3WC0A

Crystal structure of c. albicans trna(his) guanylyltransferase (thg1) with gtp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
265
structure length
265
Chain Sequence
SKYEYVKLFEKENYLLPDTYIIIRVDGKGFHKFSQFYEFEKPNDLKALQVMNSAAEKLMSKYSDVMLAYGDSDEYSFLLRKNCQLYERREMKLTTLFSSLMSTYYMYFWSQYFPDKPLHIDHLPNFDARAVLYPDFKHIRNYFSWRQVDCHINNLYNTTFWNLVLKLKMTPQQAEQRLMGTVASDKNEILFKECGVNYNNESEMYKKGTIIVREFENYETEDEAELSKRQVQRLEKKRKKAELKIYHVDIINDDSWWKSRPWLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of reverse nucleotide polymerization
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
molecule keywords Likely histidyl tRNA-specific guanylyltransferase
total genus 88
structure length 265
sequence length 265
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wc0A00
4KGMA 3OTCA 3WC0A 3WC2A 3OTEA 3OTBA 4KGKA 5AXMA 5AXNA 5AXKA 5AXLA 3OTDA 3WBZA
chains in the Genus database with same CATH superfamily
1Q8LA 4J9VA 4M5IA 2W9BA 3VWSA 1MWYA 1JLFB 1AUDA 2NPFA 2KH9A 4O23A 3RB6A 1DQ8A 2XCPA 4LF6J 2AYEA 3BJYA 4RW4A 1Q8IA 2PN6A 2YPYA 2DHGA 2OPPB 4GO7X 4Y0FA 4IFVA 1YSJA 3R97A 1EIYB 4IUFA 4RO0A 1HA1A 3KJVA 1NK6A 2YQ3A 1S77D 1NRKA 2QL5B 3WZ0A 3QZ7A 2ZKTA 3Q8PB 1ZYQA 2RF2B 1WDDA 2AWZA 4WBFA 4RU9A 1AYEA 3NWRA 2MZQA 2GV1A 2UXDF 2IJNA 4P52A 2DY1A 3A3NB 3UR0A 3CMQA 3AXMA 3HKWA 2CQ2A 5IV3A 2W7PA 3UE2A 2G0IA 1UP1A 4I7FA 1VQKS 1LQ9A 2E1RA 3NOCA 5EWEA 2C28A 4UY8T 1JLBB 4G1QA 3R9LA 2D3O1 2NPIA 2KRBA 4AXIA 3K5NA 1K8AT 3W9JA 2RKIB 3D3CJ 4WFXA 3IS9A 3KKFA 4WFNQ 4DZDA 3SYZA 1X7VA 3THTA 2CJKA 3D0GE 3RR8A 2WB1D 1J5EF 3QJPA 1FRKA 2JSXA 3NBPB 5I3PA 4ED5A 3UWTA 1HL6A 4ES1A 3V6DB 3OTCA 3QMQA 2OPQA 3M8QA 4HVZA 2MY7A 1S9FA 2R8GA 2HGNA 2HK2A 5C2CA 1N0VC 3TAQA 2B56A 2EVZA 4QYZK 4I0WA 4ZCKA 5L1IA 4ED8A 3PW4A 2AU0A 1VBYA 1I5OB 3NGDA 2FLLA 3NAIA 3IM9A 5K8PA 3M8SA 5L1LA 3QATA 2B4OA 1JLQA 4ZOSA 4U7CA 4DR2J 1QTNB 2DIVA 3H42A 4EUVA 5KG2A 1ULRA 4AQYJ 1KLMB 4ECVA 3MM9A 3ENWA 3CDBA 1IKWA 2XMWA 1S76D 4FZVA 3OJUA 1W25A 2PFDA 3FZ2A 2LLZA 1LW0A 3JTPA 4OYIA 3SQGA 2CJAA 2I9SA 4BC9A 2AYMA 2YNFA 5DZ7A 5KFFA 4FYDA 4LF5F 3LANA 3RR7A 5B08A 1B64A 4ID5B 1GMUA 1HBMB 1FD8A 1NSKL 2QSWA 2IMOA 3HVAA 2PSZA 4FXWA 1M5VC 4OI6A 1KONA 1U25A 4RW7B 3W2WB 1BUXA 2LP4A 5E3CA 2JEIA 4OJ3A 2F3JA 3B82A 4FVCA 3CD0A 1FE0A 3A3PB 4N56A 2C22A 4Z7YA 2LU2A 4ELTA 2HQGA 3M9MB 5DG8A 3SV4A 4PUOB 4PRFA 3PIOQ 2KU7A 2OIHA 1XR6A 5KT3A 2XWYA 1U1RA 1RT6A 2WB4A 1SL1A 2WVBA 3MMCA 4F4XA 1M5SA 4LRDA 4F2RA 1P6TA 4KIAA 1CSJA 1FEHA 3C14A 2HLUA 4RUAA 4PXEA 4I7FB 2XULA 5F3TA 1SJ1A 4LRFA 3MPVA 3QT7A 5L46A 3Q0AA 1IN0A 1MROA 1JIHA 4WK1A 2HQDA 2ZD1B 4A8SA 2G2YA 4HT7A 5KFJA 1Y3JA 1S0NA 1IWGA 3GPAA 5EX0A 3PW0A 2R7OA 4C3LA 4WZQA 4TN2A 1IKVB 1VOMA 2RU9A 5DLGA 4J9QA 2PMWA 2XG8A 1VQ6S 1UWBA 1IKYA 1HW8A 2JFKA 3B54A 4NA3A 3W64A 4H4KA 1TFWA 3PKMA 2ZUGA 1C2PA 3KDNA 3EZ5A 4LF4J 3UFCX 2WSEC 3CW2C 3UI3A 3MFIA 3B4DA 3VZHA 2MLXA 1N4LA 4WF9Q 3OFHA 3C15A 4ZPVR 2EXUA 3TR5A 4C0OC 1HYSB 3BS9A 4QR1A 5B0EA 3PDNA 1U26A 3D1OA 1A6LA 2J6SA 2IA0A 1MN7A 3T19A 2HHSA 5HL7Q 2FVQA 1QUVA 3KG1A 3MPYA 2UV8G 3WX8A 4ECYA 4K5SA 3PYEA 1OPZA 3SV3A 1HD0A 2WBMA 2CQ3A 2Q3PA 4B3OB 1FVSA 2AEMA 2NREA 1KHWA 2PMZD 1GAOA 2DEJA 4OZ1A 4ZPWR 5K5MA 3ZZRA 4C98A 4HHUA 1FRHA 1FJGF 2FD2A 2R7WA 2YNGB 1HNWF 4DV3F 4LQ9A 1CULB 1P27B 1SH0A 1JLAB 2FTRA 3FBBA 3GIKA 4IOCQ 1KVJA 2FIUA 2VQEF 4NX9A 2YKMB 1KVIA 4YQWA 1FNMA 2QMWA 1Q0NA 1TK8A 4J9LA 2VBWA 3CIZA 3SCIE 1CQNA 2XZTB 4F4ZA 1XWLA 4DLEA 1RKJA 1UPMB 4KO0A 4RL1A 1WSVA 2PMHA 4RU2A 1N88A 3D6TB 1HNIB 5IC6B 3PR4A 1JKHA 2LEPA 2ZDPA 4L3NA 3BN7A 3S1TA 2L9NA 1F5AA 1G7CB 1SC3B 3ZTPA 5H1SV 1R8CA 5F8GA 1S6PA 5E3PA 3RB4A 4OI3A 2ZNZA 1YI2S 4YDXA 1S79A 2F8EX 3BSAA 5C42B 2BR0A 3J81j 4DHVA 2OPSA 4LF9J 2GQQA 1EX8A 2CPDA 2D41A 2DT9A 1F6TA 2HNDB 2XI3A 4JP8A 4DOZA 4EBEA 1RWKB 1V9OA 5GMEA 2IVMA 5KFKA 2XS7A 3TAMA 3ELHA 5D3GB 1A7GE 1RADB 4A8YA 3TI0A 2J6TA 2E29A 3M7VA 5KFIA 2W9CA 4ECWA 1K1SA 3LOUA 2YX1A 2BDPA 2HVHA 4DPXA 1CEZA 4IYQA 2FVRA 4F4KA 4YY3J 3JSRA 1C1BA 1YJ9S 5KAKA 4UTGA 1VRUA 1HBMA 3DRPB 3NS7B 3O6QA 3SZ2A 3PO4A 1TL3A 3H25A 3PIPQ 3CCMS 1FXRA 2J0XA 2GO9A 2VJUA 3NGSA 1TKTA 2ZOMA 3AB2B 5IQ6A 3DRRA 5LXRA 3R1HA 2XSJB 3J81Y 4F50A 4HI2A 3T5JA 3MPUB 1VQ5S 4NI2B 2G2OA 4EI2A 4X2BA 2QT7A 3C66A 3MF5A 5F9LA 1Y0HA 4HTIA 3D9BA 3LUYA 2FC9A 3Q24A 4CP5A 4L75A 5K20B 4JI6J 1U2CA 2B9WA 2HRTA 2MPUA 4ENOA 2XGPA 3MUMP 1U45A 2BXJA 5IT9U 1RTJB 3IR6B 4OYMA 3V4IB 4PKDB 1ZS6A 1RTDB 3PRBA 3AT1B 4KH0B 5FDLB 3CC7S 2YNGA 5IV4A 4EZ6A 1TKXB 1RU2A 3BDEA 4W90B 2HWHA 2MZRA 3K59A 3VALA 3IRWP 3TVZA 3U7JA 5D77A 5IS2A 2XO6A 4DV0F 2OMOA 4DUYF 5HBMA 1PO6A 2LXIA 4ZHRB 1IBLF 2CNKB 2RDIA 4AYBD 2CQGA 2V4QA 2ZBQA 3EZOA 3AH6A 4OHVA 1NSPA 5F3ZA 3GJTB 2KFYA 3MMAA 1Y5LB 2WHOA 1CVJA 1D09B 1SJQA 5ADZA 3GFYA 4B08A 3MMJA 3EGNA 4RKUC 4TLQA 4DCPB 2JLGA 4EO8A 1XTZA 4FPIA 3JSBA 2ILYA 2W4CA 2B8QA 1P1TA 1UAWA 1ZM2A 2XLIA 2XLKA 5F41A 1KD1T 2R8KA 1HWKA 2BJEA 2B8PA 4W4MA 2AQ4A 2HYIB 2QG9B 2CQ4A 4JI5J 5D4NA 2OGUA 2ZH6A 3LP1B 1FK9B 2W9AA 5BYQA 3WIUA 1OYDA 3K5MA 2OLWA 4ZJQA 3HSGA 1TK5A 3TX8A 4LRBA 1QM9A 2FHOB 3A12A 1TUWA 2W2NP 2UUAJ 3LPEA 5ETOA 3UW1A 4DV4J 2EPIA 4ECSA 4WXOA 5EWGA 2M52A 3ILOA 2VH7A 1FKPA 4NLYA 4UQTA 5EDWA 2MZ1A 2FZGB 3GIRA 1D3WA 3PYGA 5ETKA 1BQMB 2OSQA 4ZVTB 1RT1B 3M32B 4Y34A 3TARA 3FKBA 4MH8A 2QC3A 5HVGA 1T9WA 1REVB 2XSFA 1S9GA 1NM2A 4J9NA 4JV2A 4ZPDA 5J2PB 4E2FB 3ZZZA 2CJQA 2OSRA 2GVZB 3DLHA 1RAOA 4IG0A 1D0EA 3E2EA 2OH2A 2MQNA 3ICLA 4P75A 3Q86A 1HNXJ 2KZZA 3I5AA 2CVEA 1Z1ZA 1C0UB 1WOPA 1S48A 3KWMA 4KT0C 4Y2MA 2B43A 1BGXT 3DM2B 4NLWA 2CIMA 4I64A 5JMNA 1VC5A 2F9DA 1FJGJ 3MEKA 3QGPA 3U1LA 1YZ7A 4CH0S 1WOOA 3OR1B 4O4GA 5F0UA 4MK9A 5GAGU 2HNDA 3ZZPA 4YN3B 5KFCA 1J5OA 1S1VA 3NGUA 4WYWA 5CA5A 1PGZA 1XNRJ 5AXLA 2ZNYA 3GB0A 2UVWA 1R8AA 1V5IB 2U1AA 3N01A 4UT4A 4DMZA 2G9OA 3H7HB 4QR0A 4CO4A 5KT2A 4MYTA 5A8KB 3GV5B 4P2MA 4DV1J 2RS2A 1HBUB 2H48B 4N7TA 2J7KA 4QCLA 1IVZA 4B9NA 4L76A 1VDHA 2DNLA 2CQIA 2V2ZA 2XHWA 3ZO7A 2ZJPQ 3H8YA 5CXTA 3CD6S 3OXLA 1RGVA 4IH6A 4Y2KA 1YJNS 2BOPA 1XERA 3G86A 5DGBA 3DGVA 4MK7A 2ZZMA 1EARA 1HQUB 3GU0A 1TKTB 1IBLJ 3W3SA 1OWXA 1XQIA 4IO9Q 1AFIA 2HBRB 2C42A 1KQGB 3AA9A 1S7IA 2EWHA 2ZC4A 4XPEA 5GMDA 1OY6A 1HWIA 3LWMA 1RACB 2AW0A 2MQMA 1NDPA 3QFWA 3POTA 3R7BB 3UN5A 5EGYA 3FFIB 1V5VA 3FZBA 4JV0A 2DK2A 3CDEA 5T7LA 4U6PA 2VQFF 1NJYA 1IXKA 1RTDA 5L9NA 2C2ZB 4M5GA 3UDVA 2FZKB 3A8KA 2WSFC 2HZCA 3AD9C 4PZVA 4DN0A 3T5LA 1YGYA 5EWFA 1N33F 2HAFA 4F4AA 1M1GA 1X4FA 4N5SA 1SJFA 1R0CB 2XM3A 2MEWA 1TKZA 5E5NA 3MUVP 3KK2B 1UZHA 2CADA 2VZ9A 1KOHA 2J9CA 3QJLA 2MQPA 2JH3A 1BWEA 2VPWB 1LXJA 4Q8FA 2RQKA 4CDIA 1JXVA 1N56A 2OEKA 3ONQA 3CGIA 2K7JA 3DXSX 3OHBA 2IC3A 4OZJA 4FXVA 4Q8EA 5MLCV 2ABYA 4NCGB 4ZPAA 4DL3A 2CZVC 1NK5A 1Z4UA 1QVGR 1RHQB 2LDYA 4MAKA 1PKUA 2DGQA 1Y4ZB 1WF2A 3IC1A 4L72B 1OYEA 2BKOA 4RR5A 1SB6A 4AT1B 4DR5J 5MAOA 4HEA9 4XDDA 4KFBA 4WFYA 1S9EA 4H4MB 4OJ1A 4JI7F 1YQHA 3W60A 4OX9J 5ETPA 2V4JB 4DV2J 2AX1A 3OFGA 4USKA 3NGRA 3F41A 1N52B 1RAFB 4YR3A 1APSA 5HJXA 3TW0A 4A8WA 5JJBA 4RBUA 3GZ7A 5C25A 1UVJA 3KLHA 3JTOA 4PPDA 1VR6A 3QAEA 1RHKB 3CJ8A 4L6V3 4OZ2A 3GQCA 4JUZA 2M4MA 3ZTSA 8ATCB 3VAMA 4DUYJ 1G4CA 4B3SJ 5KFSA 4M5LA 4FYVB 1DLOA 2AEJA 2D7SA 2Y3YA 2KFZA 1RSCA 2Z8QA 3OTEA 4O3PA 5L9XA 4ALZA 1R0AA 1ICEB 5IT9Y 2GVZA 2FJXA 1R8HA 1W26A 1RJJA 5EHHA 1CJUA 2CG4A 3W2VA 4ED4A 2V50A 1C0UA 4QZVB 2GS8A 1YWXA 2V8PA 3QRPA 1IM4A 3DFEA 1H98A 2BW2A 3IG1B 2VD3A 4OYWA 1Q4RA 2KO1A 3E01A 3BQ2A 2CKWA 2KHCA 1URNA 2JNJA 1TMMA 1S72S 2I38A 5LM7E 3OV7A 5C2GA 3SEOA 3HZEA 5C24A 2O1PA 4NXNJ 2YH1A 2VIHA 5HJYA 2XI2A 3T1YF 1FXLA 2QL7B 1FWPA 2OMLA 2I0XA 3KJNB 2KKHA 1S0OA 3QO9B 2DR8A 4C6AA 1U0HA 2BVZA 5HROB 1YBUA 3LGMA 2RU3A 1X4EA 2V8HA 4R25A 3BPSP 2EFGA 3FK4A 1ZAVA 1N54B 1R8BA 3EPIA 3FCVA 3PACA 1NEEA 3NS6A 4Q43A 1PYOB 3P96A 5HP1B 3HO1A 1XK8A 1V3RA 2KVIA 2OHDA 3TQ1A 1HQUA 1RP5A 5CZVA 4YFUA 4ILMA 2O5DA 4F0KA 2AX0A 1ZAXA 2GJ2A 2UUCF 4DQPA 1HFEL 3H5SA 2ILZA 1QDUB 1VRTB 1ELOA 5A0YB 3AD7C 4OHXA 5G4DA 3R5AA 1SKWA 2A2CA 2JX2A 1N6QA 3EDRB 3H5YA 2RB7A 4WTOB 2UUBF 2PT0A 2IJFA 4FYXB 5GAHU 3POTB 4WE1B 2C2EA 2HAIA 4DX7A 1S6QB 4OI2A 3SCKE 2HIQA 2MHNA 4ED6A 1RAGB 3K17A 3M2UB 1OQ3A 4GC7A 4BCAA 1MMNA 2HQIA 3RRHA 4CLUA 2OPRB 5KFTA 4F0MA 5A2QU 2ZH1A 1TUVA 4C9DA 1VGYA 2ZBCA 1WHVA 1A9NB 2CUYA 1T0TV 2DNHA 3QQCD 3N0VA 4AUKA 4RW6B 3MCOA 3BYRA 3E8OA 5AXKA 4YHHJ 5DO2A 2CZ9A 4DFKA 5DM7Q 1UA0A 3KJQB 2QLFB 3GIMA 5AE1A 3G6VA 4IOBA 4IFYA 4UOHA 4LF7J 4QPXA 1YBAA 2IBOA 2IIHA 4D3GA 3R1LA 1HW9A 2D3OR 1SL2A 1V3SA 5K14A 5J1PA 2V6AA 1O5JA 2APOA 2C2OB 3H90A 1DFDA 3SIPB 1X9MA 5HO4A 2H54B 2LEAA 2IRYA 1FERA 4DUTA 2J5AA 1Y10A 3IWXA 5J1EB 4I69A 3ET6A 5HQ8A 4R8UB 4HYKA 1WACA 1WTFA 4F04B 1MW7A 3DC2A 4N8OA 1M1KT 5GVQA 5D0GA 1B99A 1BY9A 4HLBA 3TEHB 2QLJB 4Y2IA 2C2RA 1KFDA 1V6HA 5EX3A 5DDOC 1JQGA 3BPDA 3NWGA 1IBMF 2UVVA 1TVRB 5CH7B 1LW0B 2GMJA 4Y2AA 4CYUA 1RLCL 1EKRA 3IR7B 3M1VA 4OJGA 4Z37A 2IDEA 3WX4A 2YQ0A 2Z2LA 4KC5A 1Q16B 4WYLA 2ZJQQ 3RRGA 1UKUA 3FDSA 1KTQA 2WTFA 2BW7A 3JYTA 3ITHB 4KGVB 4PPZA 3IA0A 4DL2A 4MFBB 2FVSA 2NXJA 1GXLA 3PJ9A 3PCOB 1TL1A 5I3QA 2R2UA 1QSSA 3EZUA 2FHKA 1LWCB 4OYAA 2D74B 4QIWD 2CFXA 2DRAA 4USUA 1REGX 1F9HA 2Z2YB 3MMCB 4ELUA 4HDGA 3ULHA 4EGLA 5KFMA 4EZ9A 4FBTA 4CLFA 5A8RB 4OZNA 3DDKA 2HRYA 2BJ9A 2Q43A 1KHVA 3KUHA 2GIQA 2YWFA 1AZSB 1LFWA 3KJFB 4Q45A 2CPJA 3SDEA 3RTVA 3TVKA 1OJ4A 1VFJA 3H2LA 3QO9A 4KSEB 1JX4A 1U1LA 4OI1A 4B9UA 3D7SB 2GNKA 3M9NB 2HFOA 2ADCA 4F3OA 3KG4A 4O44B 4C4WA 4F8RA 2OELA 5KFDA 3HXMA 3M05A 4RPFA 1VLOA 2OD4A 3I0SB 2M2BA 2MQLA 4DSKA 2JRSA 1C4AA 4OZ0A 4DR4F 3DLGA 4BWJA 2GAHC 3HVTA 5I4MA 3K8VA 2E66A 2YKAA 3BV8A 1RBLA 2HBZB 1UVIA 1SQEA 2HHPA 4QIVA 4LIRA 3CDWA 2R9LA 4K0KF 5HQMA 2B5JB 4XIUA 1NJXA 5J2NA 4LFBF 5D8HB 3HSDA 1GH8A 3QGHA 1RAAB 1HBNA 3G6XA 4X4SA 2GZOA 3FEYB 3R6LB 5B09A 3MM8B 4MKBA 4MKYA 5C7PA 4PWUA 5KG7A 4B02A 2P9EA 1CJVB 1GTEA 3L95X 5CCLA 2W9CB 1NKCA 3GFHA 1Q82T 3VQTA 4B3OA 2VG5B 3IWLA 1UA1A 1WOSA 4FP9A 2U2FA 4USIA 2HGMA 1O0PA 5THWA 2KT3A 3TX0A 4R5PA 1VHFA 1UVMA 4B9SA 3DDNA 3UO0A 4ECRA 4I68A 1A0OB 3W9HA 2A6OA 3OQ2A 1AFJA 4IQXA 3HD2A 3P6YC 4DR4J 4X4OA 1GFWB 3DYAA 1WKKA 5DQHA 1XR5A 2IM2A 3GE9A 1D9DA 5KFLA 1OSDA 3CMES 2HHQA 1KOOA 3PYFA 1EETB 1YX2A 3P5TL 1JK9B 3DLEB 4FYYB 1HWUA 4V19J 1JJCB 2MGZA 2MMYA 1M5HA 3O2IA 3QT5A 4YMEA 2LA4A 1HNIA 2OJ3A 4A47A 4M5HA 1H2VZ 1OMSA 4CWBA 2P6TA 2W2PP 2XO7A 1QSYA 5M2PA 2RH3A 3T1AA 1RTJA 4K50A 4ETXA 2KTQA 4UOFA 3R2DJ 4N76A 1RB0A 2BOAA 4FKYA 4KHMA 4ZLPA 3Q8RB 4DV3J 1U1MA 1TFYA 3M6VA 2M8HA 3DI6B 3RG6A 1YG0A 1TL5A 2EFOA 2K3IA 3LP0A 3S01A 1GT8A 2ZVSA 1SKUB 1HNVB 5DRKA 1CLFA 2CJBA 4I4BA 4ZJOA 1JB0C 3GLJA 3I32A 1P9YA 1EKSA 2ZBIA 2OEMA 4C0HA 2I5JB 1Q86T 3Q8QB 1TL4A 4ER8A 3MDFA 2W4PA 1XJWB 4DV7J 1T05B 3HHLD 4JI4J 4OLOA 1FTCA 4I6AA 1E6YA 3PFOA 4LF1A 1U49A 4ELVA 2V2QA 3M8WA 1WHYA 2VC0A 3PVXA 1T11A 2X7IA 3AA8A 4NL5A 3JQJA 4X65J 5IC4B 4JV5F 4A46A 3AD8C 1RT7A 2QA1A 1MG7A 2VV5A 1ZAWA 2DYAA 1MLAA 5F8JA 3AY0A 4KHRA 4MIBA 2D1CA 1HBNB 4QIGA 1JXLA 4IFVB 1G3OA 2NCKL 4KE5A 3OL9A 4DWIA 2EG1A 1FK9A 3OT9A 4Y00A 2NSCA 2HZAA 2ZC3A 1PG5B 3KJVB 4ED2A 5SZTA 3QLHB 5L8RC 5DLFA 1SC6A 2CJYB 4NLPA 2RF2A 3OVBA 4A48A 1DTQA 2FLOA 4OYOA 4ETZA 3LO3A 4B3TJ 1EQ0A 2N4DA 4EWTA 3OLAA 3FSXA 4V19X 2QEXS 1FRIA 1LOUA 1VI7A 5A8RA 2E44A 3KLIB 3HD1A 4HH1A 4I6YA 1RT1A 3M32A 4LSNB 2F8HA 2LECA 2XB2D 1R89A 4K4ZA 2PIIA 5AE2A 7FD1A 4GKJJ 3R7NB 4WZMA 3OTOF 1S1WA 2WOMB 1S7HA 2ZH4A 4NLXA 5ETRA 4J90A 4ES2A 4O44A 4NA2A 2CZ4A 3GG0A 2MGZB 2XNRA 3Q8YA 5E3RA 4QQBA 1U1QA 2HPUA 1N32J 2BMBA 3RUBL 3V6DA 1VC6A 3R5JB 3D68A 1LNQA 3GSDA 4ZJLA 3LAMA 4ZP7A 2H51B 3SMZA 2NSBA 3H20A 4CTAB 4QU6A 1IKXB 2KT5A 2WVCA 5KG5A 2IYGA 4DQRA 3BBFA 5DM6Q 4CIOA 1NK9A 1FDDA 1HNVA 2H5JB 1CJKA 3DGPA 3H2UB 5T14A 5F0WA 4ECTA 1VQ9S 3VAGA 1YJUA 1S1VB 2IRUA 2EC2A 2V63A 3CIMA 2E1CA 1R0BG 1YZ6A 4QWDA 1BC6A 3JSYA 1CJVA 1MWQA 3P4UB 5D4PA 3TWZA 1RUSA 2BE7D 1IJFB 2FVCA 3ILLA 3Q83A 3LGHA 1I94F 4QYRA 3DDIA 1TV6A 2A10A 3CCLS 4M94A 2DXEA 4WFBQ 3BGLA 2HURA 1VQ8S 3FRYA 2JC1A 5DDQC 5LJ3Y 2E5JA 4DV1F 3OL7A 2BV3A 1X5OA 2ZKUA 5H9FJ 4ZIVA 2DCUB 3DOKB 1TQLA 1TR0A 2C3YA 3FCWA 2E5HA 3HZGA 4RWXA 4M5DB 2DNNA 1OPIA 5KT4A 4LQ3A 2B9YA 3CDAA 4C8MA 1NDCA 1S1TA 4CLZA 3DLEA 1X8DA 2D3ZA 4C7QA 3ZTOA 3GTYX 1NUEA 3CSKA 3J81U 3PW5A 3EUNA 3FQLA 2JEGA 2VDHA 1X4GA 4HACA 4E98A 3OSPA 2VOOA 1MWZA 1BQNA 4DG1B 5J2QB 4NPOA 5HN0A 1RAEB 5ETTA 4R0EA 4PWDB 1D9FA 4ED0A 2RRAA 1JLAA 2R4FA 2K3KA 3AAWB 1SH2A 1TELA 3L4BC 4YDDB 2FLNA 5D15A 4BWMA 5I3UB 3OUYB 1Y7PA 2HRUA 2ALZA 3KK3A 4M5NA 1FWLA 3G8SA 3EICA 2Q6CA 3O3LA 1UJ6A 4OX6A 2MKJA 4ANDA 2LEBA 1DZ5A 1UWBB 1IKYB 1ZM4A 4LVNP 2IYIA 2F1FA 4ZVOB 4MMOA 1N34J 2DB1A 3WC0A 3HHLA 4GVBA 2BJ7A 2XY5A 1H7WA 3OL6A 5A8WB 1NHVA 1T9UA 5AJ3J 4ZLJA 2P8IA 1CJKB 3DGPB 4LBHA 3TZZA 1FFSB 3B78A 4ZVGA 2MQQA 2ZH5A 1B0TA 1EAYC 3GJRB 4KFBB 1JMTA 2ASDA 4LF2A 3QYYA 1U1OA 2CPIA 5DG9A 5K8NA 1ZA2B 3C46A 1NPKA 1VQLS 3CCJS 5F9NA 4DR5F 2NUHA 2VBXA 2C2DA 4GVLA 1C1BB 4ANEA 2W7OA 2IVYA 2XTJP 4O3SA 1VRUB 3DRPA 1VYAA 4LR7A 4DCJB 1WEXA 4DV0J 1CULA 1RWOB 4UOGA 3JB9k 3D2WA 1WC4A 2YKPA 3H2VE 1R43A 1WC1A 4QWBA 4BBYA 2CQHA 3IMQJ 2QMXA 2AHOB 4UZCA 5B0CA 1FFGB 4TLRA 5IT0A 3ENAA 3P5BP 3T9ZA 2XYGB 1BQNB 2DNMA 1KSPA 1P1LA 3MEGA 3KLGA 4DR6J 3ZFVA 4NOHA 3DMJB 4NLTA 4QWEA 1JJ2R 2CDRB 3IBCB 1R8PA 1XN9A 4Q2LA 1Q8KA 3CCVS 3NLCA 3D6MB 3TANA 3AFGA 3MEDB 4QIFA 4J9RA 1GTHA 3D1QA 1L5UA 1KVKA 4KHPJ 1WG4A 2HBYB 4F26A 4ZHRA 4RNMA 4FF2A 2CNLB 2BYCA 3KLFB 3H40A 3CJTA 3BO2A 4I67A 2Z4PA 5DQIA 4F0HA 4ILLA 2F4FA 2YWWA 1R7IA 1EP4B 1JLGB 3OJSA 4X84A 2QFJA 5KG6A 3AOAA 3UDCA 5BYRA 1U1KA 1YHQS 1CS4A 2DIUA 3IR5B 3KLHB 3I9ZA 4CLYA 2FC8A 3D0IE 1S5ZA 1YBTA 4NLVA 2RMLA 2DGWA 1TL3B 3TQEA 4MT1A 1PSDA 1U6FA 4PYDA 5KFBA 2XSJA 4ZVQB 2DRBA 1VQNS 4DF8A 4C8OA 2VODA 4XO0A 4DPTA 1K47A 1WHWA 3DLKB 3SFUA 1H74A 2I1RA 3C6UA 1SQGA 4BLGA 1NJWA 1N34F 2NS1B 2K1RA 3MR3A 5AE3A 1AB8A 2CPXA 2EFPA 3UQSA 3W2VB 9RUBA 5AJ3F 1IR0A 1HBOB 3HHEA 4ICLB 2WK4A 4IR9A 3CJKB 4DFJA 1FDNA 2XMMA 4WJBA 1J27A 3H5UA 4HL9A 3IO1A 4FS1A 4P10A 1IUJA 3VGSA 4IO1A 5HI7A 1TU0B 1XR7A 4V1Ak 1X0PA 3V2UC 4CI0B 2ZM6J 3IXQA 3PEHA 2HHHF 1UVLA 3M8PA 2XY7A 1SJRA 5J2PA 1ZZNA 3PKYA 2J8AA 3UD4P 1WWHA 4LRAA 2GJFA 2FYXA 3TUZC 2F9JA 3T6JA 4NLDA 1XC9A 1BD6A 1HI1A 1SVDA 4JI0F 5CAAA 2DTJA 5F8IA 2C3MA 4LVOP 2DNQA 3BBBA 1VMBA 2MXYA 2V67A 4KGXB 5HMXA 4JB8B 3FBFA 3G82B 3RAQA 4I56A 2HQCA 3FUYA 2AGPA 3VGTA 1FWKA 4URQU 3I5BA 5HMZA 3EX7B 1J5OB 1QLNA 4F7VA 4YOEA 2Y0BB 3LP1A 3AJ1A 3CE8A 3FEZA 3M6WA 4Q44A 1NK4A 1FI4A 2M3DA 1H0HB 1PAUB 1TL7A 3KLFA 4KV8A 2ZH9A 1JLCB 2ZWOA 3MECA 3HI9A 2CA9A 4GC6A 1RHRB 5HVHA 5RUBA 1HR0J 3AQPA 3RB0A 3MUTP 2BJ1A 2AJFE 3QFHA 1H7XA 1IM6A 3N9UC 1GXUA 2PGCA 2VFRA 1R3NA 1VQOS 2UXCF 1H38A 3CVKA 2OKQA 4RUHA 4WPAA 3R5CA 2F4VJ 3AHPA 2PDAA 4P2SA 5K9FA 4CYUB 1YTYA 4W92B 3NNHA 3V6HA 4O3NA 1G1XA 5IWAJ 2A1BA 4ITSA 5KFGA 3RBDA 1F60B 1RI7A 2R7VA 3MM7B 4C48A 2CQ0A 3DRXA 1CG2A 3TEGA 2OFGX 4N41A 4J9SA 4DX6A 1FFWB 4DV6J 2BACA 3CJ3A 2V2KA 1NZAA 4MYUA 1U2FA 1X60A 2W2OP 1GQEA 1HBOA 3DOLB 3ILJA 2RAQA 4PYAA 3RBEA 1FNXH 1WC5A 3RJMB 2ZFHA 1LWCA 3OL8A 5E3AA 3LW5C 5L1JA 5IWAF 2EFQA 4X64F 2JDJA 2DR5A 1FRMA 1GXTA 4F36A 4WKYA 3I6PA 3KDOA 1U0SA 3IRXA 3HM9A 1QSLA 1VQMS 2ROEA 2LXFA 5D0RA 1PBAA 1TKZB 1UWAA 1F5CA 1KQFB 4CT8A 4XTTA 2CWKA 1RT4A 1S10A 3MEEB 1KLNA 1KP6A 4G65A 5FIIA 3ILIA 3VCDA 2ZZNA 1XNQF 4FS2A 3RW7A 2FUG9 2RUGA 2RNEA 2RRBA 5BXIA 2RHQB 5C5JA 5A6WA 2QN6B 2YNIB 4WTYA 3GIIA 2VOPA 3QRRA 3NBPA 2VG6A 3PJWA 2IHR1 1DY3A 2B7CB 2LQJA 3A1YG 1YRXA 3UR3C 3W63A 2B0GA 3KUGA 2HKEA 3M8QB 1SPBP 4PG5A 1XIQA 4LIWA 6FDRA 5HSPA 4NLQA 2FGCA 5LMNJ 2GVDB 3TRGA 4DN9A 2K2PA 5J2NB 3CDUA 4LT6A 4NYPA 3F44A 4X66F 3JYTB 2VDIA 3M6XA 3LQVA 1T03A 1F3VA 1VQ4S 4MFBA 2R7TA 5CYMB 4QOTA 3EGWB 2QZ8A 3QBCA 5KG4A 3QIPB 4DU8A 3PX0A 4ZIWA 3BO3A 4IR1A 3FFIA 3MM9B 1UFWA 3NL0A 4FXDA 4ES3A 3M4XA 4ED3A 4WP8A 3OFEA 2N4CA 2MQ8A 3AOBA 1FCAA 1HHTP 4QIEA 3M6UA 1ZBTA 3VAIA 2AYBA 2A3JA 3N79A 1ZZFA 2CQCA 2J7UA 2XMJA 3HLUA 3P3DA 4K2JA 2GAGC 2VQFJ 4X4NA 3W2WA 2M7SA 2DGSA 1O6XA 2CPHA 3G8TA 1H2UX 4AFFA 4IRCA 3K5PA 4IG3B 4O0IA 5CD4H 3B4MA 2DGXA 1U02A 4LR8A 3BO4A 3QSYB 3RB3A 2GIFA 4CLKA 4BS2A 4Y2CA 4C8LA 2RILA 2FJVA 2F4VF 2NXCA 2ZVIA 3BKUA 3O44A 3OR2A 2W8LA 3UCGA 1RCOB 2KN4A 3G82A 1SL0A 3M8RA 3DLBA 3KHRA 4YB5A 3HVTB 3WBZA 1SUQB 2BRKA 2ZHBA 2DKOB 4P74A 4PR6A 2VQEJ 2MKYA 2UUBJ 2OTJS 1K9MT 3LP0B 2BJ3A 1C0TA 2H5EA 2IVFB 4OI4A 4KV8B 4DF4A 2NYHA 4EO6A 3MEEA 4LRCA 4K4UA 1WF0A 4KYZA 5B7WA 2DNGA 1H6KX 2OAUA 3VAFA 4RW8A 4YR0A 2NR0A 4NEZA 1LWEB 1KLMA 3L7UA 1TP7A 3W61A 1XNRF 1CPZA 5LSOA 1MU2B 3LTOA 1B7FA 2YNIA 3MMBA 4PEOA 4OV1A 2Y1RI 2SXLA 4DSLA 5HP1A 2HBQB 1LWXA 4OMFG 3U27A 4M95A 2N3OA 1N8RT 4MJKA 2C1EB 3TYTA 2ZH7A 2XEXA 3G8QA 2J0SD 1CC7A 4OIXA 4IRDA 1SCJB 4O4RA 4RW7A 2GHPA 4XK8C 3VAKA 1Q1KA 3MM7A 2HG4A 2YH0A 3AJ2A 1HHSA 2BE2A 2HS4A 2PEHA 3GP9A 2BE9B 4GMKA 1Q53A 5E3QA 2BRLA 2KXFA 4OZLA 2VUGA 2K8GA 1I51B 1ZM9A 2JZ5A 2UV8A 3Q2SC 4RNOA 1N6QB 2UXDJ 2M88A 3BGRA 2GO8A 1FT8A 1MMDA 1S6QA 1U8WA 2Z2MA 2HNYA 4KR0B 5ETQA 4Y6IA 1Q8BA 3P45B 1DTQB 1RA6A 2CQPA 3R8YA 1NDLA 2KDOA 2FVPA 5KFZA 1VBKA 8AT1B 3IG1A 1W2IA 4CO0A 1CC8A 1DQ9A 4O0NA 5E41A 4LF7F 4USJC 4KHPF 2HSEB 2JVRA 4DL4A 3C14B 2ASJA 4RW6A 5C24B 1C1CB 4WU3A 2V68A 2ROPA 3MD3A 1EHWA 2YKMA 2ZOFA 1URRA 4USVA 2YWHA 5DZ6A 5CYJA 9ATCB 4Q7AA 2Z2ZA 4I6WA 3KHLA 1T94A 2CPFA 1B4SA 1T05A 3Q8UA 5ITHA 4P6QA 2BABA 1R31A 1RWMB 2Z56B 3D3BJ 3ENVA 4I2QB 5KFNA 1IWAA 3N28A 2G0JA 4ZVSB 5J1EA 1IQZA 5D0HA 1I6JA 1NBEB 1EZZB 2VG7B 3C15B 3H0PA 3GYGA 3SFGA 2E5LF 5C42A 4BDPA 2ACYA 3UD3P 2R7RA 1B3TA 3RZAA 2V69A 1FD2A 4KGMA 3TVYA 3BGOP 1FDAA 2CJ9A 3BYPA 2AZ1A 2CYYA 2MLYA 2V2VA 3GONA 3QSIA 4J7CA 1NSQA 4ECXA 2DPJA 1DAXA 1N36F 2UP1A 2FGOA 4CO5A 1WELA 2LQ5A 1FX2A 4OYPA 3KMQA 3FGVA 5KT6A 4N8NA 4F3MA 4TNOA 4AXJA 2CDQA 2F5GA 4G6VB 2DH9A 4U96A 3TUIC 3OSNA 4YB1P 1TV6B 2L08A 2CWXA 5KFYA 2DO4A 1XNQJ 3MXHP 1UJ5A 3IM8A 4RNFA 2HHVA 4Y65A 1L3KA 3SSQA 4TY9A 2XBPA 1VLYA 3KLIA 2AV5A 3M30A 2J9EA 2QRRA 4WCEQ 3ZXWA 3MCSA 2X1AA 2XY6A 4KQZA 1GMWD 5DGAA 5ETLA 4JI0J 1WKJA 4JYAJ 1RTHA 1LKZA 2V9KA 2Z0GA 4TQRA 3UVJB 4DXLA 3CXCR 1WD6A 3HVWA 1BXNA 3U1NA 3W66A 4J9KA 3BM7A 4UW2A 2IFXA 3KHGA 4DR1J 1FRLA 1JKHB 2C3UA 3M2VA 3GV7B 3EXCX 4ZCMA 1N33J 5EUHA 3LWLA 4NMLA 3LA0A 3R7SB 2OO4A 2AJ4A 3D66A 4L3KA 1S12A 3FSIA 3MWBA 2H65B 3KXDA 4RLEA 5FDLA 2OP5A 2R2RA 1IBMJ 1IKXA 4R8UA 2X3GA 2UUTA 4CM0A 1DURA 4DL7A 1IBCB 1AZSA 2PO4A 4B3RJ 3PRDA 4X4TA 2F7VA 2R7QA 4J37A 4FN5A 1VHIA 4PG6A 5L39A 1SI9A 4ZITA 4LBIA 3KOAA 1T9YA 4RW8B 3GV8B 3SXLA 2MKSA 2KJWA 1ZTWA 1S6UA 2AZ3A 3I0SA 4B9TA 4PQAA 4P7VA 2YWGA 2VB6A 4KH1B 1BLUA 3MAHA 4EK2A 1ZOTA 2MZSA 5LT5A 5HANA 3G71S 3I0RA 3QNWB 2E9ZA 3RBXA 3KK1B 1YLXA 3DXBA 2P5VA 1PAEX 4ZK7M 2IM0A 1SIWB 1VQ7S 1S57A 2BE2B 2KM8B 4JI7J 4LREA 1L3VA 4M5DA 3FNNA 2K06A 2WONB 1Z2ZA 1ZA1B 5EN1A 2LCWA 4NYZA 2HHUA 4CO1A 3IBFB 4O3RA 2RQMA 3T3FA 5HAOA 3HHDA 2KJVA 2LU1A 3CT9A 3THVA 2YY3A 5GAHI 4CLWA 4HKQA 1WEZA 4HH0A 5IM0B 3ZTRA 4AE5A 3PX4A 1VBXA 4ID5A 2QA2A 3AB4B 4JI6F 4RZRA 2CG8A 3KLEB 3K5OA 4CH7A 3WDOA 2PA8D 3TA0A 1JLBA 1S99A 4G1QB 4C11B 2I8EA 3PTWA 3C16B 3RW6A 2RE1A 1S9GB 2E1MC 4H4OA 2AIRB 1RTHB 3R5GA 5KTQA 3K58A 2M8DB 1S6OA 5JXSA 2LQ8A 4PUOA 1S4FA 4IG0B 5LXYA 3P49B 1RYRA 4NASA 2Q66A 1RBAA 1KR4A 1RT5B 2B3TB 5KT5A 4BC7A 1RT6B 3CMAS 2BUNA 3QAUA 4A8QA 2QMUB 2N7CA 2DRDA 1U24A 1YIJS 2WVFA 1RT2B 2DNOA 3A8IA 5LMNF 1VIXA 2OPQB 2XZWA 1RDRA 1SV5A 3BSOA 3HSJA 2GGPB 3I4PA 2YNHB 3MCMA 2B9XA 1PC5A 3GFXA 1FRXA 4FPRA 4U67Q 1X5TA 1Q7YT 4KTQA 4ILRA 5GAEU 3MEDA 2ZD1A 1FF2A 1Q95G 2MKIA 3MFHA 3MAQA 3CCWA 5BJRA 5A76A 4NLOA 1X4AA 2OEJA 1PCAA 2UUCJ 1KBRA 1TTHB 2VPXB 2KL8A 1IKVA 3JQKA 3N5FA 3HK2A 4DL6A 2BBEA 2O66A 4M1KA 4DJBA 1H3DA 3UD5A 4OQJA 1P8GA 4USHA 5CHCB 3SQGB 1WSRA 4OYXA 2QGFB 5A8KA 3JSMB 4R5PB 5GADI 2I6WA 3S6EA 1B0VA 1HWLA 1CS4B 1TZ0A 2FJAB 4DPWA 1FKPB 2FHJD 3I96A 4U7UD 3KLVA 2MB0B 2OTLS 1BQMA 4M5MA 1VQSA 1KS2A 2BJDA 2DEIA 3PFEA 4PG8A 4YY3F 2DR9A 3VTIA 4MKAA 2DR7A 4ZMMA 2AGOA 1X9WA 4IRKA 2C2MB 2KG0A 2A0FB 2ZHOA 5LSRA 3N6LA 4KGZB 2HVEA 2XMTA 4JI1F 4X4RA 2VPYB 2K1RB 3MD1A 3BKTA 3CCUS 2BM1A 3R2CJ 4QU7A 1S1UB 2AT1B 2A2DA 3M2VB 8RUCA 3PZPA 1QTMA 4ICLA 1D8ZA 1O51A 1F0XA 1RABB 1RCXB 2VBZA 3MEGB 5J2MB 3KLGB 1NNDA 2HEKA 3PV8A 1HNXF 1QJHA 1B70B 2UZAA 3BH7B 2E7WA 5E7OB 3VR1A 3ZZUA 3DI6A 2HFSA 3T1HF 3RRKA 1AT1B 1NJIT 1MROB 3CJ5A 3C16A 3QGGA 2OUGA 4N47A 4UZBA 2B6AA 3Q89A 4DX8H 2BKNA 1Y11A 4H4OB 2WSCC 3Q23A 1YJ7A 2CXEA 1GMVA 2JOQA 4URSA 2A6MA 3FRZA 7FDRA 2MKHA 3Q22A 1Q78A 2MSSA 3JAMU 2C2NA 4DSEA 1LEOA 1I3OB 2EW9A 2V34A 4E8UA 2BA9A 1BE4A 1E6VA 3J7ZT 2L9DA 3DN9A 1H72C 1SV5B 2VC1A 1YJWS 3KTQA 3KFWX 4TKTA 5IXUA 4DR7J 2Z58B 2OPSB 3MR2A 4DL0C 3AXKA 2ZJRQ 3W5ZA 5IT4A 4KRWA 3V4MA 2MKKA 5FJ4A 2EKNA 2FPHX 4TU9A 4AL7A 3O5TB 1NDKA 1U4BA 3S8SA 2QLBB 2MKCA 2NXUA 1S59A 1FE4A 4B9VA 5D6GA 3JSMA 2JEFA 4QJVA 2Y8WA 2EKYA 1KDNA 1FEEA 3D0HE 5T7LB 3KLEA 3HP6A 4USWA 2AYGA 4LMZA 4A8OA 1JJ4A 1EB0A 1U6ZA 1HNZF 4ZVHA 4NXMF 2Y8YA 4OHZA 4C0BA 2JHEA 3CUNA 2KZMA 4UUXA 1K0TA 3DOKA 2KG1A 4ED7A 3NAHA 2ZZTA 3W7BA 2O67A 1S1WB 2WOMA 2Y0SD 2BANA 3LP2B 2BQ3A 1ZPWX 3DNCA 4TQSA 1VJWA 4ZVFA 3LF0A 4B9LA 2FJEB 2QX0A 3O8WA 4DR3F 1RLDA 4J9PA 1T02A 2YBVA 3MM6A 2LQ9A 2AJQA 2RDJA 3DKDA 4WP9A 4IOAQ 4GKJF 1GX6A 4AD6A 1DARA 2IC3B 1RE1B 3TP2A 2AMCB 3OHAA 5J2QA 1VQYA 2L9WA 4C8NA 4CRJA 1HNWJ 4EEYA 4LSLA 2X1FA 4P2XA 4KB7A 1S97A 2UXBJ 3VGVA 2W1BA 4WU2A 4CT9A 3E01B 1F9FA 1U8SA 1UJ4A 4XPCA 4X4QA 1NB7A 5KG3A 5CQGA 1D8YA 2GMLA 3KK3B 4DS4A 1S9EB 3W9IA 4B3RF 2GFFA 2R7UA 3DRYA 1ZTTA 3DHWC 3DOMA 4DU7A 2QYGA 1NB2A 1N5YB 3PYDA 1U0HB 2UUWA 3EMTA 5HK4A 1SXLA 5HROA 3VV2B 4PWWA 3FC9A 2V9WA 1EQMA 4MK8A 1ZH5A 1VIOA 1FX4A 2N7YA 5AXMA 3TOQA 2VG6B 2LKZA 2DGUA 4DV7F 4JI4F 2YKOA 1LV5A 4IH5A 1RTIA 2WAQD 2HIYA 5U47A 3UNGC 3CD5A 4JOUA 5JVHQ 2DCLA 2BX6A 1VBZA 4A4JA 1JJHA 1DBDA 1HWJA 4DFPA 1T03B 4ZA1A 1CJUB 1N5QA 2MZTA 3GYNA 1NMEB 3NCRA 1S1UA 5ETVA 2HZVA 4NLRA 2WW8A 3LGNA 2WCXA 1NPPA 3MOZA 3QIPA 4DG1A 1IR2A 3MAAB 3PEJA 5JVGQ 5J2MA 1WI6A 5I42A 4C8YA 4Q0BB 4I2PA 3J7YU 5BR8J 2NXEA 3HPOA 4K4YA 2OPRA 3BKFA 1TKXA 2B4PA 4O3OA 1RTZA 5E2QA 3L09A 3QGIA 4L73A 2MHEA 2FHJA 1M5OC 1HNZJ 5B0GA 3LP2A 4PXBA 4ZPBA 2EFNA 3QT8A 4ZVRB 3OTOJ 3BZQA 1UTAA 1UPPA 3OW2R 2IMWP 1UCNA 2IDLA 4NCBA 4UY85 2XHCA 4P72A 1UEVA 4YP3A 3W8GA 1PYSB 2ZOGA 3L7OA 3MTJA 4DV6F 1OSCA 3GCXP 5FD1A 3T9NA 1U2RA 1WUUA 3QT6A 4I1TA 1LK7A 3RYLA 5HMWA 3NG8A 3HHLB 4GVBB 4LSLB 2QIFA 1PBUA 3HFZB 3TA2A 4RX6A 4KGKA 3L7PA 4NYOA 4P2FA 3TZWA 4OI0A 2KHDA 5A8WA 4NRUA 5GAGI 4LJMA 4CLTA 3FVYA 1M0SA 1TMJA 2MTLA 4IQMA 4U8VA 3J7A1 3TAPA 3ZZTA 1NZ8A 2VL1A 4JI8J 1FHTA 3QIDA 2GVDA 4AQYF 3EGVA 2FDNA 1U1NA 3OTDA 1N5SA 2ZH8A 4UUWA 3A8EA 5GAEI 1RWVB 1FTRA 1WF1A 3PW7A 4DR2F 2R8JA 2FB0A 3PM9A 3FQKA 1UETA 1UFKA 2KRRA 1VK8A 1Y00A 3NCPA 2X1BA 1IQTA 3IWNC 3DLLQ 4LR9A 2AGQA 1PYTA 1RISA 2O01C 3MMBB 3I5CA 1RYSA 4FF3A 1SH3A 2FQQB 5GADU 4LF4F 3D1HA 2W9BB 5HLFB 3NGTA 3BH6B 4DQIA 4ZPTR 1RTIB 1YJVA 1RQ0A 3BB5A 4WIQA 4F2SA 2XCAA 4ATNA 2VA3A 3GCWP 1NO8A 4DQQA 2YKNA 2DXFA 5KG0A 1KQKA 4KPYA 4YUDA 4IG3A 4IFYB 4CNZA 2ALYB 2V0NA 2W24A 1I1GA 2B51A 2H9ZA 2GC8A 5A6PA 3FMBA 4X62F 2KVQE 4TYBA 2XYHB 2ASLA 4B3TF 5ETMA 2GHVC 1B7YB 3X1LB 6AT1B 3CNQP 3C2PA 3TZYA 3IGNA 3JTNA 3LPYA 3TJAA 2Y1IA 2D9PA 4NXNF 3K7RA 1PJ6A 1DJ0A 4DSIA 3P8BB 1TKDA 1WEYA 2ACMA 3OPKA 3FCHA 3RAXA 5D78A 1SC1B 1F2GA 4DZ6A 5LMUJ 3CF5Q 3DU6A 4YR2A 4EYIB 1JNRB 4C97A 2XYPB 3DOMB 3QZ8A 4DLGA 4KY3A 2B9EA 1AA1B 2D9OA 4K4TA 1XEZA 4URGA 1RHMB 2MZJA 1HBUA 2J9DE 1JLEB 3S7RA 3T5KA 1KC8T 2DHXA 1QUPA 1T7PA 3ADAC 1FDBA 1FESA 2WBRA 3PRVA 2V8GA 2ZH2A 2IBKA 4WIIA 1KFSA 4PXCA 3B8HA 4F25A 2QJ3A 1HKAA 4ANCA 3VHQA 3RBZA 2XGQA 1GMWA 3M1VB 2EBGA 3C6TB 3V6KA 3J80U 4YB6A 1S1XB 2KI2A 2E9TA 2B5JA 3BF4A 3OVSA 4J9MA 2ZWPA 2AF6A 4NLGA 1TAQA 1AW0A 2V4JA 4F3QA 3VAJA 1UL3A 2OPPA 5K8MA 1JWWA 3I55S 4HDHA 3HDSA 4CO2A 1NKEA 2BZ2A 2WVDA 3MM8A 5IOLA 1Y3KA 1JXEA 1TL1B 2IM1A 5F8NA 1QY7A 4P7TA 1M1HA 1GEHA 5KFXA 3G6ES 2E5IA 3N5BA 4I2PB 4B3MF 3A3OB 1KWMA 1YDLA 4PG4A 2ZM6F 2YNFB 3CC2S 3G87A 5HLFA 3M8PB 1R6YA 3M30B 3U1MA 4OX7A 2RD5C 4EMDA 1RWXB 1OY8A 1SKRA 4ZP9A 3SDEB 5E0OA 4JI1J 3HJFA 1X4HA 3BQ1A 5B0BA 2B4VA 1FJ7A 3GJSB 4ZKAA 2M5YA 2H4WB 2HHHJ 3OD2A 1SKSA 2Y9HA 4YHHF 5L38A 3D54A 4PCQA 3OXFA 4TU7A 2BEFA 2ROGA 4DQSA 1WG1A 3N6MA 4N77A 4WP3A 2W01A 1QD1A 1UW9A 2A18A 4NRTA 5G0RA 4B17A 3NNCA 1HD1A 3TJ8A 2YWKA 2MDAA 1YKWA 4X62J 2KM8C 5IFMA 5JUMA 1FNOA 2FJWA 3CJQA 4HT5A 5GMKa 3VAHA 3GFZA 1RWNB 3CB4A 4ZP8A 1HPZB 1NHUA 2KXNB 4K0KJ 1J2VA 4ZVPB 1TAUA 1PJ7A 3EVWA 4LSZB 1Y5IB 1X9SA 2ZDOA 2DITA 2EI5A 3PNIA 5F8MA 3D28A 1NCLA 1FKAF 4NLSA 2DH8A 2MYFA 1UFLA 3CWJA 2AJ0A 4Z7CA 2JWNA 3K57A 2R8IA 2ADBA 3EVOA 1UEUA 3KHHA 2P6SA 2IRXA 5KT7A 1QAXA 2KYZA 2CPYA 3F0NA 3QRQA 5KFEA 1RT7B 3CO0P 2W8KA 1HYSA 4X4VA 4LUBA 2HWIA 2ZITA 3Q8SB 1RWPB 2F63A 2IM3A 2RT3A 4J9UE 2HFVA 1WC3A 3OLBA 4EBDA 2WONA 1EETA 3VVUA 1RT3B 2HS3A 3MPWA 4RNHA 4OHWA 4LF8F 3NMRA 1UEKA 2EFVA 3RU0A 3M2UA 3PY8A 3VGUA 2DGTA 1UW4A 3SQOP 2ZH3A 1TK0A 3D4JA 1KN6A 2DPIA 4XDCA 2EEYA 2XMUA 3Q8VA 1LWFB 5HATA 4PG7A 2WVEA 2E5GA 2YTCA 3HX9A 3IRXB 4WFZA 3M2RB 2V4RA 3V81B 3IFEA 3EJMA 4LSNA 3J7YI 5F8LA 3CJSA 2CPEA 3MR5A 3G96A 4QW9A 4EYHB 1X5PA 1FKOB 4RBTA 2H1YA 1WNEA 2PD1A 4FVMA 1UVKA 4GRSA 3ZZOA 4YB7A 3EDQB 1ZM3A 3SCLE 1GNKA 2N82B 4KO0B 4P73A 4YEAA 2QE5A 4DR1F 2MLZA 4NA1A 4OZ3A 4WFAQ 3ZZYA 4TVAB 1RAIB 4JI5F 1RT5A 4CLLA 2R7SA 1H73A 1M5KC 2X1GA 1RA7A 5LOQA 1RT2A 2IPOB 1WKLA 2E1AA 3AOCA 1TUGB 4DR6F 5D0EA 3C6TA 1OIAA 1V3ZA 1U09A 2B4UA 4JI2F 3KK1A 1WTBA 3BSCA 2OFHX 3OXGA 1VCTA 2M9KA 2V8DA 2NLWA 2HNZB 2CPZA 2DR6A 3CJRA 3I87A 2UU9F 1SBRA 1G6BA 1FA0A 3BR9A 3ENQA 5CYMA 2ZE2A 3B6BA 3SSSA 1ACMB 4WE1A 3TUPA 1RAHB 4DR7F 1IR1A 5HMYA 4QPTA 1TVRA 2GQCA 1RWUA 2AJ2A 3CJ0A 3PG9A 1SJ3P 2MJNA 2B7BB 1ROFA 5IM0A 1LFPA 4TYAA 2NZCA 4K59A 2VJVA 2UU9J 4GKKJ 4RUCA 4MKVA 2VKZG 2KYXA 4Y28C 4CM2A 2CVIA 3PW2A 2R2TA 2RIJA 2VONA 2UXBF 4RW4B 4H54A 2BM0A 2FY8A 2JL9A 3ITHA 3RGIA 3WQPA 4L74A 2HVIA 3E3XA 1W2BR 1VS3A 2F8MA 2RJZA 3NP5A 1FVQA 2HK3A 2MJUA 2D3UA 1S1TB 2P9CA 4HR2A 4WXWA 4FF1A 3T6BA 1J5EJ 1RHUB 2QL9B 5LJ5Y 1EJ7L 1NXIA 2HFUA 2RQCA 4NLUA 3FBEA 3FSYA 1HMVA 1Z2LA 2X51A 1UZDA 4NMXA 3MZIA 1SUQA 2R2SA 3GJQB 3PO5A 3NCQA 1HHQA 3ET6B 3G6YA 3M2RA 2IJRA 1RK8A 2VFVA 2GGPA 4EFAC 3IAM9 2Q6BA 2V94A 5K8OA 3HULA 1NU4A 3TNVA 2DHAA 1DHMA 4LF8J 2X3DA 3OUYA 3MTKA 3IGVA 5I3UA 1PJ5A 2GQ2A 2CQ1A 1KKHA 2OI2A 3CEDA 3K89A 3TAMB 2GA7A 3NRBA 3H4BA 3DRSB 2YQ1A 3UCUP 3I31A 2DNZA 4XAKA 4B3SF 4WWSA 1CBKA 2DO0A 3HT0A 4FDFA 1OS5A 4RWWA 4Y3CA 1N0UA 1HQEB 3KUEA 4F02A 1CQMA 5KFWA 4Q2MA 4J9OA 2GJIA 4ZDNA 1QVFR 3MR7A 4IDKA 2DHSA 1PILA 4PABA 3GR0A 3EPGA 4DFMA 1T3NA 2XS5A 4JV5J 2VFSA 1FJCA 3CC4S 2UUAF 1YRTA 3H4DA 2VPZB 2HNZA 5HQLA 2ZBRA 4LBPA 3LALA 4DCOB 1JLQB 1U1PA 2NYIA 3PX6A 1U48A 2AJ1A 3FMWA 3I9V9 2G0CA 1RT3A 3HHKA 2C2KB 1N5TA 2VKRA 3L9ZA 4P71A 5LL6d 2UVUA 2HNYB 3ETMA 1IJEB 1IKWB 1T9XA 5KFPA 4ZP6A 2HMIB 3NY0A 4DUZJ 2ZHAA 2JFDA 1UMJA 1YK9A 2J9DA 4HHHA 3V4IA 3R6GB 1RZMA 5KFRA 3HMJG 3A13A 2G4BA 3V81A 2PA3A 1NH7A 5KFHA 2RQ4A 4DX5A 1C1CA 3TZXA 6FD1A 4OL8A 4DBQA 4AL6A 2DNYA 2RUSA 1BMQB 3FJ2A 3BBCA 2W25A 4D3HA 2B6AB 2VFTA 2XC9A 2ZEJA 1WC0A 4R0JA 3C3LA 1Q7LB 4AL5A 4QR2A 1ZETA 2H4YB 2JC0A 2L48A 3T1YJ 5DG7A 3J7AN 1AUSL 2NUUG 3A4TA 5D4LA 1NPRA 4GO5X 3SBMA 1HIYA 3ISND 3KMSA 3NKYA 1HMVB 3BN4A 2XZDB 1SC4B 4ED1A 3GR1A 3C19A 3W5YA 2QLWA 1FRJA 2UVRA 3AQOA 4X64J 3DLJA 4ECUA 4KJIA 3NGKA 3ZNUA 3QWUA 2KXHA 1SQFA 1T95A 2W7AA 4C8ZA 1Q5VA 2XNQA 3MM5B 2DNRA 4O4GB 4NWBA 3WIVA 4K4SA 2DJWA 3ISZA 3JAMY 2FJBB 1KRPA 5D4OA 3EWGA 4F4WA 2RS8A 4J5OA 4A8XA 2EC0A 2EBEA 3DRSA 4K8RA 4P9SA 4B3MJ 4FNHA 2KT2A 4OV6A 2CRLA 2NZ4A 1E6YB 5KG1A 1U6BA 5FLXY 2QA4G 4K7QA 4F67A 3I56S 3NNAA 2HQ3A 3QPIA 4FBUA 3K5LA 4IDKB 3I0RB 4QYZJ 5B0AA 1N5VA 2E7XA 4ZS6A 5A2QY 5KFVA 3EXYA 2VICA 5H9FK 4MTPA 4BHQA 3N6NA 3D67A 3IAS9 5M2RA 1JNZB 3ISNC 4H4KC 2BANB 2Y1JA 2PFFB 2YX4A 2EK1A 1HLWA 4C3KA 3QJJA 4K4VA 5KFOA 4MIAA 5LMUF 4K2XA 1GX5A 2Y1LB 2DISA 2PC6A 3QLHA 2XMAA 4X4UA 3H98A 4TXSA 1MSWD 3GG1A 3L3CA 2GW8A 4LF9F 4OX8A 2HVZA 1WHXA 2HQFA 1C4CA 4JBCA 2F40A 1K1QA 5F8HA 3HT3A 4M5JA 5CD4A 3CJKA 3Q2TC 3DMJA 4DUZF 3I82A 2O3DA 3D6HB 2F65A 2R3VA 4O3QA 4OFZA 5DQGA 3SI8A 1T9VA 1F2HA 1Y5NB 1PIEA 4DI6A 7AT1B 3D5MA 2I2YA 2H3EB 2DGOA 1D9AA 3M8ZA 2Z57B 3R5DA 3VVTA 3G2XA 1QE1B 4TY8A 3VF0B 2J8SA 4OLPA 4OYBA 5ETNA 2E1PA 2CNOB 4G1PA 4DSFA 4NXMJ 3OTBA 3H5XA 5CABA 2NXNA 1L3SA 2OD6A 3CPWR 1U7LA 4OZ5A 3GYXB 1RWWB 1S6PB 2FY1A 3D6FB 4CTAA 1WORA 4NEYA 2YNHA 2G2ZA 4U9RA 1YJRA 1RXOB 3KNAA 2XMVA 1MNEA 4WKRA 4WK3A 3K0JA 1F9EB 2J0QD 3HHLC 1NK7A 1YITS 2P2CB 3M8YA 5D3GA 2QA4S 3K8WA 1TL7B 4HHJA 3DLKA 2RHSB 1FXDA 1S49A 2FJDB 3AODA 3OFFA 3GMGA 2HMIA 1X4DA 3U02A 4RJVA 5J1NA 3UN3A 5L1KA 1L3UA 2MSTA 4PXDA 4UF4A 4YS2A 3HVRA 1VC0A 1N36J 1QAJA 5SUHA 2LA6A 4DEZA 4C2MA 1F3FA 4CH1A 5KOWA 2CJXB 1D1UA 2LMIA 3FBCA 5LSLA 5CYQA 3SCJE 4DV5F 1VK3A 2Q79A 4LFAF 4ZLNA 3THPA 1X4BA 3FEXB 3UNYA 2J76E 4C11A 1WJ9A 1LW2A 1T9TA 2HFZA 4CZCA 3EYZA 2VFUA 3DRRB 3OBIA 2LQBA 2XQCA 2JLFA 4JYAF 3KG0A 4NI2A 2HVDA 1HQ2A 3PHTA 4CCHA 3EGZA 2HS0A 2XLJA 4ERDA 2G1DA 2DH7A 2CNNB 1WI8A 3DOLA 3CCES 2KFNA 2AKWB 4LF5J 3MPDA 1B0PA 5BR8F 3GWCA 4ZLLA 5B0FA 2YVSA 3MOJB 2LVWA 1U47A 2PEBA 4PWDA 4IH7A 3G9CA 5DJBA 3CULA 3MM5A 3GIJA 1NH8A 1HI8A 1Q79A 4OHYA 4KAIA 3VZIA 1DRZA 2CQDA 4M63A 2VBYA 1OY9A 4NZ7A 1NJZA 1BWVA 1QE1A 4TY8B 4QBUA 4DR3J 5KFUA 4ECZA 4LFBJ 3F73A 2J6UA 1R27B 3DU5A 3C8YA 2ZBPA 3MMAB 3OVAA 4X66J 1M90T 5DS7A 4C3MA 4M8LA 2KB2A 3ZZ0A 2DVIA 1E6VB 2CAJA 3ZTQA 1HR0F 3K2YA 4HI1A 3NMAA 3A8JA 2QLXA 3W1YC 4B9MA 4NCAA 1OQ6A 4K4XA 4PQUB 3MR6A 3BR8A 2HGLA 3CTRA 2ATLA 3MCNA 4ID8A 1K44A 2GIRA 2E5LJ 4JI8F 2G1HA 5DETA 4FKXA 4A8FA 2VHGA 1R0AB 1S1XA 2RDDA 3G4SS 4MIWA 1K0VA 2JLEA 1NK8A 1IBKJ 2IY5B 3ETOA 3GILA 3O1LA 5KOXA 2YKNB 5HVFA 3UDEA 3EM1A 4DPUA 4HACB 2VA2A 3CO9A 2FLPA 3M9OB 4DDFA 3W65A 3HCXA 3T41A 5CZXA 4DPYA 1N32F 3LAKA 4U95A 3J7Z5 5CYQB 2HHTA 1Y9OA 2DNKA 1AXQA 5KFQA 3QWPA 2QFIA 4FYWB 3RAMA 4QWAA 1SJ4P 1WC6A 3HKZD 1REVA 2GX8A 5IQQA 2FZCB 4TU8A 4ZVUB 4EBCA 1M5PC 4LFCF 5HBMB 4A8MP 3PHEA 1F1BB 2QO3A 2IA6A 3T5HA 2WW4A 3AJDA 4E0DA 1VRQC 1CJTA 5E33A 3MM6B 3KYLA 2XMKA 4RW9B 2VASA 3CCRS 1ZPVA 3MI7X 2WRMA 1NK0A 2L3MA 3V6JA 3DM2A 4ZCIA 1WG5A 5K14B 4K4WA 2ERRA 3F56A 3JXOA 2YWEA 4G3IA 1Q81T 2PI5A 2G13A 3H59A 5B0DA 2ZUAA 3MURP 2QYCA 4LF6F 3JS9A 4DV4F 3TJ9A 1FJEB 1BHNA 5IZHA 4PQUA 2Q1LA 2QTWA 5G0RB 1VRTA 5A0YA 4X4PA 1C0TB 4OJHA 2GHWA 3NS5A 4U8YA 1X4CA 2DXDA 2IAJA 4KKOA 1HPZA 1N5YA 4CO3A 1HI0P 1VISA 3IN5A 3MGJA 1EP4A 1JLGA 1O8BA 3CCTA 3V5RA 1FO1A 4JI2J 2V5HG 4KPCA 4CNYA 2E7VA 1MU2A 1P9QC 2DGVA 2VF3A 3J80Y 2BQUA 2R42A 2COLA 2EK6A 1T8EA 1RAJA 3BGUA 1BQXA 1NLKL 3UDLA 5H9EK 4W98A 3EVMA 4RUBA 1LW2B 1KQSR 3NEKA 1AROP 1JLFA 1XMOF 1LK5A 2LDIA 2QV6A 3GSIA 4QW8A 2HFNA 2HWTA 2DNPA 4RBVA 1XMQF 1ITPA 4HTJA 3C6UB 2YXLA 3CCQS 1NKBA 2M70A 4USMA 5M2UA 4C8KA 2YX7A 3ZNJ1 3I4HX 2W4DA 3BDPA 4UOCA 2PI4A 2V8VA 3BGFA 3BGRB 2BJ8A 4J91A 2DHHA 5CCMA 3IP0A 5I42B 4ECQA 4Q0BA 2M0GB 3OR2B 3CD7A 1XMOJ 3MHYA 3IBWA 3JQMA 4DSJA 1MMLA 1SIZA 2DY9A 2GMHA 1LWFA 1W7WA 2P9GA 1XBWA 2XWXA 3OR1A 4ZVEA 3SSRA 3BQ0A 4F4YA 4QWCA 1HARA 4K5RA 4EU0A 1OO0B 2DBBA 3R27A 4UQGA 4ZPCA 1DTTB 2AEFA 3LH2S 2R8HA 3T1HJ 3TA1A 4NZ6A 4RW9A 1FKOA 2AP6A 3HF5A 1S0MA 3CJ2A 4M5KA 3W8PA 3PXGa 4DV2F 5T41A 2POKA 3IS9B 2RVJA 2HLTA 4ZN1A 1YVFA 2PE8A 1LWEA 4X65F 1N48A 1X31C 4NE9C 4NCGA 1QAIA 3HFVA 4Q5VA 2NQPA 4KBIA 3BEGB 3EE3A 4I2QA 3DLGB 3R5BA 5DDRC 4RNNA 1MN9A 2K7KA 4ZCLA 4ZN3A 5FLXU 2GCFA 2L41A 3CCSS 2VG7A 4USTA 3N4WA 3NXZA 1S0VA 1DQAA 2FHMA 2C3OA 2LFVA 4H4MA 4U7UK 3VQSA 2MQOA 3HHNB 3HJVA 1L3TA 1RKIA 5KFAA 2IAJB 4JI3F 2E9RX 1GK8A 3CJ4A 4S0MA 1YJTA 2HW3A 1NHKL 2UXCJ 5AXNA 1X0FA 1YRUA 1KEKA 3PR5B 1UVNA 3MAAA 3HSZA 2YPZA 2ASYA 2D69A 2JJ4D 1LXNA 3TO8A 4G1IA 5AT1B 4CLSA 3UPFA 4OYZA 2CQBA 2RRNA 3US5A 1RHJB 1H2TZ 5ETSA 2JEJA 2LXUA 2N3LA 3KNGA 3R3TA 2AD9A 4A8KA 4JI3J 2R7XA 1F5BA 4LFAJ 3KK2A 2YKQA 2BQRA 2DD8S 3BREA 1CJTB 2ATCB 3DYAB 4CLPA 2J0WA 1R6VA 2WZ1A 5DDPC 4GKKF 1RBOB 2RKIA 3UVJA 3NOGA 3W5XA 2LYVA 5BYSA 1VQPS 1IBKF 3WC2A 1PC4A 2JVOA 2QSFA 1X5SA 3CCZA 3TUJC 3UN2A 4DPOA 2XS2A 4Z2XA 3UCZP 5H9EJ 1Q5YA 3E51A 4DL5A 3ZC4A 3BSNA 4DS5A 1XMQJ 3DCAA 1QAYA 4JV1A 2C3PA 3HFKA 4NZ0A 2EG2A 1NAQA 1WDTA 2BKPA 4DV5J 2J7WA 1S4EA 2W2QP 2HHWA 4LFCJ 2W2MP 1DTTA 4OX9F 1RT4B 1JLCA 3MECB 4FF4A 3DHXA 3PJXA 4KKOB 3WHIA 1KNZA 2MY8A 2VU5A 2H5IB 1VJQA 1K73T 1T3OA 2Z30B 1KTVA 2ZE2B 4PAAA 1JLEA 4CQ1A 2HHXA 2I5JA 1NSAA 5C25B 1G2EA 1I94J 1XMBA 4FNIA 3X3UA 4IKAA 2VG5A 1RU1A 2RSQA 1HQEA 3W62A 1DLOB
chains in the Genus database with same CATH topology
1Q8LA 2W9BA 3VWSA 1MWYA 1JLFB 2NPFA 2KH9A 4O23A 3RB6A 1DQ8A 2XCPA 2AYEA 3BJYA 4RW4A 1Q8IA 2PN6A 4Y0FA 2DHGA 2OPPB 4GO7X 4IFVA 1YSJA 4IUFA 1HA1A 3KJVA 1NK6A 2YQ3A 1S77D 1NRKA 3WZ0A 3QZ7A 2ZKTA 3Q8PB 1ZYQA 2RF2B 2AWZA 4RU9A 2MZQA 2GV1A 2UXDF 2IJNA 3UR0A 3HKWA 2W7PA 2CQ2A 3UE2A 1UP1A 4I7FA 1VQKS 1LQ9A 2E1RA 5EWEA 2C28A 4UY8T 1JLBB 4G1QA 2NPIA 2KRBA 4AXIA 3K5NA 1K8AT 2RKIB 4WFXA 3IS9A 3KKFA 4WFNQ 3SYZA 2CJKA 1X7VA 3THTA 3D0GE 3RR8A 2WB1D 1J5EF 3QJPA 1FRKA 2JSXA 3NBPB 5I3PA 4ED5A 3UWTA 1HL6A 4ES1A 3V6DB 3OTCA 3QMQA 2OPQA 3M8QA 4HVZA 2MY7A 1S9FA 2R8GA 2HGNA 1N0VC 3TAQA 2B56A 2EVZA 4I0WA 4ZCKA 5L1IA 4ED8A 3PW4A 2AU0A 1VBYA 3NGDA 2FLLA 3NAIA 5K8PA 3M8SA 5L1LA 2B4OA 1JLQA 4ZOSA 4U7CA 2DIVA 4EUVA 5KG2A 1ULRA 1KLMB 4ECVA 3MM9A 3ENWA 3CDBA 1IKWA 2XMWA 1S76D 4FZVA 3OJUA 1W25A 3FZ2A 2LLZA 1LW0A 3JTPA 3SQGA 4BC9A 2CJAA 2I9SA 5KFFA 2AYMA 2YNFA 4FYDA 4LF5F 3LANA 3RR7A 5B08A 1B64A 4ID5B 1HBMB 1FD8A 2QSWA 1M5VC 2IMOA 3HVAA 2PSZA 4FXWA 4OI6A 1KONA 1U25A 4RW7B 3W2WB 5E3CA 2JEIA 4OJ3A 2F3JA 3B82A 4FVCA 3CD0A 1FE0A 4N56A 2C22A 4ELTA 2LU2A 3M9MB 5DG8A 3SV4A 4PUOB 4PRFA 3PIOQ 2KU7A 2OIHA 1XR6A 5KT3A 2XWYA 1U1RA 1RT6A 2WB4A 1SL1A 4F4XA 3MMCA 1M5SA 4F2RA 1P6TA 4KIAA 1CSJA 1FEHA 2HLUA 4RUAA 4PXEA 4I7FB 2XULA 5F3TA 1SJ1A 3MPVA 4A8SA 3Q0AA 1IN0A 1MROA 1JIHA 4WK1A 2ZD1B 4HT7A 5KFJA 1Y3JA 1S0NA 5EX0A 3PW0A 2R7OA 4C3LA 4TN2A 1IKVB 1VOMA 2RU9A 5DLGA 4J9QA 2XG8A 1VQ6S 1UWBA 1IKYA 1HW8A 2JFKA 4NA3A 1TFWA 3PKMA 4H4KA 2ZUGA 1C2PA 3EZ5A 3UFCX 2WSEC 3UI3A 3MFIA 3B4DA 3VZHA 1N4LA 4WF9Q 3OFHA 4ZPVR 3TR5A 4C0OC 1HYSB 3BS9A 4QR1A 5B0EA 3PDNA 1U26A 3D1OA 1A6LA 2J6SA 2IA0A 3T19A 2HHSA 5HL7Q 2FVQA 1QUVA 3KG1A 3MPYA 2UV8G 4ECYA 4K5SA 1OPZA 3SV3A 1HD0A 2WBMA 2CQ3A 2Q3PA 4B3OB 1FVSA 2NREA 1KHWA 2PMZD 1GAOA 4OZ1A 4ZPWR 5K5MA 3ZZRA 4C98A 1FRHA 1FJGF 2FD2A 2R7WA 2YNGB 1HNWF 4DV3F 4LQ9A 1P27B 1SH0A 1JLAB 2FTRA 3GIKA 4IOCQ 1KVJA 2FIUA 2VQEF 4NX9A 2YKMB 1KVIA 4YQWA 1FNMA 2QMWA 1TK8A 4J9LA 2VBWA 3CIZA 3SCIE 1CQNA 4F4ZA 4DLEA 1XWLA 1RKJA 4KO0A 2PMHA 4RU2A 1N88A 1HNIB 3PR4A 1JKHA 2LEPA 2ZDPA 4L3NA 3BN7A 3S1TA 2L9NA 1F5AA 1G7CB 5H1SV 1R8CA 5F8GA 1S6PA 5E3PA 3RB4A 4OI3A 2ZNZA 1YI2S 4YDXA 1S79A 2F8EX 3BSAA 5C42B 2BR0A 4DHVA 2OPSA 2CPDA 2D41A 2DT9A 2GQQA 2XI3A 2HNDB 4DOZA 4EBEA 2UUCF 4JI3F 2XS7A 1V9OA 5KFKA 2IVMA 3TAMA 5D3GB 1A7GE 4A8YA 2J6TA 2E29A 5KFIA 2W9CA 4ECWA 2BDPA 1K1SA 3LOUA 2YX1A 2HVHA 1CEZA 4IYQA 2FVRA 4F4KA 3JSRA 1C1BA 1YJ9S 5KAKA 1VRUA 1HBMA 3DRPB 3O6QA 3SZ2A 3PO4A 1TL3A 3H25A 3PIPQ 3CCMS 1FXRA 2J0XA 2GO9A 1TKTA 2ZOMA 3AB2B 5IQ6A 3DRRA 5LXRA 3R1HA 2XSJB 3J81Y 4F50A 4HI2A 3T5JA 1S0VA 1VQ5S 4X2BA 2QT7A 3C66A 3MF5A 5F9LA 1Y0HA 4HTIA 3LUYA 2FC9A 3Q24A 2B9WA 2MPUA 2XGPA 3MUMP 1U45A 2BXJA 1RTJB 3IR6B 3V4IB 4PKDB 1RTDB 3PRBA 5FDLB 3CC7S 2YNGA 4EZ6A 1TKXB 3BDEA 4W90B 2HWHA 2MZRA 3K59A 3VALA 3IRWP 3TVZA 3U7JA 5D77A 5IS2A 4DV0F 2OMOA 4DUYF 5HBMA 1PO6A 2LXIA 4ZHRB 1IBLF 2RDIA 4AYBD 2CQGA 2V4QA 3AH6A 4OHVA 5F3ZA 2KFYA 3MMAA 1Y5LB 2WHOA 1CVJA 5ADZA 1SJQA 3GFYA 4B08A 3MMJA 3EGNA 4RKUC 4TLQA 2JLGA 4EO8A 1XTZA 3JSBA 2ILYA 2W4CA 1P1TA 1UAWA 1ZM2A 2XLIA 2XLKA 5F41A 2R8KA 1HWKA 2BJEA 2AQ4A 2HYIB 2CQ4A 5D4NA 2ZH6A 3LP1B 1FK9B 2W9AA 5BYQA 3K5MA 2OLWA 1TK5A 3TX8A 1QM9A 2FHOB 3UW1A 2EPIA 4ECSA 4WXOA 5EWGA 2M52A 2VH7A 1FKPA 4NLYA 4UQTA 5EDWA 2MZ1A 2ASDA 1D3WA 1BQMB 2OSQA 1RT1B 3M32B 4Y34A 3TARA 4MH8A 2XSFA 1REVB 1S9GA 4J9NA 4JV2A 4ZPDA 5J2PB 3ZZZA 2CJQA 2OSRA 3DLHA 4IG0A 1D0EA 3E2EA 2OH2A 2MQNA 3ICLA 2KZZA 3I5AA 2CVEA 1Z1ZA 1C0UB 1S48A 3KWMA 4KT0C 4Y2MA 2B43A 1BGXT 3DM2B 4NLWA 2CIMA 4I64A 1VC5A 2F9DA 3MEKA 3QGPA 3U1LA 4CH0S 5GAGU 3OR1B 5F0UA 4O4GA 1DZ5A 4MK9A 2HNDA 3ZZPA 5KFCA 1J5OA 1S1VA 4WYWA 5CA5A 1PGZA 5AXLA 2ZNYA 3GB0A 2UVWA 1R8AA 2U1AA 3N01A 4DMZA 2G9OA 4CO4A 4QR0A 5KT2A 4MYTA 5A8KB 3GV5B 2RS2A 1HBUB 2J7KA 4QCLA 4B9NA 2DNLA 2ZJPQ 2CQIA 2XHWA 3H8YA 5CXTA 3CD6S 3OXLA 1RGVA 4IH6A 4Y2KA 2BOPA 1XERA 3G86A 5DGBA 4MK7A 2ZZMA 1HQUB 1TKTB 3W3SA 1OWXA 4IO9Q 1AFIA 2C42A 1KQGB 3AA9A 2EWHA 2ZC4A 4XPEA 1HWIA 3LWMA 2AW0A 2MQMA 3POTA 5EGYA 3FFIB 4JV0A 3FZBA 4U6PA 2DK2A 3CDEA 5T7LA 2VQFF 1NJYA 1RTDA 1IXKA 5L9NA 2WSFC 2HZCA 4DN0A 3T5LA 1N33F 1YGYA 5EWFA 4N5SA 1SJFA 1X4FA 1TKZA 5E5NA 3MUVP 3KK2B 2VZ9A 1KOHA 2J9CA 3QJLA 2MQPA 2JH3A 1BWEA 2VPWB 1LXJA 4Q8FA 2RQKA 1N56A 3ONQA 3CGIA 2K7JA 3DXSX 3OHBA 2IC3A 4OZJA 4FXVA 4Q8EA 5MLCV 2ABYA 4NCGB 4ZPAA 4DL3A 2CZVC 1NK5A 1Z4UA 2LDYA 4MAKA 2DGQA 3IC1A 1Y4ZB 1WF2A 4L72B 2ADBA 1YJNS 1APSA 1SB6A 5MAOA 4HEA9 4XDDA 4KFBA 4WFYA 1S9EA 4H4MB 4OJ1A 4JI7F 1YQHA 2V4JB 2AX1A 3OFGA 3F41A 1N52B 4YR3A 3TW0A 4A8WA 5JJBA 4RBUA 3GZ7A 5C25A 1UVJA 3KLHA 3JTOA 4PPDA 3QAEA 4L6V3 3GQCA 2M4MA 3VAMA 5KFSA 1DLOA 2D7SA 2KFZA 2Z8QA 3OTEA 4O3PA 5L9XA 4ALZA 1R0AA 5IT9Y 2FJXA 1R8HA 1RJJA 5EHHA 2CG4A 3W2VA 1C0UA 4QZVB 1YWXA 1IM4A 3DFEA 1H98A 2BW2A 3IG1B 2VD3A 1Q4RA 2KO1A 3E01A 3BQ2A 2CKWA 2KHCA 1URNA 1S72S 2I38A 3OV7A 3SEOA 3HZEA 5C24A 2O1PA 2YH1A 3T1YF 2XI2A 1FXLA 2OMLA 2I0XA 2KKHA 1S0OA 3QO9B 2DR8A 5HROB 2BVZA 3LGMA 2RU3A 1X4EA 2V8HA 4R25A 2EFGA 1ZAVA 1N54B 1R8BA 3EPIA 3PACA 1NEEA 3NS6A 4Q43A 5HP1B 3P96A 3HO1A 1XK8A 1V3RA 2KVIA 3TQ1A 1HQUA 1RP5A 5CZVA 4YFUA 4ILMA 2O5DA 2AX0A 1ZAXA 2GJ2A 4DQPA 3HK2A 1HFEL 3H5SA 2ILZA 1VRTB 5A0YB 1ELOA 4OHXA 5G4DA 3R5AA 1SKWA 2A2CA 2JX2A 1N6QA 3H5YA 2RB7A 2PT0A 2IJFA 5GAHU 3POTB 4WE1B 2C2EA 2HAIA 4ED6A 1S6QB 4OI2A 3SCKE 2HIQA 2MHNA 2NR0A 3M2UB 1OQ3A 4BCAA 1MMNA 2HQIA 3RRHA 2OPRB 5KFTA 2ZH1A 1TUVA 4C9DA 1VGYA 2ZBCA 1WHVA 1A9NB 2DNHA 3N0VA 4AUKA 4RW6B 3E8OA 5AXKA 5DM7Q 4DFKA 5DO2A 1UA0A 3GIMA 5AE1A 3G6VA 4IOBA 4IFYA 4QPXA 1YBAA 2IBOA 3R1LA 4D3GA 1HW9A 2D3OR 1V3SA 5K14A 5J1PA 1O5JA 2APOA 1DFDA 1X9MA 5HO4A 2LEAA 2IRYA 1FERA 2J5AA 3IWXA 5J1EB 4I69A 5HQ8A 4R8UB 4HYKA 1WACA 1WTFA 1MW7A 3DC2A 4N8OA 1M1KT 5GVQA 1BY9A 4HLBA 4Y2IA 2C2RA 1KFDA 1V6HA 5EX3A 5DDOC 1IBMF 3NWGA 2UVVA 1TVRB 5CH7B 1LW0B 2GMJA 4Y2AA 3IR7B 3M1VA 4OJGA 4Z37A 3WX4A 4WYLA 2Z2LA 4KC5A 1Q16B 3RRGA 2ZJQQ 1UKUA 3FDSA 1KTQA 2WTFA 3JYTA 3ITHB 4PPZA 3IA0A 4DL2A 4MFBB 2FVSA 5I3QA 1GXLA 2R2UA 1TL1A 1QSSA 3EZUA 2FHKA 1LWCB 2D74B 4QIWD 2CFXA 2DRAA 3MMCB 4ELUA 4HDGA 3ULHA 4EGLA 5KFMA 4EZ9A 4FBTA 5A8RB 4OZNA 3DDKA 2HRYA 2Q43A 1KHVA 2GIQA 2YWFA 1LFWA 4Q45A 2CPJA 3SDEA 3RTVA 3TVKA 3QO9A 1VFJA 3H2LA 4KSEB 1JX4A 1U1LA 4OI1A 4B9UA 3M9NB 2GNKA 2ADCA 2HFOA 4F3OA 3KG4A 4O44B 4C4WA 4F8RA 5KFDA 3HXMA 3M05A 2OD4A 3I0SB 2M2BA 2MQLA 4DSKA 2JRSA 1C4AA 4OZ0A 4DR4F 3DLGA 4BWJA 3HVTA 5I4MA 3K8VA 2E66A 2YKAA 1UVIA 1SQEA 2HHPA 4QIVA 4LIRA 3CDWA 2R9LA 4K0KF 2B5JB 4XIUA 1NJXA 5J2NA 4LFBF 5D8HB 1GH8A 3QGHA 1HBNA 3G6XA 4X4SA 3FEYB 5B09A 3MM8B 4MKBA 4MKYA 4PWUA 5KG7A 4B02A 2P9EA 5CCLA 1GTEA 3L95X 2W9CB 1NKCA 1Q82T 3GFHA 3VQTA 4B3OA 2VG5B 3IWLA 1UA1A 4FP9A 4USIA 2U2FA 4R5PA 2HGMA 1O0PA 5THWA 2KT3A 1UVMA 1VHFA 4B9SA 3DDNA 4ECRA 4I68A 3OQ2A 1AFJA 4IQXA 3P6YC 4X4OA 3DYAA 5DQHA 1XR5A 2IM2A 3GE9A 1D9DA 5KFLA 1OSDA 3CMES 1KOOA 1EETB 3P5TL 1JK9B 3DLEB 4V19J 1HWUA 2MGZA 2MMYA 1M5HA 3O2IA 4YMEA 2OJ3A 2LA4A 1HNIA 4A47A 1H2VZ 2XO7A 2P6TA 1QSYA 5M2PA 2RH3A 3T1AA 1RTJA 4K50A 4ETXA 2KTQA 4N76A 4ZLPA 4KHMA 3Q8RB 1U1MA 1TFYA 3M6VA 2M8HA 3DI6B 4GC7A 1YG0A 1TL5A 2EFOA 2K3IA 3LP0A 3S01A 1GT8A 2ZVSA 5DRKA 1HNVB 1CLFA 2CJBA 4I4BA 1JB0C 3I32A 2ZBIA 4C0HA 2I5JB 1Q86T 3Q8QB 1TL4A 3MDFA 2W4PA 1T05B 3HHLD 4OLOA 1FTCA 4I6AA 1E6YA 3PFOA 1U49A 4ELVA 3PVXA 1WHYA 2VC0A 3AA8A 4NL5A 4JV5F 4A46A 1RT7A 2QA1A 2VV5A 1ZAWA 5F8JA 3AY0A 4KHRA 4MIBA 2D1CA 1HBNB 4QIGA 1JXLA 4IFVB 1G3OA 4KE5A 3OL9A 4DWIA 2EG1A 1FK9A 3KJVB 2NSCA 2ZC3A 4ED2A 5SZTA 3QLHB 5L8RC 5DLFA 1SC6A 4NLPA 2RF2A 3OVBA 4A48A 1DTQA 2FLOA 4ETZA 3LO3A 2N4DA 4EWTA 3OLAA 3FSXA 4V19X 2QEXS 1FRIA 1LOUA 1VI7A 5A8RA 2E44A 3KLIB 4HH1A 4I6YA 4LSNB 1RT1A 3M32A 2LECA 2F8HA 2XB2D 1R89A 4K4ZA 2PIIA 5AE2A 7FD1A 4WZMA 3OTOF 1S1WA 2WOMB 1S7HA 2ZH4A 4NLXA 4ES2A 4O44A 4NA2A 2CZ4A 3GG0A 2MGZB 2XNRA 5E3RA 4QQBA 1U1QA 2HPUA 3V6DA 1VC6A 3GSDA 3SMZA 3LAMA 4ZP7A 4CTAB 2NSBA 3H20A 4QU6A 1IKXB 2KT5A 5KG5A 2IYGA 4DQRA 5DM6Q 4CIOA 1NK9A 1FDDA 1HNVA 5T14A 3DGPA 3H2UB 4ECTA 1VQ9S 5F0WA 3VAGA 1YJUA 1S1VB 2IRUA 2E1CA 3CIMA 4QWDA 1BC6A 3JSYA 5D4PA 1IJFB 2FVCA 1I94F 4QYRA 1TV6A 2A10A 3CCLS 4M94A 4WFBQ 3BGLA 1VQ8S 3FRYA 2JC1A 5DDQC 5LJ3Y 2E5JA 4DV1F 3OL7A 2BV3A 1X5OA 2ZKUA 5H9FJ 2DCUB 3DOKB 1TQLA 1TR0A 2C3YA 3HZGA 2E5HA 4RWXA 4DEZA 4M5DB 2DNNA 1OPIA 5KT4A 4LQ3A 2B9YA 3CDAA 4C8MA 1S1TA 3DLEA 1X8DA 2D3ZA 4C7QA 3PW5A 3CSKA 3EUNA 3FQLA 2JEGA 1X4GA 4E98A 3OSPA 2VOOA 1MWZA 1BQNA 4DG1B 5J2QB 4NPOA 5HN0A 4R0EA 4PWDB 1D9FA 4ED0A 2RRAA 1JLAA 2R4FA 2K3KA 3AAWB 1SH2A 4YDDB 1QVGR 2FLNA 4BWMA 5I3UB 3OUYB 1Y7PA 2HRUA 2ALZA 3KK3A 3G8SA 3O3LA 2Q6CA 1UJ6A 4OX6A 2MKJA 2LEBA 1UWBB