3OQ2A

Structure of a crispr associated protein cas2 from desulfovibrio vulgaris
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
NDAMLVLISYDVSFEDPGGQRRLRRIAKACQDYGQRVQYSVFECVVDPAQWAKLKHRLLSEMDKEKDCLRFYYLGANWRNKVEHVGAKPAYDPEGPLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a CRISPR-associated protein Cas2 from Desulfovibrio vulgaris.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Immune system
molecule keywords CRISPR-associated protein Cas2
total genus 21
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3oq2A00
2L9NA 2EFGA 1KTVA 3B8HA 3EXCX 4ES3A 1P9QC 4QR1A 3LH2S 2WBMA 4MYUA 3OQ2A 1U2RA 3ZZ0A 2ZITA 2BM0A 3B78A 3ZZUA 1N0UA 2XEXA 1T95A 2KDOA 1FNMA 4TNOA 4ES1A 1ZM3A 1ELOA 1ZM2A 4ZCLA 2J7KA 1DARA 3B82A 1N0VC 2I8EA 2IVYA 4ZCMA 1VI7A 4ES2A 3UI3A 4M1KA 4QR0A 1ZM4A 4QR2A 2E1RA 2I0XA 3ZZTA 4MYTA 2NPFA 4ZCIA 4ZCKA 4MAKA 1ZPWX 4FN5A 2CVEA 1ZM9A 2BV3A 5G4DA 3E3XA 2BM1A
chains in the Genus database with same CATH superfamily
5IFMA 3CULA 3LP1A 4ES3A 3W3SA 3K5OA 1UETA 2HBQB 5KFOA 1RP5A 2HS4A 2QX0A 3RW6A 2AW0A 3TA0A 1IKWA 2BZ2A 1FX2A 4J9VA 1HNIB 3EDQB 4GO7X 2YKPA 4UUWA 2ZJPQ 2ROPA 3CMAS 2CQDA 3FKBA 1RWNB 1RLDA 2D9OA 1IN0A 2IVYA 2PFDA 2GAHC 1SI9A 4H4MB 4DV1J 1JJ4A 4A8XA 4GMKA 1KVIA 3MDFA 1EJ7L 1VC0A 4UY85 2VFRA 5HQLA 2W2PP 2DPIA 3HHLD 4NEYA 5L1LA 1IBMJ 1VQNS 1Y00A 4C4WA 3MM8A 4LIWA 4WCEQ 4J9OA 4LR8A 4ED2A 4DQSA 1WD6A 4HH0A 3W64A 2L9DA 3B8HA 5DDRC 3OTEA 2W9CB 2B43A 4C3LA 2OFGX 2U2FA 3WBZA 5HQ8A 2NZ4A 1YRUA 2LQJA 3QQCD 3A8EA 1UMJA 1KQFB 4DDFA 2DNMA 1BQXA 2P6TA 2RDDA 4K5SA 5M2PA 2QSFA 4OQJA 4QW8A 1UWBB 1YHQS 2R7UA 2Y0SD 3ZTQA 4YFUA 2E1MC 4ZLLA 2DNZA 3D3CJ 5K8MA 3OJSA 3DRXA 1S6PB 1EHWA 2MLZA 2DH7A 4IFVB 3SDEB 4ELTA 1Q8IA 2F9JA 4KKOA 2V2VA 3PYDA 2VQEJ 3JSMB 1FXRA 3Q8SB 3EZUA 4O4RA 4OHZA 1T7PA 2R7RA 3J81j 3MM5B 3W63A 5HJYA 5LSRA 5DG8A 2LDIA 4NYOA 5CYQA 1YK9A 4KGVB 4URQU 3VVUA 5LJ3Y 1MNEA 5KT6A 3JSRA 2YWFA 3BO4A 2E9ZA 2KRRA 3TI0A 4M5DB 3E51A 2DTJA 1SJ4P 3K59A 1KQSR 1LW2A 3PKYA 1X5OA 1U1NA 3HKWA 4NMLA 3BH6B 3HX9A 2OEMA 3OTDA 5FDLB 4ZHRB 1SC3B 5KFIA 3M2RA 2C2NA 2N4DA 1HKAA 4OYWA 2MQMA 1X9SA 2QMUB 1RT1B 8ATCB 3H90A 2UXDJ 2DNKA 2P8IA 3A4TA 3NS5A 1Y5IB 5A2QU 3NGTA 2ZHOA 3MUVP 1N5QA 5IWAJ 3KDNA 5KFWA 3W7BA 4YEAA 5LM7E 2EFVA 1RT3B 4OJ3A 3GONA 1H98A 2AJ0A 2H1YA 2XZTB 4TYAA 2VPXB 2R7XA 3QSIA 4F4KA 2I5JB 4ZJOA 3FRYA 4BLGA 2JJ4D 2RF2B 3BPSP 3ZTSA 2ILYA 1U49A 2ZKTA 2JVOA 1IQTA 3S1TA 2GVZA 1I94J 5KG7A 1MROA 3F0NA 1ZZNA 2YQ3A 2XLIA 3OSPA 4B3TJ 4HDHA 2C2RA 1BY9A 2WOMB 5ETQA 2MKSA 4JI1J 4RUBA 1HMVA 4KGKA 5LMNF 1WOSA 4OI0A 1U48A 1H3DA 1Z1ZA 1X5SA 1G7CB 2BXJA 3FQLA 1RT7A 2X1GA 2AT1B 1EX8A 1IKYA 3DOKB 4K4YA 1S9GB 4O44B 4PWUA 5LOQA 1S48A 4QWDA 3CC7S 1WF1A 2O1PA 2Y1JA 1Y5NB 2B5JA 4PG7A 5HVHA 3J81U 4JI3J 3O3LA 2MKIA 3U02A 1IKVA 5F8GA 3JQMA 3JSYA 2PO4A 2NPIA 4PXDA 4DF4A 2AYMA 4YDXA 3IRWP 1Z2LA 3EZ5A 3T5KA 2P9CA 3BM7A 3EXCX 2HEKA 2V5HG 4P73A 4Q5VA 2PI5A 4QIGA 4ED1A 1IR2A 4PXEA 2V0NA 2CXEA 4DFKA 1XMOF 4YR3A 2Y1LB 4UQGA 3QRPA 1K1SA 3SQGB 4BDPA 3VGUA 3EPIA 2LVWA 4ZHRA 4P9SA 4U67Q 1IBKF 1KHVA 1TKTA 2C3OA 2HNDB 2WK4A 4RW4A 5E3RA 3NL0A 3VAMA 4WKRA 2BDPA 2VBZA 1IKXB 3M8YA 4CLFA 2JEGA 1Y9OA 2P9EA 4MK7A 4ETXA 2HGNA 1HNZF 1EARA 3D9BA 2VFUA 3M8QB 4KO0B 4ECWA 5I3UA 4F3MA 1SB6A 1WF0A 4U8YA 4MKYA 2EG1A 2W2OP 1U8WA 4DV0F 2CVEA 3ITHA 3UR3C 4TU7A 3KLGA 4CYUB 3G71S 1RABB 3D1HA 2GQ2A 2RIJA 2DR9A 1YWXA 3G8SA 3DRPB 2BE9B 5FLXY 4Y2MA 1AB8A 5J2PA 2HFSA 1UWBA 1HPZB 1RB0A 5AJ3J 1GMWA 2KYXA 1TL3A 1U1OA 1XEZA 1FE4A 2BW2A 2IC3B 5J1NA 4Y2CA 2Z57B 1WACA 3FSYA 1S0VA 1APSA 2J7UA 5D0GA 1NB2A 2BRLA 2E5IA 2YPYA 1WG4A 3JQJA 5F8IA 1K8AT 2ACYA 2JOQA 2RT3A 1S7IA 1WF2A 5H9EK 4LRDA 4B3MF 4QR2A 4C8ZA 3HHDA 1U0SA 2YNGB 1NBEB 2EC2A 3FDSA 4LRCA 4JI4J 1NH7A 4LFCF 5E7OB 3MUMP 2V8HA 2BJDA 2M70A 5B0EA 2DJWA 3GJTB 4JV2A 4DR7J 4X62J 3TARA 2V69A 3P45B 3NEKA 5DQGA 2V50A 3CDAA 2D41A 4CTAA 4X4TA 2HHSA 1LWFA 1PAEX 3D6FB 3FQKA 2BJ9A 2K3KA 2DHAA 3G2XA 3KLIB 1S0MA 2VHGA 4K4VA 1TU0B 1ZPVA 4NA2A 4ZITA 4YB1P 1WC5A 4J9RA 4RWWA 3VV2B 2FVQA 4JI1F 1RWKB 2WBRA 3R5BA 4MMOA 3W65A 4UW2A 5AE2A 2B3TB 2KVQE 4FS2A 4ED3A 2J0QD 4CNYA 2GGPB 3LAKA 2C2MB 3BDEA 1NRKA 4RBUA 4IR9A 1FD8A 2ZUAA 1HPZA 2QL9B 3EMTA 1B0VA 4P74A 4R8UB 5IV3A 3MURP 4F50A 3JB9k 4LFAF 2L3MA 2QN6B 2ZDPA 2L48A 1HHTP 3A3OB 2H65B 4ZPWR 1CG2A 5T41A 3W60A 2F40A 1MW7A 1WHYA 1XBWA 3UWTA 3UD3P 2XNQA 3DLKB 4UQTA 4OMFG 4C11A 1CQNA 1R43A 2XTJP 1RHMB 1SKRA 2NXUA 3QGPA 2BOAA 1KS2A 3D3BJ 3R5GA 4I2PB 4KO0A 1RCOB 1VDHA 4DN0A 3EYZA 4LFCJ 2R4FA 4IH6A 1VIXA 3LH2S 3C6UB 4OZ1A 2W2MP 3VGTA 3T41A 2KH9A 1U47A 1K73T 3PTWA 1RT1A 1ZA2B 3G8TA 3GCXP 4NYPA 3KUGA 4C8YA 2J8SA 2EBEA 1O0PA 1VISA 3NBPB 5FDLA 1T8EA 4ZOSA 3GMGA 2D3OR 1SQFA 2CPIA 2BX6A 2CQIA 5C25B 4M5DA 4DSKA 4GKKJ 2WW8A 5HVFA 5MAOA 4YP3A 3DRRA 3GIIA 3D6MB 1IM4A 3BKUA 1HR0F 1F2HA 2XMMA 2R2UA 4OHYA 2FHOB 1WHVA 4N8OA 3UDVA 2B7CB 3AQOA 5CYMA 3I9ZA 3HHLA 3MPWA 2DXEA 4NMXA 4OJHA 2A18A 5KFAA 4CIOA 4OL8A 3J7YI 1G3OA 1ACMB 1HWUA 2HNZB 3A12A 3LPYA 3MM7A 4U96A 1REVA 3DOMB 4IFVA 4U7UK 3R9LA 5L9XA 4IQMA 5AXKA 4ZVEA 5J2QB 4F0HA 2BM0A 2ZBCA 1T9UA 4CI0B 4QOTA 3V6JA 2CQGA 3KUEA 1FKOA 2UXDF 1SKUB 1UAWA 2HK3A 2MGZB 4C9DA 4PWDB 3M9NB 3DCAA 4B3RJ 1G4CA 3TEHB 2AEMA 2KXHA 1VRQC 2W9CA 2N3LA 4G3IA 5MLCV 2J6SA 5AXLA 5A8KB 2GIQA 1MROB 3QAEA 2MSTA 2OPPA 2PA8D 3E01A 5THWA 4F4WA 4DV4F 1F6TA 3F73A 2NYHA 2RUSA 1VRUB 4QYZK 2R7VA 4PKDB 4F4AA 1S1VB 2ZHBA 1UVNA 3CUNA 1D0EA 2KB2A 3TUJC 4P6QA 4M5KA 2ZDOA 2G0IA 1CJTB 2F4VF 1XJWB 2KKHA 4GC7A 3RB0A 4DR1F 4DPXA 3HDSA 2QL7B 2MJNA 3HSDA 5BYSA 1X4EA 4AL5A 5KG5A 1VC6A 3D28A 4DBQA 1UFKA 1N5VA 1U0HB 2K1RB 2MZ1A 1KONA 3MR7A 3KLEA 4QZVB 2Q6BA 4F4ZA 2R8HA 3P49B 2V8VA 4KYZA 1RWMB 2VKZG 3QIPA 3DRPA 1IXKA 2IIHA 3E8OA 4ZVGA 1XMQJ 3CXCR 3CCUS 4B17A 2JWNA 3EVOA 3MMCB 2KT5A 3G6YA 3V6KA 1SKSA 5DS7A 2RKIA 1GTEA 2OEKA 2XZDB 2UUCF 4DL3A 3E3XA 1X5TA 4YUDA 1NKCA 2M8HA 2KG1A 4USHA 3LALA 2IHR1 2U1AA 5E3AA 4A47A 2B51A 1UJ5A 2GMJA 1RTZA 1GMVA 3SDEA 4JI0F 4ID5A 2YNFA 3QIDA 2HRTA 4XAKA 3PZPA 1NSAA 2XG8A 5IS2A 4U6PA 2VPZB 3BJYA 3EM1A 4WZQA 2HWHA 3KLFA 3THVA 1C1CA 4J90A 4AD6A 4CT9A 1U6BA 5D4OA 1UPMB 3VWSA 3MPVA 4KGZB 2RU3A 1DRZA 1JLCA 4LRFA 3RAXA 1B0PA 2DO0A 3HFKA 1SL1A 5J2NB 4B02A 4PPDA 4ZK7M 2PMZD 4OI3A 2QYGA 3R6LB 2HHTA 4J9PA 3NP5A 3ZNJ1 5ADZA 4IRDA 1NDLA 5C5JA 2XSJA 3C66A 1N4LA 3Q8QB 4DFMA 2UZAA 4J9LA 1RZMA 1VK3A 2YNIB 1NKEA 4I6AA 4L72B 1CVJA 4OFZA 3PIPQ 1TTHB 2UUAJ 3M8PA 2QV6A 1D09B 4O44A 2BBEA 2PGCA 2VG6B 1DHMA 1FRMA 4H4MA 1RA6A 1FEEA 2MHEA 3C6TB 3CJTA 3ENAA 5BYQA 4DCPB 3RB3A 4RZRA 2IDEA 4FBTA 4PYDA 2C42A 1XR6A 1H6KX 1SBRA 1SUQB 2QIFA 4ZVHA 2X1AA 3T3FA 4PQUA 2F5GA 3PJ9A 3TUZC 2GS8A 4EMDA 1IKWB 1SH2A 1N0VC 3OTBA 2IY5B 3AJ2A 4Q2LA 3VAIA 1FDDA 4CDIA 3HF5A 4LF7F 1UEKA 1GFWB 2FHKA 2JX2A 4MT1A 4TVAB 2HHXA 4ITSA 2RJZA 1TKZA 4IDKA 3M2VB 3UVJA 5AE1A 2DKOB 3G82A 1TMJA 2MKYA 2ZEJA 4DL7A 1PJ5A 2M9KA 1R8CA 2QJ3A 2RE1A 4NLRA 3KK2A 1QUPA 1FKAF 1FK9B 4OYPA 3DGVA 1VBXA 2D74B 3MZIA 3NMAA 1WTFA 4QIFA 2CQ4A 3HPOA 1U1RA 5LMUJ 2V2KA 5KG0A 2ADCA 2FPHX 5DLGA 2NREA 2AJQA 2LXIA 3I0RB 4WP9A 3AH6A 4WXWA 7AT1B 1C0UB 2WSFC 3H4DA 1CJKA 3DRSA 2LFVA 4QWAA 2W7OA 1JX4A 2E29A 4EUVA 4OZ5A 4X4NA 1PILA 1TKXB 1RT5A 4HR2A 1NM2A 4WU2A 1LW2B 1ZM4A 2GX8A 2OI2A 2G1HA 3I5CA 2E9RX 3GG0A 2B9XA 4JI6J 3PEHA 4FPIA 4OZ2A 2VA2A 2CQ3A 5DM6Q 1VQMS 1GX6A 1LWEA 4DZ6A 1S1UA 5KFJA 4ZIVA 5D0EA 1QVFR 4OI1A 3PW0A 2BM1A 4YHHJ 2SXLA 3RU0A 3PO4A 1XMOJ 2P2CB 1GAOA 4MFBB 4RNFA 1RYRA 4CLWA 1S10A 3CE8A 3M8SA 4A8MP 2VC0A 1H2UX 3W1YC 2ZVIA 3DRYA 1U1KA 4EO8A 2ZNYA 5ETKA 4CNZA 3OVAA 3Q23A 4X4VA 3MEDB 4CCHA 4V19J 2B6AB 2RQMA 4DR1J 4J9SA 3V4IA 2DGTA 2WONB 3X3UA 1VOMA 3MCNA 2ZH8A 2DVIA 3IBCB 4Y65A 5HBMB 2A1BA 5LJ5Y 3SV3A 4DL2A 4XIUA 3N6LA 3BBBA 2K06A 1TKXA 4UOCA 4WFXA 4HHUA 3EGVA 2HZCA 3HLUA 5D0RA 4LR9A 1I1GA 4MIAA 1J5EF 3AFGA 4RU2A 4K50A 3VHQA 3SSRA 1AT1B 3CCTA 5U47A 2J6TA 1D8ZA 4N77A 4NA3A 2IJNA 4JB8B 4TLQA 4A8SA 4TQRA 1ZS6A 1RK8A 1S4FA 2BUNA 3G86A 3M32B 3DLEA 3H5XA 4N41A 2JL9A 1DTTB 2UUWA 2YQ0A 4NCGB 3WDOA 1FK9A 1FO1A 4USMA 2PMWA 2AJ2A 1VHFA 2EW9A 4RW7B 3HT3A 3CJ3A 3TZZA 2ZE2A 2XI3A 3MR3A 2ZH3A 4XK8C 3TUPA 2FDNA 3H0PA 3QIPB 1BQNA 4M5NA 2GC8A 4M5MA 3HVTA 4DX8H 3I0SB 2CQ2A 2Z56B 2RRNA 3L7OA 2NS1B 4NL5A 3JXOA 4YR0A 1OQ6A 3BGUA 3PEJA 1I5OB 3QBCA 3LP1B 1XMBA 4LSNA 5A8WB 4USWA 2LEAA 3D7SB 2YWHA 5AXMA 3KLEB 1HR0J 4FN5A 3IGNA 4UF4A 1MMNA 2H4WB 3CD5A 4I64A 4LF2A 4RBVA 3AJDA 1WEXA 4GKKF 4KE5A 3KMSA 2FJAB 1DTTA 4NCGA 1X4GA 2R2SA 4ZLNA 3FFIB 2ZH4A 1WHXA 4Y3CA 1LV5A 1KR4A 2JLFA 3WIVA 1D3WA 4ETZA 2HPUA 4CLZA 2V94A 1LWXA 1NUEA 1HHQA 1S76D 4KV8B 3SEOA 5AJ3F 4DL0C 3LWLA 1N88A 4GKJJ 2YKQA 3DOLA 4IO1A 4LBHA 4NXMF 4JI7J 2GIFA 3MAAA 1HWLA 4EYHB 1QE1A 2VFVA 4O4GA 3VZIA 4EBDA 1TK0A 2OH2A 3OTCA 3BS9A 1Y7PA 4P71A 1FJEB 4C6AA 2DEJA 1UWAA 1FRXA 5HP1B 3B54A 1D9FA 1UEVA 1Q8LA 5HLFB 3LP0B 2PFFB 3R5JB 2RS8A 1JLQB 2VG6A 2N7CA 4J9KA 1EZZB 4PRFA 4RWXA 1OY8A 4WIQA 5BR8J 3KHRA 3MXHP 2O3DA 5KFZA 3EGZA 1B70B 4PXBA 1N8RT 1IVZA 3SSQA 2F8EX 2QSWA 3DI6B 4P2XA 4C7QA 2LECA 2AP6A 1DLOB 3RAQA 4PUOB 3AOCA 4EU0A 1VQ6S 1CULA 2Q6CA 1SQGA 5B08A 2MHNA 2VF3A 3T5LA 4K4WA 3PNIA 3KHLA 3MMCA 4WTOB 1G2EA 3IG1B 3NXZA 3V6DA 1WKJA 3HO1A 2CPJA 2ZD1B 2ZC4A 3AA8A 3GPAA 2X7IA 5KFMA 1Q78A 4L75A 3WZ0A 5J2NA 1YJ7A 3M7VA 4WYWA 4ER8A 3P4UB 1CJVB 2WW4A 1IM6A 4P7VA 4DL6A 1TELA 1WWHA 2X51A 3QYYA 3PXGa 3VR1A 2KL8A 3G4SS 4W90B 1QM9A 5IT0A 2HLTA 2KXFA 1CBKA 1HNVB 1WELA 4RU9A 1JB0C 2CNKB 2G1DA 4QQBA 1FJGF 2HHVA 1C0UA 3I5BA 3EJMA 2VH7A 3CCWA 2VODA 1P6TA 1PKUA 3QSYB 5K20B 3CMQA 3IO1A 1M1KT 4FNIA 3SCLE 3TVZA 3O44A 5KG6A 3MCSA 3ZO7A 1S0OA 4IUFA 2HIYA 2F65A 1VQPS 1AFIA 1EQ0A 5KFNA 2A6OA 3NNCA 2B4PA 3J7AN 3C46A 2CA9A 4LREA 4NEZA 3CJSA 1NKBA 2UU9F 2R8GA 2VOOA 2PDAA 2FVCA 5J2MB 4OZ3A 2E1RA 8RUCA 4U9RA 4L6V3 2HYIB 3BSAA 3OVBA 1PSDA 2D69A 1LQ9A 3FBCA 4I6WA 3FVYA 2W7PA 2VQEF 2KZZA 5ETPA 3T1AA 3HHLC 4AUKA 1U0HA 1SUQA 2LEPA 1HNZJ 1WDDA 5J1EB 4PQUB 5IT9U 4X84A 3Q86A 3TJAA 2DCLA 1ICEB 1VQ8S 4YY3J 1VFJA 3CT9A 4JYAJ 2HGMA 3AQPA 4USUA 4CLYA 2IA6A 1U6FA 1CQMA 5HROA 2RRAA 4DR6F 3MEGB 5LT5A 1VBYA 1REVB 2H5JB 2DD8S 3DOMA 3GZ7A 5B0GA 1WC4A 3HXMA 4QCLA 3CCJS 1F3FA 1FTCA 1JXVA 5KFEA 4DHVA 5K14A 1WUUA 2F63A 2OAUA 1NHVA 3DGPA 1TR0A 2IRYA 3HHLB 1NCLA 5CYMB 2W9BB 4RNMA 1CJUB 3TANA 2MQLA 4G6VB 2D3ZA 3HHEA 1XN9A 3D68A 4Y2IA 3UI3A 4ES2A 6FDRA 4OV1A 3GQCA 2ZH1A 3UN3A 4CLPA 3OUYB 3BSCA 2FJBB 2CDRB 1FFWB 4OX9F 2VQFJ 3KG1A 1X0FA 1ZAVA 4JV1A 3Q2TC 4W98A 3MM9A 1SL0A 3RR7A 4OYAA 3R2CJ 5DRKA 3CJRA 1HFEL 2VKRA 4H4OA 2VUGA 3F56A 2LQ5A 1U1MA 1RBOB 2LDYA 4WPAA 4YS2A 4NLOA 3MWBA 4TKTA 3O5TB 3RYLA 1VLOA 1HBOB 3MM7B 4F4XA 3V6HA 1H0HB 1NJZA 2DNQA 3ENWA 4WE1B 2MKHA 1UL3A 2BJ3A 3T6BA 2XEXA 3CDEA 3DLGA 4LQ9A 2E1PA 3DLGB 4URGA 1FI4A 1ZM3A 2DIUA 4DUYF 1YITS 4EZ9A 3C3LA 4ALZA 1MU2B 1RI7A 2J0WA 2CPYA 2DGXA 2NUUG 2O66A 3CDWA 3EDRB 4DCJB 3HI9A 2AGPA 1L3KA 4M1KA 4QR0A 2N3OA 3O8WA 3IGVA 3THTA 3PV8A 3DLHA 4X64F 3L09A 6FD1A 3W2WA 2DHSA 3L9ZA 2FVPA 1KN6A 4JUZA 1V3SA 2RHQB 2QRRA 3IM9A 2VG5B 1T11A 1VK8A 5CABA 5F8HA 1LWCB 2HQGA 2GV1A 1WC1A 1EP4A 1S1WA 2EVZA 2K1RA 3SQOP 3CWJA 3VQTA 8AT1B 4JV5F 2XQCA 2MQPA 4MYUA 1YGYA 2PA3A 5GAGU 5HATA 3IS9A 3K7RA 1KVJA 1R3NA 2JNJA 1S6UA 3GG1A 4G1IA 2XS7A 1IBKJ 4DV4J 5IM0A 4B9NA 2Z8QA 4OV6A 5GAHU 3SCJE 1S9GA 3MEGA 1GT8A 1JLAB 3DDNA 1URRA 1N5TA 3A8IA 3S7RA 2OPPB 2DGWA 3E01B 1RISA 5KFFA 3MR2A 3IWXA 1KHWA 3DFEA 2NZCA 3VGVA 2MLXA 4NRUA 3FCWA 4WF9Q 3FCVA 1VLYA 3V81A 4MK9A 2JH3A 2ZOGA 5CCLA 4NE9C 3GSIA 1SH3A 2RSQA 2W2NP 2LU1A 4F25A 1GXUA 2XMUA 3ENQA 4KBIA 3WX4A 2OD6A 3MGJA 3OHBA 2WAQD 3PO5A 2KHDA 1N5YB 2ZH2A 2D1CA 1SL2A 4WXOA 4R5PA 3TAQA 1VC5A 1RT2A 3KG0A 4X64J 3UR0A 1OPIA 2MEWA 2VG7A 1RWWB 3TYTA 4DS5A 4K4TA 1J5OB 2KI2A 3D0IE 3IS9B 3IR6B 3LF0A 4PEOA 4S0MA 4F0MA 3RB4A 3M8QA 5I3UB 4B3MJ 3LQVA 2HSEB 3TWZA 5HSPA 4KHPJ 3W9JA 4ANCA 4HKQA 4Z7YA 3DRRB 2AU0A 2ABYA 4X2BA 2V63A 2BR0A 1RTIA 5KFBA 2VG5A 3FBFA 4ZCKA 5D6GA 4EZ6A 4LF9F 1R8PA 1HIYA 3LA0A 2LXUA 2ASJA 1GMWD 3NNAA 3JTOA 2C2OB 1TV6B 4DR3J 1NZAA 4TN2A 3OT9A 2HS0A 4EK2A 5IXUA 1WC3A 2XI2A 4F2SA 5D3GA 4E98A 1U1LA 2YWWA 2UV8G 3ZZPA 4DL4A 3OL8A 4PAAA 2CQ0A 1U02A 3R7NB 4ZIWA 3UPFA 4F2RA 4NLXA 1GNKA 1RQ0A 2YNHA 2AZ1A 1WG5A 4NX9A 2R8JA 4CH1A 5DG7A 1GK8A 3LWMA 5E41A 1P8GA 4Q0BB 5KFQA 2KHCA 4XPEA 2V6AA 2IJFA 4ZP8A 4ZVQB 4BHQA 2EFOA 2YWEA 2HVHA 2MTLA 4FNHA 4RO0A 4M5IA 2DGVA 1K1QA 1VS3A 3GTYX 4DMZA 3NRBA 4DQRA 5KFHA 3N01A 4KIAA 4E8UA 4L76A 5E0OA 4KY3A 4WKYA 1HMVB 5HP1A 4RBTA 2QT7A 4IFYA 1NJWA 1AFJA 3AAWB 3NGSA 3G6XA 3PW7A 5LXYA 4Y34A 4DR5J 1BWEA 5DG9A 3JSBA 3TVYA 4RUHA 3PR5B 1EIYB 4YOEA 1QE1B 4AT1B 2KU7A 3MAAB 2VDHA 2V2ZA 1RAAB 1RYSA 4K4ZA 3EICA 1LKZA 4QIVA 3TX8A 2W9BA 4DR4F 4FXWA 1RGVA 5CYJA 4HT7A 3JAMU 1WKKA 2KM8C 4JI4F 4FYDA 1BC6A 2CJXB 2M2BA 2OHDA 4KHMA 3OTOJ 2IMOA 1NJYA 4H4KA 1VQKS 2R7QA 5IQQA 1PG5B 3BEGB 5B09A 3IRXB 5C2GA 2XO7A 1D9DA 4A8FA 2YTCA 2MY8A 4ZP9A 2I6WA 3J7Z5 3OVSA 1RHUB 2QYCA 2UUBJ 2XM3A 4FXVA 4KFBB 5C7PA 3PX6A 1J2VA 1O51A 4FKYA 1UZHA 4D3HA 1TFYA 1F9HA 1Y3KA 2F8HA 2HWIA 4IG3B 2HZVA 1HYSA 5CCMA 1IQZA 1GTHA 4OYBA 4B9SA 2BV3A 2V8GA 1KFDA 3GFZA 4XTTA 3CC4S 2HG4A 4DR6J 1TVRB 2AGOA 5D4LA 1YQHA 3CJ0A 4RPFA 5J2PB 3BSNA 4LJMA 4UOGA 3TP2A 1M5OC 2AX0A 1MU2A 4CM2A 4O3SA 2COLA 2YX4A 5KFUA 3SFUA 2CPEA 5GAHI 2X1FA 1WOPA 2GJIA 3GR1A 4A8QA 3WQPA 4ED5A 1DQ9A 1RE1B 1V3RA 2MMYA 3DLEB 4YB7A 3V5RA 3I5AA 4CRJA 1QVGR 4HL9A 1N5SA 2P9GA 3L95X 5KG2A 1W2IA 2NXCA 2XMVA 1NH8A 2VB6A 1XWLA 4YHHF 3CNQP 1PO6A 3Q8UA 1R0AA 4K0KF 3GR0A 4RW4B 2HFZA 4BBYA 2LCWA 2QO3A 3OSNA 1JIHA 4J5OA 5IC6B 4WBFA 3D0GE 4K0KJ 3TAMB 1HQEA 4OYXA 3W5YA 3OXFA 1U25A 2VOPA 1JLGA 3M1VB 4ED7A 3GFHA 3ET6A 1ZH5A 3I32A 3P96A 3OUYA 5E3QA 1T3NA 4YB5A 1LXNA 2DBBA 3CCLS 2W1BA 1PBUA 1B0TA 1BD6A 1ROFA 3OHAA 3BQ0A 5GMKa 3TQ1A 1U45A 4DR2F 1U7LA 3K57A 4CWBA 4KSEB 4TLRA 5J1PA 3Q22A 5A8RB 2VG7B 1HLWA 3QT8A 2VBWA 3FMBA 3RRKA 5DDOC 1SC6A 4NI2A 4K4UA 2WVDA 2JLGA 4LSLA 4A8YA 2E5GA 5HANA 3N6NA 2MPUA 3F41A 5KFGA 5HROB 1N5YA 4B3SJ 1U26A 2UUAF 2E5LF 1S1UB 3OFGA 1W7WA 2C2KB 2XYHB 2OELA 3MOZA 4D3GA 3MR5A 2UUCJ 2YXLA 3BBFA 1WJ9A 1XMQF 3RGIA 4ILLA 2DHGA 2FZCB 3K89A 3R7BB 1NK8A 1QAJA 3QT7A 1RKIA 4WFYA 1SH0A 5CXTA 2J9DE 3PRVA 3C19A 1AXQA 2X1BA 5D8HB 4JI5J 2HFUA 1F3VA 5FLXU 2FVRA 2EC0A 1OYEA 3PKMA 2YWGA 2VC1A 5F8LA 3HZEA 2MQ8A 3T6JA 2XLJA 2VA3A 1YJNS 4E0DA 1XNRJ 1XQIA 1V6HA 1WDTA 1NEEA 2AKWB 2EFNA 1NK0A 4WP8A 2F7VA 5C42B 1RDRA 5KFLA 1Y0HA 3GP9A 2NLWA 3VAKA 3PX4A 1I51B 1FNXH 4XO0A 5B0CA 3U7JA 1EP4B 1F9FA 1S1WB 2FHMA 1HNVA 3R5CA 1C0TA 3FSIA 1UVJA 1HARA 3GV5B 2VASA 1ZM9A 1RU1A 1BXNA 1Y11A 4WTYA 1RAIB 2FLOA 4RW6B 2FJWA 4LF5J 1GH8A 2W24A 5JJBA 2CKWA 3OJUA 3CD6S 1P1LA 2QA1A 1FA0A 4PG6A 5KT3A 4LSZB 1U2RA 1WKLA 2DRDA 1AA1B 3LAMA 1LOUA 2CZ4A 2D9PA 3O2IA 2XY6A 2UP1A 1NDCA 1L3VA 1IBCB 1TL1A 3ELHA 3I4PA 2CPHA 3MEEB 5K8NA 3OL7A 2NCKL 3GYGA 3UCGA 1AUDA 3KLHA 4ANDA 3M32A 3U1LA 2AYEA 2KM8B 3JSMA 1BWVA 3M8PB 1RWOB 2XHWA 2GZOA 4WK1A 2VQFF 5KT2A 5E3PA 3IFEA 3RAMA 4DZDA 3KTQA 3KJVA 4JOUA 1XNRF 2RILA 4M95A 3UN2A 4FYYB 2B9WA 3LP0A 5B0BA 4WFBQ 2XCAA 2YX1A 3M8ZA 3W61A 1Q7YT 3OFFA 2GHVC 2AQ4A 2DY9A 3ISNC 3DYAB 1CS4A 4F7VA 4OIXA 5IOLA 4UT4A 3NAIA 3J80Y 5A0YA 3MFIA 1N6QB 2WONA 4O4GB 1FEHA 4RNOA 5CD4A 2ZH9A 1FRLA 3Q83A 1IBLF 3ZZUA 1KLMA 4NOHA 5E5NA 2GVDB 2B8QA 2DISA 4DQPA 1CJUA 3CVKA 5L46A 3TZYA 1FT8A 4TNOA 2G0JA 2OMOA 2W2QP 3VGSA 2WVEA 4KAIA 3VF0B 1VGYA 2B8PA 5KFXA 5KG4A 1AROP 1HWIA 1B64A 1DQ8A 1YVFA 3QAUA 1UVMA 4CH0S 1XNQJ 1HBNB 5D78A 3NWGA 4LRBA 2G2OA 3DLLQ 3H2LA 4CLUA 2UVUA 4DI6A 4ECVA 1AYEA 1XNQF 4USJC 1EKSA 4NCAA 3KOAA 3N0VA 1RT4A 3BBCA 1T94A 4OZNA 3V2UC 2XZWA 3HD2A 3P8BB 7FD1A 2CJAA 2CZ9A 5D4NA 4UZCA 1HNIA 2Y8WA 2VJUA 2NPFA 1XTZA 1YBAA 3IC1A 1KOHA 1ZBTA 1RT5B 2WBMA 3T9ZA 4AQYF 4LF9J 3A8KA 1X4DA 2C3MA 4WJBA 3QPIA 4ZP6A 3RJMB 2H3EB 2JHEA 2OD4A 3MCMA 4DV6F 4LVNP 2GIRA 3KKFA 5ITHA 3KK1A 1DZ5A 1CJKB 2GO9A 4Q8EA 4BCAA 1A9NB 3GLJA 4DPTA 9ATCB 3KJFB 3NWRA 3IXQA 4WFAQ 1IUJA 4KR0B 3WHIA 1PCAA 1C2PA 3GIJA 4QPTA 3ZXWA 1S49A 4ZPTR 1U09A 2ZWPA 3IAM9 5H9FJ 2QLWA 4OX7A 3KK1B 3OFEA 1FHTA 4HHHA 2E66A 3AHPA 3WIUA 2ZZNA 4KC5A 3UDLA 1Q95G 2DITA 5G4DA 2FC8A 4LF6F 4C0OC 2V8PA 3QWUA 3ETMA 2XWYA 5KT5A 2V2QA 5D77A 1Q81T 1B99A 3SSSA 2DRBA 4QBUA 1IR1A 4CLLA 4TU9A 2FVSA 3H5YA 1LXJA 1UVLA 4JI6F 3SFGA 2C1EB 2ILZA 1F5CA 3MD3A 4N56A 2HRYA 2JVRA 3PDNA 2ADBA 1GX5A 2Q3PA 2E1CA 2HNZA 4MFBA 1NDKA 2ATCB 2EG2A 2R42A 2M0GB 2DNRA 3OTOF 3CJ5A 2GMLA 4X62F 1H72C 1NDPA 4U8VA 4Q43A 1CLFA 1LWEB 3HFVA 4FF3A 1MWQA 2CPZA 4F02A 1TFWA 2KTQA 5B7WA 2MZQA 2MDAA 1VQ9S 3PYGA 5FIIA 5C25A 3AXKA 2KXNB 1IWAA 1JLCB 2E1AA 2QC3A 4QYRA 4BS2A 5L8RC 1RAGB 2HGLA 5B0AA 4ECTA 2E7XA 3RUBL 3TVKA 3NGDA 4HT5A 4FF4A 4LFBF 3R5AA 5FD1A 1JNZB 2MQNA 2YKMB 1Z2ZA 3A1YG 3G96A 4LFAJ 4IO9Q 1ZTWA 1JWWA 2QLJB 4DUTA 2HQDA 2FY1A 3SXLA 4DX6A 4FP9A 2H5IB 3L4BC 1SPBP 5DLFA 2E5LJ 4F3OA 4LRAA 4RJVA 2AD9A 1QLNA 4CZCA 5KT4A 3EVMA 1NZ8A 1GXLA 3N5FA 3IBFB 4IYQA 1H74A 1UPPA 3KK2B 1M1HA 4U95A 2JFKA 2HVIA 1JJCB 3MEKA 2HBYB 3QMQA 3U1MA 1KVKA 4M5JA 3SBMA 2ZM6F 4ED6A 1T3OA 4FBUA 3GB0A 2DNPA 2MZTA 1URNA 5CAAA 2DNHA 2GGPA 2PC6A 1FDBA 4IOAQ 2LA6A 1RAEB 4ZA1A 3I4HX 5ETVA 2ZJQQ 2HFVA 2K7KA 2DNGA 2ZE2B 2K2PA 4ES1A 4DV7J 3R3TA 2G4BA 2GAGC 3T1HF 4HDGA 1XR7A 1TAUA 4IG0B 3PRDA 5GAGI 3CCVS 5LSLA 3T1HJ 1QTNB 3QATA 3POTA 2IPOB 3H7HB 4NLUA 4NLSA 4DQQA 2EKNA 4EO6A 2Z30B 1VQ4S 4BWMA 4WFNQ 3MI7X 3ZC4A 4UTGA 5F3ZA 1JNRB 1NB7A 2OSQA 1MMDA 2HVDA 3HSZA 2FJXA 2JEFA 1RTJB 3TNVA 2CDQA 3UQSA 4DV5F 4NXMJ 1Q53A 4FYVB 4GVLA 2DH8A 2EI5A 2IBOA 3DYAA 2CQHA 2EXUA 2B6AA 1FRHA 1TL3B 2LQBA 1S9FA 1S0NA 1Q5YA 4XPCA 2HAFA 1JMTA 5E3CA 3DHWC 3W66A 2DGUA 2F8MA 1FX4A 4R0EA 2XGPA 4X4RA 4DV6J 3HHKA 3KK3B 1L3UA 4PABA 1SV5B 1QAYA 1JXEA 3K8WA 1HHSA 3PYEA 5KFSA 4CYUA 2B4VA 2YWKA 3BF4A 3CEDA 3G87A 5DQHA 2JFDA 2DRAA 3H42A 4KH0B 3OPKA 1QD1A 4KQZA 2V68A 4PQAA 4ZVFA 1RHJB 1YJTA 1KRPA 5K8PA 1F9EB 1JLEB 4NASA 4ZPAA 3I55S 4ED0A 3TRGA 3OR2B 4QIWD 4ED8A 4YR2A 2A6MA 1IKXA 2IYIA 3KNGA 3LGHA 1F1BB 4OYIA 3W8PA 2WVFA 1X9WA 2HW3A 4JI3F 2KN4A 2HHPA 1TVRA 4DPWA 5M2UA 3TEGA 2X3DA 4CO0A 3SIPB 3KG4A 3HZGA 5HMZA 1K47A 3AOBA 2FD2A 5DZ7A 1R0CB 4IG3A 3MMBB 1HYSB 4GVBB 3KDOA 3G9CA 3DKDA 4OYZA 2D7SA 2YX7A 2CQPA 3DLBA 4ZP7A 1KBRA 5EHHA 3RBXA 4ZDNA 3OBIA 2CJKA 2BA9A 3IRXA 3CB4A 2UVRA 4XDCA 5DGBA 4QJVA 4C0BA 3N79A 2E5JA 2IFXA 1TK5A 5JXSA 4LF7J 2ZM6J 4OZ0A 2C22A 1RT7B 2EFGA 3DDIA 2OTJS 4ZKAA 1MWYA 1Y10A 2RRBA 3QLHB 2RDJA 1GMUA 3AJ1A 4R8UA 4IOCQ 4C3KA 2CQCA 4OHVA 3MR6A 2F4FA 3B78A 1WC0A 1VJWA 3J7A1 3BGLA 5L39A 2J0SD 3MTKA 4LF8F 4URSA 4LBPA 3BPDA 4MKAA 2K8GA 5HK4A 1FNMA 1FKOB 3IM8A 2V67A 3DMJB 1SQEA 2WSCC 5C24A 3GIRA 3OR1A 4NZ6A 3GIMA 4N76A 4A46A 2XNRA 3RBEA 1A6LA 4Y28C 4NLGA 2CG4A 4CP5A 1LWFB 3KLIA 3NKYA 4G1QA 2J7WA 3C16B 2FUG9 3NGRA 5M2RA 3HK2A 3PACA 2VD3A 2EEYA 4LSLB 3C2PA 4KJIA 2BE2B 4QWBA 1J5EJ 2MSSA 2BQRA 1ULRA 3T9NA 1X8DA 2YNIA 2VPWB 4UOHA 3CGIA 4DSEA 1RU2A 2FHJD 2ZZTA 3CO9A 3MD1A 3RB6A 1H2TZ 1Q79A 2AJFE 2XSJB 1L3TA 1MSWD 1G6BA 4M5GA 2ZVSA 3QJJA 4C0HA 2BJEA 1BQMB 4PG4A 1QDUB 5LSOA 3UO0A 4DL5A 3ZZRA 3BGOP 2CIMA 1DURA 1TV6A 2ZH6A 3D66A 4DR7F 3TZXA 3KLFB 3OXLA 3LW5C 3NBPA 4C8NA 4AL7A 2XY5A 1U4BA 2MXYA 2RD5C 3B82A 2YQ1A 3BN7A 3TJ9A 2YNFB 4C8LA 3HCXA 3H59A 1RACB 4WU3A 4DV2J 3P5BP 2YH0A 3C6UA 4X66F 3RG6A 5CYQB 3NGKA 3TOQA 2AWZA 3VALA 1S1TA 3ITHB 1JLBA 1H2VZ 2CQBA 3AXMA 2EFQA 1FKPB 3DC2A 3SCIE 1IBLJ 3G8QA 2Z2ZA 3DLKA 4C11B 3I56S 2DR8A 2VONA 3I9V9 3OLBA 1WI8A 1Z4UA 2B56A 2FTRA 1NHKL 3HD1A 4AE5A 5GADI 3WC2A 2L9NA 4DF8A 4KKOB 2MJUA 1SXLA 1HBOA 2VZ9A 4LVOP 5DZ6A 2E9TA 1Q5VA 1N36J 3CDBA 3MPYA 4DX5A 4B3SF 1R89A 2KDOA 2RVJA 3DXSX 4B3OA 3ZTOA 4O3RA 2FB0A 4NLWA 4X4SA 2AMCB 1Q8KA 2BEFA 4DU8A 3UCZP 5JVHQ 4B9UA 3LANA 2OPRB 3QJPA 2OPQB 3H98A 1BQMA 2D3O1 2C2DA 4TXSA 4QWCA 3MAQA 2PI4A 1UJ4A 1X4CA 4ECSA 5CHCB 3UDCA 1HL6A 3KUHA 3D1QA 3ENVA 1J5OA 2R3VA 9RUBA 3ILIA 3DGPB 2W01A 2ZBRA 1QUVA 2XBPA 2KFYA 4LMZA 3A3NB 5EGYA 4I0WA 2QFIA 4DPOA 3CCMS 3HP6A 1YRXA 4KTQA 2KG0A 2DH9A 4ILRA 1GQEA 2VIHA 1T9VA 4YMEA 1UEUA 2LMIA 2OPSA 2W4DA 3L3CA 4DV2F 2OPQA 3WC0A 4J9MA 1VJQA 3ILJA 1W25A 3V81B 1PJ7A 3K5NA 3BB5A 4YY3F 4ZCLA 3VZHA 4NA1A 1S1XB 2PMHA 2CWKA 1UW4A 3V4MA 4A8OA 2FZGB 3W2WB 2RAQA 3VAJA 2CFXA 2DHHA 2Z0GA 5D15A 3SV4A 1HBMA 1S99A 3GWCA 3CC2S 2FLNA 3CJQA 4JI7F 1UVIA 1KWMA 2NR0A 2IM3A 2Y3YA 2V8DA 4BC9A 1VQ5S 2BQ3A 1I6JA 2PT0A 4NLDA 2HVEA 2K3IA 3DM2B 5HMWA 2UV8A 1FVSA 4A48A 1T02A 4OI4A 2YPZA 3H8YA 2PN6A 3L7PA 4NYZA 1U24A 3M30A 3OXGA 1QAXA 3W9IA 4DWIA 1KFSA 2YBVA 1N33F 5BR8F 4KPCA 1LWCA 3AD8C 3MMBA 5HVGA 1M5SA 5CZVA 4IRKA 4MKVA 3QZ7A 4DLEA 3IN5A 1SJ3P 1KKHA 1NNDA 4DQIA 3FEYB 2EPIA 1M1GA 2CJ9A 2GMHA 2BOPA 3AT1B 2F4VJ 3TO8A 3CIMA 1TL7B 4DR2J 1TQLA 2FGOA 2MKCA 2QA4S 3I31A 1N34J 2EKYA 1Y3JA 1D9AA 3PRBA 4WE1A 1R8BA 2HWTA 2OFHX 3FBBA 1JKHA 3LGNA 4M8LA 3TQEA 4C98A 4TQSA 4LF4F 2H48B 3TJ8A 1FDNA 2XHCA 2IA0A 4CO4A 4EGLA 3C16A 2GCFA 2MY7A 2QL5B 4RW8A 4MH8A 4LFBJ 3ZZYA 3ADAC 4AFFA 1F60B 1S1XA 2BVZA 3WX8A 3EPGA 2H54B 2ZH7A 4OYOA 2HURA 2DNNA 5EX3A 2RB7A 1PC4A 1WSVA 2J76E 2J7KA 2Q43A 4O3QA 3R97A 2Q66A 1N32F 2B4OA 3KHGA 2KVIA 3BKTA 2QE5A 4FKXA 4DV5J 3R1LA 4USIA 2DPJA 3FZBA 2V4QA 4GC6A 2HHWA 1VQOS 4YDDB 3RZAA 3Q8PB 3QRRA 2FHJA 4MAKA 4KV8A 1BE4A 3KWMA 4ZVUB 3L7UA 4FYWB 2P6SA 4ZVOB 1RAFB 2VL1A 2DNYA 5IM0B 1A7GE 5L1JA 3POTB 3LO3A 2BMBA 3AOAA 4PYAA 5KFYA 2Y8YA 1GEHA 4QYZJ 3P5TL 4ECZA 1NMEB 1TAQA 3MHYA 3VCDA 5KOWA 3JTNA 4B3TF 2VU5A 1UKUA 2H4YB 1M0SA 2L9WA 3S01A 4AXIA 1NO8A 4CLKA 1N0UA 3TW0A 5DETA 2DY1A 3D2WA 2R7WA 2HLUA 2POKA 2MKKA 2RS2A 3MMAA 3K58A 3I6PA 3BGRB 3W62A 2I1RA 3CJ8A 2XMAA 1M90T 4B9VA 3QT6A 2ACMA 3OL6A 5AE3A 3GU0A 4IKAA 4K5RA 6AT1B 2G0CA 4LUBA 3OR2A 2GQCA 3GIKA 3VVTA 4EWTA 5T14A 2KFZA 3NOGA 3KLGB 3FEXB 3OW2R 5G0RB 1RTDA 3MM5A 3VQSA 5CD4H 2IYGA 1D8YA 1YDLA 1JLBB 1SJQA 3CW2C 4USKA 3BDPA 3ICLA 4J7CA 1KTVA 1Q1KA 4I56A 4PUOA 3I82A 4F3QA 2BJ7A 4B3OB 3FC9A 2HBZB 2CQ1A 1O5JA 4DS4A 1RWXB 2HIQA 1U1PA 2YKMA 2QG9B 2MZJA 1KLMB 2WVBA 2BACA 4QIEA 2XMTA 2DR7A 3N9UC 4FF2A 3CSKA 3SQGA 4CO2A 4JV0A 2IRUA 1MLAA 3HVWA 5IZHA 3JYTA 2JLEA 1DQAA 2J6UA 1MN9A 4DFPA 2ASDA 2CADA 2ZD1A 4AL6A 1AUSL 2W8KA 4JYAF 4IR1A 3M6XA 3IG1A 2ZUGA 4ZCIA 4FVCA 3V6DB 4OI6A 2R7TA 3X1LB 1CEZA 3MM8B 2AYBA 1WI6A 3RRHA 1S79A 1IKVB 1PC5A 5E2QA 1KQGB 4DSFA 3C14B 2B5JB 4NLPA 2BE2A 4DJBA 3T5HA 3NCQA 5A6WA 2DIVA 4CLSA 4F0KA 2R9LA 1S9EA 3RBDA 4RW9A 1FXLA 1CC7A 2MZSA 1NXIA 3EGNA 3HT0A 2Z2YB 4HI2A 4NWBA 1E6VB 1V3ZA 2AJ4A 2V9WA 3NGUA 1QSYA 4U7UD 4IG0A 1AZSB 4YB6A 1C1BA 2IVMA 2DYAA 1TL1B 2L08A 2WB1D 3BYPA 2WOMA 1PIEA 2LKZA 3ILOA 3N6MA 2RNEA 3QGIA 5I3QA 4ENOA 1Q82T 1QJHA 4O3NA 2RU9A 4L3KA 3EE3A 4CO3A 3LPEA 2HQIA 4KPYA 2R8KA 1O6XA 1PJ6A 3UD4P 3K17A 3R1HA 1FRIA 1RBAA 3J7ZT 1RXOB 1TZ0A 4P2FA 5LMUF 4HI1A 2XWXA 4DU7A 1NK7A 4P2MA 4RKUC 3IR5B 2W7AA 2VJVA 4F36A 1KQKA 3ZZ0A 4DFJA 3SI8A 2V34A 1YZ7A 1FWKA 2F9DA 1T9YA 4CO5A 2CPXA 3NAHA 4GVBA 1L5UA 1NAQA 1S6QA 2H9ZA 3ULHA 4C48A 4Q2MA 2ALZA 4LF4J 4RX6A 1GXTA 1DTQA 4OYMA 3PW5A 4FXDA 2A2CA 3W5ZA 3BR8A 2ASLA 2CVIA 4OX8A 3K5PA 1ZA1B 2JRSA 2M52A 2VV5A 3W2VA 4KHPF 3FEZA 4N47A 1F5AA 2QEXS 1EQMA 4DG1A 5KT7A 1C1BB 4F4YA 5JMNA 1HWJA 2QZ8A 3PHEA 1TMMA 4RNHA 2HBRB 4UUXA 1R8HA 2DR6A 5CA5A 4ZLJA 4I1TA 3N5BA 1LEOA 4RW9B 1YSJA 2V4RA 1FD2A 5F9LA 3DI6A 2YKNA 4FVMA 3R2DJ 3KK3A 2YKNB 2WB4A 1RHQB 4NZ7A 1HD0A 1N48A 1EAYC 1S6PA 3VTIA 5A8RA 1SIZA 4C8MA 1BGXT 2JEIA 3QWPA 4MJKA 5KFTA 3GV7B 3R8YA 5HLFA 3T1YF 1ZM2A 5FJ4A 1FRKA 1UA1A 3R5DA 3OL9A 4OJGA 1MN7A 1UTAA 4DV7F 3QFHA 3J80U 4ZPBA 2I0XA 2KT2A 4HH1A 4KGXB 4OX6A 3DN9A 4DV1F 3MEDA 4ECUA 1LNQA 3CF5Q 1T03A 5SUHA 3ZTPA 2BRKA 1LK5A 4ZVSB 3NG8A 1Q16B 1FERA 5RUBA 2HQFA 4ID5B 3CTRA 1JQGA 5CZXA 2DK2A 2PSZA 4ZVRB 3M9OB 2BJ8A 1JXLA 5DDPC 3RR8A 1PBAA 1LW0B 2KT3A 1N56A 1J27A 1SIWB 2XMKA 1FXDA 4RUAA 2AX1A 4Y6IA 2EBGA 5HI7A 5JVGQ 4JV5J 2VFSA 3DU5A 3UDEA 2DCUB 4JP8A 4J9NA 3HKZD 2UXCJ 5GMDA 2PIIA 3PJXA 1UZDA 1WEYA 1YZ6A 2O01C 4OHXA 3HMJG 2DGOA 4ATNA 4I67A 3TAPA 4DPUA 2J9DA 3G82B 3UVJB 2RUGA 4BWJA 4DSJA 1HBUB 3M2UB 4I7FB 1RWVB 2GFFA 2VDIA 4RW6A 2J0XA 2XMWA 4Z7CA 2BJ1A 3N4WA 3QT5A 4YN3B 3UW1A 3H40A 4X66J 2H51B 3CCZA 4KH1B 3O1LA 2FLLA 1VQYA 1RA7A 4ED4A 2HHUA 4RW7A 4WIIA 2A3JA 2OMLA 3FJ2A 3GSDA 3I0RA 3T5JA 4DV3J 2QGFB 3AB4B 5DDQC 4DXLA 4ZN1A 1E6VA 2OIHA 1BLUA 1FRJA 1MG7A 1ZZFA 2AZ3A 2CNLB 2DO4A 3NY0A 3OFHA 5L38A 1KEKA 1YBUA 3MTJA 4K4XA 4K4SA 1LW0A 2MKJA 2WVCA 1E6YA 2BKOA 2J5AA 3C14A 3ETOA 3FSXA 3FUYA 1DJ0A 2C2ZB 3CMES 2CUYA 3BR9A 3JAMY 4GKJF 4MTPA 5F8JA 1BUXA 2APOA 3MM6B 3M2VA 5H1SV 2XYGB 4HACB 3QZ8A 1WEZA 1SJ1A 5EUHA 3NCRA 1RBLA 2BANA 1JK9B 2I9SA 2IRXA 2J8AA 2Z2MA 3MOJB 2ROGA 5F9NA 1CS4B 3IWNC 3CJKB 2K7JA 1JJ2R 4B9MA 3FBEA 4X65F 2QLBB 1AZSA 3GJRB 4OJ1A 2FJVA 2DGSA 2UXCF 1DBDA 2KYZA 4DSIA 4ECRA 3M05A 4CO1A 1ZAWA 3PFEA 1HNXJ 4JI0J 3DLJA 4HHJA 1R6VA 3MECB 2JC0A 1JKHB 4QW9A 1L3SA 4Q0BA 1TUWA 1V5VA 3CCSS 1EKRA 2VBYA 3KLHB 1PGZA 4ICLA 2F1FA 2B9YA 4NZ0A 4FS1A 5G0RA 1U2CA 1T05A 2LEBA 4J9QA 3I96A 3IWLA 2AEFA 2I8EA 5K8OA 1VI7A 1HI0P 3AY0A 2ZC3A 4Q45A 1OIAA 4P72A 3BH7B 4USTA 3ZZTA 1ZOTA 4EI2A 3K5LA 2R2TA 1HW9A 4Z37A 1NPRA 3SZ2A 1EETB 2FYXA 3JQKA 2OTLS 4AXJA 4LF5F 1I3OB 2XC9A 2ZKUA 2KO1A 4TU8A 1SVDA 1YBTA 1YJVA 1JLFB 3QRQA 3QJLA 2KZMA 2ZBPA 2V4JA 4J91A 3CCRS 2ROEA 3W5XA 1X4FA 2YKOA 3NNHA 1Q7LB 4Y00A 3PIOQ 1NHUA 3M30B 4I69A 2C3PA 3K2YA 2LQ9A 1NSKL 2C2EA 2DHXA 3HJFA 2HVZA 1U6ZA 4FZVA 2ZWOA 3W9HA 4C3MA 4DPYA 5GAEI 1RTDB 5KFKA 2UVVA 1RT2B 5GADU 1IJEB 2GQQA 2VICA 2IBKA 1NSPA 1HQUB 4P7TA 3U1NA 1VRUA 2OUGA 1FE0A 2W4PA 4K8RA 2PD1A 2KJWA 4P52A 4U7CA 2UU9J 3FRZA 4Z2XA 2MB0B 2ERRA 3BGRA 3TA1A 4O0IA 3EXYA 3T1YJ 3PY8A 2V9KA 2WTFA 1NU4A 3JTPA 4PG8A 5HL7Q 2MGZA 3ZNUA 4RUCA 2M88A 2XCPA 1YJWS 4NRTA 1OQ3A 1R31A 1DAXA 1S7HA 2MZRA 5HO4A 2VBXA 3GV8B 3CDUA 4CH7A 4QWEA 5J2QA 3DDKA 3QGHA 3HSGA 3TUIC 1OO0B 4FDFA 1FDAA 3S6EA 4DLGA 2MYFA 4NI2B 2CJBA 1QAIA 1IWGA 2W4CA 1QSSA 5DJBA 2GO8A 4GO5X 2HMIA 2XYPB 3BGFA 3MFHA 2I2YA 4C8KA 1R8AA 3P6YC 1OSDA 3CIZA 1YJUA 2LYVA 4OX9J 2ZZMA 5DQIA 1N32J 5F8NA 4IRCA 2OP5A 1MMLA 4F26A 2OPRA 1NK9A 1RHKB 2LU2A 4E2FB 5HQMA 2UUTA 1YJ9S 1W26A 4V19X 2O5DA 4DSLA 1TUGB 3Q0AA 2R2RA 1FJ7A 1VQSA 3NCPA 1M5KC 4ZPCA 4AQYJ 1HQ2A 2J9EA 2C3UA 3BV8A 2FJEB 3MPUB 2BW7A 3RBZA 5T7LB 2Z58B 2ZOFA 3FCHA 2BABA 2YNHB 3EVWA 5BXIA 1FNOA 5CH7B 3BQ1A 4EBEA 2IMWP 3S8SA 3RW7A 2PE8A 2XY7A 4KGMA 3QO9A 3EX7B 4DR5F 2JEJA 2LLZA 5ETOA 2NSBA 1VHIA 4LBIA 2MQOA 1HA1A 2HFNA 3HFZB 4DV0J 5D3GB 3LTOA 3P3DA 1TKTB 2F3JA 2HNDA 3HULA 4W4MA 2C28A 3K8VA 4WYLA 2OSRA 3MM9B 3A8JA 2HHQA 4ILMA 2XSFA 2DEIA 3R27A 4O0NA 2GHPA 3PR4A 3W8GA 3NS7B 2DXDA 1WSRA 2YKAA 2LP4A 1VQLS 4I2PA 3GYXB 2HQCA 2CZVC 3RRGA 4PWDA 3THPA 1XERA 4NPOA 1S4EA 1R6YA 1OY9A 3ZTRA 1CJTA 4O23A 3O6QA 1KTQA 1HW8A 4DCOB 2HMIB 1QSLA 4W92B 1TL4A 3PYFA 2N7YA 2ALYB 3IP0A 4R5PB 1KP6A 1FESA 1HBMB 3ISND 1LFPA 2FJDB 2RDIA 4LT6A 4G1QB 4NLQA 4ZCMA 5B0FA 2YNGA 1PAUB 1VCTA 2CYYA 5A8KA 5K5MA 3OR1B 1KSPA 2DGQA 3F44A 1YG0A 3PW2A 2AJ1A 2CPFA 4V1Ak 4O3PA 1BHNA 3UN5A 2HK2A 2BKPA 1RUSA 4CLTA 3NS6A 3AD9C 2HNYA 5KFCA 1K9MT 5LMNJ 5ETNA 4WK3A 4A8WA 2XB2D 4QPXA 1B7YB 5EWEA 4HTJA 1X60A 5J2MA 4Y2AA 3QLHA 4J9UE 1RADB 4CTAB 1JLAA 1P9YA 1R0BG 1T9TA 2RF2A 4X4PA 2ZITA 2RHSB 4HEA9 1S12A 3Q24A 3QNWB 3SMZA 3MPDA 5GVQA 2FGCA 5KFVA 3CCES 1IJFB 1REGX 1D1UA 1RAJA 2AGQA 4B9TA 1AW0A 2Q1LA 4I2QA 3M8RA 1QY7A 4OZLA 2I38A 3KYLA 2M4MA 2ZNZA 1CC8A 1S1TB 2B7BB 4ELUA 3H2VE 5F3TA 3VAGA 5IQ6A 1U2FA 5ETRA 2WCXA 4TYBA 1RCXB 2A0FB 3ET6B 3KMQA 4JI8J 4PZVA 1ZETA 2QMWA 2N82B 2QTWA 1IR0A 1W2BR 3M2RB 4ERDA 1WORA 1TP7A 3KFWX 3TAMA 5K9FA 3IR7B 4G65A 1CJVA 2AIRB 7FDRA 1KNZA 3TA2A 1RTIB 3H2UB 4C97A 1X4BA 3UFCX 5EWGA 3A3PB 4DN9A 3MF5A 1KOOA 1S59A 4JI2F 3MUTP 2W8LA 1WOOA 2MLYA 4I4BA 4KRWA 2EFPA 2UUBF 1FKPA 1FJCA 4I2QB 2AHOB 1O8BA 1N34F 1ELOA 1S97A 2UXBJ 1P1TA 3M6VA 2XMJA 4RLEA 3EUNA 5HMXA 5AXNA 1R7IA 1H73A 4R0JA 3Q8RB 4LF1A 5SZTA 3TZWA 2C3YA 3R6GB 1LFWA 1S57A 2HAIA 1G1XA 4N5SA 2W25A 2P5VA 1N52B 3DMJA 1NPKA 1YLXA 2FY8A 4FPRA 4EBCA 3KNAA 2G13A 4NXNJ 5BYRA 2ATLA 2GA7A 3E2EA 3GFXA 1TL5A 2OPSB 5KOXA 5I4MA 3PVXA 1TUVA 4KFBA 1B4SA 1RLCL 4HLBA 2ZJRQ 4XDDA 5J1EA 3CJ2A 3MM6A 2N4CA 2B0GA 3D6TB 3EWGA 5HMYA 1N54B 5KAKA 2M3DA 2LXFA 2RQKA 1H7WA 4HYKA 2CJYB 3Q8VA 2QMXA 2PEHA 1R27B 1DARA 2ASYA 3KLVA 2CNNB 2L41A 5E33A 1UFWA 1ITPA 4Q7AA 3H4BA 1RSCA 1WC6A 3AD7C 5EN1A 2OKQA 3CPWR 5C24B 4IQXA 1VMBA 2GJ2A 3UCUP 5DGAA 2OGUA 2R7OA 4MIWA 2HS3A 3BZQA 4P10A 5A6PA 1HD1A 2EWHA 1YTYA 4IFYB 5DO2A 1SJRA 2IC3A 2Z2LA 4LSNB 2EK1A 1T9WA 4CQ1A 3B4DA 5A8WA 2QFJA 1SKWA 3HSJA 2GVZB 3NLCA 5C2CA 2G2YA 1N36F 4ANEA 4ID8A 2FC9A 4I6YA 2ZOMA 3GJQB 1BQNB 2HHHJ 1F0XA 1HQUA 1OS5A 3T19A 3CO0P 3NOCA 2ZFHA 1QTMA 5ETLA 4X4UA 1WHWA 2NYIA 3D1OA 3DXBA 4AYBD 4B3RF 2AYGA 3BSOA 5H9EJ 3BO2A 3N28A 4WP3A 2Q79A 3KHHA 2HFOA 4UY8T 4X4QA 4NXNF 4NLTA 4JI8F 1SV5A 1M5HA 2AF6A 2CPDA 4MYTA 1VR6A 1X31C 1RKJA 3VAFA 1SJFA 3BO3A 1C4CA 3PM9A 4OHWA 1T03B 2IVFB 4DX7A 2XS2A 3EGWB 2HQ3A 3M6UA 1OY6A 1RWUA 2VPYB 4OLOA 2JDJA 5HBMA 3KJQB 3VAHA 5F41A 1P9QC 2H5EA 2RH3A 4CT8A 3PW4A 1X9MA 3V4IB 1JLEA 1M5PC 1YX2A 2B9EA 3D5MA 2LQ8A 1RWPB 3BYRA 3ISZA 4EFAC 3RTVA 2KRBA 3D54A 3AODA 4N8NA 4LIRA 1SC4B 2M5YA 5K14B 4I68A 1DLOA 4MIBA 1IBMF 4OZJA 4YQWA 2RMLA 4ZPVR 4K2JA 4OI2A 2Z4PA 1VBKA 3ONQA 3DNCA 4Q44A 1IKYB 3DOKA 2BQUA 3PCOB 2FQQB 1VBZA 4DUZJ 5KFPA 3M4XA 1Q86T 1XIQA 3FNNA 2GNKA 4WWSA 5F8MA 1X7VA 1U8SA 4A8KA 5DM7Q 1OJ4A 2E7VA 1KC8T 3CJKA 2OEJA 2HNYB 5IT9Y 2KFNA 2W9AA 3Q8YA 5LXRA 1HWKA 2YY3A 1ZPWX 2GHWA 3M8WA 3QGGA 5IWAF 1CPZA 1RTJA 2G9OA 3PHTA 1ZTTA 2R7SA 4ZLPA 1LK7A 4JI5F 1HNXF 2YH1A 1ZAXA 1K0VA 4EEYA 5L1KA 3G6VA 1T95A 1UP1A 1NSQA 1HNWF 3OV7A 1UJ6A 2I5JA 2QLFB 4HTIA 3SCKE 3U27A 3C15B 4C8OA 4M5HA 4HVZA 2Y0BB 3GYNA 1RT3A 4TY9A 3D4JA 5A76A 4DUYJ 4P75A 5LL6d 4BC7A 4WZMA 3K5MA 2Y9HA 1X4AA 3AB2B 3EZOA 2QLXA 2FIUA 3MCOA 2V4JB 4NCBA 3GFYA 4MK8A 3MAHA 3HHNB 1RTHA 4IDKB 1XK8A 1TKZB 1RAHB 2CRLA 5JUMA 3JS9A 3FGVA 4QU7A 1C4AA 1OYDA 1FTRA 4R25A 1YJRA 3BKFA 1TKDA 4LQ3A 1HBUA 4I7FA 2WSEC 3I0SA 1UW9A 3PFOA 3ILLA 4TY8A 2EK6A 4KT0C 5AT1B 3QO9B 4DUZF 1T05B 4Y0FA 3DHXA 1VYAA 2RQCA 4PR6A 2E44A 1KLNA 2QA2A 2OJ3A 5KG1A 1FFSB 4ZN3A 4ICLB 1CULB 5T7LA 1HBNA 1Q8BA 1S72S 1S9EB 1JJHA 2DNLA 3J7YU 1YKWA 3IA0A 2KJVA 3M9MB 2HZAA 3MECA 2OLWA 1HI1A 2CG8A 4GRSA 3OD2A 2BYCA 1V5IB 1F5BA 1HI8A 1S5ZA 1S6OA 3KJNB 1I94F 4JBCA 1JLQA 2NXJA 2VFTA 4H54A 4PPZA 5CQGA 3ZZZA 3QFWA 5HN0A 1X0PA 2DXFA 4H4OB 4LF8J 1HNWJ 3K0JA 4M5LA 2G2ZA 2O67A 4X4OA 1H7XA 2ZBIA 3C8YA 2R8IA 1FWPA 3FMWA 3JYTB 3TR5A 3CD0A 2BANB 4IOBA 5HJXA 2IAJB 5H9FK 3IBWA 3KXDA 4Y2KA 3GJSB 5I42A 4H4KC 2XO6A 3HVRA 3CJ4A 3D6HB 3DOLB 3BREA 4HACA 4PCQA 2ZH5A 1U1QA 1TK8A 1NK6A 1KD1T 2UXBF 1UCNA 3LP2B 4LR7A 2NUHA 5KTQA 3GE9A 4M63A 1E6YB 1UVKA 3SYZA 2OO4A 4ZJLA 3FK4A 1RJJA 5B0DA 2YVSA 3FFIA 3H5UA 2HRUA 2JSXA 2RKIB 3OLAA 1RT6A 4M94A 1KDNA 1X4HA 3D0HE 1ZYQA 4K2XA 3B4MA 2DNOA 3TX0A 4DG1B 5A2QY 4ZJQA 2ZHAA 1M5VC 2M8DB 1K0TA 2JZ5A 1NPPA 3MMJA 2LA4A 2X3GA 2Y1RI 3GCWP 2JC1A 4RR5A 4B08A 2E7WA 4ZPDA 4IH7A 2J9CA 4P2SA 1T9XA 1WNEA 5D4PA 4F04B 3R7SB 5EDWA 4NLVA 4C2MA 1Y4ZB 4DR4J 1B7FA 1OPZA 3UE2A 3M2UA 4MKBA 1DTQB 1RTHB 2MQQA 4RNNA 3MMAB 2NSCA 3HVTB 2M7SA 1S6QB 2NXNA 1C0TB 3I87A 2BKNA 4WFZA 3Q2SC 4ECYA 1FVQA 2QA4G 4DV3F 4G1PA 4EYIB 2CAJA 2Y1IA 2D3UA 5ETSA 1RT4B 3UNYA 1CSJA 2AEJA 2XS5A 4QU6A 1P27B 2FLPA 5C42A 1VRTA 5I3PA 5L9NA 5KG3A 1NJXA 1VRTB 4ELVA 1Q4RA 4OLPA 5GAEU 4ZVTB 4J37A 1XC9A 2IM2A 4IH5A 3CCQS 2XGQA 2WRMA 1PYTA 3IAS9 5KFDA 1NLKL 1JLFA 1S1VA 2DB1A 4ECQA 3LP2A 1BMQB 2UVWA 4B9LA 2FZKB 3HM9A 4Q8FA 2DR5A 1EETA 2GJFA 4PG5A 5KFRA 2HHHF 2DT9A 5I42B 3PJWA 1OSCA 3BN4A 2IAJA 4LF6J 2GW8A 2WHOA 4USVA 3OQ2A 1FJGJ 3NMRA 3UNGC 4F67A 2XULA 2NQPA 2XLKA 3PX0A 3HJVA 1PYOB 1NK4A 3AA9A 5HAOA 2B4UA 1XR5A 3FZ2A 3LOUA 1FCAA 1RT6B 3C6TA 3H20A 1Q0NA 2IDLA 3PG9A 4FYXB 4RW8B 4DOZA 5IT4A 1H38A 4F8RA 3DU6A 1N33J 4K7QA 4UOFA 4UZBA 5IC4B 4FF1A 3J81Y 1RHRB 3A13A 4PWWA 4DR3F 1NK5A 5ETTA 1OWXA 4N7TA 4L74A 3H25A 3BQ2A 2RQ4A 1DFDA 4A4JA 1PYSB 3M6WA 1WTBA 2A2DA 4JI2J 4ZVPB 1B3TA 2HKEA 2GVDA 2E5HA 3MEEA 1FF2A 5EWFA 3G6ES 1TL7A 4K59A 2ZBQA 4PXCA 3Q89A 4L3NA 5EX0A 5A0YB 1N6QA 1YRTA 1SCJB 4RL1A 5ETMA 1JLGB 3M1VA 4QR1A 2CNOB 4DEZA 4KHRA 4L73A 3W2VB 5BJRA 4ZMMA 2PEBA 3US5A 1C1CB 1HQEB 1V9OA 1YI2S 1VQ7S 2CJQA 1Y5LB 1NJIT 4ZS6A 1SC1B 4NLYA 3B6BA 1T0TV 1UFLA 1EB0A 1A0OB 3D67A 3GILA 1R0AB 4O3OA 1F2GA 3DRSB 3KJVB 4KB7A 1YIJS 5L1IA 1VIOA 3UD5A 3ZZOA 4ECXA 5D0HA 5GMEA 2BE7D 3LUYA 1S77D 2CWXA 2IM1A 2IJRA 3H5SA 3IMQJ 5F0WA 2AV5A 3HVAA 3ZFVA 1DY3A 5F0UA 3LGMA 5IV4A 1K44A 2A10A 1FWLA 1RAOA 1UA0A 4CM0A 3CD7A 3DM2A 2WZ1A 1X5PA 1OMSA 2NXEA 4TY8B 3C15A 4X65J 2IM0A 1FFGB 1MWZA 1WG1A
chains in the Genus database with same CATH topology
5IFMA 3CULA 3LP1A 4ES3A 3W3SA 3K5OA 1UETA 5KFOA 1RP5A 2HS4A 3RW6A 2AW0A 3TA0A 1IKWA 2BZ2A 1HNIB 2ZJPQ 4GO7X 2YKPA 4UUWA 2ROPA 3CMAS 2CQDA 2D9OA 1IN0A 2IVYA 1SI9A 4H4MB 1JJ4A 4A8XA 4GMKA 1KVIA 3MDFA 1VC0A 4UY85 2VFRA 2DPIA 3HHLD 1VQNS 5L1LA 4C4WA 1Y00A 3MM8A 4LIWA 4WCEQ 4J9OA 4ED2A 4DQSA 1WD6A 4HH0A 2L9DA 3B8HA 5DDRC 3OTEA 2W9CB 2B43A 4C3LA 2OFGX 2U2FA 3WBZA 5HQ8A 2NZ4A 1YRUA 2LQJA 3A8EA 1UMJA 1KQFB 4DDFA 2DNMA 1BQXA 2P6TA 4K5SA 5M2PA 2QSFA 4OQJA 4QW8A 1UWBB 1YHQS 2R7UA 2Y0SD 4YFUA 2E1MC 5K8MA 2DNZA 3OJSA 3DRXA 1S6PB 2DH7A 4IFVB 3SDEB 4ELTA 1Q8IA 2F9JA 4KKOA 3JSMB 1FXRA 3Q8SB 3EZUA 4O4RA 4OHZA 1T7PA 2R7RA 3MM5B 5DG8A 5LSRA 2LDIA 4NYOA 5CYQA 4URQU 5LJ3Y 5KT6A 2E9ZA 1MNEA 3BO4A 3JSRA 2YWFA 2KRRA 3TI0A 4M5DB 3E51A 2DTJA 1SJ4P 3K59A 1KQSR 1LW2A 3PKYA 1X5OA 1U1NA 3HKWA 4NMLA 3HX9A 3OTDA 5FDLB 4ZHRB 5KFIA 3M2RA 2N4DA 2MQMA 1X9SA 1RT1B 2DNKA 3NS5A 1Y5IB 2ZHOA 3MUVP 1N5QA 5KFWA 3W7BA 4YEAA 2EFVA 1RT3B 4OJ3A 2R7XA 1H98A 2AJ0A 4TYAA 2VPXB 4F4KA 2I5JB 3FRYA 2JJ4D 2RF2B 1IQTA 2ILYA 1U49A 2ZKTA 2JVOA 3S1TA 5KG7A 1MROA 1ZZNA 2YQ3A 2XLIA 3OSPA 4HDHA 2C2RA 1BY9A 2WOMB 2MKSA 1HMVA 4KGKA 5LMNF 4OI0A 1H3DA 1Z1ZA 1X5SA 1G7CB 2BXJA 3FQLA 1RT7A 2X1GA 4K4YA 1IKYA 3DOKB 3CC7S 1S9GB 4O44B 4PWUA 1S48A 4QWDA 1WF1A 2O1PA 2Y1JA 1Y5NB 2B5JA 4PG7A 3O3LA 2MKIA 3U02A 1IKVA 5F8GA 3JSYA 2PO4A 2NPIA 4PXDA 4DF4A 2AYMA 4YDXA 3IRWP 1Z2LA 3EZ5A 3T5KA 2P9CA 3BM7A 3EXCX 2V5HG 4Q5VA 2PI5A 4QIGA 4ED1A 4PXEA 2V0NA 4DFKA 1XMOF 4YR3A 4UQGA 1K1SA 3SQGB 4BDPA 3EPIA 2LVWA 4ZHRA 4U67Q 1IBKF 1KHVA 1TKTA 2C3OA 2HNDB 2WK4A 4RW4A 5E3RA 3NL0A 3VAMA 4WKRA 2BDPA 2VBZA 1IKXB 2JEGA 1Y9OA 2P9EA 4MK7A 4ETXA 2HGNA 1HNZF 4KO0B 4ECWA 2VFUA 3M8QB 5I3UA 4MKYA 4F3MA 1SB6A 1WF0A 2EG1A 4DV0F 2CVEA 3ITHA 3UR3C 4TU7A 3KLGA 3G71S 3D1HA 2GQ2A 2RIJA 2DR9A 1YWXA 3G8SA 3DRPB 5FLXY 4Y2MA 5J2PA 1UWBA 1HPZB 2KYXA 1TL3A 1U1OA 1XEZA 1FE4A 2BW2A 2IC3B 5J1NA 4Y2CA 1APSA 1WACA 3FSYA 1S0VA 2J7UA 2BRLA 2E5IA 1WG4A 5F8IA 1K8AT 2ACYA 2JOQA 2RT3A 1WF2A 4B3MF 4QR2A 4C8ZA 3HHDA 2YNGB 3FDSA 4LFCF 1NH7A 5E7OB 3MUMP 2V8HA 2BJDA 2M70A 5B0EA 2DJWA 4JV2A 3TARA 5DQGA 3CDAA 2D41A 4CTAA 4X4TA 2HHSA 1LWFA 3FQKA 3KLIB 2K3KA 2DHAA 1S0MA 4K4VA 4NA2A 1ZPVA 4J9RA 4YB1P 2FVQA 4RWWA 4JI1F 2WBRA 4MMOA 3R5BA 5AE2A 4UW2A 4ED3A 2B3TB 4FS2A 2J0QD 4CNYA 2GGPB 3LAKA 4RBUA 3BDEA 1NRKA 4IR9A 1FD8A 1HPZA 4R8UB 1B0VA 3MURP 3JB9k 4LFAF 4F50A 2L3MA 2ZDPA 2L48A 1HHTP 4ZPWR 5T41A 1CG2A 2F40A 1MW7A 1WHYA 1XBWA 3UWTA 3UD3P 2XNQA 3DLKB 4UQTA 4OMFG 4C11A 1CQNA 1R43A 1SKRA 2NXUA 3QGPA 1KS2A 4KO0A 4I2PB 3EYZA 4DN0A 2R4FA 4IH6A 1VIXA 3LH2S 3C6UB 4OZ1A 1U47A 2KH9A 1K73T 4ILLA 3G8TA 1RT1A 4NYPA 4C8YA 2EBEA 1O0PA 3NBPB 5FDLA 1T8EA 4ZOSA 3GMGA 2D3OR 2CPIA 2CQIA 4DSKA 5C25B 4M5DA 2WW8A 5MAOA 3GIIA 4YP3A 3DRRA 1IM4A 1HR0F 2XMMA 2R2UA 4OHYA 2FHOB 1WHVA 4N8OA 2B7CB 3AQOA 5CYMA 3I9ZA 3HHLA 3MPWA 4OJHA 2A18A 5KFAA 4CIOA 4OL8A 3J7YI 1G3OA 1HWUA 2HNZB 3LPYA 5GAHI 3MM7A 1REVA 4IFVA 4U7UK 5L9XA 4IQMA 5AXKA 4ZVEA 5J2QB 2BM0A 2ZBCA 4CI0B 4QOTA 3V6JA 2CQGA 1FKOA 2UXDF 1UAWA 2MGZB 4PWDB 3M9NB 3DCAA 2KXHA 2W9CA 2N3LA 4G3IA 5MLCV 2J6SA 5AXLA 5A8KB 2GIQA 1MROB 3QAEA 2MSTA 2OPPA 2PA8D 3E01A 5THWA 4F4WA 4DV4F 3F73A 1VRUB 4PKDB 1S1VB 2ZHBA 1UVNA 3CUNA 1D0EA 2KB2A 3TUJC 4P6QA 2ZDOA 2F4VF 2KKHA 4GC7A 3RB0A 4DR1F 3HDSA 2MJNA 5BYSA 1X4EA 4AL5A 5KG5A 1VC6A 3D28A 4DBQA 2K1RB 1N5VA 2MZ1A 1KONA 3KLEA 4QZVB 2Q6BA 4F4ZA 2R8HA 3P49B 2V8VA 2VKZG 3QIPA 3DRPA 1IXKA 3E8OA 4ZVGA 3CXCR 3CCUS 4B17A 2JWNA 3G6YA 3MMCB 2KT5A 3V6KA 1SKSA 5DS7A 2RKIA 1GTEA 2UUCF 4DL3A 3E3XA 1X5TA 4YUDA 1NKCA 2M8HA 2KG1A 4USHA 3LALA 2IHR1 2U1AA 5E3AA 4A47A 2B51A 1UJ5A 2GMJA 3SDEA 4JI0F 4ID5A 2YNFA 3QIDA 4XAKA 3PZPA 5IS2A 2XG8A 4U6PA 2VPZB 3BJYA 4WZQA 2HWHA 3KLFA 3THVA 1C1CA 1U6BA 4CT9A 5D4OA 2RU3A 3VWSA 3MPVA 1DRZA 1JLCA 3RAXA 1B0PA 2DO0A 3HFKA 1SL1A 5J2NB 4B02A 4PPDA 4ZK7M 2PMZD 4OI3A 2HHTA 4J9PA 3NP5A 4IRDA 5ADZA 5C5JA 2XSJA 3C66A 1N4LA 3Q8QB 4DFMA 2UZAA 4J9LA 2YNIB 1VK3A 1NKEA 4I6AA 4L72B 1CVJA 4OFZA 3PIPQ 3M8PA 2QV6A 4O44A 2BBEA 2PGCA 2VG6B 1DHMA 1FRMA 4H4MA 1RA6A 1FEEA 2MHEA 3C6TB 5BYQA 3RB3A 1ZH5A 4C9DA 4RZRA 4FBTA 2C42A 1XR6A 1H6KX 1SBRA 1SUQB 2QIFA 4ZVHA 2X1AA 3T3FA 4PQUA 3TUZC 1IKWB 1SH2A 1N0VC 3OTBA 3AJ2A 4Q2LA 3VAIA 1FDDA 3HF5A 4LF7F 2FHKA 2JX2A 2HHXA 4ITSA 2RJZA 1TKZA 4IDKA 3M2VB 5AE1A 4DL7A 2M9KA 4NLRA 1R8CA 2RE1A 1FKAF 3KK2A 1QUPA 1FK9B 1VBXA 2D74B 3MZIA 3NMAA 1WTFA 4QIFA 2CQ4A 3HPOA 1U1RA 2ADCA 2V2KA 5KG0A 2NREA 2FPHX 5DLGA 2AJQA 2LXIA 3I0RB 3AH6A 4WXWA 1C0UB 2WSFC 3H4DA 3DRSA 2W7OA 4QWAA 2E29A 4EUVA 4OZ5A 4X4NA 1PILA 1TKXB 1RT5A 4WU2A 1LW2B 1ZM4A 2GX8A 3I5CA 2E9RX 3GG0A 2B9XA 3PEHA 2VA2A 2CQ3A 5DM6Q 1VQMS 1GX6A 1LWEA 1S1UA 5KFJA 1QVFR 4OI1A 3PW0A 2BM1A 2SXLA 3RU0A 3PO4A 1GAOA 4MFBB 4RNFA 1RYRA 1S10A 3CE8A 3M8SA 4A8MP 2VC0A 1H2UX 3DRYA 1U1KA 4EO8A 2ZNYA 4CNZA 3OVAA 3Q23A 4X4VA 3MEDB 4CCHA 4V19J 2B6AB 2RQMA 3V4IA 4J9SA 2DGTA 2WONB 3X3UA 1VOMA 2ZH8A 2DVIA 4Y65A 5HBMB 2A1BA 5LJ5Y 4DL2A 4XIUA 3N6LA 4UOCA 1TKXA 4WFXA 3HLUA 2HZCA 1I1GA 4MIAA 1J5EF 4RU2A 4K50A 3SSRA 3CCTA 5U47A 2J6TA 1D8ZA 4N77A 4NA3A 2IJNA 4TLQA 4A8SA 4TQRA 2BUNA 1RK8A 1S4FA 3M32B 3G86A 3DLEA 3H5XA 4N41A 2JL9A 1DTTB 2UUWA 4NCGB 3WDOA 1FK9A 1FO1A 3HT3A 4RW7B 1VHFA 2EW9A 3CJ3A 2ZE2A 2XI3A 3MR3A 2ZH3A 4XK8C 1TAUA 2FDNA 3QIPB 1BQNA 4DX8H 2GC8A 3HVTA 3I0SB 2CQ2A 2RRNA 3L7OA 2NS1B 4NL5A 4YR0A 1OQ6A 3BGUA 3PEJA 3LP1B 1XMBA 4LSNA 5A8WB 2LEAA 2YWHA 5AXMA 3KLEB 4FN5A 3IGNA 1MMNA 4RBVA 3CD5A 4I64A 1WEXA 4GKKF 4KE5A 3KMSA 2FJAB 1DTTA 4NCGA 1X4GA 2R2SA 3FFIB 2ZH4A 1WHXA 4Y3CA 1LV5A 1KR4A 2JLFA 1D3WA 4ETZA 2HPUA 2V94A 1S76D 4KV8B 3SEOA 5AJ3F 4DL0C 3LWLA 1N88A 2YKQA 3DOLA 4IO1A 4NXMF 1HWLA 4EYHB 1QE1A 2VFVA 4O4GA 3VZIA 4EBDA 1TK0A 2OH2A 3OTCA 3BS9A 1Y7PA 1FJEB 1FRXA 5HP1B 1D9FA 1UEVA 1Q8LA 5HLFB 3LP0B 2PFFB 2RS8A 1JLQB 2VG6A 2N7CA 4J9KA 4PRFA 4RWXA 3KHRA 3MXHP 2O3DA 5KFZA 3EGZA 4PXBA 1N8RT 3SSQA 2F8EX 2QSWA 3DI6B 4C7QA 2LECA 3RAQA 2AP6A 1DLOB 4PUOB 4EU0A 2Q6CA 5B08A 2MHNA 3T5LA 4K4WA 3PNIA 3KHLA 3MMCA 1G2EA 3IG1B 3V6DA 3HO1A 2CPJA 2ZD1B 2ZC4A 3AA8A 5KFMA 5J2NA 1Q78A 3WZ0A 4WYWA 4P7VA 4DL6A 3QYYA 1WWHA 2X51A 3PXGa 3VR1A 3G4SS 4W90B 1QM9A 5IT0A 2HLTA 2KXFA 1WELA 1HNVB 4RU9A 1JB0C 2G1DA 4QQBA 1FJGF 2HHVA 1C0UA 3I5BA 2VH7A 3CCWA 2VODA 1P6TA 3IO1A 1M1KT 4FNIA 3SCLE 3TVZA 3O44A 5KG6A 3MCSA 1S0OA 4IUFA 1AFIA 1VQPS 5KFNA 3NNCA 2B4PA 3C46A 2UU9F 2R8GA 2VOOA 2PDAA 2FVCA 5J2MB 2E1RA 4U9RA 4L6V3 2HYIB 3BSAA 3OVBA 1PSDA 2W7PA 1LQ9A 4I6WA 3FVYA 2VQEF 3T1AA 3HHLC 4AUKA 2LEPA 1SUQA 4PQUB 5J1EB 4X84A 1VQ8S 2DCLA 1VFJA 3CT9A 2HGMA 3AQPA 2IA6A 1U6FA 1CQMA 5HROA 2RRAA 4DR6F 3MEGB 5LT5A 1VBYA 1REVB 3DOMA 2DD8S 3HXMA 3GZ7A 5B0GA 4QCLA 3CCJS 1FTCA 5KFEA 4DHVA 5K14A 2OAUA 3DGPA 1NHVA 3HHLB 1TR0A 2IRYA 2W9BB 5CYMB 4RNMA 3TANA 2MQLA 4G6VB 2D3ZA 3HHEA 1XN9A 4Y2IA 3UI3A 4ES2A 6FDRA 3GQCA 4OV1A 2ZH1A 3OUYB 3BSCA 2FJBB 4OX9F 1X0FA 3KG1A 1ZAVA 4JV1A 3Q2TC 3MM9A 1SL0A 3RR7A 5DRKA 1HFEL 2VKRA 4H4OA 2VUGA 3F56A 2LQ5A 1U1MA 2LDYA 4NLOA 3MWBA 4TKTA 3O5TB 3RYLA 4F4XA 1HBOB 3MM7B 3V6HA 1NJZA 1H0HB 2DNQA 3ENWA 4WE1B 2MKHA 1UL3A 3T6BA 2XEXA 3CDEA 3DLGA 4LQ9A 3DLGB 4URGA 1ZM3A 4DUYF 2DIUA 1YITS 4EZ9A 3C3LA 4ALZA 1MU2B 1RI7A 2CPYA 2DGXA 2J0WA 3CDWA 2NUUG 2O66A 3HI9A 2AGPA 1L3KA 4M1KA 4QR0A 2N3OA 3O8WA 3IGVA 3THTA 3PV8A 3DLHA 4X64F 3L09A 6FD1A 3W2WA 2DHSA 2FVPA 1KN6A 4JUZA 1V3SA 2QRRA 2VG5B 1VK8A 5F8HA 1LWCB 2GV1A 1EP4A 1S1WA 2EVZA 2K1RA 3VQTA 3CWJA 4JV5F 2MQPA 4MYUA 1YGYA 2PA3A 5GAGU 3IS9A 3K7RA 1KVJA 1R3NA 1S6UA 3GG1A 4G1IA 2XS7A 5IM0A 4B9NA 2Z8QA 5GAHU 3SCJE 1S9GA 3MEGA 1GT8A 1JLAB 3DDNA 1URRA 1N5TA 3S7RA 2OPPB 2DGWA 3E01B 1RISA 5KFFA 3MR2A 3IWXA 1KHWA 3DFEA 4NRUA 4WF9Q 3V81A 1VLYA 4MK9A 2JH3A 2ZOGA 5CCLA 1SH3A 2RSQA 4ECSA 2LU1A 4F25A 1GXUA 2XMUA 3ENQA 4KBIA 3WX4A 2OD6A 3MGJA 3OHBA 2WAQD 3PO5A 2KHDA 1N5YB 2ZH2A 2D1CA 1SL2A 4WXOA 4R5PA 3TAQA 1VC5A 1RT2A 3KG0A 3UR0A 1OPIA 2VG7A 3TYTA 4DS5A 4K4TA 1J5OB 2KI2A 3D0IE 3IS9B 3IR6B 3LF0A 3RB4A 3M8QA 5I3UB 3LQVA 4HKQA 3DRRB 2AU0A 2ABYA 4X2BA 2BR0A 1RTIA 5KFBA 2VG5A 4ZCKA 4EZ6A 5D6GA 4LF9F 1R8PA 2LXUA 2ASJA 3NNAA 3JTOA 1TV6B 1NZAA 4TN2A 2HS0A 5IXUA 2XI2A 4F2SA 5D3GA 4E98A 1U1LA 2UV8G 3ZZPA 4DL4A 3OL8A 2CQ0A 3UPFA 4F2RA 4NLXA 1GNKA 1RQ0A 2YNHA 1WG5A 4NX9A 2R8JA 4CH1A 5DG7A 3LWMA 4Q0BB 5E41A 1P8GA 5KFQA 2KHCA 4XPEA 2IJFA 4ZP8A 4BHQA 2EFOA 2YWEA 2HVHA 4FNHA 2DGVA 1K1QA 1VS3A