3C6UB

Crystal structure of hiv reverse transcriptase in complex with inhibitor 22
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
423
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 108
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB04
3FFIB 3NL0A 2E9ZA 1LWCB 5L1KA 1RT7A 3D5MA 2W9CB 3KK1B 4KFBA 5C42B 2FJVA 4Y34A 1ZETA 3QLHA 4I7FA 1SV5A 3QYYA 1D0EA 5HROA 3DI6B 4KV8B 1TP7A 2YNFB 1HNIA 5KFPA 3OLAA 4ZVFA 3BSOA 5HBMA 1S48A 3G6YA 4NLTA 5HBMB 3PVXA 1RTDB 4K4YA 1Z4UA 4MK8A 5KFRA 1RTDA 5CYMB 4TQRA 1JLCA 4RW8B 3V81A 1JLEA 3QIPA 2IM1A 4K4UA 4O3PA 5JXSA 4URSA 1MU2B 1HNVB 3MF5A 3OL6A 2AGQA 1MU2A 1D1UA 4NLSA 5L1JA 2R8GA 5DQGA 3QLHB 1J5OA 3SI8A 2ALZA 1LWEB 2HWIA 4WE1B 4WZMA 5F8IA 3OL7A 1KLMA 3MTKA 5KFCA 3RB4A 3ISNC 5DGBA 5KFKA 3KHGA 3KHLA 2C2RA 4WZQA 5CYQA 2IAJB 3MECB 5F8LA 5KFBA 4M94A 4WFYA 4ZP6A 2UUTA 3QO9B 3KLHA 3I0SB 3JYTB 5KG0A 3VQSA 3M8QB 1JLCB 2ATLA 4ECZA 1K1QA 2DPJA 4O3RA 2E9TA 2R2TA 3QGHA 2R2RA 4XPCA 4KO0B 4HYKA 1RT3A 2O5DA 5J2PB 2YKMA 3V6DB 4H4MB 4I2PA 4IH7A 5KG7A 2J6UA 4H4MA 4I2PB 2FVQA 4YP3A 1RTIA 1W25A 5EDWA 1C0UB 5K14A 1S9FA 3KHHA 3PR4A 2FJXA 4ECXA 4O4GB 1RT5A 3MR2A 1JIHA 5DG8A 5J2MB 1TL3B 2OPRB 3RAXA 4TYBA 3I0SA 3RB6A 4G3IA 2WTFA 4IFVA 1JKHA 1C1BA 2WCXA 4O3NA 5J2QB 2WK4A 3IGNA 3MR6A 5C25A 4EO8A 1KHVA 2IC3A 1JLQB 4ECTA 1VRTB 3KLGA 4Y2CA 1HQUB 1JLQA 2JLEA 2VG7A 2JC1A 2B43A 3IGVA 5KG1A 5KT6A 4ED8A 3PW7A 2BQUA 4B3OB 2VG7B 5EWGA 3DLGA 1S6QB 2BE2A 3DDKA 3LAMA 1FKPA 2BE2B 4ZPCA 1HMVB 3M9MB 3GQCA 1S1WB 4F4ZA 1VRUB 3KLVA 2WOMA 1RT6A 1RDRA 4YR0A 4IDKB 5J2MA 2YNHA 1DLOA 3DRPA 5JUMA 3GIKA 2IJFA 3BQ2A 1RT7B 4NZ0A 4NLGA 4NLWA 2W9CA 4EYHB 2IBKA 1NHVA 5J2QA 1RT4A 4ED1A 2IJNA 4KBIA 3I0RA 3DMJB 3IRXA 3H4DA 2W9BB 3CDUA 3E01A 3RBEA 3N6LA 1DTQB 3MEGA 1S0MA 2YKNB 1S6QA 5F8GA 4Q43A 1TVRB 4MKBA 2GIRA 1TV6A 2UVWA 2CKWA 4WFZA 3KLEB 1C0TB 2OPPB 3LP1A 1TKZB 1CSJA 3H4BA 4RW9B 2VG6B 3KLEA 3C6UA 2R8KA 2AX0A 4RW9A 2IM2A 4DL5A 3TQ1A 4F4WA 1HNVA 4DG1B 2XWYA 4QWEA 4K4VA 3MEEA 1LWCA 5C42A 3NBPB 5KFTA 4EBDA 4ID5A 3N6NA 3DOLA 3T19A 3SFUA 5KFUA 4RZRA 3Q8QB 3GILA 2AU0A 4J9NA 1JLFB 3LALA 1I6JA 5KG3A 1S0OA 2F8EX 1C2PA 4WE1A 5DLGA 4YQWA 3G6VA 4RNHA 4ZPAA 1HNIB 5D3GA 2VG5B 4PQUA 1EETB 1RT2A 4O4RA 4Y3CA 5KT2A 3CJ0A 4NLYA 4DL4A 3KLIA 3CO9A 5KFDA 2XCAA 3CDEA 2V0NA 2B5JA 3CWJA 3KLFB 3EPGA 1UWBA 5HLFA 1JLGB 5KFFA 2BRLA 4ED0A 3DRRB 4NLPA 3RB3A 4R5PA 5I42A 4IG0B 4IQXA 1S9GA 2EC0A 2CJQA 3RBDA 5KFMA 1J5OB 3HVAA 5KT7A 4F50A 3M9NB 4EBEA 2HNDA 1LWEA 1S10A 5K14B 1NNDA 3IG1A 2ZE2B 4IRCA 5KT3A 1TKTA 4U7CA 4O3SA 2FLLA 1LWFB 4ZHRA 1TQLA 1YVFA 4GC6A 5CYMA 1JKHB 2IM3A 3G6XA 4FS2A 3QIPB 3LP2B 2JEGA 3ISND 1S1TB 3LAKA 3KK2B 4PUOA 3BGRB 1IKWB 5J1EA 3DRSA 5C24B 4Q0BA 1C1CA 1QE1B 4TYAA 3OHAA 1QE1A 1RTIB 4KHMA 5J2NB 2AWZA 3CJ3A 3MR3A 2YNGB 4DEZA 1T03A 1KHWA 2D3ZA 5KG4A 2FLPA 3DOKA 1RTJA 4RUCA 5KFGA 3ITHB 3FRZA 4O3OA 5KFYA 1S6PB 5F8HA 4XPEA 5FDLA 2R2UA 3E51A 4IKAA 4IFVB 4H54A 3PW4A 1S4FA 3TVKA 4NRUA 3BSCA 4KHRA 4OL8A 1JXLA 2VA2A 2W9AA 2UVUA 3KK3B 3H5YA 3Q8SB 4EEYA 1EP4B 4FBTA 2AGPA 1WNEA 5J1EB 1N4LA 1SH0A 2W9BA 4RW6B 2ZD1A 4EYIB 3KJVB 4HKQA 4FS1A 2YKMB 1GX5A 2RKIA 3GV5B 4TXSA 4K4ZA 3N6MA 1HQUA 5DG9A 2C2DA 3T5KA 3EPIA 5HP1B 4B3OA 2RF2B 4ZP7A 3FSIA 4F4YA 5DLFA 3FQKA 3MFIA 4ZPBA 1HYSA 3PZPA 1JLBA 3ITHA 2RDIA 4LQ9A 3D28A 5FDLB 1JLBB 3PW5A 4IDKA 3PJXA 3KMSA 3DYAA 1REVB 4ECVA 3DRPB 3KMQA 2AQ4A 4WXOA 3BREA 2FVPA 3KK3A 4F4XA 4KAIA 2HWHA 3FDSA 3E01B 2JEFA 4MK9A 2GC8A 5KFSA 5HROB 2YKNA 2YNFA 1K1SA 3T5LA 4ICLB 4ED2A 3T5JA 5KFZA 3IS9B 5KFQA 2BANA 5I3UA 3I5CA 2HMIB 4ZP9A 3KHRA 4ZMMA 1JLAA 1TVRA 3KLIB 1S1WA 5KG2A 1JLAB 5DGAA 2UVRA 4YR3A 4G1QB 4YMEA 1IKYB 2IM0A 2UVVA 3FFIA 1S1VA 1RT1A 1BQNA 4IG3A 3DOLB 1U09A 4RW7A 1RT4B 3OSNA 4J9LA 1JLFA 2E9RX 5I42B 3CJ5A 5EWFA 2XI3A 4NLDA 3H40A 1N6QA 2HNYB 3V4IB 2D7SA 3NAHA 2WHOA 4KV8A 3DLKB 3LANA 2BANB 5I3UB 3M8PB 3NKYA 1SH2A 4TN2A 1EETA 2W7OA 4ZHRB 1JLEB 3NAIA 3DLEA 4TY8B 1RYSA 2VG6A 3V6HA 3OL9A 5DQHA 4LSLB 1S9EB 4QW9A 4DL3A 4Q8FA 4J9RA 1JLGA 3CJ4A 4K4TA 3IN5A 1RT1B 3GIIA 5C24A 4Q0BB 2BRKA 4EO6A 1T3NA 3T5HA 4RW7B 1QAJA 4ID5B 5HLFB 1S9GB 2I5JA 1R0AA 4R5PB 3OL8A 1KLMB 5T14A 1SV5B 5KFOA 3Q8RB 4KKOB 5KFAA 4DL2A 1HPZA 4NLOA 5D3GB 5KFVA 3M8PA 1RT2B 1LWFA 4MK7A 5L1LA 3IG1B 1TL3A 2OPRA 1NHUA 4EBCA 4RW4B 2YNIA 2ILYA 2VA3A 4RW8A 3V81B 3M8QA 1OS5A 2C22A 1N48A 4IH6A 3LP2A 4R8UB 3UR0A 4YR2A 4ECYA 2C2EA 4PWDB 1UWBB 3OHBA 4RW6A 4KO0A 1GX6A 1VRTA 3H5XA 3C6TA 4KSEB 1FKOB 2WRMA 3EZUA 2UUWA 3H98A 4TLRA 5F8MA 4RNNA 5HP1A 4QWAA 2WB4A 4ECRA 4ED6A 4LSNB 3KOAA 3DOKB 4ZVGA 4LSNA 2V4QA 1XR7A 1VRUA 4ED7A 1TKTB 4IRKA 3BQ0A 1RT5B 2YNHB 4NLUA 5KT4A 1DTTB 5F9NA 2J6SA 2WONB 4WXWA 2W7PA 1DTTA 1SUQB 4MH8A 3JSMA 3HVWA 5EUHA 2WONA 3QZ7A 4RUAA 3KK2A 1SUQA 4PUOB 2ZD1B 2XGQA 3BGRA 3MR5A 3DMJA 1RT3B 4PWDA 1RA7A 4K4SA 1C1CB 1EP4A 2R2SA 5C25B 5J2PA 3SFGA 5KG6A 4NCGA 3OSPA 4MFBB 4ECQA 4LQ3A 3KJVA 1T05B 3V6KA 4Q45A 2RF2A 2YNGA 5KFWA 3IS9A 3MFHA 4ECUA 1FKPB 4NLQA 2AX1A 4O4GA 1C0TA 2OPPA 3UPFA 1S6PA 3DM2B 1LW0A 1MMLA 1RT6B 4TY9A 5KG5A 2OH2A 1S1UA 3HVTB 1LW0B 2W8KA 1IKXA 3HVTA 4DG1A 4J9QA 1IKXB 1BQNB 4KB7A 3I0RB 3IRXB 4J9OA 3KK1A 1RA6A 5KFXA 4WYLA 4NLRA 5KT5A 1IM4A 1FK9A 2HNZA 3KLGB 2FVRA 1S0NA 4K4XA 1TL1B 3MEDA 2V4RA 2HNYA 1T05A 4NRTA 2FLNA 2HMIA 4IRDA 4IR1A 3H5UA 2C28A 3LP1B 1HMVA 2BQ3A 1QUVA 3V6JA 1HYSB 1N5YB 2RDJA 2WOMB 3PW0A 1HQEA 4RU9A 3DM2A 1TKZA 1S9EA 4JV2A 4J9PA 4IG3B 4IH5A 3NBPA 3QIDA 3CIZA 5EWEA 3UDLA 2ASDA 3DRRA 1S1XB 4I7FB 4Q8EA 5C5JA 4R0EA 1RYRA 4IG0A 4ED3A 3GYNA 5KFEA 3DI6A 3ICLA 1FK9B 2HNZB 3T1AA 1S49A 4DL6A 3V4IA 1TL1A 4NLXA 4FBUA 1IKVA 3MEDB 3DLKA 1LW2B 2XI2A 1IKVB 4PQUB 3FQLA 4J9MA 2HAIA 2AGOA 4ZPDA 5CYQB 3LP0A 5L9XA 1RAJA 5KFIA 1TV6B 3OLBA 3GV7B 2R8IA 1N5YA 3I5BA 4LSLA 4RW4A 3G86A 4Y2AA 3HHKA 3DLEB 1IKYA 4TY8A 2JEJA 2GIQA 1S1VB 3QZ8A 5DG7A 2DPIA 2BQRA 3PR5B 3QGIA 2ILZA 2OPQA 4QWBA 4KFBB 3V6DA 2B6AA 2OPSB 3C6TB 3RAQA 4IFYA 2B6AB 1XR5A 4KKOA 2XCPA 2FVSA 2I5JB 1R0AB 1HPZB 2V9WA 4IFYB 1T03B 4M95A 1LW2A 1C0UA 4RNOA 2ZE2A 4NYZA 3QGGA 1RTJB 2JC0A 3MECA 2VG5A 4U6PA 4ECWA 3QO9A 3KLHB 4J9SA 3PJWA 4H4OA 2IAJA 2FVCA 3UQSA 1HARA 3M9OB 3BSNA 5L1IA 2J6TA 4K50A 1ZTWA 4R8UA 2YNIB 1IKWA 4JUZA 2B5JB 3BJYA 1T94A 1S1TA 3KLFA 3TAMA 3KNAA 3NGDA 1RTHA 2OPQB 3H2LA 4NCGB 3CVKA 4MKAA 4MIBA 4K4WA 4IOBA 2OPSA 2IMWP 2I1RA 5KFLA 4ZP8A 4TQSA 4IR9A 4JV1A 4MIAA 5J2NA 2HNDB 4NLVA 4O44A 3CDWA 4KE5A 2BR0A 4QPXA 4O44B 4QWDA 4H4OB 1BQMA 4I2QB 5F8NA 4QWCA 1S1UB 3JYTA 3DYAB 4RNMA 1C1BB 3JSMB 3GV8B 4RNFA 4J9KA 1ZTTA 4DL7A 4XO0A 3BR9A 2IC3B 1TKXB 3TAMB 3DRSB 5DQIA 3BQ1A 4URGA 5F9LA 1RTHB 1JX4A 1DTQA 1FKOA 4ICLA 4WFXA 2RKIB 2ASLA 4ZVEA 4ECSA 2IA6A 4Q44A 3DLGB 1S97A 2W8LA 4GC7A 5F8JA 3H5SA 5KFHA 2R8HA 3GIMA 2D41A 4G1QA 1REVA 4I2QA 1BQMB 3HKWA 2JEIA 5KFJA 1SH3A 1DLOB 3I5AA 2D3UA 3MEEB 5KFNA 4URQU 1S1XA 3H59A 2XGPA 2FJWA 1TKXA 1N56A 2ZKUA 2R8JA 3GIJA 3NMAA 4MFBA 3BSAA 1N6QB 4O3QA 3CJ2A 1QAIA 1XR6A 2QV6A 3MEGB 3PHEA 2QE5A 2ASJA 4ZVHA 4X2BA 3LP0B 4QW8A 3RB0A 1HQEB 4JV0A 4WYWA 2XC9A 3C6UB 3Q8PB 3PW2A
chains in the Genus database with same CATH superfamily
3NL0A 2POKA 4ETXA 3RR7A 2C3OA 1MW7A 4HT5A 3CT9A 3D5MA 5L1KA 1VC5A 3ETOA 3MI7X 1CULA 1NHKL 2HURA 4M63A 4Y2KA 1ZETA 3QSYB 4HH1A 2WZ1A 3EGNA 3SMZA 5I4MA 2F5GA 2MGZA 5HVFA 5HROA 2FHKA 1TP7A 2YNFB 2Q43A 3MZIA 3OLAA 5HJYA 4U67Q 4DR5J 4KHPF 9RUBA 1QY7A 4RKUC 5A0YB 5HBMA 1X4EA 3N9UC 4OZJA 1S48A 2VJUA 1VQKS 1WJ9A 2V8PA 3PVXA 1QSLA 4C4WA 5KFRA 5DETA 2P9EA 4OLPA 4RW8B 4FXDA 1JLEA 1X4FA 2EC2A 2RD5C 3D54A 1JJ2R 1MU2B 2DR5A 4DQIA 1IN0A 2UXDJ 2COLA 3MF5A 3OL6A 2AGQA 3NNCA 1D1UA 4ITSA 4OJGA 5L1JA 2AD9A 3UW1A 2J0SD 1FWLA 1J5OA 2Q66A 1VIXA 4OYPA 2HYIB 2UXBF 1UJ5A 1Z2ZA 5KFCA 5E7OB 1G6BA 4USKA 3R1LA 4B9MA 2JJ4D 4RO0A 3MMCB 3U7JA 4A48A 4AXIA 3KHLA 3K5LA 1G1XA 4WZQA 5KFBA 2M52A 2CQIA 3H0PA 4ZP6A 5JJBA 3JYTB 2HHXA 4CLPA 3K59A 1HLWA 4O3RA 3MM7B 3NGUA 2DHHA 1OWXA 1BY9A 3CJ8A 4FYVB 2V9KA 4OV1A 2H54B 3QT7A 1Y5LB 2HQFA 1RT3A 4DV1F 3KG4A 3BKFA 4UW2A 4C3KA 4DQPA 2P2CB 3CCZA 2XTJP 2FJEB 1PC5A 5CHCB 3U1LA 1FJEB 4LF8F 2QA4S 4I2PB 1AW0A 2DH9A 5EDWA 4YUDA 2OKQA 2VU5A 1HR0J 2CA9A 4ID8A 1UVJA 2CIMA 5L9NA 4B9NA 2IJRA 3PR4A 4J91A 3MR2A 1JIHA 5DG8A 2F7VA 3WQPA 5FLXU 4DUZJ 2I6WA 2OPRB 1X5OA 1G2EA 4TYBA 3US5A 5B09A 1JKHA 1QDUB 3CNQP 3M4XA 2C2MB 2WK4A 2VBWA 3GSIA 2HBYB 3PCOB 3MR6A 4AFFA 3R9LA 1DRZA 2I2YA 4C8YA 4Y2CA 1SIZA 3HULA 1MN7A 5KG1A 3PY8A 2VG7B 1B7YB 3DLGA 3R7NB 5IM0B 3CC2S 1HW8A 1BGXT 1GFWB 4J9UE 1Q81T 4JV5F 3K5MA 2OTJS 1WC3A 4QU6A 3LAMA 1F9HA 4ZPCA 3M9MB 4HDGA 4QPTA 4FKYA 1VRUB 1BWEA 2WOMA 2J9CA 4YR0A 2OD6A 2V50A 2XMTA 5J2MA 1X60A 3I4HX 3MD1A 2YNHA 1FNXH 1N5VA 3AD8C 3E3XA 1UW4A 4H4KA 3GIKA 1RZMA 4NZ0A 4QBUA 4NLGA 4OFZA 5EX3A 4EYHB 3A4TA 2EK1A 2VKRA 1QD1A 4FYXB 4KBIA 3IRXA 3H4DA 1Q8KA 2X1GA 2OSRA 2XMMA 1VYAA 1VFJA 1AFIA 4C8ZA 1S0MA 2VFUA 2CPXA 2P5VA 1TVRB 2DNHA 1OIAA 4MKBA 2G0CA 5K8OA 2X1AA 4EK2A 3B54A 2ZH3A 3KLEB 1CJUB 3LP1A 1TKZB 2VF3A 1FVSA 1IQZA 5ETNA 3CIMA 2LMIA 2BKOA 3LQVA 5DDQC 3JAMY 3OVAA 4DL5A 1T7PA 1EZZB 1FERA 3BBBA 1AZSA 1MN9A 3NGTA 4DG1B 4FBTA 3MCMA 2J76E 4JI6J 4LBPA 3J7AN 2R7TA 5KFTA 3SCLE 3Q8QB 3DOLA 4ZCKA 2E5JA 3J7YI 1M5PC 1P1LA 2FZKB 3LALA 1Q0NA 1MROB 3N01A 1NCLA 3M8WA 4WWSA 2YH1A 2VQEJ 1IM6A 1U24A 2H4YB 1U48A 3L3CA 4RNHA 2OJ3A 1IR2A 2E7XA 1V3ZA 5A0YA 3EDQB 1HNIB 3MOZA 4UZBA 2JHEA 2KDOA 3W61A 4ALZA 2EK6A 2OTLS 1NU4A 4DL4A 3KLIA 2U2FA 2ASYA 1WHWA 4CP5A 3GWCA 3G82A 2KI2A 2MPUA 3N79A 1FESA 4C98A 5GAEI 3CCWA 2DY9A 3MUTP 3M8SA 1XNQF 2HBQB 2JFKA 3D68A 2HQCA 1JLGB 1Q16B 3OR2A 4USMA 2E1PA 4LR8A 4R5PA 1GTEA 2CYYA 2G1HA 1RWXB 1S9GA 2I9SA 3A1YG 3B4MA 1UVMA 3RBDA 5KFMA 1J5OB 3HVAA 5KT7A 2Z58B 3J81U 2IY5B 1OY9A 4OX7A 5K14B 2CZ9A 3B8HA 1NNDA 4M5JA 5ETOA 4DZ6A 3PX4A 3CCJS 1SQFA 2ZH8A 1TKTA 1DBDA 4M5LA 1U7LA 2J7UA 3MAQA 2KVIA 5ADZA 5HN0A 3QIPB 5H1SV 4QR0A 5H9FJ 1RACB 3LAKA 3KYLA 3KK2B 2C3YA 2MKCA 3GJRB 2QC3A 2V63A 5J1EA 4ED5A 3BKTA 2JLGA 3C16A 3QWPA 4M5IA 2NXUA 1WOSA 2UUAJ 4BWMA 3KUGA 1KFSA 2F8MA 3IR7B 3K5OA 4ZVQB 4G6VB 1M5SA 2D3ZA 3BYPA 3FUYA 1Y3JA 4USIA 4RUCA 1NK9A 4NL5A 1HBNA 1GT8A 1NB7A 2KT5A 4LR7A 5F8HA 4GKKJ 2R2UA 1YJ9S 3PW4A 1YRXA 3QRRA 1S4FA 2O1PA 4OI1A 2RIJA 2WVFA 4OL8A 2VA2A 3C14A 3WX4A 3KTQA 2PT0A 3DNCA 1J27A 2W24A 3H5YA 3DHWC 2UVUA 2E5LF 2HGLA 4WJBA 4R0JA 2W9BA 1JWWA 2GFFA 4PG7A 3KJVB 1XN9A 3CJKB 2LVWA 2OO4A 2F9DA 2QJ3A 3N6MA 5DG9A 1R6VA 3GU0A 3R2DJ 1WDTA 4CLKA 3LPEA 2Z30B 2RF2B 4ZP7A 3FSIA 5CD4H 3MXHP 4LRBA 5E3PA 3MFIA 2IMOA 2KHCA 4DV6F 1ZZNA 3PFOA 1JLBA 3JAMU 4LQ9A 4MJKA 5K20B 5FDLB 3KMSA 4DR7F 1V5VA 2IRUA 4LF9F 2MEWA 2UXCF 3GJTB 2AQ4A 1AUDA 3BREA 1CS4B 2DVIA 2M9KA 4B3SJ 4EZ9A 3JQKA 1Y10A 2EFQA 2GJFA 2ZKTA 6AT1B 1GXUA 2JEFA 1UKUA 3EXYA 1U26A 1VRQC 2QLBB 1JK9B 4CI0B 9ATCB 3SCJE 2OUGA 1NJZA 1KC8T 4GKJF 1HD1A 2ZUGA 1DFDA 1UEKA 4ICLB 2L9DA 3VGTA 1NLKL 3T5JA 5KFQA 2XZDB 2GAHC 2I38A 2PMWA 3CMAS 4LFCJ 2HMIB 4LFAJ 4X65F 4ZP9A 4CLWA 3KHRA 4ZMMA 1TVRA 1SC4B 4YHHF 4IO9Q 5E3AA 2HHHF 3EGVA 2UVRA 3UO0A 2VOOA 1V3RA 1CEZA 4CO2A 4ES3A 3U02A 1S1VA 4ZVSB 1PG5B 4X62F 3IAM9 4DUTA 5I3QA 4TLQA 1JLFA 3W65A 3D9BA 3DU6A 2A2DA 3ZZTA 1HBOB 1UFWA 3NS6A 3QBCA 3S8SA 3HFKA 4NLDA 4N5SA 3PKMA 2HNYB 3L4BC 4TVAB 3BO3A 2QSFA 3LANA 2KG0A 4OX9J 4J7CA 4CNYA 2DNOA 4FF1A 3CCSS 1F2GA 4TN2A 3M2UA 4BBYA 4CDIA 1VC0A 1TELA 4TY8B 1M0SA 2CJ9A 3EXCX 3V6HA 4LFCF 5DQHA 2HZVA 4QW9A 1EIYB 4DL3A 1RI7A 2XBPA 1TK5A 3A3OB 3P5TL 4Y6IA 5LMNF 3GIIA 5C24A 4Q0BB 4DSJA 4DJBA 3C16B 1OQ3A 2XNQA 3NGRA 5HLFB 1S9GB 5AJ3F 1XEZA 4ZKAA 2I5JA 5IZHA 4R5PB 5RUBA 3OL8A 1C4CA 1J5EJ 2RS2A 1S72S 5KFOA 4DV5J 1NK8A 3R3TA 3Q8RB 2CAJA 1S77D 3NNAA 5BYSA 2YWGA 1G4CA 1JNRB 3BN7A 1XIQA 5KFVA 1Y3KA 3NEKA 4WK1A 4DI6A 2YQ1A 4LF5F 4MK7A 5L1LA 3I87A 1TL3A 1SBRA 4ZLNA 4HL9A 1VISA 4EBCA 1EHWA 1NDCA 1U2CA 4JI2J 2KJVA 1N34F 4RW8A 3M8QA 1OS5A 1UFKA 3DGVA 3UD5A 4GRSA 1RWMB 1UWBB 5LM7E 2D3O1 4ZK7M 3H98A 2M0GB 4Y0FA 5LMNJ 4ECRA 2K2PA 2WB4A 2RRAA 2CFXA 4KH1B 2UUBJ 2UXDF 3KOAA 4OZLA 4I6WA 2FHJA 1XR7A 5D0GA 1LFPA 4ZPTR 4ED7A 2E5IA 1SKSA 2K06A 3K0JA 4NLUA 4HTJA 3QWUA 4WIQA 4CLFA 2XS7A 2IDLA 4B9UA 2MQMA 2QYCA 4K8RA 1SUQB 3HVWA 3JSMA 4OYAA 1KD1T 2WONA 2Z2MA 4DR5F 4ZJQA 4K4SA 3RAMA 1FHTA 1C1CB 1KTVA 2I0XA 4J90A 5J2PA 1ZM4A 3CDBA 5HVGA 3RW6A 3G6ES 3KFWX 4ECQA 1IBMJ 2UUBF 1YDLA 2OLWA 1QAYA 4M5NA 2HFVA 1T05B 4P7TA 4Q45A 2RF2A 4FP9A 5M2RA 3LWMA 4ECUA 4JI1F 1FJGF 4WU2A 1FKPB 4KGMA 4KR0B 3ZTRA 3VAKA 4DQQA 1KN6A 2ZWOA 2YKAA 3OR1B 2CPEA 3HHEA 1C0TA 3R7BB 4L6V3 3MR7A 3NLCA 4UOHA 4ZVTB 2DD8S 5C2GA 3UPFA 2LDIA 3NP5A 2W8KA 2LEAA 1Q79A 3R6LB 3HVTA 2V2QA 4B3TJ 4CM0A 1BQNB 3OUYA 2N7CA 2PO4A 4ZOSA 4ES1A 4LF4F 2XLJA 1NPPA 1ZAVA 4OI3A 1VR6A 4DHVA 1FK9A 4WTYA 4LFBJ 4ER8A 4DR6F 1FXLA 2XHWA 2KVQE 3PYGA 3MMAB 3MEDA 2HNYA 1T05A 1X8DA 2G0IA 2FLNA 4UF4A 4LFBF 3BYRA 2BACA 2QZ8A 3HP6A 3CUNA 2A18A 3GTYX 5IV3A 3AJ2A 5IV4A 2RDJA 2WOMB 4YY3F 2VC0A 1JJHA 4LVNP 4HVZA 2XSFA 3PACA 4X4QA 1MSWD 2NXCA 1KQGB 2VFVA 2AF6A 3R27A 1YWXA 2FUG9 5HMXA 1OO0B 1OPIA 1C4AA 1W26A 2OELA 3K5PA 4QQBA 2CRLA 1W2IA 2F1FA 1NJWA 2HBZB 4U9RA 1P27B 3M2VA 3VAJA 2FHOB 2N4DA 5DM7Q 4M5HA 4ED3A 1X4BA 3GYNA 2HNZB 2OEMA 3GFHA 5CA5A 4KYZA 3MEDB 1YRUA 1LW2B 1XMOJ 2ZH2A 2WVDA 1KSPA 4HI1A 1X31C 2QL5B 4B17A 3CTRA 3DLLQ 4LF1A 2ZJRQ 3GV7B 5CYQB 2FGOA 4HEA9 1H7WA 1JMTA 4L3NA 2AKWB 5IOLA 2R8IA 1N5YA 4M5DA 2HVDA 2Y9HA 4FKXA 1U8WA 2QIFA 4DX7A 3G9CA 2XSJA 3HHKA 4TY8A 1IKYA 1L3VA 4ZVPB 2JEJA 2GMJA 2OEKA 2CNOB 5DDOC 2MZ1A 1B99A 3GJQB 5K5MA 3EZOA 3QGIA 4ILRA 2OPQA 4KFBB 3C46A 5T41A 4F36A 1YLXA 1UJ4A 1ZOTA 2V8GA 1S12A 1T9XA 2XZWA 4OX8A 1XR5A 2DXFA 3RAQA 2FVSA 3EDRB 3GZ7A 3MM8A 4UOFA 4IFYB 4FN5A 1T03B 4M95A 4WK3A 3THPA 2ZDOA 4RNOA 2VIHA 4C8OA 2ZE2A 4NYZA 2HVHA 2PIIA 1RTJB 2BJ8A 1NPKA 4ECWA 1TZ0A 4C0HA 1X4HA 5GAHU 4J9SA 1SKWA 3QATA 2XULA 2JRSA 2IAJA 1DURA 2FVCA 4DLEA 4M5DB 1SCJB 4A8XA 5L1IA 2MJNA 3Q8YA 1XMQF 3M30A 2YNIB 1HBUB 4GVBA 4N8NA 2B5JB 2ROPA 2AHOB 1X4AA 3NGDA 2R9LA 5IFMA 2CPHA 3LOUA 1D8ZA 2WVEA 2Z8QA 1XC9A 1EB0A 1T9VA 2CNLB 1AUSL 1Q5VA 2KO1A 2M4MA 5IXUA 4TQSA 1TMMA 4IR9A 3EWGA 4X66J 1VHFA 3ZZYA 3R1HA 1TK8A 3CCQS 4JV1A 4QYZK 1K0TA 1VMBA 2QLWA 1VS3A 5IC4B 1O51A 1MMNA 4DV7J 4L73A 4O44B 3AT1B 4WFBQ 3DLBA 3PRVA 4PG8A 2Y1JA 1WSRA 1BQMA 1S79A 2VV5A 4AQYF 1TL5A 1VBXA 4I0WA 4RNMA 4JI8J 3JSMB 1BLUA 2W01A 3BPDA 1U1OA 1U1KA 4DSIA 2CJXB 3ET6A 3DRYA 3BQ1A 1GK8A 2GCFA 2XZTB 3M2RB 3UI3A 1JX4A 3PO4A 2E5HA 1FO1A 1Q95G 1UZHA 3OVBA 4P9SA 1WOOA 1PYSB 1BUXA 4ECSA 2IA6A 2PI4A 4HT7A 4YB7A 1S97A 1SXLA 1S4EA 4J9VA 4DX8H 2R8HA 6FD1A 3NCQA 4G1QA 2A1BA 1BQMB 3EYZA 2JEIA 2UUCF 2OFHX 2WBRA 1RBOB 1SJ1A 2ACMA 4PEOA 1DLOB 2V34A 1AZSB 1ZS6A 2PA3A 4CT9A 1H7XA 1KTQA 1S6OA 1RAFB 2UP1A 5HO4A 2QGFB 3FBFA 4URQU 2XGPA 1VQ7S 4F02A 2L9NA 3EVOA 1UVIA 3C15A 2JVOA 4UY8T 5IT9U 1FEEA 4OMFG 4QJVA 2NUUG 3BSAA 2HHUA 4O3QA 2V8HA 1BD6A 1K8AT 3CJ2A 3KG0A 2QV6A 3MEGB 1CQMA 2QE5A 3BH6B 2LEBA 4X2BA 3SCKE 1OSDA 3RB0A 1GNKA 2GO8A 3QPIA 1QVGR 2HHTA 2DNGA 2EXUA 2QA4G 4NZ6A 4DR2J 3FFIB 2VUGA 3JTNA 5ETVA 2C1EB 4V19J 1E6VA 3U1MA 3TARA 4KHPJ 2JL9A 3RBXA 1RT7A 2CQ0A 2FDNA 4Y65A 2DGTA 4UZCA 3OTOJ 2R7WA 2VHGA 2XS2A 3WC0A 2ZH1A 3QLHA 4I7FA 1AT1B 1FJ7A 2PMHA 1SV5A 2MHNA 3WDOA 1FFGB 5KFPA 2L9WA 1B0VA 3LO3A 4WCEQ 4ZVFA 1BE4A 3PJ9A 2LEPA 2QFIA 4XDDA 2GGPB 5DRKA 1U0HA 1DZ5A 2EG2A 1RTDB 3AOAA 4K4YA 1X9MA 2HHWA 2ZH5A 4DF4A 2CJAA 4PYDA 2D9OA 5CYMB 3UNYA 3QIPA 4KC5A 5BYQA 1WG5A 4K4UA 1NKCA 5E2QA 2HLUA 3DFEA 4ZCLA 1M90T 3QLHB 3MAHA 2ZM6F 1R89A 1WI6A 1LWEB 2HWIA 3IXQA 3D1QA 2CQ1A 4V1Ak 2ZFHA 5ETLA 1QSYA 1QTNB 4E0DA 2Y3YA 1M5VC 4M1KA 4AYBD 3DOMA 2IAJB 3MECB 5F8LA 4YP3A 4M94A 2A6OA 2B9WA 3UFCX 1QAXA 3VQSA 2DNKA 4AUKA 5CABA 4XIUA 1L3UA 2NCKL 3R5CA 4NYOA 3UNGC 4DV3J 2ATLA 1PGZA 4A8QA 4BS2A 2E9TA 3CCES 2R2TA 2AT1B 2R2RA 3M30B 3R5GA 2VPWB 4OLOA 3SV4A 1VQ9S 3W3SA 1YBTA 3CD5A 1VK8A 1H0HB 2YKMA 2R4FA 2MKSA 1FJGJ 1PYOB 3CD0A 3O8WA 2BOPA 2DGWA 4IYQA 4H4MA 2FVQA 3TR5A 1LXNA 1RTIA 1FRMA 1XQIA 3D4JA 3JSBA 2ATCB 3PDNA 2MSTA 4OIXA 1KQSR 2R7SA 2AJQA 2JX2A 1S9FA 3VGVA 4F3MA 3A13A 1ZM9A 4ECXA 4O4GB 1LNQA 3CDAA 2XY7A 3NCRA 2AJ1A 1RAHB 2JWNA 4CO0A 5H9EJ 2F9JA 3I96A 4IFVA 2HS3A 1C1BA 4OZ0A 3SDEA 3JQMA 1UWAA 1E6YB 3IGNA 3RYLA 4EO8A 4PXCA 1X5TA 4C8MA 1VRTB 1NDKA 3P3DA 3RTVA 4MIWA 3W7BA 1HQUB 2JLEA 3BDEA 2VG7A 1X4GA 3M6WA 2VFTA 1WSVA 5IM0A 5KT6A 4CIOA 3SYZA 3MMBB 1S6QB 2D74B 2NSCA 3GQCA 1FKPA 2BE2B 1T3OA 2G2YA 2NUHA 4F4ZA 3KJFB 5IC6B 4PKDB 1U47A 3UDCA 1N34J 5JUMA 1QUPA 1RT7B 3HXMA 3MPVA 4LMZA 2IBKA 2DBBA 1NHVA 2GHPA 1TAQA 4X4SA 4ED1A 1AROP 2VBYA 3CCVS 1WORA 2Z57B 4KIAA 4ZJLA 2EBEA 3GIRA 3IO1A 4DFMA 1FTRA 3CDUA 4OZ2A 3TWZA 3W63A 3LGMA 1DTQB 1NXIA 2B8QA 3MEGA 3ZZRA 2ZVIA 2LECA 1S6QA 3OFGA 4Q43A 3M8YA 4FPRA 4Q5VA 3D6FB 2ZBQA 1ZYQA 4FNIA 1TV6A 2UVWA 3I6PA 3AA9A 1C0TB 3ZZ0A 2CWXA 5HQ8A 1CSJA 1ZPWX 3CCTA 4WPAA 1F6TA 3GYXB 1HFEL 1DQAA 4RW9A 2AX0A 2IM2A 4YDXA 5D77A 3ZZPA 3TQ1A 2RUGA 1CVJA 1T0TV 1HNVA 3D1HA 3FBCA 3MEEA 2NXNA 5C42A 1Z1ZA 2W2MP 2W1BA 3DN9A 3AD7C 4ID5A 3N6NA 4OX9F 3SFUA 3GILA 2AU0A 3T1YF 1SL0A 1S0OA 3B78A 2DCUB 3GCXP 4WE1A 2GZOA 2NZCA 3FRYA 4DU7A 1PC4A 4USVA 3NRBA 4ZPAA 1N36F 1PAUB 2VBZA 4PQUA 1FXDA 2BBEA 2LA4A 4O4RA 4JI8F 2BXJA 5KT2A 5CD4A 3CJ0A 4NLYA 1HNWJ 2NYHA 2YX7A 1F5AA 2DIVA 2IBOA 3GPAA 4CLUA 2V67A 1FRIA 3P49B 1S76D 2V0NA 1RE1B 2J5AA 5BYRA 1OQ6A 2K7KA 3CWJA 5FD1A 1UWBA 5EX0A 4ED0A 1H38A 3TUJC 3QRQA 3DRRB 2K1RA 3CJTA 2VQFJ 1RWWB 3OR2B 1UP1A 3EVWA 3ENWA 3IBWA 1IBMF 2CJQA 2P6SA 1LEOA 4F50A 1S10A 2BOAA 3BPSP 2Y0SD 2A0FB 2ZE2B 4ZLLA 3DGPA 1BC6A 1PJ6A 3AQOA 4DUYJ 2QMWA 3H42A 4ZPWR 2XMWA 3FSXA 4LF9J 2OD4A 2GS8A 4GC6A 3Q8UA 4FS2A 3LP2B 4D3HA 4DR3F 1N5QA 1YSJA 3J7A1 4W98A 3BGRB 4GVBB 3LH2S 4RL1A 3DRSA 4WU3A 3VCDA 1Q5YA 4K7QA 1VHIA 4TYAA 2HS0A 1QE1A 2L3MA 1CJKA 3D0HE 3VALA 2AWZA 3OD2A 4TNOA 3MR3A 2YNGB 4DEZA 1T03A 2W2NP 4U8YA 3L95X 2FLPA 2FTRA 2HFNA 2Q79A 5KFGA 5A8KA 4TU8A 2H5IB 2XMKA 1IBLJ 1VQOS 2FY1A 5KFYA 1ZA2B 2LQ8A 4DL0C 4XPEA 5BXIA 4UOCA 4RU2A 4IFVB 3GG1A 3FBBA 1PJ5A 4Y2MA 4NRUA 3BSCA 2DNLA 3OJSA 5HI7A 4KHRA 4DU8A 1TKDA 2VH7A 5GMDA 4WTOB 3KK3B 2LU1A 1FA0A 4U7UK 1EP4B 1U1RA 2E5GA 4AL6A 1SH0A 2PSZA 4FS1A 5F3ZA 1QM9A 2XMUA 1BWVA 4LF6F 1BQXA 2AYMA 2B3TB 1CJVA 3CJKA 1CJKB 4CO1A 4K4ZA 2C2DA 4C11B 3AXMA 3EPIA 4N41A 1WHYA 2CDQA 4B3OA 4ZVUB 3FQKA 3I32A 4ZPBA 3M6XA 2RNEA 3I82A 4I4BA 2MMYA 3D28A 4Z2XA 4GKKF 1JLBB 2PMZD 3PJXA 5GAGI 4X64F 2MZSA 3DRPB 2BV3A 4WXOA 2FVPA 2V4JB 3KK3A 1S99A 4KH0B 4ZVRB 1EAYC 2HWHA 4DV5F 1GMWD 3UCZP 2MLZA 4ATNA 4LF6J 1VLYA 1GTHA 4OI2A 1DARA 1RHJB 1GMVA 1NSQA 5CQGA 5KFSA 4PPZA 3W64A 2YNFA 2A10A 3H25A 3T5LA 3CCUS 2DHSA 2N7YA 2DISA 3DXSX 3DCAA 1NSAA 1T95A 5KFZA 3IRWP 4OV6A 2J9DE 2NS1B 3QNWB 2PGCA 1J2VA 2B9YA 2DO0A 1S1WA 3BH7B 3W60A 2CG4A 1GMWA 1JLAB 2ZZMA 3P96A 4L72B 1UJ6A 4DLGA 5DGAA 2MKIA 1JJCB 3FFIA 2MDAA 1TMJA 4ZS6A 5A6WA 4RX6A 1RT1A 5KTQA 1U09A 2XYGB 3S1TA 4J9LA 1YG0A 4NXNF 2E9RX 5I42B 2DGUA 2GW8A 3CJ5A 1KLNA 1UTAA 4IO1A 5EWFA 3OTBA 3Q0AA 7FD1A 2G2ZA 3DLHA 3G96A 4LF8J 1RAGB 3PHTA 4ETZA 1N88A 2J7KA 3NAHA 4OYWA 4USWA 5L39A 3L7OA 2B4OA 4OYIA 1T9WA 5LJ5Y 3CO0P 3OXLA 1HA1A 1NKEA 2UXCJ 3DGPB 3D3BJ 1SH2A 1YZ6A 3Q23A 4FF4A 4MYTA 1JLEB 3NAIA 4USHA 2GHVC 1RBAA 3BEGB 1HBUA 4Q8FA 1E6VB 2B4UA 4J9RA 2LXIA 2WSCC 3CJ4A 4N7TA 3G4SS 1RT1B 1Y11A 2CPJA 3MCOA 2BRKA 1TTHB 1QAJA 3CJSA 4E8UA 5IS2A 4N47A 1GXTA 3WC2A 1VIOA 2FHJD 1NRKA 2J7WA 4C2MA 8AT1B 2DGQA 1HBMA 5E33A 2DK2A 3TA2A 2V2VA 1WHXA 4DL2A 5EN1A 3RR8A 1B64A 3KDOA 1RAEB 4NLOA 3BO2A 3QJPA 1LWFA 2H4WB 2GGPA 5AE2A 4K5SA 1MMDA 1YTYA 2WW4A 5GADU 4RW4B 2B7BB 2ILYA 3J7ZT 2VA3A 1HHQA 1N33F 3JSYA 3CD6S 1K47A 4PR6A 1FD2A 1H2UX 3TJAA 5B08A 4IOAQ 4DQRA 4FVMA 3I9ZA 1HNXF 2AZ1A 2DHGA 3VTIA 3V4MA 3L9ZA 1R8AA 3NWGA 3C6TA 5F8MA 4A8YA 5DZ7A 4QYRA 1PILA 2UUWA 4M5KA 4TLRA 2W7AA 5HP1A 4HTIA 4ED6A 4B9SA 3SSSA 3J7YU 2CJBA 4V19X 5G0RA 2V4QA 3BB5A 3FVYA 4HDHA 1TK0A 4IRKA 3IAS9 2Y1LB 2YNHB 4E2FB 1Q7YT 2EFVA 1DTTB 3S7RA 4DUYF 2WONB 2W7PA 3MMJA 3BV8A 3TOQA 4W92B 1W7WA 2E29A 4RUAA 3KK2A 3MR5A 3MDFA 2XGQA 3VAFA 4RPFA 5IWAJ 4K5RA 4BDPA 1U8SA 1EP4A 4USUA 4UQTA 3A8EA 5KG6A 1HR0F 4NCGA 2HFOA 3CEDA 1YRTA 3EGZA 4FYYB 3UD4P 3RG6A 5IWAF 2MB0B 4MTPA 3VF0B 1T9YA 2YWEA 1A6LA 3V5RA 1CJTB 2KXFA 2XY5A 1VLOA 2BE9B 3SCIE 4NXMJ 4ANEA 4O4GA 2P8IA 1CJUA 1HI8A 1F3FA 3OTCA 3PO5A 3DM2B 2RS8A 4X4NA 1RT6B 4TY9A 1S1UA 5BJRA 4ELUA 5AE3A 1LW0B 4LFAF 1JXEA 2O66A 3AA8A 1F5CA 4DG1A 1RSCA 3AJ1A 2J0QD 2M70A 3IRXB 2IPOB 1SJRA 4PABA 3KK1A 5KFXA 4BC7A 1MNEA 4WYLA 4QZVB 4J9OA 3T9ZA 1EQ0A 3TX0A 1IM4A 1UW9A 3EM1A 1FE0A 2RU3A 3KLGB 3HI9A 1WC5A 4K4XA 1TL1B 1N32J 3OTEA 3AD9C 3MEKA 1AB8A 4OZNA 2V4RA 4QU7A 2BM0A 2UV8G 3MMAA 2B4VA 4Q2LA 3W5YA 1IJFB 5DJBA 1HI0P 4JYAF 5A8WA 4IR1A 4AE5A 2E1RA 2HWTA 3I4PA 5LSOA 1D09B 1HMVA 1YITS 1QUVA 3S01A 3IR5B 4C6AA 3PW0A 1L3SA 1D9DA 4KGXB 1HQEA 3NGSA 3DM2A 3M6VA 2H65B 1H2TZ 4I1TA 2IYIA 4DMZA 1KR4A 2DRBA 4IG3B 5LSLA 1WF1A 2RQMA 3CIZA 4ZIWA 3UDLA 5HMWA 1JJ4A 3Q2SC 5E41A 2AGPA 3CXCR 2JH3A 4F04B 4GMKA 5KFEA 3TX8A 1FEHA 3V4IA 1TL1A 4FBUA 1GXLA 4GVLA 3DLKA 1NZ8A 2X1BA 2XI2A 2GVDA 1HNZJ 4J9MA 1HHSA 2HAIA 2AGOA 2G0JA 3LP0A 3TANA 1T11A 2AP6A 2DHXA 2BJ7A 2AIRB 3MUMP 4LSLA 4RW4A 1NZAA 1X5SA 1WC0A 1RLCL 2Z2YB 3N4WA 4OYMA 1FT8A 4UUXA 4Y2AA 3R97A 3RGIA 2W4DA 2Q6BA 1S1VB 5DG7A 3K17A 1J5EF 4EFAC 1RLDA 6FDRA 1SC3B 1FX2A 1R27B 2DIUA 2RU9A 7AT1B 2ILZA 2ZNZA 4JV5J 5A2QY 1RXOB 2KT3A 5FLXY 1K0VA 2B6AA 2OPSB 3C6TB 5ETTA 3UVJA 4FVCA 2MY7A 2M5YA 3PG9A 3JQJA 4ZA1A 2KTQA 4QIGA 1C0UA 1IQTA 2GAGC 3ULHA 2EEYA 2R7VA 3ELHA 3C8YA 2HAFA 2JC0A 2M8HA 4UT4A 2R7QA 2BYCA 5BR8J 1RP5A 4H4OA 1UCNA 3ETMA 4RUHA 2HRTA 1S57A 2BUNA 3UQSA 1IJEB 2FPHX 4ZDNA 1SQEA 4DOZA 1T94A 3ZNJ1 4QYZJ 1R3NA 3PFEA 3BO4A 3TAMA 4JB8B 5H9EK 2ADCA 3P45B 4NCGB 1O8BA 3QQCD 4MKAA 3D67A 3K8VA 2OPSA 4IOBA 2YWWA 2ZH4A 3SXLA 1F9FA 1MWZA 3W8PA 4F67A 2LA6A 4DS5A 5C2CA 1FNOA 2BJ9A 2NYIA 4YN3B 2CJKA 3W2WB 1VGYA 4LF7F 3ILLA 1VJQA 4O44A 1MWYA 4TKTA 4KY3A 2ZBCA 2BR0A 2LCWA 4D3GA 2HHSA 1GQEA 1HWJA 2FIUA 4H4OB 4LUBA 4I2QB 4Z7CA 4KGZB 4QWCA 2DEJA 4DN9A 3DYAB 4RUBA 3GV8B 2YQ3A 3SBMA 1ZTTA 4EMDA 4RNFA 4X4TA 3W2VA 3LW5C 3CF5Q 4F3QA 2BQUA 1I94F 4XO0A 4HR2A 4F2SA 2IC3B 3TAMB 3CMQA 3QT5A 2OMOA 4URGA 2FD2A 3PEHA 2W25A 2K8GA 3TUIC 3M2RA 1DTQA 3TVZA 2WSFC 4WFXA 2RKIB 4JI6F 5DS7A 4DR7J 2C42A 3JTPA 2VODA 4Q44A 1FTCA 2W8LA 3CJQA 1SIWB 2NQPA 2ZVSA 5F8JA 3IR6B 5KFHA 1Q82T 1OPZA 2Z2LA 1VQYA 3GIMA 5L46A 5D4LA 1REVA 1Y00A 4JI0J 2J9DA 1SC1B 1S59A 4ENOA 5KFJA 3PV8A 1FVQA 1XMQJ 3I5AA 4CLSA 2XM3A 3G71S 2DRAA 3MEEB 1M5KC 2JZ5A 5A8RA 2FJWA 3PM9A 3K7RA 1TKXA 3UD3P 1S6UA 1HW9A 4X65J 1N56A 3GIJA 2R8JA 3A8KA 3NMAA 2H48B 4MFBA 2CUYA 4PG6A 2DNMA 1CJVB 3PYFA 4X4OA 2AZ3A 2FQQB 2FC9A 4G1IA 1BMQB 1B0PA 1XR6A 1B4SA 2QX0A 2YWFA 3LF0A 3PHEA 1P6TA 1LFWA 3GR1A 4ZLJA 5HK4A 5MAOA 3LP0B 1F60B 4RWWA 3SZ2A 3FMWA 1HQEB 2GO9A 3JTOA 3R7SB 1CC8A 1PJ7A 2FC8A 3GFXA 4WYWA 1KEKA 1JXVA 2OAUA 3Q8PB 5ITHA 3TUPA 2EW9A 4LF7J 1T02A 3EX7B 1RU1A 2D69A 3J81Y 1WKJA 2AJ2A 2E66A 3CGIA 4PXBA 3I56S 1UA1A 2WBMA 1UVLA 1YJWS 4DR4J 2F65A 2L08A 3D7SB 4ZITA 2F4VJ 1NJYA 1CG2A 3CCRS 1WTFA 3RJMB 1D0EA 3DI6B 1FI4A 2RRBA 1HNIA 3VVUA 1F1BB 2XEXA 2HZCA 1JB0C 4IQMA 1R8HA 2ROEA 4HHHA 4NLTA 4ZCIA 4A8KA 4DPWA 1K73T 1Z4UA 1RTDA 3ZTQA 4TQRA 1NJXA 1YBUA 1JLCA 3V81A 2IM1A 2GJ2A 2M2BA 3LTOA 2VKZG 3VAGA 3L7PA 3UCGA 3WX8A 1IR0A 2PI5A 4JI4J 2QLFB 2APOA 4NLSA 3ENAA 2BZ2A 2DH7A 5DQGA 2R8GA 4C97A 4OHYA 4ELTA 1RKIA 2HIQA 3FCWA 4BHQA 4OI4A 3OW2R 2CPYA 1PYTA 5JVGQ 1Q86T 2ALZA 1ELOA 4WBFA 5F8IA 3MTKA 3OL7A 3RB4A 4F3OA 1OY8A 3ISNC 2R3VA 4W4MA 3KWMA 5H9FK 5DGBA 3AJDA 4DX5A 5KFKA 2B7CB 3KHGA 4QOTA 5CYQA 2ZH6A 1HHTP 3CMES 8ATCB 4WFYA 1X9WA 2UUTA 3QO9B 2HQIA 4RLEA 5HANA 5KG0A 2HW3A 3M8QB 1RHMB 1XJWB 1Y5NB 1I1GA 1JLCB 2AEMA 3PNIA 4CRJA 2MXYA 2Z0GA 4ECZA 1SJ4P 4KPCA 4OHZA 3OFEA 1B0TA 4XPCA 4KO0B 1WF2A 3HHLA 4HYKA 2YX1A 2O5DA 5J2PB 4GO5X 2R7UA 4U96A 3V6DB 4H4MB 1SKUB 4IH7A 3OPKA 2AEJA 5KG7A 3R6GB 4CO4A 5GAEU 2J6UA 5DDRC 1W25A 1RWUA 2DGVA 5IQ6A 5K14A 4BCAA 4QIEA 4OYOA 2FJXA 1WDDA 2ZOGA 2Q3PA 5G0RB 4LIWA 4DR3J 4I67A 4QIVA 5J2MB 2MQQA 4JYAJ 1RHQB 4DV2F 2LXUA 1N5SA 2QLXA 3VR1A 3RB6A 1IWGA 2P9GA 2AJ4A 3RAXA 1V5IB 2WTFA 4O3NA 4CO5A 3HCXA 5J2QB 4CH1A 1VQ6S 4PG4A 2BA9A 1KHVA 2CNNB 2IC3A 1JLQB 1ACMB 3A8JA 4DPXA 3HZGA 4EUVA 2JC1A 3PW7A 1YHQS 3IGVA 3ENQA 2HHPA 4NYPA 3NS5A 4ED8A 5EWGA 1IBKJ 5HMYA 3FCVA 3V2UC 2BE2A 2CQ2A 3N28A 2CZ4A 2R42A 3ZZZA 3TP2A 3Q2TC 1S1WB 3GLJA 2H5EA 3EVMA 3BR8A 4IDKB 5IT4A 3UN2A 3EMTA 2HKEA 2CQDA 2YKQA 3LPYA 3A3NB 2EI5A 1FCAA 2G2OA 2HBRB 2BE7D 4OI0A 2VPXB 2G9OA 2ZOMA 3NXZA 3F44A 5F41A 4A8MP 2PD1A 3K8WA 2FB0A 4BLGA 5ETKA 4L75A 5J2QA 4KPYA 5LT5A 3I0RA 3DDNA 2W9BB 4U7UD 1MROA 4DPTA 2DR7A 3E01A 2D1CA 3KXDA 3N6LA 1MWQA 2KYXA 3W1YC 1TFYA 1FNMA 4EWTA 2B8PA 1SVDA 4L3KA 5F8GA 4F25A 2RVJA 1PBAA 1XBWA 1WUUA 2FGCA 2GIRA 4JI5J 2CKWA 2QLJB 3FZBA 3THTA 1U6ZA 3H4BA 1NKBA 2OPPB 4MYUA 3KKFA 4RW9B 2VG6B 3B82A 3GJSB 1YJVA 1HWKA 1RWPB 4CQ1A 2XYPB 4U95A 8RUCA 2R8KA 2EKNA 4F4WA 4YEAA 2HHVA 4QWEA 2GJIA 3OXGA 4EBDA 1YQHA 1HBOA 4RJVA 3T19A 4RZRA 3HM9A 2IMWP 1EKSA 4J9NA 1JLFB 5KG3A 3Q86A 4PXEA 1C2PA 5L38A 1PIEA 4ZN1A 4YQWA 3G6VA 1QTMA 1Q8LA 5ETRA 4P73A 1FRHA 3ENVA 1ZAWA 2CPIA 2YX4A 2GVDB 2ZOFA 5A8WB 3LGHA 4Y3CA 2H9ZA 2ZJQQ 2CQBA 4Y2IA 1Y0HA 3CO9A 3BM7A 3G8QA 3ZZUA 4RBTA 4F4AA 5KFDA 3ZFVA 2KM8B 4DV4F 2DO4A 1NMEB 4ANDA 3TZYA 1XWLA 1PSDA 2H51B 2V2ZA 1SL2A 2B5JA 2CJYB 5DDPC 1V6HA 2VB6A 5HLFA 5KFFA 1K44A 2RAQA 3P8BB 4NLPA 4OYZA 5EHHA 3RB3A 2DEIA 1YI2S 3HO1A 4IQXA 3QFWA 5L8RC 4EBEA 4X4VA 3M9NB 2HNDA 2BQ3A 3RRGA 5KAKA 2OGUA 5LJ3Y 3IG1A 2DNNA 2VFSA 1HWLA 4C3LA 4O3SA 2HG4A 3EZ5A 4DR2F 2FLLA 4KTQA 4ZHRA 1TQLA 1VQPS 4NA1A 4WFNQ 4P6QA 2RQCA 5CYMA 5HAOA 1JKHB 2CQ4A 2IM3A 4R25A 2IHR1 4KT0C 7FDRA 3G6XA 4XK8C 2JEGA 3ISND 4HHJA 4W90B 4PUOA 3VQTA 2KFZA 5C24B 4Q0BA 4B3MF 4B9LA 3VV2B 1QE1B 2JNJA 2MSSA 3OHAA 1XMOF 3B4DA 4WIIA 3PYEA 2GIFA 4KHMA 4Y00A 5J2NB 1R0BG 3MCSA 3CB4A 1KHWA 2FJAB 3MUVP 3A8IA 1RCXB 2RH3A 3O1LA 4OYBA 3DOKA 4LRCA 4P10A 5KG4A 1U4BA 3C3LA 2KFYA 4I6AA 2ZBIA 3T1HF 3ITHB 3FRZA 3PRDA 1S6PB 2HK3A 5FDLA 3E51A 2G13A 3LUYA 3TVKA 1OJ4A 1JXLA 2RT3A 4OHVA 3RUBL 4GKJJ 3ZNUA 3W2VB 3Q8SB 4EEYA 2LQJA 3X3UA 2KYZA 1ULRA 5J1EB 1N4LA 2ZBRA 3MM5B 4RW6B 4EYIB 1RAIB 4HKQA 1T9UA 5LMUF 4F7VA 4B3SF 2YKMB 1GX5A 2ZM6J 2AYBA 5SZTA 3GV5B 4TXSA 4ERDA 2R7XA 1N52B 4JI3F 3MTJA 3WIUA 2OHDA 2PA8D 2VONA 2K3KA 1ZBTA 2QT7A 3D66A 4P2FA 1F9EB 2DXDA 4F0MA 5DLFA 4MKYA 1T8EA 4LF4J 2AYGA 2DNRA 1RAOA 2WB1D 2ADBA 3VAHA 3PZPA 1VC6A 3ITHA 2BMBA 2RDIA 2YPYA 3CCMS 2MQOA 4JOUA 4IDKA 2RMLA 3DYAA 1REVB 2RSQA 1Q53A 3AFGA 4X84A 3PXGa 4ECVA 3TNVA 1LV5A 3KMQA 3WIVA 3UDEA 1WG4A 2VDHA 4F4XA 4KAIA 3KUEA 1X4CA 1KQKA 3OUYB 4DPUA 1NEEA 2IYGA 2C3MA 2QO3A 4KQZA 3E01B 4FZVA 2GC8A 5GAHI 4LSZB 3HT0A 1DJ0A 3IWLA 2IVYA 2ABYA 2CWKA 3IBCB 2RJZA 3MPYA 2YWKA 3POTB 4KGKA 3OBIA 2BANA 5I3UA 2DNPA 1JLAA 4HI2A 2CZVC 3KLIB 5KOXA 5KG2A 2A6MA 3HD2A 4YR3A 2AYEA 2FJBB 4EGLA 4YMEA 1QSSA 2GV1A 3K57A 2UVVA 4X64J 3O44A 2KXHA 4HLBA 3PX0A 3LWLA 4DSLA 3L09A 3QMQA 1BQNA 3DOLB 1VBZA 5EGYA 1RT4B 1TUVA 4P75A 5JVHQ 1VDHA 3HK2A 3TJ9A 3C19A 2LQ5A 1SJQA 1WC4A 1N0VC 2H1YA 2XI3A 1WTBA 2HLTA 2ZH7A 1UVNA 1A9NB 3G8SA 2XG8A 3H40A 2AW0A 3IA0A 2MGZB 1Z2LA 3NMRA 2D7SA 2WHOA 1D8YA 4NWBA 5D4PA 3NOGA 2BANB 5I3UB 3TAPA 3AOCA 1V9OA 2ROGA 2MY8A 1FDDA 1PKUA 4CH0S 2C3PA 4ZHRB 5ETSA 2QMXA 5AXNA 1KVJA 3DLEA 3BS9A 5GMKa 2JSXA 1S9EB 5E3CA 4CTAB 2U1AA 1JLGA 4Q7AA 1V3SA 2BEFA 1RBLA 4JBCA 4C3MA 3IN5A 4K4TA 4B3TF 1S0VA 3JSRA 3TJ8A 1FF2A 4QCLA 1WC1A 4ID5B 5LXYA 2NXJA 3T41A 5B7WA 4N56A 2BDPA 1KLMB 2MZTA 5T14A 1F5BA 3PYDA 3IM9A 4KKOB 2DKOB 2H5JB 1FFWB 1R0CB 4LF2A 5HL7Q 5D3GB 1NJIT 2UUCJ 1HNWF 1RT2B 2HZAA 2J0XA 3IG1B 1NHUA 2XQCA 1TAUA 2V8DA 2RB7A 1WEZA 3RRHA 2XB2D 2YNIA 4WP3A 3V81B 3WHIA 1SJ3P 3W66A 4OJ1A 2OSQA 5T7LA 1NO8A 2C22A 1N48A 4IH6A 1IR1A 4YR2A 2C2EA 1U45A 4ECYA 1SPBP 4PWDB 3DRXA 4RW6A 3NGKA 4KO0A 2VJVA 1VRTA 5LMUJ 3H5XA 4A47A 1U2FA 4KSEB 3VAIA 2WRMA 4DN0A 4WKYA 4NI2A 3MM8B 3ZTPA 4A8WA 2CDRB 1U6BA 3DOKB 2MKHA 3MURP 4LSNA 2AEFA 3W9IA 4PQAA 4P7VA 3AH6A 4JP8A 3BQ0A 1AFJA 1FRKA 5KT4A 1H2VZ 3G87A 3MM9B 5CZVA 1HWIA 2YWHA 3AAWB 1H6KX 1Y9OA 2DGSA 2PE8A 4PZVA 1DTTA 4WXWA 2DCLA 2O67A 1YJRA 3KDNA 1CS4A 1RWKB 5ETQA 5T7LB 4WFAQ 3E2EA 2QA1A 2MKYA 3BGRA 3DMJA 1RT3B 4PWDA 2PEHA 5CCMA 2X3DA 3SFGA 4LQ3A 3OSPA 4MFBB 2DNQA 3KJVA 1KWMA 4YB5A 1SJFA 5I3PA 3HPOA 3V6KA 2RUSA 4LRFA 2YNGA 5KFWA 2FLOA 3MFHA 2WAQD 2CADA 5HSPA 2NREA 5B0EA 4CO3A 1CJTA 2AX1A 4Z37A 5D0HA 4ZJOA 1CC7A 3AXKA 1LW0A 2FZGB 5KG5A 2EBGA 3N5FA 3MM9A 5CYJA 2B0GA 1TUGB 1IKXB 3R2CJ 4KB7A 4OYXA 3TZXA 3C15B 4NLRA 3SSQA 1T9TA 2VQFF 2UU9J 2Y0BB 2HNZA 5F3TA 4DFJA 3C2PA 1S0NA 1M1GA 2J8SA 4QR1A 1OMSA 2HMIA 2MHEA 1NH7A 2B9XA 4PRFA 1SI9A 2KG1A 2GHWA 2C28A 4FPIA 2RHSB 2YXLA 3BBCA 3V6JA 1HYSB 1N5YB 1Y7PA 2W2QP 1VBKA 2K3IA 3IM8A 1FFSB 4USJC 4RU9A 1UFLA 3GFZA 1TKZA 1LXJA 1S9EA 3ILIA 3RBZA 4CTAA 4JV2A 1U49A 4IH5A 3NBPA 3QIDA 1BXNA 2V4JA 3DRRA 1S1XB 2HQ3A 5MLCV 4I7FB 2M8DB 4A4JA 3HSGA 4UQGA 1NSPA 4R0EA 4IG0A 2CVIA 2HQGA 3P6YC 4P72A 3ICLA 1FK9B 5LXRA 1S49A 4AT1B 4DL6A 4LR9A 2D3OR 3NNHA 5J1NA 1M5HA 3FBEA 1IKVB 4PQUB 4E98A 3FQLA 2BVZA 2QA2A 3MMCA 4NXNJ 4IOCQ 1LKZA 2XMJA 5CAAA 4FYDA 4ANCA 3K5NA 1UVKA 2LXFA 3FZ2A 1YX2A 4DSEA 3DLEB 3ZC4A 2GIQA 1G3OA 3QZ8A 4MT1A 5D4OA 2Z4PA 1VK3A 3M32B 2BKPA 3FGVA 3GYGA 3M6UA 2E7VA 4HHUA 4QWBA 1PAEX 3V6DA 4DFKA 2BJ3A 2ZZNA 1ZZFA 2ZITA 1UPPA 3K2YA 2YH0A 1H3DA 2B6AB 1KONA 4KKOA 2IRXA 3TO8A 2I5JB 2V94A 4ZVOB 2KM8C 3UVJB 1LW2A 2KZMA 3DKDA 4ZN3A 5C7PA 3QGGA 3W8GA 2BKNA 3MECA 2LP4A 3HZEA 2LKZA 3HX9A 1SB6A 3KLHB 3N5BA 2IVMA 3DHXA 3QFHA 1HARA 3BSNA 4AXJA 3ISZA 1I3OB 3OXFA 4DV3F 2IIHA 2ERRA 2KXNB 4K50A 4DCPB 4PYAA 5M2PA 1IKWA 1WOPA 2LYVA 4N77A 4LRAA 1U02A 3H2VE 1N5TA 3UCUP 1HNZF 3Q24A 2OPQB 2NSBA 3H2LA 3P4UB 1AA1B 1FWKA 1NPRA 4OZ3A 4UUWA 5F0WA 3ZO7A 2VQEF 1GAOA 4OZ1A 4ZP8A 3R5BA 4USTA 4MIAA 1EARA 4J5OA 3CC4S 5J2NA 2HNDB 2XHCA 3U27A 4DX6A 1HNXJ 3TAQA 4JI7J 2M88A 2A2CA 1FDAA 2IRYA 4ED4A 4QWDA 2XNRA 2F4FA 4B9VA 2O3DA 4P2MA 2AV5A 3GG0A 1HWUA 1C1BB 3SDEB 3TZWA 4YDDB 3PKYA 4B3RF 1OSCA 3M05A 4LBIA 2IA0A 4OHWA 4DL7A 3CPWR 2B56A 3TRGA 4PPDA 3C14B 3FSYA 1YBAA 2ZEJA 2YKOA 3HFZB 2RE1A 4OJHA 3TVYA 3UN3A 2AJ0A 5F9LA 2HGMA 2HVZA 2MZRA 4DQSA 2DR6A 3M1VA 1WEXA 1FKOA 1EJ7L 4PWWA 5B0GA 2ASLA 1UPMB 2ZUAA 2E5LJ 4ZVEA 2BJDA 4OX6A 3O6QA 2ZHOA 3VZHA 1SC6A 4B3MJ 2VICA 1HKAA 1XTZA 2Y1RI 2C2OB 3H5SA 2W4PA 4Y28C 3TA0A 4YY3J 1U6FA 2BW7A 2DHAA 3OTOF 1U0SA 5HATA 1VQ5S 4JI5F 2PDAA 1SH3A 4DR1F 4XAKA 2N82B 3EE3A 2B4PA 3MAAA 4P2XA 2C3UA 3KG1A 5THWA 4BWJA 2D3UA 4YB6A 5JMNA 5KFNA 4NXMF 4NEZA 3PIOQ 4DDFA 1S1XA 1FDNA 1E6YA 3FCHA 3HLUA 4ZIVA 5GADI 1YJNS 4F8RA 3D6TB 2UUAF 2MTLA 1DQ9A 3RW7A 1KKHA 3EGWB 1N6QB 1O5JA 2LU2A 1QAIA 1D3WA 2PC6A 4B02A 1RWOB 5D6GA 1KBRA 3BN4A 3QAEA 5HQLA 4I6YA 4C8LA 1X5PA 1U0HB 1RHKB 4JV0A 3AQPA 2DTJA 4QR2A 2XC9A 1R8PA 3C6UB 1WKKA 4WF9Q 3BQ2A 3PW2A 1TR0A 3GB0A 3UN5A 2E9ZA 2DGXA 3ILJA 3NCPA 4NE9C 3SV3A 3VVTA 1LK5A 1LWCB 2CXEA 2W9CB 1WI8A 2HQDA 2M7SA 2YBVA 3H7HB 4EU0A 3KK1B 4DF8A 4KFBA 2MYFA 1VQ4S 5C42B 2FJVA 3QSIA 1VQLS 4Y34A 2NPFA 3M2VB 4M5MA 3FNNA 2OMLA 2DB1A 3D2WA 3QYYA 2EFOA 3OQ2A 2X1FA 4KV8B 1YJTA 2DGOA 3H90A 5HQMA 5GVQA 4X62J 2NR0A 3O2IA 1KVIA 2JDJA 2F8HA 3HKZD 1R8BA 3O3LA 1WF0A 4NMXA 3BSOA 3MPDA 3G6YA 1DAXA 2HPUA 3BKUA 4C8KA 2EPIA 5HBMB 4OQJA 4DV2J 4CZCA 4MK8A 5D4NA 4EZ6A 1FRJA 2KU7A 1GEHA 1IWAA 2EWHA 3FEXB 4K59A 4H4KC 3JXOA 4QIWD 3HSZA 3H20A 1X4DA 4URSA 4O3PA 5JXSA 3WBZA 3M32A 1HNVB 1MU2A 4YFUA 4DV7F 2HHQA 3W62A 2HGNA 2PN6A 5CXTA 1RHUB 3SI8A 2DXEA 1H74A 4WE1B 4QIFA 2OEJA 4WZMA 4YS2A 1KLMA 1L5UA 1VI7A 1CBKA 2UU9F 5CH7B 2HFZA 5GAGU 1S7IA 3A3PB 2HVIA 1TU0B 1YKWA 2C2RA 2MQ8A 1R7IA 1U2RA 4B08A 4X4UA 1WACA 3NY0A 3OFFA 3KLHA 3KNGA 3I0SB 4CCHA 1DQ8A 4XTTA 2HVEA 4KJIA 1NBEB 2HRUA 1K1QA 2DPJA 1U1NA 4TU7A 1EKRA 4C48A 3QGHA 2N3OA 2VOPA 1GMUA 4HACB 1UA0A 4L76A 3BGUA 3FC9A 2ACYA 1AXQA 2MJUA 4PCQA 3ZXWA 4I2PA 1B7FA 2JFDA 1EQMA 1RJJA 4CWBA 2EG1A 5AXLA 1WHVA 3IWNC 5A6PA 3GCWP 1GH8A 1C0UB 3KHHA 3DLJA 5HMZA 1JNZB 1RT5A 1XNRJ 1R43A 4IUFA 1TL3B 2MZJA 2V6AA 1OYDA 5LSRA 4G3IA 3I0SA 5D15A 1KOOA 3H8YA 3BGLA 2XO7A 3VWSA 2R7RA 1F2HA 4X66F 2WCXA 2UV8A 4A46A 3HHLC 1W2BR 5K8NA 1BHNA 3ET6B 3Q8VA 5C25A 1KP6A 1RISA 3UDVA 1X0PA 1RQ0A 1SQGA 2GA7A 3FJ2A 4ECTA 1YJUA 3R5DA 3KLGA 5CCLA 3DXBA 1JLQA 2B43A 4RR5A 1VBYA 4DR4F 3AOBA 2MQPA 4B3OB 1XK8A 3VGSA 2XO6A 4DFPA 2BJEA 5K8PA 1FWPA 1RGVA 3DDKA 3PX6A 3EUNA 1HMVB 4NCBA 2ZH9A 2BABA 3KLVA 1MLAA 1RDRA 1RT6A 4DSFA 3AODA 4N76A 2Y8YA 4P2SA 5GMEA 1DLOA 3DRPA 2VBXA 1NK7A 1G7CB 2IJFA 4NLWA 5AE1A 2W9CA 2C2ZB 3MAAB 1XMBA 1Q8BA 1RT4A 3ADAC 2IJNA 1A0OB 3DMJB 1UEUA 2VZ9A 5D0EA 1Q78A 3SQGA 3I55S 3HDSA 2DNYA 3RBEA 2C2KB 2VDIA 2YKNB 3W9JA 3TYTA 1KFDA 3RU0A 2KJWA 2OFGX 2KB2A 5DM6Q 2OP5A 2ZDPA 1YZ7A 2MKKA 3D6HB 2FY8A 1WELA 2H3EB 3TUZC 2KN4A 4WFZA 2X51A 2VD3A 3I31A 2CG8A 3KLEA 1B70B 1QVFR 3C6UA 1O0PA 1FD8A 3CCLS 5D8HB 2XYHB 2AJFE 3F56A 4NMLA 4F2RA 2XWYA 2NPIA 3P5BP 4K4VA 3MM6A 1LWCA 3CJRA 4DSKA 3NBPB 1F3VA 3BDPA 1MG7A 1U1LA 5KFUA 4PWUA 2F63A 4I64A 1I6JA 4LIRA 1SL1A 3M7VA 3SQGB 1WD6A 2F8EX 3RRKA 5DLGA 2OIHA 4FF2A 5E3QA 1EX8A 1I94J 4UOGA 1VCTA 2JVRA 5D78A 5D3GA 1N0UA 2KFNA 3GMGA 2VG5B 1U1PA 1EETB 1RT2A 1FRXA 1TL7A 3SSRA 4PAAA 2WW8A 2HK2A 2W2OP 3E8OA 5IT9Y 4Z7YA 2XCAA 3CDEA 1RU2A 2LDYA 4CM2A 4DCOB 1RAAB 3G82B 2XLIA 1RUSA 4CLYA 3KLFB 3EPGA 2FZCB 3DU5A 4KGVB 2BRLA 5K9FA 1VJWA 5I42A 4IG0B 1LQ9A 2O01C 2EC0A 3NS7B 5ETMA 1I51B 2WVCA 1LWEA 2BJ1A 2Z2ZA 1HQ2A 1FKAF 3HJFA 1WC6A 3EJMA 3LA0A 5A8KB 5G4DA 1IBCB 4IRCA 5KT3A 4U7CA 4F4KA 2DITA 1KVKA 1LWFB 1YVFA 2E1AA 4OZ5A 1Q4RA 4O0IA 4AD6A 4HACA 1S1TB 3AY0A 4X4PA 2W2PP 3QT6A 1IKWB 1UMJA 1C1CA 2A3JA 2FJDB 3UWTA 4LVOP 2DR9A 2K1RB 2NLWA 2MKJA 4X4RA 5A2QU 1RTIB 4JI3J 3KUHA 3CJ3A 1RK8A 3W2WA 2GX8A 2XWXA 4K0KF 3OTDA 4DV1J 5B0BA 1IVZA 3OT9A 5AJ3J 3TW0A 4ZCMA 1RTJA 4FYWB 1PBUA 1R6YA 5AT1B 3Q89A 4F0HA 3QAUA 4DR1J 3L7UA 1FXRA 1UZDA 2EFNA 4O3OA 1XNRF 4YOEA 4IKAA 1DY3A 4Q2MA 4H54A 1N54B 2WVBA 1PO6A 1RADB 5DO2A 2XY6A 3B6BA 1ICEB 1NAQA 2ZC4A 4NOHA 2W9AA 1I5OB 1L3TA 1HD0A 1WNEA 1P9QC 1OY6A 3MPUB 3SEOA 2ZD1A 1A7GE 2EFGA 3A12A 3AB2B 3G2XA 3MM5A 5LL6d 3H2UB 2RKIA 3IC1A 3RZAA 1HQUA 3HFVA 3T5KA 4CNZA 1UL3A 5HP1B 2CPDA 3VAMA 1KQFB 3MMBA 4LT6A 4F4YA 1LK7A 5A76A 4NPOA 1HYSA 3AHPA 5SUHA 2F40A 4CLTA 3ZTSA 1NK0A 3PW5A 4OI6A 3W5XA 2J9EA 4CYUA 1UAWA 1KNZA 4JI7F 1TFWA 4YHHJ 3MHYA 4DWIA 1P8GA 4DV0J 4LRDA 2E7WA 4JI1J 3FDSA 1VQNS 1RWVB 4MK9A 4NA2A 1K9MT 1OYEA 2PFDA 3CD7A 3FEZA 3TEGA 5HROB 2YKNA 4FDFA 2PEBA 4CLZA 1K1SA 3IP0A 4ED2A 3IS9B 1VQSA 2QL9B 1RCOB 2ZWPA 3I5CA 3I9V9 2RDDA 4S0MA 5FIIA 1TL7B 4F0KA 5HVHA 3FKBA 4K2JA 5HJXA 3EICA 1M1KT 3HHNB 2UZAA 4G1QB 2ZZTA 1IKYB 1NDPA 2IM0A 4WP8A 4JI0F 1H98A 4N8OA 2GVZB 4IG3A 1NK4A 1ITPA 2FYXA 1UEVA 4RW7A 2N4CA 3OSNA 5AXKA 2ZHBA 3QJJA 1LWXA 2ZC3A 2BM1A 1D9AA 1URRA 1ZM3A 2DT9A 1P1TA 1N6QA 1X7VA 3V4IB 1HI1A 2HFSA 2CQ3A 4KV8A 2VPYB 3R5JB 3DLKB 1N8RT 1RWNB 3NKYA 3M8PB 3M2UB 2Y8WA 2KT2A 2MLYA 1EETA 2W7OA 2ZJPQ 3MPWA 2P9CA 4DUZF 2QL7B 3PRBA 4JI2F 1RYSA 2VG6A 2LQ9A 1H72C 3OL9A 1S7HA 4LSLB 3DDIA 4MMOA 3VHQA 4B3RJ 1ZAXA 2VPZB 3MGJA 2Z56B 2KH9A 1N36J 2ZHAA 2QSWA 2GVZA 4LF5J 1QJHA 2J8AA 4EO6A 1T3NA 3QRPA 3T5HA 4RW7B 2ZNYA 3O5TB 3FK4A 4C7QA 3M8RA 1RKJA 1R0AA 1NSKL 2RQKA 3HSDA 1ROFA 4P52A 1SV5B 4A8SA 3T3FA 1SKRA 1XNQJ 3D0GE 2XS5A 1N32F 3C66A 5KFAA 5E5NA 1HPZA 5KOWA 2HFUA 4C8NA 3U1NA 2GQQA 3OVSA 3G8TA 3M8PA 3GFYA 2E44A 2V68A 3MOJB 2OI2A 2OPRA 3DOMB 4DXLA 1FRLA 3PEJA 1RB0A 2YKPA 2LQBA 3MM7A 2BW2A 1NH8A 3J7Z5 1U1MA 3ILOA 4DPYA 3T1HJ 2GQCA 1FE4A 3T9NA 4CH7A 3UR0A 3LP2A 4R8UB 3OFHA 1LOUA 2D9PA 3S6EA 1REGX 2VFRA 5AXMA 4C0BA 1FDBA 3OHBA 1GX6A 1WEYA 3SIPB 4NA3A 3R5AA 3GP9A 2C2NA 4RWXA 4RNNA 3EZUA 1FKOB 3GONA 4QWAA 1CLFA 4BC9A 4LSNB 4M8LA 3N0VA 4L74A 4FXWA 5E3RA 2AMCB 3SQOP 4ZVGA 4DPOA 2QFJA 3BGFA 1VRUA 1M1HA 3BGOP 4ZPVR 1TKTB 2DYAA 1IBLF 1RT5B 1ZM2A 1ZH5A 2XMVA 5F9NA 2KHDA 2J6SA 2HHHJ 2F3JA 3F73A 4M5GA 4MH8A 5EUHA 3QZ7A 4UY85 4OHXA 3UR3C 4ILLA 4PUOB 1SUQA 2HS4A 2ZD1B 2M3DA 2HEKA 4F26A 2QG9B 3J81j 1RA7A 1B3TA 1WWHA 2R2SA 5C25B 1Q7LB 3QGPA 3TZZA 5K8MA 1NDLA 2NZ4A 3D1OA 2KKHA 1IXKA 2CPZA 2GMHA 2IVFB 3TQEA 3WZ0A 4ILMA 4WKRA 1U25A 3IS9A 2B9EA 1F0XA 4OJ3A 2BX6A 4NLQA 3PIPQ 1YGYA 4PG5A 4A8FA 2LLZA 1HBNB 2RHQB 4GO7X 3TI0A 2OPPA 3FMBA 1D9FA 4I56A 1QLNA 1S6PA 1MMLA 2OH2A 4C9DA 3HVTB 3CE8A 3CSKA 1IKXA 3DC2A 3CW2C 1CQNA 5FJ4A 4J9QA 2V5HG 4WP9A 1ZPVA 4RBUA 5M2UA 3I0RB 4DV6J 1RA6A 1P9YA 3GE9A 1U1QA 5KT5A 4O0NA 2VL1A 3QJLA 4KRWA 4C0OC 2MQNA 3D6MB 2FVRA 2RILA 3J80U 2GMLA 5E0OA 1KS2A 2V2KA 4O23A 4NRTA 4IRDA 3HT3A 1HL6A 4DCJB 2W4CA 2L41A 1R31A 1R8CA 3H5UA 3LP1B 2HRYA 4U8VA 3HVRA 4AL5A 2DNZA 2KRBA 3KJQB 4J9PA 2GNKA 1X0FA 2YPZA 3F41A 3TEHB 2QEXS 2LFVA 5EWEA 2ASDA 2QN6B 5A8RB 2X7IA 1CULB 4TU9A 4Q8EA 5C5JA 2E1CA 1RYRA 4K0KJ 2EFPA 3DI6A 1PCAA 3T1AA 5D0RA 4DR6J 1HBMB 3AB4B 4NLXA 3VGUA 2DJWA 1IKVA 2CNKB 4FXVA 3THVA 3J80Y 2K7JA 4UTGA 5F0UA 4DS4A 4JI4F 4MKVA 2RRNA 2CQPA 4ZPDA 5L9XA 5KFIA 4EI2A 1RAJA 3HSJA 1TV6B 4NEYA 3TA1A 3ZTOA 3MCNA 3OLBA 5B0CA 3OJUA 1FX4A 4AQYJ 1URNA 2XSJB 2QMUB 3I5BA 3G86A 2I8EA 1APSA 1VQMS 1IUJA 5B0DA 3GR0A 1AYEA 4NX9A 5B0AA 4I69A 2XMAA 2DRDA 3OV7A 2BQRA 3PR5B 1X9SA 2DPIA 3BZQA 2MLXA 1Q1KA 1IBKF 1YIJS 4G65A 1Y5IB 3T6JA 2KZZA 4IFYA 2V9WA 2XCPA 2NXEA 1R0AB 4YB1P 1HPZB 2JLFA 5CZXA 2CQHA 5IQQA 2Y1IA 1L3KA 1NM2A 1NK6A 3ZZOA 2VG5A 4U6PA 3KJNB 3QO9A 1RTZA 2V8VA 3PJWA 4XDCA 1XERA 3X1LB 3K89A 3M9OB 2J6TA 2P6TA 1WKLA 2Q1LA 1ZTWA 2EKYA 2FHMA 1N33J 3HHLB 1NUEA 4R8UA 2IFXA 1VOMA 4JUZA 3BJYA 2WSEC 2MQLA 1VQ8S 1RHRB 1S1TA 3KLFA 2B51A 2G4BA 3KNAA 3IMQJ 4ZLPA 1RTHA 2YQ0A 5U47A 4K4WA 3CVKA 4MIBA 4MAKA 1FJCA 3HD1A 2L48A 4NASA 2DR8A 2I1RA 4FNHA 4P74A 5KFLA 4ES2A 2VC1A 4DV0F 1Q8IA 2UXBJ 1CPZA 2HSEB 1UETA 3W9HA 1KRPA 1TL4A 4NLVA 2YTCA 3R8YA 2Q6CA 2CQCA 1TUWA 3CDWA 1JQGA 4HH0A 4KE5A 4DV4J 1DHMA 3JS9A 4QPXA 1M5OC 3HHLD 4CT8A 3T6BA 4RBVA 4CLLA 2KL8A 2RQ4A 4K2XA 2ZBPA 4B9TA 4ELVA 1S1UB 5F8NA 3JYTA 1RABB 2ALYB 2QTWA 2DH8A 3BF4A 4J9KA 3GSDA 4I68A 1NK5A 4LJMA 4NCAA 4FF3A 4NZ7A 3W5ZA 3QT8A 3HMJG 4P71A 2XLKA 3BR9A 2IDEA 2CPFA 3JB9k 1TKXB 1KDNA 3DRSB 5DQIA 5LOQA 4AL7A 4PXDA 3LGNA 1RTHB 3M1VB 2V69A 3T1YJ 1O6XA 3FEYB 3HJVA 2EVZA 4ICLA 2E1MC 3POTA 3M8ZA 3NWRA 2YY3A 4NI2B 2VASA 3DLGB 3IFEA 2MZQA 3IBFB 5DZ6A 3UE2A 1ZA1B 2QYGA 4GC7A 4A8OA 3Q22A 1WG1A 2D41A 3HKWA 1YK9A 4I2QA 3PTWA 4DZDA 3CULA 5J1PA 2DY1A 1KOHA 3BBFA 3ONQA 3D0IE 2YVSA 3MM6B 4G1PA 4J37A 4CYUB 1NB2A 5BR8F 2CVEA 3H59A 2GQ2A 2QRRA 5B0FA 2ZKUA 2J0WA 3IWXA 3MD3A 2PFFB 3Q83A 1Y4ZB 2CQGA 2KRRA 5ETPA 2F4VF 3CC7S 4C11A 1S5ZA 2G1DA 2JOQA 1H73A 2N3LA 3HF5A 3NG8A 5IT0A 3F0NA 1HIYA 3D3CJ 4ZVHA 4QW8A 2ASJA 3HHDA 2R7OA 3NOCA 2SXLA 3K58A 3OR1A 4DBQA 3MWBA 1YJ7A 4LREA 4LBHA 2X3GA 3VZIA 2HIYA
chains in the Genus database with same CATH topology
3NL0A 2POKA 4ETXA 3RR7A 2C3OA 1MW7A 4HT5A 3CT9A 3D5MA 5L1KA 1VC5A 3ETOA 3MI7X 4M63A 4Y2KA 1ZETA 4HH1A 3EGNA 3SMZA 5I4MA 2MGZA 5HROA 2FHKA 1TP7A 2YNFB 2Q43A 3MZIA 3OLAA 4U67Q 4KHPF 1QY7A 4RKUC 5A0YB 5HBMA 1X4EA 3N9UC 4OZJA 1S48A 1VQKS 3PVXA 1QSLA 4C4WA 5KFRA 5DETA 2P9EA 4OLPA 4RW8B 4FXDA 1JLEA 1X4FA 2RD5C 3D54A 1JJ2R 2DR5A 1MU2B 4DQIA 1IN0A 2COLA 3MF5A 3OL6A 2AGQA 3NNCA 1D1UA 4ITSA 4OJGA 5L1JA 2AD9A 3UW1A 2J0SD 1J5OA 2Q66A 1VIXA 2HYIB 2UXBF 1UJ5A 1Z2ZA 5KFCA 5E7OB 1G6BA 3R1LA 4B9MA 2JJ4D 3MMCB 3U7JA 4A48A 4AXIA 3KHLA 3K5LA 1G1XA 4WZQA 5KFBA 2M52A 2CQIA 4ZP6A 5JJBA 3JYTB 2HHXA 3K59A 4O3RA 3MM7B 1OWXA 1BY9A 4OV1A 2V9KA 1Y5LB 1RT3A 4DV1F 3KG4A 4UW2A 4C3KA 4DQPA 3CCZA 2FJEB 1PC5A 5CHCB 3U1LA 1FJEB 4LF8F 2QA4S 4I2PB 1AW0A 2DH9A 5EDWA 4YUDA 2OKQA 4ID8A 1UVJA 2CIMA 5L9NA 4B9NA 3PR4A 3MR2A 1JIHA 5DG8A 2F7VA 1G2EA 2OPRB 1X5OA 4TYBA 3US5A 5B09A 1JKHA 3M4XA 2WK4A 2VBWA 3MR6A 4AFFA 1DRZA 2I2YA 4C8YA 4Y2CA 1SIZA 5KG1A 3PY8A 2VG7B 5IM0B 3DLGA 3CC2S 4JV5F 1HW8A 1BGXT 1Q81T 3K5MA 2OTJS 4QU6A 3LAMA 4ZPCA 3M9MB 4HDGA 4QPTA 1BWEA 1VRUB 2WOMA 2J9CA 4YR0A 2OD6A 2XMTA 5J2MA 3I4HX 3MD1A 1FNXH 2YNHA 1N5VA 3E3XA 3GIKA 1UW4A 4H4KA 4NZ0A 4QBUA 4NLGA 4OFZA 5EX3A 4EYHB 2EK1A 2VKRA 4KBIA 3IRXA 3H4DA 2X1GA 2OSRA 2XMMA 1VFJA 4C8ZA 1S0MA 2VFUA 2CPXA 2P5VA 1TVRB 2DNHA 1OIAA 4MKBA 2G0CA 5K8OA 2X1AA 2ZH3A 3KLEB 3LP1A 1TKZB 1FVSA 1IQZA 3CIMA 2LMIA 3LQVA 5DDQC 3JAMY 3OVAA 4DL5A 1T7PA 1FERA 4DG1B 2J76E 5KFTA 3SCLE 3Q8QB 3DOLA 4ZCKA 2E5JA 3J7YI 1M5PC 1P1LA 3LALA 3N01A 1MROB 2YH1A 1U48A 2OJ3A 1U24A 3L3CA 4RNHA 2E7XA 1V3ZA 5A0YA 1HNIB 3MOZA 2JHEA 2KDOA 4ALZA 2EK6A 2OTLS 1NU4A 4DL4A 3KLIA 2U2FA 2ASYA 1WHWA 3GWCA 3N79A 2KI2A 2MPUA 4C98A 1FESA 5GAEI 3CCWA 3M8SA 1XNQF 2JFKA 1JLGB 1Q16B 3OR2A 4R5PA 1GTEA 2CYYA 1S9GA 2I9SA 3A1YG 3B4MA 1UVMA 3RBDA 5KFMA 1J5OB 3HVAA 5KT7A 4OX7A 5K14B 3B8HA 1NNDA