3C6UB

Crystal structure of hiv reverse transcriptase in complex with inhibitor 22
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
423
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 108
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uB04
4URSA 2YKNA 4H4MB 1JLCA 3GYNA 3IGNA 3N6NA 4IRDA 4WZMA 3LAMA 1S9EA 1C0TB 5C42A 5JXSA 4XPEA 3NMAA 1JLQA 2IM0A 3DLKB 1JKHA 3I0SB 3ITHA 2C2DA 1LWFA 1KHVA 3QO9B 3E01A 4X2BA 4LSNA 4I2PA 1S1WB 1T03A 4ED2A 3MEEA 3T5JA 1BQMA 4IOBA 3SI8A 2HNDA 2W8LA 1RTIB 2FJWA 1KLMB 2IAJA 4IR1A 1EP4B 5KFBA 4RZRA 1QAJA 2BANA 4ZPBA 3DMJB 2BE2A 1FK9B 4J9QA 2AGQA 5KFTA 3FRZA 3KK1B 4H4OB 3OLAA 5KFUA 3OL9A 3KK3A 3IS9A 1REVA 1HMVB 1FKPB 4J9MA 4NLDA 5FDLA 3DRSA 3EZUA 4ECVA 5F9LA 4DL7A 1RAJA 5I3UB 3PJWA 1N56A 1RYSA 3QIPA 4NZ0A 4RW8B 4IH5A 2W9CA 5KFXA 1RTHA 1EETA 3FQLA 5J2PA 5K14B 1TL3A 3UQSA 4RNFA 2WOMB 2XC9A 4ICLB 3BQ1A 1DTTB 4EO6A 2WONA 3DYAA 5J2QA 2R8GA 4F4XA 4Q0BB 4FS2A 4QWBA 1RTJB 5L1IA 4J9LA 1XR5A 3KK2B 4GC6A 4ZVEA 2R2TA 2J6TA 1RTDA 3G86A 2FLPA 1S6PA 2OPSB 1FKOA 3CJ3A 1IKWA 3M8QB 3ISNC 3KLIB 3KLGB 4NLRA 3DM2B 1HYSA 3N6MA 4PQUA 4YR3A 1S97A 3PR5B 1QE1B 1JX4A 2GC8A 1J5OB 3H98A 1YVFA 4PWDA 3DLGA 4H4OA 1S6QB 5F8JA 2RKIB 4XO0A 5KG7A 4K4SA 5D3GA 4MKAA 3GV8B 1SV5B 2OPRA 1SH3A 3LP1A 5KFCA 3HVTB 4DG1B 4O3QA 4KFBB 1S1UA 1T94A 3MR2A 2YNGB 3OL7A 1HQEB 3MFIA 3KHRA 4QWCA 4QWAA 1LWCA 2BR0A 3H5XA 4I2QA 3H2LA 3QGGA 4ZPAA 5L1KA 4H54A 2OPQB 3CJ5A 4ZPDA 3RBDA 4J9OA 1T05B 2VA3A 4NLYA 4TQRA 1RT4A 1DTTA 4EBCA 4WYLA 1IKYB 4RU9A 2XCPA 2ASDA 1SUQA 2I5JA 4MIAA 5KFGA 2D41A 5KFMA 3EPIA 3MR3A 1T3NA 1RTJA 4KBIA 3VQSA 1S49A 1IKVA 3GIJA 5KFFA 1LW0B 1RT2B 1JXLA 3M8QA 1C1BA 5KFRA 5T14A 3M9MB 1S9GB 5F8NA 5F8HA 4M95A 4KKOA 2D3UA 4IRKA 4QPXA 1R0AB 3KLEA 2UVRA 1TV6B 3TAMB 1J5OA 1XR7A 4NLTA 4R0EA 3QLHB 5C25B 3QIDA 2W7PA 3CJ0A 4TYAA 2HAIA 3DOLA 3BSAA 3T5KA 1S6QA 1TVRA 1C1CB 2WHOA 4Y34A 2WB4A 4ED8A 3SFGA 5DG9A 4ZP6A 3BSCA 2VG6B 3MEDA 1HPZB 2GIQA 5CYQB 4TY9A 2V9WA 2OH2A 2IM1A 5KG6A 5HBMB 4NLGA 1LW2B 4IDKB 4IG3B 4MIBA 4O3PA 2UVWA 1RT6A 1TKTB 1RT7A 5J2NB 2B43A 5C24B 4KO0A 1QUVA 3V6KA 1TKXB 2W9BB 1S0NA 2R8HA 1HNIA 3H4BA 1BQNA 4MFBA 1UWBB 3MEGB 1JLBA 3DDKA 4YR2A 2W9AA 2ILZA 1C0UB 3HKWA 4EBDA 4DL4A 3DI6B 4J9PA 1MMLA 4R8UA 3KHHA 4IG0B 5KFQA 4TQSA 2QV6A 3KJVA 4K4VA 3KHLA 3BJYA 4LSLB 4ED6A 3GV5B 5I42B 4ZP9A 3CJ4A 3QLHA 3MR6A 2BRKA 2RDIA 3CJ2A 4MKBA 4ED1A 1KHWA 3V6JA 1S10A 5DGBA 3BQ2A 1TL1B 1N48A 3H5SA 4IFVB 1S4FA 3OSNA 2BQ3A 4M94A 2XGPA 4ZPCA 1RT1B 2C2RA 5CYQA 1JLGB 3M9NB 3RB4A 3PW2A 5EWEA 5HBMA 2ALZA 5DQGA 3BGRA 1S0OA 3NAIA 3GIKA 3I0RB 2AX0A 3V6DA 1TKTA 4ZHRA 2IC3A 2C28A 1TKXA 5KFSA 4YP3A 2W9BA 2RDJA 4KV8A 5KT2A 1VRTA 4K4XA 4DL2A 2AU0A 3IN5A 3MTKA 3CWJA 5F9NA 3C6UA 3DLEB 1S48A 5KT5A 4WFYA 2JEJA 2IJNA 2E9RX 4O3NA 3LP0A 5L1JA 4G3IA 3H5YA 4DL5A 1RT5B 3LP2B 3JYTB 2J6UA 2AX1A 3IRXB 3MR5A 3E51A 5L9XA 5CYMB 2FJXA 4RNHA 3UDLA 5C5JA 5KG2A 1N4LA 2HWIA 1CSJA 3PR4A 5F8GA 4U7CA 4JUZA 4TYBA 5J2MA 2ATLA 3TQ1A 3BREA 5KT6A 5KFYA 2YKMA 3CDEA 2F8EX 4MK9A 3KLHB 1JLAB 5KFHA 1S1XB 3MECB 3IG1B 1LWEB 4H4MA 3OHAA 2XI2A 1RT1A 5KFWA 1C0TA 2JC0A 4Q44A 5KFIA 2I1RA 3DLKA 3I0SA 4F4WA 2IJFA 1JIHA 3PW4A 2J6SA 3QO9A 3QYYA 2ZE2B 1IM4A 2YNIB 1S1WA 1RT3B 4NLXA 1W25A 2IBKA 4O44B 1DLOB 3D5MA 1RTIA 1KLMA 3RB3A 4G1QB 1EP4A 5KG0A 2WK4A 2ILYA 3KLVA 2FVRA 4ECXA 4YMEA 3DMJA 3GQCA 4FBTA 1FK9A 2RF2B 1D0EA 4O4GB 3MF5A 2XCAA 5KFDA 3KK1A 2ZD1B 4F50A 4NCGB 3JYTA 4EEYA 1HMVA 4K4YA 1FKPA 2AGPA 3DRPB 2EC0A 2UVUA 5I3UA 3PHEA 2AGOA 2FLNA 1S1VB 3CDUA 3BSOA 1DTQB 2C22A 2YNFB 4RW8A 5KT4A 1U09A 3KLHA 4ID5B 4XPCA 5K14A 2D7SA 2OPPB 1S1TB 5HLFB 2WOMA 1K1SA 4F4YA 2VG5B 2ASJA 4ICLA 4MK8A 5EUHA 3NAHA 3Q8SB 3KNAA 3DRRB 1N5YB 4J9SA 2CJQA 1ZTTA 4ED0A 3M8PB 4R5PB 5KFVA 4Q0BA 3QZ7A 5KFAA 3EPGA 4IR9A 3KLFB 3KK2A 2ZE2A 1HQUB 3OSPA 2OPSA 1HARA 3FSIA 2HNYB 3KLGA 2DPJA 3KLIA 4G1QA 3DM2A 4PUOB 3N6LA 3CVKA 3NKYA 3NBPB 3G6VA 3LAKA 3JSMB 4WFZA 1QE1A 4EYHB 1QAIA 1ZETA 4RW9B 2WCXA 1SH2A 2RKIA 3C6TB 1JLEB 3FFIB 2R2SA 2FVQA 3RAXA 1SV5A 2R2RA 1TP7A 1VRUB 4IFYB 4TN2A 4Y2AA 2C2EA 3HVTA 4DG1A 5HROB 3I5CA 1JLFB 4KFBA 3PJXA 4NLOA 5KFJA 3OL8A 5F8LA 4QWEA 2YNFA 2YNGA 2QE5A 1HQEA 2VG7B 4B3OB 4ZVGA 3Q8PB 4RW7B 4ID5A 2YNHB 1S1TA 1D1UA 2OPQA 4Y2CA 1T05A 4I7FB 5HP1B 3V4IB 2IM3A 3DRRA 1IKYA 1S9FA 1WNEA 2JLEA 4WE1B 4R5PA 1NNDA 4HYKA 3V81B 2V0NA 4ZMMA 3Q8QB 3PZPA 3KLFA 4ECRA 3DOKB 3ICLA 1SH0A 2YKNB 1JLCB 4TY8B 1LW0A 1RT2A 4YQWA 1S9EB 5C42B 3UPFA 1S9GA 1JLQB 4IKAA 2D3ZA 5DQHA 1JKHB 3ITHB 1R0AA 1LWFB 1TV6A 3TAMA 3BR9A 3FDSA 5DG8A 4URGA 4LSNB 5C25A 2FJVA 3CO9A 2R2UA 1T03B 5DQIA 5KFKA 1BQMB 2B5JB 1C1CA 3RB0A 2WRMA 2XI3A 3C6TA 4NLSA 2IAJB 4NRUA 4K4UA 4RNMA 2VG6A 2BANB 3D28A 1HPZA 3KMSA 4IH6A 4ED7A 1TQLA 5DGAA 2BE2B 4WFXA 3QZ8A 4FS1A 1LW2A 4IDKA 1NHVA 4IG3A 5KT7A 3G6YA 3KK3B 5J2NA 3IS9B 4QWDA 3MFHA 4WXWA 5KFLA 4K4WA 5C24A 2YNHA 3DRSB 5FDLB 2FLLA 4J9KA 4I7FA 4K4ZA 3V4IA 1NHUA 4QW9A 4IRCA 1UWBA 3MEGA 4URQU 4ZVHA 4ECQA 2ZKUA 2W9CB 4DL6A 3OL6A 1RTHB 1K1QA 1C0UA 3HVWA 1TL3B 3DI6A 3T5HA 4RNOA 4Q8FA 3H59A 1HNVB 2FVPA 4IG0A 4TY8A 2WONB 3DYAB 5J2QB 2JC1A 3QGIA 4QW8A 4EO8A 1ZTWA 2IA6A 3G6XA 4LSLA 1S0MA 3NL0A 5I42A 4JV1A 3FQKA 1RTDB 4KAIA 2IMWP 1S6PB 4DEZA 1FKOB 2B5JA 1IKWB 5KFEA 1TL1A 3T1AA 3PW5A 4IFVA 2W7OA 2HWHA 1HYSB 3RBEA 2WTFA 4KHMA 4PQUB 2JEFA 4NLUA 1JLGA 2UVVA 3UR0A 3BSNA 3NGDA 4WZQA 4PWDB 3PW7A 3DLGB 3I0RA 4Y3CA 1Z4UA 2FVCA 2HNZB 5D3GB 2BQRA 2AWZA 4O3SA 2OPRB 4HKQA 4Q8EA 3LP1B 3GIMA 4IH7A 2GIRA 3M9OB 1S1UB 3OHBA 3DLEA 4RW4B 1LWCB 4I2QB 5KG4A 1C2PA 4MK7A 4NLVA 1RT5A 3LP2A 1HNVA 2UUTA 1RT4B 3IRXA 2HMIB 5EWFA 5CYMA 3Q8RB 1SUQB 2I5JB 5JUMA 3CIZA 3IGVA 3LANA 4NLPA 2BRLA 4ECSA 2DPIA 4TXSA 4K4TA 1IKVB 3LALA 2E9TA 3TVKA 4EYIB 5DLGA 1JLAA 5F8MA 1C1BB 1S1XA 3MECA 3IG1A 2CKWA 1LWEA 4WYWA 4DL3A 4KKOB 1N6QB 2O5DA 4YR0A 4J9RA 3GIIA 3KLEB 4NRTA 5KFNA 4O3RA 4F4ZA 2BQUA 4NYZA 4ECYA 4RUAA 3BQ0A 3DOLB 1IKXB 1TVRB 4KSEB 2HNZA 2YNIA 1RT3A 4Q43A 3MEDB 4O44A 1DLOA 2IM2A 1RDRA 3HVAA 4RNNA 4ZVFA 4GC7A 1TKZB 4ED3A 4ECWA 2UUWA 4RW6B 5KT3A 2W8KA 1RT6B 1RT7B 2RF2A 4RW4A 4O4GA 3OLBA 1RA6A 2ZD1A 4KO0B 2R8JA 4NCGA 3QGHA 4NLQA 2FVSA 2XWYA 3KMQA 4LQ3A 3DRPA 1HNIB 2HMIA 4IQXA 1BQNB 1OS5A 4MFBB 4LQ9A 5EWGA 3RAQA 1JLBB 5KFPA 5F8IA 4FBUA 4K50A 1S1VA 2R8IA 3I5BA 3RB6A 1DTQA 2XGQA 5J1EB 1MU2B 4R8UB 2B6AB 3PVXA 2JEIA 4J9NA 1I6JA 1RYRA 4ZP7A 2OPPA 3KJVB 5HLFA 3H5UA 2V4QA 3KOAA 2VG5A 3H40A 1RA7A 1N6QA 1N5YA 2VA2A 3M8PA 4EBEA 3SFUA 4O4RA 1IKXA 4Q45A 1HQUA 5KG5A 2HNYA 4U6PA 4KHRA 4NLWA 1TKZA 4PUOA 2AQ4A 3I5AA 3BGRB 3NBPA 4RW6A 3JSMA 3V6DB 4ZHRB 3E01B 4RW9A 4I2PB 3HHKA 4WXOA 2IC3B 3MEEB 4KE5A 3PW0A 2HNDB 3ISND 3CDWA 4KB7A 1JLEA 3FFIA 1VRTB 4KV8B 5KG3A 3V6HA 4MH8A 1VRUA 4IFYA 4RUCA 3H4DA 3C6UB 2JEGA 5HROA 1JLFA 5EDWA 1GX5A 3LP0B 3T19A 1XR6A 4ECZA 2VG7A 5J1EA 4B3OA 4TLRA 1MU2A 5KG1A 5KFZA 2B6AA 1REVB 4RW7A 4ECTA 4JV2A 4JV0A 4O3OA 3KHGA 2V4RA 3GV7B 1GX6A 5HP1A 4ECUA 3QIPB 2R8KA 5J2MB 5L1LA 4WE1A 5KFOA 3V81A 3T5LA 2E9ZA 2YKMB 3GILA 1EETB 5J2PB 4OL8A 3DOKA 2ASLA 4ZP8A 5DG7A 5DLFA
chains in the Genus database with same CATH superfamily
1M1HA 2M9KA 1A0OB 3MPUB 5JXSA 4JI6F 1RE1B 1V3ZA 4AYBD 1T03A 1EP4B 1NB7A 5KFTA 4AT1B 3OL9A 2IFXA 2K3IA 4LFBJ 1TL3A 5J2QA 3P5TL 2SXLA 5IT0A 4Q7AA 3CCUS 2KL8A 3A3OB 3KLGB 3DM2B 3AHPA 4YR3A 2BJDA 3W2VA 3A12A 3GB0A 1S6QB 2QA4S 3QRPA 1WC1A 3GG0A 4DR6J 4KFBB 2Q6CA 4FP9A 3VALA 2LA4A 3HHDA 5L1KA 1K8AT 2XCPA 4RLEA 2D41A 3PFOA 1B7FA 4KBIA 1IR0A 3GPAA 3M32A 3TYTA 1LW0B 2GGPA 3ENAA 4OI4A 1R0AB 2UVRA 4CLWA 2DEJA 4ED8A 2WB4A 4CO0A 1UFLA 3ULHA 4IG3B 4WIQA 3W2WB 1VJWA 1H7XA 3KWMA 4C7QA 3TA1A 1GMUA 3MDFA 3WZ0A 3HHLC 4X4RA 4EBDA 5A6PA 2XHWA 5KFQA 4BC9A 4K4VA 5I42B 2LLZA 5GAHI 1FF2A 1JLGB 1IJFB 5T7LA 2ZOMA 4X65F 2C28A 1NJYA 4HEA9 5B0FA 3ZTRA 4OZ5A 1U1NA 1PJ6A 4G3IA 2LU1A 2HHVA 2AP6A 2HWIA 3W1YC 5J2MA 1SI9A 3WBZA 1QM9A 2YKMA 1HKAA 1JLAB 5KFHA 4DDFA 3BDPA 4A8FA 3ZTPA 1TZ0A 4M5LA 4DQQA 3HZGA 2FJDB 1RT3B 4Z7YA 4FN5A 2FD2A 2BBEA 3JTPA 4K2JA 1NH7A 4ZJLA 1LQ9A 3DRPB 2Q6BA 3PHEA 1S1VB 3BSOA 1BC6A 2YY3A 1SJ4P 3PEJA 1X4FA 4FNIA 3DRRB 1F1BB 2OTJS 4RWWA 3M8WA 5BYSA 2D9PA 4N7TA 1TK0A 3N4WA 4DR1F 3SZ2A 2YKAA 2MXYA 1QE1A 1IBLF 2V4JB 2WZ1A 4DPXA 4CLTA 4TNOA 2CPJA 3D9BA 3GFHA 3VAMA 1S1TA 4KGVB 3LWLA 1WNEA 4KGZB 4ZMMA 5SUHA 4DUZJ 2JLFA 2HZCA 4HTIA 2LQ9A 2RQMA 2MZJA 4H4KA 2VL1A 2Z56B 4NRUA 1XTZA 1TQLA 4ZCLA 2G1DA 2AEMA 2Z2MA 3V4IA 2VH7A 1NHUA 2JL9A 3W61A 4X4PA 5B7WA 2IBOA 1KVKA 2HHXA 1X4DA 2DNZA 4ZCKA 4DU7A 1RB0A 3IC1A 2E7VA 2C2OB 3R6LB 4FDFA 2KFZA 3TA0A 2I6WA 3MM6B 1TR0A 3NGDA 4B08A 2N3LA 1VC5A 4ZVTB 4IO1A 4U96A 3LF0A 2CUYA 1FFWB 4YDXA 2VD3A 5CYMA 4DXLA 2EC2A 1SUQB 4DR2F 1LFPA 1VYAA 3POTB 1YLXA 2LA6A 1BUXA 1QTNB 4KKOB 2O5DA 1AW0A 2XSJA 1HBUA 4W4MA 5CYJA 2F65A 4ED3A 4FXDA 3G82B 2MY8A 4C11A 4IQXA 1NAQA 1ZM3A 3BGFA 1RWNB 1YX2A 5G4DA 5D8HB 3D6TB 3KJVB 2ZC4A 1N5YA 4KH1B 2VA2A 3VWSA 1WKLA 2JFKA 4IYQA 2CIMA 2ZUGA 2ZHAA 3CGIA 3Q2TC 4RBVA 1CS4B 1GXLA 4PUOA 3AOCA 3A8IA 2YX1A 2DNRA 1FD2A 2B6AA 3MM5A 2LQBA 8ATCB 4RKUC 3EWGA 3V81A 3E2EA 2GO8A 5J1NA 2YKNA 3PHTA 5G0RB 2NZ4A 1X7VA 1YJTA 2C1EB 1YJUA 4G65A 4M5DB 2W8LA 5KFBA 4JV5J 1S7IA 4QBUA 3D6HB 4J9MA 3TP2A 3DRSA 4ECVA 2VOOA 2Z57B 4OYMA 2F3JA 3GYGA 2B9YA 1Q82T 5L1IA 4DSFA 1RU2A 1S6PA 4YB1P 2G4BA 1WWHA 2RHSB 1U1QA 4H4OA 1HBNA 1T9YA 1NDPA 2RKIB 1YZ7A 1VISA 1RABB 1SKWA 1L3UA 1LWCA 4K8RA 2QSFA 4H4KC 1IBMF 4NXNF 3OJUA 1RT2B 4ZOSA 4C8ZA 1C1BA 5IT4A 5A6WA 2B0GA 4L72B 2FY1A 2HHHJ 3HT0A 1OJ4A 3QWUA 1NDKA 3DGVA 1RUSA 3GE9A 5FIIA 5J2NB 3MEKA 1KSPA 2BE7D 1FO1A 3J7YI 4KC5A 2Q79A 3QT5A 1C0UB 5HO4A 1U0HA 1SC1B 3QLHA 2HS4A 3NY0A 1KHWA 1HBMA 5HQMA 3SXLA 2IVFB 1HI8A 4WKRA 3MPYA 4B9UA 3I0RB 1TKTA 3MMCA 1RAIB 1MWQA 3DLEB 3LP0A 1GT8A 2MJNA 1VDHA 1JNRB 4FYYB 2QLWA 4OHVA 1WJ9A 2HGMA 4MK9A 4NA3A 4LRFA 3JSYA 3IWXA 4A8XA 4JI2J 4F4WA 2IJFA 3AXKA 3C16A 1YHQS 2PO4A 2AJ4A 2EG1A 1EARA 5HL7Q 4HH1A 3KDNA 2ZNZA 3B54A 1YG0A 1HMVA 1ZOTA 1WF2A 2H4WB 3F41A 3WDOA 4WJBA 1XNRF 2CDRB 4MYTA 1S1TB 4DR4J 4ED0A 3UDVA 1P9QC 3BR8A 3G6VA 4P9SA 3R5CA 3ONQA 2C2EA 2MHEA 5HQ8A 1P1LA 2NXJA 2LKZA 3RU0A 4Y2CA 2IM3A 5HP1B 3V4IB 1WEZA 2A10A 2LQJA 1JMTA 2W2PP 5LJ5Y 3CDBA 2YWEA 1YZ6A 2R7SA 4N41A 2UV8A 5A8KB 1YKWA 3FEZA 5L9NA 3KJNB 3CCLS 1VBZA 5KT7A 1U26A 1VQ5S 1H2VZ 5KFLA 4OJHA 4I68A 2V8GA 3OV7A 4TU9A 1XNQJ 3H59A 2EXUA 3KDOA 2FZCB 2ZOFA 3FQKA 3UD3P 4IFVA 2RU9A 4DF8A 2JEFA 2CQCA 3CTRA 2RS2A 5KOWA 4MK7A 5H9EK 1X5TA 2ZM6F 1FNXH 4YY3J 4OX9F 4K0KF 2E5LF 4G1PA 5F8MA 3DRXA 3IG1A 4GVLA 4DL3A 1DY3A 4E2FB 3GIIA 3OJSA 4QU6A 4XIUA 4CWBA 3R2DJ 3RR7A 3QJJA 4Y6IA 2MEWA 2JZ5A 4USHA 4PQAA 2R7QA 4OYWA 4B9MA 3I31A 3I5BA 2B6AB 4J9NA 2BDPA 2NZCA 4P7TA 5LM7E 4NE9C 4C8YA 3LWMA 3T1HF 5KG5A 2HGNA 2CJAA 3DDNA 2EFNA 1CJKB 2C3MA 4KB7A 1OY9A 1VRTB 3QBCA 1N32J 2G0CA 2JEGA 5D0HA 1GX5A 1RAEB 4TLRA 4JV2A 1UA0A 1TK5A 2B3TB 3BDEA 1F3FA 4NOHA 3PDNA 4U95A 4ZP8A 1G7CB 1AFJA 1PBUA 3IR5B 1LWFA 4W98A 1FRKA 1PCAA 3RUBL 2OD6A 4H4OB 3B6BA 3IS9A 4ZN3A 4HL9A 2RNEA 1R6YA 1TFYA 2GAHC 2EG2A 3NOGA 3IWLA 2JNJA 3R5BA 4B17A 4J9LA 1XR5A 3OW2R 2LEAA 3OUYA 5BYQA 1MN7A 1EX8A 3DFEA 4K4SA 2OPRA 3MMAB 2B8QA 5BXIA 3H5XA 2PGCA 3G4SS 4C8NA 2RH3A 5KFMA 3NGTA 5I4MA 3G6ES 5KFFA 4OZLA 3M9MB 2H5EA 1CQMA 4DV2J 4IRKA 3GTYX 3H8YA 1FX4A 3NMRA 1IBKJ 3QLHB 1K47A 3CJ0A 1WC6A 1XEZA 2ZZMA 2OELA 2Z30B 3LGNA 5KG6A 1UZDA 2JJ4D 1LW2B 4KT0C 4MIBA 2M88A 1TKTB 2YVSA 4KR0B 3OR1A 2I38A 4NWBA 5ADZA 2PMWA 3M6VA 2W9AA 4NASA 1DRZA 3IBWA 2VFRA 5HJYA 1UETA 3GLJA 3NS6A 1KFDA 1A9NB 3UVJB 4A46A 1TKDA 2W4PA 3H5SA 3ADAC 3CD7A 1OQ3A 1S72S 4OI1A 3X3UA 2JDJA 2MKJA 2EEYA 3OFHA 3WC0A 2IC3A 1PAUB 2V2QA 1K0TA 4KV8A 4OZ2A 2A6OA 4L73A 1RT5B 3LP2B 2ZHBA 2HHSA 5L9XA 2VKRA 4TYBA 5LSOA 3PM9A 2DHSA 4DV0J 3GFXA 3QO9A 2AW0A 3D1HA 2G13A 2WK4A 3GQCA 4FBTA 1D0EA 3Q89A 4O4GB 5SZTA 4B3TJ 3MCOA 5I3UA 2MSSA 4DFKA 2PSZA 2CPEA 3I9V9 1UL3A 3ETOA 5HSPA 3CC2S 2ASJA 3A1YG 4MK8A 3CNQP 1WHYA 1WELA 1H38A 1XMQJ 1HWIA 4G1QA 1HHQA 3KKFA 3NBPB 1QAIA 4DMZA 2G2YA 3FFIB 1RWUA 3K8VA 2WSFC 3ZZRA 4ZVGA 2CQPA 5HMWA 1HQEA 4ZS6A 3M30A 1P6TA 2BVZA 3T6BA 1HA1A 4WE1B 1LOUA 3NXZA 1H74A 2AYMA 2YWHA 1NK5A 1CULA 1VC0A 4GKKJ 2CQ0A 1KONA 3FDSA 3CO9A 1CJTB 4ELVA 2J9EA 3MGJA 1YBAA 5DZ7A 1WC5A 4JI6J 2BW7A 4K4ZA 2DHXA 3UN3A 4URQU 4ZVHA 4CLPA 1RTHB 1R0CB 2VBWA 4Q8FA 4DR3F 2CQIA 2GCFA 4EI2A 4DV3F 4ZVOB 4CLFA 4DSKA 4P6QA 3H2UB 4KHMA 4YOEA 3R5GA 4Y3CA 7AT1B 3P3DA 2F4VJ 1SL1A 2VJUA 4EU0A 1XMOF 3M8ZA 3IAM9 1WHVA 1E6YB 2HQIA 5EWFA 2E1MC 3VF0B 1NJZA 2RQ4A 2FHOB 4B3SJ 4EYIB 4LF4J 4CTAA 4WBFA 4CM2A 2CKWA 2GFFA 5KFNA 1N88A 2QSWA 4KIAA 1V5IB 2W2NP 4Q43A 1RA6A 2V9KA 4KYZA 4NCGA 4NLQA 2HQGA 2DGTA 4ZVRB 4OJGA 5EWGA 4FBUA 4K50A 3J81Y 2KXNB 1I6JA 3M8SA 1N6QA 1TAQA 1KVJA 4KRWA 1A6LA 1ZA2B 2GA7A 3MTJA 4MH8A 1F9HA 2MZRA 5DDOC 4A48A 2V68A 1J27A 4JV0A 3B82A 5IV3A 2R8KA 2ZEJA 2ASLA 2B8PA 4OZ1A 1HHTP 5E7OB 1Y3JA 2CRLA 2VONA 1T9WA 2X51A 4LVNP 2HYIB 2QT7A 3DMJB 3KK3A 1SC4B 3TQEA 4DV5F 3PJWA 3GU0A 4NZ0A 1FRJA 5B09A 4Q5VA 3UQSA 4X62J 5AXNA 4ICLB 2B7CB 4NI2A 4EO6A 2WONA 2V8VA 2ZDPA 2J6TA 5JVGQ 2K1RA 4LF7J 2R4FA 5GVQA 4QU7A 1JX4A 2GC8A 3HFZB 3TZZA 2ZH1A 2V6AA 5D3GA 3VAJA 1WDTA 1VCTA 1Q5YA 3A3PB 5D4PA 1X4AA 1M5OC 2HFOA 1IKYB 2MDAA 2KN4A 3CD6S 3H0PA 4QPXA 4CLLA 2RU3A 2W2MP 3BSAA 2D3O1 1NPPA 2Z2YB 4NYPA 1M5VC 3FZ2A 4AXJA 4WK1A 1RT6A 3H4BA 1JLBA 5ETQA 3QAUA 3E8OA 1YK9A 4QOTA 4ED6A 4DR5F 4DR7F 3D66A 3CJ4A 5AE3A 1NPRA 1S4FA 3EGWB 3BEGB 5CYQA 1TL4A 2A3JA 3R1LA 2JLGA 5DQGA 3DOMA 1S0OA 2AX0A 5JJBA 5A8WB 1LXJA 3IN5A 3CWJA 2DKOB 1YI2S 2IJNA 1D9DA 2PE8A 2CQBA 4DL5A 1VQNS 2VDHA 2AX1A 2OI2A 4C6AA 4N5SA 3HVRA 4UY8T 4P2SA 4H4MA 3MOZA 1C0TA 4QJVA 5GAEU 3SIPB 2HSEB 2CYYA 4G1QB 5KG0A 4ECXA 2HIQA 3CF5Q 3PEHA 4AQYJ 1U49A 2AGOA 2E1CA 1DTQB 3TWZA 4TU8A 4O0IA 4F26A 3EUNA 4CT9A 4N56A 2CJQA 3M8PB 3C2PA 4UTGA 5ETPA 3BB5A 1YRTA 4UOHA 2HFZA 3CD0A 3JTNA 2CA9A 3HXMA 1SQGA 3MM7A 1Y5IB 1JLEB 4IFYB 4TN2A 2C3PA 2O1PA 3PJXA 5IT9U 2QE5A 2K2PA 2CWKA 2N4DA 2PEHA 3W60A 3KLFA 4ECRA 4ZPTR 5D4LA 1SH0A 2N82B 5DDPC 4I67A 1JLQB 2D3ZA 2R2UA 2GVZB 2XI3A 2BE2B 4QWDA 1LK5A 2CPXA 1TUVA 3EJMA 3OL6A 2BJ1A 2ACYA 1K1QA 2L9WA 1VBYA 5A2QU 3TUJC 1FTCA 1RJJA 3W7BA 1NRKA 3S6EA 3HPOA 3M2VA 2CG4A 1TMJA 3VAFA 2VOPA 1FD8A 2FZGB 3D0HE 3UR0A 3T9ZA 3DLGB 2GMHA 3OFGA 2F1FA 3JAMU 2XYGB 1U45A 3OHBA 2ATCB 4M5HA 3UDCA 4I2QB 4USVA 1AZSA 1NBEB 1UPPA 5CA5A 3SDEB 2F5GA 1VQKS 3TVKA 3GCWP 4C0BA 1SC6A 1HR0F 1CG2A 3DLBA 1N6QB 4YR0A 3EVMA 1G4CA 1IBMJ 2LU2A 4X4OA 2L9NA 4DWIA 3FEXB 2UUWA 4CQ1A 3ETMA 4Y28C 2HMIA 1BMQB 2DHHA 3RAQA 2ZVIA 4ZN1A 1FFSB 4RX6A 2MZTA 3LW5C 2V4QA 2VG5A 2QTWA 4Y00A 1KQSR 4EK2A 4ZK7M 1HQUA 3ZTOA 1OY6A 1LV5A 3V6DB 2G0JA 1DJ0A 3V6HA 1JLFA 1KN6A 4JI7J 3NRBA 2BJ7A 4DCOB 5E2QA 5DLFA 2Y1IA 2ZH7A 3NCQA 4ZVPB 3IGNA 2JFDA 4JBCA 3PIPQ 2XULA 1E6VB 2KDOA 1BQMA 1WTBA 3PV8A 2XO7A 2FJWA 2IAJA 1QAJA 1GK8A 3B78A 4NCAA 1K44A 2KYXA 5KFUA 3KUHA 2LYVA 5F9LA 1RAJA 3QIPA 5KFXA 1VMBA 5K14B 4RNFA 4DSIA 3DYAA 2FYXA 4Q0BB 2K7KA 3WQPA 4K2XA 1XNRJ 1VQYA 2ADBA 1JXEA 4PWDA 3JTOA 1FRHA 2VIHA 1SV5B 2EFOA 1V3SA 4AFFA 3GJTB 4LBHA 3OL7A 4CLZA 1VFJA 4ZPDA 1CJUA 4BC7A 3MR3A 4XDDA 1RTJA 2V69A 1GMWA 3M2UB 3GIJA 4OYOA 5KFRA 1WKKA 1GMVA 3B8HA 2W7PA 2HAIA 4LBIA 1YGYA 2VG6B 1SJ3P 5CYQB 3VVUA 1WORA 3S7RA 5HANA 4IDKB 2MKIA 3HJVA 2VU5A 1Y0HA 4DQSA 3ILIA 3MAQA 3NNCA 1PYOB 4Y2KA 5L39A 2Y1JA 3CW2C 1K9MT 3PKMA 4KGMA 4DHVA 3GYXB 3TUZC 2HZAA 4TQSA 4ELTA 2XM3A 1XIQA 2FLOA 1D8YA 3V6JA 2W7AA 1TL7A 1S77D 2ZJPQ 4USKA 3PW2A 1WC0A 5HBMA 1NK6A 2YBVA 4FNHA 2GJFA 2DJWA 4K4XA 3AB2B 3DLHA 2ZFHA 5L1JA 3H5YA 1MW7A 2VODA 3IRXB 3S1TA 1VK8A 2DY9A 2CJBA 4BLGA 1MROA 1U24A 4J5OA 2A2DA 1RT1A 1URNA 1R8PA 3CCWA 4D3GA 5AXLA 5J1PA 1JIHA 4OX9J 1RLCL 2MKSA 4L6V3 3D7SB 5D77A 1FXDA 4O44B 4P2MA 4K0KJ 4C3KA 4F2RA 1KLMA 1FHTA 3KG0A 3MOJB 2ZD1B 3JQJA 3HT3A 1TFWA 4LR9A 2IY5B 4X4NA 3OXGA 4LFCF 3HSGA 5KT4A 3NLCA 5CAAA 1HBOA 3V5RA 4LF2A 3KLFB 2QMUB 5E3AA 2OPSA 5AT1B 4ZVUB 3LAKA 2FB0A 2FVQA 4Y2AA 5HROB 4NLOA 1T8EA 3PO4A 1FNMA 2HS3A 1KBRA 1H6KX 2ZH6A 1WC3A 2GVDB 2CQ1A 2MQMA 3FZBA 3VAGA 2P6SA 4OI6A 3CCQS 2H54B 2AIRB 3OQ2A 1X31C 4DSJA 3ITHB 4DPYA 2PFFB 2GV1A 3DGPA 3TAQA 1HPZA 4DUZF 1NHVA 3C15B 4C9DA 5A8RA 1QY7A 3OD2A 4K4WA 3PIOQ 2I8EA 4QW9A 4DV1F 5EX0A 2ZKUA 4MT1A 2L08A 1AZSB 3B4MA 4IG0A 1PJ7A 3QGIA 1SJRA 1S57A 3NL0A 2XLKA 4M1KA 4P74A 3OVBA 1HYSB 1OPZA 3FKBA 5K8NA 3T1YF 3L3CA 2R7WA 4GVBA 1X8DA 1IJEB 3MM8B 2V2ZA 3HHNB 3PX0A 5GAHU 2HMIB 1FWLA 3E3XA 2MGZB 4LJMA 5F0UA 3FRYA 3LALA 2E9TA 4YS2A 4V19J 4OZNA 4UUWA 4NRTA 4NYZA 1AXQA 4ECYA 3DOLB 3G2XA 2DCLA 3OBIA 1S99A 1Y10A 2FZKB 3AA8A 4V19X 4RNNA 2VPXB 4AXIA 1Y00A 4DV7F 3MUVP 3KMQA 4LQ3A 2LXUA 4FF1A 3LGMA 2R8IA 3WHIA 3PVXA 2WVBA 5HLFA 4M5MA 2IVMA 2AT1B 2UXDF 2C2KB 2KT5A 1CLFA 3D1QA 2VZ9A 4QYZJ 3IWNC 1OQ6A 2L3MA 2HNYA 3AOBA 4N47A 4RW9A 4WXOA 4KE5A 2RRNA 4R25A 4ZJQA 5T41A 1I1GA 2PI5A 4RW7A 2R7UA 4DN9A 4ECUA 3QIPB 3U1NA 2RDDA 2XY7A 5DG7A 1HD0A 1JLCA 3VAKA 2QO3A 2Z58B 2WB1D 3I0SB 1N5SA 3W5XA 5M2RA 4I64A 2BOAA 3JSBA 4CLYA 1QAXA 5FLXU 3EZUA 1N56A 2J9DE 4JI0F 4LSZB 3UW1A 1RWMB 1QAYA 2DYAA 4JV5F 2PEBA 3WX4A 3QFHA 3BQ1A 3CB4A 1U6FA 1H73A 4F4XA 4OYXA 1UEKA 1RTJB 5CABA 1NKCA 1V9OA 2HG4A 2X1BA 1RLDA 2HVDA 1VR6A 3EDRB 3HVTB 3FCWA 2OPQB 3RBDA 4FPIA 1ZM9A 1UJ4A 3RBXA 2HHTA 2PT0A 1EQ0A 1R8HA 1UVNA 3FUYA 3RR8A 2GIQA 2V9WA 5HBMB 1HI0P 2BX6A 1VQ8S 1S0NA 2HHHF 3DI6B 1MMLA 2BZ2A 1ZZNA 3FBFA 4PXCA 4CIOA 4MKBA 4FYWB 1RT1B 4ZITA 3K5MA 2EK1A 3F0NA 4DR3J 1RTZA 4DU8A 4DCPB 1QLNA 4LMZA 4DV3J 4O3NA 3V4MA 2FHMA 2HLTA 4AUKA 2V50A 2RAQA 4TU7A 1LEOA 1XMOJ 2EKYA 3ZZTA 4CLUA 3OTCA 4B3RJ 5KFWA 2CJKA 3SV3A 2JC0A 4PXBA 1FWKA 2Y8WA 3W64A 4EWTA 3D5MA 1DARA 3RB3A 2DRBA 2FVRA 1LXNA 4WU3A 2ZBQA 3JYTA 4JI2F 4KJIA 4NEYA 2C22A 4CO4A 4RW8A 4CH1A 2ROGA 2D7SA 4F4YA 3JQMA 2DR5A 2W4CA 2MQ8A 4A8OA 4RUHA 3FBBA 2DPJA 3NKYA 4EYHB 2HK3A 4DR4F 1FRMA 3K5OA 2WCXA 2HHUA 1N5QA 3NOCA 1KP6A 2KM8B 1TP7A 2LXFA 3QQCD 3Q8PB 1X4CA 4OJ1A 1T05A 2J0WA 1UZHA 4R5PA 1GXTA 4F3QA 2OD4A 1S9EB 3ZZPA 1S7HA 3D4JA 2CDQA 2NQPA 1JKHB 2DNLA 1S12A 2CJYB 4LSNB 5DQIA 2WRMA 5GAEI 1RADB 2BANB 4IH6A 1FJ7A 5CCLA 5CXTA 3SSSA 1MLAA 2FGCA 5KOXA 2F7VA 2RSQA 2ZWOA 2C3OA 4IRCA 3MEGA 1GXUA 1QD1A 5C7PA 1U47A 3O5TB 3MAAA 2KG0A 2CJ9A 1NK4A 4EO8A 1RKJA 2XMWA 4JV1A 4DV5J 1L3TA 4J91A 2QLBB 4TKTA 1RTDB 2RVJA 1HHSA 3PTWA 2Q3PA 1IKWB 1BHNA 3T1AA 3J7YU 4BHQA 2FVCA 1FE4A 4F3MA 2HLUA 3FC9A 4IH7A 3AAWB 1RT4B 3Q83A 2P5VA 2D74B 2DO0A 4TXSA 1XJWB 5IZHA 3EX7B 5DLGA 2Z4PA 1LWEA 3TAPA 3CCMS 3KLEB 4O3RA 1O6XA 4YY3F 3EE3A 2YNIA 1UPMB 2RQKA 3MEDB 2IM2A 4RBUA 4ITSA 2PA8D 2HBRB 1EHWA 2EPIA 2RF2A 4RW4A 3J7ZT 3OTOF 4KO0B 2GQCA 4HH0A 3BPSP 2AHOB 3UN2A 3MCSA 3RB6A 1B0TA 2OFGX 4ZP7A 2MYFA 3J81j 3HKZD 2NXCA 5K5MA 2G2OA 4DUYJ 2DRDA 1J5EF 3Q8VA 2HURA 3G71S 1UVKA 4DV6J 1TKZA 4OZ3A 3C3LA 2XSFA 3ET6B 4RWXA 3W65A 3NCRA 1TMMA 4LR8A 2EFQA 1GX6A 4X4VA 7FDRA 3O1LA 2LDIA 3DOKA 2NXNA 1ZBTA 3I87A 2BJ9A 4DX8H 2MQOA 4XPEA 2XMJA 3TO8A 1KHVA 2UUBJ 3FEYB 4X2BA 1VQ7S 2EW9A 4JI1F 1QTMA 3RZAA 2HK2A 4N77A 4NLDA 1GEHA 4YHHJ 3ILLA 1TUWA 2W9CA 2R9LA 1P8GA 3R5JB 1V3RA 3KJFB 2H51B 4CP5A 3KK2B 4ZVEA 2JX2A 2H65B 4CM0A 3LUYA 2DBBA 2XMTA 4ETXA 4A8WA 2DNOA 3IO1A 2QA4G 4OYAA 3QJLA 2HS0A 2X3GA 4WU2A 4QWCA 4KHPJ 1VK3A 3EPIA 3IR7B 2CPYA 1YJNS 1IKVA 1RHMB 1YJ7A 2ZH2A 1SCJB 3BBCA 4EFAC 1S9GB 2OFHX 1TV6B 4NLTA 2IHR1 4TYAA 1ZM2A 1C1CB 1OY8A 2UVWA 2J7KA 4O3PA 5DETA 4DV2F 3AQOA 5C24B 1IBKF 1U1MA 3BO2A 3DDKA 3DCAA 3U27A 4LREA 2DO4A 4J9PA 1DURA 4DPUA 5ETSA 2KHDA 1CJVA 5DGBA 5K9FA 1UVLA 1S59A 2BQ3A 1H2TZ 4ZPCA 1O0PA 4DFPA 4WP9A 3FCVA 1X9MA 3KFWX 4USTA 2FDNA 3MTKA 2FY8A 2VQEJ 2YXLA 3H90A 5HMYA 4MMOA 1K73T 3JYTB 4USWA 1SKSA 1M90T 2FJXA 2QIFA 2DR8A 1N4LA 1NEEA 1IXKA 3BH6B 4PRFA 3CDEA 5CD4H 3BGLA 3F56A 5HATA 3LOUA 1S1WA 2C42A 2RE1A 1N8RT 1IQZA 5KFDA 4EEYA 1YBUA 1FKPA 4ZPVR 4ZCMA 1R8AA 3HFKA 2OPPB 3KNAA 1N52B 1SL2A 4B3TF 4R5PB 4IR9A 5H9FK 5HVHA 2HAFA 3OSPA 1HARA 2DB1A 4Y2IA 3M6WA 3B4DA 2KB2A 2L41A 1XMQF 2GAGC 2BW2A 1SIZA 1D1UA 2LP4A 2JLEA 1HLWA 3ELHA 4R0JA 3W5ZA 2I9SA 4RL1A 2CVIA 5C42B 3UPFA 4FKXA 1RAHB 9ATCB 3D6MB 2ADCA 4CYUB 3RB0A 4RNMA 3H20A 4GKKF 2EWHA 2G9OA 5EHHA 2H4YB 2YNHA 4J9KA 3O8WA 4F36A 4BWJA 4I56A 3EYZA 1NJIT 2BM0A 4TVAB 3M8RA 4BBYA 3RYLA 1HNZJ 1FKOB 2B5JA 1N36J 2DXDA 2HWHA 5H1SV 4ZDNA 2A6MA 1T0TV 2BQRA 3HZEA 5L8RC 3PX4A 1S1UB 4RW4B 3EM1A 2EVZA 4HR2A 1NUEA 4WF9Q 4J37A 3OR2B 3H25A 2BRLA 4B9VA 3Q2SC 2F4VF 4OX7A 1SJFA 1RBLA 1I94J 5BR8J 4AL5A 1SPBP 3MECA 3PYEA 3H2VE 4F4ZA 1RAFB 2AJ2A 1ZPWX 2LMIA 4B3SF 3HVAA 4LF4F 1TKZB 4DN0A 2M8HA 2XY5A 3GWCA 2XWYA 1F0XA 1BQNB 4M63A 1ZA1B 2B9XA 1H98A 4WTOB 1VQ4S 3CCJS 1RYRA 4JB8B 3H40A 3CJTA 3X1LB 2CNLB 3M1VA 2XBPA 3TUIC 2VV5A 3AH6A 2M52A 2M4MA 4OV6A 3VQTA 4U67Q 1X5PA 3HD1A 1GH8A 3AD8C 3BGRB 3JSMA 4ZHRB 4LF6J 3VCDA 2V8PA 1WUUA 5KG3A 1VRUA 3H4DA 1A7GE 1X9SA 3CCES 5KG1A 3PRDA 2NXUA 4C8OA 1WOSA 1NO8A 3WIVA 5DO2A 4G1IA 1V5VA 1RHRB 3SI8A 1EB0A 2HNDA 2MY7A 4ILRA 2MQNA 3C14B 1HQ2A 4FF3A 1FK9B 2AGQA 4PG5A 3KK1B 1FE0A 4QR1A 5FDLA 3GZ7A 4GRSA 5AE1A 2B9WA 2YPYA 3M2RB 2CG8A 2CJXB 1EETA 5J2PA 2PDAA 5EGYA 2WOMB 4LR7A 1U1LA 2MLYA 1JB0C 3ZNJ1 4HHUA 2FLPA 4LFCJ 4BCAA 3KLIB 3UN5A 2CZ9A 1KTQA 2LCWA 4PQUA 4X62F 1F60B 3QT7A 3H98A 1YVFA 4PXEA 2DXFA 1KEKA 2AV5A 2IA0A 4LF7F 4RR5A 2YNGB 1Z2ZA 4B02A 1BGXT 2RUSA 2ASDA 2E7XA 3T9NA 3HF5A 4C0OC 1UCNA 3ZZOA 3TAMB 1XR7A 4TLQA 3QIDA 2BA9A 2DHGA 2WHOA 1QSLA 4JOUA 2RIJA 3FVYA 4P7VA 1NK8A 1OYEA 4TY9A 3AJ1A 3BM7A 5MLCV 1EZZB 2J7WA 4DX6A 1HNIA 4MFBA 1UWBB 4Z2XA 1RHKB 5FJ4A 2W01A 4R8UA 3KHHA 3MCMA 2FTRA 2QL5B 4LSLB 1X4HA 4DV1J 3CMAS 1SKUB 3HHLB 2C2RA 3N28A 5HN0A 4O0NA 4B9TA 4PKDB 1UFKA 3NWGA 1TKXA 5KFSA 2ASYA 2BYCA 4X66F 2PI4A 3C6UA 1S48A 5KT5A 1Z1ZA 1WTFA 3T1YJ 5L46A 3PR4A 2WW4A 4ZPWR 2GW8A 2GHWA 1S1XB 1Q4RA 4OQJA 2KXHA 4C8KA 3DLKA 4F04B 2NS1B 4FVCA 5IM0A 1W25A 1T7PA 4ZLJA 1RTIA 4D3HA 1O8BA 2UUCJ 2AEFA 1NK0A 4F50A 3HSDA 4CZCA 3UO0A 5CZVA 3NNHA 4ZLPA 4LF9J 4NCBA 3PYDA 1RWKB 4M8LA 4DV7J 3R6GB 5E0OA 1ZTTA 4QIWD 1YJWS 1AB8A 4AQYF 2AZ3A 5IS2A 4KGXB 3FSIA 3GJRB 1KDNA 5A0YA 1T9UA 6FD1A 2YX4A 2X1GA 2UXDJ 2MHNA 1H3DA 4HVZA 2KJVA 3KUEA 4DG1A 4ANCA 2HHWA 2VG7B 2HFVA 2YNHB 2XQCA 4FXWA 2H9ZA 2MKHA 5IOLA 5KAKA 3ENVA 4HT7A 3FCHA 1S0VA 1F9FA 3QAEA 5C25A 3KNGA 1T03B 2BJ8A 4ENOA 2B5JB 4PXDA 4FVMA 2AKWB 6AT1B 1JQGA 4JI5J 4WFXA 3QZ8A 2VFSA 2CNKB 4USMA 2B56A 2UV8G 1MN9A 4I7FA 2C2MB 3UCGA 2KZZA 2QGFB 1TL3B 1VQ6S 2DY1A 1S6UA 5J2QB 2V2VA 3A8JA 4KAIA 4JI0J 3R7NB 1TL1A 1OIAA 3W2VB 4LIWA 4L74A 3MXHP 2XS2A 2YTCA 2HBYB 4F8RA 1H2UX 4MTPA 1PYSB 2ZDOA 4LF8J 4F0MA 1MWYA 5U47A 4UQTA 2H48B 4CLSA 3Q8YA 2WBMA 3CIZA 3IGVA 3LANA 2X7IA 2DHAA 1HIYA 3ILOA 3M32B 3NWRA 3K59A 3R2CJ 2GGPB 4M5KA 4KH0B 4PG6A 1RXOB 2IJRA 1F2GA 1RWXB 1DLOA 4E8UA 4GC7A 3DNCA 2APOA 3TEHB 2BEFA 3QNWB 3FK4A 2CWXA 2WW8A 5LL6d 3OXLA 2CNOB 2DH9A 4PYDA 2XGQA 4NZ6A 3L09A 1ZYQA 1Q16B 3EZ5A 4OHYA 2KFNA 1CC8A 2ZKTA 4OYIA 3Q23A 1SVDA 5D6GA 3GIRA 1IKXA 3JB9k 3THVA 1VQPS 3C46A 1VQMS 3W9JA 5T7LB 4OJ3A 4DFMA 3PW0A 2HNDB 3CDWA 1AUSL 3NS5A 1R43A 4CO3A 4ILLA 5EDWA 3VTIA 5D4OA 4B3OA 4UY85 3GJSB 5J2MB 3P96A 2MZ1A 2YKMB 1EETB 5J2PB 1FJCA 2XZDB 4URSA 3VGVA 4WZMA 4HACA 3NMAA 2M2BA 4JI7F 5D15A 3HI9A 3EZOA 4NA2A 3BKFA 3VAHA 4K59A 3L4BC 2DEIA 4HLBA 3CXCR 3TZYA 4FF2A 2IPOB 1RGVA 5AJ3J 3SCKE 2F9DA 2XC9A 4CCHA 3VAIA 4ED4A 4KPCA 2KO1A 2V67A 5E3CA 3N6MA 2F8HA 1QE1B 2VC1A 5HAOA 5ETVA 2GHPA 3I32A 2GNKA 3LGHA 1SH3A 3LP1A 5KFCA 2BJEA 2KXFA 3M6XA 2QX0A 3T41A 4ZLLA 4X64F 4H54A 3CJ5A 1DTTA 3D68A 4LUBA 2I5JA 5KFGA 2ZBIA 2WSCC 3U02A 2HFNA 2D3UA 2VPZB 4LIRA 1XBWA 2VBZA 4ES2A 1TVRA 3CIMA 5DG9A 2E5GA 3DN9A 4I69A 1ZAWA 3AA9A 2GQ2A 1RT7A 1TKXB 3CEDA 4DI6A 2I2YA 3HKWA 4DL4A 2P9EA 1U02A 3RRKA 2VFUA 4ELUA 2RDIA 3CJ2A 1Q7YT 3IXQA 2R7XA 3CJKA 2OLWA 3NAIA 2PMHA 3PRVA 5IM0B 3MPWA 2F4FA 2K8GA 3PNIA 1KQGB 3TX0A 5CYMB 4RNHA 2KVQE 4U7CA 2ZH8A 2ATLA 3NGSA 1YITS 3BO3A 3SMZA 3VV2B 2FJEB 2XSJB 1HBUB 2NSBA 4OYPA 1YTYA 2H5JB 2HQFA 1EP4A 1JNZB 4DV4J 3MCNA 2E5IA 2FQQB 2MTLA 4C11B 2A0FB 2BUNA 4C8LA 3PXGa 1ULRA 4EUVA 3THPA 3R7SB 1AA1B 3KXDA 1T3NA 4HHHA 2G0IA 1VGYA 3OTOJ 1DHMA 1N5YB 2XLIA 1D8ZA 1YJ9S 3CCRS 4RUBA 1WG1A 3KLGA 3DM2A 2JVOA 4PUOB 3N6LA 4LFAF 4LT6A 4I6WA 1ZETA 3KG4A 3UCZP 5CHCB 1SH2A 4KFBA 1J5EJ 2YNFA 1O5JA 4NZ7A 1T02A 3MM5B 1MNEA 4I7FB 2CFXA 5F3TA 1SB6A 1Q79A 5H9EJ 3V81B 1ZPVA 2YKNB 2MQQA 4QYRA 1LW0A 3R7BB 1R0AA 4C48A 4HI1A 4JI4J 4NLSA 1UJ6A 5DS7A 2ROEA 2BJ3A 4IG3A 3TOQA 1Q86T 3W2WA 3D1OA 4OX8A 2ZH3A 3DRSB 4X4QA 1PGZA 4DUTA 1HNXF 4JI1J 2J76E 2VQFJ 1XMBA 2W2OP 3D54A 5GAGI 2RRAA 1DQAA 5I42A 2IMWP 1S6PB 2VC0A 4IQMA 1T9XA 2W7OA 3RBEA 1JLGA 1VQ9S 1HBNB 1SBRA 2MB0B 1U6ZA 2GIRA 3JSRA 3M9OB 1UW9A 2QLJB 3SYZA 3R3TA 1LWCB 2FHJD 1C2PA 1Q8BA 5DJBA 2CZVC 1X60A 2DH7A 1IBCB 4ZA1A 4ECSA 1EAYC 1WD6A 1JLAA 1C1BB 2YQ1A 4WYWA 1U48A 4J9RA 1IKXB 2ROPA 1RT3A 4J7CA 3TNVA 4MJKA 2W8KA 2E44A 3DRPA 4P52A 1KR4A 3NP5A 1U1RA 1S1VA 1SJ1A 2MMYA 4DZDA 4L75A 1U0HB 2EFPA 2JEIA 1SIWB 1X5SA 3RRHA 2UP1A 3SFUA 4O4RA 4FPRA 1HBMB 3Q86A 4U6PA 4HACB 1VBKA 5K8PA 1NSPA 4ZCIA 2VICA 1Q1KA 1FVQA 2AQ4A 2XYPB 3MMCB 2V4JA 4L76A 4RUCA 3LP0B 1QUPA 2HHQA 3CUNA 3CT9A 4Q2LA 5B0CA 2IIHA 2MQPA 5BYRA 4P2XA 3GILA 5ETKA 3GYNA 3QFWA 4YB5A 4C2MA 2E1PA 3UE2A 2XY6A 3C16B 3BS9A 3UNYA 4XTTA 4RBTA 4QR0A 3FRZA 3L95X 1HMVB 2RHQB 3I56S 1DTTB 1WF1A 3MHYA 2Y1RI 2AD9A 2A1BA 2R7OA 1T9VA 2GJ2A 3F73A 2QRRA 4RU2A 2KT2A 2KRRA 1I5OB 2WAQD 4MKAA 3GV8B 3R97A 2AYEA 5JMNA 2XTJP 3H2LA 3QGGA 2GHVC 4ZPAA 4WYLA 4RU9A 1SUQA 3Q0AA 2E5HA 2YH0A 3POTA 1WG5A 2V8HA 1JXLA 5F8NA 5F8HA 4KKOA 4F2SA 3DRYA 1YIJS 3CJKB 5D0EA 3G82A 1QUVA 1BLUA 3ZZ0A 1PG5B 2ILZA 3P5BP 2V8DA 2B4OA 1Q5VA 3KJVA 3IRWP 1EKSA 4KGKA 2HQCA 2EBGA 4U8VA 1N48A 4IFVB 1WC4A 1CS4A 3BZQA 2B4PA 4NA1A 2CQGA 1H0HB 1FJGJ 3CCSS 2MKYA 5K8OA 1DAXA 3HMJG 4LRAA 2YKQA 4WFYA 2L9DA 4NX9A 2F40A 1KS2A 3GSDA 5KG2A 2QA1A 2QYCA 5KT6A 1X5OA 3TEGA 3IG1B 4OYZA 4JI8J 3VHQA 5G0RA 3QWPA 1N33J 2O67A 5A2QY 1RBAA 3N01A 4M5DA 3EMTA 4K5SA 2ILYA 4B3RF 1Q8IA 2XCAA 1BXNA 2YPZA 4EZ6A 4PPZA 1R6VA 3V2UC 2FLNA 3J80U 2YNFB 2O3DA 3JAMY 1WG4A 3NAHA 1U0SA 2VASA 4P10A 4PAAA 3AD7C 2MLXA 3I6PA 1IN0A 1JK9B 2KG1A 2RKIA 2V94A 2DNPA 1MMNA 3T6JA 5F8LA 4UOCA 3TVZA 3VZIA 3PCOB 1OWXA 4AD6A 3JS9A 1YDLA 1RT2A 4RJVA 1LWFB 5DG8A 2EKNA 4WWSA 1N0VC 2LXIA 2HFUA 2VFTA 3C6TA 4DFJA 2DNNA 3BGUA 1HL6A 1PYTA 5HK4A 5J2NA 3IS9B 3K5NA 1FRXA 1C0UA 3ZZZA 2MZSA 4MKVA 5LXRA 4W92B 4UZCA 4CH7A 3K5LA 2ZZTA 1DFDA 5KFEA 3PW5A 3OUYB 2WBRA 2UXCF 2E1AA 2K7JA 3BV8A 4WCEQ 4LBPA 5ETNA 2YX7A 3LTOA 3I0RA 1TUGB 2AWZA 2CPHA 2OPRB 5I3PA 4Q8EA 5LOQA 3DLEA 3A4TA 1W2BR 4OZJA 1CC7A 5JUMA 1WOOA 2P6TA 1OMSA 1Y9OA 2CQ3A 3NCPA 2KI2A 3QMQA 1AUDA 2M0GB 2EK6A 2VUGA 1U25A 7FD1A 2HNZA 3AFGA 3KG1A 2OMLA 1LKZA 1KVIA 4ECWA 4FYXB 2QA2A 3OR1B 2M5YA 3QGHA 2A18A 5LMNJ 2DGQA 1HWUA 3M6UA 2QMWA 3QSYB 3P8BB 2AMCB 2CPFA 4Q45A 3FSYA 2XB2D 1Y4ZB 1FI4A 4B9LA 2IC3B 4RPFA 3ISND 1KC8T 4KV8B 4DUYF 1U6BA 4DS4A 4DV6F 1YJRA 1MU2A 5KFZA 1YRUA 2V4RA 3GV7B 5HP1A 1REGX 3EDQB 4F67A 1NCLA 2OHDA 3T5LA 4X66J 1VI7A 2RD5C 3N6NA 4WFBQ 1FJEB 1KOHA 3QO9B 2UU9J 5A8KA 4I2PA 4IOBA 1MSWD 1RSCA 2FJAB 4J9QA 1SXLA 1REVA 2JH3A 4DL7A 5I3UB 2UUBF 1RYSA 2R7RA 1B64A 2DGXA 1FDDA 4KTQA 3C8YA 2HW3A 1U8WA 1G6BA 2YH1A 1FDBA 4ES1A 3RG6A 4YHHF 1IVZA 1D3WA 1NU4A 2R3VA 3LPEA 2FIUA 1Q7LB 5F8JA 4XDCA 1HNWF 3QATA 3MM9A 1HQEB 3M30B 2CPDA 3GG1A 2VA3A 2BABA 3CJQA 2QC3A 1U2FA 2HQ3A 5DDQC 1CULB 3TJAA 4KHPF 1VQSA 5F41A 4F7VA 1YJVA 3BSCA 1C4CA 3UCUP 3GR1A 2QLFB 4DZ6A 3CC4S 1PBAA 3M7VA 1U1OA 1EQMA 2R8HA 3HDSA 3RW7A 2LEBA 4JYAJ 2NYIA 1ACMB 2L48A 2DNYA 4CRJA 1CJKA 4OI2A 3DXSX 1VRTA 1FDAA 3G8TA 4DQIA 3L7UA 2J6UA 3K58A 2J5AA 1M5KC 5C5JA 2WVDA 3TQ1A 4CTAB 2VQEF 3OPKA 1W2IA 5EN1A 5GMEA 5LJ3Y 2BE9B 3QT8A 3J7Z5 2QLXA 2E5JA 1NB2A 3W3SA 2HVZA 4PEOA 1B70B 4CT8A 3CCZA 4NCGB 4M5NA 2P8IA 2YKPA 2BKPA 8AT1B 4P71A 2YWKA 2QEXS 3J7A1 4F0HA 2OUGA 5B0BA 3KLHA 2ZBRA 5EUHA 4J9SA 2P9GA 5KFVA 3QPIA 3EGNA 4P72A 4QZVB 3TZWA 2ZE2A 1N54B 1OPIA 3CVKA 1VQLS 1TL5A 2J0SD 3C6TB 1Q78A 1RHUB 5GADI 2R2RA 3MMAA 1WHXA 3CC7S 1B4SA 1ZAXA 3MAHA 1OYDA 2M70A 4KQZA 1NJXA 4DX7A 3SCLE 3I4PA 4L3NA 1P9YA 4NMLA 3CJ8A 1FEHA 3AQPA 1B7YB 3BR9A 1AROP 2J8AA 4URGA 2NLWA 5KFKA 2W25A 3AJDA 4K4UA 3HFVA 4U7UK 3KMSA 4FZVA 3EGZA 1LW2A 3BN4A 2GJIA 1KQFB 3G6YA 3KK3B 3PY8A 2ZWPA 3GSIA 2LEPA 4BWMA 3DDIA 3RGIA 4UQGA 5LMUF 4NI2B 2WONB 2C3UA 3G6XA 3UVJA 1UW4A 2CQ4A 2QFIA 1NSKL 3RBZA 2K1RB 2WTFA 2Q1LA 1G3OA 2HNZB 5D3GB 1U1KA 2LVWA 1HNZF 2OAUA 1V6HA 1N36F 1NDLA 1R89A 4NLVA 1RT5A 3LP2A 2BXJA 1XN9A 3HCXA 5FLXY 2AJ0A 1RWWB 1D09B 1L3VA 1OSDA 3C66A 3D2WA 5LSRA 4X64J 1VHFA 1KOOA 1UVJA 3K7RA 4RUAA 3OXFA 2G2ZA 1I94F 5BR8F 4F3OA 4WPAA 1RT6B 4O4GA 2LDYA 3R27A 4ETZA 2FVSA 3P6YC 2XZTB 4CNZA 1JLBB 1DBDA 3OTEA 3CCVS 1MU2B 5DDRC 1PO6A 1RA7A 3R1HA 3SEOA 1X0PA 4DL0C 2HGLA 1DQ8A 4NLWA 3NBPA 3DOMB 2FGOA 4I2PB 1AT1B 3FFIA 1U8SA 4NMXA 2AZ1A 4ECZA 1QVFR 4ECTA 1REVB 2C2NA 4O3OA 4QIVA 4LF6F 1NM2A 5L1LA 4WE1A 5KFOA 3O6QA 2J0XA 2D3OR 4N76A 4OL8A 4H4MB 3UD4P 1C0TB 3OTDA 1SKRA 4QIFA 4OHWA 3IM8A 5B0AA 1CJTA 1L5UA 1T95A 5CH7B 3U7JA 2W4DA 3OLAA 3W66A 1VQOS 3MM9B 1FKAF 1BWEA 4OI3A 1RTHA 3D0IE 3O3LA 4UOGA 3W9IA 3HHLD 2JRSA 1RAGB 1PSDA 4A8QA 2R2TA 2BV3A 3G86A 3FBEA 3N5FA 5HMXA 4NLRA 2KKHA 3W8PA 3HO1A 3PR5B 4WP8A 5KG7A 2ABYA 3MM7B 5ETOA 2UXBJ 3MFIA 3KHRA 3VVTA 2BR0A 4ED5A 2KYZA 4OZ0A 4LFAJ 4OI0A 1E6YA 4NLYA 1XWLA 5BJRA 5CD4A 2E29A 4IOCQ 3PFEA 4PWUA 2WVCA 5T14A 3FBCA 2J9DA 1NDCA 3NEKA 3SFGA 2VFVA 1DZ5A 1S6OA 3JQKA 1D9FA 2YWGA 1RWVB 2D9OA 4UW2A 3V6KA 4WK3A 3MMJA 4ZIWA 4IOAQ 4ZLNA 4X4TA 3M2VB 3M05A 1HNXJ 1L3KA 3OVAA 1YRXA 1VC6A 4M94A 3D0GE 4A8MP 2IDLA 2KRBA 3M9NB 3RB4A 3MR7A 3CMQA 2B9EA 2Q66A 2W9BA 2MQLA 4WFAQ 2ZH9A 1BE4A 4GKJJ 5IWAJ 1NSAA 2R7TA 2NREA 4Q2MA 3W63A 3UDLA 4DQRA 3FGVA 4JUZA 5F3ZA 5DM7Q 3KLHB 2XI2A 2X1FA 3PRBA 1Y7PA 4CDIA 3QYYA 3TR5A 2ZE2B 1IM4A 1G1XA 3DMJA 3U1MA 2DH8A 1SQFA 1U7LA 2HRUA 1WOPA 1QDUB 2ZBCA 2DR9A 1XQIA 3AY0A 1M1GA 2CADA 2ZNYA 3D3CJ 2UUCF 1YSJA 2VG5B 4ICLA 4OFZA 1ROFA 4O23A 4J90A 2HBQB 2KJWA 1HQUB 1K0VA 4LF5J 1FRIA 2DVIA 2COLA 4LF9F 1KRPA 2Y1LB 1QJHA 2UUAJ 3N0VA 2XMAA 2XHCA 2JWNA 1JLFB 2FUG9 2B7BB 2ZHOA 2FPHX 1XERA 1IKYA 3DLLQ 2B4VA 2ZJQQ 3ICLA 6FDRA 4JI3J 5L38A 4PCQA 2GO9A 2QL9B 1F3VA 2OEJA 1FWPA 2FJVA 1BQMB 2IAJB 4FS1A 1Y3KA 1R0BG 2H3EB 2FLLA 4DPOA 4OX6A 1N5VA 3IAS9 1CVJA 3A8KA 2ALYB 3HVWA 4JI5F 2CPIA 1JJHA 3DYAB 2DGVA 4OLPA 3PO5A 3AT1B 3VGSA 2E66A 4QPTA 1M0SA 2X3DA 5FD1A 1WEXA 4GO7X 3SSRA 4PWDB 3PW7A 1NZ8A 2EI5A 2LQ8A 1U4BA 5A8WA 2XMKA 2DR7A 2ZH5A 5CZXA 4NXMJ 1FVSA 1YBTA 1CJUB 4W90B 4B3MF 4NLPA 4LF8F 2NSCA 2CZ4A 5C2GA 4IO9Q 2GS8A 2IDEA 1KD1T 1TELA 1ITPA 2GIFA 3CO0P 2ZITA 4DPTA 3MMBA 2R8JA 2Z2LA 2Z0GA 4LQ9A 4NL5A 2CPZA 3I96A 2RUGA 3S01A 1DTQA 4A8KA 3H5UA 4PG7A 2NPIA 5K8MA 3M8PA 4UT4A 1GFWB 1ELOA 2R7VA 3I82A 2MKKA 1TL7B 4RW6A 4U9RA 4LVOP 2X1AA 1JLEA 4IFYA 1SJQA 3QGPA 3T19A 1UJ5A 2AEJA 2XNRA 2HWTA 3O2IA 1UEVA 3GONA 1MROB 2BM1A 2B4UA 1WSRA 2V5HG 1JLQA 3BPDA 4ED2A 2GVZA 3ENQA 4NEZA 2N3OA 4IR1A 1KLMB 2BE2A 4HI2A 1VS3A 2IRYA 5ETLA 1PILA 2DGSA 4I1TA 1HBOB 2R8GA 1PAEX 2OPSB 2VF3A 1JJ2R 3UD5A 5AJ3F 1I51B 3DLGA 3K89A 3AOAA 4OIXA 4YB6A 4O3QA 3MD3A 1T94A 1Y11A 3MR2A 2R42A 2AF6A 1WEYA 2IYIA 4I2QA 1M5PC 2MSTA 4EBCA 3SDEA 1S49A 2IVYA 4K5RA 1RP5A 5HVFA 3P4UB 1PIEA 3QT6A 3T5KA 1F5CA 3DGPB 4Y34A 4ZJOA 2I0XA 1HPZB 2OH2A 2IM1A 2OSRA 3KYLA 1FRLA 3QRRA 3ZC4A 5A8RB 5LT5A 4FYDA 3BN7A 5HI7A 2W9BB 3PG9A 2DCUB 2IYGA 4F25A 1RAOA 1NH8A 3A3NB 1BY9A 2NUHA 4IG0B 4X65J 3BJYA 1WF0A 3MWBA 1NHKL 5E3PA 3BQ2A 3BH7B 2XGPA 3F44A 4LRBA 4GVBB 3V6DA 4CO5A 4YP3A 2RDJA 5KT2A 3BKUA 2XWXA 2OKQA 2JEJA 3ZTQA 5E3QA 5RUBA 2UXCJ 2AYGA 3IBCB 4PPDA 5F8GA 2XMUA 2GX8A 1L3SA 3H42A 4DJBA 2BOPA 3OHAA 3VGTA 1EJ7L 1RWOB 2DR6A 5E41A 3UWTA 1NKEA 1E6VA 3L7OA 1QSSA 2VJVA 3NGUA 4YMEA 3TARA 5M2UA 2XYHB 1RCXB 3BYRA 2UVUA 2YWWA 4DR1J 4DV4F 5K14A 1S10A 5HLFB 1K1SA 4LF1A 1IBLJ 4Q0BA 5KFAA 1UMJA 2GMJA 1LFWA 2RJZA 1VIOA 2HNYB 3J7AN 2UZAA 4DPWA 2KFYA 5JVHQ 3PKYA 4RW9B 1VLYA 2QG9B 4ZVQB 3R5AA 1JXVA 2C3YA 1FX2A 1SV5A 2HFSA 2AJ1A 4QWEA 3I55S 4DF4A 3L9ZA 3D6FB 2HVHA 4RW7B 4CI0B 3FNNA 2OSQA 3GR0A 2Z2ZA 5I3QA 3ENWA 1S9FA 1LNQA 2OEMA 1Q0NA 1Y5LB 5ETTA 3M2UA 1JLCB 2HRYA 1SL0A 1YQHA 2JVRA 2J0QD 1KQKA 2VG6A 3D28A 5DGAA 3PACA 4OHXA 4IDKA 4QR2A 4WXWA 3ILJA 4JI4F 4P75A 1KKHA 5IC6B 2HBZB 2DITA 3TJ8A 4YN3B 2EFVA 2JC1A 2M8DB 1CQNA 2DK2A 3ZFVA 2VQFF 2QL7B 3BSNA 3BYPA 1TU0B 3GMGA 2K3KA 4DR2J 1RACB 2QZ8A 2O66A 4ZVSB 3MMBB 2VB6A 4J9VA 5KG4A 1JWWA 3IRXA 2WVEA 4OHZA 2HQDA 2PD1A 1HNWJ 1RCOB 2MLZA 1M5SA 1UEUA 4Z37A 1Q95G 3M8YA 4WTYA 2KTQA 1BQXA 3MUTP 1ZAVA 1FDNA 4O44A 4ZVFA 3BF4A 5KT3A 4RW6B 1FFGB 2ZD1A 1H7WA 5IQQA 4PYAA 1OS5A 3DU6A 5F8IA 5B0EA 1KNZA 4MAKA 4A8SA 2WVFA 3PYFA 2DT9A 4OMFG 1N34F 1F2HA 1N5TA 3ZNUA 1RKIA 4DX5A 1RZMA 5ITHA 3RTVA 1N0UA 3OT9A 2D1CA 3OTBA 1FNOA 5HROA 3BO4A 3KUGA 1SC3B 3KHGA 1KWMA 2GVDA 2J7UA 1YWXA 4M5GA 4QQBA 1TK8A 2HHPA 4UZBA 1S79A 4IRDA 4C3MA 4ILMA 3UI3A 3ITHA 3HD2A 2CNNB 3HP6A 3MEEA 3IA0A 3RRGA 4Y65A 4CH0S 2LECA 1GQEA 3C15A 4CO1A 1UKUA 4DS5A 2XLJA 4RW8B 4I6YA 3BGOP 4ALZA 5KTQA 4BS2A 3CDAA 4XAKA 1F5BA 2PN6A 2Y3YA 5HJXA 4HT5A 1HW8A 4GC6A 4HDHA 3SCIE 3CJ3A 9RUBA 5HVGA 1HYSA 3SQOP 1S97A 3J81U 4XO0A 3PX6A 2DRAA 4NXNJ 4MKYA 3MM8A 5GAGU 3DHXA 4OYBA 3TX8A 3ZZYA 1T05B 4TQRA 3HSJA 2Y0BB 4MIAA 3HM9A 3CMES 2MGZA 3TRGA 3MPDA 3FJ2A 4EMDA 3DXBA 2F63A 3M8QA 4ERDA 4R0EA 4WKYA 2XEXA 3DOLA 3GP9A 4HTJA 4OLOA 4ER8A 4NLGA 5D78A 4AL6A 1R8CA 2HPUA 3D3BJ 4I4BA 3TA2A 3MEGB 4YR2A 5IC4B 3MAAB 5D4NA 3HK2A 1IQTA 2OP5A 2OIHA 2W24A 3ZXWA 2BRKA 4ED1A 5M2PA 5K20B 5H9FJ 1FEEA 5LMUJ 4C97A 2OEKA 1F6TA 4DL2A 2AU0A 5F9NA 1T9TA 1KLNA 1CSJA 4CLKA 1G2EA 2FHJA 2DNGA 1FJGF 3IR6B 1LWEB 4X84A 3S8SA 4Z7CA 2GMLA 3TVYA 3I0SA 3MUMP 2OGUA 3PW4A 1PKUA 2J6SA 2YNIB 3N79A 4NLXA 4EGLA 1UAWA 3W9HA 4LFBF 2Y8YA 1CEZA 3N9UC 2Y9HA 1NZAA 1P1TA 2RF2B 4JI8F 3MF5A 1T3OA 1Y5NB 1N33F 2ERRA 2AGPA 4ZKAA 2MZQA 1XC9A 1NJWA 3IMQJ 4XPCA 5AE2A 3QZ7A 5CQGA 3THTA 2MJUA 3OFEA 4DR6F 2EFGA 2RS8A 2HVIA 5B0GA 3VZHA 3HVTA 3I5CA 5KFJA 3O44A 2OPQA 4DLEA 3G87A 1NNDA 4HYKA 2RQCA 1IUJA 3DOKB 4YFUA 4YQWA 4FKYA 4DSLA 1J2VA 4B9SA 3CPWR 2XS7A 1UVIA 2JHEA 2DNHA 3HJFA 4ED7A 1OO0B 4UUXA 2Y0SD 1RHJB 4M5JA 1WHWA 2G1HA 4DSEA 4ECQA 2W9CB 1FCAA 3DI6A 3T5HA 3CD5A 3ZO7A 2K06A 4YEAA 2A2CA 4TY8A 3NGKA 1U2RA 2IA6A 4QW8A 1ZTWA 1UP1A 3W62A 2ZM6J 5GMKa 1R7IA 4O3SA 2YQ0A 3PYGA 2E5LJ 4C98A 1UFWA 2P9CA 4X4SA 1GNKA 3Q8RB 3ZZUA 1RISA 2DPIA 3I9ZA 1IKVB 3FMWA 4EZ9A 3N5BA 2ZZNA 1VLOA 1DQ9A 3IP0A 3T3FA 3R9LA 3NNAA 3BQ0A 4DLGA 1FTRA 1RDRA 2DGUA 2OMOA 3PJ9A 1RAAB 3HHEA 2CQHA 2AYBA 1RK8A 2M7SA 5KFPA 2VHGA 3T1HJ 2XO6A 2QJ3A 2W1BA 3G9CA 3KOAA 1GTHA 2ZBPA 1X4BA 3TZXA 5LMNF 1X4EA 5F0WA 1CJVB 2QYGA 4P2FA 1R31A 2POKA 3GFZA 3MEEB 3GJQB 4XK8C 1Z2LA 2GZOA 1R27B 1JJ4A 1XR6A 1ICEB 2NUUG 1QSYA 3ISZA 1VOMA 2E9ZA 1RI7A 5LSLA 3OVSA 3P49B 3CJRA 4U7UD 2D69A 2XS5A 1S9EA 2IM0A 1JKHA 2C2DA 3E01A 4LSNA 1S1WB 2VDIA 5HMZA 1PC5A 4RZRA 2BANA 2NYHA 2W2QP 1FKPB 2UU9F 5GMDA 5B0DA 1ZM4A 3FQLA 4USIA 5IFMA 4QYZK 5LXYA 3UNGC 4QWBA 1HWJA 1RTDA 3P45B 3VGUA 3SCJE 2RRBA 1IKWA 3M8QB 3DKDA 3BKTA 1NXIA 3D67A 3TW0A 2FHKA 4N8OA 2PA3A 2QMXA 4QWAA 3UFCX 1RT4A 3AJ2A 4X4UA 3M4XA 2HIYA 1NKBA 1TTHB 3K17A 4M95A 3Q22A 3KLEA 1IR2A 3GFYA 1J5OA 1R8BA 3DLJA 3RAXA 3R5DA 4ZP6A 2MKCA 3MEDA 2QN6B 3IFEA 4PG4A 1RHQB 3L7PA 2OO4A 3NG8A 4C4WA 2B43A 2N7CA 4KO0A 4S0MA 4N8NA 4HHJA 2O01C 1WSVA 2QV6A 3WIUA 3KHLA 2PIIA 4F4KA 3GV5B 2DGOA 4YB7A 4ZP9A 3FMBA 2U1AA 2ALZA 1Q53A 4JYAF 1WACA 3RJMB 3ET6A 1ZH5A 2ZJRQ 1MWZA 5IV4A 3SQGA 3SV4A 2IMOA 1RU1A 4YDDB 3CULA 4QCLA 3TI0A 4LRCA 3BREA 2NXEA 3ZTSA 2KT3A 2DISA 4PG8A 3MECB 1AFIA 4YUDA 1NK7A 3WC2A 5ETMA 2QFJA 4B3MJ 2HZVA 2HRTA 1I3OB 3G8QA 3MI7X 4K4YA 2J8SA 3R8YA 3MPVA 3CDUA 2ZC3A 2V63A 1FT8A 2C2ZB 1FERA 4I6AA 2VBYA 3Q8SB 3UDEA 3M1VB 2KM8C 3KK2A 3GCXP 3JSMB 1IR1A 5ETRA 4FYVB 3WX8A 1URRA 3DHWC 3HLUA 2R2SA 1VRUB 2XZWA 4Y2MA 3OL8A 8RUCA 4ID5A 2YQ3A 2V0NA 2U2FA 3PZPA 1M1KT 1HD1A 4TY8B 3TUPA 1NK9A 4PR6A 1S9GA 1XK8A 3LQVA 4IKAA 3FSXA 5DQHA 1TV6A 3DU5A 2DNMA 1C1CA 5A76A 1GAOA 3MFHA 5DZ6A 5C24A 5FDLB 3TANA 3SSQA 1LK7A 4DL6A 1FESA 3RW6A 4RNOA 4E98A 2ZOGA 4BDPA 3DC2A 5EX3A 2ZVSA 2KHCA 3EGVA 1HW9A 2DGWA 1VHIA 2Z8QA 2ZUAA 1FA0A 5D0RA 4PQUB 4NLUA 2UVVA 4WZQA 5E33A 4ES3A 1SQEA 4E0DA 2GQQA 3SBMA 1X4GA 5C2CA 1X9WA 2HEKA 1U2CA 2ZH4A 1HNVA 2KVIA 2V2KA 2FC9A 4I0WA 4DQPA 4K4TA 4RO0A 5D0GA 3VR1A 4PWWA 3TJ9A 1NLKL 1HWKA 2RILA 2IRXA 2VBXA 1FXLA 2DXEA 2LFVA 3LO3A 2PC6A 2RB7A 1UVMA 1HNIB 2YWFA 4A47A 4MFBB 2IRUA 4R8UB 2MPUA 2CQ2A 2OPPA 1Q8KA 4CO2A 1WDDA 3CSKA 4KHRA 2NPFA 3W8GA 1WKJA 3H7HB 2RMLA 4FF4A 2OTLS 3E01B 3HHKA 5E5NA 3EXYA 3C6UB 5HQLA 5J1EA 3QJPA 2XG8A 3G96A 4P73A 3EVOA 3OFFA 1Q8LA 1S4EA 3MD1A 3LAMA 5C42A 3DLKB 4F0KA 5GADU 2VKZG 4C3LA 4DBQA 4HDGA 3T5JA 2EBEA 1JJCB 3IM9A 4CYUA 1VJQA 1RTIB 1HI1A 4ZPBA 1XNQF 1IM6A 1HWLA 1NMEB 4C0HA 1EIYB 2RT3A 4IH5A 1IWAA 2DD8S 4OV1A 4UF4A 4FS2A 3LH2S 3KJQB 2DTJA 2N4CA 1KTVA 1FKOA 3ISNC 5A0YB 4U8YA 5AXMA 1X0FA 1PJ5A 1J5OB 5MAOA 4NPOA 3QSIA 4ANDA 2AJQA 3EVWA 3HULA 1VIXA 1U1PA 4DG1B 3QRQA 2CVEA 1S1UA 3LPYA 3CCTA 2BKNA 4J9OA 3HX9A 2N7YA 5THWA 1CPZA 2FC8A 3OR2A 2B51A 4A4JA 2KH9A 3VQSA 3NS7B 2UXBF 3J80Y 2F9JA 4GMKA 1B0PA 2BACA 2M3DA 2CQDA 1MG7A 5C25B 3CE8A 1S6QA 1OSCA 3K8WA 4DR5J 4DR7J 4FXVA 1S76D 1ZS6A 2NCKL 1MMDA 3AD9C 1BQNA 3C19A 3SQGB 4WIIA 4JP8A 3MURP 1TAUA 1T11A 4CNYA 3A8EA 3LA0A 4LRDA 4B9NA 2P2CB 3MR6A 1UTAA 3EICA 4PABA 1N32F 1TL1B 3OSNA 3BBFA 5EWEA 3BGRA 1VBXA 3GIKA 4ZHRA 4C8MA 2H1YA 1O51A 2E9RX 3A13A 3MR5A 2AJFE 2VPYB 3E51A 1UA1A 5KFYA 2F8MA 2XNQA 2F8EX 4PZVA 1B0VA 2E7WA 1BWVA 4KY3A 1ZZFA 3Q8UA 4MYUA 3AODA 4GKJF 1HFEL 5IWAF 4Q44A 5KFIA 2I1RA 2BMBA 3JXOA 2IBKA 2DIVA 1DLOB 3KLVA 1W26A 3C14A 4AL7A 1FK9A 3KK1A 4QIEA 3UR3C 2FJBB 1VRQC 3AXMA 4A8YA 2EC0A 5E3RA 4F4AA 2OJ3A 1APSA 3M2RA 1U09A 4ATNA 5AXKA 4ID5B 1P27B 3AB4B 2WOMA 4M5IA 1RQ0A 1CBKA 5B08A 2JSXA 4IUFA 4K7QA 3EPGA 5CCMA 2J9CA 3EXCX 3KLIA 1C4AA 1B3TA 4WFZA 4V1Ak 1RWPB 3U1LA 4GO5X 1WI8A 2KZMA 1N34J 3W5YA 1B99A 4LF5F 2YNGA 4B3OB 2UUAF 1W7WA 3K57A 1GMWD 1Q81T 3DRRA 4G6VB 1NPKA 3Q8QB 3CJSA 3K5PA 2DNKA 2XMVA 4DCJB 3MZIA 1QVGR 1EKRA 2KU7A 3TAMA 2PFDA 4NYOA 2PMZD 4JI3F 3BBBA 3K0JA 1KFSA 4J9UE 1GTEA 2NR0A 1UWBA 5DRKA 4Y0FA 1HNVB 5DM6Q 2CXEA 2FVPA 4QIGA 2HVEA 4LSLA 3G8SA 3I4HX 3HSZA 1S0MA 4ZIVA 4DEZA 1PC4A 2YKOA 4WFNQ 3HHLA 1M5HA 2WSEC 1S5ZA 1Z4UA 3K2YA 4UOFA 4HKQA 2H5IB 4USJC 3LP1B 3GIMA 1D9AA 2V34A 2VPWB 5IQ6A 3IBFB 1HR0J 1AYEA 4WP3A 4DV0F 2UUTA 2CAJA 2I5JB 1RBOB 4ID8A 3Q24A 4NXMF 3KTQA 1S1XA 4AE5A 2BQUA 3MM6A 5IXUA 4ANEA 1TVRB 2Q43A 1WI6A 4KSEB 4DOZA 2LQ5A 1R3NA 2E1RA 1LWXA 1RT7B 3OLBA 1UWAA 2JOQA 2HKEA 1H72C 4L3KA 5J1EB 3RAMA 3US5A 4EBEA 4KPYA 2BKOA 1NSQA 3I5AA 1BD6A 1F9EB 4F02A 4USUA 2DIUA 1IWGA 2DNQA 2ACMA 3NGRA 1F5AA 2VG7A 4MIWA 5IT9Y 2XMMA 1FXRA
chains in the Genus database with same CATH topology
4URSA 2ZH7A 3NCQA 2B4UA 3IGNA 2M9KA 4WZMA 5JXSA 2V5HG 2JFDA 4JI6F 3NMAA 1JLQA 4JBCA 2M2BA 3PIPQ 4JI7F 1V3ZA 3HI9A 4NA2A 2XULA 1E6VB 4AYBD 2KDOA 4ED2A 1T03A 1BQMA 1WTBA 3ENQA 2N3OA 3PV8A 2XO7A 2FJWA 1KLMB 2IAJA 4IR1A 1EP4B 1QAJA 1NB7A 3VAHA 2BE2A 3B78A 4K59A 4HI2A 4NCAA 5KFTA 2KYXA 5KFUA 3OL9A 1VS3A 2IFXA 2LYVA 5F9LA 1RAJA 2IRYA 4HLBA 3QIPA 3CXCR 4FF2A 1PILA 5KFXA 2K3IA 1RGVA 1VMBA 2DGSA 3SCKE 5K14B 1TL3A 2F9DA 4RNFA 2XC9A 4CCHA 4I1TA 4DSIA 1HBOB 3DYAA 5J2QA 3P5TL 2R8GA 4Q0BB 3VAIA 2SXLA 2K7KA 4K2XA 5IT0A 4Q7AA 2OPSB 3CCUS 3KLGB 2KO1A 1JJ2R 1VQYA 5E3CA 3DM2B 5AJ3F 3N6MA 2F8HA 3AHPA 4YR3A 2ADBA 2BJDA 1QE1B 2VC1A 3W2VA 1JXEA 4PWDA 3DLGA 3GB0A 1S6QB 2GHPA 3JTOA 3I32A 2QA4S 1FRHA 2GNKA 1SV5B 3GG0A 2EFOA 1SH3A 3LP1A 4OIXA 5KFCA 1V3SA 2BJEA 4YB6A 4KFBB 4O3QA 4AFFA 2Q6CA 3MD3A 1T94A 4FP9A 2KXFA 3M6XA 3OL7A 3MR2A 3VALA 2AF6A 1WEYA 2IYIA 1VFJA 2LA4A 4I2QA 1M5PC 4X64F 3HHDA 5L1KA 4H54A 3CJ5A 4ZPDA 1K8AT 1DTTA 2MSTA 4EBCA 2XCPA 4RLEA 4LUBA 2I5JA 5KFGA 2D41A 3PFOA 3SDEA 1B7FA 4BC7A 3MR3A 4XDDA 2ZBIA 2WSCC 1RTJA 4KBIA 1S49A 3U02A 3GIJA 2IVYA 1IR0A 3M2UB 3M32A 3TYTA 1LW0B 2HFNA 4K5RA 2GGPA 1RP5A 5KFRA 2D3UA 4OI4A 1R0AB 2VPZB 4LIRA 2UVRA 3B8HA 1XBWA 2VBZA 4ES2A 2W7PA 3T5KA 2HAIA 1F5CA 1TVRA 4Y34A 4ED8A 1YGYA 2WB4A 3CIMA 5DG9A 4CO0A 2E5GA 2I0XA 2VG6B 1UFLA 3DN9A 1HPZB 4I69A 5CYQB 3ULHA 1SJ3P 1ZAWA 2IM1A 3S7RA 2OSRA 2OH2A 1FRLA 3KYLA 4IDKB 2MKIA 4IG3B 3ZC4A 3AA9A 2GQ2A 3W2WB 1VJWA 5A8RB 1RT7A 1Y0HA 4DQSA 5LT5A 1H7XA 3MAQA 4FYDA 3KWMA 1TKXB 4C7QA 3BN7A 3CEDA 5HI7A 3TA1A 3MDFA 2W9BB 3WZ0A 5L39A 4Y2KA 3NNCA 2Y1JA 3HHLC 2DCUB 2I2YA 2IYGA 4X4RA 1K9MT 3PKMA 4KGMA 4F25A 3HKWA 4EBDA 1NH8A 5A6PA 4DL4A 4DHVA 3GYXB 3TUZC 1BY9A 2P9EA 2XHWA 2NUHA 3RRKA 4IG0B 5KFQA 4TQSA 4ELTA 4BC9A 4K4VA 3BJYA 2VFUA 5I42B 1WF0A 4ELUA 2LLZA 3MWBA 5GAHI 2RDIA 2FLOA 3CJ2A 1Q7YT 3IXQA 1D8YA 3V6JA