1F60B

Crystal structure of the yeast elongation factor complex eef1a:eef1ba
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords ELONGATION FACTOR EEF1A
publication title Structural basis for nucleotide exchange and competition with tRNA in the yeast elongation factor complex eEF1A:eEF1Balpha.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f60B00
1XNQF 4GKKF 4DUYF 4DV2F 4OX9F 4DV4F 1QJHA 1IJFB 2KJVA 5IWAF 1HNXF 1J5EF 1B64A 4YY3F 3OTOF 2BVZA 4NXNF 1N32F 4JI1F 4JYAF 2UXCF 1VMBA 4DV6F 2UUAF 1GH8A 4LFCF 1XMQF 4LFAF 4JI3F 1HNZF 4JI4F 2VQEF 4LFBF 4DR2F 1IBMF 1IJEB 2HHHF 4DR5F 1FKAF 1G1XA 4DV1F 4GKJF 5BR8F 1FJGF 4DV0F 4X62F 2UU9F 4DUZF 1RISA 4B3TF 4DR1F 2B7CB 2UXDF 4B3MF 4DR7F 4JI0F 5LMUF 3ZZPA 4LF9F 4X64F 1CQNA 4JI2F 4JI6F 2RJZA 4X65F 5AJ3F 1N34F 4K0KF 2YY3A 4LF7F 1CQMA 4DV5F 1XNRF 4YHHF 2UXBF 2KJWA 4NXMF 4JI5F 2UUCF 1XMOF 4DV3F 3T1YF 2VQFF 4LF6F 4B3RF 2UUBF 2BXJA 4LF5F 3R3TA 4LF8F 1LOUA 4DR3F 5LMNF 1G7CB 4DV7F 4DR4F 4JI8F 4DR6F 1HNWF 1N33F 4JV5F 1F60B 1HR0F 4JI7F 1N36F 4AQYF 4KHPF 1I94F 3T1HF 1IBKF 4LF4F 1IBLF 2E5LF 4B3SF 4X66F 2F4VF 2ZM6F 2B7BB 2J5AA
chains in the Genus database with same CATH superfamily
3W63A 3GG1A 1IVZA 5A8RA 3MPUB 4B9NA 4DU8A 3FBBA 5E33A 3TZZA 1IM4A 3HT3A 2R7RA 2OEKA 2EFNA 2U2FA 4O0NA 3MD1A 4HH1A 1EJ7L 2HFUA 4DUZF 2ROPA 1UAWA 3BM7A 1VRUB 3G87A 3NAIA 3RTVA 4N47A 1FJ7A 1S6PA 1CQNA 2MPUA 4X65F 1Q4RA 2QE5A 1NJYA 2GJ2A 3MMAB 2WSEC 1WC1A 3BN4A 3JQMA 4X4RA 4CH7A 4OYWA 3VAJA 4ZVSB 3GCWP 3K7RA 4ED1A 1RWUA 4ZJOA 4M95A 4C2MA 3CGIA 1LQ9A 1Z4UA 5T41A 4M8LA 1EZZB 3M8YA 3C14A 1IKYB 3WX8A 2XCPA 4ZCKA 4B9VA 3BR9A 4PEOA 1I5OB 4DZ6A 4YR2A 1ZAXA 3C6UA 2J7UA 2KL8A 4CZCA 4QIWD 2XY6A 3MAQA 4JI1J 1RKJA 3ZTQA 2MGZB 3H5UA 1X9WA 2J7KA 2K1RB 1SUQA 3WC2A 1R6VA 1S57A 1J2VA 3DRYA 2MQ8A 8RUCA 2VC1A 2MSSA 1ITPA 1FVQA 1LXNA 2R2UA 2RUSA 4H4OB 5BYRA 1A0OB 4QYZK 2DRAA 1EQMA 1H38A 5CH7B 4KBIA 3W5ZA 3EWGA 2KH9A 1BQNA 4EUVA 2YNHA 1WG4A 2P9EA 2ZH9A 2HVHA 1IQTA 1WEZA 2B4UA 1PC5A 4K8RA 3H2VE 2QL9B 2MQLA 4ZCMA 4ED2A 1UVMA 3CJKA 1U1LA 2JC1A 4W4MA 3FBFA 1RHJB 3MUMP 3CDAA 1TL1A 5K14A 2G13A 4M5KA 2P8IA 1MMLA 5I42B 1J5EJ 1WI8A 2B8QA 2ZJPQ 2UV8A 3ZNJ1 5I3UA 4OI0A 4MIWA 3W2WA 4JP8A 2Z2LA 1XC9A 4ED5A 4DSFA 3IRWP 5ETOA 1GTEA 3PIOQ 1SQGA 2H3EB 5LMUF 3ISZA 1RA6A 3HI9A 4UF4A 4NLVA 1NHVA 2VDHA 1OPIA 3O1LA 1U48A 4ICLB 2G0JA 4Y2AA 3SXLA 4R5PB 1QD1A 1NRKA 1H98A 1G2EA 1LWXA 4YB1P 1DAXA 3GR0A 5DRKA 2LKZA 2W9AA 5IOLA 1YIJS 3Q89A 5M2RA 4J91A 2HNYB 4YS2A 4ATNA 3ZZ0A 5LMNF 3DLLQ 5HL7Q 2LVWA 3MM7B 5KFVA 1TQLA 1IWGA 1KHWA 4NLDA 2MHNA 4XDCA 3MD3A 3PHTA 1N5VA 3EVOA 2GNKA 1FRKA 2ZD1A 1NZ8A 3PFOA 3LTOA 2DGQA 1TK0A 2CQ0A 5AE3A 1IXKA 2DCUB 1NM2A 5KFKA 3ONQA 4ZPDA 4DV6J 2FJBB 4FF4A 1WSVA 4FVMA 1ZZFA 2VL1A 1X4GA 5H9EJ 4DR5F 1YK9A 1RWPB 5D8HB 2HBZB 1D3WA 3UN2A 5B0FA 4WYLA 4PUOA 2E1AA 4UOHA 2UUAJ 1T03B 1LWCB 2VHGA 4YMEA 4E98A 1HQ2A 2KDOA 1KRPA 5J2PA 2Q1LA 4WU2A 2JEGA 4CLZA 1BGXT 3AB4B 1F2HA 4EYIB 2WRMA 4QWEA 1TL3A 3ILJA 2XS7A 1S6UA 2WONA 4NWBA 3DOKB 4IRKA 3CPWR 5KFTA 1P9QC 1FA0A 3DDKA 2YTCA 5HO4A 1UWBB 1RT6A 3CCQS 5E41A 1F5CA 3PX4A 1MN9A 2RHQB 3DKDA 1Q81T 3FMWA 4C4WA 3I5AA 1KS2A 1RT3B 3E2EA 3CUNA 2VKRA 3W2VB 5DM7Q 2ADBA 1Z2ZA 2EC0A 1HMVA 3PJWA 2FHMA 2G0CA 2KHDA 3H4BA 3VAMA 2GVZA 2XZDB 2DH9A 1CULA 2XMAA 1DHMA 3CEDA 5BYQA 2KT2A 5L9XA 4BC9A 2QMXA 4F3MA 8ATCB 3PDNA 2CFXA 5C25B 4RW4A 1T9YA 2KXFA 4UY85 2AJ1A 2HHWA 3P96A 3BPDA 4OIXA 1REVA 4KGMA 4NLSA 5K9FA 2UUBF 1T95A 3JSMB 4FYDA 3M8QA 2DGXA 4TYBA 3VGVA 3JXOA 3T9ZA 2DCLA 4LRAA 5IFMA 3KWMA 4NLYA 4KV8B 1S4EA 3MR7A 1NSAA 1RP5A 1IKXA 2HS3A 4NCGA 3DC2A 1LKZA 2E1PA 1M1GA 3R6LB 4F4AA 3KG1A 5FD1A 3HSZA 3KNAA 1LWFA 3FZBA 2JEFA 2W9BB 2R7VA 5ETQA 4EU0A 1FNMA 1KOOA 4RNNA 4GKJF 2MQQA 1H0HB 4C11A 2XG8A 5LXRA 3FCWA 3D66A 2FYXA 2DYAA 2J9DE 1Q0NA 2M70A 4FXDA 3TEGA 1L3UA 5B0GA 4DV5F 2EW9A 2GMHA 3SMZA 1XMOJ 1LWEA 4I7FB 5F8LA 2OHDA 4KHRA 4F26A 3VWSA 4DU7A 1FEHA 2HVIA 4ZDNA 2HZAA 3PW7A 1FXDA 3K57A 5HROA 4NCBA 2QT7A 2CQGA 1VDHA 4WCEQ 3G96A 1CBKA 2L9NA 1HNIB 1NK8A 4IRDA 2UVWA 3UD4P 3ENVA 4HHHA 3V4IA 4DCJB 2J0WA 1PIEA 3AJ1A 2P5VA 1WF2A 1ZPWX 2YKMA 1SB6A 5C2CA 4X4OA 2I2YA 4JI3J 4X4NA 2ZUGA 2QJ3A 1YJVA 4U9RA 2G1DA 2R3VA 1ZAWA 4CO2A 5GVQA 2MKHA 1L3KA 2FB0A 1SC1B 4OYIA 3I56S 3Q2TC 2WB4A 5L1KA 3L3CA 2DRDA 5J1EB 2JH3A 3IM9A 3L7UA 3K89A 1UW9A 4PXCA 4F0HA 1RI7A 1S4FA 2UUWA 3HPOA 4ZPAA 1YLXA 5D0GA 2M2BA 4JBCA 2XMKA 1N36F 1K9MT 5FLXU 3G6VA 1I1GA 1RWXB 5KFBA 2E1RA 4A47A 3LP0B 1N5SA 3E01B 4WIIA 4X66F 3BDPA 2N3LA 2V2QA 5LSOA 3O3LA 1HA1A 2HVEA 2QZ8A 3CD0A 3RJMB 2IVYA 4IR9A 1DY3A 5L1IA 3TZWA 5D4LA 2Z30B 5IC6B 4Q44A 4KSEB 4PG6A 4YUDA 1OIAA 4IG0B 3FQKA 1S97A 2V4JA 2FTRA 1EIYB 3M32B 3NGDA 3SI8A 3EDQB 3CULA 4AUKA 2DTJA 1FRMA 3N9UC 3PO5A 5KG3A 2HAFA 2F8MA 4IOAQ 3POTA 3W62A 2J9DA 2A18A 2R7TA 2E1MC 5C24B 2Z2YB 5G0RB 1S48A 3J80Y 1D0EA 4FNIA 4IG3A 2X1AA 1FXLA 1DJ0A 2ZBRA 4FPIA 3BKTA 1OSCA 2DHXA 1FKOA 1N5YA 2O66A 3TZXA 1T0TV 1YJRA 2XB2D 5AT1B 1C0TA 3QWUA 2PO4A 3DLKB 4DDFA 5HMWA 3OJUA 1U4BA 1ZPVA 5F0WA 1U1MA 4DSKA 2CJBA 2XY7A 4ZLPA 2MKYA 2HHSA 1FFWB 3OL9A 2YQ3A 1BLUA 5IWAF 3HDSA 1HNXF 4C9DA 2DO0A 3JAMU 1KWMA 1ZM9A 2K7JA 3PJXA 2FVPA 4LFCF 1M5HA 2E5LJ 1N48A 4RUHA 2XMMA 2YX4A 3PRBA 2UZAA 2Z2MA 1D09B 2AGOA 1CJTB 3G2XA 4CT9A 3K8WA 2B43A 1FDNA 2R7SA 2LU1A 4LF1A 3QIPA 2WW8A 1A6LA 1AB8A 4HDHA 3WC0A 4WJBA 2P9CA 4KJIA 2PA8D 1RT4B 1C4CA 4EWTA 4M5LA 4EGLA 3DLGB 3A4TA 1WEXA 5DLFA 4DLEA 1KBRA 3CMQA 4LF8J 2CIMA 3MTKA 2BV3A 5HQLA 2D41A 4NYPA 3DLEA 4U8YA 1OYEA 2VOOA 5ETNA 3BQ0A 2HW3A 2YWFA 3DMJA 3ZZUA 3ZZYA 2W2NP 1P1LA 2EBEA 3O44A 3US5A 4RW7B 2PN6A 2AJFE 3OD2A 3MEEA 1DURA 3CSKA 4WZQA 4IYQA 2AJQA 4F2RA 1ZYQA 1IBMF 2AZ3A 3H2UB 2CUYA 2KO1A 3QQCD 3RR7A 4JB8B 4ZVFA 4UY8T 2H4WB 4LRBA 4ZP7A 2HK2A 5E3RA 2B4VA 2XLIA 1AXQA 3KHLA 2NYHA 5B0EA 3PKYA 1YX2A 5D4NA 4GO7X 3ITHA 4KIAA 4B3RJ 2HKEA 3EPGA 4A4JA 1YSJA 2RU9A 3KHHA 2KT5A 4UQTA 2MGZA 4AE5A 3M9MB 2I38A 2V0NA 2BJ1A 2G2ZA 1TKTB 4ZVGA 1UTAA 2EK1A 4HT5A 2V4QA 3SCKE 1P6TA 2ERRA 1OSDA 1UJ5A 1FNXH 4WIQA 3OVSA 3W5XA 2Z0GA 2FJVA 3N0VA 1RAGB 1OY8A 2QA1A 3BGFA 4OHVA 1UZHA 2W01A 2HG4A 4NLGA 3CIZA 1RISA 2VFSA 1D9DA 4YP3A 1WHVA 3ULHA 4OYBA 2FY8A 3OR2B 3GILA 3BYRA 4GC6A 1LXJA 3QIDA 2FHJA 2W7PA 1WC0A 2WAQD 2W9CA 4M5MA 1S0MA 4KH1B 2CPHA 3QRPA 1HWJA 2PEHA 3CXCR 2J6TA 3GJSB 1U8WA 2IM3A 2LQ8A 4ZP9A 3OR1A 1Q95G 5CD4A 2RRAA 1EB0A 2LQ5A 5KT6A 2ZBCA 1CEZA 3D4JA 1RAFB 3P3DA 3PEHA 5IQ6A 4WYWA 1AUDA 3ILLA 2DIVA 3V81B 4GVBB 4QR0A 1VQ6S 9RUBA 1R0CB 1RTJB 3VAIA 3BF4A 4ETXA 4JYAF 2ZH3A 4CLKA 5HLFB 5C5JA 1NJIT 2VG5B 3L9ZA 3KKFA 3DRPA 4ICLA 5B0DA 2KXNB 1FKAF 1FDBA 2OSQA 2UU9J 1K47A 4JV0A 3V4MA 3NAHA 2FJDB 1NB2A 2Q43A 1N6QB 2QA4G 3CCZA 3CCJS 1Y5NB 5F9NA 2HNYA 4F0KA 1RWMB 3OTEA 2LLZA 1FE0A 3MEKA 4JI5F 4TYAA 1KQGB 3KDNA 5B0AA 3LAMA 1UPMB 2D69A 3A8JA 4M5IA 1A7GE 3KG4A 4IQMA 4K2XA 1WC4A 3FNNA 4FKXA 1G7CB 2IYGA 2XS5A 4DR4F 3GFHA 3D54A 5ADZA 3D6HB 4O3RA 2RRBA 3CDWA 5M2UA 4ED0A 1JXLA 2DNOA 4H4MB 4GKKF 4USVA 3AA8A 5DDRC 1E6VB 1DZ5A 8AT1B 2ATCB 3GU0A 3CJQA 1NSKL 2LDYA 5IM0B 4RU9A 1IR2A 2IM1A 1I51B 3D0GE 3CCUS 3GLJA 1J27A 5AXKA 2XSFA 3MR3A 3RZAA 4L73A 1SIZA 3RYLA 4WKRA 3W8GA 5KFZA 2XULA 1VI7A 4YHHJ 1TL7B 1WHYA 3SFGA 2RDDA 2UUCJ 2GQ2A 1TV6A 3L09A 4MAKA 2A3JA 4HR2A 1LFWA 2ZH5A 1SKSA 4ZP8A 1RHQB 4WK1A 3L95X 1VBKA 1RT3A 5EWGA 3M1VB 2ZKUA 4ES2A 1XK8A 3OHBA 1TUWA 1PYOB 4TU7A 3BDEA 1WKKA 1ZA1B 4KHPF 3SSSA 2ZDPA 3LF0A 2DITA 1NDLA 3MTJA 3MM9B 4K5SA 3O8WA 1SKWA 2XC9A 4I67A 4DUYF 1FDAA 2WHOA 2FIUA 2KJVA 2CG4A 3UNYA 4Z37A 4DSIA 3GIKA 1HI1A 4O0IA 4AL6A 2WSFC 4ECXA 2VQEF 3DOMA 4OMFG 2CPIA 3CDBA 4DG1B 1FJGJ 1IBCB 4X62J 4ZPTR 4KPCA 4DEZA 4HL9A 3BEGB 2JVOA 3DU5A 3JSMA 4V19X 2UXDJ 4DL0C 4EK2A 1NU4A 1QVFR 4L72B 3T5LA 2EKNA 4PG7A 5T7LB 1QSSA 1YHQS 4KV8A 4ZPBA 1OO0B 3DGVA 3JSRA 3VF0B 4USUA 4LQ9A 4LF5F 4Y6IA 4DL2A 4KYZA 3TANA 2W9BA 1R8AA 3SEOA 1AUSL 3A8KA 3IR6B 1HR0F 2E29A 1X8DA 4O3PA 2HEKA 3U02A 4AD6A 2J0XA 1IBLF 4U96A 3KTQA 2EBGA 4S0MA 1RJJA 2DNHA 4F4WA 1PYSB 1S1XB 4ZHRB 3VCDA 4A8OA 1TR0A 1Q86T 3P6YC 1RBAA 2B9WA 2BJ3A 4Y65A 1OY6A 3Q8UA 3G8QA 2CKWA 4JI4J 3KJFB 3NCQA 2GQCA 3ZTSA 3BPSP 2HRUA 4WF9Q 2I5JB 1O0PA 1DTTA 3NS6A 2LA4A 3N5FA 3IWXA 1UZDA 2IBKA 2CVIA 4G1QB 2HQIA 1FE4A 3D1QA 5DQGA 1LK5A 1U7LA 2W4PA 5CXTA 4IO9Q 3KLIA 3OVAA 3KUHA 3H5YA 2MQPA 1K0VA 1HNIA 4OL8A 3CDUA 2CQ3A 2X3GA 4IUFA 2R8GA 3ETMA 1K0TA 3E8OA 1TELA 1X4AA 3HKZD 3GP9A 2Q6CA 2VG6A 2Z4PA 3U7JA 4C3KA 5CYMB 2JFDA 2DVIA 1FVSA 3G6YA 2A10A 4DV4F 1RQ0A 2PSZA 2OUGA 3LP2B 2H65B 4YY3F 2CQHA 2H51B 2RB7A 1PG5B 2KI2A 1XWLA 1SJRA 2NPIA 3ETOA 1VISA 4G1IA 4A8KA 1W7WA 3HVTA 3KK2A 4O44B 3I31A 3OHAA 4MT1A 3TX0A 2ZC4A 4CIOA 2F4FA 2JVRA 3P8BB 1RHUB 4F8RA 1S10A 1Q1KA 2V8VA 4F02A 4I69A 2HHXA 4ZS6A 3NOGA 1TL4A 4X4VA 1NZAA 1GK8A 2OGUA 2XYPB 4EBEA 4LF7J 3SDEB 5JVGQ 1WJ9A 3ZZRA 1VC0A 3KK3A 3FK4A 3PW2A 2HQGA 3N28A 1T9TA 5IZHA 3MMCB 4OLOA 1Y3JA 4J7CA 1Y4ZB 1WDDA 3CCVS 3E01A 3LWLA 1BY9A 5FLXY 4KB7A 3CNQP 2BE2B 1FJEB 4M5HA 2OH2A 1N5QA 4ZLJA 3MEGB 1KFSA 2C3PA 2ZDOA 4OYPA 1REGX 3MMJA 1WHWA 1Q7LB 4WKYA 4AXIA 5KFQA 3NMRA 2EKYA 1RYRA 4ECWA 1YQHA 3WQPA 4DV2J 5LSRA 1JLFA 1HPZB 1V9OA 3DRSB 5GADU 1ZM4A 2Y1IA 2P9GA 3NY0A 1KDNA 4Y2CA 3CTRA 3NLCA 3OV7A 1S1TA 3OFGA 3MM8B 4M5NA 2IJFA 3NBPB 1T9XA 5C24A 2N4CA 2H5IB 2CA9A 3QT7A 1FF2A 2JHEA 2FVRA 3LO3A 1JLAB 1N34J 2R8JA 3I87A 3PM9A 4B3OA 1B0TA 2IVMA 2OPPA 1VCTA 4ZIWA 3DLKA 4E8UA 3Q8PB 2G1HA 4TKTA 1TVRB 2D74B 1QE1B 3I9V9 1IN0A 5KG0A 3NEKA 1YITS 5G4DA 4NE9C 3AB2B 3FEZA 3BGLA 4YR0A 4H4KA 1J5OB 2DIUA 4F0MA 5HQMA 3B54A 3JAMY 4L75A 2C2RA 2ZM6J 3WDOA 1D9FA 3AOCA 3HSGA 4YB7A 3MOZA 1X4HA 2GIQA 1F9FA 4NXNF 4WE1A 1SC3B 3UNGC 5H9EK 2J7WA 1WTFA 3C15B 1M5KC 4OZLA 3HX9A 3IBCB 2V9KA 5LOQA 2QMUB 2QV6A 1EAYC 4DR2F 4GVLA 1KLMA 3X1LB 1L5UA 4DV0F 3GV7B 1HW9A 2CPDA 4J9RA 3DLGA 5D78A 5FIIA 3IG1B 4ANDA 4DR1J 3MAAB 4CM2A 4IQXA 3N6LA 1S1WB 1RYSA 3R7NB 4WFXA 4QCLA 4DN0A 2GVDA 2R7UA 1VS3A 2OTLS 2LXUA 4ECYA 4OI3A 2ZH7A 1SQEA 1FJCA 1SJ3P 1VBYA 5I4MA 1E6YA 2Y1LB 4LBHA 5KFAA 3CO0P 3TAMA 4P52A 1ZM3A 1RWNB 2Y1JA 2DD8S 5GAEI 1MROA 1T11A 4I6YA 2W4DA 1NLKL 2VJVA 1TFYA 5HBMB 2LU2A 2AYMA 4HH0A 3OFEA 3FEYB 4DL7A 4R25A 5HAOA 4RBUA 3MPVA 4HHUA 3Q0AA 3TX8A 5D77A 5A8KB 4P9SA 3I0RB 2B8PA 1SJQA 2F5GA 3U27A 4E2FB 1HHTP 1R8HA 2G4BA 5KFJA 3HFZB 2KFZA 4JI0F 3UE2A 2OPRA 2VPZB 4I6WA 2XMTA 2IPOB 3MOJB 1ZA2B 4OQJA 4QZVB 2MZRA 2CZ9A 4F04B 1B7FA 4EZ9A 1KFDA 3UO0A 2GHPA 3W60A 3D67A 3VGTA 1YBTA 3PTWA 5HATA 4U6PA 3PG9A 3UDEA 1H2VZ 1HBOB 1OYDA 2D9PA 4PXEA 2CZVC 4DF8A 4WFNQ 4FYXB 1XERA 2HBQB 5LSLA 2PC6A 2E5IA 3DCAA 2MSTA 4R0EA 3MUTP 4RNHA 1TAUA 1B64A 3O5TB 5KFCA 4ED3A 2DR7A 4QBUA 1RAIB 3RBEA 1C1BA 4LFAF 1VQNS 1JMTA 1JLGB 3HSDA 1W26A 4YQWA 2CQCA 3IR5B 4L3NA 4X4TA 2M3DA 4DR7J 4LF9J 2LCWA 2OEJA 4JI6J 5CCMA 3JTPA 1WSRA 2FHJD 1F5AA 3RU0A 2XI3A 5KG7A 2LQJA 5F8IA 4DV3F 2AU0A 2RQMA 4CO1A 3R5DA 4LF6J 3K0JA 3BBBA 2GAGC 5AXMA 3MMBA 4KAIA 1B0VA 2OSRA 3BV8A 2DR6A 3HFVA 5I3QA 1K1SA 3S7RA 1M1HA 4ER8A 2U1AA 3UVJB 4MK9A 5E3QA 3ELHA 1S7IA 4OJ3A 4NZ7A 4RW8B 5KFNA 3R2DJ 5KT4A 3QZ8A 5A6WA 3R5JB 4QWDA 1RZMA 3TW0A 2B9EA 3HM9A 2FJEB 5KT3A 1N6QA 2JRSA 4NZ0A 3TVKA 2V8GA 1VMBA 2R8KA 1Y10A 4NASA 2FDNA 1U0SA 1TU0B 1L3TA 2DHAA 4F2SA 4WWSA 2EWHA 3QJLA 4KO0B 4R8UB 3ILOA 2IA6A 5IWAJ 1LEOA 5KFPA 5KFFA 1U6ZA 4TY8A 2R7WA 3VHQA 4Q8FA 3W1YC 4U7CA 3KJVA 4HACA 3BBCA 2VBXA 1X0FA 3PYDA 4KGVB 4B9SA 2AD9A 1JJHA 2JLEA 4RUBA 2AYBA 1RT1B 3DYAB 4QU6A 4DX5A 5K8MA 2UV8G 2HZCA 4MFBA 2CDQA 1JLEB 1E6VA 3GQCA 2KZZA 3C2PA 1U1NA 4ZVQB 3KJNB 4C7QA 1RK8A 1FRJA 4AQYJ 4USKA 3CD6S 4I2PB 3KHGA 5F8JA 2F3JA 5CQGA 2WVFA 4IR1A 4P6QA 5LJ5Y 4K4TA 2ZVIA 1UVIA 2B6AB 2LECA 1OMSA 3M2VA 1WC5A 2NPFA 3OUYB 2OEMA 2VC0A 3LP1B 3BSAA 5DZ7A 3F73A 2RIJA 2VG7B 3HVRA 5BR8F 2DNKA 1TL7A 4B3TJ 2PI5A 4YDXA 1IKWB 3HVWA 4CH1A 5K5MA 4ED7A 2WSCC 4JI2J 3GIRA 3OW2R 4CLPA 1VJQA 2I0XA 3GR1A 3HHLB 1RDRA 1IBMJ 2EG1A 5IT9U 4RNMA 1WTBA 3DGPB 2LQ9A 2V8DA 2MZ1A 1BD6A 4CYUA 1B7YB 3CCRS 2YKPA 3K17A 5KFEA 4CQ1A 3G8TA 4DQPA 2ZH2A 5DQHA 3WIVA 1VLOA 3VQSA 4KPYA 2B56A 1AZSB 4OJGA 1RB0A 3GG0A 2KVIA 4QR1A 2HBRB 1NK4A 3OSNA 3D0HE 5T14A 1TZ0A 2WW4A 1N32J 3DOLA 1NHUA 1FK9A 1FWPA 3IC1A 3M8RA 3EE3A 1LV5A 3HO1A 1PO6A 1GH8A 1AA1B 4QIEA 3A13A 4L6V3 3JSBA 3P5TL 3TAPA 1U2RA 3QWPA 4LBPA 3KLGA 5GAEU 3K58A 3SQGA 4PWWA 2R9LA 2CZ4A 2KHCA 2H9ZA 5KG5A 3IGVA 4RW9B 1U1KA 4URSA 1NK5A 1LW0B 3CWJA 2C2MB 1K73T 2L41A 2CRLA 4PQAA 2ASLA 2G2OA 2BJ9A 3MECB 4U67Q 1S1XA 3KG0A 3FBCA 1P27B 1X5OA 4ZVPB 4X4PA 2KVQE 4B3SJ 3FSIA 2IIHA 3M2UB 2C1EB 3DXSX 1FRHA 2IMWP 2I5JA 1NHKL 3I4PA 4HTIA 2YKAA 1WDTA 4DI6A 1YWXA 2VBZA 3KLFB 3EJMA 2V94A 1Q78A 1UP1A 2YKNB 4LRDA 1X4CA 2HZVA 4O3QA 2V34A 2RF2A 4U7UD 2GHVC 2MLXA 3B82A 2UXBJ 2J0QD 1LW2A 4NXMF 3BO2A 4ETZA 2DGVA 3WHIA 1IR0A 1HIYA 2HFVA 2V8HA 1TL5A 4DR3J 2ACYA 4PWDA 1BC6A 4NLQA 1KVJA 4XTTA 3LP2A 4WP3A 1QVGR 1HNWF 2QA4S 5F3TA 1UVKA 1FTCA 5K8OA 1I94J 2C3UA 1K8AT 3P5BP 1X4FA 3KXDA 4O44A 1Q8LA 1KP6A 3H40A 4CCHA 3Q8YA 3ENWA 5K8NA 4UT4A 2BANB 4YOEA 4NOHA 3NWRA 1HARA 4OX8A 4F67A 5BYSA 1XMQJ 2B4PA 1KVKA 2R8HA 4K4VA 4C8MA 3IWLA 4ZK7M 1LFPA 1CJKA 2R4FA 1TKXB 2W2PP 4V1Ak 3K59A 3NKYA 3M8WA 1RTDB 1C1CB 2RQCA 4K0KJ 2W8KA 2OD6A 2GGPA 1XNRF 3VAFA 2AJ0A 1U1PA 4Y0FA 1HWUA 5KAKA 4OZ3A 2RDIA 4QYRA 1RA7A 1HL6A 1Q79A 3IN5A 3UCUP 1ZAVA 3DHXA 1XR5A 3RB6A 5A0YB 3DRSA 1N33J 1FEEA 4OJHA 5KFMA 1WKLA 1WEYA 3T1HF 2XY5A 4J9OA 4LF4J 1TFWA 3LWMA 3MM8A 2YNFA 4DF4A 3Q2SC 1GMUA 4ELTA 1NUEA 1TUGB 1WOPA 2HLUA 4DQSA 4DPTA 4ZN1A 3AT1B 1NK6A 3OTOF 2ZC3A 3QRRA 4FS2A 3NS7B 2ZVSA 5GMKa 3MR6A 4LFBJ 3GZ7A 2QLFB 4NYZA 3HF5A 4O3OA 5HANA 2O1PA 1I3OB 5AXLA 4W90B 5HP1B 3FUYA 2J76E 2OI2A 4X64J 1UCNA 3AOAA 5AJ3J 2AQ4A 4M94A 3BS9A 1RLCL 1U0HB 3OLBA 4BCAA 1VQKS 2Z2ZA 1NDPA 1DBDA 3LPYA 1J5OA 2WOMB 1NH7A 4CLWA 1OJ4A 5KOXA 4CTAB 3M8PB 3FVYA 1QTNB 3D2WA 2OO4A 1ZTWA 4RZRA 3H20A 1TMJA 2G2YA 2X1FA 1N0VC 2F9DA 2LXFA 1TKZB 1T05A 4XK8C 2XBPA 4LF5J 1U49A 5EX0A 1T9WA 3MF5A 1V3RA 1W25A 2EG2A 4OI6A 4FF2A 2E9RX 3PV8A 3B4DA 2QL7B 3VGSA 3MAAA 3C6TB 1TTHB 4ED4A 5F3ZA 4JI1F 1HR0J 2XMVA 3IAM9 2OPQB 1FRXA 2DHHA 2H5EA 2VPYB 2CPEA 1SC4B 2BJ8A 5KG1A 4RW6B 3MURP 1JNRB 4HKQA 4Q8EA 3OL7A 2HHVA 4K50A 1N0UA 1JKHA 1NKEA 4IH5A 5EWFA 3R7SB 1R8PA 3K2YA 3P4UB 5E7OB 2D1CA 1S59A 5DG9A 3M30A 2ZNZA 5IT4A 3MCMA 1H2TZ 1VOMA 3GFZA 4X84A 3RAXA 1JLBB 3ADAC 4O3SA 4EI2A 3LAKA 1Q8IA 1KQFB 4KY3A 3OFHA 1HWKA 3SCJE 2ZBIA 3FFIB 1RBOB 1B99A 2FC9A 4WZMA 4FNHA 2ADCA 3UDCA 4WXWA 5A8KA 3QGIA 3I0RA 4USTA 2MZTA 1IUJA 4JV2A 4AFFA 2ILYA 3QAUA 5CYQA 3LOUA 2GAHC 1H7WA 4I0WA 3LPEA 3BH7B 4CNZA 4QW9A 1UL3A 2CJQA 2ZWPA 4CWBA 2V9WA 4PAAA 2XYGB 5KT5A 1NMEB 4USWA 2GX8A 1J5EF 2YNIB 3AH6A 3KUGA 3IAS9 1SJFA 4NPOA 3T5KA 5C42B 3T9NA 1U2CA 2YQ0A 5M2PA 1OWXA 5DS7A 2FLPA 1FWLA 3M4XA 1T94A 4A46A 4PXDA 1HBMB 2D7SA 2CQBA 2BQUA 5DGAA 3D6FB 1X9SA 1LK7A 3G82B 3D3BJ 4DFKA 1PILA 1M5PC 1CJVB 2YQ1A 4OYMA 1HBOA 1HFEL 4I6AA 4RO0A 3UD5A 3VZHA 3QFWA 3GYNA 4CI0B 1Q8KA 2Q3PA 2HHTA 4WFBQ 1RT7A 3PFEA 3ZC4A 2ZOFA 4B02A 2IC3A 3CVKA 4Z7YA 1TUVA 1PYTA 2MZQA 2HMIA 4F4XA 4GC7A 2DEIA 4MK8A 2OELA 2VPWB 1FKPB 3H90A 2ZOGA 4HTJA 2HNZA 2CQ2A 4DV6F 3WX4A 4NA2A 5A76A 4P75A 2RILA 4DPWA 1PAEX 2OFGX 1F9HA 2L9WA 1BWEA 1VRTB 2ZE2A 3SV4A 4KFBB 4RBVA 4X4UA 2WK4A 2AGQA 3QATA 3OL8A 4DQRA 3AXKA 1RLDA 4KGZB 2XTJP 3UR0A 3UVJA 2K3IA 1NSPA 1X9MA 4NRTA 3D9BA 4PWUA 3GFXA 3HHLC 2OPSA 5E5NA 1RADB 1BHNA 2UP1A 2GFFA 3CCES 1N56A 4ZVOB 2CJXB 3QPIA 3KLEB 4JV5J 3X3UA 3S8SA 4OHXA 1JX4A 5J2MB 1M5OC 3A3PB 4KO0A 1S6PB 1WORA 3RGIA 4DSJA 2QX0A 1SL0A 3EMTA 3AODA 4LVOP 1WOSA 3I5BA 3HCXA 1IWAA 1U24A 4M5DA 4B9TA 1QSLA 3MPWA 4ZJQA 2POKA 3JYTB 2OAUA 2W2MP 2CVEA 3CF5Q 1PC4A 3PYFA 4C48A 2V6AA 3PKMA 3IA0A 2DR8A 4CLFA 2QTWA 2HNDA 1JLEA 3GYXB 3K8VA 1C0UA 5A8WB 2ZITA 3PEJA 5D6GA 4IKAA 3WBZA 1RTIA 3OJSA 3DU6A 1SUQB 3DLHA 4CO3A 4CLLA 2JLFA 2IAJB 5H9FJ 5DM6Q 2B3TB 2WCXA 3AQOA 3FJ2A 1S9GB 4DZDA 2NR0A 3Q8RB 3LP1A 4DMZA 4TU8A 3T1AA 1SKUB 2QL5B 2F65A 1X5TA 5HQ8A 2EVZA 2L9DA 3NNAA 2AV5A 2NUUG 3GSDA 5IV4A 2YNHB 3QNWB 2V2ZA 3EM1A 3N6MA 5GAGI 2Y1RI 1PJ6A 2HHHJ 3EVMA 2ASYA 4NMLA 2BW7A 5IT9Y 4Q43A 3ZZPA 3CJKB 3TOQA 5U47A 4YFUA 3CE8A 2CDRB 1RSCA 3BYPA 1NJWA 1ZZNA 4TLQA 2VUGA 1U26A 4N77A 1TL1B 1RTHB 5K14B 4I2QB 3I6PA 2H5JB 4QPTA 2BW2A 1XMOF 1BQMA 4TN2A 2I1RA 1HQEA 2DR9A 1X0PA 5I3UB 3W2WB 2N3OA 2ZUAA 2C42A 3LALA 1JJ4A 2AEFA 5FJ4A 3M2RB 4ZVTB 3FSYA 4EBDA 3MI7X 3MAHA 2KT3A 4NLUA 1XNQJ 2Y9HA 2V67A 1HKAA 2IJNA 1B0PA 3IP0A 1HNVB 4USHA 2UXCJ 4OYZA 1R27B 1I6JA 4J9KA 1X7VA 3BN7A 3EDRB 4JI3F 4RW9A 2FJWA 3DXBA 2DNQA 4DV1J 1G4CA 2V63A 5BXIA 3AD7C 1L3VA 4FF1A 2GW8A 2NXUA 1CSJA 4ZOSA 1S5ZA 4GRSA 4K4SA 3HJVA 3J7AN 4QPXA 2WVEA 2NREA 3JTOA 2ZD1B 3KMSA 3Q23A 4I64A 2VONA 2PMZD 4QU7A 4FZVA 3Q86A 2K2PA 1CS4A 3M2UA 4PQUA 2V50A 3I9ZA 2HGMA 1WI6A 3CJ2A 4ZITA 3PYGA 4J9QA 1IBKJ 4PUOB 2BUNA 1CJUA 4N8OA 3KUEA 1VQPS 1EARA 2ZZTA 2WVDA 4P7VA 2YKNA 1WUUA 1QJHA 3FMBA 4KR0B 5ETMA 1Z1ZA 3JTNA 4M5GA 4AL7A 2HS4A 3TZYA 5LT5A 5SZTA 1PSDA 2WONB 2QYGA 3SSQA 3TJ9A 4EO6A 2OFHX 4FYVB 3HFKA 2JWNA 4ZCLA 1S1VB 1U25A 1IM6A 1RT6B 2UVUA 1S12A 3ZZOA 2ROEA 1FD8A 2HWTA 2CNOB 5IQQA 4KRWA 3PIPQ 2AHOB 2RQKA 2VV5A 3UPFA 1UJ6A 3GE9A 3QJJA 1HMVB 3RB0A 2VODA 4JI8J 1X4DA 5A6PA 3CJRA 2XSJA 2GVZB 4J9PA 1NJZA 2MXYA 1SKRA 4DJBA 7AT1B 2VU5A 2W1BA 4OHWA 1S6QA 4AL5A 2MKKA 3F56A 1EETB 4RW4B 1AT1B 3FDSA 3SYZA 3MXHP 1UETA 2AIRB 1Y9OA 1C1CA 2CWXA 1FI4A 4ZPWR 2H1YA 1HNZJ 3BSCA 2O5DA 1IJEB 1W2IA 4J5OA 4CNYA 3ISND 3J7Z5 5ITHA 4QIFA 2W2QP 3MEDB 3QGGA 1S9EB 1DRZA 4B3MJ 2APOA 1F1BB 1IKXB 3IO1A 3ZZZA 1DARA 4KKOA 4ZVHA 1NCLA 2EFQA 3FKBA 1LWFB 4DL3A 1S9FA 4L74A 4LF8F 1M90T 1K44A 4ZN3A 3OTBA 4RX6A 3BGRB 1NPPA 7FDRA 1HD0A 2P6SA 2GV1A 4G6VB 3PHEA 4URGA 2C2EA 2FHOB 2RH3A 4UW2A 1KNZA 5A2QU 4LSNB 2NQPA 5D0HA 1FX2A 2DB1A 2G9OA 1XQIA 3HHKA 1V5IB 2WBRA 3QGPA 2W8LA 1OPZA 3JB9k 1LWEB 4UZCA 4Q0BA 2DNPA 3FGVA 4KC5A 1JB0C 4LIRA 3GJRB 3HVAA 3BJYA 3V6DB 2F63A 4CTAA 5KFXA 1VQYA 2G0IA 1SH3A 2CG8A 1LNQA 1N8RT 1TP7A 1IR1A 3IRXB 3NGSA 5J2QB 3PCOB 4RJVA 3Q8SB 5DG7A 3V4IB 1HYSB 4WPAA 4B3RF 3HKWA 1F3VA 2CPJA 3R9LA 3R1HA 1JLCB 2DT9A 5IT0A 3W5YA 1ZETA 2YVSA 4NRUA 5GAGU 2OPQA 1NDCA 3J81j 3SCIE 2AP6A 2HK3A 1H6KX 4TVAB 5J2NA 4WTYA 1X31C 4OX9J 2LXIA 1UA0A 1RXOB 5KOWA 1EP4A 4I56A 3ZTPA 5D4OA 4DL4A 4USJC 1SPBP 4MH8A 4A8SA 2FZGB 1JXVA 1UEVA 1UVNA 2BE9B 3SSRA 5E3AA 2IM0A 1GAOA 2JL9A 2ASJA 2E5GA 4PYAA 1SV5B 3G4SS 2Q6BA 3CC2S 3A12A 5L9NA 3M6VA 1R8BA 3EGZA 5DG8A 2M8HA 4OYAA 2VQFJ 1R43A 1XMBA 2HBYB 1S0OA 1O5JA 3MCSA 1RAJA 4FYYB 3H0PA 4BBYA 2MQMA 5CABA 3EX7B 1RU2A 1BQXA 1GX6A 2UVVA 2YNIA 2V4JB 4DR6J 1KVIA 1VRUA 4CDIA 3HJFA 2CQIA 4I4BA 3CJ5A 4FKYA 5HI7A 4CP5A 3LUYA 3MMAA 2DJWA 2Y8YA 3POTB 4PABA 4ILLA 1QUPA 2EI5A 4KTQA 2OTJS 3QRQA 2V2KA 2PIIA 2KYXA 2MJNA 1N5YB 1R0BG 2UU9F 4ID8A 5ETSA 1G6BA 1IKYA 1C0TB 1KHVA 2F8EX 3DI6B 1VQ7S 2XS2A 3H2LA 3NMAA 1T8EA 2QLXA 3KNGA 1WOOA 4USIA 4NYOA 2FLLA 3T6JA 3VAGA 3PR5B 4ECUA 2K1RA 4MIBA 2M0GB 4TXSA 2YWWA 4WP9A 1V6HA 2CPZA 3GPAA 2FGOA 2AW0A 1R6YA 2AGPA 1LOUA 4M63A 3HD2A 3C46A 1OQ3A 3E51A 5SUHA 1WG1A 1XNRJ 4H4OA 2E66A 1ZTTA 1RAHB 4EO8A 2NXNA 2FGCA 4JI7J 4PYDA 3ENAA 3MM5B 2W25A 2MKSA 4K5RA 1VRTA 1F0XA 1WG5A 2YNGB 4C8NA 1P8GA 4WBFA 2DH7A 4KFBA 4Y00A 4YB6A 2DXFA 2HFSA 4DPOA 2HVZA 4FBUA 2Q79A 3GV5B 3NOCA 1VQ8S 3MGJA 3PJ9A 4Z2XA 5E3CA 2RVJA 1ZBTA 3TYTA 3DLEB 1AW0A 2GIFA 1HD1A 2BOPA 3RB3A 4O3NA 1XEZA 3OTOJ 1YZ6A 2JNJA 3R27A 4ENOA 3SIPB 5JJBA 5CA5A 3R97A 2C3OA 3DMJB 3QT6A 2LEBA 2JEJA 2CWKA 3W9JA 5I42A 3KLEA 2IVFB 4YHHF 2CQ4A 2ZFHA 4H54A 4C0HA 2XHWA 2RQ4A 2UUCF 3T1YJ 5J2MA 1PBUA 2MDAA 5AXNA 2DNZA 2BJ7A 4K7QA 2YX1A 4DS5A 3MEEB 3MUVP 3KMQA 5KFRA 3CCMS 3PZPA 4CRJA 3OPKA 3M8SA 1RAOA 2EFOA 1Q8BA 2VBYA 3IM8A 3THVA 1UVLA 3W66A 2YKQA 3JYTA 2GMJA 4DLGA 4DPYA 4R5PA 5FDLB 1UFWA 1R8CA 2YBVA 5THWA 3HT0A 4IDKB 3UI3A 1T3OA 5F8HA 4M5JA 3LW5C 1U6FA 3FSXA 3J7ZT 3ITHB 3LH2S 3BKUA 1GXUA 3MM7A 5A8WA 3BBFA 1FJGF 4X62F 2KG1A 4QIGA 1VQSA 2UXDF 4QW8A 4UQGA 2IAJA 3OVBA 2HGNA 3QT5A 3TR5A 1P1TA 1SH2A 3BGOP 2EK6A 1N52B 1X4BA 4ZKAA 2ZH8A 2D3ZA 4P10A 1YVFA 2D3O1 3TQ1A 4ZVRB 2DGTA 3IMQJ 1S9GA 2JX2A 2D3OR 1B4SA 1VC6A 3NXZA 1Q5VA 1DQAA 1Y7PA 4NA3A 1A9NB 2J8SA 2F7VA 1OS5A 4DV7J 1SC6A 4ZPVR 1JWWA 1KOHA 5HSPA 3TUJC 4G3IA 4P73A 2IM2A 4LR9A 4PKDB 1T03A 2C3MA 1LWCA 4FP9A 1SIWB 2MKJA 4DFMA 4QJVA 2M88A 4F4KA 5HJYA 2VA3A 2X7IA 2W9CB 3RW7A 4YN3B 1GNKA 3T5JA 2AX0A 4UTGA 3PW0A 4HI2A 4ZA1A 1H73A 3DOKA 2VFRA 3OR1B 4C97A 4JI4F 1RTHA 4RBTA 3HHLD 2R7XA 4I2QA 2GO9A 4DUZJ 4F3QA 1MU2B 4DPUA 2M5YA 2ASDA 2HQFA 1UWBA 5EGYA 1MG7A 1ICEB 1MWZA 2E44A 4X65J 4ECRA 3RBZA 2VD3A 2QO3A 3W2VA 3T5HA 4CH0S 3M2RA 2DEJA 3R5AA 3D0IE 4UZBA 1JQGA 5IXUA 1TK8A 1FFSB 1FFGB 1F5BA 2KTQA 4K4XA 1URRA 1RT2B 1YJNS 2MZJA 2XI2A 3PY8A 5DLGA 5B0CA 4WP8A 4HVZA 5GMDA 1HNVA 3DRPB 4OLPA 3AAWB 2M7SA 2X3DA 2VFTA 1VQ4S 4FF3A 2FZKB 3Q22A 4OYXA 4NI2B 5C25A 2F8HA 3BB5A 2XLKA 2DNGA 1X60A 1FTRA 2KM8B 2VFUA 4MJKA 4RWXA 5DO2A 1OQ6A 4A48A 1BXNA 1R0AB 3F41A 2ABYA 1CC7A 3IFEA 3BREA 6AT1B 5ETTA 3B4MA 1RU1A 2VBWA 4TLRA 4URQU 1VFJA 3QSYB 1MMNA 2YPZA 1U6BA 1QM9A 1PJ5A 5ETVA 1VQMS 1KR4A 3IBWA 2KKHA 3IXQA 3UCGA 4EEYA 4LF7F 2ACMA 2A1BA 4WFAQ 2CPFA 4OV1A 4KH0B 2BJDA 2ZEJA 3VAKA 3GV8B 2DBBA 3OXGA 2C2DA 2HIQA 4J9UE 4DOZA 1M5SA 4J37A 2RMLA 2VF3A 4OHYA 4OHZA 4LREA 1KEKA 3TEHB 3Q24A 4P2XA 4P2SA 5MAOA 5D15A 4CT8A 4ZVUB 1UA1A 1GXTA 3V6KA 4DV2F 4UOCA 2CJKA 3IS9B 4I7FA 4DPXA 3UWTA 4MK7A 1HI0P 4PCQA 2ILZA 1RAAB 1QAJA 1S1VA 5CYJA 4O4RA 1QY7A 3W65A 4OV6A 2PD1A 1TV6B 5BJRA 1RT5B 5KFDA 2DY9A 2AKWB 1ZH5A 2CQDA 4ECQA 1G1XA 2QLWA 3NGUA 2ZBPA 2IRXA 3TARA 3I5CA 5LMUJ 4C6AA 4ANEA 4ES3A 4M1KA 3DLJA 4RUCA 1N34F 1JIHA 1CQMA 3OTCA 1OY9A 4LJMA 4D3HA 3D1HA 5IC4B 3VGUA 1Y0HA 3T19A 1SJ4P 1EETA 5LMNJ 4PXBA 2HRTA 3R2CJ 2L08A 3QO9B 4Z7CA 3DOMB 2NSBA 1S76D 2GS8A 2HFZA 4DQQA 1HHSA 4ELUA 2BX6A 1SL2A 4A8XA 1N5TA 2IBOA 2N7YA 1KQKA 2ZM6F 5J1EA 3IGNA 1VBZA 1S79A 3MZIA 4XPCA 2E9TA 3MEDA 2ZH4A 1S9EA 2ALYB 3GIJA 4K4ZA 1S6OA 2XWYA 4DR5J 4OJ1A 4TU9A 2FVSA 1Q82T 3M9NB 4DL5A 2H54B 1M1KT 1RAEB 4DR1F 3LP0A 4LQ3A 2WBMA 4DX6A 4V19J 3PW4A 2LQBA 3A3OB 3CB4A 3S6EA 5L1JA 3BGRA 5KFOA 2YY3A 4CLTA 2A6OA 2I9SA 5C7PA 4TY9A 2Z58B 1YJUA 2GJIA 5EHHA 4ZLLA 5KG4A 1PAUB 2YH0A 3EZOA 2MLZA 4IG0A 4LSNA 3M32A 4LR8A 4EBCA 4DX8H 1QLNA 4F3OA 2DNYA 5A2QY 2R42A 1KTQA 1DTTB 1XJWB 2O67A 4OZ1A 2C2OB 1NK9A 2AZ1A 4N7TA 5G0RA 1FRIA 2VIHA 3V6DA 1RUSA 2BMBA 1WHXA 3UCZP 5L8RC 3GB0A 3KLIB 3IRXA 2BDPA 5F8MA 2M9KA 4DCPB 5J2QA 1UEUA 2CQ1A 2B51A 3EICA 4ZLNA 1WF1A 1L3SA 1HYSA 3NNHA 1GXLA 3TVYA 4P71A 2BM1A 1JLCA 2ZH6A 4CLSA 2VG6B 3AOBA 2H48B 2AYGA 1NNDA 4GO5X 2IJRA 2V5HG 5HVHA 2LMIA 2RUGA 3SCLE 3RBDA 2UUBJ 5H9FK 3R3TA 1B70B 4ZP6A 4YEAA 3HP6A 1ZM2A 2FVCA 1EKSA 1RCOB 3C16B 3HVTB 3AJ2A 5DJBA 3KK2B 1CJTA 2GJFA 3KK1B 1QAYA 2FLOA 2Z8QA 1RGVA 4Y2MA 1NSQA 2BE7D 2HFOA 4HYKA 1RT4A 4K4UA 2CAJA 5ETRA 1VC5A 3KK3B 2XYHB 1SV5A 4U8VA 1HLWA 2XO6A 2UVRA 4QWAA 4GKJJ 1NKCA 1TMMA 4J9MA 1YBUA 3UQSA 2V68A 2JZ5A 3N5BA 2XZWA 4DR7F 4F25A 2PI4A 2JEIA 4LF9F 4JI6F 1NK0A 2YX7A 5DDPC 3Q83A 1FX4A 4A8YA 4XPEA 4DV5J 2F9JA 2FC8A 3NGRA 4RW7A 4OFZA 1U8SA 1S99A 3CC7S 3JSYA 1JLFB 4LF6F 4ILRA 2CYYA 5IS2A 1D9AA 1S1TB 2NSCA 1WKJA 5KT2A 2XMWA 2BR0A 1MLAA 5HN0A 4DFPA 2YPYA 2VH7A 4ZIVA 1U09A 3IBFB 2XGPA 1HWLA 4O4GB 1S77D 3FC9A 1YI2S 4DSEA 1CG2A 4B3OB 4NCAA 2OPPB 4A8WA 4N5SA 3DI6A 3D28A 2RAQA 3EVWA 4B08A 1H7XA 2QSWA 4ECVA 3WZ0A 2Y0BB 2HQCA 3GTYX 1RBLA 5KT7A 2BACA 3W8PA 2J6SA 2BKOA 1KQSR 4PG8A 1TKTA 2EXUA 1RWVB 3TI0A 1RWOB 3M6XA 2CPXA 3AXMA 4NLTA 2EFPA 1XTZA 5ETLA 1JLQB 5L38A 3FCVA 2DNMA 3MM5A 4IH6A 3RB4A 4WE1B 3SQOP 2BKNA 2EFGA 2DGUA 2YWGA 2YNGA 2XNQA 1AYEA 1KLMB 1KSPA 3OR2A 2B9XA 2B9YA 1N36J 4AQYF 3I55S 1CC8A 4YDDB 3AA9A 1FHTA 4JV1A 4MMOA 4X66J 3PRVA 2F4VF 3DNCA 2NLWA 3V6HA 2GVDB 2NXEA 2IYIA 3GCXP 2IRUA 4ECSA 4PPDA 4PR6A 4IFVB 4LBIA 3H7HB 1E6YB 3BGUA 3TAMB 2L3MA 3THPA 1MROB 4IFYB 2RNEA 2MHEA 4B3TF 2VOPA 1FXRA 2D9OA 1UMJA 2FLNA 5J1NA 3V81A 4GVBA 2QFIA 4OX6A 4JI2F 1VR6A 1RTJA 2VDIA 4KE5A 1Q7YT 4TNOA 1R31A 4NEZA 1HW8A 2DR5A 5HLFA 4WU3A 5F41A 2AT1B 2VG5A 3VR1A 1S0NA 2ROGA 5FDLA 1N4LA 4IDKA 2ZZNA 1MW7A 2DY1A 6FD1A 2Z56B 3N4WA 4OZNA 3S1TA 4CO0A 3PRDA 2OPRB 3ZO7A 2CPYA 1HNXJ 2KM8C 3K5LA 1N32F 5LJ3Y 1S0VA 2XMUA 1M5VC 4LFCJ 4EZ6A 2BM0A 3S01A 4ECTA 3BR8A 4IOCQ 2R2RA 3TP2A 1UPPA 2XLJA 3QLHB 3RG6A 1GTHA 3PR4A 2AEMA 4WTOB 4H4MA 3SFUA 2HSEB 2X1BA 1DTQB 1Y00A 2Y3YA 5DGBA 1VK8A 1FT8A 2I8EA 3SV3A 4J90A 4ID5B 3KYLA 3CJ0A 3GWCA 1H3DA 2B4OA 3O6QA 1C1BB 4L76A 3BQ1A 4IO1A 2C2KB 5E0OA 4MKVA 2WZ1A 2SXLA 1TKDA 2KRRA 5GAHI 1V3ZA 5IM0A 1Z2LA 1F60B 2CJAA 3AD8C 1BWVA 3CDEA 1HQUB 4WFYA 3KFWX 3TA0A 1YJ9S 4B3SF 5HMYA 1MU2A 4DBQA 3A8IA 2KFNA 2BEFA 2CNKB 5KFYA 4Y3CA 5B7WA 1AFIA 2QA2A 1Q16B 3MMBB 3M1VA 2OJ3A 2GQQA 3EXCX 5D4PA 3CJ8A 3N79A 3CW2C 1ELOA 1RT2A 3MM9A 1YTYA 2RJZA 4X4SA 1VQ5S 3DFEA 3CC4S 2M8DB 2Q66A 2OP5A 5E2QA 2UXBF 4AT1B 2JDJA 2DGOA 1T7PA 2JOQA 4TQSA 4PPZA 4ZMMA 4NI2A 4DS4A 1IQZA 1SL1A 5GADI 2PMWA 2FHKA 1WF0A 4DG1A 2RSQA 3I4HX 3MPYA 4DR3F 3GMGA 5B0BA 3AD9C 2K06A 4A8QA 1R0AA 2FPHX 3V5RA 2QGFB 2PT0A 4OZJA 5GMEA 2QYCA 4TY8B 3DM2B 1I94F 1SI9A 3W3SA 5T7LA 4N76A 1G3OA 3KJVB 4HACB 1NO8A 1IJFB 1S1UB 4LSZB 3ICLA 2KG0A 3TWZA 2GC8A 3D68A 1YJ7A 4DX7A 1XMQF 3NNCA 2E5JA 4OYOA 4HHJA 4ZVEA 1GT8A 1MNEA 3VZIA 3ZZTA 4MFBB 4CM0A 4JUZA 2MYFA 3A1YG 1ZOTA 1PCAA 2QFJA 2C3YA 2DXEA 2NXJA 2GCFA 3J81U 4K0KF 4ZHRA 2DXDA 4Q5VA 3DLBA 2NZ4A 3RRGA 3HZEA 4C3LA 1GX5A 1F6TA 3M2VB 4OZ2A 1GFWB 3W9IA 3CMAS 4XAKA 3IS9A 5CHCB 3LQVA 4IRCA 1N33F 1HBUB 4KT0C 3W61A 3CJTA 1U2FA 3N01A 4Y34A 5EDWA 1H74A 1T9VA 4LSLB 4C3MA 1RT5A 2K7KA 4G1QA 4LF4F 3TUIC 4LF2A 2HRYA 3AHPA 2HFNA 4Y28C 2J5AA 2IFXA 5KG6A 3NL0A 1VHIA 1NK7A 3AY0A 4JYAJ 3DDIA 1SCJB 3WIUA 4CYUB 2VZ9A 3ZNUA 1XR7A 4IOBA 4LVNP 4LFBF 3KLHB 2C2NA 2DNLA 1D1UA 3UDLA 2CADA 2B7CB 2QIFA 2MEWA 5F0UA 1MWQA 1RKIA 5CYMA 4X64F 5LM7E 2F1FA 2HWHA 2KU7A 5AJ3F 3QO9A 2MZSA 2HIYA 5JVHQ 4Q2LA 1ACMB 4MIAA 4JI5J 1UWAA 3OQ2A 1MN7A 2WVBA 3JQJA 2DGSA 3DOLB 1YZ7A 3SZ2A 1FK9B 2VICA 2BABA 5L39A 2M4MA 4RUAA 3HHDA 4RL1A 5LXYA 4RU2A 3UN3A 4DR4J 1GMWA 1XIQA 3VVTA 2MY8A 2RKIB 2HQ3A 2YWEA 3KLGB 3L7PA 4KGXB 1IKVB 1X4EA 5DDQC 3UR3C 5EWEA 3SDEA 3SQGB 1DLOB 3TQEA 2DNRA 3THTA 1UEKA 4RKUC 3VV2B 4GKKJ 3LANA 1NXIA 2N4DA 4Q7AA 2C2ZB 3MMCA 3DRXA 4LUBA 4K4WA 5EN1A 2LYVA 2BE2A 4QWBA 3AFGA 2CJYB 2BJEA 1VK3A 3QT8A 5IV3A 3UW1A 3NWGA 3MEGA 1O8BA 2MY7A 4ILMA 1NAQA 2IDEA 2PMHA 1VIXA 4DWIA 4FS1A 5F8GA 2MKCA 2HGLA 4QYZJ 4ZPCA 1MWYA 3L4BC 3T41A 1HPZA 3CCSS 2WVCA 2MTLA 5KFWA 5E3PA 4QOTA 5ETPA 4K59A 3BH6B 4U95A 1QAIA 3LGMA 4B9MA 1RWWB 2DH8A 2C22A 3NBPA 4UUWA 2JC0A 1YRXA 2K8GA 1VQ9S 1BUXA 3I0SB 1RE1B 5C2GA 3OXLA 4KHPJ 4BHQA 4RNOA 2ZHAA 1JLAA 2R7OA 2FZCB 1FWKA 4OI1A 1VQLS 2OIHA 4HLBA 1M0SA 1NPRA 4KQZA 1VLYA 4DUYJ 1HWIA 2RF2B 4LRCA 1LW2B 5D3GB 4NX9A 1TVRA 3LGNA 1T3NA 3CT9A 1QE1A 5MLCV 1PBAA 1TK5A 2VQEJ 1KN6A 3RBXA 3RW6A 2HQDA 1KKHA 3NRBA 3CJSA 3CCLS 4PWDB 1EQ0A 2LFVA 4ED6A 2A2CA 1U1RA 3ET6B 1FRLA 5GAHU 3C16A 3FZ2A 3GJQB 4Q45A 4H4KC 2ZBQA 4MTPA 3D6TB 3KK1A 4J9NA 3TO8A 2YH1A 2XNRA 2LDIA 4C8KA 4P74A 3C15A 3TJAA 2B5JB 4OI4A 4G1PA 1XN9A 2Y8WA 2YKOA 1NH8A 1S72S 4P7TA 4DN9A 2E1CA 2PE8A 1CVJA 3AQPA 2W4CA 1Y11A 1YKWA 4RLEA 2K3KA 1ULRA 1O6XA 2WB1D 3IG1A 1YDLA 2LEAA 4C8YA 1S1WA 1CJKB 4LRFA 4PG5A 5HK4A 2ATLA 1PKUA 1IBLJ 2P2CB 2R2TA 1VBXA 1RHMB 3PX0A 4MYTA 2DPJA 4I68A 2DRBA 2JLGA 3P49B 2O01C 2QG9B 2GGPB 3H8YA 1U1QA 2R2SA 2X1GA 3BZQA 3JS9A 1RCXB 2M52A 3JQKA 5CD4H 5HBMA 5KFIA 3HULA 2XM3A 4NMXA 2KXHA 4OZ5A 5K8PA 5DZ6A 4NL5A 2N82B 4F50A 1WD6A 2YNFB 5LL6d 2A2DA 2OD4A 4G65A 6FDRA 3D5MA 4BLGA 4RWWA 3DRRB 1U1OA 4B9UA 5I3PA 2EFVA 2QN6B 1B3TA 3F0NA 4O4GA 5L46A 4EMDA 1JXEA 3GJTB 3NG8A 3OT9A 3J7YI 4NEYA 4C0OC 4QQBA 2GHWA 3MR2A 2GMLA 4BC7A 4JV5F 4X2BA 3R1LA 4C0BA 2IHR1 2XQCA 4QR2A 2V4RA 1QUVA 4DV4J 2XMJA 1R3NA 4YY3J 3EZ5A 2HS0A 1QTMA 2BRLA 1P9YA 3IWNC 2XEXA 3NCRA 4U7UK 3MFHA 4CLUA 1JLQA 2ZWOA 3H5XA 4FXVA 2L48A 3V2UC 2LEPA 4XO0A 2ZKTA 3AJDA 3OXFA 2R7QA 4E0DA 4ALZA 3OFFA 2XHCA 1T05B 1KLNA 2KN4A 1R7IA 3W64A 3QMQA 3HZGA 1DFDA 3TVZA 2KB2A 3FBEA 1N88A 1URNA 2Z57B 2RU3A 4NA1A 4F4ZA 4N8NA 3PACA 2XO7A 5HVGA 1JLGA 4MKYA 4DSLA 3H59A 1JK9B 3CD5A 3MWBA 3N6NA 3OTDA 2COLA 4IFVA 2E5HA 1H72C 1HBNB 1JKHB 2IMOA 2J8AA 3O2IA 2ZHOA 4USMA 2DISA 3MM6B 4IFYA 4NLRA 3UN5A 3UFCX 1SH0A 3HHEA 2DGWA 3M30B 5JUMA 3E3XA 3VTIA 3F44A 1MMDA 2UUAF 1KD1T 3U1LA 4KGKA 1JJCB 1CLFA 4MKBA 3G86A 3PO4A 5KTQA 4F7VA 2HHHF 1F9EB 3TA2A 1FNOA 2A6MA 2HWIA 3K5OA 2W7AA 3BQ2A 4RW8A 3C3LA 5A8RB 1Y5LB 4P72A 3EPIA 4PG4A 5D0RA 2KRBA 2HHPA 3EZUA 5CYQB 1WELA 3QSIA 1VJWA 2EC2A 2AWZA 3TJ8A 5AE1A 2MKIA 4AXJA 3MFIA 4O23A 4ELVA 2BYCA 4NLOA 1KTVA 3T3FA 2DK2A 4F4YA 4R8UA 1UKUA 4HI1A 4BWMA 2FQQB 2AEJA 1NDKA 2XWXA 2PA3A 4HT7A 3QJPA 3HMJG 3FCHA 3C8YA 1YG0A 3QGHA 4DHVA 2J0SD 4Y2KA 3M9OB 4XIUA 3T6BA 1XNQF 2P6TA 2YXLA 4FPRA 3Q8VA 4NXNJ 1F2GA 5KFLA 3QLHA 2UXCF 1RT1A 3DYAA 1FO1A 3SBMA 3C14B 2NS1B 1WC3A 2JJ4D 2J9EA 2AJ4A 4DR2J 3QFHA 1DTQA 3H25A 4DV1F 4DV0J 3C6UB 3KHRA 4A8FA 1RT7B 2CNLB 2YWKA 4ID5A 4J9LA 4I2PA 3KLVA 2CJ9A 3BSOA 3EGWB 2IC3B 2PGCA 2HURA 2B6AA 2HMIB 3CD7A 2JFKA 1X5SA 1S7HA 1NPKA 2YWHA 4J9VA 3FEXB 1QDUB 7FD1A 4TQRA 1W2BR 1UFKA 3CMES 1YRTA 3OUYA 5B08A 3LA0A 3ENQA 1HQUA 3GONA 1NKBA 1CPZA 2BXJA 2HNZB 2VG7A 3M6WA 4C8LA 3DN9A 2GO8A 4N41A 4F36A 1WC6A 1IKWA 2D3UA 2RS8A 5D0EA 5JMNA 2HPUA 9ATCB 5KFGA 1BQNB 5CAAA 2ZE2B 4C8ZA 1BMQB 3NCPA 3A3NB 4I1TA 2E7XA 1IBKF 2BZ2A 1GMVA 4K2JA 3HHLA 3MPDA 3DGPA 2KYZA 2OLWA 1JJ2R 4NLXA 2HHQA 1D8YA 4FVCA 5CZXA 2WTFA 2BVZA 2Y0SD 3K5MA 2OPSB 3R7BB 3BSNA 3RRHA 2XCAA 2DHSA 3V6JA 2VASA 4ZJLA 4OI2A 3KJQB 1RHRB 1RACB 1AZSA 3CCTA 5KG2A 4ANCA 5EX3A 4WXOA 3GIIA 4JI0J 2FVQA 1JNZB 1YGYA 2FJXA 4LT6A 3GYGA 2OKQA 3M6UA 4ITSA 1GQEA 2RDJA 3NP5A 3NGKA 5KFHA 2CNNB 4DCOB 3DM2A 2FUG9 2AF6A 3NS5A 4YR3A 1XR6A 2HLTA 3CO9A 3CIMA 2W2OP 4M5DB 2W7OA 1RABB 1VGYA 3ZFVA 1S1UA 4JI8F 1H2UX 3PNIA 2PFFB 4RR5A 2IDLA 3M7VA 1NEEA 2NXCA 5F9LA 2GA7A 4ECZA 1RTZA 1YJWS 1LW0A 4ES1A 1X5PA 5HMXA 3G9CA 5KFSA 2HNDB 1HI8A 3PXGa 5ETKA 1Y3KA 3FRZA 1C0UB 3CJ3A 3MECA 4ZCIA 3J7A1 2KZMA 1SBRA 4W92B 3MR5A 4LFAJ 1HNZF 1RTIB 3HD1A 2F4VJ 4P2FA 1T9UA 2DPIA 5L1LA 3H4DA 2AX1A 5HJXA 3TUPA 3J81Y 4OZ0A 1V5VA 3QZ7A 1FERA 3I82A 4ERDA 1D8ZA 4B3MF 3D7SB 2AYEA 3QYYA 3J7YU 3RR8A 4L3KA 4RNFA 5DDOC 4QWCA 2MLYA 2FY1A 2VKZG 3MHYA 1FDDA 1HBUA 1S49A 4DQIA 4DV3J 4CO4A 2DHGA 2HYIB 4LSLA 4EFAC 1FESA 2DKOB 2JSXA 3KLFA 1SXLA 2VA2A 4RPFA 5J2PB 1NJXA 2J9CA 1VRQC 2HHUA 3OSPA 1TL3B 1O51A 3TAQA 1TAQA 2MMYA 4YB5A 3ZXWA 3KLHA 2QLJB 4C8OA 2MJUA 2HVDA 3UD3P 4K4YA 3A8EA 4MYUA 1WWHA 1BQMB 4W98A 2B0GA 2E9ZA 4Y2IA 1FD2A 2QC3A 1HQEB 1RHKB 3NGTA 3ZTOA 3R5CA 4KHMA 5CZVA 5JXSA 2LP4A 2UUTA 2PFDA 2NCKL 4FXWA 2EEYA 1U02A 4FBTA 5B09A 3I96A 4JOUA 3LGHA 3M05A 4FDFA 2MB0B 2NYIA 3PYEA 2RKIA 2XZTB 2BANA 2ZJQQ 1IKVA 1CULB 1Q53A 4OX7A 3VALA 2LA6A 3VQTA 2CQPA 1DLOA 1V3SA 4ED8A 1KONA 1Y5IB 2HAIA 1TKXA 3TNVA 1HHQA 3MCNA 4B17A 1GMWD 4WFZA 4DXLA 1RTDA 3ISNC 2VPXB 3FRYA 1REVB 4HEA9 3HXMA 1UW4A 2IY5B 2E5LF 3M8QB 5KFUA 4Q2MA 4CLYA 2C28A 4OX9F 5EUHA 5J1PA 3TA1A 1C4AA 4FYWB 3I32A 1VQOS 4NCGB 2R8IA 3RAMA 5A0YA 1CS4B 4PQUB 5BR8J 3B78A 3EUNA 4CO5A 2ZNYA 3GSIA 2NUHA 1DQ8A 3CCWA 3FQLA 3G6ES 4NLWA 2ZJRQ 1CJUB 2NZCA 1NBEB 3H42A 1AROP 3I0SA 1N54B 2XGQA 4NLPA 2KJWA 1DQ9A 1AFJA 1K1QA 4C11B 2VQFF 2PEBA 1KC8T 4B9LA 2E7VA 2MQNA 3W9HA 1UVJA 3H5SA 3BKFA 2RHSB 2GZOA 4X4QA 2ZOMA 4DR6F 5CCLA 5D3GA 2I6WA 5HP1A 1MSWD 3TUZC 1Q5YA 3TRGA 1U0HA 2RD5C 3KOAA 2ZH1A 3DHWC 3MCOA 4PRFA 5HVFA 3OBIA 2WOMA 3ZTRA 3EYZA 2BKPA 4A8MP 3M8PA 5HROB 2RS2A 3ET6A 3PW5A 3OL6A 3C19A 4AYBD 2RE1A 3UDVA 4QIVA 1EX8A 2BOAA 3EGVA 1UFLA 1TKZA 4DFJA 1T02A 3R6GB 2B5JA 4PZVA 2XSJB 3BO4A 2QMWA 2YKMB 2IA0A 2V69A 3C6TA 1S6QB 3DDNA 2V2VA 3B6BA 4BDPA 2F40A 2PDAA 3RAQA 4MKAA 3R5GA 2CXEA 4RW6A 3K5PA 2X51A 2BBEA 4UOFA 2N7CA 2A0FB 3PVXA 3VVUA 4JI7F 2KFYA 1SVDA 3G71S 3G6XA 1SQFA 1XBWA 2FJAB 3U1MA 3QAEA 4J9SA 3HLUA 2QEXS 1NB7A 4XDDA 4IH7A 3G8SA 1JLBA 4KKOB 1UJ4A 2BQ3A 2IRYA 4GMKA 2J6UA 1YRUA 1PJ7A 3FFIA 3R5BA 4BS2A 1ROFA 1C2PA 2ZHBA 3PX6A 3EGNA 4HDGA 4D3GA 1BE4A 2AMCB 2QSFA 3DRRA 2BA9A 2VJUA 3IR7B 3GFYA 2ALZA 3C66A 4R0JA 3M8ZA 3W7BA 3EXYA 1YJTA 1VYAA 3OLAA 2VFVA 5RUBA 4EYHB 4NXMJ 3T1YF 3U1NA 5C42A 2RRNA 3KDOA 4FN5A 2ZZMA 2AJ2A 4Q0BB 1HBMA 1GEHA 3VAHA 2DO4A 1EKRA 1VHFA 3J80U 1APSA 3QBCA 1HNWJ 4NZ6A 3CJ4A 2V8PA 3R8YA 1SJ1A 5DETA 4P2MA 3G82A 4IG3B 4BWJA 2E7WA 3H98A 3L7OA 3HSJA 2BRKA 1CJVA 1FKOB 4UUXA 1U47A 2QRRA 2EPIA 1VIOA 2OMLA 1WNEA 3MDFA 3ILIA 1F3FA 2H4YB 4DUTA 3HK2A 3HHNB 2QLBB 2MQOA 5AE2A 1U45A 5HMZA 2RT3A 1ZS6A 5K20B 3D1OA 2DNNA 1PGZA 3RUBL 4C98A 3RRKA 1WACA 2VB6A 5H1SV 1FKPA 5J2NB 4UOGA 4LMZA 3D6MB 4LR7A 4WK3A 1QAXA 1RWKB 1HBNA 3D3CJ 5DQIA 1YBAA 4LIWA 2GIRA 3P45B 1EP4B 3MM6A 4DL6A 2W24A 1QSYA 2O3DA 3BO3A 2BQRA 1FCAA 3QIPB 4DV7F 3GIMA 3B8HA 1EHWA 4N56A 3K5NA 3T1HJ 5F8NA 2OMOA 1R89A 2FD2A 3Q8QB 2B7BB
chains in the Genus database with same CATH topology
1MU2A 4DBQA 3GG1A 2KFNA 4P7VA 2YKNA 5A8RA 1QJHA 5LSRA 4B9NA 1JLFA 3FMBA 1HPZB 1V9OA 3DRSB 4KR0B 5GADU 5E33A 1ZM4A 2Y1IA 5KFYA 1Z1ZA 1IM4A 3HT3A 2R7RA 3JTNA 2EFNA 2P9GA 2U2FA 4Y2CA 4Y3CA 5B7WA 4AL7A 3CTRA 3NLCA 2HS4A 3OV7A 1AFIA 1S1TA 5LT5A 5SZTA 3OFGA 2QA2A 1Q16B 3MMBB 3MD1A 3M1VA 3MM8B 1PSDA 2IJFA 3NBPB 2WONB 2OJ3A 4HH1A 2GQQA 3EXCX 5C24A 3SSQA 4DUZF 5D4PA 2N4CA 2ROPA 4EO6A 2OFHX 1UAWA 1FF2A 3N79A 3BM7A 1VRUB 3NAIA 3RTVA 1ELOA 3HFKA 1RT2A 2JWNA 4ZCLA 4N47A 3MM9A 1FJ7A 1YTYA 1S6PA 1S1VB 1U25A 1CQNA 2RJZA 2JHEA 4X4SA 1RT6B 3LO3A 1VQ5S 2MPUA 2FVRA 4X65F 3DFEA 1JLAB 2UVUA 3CC4S 2R8JA 3ZZOA 3I87A 1Q4RA 3PM9A 2QE5A 2ROEA 4B3OA 1B0TA 2IVMA 2M8DB 2Q66A 1NJYA 1FD8A 2OP5A 2GJ2A 2OPPA 5E2QA 2HWTA 3MMAB 5IQQA 2UXBF 2JDJA 4KRWA 2DGOA 3PIPQ 1T7PA 2WSEC 3DLKA 2JOQA 3BN4A 4TQSA 4E8UA 4X4RA 4PPZA 4CH7A 4ZMMA 3VAJA 3Q8PB 2RQKA 4DS4A 3K7RA 1IQZA 1SL1A 5GADI 2VV5A 2FHKA 4TKTA 3UPFA 1TVRB 1WF0A 4DG1A 2RSQA 4ED1A 1RWUA 1UJ6A 2D74B 4M95A 3I4HX 1QE1B 3MPYA 4C2MA 3CGIA 3GE9A 4DR3F 1LQ9A 3I9V9 3GMGA 5B0BA 1IN0A 3QJJA 1Z4UA 5KG0A 1HMVB 3RB0A 4A8QA 1YITS 2VODA 5G4DA 1R0AA 5T41A 2FPHX 4M8LA 1X4DA 3V5RA 5A6PA 2XSJA 3AB2B 3FEZA 2PT0A 3BGLA 4OZJA 2QYCA 4J9PA 1NJZA 2MXYA 4YR0A 4H4KA 4TY8B 1IKYB 3DM2B 1SKRA 1I94F 2XCPA 1J5OB 1SI9A 4DJBA 2DIUA 4ZCKA 3W3SA 4B9VA 3BR9A 5T7LA 3JAMY 2C2RA 4N76A 4OHWA 1S6QA 3WDOA 1ZAXA 1G3OA 4YR2A 3KJVB 1D9FA 1NO8A 3C6UA 3MOZA 4YB7A 4AL5A 2MKKA 1X4HA 2J7UA 3F56A 1EETB 2GIQA 4RW4B 1F9FA 1IJFB 1S1UB 3FDSA 4CZCA 3ICLA 4QIWD 2KG0A 2XY6A 3MAQA 4NXNF 4WE1A 3SYZA 1RKJA 3MXHP 2MGZB 3H5UA 1UETA 3UNGC 2J7WA 1X9WA 1WTFA 1Y9OA 2J7KA 2K1RB 1SUQA 1M5KC 4OZLA 1C1CA 2GC8A 3WC2A 3HX9A 1XMQF 3NNCA 4ZPWR 2V9KA 2E5JA 2QV6A 1J2VA 3BSCA 3DRYA 4DR2F 2VC1A 1KLMA 2O5DA 3X1LB 1IJEB 1W2IA 4HHJA 4J5OA 4ZVEA 1L5UA 1GT8A 1MNEA 2MSSA 4CNYA 3VZIA 3ZZTA 4MFBB 4DV0F 3ISND 1FVQA 3J7Z5 3GV7B 1HW9A 1LXNA 2CPDA 3DLGA 5D78A 5FIIA 5ITHA 4J9RA 4QIFA 2R2UA 3IG1B 4H4OB 5BYRA 4IQXA 3MEDB 3QGGA 1S9EB 4JUZA 1DRZA 3N6LA 1S1WB 1RYSA 2DRAA 2APOA 2MYFA 3A1YG 1ZOTA 1IKXB 3IO1A 4WFXA 1H38A 3ZZZA 4DN0A 4QCLA 5CH7B 2C3YA 2QFJA 1DARA 2GCFA 4KKOA 4KBIA 4K0KF 4ZVHA 2R7UA 1VS3A 4ZHRA 2OTLS 4Q5VA 2KH9A 2LXUA 1BQNA 3DLBA 4EUVA 2NZ4A 4ECYA 3RRGA 2EFQA 2YNHA 4OI3A 2ZH7A 3HZEA 1SQEA 2KTQA 1FJCA 1SJ3P 1WG4A 2P9EA 1VBYA 4C3LA 5I4MA 1LWFB 1E6YA 5KFAA 4DL3A 2ZH9A 2HVHA 1GX5A 1IQTA 3TAMA 1S9FA 1ZM3A 3M2VB 2Y1JA 2DD8S 4LF8F 5GAEI 1M90T 1MROA 1WEZA 3CMAS 2B4UA 4XAKA 3OTBA 1PC5A 3IS9A 5CHCB 4RX6A 3BGRB 4I6YA 2W4DA 3H2VE 3LQVA 7FDRA 1HD0A 2P6SA 2GV1A 2MQLA 4IRCA 1TFYA 1N33F 4ZCMA 5HBMB 4G6VB 1HBUB 3PHEA 4KT0C 4URGA 4ED2A 1U2FA 3N01A 4Y34A 3CJKA 2JC1A 2LU2A 5EDWA 2C2EA 1U1LA 2AYMA 2FHOB 2RH3A 4LSLB 4C3MA 1RT5A 2K7KA 4G1QA 4LF4F 4UW2A 4HH0A 3TUIC 3OFEA 3MUMP 1KNZA 3CDAA 2HRYA 3AHPA 1TL1A 3FEYB 2HFNA 4LSNB 5K14A 2NQPA 2G13A 4DL7A 4Y28C 2J5AA 2DB1A 2G9OA 4R25A 2IFXA 3HHKA 4RBUA 3MPVA 5KG6A 3NL0A 1MMLA 5I42B 3Q0AA 1WI8A 1NK7A 3TX8A 2ZJPQ 2WBRA 5D77A 2UV8A 3AY0A 3QGPA 5A8KB 2W8LA 1OPZA 3I0RB 3JB9k 1LWEB 2VZ9A 4Q0BA 5I3UA 4OI0A 1XR7A 4IOBA 4MIWA 3W2WA 1SJQA 2DNPA 4LVNP 4LFBF 3FGVA 4KC5A 3KLHB 1JB0C 2DNLA 4LIRA 1D1UA 3HVAA 3U27A 2Z2LA 3UDLA 1HHTP 1R8HA 1XC9A 4ED5A 4DSFA 3IRWP 3BJYA 2G4BA 3V6DB 1GTEA 2B7CB 3PIOQ 5KFJA 2QIFA 4CTAA 5KFXA 2KFZA 5F0UA 4JI0F 5LMUF 1RKIA 5CYMA 1VQYA 3ISZA 1RA6A 3HI9A 3UE2A 4X64F 2F1FA 2OPRA 2VPZB 2HWHA 4I6WA 2KU7A 1SH3A 2XMTA 3MOJB 4NLVA 5AJ3F 1N8RT 1NHVA 1TP7A 3IRXB 3QO9A 1OPIA 2MZSA 4OQJA 3O1LA 5JVHQ 4Q2LA 4QZVB 1U48A 4ICLB 5J2QB 4Y2AA 4MIAA 3SXLA 4R5PB 1NRKA 1H98A 2MZRA 1G2EA 3OQ2A 3Q8SB 5DG7A 3V4IB 1HYSB 4YB1P 1B7FA 1DAXA 3GR0A 5DRKA 4EZ9A 4B3RF 2DGSA 2LKZA 1KFDA 3DOLB 3HKWA 2GHPA 2W9AA 3SZ2A 1FK9B 2CPJA 1YIJS 1JLCB 2DT9A 5M2RA 5IT0A 3R1HA 2HNYB 2BABA 5L39A 2M4MA 4RUAA 4ATNA 3HHDA 3ZZ0A 5LMNF 3DLLQ 4U6PA 1ZETA 2YVSA 5HL7Q 2LVWA 3MM7B 5LXYA 5KFVA 4RU2A 1TQLA 4NRUA 1H2VZ 1HBOB 1KHWA 2MY8A 4NLDA 2MHNA 2RKIB 2HQ3A 2YWEA 2D9PA 4PXEA 3KLGB 2CZVC 3L7PA 4DF8A 5GAGU 4WFNQ 4XDCA 1XERA 3MD3A 1IKVB 2OPQA 1N5VA 1X4EA 2GNKA 5DDQC 3SCIE 3UR3C 1FRKA 2AP6A 2ZD1A 5LSLA 5EWEA 1H6KX 3SDEA 3SQGB 1DLOB 5J2NA 2DNRA 3PFOA 2DGQA 3THTA 4WTYA 1TK0A 2PC6A 2E5IA 3DCAA 2CQ0A 2MSTA 4RKUC 5AE3A 1IXKA 3LANA 2DCUB 4R0EA 2LXIA 3MUTP 2N4DA 4Q7AA 1UA0A 3MMCA 4RNHA 1TAUA 1B64A 3DRXA 3O5TB 5KOWA 5KFKA 5KFCA 3ONQA 4LUBA 4ZPDA 4ED3A 2FJBB 2DR7A 4K4WA 1EP4A 2LYVA 5EN1A 4FF4A 4QBUA 4I56A 3RBEA 2BE2A 5D4OA 1C1BA 4DL4A 4QWBA 4FVMA 1ZZFA 2VL1A 4USJC 4LFAF 1X4GA 4MH8A 2BJEA 1VK3A 4A8SA 5H9EJ 1VQNS 1UEVA 4DR5F 1UVNA 1JMTA 3UW1A 1JLGB 3NWGA 3MEGA 1O8BA 5D8HB 1D3WA 2MY7A 4YQWA 3SSRA 4ILMA 2CQCA 5B0FA 4WYLA 4PUOA 2E1AA 1NAQA 5E3AA 3IR5B 2IM0A 1GAOA 4L3NA 2JL9A 4X4TA 2M3DA 2ASJA 2E5GA 1T03B 2PMHA 1VIXA 1LWCB 4DWIA 2LCWA 4FS1A 4YMEA 4E98A 1SV5B 5CCMA 1UVMA 2KDOA 5F8GA 1KRPA 3JTPA 2FHJD 1F5AA 2MKCA 2HGLA 5J2PA 4ZPCA 4QYZJ 3G4SS 1MWYA 3RU0A 2Q6BA 2Q1LA 4WU2A 3CC2S 2JEGA 1HPZA 1BGXT 3AB4B 3CCSS 5L9NA 3M6VA 1R8BA 4EYIB 3EGZA 2WRMA 2XI3A 5DG8A 2M8HA 5KFWA 5KG7A 4QWEA 2LQJA 5E3PA 5F8IA 4QOTA 4DV3F 1TL3A 2RQMA 2AU0A 4K59A 4CO1A 3R5DA 1QAIA 3LGMA 1R43A 1XMBA 3K0JA 4B9MA 1S0OA 2XS7A 5AXMA 3MMBA 1O5JA 4KAIA 1S6UA 1RAJA 2DH8A 1B0VA 3MCSA 2OSRA 2C22A 4BBYA 3NBPA 2MQMA 2WONA 4UUWA 4NWBA 5I3QA 1K1SA 3DOKB 2JC0A 3S7RA 1YRXA 4IRKA 3EX7B 2U1AA 3CPWR 2K8GA 1BQXA 1VQ9S 5KFTA 1GX6A 1P9QC 3I0SB 2UVVA 2YNIA 4MK9A 2V4JB 1KVIA 1FA0A 1VRUA 3OXLA 5E3QA 3HJFA 3DDKA 4OJ3A 4NZ7A 4RW8B 2YTCA 5HO4A 1UWBB 2CQIA 4BHQA 4I4BA 1RT6A 5KFNA 3CJ5A 4RNOA 2ZHAA 1JLAA 3CCQS 2R7OA 5HI7A 5E41A 1F5CA 3PX4A 4OI1A 1VQLS 2OIHA 3LUYA 5KT4A 3QZ8A 4HLBA 3MMAA 2DJWA 1M0SA 1Q81T 3FMWA 4KQZA 5A6WA 1VLYA 4C4WA 1HWIA 3TW0A 4QWDA 3I5AA 3HM9A 3POTB 1KS2A 4ILLA 2RF2B 1RT3B 2FJEB 1QUPA 5KT3A 1N6QA 2JRSA 4NZ0A 3E2EA 3TVKA 2EI5A 1LW2B 3CUNA 2V8GA 1VMBA 2VKRA 3W2VB 5D3GB 2R8KA 4NX9A 1TVRA 3LGNA 2FDNA 4KTQA 5DM7Q 2ADBA 1Z2ZA 1T3NA 3CT9A 1L3TA 1QE1A 2OTJS 2DHAA 5MLCV 4F2SA 2V2KA 2EWHA 2PIIA 1TK5A 2EC0A 3QJLA 4KO0B 2KYXA 4R8UB 1HMVA 3PJWA 2MJNA 1KN6A 3RW6A 2FHMA 2G0CA 2KHDA 1N5YB 3H4BA 2IA6A 3VAMA 2UU9F 4ID8A 2DH9A 3NRBA 5KFPA 5KFFA 4PWDB 3CCLS 1G6BA 1U6ZA 1IKYA 4TY8A 2R7WA 1C0TB 4Q8FA 1DHMA 1KHVA 2F8EX 2KT2A 3CEDA 5BYQA 5L9XA 2QMXA 4BC9A 4F3MA 4ED6A 2A2CA 3DI6B 3PDNA 4U7CA 1VQ7S 1U1RA 2XS2A 3H2LA 3NMAA 2CFXA 3KJVA 1FRLA 1T8EA 2QLXA 3KNGA 5GAHU 3FZ2A 5C25B 4USIA 4Q45A 4RW4A 4NYOA 2FLLA 4H4KC 4MTPA 2VBXA 3T6JA 1X0FA 3KK1A 3VAGA 2KXFA 4J9NA 3PR5B 3TO8A 4UY85 2AJ1A 2YH1A 2HHWA 3P96A 2XNRA 2LDIA 4ECUA 4B9SA 4OIXA 2AD9A 4C8KA 2K1RA 1REVA 4MIBA 2M0GB 1JJHA 2B5JB 2JLEA 4KGMA 4TXSA 4OI4A 4NLSA 4G1PA 1XN9A 5K9FA 1V6HA 2UUBF 2CPZA 1T95A 2YKOA 1NH8A 2AYBA 3JSMB 1S72S 4P7TA 1RT1B 2FGOA 3DYAB 3M8QA 4FYDA 4DN9A 2E1CA 2DGXA 2PE8A 2AW0A 4TYBA 5K8MA 4QU6A 1R6YA 1CVJA 2AGPA 2UV8G 3AQPA 2HZCA 4MFBA 2W4CA 3T9ZA 1LOUA 4M63A 2CDQA 2DCLA 4RLEA 2K3KA 3C46A 1ULRA 1JLEB 1E6VA 2WB1D 1OQ3A 3E51A 3IG1A 5SUHA 3GQCA 1WG1A 5IFMA 2KZZA 2LEAA 2E66A 4H4OA 3KWMA 4NLYA 1ZTTA 3C2PA 4EO8A 1U1NA 4KV8B 4C8YA 4C7QA 1RK8A 1S1WA 2FGCA 1FRJA 1RP5A 3MM5B 4PG5A 3CD6S 1IKXA 2W25A 2ATLA 2HS3A 4I2PB 4NCGA 3KHGA 2MKSA 3DC2A 2R2TA 5F8JA 2F3JA 5CQGA 1LKZA 1VBXA 4K5RA 4IR1A 1VRTA 4P6QA 3PX0A 3KG1A 5LJ5Y 4MYTA 4K4TA 5FD1A 1F0XA 1WG5A 2DPJA 4I68A 2YNGB 1UVIA 2B6AB 1P8GA 4C8NA 2DH7A 4KFBA 4Y00A 4YB6A 2LECA 2DRBA 2JLGA 3P49B 3KNAA 1LWFA 2O01C 3FZBA 2JEFA 2GGPB 2W9BB 2R7VA 4DPOA 2HVZA 3M2VA 3H8YA 2NPFA 1U1QA 3OUYB 4EU0A 2R2SA 4FBUA 2X1GA 3BZQA 2Q79A 3GV5B 1FNMA 1KOOA 2VC0A 3LP1B 1VQ8S 3MGJA 3BSAA 3F73A 2RIJA 4Z2XA 2VG7B 5E3CA 4RNNA 2RVJA 1ZBTA 3HVRA 4GKJF 2M52A 5BR8F 2DNKA 3TYTA 2MQQA 1H0HB 5CD4H 3DLEB 5HBMA 1AW0A 4C11A 1HD1A 5KFIA 2BOPA 2PI5A 4YDXA 1IKWB 4O3NA 1XEZA 2XG8A 3RB3A 5LXRA 3HVWA 2KXHA 4CH1A 4OZ5A 3R27A 5K8PA 5K5MA 5JJBA 4NL5A 2J9DE 5CA5A 2N82B 2WSCC 4ED7A 2C3OA 2M70A 3OW2R 3DMJB 2I0XA 4F50A 1WD6A 2LEBA 3GR1A 2JEJA 4FXDA 3HHLB 1RDRA 2YNFB 2EG1A 5I42A 5LL6d 1L3UA 2A2DA 5B0GA 4RNMA 2OD4A 2IVFB 3KLEA 2EW9A 4DV5F 1WTBA 4YHHF 2CQ4A 2ZFHA 6FDRA 2GMHA 2LQ9A 3D5MA 4H54A 2V8DA 4C0HA 2XHWA 2RQ4A 2MZ1A 1BD6A