1F60B

Crystal structure of the yeast elongation factor complex eef1a:eef1ba
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ELONGATION FACTOR EEF1A
publication title Structural basis for nucleotide exchange and competition with tRNA in the yeast elongation factor complex eEF1A:eEF1Balpha.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f60B00
1IJEB 4DR3F 2RJZA 2B7CB 4AQYF 1HR0F 4JI3F 1XNQF 4YHHF 4JI0F 4X65F 2UUBF 4X62F 2E5LF 4NXNF 1B64A 4KHPF 4DV2F 2KJWA 4DV3F 1N32F 2F4VF 2VQFF 2ZM6F 1CQMA 2UXBF 4X66F 1J5EF 4B3MF 4JI1F 4YY3F 2KJVA 1IBMF 1IJFB 4DV0F 4LF8F 3R3TA 3T1YF 1CQNA 4GKJF 2J5AA 5BR8F 2VQEF 1XMOF 4NXMF 1XNRF 4LFBF 1GH8A 1HNZF 4LF7F 1IBKF 1G7CB 4DV4F 4JI8F 4DR2F 4JV5F 4GKKF 5LMUF 4DV7F 4DR5F 4JI2F 2BVZA 1QJHA 2B7BB 4DR4F 4LFAF 1HNXF 1VMBA 5AJ3F 4LFCF 4LF5F 2HHHF 1HNWF 2YY3A 1I94F 4LF9F 4JI6F 1FKAF 4B3SF 4DR1F 1LOUA 2UUAF 4DR7F 1RISA 4DR6F 3T1HF 4JI5F 4LF4F 1XMQF 1N34F 3ZZPA 4DUYF 2UXCF 4X64F 2UUCF 1N33F 4B3TF 4JI4F 4LF6F 4K0KF 2BXJA 1N36F 2UXDF 4JI7F 1G1XA 4OX9F 4B3RF 4JYAF 4DUZF 5LMNF 5IWAF 1IBLF 4DV6F 4DV1F 1F60B 1FJGF 3OTOF 4DV5F 2UU9F
chains in the Genus database with same CATH superfamily
5KFPA 2HQCA 2RUGA 2E5LJ 4C3LA 4DSIA 2ZM6J 4G3IA 3LQVA 2CG8A 3M8WA 3QT6A 2HYIB 1KWMA 3LP0A 3HVWA 3K5MA 1RA6A 3IWLA 1J5OA 3V81A 1CVJA 2IBKA 3FMWA 2CPDA 1N5YB 1S7IA 3DLKB 2IA6A 5IFMA 2WVFA 2HQ3A 2VQEF 2DHGA 5D0GA 1BWEA 4MFBA 1HBNB 1G4CA 2MQNA 3FRZA 5B0FA 1QTNB 3MM7A 4HKQA 1I94F 1VI7A 1CJKA 2UUAF 2AWZA 1BLUA 2CQ1A 1SKSA 1WDDA 1SUQB 4UOGA 1AYEA 4Z37A 3NWRA 3J7YI 2AP6A 4B9TA 1JXVA 4CO5A 1WOSA 4OJ1A 2LMIA 5LMNF 2HSEB 4CH1A 4A48A 1HNZJ 1IN0A 2LP4A 2JNJA 4QWBA 1RA7A 2G2ZA 2Z56B 2VA3A 1YZ6A 4YY3J 1WACA 5H9FJ 3M9NB 4RW6B 4WCEQ 3RBXA 2GHPA 3QAEA 2YBVA 3QBCA 2GJFA 2B6AB 4JI2J 2PC6A 1S10A 1VRUA 5CZXA 1YK9A 4W98A 4WFBQ 5HLFA 2EVZA 5K9FA 3FJ2A 3EMTA 5CABA 2QSFA 2HHHF 4A4JA 4HTIA 1Q0NA 2B43A 2C3YA 2E5HA 4DN0A 4MK8A 3T5HA 1N5VA 3BGRA 2RHSB 1FJ7A 3SV4A 2NREA 2V67A 1NK5A 1REVB 2VUGA 1U1OA 1N32J 9ATCB 5B0GA 2XHWA 5D77A 3M8QB 3MPDA 1N0VC 3QRQA 3DGVA 3I5BA 4DBQA 4K2JA 3TUIC 2BOAA 1FEEA 2GMJA 4F8RA 3QGGA 1N5YA 2PMHA 2QO3A 4KBIA 3DLKA 5KFHA 3RB0A 1SJ1A 2GV1A 4JI1J 3O6QA 1TMMA 1K1QA 2JLFA 4DV2F 2KJWA 1HBNA 1WEZA 3OSPA 4F0MA 3I6PA 1QAYA 4MTPA 2XGQA 2HWIA 3MMCB 4A8OA 2G4BA 2CZ9A 1X4CA 3TANA 2ZHOA 3NL0A 3MI7X 4ED2A 1P6TA 4J9SA 3CJ2A 1HWKA 2H5IB 5LJ3Y 1SUQA 1FRJA 1VBKA 2VPYB 2FJWA 1IWAA 2DPJA 2FZKB 2KHCA 1NPRA 4DCJB 1U1LA 3T9NA 2KZMA 2LU2A 4CO4A 5D4PA 1OY6A 2MQLA 1O51A 2JEFA 3SCKE 3QFHA 2QMUB 4NLGA 3R6LB 4RW6A 4TQSA 4QPTA 4CM2A 2ADCA 2FZGB 3MUMP 2FLOA 1BMQB 3C16B 2DGSA 3MCOA 2B6AA 4ES3A 3NAIA 5HMXA 1Y10A 4ZVRB 1CJVB 1HW9A 4WXOA 2H51B 2B0GA 3RB3A 2F65A 4JP8A 2QMXA 4USUA 4U7UK 3L7PA 2ILZA 2JZ5A 3TA1A 5JMNA 5IC4B 4ECWA 4QIWD 1SXLA 1T9VA 1XMBA 1FKOB 5ETNA 2N4CA 3M2UB 3B4DA 5B0EA 1REVA 4TYAA 3R6GB 1JXEA 1EKRA 4JOUA 4ZP7A 3M8QA 3H8YA 2L41A 5J1NA 3CTRA 3UNYA 3PJXA 1VQYA 1RABB 4IH7A 3HVTB 4F02A 2ZBQA 2LVWA 1R8PA 1VQ4S 4C8NA 1YRUA 4OX9F 5KG2A 3NLCA 3GG0A 1ZA2B 1WC3A 1RAFB 4DN9A 4ZPDA 3O3LA 1KNZA 2MKHA 3AT1B 1CEZA 2GFFA 1UFLA 1HMVB 2M9KA 3AB4B 2ZJQQ 3MMCA 2GQQA 1X5TA 1FJCA 2AJQA 3CE8A 2F4VF 2OAUA 5LMUJ 4DSJA 2J0XA 3DOLB 2VC1A 4P52A 1KP6A 4JI4J 4ZVFA 4ZCIA 4NLXA 1U6ZA 4DV4F 2ZBIA 3FZBA 2M8DB 5KFMA 1RAGB 4DV5J 1VQMS 2JVOA 1WTBA 3MTKA 3VAKA 3BKFA 4YEAA 2B8PA 3S1TA 1AUSL 1FTRA 5K8NA 2ATCB 3C16A 2KO1A 2AMCB 2GAHC 2PMWA 5F8NA 4I56A 3IO1A 1CJVA 1QY7A 1YVFA 1S76D 2R7SA 3GQCA 3I0RB 1SL0A 4IR1A 3W1YC 3PX4A 1SH0A 4KHPJ 3QQCD 1ZZFA 3WIUA 1TUWA 3UN5A 3IAS9 3IWXA 3AD8C 1S0OA 4GKJJ 3ZZYA 2KZZA 1FKOA 4RUHA 1EX8A 3R7NB 3M2UA 2CVEA 4C98A 2KM8C 5D4LA 3R27A 2UUCJ 2Q6BA 4B3TJ 4YB7A 2RH3A 5ETLA 4FS2A 1I5OB 1C1CB 3PJWA 2EBEA 5BYQA 2WSFC 1K1SA 3HVTA 3ISZA 2MKJA 3TAPA 4O4RA 1E6VB 5JUMA 2KFNA 1YJ7A 2HMIB 4DJBA 2RS8A 2N82B 5KG4A 3JTPA 3A8JA 3BSOA 4KB7A 1IQTA 1HMVA 1LKZA 3IG1B 1O5JA 4ZN1A 3LALA 3BO3A 3GFHA 4KH1B 3FBCA 4FNIA 4DV6F 1IR0A 4F4YA 2GMHA 4OYOA 4HI2A 3RRHA 2A18A 1KKHA 1JNRB 4QIFA 4MKVA 1WDTA 3OT9A 3DOLA 1NJXA 5KG6A 4BHQA 2KI2A 4WZQA 1FX2A 3QRPA 3OHAA 3VGTA 5HL7Q 2DGOA 2RKIB 1UEVA 2QN6B 4IOBA 4DV0F 4ZJQA 3CMAS 5CD4H 1KOHA 2M2BA 2ZOGA 3EYZA 4LF1A 4C8KA 4FF4A 4F26A 2L9WA 3FQLA 2NUUG 5J2MB 4MYTA 3VAFA 4I68A 4NLYA 3BH6B 5L9NA 5AXNA 3Q8UA 3AJ2A 2ZBPA 4YP3A 3Q89A 3PW2A 2GGPB 2WK4A 4J9UE 5G4DA 2E7VA 3O1LA 1GXUA 3I0RA 3MMAB 2QLJB 1KQGB 3G86A 2CPJA 3J81Y 2M88A 3AQOA 1G1XA 4F2SA 1L3SA 3CXCR 4E8UA 1P1LA 3C14B 3G6ES 3T1YJ 3I9ZA 3C46A 3CUNA 3SQOP 5IT0A 4ZPCA 4DFJA 2OEKA 5D0HA 2ABYA 2LKZA 5A6WA 3KOAA 1HI0P 4QWDA 2J6SA 2FGCA 2QL9B 1C1CA 1FNXH 1UAWA 4JB8B 3H4DA 4FBUA 2UXCJ 1E6VA 1S6OA 1CQNA 2XB2D 4WE1B 4AE5A 4X4TA 1D9DA 2HMIA 3KYLA 1SC4B 4Q2MA 2FC8A 2B7BB 4B3RJ 1KVKA 3K17A 4PXDA 2RDJA 1WF0A 2MLYA 3W9JA 4CM0A 3OV7A 3TJAA 1WC5A 4FYYB 2GC8A 3IG1A 2DHAA 1ZAWA 1T94A 1VYAA 2BXJA 2BE9B 2E1PA 3NXZA 4NEYA 4ZJOA 5L1KA 4PR6A 4ZP6A 4ZKAA 4F3OA 2F9JA 2Y1LB 2W01A 4ELTA 2CA9A 4BWJA 4LQ9A 2RKIA 4URSA 3CMQA 2RILA 3IC1A 4OHWA 3H2UB 3GYGA 1JLFB 1FRIA 4ETZA 5J2MA 4FXDA 1IBCB 4ECZA 2FLNA 2MZTA 4PCQA 5F0WA 4CLUA 4OFZA 2VC0A 1U6BA 2AV5A 2DHXA 3GIRA 2GGPA 4YOEA 3FSXA 4BBYA 1HNXF 1URNA 2RB7A 2MSTA 4NZ7A 1WC6A 3MMAA 3ZTRA 3Q86A 1U8SA 2HLUA 3RTVA 1VC5A 4JV2A 2H4WB 1HR0J 3TO8A 3H7HB 3C14A 1VQ5S 3BF4A 1Y11A 2M4MA 1NB7A 1YJ9S 4ZS6A 2NPIA 3I4PA 3JSMB 2BACA 1HHQA 4ALZA 4KT0C 4M5KA 4I4BA 1RT4B 4UY85 2D41A 1XN9A 4N76A 3AXKA 3PM9A 3H5YA 1AXQA 4LT6A 5H1SV 1SC6A 3WX4A 2G2YA 3RB6A 5KG3A 2DK2A 4WE1A 5D8HB 3D5MA 2VOOA 3GONA 3GJRB 3VGSA 3OSNA 2F7VA 1IBMF 1VQPS 1DTTB 2Y1JA 5HJYA 5IT9U 1N33J 1R43A 1M5VC 1Q7YT 2EI5A 2AEFA 2OSRA 5ETRA 4N8OA 4LR9A 4IO1A 2MGZB 1YJRA 4ANEA 4AL5A 3HHKA 1L5UA 2YY3A 1XMQJ 2QLFB 3AAWB 4OIXA 5C2GA 1FFGB 1U1QA 5E3AA 2U1AA 5T41A 2DNHA 2BQ3A 4P9SA 4KC5A 1HKAA 1RTJB 4CLZA 3G6XA 4K0KF 3K5LA 1RADB 8ATCB 1Y00A 1H98A 3FCVA 2HS3A 4DFMA 4J9NA 1PILA 3I9V9 2DISA 4GRSA 3IMQJ 1JLFA 1O8BA 4YHHJ 1FNMA 1C1BB 3TZYA 2MLXA 2QIFA 3RU0A 2DNPA 1OY8A 3L3CA 2RRAA 4RBUA 3AJDA 1ZAXA 2KXFA 5DG7A 5AT1B 1Q95G 4KJIA 2KT2A 3AODA 3GILA 2AYBA 4X4SA 4A8WA 1YBUA 2ZHAA 4L72B 1RK8A 2CJXB 1FO1A 5CHCB 5I3PA 4A8SA 1PG5B 2QYGA 1M1HA 3DLEB 3L4BC 2NSCA 1GMVA 4W90B 4UT4A 2QYCA 4L3KA 3IA0A 2J76E 4ILLA 4Y2IA 1W2IA 3JSMA 2YQ1A 3MMJA 3PEJA 1RT4A 3GV7B 2AGOA 1KOOA 2XLIA 3DNCA 3EVMA 4IQMA 4NRTA 1VQ6S 3BN4A 1FJEB 1FT8A 1SQGA 4DLEA 3JTNA 2KG1A 3JQKA 2V0NA 4ZVQB 3BREA 1NDKA 2IA0A 3CCQS 2BA9A 3RUBL 1HD1A 1DTTA 4ED1A 3M9OB 5B08A 3IBCB 3TZZA 2P5VA 1WC4A 1S1XB 2MQMA 2UVWA 2MGZA 1S4FA 4DR6J 2JEIA 2VU5A 5DQIA 4WTYA 4DQRA 3NGTA 4HI1A 2ZITA 2CPZA 1WF1A 2AGPA 1S9GB 1KFSA 2BJEA 4JV5F 3H40A 1R0BG 1ZA1B 1RTJA 3FBFA 2CJKA 1HWLA 5AXMA 1RT3B 4OQJA 2QA2A 3O2IA 1QSSA 4P6QA 4USIA 1NAQA 1CC7A 2X1AA 2VASA 1XNQJ 4MK9A 3GIIA 3KG1A 1VQ7S 3EPGA 3HZEA 4PWDB 2DR5A 1C1BA 2H5JB 3R5GA 5HBMB 1NK0A 2NCKL 2GAGC 3TI0A 3N6LA 3PHTA 4P2MA 2BJ9A 4NXMJ 4XO0A 3W5XA 3GSDA 2DXFA 1RDRA 5DS7A 1RBAA 4KFBB 3Q8SB 3D3CJ 3OBIA 3R5CA 3AA8A 3RR8A 2KTQA 2UUWA 3DRSB 3LH2S 5KFXA 2FVRA 4O0IA 3DLEA 4FXVA 3W2VB 3T6BA 2CWKA 2AZ1A 3AOAA 2R8KA 3FRYA 4NZ0A 4EFAC 2HFSA 2H1YA 2CJYB 2ALZA 5L39A 2OPRB 5CYQA 1PBUA 4OI1A 2HFNA 2IJNA 5ETKA 2FUG9 1NEEA 2ZFHA 3M8SA 2BX6A 3MAHA 2E1RA 1R6VA 4NLUA 2C2KB 2OEJA 5E5NA 3H25A 2K3KA 4WKRA 3M05A 3ZXWA 1X8DA 3R9LA 2HHUA 2VQEJ 4AQYJ 1VHFA 1S1XA 4QU7A 2FJXA 1GNKA 1HNVB 4ERDA 1RHQB 1U25A 4WIIA 1Y3KA 3HSDA 4OZ1A 3RW7A 4ED8A 4CRJA 1I94J 3D0IE 1S9GA 3BS9A 4OL8A 2UUAJ 3PKYA 2N7CA 4PZVA 4DU8A 5EX0A 4M5NA 4PQUB 3QIDA 1XMOF 4R8UB 1RT3A 1SJFA 4OI2A 3Q8RB 2R7RA 3OL8A 5F9LA 1VK8A 3MM8B 3I5CA 2MDAA 5LMNJ 4DR1J 3ZZ0A 3IGVA 1DBDA 2G9OA 4PWDA 1R7IA 2Q1LA 5HBMA 2GJ2A 1WWHA 1DHMA 4LF4F 2AEJA 2KFZA 3K5NA 4KFBA 1U1MA 3MPWA 4DV1J 4TLQA 4M5JA 3DRSA 3AQPA 1RCXB 1JLQB 3MFIA 3U7JA 2RRNA 3ULHA 2X3DA 2QLXA 3W2VA 3MURP 2ZUAA 2ZVSA 3H5SA 5IV3A 2GA7A 4OI3A 2E5LF 5EDWA 2V68A 2ZM6F 2OPRA 3KLVA 2SXLA 1D9FA 4W4MA 3W3SA 3OUYB 2GCFA 3CDBA 3HJVA 3CJKB 1TZ0A 1H6KX 4O44B 4GKKF 1X5PA 1FFWB 2IC3B 1ZM3A 4BC9A 2D7SA 2YWWA 5BYRA 2N4DA 3W5ZA 1FI4A 4OZ0A 1UWBB 1O0PA 2IVYA 1Q8IA 4NL5A 3IRWP 2AGQA 2R3VA 3LP1B 4ANDA 4QYZJ 2OJ3A 1T8EA 3QAUA 1JJ2R 1HNVA 4RX6A 2IMOA 3TRGA 3B82A 4DX6A 5F8GA 4K2XA 5KT7A 3UN2A 2J9DA 4MKAA 1WG4A 3EE3A 2ALYB 2HRYA 1LEOA 2CZ4A 4DV3J 1PAUB 4PQUA 1Q8KA 4UQGA 4QW9A 2HAFA 2FHJD 4R8UA 3W62A 4CNZA 1TKTB 2FPHX 1ZAVA 4X62F 4DL5A 3M6UA 2Y8YA 4WPAA 2VBYA 3MM8A 4I0WA 3D9BA 2WVEA 3UD5A 5L1IA 4YY3F 4DPYA 3H90A 1PIEA 3A1YG 3CCES 2W4PA 3UD3P 3MOZA 2BANB 3LF0A 2XULA 2E9TA 1TMJA 4JI2F 1QJHA 4XPCA 1NHVA 5HVFA 4NLPA 1SC1B 3KLIB 3SIPB 4HHUA 4Q7AA 3WC0A 1NO8A 2XNRA 2YPZA 1F9HA 4MKBA 2O5DA 2R7VA 2G1DA 1ACMB 3MEDB 4UUWA 4LQ3A 2FZCB 1JLQA 2R8HA 2Q43A 5A6PA 2EW9A 2P6TA 3DMJB 5L1JA 2VDIA 1ZM2A 1TKXB 1ZTTA 5C42B 2J6UA 4NA1A 4NOHA 2HWTA 1FE0A 1VMBA 1UVJA 1SL2A 3C6UB 4X84A 5J2NB 5DGAA 4PXCA 3ADAC 3OUYA 3CJSA 4U8YA 3CJKA 1T3NA 2IPOB 4OYPA 4O44A 2ZJPQ 2GIFA 1DLOB 4Z7YA 2IC3A 1IM4A 3LO3A 2V5HG 4JI1F 2IRUA 4LJMA 1AB8A 4K4TA 3KNAA 3DLJA 2FHOB 1UWBA 2LECA 4M63A 4HVZA 1WHYA 1T02A 4BWMA 3KJQB 4F3QA 4DSFA 5JVGQ 3KUEA 4OX9J 3LP1A 2E29A 1N6QA 4WYLA 1Q5VA 1MNEA 4WTOB 3HT0A 3O44A 2NS1B 3PHEA 2D3UA 4DX7A 5KFZA 4QJVA 5GMKa 3ENWA 1RZMA 3NS6A 4DL3A 4HT5A 1U09A 2CNOB 4IYQA 4QPXA 5JJBA 1U1PA 2VPXB 1LWEB 4X4UA 1TKTA 5FLXU 2EWHA 4DV4J 1GK8A 4NMLA 3I82A 3BBFA 3RBDA 4ZCKA 1QSYA 2GIRA 4TYBA 3PW5A 3LA0A 3ILIA 5BR8J 4A8YA 2BANA 3PY8A 2WVDA 1AA1B 4FXWA 5AE3A 1E6YB 2Y3YA 3K5PA 3UCGA 4F4AA 5GAGI 2DIVA 1QLNA 3AD9C 3J7Z5 3EZOA 2XYGB 2FDNA 3KLIA 2PEBA 5D4NA 3JTOA 3AJ1A 3A8EA 4EYIB 2GMLA 2XMWA 3VF0B 2LEBA 1J27A 3MEDA 3M8ZA 3CCVS 5K5MA 2ZH1A 4U8VA 4X4NA 1FA0A 4OI0A 3DMJA 5KFUA 4CLWA 3NNAA 1NUEA 1L3KA 3IBWA 5KFEA 5BYSA 1TKXA 2DGTA 5C42A 3DU6A 3G9CA 3E01A 5E3CA 4I2QB 2CDRB 4ZP8A 2OPQB 3C6UA 5HROB 5J2NA 1RWMB 1U2FA 1S77D 4GVLA 4Y0FA 4O3RA 3Q8VA 5IWAF 4HHJA 4X4PA 4KV8B 4F36A 1DLOA 3H20A 1GXLA 3Q8PB 1HNIB 4EUVA 3RYLA 2VFTA 1NJYA 1MMLA 4K4SA 2F8EX 2UV8A 1TUGB 2W2OP 1O6XA 2F9DA 4WZMA 4LFCJ 3HX9A 4TY9A 1KR4A 5KFDA 4LF9J 4MYUA 5LMUF 4YB1P 2KVIA 2COLA 2ZDPA 2E7WA 1BQXA 9RUBA 3KHGA 3CDAA 2DXEA 3RG6A 3KTQA 5KG5A 3UDCA 1LWEA 4NCBA 1U1RA 4B9NA 1SJ4P 4N7TA 5ETQA 1U4BA 3EJMA 3Q22A 3MR2A 3IGNA 2V9KA 2DR6A 4DV0J 4JYAF 3Q0AA 2O3DA 2MKYA 2FHKA 1SCJB 1MN7A 3X1LB 4JI0J 4ZP9A 1E6YA 1F6TA 5B7WA 4USWA 3MM5B 1APSA 1C0TB 1VQNS 3LOUA 2WVCA 4KHPF 1C0UB 4YN3B 1VQ9S 4C6AA 4F4XA 3K5OA 2WOMB 3HFZB 1OMSA 5FD1A 4GKJF 3QMQA 1U45A 4NPOA 1S6QA 4X4VA 3JAMY 1P8GA 1XBWA 4I2QA 2OPQA 4K59A 1JIHA 3VAIA 3DU5A 1SI9A 4WBFA 4PYDA 4K50A 2KRRA 1UVMA 3O5TB 3HMJG 4KV8A 1LWFB 4F67A 3PR5B 2I2YA 1VC0A 3W8PA 1HNIA 2Z4PA 2BYCA 1ICEB 3CCUS 4LREA 2R4FA 2JJ4D 1TUVA 3SBMA 4Q5VA 3PYFA 4J9KA 3CJQA 2IRYA 4PYAA 1IKXB 3UPFA 2XQCA 3JQMA 3FFIB 3G82B 3AY0A 2Y1IA 1VQKS 4QWEA 3PNIA 2EFGA 5LL6d 2KJVA 2WW8A 1B7FA 1WF2A 3OL6A 2DNRA 5C25B 3PO4A 3JXOA 2MJNA 4DCOB 3AB2B 1T11A 3QT7A 2A3JA 3FEXB 4DS5A 1FD8A 3N5BA 1YHQS 3DDIA 1RU2A 3CCWA 3L7UA 3OXGA 3H5XA 4UZBA 3ZC4A 2G13A 3EXCX 2DT9A 3UE2A 4DPXA 3RZAA 2HQFA 2F63A 1KD1T 2AIRB 3BM7A 3MM5A 4DF8A 4WF9Q 1EKSA 1SBRA 1VCTA 1C0TA 2DNMA 2XCPA 1C0UA 1WI6A 2H5EA 5CCLA 4OYWA 3FSYA 1B4SA 1HQUB 1TL5A 4R25A 3UW1A 5EHHA 2WOMA 1RWOB 4QWAA 4ZPWR 3VGUA 3SFGA 4U7UD 3DHXA 2FVSA 2F3JA 3HSZA 1BWVA 2DNLA 2VA2A 1H0HB 4Q0BB 2ZE2B 3D6TB 1QVGR 1FWKA 2HGMA 2HLTA 2RNEA 2PFDA 4OX7A 2CNKB 4USHA 1U24A 2DNOA 3GYXB 3KWMA 2FLPA 5T7LB 4XPEA 4NCAA 4CLFA 1LWFA 3A8IA 4CO1A 3UR0A 1A9NB 2QT7A 2F5GA 1URRA 1MSWD 2FVCA 1T9XA 2CQBA 3CGIA 4FYXB 4FP9A 3CD5A 1T9UA 1M5PC 3OQ2A 3UDVA 4ZCLA 3CDEA 4OJGA 4OHZA 1IBMJ 1NDCA 4K8RA 1IKXA 2MZJA 2P9CA 2RDDA 3FFIA 3G82A 5HQLA 1T9YA 3M9MB 5HP1B 4NXNJ 4OJHA 1TKDA 4RW7B 4RO0A 2MZQA 2PEHA 3OJUA 5C25A 1QSLA 1K0TA 1CULB 1JWWA 3KNGA 5L8RC 4HYKA 4UQTA 5KFOA 1HNWJ 4K0KJ 1RT1B 2MSSA 3BKUA 5KFQA 2IM1A 4OMFG 1X31C 4P73A 4DPTA 2EPIA 2HNYB 1X9MA 4DL6A 4IH6A 4M5DB 3NGRA 2VPZB 4ES1A 4M5HA 4EBCA 4DMZA 1N5TA 4DSEA 4JI7J 3LWLA 4YQWA 1D3WA 5ETMA 2VDHA 3EX7B 3VALA 4OI4A 5KOXA 1HQUA 3K8WA 2J7WA 4ED3A 4N77A 2WBRA 2DGVA 5IM0B 3RB4A 2AU0A 3DLBA 2VV5A 4Q0BA 1S0NA 2ZE2A 2R7OA 3OPKA 2ACYA 3G8QA 2XMJA 3MD1A 2OTJS 4XIUA 4O23A 3NWGA 5F8JA 2XZDB 3IXQA 2OEMA 4C8YA 4IUFA 3A3PB 4NLRA 3M8RA 2Y9HA 5T7LA 4DX5A 1R89A 5JXSA 3U02A 1B99A 1NU4A 2PT0A 1V5VA 4RNHA 1XNRF 4TQRA 2DVIA 1RTIB 2ZD1B 1J2VA 2N3LA 4WWSA 3MWBA 4DX8H 3N6NA 1K44A 4EEYA 4DR7J 2X3GA 3CCMS 1KTQA 1ZPVA 4ID8A 1NJWA 3H0PA 1XMQF 1N34F 2IM3A 1H72C 2V8GA 3MAQA 5HP1A 1Q82T 2CPHA 3MPYA 3HVRA 5J2PB 3MEEB 4OZ5A 4RW7A 3TUJC 1YX2A 2DPIA 3EPIA 3NMRA 3IRXA 1CULA 2QGFB 3VAHA 4JV5J 1XC9A 2WBMA 2B4OA 2CAJA 2EFPA 3VAJA 3LPYA 2DNYA 4QIEA 2WZ1A 2ZH4A 4YHHF 1RT1A 3BDPA 3TNVA 3SCJE 5C7PA 1RHMB 1ZYQA 1SPBP 2QX0A 3E2EA 2HNYA 1MWZA 1NK4A 3LTOA 4M5DA 2F8MA 2PD1A 2DD8S 4DI6A 3LW5C 3UVJB 2AYMA 1RWKB 3VZIA 1VHIA 3T1HJ 4RL1A 4ZIWA 5DO2A 2JDJA 5IZHA 4K7QA 4R5PB 5F8LA 5IM0A 1C4CA 4UF4A 1PJ7A 5I3QA 1LFPA 1ITPA 1RKIA 5E33A 4XAKA 4Y65A 3F41A 3DCAA 2A10A 1D1UA 4C4WA 4YR2A 3MECB 2YKAA 5KFBA 2XMTA 2HEKA 3SI8A 2OO4A 2WSCC 1RBOB 1RAAB 1X4AA 1RTIA 2ZD1A 1WKJA 3BQ2A 3GV8B 4L74A 2MZ1A 1G2EA 2QLWA 1X9SA 3R8YA 4EK2A 3H4BA 3D68A 1U26A 3R3TA 4DL4A 3T3FA 1YJNS 1N54B 3EXYA 4RUCA 1RT6B 5DDPC 3ZTQA 1H2VZ 1SKRA 4J91A 2JHEA 3BJYA 5J2PA 5F3ZA 2X1GA 3MEEA 2C42A 3THTA 2VF3A 3MTJA 4ECTA 3BBBA 2IVFB 2YKOA 3ZZPA 1X9WA 4B9UA 1V3SA 3W60A 5E41A 2ERRA 4O0NA 3ET6B 2BR0A 1M90T 2AJ1A 5IT9Y 4J9RA 1VRTB 2JX2A 2BJ8A 3NCPA 4U9RA 2GNKA 2Z2LA 4OJ3A 3RRGA 3W2WB 3FMBA 2W4DA 3L95X 4LF8J 2I5JB 4C0HA 2AJ2A 3NNCA 1MG7A 3W8GA 3UVJA 2J8AA 1CC8A 1UCNA 4LF4J 3IWNC 3OLAA 5A2QY 4C8OA 4CH0S 4R5PA 2YVSA 1KDNA 3FNNA 2EFOA 2JL9A 5RUBA 4DR4F 2V2KA 4J9LA 1RWVB 3DDNA 4UTGA 5AJ3F 2DRBA 2CADA 3FGVA 3WZ0A 3Q23A 4B02A 3LAKA 2HBZB 1TELA 2CZVC 2E7XA 4LRAA 2QA1A 2AJFE 2Y1RI 4USKA 5DM6Q 1WI8A 2RDIA 3MECA 2DR8A 2LCWA 1FXRA 4IRCA 2HNDB 3JSBA 4ES2A 2BM0A 1HA1A 2DITA 2LA4A 4A8QA 4FF2A 1KN6A 5KFAA 3IR5B 5HMWA 2F1FA 3OFFA 1OYEA 3HVAA 2WB4A 4FZVA 4ZVGA 2HVDA 3UR3C 4ELVA 2V2ZA 3EGVA 4GKKJ 3V2UC 1VQSA 2OMLA 2V63A 3V6KA 4AQYF 4ZLLA 5KG7A 5DZ6A 4O3SA 5U47A 3AOBA 4B9MA 1GT8A 1ELOA 4L6V3 2JOQA 4P72A 4YS2A 3W66A 1RT6A 4LRBA 3DYAB 1VISA 1TL7B 3KG0A 4NLQA 3P96A 1GH8A 3ETOA 4QYRA 2IAJB 2DHHA 5CQGA 4F0KA 3J81U 4A8MP 1R8BA 3KKFA 1A0OB 3EZ5A 2F40A 1VGYA 2B9EA 3ET6A 4B3SF 4DR1F 4C8ZA 3R7SB 3FQKA 3LUYA 1T9WA 5I42B 1QDUB 3GPAA 3IP0A 3DXBA 1VRTA 2POKA 5ETSA 4X62J 3ILLA 4DS4A 2DGQA 2DH8A 3VAGA 3KUHA 3W2WA 5L46A 2DCUB 3IAM9 2I5JA 4DV1F 2HK2A 5E7OB 2UU9F 2CVIA 1GFWB 5I3UB 2ASLA 3PVXA 1R0CB 1IWGA 1S12A 4DQPA 2ROPA 3W64A 3RAXA 4ZDNA 1X5OA 2DXDA 5KT5A 3SZ2A 2EC0A 3NS5A 6FD1A 4DPUA 5DZ7A 1V5IB 4ER8A 2Z8QA 2DNQA 4QR0A 1G7CB 1NLKL 4DR2F 3SDEB 4FDFA 1BC6A 4G1PA 2HNDA 3OTCA 3JB9k 2XEXA 4K4VA 5IXUA 4DUYJ 2FJEB 1NK8A 2O66A 2HVEA 2L08A 5HVGA 1UJ5A 1U0SA 3ZZUA 4IOCQ 2UP1A 3PYEA 4XDDA 4W92B 3OTOJ 2DYAA 5GMDA 2C22A 3GJTB 1FJGF 5DDQC 4ZN3A 5D3GB 2XS7A 3HFVA 3DYAA 4ED6A 3KHRA 2J0QD 3C15B 1TL7A 1WOPA 1HYSB 3R7BB 3TA2A 1AROP 4IFVB 2IAJA 3HLUA 4DV3F 2CQ2A 2VQFF 4F25A 3GJQB 4GO5X 2EK1A 4I6AA 5KFWA 3GSIA 3D67A 2J5AA 1P27B 1RT5B 2VFUA 3HDSA 5I42A 4U96A 2W9CB 3M2RB 5L9XA 1LW0B 4YFUA 1IKWB 3W61A 1JX4A 4ZVUB 4EU0A 3I5AA 3OFEA 1LK5A 4G65A 4AD6A 5IOLA 3I56S 3D0HE 2D3O1 1YZ7A 2Z2YB 2HVHA 4CLLA 5I3UA 3OR1B 2FIUA 4JUZA 3KK1B 4LMZA 1N88A 1M1KT 3THPA 1V3RA 2ACMA 5EWEA 4I6WA 5KT2A 3FDSA 1F60B 1LW2A 1EHWA 2FJVA 2J0SD 3Q24A 3BV8A 3IFEA 2KT3A 3AA9A 4ZVOB 1KRPA 3SDEA 2DR7A 4E98A 3W5YA 1R8CA 5IV4A 2ZKTA 3MAAB 3Q8YA 2HVZA 1NPPA 3CMES 3OFHA 4WFAQ 1FRKA 2BVZA 2HHVA 5IWAJ 3BEGB 4IOAQ 1D9AA 2HNZB 2H48B 3K57A 1FCAA 1RT7B 4CIOA 4GVBB 4CT9A 1NK6A 5E3QA 3NGKA 1P1TA 3A8KA 3PEHA 3ILOA 2YKMB 1BE4A 2G2OA 2W7AA 2KYXA 4UOFA 5D3GA 5BJRA 4KGKA 1K8AT 4ILMA 3C15A 3HXMA 3OD2A 4RUAA 1HYSA 3A12A 1KSPA 4WFXA 4IFVA 1H2TZ 2BKPA 2EFQA 1AFJA 4ZLJA 1YSJA 3FBEA 4C11B 3JYTB 1AUDA 4QIGA 1RT5A 5THWA 1OSDA 4LRDA 4ED0A 4OHYA 2CIMA 5LXYA 2W9CA 2MY7A 3M2RA 4P2FA 2UXBF 4X4RA 1KVJA 2YTCA 1LW0A 1VLYA 2JWNA 3U1LA 1IKWA 3KJNB 5BR8F 5DJBA 2OELA 3EUNA 2YWHA 3BB5A 3TWZA 5K8OA 2WRMA 1F5BA 2DNZA 4JYAJ 3M7VA 1NCLA 3R2DJ 1RTDB 4WP3A 1PBAA 4PABA 3OR1A 1KQSR 4USMA 3MFHA 3KK1A 4O3QA 4MIWA 3CJ3A 2XY7A 2W2QP 3KFWX 3TVZA 2BMBA 2MLZA 5C5JA 1S48A 4M95A 1W7WA 3NRBA 3M8PB 2W25A 3HSJA 3MZIA 5EWGA 2RQ4A 3TX8A 2R7TA 7FD1A 2BM1A 4N5SA 2HFZA 2R2TA 3SEOA 3IR6B 4CLPA 3MUVP 3MAAA 4YDDB 4P71A 3UNGC 3UI3A 2VKZG 2YX1A 1TVRB 4RNOA 4ETXA 3SCIE 4B9VA 3BGOP 4DF4A 2C2ZB 4DQQA 5E2QA 1S99A 2HHTA 2DY1A 4M5LA 1WKKA 1ZETA 2HNZA 3GYNA 3KMQA 2QRRA 1RT7A 1X5SA 4GVBA 2W2NP 3PW0A 4B9SA 2YKMA 1WEYA 4LFCF 4LRCA 2OHDA 2LQ5A 4TXSA 4LF9F 2JLGA 4F50A 4Y3CA 1PYOB 2EKYA 2M5YA 1VDHA 3WC2A 3K7RA 2PI4A 4YR0A 4WFNQ 6FDRA 4C3MA 4C11A 2W8LA 3JYTA 1K9MT 5F3TA 5KFKA 1RWWB 1EARA 3S01A 1D09B 5KFVA 1P9QC 2XZWA 2RQCA 1HL6A 2MZRA 2X51A 2PN6A 4X66J 1C4AA 1BD6A 4DZDA 4JI0F 2PA3A 3H5UA 1F9FA 4ZLNA 4RU2A 1HQEB 5DLGA 5K14B 3VGVA 3VAMA 4MJKA 4F3MA 3GV5B 1RTDA 1Y7PA 1UW4A 2PMZD 4DL2A 4KO0B 1WOOA 3OXFA 1DRZA 3PTWA 1Z2LA 2KRBA 3KDOA 3WHIA 1FFSB 2HHXA 5HMYA 3SQGB 3K8VA 3T5LA 1DQ9A 1HD0A 5FLXY 2V8VA 2V4JB 4MIAA 1DFDA 3DOMB 1PKUA 3GTYX 1HWUA 2PA8D 3M8PA 1Y9OA 4F2RA 2C2OB 4DUZJ 4FF3A 1MMDA 4Q8FA 1H73A 4ZMMA 5LSOA 2DR9A 1LFWA 1KONA 3NGUA 4Y6IA 4DWIA 2KYZA 1TVRA 3QO9B 4KYZA 1OO0B 2VG5B 3DLGB 3HHLD 2E66A 3MHYA 2FYXA 4Y2CA 4OYMA 1GX5A 1X4DA 3IS9B 3TUZC 3PZPA 4LIRA 3HHLC 3TVYA 1FEHA 2RU9A 5F8MA 3NNHA 1FDAA 4PWWA 3EWGA 3LP2B 2WB1D 1RAHB 1X0FA 5H9EK 2NXEA 2DNNA 1K47A 3M30B 3GCWP 1QAIA 2JFDA 4CLSA 4WU2A 1UJ4A 2ZZTA 2XY5A 2CPFA 4Y2KA 2OLWA 1KVIA 4QR1A 1KS2A 2FHJA 4B08A 3KLEB 3RAQA 3GFXA 4DFKA 2YX4A 1U02A 1RHRB 2R42A 5SUHA 2HW3A 5HVHA 2ZZNA 3PW7A 2DNGA 1R3NA 1X4GA 1HW8A 4B17A 1WHVA 1HQEA 4P7VA 1NHKL 4KH0B 5K14A 5E3RA 1U8WA 1SV5B 4KR0B 4ZCMA 4HDGA 1F3FA 4KO0A 4PKDB 3LWMA 4N47A 3PFOA 5E0OA 3DRYA 2C2MB 3BSAA 2ZNYA 2MHEA 3SQGA 2AW0A 2QLBB 1IJFB 4ZVHA 1SC3B 1NB2A 4PXEA 3FCWA 2V4JA 1B7YB 2MKCA 1S7HA 3DOMA 2OKQA 4C8MA 1LQ9A 1RWNB 2NSBA 3B54A 2OI2A 2ZEJA 2EC2A 2FY8A 4LUBA 3TUPA 4H4KA 1RAJA 1N0UA 6AT1B 3DFEA 2UUTA 1RISA 2MEWA 3VR1A 1HBOB 3LANA 4HLBA 2RQMA 5EGYA 3QO9A 3EDRB 2CXEA 1NSAA 5CAAA 4RNMA 2FB0A 3BO2A 2VG5A 4C97A 3DLGA 2HPUA 4LR8A 2P9GA 3J7A1 4NLTA 3BGLA 4ZPTR 2A1BA 4PG4A 2LU1A 1XNRJ 2YNFB 2I6WA 1RB0A 3IS9A 4ZA1A 2C3PA 2BW2A 4QIVA 2HQGA 5DM7Q 3WDOA 1UFKA 4YMEA 1NBEB 2B9YA 5CD4A 4DPOA 3CJ5A 3LP2A 2J8SA 4TY8B 5IQQA 2UUBF 3V6JA 1YRTA 3M4XA 4NXNF 3OXLA 3VQSA 2A6OA 3M30A 3GIKA 3HCXA 1WC0A 4H54A 1N34J 2QFIA 3T19A 2H9ZA 3I96A 4PPZA 2D69A 2AKWB 3H42A 2C3MA 4EWTA 3PO5A 3TVKA 2OGUA 1S59A 3KLEA 3HT3A 2E1CA 3GB0A 1CLFA 2XHCA 1BQNB 4QOTA 3T41A 2JC0A 2Y0SD 3EZUA 1F2HA 2B4VA 2CFXA 1HNWF 4IRKA 1YG0A 2RF2B 4USJC 4J9OA 1S72S 2R8GA 1JLEB 1IKVB 2VD3A 1EAYC 2A2DA 2HRUA 2FJDB 3J81j 3ISND 2FY1A 4C3KA 1FNOA 1GXTA 5SZTA 3HD1A 1U7LA 5KFGA 2RHQB 2LXFA 4JI7F 1SV5A 1X4FA 2RD5C 3EVWA 2KL8A 1Z4UA 3ISNC 3ONQA 2IDLA 2YNHB 1OQ3A 3V5RA 5K8MA 4CNYA 4FNHA 3U1NA 1R0AB 4FVMA 4P2SA 1VJWA 1RHUB 3RR7A 1NZ8A 5B09A 3TAQA 4LBIA 2YKNB 4BDPA 2Q79A 3CWJA 3PR4A 2XS5A 1TTHB 2N7YA 4WJBA 2W24A 1UJ6A 5CYQB 1JLBB 4BC7A 3PIPQ 3PG9A 1HBOA 2ZH6A 2DY9A 4F7VA 1DZ5A 3HHEA 2G0JA 5D78A 3OVSA 5DETA 3V4MA 3PX6A 1UA1A 2GHVC 3T6JA 2LXUA 2VBXA 4DR7F 2XLJA 3MGJA 1LXNA 2FLLA 1KLMB 3S6EA 2YNFA 2FVPA 1M0SA 4LF6F 2J7UA 3R5BA 4YR3A 2VBWA 2V50A 4TY8A 3R5JB 3TEHB 3N4WA 3CT9A 3I55S 2W7PA 3A3NB 3J80U 3CD0A 4M5MA 4OLPA 2RJZA 3AD7C 2AHOB 1UETA 3W9HA 2CQ3A 4K5SA 2R2UA 1H38A 2NQPA 4ZVSB 1OS5A 2NXUA 4DOZA 2IM0A 1QAJA 3R5DA 1RWXB 3OJSA 1BQNA 1H7XA 2CQDA 1TP7A 3B4MA 4EMDA 8RUCA 1B0PA 1CG2A 2RF2A 2CDQA 2V4QA 2V6AA 2Q6CA 5K20B 5AE1A 3A3OB 1JLEA 2PI5A 1IKVA 1LK7A 4C0BA 4V1Ak 4GO7X 3N28A 4ZVTB 3NCRA 2C2DA 4LF5F 1Y3JA 2WHOA 2PIIA 2KU7A 3G2XA 4DXLA 1Y5IB 3UDLA 3DLHA 3HI9A 3T1HF 2A0FB 2I1RA 3HP6A 3RJMB 1H2UX 2B9WA 2M3DA 4X64F 3G96A 2LXIA 3M6XA 2HAIA 2YNHA 3CD6S 4WFZA 3KHHA 2V9WA 3NGSA 1FDNA 2EBGA 3QT8A 3MM6B 1R8AA 3FEYB 1R0AA 2HHWA 4L76A 2VB6A 4RNFA 1WHXA 1Q8BA 1VIOA 5IS2A 4DR4J 1F5AA 2YKNA 2LQBA 4J5OA 5A8RB 2HURA 1RAIB 5AJ3J 2E5IA 2YKPA 3GE9A 2O67A 1KBRA 1BXNA 4JI3F 2E5JA 1VJQA 3QFWA 1L3VA 2DCLA 5FIIA 3FZ2A 1CPZA 3TA0A 3VV2B 1JLBA 3Q2TC 1XERA 4DR5J 1T7PA 3DHWC 4ECYA 5GMEA 3SMZA 1UPMB 1TV6B 1SIZA 3QPIA 4UZCA 1VBZA 3QNWB 1G6BA 2JLEA 2OSQA 2CUYA 1KLMA 3CW2C 2HQDA 3VTIA 1LNQA 3PRDA 2DGXA 5G0RB 4Z2XA 5B0CA 1OY9A 4ID5B 3MEGB 1MW7A 4UUXA 3CEDA 1MLAA 3OL7A 4FPRA 4A8XA 1NH8A 2DNKA 1NK9A 2M0GB 2LEPA 5HAOA 1IVZA 2VJUA 3W9IA 4B9LA 3AXMA 4C8LA 1S1UB 2DGUA 2VH7A 3H98A 1JNZB 4KPCA 1XK8A 1JK9B 2GJIA 3TJ8A 3DRPB 3I87A 1DTQB 3US5A 4PEOA 2OP5A 1IBLF 3GP9A 2W8KA 1RWUA 1SQEA 1RAEB 5KG0A 1K0VA 2NYHA 3TARA 4EYHB 1FRLA 3IM8A 2HGLA 4ECSA 4NLWA 2MJUA 3OHBA 2GVZB 1S0MA 1RTZA 4QQBA 2MYFA 2H3EB 2LYVA 3JAMU 3CCSS 5DDRC 4X65F 4RLEA 2C3OA 1RUSA 4G1IA 4B3SJ 3MR5A 2CQHA 5A8WB 3F44A 1FE4A 1JXLA 2HHQA 4N8NA 4LF8F 5JVHQ 1DARA 4HH1A 4QCLA 1VC6A 4P10A 1R8HA 2RU3A 4LF7F 1AW0A 3OFGA 1XR7A 5J1EB 4M8LA 3PYDA 2LEAA 4RW4B 4J9MA 3LPEA 2IJFA 1KC8T 2UU9J 1SH3A 3ZNUA 5ETTA 4XDCA 3CB4A 4U7CA 4WKYA 2XMUA 3MM6A 4CDIA 2ASDA 2CRLA 4ITSA 2OFGX 1YJVA 3D7SB 2CNNB 4ECRA 4K4YA 5A8RA 1V6HA 5DRKA 3KLGB 1JJHA 2YH1A 4LR7A 2J9CA 2CPIA 4DR2J 1TK0A 1HIYA 3F56A 4CZCA 3M2VB 2YWEA 2BJ7A 1IXKA 4J9QA 3V4IB 4NE9C 1TV6A 3SXLA 3BYRA 3E3XA 4PRFA 2HZCA 4FYVB 3I32A 1YRXA 1N8RT 3BR8A 2V4RA 2O01C 5G0RA 2Z58B 1S6PB 1QVFR 1FERA 4ID5A 2DEIA 3MEGA 1N6QB 4PUOB 2BJDA 3C19A 1FJGJ 1RJJA 4GC7A 1S1UA 1U47A 4KHMA 1U0HB 4RBTA 3DRPA 1DY3A 4DPWA 3ZTSA 1DTQA 1EB0A 1LWCB 2A2CA 5J2QB 2RAQA 2H54B 3R5AA 1TKZB 4UOCA 2MQOA 2VQFJ 3CULA 4Q2LA 2GVZA 3BPSP 2QV6A 1DURA 3EGWB 3NGDA 3CDUA 2HIQA 1TK8A 2QA4S 2ASYA 2R7XA 2GIQA 1HI1A 1JJCB 4OYIA 1OPZA 5A8WA 2XSJB 1U6FA 2M52A 4ZPBA 4DG1B 4LSNB 1FKPB 3G87A 3TP2A 2XC9A 1FWPA 3NBPB 5J1EA 4HHHA 2FTRA 3ZO7A 2QJ3A 2CJBA 2BE7D 3UN3A 4RW4A 1JLAB 3H2LA 2J9EA 1S4EA 2KT5A 3K59A 1TK5A 4CLTA 4N56A 1CJTB 3D6HB 4ZLPA 4MK7A 4PG8A 1JB0C 3KLGA 2ZWPA 2KG0A 1WEXA 3E01B 2OD4A 3DLLQ 1X4HA 3FBBA 4PG5A 4WXWA 4DUYF 4IRDA 2UV8G 5HO4A 2XMMA 2GO9A 1UMJA 1PO6A 3M2VA 2J7KA 1FDBA 5A76A 3MM9B 3V4IA 3TZXA 2I9SA 4H4KC 3TYTA 3OTOF 1GMWD 5B0DA 2RIJA 3ELHA 5LOQA 4IDKB 1S6PA 3PX0A 2YQ3A 2W9BB 3QATA 3MPVA 5L38A 4NMXA 2QSWA 4B3MF 3SFUA 1Q79A 4PUOA 5EUHA 4F4KA 2D74B 2RUSA 2DH9A 3U27A 1U0HA 1CJUB 4OV6A 2B4PA 1LWCA 5F8HA 3RBEA 5J2QA 5A8KB 1U2CA 2R2SA 1TKZA 2F4FA 3BGFA 4K4UA 4H4MB 5KFNA 1FVQA 2OPPB 3GMGA 3UFCX 3VCDA 1RCOB 5H9FK 3P8BB 3MCMA 1SIWB 3OL9A 2CJ9A 1WJ9A 2XSJA 2UXBJ 2XWYA 4IH5A 4WP9A 1ZS6A 5HMZA 3TAMB 1IKYB 3CIMA 1KQKA 3PJ9A 4DLGA 3WX8A 4USTA 4DG1A 4LSNA 2HHSA 1FKPA 4AT1B 7AT1B 2IM2A 2XLKA 1BUXA 3NBPA 3KK3B 3CCZA 1UWAA 3BGUA 1JLAA 3UWTA 1SJQA 2ROEA 2BRKA 1SKUB 1EETB 1S97A 2YKQA 5GADI 3Q83A 1FRXA 1CJTA 4ZPVR 4NASA 3RAMA 2HK3A 1S6QB 3ETMA 1F1BB 2IDEA 3QWUA 2BBEA 1NKCA 1D8ZA 3J7ZT 1RE1B 2CYYA 2BQUA 1DJ0A 3NY0A 3DC2A 4QBUA 2YQ0A 1MWQA 2JEGA 3ZZZA 2P8IA 4ED5A 1U2RA 3MM9A 3ZZTA 3DKDA 4NX9A 2VL1A 4MIBA 1ZOTA 2UVRA 2V2VA 3CJRA 4IQXA 5DG8A 1NDLA 3VWSA 2VZ9A 3G71S 1CS4B 3QLHB 2D9PA 2Q66A 1QE1B 4IDKA 5FJ4A 1VQ8S 4ECQA 4TNOA 4I7FB 2W9BA 5M2PA 3K0JA 2CQCA 3OTDA 2H4YB 3ENQA 1J5EJ 3TJ9A 3D6FB 2Z2MA 1ZPWX 2R2RA 2XCAA 2X1FA 1TAQA 1CJUA 3PRVA 3R2CJ 2WW4A 4OYXA 1ZM9A 1R27B 3KMSA 1R6YA 5A8KA 4DUTA 1TFWA 1UVNA 1GTHA 5C2CA 1YI2S 3C6TB 5ETVA 4DFPA 2LQJA 4ECVA 2LDIA 2HKEA 2MKKA 3BN7A 2E44A 3D28A 5LSRA 4H4MA 3IN5A 4D3HA 2OPPA 2FGOA 1V9OA 4NI2B 5CYMB 1VOMA 3KXDA 5DDOC 1S1TB 4NLOA 2HQIA 1S6UA 3TAMA 1IKYA 4FYDA 3PIOQ 3GU0A 2ZDOA 1XTZA 1T3OA 1RTHB 1TL1B 5LSLA 3KK3A 5MLCV 3M6VA 2B56A 2KXHA 8AT1B 1RT2B 1ROFA 1MN9A 1RI7A 3C2PA 1EETA 2VOPA 3CVKA 1HHSA 4B3OB 2NZ4A 1WKLA 2B7CB 2LA6A 3MEKA 2JEJA 2ZWOA 3D1QA 3J7YU 2AJ0A 2KKHA 3V6DB 4HT7A 1T95A 4EO6A 2E5GA 1NSQA 4KQZA 3P6YC 4PPDA 4DV7J 2B5JB 4I1TA 1TFYA 2KVQE 2RMLA 1ZTWA 2K3IA 3L09A 2GO8A 3P45B 3CC4S 5I4MA 1M5OC 4WYWA 1CS4A 1Q1KA 4JI6F 1NM2A 4RWXA 2VG7B 3QLHA 2IHR1 2U2FA 2PGCA 3GFYA 1QE1A 3N6MA 2DEJA 2GW8A 1WNEA 4X4QA 2HFVA 3D1HA 4I7FA 4Q45A 3N0VA 5C24B 1ZH5A 2AEMA 4FKYA 2KN4A 4EGLA 2UXDF 2QEXS 4RWWA 4KPYA 2B9XA 2CPXA 2QL5B 3JSRA 2LDYA 3ENVA 1REGX 4FPIA 5A2QU 2VBZA 3B8HA 3I31A 1XIQA 2K2PA 4EI2A 3C6TA 3T9ZA 1L3TA 2VJVA 3QRRA 3DRXA 1ULRA 1YTYA 3PV8A 1RP5A 3V6HA 4LSZB 4NI2A 4X66F 5CYMA 4KKOB 3F0NA 4QU6A 3ENAA 3PW4A 4C2MA 4RZRA 2L9DA 1S1TA 1IBKF 2LQ9A 4JV1A 2FQQB 4WK1A 3K58A 1LV5A 2K7JA 2QA4G 2IVMA 5F0UA 3M1VB 2OPSB 1RTHA 1TL1A 4Y2MA 4QZVB 3VZHA 2V8PA 4CQ1A 4K4WA 4A47A 4LVOP 2VIHA 1S0VA 1RT2A 5KT4A 4I67A 4Y2AA 1UP1A 1OYDA 4B3OA 1HWJA 2KB2A 3N5FA 5AE2A 3ICLA 4BCAA 4DUZF 3BH7B 3WBZA 3V6DA 2MB0B 2E1MC 1RGVA 4HH0A 2Q3PA 1F2GA 3EGNA 2QG9B 4HR2A 1SB6A 2B5JA 2BJ3A 3D1OA 3PXGa 1S49A 4TLRA 4Z7CA 3KUGA 2ZHBA 5DGBA 2OFHX 2GQCA 5ETPA 3NAHA 2IJRA 3HULA 2HWHA 2R8IA 4RJVA 4EO8A 2VG7A 2OTLS 1RBLA 4BS2A 2W9AA 2VICA 1NNDA 3BPDA 2PE8A 5C24A 4QW8A 4PG6A 2BW7A 3KG4A 2CKWA 2FJBB 3R1HA 4OYZA 1XJWB 3CO0P 4CLYA 2HBYB 5B0BA 4E2FB 1JMTA 2ZOMA 4DCPB 4JI5F 4O4GB 1X7VA 4USVA 5KT6A 1ZZNA 2UUBJ 2XI3A 3BBCA 1RKJA 2DIUA 3ZZRA 5T14A 4C48A 2KH9A 2AX1A 1AFIA 1WG1A 1NXIA 5GAEI 4DR3J 1YJWS 3IRXB 1Q53A 4KHRA 1FWLA 5CYJA 4CH7A 2IIHA 4GC6A 3N9UC 1TQLA 1GMUA 4KKOA 2IBOA 3BKTA 3MMBB 2EXUA 3KK2B 2QL7B 1PJ5A 4K4XA 4OZNA 4PXBA 1VRQC 4LFBJ 5HN0A 1KHVA 2DTJA 3J7AN 3AH6A 3SV3A 1S79A 4A8FA 4CO3A 3M1VA 3DDKA 2OPSA 2ZC4A 1N48A 5DLFA 1BGXT 3UCZP 1X0PA 3PKMA 2FC9A 1RAOA 2HFUA 4QR2A 1BY9A 2CNLB 3CCJS 2EKNA 4TU9A 1LOUA 3UD4P 1VLOA 4KGVB 2W2PP 3S7RA 3BDEA 4XK8C 4WIQA 2YH0A 2AD9A 2YWGA 1Q16B 2B8QA 1N36F 1B0VA 1S1WB 2ZH2A 1F9EB 2GVDB 2WCXA 2ZZMA 4V19X 4IFYB 1NJZA 2XTJP 2FJAB 2GX8A 1KTVA 1UA0A 2ZNZA 3HF5A 3OTBA 3GCXP 1NK7A 1T05B 1T03B 3VVUA 3H2VE 1SJ3P 1BQMB 3O8WA 1HI8A 4ZK7M 4U95A 2YWKA 3HHDA 2YPYA 4EZ9A 5EWFA 2CPEA 2ZOFA 2XY6A 4ATNA 3OW2R 4LF6J 1FRHA 2CQPA 3HFKA 3OTEA 4TKTA 4JI8F 1FK9B 3GZ7A 4HTJA 4DL0C 4LFAF 1OWXA 4O4GA 2ZKUA 4TVAB 5IC6B 2CPYA 4NLSA 5HQMA 1WELA 3D3BJ 3D6MB 4RKUC 2QMWA 4G1QB 3M32B 2OD6A 3N79A 2IY5B 1Q7LB 5M2UA 1F3VA 4NYPA 3MDFA 4MH8A 2BJ1A 3M6WA 4O3PA 5CA5A 3MR6A 1UTAA 3MMBA 5CZVA 3UO0A 4YDXA 2AT1B 3KK2A 2RS2A 2JSXA 3TEGA 3Q2SC 4HACB 4CI0B 2K06A 2JRSA 2WAQD 5KFJA 4LF5J 1W2BR 3DOKB 1B0TA 1FF2A 1YWXA 3KDNA 1B3TA 4NYZA 4K4ZA 5LM7E 2FHMA 1CQMA 4U6PA 5HSPA 2NPFA 2YXLA 4X64J 2E1AA 4KGMA 1HARA 2HHHJ 4ED4A 1HHTP 1T0TV 1W26A 1QUPA 5BXIA 4WP8A 1UZDA 2AX0A 2AYEA 3CIZA 4ELUA 4C9DA 3RW6A 2NYIA 2G0CA 2RE1A 1S1WA 5LT5A 3QT5A 1RXOB 4CLKA 3GLJA 2GVDA 4C0OC 1XWLA 4JI3J 2VHGA 2L9NA 3PDNA 3DN9A 4NRUA 3TX0A 2BDPA 1H74A 4IFYA 2X1BA 3HHLB 5KFFA 3QGPA 2XYPB 2QE5A 1T05A 1T03A 3DGPB 2UZAA 3D4JA 4MAKA 4OZJA 2HGNA 1BQMA 4V19J 1K73T 3VHQA 1XR6A 1TR0A 1N52B 1H3DA 2XM3A 1V3ZA 3BR9A 4DV2J 3EM1A 1VIXA 2UVVA 3TOQA 4YB5A 2W2MP 2WVBA 2XG8A 5IQ6A 4MKYA 3E51A 5D4OA 1B64A 4HEA9 1FK9A 4C7QA 5HK4A 3L7OA 1YBAA 2VFSA 3TZWA 1RU1A 1S5ZA 2K7KA 4YUDA 5GADU 2MQ8A 2L48A 5HJXA 1FRMA 1NH7A 1HNZF 3D66A 1M5SA 4G1QA 3M32A 2IMWP 3SSRA 1IBLJ 3GJSB 1IR1A 1NMEB 5KFIA 1M5HA 4FYWB 2DHSA 2PSZA 1FVSA 3CJTA 4FKXA 2R8JA 3K89A 5CH7B 3UCUP 3WIVA 1SJRA 1MU2B 5GAHI 1NDPA 4AUKA 3NMAA 4X65J 2MPUA 3CD7A 1JKHB 4I2PB 4HACA 3HD2A 1NJIT 1YQHA 3KLFB 3CPWR 4LBHA 3DOKA 2NUHA 1U48A 4RUBA 3D2WA 4PQAA 3A13A 2BKOA 4Q44A 4LF7J 4RW8B 5FDLB 3ZTOA 4EBDA 3IBFB 1FXLA 3DRRB 4PAAA 4ZVEA 1NKBA 4CTAB 4OHXA 1X4EA 3B6BA 4PWUA 1TU0B 2HRTA 2RSQA 1Y5LB 1WC1A 2HG4A 1OJ4A 3FVYA 1N32F 1MROB 4OYAA 2J9DE 2VG6B 2PDAA 2DRDA 3K2YA 3FUYA 1HWIA 1GTEA 1EIYB 1R31A 1FHTA 4ZVPB 4DR5F 1UVIA 2WONB 1AT1B 4PG7A 1VFJA 2K8GA 3P49B 3HHLA 1MWYA 2ATLA 4OX8A 1UVLA 2P9EA 3DI6B 3JS9A 4IG0B 2JH3A 3DGPA 3HHNB 3G4SS 2C28A 2DRAA 5DQGA 1U49A 1UVKA 2M8HA 4CYUB 3MD3A 1RHKB 1WUUA 4R0JA 5AXKA 4NZ6A 2MQPA 1Y4ZB 2C3UA 3QZ7A 5KAKA 1FDDA 4DQIA 5ETOA 4JBCA 2DH7A 2NXNA 2M70A 3D0GE 5KT3A 5HI7A 2E9RX 2R7UA 4M5IA 4RR5A 3HM9A 2F4VJ 1P9YA 2EG2A 1UPPA 5LXRA 1DQ8A 2J6TA 2CJAA 3GR0A 1Q86T 2VFRA 1I1GA 1RLCL 2DBBA 1F5CA 4Y28C 3PFEA 4ZPAA 4ZOSA 3R1LA 1UEUA 2MY8A 2IYIA 4YB6A 3GIMA 2A6MA 1MU2A 2ZH5A 3CJ0A 4DQSA 2AQ4A 1ZBTA 4NA2A 2AF6A 1JKHA 4I2PA 2KFYA 3KLFA 3J80Y 2VKRA 4LF2A 2IRXA 2I8EA 1S9FA 1FKAF 3CDWA 4ZIVA 2CQ4A 4KSEB 2ZH7A 3QSYB 1IM6A 3QYYA 4AL6A 4CP5A 4RW8A 5FDLA 1VBYA 1NKEA 2APOA 1Z1ZA 1Q5YA 1F0XA 3DRRA 4KAIA 5EX3A 4CTAA 2MZSA 4WU3A 3C3LA 1LW2B 1UKUA 4DHVA 4ICLB 2PO4A 1D0EA 3QJPA 3HK2A 1IJEB 1HBMB 1MROA 2VG6A 3W63A 4OHVA 4ZHRB 2ILYA 3CO9A 2V2QA 1LWXA 2F8HA 3MOJB 3QJLA 2ZUGA 1EP4B 4G6VB 2MXYA 1S57A 2WONA 2HHPA 5B0AA 4WFYA 4K5RA 2R7QA 3P4UB 4ENOA 3VVTA 1GX6A 2ADBA 4NCGB 1VQLS 2K1RB 4AL7A 3DI6A 3GR1A 4IG0A 1JQGA 1PC5A 2RRBA 4MMOA 1YKWA 2RVJA 3T5JA 1EQ0A 4CYUA 4BLGA 1IR2A 3PYGA 1YJUA 3RBZA 1WHWA 2ZVIA 4L75A 3N01A 2V69A 3NOCA 2HIYA 4JI4F 2V8DA 4DV6J 4TU7A 1NSPA 3BZQA 3F73A 3OVBA 5H9EJ 4B3MJ 4EZ6A 1M5KC 1N5QA 3POTB 1N4LA 4DEZA 4KGZB 3QSIA 1CBKA 3OVAA 4KIAA 3G8TA 2Z0GA 4DV5F 5AXLA 4ECUA 5F9NA 3T1AA 2QFJA 3FC9A 4TU8A 2YWFA 2YNIB 5KFTA 1WORA 1PYSB 2BOPA 2H65B 4P2XA 1VK3A 1OPIA 2NXJA 4S0MA 3CNQP 3QIPB 3HJFA 3CSKA 4LRFA 3I0SB 1UEKA 3MR7A 2FD2A 2XZTB 2XO6A 1TAUA 4J9VA 2ZH3A 3PCOB 2MKSA 2XI2A 5D0EA 2NZCA 4HDHA 1PYTA 1WSRA 1FESA 4IG3B 2XMKA 1RYRA 3HO1A 4KGXB 2JC1A 3ITHB 1DAXA 1KLNA 2ZBRA 3BYPA 3HKWA 4HL9A 3MCNA 3D54A 2PFFB 1PAEX 3WQPA 5KOWA 5ADZA 5J1PA 3QZ8A 1OIAA 3BSCA 1FTCA 4ICLA 1RSCA 3VQTA 3CCRS 4OZLA 1I3OB 2UUCF 4B3TF 5F41A 1HBMA 2XYHB 5HROA 4DZ6A 4ZHRA 2C1EB 3AHPA 5GAEU 1FD2A 3CF5Q 4JV0A 1EP4A 2MKIA 1YITS 4FBTA 2VPWB 5DQHA 2IYGA 3W65A 4NCGA 2K1RA 4OZ3A 1TL3B 2V8HA 2OUGA 3NS7B 4H4OB 3OLBA 3CCLS 1QAXA 4DSLA 4J37A 4QYZK 4RPFA 2Z57B 4ED7A 1SQFA 1UFWA 5DG9A 3G8SA 2W1BA 4LBPA 2M7SA 4IR9A 4I6YA 2MTLA 4CO0A 1KFDA 1DQAA 3NP5A 3QGHA 1FX4A 4FF1A 4ZITA 5D6GA 4L3NA 1BHNA 2IFXA 2R7WA 2UVUA 1NRKA 2Z30B 3FKBA 2EFVA 2KXNB 2VFVA 1AZSB 3POTA 2BE2B 5M2RA 3FEZA 4CWBA 4NWBA 2XO7A 5EN1A 4EBEA 3ZTPA 1L3UA 1VBXA 1RLDA 4XTTA 2OH2A 2L3MA 1GAOA 2P2CB 2YNIA 2VONA 1WTFA 2R9LA 2E9ZA 1YIJS 2V34A 2KHDA 2HVIA 3NCQA 2HBRB 2JFKA 3QIPA 3I0SA 2C2EA 4KY3A 5K8PA 3MR3A 1OQ6A 3MUTP 4LSLB 5D0RA 1EZZB 2DB1A 1PC4A 2GZOA 3HZGA 1W25A 4X4OA 4IG3A 2EK6A 2FVQA 3ITHA 1HNXJ 3GWCA 4CO2A 3T1YF 3MCSA 1H7WA 1HQ2A 2J0WA 2D3ZA 4GMKA 1G3OA 2W4CA 4KTQA 2BZ2A 4FN5A 4NLDA 2ZH9A 2WTFA 1PSDA 3Q8QB 2YNGB 2XMVA 3AFGA 2DO4A 5HANA 3GFZA 2NR0A 5ITHA 2HZVA 3JQJA 1HBUB 1ZM4A 3ZFVA 2XMAA 4KE5A 2BRLA 5HATA 2D3OR 1QTMA 3CJ4A 1TL4A 3SSQA 4RNNA 2BQRA 1S1VB 2GHWA 3TW0A 3ILJA 1KQFB 4NA3A 4DSKA 2NXCA 2Y0BB 3C8YA 2UXCF 1X60A 2CQGA 3OR2B 4O3NA 1Q78A 5KFCA 2G0IA 4NLVA 5KFYA 4B3RF 3TQ1A 5HQ8A 4P74A 2WSEC 3THVA 1RHJB 2CWXA 4F04B 1TL3A 4H4OA 4Y00A 5MAOA 2V94A 3JSYA 1MMNA 4UOHA 2Y8WA 4NYOA 1NHUA 4R0EA 4JI6J 2YX7A 3BQ1A 4P7TA 1J5EF 2P6SA 3SYZA 1VR6A 2UXDJ 1EQMA 2B3TB 1AZSA 3GG1A 2BE2A 3MXHP 3FK4A 3I4HX 3LGMA 3IR7B 3DM2B 3NOGA 4DDFA 2XWXA 5KG1A 1SL1A 2X7IA 1B70B 2BUNA 1HPZB 3HKZD 3KLHB 1YLXA 3UQSA 3U1MA 2QTWA 3TQEA 2XSFA 3GIJA 1S9EB 1UZHA 1N56A 3KJVB 1VQOS 1PCAA 4I64A 1A6LA 1PGZA 1WD6A 3ZNJ1 4LSLA 2JVRA 3SCLE 3BO4A 2ZC3A 1IBKJ 2O1PA 4E0DA 3HPOA 4AFFA 1VS3A 2RT3A 4A8KA 1HR0F 3G6YA 4DL7A 3ZZOA 2KM8B 2HBQB 1HLWA 2B4UA 4LVNP 1CSJA 4J90A 2CJQA 3FCHA 1Z2ZA 3FSIA 1EJ7L 1SVDA 2YNGA 2MHNA 5KFSA 4Q43A 1HBUA 2QC3A 1LXJA 2D9OA 1QM9A 1X4BA 3S8SA 4DV7F 1QUVA 4KRWA 1OSCA 1S1VA 1RACB 2ZBCA 5A0YB 3QJJA 2NLWA 7FDRA 5L1LA 2ASJA 3BSNA 3OR2A 1NZAA 3SSSA 4Y34A 4UW2A 4F4WA 3NKYA 2CQ0A 2XS2A 1JLGB 2EEYA 5KFLA 5GAHU 1N33F 2XNQA 3E8OA 2XGPA 2AJ4A 2ROGA 2LLZA 4J9PA 1IUJA 4F0HA 4CCHA 1GEHA 5D15A 1U1KA 4X2BA 1SKWA 2EG1A 4RBVA 1N5SA 3CJ8A 1I51B 1RWPB 4AXIA 3KHLA 3M8YA 3R97A 4OZ2A 2CG4A 3NEKA 2BV3A 1JLCB 3W7BA 5KTQA 4L73A 5KFRA 4JI5J 2W7OA 3DM2A 3UDEA 3C66A 3LGNA 1HPZA 4CT8A 2HFOA 3KLHA 4OLOA 4ILRA 4A46A 2ZH8A 2DGWA 1S9EA 1C2PA 4QWCA 2DKOB 1YGYA 1JJ4A 3KJFB 3KJVA 4TN2A 4OI6A 4N41A 4O3OA 2LQ8A 4URQU 4OX6A 2N3OA 4MT1A 1FXDA 3X3UA 4RW9B 4FS1A 2OMOA 2HZAA 2QZ8A 1IQZA 2CQIA 3PACA 4F4ZA 1Y0HA 2VODA 4OYBA 2MQQA 2RQKA 1A7GE 2GS8A 3T5KA 4M94A 2G1HA 3BQ0A 2MMYA 2OIHA 1KHWA 3RRKA 2ZJRQ 1UL3A 4LIWA 4D3GA 2BKNA 5GVQA 1GQEA 1T9TA 3LGHA 2XBPA 1YJTA 2DJWA 1PJ6A 3H59A 4IO9Q 1D8YA 3DXSX 5A0YA 1Q81T 3LAMA 3LP0B 1N36J 3P3DA 3B78A 1J5OB 2D1CA 4J7CA 3V81B 4P75A 3QWPA 4U67Q 2EFNA 1NSKL 1XR5A 3A4TA 1GMWA 3G6VA 2AYGA 1JLGA 1NPKA 3P5TL 2LFVA 3PRBA 5GAGU 3AOCA 4MFBB 4DR6F 1RQ0A 4Q8EA 4WK3A 4RU9A 3MM7B 1UW9A 2KDOA 2AZ3A 3TR5A 1CJKB 3MPUB 3RGIA 5CXTA 4AYBD 1WG5A 4ZJLA 4UY8T 2I38A 5E3PA 3EDQB 4URGA 3MF5A 1JLCA 4JI8J 3L9ZA 2C2NA 1Y5NB 2GQ2A 5LJ5Y 4IKAA 3EICA 4LFAJ 4DR3F 4OV1A 2BABA 2Z2ZA 4M1KA 1Q4RA 1YBTA 4AXJA 1YDLA 1XNQF 4FVCA 5IT4A 5F8IA 1XMOJ 1M1GA 3CCTA 4M5GA 5CCMA 3CC2S 4NEZA 1U1NA 2HS4A 1XQIA 2HS0A 4NXMF 4LFBF 3IM9A 4RW9A 2I0XA 1XEZA 1HFEL 4ANCA 4I69A 1SH2A 1VRUB 1RYSA 4ECXA 1I6JA 2C2RA 4DU7A 5HLFB 3P5BP 1QD1A 2BEFA 3HSGA 2DO0A 1WSVA 3CC7S 3EVOA 1Q8LA 3BGRB 3NG8A 3EGZA 1KEKA 3QGIA 2B51A
chains in the Genus database with same CATH topology
1UVJA 7FD1A 1RGVA 2BM1A 5KFPA 1SL2A 3C6UB 4HH0A 4X84A 4N5SA 2HFZA 2RUGA 4C3LA 5J2NB 3SEOA 2R2TA 3IR6B 5DGAA 2Q3PA 4PXCA 1F2GA 4DSIA 3EGNA 4G3IA 3LQVA 3OUYA 1SB6A 3MUVP 2B5JA 2HYIB 3D1OA 4YDDB 3UNGC 3UI3A 3LP0A 2VKZG 3CJKA 3HVWA 3PXGa 1S49A 1T3NA 3K5MA 4TLRA 2YX1A 1RA6A 3IWLA 4O44A 1TVRB 2ZJPQ 1J5OA 3V81A 1DLOB 4RNOA 1CVJA 2IBKA 2ZHBA 4ETXA 3SCIE 5DGBA 3FMWA 2IC3A 1IM4A 2CPDA 2V5HG 3LO3A 2OFHX 1N5YB 4B9VA 4JI1F 3DLKB 2GQCA 2IRUA 4DF4A 4LJMA 4K4TA 5IFMA 2IA6A 3KNAA 4DQQA 3NAHA 3DLJA 5E2QA 1S99A 2HHTA 2FHOB 2HWHA 1UWBA 2LECA 2R8IA 4M63A 2HQ3A 2VQEF 1ZETA 2HNZA 4HVZA 1WHYA 2DHGA 3GYNA 3KMQA 1T02A 4BWMA 1BWEA 4F3QA 4EO8A 2QRRA 2VG7A 1RT7A 2OTLS 4DSFA 1X5SA 5JVGQ 4BS2A 4MFBA 1HBNB 2W9AA 3LP1A 3PW0A 1NNDA 4B9SA 2E29A 2MQNA 2YKMA 4WYLA 1N6QA 1WEYA 4LFCF 1MNEA 3FRZA 2PE8A 5B0FA 2LQ5A 5C24A 3MM7A 4HKQA 4TXSA 4QW8A 4PG6A 1I94F 3O44A 4LF9F 1VI7A 2NS1B 3KG4A 3PHEA 2JLGA 4F50A 4Y3CA 2CKWA 2FJBB 3R1HA 2UUAF 2D3UA 4IRCA 2AWZA 1BLUA 2CQ1A 1SKSA 5B0BA 1JMTA 2ZOMA 4JI5F 4O4GB 2EKYA 2M5YA 5KFZA 1X7VA 4QJVA 1SUQB 5KT6A 1ZZNA 3WC2A 4Z37A 2XI3A 3K7RA 2PI4A 5GMKa 3ENWA 4YR0A 4WFNQ 6FDRA 1RKJA 2DIUA 3ZZRA 3J7YI 2AP6A 3NS6A 4DL3A 4B9TA 4HT5A 5T14A 1U09A 2KH9A 4C3MA 4CO5A 2AX1A 1AFIA 4IYQA 1WG1A 4C11A 4OJ1A 5GAEI 4QPXA 2LMIA 5JJBA 3JYTA 2VPXB 2W8LA 5LMNF 1YJWS 1LWEB 1U1PA 3IRXB 1K9MT 1Q53A 4CH1A 4X4UA 4KHRA 4A48A 1IN0A 1TKTA 5F3TA 5KFKA 5CYJA 4CH7A 4GC6A 2EWHA 4QWBA 1RA7A 3N9UC 3S01A 1TQLA 5KFVA 4NMLA 3I82A 3RBDA 4KKOA 1P9QC 2XZWA 2RQCA 1HL6A 2MZRA 2X51A 4ZCKA 2IBOA 2PN6A 3MMBB 2VA3A 1C4AA 1QSYA 1BD6A 3KK2B 2GIRA 1WACA 4JI0F 4TYBA 3PW5A 5H9FJ 3M9NB 4K4XA 4RW6B 4OZNA 4WCEQ 4PXBA 4A8YA 2PA3A 3H5UA 2BANA 2GHPA 3QAEA 5HN0A 1KHVA 3PY8A 1F9FA 4RU2A 4FXWA 1HQEB 2DTJA 5AE3A 5DLGA 3AH6A 5K14B 3VAMA 1E6YB 3K5PA 3UCGA 5GAGI 2B6AB 4MJKA 3SV3A 2DIVA 1S79A 4A8FA 1QLNA 3J7Z5 4F3MA 2PC6A 3GV5B 1RTDA 4CO3A 1Y7PA 3M1VA 1S10A 1UW4A 2FDNA 3DDKA 3KLIA 2PMZD 4DL2A 2OPSA 1VRUA 2ZC4A 5D4NA 5CZXA 5DLFA 1N48A 1BGXT 3JTOA 4KO0B 3OXFA 3UCZP 1DRZA 1X0PA 4WFBQ 3PKMA 5HLFA 1Z2LA 2EVZA 2KRBA 3A8EA 3AJ1A 2FC9A 5K9FA 4EYIB 3FJ2A 2GMLA 2HHXA 2XMWA 5HMYA 3VF0B 2LEBA 3MEDA 3SQGB 3CCVS 2QSFA 4QR2A 5K5MA 1BY9A 3K8VA 2HHHF 3T5LA 1DQ9A 4A4JA 4HTIA 2ZH1A 1HD0A 5FLXY 2B43A 2V8VA 2C3YA 4X4NA 1FA0A 3CCJS 4OI0A 3DMJA 5KFUA 2V4JB 3NNAA 4MIAA 1DFDA 2E5HA 4DN0A 4MK8A 3T5HA 4TU9A 1L3KA 1N5VA 1LOUA 3IBWA 5KFEA 3UD4P 1HWUA 5BYSA 1TKXA 3BGRA 1FJ7A 2DGTA 3SV4A 2PA8D 3M8PA 3S7RA 2NREA 1Y9OA 5C42A 4F2RA 3DU6A 3G9CA 3BDEA 3E01A 4XK8C 5E3CA 2YH0A 4I2QB 2AD9A 4FF3A 1NK5A 1REVB 2VUGA 1MMDA 1U1OA 4ZP8A 4Q8FA 2OPQB 4ZMMA 3C6UA 2YWGA 5HROB 5LSOA 1Q16B 1N36F 5B0GA 5J2NA 2XHWA 1B0VA 5D77A 1S1WB 3M8QB 1U2FA 2ZH2A 1N0VC 2DR9A 1LFWA 1KONA 1S77D 4Y0FA 2WCXA 4O3RA 3I5BA 2ZZMA 5IWAF 4HHJA 4Y6IA 4DWIA 4V19X 2KYZA 4X4PA 1TVRA 4KV8B 4IFYB 3QO9B 1NJZA 1DLOA 2FJAB 2GX8A 4DBQA 3H20A 3TUIC 1KTVA 1GXLA 3Q8PB 1FEEA 1OO0B 1UA0A 2GMJA 2VG5B 4F8RA 1HNIB 3DLGB 3QGGA 1N5YA 2ZNZA 2PMHA 2QO3A 3HF5A 3HHLD 3DLKA 4KBIA 3RYLA 4EUVA 5KFHA 2E66A 3MHYA 3OTBA 1NK7A 4Y2CA 1T05B 3RB0A 1T03B 1SJ1A 1GX5A 3H2VE 1SJ3P 2GV1A 1BQMB 3O8WA 2VFTA 3O6QA 1NJYA 1X4DA 1MMLA 1HI8A 4K4SA 1K1QA 2F8EX 2JLFA 3IS9B 3TUZC 4DV2F 2KJWA 4ZK7M 3PZPA 1HBNA 4LIRA 2UV8A 1WEZA 3OSPA 3HHLC 2YWKA 3TVYA 3HHDA 1FEHA 2RU9A 5F8MA 3I6PA 1QAYA 4MTPA 2XGQA 3NNHA 1FDAA 4EZ9A 5EWFA 2F9DA 4WZMA 2HWIA 2CPEA 2ZOFA 3MMCB 2XY6A 4A8OA 2G4BA 4ATNA 3LP2B 3OW2R 3HX9A 4TY9A 2WB1D 1KR4A 1X4CA 3TANA 2ZHOA 1FRHA 3NL0A 2CQPA 3HFKA 3OTEA 4TKTA 3MI7X 5KFDA 4JI8F 4ED2A 1X0FA 4MYUA 5LMUF 4YB1P 1FK9B 3GZ7A 4HTJA 1P6TA 4J9SA 2DNNA 4DL0C 4LFAF 3CJ2A 1HWKA 1OWXA 2KVIA 2COLA 2ZDPA 2ZKUA 4O4GA 3M30B 1QAIA 2JFDA 2E7WA 2CPYA 5LJ3Y 1SUQA 1FRJA 4WU2A 1UJ4A 1BQXA 2VPYB 4NLSA 2XY5A 2FJWA 2CPFA 1WELA 4Y2KA 3KHGA 4RKUC 2OLWA 3CDAA 1KVIA 4QR1A 2DPJA 2QMWA 4G1QB 1KS2A 2FHJA 3KTQA 3M32B 2KHCA 4B08A 2OD6A 5KG5A 3UDCA 3KLEB 1LWEA 4NCBA 1U1RA 4B9NA 1SJ4P 3RAQA 3GFXA 3N79A 4DFKA 1U1LA 3T9NA 1Q7LB 2LU2A 2YX4A 4CO4A 5M2UA 5D4PA 1U4BA 2KZMA 4NYPA 2MQLA 5SUHA 1O51A 3MDFA 4MH8A 3SCKE 3Q22A 2JEFA 2HW3A 3M6WA 4O3PA 5CA5A 2ZZNA 3MR6A 3MR2A 4NLGA 3MMBA 3IGNA 2V9KA 3PW7A 4JYAF 5CZVA 3Q0AA 4YDXA 3KK2A 2DNGA 2O3DA 2RS2A 1R3NA 4RW6A 1X4GA 2JSXA 1HW8A 2FHKA 4TQSA 4QPTA 3X1LB 4B17A 2ADCA 3MUMP 1WHVA 1HQEA 4ZP9A 4P7VA 3Q2SC 2FLOA 4CI0B 5K14A 2DGSA 1E6YA 5E3RA 2B6AA 2JRSA 2WAQD 4ES3A 5B7WA 3NAIA 5KFJA 1SV5B 3MM5B 5HMXA 4KR0B 4ZCMA 1W2BR 1APSA 3DOKB 4HDGA 4KO0A 4PKDB 3LWMA 1C0TB 1HW9A 4N47A 1B0TA 1VQNS 1FF2A 1YWXA 4WXOA 3LOUA 3PFOA 5E0OA 3DRYA 4NYZA 4KHPF 1C0UB 2B0GA 4K4ZA 2FHMA 3RB3A 1CQMA 1VQ9S 3BSAA 2ZNYA 2MHEA 3SQGA 2AW0A 4F4XA 2QMXA 4U6PA 2NPFA 3K5OA 2WOMB 1IJFB 4U7UK 3L7PA 5FD1A 2ILZA 4ZVHA 2JZ5A 3TA1A 4GKJF 2E1AA 4KGMA 1HARA 3QMQA 4PXEA 1U45A 2V4JA 4ECWA 4QIWD 4NPOA 2MKCA 1HHTP 1S7HA 3DOMA 2OKQA 1QUPA 1S6QA 1SXLA 4C8MA 4X4VA 1XMBA 1FKOB 1LQ9A 2AX0A 2NSBA 3JAMY 2N4CA 2AYEA 1P8GA 3M2UB 3CIZA 1XBWA 3B4DA 4ELUA 4C9DA 4I2QA 4LUBA 5B0EA 1REVA 4TYAA 4H4KA 2OPQA 4K59A 2NYIA 3RW6A 1JIHA 1RAJA 2G0CA 3VAIA 1JXEA 3DU5A 1SI9A 4JOUA 1N0UA 2RE1A 1S1WA 3M8QA 4ZP7A 5LT5A 3H8YA 2L41A 2UXCF 4K50A 5J1NA 3DFEA 3CTRA 3PJXA 2KRRA 1RISA 2UUTA 1UVMA 4C0OC 1XWLA 3VR1A 1VQYA 1HBOB 3O5TB 2L9NA 4IH7A 3LANA 3DN9A 3PDNA 4HLBA 4NRUA 3HMJG 2RQMA 5EGYA 3HVTB 2BDPA 4KV8A 4IFYA 1LWFB 3QO9A 4F67A 4F02A 2X1BA 3PR5B 2I2YA 4RNMA 1VC0A 2FB0A 3BO2A 2LVWA 3HHLB 2VG5A 1HNIA 2Z4PA 4C97A 5KFFA 3DLGA 1R8PA 2HPUA 3QGPA 1VQ4S 2BYCA 4C8NA 3CCUS 2QE5A 1YRUA 4OX9F 2P9GA 1T05A 1T03A 3J7A1 2R4FA 2UZAA 2JJ4D 3BGLA 4MAKA 4NLTA 3NLCA 3GG0A 4OZJA 4ZPTR 2A1BA 1BQMA 2HGNA 4PG4A 2LU1A 4V19J 1K73T 2YNFB 1XR6A 1TR0A 1N52B 4DN9A 1H3DA 4ZPDA 1TUVA 3O3LA 3IS9A 4ZA1A 1KNZA 2C3PA 2BW2A 2MKHA 4QIVA 1CEZA 1V3ZA 3BR9A 5DM7Q 3WDOA 4Q5VA 4YMEA 4J9KA 2GFFA 1VIXA 1UFLA 2UVVA 1HMVB 2B9YA 4DPOA 2IRYA 2M9KA 3AB4B 3TOQA 4YB5A 2ZJQQ 3CJ5A 3MMCA 2GQQA 3LP2A 1X5TA 2XG8A 1FJCA 1IKXB 3UPFA 2AJQA 4TY8B 5IQQA 5IQ6A 3FFIB 2UUBF 3CE8A 4MKYA 3V6JA 1YRTA 3E51A 3M4XA 5D4OA 4NXNF 1B64A 3AY0A 4HEA9 1FK9A 3OXLA 2Y1IA 2F4VF 4C7QA 1VQKS 3VQSA 2OAUA 4QWEA 3L7OA 3PNIA 1YBAA 2VFSA 2EFGA 3M30A 5LL6d 3GIKA 4H54A 2KJVA 2WW8A 2K7KA 4DSJA 4YUDA 3T19A 2H9ZA 3I96A 5GADU 1WF2A 2L48A 1B7FA 4PPZA 2J0XA 3OL6A 3DOLB 1FRMA 1NH7A 2DNRA 2VC1A 4ZVFA 4ZCIA 5C25B 4NLXA 2C3MA 1HNZF 4EWTA 3PO5A 1M5SA 1U6ZA 3TVKA 4DV4F 2ZBIA 4G1QA 3M32A 3PO4A 2IMWP 3KLEA 3HT3A 3FZBA 3GB0A 3SSRA 2E1CA 2M8DB 1CLFA 1BQNB 4QOTA 2MJNA 2JC0A 3AB2B 2Y0SD 3EZUA 5KFIA 1M5HA 2B4VA 2CFXA 5KFMA 4IRKA 1HNWF 1YG0A 2RF2B 4USJC 4J9OA 2DHSA 2A3JA 2PSZA 1VQMS 3FEXB 4DS5A 1S72S 2JVOA 1WTBA 1FVSA 2R8GA 3MTKA 1JLEB 1IKVB 2R8JA 1FD8A 3N5BA 2VD3A 1YHQS 5CH7B 3UCUP 3VAKA 1SJRA 1MU2B 5GAHI 4YEAA 4AUKA 2A2DA 3NMAA 3S1TA 3CCWA 3OXGA 3H5XA 2MPUA 2HRUA 1FTRA 2FJDB 3ZC4A 5K8NA 3CD7A 2G13A 1JKHB 3EXCX 3ISND 4C3KA 2DT9A 2FY1A 1FNOA 4I2PB 3UE2A 1GXTA 1NJIT 3RZAA 1YQHA 3KLFB 5SZTA 2KO1A 3CPWR 1U7LA 5KFGA 1KD1T 2LXFA 3BM7A 4JI7F 1SV5A 3MM5A 5F8NA 4DF8A 4I56A 4WF9Q 3IO1A 3DOKA 1SBRA 2NUHA 1X4FA 1U48A 1QY7A 1YVFA 3D2WA 1S76D 1C0TA 2DNMA 4PQAA 2RD5C 3I0RB 3GQCA 2R7SA 1SL0A 2XCPA 4Q44A 4IR1A 1Z4UA 3ISNC 4RW8B 5FDLB 1C0UA 3PX4A 1WI6A 3ONQA 2H5EA 4EBDA 5CCLA 1SH0A 3FSYA 2YNHB 1OQ3A 1HQUB 3DRRB 4ZVEA 1FXLA 1TL5A 4R25A 3UW1A 5EHHA 1NKBA 2WOMA 1ZZFA 3V5RA 4CTAB 4OHXA 4QWAA 4ZPWR 1X4EA 3IAS9 5K8MA 3SFGA 3IWXA 3DHXA 2FVSA 2F3JA 4PWUA 4FNHA 3U1NA 4CNYA 1R0AB 4FVMA 4P2SA 2RSQA 1VJWA 1Y5LB 1S0OA 2HG4A 3ZZYA 3RR7A 2KZZA 1FKOA 2DNLA 3FVYA 2VA2A 1N32F 1H0HB 5B09A 4RUHA 3TAQA 2YKNB 4Q0BB 1MROB 2J9DE 2VG6B 2ZE2B 2PDAA 1QVGR 4BDPA 3M2UA 2CVEA 3K2YA 4C98A 2HGMA 2KM8C 1HWIA 5D4LA 2Q79A 3R27A 2HLTA 2Q6BA 2RNEA 3CWJA 3PR4A 4YB7A 2RH3A 1GTEA 2XS5A 4OX7A 1R31A 1FHTA 4USHA 1U24A 2N7YA 4WJBA 2DNOA 4DR5F 2W24A 4FS2A 1UJ6A 5CYQB 1C1CB 1UVIA 1JLBB 4BC7A 3PJWA 2EBEA 3GYXB 3PIPQ 3KWMA 1HBOA 2FLPA 2WONB 5BYQA 2WSFC 5T7LB 4XPEA 2ZH6A 1DZ5A 1K1SA 4NCAA 3HHEA 3HVTA 3ISZA 1LWFA 4PG7A 5D78A 2MKJA 3OVSA 3TAPA 1VFJA 2K8GA 4O4RA 3P49B 1E6VB 4CO1A 3HHLA 5JUMA 5DETA 1MWYA 3UR0A 3V4MA 2ATLA 2KFNA 4OX8A