1N32F

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n32F00
4LF5F 4JI3F 1XMQF 4JI2F 2KJWA 1FKAF 1N34F 4LF8F 4LFAF 4DV6F 1HR0F 1XNRF 2ZM6F 2J5AA 4DR7F 4B3RF 3R3TA 4B3MF 4DV0F 1RISA 4DV2F 1VMBA 1IBKF 1B64A 2YY3A 1XNQF 1XMOF 2UXBF 1N32F 5IWAF 2UUAF 1HNWF 1IJEB 1G1XA 4DR5F 1LOUA 4LFCF 4DR2F 1CQMA 4JI4F 1CQNA 1FJGF 1N36F 2B7CB 1N33F 3OTOF 4KHPF 4JV5F 4YHHF 5LMNF 4JI5F 4K0KF 4DR3F 2VQEF 4DV4F 4GKJF 3T1YF 4X64F 2UUCF 2UU9F 4JI0F 4NXNF 2UXDF 2BVZA 4OX9F 4B3TF 4LF4F 4DUYF 2E5LF 4DR1F 2UXCF 4GKKF 4X66F 1IJFB 1HNXF 4DV5F 1J5EF 1G7CB 3ZZPA 4LF6F 1QJHA 2UUBF 1GH8A 4DV3F 4AQYF 4JI6F 4DR4F 4X62F 4JI1F 4LFBF 4DUZF 2BXJA 2RJZA 4B3SF 4LF9F 2B7BB 2F4VF 5LMUF 4DV1F 4NXMF 4JI8F 4JYAF 1F60B 5AJ3F 1IBMF 4X65F 1I94F 2KJVA 3T1HF 4DV7F 4JI7F 5BR8F 1IBLF 4LF7F 4DR6F 4YY3F 2VQFF 2HHHF 1HNZF
chains in the Genus database with same CATH superfamily
1ZM2A 4FPRA 3EPIA 2ZH4A 4BBYA 1JQGA 4K50A 3N5BA 2DEIA 4ECVA 1TKZA 3PX6A 3CCZA 2Y8YA 1CLFA 1FCAA 3A3OB 3PDNA 3CCRS 1FKPB 2Y0BB 3MUMP 3CMQA 4ZJOA 3EICA 4ZLJA 3CJTA 3RB0A 3R7SB 3GIIA 3SCLE 3H90A 3OT9A 5DZ6A 1KVIA 5CAAA 4X84A 2UU9F 4P2SA 5KFVA 2V9KA 2CQCA 3D1QA 2MKHA 4P72A 2AIRB 4USMA 2VF3A 1SUQA 2BJ7A 2E1MC 1TKZB 2YWHA 3HHKA 1SJ3P 4ED1A 3L7PA 3DI6A 2HBYB 2DJWA 3PACA 3UW1A 1Y4ZB 1FE4A 5DG7A 4LF7J 4YY3F 1L3KA 2IM3A 2W4PA 1SQEA 2DO0A 5D4OA 4URSA 1WEZA 2VICA 4RNFA 1NK4A 2VKRA 3SFUA 5L9NA 1FEHA 4ZMMA 5B0GA 1TUVA 1SUQB 4M5GA 3RGIA 2ZH7A 4CO5A 2F8MA 3VHQA 2IC3A 2OGUA 2HBRB 3DI6B 4KB7A 3DDKA 2FC9A 2WK4A 5KFSA 2DIVA 3I56S 3IP0A 3EXYA 1UVMA 4ZCMA 3OLAA 2ZC3A 1E6VA 1KOOA 3OR2B 2HAIA 1Z4UA 3IRWP 5ETRA 3TWZA 2XY5A 3G2XA 2IC3B 4DPYA 4LF9F 1T7PA 3UNYA 4K4VA 3EJMA 3N5FA 3AQOA 1QY7A 4FYVB 1XEZA 4NYOA 1F3FA 1KHWA 3OSNA 3FJ2A 5BXIA 3UPFA 1RAIB 2FHOB 3QAUA 1FRJA 2Z30B 2MEWA 1E6VB 2QFIA 3GU0A 3HT0A 4W4MA 4KQZA 2FJXA 4NA1A 2FPHX 4DSIA 5EWGA 2ZJRQ 4NLXA 3RJMB 1VFJA 1VQ6S 2KDOA 3JSBA 3VAKA 3M8ZA 1NB2A 4DR2F 2GA7A 4DLEA 3D9BA 2VFVA 2ZJPQ 1ZTTA 5D6GA 3DN9A 4YB7A 2X1GA 3NKYA 4OYOA 1JXVA 4JI0J 1LWFA 2X1FA 1BWVA 3R7BB 5KFHA 1U49A 2LP4A 1TKXA 3PHEA 2VOOA 2BR0A 3E51A 3TEHB 3OL9A 4LREA 1X9SA 3MR6A 2J7WA 1FVSA 3W3SA 3UCUP 3HD2A 5ETKA 4K5RA 3NGUA 1HBMA 3SZ2A 3FK4A 1TTHB 2PFFB 2E9RX 5A76A 3ETOA 2H5JB 1NK5A 5I4MA 2G0IA 2VONA 4CLUA 3W8PA 1S12A 1LWFB 4IO9Q 5IXUA 2YWWA 3CULA 2XULA 3W9HA 3QAEA 1QSSA 4NEZA 5GVQA 3DRSA 2KYZA 3K57A 3CD7A 1XMQJ 2OPSB 1HBMB 3IS9A 1LOUA 1RLDA 5ETTA 2RDIA 3VQTA 3DLLQ 4ZPAA 2ILYA 3SV3A 2B4PA 2UXCF 3H5YA 2BYCA 4ZP6A 4G1PA 1N56A 1QJHA 3IWLA 3E01B 3DRSB 4AE5A 2J8AA 1SKRA 2GMHA 3BKFA 3TX0A 4A8FA 3IS9B 1HQUA 2IJRA 1WD6A 4YFUA 2AW0A 1FA0A 4L73A 5DQGA 1WOPA 3MAHA 5KFCA 1UCNA 3KG0A 3AD7C 5AXNA 3JSMA 3RZAA 4JI3F 2ATLA 3HSZA 4I6AA 2WW8A 1S7IA 2F63A 2RNEA 2D9OA 3Q8SB 1N0VC 3CCWA 4FXVA 5IV3A 4ZCLA 3UVJA 2ZOGA 3OFFA 3UN5A 1XNRJ 1GMVA 2MDAA 1HQUB 3PYEA 1Q8BA 4ZVSB 4DR3F 2GVDA 5KFJA 3MTJA 3JSMB 2HHPA 4PKDB 3EVMA 4MJKA 2GJ2A 4DLGA 3TQ1A 2VODA 2QE5A 3H5SA 5LMNJ 4OFZA 3M9OB 4PWDA 2CXEA 3UVJB 5DG9A 3CD0A 3K5MA 2YH0A 8ATCB 4FBTA 4LF7F 4Y65A 5DM7Q 2QSFA 4QOTA 1XJWB 3Q8UA 1NJWA 4E8UA 4PYDA 2GVDB 2YPYA 1EZZB 1RLCL 4DUZJ 3K58A 3GR1A 3JB9k 3L9ZA 3R5DA 4B9LA 2DNPA 4C8MA 2AGOA 4M5KA 1FJCA 3NGTA 2WSCC 4HEA9 3TVYA 2OD4A 4PWDB 4NLWA 1N32J 2VFRA 4LR9A 3D3BJ 3CC2S 4MYUA 3KKFA 3NLCA 4KRWA 3GV7B 4P2MA 5E2QA 2E5JA 3CD5A 2UXBJ 1QDUB 2HVDA 2FVRA 2NZ4A 5KT7A 1SCJB 3TZYA 4CLYA 1NEEA 2HYIB 2RDJA 1SQGA 2H1YA 4LJMA 1HBUA 1ELOA 3TANA 2V50A 5D4PA 2FZGB 5AT1B 2Y1LB 2E1PA 1UW4A 2G2ZA 2V4QA 2HK2A 3ZZOA 4LSLA 4DV6F 3WHIA 1KSPA 4DV1J 3BO2A 2ROEA 4ZVRB 1D09B 2XSJA 2WW4A 5E3QA 4USJC 1T0TV 4TXSA 5KT4A 3BO3A 3JS9A 4NLTA 3SV4A 3M6WA 2A6MA 4IQMA 1HBUB 3C16A 2WAQD 3RB4A 3K0JA 3KDOA 4KFBA 1AFJA 2G13A 2Z2MA 1TL5A 2BACA 2P8IA 4JI0F 2O67A 2IA6A 1UWBA 2AYGA 1DLOB 4LSLB 3OTDA 5LXRA 2Z4PA 2AGQA 4DCOB 4O3PA 4X4UA 3F0NA 3J7Z5 2XSJB 2L08A 5J1NA 1TL7A 2Z56B 3DYAA 1FRMA 4I0WA 1U1MA 1H7WA 2RRBA 2VG6A 3C16B 4WJBA 3CWJA 1IBLJ 3A3PB 1U47A 4KFBB 2JC1A 2XZDB 3PX4A 2GHVC 1FRXA 1JNZB 5D77A 1K0VA 4KH0B 3H2LA 1H72C 2WZ1A 4A8OA 1XK8A 1UWBB 3ELHA 2EFNA 2J76E 1S48A 4KH1B 3TRGA 1BXNA 4K4SA 4RBVA 2C3UA 1GXUA 1TL7B 4K8RA 3DYAB 5AE2A 1F2GA 4U9RA 5CA5A 2VG6B 4WYWA 4DR7J 1WWHA 1UL3A 4FS1A 4CO1A 1VQ8S 2HWTA 5F3ZA 2N3OA 1PYTA 1VHIA 3RRGA 3F44A 3ZTQA 2IJNA 2LDIA 1U0HA 4J9LA 2NREA 2BA9A 4ZVOB 3GR0A 1OSCA 2D7SA 3IBCB 2K3KA 2J6TA 1RBOB 3UI3A 3R5JB 3DLGA 3I4PA 1UVKA 1FDAA 4B3TJ 3MCMA 4Q8FA 1T9UA 5HJYA 2BJEA 1YZ6A 2O5DA 2MY8A 2OPPA 3AB2B 3HZGA 4CM2A 2DGWA 3PO4A 3FBCA 3NY0A 1QLNA 3DOKA 2QLFB 1U0HB 2KRRA 1XR6A 3CIMA 1S49A 4DS4A 4YDXA 2MTLA 4BCAA 2DNGA 3MM7A 1UA1A 2XEXA 4RW7A 4TQSA 3DLGB 4DR5F 2Y8WA 3GIRA 4AXJA 1XERA 4OX8A 1GEHA 2EK1A 2OPPB 2OSQA 4J9VA 3PFEA 3M7VA 4HKQA 3SCJE 4MYTA 2FD2A 2WBMA 3DOKB 2HQDA 8RUCA 2V4JA 2CPFA 4ECSA 4Y2AA 3R27A 3IGVA 2J0SD 1HHQA 3RR7A 1FKOA 3MM7B 4RW7B 2FHJD 2N4CA 1KLNA 4CLFA 1VQ5S 4NI2A 4I68A 3KLHA 1PYOB 1K1QA 1J5EJ 3EZUA 4JOUA 4MKYA 1WI8A 1XTZA 1TFWA 3OFEA 3L7OA 4J91A 3CMES 2DHHA 1C0TA 1BWEA 1KD1T 2DPIA 3G8QA 4ER8A 2A2DA 1HR0F 1LWEA 2XI2A 2V4JB 4CLSA 1Z1ZA 5GAHU 1H74A 4MKVA 1RZMA 2MKCA 1SH2A 4CQ1A 3KK1A 4PG4A 1FKOB 3PEJA 3FDSA 1N32F 3QZ7A 4NI2B 2C2EA 3KLHB 3I9V9 1Y10A 4JV5J 2ZNZA 3HFVA 2HWIA 1IM4A 2M4MA 3OW2R 1KOHA 1RDRA 2DTJA 4ZIWA 2DR9A 4NXNF 1C0TB 5FDLA 3M4XA 3LAMA 4ZKAA 1LWEB 2YXLA 2QRRA 2HIYA 4Q44A 5ITHA 1FT8A 3BBBA 2HHUA 3NAIA 3MFHA 3KK1B 4DEZA 4U8VA 5LMUF 3UDCA 3J7A1 5AJ3J 3LA0A 5HO4A 1JLBA 4ZVEA 3LP0A 3HHLC 4DSKA 2CQ2A 2W8KA 3RUBL 5GMEA 2ABYA 1EQMA 5FDLB 2F4VJ 4PRFA 1RT6A 3D5MA 5DGAA 4TN2A 1SB6A 2YX7A 3ISZA 4B3MF 4P10A 4C3MA 4DR6J 4KT0C 2CNLB 3QBCA 4LRBA 4JI2J 1DURA 2CDRB 1REVA 2UVRA 3D0GE 2KXHA 1JLBB 4M8LA 2K7JA 1H2TZ 2IIHA 3T6JA 1G6BA 4V1Ak 3OD2A 4RWXA 1ZM3A 4MIWA 2QYCA 1RT6B 4F4WA 4TQRA 4OI6A 5C24A 2AX0A 3GCWP 4OZ3A 4PXEA 1F5AA 5JJBA 3K2YA 1LW2B 4HVZA 1REVB 4RO0A 3I0SA 1S10A 2BRKA 1IBLF 2CDQA 3RW7A 1T9TA 4KO0A 3MCSA 4Y2CA 2LXFA 4RU2A 4AQYJ 2KT5A 2QL5B 2Q6BA 4RUCA 3GSDA 4IUFA 1JX4A 5LOQA 4LSZB 2DKOB 4X4PA 2DCUB 1I94J 3EGNA 4OZ0A 4EI2A 5C24B 3FFIA 2KI2A 1ZZNA 2JC0A 4XAKA 2B56A 2B9YA 4IOCQ 5SUHA 3TUJC 1RKJA 3I0SB 4QIWD 4JI5F 4KO0B 1I3OB 2C1EB 4DV4F 2PA8D 3T1YF 4QYZK 2ZEJA 4IFYA 1TR0A 2MMYA 3NEKA 3H5XA 1P27B 5E3RA 4B17A 4O23A 2KN4A 1NK8A 1NXIA 3FFIB 4UOHA 1YDLA 1S99A 2XCAA 5DQHA 1RAHB 1CJUA 2VBYA 2YNFA 4LRDA 4IRCA 4DQIA 3P5BP 2I8EA 2A18A 3CJ0A 1TMMA 1Q79A 1RJJA 4S0MA 1N5VA 5F8IA 4WF9Q 3UD4P 1M1HA 2D74B 1RTJA 4KGKA 2R8GA 2E44A 3EDRB 3FSIA 2VQFJ 3FCHA 3BGRA 4HT5A 1CJUB 2YNFB 1S76D 2HSEB 3OFHA 2ZM6J 3M1VA 3UDVA 2EFQA 1ZA2B 3MD3A 1P6TA 1DQ8A 3M2RA 4CI0B 4G1QA 4OIXA 4LF4F 1RTJB 2JEGA 2MLYA 1Y11A 1I5OB 4JBCA 3AA9A 2W2QP 2JSXA 4ZVPB 3UD3P 2UV8G 3BO4A 4DPUA 4DFPA 2BJ3A 2W2NP 1OSDA 3A13A 1RHJB 1UWAA 1RSCA 2J6SA 2YPZA 3IN5A 3BGRB 4JYAF 1TFYA 3PJXA 5LJ3Y 4GVBA 1YJUA 3M1VB 3A8KA 1HI0P 2CZ9A 3MEKA 1P1LA 3MECA 3M2RB 5LM7E 4WFAQ 1U48A 2YTCA 4ZOSA 4G1QB 3QT8A 1M5PC 1NB7A 2VASA 3FVYA 5EWEA 1Y0HA 2PFDA 4I4BA 4GMKA 3ZZRA 3QYYA 1YBAA 2HAFA 5J1EA 3PW5A 3OLBA 3KG4A 2C42A 5CYJA 2ZH5A 3LALA 5D0EA 4RW6A 2LA4A 4GVBB 1UZDA 1X9MA 4JV5F 3CJ2A 2OMOA 4L3KA 9ATCB 4ED3A 3PXGa 3MECB 1KC8T 5H9FJ 1RXOB 4FYXB 2UVWA 3NS7B 2CADA 1ICEB 5F0UA 2BANA 1UPMB 5A8WA 2HQCA 4LIWA 3CJ4A 2VPYB 4RBTA 1UJ4A 3FBBA 2L9WA 4FS2A 4KGXB 5IFMA 4TYBA 1RHRB 1NSPA 4F02A 1FEEA 3LWMA 5J1EB 5KT6A 3PW7A 1SVDA 3VVTA 5AJ3F 3LP2A 1TELA 5BR8F 4RW6B 5IV4A 4DX6A 4RL1A 2EPIA 4M5IA 2VH7A 2GC8A 1HWUA 1VQSA 1AUDA 2RIJA 4NLDA 1FHTA 2KJWA 1SXLA 2B0GA 2VDIA 4Z7CA 4KHRA 1WI6A 2B4OA 3DDNA 4ZVQB 2BANB 5HVGA 5A8WB 2O01C 2MGZA 2G4BA 4KPYA 3TVZA 2GVZA 4A8WA 3BSAA 2DXDA 4KPCA 1AA1B 3H5UA 1DARA 1CQNA 3WC2A 3LP2B 2EBEA 2FLLA 1UJ6A 3VGSA 2IVYA 3A8JA 1OY6A 3GYGA 1S59A 1VQKS 3Q8VA 1IWGA 1RGVA 3AJ2A 3UCZP 5IC6B 1HNXJ 3TAPA 2XZWA 4OJHA 2MGZB 2FYXA 3LPYA 4BC9A 1JIHA 3KLEA 2GVZB 3MPDA 3R8YA 4CLZA 2ZBIA 3V6JA 4KY3A 4NYPA 4Y0FA 5AE3A 3UN3A 5J2PA 2BE2A 2DR5A 2C2KB 2ZITA 1TMJA 5L9XA 4IDKA 2IMWP 1RTIA 3LAKA 4XTTA 2ROGA 1C0UA 3T6BA 2MQMA 4OI4A 5IT9U 5MAOA 1Q81T 1S57A 3THVA 1IR2A 5L1KA 2RRAA 3RRHA 4RZRA 1LEOA 4A8SA 4USTA 2QEXS 1WHYA 2GMLA 3KLEB 2HS3A 4OX7A 3GE9A 1C1CA 1FTRA 3V5RA 4LFCF 2E1CA 4XDCA 3R9LA 1HMVA 5J2PB 2BE2B 4KHPF 3N6MA 2BDPA 3NWGA 4C3LA 1V3ZA 4IDKB 1N88A 1RTIB 3CB4A 2JEFA 5A6PA 1C0UB 1OS5A 4KR0B 3BN4A 1UFKA 1EKSA 1B3TA 2MZRA 3ZC4A 4K4YA 2XMMA 4HH1A 1QTMA 3P6YC 3GP9A 5H1SV 3GILA 2IVMA 4CH0S 2FLNA 3VGUA 2HQFA 4M5MA 1C1CB 1FNOA 3QRRA 2P9GA 1VQMS 3SBMA 3CO9A 1HMVB 3NGDA 1UP1A 4ELUA 2C22A 4DN9A 1J5OB 2VJVA 2VDHA 4H4KC 3C15A 2C28A 3R7NB 3PHTA 4BS2A 1Q7LB 1NDPA 3UDEA 4DV0J 2OH2A 2DR8A 1LXJA 4CNZA 2DNOA 3HVTA 4C6AA 1YQHA 2CPEA 4DPOA 1R8BA 3CCTA 2CJQA 2CQHA 2XB2D 2HNYA 5BYRA 3P4UB 4LFAJ 2HFSA 3CJSA 1JJ4A 1R0BG 2YBVA 4CLPA 1RT1A 3GV5B 2V69A 2HQGA 4HI2A 3D0IE 2BKPA 3C15B 4DZ6A 6FD1A 2U1AA 2OUGA 4N76A 1C1BA 1HWJA 1QAYA 5FLXY 4ZLPA 1WG5A 1GH8A 4G1IA 4CH7A 3HVTB 3T5LA 4IKAA 4USVA 5C42A 5U47A 4MK9A 4DFMA 2XNQA 2HNYB 2XSFA 2N7YA 1RT3A 3IAM9 1NAQA 3NNHA 1RT1B 2XQCA 3DOMA 2XGQA 1YG0A 1B70B 1WF2A 2AYBA 1KVKA 1C1BB 1X4AA 2J6UA 2H65B 2CQIA 1YJ7A 2FVPA 4OYXA 4OX6A 3ADAC 2EKYA 1HWKA 2W8LA 3ISNC 5C42B 4N56A 1OJ4A 4DOZA 1RT3B 2MKJA 3GIMA 5HQMA 1TK0A 2Z2YB 3PVXA 1ZAWA 1REGX 3DOMB 4BWJA 2QG9B 1S0NA 1UEKA 3VR1A 4C8YA 2QJ3A 1HA1A 1UFLA 5GAEU 4RW9A 1QD1A 2LQ5A 5FLXU 2IFXA 1GXLA 3DLHA 2MLXA 2BW2A 3CSKA 2AWZA 2OI2A 3KNGA 3NGSA 3K7RA 4WTYA 3ISND 3UN2A 4W98A 4WXWA 2CRLA 4DXLA 2KJVA 1TK8A 2FIUA 4I56A 4QIEA 4X4TA 3LOUA 3G6XA 1JJHA 2CZVC 1VQ7S 5B0BA 3MZIA 5DETA 4Q2LA 2J7KA 3D1HA 3ZO7A 3HKWA 4ZIVA 4CO4A 3Q22A 3GYXB 4RW9B 4UF4A 4FF2A 4J9OA 3HKZD 4ZP9A 2Q43A 5KFIA 3DRPA 2R7SA 1X7VA 3MMBA 2QFJA 2XMWA 1KQGB 2FGCA 1PO6A 2CVEA 2G2OA 1IR0A 1KEKA 1RWKB 3QT6A 2XBPA 4YDDB 4DV2J 2HHSA 3AD8C 2CJXB 1XBWA 4X64J 4KC5A 1DQAA 2OMLA 5KG6A 3IM8A 2MPUA 4OX9F 1HNXF 2E29A 1S97A 4CCHA 1KQSR 1AT1B 4ZK7M 3KHLA 4DR4F 3DRPB 1NZAA 3AJ1A 4X4OA 3MMBB 3CCLS 4FYDA 3KMQA 1RA7A 1UVJA 1Q7YT 3TUZC 3TVKA 2YWFA 5FIIA 5J2QA 1Y5NB 4OYMA 1PJ7A 5HMZA 2C2DA 4J9PA 3BV8A 4J9NA 4ELVA 4EBDA 2CQ4A 1A6LA 1NM2A 5F9NA 3JTPA 5LSRA 1YRTA 4EZ9A 3KHHA 4ECQA 2VQEF 1I51B 1U45A 1S6UA 5HATA 2HVHA 2P6TA 2YKMB 5J2QB 4NLPA 4EMDA 4HH0A 3G8TA 2OIHA 2LXUA 1TUGB 4P7VA 1EP4A 3HHLA 2HWHA 3QZ8A 3ZZYA 2POKA 1RTHA 1NSKL 1H73A 4WK1A 4WFYA 1S6OA 1D9FA 3F56A 4DV7F 2V94A 3QIDA 5A8KA 3T1AA 1U2CA 1AROP 3PW4A 3IGNA 4FF1A 4ELTA 3PR5B 3OFGA 2OEMA 5K9FA 3BH6B 2FLOA 2PIIA 2CG4A 2HRYA 2QA1A 4DV0F 4AYBD 4KGZB 1VR6A 2HFVA 2ADBA 1R3NA 2MSSA 4Y2IA 3AB4B 1EP4B 3RR8A 1WEYA 3HHLB 1XIQA 3CGIA 5ADZA 3HP6A 2HBQB 3VCDA 1FJGF 1PG5B 3LWLA 4G6VB 5A8KB 3B6BA 4I64A 4NZ0A 1E6YA 1L3VA 2K06A 4ILMA 4L3NA 5KFNA 2Q3PA 3MPUB 4MH8A 3MDFA 3TJAA 1V3RA 2E1RA 3VTIA 4ANDA 4NPOA 3DNCA 3TNVA 4C48A 4C8KA 4XK8C 2F8HA 3POTA 4L76A 3G86A 4FPIA 4KAIA 2YKAA 1NZ8A 2ZOMA 3CO0P 1E6YB 1DTTA 2YWEA 2OEKA 2VBXA 3W5YA 1S1TA 2RF2A 3TP2A 4B9UA 3TAMB 1TP7A 4OZ5A 1HNZJ 1K47A 4LF5J 2KVQE 1WG1A 5ETVA 1NHVA 3CCMS 4JI4F 2XMJA 2CQBA 3POTB 1T8EA 4JV2A 2AZ1A 4UT4A 2WVDA 1VJWA 1TAQA 2CWKA 1WC1A 4IH5A 2K8GA 2BVZA 2WOMA 1DTTB 4J9SA 3D2WA 2LLZA 1FX4A 3Q23A 1S1TB 5H9EK 3EDQB 3KWMA 2HW3A 3ZTSA 2RF2B 4P2XA 2DGVA 1IKVA 4FKXA 3QJPA 4DSLA 2H9ZA 2DNNA 3JQMA 1L5UA 3FZBA 3W9IA 2DISA 2QLWA 2L48A 2CUYA 2WOMB 3M8SA 4A48A 2XTJP 4B9VA 3LGNA 2K2PA 5B0CA 2HHHJ 2V8GA 2OLWA 1IKVB 4DF4A 1HI1A 3US5A 3FEYB 4ZJLA 2WVFA 4LF8J 1WEXA 2MZTA 5DZ7A 2DPJA 2OAUA 4UQTA 3BGUA 4X64F 1Z2ZA 4M95A 1FRKA 3E3XA 3T3FA 4OZLA 3QGHA 5D78A 2D3UA 4OZ2A 1KRPA 1B7FA 3FQLA 2CFXA 1VS3A 1ZS6A 6AT1B 2V2QA 3IXQA 2FDNA 1F60B 2QMUB 4X65F 1HHTP 2ASYA 3DFEA 4ES2A 1S0OA 1BQNB 2UUBJ 3BSCA 4EO8A 1U1OA 4JI1J 1YSJA 1MG7A 1OO0B 5I42A 1R8CA 2MKSA 3DXBA 2GX8A 5ETMA 2HLUA 2HHXA 4F2RA 1JLGA 4J90A 2ZDOA 4L6V3 1WF0A 1U1PA 4V19J 4L74A 5CD4A 3R2DJ 2RAQA 2R42A 4URGA 2MZ1A 1MN9A 1N33F 2IY5B 3KUEA 2LECA 4JP8A 4DUTA 3TW0A 1PGZA 2AEJA 1T03A 2PGCA 5I42B 5E3PA 3MMAB 1WSRA 4BC7A 3C14A 3OTOJ 4CDIA 1JLGB 2W4DA 2DHSA 5IT0A 1SJRA 2J8SA 2ZHOA 3CDEA 4RNMA 2JDJA 2W2PP 3FUYA 1RYRA 1Y00A 1RT2A 2B4VA 1QAIA 2UVVA 1NNDA 1CJVA 2HS4A 1T03B 1ITPA 4DL0C 4CTAA 1RWOB 4CWBA 1WC5A 4QPTA 3LGMA 1PIEA 2ZBRA 4DPWA 3C14B 1NH7A 2W2OP 1MWQA 3WQPA 4TY9A 5L1IA 2KTQA 2CJBA 4ERDA 2FVCA 1S0MA 1O5JA 1LWCA 1W2IA 3QJLA 2O3DA 2RQMA 1RAAB 1DFDA 2B8PA 2MKIA 3AAWB 2J0WA 1U0SA 2EWHA 2KT3A 3NBPA 3FCVA 1QAJA 2I2YA 1RT2B 3TJ9A 1EARA 2MQLA 4Q5VA 3DLEA 1CJVB 4CTAB 1O0PA 5IS2A 2ASJA 1GNKA 3UCGA 5I3PA 1XN9A 1S77D 5CQGA 1YJWS 2RS2A 4WPAA 3H7HB 4LFBF 2DR6A 5KFEA 4B3SF 2NYHA 3AD9C 2A0FB 1LWCB 3W5XA 3VQSA 4OYBA 2A6OA 1IQTA 4J9KA 2JZ5A 1IKYA 1UPPA 2MQOA 4N8NA 3NBPB 3PYDA 5DS7A 3S01A 3DLEB 4OZNA 5D0RA 2XY6A 1N6QA 1RK8A 4EBEA 3HCXA 3A1YG 2FJDB 2DCLA 4A8KA 1LK7A 4Y2MA 3CCQS 1TL1A 5LJ5Y 1Q1KA 4ED0A 2CYYA 2ATCB 3W66A 3H2VE 1DHMA 4RLEA 4LR8A 1SIWB 1FERA 1WDDA 5HI7A 1TQLA 1IKYB 1WC3A 3HHNB 2YNGA 5GAEI 3TEGA 5KFQA 1SC3B 4I6YA 2DHGA 4NMLA 5HP1A 2UXDJ 2EVZA 4UQGA 4DUYF 1S9FA 4DR1F 2P5VA 2E5LF 1JXEA 2V0NA 1N6QB 2PC6A 3DM2A 3N6LA 2C3PA 4J7CA 4RR5A 2VA2A 3GJRB 3WX8A 5K8MA 2XYPB 3MCOA 4DG1A 5D4LA 3L09A 1TL1B 1Q4RA 4F2SA 1U2RA 1MSWD 2ZZNA 3B8HA 1UEVA 2BM1A 4KGMA 3HZEA 2GQ2A 4DV3J 4H4KA 3KFWX 2YNGB 4O3SA 3QPIA 2AYMA 4N5SA 1FRLA 3M6VA 5HP1B 4MK8A 1R31A 3GYNA 2C3OA 1OY9A 3I0RA 2XLJA 3OJUA 1KQFB 1U26A 3DM2B 5KFFA 3CCES 3TZXA 1M5HA 1TV6A 1MU2A 4DG1B 3MHYA 1WTFA 1HNVA 2HFUA 1H2UX 3RBZA 1N36F 3OTEA 3EM1A 1HNIA 1S4EA 1VDHA 2R3VA 2CPYA 1Q53A 4NX9A 5HLFA 2MSTA 1W7WA 4QPXA 5HVFA 4NLRA 3KLVA 3TX8A 4ZLLA 3OBIA 3CCUS 3BDPA 2EXUA 3I0RB 1X9WA 3PRVA 3OJSA 1X0PA 3ZZ0A 1VBXA 2IA0A 1TV6B 1MU2B 3UE2A 1KQKA 2HURA 2W25A 3P45B 1HNVB 1GXTA 2LEBA 2QA4G 2XO6A 1G2EA 4XIUA 4JI7F 4KV8A 2Y0SD 3JYTA 1HNIB 3PTWA 1Y5IB 4M5LA 4JI6J 5DG8A 4NA3A 2OO4A 2GIQA 4P52A 5HLFB 5CYQA 3D7SB 4C8LA 4YEAA 1RWUA 4E0DA 4QCLA 5EHHA 1JKHA 3ENAA 3QFHA 5CZVA 3AXMA 3KOAA 5GMKa 3JSRA 2AD9A 5KAKA 2VBZA 3QNWB 2XS2A 5D0GA 3Q86A 3N4WA 4KV8B 4YHHF 4DQSA 3JYTB 1JLEA 2ZE2A 3IRXA 2CZ4A 3GJSB 1XMOJ 5DGBA 1M5SA 2V6AA 4QJVA 5CYQB 5L46A 3OR1A 4IOAQ 1JKHB 3PCOB 4GO7X 4ZPWR 3QGGA 1IBMF 3DXSX 5HROA 1HIYA 2VC0A 1VQYA 4CH1A 3DLJA 2LQ9A 1JLEB 3LP1A 4OJGA 1F3VA 1FWLA 1RWXB 2ZE2B 3IRXB 3O44A 2ZZTA 3ZTOA 2HHTA 1RT7A 1FESA 1QSYA 3R3TA 2HK3A 1U4BA 1GFWB 4O4RA 1WUUA 3OR1B 2MY7A 3MR5A 1NRKA 1HHSA 3LPEA 2J0QD 1B7YB 3OTCA 2IM0A 3D6TB 2N82B 3RBEA 1U6FA 3QGIA 3RW6A 4NRTA 2GAGC 4YS2A 3OPKA 4FYWB 2EFVA 3KMSA 3BKUA 3PJWA 5HROB 1C4CA 4UTGA 1YRXA 4UOFA 1T3NA 1TKDA 2LYVA 3ONQA 2VJUA 1Q95G 3ENVA 3LP1B 1S72S 3EWGA 1RHKB 4RX6A 3RTVA 1RT7B 1CSJA 4B08A 5B0DA 1DZ5A 3GPAA 2IRUA 3JAMY 2CKWA 4QWAA 2DRDA 2OFHX 1CEZA 1S9EA 3PYFA 5KG4A 3AOAA 1KS2A 4YB5A 4RKUC 4ZVUB 3OVSA 1GMUA 2W1BA 3NRBA 1VLOA 4LQ9A 5HMXA 2DYAA 5IT4A 5KFKA 2DHAA 4BDPA 1ZTWA 3ITHA 1B99A 4WBFA 3OXFA 2V9WA 3AT1B 2VV5A 3BF4A 2F4FA 2DVIA 3I55S 4ICLA 4Y34A 3V6KA 4FF3A 2X3GA 2RUGA 2DGQA 5KT3A 3CCSS 1S9EB 4U6PA 3G71S 1M90T 5IWAF 2PI5A 3K5LA 3V4IA 4MT1A 2EKNA 1FXLA 3BGFA 1XMBA 5D3GA 1HWIA 3GWCA 4OJ1A 1XNQJ 3ITHB 2VPZB 2UXDF 3NWRA 4P2FA 3H40A 2PI4A 3D28A 2GCFA 4IRDA 4F4KA 3JAMU 1ZPWX 5E3AA 3H0PA 1FNXH 2F7VA 3JTOA 4M5DA 4M1KA 2DGOA 4PPZA 3V4IB 4CIOA 2CVIA 1TKXB 2M52A 5D3GB 4H4OA 3DRYA 2BW7A 1H6KX 2MZSA 2BE9B 2KFNA 1W25A 3ZFVA 3FSYA 2ILZA 3Q2TC 2XHCA 1FDNA 4P71A 4Y2KA 4K4WA 2D3O1 1B0VA 3G82A 1S6PA 3GLJA 2JL9A 1MLAA 2Q6CA 4K2XA 3BYPA 2BQUA 2ZDPA 2KH9A 4DMZA 1LWXA 1GQEA 4B3RJ 1IKXA 3HX9A 3RG6A 4H4OB 4O0NA 5K8OA 1T05A 4P7TA 2WSEC 3PEHA 2HZAA 2B43A 1Y5LB 2PMHA 4GKKF 2H51B 3G82B 4DV5J 1S6PB 4ZCIA 3VAFA 2RQKA 5KOWA 1FF2A 4YP3A 1U09A 5CD4H 5DRKA 3H4BA 2KHDA 4DFJA 5KFTA 1UW9A 4IO1A 3ILOA 2MXYA 3I5AA 4I1TA 1IKXB 1J27A 3GB0A 2AJ2A 1T05B 3X1LB 5RUBA 2N4DA 4ZJQA 1PC5A 5KT2A 1NU4A 3IG1A 1X60A 2JJ4D 1GMWA 5C5JA 2YWKA 3V2UC 2YQ0A 1NHUA 2RQCA 3HHEA 1F9HA 3S7RA 4LF1A 4OZJA 2E66A 2WBRA 3RBXA 5DDPC 2YQ3A 3MM8A 1WORA 2VFTA 1VRUA 4PEOA 2HRTA 1U25A 3HLUA 4GVLA 3I87A 2XY7A 5HK4A 2NR0A 3PY8A 3M9MB 5C7PA 2IRYA 3BR9A 2X7IA 1HNWJ 4ECUA 2VZ9A 1G7CB 1W26A 2B51A 3IG1B 4I2PA 3SCKE 3MMJA 1S6QA 2KG1A 4F7VA 3SFGA 2W7OA 1SL2A 3D6HB 2ZBQA 4C7QA 3PRDA 2HFOA 3I6PA 3MM8B 1HL6A 1VRUB 4OI1A 4ENOA 1NKBA 2ZWPA 4C0HA 1EKRA 1YX2A 5EX3A 4Z37A 1S1XA 5GAGU 2MHEA 4DQQA 1FTCA 3ETMA 3TJ8A 2XM3A 2G2YA 1SPBP 2BOPA 4YB1P 2W9BA 4I2PB 4DU7A 2FJEB 2GMJA 2KM8B 4F0HA 1HWLA 4F4AA 2LU2A 1A9NB 3H2UB 3PKYA 5KT5A 1EB0A 4TU7A 2R8KA 2HGNA 1AZSA 2L9NA 3RBDA 3MTKA 3MOJB 3M2UA 1JWWA 4CLKA 1H7XA 1JLCA 2CQ1A 1RYSA 1IXKA 1S1XB 5C25A 3DU5A 4HLBA 4X66J 1NK0A 2APOA 2W9BB 4C98A 5F8LA 2XS7A 2M2BA 2FTRA 3RAQA 3PIPQ 4MTPA 1CS4A 2GJFA 4F3OA 4WIQA 1NK6A 5LSOA 1AZSB 1D8ZA 1H38A 4OL8A 3J80Y 2VPXB 1SJ4P 2RQ4A 3M2UB 1JLCB 2MQQA 4ETZA 5C25B 2NSBA 1SQFA 3TZZA 4ZP8A 2HQ3A 2V63A 2KZZA 3PNIA 4Q8EA 4P74A 2QMXA 1CS4B 2KU7A 3GG1A 4CM0A 2JFDA 1N5SA 1HD1A 3HJFA 2ZD1A 2MZJA 3FMWA 4GC6A 4YR3A 4C4WA 3G6YA 4LQ3A 2MQ8A 2R8HA 2QO3A 3FBEA 3ILJA 4KYZA 3OVAA 2C3YA 4QR2A 5KFLA 3QJJA 1MWYA 2BXJA 2UU9J 3R5BA 1K1SA 4JI8J 5E41A 2ZD1B 2UVUA 3TUPA 2W4CA 3QT7A 5LT5A 2PEBA 3J80U 2HLTA 3MFIA 1XMQF 1CULA 1K0TA 4WWSA 3NGRA 1MMLA 3VAHA 4WE1A 3EXCX 3DC2A 1U6BA 5IZHA 2M70A 4YY3J 2BQRA 2MYFA 2XYHB 3QATA 2F3JA 1QE1A 1T94A 5KFZA 5AXMA 1RKIA 4O3RA 1OPIA 2C2NA 3ICLA 3NP5A 1GTEA 3M8PA 3N0VA 3ILLA 3G6ES 2B4UA 3T19A 2FLPA 3VZHA 4DS5A 4ED8A 2V8PA 3IR5B 2OTLS 3SIPB 2LA6A 1IJFB 3PJ9A 4DV5F 3MCNA 4F4XA 4WE1B 1WF1A 5EGYA 2D41A 1BGXT 2JEJA 3I32A 3CDWA 2R7WA 4PWUA 5EWFA 3TYTA 4O0IA 2ZNYA 1QE1B 3KLIA 2G1HA 3MPYA 5KG0A 1B0TA 1X5SA 5J2NA 1KDNA 3NCPA 2G0JA 1W2BR 2RHQB 3M8PB 3CUNA 4F26A 1WNEA 3I31A 3P3DA 3MPVA 1XR5A 3CCJS 3IR7B 2AEFA 4LF9J 1RCXB 3O2IA 1XNRF 1ZZFA 3CJKA 4QWBA 2CPDA 3MAQA 2DNZA 3QSIA 4NL5A 4NCAA 2R2SA 4V19X 1NHKL 3KLIB 1J2VA 3TA0A 2LFVA 3BJYA 3MEGA 5J2NB 2BE7D 5LMNF 2LQ8A 5BYQA 2RMLA 1S7HA 4MIBA 2E5HA 4NCBA 3FSXA 1MROA 4ZITA 2ZHAA 3DHWC 2R8JA 2DGXA 3CJKB 2DH7A 1R43A 2PE8A 4Q45A 1ZYQA 1YKWA 4DUZF 1FK9A 2F1FA 3PFOA 3FRYA 1RU2A 2EC0A 3QRPA 2FHMA 4FKYA 1A7GE 4KKOA 2Q1LA 3BGOP 2XHWA 3MEGB 3CE8A 2R7RA 2M7SA 4W90B 4ZN3A 3AH6A 1MROB 1NPPA 2LXIA 2FVSA 2V2KA 5HL7Q 1EX8A 3OL8A 2XZTB 1RWPB 2YX1A 2BRLA 1M5KC 2E7WA 1RACB 2J0XA 2UXBF 1SI9A 3QMQA 1FK9B 3WDOA 3Q0AA 1TKTA 3HO1A 4NA2A 4NZ7A 2YKPA 3MM9A 4KKOB 1Q8KA 2M9KA 4DCJB 4GKJJ 2AMCB 4K4TA 4O3OA 4ECRA 4X66F 1F9EB 1Q8IA 1RHQB 2E5GA 4Z7YA 3CNQP 3W62A 1WELA 1RWVB 2IM2A 2VFSA 3TR5A 2NXNA 2VUGA 2RJZA 1WKJA 5M2RA 4DV1F 2KHCA 4ITSA 1TKTB 3MM9B 2ZH3A 4K59A 5JXSA 3KK2A 5G0RA 2DEJA 3ULHA 2RU9A 5EX0A 4CLTA 3OUYA 3N79A 1NUEA 1V9OA 3LP0B 2CJKA 3ZXWA 5B08A 2IBKA 2CQGA 1VQ9S 2CPXA 2F40A 1HW9A 1T11A 4JI3J 1VBZA 3G9CA 1R0AA 2ZWOA 4J5OA 1IBCB 4K2JA 5KFOA 4HYKA 1VHFA 4URQU 3PYGA 3K17A 4WXOA 3LTOA 1LFPA 3KK2B 5G0RB 4ECYA 1MW7A 1TL3A 3NG8A 5DDRC 4PQUA 3ENWA 1UVIA 4WKYA 3OUYB 1CJTA 4H4MA 3BB5A 5IOLA 4TYAA 4DR3J 5J1PA 4W92B 5K20B 4UOGA 3GONA 5F8JA 4JI8F 4DPTA 1VISA 4PQAA 1R0AB 4LT6A 3L7UA 3BQ1A 2FJWA 2FJVA 3WZ0A 4CO3A 1CBKA 4H54A 1OYDA 2ZH2A 3DLBA 1TL3B 4UY8T 1YJ9S 4PQUB 2F5GA 3NS6A 4J9QA 4DR7F 4U95A 1CJTB 4H4MB 2W24A 3N9UC 2KL8A 2RS8A 4WKRA 4FF4A 2V8HA 1M5OC 2BMBA 1VJQA 4ZVTB 1I6JA 4QWEA 3NGKA 3OR2A 3T5HA 4BHQA 5M2PA 4J9MA 3OHAA 1X4HA 4LVOP 3HVWA 4KHMA 1WJ9A 4XDDA 4WU3A 4HACA 4B3TF 4QIGA 1KN6A 3OL7A 3AOCA 2NXJA 5KG3A 4JB8B 4FVCA 1MNEA 2I1RA 2YX4A 2IBOA 1RABB 4J37A 1X5TA 2AQ4A 2J9DE 2Y1RI 4IFYB 4NLOA 2DGTA 4M94A 1CJKA 5K5MA 3BZQA 2RD5C 2RDDA 1RA6A 1WOSA 1VQ4S 1KR4A 2PMWA 3W9JA 7FD1A 2NCKL 3HHDA 5D8HB 2ZZMA 2I5JA 1KFDA 4DBQA 2DBBA 4IH6A 2I38A 1KVJA 3FBFA 2D1CA 2M3DA 4HACB 1FFGB 4ANEA 3EVWA 4OHXA 1GTHA 2RE1A 3VGVA 5IQ6A 4OJ3A 4O44A 4USIA 2XMTA 2FGOA 1RUSA 3OQ2A 3U1MA 3M9NB 2GHWA 3VAJA 5D4NA 2NPFA 2BEFA 2GZOA 1N5QA 1CJKB 4DV6J 2DIUA 3M30A 3R97A 3PR4A 2JVOA 3CJ3A 2I5JB 3DGVA 1AFIA 4DZDA 4DL7A 1YJVA 2HEKA 1SJQA 1IKWA 1G4CA 2OELA 4YR2A 1J5EF 1BE4A 4DX5A 1TU0B 4ANCA 1HQ2A 3CJ5A 4O44B 2FZKB 3DOLA 4X62J 1WHVA 2WONA 3C46A 1HARA 5KFBA 5C2GA 2HHVA 2CJAA 2W9AA 2VIHA 3M30B 2QLBB 2C2OB 1SL1A 5GAGI 3U02A 4A47A 5M2UA 4C0OC 5I3UA 1B4SA 2IM1A 4DFKA 3BM7A 3I9ZA 2L3MA 1ZAXA 2YKOA 1IKWB 2X1BA 1NK9A 3H42A 2OPSA 1WC0A 3HULA 3KNAA 5ETQA 1JJCB 2R2TA 4OHYA 2YQ1A 2KB2A 1T95A 4PWWA 1RQ0A 3DOLB 3QT5A 5F0WA 1KTQA 4HHJA 1S4FA 2F65A 2WONB 2VHGA 4TVAB 4C8NA 2C3MA 5DDOC 2QGFB 2DB1A 3CDBA 5I3UB 4F3MA 4GKJF 1O8BA 4DWIA 3E01A 3M6XA 1UZHA 4X4VA 1IVZA 3RYLA 4JV1A 3NXZA 1SH3A 5E7OB 2HFNA 3A3NB 5IC4B 2DNRA 2B6AA 1S79A 2LEAA 1R6YA 3R1HA 4QYRA 4YR0A 3AFGA 1R8PA 5LXYA 2F4VF 1WOOA 1FE0A 3M8QA 4DL5A 1LXNA 1L3UA 4WFZA 2V5HG 4DR6F 4KJIA 4LF2A 4F0MA 2QL7B 2OTJS 4JI2F 4M5JA 2V8VA 2AP6A 4LRAA 4OV1A 2CNOB 2B6AB 3GV8B 4QU6A 1EIYB 3TA1A 4AXIA 4QZVB 1BY9A 3IBWA 1WHWA 3NCQA 3P5TL 2WVEA 5B0FA 4B3OA 3EVOA 1H98A 3M8QB 2KFYA 5LSLA 4ZPDA 1C4AA 1IQZA 1IUJA 4ZVFA 4R25A 2CAJA 3D0HE 2B9EA 4Y00A 3HPOA 4ED6A 4C11A 1GX6A 4QR1A 3HJVA 1U1KA 1VIXA 4DR5J 2NQPA 4CLLA 7AT1B 4AQYF 1YIJS 1EHWA 1HQEA 3F73A 5H9EJ 1CC8A 4TKTA 2DNYA 3WX4A 4B3OB 2B7BB 4WCEQ 2C2RA 1KTVA 4CLWA 2IJFA 4RU9A 3U7JA 3L95X 1S9GA 1I94F 4N47A 2DNLA 2ZFHA 2E7VA 1RTZA 3UO0A 3JTNA 1Q5YA 2X1AA 1R7IA 4C11B 2ASLA 2ZKUA 3BPDA 3GQCA 3DDIA 4UOCA 1T9XA 2EG1A 4F4ZA 3KUGA 2QSWA 1YITS 3K59A 4ZS6A 2D9PA 4QQBA 3CJ8A 1HQEB 3S6EA 4K5SA 2A2CA 2CNKB 1BC6A 5DO2A 3GMGA 2FZCB 1IJEB 4B9TA 1HR0J 2QV6A 4O3NA 1S9GB 4DDFA 1PBAA 5F8HA 4QWCA 1X4CA 4U7UD 3TAQA 3OHBA 3EE3A 1AB8A 2QIFA 3W5ZA 2GAHC 3X3UA 5KOXA 1RP5A 3OTBA 3R5CA 2Z57B 1Q0NA 3PG9A 1RTDA 3Q89A 2R7VA 5HMYA 2OFGX 3NAHA 4IRKA 4Q0BA 5AXKA 4AT1B 1QUPA 2GO8A 3ZZZA 3HM9A 2YNIA 4NXNJ 2AX1A 5K8PA 3ZTPA 5MLCV 2EC2A 2G0CA 2VQFF 4LSNA 1KKHA 2CJ9A 4ED7A 3NMAA 1LW0A 2R4FA 3H59A 5LMUJ 1DBDA 2FUG9 2ZM6F 1M0SA 1YLXA 2LQJA 2ALYB 1RWMB 4RWWA 5HANA 4Z2XA 1RTDB 3LW5C 3SQOP 2K1RA 1X4BA 4RUHA 4Q0BB 4OHVA 3EZOA 1SKWA 1DLOA 2YNIB 1BHNA 4U96A 1JLQA 1R8HA 2O1PA 3SQGA 4B3MJ 1VLYA 3PX0A 1LK5A 3HXMA 1ZAVA 3GCXP 2XS5A 2OKQA 4LSNB 4NWBA 4B02A 4R0EA 3TA2A 3D6MB 2RUSA 1A0OB 1TAUA 1LW0B 3OL6A 3NMRA 1NKCA 1X8DA 3H98A 3IAS9 3QWUA 1ZA1B 3Q8YA 2ZVIA 2I6WA 4X62F 2EG2A 1GX5A 3E8OA 2K1RB 2AJ0A 3UR3C 4DN0A 3B78A 2RU3A 1JLQB 3MEEA 2NSCA 4F67A 1RAGB 3MI7X 1ZM4A 4L75A 1AUSL 5CH7B 1UKUA 2HVZA 3QWPA 3SQGB 4DPXA 1KWMA 4EWTA 4M63A 3R6GB 4CT8A 3ENQA 5L1JA 2M8DB 2KFZA 1QM9A 2XLKA 3UD5A 3WIUA 2A3JA 4F04B 1SV5A 1T02A 3DRXA 1NCLA 1D1UA 3MAAA 6FDRA 1F1BB 4GRSA 2ZUGA 2XYGB 4DX7A 4A8XA 4OMFG 1TL4A 1LV5A 3K8VA 1RT4A 5L38A 4MKBA 3R5AA 1X5OA 4DHVA 3MEEB 4A46A 5HAOA 1FWKA 3DMJA 3DHXA 1PAUB 4RNNA 4TNOA 2ZH6A 1PKUA 3AHPA 3AA8A 3VV2B 2IAJA 5T7LA 4IG0A 4RW8A 1SV5B 1KFSA 4B9MA 1UEUA 4JI5J 3MXHP 2DY1A 3MAAB 4EBCA 4DV4J 5E5NA 3EPGA 3T1YJ 1O51A 1L3SA 4OHWA 2FJBB 1WTBA 2ZUAA 2DH9A 1RT4B 2CQ3A 2L41A 3CC4S 1M5VC 4DF8A 3KYLA 3FEXB 3DMJB 2HZVA 5A2QY 4F50A 5KG2A 2FHJA 4DI6A 4AL7A 3RB3A 1EAYC 2AV5A 4TLRA 3UWTA 3G6VA 2AJFE 1FD2A 5DJBA 2IAJB 5T7LB 1SC6A 4IG0B 5HVHA 2G1DA 4RW8B 4DL3A 1KNZA 4L72B 1RHMB 1HBOA 1NK7A 5KFPA 1X4DA 1BUXA 1CVJA 4DX8H 2NXCA 3J7YU 1OQ6A 3M05A 4C8ZA 3SI8A 2QTWA 2UUCJ 4U7UK 1VK3A 4ZHRA 4IG3A 3H8YA 2ZH1A 3ZZUA 4PZVA 5CXTA 2ZH8A 2M88A 3OV7A 3AQPA 5DM6Q 1RWNB 2KXFA 1HBOB 4NLYA 3WC0A 3AY0A 2L9DA 4IR9A 2AT1B 2R7QA 3ILIA 1QUVA 4LF4J 2MQPA 2LCWA 3GFHA 1Y9OA 2HRUA 5A2QU 3MGJA 5F3TA 2XCPA 2XGPA 3SSRA 5JVGQ 4DQRA 2CPIA 1U2FA 3J7ZT 1URRA 2O66A 3D4JA 3GFZA 2WSFC 4ZHRB 4IG3B 4JYAJ 1YTYA 4GO5X 2A1BA 4AFFA 3KJFB 2G9OA 1RBAA 3H4DA 1T3OA 4N8OA 5I3QA 4OZ1A 3IWNC 3GG0A 3PM9A 2J9CA 4WP3A 4X4NA 2MZQA 1XWLA 2AU0A 2QZ8A 5KG7A 2OEJA 3O1LA 2KG0A 3V6DA 5JVHQ 4YN3B 3VVUA 2GQCA 2Z2ZA 3N28A 1L3TA 4HI1A 4DL6A 1FWPA 2XLIA 2HMIA 3C8YA 3EZ5A 2NUUG 1FI4A 3SXLA 5DLFA 4OHZA 3QSYB 4GC7A 1U8SA 4CO0A 1WDTA 3JQJA 2DHXA 3EGVA 1X4EA 2DNKA 1UETA 4RJVA 4HT7A 2QX0A 4AL5A 3NNAA 2NLWA 3GZ7A 3V6DB 3D3CJ 2N7CA 3M8WA 2QA2A 1NDLA 1SIZA 2GGPA 2Y1IA 1RTHB 1N34J 4LFAF 1OQ3A 2HMIB 5B09A 3KDNA 3IC1A 3RRKA 5BR8J 1VMBA 5BJRA 1IBKJ 1V6HA 3HVRA 4N77A 3CT9A 3CTRA 1N54B 2JLFA 1F9FA 3OXGA 2LQBA 1RAFB 1G1XA 3O3LA 1HLWA 1U7LA 4DCPB 2PMZD 1UTAA 4EUVA 4ED5A 3SSQA 4ILLA 2M5YA 3PIOQ 1KLMA 3ZZTA 4IQXA 4EU0A 3D67A 3MF5A 4E98A 2GGPB 1LW2A 2XI3A 3HHLD 2BX6A 3JSYA 1QTNB 4P75A 1B0PA 3D68A 1VCTA 3LO3A 2JNJA 1NH8A 4PG6A 5LL6d 3NNCA 3Q2SC 1N48A 1WG4A 3C3LA 1F6TA 1MMDA 4G3IA 2MKYA 3B4DA 2IMOA 2JLGA 3CCVS 4JV0A 2DGSA 2KYXA 3G96A 2FY8A 1KLMB 1Q78A 4Y28C 2HNZA 3QQCD 1OYEA 4BWMA 3VAMA 5KFUA 2JWNA 1D9AA 2BKNA 4QIFA 3RAXA 2R2RA 2ZHBA 5HBMA 1PSDA 3MMCA 2KXNB 5B0EA 4YB6A 3THTA 4CRJA 5J2MA 4I69A 1ZH5A 1B64A 2CQDA 2V4RA 4PABA 2M8HA 5D15A 4NZ6A 4NYZA 5FD1A 2JHEA 1VC6A 3OSPA 3HVAA 1U02A 2XMVA 3HF5A 8AT1B 5L39A 2OPRA 4WFBQ 1SC4B 4OYAA 4ZDNA 4EYIB 2F8EX 2HNZB 1CC7A 5A0YA 2PD1A 2FC8A 3KJNB 1ZETA 2K3IA 2FJAB 3G8SA 4NLSA 2DITA 4LFCJ 5HBMB 3ZZPA 3LQVA 4KHPJ 3MMCB 4ECZA 4WZMA 5B0AA 5J2MB 3SMZA 4WTOB 2GW8A 4IYQA 3UNGC 3CC7S 2A10A 5HN0A 4WU2A 3DKDA 3LUYA 4PG5A 4RPFA 2OPRB 2EK6A 3W65A 4PYAA 4D3GA 4OYIA 1Z2LA 1VBYA 5A0YB 3DRRA 2P9CA 1CPZA 3BBFA 4NMXA 3TARA 4DV2F 3RB6A 3FEZA 4TY8A 3MR2A 4CP5A 3KJVA 1D8YA 4RNOA 3VAGA 2D3ZA 5T41A 2HIQA 1YJTA 4XPEA 2DGUA 5KFMA 4J9UE 2W7AA 4DU8A 4K0KJ 1PC4A 3IM9A 4EO6A 3PKMA 2UUCF 4X4QA 1N5TA 4YUDA 4X4RA 3DRRB 2KKHA 4AD6A 2D69A 2PO4A 2AJ1A 1P1TA 1FJEB 5DLGA 3U27A 2AKWB 1OWXA 2OJ3A 3TO8A 3O6QA 3TOQA 4TY8B 1QVFR 3L3CA 4HHHA 3KJVB 5E33A 1YBUA 2CWXA 3M6UA 2VBWA 1HFEL 3PW0A 2IYIA 1S1WA 3WBZA 2EI5A 4PXBA 3T1HJ 2SXLA 2CPJA 1OY8A 4C0BA 1U1RA 4X2BA 4AL6A 1V5IB 1VQLS 2AHOB 1S0VA 3GSIA 4RUAA 4KSEB 1YVFA 3MD1A 2J5AA 1H2VZ 4I7FA 2W2MP 1TVRA 3P49B 3CJQA 1SL0A 3IFEA 5F9LA 4HDHA 4TLQA 5THWA 2HZCA 3H20A 2DXFA 4USUA 2AYEA 1HW8A 1ULRA 2W7PA 1KHVA 3A8EA 3SDEA 1ZM9A 3S8SA 2VL1A 4QR0A 3MM5A 1S1WB 1NPKA 1Y7PA 2GJIA 4QW8A 2ALZA 2VB6A 3S1TA 1EJ7L 2CG8A 2QC3A 2PA3A 2GFFA 4NLQA 2FVQA 4I7FB 2I0XA 1TVRB 1ZPVA 5A6WA 4B9SA 4O4GA 4C97A 4PCQA 2V34A 3T5JA 5L1LA 5EN1A 4WP9A 3SDEB 4OI0A 4PG8A 1R0CB 3BN7A 4KBIA 2XWXA 3FRZA 4NCGA 5E3CA 3MM5B 1ZBTA 2EFGA 3IA0A 1FD8A 3M8RA 3N01A 1FFSB 4OV6A 2H5EA 2BJ1A 2VFUA 5JMNA 2U2FA 3DGPA 4R5PA 4C9DA 1SJFA 1BQMA 5KTQA 3BQ2A 1N34F 5ETPA 3JQKA 4K4UA 1JNRB 3M32A 3UDLA 1D0EA 2ZC4A 1IBKF 1VYAA 3P8BB 1P9QC 4O4GB 1FX2A 4ES1A 2F9JA 2DH8A 5HJXA 3V4MA 5IT9Y 3V6HA 3LGHA 3QIPA 4NCGB 4JUZA 1DRZA 4IR1A 1WC6A 1VQNS 5ETNA 3FQKA 3IBFB 2LEPA 1NKEA 2WCXA 4Y3CA 3DGPB 4R5PB 3AODA 1BQMB 3EGZA 4ZCKA 1RAJA 4FVMA 2DRAA 3NCRA 2ADCA 2VC1A 3AXKA 4EYHB 3M32B 3OVBA 3R2CJ 2WB1D 3KG1A 3P96A 3T9ZA 2QLXA 3HFZB 4UZBA 1RE1B 2KT2A 5HSPA 3QFWA 1GK8A 4QBUA 2MQNA 1FJ7A 4OX9J 2CNNB 4A8QA 2HHQA 3QIPB 3NOGA 1KP6A 4R0JA 4PUOA 1HNZF 3CXCR 4LF5F 3OXLA 4DR4J 1VIOA 2JLEA 4ILRA 2R2UA 1ZOTA 1DJ0A 1N52B 2PT0A 2HG4A 3MUVP 4Y6IA 3CPWR 2C2ZB 2GQQA 4LBIA 3K8WA 2BJDA 2ZJQQ 3H25A 1PJ5A 2YNHA 3MM6A 4I67A 4ZPVR 1XQIA 2DR7A 1S1UA 2VG7A 2DNQA 2Z0GA 1DAXA 4PUOB 2DD8S 5CHCB 2W01A 3GIJA 5IQQA 2WVBA 1GAOA 2HFZA 1N0UA 3DCAA 5HQ8A 3R6LB 2VQEJ 3VF0B 2JRSA 4QU7A 3MWBA 2YNHB 3MM6B 4UZCA 1J5OA 2QA4S 3O8WA 4NXMJ 3NL0A 2P9EA 4KE5A 4YQWA 4M5NA 1IM6A 3BSOA 1S1UB 3T9NA 2VG7B 4OI3A 2HHHF 1FRHA 2MJUA 4ES3A 2R9LA 3K5NA 4K7QA 5EDWA 3VWSA 4LF8F 2JOQA 1EETA 2LMIA 5DDQC 3C2PA 3BPSP 1UAWA 2V67A 3GJTB 4DV7J 1X0FA 1YI2S 2Y9HA 2ZOFA 3AOBA 5KFAA 2IRXA 2HVIA 2R7UA 4CT9A 3J7YI 4PPDA 2PEHA 2UUWA 4TU9A 1SC1B 1JK9B 4U7CA 5F8NA 3GFXA 4K0KF 4DJBA 3E2EA 3D54A 3M2VA 3W64A 3HT3A 4Q43A 2NYIA 2BABA 2PDAA 1HKAA 5KFGA 2AZ3A 1EETB 3K5PA 3FKBA 1FJGJ 1HBNA 4UUWA 2UUBF 3B82A 1KBRA 4MIAA 1AYEA 4JI1F 1FVQA 2RILA 3SEOA 1XC9A 2HHWA 1U1QA 1LFWA 1UJ5A 3T1HF 2MJNA 1R27B 2RSQA 3U1NA 3R5GA 4ECTA 3B54A 4OLOA 3M2VB 3W60A 2VG5A 1FO1A 2XG8A 3MEDA 3CMAS 3JXOA 3EX7B 3KHGA 3BGLA 4NASA 2AGPA 5KFWA 4BLGA 1RAEB 2UV8A 1D3WA 2M0GB 2IDLA 3UFCX 4K4ZA 4WIIA 4PG7A 1HBNB 4HL9A 3TI0A 2FQQB 2IHR1 2PN6A 1PJ6A 1R6VA 1FXRA 2Z8QA 5GAHI 4LR7A 4ZPBA 2DXEA 4YMEA 1FXDA 3Q83A 3OTOF 1VI7A 3CDAA 4DSJA 2OSRA 4LBHA 2VG5B 1Q8LA 1VGYA 1X4GA 1PAEX 1U24A 3MEDB 3FZ2A 3KLFA 3BH7B 1YJRA 4EK2A 1AW0A 2EEYA 4C2MA 5CYMA 1JXLA 4JI4J 2MB0B 3UR0A 2VA3A 2W9CA 1VRTA 3RU0A 3Q8QB 3C6TA 1EQ0A 3EYZA 2V2ZA 1KONA 3C6UA 2I9SA 1ACMB 4FP9A 1LKZA 1U6ZA 4E2FB 2NXEA 2GIRA 2XMAA 1YBTA 2XMUA 1LQ9A 2BQ3A 2P6SA 2YKNA 4ED4A 4FYYB 3KLFB 1HD0A 1F5CA 3BS9A 5GADU 2CPHA 5JUMA 3ZTRA 4LRCA 1BQXA 1RWWB 5CYMB 2V2VA 3QGPA 1NSQA 1SKSA 1UFWA 3KJQB 1IWAA 2W9CB 4USHA 1VRTB 1C2PA 3C6TB 1G3OA 3C6UB 2EW9A 2XO7A 1BD6A 3W1YC 4PR6A 2B7CB 2KVIA 4RW4A 4USKA 1UVNA 4CO2A 2CQPA 4I6WA 2DT9A 1QAXA 2YKNB 5ETLA 1HYSA 3IMQJ 2DNMA 1LNQA 1RB0A 2LVWA 2LDYA 2XWYA 4LF6J 1K44A 3QO9A 2AJ4A 3FNNA 4WZQA 5F8MA 4RNHA 2ZH9A 1HI8A 1F0XA 5HMWA 3VGTA 1TK5A 4B9NA 3BQ0A 4AUKA 4QWDA 4FXWA 2OHDA 2HBZB 4RW4B 5IM0A 2RKIA 4EFAC 4OYZA 3C66A 1HYSB 2GS8A 2BJ8A 2MKKA 3ZNJ1 2ZBCA 5CCLA 4X65J 2E9TA 4Q2MA 3QO9B 1F5BA 4LRFA 2NXUA 2CA9A 2YKMA 1HPZA 4ICLB 4U8YA 1FNMA 3W61A 7FDRA 2VOPA 1VBKA 1RCOB 3THPA 5IM0B 2YH1A 2RKIB 2OPQA 1BMQB 4WYLA 2IYGA 1MWZA 5HQLA 2HKEA 3CD6S 3I82A 4ZVGA 4CNYA 5CABA 2X3DA 1N33J 4DV3F 2UZAA 3W8GA 2UUTA 3TUIC 1RHUB 1MN7A 1RT5A 5D0HA 4HTIA 2H4WB 3QLHA 2J9DA 1Y3KA 3VAIA 3N6NA 4F3QA 4NXMF 5KFDA 1YWXA 1HPZB 3BBCA 4ZLNA 2RHSB 2IPOB 4ZP7A 2LU1A 3CJRA 3A12A 1DTQA 2AF6A 1YHQS 1NJYA 4M5DB 2OPQB 3G87A 2X51A 2LKZA 1DQ9A 1SJ1A 4P9SA 1Q86T 4P73A 1NSAA 4N7TA 3HI9A 1JB0C 1YK9A 2E1AA 5T14A 2YY3A 2BKOA 2JH3A 1RT5B 2K7KA 3F41A 1PCAA 3CW2C 3PO5A 3QLHB 5KFXA 1SH0A 1K73T 2CQ0A 1SBRA 1UVLA 2H4YB 4ECWA 5C2CA 5DQIA 1DTQB 2R8IA 3KLGA 5H9FK 1CG2A 2KO1A 2DRBA 2PSZA 1RADB 5CZXA 3VZIA 2HS0A 3W2VA 1U1LA 4JI6F 2VU5A 2N3LA 4MAKA 5B7WA 1WC4A 2ACMA 1VRQC 4NEYA 3FMBA 4DL2A 3AJDA 1NJZA 5AXLA 1XR7A 2HVEA 3W7BA 4C3KA 3BYRA 3BR8A 3TAMA 2QMWA 3FCWA 3KLGB 4LFBJ 2RRNA 1YRUA 1IN0A 2B8QA 4B3SJ 3MOZA 1TUWA 3V81A 4OYWA 1DY3A 2HGLA 4FNIA 3NOCA 2XC9A 2JFKA 4ZPCA 5F8GA 3HDSA 3W2VB 4MMOA 4MK7A 3GJQB 3BREA 2J9EA 1XMOF 4IH7A 4M5HA 4QYZJ 2DK2A 2UUAJ 4ETXA 2BBEA 4C8OA 2Z58B 1OMSA 3CDUA 1PILA 3BEGB 5KG1A 2R7XA 4EEYA 2HPUA 3BSNA 5KFYA 2ZKTA 3DLKA 1APSA 3J81Y 3W2WA 1NJIT 1FRIA 1NMEB 3IO1A 3V81B 4N41A 3LH2S 1U8WA 1PYSB 2GHPA 3A8IA 2WVCA 3ET6A 4UW2A 5A8RA 3HD1A 3PZPA 3PW2A 3GTYX 2RT3A 4DUYJ 4WK3A 4DR1J 2E5LJ 1T9WA 3HSGA 1S6QB 1GT8A 2HNDA 1GMWD 2H54B 2ASDA 2WTFA 3DLKB 3SYZA 2CJYB 2KM8C 3W2WB 2BM0A 1Y3JA 2Q79A 3FGVA 4FBUA 2GV1A 3KUHA 3O5TB 3ET6B 3U1LA 5A8RB 1Q5VA 1Q82T 2B5JA 3NS5A 2RB7A 4ZN1A 3PRBA 1N8RT 2E5IA 2JX2A 1CQMA 3MPWA 1VQPS 3R1LA 3W63A 4YOEA 1M1GA 2HNDB 5K14A 2R7TA 2BZ2A 3EMTA 4WFNQ 3J81U 3HK2A 5ETOA 3J81j 4ECXA 4KIAA 2NPIA 1RAOA 3CF5Q 5FJ4A 4LF6F 1N36J 4X4SA 4ZVHA 1BQNA 2YWGA 2JVRA 4ZA1A 1H3DA 5G4DA 2B5JB 3BDEA 2C2MB 3C19A 3T5KA 4IOBA 5CCMA 3CIZA 4ID5A 4NE9C 1V5VA 3GFYA 1YGYA 5K14B 4USWA 4FZVA 1UMJA 2BJ9A 2F9DA 1FKAF 2GO9A 4F4YA 1YJNS 4ED2A 1N4LA 4JI7J 3J7AN 1K8AT 2QN6B 4LBPA 2RVJA 1JLAA 1XNQF 3Q8PB 4DSFA 4LUBA 2FHKA 3MMAA 2ACYA 3FC9A 3MURP 4LIRA 1JLFA 3MR3A 4QW9A 3B4MA 4ID5B 1IR1A 2EFPA 2CPZA 2VD3A 2OD6A 1QSLA 1O6XA 1OPZA 2ROPA 4F25A 2J7UA 4YHHJ 1SKUB 3A4TA 1VK8A 1JLAB 4PXDA 2AEMA 2WRMA 4F8RA 5KG5A 4ALZA 3QRQA 2IDEA 4PAAA 3KTQA 5EUHA 1QVGR 4NLUA 1JLFB 3HSDA 2BOAA 3BKTA 1JJ2R 4D3HA 4WP8A 3IR6B 2FY1A 5BYSA 1X4FA 3D6FB 3I5BA 5AE1A 1NO8A 2EFOA 4XPCA 2RH3A 3LANA 5L8RC 1NJXA 4B3RF 4FN5A 1IBMJ 1F2HA 4CYUA 2NZCA 2Z2LA 2NUHA 4OYPA 9RUBA 2DY9A 1CULB 1U1NA 4ATNA 2ERRA 2XMKA 2WHOA 4HTJA 1RI7A 2ZBPA 3HFKA 4FDFA 1VQOS 4IFVA 4EZ6A 2QLJB 2Y3YA 1NDKA 2Q66A 2P2CB 2HQIA 1T9VA 1VOMA 3KXDA 3CVKA 3DU6A 1WHXA 3UQSA 2DNHA 2H48B 4DL4A 2WB4A 4RBUA 5K8NA 2AJQA 4CYUB 1R89A 1X31C 1D9DA 3Q8RB 1T9YA 3EGWB 4OI2A 4OLPA 3L4BC 2YKQA 1WKLA 4IFVB 3TZWA 2FB0A 1VC0A 4TU8A 1M1KT 4RUBA 5E0OA 1BLUA 3WIVA 1URNA 2H5IB 2R7OA 4HR2A 2KRBA 1RISA 2XNRA 4R8UA 5F41A 4G65A 3KHRA 1FDBA 2ZVSA 1P8GA 4ZPTR 5KFRA 4J9RA 2UUAF 4U67Q 1HNWF 2EBGA 2JEIA 3RAMA 1FFWB 4DR2J 3VALA 3Q24A 5GMDA 2D3OR 1S1VA 3D1OA 3G4SS 1MMNA 2OP5A 2Y1JA 3EUNA 4MFBA 3K89A 3MR7A 3D66A 5IWAJ 2BV3A 4NOHA 1N5YA 4P6QA 4LVNP 4I2QA 4UY85 4WFXA 2VPWB 2UP1A 3PV8A 4ID8A 1OIAA 1TZ0A 4R8UB 4KTQA 2V68A 3SSSA 1NLKL 2NS1B 4Q7AA 4A8MP 2B9WA 4MKAA 3ZNUA 4HHUA 4DSEA 1V3SA 3I5CA 3MUTP 1NDCA 4PXCA 3SCIE 4OQJA 1NPRA 2BUNA 3M8YA 1S1VB 5SZTA 5GADI 1UA0A 4LMZA 3KK3A 4MFBB 1NBEB 4CZCA 2QL9B 2E9ZA 2DO4A 3CEDA 3I4HX 1N5YB 4DQPA 4K4XA 1VC5A 4HDGA 4I2QB 2E7XA 2V8DA 1P9YA 2HGMA 4NLVA 1H0HB 2YVSA 3LF0A 4F36A 2COLA 1X5PA 4QIVA 4FNHA 3TQEA 2B9XA 3HSJA 3IWXA 3HMJG 4A8YA 1RU1A 1S5ZA 2VKZG 2KZMA 4UUXA 2QYGA 2GNKA 3KK3B 3GIKA 4FXDA 1JMTA 5ETSA 1R8AA 4NLGA 1RBLA 1Q16B 2QT7A 4F0KA 2UXCJ 4A4JA 3T41A 4KGVB 3K5OA 1WSVA 2B3TB 2CIMA 2H3EB 1WKKA 4O3QA 1I1GA 1K9MT 1YZ7A 4EGLA 3I96A 2MHNA 2IVFB 1FDDA 4XO0A 1ROFA 1AXQA 1FKPA 2MLZA 4GKKJ 1WACA 4NRUA 2GIFA 1PBUA
chains in the Genus database with same CATH topology
2C22A 1Q78A 1ZM2A 4DN9A 4Y28C 2HNZA 5EX3A 4Z37A 4FPRA 4BWMA 3EPIA 2ZH4A 1S1XA 1J5OB 3VAMA 5GAGU 2MHEA 5KFUA 2JWNA 4DQQA 1FTCA 1D9AA 4BBYA 4QIFA 4H4KC 3RAXA 2C28A 2R2RA 2ZHBA 4K50A 2BOPA 3N5BA 4YB1P 5HBMA 4ECVA 4BS2A 1PSDA 2W9BA 1Q7LB 4I2PB 2OH2A 3MMCA 1TKZA 2KXNB 2DR8A 1LXJA 3CCZA 2FJEB 5B0EA 2GMJA 4YB6A 3THTA 4CNZA 4I69A 5J2MA 1ZH5A 1B64A 1CLFA 2DNOA 3HVTA 1FCAA 2KM8B 2CQDA 1HWLA 1YQHA 2V4RA 2CPEA 2LU2A 2M8HA 1A9NB 4DPOA 3H2UB 4NZ6A 3PKYA 4NYZA 5FD1A 1R8BA 3CCTA 2CJQA 2CQHA 3PDNA 2JHEA 5KT5A 1VC6A 3CCRS 2XB2D 3OSPA 3HVAA 2HNYA 5BYRA 4TU7A 2XMVA 3HF5A 1FKPB 2R8KA 5L39A 1JJ4A 3MUMP 2HGNA 2OPRA 3RB0A 3GIIA 3SCLE 4WFBQ 1RT1A 2L9NA 3GV5B 3RBDA 4ZDNA 4EYIB 1KVIA 3MTKA 2F8EX 3MOJB 3M2UA 1JWWA 2HNZB 4X84A 2UU9F 1CC7A 1H7XA 1JLCA 2CQ1A 5A0YA 4HI2A 2PD1A 4P2SA 1IXKA 1RYSA 2FC8A 1S1XB 3D0IE 5KFVA 1ZETA 5C25A 2K3IA 2V9KA 2CQCA 2FJAB 3DU5A 4HLBA 6FD1A 3D1QA 2MKHA 2U1AA 3G8SA 4NLSA 4N76A 2DITA 1C1BA 2APOA 1NK0A 1SUQA 1HWJA 1QAYA 5HBMB 3ZZPA 2W9BB 2E1MC 3LQVA 4C98A 5FLXY 4ZLPA 1WG5A 1GH8A 5F8LA 4G1IA 3MMCB 1TKZB 4CH7A 4ECZA 2XS7A 4WZMA 5B0AA 5J2MB 3SMZA 2M2BA 3HVTB 2FTRA 2GW8A 2YWHA 4IKAA 3HHKA 4IYQA 3T5LA 3RAQA 1SJ3P 3PIPQ 3UNGC 3CC7S 4MTPA 4ED1A 4F3OA 3L7PA 2A10A 3DI6A 5C42A 5HN0A 5U47A 4WU2A 1NK6A 4MK9A 4DFMA 2XNQA 2DJWA 2HNYB 2XSFA 3LUYA 3PACA 2N7YA 4PG5A 3UW1A 1Y4ZB 1FE4A 5DG7A 1RT3A 3IAM9 1NAQA 2OPRB 5LSOA 2EK6A 4YY3F 1D8ZA 1L3KA 2IM3A 2W4PA 3NNHA 1SQEA 1RT1B 1H38A 4D3GA 4OL8A 3J80Y 2VPXB 1SJ4P 1Z2LA 2RQ4A 3DOMA 3M2UB 2XGQA 2DO0A 1VBYA 1JLCB 5D4OA 3DRRA 5A0YB 1YG0A 2P9CA 4URSA 2MQQA 1WEZA 4ETZA 1CPZA 5C25B 4RNFA 1NK4A 2VKRA 3SFUA 1WF2A 5L9NA 1FEHA 4ZMMA 2NSBA 2AYBA 5B0GA 1C1BB 1TUVA 1SUQB 1X4AA 3TARA 2J6UA 4ZP8A 2HQ3A 4DV2F 2CQIA 3RB6A 3FEZA 2KZZA 4TY8A 2ZH7A 3MR2A 3PNIA 4Q8EA 4CO5A 3KJVA 2F8MA 1D8YA 2FVPA 4RNOA 2IC3A 2QMXA 4OX6A 2EKYA 2KU7A 3GG1A 1HWKA 3DI6B 2JFDA 1N5SA 2D3ZA 4KB7A 5T41A 2W8LA 3DDKA 3VAGA 3ISNC 5C42B 4N56A 2FC9A 3HJFA 2HIQA 1YJTA 2ZD1A 4XPEA 2DGUA 2MZJA 3FMWA 5KFMA 4GC6A 4YR3A 4DOZA 1RT3B 2MKJA 2W7AA 3GIMA 1TK0A 2WK4A 5KFSA 4C4WA 3G6YA 2DIVA 1PC4A 3I56S 4LQ3A 4EO6A 3EXYA 3PKMA 1UVMA 4ZCMA 2UUCF 3PVXA 4X4QA 1N5TA 4YUDA 1ZAWA 2R8HA 4BWJA 2QO3A 3DRRB 2KKHA 4X4RA 2ZC3A 3OLAA 1S0NA 1E6VA 1KOOA 2PO4A 3OVAA 2AJ1A 3VR1A 4C8YA 3OR2B 1HA1A 1P1TA 1UFLA 5DLGA 1FJEB 5GAEU 3U27A 4RW9A 1OWXA 2OJ3A 2LQ5A 3TO8A 2HAIA 2IFXA 2C3YA 3O6QA 4QR2A 1GXLA 3TOQA 1Z4UA 3DLHA 4TY8B 2BW2A 3CSKA 2AWZA 3KNGA 1QVFR 3L3CA 3IRWP 5KFLA 3QJJA 1MWYA 3KJVB 2BXJA 5E33A 2XY5A 3K7RA 3M6UA 4WTYA 2IC3B 1HFEL 2VBWA 3ISND 3PW0A 3R5BA 4LF9F 1T7PA 4WXWA 1K1SA 2CRLA 2IYIA 1S1WA 3WBZA 5E41A 2KJVA 2EI5A 2ZD1B 1TK8A 4PXBA 2UVUA 2FIUA 4I56A 4K4VA 2SXLA 3N5FA 3OL9A 3AQOA 4QIEA 2W4CA 1QY7A 2CPJA 4C0BA 1U1RA 1XEZA 5LT5A 4X2BA 4NYOA 4X4TA 3LOUA 4AL6A 1KHWA 3G6XA 1JJHA 2CZVC 2HLTA 3FJ2A 3OSNA 3MFIA 1VQ7S 5B0BA 3MZIA 1VQLS 5DETA 1XMQF 1K0TA 4Q2LA 1S0VA 3UPFA 2J7KA 2FHOB 4RUAA 4KSEB 3D1HA 3QAUA 1FRJA 1YVFA 3HKWA 3MD1A 1E6VB 2J5AA 1H2VZ 4I7FA 4CO4A 1TVRA 1MMLA 3Q22A 3GYXB 4KQZA 3VAHA 2FJXA 3P49B 4NA1A 4WE1A 3EXCX 3IFEA 4HDHA 5F9LA 1SL0A 4RW9B 4TLQA 5THWA 2FPHX 2HZCA 3DC2A 4J9OA 4DSIA 4FF2A 3H20A 3HKZD 1U6BA 5EWGA 5IZHA 2M70A 4ZP9A 2Q43A 4NLXA 5KFIA 3DRPA 2ZJRQ 2BQRA 2AYEA 1HW8A 2R7SA 1X7VA 2MYFA 1ULRA 3MMBA 2W7PA 2XMWA 1VFJA 2QFJA 1KHVA 3A8EA 2F3JA 1QE1A 1KQGB 2FGCA 3SDEA 1VQ6S 2KDOA 1ZM9A 1T94A 3S8SA 1PO6A 2VL1A 5KFZA 4QR0A 3JSBA 3VAKA 5AXMA 2CVEA 3MM5A 4DR2F 1S1WB 2GA7A 4DLEA 1RKIA 4O3RA 1OPIA 1IR0A 2VFVA 2GJIA 1Y7PA 4QW8A 1KEKA 3ICLA 2ZJPQ 1ZTTA 3NP5A 5D6GA 3DN9A 2XBPA 4YB7A 4YDDB 1GTEA 3M8PA 2HHSA 3N0VA 2X1GA 3G6ES 1XBWA 2B4UA 3T19A 2ALZA 2VB6A 3NKYA 2FLPA 3S1TA 3VZHA 4KC5A 1DQAA 2OMLA 4DS5A 5KG6A 4ED8A 2PA3A 1LWFA 2MPUA 2X1FA 3IR5B 4OX9F 5KFHA 2GFFA 2OTLS 4NLQA 2FVQA 1U49A 2LA6A 1IJFB 1TKXA 3PHEA 4I7FB 4DV5F 1HNXF 2I0XA 1TVRB 2E29A 1S97A 1ZPVA 4F4XA 4WE1B 1WF1A 5EGYA 5A6WA 2D41A 1BGXT 4B9SA 4CCHA 2VOOA 1KQSR 2JEJA 4ZK7M 3I32A 3KHLA 3CDWA 3DRPB 1NZAA 4O4GA 4C97A 4DR4F 2BR0A 3E51A 2R7WA 4PCQA 4PWUA 5EWFA 1X9SA 3AJ1A 3TYTA 4X4OA 3MR6A 3MMBB 3T5JA 4O0IA 2J7WA 2ZNYA 1FVSA 3W3SA 3CCLS 5L1LA 1QE1B 3KLIA 3UCUP 5EN1A 3SDEB 3MPYA 4K5RA 4OI0A 4PG8A 5KG0A 1HBMA 3BN7A 4KBIA 2XWXA 3FRZA 4FYDA 1B0TA 4NCGA 1X5SA 5E3CA 3KMQA 1RA7A 1ZBTA 2EFGA 3MM5B 3SZ2A 3IA0A 5J2NA 1UVJA 2PFFB 2E9RX 3NCPA 1Q7YT 1FD8A 3TUZC 3M8RA 3N01A 1W2BR 3TVKA 2H5EA 3ETOA 1NK5A 2VFUA 3M8PB 5I4MA 2VONA 3CUNA 4F26A 2YWFA 1WNEA 3I31A 3P3DA 3MPVA 2U2FA 1XR5A 3DGPA 4R5PA 3CCJS 1SJFA 4C9DA 1BQMA 5FIIA 3IR7B 5KTQA 3BQ2A 1N34F 5J2QA 3O2IA 1Y5NB 1LWFB 1XNRF 4IO9Q 4K4UA 1JNRB 1ZZFA 3CJKA 4QWBA 2CPDA 5IXUA 5HMZA 3MAQA 2C2DA 3M32A 4J9PA 3CULA 4J9NA 3UDLA 1D0EA 2ZC4A 2DNZA 2XULA 1IBKF 3QAEA 4NL5A 4NCAA 1P9QC 1QSSA 4O4GB 5GVQA 4ELVA 3DRSA 2R2SA 4EBDA 2KYZA 2CQ4A 4V19X 3K57A 1A6LA 3CD7A 4ES1A 2F9JA 2DH8A 3KLIB 5F9NA 1J2VA 2OPSB 3TA0A 3JTPA 1HBMB 3IS9A 3V4MA 1LOUA 5IT9Y 3BJYA 3V6HA 3QIPA 4NCGB 5LSRA 4JUZA 3MEGA 1DRZA 4IR1A 1YRTA 4EZ9A 5J2NB 3KHHA 5LMNF 1VQNS 4ECQA 2RDIA 3VQTA 2VQEF 3DLLQ 5BYQA 3FQKA 2RMLA 1S7HA 1U45A 2JEGA 2LEPA 4MIBA 4ZPAA 2ILYA 1NKEA 1S6UA 2E5HA 2WCXA 4Y3CA 4NCBA 2HVHA 3FSXA 2P6TA 4R5PB 1MROA 1BQMB 3SV3A 3EGZA 2ZHAA 2YKMB 5J2QB 4ZCKA 3DHWC 4NLPA 1RAJA 2B4PA 2UXCF 3H5YA 4FVMA 2R8JA 2DRAA 3NCRA 2ADCA 2DGXA 2BYCA 4ZP6A 3CJKB 2VC1A 2DH7A 4G1PA 4EYHB 3M32B 4HH0A 1N56A 3G8TA 2WB1D 3KG1A 3OVBA 2OIHA 1QJHA 1R43A 2PE8A 2LXUA 3P96A 3T9ZA 2QLXA 4Q45A 1ZYQA 3IWLA 3E01B 4P7VA 4DUZF 2KT2A 1EP4A 3DRSB 1FK9A 2F1FA 3HHLA 2J8AA 3PFOA 2HWHA 4AE5A 3QZ8A 3FRYA 3ZZYA 1SKRA 4QBUA 2POKA 1RTHA 2MQNA 2EC0A 1FJ7A 2GMHA 2FHMA 4WK1A 4WFYA 4A8QA 1S6OA 4A8FA 3IS9B 1D9FA 1HQUA 3F56A 1A7GE 4KKOA 2HHQA 4DV7F 2Q1LA 1WD6A 3QIPB 4YFUA 2AW0A 2V94A 2XHWA 3MEGB 1FA0A 3CE8A 3QIDA 5A8KA 5DQGA 3T1AA 3PW4A 1AROP 4FF1A 3IGNA 4ELTA 4R0JA 2R7RA 3MAHA 4PUOA 1HNZF 3CXCR 3PR5B 5KFCA 3KG0A 5AXNA 3JSMA 3OXLA 2M7SA 1VIOA 3RZAA 4LF5F 2JLEA 4ILRA 4JI3F 4W90B 3OFGA 2ATLA 3AH6A 2R2UA 4I6AA 1ZOTA 1DJ0A 5K9FA 1MROB 2FLOA 2PIIA 1N52B 2PT0A 2WW8A 2CG4A 2HG4A 2LXIA 2HRYA 3MUVP 2FVSA 4Y6IA 2QA1A 2RNEA 2D9OA 4DV0F 4AYBD 3CPWR 1N0VC 2GQQA 2V2KA 3CCWA 4FXVA 5HL7Q 3Q8SB 3K8WA 3OL8A 2ADBA 1R3NA 2BJDA 2YX1A 3H25A 2ZJQQ 2MSSA 2BRLA 1M5KC 2E7WA 2YNHA 3MM6A 2J0XA 4Y2IA 4ZCLA 4I67A 2UXBF 1SI9A 3QMQA 3AB4B 4ZPVR 1EP4B 3RR8A 1WEYA 1FK9B 3WDOA 3Q0AA 3HHLB 2DR7A 2ZOGA 3OFFA 1TKTA 3HO1A 3CGIA 5ADZA 4NA2A 3HP6A 4NZ7A 2YKPA 3VCDA 3MM9A 1FJGF 2MDAA 1HQUB 1S1UA 4KKOB 2VG7A 1Q8BA 2M9KA 4DR3F 3LWLA 2DNQA 4G6VB 5A8KB 2Z0GA 1DAXA 4PUOB 5KFJA 2DD8S 3MTJA 5CHCB 3JSMB 4I64A 3GIJA 2HHPA 4PKDB 4NZ0A 4MJKA 2GJ2A 1E6YA 4DLGA 4K4TA 5IQQA 1L3VA 1URNA 4O3OA 4ECRA 1GAOA 4ILMA 2HFZA 3TQ1A 4L3NA 5KFNA 4X66F 2VODA 2Q3PA 2QE5A 4MH8A 1Q8IA 1N0UA 3MDFA 3H5SA 3DCAA 2E5GA 1V3RA 2E1RA 4OFZA 3VTIA 5HQ8A 1WELA 4NPOA 3VF0B 2IM2A 3DNCA 2VFSA 3TR5A 2JRSA 2VUGA 3M9OB 4PWDA 4QU7A 2RJZA 3MWBA 2YNHB 3MM6B 1J5OA 5DG9A 3CD0A 3TNVA 5M2RA 2QA4S 3K5MA 4DV1F 2YH0A 4C8KA 4FBTA 4XK8C 2KHCA 3O8WA 3NL0A 2P9EA 4ITSA 4KE5A 2F8HA 4YQWA 1TKTB 3POTA 3BSOA 3MM9B 1S1UB 4LF7F 2ZH3A 4Y65A 3G86A 3T9NA 5DM7Q 4K59A 2VG7B 2QSFA 4OI3A 4QOTA 1FRHA 5JXSA 2HHHF 1NJWA 4E8UA 2MJUA 2YKAA 4KAIA 4ES3A 3KK2A 5G0RA 2R9LA 3K5NA 2ZOMA 3ULHA 2RU9A 3K58A 3GR1A 3JB9k 5EX0A 3VWSA 5EDWA 3R5DA 1E6YB 4LF8F 2JOQA 4B9LA 1DTTA 1EETA 2LMIA 5DDQC 3C2PA 2DNPA 1UAWA 2YWEA 3OUYA 4C8MA 2AGOA 3N79A 1V9OA 3LP0B 2VBXA 2CJKA 5B08A 1X0FA 2IBKA 1FJCA 1S1TA 2CQGA 1VQ9S 2RF2A 2WSCC 2CPXA 4HEA9 3TP2A 3TVYA 1YI2S 4B9UA 3TAMB 2F40A 1HW9A 2OD4A 2ZOFA 1TP7A 4OZ5A 5KFAA 4PWDB 4NLWA 1WG1A 2IRXA 1VBZA 2HVIA 3G9CA 2R7UA 4CT9A 3J7YI 2VFRA 1R0AA 1NHVA 4PPDA 4J5OA 3CC2S 2PEHA 3CCMS 4JI4F 2XMJA 4MYUA 3KKFA 2UUWA 5KFOA 4TU9A 4HYKA 2CQBA 3NLCA 3POTB 1T8EA 4JV2A 1VHFA 1JK9B 4URQU 4KRWA 4U7CA 3GFXA 4K0KF 5F8NA 4DJBA 3GV7B 4WXOA 3E2EA 3D54A 3M2VA 3HT3A 4Q43A 2NYIA 1VJWA 1TAQA 1LFPA 5E2QA 3KK2B 5G0RB 4ECYA 1MW7A 2BABA 2PDAA 2E5JA 1TL3A 3CD5A 4IH5A 3NG8A 5DDRC 2FVRA 2K8GA 4PQUA 3ENWA 2BVZA