1F60B

Crystal structure of the yeast elongation factor complex eef1a:eef1ba
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for nucleotide exchange and competition with tRNA in the yeast elongation factor complex eEF1A:eEF1Balpha.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords ELONGATION FACTOR EEF1A
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f60B00
1HNZF 1N36F 4JI5F 4DR6F 4JI6F 4LF4F 5BR8F 2ZM6F 4JI7F 2B7CB 1N34F 1XNRF 4B3TF 4KHPF 3ZZPA 4DV3F 4X64F 4DV6F 4B3MF 2YY3A 3T1YF 1CQNA 4LF5F 2B7BB 1XMOF 4LF6F 2RJZA 2HHHF 1XMQF 4NXMF 5AJ3F 1IBKF 4AQYF 2VQEF 4DR3F 1LOUA 4JYAF 2F4VF 4LF7F 2UUAF 1FKAF 2UXBF 1HNWF 1I94F 2KJVA 4YHHF 2BXJA 2J5AA 1IJEB 4DV7F 4LF9F 1N32F 4NXNF 4DR7F 4LFCF 4DV2F 4JV5F 4GKJF 1G1XA 2KJWA 4JI8F 4JI0F 4DV4F 3R3TA 2UXCF 2VQFF 4K0KF 4JI3F 1RISA 4X66F 1J5EF 4JI4F 4JI1F 5IWAF 4X65F 4DR1F 1B64A 2UUCF 4X62F 5LMNF 1HNXF 1G7CB 1IBLF 3OTOF 4DV0F 1XNQF 4LF8F 4LFAF 4DUYF 4DUZF 1N33F 4DR5F 1CQMA 4OX9F 2UXDF 4B3RF 4B3SF 3T1HF 1QJHA 4JI2F 2UUBF 5LMUF 1IJFB 4GKKF 1VMBA 1GH8A 1F60B 1IBMF 4DV5F 1HR0F 4DR4F 4LFBF 1FJGF 4DV1F 2BVZA 4YY3F 2UU9F 4DR2F 2E5LF
chains in the Genus database with same CATH superfamily
1BHNA 1MU2A 2GV1A 3KK1B 3PX6A 3QPIA 4RKUC 1TL5A 3ILOA 3H2VE 1T05B 2MKJA 2UV8A 3D4JA 1M1HA 2EFQA 3QT6A 1QUVA 4C8YA 3DLKA 1FRJA 3EGNA 1QAXA 2ZUGA 2BJ7A 3DLGB 4PXCA 1K1QA 1LFPA 1NO8A 2Z4PA 3TA2A 3H40A 3P49B 4CH1A 2VFRA 2WSCC 3M6WA 3UCZP 4F04B 4RWXA 3PYGA 1Q86T 3H4DA 3S7RA 2F8HA 3M7VA 3KLEB 1NPKA 1OMSA 1FKPA 2LP4A 4RW7B 4B08A 4RBVA 3SYZA 2GCFA 5DO2A 3GONA 5ETRA 2H48B 1U0SA 3FMBA 4JV1A 4CNYA 3FSXA 3CD6S 3ZZRA 4OLOA 3HFVA 3JYTA 1XMQF 1N4LA 1DY3A 1WEYA 3CE8A 3US5A 1G6BA 1ZTWA 2R7QA 4MIBA 2E5IA 1BLUA 4FKXA 3JQMA 3EE3A 4YHHJ 1RE1B 2CZVC 3ISNC 3CC2S 1NK7A 5GMDA 2DY1A 4N8NA 1VBZA 4HTIA 4DV7J 1KFSA 3UO0A 3M2VA 1HNWF 3TVKA 3V81B 2ROGA 1WORA 4FXWA 4ZKAA 2C1EB 3E2EA 3TEHB 3C46A 2W9AA 4AT1B 5KFXA 1REVB 1RWXB 1YSJA 3H2UB 3SZ2A 5J2PA 1SL1A 1MWZA 3PNIA 1CJUB 1B0PA 2OTJS 2QFIA 4RL1A 4U6PA 1NKEA 3PY8A 3J7YI 4GKJF 1RT1A 3SFUA 1M1KT 5JUMA 1RABB 2YKMA 3TOQA 2OMOA 3OL6A 2GW8A 2AGQA 2B9YA 3TVYA 2XO6A 5EN1A 1JWWA 2GAGC 3MEDB 1RISA 5GVQA 4LR9A 4DN9A 3BO3A 1W2IA 4X66F 2XLJA 3DLLQ 3LGHA 1NCLA 1U7LA 5DRKA 2OEKA 3TUJC 2RS8A 2H1YA 4LVOP 4ZCMA 3VWSA 2HKEA 3MDFA 4LIRA 4NEYA 2AJ2A 3SQGA 5KFFA 2GO9A 4U8VA 3KNGA 1BQNB 2XG8A 3M32B 3C2PA 4OJHA 4DR1J 2D1CA 5F3TA 2AJ0A 1V6HA 1UKUA 2OPSB 2YNIA 5SZTA 1C0UA 5HATA 2OPPB 5EWFA 1PBUA 1N5VA 1RCXB 3D6FB 5J2NA 4WXOA 3DN9A 4H54A 1Y00A 1NDCA 4NLGA 2QE5A 2V94A 2LEAA 1PAUB 4WZQA 5KAKA 2VOPA 4ETXA 4DCPB 3CDAA 5EHHA 1VQ4S 5LOQA 2YWGA 3OBIA 2VBZA 4WIQA 5HBMB 2OFHX 2VH7A 1R8CA 2IVMA 4TYBA 4G6VB 1O6XA 3HSZA 3RRGA 4LRCA 1P1TA 4DMZA 5KFMA 4LQ9A 4J9QA 1RQ0A 4QYRA 1IM6A 1IR2A 3OL7A 4F50A 4ECVA 3FEXB 2V4QA 3TJAA 3D0IE 5CZVA 1WDTA 4I6AA 1S79A 2C3PA 1HNVA 3DLBA 4F0KA 1H7WA 5T7LB 2J7KA 4J9SA 3V6HA 1F60B 2H51B 1UWAA 3BSCA 2BYCA 2M52A 2F8EX 5CYJA 1CJVA 1YJTA 5HMYA 3FBBA 5KFAA 5MLCV 3KYLA 1HR0F 3G86A 1DTTA 1NZAA 1RK8A 2CVEA 2HNYA 3I32A 5DQIA 3OL9A 1S0VA 5LSLA 1S7HA 3LANA 1AUDA 2CJKA 3OR1A 1U1PA 2OUGA 2BX6A 4I6YA 3K5OA 1JXLA 4J9PA 3NP5A 2D3ZA 3GYNA 1XWLA 3KMSA 2AGOA 2JLFA 2FVRA 4EO6A 2MKSA 1JJHA 1FK9A 3Q8QB 2PEHA 4JI6F 4OYBA 3CJSA 2BQRA 2EXUA 3N6LA 5IT9Y 4N76A 3IM9A 3PEHA 2W8KA 1RT6B 2YWHA 2W4DA 3VQTA 2IM3A 1GTEA 3HSDA 2KG1A 2NS1B 4XPCA 4DV6F 3RR7A 4QU7A 2GHWA 4IOBA 2LEBA 1FKPB 2J7UA 4Y2CA 4LF5F 1B0TA 1TTHB 1X5SA 2HQIA 3M30B 4PR6A 3OLAA 1YHQS 3MD3A 3KLHA 2AEJA 3S6EA 1VQMS 1FKOB 3PJXA 2CQ4A 1JLFA 2EW9A 4HH1A 4PPZA 5A0YA 2P9EA 2XMWA 3W65A 4LF5J 1Q8IA 3W9IA 1C2PA 4MFBA 2FJXA 4CTAA 1RYRA 1U2CA 1N54B 4NLRA 2DRDA 2V63A 3UD5A 3PX0A 1EARA 3QIDA 5BYRA 5KFNA 4LF7F 3C14B 1HWIA 3A8JA 2HRYA 3NAHA 2A1BA 1GFWB 3P5BP 2E7WA 3KJVA 1K1SA 2ZNYA 2MKCA 3D0GE 1X8DA 4IOCQ 2HS3A 4ECSA 1H72C 3ICLA 3RAXA 1QM9A 2BJ3A 4IFYB 5IT0A 2VA2A 3DOKA 2XMAA 1UA0A 1ZA2B 3HHDA 3Q89A 3EVOA 4M5JA 2HBQB 5E7OB 2BM1A 3CDBA 2HRTA 4J90A 3CJ5A 3OVAA 3LAMA 5FDLA 1JJ2R 3IM8A 2DGWA 3JAMY 4C11B 2KM8C 3HDSA 5K8PA 2BR0A 2FLPA 4OYOA 4O3SA 3MOJB 4K0KF 4ID5A 3IS9A 2P6TA 3F56A 2W01A 5B0BA 3NCQA 5IV4A 1RA7A 2OMLA 3M1VB 3NRBA 5A8KA 4DU8A 4TQRA 1J5EF 2R2UA 1YBAA 3A3OB 5I3QA 3KLIB 1B64A 1FRIA 1F9FA 1WHWA 4URQU 4MKYA 1HNXF 4ZVHA 3UNGC 3BSOA 3GTYX 4FYDA 2ZBPA 1FTRA 2CQIA 3WQPA 2JL9A 4ZPWR 1RAEB 4DX5A 3UD3P 2XS7A 4M5KA 5B7WA 2HRUA 3O8WA 4G1QA 2DIUA 4ILLA 1UFWA 3P45B 3UWTA 3MI7X 2NUUG 3AAWB 3MMJA 3ZTRA 1CC7A 1KP6A 4RW9B 4ECYA 2K1RA 3OTCA 1KC8T 1GXLA 2R7SA 1J2VA 3C14A 5AXKA 3U27A 2FGOA 4H4MB 3BJYA 3CCMS 2AQ4A 2PMWA 3ELHA 3NXZA 4RWWA 1YJRA 2NUHA 3GR0A 3JSMA 1E6VB 2V4JB 1FO1A 1HNWJ 2LA6A 3VCDA 4EO8A 1ICEB 2AT1B 1KQKA 4V19X 2V0NA 2DR6A 2J9EA 2Y0BB 4QBUA 4U67Q 3Q8SB 2XNRA 2HHSA 4RX6A 3D3CJ 3CJKA 4QW9A 5GAGI 1OYDA 3JXOA 3PO5A 2GZOA 2CPZA 3R5BA 4ZVSB 3CF5Q 1WF1A 3H5YA 4ECTA 1FJGF 3EWGA 3BBFA 4OQJA 3T5HA 3K8VA 3C66A 1JLGB 2LQJA 5I3UA 4DU7A 1YDLA 2HQGA 3CULA 2YPYA 2AP6A 3IRWP 3CCZA 2VD3A 2R8HA 1GXUA 1EZZB 3DMJB 3GSIA 4WBFA 3WX8A 4C3KA 3Q24A 5F0WA 3GPAA 4FF3A 1IQZA 3FSYA 7AT1B 4KFBB 2YTCA 4KSEB 4PG5A 1Y9OA 8ATCB 3OTOJ 1QAIA 3RR8A 3PYFA 3UDLA 1M5OC 1RT1B 1XR7A 3PHEA 4F67A 2LEPA 3HHLC 1LWCB 4NYPA 4DOZA 2FTRA 2UUAJ 3RB0A 2FZCB 5L9XA 4F3OA 3N28A 3K59A 2GIRA 1PBAA 1OY9A 1FESA 3L4BC 5BYQA 2ZDOA 2I5JB 2GS8A 2I0XA 3HD2A 1M5HA 2CJ9A 2MZTA 2VPWB 3PCOB 1HWLA 3VALA 2AV5A 4V1Ak 1U0HB 1S6OA 3OQ2A 4PYDA 3U1LA 1RTJB 4DX7A 4YQWA 1WHVA 3EGZA 4OHVA 2MEWA 4KB7A 3GFYA 3ZO7A 2JVRA 2V6AA 2YBVA 1IBKF 2EWHA 4DR5J 2DVIA 1UTAA 3WIUA 5THWA 4DX8H 2ZH4A 4X4VA 2JEIA 2O1PA 3MEGA 4Q2LA 1QDUB 1HQEB 3Q8YA 4DDFA 1FFSB 2CJQA 2ATLA 3QRRA 2DHAA 3KJVB 4K4UA 1S77D 2JWNA 3R7NB 4CLTA 4DLGA 4ZLLA 1R27B 1RI7A 4Q2MA 2YX4A 4QZVB 4ZVRB 4E98A 3CUNA 2W9CA 2DK2A 2CWKA 2WVBA 4B3OB 2XLKA 5IT9U 1XBWA 3H59A 5GAEI 2CPDA 2WK4A 3GYXB 1N5YA 4LBIA 2EFOA 2DEJA 3LH2S 2XC9A 1GTHA 4DV2F 2HPUA 2KJWA 3DLKB 2Q1LA 3FBCA 4F4WA 2KG0A 4DV1J 4RW4A 3EDQB 1N56A 2HYIB 1RWPB 3VAKA 1R43A 3OFFA 4D3GA 4I2QB 4WWSA 2E5LJ 2J6TA 4KJIA 3ENVA 4KH1B 3MCOA 1EETB 2LYVA 3MPWA 2AJ1A 1E6YA 3Q8PB 1U26A 1UAWA 2VPYB 3MTJA 5ETTA 5B0AA 2KFYA 3EYZA 3NMAA 2RQKA 2RDDA 2RF2A 4C0OC 4E0DA 3GCXP 3V2UC 4CLSA 2W9CB 1UPMB 3RAQA 4FF1A 4LSZB 1UFLA 3WDOA 4DSFA 4ANDA 1QE1B 2W1BA 5DJBA 3W3SA 1BC6A 3KMQA 4ELUA 3L95X 4PWDA 1DLOA 2Q6BA 2VL1A 4LRBA 5C25B 1U1RA 2YKAA 1XNQF 2MKHA 3PO4A 1LXNA 1IKVA 1J5OA 1RAOA 2VPXB 3N5BA 1N88A 5CXTA 1H38A 3EVWA 4DFMA 1S4EA 3V6DB 2FHJD 5ETNA 2ZH9A 1DTTB 2HS0A 4M8LA 4JI2J 3KXDA 3JAMU 4ZVEA 2HIYA 4ILMA 3U1NA 1LWEB 5D3GB 2FIUA 2V50A 4FF4A 4MKAA 1CULB 2XYGB 3PJWA 2PFFB 3C16B 3E01B 4NA1A 2ZC3A 2Z2YB 5T14A 3NGDA 3MECA 1BQNA 3BDEA 4QW8A 5H9FK 1PC5A 1EQMA 4J7CA 3NGRA 3BH7B 4M63A 5B0CA 3FSIA 2UXBJ 2CXEA 1HHSA 4AQYJ 4UY85 1XEZA 2XSJA 3BSNA 2UUBJ 2LQ5A 1M1GA 2DTJA 1ROFA 4N77A 3VVUA 2L41A 3OXFA 4DCOB 4ZPAA 1BWEA 3MEEB 4XAKA 4IG3A 1K8AT 4BS2A 2K7KA 4H4OB 3DMJA 3FEZA 4U7CA 4IO9Q 3D68A 1HQUB 4DFPA 5J1EB 1IR0A 1R8HA 1VQLS 4NYOA 1Y7PA 4UZBA 3D0HE 1HMVA 3QJJA 2KT3A 4HT7A 2EBGA 1WKKA 1YWXA 1ZM2A 2RUSA 3GLJA 1S1UA 4JI5F 3GWCA 2A2CA 3L7UA 2E5JA 4NWBA 4GRSA 3LUYA 2M8DB 1N34F 1RTHB 1LWFA 5DQGA 1L3TA 1R6YA 4Z37A 1FNMA 2R4FA 1VQKS 3R7SB 3ZNUA 3D7SB 1FRXA 4NLVA 5D0HA 1QY7A 4O23A 1B99A 1F3FA 2MQPA 4TY8B 5LM7E 4NRUA 4F3MA 4ZK7M 1CS4A 4DSLA 2CA9A 3IO1A 4R5PB 4CLKA 4GVLA 2HHWA 3HSGA 3QIPB 3AT1B 5E5NA 2DNLA 1RTZA 2CPEA 3M8QB 5DM6Q 4UQGA 2PMZD 3QGIA 4I7FA 4NLDA 4TYAA 4IR1A 5DDQC 4QIWD 3QYYA 2ZHAA 4MKBA 1OYEA 2QEXS 2GMJA 2WOMB 1RHUB 4XK8C 3WHIA 1M5VC 3GFHA 3ULHA 2KVIA 3IFEA 3R2DJ 4CH0S 2CPFA 1F6TA 1T9XA 1WDDA 3HHLD 4PXDA 3GFXA 3J81Y 3CJ2A 3PKMA 3TP2A 4JYAJ 4FYVB 5F8NA 4E2FB 1WC0A 3M2VB 3KTQA 3FMWA 1FERA 1DURA 2AIRB 1HBMB 3F44A 2QA4S 4YP3A 3NKYA 3JSYA 5KT6A 1RAGB 3HZEA 4DQSA 4KIAA 3DKDA 4IO1A 2B4OA 3CNQP 4PXBA 4ES1A 1ZS6A 1WKJA 4KC5A 3HMJG 3EMTA 4UW2A 1ZETA 2A10A 5C2CA 3BGOP 2DISA 3KK3A 2HFVA 4ES3A 4RW9A 2DRBA 3C6TA 3SXLA 2XNQA 4N41A 2KU7A 2EVZA 4OV6A 5DDOC 4U95A 4PQUA 4L3KA 1AUSL 3HCXA 1UMJA 4NLPA 3PDNA 2FJDB 1GMUA 4WFZA 1KQFB 4JI4F 4J9MA 5J2QA 1JLGA 4RNOA 3NGTA 5F8IA 2XY5A 1FE0A 1K73T 4OI0A 4X65J 4C9DA 2QA2A 2XMTA 3N79A 2B8QA 2EG2A 1A7GE 2RAQA 1HPZB 4F36A 1S1XA 3GZ7A 2O3DA 3HP6A 3ITHB 2G4BA 3SSRA 3CEDA 3W5YA 1N0VC 1YJUA 3BKUA 4HR2A 4F26A 3WC2A 2NXNA 3GB0A 2H3EB 3NGKA 2DH8A 5AXLA 1FJEB 3ZZUA 3B4DA 1B70B 2XHCA 4RU9A 1RT7B 1ZAVA 4CDIA 4DUYF 1HNIB 5K20B 3TYTA 1DBDA 3T1AA 1WOSA 2HVDA 3CGIA 3BM7A 3HLUA 3I9ZA 3HJVA 4WIIA 1KLNA 3MAHA 4TLQA 3DU6A 2DRAA 1IXKA 2CNOB 1MU2B 1PC4A 1T11A 1UL3A 3FRZA 1CJKB 3OT9A 4LRAA 3T9ZA 4DN0A 5HMWA 5DG8A 8AT1B 1T03A 5D78A 1VJWA 3CJTA 4ZPVR 4EBCA 3LWLA 3L7OA 3SSSA 1GMWD 2I8EA 1HW8A 2W7AA 3RBDA 2HHHJ 1FX2A 1RUSA 1GX5A 1GMVA 3V6KA 1JLCA 2FY8A 2FHMA 5ETMA 2QLJB 2YH0A 2LQ8A 4RNMA 3DI6A 4AL5A 4A8YA 1OS5A 3Q8RB 4LRDA 3BZQA 2PA3A 2G2ZA 3MUMP 1TUVA 4OX8A 4WFNQ 1U6ZA 2E7XA 2KHCA 5GAEU 4RZRA 2ACYA 2NXCA 3BGLA 1Q7LB 2LXIA 2A18A 2HK3A 3IWNC 2YNFB 4Q8EA 3IBWA 5L1LA 3UW1A 4J9LA 4QJVA 1XMBA 3A13A 3RW7A 4CLUA 4MYUA 3M6UA 2CG4A 3MM8B 1T7PA 1WF2A 2C22A 3M2UB 1N36F 4DEZA 2OD6A 4KHPJ 3LGMA 4MYTA 2KN4A 3I82A 4NPOA 3H5XA 5LXRA 1S10A 4F3QA 1WC1A 2HIQA 2V8VA 5CCMA 4ZPCA 5IZHA 1BD6A 2R8GA 1IVZA 3EUNA 5KOXA 1NHKL 2VODA 5EGYA 2W9BA 1RWNB 1S1WB 2IMOA 1EETA 3KDOA 4EI2A 5I4MA 1WG1A 4CLZA 3QWPA 2GAHC 4ZIVA 2XGPA 1KQGB 3N01A 3W2VA 2WVDA 1NK9A 4QR1A 3TQ1A 1B7FA 3TUIC 2WVFA 1DZ5A 5HLFA 3HVTB 2VG5B 3G6VA 3CJQA 1TQLA 5HP1B 4C8OA 4UOGA 3OV7A 5C7PA 1UPPA 3MUTP 4C6AA 7FDRA 2BJEA 2LXUA 4ALZA 2XI2A 1CSJA 4CYUB 4URGA 2J8SA 2X7IA 2OO4A 2XI3A 1ZZNA 1S7IA 2OFGX 3BQ1A 4HI1A 3V4IB 2DHSA 4KR0B 2ZHBA 1LOUA 1PSDA 1YRUA 2DBBA 3ILLA 2JDJA 4P73A 4JB8B 4ZCIA 5BJRA 2KB2A 3SCLE 4FZVA 3MM7B 3N6MA 2UUAF 2JHEA 3P6YC 1Q4RA 1U48A 4RR5A 3TUZC 4TN2A 4FBUA 1DQ9A 3MAAB 5L1IA 2BXJA 2ZJQQ 2F5GA 1NH7A 2E7VA 2PDAA 1NKCA 1JLBB 2BV3A 3F0NA 5CHCB 2RUGA 4DL0C 1RZMA 2IFXA 3ILJA 4YB1P 3LP0A 4AYBD 2EC2A 2L08A 2QMUB 3A3PB 3OXGA 2Y1RI 1HL6A 4USKA 2MZ1A 3BREA 4A8XA 5KFHA 4MT1A 1S49A 6FDRA 1PYOB 1SIZA 2XSJB 3ENQA 1VQ9S 4C98A 3H42A 4DV2J 3IRXA 3HHLB 1WC6A 2DEIA 3AD9C 1SC4B 3MM9A 4PUOA 1HR0J 1FJCA 3NBPB 3PW4A 2HNYB 2AKWB 3BDPA 2KHDA 1M5PC 4JI1F 3PYEA 1K47A 1QAYA 2K7JA 1KSPA 1UVMA 4USWA 5K14A 5HLFB 1NKBA 2C3MA 3CWJA 3DHWC 4F4XA 1U45A 1F5BA 1HMVB 3H98A 1U47A 2AYEA 2B51A 2F63A 3G82B 3K7RA 5T41A 1UJ5A 4ZN1A 2HBZB 3CCRS 1S9FA 2JEJA 1RP5A 2Q3PA 3FJ2A 4DV0F 2N82B 4DJBA 3RRKA 1AZSA 1WC3A 2JJ4D 4BDPA 1BQMB 3U7JA 4USIA 1RLDA 3QT5A 3MM6A 5G0RB 4JV2A 4XO0A 1N33F 4KGKA 2SXLA 2ZOFA 1CQMA 2NXJA 1I51B 3GILA 2HAFA 3PG9A 3BO4A 4N56A 2XYPB 4WK3A 3DRRB 1I1GA 4A8FA 1I3OB 4P2SA 4QOTA 2DNOA 4B3SJ 4JP8A 2GMHA 3VAIA 4C8LA 4J9NA 5BXIA 1VBXA 2ADBA 1T9WA 1RBOB 1FK9B 2KH9A 3M9OB 5LMUF 2OPSA 1H2TZ 1X4GA 2YNIB 1X0FA 3CCWA 1RT7A 1S97A 1QSSA 4C3LA 3RU0A 3SCKE 4LUBA 2LKZA 1T8EA 3DM2A 3OR2A 4ATNA 4DV5F 4DV4J 2HVHA 2B9XA 1GAOA 1EX8A 2I9SA 4WK1A 2FQQB 2MKKA 3JS9A 3HVAA 5HJYA 2AYMA 2ZZTA 4RJVA 3O3LA 1UEUA 3NY0A 3QSIA 3M8YA 1XN9A 4YS2A 5FLXU 3BBBA 1UW9A 2KFNA 1NHVA 4F7VA 4KBIA 2HGLA 1Q81T 3ILIA 4PWUA 2B6AB 3TJ9A 1X5PA 2MZRA 2RH3A 4DV0J 2HFSA 3PACA 4OYZA 2DXDA 4UTGA 4TU9A 3PW7A 3IN5A 2ASLA 4WFYA 2HFOA 4TU8A 4WP3A 4Q0BA 2X1BA 1C0TA 1AZSB 2QN6B 3P96A 4JI7F 2EFPA 3CT9A 1X9WA 1JIHA 1F5CA 1XNRF 1N48A 2NYHA 2VBWA 3VF0B 3HO1A 3LP2B 1S57A 1KVJA 1MN7A 2YQ0A 2M5YA 1H98A 1Q79A 1NDLA 5HBMA 2EK1A 5LXYA 3LP1B 4B9TA 2D74B 2DGQA 1CQNA 4KKOA 5D77A 4KO0B 4USHA 3HHEA 4KRWA 4IR9A 1CJTA 3Q86A 3CPWR 4X4OA 4B3MJ 4DFJA 3B6BA 3G8TA 5LJ3Y 3ONQA 3IR7B 2RILA 1H74A 2W2QP 3RAMA 5J2MA 2FHOB 4ZS6A 1WI8A 3GE9A 2XMUA 3PV8A 2IA6A 4OV1A 4DR7J 2QZ8A 2IRUA 3S8SA 2ZJRQ 1ZH5A 2KJVA 3TARA 3W2VB 5CYMB 4ED0A 2Y3YA 3CDEA 1Q95G 2XTJP 3NMRA 1RAJA 2KZZA 2YX7A 2HSEB 3B78A 2UXDJ 1D0EA 1UEKA 2B9EA 2UXCJ 4DR7F 3P3DA 2RQMA 2Z2LA 2DIVA 4F0MA 1X4DA 2POKA 4ECRA 2X3GA 2YKMB 3G82A 5KFPA 3UI3A 1WOPA 1P6TA 2JLEA 4RPFA 4ZHRA 2VA3A 3OJSA 3CMES 4USTA 2PFDA 4L75A 2JLGA 2UXCF 4WFXA 3M6VA 3MM5B 4I68A 1M5KC 4WKYA 5HQLA 2FVSA 5IM0B 2DNGA 4NA2A 2ZBCA 4I2PA 1H6KX 3OW2R 2G0CA 1L3KA 3CD5A 3NBPA 3QBCA 1UVIA 3D67A 1B7YB 4HHJA 4P52A 4FYXB 3N9UC 2LECA 3CO9A 4OZNA 5CYMA 5F8LA 4CWBA 2W8LA 4JI5J 3IGNA 2UUCJ 5LMNF 1NAQA 1UZDA 4DS5A 1FFWB 1G7CB 1TL1A 2DR8A 1I6JA 3MMBA 1D3WA 1X4BA 3QGHA 3L7PA 4OHWA 4A8QA 3P5TL 3LF0A 4I64A 2XZDB 2WCXA 2AJ4A 2W2NP 1ZTTA 2V34A 5DLGA 1RWWB 5A8RA 4DL2A 4EBEA 4IRDA 3KHHA 4QYZJ 5C24B 1Q5YA 2ZD1B 4IOAQ 5IT4A 1DRZA 3NS5A 1JK9B 5KG0A 1RACB 1PAEX 2ZH8A 4MK7A 3IP0A 4J37A 4P75A 4IDKA 4GC7A 1VQ6S 2BKPA 4K4TA 2HBYB 3S1TA 1D8YA 1TL3B 3LA0A 4HACA 4B3SF 4Z7YA 3QLHA 3GR1A 3JQJA 1LNQA 1RAFB 1HWUA 4GVBB 3VTIA 1KLMA 2B5JA 1F1BB 2PEBA 4OX6A 5D4NA 3WZ0A 3R5CA 4DQIA 2UVUA 5GMEA 4RO0A 2FLLA 2VKZG 1N6QB 4PRFA 1WHYA 1I5OB 1SQGA 4OJGA 3OTDA 4URSA 5B0EA 4DR4F 2K1RB 4ECXA 2QLWA 3I9V9 1YK9A 2W4CA 4UZCA 1Q82T 1HA1A 2BE9B 1U1QA 4IG3B 1HIYA 2KL8A 3IAM9 4B02A 2PI5A 5K8OA 1HWJA 2CZ9A 2FC8A 1S72S 2CQPA 3K8WA 5D4LA 4DCJB 2BE2A 2BUNA 1F9EB 2FLOA 3N0VA 3QAUA 2CPIA 3PRBA 5JJBA 3TI0A 3LOUA 1F0XA 1NLKL 4QPTA 2CPXA 5KFGA 4N5SA 1KNZA 4DR6F 2AWZA 2YWFA 4ICLB 2HVEA 5A0YB 4X4SA 2BOAA 2HHVA 1RXOB 2ZVIA 2HQDA 2N7YA 3CJKB 4A46A 1XNRJ 2XS2A 3PIOQ 2VBXA 2WONB 4O4GA 3W62A 3QT7A 1WTFA 5B0GA 4CTAB 2O01C 4KHPF 3CJ8A 1HBNB 1LK7A 1W25A 1N5TA 4X64F 4DV6J 1JKHA 1S6QB 3A3NB 4A8OA 2DCUB 2DT9A 1RAHB 2DHHA 1OSDA 3RUBL 3FNNA 3J80Y 5D0GA 3UCGA 1B0VA 4MIAA 1YITS 2DHXA 2R42A 3SIPB 3CW2C 2KT5A 2F3JA 1C4AA 4YDXA 5KG7A 3OD2A 2IJFA 1PJ5A 5J1PA 4QCLA 2V2ZA 5JXSA 5DDRC 1DHMA 2G1DA 3TVZA 2JFDA 5KFJA 5EWEA 3M8SA 4OHZA 1RT6A 3RB4A 4LF8J 4Q8FA 2X1FA 2MSSA 2ERRA 5HVFA 3N5FA 5G0RA 3NCPA 2Z57B 1P8GA 2IC3B 2NSBA 2WB1D 3MGJA 3NOCA 3W1YC 4AD6A 5F8GA 1ZPVA 2FHKA 4M5DA 2MLZA 1I94F 4DR3J 1UW4A 4YHHF 1S9GB 2B9WA 2ZVSA 3A1YG 2BRLA 3K5PA 3VV2B 2LU1A 3VHQA 2MYFA 4NLSA 4DPOA 3R5AA 4LF9F 1Y3KA 2IRXA 3HULA 1N36J 1AFJA 3I6PA 3CO0P 5KT3A 3VGTA 4JI8F 2GJ2A 2ZC4A 1IKVB 4CQ1A 3B82A 5FLXY 2KXFA 1K9MT 4AUKA 3QRPA 2P8IA 2PGCA 3D6TB 4CLFA 3QRQA 2ZBRA 3GIIA 4G1IA 1D8ZA 1U24A 1CG2A 3EZUA 3ZZZA 3TZZA 4RW6B 2C2ZB 2RQCA 2ZH1A 2CPYA 5J2QB 3R1HA 3J7AN 3MURP 4NCGA 4WU2A 1T05A 1IBLJ 1YGYA 4FF2A 1LW2A 2MMYA 1XMQJ 1XR6A 1NK6A 3AFGA 3EXYA 3OSNA 4NCAA 3THPA 2QC3A 3QLHB 2RRBA 3JTPA 3WBZA 4J9OA 1R0AB 4JOUA 2CQCA 2PIIA 1EB0A 3P4UB 3EPGA 2VOOA 1T02A 1RHQB 5HVGA 2DPJA 2RIJA 4C8ZA 1JB0C 3O2IA 1CJVB 1S12A 1F2HA 5E3PA 4DX6A 2RVJA 2RU9A 2Q6CA 1M5SA 2EFVA 1S59A 1X4FA 1TL3A 4HACB 3H20A 2ABYA 1HQUA 2CYYA 2I2YA 1FVSA 1V3SA 2I6WA 4AXJA 2ATCB 2DNRA 3FZ2A 1P9YA 3X1LB 3I0SA 4KGVB 1HW9A 2O5DA 3DU5A 1KDNA 4P7VA 2FZKB 2D3OR 1YIJS 3MXHP 2G2YA 1Z2ZA 4M5LA 2KVQE 1AROP 1BUXA 2K3KA 1N6QA 2ZDPA 3T1HJ 4QWEA 4Y6IA 5DGAA 1BQMA 2CJAA 4FYWB 1VI7A 4HDGA 2HZCA 2YKOA 4JI0J 2MB0B 2E66A 3EPIA 1DTQA 1S99A 2UU9J 4DWIA 3MHYA 2M4MA 3OVBA 5KG6A 2RRAA 2R7OA 4KTQA 3AHPA 3HI9A 5SUHA 3G8SA 3Q8VA 4DSJA 1TV6A 1A0OB 2BE7D 5KFBA 1WEXA 4DL3A 2V2KA 3DRSB 2UVRA 3TNVA 1TFYA 5EX0A 3K2YA 5AE2A 1C1CA 1P9QC 1IKXA 1DJ0A 2B8PA 4Z7CA 4A8MP 2NYIA 2WOMA 2MHNA 2UVVA 1OJ4A 1U4BA 1KKHA 3VGUA 4KH0B 3K89A 2CNKB 5E33A 1BXNA 1X4HA 2QJ3A 2AEMA 2XZWA 4L76A 2MQ8A 4O0NA 4ANCA 3D3BJ 4RW7A 4U8YA 4MMOA 1NDKA 1UJ4A 3PR4A 4JI7J 3QGGA 2UUTA 4OYIA 4X62J 1VRTB 2M88A 4NYZA 3FCHA 1N5QA 4LFAJ 3W60A 2XZTB 2CUYA 4O4RA 2BOPA 4I6WA 3I55S 4WYWA 1WI6A 2VZ9A 1FRLA 3MR5A 5IV3A 3G71S 2K3IA 3ZC4A 3R97A 1LWXA 1OY6A 1ZM3A 4IYQA 2JOQA 5IC4B 3V4IA 1BQXA 1RTHA 4LBPA 4LR8A 4O44B 3G87A 5AXMA 2GVDA 2V8GA 3TZWA 2UVWA 4NCGB 2VG5A 1S76D 4B3OA 1JLBA 1RHRB 1TUGB 2DH7A 2ASJA 1TFWA 1N32F 4YFUA 2PD1A 1N5SA 2A6MA 3RZAA 4DL5A 4GKJJ 2DCLA 4ES2A 1G1XA 2RHSB 4XPEA 4PWDB 1WJ9A 4JV5J 3H8YA 4ER8A 2AW0A 4ZP6A 1WEZA 1LV5A 3ENAA 2HNDB 2MZJA 1RT4A 4ZOSA 2RHQB 1IKYB 1OPIA 4O3QA 2MGZB 3FUYA 5M2PA 1T9TA 4KHMA 4YB7A 2FB0A 1SJ3P 2FLNA 2MLXA 2DGXA 2E1AA 2LQ9A 3MF5A 2G1HA 2E29A 5KG2A 1YX2A 4N7TA 1SL2A 1FRHA 5HN0A 1SKRA 1NSQA 1M90T 3IXQA 4L72B 2G0JA 4Q43A 4LR7A 3KLHB 5K14B 3TAPA 1H2VZ 2KI2A 3TANA 2HGMA 4ED6A 4ZPDA 5C25A 3TX8A 2E1RA 2DR9A 4ED8A 2DY9A 2RU3A 1LWCA 2OD4A 4DL4A 4LSNB 2CQ3A 3HZGA 2C2RA 1YKWA 4FYYB 2QX0A 2Q79A 4ZPTR 1V3ZA 3VZIA 2W7PA 3MM6B 3CCES 2HNDA 2VICA 3JSBA 3KLFA 2FPHX 3B54A 4X2BA 1YZ7A 4HEA9 2L48A 1RTIA 1HBOA 1OIAA 2ZFHA 3DRRA 4F25A 2UXDF 1U8WA 3D66A 2R7TA 3DYAA 4HHUA 3TZXA 1R31A 3D6MB 4OYMA 1QE1A 4J9KA 4M95A 4Q5VA 2EFNA 1SC1B 2YWKA 2XGQA 3M2RA 2IBKA 1S6UA 1TAUA 1SBRA 2F8MA 1SKWA 3IG1B 1IBMJ 1W7WA 2DYAA 2H5JB 4C7QA 2MPUA 2RKIA 1U1KA 3G9CA 1HD1A 1BWVA 2E5HA 1YJVA 2KDOA 2QT7A 4R0EA 4Y34A 1L3SA 3W8GA 1U1NA 2ZWPA 2AEFA 4PXEA 1P1LA 3KLGA 2V8PA 2CNNB 4FKYA 1VQYA 1D09B 3M8PA 3W5XA 4BC7A 2W7OA 1RBLA 2IC3A 3A8KA 1IBMF 4FDFA 4K4VA 3GQCA 1UVLA 4H4OA 4ZP8A 2U1AA 2QMWA 2HZVA 2EI5A 3LGNA 3MEEA 4KAIA 2FUG9 1Q8KA 2VV5A 2ZE2A 3KUHA 2EBEA 1SJ1A 2W2MP 3RBZA 2N4CA 1B4SA 2L9DA 1BMQB 1ULRA 1FDNA 1YJNS 3DGPA 3DLEA 1MROB 1HYSA 3Q8UA 1S1VA 1ZZFA 3AJ1A 3DLHA 1FJ7A 1T95A 4B17A 5EX3A 2R7VA 1IWGA 2AZ1A 1YJWS 2L9NA 3MEGB 4OZJA 2YKPA 2NQPA 5L9NA 5FJ4A 1N8RT 3CXCR 3G4SS 3KLFB 1EAYC 4HKQA 4M5MA 4RU2A 4RW6A 4AE5A 3EZ5A 2KO1A 3V6JA 2ASYA 3D5MA 2ZH3A 1MNEA 4DG1B 4DPYA 3FBFA 3MAAA 3UCUP 5ETSA 4ZITA 1NK0A 1MWQA 3GG1A 4NX9A 2PE8A 3TW0A 3EICA 2MJUA 4KKOB 1W2BR 2OGUA 4ILRA 2EFGA 4K2XA 4AFFA 1S1UB 5KFQA 3H90A 4GVBA 4DF4A 1SJFA 3NGSA 4OZ5A 5CH7B 5EDWA 2HMIA 3C8YA 2OSQA 3OUYB 2GFFA 4E8UA 4ZVFA 5B0FA 4N8OA 2LFVA 2C2MB 2VQEF 2NREA 1RHJB 2LQBA 5KT7A 3OSPA 4CO2A 2F4VJ 2CNLB 4C2MA 3C6TB 4Q45A 5DG7A 1FX4A 2DGUA 4JYAF 2C28A 1RT4B 1NSAA 2AMCB 3CCLS 1FFGB 4LFCJ 3LQVA 1NHUA 2WSEC 1KTVA 3U1MA 2JC0A 2AF6A 4EMDA 3J7YU 2KZMA 1LXJA 4QIGA 4ZDNA 3MOZA 1RT3B 4NOHA 5IC6B 1PG5B 9RUBA 1NK4A 1TKTB 3GIRA 3PJ9A 4DF8A 4LFCF 2XWYA 3ETOA 2CJXB 3DGVA 1R3NA 2EEYA 2E9RX 5EWGA 3BH6B 2ROEA 4OJ1A 5J2NB 1X4AA 3OUYA 4D3HA 4ZCLA 3BQ0A 2FYXA 3BPDA 1YRTA 2R2TA 1GEHA 2GC8A 1WC4A 3ZFVA 2GVDB 4EEYA 1X5OA 2WW4A 2AHOB 3W63A 1F9HA 2ZBQA 1UZHA 1S1TA 1HBNA 2V2VA 3BGRB 5B09A 2QV6A 3LPEA 5F9LA 4DV5J 2P2CB 4B9VA 1RGVA 4JI4J 4X65F 1T9YA 2VG7B 2LLZA 4F4YA 4HH0A 4OHXA 3HJFA 4YMEA 2R7WA 2EK6A 2WZ1A 1Q78A 1SI9A 4WE1B 2BJDA 3HHNB 3I0RB 4RUBA 1S1XB 4RW8A 4ITSA 3DYAB 4WKRA 4QR2A 2WSFC 2ZKUA 3MFHA 1YLXA 5DM7Q 2QSWA 1T03B 5FDLB 3L3CA 4B3TJ 4IQXA 2FJEB 4G1QB 2HLUA 2DJWA 5T7LA 4ED7A 1VLOA 4LF8F 2QL9B 2VJUA 3OVSA 4OZLA 3ADAC 3UR0A 1TU0B 1U1OA 4LSNA 1HD0A 1LWFB 1X9SA 2NPIA 3BYRA 3BKFA 1HQEA 1JXVA 1SQFA 1SV5A 1CVJA 5M2RA 1JLQA 5AE1A 1QD1A 5C42A 5IXUA 3C15B 4O0IA 2IM1A 2KKHA 5HANA 4OX9F 4NZ6A 3QATA 4BWJA 1GXTA 3LP1A 2VHGA 2X1GA 2DNZA 2VG7A 3RG6A 2MJNA 4DBQA 2R8IA 1KRPA 5KFKA 2XCPA 3GJRB 4YEAA 2HVIA 4ZJQA 1MMLA 3FCVA 4PKDB 1QJHA 4UF4A 2BA9A 2YWEA 1SUQB 3EJMA 4I1TA 4IKAA 4OMFG 1XMOJ 3HFZB 1SPBP 5H1SV 5D6GA 4K4XA 1KLMB 1O0PA 1VFJA 2RS2A 1K0VA 5D0EA 4B9MA 2RKIB 2C2KB 2VG6B 2RE1A 3DLJA 3DI6B 1KBRA 2OPPA 4KY3A 2AJFE 2R8JA 5CAAA 1SVDA 3T19A 3FRYA 2OH2A 2YQ1A 1O8BA 1MW7A 4LFBF 4ZA1A 1LEOA 2M70A 2IJRA 3DFEA 5GADU 4ECWA 4CH7A 4FPRA 1NK8A 2N4DA 1TKDA 1ZPWX 4HTJA 5I3UB 3KLEA 2R7UA 3DHXA 4JI8J 1S5ZA 4OZ2A 2K2PA 5E3CA 1HARA 5K9FA 5GAHU 3MPUB 3NOGA 3Q2SC 1BE4A 1CULA 4TKTA 1VQ7S 3ZNJ1 2UZAA 2OSRA 2B43A 4FNHA 1X9MA 2C2EA 2CJYB 4LBHA 1U0HA 2OJ3A 4F2SA 3CMQA 4R0JA 3KG0A 3DLGA 1UWBA 1SB6A 3RGIA 3H0PA 4EYIB 2GNKA 1VRUA 3DDKA 4G65A 3DDNA 2ZM6F 2B7CB 3M8PB 4O4GB 1G3OA 4WTYA 3DDIA 4BC9A 3SDEA 4ZJLA 5L8RC 2H65B 2P9GA 3E8OA 2Y1JA 5C42B 4MJKA 5L1KA 4YR3A 4NL5A 3BR8A 1DARA 3BKTA 3FCWA 3RTVA 1A6LA 4B3MF 3RRHA 4UUWA 4WP9A 4ZLNA 4LF1A 3AQOA 3AOAA 3ZZYA 4DXLA 1UA1A 4LF6F 1RADB 2AX0A 3BGUA 2OEJA 4HL9A 5J1EA 2APOA 2RJZA 2FVPA 4CNZA 3I0SB 3ZXWA 1TZ0A 2B6AA 2ILZA 4EYHB 4DPWA 4YB5A 1IBKJ 2AYGA 2GVZB 1GNKA 1XR5A 2IDEA 3PYDA 3R5GA 4L3NA 3ZTOA 1TKZB 1EHWA 2BEFA 5ETVA 1D9AA 3QT8A 4KV8A 1FVQA 2H54B 2OP5A 3TWZA 1VQSA 4ZVGA 3W9HA 2DNKA 3RYLA 3PVXA 3LW5C 1PGZA 4FXDA 1L3UA 3CD7A 3GYGA 3MR2A 4EZ6A 5B0DA 2DNQA 5LT5A 1OQ3A 1VIOA 2H4YB 2NLWA 4PG6A 5KFUA 2DNMA 2X3DA 5GMKa 4XIUA 2R9LA 1QSYA 3GU0A 3ENWA 4PWWA 2J8AA 2V8HA 2MY8A 3DOMA 3WIVA 5AE3A 1U02A 4WU3A 3J7Z5 1FDBA 3DXBA 2XYHB 3QAEA 5HO4A 4DV4F 2JFKA 2QLFB 2BQ3A 2CQBA 4ZP9A 5ITHA 2BDPA 3BN4A 1EKRA 1C0TB 3UDEA 3RBEA 2FC9A 1YJ7A 3CSKA 4DSEA 3O5TB 4NLTA 3FDSA 3HKWA 1FWLA 4MH8A 4ZIWA 4A8KA 3UVJA 5C2GA 1WG4A 1FI4A 2BABA 3CIMA 1WHXA 2MDAA 3NCRA 4M5IA 4X62F 3OHAA 1XC9A 1CJKA 4WPAA 4M5NA 2DR7A 3VAFA 1TVRB 1KS2A 4P74A 2HW3A 3CIZA 3A8IA 3DOKB 1TAQA 4TXSA 1IR1A 5LL6d 1C0UB 1Y0HA 2LA4A 3GIJA 1FNOA 1X31C 3AB4B 1FNXH 3WX4A 1CPZA 4EU0A 3FEYB 3LTOA 4MAKA 3PTWA 3W61A 3CCJS 4QWDA 4ECZA 3TZYA 1PJ7A 5DQHA 2IYGA 1RU1A 2VFTA 3O44A 4PYAA 2GQCA 4QIVA 1HQ2A 2VC1A 4RNHA 4Y65A 4DPUA 2VQEJ 1NUEA 1R8PA 2GIQA 2YKNB 5D8HB 1C1BB 5F41A 3C15A 1AB8A 2XMJA 2MKYA 4RNFA 4NEZA 5FIIA 4YDDB 3PKYA 4H4KC 3ET6B 3F73A 4X4UA 3IAS9 3W66A 1DFDA 1KFDA 1S9EB 4KGMA 5KFTA 4F4AA 2YWWA 4O3OA 1RLCL 5L46A 1JLAA 2L3MA 4YR2A 4CLYA 1RAIB 2Z30B 3J81j 1XJWB 6FD1A 3QZ8A 4GKKF 1UFKA 3C3LA 1XQIA 2ALZA 2D9PA 4P2FA 1M0SA 3BEGB 4W92B 2LVWA 3GMGA 4OZ3A 4DV1F 2XEXA 2Y0SD 5G4DA 3SDEB 5CD4A 1NJXA 4F8RA 2D7SA 1Y3JA 4DR2J 1VJQA 4NASA 1SJ4P 1HLWA 1FF2A 2HWHA 3DRSA 4Y2IA 4K59A 4O3PA 3IR5B 5GADI 3E51A 1N5YB 4ETZA 4K50A 3CJRA 2VF3A 4C8NA 1VQNS 5CYQA 3R6LB 2LMIA 5F0UA 2N3OA 4UQTA 4K4YA 2D3O1 1RT5A 2OELA 3NLCA 4A4JA 1VYAA 1VRUB 1NRKA 1ZOTA 4WF9Q 1WSRA 1RWKB 4B3TF 4DSKA 3HX9A 4KGZB 3HHLA 3MM9B 5J2MB 4LRFA 4HVZA 1TELA 4ZLJA 1WNEA 1URNA 3G8QA 2PA8D 1FXRA 4ID8A 3NGUA 3M8QA 1VHIA 2B7BB 1SXLA 2W24A 5E3AA 1NJYA 2W2OP 2D3UA 3SFGA 4NXMF 2HHHF 1CJTB 2B5JB 2DH9A 3A12A 2DR5A 1O5JA 1MROA 5IQ6A 4GKKJ 4TY9A 4DR3F 1RU2A 2DITA 4KE5A 1VBYA 3L09A 2KTQA 4F02A 1A9NB 1H2UX 4WYLA 3RJMB 5F8JA 2JZ5A 3AOCA 1SV5B 3MM5A 2QG9B 5KFCA 2GGPA 2OTLS 1LW0B 2FDNA 3QNWB 3FKBA 1KWMA 2F7VA 2MZQA 1YVFA 5KFLA 3AY0A 3EDRB 4NMLA 3KK1A 1VBKA 2K8GA 1G2EA 1JXEA 2BMBA 2HGNA 4I0WA 1QAJA 4DQRA 3HM9A 2Q66A 1XK8A 2DD8S 2F9DA 1R8BA 3W2WA 1KONA 4NLXA 3KK3B 4IRCA 2HHTA 2E1CA 4LF2A 2DGSA 4RUCA 1KEKA 3CVKA 3W5ZA 4F2RA 3DM2B 3OR2B 5F8MA 4FVCA 4BCAA 3EX7B 4ED4A 4HYKA 2OLWA 1S0MA 2MZSA 3AXMA 5DG9A 1FA0A 5IOLA 1NPPA 4DR1F 1J5EJ 1VOMA 4U9RA 1U6FA 2HFZA 1YG0A 2BBEA 2HFNA 4DL6A 2NSCA 2E9ZA 4DR6J 3UR3C 1KQSR 2QTWA 4IH5A 3GJTB 1E6VA 2V4JA 4OZ0A 1HNZJ 1ACMB 4PG4A 2I1RA 1RWMB 2C42A 4J9VA 4RUAA 2G0IA 2VUGA 2JEFA 2FZGB 1KHWA 4P71A 3KFWX 1JLCB 2HS4A 5C24A 5A8WA 3KG1A 4JI6J 1VC0A 1Z4UA 3LP2A 2AZ3A 3MTKA 4CM2A 2DNPA 5D4PA 2FHJA 2IBOA 2N3LA 4NE9C 3SCJE 4TU7A 3BV8A 3MAQA 5HMXA 1TKXA 2B4PA 4CI0B 2DXEA 2ZEJA 1TL1B 2MQNA 4H4MA 4DHVA 4AL6A 2XULA 1WTBA 4KGXB 4LF9J 2IHR1 4PG7A 3J81U 3H4BA 2W25A 2WAQD 4DUZJ 3T1HF 4M5GA 1X5TA 4RLEA 4A8WA 4XDCA 3X3UA 4S0MA 1H0HB 1EKSA 4K4WA 1OPZA 2ZOMA 3W9JA 1NPRA 2XMMA 1REGX 2YNGA 2VBYA 4KQZA 4ZVOB 3IWXA 2V9WA 2RSQA 1YTYA 1KR4A 1NU4A 4USUA 4QQBA 1X0PA 4OIXA 3HSJA 2F9JA 4BLGA 3CCVS 2O66A 2ADCA 2DO4A 4MTPA 3VAHA 2R7XA 3PW0A 1S1TB 3BGRA 1ZA1B 2CQHA 2CVIA 2G13A 2K06A 4PPDA 5F9NA 2RRNA 4DUTA 2R2SA 1JJ4A 1FJGJ 3MEKA 5A76A 4FBTA 2IMWP 3KWMA 5DZ7A 1B3TA 1VRQC 3JTOA 4IUFA 3UE2A 1HNZF 3IG1A 3PIPQ 1HKAA 2B4UA 2Y1LB 3BF4A 3DGPB 2QRRA 3DLEB 4QWBA 1HYSB 2IPOB 2QGFB 2DHGA 3SV3A 2J76E 3M8ZA 3CC4S 3EXCX 5CQGA 2FGCA 3IGVA 2IIHA 1KOHA 5DDPC 3SQOP 2ZH6A 3M6XA 4LF4F 1JNZB 3THVA 4W90B 4YUDA 1GK8A 3HKZD 4ZP7A 5EUHA 4Y00A 3FQLA 4C8KA 2GIFA 2OAUA 4DV3J 3PW2A 2IVFB 2VASA 1LFWA 3RB3A 1EQ0A 2ZM6J 3SSQA 4CM0A 1F2GA 1XERA 1LKZA 3MMAA 1EIYB 3MM8A 5KFRA 2B4VA 2KFZA 1N0UA 3JSMB 1R0BG 3DOMB 4X4PA 3OJUA 1KD1T 2M2BA 5CYQB 3QO9B 3CB4A 4YN3B 2XY7A 4LF7J 3PFOA 3WC0A 1T0TV 1HWKA 2WW8A 3M8WA 3T6BA 1HI0P 1FDAA 1S48A 5F3ZA 3D1OA 2B3TB 2V67A 2W9BB 3BYPA 1ZM4A 4HDHA 3OTBA 1F3VA 1YQHA 1ZAXA 2DGTA 1URRA 2JSXA 4HT5A 2VB6A 4GO7X 2J0SD 2YKQA 2ZH5A 2VJVA 4TLRA 3I5AA 4R5PA 1RT3A 2CJBA 3ET6A 1CJUA 3MMBB 3TAMB 4J5OA 5J2PB 2BANB 1CEZA 1T9VA 3M9MB 3AJ2A 3K5NA 3GSDA 2CQ2A 3AOBA 2MKIA 4LF4J 4RW4B 2YX1A 5KFZA 3CMAS 2HVZA 2ZOGA 2DPIA 3J80U 3KOAA 4EWTA 2ZZMA 2FJWA 2PC6A 2VDIA 5E2QA 1SL0A 5HVHA 2DNNA 4PUOB 4I56A 4O44A 4I2QA 3BQ2A 1TK5A 2P5VA 4WFAQ 1KVIA 4V19J 3KHRA 1HBUB 2ALYB 4X66J 5GAHI 2VQFJ 3QQCD 4K7QA 1VK8A 3PRDA 1RWVB 2QYGA 2U2FA 1LW2B 2LU2A 3LP0B 4FP9A 2XHWA 2HHPA 2ILYA 1RDRA 1V5VA 4MKVA 5M2UA 1UETA 2XMKA 2C2DA 2RD5C 4WCEQ 3PR5B 4B9LA 3R2CJ 4I67A 2Y1IA 5LMNJ 3MCNA 2KYXA 2ZZNA 3SCIE 1TKZA 3BPSP 2ZH2A 4NXMJ 2ZHOA 3D9BA 3UQSA 3TAQA 2D9OA 5ETLA 1YJ9S 3G2XA 1PYTA 1JMTA 2IRYA 1X7VA 2ZNZA 1RA6A 3KKFA 4PABA 3DRYA 4Y28C 5HSPA 1VQOS 2KM8B 4WE1A 4ERDA 1ZAWA 2P9CA 1VGYA 1LWEA 5F8HA 5D3GA 3TUPA 2RQ4A 4LSLA 5D15A 2NR0A 2V4RA 4P7TA 3M32A 2VFSA 2GHVC 1TR0A 1MN9A 1YZ6A 3LPYA 5MAOA 4OX7A 5KG3A 2WBRA 4ED1A 3H5UA 4CO4A 1HHTP 2BJ9A 1GMWA 5LSOA 5AT1B 4ZVQB 4ZHRB 3BN7A 4NXNJ 4UOFA 3SEOA 1N52B 2YPZA 3ISZA 3UD4P 1H7XA 1PO6A 4CO5A 1MG7A 1VLYA 4PQUB 5KFVA 1S1WA 5KFDA 4LREA 1GT8A 3OLBA 3K57A 5K8NA 2MY7A 4RUHA 4K5RA 4BWMA 3VAMA 2UU9F 1RJJA 2H5EA 3TX0A 5HJXA 1D9DA 3DXSX 4NRTA 1MMDA 4PZVA 3DOLA 3HD1A 3L9ZA 1JNRB 1VS3A 3HVRA 5H9EK 4P10A 2UP1A 4C4WA 1NEEA 2CDRB 2R7RA 3CJ0A 1IKXB 3OFHA 4CLPA 5I3PA 5A2QY 2GQ2A 2I38A 2ZUAA 2QL7B 5L1JA 4YOEA 2VFUA 3T5LA 2JC1A 1JLAB 3QO9A 2WTFA 3QFWA 3GFZA 2Z2MA 5KT5A 3K5LA 1Y11A 3JB9k 2OPQB 3T5JA 4MFBB 3NNCA 3D1HA 2CDQA 1DTQB 2C3OA 2XMVA 3EGWB 1LK5A 2GGPB 4QPXA 2IY5B 4DZDA 4DV3F 2BQUA 2GJFA 2J9DE 2WB4A 4M5HA 3R5DA 2HEKA 2QMXA 1TV6B 2V8DA 1V5IB 2Z2ZA 2NZCA 3G96A 4LSLB 4G1PA 4QIEA 1RWOB 2F1FA 3DRPB 3ZZ0A 4M94A 3QZ7A 1HI8A 3M30A 4OYPA 2DGOA 1TKTA 2CIMA 3OXLA 1VDHA 3CD0A 4TVAB 3TAMA 4KFBA 2AD9A 1IUJA 3NWRA 4YR0A 3N6NA 1FWKA 1L5UA 1RTDB 2F65A 4WP8A 1GQEA 1KOOA 2XWXA 3OTEA 4C3MA 1GH8A 1TK0A 1K0TA 4FS2A 2MQLA 1E6YB 3IC1A 3BSAA 5KT2A 3I4PA 4MK9A 2JH3A 3VVTA 3MFIA 1U1MA 2HNZA 4QU6A 1CLFA 4KO0A 1U1LA 1JQGA 4NZ7A 4U7UK 3PXGa 9ATCB 2CKWA 5LJ5Y 2E44A 3UN2A 2J5AA 2IJNA 3NG8A 1YRXA 3DRPA 4DV7F 3KJNB 4OL8A 2J9DA 2HWIA 5HK4A 2ZBIA 3FBEA 1R0AA 1N32J 3EGVA 1TUWA 5DS7A 4JI3J 5AXNA 1U09A 3TQEA 4C11A 4USVA 1X60A 2WHOA 4FPIA 3T9NA 4Y2AA 3TO8A 1UVKA 2O67A 2V5HG 1IKYA 1TMMA 4U96A 1PCAA 3V6DA 3KHGA 4JI3F 4PG8A 3IS9B 1UP1A 4EGLA 1GX6A 1TKXB 5IS2A 2LXFA 2PO4A 3EVMA 4K5SA 3VGVA 5IWAF 3T3FA 5KFIA 2CPJA 2UUCF 2BKNA 5K5MA 6AT1B 1RTIB 1EJ7L 5JMNA 3G6YA 4NI2B 1IWAA 3C16A 1HI1A 3E01A 3JTNA 4I69A 1JLEA 2RDJA 1MMNA 2DO0A 3POTA 4J9UE 1IQTA 1IBLF 4BBYA 3D54A 2BW7A 5KFWA 4OI3A 3TA1A 1RAAB 4DPXA 4QWCA 2HZAA 2BJ8A 2M8HA 4OI6A 2BKOA 3AH6A 2EPIA 1FRKA 5E3RA 8RUCA 3UN3A 4ZLPA 5K8MA 2XY6A 1U49A 2C2OB 2IM2A 3OPKA 4G3IA 1I94J 2GMLA 2LDIA 1LW0A 1U25A 4ED3A 5KG5A 4Y3CA 2N7CA 4EFAC 1YBTA 3AA9A 1VRTA 1W26A 3W7BA 1YBUA 4USJC 1JX4A 1VQ5S 2Y8WA 3M2RB 2A3JA 5IQQA 5HL7Q 2DXFA 2UUBF 1SH0A 4OJ3A 1UWBB 3DRXA 4OYAA 4IG0A 2XQCA 3Q2TC 4ZCKA 5CD4H 1SCJB 1TMJA 2QFJA 2NXEA 1Q16B 2F4FA 5KFSA 3THTA 4WTOB 4LIWA 2DKOB 2BM0A 1Q5VA 1AT1B 1C1BA 3QFHA 1RHKB 1U2FA 4H4KA 3I87A 5HMZA 1Y5NB 3MR7A 3QWUA 5HROA 2UUWA 2CAJA 4K2JA 3UNYA 4YY3F 2ZE2B 4NLUA 4OYWA 1S9EA 5IFMA 5BR8J 2LDYA 1KVKA 4NLQA 1RKJA 3R6GB 2HURA 2JRSA 4FS1A 1TP7A 1SC6A 1RKIA 3MMCA 3AQPA 2CPHA 1S0NA 2HWTA 1HNXJ 3KK2A 3NL0A 2XS5A 1VIXA 3IMQJ 4CYUA 2VKRA 2ZITA 3IA0A 5L38A 3QSYB 1L3VA 2JEGA 3RW6A 3Q23A 4IH7A 3BGFA 3NS7B 4ENOA 2GA7A 1OY8A 2EC0A 4LFBJ 1NZ8A 1FXLA 3M1VA 5A8KB 1S4FA 2WRMA 3UVJB 3VGSA 5HROB 5J1NA 4GO5X 4MK8A 3JQKA 2V9KA 2L9WA 1AA1B 2HNZB 3BBCA 3MCMA 4LQ3A 3AB2B 3I4HX 3MPDA 2KRRA 3CDUA 1SKUB 2CG8A 4NLYA 4ELTA 1WC5A 2MQOA 1S1VB 2VC0A 3NEKA 3A4TA 1BY9A 4USMA 4WFBQ 5AJ3F 3MMCB 2EG1A 2VG6A 1R7IA 3HHKA 2LCWA 2DB1A 3GCWP 5CA5A 5KTQA 2HHQA 3I56S 3T41A 3W8PA 1TL7A 5U47A 1RYSA 4I2PB 4B3RJ 1JKHB 1S6QA 3FFIA 5A2QU 2F4VF 4IDKB 4WXWA 4M5DB 5KFYA 5AJ3J 2YKNA 1ELOA 1RCOB 3DNCA 2Q43A 3V81A 3H5SA 3KDNA 3NAIA 2XLIA 2Z56B 3I96A 1Q8BA 4CO1A 2OPRB 3MMAB 4ED2A 1R0CB 4DS4A 2YH1A 1FEHA 5KFOA 4EUVA 4ZN3A 4ANEA 3SQGB 4MIWA 5ADZA 3H2LA 4Q44A 2QSFA 3POTB 1TL4A 4P2MA 2E5GA 3IR6B 3ZZOA 1U6BA 2ZD1A 7FD1A 2FY1A 2J9CA 2OIHA 3C19A 4IH6A 2H5IB 3SMZA 1FXDA 3M4XA 2G2OA 3AODA 3D1QA 4HLBA 4CRJA 4CT9A 3TA0A 4C0BA 2VIHA 3LO3A 2AGPA 1Q1KA 4NLOA 2QLBB 3JSRA 1VQ8S 2QYCA 5E3QA 3GIMA 1NMEB 3GIKA 2DGVA 1KN6A 3R27A 2YNFA 2ZH7A 1WF0A 2RF2B 1VCTA 2GQQA 2M7SA 4IFVA 2BW2A 2FVCA 4PEOA 3SV4A 3UN5A 1T94A 2KT2A 2MQMA 1D1UA 4EBDA 4F4KA 2E1PA 1Z2LA 1JLFB 1SUQA 2CWXA 5BYSA 3HT3A 4DQPA 1R8AA 2FJVA 1R89A 3MCSA 4QR0A 3KJFB 3T6JA 4WJBA 1J27A 1U2RA 2B0GA 4R8UA 1HNVB 4CIOA 2ZWOA 2Z8QA 2YNGB 4CZCA 2HAIA 4ZVTB 1JLQB 4PAAA 3AD7C 4KT0C 4M1KA 1RBAA 4L6V3 4C0HA 3PRVA 2ASDA 4UY8T 3J7ZT 3PFEA 3AXKA 4DG1A 4UT4A 1UVJA 2IM0A 3C6UA 1V3RA 2JVOA 1BGXT 1RHMB 2BE2B 1C4CA 1JLEB 3GV5B 4IFYA 1K44A 1TVRA 2R2RA 1FWPA 4LMZA 1Y10A 1RTJA 1OQ6A 1Z1ZA 5DZ6A 3MWBA 5KOWA 1PYSB 4L74A 1KHVA 4O3NA 4X84A 4OI4A 1PKUA 1IJFB 1FTCA 2UV8G 2VU5A 4LJMA 5A6PA 4P6QA 5B08A 2Z0GA 5HQMA 2HG4A 2WONA 4R8UB 3CCQS 2FJAB 4JBCA 3TRGA 1FT8A 2DNHA 3QGPA 3M8RA 3CDWA 4RBTA 2BVZA 4GMKA 5D0RA 4YY3J 2DNYA 3R5JB 2FD2A 1S9GA 4DI6A 2OI2A 2AX1A 2E5LF 1LQ9A 2NCKL 4IQMA 2RNEA 1FCAA 3KJQB 1NJZA 3R1LA 4DSIA 1AFIA 2FJBB 2KYZA 4ZMMA 5E41A 1SJQA 3OFEA 5ETPA 3G6XA 1VR6A 4Y2MA 5H9FJ 5RUBA 4UOCA 3CCSS 1FHTA 3P8BB 3TJ8A 3G6ES 3VAGA 3GP9A 2MLYA 1VC6A 2NZ4A 4B9UA 3ZZTA 3D2WA 2A6OA 4KPYA 4KV8B 2J6SA 1DAXA 3ZZPA 2GX8A 1T3OA 1R6VA 2Y8YA 2IDLA 1V9OA 2XSFA 1HBOB 4B9SA 2YY3A 3T1YF 1U8SA 2C2NA 1UEVA 1RSCA 1CS4B 2Z58B 3QMQA 5HAOA 1WOOA 3V4MA 4FN5A 4RNNA 4ED5A 3I0RA 3CC7S 2HLTA 2JNJA 1ZM9A 3UDCA 2CZ4A 1MWYA 4OLPA 3GG0A 1WD6A 4KYZA 4OZ1A 4P72A 4TNOA 3KUEA 3M2UA 2HBRB 3UDVA 4B9NA 1RT2B 1QSLA 2MHEA 3LAKA 3T5KA 2XM3A 2KXHA 2QA1A 1TL7B 2RMLA 2GHPA 3E3XA 4P2XA 2QL5B 2OPQA 3IBCB 4EZ9A 1F5AA 4ID5B 3PX4A 2UXBF 2ZKTA 3BS9A 3I31A 1ZBTA 3W64A 3QIPA 5HQ8A 5KG1A 3TR5A 3FVYA 4OHYA 1NSPA 2H9ZA 3GV8B 1QTNB 3ZTSA 4JUZA 2F40A 4C97A 3OL8A 4NXNF 2OPRA 4Q7AA 3MR3A 1VQPS 3K58A 3BB5A 3HK2A 4YB6A 5HI7A 2RB7A 5H9EJ 4ZVUB 4JV5F 4F4ZA 2GJIA 1TK8A 2W2PP 2MTLA 1QTMA 5KT4A 4XTTA 3I5CA 3R3TA 2QA4G 4JI1J 4TQSA 1AYEA 2HQFA 5LMUJ 3UFCX 4ECUA 3QJLA 2OEMA 3Q83A 3CTRA 4HHHA 2VDHA 1T9UA 1Y5LB 3NNHA 1NB2A 4NZ0A 4O3RA 1UVNA 2XBPA 2MXYA 1SC3B 2CRLA 3HT0A 1JJCB 1HBUA 2E1MC 4J91A 2HQ3A 3KUGA 1UJ6A 4OI1A 2I5JA 2HK2A 3KNAA 2CQDA 4OYXA 1HPZA 2G9OA 2J7WA 1FEEA 4PCQA 4NMXA 4DZ6A 2FVQA 2IYIA 2YQ3A 1VHFA 3ETMA 3PHTA 3IWLA 4IFVB 3GJQB 3ZTQA 1NH8A 5E0OA 4UUXA 5HP1A 5IWAJ 1HFEL 4DFKA 1N33J 1Q0NA 4LT6A 5ETQA 3RB6A 2CQGA 3FGVA 5A8RB 1Q7YT 4LFAF 3MD1A 1DQ8A 4Y0FA 1NXIA 3PM9A 4DUZF 2XO7A 3SI8A 3NNAA 1QUPA 2AJQA 4TY8A 4DQQA 4QYZK 2J0XA 3HFKA 4BHQA 4AL7A 2J0QD 3QJPA 4C8MA 2BACA 3O6QA 2BRKA 3C6UB 4B3RF 1EP4A 3KHLA 1OSCA 1WUUA 2CFXA 3BR9A 4K4ZA 2CADA 3EM1A 4QWAA 5ETOA 4K4SA 4RW8B 2JX2A 3H25A 4JI2F 5I42A 1FKOA 1VC5A 1S6PB 4ELVA 5KG4A 4CLWA 2R3VA 2CQ0A 5CZXA 4ZPBA 1Q53A 3VR1A 2E9TA 3AA8A 1CBKA 4L73A 3MUVP 3AD8C 2AU0A 4LVNP 3V5RA 2XCAA 3KLGB 2MQQA 5DETA 1NSKL 1RWUA 3MPVA 3GV7B 1H3DA 2M3DA 3K0JA 3VAJA 3IRXB 1MLAA 2IAJA 2COLA 1XTZA 1Y5IB 3CCTA 2ZJPQ 3M9NB 2J6UA 3RBXA 3I5BA 4FVMA 4R25A 3TEGA 2R8KA 4K0KJ 3KG4A 4DR2F 1X4EA 4X4TA 3MPYA 3K5MA 2X51A 4A47A 4FXVA 1MSWD 1FD2A 3B8HA 4CLLA 1IKWA 4I4BA 4W4MA 5KFEA 2HQCA 1XNQJ 1PIEA 3AJDA 3M05A 3PZPA 3MECB 2Y9HA 1RT5B 1UCNA 3HPOA 3B4MA 4W98A 5DLFA 1OWXA 5BR8F 3OFGA 4Z2XA 3Q0AA 1AW0A 1WG5A 2GO8A 2C3YA 3FFIB 5IM0A 3FC9A 4OX9J 2VONA 1WKLA 1SJRA 4JV0A 4C48A 4U7UD 1HBMA 4X4QA 3N4WA 3T1YJ 5L39A 2HHUA 3BO2A 1WSVA 2V2QA 2IVYA 4UOHA 2MSTA 1DQAA 3ZTPA 5FD1A 1SQEA 4DUYJ 1N34J 1XMOF 3HVWA 3JYTB 1FD8A 1KTQA 4XDDA 1FE4A 1NM2A 4ICLA 1IKWB 4P9SA 4QIFA 3DCAA 3H7HB 3R8YA 1ZYQA 2P6SA 4HI2A 4K8RA 2WBMA 1X4CA 1APSA 4AQYF 1VISA 1XIQA 2H4WB 1SIWB 2B56A 4CO0A 1RTDA 4CO3A 1ITPA 3D6HB 4RBUA 5A6WA 1O51A 1IBCB 2C3UA 1IN0A 5C5JA 1HNIA 2QLXA 3MR6A 5JVHQ 2YNHA 4KPCA 1SH2A 1YI2S 1FKAF 4CCHA 2NXUA 3MM7A 3SBMA 2BJ1A 3D28A 2RT3A 2NPFA 5LSRA 3KLVA 4A8SA 3VZHA 1QVFR 3OR1B 1Y4ZB 1IJEB 2VFVA 3FZBA 3CJ4A 4A48A 2HMIB 3R7BB 3R9LA 2D69A 4KHRA 3ITHA 4X4NA 1PILA 5CCLA 1C1CB 4DLEA 1VK3A 1RT2A 3NS6A 4JI0F 3CJ3A 3KK2B 2EKYA 2YXLA 1T3NA 1D9FA 2HHXA 2VQFF 4NLWA 2D41A 1J5OB 3LWMA 1FRMA 1NDPA 1NNDA 4AXIA 4X4RA 2X1AA 2IA0A 2HFUA 3FQKA 3K17A 2PN6A 3EZOA 3MEDA 2PT0A 4NA3A 2YNHB 1SH3A 4FNIA 3U02A 2M9KA 4CT8A 3ISND 4DR4J 2CQ1A 5GAGU 4IRKA 4LF6J 1CC8A 4Y2KA 2KXNB 1IM4A 2W4PA 1QLNA 4F0HA 3FK4A 3DOLB 1G4CA 2WVCA 1WACA 4N47A 3S01A 2KRBA 1FDDA 2J0WA 4NI2A 3UPFA 2VPZB 3F41A 2WVEA 3MZIA 2BANA 4I7FB 5ETKA 3W2WB 5DGBA 4CP5A 2PI4A 2EKNA 1DLOB 1HHQA 1PJ6A 2GVZA 2OKQA 3OTOF 3PEJA 4OI2A 1Q8LA 4ZVPB 1NJIT 4IG0B 3O1LA 2BZ2A 3A8EA 3GJSB 1NJWA 1AXQA 5A8WB 3PW5A 2ACMA 2ROPA 4DR5F 4OFZA 1OO0B 1QVGR 5JVGQ 4X64J 2V68A 1EP4B 2PMHA 2YVSA 1WELA 3KLIA 5CABA 3VQSA 4GC6A 2XB2D 3HVTA 3Q22A 3DC2A 2A2DA 1S6PA 1S0OA 1H73A 5I42B 3J7A1 4PQAA 1NBEB 4DPTA 1SKSA 1RB0A 3NWGA 3CCUS 1VMBA 4Q0BB 4ECQA 2QO3A 3HF5A 2MGZA 3HXMA 2M0GB 4EK2A 4ZJOA 2PSZA 4WZMA 1WWHA 2IAJB 2OHDA 2V69A 1NB7A 4J9RA 1P27B 1NK5A 4NCBA 5D4OA 3IBFB 2QIFA 3OHBA 4DL7A 2AYBA 2A0FB 2RDIA 1REVA 3LALA
chains in the Genus database with same CATH topology
1MU2A 2GV1A 3PX6A 3KK1B 3QPIA 4RKUC 1TL5A 3H2VE 2MKJA 2UV8A 2EFQA 1QUVA 4C8YA 3DLKA 1FRJA 3EGNA 1QAXA 2ZUGA 3DLGB 4PXCA 1K1QA 1LFPA 1NO8A 2Z4PA 3TA2A 3H40A 3P49B 4CH1A 2VFRA 2WSCC 3M6WA 3UCZP 4RWXA 1Q86T 3H4DA 3S7RA 2F8HA 3KLEB 4RW7B 1FKPA 4B08A 4RBVA 3SYZA 2GCFA 5DO2A 3FMBA 4JV1A 4CNYA 3FSXA 3CD6S 3ZZRA 4OLOA 3JYTA 1XMQF 1N4LA 1WEYA 3CE8A 3US5A 1G6BA 1ZTWA 2R7QA 4MIBA 2E5IA 1BLUA 2CZVC 3ISNC 3CC2S 1NK7A 1VBZA 4N8NA 4HTIA 1KFSA 3M2VA 1HNWF 3TVKA 3V81B 2ROGA 4ZKAA 4FXWA 3E2EA 3C46A 2W9AA 5KFXA 1REVB 3H2UB 1YSJA 3SZ2A 5J2PA 1SL1A 1MWZA 3PNIA 1B0PA 2OTJS 1NKEA 4U6PA 3PY8A 3J7YI 4GKJF 1RT1A 3SFUA 1M1KT 5JUMA 2YKMA 3TOQA 2OMOA 3OL6A 2GW8A 2AGQA 2B9YA 3TVYA 5EN1A 1JWWA 3MEDB 1RISA 5GVQA 4DN9A 3BO3A 1W2IA 4X66F 2XLJA 3DLLQ 1U7LA 5DRKA 3TUJC 2RS8A 4LVOP 4ZCMA 3VWSA 3MDFA 4LIRA 3SQGA 5KFFA 2GO9A 3KNGA 1BQNB 2XG8A 3M32B 3C2PA 4OJHA 2D1CA 5F3TA 2AJ0A 1V6HA 1UKUA 2OPSB 2YNIA 5SZTA 1C0UA 5EWFA 2OPPB 1N5VA 5J2NA 4WXOA 3DN9A 4H54A 1Y00A 4NLGA 2QE5A 2V94A 2LEAA 4WZQA 5KAKA 2VOPA 4ETXA 5EHHA 3CDAA 1VQ4S 2YWGA 3OBIA 2VBZA 5HBMB 2OFHX 2VH7A 1R8CA 2IVMA 4TYBA 4G6VB 3RRGA 1P1TA 4DMZA 5KFMA 4LQ9A 4J9QA 1RQ0A 4QYRA 4F50A 3OL7A 4ECVA 3FEXB 2V4QA 3D0IE 5CZVA 4I6AA 1S79A 2C3PA 1HNVA 3DLBA 1H7WA 5T7LB 2J7KA 4J9SA 3V6HA 1F60B 3BSCA 2BYCA 2M52A 2F8EX 5CYJA 5HMYA 1YJTA 3KYLA 5MLCV 1HR0F 3G86A 1DTTA 1NZAA 1RK8A 2CVEA 2HNYA 3I32A 5DQIA 3OL9A 1S0VA 5LSLA 1S7HA 3LANA 1AUDA 2CJKA 3OR1A 1U1PA 4I6YA 1JXLA 3K5OA 4J9PA 3NP5A 2D3ZA 3GYNA 1XWLA 3KMSA 2AGOA 2JLFA 2FVRA 4EO6A 2MKSA 1JJHA 1FK9A 3Q8QB 2PEHA 4JI6F 2BQRA 3N6LA 5IT9Y 4N76A 3PEHA 2W8KA 1RT6B 2YWHA 2W4DA 3VQTA 2IM3A 1GTEA 3RR7A 2KG1A 2NS1B 4XPCA 4DV6F 4QU7A 2GHWA 4IOBA 2LEBA 1FKPB 2J7UA 4Y2CA 4LF5F 1B0TA 1X5SA 3M30B 2HQIA 3OLAA 4PR6A 1YHQS 1UVLA 3MD3A 3KLHA 3S6EA 1VQMS 1FKOB 3PJXA 2CQ4A 1JLFA 2EW9A 4HH1A 4PPZA 5A0YA 2P9EA 2XMWA 1Q8IA 1C2PA 4MFBA 2FJXA 4CTAA 1RYRA 1N54B 4NLRA 3PX0A 5KFNA 3QIDA 5BYRA 4LF7F 1HWIA 2HRYA 3NAHA 2A1BA 3KJVA 2E7WA 1K1SA 2ZNYA 2MKCA 3D0GE 1X8DA 4IOCQ 2HS3A 4ECSA 3ICLA 3RAXA 1QM9A 5IT0A 4IFYB 2VA2A 3DOKA 3HHDA 5E7OB 2BM1A 3CDBA 1JJ2R 3CJ5A 3OVAA 3LAMA 5FDLA 2DGWA 3JAMY 4C11B 2KM8C 3HDSA 5K8PA 2BR0A 2FLPA 4O3SA 3MOJB 4K0KF 4ID5A 3IS9A 2P6TA 3F56A 5B0BA 3NCQA 1RA7A 2OMLA 3M1VB 3NRBA 5A8KA 4TQRA 1J5EF 2R2UA 1YBAA 5I3QA 3KLIB 1B64A 1FRIA 1F9FA 1WHWA 4URQU 1HNXF 4ZVHA 3UNGC 3BSOA 4FYDA 1FTRA 2CQIA 2JL9A 4ZPWR 3UD3P 2XS7A 5B7WA 2HRUA 3O8WA 4G1QA 2DIUA 4ILLA 1UFWA 3UWTA 3MI7X 2NUUG 3AAWB 3MMJA 1CC7A 4RW9B 4ECYA 2K1RA 3OTCA 1KC8T 1GXLA 1J2VA 5AXKA 3U27A 2FGOA 4H4MB 3BJYA 3CCMS 2AQ4A 4RWWA 1YJRA 2NUHA 3GR0A 1E6VB 2V4JB 1FO1A 2LA6A 3VCDA 4EO8A 1KQKA 4V19X 2V0NA 4U67Q 2J9EA 4QBUA 3Q8SB 2XNRA 2HHSA 4RX6A 3CJKA 4QW9A 5GAGI 3PO5A 2CPZA 3R5BA 3CF5Q 1WF1A 3H5YA 4ECTA 1FJGF 4OQJA 3T5HA 3K8VA 3C66A 1JLGB 2LQJA 5I3UA 3CULA 2AP6A 3IRWP 3CCZA 2VD3A 2R8HA 1GXUA 3DMJB 3Q24A 4FF3A 4C3KA 5F0WA 1IQZA 3FSYA 4KFBB 2YTCA 4KSEB 4PG5A 1Y9OA 1QAIA 3RR8A 3UDLA 1M5OC 1RT1B 1XR7A 3PHEA 4F67A 2LEPA 3HHLC 1LWCB 4NYPA 4DOZA 2FTRA 3RB0A 5L9XA 4F3OA 3N28A 3K59A 2GIRA 1FESA 5BYQA 2ZDOA 2I5JB 2I0XA 1M5HA 2CJ9A 2MZTA 2VPWB 1HWLA 3VALA 2AV5A 1S6OA 3OQ2A 3U1LA 4YQWA 1RTJB 1WHVA 4OHVA 4KB7A 3GFYA 2JVRA 1IBKF 2EWHA 2DVIA 4DX8H 5THWA 2ZH4A 4X4VA 2JEIA 2O1PA 3MEGA 4Q2LA 4DDFA 1HQEB 2ATLA 2CJQA 2DHAA 3KJVB 2JWNA 4DLGA 1R27B 1RI7A 4Q2MA 2YX4A 4QZVB 4E98A 3CUNA 2W9CA 2DK2A 4B3OB 2XLKA 1XBWA 3H59A 5GAEI 2CPDA 2WK4A 3GYXB 1N5YA 2EFOA 3LH2S 2XC9A 1GTHA 4DV2F 2HPUA 2KJWA 3DLKB 2Q1LA 4F4WA 2KG0A 1N56A 4RW4A 2HYIB 3VAKA 1R43A 3OFFA 4D3GA 4I2QB 2J6TA 4KJIA 3ENVA 1EETB 2LYVA 3MPWA 2AJ1A 1E6YA 3Q8PB 1U26A 1UAWA 2VPYB 3MTJA 5B0AA 2KFYA 3NMAA 3EYZA 2RQKA 2RF2A 4C0OC 4E0DA 2W9CB 3V2UC 3RAQA 4FF1A 1UFLA 3WDOA 4DSFA 1QE1B 5DJBA 3W3SA 3KMQA 4ELUA 3L95X 4PWDA 1DLOA 2Q6BA 2VL1A 5C25B 1U1RA 2YKAA 1XNQF 2MKHA 3PO4A 1LXNA 1IKVA 1J5OA 2VPXB 3N5BA 1N88A 5CXTA 1H38A 4DFMA 3V6DB 2FHJD 2ZH9A 1DTTB 2HS0A 4M8LA 4ZVEA 4ILMA 3U1NA 1LWEB 5D3GB 2FIUA 4FF4A 4MKAA 3PJWA 2PFFB 3E01B 4NA1A 2ZC3A 5T14A 3NGDA 3MECA 1BQNA 3BDEA 4QW8A 1PC5A 4M63A 5B0CA 3FSIA 1HHSA 4UY85 1XEZA 2XSJA 3BSNA 2LQ5A 2DTJA 2L41A 1ROFA 4N77A 3OXFA 4ZPAA 1BWEA 3MEEB 4XAKA 4IG3A 1K8AT 4BS2A 2K7KA 4H4OB 3DMJA 3FEZA 4U7CA 4IO9Q 1HQUB 4DFPA 5J1EB 1IR0A 1R8HA 1VQLS 4NYOA 1Y7PA 3D0HE 1HMVA 3QJJA 2KT3A 4HT7A 2EBGA 1YWXA 1ZM2A 1S1UA 4JI5F 3GWCA 2A2CA 2E5JA 4NWBA 3LUYA 2M8DB 1N34F 1RTHB 1LWFA 5DQGA 1L3TA 1R6YA 4Z37A 1FNMA 2R4FA 1VQKS 1W2BR 1FRXA 4NLVA 1QY7A 4O23A 2MQPA 4TY8B 4NRUA 4F3MA 4ZK7M 4DSLA 3IO1A 4R5PB 2HHWA 3QIPB 5E5NA 2DNLA 2CPEA 3M8QB 5DM6Q 4UQGA 2PMZD 3QGIA 4I7FA 4NLDA 4TYAA 5DDQC 4QIWD 3QYYA 4MKBA 2QEXS 2GMJA 2WOMB 4XK8C 1M5VC 3GFHA 3ULHA 2KVIA 3IFEA 4CH0S 2CPFA 3HHLD 3J81Y 4PXDA 3GFXA 3PKMA 3CJ2A 5F8NA 3TP2A 3M2VB 3KTQA 3FMWA 1FERA 1DURA 3F44A 1HBMB 2QA4S 4YP3A 3NKYA 3JSYA 5KT6A 3HZEA 4DQSA 4KIAA 4IO1A 2B4OA 4PXBA 4ES1A 4KC5A 3HMJG 4UW2A 1ZETA 2A10A 2DISA 3KK3A 2DRBA 4ES3A 4RW9A 3C6TA 3SXLA 2XNQA 4N41A 2KU7A 2EVZA 5DDOC 4PQUA 1UMJA 4NLPA 3PDNA 2FJDB 4WFZA 1KQFB 4JI4F 4J9MA 5J2QA 1JLGA 4RNOA 5F8IA 2XY5A 1FE0A 1K73T 4OI0A 4C9DA 2QA2A 2XMTA 3N79A 2EG2A 1A7GE 1HPZB 1S1XA 3GZ7A 2O3DA 3HP6A 3ITHB 2G4BA 3SSRA 3CEDA 1N0VC 1YJUA 4F26A 3WC2A 3GB0A 3NGKA 2DH8A 5AXLA 1FJEB 3ZZUA 3B4DA 4RU9A 1RT7B 1ZAVA 4DUYF 1HNIB 3TYTA 1DBDA 3T1AA 3CGIA 3HLUA 3I9ZA 3BM7A 4WIIA 1KLNA 3MAHA 4TLQA 3DU6A 2DRAA 1IXKA 1MU2B 1PC4A 1UL3A 3FRZA 5HMWA 4DN0A 5DG8A 3T9ZA 1T03A 4DSKA 2XS2A 5D78A 1VJWA 4ZPVR 3LWLA 3L7OA 3SSSA 2I8EA 3RBDA 1HW8A 2W7AA 3V6KA 1GX5A 1JLCA 2FHMA 4RNMA 2YH0A 3DI6A 4AL5A 1OS5A 3Q8RB 3BZQA 2PA3A 3MUMP 1TUVA 4OX8A 4WFNQ 1U6ZA 2E7XA 2KHCA 5GAEU 4RZRA 2ACYA 3BGLA 1Q7LB 2LXIA 2A18A 3IWNC 2YNFB 4Q8EA 3IBWA 5L1LA 3UW1A 4J9LA 4QJVA 1XMBA 3RW7A 4MYUA 3M6UA 2CG4A 3MM8B 1T7PA 1WF2A 2C22A 3M2UB 1N36F 4DEZA 2OD6A 3LGMA 4MYTA 2KN4A 3I82A 4NPOA 3H5XA 5LXRA 1S10A 4F3QA 2HIQA 2V8VA 5CCMA 4ZPCA 5IZHA 1BD6A 2R8GA 3EUNA 5KOXA 2VODA 5EGYA 2W9BA 1S1WB 2IMOA 5I4MA 1EETA 1WG1A 3QWPA 1NK9A 2XGPA 1KQGB 3N01A 3W2VA 1B7FA 4QR1A 3TQ1A 3TUIC 1DZ5A 5HLFA 3HVTB 2VG5B 3G6VA 1TQLA 5HP1B 4C8OA 3OV7A 3MUTP 7FDRA 2BJEA 2LXUA 4ALZA 2XI2A 1CSJA 4URGA 2OO4A 2XI3A 2OFGX 3BQ1A 4HI1A 3V4IB 2DHSA 4KR0B 2ZHBA 1LOUA 1PSDA 1YRUA 2DBBA 5BJRA 2JDJA 4ZCIA 2KB2A 3SCLE 4FZVA 3MM7B 3N6MA 2UUAF 2JHEA 3P6YC 1Q4RA 1U48A 3TUZC 4TN2A 4FBUA 1DQ9A 5L1IA 2BXJA 2ZJQQ 1NH7A 2PDAA 1NKCA 1JLBB 2BV3A 5CHCB 4DL0C 2RUGA 4YB1P 2IFXA 3LP0A 4AYBD 2L08A 3OXGA 2Y1RI 1HL6A 2MZ1A 3BREA 4A8XA 5KFHA 1S49A 6FDRA 1SIZA 2XSJB 3ENQA 1VQ9S 4C98A 3IRXA 3HHLB 3MM9A 4PUOA 1FJCA 3NBPB 3PW4A 2HNYB 3BDPA 4JI1F 2KHDA 1M5PC 1QAYA 2K7JA 1KSPA 1UVMA 5K14A 5HLFB 1NKBA 2C3MA 3CWJA 3DHWC 4F4XA 1U45A 1F5BA 1HMVB 3H98A 1U47A 2AYEA 2B51A 3K7RA 5T41A 3CCRS 2JEJA 1UJ5A 1S9FA 1RP5A 2Q3PA 3FJ2A 4DV0F 2N82B 4DJBA 3RRKA 4BDPA 2JJ4D 1BQMB 3U7JA 4USIA 5G0RB 3MM6A 4JV2A 4XO0A 1N33F 4KGKA 2SXLA 2ZOFA 1CQMA 3GILA 3BO4A 4N56A 4WK3A 3DRRB 1I1GA 4A8FA 4P2SA 4QOTA 2DNOA 2GMHA 3VAIA 4C8LA 4J9NA 1VBXA 2ADBA 1FK9B 2KH9A 3M9OB 5LMUF 2OPSA 1H2TZ 1X4GA 2YNIB 1X0FA 3CCWA 1RT7A 1S97A 1QSSA 4C3LA 3RU0A 3SCKE 4LUBA 2LKZA 1T8EA 3DM2A 3OR2A 4ATNA 4DV5F 2HVHA 2B9XA 1GAOA 2I9SA 4WK1A 2MKKA 3HVAA 2AYMA 3O3LA 1UEUA 2RQCA 2KFNA 1XN9A 1NHVA 4KBIA 2HGLA 1Q81T 4PWUA 2B6AB 1X5PA 2MZRA 2RH3A 2ASLA 3PACA 4TU9A 3PW7A 3IN5A 4WFYA 2HFOA 4TU8A 4Q0BA 2X1BA 1C0TA 3P96A 4JI7F 2EFPA 3CT9A 1X9WA 1JIHA 1F5CA 1XNRF 1N48A 2VBWA 3VF0B 3HO1A 3LP2B 1KVJA 2M5YA 1H98A 1Q79A 5HBMA 2EK1A 5LXYA 3LP1B 4B9TA 2D74B 2DGQA 1CQNA 4KKOA 5D77A 4KO0B 4USHA 3HHEA 4KRWA 4IR9A 3CPWR 4X4OA 4DFJA 3G8TA 5LJ3Y 3ONQA 3IR7B 2RILA 3RAMA 5J2MA 2FHOB 4ZS6A 1WI8A 3GE9A 2XMUA 3PV8A 2IA6A 4OV1A 2QZ8A 2IRUA 3S8SA 2ZJRQ 1ZH5A 2KJVA 3TARA 3W2VB 5CYMB 4ED0A 3NMRA 3CDEA 2KZZA 1RAJA 2YX7A 3B78A 1D0EA 4DR7F 3P3DA 2RQMA 2Z2LA 2DIVA 1X4DA 2POKA 2X3GA 2YKMB 5KFPA 3UI3A 4ZHRA 1P6TA 2JLEA 2VA3A 3OJSA 3CMES 2UXCF 2JLGA 4WFXA 3M6VA 3MM5B 4I68A 1M5KC 4WKYA 2FVSA 5IM0B 2DNGA 4NA2A 2ZBCA 4I2PA 1H6KX 3OW2R 2G0CA 1L3KA 3CD5A 3NBPA 1UVIA 4HHJA 3N9UC 2LECA 3CO9A