3IBCB

Crystal structure of caspase-7 incomplex with acetyl-yvad-cho
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, apoptosis
total genus 15
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3ibcB00
3R7SB 1ICEB 4ZVOB 1RWWB 1RWXB 3GJQB 4ZVUB 3D6MB 4JB8B 2XYGB 2C2MB 2XYHB 2Y1LB 5IC4B 2QL7B 3R6LB 4DCOB 1RWOB 2CDRB 2H5JB 2CNKB 2CNLB 2HBYB 2H5IB 1RWKB 3KJFB 2H51B 3GJSB 3KJNB 1RWMB 1PYOB 1I3OB 2H65B 2P2CB 1RWPB 3P45B 3R7BB 4ZVSB 2DKOB 3SIPB 4ZVPB 4ZVQB 3D6HB 3D6FB 1I51B 2CJXB 1SC4B 2HBZB 4DCPB 3GJTB 3KJQB 4ZVRB 2CJYB 2Y0BB 2H4WB 3GJRB 3RJMB 2H4YB 2HBQB 1SC1B 2FQQB 1RWVB 4ZVTB 1RHUB 3R7NB 4DCJB 5IC6B 2QLBB 1IBCB 1NMEB 1RHKB 2HBRB 3IBCB 5K20B 2CNNB 1RHMB 1BMQB 3EDRB 2C2KB 1RHRB 1F9EB 2QLFB 1RE1B 1PAUB 2QLJB 2QL5B 3R5JB 1RHJB 1SC3B 3NS7B 1QDUB 1RHQB 3R6GB 2H48B 2CNOB 1RWNB 1GFWB 2XYPB 2H54B 2QL9B 2C2ZB 2XZDB 3EDQB 3QNWB 2C1EB 3IBFB 2C2OB 1QTNB 4LSZB 2XZTB 3P4UB
chains in the Genus database with same CATH superfamily
3ZXWA 3OBIA 1B70B 4KH0B 4TU9A 2ZBIA 3CCLS 2EFVA 2X1FA 3NAHA 1TKZA 2ZVIA 2CZ4A 3MM7B 2F4FA 2CQ1A 1LWEA 4DUZJ 4UQTA 4H4KC 1RWOB 3NOCA 3TAQA 3IXQA 1ACMB 2QYCA 2KRRA 2XNRA 4ZPBA 4ATNA 3AD9C 4G65A 3EZ5A 3I87A 4WFZA 1YJ9S 1IM6A 2AYMA 4HI1A 5LSRA 3E01A 2J9DE 1U1OA 1FDBA 4RX6A 3M9OB 3ILOA 1T0TV 4DR5J 1NU4A 3F56A 1RT4A 4RL1A 1UZDA 3HHEA 4I2PB 4M5IA 2ZUAA 4LF6J 2JZ5A 2W1BA 3H2LA 3DOMA 1KLMB 2HHTA 2XZTB 1S6UA 3IRXA 1VQKS 3RR7A 5HMYA 1IKXB 4TNOA 1CJTA 3LANA 3M2RA 2VFSA 1XWLA 2QN6B 4DV3F 1H38A 2V2VA 2XY7A 1X4EA 4JI6J 3MECA 1BXNA 1YRTA 5IT9U 2M0GB 3HVAA 4M5KA 5HVFA 4WFAQ 5A0YB 2HVIA 1FFSB 2HFOA 4Z2XA 5EWEA 2NUHA 1OWXA 3W2WA 4PR6A 4MKAA 5DDQC 4ZVSB 3CT9A 2MQPA 4JI0J 1HMVA 3Q0AA 5BXIA 2IDLA 1NDKA 1X4DA 2M9KA 1Q7YT 4HH1A 1IR2A 1SH2A 3E51A 5THWA 3TVKA 1RHKB 4K7QA 5C25B 2DPIA 3FBBA 3N28A 3T5HA 3KLEB 4DPYA 4F4WA 2VDIA 3HO1A 5B0GA 2GFFA 3A1YG 4ECTA 1NPKA 2A1BA 2JEJA 2FLOA 1W2IA 4IG0A 1QSLA 1IUJA 4N41A 1NBEB 3GCXP 4J9OA 3BV8A 2XSJA 5D0HA 4GC7A 3MMBB 4C0HA 4U7UK 1U6ZA 4R0EA 2L9NA 2WVEA 1Q5VA 3SEOA 1X5OA 1VQPS 4RZRA 2DNOA 5H9FK 1FXRA 2BKPA 1JB0C 3DNCA 1K9MT 5F9LA 1X0PA 4H4OA 3CCJS 1S4FA 4AL7A 2CZ9A 2JC1A 2AD9A 3M7VA 4WTYA 2OPSA 3MD1A 3U1LA 5IM0A 2X51A 4I56A 4X4VA 2WSFC 4USHA 2IAJA 4YDXA 1VGYA 4GVBA 2Q6BA 2CJAA 4DV3J 2E5IA 2DJWA 2GGPA 4FYVB 3D7SB 2LEPA 1ZBTA 2DR6A 4N47A 3OVAA 4X4UA 3UDCA 1EETB 4D3HA 5CH7B 5E3CA 3N5FA 1BQNB 4F8RA 3R2CJ 3POTB 3IBFB 3LA0A 1Y9OA 4M5HA 1RT1A 4Q7AA 1Q8KA 2PSZA 1O5JA 3RBZA 3J7YI 2D7SA 1U2RA 4RNHA 2XY5A 4QCLA 4F2RA 3OUYB 1S1XA 4E0DA 2ZBQA 1F5BA 4NEZA 5DZ6A 3FSIA 2KG0A 4OZ3A 1T9XA 4X62F 3KK3A 4HDGA 4YUDA 4JI7F 4JYAF 4KV8A 3ENWA 1PYOB 5BJRA 5KT3A 2B9XA 4I6YA 4FXDA 1UVIA 3G96A 2VFTA 2GHWA 1FK9B 5BR8F 3ZNJ1 3NS6A 1WEZA 2AWZA 2GV1A 3HSGA 1V5IB 4BHQA 2B0GA 2RE1A 5FDLA 2C2KB 1RE1B 2UXDF 1YTYA 4DXLA 5HROB 5CXTA 1QSSA 2OMLA 3SBMA 2Z30B 3C14A 1FXLA 1WACA 1FDAA 4RJVA 2XSFA 3AAWB 3GIRA 3BO3A 3UPFA 3TNVA 1AFIA 2LMIA 2GAHC 1X9WA 2P5VA 2RAQA 5H9EK 2PT0A 4YQWA 2HFVA 5ETLA 3QGIA 4FYDA 2DNMA 1F5CA 2VC0A 1HNIA 1FJGF 1CC7A 4W90B 1N36F 1GNKA 2XWXA 3IS9A 1UCNA 1D8YA 5KFPA 3GSIA 1WHXA 4Q0BB 3S1TA 2YWGA 1BY9A 3QO9A 2QSWA 5D77A 4QIEA 3KG0A 4IDKA 4LMZA 1S1VA 4C11B 1HD0A 5CYQB 3BREA 2A10A 4O0IA 4CWBA 4HR2A 3EPIA 4OZ2A 3HP6A 3F0NA 3KUEA 4B9SA 1T3OA 5C7PA 3CCUS 4UUXA 2ABYA 5KG7A 2AGQA 1RTZA 1JLGA 2CQCA 1XTZA 1P9QC 2YKMB 2OEMA 3NGKA 1VI7A 4JV0A 3DDKA 4ZLJA 3FDSA 4X62J 1BWEA 2H48B 3PRDA 2HHPA 1D0EA 3DM2A 5KG1A 4JI7J 5J2NB 3CDWA 4JYAJ 2YH0A 2C2OB 2VJVA 1T11A 4LF4F 3QLHA 4DX8H 3LP2A 4DR1F 2BX6A 3FC9A 1F3FA 2PIIA 4DX5A 3NKYA 1YJRA 4K50A 2VA3A 2QZ8A 5BR8J 1U1LA 4MAKA 2DO0A 1RT2B 2E1CA 2RUSA 2YWHA 2ZZTA 3CCQS 4LF5F 4YB7A 1RAGB 1G3OA 3GJSB 3B4DA 3HJVA 2VBZA 2UXDJ 1LW0B 1DLOB 2HIQA 5G4DA 3IN5A 2VQFF 4DL3A 2LXFA 2RKIA 5KG4A 3B54A 1SC1B 4ZMMA 2FY8A 4KR0B 4PZVA 1D1UA 3R7NB 2SXLA 1U47A 2AJQA 2Q79A 4HKQA 4F0HA 2PFFB 5CD4H 1FJGJ 1SIZA 3GIMA 3MM8B 3DRXA 3NGDA 1N36J 3QMQA 4RNFA 4YEAA 4LF8F 4F2SA 3CW2C 3V6KA 3AOCA 3H5UA 2YWEA 3FK4A 3PW4A 1C1CA 3J7YU 4LFCF 4QR2A 3DOKA 1NB2A 2ZNYA 4OV1A 4J9KA 1GXUA 1GK8A 4N5SA 1TV6A 3D1OA 3T6JA 1IN0A 1VJQA 1UMJA 2O66A 8RUCA 2MKSA 2UVRA 1HWKA 3BQ1A 1CS4B 2JVOA 2QSFA 4U67Q 1OSCA 5SZTA 4F4AA 1X4BA 3PTWA 4QZVB 1HNZF 4P7VA 4DL7A 1T05A 4Q45A 4QR1A 1HIYA 3GG0A 4DSLA 4GO5X 1PGZA 4V1Ak 4UT4A 5GVQA 4AL6A 3F44A 5B0CA 5KFQA 4LF4J 2JEGA 2Y0BB 2CPEA 2YNFA 5HAOA 5LMNF 5CA5A 1PKUA 3PHTA 1KC8T 4NYZA 3K2YA 3TANA 5JVGQ 1RHMB 2DNYA 4UUWA 2EC0A 1HPZA 2VFUA 4ZPAA 5T7LA 3OTOF 4TY9A 3HHKA 4LF5J 4Q44A 3ZC4A 5HI7A 3VWSA 1B4SA 5C2GA 1VQ8S 3J81j 1RT5A 4P71A 2FD2A 5KOWA 2DH7A 2KI2A 1WTBA 2MZRA 1IQTA 4QU7A 5GMKa 4ZCLA 3G6XA 3N79A 3CO0P 5C42B 1S9FA 2W2PP 2MQMA 2VQFJ 3QT7A 4Q2LA 3K5NA 2DY1A 3DRSA 4MK8A 1JLCB 9ATCB 2FJXA 3J81Y 3TJAA 4LF8J 4K2JA 3DI6B 5J2MB 4IFYB 2PEHA 2PC6A 3P6YC 1WC5A 5ETPA 3JYTA 4LFCJ 3M4XA 5L1KA 2XMVA 4I64A 2KZMA 2VPWB 2IA6A 3SV3A 4CLZA 1TMMA 3SCKE 3FQLA 5HJXA 2V50A 1F9EB 4U95A 2ATLA 2ROPA 4Y2CA 2A6OA 3BN7A 2JL9A 4QWCA 2FC9A 3MM5B 2OPPA 3TZXA 7FD1A 3BS9A 1DZ5A 1HNZJ 3SXLA 1S59A 2B7BB 4KPCA 4ZOSA 4KSEB 2YX4A 4NLTA 3W62A 3D6MB 1S12A 2J0WA 5J1NA 5L1LA 1H7XA 4ES1A 3H7HB 1OS5A 3CDAA 5LMNJ 2O01C 2HQDA 2B4UA 3W65A 1N8RT 4X4NA 4F67A 4ECUA 2R7RA 4G1QB 2DHGA 1RA7A 3WC2A 2FZKB 1S9GB 2POKA 2XMKA 3OTOJ 2IVFB 4CCHA 3OJUA 1TP7A 5DM6Q 1U1PA 1ZH5A 1DJ0A 2VHGA 1SJ4P 4EGLA 4DFKA 4F02A 2O3DA 1R8AA 4OHVA 1X4FA 1TKXA 1AYEA 1TL4A 2DITA 2RU9A 5HANA 2DRAA 2MJUA 1FDNA 5ETKA 2IHR1 3CWJA 2J9EA 1PIEA 1VQNS 1HI1A 4ETXA 1BLUA 1EKSA 4K5SA 3ZFVA 3HFVA 3TI0A 1ZM4A 1NCLA 2MSSA 4FZVA 4OL8A 2BE2A 3J7Z5 4DR4F 2BMBA 2F4VF 5EDWA 2W4CA 2F40A 2Z2LA 1UEUA 3E3XA 3GONA 2H51B 1XMOF 4I7FB 1OSDA 3VGVA 5A8KB 3SSRA 1FRXA 2VBWA 4RNMA 1PYSB 5DG7A 3VGTA 2DH8A 4CO2A 2BW2A 2ACYA 1GTEA 4IOBA 1SIWB 3QBCA 1FDDA 3Q8VA 2E1AA 3NP5A 4ZJLA 1SJQA 3VAMA 3PJXA 1LKZA 2KHCA 3OTDA 5K8OA 2QV6A 4LFBF 2D3OR 4PWUA 1HBMA 4EBEA 4UTGA 4A47A 2VIHA 3QJLA 2OIHA 4PXEA 3QIDA 5E3RA 2DNGA 1NHKL 4L73A 3BH6B 1LWCA 1YRXA 4Y3CA 4DL0C 3QNWB 1H6KX 5A8RB 3RAXA 2LQ9A 1VBYA 2E7VA 2OPRB 2RSQA 3DN9A 2HQ3A 2Y1IA 2MZQA 2ZH7A 3DRRA 4NLSA 2WVBA 5BYRA 1ZOTA 2AZ3A 1RT3B 4CO4A 4ELTA 1M5SA 1O51A 1KVKA 2HBYB 1VBXA 1KHWA 3ZTOA 3QATA 2JX2A 2MXYA 4K2XA 3CF5Q 3QJJA 2E5LF 1PC4A 3D0GE 5F0UA 4KGVB 4QIWD 2WZ1A 1TZ0A 2KFZA 1GTHA 2XMMA 2KXHA 3M8YA 4P10A 5E33A 2IPOB 1RHUB 2OGUA 2DXEA 3KLFA 3L95X 1ZZNA 2KO1A 1IBMF 3CJ3A 4B9TA 1NAQA 3HFZB 4DR4J 2F4VJ 2I5JB 3CIZA 3LGMA 2F5GA 2RF2B 1XMOJ 1EB0A 4HACB 4FXWA 2CPIA 3F73A 1G7CB 3MEEA 3ZTRA 3PX4A 2CPDA 4DR2F 1C4CA 2X1AA 6AT1B 2I9SA 3R6LB 1LWXA 3CJTA 1KP6A 3CCVS 3TW0A 2EK1A 2X1BA 2FHOB 1X4GA 3QQCD 4QYRA 1B7FA 4DSJA 2VH7A 3M6XA 5DQGA 4LFBJ 1M1GA 1Q53A 4QPTA 2X3GA 4NLOA 5AT1B 3ITHB 1R8CA 2H65B 1OY9A 2ZH1A 4NI2A 3GILA 4M95A 1X4HA 2GS8A 3MHYA 2PGCA 2BV3A 2ATCB 4BCAA 1DTQB 2BKOA 4LR9A 2W2NP 2GX8A 3OTCA 2APOA 4P9SA 2FQQB 3NNHA 4CNYA 1QLNA 3SZ2A 1WJ9A 2FHJD 1IBCB 1N54B 4R0JA 4WFNQ 4F4KA 3CMQA 2FVPA 1TK8A 4J5OA 2LDYA 3UD3P 4K8RA 2RHSB 1N0UA 2VG5A 4OYWA 3DLLQ 2R8IA 5A6WA 1S1TB 1RJJA 1I1GA 1RDRA 2AF6A 2E5LJ 1U48A 3GPAA 3IFEA 4Z7YA 3GB0A 5H1SV 3CCRS 5LXRA 3ET6A 4X4TA 3TQEA 1FKPB 3GV7B 1R8HA 4M8LA 1JLFB 1HWLA 5DJBA 4Y2KA 1IBMJ 5J2PA 1SKWA 4FXVA 4LF1A 3I9ZA 2BOPA 3W2VA 1FKOA 2AZ1A 4CM2A 4ZVQB 2MKIA 2B4VA 3IR6B 3QJPA 1RQ0A 3GFXA 3I6PA 4LR8A 3PX6A 3W63A 3BO4A 4OX8A 4HEA9 1B0VA 2LU1A 2G9OA 3K8WA 1RLDA 1VQSA 2L3MA 3C6TB 4LF9F 2JWNA 4DR2J 2BW7A 1CULB 2Y1JA 1D9FA 4X2BA 4NCGA 4J90A 1RHRB 1KBRA 2K7JA 3KUHA 3FBCA 1KQSR 1S7IA 5KG2A 2MPUA 3MM9B 2R7TA 2ASJA 3CPWR 3HXMA 1EQ0A 4DR3F 1WI6A 2E1RA 1T9TA 3IR5B 4DQQA 3M32B 2ROEA 1Y0HA 2ALZA 3KDOA 3I5CA 1S1WB 1NRKA 3TUZC 4DFJA 1KLNA 1P9YA 3R5BA 1Y11A 1WG5A 2IJRA 3IG1B 3M2VB 3OFGA 4IQXA 4FYXB 3NAIA 4TYAA 3CJQA 4WTOB 1XJWB 2CQ2A 4AD6A 3EGZA 1Q79A 1FFGB 4FF3A 1EX8A 1LWFA 2GMJA 1UAWA 1N6QA 4LFAF 5D0RA 3TWZA 5ETMA 3UD5A 1LFWA 3TVZA 3UQSA 1PJ5A 4S0MA 5KFEA 2C2NA 5D3GB 4AUKA 3GWCA 2ALYB 2KVIA 1R31A 3PO5A 5IXUA 4U7UD 5DDPC 4C8KA 4V19X 2XZDB 3VAHA 3BSCA 2UUBF 3PACA 3RB4A 2AQ4A 2Z56B 1UL3A 5GMDA 1VBKA 2HVZA 1RKIA 1C1BA 2HFSA 2CPZA 3LF0A 1X9MA 4QU6A 2D9PA 3NBPB 2OEJA 3MUMP 4USMA 4DQIA 2L08A 4LF9J 4DHVA 1Y00A 2ADCA 2UUTA 2V4JB 2L48A 2Y0SD 3W1YC 5RUBA 1FKAF 1YRUA 5IT0A 3CCSS 4Y6IA 2Q66A 3PYGA 1N5TA 4K4TA 2JEIA 5GAHI 3SCLE 1VLOA 4URGA 2EPIA 4DR3J 2YWKA 1NXIA 2PA8D 4LRDA 4NZ7A 4LR7A 3VGUA 4NLXA 1S0OA 3M8SA 2M4MA 1VC6A 1P27B 3OQ2A 3DRPB 1NK4A 3CJ4A 5C2CA 3D28A 1L3SA 1BD6A 1KTQA 1RTJA 4RW4A 1RAAB 1X4CA 4HLBA 4KGZB 5CCLA 4XDCA 2YVSA 1UPMB 3W5YA 3K7RA 2IBOA 1H74A 3J80U 2HKEA 4LFAJ 3RR8A 3HD2A 2DR7A 3D1QA 7FDRA 1RT7B 4WIQA 1PO6A 1AUDA 4L72B 3RU0A 1K73T 3KLHA 1DQ9A 3E01B 1QVGR 3NRBA 4EI2A 2CG4A 1HHTP 4NYPA 3MMJA 4ZCMA 1VK3A 2DRBA 4CO3A 4RW8B 1RT4B 4PEOA 3H5YA 1NJXA 1SJRA 2UUBJ 3QIPA 3FSYA 2DHSA 4WCEQ 5I42A 2K06A 2YNIB 3TEGA 5M2UA 1F2GA 4GRSA 1CJVA 3EDRB 3DOMB 3RB0A 3IRXB 2MQOA 2GMLA 1QDUB 1CJTB 3M2RB 2JFKA 2W2MP 3EZOA 4TVAB 3H2UB 1AZSA 3CD0A 3X3UA 1VISA 4ZVGA 3OR2A 3S01A 4OZ0A 4KRWA 4TXSA 1T9VA 4PWDA 1XIQA 2E29A 4KFBA 4JB8B 4YR0A 4X4RA 1RYSA 1SL2A 4FPIA 5F8GA 3CDBA 4N77A 2F9DA 2C2RA 4Y34A 2DNNA 2W9BB 4KHRA 2BM1A 2MYFA 2P2CB 4DPOA 1X5TA 5L8RC 4A48A 2EXUA 4LBPA 3KFWX 5LM7E 5EGYA 3MR2A 2K7KA 2B6AA 2DEIA 3G9CA 1VIOA 2NPFA 3HMJG 5KFGA 4C97A 4R5PA 2J0SD 1TL3B 4M5LA 4ZPTR 4R8UA 2FY1A 5JXSA 4IG0B 3BSNA 1KONA 3W9HA 3RRHA 5BYQA 2OO4A 3PX0A 5F3TA 2B5JA 2ZITA 4AFFA 2XSJB 1BQXA 3D6TB 2P9CA 4IRDA 3C15A 4P52A 1QUPA 3FNNA 1NPPA 3RBXA 5IT9Y 3US5A 1KTVA 3H5SA 4WK1A 2CPXA 1CLFA 4ED1A 3LOUA 1HQUA 4B3RF 4C4WA 4H4OB 1RTHA 3RBEA 5T14A 2C28A 1U1MA 2YKQA 4MK9A 3W61A 4K4XA 4A8FA 2Z8QA 1IVZA 3DMJB 3K5OA 2V63A 3IBWA 3EMTA 4HTJA 5LSLA 5IM0B 4EWTA 4ZHRB 1WC1A 2IAJB 3VZHA 3DRYA 4GVBB 4YHHF 5F8JA 5GAHU 2CWXA 2B56A 5L9NA 3IRWP 2GGPB 2AYBA 3TZZA 3TUIC 2YNGA 4C2MA 2RILA 2R8GA 1PJ7A 1RZMA 3MPVA 3BYPA 3I0RB 3T41A 4USJC 4WF9Q 3RAMA 4ID5A 4IQMA 4B3OA 4B9UA 2GNKA 4F26A 4IFVB 2CQ3A 1RT1B 3O8WA 2GIRA 3A13A 4H4MA 3JAMU 2R42A 3H4DA 3OSPA 3DLGA 3C16A 3AJDA 5LJ5Y 2N82B 5B0AA 3HCXA 4G1IA 5HMWA 3BPSP 1JLBB 3KOAA 2Z4PA 2PA3A 3DHWC 2QO3A 5KFTA 2M2BA 4KGMA 3ISNC 2CXEA 2N4CA 5EX0A 1UFLA 2XGQA 4JI2F 3WBZA 2VJUA 3TA0A 3PFOA 4RLEA 3HSZA 4FS1A 2DK2A 2YQ3A 4JI8F 4CT9A 3SMZA 2XULA 4EZ6A 2R4FA 4YFUA 3VAGA 2BE7D 2JHEA 2W2OP 2YQ0A 4WPAA 5FDLB 3HHLD 3E2EA 1NKBA 1MMNA 2NYIA 3FQKA 1MG7A 4P75A 1YVFA 4C9DA 2EG1A 3C14B 4KAIA 5CABA 2VICA 4P2MA 3RB3A 4B3RJ 1S9EA 3NCPA 4A4JA 1WC3A 3FGVA 1NUEA 4A8YA 3H98A 3NY0A 4FP9A 4YDDB 2DNHA 1KOOA 1ZPVA 2D9OA 4CO1A 2XO6A 2WTFA 3EWGA 4G3IA 2XMWA 1HNIB 4YHHJ 4F36A 3FEYB 2W7OA 1G6BA 3IS9B 4C8MA 2XYGB 2XHCA 1CJUA 2HIYA 5D4NA 3BM7A 4ILRA 3T5JA 3GYGA 3M6VA 3BKUA 2H5IB 4J9SA 1UTAA 1S1VB 3SDEA 3V6DA 3BGRA 4C8ZA 1WF0A 1N33F 2V94A 5HBMA 1F60B 4FNHA 2FZGB 3AXKA 4A46A 4GKKF 5KFIA 2YQ1A 1WEYA 4OZ5A 4ED0A 2Z2YB 4O3SA 1VQ7S 2ZZNA 4OJHA 3RBDA 3DM2B 2RH3A 3T5LA 1NSQA 1FJEB 3QLHB 3LP2B 4JI2J 4U96A 5HN0A 3V5RA 3GYNA 3M30B 4NA1A 3I0SA 1VIXA 2MTLA 2VG7A 2VONA 3KHGA 4DLEA 3B78A 2R7XA 4LRCA 4B17A 4JI8J 4WE1B 1ZTWA 3W3SA 1KEKA 4OI4A 1FO1A 2XHWA 1KS2A 2Q1LA 3EPGA 1IKYB 3I31A 3OHAA 4X65F 1S4EA 2KYXA 1JXVA 5HMZA 2BJ7A 2H1YA 2ZZMA 3LPYA 1LK7A 2PI4A 2J8SA 2E44A 4DPXA 1VQ5S 3ETMA 1H2UX 5HL7Q 3HFKA 2RKIB 2IRUA 3NEKA 3MOZA 3P45B 3C6UA 4OQJA 3QFWA 2RQCA 2V4RA 1DBDA 4IR9A 4TN2A 2MHNA 4ZPVR 3T9NA 5L39A 1FE0A 4CP5A 1TMJA 3R5CA 4P6QA 4J9PA 2MMYA 4LUBA 2CNNB 2HRTA 3P96A 4WBFA 2DISA 3R5JB 1I94F 4EU0A 2Z0GA 4WYLA 4ETZA 4Y00A 2ZC4A 2DHXA 1TV6B 1HW8A 2WRMA 4L76A 1YZ7A 5E3AA 1FERA 2HZCA 3IC1A 1N33J 1H2TZ 3DLEB 1O0PA 2AV5A 4Q2MA 2IRXA 2M8DB 4GKKJ 1S72S 4UOHA 3THTA 2XS7A 1VMBA 4PWWA 4ED2A 2ZWOA 4CLTA 2MGZA 4OFZA 3H59A 3ENQA 3HLUA 4TY8A 2P9GA 4USWA 2CNLB 2VOOA 1SQFA 4HT5A 1OQ3A 4J7CA 3QFHA 2ZUGA 1IWAA 1YLXA 1U8SA 2KB2A 3FSXA 3V4MA 1WF2A 4IKAA 3PW5A 2BJ9A 3I96A 4UOGA 2G0JA 2YNFB 4J9RA 2FZCB 3SV4A 1J5OA 2EFPA 1PJ6A 5B08A 3HPOA 1U8WA 1S77D 5K14B 2AP6A 1SC4B 2FJBB 3KNAA 4CTAA 1Q82T 2WW4A 3RJMB 5T7LB 3VF0B 3M8RA 5CCMA 2DYAA 4X65J 1YHQS 3D0IE 3QZ7A 3KLIA 1JKHA 1FT8A 1SV5A 1B3TA 4MIAA 1HYSB 1Q86T 2CPYA 3D3BJ 5E3PA 3KWMA 2IM0A 2PMHA 3BPDA 4JI4F 1RAEB 4Q8EA 3NWRA 4YP3A 4ZN3A 4FVCA 1NK5A 4AYBD 1KNZA 4CZCA 1NSKL 4NE9C 1LXNA 2COLA 3DRSB 4WP9A 2OSRA 4MKYA 3L4BC 4OJ1A 1TUWA 3MCOA 2H5EA 2MZTA 2VASA 3JYTB 1WUUA 1I94J 2HRUA 3TR5A 2HWTA 2DPJA 4BC9A 1FCAA 1DTTB 2YKOA 1RP5A 2CADA 1RTDB 1NK9A 5F8IA 3MCMA 1S1UB 3MM7A 3HF5A 2HS4A 2Q6CA 3NCQA 3LAMA 2QA1A 5HP1A 2FB0A 4BWMA 2OPPB 1NMEB 1E6VA 2W4DA 3ZZYA 1FRKA 1T3NA 2QL5B 4DN0A 4RUBA 4ID8A 4R25A 2LU2A 2QMXA 3BKTA 1GXTA 1DRZA 2DGSA 1VHFA 4RNNA 3CB4A 2DR8A 2DCLA 2WAQD 1UFKA 3P8BB 2ZJRQ 3CCMS 2LXUA 1Y5LB 5KOXA 4I0WA 2ZC3A 2YKNA 1H3DA 5CHCB 4I2PA 3QT8A 4O4GB 3NS5A 1HNWJ 3CVKA 4JV1A 4Q43A 1NZAA 2C3MA 4Q5VA 4C98A 4F4ZA 2LDIA 4O0NA 3K5MA 1VQ9S 1I6JA 5KFUA 3DU6A 1IKXA 2BACA 2NZCA 3TVYA 1T9UA 4JI4J 1LFPA 1OY8A 4DV5F 1UJ5A 3JSRA 2IY5B 3A12A 4ELVA 3VGSA 1IKVB 1Z4UA 1L3TA 4I2QB 2WVDA 3GFYA 2IIHA 3G6YA 2C3OA 3K5PA 5CQGA 1I5OB 4OHYA 2IC3A 2JH3A 3G71S 1TL5A 2HPUA 1J27A 4JI1F 3CJRA 2BE2B 2OFGX 3W5XA 1KKHA 4FKYA 3MCNA 3OXLA 2ZBCA 1B64A 3ZTPA 4DUYF 2HK3A 1L3KA 3P5TL 3K59A 2B9YA 1IM4A 2V8PA 3FRYA 4DWIA 1LXJA 4DSIA 2B8QA 1OJ4A 1H72C 2CNKB 2DNPA 3KLEA 4ZS6A 2BE9B 5D4OA 4GKJF 2J6SA 1Q7LB 4WZQA 2MZJA 2HHWA 4CDIA 2BJ3A 4DBQA 2FHMA 2J76E 1Z2LA 1MU2B 4KHPF 1H2VZ 1EP4A 2HK2A 2F63A 3R3TA 1UW9A 3CJ5A 1B99A 3GJRB 1IJEB 5HVHA 1TQLA 3L7PA 4L75A 1NJZA 1A9NB 1OMSA 1WD6A 2V6AA 2L9DA 3MEKA 4WFYA 4KO0B 1UKUA 4USVA 1LWCB 2U2FA 5H9FJ 2M52A 3N01A 1F0XA 4IH6A 5CD4A 1GH8A 3OFFA 2OD6A 4JV5F 4YOEA 2DGXA 3DRRB 3EXYA 4OI2A 2FJVA 4DL2A 1RTIB 3TAMA 5A2QU 2IVYA 3LW5C 5B09A 4ZP8A 1HBNB 1ZETA 4PXDA 2J7UA 3CD5A 3QAUA 1UPPA 4FN5A 1HW9A 3MPWA 1G2EA 3RRKA 1D3WA 3W7BA 5EWFA 2FVCA 4DV5J 1HR0F 2J9CA 1UEVA 4GMKA 1RAOA 4NMXA 1WDDA 1TUGB 3SFUA 2VG6A 1RWKB 5ADZA 1PAEX 4YN3B 1EETA 1K1QA 3EVWA 3D2WA 1BQNA 1U02A 1B7YB 3J7ZT 1LW2A 2F8EX 4M1KA 3SI8A 2OHDA 3PJ9A 3KLFB 2E7WA 3TA1A 2R8KA 2ASLA 4JI1J 1JJHA 2R2TA 2XM3A 1R27B 2BJEA 4JBCA 1T7PA 3PFEA 4IYQA 4EO8A 1DQ8A 1U1QA 4DUYJ 4KKOA 4E98A 2DNQA 3I56S 4KJIA 3MEEB 4CLLA 1RA6A 2DT9A 3LGNA 4MK7A 3LO3A 1UETA 1SKSA 1TL7A 4GKJJ 4XPCA 2OSQA 1AUSL 5KFSA 3VR1A 3QAEA 3LP1A 2ZKUA 3N0VA 3BDEA 3G86A 3OT9A 1T9YA 3MDFA 1IR1A 4DDFA 1R7IA 4KHPJ 3MMCA 2B7CB 3NGTA 2DO4A 5KFBA 3KJFB 2LKZA 1F9FA 4NI2B 2KG1A 1OPZA 5IWAJ 1BQMB 5K8PA 2ERRA 3OR1A 2OMOA 3AOAA 2K3IA 2UV8G 5H9EJ 1RU1A 1Y5NB 2QC3A 4P73A 1HWUA 3MMAA 4K0KF 2JRSA 5IFMA 2IJFA 4ECQA 3RW7A 2F8HA 2QFIA 5FJ4A 2EC2A 3HKZD 4LSLB 4TLRA 4K4UA 1HR0J 2EKYA 2GZOA 4RUHA 3HJFA 4NYOA 5K8MA 4Y28C 1FVQA 3UD4P 1DAXA 4OYOA 1YDLA 2DIUA 6FDRA 5JUMA 1NJYA 2UXBF 5CYQA 4CM0A 2CZVC 1Y3JA 5KFCA 5J2PB 3R5AA 2BJDA 4FYWB 2AJ1A 3H2VE 1W7WA 3ZZ0A 2VFVA 3Q22A 2YKMA 4LSNA 5U47A 2FDNA 3W2VB 2RQKA 1FKOB 1IWGA 4DR6F 3OFHA 2HW3A 3EM1A 1FWPA 1S6OA 3PEHA 4DSFA 4UY8T 3JTOA 3PG9A 4NLUA 2RQ4A 5L46A 3KNGA 1YJNS 3CC7S 3GCWP 4Y0FA 4UQGA 2VD3A 4QR0A 3JXOA 5KFOA 3OVBA 2BDPA 1TR0A 2ZHOA 2AEJA 4QIGA 3OL6A 1DLOA 5JMNA 1SJ1A 2HNDA 3WQPA 3PZPA 3KYLA 3M6WA 3ZTQA 4PKDB 1X5PA 3C46A 1WEXA 3BKFA 1NEEA 3PO4A 4K0KJ 3MWBA 3MM8A 4W92B 3PW7A 1RISA 2CA9A 3MZIA 2NXUA 1X31C 4J9UE 1V3ZA 2WW8A 5KFHA 1V3RA 1JLAA 1NH8A 4IOCQ 2JC0A 5LMUF 3G2XA 2QMUB 1C0TA 2OLWA 2N7CA 2UXBJ 1TKTB 4DPTA 2HBQB 2CKWA 4ZVTB 1FFWB 2FYXA 4DCJB 3AD8C 3TP2A 4WKRA 3UN2A 3A8JA 4WU2A 2J6TA 2KM8B 2ZE2B 3LWLA 2O67A 5ITHA 2KDOA 4DR6J 2OTLS 2YTCA 4XIUA 3D68A 1C1BB 2P8IA 4GO7X 4KE5A 3DXSX 1WF1A 3UDVA 2WSEC 4I1TA 3W66A 2DH9A 1S97A 2P6SA 1JXLA 3V2UC 3FVYA 1SKRA 4QJVA 4QIVA 4IR1A 4ZPCA 3AXMA 2HGNA 3LUYA 1N0VC 2ZD1A 3OV7A 4HH0A 3O5TB 2VUGA 5JJBA 4YS2A 1FTCA 3R1LA 2K3KA 1ZM2A 2GVDB 1S99A 2F8MA 1I51B 3RGIA 1T8EA 3PHEA 5M2PA 5C42A 5KT2A 2H4WB 1VC0A 3LWMA 2LA6A 2QFJA 1WHYA 3CMAS 1LK5A 4MT1A 4RW4B 1RBLA 1NLKL 4MH8A 1UWBA 4YB6A 2HNYA 4MIBA 3B8HA 2WVFA 2GIFA 4YB1P 2HMIA 1ROFA 4RU9A 1UA1A 1RLCL 3DI6A 1REVA 1HQ2A 2E1PA 1AFJA 3O44A 1RCOB 3GSDA 2HFUA 4C0OC 4QWAA 2D1CA 4LF7F 4Q8FA 3CCWA 4PRFA 1Q95G 2OUGA 5LMUJ 2R9LA 1M5OC 1MWYA 4BWJA 4LRFA 4ES3A 2NSCA 3EX7B 5F8LA 3M9NB 4OYZA 4YR2A 2G2OA 4DR7F 2HURA 2AKWB 2J0XA 4ZA1A 2GVZA 1LOUA 2EFOA 2AEMA 2CQPA 1KRPA 3I55S 3QIPB 1UVJA 3AOBA 1U1KA 5I42B 1M1HA 1VQ4S 3GU0A 4ZVPB 2C3YA 2V8DA 3BZQA 3GMGA 3U1MA 1CJVB 1JXEA 1NDLA 3UCGA 4RW6B 5E5NA 1N88A 1VC5A 4QYZK 3ISZA 1T94A 3OR2B 3HT3A 2FLPA 2F7VA 2D3UA 1VQOS 3J80Y 2CDQA 2R8HA 4IO1A 5LJ3Y 2HS3A 3HD1A 1S9GA 2YKPA 3Q8UA 4JI5F 3CEDA 4OI6A 2PN6A 5D78A 5K5MA 3CJKA 1QAJA 4C8OA 2I2YA 1NDCA 3PRVA 2ZH3A 4TQSA 2FPHX 4OZNA 1QJHA 2U1AA 3KK2B 2UZAA 3EGWB 2V8VA 2E9ZA 4AT1B 3EZUA 3NGRA 3Q86A 3CXCR 2QEXS 1SI9A 3AHPA 2B6AB 2RS2A 4EEYA 1XNQF 3O2IA 2OD4A 1N32F 2ACMA 2IVMA 4R5PB 1VS3A 4RPFA 4R8UB 2L41A 1FD2A 4BLGA 4O3QA 4LF7J 1MN9A 4WKYA 2WBRA 3I4PA 1A0OB 2B5JB 4UW2A 3H25A 4I7FA 2HVEA 2YPYA 1UVNA 3HDSA 1PBUA 1NDPA 1MW7A 3QRRA 4DR7J 4DSEA 3BBFA 3C3LA 2OAUA 5KFMA 1HQUB 4KQZA 3WX4A 3ILJA 5J1PA 1VJWA 4LSZB 1RTHB 2QA4S 3QSIA 2FJDB 2YX7A 1SQEA 1XK8A 2K1RA 4QBUA 1M5PC 3AB2B 3JSMA 2IA0A 2R7OA 2I38A 1HI0P 2LFVA 2DGWA 4P74A 3BBBA 2QIFA 3QGHA 4ALZA 3FFIB 5KFZA 3BB5A 2BKNA 3T9ZA 2N7YA 2HFNA 2QA2A 3MTJA 2ZEJA 4D3GA 3G8SA 2KRBA 2YNGB 1VRQC 2UVWA 2HVHA 2EEYA 4ZLNA 3IAM9 4NLVA 2NZ4A 3VVUA 5DGBA 3NNAA 4OI0A 3GP9A 1JNZB 1R43A 2AHOB 1RWUA 4JI5J 2FGCA 2LXIA 3A3OB 4H4MB 2DGOA 2IFXA 1W25A 3DLGB 3C16B 3H42A 3HZEA 4OLPA 1GMWD 3FBEA 3UFCX 4XPEA 1ZAVA 1F3VA 1VDHA 2VPXB 4TLQA 4CH0S 4X4QA 5G0RA 2FGOA 1QD1A 4RWWA 1UWAA 3QWPA 3O3LA 2VL1A 2RQMA 1XNQJ 5ETTA 3WDOA 3V81B 1N32J 2CQ0A 2YNHA 3MFIA 1C2PA 1R6YA 2GO8A 2E9RX 2AEFA 3HULA 1Q5YA 4F0KA 1N5SA 1Q81T 1V6HA 1RCXB 2KZZA 4WFXA 1HWIA 5CYMA 2G1DA 1XMQF 2RF2A 4DX7A 3I4HX 3RB6A 1PSDA 1SCJB 5K8NA 1VYAA 3GLJA 4ZJQA 4ZVRB 1R3NA 2Z2ZA 2WVCA 4EBCA 3JAMY 2H4YB 3FMBA 4DL4A 4QQBA 2D3O1 2QA4G 1Q8BA 2LP4A 3Q2SC 1E6YB 1FJCA 2B3TB 3ZTSA 2DNLA 3WIUA 2A2CA 3EYZA 2HHSA 3ITHA 1FRLA 4U9RA 2XEXA 1QTNB 4K59A 2A0FB 2GHPA 3P4UB 1DTQA 4B3TF 2VOPA 1C4AA 1X5SA 3WIVA 3DFEA 1G1XA 1GAOA 4A8OA 4LRBA 4CLPA 4PCQA 4EUVA 3SDEB 2BR0A 3V6DB 1MNEA 3BGRB 3ZZUA 3G4SS 5HBMB 2GMHA 2PE8A 4XTTA 2RHQB 1OPIA 1SXLA 2WOMA 1PYTA 3PR4A 2GQQA 4WJBA 4JI3F 3KDNA 1S1TA 3ZZRA 1M0SA 2EBGA 2V34A 4NA2A 4X4PA 1OQ6A 4NCAA 2ZFHA 1FRMA 3DC2A 4ICLA 2J5AA 4DL5A 3I5BA 3UI3A 2HHHF 4PQUA 5E0OA 1PC5A 2ZVSA 5I3PA 3FCWA 5KFDA 4N8OA 3UN5A 1JLFA 4NLQA 3M1VA 2VG7B 3UNGC 1MSWD 3GFHA 3AT1B 5E41A 4ZJOA 5E3QA 1IJFB 4OYPA 2UUWA 4QWBA 1TAQA 4EK2A 1SUQB 2VFRA 1XMQJ 4C7QA 4OX6A 4E2FB 4RWXA 3CCES 1K8AT 1B0PA 2QG9B 1U4BA 2LVWA 2ZH4A 3C6TA 3UCUP 1ZA1B 2J9DA 3UDLA 1Y4ZB 1RBAA 3H0PA 3A8KA 1N5YB 2RDDA 3R1HA 4ZPWR 3C6UB 1MWQA 2JNJA 2J6UA 3MM9A 2G1HA 1UVMA 3G82A 5A6PA 1J2VA 3M32A 1L3VA 1QUVA 2ILYA 1YSJA 4B9MA 1S1WA 5KFVA 4B3TJ 2LQBA 5ETRA 3M2VA 1FVSA 2VKZG 4NRTA 3ZZOA 1B0TA 2M7SA 1UZHA 3CGIA 5I3UA 4LIRA 3Q8RB 2ZBRA 2H54B 3VVTA 2HFZA 2MGZB 2CWKA 4JI3J 1FJ7A 4TY8B 4F3MA 4ANEA 4DJBA 4NCBA 1PG5B 4USTA 2FJAB 1VQYA 2CJBA 3GYXB 2R2RA 3OL9A 5IC4B 1WWHA 5ETQA 3HHDA 5IOLA 1QAXA 2KT5A 4ZDNA 5J1EA 1TELA 3TEHB 1FF2A 4CLWA 4IH5A 1S48A 1UVKA 2HHHJ 1J5OB 3KMQA 2QJ3A 2DNRA 1UA0A 1JLEA 2FHJA 3RTVA 2CAJA 2KHDA 1YQHA 1IBLF 4CTAB 2MKCA 3VHQA 1NPRA 2B43A 2GW8A 2V69A 5LT5A 3K57A 5D6GA 5A8WA 2J7WA 2MKHA 3A8EA 3DYAA 4ED7A 3D4JA 4DV0F 1ZPWX 3KLIB 1JKHB 3MURP 3NBPA 2YBVA 4UZBA 3N6MA 1ZAWA 1HLWA 1ZS6A 2DTJA 2C42A 1N48A 2QLJB 2E9TA 4PYAA 1YBTA 2BQ3A 2NXCA 4O3PA 3R6GB 1KFSA 2DNKA 3M8ZA 5KT5A 1HQEA 2LECA 3C2PA 4K4ZA 1FRIA 2WB1D 1CBKA 2JJ4D 4IO9Q 2KT3A 3TX8A 2HG4A 3NL0A 4LJMA 5EX3A 4X64J 2P9EA 3DLHA 2V4QA 2M3DA 4MYUA 3BO2A 2XYHB 2HNZA 3RRGA 4DCOB 3K5LA 3DHXA 2CDRB 1HBUA 3DRPA 5DETA 4HDHA 3DDIA 2LYVA 2PD1A 4YMEA 3QT6A 4CLUA 3BN4A 5A76A 3TO8A 1KWMA 1U1RA 3MCSA 4NA3A 1YKWA 3MAHA 4DV4F 4FBUA 4F04B 5KG6A 3JSBA 1JQGA 5KFAA 1YJWS 5HP1B 3HSJA 2AJFE 3PY8A 1GMUA 1O6XA 2XGPA 2JVRA 1E6VB 1RT7A 2W25A 3V4IB 5IQQA 1M5VC 3G8QA 4DS4A 3BYRA 2ZHBA 4C8LA 4BDPA 2XTJP 1QE1A 1NJWA 1S6PA 4B02A 4ZP9A 4OHZA 3GIIA 2VKRA 4UY85 3JQJA 4RW8A 1K1SA 4FF1A 1IBLJ 2KM8C 5I3QA 2YKNB 1ULRA 3MEGB 1QTMA 3MUTP 4DF4A 4ZVUB 3CE8A 4URQU 2F9JA 2YNIA 2DD8S 2BOAA 4DV0J 1FX2A 2IM3A 1SQGA 3EVOA 5IT4A 3N5BA 2LQ5A 4IUFA 2HQFA 1N5QA 1IR0A 4DU7A 3TJ8A 3R7BB 5DZ7A 1RAJA 1NZ8A 4NMLA 2C3UA 2BQUA 2LEBA 4A8MP 4ED6A 2MQ8A 3R9LA 4NX9A 1U2FA 1R6VA 2IC3B 4J91A 1D9AA 1D9DA 5M2RA 2IYGA 2XC9A 2MDAA 2BM0A 2V2ZA 4OYIA 2W9BA 4NLRA 5AXMA 3AH6A 4NZ0A 5LSOA 4ZVEA 1TAUA 4DV4J 2CRLA 3M9MB 3QGPA 2XI3A 4RUCA 1FX4A 1TL1A 4LQ3A 1Q8IA 2FJEB 1TL3A 4NL5A 4M63A 4X4OA 2V5HG 4ELUA 5C24A 1U0HB 1EP4B 3SQGB 2OH2A 1HHQA 1T9WA 3G8TA 1WKJA 4M5DB 2Z2MA 3THVA 3CD6S 1RT6B 4ECRA 2HVDA 3KJQB 1TVRA 3M2UA 1F6TA 3NOGA 3KJVA 5HVGA 2EFGA 5HLFA 2OPQB 2VV5A 3DMJA 1ZM9A 3ONQA 2BANB 1FHTA 1KFDA 4ZHRA 3CMES 2N3LA 3EXCX 3CJ0A 3RG6A 3TAMB 5KFLA 3IMQJ 4NLYA 4QPXA 1PILA 3F41A 2FVRA 1XR5A 2F1FA 1WC6A 4K4WA 2EW9A 4USUA 1RWWB 2VG6B 1HBOA 1AROP 4GVLA 2AU0A 3I0RA 2Y1LB 2CYYA 1DQAA 4H4KA 3VTIA 1BE4A 3T1YF 1LW2B 2WHOA 4IFVA 2RDJA 4ECXA 2HQIA 2W2QP 3DLKB 3T5KA 2HHVA 1RI7A 3OHBA 1HFEL 2XWYA 3KJNB 2CQ4A 1F2HA 5C5JA 4KPYA 3HHLC 1JLBA 3D6FB 4KKOB 1C0UA 2AJ0A 2MZ1A 5AXNA 4ECYA 1EQMA 1Y10A 4OYMA 2CJQA 1TL7B 2RU3A 5FLXU 2QLFB 4P2SA 5A2QY 1RHJB 2PMWA 3LP1B 3CDUA 2CQDA 4URSA 4EFAC 2KU7A 2VZ9A 2BEFA 1JLQB 1N4LA 3MMCB 5KFKA 1R0AB 1D09B 4DFMA 4OZ1A 3B6BA 1NK8A 1P1LA 1RU2A 4FVMA 5DLFA 1ZYQA 2E5GA 2EFQA 2JEFA 4OMFG 2R7WA 2VPYB 1R0BG 3NLCA 4LQ9A 3QGGA 3DKDA 3T1AA 3KTQA 3OR1B 3AQOA 4NPOA 4A8XA 5K9FA 5CYJA 5J2QA 4NLPA 3MMAB 4LREA 2WONA 1FRJA 2MLYA 1MMLA 5AJ3F 3GIKA 3DOLA 3J7AN 3GR1A 3Q23A 1S57A 2G2YA 1EAYC 2G13A 4MFBA 1VQLS 4F4YA 1FNMA 1TKZB 4FF4A 5HK4A 4HHHA 4CYUA 3D3CJ 1LWEB 3O6QA 1RACB 3T1YJ 3Q24A 1R0CB 4JUZA 2HZAA 1WOOA 1R8BA 4CLFA 2W9CA 3PIPQ 4BBYA 3H5XA 4DV1F 3N6LA 5E7OB 4LSNB 1VQMS 1EKRA 1RWXB 4MTPA 3BH7B 2RVJA 4UOFA 4OJGA 2V68A 3AFGA 2MQQA 3KMSA 2W8KA 2DGUA 2XG8A 2ZKTA 3M8PA 3M30A 3S7RA 1RABB 3W5ZA 2OI2A 4KIAA 1RWMB 1Q1KA 3ETOA 1S0VA 4ZPDA 1KQGB 3BDPA 4WE1A 4DSKA 4DI6A 3VAFA 3DGVA 2HBZB 2JLFA 1IKYA 1NK6A 5HSPA 4NLWA 2XCPA 1URNA 1KR4A 3A4TA 1RK8A 1RXOB 5MLCV 3BGFA 1LQ9A 1HL6A 3S8SA 1S6QA 3HSDA 1T03A 5DG9A 2A3JA 4H54A 3MECB 2ZOFA 1TK5A 2ZBPA 2HNDB 4UOCA 2XS2A 1RWNB 3CD7A 3TYTA 4ED3A 4F7VA 2B4OA 2R7QA 3MM6A 3M6UA 4LRAA 2AMCB 1ZAXA 2HWIA 3W2WB 1Q4RA 2CPFA 2V67A 1YG0A 5AJ3J 2XZWA 3GR0A 1CJKA 5SUHA 1HMVB 3LP0A 1PBAA 3ENVA 1HHSA 3HHLA 4X66F 1NH7A 4K5RA 2UVUA 4CH1A 4RBTA 4DQSA 1JLAB 5D0EA 5EN1A 2AJ2A 1OO0B 4ERDA 1C0TB 1U24A 2BQRA 3GG1A 3QSYB 2EG2A 3FEZA 1M1KT 2PI5A 3VAIA 2J8AA 1SJFA 3DLEA 3HZGA 1HNVA 3LH2S 4EYHB 4DV1J 1RADB 3N6NA 3BGOP 1HWJA 1CQMA 1K0TA 1U09A 3UVJA 3MPDA 2K2PA 4PUOA 3B4MA 2AX0A 1XC9A 4MIWA 2NPIA 1SL1A 1J5EF 4AQYF 4DR1J 5KFNA 5K14A 4N56A 2OTJS 2OPSB 4CLKA 2EFNA 2H9ZA 1WI8A 2ZD1B 2HQGA 5T41A 4C6AA 3ADAC 2ZDOA 1WOSA 3MR7A 3IWXA 1KVJA 2A6MA 4ED5A 4HT7A 2BYCA 4J9QA 3BR9A 5AE3A 1HYSA 1FEHA 3SFGA 3OXGA 4KGXB 2W01A 3QYYA 3BGUA 4WZMA 3TQ1A 2OKQA 4OI1A 3MPYA 4O4RA 2B51A 1UWBB 2HNYB 1MROA 4NZ6A 5D4PA 2HMIB 1NHVA 4K4SA 1S1XB 2B8PA 4LF2A 1REVB 1QSYA 3UCZP 3PVXA 3PCOB 1PAUB 4X66J 4RW7A 3KK3B 4OYXA 1ZTTA 4ZN1A 2GHVC 4NWBA 2HHXA 3MEDA 3K89A 2NCKL 4ZP6A 1X9SA 1DTTA 4KV8B 2MLXA 3BSOA 2HLUA 1Q0NA 1EZZB 3KHLA 3K58A 5D8HB 1RTDA 1S1UA 2VBXA 2XMTA 2RT3A 4O3OA 4B3MF 4F3QA 2GVZB 2N3OA 1YJ7A 2GAGC 3KG1A 4UF4A 1VCTA 1H7WA 4WXWA 1U6BA 4DX6A 2A2DA 5HJYA 2MEWA 2EK6A 1U6FA 1RB0A 1Q78A 2O1PA 3OL7A 3UNYA 2F3JA 3G6VA 3GIJA 2CVIA 4UZCA 1J5EJ 3SIPB 4AQYJ 3CJ2A 4W98A 1UEKA 1RSCA 1YIJS 3MAAA 3GV8B 2RS8A 3SCJE 5EWGA 3CTRA 2HBRB 4X4SA 1VRUA 4O4GA 1UJ6A 3RYLA 4ENOA 1KVIA 5HQLA 3CJKB 4PG7A 3WX8A 4C3LA 3O1LA 1JMTA 1GXLA 3C19A 3QO9B 4Y2MA 5IV4A 1JNRB 2CQIA 4LBIA 4IDKB 2MKKA 4PYDA 1AA1B 3ILLA 3Q8YA 2EBEA 4OHWA 3L7UA 2DRDA 4OYAA 1Y3KA 1IKVA 1YBAA 4I2QA 2LQJA 3K17A 3D54A 1JLGB 4OI3A 3S6EA 2YXLA 3W8PA 2HYIB 2ZWPA 4QWDA 3T6BA 8AT1B 2XCAA 3OFEA 3DGPA 3SCIE 2QRRA 1TFWA 2DHHA 1RUSA 9RUBA 2EVZA 4DEZA 4ED4A 3B82A 1WKKA 2GJFA 4B3MJ 4ECZA 5DQIA 4USKA 3QZ8A 4AXJA 2CIMA 4I6AA 4FS2A 1FTRA 1FNOA 1N56A 2K1RB 3JSMB 4IRCA 1MU2A 4J9NA 1D8ZA 2NXEA 2NYHA 2M5YA 4KTQA 1ZA2B 4KGKA 1WHWA 3C66A 1S76D 2Q3PA 3PR5B 4RW9A 4KO0A 2ZHAA 1BUXA 1RBOB 2WK4A 4CH7A 2FTRA 4A8KA 1LEOA 2Y8WA 2AT1B 2ADBA 1JJ2R 5ETOA 1K0VA 1NKEA 5HO4A 3TX0A 5F3ZA 3V6JA 5HQMA 1RTIA 5KT4A 5I4MA 3BF4A 5L38A 4F50A 1C1CB 2DBBA 1HBNA 3DOKB 1QAIA 4ZVFA 3MUVP 3TOQA 5GADI 3KLGA 2J7KA 1W26A 2UV8A 1VFJA 5DM7Q 2DHAA 5IC6B 2DGQA 5G0RB 1WNEA 3M8QA 3DLJA 2HHUA 1XMBA 2CNOB 4GC6A 2C1EB 2YNHB 1S0MA 2OFHX 1T05B 5CAAA 1NB7A 4U7CA 4EO6A 1LNQA 3ZZPA 4A8SA 3NMAA 2BVZA 4C48A 1X4AA 1YX2A 4ZK7M 2QL7B 1CC8A 5CYMB 3VALA 1HARA 1IKWA 5LOQA 2VODA 2YH1A 1JK9B 1ITPA 4YY3F 4CRJA 4LBHA 3AQPA 2CQHA 3KK1A 1HPZB 2NLWA 2BJ1A 2JSXA 5F0WA 4DG1A 1HNWF 2WCXA 5KT7A 2FUG9 5LXYA 4I67A 3IM9A 1UP1A 1V3SA 2IBKA 3PYFA 4HYKA 1RT5B 3Q8SB 5F9NA 1NKCA 4TU8A 1QAYA 5GAGI 3CJ8A 4MKVA 3PYDA 4B9NA 5CZVA 5K20B 2ASDA 1N34F 2R3VA 1VRTA 5DDRC 5KG5A 3HVTA 3I82A 3OJSA 4JV2A 1BQMA 4DFPA 3IR7B 3EDQB 4O44A 5BYSA 3FBFA 3KXDA 1FNXH 1REGX 2Y9HA 2ZH9A 3MI7X 4CQ1A 2MQLA 3U1NA 3FCHA 3BJYA 2RRBA 3AJ2A 1MLAA 2KFYA 5JVHQ 4PXBA 2GQCA 3ENAA 4ZP7A 4Z7CA 1APSA 4DQPA 2WOMB 4IG3A 2CPHA 4LSLA 3H8YA 3FZBA 4F3OA 5GMEA 4G1PA 3QPIA 3DU5A 4EYIB 1AXQA 2DR9A 4ICLB 1WTFA 3W9IA 1RWPB 2X3DA 1U0SA 2DKOB 2GA7A 5AXLA 3IWLA 4CT8A 4P2FA 4PQUB 3M1VB 1A7GE 1WKLA 1RYRA 2AGOA 2RB7A 3VQSA 2DB1A 2XBPA 3TRGA 3TA2A 4P2XA 3LTOA 2J0QD 1KHVA 2NREA 4DL6A 4NOHA 1IXKA 2LLZA 2DCUB 4PXCA 4YY3J 4F25A 4ECVA 2KL8A 2KVQE 1HD1A 2YPZA 3LPEA 3PW2A 2OEKA 1T02A 5KFXA 1CG2A 3OSNA 3U27A 4M5GA 4P7TA 2ILZA 4OIXA 2HLTA 4BS2A 3D67A 4ZCIA 1KLMA 2GJ2A 5B0DA 2VU5A 3R8YA 1TKXB 2EI5A 4FBTA 3N4WA 3G82B 5DQHA 2MY7A 3OLBA 5F8MA 3BGLA 1N34J 5L1IA 3PV8A 2DXFA 1XERA 2RRNA 5A0YA 1WELA 1YI2S 5GADU 4W4MA 2CJYB 2NSBA 3HT0A 3AODA 2C3PA 2EKNA 2NUUG 1VR6A 5AE1A 5I3UB 4PAAA 2C22A 3FMWA 1SPBP 3MPUB 2ZDPA 2PMZD 4NLGA 1YJUA 2F65A 1YWXA 4LIWA 3JQMA 2I6WA 5C25A 4KY3A 3VQTA 2BRKA 5J1EB 2MB0B 1FESA 2YKAA 1TKTA 3PDNA 1YITS 1H98A 2FHKA 1N5VA 1JLEB 2MZSA 1NSAA 4RO0A 3L3CA 5AXKA 2ZE2A 2DGVA 3MMBA 4ILLA 1F5AA 2V2QA 5A8WB 1HBMB 3DYAB 4BC7A 1U2CA 4ES2A 1IBKF 1DHMA 3ZNUA 1IQZA 5IWAF 3P3DA 3W60A 1GEHA 2IMWP 1UJ4A 4WYWA 4MKBA 2B4PA 2JOQA 3H4BA 3BBCA 5CZXA 5GAGU 1Z1ZA 4CNZA 1K44A 5HATA 1GMVA 1HQEB 2V8GA 2XS5A 2MKJA 4PG5A 1S49A 2FC8A 1X7VA 3T19A 2KXFA 2QLWA 3NS7B 5KFFA 3CO9A 4ILMA 2IMOA 2GVDA 5FD1A 3BQ2A 2XYPB 4DUTA 2XMAA 5B7WA 2CVEA 4FKXA 2YWFA 4NLDA 3I9V9 1OYDA 2HNZB 2XB2D 4HHJA 1HBUB 4I6WA 3MTKA 2R2SA 3J7A1 1S10A 3POTA 2UU9F 1KSPA 1VQ6S 2QX0A 2AYEA 3P5BP 1GT8A 4QW9A 3CC4S 3WZ0A 2UVVA 4QW8A 4FYYB 4ITSA 3OUYA 3IA0A 4TKTA 2VF3A 1ELOA 2HGMA 2KJVA 1HNXF 4A8WA 1UW4A 3LALA 4Y2AA 3PKMA 3Q8PB 4RKUC 2HAIA 2I8EA 2H3EB 2NQPA 2MY8A 1QE1B 3D5MA 2HQCA 3I32A 1L3UA 1O8BA 2KT2A 1S6PB 3MFHA 3EGVA 1RAIB 2IRYA 4PPZA 3R2DJ 1FK9A 3OVSA 3MXHP 3TZYA 3CCZA 4IRKA 3HM9A 2G4BA 1GFWB 4DZ6A 5KFJA 1W2BR 1JX4A 3GV5B 3K8VA 2XQCA 5HROA 1IBKJ 4JOUA 1U1NA 7AT1B 3FZ2A 4N8NA 4KC5A 4RW6A 1CPZA 3R5GA 3K0JA 3MR3A 3W8GA 3NGSA 1NK7A 4IOAQ 1FXDA 4QYZJ 1FRHA 3IAS9 5KAKA 3HX9A 5IS2A 3CULA 4RUAA 5KTQA 4IH7A 2VG5B 3AA9A 1S7HA 4DQRA 2G0CA 1SB6A 3VAKA 4TU7A 2E7XA 1BWVA 4Q0BA 3DCAA 1GQEA 2XO7A 3IM8A 4L3NA 5HQ8A 2NXJA 3WHIA 2DGTA 3VAJA 2ZNZA 3NCRA 5B0FA 1UVLA 3KG4A 4C11A 2ZH5A 3ET6B 3KK2A 2M88A 2UU9J 2HZVA 2ZOGA 4YB5A 2CJ9A 1Q8LA 1WC4A 3DLBA 2YX1A 3AJ1A 3BEGB 4HVZA 4OJ3A 1XR6A 2WSCC 2DVIA 3NGUA 1N52B 1TL1B 2W8LA 3ZZZA 1KD1T 1BHNA 1HNXJ 4ZVOB 1DFDA 4KHMA 3EE3A 5J2NA 5C24B 2BRLA 2CJKA 3H20A 5D0GA 2ZM6F 3U7JA 1WHVA 5DRKA 2KXNB 3RZAA 5DDOC 1U26A 1V5VA 2HS0A 4X84A 4NCGB 3FEXB 4AXIA 3A8IA 1LV5A 1TVRB 2B9EA 3M2UB 2K8GA 5FIIA 3KJVB 1CSJA 2D41A 1RT2A 2W7AA 1WC0A 3V6HA 5HLFB 3SQOP 3BQ0A 1SL0A 4DCPB 3GJTB 3OTBA 5L1JA 1Y7PA 3G6ES 4EBDA 4FNIA 4DZDA 2V0NA 4JP8A 2O5DA 1LW0A 2M8HA 3D9BA 2W24A 1NK0A 3W64A 3FFIA 3PIOQ 4RNOA 3N9UC 1TK0A 1WG4A 2XLKA 1HBOB 3OXFA 1R89A 4CIOA 2MSTA 3QWUA 4DPUA 3CDEA 4RBVA 1TUVA 2NR0A 5DGAA 1LWFB 1ZZFA 1YZ6A 2Y3YA 1MWZA 3R7SB 1N6QB 2RIJA 4CLYA 3ZO7A 2ZJQQ 2GIQA 2EWHA 4OX7A 2DNZA 3FJ2A 3EGNA 1SH3A 1T95A 4F0MA 2XY6A 1CQNA 5KG0A 5IZHA 2GC8A 1FWLA 2BBEA 2C2EA 2RDIA 3HKWA 4ED8A 1WSVA 4B9VA 3ZZTA 2KFNA 2Y1RI 5KFYA 4DU8A 3IP0A 1TU0B 1CS4A 1C0UB 2R2UA 2YY3A 2XMJA 1CEZA 1EHWA 3UE2A 5DLGA 1S5ZA 2CUYA 2V2KA 3V81A 4ZIVA 1M5HA 3GE9A 1U49A 1NM2A 3GQCA 3J81U 2LEAA 3PKYA 4DOZA 4QWEA 3EVMA 4C8NA 3OTEA 4FPRA 2RJZA 1P6TA 2ZH8A 2LCWA 1DURA 1BMQB 2ZM6J 3KUGA 3Q89A 1SC6A 1P8GA 1Y5IB 4WWSA 8ATCB 1FEEA 4DV6F 1UFWA 3HVRA 4AE5A 1V9OA 4ZITA 5KFWA 4ECSA 2XMUA 3CCTA 2MQNA 2L9WA 1VLYA 2MKYA 3D66A 1FE4A 2BZ2A 5J2QB 1E6YA 3IO1A 2WONB 1MMDA 3ICLA 3MF5A 3DOLB 1K47A 1OYEA 4NRUA 4ZLPA 2KN4A 2JDJA 4MFBB 1WORA 1RTJB 3MR5A 3TUPA 1JJ4A 4MJKA 4B3SF 4CYUB 1JLCA 4XAKA 5FLXY 2N4DA 1RAHB 5B0BA 4J37A 3UN3A 3Q2TC 2AJ4A 3E8OA 4HL9A 1VOMA 2DXDA 5J2MA 2UP1A 3TUJC 4IFYA 4DLGA 1X60A 2W9CB 1S79A 3A3PB 2C2DA 3TJ9A 2FIUA 3KLHB 1XEZA 2JFDA 2FLNA 1KDNA 1XR7A 1ZM3A 1RHQB 3LAKA 1QY7A 3HI9A 2P6TA 4FDFA 4ANDA 4PG8A 3OPKA 3PXGa 4Y65A 5F8HA 4O3RA 3MM5A 2IM2A 3M8PB 4WP8A 5F41A 2YWWA 2IYIA 3R27A 5EHHA 4KT0C 1SJ3P 4C0BA 1YGYA 3HK2A 1AB8A 4WFBQ 4OZLA 3A3NB 1GMWA 1NSPA 1SUQA 2V9WA 1M90T 3CC2S 4TYBA 4RBUA 2Q43A 2HSEB 2OP5A 1GX6A 4QOTA 1AZSB 2GQ2A 3D6HB 2HAFA 1WOPA 1S6QB 1T03B 4DV6J 5ETVA 3H40A 2D74B 4G1QA 3NNCA 5ETSA 2OELA 1AT1B 3QRQA 4PWDB 3KHHA 4KFBB 2KTQA 1N5YA 2CQBA 2BJ8A 4DV7F 4C3KA 2CG8A 2QE5A 4L6V3 3EJMA 2QLBB 3MM6B 1S0NA 3AD7C 3OD2A 3VCDA 5DG8A 4CI0B 2PO4A 1SC3B 1G4CA 2ZH6A 3JQKA 1XN9A 1AW0A 2C2ZB 1CJKB 4ER8A 1NJIT 2JLGA 3LP0B 5F8NA 3HHLB 3MAQA 4KH1B 3HHNB 3PW0A 2E66A 2PDAA 3OL8A 2Y8YA 4Z37A 2AYGA 4DMZA 4KB7A 2GCFA 1YJVA 2DY9A 2WB4A 2I1RA 4B3SJ 2C2MB 4L74A 4I69A 3QRPA 2Z58B 3HVWA 3IGVA 4NEYA 1HNVB 3I5AA 4ZVHA 3MGJA 3UO0A 2BUNA 1FA0A 4OYBA 5ETNA 4DS5A 4LVOP 2RNEA 4ANCA 1NO8A 3D1HA 2FLLA 3UVJB 2VA2A 2MJNA 1L5UA 3C15B 3MR6A 1EJ7L 1X0FA 4PUOB 6FD1A 5GAEI 2HWHA 5A8KA 2X7IA 5AE2A 4MMOA 3CNQP 1JWWA 1DY3A 5KG3A 4ZCKA 3CJSA 1XNRF 3MD3A 2JLEA 4N76A 2QTWA 5IQ6A 5KT6A 3R97A 3JSYA 2XNQA 4NXNF 1NHUA 4XO0A 3PYEA 1VHIA 1P1TA 2W9AA 5MAOA 2VC1A 3TARA 5A8RA 3L09A 4J9MA 2W7PA 3VZIA 2OPRA 4PABA 4I4BA 2ZH2A 1YJTA 1SBRA 4XDDA 4DV7J 4ID5B 2LA4A 2XI2A 4B3OB 2IM1A 1FWKA 3UR0A 4PPDA 1RT3A 2NS1B 1PCAA 2HGLA 3PM9A 1MROB 1SKUB 4F4XA 2BABA 2AGPA 4ZLLA 1YK9A 1KQFB 2XLIA 4O3NA 2BA9A 4USIA 4LVNP 4NXMF 4RW7B 4PG6A 4AL5A 1RWVB 3MEDB 4I68A 2VQEF 4M5NA 3CSKA 1A6LA 1Z2ZA 2KH9A 3NXZA 5KFRA 4KBIA 3SYZA 4OLOA 1EARA 1KOHA 3TAPA 4CO0A 1GX5A 3PEJA 2QL9B 2A18A 3PJWA 3BR8A 3L7OA 4WXOA 2I5JA 4U8VA 1QM9A 3T1HF 2R7SA 3CIMA 3V4IA 3T3FA 2VPZB 2KYZA 4K4VA 1EIYB 2RRAA 2RD5C 4ZIWA 2E5JA 4HACA 1X8DA 1F9HA 1JJCB 2AX1A 1QVFR 2W4PA 2CPJA 2HEKA 3ISND 1S9EB 4PG4A 1XNRJ 1RKJA 3NMRA 4DF8A 2I0XA 3MAAB 3W9JA 1H73A 2UUCF 5D4LA 3MEGA 1U25A 3FUYA 4NXNJ 3UW1A 4EZ9A 1VRUB 1OY6A 4TQRA 3KHRA 2R7VA 3GTYX 1CJUB 1WDTA 2QT7A 3BSAA 5DO2A 1XQIA 2NXNA 2X1GA 3JTPA 2Z57B 2MLZA 3ILIA 2HRYA 1R8PA 4B9LA 3FRZA 2ZOMA 4N7TA 3UDEA 3AB4B 4ZKAA 5L9XA 2M70A 4Y2IA 4WK3A 1VK8A 1FI4A 3Q83A 2ROGA 4NXMJ 2WBMA 4RU2A 2H5JB 2IJNA 5HMXA 3UR3C 4LT6A 3R5DA 4CO5A 3DGPB 3G87A 2D69A 2ASYA 2VQEJ 2E1MC 2GO9A 1FKPA 3ELHA 3M05A 1XBWA 1I3OB 3I0SB 5GAEU 3GZ7A 3X1LB 2R8JA 1U45A 3D0HE 2CJXB 2XLJA 2B9WA 4HTIA 5IV3A 2CQGA 1CVJA 1Q16B 2KJWA 4RR5A 1OIAA 2KKHA 3GFZA 3T1HJ 4C8YA 2DEJA 3JS9A 3WC0A 1HA1A 5DS7A 2BXJA 2D3ZA 4O23A 1U0HA 4DV2F 2PEBA 2VB6A 4QIFA 3MOJB 4B08A 4OV6A 3OW2R 3SQGA 4OZJA 3IWNC 3PNIA 3RAQA 4M5DA 4OX9F 2DIVA 1CULA 2UUAF 3DDNA 4RW9B 4CLSA 1RT6A 3C8YA 1MN7A 3H90A 3ULHA 2OJ3A 1ICEB 2PFDA 2RUGA 4A8QA 4WU3A 2E5HA 2UUCJ 3LGHA 4MYTA 2OPQA 2MHEA 4C3MA 4X64F 2BANA 2FJWA 2UXCF 3AA8A 3TZWA 4V19J 3EUNA 2QGFB 1NNDA 4XK8C 1SVDA 4FF2A 3RUBL 4ECWA 4M94A 5E2QA 3THPA 3PRBA 3IG1A 2R7UA 3KLGB 2VDHA 2QMWA 1TTHB 2AW0A 3L9ZA 2LQ8A 4DUZF 1JIHA 3DXBA 2VBYA 3M8QB 4DPWA 4DN9A 2HHQA 3JB9k 4U8YA 2QYGA 3DLKA 3IBCB 3QT5A 1DARA 3JTNA 3AY0A 3SSQA 2AIRB 1HKAA 2V9KA 2V8HA 3FKBA 5D3GA 3FCVA 1KQKA 4NASA 2DR5A 3Q8QB 2ZJPQ 4DR5F 3RW6A 3U02A 1IKWB 1WSRA 3LQVA 2FVSA 3UWTA 4PQAA 4OHXA 3KKFA 2GJIA 4J9VA 4E8UA 1KN6A 3GJQB 5EUHA 2QLXA 3KK1B 4M5MA 1URRA 2G2ZA 4HHUA 4EMDA 4M5JA 3CUNA 4DG1B 4LF6F 1U7LA 1VBZA 1FD8A 1RAFB 5B0EA 1JLQA 1SV5B 4DV2J 4WIIA 1R0AA 4L3KA 1M5KC 2RMLA 2IDEA 5LL6d 1WG1A 4JI6F 4OX9J 1SH0A 4YR3A 2G0IA 2V4JA 4J9LA 2UUAJ 1BC6A 4G6VB 4P72A 2FVQA 1TKDA 3IGNA 1VRTB 3HVTB 3NWGA 5D15A 3SSSA 3M8WA 3NG8A 1RGVA 3VV2B 4JV5J 4O44B 1H0HB 4WP3A 3P49B 1F1BB 2UXCJ 2CFXA 3EICA 3OLAA 4HI2A 3KLVA 4KYZA 1BGXT 4U6PA 4K4YA 1HI8A 1YBUA 1TFYA 4IG3B 4JI0F
chains in the Genus database with same CATH topology
3R7SB 1ICEB 4ZVOB 1RWWB 1RWXB 3GJQB 4ZVUB 3D6MB 4JB8B 2XYGB 2C2MB 2XYHB 2Y1LB 5IC4B 2QL7B 3R6LB 4DCOB 1RWOB 2CDRB 2H5JB 2CNKB 2CNLB 2HBYB 2H5IB 1RWKB 3KJFB 2H51B 3GJSB 3KJNB 1RWMB 1PYOB 1I3OB 2H65B 2P2CB 1RWPB 3P45B 3R7BB 4ZVSB 2DKOB 3SIPB 4ZVPB 4ZVQB 3D6HB 3D6FB 1I51B 2CJXB 1SC4B 2HBZB 4DCPB 3GJTB 3KJQB 4ZVRB 2CJYB 2Y0BB 2H4WB 3GJRB 3RJMB 2H4YB 2HBQB 1SC1B 2FQQB 1RWVB 4ZVTB 1RHUB 3R7NB 4DCJB 5IC6B 2QLBB 1IBCB 1NMEB 1RHKB 2HBRB 3IBCB 5K20B 2CNNB 1RHMB 1BMQB 3EDRB 2C2KB 1RHRB 1F9EB 2QLFB 1RE1B 1PAUB 2QLJB 2QL5B 3R5JB 1RHJB 1SC3B 3NS7B 1QDUB 1RHQB 3R6GB 2H48B 2CNOB 1RWNB 1GFWB 2XYPB 2H54B 2QL9B 2C2ZB 2XZDB 3EDQB 3QNWB 2C1EB 3IBFB 2C2OB 1QTNB 4LSZB 2XZTB 3P4UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7S B;  1ICE B;  4ZVO B;  1RWW B;  1RWX B;  3GJQ B;  4ZVU B;  3D6M B;  4JB8 B;  2XYG B;  2C2M B;  2XYH B;  2Y1L B;  5IC4 B;  2QL7 B;  3R6L B;  4DCO B;  1RWO B;  2CDR B;  2H5J B;  2CNK B;  2CNL B;  2HBY B;  2H5I B;  1RWK B;  3KJF B;  2H51 B;  3GJS B;  3KJN B;  1RWM B;  1PYO B;  1I3O B;  2H65 B;  2P2C B;  1RWP B;  3P45 B;  3R7B B;  4ZVS B;  2DKO B;  3SIP B;  4ZVP B;  4ZVQ B;  3D6H B;  3D6F B;  1I51 B;  2CJX B;  1SC4 B;  2HBZ B;  4DCP B;  3GJT B;  3KJQ B;  4ZVR B;  2CJY B;  2Y0B B;  2H4W B;  3GJR B;  3RJM B;  2H4Y B;  2HBQ B;  1SC1 B;  2FQQ B;  1RWV B;  4ZVT B;  1RHU B;  3R7N B;  4DCJ B;  5IC6 B;  2QLB B;  1IBC B;  1NME B;  1RHK B;  2HBR B;  3IBC B;  5K20 B;  2CNN B;  1RHM B;  1BMQ B;  3EDR B;  2C2K B;  1RHR B;  1F9E B;  2QLF B;  1RE1 B;  1PAU B;  2QLJ B;  2QL5 B;  3R5J B;  1RHJ B;  1SC3 B;  3NS7 B;  1QDU B;  1RHQ B;  3R6G B;  2H48 B;  2CNO B;  1RWN B;  1GFW B;  2XYP B;  2H54 B;  2QL9 B;  2C2Z B;  2XZD B;  3EDQ B;  3QNW B;  2C1E B;  3IBF B;  2C2O B;  1QTN B;  4LSZ B;  2XZT B;  3P4U B; 
#chains in the Genus database with same CATH topology
 3ZXW A;  3OBI A;  1B70 B;  4KH0 B;  4TU9 A;  2ZBI A;  3CCL S;  2EFV A;  2X1F A;  3NAH A;  1TKZ A;  2ZVI A;  2CZ4 A;  3MM7 B;  2F4F A;  2CQ1 A;  1LWE A;  4DUZ J;  4UQT A;  4H4K C;  1RWO B;  3NOC A;  3TAQ A;  3IXQ A;  1ACM B;  2QYC A;  2KRR A;  2XNR A;  4ZPB A;  4ATN A;  3AD9 C;  4G65 A;  3EZ5 A;  3I87 A;  4WFZ A;  1YJ9 S;  1IM6 A;  2AYM A;  4HI1 A;  5LSR A;  3E01 A;  2J9D E;  1U1O A;  1FDB A;  4RX6 A;  3M9O B;  3ILO A;  1T0T V;  4DR5 J;  1NU4 A;  3F56 A;  1RT4 A;  4RL1 A;  1UZD A;  3HHE A;  4I2P B;  4M5I A;  2ZUA A;  4LF6 J;  2JZ5 A;  2W1B A;  3H2L A;  3DOM A;  1KLM B;  2HHT A;  2XZT B;  1S6U A;  3IRX A;  1VQK S;  3RR7 A;  5HMY A;  1IKX B;  4TNO A;  1CJT A;  3LAN A;  3M2R A;  2VFS A;  1XWL A;  2QN6 B;  4DV3 F;  1H38 A;  2V2V A;  2XY7 A;  1X4E A;  4JI6 J;  3MEC A;  1BXN A;  1YRT A;  5IT9 U;  2M0G B;  3HVA A;  4M5K A;  5HVF A;  4WFA Q;  5A0Y B;  2HVI A;  1FFS B;  2HFO A;  4Z2X A;  5EWE A;  2NUH A;  1OWX A;  3W2W A;  4PR6 A;  4MKA A;  5DDQ C;  4ZVS B;  3CT9 A;  2MQP A;  4JI0 J;  1HMV A;  3Q0A A;  5BXI A;  2IDL A;  1NDK A;  1X4D A;  2M9K A;  1Q7Y T;  4HH1 A;  1IR2 A;  1SH2 A;  3E51 A;  5THW A;  3TVK A;  1RHK B;  4K7Q A;  5C25 B;  2DPI A;  3FBB A;  3N28 A;  3T5H A;  3KLE B;  4DPY A;  4F4W A;  2VDI A;  3HO1 A;  5B0G A;  2GFF A;  3A1Y G;  4ECT A;  1NPK A;  2A1B A;  2JEJ A;  2FLO A;  1W2I A;  4IG0 A;  1QSL A;  1IUJ A;  4N41 A;  1NBE B;  3GCX P;  4J9O A;  3BV8 A;  2XSJ A;  5D0H A;  4GC7 A;  3MMB B;  4C0H A;  4U7U K;  1U6Z A;  4R0E A;  2L9N A;  2WVE A;  1Q5V A;  3SEO A;  1X5O A;  1VQP S;  4RZR A;  2DNO A;  5H9F K;  1FXR A;  2BKP A;  1JB0 C;  3DNC A;  1K9M T;  5F9L A;  1X0P A;  4H4O A;  3CCJ S;  1S4F A;  4AL7 A;  2CZ9 A;  2JC1 A;  2AD9 A;  3M7V A;  4WTY A;  2OPS A;  3MD1 A;  3U1L A;  5IM0 A;  2X51 A;  4I56 A;  4X4V A;  2WSF C;  4USH A;  2IAJ A;  4YDX A;  1VGY A;  4GVB A;  2Q6B A;  2CJA A;  4DV3 J;  2E5I A;  2DJW A;  2GGP A;  4FYV B;  3D7S B;  2LEP A;  1ZBT A;  2DR6 A;  4N47 A;  3OVA A;  4X4U A;  3UDC A;  1EET B;  4D3H A;  5CH7 B;  5E3C A;  3N5F A;  1BQN B;  4F8R A;  3R2C J;  3POT B;  3IBF B;  3LA0 A;  1Y9O A;  4M5H A;  1RT1 A;  4Q7A A;  1Q8K A;  2PSZ A;  1O5J A;  3RBZ A;  3J7Y I;  2D7S A;  1U2R A;  4RNH A;  2XY5 A;  4QCL A;  4F2R A;  3OUY B;  1S1X A;  4E0D A;  2ZBQ A;  1F5B A;  4NEZ A;  5DZ6 A;  3FSI A;  2KG0 A;  4OZ3 A;  1T9X A;  4X62 F;  3KK3 A;  4HDG A;  4YUD A;  4JI7 F;  4JYA F;  4KV8 A;  3ENW A;  1PYO B;  5BJR A;  5KT3 A;  2B9X A;  4I6Y A;  4FXD A;  1UVI A;  3G96 A;  2VFT A;  2GHW A;  1FK9 B;  5BR8 F;  3ZNJ 1;  3NS6 A;  1WEZ A;  2AWZ A;  2GV1 A;  3HSG A;  1V5I B;  4BHQ A;  2B0G A;  2RE1 A;  5FDL A;  2C2K B;  1RE1 B;  2UXD F;  1YTY A;  4DXL A;  5HRO B;  5CXT A;  1QSS A;  2OML A;  3SBM A;  2Z30 B;  3C14 A;  1FXL A;  1WAC A;  1FDA A;  4RJV A;  2XSF A;  3AAW B;  3GIR A;  3BO3 A;  3UPF A;  3TNV A;  1AFI A;  2LMI A;  2GAH C;  1X9W A;  2P5V A;  2RAQ A;  5H9E K;  2PT0 A;  4YQW A;  2HFV A;  5ETL A;  3QGI A;  4FYD A;  2DNM A;  1F5C A;  2VC0 A;  1HNI A;  1FJG F;  1CC7 A;  4W90 B;  1N36 F;  1GNK A;  2XWX A;  3IS9 A;  1UCN A;  1D8Y A;  5KFP A;  3GSI A;  1WHX A;  4Q0B B;  3S1T A;  2YWG A;  1BY9 A;  3QO9 A;  2QSW A;  5D77 A;  4QIE A;  3KG0 A;  4IDK A;  4LMZ A;  1S1V A;  4C11 B;  1HD0 A;  5CYQ B;  3BRE A;  2A10 A;  4O0I A;  4CWB A;  4HR2 A;  3EPI A;  4OZ2 A;  3HP6 A;  3F0N A;  3KUE A;  4B9S A;  1T3O A;  5C7P A;  3CCU S;  4UUX A;  2ABY A;  5KG7 A;  2AGQ A;  1RTZ A;  1JLG A;  2CQC A;  1XTZ A;  1P9Q C;  2YKM B;  2OEM A;  3NGK A;  1VI7 A;  4JV0 A;  3DDK A;  4ZLJ A;  3FDS A;  4X62 J;  1BWE A;  2H48 B;  3PRD A;  2HHP A;  1D0E A;  3DM2 A;  5KG1 A;  4JI7 J;  5J2N B;  3CDW A;  4JYA J;  2YH0 A;  2C2O B;  2VJV A;  1T11 A;  4LF4 F;  3QLH A;  4DX8 H;  3LP2 A;  4DR1 F;  2BX6 A;  3FC9 A;  1F3F A;  2PII A;  4DX5 A;  3NKY A;  1YJR A;  4K50 A;  2VA3 A;  2QZ8 A;  5BR8 J;  1U1L A;  4MAK A;  2DO0 A;  1RT2 B;  2E1C A;  2RUS A;  2YWH A;  2ZZT A;  3CCQ S;  4LF5 F;  4YB7 A;  1RAG B;  1G3O A;  3GJS B;  3B4D A;  3HJV A;  2VBZ A;  2UXD J;  1LW0 B;  1DLO B;  2HIQ A;  5G4D A;  3IN5 A;  2VQF F;  4DL3 A;  2LXF A;  2RKI A;  5KG4 A;  3B54 A;  1SC1 B;  4ZMM A;  2FY8 A;  4KR0 B;  4PZV A;  1D1U A;  3R7N B;  2SXL A;  1U47 A;  2AJQ A;  2Q79 A;  4HKQ A;  4F0H A;  2PFF B;  5CD4 H;  1FJG J;  1SIZ A;  3GIM A;  3MM8 B;  3DRX A;  3NGD A;  1N36 J;  3QMQ A;  4RNF A;  4YEA A;  4LF8 F;  4F2S A;  3CW2 C;  3V6K A;  3AOC A;  3H5U A;  2YWE A;  3FK4 A;  3PW4 A;  1C1C A;  3J7Y U;  4LFC F;  4QR2 A;  3DOK A;  1NB2 A;  2ZNY A;  4OV1 A;  4J9K A;  1GXU A;  1GK8 A;  4N5S A;  1TV6 A;  3D1O A;  3T6J A;  1IN0 A;  1VJQ A;  1UMJ A;  2O66 A;  8RUC A;  2MKS A;  2UVR A;  1HWK A;  3BQ1 A;  1CS4 B;  2JVO A;  2QSF A;  4U67 Q;  1OSC A;  5SZT A;  4F4A A;  1X4B A;  3PTW A;  4QZV B;  1HNZ F;  4P7V A;  4DL7 A;  1T05 A;  4Q45 A;  4QR1 A;  1HIY A;  3GG0 A;  4DSL A;  4GO5 X;  1PGZ A;  4V1A k;  4UT4 A;  5GVQ A;  4AL6 A;  3F44 A;  5B0C A;  5KFQ A;  4LF4 J;  2JEG A;  2Y0B B;  2CPE A;  2YNF A;  5HAO A;  5LMN F;  5CA5 A;  1PKU A;  3PHT A;  1KC8 T;  4NYZ A;  3K2Y A;  3TAN A;  5JVG Q;  1RHM B;  2DNY A;  4UUW A;  2EC0 A;  1HPZ A;  2VFU A;  4ZPA A;  5T7L A;  3OTO F;  4TY9 A;  3HHK A;  4LF5 J;  4Q44 A;  3ZC4 A;  5HI7 A;  3VWS A;  1B4S A;  5C2G A;  1VQ8 S;  3J81 j;  1RT5 A;  4P71 A;  2FD2 A;  5KOW A;  2DH7 A;  2KI2 A;  1WTB A;  2MZR A;  1IQT A;  4QU7 A;  5GMK a;  4ZCL A;  3G6X A;  3N79 A;  3CO0 P;  5C42 B;  1S9F A;  2W2P P;  2MQM A;  2VQF J;  3QT7 A;  4Q2L A;  3K5N A;  2DY1 A;  3DRS A;  4MK8 A;  1JLC B;  9ATC B;  2FJX A;  3J81 Y;  3TJA A;  4LF8 J;  4K2J A;  3DI6 B;  5J2M B;  4IFY B;  2PEH A;  2PC6 A;  3P6Y C;  1WC5 A;  5ETP A;  3JYT A;  4LFC J;  3M4X A;  5L1K A;  2XMV A;  4I64 A;  2KZM A;  2VPW B;  2IA6 A;  3SV3 A;  4CLZ A;  1TMM A;  3SCK E;  3FQL A;  5HJX A;  2V50 A;  1F9E B;  4U95 A;  2ATL A;  2ROP A;  4Y2C A;  2A6O A;  3BN7 A;  2JL9 A;  4QWC A;  2FC9 A;  3MM5 B;  2OPP A;  3TZX A;  7FD1 A;  3BS9 A;  1DZ5 A;  1HNZ J;  3SXL A;  1S59 A;  2B7B B;  4KPC A;  4ZOS A;  4KSE B;  2YX4 A;  4NLT A;  3W62 A;  3D6M B;  1S12 A;  2J0W A;  5J1N A;  5L1L A;  1H7X A;  4ES1 A;  3H7H B;  1OS5 A;  3CDA A;  5LMN J;  2O01 C;  2HQD A;  2B4U A;  3W65 A;  1N8R T;  4X4N A;  4F67 A;  4ECU A;  2R7R A;  4G1Q B;  2DHG A;  1RA7 A;  3WC2 A;  2FZK B;  1S9G B;  2POK A;  2XMK A;  3OTO J;  2IVF B;  4CCH A;  3OJU A;  1TP7 A;  5DM6 Q;  1U1P A;  1ZH5 A;  1DJ0 A;  2VHG A;  1SJ4 P;  4EGL A;  4DFK A;  4F02 A;  2O3D A;  1R8A A;  4OHV A;  1X4F A;  1TKX A;  1AYE A;  1TL4 A;  2DIT A;  2RU9 A;  5HAN A;  2DRA A;  2MJU A;  1FDN A;  5ETK A;  2IHR 1;  3CWJ A;  2J9E A;  1PIE A;  1VQN S;  1HI1 A;  4ETX A;  1BLU A;  1EKS A;  4K5S A;  3ZFV A;  3HFV A;  3TI0 A;  1ZM4 A;  1NCL A;  2MSS A;  4FZV A;  4OL8 A;  2BE2 A;  3J7Z 5;  4DR4 F;  2BMB A;  2F4V F;  5EDW A;  2W4C A;  2F40 A;  2Z2L A;  1UEU A;  3E3X A;  3GON A;  2H51 B;  1XMO F;  4I7F B;  1OSD A;  3VGV A;  5A8K B;  3SSR A;  1FRX A;  2VBW A;  4RNM A;  1PYS B;  5DG7 A;  3VGT A;  2DH8 A;  4CO2 A;  2BW2 A;  2ACY A;  1GTE A;  4IOB A;  1SIW B;  3QBC A;  1FDD A;  3Q8V A;  2E1A A;  3NP5 A;  4ZJL A;  1SJQ A;  3VAM A;  3PJX A;  1LKZ A;  2KHC A;  3OTD A;  5K8O A;  2QV6 A;  4LFB F;  2D3O R;  4PWU A;  1HBM A;  4EBE A;  4UTG A;  4A47 A;  2VIH A;  3QJL A;  2OIH A;  4PXE A;  3QID A;  5E3R A;  2DNG A;  1NHK L;  4L73 A;  3BH6 B;  1LWC A;  1YRX A;  4Y3C A;  4DL0 C;  3QNW B;  1H6K X;  5A8R B;  3RAX A;  2LQ9 A;  1VBY A;  2E7V A;  2OPR B;  2RSQ A;  3DN9 A;  2HQ3 A;  2Y1I A;  2MZQ A;  2ZH7 A;  3DRR A;  4NLS A;  2WVB A;  5BYR A;  1ZOT A;  2AZ3 A;  1RT3 B;  4CO4 A;  4ELT A;  1M5S A;  1O51 A;  1KVK A;  2HBY B;  1VBX A;  1KHW A;  3ZTO A;  3QAT A;  2JX2 A;  2MXY A;  4K2X A;  3CF5 Q;  3QJJ A;  2E5L F;  1PC4 A;  3D0G E;  5F0U A;  4KGV B;  4QIW D;  2WZ1 A;  1TZ0 A;  2KFZ A;  1GTH A;  2XMM A;  2KXH A;  3M8Y A;  4P10 A;  5E33 A;  2IPO B;  1RHU B;  2OGU A;  2DXE A;  3KLF A;  3L95 X;  1ZZN A;  2KO1 A;  1IBM F;  3CJ3 A;  4B9T A;  1NAQ A;  3HFZ B;  4DR4 J;  2F4V J;  2I5J B;  3CIZ A;  3LGM A;  2F5G A;  2RF2 B;  1XMO J;  1EB0 A;  4HAC B;  4FXW A;  2CPI A;  3F73 A;  1G7C B;  3MEE A;  3ZTR A;  3PX4 A;  2CPD A;  4DR2 F;  1C4C A;  2X1A A;  6AT1 B;  2I9S A;  3R6L B;  1LWX A;  3CJT A;  1KP6 A;  3CCV S;  3TW0 A;  2EK1 A;  2X1B A;  2FHO B;  1X4G A;  3QQC D;  4QYR A;  1B7F A;  4DSJ A;  2VH7 A;  3M6X A;  5DQG A;  4LFB J;  1M1G A;  1Q53 A;  4QPT A;  2X3G A;  4NLO A;  5AT1 B;  3ITH B;  1R8C A;  2H65 B;  1OY9 A;  2ZH1 A;  4NI2 A;  3GIL A;  4M95 A;  1X4H A;  2GS8 A;  3MHY A;  2PGC A;  2BV3 A;  2ATC B;  4BCA A;  1DTQ B;  2BKO A;  4LR9 A;  2W2N P;  2GX8 A;  3OTC A;  2APO A;  4P9S A;  2FQQ B;  3NNH A;  4CNY A;  1QLN A;  3SZ2 A;  1WJ9 A;  2FHJ D;  1IBC B;  1N54 B;  4R0J A;  4WFN Q;  4F4K A;  3CMQ A;  2FVP A;  1TK8 A;  4J5O A;  2LDY A;  3UD3 P;  4K8R A;  2RHS B;  1N0U A;  2VG5 A;  4OYW A;  3DLL Q;  2R8I A;  5A6W A;  1S1T B;  1RJJ A;  1I1G A;  1RDR A;  2AF6 A;  2E5L J;  1U48 A;  3GPA A;  3IFE A;  4Z7Y A;  3GB0 A;  5H1S V;  3CCR S;  5LXR A;  3ET6 A;  4X4T A;  3TQE A;  1FKP B;  3GV7 B;  1R8H A;  4M8L A;  1JLF B;  1HWL A;  5DJB A;  4Y2K A;  1IBM J;  5J2P A;  1SKW A;  4FXV A;  4LF1 A;  3I9Z A;  2BOP A;  3W2V A;  1FKO A;  2AZ1 A;  4CM2 A;  4ZVQ B;  2MKI A;  2B4V A;  3IR6 B;  3QJP A;  1RQ0 A;  3GFX A;  3I6P A;  4LR8 A;  3PX6 A;  3W63 A;  3BO4 A;  4OX8 A;  4HEA 9;  1B0V A;  2LU1 A;  2G9O A;  3K8W A;  1RLD A;  1VQS A;  2L3M A;  3C6T B;  4LF9 F;  2JWN A;  4DR2 J;  2BW7 A;  1CUL B;  2Y1J A;  1D9F A;  4X2B A;  4NCG A;  4J90 A;  1RHR B;  1KBR A;  2K7J A;  3KUH A;  3FBC A;  1KQS R;  1S7I A;  5KG2 A;  2MPU A;  3MM9 B;  2R7T A;  2ASJ A;  3CPW R;  3HXM A;  1EQ0 A;  4DR3 F;  1WI6 A;  2E1R A;  1T9T A;  3IR5 B;  4DQQ A;  3M32 B;  2ROE A;  1Y0H A;  2ALZ A;  3KDO A;  3I5C A;  1S1W B;  1NRK A;  3TUZ C;  4DFJ A;  1KLN A;  1P9Y A;  3R5B A;  1Y11 A;  1WG5 A;  2IJR A;  3IG1 B;  3M2V B;  3OFG A;  4IQX A;  4FYX B;  3NAI A;  4TYA A;  3CJQ A;  4WTO B;  1XJW B;  2CQ2 A;  4AD6 A;  3EGZ A;  1Q79 A;  1FFG B;  4FF3 A;  1EX8 A;  1LWF A;  2GMJ A;  1UAW A;  1N6Q A;  4LFA F;  5D0R A;  3TWZ A;  5ETM A;  3UD5 A;  1LFW A;  3TVZ A;  3UQS A;  1PJ5 A;  4S0M A;  5KFE A;  2C2N A;  5D3G B;  4AUK A;  3GWC A;  2ALY B;  2KVI A;  1R31 A;  3PO5 A;  5IXU A;  4U7U D;  5DDP C;  4C8K A;  4V19 X;  2XZD B;  3VAH A;  3BSC A;  2UUB F;  3PAC A;  3RB4 A;  2AQ4 A;  2Z56 B;  1UL3 A;  5GMD A;  1VBK A;  2HVZ A;  1RKI A;  1C1B A;  2HFS A;  2CPZ A;  3LF0 A;  1X9M A;  4QU6 A;  2D9P A;  3NBP B;  2OEJ A;  3MUM P;  4USM A;  4DQI A;  2L08 A;  4LF9 J;  4DHV A;  1Y00 A;  2ADC A;  2UUT A;  2V4J B;  2L48 A;  2Y0S D;  3W1Y C;  5RUB A;  1FKA F;  1YRU A;  5IT0 A;  3CCS S;  4Y6I A;  2Q66 A;  3PYG A;  1N5T A;  4K4T A;  2JEI A;  5GAH I;  3SCL E;  1VLO A;  4URG A;  2EPI A;  4DR3 J;  2YWK A;  1NXI A;  2PA8 D;  4LRD A;  4NZ7 A;  4LR7 A;  3VGU A;  4NLX A;  1S0O A;  3M8S A;  2M4M A;  1VC6 A;  1P27 B;  3OQ2 A;  3DRP B;  1NK4 A;  3CJ4 A;  5C2C A;  3D28 A;  1L3S A;  1BD6 A;  1KTQ A;  1RTJ A;  4RW4 A;  1RAA B;  1X4C A;  4HLB A;  4KGZ B;  5CCL A;  4XDC A;  2YVS A;  1UPM B;  3W5Y A;  3K7R A;  2IBO A;  1H74 A;  3J80 U;  2HKE A;  4LFA J;  3RR8 A;  3HD2 A;  2DR7 A;  3D1Q A;  7FDR A;  1RT7 B;  4WIQ A;  1PO6 A;  1AUD A;  4L72 B;  3RU0 A;  1K73 T;  3KLH A;  1DQ9 A;  3E01 B;  1QVG R;  3NRB A;  4EI2 A;  2CG4 A;  1HHT P;  4NYP A;  3MMJ A;  4ZCM A;  1VK3 A;  2DRB A;  4CO3 A;  4RW8 B;  1RT4 B;  4PEO A;  3H5Y A;  1NJX A;  1SJR A;  2UUB J;  3QIP A;  3FSY A;  2DHS A;  4WCE Q;  5I42 A;  2K06 A;  2YNI B;  3TEG A;  5M2U A;  1F2G A;  4GRS A;  1CJV A;  3EDR B;  3DOM B;  3RB0 A;  3IRX B;  2MQO A;  2GML A;  1QDU B;  1CJT B;  3M2R B;  2JFK A;  2W2M P;  3EZO A;  4TVA B;  3H2U B;  1AZS A;  3CD0 A;  3X3U A;  1VIS A;  4ZVG A;  3OR2 A;  3S01 A;  4OZ0 A;  4KRW A;  4TXS A;  1T9V A;  4PWD A;  1XIQ A;  2E29 A;  4KFB A;  4JB8 B;  4YR0 A;  4X4R A;  1RYS A;  1SL2 A;  4FPI A;  5F8G A;  3CDB A;  4N77 A;  2F9D A;  2C2R A;  4Y34 A;  2DNN A;  2W9B B;  4KHR A;  2BM1 A;  2MYF A;  2P2C B;  4DPO A;  1X5T A;  5L8R C;  4A48 A;  2EXU A;  4LBP A;  3KFW X;  5LM7 E;  5EGY A;  3MR2 A;  2K7K A;  2B6A A;  2DEI A;  3G9C A;  1VIO A;  2NPF A;  3HMJ G;  5KFG A;  4C97 A;  4R5P A;  2J0S D;  1TL3 B;  4M5L A;  4ZPT R;  4R8U A;  2FY1 A;  5JXS A;  4IG0 B;  3BSN A;  1KON A;  3W9H A;  3RRH A;  5BYQ A;  2OO4 A;  3PX0 A;  5F3T A;  2B5J A;  2ZIT A;  4AFF A;  2XSJ B;  1BQX A;  3D6T B;  2P9C A;  4IRD A;  3C15 A;  4P52 A;  1QUP A;  3FNN A;  1NPP A;  3RBX A;  5IT9 Y;  3US5 A;  1KTV A;  3H5S A;  4WK1 A;  2CPX A;  1CLF A;  4ED1 A;  3LOU A;  1HQU A;  4B3R F;  4C4W A;  4H4O B;  1RTH A;  3RBE A;  5T14 A;  2C28 A;  1U1M A;  2YKQ A;  4MK9 A;  3W61 A;  4K4X A;  4A8F A;  2Z8Q A;  1IVZ A;  3DMJ B;  3K5O A;  2V63 A;  3IBW A;  3EMT A;  4HTJ A;  5LSL A;  5IM0 B;  4EWT A;  4ZHR B;  1WC1 A;  2IAJ B;  3VZH A;  3DRY A;  4GVB B;  4YHH F;  5F8J A;  5GAH U;  2CWX A;  2B56 A;  5L9N A;  3IRW P;  2GGP B;  2AYB A;  3TZZ A;  3TUI C;  2YNG A;  4C2M A;  2RIL A;  2R8G A;  1PJ7 A;  1RZM A;  3MPV A;  3BYP A;  3I0R B;  3T41 A;  4USJ C;  4WF9 Q;  3RAM A;  4ID5 A;  4IQM A;  4B3O A;  4B9U A;  2GNK A;  4F26 A;  4IFV B;  2CQ3 A;  1RT1 B;  3O8W A;  2GIR A;  3A13 A;  4H4M A;  3JAM U;  2R42 A;  3H4D A;  3OSP A;  3DLG A;  3C16 A;  3AJD A;  5LJ5 Y;  2N82 B;  5B0A A;  3HCX A;  4G1I A;  5HMW A;  3BPS P;  1JLB B;  3KOA A;  2Z4P A;  2PA3 A;  3DHW C;  2QO3 A;  5KFT A;  2M2B A;  4KGM A;  3ISN C;  2CXE A;  2N4C A;  5EX0 A;  1UFL A;  2XGQ A;  4JI2 F;  3WBZ A;  2VJU A;  3TA0 A;  3PFO A;  4RLE A;  3HSZ A;  4FS1 A;  2DK2 A;  2YQ3 A;  4JI8 F;  4CT9 A;  3SMZ A;  2XUL A;  4EZ6 A;  2R4F A;  4YFU A;  3VAG A;  2BE7 D;  2JHE A;  2W2O P;  2YQ0 A;  4WPA A;  5FDL B;  3HHL D;  3E2E A;  1NKB A;  1MMN A;  2NYI A;  3FQK A;  1MG7 A;  4P75 A;  1YVF A;  4C9D A;  2EG1 A;  3C14 B;  4KAI A;  5CAB A;  2VIC A;  4P2M A;  3RB3 A;  4B3R J;  1S9E A;  3NCP A;  4A4J A;  1WC3 A;  3FGV A;  1NUE A;  4A8Y A;  3H98 A;  3NY0 A;  4FP9 A;  4YDD B;  2DNH A;  1KOO A;  1ZPV A;  2D9O A;  4CO1 A;  2XO6 A;  2WTF A;  3EWG A;  4G3I A;  2XMW A;  1HNI B;  4YHH J;  4F36 A;  3FEY B;  2W7O A;  1G6B A;  3IS9 B;  4C8M A;  2XYG B;  2XHC A;  1CJU A;  2HIY A;  5D4N A;  3BM7 A;  4ILR A;  3T5J A;  3GYG A;  3M6V A;  3BKU A;  2H5I B;  4J9S A;  1UTA A;  1S1V B;  3SDE A;  3V6D A;  3BGR A;  4C8Z A;  1WF0 A;  1N33 F;  2V94 A;  5HBM A;  1F60 B;  4FNH A;  2FZG B;  3AXK A;  4A46 A;  4GKK F;  5KFI A;  2YQ1 A;  1WEY A;  4OZ5 A;  4ED0 A;  2Z2Y B;  4O3S A;  1VQ7 S;  2ZZN A;  4OJH A;  3RBD A;  3DM2 B;  2RH3 A;  3T5L A;  1NSQ A;  1FJE B;  3QLH B;  3LP2 B;  4JI2 J;  4U96 A;  5HN0 A;  3V5R A;  3GYN A;  3M30 B;  4NA1 A;  3I0S A;  1VIX A;  2MTL A;  2VG7 A;  2VON A;  3KHG A;  4DLE A;  3B78 A;  2R7X A;  4LRC A;  4B17 A;  4JI8 J;  4WE1 B;  1ZTW A;  3W3S A;  1KEK A;  4OI4 A;  1FO1 A;  2XHW A;  1KS2 A;  2Q1L A;  3EPG A;  1IKY B;  3I31 A;  3OHA A;  4X65 F;  1S4E A;  2KYX A;  1JXV A;  5HMZ A;  2BJ7 A;  2H1Y A;  2ZZM A;  3LPY A;  1LK7 A;  2PI4 A;  2J8S A;  2E44 A;  4DPX A;  1VQ5 S;  3ETM A;  1H2U X;  5HL7 Q;  3HFK A;  2RKI B;  2IRU A;  3NEK A;  3MOZ A;  3P45 B;  3C6U A;  4OQJ A;  3QFW A;  2RQC A;  2V4R A;  1DBD A;  4IR9 A;  4TN2 A;  2MHN A;  4ZPV R;  3T9N A;  5L39 A;  1FE0 A;  4CP5 A;  1TMJ A;  3R5C A;  4P6Q A;  4J9P A;  2MMY A;  4LUB A;  2CNN B;  2HRT A;  3P96 A;  4WBF A;  2DIS A;  3R5J B;  1I94 F;  4EU0 A;  2Z0G A;  4WYL A;  4ETZ A;  4Y00 A;  2ZC4 A;  2DHX A;  1TV6 B;  1HW8 A;  2WRM A;  4L76 A;  1YZ7 A;  5E3A A;  1FER A;  2HZC A;  3IC1 A;  1N33 J;  1H2T Z;  3DLE B;  1O0P A;  2AV5 A;  4Q2M A;  2IRX A;  2M8D B;  4GKK J;  1S72 S;  4UOH A;  3THT A;  2XS7 A;  1VMB A;  4PWW A;  4ED2 A;  2ZWO A;  4CLT A;  2MGZ A;  4OFZ A;  3H59 A;  3ENQ A;  3HLU A;  4TY8 A;  2P9G A;  4USW A;  2CNL B;  2VOO A;  1SQF A;  4HT5 A;  1OQ3 A;  4J7C A;  3QFH A;  2ZUG A;  1IWA A;  1YLX A;  1U8S A;  2KB2 A;  3FSX A;  3V4M A;  1WF2 A;  4IKA A;  3PW5 A;  2BJ9 A;  3I96 A;  4UOG A;  2G0J A;  2YNF B;  4J9R A;  2FZC B;  3SV4 A;  1J5O A;  2EFP A;  1PJ6 A;  5B08 A;  3HPO A;  1U8W A;  1S77 D;  5K14 B;  2AP6 A;  1SC4 B;  2FJB B;  3KNA A;  4CTA A;  1Q82 T;  2WW4 A;  3RJM B;  5T7L B;  3VF0 B;  3M8R A;  5CCM A;  2DYA A;  4X65 J;  1YHQ S;  3D0I E;  3QZ7 A;  3KLI A;  1JKH A;  1FT8 A;  1SV5 A;  1B3T A;  4MIA A;  1HYS B;  1Q86 T;  2CPY A;  3D3B J;  5E3P A;  3KWM A;  2IM0 A;  2PMH A;  3BPD A;  4JI4 F;  1RAE B;  4Q8E A;  3NWR A;  4YP3 A;  4ZN3 A;  4FVC A;  1NK5 A;  4AYB D;  1KNZ A;  4CZC A;  1NSK L;  4NE9 C;  1LXN A;  2COL A;  3DRS B;  4WP9 A;  2OSR A;  4MKY A;  3L4B C;  4OJ1 A;  1TUW A;  3MCO A;  2H5E A;  2MZT A;  2VAS A;  3JYT B;  1WUU A;  1I94 J;  2HRU A;  3TR5 A;  2HWT A;  2DPJ A;  4BC9 A;  1FCA A;  1DTT B;  2YKO A;  1RP5 A;  2CAD A;  1RTD B;  1NK9 A;  5F8I A;  3MCM A;  1S1U B;  3MM7 A;  3HF5 A;  2HS4 A;  2Q6C A;  3NCQ A;  3LAM A;  2QA1 A;  5HP1 A;  2FB0 A;  4BWM A;  2OPP B;  1NME B;  1E6V A;  2W4D A;  3ZZY A;  1FRK A;  1T3N A;  2QL5 B;  4DN0 A;  4RUB A;  4ID8 A;  4R25 A;  2LU2 A;  2QMX A;  3BKT A;  1GXT A;  1DRZ A;  2DGS A;  1VHF A;  4RNN A;  3CB4 A;  2DR8 A;  2DCL A;  2WAQ D;  1UFK A;  3P8B B;  2ZJR Q;  3CCM S;  2LXU A;  1Y5L B;  5KOX A;  4I0W A;  2ZC3 A;  2YKN A;  1H3D A;  5CHC B;  4I2P A;  3QT8 A;  4O4G B;  3NS5 A;  1HNW J;  3CVK A;  4JV1 A;  4Q43 A;  1NZA A;  2C3M A;  4Q5V A;  4C98 A;  4F4Z A;  2LDI A;  4O0N A;  3K5M A;  1VQ9 S;  1I6J A;  5KFU A;  3DU6 A;  1IKX A;  2BAC A;  2NZC A;  3TVY A;  1T9U A;  4JI4 J;  1LFP A;  1OY8 A;  4DV5 F;  1UJ5 A;  3JSR A;  2IY5 B;  3A12 A;  4ELV A;  3VGS A;  1IKV B;  1Z4U A;  1L3T A;  4I2Q B;  2WVD A;  3GFY A;  2IIH A;  3G6Y A;  2C3O A;  3K5P A;  5CQG A;  1I5O B;  4OHY A;  2IC3 A;  2JH3 A;  3G71 S;  1TL5 A;  2HPU A;  1J27 A;  4JI1 F;  3CJR A;  2BE2 B;  2OFG X;  3W5X A;  1KKH A;  4FKY A;  3MCN A;  3OXL A;  2ZBC A;  1B64 A;  3ZTP A;  4DUY F;  2HK3 A;  1L3K A;  3P5T L;  3K59 A;  2B9Y A;  1IM4 A;  2V8P A;  3FRY A;  4DWI A;  1LXJ A;  4DSI A;  2B8Q A;  1OJ4 A;  1H72 C;  2CNK B;  2DNP A;  3KLE A;  4ZS6 A;  2BE9 B;  5D4O A;  4GKJ F;  2J6S A;  1Q7L B;  4WZQ A;  2MZJ A;  2HHW A;  4CDI A;  2BJ3 A;  4DBQ A;  2FHM A;  2J76 E;  1Z2L A;  1MU2 B;  4KHP F;  1H2V Z;  1EP4 A;  2HK2 A;  2F63 A;  3R3T A;  1UW9 A;  3CJ5 A;  1B99 A;  3GJR B;  1IJE B;  5HVH A;  1TQL A;  3L7P A;  4L75 A;  1NJZ A;  1A9N B;  1OMS A;  1WD6 A;  2V6A A;  2L9D A;  3MEK A;  4WFY A;  4KO0 B;  1UKU A;  4USV A;  1LWC B;  2U2F A;  5H9F J;  2M52 A;  3N01 A;  1F0X A;  4IH6 A;  5CD4 A;  1GH8 A;  3OFF A;  2OD6 A;  4JV5 F;  4YOE A;  2DGX A;  3DRR B;  3EXY A;  4OI2 A;  2FJV A;  4DL2 A;  1RTI B;  3TAM A;  5A2Q U;  2IVY A;  3LW5 C;  5B09 A;  4ZP8 A;  1HBN B;  1ZET A;  4PXD A;  2J7U A;  3CD5 A;  3QAU A;  1UPP A;  4FN5 A;  1HW9 A;  3MPW A;  1G2E A;  3RRK A;  1D3W A;  3W7B A;  5EWF A;  2FVC A;  4DV5 J;  1HR0 F;  2J9C A;  1UEV A;  4GMK A;  1RAO A;  4NMX A;  1WDD A;  1TUG B;  3SFU A;  2VG6 A;  1RWK B;  5ADZ A;  1PAE X;  4YN3 B;  1EET A;  1K1Q A;  3EVW A;  3D2W A;  1BQN A;  1U02 A;  1B7Y B;  3J7Z T;  1LW2 A;  2F8E X;  4M1K A;  3SI8 A;  2OHD A;  3PJ9 A;  3KLF B;  2E7W A;  3TA1 A;  2R8K A;  2ASL A;  4JI1 J;  1JJH A;  2R2T A;  2XM3 A;  1R27 B;  2BJE A;  4JBC A;  1T7P A;  3PFE A;  4IYQ A;  4EO8 A;  1DQ8 A;  1U1Q A;  4DUY J;  4KKO A;  4E98 A;  2DNQ A;  3I56 S;  4KJI A;  3MEE B;  4CLL A;  1RA6 A;  2DT9 A;  3LGN A;  4MK7 A;  3LO3 A;  1UET A;  1SKS A;  1TL7 A;  4GKJ J;  4XPC A;  2OSQ A;  1AUS L;  5KFS A;  3VR1 A;  3QAE A;  3LP1 A;  2ZKU A;  3N0V A;  3BDE A;  3G86 A;  3OT9 A;  1T9Y A;  3MDF A;  1IR1 A;  4DDF A;  1R7I A;  4KHP J;  3MMC A;  2B7C B;  3NGT A;  2DO4 A;  5KFB A;  3KJF B;  2LKZ A;  1F9F A;  4NI2 B;  2KG1 A;  1OPZ A;  5IWA J;  1BQM B;  5K8P A;  2ERR A;  3OR1 A;  2OMO A;  3AOA A;  2K3I A;  2UV8 G;  5H9E J;  1RU1 A;  1Y5N B;  2QC3 A;  4P73 A;  1HWU A;  3MMA A;  4K0K F;  2JRS A;  5IFM A;  2IJF A;  4ECQ A;  3RW7 A;  2F8H A;  2QFI A;  5FJ4 A;  2EC2 A;  3HKZ D;  4LSL B;  4TLR A;  4K4U A;  1HR0 J;  2EKY A;  2GZO A;  4RUH A;  3HJF A;  4NYO A;  5K8M A;  4Y28 C;  1FVQ A;  3UD4 P;  1DAX A;  4OYO A;  1YDL A;  2DIU A;  6FDR A;  5JUM A;  1NJY A;  2UXB F;  5CYQ A;  4CM0 A;  2CZV C;  1Y3J A;  5KFC A;  5J2P B;  3R5A A;  2BJD A;  4FYW B;  2AJ1 A;  3H2V E;  1W7W A;  3ZZ0 A;  2VFV A;  3Q22 A;  2YKM A;  4LSN A;  5U47 A;  2FDN A;  3W2V B;  2RQK A;  1FKO B;  1IWG A;  4DR6 F;  3OFH A;  2HW3 A;  3EM1 A;  1FWP A;  1S6O A;  3PEH A;  4DSF A;  4UY8 T;  3JTO A;  3PG9 A;  4NLU A;  2RQ4 A;  5L46 A;  3KNG A;  1YJN S;  3CC7 S;  3GCW P;  4Y0F A;  4UQG A;  2VD3 A;  4QR0 A;  3JXO A;  5KFO A;  3OVB A;  2BDP A;  1TR0 A;  2ZHO A;  2AEJ A;  4QIG A;  3OL6 A;  1DLO A;  5JMN A;  1SJ1 A;  2HND A;  3WQP A;  3PZP A;  3KYL A;  3M6W A;  3ZTQ A;  4PKD B;  1X5P A;  3C46 A;  1WEX A;  3BKF A;  1NEE A;  3PO4 A;  4K0K J;  3MWB A;  3MM8 A;  4W92 B;  3PW7 A;  1RIS A;  2CA9 A;  3MZI A;  2NXU A;  1X31 C;  4J9U E;  1V3Z A;  2WW8 A;  5KFH A;  1V3R A;  1JLA A;  1NH8 A;  4IOC Q;  2JC0 A;  5LMU F;  3G2X A;  2QMU B;  1C0T A;  2OLW A;  2N7C A;  2UXB J;  1TKT B;  4DPT A;  2HBQ B;  2CKW A;  4ZVT B;  1FFW B;  2FYX A;  4DCJ B;  3AD8 C;  3TP2 A;  4WKR A;  3UN2 A;  3A8J A;  4WU2 A;  2J6T A;  2KM8 B;  2ZE2 B;  3LWL A;  2O67 A;  5ITH A;  2KDO A;  4DR6 J;  2OTL S;  2YTC A;  4XIU A;  3D68 A;  1C1B B;  2P8I A;  4GO7 X;  4KE5 A;  3DXS X;  1WF1 A;  3UDV A;  2WSE C;  4I1T A;  3W66 A;  2DH9 A;  1S97 A;  2P6S A;  1JXL A;  3V2U C;  3FVY A;  1SKR A;  4QJV A;  4QIV A;  4IR1 A;  4ZPC A;  3AXM A;  2HGN A;  3LUY A;  1N0V C;  2ZD1 A;  3OV7 A;  4HH0 A;  3O5T B;  2VUG A;  5JJB A;  4YS2 A;  1FTC A;  3R1L A;  2K3K A;  1ZM2 A;  2GVD B;  1S99 A;  2F8M A;  1I51 B;  3RGI A;  1T8E A;  3PHE A;  5M2P A;  5C42 A;  5KT2 A;  2H4W B;  1VC0 A;  3LWM A;  2LA6 A;  2QFJ A;  1WHY A;  3CMA S;  1LK5 A;  4MT1 A;  4RW4 B;  1RBL A;  1NLK L;  4MH8 A;  1UWB A;  4YB6 A;  2HNY A;  4MIB A;  3B8H A;  2WVF A;  2GIF A;  4YB1 P;  2HMI A;  1ROF A;  4RU9 A;  1UA1 A;  1RLC L;  3DI6 A;  1REV A;  1HQ2 A;  2E1P A;  1AFJ A;  3O44 A;  1RCO B;  3GSD A;  2HFU A;  4C0O C;  4QWA A;  2D1C A;  4LF7 F;  4Q8F A;  3CCW A;  4PRF A;  1Q95 G;  2OUG A;  5LMU J;  2R9L A;  1M5O C;  1MWY A;  4BWJ A;  4LRF A;  4ES3 A;  2NSC A;  3EX7 B;  5F8L A;  3M9N B;  4OYZ A;  4YR2 A;  2G2O A;  4DR7 F;  2HUR A;  2AKW B;  2J0X A;  4ZA1 A;  2GVZ A;  1LOU A;  2EFO A;  2AEM A;  2CQP A;  1KRP A;  3I55 S;  3QIP B;  1UVJ A;  3AOB A;  1U1K A;  5I42 B;  1M1H A;  1VQ4 S;  3GU0 A;  4ZVP B;  2C3Y A;  2V8D A;  3BZQ A;  3GMG A;  3U1M A;  1CJV B;  1JXE A;  1NDL A;  3UCG A;  4RW6 B;  5E5N A;  1N88 A;  1VC5 A;  4QYZ K;  3ISZ A;  1T94 A;  3OR2 B;  3HT3 A;  2FLP A;  2F7V A;  2D3U A;  1VQO S;  3J80 Y;  2CDQ A;  2R8H A;  4IO1 A;  5LJ3 Y;  2HS3 A;  3HD1 A;  1S9G A;  2YKP A;  3Q8U A;  4JI5 F;  3CED A;  4OI6 A;  2PN6 A;  5D78 A;  5K5M A;  3CJK A;  1QAJ A;  4C8O A;  2I2Y A;  1NDC A;  3PRV A;  2ZH3 A;  4TQS A;  2FPH X;  4OZN A;  1QJH A;  2U1A A;  3KK2 B;  2UZA A;  3EGW B;  2V8V A;  2E9Z A;  4AT1 B;  3EZU A;  3NGR A;  3Q86 A;  3CXC R;  2QEX S;  1SI9 A;  3AHP A;  2B6A B;  2RS2 A;  4EEY A;  1XNQ F;  3O2I A;  2OD4 A;  1N32 F;  2ACM A;  2IVM A;  4R5P B;  1VS3 A;  4RPF A;  4R8U B;  2L41 A;  1FD2 A;  4BLG A;  4O3Q A;  4LF7 J;  1MN9 A;  4WKY A;  2WBR A;  3I4P A;  1A0O B;  2B5J B;  4UW2 A;  3H25 A;  4I7F A;  2HVE A;  2YPY A;  1UVN A;  3HDS A;  1PBU A;  1NDP A;  1MW7 A;  3QRR A;  4DR7 J;  4DSE A;  3BBF A;  3C3L A;  2OAU A;  5KFM A;  1HQU B;  4KQZ A;  3WX4 A;  3ILJ A;  5J1P A;  1VJW A;  4LSZ B;  1RTH B;  2QA4 S;  3QSI A;  2FJD B;  2YX7 A;  1SQE A;  1XK8 A;  2K1R A;  4QBU A;  1M5P C;  3AB2 B;  3JSM A;  2IA0 A;  2R7O A;  2I38 A;  1HI0 P;  2LFV A;  2DGW A;  4P74 A;  3BBB A;  2QIF A;  3QGH A;  4ALZ A;  3FFI B;  5KFZ A;  3BB5 A;  2BKN A;  3T9Z A;  2N7Y A;  2HFN A;  2QA2 A;  3MTJ A;  2ZEJ A;  4D3G A;  3G8S A;  2KRB A;  2YNG B;  1VRQ C;  2UVW A;  2HVH A;  2EEY A;  4ZLN A;  3IAM 9;  4NLV A;  2NZ4 A;  3VVU A;  5DGB A;  3NNA A;  4OI0 A;  3GP9 A;  1JNZ B;  1R43 A;  2AHO B;  1RWU A;  4JI5 J;  2FGC A;  2LXI A;  3A3O B;  4H4M B;  2DGO A;  2IFX A;  1W25 A;  3DLG B;  3C16 B;  3H42 A;  3HZE A;  4OLP A;  1GMW D;  3FBE A;  3UFC X;  4XPE A;  1ZAV A;  1F3V A;  1VDH A;  2VPX B;  4TLQ A;  4CH0 S;  4X4Q A;  5G0R A;  2FGO A;  1QD1 A;  4RWW A;  1UWA A;  3QWP A;  3O3L A;  2VL1 A;  2RQM A;  1XNQ J;  5ETT A;  3WDO A;  3V81 B;  1N32 J;  2CQ0 A;  2YNH A;  3MFI A;  1C2P A;  1R6Y A;  2GO8 A;  2E9R X;  2AEF A;  3HUL A;  1Q5Y A;  4F0K A;  1N5S A;  1Q81 T;  1V6H A;  1RCX B;  2KZZ A;  4WFX A;  1HWI A;  5CYM A;  2G1D A;  1XMQ F;  2RF2 A;  4DX7 A;  3I4H X;  3RB6 A;  1PSD A;  1SCJ B;  5K8N A;  1VYA A;  3GLJ A;  4ZJQ A;  4ZVR B;  1R3N A;  2Z2Z A;  2WVC A;  4EBC A;  3JAM Y;  2H4Y B;  3FMB A;  4DL4 A;  4QQB A;  2D3O 1;  2QA4 G;  1Q8B A;  2LP4 A;  3Q2S C;  1E6Y B;  1FJC A;  2B3T B;  3ZTS A;  2DNL A;  3WIU A;  2A2C A;  3EYZ A;  2HHS A;  3ITH A;  1FRL A;  4U9R A;  2XEX A;  1QTN B;  4K59 A;  2A0F B;  2GHP A;  3P4U B;  1DTQ A;  4B3T F;  2VOP A;  1C4A A;  1X5S A;  3WIV A;  3DFE A;  1G1X A;  1GAO A;  4A8O A;  4LRB A;  4CLP A;  4PCQ A;  4EUV A;  3SDE B;  2BR0 A;  3V6D B;  1MNE A;  3BGR B;  3ZZU A;  3G4S S;  5HBM B;  2GMH A;  2PE8 A;  4XTT A;  2RHQ B;  1OPI A;  1SXL A;  2WOM A;  1PYT A;  3PR4 A;  2GQQ A;  4WJB A;  4JI3 F;  3KDN A;  1S1T A;  3ZZR A;  1M0S A;  2EBG A;  2V34 A;  4NA2 A;  4X4P A;  1OQ6 A;  4NCA A;  2ZFH A;  1FRM A;  3DC2 A;  4ICL A;  2J5A A;  4DL5 A;  3I5B A;  3UI3 A;  2HHH F;  4PQU A;  5E0O A;  1PC5 A;  2ZVS A;  5I3P A;  3FCW A;  5KFD A;  4N8O A;  3UN5 A;  1JLF A;  4NLQ A;  3M1V A;  2VG7 B;  3UNG C;  1MSW D;  3GFH A;  3AT1 B;  5E41 A;  4ZJO A;  5E3Q A;  1IJF B;  4OYP A;  2UUW A;  4QWB A;  1TAQ A;  4EK2 A;  1SUQ B;  2VFR A;  1XMQ J;  4C7Q A;  4OX6 A;  4E2F B;  4RWX A;  3CCE S;  1K8A T;  1B0P A;  2QG9 B;  1U4B A;  2LVW A;  2ZH4 A;  3C6T A;  3UCU P;  1ZA1 B;  2J9D A;  3UDL A;  1Y4Z B;  1RBA A;  3H0P A;  3A8K A;  1N5Y B;  2RDD A;  3R1H A;  4ZPW R;  3C6U B;  1MWQ A;  2JNJ A;  2J6U A;  3MM9 A;  2G1H A;  1UVM A;  3G82 A;  5A6P A;  1J2V A;  3M32 A;  1L3V A;  1QUV A;  2ILY A;  1YSJ A;  4B9M A;  1S1W A;  5KFV A;  4B3T J;  2LQB A;  5ETR A;  3M2V A;  1FVS A;  2VKZ G;  4NRT A;  3ZZO A;  1B0T A;  2M7S A;  1UZH A;  3CGI A;  5I3U A;  4LIR A;  3Q8R B;  2ZBR A;  2H54 B;  3VVT A;  2HFZ A;  2MGZ B;  2CWK A;  4JI3 J;  1FJ7 A;  4TY8 B;  4F3M A;  4ANE A;  4DJB A;  4NCB A;  1PG5 B;  4UST A;  2FJA B;  1VQY A;  2CJB A;  3GYX B;  2R2R A;  3OL9 A;  5IC4 B;  1WWH A;  5ETQ A;  3HHD A;  5IOL A;  1QAX A;  2KT5 A;  4ZDN A;  5J1E A;  1TEL A;  3TEH B;  1FF2 A;  4CLW A;  4IH5 A;  1S48 A;  1UVK A;  2HHH J;  1J5O B;  3KMQ A;  2QJ3 A;  2DNR A;  1UA0 A;  1JLE A;  2FHJ A;  3RTV A;  2CAJ A;  2KHD A;  1YQH A;  1IBL F;  4CTA B;  2MKC A;  3VHQ A;  1NPR A;  2B43 A;  2GW8 A;  2V69 A;  5LT5 A;  3K57 A;  5D6G A;  5A8W A;  2J7W A;  2MKH A;  3A8E A;  3DYA A;  4ED7 A;  3D4J A;  4DV0 F;  1ZPW X;  3KLI B;  1JKH B;  3MUR P;  3NBP A;  2YBV A;  4UZB A;  3N6M A;  1ZAW A;  1HLW A;  1ZS6 A;  2DTJ A;  2C42 A;  1N48 A;  2QLJ B;  2E9T A;  4PYA A;  1YBT A;  2BQ3 A;  2NXC A;  4O3P A;  3R6G B;  1KFS A;  2DNK A;  3M8Z A;  5KT5 A;  1HQE A;  2LEC A;  3C2P A;  4K4Z A;  1FRI A;  2WB1 D;  1CBK A;  2JJ4 D;  4IO9 Q;  2KT3 A;  3TX8 A;  2HG4 A;  3NL0 A;  4LJM A;  5EX3 A;  4X64 J;  2P9E A;  3DLH A;  2V4Q A;  2M3D A;  4MYU A;  3BO2 A;  2XYH B;  2HNZ A;  3RRG A;  4DCO B;  3K5L A;  3DHX A;  2CDR B;  1HBU A;  3DRP A;  5DET A;  4HDH A;  3DDI A;  2LYV A;  2PD1 A;  4YME A;  3QT6 A;  4CLU A;  3BN4 A;  5A76 A;  3TO8 A;  1KWM A;  1U1R A;  3MCS A;  4NA3 A;  1YKW A;  3MAH A;  4DV4 F;  4FBU A;  4F04 B;  5KG6 A;  3JSB A;  1JQG A;  5KFA A;  1YJW S;  5HP1 B;  3HSJ A;  2AJF E;  3PY8 A;  1GMU A;  1O6X A;  2XGP A;  2JVR A;  1E6V B;  1RT7 A;  2W25 A;  3V4I B;  5IQQ A;  1M5V C;  3G8Q A;  4DS4 A;  3BYR A;  2ZHB A;  4C8L A;  4BDP A;  2XTJ P;  1QE1 A;  1NJW A;  1S6P A;  4B02 A;  4ZP9 A;  4OHZ A;  3GII A;  2VKR A;  4UY8 5;  3JQJ A;  4RW8 A;  1K1S A;  4FF1 A;  1IBL J;  2KM8 C;  5I3Q A;  2YKN B;  1ULR A;  3MEG B;  1QTM A;  3MUT P;  4DF4 A;  4ZVU B;  3CE8 A;  4URQ U;  2F9J A;  2YNI A;  2DD8 S;  2BOA A;  4DV0 J;  1FX2 A;  2IM3 A;  1SQG A;  3EVO A;  5IT4 A;  3N5B A;  2LQ5 A;  4IUF A;  2HQF A;  1N5Q A;  1IR0 A;  4DU7 A;  3TJ8 A;  3R7B B;  5DZ7 A;  1RAJ A;  1NZ8 A;  4NML A;  2C3U A;  2BQU A;  2LEB A;  4A8M P;  4ED6 A;  2MQ8 A;  3R9L A;  4NX9 A;  1U2F A;  1R6V A;  2IC3 B;  4J91 A;  1D9A A;  1D9D A;  5M2R A;  2IYG A;  2XC9 A;  2MDA A;  2BM0 A;  2V2Z A;  4OYI A;  2W9B A;  4NLR A;  5AXM A;  3AH6 A;  4NZ0 A;  5LSO A;  4ZVE A;  1TAU A;  4DV4 J;  2CRL A;  3M9M B;  3QGP A;  2XI3 A;  4RUC A;  1FX4 A;  1TL1 A;  4LQ3 A;  1Q8I A;  2FJE B;  1TL3 A;  4NL5 A;  4M63 A;  4X4O A;  2V5H G;  4ELU A;  5C24 A;  1U0H B;  1EP4 B;  3SQG B;  2OH2 A;  1HHQ A;  1T9W A;  3G8T A;  1WKJ A;  4M5D B;  2Z2M A;  3THV A;  3CD6 S;  1RT6 B;  4ECR A;  2HVD A;  3KJQ B;  1TVR A;  3M2U A;  1F6T A;  3NOG A;  3KJV A;  5HVG A;  2EFG A;  5HLF A;  2OPQ B;  2VV5 A;  3DMJ A;  1ZM9 A;  3ONQ A;  2BAN B;  1FHT A;  1KFD A;  4ZHR A;  3CME S;  2N3L A;  3EXC X;  3CJ0 A;  3RG6 A;  3TAM B;  5KFL A;  3IMQ J;  4NLY A;  4QPX A;  1PIL A;  3F41 A;  2FVR A;  1XR5 A;  2F1F A;  1WC6 A;  4K4W A;  2EW9 A;  4USU A;  1RWW B;  2VG6 B;  1HBO A;  1ARO P;  4GVL A;  2AU0 A;  3I0R A;  2Y1L B;  2CYY A;  1DQA A;  4H4K A;  3VTI A;  1BE4 A;  3T1Y F;  1LW2 B;  2WHO A;  4IFV A;  2RDJ A;  4ECX A;  2HQI A;  2W2Q P;  3DLK B;  3T5K A;  2HHV A;  1RI7 A;  3OHB A;  1HFE L;  2XWY A;  3KJN B;  2CQ4 A;  1F2H A;  5C5J A;  4KPY A;  3HHL C;  1JLB A;  3D6F B;  4KKO B;  1C0U A;  2AJ0 A;  2MZ1 A;  5AXN A;  4ECY A;  1EQM A;  1Y10 A;  4OYM A;  2CJQ A;  1TL7 B;  2RU3 A;  5FLX U;  2QLF B;  4P2S A;  5A2Q Y;  1RHJ B;  2PMW A;  3LP1 B;  3CDU A;  2CQD A;  4URS A;  4EFA C;  2KU7 A;  2VZ9 A;  2BEF A;  1JLQ B;  1N4L A;  3MMC B;  5KFK A;  1R0A B;  1D09 B;  4DFM A;  4OZ1 A;  3B6B A;  1NK8 A;  1P1L A;  1RU2 A;  4FVM A;  5DLF A;  1ZYQ A;  2E5G A;  2EFQ A;  2JEF A;  4OMF G;  2R7W A;  2VPY B;  1R0B G;  3NLC A;  4LQ9 A;  3QGG A;  3DKD A;  3T1A A;  3KTQ A;  3OR1 B;  3AQO A;  4NPO A;  4A8X A;  5K9F A;  5CYJ A;  5J2Q A;  4NLP A;  3MMA B;  4LRE A;  2WON A;  1FRJ A;  2MLY A;  1MML A;  5AJ3 F;  3GIK A;  3DOL A;  3J7A N;  3GR1 A;  3Q23 A;  1S57 A;  2G2Y A;  1EAY C;  2G13 A;  4MFB A;  1VQL S;  4F4Y A;  1FNM A;  1TKZ B;  4FF4 A;  5HK4 A;  4HHH A;  4CYU A;  3D3C J;  1LWE B;  3O6Q A;  1RAC B;  3T1Y J;  3Q24 A;  1R0C B;  4JUZ A;  2HZA A;  1WOO A;  1R8B A;  4CLF A;  2W9C A;  3PIP Q;  4BBY A;  3H5X A;  4DV1 F;  3N6L A;  5E7O B;  4LSN B;  1VQM S;  1EKR A;  1RWX B;  4MTP A;  3BH7 B;  2RVJ A;  4UOF A;  4OJG A;  2V68 A;  3AFG A;  2MQQ A;  3KMS A;  2W8K A;  2DGU A;  2XG8 A;  2ZKT A;  3M8P A;  3M30 A;  3S7R A;  1RAB B;  3W5Z A;  2OI2 A;  4KIA A;  1RWM B;  1Q1K A;  3ETO A;  1S0V A;  4ZPD A;  1KQG B;  3BDP A;  4WE1 A;  4DSK A;  4DI6 A;  3VAF A;  3DGV A;  2HBZ B;  2JLF A;  1IKY A;  1NK6 A;  5HSP A;  4NLW A;  2XCP A;  1URN A;  1KR4 A;  3A4T A;  1RK8 A;  1RXO B;  5MLC V;  3BGF A;  1LQ9 A;  1HL6 A;  3S8S A;  1S6Q A;  3HSD A;  1T03 A;  5DG9 A;  2A3J A;  4H54 A;  3MEC B;  2ZOF A;  1TK5 A;  2ZBP A;  2HND B;  4UOC A;  2XS2 A;  1RWN B;  3CD7 A;  3TYT A;  4ED3 A;  4F7V A;  2B4O A;  2R7Q A;  3MM6 A;  3M6U A;  4LRA A;  2AMC B;  1ZAX A;  2HWI A;  3W2W B;  1Q4R A;  2CPF A;  2V67 A;  1YG0 A;  5AJ3 J;  2XZW A;  3GR0 A;  1CJK A;  5SUH A;  1HMV B;  3LP0 A;  1PBA A;  3ENV A;  1HHS A;  3HHL A;  4X66 F;  1NH7 A;  4K5R A;  2UVU A;  4CH1 A;  4RBT A;  4DQS A;  1JLA B;  5D0E A;  5EN1 A;  2AJ2 A;  1OO0 B;  4ERD A;  1C0T B;  1U24 A;  2BQR A;  3GG1 A;  3QSY B;  2EG2 A;  3FEZ A;  1M1K T;  2PI5 A;  3VAI A;  2J8A A;  1SJF A;  3DLE A;  3HZG A;  1HNV A;  3LH2 S;  4EYH B;  4DV1 J;  1RAD B;  3N6N A;  3BGO P;  1HWJ A;  1CQM A;  1K0T A;  1U09 A;  3UVJ A;  3MPD A;  2K2P A;  4PUO A;  3B4M A;  2AX0 A;  1XC9 A;  4MIW A;  2NPI A;  1SL1 A;  1J5E F;  4AQY F;  4DR1 J;  5KFN A;  5K14 A;  4N56 A;  2OTJ S;  2OPS B;  4CLK A;  2EFN A;  2H9Z A;  1WI8 A;  2ZD1 B;  2HQG A;  5T41 A;  4C6A A;  3ADA C;  2ZDO A;  1WOS A;  3MR7 A;  3IWX A;  1KVJ A;  2A6M A;  4ED5 A;  4HT7 A;  2BYC A;  4J9Q A;  3BR9 A;  5AE3 A;  1HYS A;  1FEH A;  3SFG A;  3OXG A;  4KGX B;  2W01 A;  3QYY A;  3BGU A;  4WZM A;  3TQ1 A;  2OKQ A;  4OI1 A;  3MPY A;  4O4R A;  2B51 A;  1UWB B;  2HNY B;  1MRO A;  4NZ6 A;  5D4P A;  2HMI B;  1NHV A;  4K4S A;  1S1X B;  2B8P A;  4LF2 A;  1REV B;  1QSY A;  3UCZ P;  3PVX A;  3PCO B;  1PAU B;  4X66 J;  4RW7 A;  3KK3 B;  4OYX A;  1ZTT A;  4ZN1 A;  2GHV C;  4NWB A;  2HHX A;  3MED A;  3K89 A;  2NCK L;  4ZP6 A;  1X9S A;  1DTT A;  4KV8 B;  2MLX A;  3BSO A;  2HLU A;  1Q0N A;  1EZZ B;  3KHL A;  3K58 A;  5D8H B;  1RTD A;  1S1U A;  2VBX A;  2XMT A;  2RT3 A;  4O3O A;  4B3M F;  4F3Q A;  2GVZ B;  2N3O A;  1YJ7 A;  2GAG C;  3KG1 A;  4UF4 A;  1VCT A;  1H7W A;  4WXW A;  1U6B A;  4DX6 A;  2A2D A;  5HJY A;  2MEW A;  2EK6 A;  1U6F A;  1RB0 A;  1Q78 A;  2O1P A;  3OL7 A;  3UNY A;  2F3J A;  3G6V A;  3GIJ A;  2CVI A;  4UZC A;  1J5E J;  3SIP B;  4AQY J;  3CJ2 A;  4W98 A;  1UEK A;  1RSC A;  1YIJ S;  3MAA A;  3GV8 B;  2RS8 A;  3SCJ E;  5EWG A;  3CTR A;  2HBR B;  4X4S A;  1VRU A;  4O4G A;  1UJ6 A;  3RYL A;  4ENO A;  1KVI A;  5HQL A;  3CJK B;  4PG7 A;  3WX8 A;  4C3L A;  3O1L A;  1JMT A;  1GXL A;  3C19 A;  3QO9 B;  4Y2M A;  5IV4 A;  1JNR B;  2CQI A;  4LBI A;  4IDK B;  2MKK A;  4PYD A;  1AA1 B;  3ILL A;  3Q8Y A;  2EBE A;  4OHW A;  3L7U A;  2DRD A;  4OYA A;  1Y3K A;  1IKV A;  1YBA A;  4I2Q A;  2LQJ A;  3K17 A;  3D54 A;  1JLG B;  4OI3 A;  3S6E A;  2YXL A;  3W8P A;  2HYI B;  2ZWP A;  4QWD A;  3T6B A;  8AT1 B;  2XCA A;  3OFE A;  3DGP A;  3SCI E;  2QRR A;  1TFW A;  2DHH A;  1RUS A;  9RUB A;  2EVZ A;  4DEZ A;  4ED4 A;  3B82 A;  1WKK A;  2GJF A;  4B3M J;  4ECZ A;  5DQI A;  4USK A;  3QZ8 A;  4AXJ A;  2CIM A;  4I6A A;  4FS2 A;  1FTR A;  1FNO A;  1N56 A;  2K1R B;  3JSM B;  4IRC A;  1MU2 A;  4J9N A;  1D8Z A;  2NXE A;  2NYH A;  2M5Y A;  4KTQ A;  1ZA2 B;  4KGK A;  1WHW A;  3C66 A;  1S76 D;  2Q3P A;  3PR5 B;  4RW9 A;  4KO0 A;  2ZHA A;  1BUX A;  1RBO B;  2WK4 A;  4CH7 A;  2FTR A;  4A8K A;  1LEO A;  2Y8W A;  2AT1 B;  2ADB A;  1JJ2 R;  5ETO A;  1K0V A;  1NKE A;  5HO4 A;  3TX0 A;  5F3Z A;  3V6J A;  5HQM A;  1RTI A;  5KT4 A;  5I4M A;  3BF4 A;  5L38 A;  4F50 A;  1C1C B;  2DBB A;  1HBN A;  3DOK B;  1QAI A;  4ZVF A;  3MUV P;  3TOQ A;  5GAD I;  3KLG A;  2J7K A;  1W26 A;  2UV8 A;  1VFJ A;  5DM7 Q;  2DHA A;  5IC6 B;  2DGQ A;  5G0R B;  1WNE A;  3M8Q A;  3DLJ A;  2HHU A;  1XMB A;  2CNO B;  4GC6 A;  2C1E B;  2YNH B;  1S0M A;  2OFH X;  1T05 B;  5CAA A;  1NB7 A;  4U7C A;  4EO6 A;  1LNQ A;  3ZZP A;  4A8S A;  3NMA A;  2BVZ A;  4C48 A;  1X4A A;  1YX2 A;  4ZK7 M;  2QL7 B;  1CC8 A;  5CYM B;  3VAL A;  1HAR A;  1IKW A;  5LOQ A;  2VOD A;  2YH1 A;  1JK9 B;  1ITP A;  4YY3 F;  4CRJ A;  4LBH A;  3AQP A;  2CQH A;  3KK1 A;  1HPZ B;  2NLW A;  2BJ1 A;  2JSX A;  5F0W A;  4DG1 A;  1HNW F;  2WCX A;  5KT7 A;  2FUG 9;  5LXY A;  4I67 A;  3IM9 A;  1UP1 A;  1V3S A;  2IBK A;  3PYF A;  4HYK A;  1RT5 B;  3Q8S B;  5F9N A;  1NKC A;  4TU8 A;  1QAY A;  5GAG I;  3CJ8 A;  4MKV A;  3PYD A;  4B9N A;  5CZV A;  5K20 B;  2ASD A;  1N34 F;  2R3V A;  1VRT A;  5DDR C;  5KG5 A;  3HVT A;  3I82 A;  3OJS A;  4JV2 A;  1BQM A;  4DFP A;  3IR7 B;  3EDQ B;  4O44 A;  5BYS A;  3FBF A;  3KXD A;  1FNX H;  1REG X;  2Y9H A;  2ZH9 A;  3MI7 X;  4CQ1 A;  2MQL A;  3U1N A;  3FCH A;  3BJY A;  2RRB A;  3AJ2 A;  1MLA A;  2KFY A;  5JVH Q;  4PXB A;  2GQC A;  3ENA A;  4ZP7 A;  4Z7C A;  1APS A;  4DQP A;  2WOM B;  4IG3 A;  2CPH A;  4LSL A;  3H8Y A;  3FZB A;  4F3O A;  5GME A;  4G1P A;  3QPI A;  3DU5 A;  4EYI B;  1AXQ A;  2DR9 A;  4ICL B;  1WTF A;  3W9I A;  1RWP B;  2X3D A;  1U0S A;  2DKO B;  2GA7 A;  5AXL A;  3IWL A;  4CT8 A;  4P2F A;  4PQU B;  3M1V B;  1A7G E;  1WKL A;  1RYR A;  2AGO A;  2RB7 A;  3VQS A;  2DB1 A;  2XBP A;  3TRG A;  3TA2 A;  4P2X A;  3LTO A;  2J0Q D;  1KHV A;  2NRE A;  4DL6 A;  4NOH A;  1IXK A;  2LLZ A;  2DCU B;  4PXC A;  4YY3 J;  4F25 A;  4ECV A;  2KL8 A;  2KVQ E;  1HD1 A;  2YPZ A;  3LPE A;  3PW2 A;  2OEK A;  1T02 A;  5KFX A;  1CG2 A;  3OSN A;  3U27 A;  4M5G A;  4P7T A;  2ILZ A;  4OIX A;  2HLT A;  4BS2 A;  3D67 A;  4ZCI A;  1KLM A;  2GJ2 A;  5B0D A;  2VU5 A;  3R8Y A;  1TKX B;  2EI5 A;  4FBT A;  3N4W A;  3G82 B;  5DQH A;  2MY7 A;  3OLB A;  5F8M A;  3BGL A;  1N34 J;  5L1I A;  3PV8 A;  2DXF A;  1XER A;  2RRN A;  5A0Y A;  1WEL A;  1YI2 S;  5GAD U;  4W4M A;  2CJY B;  2NSB A;  3HT0 A;  3AOD A;  2C3P A;  2EKN A;  2NUU G;  1VR6 A;  5AE1 A;  5I3U B;  4PAA A;  2C22 A;  3FMW A;  1SPB P;  3MPU B;  2ZDP A;  2PMZ D;  4NLG A;  1YJU A;  2F65 A;  1YWX A;  4LIW A;  3JQM A;  2I6W A;  5C25 A;  4KY3 A;  3VQT A;  2BRK A;  5J1E B;  2MB0 B;  1FES A;  2YKA A;  1TKT A;  3PDN A;  1YIT S;  1H98 A;  2FHK A;  1N5V A;  1JLE B;  2MZS A;  1NSA A;  4RO0 A;  3L3C A;  5AXK A;  2ZE2 A;  2DGV A;  3MMB A;  4ILL A;  1F5A A;  2V2Q A;  5A8W B;  1HBM B;  3DYA B;  4BC7 A;  1U2C A;  4ES2 A;  1IBK F;  1DHM A;  3ZNU A;  1IQZ A;  5IWA F;  3P3D A;  3W60 A;  1GEH A;  2IMW P;  1UJ4 A;  4WYW A;  4MKB A;  2B4P A;  2JOQ A;  3H4B A;  3BBC A;  5CZX A;  5GAG U;  1Z1Z A;  4CNZ A;  1K44 A;  5HAT A;  1GMV A;  1HQE B;  2V8G A;  2XS5 A;  2MKJ A;  4PG5 A;  1S49 A;  2FC8 A;  1X7V A;  3T19 A;  2KXF A;  2QLW A;  3NS7 B;  5KFF A;  3CO9 A;  4ILM A;  2IMO A;  2GVD A;  5FD1 A;  3BQ2 A;  2XYP B;  4DUT A;  2XMA A;  5B7W A;  2CVE A;  4FKX A;  2YWF A;  4NLD A;  3I9V 9;  1OYD A;  2HNZ B;  2XB2 D;  4HHJ A;  1HBU B;  4I6W A;  3MTK A;  2R2S A;  3J7A 1;  1S10 A;  3POT A;  2UU9 F;  1KSP A;  1VQ6 S;  2QX0 A;  2AYE A;  3P5B P;  1GT8 A;  4QW9 A;  3CC4 S;  3WZ0 A;  2UVV A;  4QW8 A;  4FYY B;  4ITS A;  3OUY A;  3IA0 A;  4TKT A;  2VF3 A;  1ELO A;  2HGM A;  2KJV A;  1HNX F;  4A8W A;  1UW4 A;  3LAL A;  4Y2A A;  3PKM A;  3Q8P B;  4RKU C;  2HAI A;  2I8E A;  2H3E B;  2NQP A;  2MY8 A;  1QE1 B;  3D5M A;  2HQC A;  3I32 A;  1L3U A;  1O8B A;  2KT2 A;  1S6P B;  3MFH A;  3EGV A;  1RAI B;  2IRY A;  4PPZ A;  3R2D J;  1FK9 A;  3OVS A;  3MXH P;  3TZY A;  3CCZ A;  4IRK A;  3HM9 A;  2G4B A;  1GFW B;  4DZ6 A;  5KFJ A;  1W2B R;  1JX4 A;  3GV5 B;  3K8V A;  2XQC A;  5HRO A;  1IBK J;  4JOU A;  1U1N A;  7AT1 B;  3FZ2 A;  4N8N A;  4KC5 A;  4RW6 A;  1CPZ A;  3R5G A;  3K0J A;  3MR3 A;  3W8G A;  3NGS A;  1NK7 A;  4IOA Q;  1FXD A;  4QYZ J;  1FRH A;  3IAS 9;  5KAK A;  3HX9 A;  5IS2 A;  3CUL A;  4RUA A;  5KTQ A;  4IH7 A;  2VG5 B;  3AA9 A;  1S7H A;  4DQR A;  2G0C A;  1SB6 A;  3VAK A;  4TU7 A;  2E7X A;  1BWV A;  4Q0B A;  3DCA A;  1GQE A;  2XO7 A;  3IM8 A;  4L3N A;  5HQ8 A;  2NXJ A;  3WHI A;  2DGT A;  3VAJ A;  2ZNZ A;  3NCR A;  5B0F A;  1UVL A;  3KG4 A;  4C11 A;  2ZH5 A;  3ET6 B;  3KK2 A;  2M88 A;  2UU9 J;  2HZV A;  2ZOG A;  4YB5 A;  2CJ9 A;  1Q8L A;  1WC4 A;  3DLB A;  2YX1 A;  3AJ1 A;  3BEG B;  4HVZ A;  4OJ3 A;  1XR6 A;  2WSC C;  2DVI A;  3NGU A;  1N52 B;  1TL1 B;  2W8L A;  3ZZZ A;  1KD1 T;  1BHN A;  1HNX J;  4ZVO B;  1DFD A;  4KHM A;  3EE3 A;  5J2N A;  5C24 B;  2BRL A;  2CJK A;  3H20 A;  5D0G A;  2ZM6 F;  3U7J A;  1WHV A;  5DRK A;  2KXN B;  3RZA A;  5DDO C;  1U26 A;  1V5V A;  2HS0 A;  4X84 A;  4NCG B;  3FEX B;  4AXI A;  3A8I A;  1LV5 A;  1TVR B;  2B9E A;  3M2U B;  2K8G A;  5FII A;  3KJV B;  1CSJ A;  2D41 A;  1RT2 A;  2W7A A;  1WC0 A;  3V6H A;  5HLF B;  3SQO P;  3BQ0 A;  1SL0 A;  4DCP B;  3GJT B;  3OTB A;  5L1J A;  1Y7P A;  3G6E S;  4EBD A;  4FNI A;  4DZD A;  2V0N A;  4JP8 A;  2O5D A;  1LW0 A;  2M8H A;  3D9B A;  2W24 A;  1NK0 A;  3W64 A;  3FFI A;  3PIO Q;  4RNO A;  3N9U C;  1TK0 A;  1WG4 A;  2XLK A;  1HBO B;  3OXF A;  1R89 A;  4CIO A;  2MST A;  3QWU A;  4DPU A;  3CDE A;  4RBV A;  1TUV A;  2NR0 A;  5DGA A;  1LWF B;  1ZZF A;  1YZ6 A;  2Y3Y A;  1MWZ A;  3R7S B;  1N6Q B;  2RIJ A;  4CLY A;  3ZO7 A;  2ZJQ Q;  2GIQ A;  2EWH A;  4OX7 A;  2DNZ A;  3FJ2 A;  3EGN A;  1SH3 A;  1T95 A;  4F0M A;  2XY6 A;  1CQN A;  5KG0 A;  5IZH A;  2GC8 A;  1FWL A;  2BBE A;  2C2E A;  2RDI A;  3HKW A;  4ED8 A;  1WSV A;  4B9V A;  3ZZT A;  2KFN A;  2Y1R I;  5KFY A;  4DU8 A;  3IP0 A;  1TU0 B;  1CS4 A;  1C0U B;  2R2U A;  2YY3 A;  2XMJ A;  1CEZ A;  1EHW A;  3UE2 A;  5DLG A;  1S5Z A;  2CUY A;  2V2K A;  3V81 A;  4ZIV A;  1M5H A;  3GE9 A;  1U49 A;  1NM2 A;  3GQC A;  3J81 U;  2LEA A;  3PKY A;  4DOZ A;  4QWE A;  3EVM A;  4C8N A;  3OTE A;  4FPR A;  2RJZ A;  1P6T A;  2ZH8 A;  2LCW A;  1DUR A;  1BMQ B;  2ZM6 J;  3KUG A;  3Q89 A;  1SC6 A;  1P8G A;  1Y5I B;  4WWS A;  8ATC B;  1FEE A;  4DV6 F;  1UFW A;  3HVR A;  4AE5 A;  1V9O A;  4ZIT A;  5KFW A;  4ECS A;  2XMU A;  3CCT A;  2MQN A;  2L9W A;  1VLY A;  2MKY A;  3D66 A;  1FE4 A;  2BZ2 A;  5J2Q B;  1E6Y A;  3IO1 A;  2WON B;  1MMD A;  3ICL A;  3MF5 A;  3DOL B;  1K47 A;  1OYE A;  4NRU A;  4ZLP A;  2KN4 A;  2JDJ A;  4MFB B;  1WOR A;  1RTJ B;  3MR5 A;  3TUP A;  1JJ4 A;  4MJK A;  4B3S F;  4CYU B;  1JLC A;  4XAK A;  5FLX Y;  2N4D A;  1RAH B;  5B0B A;  4J37 A;  3UN3 A;  3Q2T C;  2AJ4 A;  3E8O A;  4HL9 A;  1VOM A;  2DXD A;  5J2M A;  2UP1 A;  3TUJ C;  4IFY A;  4DLG A;  1X60 A;  2W9C B;  1S79 A;  3A3P B;  2C2D A;  3TJ9 A;  2FIU A;  3KLH B;  1XEZ A;  2JFD A;  2FLN A;  1KDN A;  1XR7 A;  1ZM3 A;  1RHQ B;  3LAK A;  1QY7 A;  3HI9 A;  2P6T A;  4FDF A;  4AND A;  4PG8 A;  3OPK A;  3PXG a;  4Y65 A;  5F8H A;  4O3R A;  3MM5 A;  2IM2 A;  3M8P B;  4WP8 A;  5F41 A;  2YWW A;  2IYI A;  3R27 A;  5EHH A;  4KT0 C;  1SJ3 P;  4C0B A;  1YGY A;  3HK2 A;  1AB8 A;  4WFB Q;  4OZL A;  3A3N B;  1GMW A;  1NSP A;  1SUQ A;  2V9W A;  1M90 T;  3CC2 S;  4TYB A;  4RBU A;  2Q43 A;  2HSE B;  2OP5 A;  1GX6 A;  4QOT A;  1AZS B;  2GQ2 A;  3D6H B;  2HAF A;  1WOP A;  1S6Q B;  1T03 B;  4DV6 J;  5ETV A;  3H40 A;  2D74 B;  4G1Q A;  3NNC A;  5ETS A;  2OEL A;  1AT1 B;  3QRQ A;  4PWD B;  3KHH A;  4KFB B;  2KTQ A;  1N5Y A;  2CQB A;  2BJ8 A;  4DV7 F;  4C3K A;  2CG8 A;  2QE5 A;  4L6V 3;  3EJM A;  2QLB B;  3MM6 B;  1S0N A;  3AD7 C;  3OD2 A;  3VCD A;  5DG8 A;  4CI0 B;  2PO4 A;  1SC3 B;  1G4C A;  2ZH6 A;  3JQK A;  1XN9 A;  1AW0 A;  2C2Z B;  1CJK B;  4ER8 A;  1NJI T;  2JLG A;  3LP0 B;  5F8N A;  3HHL B;  3MAQ A;  4KH1 B;  3HHN B;  3PW0 A;  2E66 A;  2PDA A;  3OL8 A;  2Y8Y A;  4Z37 A;  2AYG A;  4DMZ A;  4KB7 A;  2GCF A;  1YJV A;  2DY9 A;  2WB4 A;  2I1R A;  4B3S J;  2C2M B;  4L74 A;  4I69 A;  3QRP A;  2Z58 B;  3HVW A;  3IGV A;  4NEY A;  1HNV B;  3I5A A;  4ZVH A;  3MGJ A;  3UO0 A;  2BUN A;  1FA0 A;  4OYB A;  5ETN A;  4DS5 A;  4LVO P;  2RNE A;  4ANC A;  1NO8 A;  3D1H A;  2FLL A;  3UVJ B;  2VA2 A;  2MJN A;  1L5U A;  3C15 B;  3MR6 A;  1EJ7 L;  1X0F A;  4PUO B;  6FD1 A;  5GAE I;  2HWH A;  5A8K A;  2X7I A;  5AE2 A;  4MMO A;  3CNQ P;  1JWW A;  1DY3 A;  5KG3 A;  4ZCK A;  3CJS A;  1XNR F;  3MD3 A;  2JLE A;  4N76 A;  2QTW A;  5IQ6 A;  5KT6 A;  3R97 A;  3JSY A;  2XNQ A;  4NXN F;  1NHU A;  4XO0 A;  3PYE A;  1VHI A;  1P1T A;  2W9A A;  5MAO A;  2VC1 A;  3TAR A;  5A8R A;  3L09 A;  4J9M A;  2W7P A;  3VZI A;  2OPR A;  4PAB A;  4I4B A;  2ZH2 A;  1YJT A;  1SBR A;  4XDD A;  4DV7 J;  4ID5 B;  2LA4 A;  2XI2 A;  4B3O B;  2IM1 A;  1FWK A;  3UR0 A;  4PPD A;  1RT3 A;  2NS1 B;  1PCA A;  2HGL A;  3PM9 A;  1MRO B;  1SKU B;  4F4X A;  2BAB A;  2AGP A;  4ZLL A;  1YK9 A;  1KQF B;  2XLI A;  4O3N A;  2BA9 A;  4USI A;  4LVN P;  4NXM F;  4RW7 B;  4PG6 A;  4AL5 A;  1RWV B;  3MED B;  4I68 A;  2VQE F;  4M5N A;  3CSK A;  1A6L A;  1Z2Z A;  2KH9 A;  3NXZ A;  5KFR A;  4KBI A;  3SYZ A;  4OLO A;  1EAR A;  1KOH A;  3TAP A;  4CO0 A;  1GX5 A;  3PEJ A;  2QL9 B;  2A18 A;  3PJW A;  3BR8 A;  3L7O A;  4WXO A;  2I5J A;  4U8V A;  1QM9 A;  3T1H F;  2R7S A;  3CIM A;  3V4I A;  3T3F A;  2VPZ B;  2KYZ A;  4K4V A;  1EIY B;  2RRA A;  2RD5 C;  4ZIW A;  2E5J A;  4HAC A;  1X8D A;  1F9H A;  1JJC B;  2AX1 A;  1QVF R;  2W4P A;  2CPJ A;  2HEK A;  3ISN D;  1S9E B;  4PG4 A;  1XNR J;  1RKJ A;  3NMR A;  4DF8 A;  2I0X A;  3MAA B;  3W9J A;  1H73 A;  2UUC F;  5D4L A;  3MEG A;  1U25 A;  3FUY A;  4NXN J;  3UW1 A;  4EZ9 A;  1VRU B;  1OY6 A;  4TQR A;  3KHR A;  2R7V A;  3GTY X;  1CJU B;  1WDT A;  2QT7 A;  3BSA A;  5DO2 A;  1XQI A;  2NXN A;  2X1G A;  3JTP A;  2Z57 B;  2MLZ A;  3ILI A;  2HRY A;  1R8P A;  4B9L A;  3FRZ A;  2ZOM A;  4N7T A;  3UDE A;  3AB4 B;  4ZKA A;  5L9X A;  2M70 A;  4Y2I A;  4WK3 A;  1VK8 A;  1FI4 A;  3Q83 A;  2ROG A;  4NXM J;  2WBM A;  4RU2 A;  2H5J B;  2IJN A;  5HMX A;  3UR3 C;  4LT6 A;  3R5D A;  4CO5 A;  3DGP B;  3G87 A;  2D69 A;  2ASY A;  2VQE J;  2E1M C;  2GO9 A;  1FKP A;  3ELH A;  3M05 A;  1XBW A;  1I3O B;  3I0S B;  5GAE U;  3GZ7 A;  3X1L B;  2R8J A;  1U45 A;  3D0H E;  2CJX B;  2XLJ A;  2B9W A;  4HTI A;  5IV3 A;  2CQG A;  1CVJ A;  1Q16 B;  2KJW A;  4RR5 A;  1OIA A;  2KKH A;  3GFZ A;  3T1H J;  4C8Y A;  2DEJ A;  3JS9 A;  3WC0 A;  1HA1 A;  5DS7 A;  2BXJ A;  2D3Z A;  4O23 A;  1U0H A;  4DV2 F;  2PEB A;  2VB6 A;  4QIF A;  3MOJ B;  4B08 A;  4OV6 A;  3OW2 R;  3SQG A;  4OZJ A;  3IWN C;  3PNI A;  3RAQ A;  4M5D A;  4OX9 F;  2DIV A;  1CUL A;  2UUA F;  3DDN A;  4RW9 B;  4CLS A;  1RT6 A;  3C8Y A;  1MN7 A;  3H90 A;  3ULH A;  2OJ3 A;  1ICE B;  2PFD A;  2RUG A;  4A8Q A;  4WU3 A;  2E5H A;  2UUC J;  3LGH A;  4MYT A;  2OPQ A;  2MHE A;  4C3M A;  4X64 F;  2BAN A;  2FJW A;  2UXC F;  3AA8 A;  3TZW A;  4V19 J;  3EUN A;  2QGF B;  1NND A;  4XK8 C;  1SVD A;  4FF2 A;  3RUB L;  4ECW A;  4M94 A;  5E2Q A;  3THP A;  3PRB A;  3IG1 A;  2R7U A;  3KLG B;  2VDH A;  2QMW A;  1TTH B;  2AW0 A;  3L9Z A;  2LQ8 A;  4DUZ F;  1JIH A;  3DXB A;  2VBY A;  3M8Q B;  4DPW A;  4DN9 A;  2HHQ A;  3JB9 k;  4U8Y A;  2QYG A;  3DLK A;  3IBC B;  3QT5 A;  1DAR A;  3JTN A;  3AY0 A;  3SSQ A;  2AIR B;  1HKA A;  2V9K A;  2V8H A;  3FKB A;  5D3G A;  3FCV A;  1KQK A;  4NAS A;  2DR5 A;  3Q8Q B;  2ZJP Q;  4DR5 F;  3RW6 A;  3U02 A;  1IKW B;  1WSR A;  3LQV A;  2FVS A;  3UWT A;  4PQA A;  4OHX A;  3KKF A;  2GJI A;  4J9V A;  4E8U A;  1KN6 A;  3GJQ B;  5EUH A;  2QLX A;  3KK1 B;  4M5M A;  1URR A;  2G2Z A;  4HHU A;  4EMD A;  4M5J A;  3CUN A;  4DG1 B;  4LF6 F;  1U7L A;  1VBZ A;  1FD8 A;  1RAF B;  5B0E A;  1JLQ A;  1SV5 B;  4DV2 J;  4WII A;  1R0A A;  4L3K A;  1M5K C;  2RML A;  2IDE A;  5LL6 d;  1WG1 A;  4JI6 F;  4OX9 J;  1SH0 A;  4YR3 A;  2G0I A;  2V4J A;  4J9L A;  2UUA J;  1BC6 A;  4G6V B;  4P72 A;  2FVQ A;  1TKD A;  3IGN A;  1VRT B;  3HVT B;  3NWG A;  5D15 A;  3SSS A;  3M8W A;  3NG8 A;  1RGV A;  3VV2 B;  4JV5 J;  4O44 B;  1H0H B;  4WP3 A;  3P49 B;  1F1B B;  2UXC J;  2CFX A;  3EIC A;  3OLA A;  4HI2 A;  3KLV A;  4KYZ A;  1BGX T;  4U6P A;  4K4Y A;  1HI8 A;  1YBU A;  1TFY A;  4IG3 B;  4JI0 F; 
#chains in the Genus database with same CATH homology
 3R7S B;  1ICE B;  4ZVO B;  1RWW B;  1RWX B;  3GJQ B;  4ZVU B;  3D6M B;  4JB8 B;  2XYG B;  2C2M B;  2XYH B;  2Y1L B;  5IC4 B;  2QL7 B;  3R6L B;  4DCO B;  1RWO B;  2CDR B;  2H5J B;  2CNK B;  2CNL B;  2HBY B;  2H5I B;  1RWK B;  3KJF B;  2H51 B;  3GJS B;  3KJN B;  1RWM B;  1PYO B;  1I3O B;  2H65 B;  2P2C B;  1RWP B;  3P45 B;  3R7B B;  4ZVS B;  2DKO B;  3SIP B;  4ZVP B;  4ZVQ B;  3D6H B;  3D6F B;  1I51 B;  2CJX B;  1SC4 B;  2HBZ B;  4DCP B;  3GJT B;  3KJQ B;  4ZVR B;  2CJY B;  2Y0B B;  2H4W B;  3GJR B;  3RJM B;  2H4Y B;  2HBQ B;  1SC1 B;  2FQQ B;  1RWV B;  4ZVT B;  1RHU B;  3R7N B;  4DCJ B;  5IC6 B;  2QLB B;  1IBC B;  1NME B;  1RHK B;  2HBR B;  3IBC B;  5K20 B;  2CNN B;  1RHM B;  1BMQ B;  3EDR B;  2C2K B;  1RHR B;  1F9E B;  2QLF B;  1RE1 B;  1PAU B;  2QLJ B;  2QL5 B;  3R5J B;  1RHJ B;  1SC3 B;  3NS7 B;  1QDU B;  1RHQ B;  3R6G B;  2H48 B;  2CNO B;  1RWN B;  1GFW B;  2XYP B;  2H54 B;  2QL9 B;  2C2Z B;  2XZD B;  3EDQ B;  3QNW B;  2C1E B;  3IBF B;  2C2O B;  1QTN B;  4LSZ B;  2XZT B;  3P4U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...