3C6UB

Crystal structure of hiv reverse transcriptase in complex with inhibitor 22
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
423
structure length
404
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 108
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB04
1MU2B 3IS9A 4PWDA 2XC9A 4ZVFA 3T5KA 5C42A 2YKNA 1JLCB 4ZMMA 5KG5A 3PW5A 3JYTA 4RNHA 4FS1A 4I7FA 3LP1B 2R2SA 3H5XA 2GC8A 1T3NA 5DLFA 5KFNA 4MIAA 4WE1A 2JC0A 2YNHA 4J9QA 1VRUA 3BQ0A 2HNZB 4ZVHA 5CYMA 5C5JA 5KT4A 2V4QA 2J6TA 4K4VA 3RBEA 4DL6A 1S0NA 3OHBA 2YNIA 1LWFA 2XGPA 3MEGA 3V6JA 4RW7B 3DOKB 1S1TA 3DI6B 4MK7A 3T5JA 3PVXA 3CIZA 3KLEA 3DRPB 4B3OB 3H2LA 4PQUA 1S6QA 4LSLA 4PWDB 3IS9B 4MK9A 1T05B 3KMQA 2CKWA 2FJWA 4PUOA 4WZMA 2UUWA 4DL4A 4WXOA 1WNEA 5KG3A 3DLGA 4QW8A 2ASDA 4I7FB 2E9TA 4R0EA 1LW2A 2YNHB 3MEDA 3NKYA 1VRUB 4KSEB 3PHEA 2WCXA 4ZPDA 3M9OB 4IR9A 2VA2A 3NMAA 3DOLA 3MEEA 5KT5A 3G6VA 3BJYA 2W9BB 2VG5A 4ED1A 4TLRA 2YNGB 4YQWA 2YNIB 1JX4A 5HP1A 3BSCA 5KFPA 4ECVA 1RT2A 2FVCA 1SUQA 3FQLA 5F8GA 4DL5A 4DL7A 1S1TB 2J6UA 5F8NA 2VG7B 3V6HA 1RYSA 5DG9A 5KFDA 4RUCA 3GIKA 3KLHB 1S6QB 4PQUB 4LSLB 4WFYA 2WONA 3E51A 4LQ9A 3IG1A 4PUOB 5L1LA 4K4UA 1VRTA 4Q44A 3DLGB 4IG0A 5DG7A 2HNYB 3MF5A 3BQ2A 3DDKA 1TKXB 1RTIB 4Y3CA 4KHRA 1S1VA 2BRLA 1C2PA 3CJ2A 1N5YA 3MEDB 5HBMB 3T19A 2XI3A 3CJ4A 1S0MA 2IA6A 4DEZA 5DQGA 4R5PA 3DOLB 2R8IA 5KFTA 4EEYA 2RF2A 3DLKA 4K4WA 3GIIA 2RDJA 4O3QA 5KT6A 3RAXA 4ICLA 4NYZA 1RT7B 1S49A 3M9NB 5EWEA 4U7CA 3Q8SB 4RNNA 3GIMA 5EWFA 4RU9A 4IFVA 1TV6B 4RW4A 3G86A 4K4ZA 3E01A 1RDRA 3NAHA 1QAIA 2IAJA 2WONB 4O3PA 3PR4A 3IG1B 3N6LA 4IG3A 2ALZA 1VRTB 2ASJA 3T5HA 5L1KA 1XR7A 3MECA 3QIPB 2JEIA 4ED7A 1JLAA 1S1VB 1CSJA 4O4RA 1N5YB 2HWIA 5FDLA 4R5PB 3NGDA 2WHOA 2RF2B 3DLKB 1TP7A 4KB7A 3MR6A 4EO6A 3BSOA 4ECSA 4EYHB 1SV5B 3SI8A 1HMVB 1BQNA 4H4MA 2W9AA 3UDLA 3PW4A 1IKWB 4RW8A 3C6UA 4WYWA 5HLFA 3H40A 3DLEB 2YKMB 4I2QA 1KLMA 4IFVB 4RW4B 3KLGA 3KK2B 3E01B 5D3GA 2XWYA 4NLYA 1DTTA 4TN2A 3KHHA 2IAJB 2I5JB 3DYAA 5JUMA 4IG3B 4KBIA 4YR0A 4NLWA 4JV2A 3MECB 2R8JA 2HNDB 2AGOA 4LQ3A 1JLCA 3CDUA 5DLGA 1JLAB 2IM3A 4YMEA 5KFCA 1QE1A 2W9CA 4TQRA 1S9FA 2B6AB 4KO0A 5FDLB 2OPSB 1GX5A 2XI2A 4G1QA 5KFHA 4QWAA 1JKHA 4QW9A 1RTHA 2UVRA 4HKQA 1C0TA 4EBCA 1BQNB 1C1CA 3TQ1A 3LAKA 4RW8B 5KFSA 1BQMA 1EETA 4ZP6A 5HLFB 3IGVA 5KFLA 1D0EA 3KLGB 4ED2A 4RUAA 4ECUA 1REVA 3DRSA 2W8KA 1TQLA 1DTTB 4NLVA 3UPFA 3OL7A 1RYRA 3DYAB 2OPQB 4Q8FA 2WOMB 3HHKA 3ITHA 3LALA 3RB4A 1T05A 2AGPA 1R0AB 3FFIA 2JLEA 2BQ3A 2BE2A 4IFYA 4TYBA 3D28A 3QGIA 2W9CB 4EBDA 1QE1B 2FLLA 5KFRA 2RKIA 4KO0B 4J9NA 2HAIA 5K14A 4ECRA 3OL8A 3CJ5A 4IR1A 4XPEA 4G1QB 4J9SA 3I5AA 2AWZA 4JV0A 5KFOA 1N48A 1JKHB 2BQUA 5F8JA 1RTHB 3H4BA 1C0TB 5KG0A 1C1CB 2GIRA 1TKTA 5DGAA 2ATLA 2W9BA 1BQMB 2YNGA 1EETB 1S48A 4WYLA 1N4LA 4KKOA 3H5UA 1D1UA 5L9XA 1GX6A 3LP0B 1REVB 3DRSB 4MK8A 4TYAA 2VG7A 4QPXA 4IH5A 2FJXA 3GIJA 3GQCA 3RB0A 4ZP7A 3KLHA 1HNIA 3ITHB 3VQSA 4KE5A 4RZRA 4TY8A 3CVKA 2OPRA 1SH0A 3FFIB 5KFXA 1U09A 2BE2B 3EZUA 4IFYB 4NRTA 3IRXA 3SFUA 2HNYA 2C28A 2RKIB 3ISNC 1TKXA 1RTIA 5K14B 4ECWA 4ED0A 2BANB 2ZE2B 2R2UA 1FKPB 3MTKA 4O3NA 3H4DA 5F8IA 5HBMA 1S4FA 1RTJA 3I5BA 1S1WA 4I2PB 4KHMA 3QZ8A 4YP3A 1DTQA 3KHGA 3KJVA 3V6DB 1TKTB 2OPPB 2WRMA 4KKOB 1RT7A 2HWHA 2R8KA 4FBTA 2BR0A 3QYYA 3M9MB 3DMJB 3I0SA 1TV6A 5KFFA 1HNIB 1KHWA 4ZPBA 3ISND 2CJQA 2OPRB 1HNVA 3BREA 4TY8B 2O5DA 3NL0A 4IRCA 3IRXB 5KFAA 3GV5B 4J9MA 2R2TA 3QIPA 3QGHA 4O44A 4MH8A 1T94A 2VA3A 3KHLA 2QV6A 5F9LA 5KFJA 1RTJB 3DM2B 1ZTTA 1S1WB 3I5CA 4MKAA 3OSPA 4NLUA 1S0OA 4IRDA 4NLTA 1DTQB 4URSA 4O3OA 3KJVB 3SFGA 4FBUA 1W25A 5KFMA 3BR9A 1YVFA 3HKWA 3H5YA 1JLEA 3QZ7A 1SV5A 2BQRA 3CJ3A 1HMVA 1K1QA 5F8HA 5EWGA 1IKWA 1HQEB 2ZD1A 3OLAA 3DLEA 3I0SB 3LAMA 2YKMA 3KK2A 1XR5A 3KK3A 3G6XA 1HNVB 2I5JA 5J2MB 1J5OA 4DL2A 1T03B 2XGQA 2HNDA 4URQU 4ZPCA 4O44B 1RAJA 5F9NA 1UWBB 4HYKA 3QGGA 5KG6A 4F4XA 2B6AA 4ECXA 5KFBA 2OPSA 3QLHA 1OS5A 3PJXA 5KG4A 4F4ZA 5T14A 4Y2AA 4Q8EA 3KNAA 4K50A 4MKBA 3PR5B 2QE5A 4ZHRA 1DLOB 5KFIA 5KG1A 2YNFB 1JLEB 4YR3A 1EP4B 4ED6A 2IJNA 1RT4B 2ZD1B 4ZP8A 3KLFA 5KT2A 4G3IA 3KK3B 4DL3A 5I42B 5DQIA 4ID5A 2OPQA 1J5OB 4K4TA 3GV7B 4F4WA 2WOMA 3OL6A 2W8LA 4F50A 3OL9A 1S9EA 2OH2A 1R0AA 5EUHA 4NLOA 4J9RA 3UR0A 2DPIA 3QO9A 2IM0A 5J2QB 4H4OA 3QLHB 4ZP9A 1IKYA 3PW2A 2D3UA 3CJ0A 4NLQA 4ZHRB 5KG2A 5JXSA 5KFWA 3N6NA 4KFBA 3MFHA 1S1UB 1TL3A 1NHVA 5KFKA 4MFBA 4ED8A 2RDIA 1NHUA 2JEFA 4O3SA 1LWCA 3NBPA 3OLBA 4Q43A 2BRKA 3KLFB 4ECQA 1N56A 4F4YA 3LP0A 2GIQA 1RT5B 2IC3A 4ID5B 2D7SA 1KHVA 3RB3A 4URGA 1S9GB 2AGQA 5DG8A 1S9EB 2FVRA 4ECYA 2HMIB 4RNMA 1HYSA 3QO9B 2AX1A 4MIBA 3RAQA 3GILA 4LSNB 1JLQA 3UQSA 4H4OB 4K4SA 1IKYB 2BANA 2ZE2A 1FKPA 4TQSA 5L1JA 2J6SA 1JLBB 1HPZB 3ICLA 2FLPA 5KFQA 3EPIA 3PZPA 4I2PA 4KFBB 3BGRA 5J2NA 1TL3B 1K1SA 4NLPA 1JLGA 4DG1B 4MFBB 3CDWA 3V6DA 3FQKA 4NLXA 5DQHA 4QWCA 1LWCB 4TY9A 2OPPA 3Q8PB 3NBPB 1ZETA 4EO8A 2IBKA 4WZQA 3GYNA 3DRRB 4JUZA 2FLNA 2C2EA 4IQXA 1TVRB 5F8LA 2AQ4A 2UVVA 3LANA 4ED3A 2IC3B 4H54A 3DMJA 1MMLA 4KV8B 4TXSA 3H5SA 5KG7A 2IJFA 4QWEA 5C25B 3KLVA 4Q45A 3LP2B 1HYSB 1RT3B 4J9PA 2R8HA 3M8QA 1JLQB 3TAMA 3HVWA 2C22A 4IH6A 3KMSA 1S1XA 4ECTA 2B5JB 2R8GA 1C0UB 1RA6A 1TL1B 3DM2A 1FK9B 3BGRB 5J2NB 1QUVA 1JLGB 3KK1A 3FSIA 5J2PA 2IMWP 4J9LA 5EDWA 5C24A 3T1AA 2FVQA 3C6TA 2XCPA 1I6JA 2DPJA 4Q0BA 3KOAA 1Z4UA 1HQEA 1TKZA 3GV8B 3RB6A 5C42B 2YKNB 3PJWA 3JYTB 4R8UA 2FVSA 2WTFA 2V4RA 2E9ZA 4IRKA 1QAJA 5J2MA 2W7OA 3BSAA 2ZKUA 2V0NA 4WE1B 1T03A 3M8QB 2JC1A 5KFZA 4ECZA 1SH3A 2IM1A 3PW0A 3TAMB 1UWBA 1S1XB 4WFXA 2I1RA 4U6PA 4WFZA 5CYMB 1S10A 3KHRA 2B43A 3OSNA 4WXWA 1IKXA 4M95A 3TVKA 3MR3A 3KK1B 4Y2CA 4EBEA 1N6QA 4NCGA 5J2PB 1LWFB 1DLOA 3M8PA 3MEGB 5C24B 2ILYA 3CDEA 5KT7A 3OHAA 4K4XA 1HQUA 2YNFA 1S6PA 3C6TB 1JLFA 1LWEA 2D3ZA 4QWBA 3KLEB 1EP4A 5DGBA 4XO0A 3IN5A 4Q0BB 2JEGA 4O3RA 3IGNA 1RT4A 1TKZB 2C2DA 4IDKA 4ZVGA 4Y34A 4IOBA 1S97A 4EYIB 5L1IA 3V6KA 4R8UB 4NLGA 1LW0A 3QIDA 2VG6A 5I3UA 5I42A 3H98A 5KFYA 4OL8A 4GC7A 1FKOA 3EPGA 3FDSA 4ZPAA 1LW2B 3PW7A 1RT6A 2ASLA 5HROA 5KT3A 3G6YA 5J2QA 3MEEB 3V81A 2D41A 1IKXB 3MR2A 3KLIA 2VG5B 2WB4A 5HP1B 4NCGB 1N6QB 4JV1A 3M8PB 1RT2B 4O4GA 1SUQB 3H59A 1HQUB 1S1UA 1S6PB 2JEJA 1JLFB 1LWEB 2W7PA 3N6MA 4NZ0A 2IM2A 2ILZA 3Q8QB 4IDKB 1RTDA 4NLSA 5CYQA 2E9RX 1RT5A 1LW0B 2VG6B 4IG0B 5I3UB 2AX0A 1ZTWA 5KFEA 4NLRA 1FKOB 4M94A 5KFUA 3D5MA 1S9GA 4IKAA 4RNFA 2R2RA 1RT6B 3HVTA 3FRZA 5HROB 2HMIA 2V9WA 1C1BA 4LSNA 4RW6A 3CO9A 3V81B 2XCAA 5KFGA 4YR2A 1JXLA 4X2BA 3KLIB 1RT1A 1IM4A 2AU0A 4NRUA 1HPZA 1JLBA 4ICLB 3V4IA 4O4GB 4RW9A 5F8MA 4ZVEA 3BQ1A 4FS2A 2UVWA 4NLDA 2WK4A 5J1EA 4DG1A 2F8EX 1RA7A 3CWJA 1IKVA 3JSMA 2FVPA 3DRRA 4J9KA 1RTDB 1XR6A 5CYQB 4IH7A 3BSNA 1JIHA 3I0RA 4XPCA 1TVRA 2UVUA 1MU2A 3RBDA 3HVAA 4GC6A 4KV8A 3MFIA 4J9OA 5KFVA 5C25A 3HVTB 4QWDA 3MR5A 3LP1A 3LP2A 1RT3A 3Q8RB 1HARA 1C1BB 4RW6B 2FJVA 2HNZA 2EC0A 1RT1B 2UUTA 3NAIA 2B5JA 3V4IB 4KAIA 1C0UA 1TL1A 4H4MB 4RW9B 1FK9A 3C6UB 5J1EB 4I2QB 1IKVB 1KLMB 3JSMB 4RW7A 3DOKA 3DI6A 5D3GB 1SH2A 3T5LA 2C2RA 4K4YA 4RNOA 1NNDA 3I0RB 3DRPA 4B3OA
chains in the Genus database with same CATH superfamily
4PWDA 1WWHA 1FXDA 3CMAS 5LJ3Y 5KT4A 1CG2A 7FDRA 2J8SA 2ZM6J 2KDOA 5G0RB 1HD0A 3T5JA 1SBRA 1WHXA 3CIZA 5IFMA 1HBOA 2AD9A 4DU8A 1L3KA 5RUBA 2MKJA 2RQKA 4WXOA 4M5DB 3VZHA 2NXJA 1VRUB 3CCQS 2WCXA 1JJCB 2DRDA 1AUSL 3G6VA 4WP8A 4TLRA 1ZH5A 2LA4A 4DL5A 2K06A 3B6BA 3V6HA 1R43A 1WKLA 2LEAA 3MXHP 3I32A 4CO4A 1XMQF 2IA6A 4C2MA 1UAWA 3GIRA 3GIIA 5BXIA 2QL9B 2DO4A 2UU9F 1TL7B 3MMJA 1JLAA 1S1VB 3R6GB 5HI7A 2Y1IA 3PACA 2JNJA 2IA0A 3O44A 1KTQA 2NS1B 4ECSA 1GFWB 1IKWB 2IVMA 3BBCA 2Q79A 1IR1A 4J5OA 3BN7A 2B6AB 3U27A 4PXBA 2N7YA 4F67A 2MZQA 1KBRA 1UKUA 3AXMA 1EETA 5HLFB 1B7FA 3OL7A 3A8KA 3K59A 3AAWB 2XM3A 2R7SA 2YWHA 5KFRA 3EXYA 3M30A 2HQFA 1RTHB 4FYXB 2GVDB 4PZVA 1TELA 3I56S 2X1BA 4ZVQB 5IXUA 3RB0A 3DGVA 3KLHA 3IWLA 3TNVA 3R5BA 1F6TA 2B0GA 2DGOA 2FHJA 5DDPC 2NXEA 3C3LA 1WF1A 2QSFA 5DDOC 2ZJPQ 1TV6A 2RQ4A 2FHJD 2OPRB 3NL0A 1U8WA 4ZVTB 4CLPA 2KVQE 3DLBA 4OHWA 3OR2A 2MDAA 4PAAA 1X4BA 2DKOB 3QZ7A 2HHHF 4FN5A 2DNKA 2E7VA 1RQ0A 3DLEA 4QYZK 5J2MB 4URQU 4X4VA 3M2VB 2LCWA 3R6LB 3QLHA 2DNGA 3BBBA 4OIXA 3HHLC 3HX9A 1U1OA 3Q22A 3QNWB 3BKUA 5DQIA 2KYZA 2OJ3A 3P5TL 2HVIA 1BC6A 4W98A 4GVBA 1NHVA 4MFBA 2V8PA 1X9WA 3W66A 2GIQA 2U1AA 4GKJF 3ZTSA 3MAQA 1TKDA 5HQ8A 4MYUA 3NEKA 2FLPA 4FF1A 3MM9A 4EO8A 2KZZA 4N5SA 1FHTA 4H54A 1MMLA 4TXSA 4Q45A 3MCSA 1K47A 1JLQB 1FX2A 2G0IA 4IH6A 2XWXA 4CTAB 4DV0F 1WKKA 3PIPQ 1KRPA 3HDSA 3T1AA 1F0XA 2NXNA 2RS8A 2Y8YA 4B9TA 1Q8KA 4L75A 3I9V9 4QR2A 5I4MA 4DX6A 4M95A 1N6QA 2ZVIA 2HBYB 2HRTA 4KGMA 1T9UA 2DGSA 2C2DA 3R7SB 3HM9A 1UVKA 4Y65A 3SV4A 4WU2A 3WIUA 2B9EA 1X4DA 1IKXB 1JB0C 4CYUB 4IDKB 3DLJA 4ES1A 2ACYA 1TK8A 1D3WA 4EK2A 2VQFF 3ZZYA 4A8KA 2HYIB 2ZWPA 3MPYA 2CQ1A 3MOJB 1Q8LA 2JDJA 3LGHA 1MU2A 2PEBA 2JFDA 1J5EF 2XNRA 1HHSA 4LF8J 2RVJA 3TZWA 5D3GB 3DOKA 3DI6A 1T3OA 2PA3A 1MROB 2XQCA 4RX6A 3D6TB 1RGVA 5JJBA 1Q5YA 1SKRA 4ANDA 4WTYA 2F4VJ 2DGTA 2C3MA 2VFRA 1FD8A 2DHHA 1S0NA 2XGPA 4RW7B 5DM7Q 3QPIA 3MGJA 4F3OA 3SCLE 2DR5A 1KFSA 4DR3F 3NGKA 1VBYA 2WSEC 2ZBCA 2MJUA 1Y7PA 1RT2A 2FVCA 3UCUP 4DLGA 5A6WA 4UOCA 3GIKA 4B9NA 2DNPA 4Y6IA 4DV2J 5D8HB 1TKXB 4OZJA 3CJ4A 3K8WA 2KFYA 5E0OA 2BEFA 2B7BB 1LK7A 2XLIA 2C2MB 2H9ZA 4YEAA 2JX2A 1FJ7A 3ZZPA 2QX0A 2ZHAA 2MZSA 1X0FA 2Q6BA 5IT9Y 3IR5B 2XY6A 1Q86T 1DZ5A 2DB1A 4HH0A 1AFJA 4TN2A 4M5GA 5U47A 2KFNA 1PAUB 5FD1A 3RUBL 2IM3A 2BYCA 1N5QA 2H5IB 3HHLB 1YJRA 1OQ6A 4F7VA 4Q8FA 2VOOA 4U67Q 3E2EA 2GX8A 2V5HG 3CSKA 4EBDA 3ELHA 1RISA 3BO3A 3OW2R 2K7KA 4WFAQ 1N36J 5HMXA 4LFAF 1FJCA 4TYAA 3VGSA 3ITHB 4E0DA 1PBUA 2HNYA 2HHSA 4EU0A 3QSIA 3R2DJ 5DRKA 3H4DA 3VHQA 1TAQA 3C15B 3MZIA 5D15A 4ZPBA 4IRCA 1H7WA 2DH8A 4UQTA 1SQGA 4DF4A 2XLKA 4NEZA 1FT8A 3KJVB 4Y2KA 3H0PA 5AE1A 4ZIWA 4DR6F 2W7AA 2HHQA 3RAMA 4ECXA 4XTTA 4QCLA 3D54A 5ETNA 2K8GA 4J37A 1YK9A 4HLBA 1KDNA 1KSPA 3AA8A 1FRKA 4ZP8A 3KLFA 4Q7AA 1VQ4S 2WOMA 4C0HA 2HFZA 3RJMB 4OV1A 2W2MP 1UPPA 4ZP9A 5KG2A 1PKUA 3PV8A 1QUPA 2K1RB 4AL6A 1N5SA 2D7SA 3BKFA 5D0GA 5LXYA 1V3SA 1UJ6A 2V67A 2BANA 5LMUF 2XYHB 3P8BB 5T41A 3FVYA 1ZETA 3D2WA 3TUIC 1TVRB 3QT6A 5HO4A 3GSIA 2C42A 4AYBD 3TZYA 4M5HA 3PY8A 4JI4J 5CHCB 1QDUB 1OY6A 1XEZA 1KEKA 5EDWA 3TA0A 3JAMY 2EI5A 3GV8B 5A2QU 3PYEA 4N8NA 2NSCA 1YJ7A 4PEOA 2ZZMA 5FLXU 1XWLA 2YX4A 3TVKA 3EYZA 3JQJA 3MAAA 4ZMMA 3M8PA 4ZLPA 1HBNA 3CT9A 4IOBA 1Z1ZA 4UUWA 2AW0A 3QIDA 2HLTA 5KT3A 1NZ8A 3G6YA 1DRZA 2OELA 1HWLA 3HO1A 1SCJB 2JEJA 1S6PB 3VAKA 4DS4A 4YN3B 1Q1KA 2H54B 3MM7B 3DOMB 2B56A 2L08A 2E5LF 5I3QA 1UFWA 1U0HA 2XBPA 1PSDA 3BPDA 1IM4A 1WSVA 3OUYA 3JXOA 2BXJA 1NSAA 2CPIA 2UV8A 4NE9C 3HVTB 3FK4A 2RUSA 4JI6J 2FGCA 4QU6A 4A4JA 3ZZUA 2MHNA 2V9KA 2QA4G 2OFHX 5J1NA 3DRPA 4B3OA 3T5KA 2YKNA 4LUBA 4J9VA 3H5XA 3PRDA 4MIAA 2JOQA 3OJSA 4LF5F 2V4QA 1ZM4A 4K4VA 4JYAF 2G1DA 2OFGX 3US5A 5HANA 4DUZF 1E6VA 3H2LA 2Q43A 5IWAF 1WNEA 3MCMA 3JQMA 4KSEB 1S5ZA 3QJJA 1VQPS 2YWKA 2GVZA 2R3VA 2W9BB 2YNGB 2BJ8A 4LSLB 1FD2A 2K7JA 3E51A 3BGFA 2C2NA 2KJWA 2MEWA 4CT8A 1C2PA 2IVYA 4YB7A 2B51A 2Z8QA 3DLKA 4DV4J 2ROEA 1FJGF 2F8HA 3M05A 4RW4A 3PRBA 2RS2A 3OTEA 2BM1A 3T5HA 3HJFA 3GWCA 4R5PB 1HMVB 3SZ2A 2IHR1 1VGYA 5ITHA 1TFYA 3ONQA 2AGOA 4LFBJ 3N5FA 2RD5C 3GR0A 1VQNS 2DY9A 3UNYA 4DSLA 1HNZJ 2DIVA 5IQQA 3F44A 3G8TA 5H9FJ 3QQCD 4OHXA 4LREA 2BE2A 4WCEQ 4IFYA 2MKYA 2NPIA 2DBBA 3GE9A 4ECRA 2MQOA 1LK5A 1X8DA 1VFJA 1D1UA 4PYAA 1YJVA 4C7QA 4ZP7A 1NJWA 2DGUA 4NRTA 1VQ5S 1NEEA 2DNQA 5T7LB 2ZE2B 2ZC4A 1Y9OA 3TR5A 2VICA 2GV1A 4JB8B 3HHNB 2QZ8A 3DMJB 5DETA 1HNIB 2VPXB 1G4CA 4M1KA 2ZH4A 2ERRA 2V2KA 1ZTTA 1XMOF 2ZH7A 3LH2S 3SFGA 1GK8A 3BR9A 4J7CA 1SV5A 1IBKF 2DNZA 3P49B 2QA2A 2UUAF 3T3FA 1FVSA 4RKUC 3KNAA 4K50A 3Q89A 2QLFB 1RAEB 3N9UC 5B08A 4B3MJ 5J2QB 2EPIA 1J2VA 2OD4A 3PW2A 4W4MA 4F0MA 1I94F 3P96A 2P9GA 2FJAB 1BE4A 4KFBA 4LRAA 3A4TA 3NBPA 4F4YA 4YY3J 4ID5B 5ADZA 5DG8A 4U9RA 2QN6B 2AT1B 3VV2B 3UQSA 3QT5A 3HSDA 1IKYB 3ICLA 1R7IA 4NLPA 1KVIA 4NLXA 3VGTA 3OR1B 2HS0A 2ZH5A 3R97A 1FRJA 3JSRA 3L7OA 1S1XA 3EXCX 1FKAF 4P71A 3A13A 1RBLA 3D66A 2XEXA 3JYTB 4JI3J 2PA8D 5CYJA 5M2PA 1IJFB 2LFVA 1RCOB 2R7RA 4DR4F 3NXZA 3AXKA 1LWEA 3IAS9 3D1HA 1XMBA 3G8QA 3AY0A 3R8YA 2A6MA 5I3UA 5D77A 1RT6A 5F0UA 2D41A 2HZCA 2WB4A 5D4NA 4I0WA 2DNMA 4U95A 1UVIA 1JLFB 3RR8A 3Q8QB 3UW1A 3A8IA 4UZBA 2FB0A 3CD7A 1XERA 3M6WA 2V9WA 2PDAA 3VAFA 3KLIB 4M8LA 2JFKA 4DG1A 1I3OB 3LF0A 2HQ3A 3VCDA 3RBDA 3FZ2A 3MR5A 3KUGA 1FNXH 1X4HA 3PFOA 2B5JA 4DHVA 2Y1RI 2OLWA 3CD0A 3EVMA 2ZOGA 2VDHA 4UQGA 4C8OA 3HSGA 3VVUA 3BGUA 4GRSA 4RPFA 5HVFA 5C42A 3PW5A 4B9LA 4RNHA 4I7FA 1AROP 2GC8A 5DLFA 5KFNA 4WKRA 3MURP 4DQQA 2HNZB 1YHQS 1X5SA 1YI2S 2MYFA 2HHUA 1PJ7A 2E7WA 4PQUA 2FJWA 5D0RA 1OMSA 3TZZA 3GTYX 1A9NB 2VASA 5HQMA 2ZHOA 3BJYA 4ED1A 2VG5A 2BBEA 4WBFA 2D9PA 2A0FB 2DNHA 1LXJA 2WONA 3ILOA 2HQIA 4AXJA 3Q0AA 4Y3CA 3AD8C 2QRRA 3MEDB 2QMXA 4DEZA 3DOLB 3FCWA 1XC9A 2NZ4A 1NLKL 2MLZA 3G6ES 2Q3PA 2C3PA 3FRYA 4IG3A 1F9FA 3R3TA 1EZZB 4FPRA 4C8KA 2B4UA 4DXLA 4KGVB 1VC0A 2ALYB 3WHIA 2W9AA 1UW4A 4ES3A 4NLYA 2XWYA 2EFPA 3DFEA 3NGTA 1NSQA 2HHVA 1HFEL 2U2FA 5DLGA 2YY3A 4CLLA 1ZAXA 1C0TA 2E1AA 4DV3J 3IM8A 3DN9A 3QGPA 2W8KA 3SIPB 3DYAB 1R31A 3NMRA 3CMQA 2DT9A 3J80U 4DPOA 2J7UA 1TKTA 5DGAA 3AD9C 4MK8A 1HLWA 4TY8A 2KHDA 3C2PA 3CCMS 4L72B 1RWOB 1RTIA 4ED0A 3AB2B 4NXMJ 5HBMA 1RTJA 1FRIA 2UU9J 2R8KA 2IBOA 1X4CA 5KFFA 1QM9A 4BDPA 3BREA 1WC4A 5KFAA 1RAHB 3HSJA 2QV6A 3U1LA 1S1WB 1FTRA 3O5TB 1B0PA 2G4BA 3OPKA 2V69A 2GO8A 4USJC 3UCGA 2ZM6F 2I5JA 5H9FK 3D3CJ 1F3FA 5B09A 3KOAA 4F4ZA 4Y2AA 2CQPA 4ZHRA 1VHIA 3M32A 1JLEB 2OD6A 2Y3YA 1NJZA 2BKPA 2DHGA 2AJ4A 1J5OB 3QFHA 3OTCA 3LQVA 2HHWA 1UEUA 4HHUA 4ZIVA 3CJ0A 2DO0A 1TL3A 4ED8A 4JI8F 3N5BA 2BA9A 2AJQA 4OFZA 3OTBA 1Q7YT 2AGQA 3MCNA 3X1LB 3R1HA 3Q8VA 5IC6B 2HRYA 4QWDA 2KTQA 2W2NP 3W64A 4XIUA 1CJUB 2UVVA 2FHOB 3LANA 4EI2A 3KLVA 3LP2B 2P9EA 5HQLA 3LTOA 2F8MA 5J2NB 2VZ9A 3VZIA 2ABYA 2FJEB 3C6TA 1F2HA 1FERA 4WK3A 5A8WB 4R8UA 2MGZA 4LRFA 1VHFA 4JP8A 3NNHA 4WE1B 5KOWA 2PI5A 1MSWD 2AJ1A 1OYEA 1BXNA 4U6PA 4DV6F 2B43A 4KJIA 3KK1B 2HFUA 3CULA 2LMIA 1DLOA 3MEGB 1OSDA 4C9DA 3HZEA 3IGNA 2DR9A 4UF4A 1QLNA 4P6QA 4GC7A 2VG6A 4C3LA 2V8VA 5CXTA 4OHYA 4NCGB 2HEKA 4NI2B 3RBZA 5CZXA 2W4CA 4ER8A 4NLRA 2CJBA 5HN0A 4NYPA 4O0NA 5E2QA 1DFDA 4WK1A 1CS4B 3V81B 5C2CA 1Y5LB 4FS2A 3DHXA 2KRBA 3JSMA 3BH6B 3DRRA 3EGNA 4LF2A 1JIHA 4UY85 4DV0J 4F0HA 1VQKS 3MUTP 1O8BA 2ZBQA 4KPYA 1TAUA 4BLGA 3V4IB 3PRVA 1YITS 3C19A 2XS7A 1IKVB 3I9ZA 2OO4A 3CDBA 4FS1A 2QTWA 2BZ2A 2YNHA 1L3SA 2RHQB 4FKYA 5ETMA 1AXQA 3MHYA 3CPWR 2YNIA 3NGSA 1YBAA 4P2MA 4DZDA 2CQIA 3MUMP 2DNYA 5KG3A 4QW8A 2ASDA 2LQ9A 2O1PA 3D9BA 2I38A 4UW2A 2DRAA 1WACA 3BB5A 2E44A 2FHMA 2J6UA 3W2VB 5KFDA 1H2TZ 4HACB 2VQFJ 3IG1A 2JVOA 2VBYA 4F0KA 4DLEA 4CZCA 4F3QA 4O3QA 2VKZG 1RT7B 3D1OA 4TU9A 4U7CA 1J5EJ 2M9KA 1T0TV 1QAIA 3THTA 1BQXA 2RF2B 4TU7A 3QATA 4QJVA 1MMNA 3MM8B 2JL9A 4FVMA 5KFOA 3E01B 1YDLA 2LEBA 1ELOA 2M2BA 2GMHA 4YMEA 1QE1A 2CPYA 3GJSB 4USVA 1S9FA 2OPSB 2ZDOA 2CNKB 2ZUAA 1WHYA 5GAGI 4QWAA 1IVZA 3TQ1A 4C8MA 1B7YB 4RUAA 4DR3J 2NXCA 3MPWA 5KTQA 4PWUA 1RU2A 2APOA 1TTHB 4DDFA 2C3YA 1AB8A 4J9SA 3I82A 5IM0A 1P8GA 3H5UA 1TUWA 2XYPB 3VQSA 3VAIA 1SB6A 3UCZP 2O01C 2V2ZA 1FKPB 1VLYA 3ET6B 6FDRA 3TJ9A 3PX0A 2H5JB 4LF9J 3MEKA 1S6OA 4DFJA 2GJFA 1PC5A 2D74B 4C0BA 3IRXB 2FUG9 3J7ZT 2GCFA 3N0VA 3G87A 2J0SD 1FNMA 3MAHA 2UZAA 1HNWF 1IKWA 1FTCA 5D0EA 3SSQA 3KK3A 3EJMA 5CH7B 9ATCB 3GCXP 3W63A 3IMQJ 4K0KF 5KG6A 2AF6A 2B6AA 4CO2A 2E1RA 2FHKA 1YG0A 2EBGA 5K8OA 3PYFA 2N82B 3QJPA 5KAKA 3CJTA 3UR0A 1FRXA 4LFAJ 3I55S 3MFHA 2DHXA 2JVRA 3QAUA 1NHUA 4O3SA 3G96A 1FJEB 1U1NA 4J91A 2IC3A 2B4OA 2H1YA 3GB0A 1UA1A 2HGNA 3QO9B 4LJMA 1GQEA 3UI3A 5GADU 3D68A 3K8VA 2V94A 1HPZB 2YBVA 3PZPA 1G1XA 1JLGA 3J81U 1OWXA 4TY9A 2I2YA 1UEKA 2V8DA 4DSEA 4OI2A 4B9UA 4RR5A 2VDIA 4HT7A 3M6XA 4AE5A 4CLUA 5THWA 4NMLA 3CF5Q 1FK9B 1Y4ZB 2EBEA 3CCES 2NZCA 2B8PA 4PABA 4Q2LA 4ELUA 2FVSA 5J2MA 2CG4A 3BSAA 5K9FA 2ZKUA 4KQZA 2QA4S 3M2VA 4ALZA 2AMCB 2EFVA 2J9DE 2HZAA 2DGVA 2GGPB 1BWVA 3MI7X 4KTQA 3CW2C 4XO0A 4AT1B 1TKZB 4UOGA 4QIWD 2WW8A 2DGXA 2HQGA 2QLXA 3OTDA 4ZPAA 1NO8A 1LXNA 3GP9A 2VOPA 4DUYJ 3U1NA 2NXUA 4X4SA 5F0WA 3D0HE 3CNQP 3M1VB 4N77A 1FF2A 2GHVC 4KC5A 1IBMF 4NZ0A 3UR3C 3K5OA 1JQGA 4OQJA 5CYQA 4IG0B 4ED5A 1ZTWA 3R5AA 3PCOB 4M94A 5LMUJ 1HHQA 2LU2A 3WC0A 2IYGA 4NA1A 7AT1B 2RHSB 3MM6B 2GMJA 1Y0HA 4AL5A 3MMBB 2MKKA 2KXHA 3A3OB 4FYVB 4J9KA 1IJEB 3ZO7A 1D8ZA 1VK8A 2IMOA 3DLLQ 1HIYA 3MWBA 2ZFHA 1EAYC 3TZXA 3PKYA 1JWWA 1WG5A 1HARA 1C1BB 1Y3KA 2CJYB 1R8CA 3VAJA 2EC0A 1RT1B 3NAIA 4CTAA 1SKSA 1RADB 1D9DA 3CE8A 2XSFA 4USTA 2DEJA 4PRFA 2XNQA 4A46A 4LF1A 4ZVFA 5KG5A 4FVCA 1E6YA 4ZVHA 2H4WB 2MZJA 1Q79A 1D9FA 4C6AA 2XSJA 4Y28C 2JLGA 1S6QA 4PWDB 1T05B 2CKWA 3OXFA 1PCAA 1VR6A 3LWMA 2FTRA 4OI0A 2XMKA 5KFPA 2F5GA 4P75A 3M2UA 2DHAA 1TFWA 2VG7B 3ZXWA 4P72A 2HGLA 5BYQA 1D8YA 3BO2A 3KWMA 2ZEJA 3CJ2A 1TUGB 3H42A 5DQGA 1CJVA 2VL1A 5KFTA 1EARA 3TA2A 4IFVA 2B9WA 1HWUA 1A6LA 6FD1A 2PMWA 1XR7A 2CPHA 2GHWA 4P9SA 4LIRA 2Z58B 3UDLA 1WHWA 4UY8T 3F56A 3KK2B 2YWFA 5D3GA 3KHHA 4LF5J 1MROA 2Q66A 4LQ3A 1JLAB 5KFCA 4KO0A 3ZC4A 2WZ1A 5HSPA 3VAGA 1PAEX 4DUZJ 3BGOP 5IWAJ 4C0OC 1BQMA 4HTIA 1RAGB 2OPQB 2MXYA 1R0AB 3FFIA 2KL8A 4TYBA 1F1BB 5K14A 2QLJB 4JV0A 4U8VA 4F02A 1EETB 3KJNB 1N4LA 1N0VC 3GIJA 3H2UB 3N79A 3CVKA 3W5ZA 5D78A 1WG1A 1M5VC 1TKXA 2R2UA 3M30B 1AZSA 4DR7J 1QSLA 3QZ8A 3CEDA 4JI6F 2OPPB 4FBTA 3Q83A 3QYYA 2C1EB 4F2RA 1FA0A 2UUCJ 2CJ9A 1ACMB 1VLOA 2PEHA 1T94A 1NDPA 1NBEB 4OI3A 1SIZA 5CABA 3NS7B 5G4DA 4O3OA 4FBUA 1YX2A 2WSCC 3MPVA 1WJ9A 4A8OA 2DCLA 4WU3A 1HQEB 1BHNA 5IOLA 1KOOA 1ZOTA 2LU1A 4ZA1A 3MDFA 4N56A 2DRBA 3OR2B 1NK7A 4YDDB 2EG1A 3W3SA 2PT0A 1FDBA 1U6FA 3ENWA 5IS2A 1NKEA 3GR1A 3KDNA 4ZVRB 4CLWA 4K4TA 1NJXA 2W8LA 1KR4A 4IQMA 2H65B 2FQQB 1KWMA 3QLHB 2BW7A 2CDQA 2R4FA 3HHLD 2E5GA 2R42A 4X4RA 1UPMB 1J27A 1N56A 1RT5B 4DV4F 4I69A 3AQOA 3RB3A 1S9GB 1NJIT 2HMIB 3F73A 1VCTA 4NL5A 4QIFA 1H0HB 1JLBB 2M8HA 3CB4A 4EWTA 1QD1A 3BGRA 2WBMA 4RLEA 3TOQA 4MFBB 1TU0B 3KDOA 3Q8PB 4C3KA 2Z4PA 5MAOA 1CULB 4ED3A 4NCBA 1G6BA 2W2OP 3DCAA 1XMOJ 1KVJA 4ANEA 1LFWA 1B0TA 1NAQA 2G2ZA 4LFBF 1IBKJ 3H90A 1QUVA 1M5PC 5C24A 3I96A 2UUAJ 2CQHA 3T1HJ 2X1GA 4ERDA 2EXUA 3BDPA 4IRKA 1R6VA 2JC1A 5CYMB 2K3KA 3TJ8A 3MR3A 1FRMA 3IN5A 2VD3A 1URNA 5L1IA 4Z37A 4CIOA 1I94J 3FMBA 2YWEA 5HROA 5HVHA 4CCHA 1CJTA 2KJVA 1N6QB 4JV1A 4K7QA 2G9OA 1Q95G 1RHKB 2P6SA 2HS3A 3SDEA 2FC9A 1A7GE 1LWXA 2PMZD 4RW6A 1CBKA 4ZJLA 1NU4A 4ZVEA 3W1YC 5J1EA 3TJAA 2W24A 1M5OC 1UVJA 2LECA 1XR6A 2F3JA 4ATNA 3A3PB 1TVRA 2UVUA 1SQEA 5MLCV 3FJ2A 3MFIA 4USMA 1XN9A 2QO3A 4B17A 2MQ8A 4DV7F 2QT7A 4B9VA 4DUTA 2RRNA 5DJBA 1MU2B 4DR4J 2WW4A 4RBTA 4I6WA 2R2SA 2MLXA 2CJXB 4YOEA 1MMDA 1GEHA 1HWJA 1KLNA 1FESA 3DOKB 3DI6B 3HFZB 3UDCA 1K73T 3FBCA 1WEYA 3NY0A 2I0XA 2MHEA 2DXFA 4IR9A 1QSSA 2VA2A 3NMAA 1NUEA 1ZS6A 1KC8T 3TW0A 1YLXA 3G9CA 3FKBA 3MM7A 2CYYA 2GJIA 2LDYA 5GAEI 3DDKA 4OX8A 4A8MP 2F9JA 2J9DA 5LSLA 1P1LA 1NKBA 1I1GA 4RU9A 4DJBA 3RW6A 4OX6A 3PR4A 3K58A 4NZ6A 3MECA 2E5JA 4O23A 1S6UA 2DISA 2M4MA 3R7NB 5E41A 4JI3F 3MR6A 4EO6A 4EYHB 3SSSA 4RW8A 4DMZA 2EEYA 2I8EA 4JV2A 4RWXA 4PG6A 4A47A 5F41A 2Z30B 1GX5A 5KFHA 2OI2A 4ECUA 3DRSA 3GYGA 2V8GA 4JI7F 2HK3A 3RB4A 3HVRA 3D28A 3QSYB 2RKIA 1MWQA 3I5AA 1ZAWA 1T9WA 2W9BA 2YNGA 2HHXA 4AD6A 3SQOP 3GJTB 4KRWA 4U7UK 1SJFA 1UFLA 4ZPWR 1N5VA 4F2SA 1T9XA 1GNKA 1N0UA 1I51B 1VC6A 1RLDA 2E1PA 3I5BA 3EVWA 3KHGA 2PMHA 4B02A 4DFMA 3PX6A 1IBCB 2HFSA 4N8OA 1UZHA 1N88A 2CJQA 2X1FA 2BKOA 2BJDA 2B4VA 3DM2B 1WF2A 4ZVOB 1KD1T 4FXDA 4B9SA 1HMVA 3LAMA 1RAFB 3G6XA 1RBAA 1U26A 3DC2A 1MN9A 1FVQA 4MKBA 2QE5A 3HHEA 3D6HB 4X62J 3H7HB 1SPBP 1ICEB 3W9IA 1EP4B 3ETMA 3IM9A 3SBMA 5HVGA 4PWWA 3OL9A 1YBTA 3VR1A 2YH1A 1S9EA 4JI0F 5CD4H 4ZJOA 1URRA 2IM0A 3DRYA 2HW3A 2MB0B 5IQ6A 2X3GA 3NGRA 4CLSA 2ADBA 1LWCA 2MSSA 1Z2ZA 3KLFB 1O6XA 3OQ2A 3LGMA 2FVRA 1TMJA 4I6AA 4ECYA 3IWNC 1Q78A 5IC4B 4K4SA 4CLZA 2ZE2A 4CH0S 4YHHJ 5KFQA 4X4PA 3MMCB 4ES2A 3GYNA 3DMJA 4KV8B 4CO1A 1LFPA 3VAMA 3MCOA 4ECTA 1TL1B 2P2CB 1YTYA 2HFVA 5J2PA 2IMWP 1L3VA 4USIA 4FNIA 4BWMA 3P3DA 1NPPA 3DDNA 3OFGA 4DV3F 1GXUA 1U1PA 5AE2A 3ZZOA 3KNGA 1M1GA 1KVKA 2ILYA 2B3TB 3V2UC 2H5EA 2HHTA 4MAKA 1LW0A 3CD6S 4CRJA 1FKOA 1CPZA 4JI8J 1ZAVA 5J2QA 1VQ8S 3FC9A 4CO0A 3MAAB 3M8PB 4NXMF 1SVDA 4DX8H 1N33J 1HBNB 3ZNJ1 3K2YA 2PD1A 4ANCA 1HBUB 2R7UA 1U4BA 6AT1B 2HBQB 2AX0A 2IRXA 5KFUA 2Q1LA 4ELVA 4NMXA 2CFXA 3HCXA 1S0VA 5KFGA 5ETPA 3ZFVA 1NDKA 3H20A 4NLDA 1OO0B 2DITA 3I0RA 4M5MA 3D6FB 3C14A 5B0DA 1U0HB 3K5NA 3RR7A 1JMTA 3C46A 4F4AA 1RWPB 4RO0A 3OUYB 1NB2A 2BDPA 4F26A 4RNOA 3EM1A 2XB2D 4ENOA 3IS9A 4DV6J 2NYIA 3JYTA 2PI4A 3GFZA 1VIXA 3BEGB 3A12A 8ATCB 5BJRA 2FZGB 1S1TA 2RAQA 3KUHA 1PGZA 3DRPB 4B3OB 2UUWA 4X4TA 3DLGA 3HULA 3G82A 2E9TA 4FNHA 3QT7A 3CC4S 4DWIA 4Y00A 2BVZA 2C2ZB 1JJ4A 4G1IA 4KY3A 2FGOA 1ZPWX 1NPRA 3POTB 3R7BB 1HBMA 4RUCA 4Z2XA 2EG2A 1PYTA 3VQTA 3HK2A 2EVZA 5DG7A 2A6OA 4DPTA 1UEVA 1X7VA 2XI3A 4JI1F 4B08A 2R8IA 1M5HA 4PXCA 3R5DA 2QEXS 3W2WB 3TYTA 1NZAA 3NAHA 2ASJA 2R9LA 5LM7E 3IA0A 3QIPB 2MQNA 1CSJA 4K5SA 1RE1B 3DLKB 1TP7A 2M52A 1WSRA 1BQNA 1CC7A 4RBUA 4PR6A 4RW4B 3PO5A 4DV1F 1RHJB 3QRQA 4G1QA 1U48A 2KXFA 4HKQA 2VC1A 1WOOA 2HQDA 1TQLA 4NLVA 4YB1P 1N52B 4DCPB 3IP0A 3U02A 3GCWP 5A2QY 2CQGA 4P52A 4RUHA 4ZLNA 1IR2A 5FLXY 3S7RA 3MD1A 1GTHA 2CRLA 3SQGB 2BE2B 4IFYB 3ULHA 3ISNC 3K7RA 4PG8A 2WRMA 3LGNA 2VKRA 1UCNA 4OV6A 2HRUA 5HK4A 3I0SA 2XULA 1T02A 3KHLA 3EVOA 2Y8WA 3M4XA 2UUBF 3O8WA 3D6MB 1U2RA 5HMZA 1YJ9S 2NPFA 1T9VA 2H4YB 1EIYB 1OS5A 5KG4A 4D3GA 1X9SA 2HWTA 5KG1A 5IT0A 2DD8S 3B4MA 5EUHA 4NLOA 3KG4A 4DQSA 3W65A 4H4OA 2VQEF 2EK6A 2J5AA 3S01A 2JEFA 3NCPA 3PX4A 2EFNA 4RNMA 3RAQA 3J7A1 1GMWA 1NKCA 5CQGA 2YWGA 3O6QA 3F0NA 3M6UA 3IR6B 4KFBB 1FDNA 2DR6A 4XDDA 1FI4A 3NBPB 4ZCMA 1R8AA 1IM6A 1VMBA 5HJXA 3B78A 1GMWD 3EWGA 4F36A 2OUGA 1JXEA 1RT3B 2PE8A 2P8IA 3FNNA 4LVNP 1N32F 1HNWJ 2R8GA 1YZ7A 2LXFA 3N4WA 4J90A 5DDRC 4BHQA 4K0KJ 2WVBA 3AHPA 2W7OA 3UN3A 2EFOA 1S1XB 1PIEA 1NK8A 3MPUB 3Q2SC 4U8YA 1LWFB 2WBRA 3CDEA 1W26A 1X4AA 1ZM3A 4QWBA 5DGBA 2O66A 2BE7D 4Y34A 1RCXB 4GO5X 2NSBA 1RWWB 1OPIA 2ASLA 1S79A 3M8YA 4X65F 2E1CA 2DTJA 2DR8A 1OPZA 5HP1B 4H4KC 2HHPA 3H59A 4M5JA 2GJ2A 1XK8A 1LWEB 3SCKE 2ROGA 2CNLB 1YJTA 4LF9F 5I3UB 2B8QA 2G13A 3HI9A 2GQQA 1RT6B 3NS5A 4LIWA 3GYXB 2XCAA 1PYOB 3NCRA 2L9NA 1ZBTA 3W9HA 1F5CA 2F8EX 3CWJA 1FFSB 5GAHU 4XPCA 4ZCLA 3LP1A 3LP2A 2PFFB 2FJBB 4OYWA 4A48A 5A6PA 4W92B 3M8RA 4Y2MA 3FSYA 1U24A 3AOBA 1EQMA 4AXIA 4DPYA 2HFNA 4NEYA 2J9CA 4WE1A 3BQ0A 2MQPA 3BS9A 4OZ1A 2W4DA 5AT1B 2ZKTA 3MEGA 1KS2A 3NOGA 1K44A 2M7SA 4MK9A 4N41A 3ZTQA 4I7FB 2VPWB 4NZ7A 1G3OA 1IBMJ 2XO6A 5CCLA 2KKHA 4L6V3 4KHPJ 1ZZNA 5B0CA 4YQWA 1FFWB 4NI2A 4PQUB 3UVJB 2IJRA 2J0XA 2BE9B 4ZVPB 3BQ2A 3R5CA 4JI5J 1U2CA 1N5YA 3T19A 1NDLA 2MSTA 1CS4A 5C2GA 2CPDA 2L3MA 1UVNA 1FWPA 1TK0A 1NSKL 1RLCL 4YDXA 2IAJA 2WONB 4O3PA 3PHTA 4U96A 3SV3A 2G2YA 4ZPTR 2KM8C 3FUYA 1UMJA 5FDLA 2FDNA 4QPTA 1N54B 1LNQA 4HEA9 3BSOA 3BPSP 4DS5A 5SZTA 3M8ZA 2KRRA 2YKMB 2CQ2A 1ZYQA 3TQEA 4V19J 4IG3B 1K9MT 2RQMA 2A18A 1HQ2A 1VIOA 2W9CA 4C3MA 1BMQB 1VYAA 4LRBA 1JKHA 3QFWA 1KP6A 2UVRA 1M5KC 1RWUA 3HZGA 1HI8A 3EZOA 3LAKA 3EUNA 5D4OA 4DUYF 4NX9A 2B4PA 4L3KA 1QTMA 4AQYF 4JBCA 2AGPA 2AEFA 3QGIA 2DJWA 3J7YU 1MWYA 5ETVA 4DQRA 1P9YA 1IR0A 1C0TB 3R27A 2HVDA 1S48A 2NLWA 5L9XA 1GT8A 1O0PA 3W2VA 3EE3A 4K8RA 2CZ9A 1B70B 4RZRA 1S77D 3BO4A 2MZ1A 4HDHA 1WELA 1T8EA 2CWXA 4OZ5A 1QVGR 1TKTB 3QWPA 1RT7A 3M6VA 3OTOF 1KHWA 4TY8B 1HNVA 1ZM2A 2Z56B 3UN5A 4J9MA 2DY1A 4MH8A 2AJFE 2VA3A 4HHHA 4AL7A 5KFJA 1RTJB 3CD5A 3J7AN 4WWSA 4NLTA 4URSA 3A8JA 3G71S 4LBHA 1U6ZA 5ETQA 4EUVA 4N47A 1CLFA 1NK5A 1QAXA 4EGLA 1VJQA 4LRCA 2OPSA 4CNYA 3ZNUA 2DK2A 1VQOS 2C2KB 5I42B 4WTOB 3NNCA 3OL6A 1X4GA 3SCIE 4DQIA 4ZHRB 2RUGA 3OFFA 1R8PA 4PG4A 2RRAA 2RB7A 2CVIA 5HL7Q 3H25A 2V34A 3ENQA 3W8GA 3CC2S 1MNEA 5E3AA 2ZITA 2CPJA 3NNAA 1FKPA 3S6EA 2C3UA 2IVFB 2DXDA 3EPIA 1TL3B 5BYRA 5K8MA 3CDWA 1X5TA 3TEHB 2BJ1A 4P2XA 2RJZA 2CQ3A 2QFIA 2IJFA 4J9PA 2AJ0A 5H9EJ 1WD6A 1D09B 1RA6A 2J8AA 1OSCA 2ZZNA 1HKAA 3OVAA 1AYEA 3O3LA 4QR0A 1U0SA 1I6JA 1F5AA 3BBFA 4F04B 4B9MA 1UWAA 2D1CA 1SH3A 1S10A 4TKTA 4CI0B 1S7HA 1HQUA 3C6TB 4DF8A 2WVFA 4R8UB 2MGZB 4DSIA 4NA3A 2YKPA 4WPAA 1LW2B 5D4LA 2IY5B 4E98A 3L3CA 4X66J 2LVWA 1YQHA 2VC0A 2W7PA 4DR7F 3CGIA 3NWGA 2EFQA 1RTDA 2E1MC 2E9RX 3JTNA 2W1BA 2BM0A 2VG6B 4OYAA 4DCJB 4CLKA 2E66A 1HW9A 2V6AA 3P45B 2UUCF 2BJEA 4R0JA 1HPZA 3L95X 2HK2A 1RBOB 1X60A 1BLUA 3J80Y 3D1QA 3LOUA 4NXNF 4K2JA 2XMUA 4DPXA 5KFVA 3IWXA 2KM8B 1RABB 3RYLA 3B54A 1HI1A 1FK9A 4I2QB 3JSMB 3T5LA 1UVMA 1U1RA 3TWZA 1HW8A 2OSRA 3HPOA 4OYZA 1WC5A 2DIUA 1WHVA 2QLWA 1RUSA 5LOQA 5C5JA 2GGPA 2M3DA 4RUBA 2F4FA 2AYEA 1PC4A 5HMWA 3HT0A 4I1TA 4CLFA 3B82A 2BJ3A 4PXEA 5L38A 2AYMA 2XS5A 2YNHB 5ETRA 2ZVSA 4USUA 2SXLA 2EWHA 2YNIB 1JX4A 4GKKF 1XNRJ 4K4UA 4Q44A 4IG0A 2KVIA 4KGXB 1S0MA 1VQ9S 1VBKA 3IRWP 3R5JB 1NK6A 4HI1A 4B3RF 4NYZA 4FZVA 3MMBA 3W8PA 3Q8SB 2N3LA 1NB7A 2XMWA 4CP5A 1EKSA 2CQBA 4LFCF 3IG1B 2ALZA 3T1HF 1M1HA 4DV7J 1B64A 1F2GA 4WIIA 5LJ5Y 2WHOA 3VF0B 4KB7A 1V3ZA 1T95A 4CM0A 4OJHA 4DR2J 3SI8A 1F60B 4WYWA 1DTTA 2DH9A 5JUMA 1UFKA 2YKAA 3CJ8A 4KBIA 4OLPA 4QIGA 2R8JA 2HNDB 3CDUA 1Q5VA 3OD2A 3N01A 4L3NA 3OFHA 4OJ1A 2QYGA 4ELTA 4EBCA 5KFLA 3MMAA 4DPWA 5BYSA 1T05A 2LEPA 9RUBA 4OYPA 1QE1B 4DCOB 5B0AA 4B3SJ 3PDNA 2P6TA 2BQUA 2YQ0A 1JK9B 3WDOA 3K5MA 1RHQB 4WYLA 3TI0A 2YX7A 1GX6A 2HG4A 4QPXA 2VG7A 5A8KA 3Q8YA 1SH0A 3HKZD 3SFUA 1Q81T 3CJRA 2HVEA 3AOAA 2Y1JA 5IM0B 1DTQA 5E3QA 3RZAA 2HWHA 5K8PA 2IIHA 2N4DA 4YS2A 2R7XA 2QYCA 2O5DA 5B0FA 4DV5F 4O44A 3GPAA 3KXDA 1TMMA 5F9LA 3ZZRA 3I5CA 2CDRB 1F3VA 1RAAB 5ETOA 2MLYA 4FF4A 2BQRA 2ZD1A 3OLAA 3KK2A 1MW7A 4ZPCA 1UWBB 3QGGA 1YRTA 2MY7A 2J9EA 4DZ6A 4JI7J 2J76E 3CJQA 4MT1A 3CCZA 2G0JA 4YR3A 2J0WA 2IJNA 1RT4B 3KK3B 2OPQA 1R0AA 4DX5A 1UL3A 4M5IA 1LQ9A 3PJ9A 1SC3B 1EQ0A 5KFWA 2HIYA 2HAFA 2CWKA 4OMFG 5AJ3F 2AIRB 2BRKA 5K5MA 5B0GA 3PYGA 4LR7A 2AX1A 3GILA 4D3HA 1X4FA 1EKRA 2ZH1A 2MZRA 2OPPA 2A1BA 2H3EB 1UZDA 1SJRA 2IC3B 2CADA 3H2VE 4BC9A 2XHCA 4QWEA 4C98A 3M8QA 3TAMA 2C22A 1H3DA 2UXDF 3NLCA 5DM6Q 1JLGB 3MR7A 3KYLA 1IBLF 2LP4A 1HQEA 1ZZFA 1FCAA 2V4RA 2E9ZA 3MM5A 2F63A 1W7WA 4I56A 1K8AT 2I1RA 2KG0A 4HT5A 4WXWA 4MYTA 3DU6A 4EBEA 5KT7A 2VIHA 1IN0A 2OEMA 3FBEA 3HFVA 4JI0J 4O3RA 1S97A 4NOHA 1RAOA 3V6KA 4CO5A 2KT5A 3EPGA 3PW7A 5CD4A 4PXDA 5LSRA 3GLJA 4O4GA 1SUQB 2YWWA 2CPXA 2WVDA 3N6MA 3WX8A 2ILZA 4HH1A 2RILA 2RNEA 3DGPA 1RT5A 4X4UA 1LOUA 1S9GA 1FDDA 4V1Ak 2HMIA 3WIVA 1KN6A 1HHTP 1P6TA 5H9EK 1JLBA 4ICLB 3BH7B 3OXLA 4XDCA 3UO0A 2UVWA 2Z57B 2WK4A 2NUHA 3CCVS 5EN1A 3AQPA 1RWVB 5CYQB 1SC1B 1CULA 1KOHA 3PG9A 2WAQD 2VHGA 4CNZA 1A0OB 4P2FA 2G2OA 4BC7A 3R9LA 4H4MB 2MTLA 1HI0P 2HZVA 3M2RA 4W90B 4X62F 1FRHA 2XC9A 1JLCB 3NCQA 2DCUB 3TVZA 3VTIA 1TL5A 4I67A 5CYMA 2J6TA 3CJSA 1X4EA 3V6JA 3HHDA 3KMQA 4FKXA 4PUOA 3VAHA 1E6YB 4DI6A 1P9QC 2DEIA 3EZ5A 5JVHQ 3PHEA 4ZLJA 2FPHX 5ETKA 2BMBA 4ECVA 2HVZA 2QL7B 1NK4A 2ZBPA 8AT1B 2XSJB 4YHHF 1DAXA 1S6QB 4ID8A 4IOCQ 4C8LA 3FEZA 1VRTA 2ZH6A 3AB4B 1Y00A 3AJ1A 4UT4A 1OYDA 3C16A 5L8RC 1QTNB 4EEYA 2KG1A 1YJNS 4LF6F 3M2UB 4UTGA 1CQMA 1FXLA 2YH0A 1V9OA 2JHEA 1V6HA 2EFGA 5L1KA 3JSYA 2BV3A 3HSZA 4O4RA 1CJVB 1Q16B 2ZH2A 4ITSA 5HAOA 5DZ7A 3GMGA 1KQSR 2CXEA 4IFVB 3KLGA 3J81Y 3IR7B 4R25A 1RXOB 3I87A 2LXIA 3B8HA 2IRUA 2XI2A 4MKVA 2OP5A 4QW9A 1T11A 1S59A 1C1CA 2F40A 4ZP6A 1VI7A 1REVA 4CWBA 1U1MA 4TLQA 1N33F 2OMOA 2PGCA 1Y5IB 2FLLA 4KO0B 1U1LA 1X5PA 1FWLA 2AWZA 3VGUA 5LMNJ 2CZVC 1Y10A 4IO1A 1BQMB 2QIFA 4KKOA 2ADCA 4JI1J 3FFIB 1U09A 3CCLS 2L41A 5K14B 4MJKA 4MMOA 3MTKA 2JWNA 4I2PB 2VU5A 3V6DB 2KB2A 1RZMA 2QL5B 2NUUG 1VJWA 2CQ4A 3TP2A 1WDTA 3M9MB 2R7QA 3PO4A 1T9TA 2GMLA 4A8FA 2ZBIA 2XTJP 4ZPVR 1R6YA 1AZSB 4OZNA 4MKAA 1RAIB 1N34F 1CJKB 4FF2A 4DV1J 2XY5A 3KFWX 4WFBQ 3UDEA 4EMDA 3LPEA 4ZN1A 4FYYB 2Z2MA 1T03B 2FC8A 2ZDPA 1OY8A 2XGQA 2CQDA 4LF4J 1KQKA 4TVAB 5T14A 5JMNA 1B3TA 5DZ6A 2YNFB 3RBXA 1L3UA 2ROPA 4PG5A 4ED6A 3IBFB 1SJ4P 2F7VA 4QIEA 4G3IA 1SJ3P 1ULRA 3DLHA 2IPOB 3ZZ0A 1Q7LB 2J7KA 3OXGA 2V4JB 4ZS6A 5M2RA 1QAYA 1GXTA 1FNOA 4JV5F 1RWMB 3NP5A 3HD1A 2ZBRA 1YGYA 1SJ1A 2FZCB 1SL1A 2AV5A 4ZLLA 1RACB 1HYSA 3M7VA 4HVZA 5A0YB 5HJYA 1CVJA 4WZQA 3JS9A 3BZQA 4IQXA 2RU3A 2XMJA 1F9HA 5KG7A 1W2IA 2VBXA 2XY7A 1Z2LA 4RL1A 2UUBJ 1GMVA 4KH0B 2OSQA 2QGFB 4CO3A 3MOZA 3DM2A 3BGRB 2RDDA 2ZHBA 5L9NA 2CNOB 2DPJA 4EZ9A 4Q0BA 4DBQA 1Z4UA 2CNNB 4DR5F 1U1KA 4ETZA 1SJQA 3FCHA 4ECZA 3PW0A 3CJKA 3KHRA 3MPDA 3AH6A 1XNQF 3WQPA 5C24B 2BOPA 3KLEB 1EP4A 3CCRS 3QMQA 4ZVGA 4C11A 2VQEJ 4DPUA 2ZJRQ 2G1HA 1EJ7L 2XMMA 3FDSA 2OHDA 2MJNA 2GAHC 1VBZA 2GZOA 3MEEB 2N7CA 1IWAA 1VS3A 1S72S 2M0GB 2QLBB 3BR8A 5GADI 2LKZA 2CJAA 4NLSA 3AJDA 2QMWA 5KFEA 5EGYA 3G8SA 4IKAA 2R2RA 5HROB 2KO1A 1UJ5A 1CJTB 2R7WA 2LDIA 2AU0A 1NMEB 4RW9A 5F8MA 3MMCA 5CZVA 1RA7A 5E33A 3BSNA 2FD2A 1N32J 2DYAA 4KV8A 3AA9A 2W01A 3SDEB 3K5LA 4C97A 4CH1A 3DDIA 4RW6B 3DRXA 1TL1A 3R1LA 3C6UB 5G0RA 5J1EB 2QA1A 4QYRA 1KLMB 4CH7A 3GJRB 4K4YA 3RRKA 2FLOA 1HWIA 4M5DA 3FCVA 4J9QA 1VRUA 1TR0A 5A8RB 3RBEA 3R2CJ 4ZVUB 4EZ6A 3PVXA 4BWJA 2K3IA 4OHVA 4X65J 1SXLA 4CLYA 5SUHA 4OX9F 3NKYA 4ZPDA 3M9OB 2V50A 3KJQB 4DL7A 3FQLA 2Z2LA 3GU0A 3P6YC 5DG9A 2B7CB 3UDVA 1B4SA 5L39A 1R3NA 2CQ0A 1HBUA 1Q8IA 1TL7A 3GFYA 4BBYA 1S1VA 2BRLA 3KG0A 3CO0P 3BM7A 2D3O1 2RDJA 3FBBA 1AFIA 2FZKB 3N6LA 1U47A 2JEIA 2MZTA 4ED7A 3W9JA 3IBCB 4F3MA 1M1KT 2OEKA 2HGMA 1H2UX 3DU5A 3ENVA 3K0JA 1U45A 5HLFA 2LA6A 3T1YJ 3KG1A 3MECB 3V5RA 4PQAA 1RHUB 1XQIA 4CLTA 1QJHA 1Q82T 4LRDA 1RTHA 2GVDA 3X3UA 1L5UA 1OIAA 4RW8B 3IGVA 4C8ZA 2HPUA 5BR8F 1X0PA 3HHKA 3LALA 3W5XA 4KH1B 4HL9A 2D69A 3H4BA 3UD3P 3M8SA 2XMAA 1OJ4A 3LP0B 3DRSB 3POTA 3GQCA 4IH5A 2UP1A 2OPRA 5KFXA 2H51B 3SMZA 4RBVA 2RKIB 3ILJA 2RT3A 5B0EA 1R89A 3PYDA 4M5LA 3JTPA 2J0QD 2KH9A 3W2WA 4P7TA 2QG9B 4MIWA 1VK3A 2R2TA 1PG5B 4NYOA 3QIPA 1ZM9A 1NHKL 3OSPA 2V68A 2XZWA 1Y11A 1W25A 3HKWA 1YVFA 2YKOA 5E7OB 3CJ3A 4FPIA 5F8HA 1BY9A 3WX4A 1NCLA 4M63A 1VDHA 1RAJA 5F9NA 1TK5A 4QBUA 3LW5C 2RH3A 1Y3JA 3PJXA 4Q8EA 1VQ6S 4AQYJ 2FIUA 2XO7A 3NWRA 1OY9A 4QZVB 5KT2A 4KHPF 2XLJA 3NOCA 2UXCF 5B0BA 4P74A 4LF7F 1AUDA 2RIJA 4LMZA 2D3UA 3BYPA 4USHA 4JI5F 1S1UB 4L76A 2RMLA 2AHOB 3D7SB 4Q5VA 5IT9U 1JNRB 3SQGA 2XS2A 1S9EB 1P27B 1RB0A 4MIBA 1HA1A 2AP6A 3OT9A 4LSNB 1JLQA 3NS6A 4TQSA 2J6SA 3OTOJ 1FFGB 4ILRA 3LPYA 2O67A 2PSZA 1LWCB 2FLNA 1O5JA 3LO3A 2QJ3A 3PXGa 3M8WA 2DNOA 5C25B 4I4BA 1D9AA 3PEHA 1FWKA 1APSA 1G7CB 3KTQA 4IOAQ 4DR1F 1C0UB 3FSIA 3HT3A 3UNGC 2XCPA 2NCKL 2Z2YB 3PJWA 2EK1A 5CCMA 5KFZA 2XZTB 2POKA 1S99A 4OYBA 5F3TA 1IKXA 3QAEA 5J2PB 2YKQA 4CYUA 1HBOB 1HNXF 2YQ1A 3EICA 4IDKA 1S57A 1RK8A 4EYIB 3Q86A 1HD1A 5D4PA 3DNCA 1RKJA 5HMYA 5HATA 3D3BJ 4N76A 1NJYA 3CUNA 1T9YA 2BOAA 2DH7A 1KFDA 3G2XA 4YFUA 1LW0B 1ITPA 1FKOB 3GSDA 2IDLA 3QRRA 2HIQA 3IC1A 3CO9A 1G2EA 1JXLA 4X2BA 1H74A 3U1MA 1H6KX 1FX4A 1O51A 4GC6A 2Y0BB 2F1FA 2DNRA 3BGLA 3ZTOA 1RT3A 3CIMA 4LBIA 4KAIA 2G0CA 1UP1A 4KYZA 3AJ2A 4RW7A 2C2RA 2BJ9A 1NNDA 3I0RB 5IV4A 2JLFA 5IZHA 3K5PA 5LL6d 3C14B 3WC2A 2M5YA 1LV5A 1T3NA 2J7WA 4DL6A 4DOZA 2DR7A 5LSOA 2VF3A 3OV7A 1LWFA 2FY8A 4QQBA 3OVSA 3J81j 3IS9B 3UD4P 5F3ZA 2W25A 5B7WA 2KI2A 4C8NA 1FRLA 2GNKA 4R0EA 3E8OA 5GVQA 3D67A 3UD5A 1K0TA 5HP1A 3GZ7A 5F8NA 1SL2A 1S1TB 3KLHB 2L48A 3D0IE 3LA0A 5L1LA 1FO1A 3DLGB 2HSEB 3G82B 4JI2F 4V19X 1P1TA 5ETTA 1KQGB 4OZ0A 3JAMU 4NXNJ 2HS4A 5KT6A 2OEJA 1HBMB 3BDEA 4RNNA 2MQLA 3G86A 1TV6B 4K4ZA 1RDRA 3QRPA 2KT3A 1NPKA 3TVYA 3W60A 2M70A 4F25A 2OAUA 3P5BP 2BW2A 2OGUA 3NGDA 3ZZZA 4MTPA 4ZVSB 5DO2A 4YB5A 4OYXA 4RJVA 3HHLA 2AYBA 3DLEB 3SEOA 4ZCIA 4I6YA 4MKYA 1SL0A 1U25A 2HVHA 2LLZA 5J1PA 5IV3A 2JSXA 3I4PA 2JRSA 2KYXA 3GG0A 4FDFA 4USWA 4P2SA 1BQNB 2VH7A 4X66F 3GFXA 1D0EA 1SQFA 3ZZTA 4B3TF 3ITHA 1HR0F 4DX7A 3K17A 3A8EA 2V63A 3CJ5A 4XPEA 4G1QB 4GVBB 4GKKJ 1UETA 3C15A 5F8JA 3AT1B 2XYGB 5KG0A 2GIRA 4AFFA 4UOFA 2EC2A 1U6BA 4ED4A 3QWUA 1QY7A 1WUUA 3UVJA 3AODA 1EX8A 4BS2A 2B9YA 4B3RJ 3OFEA 3HF5A 3MM9B 3KJVA 4LFCJ 2Q6CA 4FP9A 3ISND 3GV5B 2NQPA 2DNLA 2K2PA 1S0OA 4X4QA 4X64F 1AA1B 1NDCA 1DQ8A 2W2PP 3KUEA 3J7Z5 4P73A 3I0SB 2YKMA 3THPA 1H98A 3UWTA 2HURA 2KZMA 1FE0A 3BKTA 4ZOSA 2RRBA 2H48B 2UXBF 3A1YG 5KFBA 4OI1A 2KT2A 1S7IA 1NK0A 3BF4A 2K1RA 1LEOA 3H8YA 5M2UA 1VBXA 1X31C 1XNRF 3CCWA 3V4MA 4NWBA 4NLQA 3RG6A 3C8YA 3TEGA 1BWEA 1XJWB 4ECQA 2W4PA 3TX8A 4DSKA 2BACA 4H4OB 4E8UA 3HXMA 1K1SA 5DQHA 2C2OB 4DV5J 1XIQA 2C2EA 1GAOA 1XMQJ 4DR2F 1RHRB 3H5SA 3VWSA 4HTJA 4I68A 2UV8G 2O3DA 2X3DA 3I4HX 5CAAA 3FBFA 2KU7A 4TNOA 3SCJE 4KGZB 3RB6A 4DN9A 4NA2A 2QC3A 1H72C 1MG7A 3FEXB 2PO4A 4DQPA 1I5OB 2GQ2A 2NR0A 4Y2CA 1NM2A 2D3ZA 1S6PA 4B3SF 3BYRA 3E3XA 2QSWA 2JEGA 3DOMA 3VVTA 3TO8A 5I42A 5KFYA 2CQCA 4NPOA 1Q53A 3MD3A 5AJ3J 2MKHA 3TUJC 1RWNB 2VODA 4OX7A 2MQQA 1RT2B 5CA5A 3LWLA 4H4KA 2VPYB 1RI7A 4C8YA 2RU9A 3DHWC 4QR1A 3HVTA 4LVOP 4IUFA 2BABA 3WZ0A 4NRUA 2KN4A 1N5TA 3BQ1A 2PIIA 4IH7A 5I3PA 1YBUA 2AZ1A 1YRXA 3HVAA 2UXDJ 3OVBA 2AEJA 1IBLJ 3RTVA 2OIHA 2AYGA 3AD7C 1F5BA 3EDQB 2PC6A 2P9CA 3L09A 1YZ6A 2HBZB 2MMYA 3FEYB 2EW9A 3HLUA 1IWGA 3LP1B 4F8RA 3IBWA 2ZOMA 2CJKA 1QSYA 4LR9A 2JC0A 2HHHJ 4HR2A 1TL4A 4KGKA 3D4JA 2VPZB 3MTJA 4MK7A 1RJJA 4LSLA 3GONA 2CZ4A 4A8WA 1LW2A 2MQMA 1L3TA 2YPYA 1R8HA 1WC3A 3EDRB 5KT5A 5FJ4A 4OYOA 3C66A 1YSJA 5ETLA 4QOTA 1UW9A 4PKDB 2YXLA 2X51A 1ZA1B 2HNYB 3R5GA 3HD2A 2HBRB 4R5PA 3F41A 1IXKA 3TARA 2Z0GA 4K4WA 4GKJJ 1U02A 2X7IA 1S49A 1F9EB 1WTBA 3GIMA 1SC4B 5EWFA 3ILLA 3SYZA 1PBAA 2X1AA 1DARA 1N5YB 2D3OR 1FEEA 3Q23A 3FSXA 3PW4A 4ILLA 3T41A 3T9ZA 4I2QA 3NRBA 2IAJB 5AXKA 1FXRA 4YR0A 3BN4A 2VBZA 2A10A 3P4UB 2RSQA 4TQRA 1JNZB 5FDLB 3EGWB 1Q8BA 4HHJA 1SC6A 5LXRA 3ILIA 4LR8A 2WOMB 5DDQC 4WF9Q 2W9CB 4J9NA 2HAIA 3OL8A 5T7LA 4IR1A 3PEJA 2LQ5A 1WEZA 1JKHB 3THVA 3CCJS 1WKJA 2BJ7A 4N7TA 2B9XA 1H7XA 3U7JA 4PPDA 2VJVA 4OI6A 2VB6A 1HNIA 2JH3A 4NCAA 1IQZA 4LF6J 3RW7A 2BANB 5F8IA 3EGVA 4RU2A 1WOPA 3K89A 3W62A 1NH8A 3IAM9 3HP6A 1M90T 1VC5A 3QGHA 3MUVP 1IQTA 3CTRA 3QBCA 4X84A 5KFMA 5EX0A 3H5YA 4FXVA 1TZ0A 3L7PA 1HNVB 3ZTPA 1VRQC 3UFCX 2VFUA 4PPZA 2HNDA 4OLOA 5D6GA 2L9DA 2R7TA 3EGZA 2VUGA 3FZBA 1R0BG 1NXIA 1AW0A 4YB6A 5KFIA 2Y1LB 3L7UA 2AEMA 4ID5A 3VALA 3RGIA 1JJ2R 1IKYA 1M0SA 4Y0FA 2VJUA 1W2BR 5JXSA 3CC7S 2FJDB 4Q43A 4OJ3A 5GMKa 2IRYA 3OR1A 1OQ3A 1SIWB 1VQ7S 4K5RA 4GO7X 2BX6A 1RTZA 2MKCA 4CT9A 4QWCA 2OTLS 1DQAA 2MY8A 2AQ4A 1ZPVA 1N34J 5H1SV 3HVWA 3KMSA 4A8YA 1GTEA 4GMKA 3O1LA 2FVQA 1HWKA 2XG8A 5JVGQ 1KNZA 3K57A 2ZH3A 4LF8F 2FY1A 4WJBA 2YKNB 1C4CA 1X5OA 3AFGA 2V2VA 2VONA 1UWBA 4IYQA 1CC8A 4WFZA 3L9ZA 4M5NA 1S4EA 4K4XA 2GQCA 1JLFA 1E6VB 2F4VF 1RT4A 4ZDNA 5LMNF 1VQMS 1SKUB 4JV5J 1U2FA 2GVZB 3MR2A 3KLIA 2NYHA 1FDAA 5AXNA 1HQUB 2Y0SD 3IXQA 2BKNA 3TAQA 2IM2A 2CAJA 4OZ2A 1RWKB 4X4OA 4Z7YA 4DFPA 4DV2F 1MLAA 1WI6A 2CIMA 1U1QA 4G65A 3TAPA 1FE4A 1YRUA 4OHZA 4RWWA 1RTDB 3TA1A 4F4KA 1V5IB 4ZJQA 2VV5A 2MKIA 3Q8RB 3I6PA 1RHMB 2HNZA 1WDDA 4LF4F 4U7UD 4DR5J 1DQ9A 1WG4A 3HMJG 1XNQJ 2AJ2A 4DR6J 3B4DA 3S8SA 3OHBA 2MKSA 3ISZA 4E2FB 1DURA 5GAGU 1WC6A 4PCQA 1ZA2B 3MEDA 1T7PA 1VQSA 3DOLA 4HI2A 1SUQA 1CQNA 2YTCA 4I64A 5F8GA 1RYSA 4WFNQ 1DBDA 3JB9k 3CCUS 3UE2A 4LQ9A 2E5HA 1N36F 4NASA 2W2QP 4P10A 2HLUA 3QT8A 4KHRA 5GAHI 1BD6A 2BUNA 5E3PA 3RAXA 4UZCA 4ICLA 3PM9A 3CCSS 2ZJQQ 2KXNB 4ILMA 1Y5NB 4OZLA 5AE3A 3O2IA 2AKWB 2YQ3A 2IFXA 3GFHA 4BCAA 2GAGC 4WIQA 5AXLA 1SV5B 3FMWA 3CCTA 4H4MA 3H40A 5L1JA 3Q8UA 3DYAA 4NLWA 2QFJA 1JLCA 1R0CB 4XAKA 2OKQA 4DL0C 1GXLA 4ED2A 5E5NA 1DTTB 3UPFA 4OX9J 3W5YA 2OTJS 4K2XA 2DHSA 1BGXT 2BQ3A 2C3OA 3EMTA 4J9UE 3D0GE 4UUXA 1N48A 1MWZA 2ZC3A 1YJWS 3MMAB 1YKWA 1CEZA 3ETOA 4KE5A 1RP5A 3EZUA 2OMLA 2C28A 1VISA 2EKYA 3PNIA 4O3NA 1S1WA 1DHMA 1NSPA 1B99A 1PILA 1Q0NA 2CA9A 5A8KB 2E5LJ 3CDAA 2ACMA 2DVIA 4A8SA 1RKIA 3DXSX 4NLUA 1DTQB 1JLEA 4JI4F 3NG8A 1K1QA 2N3OA 3EX7B 5EWGA 4KR0B 1FEHA 2A3JA 1J5OA 2PFDA 1S12A 4L74A 1KQFB 4O44B 2KHCA 4F4XA 5BR8J 4AUKA 3J7YI 1C4AA 2JJ4D 4Q2MA 1S76D 2ZD1B 2Y9HA 2GFFA 2WVEA 4DL3A 1WC1A 3BV8A 4F50A 3VGVA 1SKWA 3T6JA 5A76A 2ZWOA 2HFOA 1AT1B 4JYAJ 4TU8A 3TUZC 5KFKA 1RU1A 3OLBA 1BUXA 5E3CA 1CJUA 4URGA 4JOUA 1KTVA 5EX3A 3L4BC 1M5SA 4P7VA 4XK8C 2WVCA 3NGUA 3JQKA 4I2PA 4ETXA 5J2NA 4DG1B 3V6DA 1REGX 3FQKA 2VFVA 1VQYA 4C4WA 5A8WA 3T1YF 2IYIA 1FJGJ 1WOSA 2B5JB 1VOMA 3KK1A 3AOCA 4J9LA 1CJKA 1YJUA 2YX1A 3SSRA 2DGWA 2GA7A 5C42B 4G6VB 1H2VZ 1LKZA 2V0NA 1T03A 3M8QB 1PJ6A 3TAMB 2L9WA 2R7OA 2NREA 4NCGA 3OHAA 2UXCJ 2YNFA 1EHWA 1H38A 1NRKA 2GO9A 4ZN3A 4LF7J 4NLGA 3MM5B 4OL8A 2VFTA 2V4JA 2EKNA 3V81A 5E3RA 2VG5B 3CMES 2F9DA 3PIOQ 2I9SA 4FF3A 3KKFA 4IO9Q 4L73A 4CDIA 2CUYA 3ENAA 3D5MA 3KJFB 4RNFA 3GJQB 3FRZA 1JJHA 1PYSB 3CXCR 1R8BA 5A0YA 3V4IA 4O4GB 4PG7A 2HQCA 3T6BA 2DXEA 1IKVA 3UN2A 4PYDA 3N28A 3DGPB 1JXVA 3A3NB 4A8QA 4DR1J 2GHPA 4J9OA 2YPZA 2FJVA 2DNNA 4ZITA 2UUTA 2RE1A 1RWXB 3W61A 2Z2ZA 3OBIA 1SH2A 4OI4A 1WEXA 1MN7A 1HNXJ 3PTWA 2E29A 1EB0A 3M2RB 4OZ3A 4QIVA 3KLEA 2I6WA 4HACA 1HNZF 4WZMA 4DL4A 2GW8A 2GIFA 4CM2A 3MEEA 4KPCA 3PKMA 3BSCA 2RQCA 4UOHA 2CG8A 2LYVA 2FYXA 4WFYA 1H73A 4PUOB 3MF5A 3QJLA 1RTIB 1U7LA 5HBMB 1GH8A 2QMUB 3JTOA 2RF2A 4KIAA 2CPEA 3M9NB 3MM8A 1K0VA 5EWEA 2M88A 3OJUA 3E01A 2MPUA 4ZK7M 1VRTB 2ZNYA 2HWIA 3C16B 2PN6A 3WBZA 2ATCB 3C6UA 1KLMA 2I5JB 3RU0A 4LBPA 3JSBA 1KONA 2D9OA 4M5KA 2ZZTA 3M32B 5A8RA 1TUVA 5KFSA 2N4CA 2CPZA 4QYZJ 3KLGB 4S0MA 1RYRA 1U49A 4EFAC 2JLEA 3DXBA 4QU7A 4DSJA 2A2CA 2CPFA 1QVFR 4WKYA 4LT6A 1ROFA 5K8NA 3ET6A 1C1CB 2HKEA 2ATLA 1R27B 2M8DB 4B3MF 3PFEA 4JI2J 7FD1A 1REVB 4OYMA 5K20B 2P5VA 2FJXA 2E7XA 1NK9A 5GMEA 3HJVA 1YIJS 3IRXA 4ECWA 3ADAC 4YY3F 1V5VA 1S4FA 3IFEA 4KHMA 4YP3A 3TRGA 3DKDA 2DGQA 2LXUA 4KKOB 2JZ5A 2BR0A 2VFSA 5KOXA 5C7PA 4KT0C 3S1TA 2ZOFA 1GMUA 4USKA 1N8RT 1YWXA 2V8HA 3W7BA 1IUJA 4DFKA 1KKHA 2YVSA 4YUDA 3TUPA 3LUYA 4IRDA 1VQLS 1WC0A 3RRGA 1RSCA 5DS7A 1UTAA 1PO6A 2ASYA 3GG1A 1XR5A 4DL2A 3TANA 4DSFA 2VBWA 4HYKA 4FYWB 1UA0A 4B3TJ 3PR5B 1DLOB 4G1PA 4LSZB 5IT4A 1HR0J 1DY3A 3GV7B 4F4WA 2LQ8A 4CQ1A 2WB1D 2OH2A 4J9RA 2DPIA 3QO9A 5L46A 3IO1A 1UJ4A 3N6NA 2ZNZA 1WTFA 2RDIA 1XBWA 2WSFC 4FXWA 1HL6A 3LP0A 3TX0A 1KHVA 5GMDA 2ZH8A 3HFKA 2XHWA 4ZKAA 2V2QA 5FIIA 1WORA 1WI8A 2IBKA 4ZCKA 3DRRB 4JUZA 4GVLA 5D0HA 5F8LA 2LQBA 4WP9A 2CVEA 3Q2TC 2R7VA 4X64J 1HYSB 2R8HA 4K59A 4DN0A 4O0IA 2F65A 8RUCA 4X4NA 1U8SA 2AZ3A 4FYDA 1UVLA 1B0VA 4DU7A 1TKZA 3SXLA 2UXBJ 2WTFA 1QAJA 1PJ5A 2IM1A 4WFXA 3OSNA 3M1VA 2A2DA 3G4SS 1V3RA 1NH7A 4Q0BB 4Z7CA 3H98A 3T9NA 1Q4RA 2ZUGA 3CJKB 4OYIA 2GS8A 5AXMA 2COLA 4OJGA 3MM6A 1S1UA 1SI9A 5LT5A 4C11B 2ZH9A 2E5IA 3ZTRA 4A8XA 3I31A 1C1BA 4LSNA 2KFZA 3FGVA 1DJ0A 4YR2A 1RT1A 5ETSA 5EHHA 2LQJA 5GAEU 2FVPA 1WF0A 4Y2IA 1X9MA 2XMTA 5C25A 1XTZA 3RRHA 4C48A 1C0UA 4HDGA 4RW9B 2XMVA 4WP3A 3Q24A 2XZDB 2IDEA
chains in the Genus database with same CATH topology
4AXIA 5IZHA 4PWDA 3K5PA 2HFNA 1WWHA 5LL6d 3WC2A 2M5YA 1LV5A 4FS1A 1FXDA 1T3NA 3CMAS 2J9CA 2J7WA 4WE1A 2BZ2A 5LJ3Y 2YNHA 1L3SA 3BQ0A 2MQPA 3BS9A 5KT4A 4OZ1A 1CG2A 7FDRA 4DL6A 4DOZA 2W4DA 2DR7A 5LSOA 1AXQA 2KDOA 3MHYA 5G0RB 3OV7A 3CPWR 2YNIA 2ZKTA 1LWFA 3MEGA 1YBAA 1HD0A 1KS2A 3T5JA 4QQBA 1SBRA 1WHXA 2M7SA 3CIZA 1HBOA 5IFMA 3OVSA 2CQIA 2AD9A 4MK9A 3IS9B 1L3KA 3MUMP 2DNYA 2MKJA 4N41A 2RQKA 3UD4P 5F3ZA 4WXOA 4M5DB 2W25A 5KG3A 3VZHA 4QW8A 5B7WA 2ASDA 4I7FB 2KI2A 2VPWB 4C8NA 1FRLA 2GNKA 2LQ9A 2O1PA 4NZ7A 4R0EA 1G3OA 2I38A 1VRUB 2KKHA 4UW2A 2WCXA 5CCLA 3CCQS 2DRAA 3E8OA 5GVQA 4L6V3 1WACA 3BB5A 3G6VA 1ZZNA 5B0CA 4TLRA 4YQWA 2E44A 2FHMA 5HP1A 1ZH5A 2LA4A 3GZ7A 1K0TA 4DL5A 2J6UA 5F8NA 1SL2A 1S1TB 3W2VB 3V6HA 1R43A 2LEAA 5KFDA 3MXHP 3KLHB 4PQUB 1H2TZ 2L48A 3D0IE 3IG1A 3I32A 2J0XA 5L1LA 1FO1A 4CO4A 3DLGB 2JVOA 4JI2F 4V19X 3BQ2A 1P1TA 3R5CA 2VBYA 1XMQF 1N5YA 3T19A 4DLEA 2IA6A 1KQGB 4C2MA 2MSTA 4OZ0A 4CZCA 1UAWA 4F3QA 3GIIA 2CPDA 2L3MA 2HS4A 2VKZG 4O3QA 5KT6A 1RT7B 3D1OA 4TU9A 1UVNA 4U7CA 1HBMB 3BDEA 4RNNA 1TK0A 2MQLA 3G86A 1TV6B 4K4ZA 2M9KA 2DO4A 2UU9F 4YDXA 1RDRA 1QAIA 2IAJA 2WONB 4O3PA 3SV3A 2KT3A 4ZPTR 3TVYA 2M70A 3THTA 3MMJA 2KM8C 4F25A 1JLAA 1S1VB 2OAUA 1UMJA 2BW2A 5FDLA 2FDNA 4QPTA 5HI7A 1N54B 2Y1IA 3PACA 3NGDA 1BQXA 3O44A 2IA0A 4HEA9 4MTPA 1KTQA 2RF2B 2NS1B 3ZZZA 4TU7A 3BSOA 5DO2A 4ECSA 4QJVA 4DS5A 1MMNA 4YB5A 5SZTA 3MM8B 1IKWB 2JL9A 2KRRA 3HHLA 2AYBA 3DLEB 2YKMB 2CQ2A 4FVMA 3SEOA 4ZCIA 5KFOA 1ZYQA 3E01B 2IVMA 2LEBA 2Q79A 4V19J 4IG3B 4I6YA 4MKYA 1K9MT 2RQMA 1ELOA 1SL0A 1U25A 4J5OA 2A18A 2M2BA 2GMHA 2HVHA 3BN7A 1VIOA 4YMEA 2W9CA 2LLZA 1QE1A 2CPYA 4C3MA 5J1PA 2B6AB 3U27A 2JSXA 2OPSB 2ZDOA 1S9FA 3I4PA 2JRSA 4PXBA 1WHYA 5GAGI 2KYXA 4QWAA 1JKHA 2UVRA 2N7YA 3GG0A 4F67A 1M5KC 1RWUA 3HZGA 2MZQA 4P2SA 1BQNB 1UKUA 2VH7A 3TQ1A 1HI8A 4DUYF 3LAKA 3EUNA 5D4OA 4C8MA