3NWGA

The crystal structure of a microcomparments protein from desulfitobacterium hafniense dcb
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
180
Chain Sequence
AMESIGLVEVNSIARGIEAADAMLKAAQVDLLEAKPVCPGKYIVLICGDVAAVQSSVTAGKTMAAHSVLDDFILPNVHPQVLTAISAATPLTLIKALGIIETFSIASLIVAADTAAKTGQVDLVEIRIGMGIGGKSFVTLTGDVASVESSVAAGVMLASERGMLVDKVVIPSPHDHLKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Microcompartments protein
publication title Structure of a PduT homolog from a novel bacterial microcompartment
rcsb
source organism Desulfitobacterium hafniense
total genus 41
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nwgA02
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nwgA01
4QIFA 4DDFA 3DN9A 4LIWA 5L38A 3I96A 3SSRA 4P7TA 4RBUA 3SSQA 3CGIA 3DNCA 4AXJA 2G13A 3H8YA 2A10A 4P2SA 4OLPA 5DJBA 4PPDA 3CIMA 3NGKA 4RBTA 4P7VA 4AXIA 4RBVA 4OLOA 4OX8A 2A1BA 3NWGA 4QIEA 3SSSA 3I6PA 4QIGA 2EWHA 3MPYA 3N79A 2A18A 3IA0A 4OX7A 3PACA 3VCDA 4OX6A 3BN4A 4QIVA 3MPWA
chains in the Genus database with same CATH superfamily
3T19A 4DR5F 4GMKA 5H9EJ 3P45B 4EZ6A 4FVMA 4R8UB 4WXOA 1Q7YT 3ONQA 2BYCA 2BE2B 2O5DA 2GIRA 1S1VB 1KOOA 4KR0B 1S99A 5B08A 1T05B 2EFOA 4FS1A 1YX2A 4O3NA 3MCMA 1C4AA 3DXSX 4NCGB 2AIRB 4DSLA 4ELUA 3PJ9A 4ANEA 1RWUA 3VZIA 2UUAF 5C5JA 2VASA 2C2RA 4WPAA 2G2ZA 3W9IA 3CULA 2UVWA 3FQKA 3FSYA 3G96A 2Q6BA 2FZKB 4M95A 1FVQA 1LKZA 2V69A 5ETLA 2V9KA 4A8YA 2D3O1 3LAMA 2CQGA 1HNWJ 2ZZTA 2J7WA 4ZPWR 1GMUA 3NAHA 1X4BA 4USJC 4O3QA 4ZS6A 4YHHF 3QSYB 5JVHQ 4TU9A 5A2QU 1VJQA 1HL6A 4YOEA 3N6MA 4NA2A 2QV6A 4OV6A 2XLJA 1J5OB 2RAQA 3SV3A 3SSRA 1B3TA 3V6HA 2CPEA 2E9ZA 2VFSA 4DUYF 4OQJA 3BSOA 5BYRA 2HQCA 2FHMA 3DM2B 1FRIA 2K8GA 3MM5A 4J90A 1TTHB 2ZH7A 3M2VB 5D8HB 1HNZF 3TX8A 2HQDA 2C3MA 3JB9k 3UW1A 3T9ZA 2HSEB 3P3DA 2I8EA 3JAMY 1JWWA 5GADI 1RTHB 4A48A 1M5KC 3CDWA 2EFGA 3OXFA 3ZTRA 4C48A 2B6AA 3HZEA 4PG8A 1BUXA 2Y1LB 3V6JA 4O4RA 2A2CA 2G9OA 1XMBA 1HYSB 1EQMA 3CCSS 4RL1A 4Y6IA 1VHFA 1HQEB 2H4YB 3PV8A 1B7YB 4PYDA 4HI1A 1QD1A 3GP9A 2B56A 5DRKA 3GJRB 4LIRA 3WX8A 1U0HB 3SZ2A 1TMJA 2CPXA 3QAEA 3QBCA 2HIQA 3Q8RB 4K7QA 2MY7A 4DL0C 2WK4A 1RZMA 2L08A 5KFHA 1FKPA 5B0FA 4LF9F 3KTQA 4B3RJ 4JI6F 4FKYA 3HHLD 4ZPTR 2VONA 2NSCA 3C6TB 1S1TB 2AEFA 2P6TA 4KGXB 3GR1A 2BKNA 3UD4P 2XS5A 5DZ6A 5I3QA 4DF8A 3CC4S 5KFNA 4EBEA 4K4WA 2BQUA 3CCLS 2MZSA 4C9DA 4YB7A 4C3MA 4LF2A 2VBWA 1LW0B 3R2CJ 1UW4A 2EVZA 2MLYA 3I5AA 1NZ8A 2ZBQA 1VQ9S 2PA3A 4OYXA 3I0SA 4I2PA 1VJWA 3BDEA 4PAAA 3BO3A 2FC8A 3GV7B 1F5CA 4DR7F 4RO0A 2G0CA 2W2OP 1URNA 1ELOA 2QMUB 2NXNA 2HYIB 3EM1A 1EETA 5LMNJ 2ZBCA 4KO0A 4ZN3A 3ZO7A 1BWVA 1NDKA 1RWNB 1NXIA 4P6QA 4Q45A 2HRYA 2XMAA 1H72C 4TYAA 3CD5A 3HHLA 3LAKA 4KGKA 3R5JB 1QY7A 1YZ7A 3KLFA 3D1QA 1HPZB 3HKZD 2FIUA 1BQMB 4LBIA 5HBMB 4CLKA 1F3VA 3EPGA 1H6KX 5T7LA 1U7LA 1Z1ZA 4WZQA 1M0SA 3DYAA 1YTYA 1X4AA 1LW2A 4NYPA 1FXRA 2HZVA 1KFDA 2UUCF 2MQNA 3FBEA 2DRAA 4BWJA 4P52A 1UEUA 3FNNA 4NLPA 3QYYA 4WYLA 1UP1A 2HNYB 3T9NA 1KOHA 4F04B 4X4PA 4TYBA 1SJFA 4DV5F 2MLZA 1CJUA 1TAQA 5ETSA 4C8MA 4K5SA 4HDGA 3V6DB 2DVIA 1Q86T 1FDDA 4OLOA 3NWGA 1NRKA 2HEKA 2A18A 3LGMA 5K14B 4NE9C 1VQKS 2O67A 1Y0HA 1U2FA 4J9MA 2YKNA 1HHTP 4QPTA 2FVCA 4YHHJ 4ZVTB 3OSPA 3M8YA 2FGCA 3PTWA 3QO9A 4CRJA 2C42A 3LQVA 1VI7A 4DX6A 2W2QP 4TU7A 1U1NA 3DMJB 5BXIA 2HS3A 3K2YA 3D6TB 1WI6A 4KH0B 2BA9A 4DUYJ 1YJ7A 1AUSL 4FPIA 1Q8IA 2X7IA 3TZZA 2X3GA 1FKOB 1RU2A 3UDEA 4XDCA 1HNZJ 2RKIA 4FYYB 1WEXA 3H40A 1NKEA 3LP2B 2CJAA 1FD8A 4DV1J 5LM7E 5G0RB 2AGQA 4ZVPB 2FB0A 4RW8B 2QLWA 3RYLA 1WF1A 2DNGA 2WOMA 4LSLB 3CW2C 5GAEI 1QLNA 3MMCB 3A3NB 3ZTQA 2OPSB 3AJ2A 1F60B 3QZ8A 6AT1B 1IQTA 5EWGA 4RNNA 3HKWA 1LXJA 1KEKA 4FXWA 1P1LA 2YWHA 1GT8A 2I6WA 2QEXS 4GC7A 1IN0A 4PZVA 3MM7A 2BKOA 1PIEA 1D09B 1ZBTA 5L8RC 1LWFB 3D5MA 1SB6A 2WVDA 2BJ7A 1LQ9A 2PEBA 2MQMA 2AYGA 3LWMA 4I64A 3CB4A 2HAIA 4J9SA 2W9CB 1VIXA 4WZMA 3MI7X 4F0KA 4DQRA 1FEHA 1TU0B 5C25B 3M8WA 1N34F 2FY8A 1AW0A 2VQFJ 2B4PA 2R7VA 4C8YA 2OFHX 3EZ5A 1JLBB 2KTQA 5DDRC 4CH7A 2W4DA 2ZVSA 2FTRA 4X64F 4GC6A 5F8MA 2VF3A 2W9BB 4K4ZA 2J9DA 1F3FA 4USWA 2XNQA 4TNOA 3O8WA 1SL1A 3QJJA 4X84A 3THTA 2DGUA 2RUGA 1VQMS 1VK3A 2C1EB 2UUTA 1G4CA 2N4CA 4IDKA 2R4FA 2LXUA 4WBFA 4DR7J 2BW2A 1H74A 4DV7F 3GIJA 3J7YU 2QL5B 2M88A 1VRTA 4RW9B 3TA2A 2CZ4A 3GYXB 2OJ3A 5KG1A 4B3TF 3M1VB 3GIKA 4ZP6A 4BDPA 4P2XA 2RILA 1RTJB 3DOMA 2XULA 4DQIA 1EP4B 2ZOFA 4P2SA 1BQXA 3J81U 3D0GE 3M6XA 1MW7A 2GCFA 4EUVA 2HNDA 1HQUA 4ZKAA 4RUBA 1Q8KA 3MF5A 3SMZA 4OV1A 4Q0BA 1WEZA 2UV8G 4CO5A 4F0HA 1RBLA 3IBWA 3POTB 4DN9A 3W60A 2DY9A 1C1BB 2QT7A 2FGOA 1V3ZA 4QIGA 2UUCJ 5AXLA 1HWIA 4MTPA 3BYRA 4NMXA 4CO3A 2DPIA 2E44A 1U25A 4DV5J 3EZOA 1WSVA 5M2PA 2FJXA 2X1FA 2KYXA 5LMUJ 2GQ2A 1T9UA 1BMQB 2YNFB 3CJSA 3S8SA 2O66A 2J0QD 2HFSA 2ZKTA 4JI3F 4YEAA 1SBRA 1DZ5A 2AD9A 4P10A 5GVQA 2G2OA 3JSMA 3FRZA 1HNIA 2K06A 1RU1A 5F8LA 4LVNP 1MMLA 1SH0A 1WJ9A 3BJYA 2KT3A 5I3UA 3TNVA 1S6OA 1Q53A 2KI2A 4JOUA 2ROEA 1XWLA 3NKYA 4JYAF 4NZ0A 2DNZA 4OMFG 4ZHRA 4ICLB 3CCQS 1JLCB 4R25A 2XLKA 2NUUG 3A13A 5SUHA 2XO7A 2F4FA 4OIXA 3ZZZA 4YFUA 2OD6A 3QGPA 4USMA 4ANDA 2IY5B 3HMJG 2HHTA 3OV7A 5B0BA 1F0XA 1UA1A 3PCOB 2D7SA 3RB6A 3DLLQ 3MPUB 4ZK7M 4PCQA 3RRKA 3DOLA 3K89A 4I1TA 3CCTA 3OPKA 2KN4A 1S0VA 1FNOA 2ZM6F 2YXLA 1FVSA 4DN0A 1NU4A 2V4QA 2P9CA 4GRSA 4FF3A 2OEMA 2HVZA 4I6YA 2AYMA 7FDRA 4QW9A 4I2QB 4USKA 4U8VA 3P6YC 1WTFA 1F5AA 3UCGA 4E98A 1RBAA 3MEDA 1WHYA 2EG1A 2G1DA 1CS4A 4ECQA 1MG7A 5HVGA 1S76D 1CULB 5AT1B 1NDPA 2JZ5A 1GFWB 1HBMA 3H42A 3K5LA 2YWGA 1ZAVA 2Z56B 2Z30B 3PYEA 3H98A 2XGQA 2WW4A 4B17A 1V9OA 3RJMB 2MLXA 1VBZA 4MK8A 4O44A 4QIVA 3SCKE 3MR2A 1QUVA 4DX7A 1TKTB 1SQGA 4NLRA 1RCOB 2QRRA 3EWGA 3V2UC 3W63A 4DHVA 3WBZA 3KG4A 1BE4A 1S1UA 4LF6F 1TL3B 3OQ2A 3MPYA 4K59A 5F8HA 2HHVA 2H4WB 1RHUB 5T14A 1D8YA 1HW8A 1YJNS 1IQZA 1D9AA 3D68A 3RW7A 1C0TB 4ZVGA 1KBRA 4HTJA 4OHWA 4A8XA 1UCNA 2H1YA 4K4SA 3MM6B 3TUJC 4NWBA 4YB1P 3DRSA 2XSJA 3PW2A 1WDTA 2D9PA 4AXIA 4USIA 4Z2XA 3HJVA 5J2QB 2DPJA 5ETQA 2DNRA 4TY8B 3MTJA 4MAKA 1C1CA 4QOTA 3GJTB 2VD3A 2DHXA 4OLPA 1HBOB 3M32A 2FVRA 4NLYA 3W2VA 2FLNA 4Q2MA 4C0OC 4HYKA 2MZ1A 5A2QY 1RT3A 4Y2AA 2O1PA 1R6YA 1S9EB 3OL6A 2WVFA 2VIHA 4X66J 4DL7A 5EX0A 3MR7A 4PR6A 3NAIA 1SC1B 1YKWA 3WQPA 2YKPA 1ZA2B 1T02A 2E29A 3R1HA 1X9WA 4OJ3A 2BX6A 5HROA 3NXZA 1MU2A 2B0GA 3VHQA 3G8TA 4F2RA 1X4GA 4R8UA 1FDNA 5CXTA 2VUGA 2M70A 3BSAA 4J9UE 1NPPA 1BHNA 2XG8A 1NPKA 3T6JA 2W8LA 5CAAA 2OTJS 1T05A 2V2ZA 4ZPBA 2FJAB 2ZHAA 3M2UB 1RTDB 4NCGA 4ETZA 1U2RA 3KJFB 3R5DA 5D15A 2V8HA 1JLAA 4CLPA 1LWEB 4ZN1A 5ETNA 4J9KA 1Q7LB 3IAM9 3GYNA 2W8KA 4L76A 2QC3A 4JYAJ 2RD5C 3BQ2A 1SQFA 5F8JA 4ZCMA 3R5CA 4G3IA 1CJTB 5KG6A 4NOHA 3BZQA 4PXEA 3H0PA 4IRDA 4LREA 4ED6A 2AYBA 4N77A 3R5BA 2UP1A 1FWKA 5LSRA 3Q0AA 2CDQA 4OX7A 3D0HE 1K1QA 2RIJA 2FVPA 5FLXU 1Y5LB 2PA8D 2YVSA 1Q82T 5KFYA 2XMTA 5HVFA 3OTEA 2ZM6J 4JI0F 3KUHA 1SC4B 2JEJA 4O3RA 3HFVA 4LRCA 5D0HA 3C16A 3IR5B 4MIWA 2UXCF 4H4KA 2JVRA 4G1QB 2AHOB 1IKYB 3MUMP 2NXCA 4QIEA 2B4UA 2HFUA 2Z2YB 4CT8A 3GTYX 4O23A 3Q8PB 4DR4F 4JI2F 3NMRA 4U9RA 2XY7A 2KXFA 2DH7A 2YWFA 5CYMA 5I42A 5J2PA 2VOPA 1RT4A 1NUEA 1OPIA 3E01B 3RAXA 2GJIA 5J1EA 2R8GA 1QE1A 1BD6A 4IG0A 2J5AA 2PMZD 3BSNA 3BGFA 1N5SA 3BO2A 5DDOC 1A7GE 4HL9A 1AZSA 5EHHA 2LP4A 4CLYA 2R7WA 4F0MA 5HN0A 3RAMA 3PRVA 4QR1A 3TUPA 3VGTA 3M8QA 2C3PA 3C14A 1RWVB 5LXRA 4H4OA 5JMNA 4LF6J 5SZTA 2VODA 1W2IA 1GMWD 4J9OA 4DL5A 2OI2A 3FKBA 3BF4A 1ZH5A 2DHGA 1NHKL 3QJLA 4MMOA 2DRBA 2IJFA 2IM0A 2CQ4A 3QLHB 3OUYB 2EKNA 2GO8A 4TLRA 2R8JA 1ZM2A 5HO4A 1SL2A 3M30A 3K0JA 3D1HA 3B4MA 4DV6F 5KT4A 1H3DA 4K2JA 2ADBA 2PE8A 1XBWA 2CJBA 1S1TA 3DI6A 3ZNUA 2B4VA 3PR4A 5IC6B 4F26A 3Q8YA 2ZD1B 4UW2A 5KFVA 1NSQA 2NZCA 2BANB 2D1CA 4ZJQA 3SQGB 2C2NA 3NGUA 2D9OA 5ETRA 2MHNA 2XI3A 4ZLJA 1RT7B 2XWYA 2HVHA 1BY9A 2QA1A 5K8OA 3B6BA 1U1QA 3MHYA 4JI5J 4MIBA 4LRDA 4CNYA 3HT0A 3A8KA 1IM6A 2QMXA 4WFAQ 3NP5A 3TA0A 1G7CB 3WC0A 1JK9B 2IC3B 1D9DA 2VJUA 1RISA 3LPYA 4C8LA 4C3KA 4LF1A 4K0KF 1GQEA 2FJVA 3G82B 1DQ8A 2AT1B 3D3CJ 5E33A 4WU3A 3KG1A 1HNXF 2JNJA 2L9WA 2VA3A 3AJDA 2E1CA 1U1OA 2FJEB 1GH8A 4RPFA 1U48A 8ATCB 1HPZA 9RUBA 2PI5A 1EQ0A 3IRXB 2WHOA 2B9XA 2W2MP 1HBUA 1IUJA 3WX4A 5LOQA 1WHXA 5KFKA 2ZUGA 4P9SA 2QE5A 1JLEA 1ROFA 1N32F 2ZJQQ 5BR8F 1RT6B 3H4BA 2KG0A 1RT5A 1FWPA 2V4JB 2XQCA 1OS5A 2C3UA 3IP0A 3CJ8A 2AEJA 2EFQA 4O4GB 1OMSA 2HNYA 4G6VB 3D54A 3CCJS 2GFFA 4DV4F 1DTQB 4M94A 2QN6B 3DFEA 2CQCA 3OR1A 2ZWOA 4GKKJ 1R6VA 4ES1A 2HGMA 1Q8BA 5KFCA 1TL1A 2VA2A 2A10A 4FF2A 1OY6A 1RWWB 4JI7J 2HWTA 5HI7A 5K14A 2KJWA 3ILIA 1X5SA 1T94A 4CP5A 1RAOA 4JV1A 4FPRA 4KGZB 1QAXA 1PJ5A 2Q6CA 4WYWA 1IM4A 1U1MA 4IKAA 3QATA 4OZ0A 4KGMA 3J80U 3U7JA 1G2EA 3C15A 4JI0J 1QTMA 3RR7A 4OZJA 5GAHI 4EBDA 3BM7A 3FEXB 3A12A 4M5DB 5F3TA 5CYQA 3TUIC 4KC5A 3AA8A 2PN6A 3NWRA 4RR5A 4LSNB 5L1JA 4L6V3 4NRTA 5EWEA 1DQAA 1R0BG 2OLWA 4MK7A 1KFSA 2OPPA 4MYTA 1S9GB 4AL5A 4DR4J 4HT7A 1N36F 4YMEA 1RTIA 3CCMS 5J2NB 1S1XB 2WBRA 8AT1B 5DG9A 2O01C 4UOCA 2YY3A 1RHRB 4ECXA 1FWLA 4DPXA 3WIVA 3J81Y 1SKUB 3HHLC 2OTLS 2VG7A 2Y1JA 1E6VA 4PQAA 4A8MP 1VQNS 1HFEL 3UD3P 2XEXA 1CSJA 2YNHA 3LA0A 1Q81T 4CO2A 5AXMA 5KFRA 5KT3A 3H5UA 1WC6A 3OTBA 1LWFA 1U1KA 2AX1A 5AJ3F 3CDBA 1T8EA 2QYGA 3E3XA 4L75A 1FRKA 4FNIA 5K8PA 3ET6A 3K5MA 4FBUA 4N47A 2CWKA 3CSKA 2VH7A 2ZNZA 3ZFVA 4GO7X 1TUGB 3A3OB 2H9ZA 3BQ0A 2HQIA 4Q8EA 5LT5A 5CQGA 5D3GB 1Z2LA 2CJKA 4KHPF 2P9GA 3BGOP 3KJNB 1LOUA 1YBTA 2W9BA 2L9DA 3HI9A 3EGWB 1I6JA 1NSKL 4JI8F 1U45A 4OYIA 1VIOA 2DXDA 3E51A 4P74A 2FDNA 1O6XA 2A6MA 3NL0A 5IT4A 4R5PA 1ZM9A 1IKWA 4BHQA 2BVZA 2KHDA 4Y2IA 1T03B 2BMBA 3U1MA 2DY1A 4CIOA 2GGPA 4IR9A 5KFAA 3B82A 2GMHA 1M1GA 3AH6A 2Z58B 1HLWA 2DK2A 2APOA 3KG0A 3N6NA 3PKYA 1FNXH 4EK2A 4L73A 3CJ4A 3M1VA 4UOFA 1KQKA 3QGIA 3RTVA 2BV3A 1HNXJ 3GILA 3A3PB 2XB2D 2HKEA 3TR5A 2KFZA 3ZZTA 3BV8A 1Z2ZA 4WFXA 5IM0A 2PC6A 3CT9A 5IS2A 5GADU 1K0VA 1M5SA 2HHQA 4OZ2A 2ZH8A 2CQPA 3MM5B 3U1NA 2ZOGA 3RBEA 3CVKA 4FVCA 1V5IB 3HFKA 3OVBA 3IWNC 1RHKB 3AOBA 1L3SA 2FJBB 1N32J 2YQ1A 3NNCA 5BR8J 2MSTA 1XN9A 2B6AB 2XMKA 1HR0F 4RW4A 5FD1A 4B3SF 1N88A 2HHUA 4QW8A 4EO8A 4FKXA 2QLJB 2C2MB 1WKKA 2HZCA 4CCHA 4FYXB 2VDHA 4DV4J 4NASA 1U6ZA 2YKAA 2KZZA 4WP8A 4X4TA 1FRMA 1F9EB 3OVSA 3PJWA 2ZE2A 4URGA 4UOGA 3V4MA 1CEZA 2YWKA 4CLZA 3HSZA 1VRUA 1QM9A 1X4HA 3GYGA 1NNDA 4OYBA 4M5KA 4E2FB 3KMQA 1VC6A 3D66A 3FZ2A 1X0FA 3I32A 3CJTA 3VCDA 1FK9B 4OZ1A 4FXVA 1RB0A 3LALA 2V0NA 4ZLLA 4J37A 3UN2A 1KVKA 5E3CA 4UQGA 1SH3A 1FKPB 3GJSB 4ICLA 3TJ9A 3FFIA 2FPHX 3IM9A 5A8KA 5I4MA 1WUUA 3D28A 2MQPA 4OYAA 3GONA 3UNYA 3M8RA 3IFEA 3Q24A 5KFJA 5A8WA 2ZVIA 2ZKUA 2H54B 3AXKA 4QU7A 2XNRA 4ATNA 2LYVA 4DSJA 3GR0A 1V3SA 3THVA 4NA3A 5FJ4A 4WF9Q 1N6QA 3OTOJ 2WRMA 3PRDA 2HIYA 1EX8A 3PNIA 4IUFA 1UVNA 3RR8A 3I0SB 4I2PB 3IC1A 1FFSB 1FTCA 3T1YF 3FMBA 3CD7A 3KDNA 3TAPA 2UUBF 1R31A 1YJVA 4HHUA 3PO4A 3NY0A 1EETB 2OMOA 1ZYQA 3OLBA 3G8QA 1D9FA 3H8YA 4LR9A 4KO0B 1VQ8S 1Y11A 4J9RA 3B8HA 1S7HA 2BUNA 5C2GA 3EYZA 5L38A 3HHLB 4DU7A 2VDIA 2HURA 3WIUA 2ZH4A 2R8KA 3ZZPA 4ZVEA 2KHCA 5B0DA 1UFLA 3P8BB 3KLVA 4B3OA 3CCVS 3M8PA 5HP1A 1YRUA 3BN7A 1DARA 3DYAB 1JB0C 1LW2B 2IA0A 4FF4A 5DM7Q 5KFBA 3OLAA 3VV2B 4WTOB 2MJUA 2VG6A 4IYQA 3VGSA 3I96A 4NRUA 3CWJA 3MMJA 3R2DJ 3R7BB 2IVMA 3GE9A 1KR4A 1TL3A 1PKUA 1S12A 3MR3A 1REGX 2XHWA 4KHPJ 4ID5B 2H3EB 1CJUB 3MEKA 2EKYA 4ILLA 4QCLA 2FJWA 1T9YA 2GA7A 3O2IA 2IDLA 1S97A 2AQ4A 3P5TL 1NK7A 3T41A 2IBKA 1NKCA 2ZC4A 1C0TA 3UPFA 4A46A 3RBZA 5D4OA 2Q43A 1UVJA 3PDNA 2RSQA 2YKNB 1URRA 1XR7A 1Y3JA 3T5LA 4N8NA 1FRLA 2DGWA 2ROGA 2MPUA 4AXJA 2Z2ZA 1HNVA 5J2QA 1F6TA 2DEIA 4TY8A 4F8RA 3QO9B 5LSOA 2VFUA 1PBAA 4ENOA 2CZVC 3IR7B 4M5LA 4DV0F 4TY9A 4LF7F 3DLHA 2R2SA 2V2VA 4DV2J 1OO0B 5FLXY 2DGSA 4ECTA 2E66A 2J9DE 2VQEJ 2EK6A 1S7IA 2RKIB 5GAEU 1S6QA 4W98A 4IR1A 2ZBPA 2OELA 4L74A 4AQYF 1IWAA 4JI4J 4NCAA 3W2WB 3TOQA 1NK0A 1VQ5S 3KHLA 5IQ6A 5HANA 3BQ1A 1RWMB 4X62F 2B51A 1ZTWA 4PKDB 1HR0J 3HVAA 3BB5A 4B3SJ 4OHYA 4BLGA 4RBUA 1HQ2A 1NSPA 3VGUA 2W24A 2IRYA 5J2MA 2B8PA 4N5SA 1YI2S 4UQTA 3UQSA 5KG0A 4B9LA 3SXLA 4F4ZA 1WC4A 3VALA 3MOZA 3BO4A 1VFJA 2ZHOA 5EN1A 4P73A 2IRUA 3E8OA 3RGIA 2DH8A 5GMDA 4QBUA 4C8OA 3MAAA 3MM7B 3QIDA 1KVIA 2UU9F 2DNMA 1HBNA 4RUHA 2ZH6A 1BWEA 2V8VA 2CQ2A 1CQMA 2QLXA 4CO4A 4ZP8A 4QZVB 4WP9A 2DHSA 2AZ1A 2LLZA 1QDUB 3MCOA 4CNZA 3L09A 3D2WA 3ZZYA 1WF2A 3AODA 2HHSA 2V63A 4KJIA 1MMNA 1KHVA 4GKJF 3GIMA 3EXCX 3RBDA 3R97A 3ZZRA 5DLFA 5KFGA 1RABB 5IT0A 4J7CA 3GLJA 2MHEA 4HHHA 1U2CA 4N8OA 1CVJA 1ZETA 2B5JA 4LF4F 2RF2A 1H0HB 1S59A 3VGVA 1VRTB 2SXLA 2WBMA 2I5JA 3AD9C 3QT8A 3NOGA 4CT9A 4LRFA 2E1RA 3DLEA 1G3OA 5L1IA 1RHQB 3KK2A 3DOMB 1I1GA 3CCRS 4I6AA 5C24A 3MGJA 1UZHA 2RRAA 4FXDA 4OFZA 4WK3A 4Z7CA 2HNDB 3NOCA 3RRHA 1HQUB 3E01A 4K4UA 2J76E 5D0EA 3HVTB 3R27A 4Q0BB 4CLLA 2M5YA 1CJKA 5IWAF 1CC8A 2MKYA 3DRRA 2J7UA 3KFWX 3M6UA 2OKQA 3CJ5A 3K57A 2FYXA 4P7TA 5KFOA 1OSCA 2CPDA 4KKOA 3TJAA 1FDBA 2X1AA 4PPDA 1XMOF 2E5LJ 2D3ZA 1X7VA 5DDQC 2WW8A 3IO1A 4QQBA 4FYDA 2J8AA 2DJWA 3FCVA 4NMLA 1NDLA 2DGOA 1IBKF 3A8JA 4NEYA 4KFBA 2LXFA 2RQKA 4QYZK 3NS7B 5CCMA 4IOCQ 4IFVB 2FHOB 3OXLA 3JSMB 3QNWB 2GMJA 1HNIB 3CXCR 1B0VA 3CIZA 4CLUA 5I3UB 2E1MC 4LFBJ 2E5HA 1L3UA 1VQLS 3MECA 2F8HA 4QIFA 3VVUA 2HBZB 4X4UA 2BANA 1XJWB 4ZHRB 3QT6A 2J6UA 3NNHA 2PEHA 2JLFA 1FRJA 4DV0J 3QRQA 1T7PA 2IJRA 2WSCC 1RT7A 3MCSA 4WFZA 2LEPA 2D3OR 1YIJS 1XTZA 2XM3A 3BH7B 5E41A 4DZ6A 5B0AA 3G71S 5DGAA 1YZ6A 3ISZA 5L1KA 2ZBRA 1K0TA 2FHKA 3VAIA 2DB1A 3PACA 4NYZA 3M6WA 2C2OB 2RMLA 4C11B 1RT2A 2XS2A 3DOLB 2G1HA 4X62J 1U1LA 4ANCA 3S7RA 3HFZB 2OD4A 4H4KC 3LO3A 3I9V9 4ILMA 3EVMA 3WZ0A 2MZJA 1VS3A 4ED0A 3CTRA 4NI2A 1RACB 2BZ2A 2VL1A 1T3OA 4DPTA 3T1AA 5GAGU 3O44A 4Q2LA 2GHPA 3MEDB 2FHJD 3ENAA 1SUQB 4EYIB 3HCXA 1NM2A 4LFAF 4EZ9A 1CS4B 5D0RA 1RT6A 2B7BB 2V4JA 2UU9J 2DCLA 1KNZA 3EE3A 1HBMB 1U09A 1SKRA 4ZP9A 4A4JA 1XNRJ 2GVDA 1RQ0A 3PO5A 2LQ8A 1DTQA 4O44B 4ZIVA 3Q8VA 2DCUB 4M5NA 3H2LA 2MZQA 1BQNA 3PM9A 2GQQA 4KGVB 2LEBA 3GIIA 2H5JB 3DDIA 1RWXB 2GAHC 1VLOA 1S1UB 3MFIA 2ZITA 4CLFA 1KKHA 1A0OB 3K8WA 2MMYA 1GXLA 2BBEA 3T1HJ 4Y00A 2U1AA 3W62A 3DCAA 2R2UA 2RT3A 5K20B 4CH1A 4O3PA 1N33J 4Y65A 2HMIA 4H4MA 4ECSA 2DTJA 4OYOA 3DRSB 3CNQP 2EFNA 4LF4J 1FJEB 2G4BA 3OJUA 1XK8A 4HDHA 4JV2A 1YJWS 1GXUA 1TFYA 4CLWA 1C1CB 1X8DA 1D0EA 4LSNA 2GX8A 1FF2A 3M32B 2QSWA 1HWLA 4ZIWA 3W2VB 4X4OA 4J9LA 2AMCB 1JLQA 2K1RA 4X4RA 4DR2F 1RT3B 1GTEA 4K8RA 1XNQJ 1DJ0A 1NB7A 1V3RA 4PXBA 3IA0A 2ROPA 2KM8C 5KG4A 3OL8A 2QG9B 2DGQA 2HQFA 2V67A 1RAJA 2R7TA 2A2DA 3HHDA 5HROB 2RUSA 1W2BR 1I3OB 3KHRA 3W5XA 1U8WA 1MU2B 5BYQA 1XMOJ 1R0CB 2XZWA 5HQLA 3DKDA 1YWXA 3MAHA 3TEHB 2EK1A 2ZEJA 4MFBA 1R89A 4X65F 4U6PA 5JUMA 2N4DA 1IBKJ 1RCXB 3LUYA 3JYTB 1T9TA 2E7XA 3FBCA 3UCUP 2HHHF 3CMQA 3FDSA 3GWCA 1UEKA 3W9JA 1JLAB 3IN5A 4USVA 4WK1A 2JLGA 1S5ZA 2HRTA 4ZPAA 3OTDA 4DCPB 1I51B 3GZ7A 2KRBA 1IVZA 4C0BA 2XWXA 2QTWA 5D3GA 3KKFA 3VAGA 1QVFR 5AXKA 3T5HA 2GIFA 2B4OA 4PWUA 3AY0A 1WC3A 3K58A 4A8KA 3C6UB 4KHRA 2QFJA 5E5NA 1RSCA 5F8GA 3UN5A 3RG6A 1QVGR 4KIAA 4IH6A 3QFWA 1PAUB 1Y10A 1T03A 3W5YA 5ETOA 4U96A 1EJ7L 3UDLA 4DXLA 2LMIA 3L7UA 1Q16B 4B9MA 3CDUA 3SCIE 2BJ9A 3LP1A 3GFYA 3PX4A 3M9OB 2KYZA 4CH0S 4OHVA 4RNHA 4DWIA 1ACMB 4I67A 6FD1A 2HVEA 2HAFA 4CLSA 3FBFA 1DBDA 1I5OB 3QAUA 2RRBA 4QYZJ 1UWBA 2POKA 5K8NA 3C16B 2Z0GA 1M1KT 2HWIA 3QPIA 3RW6A 1KQSR 2L48A 1D8ZA 1HWUA 3G6ES 2DR5A 4LF8F 3H2VE 5ADZA 1Q78A 1X5PA 4PABA 4OI0A 1SIWB 3ILOA 2KB2A 5CYMB 1WC5A 5I42B 1FI4A 2BRKA 5J2PB 5FDLA 1RT4B 1TVRA 2CKWA 2M4MA 2V2KA 3EGVA 3TRGA 5DO2A 5J1EB 3P49B 2UXDJ 1QE1B 4IG0B 1IKXB 3KJVA 1JLFA 2H51B 3HT3A 4OJ1A 2C22A 1AZSB 1MNEA 5D4NA 1DURA 1AA1B 4IRKA 3W61A 3BSCA 4C98A 1UKUA 3NLCA 1RE1B 2XSFA 4DFKA 4HH0A 3BN4A 3SCJE 2XY5A 2CAJA 4EWTA 4X4QA 2VFTA 2CG4A 1UWAA 3U27A 3EX7B 2WSEC 3PIOQ 3M8QB 3T3FA 1UVMA 4IFYB 3C14B 1ZOTA 4H54A 4XO0A 5H9FK 4A47A 4F4XA 4PWDA 2OUGA 3PG9A 4H4OB 2BW7A 3KNGA 2V2QA 2ASDA 1OQ6A 1U49A 4G65A 2DD8S 5EWFA 3NCQA 4ES2A 4DPOA 1FK9A 4TU8A 1NK8A 4FF1A 3EJMA 4WCEQ 3M30B 1KONA 3DGPA 2B3TB 3HJFA 3NG8A 2C28A 1Q8LA 2HFVA 3DI6B 4F2SA 3MXHP 3TAQA 2E5GA 4OI1A 2G0JA 4ID8A 1L3VA 1W25A 5HATA 3SSQA 2CNKB 3OFHA 2Z4PA 2V50A 2G13A 2RQMA 4NL5A 3AT1B 3JQKA 2KL8A 1B0TA 3EMTA 4ETXA 1G6BA 2YNIA 2MKSA 4DR2J 2I0XA 1TUVA 3Q23A 5HAOA 3PRBA 3JAMU 4ZA1A 1RKJA 5IV4A 4XK8C 1N5YA 1FCAA 2P2CB 2R7QA 4AE5A 4MYUA 4F67A 3CCZA 1UZDA 5U47A 3TZXA 4CYUA 1TFWA 3M7VA 2KM8B 1ZM3A 3G86A 5LJ5Y 4NXNJ 2R3VA 4M5JA 4MKYA 2AKWB 4DR5J 4HEA9 2HS0A 1YQHA 3PX0A 4ZCIA 3N9UC 4W90B 2WCXA 4NLWA 3BGRA 1SH2A 3IM8A 2HVIA 2D69A 1HBUB 4M5GA 2LQ9A 3MDFA 4QR0A 1OWXA 4B9NA 1JLEB 2ZZMA 1TKDA 2HHHJ 4DOZA 5RUBA 3QFHA 2E5IA 2AJ1A 2Y1RI 1RT5B 4I68A 4C8ZA 2UUAJ 1DTTA 2AEMA 3RB3A 2W9AA 3I9ZA 4DR3F 1SJ4P 1S4EA 3WDOA 2HVDA 3OHAA 3NGSA 4IG3A 5IXUA 4DR1F 4DEZA 4D3HA 4ID5A 2WB4A 2OPRA 3OR1B 3KXDA 3A1YG 1QSYA 2K7JA 1TL1B 2JJ4D 1KWMA 5IT9Y 2DGXA 3HD1A 5CA5A 3D6MB 2GNKA 2Z8QA 2FUG9 1HI8A 2DHAA 4ITSA 1NJWA 2MQOA 2BOPA 4ZCLA 3BDPA 3D67A 5GAHU 1T11A 2AF6A 1KS2A 2AWZA 1H2UX 3H2UB 1AT1B 3CD0A 1YG0A 1NDCA 3UVJA 2ZZNA 3C15B 2IAJB 2M2BA 2ZNYA 3F0NA 2DH9A 3HHNB 1QAJA 1FHTA 1K9MT 5CYQB 3TVZA 3KLHA 4I7FA 1LFPA 1SC3B 4DPUA 4OZ5A 2R42A 2JFKA 2OPPB 3GCWP 4NZ6A 2EFPA 3W2WA 3ZNJ1 1CQNA 3ETMA 4TQRA 2R7SA 2F8EX 1RTIB 1KTQA 2RB7A 2ZDOA 4TVAB 3OW2R 3PHTA 4MJKA 3CCUS 3DGVA 3NBPA 1NJYA 4CLTA 1VYAA 3EUNA 2J6TA 2CPHA 1CLFA 3DLKA 3IBFB 5E0OA 3W5ZA 3TZYA 1AYEA 2XLIA 1UETA 4O0IA 3CMAS 4DU8A 1S79A 3KNAA 4ZOSA 2VG7B 2UVUA 2IM1A 4OYPA 1E6VB 3CJ0A 1VR6A 5HMZA 2YNHB 3CJRA 2V8GA 1J2VA 1GXTA 2WVCA 4G1IA 3HSDA 4BS2A 4RU2A 3KDOA 2YWWA 1C4CA 5A0YA 3C19A 1XMQF 5CYJA 4LF9J 2PO4A 3ET6B 4JI6J 3W8PA 5KFSA 1YK9A 4J9QA 2XMUA 1YBAA 4WFBQ 2HQ3A 3SFGA 4CWBA 2XMWA 4I69A 2DNLA 3G6YA 3TVYA 2EBEA 2ZJPQ 3OFFA 2DXEA 1HARA 2RDJA 3MM8A 2CPIA 1VQ7S 2XMJA 4WKYA 2YNGA 5A6PA 3BKTA 2LU2A 5JJBA 3CO0P 2W7AA 1JLGA 1K47A 2UXBF 4R5PB 2NREA 5B0EA 4DFMA 1WORA 1IKWB 3F73A 1X9MA 1F2GA 2CYYA 2FC9A 1NB2A 4PXDA 2GGPB 4C8KA 5KFPA 4K4VA 1FA0A 2GMLA 5H9FJ 1VQ4S 2HGLA 3MEEA 2HFOA 1TKXA 4AL6A 1WI8A 1PCAA 2GHWA 4YY3F 3ELHA 2GC8A 1FNMA 3SYZA 5IM0B 2N7CA 3HX9A 4YR3A 2R7RA 1WTBA 4B9SA 3PW7A 4ZJOA 1X5OA 3V5RA 4QYRA 2F5GA 1VC0A 3KLEA 3TO8A 3QGHA 4U95A 3AHPA 2BDPA 3HVTA 2XBPA 3KK3A 3CC7S 2R7UA 3CGIA 2JC0A 3SDEB 1K1SA 5HMWA 2UVRA 3UWTA 5A76A 1GK8A 4FNHA 3B4DA 4HVZA 1B7FA 4RW4B 4TQSA 2LEAA 2WZ1A 4UUXA 5AE1A 5HL7Q 1UFKA 2GHVC 3R8YA 1LK5A 2OSQA 4DR3J 1UVIA 3LWLA 1R0AA 2CJYB 1OQ3A 3OFEA 2L41A 3UCZP 2RHQB 1P9QC 4DR1J 2LCWA 2DR7A 1TV6A 4DV3F 3Q2SC 1JKHA 5C42A 2XYPB 2HBRB 2ZE2B 5DQIA 2RVJA 1VQSA 4AUKA 1JXLA 2QLBB 4NX9A 2KG1A 2AGOA 1P6TA 4IFVA 4DL3A 1Q1KA 2AYEA 1VRUB 4DX8H 4AYBD 3HHEA 4CQ1A 4A8QA 2IHR1 4ZDNA 4ZVHA 1ZAXA 4OZLA 2ZH9A 3ITHA 1APSA 1CJVA 5LXYA 1OSDA 3FSIA 3FFIB 3BBFA 1VQOS 2VC0A 5A8KB 1KLNA 2QFIA 1YRTA 3L4BC 1HKAA 5A8WB 2Y0SD 1Q0NA 2MKHA 5D0GA 4RBVA 3S1TA 2HLTA 2JEFA 2GQCA 4C4WA 2HWHA 3MZIA 1V5VA 3IWXA 2NUHA 3VQSA 3R3TA 4DUTA 3L95X 4LRAA 1U4BA 4B9VA 1N6QB 4DQQA 2I9SA 4C11A 1KLMA 4OI3A 3SSSA 1CPZA 1U6FA 3V4IA 4UOHA 3C3LA 3QRRA 3ZC4A 4ED7A 3KLGA 3OR2A 2HK2A 4YQWA 3X3UA 4C0HA 1XEZA 1LWXA 3ENQA 2GJFA 3D6HB 1YJUA 1UVLA 3S01A 3VVTA 1P1TA 3AJ1A 4UY85 3PEHA 3N01A 4NXMF 1LEOA 3TX0A 1SUQA 5D6GA 2ZC3A 4OI6A 4V19J 3PYGA 2I1RA 5GMEA 4QU6A 3MTKA 2F8MA 1PYTA 4ZITA 5J1PA 3OHBA 5GAGI 2ACMA 4B3OB 4DCOB 3M8PB 3W3SA 4C2MA 5HP1B 4M8LA 1X4EA 3DRXA 2DR9A 1EKRA 1OIAA 4HI2A 1O51A 2DNQA 2BEFA 1XIQA 4URQU 1N34J 2VG6B 2LDIA 4NLDA 1JXEA 4PYAA 5IZHA 3Q22A 1J5EF 1G1XA 1PYSB 3MUVP 4X64J 4KV8A 1WC1A 2R8HA 1EAYC 2Y3YA 2EC2A 2RDDA 2M52A 2E5JA 3UDCA 1T9WA 3DLGA 2MKIA 3VR1A 1PG5B 1SKSA 3AQPA 5CHCB 1QAYA 5KG2A 2HK3A 4DV7J 2BQRA 2EPIA 3R7SB 2PI4A 3KHGA 1N0UA 1HNVB 5LL6d 1IXKA 3IWLA 4B3TJ 5B7WA 1R3NA 3S6EA 1B70B 3HHKA 3JSYA 4YY3J 1FE0A 3HO1A 5KT6A 1C2PA 2UVVA 3NRBA 2V68A 2CUYA 4QIWD 3KUGA 2PFFB 4IO1A 3HD2A 5JXSA 1PBUA 2WVEA 3SEOA 1Y7PA 3SV4A 2EXUA 1OJ4A 4DL4A 1S6QB 3FCHA 2H65B 4MK9A 1ULRA 1J27A 4IOAQ 3HZGA 3M8ZA 3RU0A 1XC9A 3UO0A 1TR0A 2MQQA 4M63A 5CZXA 1ZPWX 3ZTPA 5J2MB 4NZ7A 4DV3J 3KK1A 1RAHB 2CQ3A 4DQPA 3LGNA 2F4VF 5C2CA 3JYTA 1I94F 1JNRB 4JI3J 1TUWA 3EGZA 4ECRA 2XHCA 2DXFA 4WE1A 3MAAB 3NS6A 2YTCA 2E1AA 1T0TV 2D3UA 3BBBA 1HBNB 4OI2A 4F36A 2JWNA 2ALYB 5CD4A 2RU9A 1IJEB 1R8HA 4YUDA 1KP6A 1RAAB 5CZVA 1QSSA 2P8IA 5DQHA 2GV1A 5HQMA 3US5A 4XPCA 4J9PA 2YX4A 3AFGA 2PSZA 3C6UA 1DRZA 4PQUA 1AXQA 2BM1A 2GS8A 4KHMA 1FXDA 2OEJA 2UUWA 8RUCA 3QWUA 1FFGB 2YX1A 4AD6A 1M5VC 5B0GA 3IS9A 3NGTA 2KDOA 1GNKA 1Y4ZB 4V1Ak 4P71A 2CPFA 5MAOA 1WNEA 1AUDA 3ILJA 3LGHA 3PYFA 1SCJB 4QWBA 3GSDA 2L9NA 2HHPA 4IO9Q 3VTIA 2H48B 2B5JB 3WC2A 1BGXT 2BJEA 4DSEA 2RF2B 3FRYA 2CWXA 2Q3PA 2I5JB 4M5HA 2OIHA 3P4UB 5HVHA 1K8AT 3DLEB 4DV1F 4DLEA 1RAFB 1Y5NB 4NXMJ 3KK2B 2ATLA 2OPQA 5C24B 1MLAA 2IDEA 3N0VA 4LR8A 1CJKB 1IKXA 5A6WA 4XPEA 2ASJA 3DRRB 3ZTOA 3PXGa 2X1GA 4R0EA 3DOKA 4Z37A 4ELTA 2ADCA 2QA4G 4EI2A 1LWCA 4ER8A 4KKOB 4LVOP 3Q2TC 1YSJA 4IFYA 2ASYA 1VGYA 2DR6A 1TK8A 1J5EJ 4FP9A 5DZ7A 4DR6F 1S72S 1BLUA 4OJGA 1T9VA 2GJ2A 1RJJA 4KFBB 2RS2A 1AROP 3OT9A 2ZUAA 1OY8A 2VQFF 3QZ7A 2BKPA 1T9XA 1IR0A 3DC2A 1F2HA 3IG1A 2FZGB 2NSBA 1U47A 4RW7B 4I6WA 4OHZA 2ZH1A 1K73T 2CQ1A 5HLFA 3FVYA 4F4KA 1OY9A 3MECB 4U8YA 1WWHA 2NR0A 1O0PA 1VQPS 1NLKL 1H98A 3CPWR 3MPVA 4LQ3A 1KN6A 2XZTB 2YQ0A 3SQOP 3FUYA 3IGVA 3UNGC 1IKVB 2ALZA 1QTNB 3L7OA 2XY6A 1TL4A 3DLJA 1PSDA 2DBBA 2Z2MA 3EVOA 4JI1F 3AB2B 4QWDA 1GMWA 1NJZA 1S6PA 4HKQA 2W2PP 1RA6A 2KO1A 1WSRA 3O1LA 2LKZA 1RT2B 4I56A 2DHHA 2J6SA 3C46A 1E6YA 4DPWA 1RK8A 1C0UA 4R0JA 3QJPA 2OO4A 3MM9A 4NI2B 1TK5A 1VQ6S 5EDWA 2RRNA 2A0FB 3K5NA 1SI9A 2F4VJ 4RNFA 1D1UA 1SJRA 1I94J 1SJQA 3KLIA 3K5PA 3J7A1 4X4SA 3AOCA 1S0NA 5EX3A 1DFDA 3BPDA 4DFPA 4Y2MA 3G9CA 1DY3A 2W7OA 1ZAWA 3FGVA 1FJGF 5LMUF 1WOPA 5F8IA 2GVDB 3PY8A 2YWEA 3OD2A 1FRHA 3D1OA 5KFZA 4A8WA 1WKLA 1R27B 3CEDA 1BQNB 2JLEA 3AQOA 3K8VA 2VJVA 2JL9A 3NGRA 1M5OC 2BR0A 3O6QA 1ZS6A 2GZOA 2HW3A 4EO6A 2F9JA 3CCWA 3P96A 3TQ1A 2E1PA 4NLXA 4C6AA 4NCBA 1X5TA 2HMIB 4ECWA 4H4MB 4LBHA 3H5YA 1M1HA 4ED1A 4ES3A 2IAJA 3K5OA 2V34A 2ZJRQ 3BREA 2Q79A 2ZHBA 5E3PA 5HSPA 2UXCJ 2DO4A 3AD8C 4EYHB 4RUAA 1W7WA 4IOBA 2BABA 4DCJB 1RYRA 2DIUA 2R9LA 3IBCB 2K3IA 4AFFA 3VAKA 2CA9A 1JLQB 4JI2J 2K1RB 2W7PA 1ZM4A 1T95A 2OGUA 2IM3A 1GX5A 5F0UA 1DQ9A 1Y00A 2Y1IA 1D3WA 1AFJA 3BGUA 2BJ8A 5FIIA 2BXJA 4A8SA 4F3QA 1DLOA 3I82A 5HJXA 4L72B 1HA1A 1N5VA 2AJ0A 3R6GB 2HHXA 3MPDA 2QIFA 1M5HA 2YPYA 2F1FA 3AXMA 4RNOA 4DR6J 3L9ZA 3ZZOA 4MFBB 2R7OA 4PUOA 4UZBA 2PDAA 3QWPA 4DL6A 1RAGB 4RZRA 3SFUA 5KFWA 2F3JA 5AE2A 3AA9A 4F3OA 3CD6S 1TAUA 3HVWA 3OL9A 1WEYA 5KG5A 4LMZA 3TJ8A 3BR8A 2FQQB 4NPOA 3JSRA 4WWSA 5HJYA 1UVKA 4DV6J 4Q7AA 1HMVB 2DYAA 3R7NB 3MMAA 2CADA 4B9TA 2V94A 2IA6A 3MPWA 3BR9A 4EGLA 1NZAA 1WACA 2QX0A 2Z57B 3DRPA 2W2NP 3RUBL 2PMHA 2AP6A 1F9FA 5G4DA 3N5BA 3LTOA 4EBCA 4U7UK 1LNQA 4X2BA 1MWQA 2WB1D 4DJBA 4RWXA 4JI1J 1N52B 2VB6A 3HM9A 1TL7A 4OZNA 5LJ3Y 1JJHA 4WJBA 3LP0B 2NXEA 4USUA 2K2PA 3G6VA 1FD2A 2DNYA 1UMJA 1EIYB 1VBYA 3LP1B 1F1BB 2F63A 3Q8QB 5B0CA 4KSEB 2IVFB 4K0KJ 2JEGA 4ZVQB 2IPOB 2D41A 4IH7A 3J7ZT 1R43A 4RUCA 3EGNA 4RBTA 2HLUA 3ILLA 1UWBB 2FLPA 1IR1A 4X66F 5M2RA 4QWAA 1DHMA 4KYZA 4YB6A 1CC7A 1X0PA 1YHQS 2HNZB 3B78A 4J91A 3TQEA 1S77D 2HHWA 1CBKA 3EXYA 3SDEA 3SIPB 4ED3A 5FDLB 4FYWB 1TVRB 3TVKA 1N56A 4KPCA 4C3LA 1U6BA 2VFRA 3M2RA 4MT1A 3KJVB 3C66A 2UZAA 1JLFB 2VV5A 4B3MF 1FJGJ 4DX5A 2EI5A 4UT4A 3UD5A 2OSRA 4ECYA 1PJ6A 2LXIA 1SQEA 4W92B 2COLA 1S4FA 2AV5A 4N41A 4WXWA 2DO0A 1RHJB 2QA2A 2ACYA 2DIVA 2J9EA 5BYSA 5D4PA 4K5RA 1RBOB 2IIHA 4C7QA 3I4HX 3FSXA 2XCPA 4PWDB 2VBZA 4WIIA 2PT0A 3LH2S 5DM6Q 2Q66A 3PFOA 3JXOA 3DNCA 3GFXA 2EC0A 1YRXA 4KRWA 4QPXA 1TZ0A 5EUHA 2WAQD 5F3ZA 4HACA 1JMTA 1PILA 3CMES 2MGZB 1OYEA 2JC1A 1NJXA 1R8BA 3DGPB 1SV5A 1U1RA 1JJCB 5I3PA 5IV3A 1L3TA 4V19X 1N4LA 2F40A 2U2FA 2KZMA 2OAUA 2W1BA 2BQ3A 4OJHA 3KOAA 5F41A 4N56A 3BKFA 4ZPCA 4A8FA 3W1YC 4XIUA 4O3OA 4UUWA 3VAHA 3MMBA 4I4BA 3U02A 1VISA 2XZDB 3I6PA 3IXQA 1NCLA 4ECZA 4WP3A 3MOJB 2ZDPA 4GVBA 1N36J 2YNIB 4BC7A 2PD1A 4HLBA 2E9TA 5L9NA 5LSLA 5KOXA 1N5YB 3LPEA 3QRPA 2LQJA 3GFZA 4DG1A 1TELA 2MZTA 4CYUB 1S0MA 3CCES 2MKCA 1VK8A 3H59A 2QL7B 2FY1A 1GTHA 2ZH3A 2YKMB 2J0SD 2OEKA 2Y0BB 3A8EA 4ZVUB 3O3LA 2BJDA 2GVZA 1N5QA 5A8RB 2G2YA 4P2MA 1VC5A 1NH8A 3PW0A 3TAMB 3BGRB 3C2PA 2Z2LA 2OMLA 1LFWA 4TKTA 5AJ3J 1EARA 2IRXA 2CPJA 1B64A 3QIPA 3NGDA 3CUNA 3CJKA 1N8RT 1DTTB 4P2FA 2IMWP 4ECUA 2M8HA 3M05A 4OYZA 3C8YA 3I55S 4F4YA 1X9SA 5CD4H 4RW6A 1MROA 4IG3B 5F0WA 2P9EA 2NLWA 2OPRB 2EBGA 3I5CA 2QLFB 3BS9A 4K4YA 2YBVA 2DGVA 2NXJA 4JI8J 2EFVA 3N5FA 1UEVA 2JEIA 2LA6A 1PYOB 5IOLA 4MIAA 5KG3A 3THPA 3GU0A 3TARA 3UDVA 2V8PA 2CJ9A 2VG5A 3BBCA 4DSKA 3MEGA 4DDFA 4NLGA 2N3OA 1ZPVA 1AB8A 2LU1A 2Y9HA 1X4CA 2EW9A 1YITS 4YB5A 5KT5A 3HF5A 2BE7D 4J9VA 4F02A 2A1BA 4ILRA 3UVJB 3F44A 3G6XA 1N5TA 4JI5F 4KTQA 4ZPDA 4NLSA 4E8UA 4RLEA 1KSPA 4TXSA 3I0RA 3KLHB 1TKZA 4I7FB 4Y2KA 5F8NA 5D78A 3QT5A 2QO3A 2RJZA 3BKUA 2R7XA 3CJ3A 1TQLA 1YJRA 3KMSA 5ETVA 1MSWD 3EICA 2VOOA 4PXCA 2KFNA 3H5XA 4ZVFA 1HW9A 7FD1A 2Y8WA 2KH9A 2HBYB 1NMEB 2V6AA 2BE2A 4B3MJ 4DF4A 3N4WA 3OBIA 1VMBA 3NBPB 2YKQA 5DG7A 3Q89A 3DLKB 3UN3A 1S1VA 4HT5A 1WOSA 4F50A 3EDQB 1NKBA 2J7KA 1NHUA 4PG6A 3OJSA 1GX6A 1PJ7A 1RWPB 2DNKA 1W26A 4UF4A 5CABA 1N54B 1WELA 4HH1A 5K9FA 3CC2S 2N3LA 5F9LA 1MN9A 4CTAB 5A0YB 4GKKF 2WONB 2VPZB 2NS1B 2R2TA 3IRWP 1KQFB 1S49A 1XR6A 3GMGA 5L9XA 3R5GA 3VQTA 2VBYA 3TI0A 4JV5F 4JI7F 2C2ZB 3DU5A 4XDDA 4L3KA 4KE5A 3MM8B 3TEGA 3GV8B 3QQCD 2YH0A 2MZRA 5KT7A 5DQGA 5GMKa 4M5MA 4GO5X 2YNGB 2IMOA 4MKBA 2A6OA 3M9NB 1J5OA 4EU0A 2NCKL 3LW5C 1JLGB 3RB4A 1YVFA 4NLQA 5KFQA 4FYVB 3T1YJ 3AOAA 4OYMA 2X51A 1X4DA 3DM2A 2N82B 1AFIA 1HD0A 1U1PA 2UUBJ 2XGPA 4DLGA 3M2VA 1BC6A 3JTPA 2UV8A 3MEEB 3OSNA 4RJVA 4PG5A 3ISND 1TKXB 3ENWA 2MKJA 4DI6A 2FVSA 3NEKA 3H4DA 3W66A 3PYDA 4KAIA 1B4SA 1RTHA 1JJ2R 5DG8A 3KLEB 1VRQC 4F25A 1RI7A 3R1LA 4WIQA 3BH6B 2HG4A 3D9BA 4D3GA 2JHEA 3KK3B 1HYSA 3DDKA 4MKVA 5KG7A 1HQEA 4NLTA 4NLVA 4P7VA 5C7PA 1FESA 2ABYA 3CDEA 3TA1A 4Q44A 9ATCB 2RE1A 1HWKA 3Q8SB 4M1KA 2FLOA 2VKZG 3QGGA 5IFMA 2R2RA 1U0HA 2BE9B 3GFHA 5L1LA 2RNEA 1A6LA 4XTTA 3BYPA 2DRDA 1NK4A 3IAS9 4ZLPA 1R0AB 7AT1B 3V81B 1KVJA 1TV6B 1SJ3P 1N0VC 3UFCX 1FT8A 3NS5A 1JKHB 1FDAA 5C42B 2HBQB 1HD1A 3W7BA 4RU9A 5DETA 1WF0A 1LK7A 2JVOA 2HS4A 4HHJA 4ED2A 3C6TA 2XYGB 4OYWA 1VQYA 1RADB 1Q5VA 3L3CA 1RYSA 4RW7A 3TP2A 3ITHB 3I56S 3IMQJ 1CJVB 5HK4A 4U7CA 1LW0A 2YPZA 2KT5A 1ITPA 2DKOB 3WHIA 4LF7J 3DHWC 4TLQA 4A8OA 4X4VA 3N6LA 4J5OA 5EGYA 4UY8T 2DISA 1IKVA 3H7HB 3J7AN 1IR2A 3EDRB 3HULA 4LSZB 4IH5A 4B9UA 1S57A 2OHDA 3J80Y 1GAOA 1TMMA 4AQYJ 2XCAA 1KC8T 4Q8FA 3DDNA 3UE2A 2AU0A 2W01A 1KLMB 2DNOA 3UR0A 3V4IB 3AD7C 3KJQB 1H38A 3KLGB 3OR2B 2PMWA 2XMMA 2BRLA 2I2YA 1BQMA 2XO6A 3H5SA 3N79A 4ZPVR 5HBMA 3PZPA 1RGVA 1UL3A 2QZ8A 1NK6A 1JX4A 2ZFHA 2LVWA 1IBMF 1NHVA 1SIZA 3M6VA 2KJVA 5KT2A 2RQ4A 1IWGA 2MXYA 3NCPA 1S48A 2KU7A 4BWMA 3MD1A 1FFWB 4FN5A 3RBXA 4GVLA 3GJQB 2VKRA 3D7SB 1B0PA 2C3OA 3DU6A 3ZTSA 5E7OB 2RH3A 1H7XA 1EHWA 1SKWA 3L7PA 1WC0A 3V6DA 3OTCA 3G87A 3KWMA 1VDHA 3K7RA 3SBMA 1P8GA 3UI3A 3CJQA 4F7VA 3HSJA 4JV5J 3H20A 1FTRA 2QSFA 1U8SA 2VBXA 3BGLA 2MYFA 1PAEX 3GB0A 4GKJJ 1A9NB 1TP7A 5CCLA 1REVB 2KVIA 4KV8B 4EMDA 4CDIA 1S1WB 5M2UA 3KYLA 1UA0A 4DSIA 2IYGA 2IM2A 2J9CA 4LF5F 2VPYB 1UAWA 2CG8A 1WG5A 3NMAA 1H2TZ 3DLGB 5AXNA 1B99A 2ZOMA 1P9YA 2DT9A 3I5BA 1SC6A 2FHJA 1NJIT 1RT1B 3MR5A 1NO8A 3DMJA 4WU2A 1NPRA 3R5AA 1N48A 4PPZA 4PG7A 2XI2A 1FKOA 1WDDA 2F9DA 1SVDA 6FDRA 1S10A 3TWZA 3W65A 1RTZA 2HQGA 3LP2A 3M8SA 2NZ4A 3OTOF 4L3NA 1NAQA 2AX0A 5G0RA 5THWA 3A8IA 4K50A 2J0XA 4RW8A 2ZH2A 3DHXA 1MN7A 5KFXA 1QSLA 4UZCA 3GCXP 5F9NA 1K44A 4P75A 4X4NA 1KD1T 5E3RA 2B7CB 4LSLA 3MMCA 4KT0C 2OPSA 2CFXA 3ZZ0A 1GMVA 1UFWA 2OP5A 5IWAJ 4CM0A 3PIPQ 4CM2A 3FMWA 2B8QA 4U7UD 2GO9A 4BC9A 1HI0P 3HXMA 2XYHB 3OL7A 4F4WA 1JQGA 1KQGB 5ETMA 4LIWA 3V6KA 1Q5YA 1FEEA 4ZCKA 3HP6A 4CI0B 1HHSA 2CDRB 2M3DA 2DEJA 1VCTA 3FQLA 3KK1B 4Y28C 3PR5B 1VBXA 2W9CA 1U26A 3FCWA 2PGCA 4ZLNA 5KFEA 4QWEA 5KFMA 5C25A 4WE1B 3EPIA 2KFYA 2HPUA 2QA4S 4OX9F 5ITHA 4DS4A 1RXOB 1FX4A 4FDFA 4ERDA 2V5HG 3FZBA 1JLBA 1RAIB 3MURP 5KAKA 2ZH5A 2V9WA 5HQ8A 2WTFA 1HMVA 1XERA 3PJXA 3FJ2A 2LDYA 4TN2A 3K17A 3O5TB 1R8AA 3GPAA 4EEYA 4PQUB 3PVXA 4WFYA 5MLCV 2CQBA 2W25A 4ZJLA 5ETTA 1H7WA 2VU5A 2JOQA 5HMYA 2KKHA 3TZWA 2CNNB 4DSFA 3PX6A 4RW9A 2H5IB 1PO6A 2AJ4A 3LP0A 3IS9B 1IBLF 1SPBP 4JV0A 3RB0A 2W4PA 2BOAA 3PEJA 3W9HA 1RTJA 4P72A 1KRPA 4K4TA 4LUBA 3ZZUA 3N28A 1EP4A 3J7YI 4FBTA 3AB4B 4DV2F 2ZWPA 4JUZA 2RDIA 1HHQA 2HFNA 2NQPA 4ALZA 2DR8A 3Q83A 2VQEF 4LRBA 3ULHA 4WTYA 2YKOA 4HR2A 5H1SV 1IBMJ 4JI4F 1RLCL 4DQSA 1VHIA 1EZZB 3POTA 2FJDB 2HNZA 1C1BA 2OPQB 4LFAJ 2RQCA 1JJ4A 4WKRA 1FJCA 4RX6A 2QL9B 2ATCB 2B43A 1GEHA 3VF0B 4NEZA 2E7WA 3CJ2A 2CJQA 4YP3A 2IJNA 4ZMMA 2K7KA 1U24A 2ERRA 1HI1A 3J7Z5 2YNFA 3NNAA 1UPMB 3UR3C 3DOKB 1LWCB 3Q8UA 4Y3CA 3ZXWA 1F9HA 2CRLA 1FKAF 1XQIA 1WHWA 3JTNA 2IFXA 1XR5A 2CNLB 3B54A 1F5BA 2MKKA 2J0WA 3VAMA 2MDAA 2B9YA 4IQXA 2CXEA 4LF5J 3HVRA 2VZ9A 3QSIA 2WVBA 1JLCA 2O3DA 1YJTA 2ILYA 1UJ6A 2JFDA 2MGZA 4USHA 2P5VA 4K2XA 3RAQA 3IG1B 1UTAA 2P6SA 1TL5A 1RAEB 2VICA 2N7YA 5HLFB 3R6LB 3DXBA 4USTA 2GAGC 1QAIA 2FD2A 1LXNA 2QYCA 2DNPA 3T6BA 5K5MA 2BJ3A 2LQBA 2R8IA 1R7IA 3BEGB 1FE4A 2XC9A 5KFTA 2LA4A 4QJVA 5KTQA 3M4XA 3VWSA 3GIRA 4RKUC 3JSBA 3H90A 5IQQA 3HSGA 1S6PB 5E2QA 4I2QA 3GV5B 4Y0FA 1SJ1A 3ADAC 2VPWB 2FVQA 2V8DA 3PW5A 1E6YB 2YKMA 4PRFA 3SI8A 3KLFB 4MKAA 4LFCF 1C0UB 1CULA 4DUZF 3Q86A 5A8RA 3VAFA 3MM9B 3TAMA 3TW0A 1H73A 4X65J 5T7LB 3EVWA 2OH2A 1WHVA 1SL0A 1L5UA 1ZZFA 3KLIB 1TKTA 4OX9J 1HWJA 5IC4B 2E5LF 1U0SA 2Q1LA 1PC4A 3QT7A 4OHXA 1EKSA 3JS9A 3HLUA 1YBUA 2KVQE 4M5IA 4RNMA 4KQZA 2XMVA 1MWZA 4YDDB 3LANA 4OI4A 3OVAA 4YN3B 2A3JA 4RWWA 3TANA 2MQ8A 3OXGA 1WOOA 3EZUA 1Y5IB 3MM6A 4CO0A 4DBQA 4ED8A 4DL2A 4LFBF 4PWWA 1RWKB 4QWCA 5D77A 2AJQA 1S9FA 2LFVA 1IBLJ 1UJ5A 2CQHA 1VBKA 3GSIA 1T3NA 1HBOA 1JXVA 1FJ7A 4W4MA 2YH1A 1MMDA 2DGTA 1NH7A 2MSSA 3CIMA 5ETKA 2WSFC 2JX2A 1S9EA 4F4AA 1NK5A 4N7TA 2VHGA 2ASLA 1R8CA 3HDSA 4IQMA 3GG1A 2FLLA 3IGNA 2CQDA 3G8SA 4LF8J 1PGZA 1H2VZ 4O0NA 2MTLA 2HGNA 3JTOA 3MAQA 2EEYA 1O8BA 2MJNA 2WOMB 2MB0B 2E9RX 3T5JA 4C97A 2PFDA 1WG4A 2BJ1A 3D3BJ 1RLDA 1QUPA 1NK9A 1SXLA 3K59A 1DLOB 1FX2A 3CE8A 2IBOA 4LQ9A 3GG0A 2JSXA 1QJHA 3GQCA 4YR0A 3NCRA 2CQ0A 3PW4A 5ETPA 2AZ3A 1RP5A 2MQLA 2KRRA 3MWBA 3M2UA 2IVYA 1RTDA 2ZBIA 4ZVRB 1LWEA 1IBCB 1JNZB 3T5KA 2FZCB 5IT9U 4PUOB 2AW0A 2BACA 1XNRF 4IRCA 3LF0A 2LECA 1PC5A 5KFLA 4JBCA 1BXNA 1WKJA 3W8GA 4DS5A 2GW8A 4CTAA 2L3MA 2WONA 4Y34A 1CJTA 4YDXA 1OPZA 1YJ9S 1S6UA 4AT1B 4OX8A 1OYDA 4Y2CA 2I38A 3MMAB 2VC1A 4ZVSB 5H9EK 4DZDA 3T1HF 3F56A 1ICEB 3DRPB 2X3DA 1Q79A 4HTIA 5KFUA 4NA1A 2CQIA 4IDKB 1N33F 1EB0A 4B02A 1S0OA 2CPYA 1FRXA 2X1BA 1TK0A 5T41A 4I0WA 2VFVA 1L3KA 2PIIA 2W4CA 3J81j 1ZZNA 1YLXA 1TL7B 2HZAA 2Y8YA 2J8SA 3F41A 3FEZA 3PFEA 3HPOA 4G1QA 1IKYA 3M9MB 1ZA1B 1KHWA 1Q95G 4YS2A 2C2DA 1RHMB 5BJRA 1YGYA 4XAKA 3SCLE 3PKMA 4LJMA 1RWOB 4ED4A 4BCAA 4LFCJ 3CDAA 3W64A 4DUZJ 5CH7B 3P5BP 4LBPA 4YR2A 1XNQF 3H25A 5DS7A 2DITA 4ELVA 3MFHA 2B9WA 1LV5A 2QMWA 1UPPA 1NSAA 3FEYB 2M8DB 2DNNA 3R9LA 4KY3A 2G0IA 4PG4A 2JDJA 4DPYA 1FERA 3IR6B 2RS8A 2GIQA 3M2RB 1MWYA 1DAXA 4Z7YA 4JP8A 2LQ5A 4ZP7A 1UJ4A 4KBIA 2RU3A 5DDPC 3V81A 4FS2A 2M9KA 1VOMA 3QLHA 5KFFA 3OUYA 3ETOA 3TYTA 1RUSA 2NPIA 3CO9A 1NBEB 4URSA 4Q43A 1FO1A 2NPFA 2NYHA 2ZD1A 2M7SA 4OZ3A 2CJXB 2F7VA 4NLOA 2HFZA 4OL8A 2C2EA 3D6FB 3SQGA 5B09A 4ZVOB 4ECVA 3I87A 2JRSA 4HACB 4C8NA 3FC9A 5L46A 1SV5B 1X31C 4U67Q 2OFGX 1FXLA 3BPSP 4S0MA 3DLBA 2RHSB 3X1LB 3AAWB 3RRGA 1HNWF 2E7VA 1KDNA 3MD3A 5KFDA 4KB7A 1WD6A 3E2EA 3QMQA 5E3AA 2IC3A 1JIHA 3MMBB 5L39A 2H5EA 4JB8B 3DN9A 4QR2A 2KT2A 3G82A 5AE3A 2ILZA 2VPXB 3PHEA 4GVBB 1O5JA 3I4PA 1X4FA 1M5PC 3VAJA 2CPZA 5E3QA 1HIYA 2MEWA 3ENVA 4CZCA 3MR6A 1P27B 4NYOA 2NYIA 3ICLA 3IRXA 4F3MA 2XS7A 4DG1B 1RKIA 4ED5A 3D0IE 4EFAC 5D4LA 1RA7A 5JVGQ 2V4RA 3G2XA 3VZHA 2KXHA 5K8MA 3KHHA 3FBBA 2AGPA 1V6HA 2CVEA 4KH1B 1U02A 2GVZB 4Q5VA 2UXDF 4PEOA 3RZAA 3JQMA 3G4SS 2YX7A 1IJFB 4O4GA 4DMZA 5KFIA 2AJ2A 1VLYA 2AJFE 4B08A 2DNHA 2QGFB 2CNOB 3D4JA 5DJBA 3QIPB 5DLGA 1XMQJ 3CJKB 1Z4UA 1Y9OA 4WFNQ 1Y3KA 3DRYA 2C3YA 4AL7A 3OFGA 1RDRA 2KXNB 2F65A 1MROB 4RW6B 4LT6A 5KOWA 1REVA 2EG2A 5J1NA 3ISNC 1YDLA 2JH3A 4CO1A 1S1WA 2XTJP 4N76A 4BBYA 3LOUA 4UTGA 4B3RF 1KTVA 3JQJA 3U1LA 1RT1A 2UXBJ 4G1PA 2XSJB 2CZ9A 1R8PA 1Q4RA 1NEEA 2NXUA 4LR7A 2VG5B 4M5DA 3MEGB 1UW9A 3HK2A 3NGKA 4NLUA 3I31A 2IYIA 2CIMA 2YQ3A 3TUZC 4KPYA 4OX6A 2B9EA 5HMXA 1CG2A 1S9GA 3MCNA 3A4TA 4O3SA 2K3KA 2MY8A 4K4XA 2BM0A 4DFJA 1M90T 5J2NA 2HRUA 1S1XA 4E0DA 5DGBA 3I0RB 1TKZB 4J9NA 3CF5Q 3MUTP 2C2KB 2M0GB 3KUEA 4FZVA 2D74B 2CVIA 4MH8A 1ZTTA 5LMNF 3FK4A 1X60A 4NXNF 1WG1A 2QJ3A 2EWHA
chains in the Genus database with same CATH topology
3EUNA 3T19A 2CPHA 3J81Y 4DR5F 2J6TA 1CLFA 3DLKA 4GMKA 5H9EJ 2BE2A 4DF4A 3HHLC 5E0OA 2XLIA 2OTLS 3N4WA 3OBIA 1VMBA 3NBPB 2VG7A 4FVMA 1UETA 4R8UB 4WXOA 4O0IA 2YKQA 2Y1JA 5DG7A 3CMAS 3DLKB 1Q7YT 1E6VA 1S1VA 1S79A 2BYCA 3ONQA 2BE2B 4PQAA 3KNAA 2O5DA 4A8MP 1VQNS 1HFEL 3UD3P 4ZOSA 2VG7B 2XEXA 4HT5A 1CSJA 2YNHA 2UVUA 2GIRA 2IM1A 4F50A 1E6VB 1S1VB 1KOOA 1Q81T 4KR0B 4CO2A 5AXMA 1NKBA 2J7KA 5KFRA 3CJ0A 5KT3A 1S99A 5HMZA 3H5UA 5B08A 1T05B 2EFOA 2YNHB 4FS1A 3OTBA 1LWFA 1U1KA 2V8GA 4O3NA 1J2VA 1GXTA 1NHUA 4G1IA 4BS2A 2AX1A 1C4AA 5AJ3F 3DXSX 4NCGB 4PG6A 3OJSA 1GX6A 3CDBA 1T8EA 2DNKA 4DSLA 3E3XA 4RU2A 4ELUA 1N54B 1C4CA 1RWUA 3VZIA 2UUAF 1FRKA 1WELA 4FNIA 5C5JA 4HH1A 5K8PA 3K5MA 5A0YA 5K9FA 3CC2S 2VASA 2N3LA 2C2RA 4FBUA 4N47A 3CSKA 2VH7A 5F9LA 5CYJA 1XMQF 2ZNZA 3ZFVA 4GO7X 3CULA 2PO4A 4CTAB 5A0YB 4GKKF 5KFSA 2WONB 2VPZB 4J9QA 2NS1B 2UVWA 2H9ZA 2XMUA 3FQKA 2R2TA 3BQ0A 3FSYA 2HQIA 3G96A 1YBAA 4WFBQ 3IRWP 4Q8EA 2HQ3A 2Q6BA 1KQFB 3SFGA 1S49A 1XR6A 2XMWA 3GMGA 4I69A 2DNLA 5L9XA 5CQGA 5LT5A 1Z2LA 3G6YA 5D3GB 2CJKA 4KHPF 3TVYA 2P9GA 3VQTA 4M95A 2EBEA 2VBYA 1FVQA 1LKZA 2ZJPQ 3OFFA 1LOUA 3TI0A 4JI7F 4JV5F 2W9BA 1HARA 2L9DA 3HI9A 3EGWB 1I6JA 2V9KA 2RDJA 4JI8F 4A8YA 3MM8A 2CPIA 1U45A 3LAMA 2CQGA 3DU5A 1VIOA 1VQ7S 4XDDA 3E51A 4KE5A 2XMJA 3MM8B 4WKYA 2YNGA 3GV8B 2J7WA 2FDNA 4ZPWR 5A6PA 3NAHA 2YH0A 2MZRA 3NL0A 5IT4A 2LU2A 4R5PA 5JJBA 5KT7A 1X4BA 1ZM9A 2W7AA 5DQGA 5GMKa 1IKWA 4GO5X 2BVZA 4BHQA 2YNGB 2KHDA 4USJC 4Y2IA 1T03B 1JLGA 3U1MA 2IMOA 4O3QA 4ZS6A 2UXBF 4MKBA 4YHHF 3M9NB 4R5PB 5JVHQ 4TU9A 5B0EA 2NREA 4CIOA 1J5OA 4DFMA 2GGPA 4IR9A 1HL6A 5KFAA 1IKWB 3B82A 2GMHA 4EU0A 3F73A 1X9MA 3AH6A 3LW5C 4YOEA 3N6MA 4NA2A 1F2GA 1JLGB 3RB4A 2QV6A 1YVFA 4NLQA 2CYYA 2DK2A 2FC9A 2APOA 2XLJA 3KG0A 4PXDA 5KFQA 2GGPB 1J5OB 4C8KA 3SV3A 3N6NA 5KFPA 3PKYA 1FNXH 3SSRA 4K4VA 1FA0A 3CJ4A 3V6HA 2CPEA 2X51A 1X4DA 3DM2A 3M1VA 2GMLA 2N82B 2E9ZA 1AFIA 1KQKA 5H9FJ 1VQ4S 1HD0A 2VFSA 2HGLA 3QGIA 3RTVA 2BV3A 1U1PA 4DUYF 2XGPA 4OQJA 3GILA 3MEEA 5BYRA 3BSOA 4DLGA 2XB2D 2FHMA 2HFOA 3DM2B 3M2VA 3TR5A 1FRIA 2KFZA 2K8GA 3ZZTA 1TKXA 1BC6A 3JTPA 2UV8A 1Z2ZA 4WFXA 1WI8A 3MM5A 5IM0A 2GHWA 4YY3F 4AL6A 3MEEB 2PC6A 3CT9A 5IS2A 5GADU 2ZH7A 2GC8A 3OSNA 1K0VA 1FNMA 4PG5A 3M2VB 1M5SA 2HHQA 3ISND 1TKXB 3ENWA 3SYZA 4IOCQ 2MKJA 2FVSA 3H4DA 5IM0B 2CQPA 3MM5B 2ZH8A 5D8HB 1HNZF 3TX8A 2N7CA 3HX9A 4YR3A 2C3MA 2R7RA 3JB9k 3UW1A 3U1NA 3T9ZA 1WTBA 3PW7A 4B9SA 2ZOGA 1X5OA 3V5RA 4QYRA 3P3DA 1VC0A 4KAIA 3KLEA 3RBEA 1RTHA 3CVKA 4FVCA 2I8EA 3TO8A 1JJ2R 3HFKA 3JAMY 3QGHA 3OVBA 1JWWA 3IWNC 5GADI 3AHPA 2BDPA 5DG8A 1L3SA 3KLEB 3HVTA 1RTHB 4A48A 1M5KC 2FJBB 3CDWA 2EFGA 2XBPA 1RI7A 3OXFA 4F25A 3KK3A 3R1LA 3CC7S 3NNCA 2B6AA 3HZEA 4PG8A 2HG4A 2R7UA 4D3GA 2MSTA 3CGIA 3V6JA 4O4RA 2JHEA 2A2CA 2G9OA 3KK3B 1XMBA 1XN9A 1HYSA 3DDKA 2JC0A 2B6AB 2XMKA 3SDEB 1K1SA 1HR0F 4RW4A 5FD1A 4B3SF 5HMWA 1N88A 5KG7A 2HHUA 2UVRA 1HQEA 4NLTA 4NLVA 4P7VA 4QW8A 1FESA 3UWTA 4FNHA 2ABYA 3CDEA 4EO8A 3B4DA 4HVZA 3TA1A 1HYSB 1B7FA 4Q44A 3CCSS 2HZCA 4CCHA 4RW4B 4TQSA 4Y6IA 2LEAA 1VHFA 1HQEB 2RE1A 4UUXA 1HWKA 3Q8SB 5AE1A 5HL7Q 3PV8A 4M1KA 2GHVC 2FLOA 1LK5A 2VKZG 2OSQA 1UVIA 3QGGA 3LWLA 1R0AA 5IFMA 2R2RA 1OQ3A 1U6ZA 3GFHA 2YKAA 3OFEA 4HI1A 2L41A 5L1LA 3UCZP 2RNEA 1A6LA 1P9QC 2KZZA 4X4TA 2B56A 2LCWA 2DR7A 5DRKA 3IAS9 4ZLPA 1FRMA 1NK4A 1TV6A 1R0AB 4LIRA 4DV3F 3OVSA 3PJWA 2ZE2A 4URGA 3Q2SC 3SZ2A 3V4MA 3V81B 1JKHA 1KVJA 2CPXA 3QAEA 5C42A 1CEZA 2YWKA 1TV6B 1SJ3P 1N0VC 2ZE2B 2HIQA 3UFCX 5DQIA 1FT8A 3NS5A 3Q8RB 2RVJA 1JKHB 1VQSA 1QM9A 1VRUA 1FDAA 4AUKA 5C42B 1X4HA 1JXLA 1NNDA 4NX9A 2KG1A 1HD1A 3W7BA 2AGOA 1P6TA 4IFVA 4RU9A 5DETA 1Q1KA 4DL3A 2MY7A 2AYEA 4DL0C 1VRUB 3KMQA 1VC6A 1WF0A 1LK7A 2WK4A 2HS4A 2JVOA 3FZ2A 4HHJA 1X0FA 4DX8H 3I32A 4AYBD 3HHEA 2L08A 4CQ1A 3VCDA 5KFHA 4A8QA 1FKPA 5B0FA 1FK9B 4OZ1A 4FXVA 2IHR1 4ED2A 4LF9F 3C6TA 3LALA 3KTQA 2V0NA 4J37A 4JI6F 1VQYA 4ZDNA 4ZVHA 5E3CA 4UQGA 1SH3A 3HHLD 1ZAXA 1FKPB 4ZPTR 2VONA 4OZLA 2ZH9A 3L3CA 4ICLA 3ITHA 2NSCA 3C6TB 1APSA 1S1TB 2P6TA 3FFIA 2FPHX 5LXYA 1RYSA 4RW7A 1OSDA 3FSIA 3TP2A 3GR1A 3ITHB 5A8KA 5I4MA 3D28A 2MQPA 3UD4P 2XS5A 3I56S 3FFIB 5I3QA 4DF8A 3M8RA 2VC0A 1VQOS 5KFNA 3CC4S 3IFEA 5A8KB 4EBEA 3Q24A 4K4WA 4U7CA 5KFJA 1LW0A 5A8WA 2ZKUA 2BQUA 1KLNA 3CCLS 2MZSA 2KT5A 1YRTA 4C9DA 4YB7A 4C3MA 4QU7A 3DHWC 2XNRA 4TLQA 4A8OA 4ATNA 2LYVA 2VBWA 1LW0B 5A8WB 4X4VA 2Y0SD 2MKHA 3GR0A 3N6LA 4RBVA 3S1TA 4DSJA 2HLTA 2JEFA 2GQCA 4C4WA 1V3SA 4J5OA 1UW4A 2EVZA 2HWHA 3MZIA 5EGYA 3THVA 4UY8T 3IWXA 4NA3A 2NUHA 3I5AA 2DISA 5FJ4A 3VQSA 1IKVA 2PA3A 1VQ9S 5I42B 3R3TA 4WF9Q 1N6QA 2WRMA 3I0SA 4I2PA 1VJWA 3L95X 3PRDA 3BDEA 1U4BA 3BO3A 2FC8A 3PNIA 3GV7B 4IUFA 1F5CA 4IH5A 4B9VA 1UVNA 1N6QB 3RR8A 4B9UA 4DR7F 3I0SB 4I2PB 3IC1A 1GAOA 3J80Y 2G0CA 4DQQA 1FTCA 2I9SA 1URNA 1ELOA 3T1YF 3FMBA 4C11A 3CD7A 2XCAA 1KC8T 1KLMA 4OI3A 2HYIB 3SSSA 4Q8FA 3DDNA 3TAPA 1EETA 1CPZA 1U6FA 2UUBF 3UE2A 3V4IA 1R31A 3C3LA 2AU0A 1KLMB 3ZC4A 3KLGA 2ZBCA 4ED7A 1YJVA 3OR2A 4KO0A 3PO4A 2DNOA 1EETB 2OMOA 4YQWA 1ZYQA 3X3UA 4C0HA 3OLBA 1XEZA 3UR0A 3V4IB 3G8QA 1D9FA 3H8YA 3ENQA 1H38A 4P6QA 3KLGB 3OR2B 4KO0B 1VQ8S 4Q45A 2HRYA 2XMMA 4J9RA 1YJUA 4TYAA 2BRLA 3B8HA 3CD5A 2I2YA 1BQMA 3HHLA 3LAKA 1S7HA 4KGKA 2BUNA 3H5SA 1QY7A 3N79A 4ZPVR 5HBMA 3KLFA 1UVLA 3D1QA 1HPZB 3PZPA 3HKZD 3S01A 1P1TA 1RGVA 1UL3A 2FIUA 2QZ8A 1BQMB 3HHLB 5L38A 3EYZA 3AJ1A 4UY85 3PEHA 1NK6A 5HBMB 3N01A 1JX4A 4NXMF 2ZFHA 2LVWA 2ZH4A 1IBMF 1NHVA 1SIZA 3M6VA 1SUQA 2R8KA 2KJVA 3ZZPA 4ZVEA 2KHCA 2RQ4A 5KT2A 3EPGA 1H6KX 5B0DA 5D6GA 5T7LA 2MXYA 1UFLA 3NCPA 2ZC3A 1S48A 1U7LA 2KU7A 4OI6A 4V19J 3KLVA 1Z1ZA 2I1RA 4B3OA 4WZQA 1M0SA 3DYAA 3CCVS 3M8PA 1YTYA 4QU6A 3MTKA 2F8MA 4BWMA 5HP1A 1X4AA 1LW2A 1YRUA 3MD1A 3BN7A 4FN5A 4NYPA 5J1PA 1FXRA 1DARA 3OHBA 5GAGI 2VKRA 4B3OB 3DYAB 3M8PB 3W3SA 1JB0C 1KFDA 4C2MA 2UUCF 5HP1B 1LW2B 2IA0A 1B0PA 4FF4A 2MQNA 2C3OA 4M8LA 3DU6A 5DM7Q 2DRAA 5KFBA 3OLAA 1X4EA 5E7OB 4BWJA 1UEUA 2RH3A 3FNNA 4NLPA 3QYYA 3DRXA 4WYLA 2DR9A 1H7XA 2MJUA 1UP1A 2HNYB 2VG6A 3T9NA 1KOHA 4IYQA 4X4PA 1OIAA 4TYBA 4HI2A 1O51A 1SJFA 4DV5F 2DNQA 1SKWA 3I96A 4NRUA 3CWJA 3L7PA 4URQU 3V6DA 3MMJA 3OTCA 2VG6B 2LDIA 1TAQA 3KWMA 2IVMA 4NLDA 3GE9A 1JXEA 1KR4A 1TL3A 4C8MA 3K7RA 4K5SA 5IZHA 4HDGA 3MR3A 3V6DB 3Q22A 2XHWA 2DVIA 1P8GA 4ID5B 3UI3A 1J5EF 1Q86T 1G1XA 1FDDA 4OLOA 3MUVP 3NWGA 1NRKA 3MEKA 4ELTA 3H20A 2EKYA 1FTRA 4KV8A 2QSFA 1U8SA 2A18A 4ILLA 2FJWA 2GA7A 2VBXA 3BGLA 3O2IA 4QCLA 2MYFA 3GB0A 1S97A 2AQ4A 3P5TL 1NK7A 3LGMA 2R8HA 1A9NB 5K14B 1TP7A 2IBKA 5CCLA 1REVB 2KVIA 4KV8B 1NKCA 1VQKS 2O67A 2ZC4A 1C0TA 3UPFA 1Y0HA 4A46A 1S1WB 2M52A 2E5JA 5M2UA 3KYLA 1U2FA 4J9MA 1UA0A 2YKNA 5D4OA 1HHTP 4DSIA 2IYGA 3UDCA 3DLGA 2Q43A 3VR1A 2MKIA 1UVJA 2IM2A 2J9CA 3PDNA 4QPTA 4LF5F 1SKSA 2RSQA 3AQPA 2VPYB 2YKNB 1URRA 1UAWA 1XR7A 2FVCA 3NMAA 1WG5A 1H2TZ 3DLGB 1Y3JA 5CHCB 3OSPA 5AXNA 2ZOMA 1QAYA 2DT9A 3I5BA 3T5LA 4N8NA 1SC6A 1FRLA 5KG2A 2DGWA 2FGCA 2FHJA 1RT1B 2ROGA 1NJIT 3QO9A 3MR5A 2MPUA 1NO8A 2C42A 3DMJA 3LQVA 4WU2A 4AXJA 1HNVA 5J2QA 1VI7A 2BQRA 2EPIA 3R5AA 4TY8A 4TU7A 1U1NA 2PI4A 4F8RA 3QO9B 5LSOA 3KHGA 3DMJB 1N0UA 2VFUA 1N48A 2HS3A 3K2YA 1HNVB 1WI6A 2CZVC 3IR7B 2BA9A 4PPZA 5LL6d 1IXKA 4DV0F 4PG7A 4TY9A 1Q8IA 3IWLA 5B7WA 4LF7F 1R3NA 2XI2A 1FKOA 2F9DA 3S6EA 3DLHA 3HHKA 2R2SA 3JSYA 2X3GA 6FDRA 1FE0A 1S10A 3HO1A 5KT6A 1C2PA 2UVVA 3NRBA 1FKOB 4QIWD 2PFFB 4IO1A 3LP2A 3M8SA 2NZ4A 4XDCA 3OTOF 4L3NA 5JXSA 1NAQA 2RKIA 1OO0B 2AX0A 2DGSA 5G0RA 5FLXY 5THWA 4ECTA 2E66A 2J0XA 4K50A 1WEXA 3H40A 2J9DE 1NKEA 3SEOA 1Y7PA 3LP2B 2EK6A 2CJAA 1FD8A 3SV4A 4RW8A 2ZH2A 2RKIB 3DHXA 5GAEU 5G0RB 1S6QA 2AGQA 4IR1A 4AQYF 5KFXA 1QSLA 5F9NA 4NCAA 3W2WB 3TOQA 2FB0A 4X4NA 4DL4A 4RW8B 1KD1T 2QLWA 5E3RA 1NK0A 1VQ5S 2B7CB 1S6QB 4LSLA 3FCHA 3KHLA 5IQ6A 3MMCA 4KT0C 2OPSA 2CFXA 3RYLA 4MK9A 3BQ1A 3ZZ0A 1WF1A 1ULRA 4X62F 2B51A 2DNGA 1UFWA 2WOMA 1ZTWA 2OP5A 4PKDB 4LSLB 5GAEI 1QLNA 3MMCB 3HVAA 3BB5A 2OPSB 3AJ2A 3PIPQ 4OHYA 4IOAQ 1F60B 3FMWA 4RBUA 3HZGA 2W24A 3RU0A 2GO9A 2IRYA 1XC9A 4BC9A 1HI0P 3QZ8A 5J2MA 1IQTA 1TR0A 2MQQA 3HXMA 4M63A 4N5SA 5CZXA 1ZPWX 5EWGA 4RNNA 1YI2S 3OL7A 3HKWA 4UQTA 3UQSA 5KG0A 1LXJA 4F4WA 1KEKA 5J2MB 3SXLA 4NZ7A 4B9LA 4FXWA 1KQGB 1P1LA 2YWHA 1GT8A 4LIWA 4F4ZA 4GC7A 2QEXS 3VALA 3MOZA 1IN0A 3BO4A 3V6KA 1VFJA 2ZHOA 5EN1A 3MM7A 3KK1A 1FEEA 2IRUA 4ZCKA 3HP6A 3E8OA 2CQ3A 1HHSA 2DH8A 4CI0B 4DQPA 2M3DA 3LGNA 2F4VF 1ZBTA 4QBUA 5L8RC 4C8OA 3FQLA 1LWFB 3JYTA 3MM7B 3KK1B 1I94F 4Y28C