3WC0A

Crystal structure of c. albicans trna(his) guanylyltransferase (thg1) with gtp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
265
structure length
265
Chain Sequence
SKYEYVKLFEKENYLLPDTYIIIRVDGKGFHKFSQFYEFEKPNDLKALQVMNSAAEKLMSKYSDVMLAYGDSDEYSFLLRKNCQLYERREMKLTTLFSSLMSTYYMYFWSQYFPDKPLHIDHLPNFDARAVLYPDFKHIRNYFSWRQVDCHINNLYNTTFWNLVLKLKMTPQQAEQRLMGTVASDKNEILFKECGVNYNNESEMYKKGTIIVREFENYETEDEAELSKRQVQRLEKKRKKAELKIYHVDIINDDSWWKSRPWLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Likely histidyl tRNA-specific guanylyltransferase
publication title Structural basis of reverse nucleotide polymerization
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 88
structure length 265
sequence length 265
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wc0A00
3WC2A 3OTCA 3OTEA 5AXLA 3OTDA 4KGKA 3WBZA 3OTBA 5AXKA 5AXNA 5AXMA 4KGMA 3WC0A
chains in the Genus database with same CATH superfamily
4M8LA 3C15B 1RU1A 4RW9B 5IT9U 3T6BA 3KHRA 5IT0A 3AD7C 2R7TA 4CCHA 2KJVA 1SH2A 3BDPA 3ZNUA 4B9VA 2DGXA 1JJ2R 1SXLA 3V6HA 2QA1A 4LIRA 2KT5A 4WCEQ 1Y7PA 1UZDA 2RILA 1S6QA 5KAKA 1H38A 3NMRA 2GCFA 1NU4A 3C46A 1LWFA 1M5PC 2XI2A 2AHOB 4OZ1A 3I55S 1DQ8A 4RBUA 2F8MA 2L9WA 2D74B 2BANB 2EWHA 3THTA 4D3GA 2C3MA 1DY3A 4N8NA 3CDAA 4AXJA 4LFAF 4Y2IA 2ROGA 3T1YJ 5DLFA 3V81B 4DN0A 4ZLPA 4MYTA 4CH1A 3M2VB 3ZC4A 2MQLA 2JSXA 2V2VA 2D3OR 4OMFG 2F5GA 4JV2A 4I6AA 3M1VB 2UVRA 4IDKA 3BYRA 1L3UA 1TUGB 1S0MA 1H2VZ 2BKPA 5A8RB 3H5YA 5M2PA 1HKAA 1O51A 3L7PA 3OLAA 3IRWP 3SQGA 3VGTA 4DV3F 1FXRA 1I1GA 4MAKA 4QWEA 3W2WA 1NDLA 1MN7A 3KKFA 1TKZA 3W2VB 2KG1A 4ILLA 1LW0A 1Q95G 1FKPA 1F5AA 1DZ5A 2M8DB 2WVFA 2DHAA 5KFHA 1IKWB 3BM7A 3VZIA 4CI0B 3V5RA 1MSWD 3LH2S 1RE1B 1TKXA 3QIPB 2KG0A 2NYIA 2FHJD 2BQ3A 1QSSA 1Y3JA 4UF4A 3VCDA 4UQGA 5DLGA 2HNDA 2V8DA 4AT1B 1YJ7A 4FZVA 1Q5YA 4PAAA 3HD2A 1TKTA 1L3VA 4P9SA 2RQMA 3GSDA 1WKKA 4CH7A 4LF7F 1S6PB 3GLJA 1H98A 2KJWA 3D0GE 3O6QA 2FJEB 2HURA 4OZ3A 1VIXA 3QLHB 1M5OC 4NLSA 5EX0A 2W2PP 2VQEJ 1UW9A 1S9EA 3ZZPA 2XZWA 3OPKA 4DPUA 4KJIA 4TXSA 2BUNA 1HNXF 2VPYB 3R5CA 2XY5A 5C25A 5A8WB 2YVSA 4DWIA 3P45B 2MY8A 4EZ9A 2C2KB 4X62J 3HO1A 2Y8WA 2NXCA 4FXWA 2EFPA 1U6FA 2BOPA 2OSQA 3CMES 2CZVC 1IM4A 1TV6A 5DG9A 3LPEA 4CLKA 3PACA 2QGFB 1U26A 5KG6A 1FTCA 1HNWF 1XEZA 3SEOA 3CJQA 5F8MA 1S1UA 1V5IB 3KK3B 4I6WA 3G82B 5J2MA 1C0UA 5KFMA 3TNVA 2Y8YA 1VQLS 3AOCA 4P74A 1UTAA 1HLWA 1Q8BA 2AJQA 4MMOA 2B6AA 1YRTA 3DXSX 3G8SA 4J9NA 4PXDA 2HLUA 4F3OA 5A8KB 3UN2A 3AJ2A 4H54A 3RG6A 1RTHB 2CPEA 3UE2A 4WFAQ 4J91A 2HS0A 3OXFA 2YH0A 2JEFA 3FNNA 3Q0AA 2NQPA 1UVJA 2LYVA 2DXEA 4N77A 3R2DJ 3ZXWA 4LRDA 3N6LA 5IQQA 3DI6B 1A7GE 2QC3A 4HI1A 3NNHA 5E41A 3MPVA 4MJKA 2NZ4A 5KOXA 2L08A 1IR0A 2VBZA 7FD1A 3FMBA 4K4TA 3VHQA 2W8LA 2J9DE 3NCQA 3CW2C 3MTKA 2MGZB 2RKIB 3PJXA 3K5OA 3IR7B 1SJFA 2MZ1A 1N6QA 3W1YC 5BYQA 2YKPA 1NNDA 2BJ3A 4V19J 4F50A 2LQJA 2EXUA 2AYGA 3KLGB 2YKMB 5BXIA 4KYZA 1RT2B 1LQ9A 1HW8A 2W2MP 1X9MA 1U7LA 2D41A 3MM7A 4LRCA 2ZOFA 2K7KA 2WCXA 2JEJA 2FZCB 2OPQA 4RW7A 3JTNA 1IBCB 3ILLA 2NSCA 1RU2A 2J0XA 1FDDA 3BR9A 2EBGA 1CSJA 3MHYA 3TWZA 1TAUA 4HL9A 4DR3F 3DRXA 3KOAA 2FC9A 4ZK7M 1SIWB 2IYIA 1R8HA 3GV7B 1Q1KA 2X1GA 1XC9A 1JJCB 5LXYA 3TAMB 4CTAB 3HJFA 3CJ2A 1X4AA 2RRAA 1N5YA 4ZVFA 1C1BB 5L8RC 3BB5A 1LWCA 5IWAJ 2COLA 4DV5J 2HNZA 4B3OA 4EBEA 2Q3PA 2J7UA 3ITHB 4R8UB 2BV3A 1JLQA 4ILRA 5HMZA 4YR2A 3DXBA 2FJDB 3RB4A 2YWWA 2MMYA 4KIAA 3ZTRA 1Y11A 2CVEA 4C3LA 5LSOA 2BW7A 3MM9B 3AAWB 3PHTA 4QPXA 4DR2J 1RWVB 4K5SA 3A3NB 2KI2A 3P6YC 1E6YB 2ZH9A 1PAUB 4U7CA 1K1SA 5C2GA 2UXCF 1VQ4S 2LQ8A 1N5TA 2HRYA 3M8ZA 5K14B 3ILIA 1SC3B 3N5BA 4DSIA 2HZVA 4C0OC 7AT1B 2MZQA 3UD4P 2K1RA 2FJAB 5AXLA 1QJHA 3M4XA 1WHYA 3G86A 3PYEA 3IBFB 1P9YA 1L3TA 1VRQC 2ZOGA 2OPPA 1NK0A 4PR6A 3EICA 3NBPA 3KLVA 3G6YA 2DNRA 3PRBA 1D9AA 4I7FA 3I0RA 1XK8A 1EQ0A 1UL3A 3M8RA 2HS3A 3DRPA 2MLXA 4LRBA 2ZVIA 3EZUA 3FBBA 1DURA 3FFIB 3HFVA 3PX6A 2ZBPA 3AXMA 3NKYA 3G4SS 5EHHA 1U0HA 1RHJB 3O44A 2ZITA 3R5AA 3K17A 5GMKa 4FKYA 4ER8A 1UKUA 1AUSL 5KT5A 1BQNB 4PG7A 1Q16B 5DGBA 3KG1A 3PG9A 1Q8LA 2QL7B 3HKZD 3CF5Q 2ZM6J 5C24A 1NJYA 1TAQA 2V0NA 3CCMS 4Q0BA 2DIVA 1WSRA 2R42A 3R5GA 3V6JA 2OIHA 2CWXA 3NOGA 5DQIA 2OTLS 3TVZA 1NSQA 1NSKL 4ZVTB 1XQIA 4YFUA 4NA2A 2GVDB 2JHEA 2XO6A 4EWTA 2NLWA 3CJ4A 1DARA 4KO0B 4G1QB 1TK8A 3I56S 2Y1RI 2IMOA 5GMDA 2HFSA 2OSRA 4N7TA 5DDQC 3DGPA 2YQ0A 1RCOB 1GT8A 3AOAA 4CLTA 1EP4B 4A8KA 2HHPA 1X8DA 2YKNB 4I0WA 2ACMA 5I42A 2R2TA 1HW9A 4F0HA 4GKJJ 3MECA 4OYZA 1ZS6A 2F8HA 4E2FB 5C5JA 1C2PA 1UVKA 1ZM4A 4URSA 2QN6B 4N41A 3PW5A 4OLPA 2CPZA 3BKTA 4JV5J 3GV5B 3W5XA 5C2CA 1XNQF 2HVDA 4PWDB 4YDDB 5KFUA 5J2PB 3GYXB 2GIFA 4Q43A 3GFYA 3CJKB 5IS2A 3UPFA 3NGKA 4RW8B 1RTJA 3R27A 4ZPDA 2GC8A 1MMDA 1KQGB 3ULHA 1H2TZ 3I31A 4NYOA 2VB6A 2DBBA 1SH0A 2LVWA 1TL3A 2MTLA 1SQEA 3CJ5A 2GQ2A 3PRVA 4ZS6A 1T9TA 4OYXA 2G1HA 2AV5A 1HNIA 3FDSA 2OEJA 2PO4A 1LWXA 3M32B 1Y5LB 1XNRJ 2A18A 1W7WA 4ZCIA 2FY1A 1HR0J 1NH7A 3H25A 3ZZRA 5L1LA 1GAOA 3QNWB 4AL6A 2BQRA 4WFXA 4ZA1A 3MURP 2CAJA 3UN3A 1FI4A 4HT5A 1YKWA 4RU9A 5D4LA 4TQSA 5ITHA 2LA4A 3UN5A 2XYPB 4FF3A 4B9UA 4C11A 4JI4F 5EWEA 1R89A 3NAHA 5KFGA 2EVZA 4WP3A 2FVSA 5ETTA 1H6KX 2K3KA 2C3PA 5KFYA 2X1AA 3L3CA 1GX6A 2UUAF 1SB6A 3OFGA 2DEJA 1KHVA 4OZ2A 2I9SA 4EYIB 2Z2MA 1D3WA 2F8EX 4NXNF 1AZSB 5HJYA 3ZTPA 1NM2A 4B9LA 2FD2A 1OYEA 2R9LA 3DLEA 5HQMA 2OUGA 1LW2B 2XLJA 2QMWA 5KG2A 1DTTA 2PI5A 4KV8B 5D0GA 1RA6A 4DG1B 4JBCA 4U6PA 3PKMA 3UVJB 2GGPB 2X1BA 4RJVA 2BMBA 1VJWA 1BQMB 2XY6A 2UVWA 4ERDA 2RE1A 1CBKA 1HQUA 3EYZA 2XEXA 1FKOB 3OHBA 2DNGA 2L9DA 3WBZA 2RQKA 2CQIA 3ENWA 3RAMA 2N3LA 3C8YA 3CDWA 2ATLA 2JJ4D 1KNZA 1FK9B 2AYBA 2JZ5A 1PBUA 3TW0A 1HNZJ 5I3UA 3DMJA 4LF5F 3BPSP 1R0AB 5ETOA 1H72C 2W4DA 2ZE2A 1RAHB 3B78A 2MKHA 1RI7A 1DLOB 2CQDA 1DRZA 4A48A 1JJ4A 3HVTB 1KVIA 2XTJP 1K1QA 4WFYA 1NK9A 1KTVA 1OQ3A 1XR7A 1KOHA 3HMJG 2JRSA 1TTHB 5KFKA 1LKZA 2OJ3A 2B9XA 4AFFA 1NJIT 4OJHA 3H40A 2MHNA 1CJKA 1GMWD 3CDBA 2ZKTA 1J5OA 1NKCA 3HSGA 4DV4J 2QSWA 4LSNA 4B9SA 4ZJQA 2R7OA 4UOCA 1DTQA 5KFJA 2MJNA 3IP0A 1ZETA 4TQRA 3PX0A 2Q1LA 2ZKUA 2MLZA 4IUFA 5CQGA 3M2UA 1NDKA 2DHHA 1FE0A 3HT3A 3RRHA 4FBTA 2WSCC 1KVKA 1RWPB 2W9CB 4RUHA 2GHPA 4E98A 5LMUJ 1WEYA 2LXUA 1VQ7S 4Q2MA 1RQ0A 1Z4UA 3KLEA 3NS6A 3HZGA 3FCHA 1QUPA 3QZ8A 4BDPA 2WBRA 4XDDA 1SVDA 3DDKA 1ICEB 3VAHA 1MLAA 4HKQA 4F04B 1EHWA 2E5LJ 5AXKA 3LP2A 1RAGB 2QYCA 2JH3A 1HQEB 4PQUB 1U49A 4M5NA 1HL6A 3IS9B 2OMLA 2VICA 2QG9B 1TVRA 2HHXA 3T1YF 2RS8A 3MMBB 3CD6S 5IT9Y 3S7RA 3LA0A 2BRKA 1ZOTA 2KXHA 3GWCA 2EG1A 5B0GA 4KY3A 1TL7A 4K4WA 3QAEA 3H42A 2V50A 2J8SA 5FLXU 3Q24A 2QEXS 4NX9A 1ZZFA 4ZCKA 2DITA 3W3SA 4Z2XA 4ZPCA 2CNKB 1SIZA 3D28A 2XS7A 3ISZA 1VISA 2ZH4A 3FBEA 1RWMB 2GHVC 2NXJA 4G3IA 4BC9A 3FSXA 4IOCQ 4FXVA 3G6ES 2V5HG 4AE5A 2DNNA 3CWJA 5FDLB 5HMYA 3AY0A 1V3SA 1UWAA 2DT9A 5HQLA 4DLEA 3C19A 1OIAA 5F8LA 3K57A 1HQ2A 1FEEA 1SJ3P 2D1CA 2OEMA 5KFZA 2CPFA 4R5PA 1TU0B 3JQMA 4XAKA 3PEHA 2W8KA 4OZ0A 2EEYA 1JLEA 2HLTA 3QGGA 2XC9A 2QFIA 2JVRA 1S1XA 3O2IA 1JK9B 3MD3A 1XMQJ 4WTYA 3BO3A 3KFWX 1AW0A 1NRKA 3KHGA 4ZP8A 4OHYA 2QLJB 3NGUA 1KVJA 2BA9A 5HK4A 5CA5A 3M9OB 4QW8A 1MG7A 2R8IA 3W9IA 3CJ0A 2UVUA 1E6VB 2AJ4A 3H90A 2E1AA 1MU2A 2K7JA 3DOKA 1RT7B 4PWUA 4YHHJ 5IV3A 2B7CB 4V19X 1DQ9A 4FPIA 3DGVA 1N32F 3UCGA 2XGPA 4DX8H 2J9CA 4RNOA 2DRAA 4RL1A 5H9FK 5BYRA 3HPOA 2GQCA 2VQFJ 2XB2D 2VFRA 5HN0A 2BRLA 3JTOA 2EBEA 1MROB 4PCQA 4DR6F 1XJWB 3PV8A 2J0SD 4JI5F 2VG6A 2E5JA 4QWAA 3H5XA 2HBRB 2N7YA 2E66A 5AJ3J 1ELOA 2LQ5A 3TOQA 4F4XA 3C66A 3KNGA 4WIIA 2VV5A 3MAAA 4DU8A 4A8OA 1AB8A 3WIUA 2VA3A 1RAOA 3BGLA 3QO9B 3Q2TC 3HFZB 3RBZA 3OSNA 1V9OA 1N33J 2J9EA 4ZIVA 1ZH5A 1ZTWA 2YNHA 3H8YA 1XMBA 4WFNQ 2OD4A 4GVLA 5D8HB 1ZA2B 1S6QB 2HIYA 3FEXB 4O3OA 3MM8A 4LBHA 4FYVB 3R5JB 3P4UB 1RDRA 1LWFB 5B7WA 4QU7A 4A4JA 4KGKA 2HK3A 2OLWA 1QAJA 4NLTA 2UUTA 2AGPA 2R2SA 4IH5A 2LDYA 5MAOA 3RU0A 3D3CJ 1T9YA 1WI8A 4DN9A 4K4YA 4J9SA 2DRBA 2FJWA 1VC5A 4Q45A 2ZVSA 3FRYA 3SQOP 5SUHA 2PI4A 1S1TB 2PE8A 5B0CA 2BDPA 2LECA 2HFOA 2OPRA 2YX7A 1KDNA 2IM1A 1Q8IA 4USIA 3DHXA 3FC9A 4C8KA 1EKSA 3OR2B 4IDKB 4LF4J 2Z2YB 2AP6A 2UXBJ 2B5JA 3ZO7A 4OZLA 3GJTB 3RJMB 2VIHA 3MR3A 4WYLA 4X4RA 2FLOA 2JLGA 4J9RA 3SQGB 5F8JA 2F40A 3M7VA 1WUUA 1OSCA 2WVCA 2HVEA 3W2WB 4XDCA 1D9FA 1OQ6A 5HMWA 1TKZB 4W92B 2BKOA 1LW0B 3CC7S 3HP6A 1FKPB 1KEKA 1IBMJ 2N3OA 2GMHA 3RRGA 1U4BA 1HYSA 4ZDNA 4KHPJ 3TJ9A 2KRBA 4EEYA 1JB0C 4UW2A 4K4UA 2CG4A 3V2UC 3AD8C 1TKXB 5H1SV 3LTOA 3TZYA 2DHXA 3UQSA 1L3KA 1DFDA 1EQMA 4IRDA 4J9MA 1YIJS 2RSQA 2AJ2A 4USKA 1P6TA 1T94A 2HNDB 4EI2A 1TKTB 1ZYQA 4Y0FA 1H2UX 5IWAF 3RZAA 3D6HB 1UEVA 4KT0C 3PW7A 2W2OP 4RU2A 4YP3A 4ES1A 5CCMA 4ZPVR 1S9EB 5F9LA 4F3MA 1QY7A 2I0XA 2WW4A 5CXTA 4NLPA 3MM5A 4N76A 1R43A 3D6FB 1B7YB 1X4DA 4DR2F 5C25B 3CD7A 2W25A 1SPBP 4U8VA 3QMQA 2NR0A 1KC8T 2L9NA 1U8SA 2BE9B 1KQKA 4ZVUB 5L1IA 1RWUA 4WWSA 1RKJA 3D1OA 1X5SA 3BQ1A 3PYDA 2GW8A 5CYMB 1RT3A 1UVIA 2HWIA 2YWKA 1TV6B 3CCWA 5A76A 3C6UA 2C28A 1LEOA 1N0VC 4J9OA 2WSEC 1GXUA 1U0SA 2CJAA 4I1TA 2FGCA 3ADAC 1Z1ZA 2QYGA 2M8HA 3E8OA 3VF0B 3FCWA 2IRXA 5J2MB 2HW3A 1C0UB 4LVOP 2HBQB 3G82A 2HIQA 4LQ3A 1ZTTA 4LFBF 2AJ0A 4JI7J 1SL2A 2HFUA 3ET6B 4USVA 1N56A 3T5KA 2AQ4A 4JP8A 4O0NA 2PC6A 2GFFA 3LGHA 3RBDA 1JMTA 2YKOA 2B6AB 3GCWP 2MJUA 3N01A 4KAIA 5EX3A 3LP1A 4PKDB 3GG0A 3UDLA 3Q8QB 1M5KC 2EFNA 3NG8A 5A8KA 2IM0A 5HANA 4MIWA 2VZ9A 2DCUB 4F67A 4DF4A 1Q5VA 2ZM6F 3H5SA 3CUNA 2A3JA 2RJZA 2HMIB 4K4VA 5HATA 1EX8A 2I8EA 3HVAA 2XS2A 5ETRA 3DRRA 2QJ3A 5A6WA 2Y0BB 1BWEA 1ZAVA 4G1IA 3G8TA 1QTNB 2HRTA 1LOUA 1YZ6A 5DM6Q 1PKUA 4DV2F 4UOGA 3U7JA 4PG5A 4ELTA 1LV5A 1CC7A 4LSLA 2OMOA 4C3KA 3CO9A 3DU5A 4IFYA 3LANA 5BYSA 1RWKB 2HHQA 2QA4G 1SKSA 3EVWA 4NRUA 1IUJA 4H4MA 3OVAA 2Z0GA 4M5GA 1OJ4A 4DR7J 2V4JA 1NB2A 1N6QB 3BGFA 5KT2A 1GFWB 5HMXA 3GCXP 4GKJF 4MK7A 5H9FJ 2YKMA 3BBFA 4JYAJ 2GZOA 3DC2A 1RT2A 3ISND 3MM7B 1M5SA 5HO4A 4RBTA 2OPQB 1IQTA 4DL7A 4JV5F 2YXLA 1FF2A 6FDRA 4F2SA 1NJXA 4URQU 2B9WA 2EK6A 2V8HA 1OY8A 1UVMA 3KG4A 1YITS 3LO3A 4PYDA 2ZH1A 3FVYA 4X4SA 2RRNA 4B3TF 1YLXA 2FJBB 1N5YB 2CJYB 3IBWA 3NCPA 1Y5NB 3T5HA 2UUCF 4MYUA 4DDFA 4KR0B 2G2YA 3HHDA 1LWCB 1C1BA 5F41A 3J80U 1RT4A 2ZZTA 5L9XA 2ZEJA 1FERA 2HNZB 3DRSB 2MEWA 4TU9A 4JUZA 1YJVA 1RYRA 3B82A 1JLQB 2KZMA 4KPYA 2HQIA 2L48A 4UY85 2VDHA 1U1NA 2DGQA 4K50A 2V2QA 2PMHA 3S01A 1XNRF 4OYIA 3LW5C 3N79A 1VBXA 1HR0F 4Y2AA 3MM9A 3GFZA 3IWXA 3M8QA 3LALA 2FGOA 1K8AT 1SKRA 4NLQA 4Q44A 1RLDA 2V6AA 4LFCF 4F4KA 1OPIA 1YDLA 4PABA 2UV8A 2ZBQA 2VONA 1TR0A 2H65B 5K9FA 4DPXA 5I3QA 1SQFA 1BY9A 2F7VA 2VFVA 4IOAQ 2R8HA 4Y34A 1IKYA 2OPPB 1RHMB 3Q8SB 5T7LA 1S77D 3L4BC 2RAQA 2KDOA 3M6XA 3R7SB 5B0EA 1PYOB 4I7FB 5DS7A 4TKTA 3NNAA 2HHHF 4WE1A 4DL3A 3DRPB 5C7PA 2A6MA 3X3UA 4WU2A 4USUA 4C0HA 3R5DA 1Y00A 3KUHA 5L1KA 3D6MB 3FFIA 2PGCA 4NLDA 4QR2A 4ENOA 4QR0A 4O4RA 2CUYA 3G2XA 1VQYA 2LU1A 3QGPA 3R7NB 1FDNA 4KHRA 4PUOA 2Y1JA 1FRJA 3VAGA 3HHNB 1DJ0A 1I5OB 2GV1A 2L41A 2M2BA 3TI0A 2F4VJ 4F4YA 4Q0BB 2BXJA 1FRLA 4X4QA 3KK1A 4HH0A 4O44B 2HFNA 4KGZB 3G6VA 1J5EJ 1YJUA 4TY8A 5HLFB 3KWMA 1HI8A 3GMGA 4WKYA 4M5HA 3HM9A 3IGVA 5C42B 2UXDJ 1Q78A 2GVDA 1HNZF 2XYHB 1NB7A 3WQPA 4ED1A 1C4CA 3O3LA 1S4EA 2VPWB 3W60A 3DLHA 2R4FA 4YOEA 1KRPA 2LFVA 2PN6A 3SSSA 2IC3B 4FS1A 5I42B 1VK8A 1VQNS 1R0CB 3HHLD 1HWIA 2FQQB 1Q8KA 4HI2A 4F36A 1WC3A 4X4TA 3D66A 3R6GB 4X2BA 1F3VA 3RB6A 4A8FA 2J5AA 4C0BA 1WG1A 5T14A 1J27A 3TAQA 4UZBA 2Z8QA 5L38A 4DX5A 4YDXA 3IM8A 1HHQA 2JNJA 2BKNA 3SV4A 1PC4A 1RTJB 1A0OB 4CM0A 3PXGa 2AGQA 4OLOA 2Z4PA 2LU2A 2YWHA 1PJ5A 3IWNC 1LNQA 3SSRA 3CT9A 1X4EA 3EGVA 1TL3B 3IM9A 1VQMS 3N6NA 4OZ5A 4QIEA 4PWWA 3V6KA 3J81U 1M1GA 3MR6A 2XWYA 2KHDA 1UA0A 4U67Q 3MF5A 1UPPA 4Y65A 3HF5A 1RJJA 5E3AA 3GSIA 4GMKA 3TAPA 2DR6A 2VBYA 4KSEB 4I2QA 2VBWA 4JV1A 2PFFB 1KOOA 2ZH7A 1MWQA 4MIBA 3EGNA 3GIJA 3UD3P 4LF1A 4P73A 1SUQA 1HBNA 1IR2A 4XO0A 4DL4A 1IBKF 4RW4A 3ZZYA 4DI6A 2DHSA 1YJRA 3L95X 1LFPA 4ZPWR 2Y0SD 2W24A 5GADI 4DU7A 2E5IA 3DDIA 2J7KA 2DGVA 1K0VA 2CDRB 4X66F 1TK0A 1TFWA 3HCXA 4NXMF 2E7XA 2XULA 4FBUA 3OFFA 3W5YA 4WK3A 2IAJA 4DS4A 3GE9A 5KFEA 2HS4A 3IGNA 4ZVOB 4Y2KA 3ENQA 4LREA 2JVOA 2B43A 1Q0NA 2KVQE 1PCAA 1CEZA 1CVJA 5GAHI 5THWA 3QT8A 2VC1A 4WK1A 3LWMA 3DLEB 3AB4B 3JAMU 3RGIA 2YKQA 4U8YA 4P2FA 1FDBA 1ZM2A 1RHRB 3H59A 4PRFA 8ATCB 1LW2A 3UR3C 1JLFB 1RBLA 2YQ1A 2YNGA 1N36J 3MXHP 2ZUGA 5J1EB 1ZPWX 3TJAA 4B9MA 5CHCB 4NLVA 1WEZA 4G1PA 4RUCA 1S9FA 1FFGB 1VHFA 2XMAA 3CIMA 2R7RA 3H2LA 5KG1A 4J9KA 2X51A 4F0KA 2KZZA 5L1JA 5D6GA 5KFXA 5K8OA 4KB7A 4DZDA 2RT3A 4GO5X 2WZ1A 2ZHBA 1NXIA 3HHKA 5FLXY 1X4HA 1FK9A 5I3UB 1WG5A 3DMJB 1V3RA 4I2PB 4QIFA 5LMNF 2GO9A 2KH9A 2ZE2B 3GU0A 4B3MF 3RTVA 3GIKA 3OTCA 4K4ZA 1NSPA 4H4OA 3V6DA 4OIXA 1TUWA 3JQJA 4DCJB 1DLOA 2LMIA 1KR4A 3NAIA 4USWA 3RB0A 3H98A 1QLNA 5ETQA 2XHWA 4YHHF 2HEKA 1PO6A 1P1TA 3CD5A 2MKJA 2C2ZB 4NCGA 4ZPAA 2HG4A 1FE4A 2PA8D 5AT1B 1HWLA 2VQFF 2PSZA 2HVZA 1J5OB 3U02A 4LSNB 3BREA 1WKLA 4OI3A 2CQGA 3R5BA 2LEAA 3RUBL 2B4VA 2ZC3A 2I6WA 4KGMA 1KN6A 4OX9J 5AJ3F 2P9EA 4DJBA 3M2UB 3J81j 3JSBA 3D2WA 3DN9A 1W2IA 2HK2A 2D9PA 2V9KA 3DFEA 2KT3A 3HLUA 1N33F 1HWUA 3OD2A 3IC1A 5D78A 2B56A 1N8RT 3PO4A 3OT9A 2ERRA 3CGIA 2U1AA 5G0RA 1Q86T 2W4PA 3ZTSA 1FNOA 2NUUG 4JI0J 3HJVA 1YG0A 1WD6A 2R3VA 2H54B 1FJ7A 1RTDA 1JJHA 3LP2B 1R6YA 4ZVQB 2RQ4A 2VKRA 2R2UA 1HQEA 4NL5A 1PILA 1U1RA 3DLJA 3X1LB 1HIYA 2NYHA 4KTQA 5KFVA 2HWHA 5EGYA 3HD1A 2MQNA 4NEYA 1OS5A 1G4CA 3BN7A 1TK5A 4OYAA 2OP5A 2X3GA 2JL9A 3VQSA 4K2JA 3CDEA 3IAM9 1TL7B 1Y0HA 2GMLA 2Q6CA 3GG1A 3NRBA 5A2QY 1AROP 2XSJA 3CD0A 2IVMA 4CYUA 3HI9A 4LF4F 4ZP6A 4NPOA 3KLFB 3SIPB 3OXLA 1FESA 2H4WB 2IVFB 2ALYB 4L72B 5BR8F 4PXBA 3VAIA 1IXKA 2N7CA 4X4PA 1P9QC 3TX8A 4X84A 4QOTA 4A47A 2B4OA 2HKEA 3CCSS 2E1CA 4DSJA 5KG7A 2OGUA 3A1YG 3NGRA 3F56A 1PYTA 3NLCA 2V8VA 3TEGA 4M63A 1VC6A 2R7QA 3KJVA 3WHIA 3ZZUA 1TL5A 2CQ0A 3BEGB 1FJGJ 4DOZA 3CC2S 1P8GA 4R5PB 4UOFA 4B3SJ 3JXOA 4HDHA 1JLEB 5KTQA 1S1XB 5DM7Q 2BW2A 5KFDA 1Z2ZA 2GIRA 4P2XA 3OV7A 1NPKA 1H3DA 1VI7A 2FDNA 4ZJOA 1JNZB 1R27B 3UO0A 4OX6A 5D3GA 2M52A 2HAIA 1R0BG 4BWJA 1NHKL 4NLWA 4XTTA 1FXDA 1RTIA 2DJWA 3HSJA 4LRFA 2J7WA 1X4FA 4TVAB 4L76A 3MAHA 2PA3A 1K73T 4YUDA 2A0FB 1SC6A 2AEFA 3GFXA 1HBMA 1RGVA 3J7YI 4Y2MA 3IR6B 4ED2A 1UVNA 1VR6A 1WHVA 4LJMA 1T9XA 2BJ9A 3CVKA 2G0IA 4E8UA 2VG6B 3QSIA 5FJ4A 3LAKA 3C6TA 4QWDA 2O66A 5KT3A 3LF0A 2RHQB 3F0NA 1VBYA 1YZ7A 2BM1A 3MAAB 2NXUA 4ZOSA 4RNMA 2OHDA 3FSIA 5CH7B 1TP7A 3EDRB 2O01C 2LEBA 3QO9A 1YK9A 4PXEA 1GTHA 2XZTB 2YNHB 1D0EA 2KFNA 2ZFHA 3GIRA 5D0HA 5CABA 4CNZA 3VALA 5KFBA 2IHR1 5KFAA 1T9UA 3MM8B 3IMQJ 2HHSA 4ECUA 4LBIA 1JLCA 1X31C 1Q79A 1WSVA 4CIOA 3QWUA 5HP1A 3MEDA 2YPYA 1O0PA 3CCJS 1U45A 1I94J 3I0SA 1NKEA 1WC6A 2W2QP 4LFAJ 1UFWA 1Y9OA 1NDPA 3UI3A 2AEMA 1UPMB 1RWXB 1IKVA 1S1VB 1KQFB 2OPRB 1S1TA 4CLPA 2ADCA 2IY5B 5D4OA 1YJNS 3MR5A 2OPSA 4EUVA 1G7CB 3OFHA 3MMCA 5GADU 3MUVP 1B64A 2XLKA 4DR5J 2M7SA 2B5JB 5K8PA 3OR2A 2DB1A 2CPIA 4M1KA 2IFXA 4NLUA 4ZVPB 4WZMA 4JI2F 4B08A 4Z7CA 2MSSA 3ENVA 3G96A 4U7UD 2B8QA 4G6VB 4DR7F 1PJ6A 2IA0A 1NZAA 4O3SA 2P8IA 3NL0A 5GAGI 4OJ3A 3K5MA 1HWJA 4LF8F 4DV3J 3CJ8A 5BJRA 2ZNYA 1CJTA 2KB2A 3CJRA 1S0OA 4O3RA 4YQWA 1XR5A 4IFVA 4DX6A 2M4MA 5B0BA 3CNQP 1HYSB 4MK8A 5GAHU 2I5JA 3K8WA 1K0TA 1F1BB 2VBXA 3QBCA 4MKAA 1T02A 1U1PA 2E1PA 1YWXA 1URNA 3IO1A 2PFDA 2DPIA 2C3OA 2AT1B 1C0TA 3MWBA 2G2ZA 2IDEA 2DNPA 5HSPA 2ZBCA 3CPWR 2JFKA 4EGLA 3BS9A 3SDEA 2C2NA 2FHJA 3GZ7A 1SCJB 3H0PA 4J90A 1ZBTA 8AT1B 1N5VA 5DG7A 3UNGC 5KFOA 2E7VA 2VC0A 3A8IA 4LF7J 3QIDA 1Y5IB 4DPWA 2KVIA 1ZZNA 4CO3A 1FJEB 3VAKA 1HI1A 3OUYA 2B4PA 2BM0A 3HHEA 1QAYA 4UOHA 3DU6A 2YY3A 1ULRA 4MH8A 3I5CA 3KTQA 3MM5B 1F0XA 4NRTA 3K59A 2NXNA 1T9WA 1EKRA 5IC4B 1OYDA 3MPDA 2G9OA 5JJBA 5HAOA 3VWSA 4B02A 6AT1B 2QA4S 5KG4A 1YJTA 5AE1A 1RT3B 3SCIE 4DCPB 2GS8A 3CDUA 4J37A 3C6UB 5CYMA 1R8BA 3OR1B 3CB4A 5M2UA 1S99A 2AW0A 3IBCB 5I3PA 2CPDA 1M1HA 4CP5A 3CC4S 4NLOA 3E01A 1HNWJ 2MHEA 2AZ1A 2OAUA 2N82B 2WOMA 2RMLA 3EZ5A 2QZ8A 3EMTA 4CLUA 1WWHA 2J9DA 2WW8A 1TZ0A 3ET6A 4H4KC 2AGOA 3LP1B 3VV2B 4MTPA 3CCRS 4NZ6A 5E0OA 1QDUB 2QO3A 1URRA 2ATCB 1KONA 3C14A 2OFHX 3HSZA 2AKWB 4DEZA 3K89A 4ES3A 2F4VF 4MT1A 5F8IA 1RBOB 2C42A 2UUWA 2HMIA 4LR9A 4IR1A 3DRRB 2BOAA 1WACA 2BJEA 4ZCLA 1UVLA 1XERA 1IKXA 4X4UA 4RW6A 3B6BA 3PDNA 1NBEB 1FNXH 2UXDF 1S0NA 3B4MA 2YKAA 1F9FA 1XMOF 3SFUA 4LSLB 3R1LA 4B3RF 1FJCA 2BJ1A 4IFYB 2CQ1A 3LAMA 4ATNA 4DQRA 3OVSA 3LWLA 4H4MB 3TA2A 2V4JB 5DQGA 1EJ7L 4CLFA 1H0HB 1I51B 3I32A 3FZBA 5E7OB 4HHHA 4K2XA 2Y9HA 1FHTA 4ZHRB 2RS2A 4CQ1A 3CCTA 1XR6A 4U9RA 4EK2A 2C1EB 3IXQA 1CPZA 3F44A 2NCKL 4OJ1A 1X5OA 4K8RA 4ZPTR 3R8YA 2E1RA 1N4LA 4P10A 3OW2R 2DNKA 3ZTOA 3FQLA 5EWFA 4FNIA 3ZTQA 1H73A 1S49A 1WJ9A 4K5RA 1NZ8A 1F6TA 2K3IA 2W7AA 2BBEA 4ICLA 3IWLA 5M2RA 1RT4B 2NSBA 2ILZA 3N6MA 3VAJA 3R9LA 1GMVA 1Q81T 4YMEA 4IG3B 3DRSA 4OQJA 3D0HE 5CZXA 2K06A 2XMMA 2LXFA 2FJVA 1JLGA 4JI1J 3D5MA 3D4JA 4RNHA 4NWBA 5HROB 2A1BA 4C9DA 3M8QB 4ETZA 1PSDA 1WG4A 2GX8A 4DX7A 4RZRA 1OWXA 3I87A 4HVZA 5AXMA 4EMDA 3BF4A 2UXCJ 4OI4A 2WK4A 3TX0A 4GC6A 1SL0A 3SCKE 2M9KA 5KFTA 3WIVA 1OSDA 5LJ3Y 2IYGA 4RWWA 2Q43A 1GH8A 2PIIA 1IKYB 1XIQA 1D8ZA 5T7LB 3J7YU 3W7BA 2WB4A 2D9OA 3J81Y 2IBKA 3UDCA 3EE3A 1SBRA 3ELHA 4WE1B 1SV5A 3U1LA 4DR1F 1RXOB 2OH2A 1APSA 2GJ2A 1FX4A 4WBFA 4NZ0A 4DBQA 1R8CA 3G6XA 1RADB 3BBCA 3PNIA 2XI3A 2HGMA 1PC5A 1R8AA 2ZBRA 2KTQA 4FYXB 4Z7YA 2H5EA 5H9EK 1FFWB 1GQEA 4PUOB 1SC4B 3H20A 3P49B 1HNVA 1M0SA 3BSCA 3D1HA 3POTA 3HK2A 1IJEB 4Y2CA 2P6SA 2VG7A 2H4YB 3UDEA 5J1PA 2YH1A 4QWBA 3IN5A 3KK1B 4IO1A 4TLQA 3TQ1A 2X3DA 2HBYB 4O44A 4TY8B 1RZMA 2DR5A 2ZJQQ 2HPUA 4OYBA 1SJ4P 3D9BA 2O1PA 2ROEA 4FDFA 3TUJC 5J2QA 5HLFA 3FJ2A 3OL9A 4A8QA 3GILA 5C42A 2FZGB 1JKHB 2DO0A 3AFGA 1UCNA 5KG3A 2LCWA 5KT7A 2R7XA 2LQ9A 1DQAA 1X7VA 4AYBD 2R7VA 2HAFA 3JAMY 2CQBA 4IG0A 1UWBA 2CQ4A 5ETMA 2IC3A 2VPXB 4LBPA 2HZAA 2FIUA 3D0IE 2GJIA 1S7HA 3Q2SC 2EG2A 1BE4A 2G13A 2FHKA 3RR8A 2VFUA 1OY6A 4FF1A 2PMWA 3TYTA 1VQ6S 5GAGU 2WVBA 2HWTA 4DL2A 1SL1A 3T3FA 2ASDA 2XMUA 3N4WA 4ED7A 4ZITA 1WTBA 2HQCA 4CO4A 5F8HA 5L46A 4Y3CA 1T11A 3GP9A 4DMZA 2HQFA 5E33A 4OL8A 1G3OA 4CNYA 2MXYA 2M70A 4HTIA 4ES2A 2Z2LA 2GIQA 4AQYF 1SQGA 2HHVA 4YR3A 4C7QA 4I2QB 4KFBA 1X60A 3QFHA 4WP9A 4C8MA 3QAUA 2BZ2A 3RBEA 1SUQB 4LR8A 1HBNB 5JVGQ 2H48B 3MPUB 1BQXA 3MZIA 4RW4B 2P5VA 1S4FA 3JS9A 5AXNA 2ABYA 1S1WA 5KFNA 1D9DA 4AXIA 2E9TA 3KLIB 3MEKA 4N47A 5DDPC 3GYNA 3J7A1 2DR8A 4YN3B 4YY3J 1I3OB 3MCSA 4JI4J 4M5LA 3OXGA 4IO9Q 3O8WA 5B08A 2J6TA 2LA6A 2H5JB 3DLKB 4DQSA 1FA0A 4UT4A 2IAJB 5JUMA 4OYPA 4DFMA 2KL8A 4QR1A 3GONA 3DLBA 1CULA 1IN0A 1R31A 2IRYA 1BWVA 1VRTB 1V3ZA 9RUBA 2RU3A 4WU3A 5EWGA 1CC8A 2AX1A 2I38A 2JWNA 1U2FA 2KYXA 3Q86A 2RVJA 3THVA 1WORA 4CLYA 2W4CA 2Q6BA 1UA1A 2YPZA 2KKHA 2EKYA 3T1HF 4CT8A 2XQCA 3QATA 1U1MA 3ILOA 2DIUA 2YNGB 1JLFA 4DPTA 4M5JA 2IBOA 2V34A 1HMVB 3RW6A 1TL4A 2ZBIA 5J1EA 2B9EA 5LJ5Y 2XNQA 1NEEA 4C2MA 3PJWA 2LQBA 2CJ9A 3L7UA 3O5TB 4ZLJA 1YJ9S 4DR4F 1KFSA 2QE5A 1A9NB 1BLUA 2IMWP 5GVQA 2DR9A 2UZAA 4X65J 2MZSA 2DGOA 3OTEA 4I2PA 5CYQA 2PEBA 4CO0A 4OV1A 2HGNA 1LK5A 2LDIA 4H4OB 3V6DB 3CCUS 4DLGA 2IVYA 4MFBA 4WFZA 2XMTA 4DV1J 2UU9F 4DV0F 1HPZB 4C6AA 3RAQA 1SJQA 4LF6J 4NCGB 2CA9A 1M1KT 4AL7A 4OZJA 1RP5A 4J5OA 5DQHA 1IJFB 2A2DA 4WJBA 3T9NA 1VDHA 3EGZA 3G71S 3K7RA 4BLGA 4ILMA 4DQPA 1NJZA 4MIAA 2UUBJ 2XMJA 1GMWA 3NWGA 4HHUA 2YWGA 4ITSA 3JSMA 4M94A 5AE2A 4FKXA 2BE2B 2VODA 2QX0A 3KXDA 4RUAA 3N28A 3TO8A 2YNFA 1REGX 3IR5B 1X5TA 2K2PA 3B4DA 3BV8A 2BQUA 3D1QA 2C2EA 3P96A 4OHZA 5H9EJ 4OHVA 3SYZA 5G0RB 4X64J 1RT1A 2D69A 2D3O1 1WI6A 5RUBA 1GTEA 5HVHA 2MQMA 3RW7A 1NLKL 1VQSA 2V4RA 1U1OA 1FD2A 4FVMA 1F60B 1RTDB 1PIEA 2QRRA 1WOSA 4ECYA 5EUHA 3KHHA 1ZM3A 1EARA 2FVCA 1WC0A 3T41A 2FJXA 5IV4A 3EXCX 2BX6A 1WF0A 3OFEA 5HI7A 2WBMA 2ILYA 1W2BR 1I94F 1TQLA 2J76E 5LL6d 3GPAA 1B70B 1Q4RA 3VR1A 2EPIA 2MDAA 1FWLA 3AJ1A 4YB1P 1S76D 2L3MA 1X0PA 4DSEA 1KSPA 2HNYA 3FKBA 2XSJB 3W9JA 1ZAWA 4CYUB 4EO8A 4WXWA 3HT0A 4R0EA 1PAEX 3QJLA 3LGMA 1UJ6A 4DR5F 4N8OA 2BVZA 1RA7A 3ZFVA 4NOHA 1VQPS 1B0PA 3KLFA 3W66A 4J9LA 4QW9A 5ETPA 4ETXA 3SSQA 1MW7A 2M88A 5B0AA 5D77A 5IM0A 2RF2B 3ZZ0A 1N0UA 3OHAA 3DLGB 4YEAA 3GTYX 1AXQA 2XO7A 4F25A 4PPDA 1F9EB 3KJVB 1LK7A 2VPZB 4OHXA 3PR5B 2AEJA 3FRZA 1FVQA 3ETMA 1RWWB 4Y6IA 1VQKS 1GEHA 2D3ZA 4I67A 1Z2LA 2V67A 3NS5A 3EX7B 1U1LA 1VMBA 1TL1B 2C2DA 3HFKA 2O5DA 2ZH8A 4DCOB 1WOOA 2QA2A 2XMVA 2CPHA 5D3GB 4P52A 4DUYJ 1SJRA 1HA1A 4U95A 5L39A 4UUXA 1RTIB 4ECRA 3OL7A 1QE1B 1JLAA 2F9DA 4WXOA 4Z37A 3HULA 1MWZA 2CNOB 2VQEF 5G4DA 3SI8A 1HBMB 1YRXA 2FVRA 1N32J 1BHNA 5DJBA 2F63A 3AODA 3A8JA 1VJQA 3KDNA 3WZ0A 4NI2B 2E5GA 4L74A 1RLCL 1NH8A 4RX6A 4DR6J 3T19A 5E3RA 4X62F 3B8HA 3C6TB 3LOUA 4JI5J 1HARA 4JV0A 2VU5A 2DK2A 1UAWA 2FUG9 3LPYA 1CJVA 5DG8A 2FC8A 4GKKJ 3DOLA 4NCBA 1IR1A 1H74A 4RNNA 3MOJB 2GVZA 1QAIA 4GVBA 3FEYB 3MTJA 3PHEA 3E51A 2CJBA 3D54A 4YB6A 1B7FA 1WC4A 3N0VA 3GJRB 2DGWA 2SXLA 3Q83A 4Q2LA 3BKUA 3BPDA 5F3ZA 4UZCA 4MK9A 1KLMB 1R3NA 3QJPA 1JLCB 4IKAA 3DM2A 4WIQA 4ZP9A 2OI2A 3TRGA 4CO5A 4ANEA 3OL6A 2AWZA 4C48A 3C16A 4P7VA 2MZRA 1KLNA 1IBLJ 3RRKA 5KG0A 5HP1B 3MEDB 2IM3A 2DY1A 1HBUB 1CQNA 3I0SB 4RR5A 4FNHA 5KFIA 3FBFA 4HT7A 2R7WA 2FLNA 3AA9A 2ROPA 1IKVB 2MB0B 1OO0B 3CCZA 2CWKA 2YBVA 4WZQA 5IT4A 2VKZG 1S1VA 4O4GB 4QJVA 2OPSB 2J8AA 1QAXA 1F2GA 3MMCB 4P6QA 3FCVA 2XY7A 2MZJA 4K4SA 3PEJA 3MD1A 4FYYB 2P6TA 3PM9A 1DHMA 3A8KA 3AHPA 1DBDA 1RBAA 3QT5A 4PQAA 4K0KJ 5A0YA 4O3QA 4ANDA 3MM6A 2ZHOA 2DGSA 2EFGA 3V4IA 2RNEA 3D7SB 1FRMA 1UFKA 4L73A 3A3OB 5KFPA 5KFLA 1KD1T 1VQ5S 2VJVA 2IM2A 1GNKA 1RT6A 1T03A 1QM9A 3W61A 5J2NA 1CJTB 1F5CA 4IFVB 2ASLA 3U1NA 1UZHA 3Q8YA 2CZ9A 2QV6A 4TNOA 2I5JB 2NPFA 2VH7A 4LF2A 1AT1B 3TA1A 2MKIA 2C2OB 3TARA 1UJ4A 2E9RX 2O3DA 1IQZA 2W9BA 4OI1A 5HQ8A 2U2FA 2JEGA 1UETA 2J6UA 4KGVB 1R8PA 1FD8A 2Z2ZA 2C2RA 3K5LA 5DDRC 1C0TB 1U2RA 4ZN3A 1JLBA 4QU6A 1FXLA 1MMNA 1H7XA 3PW0A 4F4WA 1OPZA 1PBAA 3K8VA 4KRWA 4I4BA 3SDEB 1S5ZA 4WKRA 1Q7LB 2XCPA 3M9MB 1RWNB 3BH7B 2V63A 1B0TA 1YGYA 3F73A 4U96A 2HVHA 5K8NA 1S9GB 3UNYA 3I5AA 3IFEA 3NGSA 4FF4A 4BC7A 3GR1A 1YRUA 4DV5F 3M8YA 4OJGA 1N52B 4C3MA 3OUYB 5GAEI 1Y3KA 2Y1LB 3FZ2A 2R8GA 5JXSA 4PPZA 2FLPA 3KYLA 4A8SA 4QPTA 2F3JA 4JI1F 2G1DA 2ZUAA 4QYZK 3VAFA 1T95A 4ECSA 2HVIA 2ZDOA 1WC5A 2MKCA 4EFAC 5CZVA 1WNEA 1VBKA 2EFOA 4MKVA 3W9HA 2GAGC 2QT7A 3PR4A 4ECVA 2CPJA 2DH7A 3TQEA 4BWMA 1EETA 3W62A 2DNOA 3OR1A 2V4QA 4OV6A 4ED5A 4OZNA 2VL1A 1T7PA 3E01B 3R97A 3GFHA 2GQQA 2WOMB 1JX4A 1PJ7A 3O1LA 3WX4A 1TELA 5DZ7A 2B0GA 3LQVA 4LFBJ 4CO2A 1VCTA 2JX2A 3RB3A 4C8ZA 1N5SA 1NUEA 3CJSA 2MSTA 1KKHA 4XK8C 3OTOJ 4F4ZA 1T3OA 5F0UA 4EBDA 4NE9C 2ZH3A 2DNQA 3MFHA 1FRHA 3IRXA 4KBIA 3PO5A 2AU0A 2C3UA 1WOPA 1LWEA 3MPWA 3CEDA 1M5HA 1X4CA 2KYZA 3EXYA 3C14B 3JYTA 2DEIA 2XM3A 2P9CA 1RK8A 2KFZA 2VFTA 3QGIA 3TUZC 4J9QA 4YB5A 4NASA 2KHCA 4O0IA 1VQ8S 4F7VA 4GC7A 1ACMB 5KT6A 1IKXB 4RW6B 5SZTA 2HHWA 1AUDA 1X4GA 4FYWB 4TU7A 3MMAB 3TEHB 1WDTA 4F4AA 4LIWA 3D68A 4DV2J 5I4MA 4JI6J 2BR0A 1MMLA 2M5YA 4NMLA 4LRAA 3M9NB 4IRCA 3NS7B 1R6VA 1ROFA 3LP0A 3TR5A 4RBVA 2AZ3A 1KBRA 1FFSB 4B17A 1O6XA 1Y10A 2FLLA 1EAYC 3PIPQ 3MR2A 2CYYA 4PEOA 3VVTA 2F65A 4ZHRA 5HVFA 3EVOA 4D3HA 4CWBA 1JQGA 2HQDA 3PYFA 4P72A 3TVYA 1RKIA 3M30A 2E5HA 4V1Ak 1YHQS 1XN9A 5E3CA 2QMUB 4HDGA 4QZVB 2V8PA 4GRSA 2YNIB 4QYRA 2EW9A 3MUMP 4QWCA 1REVB 3DCAA 2MY7A 4B3TJ 3GJQB 4WP8A 4DSLA 4ICLB 4I68A 3M6VA 1OY9A 4F8RA 2UUCJ 3BSNA 3BN4A 5LSRA 2CG8A 5DGAA 2OELA 5EDWA 3NWRA 2E7WA 1L5UA 4IG3A 1S57A 3W8GA 3DLLQ 2M0GB 3GIIA 4R0JA 4ZP7A 1JLGB 4TU8A 2DNLA 1SKWA 3ENAA 2CIMA 4J9VA 1XWLA 3DOMA 4DL0C 5HROA 3IG1B 2WTFA 1NCLA 2G0CA 3ISNC 1NHUA 2W2NP 3KNAA 4LFCJ 4RPFA 2JLFA 2VUGA 1OMSA 4YY3F 2NPIA 3EUNA 1HBOA 2KXNB 5F8GA 3NY0A 1L3SA 1U47A 2DYAA 4PG6A 2IDLA 4ZVSB 3BYPA 2J6SA 3WC2A 4ZVRB 1SV5B 2CQ3A 1RCXB 3KK2A 1CJUA 2B8PA 3CCVS 1YQHA 3FBCA 1J2VA 2HHHJ 2VG5B 2ASYA 2R8KA 1LFWA 3PYGA 2KM8C 3M8PA 4KGXB 4CDIA 4DFPA 2PD1A 1Q7YT 3AXKA 4PXCA 5B0FA 3KUGA 4CLSA 4ZIWA 2OD6A 4NLYA 3PCOB 4A8MP 4OI0A 1VLOA 3VGSA 3DKDA 1RABB 2DXFA 3JQKA 5JVHQ 4DF8A 1HNVB 3POTB 1GX5A 2VG7B 1X4BA 1BMQB 1IVZA 4BHQA 3I5BA 3EVMA 5A6PA 4EYHB 3PY8A 1KTQA 3I6PA 2MYFA 3RYLA 1AYEA 1NPRA 3RR7A 1TUVA 2W7PA 4DL6A 4IQXA 2CFXA 2XGQA 3AA8A 2HRUA 2A10A 3DYAB 1DAXA 1V6HA 5J2QB 4HEA9 2AYMA 3R3TA 2QL5B 4JOUA 2W7OA 4X65F 4TLRA 9ATCB 4FPRA 1U1KA 1NK5A 1JKHA 1T05A 1ZAXA 1S7IA 3E3XA 3GYGA 1B3TA 4DV7J 3HVRA 4W98A 4UY8T 4IG0B 2VFSA 1U1QA 1UWBB 3BGRA 4QYZJ 3FGVA 1FX2A 4ANCA 1M90T 4DHVA 3G9CA 4CRJA 4DV1F 3NEKA 4ZVGA 4DUZJ 3HHLA 4LF6F 4KKOA 2CQCA 3JSRA 4NLXA 4CM2A 1VYAA 1T9VA 2RDJA 3NOCA 1XTZA 3BQ0A 3CULA 2ALZA 3Q22A 3EM1A 4ZLLA 3AH6A 4DV4F 3SBMA 2UUBF 2IIHA 1NK7A 1F3FA 1HD0A 1FEHA 4C8NA 2ZWPA 4QIGA 1VLYA 2WONA 3US5A 4A8XA 5LXRA 2GJFA 2CJXB 3AQPA 1U8WA 2QFJA 3BQ2A 3UCZP 2H51B 5LMUF 1UMJA 2DD8S 3ICLA 4KFBB 2QMXA 4KC5A 4EZ6A 4X64F 4NLGA 1BC6A 2XMKA 2M3DA 4ZVHA 3VGUA 2ZZMA 3KLHA 3HHLC 4URGA 1CS4B 4HACA 3S6EA 4ID5B 1TMMA 1IBKJ 3QJJA 2E5LF 1KWMA 4LQ9A 1S1WB 3SXLA 1N48A 3OL8A 2MQQA 4DSKA 2ZD1A 5GAEU 1FWPA 1UFLA 2WAQD 3KLIA 3MOZA 4IQMA 1JXEA 3M8SA 4X66J 3VVUA 2MQPA 4NXMJ 3DLKA 2DPJA 1RAEB 1U48A 2DTJA 4KHMA 1K9MT 3L9ZA 3QPIA 1CULB 2ZWOA 1GMUA 4DXLA 3H2VE 4P71A 2XWXA 1VRTA 1CLFA 1WEXA 4NCAA 4PZVA 2Y1IA 1B99A 2DGUA 3HVWA 1YX2A 1WELA 4M5DA 2RUGA 2IJFA 1U6ZA 1RT5B 1VC0A 3CIZA 1D09B 3D6TB 3THPA 5K5MA 2ZDPA 1SH3A 1G1XA 3MEGA 3QT7A 4J9UE 4LF9J 1C1CA 3Q8PB 3CE8A 5F0WA 3BKFA 3CCQS 2W9AA 2XYGB 2YQ3A 2PT0A 3T5LA 1RHUB 1T8EA 3NGTA 1HMVA 4P2MA 4A8WA 1X5PA 5DZ6A 2MKSA 2EC2A 3GB0A 1VRUA 3CMQA 5FIIA 1X9WA 3NCRA 2FZKB 4YR0A 1RACB 4EBCA 2RB7A 3MEEA 4IH6A 1XMQF 2EK1A 1FTRA 3R7BB 1N34J 2KT2A 1WF1A 3MCOA 5DDOC 2A2CA 2NXEA 2HGLA 4DUYF 5CYQB 1S0VA 1M5VC 3H2UB 5LMNJ 3AJDA 5F3TA 4TYBA 4B3MJ 4MFBB 3M2RA 3NXZA 1S10A 3JSYA 3NNCA 3SFGA 5HBMA 1ZM9A 3T6JA 4B9NA 5J1NA 2HFVA 1HPZA 4DS5A 5IOLA 3BZQA 2R7SA 2F4FA 5JMNA 4JB8B 2XSFA 4DQQA 4IYQA 1RTZA 3E2EA 1NKBA 1U09A 1UJ5A 4K4XA 5ETVA 2JDJA 2JOQA 3IAS9 1KS2A 3M8WA 2ACYA 3JTPA 3JSMB 5CD4A 4GKKF 2VOOA 3C15A 4RW9A 3AD9C 2YNFB 3UDVA 2BE2A 1FT8A 3V4MA 2XCAA 4ECQA 4MKYA 5A2QU 2HQ3A 2VA2A 4TN2A 3T1AA 2ZHAA 5IZHA 1U6BA 1RT1B 4WYWA 3ZNJ1 2Z57B 1A6LA 5EN1A 2KU7A 3BSOA 5D0EA 4DFKA 3S8SA 4WF9Q 5HJXA 2GO8A 3I4PA 4OI6A 3BSAA 1RSCA 4F3QA 2RDIA 2DRDA 4DL5A 4KH0B 3Q89A 2DGTA 4R25A 1IBLF 1NK6A 3TJ8A 8RUCA 4L75A 4DV6J 2QLXA 2CZ4A 3A8EA 2BANA 5ETNA 3U1MA 2C22A 4ZJLA 2NUHA 3FQKA 3S1TA 2VHGA 1U25A 3P8BB 1FO1A 5DO2A 3TVKA 4ZKAA 4DPYA 3V81A 4QBUA 2AX0A 3PTWA 3PFOA 4JI8J 2HNYB 4O3NA 3A13A 4RKUC 2IPOB 3PX4A 3M2VA 3GIMA 1UEKA 1C4AA 2YWFA 1YBTA 3CJ3A 5LM7E 4XPEA 2E44A 2UXBF 3OQ2A 4K0KF 1CQMA 3M1VA 2CPYA 2V8GA 2I1RA 2LP4A 4ED0A 2VJUA 3DNCA 4OYMA 1SC1B 4YS2A 1U02A 2RRBA 5A8RA 5BR8J 4KE5A 1GK8A 5IM0B 4JI3J 3H7HB 5LSLA 2J0QD 1LXJA 2RF2A 1PG5B 4NMXA 1KFDA 3DLGA 3BO2A 2GNKA 1IBMF 2V69A 3W2VA 1MN9A 4C98A 3EDQB 5MLCV 4KHPF 2XMWA 4L3NA 3Q23A 4RO0A 2OTJS 3MFIA 1RB0A 1QSLA 2XHCA 3PZPA 1IKWA 1RAJA 2PMZD 4N56A 3QIPA 1TL1A 3BBBA 4X4NA 3W5ZA 2BABA 4OFZA 4W4MA 1VS3A 3CSKA 4F2RA 4O23A 1NK4A 3F41A 3HXMA 3D3BJ 5CYJA 3U27A 1F2HA 3VTIA 2AMCB 3EPIA 2CQHA 2A6OA 3EWGA 2BE7D 1ITPA 1JLAB 4ELUA 3QRQA 1S6PA 2D3UA 4FN5A 1O8BA 1QE1A 4UQTA 4HYKA 3W63A 2FPHX 2QLBB 3QLHA 3BDEA 3N5FA 1RAIB 1LXNA 3PKYA 1I6JA 2POKA 5KOWA 4F02A 4FYDA 1N5QA 2ZH5A 4J7CA 3OVBA 5A8WA 3MDFA 3EGWB 1AFJA 4K59A 4NI2A 3AOBA 5D15A 5E3PA 1T3NA 3RAXA 1HWKA 4AL5A 2DH9A 4KPCA 2HQGA 1CJVB 1FRKA 4M5MA 5E5NA 3DOLB 4USTA 1TKDA 2XG8A 1AA1B 2GVZB 2Y3YA 4IRKA 4X4VA 3I4HX 4GVBB 1V5VA 1S1UB 3I9ZA 2WB1D 4Q7AA 3MAQA 3KK3A 2VD3A 4JI7F 5KG5A 2QLFB 2NZCA 1SKUB 1WTFA 4N5SA 2UVVA 1EZZB 1YI2S 2CNLB 1KLMA 3DM2B 3SCJE 3OTOF 1VIOA 2BJDA 3ZZTA 3DHWC 1H7WA 4FVCA 5CAAA 4LMZA 3C16B 4CLZA 2N4DA 2NS1B 5F9NA 3QFWA 2XS5A 1SJ1A 2CPXA 1RTHA 6FD1A 5F8NA 3VAMA 1HBUA 3KJNB 1S97A 5ADZA 2EI5A 3QT6A 2JFDA 5KT4A 3KMQA 4E0DA 2VASA 2B7BB 3BGUA 4RWXA 4O4GA 1IWGA 1ZA1B 3KDOA 1VFJA 4I64A 5HL7Q 4DZ6A 3G8QA 3DI6A 4NYPA 4K7QA 1F9HA 4JI6F 3NMAA 4ZVEA 1VBZA 5KFFA 5A0YB 2Z58B 3MM6B 3HKWA 2ZC4A 2DXDA 3V4IB 4C8OA 5FD1A 4CH0S 1F5BA 4JI2J 4CLWA 1SI9A 1TFYA 5K20B 4ECTA 2RHSB 2DVIA 3QWPA 1S6OA 2MGZA 2RKIA 1RT6B 4TY9A 1T03B 3ZZOA 5J2NB 4NEZA 4LF8J 2ZZNA 2DCLA 1ZPVA 3OSPA 2DO4A 2Q79A 3W8PA 1X0FA 4JYAF 3KLGA 2W1BA 2N4CA 3BH6B 4ZCMA 3KG0A 3PJ9A 2CDQA 2CKWA 2W9BB 3R1HA 1BD6A 4KQZA 1JXLA 4RW7B 1P1LA 1IWAA 1QUVA 3Q8VA 4ZN1A 3KHLA 1JLBB 3MGJA 4WTOB 4HHJA 5KFSA 4ID8A 4DQIA 1FCAA 1RAAB 4ZMMA 3G87A 3SV3A 2JC0A 2CRLA 3TAMA 4CTAA 2DY9A 1Q53A 4QQBA 5ETKA 2V9WA 2MKYA 3UCUP 4YB7A 5CCLA 1U2CA 4AUKA 1S9GA 3D67A 4L6V3 3KMSA 4B3OB 4CZCA 4NLRA 5KFCA 3LGNA 1UEUA 3UD5A 2YX1A 2B9YA 4RNFA 1N88A 1VOMA 3ITHA 3OJSA 4R8UA 3A12A 1Y4ZB 4NZ7A 4H4KA 5IC6B 1EIYB 3QRRA 1S6UA 2OFGX 5K8MA 3TZXA 1NK8A 4UTGA 1KP6A 4FXDA 4LSZB 2V94A 1RAFB 2GMJA 2OO4A 2CADA 4AD6A 1HNXJ 2EFVA 4EU0A 1QSYA 1E6YA 1U24A 7FDRA 4Q8FA 2JC1A 2B3TB 3GV8B 1JIHA 3TUIC 1FRXA 4LUBA 2V2ZA 3Q8UA 1RUSA 2K1RB 5K14A 4A46A 1KQSR 1EETB 3C2PA 5E2QA 4EO6A 2C2MB 2RUSA 4X4OA 4I69A 3VZHA 2ZNZA 3NBPB 3M6UA 3J80Y 2HYIB 3CMAS 4QIWD 1GXLA 3I0RB 3ETOA 3OTDA 2HHTA 3BJYA 2HSEB 4ED3A 3I9V9 4P2SA 5ETLA 5D0RA 5KFQA 1HHSA 2FVPA 1U0HB 3IRXB 3MCMA 4NA3A 1LWEB 5ETSA 2HFZA 4XPCA 3JYTB 2FHMA 2H9ZA 4HLBA 1JXVA 1BQNA 5C24B 3HX9A 3A3PB 2EKNA 2DKOB 1BGXT 4A8YA 3K2YA 4BS2A 1HHTP 1J5EF 2WVDA 1NO8A 2DISA 3MPYA 2O67A 5L9NA 3ZZZA 2RD5C 3WX8A 4F26A 3CCLS 1XMOJ 3MMAA 5GMEA 4LT6A 1QVGR 2CQPA 4B3RJ 1NMEB 1WC1A 1YTYA 2KRRA 4KO0A 4M95A 4Y00A 1B0VA 3DGPB 3LP0B 5KFRA 4G1QA 1UP1A 4DV7F 3MCNA 3KJQB 4GO7X 1EP4A 2YKNA 3MECB 1TMJA 5CD4H 4DUZF 4M5IA 1KHWA 4IOBA 1QVFR 4P75A 2ZJRQ 2AD9A 1N54B 1RISA 2PDAA 2R8JA 3M30B 5IQ6A 2G2OA 3FSYA 2P2CB 4F0MA 2RH3A 4PWDA 2QSFA 2Z56B 3EPGA 2GHWA 3CTRA 2HBZB 2W01A 4ED4A 4DR3J 3ILJA 5J2PA 1QD1A 2I2YA 2YNIA 3N9UC 3CJKA 4RW8A 3QYYA 3L09A 2YWEA 1REVA 2B4UA 3JB9k 2DR7A 1VGYA 4WPAA 4USHA 3P5TL 1YBAA 1YJWS 4ZLNA 2WSFC 4ED6A 1RHQB 5DETA 1VHIA 2KM8B 4XIUA 3H5UA 1HNIB 2BJ7A 4QCLA 2CJKA 4KH1B 2LLZA 2RQCA 2VOPA 4PG4A 2IRUA 2E9ZA 3BR8A 2MZTA 4DSFA 3H4DA 3DOMB 3P3DA 2ASJA 1S79A 4OI2A 1YVFA 3M32A 1R7IA 4B9TA 3BO4A 2MQ8A 1WKJA 5IFMA 3IG1A 3PIOQ 3HZEA 1D8YA 2UP1A 2K8GA 4P7TA 2QLWA 2JLEA 2E1MC 1HBOB 1Q82T 4C11B 4TYAA 3R2CJ 3NGDA 4OYWA 4Y28C 3PW4A 4IR9A 3PW2A 3UW1A 3R6LB 2IJNA 2QIFA 5LOQA 1HD1A 5HVGA 2DHGA 3GR0A 2XNRA 4LVNP 2XBPA 5DRKA 3T9ZA 4ECWA 4I6YA 3K5PA 2RU9A 3KK2B 1CJUB 3CCES 3B54A 2H5IB 3TUPA 4DR1J 2MKKA 2WRMA 3FUYA 1G6BA 2VG5A 3M8PB 5D4NA 4CLLA 4QIVA 4L3KA 3LUYA 4PG8A 4BBYA 4ELVA 3TA0A 2CVIA 2CXEA 1AZSA 4ALZA 5B09A 3P5BP 2R2RA 1WHXA 4UUWA 4FS2A 2XZDB 3DRYA 1DTTB 2YX4A 1XBWA 1X9SA 4LF9F 2LXIA 4KV8A 1PYSB 3MI7X 2FVQA 4DG1A 1N36F 3OTBA 4U7UK 5U47A 3UVJA 1FVSA 2GGPA 3CXCR 3PVXA 4C8LA 3QSYB 3TANA 4OX8A 2X7IA 1NHVA 2FYXA 1CG2A 2DNHA 2ZH6A 1BQMA 1FWKA 1WDDA 4Q8EA 2X1FA 4OYOA 4MKBA 1HQUB 2ZH2A 2D7SA 5AE3A 1FNMA 2DH8A 2AYEA 3DYAA 1FKOA 2NREA 4LR7A 1QTMA 1N34F 2AF6A 2WVEA 1T05B 2LEPA 1BUXA 2V68A 2QTWA 3HDSA 1RWOB 1FDAA 3EJMA 4CT9A 2QL9B 3BGRB 2Q66A 1R0AA 1B4SA 2IJRA 4M5KA 1HI0P 3J7AN 3HHLB 3TP2A 4KKOB 3WC0A 1S59A 3HVTA 3H4BA 2BJ8A 2DNMA 2MQOA 3QZ7A 3SZ2A 3K58A 4USJC 1VQOS 4FP9A 3IA0A 2YTCA 1NDCA 1YBUA 3I96A 1NJWA 1CJKB 1XNQJ 1S72S 2J0WA 3CJTA 1DTQB 2CJQA 2C3YA 4ECZA 1O5JA 4O3PA 4OHWA 4OX9F 3VGVA 2WONB 2RDDA 3CO0P 3QGHA 2P9GA 1S48A 4RLEA 2Z30B 2KO1A 2XLIA 3TZWA 4AQYJ 2ADBA 3OJUA 2W9CA 3KLEB 3M05A 2OEKA 3T5JA 3SMZA 2FTRA 5T41A 3TZZA 3KLHB 3PFEA 1K44A 3L7OA 4HACB 4JI0F 1CS4A 2OKQA 4OX7A 4ID5A 1YSJA 2KN4A 2MPUA 2ZD1B 3MR7A 4ECXA 4DV6F 2H1YA 3J7Z5 4PQUA 1UW4A 3AQOA 1TVRB 1JNRB 1WHWA 2F9JA 3IS9A 1S12A 1HFEL 2BEFA 1GXTA 3MMBA 1T0TV 2JEIA 1NAQA 3UR0A 4JI8F 3SCLE 2GAHC 2FY8A 2G0JA 3FEZA 3VQTA 2VDIA 1FRIA 3KUEA 4CO1A 3K5NA 2UUAJ 2AJ1A 2ZJPQ 4PYAA 4C97A 4NA1A 3BGOP 2G4BA 1WF2A 4M5DB 4NXNJ 1RHKB 4JI3F 5KFWA 1RT5A 5IXUA 1NSAA 3MEGB 2FHOB 3T1HJ 1MWYA 2LKZA 3FK4A 4J9PA 1VK3A 1C1CB 1K47A 3QQCD 2KXFA 2E29A 3GJSB 1JWWA 3PRDA 4C4WA 1D1UA 1AFIA 1EB0A 4FF2A 5D4PA 5FDLA 4W90B 4DFJA 5LT5A 3Q8RB 1FJGF 3KJFB 4DUTA 4B3SF 4USMA 1IM6A 2DNYA 1VRUB 4Q5VA 1W25A 2HHUA 2HZCA 4DR4J 3C3LA 3MEEB 3ONQA 4WFBQ 3MMJA 3EZOA 4HH1A 3W64A 2AIRB 1MNEA 2MLYA 1PGZA 2F1FA 3M6WA 2ZOMA 3GQCA 2EFQA 2RIJA 2BYCA 4C8YA 2BACA 4HR2A 4LF5J 1VQ9S 2VF3A 5B0DA 3M2RB 5E3QA 3QRPA 4I56A 2PEHA 2IA6A 5HBMB 3HSDA 4HTJA 3WDOA 1MU2B 1NPPA 3NP5A 3DOKB 1E6VA 3OBIA 4G65A 4BCAA 4NYZA 2EC0A 4ED8A 2UU9J 1G2EA 4DV0J 3AT1B 1RT7A 1W26A 2UV8G 4DPOA 2AJFE 4ZPBA 3W65A 1P27B 3J7ZT 3FMWA 3AB2B 2WHOA 2APOA 1BXNA 2FB0A 2KFYA 4RUBA 4S0MA 3OLBA 2B51A 3UWTA 1RYSA 1FKAF 3K0JA 2CQ2A 2R7UA 3RBXA 3A4TA 3I82A 1MROA 4IH7A 2H3EB 2GA7A 3DDNA 2CNNB 3MUTP 2DNZA 2V2KA 3UFCX
chains in the Genus database with same CATH topology
1KC8T 4M8LA 2DD8S 3ICLA 4KFBB 2QMXA 4RW9B 3D5MA 2L9NA 3T6BA 4RNHA 3KHRA 4KC5A 5IT0A 4NWBA 4EZ6A 1U8SA 2R7TA 4X64F 4NLGA 5HROB 1BC6A 2A1BA 4CCHA 1KQKA 5L1IA 4C9DA 1RWUA 2KJVA 1SH2A 1PSDA 2M3DA 1WG4A 2XMKA 3M8QB 4ZVHA 4ETZA 1RKJA 3BDPA 3D1OA 2GX8A 1X5SA 3BQ1A 2GW8A 2ZZMA 5CYMB 4B9VA 2DGXA 1RT3A 1UVIA 2HWIA 3KLHA 1JJ2R 2YWKA 1TV6B 1SXLA 3CCWA 4RZRA 3HHLC 4URGA 1OWXA 3C6UA 3I87A 2C28A 4HVZA 5AXMA 3V6HA 1N0VC 2QA1A 4LIRA 3S6EA 4ID5B 3BF4A 4OI4A 2KT5A 4J9OA 2WSEC 1GXUA 2WK4A 4WCEQ 1Y7PA 3QJJA 2E5LF 4GC6A 1SL0A 2CJAA 3SCKE 4I1TA 4LQ9A 1S1WB 2FGCA 3SXLA 1Z1ZA 2RILA 2M9KA 5KFTA 2M8HA 3E8OA 1OSDA 3VF0B 1N48A 3OL8A 5LJ3Y 2IRXA 2MQQA 1S6QA 2IYGA 5J2MB 4RWWA 1QAIA 2HW3A 2Q43A 1GH8A 5KAKA 1C0UB 1H38A 3NMRA 4LVOP 4DSKA 2ZD1A 2PIIA 5GAEU 1IKYB 1D8ZA 5T7LB 3J7YU 2GCFA 1UFLA 2HIQA 4LQ3A 3W7BA 2WB4A 1NU4A 1ZTTA 2D9OA 3C46A 2AJ0A 2WAQD 3J81Y 2IBKA 4LFBF 3KLIA 3UDCA 1LWFA 1SL2A 1M5PC 2XI2A 3MOZA 3I55S 4OZ1A 4IQMA 1N56A 1SBRA 1DQ8A 3T5KA 2AQ4A 1JXEA 2PC6A 4RBUA 2F8MA 2GFFA 3M8SA 3RBDA 4WE1B 1SV5A 2L9WA 3U1LA 1JMTA 4DR1F 2YKOA 2OH2A 2B6AB 2D74B 2MQPA 2BANB 2MJUA 1APSA 3DLKA 2EWHA 3N01A 4KAIA 3THTA 4D3GA 2C3MA 5EX3A 2GJ2A 2DPJA 3LP1A 1U48A 2DTJA 4KHMA 4N8NA 4NZ0A 4PKDB 1K9MT 3CDAA 3GG0A 4AXJA 3QPIA 4LFAF 4Y2IA 3UDLA 2ROGA 4DBQA 5DLFA 3Q8QB 1M5KC 3V81B 1R8CA 2EFNA 3NG8A 5A8KA 2IM0A 3G6XA 3PNIA 4DN0A 2XI3A 2HGMA 1PC5A 4MIWA 4ZLPA 4MYTA 1R8AA 3H2VE 2VZ9A 4CH1A 2DCUB 4F67A 2KTQA 4DF4A 2XWXA 1VRTA 1CLFA 1WEXA 2H5EA 3M2VB 3ZC4A 2ZM6F 4NCAA 3H5SA 2Y1IA 3CUNA 1GQEA 2MQLA 4PUOB 2A3JA 2RJZA 2HMIB 4K4VA 2JSXA 2D3OR 2DGUA 3HVWA 3H20A 2I8EA 3HVAA 4OMFG 2XS2A 3P49B 1WELA 4M5DA 1HNVA 4JV2A 1M0SA 2RUGA 3BSCA 3D1HA 3POTA 2IJFA 1U6ZA 1RT5B 3M1VB 4I6AA 1VC0A 2UVRA 4IDKA 3CIZA 3HK2A 3DRRA 1IJEB 4Y2CA 5A6WA 2P6SA 3THPA 2VG7A 1L3UA 1BWEA 5J1PA 1ZAVA 5K5MA 2ZDPA 2YH1A 1S0MA 4G1IA 4QWBA 1SH3A 3G8TA 1G1XA 3IN5A 1H2VZ 1LOUA 3MEGA 5A8RB 3H5YA 5M2PA 3KK1B 4IO1A 1C1CA 4TLQA 3CE8A 5F0WA 3Q8PB 3CCQS 5DM6Q 2W9AA 1O51A 3L7PA 4DV2F 3TQ1A 4ELTA 3U7JA 4PG5A 3OLAA 3IRWP 2YQ3A 2PT0A 1LV5A 3SQGA 1CC7A 4LSLA 2OMOA 4O44A 4TY8B 4C3KA 3T5LA 3CO9A 2DR5A 3DU5A 4IFYA 2ZJQQ 3LANA 4DV3F 5BYSA 1T8EA 1FXRA 2HHQA 1HMVA 2QA4G 1I1GA 2HPUA 4MAKA 1SKSA 1SJ4P 4QWEA 2O1PA 3W2WA 2ROEA 4A8WA 3TUJC 4NRUA 5J2QA 1IUJA 4H4MA 3OVAA 2Z0GA 5HLFA 3FJ2A 1X5PA 4A8QA 3OL9A 3KKFA 3GILA 1TKZA 5C42A 3W2VB 2V4JA 2KG1A 4ILLA 2MKSA 1LW0A 1N6QB 1FKPA 1F5AA 3BGFA 5KT2A 1JKHB 2DO0A 3GB0A 1DZ5A 5HMXA 1VRUA 5FIIA 5KG3A 1X9WA 3NCRA 4GKJF 2M8DB 2LCWA 4MK7A 5H9FJ 5KT7A 2R7XA 4YR0A 2LQ9A 2DHAA 4EBCA 1DQAA 1X7VA 2RB7A 3MEEA 4IH6A 2EK1A 1XMQF 5KFHA 1FTRA 1IKWB 4AYBD 2R7VA 2YKMA 3BM7A 2KT2A 1WF1A 3VZIA 4CI0B 3JAMY 3DC2A 3V5RA 5DDOC 1RT2A 2A2CA 2CQBA 4A8FA 4IG0A 1MSWD 1UWBA 2CQ4A 3ISND 2HGLA 2IC3A 3MM7B 2VPXB 1M5SA 3LH2S 4DUYF 5CYQB 5HO4A 4RBTA 1TKXA 3QIPB 1S0VA 2KG0A 2OPQB 1M5VC 3H2UB 2NYIA 1IQTA 4DL7A 4JV5F 2FIUA 3D0IE 2GJIA 1S7HA 2FHJD 1FF2A 6FDRA 4F2SA 1NJXA 2BQ3A 3Q2SC 4URQU 2EG2A 1QSSA 1Y3JA 5F3TA 2B9WA 4TYBA 2G13A 2EK6A 4MFBB 3M2RA 2FHKA 3RR8A 2V8HA 1S10A 3VCDA 4UQGA 3JSYA 3NNCA 2VFUA 1UVMA 3SFGA 5DLGA 5HBMA 2HNDA 2V8DA 1ZM9A 3T6JA 4FZVA 4FF1A 3KG4A 1YITS 1TKTA 3LO3A 4B9NA 1L3VA 3TYTA 2RQMA 5J1NA 1VQ6S 5GAGU 2ZH1A 1HPZA 3FVYA 4X4SA 3GSDA 4DS5A 2RRNA 3BZQA 4B3TF 4CH7A 2HWTA 4LF7F 2R7SA 1S6PB 2FJBB 4DL2A 1SL1A 3T3FA 1N5YB 2ASDA 2XMUA 1H98A 2KJWA 3D0GE 3N4WA 4ED7A 3IBWA 1WTBA 3O6QA 3NCPA 4CO4A 5F8HA 2FJEB 1Y5NB 3T5HA 2UUCF 4MYUA 2XSFA 4DDFA 4KR0B 3HHDA 1VIXA 1LWCB 3QLHB 1C1BA 4Y3CA 5F41A 1M5OC 4NLSA 4DQQA 4IYQA 1RT4A 5EX0A 5L9XA 3E2EA 1FERA 1NKBA 2HNZB 3DRSB 1S9EA 3ZZPA 4DMZA 2XZWA 5E33A 4OL8A 1U09A 1G3OA 4TU9A 1UJ5A 1YJVA 4JUZA 4K4XA 3OPKA 1RYRA 2JDJA 3B82A 4KJIA 1JLQB 2JOQA 3IAS9 4CNYA 1KS2A 4TXSA 2KZMA 2MXYA 2BUNA 2ACYA 2M70A 3JTPA 1HNXF 4HTIA 2VPYB 4KPYA 4ES2A 2HQIA 2L48A 2Z2LA 4UY85 3JSMB 2GIQA 3R5CA 2XY5A 4AQYF 5C25A 5A8WB 2YVSA 1U1NA 2DGQA 4DWIA 2HHVA 4YR3A 4K50A 2MY8A 2PMHA 3S01A 4C7QA 4GKKF 4EZ9A 1XNRF 3LW5C 3N79A 2VOOA 4I2QB 4KFBA 1VBXA 4RW9A 2YNFB 3HO1A 1HR0F 4Y2AA 3MM9A 2BE2A 3GFZA 4C8MA 4FXWA 1FT8A 3IWXA 3M8QA 3V4MA 2XCAA 2EFPA 3LALA 3QAUA 2FGOA 2BZ2A 4ECQA 1SKRA 1K8AT 1U6FA 3RBEA 4NLQA 4Q44A 2BOPA 4MKYA 2OSQA 1SUQB 2HQ3A 3CMES 1HBNB 2CZVC 5JVGQ 4LFCF 1IM4A 1TV6A 2VA2A 4TN2A 3T1AA 5DG9A 2ZHAA 1BQXA 1OPIA 5IZHA 4F4KA 3MZIA 4RW4B 1RT1B 1U6BA 4WYWA 2P5VA 1A6LA 5EN1A 3PACA 2UV8A 1S4FA 2KU7A 3BSOA 4DFKA 3S8SA 1U26A 2VONA 1TR0A 5KG6A 1FTCA 5AXNA 5K9FA 1XEZA 1HNWF 2ABYA 3SEOA 1S1WA 4WF9Q 5I3QA 5F8MA 1S1UA 1BY9A 2GO8A 5KFNA 1D9DA 3KK3B 2F7VA 4I6WA 5J2MA 4AXIA 2VFVA 3I4PA 4OI6A 3BSAA 2E9TA 4IOAQ 1C0UA 2R8HA 3KLIB 4Y34A 1IKYA 2OPPB 3MEKA 4N47A 5T7LA 5KFMA 3GYNA 4F3QA 5DDPC 3TNVA 2RDIA 3Q8SB 4DL5A 1S77D 2DR8A 3J7A1 2KDOA 3MCSA 2DGTA 3M6XA 4R25A 1VQLS 3OXGA 1IBLF 5B0EA 4IO9Q 1NK6A 3O8WA 4I7FB 5DS7A 1Q8BA 5B08A 4TKTA 2J6TA 2LA6A 3DLKB 3NNAA 2HHHF 4WE1A 2QLXA 4DQSA 4DL3A 2AJQA 2CZ4A 4MMOA 2B6AA 3A8EA 1YRTA 3DRPB 1FA0A 3DXSX 2BANA 2IAJB 3U1MA 3G8SA 2C22A 4J9NA 4PXDA 2HLUA 5JUMA 3X3UA 2NUHA 4WU2A 4F3OA 3FQKA 4C0HA 3R5DA 4DFMA 3S1TA 4QR1A 5A8KB 1Y00A 1U25A 3AJ2A 4H54A 5L1KA 1FO1A 5DO2A 3TVKA 1RTHB 2CPEA 3DLBA 4ZKAA 3UE2A 4WFAQ 3V81A 3FFIA 1IN0A 1R31A 2IRYA 4QBUA 2AX0A 2HS0A 1VRTB 2PGCA 1V3ZA 4NLDA 3PFOA 4QR2A 2HNYB 2RU3A 4O3NA 4QR0A 4O4RA 3OXFA 4WU3A 4RKUC 3PX4A 2YH0A 3M2VA 5EWGA 1CC8A 1VQYA 2LU1A 3QGPA 3GIMA 2YWFA 1C4AA 2JEFA 2AX1A 1FDNA 4KHRA 2I38A 3FNNA 3Q0AA 4PUOA 2JWNA 1U2FA 2KYXA 3CJ3A 2NQPA 1UVJA 2LYVA 2RVJA 3THVA 2Y1JA 1FRJA 3VAGA 4XPEA 2W4CA 3HHNB 1DJ0A 2E44A 2Q6BA 2UXBF 3OQ2A 1UA1A 4K0KF 1CQMA 3M1VA 2GV1A 4N77A 2L41A 2KKHA 2EKYA 2CPYA 2M2BA 3T1HF 4CT8A 2V8GA 3TI0A 4F4YA 3N6LA 2I1RA 4ED0A 4Q0BB 5IQQA 3DNCA 1U1MA 3DI6B 2DIUA 1A7GE 2YNGB 1JLFA 2RRBA 2BXJA 5A8RA 1FRLA 4KE5A 4X4QA 3KK1A 4HH0A 4HI1A 4O44B 5IM0B 2HFNA 2IBOA 3NNHA 3G6VA 5E41A 1YJUA 1HMVB 3MPVA 3RW6A 4MJKA 1TL4A 2NZ4A 2ZBIA 5J1EA 5KOXA 4TY8A 5LSLA 2J0QD 1LXJA 2L08A 2RF2A 1IR0A 2VBZA 7FD1A 3FMBA 5LJ5Y 4K4TA 5HLFB 1KFDA 1HI8A 3KWMA 2W8LA 2J9DE 3GMGA 3NCQA 4WKYA 3DLGA 3HM9A 3IGVA 3BO2A 2XNQA 5C42B 3MTKA 2MGZB 1Q78A 1NEEA 4C2MA 2RKIB 3PJWA 3PJXA 2GNKA 2LQBA 3K5OA 1IBMF 3IR7B 1SJFA 3W2VA 2CJ9A 3O5TB 2MZ1A 1N6QA 1HNZF 4C98A 1YJ9S 1NB7A 5BYQA 4DR4F 2YKPA 1NNDA 5MLCV 4V19J 1KFSA 4KHPF 4F50A 2LQJA 2QE5A 1A9NB 4ED1A 2XMWA 4L3NA 1BLUA 2AYGA 3Q23A 1C4CA 3O3LA 2IMWP 3KLGB 2YKMB 2OTJS 3MFIA 1QSLA 5GVQA 2VPWB 1RT2B 3DLHA 3PZPA 1LQ9A 2R4FA 1IKWA 4YOEA 1KRPA 2DR9A 1RAJA 1HW8A 2PN6A 2UZAA 3SSSA 2IC3B 4FS1A 5I42B 1X9MA 1VK8A 2PMZD 1VQNS 2MZSA 4N56A 1U7LA 3HHLD 1HWIA 2DGOA 2D41A 3MM7A 2ZOFA 2K7KA 2WCXA 3OTEA 2JEJA 4I2PA 5CYQA 3QIPA 1TL1A 2OPQA 4HI2A 4X4NA 4RW7A 3JTNA 2BABA 4OFZA 4OV1A 4CO0A 2HGNA 2NSCA 4X4TA 2J0XA 1VS3A 1LK5A 4X2BA 3CSKA 1FDDA 2LDIA 4O23A 4F2RA 1NK4A 3RB6A 3F41A 3BR9A 4H4OB 2EBGA 1CSJA 2J5AA 3MHYA 3CCUS 3V6DB 4DLGA 1TAUA 2IVYA 3HXMA 4HL9A 4C0BA 1WG1A 3DRXA 4DR3F 5T14A 4MFBA 3KOAA 2FC9A 4ZK7M 4WFZA 1SIWB 3U27A 2IYIA 5CYJA 1R8HA 3TAQA 3GV7B 2XMTA 3VTIA 2UU9F 1Q1KA 2X1GA 4DV0F 3EPIA 1HPZB 1XC9A 3RAQA 2CQHA 5LXYA 3TAMB 1SJQA 4CTAB 2Z8QA 3HJFA 3CJ2A 5L38A 4NCGB 4YDXA 1M1KT 4AL7A 1X4AA 1JLAB 4ELUA 2RRAA 1S6PA 2D3UA 4OZJA 4FN5A 1O8BA 1N5YA 1RP5A 4J5OA 4ZVFA 3SV4A 1QE1A 4UQTA 5DQHA 4HYKA 1IJFB 1PC4A 1RTJB 1C1BB 5L8RC 3PXGa 2A2DA 3BB5A 4WJBA 2FPHX 3T9NA 1LWCA 3BDEA 3QLHA 3N5FA 2AGQA 3EGZA 2COLA 4OLOA 3G71S 3K7RA 1LXNA 3PKYA 4ILMA 2Z4PA 2HNZA 2LU2A 2YWHA 4B3OA 4EBEA 1I6JA 4DQPA 2Q3PA 2J7UA 3IWNC 3SSRA 3CT9A 3ITHB 4MIAA 1X4EA 4R8UB 1NJZA 1TL3B 2POKA 5KOWA 1VQMS 3N6NA 4F02A 4OZ5A 2XMJA 4QIEA 2BV3A 1JLQA 3V6KA 4ILRA 4FYDA 3NWGA 5HMZA 4YR2A 2YWGA 1N5QA 3MR6A 2XWYA 3DXBA 2ZH5A 2FJDB 2KHDA 1UA0A 4U67Q 3MF5A 3RB4A 4ITSA 3JSMA 4Y65A 4M94A 3HF5A 3OVBA 1RJJA 2MMYA 3MDFA 3EGWB 4KIAA 5A8WA 5E3AA 5AE2A 1AFJA 2CVEA 4K59A 4C3LA 4GMKA 3TAPA 5LSOA 5E3PA 3MM9B 2VBYA 2BE2B 4I2QA 4KSEB 2VBWA 1T3NA 3AAWB 3RAXA 4JV1A 2VODA 4QPXA 1HWKA 1KOOA 4RUAA 2PFFB 3N28A 3TO8A 4AL5A 2ZH7A 2YNFA 3IR5B 4K5SA 2DH9A 4MIBA 3EGNA 3GIJA 1X5TA 1FRKA 2K2PA 3UD3P 2KI2A 3P6YC 1E6YB 3B4DA 2ZH9A 5E5NA 3DOLB 2BQUA 3D1QA 2C2EA 4U7CA 1K1SA 1SUQA 1HBNA 1TKDA 4XO0A 2UXCF 3P96A 2XG8A 4DL4A 1VQ4S 4OHZA 1IBKF 5H9EJ 1N5TA 4OHVA 2HRYA 3SYZA 5G0RB 4IRKA 4X4VA 4RW4A 3ZZYA 1RT1A 3I4HX 2DHSA 1WI6A 5K14B 1YJRA 1GTEA 3L95X 3N5BA 4DSIA 1LFPA 2MQMA 3RW7A 1VQSA 1S1UB 4ZPWR 2Y0SD 3I9ZA 4C0OC 2V4RA 2MZQA 1U1OA 1FD2A 2K1RA 3UD4P 2WB1D 4FVMA 4Q7AA 2FJAB 5AXLA 2W24A 1QJHA 3M4XA 3MAQA 5GADI 1F60B 1WHYA 3G86A 2E5IA 3KK3A 1RTDB 2QRRA 1L3TA 4ECYA 2VD3A 5EUHA 3KHHA 4JI7F 2ZOGA 2J7KA 5KG5A 2DGVA 2OPPA 1NK0A 4PR6A 1ZM3A 2FVCA 1WTFA 2FJXA 3NBPA 3EXCX 4N5SA 3KLVA