3WC0A

Crystal structure of c. albicans trna(his) guanylyltransferase (thg1) with gtp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
265
structure length
265
Chain Sequence
SKYEYVKLFEKENYLLPDTYIIIRVDGKGFHKFSQFYEFEKPNDLKALQVMNSAAEKLMSKYSDVMLAYGDSDEYSFLLRKNCQLYERREMKLTTLFSSLMSTYYMYFWSQYFPDKPLHIDHLPNFDARAVLYPDFKHIRNYFSWRQVDCHINNLYNTTFWNLVLKLKMTPQQAEQRLMGTVASDKNEILFKECGVNYNNESEMYKKGTIIVREFENYETEDEAELSKRQVQRLEKKRKKAELKIYHVDIINDDSWWKSRPWLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Likely histidyl tRNA-specific guanylyltransferase
publication title Structural basis of reverse nucleotide polymerization
pubmed doi rcsb
source organism Candida albicans
total genus 88
structure length 265
sequence length 265
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wc0A00
3OTDA 4KGKA 5AXKA 5AXMA 3WC0A 3OTEA 3OTCA 5AXNA 3WC2A 3WBZA 5AXLA 4KGMA 3OTBA
chains in the Genus database with same CATH superfamily
5DG9A 1LWFB 2IPOB 3DLGA 1ACMB 3KJVB 4DV3J 2HHHF 3CCVS 4QBUA 2CVEA 3EWGA 4F4AA 3MR2A 2LMIA 4DR3J 2YKNB 2YWKA 4DX6A 2A10A 4OYAA 1S1WB 4MYTA 4PZVA 4DV5F 2BM0A 5LMNJ 4UZBA 3FSXA 1X4HA 4TXSA 3PNIA 2XS5A 3VQTA 1N36J 5HO4A 2OLWA 1A0OB 5IT0A 3R27A 3L7PA 4FYDA 2J6SA 4QPTA 2BOPA 1GH8A 4YFUA 1N5QA 1IKXA 1S1UB 3DOKA 4OYOA 4BCAA 2M2BA 3ZC4A 5ETLA 2DNPA 4GVLA 1IKVB 4IQXA 3IM9A 3Q23A 2LQ9A 2I9SA 2LQBA 4DX7A 1YDLA 1PG5B 1SUQA 2QL5B 4LF2A 4YHHF 2QYCA 5KAKA 5B7WA 4MIWA 3J7YU 9ATCB 1ZM4A 2ZFHA 4QWEA 1SQEA 4UT4A 4LF7F 3JSYA 3MAAA 4I7FB 3CT9A 4QIGA 1YKWA 4JV5F 2B9EA 2CQ2A 5H9EJ 1I1GA 2GNKA 5FLXY 3KNAA 2V94A 3MWBA 4K4VA 3MAHA 2MKJA 2R7XA 3OL8A 3G2XA 1FDBA 2DITA 1GTEA 4QYRA 5CABA 4K4UA 3HHLB 1QVGR 4FDFA 1UJ4A 2FGCA 4F3QA 5A6WA 3SDEA 2MXYA 3UVJB 2E7VA 2DGUA 1EP4B 4NL5A 1F9FA 3DNCA 3A8KA 2KHCA 1P1TA 1NDPA 3BS9A 3DXSX 5EX0A 3Q22A 2DH7A 4GO7X 4ZPDA 4E2FB 3VF0B 4B17A 2VBWA 1BQXA 2V0NA 1C4AA 4CNZA 3N5FA 2VBXA 4TU9A 2WTFA 2YWWA 2WOMB 3RR8A 1LK5A 4EWTA 1YVFA 3M9NB 4CP5A 1MMLA 2QEXS 2NPFA 2ZKUA 3HFZB 3NLCA 1VRTA 2MKCA 5KFTA 4NXMF 3T3FA 4JI1F 2J8SA 1WORA 1VQLS 2V8HA 1EX8A 4YP3A 3UDEA 1TKXA 1FVQA 1KLMB 3TNVA 2A2CA 1OPZA 2AHOB 1F60B 3RB0A 3CGIA 2FVPA 3NGTA 4Y2KA 3MCOA 4M8LA 4B9SA 3O1LA 2VC0A 5C24A 3LAKA 3HSGA 3SQGB 4FBUA 4QR0A 2N82B 3IN5A 1IQZA 2F8EX 3CJTA 1JXEA 4NXNJ 4IG3B 3CDEA 2VG6A 5F8NA 1HR0J 4UW2A 4U7UK 2ZUAA 2FGOA 4ZPAA 1QUVA 2J76E 4JI8F 1B70B 4Z2XA 3K7RA 4YR2A 4ECTA 4X4VA 1YHQS 2EFOA 4NASA 5F41A 4B3OA 1WC3A 5CYQB 2BKNA 4OI6A 1NK7A 1HBMB 3OTOJ 2R2RA 2J9CA 1S10A 3KUHA 4NWBA 3KUGA 4JYAF 2Q43A 4L74A 4NZ7A 2WSFC 3OHBA 4FP9A 2ALZA 4QWCA 1U48A 3G9CA 2BANA 1KHVA 1WDTA 1TL1A 4ZDNA 3OV7A 3F0NA 4HYKA 4NZ0A 2XHWA 5T7LB 1YBUA 2BUNA 3PKYA 4DQIA 5IV3A 4OYPA 3A8EA 1N32F 1UEKA 2VONA 3BH7B 2XMVA 2X51A 1LK7A 4IO1A 2FY1A 1YTYA 2KO1A 2VOPA 4HH1A 3L7OA 3KLEB 2DISA 1JLGA 1WG5A 1DLOA 5B0EA 4XPCA 2KYZA 2XMKA 2W9AA 3W7BA 3T1HF 1WC6A 1S9GA 3KJNB 4NEZA 2D7SA 5HJXA 4OYZA 4WKRA 2R8IA 1N54B 3SFGA 3M8QB 2WHOA 1YRTA 5D15A 4DX8H 1BQMA 5MLCV 4IH6A 3KLVA 2UV8A 3P3DA 1HMVA 1C0TA 5SUHA 1RJJA 1QSLA 1J5EJ 2QA4G 3OPKA 2AX0A 5KFSA 3I4HX 3OJUA 2G0JA 2M88A 3GLJA 2ALYB 4RKUC 4J9SA 3BN7A 3H2UB 2QV6A 2HAIA 3M8PA 3C16A 1FEHA 1FD8A 4DF8A 4R5PA 3QWPA 4FS2A 3NOGA 2GMHA 1P27B 5DQHA 3QLHB 5K8NA 3TZYA 3I0RA 2GJFA 4M5GA 3ULHA 2VFVA 3TAPA 4KFBA 1VQ7S 3OXGA 2WAQD 1TVRB 4UY8T 3MEDB 3QNWB 2XBPA 3DRRA 4CLYA 2ZWOA 2GZOA 3MEKA 1TV6A 3FGVA 4OYWA 2F8MA 2IM2A 3EXCX 2KRBA 1M5VC 3D0HE 4GVBB 3T41A 3QT8A 3J7A1 1VMBA 2HQ3A 5DLGA 2WZ1A 2Q66A 4A47A 2GVZB 4MMOA 4LF4J 3D28A 3LA0A 2GGPB 1LOUA 3UDLA 1L3SA 3DU6A 2QG9B 4P71A 2ABYA 2Y1IA 5L1KA 4RW7A 1FFSB 4JI6F 3K17A 4A8XA 1H73A 4CM0A 1NDKA 1NSPA 5FLXU 1DQ9A 1K0VA 4KGMA 1SJ4P 2J6TA 3KLGB 4F50A 1X4AA 4YB6A 2IVMA 3DLBA 4PYDA 5GMDA 4K0KJ 3QYYA 2AYGA 4EBEA 1NO8A 2OIHA 3P5BP 4EI2A 1YLXA 3D3CJ 1G3OA 4ID8A 1EARA 1RT6B 4ICLB 4P6QA 3W2WA 3AD7C 1DJ0A 4IH7A 4JV2A 4NA1A 1DY3A 4DJBA 4IOAQ 1YJ9S 4XAKA 5C7PA 2MQOA 4P2MA 5ETSA 3PO4A 3MEEA 2W4PA 4QW9A 1OYEA 4DFPA 5KT4A 5BR8J 4H4MB 4P7TA 3U27A 4ED6A 4QU7A 3MFIA 4G1IA 2L9NA 2JSXA 2EFPA 4KGKA 5HVGA 1TL3A 3L4BC 4EBCA 3BYPA 2KG1A 1I94J 2B4OA 1NPPA 4RLEA 2HWIA 4C48A 1XR5A 2LXIA 2MKHA 1GTHA 4IKAA 4FPRA 2OPRA 3SYZA 3NAHA 3VAHA 1D8ZA 4PQUB 1A9NB 3DM2A 3ETOA 1U1OA 1FERA 5AJ3F 2ROEA 1OY6A 3FRYA 3M2RA 1SKUB 1IBMJ 3D66A 4O3RA 4MKBA 1MMDA 1FA0A 4F67A 1B7FA 4ZPBA 4EMDA 3IRXA 1V6HA 1GMUA 3JTNA 1RT4B 1WWHA 3QIPB 2LDIA 4LF6J 1Q78A 4CZCA 3AQPA 2YWHA 2XMAA 5DO2A 1X5TA 4C3MA 3CO0P 2M9KA 2DTJA 1VRUB 5HROB 5D0EA 4F0MA 4W98A 3TW0A 3Q8SB 1N48A 4RBUA 2L41A 2LEPA 5F9LA 2IJRA 4P52A 5IV4A 4BBYA 3WHIA 4YB1P 3HFVA 4QU6A 4G1PA 3QGHA 3CD5A 4ZVFA 3DXBA 2VFUA 1HNVA 1HNIA 3PW4A 4MK8A 3FBFA 3PHTA 1RTDA 4IDKA 5IXUA 3M8YA 3D1QA 3O2IA 2NXNA 1YWXA 2XSFA 5LSLA 1Q8IA 3BBBA 5G0RB 2W9BA 2OPQA 2LP4A 1VQ6S 2DNGA 2VPWB 5A8WA 5HJYA 3PR4A 2DKOB 5HAOA 4ED3A 5KFFA 4Y2IA 1NDCA 3CIMA 3RU0A 3DGPB 5KFNA 4K8RA 3ZO7A 3LP0A 3I56S 4RUAA 1LQ9A 5KG3A 1ZBTA 2ZD1A 1XNRF 1VC5A 2NPIA 4OQJA 3S1TA 3N6MA 3CCQS 2GJIA 3PW2A 1NU4A 4JI7F 2YKQA 1QUPA 3UD3P 1CULB 1SJFA 4F2RA 1RT1A 4DV1J 3KK3A 1VQKS 1X9WA 5CQGA 2XG8A 1VK8A 2R3VA 5CZXA 3RB4A 2V63A 1EHWA 2GV1A 3EVMA 1ICEB 2GA7A 3TR5A 1FDDA 4MK7A 4ED5A 1VQ4S 5J2PA 1C0UB 3A3PB 5HVHA 3RBZA 2UXBJ 2VG7B 4DFJA 2J7KA 4LF8J 1FKOB 2M7SA 2OMOA 3K5MA 2DCLA 2E5LF 3SIPB 1F5AA 4F3MA 2HHVA 2ZH2A 2OSRA 1RTIA 2XO7A 4LRBA 4DR6F 4DL2A 2APOA 2GQQA 1DZ5A 2DHGA 1TAUA 3TAQA 5DDPC 2JHEA 1MMNA 2I5JB 1H74A 3QMQA 1Q95G 4P73A 1FFWB 1FD2A 1RKJA 4NYPA 3RG6A 3QRPA 4DN0A 3MZIA 5C2GA 2OMLA 1KQKA 3BKFA 5SZTA 4HKQA 4NLUA 4UUWA 1YX2A 4TNOA 2ZHBA 4HDGA 2AJ1A 1NAQA 3M9OB 1S1TA 2KFZA 3KJQB 8ATCB 2F5GA 2F4VJ 2Z56B 2V8VA 4ZK7M 2LU2A 3M1VA 1TUWA 4ZVGA 4F36A 3BQ2A 2G1DA 5D77A 3KHGA 1TUGB 4B9NA 4B9TA 2E66A 3KK1B 3FMWA 3D0GE 4ILRA 1FNOA 4LRCA 1Q82T 4PXCA 5J1EA 3VQSA 1YBAA 1YJTA 5HQLA 4DUZJ 3ITHA 2HZCA 4Y2AA 1L3KA 1HKAA 3TO8A 2ZJRQ 4UF4A 3CULA 3T5HA 3DI6B 3CJ8A 4QWDA 4JI0J 3M6UA 4TN2A 3CPWR 3G6VA 5B08A 2F65A 3BO3A 2OEJA 5IT4A 1HNWF 3CSKA 1VLYA 1BGXT 4YQWA 5C24B 1FX2A 3OR1A 4KPYA 1Y11A 1S6PA 1TELA 4UY85 4OLOA 1ZPWX 1JLBA 5G4DA 1Q7YT 3SCIE 3UR0A 2R7SA 1XR6A 2L9DA 2LYVA 2HFSA 4GC7A 3C6UA 4TYAA 3TEHB 2EFQA 2MZ1A 2ATLA 3AQOA 2CG4A 3O44A 4LRFA 5K9FA 3U02A 3ZZ0A 2MLZA 3CC2S 4LBIA 1EETB 1HW8A 4N47A 1RLCL 3M32A 1UVKA 3Q8YA 3PRBA 4DR4J 2UVUA 2ZE2A 4ANCA 4J5OA 3HT3A 2XY7A 1T03B 3JYTB 2ZVIA 1A6LA 1TL1B 3FEZA 4EYIB 4AXIA 2XGPA 3OTEA 2BRKA 3BGRA 3I6PA 1OO0B 2DGWA 5AE1A 1PAEX 2L9WA 3BEGB 4HR2A 1KKHA 5KFAA 4J90A 4CI0B 5DRKA 1NSKL 3KNGA 3DHXA 4KYZA 3U1LA 4QIWD 2DCUB 4I64A 5KG2A 3CJ5A 3SZ2A 4IFVA 2P9GA 3B6BA 2ATCB 2YNGB 1BXNA 1D3WA 2BJDA 3LANA 5HQMA 3EPGA 1JB0C 2HPUA 2XS7A 1CS4B 4UOFA 4YN3B 3W66A 4KRWA 3NEKA 1F3VA 4KHRA 1HHSA 1I5OB 3P96A 4LT6A 2P9EA 2CADA 1O0PA 4RW9A 4DV6J 3RJMB 4NA2A 2UXDF 2BW2A 2MQMA 4QJVA 1IUJA 2XO6A 2UV8G 4I2PA 3HM9A 4NLPA 2OFGX 2JEIA 2V68A 3JAMY 3HPOA 2FLNA 5GMKa 1BQMB 4LSZB 5HL7Q 2W01A 4FKXA 3M8RA 5KFGA 4UQTA 3D54A 4ZPTR 4NLDA 1HPZA 2BJ8A 3FQLA 1FK9A 2Z4PA 2JEFA 3D1HA 1XIQA 2YXLA 1URRA 3A3NB 4Y2CA 1UW4A 4X62J 3TX0A 3EJMA 3MM5B 3OTCA 2LQ5A 4P2SA 4PWWA 2OJ3A 2Y9HA 1PIEA 3CDUA 1S0MA 2AJ0A 4USKA 4EZ6A 2VZ9A 3DLKA 5KFYA 1S4EA 3A13A 2GAHC 4DZ6A 2BDPA 2PMZD 1Z4UA 1TV6B 2QLXA 1AXQA 1RDRA 1VC0A 1KOHA 2XLKA 2LECA 2K2PA 4EK2A 2IM1A 3HO1A 4PXBA 3DMJA 1RI7A 2H54B 4I1TA 4X4NA 4KSEB 3ET6A 1EIYB 3MM7A 4UOGA 3D6FB 4HTIA 5KG4A 1X5OA 3GFYA 2DNMA 2QSWA 2HVIA 2ZBPA 1EQMA 3DRYA 4QIEA 4QYZJ 4DI6A 2C3PA 4Y28C 3B54A 2QTWA 3PJ9A 3H40A 4DPYA 3MMJA 1RAJA 2DJWA 2PN6A 2IY5B 4ZJLA 1NK0A 5F8HA 1TK5A 4K4SA 2FZCB 5HQ8A 2OO4A 2CQPA 1N52B 2DXDA 2IYIA 5I42A 2HGLA 3MR6A 1R0AA 4C8LA 1EZZB 5A8RB 3EUNA 1RE1B 3M7VA 4LFAJ 2FZGB 2RVJA 2FC9A 4FXDA 3ETMA 1C4CA 3PRDA 3G6ES 3C15A 2MDAA 3MEEB 1RWWB 1VQ8S 2BVZA 1SKWA 4WFAQ 3MPDA 3KYLA 4NLOA 4PAAA 3BN4A 1XERA 2OKQA 4ZVRB 2GQ2A 1MWZA 3UDVA 1SQFA 2OD4A 5CYMB 2IYGA 4J7CA 3H4DA 2CKWA 1FJEB 5KFBA 4KT0C 2HNDA 2RDIA 2YKMA 2CQ0A 2PSZA 3D67A 4EGLA 5C25A 2JNJA 2LQ8A 4PG7A 3IGNA 1CC8A 4DL4A 2HRUA 2IIHA 2OGUA 1PCAA 1HI8A 3MECA 4IQMA 2IC3B 4XDDA 3M2RB 1XNQJ 2XQCA 3D9BA 2XGQA 2R9LA 2W4CA 4KAIA 4GKKF 4ZHRA 4F4YA 4M5MA 4FS1A 2EFGA 2MQQA 5ITHA 1X31C 1JWWA 2XMMA 5IQ6A 1S59A 3M9MB 4USUA 1JLCB 2ZZTA 4JI4J 4LFCJ 3HP6A 2HURA 4L73A 1C2PA 4NX9A 4NMXA 4J9NA 4KGVB 4LRDA 3RBDA 1NZAA 3QATA 1HQEA 1B4SA 4A8KA 1C1CA 3FBEA 3W63A 3GE9A 2HS3A 1LW2A 4ATNA 4DBQA 1CJTA 2DHXA 2W2QP 1HNVB 2KT3A 1JLFB 1HNIB 3ONQA 3X1LB 4B3RF 3P45B 2RH3A 5L39A 5L1JA 3NMAA 4C8NA 4IDKB 3HMJG 3BBFA 3L3CA 2C3OA 3BQ0A 3BF4A 1WF2A 2W9BB 4H4KA 3W62A 2J0WA 2CQ1A 2KG0A 4Q0BA 1S1VB 3EZ5A 3T5JA 5A8WB 4Q8EA 2OPPB 1RT2A 1FRJA 3B78A 3BO4A 2HHTA 4OIXA 2RDJA 2WBRA 4CT9A 4Q8FA 2W7AA 4WE1B 4RBTA 2ZZMA 2HWHA 3ZZRA 4NI2A 3KKFA 3PEHA 4WIQA 4WYWA 4U7CA 3K2YA 2BQUA 1AZSA 3SFUA 2LEBA 5IM0A 4RWWA 3JQJA 4U8YA 1L3TA 4DSJA 9RUBA 4MKVA 2IM0A 3PVXA 2DR6A 1WDDA 1NB2A 1NDLA 1UVMA 1S77D 2B7BB 3MCSA 5IC4B 4DQRA 2J7UA 1GX5A 1PC4A 2RRNA 7FDRA 4OX9J 1VHFA 1RWKB 2DK2A 4N76A 2OUGA 2AT1B 1QTNB 2DGVA 2VU5A 2BBEA 2VA2A 1RTIB 3DFEA 8AT1B 3LALA 2COLA 1DQAA 3ZZZA 4JOUA 5ETTA 2V2QA 2FVSA 1BUXA 3DLJA 2KM8C 1RU1A 3C14B 2QA4S 2DNZA 3PTWA 3HX9A 3FCHA 4I67A 3GB0A 3VAKA 4F4WA 1N5VA 3SEOA 2RQCA 4WTYA 2MQNA 3DKDA 3LGMA 2V4QA 2B56A 2OSQA 1KBRA 4RW4A 4C11B 3BR8A 4PKDB 5A2QY 1SJRA 2DRAA 1O51A 3I9V9 5KTQA 4DU8A 3EYZA 1MROB 2C2RA 1GXLA 3KHRA 3IXQA 1PC5A 3CB4A 3CCMS 2IA6A 3M1VB 1W26A 3J81U 2BKPA 1R8BA 3LPEA 4XTTA 1NK6A 1SH3A 2ZH6A 4JUZA 1YZ7A 1DURA 2YQ3A 1S72S 1L3VA 2DR9A 2E1MC 5F9NA 4F0KA 1T05B 3JS9A 4PABA 3GFXA 3TUZC 3ITHB 4X84A 3MOJB 1SIWB 1U6BA 2LQJA 3H90A 3OSPA 4Y2MA 3W2VB 4KKOB 4QR2A 1AUDA 1U6ZA 3RW7A 3T9NA 1O6XA 1T3NA 2VF3A 3FSYA 4GKJF 4WTOB 1F0XA 3OJSA 3H2LA 3OR1B 2MZTA 2AX1A 2FJXA 2YNHA 1TL7B 2BKOA 2UXCF 1S7IA 3ILOA 3G4SS 2Z2YB 2R2SA 3IWNC 3TOQA 1DQ8A 4B3SJ 2RUGA 3S7RA 2NUHA 3S6EA 3C6UB 1NB7A 2ASLA 2HRYA 2R8GA 1BQNB 4UUXA 1VQSA 2F40A 4DV2J 5DG8A 1B0PA 2FJAB 1M5SA 3BSAA 3F44A 2Y8YA 2NYIA 4Z7CA 3D7SB 2W9CB 3M32B 4OV6A 4ED1A 3JTPA 2PMHA 2VG5A 1FVSA 2B4UA 2BV3A 3Q2SC 4OL8A 4M5NA 2VASA 2XLJA 4L3KA 2I2YA 4TVAB 2FJDB 4PPDA 1HD0A 2K8GA 4DR1J 3FVYA 2HHHJ 3WZ0A 2QO3A 4AL6A 3BSOA 3BSCA 2JLFA 2MHNA 4DXLA 2ACYA 3OTDA 3C2PA 1K8AT 4KY3A 4ED4A 4ZKAA 3DRPA 2R4FA 4P2XA 2V9WA 1KTVA 3Q86A 4FYXB 3EXYA 1EB0A 1W2IA 3ZZUA 4NLXA 4OI4A 1ROFA 4UTGA 3AA8A 1CQMA 1M90T 3CJKB 3K5LA 5GMEA 4DV3F 3CD0A 2CJKA 4B3TF 4PPZA 4AE5A 2CDQA 4DDFA 2O01C 2RD5C 3GV8B 3CJ4A 1SVDA 3JXOA 1SCJB 4PXEA 5D8HB 1FRHA 3SQOP 1H0HB 4FVCA 2HAFA 4FZVA 5LMNF 4YOEA 2YH0A 1LWFA 4X4OA 2OH2A 2D3O1 1VCTA 1PGZA 2J9DA 3KJVA 5KFDA 4YMEA 1U1LA 4DG1B 3D0IE 4KPCA 5LJ3Y 3MMAA 3TX8A 1FK9B 3SCKE 2AD9A 2YKNA 3J80Y 4ZVSB 3K8WA 2CQ3A 2HFVA 3M2VB 4ED0A 3HJFA 1S1WA 5LOQA 4V1Ak 2XCPA 3M8ZA 4F26A 1CQNA 4JV5J 3WC0A 1UFWA 3QO9B 2VFRA 1UA0A 3UCUP 4LIWA 2XULA 2Z30B 4PG6A 1TKTB 2EWHA 4MT1A 3W8PA 2W8KA 1RHKB 4Q2LA 3KHLA 1Y9OA 2Z2LA 1S1UA 6FD1A 2K7JA 3UE2A 3ZTOA 2ZBCA 1IKVA 4EO8A 3GSIA 5EUHA 5CA5A 4WP3A 2WK4A 2MLXA 2BOAA 2RT3A 1T9VA 2OEKA 1H2UX 3IR7B 3U7JA 2YX1A 4I7FA 1VHIA 3M4XA 3CDWA 2DPJA 3AJ2A 4ITSA 2CNKB 3NGDA 3QT6A 4KR0B 2C1EB 4ZVEA 2ZJQQ 3HHLA 2XSJB 4J9UE 3BJYA 5JXSA 3J7AN 4DLEA 4JI1J 5F8IA 3SV4A 2XEXA 1NUEA 3UVJA 1VISA 3A12A 1EP4A 4HI2A 3PFEA 3M05A 3MDFA 1SJ1A 1RAOA 4NLSA 2GHPA 2IJFA 4USWA 3LOUA 1RAHB 2DNYA 2CJ9A 1VIXA 3RRKA 5J1PA 4DFMA 5L46A 5A8KB 3EVWA 3GIJA 1YJRA 1J5OB 2QLFB 3EM1A 4M5HA 2WSCC 4JI8J 5D3GB 4QPXA 1RB0A 4XO0A 4DL0C 2AEMA 3UWTA 2MQPA 1WHXA 2E7WA 2CQCA 2XHCA 4J9MA 2ERRA 1KFDA 3LP2A 3NOCA 1UJ5A 3MM9B 5F0WA 5BJRA 3SXLA 4LF5J 2HQFA 1RSCA 2WONA 2YKMB 5HBMB 4YR0A 1KLMA 1SH2A 4PWDB 2J7WA 3MECB 5KG1A 3QZ7A 2VDIA 4OX6A 3OXFA 2FJVA 1U8WA 4FF4A 1JX4A 2ZNZA 1CEZA 3OTOF 3Q0AA 4C8OA 1DHMA 2D74B 4IG3A 2NUUG 2B6AB 1Q79A 3AOCA 1N32J 2KRRA 1VI7A 3KLIB 1RHQB 4CWBA 3BGFA 3MMCA 3PYGA 1G7CB 3M8WA 4K7QA 3GYGA 5CYQA 2FHOB 1R7IA 4ECSA 1HBMA 1PJ7A 3T1HJ 1FRXA 4DV7J 2V34A 1RZMA 4FPIA 4PUOB 2CAJA 3R1LA 1JK9B 4XK8C 3H2VE 3UCZP 4CYUB 4LSNB 4WZQA 3IR6B 3EICA 3IWLA 1X4EA 5EN1A 1RBOB 4FYVB 2R2TA 4DL7A 2XWYA 2VFTA 3IP0A 5T7LA 4F4XA 2IRYA 2P6TA 1OMSA 2X1GA 3PFOA 5ETKA 2YBVA 1YIJS 2IBOA 5F8LA 3GYXB 2QLBB 4JI5J 4OYXA 2OI2A 2KU7A 1HLWA 3PW5A 2X7IA 3TZZA 1N34J 4AL5A 3BYRA 3CEDA 1REGX 3KLEA 2GMJA 5ADZA 3UD5A 4ZVTB 1RACB 3CNQP 1RT2B 4K4ZA 2IRXA 1Q81T 3M6WA 3QJPA 3GFHA 3JB9k 1H98A 5E3QA 3M8QA 2OEMA 3OT9A 4M5IA 4ES1A 3QBCA 4NI2B 2JL9A 4R25A 2BJEA 2ZBRA 1AZSB 5BYRA 2R2UA 2AU0A 3T5LA 1LV5A 2C3MA 2ADBA 2RIJA 3L95X 1QE1B 5HI7A 1VRQC 4N7TA 4B08A 2FHJD 5DJBA 3J80U 5HMWA 4DCPB 1RABB 3THPA 8RUCA 3MD3A 4LVNP 1FJGF 3NGKA 2JLGA 3OTBA 4DQPA 3QFWA 4FF3A 2EFNA 3OFGA 1RA7A 4CLUA 1NHKL 4RZRA 2KZZA 2O3DA 1VIOA 3QLHA 4WF9Q 5AXMA 2NCKL 1D9DA 4A8OA 4PG5A 3TANA 2M52A 4HT5A 1RYRA 3NNHA 1TVRA 2R7QA 3MEDA 1IJFB 4DPOA 2E29A 4HI1A 1CPZA 2A2DA 4WU2A 4RNMA 2CA9A 1K9MT 3TYTA 2VDHA 3R9LA 3VVTA 3JSRA 1G2EA 1XC9A 4ZVOB 4DX5A 5ETNA 4GVBA 3MHYA 2ASJA 2FIUA 2CYYA 1CLFA 5IT9U 4IG0A 2HSEB 1W25A 2DXFA 4LJMA 4NLWA 2GGPA 1TL5A 2MJUA 1FRMA 2HS0A 1GXUA 4U8VA 3FK4A 3ILJA 2M0GB 3RB6A 3ENVA 1R89A 4FVMA 2UUBJ 1X4BA 5IZHA 5LMUF 1TKZB 1VBYA 3KOAA 5KT2A 3ZZOA 3KLGA 1NJWA 2F63A 2PE8A 2DNHA 4KHMA 1N4LA 7AT1B 2YNIB 4OI3A 3R5CA 5D6GA 2OFHX 1V3RA 3PEJA 1SC6A 2ZOGA 3MPYA 2RHQB 4IRKA 4NYZA 5AJ3J 2RB7A 2UUTA 2DHHA 4CDIA 1N56A 1RT6A 4ICLA 3ZXWA 3TAMA 5DDOC 1F9EB 1WOPA 2JDJA 4URGA 2C2KB 4OJ3A 5KFIA 3M8SA 4MKYA 4CTAB 4DF4A 3PIOQ 2A1BA 1FKPB 4DCJB 5ETQA 3MFHA 3V4IB 5L9XA 3MPVA 2MSSA 2H3EB 1LWEB 2C28A 2FDNA 1Q86T 1TL4A 1T9XA 3W3SA 2YKAA 3DDIA 5CXTA 4J91A 4PQUA 1G6BA 2VA3A 3GCXP 3IAS9 2VG5B 2N7CA 3Q2TC 3AOAA 4JI3J 4PEOA 1B7YB 1HQUB 4DV4F 4BC9A 2DXEA 2PO4A 3TA1A 4U7UD 4A8QA 1FJ7A 1GEHA 1HWUA 2HK3A 3FDSA 3IG1A 4KGZB 3I4PA 2ZM6F 2CWKA 1HBOB 4O3NA 3OBIA 3D6MB 2PGCA 3PM9A 2DH9A 5K8MA 3DRPB 5KFKA 4O3SA 4PWUA 4RW6B 5M2UA 4EBDA 3CJSA 2GVDB 2PMWA 2VODA 4ZITA 1VRUA 2E5JA 5HROA 2B5JB 1IKYB 3CMES 1OPIA 3F41A 3NS7B 4G1QB 1WKKA 1AYEA 1AROP 2ZZNA 5B0FA 2W7PA 1BMQB 3PJWA 4OMFG 4J9KA 3ILLA 2N4DA 1X9MA 2YNFB 1NNDA 3CJQA 2J5AA 1S9EB 5F3TA 2H4YB 1LWCA 2LVWA 4NRUA 2IVYA 3VAFA 1MLAA 3BSNA 3MMAB 3GJQB 3KMSA 4X4RA 4N8NA 5G0RA 5KT6A 1R8CA 3LH2S 4RJVA 3NY0A 1UWBB 5AT1B 1NK8A 1X5PA 3GFZA 3KJFB 1GAOA 3EGWB 1CJVB 2F7VA 2MY8A 1U8SA 2MGZB 1MN9A 4IH5A 4H4OB 4P2FA 2DGQA 2CQBA 2H5JB 1KQFB 1HNXJ 4HHHA 3DGPA 3LGNA 5HN0A 3M6VA 4F8RA 4USIA 3WDOA 4DR2F 4DR6J 3DLHA 3OFEA 1OQ6A 3GIKA 4CLPA 3K57A 2J0QD 2CZVC 2HG4A 2QA1A 5F8MA 3CCUS 1Y0HA 1UP1A 2AZ3A 3F73A 5B09A 2VPYB 3T6JA 2UXBF 1D8YA 1CULA 3V81B 2DBBA 4LF8F 5D0HA 2GO9A 5EHHA 2AF6A 2I1RA 2J8AA 3IM8A 2P8IA 5JJBA 2BJ9A 5KFVA 2G4BA 4WJBA 5K8PA 1C0UA 1U7LA 1FWPA 3P6YC 2VG7A 4LBPA 1S7HA 2BRLA 3MM8B 3HD2A 1FKOA 2C2MB 2HQIA 4M5DB 5LT5A 3FZ2A 2B4PA 3ZTQA 2W25A 2JVRA 2RAQA 4USTA 4LF9F 3HULA 1S4FA 3E8OA 3PYDA 1FE0A 3W5YA 1D0EA 3HXMA 5J2MB 2I5JA 2EBEA 4GC6A 2C22A 4OZ2A 4DSIA 2HHPA 3IS9B 4RO0A 4OHXA 1ZAXA 3CW2C 3PYFA 4AYBD 2EK6A 6FDRA 1GNKA 4MIBA 3KMQA 3UPFA 1SBRA 3PZPA 4OX8A 3KG4A 3PG9A 2HFZA 4CLZA 1OYDA 2POKA 4F04B 4ELTA 2C2EA 2XZWA 4P74A 4RUCA 2VUGA 1SC4B 2DY1A 3H7HB 2E1PA 1NEEA 2IM3A 3KK1A 1NSQA 3GCWP 2GIFA 3BDPA 4C8MA 2B7CB 1N5YB 2DEIA 3LP2B 2MYFA 3NCRA 1IXKA 2H4WB 2O66A 2CZ4A 1KP6A 3HHKA 2UVWA 2WONB 2R7VA 2XI3A 4LREA 1T11A 4OZNA 4ZS6A 3DI6A 2JZ5A 2XI2A 2OPSB 1UVLA 3JSBA 4RNNA 1HHQA 2YKOA 5U47A 2RNEA 3HDSA 2RMLA 4ZLJA 4FN5A 1V3ZA 1CBKA 1JJ4A 3WBZA 4F7VA 1TMJA 1FF2A 4DFKA 3PX4A 4DS5A 3FSIA 3MOZA 1UEUA 2Z58B 4ENOA 2QSFA 2XTJP 2QT7A 2XS2A 1P9QC 2NQPA 3MMCB 3T6BA 1YITS 3UI3A 1K44A 1IBLJ 5L9NA 3PHEA 1EETA 5E0OA 2V50A 3NBPB 1NM2A 2VIHA 2GIQA 5B0GA 2UXDJ 2VKZG 2JC1A 1OJ4A 2QX0A 5GAGU 3C8YA 3LF0A 1T03A 3JYTA 3IRWP 2Z8QA 1LWXA 1VQ5S 3ENWA 3I9ZA 2XWXA 5E2QA 2PFDA 2XY5A 1W2BR 1NKBA 4OZ0A 1RLDA 1X8DA 4ETZA 4FYWB 2DPIA 2HNYA 1FFGB 2ZITA 1RA6A 5J2NB 4ANDA 2M8HA 4AQYJ 4R8UB 2CPYA 3A1YG 4LF1A 2A3JA 4DV6F 5JMNA 2YNGA 1KLNA 2LU1A 3BB5A 2KL8A 3OL6A 1CS4A 1UWAA 4UZCA 1UKUA 5KT3A 3C6TB 3L09A 5HMYA 1I51B 4WK1A 4FF1A 2F3JA 5J1NA 1KSPA 2ZH4A 2Z2ZA 2K06A 2Z57B 1XR7A 2DR8A 3KWMA 3RRHA 1NPKA 2AWZA 2HGNA 4JV0A 1KS2A 4X62F 2VBYA 3FCVA 1N6QB 1YSJA 4ZCLA 3LTOA 2WVFA 5K8OA 1LW0B 3PIPQ 4OJGA 1RAIB 3HZEA 4H4KC 3JSMB 4C8KA 5E7OB 2ZHOA 2Q1LA 3UR3C 4ILLA 2MKSA 2JFDA 3HD1A 2HKEA 2ZVSA 3OVAA 2AJFE 4URQU 1UCNA 3VZIA 1LXJA 3MM5A 3FRZA 4OZ1A 2WB1D 3EGVA 4Q7AA 1RTHB 1CC7A 1M1HA 4K5SA 4RWXA 4C97A 1RTZA 2KFYA 1T94A 1QJHA 2L3MA 1FWLA 4HACA 4CH0S 3B8HA 1YJNS 1XTZA 2HMIB 1FRLA 3MAQA 4Y00A 4KV8B 3DLEA 4ID5B 5E5NA 2R7UA 5A0YB 3IC1A 1PBAA 2MZQA 1JJ2R 2HYIB 1KFSA 2AYBA 2ILZA 5KOWA 5E3RA 4I2QB 4IG0B 4I4BA 3LWLA 4OJHA 3GWCA 4HTJA 3S8SA 2R8HA 3I5CA 3P5TL 2V67A 3OR2A 4ZA1A 1WNEA 4DOZA 1KD1T 4EO6A 2XZDB 3QGPA 2WVCA 2ZBQA 1U6FA 2EEYA 1YGYA 1HI0P 2WW4A 3RB3A 5FDLB 5KFXA 3WIVA 4LSLB 2W7OA 4HLBA 2KKHA 2XNQA 3CF5Q 1MWQA 4OI0A 2M3DA 5HP1B 3IFEA 1RP5A 5D0RA 1EJ7L 3A3OB 2G0CA 4X4UA 1HW9A 1P6TA 4H54A 2X3DA 3TVYA 3LP1A 3G86A 1HD1A 2DHSA 3MM6B 3H5SA 1VQOS 2PI5A 1X9SA 4DN9A 2HBRB 2ZJPQ 4C3LA 2WSEC 5J2QA 4NLYA 4FF2A 3R2CJ 2QC3A 4CO4A 1QAYA 1FNMA 3I55S 1AT1B 1WSRA 2HHSA 5A8RA 2UUCF 3VGVA 1TAQA 4LQ3A 3TAMB 2NLWA 3NNCA 1F5CA 3CDBA 3IO1A 1IKWB 1NSAA 5D4LA 3Q8PB 1N33F 2IMOA 1RQ0A 1HYSB 4U95A 4J9RA 2R8KA 3H0PA 2UZAA 1RT7A 1TKDA 4I56A 3FNNA 2HBYB 5K20B 1AFIA 5CYMA 2ZH8A 3GR0A 2DGTA 2HZAA 2E5HA 1V5VA 2VH7A 1REVB 2VJVA 1V9OA 3CCZA 3E01B 5GAEU 3CCJS 5B0AA 1N0VC 1NH8A 3THVA 2IC3A 4ZVQB 4PG4A 2JJ4D 3VZHA 5F0UA 5KG5A 1S79A 3ICLA 2DR5A 3CMAS 4JI4F 4LFCF 4WXOA 1PBUA 4BWMA 3GG0A 3W9IA 4B3RJ 5F8JA 3N4WA 5KFHA 3IG1B 1YBTA 5DQIA 5KFOA 4CLKA 3L9ZA 5RUBA 4DR5F 1H38A 1Y5NB 1VQMS 2DHAA 1JLCA 2V4JB 4YY3F 1F2GA 2YWEA 1BC6A 2VB6A 3TJAA 4ZLPA 5D78A 3ISZA 5AE2A 1ZPVA 3CTRA 2LDYA 4FBTA 4F0HA 1U02A 2EPIA 2VV5A 3EZOA 1JLEB 2Y1LB 4RW8B 2J9DE 2YH1A 1MN7A 2EXUA 2BEFA 1JLFA 4X64F 3R5DA 1RBLA 5I3UB 1LWCB 1CJUB 1KEKA 3KK2B 4MTPA 5ETOA 4I0WA 1DTQB 3FBCA 1S1XA 2NXEA 5E3AA 3KLHA 2R7TA 1K73T 3OW2R 1S1VA 2QFJA 1UFKA 5IFMA 1QSSA 1JNRB 3N6LA 2B8QA 2LCWA 2OPPA 4CLTA 3GU0A 5FJ4A 1Y3KA 2GJ2A 3CCSS 3LPYA 3X3UA 3G8TA 1AUSL 1XJWB 1WEZA 1MU2B 4DWIA 4DSEA 2KI2A 3R5GA 2CPXA 1DTTB 3U1NA 4WE1A 2X3GA 4OI2A 1RT3B 2XY6A 1OY9A 2FVQA 1RAGB 1WC5A 5LXRA 2UU9F 3W61A 1FE4A 2PT0A 4C6AA 2FJBB 2HBQB 1SC3B 2XB2D 1S0OA 3TRGA 3DC2A 4QZVB 1SKSA 4X65J 3M2UB 1TR0A 1NJYA 3MTJA 3DRSB 1UA1A 2FY8A 4WP8A 2M8DB 2LA4A 4E8UA 7FD1A 2FB0A 2XMJA 1ZA1B 3IGVA 4ECVA 2Q6BA 2ZNYA 5KFUA 2NR0A 4OYBA 1QTMA 1KR4A 5K14B 1KVJA 1BE4A 3W64A 4JBCA 2FJEB 1IM6A 2ZH3A 2HRTA 4Y65A 3C14A 5JUMA 4DL5A 2HFOA 1XN9A 3QQCD 2H5EA 3NRBA 4X2BA 1VQPS 4CRJA 4HH0A 1RHRB 2EC2A 4PG8A 1EKRA 4HL9A 1Z2ZA 1PYTA 3I5BA 2QLJB 4YUDA 3NGSA 1T7PA 4GKJJ 1YZ6A 5AXLA 4ED7A 4C11A 4EUVA 3IBFB 1Q8KA 1GQEA 3KG1A 4KGXB 1CJKA 2UXCJ 1MROA 3VALA 4AUKA 1FHTA 1OS5A 4X66F 2MJNA 3V6DB 3TZWA 3NNAA 1U0SA 3IBCB 3KXDA 2HHQA 1R6VA 2K1RB 5A76A 3PKMA 4OYMA 1RWVB 1YRXA 4CH7A 4C0BA 1WEYA 4YR3A 3VVUA 3AH6A 1T05A 1WHYA 1XBWA 3LAMA 2M70A 4JB8B 2PC6A 4TU7A 3KUEA 4QW8A 5CAAA 4EZ9A 2MEWA 2RF2B 3W2VA 2CJAA 4KKOA 2K7KA 3UNGC 3AA9A 1U1RA 4G6VB 5DS7A 2VPXB 2ROGA 3TVKA 1F3FA 2D9OA 4DV2F 1UEVA 3PACA 1TL7A 3FUYA 4GO5X 3TWZA 1Y3JA 3KLFB 4LR8A 1M5HA 2EKNA 1O8BA 4A8SA 1BQNA 2RILA 2E9ZA 1FXLA 3UN2A 2GQCA 1HBUA 4DR1F 3R8YA 2W9CA 2XYPB 3RZAA 4B3TJ 2FVRA 3MEGB 3PJXA 2CPIA 1Q4RA 2O67A 3H8YA 2RRAA 4A48A 3T1YF 4RU2A 2FD2A 2ZH5A 3HFKA 3CXCR 2NSBA 2NZCA 1GT8A 2V9KA 3K5PA 1S12A 3QWUA 1WTFA 1S0VA 5M2PA 2HNYB 4A4JA 1VK3A 1RADB 1WHVA 4ZJOA 5T41A 2MLYA 2NREA 1F9HA 1B0TA 1PO6A 4V19J 4KH0B 1IBKJ 4TLRA 1AFJA 4MAKA 4ZP7A 2GAGC 3GZ7A 5FIIA 3PXGa 5B0BA 2CPFA 3P49B 1Q0NA 3CJKA 3MUVP 3QFHA 3UO0A 4NLTA 2AQ4A 1FDAA 2PD1A 2MMYA 1U0HB 3POTA 2MZSA 5HATA 1ZS6A 4D3GA 1MW7A 2QLWA 1S6UA 1Z2LA 4BDPA 4M1KA 4P7VA 1Q7LB 2E1AA 2HGMA 2CFXA 3FFIB 4QWBA 3H4BA 4DG1A 1SL1A 5L1LA 3RGIA 3M2VA 1NPRA 2BYCA 4K2XA 1GMWA 3GPAA 1Y7PA 3SV3A 3JQKA 4F3OA 1BWEA 1NRKA 3QO9A 4TQRA 1IJEB 4Y0FA 2OTJS 4C9DA 3UCGA 2VQEF 2MKIA 4O23A 3AB4B 1TKTA 3HJVA 4ECRA 1WC1A 2IBKA 3THTA 4HACB 2ASYA 5F8GA 3JQMA 3RBEA 3V4MA 4ZOSA 4NRTA 3QAUA 3HHDA 1JLQA 3DLEB 1U4BA 4Q45A 2EVZA 1TMMA 2YY3A 2RKIB 1UPMB 4EFAC 2DRDA 3RAMA 4CO3A 1B0VA 4RBVA 4URSA 1YJ7A 1RAEB 1HQ2A 3BPDA 3I0SB 2E1RA 4Y6IA 1WI8A 1LEOA 2GMLA 3OR2B 4IFYB 1VQ9S 3DDNA 4DU7A 3CWJA 5ETRA 1QLNA 2QL7B 3BDEA 1YJVA 2WBMA 5C5JA 3W8GA 3D1OA 4BC7A 1UZDA 3N79A 4OJ1A 3PDNA 3CCLS 3QSYB 3V6HA 2DIVA 4LFBF 3HVTB 2GHWA 3QAEA 4IYQA 1WEXA 2ZEJA 2XSJA 3G6XA 1DBDA 3BQ1A 1Q8LA 3LP1B 4PQAA 2YQ1A 2BE7D 1NHUA 5IOLA 4DHVA 4IOBA 4ZPVR 5J2QB 2MB0B 3Q89A 4DCOB 2HFUA 1GFWB 1FRIA 1DFDA 2XMWA 4NLGA 3TA0A 1P8GA 3T9ZA 4RUHA 2Z0GA 3ZNJ1 3O6QA 3BKTA 5KT5A 4P72A 4K4XA 5GAHU 4FXWA 4I6YA 2E5GA 5A8KA 2C2OB 4X4QA 3I96A 3EVOA 4LF5F 1J5OA 3I82A 3WIUA 1FO1A 3MMBB 1XMBA 5D3GA 2QA2A 5L38A 1IR1A 1JNZB 3MURP 1RGVA 2XMUA 1RT7B 2FPHX 1VQNS 2B8PA 3DLLQ 2M5YA 1VOMA 3SI8A 4U6PA 3MM9A 2G0IA 3GSDA 4F4KA 3CJ3A 2CVIA 5HBMA 5KG6A 4MH8A 5C42B 4UOHA 4HDHA 4ZP8A 2V8DA 1U45A 4KJIA 4PWDA 2IHR1 4M5LA 2VKRA 2J0XA 1KVIA 2IRUA 3PX6A 2FLOA 4DV7F 1EQ0A 4L6V3 1R43A 1VFJA 2B6AA 3M30B 3KLIA 4IR1A 4U96A 3RTVA 1JXLA 2Q6CA 2PI4A 4K2JA 5KFRA 2D41A 4J9QA 2DO0A 1UMJA 4W90B 1NKEA 4ZN1A 2HLUA 2BJ1A 3FMBA 3G8SA 5CH7B 1HNZF 3UQSA 1PSDA 1I6JA 2L08A 3VAIA 2HHXA 5LL6d 2E44A 4PUOA 3NWGA 5EGYA 4ECUA 2CNOB 1ZM2A 1KNZA 2C3YA 2WVDA 1KQGB 4CYUA 4LSNA 2QRRA 4JI5F 1SXLA 3MPWA 3CCTA 4C7QA 1JKHB 1N34F 1JMTA 3UN5A 4O4GB 3V5RA 2FJWA 2I6WA 2RQKA 1X4GA 2EW9A 4DUYF 2BQRA 2JOQA 3BV8A 2EC0A 3DRXA 2QE5A 4V19X 1QAXA 3QPIA 4R0EA 1S1XB 3OL7A 3KLHB 1C1BB 1FJGJ 4DR7J 4M5JA 2MHEA 1OSCA 1N0UA 3CO9A 2EG1A 3VAGA 2DEJA 1BHNA 3BGUA 3BZQA 4JI2F 4L75A 1HA1A 4ECQA 3KHHA 2LLZA 2HQCA 2V4RA 4W4MA 4ILMA 4WBFA 1WD6A 2C2NA 1X5SA 2RS8A 3JAMU 4B3MJ 3K8VA 2OELA 3OVBA 3H5UA 1DRZA 2HHUA 4AXJA 2FLPA 2HNZB 1QE1A 1XMQF 2AGOA 3CVKA 3D68A 5HLFB 1VR6A 3TARA 1IR0A 1F6TA 3CJ2A 3N01A 3C19A 4CNYA 2AYEA 1Q53A 3R5JB 3DCAA 2KVIA 3B82A 4RL1A 3W9HA 5LMUJ 2MKYA 3MF5A 4BLGA 5JVHQ 4CO1A 5EWFA 3SSQA 4O3PA 4USMA 2AZ1A 3IMQJ 1JLAB 3RYLA 2FUG9 1AA1B 3CIZA 1VYAA 4LBHA 2HEKA 1U1MA 4USHA 1TTHB 5HVFA 3EGZA 3AD8C 2OTLS 2UUBF 3G8QA 3W5XA 3LQVA 5DDQC 3DDKA 2VICA 1OWXA 2CDRB 2DGOA 3FC9A 1VBXA 2RU3A 2KZMA 4RNOA 4KO0B 1AB8A 3N28A 5EDWA 1AW0A 5EWEA 1CJKB 4FNIA 4DV0F 1ZH5A 3G87A 2K3IA 3G82A 4KHPJ 4J37A 3VGUA 2E9RX 2XYGB 1TKZA 2EI5A 1X7VA 1QM9A 4S0MA 2H65B 1NJZA 3TUJC 3GMGA 2BM1A 5KG0A 4WFBQ 4MFBB 1NKCA 2IA0A 3GIMA 4RNHA 5E33A 2YNIA 4TY8B 1Y4ZB 3OLAA 4DPTA 3DOMA 1NH7A 1FXDA 5FD1A 2V2VA 3GTYX 4ELVA 3BBCA 3OUYA 1RTJA 3BREA 3CJ0A 5L1IA 2AGQA 2UVVA 4CQ1A 1KN6A 4DV4J 3VR1A 3QJJA 3OL9A 1UVJA 2D3OR 2BABA 1HBNA 4DQQA 5IWAJ 2DNOA 3PRVA 1YQHA 2ZM6J 4N41A 5C2CA 2E1CA 2AKWB 4CTAA 5D4PA 4OHYA 1FKPA 2CJQA 2XMTA 3V4IA 1UAWA 4JI3F 4J9LA 1D1UA 1LWEA 3SSRA 1M0SA 1R3NA 4AFFA 3EX7B 1R8AA 1J27A 5DLFA 2IAJB 1XMOF 1S6QB 4O44B 2BE2A 1HBUB 3DLGB 3G71S 2LFVA 3R97A 1HWJA 4LIRA 2YVSA 4OV1A 1N8RT 1PKUA 2A6MA 3AD9C 3UNYA 4E98A 1MG7A 1U47A 1NK9A 2VQFJ 1HQUA 2KN4A 3LW5C 4E0DA 3ZTRA 2WVBA 2J0SD 2UUAF 1SJ3P 3F56A 3AB2B 2ZH9A 4QQBA 4KB7A 3CMQA 5IC6B 4XPEA 5GADU 4KE5A 4LUBA 1HBOA 3AAWB 1QSYA 2B9XA 2H1YA 1Y10A 5ETVA 1ZZFA 3FBBA 4ES2A 1F1BB 2W24A 2ZC3A 5LSOA 1RHMB 5CHCB 2RHSB 1IKXB 3DOKB 4DV5J 1S6OA 2CQGA 4YB5A 3ILIA 4RW6A 1FCAA 1FNXH 3JTOA 3RRGA 2GVDA 4WFYA 2RRBA 2B5JA 5CCMA 4ER8A 4DR2J 1IKYA 1M5KC 3J7YI 3J81j 1SUQB 1U24A 3RAXA 2KM8B 3HLUA 2FC8A 4G1QA 1TUVA 1R0CB 3Q8QB 4CO5A 3POTB 3HK2A 1NJIT 4DR3F 3W60A 3ZZPA 1FEEA 1CSJA 4J9PA 5E3PA 1QY7A 1T0TV 2YNFA 1GK8A 4I69A 3S01A 3MAAB 1H72C 2E5IA 3TJ8A 1S9EA 1N36F 1Z1ZA 1HNXF 3VCDA 2N3LA 4YHHJ 3R6LB 4OFZA 2K3KA 1RWNB 3GV5B 3GR1A 3O8WA 4LF7J 3SBMA 2IMWP 3TUPA 1UWBA 1CJVA 3LUYA 2MGZA 4C2MA 4H4OA 3SDEB 1OSDA 5KFMA 1EAYC 4LF9J 1SPBP 3K89A 1T3OA 4WXWA 1WF0A 3EGNA 4A8MP 2DGSA 3KDOA 2A18A 1JLQB 2KFNA 3NGRA 1GX6A 2D1CA 2DVIA 3V81A 5DGBA 2W4DA 1FWKA 3T5KA 4NZ6A 2MZJA 3EE3A 2B9WA 4PRFA 1UFLA 4C98A 4QYZK 3DYAA 1N88A 3VWSA 1NBEB 4DL6A 5LM7E 2BE9B 2ZH1A 3MM8A 1NXIA 1VRTB 1NZ8A 4M5DA 1P1LA 3TEGA 5DGAA 4DUTA 1FTRA 1RT5A 3BPSP 3RW6A 3AY0A 2CWXA 3N5BA 1V5IB 2YQ0A 2YWGA 2B4VA 3VV2B 1TKXB 3PCOB 4ZCIA 2Y3YA 5B0DA 1T9TA 2RE1A 5EWGA 5J2MA 2PEHA 2IDLA 1TQLA 2DRBA 3NP5A 4NXMJ 2HZVA 1WKJA 1JIHA 3ISND 1FX4A 2R7OA 3RAQA 3W9JA 3IS9A 1X4CA 2CNLB 2VG6B 5DZ6A 3HVAA 1CVJA 4NMLA 3HZGA 3CCWA 2N4CA 1GXTA 2PA8D 3NWRA 4B3OB 2GIRA 2WRMA 1URNA 4DSFA 1T95A 2YPYA 2CQHA 3H20A 5AXKA 1HL6A 5A2QU 1VGYA 5GAGI 3CC7S 3K58A 2RQ4A 1SC1B 3HVRA 2FLLA 2ZWPA 4LR9A 4NOHA 3N0VA 2Y0SD 3QIDA 2BANB 3ENAA 1HI1A 4X4TA 2U2FA 3LO3A 2P9CA 1DAXA 1N5YA 1RAFB 1X0PA 1S48A 2BMBA 4JYAJ 3KG0A 2RU9A 4AT1B 3CJRA 4NXNF 2V5HG 2DY9A 1HR0F 1S76D 2VPZB 3UD4P 2DH8A 4K50A 3C66A 4L3NA 3NG8A 2OPSA 3R7BB 4A8FA 1IQTA 3BKUA 3HI9A 3PW7A 2NXCA 2PA3A 1HHTP 1O5JA 2DNKA 4LRAA 1JLGB 3R6GB 3KDNA 1TP7A 2MY7A 1IBLF 1DLOB 4B9MA 2D69A 3FKBA 2MQ8A 2AGPA 2DIUA 4UQGA 3BO2A 1RWOB 1S9GB 1SL2A 3T1AA 1M1GA 2A0FB 2QZ8A 4OHVA 1WACA 3TUIC 3GILA 3V6JA 3D5MA 4OHWA 5AXNA 2R8JA 1U1KA 2VOOA 4NA3A 1RCXB 1RUSA 1HMVB 4WZMA 1C0TB 3NS5A 3NBPA 1VDHA 3E51A 1KC8T 2D9PA 2G2OA 1H3DA 1VBZA 3E3XA 4HHJA 2ZOMA 2OD6A 4AQYF 1U1QA 4FXVA 4Q43A 4Z37A 4NCGA 3GYNA 4NLRA 1HWKA 3M8PB 3C16B 1SQGA 1VBKA 3HKZD 4KBIA 4R5PB 3MI7X 5H1SV 2CZ9A 1IBCB 5J2NA 1TZ0A 1VJQA 3I0RB 4R8UA 1Y00A 4M63A 2QJ3A 4KFBB 1UETA 2FHJA 2KT2A 3AXKA 1NJXA 3DRRB 2WCXA 3C6TA 1U25A 3GQCA 3V6KA 4F25A 4ECZA 2HVDA 1J5EF 2YX4A 1GMWD 2V2KA 2NSCA 2G9OA 1IR2A 3FEYB 2JEGA 3GJTB 2CPEA 2G2ZA 3P8BB 1RK8A 2F8HA 1N6QA 4IUFA 5GVQA 3SCLE 4RW7B 5E41A 3KFWX 2BXJA 1LW0A 2IJNA 1G1XA 3JSMA 2DB1A 3J81Y 2ROPA 1D9FA 3FJ2A 3H59A 1E6YA 3AODA 5BYSA 3C46A 4OYIA 1H2TZ 2X1FA 3TVZA 2KHDA 2NXUA 3NKYA 3D4JA 3OXLA 4KC5A 4MJKA 1RTHA 4ED8A 4HVZA 2QMXA 2YKPA 3MPUB 4JI6J 2F9DA 2OHDA 1KVKA 1L3UA 3A8IA 2HVEA 2HMIA 2HQGA 2HW3A 4N8OA 1ITPA 3W2WB 4KV8A 4ID5A 3R7NB 3VGSA 1WI6A 5A0YA 2YWFA 4C3KA 4LF4F 1K47A 4ZVPB 1ZTWA 1T02A 4WWSA 4ZPCA 2N3OA 3MR5A 4YDDB 3R3TA 1ULRA 3FCWA 1YI2S 3P4UB 4DPWA 1APSA 3WX4A 4WP9A 4Z7YA 2UUCJ 1A7GE 4I2QA 4F02A 3K5OA 1KOOA 1PILA 3MUTP 1OY8A 2NS1B 1TL3B 5MAOA 2KH9A 2QMWA 3EDRB 4PR6A 3ZZTA 3QSIA 2N7YA 3GIRA 4K0KF 5GAEI 1K1SA 4RPFA 1LNQA 3C3LA 3ZTPA 2OPRB 4ZLLA 3G82B 2GW8A 3NXZA 2AYMA 1N33J 2DO4A 3DM2B 5FDLA 2HIYA 4LSLA 3T19A 4QIVA 2RUSA 2BACA 1UVIA 3RBXA 5HP1A 2YX7A 2AJQA 2LEAA 4YDXA 1T9WA 1E6VA 2MZRA 3MM6A 1RWXB 1Q8BA 3DOMB 4NYOA 2EG2A 2AMCB 2DR7A 5DZ7A 2H51B 5BR8F 4Q44A 1RCOB 3DOLA 3IRXB 3CD6S 3OUYB 2PDAA 1RTJB 3OD2A 4ZMMA 4W92B 4C8YA 3OSNA 2NZ4A 2HWTA 3TQEA 1QVFR 3ISNC 4M5KA 1PYSB 1UZHA 1PAUB 2FHKA 1S9FA 1HBNB 2MTLA 3CDAA 1I94F 4ECXA 2YTCA 1Y5IB 4X4SA 4JV1A 2VC1A 3ELHA 1WTBA 2VHGA 4DR5J 1IKWA 4ZCMA 5JVGQ 3DN9A 2M4MA 3IA0A 2AIRB 1HYSA 4ETXA 1MSWD 2C3UA 2U1AA 5DDRC 4YY3J 2H5IB 2EKYA 2DNQA 1U2CA 5HK4A 2KVQE 2UP1A 1IBMF 2ILYA 2C42A 4OLPA 2XM3A 5ETMA 1U1NA 4NEYA 3D2WA 4USVA 2BE2B 1REVA 3HSJA 4CLLA 4DSKA 4BHQA 1RTDB 4AL7A 4CCHA 3NCQA 2BZ2A 1U1PA 3E01A 2DD8S 5A6PA 3OFHA 5L8RC 4P75A 3GJSB 5HMXA 2OPQB 4PXDA 1N5TA 3CUNA 1Q1KA 4ZVHA 2BJ3A 4LF6F 5KFWA 4X64J 3ADAC 4FKYA 4WU3A 3N6NA 5KFQA 1TU0B 2JC0A 4P10A 4ZP6A 3WC2A 3LP0B 2WVEA 4Q5VA 2KYXA 4PCQA 2XZTB 2FVCA 4OX7A 4J9OA 4XIUA 2ZD1B 1QAJA 3ENQA 2LXFA 4EU0A 1LXNA 2V4JA 4FYYB 2WB4A 4OI1A 5KG7A 2HFNA 2F9JA 1RT1B 2DNRA 4OZLA 3KK3B 1YK9A 1TK0A 3AHPA 3UFCX 1XNRJ 1IWGA 3O5TB 2MQLA 4JP8A 2J9EA 2DT9A 4O3QA 4JI7J 5J2PB 1JLEA 5KFZA 4RW8A 2UU9J 1U2FA 4M95A 2GFFA 2UUWA 1U26A 2SXLA 5LSRA 4YB7A 1B64A 1H2VZ 4KH1B 5I3UA 1ZAVA 1CJUA 1RWUA 3MXHP 3KK2A 2B3TB 4GMKA 2HLTA 4ZN3A 2RSQA 1UL3A 2CPDA 2J6UA 1UVNA 1DTQA 3DGVA 3HSDA 2XNRA 4FNHA 3TQ1A 4YS2A 3MR3A 2HIQA 3QGIA 2H48B 2W2NP 4C4WA 1SI9A 1B3TA 2FTRA 2E5LJ 2Y1RI 4DV1F 3FEXB 1MU2A 1ZZNA 2R42A 3BR9A 3Q83A 2XYHB 3MCMA 1DTTA 3FZBA 1RT3A 4X65F 3PYEA 4NCAA 2P6SA 3HHEA 3R2DJ 3AT1B 4I6AA 1S1TB 4ELUA 3UN3A 3OQ2A 1X60A 1KRPA 3D6HB 1HWLA 2D3UA 4A8YA 4ZJQA 2JX2A 3CC4S 2FZKB 3DYAB 2FYXA 4DLGA 2AEJA 3M2UA 3QT7A 3DRSA 1S97A 3AJDA 2OAUA 5J1EB 5DG7A 1RT5B 4X66J 4MYUA 4N56A 5K14A 3R5AA 3MCNA 5AE3A 2E7XA 5IQQA 2GX8A 3PV8A 1GMVA 4MIAA 4WPAA 4NCBA 4O3OA 5BYQA 4TY9A 3GV7B 2CQ4A 2LA6A 1U49A 3IBWA 3GONA 1K0TA 4A46A 2CUYA 3BH6B 1S6PB 1XEZA 2QIFA 3NAIA 1BY9A 1HARA 4KQZA 1G4CA 5IS2A 4N5SA 1JLBB 2F4VF 5KFCA 5K5MA 2GS8A 2BJ7A 2ZH7A 3MD1A 2ZUGA 1HNWJ 3NL0A 1ZM3A 1KTQA 2RQMA 2QN6B 3TP2A 1VC6A 1P9YA 2P5VA 3H5YA 2JH3A 2G1HA 1K1QA 3SSSA 2O1PA 2LKZA 4N77A 1RHJB 1D9AA 4MK9A 4DUZF 5KFJA 2AW0A 4CLSA 4WFNQ 4IO9Q 3V6DA 1U2RA 3Q24A 3PW0A 1X0FA 1SV5A 1FJCA 1HIYA 3FQKA 2K1RA 3L7UA 1JJCB 2ZE2B 4P9SA 4JI0F 4WYLA 3V2UC 2BR0A 1YRUA 1B99A 3PX0A 2JLEA 3BGLA 3BGRB 1S0NA 5D0GA 1XQIA 1R8HA 1N5SA 1S5ZA 1ZETA 2CJBA 4F2SA 5D4OA 2V8GA 2B9YA 2DGXA 5KFPA 3BGOP 5H9FK 3G96A 4IFVB 3R7SB 2RF2A 2HVHA 2CJXB 3T1YJ 3VTIA 5HANA 1TFWA 1SL0A 1IWAA 2ASDA 1FI4A 4RUBA 4ANEA 4DSLA 4ECYA 4CM2A 3MGJA 1D09B 4EEYA 3H98A 3NCPA 2JWNA 4CLFA 4QWAA 2H9ZA 1L5UA 2I8EA 5THWA 4ES3A 3KLFA 4RW9B 2I38A 2L48A 3AFGA 4I2PB 4DR4F 2AP6A 1YJUA 1FKAF 2ZKTA 4X4PA 4Y3CA 1CG2A 3NMRA 4DS4A 5DM6Q 1EKSA 2CJYB 4OZJA 4K4TA 4G65A 4HT7A 2V6AA 3ZTSA 4HEA9 3IAM9 4USJC 2AJ2A 3J7ZT 1HPZB 3MEGA 4L76A 1F5BA 2F1FA 1BWVA 5CZVA 1VQYA 4QCLA 2X1BA 4CO2A 2HQDA 4NCGB 2HK2A 3R1HA 3QRRA 3OLBA 1IBKF 2QMUB 3K5NA 1ZYQA 1Q5YA 2IVFB 5KFEA 4KIAA 1R0BG 3DLKB 1J2VA 1DARA 1X4DA 1SJQA 4CO0A 3W5ZA 4TKTA 4DQSA 4OZ5A 2Y0BB 1RAAB 1R8PA 4O0NA 1NK5A 2VQEJ 1HFEL 1U09A 1WC0A 2BQ3A 3SCJE 1KDNA 2E9TA 2BW7A 5IT9Y 2ZC4A 1NLKL 3DMJB 4IRDA 1U0HA 1T8EA 4DEZA 1JXVA 1WOOA 4CH1A 3ET6B 2D3ZA 2AJ4A 4CLWA 3MM7B 1RWMB 1UJ6A 3M6XA 1UPPA 5EX3A 5DETA 1I3OB 2GC8A 2VFSA 3H5XA 3FFIA 3VHQA 2I0XA 1LFWA 4ZCKA 2EBGA 4TU8A 4ZP9A 4TLQA 1E6YB 3O3LA 4ED2A 1RYSA 2JVOA 3CE8A 4C0HA 4K4YA 2GCFA 4GRSA 3EPIA 1WUUA 1NHVA 4NE9C 1FXRA 2CQIA 1T9YA 4U67Q 2CPJA 1W7WA 1WKLA 2MKKA 4ZVUB 5I42B 3NS6A 4LFBJ 2UVRA 4K59A 1R0AB 3IR5B 4ERDA 5GAHI 1M5PC 3PY8A 1KWMA 4O0IA 1QAIA 1Q5VA 3MUMP 3I31A 3C15B 3CD7A 2BA9A 2RKIA 5LXYA 3QT5A 3K59A 1RISA 2WOMA 2AV5A 2RJZA 4QOTA 1NMEB 4ZIWA 4ALZA 2Y8WA 2CRLA 6AT1B 3HHLD 3I0SA 4WFXA 1IM4A 4DL3A 2AEFA 2KB2A 4IFYA 2B51A 2Q3PA 3A4TA 1YG0A 2BX6A 1KQSR 2HNDB 3W65A 5C25B 1RBAA 4WCEQ 2QFIA 2CQDA 3VAJA 3HVTA 1Q16B 3CCES 4RR5A 3SQGA 4EYHB 5ETPA 4LFAF 1E6VB 3SMZA 3QRQA 5H9FJ 2JEJA 2CXEA 1QD1A 4ZHRB 1S99A 2DNNA 2ACMA 1Y5LB 2B0GA 3I5AA 4IOCQ 3TI0A 4B9UA 3DOLB 5CCLA 1FTCA 3A8JA 2KXHA 3B4DA 3QZ8A 4B9LA 4LR7A 3E2EA 4GKKJ 1ZOTA 1PJ5A 5I3QA 2IFXA 3QJLA 1M5OC 3TJ9A 3HT0A 3ZZYA 2B43A 3MMBA 1VLOA 2OP5A 1RXOB 2R7RA 1HQEB 4MKAA 3PO5A 4LMZA 5I4MA 1C1CB 2Z2MA 4WFZA 1VJWA 4WK3A 1WF1A 2GO8A 1LW2B 3EMTA 4RX6A 2F4FA 5HSPA 1XNQF 1X4FA 1HNZJ 4DZDA 2EFVA 1CJTB 1R27B 1TFYA 3EZUA 3B4MA 2KJVA 3GP9A 1NK4A 4CT8A 5C42A 2V69A 1R6YA 4UOCA 1HWIA 4LVOP 2FQQB 2O5DA 4B9VA 1BD6A 1WHWA 4YEAA 1PJ6A 4Q0BB 2LXUA 1SH0A 3H42A 1R31A 5F3ZA 4DUYJ 2HBZB 1QDUB 2CIMA 3M30A 5T14A 1VS3A 2XLIA 2MPUA 2RS2A 1V3SA 2ZOFA 5CD4A 1RHUB 1XK8A 1RWPB 3CCRS 5LJ5Y 2VJUA 5BXIA 5CD4H 2EK1A 1BLUA 2VL1A 3Q8VA 4ZIVA 3QGGA 3ZFVA 2ZHAA 2G13A 2QYGA 1H7WA 2ZDOA 5IM0B 2G2YA 3RR7A 4JI2J 3MR7A 5I3PA 1WJ9A 4R0JA 4NPOA 4CIOA 2KXNB 1RKIA 2CPZA 2KJWA 1WELA 1JKHA 5KT7A 4DR7F 3TZXA 3D6TB 4O4GA 3BM7A 3OVSA 4DMZA 4IR9A 4C0OC 2NXJA 4TYBA 3Q8UA 1JJHA 1XMQJ 4M94A 2ZDPA 2ZBIA 4Q2MA 3WX8A 1S49A 4RNFA 3PR5B 2FHMA 4ZPWR 4DPXA 4L72B 2V8PA 2KDOA 1LFPA 1MNEA 1KONA 1C1BA 3HSZA 2W2OP 3LWMA 2QGFB 1SIZA 1OIAA 4NLVA 1LKZA 1UW9A 4B3MF 2KT5A 3VAMA 3N9UC 2DNLA 2X1AA 5DM7Q 1H6KX 3DHWC 2PFFB 2CNNB 3RUBL 2GVZA 1ZTTA 4J9VA 5D4NA 4WIIA 1ELOA 1WG1A 4RW4B 1FT8A 3G6YA 4ZLNA 4OX9F 5KOXA 5KFLA 2HNZA 3OHAA 3AJ1A 4XDCA 1ZA2B 4G3IA 2MSTA 2XCAA 1H7XA 4BWJA 4QIFA 5HLFA 2IDEA 2QL9B 5H9EK 4ECWA 1WSVA 2Q79A 2Y1JA 3J7Z5 3GIIA 2W2PP 4OHZA 2VD3A 3KTQA 4A8WA 1ZM9A 3H25A 1PYOB 4OZ3A 4DV0J 2HVZA 1S57A 2W1BA 2WW8A 1SKRA 1WOSA 2HS4A 1TK8A 3Q8RB 3HF5A 2A6OA 4KTQA 1T9UA 3K0JA 1XWLA 3NGUA 4K5RA 4C8ZA 2YPZA 1IN0A 3D3BJ 3HHNB 2HHWA 1IVZA 3AOBA 1JLAA 1F2HA 5HMZA 4NLQA 3U1MA 1M1KT 3VGTA 1WG4A 2YNHB 4H4MA 4WKYA 4I68A 3LGHA 4IRCA 4KHPF 4B02A 5CYJA 4U9RA 3HKWA 2DYAA 1WC4A 2W2MP 5E3CA 1ZAWA 4KO0A 2KXFA 3UDCA 4LQ9A 1FDNA 5M2RA 3TA2A 2ADCA 4AD6A 2P2CB 2C2ZB 1RU2A 4DPUA 2CG8A 1JQGA 3HHLC 3HCXA 3I87A 4TQSA 3GJRB 1SV5B 1NCLA 1FESA 3GG1A 4MFBA 3UW1A 4K4WA 5GADI 3ZNUA 4F4ZA 1XMOJ 2KTQA 4TY8A 3HVWA 3R5BA 2PIIA 3EDQB 2C2DA 5IWAF 1SB6A 4Y34A 3WQPA 4PYAA 5B0CA 4BS2A 2XC9A 2W8LA 4B3SF 2JRSA 1RT4A 1YJWS 3I32A 3QIPA 4RU9A 2R7WA 2NYHA 2UUAJ 4QR1A 4HHUA 3OFFA 4D3HA 1UTAA 3IWXA 1OQ3A 4O4RA 2GHVC 1FRKA 3W1YC 2VBZA 2PEBA 3AXMA 5DQGA 2CPHA 2JFKA 2V2ZA 3US5A 1KHWA 2RDDA 4I6WA 2VQFF 3DU5A 2IAJA 1S6QA 1MWYA 4O44A 3MTKA
chains in the Genus database with same CATH topology
5DG9A 1LWFB 2Y0SD 3QIDA 4EO6A 2BANB 3DLGA 3QGPA 1HI1A 4DQRA 3KJVB 2HHHF 3CCVS 1U6FA 4QBUA 4X4TA 2CVEA 1YGYA 2U2FA 3LO3A 1HI0P 2J7UA 3RB3A 5FDLB 1GX5A 2P9CA 5KFXA 4LSLB 1DAXA 2W7OA 4HLBA 2KKHA 3MR2A 2XNQA 1N5YA 1PC4A 2LMIA 2RRNA 7FDRA 1X0PA 2YKNB 1S48A 2YWKA 3CF5Q 2A10A 3KG0A 1VHFA 2RU9A 4OI0A 2M3DA 2DK2A 5HP1B 3IFEA 1RP5A 4N76A 4NXNF 1S1WB 4MYTA 2G0CA 4X4UA 2V5HG 1HW9A 1P6TA 4H54A 4DV5F 1HR0F 1S76D 2VPZB 2BM0A 3TVYA 3LP1A 2DGVA 3UD4P 2BBEA 2DH8A 1RTIB 3G86A 3DFEA 3C66A 3FSXA 2DHSA 2VA2A 3MM6B 4K50A 1HD1A 1X4HA 3H5SA 3LALA 1VQOS 1X9SA 2PI5A 2COLA 4L3NA 3PNIA 4TXSA 1DQAA 2XS5A 3NG8A 2OPSA 4DN9A 4A8FA 3VQTA 2ZJPQ 1IQTA 3ZZZA 5HO4A 4C3LA 2WSEC 5J2QA 4NLYA 4FF2A 2OLWA 4JOUA 3HI9A 5IT0A 4CO4A 3PW7A 1QAYA 2PA3A 1HHTP 1O5JA 2DNKA 1FNMA 3R27A 3L7PA 2FVSA 3I55S 1JLGB 4FYDA 2J6SA 3DLJA 2KM8C 2QA4S 4QPTA 2BOPA 2HHSA 1TP7A 2MY7A 1IBLF 1DLOB 1GH8A 4B9MA 5A8RA 2UUCF 4YFUA 1TAQA 2DNZA 1N5QA 1IKXA 1S1UB 3DOKA 4BCAA 2AGPA 2M2BA 2DIUA 4UQGA 3ZC4A 3BO2A 1S9GB 1SL2A 4LQ3A 3TAMB 3T1AA 2NLWA 2DNPA 3HX9A 3NNCA 1F5CA 3FCHA 3CDBA 4I67A 1IKVB 2QZ8A 3GB0A 4IQXA 4OHVA 3VAKA 1WACA 3TUIC 3IO1A 3GILA 3Q23A 2LQ9A 1N5VA 3SEOA 3V6JA 2RQCA 4WTYA 3D5MA 4OHWA 2MQNA 2I9SA 2LQBA 5AXNA 3LGMA 2R8JA 1U1KA 2V4QA 1SUQA 2B56A 1IKWB 2OSQA 2VOOA 4NA3A 4RW4A 4C11B 4YHHF 3BR8A 2QYCA 4PKDB 5D4LA 5A2QY 5KAKA 3Q8PB 1SJRA 5B7WA 4MIWA 1N33F 2IMOA 1HMVB 4WZMA 1RQ0A 1C0TB 3NS5A 1HYSB 2DRAA 1O51A 3I9V9 5KTQA 4J9RA 3EYZA 2R8KA 2UZAA 3J7YU 1RT7A 1TKDA 3NBPA 1MROB 1ZM4A 2ZFHA 4I56A 1SQEA 4QWEA 3FNNA 2C2RA 4LF7F 1GXLA 3KHRA 3E51A 1KC8T 2D9PA 3JSYA 3IXQA 1AFIA 1PC5A 3CB4A 1H3DA 4I7FB 1VBZA 3CCMS 5CYMA 2ZH8A 2IA6A 3M1VB 3GR0A 3E3XA 3CT9A 4QIGA 2DGTA 4HHJA 2ZOMA 2OD6A 4AQYF 2E5HA 2VH7A 4JV5F 1R8BA 1U1QA 4FXVA 4Q43A 1REVB 2CQ2A 4Z37A 4NCGA 3GYNA 1V9OA 1NK6A 1SH3A 5H9EJ 1I1GA 2ZH6A 2GNKA 5FLXY 3KNAA 4JUZA 4NLRA 1HWKA 3CCZA 3M8PB 1DURA 2YQ3A 3E01B 1S72S 1L3VA 2V94A 3MWBA 5GAEU 2E1MC 5F9NA 3CCJS 5B0AA 2DR9A 4K4VA 1N0VC 3MAHA 1NH8A 1T05B 2MKJA 3HKZD 4KBIA 2R7XA 3THVA 3OL8A 3GFXA 3TUZC 4R5PB 2IC3A 1FDBA 3ITHB 4X84A 2DITA 3MI7X 5H1SV 1GTEA 2JJ4D 4PG4A 4QYRA 3VZHA 1SIWB 1TZ0A 5J2NA 1U6BA 3MOJB 4K4UA 3HHLB 5F0UA 5KG5A 1S79A 3ICLA 3I0RB 2DR5A 1QVGR 3CMAS 2LQJA 1UJ4A 2FGCA 4JI4F 4LFCF 4WXOA 4R8UA 4BWMA 4F3QA 1Y00A 3GG0A 5A6WA 4M63A 3OSPA 3SDEA 2MXYA 4Y2MA 3W2VB 4KKOB 5F8JA 4KFBB 4QR2A 1AUDA 3N4WA 5KFHA 1U6ZA 3IG1B 3RW7A 2DGUA 1EP4B 3T9NA 1UETA 5DQIA 5KFOA 2FHJA 2KT2A 4NL5A 1F9FA 3DNCA 1T3NA 3FSYA 1NJXA 2KHCA 4DR5F 3DRRB 4GKJF 1F0XA 2WCXA 3OJSA 1P1TA 3H2LA 3OR1B 2MZTA 3C6TA 3BS9A 2AX1A 2FJXA 3DXSX 1U25A 3GQCA 2YNHA 1H38A 5EX0A 3Q22A 3V6KA 1Y5NB 2DH7A 4GO7X 1VQMS 4ZPDA 2DHAA 1JLCA 2V4JB 2UXCF 4YY3F 3G4SS 4F25A 3VF0B 4B17A 2R2SA 3IWNC 3TOQA 1F2GA 1DQ8A 2VBWA 4ECZA 2RUGA 1BQXA 2YWEA 2YX4A 2V0NA 1J5EF 1BC6A 2VB6A 2V2KA 2NSCA 3S7RA 2G9OA 3FEYB 1C4AA 4CNZA 2NUHA 3N5FA 3S6EA 2VBXA 2JEGA 4TU9A 4ZLPA 3C6UB 5D78A 2WTFA 1NB7A 2CPEA 2ASLA 2HRYA 2R8GA 3ISZA 5AE2A 1BQNB 4UUXA 2WOMB 1VQSA 3RR8A 2F40A 1ZPVA 5DG8A 1LK5A 3CTRA 4EWTA 1YVFA 1RK8A 2LDYA 2F8HA 1B0PA 2FJAB 1M5SA 3BSAA 1N6QA 4FBTA 3M9NB 4IUFA 5GVQA 3SCLE 3F44A 2NYIA 4RW7B 2EPIA 2VV5A 5E41A 3KFWX 2BXJA 2W9CB 1LW0A 1MMLA 3M32B 2QEXS 1JLEB 2IJNA 1G1XA 4RW8B 3JSMA 4ED1A 2DB1A 2ZKUA 2NPFA 2J9DE 3NLCA 2YH1A 3JTPA 3J81Y 2ROPA 1VRTA 1D9FA 3FJ2A 2MKCA 3H59A 5KFTA 1E6YA 2PMHA 4NXMF 2VG5A 3T3FA 1FVSA 2B4UA 1JLFA 5BYSA 4X64F 3C46A 1H2TZ 2X1FA 2BV3A 3Q2SC 3R5DA 4JI1F 4OL8A 2VASA 3TVZA 5I3UB 1LWCB 1VQLS 2V8HA 2XLJA 2KHDA 2NXUA 2I2YA 3NKYA 3OXLA 1KEKA 4YP3A 3KK2B 2FJDB 4PPDA 4KC5A 4MTPA 4MJKA 1HD0A 1RTHA 4HVZA 4ED8A 2K8GA 1TKXA 2QMXA 1FVQA 2YKPA 3FVYA 4I0WA 1KLMB 3TNVA 1DTQB 2F9DA 1S1XA 2A2CA 1OPZA 3WZ0A 1F60B 5E3AA 3KLHA 1L3UA 2R7TA 1K73T 3RB0A 2QO3A 3CGIA 4AL6A 2FVPA 4Y2KA 3BSOA 3OW2R 4M8LA 1S1VA 3BSCA 2QFJA 3O1LA 4B9SA 2JLFA 2MHNA 5IFMA 2VC0A 2ACYA 3OTDA 1JNRB 3LAKA 5C24A 3N6LA 3SQGB 1QSSA 3C2PA 4FBUA 2LCWA 1K8AT 2HMIA 4QR0A 2N82B 3IN5A 2OPPA 2HW3A 1IQZA 2F8EX 4N8OA 5FJ4A 1JXEA 1Y3KA 3W2WB 4ZKAA 4IG3B 4KV8A 2GJ2A 3CCSS 3LPYA 3DRPA 3CDEA 3X3UA 4ID5A 3G8TA 2R4FA 2VG6A 5F8NA 1WEZA 4UW2A 1MU2B 4DWIA 1WI6A 5A0YA 4U7UK 2YWFA 4C3KA 4DSEA 2FGOA 2V9WA 2KI2A 4ZPAA 4LF4F 1KTVA 1QUVA 3EXYA 2CPXA 2J76E 1ZTWA 1DTTB 1W2IA 3ZZUA 4NLXA 1T02A 4OI4A 4JI8F 4Z2XA 3K7RA 1ROFA 3U1NA 4WE1A 4YR2A 4ECTA 4X4VA 2X3GA 4OI2A 1YHQS 1RT3B 3AA8A 4ZPCA 2N3OA 3MR5A 2EFOA 5F41A 4YDDB 2XY6A 3R3TA 4B3OA 1CQMA 2FVQA 1ULRA 1M90T 3CJKB 3K5LA 5CYQB 4DV3F 1YI2S 3CD0A 5LXRA 1VQ5S 1APSA 4OI6A 3WX4A 2CJKA 1NK7A 1HBMB 2UU9F 4B3TF 4PPZA 1A7GE 4I2QA 4F02A 3K5OA 2J9CA 2R2RA 1KOOA 1FE4A 4AE5A 1PILA 3MUTP 2CDQA 2NS1B 4DDFA 1TL3B 2PT0A 2O01C 2RD5C 3GV8B 1S10A 5MAOA 4NWBA 2QMWA 3CJ4A 2KH9A 2FJBB 4JYAF 2Q43A 4PR6A 3ZZTA 4PXEA 2XB2D 5D8HB 1S0OA 1FRHA 3TRGA 1H0HB 4NZ7A 2N7YA 4FVCA 3DC2A 4FZVA 4QZVB 2WSFC 1SKSA 3OHBA 4FP9A 5LMNF 4YOEA 2YH0A 2ALZA 1LWFA 4K0KF 4QWCA 1U48A 3G9CA 4X4OA 2BANA 1KHVA 1K1SA 5GAEI 2OH2A 3C3LA 1PGZA 2J9DA 3M2UB 1TR0A 3KJVA 2OPRB 5KFDA 1NJYA 4YMEA 1TL1A 1U1LA 2GW8A 4DG1B 3D0IE 3DRSB 3MTJA 4ZDNA 1UA1A 5LJ3Y 3OV7A 2AYMA 3MMAA 2DO4A 3DM2B 5FDLA 3TX8A 4LSLA 3T19A 2M8DB 4QIVA 4HYKA 2LA4A 1FK9B 4NZ0A 3SCKE 4E8UA 7FD1A 2AD9A 2FB0A 2YKNA 2XHWA 5T7LB 2BACA 2XMJA 3J80Y 1UVIA 2BUNA 3PKYA 4DQIA 3K8WA 3IGVA 2CQ3A 4ECVA 2Q6BA 2ZNYA 3M2VB 5KFUA 5HP1A 4ED0A 3HJFA 2YX7A 2NR0A 1QTMA 1KR4A 1S1WA 2AJQA 5K14B 2LEAA 4YDXA 2XCPA 1KVJA 1E6VA 3A8EA 4F26A 2MZRA 1CQNA 3MM6A 1N32F 3WC0A 2VONA 1Q8BA 1UFWA 3QO9B 2VFRA 2XMVA 4JBCA 1UA0A 3UCUP 2X51A 1LK7A 4LIWA 4IO1A 2FY1A 1YTYA 4NYOA 2EG2A 2XULA 2DR7A 2KO1A 2FJEB 4PG6A 2VOPA 4HH1A 1TKTB 5BR8F 4Q44A 3L7OA 3KLEB 2ZH3A 2DISA 1JLGA 2EWHA 1WG5A 3DOLA 2W8KA 3IRXB 4Y65A 3CD6S 5JUMA 4DL5A 3OUYB 4Q2LA 2HFOA 2PDAA 1DLOA 1XN9A 1Y9OA 1RTJB 2KYZA 2XMKA 2H5EA 5B0EA 4XPCA 2W9AA 3NRBA 3W7BA 4ZMMA 4X2BA 2Z2LA 4W92B 1S1UA 3T1HF 6FD1A 4C8YA 3OSNA 2K7JA 1VQPS 1S9GA 2NZ4A 2HWTA 3UE2A 1QVFR 3ISNC 4HH0A 2ZBCA 2FHKA 4PG8A 2D7SA 4HL9A 1S9FA 1HBNB 1IKVA 1Z2ZA 3CDAA 1I94F 4ECXA 3I5BA 4EO8A 2YTCA 4WKRA 4YUDA 1Y5IB 4X4SA 2R8IA 5EUHA 4JV1A 1T7PA 2VC1A 1N54B 3SFGA 5CA5A 3M8QB 1WTBA 2WHOA 1YRTA 1IKWA 5AXLA 4ED7A 4DX8H 4C11A 2WK4A 4ZCMA 1BQMA 5JVGQ 5MLCV 3DN9A 4EUVA 4IH6A 2M4MA 3KLVA 2UV8A 1GQEA 3IA0A 3P3DA 3KG1A 1HMVA 1C0TA 5SUHA 1RJJA 4ETXA 1HYSA 1MSWD 2C3UA 2U1AA 5DDRC 2RT3A 1QSLA 1MROA 3VALA 2EKYA 2DNQA 4AUKA 1FHTA 1H2UX 3IR7B 1OS5A 4X66F 2UP1A 2MJNA 3U7JA 2YX1A 4I7FA 1IBMF 3V6DB 2ILYA 2C42A 2QA4G 4OLPA 3OPKA 2AX0A 3NNAA 3M4XA 5KFSA 3I4HX 3OJUA 1U1NA 2HHQA 3CDWA 2M88A 2K1RB 3PKMA 3D2WA 2BE2B 2DPJA 1REVA 4RKUC 3AJ2A 4J9SA 3BN7A 3H2UB 4DSKA 4BHQA 1RTDB 4AL7A 4CCHA 2QV6A 3NCQA 1YRXA 4CH7A 2BZ2A 2HAIA 3M8PA 4C0BA 3E01A 1U1PA 1WEYA 2DD8S 4ITSA 5A6PA 4YR3A 1FEHA 3AH6A 1FD8A 3OFHA 1T05A 1WHYA 1XBWA 3LAMA 5L8RC 3NGDA 2M70A 4DF8A 3QWPA 4KR0B 5HMXA 4R5PA 4FS2A 4ZVEA 2PC6A 2ZJQQ 2OPQB 4PXDA 1N5TA 3CUNA 1Q1KA 2GMHA 1P27B 4TU7A 4ZVHA 5DQHA 3QLHB 3HHLA 2XSJB 5K8NA 4QW8A 4LF6F 3BJYA 3I0RA 5JXSA 5KFWA 4EZ9A 3ULHA 2VFVA 4DLEA 3TAPA 4WU3A 5F8IA 3N6NA 3SV4A 2RF2B 2XEXA 3W2VA 2CJAA 5KFQA 4KKOA 2K7KA 4KFBA 3UNGC 3AA9A 1VQ7S 3OXGA 1U1RA 2WAQD 1TVRB 4G6VB 1EP4A 2JC0A 4UY8T 5DS7A 3MEDB 2XBPA 2VPXB 4ZP6A 3WC2A 4HI2A 3LP0B 3PFEA 2ROGA 3M05A 4Q5VA 2KYXA 4PCQA 3DRRA 3MDFA 2FVCA 3MEKA 1TV6A 4OX7A 3TVKA 4J9OA 1SJ1A 2D9OA 3FGVA 4XIUA 2ZD1B 4DV2F 1QAJA 1UEVA 3ENQA 2LXFA 4EU0A 3PACA 2F8MA 4NLSA 1LXNA 2GHPA 2IJFA 2IM2A 2V4JA 2WB4A 4GO5X 4OI1A 3EXCX 5KG7A 2HFNA 2KRBA 1M5VC 3LOUA 3D0HE 1Y3JA 3KLFB 3J7A1 1VMBA 2DNYA 2F9JA 2CJ9A 1M5HA 1VIXA 2HQ3A 5DLGA 1RT1B 3RRKA 2Q66A 2DNRA 5J1PA 4DFMA 4A47A 4OZLA 5A8KB 3KK3B 4MMOA 1TK0A 3AHPA 3GIJA 3D28A 1YJRA 2GGPB 1J5OB 1O8BA 4A8SA 1BQNA 1LOUA 3UFCX 3UDLA 2WSCC 1L3SA 3DU6A 5D3GB 4QPXA 2ABYA 4XO0A 2RILA 4DL0C 2Y1IA 3O5TB 2MQLA 2E9ZA 5L1KA 1FXLA 3UWTA 2J9EA 2DT9A 1HBUA 2GQCA 2MQPA 4DR1F 1WHXA 2E7WA 4RW7A 4O3QA 4JI6F 2CQCA 2W9CA 5J2PB 3RZAA 1JLEA 5KFZA 4RW8A 4A8XA 1U2FA 4M95A 2FVRA 3MEGB 4J9MA 2ERRA 2GFFA 1DQ9A 2UUWA 1K0VA 1U26A 2SXLA 5LSRA 1KFDA 3PJXA 3LP2A 4KGMA 2CPIA 1Q4RA 1SJ4P 4YB7A 1UJ5A 1B64A 2O67A 2J6TA 3MM9B 3H8YA 5F0WA 5BJRA 3SXLA 1H2VZ 3KLGB 4F50A 2RRAA 4A48A 3T1YF 5I3UA 4RU2A 2FD2A 2WONA 1X4AA 1ZAVA 4YB6A 2ZH5A 3HFKA 3CXCR 2IVMA 2YKMB 3DLBA 1RWUA 3MXHP 3KK2A 5HBMB 2B3TB 4GMKA 2HLTA 3QYYA 2RSQA 2AYGA 1UL3A 2CPDA 4EBEA 1NO8A 2NSBA 4YR0A 2J6UA 1UVNA 1KLMA 1DTQA 1GT8A 2V9KA 2OIHA 2XNRA 1SH2A 4FNHA 4PWDB 2J7WA 3TQ1A 3MECB 5KG1A 3K5PA 3QZ7A 3QWUA 3MR3A 1WTFA 1S0VA 2HIQA 3QGIA 5M2PA 4OX6A 2HNYB 4A4JA 3OXFA 2FJVA 1VK3A 4C4WA 1SI9A 1G3OA 4FF4A 1WHVA 4ID8A 1JX4A 5T41A 1RT6B 2FTRA 2NREA 2ZNZA 1CEZA 3OTOF 3Q0AA 4C8OA