1N32F

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n32F00
4DR2F 4JI2F 4YHHF 2KJVA 5IWAF 4YY3F 2E5LF 1N36F 2UU9F 2VQFF 2ZM6F 2J5AA 4DV5F 1IBMF 4K0KF 4DUYF 4B3TF 4LFCF 4LFBF 4JYAF 4DR5F 4JI5F 1LOUA 4X66F 4B3RF 1HNZF 1XMQF 5BR8F 4DR6F 1GH8A 4NXNF 2UUAF 1G1XA 4DV4F 1IJEB 4DR3F 4JI3F 4JI7F 4JI4F 1QJHA 4DUZF 4LF6F 2B7CB 2VQEF 4X62F 4X64F 1IJFB 4DV6F 1VMBA 4LFAF 4GKKF 2BVZA 2UXBF 4GKJF 1HR0F 1CQNA 3T1HF 4OX9F 4JV5F 4DR7F 2B7BB 1XNRF 2UUBF 2YY3A 4AQYF 2RJZA 1FKAF 5LMNF 2UXDF 1FJGF 1I94F 4B3SF 5LMUF 4KHPF 4B3MF 4LF4F 3R3TA 4NXMF 4JI1F 4DV1F 2KJWA 4DV3F 4DR1F 2UXCF 1N32F 4DV0F 1N33F 1F60B 1G7CB 4DR4F 2HHHF 2F4VF 1HNWF 4X65F 3T1YF 1CQMA 4DV2F 4JI0F 1HNXF 1B64A 4LF9F 3OTOF 1IBLF 1XMOF 3ZZPA 4JI6F 2UUCF 4JI8F 4DV7F 4LF5F 4LF7F 1IBKF 1N34F 1XNQF 1RISA 5AJ3F 4LF8F 1J5EF 2BXJA
chains in the Genus database with same CATH superfamily
3GIJA 1ZM9A 3N9UC 2ZZNA 3OTCA 2ROEA 4ZLNA 2KJVA 1VRQC 2MZSA 5F8LA 5J2MA 4HHHA 4Y3CA 2MZ1A 2NZ4A 4QCLA 4X4VA 2GVZB 1FNMA 2X3GA 3AODA 3ENVA 2VKZG 3QLHB 2VG7B 4P74A 1B0VA 2P9CA 4K4YA 4MIAA 1TR0A 4Q8FA 3HJVA 2DXEA 1NHKL 2DH7A 1IM6A 1VQ7S 3IR5B 1ELOA 3BGLA 3R5JB 4ICLB 4DPUA 4Q2LA 2GA7A 3H59A 2B9EA 3KK1B 2K1RB 4OHVA 4ZHRA 3MUVP 2ZH4A 5L1LA 1HBUA 4B3RF 1Q81T 1SKUB 4DMZA 4QJVA 1U02A 3RRHA 2LDIA 2IM1A 2MQQA 2CG4A 3MCMA 3R2DJ 1IQZA 4OJ3A 5LXRA 1QVGR 3JXOA 2QG9B 3PJ9A 3UE2A 4Q0BB 3OUYA 1N33J 4R25A 2W9AA 3Q8VA 1YRUA 3NGRA 4KGMA 1D1UA 3K2YA 1SVDA 3B54A 3EGNA 4U7UK 4ZVOB 1IBKJ 4IRKA 4N5SA 4IG3A 2XMKA 3RRGA 2AF6A 1YZ6A 2FLLA 2LCWA 3BDEA 2FVCA 1OJ4A 2O3DA 3NMAA 4ZVFA 4K4VA 1UWBB 1WDDA 5C24A 4O3QA 3IBCB 1LEOA 4HDGA 5EX3A 3H42A 2NXJA 4PPDA 5MAOA 3GIIA 4F2SA 4Y28C 3LP2A 1CC8A 1N5SA 1V5VA 1JQGA 4HLBA 4DG1A 4DPWA 1WELA 1XIQA 4USWA 3NY0A 2KFYA 1DZ5A 4GKKF 4WZQA 4CLFA 3DXSX 1IVZA 2WSFC 4RW9A 5KFXA 1C4CA 4MTPA 4ELTA 1C1BA 1RADB 3LGNA 4KFBA 3EE3A 4UQTA 1CULA 1HI0P 3O5TB 2B8QA 4ZPTR 1BQMB 1Q4RA 2V67A 2BZ2A 5DS7A 1U1OA 4OFZA 3KUHA 1UFKA 4FPRA 3VQTA 4USMA 1IWAA 3A13A 3BN7A 5SUHA 4PG8A 5F8IA 3JSMB 1I3OB 2HKEA 2KYZA 2CYYA 3MPUB 4DX6A 1SV5B 3NWGA 1FDAA 2V4JB 4NLWA 2DXDA 3K5LA 2OEMA 3MEGB 3ZTPA 4UTGA 4Y2IA 6FDRA 4TYBA 1L5UA 1I94F 3ZXWA 3A12A 2VQEJ 1A7GE 1U6BA 1HYSA 1VS3A 2NUHA 3ENWA 2G1DA 3DI6A 4ALZA 2GIRA 1YKWA 1WI6A 3LGHA 4KY3A 4M5JA 4I1TA 2ZBCA 4X84A 4BWJA 3UDEA 5DG8A 2IFXA 5KFYA 2ASDA 3BH7B 2FDNA 3AQOA 1JJ4A 2K06A 4F36A 1U1NA 1M1KT 2O66A 3CF5Q 1EZZB 3D3CJ 1DURA 4B3SJ 2WZ1A 5AT1B 3MI7X 1EB0A 2EEYA 3DOKA 2ZC4A 2DGSA 2G13A 1T9WA 1MWZA 2GQ2A 4DPOA 8RUCA 2R7SA 2V8PA 2AU0A 2QEXS 3O6QA 4QWAA 2UXBJ 3D0HE 1FXRA 2BJEA 1X4DA 1FE4A 2L9WA 3MUTP 1NSKL 2JVOA 1EHWA 2HW3A 1AW0A 1UA0A 1FWPA 1O5JA 4CNZA 4DX8H 4X66J 2UUCF 5CYMA 2H1YA 4C3MA 2J6SA 3FK4A 1D9DA 5F3ZA 3HVTB 2JOQA 4DR7J 3F73A 3IM9A 1HFEL 1BC6A 1DAXA 4M5DB 3LP0A 3OD2A 2ZDPA 2YKPA 4ECXA 1UA1A 4LF8F 3DMJB 1EP4B 2BXJA 3K58A 4LR7A 3FBFA 4USHA 1WC6A 4NLTA 1LK5A 3CMQA 2OPRA 1RAEB 2N82B 1CJKA 1WC1A 5D3GB 1UPPA 3JS9A 1ZTTA 4HHUA 3OL8A 2UVWA 1YJ7A 4NRUA 3HHEA 1IKXA 1NAQA 3D4JA 3HHLC 2UV8G 1RACB 1IBMF 2WSCC 2ZH1A 2C2MB 2V2QA 2ZUAA 4QW8A 3L7OA 4ES1A 4IFYB 2BYCA 1TAUA 4KO0B 2DO4A 1RJJA 3H2LA 3MHYA 2KG0A 1RTIB 2B5JA 3QO9A 4GC6A 5HI7A 2ASYA 3V6DB 1NDLA 2AJ1A 2HG4A 1BQXA 4N56A 4J9LA 2DIUA 1WACA 2POKA 3M32B 4HHJA 4USTA 5AXMA 3KLGA 3FRYA 2GW8A 2DNNA 3EYZA 1F9EB 3NGTA 2J6TA 1EJ7L 3CSKA 3U1MA 4O0NA 5C42A 2BKOA 3AOBA 1FA0A 3IG1A 3T19A 3TRGA 4QWCA 5J1EA 4LR9A 2AHOB 5L8RC 2G2YA 5T7LB 1LK7A 2H9ZA 3PV8A 5D77A 2YNHB 2BW7A 2OPPA 3AB2B 1Y00A 4FYXB 2ZWPA 2GMLA 3NMRA 2Y0SD 2DH9A 3FJ2A 3PYDA 3S8SA 2WVEA 4KGXB 4FYYB 4LUBA 4YY3J 3GQCA 1SL1A 1RT5B 3PVXA 2UUWA 3VR1A 3J7YI 3TJ9A 3KLIA 1NHVA 2BVZA 1PAEX 2AZ1A 1FJCA 4PPZA 3M8RA 2V94A 4FXVA 3MOZA 3DGPA 4OI3A 4WE1B 3RB6A 1UAWA 2Z57B 1BQNB 4UUXA 5FDLB 2EBGA 4WP9A 5E3RA 3DM2B 1DTQA 4NLGA 1ZM3A 4ZCMA 1MG7A 1FDDA 4LVNP 3IR7B 1PAUB 3NLCA 3DRPA 4W98A 3IRXA 3BBCA 4N41A 3PNIA 2W01A 3IWNC 2FGOA 1M1HA 4H4OA 3UCZP 2UUBF 3BZQA 3W62A 4RUAA 1VC0A 4PKDB 2BE7D 2MSSA 3T6BA 5GAEI 4CLSA 2XY6A 3RB3A 1X9MA 3V6JA 4M95A 2ZOMA 2ZJPQ 3RBXA 1YSJA 5KFFA 3AJ2A 3Q0AA 3EVWA 1REVA 4HACA 5DGBA 5D4OA 1HWIA 3W8GA 2V6AA 3AH6A 3IO1A 3CCLS 2I2YA 2XS5A 3OFGA 1X4EA 1VI7A 2IMOA 2NXCA 5DLGA 2CQ0A 2DGVA 4ZVGA 2GMHA 4ED2A 4FXWA 4OZ5A 4B3MJ 2YNFB 3G9CA 2U2FA 2PE8A 1F2GA 2PSZA 1T95A 4NOHA 5A6WA 1XWLA 1PYTA 4OYAA 2KT2A 2C2RA 4TNOA 2HHHF 4OI0A 3QJLA 3PG9A 5KT3A 2HWIA 3KJFB 4AYBD 2H5IB 4GRSA 5DG7A 4DU7A 1M90T 2WOMB 1LQ9A 1X4GA 4ZP7A 4EWTA 2X1FA 2OFGX 2V63A 3W61A 1S48A 4ZLPA 1S1XA 4EYHB 1H2TZ 5LL6d 4X4PA 5K9FA 3KMQA 4XPCA 1Q0NA 5DRKA 4LF9J 4DXLA 2HMIB 1Y10A 2LQ5A 3IS9B 3DLGA 1WHVA 1X5TA 1WHWA 3R9LA 3OXFA 3ZZPA 1XMOF 3I0RA 2HRUA 4B02A 1XBWA 3R8YA 3D6FB 2NLWA 3ISND 3MURP 5CZXA 3Q8UA 5JMNA 2NPIA 4NLVA 4YR0A 1Q8IA 1OQ3A 4TXSA 1TKZB 3KTQA 3AOAA 4ZPBA 2NPFA 1WI8A 5CABA 3JB9k 4Y2AA 2RMLA 4P2XA 2AGQA 4O4GA 1QY7A 3KDOA 3GJSB 1IM4A 3DNCA 1QUPA 4WZMA 5IWAF 5DQIA 4GMKA 2HIQA 3ZFVA 2UU9F 1C4AA 4RBTA 2CVEA 4NRTA 2IDEA 2VG7A 1SQGA 2M9KA 1RXOB 4K0KF 1R8CA 5RUBA 2HS0A 3M1VA 4R0JA 3AD7C 5HQMA 2DNPA 2QL5B 3C16B 3PW4A 4LR8A 4U95A 4DCPB 2K1RA 3T1YJ 2WW4A 2CRLA 4F0KA 4X66F 4MKYA 1EX8A 1YDLA 3DDIA 3N5FA 1YJTA 4NEYA 4M5IA 4RO0A 4ZJOA 1R6VA 2BE9B 2NYIA 4DV0J 4Q0BA 2WAQD 3NP5A 4CI0B 4QR0A 3OL7A 3N5BA 1NPPA 3OJUA 4F4YA 3TANA 4RX6A 3F44A 1G1XA 1RK8A 2LA4A 1ZAWA 2QLBB 2YXLA 4B3OB 1UWBA 1IR1A 3PIOQ 1A9NB 1NKCA 2OPQB 5SZTA 1G3OA 2C3MA 2HFVA 4DR1J 2CWXA 1NPRA 3LP2B 2WONA 1Q95G 1TUWA 4AL6A 2X3DA 4DG1B 1IJFB 3B4MA 2P5VA 3QBCA 2DGXA 4R8UA 3ZC4A 1NSAA 3CTRA 2YH1A 2RS2A 2A2CA 3I4HX 5AJ3J 1C1BB 2QSWA 1SJRA 4KFBB 2IBKA 3I32A 2EFGA 1NJWA 2XCPA 1CULB 2F8HA 1ITPA 1B99A 1BQMA 2RNEA 1KONA 2L3MA 2HVZA 2Q43A 5IWAJ 4U67Q 2QFJA 1NNDA 2JC1A 2JL9A 2VQFJ 1N5YB 3H2VE 3ZZUA 1PO6A 2JEJA 1T0TV 2CWKA 4O23A 4BBYA 3MEGA 1MW7A 2BJ9A 2PI5A 3BO3A 4MK9A 5AE3A 2EFOA 1NK5A 1RDRA 4BLGA 2QL9B 1PIEA 1FKOA 2X1GA 3D67A 4ZVHA 5KFVA 4QPXA 2ZH3A 3DI6B 1UMJA 1X4AA 2AIRB 2N4CA 3AD9C 1VQLS 2BV3A 3UI3A 3MAAA 4B3MF 4NWBA 2MLXA 3HKZD 4KC5A 5LSOA 3T41A 3DLKB 5IFMA 4RU9A 4Q44A 1AB8A 1E6VA 1YITS 1N33F 4PEOA 1WOOA 3PW2A 3LAKA 1YJ9S 3EJMA 5LXYA 2Z2MA 5L1KA 1KP6A 4LT6A 1WOPA 2EG1A 3V6KA 2DRBA 1NMEB 4FVMA 4MIBA 4WWSA 3DLJA 2HS4A 3BH6B 4C11B 2QSFA 1VFJA 4PG4A 5KT5A 2AJ4A 3CC2S 1ZH5A 2HLUA 2UUBJ 2EFPA 4U96A 3RUBL 1HQEB 4NLDA 3MD3A 4U6PA 2BM0A 1IBLF 2ZBQA 3NRBA 3KK3B 4OYXA 4JI8F 1SC6A 3QQCD 4AXIA 3MR5A 2JEFA 2C3PA 2J9DE 3PW5A 3PDNA 2DGTA 2E5JA 2L9NA 2VUGA 5IQ6A 4LF7F 3R2CJ 4XIUA 1EQ0A 5D4PA 5HJYA 4MMOA 4DV6J 1B7YB 1Q5VA 2CPHA 3CWJA 1PBAA 1S6OA 1VISA 3F41A 2COLA 3OTBA 4OYOA 5CYJA 3GJRB 1GMWA 2L48A 2XSJB 1VQPS 2FZGB 5H9EK 4UOHA 1JMTA 1YLXA 2EPIA 3BSNA 1S77D 3R5CA 3MDFA 2FC9A 2OPRB 2UV8A 4YY3F 3E01B 3KLEB 2ZM6J 2W24A 1YTYA 5D3GA 3J81U 2RF2A 4KV8B 1X7VA 1OQ6A 4DV1J 3ULHA 5E3QA 4F3MA 2OELA 5LM7E 2CG8A 5ETTA 1LWEA 3OVSA 2BJ3A 5FJ4A 2QFIA 2VPWB 2NUUG 1Z1ZA 3Q2SC 3M8WA 1MN7A 2JJ4D 1RTIA 2B5JB 3QO9B 5A8RB 3T6JA 1RWKB 2MSTA 4YQWA 3OT9A 2HRYA 2HNYA 1L3UA 3CJ5A 3RW6A 4DDFA 2VFUA 2VBZA 3I4PA 3JSYA 3M32A 4P6QA 4ZS6A 1T02A 4NLXA 5THWA 2CPFA 3US5A 1TK0A 3NAHA 3DN9A 2CZVC 3ONQA 4MYUA 4NXNF 4IO1A 5C42B 4Y6IA 1UJ4A 2MKYA 3Q8PB 4NLPA 4F4AA 1VHIA 3FSYA 5T7LA 1PBUA 2NXNA 2ZH7A 5ETKA 4KQZA 4FDFA 1TKXB 4DV5J 4LIRA 2OPPB 1HBOB 1S9EA 2O01C 3J7ZT 3BQ2A 4JI3F 4C8ZA 3QYYA 2CQBA 4A8MP 4WFYA 5LMNJ 1VQ4S 3DRSA 2V4QA 5IXUA 1FRLA 2R42A 1T8EA 5ETLA 2DHAA 5HROB 5K20B 5I3QA 4X62F 3GFXA 1TK5A 4JV5J 4OX8A 2ATCB 3I9ZA 3KLIB 3LTOA 1VYAA 3MEDA 4LFAF 4YEAA 1S1UB 4CT8A 2BRLA 5DDPC 2Y1LB 4DSIA 1RLDA 1L3KA 2BM1A 2QA1A 2ZFHA 1CSJA 5DJBA 1BQNA 3AFGA 4LIWA 4ZCIA 1H98A 1RCOB 4JOUA 5T14A 3QRQA 2QRRA 1DTQB 2VDIA 1EETB 4I64A 1R3NA 2XM3A 4DV7J 5L39A 4NXNJ 3GWCA 3AXMA 2YWGA 4PCQA 4KGVB 2OH2A 4DR7F 4QU6A 1MN9A 2R7OA 4PABA 3AHPA 1RA7A 5L1JA 2YBVA 2B7BB 4H4OB 1NK0A 3I55S 1QLNA 1PC5A 2MZJA 2E29A 2AX1A 1C2PA 3CJ2A 2ZZTA 4JI3J 2G0CA 2DNKA 2LXIA 5LMNF 3BKUA 3J80Y 4DFJA 2RHQB 4P7TA 1REVB 4HACB 4ZVEA 3RU0A 4B3SF 2RQKA 3GIRA 4G1QA 5B0AA 1S0VA 1X4CA 2JVRA 4DOZA 3HJFA 1RP5A 1SJFA 3H5XA 1TP7A 3ILIA 2B9WA 2HURA 1Q8LA 2Z56B 3IBWA 4IDKB 3M9NB 3KHGA 3KHRA 2MJUA 3OHBA 2L08A 1JLCB 3UQSA 3G96A 3BGFA 1N32J 3CCTA 4CNYA 1U0SA 2YWFA 4OZ3A 1V9OA 3QNWB 1BWVA 4N7TA 4J9QA 3C66A 1GX5A 3VZHA 2ZVIA 4ZMMA 1RWVB 2WOMA 3GU0A 3PEHA 1DBDA 1TL7B 4K2XA 4DQRA 5BR8J 1R8AA 1WKJA 4WXWA 1FESA 2OSRA 2XWYA 2DNRA 2FGCA 3M2RA 3D0IE 1IUJA 3Q89A 2Y1RI 4F26A 3DU6A 2HMIA 1HD0A 2XYPB 3EDQB 3DLGB 4LSLB 4P9SA 1TFWA 2G4BA 4DFKA 2XEXA 2W4CA 3I0RB 4JV1A 3CCES 4OZJA 1UJ6A 3VAIA 2BQ3A 4LF7J 4ZN3A 4PUOB 4NZ7A 2DEJA 4IOCQ 3EPIA 2DHSA 4KR0B 4NPOA 3C3LA 2GIQA 2LYVA 1ZM2A 2HFUA 2GHPA 4WPAA 4CTAB 4WCEQ 4DL7A 1N0VC 3VAGA 3ET6A 4FKXA 2EI5A 2Z30B 1XQIA 3PACA 4F0HA 1U1QA 2HPUA 5HQLA 1UWAA 2LQ8A 3PJWA 5KFUA 2L9DA 3HHKA 3T5KA 1NB7A 2R4FA 2PGCA 3NXZA 3IMQJ 2QLXA 2MKHA 1DQ9A 4CLWA 1T3NA 5F8NA 2IVYA 1U45A 1JB0C 5H9FK 3QGHA 1WHXA 1WORA 2EXUA 2XHWA 4CH7A 2IA6A 5E7OB 4ATNA 4DV2J 1HBMA 3BDPA 1ICEB 8ATCB 3M1VB 2DGOA 3LPEA 2EFQA 4WXOA 2R7RA 2XNRA 4E98A 3C16A 4C8YA 4H4MA 3NCQA 5HMYA 2HLTA 4WYLA 5KFPA 2CJKA 4TU8A 2DR8A 2OJ3A 3SSRA 3NEKA 4K5SA 2XLJA 1XMQJ 3VGVA 1KQGB 2V8DA 2VF3A 3AY0A 1QAJA 4JI1J 4HDHA 2Q6CA 2ROGA 2EFVA 3RG6A 1J27A 2HBRB 4CCHA 2J7UA 4A48A 3VGUA 2W9CA 2VA2A 4DPXA 2F65A 4YUDA 1I94J 4FYVB 4URGA 2IY5B 1LW0B 2RT3A 1NUEA 3QFWA 4D3GA 3D66A 2XY5A 3NNCA 4B3OA 1U1RA 5IV4A 4U8YA 1ZA1B 2OPQA 3FCHA 1JLAB 2JSXA 4XAKA 2UVVA 4CO3A 1S0MA 4NZ0A 3MR2A 2HBQB 4J9KA 2VFRA 4ECUA 2B7CB 2MEWA 2WONB 1CJUA 1HI8A 1VLOA 4ZDNA 1UEKA 3SCJE 2PC6A 5A8WA 2M4MA 1GEHA 3TZWA 1SJ3P 4DSJA 2IM0A 1LW2B 4R8UB 4RW6A 2V5HG 1UETA 2YKNB 4Y2KA 3TUZC 1RT3A 3GYGA 2DNLA 4U9RA 3TUJC 1VBYA 3E3XA 3SFUA 5EX0A 2OFHX 2BKPA 1K1QA 2JC0A 2YQ1A 5DM6Q 4RUCA 2C42A 1Z2LA 3G8SA 2UUCJ 3K8WA 4O0IA 3SV4A 4FYDA 2Y8YA 5KG4A 5D6GA 4OV6A 1N5YA 5KFLA 2AQ4A 4NA3A 1P1LA 2CVIA 3GG1A 2XY7A 2DHGA 4WFXA 1YBAA 3W5ZA 4Q8EA 1U1PA 2D69A 2CPYA 2OD4A 3ZTQA 1N88A 2ILZA 1FKOB 3S1TA 5A8KA 5KT2A 2IYGA 2YWKA 3VAKA 1S9FA 1SKSA 1D8YA 1RHKB 3RR8A 3ETMA 1KQKA 2Z58B 3MAAB 4C98A 2RKIA 3LALA 2F4FA 5F9LA 3MM7B 5GADI 2BBEA 5DQGA 3CCRS 1NJXA 4NXMF 3BKTA 3DLKA 3HVWA 4LRAA 1E6VB 1N32F 4DV0F 2IBOA 3BBFA 4RWWA 1C0TB 1N5TA 3CO0P 3IAM9 5JVHQ 4L3NA 4KKOB 5F3TA 5LOQA 2DK2A 5IT0A 2F4VF 5EHHA 1N0UA 1CJVA 1Q7LB 5FLXU 3G6YA 4NLYA 4CWBA 3HFVA 4C11A 2RRNA 4LF5J 1RU1A 2FJBB 3D54A 1K1SA 2VG5A 5J1PA 3C19A 2B9XA 2A3JA 1HQEA 1XK8A 4K4SA 1FJ7A 3PX0A 2LDYA 3AA8A 3TVZA 3KK3A 3OXGA 3OTOJ 1N54B 1SXLA 4K8RA 5A2QU 1KQFB 3RTVA 3TUPA 2UU9J 1IR2A 4KB7A 2C2DA 2IM2A 1B0TA 1Y3KA 2J9CA 2YWWA 1FDBA 3JTPA 4L3KA 1T9YA 3FQLA 3W2VB 3U1NA 4C0OC 5CA5A 1S6UA 5HMXA 4Y00A 2XSJA 2FJVA 3JQJA 1RTZA 1UZDA 3CCZA 3UCGA 2XMVA 3E01A 3KLEA 3V81A 3EXCX 4DSEA 1N36F 2BOPA 2FHKA 2RF2B 2MZTA 2C2NA 3GJQB 4KV8A 3CDUA 2ZM6F 3MAQA 2QMWA 4LRDA 5MLCV 2NXEA 1HWKA 2C2KB 5KG5A 1LWEB 2R8HA 3A3PB 2HHHJ 4BC9A 2HEKA 4B3TF 3THVA 1F3VA 1NEEA 2CZ9A 4FNHA 4YMEA 1PJ5A 2FJXA 4LF2A 1VLYA 4PQAA 1R0AB 2XMUA 5GMEA 5A8RA 1YIJS 2MQPA 1UCNA 3D6TB 2VA3A 4KH1B 1R8PA 2HNYB 3H7HB 3K8VA 5D0EA 3OL6A 2CXEA 3KHHA 4X4RA 2MKSA 1PYSB 4OL8A 2X7IA 5HSPA 2VJUA 3FGVA 4XK8C 4UOCA 1YZ7A 2H65B 2QL7B 1MSWD 2KYXA 3T5HA 4ANEA 2V0NA 2VH7A 2V2KA 2E44A 5G4DA 1NM2A 1R43A 1VK3A 1WEYA 4N47A 3QIPA 1TKXA 4NZ6A 4DL4A 3CD6S 1HBOA 1S9EB 4KTQA 3SDEB 1RBAA 3QT5A 4C48A 1FJGJ 4JI4J 3DRSB 2HVHA 3T1HJ 3BGRB 4F67A 4NLRA 4IFVB 2CQ4A 3UFCX 5HROA 1D9AA 3MM5A 4DL5A 1IWGA 1S5ZA 3NS6A 4CIOA 2XQCA 1FEEA 2H4WB 1R8BA 3MEDB 4I2QA 3ZNJ1 2DBBA 1S1UA 4Q45A 2NR0A 4RNMA 4OHWA 2JH3A 2OTLS 4CO2A 3CXCR 1PCAA 5AXKA 3HZGA 2G2ZA 1HA1A 4F4XA 2AEMA 3V4MA 1H73A 1U49A 4YR2A 1EETA 3SI8A 4YR3A 3U1LA 3M9OB 3CJQA 3MPYA 4Z37A 1SQFA 5D8HB 5KG7A 3W2WB 1DHMA 4MKBA 1KR4A 2HFZA 5D15A 1U48A 4A8SA 1UEVA 2FC8A 2I1RA 2ZWOA 2IIHA 3WBZA 1UZHA 1AZSB 2OEKA 3Q8YA 4AT1B 4OZ0A 3O1LA 3G8TA 4J9RA 1TUGB 4X4UA 2IDLA 4CO5A 2VG6B 3M4XA 5HLFA 2CQ2A 2YNIA 1ROFA 4G1QB 3GYXB 3JYTA 4DUZJ 3FDSA 2IJFA 3BR8A 4A8WA 1QTMA 4O44A 2K3IA 3R6GB 4IDKA 4PG5A 2YTCA 4YB5A 3THTA 1UW9A 3BS9A 3WHIA 5JVGQ 3RBEA 2KRRA 3IN5A 4DR1F 2R2TA 2E1CA 2DY9A 2JDJA 1JLCA 1LXNA 2I0XA 3EDRB 4NL5A 3VTIA 4R5PB 5M2PA 4DHVA 3OVAA 1TV6B 2HQFA 1LWFA 1VQYA 4ILMA 3MTJA 2W4PA 3SXLA 1YRXA 2QLJB 3IWXA 3M8ZA 4ZA1A 5KG3A 4QPTA 5KFMA 4NYPA 1PILA 2DXFA 3R5AA 1TL7A 3ELHA 4QR2A 3BN4A 3LF0A 4RJVA 2JEIA 3PRBA 3ZZRA 3NNAA 3M2RB 4P7VA 2D3ZA 1R8HA 1GXTA 2W7OA 1S7HA 4ECZA 4LSLA 3OTOF 2D1CA 3TAMA 4KH0B 3LP1B 2GC8A 1DQ8A 2BEFA 3D9BA 1R0CB 2VB6A 1OS5A 3P3DA 1X8DA 4G6VB 4DV7F 4ER8A 2LECA 4PUOA 1KSPA 4ES2A 1R31A 2DO0A 2HK3A 2FB0A 4CTAA 5EWFA 1ZPVA 2EVZA 1TMJA 4XDCA 4QWDA 3ET6B 2Q66A 1OMSA 5B0FA 2Y8WA 3M6UA 3R5DA 2BJ7A 2M0GB 3GR1A 1VCTA 5D0RA 2GFFA 5L1IA 5DDOC 1O0PA 3OFHA 3R5BA 5E5NA 4RZRA 4LF4J 4K59A 1NJZA 2UVRA 2AP6A 1PSDA 2Z2ZA 1RABB 2HQDA 1C1CA 3IGVA 2AX0A 1SC3B 4HH0A 2CA9A 1HR0J 4LF8J 3Q2TC 1WTFA 4C0HA 2V9KA 1HBMB 1WHYA 3GSIA 1K73T 2KTQA 5KAKA 1F1BB 3BPDA 4YDXA 1PJ6A 2QE5A 4WTYA 3NWRA 2HVEA 5ETOA 5J2PB 3K5MA 2NCKL 4H4MB 1GH8A 1P8GA 5L38A 1RHQB 2MQLA 4JI8J 3CJTA 1FCAA 4DQQA 2B6AB 2MB0B 4ERDA 3GCWP 3I5AA 5HVFA 4CO4A 3OHAA 1I6JA 5LT5A 4URQU 4B9SA 1GNKA 3LWMA 4FF1A 2ZUGA 3H5SA 2W9CB 5H9EJ 1U47A 1HQ2A 3GCXP 1OSDA 3NGDA 2GHVC 1ZA2B 4Q2MA 3ZO7A 4UZBA 1LW0A 1VRUA 3Q83A 4CLPA 2EC2A 2OMOA 3OXLA 2A10A 4K7QA 2VIHA 4DR3F 1JLAA 3MGJA 5B0CA 1HBNA 4I4BA 4TQSA 2MYFA 1B70B 5LMUJ 4JI6J 1CJUB 1K9MT 2V8HA 4J9SA 4M5DA 4P75A 3FCWA 5A8WB 1Q16B 3CDWA 4ID5B 2AYGA 1AFJA 2M88A 4OHXA 1LW2A 2AEFA 2W2OP 4B3RJ 2GO9A 4RW6B 2YKNA 3DHXA 4Y2MA 3UW1A 2N7YA 4ETXA 4IO9Q 1B7FA 2F3JA 1RT3B 3KJNB 1WF1A 3R27A 4B9NA 4DPTA 3EGZA 3A1YG 4PG6A 2HHQA 1JKHB 4C97A 2HZAA 2OSQA 3TUIC 3HP6A 3TVYA 4J9PA 4IUFA 1Y5NB 3FFIB 3TJ8A 3M8PA 2F7VA 2OPSA 3EX7B 3HLUA 3KJQB 2KI2A 4TLQA 4CDIA 2ZBPA 3S6EA 3QWPA 2K7JA 3J7YU 2WW8A 4JI0J 3NG8A 4IR9A 3H5YA 2R7WA 2XYGB 2RUSA 2HFOA 3VZIA 1GFWB 4TU9A 1HKAA 2PO4A 4QZVB 4KPYA 2DVIA 5HO4A 3I31A 3UO0A 2Q6BA 4HVZA 2ASLA 5A8KB 5F8HA 3CULA 1IKWA 1Y0HA 3X3UA 1VBZA 3BM7A 3PCOB 1FX2A 2RKIB 1N6QB 4ZVQB 4KGZB 3MM7A 4A8FA 1M5KC 4K4UA 5HMWA 2EK1A 5B0EA 2U1AA 4C3KA 4O3SA 3VCDA 4J5OA 4BWMA 2DHXA 1VC5A 2KM8C 1C0TA 4DN9A 4ED3A 2C1EB 4KKOA 4Y34A 4O3PA 1Y4ZB 3TA1A 1GQEA 4X65F 1HHQA 1CJVB 3FZ2A 1CQMA 3SCLE 4X4QA 2MQMA 3J80U 4WP8A 2ZHAA 9ATCB 2VC1A 2VG5B 1WG4A 2HBZB 2Z8QA 3U27A 3BREA 4DX7A 4X4SA 3UCUP 3KLFB 1L3SA 2HS3A 1KDNA 2D41A 2UXDJ 1CPZA 1JXVA 1HNXF 1QVFR 4JBCA 2GHWA 3BSAA 2MTLA 2DY1A 3CIMA 4JI2J 1WKLA 2R7TA 3HULA 2XS2A 1OPZA 1WEXA 2CUYA 2P9GA 3OPKA 4G3IA 4J9UE 1HNWJ 2HHPA 3FUYA 4GKJJ 2V68A 2VZ9A 4JUZA 2IRYA 1H2VZ 1XR5A 3W2VA 3V4IB 1J5EF 4FKYA 4BS2A 2R8JA 1HNIA 5D0HA 3D0GE 1VIOA 3CD7A 3V81B 2PFFB 2F40A 4CRJA 1AROP 3LA0A 3NS5A 3H2UB 2D3OR 3HSDA 4ZCLA 4QIGA 2OI2A 1M1GA 4RW8A 1BHNA 2J5AA 1VQOS 1KRPA 1FX4A 2BMBA 2CNNB 2DT9A 4C8KA 4V19X 1RTJB 3HO1A 2WBMA 2E9ZA 2B4VA 3DRRB 3KLHB 4LFCF 1W25A 5ETMA 3GE9A 5KTQA 1T11A 3SYZA 2WTFA 1R0AA 2IMWP 2WSEC 3JQMA 1LOUA 1NDCA 4UY8T 2GS8A 5BYSA 2X1AA 1HNZF 2W2NP 5AE1A 3SSSA 3TEGA 5C5JA 3L3CA 2R9LA 5J2NA 1A0OB 2V2ZA 4GO5X 1T9VA 2V50A 4ITSA 3V5RA 1R7IA 2XZDB 4JV0A 1TMMA 2DD8S 3B8HA 1M5OC 2JFKA 3UR0A 2HHTA 3G8QA 3UNGC 3OJSA 1GXLA 3PHTA 3W8PA 3MFHA 4KJIA 4TVAB 5ITHA 1SIZA 1EQMA 2GIFA 1KKHA 4Q7AA 1RBLA 2BUNA 2OEJA 3QIPB 5CYQA 2KM8B 3M8SA 4FF3A 3SDEA 3FSIA 3EICA 5B08A 1FTRA 2OO4A 2ZEJA 4JI7F 5JUMA 4V19J 1Z2ZA 1RAIB 3K89A 4FP9A 1PKUA 3BGRA 3HT0A 5U47A 4DBQA 1I1GA 4IFVA 2KHDA 4UOGA 1KS2A 1TKTA 3MM5B 3KK2A 1RHRB 1S7IA 4LMZA 2E1PA 4DV6F 2VL1A 4KHPJ 5M2RA 3R7SB 2BABA 1R27B 4I2QB 1K47A 1YBTA 5EWEA 1DRZA 1D9FA 2CIMA 1NDKA 2SXLA 3UR3C 2UXBF 1BY9A 1JNZB 3PEJA 4D3HA 3T1HF 1Q53A 4OMFG 4DL3A 1J5EJ 2B3TB 4EUVA 3PXGa 3OVBA 4ED5A 1HD1A 3OLAA 3C8YA 1W26A 4J37A 2GMJA 2DR7A 2RSQA 2QC3A 2MXYA 1NH7A 1H7XA 3W2WA 2ASJA 1RHJB 4F2RA 4NXMJ 1E6YA 2JLGA 1MMNA 2CQCA 2K3KA 4NLSA 1FRXA 5KFBA 4OYMA 5L9XA 1AZSA 3VF0B 4FS2A 4OI4A 2FY8A 2LP4A 3QT7A 5DDQC 2ACMA 2VG6A 2J8SA 2DH8A 4I6YA 1NHUA 5GAHI 5HLFB 4AL5A 2YNIB 1RAOA 3JYTB 1RTDB 3A8EA 2CPJA 1LWXA 1QAIA 3W3SA 3P45B 4O44B 2R7QA 2L41A 1H2UX 2KJWA 1URRA 2O1PA 2UP1A 2HNDA 1YGYA 4GVBB 4C8NA 1F60B 1G7CB 2F8EX 3R7BB 3HF5A 4R5PA 1AUDA 1NK7A 1TV6A 4O3RA 1LWFB 3P5BP 3H90A 5KG1A 5E0OA 3OFEA 4WK3A 2VHGA 4ZVRB 3NL0A 1IXKA 1ZBTA 2KT5A 4FS1A 3P4UB 4JI0F 4ED7A 2KZMA 4RU2A 4PG7A 1MMDA 2E5IA 4USKA 2HK2A 2FJWA 2EG2A 1HYSB 1FEHA 3TAMB 3PR4A 4LBHA 4NMXA 1HARA 2AMCB 3CCWA 2Z2YB 3LP1A 3R6LB 4PXCA 5ETVA 2B8PA 4KAIA 5E3AA 3D3BJ 5HP1A 1O6XA 1UFLA 2Z4PA 4DL6A 2BQUA 3H25A 1MU2B 2A6MA 7AT1B 2RDDA 3JAMU 1UVIA 3PRVA 4OQJA 1FVSA 3HDSA 2MQNA 3K0JA 2AD9A 5KFSA 1YBUA 5KFQA 2GJFA 3GB0A 4BDPA 2VODA 1NZ8A 2WB4A 3JSRA 1FF2A 2AZ3A 1LWCB 2QA4S 2FLNA 2VQFF 3FMBA 2CQDA 2GVDA 1WJ9A 3QT6A 4ECTA 1C1CB 1WSVA 1SCJB 2E1MC 2MZRA 1RAHB 2CFXA 2O5DA 3D7SB 5A2QY 4DQPA 3BKFA 1YI2S 1F9HA 1UVJA 1R0BG 3H4DA 5KFNA 3KJVB 5J2PA 1T3OA 3N0VA 3L9ZA 5JXSA 2ZJQQ 3QRRA 1S6QA 4EFAC 1QSYA 4Y0FA 2NSCA 3HHDA 3QSIA 1Y5LB 3K5PA 4URSA 3GFZA 4RW4A 2B6AA 3U7JA 3PTWA 3KLVA 3EPGA 1H7WA 2NXUA 2Y3YA 5KFTA 4ANCA 3PO4A 1VRTB 2FJDB 3AT1B 3VHQA 3B6BA 3W5YA 3M6VA 2RRAA 2D3O1 2VU5A 3GIKA 1D3WA 3A3OB 3M2VB 1L3TA 1LXJA 4KHRA 2CQGA 3AAWB 2MPUA 3PW7A 4DR6F 2EFNA 2JHEA 2LXUA 2NZCA 4L6V3 4A8XA 5IT4A 5GADU 1VRUB 1YJNS 1SUQA 4CH0S 3RAXA 3RW7A 4ENOA 2RQ4A 1IJEB 1HQUB 3MPVA 2OTJS 3KG1A 3I96A 1F3FA 4J9OA 2KN4A 2CJYB 2LQJA 1U6FA 3EZUA 1HBNB 3W66A 1SKRA 4DR4J 4DR2J 3M05A 4F7VA 1PC4A 3SEOA 3K5OA 2MKJA 3N28A 3TEHB 2VQEF 3QSYB 4YN3B 1K0VA 3UPFA 2CJAA 1SC1B 1TL4A 4ID5A 4WTOB 1AYEA 1FD2A 2IC3B 8AT1B 1RWWB 1NXIA 4MFBB 4AFFA 4XTTA 2ZNZA 1NK9A 3PYEA 2PMZD 1JKHA 1PYOB 1HR0F 3J7A1 2QJ3A 2M7SA 4I2PB 1DFDA 2D9OA 3FFIA 1KLMB 2AW0A 3MCSA 3M8PB 3R7NB 3TI0A 2OPSB 1R89A 2FZKB 4N77A 1RLCL 2WB1D 3MWBA 4FZVA 5DZ6A 4ED0A 2LU2A 4LFBJ 2W2PP 2UZAA 2YH0A 4ZJLA 2ZHBA 4PXDA 1H6KX 4USUA 1QM9A 3ISNC 4CP5A 3BJYA 4OZ2A 3CUNA 1AUSL 3ADAC 4KT0C 2W4DA 2JNJA 3FC9A 3FRZA 4RR5A 5IQQA 4KSEB 2ZBRA 1RWMB 2DPJA 2BKNA 1F5CA 4EBCA 1RUSA 1VIXA 4EEYA 1RAAB 3MR6A 2JFDA 1IKWB 4A46A 1ZOTA 3D1QA 3LPYA 3I0SB 3VAFA 1RWXB 1S6PA 2RDIA 4CLLA 4IH7A 2UXCF 3CC7S 4P71A 3G2XA 5F41A 3W65A 2LLZA 2HZVA 1QSSA 4ZCKA 1G2EA 1FRKA 2GV1A 2PN6A 2LQBA 4EU0A 3UVJA 1JLEB 2EK6A 2RQCA 1S0NA 4M5NA 2UUAJ 3T1YF 4K2JA 4TKTA 4DEZA 1JLBA 3TAQA 2KKHA 2QMUB 3OFFA 4FXDA 2VDHA 3I82A 2DNZA 3BSCA 4NLUA 2P6TA 2I9SA 5KFZA 5KG6A 3CCVS 3KLFA 4DV3J 3M8QB 4UW2A 1U2FA 5F8GA 4EI2A 3RRKA 1B64A 1O8BA 1JXEA 4LF9F 1S1TB 1YJUA 3MECA 1TUVA 1WKKA 3HI9A 1U2RA 4OX7A 1S4FA 3FKBA 3SZ2A 1U0HA 1UVMA 1WF2A 5KOWA 1J2VA 5B0GA 5GAHU 1VJWA 2V8VA 2YKMA 1TTHB 3I87A 2LEBA 5ETNA 3TAPA 1GMUA 1FT8A 1S4EA 2YPYA 4LF1A 3SCKE 3V4IA 1KBRA 1LFWA 1SJ1A 1LFPA 2DYAA 4LREA 3V2UC 1HNIB 3CJRA 4JI2F 3MR3A 3DGVA 3QJJA 4M8LA 3L09A 4H4KC 3G86A 5KFGA 2YNGB 3VAMA 1KHWA 4ZITA 3G4SS 4DV4J 1FRJA 3MM6B 4LVOP 2RE1A 3HT3A 4RW8B 3PIPQ 1QSLA 3G6VA 2FUG9 3GV8B 1SL2A 1RTJA 3RBZA 7FD1A 3UD3P 2ZZMA 3DRRA 3KLHA 4C4WA 1V3SA 3HHNB 4YFUA 1VQ8S 1GMVA 5LSLA 1XTZA 2VPZB 4WFZA 4JYAF 1APSA 1URNA 1W2BR 3E51A 1RYRA 4HT5A 1JLFA 4WIQA 2ZKTA 2HZCA 3K57A 5E33A 4DQSA 5J2NB 2XMTA 2PA3A 4DZ6A 5K8OA 3CD0A 2KG1A 5BR8F 4KPCA 1FKPA 4QWBA 3KWMA 4P72A 3QJPA 2KRBA 1X60A 1PG5B 4NLQA 4OJ1A 1SL0A 2BX6A 1WC4A 3HFZB 3P5TL 2BRKA 1NKEA 1TK8A 1U7LA 3M30A 4A4JA 2IPOB 2P9EA 1V6HA 5KOXA 3KOAA 4DV4F 4B9UA 2ZD1B 1VHFA 4I0WA 3CO9A 5HBMB 5CYQB 4HR2A 3R97A 1RE1B 2XMJA 4C6AA 4IG0B 3W1YC 1WTBA 5J2QA 3DKDA 2HGMA 4OZ1A 1AFIA 1NB2A 4HTJA 3KYLA 4OHYA 4QIVA 3VALA 2BQRA 3W5XA 3TJAA 3KK2B 1H38A 2VFTA 2HHWA 1TKTB 3C2PA 3TOQA 2MMYA 3DLLQ 1T9TA 4A8QA 5CQGA 2QTWA 1RWPB 3WDOA 3KXDA 2XO6A 4HYKA 3M6XA 3HHLD 4LQ9A 1TL3B 4EK2A 2VBWA 4Y65A 3WC0A 2V8GA 3DOLB 4LRCA 4P2SA 4I6AA 1NJIT 1KD1T 4DSKA 1VOMA 3CMES 3Q24A 3IFEA 1VQ6S 4HI2A 2ILYA 2F4VJ 4C8MA 3SQGA 1UEUA 1FD8A 3QPIA 5DQHA 1PGZA 3FQKA 4YDDB 5LSRA 4IRCA 1ZM4A 4IKAA 4J9MA 5KT7A 4NE9C 1E6YB 4LBPA 4CT9A 3I5BA 1FRHA 1OWXA 4FPIA 2QN6B 2GO8A 1U24A 3KG4A 3MF5A 4LFCJ 4RL1A 4U7CA 3RYLA 4WU3A 1YK9A 5F9NA 4J91A 1KTQA 3BQ0A 1Q86T 2G9OA 3GG0A 3HMJG 5KFIA 3VQSA 2C2ZB 4RPFA 4QW9A 1RTDA 3QT8A 1SPBP 5KFCA 3ILLA 4CZCA 5DG9A 2B9YA 4OI2A 1N36J 1HL6A 4DV1F 3A3NB 3C6TB 9RUBA 1KFDA 4DPYA 4C2MA 2GGPA 2HNDB 4GVBA 4B9VA 2LMIA 1BWEA 1HNZJ 3MTKA 2KVQE 1HNVA 1TQLA 2GQQA 4YHHJ 3QZ8A 3N4WA 4ED8A 2D7SA 2D74B 2ZOFA 1V5IB 1S72S 3UWTA 4MAKA 2AWZA 2RUGA 4OZNA 4RUHA 3RAQA 2O67A 2ZHOA 3GP9A 3ZZZA 4AD6A 2ERRA 5CCLA 3W9HA 5K8PA 2HVDA 3H5UA 1BUXA 3QWUA 2B4PA 4X2BA 4K4XA 2WCXA 1NU4A 2OP5A 1J5OA 4TLRA 4IH6A 1IBLJ 1M5PC 2CPZA 3N79A 4I7FB 3CJKA 2KXHA 4ZP6A 1S99A 3IRWP 2H48B 4L73A 4ECQA 5HP1B 4LF5F 3RJMB 2MLZA 3UN5A 1KTVA 1MU2A 4NX9A 2FVSA 4ZN1A 3OR1A 1N34J 1XNQJ 1Q78A 4C9DA 3CVKA 5ETRA 2UUTA 4O3NA 3CIZA 4USIA 3G71S 2FJEB 3GPAA 3VV2B 1JJCB 1RT4B 2AV5A 2JRSA 2LEAA 2H5EA 4L75A 1BE4A 3PKMA 1WC3A 1LWCA 2QLFB 3F0NA 2FHOB 3NKYA 2V34A 1HW9A 2GVDB 3CGIA 3GSDA 3SFGA 3EZ5A 1ZETA 4ZPWR 2M8DB 5EDWA 5KG2A 2GAGC 1U8WA 2KFNA 2XI2A 2XLKA 2H3EB 4W92B 3OV7A 4F3OA 3W64A 5I3PA 1X0PA 3KJVA 3HXMA 5KFWA 3CCSS 3D1HA 3Q22A 4LFBF 1S6QB 3D28A 4JI5F 4WF9Q 1ZPWX 3R1HA 1XMQF 4LQ3A 4RW4B 3C46A 2E66A 1NK8A 3VVUA 1VRTA 1XC9A 1RKIA 5BYRA 4AXJA 2VFVA 3M9MB 2J8AA 2NREA 2PA8D 4I68A 3M2VA 3IM8A 2CNLB 2HAIA 4ZVSB 1FK9A 2DNMA 4OHZA 3A4TA 4A8KA 1XJWB 1F2HA 3OBIA 3I56S 1SUQB 2MHNA 2YQ3A 4IH5A 4UZCA 5A6PA 5M2UA 5KFOA 3AB4B 2NSBA 4EBDA 3PO5A 4CLKA 3E8OA 1HQUA 2QLWA 2XWXA 3ILJA 2DGQA 1S10A 1XMBA 3M6WA 4DUTA 1FRIA 1MWYA 3BB5A 3QATA 1S76D 5K8NA 1Q79A 4OX9J 2H4YB 1NO8A 1M5VC 2DGUA 3HKWA 3HFKA 1KEKA 1SB6A 4OJHA 2M3DA 3LUYA 5DDRC 4JI5J 1YJRA 4QQBA 2PIIA 5CH7B 3OL9A 2IC3A 1T03B 5HN0A 2LEPA 3MCNA 3LWLA 1IKVA 1RAGB 3KUGA 2ZBIA 4GO7X 4HTIA 4MFBA 3TZZA 4AQYJ 2E7XA 3AD8C 3EXYA 3WX8A 2YKAA 4I2PA 1YHQS 1S97A 3W63A 1KLMA 1HMVA 4CYUB 1RWOB 1AA1B 2HGLA 4WFAQ 2VKRA 3EVMA 4F0MA 4RNNA 3BO2A 1VQ5S 2RILA 3L4BC 2ZE2B 1Y3JA 2G0IA 3FCVA 4LBIA 4F4WA 4OI1A 3UD4P 2YY3A 4LRFA 3E2EA 4F02A 2CPXA 2F9JA 2W25A 3IAS9 3NNHA 4M94A 2JWNA 1D09B 3CDBA 5KFDA 2GQCA 3DOMB 1U26A 3NS7B 4E8UA 4ZIWA 4RW7A 3WX4A 1OY8A 1FJEB 3PX4A 2DTJA 2ZH5A 1BGXT 2D9PA 3CB4A 4KYZA 3I0SA 2LXFA 4ZP8A 1N56A 5B09A 2DR6A 5I3UA 4LF4F 1S6PB 1NLKL 3SIPB 2J0XA 1ZS6A 2IRUA 5A0YB 2AEJA 2OMLA 2A1BA 3DDNA 4RNHA 2XLIA 1V3RA 1DLOA 2XI3A 4C3LA 4ELUA 1FHTA 1LNQA 1JJHA 1JLEA 1SI9A 2BA9A 3UVJB 2XYHB 5IC6B 4ANDA 1EARA 1JLBB 1DQAA 2OKQA 1FXDA 3EM1A 3MMCA 2PI4A 2VONA 2Y9HA 3G82B 1TVRA 4UOFA 5L46A 4ED4A 4TQRA 1S57A 1S59A 2ADCA 4ZK7M 4RBUA 4ZP9A 2OGUA 3HD1A 3M8QA 3J81j 3DRXA 1JJ2R 1N5VA 3FEYB 3H20A 1RHMB 1NDPA 1NRKA 1S1TA 5FIIA 3UDVA 3NOGA 3PFOA 5C25B 3MECB 1L3VA 1M5HA 2J76E 3VAHA 1U0HB 2NS1B 5G0RA 1NJYA 4N76A 1N34F 1XNQF 2A18A 2YKMB 3GZ7A 2HHSA 4DFMA 1KOOA 3BSOA 2B0GA 4DCOB 1RTHB 2CPDA 3TX8A 2QMXA 3SBMA 2V4RA 1FXLA 2Q3PA 2CNOB 1YX2A 4IRDA 1RT7A 4EZ9A 3HSZA 2QX0A 1Y5IB 4NCGA 1U8SA 2YNGA 1UVNA 3DXBA 1TL1A 1HWLA 1OO0B 1QUVA 2IJRA 3MM6A 1SH2A 3BGOP 3CD5A 3D1OA 2BJ8A 4M63A 4OYWA 2XNQA 3VGTA 2W2MP 2IHR1 4KE5A 4DCJB 4DUYF 4DV5F 3GIMA 1OY9A 3EGVA 4M5HA 4ZPAA 5IV3A 2R7XA 4YB7A 5EN1A 2XCAA 3TARA 5CCMA 3V6HA 3JAMY 3FEZA 4FBUA 1OPIA 3CMAS 1GT8A 2ZDOA 5D4LA 5HATA 2EKNA 5T41A 1JLFB 1YQHA 2LA6A 3NOCA 2ZH8A 3ZZ0A 1IBMJ 1P9YA 2WK4A 2R7VA 1OYDA 1FKPB 2XTJP 2HQGA 1Y11A 2PD1A 1RBOB 4EBEA 2E1RA 2M70A 3BPSP 4UY85 1R6YA 2RU9A 3NBPB 4I56A 4KHMA 2LFVA 3M30B 1CG2A 3WIUA 1G6BA 2EWHA 3QAUA 3CC4S 2ZD1A 5AXLA 3TNVA 3Q8SB 3RGIA 3GFHA 2QO3A 5HBMA 2AYBA 2AYMA 2HIYA 4IG0A 1ZZFA 5J2QB 1NCLA 5E2QA 2PEHA 4NI2A 4O4RA 4TY8B 1HI1A 2B4OA 1QJHA 5E3PA 4DU8A 2FIUA 5DZ7A 1WEZA 5LJ3Y 2J9EA 1MROB 5LJ5Y 3RBDA 1G4CA 4OYZA 3NGKA 4Q5VA 2C3YA 2WVFA 2ZNYA 3H0PA 1TL3A 4XPEA 3ZZTA 4IR1A 1KVKA 3DOLA 1UFWA 2P6SA 5D78A 3WZ0A 1X5OA 3HSJA 5GAGI 4JV2A 2BANA 2VBXA 1SQEA 2PMHA 6AT1B 3LANA 5AE2A 5DGAA 3MPDA 1HPZA 3OTEA 3IP0A 2HNZA 4OYBA 3TX0A 3K5NA 1OY6A 1P27B 3SQGB 4TU7A 1QE1A 2KXNB 2C28A 1N8RT 1DTTA 4LJMA 1U6ZA 3UN3A 2CADA 2JLEA 3DDKA 2GZOA 4CM0A 1ZZNA 2IA0A 1P9QC 3M2UB 1I5OB 2CQPA 2CJBA 3KUEA 1DARA 1JIHA 2IVFB 1NPKA 3SMZA 4A8OA 5E41A 5FLXY 3LQVA 2N4DA 2UXDF 3J7AN 2ZH6A 1FJGF 1VC6A 2PFDA 5ADZA 3OR2B 2I5JB 1RT6A 1RT2A 1UPMB 2BJDA 4LF6J 1KLNA 3DFEA 4PXEA 5HVHA 3MD1A 5CXTA 4YP3A 3R3TA 3CNQP 5KFAA 4JI1F 4U7UD 4B9MA 4L72B 3OSNA 4DV3F 3C6TA 3A8KA 2GGPB 4ZPCA 5EWGA 1F9FA 1RAJA 2GCFA 4ZVPB 2EC0A 3TA0A 3GFYA 1X0FA 1HNVB 4CLUA 3POTA 3N6NA 3FZBA 3D2WA 2I8EA 2KH9A 3PW0A 4J90A 2FLOA 2IM3A 2GX8A 2K2PA 2Y1JA 3D5MA 3IC1A 3HK2A 3TQEA 2FZCB 4FN5A 2KHCA 3ZNUA 1J5OB 4FF4A 4JI6F 3Q8QB 2KL8A 1IBCB 5BYQA 2QYCA 4I7FA 3CDEA 3CJKB 2D3UA 1B0PA 4OLOA 4ZVTB 2ROPA 2N7CA 3OR1B 2RU3A 2F5GA 3A8JA 3CEDA 1YWXA 2YX4A 4N8NA 4PWDA 2M52A 5H1SV 3FBCA 1VQMS 3QIDA 3BO4A 2H51B 4DR2F 2IAJB 1FO1A 2JLFA 1RT4A 3AQPA 5IOLA 1RGVA 3JQKA 3PYFA 1ZTWA 1T9UA 3MUMP 2G0JA 2MKKA 1GX6A 2RHSB 5K5MA 3PKYA 2BDPA 5DM7Q 4TYAA 1OIAA 3QMQA 2ADBA 1X5SA 2XB2D 2DKOB 4Z7YA 1U1KA 3MMBB 5B0BA 1AXQA 4FBTA 4R0EA 2JX2A 4V1Ak 4ZJQA 2W7PA 1WSRA 4KBIA 4PWUA 2YVSA 1F6TA 1FE0A 1F5AA 3PFEA 4CLZA 3HPOA 1YVFA 1SJQA 2E9TA 1RZMA 2RH3A 3HHLA 1RA6A 5DO2A 3TVKA 5I42B 3SV3A 1H72C 2DNOA 4B9LA 1RYSA 1KOHA 4H4KA 3TR5A 3KNAA 3ZZYA 2QZ8A 3IR6B 2N3LA 4OI6A 1FK9B 2KXFA 3RZAA 3OSPA 2AKWB 3BEGB 3K59A 4X65J 1ACMB 2BJ1A 3CCJS 1JNRB 2XMAA 1KFSA 3TZXA 2YKOA 2YKQA 3B4DA 4OV1A 2V2VA 1C0UA 2N3OA 5FD1A 1H0HB 2XMMA 5BXIA 4FF2A 3RB4A 2R7UA 1MNEA 5HANA 4ECWA 3BYPA 1U09A 1HNXJ 1ZAVA 2E5LJ 4QOTA 2WVCA 5IT9U 1JWWA 4HKQA 1NBEB 3MFIA 2G1HA 3RB0A 4MKAA 4X64F 3DLBA 4QYZK 1FI4A 1RSCA 2J7WA 4CO1A 1VMBA 4DJBA 2DR9A 1TELA 3P6YC 1O51A 3ZTRA 3C6UB 1T03A 1OSCA 3MM9A 4WKRA 1IKVB 2Z2LA 3HCXA 4K5RA 4NCAA 2C3UA 4GKJF 3BQ1A 4ZKAA 3L7UA 1XMOJ 3ICLA 1CQNA 4OX9F 4EO6A 1TAQA 1S1WB 3OLBA 1EKSA 2QT7A 3EMTA 1VQNS 2XO7A 1HMVB 5F0UA 4CYUA 2DJWA 2DNYA 4HEA9 1RT1B 3O8WA 1T05A 4CH1A 2ZE2A 1XNRF 4ZLJA 3PRDA 4AQYF 3L7PA 1FDNA 3O2IA 4Z2XA 3DRYA 4DL0C 4Q43A 4WP3A 2E9RX 3L95X 4RWXA 1EKRA 3DOMA 3AA9A 1FFGB 2X51A 4RW7B 2C22A 2WVDA 2LU1A 4RLEA 1NSPA 2Q1LA 4C0BA 2F63A 1S0OA 2LKZA 3DYAA 5LMUF 4DWIA 5ETPA 2EBEA 2DB1A 3AXKA 3GYNA 3NAIA 2HRTA 4F4KA 2ZITA 3VWSA 1MMLA 4DUZF 1S79A 4NYOA 4P10A 5I3UB 1TL5A 2B56A 2R2RA 3QFHA 3BR9A 4MT1A 1Q8KA 2PT0A 5A0YA 5HVGA 1MLAA 3F56A 4UQGA 1DLOB 4WIIA 3ITHA 1Y9OA 3QZ7A 3R1LA 1WD6A 3N6LA 1D8ZA 2IRXA 3G6XA 4PQUA 3QAEA 4WFNQ 1FTCA 1JLGB 4IOBA 5K8MA 3CCQS 1UVLA 3MMCB 3CJSA 4G65A 3G82A 1TVRB 2CQIA 1RKJA 4W4MA 2W9BB 4QYZJ 4DLEA 1GXUA 3NCPA 3IXQA 4MK8A 2C2OB 3MMJA 2A0FB 5IC4B 2PEBA 5C25A 2F1FA 3GR0A 5BJRA 2MY7A 2C3OA 4N8OA 1CJTB 1SBRA 1KQSR 5G0RB 5B0DA 3MXHP 1IBKF 3G87A 1IKYA 5IS2A 1K8AT 1RISA 2HQIA 2PDAA 2E1AA 4FYWB 1I51B 5AJ3F 4F4ZA 1KVIA 1HWUA 3CJ0A 2A2DA 4U8VA 1RTHA 1WC5A 3FSXA 3H40A 1SKWA 1CS4B 3P49B 4ED6A 5IZHA 4YHHF 2AYEA 2VC0A 1K0TA 3CW2C 2XZWA 1RT7B 4M5MA 1NK6A 4NCGB 1TU0B 2QA4G 1ZAXA 1TL1B 2RQMA 4O3OA 5CZVA 1FERA 1QTNB 3ETOA 1CLFA 5IM0B 4A47A 4OZLA 3N01A 2FHJA 4DSLA 5KFRA 3NGSA 3R5GA 4DI6A 1S9GB 1UTAA 4EO8A 5K14B 4EYIB 4NCBA 3FEXB 2VASA 4DR5F 4NMLA 4UT4A 1B4SA 1CC7A 1NH8A 1SC4B 1SJ4P 4I67A 1VDHA 3GJTB 2CPEA 3MAHA 2W2QP 1A6LA 1WG5A 2M2BA 5KG0A 4GC7A 2BOAA 2M8HA 3D6MB 2CZ4A 2MGZA 4ILRA 2HYIB 3HM9A 3UDLA 3IWLA 2OHDA 3ZTOA 5C2CA 5CD4H 4IQXA 4JI7J 4S0MA 3UD5A 2IYIA 2GNKA 1WNEA 1KHVA 3HVAA 2F8MA 4JB8B 2YWHA 2ZH2A 4KRWA 3NBPA 3QGPA 4ZPDA 2BR0A 1UKUA 4LSZB 2Q79A 3MM8B 4ID8A 4BHQA 3KG0A 3SSQA 5KFJA 5KT4A 3LOUA 3DHWC 2BE2B 4LSNA 3PM9A 2DNHA 2HHXA 1DJ0A 1UVKA 1LKZA 5I4MA 3W60A 5HK4A 1YJVA 2W7AA 3U02A 3I6PA 2FVRA 3BV8A 3T1AA 5A76A 1H74A 4NI2B 4TY8A 2FD2A 4LF6F 3GLJA 1MROA 2RB7A 3K7RA 1NK4A 4DX5A 1N48A 1TFYA 5JJBA 2IJNA 2MKCA 3IBFB 3OTDA 2Z0GA 5GMKa 1CEZA 3MMAB 3LAMA 1CBKA 4RKUC 2WRMA 2MQ8A 5EUHA 4UF4A 1V3ZA 4YS2A 3KNGA 2VV5A 4QWEA 1KVJA 2BANB 2VICA 3GMGA 2GJ2A 3C15B 2F9DA 5GAGU 1HPZB 4WYWA 2HNZB 1QAXA 2YX1A 2QGFB 4X62J 4JV5F 3MEEA 1RU2A 1HWJA 1QE1B 2CKWA 3GTYX 2CAJA 1DTTB 2BACA 7FDRA 1BXNA 2KT3A 4ECYA 1JLQA 2DRDA 3FMWA 3J7Z5 3M2UA 1OYEA 1VGYA 3C14B 1LV5A 2RJZA 2E7WA 4KGKA 1FKAF 2I6WA 5C7PA 2K7KA 3DU5A 1YRTA 3B78A 4RBVA 3SCIE 1N6QA 3OR2A 2I5JA 1M5SA 4OLPA 1RT6B 2E5HA 3BYRA 5EGYA 4XO0A 1RT2B 4DR5J 1NSQA 1TKDA 3VGSA 4DR6J 1P1TA 5GMDA 1U25A 1IR0A 2XZTB 2M5YA 4HT7A 4YOEA 5J1NA 1UW4A 2OUGA 1XN9A 2V9WA 3I5CA 2P8IA 1FWLA 3ENQA 3W9IA 1B3TA 2XMWA 5IM0A 2YWEA 2VPXB 6FD1A 4WFBQ 3CPWR 4IYQA 4DR4F 4F25A 4LRBA 3ENAA 3S7RA 3W9JA 3POTB 2APOA 3OQ2A 4BCAA 2ATLA 4Z7CA 1RQ0A 3EGWB 3O44A 1XR7A 4DQIA 2V69A 4ZIVA 3WQPA 2R8IA 1K44A 4DV2F 2VFSA 4G1PA 1VQ9S 2DR5A 3PY8A 4RNOA 3TQ1A 3DLEB 1VBKA 3GV5B 3BGUA 4DS4A 4ECSA 1UL3A 3NGUA 2FPHX 4ZVUB 1S1VB 2RD5C 3JTOA 3KFWX 3RAMA 1VR6A 3TA2A 4ELVA 3EWGA 4ZOSA 4EGLA 3VAJA 3HZEA 2MHEA 4GKKJ 2NYHA 2HHUA 1P6TA 1XERA 5HQ8A 4W90B 4NLOA 3AJ1A 4H54A 4HH1A 2J0SD 2FHJD 2I38A 3TWZA 2J7KA 4PWDB 2E5GA 4YB1P 1Z4UA 3CCUS 1SH3A 3EVOA 4NA1A 2IAJA 4WK1A 2R2SA 4PWWA 1T9XA 2ABYA 2RS8A 5J2MB 4WU2A 2GJIA 3HVRA 4A8YA 2E5LF 5F8JA 2ALZA 4CO0A 5D4NA 4KIAA 2GVZA 3N6MA 1UJ5A 2J0QD 3QLHA 4IOAQ 2MDAA 3ZZOA 4NASA 3MMBA 4P2MA 2R8KA 2B43A 4ICLA 4DN0A 3T5JA 3CJ3A 4NEZA 5KFEA 3ILOA 4IQMA 4J9NA 3KK1A 2CQHA 4ZHRB 2FLPA 1Q8BA 3UNYA 1HBUB 4DZDA 4DF4A 4QU7A 2HAFA 2XC9A 3HHLB 5I42A 4CLYA 2MJNA 1WUUA 5H9FJ 2FYXA 4ECVA 1BD6A 2B51A 2CQ3A 2QA2A 3P96A 1FNXH 1XNRJ 5L9NA 4MYTA 1W7WA 2RDJA 3OUYB 4CM2A 2J6UA 4QYRA 1RAFB 2ZH9A 4E2FB 2UUAF 4USVA 3FBEA 5HMZA 1DY3A 4IG3B 1IN0A 2CQ1A 4MK7A 1REGX 4PYAA 2OD6A 1U2CA 2J9DA 4DFPA 1C0UB 1H3DA 3JSBA 5C24B 4DUYJ 3P8BB 1X31C 4X4NA 1IQTA 3T9NA 1WOSA 4AL7A 2OIHA 4B17A 4K4TA 5ETSA 1QDUB 2LVWA 2LQ9A 2R2UA 5CHCB 4BC7A 2HWTA 4X4TA 2CPIA 3CJ8A 5DETA 2HFNA 3D6HB 3LH2S 2C2EA 4K50A 2CDRB 2HWHA 3HD2A 5HAOA 2CJ9A 2DEIA 2HHVA 3C6UA 3LGMA 3Q86A 3OW2R 3W7BA 3MM9B 4RW9B 3PJXA 2MQOA 1D0EA 4KHPF 2XHCA 3PHEA 2BW2A 2EKYA 4OX6A 1S1WA 2AJFE 3BF4A 1QD1A 1N5QA 1HLWA 2H5JB 4X64J 2DNGA 3TYTA 4F3QA 1RT1A 3JSMA 2PMWA 1XEZA 4TN2A 1T05B 1Q7YT 4K4WA 3THPA 1F0XA 1X9WA 1SV5A 3FBBA 1X5PA 3KDNA 4WKYA 4DR3J 2V4JA 1VK8A 3MR7A 4B9TA 3GILA 3TO8A 2Y1IA 4DS5A 2GAHC 1WG1A 2WBRA 3EZOA 2IVMA 2KU7A 2X1BA 2YPZA 3FNNA 4NA2A 3T9ZA 4P52A 3UDCA 3WIVA 5DLFA 5E3CA 2K8GA 3DYAB 2DIVA 2AT1B 3M8YA 1WF0A 4J9VA 4LFAJ 4M5GA 3MCOA 3BBBA 3GONA 1VQKS 2YX7A 3CJ4A 4GVLA 2VJVA 4F50A 1NKBA 3PYGA 2FVQA 1Q1KA 1FFSB 3HX9A 3ITHB 3Q23A 4WBFA 4M5KA 2HSEB 2VD3A 1HNWF 4PQUB 2MZQA 3DOKB 1JLGA 3G6ES 2DCUB 5CAAA 4QIWD 4C7QA 3B82A 1T7PA 1X4BA 1X4HA 4ILLA 1T94A 3PR5B 4RUBA 4K0KJ 1MWQA 1VJQA 2KDOA 2MKIA 2W9BA 1FWKA 1EIYB 4CLTA 5F8MA 1SH0A 2MY8A 3CCMS 2AGOA 2XBPA 5CYMB 1HIYA 1GTHA 3CT9A 3ISZA 4P2FA 5F0WA 2DPIA 1CJTA 3NCRA 2HVIA 3HVTA 3KMSA 3QRPA 3KHLA 1IKYB 2HBYB 4EMDA 4YB6A 2FTRA 2B4UA 3LP0B 1GMWD 4TY9A 4USJC 3TZYA 1Y7PA 4E0DA 1KWMA 2ZKUA 1EP4A 3DMJA 4ETZA 1CS4A 3DC2A 3ZTSA 1Q5YA 2CDQA 2HFSA 3KKFA 3LO3A 5ETQA 3D68A 5GAEU 4QIEA 2ALYB 4X4OA 3PZPA 3CE8A 3HSGA 1CJKB 4PR6A 3M7VA 1IKXB 4NYZA 1FVQA 2Y0BB 2ZC3A 5AXNA 2RAQA 2HQCA 1VQSA 3X1LB 4F8RA 4IFYA 4OYIA 3UN2A 2DITA 1PJ7A 4KO0A 2FHMA 1S9GA 5K14A 2J0WA 2WHOA 1FRMA 2KO1A 4PZVA 4QBUA 2DGWA 4MJKA 5HL7Q 3V6DA 1HHTP 4HL9A 3MOJB 1F5BA 1GAOA 2EW9A 4EZ6A 3DLHA 2XGPA 1U1LA 3O3LA 2MGZB 3KLGB 2RIJA 3A8IA 1CVJA 1RWNB 2WVBA 3S01A 2OLWA 4DF8A 2XULA 2ACYA 3IG1B 1EAYC 2QYGA 5J1EB 1BLUA 2DCLA 3H98A 2RVJA 3MM8A 3QGIA 4CQ1A 2KZZA 3TW0A 3PX6A 1KN6A 1JK9B 2YNHA 2BE2A 2VBYA 4LSNB 2XG8A 4OJGA 4F04B 2JEGA 4XDDA 3AJDA 4I69A 5KFHA 1RI7A 2JZ5A 4DL2A 1W2IA 1UP1A 4JI4F 5HJXA 2G2OA 1WC0A 1RT5A 4L76A 2DISA 1SIWB 4P73A 4C8OA 4WJBA 4JYAJ 1RWUA 3LW5C 3MMAA 1N52B 4ZLLA 4MIWA 2YQ0A 4OYPA 4ECRA 1VBXA 1JXLA 3DGPB 3IGNA 2ZOGA 1S49A 4G1IA 4WE1A 2R3VA 3TP2A 5B7WA 3MEKA 5FDLA 3DCAA 4I6WA 4DSFA 2FVPA 2DRAA 1AT1B 3C15A 3DM2A 4K4ZA 1Q82T 3I9V9 2AJQA 3MZIA 4PXBA 2AGPA 1NZAA 3MEEB 1FFWB 3DRPB 3IRXB 1HW8A 4M5LA 5D0GA 2DHHA 2ZVSA 1JLQB 2HQ3A 2DNQA 2FJAB 2NQPA 3JTNA 1X4FA 5IT9Y 1QAYA 4OIXA 3GV7B 3QGGA 4M1KA 3WC2A 1YG0A 3C14A 3FVYA 3CDAA 4MH8A 2KB2A 1YJWS 1ZYQA 4Y2CA 2XS7A 2KFZA 2OAUA 4B3TJ 1WDTA 3EUNA 4PAAA 3T5LA 4PYDA 3K17A 2QV6A 3H8YA 4ZPVR 1KC8T 3T3FA 1N4LA 4FNIA 2ZJRQ 3H4BA 4QIFA 4DLGA 2QIFA 4PRFA 5KT6A 2CNKB 4MKVA 5KFKA 2W1BA 4B08A 1RHUB 2W8KA 1ULRA 2YNFA 1GTEA 2AJ2A 5CD4A 2P2CB 3MPWA 2UXCJ 3IA0A 1WWHA 2FQQB 2R8GA 2HGNA 4HI1A 2FY1A 2RRBA 2A6OA 4RNFA 3Q8RB 1U1MA 1HHSA 2XSFA 2VOPA 4AUKA 1U4BA 1JX4A 1RB0A 2CJQA 4JP8A 2UVUA 2MLYA 4UUWA 1BMQB 2W8LA 1RCXB 3DLEA 2KVIA 4L74A 1S1XB 4J7CA 4QR1A 3SQOP 3J81Y 3IS9A 4FVCA 2E7VA 3RR7A 1GK8A 2XGQA 1S1VA 1FNOA 4C8LA 2VPYB 3VVTA 4ED1A 1M0SA 2VOOA 2AJ0A 5C2GA 4ES3A 5GVQA 2H54B 1XR6A 2CJXB 1TKZA 4AE5A 1X9SA 3AOCA 1TZ0A 1S12A 1KNZA 4O4GB
chains in the Genus database with same CATH topology
3GIJA 1ZM9A 3N9UC 2ZZNA 3OTCA 2ROEA 5J2MA 2KJVA 2MZSA 5F8LA 2NZ4A 4Y3CA 2MZ1A 4X4VA 4QCLA 2X3GA 1FNMA 3ENVA 4WK3A 2VKZG 3QLHB 2VG7B 4Q8FA 1B0VA 2P9CA 4K4YA 4MIAA 1TR0A 1VQ7S 2DH7A 3IR5B 1ELOA 3BGLA 4ICLB 4Q2LA 2GA7A 3H59A 3KK1B 2K1RB 4OHVA 4ZHRA 3MUVP 2ZH4A 5L1LA 1HBUA 4B3RF 1Q81T 4DMZA 4QJVA 3RRHA 2LDIA 2IM1A 2MQQA 2CG4A 1IQZA 4OJ3A 5LXRA 1QVGR 3UE2A 4Q0BB 3OUYA 4R25A 2W9AA 4KGMA 1YRUA 1D1UA 3K2YA 3EGNA 4U7UK 4IRKA 4N5SA 4IG3A 2XMKA 3RRGA 2AF6A 2FLLA 2LCWA 3BDEA 2FVCA 2O3DA 3NMAA 4ZVFA 4K4VA 1UWBB 5C24A 4O3QA 4HDGA 5EX3A 4PPDA 3GIIA 5MAOA 4F2SA 4Y28C 3LP2A 1CC8A 1N5SA 4HLBA 4DG1A 1WELA 2KFYA 4WZQA 1DZ5A 4GKKF 3DXSX 2WSFC 4RW9A 5KFXA 1C4CA 4MTPA 4ELTA 1C1BA 3LGNA 4KFBA 4UQTA 1HI0P 3O5TB 4ZPTR 1U1OA 1BQMB 1Q4RA 5DS7A 2BZ2A 1NK0A 4OFZA 4FPRA 3VQTA 5F8IA 4PG8A 3BN7A 5SUHA 3JSMB 2KYZA 2CYYA 1SV5B 3NWGA 1FDAA 2V4JB 4NLWA 3K5LA 3MEGB 4Y2IA 1L5UA 6FDRA 4TYBA 1I94F 1U6BA 1A7GE 1HYSA 1VS3A 2NUHA 3ENWA 2G1DA 3DI6A 4ALZA 2GIRA 1WI6A 4KHPF 4BWJA 5DG8A 4I1TA 2ZBCA 4X84A 2IFXA 5KFYA 2ASDA 2FDNA 3AQOA 1JJ4A 1U1NA 1M1KT 2O66A 3CF5Q 1DURA 3MI7X 3DOKA 2ZC4A 2DGSA 2G13A 1MWZA 2GQ2A 4DPOA 2R7SA 2AU0A 2QEXS 3O6QA 4QWAA 3D0HE 1FXRA 2BJEA 1X4DA 1FE4A 2L9WA 3MUTP 2JVOA 2HW3A 1AW0A 1UA0A 1O5JA 4CNZA 4DX8H 2UUCF 5CYMA 4C3MA 2J6SA 1D9DA 5F3ZA 3HVTB 2JOQA 3F73A 1HFEL 1BC6A 1DAXA 4M5DB 3LP0A 4LF8F 2ZDPA 2YKPA 4ECXA 1UA1A 3DMJB 1EP4B 2BXJA 3K58A 4USHA 4NLTA 1LK5A 2OPRA 2N82B 1ZTTA 5D3GB 2UVWA 3OL8A 4NRUA 3HHEA 1IKXA 1NAQA 2UV8G 3HHLC 1IBMF 2WSCC 2ZH1A 4QW8A 3L7OA 4ES1A 4IFYB 2BYCA 1TAUA 4KO0B 2DO4A 1RJJA 3H2LA 3MHYA 2KG0A 1RTIB 2B5JA 3QO9A 4GC6A 5HI7A 2ASYA 3V6DB 2AJ1A 2HG4A 1BQXA 4N56A 4J9LA 2DIUA 1WACA 2POKA 3M32B 4HHJA 5AXMA 3KLGA 3FRYA 2GW8A 2DNNA 3EYZA 2J6TA 3CSKA 3U1MA 5C42A 1FA0A 3IG1A 3T19A 3TRGA 4QWCA 5J1EA 5L8RC 5T7LB 1LK7A 2H9ZA 3PV8A 5D77A 2YNHB 2OPPA 3AB2B 1Y00A 2GMLA 3NMRA 2Y0SD 2DH9A 3FJ2A 3S8SA 1SL1A 4LUBA 3GQCA 1RT5B 3PVXA 2UUWA 3VR1A 3J7YI 3KLIA 1NHVA 2BVZA 1FJCA 4PPZA 3M8RA 2V94A 4FXVA 3MOZA 3DGPA 4OI3A 4WE1B 3RB6A 1UAWA 1BQNB 4UUXA 5FDLB 2EBGA 5E3RA 3DM2B 1DTQA 4NLGA 1ZM3A 4ZCMA 1FDDA 4LVNP 3IR7B 3NLCA 3DRPA 3IRXA 4N41A 3PNIA 3IWNC 2FGOA 4H4OA 3UCZP 2UUBF 3BZQA 4RUAA 1VC0A 4PKDB 2MSSA 1X9MA 3T6BA 5GAEI 2XY6A 3RB3A 3V6JA 4M95A 2ZOMA 2ZJPQ 5KFFA 1YSJA 3AJ2A 3Q0AA 1REVA 5DGBA 5D4OA 1HWIA 3AH6A 3IO1A 3CCLS 2I2YA 2XS5A 3OFGA 1X4EA 1VI7A 2IMOA 5DLGA 2CQ0A 2DGVA 4ZVGA 2GMHA 4ED2A 4FXWA 4OZ5A 2YNFB 3G9CA 2U2FA 2PE8A 1F2GA 2PSZA 1T95A 4NOHA 5A6WA 1XWLA 2C2RA 2KT2A 2HHHF 4TNOA 4OI0A 3QJLA 5KT3A 2HWIA 4AYBD 5DG7A 1M90T 2WOMB 1LQ9A 1X4GA 4ZP7A 4EWTA 2X1FA 2OFGX 1S48A 4ZLPA 1S1XA 4EYHB 1H2TZ 5LL6d 4X4PA 5K9FA 3KMQA 4XPCA 4C8ZA 5DRKA 2HMIB 3IS9B 2LQ5A 3DLGA 1WHVA 1X5TA 1WHWA 1XMOF 3OXFA 3ZZPA 3I0RA 2HRUA 4B02A 1XBWA 2NLWA 3ISND 3MURP 5CZXA 2NPIA 4NLVA 4YR0A 1Q8IA 1OQ3A 4TXSA 1TKZB 3KTQA 4ZPBA 2NPFA 1WI8A 3JB9k 4Y2AA 2RMLA 2AGQA 4O4GA 1QY7A 1IM4A 3DNCA 1QUPA 4WZMA 5IWAF 5DQIA 4GMKA 2HIQA 3ZFVA 2UU9F 1C4AA 4RBTA 2CVEA 4NRTA 2VG7A 2M9KA 4K0KF 1R8CA 2HS0A 3M1VA 4R0JA 2DNPA 3PW4A 2K1RA 2CRLA 4X66F 4MKYA 3N5FA 1YJTA 2NYIA 4Q0BA 2WAQD 3NP5A 4CI0B 4QR0A 3OL7A 3N5BA 3OJUA 4F4YA 3TANA 4RX6A 3F44A 1G1XA 1RK8A 2LA4A 1ZAWA 4B3OB 1UWBA 3PIOQ 1A9NB 1NKCA 2OPQB 5SZTA 1G3OA 2C3MA 3LP2B 2WONA 4AL6A 4DG1B 1IJFB 3B4MA 2P5VA 2DGXA 4R8UA 3ZC4A 3CTRA 2YH1A 2RS2A 2A2CA 3I4HX 1C1BB 2QSWA 1SJRA 4KFBB 2IBKA 3I32A 2EFGA 1NJWA 2XCPA 2F8HA 1BQMA 2RNEA 1KONA 2L3MA 2HVZA 2Q43A 2QFJA 4U67Q 1NNDA 2JC1A 2JL9A 1N5YB 3H2VE 3ZZUA 1PO6A 2JEJA 4O23A 4BBYA 3MEGA 1MW7A 2PI5A 3BO3A 4MK9A 5AE3A 2EFOA 1NK5A 1RDRA 2X1GA 1FKOA 4ZVHA 4QPXA 5KFVA 2ZH3A 3RBDA 1HYSB 3DI6B 1UMJA 1X4AA 2N4CA 1VQLS 2BV3A 3UI3A 4B3MF 4NWBA 3HKZD 5LSOA 4KC5A 3DLKB 5IFMA 4RU9A 4Q44A 1E6VA 1N33F 3PW2A 3LAKA 5LXYA 2Z2MA 5L1KA 4LT6A 2EG1A 3V6KA 2DRBA 4FVMA 4MIBA 3DLJA 2HS4A 4C11B 2QSFA 1VFJA 4PG4A 5KT5A 2AJ4A 3CC2S 1ZH5A 2HLUA 2EFPA 1HQEB 4NLDA 3MD3A 4U6PA 2BM0A 1IBLF 3NRBA 3KK3B 4JI8F 1SC6A 4AXIA 3MR5A 2JEFA 2C3PA 2J9DE 3PW5A 3PDNA 2DGTA 2E5JA 2L9NA 2VUGA 5IQ6A 4LF7F 4XIUA 5D4PA 1JWWA 4MMOA 2CPHA 4M5DA 3CWJA 3J7A1 1S6OA 3F41A 3OTBA 2COLA 5CYJA 2L48A 2XSJB 1VQPS 1S77D 3W3SA 1JMTA 2EPIA 3BSNA 3R5CA 3MDFA 2FC9A 2OPRB 2UV8A 4YY3F 3E01B 3KLEB 5D3GA 2W24A 1YTYA 2RF2A 4KV8B 1X7VA 1OQ6A 3ULHA 5E3QA 4F3MA 3OVSA 5FJ4A 1LWEA 2VPWB 2NUUG 1Z1ZA 3Q2SC 2JJ4D 1RTIA 2B5JB 3QO9B 5A8RB 3T6JA 2MSTA 4YQWA 2HRYA 2HNYA 1L3UA 3CJ5A 3RW6A 4DDFA 2VFUA 2VBZA 3I4PA 3JSYA 3M32A 4P6QA 4ZS6A 1T02A 4NLXA 5THWA 2CPFA 3US5A 1TK0A 3NAHA 3DN9A 2CZVC 3ONQA 4MYUA 4NXNF 4IO1A 5C42B 4Y6IA 1UJ4A 3Q8PB 4NLPA 3FSYA 5T7LA 2ZH7A 4KQZA 1YJ9S 1TKXB 4LIRA 2OPPB 1HBOB 1S9EA 2O01C 3J7ZT 3BQ2A 4JI3F 3QYYA 2CQBA 4A8MP 4WFYA 1VQ4S 3DRSA 2V4QA 5IXUA 1FRLA 1T8EA 2DHAA 5HROB 5I3QA 4X62F 3GFXA 1TK5A 4OX8A 3I9ZA 3KLIB 3MEDA 4LFAF 4YEAA 1S1UB 4CT8A 2BRLA 5DDPC 4DSIA 2ZFHA 1L3KA 2BM1A 2QA1A 5DJBA 1CSJA 1BQNA 4LIWA 4ZCIA 1H98A 4JOUA 5T14A 2QRRA 1DTQB 1EETB 4I64A 1R3NA 5L39A 3GWCA 2YWGA 4PCQA 4DR7F 2OH2A 4QU6A 2R7OA 3AHPA 1RA7A 5L1JA 2B7BB 4H4OB 3I55S 1QLNA 1PC5A 2MZJA 2E29A 3CJ2A 2AX1A 1C2PA 2G0CA 2DNKA 2LXIA 5LMNF 3J80Y 4DFJA 4P7TA 1REVB 4ZVEA 4B3SF 3RU0A 2RQKA 4G1QA 5B0AA 1S0VA 1X4CA 2JVRA 4DOZA 3HJFA 1RP5A 1SJFA 3H5XA 1TP7A 4IDKB 2B9WA 3M9NB 1Q8LA 3IBWA 3KHGA 3KHRA 4IOAQ 2MJUA 3OHBA 2L08A 1JLCB 3UQSA 3G96A 3BGFA 3CCTA 4CNYA 2YWFA 1V9OA 4J9QA 3C66A 1GX5A 3VZHA 4ZMMA 2WOMA 4K2XA 3PEHA 1DBDA 4DQRA 1R8AA 4WXWA 1FESA 2OSRA 2XWYA 2DNRA 2FGCA 3M2RA 3D0IE 1IUJA 4F26A 2Y1RI 4ECSA 3DU6A 2HMIA 1HD0A 4LSLB 3DLGB 1TFWA 2G4BA 4DFKA 2XEXA 2W4CA 3I0RB 4JV1A 3CCES 4OZJA 1UJ6A 3VAIA 2BQ3A 4PUOB 4NZ7A 4IOCQ 3EPIA 2DHSA 4KR0B 4NPOA 3C3LA 2GIQA 2LYVA 1ZM2A 4CTAB 2GHPA 4WCEQ 4DL7A 1N0VC 3VAGA 2EI5A 3PACA 1U1QA 2HPUA 5KFUA 3PJWA 3T5KA 2L9DA 3HHKA 1NB7A 2R4FA 2PGCA 2QLXA 2MKHA 1DQ9A 1T3NA 5F8NA 2IVYA 1U45A 1JB0C 3QGHA 1WHXA 2IA6A 2XHWA 4CH7A 5E7OB 4ATNA 1HBMA 3BDPA 3M1VB 2DGOA 2R7RA 2EFQA 4WXOA 2XNRA 4E98A 4C8YA 4H4MA 3NCQA 5HMYA 2HLTA 4WYLA 5KFPA 2CJKA 4TU8A 2DR8A 2OJ3A 3SSRA 2XLJA 4K5SA 1KQGB 2V8DA 3AY0A 1QAJA 4HDHA 2Q6CA 2ROGA 2EFVA 4CCHA 2J7UA 4A48A 2W9CA 2VA2A 4YUDA 4URGA 1LW0B 2RT3A 4D3GA 2XY5A 3NNCA 4B3OA 1U1RA 2OPQA 3FCHA 1JLAB 2JSXA 4XAKA 2UVVA 4CO3A 1S0MA 4NZ0A 3MR2A 4J9KA 2VFRA 4ECUA 2B7CB 2WONB 1HI8A 4ZDNA 3SCJE 2PC6A 5A8WA 2M4MA 4DSJA 1SJ3P 2IM0A 1LW2B 4R8UB 4RW6A 2V5HG 1UETA 2YKNB 4Y2KA 3TUZC 1RT3A 4U9RA 2DNLA 3TUJC 1VBYA 3E3XA 3SFUA 5EX0A 2OFHX 1K1QA 2JC0A 4RUCA 5DM6Q 2C42A 1Z2LA 3G8SA 3K8WA 4O0IA 3SV4A 4FYDA 5KG4A 5D6GA 1N5YA 5KFLA 2AQ4A 4NA3A 1P1LA 2CVIA 3GG1A 2XY7A 2DHGA 4WFXA 1YBAA 4Q8EA 1U1PA 2OD4A 2CPYA 5KT2A 1N88A 2ILZA 1FKOB 3S1TA 5A8KA 3VAKA 2IYGA 2YWKA 1S9FA 1SKSA 1D8YA 3RR8A 1KQKA 4C98A 5GADI 1N6QA 2RKIA 3LALA 1NJXA 5F9LA 3MM7B 3CCRS 2BBEA 5DQGA 4NXMF 3DLKA 3HVWA 1N32F 1E6VB 4DV0F 2IBOA 4RWWA 1C0TB 1N5TA 3IAM9 5JVHQ 4L3NA 4KKOB 5F3TA 2F4VF 2DK2A 5IT0A 5EHHA 1N0UA 1Q7LB 3G6YA 4NLYA 4C11A 2RRNA 2FJBB 3D54A 1K1SA 2VG5A 5J1PA 2B9XA 2A3JA 1HQEA 1XK8A 4K4SA 1FJ7A 3PX0A 2LDYA 3AA8A 3TVZA 3KK3A 3OXGA 1N54B 1SXLA 1KQFB 3RTVA 4KB7A 2C2DA 2IM2A 1B0TA 1Y3KA 2J9CA 1FDBA 3JTPA 3FQLA 3W2VB 3U1NA 4C0OC 5CA5A 1S6UA 5HMXA 4Y00A 2XSJA 2FJVA 3CCZA 3V81A 3UCGA 2XMVA 3E01A 3KLEA 1N36F 3EXCX 4DSEA 2BOPA 2FHKA 2RF2B 2MZTA 4KV8A 2ZM6F 3MAQA 3CDUA 2QMWA 5MLCV 1HWKA 5KG5A 2R8HA 1LWEB 4BC9A 4B3TF 3THVA 1NEEA 4FNHA 4YMEA 2FJXA 1VLYA 4PQAA 1R0AB 2XMUA 5A8RA 1YIJS 2MQPA 2VA3A 1R8PA 2HNYB 3K8VA 3OL6A 3KHHA 4X4RA 2MKSA 4OL8A 3FGVA 4XK8C 4UOCA 1MSWD 2KYXA 3T5HA 2V0NA 2VH7A 2V2KA 2E44A 5G4DA 1R43A 1VK3A 1WEYA 4N47A 3QIPA 1TKXA 4NZ6A 4DL4A 3CD6S 1HBOA 1S9EB 4KTQA 3SDEB 3DRSB 2HVHA 3BGRB 4F67A 4NLRA 4IFVB 2CQ4A 3UFCX 5HROA 1D9AA 3MM5A 4DL5A 3NS6A 4CIOA 1FEEA 3MEDB 1R8BA 4I2QA 2DBBA 1S1UA 4Q45A 2NR0A 4RNMA 4OHWA 2JH3A 2OTLS 4CO2A 3CXCR 5AXKA 3HZGA 4F4XA 1HA1A 3V4MA 1U49A 4YR2A 1EETA 3SI8A 4YR3A 3U1LA 3M9OB 3MPYA 4Z37A 5D8HB 5KG7A 3W2WB 1DHMA 4MKBA 1KR4A 2HFZA 1U48A 4A8SA 1UEVA 2FC8A 2I1RA 3WBZA 1U1LA 3G8TA