1F60B

Crystal structure of the yeast elongation factor complex eef1a:eef1ba
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
b'PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ELONGATION FACTOR EEF1A
publication title Structural basis for nucleotide exchange and competition with tRNA in the yeast elongation factor complex eEF1A:eEF1Balpha.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f60B00
2UXCF 1XMQF 1FJGF 4LF7F 4LF5F 4DV7F 5LMUF 4NXMF 4JI0F 4DV2F 4B3RF 1CQNA 2KJWA 4X64F 4LFAF 4JV5F 2UU9F 2F4VF 2YY3A 1F60B 2BXJA 4LFCF 1G1XA 1VMBA 2E5LF 2VQFF 2KJVA 4GKKF 1HNWF 4JI4F 2UXDF 3T1HF 2UUCF 1G7CB 1LOUA 4B3SF 1IBLF 4DV5F 4YHHF 1FKAF 3ZZPA 4JI3F 5LMNF 4X62F 2ZM6F 4DUYF 5AJ3F 1IBKF 2B7BB 4JI2F 3T1YF 4DR4F 1HR0F 4JI8F 4GKJF 1N32F 4DR6F 1J5EF 1XNQF 4LFBF 4LF8F 4KHPF 5BR8F 1IJFB 4DR2F 2J5AA 2BVZA 1QJHA 2HHHF 4DV4F 1N33F 4K0KF 1CQMA 4JI5F 4AQYF 4DR3F 4LF9F 4DR7F 4DV3F 2RJZA 2UUBF 4JI7F 4B3MF 4DV1F 1N34F 3OTOF 4DR5F 4DUZF 3R3TA 4LF6F 4NXNF 5IWAF 2B7CB 1B64A 1HNZF 1XNRF 4LF4F 1GH8A 4DV0F 4OX9F 1RISA 4JI1F 1XMOF 4X66F 1N36F 2UXBF 4X65F 1IJEB 4DR1F 1I94F 4YY3F 4B3TF 1IBMF 2UUAF 4JI6F 4DV6F 2VQEF 4JYAF 1HNXF
chains in the Genus database with same CATH superfamily
1FRMA 2CNLB 3A8KA 1OSCA 1UJ6A 4NZ7A 5F8MA 3PTWA 3G82A 4ELVA 4ZKAA 4OJGA 2H5JB 1VJQA 3DI6A 4Y28C 1VLYA 4ILLA 1JLGB 2P6TA 3C19A 2W8LA 2FC9A 2GIQA 1LXNA 4PABA 3I55S 4FP9A 5LM7E 2VICA 2M9KA 5HMWA 2XULA 2XMWA 3SFUA 1FWPA 3MD3A 3RW6A 2OPSB 2CKWA 2W2OP 4JI5F 1HHSA 3DLEA 3ITHA 4DQRA 2HQCA 5ETOA 1CJVA 4C0HA 4YDDB 2GFFA 2ZH6A 4IKAA 2XMJA 1SJRA 2ZD1A 4OYXA 3GILA 3HHNB 1N5VA 3HSGA 2X3DA 3S6EA 3A3OB 3IC1A 4LFBJ 5GAEU 5ETMA 3D1HA 3R5JB 2AEMA 2VBWA 7AT1B 3LH2S 4RNNA 3UD3P 1VFJA 1XBWA 2VKRA 1N4LA 2X51A 4RW7A 4DL7A 4GVLA 1IKWB 3HHEA 3IM8A 2RF2B 3PR4A 2ALZA 2DGSA 4LF1A 2HMIA 4ELUA 4KFBA 3IFEA 5L1IA 1R0BG 2HHTA 1GK8A 4N5SA 4WCEQ 1D9DA 1HD1A 2FJAB 3ENVA 3MR6A 1Q5VA 4P75A 2RS8A 2GMHA 3MGJA 4C8KA 1UVIA 1JKHB 2D3OR 1ZM3A 2G1HA 2WSEC 4OZ3A 4YEAA 3C66A 3CB4A 3DHXA 1MSWD 3PHTA 1YJTA 3LANA 3J81U 2VD3A 3AQPA 2WB4A 1QAJA 3UD4P 4RW8B 5A8WA 1FEHA 4GMKA 2YKNA 4DPUA 3NXZA 2XSJB 2HWTA 3QYYA 3THPA 3H42A 4LF5F 2JSXA 2UUBJ 3CMES 3NWRA 3J81Y 4PAAA 2UVUA 2R7UA 2MJUA 5LMUJ 2CPXA 2PA8D 4X4OA 5IWAJ 4AE5A 1FNMA 3DYAB 3K59A 5D15A 4Y0FA 4OLOA 1GMWD 2WVBA 1Q1KA 5L46A 4G1PA 5LSLA 1GMVA 4KPYA 4PUOB 1VDHA 1LW0A 3ISND 5D4OA 4B9NA 1Q86T 1QSSA 1L5UA 1CQMA 1BWEA 4Q2MA 4RW6B 3QJJA 3DLJA 3IAS9 2DGXA 4DG1A 4RW4B 1N54B 4NX9A 2BOAA 3BSOA 1Z2LA 1FE4A 2AZ1A 5J2MA 2Y9HA 2PD1A 4QU7A 2W2MP 4I64A 1GAOA 3DFEA 3O44A 1BUXA 3DRSB 5LJ5Y 4NZ0A 5K14A 2PC6A 3N9UC 3W9IA 4Z37A 1HPZA 1NK5A 3TUZC 2DISA 4TXSA 2YQ1A 1WC3A 1T9XA 2FJBB 3IXQA 5HP1A 1SIZA 3OR1A 2XB2D 5CXTA 2LEBA 2YNGA 2J8SA 1MN7A 4BC7A 2BE2A 1H0HB 4K8RA 1Y4ZB 3OSNA 4TYBA 4Y2KA 3BF4A 2JLFA 4WTYA 1MU2A 4F4WA 4DU7A 1RHKB 2R7TA 4JI0J 2Z56B 2LXFA 1QLNA 1ZM4A 8RUCA 6FD1A 1KHWA 4DCJB 4WIQA 1H2VZ 3IP0A 1UETA 2JFKA 5AT1B 1DQAA 4DF4A 4ITSA 4JI4J 1UMJA 4UQTA 3QT5A 1OY9A 2M4MA 1LNQA 5KFAA 3FEYB 3ICLA 3HPOA 1UVNA 2KYZA 3ZO7A 2H5EA 1FHTA 1BLUA 3NCQA 1DQ9A 2L48A 5CZXA 4P52A 1MWYA 5E3QA 1U47A 2BJ9A 2M52A 1FJGF 1WEXA 1JLQA 3BKFA 3R5CA 2EFQA 5CYJA 2R8JA 1F60B 1T02A 4X2BA 5CAAA 3N4WA 4USMA 4DUZJ 3GG0A 2KJVA 4CTAA 4TU7A 2IYIA 1KBRA 2AEFA 2VHGA 1VCTA 2KM8B 2C28A 2W2PP 5AE3A 2B9XA 1LFWA 3HKWA 3HJFA 1GTHA 3C6UB 3HVRA 2CQGA 5GAEI 4URGA 1TFYA 1OMSA 1N33F 4L3NA 2VG5A 1YJWS 2VG7A 5BJRA 1C4CA 3QFHA 4ZPCA 5KFYA 2L08A 2Z2YB 2NXCA 4DFKA 1U25A 4ZHRB 1TAUA 1DJ0A 3ZZRA 2V4QA 1V9OA 1Z1ZA 4B02A 3CCWA 1W25A 2RKIA 3ELHA 2MYFA 2CPIA 5BR8J 1I94F 4IFYA 3BR9A 3GJQB 2YWGA 2P6SA 3MOZA 1FXLA 4WK1A 2YVSA 1UEVA 4A8QA 2AYBA 2RQMA 2LA4A 2CJKA 1S7HA 1VHIA 4NLWA 3V5RA 3KWMA 2QX0A 2PT0A 3H2UB 4NYZA 1WSRA 3DRRA 1NK0A 1N5TA 2E1RA 2PIIA 1T3OA 2DPJA 2KHCA 4MJKA 4DFMA 2IMOA 2B4OA 3HFVA 3IRXB 4ZA1A 1IBKF 2Z30B 4ZPDA 1B0TA 1FCAA 3C8YA 2ZJQQ 5EUHA 1WEZA 2Y1RI 3C14B 3MMJA 3ZZTA 5C7PA 3TAQA 1D3WA 5SZTA 4LF9F 3Q23A 2DNHA 4DR7F 5HROA 4NA3A 4I68A 3GZ7A 3JSMB 4IRCA 1UVLA 2QRRA 3FBBA 3RR8A 3U1MA 1VHFA 2HFSA 3ETOA 4WFZA 3TZXA 5B0GA 4J9UE 1I51B 3FGVA 2UUAF 2N4DA 3F0NA 1RA6A 2FYXA 2AU0A 2XNQA 5C25A 1QSLA 5DDQC 2XY5A 1YIJS 1FDBA 2KRBA 4IQXA 2D3ZA 3HHLD 1Y10A 2JDJA 5EWFA 4YDXA 4I6WA 2OAUA 2F40A 3VAHA 1JLGA 1SKUB 3BQ2A 1WTBA 3EXYA 4OYPA 2YWEA 3FEZA 4YHHF 4J9MA 2RU3A 3ZZPA 2OPRB 3H5UA 4A8YA 3R5BA 4DUYF 1BY9A 3M1VB 3GJTB 3ET6B 3CD7A 4ECYA 2OPSA 1JLAA 3CJRA 5KAKA 1TMJA 1T0TV 3DOKB 3K5MA 4OI2A 3N28A 3GCXP 2ZNYA 3O8WA 2K2PA 2RUGA 3EM1A 2KHDA 3HZGA 1FTRA 1LEOA 1WNEA 4ALZA 4P72A 3TOQA 2O1PA 1SC6A 5KG7A 3PYFA 4YR2A 2XM3A 4L74A 1H73A 1KTVA 2BKNA 4HHJA 4CO2A 4HACB 3P96A 4FVCA 4C8OA 4J9OA 4J91A 1JWWA 3SSSA 2JEFA 2J9DA 1XNRF 2UV8G 2Z58B 1WHYA 1YSJA 2YBVA 1LWEB 3TWZA 1VIXA 4JYAF 2ZBCA 1BQNB 1WSVA 2O5DA 3TARA 1YQHA 2RF2A 4USVA 2MLZA 3DXBA 5CYQB 2R42A 3N5BA 2AP6A 4U8YA 4CIOA 3DRXA 2VBZA 2W4CA 1VQMS 3TYTA 4AT1B 1KVKA 1S1UB 1PJ5A 4OFZA 3TZYA 1N32F 2LVWA 1RHQB 2E1PA 3NG8A 2RH3A 3D68A 2MLYA 2GO8A 4QYRA 4M5KA 3DLGB 3L7PA 5E5NA 2XCAA 3NWGA 1XEZA 4RL1A 3ZZUA 2ACMA 4ILMA 2H1YA 3PKYA 3H5SA 1YRXA 2ZM6J 4KHRA 2IDEA 1OPIA 4LF4F 2XSJA 2ILZA 2RAQA 2WSFC 4X65F 3LP0B 3KLFB 3R9LA 3M9OB 1TMMA 3N79A 2CJXB 1KN6A 3DGVA 3M6XA 1G3OA 4OZLA 2C2KB 1Q4RA 4C97A 2R8GA 2BXJA 3L7OA 3DYAA 2ZC3A 1RWVB 2LQJA 2OMLA 4KO0B 3KLHB 2AJFE 3A3PB 3VV2B 1HI0P 4JV1A 3RRKA 3EGNA 4PUOA 4ED8A 2CWKA 3QT7A 1SXLA 4JI6J 2WCXA 2BA9A 4CYUB 3UR3C 1M5VC 5D6GA 2KXNB 4E98A 1QVGR 4RW6A 2RIJA 3MAAB 3CDBA 4RW4A 2PFFB 2CZVC 4JUZA 1M5PC 2HURA 2F65A 3UN3A 2V8HA 1RWKB 4DV1F 2FY1A 2U1AA 1U1MA 1YWXA 4NXNF 1FNXH 3MFIA 3DRSA 4M8LA 2BKPA 1NB7A 1CPZA 1MMNA 2O67A 2CPHA 4F0HA 4P7VA 3QIPB 2VQEF 3QAUA 3A8EA 4YFUA 5EWGA 2DR9A 2AGQA 3AA8A 5DJBA 3ZZZA 2XZWA 1RT1B 1HBOA 3KMQA 5F41A 1PSDA 3VAKA 3MMCB 5HBMB 1KWMA 4NE9C 4TNOA 3TQ1A 4X66J 2QLBB 2J76E 2F7VA 2XMMA 4IO9Q 1N6QB 1FFWB 4K4YA 2XYGB 3H2LA 3T3FA 2DNNA 2IHR1 1NEEA 5FDLB 4NMLA 2BVZA 2JJ4D 1TKZB 4I1TA 2WB1D 3TJAA 1S0VA 1HNWJ 4X4PA 2OFGX 3RG6A 4OZ5A 4B3SJ 1N0UA 2BOPA 1QTMA 4TU8A 3V4IB 1RYSA 1S79A 2V6AA 2FQQB 4KQZA 1FRJA 1SBRA 2V50A 4YN3B 3GV5B 1KNZA 2CPEA 4ZLNA 4AUKA 3RRHA 2HHWA 1RBOB 1FRHA 1S9FA 3UDCA 3CCUS 4WU3A 3OV7A 3S1TA 3CW2C 4WZMA 4DFJA 1HQEB 3LGMA 1RTZA 4ED4A 3LW5C 1E6VB 1KVIA 3KJFB 3MDFA 3CJSA 2DRBA 5LSRA 2IBKA 5LMNF 1XK8A 1S6QB 3FSYA 4F4YA 3P45B 1YJUA 3OQ2A 2B8QA 2F8MA 3LP2B 1TL3B 2GHPA 3DKDA 2VG6B 2DNPA 5IFMA 2VQFJ 1CJTA 2E5JA 2CPZA 3RB0A 3JTOA 1NSAA 3RJMB 4M95A 1CULB 1FK9B 3O5TB 1ZYQA 4M5NA 1HR0J 4EO6A 4LSZB 3V2UC 2BQUA 3S7RA 2F5GA 2NREA 1VBZA 1IJEB 1KTQA 1KR4A 4FKYA 5L39A 3PW7A 3PO5A 2HPUA 4E8UA 3G6XA 2YPZA 4X4NA 3W61A 2CADA 3PRDA 2ERRA 3GQCA 1HL6A 2DCLA 2QL7B 3D0IE 2YKQA 3VAGA 2ZOGA 1X4DA 2HYIB 3VAMA 2IYGA 3RAMA 3HD2A 1HW9A 1X60A 2DGUA 1OYDA 1U2RA 4LFBF 1WWHA 4BBYA 4CNZA 3EJMA 4X64J 2VV5A 2J5AA 2MZTA 2GQ2A 4RU9A 2Z4PA 1NNDA 1IR1A 2HK2A 2RMLA 4H4KC 2M8HA 1HKAA 1NKEA 4AYBD 2JC1A 3JSMA 3PDNA 2W25A 1C1CA 2CQ0A 1SJ4P 3Q8PB 1VK8A 4M63A 2E5GA 2OSRA 3L9ZA 5J2PB 3FFIB 4DCPB 2HS3A 3MECB 4WFXA 1FRKA 5HAOA 4CM2A 2WSCC 3AD9C 1XIQA 4ZK7M 2Y8YA 1A0OB 1KQGB 4DUTA 4QPTA 4NOHA 4FS1A 2XYHB 1BHNA 2C3MA 4F0KA 1NHKL 1IM4A 2AJ0A 4W98A 3TO8A 1M1KT 1OQ3A 4DI6A 2QA4S 1SL1A 2V4JA 5CD4A 3ET6A 3R5GA 3UQSA 5IT9U 4ZCIA 2WRMA 3VAIA 2QMXA 4KKOB 3MEDB 2DBBA 4ZN1A 3G87A 1NH7A 2B43A 2UUBF 1S1XB 4HACA 2QGFB 4PYAA 5DG8A 1VRTB 3UI3A 5IWAF 3TZZA 2AJQA 1TKXB 3OT9A 3D6TB 1R27B 1VK3A 2DGOA 2FJEB 3TA2A 1RGVA 3BBCA 2IA0A 3NOGA 1BQNA 2XO7A 4DL5A 2N3OA 2KZZA 3GIIA 1UPPA 4QYZJ 2BRKA 3R5AA 2GAGC 4DZ6A 1RDRA 3QRPA 4R0EA 5CYQA 4RU2A 4ZJLA 4IYQA 2ATCB 1ITPA 2IM2A 3B4DA 1OYEA 2QSFA 2ZNZA 3CDUA 1SVDA 1S1UA 2FLNA 1NSKL 2RB7A 1RLCL 3QIDA 3AJ1A 3G6YA 2R9LA 1NDLA 2KVIA 5H9FK 2WVCA 4PG7A 2G0CA 3SQGB 3CDAA 3JQMA 4UT4A 2NPIA 2KZMA 4H54A 3L95X 3O6QA 2CNOB 3DLGA 4WP8A 3SBMA 4YB7A 3RZAA 5KT4A 2B9WA 1F5BA 1WI8A 3CCMS 3T1HJ 1Q79A 4B9SA 1R0CB 4RPFA 5ETTA 3SCIE 2YWKA 1JNRB 1RLDA 1S1VA 1K73T 1S6UA 1IM6A 3CO0P 2DIUA 4TLQA 3DRPB 3JAMU 3UE2A 1J27A 2NUUG 4KRWA 3V6DB 1B64A 2MKHA 2PI5A 3LP0A 3KLFA 3TVYA 5F8LA 2ATLA 1T05B 2IM1A 4DCOB 1S97A 4DMZA 2UUTA 5C5JA 5DDPC 4ECQA 5MAOA 4JI0F 2E7WA 3HVAA 1Q7YT 2PN6A 2P9EA 3UDEA 2XCPA 3UNYA 1EETB 1NCLA 1ZOTA 5DDOC 2DR5A 4JI4F 1FWLA 1RB0A 3W2VB 1WKKA 1JJ4A 2YNFA 1IBMJ 2DNLA 1RYRA 4URQU 4CYUA 2R2TA 1F5AA 3HCXA 4F50A 1UA0A 3UD5A 2C2NA 3U1NA 2R7VA 3MAAA 4OZNA 2UU9J 2ZDPA 3HHKA 4DU8A 2F4VJ 1HYSB 1IBCB 3HX9A 4R25A 3LOUA 2ZJRQ 4F25A 4QBUA 1T9YA 5GAGU 1X9MA 3D1QA 4MKYA 2KG1A 2QN6B 3MM9A 1KS2A 2KG0A 4F3MA 3OTEA 4BLGA 2ZFHA 4HH1A 3HHLB 1NU4A 2B5JB 4KGKA 1VQPS 2IJFA 2LQBA 1LW2A 1NO8A 2BQRA 4DUZF 1UWAA 3CC7S 3C15B 1UCNA 2Z2LA 4DS5A 4PZVA 2L9NA 2QSWA 8ATCB 1VQ5S 4AD6A 3DLLQ 3QIPA 2XHCA 1S9EA 5G0RA 3M8QA 2W01A 2FZCB 4IDKA 3CCRS 4O3QA 2QO3A 2DGQA 3EICA 2FLPA 4ZIWA 2H4YB 4C48A 3B4MA 4ZVQB 4LF6J 5HBMA 5KFGA 2MKSA 3M9MB 4DQIA 1N6QA 2J9DE 2HFZA 1QM9A 3T6JA 1WC5A 2CQCA 2ZBRA 3IR5B 1RAOA 5BR8F 4OHVA 3NL0A 1HWJA 4JV2A 2K1RA 3DM2B 2OD6A 4RNMA 3GFYA 2ZUGA 4RUAA 1R6YA 3J7YU 2AYMA 1OY6A 1VOMA 1OJ4A 3MPUB 1K0VA 2V63A 3V4IA 3JYTB 2CQ1A 2YPYA 2CAJA 1YG0A 4DHVA 4J9KA 4I67A 3SI8A 2N3LA 3TUJC 4NI2B 2YNIB 2NXJA 2KI2A 4MKVA 3QO9B 3AB2B 4DPWA 2ZKUA 3H40A 2G2YA 3RBZA 2J7WA 2B8PA 3VVTA 4Y00A 3FEXB 3JQKA 1TK5A 3TNVA 5E41A 2FIUA 3BQ1A 2HRYA 4BS2A 1HQEA 5B0DA 3LWLA 3V6JA 1E6VA 1YBAA 2QG9B 2OO4A 4K5SA 4NLVA 4KB7A 3IRWP 4PYDA 4I56A 3DU6A 3FMWA 1U1LA 4NASA 2DHGA 3M8PB 4H4MB 4HYKA 3M8ZA 1N56A 2AF6A 3OFEA 1S6QA 4ED6A 2BX6A 4EFAC 2RE1A 4NLSA 3TAPA 5EX0A 3OPKA 3LP2A 3QGHA 1TL3A 3IO1A 2HVIA 2VG6A 5HANA 1F2HA 1NJXA 3KJVB 4V19X 1HI1A 2FPHX 2XMTA 3KG0A 1TL7B 2R7QA 3QWPA 1S59A 2I2YA 5KFBA 3AA9A 5FD1A 4FF4A 1HW8A 3K0JA 2DGWA 2XLJA 5AE1A 3IR6B 1IN0A 4RBTA 4DV5J 2IY5B 1FK9A 1WHXA 3E51A 4N41A 1F6TA 1ZAWA 2LLZA 1RCOB 3PVXA 1SJFA 5HL7Q 4HH0A 2NPFA 3NAIA 4Q2LA 1PJ7A 5L9XA 1RTJB 3EE3A 3AXKA 3NS5A 2I1RA 3O3LA 1R8AA 5D3GB 2N4CA 5DQIA 1JXLA 1C4AA 2BM1A 3GFHA 3HP6A 1MG7A 4ZP8A 1KEKA 4NLTA 4CLUA 4P2SA 4CH0S 4HT7A 3BGUA 3RAXA 2ZH9A 2R8IA 4CRJA 3HVTB 2OLWA 4MKBA 2MZJA 3UPFA 4OJ1A 3TEGA 1DTQB 2IRUA 3R2DJ 2CPFA 3TANA 3QNWB 4FYYB 3DMJB 1JNZB 3CCSS 2HVDA 5A6WA 4DWIA 2OEKA 4P74A 3M30B 1NPKA 5J2PA 3FFIA 1DY3A 2BYCA 4CH7A 3PKMA 4MKAA 2V0NA 3MF5A 1PBAA 4DPTA 1MN9A 5U47A 4LSLA 1GTEA 2QV6A 2QE5A 1V3SA 2RILA 4F4AA 3OTOJ 5DM6Q 4UW2A 5GAGI 4MFBB 1RCXB 4L75A 2HNDB 1I1GA 2HWHA 2IBOA 4XPCA 3Q8QB 1WC0A 2BUNA 4PPDA 3VAJA 2DHAA 1RT5B 4CLTA 2ZM6F 1KLMB 2IJNA 1UWBB 5A8RB 2EEYA 2FJWA 1JLFB 4EEYA 1R8PA 2MQMA 1IJFB 1TKDA 3Q86A 2C3PA 4G1IA 1KVJA 2A0FB 3W1YC 1S1XA 1H72C 3K89A 4IR9A 1SV5B 1IBLJ 5JXSA 3EDRB 1VRTA 4UZBA 3CC4S 5FLXU 5CHCB 2JRSA 3VGSA 1TKXA 3HT0A 1Y5NB 2QIFA 4TYAA 2N82B 2YH0A 2DNGA 3TQEA 1O6XA 2CJ9A 2EK6A 4RO0A 3BJYA 3I9ZA 4OHYA 1ZS6A 3FVYA 4JI6F 3MCNA 1ACMB 2VF3A 5HMXA 1FTCA 4RNHA 3K8VA 2DXDA 4P6QA 3LUYA 5KFVA 1OS5A 5E3AA 1R8BA 1KD1T 4USTA 2A3JA 3BV8A 4ATNA 1OY8A 4WP9A 2Q1LA 5FLXY 2ZVIA 1K8AT 5IC6B 1ZETA 3KLEA 4LSNA 1I3OB 1RBLA 5HQLA 2I0XA 3KG4A 4F26A 2VL1A 2QFIA 3AD8C 2YX4A 2F1FA 3KLGB 4OYOA 1T95A 5DQGA 1WG1A 5F8JA 2DXFA 2XGQA 3D66A 4IG3B 4U7CA 1JX4A 4UTGA 5D0GA 1RQ0A 5GADI 3VZHA 1X4AA 5HK4A 2RDDA 3L3CA 3UFCX 1AB8A 1S4EA 3DRPA 1QVFR 4P73A 3V6DA 3HF5A 5HVFA 2OTLS 1Q16B 3GP9A 2DGVA 1BE4A 1D8YA 3I96A 4UUXA 3FC9A 4QJVA 4X66F 2P9GA 2LDIA 2V8VA 1F1BB 3P5TL 4MIBA 4AQYJ 3SMZA 5L8RC 4QWAA 3MR3A 1ZTTA 5KFQA 4FBTA 1EETA 4WTOB 1MROB 2R8KA 4A8SA 2Y1JA 1VMBA 2AWZA 3ZZOA 1S12A 1HNWF 4ZPAA 1G6BA 4B3SF 2FVCA 3T19A 5F3TA 2C2RA 3KNAA 3UVJB 1FKAF 4USWA 2E66A 3F41A 2DO0A 2VJUA 3BO2A 2KRRA 1TK0A 2YWFA 3H8YA 3U7JA 4QOTA 5KG2A 3D67A 2W9BA 1N5YB 1HYSA 1U0HB 2NXEA 1ICEB 4NZ6A 3BGRB 3OTBA 3PACA 3PR5B 4NRTA 4YB5A 2DPIA 3X3UA 4M5HA 1XWLA 3HVWA 3HHLA 2CVIA 3C15A 3Q8RB 2DH9A 4ID8A 1B0PA 4DR4J 4JBCA 1DFDA 1EJ7L 5KFRA 1IXKA 3W3SA 4M5JA 3EPIA 2XMKA 3M2UB 1Q78A 1RAGB 4YR0A 2XLIA 4OV6A 4UUWA 3WDOA 3MR5A 1GT8A 4DL2A 3NMRA 2D74B 3AFGA 1S10A 1G4CA 3EGZA 2ZBPA 5IXUA 5KFJA 9RUBA 5B7WA 2V68A 2VQFF 3MM5B 1FRIA 4Z7YA 2AW0A 2BJ7A 3GYGA 5HMZA 3ITHB 1HR0F 4QCLA 4DX8H 4J7CA 4WKYA 4C8NA 4DV7J 3SFGA 1T3NA 4Y2AA 2Z2ZA 2BE7D 1WTFA 3JYTA 1NSQA 1ZPWX 4N8OA 2ZHOA 1HI8A 4DX5A 1RT4B 1W7WA 2QYCA 2KVQE 1UEKA 3KUHA 2YNIA 4NI2A 4ZP6A 4USIA 3QO9A 2PMWA 2NUHA 1RAJA 2EFOA 2HMIB 4KFBB 3ZTRA 3OVAA 5B08A 3DDNA 5JVGQ 2VFUA 1X8DA 4DN9A 3PHEA 4QU6A 4ERDA 2GHVC 4KH1B 3UN5A 4X64F 4JI7J 3CNQP 3F56A 1VQ7S 2DK2A 4H4MA 2OUGA 2X1AA 4ZCKA 2R8HA 5B0EA 3TAMB 3MMAB 3FUYA 3SV3A 2V2QA 2DRDA 1UW9A 2ZZTA 2CQPA 3KJVA 4O3OA 2OEMA 2XYPB 3FKBA 1X9WA 2QMUB 4JV5J 2DHHA 3T41A 3T5JA 5D77A 2EC0A 2AX1A 2IVFB 2Z0GA 2UXDJ 4K4VA 4I69A 1JLCB 4RX6A 1PBUA 2YKNB 1RAHB 4U9RA 2IMWP 3LAKA 3M9NB 2Q3PA 4NLGA 3HFZB 2BQ3A 5CCMA 4WXOA 5T41A 2KDOA 4A8OA 4F2RA 4NCAA 2UVRA 2KT5A 2R7RA 5LXRA 5DRKA 5DM7Q 2FGCA 5ETQA 2QEXS 4R0JA 4Y2CA 5LL6d 1SH3A 1XR5A 1X5SA 1CQNA 1VQ8S 4C6AA 2Y3YA 5D3GA 3RB4A 1P1LA 2FVPA 3KHRA 1N34J 2WHOA 1D9AA 2HBZB 3UWTA 1HBNB 5IOLA 2VH7A 2B7BB 2HQIA 1RTIB 2KT2A 3D6FB 3DOMB 5SUHA 3HVTA 2HQGA 1B7YB 2YTCA 1N52B 3ISZA 3TJ8A 3EGWB 3CJ8A 5AXMA 2YX7A 3I0SA 1QSYA 1NAQA 1Q7LB 3UCUP 3DMJA 1IKXB 3R6LB 3FMBA 5K14B 2QFJA 1HWIA 4HDHA 4NPOA 1RI7A 4IH6A 1DRZA 1HPZB 1WEYA 5KT2A 3QPIA 1RAFB 1RA7A 2BJEA 5HP1B 3BBBA 3OR1B 4X4SA 1B3TA 4GVBA 2RHQB 2YNGB 4EBEA 4X4QA 2NXNA 1PGZA 2BE2B 4R8UB 1U1NA 1VQKS 3KYLA 3EMTA 4LRCA 4MFBA 2EC2A 1W26A 3ZNJ1 5D78A 2HNDA 4UY8T 4CLPA 3ZZYA 4N8NA 3T1HF 2C2EA 5EN1A 2HHSA 4WYWA 3BB5A 4C98A 1JLFA 3A8JA 3AJ2A 3DNCA 3WQPA 2QA2A 3V6KA 4DSKA 2M8DB 5E3RA 4FPRA 1QE1B 1RHRB 1HNIA 2K8GA 1X9SA 2DHXA 2OHDA 1UJ4A 1SV5A 3PG9A 1O0PA 3NGSA 3OL7A 2PMZD 2CIMA 4HTIA 2FHMA 4CLKA 4ZVGA 1EZZB 1YJVA 2ZH8A 3CULA 2HEKA 5RUBA 2ZDOA 4JI8J 5KFKA 1JLQB 1FFGB 4DV1J 1P8GA 4PXEA 4LRDA 3CJTA 3VR1A 1IBMF 3I56S 2NYHA 2H54B 5BYQA 1NHVA 4QW9A 1EQMA 4CTAB 4ENOA 2DR7A 3MZIA 1HFEL 3D54A 5M2RA 3PRVA 2UU9F 2F4VF 5KFDA 4ZVSB 1RAEB 5DGBA 3K2YA 4C3LA 5I3UB 1RT7A 4DR1J 4ZPTR 3CJ3A 1B70B 2DH7A 4CI0B 3A13A 4IG3A 1NK4A 2DNRA 2RD5C 1CC7A 1D8ZA 1IQTA 4CLWA 2BJ1A 2RKIB 2DNQA 3W8PA 4B9MA 3N6LA 2JZ5A 3H4BA 2V69A 4WWSA 4PXBA 4IFYB 2AJ1A 4I2PB 4A4JA 3MEEB 4LF6F 1XJWB 4MAKA 1H3DA 3N6NA 2VASA 3UO0A 2H3EB 2GQCA 3G71S 1WELA 3DRRB 5D0RA 1TKTA 2J6TA 1MROA 4FKXA 2IFXA 3BH7B 1T9VA 1JK9B 3AHPA 4DJBA 3TR5A 1M1GA 3FCHA 4JV0A 4U6PA 2DNKA 1IR0A 1JMTA 3BGFA 1Y7PA 1LWFA 3BDPA 3VQTA 1XMOJ 1HIYA 3SDEA 4YY3J 4A48A 1VISA 1VC5A 4Q7AA 2ZZNA 4AXIA 1N5YA 2ABYA 2NYIA 1D9FA 5HROB 4ID5B 5K9FA 4CZCA 3QRQA 2JEJA 3BGRA 2GVZB 4OZ1A 3CCES 2BACA 2GX8A 4KE5A 4I2QA 3R6GB 1S1TA 2FDNA 2N7CA 2DTJA 2B9YA 2F3JA 2K3KA 4B9TA 1HA1A 4XIUA 4EMDA 1KOHA 3ISNC 1UP1A 2Z57B 5T7LB 5C25B 4NLRA 1IKYA 2G2OA 3I0RA 3M2UA 3OLBA 4MIAA 1U26A 1CVJA 3CVKA 2GQQA 4NLUA 4TLRA 2DH8A 1NUEA 4DBQA 2GW8A 2EPIA 1DLOA 3MM5A 4K50A 5B09A 4N56A 4ES1A 4EGLA 2I38A 3TA1A 3UN2A 3A4TA 1SH2A 1JLAB 4YS2A 4DV5F 3NNCA 1WDDA 1E6YB 3I87A 2DYAA 3PFOA 1RT3B 2DRAA 1DTTB 2GJIA 2AYGA 2VFVA 1U24A 3VHQA 1WACA 1U7LA 3RGIA 3M4XA 2MB0B 1RT4A 1HNVA 3HSZA 4LQ9A 3CCQS 4IO1A 1QUPA 3P6YC 2JLGA 1PYTA 2E5HA 4L73A 4C11B 2HGNA 3QRRA 1VQ9S 3QT8A 2VJVA 1M5HA 4RW9A 1LKZA 3G4SS 3PYDA 3DU5A 5DGAA 3R27A 2GVDA 2Q79A 1Y11A 4ZIVA 2IM3A 3FDSA 3OUYB 2E44A 5KFNA 3TAMA 3MMAA 2AX0A 1KKHA 2HHQA 3PW0A 3CD5A 4AL5A 3E8OA 3BH6B 1K47A 1OO0B 1S5ZA 2B4VA 5ITHA 3BS9A 4NLPA 4ECXA 4RNFA 1JLCA 3SV4A 5A8KB 3KMSA 4AL6A 1WHVA 2DD8S 2VKZG 2ZJPQ 1JLBA 1R8CA 1AXQA 2YXLA 4EUVA 4TY9A 4WU2A 1U09A 2A2DA 2JL9A 5EWEA 3D9BA 4F02A 3OTOF 2XMVA 2HZVA 1X5OA 3DLHA 1HQUB 3PX6A 1SL0A 4BHQA 4DL6A 3H20A 4DR2J 4CO4A 4W4MA 5I42A 3PV8A 2MMYA 3WIUA 2MQ8A 2K7KA 5DQHA 2RNEA 1RWXB 1NDPA 3SCLE 3Q0AA 1JLEB 4U7UK 2DXEA 4NEYA 1IBLF 1FJEB 1HBNA 2M5YA 3CE8A 2ZKTA 2QLXA 4OYWA 2RDIA 3KHLA 1RTIA 3MR7A 2OP5A 1NKCA 3DOMA 3G2XA 4F3QA 5D0EA 3BN4A 5C24B 2MKKA 4HR2A 3VALA 2PFDA 5HATA 3MPYA 3EYZA 5K8MA 4DL4A 5K20B 4DZDA 2O01C 2ZE2B 1TTHB 3GJSB 3TUIC 2EFPA 1IKXA 2B3TB 4BWMA 4C8LA 1P1TA 2E7XA 4JB8B 3ADAC 2MKYA 4X62J 3EXCX 1LFPA 4GKJJ 4RWWA 2ZWOA 5HLFA 1T03A 5KFIA 3BN7A 5ETLA 1FE0A 1XR7A 2V2ZA 1UJ5A 1HBOB 3NGKA 4R8UA 4WJBA 1FWKA 5L38A 1W2BR 1VS3A 2GMJA 3TJ9A 2D7SA 3DLKB 2D69A 1R3NA 2WOMB 3T9ZA 1LOUA 3GIMA 4J90A 3P3DA 5K8NA 3H98A 5F8NA 1R0AB 2M2BA 4ZP9A 1U02A 2ROEA 3PFEA 2HSEB 1QE1A 1VBXA 4DPOA 4TQRA 5CYMB 1I5OB 2KFZA 2Y0BB 4K4WA 3QAEA 4AQYF 3A12A 2VFTA 4ZLPA 2QLWA 3K57A 3IA0A 3NCPA 3K5NA 4I6AA 4LJMA 3HDSA 2LQ8A 1RU2A 1FA0A 5D4NA 4ED1A 2KB2A 3PX4A 2GZOA 2RDJA 4OI4A 2BZ2A 1S4FA 3AB4B 3EVWA 4DDFA 2GJ2A 4IQMA 2AIRB 2HHXA 1Y5LB 3RAQA 4LBHA 4CLLA 2HHPA 1PKUA 4FYXB 3CXCR 1REGX 5I3UA 4AL7A 4RBVA 3MUTP 1CEZA 1BD6A 2HFOA 2ILYA 5KG1A 2JFDA 4O0IA 1OPZA 3LAMA 2HS4A 2BJDA 4UOFA 4DR4F 1CJTB 2FVRA 3D5MA 1QAIA 2MJNA 5E7OB 5F8IA 3I32A 4DSEA 3MFHA 3LWMA 1MLAA 3M2VA 3MM6B 2PMHA 5KFTA 3D0GE 5T14A 4RUBA 4OMFG 4ANDA 4I2PA 3MEEA 1NJIT 1YKWA 2D9OA 1H6KX 4JI3J 1YRTA 1L3SA 4Z2XA 4N76A 5CH7B 3HULA 4GC6A 2RU9A 4HTJA 1XR6A 4DV4J 4WK3A 1JB0C 2Y8WA 2VODA 2LXUA 2PE8A 2D41A 5HJXA 3CWJA 4KGMA 1P9QC 4DV7F 2HZCA 2LDYA 4TQSA 3HT3A 1F5CA 1IKVA 1L3UA 2HZAA 1MW7A 4ETXA 1PYOB 2CNKB 4GO5X 3JSBA 5ETPA 5DG7A 3G86A 1H2TZ 3PO4A 4M94A 2GIFA 3EPGA 5A2QY 1OWXA 4ID5A 2XY7A 2GVZA 2H51B 3VGTA 2C2ZB 1CS4B 4K4TA 1C1CB 3EUNA 5HQMA 4U7UD 3HLUA 1EKRA 3W2WA 4LBIA 3PW4A 4JI7F 5T7LA 1QAXA 3CCZA 2BW2A 1OIAA 2ZBIA 3J80Y 1KFDA 1VBKA 2RRNA 1EKSA 2R2RA 3CCTA 2L3MA 2ZVSA 2WK4A 2J8AA 1XMBA 1B0VA 3PEJA 4S0MA 2J6SA 3BSAA 4OX6A 4JV5F 3W5ZA 4ZMMA 2V4JB 3BPSP 4ZN3A 4DR5J 1SL2A 1FERA 3VAFA 5I3QA 2UXDF 4OI6A 3OL6A 3PJXA 1RWOB 1E6YA 1TL4A 1N48A 4ZP7A 4P2MA 1RT3A 3EZ5A 2YKMB 4KH0B 3TX0A 1DTTA 2FJXA 4CO0A 3QBCA 3WIVA 5E3CA 3T1AA 1AT1B 2ZUAA 3K8WA 2FVQA 1Q81T 4PQAA 4ZVPB 4MK9A 3DDIA 2HG4A 3CMAS 4WYLA 1BGXT 1EHWA 4A47A 5E33A 1SC1B 4GKKJ 1Q53A 3W64A 4EZ6A 1TZ0A 1X4FA 4QWCA 1N34F 3M8SA 4W92B 4C11A 3P5BP 1WF0A 3FSXA 1QAYA 4URSA 2R4FA 1Z2ZA 1PG5B 4QQBA 4E2FB 3KXDA 1XTZA 3GV7B 4K59A 3DRYA 3QWUA 1NZ8A 3VF0B 1WOOA 3DOLA 1UFKA 4FN5A 2EBGA 1JJHA 2CJAA 3VWSA 1FF2A 2AYEA 3OUYA 3LP1A 2ASDA 2QYGA 1UFLA 3M2RB 2Q6BA 4DF8A 4CM0A 4OJHA 4P2FA 3IM9A 5J2QB 4O3SA 3R8YA 2ZEJA 4ECRA 1IR2A 2E9TA 4NXMJ 2YX1A 3Q22A 4PG6A 4K2XA 4TY8B 1F3FA 2CQ3A 2XMUA 2CRLA 5A8KA 1S1VB 4HI1A 2MGZB 3BO4A 1VLOA 2QL9B 4CO3A 2VBYA 3OBIA 1S7IA 2UUCJ 1VQNS 1NK9A 4RWXA 2W7AA 1HQUA 1ZAVA 3O1LA 4DR6J 2OH2A 1LWXA 4EWTA 2B4UA 3CEDA 2A1BA 4FXDA 5C42B 1RJJA 1PC5A 2HFUA 2DEIA 3BGOP 1RUSA 2MY8A 1HBMB 4USUA 2BJ8A 3QT6A 1U45A 2K7JA 1JLEA 2YNFB 4QIEA 2UP1A 1EARA 4LRAA 1T11A 2B51A 2IRYA 4MK7A 4XPEA 4LT6A 2OMOA 5C24A 2BANB 3RRGA 1S49A 1U2FA 5GMEA 2V5HG 1BXNA 3DN9A 4JI8F 3MM9B 5J2NB 2J0SD 2DHSA 2ZE2A 4KV8A 2OPPB 5LOQA 4A8WA 4TU9A 2V67A 1LW2B 2VOPA 2ZWPA 2MHEA 3MCOA 1X0FA 2KN4A 1CG2A 2LYVA 2I5JB 1AROP 4HVZA 3HZEA 3W62A 1S9EB 5G0RB 4EBDA 2BV3A 4QPXA 4P10A 2FB0A 3M8QB 3M7VA 3GR0A 3W7BA 1YVFA 2ADBA 4B9VA 1PIEA 4IDKB 2RHSB 3I82A 1U49A 3RTVA 1Y0HA 1YK9A 2NXUA 3GB0A 1SH0A 4DR1F 2HGMA 3JTNA 1NDKA 4DR3J 2NSCA 4HT5A 1LV5A 2OGUA 1JQGA 1JJ2R 5H9EK 3SZ2A 2ZH2A 4IG0B 2KH9A 1FKPB 4FBUA 3DLKA 1S6PA 3GMGA 2WOMA 3MHYA 4M5DB 3PZPA 2J0XA 4YMEA 5JMNA 5DS7A 1VQOS 1R0AA 2K1RB 3D3BJ 2DITA 3BZQA 3G8QA 1S0NA 2P5VA 5CYMA 1QDUB 1NSPA 1EAYC 3BYPA 3LO3A 3NGRA 2MQQA 4LRBA 1HMVA 5KG3A 5HJYA 1O8BA 4A46A 2ZC4A 2MPUA 3S01A 4CP5A 5I4MA 3FCVA 2RQ4A 4DOZA 4ES2A 3MI7X 2HLUA 1X7VA 4M5MA 4CT8A 4PWUA 1XMOF 3GFZA 4YY3F 5K8OA 3TEHB 4K0KJ 3GIJA 2EW9A 3MWBA 3BGLA 5KFMA 1K1QA 1HWKA 5GVQA 2KJWA 4ZPVR 1YZ7A 2JEGA 1FD8A 4J9LA 3GG1A 4FXWA 2OPQB 3N6MA 1YI2S 4YP3A 4P7TA 3CCLS 3I4HX 5IC4B 4B08A 2MZ1A 1ZTWA 3CCVS 2UXBJ 4B3TJ 3PJWA 4KBIA 2FHKA 3KLVA 1HD0A 2MKIA 1T9UA 3LTOA 5ETNA 2G4BA 2UXCJ 4D3GA 2CZ4A 3UR0A 2CJYB 2OKQA 5IT4A 4HHUA 4CLFA 5H9EJ 1UKUA 1PO6A 1TQLA 3ZNUA 2PGCA 3MM6A 3PIOQ 4LVOP 5F9NA 2EFGA 3EDQB 2ZHAA 3CSKA 3RUBL 4DQQA 2ROPA 3PCOB 5IQQA 2RS2A 1VBYA 5ETRA 1F9EB 3RYLA 5LJ3Y 4N7TA 3MOJB 5L1JA 2C22A 1Y3KA 2XEXA 3MAHA 2WVDA 5KG6A 3ZZ0A 3K7RA 5DLFA 3H5YA 4M5LA 2YWHA 3FQLA 4QW8A 3IWLA 3HXMA 4ER8A 4U96A 1S9GB 3B82A 5J1NA 4U95A 2PSZA 4GRSA 2Z2MA 2BMBA 4LR7A 2C1EB 5KFFA 1VQSA 1H98A 2E1CA 3SXLA 2KL8A 4O4GA 1RKIA 3SYZA 2HLTA 1EP4B 4QYZK 4BDPA 4X4VA 4ZPBA 1V6HA 1CS4A 2HVEA 4OHWA 5KFUA 3NY0A 3B54A 3Q89A 3NGDA 2VBXA 4C8ZA 3FQKA 4QR2A 4H4OA 3EZUA 1FFSB 2Q6CA 4OL8A 2KKHA 3BO3A 1HBUB 1WKLA 2MZSA 3UW1A 3B6BA 4LSLB 4O3NA 1BWVA 3SQOP 3GLJA 1CJUA 2VA3A 4PKDB 1WOPA 2JVOA 2EG1A 1VJWA 4PPZA 2X3GA 3R7SB 1KOOA 2UUWA 1FXDA 1AW0A 5F8GA 2K06A 5GAHI 1SIWB 2RRAA 4H4KA 4A8MP 2J7UA 2CFXA 2KFNA 1APSA 3DHWC 2JOQA 2I9SA 2RQKA 2YKMA 4YQWA 4B9LA 1V5VA 3R1LA 4DV6J 2MKJA 1S1WA 1U1QA 3V6HA 4OYMA 5DG9A 1M0SA 3GCWP 3OTDA 4DR2F 4ZJQA 4DX7A 4B3OB 1R89A 3W9HA 1FRLA 3O2IA 1L3KA 4DLGA 2C3OA 2AGOA 1U0SA 4YB1P 5EX3A 4ECUA 4PQUB 2KT3A 1RP5A 3H25A 2WW8A 5AJ3J 1KQFB 4PWWA 4ZCMA 3QZ7A 3U02A 4O3PA 1S57A 2W1BA 4ED0A 4F4ZA 4FVMA 1S0OA 1FEEA 1X0PA 3S8SA 5A76A 1KRPA 3JXOA 3KLEB 4LSNB 2XS2A 3LF0A 2G0JA 3HFKA 1ZM9A 1RHMB 3GE9A 1J2VA 3Q83A 4FS2A 3M2RA 3KK3B 1YLXA 2OSQA 4OX9J 2DGTA 3KHHA 1FDDA 3C6TA 5J2QA 3I9V9 4X62F 3NBPA 2NQPA 3H0PA 3MCSA 1XMQJ 3KFWX 3IWNC 3US5A 4GKJF 4TY8A 4MIWA 3WHIA 1AYEA 4CWBA 2MGZA 2OJ3A 2VDHA 3OHBA 4K4SA 4OQJA 1QY7A 1JXEA 2IM0A 1MWQA 2WAQD 1F9FA 1ZM2A 4L3KA 3BQ0A 3VQSA 1U6FA 4JI2J 5HSPA 2XQCA 1CBKA 3OL8A 4DL3A 4AFFA 5KFPA 1LQ9A 2XZDB 2LKZA 4JP8A 1DQ8A 5C42A 1C0TB 2AGPA 3C16B 1WI6A 2HW3A 2VA2A 3CDEA 1HBMA 3BKUA 2FHJA 1L3TA 3EWGA 3KG1A 4F8RA 4MMOA 3IBFB 2YY3A 2CPDA 1TAQA 2Z8QA 1FDAA 2YWWA 4WFBQ 2OELA 2BANA 2BABA 2EFNA 2W9BB 2R7SA 4NL5A 3SCKE 3X1LB 2EFVA 2XI2A 4V1Ak 5J2NA 3VCDA 2OPPA 1K1SA 2W4PA 3BEGB 4I4BA 4PG5A 2WBMA 4P2XA 1M5KC 1TUWA 2XG8A 4WZQA 2I5JA 4UOCA 4RZRA 4L6V3 2CG8A 4K4UA 4QIVA 1F3VA 4OYBA 1LWCB 3ZTPA 4IUFA 4ZLLA 2C42A 2X1FA 4ZDNA 1KONA 1BMQB 1SQEA 4OJ3A 3CTRA 5CD4H 4E0DA 3KDNA 3HI9A 4DQPA 4KAIA 3VGUA 1Y00A 4M5IA 1S72S 3GIKA 3H4DA 4IG0A 2MEWA 1FKPA 2JNJA 3H5XA 4O23A 3VGVA 1RAIB 4M5DA 2LMIA 1N8RT 1WJ9A 4MH8A 5B0BA 2XLKA 4HI2A 3QJPA 2CQDA 4YB6A 4JI3F 3GJRB 4QR1A 4DSJA 2GO9A 3R97A 3ENQA 2NCKL 2ACYA 2J0QD 1YX2A 3AXMA 1I6JA 4DV4F 4CNYA 4NLDA 3CJ0A 4C0OC 3AT1B 2BRLA 5BXIA 4LBPA 3C46A 1M5OC 1NRKA 2RT3A 4FZVA 4F4XA 5IS2A 5GADU 3G9CA 1K44A 3ZFVA 1WG4A 2MQPA 4J9QA 3T1YJ 4X4UA 4LF8J 4Z7CA 2ZZMA 1UL3A 2R2UA 2VZ9A 2MQOA 3LA0A 4C0BA 2WVFA 1SQFA 1ROFA 4ES3A 3TP2A 3ILJA 2MQLA 4EZ9A 2LU1A 2W7PA 3MPVA 2OPQA 4XO0A 2QA1A 4KY3A 4LREA 3WZ0A 4EK2A 1OSDA 1VGYA 4OHXA 4ZVEA 5KFZA 4F7VA 5IQ6A 1B7FA 2APOA 1EB0A 1U8SA 3L7UA 5JJBA 3W5XA 2ZOFA 3BM7A 2HAIA 1FO1A 3K17A 2FZGB 2VUGA 5M2PA 3PW5A 3DDKA 4F04B 2V8GA 4K5RA 3G6ES 1ULRA 3AOAA 2HNYB 1WKJA 3GYXB 3J7A1 3UDLA 2M7SA 2HQFA 1ZZNA 3F44A 4N77A 4DR5F 4QWBA 5K8PA 4JOUA 3OTCA 1J5EJ 2HGLA 1RISA 4OI3A 4DFPA 1OQ6A 3VZIA 1WHWA 3KTQA 1T7PA 1A9NB 2HBQB 2WZ1A 2UVVA 3CT9A 5IV3A 1S9GA 1P27B 2W2NP 3M32B 3GTYX 2IJRA 4KJIA 1HLWA 3EZOA 4GKKF 4EI2A 2VDIA 3KUEA 4KSEB 2HQ3A 1EP4A 3BBFA 1IKWA 4Y34A 5IT0A 1VIOA 1RU1A 3CMQA 3I0SB 3C3LA 1KFSA 1Q0NA 2B0GA 3RW7A 2VPZB 1WDTA 4OYAA 1F9HA 3EVOA 4IH5A 1HWLA 2GIRA 4M5GA 1TU0B 2XMAA 3FK4A 2FZKB 4OX8A 3KJNB 2BW7A 1NPRA 5FIIA 2HFNA 2CJQA 1HBUA 1WC6A 3TVKA 3TW0A 1JKHA 1RHJB 2CWXA 4GVBB 4Q8FA 1TR0A 4ED5A 2E9RX 1RTHB 4NA2A 3OFGA 2AMCB 3IGNA 1FKOB 2VPWB 3HM9A 2M70A 1KHVA 3IBCB 5HMYA 4L76A 2RSQA 5KFSA 2YQ3A 4NXMF 4RW8A 4ANEA 1X4GA 3DC2A 1GXTA 3ILIA 2BR0A 4QZVB 3MTKA 3MPDA 3KOAA 3MXHP 1PCAA 4G65A 1HNZJ 2UUCF 4HKQA 2ZBQA 3M6VA 4I6YA 1PJ6A 4JI1J 2WONB 3NMAA 1HNIB 1KC8T 4IFVB 3JS9A 1ZA2B 4I0WA 4DR6F 3FRZA 2HWIA 3NLCA 2E1MC 3G6VA 1UVKA 3Q24A 4B3OA 3DGPB 1QJHA 5A6PA 4PG8A 4UF4A 1V5IB 4PQUA 3AJDA 3Q2TC 1S6OA 2OI2A 4C8MA 1TUVA 3CC2S 1H7WA 2CXEA 2HVHA 2G2ZA 2DKOB 4ZVUB 2CUYA 3RBDA 4ECSA 3QLHB 1KQSR 4MYTA 2MKCA 4LMZA 5BYSA 1MNEA 5E3PA 3M6WA 5ETVA 3T5HA 1SC3B 4DN0A 3RBEA 2P8IA 1HQ2A 1IWAA 6AT1B 1RT7B 1PAUB 3MAQA 2R7OA 4B3MJ 2QC3A 3U27A 1JXVA 3RB6A 3KK3A 5DZ6A 2HK3A 4LUBA 4XDCA 1CLFA 4J9RA 3HJVA 1URNA 5GMKa 3E01B 9ATCB 1O5JA 5KG0A 4O3RA 4NCGB 2EK1A 3NAHA 1YJ7A 2C3YA 2L9DA 3D4JA 4DR3F 1U1KA 1SJ3P 4K4XA 4WFYA 5LSOA 1XN9A 1ELOA 1NKBA 2KM8C 3TUPA 2AD9A 2EWHA 2G13A 3T5KA 4RKUC 4OI1A 4J5OA 2QLFB 3AAWB 4EYHB 4ZOSA 1TKTB 1C0TA 1AUDA 2IAJB 2FVSA 3ZTSA 3C16A 4MYUA 4WP3A 3OW2R 4LQ3A 1QUVA 3NS7B 3HMJG 2WVEA 1LWFB 1YBUA 2IRXA 3PW2A 1SKWA 4IRDA 2E5IA 3SDEB 2A6MA 3Q8UA 4KGZB 1GX6A 1G1XA 2XC9A 5J1EB 2BKOA 1FJCA 1UVJA 1Q8LA 3KJQB 1WG5A 2IC3B 1RADB 2DIVA 4HHHA 4I2QB 4ZCLA 1S1TB 2LXIA 3QJLA 3WX8A 1VR6A 5KT3A 4K0KF 1TL1B 1UAWA 4LFCJ 1JJCB 2AQ4A 2D3O1 3GONA 2R7WA 3C6UA 1IKYB 3QFWA 1VI7A 3CDWA 3I0RB 3WC0A 4Q45A 2C2MB 3T9NA 2XO6A 2LU2A 1LWCA 5FJ4A 2XZTB 4F4KA 4YOEA 7FDRA 3KK2B 2W4DA 3PY8A 3N01A 5ETKA 4LIRA 3JSYA 2QMWA 1DBDA 3CIMA 5KFLA 4CDIA 1AA1B 1J5OB 4ZHRA 2UXBF 4B3TF 1DLOB 2F8HA 2QTWA 4TVAB 3A8IA 2UXCF 4QIFA 4CCHA 4OZJA 2HHVA 3GFXA 4FNHA 4J9PA 1U1PA 4ZJOA 2XWXA 4HDGA 4USJC 2EI5A 3KK1B 2V2KA 1WD6A 3K5PA 3R7NB 3ONQA 3C2PA 3IAM9 1HNVB 4Y3CA 2DVIA 2FHOB 3D28A 2XHWA 5HVHA 1RKJA 5KFHA 3IRXA 2BDPA 4O44B 2F9DA 4PEOA 4UOGA 3GU0A 1MMDA 1XC9A 1RT2B 4M1KA 3C14A 3OVBA 3AOBA 1FT8A 2DJWA 5F3ZA 2V4RA 2AHOB 3R3TA 4UQGA 1UEUA 4RW9B 5KFXA 1LXJA 4NYOA 5KFCA 1NK6A 5A0YB 2GVDB 2VFRA 1SJ1A 1UTAA 4X4RA 2M0GB 3TA0A 4IOCQ 3OD2A 1NMEB 1NBEB 2E9ZA 1SCJB 3TI0A 4DV3J 4ICLB 2GMLA 2XTJP 3IG1B 3OLAA 4XTTA 2Q43A 4F3OA 4WE1B 2IVYA 2HIQA 3NOCA 4MTPA 4C8YA 5KTQA 3CCJS 1RACB 2RUSA 4LF2A 1ZH5A 4ELTA 2N7YA 1HNXJ 3OJUA 1JLBB 2C3UA 3TRGA 3QQCD 4O0NA 3G8SA 1BC6A 4B3RJ 2RQCA 4LFAJ 5AE2A 4OI0A 3E3XA 2OPRA 4IH7A 1CC8A 2HNYA 3M1VA 1JIHA 3LQVA 3DOKA 3G8TA 1TV6B 2U2FA 4DQSA 4RJVA 5I42B 4BCAA 2BM0A 3OXLA 5EDWA 2GV1A 2WW4A 3CIZA 1V3ZA 1REVB 4KHPJ 5D8HB 3AH6A 3RU0A 4QIGA 3QGPA 1IWGA 4DV6F 2B9EA 5EGYA 3NP5A 3FBEA 1U2CA 4DXLA 1X31C 2CA9A 1N0VC 5LMUF 4UY85 1S48A 2F8EX 3M32A 1H38A 5IT9Y 3H7HB 4ZITA 2ADCA 2LEAA 1LWEA 1PAEX 3T6BA 4Y2MA 3KLIB 3D1OA 1NHUA 2FTRA 4QR0A 4Q5VA 1NJWA 2AT1B 2JC0A 3PYGA 3W60A 3N0VA 4PWDB 3CJ4A 5AJ3F 2VB6A 4LF7J 2CQHA 2A10A 3V81B 3GV8B 2E5LJ 1NB2A 1SPBP 2A2CA 4KPCA 1KSPA 4LRFA 5HLFB 1GMUA 2HHUA 1T03B 3BPDA 5E2QA 2IVMA 4C3KA 3L09A 4Q0BB 3CO9A 4MT1A 3ULHA 2OD4A 1RTHA 2W8KA 5C2CA 2V94A 1IQZA 3KUGA 4GO7X 4ED7A 1FKOA 2VONA 4OX9F 3AQOA 1N5QA 4D3HA 1MMLA 1XMQF 1T9WA 2QA4G 1UPMB 3J7Z5 5AXLA 1WF1A 5DLGA 3ZTQA 5CZVA 2CNNB 2HBRB 3LGHA 3BYRA 4TKTA 3R2CJ 4ECVA 4IRKA 3R1HA 2POKA 2FLLA 2WONA 4KGVB 2CQBA 2QT7A 2GJFA 3W65A 5HN0A 4IFVA 2MTLA 1NJYA 1NLKL 3AOCA 4JI2F 1VC0A 2LQ9A 3QGGA 4KO0A 1X4HA 3KLHA 3DGPA 1D1UA 3JAMY 1VYAA 2J9EA 3A3NB 3IN5A 3PIPQ 2W9CB 4F67A 1EIYB 4V19J 2XBPA 1T9TA 1IVZA 3MM8B 2BBEA 4ZVTB 2X1BA 2ZH4A 2FGOA 3OR2B 3QLHA 3NGTA 3NNAA 4UZCA 1BQMB 2VFSA 2GGPB 2GNKA 1C0UB 2O66A 3BR8A 3NCRA 1U6ZA 2HHHJ 2LFVA 2W7OA 3J7ZT 3MUMP 1Y5IB 4EU0A 3POTB 5B0CA 5H9FJ 3M05A 1RHUB 3V4MA 3IS9B 5KT6A 4K4ZA 3MM7B 2AJ2A 3CJKB 1XQIA 1HHQA 4DV0J 3E01A 1B99A 1D09B 5GMDA 2MQNA 1N36J 3PM9A 3J81j 1RT1A 3TVZA 4NCGA 2ASLA 1VRQC 2ZITA 3PX0A 1U4BA 3M2VB 2NZCA 3MMCA 2CJBA 4DV2J 4ZVFA 2V2VA 3B8HA 3GPAA 3CUNA 2Q66A 2M88A 2B6AB 3ZXWA 3ILLA 1GX5A 5F9LA 1Q8KA 4AXJA 1K9MT 1RWMB 1R8HA 4ZPWR 1RSCA 5FDLA 2NSBA 1O51A 1TKZA 5IM0B 2IAJA 1A7GE 1XNQJ 2HQDA 5DETA 3IWXA 2F63A 3P4UB 4L72B 2MZQA 2GCFA 1IKVB 4LVNP 2D3UA 2J0WA 1D0EA 2I6WA 2V9WA 1ZPVA 2EVZA 3EGVA 3OXGA 2Y1LB 4HL9A 3IBWA 3PEHA 2K3IA 1U1OA 1Q5YA 3M8YA 3H2VE 4Q43A 5J1EA 2FHJD 1RTDB 1FVQA 2PA3A 5HQ8A 2IC3A 3HKZD 2KYXA 1YZ6A 4K2JA 1RXOB 4LR8A 4FNIA 4TN2A 3T1YF 3HD1A 3M6UA 4LF8F 2F4FA 3W63A 1CSJA 1VQ4S 3W2WB 1TL1A 4RR5A 2B56A 5KOWA 5KFEA 2ASYA 2HVZA 3L4BC 5D4PA 2OTJS 3LPYA 4DSLA 2MHNA 4EO8A 2BJ3A 1S0MA 4ECWA 2PEHA 3BSNA 4Y65A 3MURP 3QGIA 3SSQA 3KK2A 4K7QA 1YHQS 3QMQA 1UVMA 2HAFA 1J5OA 4WKRA 2H9ZA 3OFHA 5KG4A 3OXFA 4X4TA 2V9KA 2I8EA 4DSFA 4JI5J 3RB3A 1CULA 2RRBA 4OIXA 2CZ9A 1NM2A 3I6PA 3SSRA 1VQ6S 3OL9A 1TELA 5KOXA 3UDVA 5AXNA 2OIHA 1SKSA 3GSIA 1GMWA 1L3VA 2LP4A 2MDAA 3KK1A 3OFFA 4DS4A 1G7CB 1LK7A 2VC1A 4G1QB 3HSDA 3M8RA 1FRXA 2DY9A 3P49B 3KHGA 4Q8EA 4F0MA 3MPWA 2G9OA 2KXFA 1TL5A 2DCUB 1YTYA 1NZAA 1J5EF 3MEKA 1X4CA 1CJKB 1S76D 4O44A 3KDOA 2NS1B 3Q8SB 1RT2A 2QLJB 4U8VA 4R5PB 1RWNB 2EKYA 3W66A 3FZ2A 1X5TA 2HKEA 1KP6A 5A0YA 3FSIA 3DOLB 1UFWA 4CH1A 1S77D 3N5FA 3SEOA 5BYRA 5JUMA 4CO5A 1KQKA 2HNZB 5HO4A 1SC4B 2XI3A 4WFNQ 3LP1B 4WIIA 1RT6B 3NRBA 4PRFA 4CLYA 4ICLA 1NXIA 3GYNA 4J9VA 3IG1A 2R7XA 1P6TA 4G6VB 4J37A 5H1SV 1R7IA 5KT5A 3MECA 4WE1A 5B0AA 3CPWR 3J7AN 1H2UX 5F0WA 4FPIA 3UCGA 1RZMA 2QL5B 3PYEA 1SUQB 2XSFA 2NLWA 2AZ3A 4NMXA 5F8HA 1FVSA 2MSTA 5ADZA 4LF5J 2KFYA 3JSRA 1RK8A 4YR3A 3PJ9A 4DSIA 4P9SA 2G1DA 3Q8YA 1SKRA 3W5YA 4NLQA 1WF2A 2ZH5A 4ZVHA 4CQ1A 4O4RA 1TV6A 4A8KA 4I7FB 4KKOA 3MEDA 2J7KA 1RE1B 3MEGB 3DCAA 2HFVA 3WC2A 2CQ4A 1REVA 3ILOA 1FXRA 3LALA 1HNZF 2GA7A 2GAHC 4JI1F 1VRUB 2UV8A 4PXDA 4OZ2A 4FF1A 2JLEA 1NH8A 2NR0A 5CCLA 1SJQA 3NGUA 1ZZFA 1T8EA 3I31A 2D9PA 3KLIA 1HWUA 1UW4A 2GHWA 2DT9A 3VTIA 2P2CB 2ZHBA 1X5PA 4KV8B 1FD2A 3OVSA 1FX4A 4PWDA 2MSSA 4RNOA 2DNYA 3A1YG 3FRYA 3NEKA 6FDRA 2C2DA 3J7YI 1U1RA 2HIYA 3V81A 1XERA 4OV1A 4FF2A 2KO1A 7FD1A 5M2UA 4NCBA 4KC5A 5C2GA 1AZSB 4XDDA 3SQGA 1UA1A 4Q0BA 4FXVA 1EQ0A 2RJZA 1RWWB 4B3MF 2AV5A 4KHMA 4ILRA 2V34A 2FY8A 1AUSL 2EBEA 4WF9Q 5KFWA 4NA1A 1RAAB 2CVEA 1NJZA 1Z4UA 4OYIA 1S6PB 2V8PA 2YKAA 1HARA 1Y3JA 3MCMA 2FJDB 1U48A 2H65B 3QSIA 3FCWA 1URRA 2VU5A 1T05A 3HHLC 1M5SA 1R43A 3ETMA 1TVRB 4J9SA 1R6VA 1WC1A 3OHAA 1RBAA 4KGXB 1M1HA 1IUJA 5L9NA 1HMVB 5L1KA 2YNHB 1FJGJ 4NEZA 1C1BB 2W9CA 1NDCA 3W2VA 4GC7A 1K0TA 2JH3A 2XWYA 4XK8C 4DL0C 5LXYA 4QWEA 2ZOMA 5EHHA 3MM8A 1PC4A 1A6LA 4OLPA 4MK8A 4WPAA 2DB1A 2KU7A 4G3IA 4IOBA 3OR2A 3LGNA 5K5MA 1DARA 1BQMA 5DDRC 1ZA1B 2GGPA 2FC8A 5J1PA 1C0UA 4B17A 1YRUA 2ZH1A 3I4PA 3D0HE 1QTNB 4RUHA 3U1LA 2XNRA 2MLXA 2ZH3A 2YKOA 3M8WA 3POTA 2HS0A 2DO4A 1N33J 4ETZA 2B5JA 1RABB 2ROGA 4A8XA 1GFWB 3MMBB 3IS9A 3K5OA 1NK7A 3MM7A 3D7SB 3ENAA 3CJKA 4LFCF 2F9JA 3G82B 4USKA 2Y0SD 3DLBA 5HVGA 3DI6B 1YBTA 3EVMA 2EKNA 3HHDA 5IZHA 1I94J 4A8FA 5ETSA 4PCQA 1AFIA 1YITS 2OFHX 3D6HB 1Y9OA 3LPEA 4PXCA 3T5LA 2CDRB 4ZLJA 2DEJA 2J9CA 1WOSA 3CD6S 2B6AA 4Q44A 3GR1A 4X84A 4LIWA 2BEFA 4QWDA 4BC9A 3MUVP 1PYSB 3CJ2A 2KTQA 3MR2A 2L9WA 3IR7B 3DLEB 2G0IA 4ZVOB 5A2QU 2CYYA 5IM0A 3RR7A 1CJVB 3DXSX 4OX7A 3DM2A 1Q8IA 2E1AA 4B9UA 2ZD1B 2PEBA 1IBKJ 2W9AA 2M3DA 3R7BB 2J6UA 4ZVRB 1DAXA 1Q82T 1KDNA 2LA6A 3CF5Q 3H90A 5G4DA 2DNZA 2WTFA 1DZ5A 4LF9J 4DR7J 1SI9A 5THWA 3THVA 1RTDA 4O4GB 4HEA9 4RW7B 2PDAA 4FYWB 3J80U 3JTPA 3UNGC 4C7QA 3MD1A 8AT1B 4KT0C 4IR1A 5I3PA 1ZBTA 3Q8VA 4FYDA 4C2MA 3IGVA 1YDLA 2UUAJ 1PILA 4RLEA 2H4WB 4KTQA 5LT5A 3Q2SC 2DR8A 1F0XA 4H4OB 2JWNA 3M8PA 1FNOA 4XAKA 1TK8A 1GXUA 1H74A 2DNOA 2JEIA 4DV3F 3RBXA 4W90B 1H7XA 4YHHJ 1CJUB 3BDEA 2L41A 2LECA 4C4WA 4DUYJ 1TL7A 2LQ5A 2VOOA 2H48B 2VC0A 3TZWA 2QJ3A 3BREA 2E7VA 4C9DA 4WXWA 3THTA 1U8WA 1NK8A 4NLXA 5A8WB 1DHMA 1MWZA 2X7IA 2P9CA 1HNXF 4F36A 5E0OA 2IPOB 2XS5A 4ECZA 3FJ2A 4B3RF 4LFAF 1R31A 1X4BA 2ZH7A 2FD2A 2ALYB 1S99A 4WFAQ 1S1WB 1LK5A 1WC4A 3QSYB 4RUCA 3GSDA 2VPYB 2AJ4A 4G1QA 1DURA 1SQGA 1XNRJ 3GIRA 1RTJA 4PR6A 4DX6A 4OZ0A 2PO4A 1VC6A 4JYAJ 2CG4A 1CJKA 4HLBA 3I5AA 4KHPF 1LW0B 1C2PA 1VQLS 3ENWA 5IV4A 2VIHA 4R5PA 3PXGa 3PRBA 4OHZA 1GEHA 1YGYA 4DG1B 4ZS6A 5KFOA 2YKPA 3GWCA 1RWPB 1WORA 1TP7A 1W2IA 2XY6A 1GNKA 2HRUA 4F2SA 3KKFA 1N32J 1DTQA 4CT9A 5J2MB 2HNZA 5D4LA 1GH8A 2HRTA 3FBCA 4CLSA 2ASJA 3NS6A 4C3MA 1RT6A 1YJNS 2BE9B 3E2EA 5AXKA 3M30A 4RBUA 4LF7F 3KNGA 3JB9k 2EXUA 3C6TB 3UCZP 1WUUA 2EG2A 3NBPB 1SUQA 2E5LF 3D3CJ 3BKTA 4EBCA 1FX2A 2X1GA 2FLOA 1VQYA 3EX7B 3AY0A 4LF4J 4J9NA 1F2GA 4CO1A 3IMQJ 3R5DA 5HI7A 4X65J 5DO2A 3W9JA 3D2WA 2UZAA 1MU2B 1GXLA 5KT7A 1UZHA 3NKYA 3PNIA 5D0HA 3BSCA 1RT5A 1G2EA 2IIHA 1YJRA 1KLMA 2R3VA 2DR6A 1B4SA 3WX4A 1EX8A 4I7FA 1N88A 1UWBA 5A8RA 3HSJA 2HBYB 2PI4A 3MEGA 1V3RA 3VVUA 3AD7C 3FNNA 5CA5A 4OYZA 2VPXB 2CPYA 2RVJA 3ZTOA 4WBFA 4USHA 4Y2IA 1VRUA 2V8DA 4Y6IA 4YUDA 2DY1A 2FJVA 5KG5A 1QD1A 1FDNA 4UOHA 4DPXA 3HO1A 2A6OA 2MZRA 2MXYA 4P71A 3CD0A 2MY7A 1Q8BA 2LEPA 4NRUA 2E29A 3OSPA 1RWUA 2B4PA 4DPYA 5B0FA 4NXNJ 2CDQA 3AODA 2WBRA 2A18A 3SCJE 5GAHU 5JVHQ 1Q95G 1T94A 4FF3A 2VQEJ 2H5IB 4EYIB 4NYPA 2GS8A 2W24A 2SXLA 3QATA 2HHHF 1AZSA 1FI4A 3FZBA 1NPPA 3K58A 3P8BB 1HHTP 4ED3A 1X4EA 1BQXA 2VG5B 5DZ7A 5MLCV 3OJSA 2VG7B 3KLGA 1TFWA 4NLYA 2YH1A 3FBFA 2C2OB 3W8GA 2IA6A 1YJ9S 1ZAXA 2DNMA 5L1LA 3TX8A 1FJ7A 3HK2A 2LCWA 2O3DA 4DV0F 3CJQA 3NNHA 4FDFA 1N36F 1AFJA 4NLOA 2CPJA 3B78A 2XGPA 2NZ4A 4ECTA 3SIPB 2R2SA 1P9YA 2AEJA 4IOAQ 4DV2F 1SB6A 4QIWD 4ED2A 3CGIA 4CLZA 2FUG9 2YQ0A 4KIAA 1TVRA 5CQGA 4LR9A 3H59A 4FYVB 2Y1IA 4U67Q 3I5CA 4DLEA 2CQIA 2JHEA 3CJ5A 2YNHA 1U6BA 2COLA 1FESA 2QZ8A 1C1BA 3MTJA 1XNQF 3WBZA 3K5LA 3G96A 2JVRA 2OEJA 2D1CA 3F73A 4KR0B 4KYZA 5F0UA 3UVJA 3ZC4A 4DEZA 1GQEA 1TUGB 2UVWA 4PG4A 4BWJA 3JQJA 1N5SA 1UZDA 4N47A 1U0HA 2GC8A 2IDLA 5CABA 5LMNJ 2XS7A 1KLNA 3D6MB 4NWBA 2B7CB 4ANCA 1M90T 2AKWB 2JX2A 3I5BA 2W2QP 2KXHA 2CQ2A 3QZ8A 3MMBA
chains in the Genus database with same CATH topology
2LXUA 1FRMA 2J7WA 2PE8A 2UXCF 4QIFA 2D41A 4Y00A 3FEXB 1OSCA 1TK5A 1UJ6A 3TNVA 2FIUA 4NZ7A 5E41A 3CWJA 4KGMA 1P9QC 5F8MA 3BQ1A 4DV7F 4CCHA 2HZCA 4OZJA 2LDYA 2HRYA 4TQSA 4BS2A 2HHVA 1HQEA 5B0DA 4ELVA 3HT3A 1F5CA 4ZKAA 3GFXA 3LWLA 4OJGA 3V6JA 1E6VA 1IKVA 4FNHA 4J9PA 1L3UA 1YBAA 3DI6A 1MW7A 1U1PA 4Y28C 2OO4A 4K5SA 4NLVA 1VLYA 4ILLA 4ETXA 4KB7A 1JLGB 3IRWP 4I56A 3DU6A 2XWXA 3FMWA 2P6TA 4GO5X 1U1LA 3JSBA 4HDGA 2DHGA 3M8PB 4H4MB 2FC9A 2EI5A 2GIQA 4USJC 3G86A 2W8LA 5DG7A 3KK1B 4HYKA 1H2TZ 1LXNA 2V2KA 3PO4A 1WD6A 1N56A 4M94A 2AF6A 3OFEA 1S6QA 3K5PA 4ED6A 3EPGA 3ONQA 5A2QY 4EFAC 2RE1A 3C2PA 3I55S 4FP9A 4NLSA 1OWXA 4ID5A 3TAPA 2XY7A 5EX0A 3OPKA 3LP2A 3QGHA 1TL3A 3IAM9 3IO1A 1HNVB 2HVIA 2VG6A 4Y3CA 2M9KA 5HMWA 2DVIA 2XULA 2FHOB 2XMWA 1NJXA 3D28A 2XHWA 3SFUA 3KJVB 1HI1A 4V19X 2FPHX 3MD3A 3RW6A 2XMTA 1RKJA 2OPSB 5KFHA 4K4TA 1C1CB 2CKWA 3EUNA 4JI5F 3KG0A 3IRXA 1HHSA 2BDPA 2R7QA 3DLEA 4O44B 2F9DA 3ITHA 3QWPA 4DQRA 2I2YA 3C46A 5KFBA 3AA9A 5FD1A 3HLUA 4C0HA 1MMDA 1XC9A 1HW8A 4FF4A 1RT2B 4YDDB 2GFFA 3K0JA 2DGWA 3W2WA 4M1KA 2XLJA 2ZH6A 5AE1A 3PW4A 3IR6B 1IN0A 4IKAA 4RBTA 4JI7F 2XMJA 1SJRA 3OVBA 2ZD1A 5T7LA 1FK9A 1FT8A 1QAXA 3CCZA 1WHXA 3GILA 2DJWA 3E51A 3HHNB 2BW2A 1N5VA 1OIAA 5F3ZA 4N41A 2V4RA 3R3TA 4UQGA 3S6EA 2ZBIA 1UEUA 3IC1A 4RW9B 5KFXA 1ZAWA 1LXJA 3J80Y 1KFDA 4NYOA 5KFCA 1NK6A 5A0YB 5GAEU 2LLZA 2RRNA 2R2RA 2VFRA 3CCTA 1SJ1A 3PVXA 3D1HA 5HL7Q 4X4RA 2L3MA 1SJFA 2M0GB 2ZVSA 3TA0A 4IOCQ 4HH0A 2VBWA 2NPFA 2WK4A 2J8AA 3NAIA 1XMBA 1B0VA 3PEJA 2E9ZA 3LH2S 4RNNA 3UD3P 4Q2LA 2J6SA 3TI0A 1VFJA 1XBWA 2VKRA 1N4LA 2X51A 4RW7A 4ICLB 4DL7A 3BSAA 4OX6A 5L9XA 1IKWB 1RTJB 4JV5F 3HHEA 3NS5A 2GMLA 2I1RA 2RF2B 3IG1B 3PR4A 3O3LA 2DGSA 3OLAA 2ALZA 4ZMMA 4KFBA 2HMIA 4ELUA 2V4JB 1R8AA 5D3GB 1SL2A 1FERA 2N4CA 5DQIA 2Q43A 3VAFA 4F3OA 5I3QA 2UXDF 4WE1B 4OI6A 3OL6A 1JXLA 1C4AA 2BM1A 2IVYA 3GFHA 3IFEA 3PJXA 3HP6A 5L1IA 4ZP8A 1KEKA 1E6YA 1TL4A 2HIQA 4MTPA 1N48A 2HHTA 4NLTA 4C8YA 4ZP7A 5KTQA 1RT3A 3EZ5A 4N5SA 3CCJS 2YKMB 1DTTA 2FJXA 4CO0A 4WCEQ 1ZH5A 4ELTA 2N7YA 1D9DA 4P2SA 4CH0S 3OJUA 4HT7A 1JLBB 2C3UA 3TRGA 1HD1A 3BGUA 5E3CA 3T1AA 3RAXA 2FJAB 2ZH9A 3ENVA 3K8WA 2R8IA 2FVQA 3G8SA 1BC6A 1Q81T 4PQAA 3MR6A 2RQCA 2RS8A 3HVTB 4MK9A 2GMHA 2HG4A 3CMAS 3MGJA 2OLWA 4WYLA 5AE2A 1BGXT 4C8KA 4OI0A 4MKBA 3E3XA 1UVIA 1JKHB 2OPRA 4IH7A 1CC8A 2D3OR 4A47A 2HNYA 2MZJA 5E33A 1ZM3A 2WSEC 3UPFA 3M1VA 1JIHA 4OJ1A 4YEAA 3C66A 3CB4A 1Q53A 3DHXA 1DTQB 4EZ6A 1MSWD 1TZ0A 1YJTA 2IRUA 3LANA 1X4FA 1FHTA 2CPFA 3TANA 3LQVA 3DOKA 2VD3A 3G8TA 3AQPA 1TV6B 3DMJB 1JNZB 2U2FA 4DQSA 3CCSS 2WB4A 5A6WA 4QWCA 4DWIA 5I42B 4BCAA 1N34F 2BM0A 3M8SA 4W92B 3OXLA 4C11A 5EDWA 3M30B 2GV1A 1QAJA 1WF0A 3CIZA 1V3ZA 3FFIA 3FSXA 5J2PA 3UD4P 2BYCA 4CH7A 3PKMA 1QAYA 1REVB 4MKAA 4RW8B 2V0NA 5A8WA 5D8HB 1FEHA 4GMKA 4URSA 2YKNA 3AH6A 2R4FA 1Z2ZA 3RU0A 3MF5A 3QGPA 4QIGA 4QQBA 2XSJB 1XTZA 3GV7B 2HWTA 4DV6F 5EGYA 3QYYA 3NP5A 4K59A 3THPA 3DRYA 3QWUA 3VF0B 3DOLA 4LF5F 1N0VC 5U47A 5LMUF 4UY85 2JSXA 1S48A 4LSLA 1GTEA 4FN5A 2EBGA 2F8EX 1JJHA 2QE5A 1V3SA 2CJAA 2QV6A 2RILA 3M32A 1H38A 3CMES 5IT9Y 3VWSA 1FF2A 3J81Y 2ADCA 2AYEA 2LEAA 2UVUA 1LWEA 3T6BA 2R7UA 3OUYA 2MJUA 3LP1A 2CPXA 4Y2MA 5DM6Q 2PA8D 4UW2A 3KLIB 5GAGI 4X4OA 3D1OA 4MFBB 1NHUA 1FNMA 4AE5A 3DYAB 2FTRA 3K59A 2ASDA 2HNDB 4QR0A 4Q5VA 1UFLA 1NJWA 1I1GA 3M2RB 2HWHA 2IBOA 4XPCA 4Y0FA 2Q6BA 4OLOA 4DF8A 3Q8QB 2BUNA 4PPDA 1Q1KA 2JC0A 4G1PA 5LSLA 3VAJA 2DHAA 1RT5B 4OJHA 2ZM6F 3N0VA 4KPYA 4PWDB 4PUOB 3CJ4A 1KLMB 5AJ3F 2IJNA 5J2QB 4O3SA 2VB6A 1LW0A 2CQHA 1UWBB 5A8RB 3ISND 4ECRA 5D4OA 2E9TA 2FJWA 2YX1A 3Q22A 1JLFB 4B9NA 4PG6A 4EEYA 1R8PA 1Q86T 2A10A 1QSSA 4K2XA 4TY8B 2MQMA 1IJFB 2CQ3A 1L5UA 2XMUA 1TKDA 2CRLA 5A8KA 1S1VB 1CQMA 2C3PA 4HI1A 2MGZB 3BO4A 4G1IA 3V81B 1BWEA 4Q2MA 1KVJA 3GV8B 4RW6B 3QJJA 2A2CA 3DLJA 4CO3A 2VBYA 1KSPA 3OBIA 3IAS9 2DGXA 4DG1A 5HLFB 1S1XA 4RW4B 2HHUA 1N54B 4NX9A 1T03B 4IR9A 1SV5B 5E2QA 2IVMA 1VQNS 4C3KA 3L09A 5JXSA 4Q0BB 1VRTA 3CO9A 3ULHA 3BSOA 1NK9A 4RWXA 5CHCB 3CC4S 1Z2LA 2JRSA 2OD4A 1FE4A 1RTHA 2W8KA 2W7AA 1HQUA 1TKXA 1Y5NB 2V94A 5J2MA 1ZAVA 1IQZA 2QIFA 2PD1A 4GO7X 4TYAA 4QU7A 2N82B 2YH0A 3O1LA 2DNGA 4ED7A 1FKOA 4I64A 2CJ9A 2OH2A 2VONA 2EK6A 1GAOA 3DFEA 4OX9F 4EWTA 3O44A 3AQOA 1N5QA 2B4UA 3DRSB 3I9ZA 3BJYA 4OHYA 3FVYA 3CEDA 2A1BA 4JI6F 5LJ5Y 4D3HA 4FXDA 4NZ0A 5K14A 5C42B 2PC6A 1MMLA 1RJJA 3N9UC 5HMXA 1FTCA 1PC5A 1XMQF 4RNHA 3K8VA 2QA4G 2MY8A 4Z37A 1HPZA 4P6QA 3LUYA 5KFVA 1NK5A 1HBMB 3J7Z5 5AXLA 3TUZC 1OS5A 5E3AA 1WF1A 5DLGA 1R8BA 1U45A 2K7JA 1KD1T 2DISA 4TXSA 1JLEA 2A3JA 5CZVA 2YNFB 4QIEA 2UP1A 4ATNA 2FJBB 3IXQA 5HP1A 1SIZA 2Q1LA 5FLXY 3OR1A 2XB2D 4TKTA 5CXTA 2B51A 2LEBA 4ECVA 4IRKA 2YNGA 3R1HA 2POKA 2FLLA 1K8AT 2WONA 2IRYA 4MK7A 4XPEA 4LT6A 1ZETA 4BC7A 2BE2A 2CQBA 3KLEA 4LSNA 2OMOA 1H0HB 5C24A 2BANB 3RRGA 2QT7A 1S49A 1Y4ZB 1U2FA 3OSNA 2I0XA 3KG4A 4TYBA 4F26A 4IFVA 5HN0A 4Y2KA 3BF4A 2JLFA 1NJYA 2V5HG 3DN9A 4WTYA 4JI2F 1MU2A 4F4WA 4JI8F 2VL1A 1VC0A 2LQ9A 2YX4A 3QGGA 4KO0A 2F1FA 1X4HA 3KLHA 3KLGB 1T95A 3MM9B 3DGPA 2R7TA 1D1UA 5J2NB 2DHSA 3JAMY 5DQGA 2J9EA 2LXFA 2ZE2A 1ZM4A 1QLNA 2J0SD 1WG1A 4KV8A 2OPPB 6FD1A 3IN5A 1KHWA 3PIPQ 5F8JA 2XGQA 2W9CB 4A8WA 4TU9A 4F67A 4IG3B 4U7CA 1H2VZ 1JX4A 1RQ0A 1LW2B 4V19J 1UETA 2VOPA 2MHEA 2JFKA 5GADI 2XBPA 3VZHA 1DQAA 1X0FA 4DF4A 2KN4A 4ITSA 1CG2A 2LYVA 1X4AA 2I5JB 3MM8B 2BBEA 1UMJA 2X1BA 4UQTA 3L3CA 1AROP 3UFCX 4HVZA 3HZEA 1S9EB 2M4MA 5G0RB 2ZH4A 2BV3A 3DRPA 4QPXA 4EBDA 1QVFR 2FB0A 3M8QB 3GR0A 2FGOA 3W7BA 3OR2B 3V6DA 3QLHA 3HF5A 5KFAA 1YVFA 3NNAA 2ADBA 4B9VA 2OTLS 1BQMB 1Q16B 2VFSA 3FEYB 3ICLA 4IDKB 3HPOA 2DGVA 3I82A 2GGPB 2GNKA 1D8YA 3I96A 1C0UB 2O66A 4UUXA 1U49A 1UVNA 3BR8A 3RTVA 2KYZA 4QJVA 2H5EA 1Y0HA 1BLUA 2NXUA 3GB0A 3NCQA 1DQ9A 2L48A 2P9GA 4X66F 1SH0A 5CZXA 4DR1F 2HGMA 3JTNA 1U6ZA 3NCRA 2LDIA 2V8VA 2W7OA 3J7ZT 1MWYA 3MUMP 1Y5IB 3P5TL 4MIBA 4EU0A 5E3QA 1U47A 2NSCA 3POTB 2M52A 4HT5A 1FJGF 5B0CA 1LV5A 1WEXA 3SMZA 5H9FJ 3M05A 5L8RC 4QWAA 1JLQA 3MR3A 1ZTTA 5KFQA 3V4MA 3R5CA 1JJ2R 4FBTA 3IS9B 2ZH2A 1EETA 3SZ2A 2EFQA 5CYJA 5KT6A 2R8JA 4K4ZA 4IG0B 1MROB 2R8KA 1F60B 2KH9A 1FKPB 4A8SA 1T02A 4FBUA 2Y1JA 4X2BA 3DLKA 1S6PA 3N4WA 3MM7B 1VMBA 2AWZA 3GMGA 3GG0A 2WOMA 2KJVA 3ZZOA 3CJKB 3MHYA 4M5DB 1HNWF 3PZPA 4CTAA 2J0XA 4ZPAA 4YMEA 2IYIA 4TU7A 1G6BA 4B3SF 2FVCA 3T19A 3E01A 5DS7A 5F3TA 2KM8B 2MQNA 1VQOS 1R0AA 2C2RA 3KNAA 1FKAF 2K1RB 3PM9A 1RT1A 3TVZA 2E66A 2DITA 3F41A 4NCGA 5AE3A 2B9XA 2ASLA 1LFWA 3BZQA 2DO0A 2ZITA 3G8QA 3BO2A 3HKWA 3PX0A 2KRRA 1U4BA 3HJFA 1TK0A 1GTHA 2YWFA 1S0NA 3M2VB 2P5VA 3C6UB 3H8YA 3U7JA 3HVRA 4QOTA 5KG2A 5CYMA 2W9BA 1N5YB 3MMCA 2CJBA 2CQGA 5GAEI 1HYSA 4URGA 4ZVFA 1TFYA 3LO3A 4NZ6A 1N33F 3B8HA 2MQQA 4L3NA 2VG5A 3CUNA 3BGRB 3OTBA 1YJWS 2Q66A 3PACA 1HMVA 2M88A 2VG7A 5KG3A 5BJRA 3PR5B 2B6AB 4NRTA 4YB5A 2DPIA 3X3UA 1GX5A 1C4CA 1O8BA 1XWLA 5F9LA 4ZPCA 3HVWA 5KFYA 4A46A 2ZC4A 4AXJA 2MPUA 1K9MT 2L08A 3HHLA 1R8HA 4ZPWR 5FDLA 4DFKA 3S01A 1U25A 4ZHRB 1TAUA 1DJ0A 3ZZRA 2CVIA 5I4MA 2NSBA 1O51A 3Q8RB 2V4QA 2DH9A 1TKZA 2RQ4A 5IM0B 4ID8A 1V9OA 1Z1ZA 4DOZA 4ES2A 3MI7X 1B0PA 2HLUA 1X7VA 2IAJA 1A7GE 3CCWA 4B02A 1W25A 2RKIA 4CT8A 4JBCA 2MYFA 2CPIA 1DFDA 5KFRA 1IXKA 3W3SA 4PWUA 5DETA 3IWXA 1XMOF 3EPIA 3GFZA 1I94F 4L72B 4YY3F 4IFYA 3BR9A 5K8OA 2MZQA 2GCFA 2XMKA 3M2UB 1IKVB 1Q78A 4LVNP 4YR0A 2D3UA 2J0WA 2XLIA 2YWGA 1D0EA 2P6SA 3MOZA 3GIJA 2V9WA 4WK1A 2YVSA 1FXLA 1UEVA 1ZPVA 2EW9A 2EVZA 4UUWA 3WDOA 3MWBA 3MR5A 4A8QA 2AYBA 3BGLA 2RQMA 3OXGA 4HL9A 1GT8A 5KFMA 4DL2A 3NMRA 3IBWA 1K1QA 3PEHA 2D74B 1HWKA 5GVQA 2KJWA 2LA4A 2K3IA 2CJKA 1S7HA 1S10A 3EGZA 4ZPVR 1U1OA 3H2VE 5IXUA 4Q43A 4NLWA 2JEGA 3V5RA 3KWMA 1FD8A 5J1EA 2FHJD 1RTDB 5KFJA 2PT0A 3H2UB 5B7WA 4NYZA 2VQFF 1NK0A 3DRRA 1N5TA 4J9LA 3MM5B 3GG1A 2E1RA 1FRIA 4FXWA 2OPQB 1FVQA 3N6MA 1YI2S 2PIIA 1T3OA 2DPJA 2PA3A 5HQ8A 2AW0A 2IC3A 2KHCA 3HKZD 4MJKA 4P7TA 4YP3A 4DFMA 3CCLS 2IMOA 3I4HX 4B08A 2MZ1A 1ZTWA 3CCVS 2KYXA 2B4OA 3PJWA 4KBIA 2FHKA 3KLVA 3IRXB 1HD0A 4ZA1A 2MKIA 2G4BA 4FNIA 1IBKF 4TN2A 4D3GA 5HMZA 3T1YF 2CZ4A 3ITHB 3UR0A 1HR0F 2OKQA 4QCLA 3M6UA 4DX8H 5IT4A