1N32F

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n32F00
4DV0F 4YY3F 1IBMF 4JV5F 4JI2F 4DV4F 4X62F 2YY3A 4DR3F 4K0KF 3ZZPA 4NXNF 1B64A 4JI8F 4DV3F 4LF6F 1HNXF 5AJ3F 4DR7F 1IBKF 4YHHF 2KJVA 2UXBF 4AQYF 2ZM6F 1XNRF 1G1XA 2VQFF 2KJWA 1CQMA 1XMQF 4DR6F 1CQNA 4JI3F 4JI5F 5IWAF 1FJGF 4DV5F 2UUBF 2B7BB 4DR5F 2UXDF 4LF7F 4DR4F 1G7CB 4LF8F 1HR0F 3R3TA 1I94F 2E5LF 4DR1F 1VMBA 1J5EF 4X64F 3OTOF 4GKKF 1N34F 1N33F 2J5AA 1FKAF 2RJZA 2HHHF 4LFCF 4X65F 2F4VF 2BXJA 4LF9F 4B3MF 4LF5F 2BVZA 2UUAF 4DV6F 2UXCF 1XMOF 4DV2F 4B3RF 4JI4F 1F60B 1IJEB 4KHPF 4NXMF 4X66F 4B3TF 4JI1F 4JI7F 4DV7F 2VQEF 2UUCF 1HNWF 1LOUA 4JYAF 2UU9F 4DUZF 1GH8A 1IJFB 1RISA 1XNQF 1HNZF 1N36F 3T1YF 5LMUF 4LFBF 4JI6F 4OX9F 4DR2F 1N32F 4JI0F 1QJHA 4LFAF 4DV1F 5BR8F 4DUYF 3T1HF 4B3SF 2B7CB 1IBLF 5LMNF 4LF4F 4GKJF
chains in the Genus database with same CATH superfamily
3QBCA 3KHHA 2Y0SD 1QUPA 2VU5A 3MPUB 1JLQB 1PILA 1B7YB 2DNOA 1Q16B 3GG1A 5HMWA 2W2MP 3FKBA 4A8YA 5F8IA 4PUOB 2BE2A 4BLGA 5ETOA 3PG9A 1QLNA 5D0HA 4QOTA 3FCWA 4Q0BA 4MMOA 3IRXB 1VI7A 4JI8J 3NP5A 3ZZUA 2QT7A 2DR5A 4LSLB 1IKVA 2MQ8A 3TQEA 2XO6A 3R6LB 1TV6B 4JI5J 1FJGJ 2A0FB 3G82B 5A8WA 4DV6F 3J7ZT 3PJXA 3C16B 2WONB 5KT3A 3QWPA 2XS2A 4I2QB 3NNHA 1ZYQA 1OY8A 1GK8A 2CQ4A 3QGHA 4IH6A 2ZH4A 3HZGA 1FJCA 2OIHA 3MD1A 1FRJA 4ECZA 2ZWPA 4NA3A 2Z57B 3A4TA 2MQLA 2HHSA 3M9NB 2Y1JA 5HLFB 1IBLF 1KHVA 1CBKA 1J27A 3TW0A 1FFSB 3KJQB 2DGXA 4MTPA 2VBXA 3W62A 3DOLB 3M6XA 2JEFA 5E41A 1Y10A 5RUBA 1FRLA 3NRBA 2OTJS 3UNGC 4DG1B 2XLJA 2JC0A 2FZCB 4X4UA 3IRXA 4WP9A 5D0RA 3VAIA 4LSLA 5KFJA 2W8KA 4FBTA 3JQJA 4IOAQ 1CPZA 1F60B 1HBNB 4WK3A 4Y00A 4LRDA 1X4FA 2COLA 4AL5A 4NLSA 3C16A 2HZAA 1H73A 4YDXA 4U6PA 4KO0B 2CA9A 1WC1A 2CJQA 1JJHA 1JLCB 1XWLA 5KG3A 3NAIA 3UR3C 5DO2A 2E1PA 3HVAA 2ZDPA 3SQOP 3RB0A 2MTLA 2LQJA 3PHTA 5HLFA 1WI6A 2CJBA 2B6AA 4TKTA 4B02A 3ILLA 1XIQA 1UTAA 3UD3P 2DITA 3QRQA 3IXQA 1P1LA 1KVIA 2ZJPQ 3OSNA 3DOLA 2Y8WA 4Q44A 1EQ0A 3WBZA 5KFXA 3UR0A 2VA2A 2ZD1B 1PCAA 3D6FB 4DG1A 1Y11A 2IVFB 4OYIA 4L6V3 5KT7A 1WG5A 3C6UB 2RDDA 4CO0A 4ATNA 3VCDA 3T5HA 4QIWD 1LWFB 3BF4A 2E7VA 2F3JA 3NGRA 1DFDA 4OHYA 3CJKA 2KRBA 3MEEB 1X8DA 2V8VA 3OR2A 2E9TA 4X4PA 3RR7A 1ZAWA 1XNQF 1A6LA 5EWFA 4EYHB 1XQIA 4NYOA 4P9SA 1TELA 3CNQP 3KJVA 2WVEA 4NLRA 2MY8A 1IKYA 2B4UA 3R7SB 2LQ9A 4DR3F 2DNRA 1X9MA 2LXFA 4PEOA 5T14A 3MOZA 4RW8A 2XHCA 3T1AA 1D8ZA 1WDTA 2UXBF 2F63A 3TUPA 4ZPVR 2JVOA 2PC6A 2WSCC 1GMWA 4H4OA 4D3HA 3I56S 2F1FA 5HBMA 4FZVA 2OHDA 4CP5A 3EZ5A 3R5JB 1RU1A 4ED8A 4MYUA 2DNHA 1X4AA 2E5LF 5KFSA 1XTZA 1RT3A 3J81U 2EVZA 3JTPA 1U45A 5DQIA 5I3UB 4FF1A 3CDUA 3PW5A 1U1RA 2RUGA 1H72C 1LWFA 4ECSA 2XYPB 3K58A 1LOUA 1TUWA 2NSCA 2BOAA 3OFGA 1GXTA 4WIQA 2GJFA 1QTMA 1S1XB 4DI6A 3A8EA 2O66A 5F9LA 2L9NA 1RP5A 2VG7B 2K7KA 3ILOA 2E1CA 1RK8A 4YUDA 1ZA2B 2KG1A 5F41A 1O8BA 2XWXA 4KR0B 5D0GA 4H54A 2R7XA 3Q83A 2V0NA 1OIAA 4ZPAA 3NAHA 4F4AA 2H4WB 1HW9A 2VD3A 1N48A 3WIVA 2ZBPA 3R5AA 1T9WA 4RZRA 2UVUA 1PYTA 1TK0A 1GAOA 3CD7A 5IZHA 3DYAB 3K5PA 3R5BA 4EBCA 3IS9A 4QIGA 4R0EA 3D66A 2XCAA 1UWAA 1DTTB 3LPEA 1D1UA 3U1NA 3LP1B 2FGCA 1MMDA 3F0NA 1PG5B 4IO1A 4ZJLA 4Y28C 2W1BA 4X4NA 5I3UA 2P2CB 4FVMA 1YVFA 5KT4A 3ICLA 3BBCA 4P73A 3MAHA 1UEVA 5KFQA 4LFCJ 3QIDA 4HEA9 2EEYA 4X84A 3QJLA 1TL3B 1CLFA 5BR8F 2ZBIA 2K8GA 4PWUA 1S1XA 3NXZA 2B7CB 5KFAA 1F9EB 1EX8A 3U02A 3AQOA 1E6VB 4FP9A 3VGTA 1HNVB 4B08A 5GAEI 3MZIA 2AJ0A 1U2RA 4K5RA 3D67A 2JFDA 1PSDA 2QC3A 5DZ6A 1HHQA 3W64A 4IG0B 3ISZA 4P75A 2LECA 3ELHA 1Z2LA 1B0TA 1M1KT 3ULHA 4O0NA 3B8HA 2QFJA 2HURA 1X4DA 2GGPB 2LU2A 4JV2A 2MSTA 5DETA 1LNQA 3UN3A 1RWOB 2BE9B 1XMBA 4FXVA 1SIWB 2DH9A 1RWPB 3H90A 3CD5A 2M4MA 2RMLA 5LL6d 3H2LA 4F2RA 1DTTA 3CDEA 3K2YA 3G6VA 1YRUA 3LP1A 1SQEA 1RWMB 3KLVA 4WYWA 1IJFB 3T5JA 2W7OA 4QR0A 1X60A 2KXHA 4AYBD 3QFWA 1NDLA 4B3MJ 1FWLA 4WU2A 2HBZB 2VJUA 5L46A 5D3GB 1DQ9A 1TL3A 2V4JB 1UP1A 3VF0B 2XLIA 4B3OB 4WE1B 2CYYA 2DVIA 2V63A 1SBRA 4KKOB 1RWXB 1HNVA 2XTJP 1OYEA 3QT5A 4UUXA 3HCXA 1REVA 5KOXA 3MEGB 3CIZA 1IUJA 1FF2A 4IG0A 5G0RB 2MEWA 3Q8UA 3G86A 2B4VA 3PX4A 1RCOB 2M2BA 2F8HA 2NQPA 3LANA 2YWFA 3JAMU 1MW7A 2X3DA 2GGPA 3NMAA 1B70B 2U1AA 3CTRA 2VHGA 1NLKL 4HTJA 2B4OA 5KFOA 2MLYA 2AX1A 1SXLA 3WX8A 3BSCA 2IJNA 1KWMA 2J9DA 2W4DA 1FRKA 1GMVA 1T9VA 3DLJA 5LJ5Y 4L73A 1SUQB 4OJHA 4TU9A 4ES1A 2KTQA 2VOPA 5H9FJ 4ZCIA 1LW2B 4F7VA 1VGYA 4GC6A 1H98A 1RTZA 1L3SA 2OPPA 5DRKA 1WD6A 3TVYA 4UZBA 3CPWR 1U1QA 1KHWA 2YKQA 2VKZG 3FC9A 4TN2A 2MZQA 3P5TL 4B3OA 5CYQB 2JHEA 3FBCA 5DDPC 1U6FA 2D9OA 3E01A 3DLGA 4NCBA 4KKOA 2M70A 2Y0BB 1RZMA 5IWAF 2L41A 1MMLA 5L1KA 3O1LA 4OYOA 3TJ8A 1WACA 1GMUA 2RE1A 3BEGB 4LBPA 4X4QA 5J2NA 5AXMA 4NYZA 1SKWA 2BW2A 3KLFB 1AW0A 5G0RA 4DCJB 2ZH5A 5KFBA 4MFBB 2HWHA 3N6LA 3CXCR 3I4PA 4UY85 4JI3J 2LQ8A 4ZP8A 3ZO7A 3IAS9 5H1SV 2IC3B 4PXEA 3L9ZA 2XCPA 5LSRA 3MFIA 3W5YA 4MIWA 1MN7A 2V68A 3QT7A 4XDDA 2I6WA 4I2PB 1S12A 2OTLS 1SUQA 1Q95G 4FYWB 4RR5A 2MQOA 1XMOJ 1JMTA 1KP6A 4ED1A 3MXHP 5JJBA 1HHSA 1X4BA 1JX4A 4DQQA 2DY1A 4A8KA 4I64A 1HBMA 2KRRA 2FQQB 4OHVA 1U49A 4DUYJ 1R6VA 2DHGA 4WFXA 3V4MA 2AGPA 2W4PA 4DX6A 3Q8PB 3DRXA 4LBHA 2V9WA 5DJBA 1U1NA 2V2QA 2QLFB 2IY5B 1B0VA 2F9DA 1IR1A 1RAOA 2MZSA 3J81Y 1NCLA 1RWVB 1ZPVA 3DRSB 3PY8A 4F26A 1X5PA 2MKHA 2E1MC 5HMXA 4KIAA 3KLFA 5H9EK 2WK4A 1YJ9S 3DXBA 4Q45A 1Q81T 2DHXA 1HHTP 3K5OA 2VPZB 1VQ6S 4C97A 5GAEU 2Y9HA 3EICA 4I6YA 3CCZA 2Z56B 3RW7A 1N32F 4ECTA 4ZPDA 3CCMS 4M5JA 2UUAJ 2DJWA 2ZHAA 4EO8A 4I2PA 3ZXWA 2HRUA 5DDRC 3EXCX 4QBUA 1DJ0A 2LMIA 1K47A 2QYCA 2DGUA 2CNKB 3T6BA 4WFNQ 2FGOA 3L7OA 3CC4S 2N7CA 3OLBA 1S49A 1W25A 2UZAA 3RUBL 4K50A 4AL7A 1S5ZA 2FY1A 3ZZ0A 4DR6F 2WAQD 4NCGA 1GTEA 2HS0A 4NEYA 2LVWA 4OYPA 1NH7A 1NJIT 1IWAA 2R4FA 2BE7D 1SQGA 4PRFA 2HHXA 4RW9A 1W26A 1RTIB 3DOKB 4OJGA 3LF0A 1YQHA 1RDRA 2IM0A 3KTQA 2C2ZB 2RKIA 7AT1B 4O23A 4CLSA 4S0MA 5HAOA 3QRPA 3M8YA 3B4MA 1RCXB 2HNYB 1LFPA 1S9GA 3U7JA 1DZ5A 4C6AA 3UPFA 3UCUP 4ZLJA 1Q53A 2SXLA 3EGWB 1JXLA 3T1HF 1OY6A 4GC7A 4JI4J 2CG4A 1RHQB 2CXEA 2HHQA 2HS4A 4DV4F 4H4MB 3PW2A 1V5VA 1E6YB 3RYLA 4LFBJ 3PRVA 4YHHF 4RW7B 3CC7S 3HHLD 4RW4B 3BO3A 1UVNA 3EGZA 1PBUA 2FZKB 4LR9A 1IKWB 4OZJA 1NSAA 2KHDA 1BD6A 5F9NA 1NZAA 4DFJA 2DISA 1S6QA 2EC0A 3TWZA 4EGLA 3AD8C 4DL0C 1WKLA 5ETMA 4DL2A 5L9NA 3VR1A 1RTIA 3W2WB 2UUBJ 3TANA 4DR4J 1S1WA 1U8SA 5KFNA 3KK2B 1WWHA 4IFYB 4Z37A 4AFFA 1SIZA 4DV7F 1SL1A 2HNYA 1NPRA 2WOMB 4J9UE 3L4BC 1QVFR 3DM2A 4N8NA 4F4KA 4JI0F 1RWNB 2BM1A 2HQDA 4IQMA 2UXCJ 1P27B 2K2PA 1PYOB 2RU9A 4BDPA 1WTFA 3SCJE 1HNWJ 1AYEA 3H42A 2EPIA 2AJ4A 2RSQA 5IC4B 2BJ3A 3G4SS 2C2OB 4C9DA 4RW7A 3UN2A 3JAMY 3HFVA 4RW4A 3TZXA 4RUCA 2OPRB 3IR5B 3QAEA 4NXNJ 5F8LA 4CLPA 5IQQA 3TARA 4WTOB 2KM8B 4ZVQB 3PDNA 2VZ9A 1LKZA 4YB1P 2NPIA 2HHHF 4IQXA 3HSGA 1GXLA 4LF5F 4FS1A 1RHUB 3GPAA 4HHUA 5KFZA 5EDWA 1VQPS 4MK7A 1NBEB 2L48A 2DPJA 1JLAA 2YPYA 2UVWA 4ICLB 5SUHA 3KK2A 1FVQA 4PZVA 5HP1A 4NLOA 2HLUA 2XMWA 1H7WA 2YKAA 1NDPA 3N01A 5CQGA 1LW0B 4ECVA 3LWMA 4KPYA 1WC3A 2CDQA 2Y1RI 2MKSA 4LSZB 1S99A 2MMYA 1T95A 2UU9J 2BKNA 1B64A 1JNRB 3EYZA 1RT4B 1L3TA 3MF5A 4BC9A 3ET6B 4R5PB 1WG4A 3O44A 3AXMA 2ZKTA 2BV3A 1Q7LB 1FDAA 1S79A 3H8YA 3J7AN 3I32A 5HN0A 3MMJA 3FMWA 3PYGA 5AXLA 3MI7X 2ASJA 1V5IB 4UQGA 3MWBA 2RHQB 5ETRA 1OY9A 2BBEA 2OPRA 3H2VE 3M1VB 2ZM6J 2OJ3A 1UAWA 1MSWD 1S1UA 1H2VZ 1TVRA 3PYFA 5EUHA 4Y2KA 2ZC3A 4E0DA 3CDBA 4QYZJ 2FJXA 1KN6A 3UDLA 3HJFA 2UUCF 1SCJB 4DZDA 3Q2SC 1J5EJ 3Q8QB 1RBOB 2HKEA 1RQ0A 2G2YA 5K8PA 5KFWA 1NRKA 1FT8A 1TK5A 3G6ES 4ELUA 2B8QA 3RR8A 4K4XA 3G71S 3LP0B 2A1BA 3B82A 4HT5A 4MH8A 4F4ZA 3JQMA 4NRUA 2OAUA 2C2MB 3BN4A 1XNRF 1F1BB 1R8AA 2MXYA 2KJWA 2CDRB 3ET6A 3GONA 2ZFHA 2CQGA 4IRDA 4CLYA 2KL8A 1RYRA 4ZHRA 4WKRA 2KZZA 3OTOF 2EC2A 3M1VA 4DL6A 1KLMB 3W5ZA 1VK8A 4J9KA 4PABA 2KVIA 5B0CA 4OMFG 1SC4B 1JIHA 1UKUA 3IFEA 2E5IA 4ED0A 3D7SB 3QGGA 2QFIA 4N56A 3FFIB 1OSCA 2YX7A 1ZM9A 1RTHB 2YWWA 2X1GA 4DQRA 3EVMA 4KYZA 4KTQA 5K8MA 1K0VA 3JSBA 3ILIA 3ETOA 4DPTA 1HD1A 2P9EA 4JI2F 3MMAB 4ZPTR 1YRXA 5F3ZA 3B78A 1DQ8A 2M8HA 1LK7A 1NJWA 3LP0A 1HNIB 2D3OR 4RNHA 4Q5VA 3OFEA 2QSWA 2XY7A 3HJVA 2CJKA 1S0NA 2GHWA 5J2PB 1XMQF 3KXDA 3N0VA 4NX9A 4CT8A 4FBUA 1Z1ZA 5L1IA 5FLXU 4LF7F 3MM6B 3CSKA 4ZLLA 1X5SA 3RG6A 2F5GA 2BR0A 4QIEA 1B7FA 3H25A 2KDOA 2R7RA 3RJMB 2DXFA 5CHCB 2F65A 4ED7A 3H5YA 5JMNA 2U2FA 3D54A 4J9SA 2RDJA 3BYRA 1CVJA 1FI4A 1B99A 4LIWA 4KSEB 3TZWA 2QL7B 1VQ8S 3FDSA 4ZA1A 4G1PA 4CO1A 7FD1A 1AZSA 1NK5A 5F8NA 8ATCB 1WG1A 1EARA 3PKMA 4HHHA 1BY9A 1Q4RA 5HANA 1YK9A 3LAMA 3W9IA 2LQ5A 3OTBA 1F5AA 5C2CA 1DQAA 3W63A 5I42B 3MR5A 1UW9A 4RKUC 4LFAF 1RTHA 3C8YA 1RAJA 3T9NA 4B3SF 1Q0NA 1YJRA 1HPZB 3M2RB 5C42A 2AT1B 1F5CA 2KU7A 1SJ1A 1RKIA 2B51A 2YWEA 4ILRA 4W98A 4ZVRB 3MMAA 2XHWA 4KH1B 8AT1B 2GQQA 3LH2S 5HMYA 5GAGI 3JSMA 1I3OB 2IRUA 2ADCA 5AE3A 1BHNA 2R7TA 4KY3A 2HEKA 1WDDA 2QMXA 4I68A 3MM6A 3G9CA 5KAKA 1CJTB 2VFSA 1EIYB 6FDRA 2HAIA 2G0CA 1QVGR 5CZXA 1QAIA 4X4VA 1RGVA 2CFXA 4PG7A 1IXKA 2HQGA 4HI1A 2ZOGA 2XULA 4ZCMA 3BN7A 3NWGA 4IH7A 2NZCA 3A1YG 1ZAXA 4CO4A 4Z7CA 3G96A 3DLKB 1Y3KA 2XMVA 4TQSA 1IBMF 2R7WA 3ZZPA 4DV3F 1HPZA 3M2RA 3LGMA 2KHCA 3DDIA 4OQJA 3GJTB 2MZTA 1D9DA 2GIFA 1VQ4S 3MPVA 4OX8A 4YEAA 1W2BR 2YKMB 1RA7A 4RJVA 7FDRA 4A8FA 2AGQA 2HWTA 4XPEA 3RTVA 1CJTA 4ZVHA 3X3UA 3DI6A 3HHEA 1T05B 2CQIA 4MKVA 1EAYC 1HMVB 5CZVA 4QIFA 4RNMA 3JQKA 1QD1A 1YWXA 1YJWS 1U26A 4JYAF 4DS5A 3W60A 2FC8A 4IH5A 1TKZB 4ZVGA 1T7PA 2D1CA 4RUAA 3EZUA 5D4NA 2VA3A 4BHQA 5A8RB 2IVYA 2F4VJ 3MTKA 3MR3A 4G6VB 2K3IA 1FRXA 5JXSA 2ZZNA 3M8QA 2X7IA 2NSBA 2V94A 5J1NA 4ZOSA 4LF4F 3F56A 2J7UA 3DLKA 2ROGA 4DDFA 4C7QA 1DBDA 4ID5B 3OTEA 4PAAA 5DZ7A 4PYDA 2VJVA 1QSLA 4ZVEA 1H7XA 2WBRA 2FPHX 2IYGA 1ZH5A 4FXWA 3EVWA 2CPYA 1X4HA 4Z7YA 5KFCA 4FKXA 1HQUA 1TL1B 4V19X 3CJRA 3E2EA 4NOHA 4M94A 5J2MB 2R7SA 3DNCA 2BX6A 4C11A 3K8WA 2FJEB 2H3EB 9ATCB 1KC8T 3PR5B 3N6NA 1FVSA 1U8WA 4ECQA 5E5NA 4AXIA 4K7QA 5LJ3Y 3GP9A 1VIXA 2B9WA 4CLTA 2ZBRA 3I0RB 2HBRB 2WCXA 3PEHA 3UDVA 3CIMA 1S48A 2FHOB 4FS2A 1QAYA 3EGVA 1TKZA 1URNA 5HROB 3R2CJ 4ZKAA 2O01C 1ULRA 2PGCA 2K7JA 3M8ZA 5HQLA 5KFMA 3U1MA 5DS7A 4A8QA 1UVIA 4UY8T 5KTQA 4C4WA 4DQIA 1HBUA 3BGUA 3MEKA 1RT5B 2V2VA 1J5OA 2YNFB 3I0SB 1VR6A 2HSEB 4H4KA 2CQ3A 3W2VB 3GFHA 2W2NP 2LEAA 4C3MA 4UUWA 1M90T 5D0EA 4FKYA 1N0VC 3UQSA 3D9BA 3MUMP 1LQ9A 4A8OA 1T03B 1K8AT 4KQZA 3IR7B 1VRTB 4G1QA 1A0OB 4PWWA 1WUUA 4CQ1A 4EMDA 3PZPA 2RIJA 3UN5A 1RAEB 1FERA 2OEKA 4JI7F 5AE2A 3HD2A 1KBRA 8RUCA 3NCPA 4O44B 4F02A 2C2NA 1DRZA 5GAGU 4F3OA 3H5UA 3PCOB 2GX8A 2VFTA 1RKJA 3TAMB 3QLHB 3A3NB 5GADI 1S57A 5I4MA 1CULA 4GMKA 5LMNF 5HROA 2XY6A 3SCKE 2MKJA 2G9OA 1YGYA 4ELVA 3WC2A 4C8KA 3CCSS 3T1YJ 1MWYA 5FLXY 2GS8A 2PE8A 2R2TA 1NM2A 2FUG9 2M3DA 3D3CJ 3IG1B 4ZJQA 1S4EA 3W2VA 2XS5A 3RRGA 3PJWA 3TI0A 2VG5A 3K5MA 4QWBA 3MEDB 4GVBB 3I5BA 2C3UA 3R5GA 3PW7A 3M6UA 4WYLA 3PW4A 1U0HB 4QR1A 3MDFA 5KT5A 3VAMA 2GO8A 4AT1B 2NXJA 1VYAA 3T3FA 1VISA 3NLCA 4PR6A 1F9HA 2LYVA 3DGVA 5H9FK 2FJWA 3LOUA 2E9ZA 3GYNA 3AFGA 4O44A 2ZE2B 4ETXA 1JXEA 2AP6A 2ZBCA 3A3OB 1G3OA 2H48B 3TAMA 3QLHA 3G8SA 4K8RA 3M6WA 4DUZJ 4HTIA 1QAJA 2M0GB 4P6QA 1WF2A 3VV2B 2HHTA 3QGIA 2A18A 2AYEA 1T9UA 4B9NA 2GZOA 3CO0P 3ZTRA 1OPZA 3B4DA 4NLGA 4CTAB 3QO9B 2HZVA 5HVHA 2HGNA 3IBFB 1MWQA 2VASA 3IG1A 1M5SA 3UFCX 3N4WA 1EETA 3PW0A 1SB6A 4K2XA 4C8ZA 1KQKA 2MKKA 3KLHB 4M5DB 2KZMA 3MEDA 4X65F 4GVBA 4J9PA 4X4OA 1VC0A 3OL8A 4Y6IA 4IO9Q 2XO7A 2MQMA 3TR5A 3TYTA 1HR0J 4X66F 3ENWA 3NBPA 3FSXA 4FF4A 5AT1B 3PVXA 1SH3A 1HWUA 3NOCA 4ZP6A 2H65B 2MQQA 2HRTA 4I6WA 3M2UA 3H5XA 4K4TA 5CD4A 3MM5B 4EBDA 4RU2A 3EZOA 3P45B 3VGUA 1O5JA 2DH7A 1PIEA 2WTFA 4DV1J 3B6BA 3LPYA 1VBKA 2DIVA 3DGPA 2YQ3A 3OPKA 4CLFA 4CTAA 1TL5A 4ZPCA 2MPUA 2VPXB 4OZ2A 3DC2A 2I5JA 2ALZA 4NLDA 1NHVA 4AUKA 4Q43A 2VUGA 3BGRB 1FD8A 4J91A 3KLHA 2M5YA 5LSOA 3WIUA 3HHLB 4PYAA 2QL5B 1TK8A 2XMKA 4USMA 3MR7A 2UUTA 5B0DA 1NDKA 3NL0A 5F0UA 5B0GA 1CJUB 4KAIA 4A48A 1EP4B 2KT2A 3BKTA 3IC1A 2IHR1 4J9MA 2JRSA 1Y7PA 2YNIB 2ERRA 2DXDA 3F44A 4B3RJ 3NGUA 1H6KX 4PKDB 5MAOA 2C28A 2A6MA 5K9FA 1AT1B 1C0UA 1DHMA 4KGMA 4JI6J 3I4HX 3ZZYA 2G0IA 4CLKA 4WFBQ 2CJXB 2IM1A 3KK3A 4USKA 4C8YA 3TJAA 4KGVB 4DV5F 5U47A 2XSFA 3PTWA 2EK1A 1UPPA 1BQMA 2Q1LA 4P2MA 3RB6A 4YB6A 4Z2XA 3RW6A 2B5JB 2FDNA 4PXDA 4QWCA 2DD8S 1RLCL 2BA9A 1FTRA 1FRHA 4CO2A 4EZ9A 3FBFA 3M8PB 2UXDJ 2NYIA 4Y65A 3BGRA 3AY0A 3BBFA 1LWEA 5KG4A 3H20A 4DR1J 2CAJA 4W90B 4LSNB 5IQ6A 4CYUA 1CJUA 1V9OA 1XK8A 2WSEC 2PA8D 4DV2J 3WX4A 3GIIA 4NXMJ 2KH9A 2YY3A 2HGMA 4WK1A 2HFSA 4OX9J 2UP1A 1OYDA 3VTIA 5M2UA 5IXUA 2YNGB 4CT9A 1LWXA 3NNAA 4GKJJ 1FWKA 5C2GA 4JV5J 1UMJA 3PHEA 5D6GA 1QM9A 4IRKA 2RHSB 3THVA 4QQBA 3FBBA 2IM2A 1WEXA 3HM9A 2KM8C 2FHJD 5A6PA 2B5JA 2VFRA 3DOMB 5CABA 2CZ9A 5J2QA 2HK3A 3KLGB 2RD5C 3OSPA 1SKSA 4DS4A 1N5TA 4P7TA 3MCSA 2JNJA 4RW6A 2DNNA 1RADB 2MJNA 2VG6B 1N36F 3BO4A 3AOCA 1RLDA 1ACMB 2MHNA 1MU2B 3MURP 4LSNA 3JSRA 1I1GA 1ZTTA 3CE8A 1DTQB 2ZHOA 1AUSL 5KFYA 1R8PA 1SH0A 2KO1A 3A8JA 4DLEA 3HT3A 4YR2A 4JBCA 3MPDA 4N77A 1NO8A 2DH8A 3MAAA 2ZHBA 2BM0A 3DLEB 2YNGA 3TA0A 1NXIA 4U95A 1FTCA 4O3QA 3LA0A 4RBTA 3M9MB 3G6YA 1X7VA 5E0OA 4ENOA 1NK9A 1GT8A 1RHJB 5C24B 1UWBA 3BR8A 4NASA 2RB7A 5IM0B 5A2QU 2XWYA 1QY7A 1SVDA 3S01A 4DSJA 3C3LA 3KLGA 4A46A 2MGZA 4X64J 4GKKJ 2DR7A 2XMMA 3EPIA 1HNZF 4U96A 4HKQA 3F41A 4NLYA 2VG6A 2GA7A 2GMHA 3N79A 5D8HB 3MPWA 4PXCA 1SV5A 4OZ3A 4EBEA 2ATLA 3UE2A 1MLAA 2QLJB 2WVCA 1Z4UA 4L74A 3LGNA 1MU2A 1WELA 2IPOB 2C1EB 4YY3F 2D9PA 1Q7YT 3ZNJ1 2CQBA 4OZLA 3TAQA 2CNLB 4C8NA 1NJXA 4ZP9A 3I5AA 1K44A 4CH7A 2ATCB 2DEIA 2IM3A 1U0SA 2P9GA 3IO1A 5L1JA 2JFKA 4HL9A 4J7CA 4AL6A 4DN0A 3RBDA 1NPKA 3GB0A 2BJ7A 2RU3A 4P71A 1R43A 3QATA 5KT2A 2KYXA 3L95X 4QYZK 3IP0A 2UV8G 4EYIB 4F4YA 1IQZA 4ZN1A 5C24A 2IJRA 4C48A 3SYZA 1UJ6A 3CJQA 2DO4A 1JKHB 2RRNA 2WVBA 3TO8A 2GJIA 3OHAA 4B9TA 4DV6J 2RVJA 1G4CA 1SJ3P 1RHKB 3HDSA 1ROFA 2DNGA 1S4FA 3UNYA 2OMLA 2ZITA 3SFGA 1HARA 1HYSA 4L72B 1NSKL 4WZMA 3UO0A 4ER8A 1IBLJ 3AB2B 1IWGA 1VC6A 4DR5F 3IWNC 1T9YA 1U48A 3PKYA 1C4AA 3UI3A 1N88A 2CUYA 1REGX 1S1TA 1M1HA 1RT6B 2BQ3A 1F3FA 1SJRA 1OWXA 2J6TA 5EGYA 2CQCA 2XNRA 2DNPA 2PSZA 4RBVA 3US5A 2AQ4A 5D78A 2G2OA 3FSIA 3IBCB 2VL1A 5LMUF 4QWDA 3D68A 2RS2A 1HA1A 3PRDA 3QJJA 2FJAB 1T11A 1TQLA 4DOZA 2Z58B 1N6QA 5E3AA 3RAQA 1EB0A 2Q3PA 1I6JA 3UD5A 4P2XA 3KHRA 4ELTA 4XTTA 5ETLA 5KFHA 3SIPB 2HWIA 2LA4A 5KG2A 1RHMB 4UZCA 2ALYB 1NPPA 3ISND 4M8LA 4DX5A 3V81B 2JWNA 1CQNA 3DRRB 1U6ZA 3GTYX 3HFZB 2YKNB 4QJVA 1RT7B 4KFBB 1S9EB 2R7QA 1I94F 3TVZA 1ZZNA 1LXNA 3KK1A 3AB4B 2KI2A 3DDKA 4O4GA 4LR7A 1W2IA 5HL7Q 2HNDB 4ZJOA 3AJ2A 1FHTA 2ASLA 4LF9F 4ANCA 2YH1A 3ZC4A 3BR9A 4U7UD 4YQWA 1VQNS 1HWKA 1FE4A 1YTYA 4V19J 3MHYA 5JUMA 2ZVSA 3KJNB 1UVKA 3GSDA 3OD2A 3R9LA 4P52A 1WTBA 4J9OA 3G2XA 3GIKA 5B0AA 1GMWD 1JLQA 3P4UB 1FXRA 4CO3A 1Q8KA 3H98A 2ZDOA 4PUOA 1UVJA 4DBQA 3BGFA 3GV8B 4W92B 4KPCA 1XNQJ 5A0YB 4I7FB 1MMNA 4MK8A 4YR0A 2JLFA 3CCVS 4J5OA 1CS4B 4QWAA 1O6XA 2KYZA 2J6UA 4FYVB 3EVOA 1K1SA 1CJKB 4Y34A 3V4IB 3V81A 2C42A 4DR3J 1HW8A 3JSYA 3DRRA 5DQHA 3PACA 1TV6A 3MM7B 3G82A 2BKOA 5DM6Q 5DGAA 2UXBJ 3BV8A 3BPDA 1PC4A 3QIPB 4KFBA 1RI7A 1VQYA 3OL6A 3NGKA 1N34F 4ECRA 2EK6A 2WONA 4I2QA 3J7A1 2XEXA 3TQ1A 1HLWA 1KFDA 4URQU 2HNDA 1RBLA 2GMLA 5DDOC 4ZDNA 3CDAA 2VODA 1FFGB 4JI1F 3Q22A 2E5LJ 3UVJB 4ETZA 1OSDA 5A76A 2GJ2A 3T5KA 1AFJA 5L39A 2ROEA 4OYWA 1T9TA 2KVQE 4PPDA 1RWWB 4F50A 1FDBA 5T7LB 4DPOA 4RNNA 4F2SA 2W8LA 1HNXF 2CPEA 2FVQA 2MYFA 3QNWB 4YMEA 3AJ1A 3LGHA 1U4BA 4H4KC 4KRWA 4I7FA 4IUFA 3CVKA 3OXFA 1Y00A 1CS4A 1VRUB 2M7SA 5FD1A 2AX0A 1C1BB 1CJKA 2ZBQA 4NYPA 2WHOA 3V4IA 3H5SA 3RB4A 1HWLA 2DBBA 4OI2A 1XERA 5A2QY 1HBNA 2LKZA 2D69A 1WHXA 4J90A 2CZ4A 4HDGA 3HKZD 4KHPF 2DCUB 4KO0A 3HSZA 1YJVA 4HYKA 2VC1A 1JXVA 1R8HA 3D0HE 1JLCA 2RQ4A 4DPXA 3EWGA 2NLWA 3PX6A 3UVJA 1ZAVA 1X9SA 1OO0B 3T9ZA 1N52B 5BXIA 1NJZA 4M63A 4KJIA 2AD9A 5BYRA 3E51A 4L3KA 4U8VA 2O5DA 1YKWA 4R8UB 4UOGA 3CWJA 1KVKA 5T7LA 2DGQA 1D9AA 2VH7A 2XBPA 2VBWA 3Q86A 3KMQA 5BR8J 4X2BA 3ZZOA 3JYTB 1S77D 2ZD1A 1RXOB 2CRLA 3QYYA 4LJMA 4Q8EA 1M5KC 4USJC 2B9YA 4N7TA 2A6OA 1S6OA 3C6UA 4NMLA 1CEZA 1S6PB 4OJ3A 4NRTA 1VRUA 4QW8A 3MUTP 1WNEA 5F3TA 4WBFA 3MEEA 4FDFA 3OW2R 1YBTA 3GCXP 4DXLA 1UZHA 3MR2A 2PI5A 1TMMA 4C8LA 4YB5A 2Z30B 4B9UA 4DX7A 5B0BA 2FVPA 1Q1KA 1NUEA 3N9UC 3KG1A 1SI9A 1S7IA 1AA1B 2GHVC 2MZ1A 3I6PA 2NXUA 4WTYA 2C2DA 3CW2C 4OX6A 5ADZA 3AQPA 2CJYB 3N6MA 2XI2A 4MKAA 1IBKF 2ZH2A 2NXCA 2JEJA 5EWEA 4R8UA 2VQFF 1CC8A 3KDNA 3PM9A 1KRPA 1FEHA 2DB1A 2HVDA 3BGOP 3BSOA 5CH7B 1G7CB 4DZ6A 1T9XA 2M52A 4I1TA 1P1TA 2ZKUA 3CC2S 3O6QA 3DCAA 5HK4A 1S6PA 1N33F 3D3BJ 2F7VA 3HVRA 4MJKA 1K1QA 1OQ6A 4AXJA 4LQ3A 2W7PA 3IAM9 2BKPA 5FDLB 3ENQA 2AKWB 3IBWA 2ABYA 1R0AB 4B3TF 1N5VA 3R2DJ 4RNOA 5B09A 3HPOA 2PI4A 1C4CA 1RISA 5HMZA 2VG7A 4DR2F 1ZM3A 4OI3A 2ZVIA 3M32B 1EHWA 2EG1A 1IVZA 4TXSA 3ZFVA 2EFQA 3NG8A 1RT1B 5DG9A 5ETKA 2QN6B 2XGPA 4IKAA 5L38A 1B4SA 2HHVA 1WC4A 2YBVA 3HT0A 3OUYB 2EFNA 1L3KA 3DYAA 2HNZB 3OXGA 1VHIA 3QZ7A 2B7BB 2R8HA 3T6JA 5KFGA 3DFEA 3C14B 1Q86T 4A4JA 1PJ7A 4C8MA 4DF8A 3Q23A 3CF5Q 4F4XA 1Q78A 1FNXH 1FWPA 3CCRS 2QA4S 3P49B 3L3CA 3UD4P 4OI0A 3CJ4A 2A2DA 4IR9A 3R7BB 5IWAJ 4M5KA 4I56A 2C3PA 4U7UK 3C2PA 1X4GA 3S7RA 3HO1A 2R2RA 3WZ0A 1R27B 4NLTA 1IKXB 5FDLA 2YWGA 2VQEF 4QCLA 4OYZA 2Z8QA 2H4YB 2FVSA 1E6VA 2RILA 3BSNA 3DU6A 4F0HA 3D5MA 4YOEA 2WSFC 2H51B 2VBYA 3V2UC 5KFDA 1PAUB 2K06A 2HVHA 3PNIA 3DXSX 1UEUA 5CAAA 4ANDA 3W1YC 3AH6A 2HFNA 2GW8A 1F3VA 4AQYF 1VFJA 1LK5A 3BPSP 2EBGA 2AWZA 3OUYA 4NA1A 3IMQJ 3NWRA 1YSJA 4OIXA 2HNZA 1RT2B 3MD3A 5KFTA 3IM8A 2KB2A 5KFFA 1Q8LA 1ZOTA 1BC6A 1XR6A 1RAHB 2ZJRQ 3CJSA 2H9ZA 2VOOA 2OEMA 4DSFA 2BVZA 3O2IA 3R6GB 1BLUA 1FDDA 4OHZA 2ZH8A 3O8WA 3KFWX 4M5MA 1GH8A 5D3GA 5F8HA 4FF3A 2V4JA 1T3OA 3VHQA 3GIMA 4MKYA 1SC3B 1FXDA 1JJ2R 3GYXB 4M1KA 4BBYA 3BDPA 5KFVA 2QZ8A 4WE1A 1XJWB 4NZ7A 3TAPA 3AAWB 1DAXA 1VC5A 2PEHA 2XYHB 1WORA 4OV1A 4K0KF 3E3XA 3MR6A 2AJQA 2HQ3A 3J80U 5DG7A 3GSIA 2RQKA 1NNDA 3O3LA 3MEGA 4JB8B 1N32J 4TY9A 1YJUA 1YJNS 1BQNB 2W4CA 3KG4A 2IRYA 3CUNA 1RAFB 2OH2A 3RAXA 2P9CA 4WJBA 1T02A 3UDCA 4NLPA 2WW4A 2YX4A 1NZ8A 4C3KA 3KDOA 4RUHA 1TAQA 1RT2A 4TU8A 2VONA 2CVEA 3DRPB 2YKPA 5ETPA 2N4DA 1KVJA 5MLCV 4DR6J 1N5QA 3PV8A 1D09B 2WB1D 1LXJA 2AJ1A 3R5CA 4ZVFA 5DLFA 4Y3CA 1NK7A 3VWSA 2E7XA 2PMZD 1LW2A 2LCWA 4HACB 3FUYA 4OV6A 2NUHA 3A8KA 2QX0A 4V1Ak 1TL7B 1FX2A 4HDHA 2QTWA 1AXQA 3QRRA 3ILJA 1AROP 3KHGA 3RBEA 5CYQA 3MOJB 5EX0A 3D0GE 2YQ0A 4DU8A 2QE5A 2RUSA 4LF6F 5AJ3F 3IN5A 3GJQB 4CNYA 3GR0A 2AU0A 4QPXA 4B9VA 3CMQA 1YRTA 3T1HJ 1S9FA 3KNAA 2YWHA 1KFSA 1C2PA 4MFBA 4DV4J 4B9LA 4HLBA 4LF8F 2FIUA 2AEMA 2UV8A 3W8PA 2AZ3A 4CIOA 1R89A 4YHHJ 1M5PC 1SL2A 2ZZMA 4PQUB 1SL0A 3OV7A 3CB4A 2IC3A 1N5SA 2HVEA 3TA2A 2DTJA 4P7VA 1X4CA 4LVOP 4FN5A 5HJYA 2GVZB 3DN9A 2PFFB 3PO5A 2XNQA 3CCWA 1JLEB 3KUHA 4ANEA 3TNVA 2O3DA 3T41A 4DV0F 2LXUA 4DV7J 1Q79A 2XZTB 4USUA 4YFUA 1GEHA 4MAKA 3MMCB 2LDIA 3SCIE 4JI0J 5HJXA 3IA0A 1QTNB 5EN1A 2LLZA 2HHUA 4ED2A 1TMJA 3DRSA 1U2CA 5E33A 2AYMA 3MGJA 3CJ5A 2XMTA 2BE2B 2AV5A 2JVRA 4RWXA 3K5LA 4UT4A 3RBZA 3RRHA 4PQUA 4QR2A 3WQPA 2CVIA 4O3NA 4O4RA 3Q8VA 3POTB 2C2RA 2HFVA 3IGVA 1OJ4A 2BRLA 3NOGA 6AT1B 2H5EA 3AHPA 2RRAA 2HHHJ 5B0EA 2OKQA 4LF5J 3CJ2A 2GVZA 2FYXA 3Q89A 2KT3A 3TX0A 4ZN3A 4ZS6A 1JLEA 1WI8A 1VQSA 2O67A 2A2CA 3IGNA 3N5BA 2BQRA 4ZCLA 3W65A 3W3SA 5I3QA 1M5OC 3R1LA 2IRXA 4RPFA 3MAQA 4TVAB 4WXOA 3DOKA 2GHPA 2CNNB 4F4WA 1NK4A 1SPBP 2OPQB 2IIHA 1RB0A 1H3DA 1APSA 2QL9B 2IA0A 2WZ1A 3K59A 4A8XA 4ED3A 4IFVB 5E3QA 1N5YB 1PYSB 3MM9B 2W2QP 3MTJA 4ITSA 3P5BP 2NPFA 1YITS 1HKAA 1SKUB 4OYXA 3POTA 3MCNA 4CWBA 1WHYA 4MYTA 5SZTA 1XN9A 4H4MA 1E6YA 4KC5A 4DL3A 4OZNA 2UUCJ 4L75A 3KOAA 4WZQA 1C1CB 2CPXA 4F04B 4DR7F 1IKWA 5KG5A 4LMZA 3TZZA 3D28A 4ECXA 4LRFA 1H2UX 3GG0A 3BQ2A 4PWDB 1KQSR 2C3YA 4NZ6A 2VV5A 5LOQA 2CADA 3GE9A 1FFWB 3FJ2A 2FLOA 1VK3A 2B6AB 4Y0FA 4ZLPA 1UJ4A 2LFVA 3W2WA 1Y0HA 4OL8A 2P6SA 3K5NA 2QG9B 2DK2A 1XNRJ 2HMIB 4HH0A 3PEJA 4LBIA 1ELOA 4IFYA 2OPQA 4ZVOB 2JDJA 2WOMA 2DT9A 1P8GA 4WXWA 3OJUA 2EFPA 2XZDB 2D3ZA 4UF4A 5D4OA 4U9RA 2ADBA 4IFVA 1N5YA 4KHMA 1UEKA 3MM9A 3TZYA 2HIQA 4DPUA 2CPDA 2LP4A 3OTOJ 3CJKB 3R8YA 3D1OA 3J80Y 3D1QA 3AOBA 3E8OA 3W7BA 3OR2B 1AUDA 5K8OA 2VPWB 3JB9k 3W9JA 4E2FB 4NEZA 2DGVA 3QZ8A 1OQ3A 4JI8F 4X62J 3N5FA 2AHOB 2IA6A 3KJVB 3M30B 2OFGX 1C1CA 2JEGA 1IKYB 4QU7A 4I4BA 3GV5B 1F9FA 2XSJB 4PWDA 4ZPWR 1FJGF 4JI5F 4RW8B 1KS2A 5HQ8A 4JI2J 1UFWA 1JQGA 4H4OB 5ETNA 3SXLA 5HBMB 1EKRA 2M8DB 3FNNA 3N28A 2BANB 2OUGA 3ZTSA 2JH3A 2KFZA 1XMQJ 2APOA 2KKHA 2JLGA 1TKXB 1Y5IB 2W9BB 2HMIA 4ICLA 4LF7J 2ZEJA 1M5VC 4B17A 3QPIA 3FQKA 5E3CA 3C19A 3HVWA 4TLQA 1LW0A 1RT3B 2CQHA 4KH0B 2AYGA 2YKOA 3MCMA 4DCOB 3VALA 3HK2A 5KOWA 3NS7B 1LEOA 1WOPA 1TUGB 1WSRA 1WOOA 3H59A 4BWJA 4NLXA 1W7WA 4J9VA 1QAXA 1RT4A 4R5PA 1GTHA 2N4CA 1NKCA 3CCLS 2YQ1A 4ZK7M 2J8AA 3GIRA 4OI6A 1QSYA 5KT6A 1NEEA 4LFAJ 1S97A 1H38A 3M30A 2HIYA 4B3SJ 5HI7A 5J1EB 3Q0AA 3BKUA 2PO4A 1HWIA 1PC5A 4URGA 2XSJA 4LRCA 3C6TB 1VBXA 3DRYA 2NUUG 3RB3A 4ED6A 1NKBA 4YR3A 4EI2A 1T0TV 4C3LA 1DURA 3CJ8A 3DHXA 2D3O1 1TR0A 1V3RA 3IS9B 2BANA 4IYQA 3FCHA 4WP8A 5E7OB 1TKXA 2W9BA 2DNQA 2EG2A 1FKOB 2V8GA 2LXIA 5L1LA 1WHVA 1VQKS 1QE1B 4MIAA 1YLXA 4FPIA 1IQTA 1YBAA 1RA6A 1F6TA 4IOCQ 3K7RA 1EKSA 2W2PP 4K4ZA 1N8RT 3KLIB 2XI3A 4OJ1A 2N82B 3Q8RB 3HI9A 1V3SA 1PBAA 5IT4A 4K2JA 2NREA 2I0XA 1G1XA 4EWTA 1TKTB 4N41A 4O3RA 3EXYA 2HFOA 1FRIA 2DR9A 4MIBA 2OSRA 2L9WA 3JTOA 1M5HA 1IBMJ 2B3TB 3NS6A 3T19A 2M88A 5J1EA 4DV3J 1KLMA 2I8EA 2F9JA 1YIJS 3C6TA 2DR6A 3AA9A 2DGSA 1D9FA 3CT9A 2J5AA 3G87A 2LDYA 2ZUAA 5K20B 3FFIA 4DQSA 2NXNA 4PG4A 4HT7A 2N3LA 2JOQA 2ZH3A 2ZOMA 1RTJB 5THWA 2WW8A 3M2VB 1OS5A 2WVDA 5ETSA 1BE4A 1FKOA 1HQEB 2ZH7A 1QE1A 3SEOA 4DPWA 5AE1A 1HNIA 4ZVSB 1Q8IA 2PA3A 4JYAJ 1S72S 5LXYA 5J2PA 3ZTOA 4C0HA 3H4DA 3KLIA 2GMJA 3PRBA 2IMWP 4O3PA 3VGSA 4A8WA 1PJ6A 2HQCA 3GMGA 5A8KB 2OSQA 4U67Q 3RZAA 4GO7X 3TEGA 3OVSA 2BMBA 1IR0A 1UFKA 2KT5A 1TKTA 4LF4J 3SSRA 3R1HA 2R7OA 5B0FA 4K4SA 3W66A 1Q5VA 1YJ7A 1REVB 2RF2B 3OXLA 4ECWA 5E3RA 4K5SA 5ETTA 4Q2MA 4ZVPB 4ZITA 1WEZA 1BWEA 2EXUA 5I42A 1NK8A 2QGFB 3ZTPA 4CCHA 3NGTA 4BS2A 1P9YA 1YG0A 1RTJA 5GMEA 2FHKA 3M2VA 2YTCA 4MT1A 3AT1B 3V5RA 1NKEA 1H74A 3HKWA 3MUVP 1HQEA 2BJDA 1I51B 4RL1A 1UCNA 1IR2A 2BEFA 2CJAA 4TU7A 2V67A 1V3ZA 1JJCB 1R31A 2Y8YA 2HFUA 1NAQA 5GAHI 1CQMA 2OPPB 2HBQB 2G13A 5KFUA 2JSXA 5A8KA 3KKFA 3Q8SB 2HLTA 2XZWA 2GQ2A 3MM8B 1R0BG 4YB7A 4OYBA 5KG6A 4PQAA 3E01B 1UFLA 3DLGB 1SQFA 5E3PA 4WFZA 1AFIA 2QLWA 4P74A 1SC6A 2H54B 3ENAA 1FD2A 4LFCF 2RF2A 3LWLA 2VB6A 5J2NB 1FJ7A 2W25A 2GV1A 3U27A 3AODA 4QZVB 1DLOB 1S7HA 4MK9A 4XAKA 3H0PA 2ROPA 3KMSA 1R7IA 4F0KA 4JV0A 2GAHC 3EDRB 3BDEA 1Y3JA 2ZH6A 2FB0A 4UTGA 2R3VA 2MZRA 5KG7A 4XIUA 4P72A 3W61A 1VLOA 1WC5A 3FBEA 2ACMA 4YP3A 3DDNA 3GFZA 2KFNA 4JI7J 4ECYA 5DDQC 1HIYA 3S1TA 4TYAA 2B8PA 4QWEA 2KJVA 4X4TA 3NKYA 1BUXA 3O5TB 1S6UA 2CG8A 2YKMA 3M9OB 4RO0A 4F0MA 4YS2A 3M8RA 1KR4A 3DHWC 2NYHA 3D6TB 2P8IA 5LMNJ 4IR1A 1HWJA 1HBMB 4YN3B 3W9HA 2K3KA 2M9KA 2GVDB 3MMBB 3MM8A 4G65A 1B3TA 1R6YA 4U8YA 1T05A 1URRA 3KLEB 3GYGA 1HMVA 4RUBA 1JJ4A 2J9EA 3RU0A 1CJVB 4ZP7A 1R8CA 3BSAA 2O1PA 1Y5LB 4B3MF 2AF6A 3UDEA 1PO6A 1JNZB 3TJ9A 2PMHA 5A8RA 1L5UA 1KQFB 2OD4A 1DLOA 3CCQS 2CQ2A 1ZPWX 3GU0A 2X51A 4C0BA 2QMWA 4DUTA 3V6JA 4CM0A 4EZ6A 4O3SA 4TNOA 2B9EA 1RAGB 2MB0B 4RU9A 2J0QD 2GQCA 4ID5A 3MPYA 2I2YA 1UJ5A 1P9QC 2DXEA 2MKCA 1TFWA 1RBAA 2WB4A 3QQCD 2DHSA 4URSA 2VBZA 4NWBA 2ZNZA 2R8IA 1TL1A 2YVSA 2F4FA 1N0UA 5DGBA 4F3MA 5J2MA 2B43A 3WDOA 3I9ZA 3BB5A 2DRAA 1FX4A 3QT6A 1U1MA 2PEBA 2GVDA 4NCGB 4NZ0A 3MMBA 3ZZRA 1KTVA 3CCES 4A8SA 1U47A 4UOCA 1DY3A 3KLEA 2BXJA 1HBOB 3I0RA 4RW9B 1D8YA 2UUWA 4A8MP 1CJVA 2Q43A 3I82A 2RKIB 4U7CA 2BUNA 2DNYA 2ZH9A 2QIFA 2IYIA 1PAEX 3DMJB 5HVFA 2QMUB 1U25A 1UPMB 1ZM2A 2KN4A 1TFYA 4X4RA 4X65J 2F8EX 1FKPB 1S9GB 3P96A 3CMAS 1VLYA 2IDLA 2QEXS 3LO3A 1RT5A 4GVLA 1U24A 2YNFA 1SH2A 3I0SA 3KUEA 4X66J 1VS3A 1XEZA 3M8SA 4Y2AA 5F8GA 1GX6A 3Q8YA 2XG8A 2Q6BA 2X1FA 2EKYA 2E9RX 3BM7A 1TZ0A 2BRKA 2ZH1A 1U1OA 5K8NA 2G2ZA 4JI3F 3Q2TC 1T03A 3R97A 1JLBB 1C0TB 2DGTA 1RJJA 3NEKA 3X1LB 4OZ0A 1VRTA 3VVUA 5C7PA 2MZJA 3J7YI 3LALA 2RJZA 3VAGA 1S6QB 3PXGa 2BABA 4J9QA 4K4UA 2DYAA 1XMOF 1HBOA 1N54B 2ILYA 4WIIA 4JV1A 2BYCA 4IRCA 5GAHU 4G1IA 1S1WB 4DSLA 3DMJA 1X5TA 5M2RA 2RH3A 1Z2ZA 5ETVA 1TAUA 4DWIA 4DUYF 1BWVA 1NB7A 1FKPA 1OMSA 1N56A 3DM2B 2CQPA 1AB8A 4CLUA 5DG8A 3HVTB 1MROB 4JP8A 2EFOA 2A3JA 2V5HG 1GNKA 4OI4A 4UW2A 2PIIA 4DN9A 1VBZA 3I5CA 4ZIVA 5ETQA 3ZTQA 4XO0A 4XDCA 1JLBA 3CCTA 1C0TA 2G1HA 3LW5C 4LF1A 5KFIA 2EW9A 1U0HA 2JJ4D 5KG1A 1EJ7L 4BC7A 3ADAC 4DV5J 2EKNA 2UUAF 2BACA 4OI1A 2N3OA 3I96A 2ZE2A 3OTCA 4LUBA 2ZUGA 2Y3YA 4MKBA 2WBMA 1JLAB 3HF5A 2Z2MA 5HP1B 3ZZZA 4CDIA 4BCAA 4ID8A 2KXFA 4ZIWA 2ZC4A 2IMOA 5D15A 3QO9A 3EGNA 1VQMS 1YDLA 3HVTA 2VF3A 4R25A 1NB2A 4Y2IA 3QJPA 1LV5A 3GR1A 2OFHX 2KXNB 1MROA 2YH0A 3GFYA 3OR1B 4E8UA 1VQ9S 3FCVA 4M5DA 1R3NA 4AE5A 4QU6A 3PJ9A 1KLNA 4M5HA 3PIOQ 5HSPA 3NCRA 3BH7B 4NLQA 4HVZA 4C98A 3LAKA 2QA4G 1YHQS 2HQIA 2OP5A 2J0SD 3R7NB 4CLWA 2XY5A 4JI4F 1S1UB 2J0XA 1TVRB 1T94A 2OI2A 1G6BA 3KHLA 4LFBF 4LQ9A 1JB0C 3VVTA 4LVNP 3MM5A 2VDHA 2HYIB 4Y2MA 1YZ7A 2B9XA 1VQOS 5T41A 2HZCA 4CH1A 1A7GE 2BDPA 1UW4A 2DNMA 3GJRB 2W9CB 1N36J 4FPRA 2E66A 1UZDA 1U1KA 2AEFA 4OZ5A 2BJEA 2CQ1A 2IJFA 5LXRA 2MHEA 2UUBF 3R5DA 4DR4F 3PX0A 3KWMA 2G1DA 2R8KA 3OL7A 4L76A 2YXLA 3BKFA 1SC1B 3OR1A 4FNIA 5CCLA 4ZVUB 2FLLA 4WU3A 3EM1A 4ZLNA 4USTA 2QA1A 3HHLA 1FK9B 3BH6B 4FF2A 4C2MA 1CSJA 2J8SA 5K14B 5F0WA 4ZHRB 4DFMA 9RUBA 2UXCF 4KHRA 1X9WA 1H2TZ 2IAJB 1EP4A 3QGPA 5F8JA 3SV4A 2E1RA 3S6EA 1HNWF 4J37A 3HFKA 1NK0A 2YNIA 2DR8A 2RRBA 4ALZA 3V6KA 1UVMA 3ZNUA 1O0PA 3KNGA 3CULA 3ZZTA 2AJFE 2LQBA 2HK2A 1WKJA 2CPJA 4JOUA 2J0WA 1KD1T 5A6WA 3V6HA 3CEDA 3W8GA 2AZ1A 2KFYA 3J7YU 2DNZA 5BYQA 1MWZA 2ZNYA 4NXNF 2W2OP 3ETMA 1HNZJ 1ZA1B 4GRSA 2AMCB 3VZIA 2W9CA 3JS9A 3GIJA 2ZWOA 4NI2B 2QSFA 4YY3J 2PT0A 1EQMA 2GCFA 3IWLA 2EFGA 4FXDA 3M8WA 2VKRA 3BYPA 3M8PA 2RQCA 1XR5A 3PO4A 2ZJQQ 1RU2A 2YX1A 1NSPA 3SQGB 4BWMA 4X4SA 1FK9A 3D6HB 1UETA 5DQGA 3H4BA 5K14A 2DRDA 2R2UA 1IJEB 5AXNA 1UVLA 5KFEA 1WSVA 2UU9F 5BYSA 2IAJA 2DGWA 1KDNA 3ISNC 1WHWA 4N8OA 3SFUA 2V69A 1T8EA 1AZSB 3THTA 4WKYA 1S0VA 3CJTA 3CJ0A 2JEIA 4F36A 4K4WA 3PFOA 1QUVA 3K89A 1U6BA 4X62F 2BZ2A 3L7PA 5CYMB 4EEYA 2IBOA 3U1LA 5GMDA 4ED5A 2MLZA 2ZM6F 2P6TA 1HI8A 5C42B 1WJ9A 2FY8A 1R8BA 4NI2A 3LP2B 3UW1A 4Q2LA 3DOMA 2DCLA 3JSMB 4OX7A 4ECUA 2X1AA 4DMZA 1J5EF 1FO1A 3BZQA 2BW7A 3IR6B 3C46A 4CLLA 2Q6CA 1KEKA 1CG2A 3CD6S 5IT0A 4KE5A 4DR5J 3GCWP 1WC0A 3SQGA 4DU7A 4OYMA 1KKHA 2L3MA 5CD4H 3S8SA 2Q79A 5BJRA 1DTQA 4NLUA 1VRQC 2OEJA 3BQ0A 4KBIA 2I9SA 1D3WA 3P3DA 1TL4A 4FYXB 2OLWA 2HPUA 2W9AA 5CA5A 4K4YA 3K17A 2R7VA 3DLEA 5LMUJ 3HX9A 4F8RA 3H7HB 3EPGA 3IRWP 5CYMA 2V9KA 3P8BB 4D3GA 3MFHA 2JC1A 3ITHB 4OFZA 1VJQA 3G8QA 3NGSA 2FVCA 4ES3A 1F2HA 5IS2A 5EX3A 2LU1A 3LP2A 2XQCA 5IV4A 2EFVA 4EFAC 1VMBA 4N47A 4M95A 5IM0A 2DHHA 2B4PA 4TQRA 4HI2A 4P2SA 3OVBA 3GJSB 3SV3A 2UVRA 2F8MA 1I94J 3OT9A 3VQTA 2R42A 4P2FA 5EWGA 3DI6B 2CPHA 2VPYB 3VQSA 4LF9J 1UA0A 3P6YC 3RRKA 4F3QA 1I5OB 3HXMA 2J7WA 3GQCA 4OLPA 3UCZP 2CQDA 2HVIA 3UWTA 2B0GA 3M8QB 1KOOA 3UCGA 2C3MA 3DKDA 2DNKA 1GX5A 2ASDA 2FJVA 1Y4ZB 2A10A 2V4QA 3WC0A 2AJ2A 2XB2D 4NMXA 3A13A 2E5JA 3ITHA 3AJDA 3G8TA 2DHAA 3TVKA 1RSCA 3WHIA 4OHWA 3OFFA 1HQUB 1JKHA 3GILA 2GO9A 2MLXA 1P6TA 3M6VA 5ITHA 5IV3A 1NU4A 1XBWA 4N5SA 1ZTWA 4KB7A 2MQPA 4F25A 1L3UA 1CC7A 4C11B 3TUJC 2C3OA 1N34J 2B56A 5LT5A 3VAFA 2DRBA 4R0JA 2E44A 4PG8A 2DNLA 4JI1J 1WC6A 5D4LA 3TOQA 4Y2CA 4NPOA 3K57A 3FQLA 4RX6A 4ZVTB 3AD7C 3J7Z5 2HAFA 3QWUA 4I0WA 1HBUB 4NLVA 5HO4A 5LM7E 1RT6A 1J5OB 3W5XA 4E98A 3C66A 2V4RA 2HQFA 4K59A 3OL9A 4ILLA 2CNOB 1HNXJ 5IC6B 2EI5A 1HI1A 3GLJA 1BGXT 3PIPQ 3H2UB 1X0FA 2ZZTA 1R0CB 4IDKB 1TTHB 3FEYB 3FRYA 2L9DA 1X4EA 4CRJA 2J9CA 2VFVA 3HZEA 4G1QB 4DF4A 2CPIA 3NY0A 3MECB 2C22A 5I3PA 2Q66A 4CH0S 5J1PA 2ILZA 2V34A 1U02A 3M05A 2BOPA 4LREA 2HFZA 4KHPJ 2NZ4A 2HHWA 3TEHB 2DO0A 3RBXA 5JVGQ 4ILMA 1TUVA 2DIUA 3OLAA 3AOAA 4I6AA 4IG3B 1RHRB 4KT0C 1CULB 2YKNA 5EHHA 1RT7A 2CPFA 1S9EA 4M5IA 1KSPA 4CM2A 2YPZA 5HATA 4NLWA 1L3VA 3SBMA 2E7WA 3EMTA 3OVAA 4ES2A 4WFYA 4RBUA 2MQNA 2BQUA 1ITPA 3KG0A 3FK4A 2POKA 5IOLA 1K9MT 4FVCA 2I1RA 3VAKA 1VHFA 4OHXA 2F4VF 1SJQA 1IBCB 2VG5B 2XLKA 1HD0A 4QIVA 2V50A 4NL5A 4IDKA 2ASYA 1OPIA 2Z2ZA 3HSJA 3KUGA 3VZHA 1FE0A 3FZBA 2H1YA 3ONQA 2FTRA 2CWKA 5B08A 4ZPBA 4PCQA 2GAGC 4UQTA 1Q8BA 3MECA 4I67A 3VAJA 5A0YA 1V6HA 2HRYA 4M5NA 5JVHQ 2HS3A 1N4LA 4DCPB 4DPYA 3I87A 1PJ5A 1T3NA 2FJDB 5GMKa 3HP6A 2CQ0A 1SJ4P 3D6MB 1FXLA 4IG3A 2QLBB 3MM7A 3SMZA 3QIPA 1D0EA 1QDUB 3BQ1A 1ZS6A 4A47A 2NS1B 2F40A 2V8HA 1VIOA 1IBKJ 2QO3A 4OYAA 1NSQA 3L09A 4WWSA 3TX8A 2RAQA 1FCAA 1WKKA 2VQFJ 1U1LA 2J76E 2NR0A 5CXTA 3GWCA 1NMEB 3HLUA 1EETB 2XMUA 2XMAA 3I55S 2V8DA 1RABB 4G3IA 2VIHA 1N33J 2FJBB 5K5MA 3CO9A 2FVRA 3ENVA 3I9V9 2V2ZA 1QJHA 2YNHB 1RWKB 2GIRA 5D77A 3NBPB 3KJFB 4WCEQ 2QYGA 3FVYA 1FNMA 2V6AA 4LF2A 2RDIA 4B3TJ 2WVFA 4KGZB 4DSKA 3DU5A 4P10A 4IOBA 3PFEA 2X3GA 4DR2J 5AXKA 2UVVA 4WPAA 2Y1IA 3M2UB 5IT9U 3AXKA 1C1BA 4Q8FA 1GXUA 1BMQB 1U7LA 2DPIA 1U2FA 1U09A 4QYRA 5DM7Q 1FESA 5D4PA 4WF9Q 4F67A 3L7UA 2DEJA 3CJ3A 4CLZA 4J9LA 1Q5YA 3HHNB 3HD1A 1S1VB 2YWKA 5G4DA 3PYEA 4ERDA 4OLOA 3DGPB 1FNOA 2Z4PA 1ZBTA 2H5IB 3M4XA 1MNEA 2VC0A 3SZ2A 4RWWA 2I5JB 5HVGA 4EUVA 2AYBA 4DFPA 4RLEA 4DL5A 1VQ7S 2WRMA 3QAUA 3BBBA 3K8VA 1QSSA 2HVZA 3T1YF 4HR2A 4K4VA 2HG4A 2DGOA 1VDHA 2FHMA 3QSYB 4LRBA 3FSYA 3TRGA 1H0HB 2YNHA 3OFHA 1FEEA 2K1RB 4ZMMA 2V2KA 1S59A 2FD2A 3DLLQ 5B7WA 2VQEJ 3D0IE 1ICEB 4USVA 3JYTA 2DY9A 1FJEB 1G2EA 2N7YA 3LTOA 3BREA 2W01A 2J6SA 4M5LA 4EU0A 1BXNA 2C2EA 3DLHA 1WF0A 1C0UB 3HULA 4LR8A 4QW9A 3RGIA 2XS7A 5F8MA 2HGLA 2L08A 3SCLE 3KK3B 3BO2A 3OJSA 2QA2A 2G0JA 4AQYJ 3PR4A 5KG0A 2AEJA 5HQMA 3F73A 1S1VA 2MDAA 1BQMB 2XM3A 3B54A 3NNCA 2OO4A 4USIA 4KGKA 4PPZA 1KONA 2IVMA 4DSIA 4L3NA 4DUZF 1UA1A 2VICA 4AD6A 1VJWA 2Z0GA 1RUSA 3EE3A 1Q82T 1KOHA 1NK6A 1LWEB 2PDAA 1GFWB 1WEYA 4DEZA 1M1GA 1VOMA 2FLPA 1A9NB 2LA6A 2HW3A 1YJTA 5C5JA 2AW0A 4CYUB 3THPA 3MCOA 4KGXB 1K73T 2K1RA 2RQMA 3VGVA 4DJBA 3RAMA 4I69A 4LRAA 1NHKL 1JLFB 4DQPA 1KNZA 1U1PA 1WF1A 1FDNA 4TYBA 4C0OC 4K0KJ 2FZGB 4DSEA 2D3UA 1HR0F 1F2GA 4J9NA 1KTQA 2QV6A 3TA1A 1ZETA 4PXBA 3CDWA 2MSSA 3PYDA 2QJ3A 1FKAF 3NMRA 1JLGB 3HHDA 2P5VA 1R0AA 2JLEA 3SSSA 1BQXA 2JL9A 5KFPA 1XC9A 1VBYA 3IWXA 2OGUA 5H9EJ 4USHA 3M32A 3M7VA 2OPSB 4J9RA 5GADU 4NE9C 1RT1A 5J2QB 1X0PA 1IN0A 4DV1F 3BJYA 4RW6B 4HHJA 2GC8A 1S0OA 3QT8A 4FNHA 5L9XA 1TU0B 4QPTA 3A12A 3FGVA 2Z2YB 3OTDA 3QSIA 2MJUA 4DFKA 3LQVA 3C14A 2XC9A 2OMOA 4OZ1A 2KG0A 3TUIC 3CD0A 1JLFA 3TP2A 2BJ9A 3OQ2A 1HL6A 3A8IA 4LF6J 5AJ3J 1YX2A 2JX2A 3MAAB 4NA2A 4O3OA 3HHLC 4W4MA 2CIMA 1K0TA 1IKXA 2VFUA 1JLGA 2PMWA 2GFFA 4UOFA 4LF8J 4B3RF 4CI0B 4TLRA 1FRMA 3SDEB 2W24A 1YBUA 2QRRA 3SSQA 1RAIB 2R7UA 1UWBB 5FIIA 1GQEA 2QLXA 5E2QA 1TP7A 3CMES 3R27A 5KFRA 3I31A 1NDCA 4USWA 2OPSA 4JI6F 5KFKA 1HQ2A 1RE1B 2XYGB 5CYJA 4CZCA 2ZOFA 4ZCKA 2MGZB 3V6DB 2E29A 2AIRB 2H5JB 3FZ2A 3CCJS 1XR7A 1SV5B 2BJ8A 3HSDA 4M5GA 5L8RC 2VDIA 4WFAQ 5GVQA 4EK2A 2X1BA 3D1HA 3QFHA 4DL4A 2LEPA 2OELA 1LFWA 3EDQB 1NJYA 2RNEA 4DV0J 3EUNA 2UXDF 1J2VA 2NXEA 3T5LA 3C15B 4DR1F 4TY8B 2FC9A 2IFXA 2MKYA 3FRZA 1MN9A 2CWXA 4DV2F 2GIQA 1LWCB 2W7AA 4DX8H 1MG7A 4NXMF 2CPZA 1FA0A 3D2WA 3SI8A 3A3PB 3SDEA 3GZ7A 4PG5A 3BGLA 4OX9F 2R2SA 2EBEA 2R8JA 2C2KB 2HBYB 2CZVC 4JUZA 1M0SA 5CCMA 2EWHA 1BQNA 4GKJF 5IT9Y 3JXOA 4JV5F 2HHPA 3J81j 1VQ5S 2IBKA 1UL3A 3V6DA 2G4BA 1RAAB 1RYSA 1YZ6A 1KQGB 2Z2LA 3NS5A 2R8GA 3HHKA 4NCAA 3CGIA 2V8PA 4Q7AA 2OD6A 3D4JA 4EO6A 1YI2S 2NCKL 3KYLA 3DRPA 2CKWA 2R9LA 2JZ5A 5KFLA 1PKUA 1WOSA 4KV8B 3GFXA 3VAHA 1HYSB 3Q24A 4HH1A 5DLGA 1X31C 1TKDA 2DKOB 1Y5NB 4ED4A 5LSLA 3C15A 1EZZB 4LT6A 2CJ9A 4TY8A 2MY7A 2IDEA 3AD9C 4N76A 4HACA 1PGZA 1SJFA 1S1TB 6FD1A 3OBIA 3EX7B 1RTDB 3TUZC 1ZZFA 5C25B 4B9MA 1HI0P 1RWUA 1TL7A 3GV7B 4XPCA 1LWCA 3LUYA 4B9SA 2D7SA 2FHJA 3FEZA 1SKRA 4FYDA 3FEXB 4UOHA 5FJ4A 2PN6A 1JK9B 2E5HA 4XK8C 4DLGA 2BJ1A 2I38A 2J9DE 2E5GA 3OHBA 1NH8A 1F5BA 3NCQA 3NGDA 2XMJA 4DHVA 4PG6A 3K0JA 1N6QB 1NHUA 3CCUS 4RNFA 1VCTA 1S10A 4GO5X 2AGOA 1X5OA 1VQLS 3BS9A 4Q0BB 1RACB 3AA8A 2PFDA 4C8OA 2ACYA 2D41A 1IKVB 2D74B 3HMJG 3R3TA 4DR7J 5M2PA 4KV8A 1IM4A 3IM9A 1B0PA 1F0XA 4X64F 1S0MA 4GKKF 5IFMA 1IM6A 5A8WB 3QMQA 3DLBA 3FMBA 2E1AA 3KK1B 4FYYB 2Y1LB 2GNKA 4YDDB 1JWWA 2MKIA 1DARA 3JTNA 4O4GB 2LEBA 4LIRA 3H40A 1S76D 1ZM4A 2RT3A 2PD1A 4WP3A 1RTDA 5C25A 2FLNA 2RS8A 4DL7A 1HFEL 1Y9OA 2XGQA 4CNZA 1O51A 3G6XA 3EJMA 3MMCA 4O0IA 4CO5A 2J7KA
chains in the Genus database with same CATH topology
5DG9A 4BCAA 4ID8A 1IBMF 2KXFA 2R7WA 2XGPA 3KHHA 2ZC4A 4IKAA 2Y0SD 3ZZPA 5L38A 4DV3F 1QUPA 2IMOA 1JLQB 1PILA 2HHVA 1HPZA 3M2RA 2DNOA 1Q16B 3LGMA 3GG1A 5HMWA 2KHCA 3QO9A 3OUYB 3EGNA 1VQMS 4OQJA 3HVTA 4A8YA 2MZTA 5F8IA 2EFNA 1D9DA 4R25A 4PUOB 1L3KA 4Y2IA 3DYAA 2BE2A 1VQ4S 3QJPA 2HNZB 3OXGA 1LV5A 3GR1A 2OFHX 2KXNB 1MROA 2YH0A 3QZ7A 3GFYA 3MPVA 4OX8A 2B7BB 4YEAA 1QLNA 2R8HA 3OR1B 4E8UA 1W2BR 3T6JA 1VQ9S 5KFGA 4M5DA 4QOTA 3DFEA 1R3NA 4Q0BA 4AE5A 4MMOA 4QU6A 3IRXB 1VI7A 2YKMB 1KLNA 1RA7A 1Q86T 3NP5A 4A4JA 4C8MA 3ZZUA 4DF8A 7FDRA 3PIOQ 4A8FA 3Q23A 2QT7A 3CF5Q 2DR5A 4F4XA 2AGQA 4LSLB 1Q78A 2HWTA 4XPEA 3RTVA 1IKVA 1FNXH 3NCRA 3CCRS 2QA4S 3P49B 4NLQA 3L3CA 4HVZA 4C98A 3UD4P 4OI0A 3LAKA 3CJ4A 2A2DA 4ZVHA 4IR9A 1TV6B 3X3UA 3DI6A 3HHEA 4I56A 2C3PA 2QA4G 1YHQS 2HQIA 5A8WA 4U7UK 4DV6F 1T05B 2OP5A 3C2PA 1X4GA 2CQIA 3S7RA 2J0SD 3HO1A 2R2RA 3J7ZT 3WZ0A 3PJXA 2XY5A 4JI4F 1HMVB 1R27B 5CZVA 1S1UB 4QIFA 2WONB 2J0XA 5KT3A 1TVRB 4RNMA 3QWPA 1YWXA 4NLTA 4I2QB 1T94A 1YJWS 1IKXB 1U26A 2YWGA 5FDLA 2XS2A 1ZYQA 2VQEF 3NNHA 4JYAF 2CQ4A 4QCLA 1G6BA 4DS5A 3QGHA 4IH6A 3KHLA 2FC8A 4IH5A 1TKZB 3HZGA 4ZVGA 2ZH4A 2D1CA 1T7PA 4RUAA 3EZUA 4LFBF 4LQ9A 1JB0C 5D4NA 1FJCA 2VA3A 2Z8QA 4BHQA 4LVNP 5A8RB 2IVYA 2OIHA 3MD1A 3MM5A 2FVSA 2HYIB 4Y2MA 1E6VA 2RILA 3MTKA 4G6VB 3MR3A 3BSNA 1FRJA 2K3IA 1FRXA 3DU6A 4ECZA 5JXSA 4NA3A 2ZZNA 2B9XA 3D5MA 3M8QA 1VQOS 5T41A 4YOEA 2WSFC 2MQLA 2NSBA 2HHSA 2VBYA 3V2UC 3M9NB 2Y1JA 2V94A 5HLFB 1KHVA 2HZCA 5KFDA 1IBLF 5J1NA 4ZOSA 4LF4F 3F56A 2J7UA 4CH1A 1A7GE 2HVHA 3PNIA 2BDPA 3DXSX 1UEUA 3TW0A 1UW4A 3DLKA 2ROGA 2DNMA 4DDFA 2W9CB 3AH6A 2HFNA 2GW8A 1DBDA 4ID5B 4C7QA 3OTEA 4FPRA 2E66A 2DGXA 4AQYF 1U1KA 4OZ5A 1VFJA 1LK5A 4MTPA 1QSLA 4ZVEA 2VBXA 2BJEA 2EBGA 2CQ1A 2AWZA 1H7XA 2IJFA 3DOLB 2WBRA 3OUYA 2FPHX 4NA1A 3M6XA 2JEFA 2IYGA 5LXRA 1ZH5A 2MHEA 5E41A 2UUBF 3R5DA 1YSJA 4FXWA 1FRLA 2HNZA 4OIXA 1RT2B 4DR4F 2CPYA 1X4HA 3PX0A 5KFCA 3KWMA 2G1DA 1HQUA 3NRBA 1TL1B 2OTJS 3UNGC 2R8KA 4DG1B 2XLJA 4V19X 3OL7A 3MD3A 2JC0A 5KFTA 3E2EA 3OR1A 4NOHA 4M94A 4FNIA 5J2MB 5CCLA 5KFFA 2KB2A 2FLLA 4WU3A 4X4UA 1Q8LA 3IRXA 1ZOTA 2R7SA 1XR6A 1BC6A 2QA1A 3DNCA 3HHLA 1FK9B 4FF2A 4C2MA 1CSJA 2ZJRQ 3VAIA 4LSLA 4C11A 5KFJA 2H9ZA 3K8WA 2W8KA 4FBTA 2FJEB 2VOOA 5K14B 5F0WA 4DSFA 4ZHRB 2BVZA 4DFMA 1KC8T 3PR5B 3N6NA 3O2IA 2UXCF 1FVSA 1BLUA 4IOAQ 1FDDA 4KHRA 1X9WA 4OHZA 4ECQA 1H2TZ 2IAJB 5E5NA 1EP4A 4AXIA 2ZH8A 1CPZA 1F60B 1HBNB 4WK3A 3O8WA 5LJ3Y 4Y00A 3QGPA 5F8JA 3SV4A 1X4FA 2E1RA 2COLA 1VIXA 3S6EA 3KFWX 2B9WA 1HNWF 4J37A 3HFKA 3I0RB 4AL5A 1NK0A 2WCXA 2YNIA 2DR8A 4NLSA 5D3GA 1GH8A 2RRBA 3PEHA 4ALZA 5F8HA 3V6KA 1UVMA 4FF3A 3CIMA 1S48A 2FHOB 2V4JA 1T3OA 1O0PA 3KNGA 4FS2A 3CULA 4YDXA 3ZZTA 3GIMA 4MKYA 1QAYA 1FXDA 2AJFE 4U6PA 1JJ2R 2LQBA 3GYXB 4M1KA 1TKZA 4KO0B 4BBYA 3BDPA 1URNA 5KFVA 5HROB 2CPJA 2CJQA 2QZ8A 4ZKAA 4JOUA 4WE1A 2J0WA 1KD1T 2O01C 5A6WA 1JJHA 3V6HA 1JLCB 1ULRA 3CEDA 1XWLA 4NZ7A 5KG3A 2KFYA 3TAPA 3AAWB 3NAIA 1DAXA 3UR3C 1VC5A 5DO2A 2PEHA 2PGCA 2K7JA 3HVAA 3J7YU 2ZDPA 2DNZA 3RB0A 5KFMA 5BYQA 3U1MA 5DS7A 1MWZA 4A8QA 1UVIA 4UY8T 4OV1A 4K0KF 2ZNYA 2LQJA 3E3XA 5KTQA 3MR6A 4C4WA 5HLFA 4DQIA 4NXNF 2AJQA 1WI6A 2HQ3A 2CJBA 1HBUA 3BGUA 5DG7A 2RQKA 2B6AA 1NNDA 3O3LA 3MEGA 3MEKA 1RT5B 4TY9A 1YJUA 4TKTA 1YJNS 1BQNB 1J5OA 2YNFB 3I0SB 2W4CA 4H4KA 3KG4A 2IRYA 3VZIA 2W9CA 1B7FA 4B02A 3CUNA 2CQ3A 3GIJA 3RAXA 2OH2A 3W2VB 3UD3P 2DITA 3IXQA 2QSFA 1P1LA 2P9CA 4WJBA 1T02A 3GFHA 3UDCA 4NLPA 1KVIA 2YX4A 2ZJPQ 3OSNA 2LEAA 2PT0A 3DOLA 4C3MA 4UUWA 1M90T 2GCFA 1N0VC 3UQSA 4Q44A 3IWLA 2EFGA 3WBZA 5KFXA 4FXDA 4C3KA 4RUHA 3UR0A 2VA2A 1TAQA 2ZD1B 3MUMP 2VKRA 1RT2A 4TU8A 1LQ9A 2VONA 2CVEA 3M8PA 4A8OA 1XR5A 2RQCA 1T03B 2ZJQQ 3DRPB 4DG1A 2YKPA 3PO4A 2IVFB 2N4DA 1K8AT 4KQZA 3IR7B 1KVJA 2YX1A 4L6V3 5KT7A 1WG5A 3SQGB 5MLCV 1VRTB 3C6UB 4BWMA 4G1QA 1N5QA 4X4SA 4CO0A 1FK9A 4CQ1A 4ATNA 3VCDA 3T5HA 3PZPA 3PV8A 1UETA 4QIWD 1LWFB 3BF4A 2F3JA 2RIJA 5DQGA 1DFDA 3H4BA 4OHYA 2WB1D 3CJKA 5K14A 2R2UA 1LXJA 2AJ1A 2KRBA 1IJEB 1FERA 5AXNA 3MEEB 1X8DA 2V8VA 4JI7F 3R5CA 1UVLA 4ZVFA 5AE2A 3OR2A 4Y3CA 5KFEA 5DLFA 1NK7A 2E9TA 4X4PA 2UU9F 5BYSA 2IAJA 3NCPA 3VWSA 2E7XA 2PMZD 4O44B 1LW2A 3RR7A 2DGWA 3ISNC 1ZAWA 2LCWA 1XNQF 1WHWA 4F02A 4N8OA 1DRZA 3SFUA 1A6LA 5GAGU 4F3OA 3H5UA 2NUHA 1T8EA 5EWFA 3THTA 4EYHB 4NYOA 2GX8A 4WKYA 1S0VA 2VFTA 1RKJA 3TAMB 4HDHA 3QLHB 5GADI 1AXQA 3CJ0A 3KJVA 5I4MA 4NLRA 2MY8A 2JEIA 4GMKA 5LMNF 5HROA 1IKYA 1AROP 3KHGA 2XY6A 2B4UA 5CYQA 3RBEA 3SCKE 4K4WA 2MKJA 3MOJB 2LQ9A 5EX0A 3PFOA 1QUVA 2G9OA 3D0GE 1U6BA 4DR3F 1YGYA 4X62F 2BZ2A 4ELVA 2DNRA 1X9MA 3WC2A 2LXFA 2QE5A 5T14A 3L7PA 4LF6F 5CYMB 4C8KA 3CCSS 3MOZA 5AJ3F 4EEYA 4RW8A 3IN5A 4CNYA 2IBOA 1MWYA 3T1AA 5FLXY 1D8ZA 3U1LA 3GR0A 4ED5A 2UXBF 2ZM6F 2AU0A 2P6TA 4QPXA 2PE8A 4ZPVR 2R2TA 1HI8A 2JVOA 2PC6A 5C42B 2WSCC 4B9VA 4H4OA 1YRTA 4D3HA 1S9FA 3KNAA 2FUG9 3I56S 2M3DA 2YWHA 2F1FA 3IG1B 1KFSA 1R8BA 5HBMA 4FZVA 1C2PA 3EZ5A 4MFBA 3W2VA 2XS5A 4B9LA 3LP2B 4HLBA 4LF8F 2FIUA 3RRGA 3UW1A 3PJWA 4Q2LA 2UV8A 4CIOA 4ED8A 3TI0A 2VG5A 3DOMA 2DCLA 3K5MA 4MYUA 4QWBA 2DNHA 3JSMB 3MEDB 4OX7A 1X4AA 1R89A 4ECUA 2X1AA 1M5PC 2E5LF 3I5BA 4DMZA 1SL2A 2C3UA 1J5EF 3PW7A 1FO1A 3BZQA 3M6UA 2ZZMA 4PQUB 3IR6B 1SL0A 3C46A 5KFSA 3OV7A 2Q6CA 1XTZA 3CB4A 2IC3A 1RT3A 1KEKA 4WYLA 1CG2A 2EVZA 1N5SA 3JTPA 5IT0A 1U45A 4KE5A 3CD6S 5DQIA 5I3UB 4FF1A 3CDUA 3SQGA 3PW4A 4QR1A 3MDFA 5KT5A 3PW5A 3TA2A 1U1RA 2DTJA 3VAMA 2RUGA 4P7VA 1LWFA 2GO8A 4ECSA 3K58A 1LOUA 3T3FA 2L3MA 3NLCA 5CD4H 1X4CA 4LVOP 4PR6A 3S8SA 2NSCA 2Q79A 4FN5A 2LYVA 5BJRA 3OFGA 1DTQA 1GXTA 2FJWA 3LOUA 3DN9A 2E9ZA 3GYNA 2PFFB 1QTMA 1S1XB 4NLUA 4O44A 3PO5A 3A8EA 3BQ0A 2O66A 2XNQA 2ZE2B 3CCWA 4KBIA 4ETXA 2I9SA 1JLEB 1JXEA 1D3WA 3P3DA 5F9LA 2AP6A 2L9NA 2ZBCA 1RP5A 1G3OA 1TL4A 2VG7B 3TNVA 2O3DA 2K7KA 3TAMA 3QLHA 2OLWA 2HPUA 2W9AA 5CA5A 4DV0F 3G8SA 2LXUA 1Q79A 3M6WA 2E1CA 1RK8A 4HTIA 4YUDA 2KG1A 5F41A 4K4YA 1O8BA 2M0GB 2XWXA 4KR0B 4YFUA 1QAJA 4P6QA 4MAKA 2R7VA 3DLEA 1WF2A 3HX9A 3MMCB 4H54A 4F8RA 2LDIA 3SCIE 2R7XA 2HHTA 2V0NA 3EPGA 1OIAA 3IRWP 5CYMA 2V9KA 4ZPAA 3NAHA 3QGIA 2A18A 1HW9A 3IA0A 2AYEA 2VD3A 4B9NA 1N48A 4D3GA 5EN1A 3MFHA 2LLZA 2HHUA 2JC1A 3ITHB 4OFZA 4ED2A 3DRSA 1OPZA 3B4DA 3R5AA 4NLGA 4CTAB 4RZRA 3G8QA 2UVUA 2FVCA 3QO9B 1TK0A 1GAOA 5E33A 2HGNA 2AYMA 3CD7A 3MGJA 4ES3A 5IS2A 2VASA 3CJ5A 5IZHA 3IG1A 5EX3A 1M5SA 2XMTA 3DYAB 3K5PA 2BE2B 3R5BA 3UFCX 4EBCA 2LU1A 3IS9A 2AV5A 2JVRA 3N4WA 3LP2A 4QIGA 1EETA 3PW0A 4R0EA 4RWXA 1SB6A 4K2XA 2EFVA 4EFAC 1VMBA 4N47A 4M95A 4C8ZA 3K5LA 1KQKA 5IM0A 2MKKA 2XCAA 3KLHB 2B4PA 4M5DB 4TQRA 2KZMA 1DTTB 3MEDA 4HI2A 4P2SA 4X65F 4J9PA 4X4OA 1VC0A 3OVBA 1D1UA 3OL8A 3U1NA 3RRHA 4PQUA 3LP1B 2FGCA 1MMDA 4QR2A 4Y6IA 4IO1A 4IO9Q 3SV3A 2UVRA 2XO7A 2CVIA 4Y28C 4O3NA 2MQMA 3TR5A 2F8MA 3TYTA 4X4NA 4O4RA 3POTB 5I3UA 4FVMA 1YVFA 4X66F 3ENWA 5KT4A 3VQTA 2C2RA 3NBPA 5EWGA 3DI6B 3ICLA 3IGVA 3FSXA 2BRLA 4FF4A 3MAHA 3Q2TC 1UEVA 2H5EA 3AHPA 2RRAA 5KFQA 2CPHA 3PVXA 3QIDA 4HEA9 5B0EA 1SH3A 4X84A 1HWUA 3QJLA 2OKQA 2VPYB 4ZP6A 3VQSA 1UA0A 3CJ2A 1TL3B 3P6YC 1CLFA 3RRKA 5BR8F 2KT3A 2ZBIA 4F3QA 2K8GA 4PWUA 1S1XA 3HXMA 2MQQA 2B7CB 4I6WA 2J7WA 3GQCA 4OLPA 4ZS6A 5KFAA 3M2UA 1JLEA 1WI8A 3H5XA 3UCZP 4K4TA 2CQDA 1VQSA 3MM5B 3U02A 3AQOA 1E6VB 4EBDA 4FP9A 4RU2A 2HVIA 3UWTA 2O67A 2B0GA 2A2CA 1HNVB 3IGNA 3M8QB 3N5BA 4B08A 1KOOA 1O5JA 2BQRA 3UCGA 2C3MA 4ZCLA 5GAEI 3MZIA 2AJ0A 2DH7A 2DNKA 1U2RA 4K5RA 1GX5A 3W3SA 2ASDA 5I3QA 2FJVA 1Y4ZB 2A10A 2WTFA 2V4QA 3WC0A 2JFDA 1M5OC 3LPYA 1PSDA 3R1LA 2IRXA 4IG0B 3ISZA 3MAQA 2XB2D 2DIVA 4WXOA 2LECA 3DOKA 2GHPA 3DGPA 2YQ3A 1Z2LA 1B0TA 1M1KT 2E5JA 3OPKA 4F4WA 3ULHA 3ITHA 3B8HA 2QFJA 1X4DA 4CTAA 1TL5A 4ZPCA 2GGPB 1NK4A 2LU2A 4JV2A 2MPUA 3G8TA 2OPQB 2VPXB 2MSTA 5DETA 3DC2A 2DHAA 3TVKA 2I5JA 1H3DA 2ALZA 4NLDA 1NHVA 4OHWA 3OFFA 1APSA 4AUKA 1XMBA 1HQUB 4Q43A 1JKHA 4FXVA 2IA0A 1SIWB 2DH9A 3GILA 3K59A 2VUGA 4A8XA 3CD5A 3BGRB 2M4MA 1FD8A 2RMLA 5LL6d 3H2LA 2GO9A 3KLHA 4ED3A 4IFVB 1DTTA 1P6TA 5E3QA 1N5YB 4F2RA 3CDEA 3M6VA