A 2E9ZA 4USJC 4KPYA 1HNZF 2Q6BA 2ZHBA 4JI8F 4B9SA 3HFVA 3BSOA 3W9IA 3W5YA 1NSAA 2COLA 2R2RA 2OPSB 3LOUA 3D54A 4Q8FA 4OI3A 4DV1J 5HQMA 2FLPA 3B8HA 3J81U 4RW7B 3D1HA 3SV4A 3M30A 1R43A 4UY85 1RKIA 3KHHA 4K4SA 2IMWP 3HHLD 1KS2A 2RJZA 4U67Q 3FK4A 5C25B 3CIZA 1VRQC 1N5TA 4P9SA 2XCPA 2G0JA 2DTJA 2OGUA 3K58A 2XG8A 3AY0A 4JI6J 2HHXA 2DH8A 4LR7A 3SMZA 4Q0BB 4YB1P 1I51B 4OYIA 1WD6A 2OD6A 3MUTP 2C22A 3P3DA 1VC0A 1RLCL 3M30B 4ZDNA 3AODA 2H3EB 2JHEA 2GHVC 4P2SA 3MAQA 4DV5J 4PAAA 3UNYA 2H5JB 3DN9A 3VCDA 1ZM2A 2DXDA 5HAOA 2XSFA 1MMLA 1M1KT 3UI3A 2CPYA 3BSNA 2CIMA 1NAQA 4YOEA 1Q8KA 2XSJB 3SYZA 5GADU 2RU3A 1XIQA 1VLYA 4RKUC 2GJ2A 1N8RT 4NA1A 3PW2A 1Q8BA 2Q66A 3HXMA 1F5BA 3LGNA 4I2QB 5AE2A 4A47A 1FRLA 3K59A 2H51B 3DGPB 4JUZA 4EUVA 2L08A 4ELTA 1D8YA 1LWEA 5LSRA 3NWGA 3A3PB 3CJ0A 4L6V3 1NZ8A 2V63A 2EWHA 2KXFA 4YFUA 1UAWA 1SKUB 3UR3C 5KG2A 2VUGA 2DITA 1WKLA 1Q5YA 4DU7A 4FF2A 3MTKA 3K57A 3BO4A 3A4TA 3JYTB 1LWEB 2VQFF 1H2VZ 3JSBA 1SC6A 3EGZA 2JFDA 2LU1A 2YX1A 2QSFA 5LMNJ 2FHMA 5L1KA 2KB2A 1IBCB 3F73A 3J80Y 1NDCA 4ER8A 2KG0A 1GFWB 3CJ4A 4RNMA 5ETSA 5L38A 2ZVSA 4PXCA 5E7OB 1OPIA 2XI3A 2ZJRQ 3KKFA 5AXLA 2VQEJ 4C3LA 3BN4A 1RWMB 1IBMJ 1PJ5A 2F40A 1WI6A 2NPFA 3P49B 4USTA 1ZAWA 2B9YA 2YVSA 2G2ZA 3G6YA 9RUBA 3HT3A 3T41A 3ETMA 4LF8F 5ITHA 2YWHA 3W9HA 3HI9A 2MJNA 1XK8A 2DH7A 4Z2XA 4WTYA 4RZRA 1Q53A 3DLEB 1V3RA 4Z7CA 1IBKJ 1NPRA 3R3TA 4PWWA 4P52A 3FCVA 3RAXA 3KHLA 1Q82T 3QRRA 4DI6A 1R6VA 1I6JA 1ZA1B 4P73A 3GIMA 2LECA 2AU0A 3CJQA 1RTZA 3VZHA 4BS2A 2GGPB 3HT0A 1ELOA 3BDEA 1GTHA 3M8WA 3M1VA 3J7A1 2G2OA 2Z58B 4RNFA 3VAMA 2LDIA 5LJ3Y 2RUGA 1RAHB 2BE7D 3C14A 4FVCA 1IKYA 2RNEA 5KT4A 1ZZNA 2BX6A 4ZJOA 2Q6CA 2NSBA 1X4AA 3ISZA 1U47A 2XGQA 1D8ZA 3OD2A 3HVWA 4CIOA 3K5NA 3R2CJ 3M1VB 2W2PP 5D77A 2FJAB 3R5BA 4LSLA 4DPOA 4M5DB 4UTGA 1KQGB 3M8RA 4A8KA 1T9TA 1RWWB 5D3GA 1Z2ZA 1IKYB 2ADBA 1V3ZA 4OYWA 3BQ1A 1MROA 3GIJA 1H2TZ 4N77A 1R0CB 1GQEA 3T5HA 5BYRA 1N5YA 1T11A 3H90A 3KNAA 2LDYA 4J9OA 3CCWA 4CYUA 1RWKB 2R7OA 2BQRA 1PJ7A 4LSLB 1D9FA 4PG7A 3FZ2A 1EIYB 1FJEB 4A8FA 4RJVA 1UCNA 2IYGA 5DRKA 5D3GB 1S9GA 2L41A 3D0HE 1MMNA 3N0VA 3TA1A 2XLJA 4B3MF 4MMOA 3C46A 2P9EA 3EMTA 4CYUB 1VYAA 2PO4A 2CQ4A 2QGFB 4U95A 2DNOA 1LQ9A 2LA6A 1U8WA 2FPHX 2R2UA 2JX2A 1S9GB 1IBLF 2RHQB 1VQMS 2JRSA 2YPYA 4C3KA 4J9KA 1P6TA 2OO4A 1WWHA 5A8KA 4WYLA 1PC5A 3HD2A 4ECWA 2CQGA 3U7JA 4WP3A 3R97A 3N5FA 4CLTA 1YG0A 3T9ZA 1TL3B 2PGCA 5AE1A 4TVAB 3THVA 2IFXA 2WBMA 2B7CB 1FJGF 2CPDA 1UWBA 1BD6A 2P8IA 3FEYB 2QMWA 2QN6B 4FBTA 4NXNJ 1T02A 1PYOB 3TAQA 2C2MB 1UVJA 3V6HA 2WVCA 5JMNA 2DR5A 1N32J 1MLAA 2Y1LB 2Y3YA 3FKBA 1Q4RA 4CLZA 1J5OA 1HARA 4JI1J 3DOKA 3MPUB 2V8PA 3I87A 3W9JA 3CDBA 1UWBB 1E6YA 2KU7A 3BF4A 4DDFA 5C5JA 3HHNB 1PSDA 3SDEA 2V9WA 4RUCA 4ECSA 2ZH8A 3KLFA 2E5LF 1FRXA 2HFUA 2OUGA 5A2QU 4KO0A 3SV3A 5L9XA 2RSQA 1U1RA 1OY9A 3BYPA 1G7CB 4V1Ak 2OMOA 4ZS6A 1K9MT 1LNQA 4IO9Q 2LQJA 3PO4A 3PR5B 3SDEB 3H0PA 2DYAA 4IOAQ 3Q23A 4YUDA 2HHPA 5JJBA 2AJ0A 3KLFB 1GMWA 2Z2YB 4JI3J 1AW0A 3DLKA 3HJFA 4CO3A 1UJ6A 4G1PA 2FGOA 1YI2S 4YEAA 4LRDA 5KG3A 2E5HA 4FPRA 2QL7B 4K50A 2FLOA 2HFNA 4CWBA 4DCJB 1DFDA 2VKZG 4CTAB 3R5DA 2FVRA 1RCOB 2WVBA 4WKRA 4GKJJ 1NEEA 3H5XA 2OD4A 1RHUB 3R2DJ 4CI0B 1CS4B 2JFKA 3UQSA 2U2FA 2J0SD 2AW0A 1FTCA 3R7NB 1W7WA 5LSLA 1XJWB 2OIHA 2LQ8A 2HPUA 4K4XA 1FNMA 4FNHA 4H4OA 8ATCB 3IR5B 4QWBA 3BYRA 1U48A 4WTOB 3RYLA 4CT8A 4KT0C 2K3IA 2VC1A 2EKYA 1WOPA 2LEBA 2HNYB 1U0SA 4GC6A 4WFAQ 5GMDA 3KLIA 5IWAF 4EBDA 1NSPA 4H4OB 4DV3F 4JI5J 1TK8A 1VISA 4WBFA 4F4XA 5E33A 3HVAA 3GR0A 1D09B 4DPUA 2ZH6A 1PAUB 4OJHA 1XNQJ 4L3NA 1G2EA 3HCXA 1RCXB 5M2RA 4U6PA 1KQSR 3PRBA 3KLIB 4LIWA 1CJTB 4B9LA 1RK8A 2AYBA 3CCQS 1SXLA 3U1NA 3BREA 1X7VA 2WB1D 5E41A 1I94J 1QY7A 4RBTA 1NMEB 2H9ZA 1S1XA 2YWFA 5DZ7A 5G0RA 3FSYA 3RRHA 3BDPA 3FSXA 1FT8A 4NZ6A 3MMCA 4KHPF 1ZPVA 4N41A 5GAEI 1HNVA 1RA7A 2FY8A 2J7WA 1MN7A 4P72A 4X2BA 2C3YA 2LQBA 3NGTA 3R7BB 2V94A 5E2QA 1DQ8A 2DNLA 3CJ2A 4OI4A 3IR7B 3IC1A 3D5MA 2GS8A 1S1XB 1HMVA 5MAOA 2L48A 5G0RB 3FVYA 4AXIA 1C2PA 5HP1A 2E1AA 3CDEA 1QUPA 3PACA 1MW7A 1WJ9A 1RTHA 2CG4A 4B3SJ 1I3OB 3CXCR 1RYRA 4ZITA 2EPIA 4EFAC 2RD5C 1EQMA 1HBUA 3RAQA 3ZNJ1 1N5SA 3MEKA 2MQLA 1H7XA 2V2VA 2OI2A 4DUZF 4PWUA 5I3PA 1JLAA 4U8YA 4B3RF 3FFIA 5LM7E 3SCLE 2WCXA 3CDUA 3FGVA 5HP1B 3RTVA 4FPIA 4DFKA 1RTHB 2DNGA 3JB9k 3M32B 1HBUB 2BA9A 4OZNA 2M5YA 5FIIA 2XLKA 4XPCA 3R5GA 4MK7A 4DWIA 1CEZA 1JLAB 2K06A 4FKYA 3VVTA 1HD1A 3FFIB 1YLXA 1FF2A 1RT2A 1P8GA 5IV4A 4Q2MA 4WYWA 3PFOA 4LF9J 1FNOA 2FGCA 4CDIA 2YKOA 2X1BA 3E01B 4NLTA 5LL6d 4ECZA 5DDPC 4N7TA 3RZAA 1YJ9S 1CJUA 4QWEA 2VPZB 3L95X 4OLPA 1EP4B 4C8ZA 3DNCA 1SC4B 2LU2A 4KYZA 4TYAA 4NYOA 2HMIA 1S0OA 1JIHA 2KRRA 4C8YA 2DPJA 3WX4A 2D3O1 4AT1B 1VR6A 4NLUA 2ZBPA 2FD2A 3QFHA 4HHHA 2JVOA 2MTLA 5AT1B 4QU7A 2R7XA 1BE4A 2XS7A 2E7XA 3I5BA 3NS6A 2AEFA 2BJ9A 2WSEC 1GMUA 4Y2IA 4O4GB 2APOA 4I56A 2DNKA 1APSA 1HFEL 3OL7A 4DN0A 1TV6A 3CDAA 4Y2MA 1VS3A 3BM7A 2IJNA 4U7UD 3MPYA 3CNQP 2Q1LA 2FVQA 3F41A 3KDOA 5ETTA 4DUYJ 5BR8J 2D41A 4BLGA 4IO1A 3FC9A 2Y1RI 1K1SA 3HKZD 4A8SA 3QJLA 4PG5A 1UEKA 5HN0A 5JVHQ 3PXGa 3G9CA 3IRXB 4NEYA 4MAKA 1TV6B 4FYDA 1X4FA 2HQFA 2DGSA 4H4MA 4M5JA 3VVUA 2VDIA 2X1FA 3V6JA 3N01A 4X62F 4CT9A 2R4FA 3GR1A 1A9NB 4CO2A 3QMQA 1NSKL 3LANA 4X4OA 2V9KA 2BJ3A 4E0DA 4ECTA 4WP9A 3TAPA 2ZFHA 1S0MA 4H4MB 3EVWA 3RBEA 3CCMS 2XMMA 4B02A 3MUMP 4DN9A 2NUHA 1X5OA 4NLPA 4NLXA 1NK4A 1QSYA 4GO5X 3TJ9A 1RDRA 1FKPA 2DGXA 1GTEA 1XR7A 2ZC3A 2Q43A 1XEZA 2UXDJ 1RAJA 4OX9F 2DCLA 4OX7A 3A13A 3FMWA 4X64F 1FE0A 1FNXH 4RUAA 2DGWA 4ECXA 5E3PA 2ZC4A 3FCWA 2K8GA 2A6OA 3EVMA 3CO9A 2QT7A 2HAIA 3LP1B 1RWXB 4YY3J 2DNNA 2C2DA 4MIAA 2RS8A 4I6YA 1IUJA 3H5UA 3GTYX 3CJRA 2R2TA 1JX4A 2KO1A 4HYKA 3KUGA 5J2PA 2MKIA 3OR2B 3D66A 1GX6A 1OY6A 2HHVA 3IG1B 5HVGA 3M05A 2YNGA 3HLUA 1K0VA 1RT1A 3I0RA 4ZPAA 2FLLA 4UZBA 3L7PA 2XMJA 4X65J 3ZZZA 2MZTA 1TVRA 4JV5F 2WVEA 1ZH5A 3PJXA 2ZWPA 2O67A 1S1WA 4QZVB 1HNXJ 3OFHA 4J9NA 1KR4A 2J6TA 2DO0A 1U6ZA 4WFBQ 4LF7J 3TX8A 2MKJA 1Q0NA 2YNGB 1HNZJ 1LK7A 4JI8J 2JZ5A 3I0RB 4P75A 1OQ3A 3ZNUA 4NWBA 4CLPA 4B9MA 2ZOGA 3M8PA 1T8EA 2VG6A 3G86A 2I0XA 4CLWA 4ES2A 3BBBA 5DM6Q 3EUNA 1ZBTA 3ISNC 2FJWA 1RWPB 2XY6A 3MM8A 1TFWA 3J81j 4MKAA 1R8PA 1K8AT 4K4TA 4M8LA 4ZLJA 3BPDA 4EU0A 2QLWA 4IOCQ 3W66A 3WZ0A 2HLTA 3M8PB 3P96A 4ZVEA 3A3OB 5HQ8A 1H3DA 3ZTSA 2J5AA 3W5ZA 1YZ7A 2W2MP 2VOOA 3MM8B 5A76A 4NZ0A 5KG4A 2MYFA 4OYMA 2R8GA 3MCSA 4C8MA 1HWUA 4USHA 1EX8A 4OHYA 1S59A 3THTA 3JQMA 3QT5A 1RU1A 2E1PA 2ADCA 2R9LA 1OSDA 3GE9A 3BH7B 1UPMB 1U2CA 2VONA 3R1HA 2B7BB 2GO8A 2VBZA 2FVSA 2G0CA 4P6QA 4KRWA 4F3QA 4NLSA 3GLJA 1QTNB 3A8IA 4MFBA 3FUYA 3WIUA 3V6KA 1F2GA 4I7FA 4DQSA 4DPTA 4HH1A 4O3OA 3VZIA 4EBEA 1SC3B 2CDQA 4RW6A 1EETB 1VJQA 2EKNA 2KI2A 1T94A 2JEJA 1JJCB 1TU0B 3CPWR 1FCAA 2GIRA 2RE1A 2R8JA 4MFBB 4WXWA 3X1LB 4NYPA 3L09A 3QT7A 4OJGA 3LTOA 5F3TA 5FLXU 3H8YA 3IN5A 1EKRA 1XC9A 2OELA 4EYIB 1Q1KA 2IAJB 4CRJA 1FX4A 3K7RA 3TJAA 2VQFJ 1FRIA 4HDHA 1C0UA 3PCOB 4OI0A 3VV2B 2CVIA 4DLEA 4IFYB 1RHMB 1VBZA 2JC0A 1V5IB 1RT7B 1NHVA 4O44A 1VQ9S 5C24B 4UOCA 4R0EA 4LSZB 3VWSA 4QIWD 1WEXA 3CCUS 2FLNA 3D0IE 4IH6A 3NNAA 3GQCA 2XO6A 2VD3A 1NKBA 1N52B 2E7WA 3CVKA 4ZP6A 3H98A 3UDLA 2QYGA 4O44B 4ZVPB 4OZ1A 3PKMA 4LF8J 2QLBB 4B9NA 4KAIA 1KTVA 4Y2KA 3CCZA 1SUQA 3FBFA 1XMQF 2UUAF 1RTIA 4OHWA 1Z2LA 3LAMA 1UVLA 4RL1A 4XTTA 3DCAA 5IM0A 4DR5F 2BJDA 4Q45A 2IJRA 6FD1A 4EZ6A 1U6FA 2KZMA 2AGPA 2ZM6F 3M8QA 3QGGA 2HS0A 2RKIA 1SUQB 5A8WA 4MKBA 1X9WA 1P1TA 2J9DE 1NB2A 4LRAA 1BWVA 3AB2B 3D4JA 3QWPA 2ZZNA 1S1VA 1JK9B 2YKAA 1OIAA 1YRUA 4KY3A 4N8OA 1MWZA 3EICA 4G1QA 1FEHA 1M0SA 2RKIB 4ES1A 5T7LA 3HF5A 1VQ7S 3ZC4A 4ZOSA 2N4DA 1ZM3A 1IR0A 1S4FA 4Y34A 3AXMA 2MKHA 3EPIA 2OPQB 4HH0A 5KFEA 5IT9Y 4C8NA 5DLFA 3TOQA 1NHUA 2EBGA 4FYXB 5F8HA 2MKCA 1AUDA 2BRKA 2J0XA 4G1QB 2KVQE 5C7PA 5IC6B 3CD6S 1Y7PA 1S12A 4DV0F 4HKQA 3PRDA 4QR1A 2DD8S 1JXEA 4QU6A 4UQTA 2ABYA 3RRKA 2I2YA 5GAGU 3AB4B 3I9V9 2KN4A 1RAOA 1S9EA 1VBKA 3G82A 1SJ4P 4L75A 3NP5A 3LQVA 4YB6A 4KQZA 4USKA 2DGQA 2V8DA 4U9RA 1N0VC 1TELA 5DJBA 1N6QA 4O3PA 3DRRA 4HACA 3P4UB 4GRSA 1C1CB 1PC4A 1H98A 5F8LA 1T7PA 2MGZA 4ZLNA 5CD4H 1OWXA 4M5NA 4MKVA 4N8NA 2MKKA 5H9EJ 1S9EB 4ECVA 3G82B 5ETVA 4B3MJ 1C0TA 1CSJA 4M1KA 1VRTB 3HHLB 3PDNA 1U1LA 4LFAF 1Y9OA 3LH2S 2KKHA 1X5PA 2EK1A 1WC6A 3UVJA 1MNEA 4WXOA 1N6QB 2W01A 3DRRB 3EZOA 2I38A 1G3OA 2XZWA 2JLEA 5D0EA 2QC3A 4PQUB 5D15A 2MGZB 2F8HA 3TQEA 1IBLJ 2L9DA 1F60B 3CGIA 5K20B 2F4VF 2PA8D 1WOOA 3H2VE 2BOAA 2WK4A 1X4DA 2EXUA 2ZH9A 3ADAC 3MM9A 3AJDA 3UVJB 5C42B 2JEFA 3DOMB 2ALZA 3PJ9A 3D1OA 2IPOB 1SJ1A 2LA4A 2WVDA 5DQIA 1FJGJ 1GK8A 2DEIA 3IR6B 2L9WA 2RRAA 3CJTA 1Q95G 2R8KA 3PX0A 3HO1A 1S0VA 2J76E 4AXJA 3RBDA 4IRKA 1FE4A 4R8UA 4UZCA 2HBYB 1UFLA 3MM9B 2BUNA 1KQKA 1C4CA 4O0IA 4TY8A 2GW8A 2M2BA 1Q7YT 3Q8SB 1S10A 3OSNA 1RU2A 1CQMA 3TAMB 4C8OA 1GXTA 3ENAA 2PMZD 3DMJB 3S1TA 1FDNA 5HBMB 5J1EB 3SSSA 4EO6A 2E5LJ 4LRBA 2VJUA 1RT3B 1NH7A 1UTAA 4TY8B 3Q86A 4YB7A 3MFHA 4K4UA 5H9FJ 1T0TV 1SQGA 2DBBA 2HNDA 4DV6F 3ZZYA 4ZMMA 4EI2A 3OW2R 3EE3A 2ZZTA 1M5PC 1EJ7L 1VQLS 1WC5A 2G2YA 4B3OA 3QYYA 3VQSA 1U1QA 1TTHB 3BZQA 2R7UA 1Q81T 5CZXA 2QA4S 3RB0A 1FESA 1DLOA 3AD7C 5E3RA 2ATCB 4N76A 3H2LA 3NGKA 2VC0A 2RT3A 5KT5A 4DXLA 3HFZB 3OLAA 3J7AN 1P9YA 3GYNA 4HVZA 5HVHA 3W5XA 3QGIA 1BC6A 2B6AA 3TARA 2XS2A 3LW5C 1DLOB 1HW9A 1SJRA 2V5HG 1B0TA 3K17A 2C2EA 2DEJA 2P6TA 1S6PA 4LBHA 3O8WA 2BKPA 3GJRB 4NI2B 3NBPA 1XMOF 1EHWA 1H72C 4DUTA 1HKAA 2WBRA 4FBUA 3T6BA 3OUYA 1NJXA 1HQUB 2B6AB 3D7SB 3PFEA 2HBRB 1DTTB 2DHAA 1SVDA 3AXKA 3MAHA 4EZ9A 2LFVA 3EGNA 1HHQA 4CLKA 1P9QC 2EC2A 3KJNB 4LREA 1KC8T 1S6PB 2XYPB 3FJ2A 2EFNA 5B08A 5IWAJ 3NBPB 1R8CA 5J2QB 1BMQB 4DV3J 4LFBF 2VBXA 2W9CA 2EK6A 4RUBA 2P9GA 2FVCA 4ZPDA 4K4WA 2K1RB 4RW9A 4ZPWR 5LSOA 2X7IA 4DV2F 3PHEA 4J9MA 3ZO7A 1VQ8S 3BKUA 2YWGA 3HHEA 3ZZRA 1AFIA 3DLGA 2DK2A 2Y9HA 5BXIA 5ETOA 1AZSB 3I5CA 4DZ6A 1DJ0A 2CQ0A 1YGYA 2BANB 1U7LA 1XWLA 3EGVA 4YR2A 1NKEA 4Y00A 3K5PA 4KHPJ 4YR3A 2QRRA 4GO7X 3G8QA 4W92B 2ZDPA 3LP2A 2E1CA 1IM4A 2V2QA 5A0YA 5K9FA 1QJHA 3US5A 1W2BR 2IBOA 3ILLA 1NK6A 4F7VA 3IWNC 2MDAA 3M7VA 1RUSA 2V34A 2XY5A 5K8OA 3WDOA 2DNRA 2JDJA 2ZVIA 2HFZA 5MLCV 1KD1T 4X4SA 1JJHA 5HL7Q 5K8PA 1W25A 1QAJA 3UO0A 2J6UA 2KYZA 2I9SA 2QA4G 2Y0SD 1EKSA 2VG7A 4ZK7M 3FRYA 2WW4A 2HVEA 4DSEA 4DUZJ 1Q8LA 4E8UA 3NGSA 1Q16B 2YWEA 4B3RJ 3EXYA 1CJVA 2LYVA 1S6QA 2OKQA 3CT9A 3OTDA 2D1CA 4ZVSB 5EWFA 2DXEA 4HTIA 2HHQA 3DXBA 4QWCA 3NKYA 3JAMY 2JLFA 2ZD1B 3SSRA 3HDSA 3EZ5A 2FHJA 2VG7B 2H5EA 4X4UA 4WFZA 3PW7A 4FS1A 4RU2A 3R6LB 3P8BB 3MXHP 2WW8A 5CAAA 1S6QB 5KFTA 1NJZA 4LF1A 4NRTA 3T1AA 2VICA 3UCUP 3AJ1A 2VFRA 2RDIA 4Q8EA 4PZVA 5J1NA 1JKHA 4LMZA 1QLNA 4JV0A 1J5EJ 4Q5VA 1KP6A 4RU9A 4WPAA 2M88A 5IT0A 4R5PA 3G4SS 3PYDA 3WX8A 3RGIA 4Q2LA 5CABA 1VQKS 4WIQA 2YX7A 4FVMA 5K14A 4F36A 2C3OA 4TXSA 3CTRA 4BC7A 1A6LA 2MQ8A 2MLYA 1I1GA 4USMA 2GO9A 2JJ4D 3BGRA 2BJ7A 1HR0F 4CCHA 2X1GA 4DZDA 2R42A 3K2YA 4QR0A 3PM9A 1O5JA 3VGTA 3CEDA 2UP1A 5KFZA 4BCAA 1X60A 5DDQC 4DU8A 4HI2A 2GZOA 1WI8A 3C6TA 4U96A 3JQJA 1RADB 4HLBA 1RTJA 5HMZA 4NCBA 5D0GA 3BH6B 3BGRB 4TN2A 1YVFA 4FYVB 4ZCLA 2CQBA 3VAKA 1WTFA 1YDLA 1WF1A 4J5OA 2MZJA 1U1KA 3EM1A 3DKDA 5U47A 4RNHA 1WC1A 4KPCA 3VAIA 4IR1A 5F0WA 4KV8B 3C6TB 3I6PA 4K7QA 5KFAA 3MECA 3DFEA 1PAEX 3KLEA 5AXMA 4X62J 1RBLA 4NA3A 3GG1A 3IM8A 4PUOA 4IG0A 1FD2A 4ZVTB 3M2RA 1XN9A 2DHSA 1UVKA 3JS9A 1U2FA 1HBOA 2W1BA 1FJCA 1WHVA 4DX8H 2ROEA 2OJ3A 4U8VA 1CJKB 4F0HA 5JXSA 3DLLQ 3OTEA 2C2ZB 3T19A 2RF2A 2V4JB 1EARA 4PUOB 4IG0B 3MF5A 2NXEA 4DSLA 2BVZA 1RHQB 3K0JA 2Y8YA 1W2IA 4CM2A 4H54A 4DFMA 1IKXA 4OX9J 1HBOB 3QFWA 3PIPQ 3LGHA 4X64J 1JLBB 1DTQA 2JWNA 4MYTA 4WFNQ 3UDEA 1CULA 4DV7F 1VQPS 4J91A 3KUEA 2FB0A 4KE5A 5CYQA 1EB0A 2YWKA 4NOHA 3HHLC 5DGAA 1IKXB 3H5YA 4O3SA 4D3HA 2UUWA 3MAAA 3DI6B 4DX7A 3MM7B 2IVYA 1DTQB 1HIYA 2CPEA 3L7UA 2V6AA 1SJ3P 4TU7A 5GVQA 1H2UX 3D68A 1IKVA 2W4PA 1CULB 2C3UA 4PR6A 2GVZB 4PWDA 4C11A 1T9WA 3R6GB 3UPFA 4JV5J 2DISA 1S0NA 1FVSA 3VF0B 1W26A 1IXKA 2ZBIA 3MAAB 4K2XA 3EDRB 1Q8IA 1R0BG 3D67A 2QA1A 2O5DA 1FWPA 2GV1A 1VRUA 2CG8A 1LEOA 4ZPTR 4PPDA 2MZSA 1IKVB 2FQQB 3ZZTA 4PWDB 3N79A 4C11B 2R7RA 4P2FA 2L3MA 4IG3A 2W24A 2F8EX 4Q44A 4L76A 5ETKA 5I3UA 4K59A 1RBOB 4WCEQ 2OTJS 4YQWA 2HVHA 1LWCA 2G13A 2DO4A 2F7VA 3AOAA 2W8KA 1GT8A 1SC1B 1VRUB 2RRNA 2YKMA 4JOUA 1B99A 3BGFA 3MEGA 5D4PA 2BJ8A 2E29A 4FNIA 3AA9A 4IG3B 3EZUA 4R25A 4F2RA 2YQ0A 3CC2S 2D74B 2LXIA 3SI8A 4ED5A 4H4KC 1FI4A 2QV6A 4LT6A 5I3UB 2BE2A 4AL6A 2GVDA 4LJMA 3RB4A 3QSYB 2WOMB 2IYIA 1LWCB 1RLDA 4CLFA 3MEGB 4G65A 1ZOTA 3BBCA 2W4CA 4J9VA 3ZTQA 1FTRA 1SKWA 2EEYA 2KL8A 1QVFR 2YX4A 3IS9B 5CYMB 1XTZA 3CF5Q 1V3SA 2NREA 2BE2B 2UV8A 2FJBB 4IDKB 1SH0A 2GVDB 1SJQA 1L3UA 5LMUF 4PYAA 2FJDB 3EWGA 5ETLA 1SI9A 3GFHA 2MQOA 4J9QA 3OTBA 2VBWA 2ROGA 1O51A 3QT8A 2KH9A 3PW5A 3OPKA 3QWUA 3PG9A 2YBVA 5CCLA 3KK1B 4U7CA 3M2UA 2OTLS 4WWSA 1Q86T 3I56S 3SCJE 2M70A 2AEMA 2OPSA 4KSEB 1X0PA 2HIYA 2ZJPQ 3Q22A 3C3LA 1U24A 3J7YU 5KT6A 3LWMA 3L9ZA 5EX0A 2DGOA 3GG0A 5IV3A 4CNZA 3GFYA 4XIUA 3BPSP 3IBCB 3C19A 1X4BA 1HHSA 3M2UB 2ALYB 3M6XA 5C25A 1JLFA 1RHKB 4Y6IA 1N56A 2FJEB 1H74A 4ECRA 3OL6A 3TZXA 2V4RA 4EK2A 2ASDA 4TU9A 4Q0BA 1FDBA 3G2XA 2GNKA 2VHGA 4F0KA 2ATLA 3SFUA 2VDHA 2KJWA 2HGLA 2XQCA 1JLFB 1KONA 2AIRB 4F4AA 1KFDA 3NCRA 1IM6A 2MJUA 3K5OA 4F0MA 2JSXA 2XSJA 4NXMF 1R7IA 2X51A 1ZTWA 3MMJA 2UUAJ 3O6QA 5B0BA 5ADZA 1TZ0A 3BKFA 1GEHA 3N6NA 3LO3A 2B3TB 1FRHA 1GMWD 2DGVA 3U1MA 2AJQA 3CD0A 2ZM6J 4LR8A 4I2QA 3I5AA 2KT3A 3DGPA 3RU0A 3QAEA 4HDGA 2UXCF 1Y5IB 4ED6A 1J27A 3U27A 2UXBF 1QM9A 1WNEA 2M7SA 4N47A 1IWGA 2NYHA 2H1YA 2DY9A 5KFXA 1RT6A 3W8GA 1NSQA 1F9EB 4OHVA 1NKCA 3OR1B 3PIOQ 1TAQA 3OVSA 3O1LA 5EUHA 5GAGI 2ILZA 3V2UC 5LXRA 2FHOB 3JYTA 3D28A 4OHXA 3NLCA 4DSIA 4OI1A 1TKDA 5E3AA 4LF4F 2HK2A 3BO3A 2BZ2A 1ICEB 1JLQB 2ZBQA 2A2DA 2HYIB 3AH6A 2W7AA 1RT6B 4DV4F 1H38A 3WQPA 5KG0A 1ZM4A 3HD1A 1KQFB 5JVGQ 3ZZPA 4ED4A 3EXCX 2VFSA 2R2SA 1WSRA 4CLLA 2C3MA 3GV7B 5KFVA 3QIPA 3SSQA 2A0FB 1ZAVA 5LXYA 1XNRF 1YJTA 4UF4A 2CUYA 4HT5A 3POTA 1F6TA 3GILA 4DV0J 1DARA 3GU0A 1UETA 2MPUA 1CG2A 2MQPA 2B9EA 4EGLA 4CLSA 1ITPA 4Y28C 3D1QA 3K89A 2MQMA 3DLEA 3UE2A 3QIPB 4MK9A 5AXNA 1WTBA 5GMKa 5C2CA 3POTB 1VBXA 3E51A 1EZZB 1N36F 1S72S 1S9FA 2HHHF 5DDOC 3CCSS 2CYYA 2OSRA 1TUGB 2CPHA 3TW0A 3K8WA 4QPTA 4C97A 1F5CA 1U1OA 3TR5A 4LFAJ 3GSDA 1U0HA 3JTPA 1KFSA 3W60A 4FXWA 4I2PA 3E8OA 1H0HB 1B0PA 3RJMB 4DBQA 1REVB 2ZOMA 3I0SB 4LBIA 2IVMA 2AQ4A 2GGPA 3J81Y 2A1BA 2KTQA 1QTMA 2O66A 2DRAA 2PT0A 4OX6A 3T1HF 2EFVA 1N34F 2XMUA 1S97A 3M6WA 2B4VA 2ZE2A 2F4VJ 3TYTA 1WSVA 4NCGB 1U0HB 3DRPB 3DRSA 1UFWA 2H4YB 5EHHA 4KGZB 5F9LA 4I2PB 3RB3A 4L72B 1HNIA 5J2NB 5T14A 3SXLA 2OP5A 4GVLA 5EWEA 2GHPA 1YRTA 4NYZA 2JL9A 1SCJB 2NYIA 2ZE2B 3CE8A 4M5DA 1X9SA 1A0OB 1KBRA 1QAIA 4NXNF 3V81A 1KVJA 3CCTA 3DRSB 4WK1A 4I6WA 1HNIB 2XNRA 3OL8A 1N32F 3VTIA 4MK8A 2A2CA 4NZ7A 1T9UA 4FP9A 2KDOA 1C1BA 3H2UB 4QOTA 2F3JA 3VGUA 3DXSX 1E6VA 2N3OA 4N56A 3R5AA 4RWXA 3ZFVA 2ACYA 2YNIA 3H40A 4TNOA 4LFCF 3OFFA 3V81B 3D2WA 1PJ6A 3N6MA 2GJFA 2RILA 4ANCA 4Z37A 4JI2F 3TA2A 4MIWA 1NZAA 3CD7A 1C1BB 3QRPA 2VB6A 4LVNP 4OZJA 3QT6A 4DR6F 1E6VB 3PX6A 4DV6J 2MQNA 1C4AA 5M2UA 2QLFB 2YNIB 3HM9A 2JC1A 2AZ3A 4QIGA 3T5JA 1ZYQA 1KWMA 2W4DA 3MOJB 1X4CA 1YJVA 1PYTA 4GMKA 4TQSA 1CC7A 1XMBA 2JLGA 2V67A 3TRGA 1F0XA 1F5AA 1KLMB 4NEZA 2LMIA 2BKOA 1Y4ZB 5AXKA 3SBMA 1U25A 3KHGA 3B78A 1BHNA 2HBZB 3MDFA 1TL3A 4DPXA 2BACA 4KJIA 5F3ZA 3CUNA 1V9OA 1RAGB 1H6KX 2QO3A 1OS5A 3CO0P 3UN5A 2R7QA 4WE1A 4ZPBA 1VQNS 2CWKA 4OV1A 2B9WA 3NS5A 2P9CA 4MH8A 2DGUA 3BSCA 5BYQA 1M5OC 3BS9A 4JB8B 3WC2A 2MXYA 3R8YA 1XMOJ 2ZEJA 3X3UA 1RTDA 4KB7A 1KHWA 2W9AA 4O3RA 2V4QA 2Z0GA 3CJ5A 1FHTA 1HI0P 4WE1B 1XERA 4KGKA 1WHYA 1DQAA 1DURA 1NB7A 1X4EA 4HT7A 4IKAA 5KFRA 1G4CA 2ZH3A 1RQ0A 4LF6J 3QBCA 2DNHA 4LFBJ 3TUZC 3ILJA 2EFGA 1Q5VA 1RTDB 1PO6A 1QSSA 1MWYA 3PR4A 2QMUB 1VQYA 3BV8A 3UCGA 4DV2J 5F8NA 1YBAA 3D6FB 3NXZA 4MYUA 1KHVA 5E0OA 3EVOA 2P6SA 2H48B 4IUFA 4FKXA 3DC2A 3I4HX 4M5LA 3MD1A 3AT1B 5DO2A 2RQKA 1TL5A 4JI0F 1NXIA 4NLVA 3L3CA 2HEKA 4A48A 1FWKA 2D3UA 3HZGA 3RW6A 3B54A 2KXHA 1I94F 3UWTA 4ECQA 4CTAA 5HROA 3R9LA 3R27A 4I64A 1KNZA 3OFEA 5DG9A 2HQCA 2F9DA 4KFBA 3PV8A 5F9NA 2C2KB 1TK5A 1MSWD 5KFOA 1X8DA 1CS4A 4O3QA 4CLYA 1WC4A 4NASA 3NAIA 1Y5LB 1UWAA 1RWVB 3BQ2A 4HL9A 5CXTA 3OHBA 1REGX 5HROB 4CH1A 1GNKA 2RU9A 1UVIA 5CZVA 4XDCA 4RNOA 4F4WA 2HFSA 2N7CA 3JQKA 4KFBB 3BR8A 3HX9A 4K2JA 3TUPA 4W98A 3RAMA 4UW2A 1O0PA 2PMWA 2LVWA 3OT9A 1HW8A 2HNYA 4PXDA 2QE5A 3ENQA 3MEEA 1U6BA 4DFJA 4TLRA 2CJBA 3AFGA 4OZ5A 2PI4A 4DMZA 3E2EA 3HSDA 4JBCA 3MCOA 2UU9F 2J9DA 4DQIA 2AX1A 1KKHA 3BGLA 2J7KA 4BDPA 2V68A 1NDLA 4ZA1A 2E7VA 4X4QA 1HWIA 4C6AA 1IR2A 3G8SA 4PG8A 4ZN3A 5KT2A 1WKKA 3MR6A 5L39A 4FF1A 2BMBA 4ZHRA 1VC6A 4WP8A 3MEEB 4M95A 4UQGA 4XAKA 3Q8QB 1TAUA 1CJTA 2E5JA 3ZXWA 6FDRA 4DL6A 1T9XA 5H9EK 4PEOA 2IC3A 5B0GA 3HSJA 2VZ9A 5KG7A 1TP7A 1RISA 5E3CA 5HVFA 4ZHRB 3UDCA 5HJXA 1U1MA 2DNYA 1QUVA 1UVNA 1HBMA 1FXDA 3QSIA 3S7RA 5J2MA 1JNRB 3LA0A 2DHXA 3HJVA 5DZ6A 5DLGA 2IC3B 1N33F 1P27B 2FZCB 3P5BP 2QIFA 2A6MA 3U02A 2X1AA 3H59A 2WHOA 5KFMA 3MOZA 1U49A 2RIJA 3CJSA 1HR0J 2E5GA 3PYFA 5KT3A 2B4PA 2RH3A 3TA0A 1HBMB 4NLDA 1DZ5A 1KN6A 4LSNB 1R3NA 3TZWA 2CZ4A 4NL5A 5J2MB 4MIBA 3MZIA 3OXLA 2WONA 1FWLA 1NHKL 3T1YF 5KFWA 2XO7A 2UVUA 1RT5B 3T5KA 5A2QY 3G6VA 1U4BA 1IKWA 3AOBA 4FYYB 4NLQA 4DUYF 3M32A 3AHPA 2KVIA 3ELHA 1R6YA 3LP0A 2R7VA 2Z56B 3BB5A 2CJKA 1M1GA 4FF4A 2WONB 1FEEA 3M2VB 5KOWA 4WF9Q 1FRKA 2AV5A 2IHR1 2ZKUA 4DSKA 2CZ9A 4DG1B 1IKWB 1QAYA 2B9XA 4F2SA 4ZLLA 3T5LA 1YX2A 3M6UA 3C15A 3E01A 3OLBA 5H9FK 3LP0B 2OSQA 1U45A 1X0FA 3E3XA 3QO9B 3RBZA 1GX5A 3I32A 3BO2A 4YB5A 3W2VB 1EP4A 2HVDA 4OI6A 3UFCX 5KOXA 3M9MB 3CCLS 3MUVP 5KTQA 4ZVHA 1L3SA 3C15B 1VHFA 1RABB 2N7YA 4KHRA 2V50A 2CQHA 2AYMA 2W25A 4AL5A 2HWTA 2BR0A 1G6BA 1RAFB 3V6DA 1X4HA 2MB0B 2AJ1A 3I96A 4JI4F 4DS5A 3ZZ0A 3VAHA 2HQGA 3QLHA 2J8SA 5A8RA 2C2RA 5FDLA 2VPYB 3V4IB 1N0UA 4DV7J 4O4GA 3IWLA 3C66A 4DR7F 4PKDB 3M9OB 4ZIVA 2UVWA 2VPWB 2HGMA 2OPRA 1MMDA 2CDRB 6AT1B 1LWFA 4F4ZA 5F8GA 3PX4A 2EFOA 1LV5A 4NLRA 2HZCA 1HI8A 3KG1A 3C16A 4MT1A 3V6DB 4IFVA 2AEJA 3QLHB 3JTOA 3V4MA 3VR1A 5A8RB 1HNWF 3FQKA 5FDLB 4IR9A 4ANEA 3J80U 1HLWA 1BWEA 4IQXA 4WFXA 2AHOB 4K4YA 5F41A 2ZH1A 2Z4PA 5IZHA 3AAWB 2OPRB 3IRXA 4K0KJ 1LWFB 1JLGB 3DGVA 2BM1A 2KFYA 2ZBRA 3C16B 4LRFA 3Q2TC 5KFGA 5FD1A 4IFVB 1OJ4A 2UUCF 2V8GA 3UN2A 3KXDA 4ZVOB 3NS7B 1T3OA 3MM6A 4JI7F 4KH0B 1R31A 2NXUA 4LIRA 2BJEA 2HLUA 4AQYF 1AFJA 3PTWA 5KFLA 4DQPA 4DJBA 2HHSA 2EBEA 3MEDB 4P10A 1YQHA 4AFFA 4A8XA 3K5MA 3KMQA 3KMSA 2C2OB 3MM6B 2ZH4A 2GHWA 4IRDA 3ETOA 1SBRA 2RS2A 1RP5A 1YKWA 1D0EA 3OVAA 2HG4A 5GMEA 3DLJA 3O3LA 1G1XA 2CPXA 5FJ4A 2YH1A 2I6WA 4X84A 3GV5B 2ZDOA 3LP1A 1TR0A 2YKPA 3TVZA 3T9NA 1B64A 4A4JA 3Q0AA 3H42A 1OPZA 2HZAA 2K3KA 1HWJA 2W2OP 2GMJA 2OLWA 5LT5A 3OR2A 3ENWA 3GP9A 4OLOA 3HHKA 3H4BA 3IG1A 4CO5A 3MR5A 2CQ3A 3IGVA 3MWBA 3J7YI 4EMDA 5LMUJ 3W3SA 4XK8C 5ETPA 2HRUA 2FZGB 3CJ8A 5F8JA 3NEKA 4NLGA 1OSCA 3Q24A 2G0IA 2YTCA 1YK9A 5AJ3F 4WK3A 4F3OA 4NCAA 2IM0A 3HVRA 1VK8A 2U1AA 4P2XA 3PYEA 2QSWA 3EDQB 4C9DA 4MTPA 4DL5A 4RW8A 4XO0A 3KOAA 4DHVA 1R8BA 4KBIA 2VKRA 1TKZA 2DRDA 3BQ0A 2G1HA 4YMEA 3O44A 4KC5A 4AUKA 2VU5A 4UOGA 2D3OR 5KFJA 5D0HA 2FYXA 5EN1A 2KHDA 2PI5A 1PG5B 3CC4S 3CWJA 3QGPA 2XHCA 2CJAA 1K47A 3Q89A 5DM7Q 4FXDA 3VGVA 1RACB 4RW8B 3GWCA 1B70B 2AX0A 2LQ5A 1TKZB 2GMLA 5D6GA 3F0NA 3TUIC 5IS2A 5F8MA 1D9AA 3EX7B 4NMXA 1SH2A 1UKUA 3Q2SC 5GADI 5DDRC 4MJKA 2RVJA 4RX6A 2LLZA 2CADA 2CPJA 2CA9A 1PBAA 4DLGA 1GXUA 5L46A 3KJFB 2H4WB 2MZ1A 4NXMJ 2XWXA 2DR9A 2BXJA 1RBAA 5ETRA 1RWUA 2N4CA 2PFDA 3MR7A 2DT9A 1CQNA 4FYWB 1YTYA 2AJFE 3QGHA 2GC8A 1RKJA 1X9MA 5KFPA 4PG4A 1ULRA 4ATNA 2J0QD 2HRTA 4X4VA 1EETA 1SB6A 3HZEA 3MHYA 5LOQA 3KFWX 3SCKE 2B4OA 2UXCJ 3FBEA 2ZJQQ 2UXBJ 4RO0A 4NLOA 3OFGA 2VFVA 4OYOA 4CQ1A 2NR0A 1YWXA 3A8EA 3L7OA 2XZTB 2CAJA 2VBYA 2GIQA 1QAXA 4F8RA 2IAJA 1EAYC 1WKJA 5A6PA 3RBXA 2M8HA 3GPAA 4HR2A 1YHQS 4DX5A 2CPFA 4LF4J 1VK3A 2HVZA 2J9CA 1MG7A 4C0BA 4IFYA 1XR6A 1RT7A 5DG8A 4DV4J 1PBUA 2VL1A 4ELVA 5C24A 2XBPA 5KFHA 2HIQA 8AT1B 3DYAA 4M63A 2CRLA 1U09A 4C2MA 4J9LA 2PFFB 1FVQA 4DF4A 4HHJA 2CQPA 3MMBA 4M5HA 1XNRJ 4F4KA 1MWQA 2NPIA 1YRXA 1P1LA 2ZITA 1FKOA 2XMVA 4KGMA 2BBEA 4QIVA 1U1PA 3WC0A 3C14B 4M5KA 4YN3B 1AYEA 3BSAA 7FD1A 3DYAB 2ASLA 3PHTA 3NNHA 3HMJG 2F1FA 3KJQB 2M4MA 3MMBB 1T95A 5BJRA 3MD3A 4WIIA 2ZH5A 4DSFA 4C8KA 4K8RA 1FKOB 1N36J 2ZZMA 4I4BA 2HHHJ 1AB8A 3MTJA 4LUBA 1MROB 1LFPA 2HS3A 3CB4A 1N5YB 2W7PA 2GIFA 2BQ3A 2Y1JA 2CVEA 5CYJA 2WB4A 3GFZA 2XY7A 2M0GB 4Y0FA 2GQ2A 1UVMA 2KFZA 3GJQB 2PMHA 1BQMA 4ZP8A 3B4MA 3T1HJ 1N34J 3DHXA 2AJ4A 3NMRA 4D3GA 3W65A 2LP4A 1NK8A 4J9UE 1NNDA 1DHMA 2DXFA 3KDNA 3C6UA 2UUBF 4P71A 3TVYA 2J7UA 2OPQA 5CD4A 4ED8A 4OJ3A 3KG4A 3MFIA 3KLGA 3UW1A 1BQMB 2GA7A 1SV5A 2AF6A 2IDEA 2BEFA 1R0AA 2MMYA 5IT4A 5A8KB 3C6UB 1HYSA 3NG8A 1F9HA 1RSCA 1GXLA 3PEHA 3SQOP 2DH9A 4OYAA 2FHJD 1YITS 2ASYA 2AKWB 2E1MC 3PVXA 3KLGB 4C98A 3A3NB 4RPFA 4ED2A 2B0GA 1IQTA 2NQPA 1SV5B 4B08A 1R0AB 3P5TL 3IBFB 4LFCJ 1C1CA 1ZS6A 4QW9A 2K7KA 1HYSB 4EYHB 4B9VA 1KRPA 3Q8RB 2KJVA 1UZHA 3HVTA 4QJVA 4YDXA 1FXRA 4HEA9 3VAGA 5D4NA 4QBUA 3SQGA 1J5OB 3WIVA 4JI2J 4P2MA 3V5RA 1VRTA 3HHLA 2FJVA 4DR1F 2MZQA 3DOKB 3N9UC 2CWXA 5KG6A 1OYEA 4DR6J 3LALA 1PIEA 4Y2CA 1E6YB 4G3IA 4TY9A 4EEYA 2NXCA 5FLXY 4PQUA 4EWTA 3AOCA 1IR1A 3HVTB 3J7Z5 2VFUA 4XDDA 1UW4A 3SQGB 1TL4A 2VJVA 4KO0B 1N88A 3HHDA 2CKWA 2ZNYA 4WU3A 2BM0A 3QJPA 4PQAA 5C42A 5HQLA 3OTOF 3DOMA 1SKSA 2FJXA 2KZZA 4F50A 1WG5A 3ZZUA 3QZ8A 4OX8A 3QJJA 2K2PA 1FFWB 1SL1A 1LKZA 5I3QA 2E44A 1NO8A 2OFGX 3DLKB 3VGSA 4X66F 1FDDA 5B0FA 4YHHF 4L74A 1FERA 5A6WA 4ZP7A 1ZM9A 1RWNB 2O3DA 3CD5A 2B51A 4ZPCA 2DHHA 3P45B 1D3WA 1BXNA 5HMWA 3KNGA 2EC0A 5CH7B 1PCAA 2KXNB 4U7UK 2HWIA 3TWZA 4A8OA 3DLBA 2OAUA 3TAMA 4H4KA 2O01C 1S4EA 3DMJA 1BQNA 3CDWA 5HBMA 5J1EA 4GKKF 4URSA 1JMTA 4A46A 4ENOA 4DR2F 1ZPWX 2B4UA 4L73A 2D69A 1RT3A 4WFYA 2VIHA 1QVGR 2Z57B 2X3DA 4NMLA 5D8HB 4DL0C 3CW2C 2ERRA 3CULA 3HFKA 2IIHA 1BQNB 1PYSB 4NE9C 1JLCA 1BQXA 2F8MA 3N4WA 5B09A 3KLHA 5B0EA 3FZBA 4JI0J 2Y1IA 2YPZA 4FS2A 2AYGA 1LFWA 4P7VA 3Q8YA 3SEOA 3KG0A 5HMYA 2Z30B 4GVBA 4OFZA 4KHMA 4PXBA 5D4LA 2XCAA 2HHUA 1RHRB 1YJRA 4UUXA 3EJMA 3D6HB 3W8PA 5BYSA 2DNMA 4JYAF 4X4TA 1JLCB 2CJQA 2CFXA 2DY1A 4ILRA 4HI1A 3KLHB 3GFXA 3M8SA 1VQSA 4LQ3A 2BJ1A 3JSRA 4N5SA 3S8SA 4LF5F 4OQJA 2BYCA 3R5JB 2ZUAA 4ANDA 3G71S 3GYXB 4GVBB 1NK7A 2MSTA 4AL7A 1X4GA 3H25A 5CCMA 3GB0A 4NI2A 4ECUA 3NY0A 3MMCB 3PJWA 3NWRA 2PE8A 2BW2A 4UY8T 1BUXA 1VFJA 1HQUA 2LXFA 1HNVB 3QIDA 3H5SA 1DTTA 4OHZA 2QZ8A 1S79A 4UOFA 3UN3A 4LBPA 1ZA2B 2OMLA 3W1YC 1HMVB 3PW4A 2UU9J 5J2QA 2PDAA 2CJ9A 5T41A 5EX3A 1S1UA 2Z2ZA 4C0OC 2PN6A 1XQIA 4FN5A 3H7HB 4CH0S 1VQ4S 2K1RA 3I9ZA 1V6HA 4X4PA 2YKQA 1M5KC 3QATA 5JUMA 1SQEA 1UJ4A 4NLWA 2DB1A 4ZJQA 5D0RA 2DIUA 2N82B 4TKTA 2O1PA 3JXOA 2PIIA 3IRWP 2IRYA 2IBKA 2VA3A 1R27B 1AZSA 1S1UB 1Q79A 1VHIA 1NJIT 2WZ1A 2BANA 3SIPB 3Q8VA 4HHUA 3W62A 1FJ7A 3GIIA 1J5EF 2DCUB 2IRUA 1NU4A 3U1LA 1B7YB 1QE1A 2YH0A 4DPWA 3UD3P 1RT2B 3S01A 3TO8A 1TUVA 1TFYA 4M5IA 4ITSA 2RRBA 1KOHA 2HS4A 1N33J 2QX0A 1TMJA 7AT1B 1PKUA 4BC9A 5GAHU 2MQQA 2EFQA 2AGOA 2E66A 1CJUB 2YWWA 1JB0C 1QE1B 1VLOA 2JVRA 3AQPA 3WHIA 1HHTP 4G6VB 2RDDA 2HMIB 1FDAA 2QFIA 1LWXA 3T1YJ 4ILLA 1A7GE 1UMJA 1Y5NB 2FHKA 1DRZA 8RUCA 3OQ2A 1NJWA 4K5RA 2B8QA 4ZVRB 2XTJP 2NCKL 4PPZA 2D3ZA 3ONQA 3KK3A 1NH8A 4J37A 2VA2A 2KYXA 2ZD1A 2JEIA 2FUG9 3K8VA 5HSPA 4PXEA 1WUUA 1S76D 1T9YA 3MCMA 3DDNA 4O4RA 3M4XA 5ETMA 1WDTA 1L3KA 4AD6A 1FX2A 2KT2A 3OSPA 1VBYA 3A8KA 4A8YA 3CMAS 1F9FA 4USUA 1YJNS 3KK3B 3TEHB 1VC5A 2QMXA 4X4NA 4Q7AA 1ZZFA 2NZCA 4B3TF 4RUHA 4ZVFA 2GJIA 1HWKA 3FRZA 4UT4A 3NNCA 3ET6A 3ENVA 3LPYA 3NGDA 2F65A 4Z7YA 1RJJA 3M8ZA 3WBZA 2HURA 4DR4F 4HTJA 2VH7A 3HPOA 4M5MA 3G8TA 1DY3A 4O0NA 4CLUA 2XMAA 1FA0A 2B5JA 1FO1A 4QW8A 1B7FA 1OMSA 1N48A 4OV6A 4JI4J 3ET6B 2F9JA 4OZ3A 3OJSA 3ITHA 2NUUG 4JP8A 2VFTA 4NLYA 4OIXA 3HULA 4CO4A 4DR7J 2FVPA 3MR2A 4CO0A 2OEKA 1LXJA 3N6LA 2YXLA 2B5JB 3R5CA 1UJ5A 4PCQA 4NX9A 2A18A 1FKPB 2DRBA 4F26A 3NCQA 1RXOB 5KG5A 2ZOFA 2C3PA 3ITHB 1HNWJ 3QPIA 2MSSA 1F3VA 1KLNA 3TVKA 1F2HA 1VOMA 3GZ7A 5LJ5Y 4ZP9A 1YSJA 5M2PA 4KV8A 2J9EA 5AE3A 2MZRA 1NK5A 5SUHA 5B0AA 3PKYA 4L3KA 5J2PB 1M5HA 4E2FB 2MEWA 3K5LA 2GCFA 2UUCJ 1XBWA 3MMAA 3C8YA 1SL0A 2CQ2A 2QJ3A 1RT1B 1HQ2A 4JI7J 4TLQA 3ILIA 4J7CA 4LQ9A 3HKWA 7FDRA 2XC9A 4WKYA 1K1QA 5DG7A 1TVRB 3TQ1A 4AQYJ 1DAXA 3D3CJ 1S1WB 2R3VA 4ZPVR 4ED0A 3VHQA 4DS4A 1URRA 1CJKA 2XMKA 1LW0A 4IYQA 1T9VA 2V4JA 5HATA 5KFNA 4TQRA 3KUHA 3MMAB 3CJKA 5KG1A 2GQQA 4DR3F 1H7WA 3P6YC 1S57A 3OJUA 1JLBA 2VG6B 3TEGA 4BHQA 2HAFA 4M94A 2MY7A 5KFCA 3KHRA 3IAS9 1LW0B 4ZN1A 2B56A 3TP2A 4YS2A 3R7SB 3CJKB 2B43A 5D78A 2ZBCA 2D7SA 1UA0A 2LEPA 2W2QP 1NJYA 1WC0A 3QZ7A 3DI6A 2CQIA 3KLVA 3MM7A 2AWZA 1KTQA 2AT1B 5IT9U 4ED7A 4A8WA 3EGWB 2XMTA 1VQ5S 1LK5A 2GVZA 1YBTA 1NDKA 4WZMA 2P2CB 4KGXB 3B6BA 4ALZA 4DEZA 2LCWA 1XR5A 4TYBA 4CO1A 1YZ6A 2ZNZA 4BBYA 5AJ3J 2ZUGA 1Y3JA 3CCVS 4F25A 4ERDA 3R1LA 2V69A 4P74A 2V0NA 2H65B 9ATCB 2ASJA 2DNQA 3TJ8A 1RGVA 1DQ9A 2QL9B 2C42A 2DHGA 3NL0A 2CPZA 1UEVA 5L9NA 4QPXA 2H54B 3D6MB 4KIAA 4I7FB 2FC9A 1U1NA 4IH7A 4OMFG 1RE1B 2J6SA 5KFFA 2XULA 2BV3A 1WG4A 4RW6B 2HBQB 3KTQA 2QLXA 2HGNA 5DQGA 2VPXB 4K5SA 1M5SA 3W7BA 4I0WA 3CJ3A 1FXLA 3SZ2A 2V2ZA 3FCHA 2OPPA 4CH7A 4Y3CA 3J7ZT 4IQMA 1QD1A 1IWAA 2HFOA 1HD0A 4DV1F 1RB0A 1HQEA 2FTRA 2Q79A 2YQ1A 4ED1A 3D3BJ 4C3MA 4RBUA 4YDDB 4UOHA 3TZYA 1K0TA 1JNZB 1K73T 2WOMA 2IY5B 1UW9A 2CNOB 3FNNA 1B4SA 1ACMB 1B3TA 2ACMA 1C0UB 5IQQA 2ILYA 1N54B 2OPPB 4PABA 4KKOA 5RUBA 1IQZA 3M9NB 3IS9A 3IFEA 5CYMA 5K5MA 1U26A 4JI6F 2CQCA 1HQEB 2WSFC 1KSPA 3B4DA 4IDKA 3AD9C 1YBUA 1WEYA 2RQ4A 2FDNA 2CZVC 1YIJS 3FMBA 4UUWA 4I1TA 4OYZA 1CVJA 2DJWA 2HKEA 4DV5F 2WSCC 4CM0A 3CSKA 3NMAA 4KKOB 3D9BA 1S49A 3TUJC 4PRFA 2HHWA 3KK1A 2KFNA 1RTIB 2XZDB 2B8PA 1NK0A 1NLKL 5IM0B 3IXQA 4ELUA 5L1JA 3DHWC 3AD8C 3ISND 5B7WA 2D9PA 2AD9A 2BDPA 1M5VC 3PO5A 5I42A 2A10A 3M8QB 5ETQA 2KHCA 2ZHOA 4QYZK 1VCTA 4RW4A 2EG1A 1TQLA 2E5IA 2OH2A 3HSGA 5A8WB 5CHCB 2KM8B 4KR0B 3N28A 2XEXA 5F8IA 4OYPA 4LVOP 2OHDA 4OL8A 5HMXA 2QEXS 1S1VB 4ILMA 3GIKA 4DSJA 5SZTA 3UR0A 5I42B 4ZLPA 3RR8A 2F4FA 4WZQA 3RW7A 4YR0A 2RQMA 4F02A 2LEAA 1D1UA 4ID5A 3QQCD 5T7LB 4RW4B 4NPOA 2KG1A 3IBWA 2NZ4A 4J90A 2IA0A 1VMBA 2C2NA 2BE9B 3VAJA 3PW0A 2I1RA 3ZTOA 2W7OA 5LMNF 2RAQA 4F4YA 3OHAA 2OFHX 4CP5A 4NA2A 1U8SA 3W64A 1LOUA 5HANA 2XLIA 1CPZA 5IOLA 1Y3KA 1VI7A 2R8HA 1JXVA 3VQTA 3A12A 4ID5B 4C8LA 2QTWA 1UA1A 2HQIA 1KVIA 4ETXA 4V19X 2VQEF 1JXLA 1RAAB 5IFMA 1IBMF 2E9RX 1H73A 2RDJA 2BW7A 5HO4A 3LF0A 2UVRA 3DLHA 5IXUA 2XGPA 4B9TA 4F67A 1R89A 2M8DB 1K44A 1XMQJ 1WDDA 3M8YA 4DX6A 1IBKF 3T6JA 4DR5J 2XI2A 3KWMA 2CJXB 1RHJB 2IA6A 2GFFA 4HACB 5IQ6A 4A8MP 3OR1A 4DOZA 2V8HA 1CLFA 4DQRA 3QNWB 2MKYA 2RMLA 3T3FA 3TZZA 5I4MA 3NGRA 2SXLA 1JQGA 1C0TB 1SQFA 3BGUA 4USIA 1JLQA 2UVVA 2UUBJ 3SCIE 2LXUA 3BBFA 5HLFA 2CJYB 4KGVB 3TI0A 1S7HA 1S77D 1NUEA 2X3GA 2IJFA 4QIEA 2V2KA 3UD5A 2F63A 5L1IA 4PG6A 2ZH7A 2R8IA 4RWWA 1B0VA 2HQDA 3IM9A 3FDSA 3I31A 1VIOA 5HK4A 1SPBP 2MLXA 1L3TA 2M52A 1HA1A 3LAKA 3MPWA 4O23A 2JOQA 3DRYA 5HLFB 1WC3A 5EDWA 2G9OA 4I6AA 4QYRA 2WAQD 1QDUB 3FBCA 1RWOB 2DR7A 2WTFA 4W90B 3DRXA 1I5OB 5CA5A 5K8MA 2JEGA 1JLEA 1MN9A 4WJBA 3ILOA 2HHTA 2Z8QA 4KTQA 1UPPA 2AMCB 3D6TB 2VV5A 4R8UB 2DVIA 2KRBA 2DGTA 3HP6A 3O2IA 2QG9B 3ICLA 4DR1J 1JLEB 1Y00A 1OO0B 4QIFA 3ULHA 4DF8A 2OEMA 3NCPA 1REVA 1HI1A 1SH3A 2H5IB 4OI2A 3I0SA 2YKNA 1TKTA 2IM2A 1S99A 1UFKA 3CIMA 1WF2A 2QYCA 4DL2A 3G87A 4I69A 4X4RA 1WORA 4KH1B 1AA1B 2HRYA 5CQGA 3Q8UA 2XM3A 1AROP 5K8NA 3FQLA 2M9KA 2CQDA 4NCGA 3DRPA 3OXGA 2QLJB 2GAGC 2W8LA 2HNDB 4QCLA 5J2NA 3JAMU 4OYBA 2Q3PA 4FXVA 3OTOJ 1AUSL 2YKNB 1TKTB 1YJWS 3SFGA 3O5TB 4C7QA 3GCWP 3GCXP 4B3OB 1S6OA 1NBEB 2NS1B 4AE5A 1NPPA 3H20A 2QA2A 4LF2A 4F04B 2OEJA 1RAIB 2CPIA 4X66J 2XWYA 2MHEA 2WRMA 3FSIA 2CQ1A 1TUWA 3OBIA 4YHHJ 5KAKA 1N5QA 4URQU 2HW3A 1T03A 3F56A 4OZLA 4LR9A 4CNYA 1JJ2R 1N5VA 2IM1A 1TMMA 1M1HA 1RI7A 1OYDA 2I8EA 3AQOA 2BOPA 4ZCIA 1ZETA 4QWDA 1V5VA 2XNQA 1WF0A 1TKXA 4GKKJ 3ZTRA 3PEJA 2A3JA 4DR2J 1NRKA 5ETNA 4WU2A 1T03B 3PY8A 2AP6A 4LF6F 4ZVGA 3G96A 3KJVA 4JI1F 1Z1ZA 3OUYB 4FZVA 5DETA 2VG5A 3NOGA 3N5BA 2Y0BB 3GYGA 1TKXB 2ZHAA 3IWXA 1GAOA 5EGYA 4P7TA 4CZCA 4ZCKA 2QFJA 1IJFB 2P5VA 2LKZA 5KT7A 1KLMA 3RRGA 2DR8A 3L4BC 1TL1A 5L8RC 3KJVB 2ROPA 2CXEA 4EBCA 3A1YG 3ZZOA 2W9CB 4V19J 2HVIA 2HWHA 1EQ0A 3AA8A 3RG6A 2VG5B 4RW9B 3UD4P 5L1LA 2BABA 2YY3A 3BN7A 4JYAJ 2W2NP 2MHNA 5THWA 4ETZA 3IA0A 1FFSB 2DNPA 1GMVA 3BGOP 3DLGB 2HNZA 4DL7A 4JI3F 4LF5J 1JJ4A 2UV8G 3UDVA 1M90T 1TL1B 2PEHA 4I68A 3EYZA 3G6XA 2MKSA 1NK9A 2UUTA 2R7SA 3CCJS 1FRMA 2VOPA 3VAFA 2XYHB 4QR2A 2HZVA 1TK0A 4RLEA 4E98A 1HPZA 1HBNA 2J8AA 4GKJF 2PD1A 2JNJA 3LP2B 4ECYA 5A0YB 2HNZB 3FBBA 3CCES 1O6XA 1R8AA 3DU6A 3M6VA 2RUSA 3NGUA 4C4WA 2HFVA 2ZWOA 1ZTTA 2W9BA 2E1RA 2EVZA 3RB6A 5G4DA 3CMQA 4ZJLA 5KFQA 4PYDA 5J1PA 1FFGB 2IM3A 2C28A 3MR3A 3IP0A 4ICLA 1Y11A 2HSEB 3LWLA 1HPZB 2XB2D 1HBNB 1UZDA 2LQ9A 1NPKA 2AJ2A 2Z2MA 2RHSB 3NRBA 2DPIA 3RUBL 1VGYA 2DKOB 1DBDA 3HSZA 5KFUA 4K4VA 3PYGA 2W9BB 3MGJA 5D4OA 2GQCA 1L3VA 3G6ES 4ZKAA 1CJVB 1RZMA 2K7JA 1N4LA 3TX0A 5GAHI 2F5GA 3DDKA 3IMQJ 4ICLB 4BWMA 1O8BA 4JI5F 4ZVUB 1PGZA 1Q78A 1T05A 2NSCA 4O3NA 1NM2A 3AJ2A 1GH8A 4K4ZA 4Q43A 3Q83A 4IH5A 2YQ3A 1XNQF 1ZAXA 2XHWA 1IN0A 3H4DA 3MM5A 4C0HA 1QSLA 1S7IA 2GAHC 3HK2A 4NRUA 2WVFA 3IGNA 5EWGA 5B0CA 2IDLA 5HI7A 3CC7S 3NOCA 2BRLA 1F1BB 3MI7X 4ZVQB 1T05B 1SIZA 4ZCMA 2FC8A 4Y2AA 1JKHB 4J9PA 4IOBA 2Z2LA 3D0GE 3BEGB 1X5SA 1BY9A 1YJUA 4G1IA 4R5PB 3MM5B 1KEKA 2RQCA 3QAUA 1F3FA 1WACA 2HK3A 4RBVA 5K14B 3GIRA 1KDNA 4URGA 3OVBA 2AYEA 3LUYA 1WG1A 4USWA 2I5JA 3F44A 1S5ZA 3PZPA 4ZIWA 3DM2A 1WHXA 1FD8A 3I82A 1Q7LB 3B82A 2HQ3A 4FF3A 3MCNA 3A8JA 3FEZA 4QWAA 4B3SF 1FKAF 2FIUA 1VIXA 1TL7A 1RT4A 4W4MA 5KFSA 3W2WA 3JSYA 3GV8B 3KYLA 2UZAA 1RA6A 4GC7A 1UEUA 1OY8A 3OTCA 3I55S 5GAEU 2POKA 4USVA 2I5JB 1SJFA 2BQUA 1NDPA 2KM8C 4AYBD 3DM2B 5E3QA 1T3NA 4RNNA 1RTJB 1IVZA 4IRCA 4DFPA 4XPEA 3NAHA 2PC6A 5IC4B 4DQQA 2DIVA 1L5UA 1TL7B 5E5NA 4B3TJ 1RT4B 2R7TA 5DS7A 1KOOA 3W2WB 4MKYA 1WOSA 3UCZP 2EG2A 3GMGA 3OV7A 4M5GA 4B9UA 2Y8WA 2EW9A 3MECB 4DR4J 2C1EB 2BKNA 2DNZA 4F3MA 3GJSB 1URNA 3KLEB 1S1TA 1FRJA 4LF9F 1WEZA 3M2RB 2XMWA 5DGBA 1J2VA 2JH3A 3EPGA 2PA3A 4DL3A 2G1DA 2NXJA 2IVFB 2D9OA 3FEXB 1X5TA 4ED3A 1UP1A 4DL4A 2IMOA 1MU2A 4LSNA 2CNKB 3THPA 4B17A 3BR9A 1U2RA 5KFDA 4DCOB 1S1TB 2RF2B 4DCPB 2IRXA 1NCLA 4ES3A 3IAM9 3W63A 3BKTA 5HJYA 1OQ6A 5DQHA 2AZ1A 1RT5A 3DDIA 1VQOS 3KK2A 1VQ6S 1SIWB 4I67A 3DOLA 1RYSA 3QRQA 2KT5A 1AXQA 1S48A 2VF3A 1PILA 2CNLB 3DU5A 1MU2B 3MPDA 4LRCA 4J9SA 1UL3A 4R0JA 3PNIA 3JSMA 3Q8PB 3M2VA 1U02A 1X31C 2J0WA 4C48A 3OXFA 2XS5A 4K0KF 1JWWA 1VJWA 5CYQB 1KVKA 5B0DA 4A8QA 1YJ7A 2NXNA 3W61A 3KK2B 4DG1A 3DOLB 2NLWA 1BGXT 1HL6A 3CCRS 2V8VA 1RAEB 5BR8F 3ZTPA 3TNVA 2PSZA 2VODA 5F0UA 2YNFA 4BWJA 4RR5A 3JSMB 4QQBA 4Y65A 3GONA 3QO9A 5KFKA 1FK9A 3W2VA 4TU8A 4QYZJ 4OZ0A 3RR7A 3IO1A 3S6EA 4JV1A 1LXNA 2G4BA 4DR3J 2FY1A 1Y0HA 2YNFB 2YNHA 2MLZA 1R8HA 4OJ1A 2VASA 2ZH2A 3I4PA 3LGMA 1CC8A 2RB7A 2XYGB 1FK9B 3V4IA 1Y10A 2L9NA 1WELA 2GMHA 4JV2A 5H1SV 1BLUA 2CNNB 3TANA 3LPEA 1WHWA 4DPYA
chains in the Genus database with same CATH topology
2QLBB 1RWWB 3GJSB 3R7NB 2CNOB 3GJQB 2QLFB 3IBFB 1NMEB 1F9EB 2C2KB 4ZVUB 1IBCB 2QLJB 1QDUB 1RWKB 2H65B 1RWOB 1GFWB 2XYHB 5IC6B 2QL9B 1RWNB 2QL5B 4ZVOB 1SC1B 3NS7B 1RWVB 1ICEB 5K20B 2CNKB 2H54B 3D6MB 1RHRB 2CJXB 3R7BB 2Y0BB 3D6HB 1PYOB 1RHJB 3P45B 4DCOB 3KJQB 4ZVTB 4DCPB 4ZVSB 1RWMB 1RHMB 2C2MB 1RE1B 3QNWB 2HBZB 3GJRB 3R7SB 2H51B 2XZTB 3RJMB 2Y1LB 3D6FB 2QL7B 2HBQB 4ZVQB 2H48B 3R6GB 4LSZB 3GJTB 4DCJB 3R5JB 1I3OB 2HBRB 5IC4B 1QTNB 2CDRB 3R6LB 1PAUB 4ZVRB 2CNLB 2C2ZB 2C2OB 1I51B 3P4UB 3IBCB 2CJYB 1RWPB 1RWXB 1SC4B 3SIPB 2XYGB 3EDRB 2XZDB 1SC3B 3KJFB 2H4WB 3KJNB 1RHQB 1RHUB 3EDQB 2XYPB 2H4YB 4JB8B 2DKOB 1RHKB 2HBYB 2H5IB 1BMQB 2C1EB 2CNNB 2FQQB 2H5JB 4ZVPB 2P2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLB B;  1RWW B;  3GJS B;  3R7N B;  2CNO B;  3GJQ B;  2QLF B;  3IBF B;  1NME B;  1F9E B;  2C2K B;  4ZVU B;  1IBC B;  2QLJ B;  1QDU B;  1RWK B;  2H65 B;  1RWO B;  1GFW B;  2XYH B;  5IC6 B;  2QL9 B;  1RWN B;  2QL5 B;  4ZVO B;  1SC1 B;  3NS7 B;  1RWV B;  1ICE B;  5K20 B;  2CNK B;  2H54 B;  3D6M B;  1RHR B;  2CJX B;  3R7B B;  2Y0B B;  3D6H B;  1PYO B;  1RHJ B;  3P45 B;  4DCO B;  3KJQ B;  4ZVT B;  4DCP B;  4ZVS B;  1RWM B;  1RHM B;  2C2M B;  1RE1 B;  3QNW B;  2HBZ B;  3GJR B;  3R7S B;  2H51 B;  2XZT B;  3RJM B;  2Y1L B;  3D6F B;  2QL7 B;  2HBQ B;  4ZVQ B;  2H48 B;  3R6G B;  4LSZ B;  3GJT B;  4DCJ B;  3R5J B;  1I3O B;  2HBR B;  5IC4 B;  1QTN B;  2CDR B;  3R6L B;  1PAU B;  4ZVR B;  2CNL B;  2C2Z B;  2C2O B;  1I51 B;  3P4U B;  3IBC B;  2CJY B;  1RWP B;  1RWX B;  1SC4 B;  3SIP B;  2XYG B;  3EDR B;  2XZD B;  1SC3 B;  3KJF B;  2H4W B;  3KJN B;  1RHQ B;  1RHU B;  3EDQ B;  2XYP B;  2H4Y B;  4JB8 B;  2DKO B;  1RHK B;  2HBY B;  2H5I B;  1BMQ B;  2C1E B;  2CNN B;  2FQQ B;  2H5J B;  4ZVP B;  2P2C B; 
#chains in the Genus database with same CATH topology
 2EFP A;  2YKM B;  3BJY A;  2MY8 A;  2YNH B;  1HWL A;  3CME S;  1D9D A;  3C2P A;  2ZKT A;  2N3L A;  2UXD F;  1SL2 A;  5KFI A;  1AT1 B;  2AGQ A;  5KFB A;  2E9T A;  3MUR P;  4S0M A;  2GX8 A;  2QL5 B;  1Z4U A;  4ID8 A;  4YY3 F;  3PRV A;  2DR6 A;  1LW2 A;  3GSI A;  1JLG A;  1S6U A;  2R7W A;  1VDH A;  5KFY A;  3VAL A;  4OYX A;  3GJT B;  2EI5 A;  4J9R A;  1IJE B;  2PEB A;  1SKR A;  2M3D A;  3UNG C;  4X65 F;  2FZK B;  3MPV A;  1LW2 B;  4YP3 A;  1ROF A;  4EO8 A;  1HNX F;  3JTN A;  5C2G A;  1CBK A;  4RW7 A;  4FDF A;  4OZ2 A;  3MED A;  4LF7 F;  3OL9 A;  2E9Z A;  4USJ C;  4KPY A;  1HNZ F;  2Q6B A;  2ZHB A;  4JI8 F;  4B9S A;  3HFV A;  3BSO A;  3W9I A;  3W5Y A;  1NSA A;  2COL A;  2R2R A;  2OPS B;  3LOU A;  3D54 A;  4Q8F A;  4OI3 A;  4DV1 J;  5HQM A;  2FLP A;  3B8H A;  3J81 U;  4RW7 B;  3D1H A;  3SV4 A;  3M30 A;  1R43 A;  4UY8 5;  1RKI A;  3KHH A;  4K4S A;  2IMW P;  3HHL D;  1KS2 A;  2RJZ A;  4U67 Q;  3FK4 A;  5C25 B;  3CIZ A;  1VRQ C;  1N5T A;  4P9S A;  2XCP A;  2G0J A;  2DTJ A;  2OGU A;  3K58 A;  2XG8 A;  3AY0 A;  4JI6 J;  2HHX A;  2DH8 A;  4LR7 A;  3SMZ A;  4Q0B B;  4YB1 P;  1I51 B;  4OYI A;  1WD6 A;  2OD6 A;  3MUT P;  2C22 A;  3P3D A;  1VC0 A;  1RLC L;  3M30 B;  4ZDN A;  3AOD A;  2H3E B;  2JHE A;  2GHV C;  4P2S A;  3MAQ A;  4DV5 J;  4PAA A;  3UNY A;  2H5J B;  3DN9 A;  3VCD A;  1ZM2 A;  2DXD A;  5HAO A;  2XSF A;  1MML A;  1M1K T;  3UI3 A;  2CPY A;  3BSN A;  2CIM A;  1NAQ A;  4YOE A;  1Q8K A;  2XSJ B;  3SYZ A;  5GAD U;  2RU3 A;  1XIQ A;  1VLY A;  4RKU C;  2GJ2 A;  1N8R T;  4NA1 A;  3PW2 A;  1Q8B A;  2Q66 A;  3HXM A;  1F5B A;  3LGN A;  4I2Q B;  5AE2 A;  4A47 A;  1FRL A;  3K59 A;  2H51 B;  3DGP B;  4JUZ A;  4EUV A;  2L08 A;  4ELT A;  1D8Y A;  1LWE A;  5LSR A;  3NWG A;  3A3P B;  3CJ0 A;  4L6V 3;  1NZ8 A;  2V63 A;  2EWH A;  2KXF A;  4YFU A;  1UAW A;  1SKU B;  3UR3 C;  5KG2 A;  2VUG A;  2DIT A;  1WKL A;  1Q5Y A;  4DU7 A;  4FF2 A;  3MTK A;  3K57 A;  3BO4 A;  3A4T A;  3JYT B;  1LWE B;  2VQF F;  1H2V Z;  3JSB A;  1SC6 A;  3EGZ A;  2JFD A;  2LU1 A;  2YX1 A;  2QSF A;  5LMN J;  2FHM A;  5L1K A;  2KB2 A;  1IBC B;  3F73 A;  3J80 Y;  1NDC A;  4ER8 A;  2KG0 A;  1GFW B;  3CJ4 A;  4RNM A;  5ETS A;  5L38 A;  2ZVS A;  4PXC A;  5E7O B;  1OPI A;  2XI3 A;  2ZJR Q;  3KKF A;  5AXL A;  2VQE J;  4C3L A;  3BN4 A;  1RWM B;  1IBM J;  1PJ5 A;  2F40 A;  1WI6 A;  2NPF A;  3P49 B;  4UST A;  1ZAW A;  2B9Y A;  2YVS A;  2G2Z A;  3G6Y A;  9RUB A;  3HT3 A;  3T41 A;  3ETM A;  4LF8 F;  5ITH A;  2YWH A;  3W9H A;  3HI9 A;  2MJN A;  1XK8 A;  2DH7 A;  4Z2X A;  4WTY A;  4RZR A;  1Q53 A;  3DLE B;  1V3R A;  4Z7C A;  1IBK J;  1NPR A;  3R3T A;  4PWW A;  4P52 A;  3FCV A;  3RAX A;  3KHL A;  1Q82 T;  3QRR A;  4DI6 A;  1R6V A;  1I6J A;  1ZA1 B;  4P73 A;  3GIM A;  2LEC A;  2AU0 A;  3CJQ A;  1RTZ A;  3VZH A;  4BS2 A;  2GGP B;  3HT0 A;  1ELO A;  3BDE A;  1GTH A;  3M8W A;  3M1V A;  3J7A 1;  2G2O A;  2Z58 B;  4RNF A;  3VAM A;  2LDI A;  5LJ3 Y;  2RUG A;  1RAH B;  2BE7 D;  3C14 A;  4FVC A;  1IKY A;  2RNE A;  5KT4 A;  1ZZN A;  2BX6 A;  4ZJO A;  2Q6C A;  2NSB A;  1X4A A;  3ISZ A;  1U47 A;  2XGQ A;  1D8Z A;  3OD2 A;  3HVW A;  4CIO A;  3K5N A;  3R2C J;  3M1V B;  2W2P P;  5D77 A;  2FJA B;  3R5B A;  4LSL A;  4DPO A;  4M5D B;  4UTG A;  1KQG B;  3M8R A;  4A8K A;  1T9T A;  1RWW B;  5D3G A;  1Z2Z A;  1IKY B;  2ADB A;  1V3Z A;  4OYW A;  3BQ1 A;  1MRO A;  3GIJ A;  1H2T Z;  4N77 A;  1R0C B;  1GQE A;  3T5H A;  5BYR A;  1N5Y A;  1T11 A;  3H90 A;  3KNA A;  2LDY A;  4J9O A;  3CCW A;  4CYU A;  1RWK B;  2R7O A;  2BQR A;  1PJ7 A;  4LSL B;  1D9F A;  4PG7 A;  3FZ2 A;  1EIY B;  1FJE B;  4A8F A;  4RJV A;  1UCN A;  2IYG A;  5DRK A;  5D3G B;  1S9G A;  2L41 A;  3D0H E;  1MMN A;  3N0V A;  3TA1 A;  2XLJ A;  4B3M F;  4MMO A;  3C46 A;  2P9E A;  3EMT A;  4CYU B;  1VYA A;  2PO4 A;  2CQ4 A;  2QGF B;  4U95 A;  2DNO A;  1LQ9 A;  2LA6 A;  1U8W A;  2FPH X;  2R2U A;  2JX2 A;  1S9G B;  1IBL F;  2RHQ B;  1VQM S;  2JRS A;  2YPY A;  4C3K A;  4J9K A;  1P6T A;  2OO4 A;  1WWH A;  5A8K A;  4WYL A;  1PC5 A;  3HD2 A;  4ECW A;  2CQG A;  3U7J A;  4WP3 A;  3R97 A;  3N5F A;  4CLT A;  1YG0 A;  3T9Z A;  1TL3 B;  2PGC A;  5AE1 A;  4TVA B;  3THV A;  2IFX A;  2WBM A;  2B7C B;  1FJG F;  2CPD A;  1UWB A;  1BD6 A;  2P8I A;  3FEY B;  2QMW A;  2QN6 B;  4FBT A;  4NXN J;  1T02 A;  1PYO B;  3TAQ A;  2C2M B;  1UVJ A;  3V6H A;  2WVC A;  5JMN A;  2DR5 A;  1N32 J;  1MLA A;  2Y1L B;  2Y3Y A;  3FKB A;  1Q4R A;  4CLZ A;  1J5O A;  1HAR A;  4JI1 J;  3DOK A;  3MPU B;  2V8P A;  3I87 A;  3W9J A;  3CDB A;  1UWB B;  1E6Y A;  2KU7 A;  3BF4 A;  4DDF A;  5C5J A;  3HHN B;  1PSD A;  3SDE A;  2V9W A;  4RUC A;  4ECS A;  2ZH8 A;  3KLF A;  2E5L F;  1FRX A;  2HFU A;  2OUG A;  5A2Q U;  4KO0 A;  3SV3 A;  5L9X A;  2RSQ A;  1U1R A;  1OY9 A;  3BYP A;  1G7C B;  4V1A k;  2OMO A;  4ZS6 A;  1K9M T;  1LNQ A;  4IO9 Q;  2LQJ A;  3PO4 A;  3PR5 B;  3SDE B;  3H0P A;  2DYA A;  4IOA Q;  3Q23 A;  4YUD A;  2HHP A;  5JJB A;  2AJ0 A;  3KLF B;  1GMW A;  2Z2Y B;  4JI3 J;  1AW0 A;  3DLK A;  3HJF A;  4CO3 A;  1UJ6 A;  4G1P A;  2FGO A;  1YI2 S;  4YEA A;  4LRD A;  5KG3 A;  2E5H A;  4FPR A;  2QL7 B;  4K50 A;  2FLO A;  2HFN A;  4CWB A;  4DCJ B;  1DFD A;  2VKZ G;  4CTA B;  3R5D A;  2FVR A;  1RCO B;  2WVB A;  4WKR A;  4GKJ J;  1NEE A;  3H5X A;  2OD4 A;  1RHU B;  3R2D J;  4CI0 B;  1CS4 B;  2JFK A;  3UQS A;  2U2F A;  2J0S D;  2AW0 A;  1FTC A;  3R7N B;  1W7W A;  5LSL A;  1XJW B;  2OIH A;  2LQ8 A;  2HPU A;  4K4X A;  1FNM A;  4FNH A;  4H4O A;  8ATC B;  3IR5 B;  4QWB A;  3BYR A;  1U48 A;  4WTO B;  3RYL A;  4CT8 A;  4KT0 C;  2K3I A;  2VC1 A;  2EKY A;  1WOP A;  2LEB A;  2HNY B;  1U0S A;  4GC6 A;  4WFA Q;  5GMD A;  3KLI A;  5IWA F;  4EBD A;  1NSP A;  4H4O B;  4DV3 F;  4JI5 J;  1TK8 A;  1VIS A;  4WBF A;  4F4X A;  5E33 A;  3HVA A;  3GR0 A;  1D09 B;  4DPU A;  2ZH6 A;  1PAU B;  4OJH A;  1XNQ J;  4L3N A;  1G2E A;  3HCX A;  1RCX B;  5M2R A;  4U6P A;  1KQS R;  3PRB A;  3KLI B;  4LIW A;  1CJT B;  4B9L A;  1RK8 A;  2AYB A;  3CCQ S;  1SXL A;  3U1N A;  3BRE A;  1X7V A;  2WB1 D;  5E41 A;  1I94 J;  1QY7 A;  4RBT A;  1NME B;  2H9Z A;  1S1X A;  2YWF A;  5DZ7 A;  5G0R A;  3FSY A;  3RRH A;  3BDP A;  3FSX A;  1FT8 A;  4NZ6 A;  3MMC A;  4KHP F;  1ZPV A;  4N41 A;  5GAE I;  1HNV A;  1RA7 A;  2FY8 A;  2J7W A;  1MN7 A;  4P72 A;  4X2B A;  2C3Y A;  2LQB A;  3NGT A;  3R7B B;  2V94 A;  5E2Q A;  1DQ8 A;  2DNL A;  3CJ2 A;  4OI4 A;  3IR7 B;  3IC1 A;  3D5M A;  2GS8 A;  1S1X B;  1HMV A;  5MAO A;  2L48 A;  5G0R B;  3FVY A;  4AXI A;  1C2P A;  5HP1 A;  2E1A A;  3CDE A;  1QUP A;  3PAC A;  1MW7 A;  1WJ9 A;  1RTH A;  2CG4 A;  4B3S J;  1I3O B;  3CXC R;  1RYR A;  4ZIT A;  2EPI A;  4EFA C;  2RD5 C;  1EQM A;  1HBU A;  3RAQ A;  3ZNJ 1;  1N5S A;  3MEK A;  2MQL A;  1H7X A;  2V2V A;  2OI2 A;  4DUZ F;  4PWU A;  5I3P A;  1JLA A;  4U8Y A;  4B3R F;  3FFI A;  5LM7 E;  3SCL E;  2WCX A;  3CDU A;  3FGV A;  5HP1 B;  3RTV A;  4FPI A;  4DFK A;  1RTH B;  2DNG A;  3JB9 k;  3M32 B;  1HBU B;  2BA9 A;  4OZN A;  2M5Y A;  5FII A;  2XLK A;  4XPC A;  3R5G A;  4MK7 A;  4DWI A;  1CEZ A;  1JLA B;  2K06 A;  4FKY A;  3VVT A;  1HD1 A;  3FFI B;  1YLX A;  1FF2 A;  1RT2 A;  1P8G A;  5IV4 A;  4Q2M A;  4WYW A;  3PFO A;  4LF9 J;  1FNO A;  2FGC A;  4CDI A;  2YKO A;  2X1B A;  3E01 B;  4NLT A;  5LL6 d;  4ECZ A;  5DDP C;  4N7T A;  3RZA A;  1YJ9 S;  1CJU A;  4QWE A;  2VPZ B;  3L95 X;  4OLP A;  1EP4 B;  4C8Z A;  3DNC A;  1SC4 B;  2LU2 A;  4KYZ A;  4TYA A;  4NYO A;  2HMI A;  1S0O A;  1JIH A;  2KRR A;  4C8Y A;  2DPJ A;  3WX4 A;  2D3O 1;  4AT1 B;  1VR6 A;  4NLU A;  2ZBP A;  2FD2 A;  3QFH A;  4HHH A;  2JVO A;  2MTL A;  5AT1 B;  4QU7 A;  2R7X A;  1BE4 A;  2XS7 A;  2E7X A;  3I5B A;  3NS6 A;  2AEF A;  2BJ9 A;  2WSE C;  1GMU A;  4Y2I A;  4O4G B;  2APO A;  4I56 A;  2DNK A;  1APS A;  1HFE L;  3OL7 A;  4DN0 A;  1TV6 A;  3CDA A;  4Y2M A;  1VS3 A;  3BM7 A;  2IJN A;  4U7U D;  3MPY A;  3CNQ P;  2Q1L A;  2FVQ A;  3F41 A;  3KDO A;  5ETT A;  4DUY J;  5BR8 J;  2D41 A;  4BLG A;  4IO1 A;  3FC9 A;  2Y1R I;  1K1S A;  3HKZ D;  4A8S A;  3QJL A;  4PG5 A;  1UEK A;  5HN0 A;  5JVH Q;  3PXG a;  3G9C A;  3IRX B;  4NEY A;  4MAK A;  1TV6 B;  4FYD A;  1X4F A;  2HQF A;  2DGS A;  4H4M A;  4M5J A;  3VVU A;  2VDI A;  2X1F A;  3V6J A;  3N01 A;  4X62 F;  4CT9 A;  2R4F A;  3GR1 A;  1A9N B;  4CO2 A;  3QMQ A;  1NSK L;  3LAN A;  4X4O A;  2V9K A;  2BJ3 A;  4E0D A;  4ECT A;  4WP9 A;  3TAP A;  2ZFH A;  1S0M A;  4H4M B;  3EVW A;  3RBE A;  3CCM S;  2XMM A;  4B02 A;  3MUM P;  4DN9 A;  2NUH A;  1X5O A;  4NLP A;  4NLX A;  1NK4 A;  1QSY A;  4GO5 X;  3TJ9 A;  1RDR A;  1FKP A;  2DGX A;  1GTE A;  1XR7 A;  2ZC3 A;  2Q43 A;  1XEZ A;  2UXD J;  1RAJ A;  4OX9 F;  2DCL A;  4OX7 A;  3A13 A;  3FMW A;  4X64 F;  1FE0 A;  1FNX H;  4RUA A;  2DGW A;  4ECX A;  5E3P A;  2ZC4 A;  3FCW A;  2K8G A;  2A6O A;  3EVM A;  3CO9 A;  2QT7 A;  2HAI A;  3LP1 B;  1RWX B;  4YY3 J;  2DNN A;  2C2D A;  4MIA A;  2RS8 A;  4I6Y A;  1IUJ A;  3H5U A;  3GTY X;  3CJR A;  2R2T A;  1JX4 A;  2KO1 A;  4HYK A;  3KUG A;  5J2P A;  2MKI A;  3OR2 B;  3D66 A;  1GX6 A;  1OY6 A;  2HHV A;  3IG1 B;  5HVG A;  3M05 A;  2YNG A;  3HLU A;  1K0V A;  1RT1 A;  3I0R A;  4ZPA A;  2FLL A;  4UZB A;  3L7P A;  2XMJ A;  4X65 J;  3ZZZ A;  2MZT A;  1TVR A;  4JV5 F;  2WVE A;  1ZH5 A;  3PJX A;  2ZWP A;  2O67 A;  1S1W A;  4QZV B;  1HNX J;  3OFH A;  4J9N A;  1KR4 A;  2J6T A;  2DO0 A;  1U6Z A;  4WFB Q;  4LF7 J;  3TX8 A;  2MKJ A;  1Q0N A;  2YNG B;  1HNZ J;  1LK7 A;  4JI8 J;  2JZ5 A;  3I0R B;  4P75 A;  1OQ3 A;  3ZNU A;  4NWB A;  4CLP A;  4B9M A;  2ZOG A;  3M8P A;  1T8E A;  2VG6 A;  3G86 A;  2I0X A;  4CLW A;  4ES2 A;  3BBB A;  5DM6 Q;  3EUN A;  1ZBT A;  3ISN C;  2FJW A;  1RWP B;  2XY6 A;  3MM8 A;  1TFW A;  3J81 j;  4MKA A;  1R8P A;  1K8A T;  4K4T A;  4M8L A;  4ZLJ A;  3BPD A;  4EU0 A;  2QLW A;  4IOC Q;  3W66 A;  3WZ0 A;  2HLT A;  3M8P B;  3P96 A;  4ZVE A;  3A3O B;  5HQ8 A;  1H3D A;  3ZTS A;  2J5A A;  3W5Z A;  1YZ7 A;  2W2M P;  2VOO A;  3MM8 B;  5A76 A;  4NZ0 A;  5KG4 A;  2MYF A;  4OYM A;  2R8G A;  3MCS A;  4C8M A;  1HWU A;  4USH A;  1EX8 A;  4OHY A;  1S59 A;  3THT A;  3JQM A;  3QT5 A;  1RU1 A;  2E1P A;  2ADC A;  2R9L A;  1OSD A;  3GE9 A;  3BH7 B;  1UPM B;  1U2C A;  2VON A;  3R1H A;  2B7B B;  2GO8 A;  2VBZ A;  2FVS A;  2G0C A;  4P6Q A;  4KRW A;  4F3Q A;  4NLS A;  3GLJ A;  1QTN B;  3A8I A;  4MFB A;  3FUY A;  3WIU A;  3V6K A;  1F2G A;  4I7F A;  4DQS A;  4DPT A;  4HH1 A;  4O3O A;  3VZI A;  4EBE A;  1SC3 B;  2CDQ A;  4RW6 A;  1EET B;  1VJQ A;  2EKN A;  2KI2 A;  1T94 A;  2JEJ A;  1JJC B;  1TU0 B;  3CPW R;  1FCA A;  2GIR A;  2RE1 A;  2R8J A;  4MFB B;  4WXW A;  3X1L B;  4NYP A;  3L09 A;  3QT7 A;  4OJG A;  3LTO A;  5F3T A;  5FLX U;  3H8Y A;  3IN5 A;  1EKR A;  1XC9 A;  2OEL A;  4EYI B;  1Q1K A;  2IAJ B;  4CRJ A;  1FX4 A;  3K7R A;  3TJA A;  2VQF J;  1FRI A;  4HDH A;  1C0U A;  3PCO B;  4OI0 A;  3VV2 B;  2CVI A;  4DLE A;  4IFY B;  1RHM B;  1VBZ A;  2JC0 A;  1V5I B;  1RT7 B;  1NHV A;  4O44 A;  1VQ9 S;  5C24 B;  4UOC A;  4R0E A;  4LSZ B;  3VWS A;  4QIW D;  1WEX A;  3CCU S;  2FLN A;  3D0I E;  4IH6 A;  3NNA A;  3GQC A;  2XO6 A;  2VD3 A;  1NKB A;  1N52 B;  2E7W A;  3CVK A;  4ZP6 A;  3H98 A;  3UDL A;  2QYG A;  4O44 B;  4ZVP B;  4OZ1 A;  3PKM A;  4LF8 J;  2QLB B;  4B9N A;  4KAI A;  1KTV A;  4Y2K A;  3CCZ A;  1SUQ A;  3FBF A;  1XMQ F;  2UUA F;  1RTI A;  4OHW A;  1Z2L A;  3LAM A;  1UVL A;  4RL1 A;  4XTT A;  3DCA A;  5IM0 A;  4DR5 F;  2BJD A;  4Q45 A;  2IJR A;  6FD1 A;  4EZ6 A;  1U6F A;  2KZM A;  2AGP A;  2ZM6 F;  3M8Q A;  3QGG A;  2HS0 A;  2RKI A;  1SUQ B;  5A8W A;  4MKB A;  1X9W A;  1P1T A;  2J9D E;  1NB2 A;  4LRA A;  1BWV A;  3AB2 B;  3D4J A;  3QWP A;  2ZZN A;  1S1V A;  1JK9 B;  2YKA A;  1OIA A;  1YRU A;  4KY3 A;  4N8O A;  1MWZ A;  3EIC A;  4G1Q A;  1FEH A;  1M0S A;  2RKI B;  4ES1 A;  5T7L A;  3HF5 A;  1VQ7 S;  3ZC4 A;  4ZOS A;  2N4D A;  1ZM3 A;  1IR0 A;  1S4F A;  4Y34 A;  3AXM A;  2MKH A;  3EPI A;  2OPQ B;  4HH0 A;  5KFE A;  5IT9 Y;  4C8N A;  5DLF A;  3TOQ A;  1NHU A;  2EBG A;  4FYX B;  5F8H A;  2MKC A;  1AUD A;  2BRK A;  2J0X A;  4G1Q B;  2KVQ E;  5C7P A;  5IC6 B;  3CD6 S;  1Y7P A;  1S12 A;  4DV0 F;  4HKQ A;  3PRD A;  4QR1 A;  2DD8 S;  1JXE A;  4QU6 A;  4UQT A;  2ABY A;  3RRK A;  2I2Y A;  5GAG U;  3AB4 B;  3I9V 9;  2KN4 A;  1RAO A;  1S9E A;  1VBK A;  3G82 A;  1SJ4 P;  4L75 A;  3NP5 A;  3LQV A;  4YB6 A;  4KQZ A;  4USK A;  2DGQ A;  2V8D A;  4U9R A;  1N0V C;  1TEL A;  5DJB A;  1N6Q A;  4O3P A;  3DRR A;  4HAC A;  3P4U B;  4GRS A;  1C1C B;  1PC4 A;  1H98 A;  5F8L A;  1T7P A;  2MGZ A;  4ZLN A;  5CD4 H;  1OWX A;  4M5N A;  4MKV A;  4N8N A;  2MKK A;  5H9E J;  1S9E B;  4ECV A;  3G82 B;  5ETV A;  4B3M J;  1C0T A;  1CSJ A;  4M1K A;  1VRT B;  3HHL B;  3PDN A;  1U1L A;  4LFA F;  1Y9O A;  3LH2 S;  2KKH A;  1X5P A;  2EK1 A;  1WC6 A;  3UVJ A;  1MNE A;  4WXO A;  1N6Q B;  2W01 A;  3DRR B;  3EZO A;  2I38 A;  1G3O A;  2XZW A;  2JLE A;  5D0E A;  2QC3 A;  4PQU B;  5D15 A;  2MGZ B;  2F8H A;  3TQE A;  1IBL J;  2L9D A;  1F60 B;  3CGI A;  5K20 B;  2F4V F;  2PA8 D;  1WOO A;  3H2V E;  2BOA A;  2WK4 A;  1X4D A;  2EXU A;  2ZH9 A;  3ADA C;  3MM9 A;  3AJD A;  3UVJ B;  5C42 B;  2JEF A;  3DOM B;  2ALZ A;  3PJ9 A;  3D1O A;  2IPO B;  1SJ1 A;  2LA4 A;  2WVD A;  5DQI A;  1FJG J;  1GK8 A;  2DEI A;  3IR6 B;  2L9W A;  2RRA A;  3CJT A;  1Q95 G;  2R8K A;  3PX0 A;  3HO1 A;  1S0V A;  2J76 E;  4AXJ A;  3RBD A;  4IRK A;  1FE4 A;  4R8U A;  4UZC A;  2HBY B;  1UFL A;  3MM9 B;  2BUN A;  1KQK A;  1C4C A;  4O0I A;  4TY8 A;  2GW8 A;  2M2B A;  1Q7Y T;  3Q8S B;  1S10 A;  3OSN A;  1RU2 A;  1CQM A;  3TAM B;  4C8O A;  1GXT A;  3ENA A;  2PMZ D;  3DMJ B;  3S1T A;  1FDN A;  5HBM B;  5J1E B;  3SSS A;  4EO6 A;  2E5L J;  4LRB A;  2VJU A;  1RT3 B;  1NH7 A;  1UTA A;  4TY8 B;  3Q86 A;  4YB7 A;  3MFH A;  4K4U A;  5H9F J;  1T0T V;  1SQG A;  2DBB A;  2HND A;  4DV6 F;  3ZZY A;  4ZMM A;  4EI2 A;  3OW2 R;  3EE3 A;  2ZZT A;  1M5P C;  1EJ7 L;  1VQL S;  1WC5 A;  2G2Y A;  4B3O A;  3QYY A;  3VQS A;  1U1Q A;  1TTH B;  3BZQ A;  2R7U A;  1Q81 T;  5CZX A;  2QA4 S;  3RB0 A;  1FES A;  1DLO A;  3AD7 C;  5E3R A;  2ATC B;  4N76 A;  3H2L A;  3NGK A;  2VC0 A;  2RT3 A;  5KT5 A;  4DXL A;  3HFZ B;  3OLA A;  3J7A N;  1P9Y A;  3GYN A;  4HVZ A;  5HVH A;  3W5X A;  3QGI A;  1BC6 A;  2B6A A;  3TAR A;  2XS2 A;  3LW5 C;  1DLO B;  1HW9 A;  1SJR A;  2V5H G;  1B0T A;  3K17 A;  2C2E A;  2DEJ A;  2P6T A;  1S6P A;  4LBH A;  3O8W A;  2BKP A;  3GJR B;  4NI2 B;  3NBP A;  1XMO F;  1EHW A;  1H72 C;  4DUT A;  1HKA A;  2WBR A;  4FBU A;  3T6B A;  3OUY A;  1NJX A;  1HQU B;  2B6A B;  3D7S B;  3PFE A;  2HBR B;  1DTT B;  2DHA A;  1SVD A;  3AXK A;  3MAH A;  4EZ9 A;  2LFV A;  3EGN A;  1HHQ A;  4CLK A;  1P9Q C;  2EC2 A;  3KJN B;  4LRE A;  1KC8 T;  1S6P B;  2XYP B;  3FJ2 A;  2EFN A;  5B08 A;  5IWA J;  3NBP B;  1R8C A;  5J2Q B;  1BMQ B;  4DV3 J;  4LFB F;  2VBX A;  2W9C A;  2EK6 A;  4RUB A;  2P9G A;  2FVC A;  4ZPD A;  4K4W A;  2K1R B;  4RW9 A;  4ZPW R;  5LSO A;  2X7I A;  4DV2 F;  3PHE A;  4J9M A;  3ZO7 A;  1VQ8 S;  3BKU A;  2YWG A;  3HHE A;  3ZZR A;  1AFI A;  3DLG A;  2DK2 A;  2Y9H A;  5BXI A;  5ETO A;  1AZS B;  3I5C A;  4DZ6 A;  1DJ0 A;  2CQ0 A;  1YGY A;  2BAN B;  1U7L A;  1XWL A;  3EGV A;  4YR2 A;  1NKE A;  4Y00 A;  3K5P A;  4KHP J;  4YR3 A;  2QRR A;  4GO7 X;  3G8Q A;  4W92 B;  2ZDP A;  3LP2 A;  2E1C A;  1IM4 A;  2V2Q A;  5A0Y A;  5K9F A;  1QJH A;  3US5 A;  1W2B R;  2IBO A;  3ILL A;  1NK6 A;  4F7V A;  3IWN C;  2MDA A;  3M7V A;  1RUS A;  2V34 A;  2XY5 A;  5K8O A;  3WDO A;  2DNR A;  2JDJ A;  2ZVI A;  2HFZ A;  5MLC V;  1KD1 T;  4X4S A;  1JJH A;  5HL7 Q;  5K8P A;  1W25 A;  1QAJ A;  3UO0 A;  2J6U A;  2KYZ A;  2I9S A;  2QA4 G;  2Y0S D;  1EKS A;  2VG7 A;  4ZK7 M;  3FRY A;  2WW4 A;  2HVE A;  4DSE A;  4DUZ J;  1Q8L A;  4E8U A;  3NGS A;  1Q16 B;  2YWE A;  4B3R J;  3EXY A;  1CJV A;  2LYV A;  1S6Q A;  2OKQ A;  3CT9 A;  3OTD A;  2D1C A;  4ZVS B;  5EWF A;  2DXE A;  4HTI A;  2HHQ A;  3DXB A;  4QWC A;  3NKY A;  3JAM Y;  2JLF A;  2ZD1 B;  3SSR A;  3HDS A;  3EZ5 A;  2FHJ A;  2VG7 B;  2H5E A;  4X4U A;  4WFZ A;  3PW7 A;  4FS1 A;  4RU2 A;  3R6L B;  3P8B B;  3MXH P;  2WW8 A;  5CAA A;  1S6Q B;  5KFT A;  1NJZ A;  4LF1 A;  4NRT A;  3T1A A;  2VIC A;  3UCU P;  3AJ1 A;  2VFR A;  2RDI A;  4Q8E A;  4PZV A;  5J1N A;  1JKH A;  4LMZ A;  1QLN A;  4JV0 A;  1J5E J;  4Q5V A;  1KP6 A;  4RU9 A;  4WPA A;  2M88 A;  5IT0 A;  4R5P A;  3G4S S;  3PYD A;  3WX8 A;  3RGI A;  4Q2L A;  5CAB A;  1VQK S;  4WIQ A;  2YX7 A;  4FVM A;  5K14 A;  4F36 A;  2C3O A;  4TXS A;  3CTR A;  4BC7 A;  1A6L A;  2MQ8 A;  2MLY A;  1I1G A;  4USM A;  2GO9 A;  2JJ4 D;  3BGR A;  2BJ7 A;  1HR0 F;  4CCH A;  2X1G A;  4DZD A;  2R42 A;  3K2Y A;  4QR0 A;  3PM9 A;  1O5J A;  3VGT A;  3CED A;  2UP1 A;  5KFZ A;  4BCA A;  1X60 A;  5DDQ C;  4DU8 A;  4HI2 A;  2GZO A;  1WI8 A;  3C6T A;  4U96 A;  3JQJ A;  1RAD B;  4HLB A;  1RTJ A;  5HMZ A;  4NCB A;  5D0G A;  3BH6 B;  3BGR B;  4TN2 A;  1YVF A;  4FYV B;  4ZCL A;  2CQB A;  3VAK A;  1WTF A;  1YDL A;  1WF1 A;  4J5O A;  2MZJ A;  1U1K A;  3EM1 A;  3DKD A;  5U47 A;  4RNH A;  1WC1 A;  4KPC A;  3VAI A;  4IR1 A;  5F0W A;  4KV8 B;  3C6T B;  3I6P A;  4K7Q A;  5KFA A;  3MEC A;  3DFE A;  1PAE X;  3KLE A;  5AXM A;  4X62 J;  1RBL A;  4NA3 A;  3GG1 A;  3IM8 A;  4PUO A;  4IG0 A;  1FD2 A;  4ZVT B;  3M2R A;  1XN9 A;  2DHS A;  1UVK A;  3JS9 A;  1U2F A;  1HBO A;  2W1B A;  1FJC A;  1WHV A;  4DX8 H;  2ROE A;  2OJ3 A;  4U8V A;  1CJK B;  4F0H A;  5JXS A;  3DLL Q;  3OTE A;  2C2Z B;  3T19 A;  2RF2 A;  2V4J B;  1EAR A;  4PUO B;  4IG0 B;  3MF5 A;  2NXE A;  4DSL A;  2BVZ A;  1RHQ B;  3K0J A;  2Y8Y A;  1W2I A;  4CM2 A;  4H54 A;  4DFM A;  1IKX A;  4OX9 J;  1HBO B;  3QFW A;  3PIP Q;  3LGH A;  4X64 J;  1JLB B;  1DTQ A;  2JWN A;  4MYT A;  4WFN Q;  3UDE A;  1CUL A;  4DV7 F;  1VQP S;  4J91 A;  3KUE A;  2FB0 A;  4KE5 A;  5CYQ A;  1EB0 A;  2YWK A;  4NOH A;  3HHL C;  5DGA A;  1IKX B;  3H5Y A;  4O3S A;  4D3H A;  2UUW A;  3MAA A;  3DI6 B;  4DX7 A;  3MM7 B;  2IVY A;  1DTQ B;  1HIY A;  2CPE A;  3L7U A;  2V6A A;  1SJ3 P;  4TU7 A;  5GVQ A;  1H2U X;  3D68 A;  1IKV A;  2W4P A;  1CUL B;  2C3U A;  4PR6 A;  2GVZ B;  4PWD A;  4C11 A;  1T9W A;  3R6G B;  3UPF A;  4JV5 J;  2DIS A;  1S0N A;  1FVS A;  3VF0 B;  1W26 A;  1IXK A;  2ZBI A;  3MAA B;  4K2X A;  3EDR B;  1Q8I A;  1R0B G;  3D67 A;  2QA1 A;  2O5D A;  1FWP A;  2GV1 A;  1VRU A;  2CG8 A;  1LEO A;  4ZPT R;  4PPD A;  2MZS A;  1IKV B;  2FQQ B;  3ZZT A;  4PWD B;  3N79 A;  4C11 B;  2R7R A;  4P2F A;  2L3M A;  4IG3 A;  2W24 A;  2F8E X;  4Q44 A;  4L76 A;  5ETK A;  5I3U A;  4K59 A;  1RBO B;  4WCE Q;  2OTJ S;  4YQW A;  2HVH A;  1LWC A;  2G13 A;  2DO4 A;  2F7V A;  3AOA A;  2W8K A;  1GT8 A;  1SC1 B;  1VRU B;  2RRN A;  2YKM A;  4JOU A;  1B99 A;  3BGF A;  3MEG A;  5D4P A;  2BJ8 A;  2E29 A;  4FNI A;  3AA9 A;  4IG3 B;  3EZU A;  4R25 A;  4F2R A;  2YQ0 A;  3CC2 S;  2D74 B;  2LXI A;  3SI8 A;  4ED5 A;  4H4K C;  1FI4 A;  2QV6 A;  4LT6 A;  5I3U B;  2BE2 A;  4AL6 A;  2GVD A;  4LJM A;  3RB4 A;  3QSY B;  2WOM B;  2IYI A;  1LWC B;  1RLD A;  4CLF A;  3MEG B;  4G65 A;  1ZOT A;  3BBC A;  2W4C A;  4J9V A;  3ZTQ A;  1FTR A;  1SKW A;  2EEY A;  2KL8 A;  1QVF R;  2YX4 A;  3IS9 B;  5CYM B;  1XTZ A;  3CF5 Q;  1V3S A;  2NRE A;  2BE2 B;  2UV8 A;  2FJB B;  4IDK B;  1SH0 A;  2GVD B;  1SJQ A;  1L3U A;  5LMU F;  4PYA A;  2FJD B;  3EWG A;  5ETL A;  1SI9 A;  3GFH A;  2MQO A;  4J9Q A;  3OTB A;  2VBW A;  2ROG A;  1O51 A;  3QT8 A;  2KH9 A;  3PW5 A;  3OPK A;  3QWU A;  3PG9 A;  2YBV A;  5CCL A;  3KK1 B;  4U7C A;  3M2U A;  2OTL S;  4WWS A;  1Q86 T;  3I56 S;  3SCJ E;  2M70 A;  2AEM A;  2OPS A;  4KSE B;  1X0P A;  2HIY A;  2ZJP Q;  3Q22 A;  3C3L A;  1U24 A;  3J7Y U;  5KT6 A;  3LWM A;  3L9Z A;  5EX0 A;  2DGO A;  3GG0 A;  5IV3 A;  4CNZ A;  3GFY A;  4XIU A;  3BPS P;  3IBC B;  3C19 A;  1X4B A;  1HHS A;  3M2U B;  2ALY B;  3M6X A;  5C25 A;  1JLF A;  1RHK B;  4Y6I A;  1N56 A;  2FJE B;  1H74 A;  4ECR A;  3OL6 A;  3TZX A;  2V4R A;  4EK2 A;  2ASD A;  4TU9 A;  4Q0B A;  1FDB A;  3G2X A;  2GNK A;  2VHG A;  4F0K A;  2ATL A;  3SFU A;  2VDH A;  2KJW A;  2HGL A;  2XQC A;  1JLF B;  1KON A;  2AIR B;  4F4A A;  1KFD A;  3NCR A;  1IM6 A;  2MJU A;  3K5O A;  4F0M A;  2JSX A;  2XSJ A;  4NXM F;  1R7I A;  2X51 A;  1ZTW A;  3MMJ A;  2UUA J;  3O6Q A;  5B0B A;  5ADZ A;  1TZ0 A;  3BKF A;  1GEH A;  3N6N A;  3LO3 A;  2B3T B;  1FRH A;  1GMW D;  2DGV A;  3U1M A;  2AJQ A;  3CD0 A;  2ZM6 J;  4LR8 A;  4I2Q A;  3I5A A;  2KT3 A;  3DGP A;  3RU0 A;  3QAE A;  4HDG A;  2UXC F;  1Y5I B;  4ED6 A;  1J27 A;  3U27 A;  2UXB F;  1QM9 A;  1WNE A;  2M7S A;  4N47 A;  1IWG A;  2NYH A;  2H1Y A;  2DY9 A;  5KFX A;  1RT6 A;  3W8G A;  1NSQ A;  1F9E B;  4OHV A;  1NKC A;  3OR1 B;  3PIO Q;  1TAQ A;  3OVS A;  3O1L A;  5EUH A;  5GAG I;  2ILZ A;  3V2U C;  5LXR A;  2FHO B;  3JYT A;  3D28 A;  4OHX A;  3NLC A;  4DSI A;  4OI1 A;  1TKD A;  5E3A A;  4LF4 F;  2HK2 A;  3BO3 A;  2BZ2 A;  1ICE B;  1JLQ B;  2ZBQ A;  2A2D A;  2HYI B;  3AH6 A;  2W7A A;  1RT6 B;  4DV4 F;  1H38 A;  3WQP A;  5KG0 A;  1ZM4 A;  3HD1 A;  1KQF B;  5JVG Q;  3ZZP A;  4ED4 A;  3EXC X;  2VFS A;  2R2S A;  1WSR A;  4CLL A;  2C3M A;  3GV7 B;  5KFV A;  3QIP A;  3SSQ A;  2A0F B;  1ZAV A;  5LXY A;  1XNR F;  1YJT A;  4UF4 A;  2CUY A;  4HT5 A;  3POT A;  1F6T A;  3GIL A;  4DV0 J;  1DAR A;  3GU0 A;  1UET A;  2MPU A;  1CG2 A;  2MQP A;  2B9E A;  4EGL A;  4CLS A;  1ITP A;  4Y28 C;  3D1Q A;  3K89 A;  2MQM A;  3DLE A;  3UE2 A;  3QIP B;  4MK9 A;  5AXN A;  1WTB A;  5GMK a;  5C2C A;  3POT B;  1VBX A;  3E51 A;  1EZZ B;  1N36 F;  1S72 S;  1S9F A;  2HHH F;  5DDO C;  3CCS S;  2CYY A;  2OSR A;  1TUG B;  2CPH A;  3TW0 A;  3K8W A;  4QPT A;  4C97 A;  1F5C A;  1U1O A;  3TR5 A;  4LFA J;  3GSD A;  1U0H A;  3JTP A;  1KFS A;  3W60 A;  4FXW A;  4I2P A;  3E8O A;  1H0H B;  1B0P A;  3RJM B;  4DBQ A;  1REV B;  2ZOM A;  3I0S B;  4LBI A;  2IVM A;  2AQ4 A;  2GGP A;  3J81 Y;  2A1B A;  2KTQ A;  1QTM A;  2O66 A;  2DRA A;  2PT0 A;  4OX6 A;  3T1H F;  2EFV A;  1N34 F;  2XMU A;  1S97 A;  3M6W A;  2B4V A;  2ZE2 A;  2F4V J;  3TYT A;  1WSV A;  4NCG B;  1U0H B;  3DRP B;  3DRS A;  1UFW A;  2H4Y B;  5EHH A;  4KGZ B;  5F9L A;  4I2P B;  3RB3 A;  4L72 B;  1HNI A;  5J2N B;  5T14 A;  3SXL A;  2OP5 A;  4GVL A;  5EWE A;  2GHP A;  1YRT A;  4NYZ A;  2JL9 A;  1SCJ B;  2NYI A;  2ZE2 B;  3CE8 A;  4M5D A;  1X9S A;  1A0O B;  1KBR A;  1QAI A;  4NXN F;  3V81 A;  1KVJ A;  3CCT A;  3DRS B;  4WK1 A;  4I6W A;  1HNI B;  2XNR A;  3OL8 A;  1N32 F;  3VTI A;  4MK8 A;  2A2C A;  4NZ7 A;  1T9U A;  4FP9 A;  2KDO A;  1C1B A;  3H2U B;  4QOT A;  2F3J A;  3VGU A;  3DXS X;  1E6V A;  2N3O A;  4N56 A;  3R5A A;  4RWX A;  3ZFV A;  2ACY A;  2YNI A;  3H40 A;  4TNO A;  4LFC F;  3OFF A;  3V81 B;  3D2W A;  1PJ6 A;  3N6M A;  2GJF A;  2RIL A;  4ANC A;  4Z37 A;  4JI2 F;  3TA2 A;  4MIW A;  1NZA A;  3CD7 A;  1C1B B;  3QRP A;  2VB6 A;  4LVN P;  4OZJ A;  3QT6 A;  4DR6 F;  1E6V B;  3PX6 A;  4DV6 J;  2MQN A;  1C4A A;  5M2U A;  2QLF B;  2YNI B;  3HM9 A;  2JC1 A;  2AZ3 A;  4QIG A;  3T5J A;  1ZYQ A;  1KWM A;  2W4D A;  3MOJ B;  1X4C A;  1YJV A;  1PYT A;  4GMK A;  4TQS A;  1CC7 A;  1XMB A;  2JLG A;  2V67 A;  3TRG A;  1F0X A;  1F5A A;  1KLM B;  4NEZ A;  2LMI A;  2BKO A;  1Y4Z B;  5AXK A;  3SBM A;  1U25 A;  3KHG A;  3B78 A;  1BHN A;  2HBZ B;  3MDF A;  1TL3 A;  4DPX A;  2BAC A;  4KJI A;  5F3Z A;  3CUN A;  1V9O A;  1RAG B;  1H6K X;  2QO3 A;  1OS5 A;  3CO0 P;  3UN5 A;  2R7Q A;  4WE1 A;  4ZPB A;  1VQN S;  2CWK A;  4OV1 A;  2B9W A;  3NS5 A;  2P9C A;  4MH8 A;  2DGU A;  3BSC A;  5BYQ A;  1M5O C;  3BS9 A;  4JB8 B;  3WC2 A;  2MXY A;  3R8Y A;  1XMO J;  2ZEJ A;  3X3U A;  1RTD A;  4KB7 A;  1KHW A;  2W9A A;  4O3R A;  2V4Q A;  2Z0G A;  3CJ5 A;  1FHT A;  1HI0 P;  4WE1 B;  1XER A;  4KGK A;  1WHY A;  1DQA A;  1DUR A;  1NB7 A;  1X4E A;  4HT7 A;  4IKA A;  5KFR A;  1G4C A;  2ZH3 A;  1RQ0 A;  4LF6 J;  3QBC A;  2DNH A;  4LFB J;  3TUZ C;  3ILJ A;  2EFG A;  1Q5V A;  1RTD B;  1PO6 A;  1QSS A;  1MWY A;  3PR4 A;  2QMU B;  1VQY A;  3BV8 A;  3UCG A;  4DV2 J;  5F8N A;  1YBA A;  3D6F B;  3NXZ A;  4MYU A;  1KHV A;  5E0O A;  3EVO A;  2P6S A;  2H48 B;  4IUF A;  4FKX A;  3DC2 A;  3I4H X;  4M5L A;  3MD1 A;  3AT1 B;  5DO2 A;  2RQK A;  1TL5 A;  4JI0 F;  1NXI A;  4NLV A;  3L3C A;  2HEK A;  4A48 A;  1FWK A;  2D3U A;  3HZG A;  3RW6 A;  3B54 A;  2KXH A;  1I94 F;  3UWT A;  4ECQ A;  4CTA A;  5HRO A;  3R9L A;  3R27 A;  4I64 A;  1KNZ A;  3OFE A;  5DG9 A;  2HQC A;  2F9D A;  4KFB A;  3PV8 A;  5F9N A;  2C2K B;  1TK5 A;  1MSW D;  5KFO A;  1X8D A;  1CS4 A;  4O3Q A;  4CLY A;  1WC4 A;  4NAS A;  3NAI A;  1Y5L B;  1UWA A;  1RWV B;  3BQ2 A;  4HL9 A;  5CXT A;  3OHB A;  1REG X;  5HRO B;  4CH1 A;  1GNK A;  2RU9 A;  1UVI A;  5CZV A;  4XDC A;  4RNO A;  4F4W A;  2HFS A;  2N7C A;  3JQK A;  4KFB B;  3BR8 A;  3HX9 A;  4K2J A;  3TUP A;  4W98 A;  3RAM A;  4UW2 A;  1O0P A;  2PMW A;  2LVW A;  3OT9 A;  1HW8 A;  2HNY A;  4PXD A;  2QE5 A;  3ENQ A;  3MEE A;  1U6B A;  4DFJ A;  4TLR A;  2CJB A;  3AFG A;  4OZ5 A;  2PI4 A;  4DMZ A;  3E2E A;  3HSD A;  4JBC A;  3MCO A;  2UU9 F;  2J9D A;  4DQI A;  2AX1 A;  1KKH A;  3BGL A;  2J7K A;  4BDP A;  2V68 A;  1NDL A;  4ZA1 A;  2E7V A;  4X4Q A;  1HWI A;  4C6A A;  1IR2 A;  3G8S A;  4PG8 A;  4ZN3 A;  5KT2 A;  1WKK A;  3MR6 A;  5L39 A;  4FF1 A;  2BMB A;  4ZHR A;  1VC6 A;  4WP8 A;  3MEE B;  4M95 A;  4UQG A;  4XAK A;  3Q8Q B;  1TAU A;  1CJT A;  2E5J A;  3ZXW A;  6FDR A;  4DL6 A;  1T9X A;  5H9E K;  4PEO A;  2IC3 A;  5B0G A;  3HSJ A;  2VZ9 A;  5KG7 A;  1TP7 A;  1RIS A;  5E3C A;  5HVF A;  4ZHR B;  3UDC A;  5HJX A;  1U1M A;  2DNY A;  1QUV A;  1UVN A;  1HBM A;  1FXD A;  3QSI A;  3S7R A;  5J2M A;  1JNR B;  3LA0 A;  2DHX A;  3HJV A;  5DZ6 A;  5DLG A;  2IC3 B;  1N33 F;  1P27 B;  2FZC B;  3P5B P;  2QIF A;  2A6M A;  3U02 A;  2X1A A;  3H59 A;  2WHO A;  5KFM A;  3MOZ A;  1U49 A;  2RIJ A;  3CJS A;  1HR0 J;  2E5G A;  3PYF A;  5KT3 A;  2B4P A;  2RH3 A;  3TA0 A;  1HBM B;  4NLD A;  1DZ5 A;  1KN6 A;  4LSN B;  1R3N A;  3TZW A;  2CZ4 A;  4NL5 A;  5J2M B;  4MIB A;  3MZI A;  3OXL A;  2WON A;  1FWL A;  1NHK L;  3T1Y F;  5KFW A;  2XO7 A;  2UVU A;  1RT5 B;  3T5K A;  5A2Q Y;  3G6V A;  1U4B A;  1IKW A;  3AOB A;  4FYY B;  4NLQ A;  4DUY F;  3M32 A;  3AHP A;  2KVI A;  3ELH A;  1R6Y A;  3LP0 A;  2R7V A;  2Z56 B;  3BB5 A;  2CJK A;  1M1G A;  4FF4 A;  2WON B;  1FEE A;  3M2V B;  5KOW A;  4WF9 Q;  1FRK A;  2AV5 A;  2IHR 1;  2ZKU A;  4DSK A;  2CZ9 A;  4DG1 B;  1IKW B;  1QAY A;  2B9X A;  4F2S A;  4ZLL A;  3T5L A;  1YX2 A;  3M6U A;  3C15 A;  3E01 A;  3OLB A;  5H9F K;  3LP0 B;  2OSQ A;  1U45 A;  1X0F A;  3E3X A;  3QO9 B;  3RBZ A;  1GX5 A;  3I32 A;  3BO2 A;  4YB5 A;  3W2V B;  1EP4 A;  2HVD A;  4OI6 A;  3UFC X;  5KOX A;  3M9M B;  3CCL S;  3MUV P;  5KTQ A;  4ZVH A;  1L3S A;  3C15 B;  1VHF A;  1RAB B;  2N7Y A;  4KHR A;  2V50 A;  2CQH A;  2AYM A;  2W25 A;  4AL5 A;  2HWT A;  2BR0 A;  1G6B A;  1RAF B;  3V6D A;  1X4H A;  2MB0 B;  2AJ1 A;  3I96 A;  4JI4 F;  4DS5 A;  3ZZ0 A;  3VAH A;  2HQG A;  3QLH A;  2J8S A;  5A8R A;  2C2R A;  5FDL A;  2VPY B;  3V4I B;  1N0U A;  4DV7 J;  4O4G A;  3IWL A;  3C66 A;  4DR7 F;  4PKD B;  3M9O B;  4ZIV A;  2UVW A;  2VPW B;  2HGM A;  2OPR A;  1MMD A;  2CDR B;  6AT1 B;  1LWF A;  4F4Z A;  5F8G A;  3PX4 A;  2EFO A;  1LV5 A;  4NLR A;  2HZC A;  1HI8 A;  3KG1 A;  3C16 A;  4MT1 A;  3V6D B;  4IFV A;  2AEJ A;  3QLH B;  3JTO A;  3V4M A;  3VR1 A;  5A8R B;  1HNW F;  3FQK A;  5FDL B;  4IR9 A;  4ANE A;  3J80 U;  1HLW A;  1BWE A;  4IQX A;  4WFX A;  2AHO B;  4K4Y A;  5F41 A;  2ZH1 A;  2Z4P A;  5IZH A;  3AAW B;  2OPR B;  3IRX A;  4K0K J;  1LWF B;  1JLG B;  3DGV A;  2BM1 A;  2KFY A;  2ZBR A;  3C16 B;  4LRF A;  3Q2T C;  5KFG A;  5FD1 A;  4IFV B;  1OJ4 A;  2UUC F;  2V8G A;  3UN2 A;  3KXD A;  4ZVO B;  3NS7 B;  1T3O A;  3MM6 A;  4JI7 F;  4KH0 B;  1R31 A;  2NXU A;  4LIR A;  2BJE A;  2HLU A;  4AQY F;  1AFJ A;  3PTW A;  5KFL A;  4DQP A;  4DJB A;  2HHS A;  2EBE A;  3MED B;  4P10 A;  1YQH A;  4AFF A;  4A8X A;  3K5M A;  3KMQ A;  3KMS A;  2C2O B;  3MM6 B;  2ZH4 A;  2GHW A;  4IRD A;  3ETO A;  1SBR A;  2RS2 A;  1RP5 A;  1YKW A;  1D0E A;  3OVA A;  2HG4 A;  5GME A;  3DLJ A;  3O3L A;  1G1X A;  2CPX A;  5FJ4 A;  2YH1 A;  2I6W A;  4X84 A;  3GV5 B;  2ZDO A;  3LP1 A;  1TR0 A;  2YKP A;  3TVZ A;  3T9N A;  1B64 A;  4A4J A;  3Q0A A;  3H42 A;  1OPZ A;  2HZA A;  2K3K A;  1HWJ A;  2W2O P;  2GMJ A;  2OLW A;  5LT5 A;  3OR2 A;  3ENW A;  3GP9 A;  4OLO A;  3HHK A;  3H4B A;  3IG1 A;  4CO5 A;  3MR5 A;  2CQ3 A;  3IGV A;  3MWB A;  3J7Y I;  4EMD A;  5LMU J;  3W3S A;  4XK8 C;  5ETP A;  2HRU A;  2FZG B;  3CJ8 A;  5F8J A;  3NEK A;  4NLG A;  1OSC A;  3Q24 A;  2G0I A;  2YTC A;  1YK9 A;  5AJ3 F;  4WK3 A;  4F3O A;  4NCA A;  2IM0 A;  3HVR A;  1VK8 A;  2U1A A;  4P2X A;  3PYE A;  2QSW A;  3EDQ B;  4C9D A;  4MTP A;  4DL5 A;  4RW8 A;  4XO0 A;  3KOA A;  4DHV A;  1R8B A;  4KBI A;  2VKR A;  1TKZ A;  2DRD A;  3BQ0 A;  2G1H A;  4YME A;  3O44 A;  4KC5 A;  4AUK A;  2VU5 A;  4UOG A;  2D3O R;  5KFJ A;  5D0H A;  2FYX A;  5EN1 A;  2KHD A;  2PI5 A;  1PG5 B;  3CC4 S;  3CWJ A;  3QGP A;  2XHC A;  2CJA A;  1K47 A;  3Q89 A;  5DM7 Q;  4FXD A;  3VGV A;  1RAC B;  4RW8 B;  3GWC A;  1B70 B;  2AX0 A;  2LQ5 A;  1TKZ B;  2GML A;  5D6G A;  3F0N A;  3TUI C;  5IS2 A;  5F8M A;  1D9A A;  3EX7 B;  4NMX A;  1SH2 A;  1UKU A;  3Q2S C;  5GAD I;  5DDR C;  4MJK A;  2RVJ A;  4RX6 A;  2LLZ A;  2CAD A;  2CPJ A;  2CA9 A;  1PBA A;  4DLG A;  1GXU A;  5L46 A;  3KJF B;  2H4W B;  2MZ1 A;  4NXM J;  2XWX A;  2DR9 A;  2BXJ A;  1RBA A;  5ETR A;  1RWU A;  2N4C A;  2PFD A;  3MR7 A;  2DT9 A;  1CQN A;  4FYW B;  1YTY A;  2AJF E;  3QGH A;  2GC8 A;  1RKJ A;  1X9M A;  5KFP A;  4PG4 A;  1ULR A;  4ATN A;  2J0Q D;  2HRT A;  4X4V A;  1EET A;  1SB6 A;  3HZE A;  3MHY A;  5LOQ A;  3KFW X;  3SCK E;  2B4O A;  2UXC J;  3FBE A;  2ZJQ Q;  2UXB J;  4RO0 A;  4NLO A;  3OFG A;  2VFV A;  4OYO A;  4CQ1 A;  2NR0 A;  1YWX A;  3A8E A;  3L7O A;  2XZT B;  2CAJ A;  2VBY A;  2GIQ A;  1QAX A;  4F8R A;  2IAJ A;  1EAY C;  1WKJ A;  5A6P A;  3RBX A;  2M8H A;  3GPA A;  4HR2 A;  1YHQ S;  4DX5 A;  2CPF A;  4LF4 J;  1VK3 A;  2HVZ A;  2J9C A;  1MG7 A;  4C0B A;  4IFY A;  1XR6 A;  1RT7 A;  5DG8 A;  4DV4 J;  1PBU A;  2VL1 A;  4ELV A;  5C24 A;  2XBP A;  5KFH A;  2HIQ A;  8AT1 B;  3DYA A;  4M63 A;  2CRL A;  1U09 A;  4C2M A;  4J9L A;  2PFF B;  1FVQ A;  4DF4 A;  4HHJ A;  2CQP A;  3MMB A;  4M5H A;  1XNR J;  4F4K A;  1MWQ A;  2NPI A;  1YRX A;  1P1L A;  2ZIT A;  1FKO A;  2XMV A;  4KGM A;  2BBE A;  4QIV A;  1U1P A;  3WC0 A;  3C14 B;  4M5K A;  4YN3 B;  1AYE A;  3BSA A;  7FD1 A;  3DYA B;  2ASL A;  3PHT A;  3NNH A;  3HMJ G;  2F1F A;  3KJQ B;  2M4M A;  3MMB B;  1T95 A;  5BJR A;  3MD3 A;  4WII A;  2ZH5 A;  4DSF A;  4C8K A;  4K8R A;  1FKO B;  1N36 J;  2ZZM A;  4I4B A;  2HHH J;  1AB8 A;  3MTJ A;  4LUB A;  1MRO B;  1LFP A;  2HS3 A;  3CB4 A;  1N5Y B;  2W7P A;  2GIF A;  2BQ3 A;  2Y1J A;  2CVE A;  5CYJ A;  2WB4 A;  3GFZ A;  2XY7 A;  2M0G B;  4Y0F A;  2GQ2 A;  1UVM A;  2KFZ A;  3GJQ B;  2PMH A;  1BQM A;  4ZP8 A;  3B4M A;  3T1H J;  1N34 J;  3DHX A;  2AJ4 A;  3NMR A;  4D3G A;  3W65 A;  2LP4 A;  1NK8 A;  4J9U E;  1NND A;  1DHM A;  2DXF A;  3KDN A;  3C6U A;  2UUB F;  4P71 A;  3TVY A;  2J7U A;  2OPQ A;  5CD4 A;  4ED8 A;  4OJ3 A;  3KG4 A;  3MFI A;  3KLG A;  3UW1 A;  1BQM B;  2GA7 A;  1SV5 A;  2AF6 A;  2IDE A;  2BEF A;  1R0A A;  2MMY A;  5IT4 A;  5A8K B;  3C6U B;  1HYS A;  3NG8 A;  1F9H A;  1RSC A;  1GXL A;  3PEH A;  3SQO P;  2DH9 A;  4OYA A;  2FHJ D;  1YIT S;  2ASY A;  2AKW B;  2E1M C;  3PVX A;  3KLG B;  4C98 A;  3A3N B;  4RPF A;  4ED2 A;  2B0G A;  1IQT A;  2NQP A;  1SV5 B;  4B08 A;  1R0A B;  3P5T L;  3IBF B;  4LFC J;  1C1C A;  1ZS6 A;  4QW9 A;  2K7K A;  1HYS B;  4EYH B;  4B9V A;  1KRP A;  3Q8R B;  2KJV A;  1UZH A;  3HVT A;  4QJV A;  4YDX A;  1FXR A;  4HEA 9;  3VAG A;  5D4N A;  4QBU A;  3SQG A;  1J5O B;  3WIV A;  4JI2 J;  4P2M A;  3V5R A;  1VRT A;  3HHL A;  2FJV A;  4DR1 F;  2MZQ A;  3DOK B;  3N9U C;  2CWX A;  5KG6 A;  1OYE A;  4DR6 J;  3LAL A;  1PIE A;  4Y2C A;  1E6Y B;  4G3I A;  4TY9 A;  4EEY A;  2NXC A;  5FLX Y;  4PQU A;  4EWT A;  3AOC A;  1IR1 A;  3HVT B;  3J7Z 5;  2VFU A;  4XDD A;  1UW4 A;  3SQG B;  1TL4 A;  2VJV A;  4KO0 B;  1N88 A;  3HHD A;  2CKW A;  2ZNY A;  4WU3 A;  2BM0 A;  3QJP A;  4PQA A;  5C42 A;  5HQL A;  3OTO F;  3DOM A;  1SKS A;  2FJX A;  2KZZ A;  4F50 A;  1WG5 A;  3ZZU A;  3QZ8 A;  4OX8 A;  3QJJ A;  2K2P A;  1FFW B;  1SL1 A;  1LKZ A;  5I3Q A;  2E44 A;  1NO8 A;  2OFG X;  3DLK B;  3VGS A;  4X66 F;  1FDD A;  5B0F A;  4YHH F;  4L74 A;  1FER A;  5A6W A;  4ZP7 A;  1ZM9 A;  1RWN B;  2O3D A;  3CD5 A;  2B51 A;  4ZPC A;  2DHH A;  3P45 B;  1D3W A;  1BXN A;  5HMW A;  3KNG A;  2EC0 A;  5CH7 B;  1PCA A;  2KXN B;  4U7U K;  2HWI A;  3TWZ A;  4A8O A;  3DLB A;  2OAU A;  3TAM A;  4H4K A;  2O01 C;  1S4E A;  3DMJ A;  1BQN A;  3CDW A;  5HBM A;  5J1E A;  4GKK F;  4URS A;  1JMT A;  4A46 A;  4ENO A;  4DR2 F;  1ZPW X;  2B4U A;  4L73 A;  2D69 A;  1RT3 A;  4WFY A;  2VIH A;  1QVG R;  2Z57 B;  2X3D A;  4NML A;  5D8H B;  4DL0 C;  3CW2 C;  2ERR A;  3CUL A;  3HFK A;  2IIH A;  1BQN B;  1PYS B;  4NE9 C;  1JLC A;  1BQX A;  2F8M A;  3N4W A;  5B09 A;  3KLH A;  5B0E A;  3FZB A;  4JI0 J;  2Y1I A;  2YPZ A;  4FS2 A;  2AYG A;  1LFW A;  4P7V A;  3Q8Y A;  3SEO A;  3KG0 A;  5HMY A;  2Z30 B;  4GVB A;  4OFZ A;  4KHM A;  4PXB A;  5D4L A;  2XCA A;  2HHU A;  1RHR B;  1YJR A;  4UUX A;  3EJM A;  3D6H B;  3W8P A;  5BYS A;  2DNM A;  4JYA F;  4X4T A;  1JLC B;  2CJQ A;  2CFX A;  2DY1 A;  4ILR A;  4HI1 A;  3KLH B;  3GFX A;  3M8S A;  1VQS A;  4LQ3 A;  2BJ1 A;  3JSR A;  4N5S A;  3S8S A;  4LF5 F;  4OQJ A;  2BYC A;  3R5J B;  2ZUA A;  4AND A;  3G71 S;  3GYX B;  4GVB B;  1NK7 A;  2MST A;  4AL7 A;  1X4G A;  3H25 A;  5CCM A;  3GB0 A;  4NI2 A;  4ECU A;  3NY0 A;  3MMC B;  3PJW A;  3NWR A;  2PE8 A;  2BW2 A;  4UY8 T;  1BUX A;  1VFJ A;  1HQU A;  2LXF A;  1HNV B;  3QID A;  3H5S A;  1DTT A;  4OHZ A;  2QZ8 A;  1S79 A;  4UOF A;  3UN3 A;  4LBP A;  1ZA2 B;  2OML A;  3W1Y C;  1HMV B;  3PW4 A;  2UU9 J;  5J2Q A;  2PDA A;  2CJ9 A;  5T41 A;  5EX3 A;  1S1U A;  2Z2Z A;  4C0O C;  2PN6 A;  1XQI A;  4FN5 A;  3H7H B;  4CH0 S;  1VQ4 S;  2K1R A;  3I9Z A;  1V6H A;  4X4P A;  2YKQ A;  1M5K C;  3QAT A;  5JUM A;  1SQE A;  1UJ4 A;  4NLW A;  2DB1 A;  4ZJQ A;  5D0R A;  2DIU A;  2N82 B;  4TKT A;  2O1P A;  3JXO A;  2PII A;  3IRW P;  2IRY A;  2IBK A;  2VA3 A;  1R27 B;  1AZS A;  1S1U B;  1Q79 A;  1VHI A;  1NJI T;  2WZ1 A;  2BAN A;  3SIP B;  3Q8V A;  4HHU A;  3W62 A;  1FJ7 A;  3GII A;  1J5E F;  2DCU B;  2IRU A;  1NU4 A;  3U1L A;  1B7Y B;  1QE1 A;  2YH0 A;  4DPW A;  3UD3 P;  1RT2 B;  3S01 A;  3TO8 A;  1TUV A;  1TFY A;  4M5I A;  4ITS A;  2RRB A;  1KOH A;  2HS4 A;  1N33 J;  2QX0 A;  1TMJ A;  7AT1 B;  1PKU A;  4BC9 A;  5GAH U;  2MQQ A;  2EFQ A;  2AGO A;  2E66 A;  1CJU B;  2YWW A;  1JB0 C;  1QE1 B;  1VLO A;  2JVR A;  3AQP A;  3WHI A;  1HHT P;  4G6V B;  2RDD A;  2HMI B;  1FDA A;  2QFI A;  1LWX A;  3T1Y J;  4ILL A;  1A7G E;  1UMJ A;  1Y5N B;  2FHK A;  1DRZ A;  8RUC A;  3OQ2 A;  1NJW A;  4K5R A;  2B8Q A;  4ZVR B;  2XTJ P;  2NCK L;  4PPZ A;  2D3Z A;  3ONQ A;  3KK3 A;  1NH8 A;  4J37 A;  2VA2 A;  2KYX A;  2ZD1 A;  2JEI A;  2FUG 9;  3K8V A;  5HSP A;  4PXE A;  1WUU A;  1S76 D;  1T9Y A;  3MCM A;  3DDN A;  4O4R A;  3M4X A;  5ETM A;  1WDT A;  1L3K A;  4AD6 A;  1FX2 A;  2KT2 A;  3OSP A;  1VBY A;  3A8K A;  4A8Y A;  3CMA S;  1F9F A;  4USU A;  1YJN S;  3KK3 B;  3TEH B;  1VC5 A;  2QMX A;  4X4N A;  4Q7A A;  1ZZF A;  2NZC A;  4B3T F;  4RUH A;  4ZVF A;  2GJI A;  1HWK A;  3FRZ A;  4UT4 A;  3NNC A;  3ET6 A;  3ENV A;  3LPY A;  3NGD A;  2F65 A;  4Z7Y A;  1RJJ A;  3M8Z A;  3WBZ A;  2HUR A;  4DR4 F;  4HTJ A;  2VH7 A;  3HPO A;  4M5M A;  3G8T A;  1DY3 A;  4O0N A;  4CLU A;  2XMA A;  1FA0 A;  2B5J A;  1FO1 A;  4QW8 A;  1B7F A;  1OMS A;  1N48 A;  4OV6 A;  4JI4 J;  3ET6 B;  2F9J A;  4OZ3 A;  3OJS A;  3ITH A;  2NUU G;  4JP8 A;  2VFT A;  4NLY A;  4OIX A;  3HUL A;  4CO4 A;  4DR7 J;  2FVP A;  3MR2 A;  4CO0 A;  2OEK A;  1LXJ A;  3N6L A;  2YXL A;  2B5J B;  3R5C A;  1UJ5 A;  4PCQ A;  4NX9 A;  2A18 A;  1FKP B;  2DRB A;  4F26 A;  3NCQ A;  1RXO B;  5KG5 A;  2ZOF A;  2C3P A;  3ITH B;  1HNW J;  3QPI A;  2MSS A;  1F3V A;  1KLN A;  3TVK A;  1F2H A;  1VOM A;  3GZ7 A;  5LJ5 Y;  4ZP9 A;  1YSJ A;  5M2P A;  4KV8 A;  2J9E A;  5AE3 A;  2MZR A;  1NK5 A;  5SUH A;  5B0A A;  3PKY A;  4L3K A;  5J2P B;  1M5H A;  4E2F B;  2MEW A;  3K5L A;  2GCF A;  2UUC J;  1XBW A;  3MMA A;  3C8Y A;  1SL0 A;  2CQ2 A;  2QJ3 A;  1RT1 B;  1HQ2 A;  4JI7 J;  4TLQ A;  3ILI A;  4J7C A;  4LQ9 A;  3HKW A;  7FDR A;  2XC9 A;  4WKY A;  1K1Q A;  5DG7 A;  1TVR B;  3TQ1 A;  4AQY J;  1DAX A;  3D3C J;  1S1W B;  2R3V A;  4ZPV R;  4ED0 A;  3VHQ A;  4DS4 A;  1URR A;  1CJK A;  2XMK A;  1LW0 A;  4IYQ A;  1T9V A;  2V4J A;  5HAT A;  5KFN A;  4TQR A;  3KUH A;  3MMA B;  3CJK A;  5KG1 A;  2GQQ A;  4DR3 F;  1H7W A;  3P6Y C;  1S57 A;  3OJU A;  1JLB A;  2VG6 B;  3TEG A;  4BHQ A;  2HAF A;  4M94 A;  2MY7 A;  5KFC A;  3KHR A;  3IAS 9;  1LW0 B;  4ZN1 A;  2B56 A;  3TP2 A;  4YS2 A;  3R7S B;  3CJK B;  2B43 A;  5D78 A;  2ZBC A;  2D7S A;  1UA0 A;  2LEP A;  2W2Q P;  1NJY A;  1WC0 A;  3QZ7 A;  3DI6 A;  2CQI A;  3KLV A;  3MM7 A;  2AWZ A;  1KTQ A;  2AT1 B;  5IT9 U;  4ED7 A;  4A8W A;  3EGW B;  2XMT A;  1VQ5 S;  1LK5 A;  2GVZ A;  1YBT A;  1NDK A;  4WZM A;  2P2C B;  4KGX B;  3B6B A;  4ALZ A;  4DEZ A;  2LCW A;  1XR5 A;  4TYB A;  4CO1 A;  1YZ6 A;  2ZNZ A;  4BBY A;  5AJ3 J;  2ZUG A;  1Y3J A;  3CCV S;  4F25 A;  4ERD A;  3R1L A;  2V69 A;  4P74 A;  2V0N A;  2H65 B;  9ATC B;  2ASJ A;  2DNQ A;  3TJ8 A;  1RGV A;  1DQ9 A;  2QL9 B;  2C42 A;  2DHG A;  3NL0 A;  2CPZ A;  1UEV A;  5L9N A;  4QPX A;  2H54 B;  3D6M B;  4KIA A;  4I7F B;  2FC9 A;  1U1N A;  4IH7 A;  4OMF G;  1RE1 B;  2J6S A;  5KFF A;  2XUL A;  2BV3 A;  1WG4 A;  4RW6 B;  2HBQ B;  3KTQ A;  2QLX A;  2HGN A;  5DQG A;  2VPX B;  4K5S A;  1M5S A;  3W7B A;  4I0W A;  3CJ3 A;  1FXL A;  3SZ2 A;  2V2Z A;  3FCH A;  2OPP A;  4CH7 A;  4Y3C A;  3J7Z T;  4IQM A;  1QD1 A;  1IWA A;  2HFO A;  1HD0 A;  4DV1 F;  1RB0 A;  1HQE A;  2FTR A;  2Q79 A;  2YQ1 A;  4ED1 A;  3D3B J;  4C3M A;  4RBU A;  4YDD B;  4UOH A;  3TZY A;  1K0T A;  1JNZ B;  1K73 T;  2WOM A;  2IY5 B;  1UW9 A;  2CNO B;  3FNN A;  1B4S A;  1ACM B;  1B3T A;  2ACM A;  1C0U B;  5IQQ A;  2ILY A;  1N54 B;  2OPP B;  4PAB A;  4KKO A;  5RUB A;  1IQZ A;  3M9N B;  3IS9 A;  3IFE A;  5CYM A;  5K5M A;  1U26 A;  4JI6 F;  2CQC A;  1HQE B;  2WSF C;  1KSP A;  3B4D A;  4IDK A;  3AD9 C;  1YBU A;  1WEY A;  2RQ4 A;  2FDN A;  2CZV C;  1YIJ S;  3FMB A;  4UUW A;  4I1T A;  4OYZ A;  1CVJ A;  2DJW A;  2HKE A;  4DV5 F;  2WSC C;  4CM0 A;  3CSK A;  3NMA A;  4KKO B;  3D9B A;  1S49 A;  3TUJ C;  4PRF A;  2HHW A;  3KK1 A;  2KFN A;  1RTI B;  2XZD B;  2B8P A;  1NK0 A;  1NLK L;  5IM0 B;  3IXQ A;  4ELU A;  5L1J A;  3DHW C;  3AD8 C;  3ISN D;  5B7W A;  2D9P A;  2AD9 A;  2BDP A;  1M5V C;  3PO5 A;  5I42 A;  2A10 A;  3M8Q B;  5ETQ A;  2KHC A;  2ZHO A;  4QYZ K;  1VCT A;  4RW4 A;  2EG1 A;  1TQL A;  2E5I A;  2OH2 A;  3HSG A;  5A8W B;  5CHC B;  2KM8 B;  4KR0 B;  3N28 A;  2XEX A;  5F8I A;  4OYP A;  4LVO P;  2OHD A;  4OL8 A;  5HMX A;  2QEX S;  1S1V B;  4ILM A;  3GIK A;  4DSJ A;  5SZT A;  3UR0 A;  5I42 B;  4ZLP A;  3RR8 A;  2F4F A;  4WZQ A;  3RW7 A;  4YR0 A;  2RQM A;  4F02 A;  2LEA A;  1D1U A;  4ID5 A;  3QQC D;  5T7L B;  4RW4 B;  4NPO A;  2KG1 A;  3IBW A;  2NZ4 A;  4J90 A;  2IA0 A;  1VMB A;  2C2N A;  2BE9 B;  3VAJ A;  3PW0 A;  2I1R A;  3ZTO A;  2W7O A;  5LMN F;  2RAQ A;  4F4Y A;  3OHA A;  2OFH X;  4CP5 A;  4NA2 A;  1U8S A;  3W64 A;  1LOU A;  5HAN A;  2XLI A;  1CPZ A;  5IOL A;  1Y3K A;  1VI7 A;  2R8H A;  1JXV A;  3VQT A;  3A12 A;  4ID5 B;  4C8L A;  2QTW A;  1UA1 A;  2HQI A;  1KVI A;  4ETX A;  4V19 X;  2VQE F;  1JXL A;  1RAA B;  5IFM A;  1IBM F;  2E9R X;  1H73 A;  2RDJ A;  2BW7 A;  5HO4 A;  3LF0 A;  2UVR A;  3DLH A;  5IXU A;  2XGP A;  4B9T A;  4F67 A;  1R89 A;  2M8D B;  1K44 A;  1XMQ J;  1WDD A;  3M8Y A;  4DX6 A;  1IBK F;  3T6J A;  4DR5 J;  2XI2 A;  3KWM A;  2CJX B;  1RHJ B;  2IA6 A;  2GFF A;  4HAC B;  5IQ6 A;  4A8M P;  3OR1 A;  4DOZ A;  2V8H A;  1CLF A;  4DQR A;  3QNW B;  2MKY A;  2RML A;  3T3F A;  3TZZ A;  5I4M A;  3NGR A;  2SXL A;  1JQG A;  1C0T B;  1SQF A;  3BGU A;  4USI A;  1JLQ A;  2UVV A;  2UUB J;  3SCI E;  2LXU A;  3BBF A;  5HLF A;  2CJY B;  4KGV B;  3TI0 A;  1S7H A;  1S77 D;  1NUE A;  2X3G A;  2IJF A;  4QIE A;  2V2K A;  3UD5 A;  2F63 A;  5L1I A;  4PG6 A;  2ZH7 A;  2R8I A;  4RWW A;  1B0V A;  2HQD A;  3IM9 A;  3FDS A;  3I31 A;  1VIO A;  5HK4 A;  1SPB P;  2MLX A;  1L3T A;  2M52 A;  1HA1 A;  3LAK A;  3MPW A;  4O23 A;  2JOQ A;  3DRY A;  5HLF B;  1WC3 A;  5EDW A;  2G9O A;  4I6A A;  4QYR A;  2WAQ D;  1QDU B;  3FBC A;  1RWO B;  2DR7 A;  2WTF A;  4W90 B;  3DRX A;  1I5O B;  5CA5 A;  5K8M A;  2JEG A;  1JLE A;  1MN9 A;  4WJB A;  3ILO A;  2HHT A;  2Z8Q A;  4KTQ A;  1UPP A;  2AMC B;  3D6T B;  2VV5 A;  4R8U B;  2DVI A;  2KRB A;  2DGT A;  3HP6 A;  3O2I A;  2QG9 B;  3ICL A;  4DR1 J;  1JLE B;  1Y00 A;  1OO0 B;  4QIF A;  3ULH A;  4DF8 A;  2OEM A;  3NCP A;  1REV A;  1HI1 A;  1SH3 A;  2H5I B;  4OI2 A;  3I0S A;  2YKN A;  1TKT A;  2IM2 A;  1S99 A;  1UFK A;  3CIM A;  1WF2 A;  2QYC A;  4DL2 A;  3G87 A;  4I69 A;  4X4R A;  1WOR A;  4KH1 B;  1AA1 B;  2HRY A;  5CQG A;  3Q8U A;  2XM3 A;  1ARO P;  5K8N A;  3FQL A;  2M9K A;  2CQD A;  4NCG A;  3DRP A;  3OXG A;  2QLJ B;  2GAG C;  2W8L A;  2HND B;  4QCL A;  5J2N A;  3JAM U;  4OYB A;  2Q3P A;  4FXV A;  3OTO J;  1AUS L;  2YKN B;  1TKT B;  1YJW S;  3SFG A;  3O5T B;  4C7Q A;  3GCW P;  3GCX P;  4B3O B;  1S6O A;  1NBE B;  2NS1 B;  4AE5 A;  1NPP A;  3H20 A;  2QA2 A;  4LF2 A;  4F04 B;  2OEJ A;  1RAI B;  2CPI A;  4X66 J;  2XWY A;  2MHE A;  2WRM A;  3FSI A;  2CQ1 A;  1TUW A;  3OBI A;  4YHH J;  5KAK A;  1N5Q A;  4URQ U;  2HW3 A;  1T03 A;  3F56 A;  4OZL A;  4LR9 A;  4CNY A;  1JJ2 R;  1N5V A;  2IM1 A;  1TMM A;  1M1H A;  1RI7 A;  1OYD A;  2I8E A;  3AQO A;  2BOP A;  4ZCI A;  1ZET A;  4QWD A;  1V5V A;  2XNQ A;  1WF0 A;  1TKX A;  4GKK J;  3ZTR A;  3PEJ A;  2A3J A;  4DR2 J;  1NRK A;  5ETN A;  4WU2 A;  1T03 B;  3PY8 A;  2AP6 A;  4LF6 F;  4ZVG A;  3G96 A;  3KJV A;  4JI1 F;  1Z1Z A;  3OUY B;  4FZV A;  5DET A;  2VG5 A;  3NOG A;  3N5B A;  2Y0B B;  3GYG A;  1TKX B;  2ZHA A;  3IWX A;  1GAO A;  5EGY A;  4P7T A;  4CZC A;  4ZCK A;  2QFJ A;  1IJF B;  2P5V A;  2LKZ A;  5KT7 A;  1KLM A;  3RRG A;  2DR8 A;  3L4B C;  1TL1 A;  5L8R C;  3KJV B;  2ROP A;  2CXE A;  4EBC A;  3A1Y G;  3ZZO A;  2W9C B;  4V19 J;  2HVI A;  2HWH A;  1EQ0 A;  3AA8 A;  3RG6 A;  2VG5 B;  4RW9 B;  3UD4 P;  5L1L A;  2BAB A;  2YY3 A;  3BN7 A;  4JYA J;  2W2N P;  2MHN A;  5THW A;  4ETZ A;  3IA0 A;  1FFS B;  2DNP A;  1GMV A;  3BGO P;  3DLG B;  2HNZ A;  4DL7 A;  4JI3 F;  4LF5 J;  1JJ4 A;  2UV8 G;  3UDV A;  1M90 T;  1TL1 B;  2PEH A;  4I68 A;  3EYZ A;  3G6X A;  2MKS A;  1NK9 A;  2UUT A;  2R7S A;  3CCJ S;  1FRM A;  2VOP A;  3VAF A;  2XYH B;  4QR2 A;  2HZV A;  1TK0 A;  4RLE A;  4E98 A;  1HPZ A;  1HBN A;  2J8A A;  4GKJ F;  2PD1 A;  2JNJ A;  3LP2 B;  4ECY A;  5A0Y B;  2HNZ B;  3FBB A;  3CCE S;  1O6X A;  1R8A A;  3DU6 A;  3M6V A;  2RUS A;  3NGU A;  4C4W A;  2HFV A;  2ZWO A;  1ZTT A;  2W9B A;  2E1R A;  2EVZ A;  3RB6 A;  5G4D A;  3CMQ A;  4ZJL A;  5KFQ A;  4PYD A;  5J1P A;  1FFG B;  2IM3 A;  2C28 A;  3MR3 A;  3IP0 A;  4ICL A;  1Y11 A;  2HSE B;  3LWL A;  1HPZ B;  2XB2 D;  1HBN B;  1UZD A;  2LQ9 A;  1NPK A;  2AJ2 A;  2Z2M A;  2RHS B;  3NRB A;  2DPI A;  3RUB L;  1VGY A;  2DKO B;  1DBD A;  3HSZ A;  5KFU A;  4K4V A;  3PYG A;  2W9B B;  3MGJ A;  5D4O A;  2GQC A;  1L3V A;  3G6E S;  4ZKA A;  1CJV B;  1RZM A;  2K7J A;  1N4L A;  3TX0 A;  5GAH I;  2F5G A;  3DDK A;  3IMQ J;  4ICL B;  4BWM A;  1O8B A;  4JI5 F;  4ZVU B;  1PGZ A;  1Q78 A;  1T05 A;  2NSC A;  4O3N A;  1NM2 A;  3AJ2 A;  1GH8 A;  4K4Z A;  4Q43 A;  3Q83 A;  4IH5 A;  2YQ3 A;  1XNQ F;  1ZAX A;  2XHW A;  1IN0 A;  3H4D A;  3MM5 A;  4C0H A;  1QSL A;  1S7I A;  2GAH C;  3HK2 A;  4NRU A;  2WVF A;  3IGN A;  5EWG A;  5B0C A;  2IDL A;  5HI7 A;  3CC7 S;  3NOC A;  2BRL A;  1F1B B;  3MI7 X;  4ZVQ B;  1T05 B;  1SIZ A;  4ZCM A;  2FC8 A;  4Y2A A;  1JKH B;  4J9P A;  4IOB A;  2Z2L A;  3D0G E;  3BEG B;  1X5S A;  1BY9 A;  1YJU A;  4G1I A;  4R5P B;  3MM5 B;  1KEK A;  2RQC A;  3QAU A;  1F3F A;  1WAC A;  2HK3 A;  4RBV A;  5K14 B;  3GIR A;  1KDN A;  4URG A;  3OVB A;  2AYE A;  3LUY A;  1WG1 A;  4USW A;  2I5J A;  3F44 A;  1S5Z A;  3PZP A;  4ZIW A;  3DM2 A;  1WHX A;  1FD8 A;  3I82 A;  1Q7L B;  3B82 A;  2HQ3 A;  4FF3 A;  3MCN A;  3A8J A;  3FEZ A;  4QWA A;  4B3S F;  1FKA F;  2FIU A;  1VIX A;  1TL7 A;  1RT4 A;  4W4M A;  5KFS A;  3W2W A;  3JSY A;  3GV8 B;  3KYL A;  2UZA A;  1RA6 A;  4GC7 A;  1UEU A;  1OY8 A;  3OTC A;  3I55 S;  5GAE U;  2POK A;  4USV A;  2I5J B;  1SJF A;  2BQU A;  1NDP A;  2KM8 C;  4AYB D;  3DM2 B;  5E3Q A;  1T3N A;  4RNN A;  1RTJ B;  1IVZ A;  4IRC A;  4DFP A;  4XPE A;  3NAH A;  2PC6 A;  5IC4 B;  4DQQ A;  2DIV A;  1L5U A;  1TL7 B;  5E5N A;  4B3T J;  1RT4 B;  2R7T A;  5DS7 A;  1KOO A;  3W2W B;  4MKY A;  1WOS A;  3UCZ P;  2EG2 A;  3GMG A;  3OV7 A;  4M5G A;  4B9U A;  2Y8W A;  2EW9 A;  3MEC B;  4DR4 J;  2C1E B;  2BKN A;  2DNZ A;  4F3M A;  3GJS B;  1URN A;  3KLE B;  1S1T A;  1FRJ A;  4LF9 F;  1WEZ A;  3M2R B;  2XMW A;  5DGB A;  1J2V A;  2JH3 A;  3EPG A;  2PA3 A;  4DL3 A;  2G1D A;  2NXJ A;  2IVF B;  2D9O A;  3FEX B;  1X5T A;  4ED3 A;  1UP1 A;  4DL4 A;  2IMO A;  1MU2 A;  4LSN A;  2CNK B;  3THP A;  4B17 A;  3BR9 A;  1U2R A;  5KFD A;  4DCO B;  1S1T B;  2RF2 B;  4DCP B;  2IRX A;  1NCL A;  4ES3 A;  3IAM 9;  3W63 A;  3BKT A;  5HJY A;  1OQ6 A;  5DQH A;  2AZ1 A;  1RT5 A;  3DDI A;  1VQO S;  3KK2 A;  1VQ6 S;  1SIW B;  4I67 A;  3DOL A;  1RYS A;  3QRQ A;  2KT5 A;  1AXQ A;  1S48 A;  2VF3 A;  1PIL A;  2CNL B;  3DU5 A;  1MU2 B;  3MPD A;  4LRC A;  4J9S A;  1UL3 A;  4R0J A;  3PNI A;  3JSM A;  3Q8P B;  3M2V A;  1U02 A;  1X31 C;  2J0W A;  4C48 A;  3OXF A;  2XS5 A;  4K0K F;  1JWW A;  1VJW A;  5CYQ B;  1KVK A;  5B0D A;  4A8Q A;  1YJ7 A;  2NXN A;  3W61 A;  3KK2 B;  4DG1 A;  3DOL B;  2NLW A;  1BGX T;  1HL6 A;  3CCR S;  2V8V A;  1RAE B;  5BR8 F;  3ZTP A;  3TNV A;  2PSZ A;  2VOD A;  5F0U A;  2YNF A;  4BWJ A;  4RR5 A;  3JSM B;  4QQB A;  4Y65 A;  3GON A;  3QO9 A;  5KFK A;  1FK9 A;  3W2V A;  4TU8 A;  4QYZ J;  4OZ0 A;  3RR7 A;  3IO1 A;  3S6E A;  4JV1 A;  1LXN A;  2G4B A;  4DR3 J;  2FY1 A;  1Y0H A;  2YNF B;  2YNH A;  2MLZ A;  1R8H A;  4OJ1 A;  2VAS A;  2ZH2 A;  3I4P A;  3LGM A;  1CC8 A;  2RB7 A;  2XYG B;  1FK9 B;  3V4I A;  1Y10 A;  2L9N A;  1WEL A;  2GMH A;  4JV2 A;  5H1S V;  1BLU A;  2CNN B;  3TAN A;  3LPE A;  1WHW A;  4DPY A; 
#chains in the Genus database with same CATH homology
 2QLB B;  1RWW B;  3GJS B;  3R7N B;  2CNO B;  3GJQ B;  2QLF B;  3IBF B;  1NME B;  1F9E B;  2C2K B;  4ZVU B;  1IBC B;  2QLJ B;  1QDU B;  1RWK B;  2H65 B;  1RWO B;  1GFW B;  2XYH B;  5IC6 B;  2QL9 B;  1RWN B;  2QL5 B;  4ZVO B;  1SC1 B;  3NS7 B;  1RWV B;  1ICE B;  5K20 B;  2CNK B;  2H54 B;  3D6M B;  1RHR B;  2CJX B;  3R7B B;  2Y0B B;  3D6H B;  1PYO B;  1RHJ B;  3P45 B;  4DCO B;  3KJQ B;  4ZVT B;  4DCP B;  4ZVS B;  1RWM B;  1RHM B;  2C2M B;  1RE1 B;  3QNW B;  2HBZ B;  3GJR B;  3R7S B;  2H51 B;  2XZT B;  3RJM B;  2Y1L B;  3D6F B;  2QL7 B;  2HBQ B;  4ZVQ B;  2H48 B;  3R6G B;  4LSZ B;  3GJT B;  4DCJ B;  3R5J B;  1I3O B;  2HBR B;  5IC4 B;  1QTN B;  2CDR B;  3R6L B;  1PAU B;  4ZVR B;  2CNL B;  2C2Z B;  2C2O B;  1I51 B;  3P4U B;  3IBC B;  2CJY B;  1RWP B;  1RWX B;  1SC4 B;  3SIP B;  2XYG B;  3EDR B;  2XZD B;  1SC3 B;  3KJF B;  2H4W B;  3KJN B;  1RHQ B;  1RHU B;  3EDQ B;  2XYP B;  2H4Y B;  4JB8 B;  2DKO B;  1RHK B;  2HBY B;  2H5I B;  1BMQ B;  2C1E B;  2CNN B;  2FQQ B;  2H5J B;  4ZVP B;  2P2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...