3NWGA

The crystal structure of a microcomparments protein from desulfitobacterium hafniense dcb
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
180
Chain Sequence
AMESIGLVEVNSIARGIEAADAMLKAAQVDLLEAKPVCPGKYIVLICGDVAAVQSSVTAGKTMAAHSVLDDFILPNVHPQVLTAISAATPLTLIKALGIIETFSIASLIVAADTAAKTGQVDLVEIRIGMGIGGKSFVTLTGDVASVESSVAAGVMLASERGMLVDKVVIPSPHDHLKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microcompartments protein
publication title Structure of a PduT homolog from a novel bacterial microcompartment
rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural protein
total genus 41
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nwgA02
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nwgA01
4OX6A 5DJBA 3H8YA 4RBTA 3CIMA 3DNCA 3NWGA 4P7TA 4RBUA 3SSRA 4AXIA 4AXJA 3MPYA 4QIEA 3IA0A 4P7VA 4QIGA 2A10A 2A18A 4RBVA 4P2SA 3NGKA 4DDFA 3PACA 5L38A 3SSSA 4PPDA 4OLPA 3MPWA 4OX7A 3DN9A 4OLOA 4QIVA 2A1BA 4OX8A 3VCDA 3N79A 4LIWA 3SSQA 2G13A 4QIFA 3I6PA 2EWHA 3CGIA 3I96A 3BN4A
chains in the Genus database with same CATH superfamily
3UNYA 1CS4A 4ELTA 2H4WB 1YX2A 2XY5A 1F1BB 3T5LA 1S1XA 3QQCD 2WSEC 4CNYA 2BJ3A 1HYSA 5HSPA 1VOMA 3RW7A 1HWIA 2HFUA 2FVPA 1D9FA 1ZTWA 3QLHB 1IKXA 2R7SA 1RWPB 3B4DA 3ILLA 1ROFA 4Y65A 4ZPTR 1VQOS 2WOMB 3M8PA 1D8YA 3R27A 1KQKA 4CLSA 4LREA 4USKA 4NLRA 1NZAA 2NUHA 5ETMA 5E2QA 5I3UB 1RWOB 2OSRA 2W4CA 3PJ9A 1REGX 1B64A 1P1LA 3ZZPA 1S1UB 2N3OA 3VGVA 1R0AA 2YNGB 3MM7A 3D54A 2GO8A 1IR0A 4B9LA 5JXSA 4B9UA 2Z56B 3L7UA 2AF6A 4NWBA 3HLUA 3UDCA 4B17A 4ZVHA 2V63A 3D6TB 4LRAA 3JQKA 1JLFA 1W25A 5K8NA 4ECRA 1LWEB 2HHUA 5T14A 1KP6A 3E3XA 1IBLJ 2OFGX 1U25A 2AJ4A 4CH0S 2KO1A 4EUVA 1NSAA 1CJTB 3JTNA 4FYWB 4F4ZA 2H5JB 4PCQA 3R5BA 4M8LA 4DG1A 4K50A 4ENOA 4OV6A 3NCQA 1NSKL 4WYLA 3GILA 3BSCA 1SH3A 1HL6A 3R5JB 2QMXA 2B6AB 4TU7A 1A9NB 2V4JA 1HHTP 2WBMA 1RT4A 1OYDA 1UAWA 4A8MP 3RB3A 4PWDB 4TYAA 5EN1A 1PJ7A 8AT1B 4Y2AA 3DHXA 4ITSA 4G1PA 1FNXH 5E3RA 1UW9A 3F41A 1QDUB 3PYFA 2XCPA 4UOGA 4O0IA 3V6DB 3ISND 2FJDB 4KBIA 3LALA 4K4YA 1VDHA 2M88A 3H5YA 2HPUA 4WU2A 2BW2A 2G0IA 3DGPB 3OFFA 4R0JA 5KFCA 1IBMF 2MPUA 1YG0A 2AQ4A 7FDRA 1NBEB 2PEBA 2VZ9A 4MKAA 3IP0A 1WF1A 5DDOC 1NRKA 2L9DA 1AXQA 1K0VA 2QN6B 3VAHA 2XMUA 3LPEA 4HR2A 3Q24A 3BREA 2FUG9 3LP2A 3UDVA 4ATNA 3O1LA 3VCDA 5ETLA 4KJIA 3PG9A 3UDEA 4C8LA 1MROA 3BJYA 2AGOA 1XQIA 5KFJA 2RF2B 1NJYA 4DFJA 5KFYA 1VJWA 1RT2B 3P45B 1YJRA 3K58A 4NASA 2B8PA 3KLIA 4WXWA 2W7AA 4DQPA 5M2UA 2G1HA 2XYGB 1KS2A 2RMLA 4QPXA 2VC0A 1X5PA 4A46A 4EK2A 3QFHA 2JWNA 3JYTB 1RWWB 2LA6A 4OHVA 3HI9A 4N7TA 1J5EJ 5LMUJ 1N88A 3PX0A 1CULB 1NU4A 1J5OB 3WX4A 3THTA 3V4IB 3UN5A 4H54A 2G1DA 1RLDA 4X4VA 2DITA 2HNYA 4TLRA 2ROGA 3T5JA 4P2SA 1NDCA 2MZTA 3SIPB 4K2XA 2MTLA 1Q1KA 1U45A 2XCAA 5J2QB 3WBZA 3W62A 1ICEB 2FVCA 3HJFA 2KG0A 3SDEA 2W2NP 5ETTA 1SJ4P 5CYQB 1NCLA 1NO8A 2R2TA 3HK2A 2XMMA 2DB1A 3TZXA 4NCAA 4K5SA 4DR4J 3R2DJ 4EBDA 2BRLA 5KFZA 2X1FA 2NQPA 3TR5A 2QE5A 5E41A 1SV5B 3LANA 4UF4A 1RYSA 4X66F 3G8SA 4RW4A 3TA1A 1S59A 1Q82T 2KJVA 2DGOA 2Y3YA 1ZS6A 3PW2A 5HQMA 4ID8A 5HROB 3ITHB 1HBMB 1HQEB 2WHOA 1GX6A 4GKKF 5AE2A 1LWCA 1Y4ZB 4OHYA 3ZTPA 1WHWA 1YWXA 3DLJA 2Q1LA 3V4MA 1S6OA 2I9SA 3PDNA 3GV7B 1H3DA 2AMCB 3N6MA 4X4PA 5DLGA 4NLUA 5IFMA 1I51B 1QE1B 5D0HA 2NUUG 2B8QA 3KOAA 1RQ0A 4DX7A 3MEDA 1SL2A 3AD8C 1S6PB 4S0MA 4QW8A 2NXUA 2F8HA 1YBAA 1GTHA 1XIQA 3DXBA 2LECA 1AA1B 1RUSA 3QIDA 5F8MA 3JTOA 3FMBA 2JEFA 2QT7A 2A3JA 1U6BA 1SKRA 3RGIA 3BKUA 4TY8A 2GZOA 2GJFA 3EYZA 2FY8A 2C2RA 5HK4A 3MMAA 2M7SA 1ZETA 2LXIA 4PZVA 5C2GA 1OO0B 3MWBA 2M2BA 1WEYA 3GCXP 4CO2A 4Y0FA 1EZZB 3VF0B 4ANDA 2DK2A 2LFVA 4J9NA 1JXEA 2ERRA 1FWKA 3OSPA 1U7LA 4IKAA 2KVIA 3VGTA 1U49A 4ZVOB 4H4MB 4PXDA 1S76D 4ES3A 2PSZA 1LW0B 4OI2A 3BDEA 5B0GA 1MWYA 4IFVB 2DRDA 4F2SA 3CJRA 4DUZJ 1HMVA 2YNIB 4P7VA 4YUDA 2QA1A 4KV8B 2RUGA 3M32A 4NCGB 2ZC4A 4DDFA 3FK4A 4MKBA 1XTZA 2C1EB 2LQJA 1SC3B 3B8HA 4R0EA 1BE4A 1XK8A 4PXEA 5A6PA 4ZLNA 3PR5B 4G1QB 3IFEA 1MWZA 2OPPB 1FK9B 2HNZA 1KTVA 1RT5A 3PIPQ 1G7CB 2FGOA 2DNRA 4CQ1A 4EGLA 4AXJA 5I3PA 3D6FB 2KT2A 3MFIA 2M52A 1TL7B 1RWXB 4U7UD 3P96A 4I6WA 5LSLA 5A8KB 3N9UC 1FXDA 2UVUA 5J1EA 3RB4A 4ILMA 4WYWA 3QLHA 1JJ2R 2RHSB 3PKMA 1PO6A 5ITHA 2WOMA 4F3QA 3FQLA 2HGMA 3NCPA 1O8BA 3B4MA 3OLBA 4IRCA 2E5LJ 3I6PA 5I3UA 2IYIA 2CDQA 1U2RA 1RDRA 2EK1A 4IYQA 3D0IE 2RQKA 5JMNA 2YNGA 4HHUA 1M5PC 1FRHA 3ZZTA 3I0RB 4DPTA 4OI0A 4NXMJ 4IH6A 1FX4A 2QEXS 1WKKA 2OFHX 2MZJA 2X51A 5E5NA 1YDLA 1LWEA 4F67A 2EXUA 2YXLA 1I6JA 1FJEB 1PAEX 3DI6B 2DGQA 1CJTA 4UOHA 2J9DA 1KRPA 1NDPA 3QWPA 3I4PA 3H7HB 2XMVA 4IDKA 4DUYF 5DDRC 5B7WA 2B6AA 4QWBA 1VQ5S 2AJQA 4JYAJ 1FRIA 3KLEB 2H5IB 4PWDA 2NXEA 4C0BA 4YN3B 4OZNA 1U1MA 2L9WA 3C2PA 5CAAA 4DQIA 3RAXA 2JC1A 2O3DA 1T3OA 4NXNJ 2MKIA 2RNEA 2QYCA 1RACB 1XBWA 3MMCB 1F60B 2VPZB 4QR2A 4Y2CA 3V6DA 1N5QA 3Q2TC 1G6BA 2R7OA 3VAGA 5FDLB 2P9EA 3HZEA 4FF1A 5SUHA 2VPYB 5KFUA 2WSCC 3M8SA 2JRSA 3DGPA 2VBWA 2BW7A 3I32A 4KR0B 1RXOB 3KLFB 5L1KA 1CJKB 1IUJA 2HFSA 3FSXA 4B3MJ 3H4BA 3M7VA 4LIRA 1VBXA 3SBMA 4LR8A 1KTQA 2ADCA 5D0GA 2YWFA 4YB5A 2XHWA 1KONA 3PO4A 2E5LF 2VFVA 4HI2A 5DQIA 1W26A 4RX6A 4FXWA 5LMNJ 3MCOA 5JVHQ 3A8EA 4RNHA 3V81B 2DEIA 4LT6A 3SCIE 4ZJQA 4PYAA 1Y5NB 4NXMF 3CJ8A 2RF2A 2CQ2A 1C0TB 1NK7A 3OVBA 4ED1A 4PUOB 4NMLA 1RT2A 1U2FA 1D1UA 4CM2A 3T3FA 1V5IB 1D3WA 2WVCA 2ZZNA 3KK2B 2YKMB 2IC3B 2ZJRQ 2XYHB 1RAIB 3PFOA 1BMQB 1UEUA 4NA1A 1O5JA 1RTZA 1XC9A 1HWLA 3JYTA 1N32F 3CCES 2UUTA 4NI2B 3JSRA 2XMAA 4FDFA 3HD1A 1CULA 4F0MA 1J5OA 2RRNA 1WC3A 4J91A 2VQFJ 4B3SF 3V4IA 5AJ3F 1NAQA 3U1MA 3K8VA 5D6GA 4LF8F 5E3PA 4P72A 2CG8A 3OVAA 1SJQA 3ZNJ1 3NGSA 2QYGA 3SCKE 4RW7B 5D0EA 3VV2B 4RWWA 3CMQA 4ZVTB 2C2DA 4P52A 3QAUA 4HHHA 3ZTOA 2BUNA 2BR0A 5J2QA 3AH6A 5DQHA 3K57A 5EGYA 4DR7J 1IKWB 1NDKA 5CYQA 1T9YA 2JL9A 2VOPA 2NREA 3G2XA 4CNZA 1RKJA 3SSRA 5C42B 1VHIA 1NPKA 4LQ9A 5F8GA 3AODA 1WI8A 3M6VA 4WIQA 2LVWA 2E1RA 3CCRS 1JWWA 2DHSA 1SV5A 2HHWA 3U1LA 4B3MF 6FDRA 3CTRA 3K7RA 3BGOP 2GMLA 3IBFB 3NWRA 4DX6A 5EWFA 3W8GA 2WAQD 4MJKA 1RT1B 2LQ5A 2G13A 4AFFA 4IH7A 4ZVSB 3I4HX 5HROA 3ITHA 1HBMA 2YY3A 4UW2A 1HQEA 4W92B 4U7UK 4DSEA 1GH8A 2F4FA 4C3MA 1GXTA 2YTCA 4DX5A 4Z7CA 3C15B 3LQVA 4UUXA 4DQRA 3K59A 3KNAA 2B4VA 1ZYQA 3OL9A 3TX0A 5B0AA 4DL5A 2LEPA 2APOA 1KVJA 1QE1A 4W98A 1LK7A 3M6WA 2C2ZB 2B4UA 2RS2A 1FTCA 1S6PA 5IQQA 4RO0A 1TZ0A 1S9FA 3CCZA 3SFGA 3DOMB 4B3RJ 5DGBA 2GVZB 2D7SA 2Y9HA 3DC2A 3K17A 3W63A 4AL5A 3BQ2A 3ENAA 2M0GB 2GMHA 1Q8BA 3K89A 1ZAWA 1F2GA 1B7YB 2R2SA 1Q7YT 3L3CA 2WK4A 2L41A 2E1AA 3CT9A 2BRKA 4TU9A 7AT1B 1YJ7A 3RAQA 4U7CA 1NK6A 4M5DB 4ZP9A 3D1HA 4M5IA 1CG2A 3R5DA 4CRJA 2MJUA 2GV1A 3D0GE 1P9YA 4H4MA 2D9OA 1UVMA 3R9LA 4IG3B 3VGSA 4DR7F 4PG8A 1JB0C 3A8KA 3AA9A 1LW0A 2ZUAA 4Y6IA 1JK9B 2VKZG 2OD4A 1REVB 2V2KA 4E8UA 5AE1A 4IFVA 1L3TA 2YNIA 2ZH8A 2JSXA 4KGKA 4KV8A 5ETRA 4DPXA 4X4QA 3TUPA 3CMES 4NCGA 3CNQP 3QJLA 4YR0A 3HHDA 4DMZA 2XI2A 5E7OB 1HR0J 2GGPA 4DCPB 4BC7A 2DYAA 1WORA 2XM3A 4GC7A 4G1QA 4KAIA 2MZQA 3H98A 5F41A 2OPPA 1JLEB 1FK9A 2AJ0A 4CO3A 3Q22A 1DJ0A 3LGNA 3SFUA 3HMJG 2R9LA 1LEOA 3CGIA 4HDHA 4FKXA 2J9CA 2WW8A 4ZCLA 4HL9A 2OTJS 4F7VA 3KG1A 2FHOB 2CQ3A 5KFWA 1HQUB 4RUHA 4FS2A 1H7XA 1TL7A 3FVYA 1P9QC 5GAHU 4X65J 3FEYB 2B3TB 5A8KA 1R8AA 3KXDA 2YQ0A 3TAQA 1HI0P 4L73A 2XS5A 3J7Z5 3LUYA 2IVMA 2A2CA 1NHVA 2C3OA 1N34J 3KHRA 1BWEA 3MOZA 2HVZA 3RB6A 2OHDA 4CP5A 1MLAA 2KKHA 4F3OA 2X1AA 5ETNA 3VAFA 2LDYA 2HVDA 1WTBA 1RLCL 3JAMY 1S1TB 4EBEA 2BOPA 4DZ6A 4KB7A 3PR4A 1DBDA 3DM2B 4WFZA 4J9PA 5A0YB 2CQHA 4LF2A 2DH9A 3I0RA 1ZZNA 3O6QA 2VG7B 2OPRB 4ZVRB 4M95A 3GWCA 4ZS6A 1T9WA 2AJ2A 3QRRA 5L9XA 3DI6A 2Z2MA 1OY8A 4JI3F 4RNOA 1V9OA 4CWBA 1LV5A 1WC5A 5G0RB 3RJMB 4UUWA 5F8HA 3Q86A 2WW4A 3FKBA 4K0KF 2XEXA 1UTAA 3OTDA 5GVQA 1HR0F 3JQJA 2IRUA 1Q78A 3U02A 3NGUA 2C3UA 2EFPA 4FPRA 3PO5A 1SKWA 3KLEA 3TI0A 4CIOA 4ZJLA 4JI5J 3GE9A 1N4LA 2DXFA 1TK5A 4L74A 1IWGA 5K9FA 1JLAB 4Q2MA 3A8IA 3CD6S 4Q45A 2H4YB 1DHMA 3ISNC 3NAHA 3M05A 3MMCA 1N48A 2E7VA 2MMYA 4X4SA 4RLEA 2F5GA 2XTJP 5KG5A 5FDLA 1KDNA 1C4AA 2I38A 3QFWA 4P2FA 1RWUA 1K47A 3KLFA 3NAIA 1CJKA 3I55S 4PQUB 2IRXA 1N34F 3PHEA 1R3NA 4LBIA 4LFCF 3D3BJ 2V94A 2NPIA 2GA7A 5MLCV 3HHLB 2V4RA 4NA2A 2D3ZA 3S6EA 3KK1B 4X64J 1RWMB 4LFAJ 1S57A 2R7WA 3MECA 5KFBA 3FBCA 1TUWA 3TJAA 3OXGA 5EX3A 2CPJA 2BE9B 1VR6A 4A48A 3ENWA 3QSIA 3KHGA 3V81A 1YJ9S 3RR8A 3JB9k 1CVJA 1SL0A 1PGZA 2CG4A 2YWWA 3TNVA 4AQYJ 1C0TA 2FHMA 3EICA 2LP4A 4N8NA 4PUOA 4IUFA 1VBKA 4ZN3A 2G9OA 2HQ3A 1KQSR 5FIIA 1RJJA 1JLBB 3KK2A 3HF5A 4X4TA 1VIOA 2YKMA 3K5OA 5GAHI 2N4DA 3O44A 4FYXB 3AJ2A 1X5SA 3T9ZA 4TQRA 2H5EA 2QIFA 3MCNA 4NLTA 4NI2A 2PMWA 3OLAA 2ZD1B 3M9NB 4F0KA 1RE1B 3ULHA 1YK9A 3OD2A 2M3DA 4IRKA 1IVZA 1GQEA 4DU7A 2MKCA 1AB8A 3MR6A 4F4WA 1WKJA 2PC6A 3CDUA 4CLPA 2EPIA 1NKBA 2ABYA 3B82A 2XMWA 3W2VA 1W2BR 3KG4A 3KLGB 4EO8A 1OY9A 3EZUA 1FD8A 3HHNB 3D1QA 1H2UX 4AT1B 2Q43A 1NNDA 2AKWB 5B09A 4IRDA 4L3KA 3VALA 2YKAA 4ETZA 5H9FK 1IKWA 2MZRA 3SYZA 1PBAA 1IM4A 5F0WA 3QYYA 4ZVGA 5C42A 3IBWA 2W4PA 4I69A 4MYUA 1WDDA 5HVFA 3DU6A 3UPFA 1HNXJ 4ZOSA 4PRFA 3MD3A 4PPDA 4KT0C 1M5KC 3ETMA 2QC3A 1XNQJ 1RT1A 3I31A 1E6VB 4YEAA 4LFAF 1MN7A 3IAM9 4Z37A 1YVFA 5K8OA 4ILRA 2F1FA 3IGNA 2Z8QA 2HHPA 4JI6J 1VGYA 3C15A 3MR7A 3EJMA 2B0GA 1X4GA 1S0VA 4F4XA 2HHXA 1UVLA 1U4BA 2MLYA 4ZIVA 3PZPA 4HEA9 4PQAA 4QZVB 4HVZA 2DR9A 2NZCA 3QRQA 1HIYA 1JXVA 5L39A 4TKTA 3R5AA 4E2FB 1U2CA 3DOMA 2GVZA 4ER8A 2AV5A 4FYVB 2MGZB 1FKPB 2HAIA 3EMTA 4O0NA 2EBGA 5IXUA 1S48A 4LRFA 3MR5A 2CNOB 3DLHA 1R43A 1RAHB 3FNNA 4B3OB 2EKYA 1DLOB 1XMQJ 2CJBA 4DV2J 2KG1A 2QO3A 3HT0A 2ASDA 2MSTA 1AFJA 4M5DA 1NM2A 2KHDA 1UETA 4YDDB 3KLVA 1U1OA 4OYAA 2GHPA 4F4KA 1WG4A 4IG3A 3T19A 3CD7A 1UW4A 4EBCA 3TUIC 5CHCB 3BGUA 1PIEA 2DO0A 4GKJJ 4JI8F 2ZH3A 1M5VC 1HD1A 1WELA 1REVA 1RK8A 1N36J 4DLEA 2R7VA 3DDKA 4DPUA 4DL3A 4DN0A 4ZPCA 1U1QA 4NLXA 2PEHA 3EVWA 2JVRA 5DM7Q 1B0VA 2OH2A 2LYVA 4DUTA 4LFBJ 2MKHA 3DRPB 2HBQB 1XNQF 3POTB 1Q95G 5LSOA 2DRAA 2R8IA 4WP9A 3C16B 1JLEA 3DHWC 4FF2A 1EKSA 3LP0B 2DVIA 3MAHA 2HHHJ 2J6SA 2J7WA 2IJNA 2CJQA 3SV3A 2QLWA 3SCJE 1HLWA 3G6ES 4KY3A 3M2UB 1VIXA 1FDDA 4N76A 3HM9A 2VBZA 4LF5J 1FFGB 1NH8A 3VAJA 3TZWA 3RUBL 3F73A 3HZGA 1MNEA 3QAEA 4K4SA 3PY8A 4NL5A 1HQUA 4OFZA 1ZZFA 4OLPA 2DHGA 4OX7A 1LNQA 1FVSA 4A8FA 3W65A 3WZ0A 3M4XA 3AD9C 1XEZA 5HVGA 2UU9J 2V8PA 2GAGC 2IBKA 3MM5B 2DNLA 3OQ2A 3H90A 3Q0AA 1WC1A 1XMQF 1IN0A 4IOAQ 2G0JA 4JP8A 3SXLA 5KFNA 1FDNA 1S1TA 3CE8A 1PG5B 3DM2A 5A0YA 4GC6A 4DEZA 4WFAQ 1VRQC 1FRMA 2BKPA 2U2FA 3AQOA 4FBUA 2VG7A 4B9VA 2OPRA 3T6JA 1IKYB 2EFVA 4LVOP 1N36F 4FN5A 4DCOB 1X4FA 1HD0A 3H2VE 4JI0J 1X4BA 5ETVA 4DR3J 4ZPBA 2J8SA 2QLBB 1SQFA 2DNQA 2V68A 3CULA 2FQQB 5G0RA 5HMZA 2A2DA 4DR5J 4YOEA 2BJ1A 1FXRA 1TP7A 4TN2A 1NJZA 2DHHA 2JFDA 5CQGA 3I0SB 5K20B 1F3VA 1QUVA 4DV1F 3B6BA 3GYNA 2G0CA 2QZ8A 3P4UB 3VAMA 3X3UA 5F3TA 2HHHF 2K3IA 3RTVA 4YB6A 1NLKL 3OL7A 4MMOA 4JV0A 4C8OA 4IR1A 4MTPA 7FD1A 1JLAA 4NRTA 2K3KA 5KG3A 3TYTA 3Q8PB 4LF5F 1UZHA 4MK8A 2BVZA 1BD6A 3NOGA 5B0FA 1T02A 4C6AA 4B3TF 1EQMA 3I5BA 1HNIA 2CPFA 3IR5B 2ZHAA 1DY3A 2CNKB 3T6BA 1IBKF 3AOAA 1S0OA 4LF9J 4OYBA 4K4TA 1SJRA 2ZH9A 3FBBA 3SQGB 4PQUA 3ENVA 2UU9F 4MFBB 1YJTA 1GNKA 3F0NA 2XS7A 2BEFA 3HHLA 1SJ1A 4O3QA 4M1KA 2QA4S 2F3JA 1FWPA 3E01B 1CLFA 1NK5A 2FZCB 2DT9A 4EYHB 4LJMA 1FT8A 4ETXA 4ECVA 4RBTA 3GV8B 1EQ0A 3O2IA 4O3SA 2W9BB 1PSDA 2IVYA 2D1CA 3UFCX 1FWLA 4DSKA 4HTJA 4USUA 2Z57B 4AL6A 1EIYB 1E6YB 5KG6A 3H0PA 4DV3F 3QGHA 2OMLA 1JLBA 4DR3F 5LL6d 4CH7A 1GMUA 2V9WA 3NXZA 2I1RA 3K5NA 2VD3A 1BGXT 5KFHA 2KXFA 2LXFA 2ZD1A 5D8HB 2VA2A 4NA3A 5HO4A 1KKHA 3BKTA 3MD1A 2QA4G 3T5HA 1VQ9S 1YGYA 3GIMA 1H72C 3GIJA 1CJVB 3V6HA 3HHKA 1UCNA 3CJ5A 4CH1A 4DV7J 2V8GA 3TQEA 2X3GA 2XO7A 4P7TA 2X1GA 1YJWS 2ACYA 3KLGA 3DLGB 4I6AA 1SB6A 4WPAA 3R3TA 2V6AA 1XR7A 2H54B 3Q8QB 4N41A 1ZBTA 4A47A 4DX8H 3OTOF 2VU5A 3ZC4A 5DDPC 4ZA1A 2DNGA 1QTNB 3LO3A 2VICA 1U09A 1OSDA 5F9NA 2XO6A 2BKOA 3GJTB 2EC2A 4XPEA 2KRBA 3TO8A 4OV1A 3CCWA 3LH2S 4XDCA 3QZ7A 3UNGC 2W2MP 3BQ0A 3GSIA 4HH0A 5L46A 3BBCA 5HLFB 2M70A 3QT5A 1GXUA 2MEWA 2QA2A 2PMZD 1E6VA 2AX1A 3M9MB 2D3O1 5J1NA 2EVZA 2ZBIA 5EUHA 3C3LA 3I5AA 4ED8A 2N3LA 4HT5A 5DJBA 2KYXA 3QZ8A 2MQPA 1BY9A 3GFYA 2GW8A 2DR6A 5SZTA 4X62F 4K5RA 3EPGA 3MPUB 1OIAA 4H4KA 2J6TA 1FEHA 2YWEA 3PFEA 4YP3A 1I3OB 3X1LB 2KZMA 1FRKA 3MAQA 3GQCA 4UZBA 4J9LA 2V67A 3F44A 4U67Q 3A3OB 2M9KA 3T5KA 4L3NA 3A12A 1QD1A 2RDIA 2MGZA 1FKPA 4XTTA 5C24B 3W2WB 4RUAA 3RZAA 4P74A 1SCJB 4ED0A 2ZFHA 2QL7B 4WK3A 4JI7J 4ELUA 1X7VA 1JLGB 3M6XA 1DLOA 3TAPA 4MH8A 1RA6A 4DV7F 2Y1IA 1MMDA 1C1CB 2J0QD 1Y5LB 4J9UE 4RW6B 2JLEA 5DG8A 4ECYA 3RR7A 3T1HJ 1U1NA 1R6YA 4DV4J 1X9MA 1FA0A 1UP1A 2IM0A 4OJ3A 2RRBA 3AFGA 4MAKA 2G2YA 2OEMA 2K1RB 4WP8A 2OTLS 4Z7YA 4Z2XA 4ECQA 1VK8A 2Y1RI 3MTKA 2VDHA 4ZMMA 2ZOGA 5BR8F 3CCVS 2IJFA 2DRBA 4J7CA 2HS0A 3R5GA 2CQIA 3D9BA 3TVZA 3DOLB 1N54B 1KR4A 4KE5A 2XI3A 1YQHA 3POTA 3BSNA 3OR2B 4IQXA 1PBUA 5KFEA 3Q89A 3C16A 4LVNP 1U1LA 3PJWA 1EETB 2BJDA 3LP0A 1K1QA 3DLEA 2E29A 1PCAA 4DV5F 2DIUA 2GX8A 3M2UA 3KDNA 4PABA 3JQMA 2MY7A 2CZ9A 2IM2A 3N28A 3CCQS 5D4PA 3UVJB 2A0FB 4OZ3A 1FF2A 1N6QB 4PXBA 2BZ2A 2UP1A 3ZO7A 3MUVP 2R7UA 1UJ6A 3UW1A 2C3MA 4FP9A 2IM1A 2OEJA 3W8PA 4KPCA 4UT4A 4XO0A 3PW4A 3GYXB 2AEMA 4NOHA 1SXLA 3MM8B 4P2MA 4PR6A 2P8IA 4TQSA 1VK3A 4CLLA 1R89A 2YQ1A 1WD6A 1YZ7A 5LT5A 4NEZA 2MQNA 4FYDA 3AA8A 3FGVA 5IM0B 5D4LA 3WC2A 3H2UB 2XMJA 3MM5A 1GT8A 4JI7F 4YHHJ 3D6MB 3TARA 2XBPA 5L9NA 5HP1B 4QIWD 3M8YA 4NZ0A 1ZOTA 3G6XA 2HRUA 3LTOA 1QJHA 2CIMA 4DV4F 3IXQA 4KFBB 3IRWP 1IKYA 2YX4A 1UMJA 3C6TB 2VFUA 5MAOA 1KHWA 1Z2LA 3D1OA 2PT0A 1SUQB 4KGZB 3RBZA 1N5TA 2QL5B 4C48A 1T95A 3THPA 4X4OA 1UPPA 1TK8A 1DQAA 4ECTA 3UR3C 2WBRA 2ATLA 3J7YU 1RTHB 1WEXA 3I0SA 2RKIB 4OZ2A 1CQMA 3ENQA 1OQ6A 3IR7B 2DKOB 3C19A 2KT3A 1HI1A 4IH5A 3W1YC 1SBRA 3MM9B 2XGPA 5A8WB 1OJ4A 1V3ZA 2HRYA 3M1VB 3ILJA 4NMXA 4KHPF 3AOCA 4NLSA 4WJBA 2YX1A 1URRA 2FHJA 5KFDA 2H3EB 2B9WA 2R2UA 2AU0A 2GJIA 3OJUA 2IIHA 2KL8A 3CC4S 3A4TA 3Q8VA 2E1MC 2OPQB 2Q79A 2ZVSA 4Q7AA 3TEGA 3OUYB 1F3FA 3DOKB 1OPZA 1XR5A 3HVAA 1RTIB 4RNNA 1OS5A 3SQGA 4DV0J 3MPVA 3T1YJ 4MFBA 1ZA1B 1F9EB 4DL4A 2NZ4A 1MW7A 1FD2A 2E7XA 2LQ9A 3R7BB 1TKTB 2ZBPA 3FZBA 4CO5A 3LPYA 1Z1ZA 2JDJA 3O5TB 3E01A 1Z4UA 2B9YA 2HHQA 4WTOB 1TU0B 1K9MT 2HFOA 2IYGA 1U1PA 5HVHA 1KNZA 4JB8B 1FDBA 2V8VA 2F4VF 1RHKB 1ZTTA 4KH1B 4ZPDA 3IGVA 3VAIA 3CD0A 1WTFA 3I5CA 2W9BA 2CADA 5JVGQ 3MUTP 4F4YA 2QX0A 1U48A 3NMAA 1X4EA 4J9VA 1YRTA 1E6YA 4DF4A 1D09B 1CJUB 1YJUA 1JNRB 5B0BA 3DRYA 2R8KA 2DTJA 3QGIA 2KB2A 4P71A 3EXYA 2QSWA 2BM1A 4BWJA 1N0VC 2FJWA 3FBFA 2YH0A 3UQSA 1SQEA 3LF0A 2C42A 3GFHA 4Y2MA 4ZCKA 2OLWA 3QWUA 1CJVA 4C3LA 2CQPA 2EK6A 5CD4A 3BH7B 2OUGA 2Y1LB 3PIOQ 1O51A 2ASYA 3NP5A 2VASA 4ECSA 3DLGA 2DR5A 3FMWA 4DPYA 4Q5VA 3OR1B 2Z2YB 2P5VA 4PPZA 1FJCA 4G1IA 5F8JA 5H9EK 5BJRA 2YH1A 3CCJS 4G3IA 1NH7A 3BR8A 1X8DA 4KGXB 3HX9A 3Q8RB 5ADZA 3EE3A 4PWWA 3EGWB 4KYZA 1X4AA 2IJRA 2LCWA 4DI6A 4AXIA 3T41A 4CO1A 3CJ3A 3KJFB 4I2QB 1VC0A 1ZA2B 3GONA 4OX9J 1S49A 2ZWPA 3CCTA 1RBLA 2FYXA 3N6NA 2AT1B 3KHLA 3SEOA 1SPBP 4DV0F 3LWMA 3GMGA 2XC9A 1U8SA 3PW5A 2YBVA 3JXOA 5HLFA 1S4EA 1RT3B 1VI7A 3J7YI 1SIZA 3KFWX 4USWA 2P6TA 3B78A 3K5PA 3RU0A 5IOLA 2LQ8A 4ED7A 1KSPA 2O66A 3RW6A 2CJXB 4P2XA 3AB4B 1UEVA 1NJIT 4J37A 2DGXA 2B5JB 3CJ0A 2MHEA 2BJ9A 1SL1A 3OW2R 4ZKAA 2PFDA 4GO7X 4DF8A 3MURP 2MJNA 2W2OP 2RDDA 4X4UA 4O3NA 3QT6A 4DV6J 4CI0B 2J76E 3SSSA 3MXHP 1C0UB 2V69A 3S01A 2UUBJ 1GMWA 1FE4A 2MDAA 4B9TA 1BLUA 3SZ2A 5C24A 3W2WA 4ZN1A 1VCTA 3GJRB 1RHJB 2NXNA 1IBLF 2WSFC 1JLGA 3P6YC 2YNFB 2B43A 1UWAA 1C1CA 1KLNA 2NCKL 5T7LB 4RW6A 3M8QB 1WKLA 3NNHA 1NK0A 2WB1D 3N4WA 4EWTA 5DS7A 3V2UC 3FBEA 5A8RB 3UWTA 2ZH7A 5D3GB 2KI2A 2MXYA 1Y00A 3A13A 2CJKA 3PYGA 1RAAB 2E9RX 4JUZA 3B54A 4USJC 1M0SA 1N52B 5C7PA 2K1RA 2HZVA 3FRYA 4OHXA 3HHLD 5EX0A 3BSAA 1BHNA 4DSLA 4TU8A 1VQ4S 2FJXA 2XMKA 1FFSB 4QIGA 4WKRA 3DOLA 1WOPA 3LA0A 4UQTA 1LFPA 1W2IA 3CDWA 2OIHA 3OR2A 4USHA 4WFNQ 1WF2A 3TA2A 1ACMB 3KG0A 1EETA 1UWBB 1NUEA 1L5UA 1U47A 1IXKA 2FGCA 1VC6A 2ZBCA 2R7TA 1L3UA 1T9TA 2F63A 1XR6A 4ECUA 3IO1A 2PI4A 1YSJA 5GMDA 4YMEA 1FTRA 1PC4A 5KFKA 3GSDA 1N6QA 3CJ4A 3DLKB 2V2QA 5ETQA 3H20A 3HFKA 4TY9A 2UV8A 4YFUA 4DV6F 1VQLS 1PYSB 5D0RA 5GADU 5K8MA 2IPOB 1X9WA 2BMBA 2HGLA 3GP9A 1YRXA 3WDOA 4JBCA 3MM8A 1PJ6A 1JLCB 2J7KA 3RRGA 4JV2A 3UN2A 3NGKA 2AW0A 4RNMA 1KFSA 4KGVB 1AFIA 2UVRA 4JI4J 5IM0A 2ZBQA 4N5SA 4NLOA 1KOHA 3DFEA 4FYYB 4CT8A 1UA1A 4CT9A 3IBCB 2E1PA 1S6UA 5GAEU 1SVDA 3IMQJ 4CZCA 1U26A 5A76A 5HP1A 1YBTA 2NYIA 2LQBA 4DQQA 3SSQA 2ZH5A 4KKOB 2MQMA 4LF7J 1WF0A 3UO0A 1J5EF 5LMUF 1H2VZ 1X4DA 1KLMB 3TUZC 3E2EA 3GIRA 3O8WA 2ROEA 3CCLS 1T9XA 4MIBA 2K8GA 4BS2A 5HANA 2DCLA 3C8YA 1U24A 3GG0A 2Q6CA 1ZPWX 1U6FA 2J8AA 4OYIA 4KFBA 4HT7A 5KFAA 5HI7A 3C6TA 3TUJC 1MMNA 1DARA 5LJ5Y 2BBEA 2KVQE 2OPSB 2XB2D 5CZVA 1EP4B 1SUQA 3U7JA 5DG9A 3AXKA 2JEGA 1L3KA 3FCWA 2J5AA 2DR8A 5HAOA 2P9GA 3S1TA 5F8NA 2IRYA 3FFIB 4QQBA 1RTHA 4LF6J 4QPTA 2RKIA 5IC4B 2K7JA 3HSDA 2YWGA 4DR4F 3JSYA 2NLWA 2EBEA 2KYZA 3TP2A 2POKA 3LAKA 4R25A 3MM9A 1WNEA 4F4AA 5A8WA 1AUSL 4XAKA 4R5PB 3M1VA 2R7XA 3UD3P 2DJWA 3UCUP 2VBXA 2E66A 3D4JA 3IG1B 1UPMB 2DR7A 4QIEA 3KNGA 3AAWB 3NY0A 3TZYA 4PKDB 2OPQA 1SH0A 2YKPA 3W64A 3OUYA 3DOKA 2AYGA 2LU2A 3BF4A 4A4JA 2UVVA 3HKZD 4FNHA 1RTIA 4M5JA 1EARA 3TEHB 4UTGA 1JNZB 2DNYA 1GTEA 5E3QA 4C3KA 2DEJA 2AJFE 1IR1A 1URNA 4JI4F 5KG1A 1PILA 1LOUA 2R8GA 1TK0A 1UKUA 1R27B 3VTIA 5DZ6A 2W4DA 2XULA 1UVKA 2RD5C 1TKTA 3R7SB 3OT9A 4KSEB 4C97A 4ZVPB 4HHJA 4P6QA 5DG7A 4QW9A 2L3MA 2P9CA 1LKZA 3TJ8A 2YVSA 1YHQS 4LF7F 2IDEA 2HWTA 5KG0A 1ZAXA 5HJYA 3GV5B 5J2MB 2FLOA 4A8SA 3M30B 3G6VA 4AUKA 1X0PA 1JMTA 4DR2J 1ULRA 1P6TA 2UVWA 5U47A 5GADI 2DHXA 1IBCB 1CJUA 1S1UA 2DGWA 4ES2A 2HWHA 4BC9A 3GYGA 4RW8B 3ZZUA 3O3LA 5CD4H 4EMDA 1Q0NA 3GLJA 1VQSA 1RWKB 2ZM6J 5DDQC 3MDFA 1NSPA 3K0JA 2Z30B 5D77A 5EDWA 1NSQA 1WEZA 1VYAA 3TVYA 4CM0A 4F04B 1NHKL 5DLFA 4DUZF 4GVBB 2G2OA 1WWHA 4QWEA 3CCSS 3TVKA 4OJHA 3PW0A 4UQGA 4C2MA 4ZLJA 5GAEI 3GFZA 1M1HA 5LSRA 4DR1J 4N47A 4F8RA 1S7IA 3RB0A 4A8YA 1IKVB 4IOCQ 4K8RA 2CNNB 4CLWA 3GZ7A 1WSVA 2EG1A 3NS5A 3OR1A 3D2WA 4OI1A 2R2RA 2RS8A 1C1BB 3I9V9 2DIVA 1WG5A 3PX4A 3IAS9 2RU3A 3PXGa 2PI5A 4OYMA 2IHR1 4OIXA 3BBBA 1BUXA 4OX6A 2CPZA 4I2QA 4L72B 3H40A 4OJGA 1J27A 2R8HA 4Q8EA 4QU6A 4PG6A 3N79A 3A3NB 4JI2J 4F0HA 1RT3A 1HQ2A 1P8GA 2RSQA 4LF4J 1FEEA 4I56A 3CO0P 3DU5A 3ILIA 2AYMA 2XNQA 5D4OA 2HWIA 4QIVA 3SMZA 3HSZA 3US5A 1ELOA 2CDRB 2B5JA 1H0HB 1FE0A 5KFTA 1T3NA 2CFXA 3EDRB 4RKUC 1SQGA 2NS1B 4EZ9A 2YX7A 1S7HA 2COLA 3H5XA 4QYZK 3D67A 1HBUB 2CQCA 1C0UA 2B4OA 4ECZA 3W60A 1QAIA 2LU1A 4GMKA 2VODA 3CCUS 1RU2A 2I6WA 1APSA 3M8WA 4HH1A 3HJVA 1P1TA 1B70B 4WE1B 2ZM6F 1H7WA 1Y0HA 1DQ9A 3MMJA 2JLGA 4MKYA 3DYAB 1BQNB 3TOQA 1RP5A 3OVSA 2C2NA 3TANA 2FHJD 2YNFA 1A0OB 3MPYA 4LRDA 5T7LA 2X1BA 2I5JB 4ZK7M 2AGPA 3EWGA 3M8QA 3BH6B 3IM9A 2DNHA 3NRBA 3N01A 1IR2A 2GMJA 5A8RA 3MTJA 2HLTA 4JYAF 5D3GA 4USIA 1FRLA 4DSIA 2BJ8A 1F0XA 4ZIWA 5AXLA 4NXNF 1HPZB 2VG5B 3KJVB 2NSBA 1RI7A 4TLQA 3NL0A 2LMIA 2XZDB 3AB2B 1RBOB 3OTCA 4JI2F 1RTDB 4DS4A 1TMJA 1LXNA 2RU9A 1HWKA 1RHRB 3SI8A 3U27A 2ZNZA 4J9SA 4MK7A 2WONB 3QSYB 5KFVA 3VQTA 2VH7A 1UWBA 4Q44A 1EHWA 2VA3A 1MSWD 3NG8A 4QR0A 1JXLA 5E33A 4ERDA 1Z2ZA 1NZ8A 2UUCJ 1MG7A 2RHQB 2VPWB 3QT7A 2YNHB 1R0CB 5KFMA 2HFVA 2VBYA 2ZEJA 2HW3A 2HEKA 2NR0A 3D66A 1VHFA 5LMNF 3C6UB 4XDDA 3CW2C 1FKOB 2V5HG 2KDOA 1ZAVA 3MCSA 1X9SA 4CDIA 3P5BP 2ZH1A 1JLCA 1SKUB 3WIVA 1UL3A 4QIFA 1U0HB 5DRKA 4K4UA 6AT1B 3LGMA 1S9EB 3DLLQ 3CSKA 2GHVC 3HKWA 4O44B 2DPJA 4M5NA 2C2EA 1IBMJ 5IQ6A 2JOQA 5J1EB 4P75A 5CZXA 2UXDJ 3L4BC 3NOCA 1AZSB 2WVBA 4KKOA 4L6V3 1WC0A 2ASJA 4PAAA 4X84A 4E0DA 1GK8A 4HDGA 2ZNYA 1T94A 1VISA 1KLMA 4J5OA 4IOBA 2MKJA 3MCMA 2MZ1A 3HHEA 2VQFF 2JEJA 1MN9A 4W4MA 3VGUA 4ANCA 3PACA 1ZH5A 4NEYA 3EVMA 1TTHB 1KVIA 3MPDA 4LMZA 1QAYA 4FVCA 3AXMA 2HS4A 2MLXA 4ED6A 1S0NA 1Q7LB 2OO4A 3ET6B 2M8HA 4RW9B 4U95A 4P10A 2HLUA 2OPSA 1S72S 1EP4A 3TJ9A 5LM7E 3DLBA 5K14B 1T9VA 2AGQA 4K4WA 2F40A 3J7ZT 3DRSB 4CLFA 1Q4RA 3FFIA 1M5OC 2GO9A 3HPOA 3L09A 4K7QA 1DQ8A 3KHHA 3EGZA 2DXEA 1SC4B 3C66A 3QMQA 3RRHA 4DQSA 2QLJB 3G86A 2Q6BA 4IDKB 4R5PA 4RR5A 3PVXA 4OI3A 5KT2A 2ZOFA 2UUCF 1GMWD 4QJVA 1T0TV 1BQXA 1TELA 3IG1A 1HKAA 4GO5X 2VUGA 1UVNA 3AJ1A 1QAXA 1KEKA 3QO9B 1RBAA 1S6QB 2KT5A 4TXSA 1PYTA 4BLGA 2YWHA 4AYBD 1VJQA 3ZZ0A 1IJEB 3NWGA 2ZJQQ 5LOQA 2AD9A 5HQLA 2O5DA 2CJYB 3DN9A 1CQNA 3H59A 2JX2A 5IZHA 2ADBA 4FF3A 3PNIA 4B3RF 1MMLA 4RUBA 2UXDF 2F65A 3ELHA 1UFLA 3M2VB 2JFKA 4WFBQ 4X66J 2CVEA 3HVTB 2E5IA 1WOSA 4YS2A 5J2MA 1G1XA 4U6PA 3M30A 1U6ZA 3GU0A 2MYFA 2HG4A 2OEKA 5HMXA 1RADB 4G6VB 3J80Y 4GKKJ 4LSZB 3HFZB 2HVHA 3FSIA 1VQKS 2QFJA 2RJZA 4RW8A 3FSYA 1F6TA 2C2MB 2CPIA 4USVA 1CC8A 3L7OA 4DOZA 2RQCA 2KFNA 2FD2A 2H9ZA 2FJBB 3G8QA 4ZVFA 4B02A 3CD5A 5CCMA 2CAJA 4GVBA 4QWAA 1KOOA 1UEKA 4RU2A 1JLQB 4OZ5A 2UZAA 1C4CA 1RT6B 2BACA 3CEDA 1IKVA 4W90B 2FTRA 4CTAB 1PYOB 2Y8YA 1K44A 4YQWA 3E51A 3EXCX 5JJBA 1V6HA 1C1BA 2YKQA 3V6JA 1T05B 2V8HA 5H9FJ 4C8YA 2BDPA 4C9DA 2BJEA 2YPZA 1B3TA 3KYLA 2Z0GA 1CPZA 5DO2A 2R4FA 3KMSA 1X4CA 3R97A 4EZ6A 1S9GB 3OXLA 3VWSA 2GQCA 4FZVA 5KFFA 3WHIA 4RPFA 3J80U 5C5JA 3PCOB 3VVUA 3UD4P 1MU2B 3UR0A 1TMMA 2RILA 4I7FB 1YBUA 3PW7A 2L9NA 4X65F 2BXJA 5L1JA 5EWEA 3KK3B 3T9NA 3I56S 3PHTA 4DHVA 1HWUA 3WQPA 1UFKA 3LGHA 2DHAA 1WDTA 2LA4A 3MAAB 3MUMP 2Z58B 1T03B 4ZITA 1UVJA 2G2ZA 1ZM3A 2VFTA 2QG9B 5F9LA 2QSFA 5IT0A 4I0WA 1HBUA 1F9FA 1WC4A 3J81Y 2XGQA 1CEZA 1V5VA 5GAGU 5CYJA 2HVIA 2OMOA 4LF1A 3IR6B 2ZZTA 4WFXA 1NKCA 2ZE2B 4KQZA 4WE1A 4MIWA 3EPIA 5B0DA 2QTWA 4DXLA 2CJ9A 3DYAA 2BQRA 1BQNA 5F0UA 2NXCA 2DGVA 1TFYA 2HZAA 2IC3A 1QLNA 2XLJA 2GJ2A 1V3RA 2I5JA 5KFOA 2HHSA 4EI2A 4ZPVR 1YITS 1QUPA 4FNIA 1JX4A 3GG1A 1DTTB 2CPXA 4UOCA 1UVIA 1GAOA 3QATA 1AW0A 1H73A 2J0XA 4JI5F 2W01A 3Q8SB 4RW7A 5B0CA 3P8BB 3HHLC 3AOBA 4ZVQB 5F8IA 4LR9A 3CJTA 2CQ0A 4KTQA 1VRTB 3HXMA 2OSQA 1S0MA 3SV4A 1HPZA 1WHVA 2VG5A 1Q8IA 2ZJPQ 3KJVA 2VV5A 5AE3A 2IDLA 3FDSA 4OZ1A 1RTDA 1LWFB 3HSJA 2R42A 1WUUA 3J81U 4AL7A 2DNMA 1RU1A 1F5BA 3D0HE 3DRXA 3GR0A 4ED3A 2OD6A 3I9ZA 3H4DA 2WONA 4FBTA 2XWXA 2HVEA 2OGUA 1Y3JA 2EG2A 2PFFB 3TA0A 2LDIA 3CO9A 4Y2KA 3MPWA 2W8KA 2ZUGA 5LJ3Y 1TL5A 4DUYJ 3CB4A 3MEKA 2DNKA 3BO2A 2GGPB 3BPSP 1KD1T 1B0TA 2EC0A 2JJ4D 4KHMA 5HN0A 4X64F 4WZQA 2YNHA 5BXIA 1NKEA 5CXTA 1ITPA 4AD6A 3HO1A 2DNNA 4FF4A 3HVRA 1VRUB 3MFHA 3C6UA 3KUEA 1RWVB 1FKOA 1VBZA 2BV3A 4ICLB 1TUVA 3VVTA 4BCAA 1FO1A 1U0HA 1ZPVA 4AQYF 4F2RA 4IO9Q 1S9EA 4F25A 3OFGA 1A6LA 2C2KB 4BBYA 1QSSA 4O44A 4AE5A 5HBMB 2H48B 2KFYA 2FVQA 4OYWA 1ZM4A 2XSJB 2V2VA 1N5SA 4M94A 2VJUA 4DBQA 1UA0A 4M63A 5KFRA 1AZSA 2GVDB 3BS9A 3HT3A 2E9ZA 3OTBA 2ZDPA 1I94J 1N33J 2FVRA 2VDIA 2GS8A 1U02A 1DRZA 4Y00A 4ES1A 2FY1A 3RG6A 3MM6B 1HNVB 1RT7B 2W1BA 2ASLA 4DCJB 5T41A 4IFYB 1TUGB 3G6YA 2D3OR 2XG8A 1D0EA 1FRJA 4X2BA 3ET6A 2BE2B 5GAGI 4H4OB 4RW9A 3TQ1A 1ZM2A 1LFWA 1Y11A 5K14A 2JVOA 1WOOA 1SC1B 5J1PA 4O3OA 1MWQA 3DRSA 3WX8A 3TAMB 2Y0SD 3H25A 2HQIA 2WZ1A 2F9JA 4H4KC 1HNXF 3CPWR 4N77A 4ZPAA 3NCRA 3K8WA 4I6YA 4FS1A 1N32J 1TAUA 2L48A 5E0OA 3I96A 1DFDA 3CIMA 4B3SJ 2QJ3A 5AJ3J 1SJFA 3W5XA 4LF8J 5IWAJ 4PG4A 4RUCA 2J0SD 2VG6B 3L95X 2M4MA 4JI6F 3MZIA 1C2PA 3QO9A 4EEYA 1S6QA 4HTIA 1K73T 4NLWA 3FJ2A 3MR2A 1LXJA 5KFLA 2QMWA 5LXRA 3OSNA 4U96A 3A8JA 4ED5A 5IC6B 2OI2A 4ELVA 3LOUA 4NYZA 4DR6J 2G4BA 2QGFB 2IMWP 2Q66A 2PIIA 1YLXA 3DDIA 2W9CB 2J9DE 4IG0B 4C0HA 2MKSA 3Q23A 4OI6A 2DCUB 1JJ4A 3M2VA 1I94F 1N33F 5C25B 2EI5A 3HVTA 1LWXA 2R7RA 2BX6A 3KKFA 3AT1B 3QNWB 1FRXA 2EFQA 2NYHA 5KFPA 5IT4A 2HQDA 1TL3B 3MECB 4KPYA 4DV2F 5E3AA 5DGAA 2B7BB 4A8QA 2VB6A 2ZBRA 3NGDA 1QTMA 4NLGA 1TKZB 3PRDA 2IBOA 1AROP 2D74B 2E7WA 1NB7A 2J9EA 3ZZYA 5AXNA 3G82B 1Q5YA 4LSLB 3EGVA 1WC6A 4LQ3A 3W3SA 1OYEA 2KXNB 5F3ZA 4GKJF 4FXDA 1X60A 2W2PP 1D8ZA 3BZQA 2J0WA 4I1TA 3PKYA 4N8OA 3PM9A 4I4BA 1HARA 3M6UA 1H98A 2B7CB 3T1AA 1OMSA 1JLQA 2H51B 2NSCA 3FEXB 1RT6A 5IV3A 1WSRA 3R7NB 2F7VA 3ZTRA 4CTAA 1S97A 2V8DA 1QY7A 2GAHC 4LFBF 1RISA 2D41A 2RIJA 1BQMB 4I67A 3G4SS 5IWAF 4RU9A 2CQ4A 1T05A 3OL8A 3DRRB 4MIAA 5L8RC 2AP6A 3BKFA 2U1AA 3ILOA 3KJNB 3W2VB 2IM3A 2FDNA 4LUBA 2K7KA 3DNCA 1Q53A 2BKNA 5A2QY 2FC9A 4QCLA 1RSCA 1N5YB 2ILYA 1S9GA 1WHYA 4CCHA 4DFMA 2VIHA 3BM7A 4OLOA 4F3MA 3W5ZA 2BM0A 3QGPA 4ZHRB 1MU2A 4DR6F 3CDBA 2KRRA 3NGTA 4I7FA 2DY9A 3UI3A 1TL1B 1X5TA 1T11A 4RNFA 1VQ8S 3KK3A 4RZRA 2FJEB 5FLXY 3IN5A 5K8PA 3NKYA 5I4MA 3BYPA 4DLGA 1RZMA 2LKZA 4WFYA 3DKDA 1Y5IB 1QVGR 4YB7A 5RUBA 1QM9A 3MAAA 4LSNB 2AZ1A 1T03A 1S77D 4U8YA 3EDQB 4MYTA 3KK1A 1M5HA 2WVDA 3L7PA 2CRLA 1KFDA 1YIJS 3PV8A 3AD7C 2ZVIA 1RCOB 5D15A 2RDJA 1VQPS 3OPKA 2CQGA 5A6WA 3MI7X 1QAJA 1HBNB 5KT6A 2EFGA 4XK8C 2CWXA 3MEEB 5CYMB 3ONQA 4F36A 5KFIA 2ZE2A 2BJ7A 3PRBA 3N5FA 3Q8YA 4RL1A 1HNWJ 2AZ3A 2HIYA 1M5SA 4D3HA 3K5MA 2BANB 1X31C 4JI0F 5A2QU 2OJ3A 1FJGJ 1TV6B 3MR3A 2LLZA 3LWLA 5M2RA 5KFXA 2L08A 3BO3A 2GIQA 4DR5F 5AT1B 3G71S 4CO4A 4WF9Q 2P6SA 1BWVA 1JJHA 5J2PB 2P2CB 1XWLA 1OSCA 2H1YA 2YKNB 1BC6A 1DTTA 2HURA 4WCEQ 2QRRA 1QVFR 5FLXU 3C14B 4O3RA 1KQGB 3A3PB 4BHQA 3HDSA 1RHMB 4KRWA 1VRTA 2VONA 3FRZA 2DXDA 2W8LA 2ILZA 2XQCA 2D69A 1U1KA 1Y7PA 3WIUA 1Q79A 2MQQA 3KMQA 2O01C 2CPYA 1LWFA 1M1GA 1YRUA 1S1VB 3AJDA 4DN9A 1NJWA 2E5HA 1TR0A 4JI3J 5J2NB 2CZ4A 3BGRB 4LF9F 4HACB 1NK4A 4ZLLA 2GCFA 1S5ZA 2DNZA 4OZJA 4E98A 5AXKA 4K0KJ 2WTFA 5L38A 2IA0A 2AYEA 2MKKA 2KXHA 1VQYA 2ZH2A 4NLVA 4DS5A 1RHQB 8RUCA 1WG1A 2JH3A 3AQPA 1TKDA 2CVIA 5CCLA 1CBKA 2HGNA 1L3VA 1VRUA 3KWMA 3OL6A 4O4GB 3PEHA 1VQMS 1VFJA 4ICLA 1U0SA 3NMRA 3UDLA 4QR1A 4QWDA 1B4SA 1X5OA 2FIUA 2JHEA 2RQ4A 3FCHA 2MY8A 2JC0A 3NBPB 1HNWF 2CZVC 1F9HA 1Q8KA 1VQ7S 2MSSA 4KGMA 4F02A 5HBMA 2ALYB 1AT1B 2DGSA 1FJGF 2KU7A 4C8KA 4DWIA 2XSJA 3R8YA 2YWKA 4P73A 3W5YA 2GVDA 1VLOA 2MB0B 3TRGA 4LFCJ 4A8XA 1GEHA 1GXLA 2WB4A 3W9JA 3P49B 2J6UA 4DJBA 1Q5VA 1Q16B 4B3OA 3MM6A 4HI1A 3PRVA 1HNVA 1RT7A 4V19X 1FNMA 3WC0A 4IFYA 5I42B 1Y10A 4M5KA 1SC6A 2RE1A 4J9RA 3BN7A 3EUNA 1H38A 2SXLA 1K1SA 1FERA 2BE2A 2V4QA 1SH2A 4H4OA 3W9HA 1YZ6A 1WI6A 5FJ4A 5HMWA 4Q2LA 3V5RA 4OYPA 4O3PA 5GMKa 4J9QA 4D3GA 3TAMA 4C11B 3OHAA 3BB5A 2BQUA 4C98A 1K0TA 1EAYC 3D28A 3BV8A 1TVRB 4ID5B 5D78A 4WZMA 3NNCA 2CPHA 3BSOA 1R31A 3UCZP 2VOOA 4NLQA 3W66A 3Q83A 5LXYA 4TNOA 3QBCA 2H65B 3RYLA 3JTPA 4XPCA 3DRPA 2KJWA 4JV5J 1NK8A 4FVMA 2I2YA 3CJ2A 2JZ5A 1YJNS 2CQBA 2VG6A 2VJVA 2C22A 3GR1A 4DPWA 3VR1A 2VC1A 1SKSA 4JI1J 2N7CA 3HULA 1I5OB 1RGVA 1SI9A 1FDAA 3V6KA 3D3CJ 2WCXA 3CUNA 3JAMU 2RUSA 1HNIB 3HP6A 4A8WA 4LBHA 2W9CA 4J90A 3M2RB 4M5GA 4IO1A 4DL0C 2R8JA 4FPIA 3W7BA 4J9MA 3HSGA 4L76A 3H42A 2XZTB 4IG0A 2HZCA 1R7IA 3BEGB 1R0BG 5C25A 4OMFG 1F2HA 3M8ZA 4Q43A 2FJVA 3K5LA 1X4HA 4X4RA 3RBDA 3CWJA 2ZC3A 1TL3A 4ZCIA 2FZGB 4NCBA 2ROPA 2PDAA 1RWNB 2KTQA 2IVFB 1IQZA 1TKZA 3CCMS 2KH9A 4NZ6A 4C0OC 4A8KA 1S99A 3T1HF 3G82A 4LSLA 2QLXA 4JV1A 2EKNA 1IJFB 3N5BA 4F50A 2W24A 3CDAA 1XMOJ 1RAGB 4DFKA 4QBUA 4EYIB 4DSJA 3BO4A 4Q8FA 2OKQA 4PYDA 3RAMA 3NGRA 2V34A 2UUWA 1AUDA 3MHYA 5KT3A 1NXIA 1FFWB 5GMEA 3GPAA 4P9SA 2AEJA 4U9RA 2W2QP 3BGFA 2GHWA 4JV5F 2AJ1A 1BQMA 3CJQA 3DCAA 4C8MA 3C46A 5H9EJ 2HMIB 4I2PB 3DRRA 1PC5A 2PD1A 3BDPA 1HBOB 3FEZA 1FHTA 1B99A 2FJAB 4JI1F 3QGGA 2KZZA 4B9SA 1N5YA 5CH7B 2X7IA 4RBVA 1XERA 3VAKA 1OY6A 2DH7A 2A1BA 1RYRA 4ZHRA 5BYSA 4JI8J 3KLHB 5C2CA 3G9CA 1BXNA 1G4CA 2J7UA 1RAFB 3CDEA 1LQ9A 2GNKA 4NRUA 4B08A 4R8UB 1TL1A 4YR3A 1HHSA 3PYDA 2VQEJ 2DISA 1UZDA 1T8EA 3IM8A 5L1IA 4C7QA 5JUMA 4CLYA 4OI4A 3JSMB 4CLTA 2BYCA 4LSNA 4YHHF 5KAKA 1IQTA 1HW9A 3GJQB 5FD1A 1CSJA 2C3PA 2E44A 3H8YA 3PJXA 3FCVA 2WVEA 5HMYA 1HBNA 4WKYA 3P5TL 3ZZOA 2CKWA 2UXCJ 1NHUA 3MEEA 5CYMA 3VZHA 1OQ3A 4NLYA 2HHVA 2KHCA 4OL8A 1G3OA 4M5HA 4B9NA 5KFSA 1S4FA 1Q81T 3BGLA 2K2PA 3CF5Q 4PG7A 2F8EX 1XMOF 2DNPA 2AYBA 2OELA 2BANA 5M2PA 2ALZA 2CJAA 4NYPA 1M1KT 3CC7S 5DQGA 4ECXA 1O6XA 3R2CJ 1TV6A 2C2OB 2XY7A 2F9DA 1U8WA 2HK3A 2EFNA 2IAJB 4ZP8A 2BQ3A 2B51A 2IA6A 3NEKA 2PA8D 4EFAC 4OYOA 2DH8A 5J2PA 4DL2A 2PGCA 4C8NA 2N4CA 3M9OB 4LRCA 2YKNA 5ETKA 3IS9B 1RAJA 1FI4A 3QT8A 3EZ5A 3GFXA 5D4NA 1JJCB 2V0NA 4V1Ak 3IWXA 3C14A 4NLPA 4EU0A 1KHVA 5G4DA 4TVAB 2ZITA 3RBXA 1O0PA 2FB0A 2FHKA 3GJSB 5ETOA 2HNDB 1HHQA 1S1WB 2HYIB 3CJSA 3G87A 3VZIA 2BOAA 4KO0B 4YR2A 1S1VA 4UOFA 4HKQA 1KQFB 2E5GA 3GIKA 2A18A 2VQEF 1YI2S 2VKRA 4Q0BB 5J2NA 3BGRA 4HACA 4TYBA 4C8ZA 3T1YF 4OX8A 5EHHA 3N6LA 3PX6A 4CLZA 3EX7B 1HW8A 4DV1J 1Q8LA 1RTJB 5HL7Q 3HD2A 3MEGB 3M8RA 1IM6A 5HJXA 2PE8A 4B9MA 3TWZA 5KT5A 3DLEB 2VFRA 1D9AA 5IS2A 3HFVA 3GCWP 4O4GA 1AYEA 4HYKA 2UUAJ 2XWYA 4CYUB 1NK9A 2UXCF 2ZOMA 4DL6A 3LP1B 3QJPA 3THVA 1B7FA 2WVFA 2W25A 1DTQB 9RUBA 2FLLA 4URSA 3NBPA 5AXMA 1R8CA 2D9PA 4B3TJ 3JS9A 1NPPA 1JKHB 3ZZZA 4QU7A 1W7WA 2DGTA 2PA3A 3UD5A 1VBYA 2C28A 2RQMA 1IBKJ 3UCGA 5H1SV 3I87A 1WHXA 2BA9A 2M5YA 1S79A 2V9KA 3Q2SC 1JQGA 2W7OA 2Z2LA 3D6HB 3OBIA 2IFXA 2CPEA 5KOWA 2HK2A 2ATCB 3A1YG 3IRXB 2QFIA 1TKXB 4BDPA 4ZPWR 4OZ0A 2E9TA 3CJKB 3KUHA 2F8MA 4K59A 1WJ9A 1R8BA 5I42A 3ZNUA 3D7SB 1K8AT 2PN6A 2HQFA 1HNZJ 1HWJA 2HFNA 3DXSX 1XMBA 2YPYA 2DGUA 4OYZA 5CA5A 2V50A 5B0EA 4LBPA 2X3DA 1TQLA 4J9KA 3P3DA 3IC1A 3W9IA 4C11A 5EWGA 4DV3J 4PXCA 3EVOA 3FC9A 2N82B 1HA1A 1TAQA 2OAUA 1TVRA 4ID5A 2KN4A 1SIWB 2ZKUA 4URGA 4OX9F 1JIHA 1TL4A 1EB0A 3IWNC 2Z2ZA 2Q3PA 3MMBB 3G96A 8ATCB 2AHOB 4ILLA 3KDOA 4NE9C 1QSYA 2MLZA 1EKRA 1VQ6S 2R3VA 3TZZA 2AEFA 4K2JA 3D68A 2LEAA 4ZVUB 2UUAF 1CC7A 2MQ8A 1KC8T 4K4VA 1NPRA 3R6GB 3R1LA 5HATA 3QJJA 3R6LB 3NS7B 3Q8UA 1VQNS 1RHUB 1KBRA 1YTYA 3H5SA 4O4RA 2B4PA 2DO4A 1LW2B 3UVJA 4LRBA 1T7PA 2NPFA 1ZM9A 1I1GA 1S12A 3OTOJ 1FCAA 3BQ1A 2WRMA 2AX0A 2I8EA 2JLFA 4KC5A 2YKOA 5K5MA 3QIPB 4UY8T 1RA7A 2HIQA 3HCXA 3OHBA 1N56A 2UUBF 2JNJA 4NZ7A 1GX5A 3OFEA 2ZH4A 3M2RA 3DMJB 5ETPA 1VC5A 1KWMA 1CS4B 4J9OA 1FX2A 4ALZA 1WACA 1B0PA 2V2ZA 1S1XB 2EWHA 3GIIA 1HYSB 2CPDA 1KVKA 2RB7A 3GTYX 3CIZA 4ZP6A 1XN9A 2KM8B 2DPIA 1XJWB 2RVJA 4ZDNA 2C3YA 2DY1A 1VLYA 1IKXB 1HNZF 2DBBA 2HFZA 3JSBA 3M8PB 5DZ7A 2W7PA 4QOTA 4X62J 4USTA 4FKYA 4I68A 2HBYB 4OYXA 2RAQA 4YB1P 5KTQA 2Y8WA 2IY5B 4N56A 4ZLPA 3BN4A 2LXUA 2BABA 4A8OA 1FXLA 4DZDA 3FZ2A 1R0AB 1FKAF 2CQDA 3MM7B 4PWUA 1RCXB 2XZWA 4K4ZA 1L3SA 1G2EA 2HRTA 1JLFB 2QMUB 1KN6A 4WXOA 4UY85 1OPIA 2QV6A 4KH0B 2HMIA 4I2PA 4NPOA 1EX8A 3QRPA 1HBOA 1RB0A 4DG1B 3IA0A 2CUYA 2PO4A 5F8LA 3ZFVA 2UXBJ 4YY3J 2KM8C 3SCLE 4DSFA 4RJVA 5DETA 5IT9Y 1T9UA 4Y28C 2CXEA 2V4JB 3MOJB 2ZZMA 1P27B 1DZ5A 5KT7A 1R8PA 2XYPB 1RT4B 4K4XA 4X4NA 5I3QA 2K06A 2GFFA 2CWKA 3KLHA 1LK5A 3ICLA 3KJQB 2CA9A 2ZHBA 3GB0A 1VS3A 2XHCA 4R8UA 3OXFA 2AWZA 2VL1A 4RBUA 4Y34A 1F5AA 1R6VA 2QLFB 5BR8J 2MHNA 2ZKTA 3U1NA 4GVLA 5KG7A 3DDNA 4QYRA 4LR7A 1N0UA 3RBEA 3JSMA 4ZCMA 1H2TZ 3TX8A 3W61A 3ZTQA 3K2YA 1RABB 2FC8A 3ZZRA 4QYZJ 2XY6A 4O23A 4MK9A 4YDXA 2PMHA 4DV5J 3MF5A 2MQLA 2AIRB 4WU3A 4PG5A 2XMTA 2XSFA 1FVQA 4CO0A 3ETOA 3LP2B 4URQU 2A6OA 3ADAC 3UN3A 4DU8A 2FLNA 4IR9A 1HFEL 4WBFA 1FNOA 4ANEA 1Q86T 5KFQA 4Y2IA 1VMBA 3SQOP 2ZHOA 1DAXA 2RH3A 3VQSA 4U8VA 2FZKB 3OFHA 5BYRA 5IT9U 1MROB 5E3CA 2EFOA 2OP5A 2ACMA 4F26A 4DFPA 2IAJA 3NLCA 1YKWA 3L9ZA 2O67A 2ZH6A 2E1CA 2W9AA 3J7A1 4LF6F 3KLIB 1U1RA 2EW9A 3IS9A 2LEBA 4HLBA 1V3SA 4ZVEA 2HAFA 2O1PA 5B08A 1TFWA 1EJ7L 3UE2A 3MGJA 4V19J 2UXBF 4YY3F 1RAEB 1UFWA 3CVKA 3R5CA 4IQMA 4CLKA 4PEOA 2BE7D 4GRSA 3S7RA 2HNDA 4C4WA 3AY0A 1S1WA 3PTWA 2B56A 2XNRA 1Y3KA 2D3UA 3BYRA 2IMOA 2VHGA 2RRAA 1UJ4A 2HNYB 1H74A 3PEJA 4KO0A 1GMVA 1XNRJ 3J7AN 4Q0BA 4JOUA 3D5MA 4KIAA 2UV8G 2EEYA 2HSEB 1NDLA 3FQKA 3SDEB 3R1HA 3ZTSA 5ETSA 3BPDA 6FD1A 5BYQA 3CMAS 2ZDOA 1QSLA 2HQCA 1NJXA 1J2VA 1RTJA 4QWCA 3MEGA 4WIIA 1UJ5A 4KHRA 2RT3A 2GC8A 4M5LA 3KTQA 2R7QA 2GQ2A 2N7YA 5CABA 4CYUA 4KHPJ 3OJSA 2GIRA 4RW4B 3ISZA 3LP1A 4G65A 1A7GE 1DTQA 4DL7A 2YQ3A 4WK1A 4DR2F 1H6KX 4ZJOA 4MT1A 2XLIA 4FXVA 2FPHX 4OHZA 4ECWA 1LWCB 4NLDA 1HI8A 1JKHA 1NB2A 4CLUA 2GIFA 3LAMA 1FESA 2B9EA 3DGVA 5KG2A 4DPOA 2HQGA 4ZP7A 1R8HA 2FLPA 4ED2A 1YJVA 5KFGA 2B9XA 3EZOA 4BWMA 2VF3A 5L1LA 1F5CA 2QL9B 4NX9A 3MEDB 1IWAA 2HKEA 3IRXA 1SJ3P 1TKXA 2HBRB 3I82A 3BBFA 1PJ5A 4ED4A 1PAUB 5KOXA 4DR1F 3CJKA 2MZSA 3EM1A 1RKIA 9ATCB 1D9DA 2CNLB 3CC2S 4XIUA 3N0VA 1N5VA 2F4VJ 4TY8B 2A6MA 1NMEB 3MMAB 5DM6Q 3HVWA 3G8TA 3H2LA 1M90T 2CYYA 4I64A 2KFZA 1DURA 2DNOA 4Y3CA 3F56A 1NEEA 5KG4A 3ZXWA 1XNRF 2M8DB 3NNAA 4M5MA 3LW5C 4WP3A 2ZWOA 2E5JA 3BR9A 2Y0BB 3MMBA 2XLKA 3IWLA 3OTEA 4LIWA 4LF4F 2HBZB 3CXCR 4EO6A 1X0FA 3TW0A 4OHWA 4L75A 4MKVA 4OJ1A 1HMVB 3EGNA 1FJ7A 3E8OA 3H5UA 3NS6A 2MKYA 1GFWB 4OZLA 2HS3A 3J81j 3M32B 3QPIA 1RAOA 2GQQA 4WTYA 2FVSA 4OQJA 2VFSA 3RRKA 3VHQA 5HQ8A 5IV4A 4RWXA 3KUGA 3FUYA 2DD8S 2XS2A 2HHTA 2CQ1A 3PYEA 1LW2A 4WWSA 1Y9OA 1PKUA 3DLKA 2NXJA 2JEIA 2VPXB 2HNZB 1N8RT 1RT5B 4USMA 5KT4A 3QIPA 3AHPA 5THWA 2I0XA 3S8SA 2A10A 4NYOA 4UZCA 2Z4PA 2MQOA 3OV7A 3DMJA 1S10A 1OWXA 2Y1JA
chains in the Genus database with same CATH topology
4ZVGA 5C42A 3IBWA 4JI0F 2J5AA 2W4PA 2DR8A 4I69A 4MYUA 4ELTA 3DU6A 2P9GA 2OJ3A 3UPFA 1TV6B 4ZOSA 4PRFA 3S1TA 3MR3A 2XY5A 2LLZA 5F8NA 2IRYA 3T5LA 3MD3A 1S1XA 5M2RA 3LWLA 3FFIB 4QQBA 5KFXA 1RTHA 4QPTA 2RKIA 2WSEC 4CNYA 4PPDA 2L08A 2K7JA 3BO3A 1HYSA 2GIQA 4KT0C 4DR5F 2YWGA 1M5KC 4DR4F 3JSYA 3G71S 2NLWA 1VOMA 2EBEA 3RW7A 4CO4A 4WF9Q 2KYZA 1HWIA 2P6SA 3TP2A 2POKA 2FVPA 1JJHA 5J2PB 3LAKA 1D9FA 1XWLA 1ZTWA 4R25A 1OSCA 2YKNB 3QLHB 1BC6A 3MM9A 1IKXA 1DTTA 1RT1A 1WNEA 3I31A 1E6VB 5A8WA 2R7SA 4YEAA 4XAKA 4R5PB 4LFAF 3IAM9 3M1VA 4Z37A 1YVFA 2R7XA 5K8OA 4WCEQ 2QRRA 3B4DA 4ILRA 1QVFR 1ROFA 4Y65A 2F1FA 3IGNA 4ZPTR 1VQOS 3UD3P 2DJWA 2WOMB 2Z8QA 3M8PA 1D8YA 2HHPA 1VGYA 3R27A 3UCUP 2VBXA 1KQKA 4O3RA 1KQGB 4BHQA 3HDSA 2E66A 2B0GA 4NLRA 4KRWA 3IG1B 1NZAA 1VRTA 3KNGA 4QIEA 2DR7A 2NUHA 2VONA 3AAWB 5E2QA 5I3UB 2OSRA 3FRZA 2W8LA 2W4CA 2ILZA 1B64A 1X4GA 4PKDB 1U1KA 1P1LA 3ZZPA 2OPQA 2YKPA 1SH0A 1Y7PA 1S0VA 1S1UB 4F4XA 2HHXA 1Q79A 2N3OA 3OUYA 2MQQA 3DOKA 1UVLA 1R0AA 1U4BA 2YNGB 2AYGA 2LU2A 3MM7A 3BF4A 3PZPA 4HEA9 3D54A 4A4JA 3KMQA 2UVVA 2GO8A 2O01C 3HKZD 4PQAA 1IR0A 2CPYA 1LWFA 4FNHA 4QZVB 4B9LA 1RTIA 5JXSA 4B9UA 4HVZA 2DR9A 1YRUA 1S1VB 2AF6A 4NWBA 4DN9A 3HLUA 3UDCA 4B17A 1JNZB 4TKTA 5L39A 3R5AA 2DNYA 1NJWA 1GTEA 5E3QA 4C3KA 2E5HA 4ZVHA 2AJFE 1TR0A 3DOMA 1JLFA 1W25A 1PILA 5KG1A 4JI4F 1LOUA 1URNA 2R8GA 5K8NA 1TK0A 1UKUA 4ECRA 1LWEB 1R27B 3VTIA 5J2NB 2HHUA 2CZ4A 3BGRB 5T14A 4LF9F 2AV5A 3E3XA 1NK4A 2W4DA 2XULA 2MGZB 1FKPB 1UVKA 2HAIA 2RD5C 2GCFA 1TKTA 2OFGX 1U25A 2DNZA 4OZJA 2AJ4A 4CH0S 5AXKA 4E98A 2KO1A 2EBGA 5IXUA 4KSEB 4EUVA 1S48A 4C97A 2WTFA 5L38A 2IA0A 2AYEA 3JTNA 4HHJA 2MKKA 2KXHA 4F4ZA 1VQYA 4P6QA 5DG7A 4QW9A 2L3MA 2P9CA 4NLVA 2ZH2A 4DS5A 3MR5A 1LKZA 3DLHA 2YVSA 1R43A 1YHQS 4PCQA 4LF7F 3R5BA 4M8LA 4DG1A 4K50A 2HWTA 5KG0A 1WG1A 2JH3A 3NCQA 1ZAXA 3AQPA 3FNNA 1TKDA 4B3OB 2EKYA 4WYLA 2CVIA 3GILA 3BSCA 1DLOB 5CCLA 1SH3A 1HL6A 3GV5B 2HGNA 2CJBA 2QMXA 1L3VA 1VRUA 5J2MB 2B6AB 4TU7A 2FLOA 3KWMA 3M30B 3G6VA 4A8SA 1A9NB 3OL6A 2KG1A 4O4GB 2QO3A 3PEHA 4AUKA 2ASDA 2V4JA 2MSTA 1X0PA 1HHTP 1AFJA 1VQMS 4M5DA 1VFJA 2WBMA 1RT4A 1JMTA 4ICLA 1UAWA 1ULRA 3NMRA 4A8MP 3UDLA 3RB3A 2KHDA 4QR1A 1UETA 4YDDB 1P6TA 4QWDA 3KLVA 1U1OA 4PWDB 2UVWA 4TYAA 1X5OA 2GHPA 5U47A 5GADI 5EN1A 2DHXA 2FIUA 1S1UA 2JHEA 4Y2AA 2DGWA 4ES2A 2RQ4A 4F4KA 1WG4A 2HWHA 3DHXA 3FCHA 4IG3A 4BC9A 4ITSA 2MY8A 4G1PA 3T19A 2JC0A 3CD7A 3NBPB 1UW4A 4EBCA 3TUIC 5CHCB 3BGUA 2DO0A 1HNWF 1FNXH 4RW8B 3ZZUA 4JI8F 2ZH3A 3O3LA 5E3RA 5CD4H 2CZVC 1M5VC 1WELA 1HD1A 1REVA 3F41A 1RK8A 1VQ7S 2MSSA 4KGMA 4F02A 1VQSA 5HBMA 2XCPA 4DLEA 2DGSA 4O0IA 3V6DB 2R7VA 5DDQC 3MDFA 3ISND 2KU7A 1FJGF 4C8KA 3DDKA 3K0JA 2FJDB 5D77A 4DWIA 5EDWA 4DL3A 2XSJA 4DN0A 4KBIA 1WEZA 3TVYA 3LALA 4K4YA 4ZPCA 2M88A 1U1QA 2YWKA 4NLXA 3H5YA 2PEHA 2HPUA 2JVRA 5DLFA 4DUZF 4WU2A 2BW2A 2MB0B 5DM7Q 1WWHA 4QWEA 3OFFA 3CCSS 3TVKA 1B0VA 4R0JA 5KFCA 4OJHA 3TRGA 4UQGA 4C2MA 3PW0A 1IBMF 2OH2A 2LYVA 2MPUA 1YG0A 5GAEI 3GFZA 2AQ4A 4A8XA 1GXLA 2MKHA 3DRPB 7FDRA 4N47A 5LSRA 4F8RA 2WB4A 3RB0A 3P49B 2J6UA 1XNQF 4A8YA 1IKVB 4DJBA 2VZ9A 3POTB 4IOCQ 5LSOA 2DRAA 2R8IA 4MKAA 1WF1A 5DDOC 1Q16B 1NRKA 3GZ7A 2L9DA 4B3OA 1JLEA 1AXQA 3MM6A 3DHWC 4HI1A 4FF2A 1K0VA 1HNVA 1RT7A 3LP0B 2EG1A 1FNMA 3MAHA 2DVIA 4V19X 3WC0A 2J6SA 3NS5A 3OR1A 3D2WA 4IFYA 2J7WA 5I42B 2IJNA 2CJQA 4OI1A 3SV3A 2QLWA 3SCJE 1SC6A 3VAHA 2XMUA 2RE1A 2R2RA 2RS8A 3G6ES 1C1BB 3BN7A 3EUNA 4J9RA 1H38A 3I9V9 3Q24A 2SXLA 2DIVA 1K1SA 1FERA 1WG5A 3IAS9 3M2UB 3PX4A 3BREA 2BE2A 1VIXA 2V4QA 1SH2A 2FUG9 1FDDA 3LP2A 4H4OA 4N76A 2RU3A 3PXGa 1WI6A 4ATNA 3HM9A 2PI5A 5FJ4A 2IHR1 3O1LA 4OIXA 5HMWA 2VBZA 3VCDA 4Q2LA 3V5RA 1NH8A 3VAJA 4KJIA 4O3PA 5GMKa 4OX6A 4J9QA 2CPZA 4I2QA 4D3GA 4L72B 4C8LA 3H40A 3TAMA 3F73A 3HZGA 1MNEA 4C11B 3QAEA 4K4SA 1MROA 3BJYA 3PY8A 3OHAA 3BB5A 4NL5A 2AGOA 2BQUA 1HQUA 4OJGA 4C98A 1K0TA 4OFZA 5KFJA 2RF2B 1NJYA 2R8HA 1ZZFA 3D28A 4DFJA 4Q8EA 4OLPA 1TVRB 2DHGA 4OX7A 4ID5B 5KFYA 1VJWA 4QU6A 4PG6A 5D78A 3N79A 1RT2B 4WZMA 1FVSA 3NNCA 1RT3A 4A8FA 1P8GA 1YJRA 2RSQA 3K58A 2CPHA 3BSOA 1R31A 3KLIA 1FEEA 4I56A 4WXWA 2W7AA 3UCZP 3WZ0A 4DQPA 3M4XA 5M2UA 1XEZA 2VOOA 4NLQA 3DU5A 1KS2A 5LXYA 2RMLA 2AYMA 2XNQA 4TNOA 4QPXA 2VC0A 5D4OA 2HWIA 3RYLA 1X5PA 3JTPA 4QIVA 3SMZA 4A46A 4XPCA 3DRPA 2KJWA 1NK8A 4FVMA 2IBKA 3MM5B 2I2YA 3US5A 3CJ2A 2JWNA 3JYTB 2DNLA 3OQ2A 2LA6A 3Q0AA 4OHVA 3HI9A 1ELOA 2JZ5A 2B5JA 1YJNS 2CQBA 2VG6A 1H0HB 1FE0A 1N88A 5KFTA 1XMQF 3PX0A 1T3NA 1IN0A 2CFXA 1NU4A 1J5OB 3WX4A 2C22A 4IOAQ 3GR1A 3VR1A 3THTA 2VC1A 3SXLA 3V4IB 5KFNA 4H54A 4RKUC 2G1DA 1FDNA 1S1TA 2NS1B 1SKSA 4EZ9A 4X4VA 2N7CA 2YX7A 1S7HA 2COLA 3CE8A 3H5XA 3DM2A 5A0YA 1HBUB 2CQCA 1RGVA 4GC6A 1C0UA 1SI9A 2B4OA 2DITA 1FDAA 2HNYA 4TLRA 4DEZA 4WFAQ 4ECZA 2ROGA 3T5JA 4P2SA 1FRMA 2U2FA 2MZTA 3AQOA 4K2XA 1QAIA 2VG7A 4FBUA 2LU1A 4GMKA 4B9VA 2OPRA 2VODA 3T6JA 3V6KA 3CCUS 1Q1KA 1IKYB 2WCXA 1U45A 2XCAA 2EFVA 5J2QB 3CUNA 4LVOP 1N36F 1APSA 3WBZA 1HNIB 4FN5A 3HP6A 4HH1A 1P1TA 1X4FA 1HD0A 2FVCA 3H2VE 4WE1B 3HJFA 2ZM6F 1X4BA 4A8WA 1H7WA 2KG0A 1Y0HA 1DQ9A 3MMJA 4ZPBA 3SDEA 1SJ4P 2W9CA 5CYQB 3M2RB 1NO8A 2R2TA 2JLGA 4MKYA 3HK2A 4IO1A 4DL0C 2DNQA 2R8JA 3DYAB 3CULA 3W7BA 4J9MA 2XMMA 5G0RA 2DB1A 1BQNB 5HMZA 4IG0A 2A2DA 2HZCA 4NCAA 4YOEA 4K5SA 1FXRA 1TP7A 1R7IA 3TOQA 4TN2A 3BEGB 1RP5A 1NJZA 3OVSA 4EBDA 2BRLA 5KFZA 2X1FA 2NQPA 3TANA 2FHJD 5C25A 4OMFG 2JFDA 2QE5A 2YNFA 3TR5A 4Q43A 5CQGA 3I0SB 5E41A 1QUVA 1SV5B 4DV1F 3LANA 3MPYA 1RYSA 2FJVA 3GYNA 3K5LA 5T7LA 2X1BA 2G0CA 1X4HA 2QZ8A 4X4RA 2I5JB 3RBDA 3CWJA 2ZC3A 4X66F 4ZK7M 3VAMA 2AGPA 3X3UA 3M8QA 1TL3A 5F3TA 4ZCIA 4NCBA 3G8SA 2HHHF 2K3IA 4RW4A 3TA1A 2DNHA 3NRBA 3RTVA 1Q82T 3N01A 4YB6A 2KJVA 2DGOA 2ROPA 2GMJA 2PDAA 5A8RA 3PW2A 3OL7A 3MTJA 2HLTA 4MMOA 4JV0A 4C8OA 4ID8A 4IR1A 4JYAF 2KTQA 4MTPA 5D3GA 2IVFB 5HROB 1IQZA 3ITHB 1HBMB 1FRLA 4USIA 7FD1A 1JLAA 4NRTA 1TKZA 2K3KA 1HQEB 3CCMS 2KH9A 2WHOA 1GX6A 4NZ6A 4GKKF 5KG3A 4DSIA 4C0OC 4A8KA 3TYTA 5AE2A 3Q8PB 1S99A 3T1HF 1LWCA 4LF5F 1Y4ZB 4LSLA 4OHYA 2QLXA 4MK8A 1WHWA 2BVZA 1F0XA 1YWXA 1BD6A 3DLJA 2Q1LA 5B0FA 5AXLA 4JV1A 1T02A 3V4MA 1S6OA 2I9SA 3PDNA 4B3TF 3GV7B 1H3DA 4NXNF 1IJFB 3N5BA 3N6MA 1HPZB 2VG5B 2W24A 4X4PA 4F50A 3I5BA 5DLGA 3KJVB 2NSBA 1RI7A 3CDAA 1HNIA 4NLUA 4TLQA 4DFKA 3NL0A 2LMIA 4QBUA 4EYIB 4DSJA 2CPFA 3BO4A 3AB2B 3IR5B 5IFMA 2ZHAA 4Q8FA 2OKQA 3OTCA 1QE1B 4JI2F 3RAMA 3T6BA 2NUUG 1RTDB 3KOAA 1RQ0A 4DS4A 1IBKF 3MEDA 1S0OA 1SL2A 1LXNA 4K4TA 1S6PB 1SJRA 2UUWA 2ZH9A 2RU9A 1AUDA 1HWKA 3MHYA 3SQGB 5KT3A 4PQUA 4QW8A 3SI8A 2NXUA 3U27A 4U9RA 2F8HA 1YBAA 3ENVA 2ZNZA 2UU9F 1GTHA 4MFBB 4J9SA 1YJTA 3BGFA 3DXBA 4MK7A 2WONB 2GHWA 2LECA 1GNKA 5KFVA 3VQTA 2VH7A 2XS7A 1UWBA 4JV5F 4Q44A 2AJ1A 3QIDA 5F8MA 1BQMA 3HHLA 2VA3A 3JTOA 1MSWD 3FMBA 3NG8A 2JEFA 1SJ1A 4QR0A 3DCAA 4C8MA 2QT7A 1JXLA 2A3JA 4O3QA 4M1KA 2QA4S 5H9EJ 3C46A 2HMIB 1U6BA 1SKRA 4I2PB 2F3JA 4TY8A 5E33A 3DRRA 4ERDA 1PC5A 2PD1A 1Z2ZA 3E01B 3EYZA 2C2RA 1NK5A 1CLFA 3BDPA 1HBOB 3FEZA 1FHTA 2DT9A 3MMAA 2M7SA 1ZETA 2LXIA 4EYHB 2FJAB 2VPWB 4LJMA 4JI1F 1FT8A 1OO0B 4ETXA 2YNHB 3QGGA 3MWBA 5KFMA 2M2BA 1WEYA 2VBYA 4CO2A 4ECVA 2KZZA 4B9SA 1N5YA 4RBTA 4Y0FA 3GV8B 5CH7B 2HW3A 3VF0B 3O2IA 4O3SA 2W9BB 2NR0A 1VHFA 5LMNF 3C6UB 2DK2A 4XDDA 1PSDA 4RBVA 2IVYA 4J9NA 1FKOB 1JXEA 2D1CA 1XERA 2V5HG 2KDOA 3UFCX 1ZAVA 3VAKA 3MCSA 4DSKA 2DH7A 2ERRA 1X9SA 4HTJA 3OSPA 1U7LA 2ZH1A 1JLCA 2A1BA 1RYRA 4AL6A 1UL3A 4IKAA 4ZHRA 1E6YB 2KVIA 4QIFA 5KG6A 5BYSA 3KLHB 4DV3F 1U49A 3QGHA 3G9CA 4H4MB 4PXDA 2J7UA 1S76D 4ES3A 2OMLA 1JLBA 5DRKA 3CDEA 1LQ9A 2GNKA 4NRUA 5LL6d 4DR3F 4K4UA 4B08A 4R8UB 1TL1A 4CH7A 4YR3A 2PSZA 1LW0B 3LGMA 1HHSA 1S9EB 2DISA 3DLLQ 2V9WA 4OI2A 2I1RA 3K5NA 2VD3A 3BDEA 3CSKA 1MWYA 2GHVC 3HKWA 5B0GA 4IFVB 4O44B 1T8EA 4F2SA 2DPJA 5L1IA 1BGXT 5KFHA 1HMVA 2YNIB 4C7QA 2C2EA 4P7VA 4YUDA 2KXFA 2LXFA 2ZD1A 5JUMA 5D8HB 2VA2A 4NA3A 5IQ6A 2QA1A 4KV8B 4OI4A 5HO4A 2JOQA 5J1EB 2RUGA 3JSMB 5CZXA 3M32A 3MD1A 4NCGB 2QA4G 3T5HA 2BYCA 1VQ9S 4LSNA 1YGYA 3GIMA 3GIJA 2ZC4A 4DDFA 4KKOA 4YHHF 4L6V3 4MKBA 2ASJA 5KAKA 4X84A 3V6HA 4E0DA 3HHKA 1XTZA 1IQTA 4HDGA 2ZNYA 1T94A 2LQJA 1HW9A 1KLMA 4J5OA 4IOBA 3B8HA 3CJ5A 4R0EA 2MKJA 5FD1A 1XK8A 4PXEA 4CH1A 2V8GA 2MZ1A 3HHEA 2VQFF 1CSJA 2C3PA 2JEJA 2E44A 3H8YA 3PJXA 2X3GA 5A6PA 2XO7A 4P7TA 3PR5B 4G1QB 2X1GA 3IFEA 1YJWS 5HMYA 2ACYA 3KLGA 1HBNA 4WKYA 3DLGB 1MWZA 3P5TL 4I6AA 2OPPB 1SB6A 1FK9B 2HNZA 3PACA 3ZZOA 2CKWA 1ZH5A 3R3TA 1KTVA 1RT5A 1NHUA 3MEEA