3C6UB

Crystal structure of hiv reverse transcriptase in complex with inhibitor 22
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
423
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 108
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB04
1RT7B 2YKNA 1HQEB 1N6QB 4NLXA 1JXLA 2FLNA 4RZRA 3BQ1A 4IKAA 5KG1A 4O3PA 1SH0A 1LW0A 1LWCA 4IRDA 5KFBA 3KJVB 1SH3A 1QE1A 3JSMB 3KLHB 4I2PA 3M8PA 1SUQB 2R2RA 2YKNB 3MR2A 5HBMB 4NLOA 3FQLA 5KFSA 1RYSA 4KBIA 2YNFA 3DOLA 3C6TA 4PUOB 1HYSB 4NZ0A 4NLTA 2YKMA 2ZE2A 3MECB 1W25A 1HMVA 4RW7B 4U6PA 3H59A 3BSCA 4NLUA 4O4RA 3CDEA 4F4YA 3PR4A 2AQ4A 1JLFA 3NBPA 3V6DA 4DL5A 2V0NA 3T19A 4DL2A 3MEDB 2R2TA 1RYRA 4WYWA 2O5DA 5FDLA 4ZPBA 4DG1A 5EDWA 3KLGB 3DRPB 1RTDA 4RW6A 4PUOA 1VRUB 2XWYA 5KG3A 1TKXB 5L9XA 3GIKA 4EBCA 1RT2B 4TY8B 1C0UA 4R5PA 5KFFA 3PW2A 3PVXA 4ED7A 2JEFA 3GV5B 4ZPDA 3BGRB 5KT2A 5L1JA 2DPJA 5T14A 4ZPAA 4IH6A 3UDLA 3H4BA 4WZQA 4O3NA 4TLRA 2VA3A 2ILYA 3GIMA 3NAIA 5KFXA 2VG6A 1XR7A 4MK7A 3KK2B 4WE1A 1HNVA 1C1CA 4KFBA 2AU0A 2JEGA 3BSAA 4WXOA 4H4MB 4ZMMA 5KT3A 5EWFA 4J9PA 5KT7A 5J2MB 1K1SA 2IM1A 4IG3B 2VA2A 3FSIA 3KK3B 1S9EA 1R0AB 4EO8A 5DG8A 3BGRA 2WTFA 2W9CB 3FDSA 4H4OA 2C2EA 1TVRA 4NLPA 3DOLB 4QWDA 1TL1B 5J2QA 1GX6A 3KHGA 5HROB 3N6NA 1KLMA 3NKYA 4RW6B 2B6AB 4RW9B 1RTHA 1N5YB 4Q0BB 1QUVA 5KFJA 4XPEA 1LW0B 4B3OA 3UPFA 4Y2CA 3RBEA 3H5XA 3E01A 2W9AA 4KHRA 2WK4A 5KFYA 4IG0B 5C25B 1HQEA 2OPPB 2W8LA 5F8JA 4MKBA 4ECRA 1S0OA 4RW8A 1FK9B 4YR3A 2UVRA 1IKVA 2BQUA 2E9RX 3NAHA 2RF2A 4TQSA 1S1WA 2JC1A 3DI6B 3DLGA 2WCXA 4G1QA 4F50A 1FKOA 2HWHA 3LANA 5KFHA 2AGPA 3IGNA 3PW0A 5J1EA 4URQU 2IAJB 3KHRA 2ASDA 1T05A 4GC7A 4ECXA 5KFEA 3TQ1A 1S9FA 4KAIA 5KFTA 3OL7A 4K4WA 5J1EB 2YNHB 2WOMB 2W9BB 2HAIA 5KG2A 1KHVA 4ECSA 1WNEA 4ECZA 4Q45A 1D0EA 3DRRA 1TP7A 1T03A 3IGVA 1S6QA 4TYBA 4GC6A 3CJ5A 2ASJA 4NLWA 4R5PB 2I5JB 1S1UB 2OPSA 4O44A 1T94A 4ZVEA 1CSJA 3HVAA 4IOBA 5DG9A 2I5JA 2OPPA 4LSNB 4RNFA 3NGDA 3EZUA 3T5JA 4EEYA 4ICLB 1IKXB 3KLFB 2FVQA 2EC0A 2AGQA 1JIHA 2YNHA 4YR2A 3DDKA 3BJYA 5F8NA 4J9OA 5DGAA 5HROA 4RNHA 3DLEA 3G6VA 4K4XA 1S1XB 5KFCA 5J2PB 4ED3A 1HMVB 3HVWA 4R0EA 4G1QB 1T05B 2C28A 2IC3B 5KFGA 2ILZA 4URGA 3QIPB 3PW7A 5HBMA 5EWGA 2UVUA 2RDJA 1QAIA 1TL3B 4I2PB 4H4MA 3TAMB 2C2RA 3CJ4A 5I42B 1RT4A 1TKZB 3BSOA 3V81B 1BQMA 5C42A 1JLQA 3M8QA 2XCPA 4WFYA 3DM2A 5KFWA 1S1VB 3G6YA 4LSNA 3V4IA 1RT3A 1KLMB 3ITHB 2IM3A 3TVKA 4MH8A 1RTHB 4I2QB 1JLAA 1SV5B 3DRSA 4LQ9A 4NLRA 1TKTA 4ED0A 2RKIA 3QLHA 5KFQA 1RTJB 5D3GB 3QIPA 4PQUA 2ATLA 5KG7A 4ED6A 1T03B 3KK3A 1R0AA 4DL7A 2UVVA 1S1TA 2W9CA 1GX5A 3KOAA 5K14A 2W7OA 2YNIA 3H4DA 4H54A 5KT6A 1EETA 3FQKA 4QWEA 1ZTWA 4NLDA 5C5JA 1C1CB 3KK1A 5J2MA 4J9SA 2BQRA 4ID5A 3NMAA 3DYAA 3GIJA 5F8HA 2IJFA 3I0SB 3CVKA 3N6LA 4MIBA 4QWBA 3DI6A 5F8MA 3IS9A 2HMIA 3GILA 3T5LA 2JEJA 4IR9A 1TV6A 3MEGB 4KV8A 3KNAA 4RW7A 2OPQA 4NCGB 1JLBB 3HVTA 3LAMA 4NRTA 4M95A 2D3UA 3DOKA 4DL6A 4Y3CA 4IDKA 5D3GA 4NLGA 1JLCA 4O3RA 3MR5A 3BR9A 3ICLA 4Y2AA 2YNGA 4DG1B 5F8LA 5KT4A 4IH5A 1IM4A 1RA6A 3H40A 4X2BA 3PW4A 1TKXA 4LSLB 4RW4A 3KLGA 3PJXA 2VG7B 3MFHA 2IJNA 4J9NA 4EO6A 3MEDA 4K50A 1BQMB 3H5UA 1RT1B 4U7CA 4G3IA 1HPZB 3EPGA 1UWBB 2UVWA 1EETB 3IG1A 5JUMA 4R8UB 1S9EB 2HWIA 3I5BA 2FVPA 2OH2A 3G6XA 2V4QA 3BQ2A 1HPZA 2WONA 3Q8SB 1DLOB 4YQWA 5KG4A 4MIAA 4R8UA 1S0NA 3SFUA 4PQUB 2E9ZA 3KHLA 4IFYB 1HQUB 4ECWA 2VG7A 2YNFB 3I5AA 1VRTA 4KKOB 3MR3A 1ZTTA 4K4SA 4MFBB 2FVCA 4WYLA 2DPIA 4QW8A 4WFXA 4MKAA 3RBDA 1TQLA 1S1VA 4ECQA 4DEZA 1JLCB 1RTIB 5C24B 5I3UB 3GV7B 1U09A 3JYTB 4KB7A 5DQIA 1TVRB 1TKZA 2ZKUA 1RT7A 3MR6A 4ECVA 1S6PA 5KFRA 2WONB 1TL3A 3HVTB 4KE5A 4NCGA 4RNOA 3RB0A 3PHEA 2JLEA 3IG1B 4KHMA 5HP1B 3T1AA 3GIIA 3KK1B 3QZ7A 5CYQB 4JV0A 5KFKA 2J6TA 4WE1B 3CIZA 1NHUA 3BREA 1IKYB 2UUWA 3CO9A 4K4VA 1NNDA 1HNIB 3RB3A 4DL3A 4LSLA 4RW4B 1OS5A 3FRZA 4LQ3A 3NL0A 5CYMA 3QGHA 5CYQA 2D3ZA 2R8JA 3DRSB 2HNDB 3FFIA 2JC0A 3VQSA 5F8IA 3MEEA 2WHOA 1RTJA 3HHKA 5J2NA 2FVSA 3LP1A 1QE1B 3ISND 3LP0B 4XPCA 3LP2A 3JSMA 5HLFB 4PWDA 4NRUA 4Y34A 4ZP8A 3N6MA 5KFIA 5KG5A 4TYAA 3RAXA 3JYTA 2OPRA 3DRRB 3UQSA 1N6QA 3E01B 3QZ8A 3BQ0A 5KG0A 5I42A 4TY9A 4FS2A 4EBDA 1XR5A 3V81A 3DYAB 2R2UA 3LALA 2C2DA 2XGPA 1RT4B 2XGQA 2V9WA 3CJ2A 3DMJA 1D1UA 4O4GA 1REVA 4O3QA 2HNDA 3FFIB 5KG6A 4QPXA 1QAJA 2IC3A 4ZVFA 3MTKA 1FKOB 2CJQA 5KFOA 2AWZA 5DLFA 5DLGA 1S10A 2HNYA 3Q8QB 4HKQA 1JKHB 2ALZA 4F4ZA 3QO9A 1DTQB 3M9NB 1S48A 4O4GB 5KFVA 2W8KA 1TKTB 2WRMA 1FK9A 3KJVA 4JV2A 3KLEB 3RAQA 4WZMA 4KFBB 1S9GB 4K4UA 2JEIA 3SI8A 3BSNA 3UR0A 1RAJA 4JUZA 3G86A 1JX4A 4ZP9A 2J6SA 1JLEB 4B3OB 3M9MB 1FKPA 2UUTA 3LP0A 2ZD1A 1S97A 1S1UA 5KT5A 3TAMA 2YNGB 5KFPA 4QWCA 3KHHA 5KFZA 4J9QA 3KMQA 2AX0A 2QE5A 1S4FA 2ASLA 5I3UA 2WOMA 2W9BA 1S6QB 3DOKB 4F4XA 2BQ3A 2B5JA 3DRPA 1RTDB 2CKWA 2BRKA 3PJWA 3QYYA 5KFNA 4RNMA 4MFBA 1HARA 1S1XA 1IKYA 3ISNC 1VRTB 4KKOA 4IH7A 3OL6A 3DLEB 3T5KA 1KHWA 2R8IA 4OL8A 4EYIB 1DLOA 2VG5B 1J5OA 2RDIA 2RF2B 2F8EX 3DLGB 2C22A 4KSEB 5DGBA 3OL9A 4ED2A 2IMWP 1DTTA 4FBTA 3CDUA 4O3OA 4ZHRA 4MK9A 1BQNA 2D7SA 3QGIA 3MECA 1UWBA 4F4WA 5HLFA 3E51A 5DQHA 2AGOA 2OPSB 4URSA 3KLIB 2FLLA 2IM2A 1IKWA 1LW2A 4TY8A 4ZP6A 3I0RB 1SUQA 3CWJA 4K4ZA 4ECTA 2FLPA 3KLEA 3I5CA 1N5YA 3V4IB 1S49A 2IM0A 3V6KA 1MU2A 5JXSA 4IFYA 3EPIA 3GYNA 1TL1A 5J2QB 3KMSA 2IAJA 1LWEA 4WFZA 3GV8B 2V4RA 3C6UA 3NBPB 1RDRA 1JLBA 5HP1A 3CDWA 1S1WB 4ZHRB 4ED1A 3OHAA 4J9LA 1REVB 4FS1A 2XC9A 2VG5A 1J5OB 4Q44A 1S6PB 4RW8B 3Q8RB 3OLAA 3H5SA 1C1BB 1C0TA 1RT5A 2OPRB 1MU2B 3M8PB 5J2PA 2FJWA 3D28A 4K4TA 2J6UA 1K1QA 1RTIA 5C24A 4QWAA 3T5HA 3V6JA 2FVRA 2B6AA 4Q0BA 5J2NB 2E9TA 5DG7A 1RT6B 4RUCA 3MEEB 1IKWB 1LW2B 5KFAA 1LWFB 4I7FA 4ZVGA 4IDKB 1VRUA 1HQUA 3KLVA 1JLAB 1SV5A 4I2QA 3CJ0A 1RT2A 1RT6A 1SH2A 3IRXB 1BQNB 5EWEA 4J9KA 2ZD1B 4NLQA 3OSNA 4KV8B 2IA6A 1DTTB 3DM2B 1FKPB 3IS9B 2HMIB 1JLQB 1C2PA 4IQXA 1I6JA 4TXSA 1N48A 3IN5A 4ZPCA 1C0TB 1C1BA 1RT5B 2BANA 4M94A 2R8HA 1S0MA 3RB4A 3Q8PB 1RT1A 3KK2A 2GIRA 3H2LA 3V6DB 5L1IA 5KFMA 4ID5B 3HKWA 4NYZA 4ECUA 3OL8A 3LAKA 1S1TB 4HYKA 1DTQA 1JLGB 4YMEA 3RB6A 3C6TB 2YNIB 2QV6A 4IRKA 3IRXA 3SFGA 2YKMB 2ZE2B 4RUAA 2BE2B 1HYSA 3QGGA 4K4YA 1LWEB 3D5MA 1MMLA 2W7PA 4NLVA 1LWCB 1C0UB 2I1RA 3MF5A 3OSPA 3OHBA 3KLHA 1IKVB 1NHVA 4EYHB 4KO0B 2R8KA 2OPQB 1TV6B 3MEGA 3M8QB 3I0RA 1S9GA 3KLIA 4IFVA 2BR0A 3V6HA 3LP1B 1JLFB 2FJVA 2GC8A 2GIQA 4FBUA 2WB4A 4WXWA 5F8GA 2R8GA 2B43A 3MFIA 2HNYB 4JV1A 5K14B 3QO9B 4ECYA 3C6UB 2XI2A 4DL4A 3PW5A 1JLGA 4IG3A 5L1LA 4ED8A 4QW9A 2RKIB 3QLHB 1YVFA 4IRCA 4IFVB 1HNVB 2BANB 2B5JB 4ICLA 3DLKB 5EUHA 5C42B 1EP4A 4EBEA 3PZPA 1XR6A 4Q43A 4YR0A 3LP2B 2D41A 4KO0A 3QIDA 1ZETA 2AX1A 1EP4B 2HNZB 4XO0A 4PWDB 3DLKA 4O44B 5L1KA 2FJXA 4ZP7A 2R2SA 1JLEA 4I7FB 1LWFA 2BE2A 2BRLA 3I0SA 4TN2A 1RA7A 4TQRA 5CYMB 2IBKA 3H98A 4RW9A 4MK8A 5DQGA 4Q8EA 1N4LA 5FDLB 3M9OB 4J9RA 4YP3A 1HNIA 3CJ3A 5F9LA 4H4OB 3H5YA 1Z4UA 1T3NA 3PR5B 4Q8FA 4J9MA 5KFLA 1JKHA 3OLBA 4NLSA 4IR1A 5KFUA 2XCAA 3GQCA 2XI3A 1IKXA 3KLFA 5KFDA 4O3SA 5F9NA 4RU9A 4ZVHA 4RNNA 2HNZA 3DMJB 1RT3B 3ITHA 4IG0A 5C25A 2VG6B 1N56A 4NLYA
chains in the Genus database with same CATH superfamily
4ANEA 2YKNA 1HQEB 2RVJA 2O67A 4DV4J 3BPDA 2X7IA 2F7VA 3L4BC 3R5AA 5KG1A 5LOQA 3GFXA 3CJQA 1M5VC 1LWCA 3EXYA 1V3RA 1EB0A 5BR8J 3JSMB 1P1LA 3VVTA 2DNMA 3M8PA 2YKNB 4TLQA 4TVAB 2A2CA 2GHVC 3FQLA 2ZC3A 5KFSA 5LMUF 3UCUP 1HNWF 3DOLA 1BY9A 4PUOB 1KWMA 1RBLA 3TJ9A 4NLTA 3MPWA 5IOLA 1CC7A 4DV6J 1H74A 1HMVA 4KHPJ 2RD5C 2CZVC 3G82A 1IR2A 3GIRA 3CDEA 5LSRA 2W2QP 4U6PA 4RPFA 4DR3F 4QR0A 1GK8A 1VRQC 3MEDB 4NA2A 2R42A 2W4DA 1OPZA 3GU0A 1UP1A 2POKA 3DHXA 3ILJA 2MKIA 1SKRA 4XAKA 5CA5A 4DV5J 3MD1A 4A8QA 1JX4A 4B9SA 5KG3A 1VRUB 4JI8J 5L9XA 3A8EA 4EBCA 2ZH6A 2UUBJ 1KTQA 1ZA2B 2JEFA 3I87A 2MY8A 3N79A 3Q8UA 5T14A 3LO3A 3FCWA 2CRLA 3UDLA 2BM0A 2FHJD 4DR5F 2ZFHA 4O3NA 4ZLJA 2ERRA 2RHQB 2VG6A 2V2KA 1QJHA 3MMBA 4MK7A 4WE1A 2VF3A 5KFXA 3MURP 4FF1A 2XSFA 1PSDA 3EVOA 3MM6B 4CLSA 3M32A 1YWXA 3BN7A 5KT3A 3FBFA 2DR7A 4QIEA 5ETLA 1LKZA 1EKSA 3MAAB 4ZCMA 1VBYA 4Y00A 3PYDA 5DG8A 1P6TA 4X4QA 4PYAA 2WTFA 1VQPS 4KGVB 1TTHB 2Y9HA 2J7WA 4H4OA 2HBYB 2MKHA 3PYEA 3DOLB 5GADU 3PIPQ 4FYDA 4ES1A 1GX6A 2LQ9A 3HSDA 1RBAA 3FBBA 1ELOA 1JB0C 2A0FB 3NKYA 5ETTA 4Q0BB 3MEKA 4FYXB 1QUVA 1ZAXA 3MM7B 5HI7A 4XPEA 4B3OA 2CJYB 4CCHA 4JI5J 2PIIA 2IJRA 3H5XA 2HHXA 1H3DA 2V69A 2RH3A 4DWIA 4JI1J 1MWYA 3BS9A 2X1AA 4D3HA 3G9CA 5C25B 2W8LA 1HQEA 2OPPB 1JJHA 1L3KA 1Y5NB 3KKFA 6FDRA 1BWEA 5I4MA 2FDNA 2F3JA 3GYXB 2EEYA 5IQQA 2UVRA 5LSOA 1IKVA 2P5VA 4NMXA 2YX1A 4TQSA 1R31A 4E8UA 3O3LA 1WC4A 2GO9A 3U7JA 2JC1A 4IOCQ 5D4LA 1MMDA 3DI6B 1UKUA 2HAFA 1SJ4P 4B3TJ 2EBGA 4LFBF 5B0EA 1IXKA 2KZMA 3AOCA 3FRYA 4FZVA 4M5DB 2DYAA 3KHRA 1M5PC 1RGVA 2C1EB 4P9SA 3ZNUA 1N32F 4FKYA 1E6YB 2YNHB 2W9BB 4HL9A 2H3EB 4OLPA 1KHVA 1WNEA 3FUYA 1TP7A 3DRRA 3DDNA 1S6QA 2WVEA 3CJ5A 3JSYA 4I69A 4R5PB 1HBUB 4QIFA 4Z2XA 2DO0A 1S1UB 2GGPB 1NDLA 2OHDA 3CD5A 1T94A 4OJHA 2N4DA 4P52A 4ENOA 3U27A 1RQ0A 2HBQB 2Y3YA 4CLFA 3NRBA 2I5JA 3GJRB 4DV7J 2KHDA 4DR1F 1WI6A 3ILLA 2OFHX 4P2SA 2QA4G 2DNLA 4OI4A 1Q81T 2RS8A 1F1BB 4CM2A 1T7PA 4B3SF 2GV1A 2BJ1A 2DO4A 2A6OA 2G13A 4OIXA 2JHEA 2RUGA 5A8WA 3HMJG 5J2PB 3QNWB 1HMVB 1FRJA 4ZLLA 1F9FA 1RLDA 3HVWA 1U0HB 2M9KA 2X51A 4KIAA 3TAQA 1T05B 2PD1A 2VBZA 4PRFA 2BA9A 3VF0B 3D4JA 4X4NA 5KFGA 1Q7YT 5HBMA 3KNGA 4YY3F 2KG0A 2DHSA 2RDJA 1TL3B 2CXEA 3QT5A 3CCQS 4DV3J 4FXDA 4K0KJ 4JV5F 1S72S 4H4MA 2N82B 4BHQA 2KJWA 4WP3A 1VQ9S 5GVQA 3BSOA 4JI3J 3V81B 5AJ3J 4EI2A 1SC1B 2DHXA 1JLQA 3M8QA 1X4BA 2ZITA 2XCPA 4P72A 4FN5A 4DX7A 2DIUA 1WTBA 1S1VB 2C2OB 2DY1A 3H42A 1M1HA 3AY0A 3W8GA 5LSLA 3UVJB 4A47A 1RTHB 3BN4A 4I2QB 1JLAA 4HH1A 5CQGA 4LQ9A 2VUGA 1IR1A 4NLRA 2VBXA 2SXLA 4QJVA 5AXKA 4ED0A 2R7WA 3THVA 3THTA 4DR6F 3H0PA 3QIPA 1QSSA 4KT0C 5KG7A 4ED6A 3KK3A 1R0AA 3EVWA 4DV6F 3D1QA 3IBFB 3CCRS 1HW9A 4M5MA 2ZOMA 5AE3A 2W7OA 2BEFA 3H4DA 5ETOA 4OZ1A 3QT8A 3FQKA 4IO1A 5KT6A 3AAWB 2F4VF 1ZZNA 1C1CB 2BQRA 4KGKA 2ZJQQ 4IO9Q 4ID5A 3NMAA 5JMNA 2HIQA 3GIJA 1K9MT 4DUYF 2EW9A 2LU2A 2IYGA 2K3KA 4OYAA 3CVKA 5KFEA 3GILA 4JI7J 3GJQB 3PCOB 3T5LA 4B3MF 4IR9A 2CWKA 4KV8A 4DSLA 2WB1D 3IR6B 4NCGB 1JLBB 4C3KA 3LAMA 1XERA 3M2UA 4NRTA 5IV4A 4JI7F 4Y3CA 4IDKA 2JWNA 1UWAA 3MUMP 3SV3A 1SIWB 5E7OB 1JLCA 5D4NA 4CH1A 4X84A 3ICLA 5F8LA 2M7SA 1RA6A 2PA3A 5GAHU 3EX7B 4XK8C 3PW4A 2EFOA 4DZ6A 2WSFC 1XN9A 4DV2F 2IJNA 5T41A 4EO6A 2ZH7A 1M1GA 3I6PA 4J5OA 3P6YC 1AFJA 2BJEA 3M2VB 3ZZOA 3KFWX 3BO4A 5D0HA 2AEFA 3DOMB 4CLKA 1VQ7S 3T9NA 1HPZB 1X5SA 4EGLA 4XIUA 5B0BA 3DKDA 4HH0A 2FZCB 2LECA 1I5OB 5BYRA 4J37A 4DR2F 3BQ2A 3VGVA 1MWQA 4YQWA 4CZCA 1VK3A 2GAHC 2E9ZA 2QGFB 1DFDA 2BW2A 4PCQA 1FEHA 4IFYB 3I4HX 3VTIA 2VG7A 1VRTA 4E0DA 1HFEL 3IA0A 2FVCA 4WYLA 2VIHA 3J81Y 1VHFA 3KYLA 2RRBA 1LQ9A 1SJ3P 4MKAA 4RO0A 1WF1A 5EHHA 1TQLA 3JAMU 3VAKA 1URRA 3F0NA 2M4MA 1RTIB 1IUJA 1FFSB 1N5VA 3OQ2A 4LF8F 3GV7B 4HT5A 5L39A 3MR7A 2VPYB 2M3DA 4USKA 3NLCA 3VALA 4AQYJ 3RR7A 1RT7A 3GYGA 1RWVB 1WDDA 1OMSA 5CH7B 4DUYJ 4LRBA 1CJKA 1TELA 2PN6A 2R3VA 3TJ8A 1B70B 3IFEA 4ETXA 5SZTA 3HVTB 1B3TA 3KJQB 5A6PA 2ZH9A 1G3OA 2Y1IA 1Y3KA 3MMCB 2COLA 3B78A 2HQ3A 3Q83A 2D9OA 3IG1B 4KHMA 4EUVA 1CQNA 3QZ7A 3GIIA 3DLLQ 5KFKA 3RR8A 5EN1A 1T95A 1Q7LB 3NWRA 2AT1B 3ZTRA 2JRSA 4DL3A 4LQ3A 1OS5A 3NL0A 3HD1A 2RJZA 2L08A 3J80U 4EZ6A 1T02A 3L7UA 4ILRA 2YWWA 2I2YA 3I9ZA 2QMXA 3QFWA 1YRUA 1F6TA 2YQ0A 4FF3A 2WHOA 5BYQA 1E6VA 3HHKA 5J2NA 5E3QA 3MM5B 5KG5A 2KG1A 2ZH2A 4NRUA 1Q8IA 4NXMF 4FF2A 1FHTA 1M0SA 1D9FA 4NCBA 1EQ0A 4M5HA 1KLNA 4ELUA 2OPRA 2V6AA 5JVHQ 2FJEB 3E01B 4EBDA 4LREA 5KG0A 5I42A 4TY9A 3W2VB 2XMUA 2MJUA 5CD4H 4FS2A 2MKKA 4W92B 1UMJA 3DYAB 2R2UA 2V9WA 4OX8A 2XGQA 2N7YA 4JYAF 3TZZA 1D1UA 2VONA 1REVA 2CZ4A 1JJ2R 4QPXA 2LFVA 2IC3A 3H2VE 1IBLJ 3FMBA 3JTPA 2IA0A 1W7WA 3ULHA 4OJ1A 5KFOA 2ZNZA 1LFWA 4HKQA 2LDYA 3Q8QB 4C97A 2W8KA 4EMDA 1RAAB 4UUXA 5KFVA 4WK3A 3NCQA 4CT8A 2XO6A 3KJVA 4LBPA 4PABA 5U47A 5D0RA 3J7A1 5A2QU 2AJFE 1S9GB 1VLOA 2DHAA 4DUZF 3A3NB 1WG4A 3CO0P 1FRLA 2V8VA 4JUZA 3HFKA 2V34A 3R6GB 4LJMA 1WACA 2WVCA 5DJBA 2HHPA 3CCVS 1L3VA 2BMBA 2CQHA 4RBUA 2ZD1A 3UE2A 3W61A 2BACA 1S97A 1L3SA 2CNNB 3TAMA 4DOZA 4JOUA 2YKOA 4QWCA 3EYZA 1HWKA 2A3JA 1TL5A 1AB8A 2J9EA 5ETQA 3KMQA 2QE5A 3U02A 2BVZA 2E5JA 1UVIA 4X64J 3QT6A 2WOMA 1VOMA 4ES3A 1TFWA 1NCLA 2BQ3A 3CDBA 1ZBTA 3DRPA 4KPYA 3C3LA 1U26A 4GVBB 4HLBA 2LVWA 4A8MP 2K1RA 2LMIA 1HARA 1IKYA 2BW7A 2JZ5A 2VFUA 2D3OR 1HR0J 5AJ3F 2A18A 1M5OC 1KKHA 3O2IA 2LQ8A 2PE8A 1KHWA 4OYXA 2M8DB 2R8IA 4EYIB 2AEMA 1J5OA 2I9SA 2RF2B 1WEZA 3DLGB 2GVZA 4NA1A 5B0AA 2CQPA 4L3NA 4O0IA 4ED2A 2G1DA 1XNRJ 2YPZA 2YWEA 4JI1F 2D7SA 1YJWS 3MECA 3T5JA 2JX2A 4ZK7M 2QLJB 3PFOA 5EX0A 5DQHA 2F8HA 3OJUA 4ZP6A 2HEKA 4CRJA 3CWJA 2XWXA 4QR1A 4YDXA 1L5UA 3TO8A 3HDSA 4LT6A 4NZ6A 1N54B 2AJ1A 2R4FA 2VV5A 2QA2A 1IBLF 2FLPA 2QLBB 2Z56B 3KG4A 3M4XA 3I5CA 2ZVSA 4EZ9A 2IM0A 2OGUA 1HWIA 2IDEA 3RGIA 4IUFA 3OVBA 1Z2LA 4IFYA 3EVMA 4JI0F 3EPIA 1DQAA 1TL1A 2IDLA 1NSPA 1ZPVA 3S8SA 1LWEA 1SIZA 2NXJA 3IM8A 1JLBA 4P2MA 4CNYA 4ZHRB 1NSKL 3QPIA 4OX9J 1B7FA 1NM2A 2W2PP 1REVB 1QTMA 3K7RA 3SSQA 2E7XA 3TA0A 1VGYA 4DV4F 2VG5A 1ZS6A 2E5HA 1JK9B 4UQTA 2H5JB 1K0TA 4RW8B 2Z30B 5D15A 1WELA 3Q8RB 3Q23A 2M8HA 3H5SA 2CYYA 1U0HA 1RT5A 2BJ3A 3D28A 3W8PA 1HBOB 5J2PA 1RABB 5KAKA 4GKKJ 3QRPA 5H9FJ 1WTFA 4CI0B 3M2RB 4PXCA 1K1QA 3M8YA 3MM7A 2FHJA 3NGUA 2FVRA 4Q0BA 1DARA 2DH8A 3DGVA 4KYZA 5J2NB 1FF2A 2ASYA 1NRKA 2MLXA 3TP2A 2XTJP 5ETPA 1HQUA 4ATNA 3OXLA 5C2CA 3CJ0A 3HHLB 2D69A 2VPXB 3FEZA 2E7WA 1VQ4S 4KV8B 1FKPB 4HR2A 1JLQB 3V5RA 1QSLA 4IQXA 3GZ7A 2MKSA 2W2OP 3EGWB 3CC2S 4LF4J 4JI4J 1N48A 4Q7AA 4ZPCA 1C0TB 2BANA 3UDEA 2AJ2A 2Y1JA 1J5EJ 1Q5YA 1KN6A 5FJ4A 3V6DB 1BE4A 3ZFVA 4QQBA 3CE8A 3HKWA 4NYZA 5HJYA 4ECUA 3R2CJ 1EKRA 4KQZA 1DTQA 2BOAA 3HF5A 3MCNA 4YMEA 2BM1A 3C15B 2XBPA 1R8PA 3CC7S 1OYDA 2YKMB 2ZE2B 3QGGA 3AD8C 1W2IA 1NHKL 3IAM9 1MMLA 3NGKA 2I1RA 1UFWA 2K8GA 4FVCA 3CT9A 3IXQA 1J2VA 2XYGB 4EYHB 1IKVB 1NHVA 3R1LA 4MYUA 3CSKA 2Q6BA 3CCSS 5CXTA 1V3ZA 1AXQA 3HLUA 4GO5X 3CJSA 2V2QA 2FC9A 4ZS6A 3M8QB 2KT2A 2RHSB 3DHWC 5K8PA 1XMOF 1FJCA 5IS2A 2GQCA 3E3XA 3PO4A 2DXDA 3V6HA 3AOAA 2GIQA 3NNCA 4FBUA 1RWOB 1YRXA 2Q43A 3MFIA 1FI4A 5K14B 2KB2A 2RE1A 5E5NA 2ADBA 5L38A 4N56A 2RDDA 1FDAA 4YFUA 1HBMA 3ILOA 4E98A 1QM9A 2MDAA 4DL4A 3PW5A 4AQYF 1WSVA 4IG3A 5HANA 1M90T 1PG5B 2AYEA 4ED8A 3QLHB 1F3FA 2QL9B 3ZZUA 4USMA 2MZRA 2UUAJ 5A8KA 1YVFA 3E2EA 3ET6A 9ATCB 2HW3A 1VYAA 2ZH3A 2BANB 2B5JB 2HGMA 2ADCA 2MSTA 2QLFB 4QCLA 2RRNA 3R7BB 1OY8A 2RIJA 1XWLA 5C42B 2D9PA 1T9WA 3HULA 4C48A 1SJ1A 1NK8A 3PZPA 1KOOA 3K59A 1ZA1B 2KDOA 4Q43A 3QIDA 1ZETA 4FXWA 3M2UB 4DV1F 2DNQA 2AX1A 2VC0A 1EP4B 4CQ1A 3RRHA 4PWDB 4O44B 1X4GA 3OVAA 1WF2A 1PIEA 3D0IE 1WWHA 1JLEA 3TR5A 3N9UC 3V2UC 4DPOA 4TQRA 3AHPA 4N8NA 2QFJA 2CDQA 5CYMB 2F65A 4A8OA 5ADZA 5HVGA 2DNPA 2ABYA 5DQGA 4CO5A 4Q8EA 1UZHA 3CUNA 3Q2SC 3X3UA 1U24A 3M9OB 3G2XA 1X9SA 4F3OA 3C66A 4ZVRB 3W9HA 2MGZA 1HNIA 1AA1B 1F9HA 3F41A 5F9LA 4H4OB 1DRZA 3NWGA 3PR5B 2OEMA 1T3NA 4Q8FA 3IC1A 5IC4B 1T9VA 3CCMS 4IR1A 3GQCA 4PPZA 1PJ5A 3KLFA 2P8IA 1SKWA 3LGHA 4ZPTR 2Z4PA 2ASDA 4RNNA 4JI6F 4C4WA 4NOHA 4M63A 2K2PA 4OYPA 3PEHA 1R6YA 5C25A 3HZEA 1NK0A 3MMBB 3FRZA 2P6TA 4NLYA 4BCAA 2LXIA 3FCHA 4NLXA 1N6QB 1ROFA 3GWCA 4QR2A 2I6WA 4N5SA 4RZRA 3ZZ0A 2ZHBA 2FLNA 1M5HA 1KFSA 2F1FA 1SH0A 3N0VA 5DM6Q 3IWNC 4OX9F 2E1RA 1HL6A 2MHEA 1O51A 1QE1A 3H90A 1FRKA 3PHTA 2R2RA 2KHCA 3EWGA 4DF4A 5HBMB 5H9EK 4GRSA 2CPJA 3SQGA 4QIVA 3C6TA 4OQJA 3WIVA 2V50A 1HYSB 4DSKA 3X1LB 3HSGA 2YBVA 3OPKA 3MECB 4YHHF 3K5LA 4LF7F 4RW7B 1RISA 3IBWA 1GTHA 3H59A 2CQDA 3R7NB 2QO3A 1RU1A 1U8SA 2H1YA 3MPVA 5F0UA 1XNQJ 2FHOB 2KN4A 3K57A 4PG8A 4AL5A 3V6DA 1OY9A 4HTJA 3W66A 2PMWA 4DL5A 2GCFA 3MTJA 3T19A 4DL2A 1U7LA 4A8XA 1F2HA 1B0VA 1TAUA 1HHQA 2XG8A 2R2TA 1RYRA 2F63A 2AV5A 4YOEA 2H48B 3MMAB 4HI1A 2OTLS 4DG1A 3NGSA 4Y2MA 3DRPB 4PUOA 5EDWA 2JJ4D 1UJ5A 3SSRA 4TY8B 4DPYA 4R5PA 2BKPA 2HWTA 3W9IA 5GAEI 5M2RA 4FPIA 3GV5B 1EX8A 2B8PA 1WG5A 5D6GA 2Q6CA 3BGRB 1I3OB 4ZPDA 4FPRA 2EFGA 1PGZA 2QEXS 2HG4A 1LK7A 2XY7A 3HCXA 1I94J 1ZM3A 3FEYB 2ILYA 3GIMA 1NKEA 3CJKB 5HQ8A 3V4MA 1HBOA 4P2XA 1JQGA 3DGPB 5FLXU 4DCPB 1HNVA 1MNEA 4A8FA 4KFBA 2ATCB 2JEGA 1OIAA 5LXRA 1S6OA 4ZMMA 4J9PA 1YI2S 1XC9A 2LU1A 2KRRA 1A7GE 2EK6A 4B9TA 2MB0B 1S9EA 4NPOA 4AXJA 2HZCA 5C2GA 2WSCC 4CLUA 4EU0A 2W9CB 2W24A 2QYGA 1TVRA 4NLPA 1TAQA 2HFSA 3FVYA 4ZCLA 1TL1B 3BGUA 4PG4A 1SJFA 2XNRA 3CJ8A 1APSA 3N6NA 3NEKA 4GMKA 1NK9A 2IHR1 1S0NA 4RW9B 1OWXA 1T9YA 3O1LA 4ZVTB 3UPFA 4OZLA 2ZZNA 2DEIA 4ELVA 3E01A 2CPDA 2FGOA 3CCTA 5CCLA 3B8HA 3UW1A 9RUBA 2DHGA 1WSRA 2C42A 1Z2ZA 2G1HA 3TI0A 2HHHF 4TKTA 5F8JA 1S0OA 2WVFA 4RW8A 1IWAA 2I38A 2W4CA 4YR3A 1RCOB 3H40A 3W3SA 2PEBA 4L74A 3FC9A 1WC5A 1NK7A 4OYMA 4DCJB 1OPIA 1CJTA 5AXMA 1S1WA 3W5YA 4DPWA 2ZWPA 2B4PA 3ETMA 5KFHA 4LF5F 1WF0A 3ZXWA 5J1EA 1D8ZA 3R27A 2GX8A 5HMXA 3SYZA 3PW0A 3HM9A 1PBUA 2QMUB 3GLJA 3I9V9 3JTNA 3K89A 3PNIA 1TUVA 4GC7A 4ECXA 3K5OA 1C4CA 2G0JA 3D0GE 3TQ1A 4K4WA 1SQEA 1WHVA 1RTZA 3GE9A 2HAIA 3P5TL 2G4BA 1RLCL 4LSZB 3IGVA 1T03A 2QA4S 1SL0A 2CPHA 1KQGB 1UW9A 2VB6A 4YS2A 2V4JA 2VD3A 1PBAA 2OKQA 5KOXA 2RSQA 4JI2F 3VWSA 3ZTSA 3TUZC 1GH8A 1SKUB 2AKWB 1IKXB 3KDOA 1DBDA 5AT1B 4AE5A 1LWXA 4DR1J 2F5GA 1RE1B 4E2FB 4DLGA 3TW0A 2XS5A 3HHNB 4Y28C 5HROA 4RNHA 2VFTA 8AT1B 3I32A 5B7WA 4K4XA 1YDLA 2BX6A 1X5TA 3EDRB 4U67Q 5LMNJ 4ED3A 3C8YA 2D74B 3C14A 4R0EA 1Y11A 4DMZA 2PI4A 4QYZK 4DU7A 1R43A 5IXUA 4X62F 2C28A 2ZEJA 1Q8BA 2ZBPA 1KR4A 5EWGA 2UVUA 4B3MJ 4I2PB 1V5VA 4M8LA 4USIA 2DR8A 3J7AN 1YSJA 3AD9C 5DDQC 4CLWA 1H7WA 1CEZA 3TAMB 2ZHOA 2MZJA 3CJ4A 4ZKAA 5I42B 2A10A 2P9EA 4AL7A 1X4CA 1VK8A 2KXNB 4KGZB 1BQMA 2A6MA 1NKCA 3G96A 1RAOA 2V8PA 5RUBA 4N76A 5T7LA 4ILMA 4WFYA 2HHVA 1HWLA 3G6YA 4LSNA 3V4IA 1WEXA 1RT3A 2IM3A 4OHXA 3TVKA 2V68A 4UY8T 3S7RA 3GP9A 3SXLA 1R8CA 3POTA 3K2YA 5GMKa 2RKIA 3TUPA 4C7QA 5JJBA 4V19J 2PO4A 2ZZTA 1MG7A 1UEUA 2UVVA 1CG2A 2GNKA 1NDCA 4HEA9 4N41A 2DGVA 1URNA 1SC4B 5A0YA 2CDRB 4USHA 1UA1A 4USVA 2YNIA 1WKKA 3CTRA 5ETRA 4DX8H 4F2SA 1ZPWX 2AEJA 3IRWP 2Q66A 4WF9Q 1U6BA 3M7VA 1XQIA 4J9SA 1FE0A 3D0HE 3NS7B 3IR5B 3DYAA 1U6ZA 4OJ3A 3OTDA 1GMWA 3EXCX 4FS1A 2DGTA 2GJFA 3N6LA 2CNLB 4MIBA 2XHCA 4MT1A 4OZ5A 3PYGA 3VGSA 2JEJA 4YDDB 2GMLA 4UW2A 2GJ2A 3D1HA 1X4FA 4M95A 2FTRA 3R6LB 1OO0B 2AMCB 4DL6A 4NCAA 4ZA1A 4A8YA 1PILA 2NXCA 3NXZA 3J7Z5 2OP5A 3EZOA 3NGTA 3MR5A 4H4KC 2JL9A 2KU7A 3MGJA 1U4BA 4IH5A 4J91A 5CZVA 2J0WA 4RR5A 5IQ6A 1TKXA 1RCXB 1UTAA 2J9CA 2APOA 1BQXA 2UP1A 3KLGA 2VG7B 1GTEA 1OQ6A 3MFHA 4J9NA 2UXDJ 3DRYA 3T1YF 1AROP 1HI8A 2OLWA 1BQMB 2GIFA 2P9CA 1UW4A 2R7OA 3AOBA 4DR7F 5ETSA 2BJ7A 1X5PA 4U7CA 3PIOQ 3AA8A 3IG1A 5IFMA 2CFXA 4NYPA 2B8QA 3KG0A 5JUMA 3MOJB 2UXBJ 2OH2A 2V4QA 1HPZA 1DLOB 5KG4A 3B54A 3SFUA 4KJIA 4P6QA 4ITSA 2IRUA 1OSDA 1GQEA 1NH8A 3DC2A 4OZJA 3I5AA 4K4SA 3E8OA 4QIWD 3PRVA 2E5IA 2BUNA 2DNGA 2OD4A 2V2VA 4IYQA 4YB7A 1S1VA 4DEZA 1JLCB 7FD1A 4K2XA 1OY6A 4S0MA 4CO2A 3FBCA 4LF6J 5AE1A 1S4EA 3DCAA 1U09A 2MLYA 4LRCA 5CABA 2VASA 5DQIA 3J80Y 2ZKUA 2JLGA 1VQYA 4NI2A 5L46A 1RHKB 3MR6A 1H2UX 4FP9A 3FZ2A 5KFRA 2WONB 2QTWA 1TL3A 3IMQJ 4NWBA 4KE5A 4NCGA 4OI3A 4OLOA 4ZVOB 2FB0A 2HFVA 3QWPA 4X4SA 3RB0A 3PHEA 2JLEA 4X62J 1NK6A 2HHSA 1VR6A 3DN9A 4L76A 5A8RA 4L72B 2QFIA 3MM8B 3CIZA 3K17A 5E3RA 1NSQA 4DV7F 3N5BA 5IWAF 2CQBA 1NNDA 1HNIB 1H72C 2HS4A 3ZTQA 3RB3A 2EFQA 2QRRA 3TVZA 7AT1B 5CYQA 1G1XA 2BKNA 1ZM9A 2B4UA 5FIIA 3IBCB 4QYRA 2R8JA 4ZJLA 1YBAA 3VQSA 2J7UA 1DAXA 1EHWA 2ZVIA 4C3MA 2CUYA 4CLPA 4CTAB 3QJPA 2PA8D 4QOTA 2LQ5A 3LP1A 4Y6IA 5HLFB 1UPPA 4PWDA 4ZP8A 5T7LB 1CQMA 1KOHA 5KFIA 1HQ2A 2J9DA 1Q86T 2QX0A 2CQ1A 1FD8A 3B82A 3PRDA 3JYTA 1R27B 2KRBA 3DRRB 1UETA 5D78A 3UO0A 4USWA 4ECTA 4DSIA 4QU6A 2FZKB 2Y8YA 1XR5A 1NK5A 3V81A 3CCZA 2XMAA 1BXNA 2FY8A 3LALA 2RU3A 2XGPA 1F9EB 1WOSA 2M2BA 4ER8A 3N4WA 1ZM4A 3R7SB 1HI1A 3MTKA 4ZVFA 5DLFA 1R7IA 1V3SA 2MQQA 5DLGA 2DGQA 3SQOP 3EGNA 4G65A 1JKHB 1EQMA 2VKZG 4W98A 5G0RA 4F4ZA 3QO9A 3ADAC 2ALZA 1S48A 4O4GB 2K3IA 4WPAA 1FVSA 1TU0B 4DSFA 1G2EA 3VCDA 2RQCA 1FK9A 2B51A 1NPRA 2YWGA 3Q86A 4M5LA 3KLEB 2LA6A 2V8DA 1CJUA 4KFBB 2CQ4A 2HHWA 4WZMA 3CCUS 3MPDA 2AYGA 1W2BR 4WKRA 3NG8A 3UR0A 1YJ9S 1TUWA 3G86A 3OTOF 2DRBA 5CD4A 2J6SA 4B3OB 4NA3A 4LF6F 3M8SA 4WCEQ 2XZWA 1H38A 2UUTA 3LP0A 2F4FA 2X1FA 3O8WA 3O6QA 1S1UA 2GGPA 2W4PA 2CJAA 2XNQA 2JDJA 1KQFB 3OUYA 1UL3A 4XTTA 3TARA 1SJQA 2CPYA 2EK1A 5KFZA 1CBKA 3HKZD 4ALZA 4J9QA 3IP0A 3VAFA 2B4OA 2OO4A 5AXLA 2ASLA 4DV0F 3QRQA 3DOKB 2IVYA 4ZDNA 1U0SA 4Q2MA 5KFNA 2BRKA 2VBYA 3QYYA 2E5LF 1NK4A 1HW8A 3OFEA 4DPXA 2DNKA 5K8MA 3ISNC 3FSXA 4TU7A 3J7ZT 1VRTB 4YB6A 4NL5A 2ZH4A 3SV4A 1EIYB 2EKNA 1W26A 1UVNA 1RXOB 1SL1A 4HTIA 5D77A 1YJ7A 3D3BJ 4PKDB 3O44A 2LYVA 2CJBA 2NCKL 2F8EX 3NOGA 5GAHI 1HKAA 3OL9A 1S99A 2IMWP 1CJTB 3UFCX 4FBTA 3BBBA 3AFGA 4MK9A 4O3OA 1BQNA 3QGIA 4H4KA 3S01A 1RKIA 4F4WA 1B7YB 4KY3A 3E51A 2AGOA 2HYIB 3KLIB 2GHWA 1T0TV 1NO8A 1IKWA 1LW2A 1RAFB 1ACMB 3I0RB 4DR3J 3UD4P 2FLLA 3HJVA 1CULA 1HA1A 3CJTA 2FGCA 2KYXA 1KFDA 4LRDA 2CPFA 2NLWA 2HQFA 3SDEB 1S49A 3QGPA 2QC3A 4FYYB 5JXSA 1VCTA 4C6AA 1NDKA 3KMSA 3M6VA 5DS7A 1AW0A 2V4RA 3A4TA 1SC6A 3NBPB 4CO1A 1RDRA 4AT1B 3UN2A 4C8YA 4WP8A 4UZBA 3M6XA 4R25A 4P2FA 4J9LA 2CVEA 2FHMA 1KNZA 2QG9B 2UXDF 1Q4RA 3KG1A 4ZVPB 1S6PB 2M5YA 1DJ0A 3TA2A 3HPOA 2W2MP 5LMUJ 3OLAA 1J5EF 3M8PB 2FJWA 2L9DA 4AD6A 4K4TA 2DRDA 4OI6A 8ATCB 4J7CA 3SDEA 4WFBQ 1NAQA 4L6V3 2OELA 3BQ0A 3T5HA 3V6JA 1YTYA 2R7VA 2WBMA 1IM6A 1NSAA 1P8GA 3FJ2A 4DR7J 2DGOA 1RT6B 4WU2A 3MEEB 1IKWB 1LW2B 1Y5IB 2EXUA 1G7CB 2EKYA 3PRBA 1CULB 1VRUA 1HBNB 4CT9A 1JLAB 4I2QA 3QWUA 4F26A 2MPUA 2A1BA 1SH2A 3OT9A 3WHIA 1BQNB 4Z37A 1TFYA 1S5ZA 1N34F 2IA6A 4DF8A 3DM2B 1IJFB 4JI8F 2HMIB 1C2PA 2F4VJ 1I6JA 3RZAA 1UZDA 5D4OA 3UR3C 1TMJA 1BWVA 1GNKA 1XJWB 1RAIB 1WKJA 3FMWA 3IWXA 3M1VB 6FD1A 1RT1A 4N7TA 5L1IA 3RTVA 3RB4A 3K5MA 2PFFB 3H8YA 4CIOA 3LWMA 3DFEA 3D66A 1U1PA 3OL8A 3GJTB 1HD0A 4OYZA 2HK3A 1FXDA 3GB0A 4K5SA 3LOUA 3DU6A 3C6TB 2K1RB 4AFFA 3HHLA 4DQRA 3SFGA 1U1RA 3CULA 3AQPA 3LA0A 2R7QA 1HYSA 3MZIA 3W65A 2XLIA 1P27B 1ZAWA 5HQLA 3D3CJ 2RB7A 2NXEA 4WP9A 1R0BG 3OSPA 4JI0J 1A9NB 2CIMA 4EWTA 4KO0B 3EMTA 4FF4A 3HX9A 1VQ5S 1X8DA 1DURA 1RWUA 2MSSA 3ISZA 1RSCA 1R8AA 4DR6J 4U95A 5HO4A 3I0RA 1S9GA 1PAEX 3BDPA 1NZ8A 2CADA 4LFAJ 3JB9k 2OIHA 2XB2D 1JXEA 2U1AA 2V2ZA 4DPUA 1NJWA 1JLFB 2HS0A 3T6JA 3IWLA 5E33A 2Y0BB 2EG2A 2I0XA 3RRKA 4WXWA 2Q1LA 3UNGC 4LF4F 5HATA 3VGTA 3T3FA 1GXLA 2WZ1A 1VC0A 3CC4S 4JV1A 2IIHA 4RBVA 1VC5A 3QO9B 1GMUA 3ILIA 2E1AA 4PXDA 1R89A 1HNZJ 5HMYA 4K0KF 1MW7A 1VQOS 4QW9A 5CYJA 2L41A 3CD6S 4IFVB 3PDNA 2DKOB 3GMGA 2OUGA 1IBCB 3QT7A 3RU0A 3D6MB 3NS5A 4ICLA 4N8OA 1NJZA 4G1IA 3M30B 5EUHA 1EP4A 2JFKA 4TNOA 4A46A 4ED5A 4YR0A 2D41A 3FKBA 2RUSA 4B9MA 4XO0A 1ZOTA 1BUXA 1RB0A 2FIUA 4NEZA 2VPWB 5L1KA 4LFCF 1U2RA 2KFYA 4ZP7A 2R2SA 1FWLA 1DQ8A 4I7FB 1WDTA 2BE2A 2E1MC 3I0SA 2VFRA 3BGLA 4DV0J 3US5A 1T8EA 3TVYA 3ET6B 2ZJRQ 4MK8A 4OZ0A 3RAMA 2K7JA 3W2WB 1CJUB 1EJ7L 3ZZTA 2HGLA 4J9RA 3TEHB 3Q89A 1F60B 3J7YI 2VL1A 4I6YA 4QIGA 3I56S 3H5YA 1Z4UA 1PYTA 4DFKA 4HVZA 1KTVA 2D1CA 4WTOB 2XSJB 4NLSA 3OR2B 3OLBA 2E29A 2FD2A 1KVIA 2YX4A 5KFUA 5IM0B 1T9XA 3UCZP 1N36J 3UNYA 1KD1T 3EZ5A 4B17A 4DZDA 5KFDA 2OTJS 2RAQA 4ZVHA 2HNZA 4PZVA 1HLWA 2ZOFA 4C8MA 2UU9F 4IG0A 1GAOA 1CJKB 1V6HA 2VG6B 2E7VA 2XZDB 4C11B 1LNQA 3Q22A 1RT7B 1SC3B 1U02A 2YH0A 2XMJA 1TK0A 1R3NA 2AZ3A 1FRXA 1DQ9A 4K59A 3BQ1A 4IKAA 4NE9C 2AYMA 3TA1A 2KTQA 3GSIA 5J1NA 3VHQA 1FTRA 1GT8A 4J9UE 4ANDA 3K58A 4AL6A 3I82A 3DLBA 4BS2A 1U2CA 2IVMA 5KFBA 5B0GA 4IRDA 2CZ9A 3HFVA 5H1SV 3MR2A 4NLOA 4ZLPA 2CQIA 5A6WA 1GMWD 2DVIA 2GQ2A 3L09A 3OFGA 4KBIA 4MKVA 3IO1A 3VV2B 1VQMS 1QVGR 4A4JA 4NZ0A 1VJWA 2YKMA 2ZE2A 1FWPA 2B3TB 2Z8QA 2ZBCA 2OEJA 2YKAA 2DK2A 2W2NP 1KQKA 3UN5A 4NLUA 4DN0A 1QSYA 3RW6A 2DGSA 2VDHA 3AH6A 1GXTA 3TZWA 5CAAA 2AQ4A 1Y4ZB 2AJQA 1S59A 1FEEA 5DETA 2XSJA 1RKJA 2PFDA 1H2VZ 1YBUA 4CWBA 1AUSL 4RWWA 1RJJA 2CJ9A 3LF0A 4LIRA 1IBMF 1N33F 3DDIA 4WYWA 2O5DA 5FDLA 4ZPBA 3KLGB 1RTDA 1KSPA 4RW6A 2IPOB 2QLXA 1TKXB 2G2ZA 1AZSB 3GIKA 3H25A 1N36F 1RT2B 4ZJQA 1C0UA 4F0KA 5KFFA 1ZAVA 3S1TA 4ED7A 3F73A 3CMQA 4I68A 2ROGA 1VQ6S 4I64A 1TUGB 1T9TA 2YKQA 3A1YG 2QLWA 4ZPAA 4IH6A 2XS2A 3A8JA 3H4BA 4C8LA 4WZQA 1PYSB 1VQSA 2V63A 3NAIA 3KJNB 1KC8T 4ANCA 3HHEA 1WKLA 3ZTOA 4CO0A 1C1CA 5A8RB 1B0PA 3TZXA 2H4WB 3HHLD 1QAYA 4WXOA 5EWFA 3CJKA 5GADI 5GAGI 1HNWJ 1C4AA 1FCAA 1K1SA 2GS8A 3A3OB 4M1KA 4CH0S 4CLYA 2DRAA 1RAGB 1RWXB 3VZIA 3FSIA 2J8AA 4EO8A 3QSYB 3PY8A 3BGRA 1LFPA 1R6VA 3O5TB 4C2MA 2ZH5A 2RU9A 2KXFA 1HD1A 5EGYA 2BE9B 3C46A 1NMEB 1RI7A 3W63A 2HVIA 5J2QA 3KHGA 5HROB 2V5HG 2YWKA 2FY1A 5AE2A 3EGZA 2DR5A 2G0IA 2HK2A 2OJ3A 4RW6B 2B6AB 4X66F 1RTHA 1JXVA 2XCAA 1Q95G 5KFJA 2OD6A 1LW0B 3PX0A 3RBEA 3N5FA 1VFJA 3W60A 4C11A 5DDOC 2WK4A 1U8WA 3KXDA 4MKBA 3PX6A 1HNXJ 2MJNA 5HSPA 4JB8B 3G8QA 5DDPC 2X1BA 1JMTA 4X4UA 2E9RX 3NAHA 1WG1A 1E6VB 2RF2A 1H6KX 2VQEJ 4ZCIA 3LGMA 1UA0A 3DLGA 2GVZB 2WCXA 3NCPA 4PQAA 4CO4A 3LANA 3G8SA 2AGPA 5LJ3Y 2VU5A 3BEGB 2O66A 2DHHA 2YY3A 3TYTA 2H9ZA 2E66A 5KFTA 4QZVB 2MXYA 5F41A 5J1EB 3MWBA 2WOMB 1MN9A 2BBEA 5KG2A 4ECSA 2ZHAA 4Q45A 1D0EA 2NYIA 2ASJA 1XMBA 3BKFA 4NLWA 3N28A 4NXNJ 2QN6B 2OPSA 2X3GA 1Y0HA 2XMWA 3OXFA 4ZVEA 1CJVB 3HVAA 5BJRA 1RACB 1X5OA 4IOBA 5DG9A 2KKHA 4NXNF 4LSNB 4F02A 3NGDA 2OMLA 3EZUA 1MWZA 3JQMA 1N0VC 2A2DA 4UOCA 1EAYC 2DIVA 3W1YC 1JIHA 3R97A 4CLZA 3LQVA 2AGQA 1U47A 1L3UA 1QLNA 3DDKA 3G6ES 3BJYA 2AHOB 5F8NA 3BPSP 3Q8VA 4L75A 5DGAA 3DLEA 1TR0A 3G6VA 1RHQB 2R7UA 1S1XB 2Q79A 3NP5A 4HHUA 4NX9A 2N3LA 3DNCA 3MXHP 2IC3B 5IZHA 5H9EJ 1FFWB 2ILZA 2Y0SD 3QIPB 2ZKTA 3AXMA 2KZZA 1RWKB 4ZPVR 3C14B 1N8RT 3CMAS 3HSZA 3GFYA 4LBHA 4NYOA 3JS9A 1OYEA 1RP5A 4UOFA 3CXCR 3M2VA 2DY9A 1RHUB 4ZPWR 3HHDA 1U2FA 5C42A 1WHYA 3B4DA 4I56A 2EFVA 2UXCF 3D7SB 2HHTA 4DX6A 5KFWA 2RS2A 4C9DA 3I4PA 3ITHB 4USTA 1HNXF 2XEXA 4ZCKA 2CQCA 2EBEA 3WZ0A 4B08A 3DRSA 1TKTA 5KFQA 1RTJB 2WVDA 4X4RA 2DXFA 2HFOA 2RQKA 2ZDPA 4PQUA 2JNJA 2ZM6J 1T03B 1S1TA 1BMQB 1REGX 4PXBA 5K14A 3MUTP 2W9CA 1UFLA 3GPAA 3GR0A 3RYLA 1FRMA 2L9WA 1SJRA 3DRXA 5A8WB 2RILA 4A8KA 4NLDA 2LEPA 3KK1A 1T9UA 1RHJB 3CCWA 3F56A 3M6UA 4MIWA 5F8HA 2ZOGA 3M1VA 4GKJJ 1LK5A 2IJFA 3I0SB 2LCWA 3VVUA 1KRPA 4QWBA 3IS9A 3FCVA 3HT0A 2CPXA 4F8RA 1IN0A 1XMQJ 4RW7A 1UVLA 3HVTA 3PXGa 1Y00A 2V8HA 2VICA 4HDGA 2D3UA 3CNQP 3HI9A 4R0JA 3DOKA 1DY3A 5EX3A 3BGFA 2B9EA 3BGOP 1UAWA 1F2GA 4RWXA 4A8SA 2HPUA 4OX6A 4V1Ak 4OX7A 2ZBQA 3BR9A 2KYZA 2YNGA 4DG1B 1KVKA 1WC6A 3MCMA 2DNZA 3TEGA 5KT4A 4X2BA 2HLUA 2F40A 2KFZA 2PMHA 4LSLB 4RW4A 4CM0A 3BO2A 2NPIA 4B3RJ 4W90B 4ZOSA 2VFSA 3D6FB 3EM1A 4WWSA 3MEDA 2BJ8A 4D3GA 3MUVP 3HK2A 4K50A 2NZ4A 1IQTA 2C3MA 3AJ1A 3BO3A 1U1OA 1RT1B 1RAHB 2C2MB 4G3IA 1OJ4A 4DPTA 3EPGA 2UVWA 2MKJA 1EETB 2FLOA 3D6HB 4R8UB 2HWIA 2H5EA 1VJQA 3I5BA 1VQLS 2FVPA 2FPHX 4X4VA 3GFHA 4OMFG 1FDNA 5HK4A 5F3TA 1YQHA 2DNRA 2L3MA 3GJSB 2NZCA 3LUYA 1NDPA 4PQUB 4N77A 2J5AA 1RK8A 2VBWA 5D4PA 3JAMY 5AXNA 3M8WA 1FNMA 3WBZA 4CDIA 3P5BP 1FNOA 1HBNA 5K5MA 3LTOA 5LXYA 4KKOB 4ECWA 3MR3A 1ZTTA 3MCSA 1L3TA 2CPZA 2NR0A 5ETKA 4QW8A 1FE4A 3T6BA 4WFXA 1KEKA 4K2JA 5IT9U 1NBEB 2CWXA 4M5IA 1YJUA 1FNXH 1PKUA 3MAHA 1TVRB 1TKZA 3SCIE 5KTQA 1S12A 4P71A 2OMOA 3TQEA 3UWTA 4ECVA 1S6PA 4JV5J 2RRAA 3D54A 1I94F 1A0OB 3SMZA 4RNOA 2HFUA 5HQMA 1FO1A 4PYDA 3OTBA 2QZ8A 4DFPA 2UZAA 1H2TZ 4JV0A 3DGPA 2C3UA 4DS4A 1NHUA 2BYCA 3BREA 4K8RA 1E6YA 3CO9A 4Q2LA 1VQ8S 4LSLA 4RW4B 2DCLA 1WEYA 3D9BA 4HACB 5CYMA 3GCXP 2PI5A 2D3ZA 2WW4A 4RBTA 4FNIA 3BBFA 2NQPA 3TWZA 3MAQA 2ZM6F 2HBZB 3FFIA 1VHIA 2H4YB 2Z2LA 2GW8A 1NZAA 4ZITA 2CJXB 5M2UA 5ITHA 1BGXT 5F8IA 4G1PA 4DV1J 1QE1B 2K7KA 4XPCA 3J81U 2PEHA 2JFDA 4Y34A 1RWPB 3GG1A 3N6MA 2XYHB 3R3TA 2X3DA 5DZ7A 3RBZA 3RAXA 2E1CA 2B7BB 2XY6A 4LF7J 3QATA 3PTWA 4I67A 2DBBA 4LRAA 4OHWA 2HQDA 5I3QA 2YPYA 4B9UA 3C2PA 2Y8WA 3A13A 3HP6A 2KFNA 3NMRA 2VQEF 3IM9A 2C2DA 4C8NA 1TL7A 4KH0B 1R0CB 2HNDA 4LF2A 1N5QA 5G0RB 2FYXA 2HVEA 1CC8A 5KG6A 3QJJA 2B4VA 1FKOB 2CJQA 1S10A 2AWZA 2YVSA 5IM0A 3GFZA 3OR2A 1FA0A 3C15A 4UT4A 3NGRA 2MQMA 3NOCA 1DTQB 4DL0C 1SCJB 1X0PA 2VDIA 1TKTB 3ZC4A 3CPWR 2W01A 4DBQA 4JV2A 5A76A 4LFAF 4MYTA 4P75A 2MTLA 3W5ZA 5E3AA 4CYUB 1XMOJ 2MZQA 4C8ZA 2JEIA 3SI8A 4ZN3A 1O8BA 4F3QA 1VQNS 4ZP9A 2H65B 3M9MB 4PG6A 1PCAA 1S0VA 5DDRC 1O0PA 1X9WA 5KT5A 3C16B 2Y1RI 1FTCA 1VDHA 3T1HF 2YNGB 2FJDB 3PM9A 5KFPA 3KHHA 2XS7A 5BYSA 4DV3F 2HFNA 3L7OA 3PKMA 3U1NA 2AX0A 2KVQE 2RMLA 2YTCA 3BR8A 2KM8B 4TU9A 5I3UA 3G8TA 3R5CA 2JLFA 1S6QB 5E0OA 2M70A 1V5IB 2W9BA 2GVDA 2B5JA 4F4XA 4RU2A 2J0QD 3PJWA 3CB4A 4MFBA 4KH1B 3AQOA 4IH7A 3T5KA 2DNOA 2HKEA 2VJVA 3P49B 4OYWA 1S6UA 3A3PB 4OI0A 3LH2S 2YH1A 4QU7A 2RDIA 1S7IA 3VAIA 2BABA 2C22A 5LT5A 1OQ3A 2QJ3A 1DTTA 2LXFA 1H0HB 3CDUA 4ED1A 4ZHRA 1WORA 1FWKA 2ALYB 1UWBA 2CVIA 4NI2B 5HMZA 4IOAQ 5HLFA 4PG5A 4BDPA 1KVJA 1SB6A 3CCES 3BH7B 2IM2A 1RBOB 2B0GA 4OZ3A 4XDCA 4K4ZA 1KBRA 4LMZA 1D8YA 2DB1A 3M2RA 3V4IB 2H5IB 5K20B 3AD7C 4DR2J 3VGUA 4F2RA 3GYNA 1VQKS 4W4MA 2IAJA 1JJCB 1V9OA 2MKCA 4WFZA 2KXHA 1HBMB 3T41A 4BC7A 2KI2A 2KL8A 1YJRA 2NUUG 5L9NA 1A6LA 1Y7PA 5MLCV 3BV8A 4WKYA 3MMCA 4MMOA 1K0VA 5B0CA 4PWUA 3PO5A 1DZ5A 1NB7A 2J0SD 4Q44A 3CW2C 3MDFA 2ZH1A 1X60A 1ZM2A 1N52B 3CD7A 4CH7A 3HT3A 1VBKA 1C0TA 2O3DA 1MU2B 1K47A 8RUCA 3D68A 3MI7X 4KR0B 2AD9A 4U8VA 1RTIA 4QWAA 4DQIA 4LR7A 2B6AA 3OTCA 4PR6A 3UCGA 4RUCA 1XIQA 2EPIA 4WBFA 1LWFB 4ZVGA 4C8KA 4XDDA 2BXJA 5HVHA 2UUAF 3OV7A 2E5GA 4ZJOA 1SV5A 5GAGU 3EGVA 1RT6A 5FD1A 3IRXB 1NU4A 2ZD1B 3KJFB 4NLQA 4UF4A 2O01C 3IS9B 2Z57B 4OHYA 1Q16B 1S79A 2ZH8A 4TXSA 1N33J 3B6BA 1RT5B 4M94A 4X66J 4X4OA 2R8HA 3EDQB 1O5JA 1U1MA 3OFHA 4KGMA 5K9FA 4LVNP 3KK2A 1D9DA 4U7UK 3PYFA 4QPTA 5KFMA 2Z2MA 3SCJE 4DJBA 5HL7Q 2ZJPQ 4JP8A 1S1TB 4HYKA 3GV8B 3DXBA 2HS3A 4IRKA 5LJ5Y 1KONA 3TJAA 4RUAA 4LBIA 4U96A 4Y2IA 2Y1LB 1F5AA 4K4YA 5E3PA 2W7PA 2VPZB 1S77D 3PV8A 2R7RA 1LWCB 3MF5A 3NCRA 3U1MA 3KWMA 1UVJA 2R8KA 5L8RC 2Z58B 1KS2A 4DQPA 2GHPA 3PKYA 3FGVA 2NSCA 4ZIVA 1FJEB 3KLIA 4IFVA 2V8GA 1PJ6A 4PXEA 4KTQA 3Q2TC 4RL1A 3LP1B 6AT1B 3SSSA 2OI2A 3AB4B 2VH7A 3BF4A 2LDIA 2DEJA 2V9KA 2WB4A 2NPFA 3MPUB 5HMWA 1S76D 3PFEA 1AUDA 2XLJA 2HHHJ 4B3SJ 4ECYA 4JI4F 4PPDA 1RWWB 1YX2A 2XI2A 1Q53A 2JOQA 1JLGA 2PGCA 4MJKA 2AIRB 5IT0A 5L1LA 2EFPA 4GVLA 2VHGA 2RKIB 2VZ9A 4BLGA 1F3VA 2HVDA 2PDAA 1CS4A 1KQSR 3NNHA 1EZZB 1FDBA 5KOWA 1YIJS 1HI0P 1XNRF 1UPMB 4K5RA 3W2VA 3GG0A 3HSJA 3DLKB 2N7CA 4GKJF 4Z7YA 3WC2A 3L95X 3HVRA 3WC0A 2QA1A 4NXMJ 4DU8A 3VZHA 1Q8LA 2IFXA 3LP2B 4KGXB 3FSYA 3VAJA 3HHLC 1JNZB 4Z7CA 1U1NA 4BWMA 2V4JB 3GTYX 2VOOA 4HT7A 1VS3A 4YEAA 3DLKA 4PAAA 1N5TA 3I31A 1NUEA 1LWFA 4TN2A 2BRLA 1RA7A 2ZBRA 4X64F 2H51B 2MYFA 2J76E 2IBKA 4WU3A 2HQIA 3FEXB 3GSDA 4M5JA 5E2QA 4B3TF 4RX6A 1N4LA 5FDLB 1ITPA 2KVIA 2DD8S 5D0EA 3OBIA 3CJ3A 1FX2A 4F3MA 1Q5VA 2FJAB 4USJC 3WQPA 1B64A 5KFLA 1JKHA 1D9AA 5ETVA 2ACMA 4TU8A 2XI3A 5FLXY 1X4DA 1IKXA 3P45B 2UUCJ 2JH3A 1BD6A 4RU9A 2FZGB 3A8IA 4DQSA 2QSFA 1YJTA 3ITHA 2YWFA 1LXNA 2MQ8A 4MTPA 5B0DA 2ZUGA 2MZTA 3LGNA 4F04B 1XMQF 1JXLA 3TUJC 3HD2A 4OFZA 1IJEB 1N5SA 3JXOA 4Q5VA 1ZH5A 2DGWA 1Q1KA 4IQMA 4O3PA 1LW0A 2HVHA 3OXGA 2HFZA 3EE3A 1NJXA 1CS4B 3KJVB 1SH3A 2EWHA 2OEKA 3KLHB 4I2PA 4DXLA 3K5NA 4K7QA 1SUQB 1T11A 1U1QA 4C0OC 3RRGA 2HHUA 1J27A 1GMVA 1R8BA 2BDPA 1YRTA 1RYSA 3CJRA 2YNFA 4ZVQB 2QL7B 3AJDA 1WOOA 5B0FA 4L3KA 1W25A 3QAEA 1ZYQA 3BSCA 4O4RA 4RJVA 3SCKE 2NYHA 4F4YA 3PR4A 4DR5J 1PC5A 1JLFA 1YJNS 3NBPA 1RHMB 2F9DA 2ZC4A 2V0NA 4DN9A 1CVJA 3T1YJ 4DV2J 5E3CA 2OSRA 3AT1B 4QYZJ 3CD0A 2C3OA 2HVZA 3JSRA 4WFAQ 3R5BA 4UQGA 3W2WA 2M0GB 2NS1B 2XWYA 4DUZJ 1FX4A 2BJ9A 4DV5F 3PW2A 4A48A 4DS5A 3PVXA 5H9FK 3POTB 2B7CB 4GKKF 4CO3A 1UVKA 5KT2A 5L1JA 2DPJA 3R5DA 1U45A 4LF8J 4KPCA 3LPYA 2GO8A 3BKUA 1PYOB 5LL6d 2FHKA 4TLRA 2NXNA 2VA3A 2G0CA 3TAPA 1XR7A 3KK2B 1F0XA 2YXLA 4M5GA 2GMHA 2LXUA 5MAOA 2AU0A 3BSAA 4H4MB 5KT7A 1MN7A 5GMEA 5J2MB 4F4KA 4YN3B 1QTNB 1N0UA 3M6WA 4GO7X 1SVDA 4IG3B 2IM1A 4YB5A 1SL2A 2VA2A 3KK3B 1R0AB 4UOGA 3LW5C 3I55S 3FDSA 2Z0GA 3D2WA 2C2EA 2FQQB 2CA9A 2XY5A 4QWDA 2QIFA 4WTYA 4P7VA 3OUYB 2LQBA 2RT3A 1KLMA 2XMTA 2HRYA 4ZVSB 4UZCA 2DGXA 2MLZA 1N5YB 3MOZA 3TZYA 4Y2CA 1RUSA 3A8KA 2W9AA 3P3DA 4KHRA 3HXMA 5KFYA 4IG0B 1TK8A 4ETZA 1B4SA 4QBUA 4ECRA 1MSWD 1F5CA 2IRXA 1FK9B 2WVBA 4L73A 1IBKJ 2XM3A 2BQUA 2IRYA 1UVMA 2EC0A 1U1KA 3G82B 4ES2A 3PJ9A 2HBRB 2RQMA 1UJ6A 7FDRA 4G1QA 4F50A 1FKOA 1BLUA 2HWHA 4X4PA 1AYEA 3G87A 3Q24A 3IGNA 2VQFJ 1P9QC 3CEDA 2IAJB 3R5GA 4URQU 2G2OA 4N47A 1T05A 1JNRB 1FT8A 2BZ2A 2IBOA 3FNNA 3T9ZA 4ZN1A 1S9FA 4KAIA 3OL7A 2MQNA 3H2UB 4M5DA 4F4AA 3UD3P 2NXUA 1H73A 4ECZA 2BV3A 4U9RA 2EC2A 2RQ4A 4GC6A 4TYBA 1NEEA 1YZ6A 2I5JB 3UD5A 4NMLA 3QSIA 1OSCA 2HGNA 4CP5A 4O44A 3J81j 3QJLA 1CSJA 2GQQA 2PSZA 5ETMA 2V94A 4CTAA 2OPPA 4RNFA 2X1GA 2CG8A 2JVRA 4EEYA 4ICLB 3KLFB 1UCNA 2FVQA 2IYIA 2LLZA 2C2ZB 3M8ZA 2MQPA 4DQQA 1GXUA 4JI2J 3BKTA 2YNHA 4YR2A 5A8KB 2MQLA 2AF6A 3IR7B 3ZZZA 4J9OA 4WIQA 3AXKA 2CQ3A 3VAGA 4B9VA 3KUEA 4LVOP 5KFCA 1SQFA 3EICA 4EFAC 2KO1A 3RUBL 4JBCA 4G1QB 5F3ZA 1JJ4A 3QAUA 4LF9J 3WX8A 1U25A 1TK5A 2E1PA 1VIOA 4I0WA 4FDFA 4URGA 3BM7A 4OV6A 3KTQA 2DNYA 3UI3A 3PW7A 1JWWA 1QUPA 2VJUA 1QAIA 2EG1A 3KUGA 5CZXA 4DR4J 2FC8A 4LUBA 2XMVA 3M32B 1FESA 2XHWA 2YX7A 2C2RA 2AYBA 1RT4A 2YWHA 3S6EA 1TKZB 2HHQA 2Q3PA 3I96A 4DSJA 1RHRB 5HJXA 3SIPB 1IBMJ 3OFFA 2CQ2A 1NJIT 1EARA 3ZNJ1 4C98A 3DM2A 2MKYA 2E5LJ 2M52A 1KLMB 1PC4A 1SQGA 2YQ1A 1LXJA 4MH8A 2MHNA 3JQJA 2HZAA 2AJ0A 1SV5B 3D1OA 4WJBA 5DRKA 3QLHA 2DH7A 2XZTB 2OSQA 2C2KB 3SEOA 2CPEA 1ULRA 5D3GB 3DLJA 4F0MA 1VISA 3FZBA 2ATLA 2MZSA 4DL7A 2ROPA 3L9ZA 4PEOA 2R7TA 3ENQA 1FJ7A 4LFCJ 4ED4A 2ZBIA 1GX5A 1S57A 2QMWA 3KOAA 4U7UD 1QY7A 3PG9A 4RKUC 4X65F 4CNZA 2VC1A 2GMJA 2ZZMA 1NXIA 4H54A 4QWEA 1EETA 3NY0A 1ZTWA 3BH6B 5C5JA 3H7HB 2HURA 5J2MA 2NREA 2AW0A 3MCOA 4P10A 3VQTA 3MD3A 3CCJS 4M5KA 2AZ1A 3BBCA 2VKRA 4FXVA 3IAS9 4O0NA 5F8MA 4LFBJ 4OYIA 3DI6A 5D0GA 2HMIA 1FERA 1WI8A 2KT3A 2BOPA 1TV6A 3MEGB 2E44A 1K8AT 3J7YU 3KNAA 2OPQA 4KC5A 1N32J 2N3OA 1WD6A 1D3WA 4JI3F 3SQGB 2FUG9 1LV5A 5D3GA 1HHSA 2R7SA 2HRTA 4DR4F 1D09B 4LF5J 4WK1A 4AYBD 4BWJA 5J1PA 3P8BB 4NLGA 5A2QY 5IC6B 4O3RA 3OVSA 3TOQA 4Y2AA 3K8VA 2M88A 1IM4A 2P2CB 2XMMA 1HWUA 4OJGA 1DHMA 5CCMA 4HDHA 5M2PA 4HACA 1IQZA 3PJXA 1SI9A 5HAOA 3R1HA 2QSWA 1M1KT 3H5UA 2UXBF 2P6SA 2MZ1A 1CLFA 1S7HA 3TNVA 3W5XA 1UWBB 2C2NA 4FYWB 2CG4A 1S9EB 4DI6A 5D8HB 3OD2A 3G6XA 1WC1A 2WONA 3Q8SB 4FNHA 3PEJA 4MIAA 4R8UA 2UXCJ 1ZZFA 4CLTA 2DNHA 3RG6A 1XEZA 2GZOA 2CNKB 2L9NA 3P4UB 4C0HA 1Y10A 3KHLA 1XNQF 4B9LA 1HQUB 2YNFB 1U6FA 4MFBB 5JVGQ 1PJ7A 4LRFA 1MMNA 4YHHJ 2DPIA 1AT1B 4DLEA 3RBDA 4FYVB 1WHXA 1SBRA 4ECQA 1RAEB 5C24B 2HSEB 5I3UB 2IY5B 4ERDA 4ZVUB 3R5JB 2KT5A 2JSXA 4OV1A 3JYTB 4KB7A 2N4CA 4YUDA 4NEYA 5LM7E 1TMMA 3C16A 4AXIA 2VQFF 2UUBF 2LA4A 1VC6A 1ICEB 2J8SA 4NASA 3GCWP 4JYAJ 3DXSX 1NLKL 3MMAA 4G6VB 2KJVA 3OR1A 2DTJA 2DNNA 4J90A 4LF9F 5HP1B 5IV3A 3T1AA 3MM6A 3KK1B 3ZZRA 2DR6A 5CYQB 2J6TA 4WE1B 4ELTA 1WUUA 5E41A 1IKYB 4OZ2A 2UUWA 4J9VA 3W9JA 3CMES 4PWWA 4K4VA 3K5PA 4UUWA 4F7VA 3W7BA 2MQOA 1FJGF 3QGHA 2LEBA 3T1HJ 1UEVA 2HLTA 3P96A 4P74A 1XTZA 1UJ4A 3DRSB 2HNDB 2NUHA 2JC0A 3MEEA 1FJGJ 1RTJA 1VMBA 4RUBA 3TX0A 4DFMA 2FVSA 1FFGB 3ISND 3JSMA 3LP0B 2MY7A 3LP2A 2UV8A 3RJMB 3ZTPA 4DDFA 3TANA 4B02A 3CIMA 4X4TA 4KHPF 4TYAA 4C3LA 2PT0A 3ENWA 1FD2A 1M5SA 3EJMA 1GEHA 1N6QA 3CDAA 1QD1A 3UQSA 4Y0FA 2DT9A 3QZ8A 3L3CA 5CHCB 1QVFR 1FXLA 1NPPA 4P73A 1RT4B 1NB2A 3LPEA 1FRHA 3CJ2A 3CCLS 3DMJA 4O3QA 4O4GA 2QT7A 1FRIA 4EK2A 3B4MA 2GFFA 3FFIB 1NJYA 1Q0NA 3AB2B 2UUCF 1QAJA 1G6BA 2LEAA 2DH9A 4RUHA 4ILLA 2QL5B 2EVZA 1IWGA 2HNYA 3BZQA 3WIUA 4F0HA 3AODA 1YZ7A 1XK8A 5THWA 3R8YA 4C8OA 3M9NB 2CQGA 5HVFA 3ONQA 1Q82T 3DLHA 1NH7A 4MAKA 4NZ7A 1IBKF 2WRMA 2DITA 3M05A 4KRWA 3VAHA 3HFZB 3SZ2A 3RAQA 3HZGA 3JTOA 3NS6A 4CLLA 1YJVA 4K4UA 1WJ9A 3BSNA 1RAJA 3H20A 1NKBA 2P9GA 3ZZPA 3WDOA 1YHQS 2RNEA 4HHHA 1JLEB 1B0TA 2Z2YB 2B9XA 1H98A 1FKPA 4OI2A 5I3PA 4OHZA 3LWLA 3MM9B 1G4CA 4P7TA 4UOHA 1WOPA 4B9NA 5IT9Y 2G9OA 3WX4A 2XMKA 1FKAF 1BHNA 1R8HA 4DSEA 3SCLE 2F8MA 4LF1A 1S4FA 5BXIA 4M5NA 1XBWA 1LEOA 1Q78A 4FVMA 3BDEA 3THPA 1RTDB 2CKWA 3C19A 3D6TB 1KDNA 4U8YA 2W7AA 4RNMA 3K0JA 1S1XA 3QRRA 4KKOA 2YKPA 3OL6A 1HHTP 3DLEB 3NNAA 3BYRA 4MKYA 2UU9J 4RLEA 5BR8F 2R7XA 3PX4A 3RW7A 2VODA 4OL8A 2V67A 1DLOA 3MM8A 2VG5B 3MHYA 1M5KC 4KSEB 5DGBA 3ETOA 5SUHA 1UFKA 1IVZA 2R9LA 3RBXA 2AP6A 2H54B 4I4BA 2B9WA 2QYCA 4OZNA 2MEWA 1CJVA 1X4AA 3MM5A 1WHWA 2OPSB 2WSEC 1MLAA 4URSA 5IT4A 5LMNF 1HWJA 1I1GA 2U2FA 4TY8A 1SUQA 1X4HA 3BYPA 4PG7A 1VLYA 1F5BA 2CAJA 3UVJA 3KLEA 2OAUA 1N5YA 2ZDOA 1Q79A 2ACYA 3V6KA 3K8WA 1U1LA 2K06A 1MU2A 1VI7A 3UN3A 3ZZYA 3TUIC 1SXLA 5J2QB 3F44A 3C6UA 1MROA 3FBEA 3DU5A 1WC0A 2LKZA 4ID8A 2CNOB 2L48A 4AUKA 3GONA 5HP1A 3CDWA 2VFVA 1S1WB 4USUA 3W62A 4Y65A 2XQCA 2EI5A 3OHAA 2IMOA 1U49A 2J0XA 3N01A 4ZIWA 2XC9A 1J5OB 2ROEA 3DOMA 3PACA 4DHVA 3HO1A 1TL4A 3A12A 1YLXA 1C1BB 1HIYA 2LP4A 2OPRB 3ELHA 3VR1A 3VAMA 2G2YA 1FDDA 3OTOJ 2DXEA 3JQKA 2J6UA 3JSBA 4GVBA 5C24A 4ZLNA 2C3PA 2CQ0A 5B08A 3ENVA 4HI2A 5G4DA 4YY3J 2E9TA 2GAGC 5DG7A 4DX5A 5KFAA 2F9JA 1YGYA 4I7FA 3AA9A 4IDKB 1AZSA 4B3RF 1CPZA 1T3OA 2DCUB 3CF5Q 3KLVA 3OTEA 3TX8A 2XLKA 1RT2A 3ZO7A 1QDUB 5B09A 1X31C 3TRGA 5EWEA 3MM9A 4J9KA 3OSNA 1DTTB 2HIYA 4UTGA 2XO7A 1FXRA 1FVQA 3QFHA 3IN5A 1Y9OA 2GA7A 1C1BA 1Z1ZA 1K44A 5C7PA 1YG0A 3Q8YA 3Q8PB 1YITS 2KH9A 2GIRA 3H2LA 1S0MA 1HR0F 2CJKA 3AJ2A 2MGZB 4ID5B 3ENAA 3EUNA 3KDNA 1SPBP 2ZUAA 3LAKA 1GFWB 1JLGB 2DISA 5F0WA 3RB6A 2YNIB 1I51B 2QV6A 3L7PA 1X0FA 3UDCA 3IRXA 5A0YB 3BB5A 2XULA 5DO2A 2BE2B 4UY85 1YBTA 1LWEB 3D5MA 4LIWA 4X65J 4NLVA 2I8EA 1C0UB 1UEKA 4BBYA 3OHBA 3KLHA 1X4EA 4LR9A 2YQ3A 4WIIA 3QMQA 2OPQB 1YKWA 2DJWA 2WBRA 1RADB 3G4SS 1TV6B 3MEGA 5GAEU 1KP6A 5DZ6A 2W1BA 4FKXA 4CYUA 2XYPB 4C0BA 2Z2ZA 2BR0A 4WFNQ 4YB1P 2ZNYA 1PO6A 2BKOA 2MMYA 2FJVA 4LR8A 2GC8A 1O6XA 1LOUA 4A8WA 4V19X 1HNZF 1H7XA 2J7KA 2LQJA 1Y3JA 5F8GA 2B43A 2R8GA 4JI6J 2HNYB 3G71S 2AJ4A 4F67A 2HRUA 1RZMA 3C6UB 1MROB 4I6WA 2ZWOA 2WW8A 1Q8KA 1P1TA 1TL7B 3MAAA 4JI5F 1AFIA 2UV8G 3KUHA 2PC6A 4Y2KA 1TZ0A 3MPYA 4DCOB 3U1LA 3UDVA 5K8OA 4IRCA 2BE7D 2IVFB 4I6AA 3OJSA 2J9DE 1HNVB 1K73T 2D3O1 2O1PA 1IR0A 2DGUA 3OR1B 4OYBA 4EBEA 3W64A 1XR6A 2FJBB 5ETNA 4DUTA 1Y5LB 4KO0A 5DM7Q 3MMJA 4OI1A 3R9LA 4OYOA 2B9YA 1HBUA 5K8NA 2HNZB 2EFNA 1U48A 3OW2R 3HJFA 1VIXA 3M30A 4F25A 2FJXA 2CPIA 5GMDA 5HN0A 1BC6A 1PAUB 3SBMA 1N88A 1YK9A 3H98A 4RW9A 2WAQD 1RWNB 2PMZD 2OFGX 4DFJA 4OHVA 1X7VA 4HHJA 3GR1A 4YP3A 4F36A 3QQCD 2DR9A 1RU2A 3D67A 4O23A 1P9YA 3Q0AA 2HZVA 1QAXA 2GVDB 2B56A 3M8RA 1B99A 4J9MA 1TKDA 2C3YA 3QBCA 2BJDA 2HQGA 1VBXA 2JVOA 2HQCA 4I1TA 5IWAJ 1SKSA 2KM8C 3CGIA 2NSBA 4BC9A 5F9NA 1X9MA 1N34J 4O3SA 3DMJB 1RWMB 2GJIA 3FK4A 2VOPA 1RT3B 1NPKA 1WC3A 2W25A 3R2DJ 1VBZA 1N56A
chains in the Genus database with same CATH topology
2YKNA 1HQEB 2RVJA 2O67A 2F7VA 3R5AA 5KG1A 3GFXA 1M5VC 1LWCA 3EXYA 1V3RA 3JSMB 1P1LA 2DNMA 3M8PA 2YKNB 4TLQA 1HNWF 2A2CA 2GHVC 3FQLA 2ZC3A 5KFSA 5LMUF 3UCUP 3DOLA 1BY9A 4PUOB 4NLTA 3MPWA 1CC7A 1HMVA 2RD5C 2CZVC 5LSRA 4U6PA 3CDEA 4DR3F 4QR0A 3MEDB 4NA2A 2W4DA 1OPZA 2MKIA 1UP1A 2POKA 3DHXA 1SKRA 4XAKA 5CA5A 4A8QA 3MD1A 1JX4A 4B9SA 5KG3A 1VRUB 5L9XA 3A8EA 4EBCA 2ZH6A 1KTQA 2JEFA 3I87A 2MY8A 3N79A 5T14A 3LO3A 2CRLA 3UDLA 2BM0A 2FHJD 4DR5F 2ZFHA 4O3NA 2ERRA 2V2KA 2VG6A 5KFXA 1QJHA 3MMBA 4MK7A 4WE1A 3MURP 4FF1A 2XSFA 1PSDA 3MM6B 3M32A 1YWXA 3BN7A 5KT3A 4QIEA 1LKZA 4ZCMA 1VBYA 4Y00A 5DG8A 1P6TA 4X4QA 2WTFA 1VQPS 2J7WA 4H4OA 2MKHA 3DOLB 5GADU 3PIPQ 4FYDA 4ES1A 1GX6A 2LQ9A 1ELOA 1JB0C 3NKYA 5HI7A 4Q0BB 3MEKA 4MKYA 1QUVA 1ZAXA 3MM7B 4QU7A 4XPEA 4B3OA 4CCHA 2PIIA 3H5XA 2HHXA 1H3DA 3G9CA 2RH3A 4DWIA 1MWYA 3BS9A 2X1AA 4D3HA 5C25B 2W8LA 1HQEA 2OPPB 1JJHA 1L3KA 1Y5NB 3KKFA 6FDRA 1BWEA 5I4MA 2FDNA 2F3JA 3GYXB 5IQQA 2UVRA 5LSOA 1IKVA 2P5VA 2YX1A 4TQSA 1R31A 4E8UA 3O3LA 3U7JA 2GO9A 4IOCQ 2JC1A 5D4LA 1MMDA 3DI6B 1UKUA 1SJ4P 2KZMA 2EBGA 4LFBF 5B0EA 1IXKA 3FRYA 4FZVA 4M5DB 3KHRA 1M5PC 1RGVA 1N32F 1E6YB 2YNHB 2W9BB 4HL9A 4OLPA 1KHVA 1WNEA 1TP7A 3DRRA 3DDNA 1S6QA 3CJ5A 3JSYA 4I69A 4R5PB 1HBUB 4QIFA 4Z2XA 2DO0A 1S1UB 2GGPB 3CD5A 1T94A 4OJHA 2N4DA 3U27A 1RQ0A 3NRBA 2I5JA 4DR1F 2KHDA 1WI6A 2OFHX 4P2SA 2QA4G 2DNLA 4OI4A 1Q81T 2RS8A 1T7PA 4B3SF 2GV1A 2DO4A 2G13A 4OIXA 2JHEA 2RUGA 5A8WA 3HMJG 5J2PB 1HMVB 1FRJA 3TAQA 1F9FA 3HVWA 1I94F 2M9KA 2X51A 4KIAA 4X4NA 1T05B 2PD1A 2VBZA 4PRFA 2BA9A 3VF0B 5KFGA 1Q7YT 5HBMA 3KNGA 4YY3F 2KG0A 2DHSA 2RDJA 1TL3B 3CCQS 3RTVA 4FXDA 4JV5F 1S72S 4H4MA 2N82B 4BHQA 2KJWA 1VQ9S 5GVQA 3BSOA 3V81B 2DHXA 1JLQA 3M8QA 1X4BA 2ZITA 2XCPA 4FN5A 1WTBA 2DIUA 1S1VB 5LSLA 3AY0A 4A47A 1RTHB 3BN4A 4I2QB 1JLAA 4HH1A 4LQ9A 4NLRA 2VUGA 4QJVA 5CQGA 2VBXA 2SXLA 5AXKA