3OQ2A

Structure of a crispr associated protein cas2 from desulfovibrio vulgaris
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
NDAMLVLISYDVSFEDPGGQRRLRRIAKACQDYGQRVQYSVFECVVDPAQWAKLKHRLLSEMDKEKDCLRFYYLGANWRNKVEHVGAKPAYDPEGPLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR-associated protein Cas2
publication title Structure of a CRISPR-associated protein Cas2 from Desulfovibrio vulgaris.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Immune system
total genus 21
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3oq2A00
2ZITA 4ZCMA 3UI3A 1N0VC 4ZCLA 3ZZTA 3E3XA 4QR0A 4ES1A 2EFGA 4MYUA 1P9QC 1FNMA 4ZCIA 3LH2S 1T95A 1ZPWX 4TNOA 4ZCKA 2IVYA 1DARA 2CVEA 2XEXA 2BV3A 3ZZUA 1ZM3A 1KTVA 2BM1A 1VI7A 4MYTA 2KDOA 1ELOA 4FN5A 4ES3A 4QR2A 4ES2A 2I8EA 2NPFA 2L9NA 3B82A 3B78A 2J7KA 3B8HA 4QR1A 1ZM4A 4M1KA 1ZM2A 2E1RA 4MAKA 3OQ2A 2I0XA 3ZZ0A 2BM0A 2WBMA 1N0UA 3EXCX 1ZM9A 5G4DA 1U2RA
chains in the Genus database with same CATH superfamily
3OXGA 2KZZA 2HFVA 3KLHA 3QO9A 4X2BA 2CZ4A 5BR8F 1VQSA 3IO1A 1KR4A 4DV7F 3AJDA 1U0SA 2P5VA 3T41A 3BB5A 1DAXA 1VQKS 2L3MA 1S6QA 2Y1LB 1R0BG 2ZITA 3CD7A 2QYGA 3GP9A 3T3FA 1C4AA 1D9FA 1CQMA 4HH1A 2GVZA 4ANCA 1YTYA 1PJ7A 4DMZA 1HBUA 1RT4B 1HNXF 1CJVB 4USJC 1NK0A 1IR2A 2IJRA 4QYZK 1PJ5A 1R8HA 3M1VA 2EC0A 4J90A 2A6MA 1DFDA 1MWZA 3GIRA 4Y3CA 2F40A 3DDNA 3AJ1A 1HQEA 3TR5A 1KVKA 5IV4A 4DSLA 1IBMJ 1RE1B 3QWUA 2B4PA 1YZ7A 3IWXA 4X4TA 4FXWA 1NJZA 3GPAA 2YNIB 5KFCA 3PJ9A 3MM5B 1O6XA 2R7UA 2F65A 1EQMA 2O5DA 2C42A 1JJHA 3OTEA 4RKUC 2CQGA 5D3GA 2OTJS 2PEHA 4DV6J 1S9GA 3J80Y 1MN9A 4OHXA 3R6GB 4NZ6A 1QTMA 3D2WA 1NDKA 2P6TA 2ASYA 3DLJA 4H54A 3L09A 2EPIA 4N8OA 4N7TA 1UJ5A 4ILMA 3SZ2A 1VQYA 4V1Ak 4N56A 4YB7A 2L08A 4LSLB 1N52B 3GSDA 4B9LA 2PN6A 3KMSA 3D9BA 1SJQA 3D5MA 2EK1A 2FLOA 4B9VA 3I0SA 2BE9B 1P9YA 3BSAA 2GO9A 3UNYA 1ZA1B 2Z30B 1NHUA 3QGGA 2FZGB 2Z57B 3SEOA 5KT6A 2FVQA 2B9WA 3FDSA 2DNMA 3N01A 4KQZA 4I67A 4IOAQ 4LF7F 3DYAB 2YQ3A 1ZM4A 2XYHB 2DGXA 2XHWA 5GAHI 2QZ8A 2DXFA 2VPXB 5IM0A 1JK9B 2GC8A 1P1LA 1TKZA 4DU7A 1NKBA 1RKIA 4RNHA 2MJUA 2DH7A 3J81j 4OYOA 2OSRA 4XK8C 5IQQA 3T1AA 1KQSR 1HI0P 1T0TV 2MKHA 3KK1B 4DR2F 1WI6A 3HHLD 3QAEA 2FC9A 1FE0A 1WTBA 3AD7C 1UL3A 1H2VZ 1VQ8S 1Q8BA 1SL0A 4K4ZA 2HNZA 1RWMB 1GK8A 4WIQA 3WHIA 1CJTA 3KHRA 1LKZA 1MROA 4QWEA 3MTKA 2W7PA 3LP1A 1IVZA 4NX9A 3MF5A 2VQEJ 3GWCA 4PZVA 2HFSA 1VLYA 4PUOB 3A3NB 3EUNA 2K7JA 2GQCA 2A1BA 2J7KA 2BRKA 3LP2A 4P7VA 4UOHA 2AGPA 3GIMA 3OJUA 2E1MC 2XHCA 2RAQA 2A3JA 2AJFE 2J9EA 4Y2CA 3DI6B 4ZCIA 4Q0BB 1Q5VA 4C6AA 3PDNA 1ZZNA 1NJWA 5L39A 4JI0J 2B9EA 4ECUA 3LWLA 5LXRA 1PAEX 1BHNA 5D0HA 2XMTA 4QWBA 1PYTA 1NK7A 2CFXA 4LBHA 2LFVA 1VBKA 3MMBB 1V3RA 2XMMA 2I5JA 4KFBB 4OI0A 3B8HA 5EWGA 2VBWA 1F5AA 3HHEA 4IH7A 3LUYA 3UDEA 2QRRA 5KFJA 1PGZA 4ECQA 4DR5F 3THTA 3DM2B 4HHJA 5A8KB 2IA0A 2VONA 4YB6A 2E1AA 1QLNA 2DHSA 2HGLA 4O44B 2AIRB 4LRFA 2AP6A 3PNIA 2WONA 3MR6A 1RHUB 1YZ6A 2QL7B 4ICLA 4NI2B 1FKPB 2QA1A 1HA1A 3D7SB 3C14A 2J6TA 5FJ4A 4IDKB 4YR2A 4A8SA 4EEYA 1KEKA 2PT0A 4FF1A 1M1KT 2FVSA 3OHBA 1NHVA 1WG4A 2G1HA 5E0OA 5JUMA 1AA1B 2SXLA 3KG4A 1ROFA 3QGIA 3MM8A 2V4QA 2DHXA 4WIIA 5B09A 3CJ8A 2X1AA 2EFQA 4O3NA 4DCJB 5B7WA 3RAXA 2GJIA 3Q86A 3MAHA 2F4VF 5DQHA 5DDQC 1LW0A 3H5YA 3F73A 4K4TA 1IWGA 4Q43A 4KR0B 3UE2A 3KLVA 9ATCB 1WORA 1U1OA 2WSCC 4DUTA 1KQGB 2KO1A 4MYTA 4ZVEA 4PR6A 5DQIA 4O3RA 3LALA 1HFEL 3M2UB 3CIZA 4HT7A 4FPIA 4JI3F 1QSLA 2AYGA 4ZVQB 1XNQF 4R0JA 2GHWA 5IT4A 5LSLA 2DNQA 1FESA 5HANA 3OUYB 2E44A 2U2FA 3FZBA 2ZUGA 4FF3A 1FJGF 1YBAA 2JLFA 3DOKA 1C0UB 1VC5A 3K5NA 2OD6A 4DSFA 4NZ0A 1T94A 4X84A 1YWXA 3HZGA 3OVSA 3JYTA 4QPXA 4CNZA 1G7CB 4NLQA 4FS1A 4TU9A 1N6QB 1UVJA 2UVWA 5ETNA 1Y5NB 1VRUA 3A12A 3OVBA 4Z2XA 2QE5A 3VGSA 2L41A 5K9FA 3GQCA 4KV8A 1TL4A 4IO9Q 4P75A 1AB8A 1E6VB 1HWLA 4HT5A 2C28A 4LFCJ 1RTHA 4KO0B 3MECA 5K14B 4IFVA 3FC9A 1IUJA 3POTB 4OX9F 2UVVA 1YJ7A 4L75A 1HWKA 4IR1A 1FRXA 2BQUA 2GQ2A 4DV4J 3A13A 3W5XA 3CJRA 4JI4F 2JJ4D 1OQ3A 4PEOA 2DYAA 4NYPA 1JX4A 1AT1B 1Q5YA 1X9MA 3BGRB 4DDFA 4DX6A 3AD9C 1FE4A 5U47A 5IT9Y 4B3OB 3FBFA 4FYDA 4QWAA 1CG2A 2BOAA 2FGCA 3BR9A 5GAHU 4F4AA 4HI2A 4HACB 1F5BA 3Q8QB 2KXNB 1RCOB 3WQPA 4CLWA 2KXHA 2DTJA 2XGPA 2OSQA 2YKPA 3HVAA 1HI1A 2DNLA 3DNCA 2XYPB 1XNRF 4NA3A 3RU0A 4XDCA 3MEEB 4DZ6A 3M9OB 5EN1A 3M7VA 1A0OB 2E5HA 2PI5A 2PD1A 1NKCA 3BBBA 2WB1D 4KHPJ 2HS0A 3EGWB 4A8OA 3V6DB 3CO9A 4CT8A 2R8GA 1X5OA 2F8EX 1UZHA 2ADBA 2DGWA 2OELA 2LLZA 3CNQP 8AT1B 5CABA 4MMOA 5L1JA 2NXJA 3H2VE 5IFMA 2CVEA 4YY3F 4JI2F 3G8QA 1RP5A 3NNHA 2VKZG 4OYIA 4NLDA 4DL0C 4YP3A 1Z2LA 2ZUAA 3PX0A 1UETA 5KFDA 2IMWP 2WB4A 4UOCA 4N76A 4UTGA 4B3MJ 4M5DA 3J7YU 3C16B 4KGZB 2IVFB 4CTAA 3PY8A 1HNZJ 1QAJA 1SC1B 2DBBA 1RT5B 2VG5B 4C8MA 1VIXA 3CCRS 2ZZNA 3FQLA 2CNKB 1N33J 3L95X 4K59A 4Q45A 4I7FA 3PHEA 2QLXA 2C2RA 2WW4A 3KJQB 5BXIA 2O01C 1FX2A 4USVA 5D4LA 4QWDA 4PWUA 5HK4A 4AYBD 2AEFA 4Z7CA 5E7OB 5HP1B 2F9DA 1APSA 4DR7F 4JBCA 5I42A 4CLTA 1N34F 3ZTOA 1Q16B 2KDOA 2HYIB 5AJ3F 5E3RA 1EETA 4MFBA 1IKXA 3NWRA 1SKRA 3KK2A 2CJAA 5BR8J 4DV7J 4B9SA 2VQFF 1MW7A 1WC0A 5KG6A 1MU2B 2HIQA 1CS4A 3K57A 2RE1A 4YR3A 1F60B 3MURP 4DL6A 3K5LA 4XPCA 1RWKB 3MAAA 1HNXJ 2ZC3A 1IR0A 3K59A 3HMJG 1WELA 2HWTA 4NA2A 2DNRA 2FZCB 1Q53A 2HQCA 2CZ9A 4IYQA 3U27A 4DSKA 3K8VA 5DDRC 5H9FK 5SUHA 2JC0A 2PI4A 3PJWA 4NXMJ 2FLNA 4LF4F 4GVLA 3OT9A 4DUYJ 1RAGB 4QU6A 4CO0A 5KFTA 3HHLC 3BN7A 3KHGA 2HHTA 1JMTA 3CO0P 3BGUA 4ZN3A 3GB0A 2IIHA 1SKSA 3M30B 3NS6A 3P8BB 5T7LB 3M8SA 4HLBA 3B4MA 3LANA 1HBMB 1Y5LB 4Y2KA 2WHOA 3I0RA 4OYPA 3Q2SC 1DTQB 3DU5A 1SJ3P 4KJIA 4C3LA 1TKTB 1ZM9A 1Q8LA 3JQJA 3KDNA 3SFGA 2MY8A 1WSVA 3RB0A 2YNFB 4GRSA 3CF5Q 3IBWA 2RDJA 3NCPA 3CULA 2CPXA 2J0WA 2F9JA 3BREA 5KFQA 5IQ6A 1CQNA 4K4SA 2ATLA 1TV6A 4A8XA 3RRGA 2AJ1A 1EZZB 4QR0A 4TYAA 4Q2LA 5KFEA 4DPOA 4K4UA 1EP4A 5GAEU 4LF7J 5FD1A 1RTDB 3MFHA 3HHLB 4KHMA 1U26A 1N5VA 1YK9A 2BE7D 1E6YA 2HHHF 2G2OA 2KHCA 2LVWA 2XQCA 1NU4A 4K4XA 4ERDA 1HQUA 1FD2A 6FD1A 4ZHRB 3IBCB 1TFWA 1U4BA 4J9RA 4JV2A 3KHHA 3FFIA 4RUBA 4WP8A 4R5PA 1EHWA 4NRUA 3VVTA 3IRWP 1CLFA 2H4WB 4TU8A 4DR2J 2COLA 5DG8A 4OZLA 1QDUB 5EHHA 1HIYA 2GW8A 3IC1A 4YS2A 2JOQA 1RT1A 2QTWA 3F44A 3W9JA 3SCIE 3GYGA 2WOMA 2MPUA 3QATA 2YH1A 2JEIA 4W92B 5ETQA 1RLCL 4RW9B 5DZ7A 4LF1A 4PG5A 4Y0FA 3T1HF 2FPHX 5I3UA 1UCNA 4RJVA 2GS8A 2ZH9A 1OO0B 3CD5A 1RBAA 1U7LA 1REGX 1SC4B 4C0BA 3W63A 5KOXA 5DG9A 1XN9A 3VR1A 4GMKA 3J7Z5 5I3QA 4ZVRB 1FKOB 1TK8A 1EKRA 3W2WB 4DUZJ 4I2QB 4YHHF 3DGPA 1I5OB 1NSAA 1JLAA 2X7IA 4TVAB 3DLKA 4ED7A 5KG1A 5D4OA 2FJVA 4O23A 4I64A 3N0VA 1FHTA 1K47A 1FJEB 2C2DA 4E98A 3LF0A 1WOSA 2X1GA 2ZHBA 3OW2R 4DS4A 2E7XA 3BPSP 4KH1B 1URNA 2VC0A 2FJEB 2RDIA 4DX5A 2JVRA 4ES3A 2I1RA 2LMIA 5HQMA 3RUBL 4Y28C 2P2CB 4L6V3 1IKVA 3WIUA 4IRDA 2V5HG 4LF9F 3KG0A 4KT0C 1L3TA 2YKNA 3IM8A 4W4MA 1FVSA 1UJ4A 2N7YA 3D4JA 3KG1A 1XR7A 4QBUA 3CJ3A 1TZ0A 5E3QA 2Z8QA 3IGNA 2MYFA 4Z37A 1I94F 3ISND 1RWWB 2XMUA 3ZZTA 1VHFA 1S0VA 1S9FA 3I4HX 3CCQS 5KFNA 3IN5A 1C2PA 2ZD1B 3DLEA 3A3OB 5C7PA 2QFJA 4PXBA 1HLWA 5EX3A 3I6PA 1JQGA 1B64A 3R7BB 4CO5A 4J9SA 3BGLA 3DRPB 4CCHA 2VBXA 1VBYA 1NUEA 2XLJA 3KWMA 2DIUA 1S12A 2G2YA 3C6TA 1X4FA 1F9FA 1WJ9A 3DDIA 4OLPA 2ZH2A 4RW7A 4F25A 4F2RA 3THVA 2A0FB 4RW8A 3BSOA 1SQFA 2CPYA 3LW5C 2F4VJ 2YQ0A 3IAM9 1W2BR 2HGMA 2CPJA 2I8EA 5B0FA 4WFNQ 2FB0A 1X4AA 1FERA 1GFWB 3EGZA 3HSZA 2PGCA 3LH2S 1ITPA 4P2XA 4B3TF 1ACMB 1RTZA 1CJKA 2XBPA 3Q23A 3EICA 4B9MA 2C2KB 3KLFB 4J9LA 5GMEA 3ONQA 4JI3J 2ZBPA 5F8GA 1XNQJ 1AROP 1S1TB 2YH0A 4OFZA 1IXKA 4EYHB 3TAQA 1BUXA 1SV5B 3LGNA 1EARA 1WHXA 4ZVPB 2G9OA 4H4MA 2KFYA 3QRQA 4RPFA 5ADZA 5M2UA 3QGPA 5ETVA 4CNYA 1QSSA 2J5AA 2B6AA 4M5HA 4X65J 2V34A 4DQIA 1F2GA 2E7WA 1NRKA 2CQHA 3FK4A 2R42A 1VLOA 4PYDA 1VHIA 4OJ3A 2NSBA 4RBUA 4ZMMA 1BQNB 1MMLA 2BW7A 5IC6B 1NDPA 4FYXB 1JLFA 1BMQB 2IBOA 1HQ2A 4PWDA 1RTIA 2QFIA 2VPYB 4DOZA 1MSWD 1TK0A 1UKUA 2BXJA 3HI9A 3R1LA 1JLCA 4B3RF 1WEXA 3MM9B 3WDOA 3FMWA 3MOJB 3W61A 1PO6A 3CJ4A 1HMVA 3NMAA 3TUIC 2OFGX 1NJIT 3TA0A 1GTEA 3Q89A 2I6WA 3HKZD 2FTRA 4IKAA 3QGHA 2BKOA 2CQBA 3DOLA 3G82A 3RR7A 3ZTQA 1EAYC 2LQ8A 4Y2AA 5CYJA 2AYMA 4HTJA 4J9UE 3KLEA 2OEKA 1C1CA 3C6UA 2JDJA 4CM2A 3A8JA 3W8PA 1WNEA 5FLXY 3R6LB 1TL3B 2MSSA 5F8IA 5HLFB 2W2QP 2F8MA 3OR2B 2DHAA 3N5BA 2W8LA 1JJ2R 4F04B 2BJ7A 2AYEA 3OPKA 3O6QA 5A8RA 4BC7A 3E01B 1VQ6S 2AQ4A 2JL9A 1S1UA 3L7PA 3QLHB 2V0NA 3NRBA 3DRSA 2D9PA 1LQ9A 4K4VA 3R2CJ 2DH9A 1N48A 4N41A 1GT8A 4IR9A 2LDIA 3VAIA 4G6VB 2H5JB 3QWPA 2D3UA 1WG5A 4GKKF 2ZEJA 3EVWA 2EXUA 1S1WA 4FKYA 4WF9Q 4J9QA 2GVDB 1LFWA 1U8SA 4DFJA 2ROPA 5MLCV 4ED8A 2KFZA 3O44A 1P9QC 4FVMA 5C42A 3A1YG 2MZJA 3D6FB 2RSQA 3SI8A 5KFPA 5J2QA 3AA8A 1ZAVA 4DV1F 2AJ0A 1XIQA 2BJ8A 2H3EB 1AZSA 5CYMA 3UR0A 4YY3J 4JI2J 3PW7A 1NEEA 2EFNA 2A2CA 2HPUA 1FRLA 1N5YB 4X4UA 1VIOA 1JXLA 2QG9B 4U8YA 2KM8B 1VRQC 3W65A 2HGNA 1HBOB 4P72A 1F3FA 2P9EA 2CQDA 3AQPA 3OFHA 1DURA 3N9UC 2DNPA 5KG5A 2RF2A 3GYXB 1U8WA 3MEDA 5M2PA 4YDXA 4RW6B 2VDIA 5J2MB 4NEYA 3QNWB 2VU5A 2B3TB 2MB0B 4DR3F 4F4KA 3KUGA 1RWUA 3AJ2A 1KKHA 2W4PA 2DR5A 1CJUA 1B7YB 2R8HA 1N34J 3JSYA 2DGOA 3JQMA 5AJ3J 1W2IA 3MXHP 3KLHB 4M1KA 3MAQA 1R27B 1U47A 2DNHA 4TN2A 1S77D 1NPRA 1HNVA 2FLPA 1ICEB 4C8ZA 4P2FA 4QIEA 5KFYA 1S6QB 1JNZB 4DL2A 1PAUB 1YJRA 2AEMA 3EZUA 3GCWP 5DQGA 2W9BA 1YX2A 4OMFG 2GVZB 2RQKA 1X31C 3TAPA 2AGOA 1NMEB 1UFKA 3JAMU 3M1VB 2W9CA 3PW5A 3GSIA 1NNDA 3RG6A 1XTZA 4L3KA 2IDLA 3CB4A 4EO6A 3MCOA 1IN0A 1Q4RA 2BQ3A 1N4LA 1H72C 2IVYA 4FP9A 3M32B 2VV5A 1NK5A 3OL9A 3NEKA 2FJXA 1MNEA 2VHGA 4LF4J 2VD3A 4MH8A 1RTJB 2OHDA 3BGFA 5D3GB 4DFPA 3EXYA 1P27B 5DETA 2W9AA 2YX1A 4OYMA 1S9GB 3SQOP 3KKFA 3B82A 3B78A 3M8PA 2CNOB 2D7SA 3R3TA 4O4RA 4F3QA 4ZP8A 2PA8D 4OZJA 1GH8A 2HRYA 4CO4A 4ZVSB 2KFNA 5EWEA 4WE1A 1WSRA 3GV7B 3R7SB 3VGVA 2Q1LA 4WP9A 2CNLB 1TR0A 3VHQA 3T6JA 1JNRB 2OAUA 3PXGa 3GIKA 3WX8A 2GAHC 5HAOA 2Y0BB 3DHXA 3ILOA 1OYEA 2ZWPA 1CC8A 4LR8A 3BO2A 4KPCA 3TJAA 4TU7A 1K0TA 4ID5A 3SYZA 2E1RA 4F4XA 2Y0SD 1FI4A 3UI3A 1RJJA 2LXFA 1OY6A 2FYXA 3W5YA 4HH0A 4C4WA 1SCJB 3GILA 4MIWA 4D3HA 3GCXP 2LQ9A 4ATNA 2HBQB 2ZH1A 2UVUA 5IM0B 4PQAA 4USMA 2LQJA 1RT7A 1TKZB 3FEZA 1JIHA 2KT3A 1D9AA 4ZA1A 4J9KA 2CKWA 4DFKA 1B0TA 2NSCA 4UZCA 1G6BA 1S6PA 2ZBQA 1KLMA 4ZPBA 1T11A 4IG3A 3LPYA 4OZ3A 1R6VA 1PC4A 1VISA 4JI8F 3UNGC 5GADI 4CYUA 4Y2IA 2HNZB 4NEZA 1LWCA 4H4OB 1S0NA 1CJTB 1MROB 3PG9A 4ECSA 3OFFA 3LP1B 5H9FJ 4ED4A 1X4CA 3PO5A 3RW7A 4FF2A 5KFLA 3CEDA 3MCNA 3LP2B 3T1HJ 2OD4A 3LP0B 2G4BA 5KG0A 3D0HE 3MM6A 4ZOSA 1HYSB 1X9WA 1RWPB 3GJSB 1H7WA 5CHCB 1IKWB 3HDSA 1BQXA 3MEKA 2B7CB 3VTIA 4ZVFA 4ECWA 2X1FA 3QZ8A 2ZOMA 5HBMA 3K0JA 1M5PC 3I31A 1R8CA 3M6XA 1XERA 1UPPA 2EK6A 2A18A 2FZKB 4YHHJ 4OQJA 2GJFA 2VJUA 1WF1A 5KFWA 3CJKA 1Z1ZA 2GMHA 1PYOB 1B99A 5HROB 3NMRA 3G71S 4WXOA 1P8GA 2P8IA 2J0SD 1FNOA 4NMLA 1QTNB 4RL1A 3OL7A 3FCWA 1R8PA 3G9CA 1HD0A 5KFIA 1Q95G 2B4OA 4RU9A 3HSDA 1T9UA 3TVKA 4JV5F 4LF9J 2KL8A 2EW9A 4A48A 1NSPA 3TW0A 1RAIB 1UW9A 2BOPA 3GYNA 4HVZA 4RLEA 3RJMB 1MMDA 4ICLB 4DSEA 2NPFA 1VGYA 2R7SA 2PFFB 4FS2A 3BSNA 1I94J 3C14B 3PEHA 2E9ZA 1LW2A 5KT2A 4JI5J 3ENAA 5B0AA 4CLKA 3MUVP 4DR4F 5L8RC 3HFZB 2N3OA 3M9NB 2GCFA 1N88A 3ETMA 2M3DA 5K8OA 1S4EA 3MMAB 1R0CB 3ZO7A 5F8NA 3MM8B 3D1HA 1KDNA 4LRBA 3CVKA 3G2XA 2HNDA 3Q8PB 2V2VA 1KFDA 3GR1A 4DQRA 2ADCA 4FDFA 4MKAA 2B8QA 2KRRA 1VQLS 1T9TA 3Q8YA 3Q22A 3PRDA 3SSRA 2XMVA 1JJCB 1IJEB 4I6WA 3RBXA 1FX4A 5T14A 3EWGA 4NCBA 4B3TJ 3NS7B 1PYSB 4CO3A 1F1BB 1JXVA 2XNQA 3EE3A 3GFZA 1RHQB 2KJVA 2IA6A 2V69A 4U67Q 4QIFA 1YI2S 1EX8A 1S49A 4K5RA 2RQ4A 5A6WA 2R7OA 2IC3A 3A8EA 1UWAA 5F0UA 3H2UB 3DOKB 5HVHA 3I32A 3W3SA 1DHMA 3MOZA 2ROGA 4NE9C 4L76A 1G1XA 1PJ6A 2M52A 2AHOB 3JYTB 2R7TA 5HQLA 2JSXA 2AJ4A 3VVUA 3ELHA 5F8LA 2EFPA 3KJVA 1BQMA 2Z56B 3H90A 3Q24A 2HHUA 2VQEF 1WOPA 4PQUA 2VOOA 1P6TA 1GXTA 1VRUB 4LQ3A 1KS2A 2L9NA 2WVDA 3NGRA 3G6VA 1FDDA 4KV8B 3OTOF 1S59A 3QPIA 5CA5A 1K1QA 3KJFB 1RTHB 1S10A 1NZAA 3TZZA 5DGBA 4IFVB 3NCRA 2CDRB 2CPEA 3DRXA 3V6HA 2M70A 4JI0F 5K8MA 3HJFA 1UVKA 4DL7A 3CC7S 3SDEA 5KFZA 3BBCA 2JEGA 2JWNA 4OX6A 4ZVHA 3HSJA 2I0XA 3GV5B 3AB4B 1UVMA 2WVBA 2J8SA 2FHKA 3SQGA 2BA9A 3QJJA 2YNIA 5E5NA 2HFZA 2AYBA 3NAHA 1AFJA 3FKBA 3MD1A 2I2YA 3MPWA 2MHNA 3VGTA 2QC3A 1RQ0A 1V6HA 1V5VA 1RSCA 3EMTA 4LF6F 1HHSA 3CMQA 2EVZA 2E66A 2HVDA 4ZDNA 5FLXU 2RNEA 4K2JA 2CWKA 1TUGB 3F0NA 5DDPC 5EDWA 2R7XA 1FXDA 1LOUA 3PVXA 4ED1A 2GNKA 4GKKJ 2VASA 3ADAC 1OIAA 4KH0B 4FN5A 2QL9B 3GG0A 3RBZA 5A0YA 4KYZA 3EVMA 3IWLA 3JS9A 1F9HA 2OI2A 2VC1A 3VQTA 4HHUA 2CWXA 1HBNA 1DTTA 4O4GA 3PYDA 2HVHA 4FVCA 1DQ8A 4IOBA 4DV1J 1HD1A 5F0WA 4M5MA 1T05A 1V9OA 2AWZA 2BANA 4I6AA 4QQBA 2NREA 5L1KA 1IM6A 4DN9A 2WRMA 1DJ0A 2YVSA 1VCTA 3QIPA 2CQ2A 2D69A 1SUQA 2EEYA 3HHKA 2E7VA 1V3ZA 3SSSA 4M5DB 1LWFA 1RI7A 2CUYA 5CH7B 3H25A 1M5KC 2HHVA 2QEXS 4ILLA 2BJEA 1FDNA 2VBZA 1X4EA 1CSJA 3QT6A 4LUBA 4I7FB 1S97A 3I9V9 2HRTA 5K8PA 4Y65A 4WWSA 3CSKA 2MSTA 2FHOB 1K8AT 1X8DA 3S1TA 3ENQA 3MR2A 3PX4A 1VK3A 3BQ1A 2DITA 1JLEB 4QU7A 1K9MT 1RT2A 2VB6A 1EETB 4MFBB 4AXIA 1IKXB 3GZ7A 4P9SA 4QPTA 3KK2B 3TJ9A 2YWFA 2ROEA 1R89A 4IOCQ 3D68A 1CS4B 3CD0A 3IAS9 1S72S 2H9ZA 4ZLNA 4I69A 2IM1A 4IRCA 4Q0BA 2HHPA 2R7WA 4DV3F 1YGYA 2MQLA 1FF2A 2JFDA 2D3OR 4M5IA 3D0IE 2CA9A 4ZVUB 2JEJA 4NLXA 3HXMA 2GJ2A 3S8SA 2R7VA 5IWAJ 2RHSB 1SC3B 1SXLA 2GMLA 3MMBA 5CYQA 3MZIA 3A4TA 4EO8A 2ALZA 4K7QA 1FWLA 2X3GA 1FWPA 3V5RA 5ITHA 5BYQA 2RILA 4C8NA 1QE1B 2QSWA 4R0EA 1IM4A 4P74A 3CJTA 3O1LA 5G4DA 2CQPA 1WHYA 3SCKE 1N5SA 3DM2A 3N4WA 3PX6A 4DPYA 1H3DA 3W7BA 2XNRA 3IS9A 1NH8A 2DR8A 5IZHA 2CJQA 1S5ZA 1Y3KA 2UV8G 4ZLLA 3I0RB 4HTIA 2O67A 2WTFA 1TUWA 1UVNA 4F3MA 4X64F 1F2HA 2WCXA 1QD1A 2CQ0A 3OJSA 2R2UA 2ERRA 3BYPA 4URSA 4AQYF 2OPSA 4LQ9A 1TU0B 3BQ0A 2FY8A 1R3NA 2HG4A 2BZ2A 2LDYA 1IBLF 2QLFB 5AXLA 3GG1A 1TL7B 2F8HA 2VH7A 4UY8T 1TV6B 3CDAA 5LSOA 2RU9A 1T9WA 1EP4B 3NXZA 1OWXA 1F0XA 1RK8A 2R8KA 1E6YB 3PJXA 4CQ1A 7AT1B 3GFHA 3EPGA 4B9NA 1RISA 2IBKA 3E2EA 4JB8B 5C25A 1HR0F 2YY3A 5HMYA 1HQUB 2WK4A 2J6UA 3PFOA 3UR3C 4CM0A 2XTJP 3AFGA 2YNHB 1FDBA 2MKJA 2HBRB 4P73A 2XB2D 1RB0A 1Z2ZA 4K8RA 2QYCA 3H4DA 3FFIB 2DRAA 4BS2A 4QWCA 3VGUA 1RA7A 2ZE2A 3DRRA 1PSDA 5B0CA 1NAQA 1U24A 2XI3A 3M2UA 3P3DA 1W26A 2FGOA 3PEJA 4JI8J 1RT1B 3CCSS 3NL0A 2IHR1 3DXBA 5K20B 2WOMB 4CH7A 4V19X 3RR8A 4WYLA 2B9YA 1KHVA 1CBKA 2DY1A 1J5OA 2X51A 2LQ5A 5J2NA 1R8BA 1ZH5A 1O5JA 5I3UB 3G6XA 5CQGA 5E3PA 1VI7A 4ZPDA 4TXSA 3QFHA 2NUUG 1O51A 4GO7X 3NGTA 1RLDA 5LJ5Y 2LCWA 4M5GA 4QOTA 2VFUA 3GJRB 1KTVA 5L1IA 4F67A 1U1RA 4WFXA 4OL8A 1KSPA 4IQMA 4KGVB 1E6VA 3DGPB 1MMNA 2W2MP 1JLAB 1KNZA 5K14A 3DLKB 4PAAA 2WVFA 3N6MA 3HD1A 2ZJQQ 4O0NA 4FNIA 3T1YF 2DCLA 1F6TA 2ZBCA 3ETOA 5DRKA 2DB1A 2KVIA 4RX6A 4B3SF 4DV0J 5K5MA 4XIUA 2CADA 3AXKA 1IKVB 1UEUA 4OYBA 4OX7A 1NLKL 4JV5J 3NKYA 4NYZA 2HNYA 4ANEA 4NXMF 2YWEA 2M8DB 4DSIA 4DUYF 1FK9A 2PO4A 4C9DA 4I2PA 4RUAA 2OIHA 1BE4A 5EUHA 1JB0C 3OVAA 1UWBA 1UA1A 3G96A 2RJZA 3DLEB 3TAMA 4NLRA 2JEFA 3BH7B 3CD6S 1REVA 2B5JA 3QSYB 4DR4J 3MEEA 4P52A 4O0IA 3KUHA 2PE8A 1KBRA 4HL9A 5BJRA 5DM6Q 1HWJA 2CPFA 2BKNA 3C6TB 3FCHA 2QA2A 4BWJA 2R7QA 2XMAA 1QM9A 1DRZA 3UCUP 4DU8A 3G8SA 2ZVSA 3EVOA 2AW0A 1ZS6A 4ZCMA 1F5CA 1LWXA 4KRWA 4MIBA 4NASA 3HM9A 4NLVA 9RUBA 2NLWA 4OI2A 2XM3A 3OTCA 4X4PA 4DR6F 1FKAF 2VPZB 2MTLA 4F2SA 1VYAA 2LECA 1SKUB 4A46A 2F63A 1CJKB 2HVEA 2XZDB 2J7UA 4NLSA 2ZOFA 2R8JA 4RUCA 1RAHB 4L3NA 2LYVA 3HSGA 3HF5A 5ETTA 2QL5B 2BACA 3MHYA 3L9ZA 1RYRA 3C16A 3BKFA 5DLGA 4H4MB 1SVDA 2OPQA 1IR1A 2VG5A 1RHJB 3RAQA 3SV3A 4DQSA 3TANA 4Q8EA 2V67A 2EWHA 1DLOA 1WDDA 2ZH7A 1JLGA 2H4YB 2CRLA 3D67A 4Y34A 3KNGA 3ZC4A 3OTBA 4O3OA 3MUMP 4PWDB 3JXOA 1RTIB 1WHWA 3G4SS 1OPZA 2DNZA 3OTOJ 4YR0A 4K0KJ 1KWMA 3CCUS 1MU2A 2DNOA 4OI6A 1JLCB 1K1SA 2B0GA 4Q44A 1QY7A 1TP7A 1RBOB 2BX6A 4YUDA 2E29A 3NS5A 1HMVB 4DPUA 4OZ0A 1RAAB 2RB7A 4LR7A 3HLUA 4NWBA 2O66A 3J7YI 2RU3A 2UXDF 2UXCF 2K7KA 4C97A 3TZWA 3DOLB 4DUZF 1HW9A 1SC6A 3DN9A 5G0RA 2P9CA 3ET6A 3KLEB 2WZ1A 4DWIA 3C6UB 2GHPA 2UUCF 1VBZA 2HZCA 4ELUA 2ZKUA 1LXJA 2ASDA 2DO0A 4CLUA 1U6ZA 2DCUB 2VFSA 3H98A 5A8RB 3LOUA 1QJHA 4M5LA 3AB2B 3AAWB 1BD6A 1UPMB 3ZZUA 3DRSB 2JFKA 2Z2MA 3K2YA 5B08A 4CWBA 3Q0AA 4LF6J 3GFYA 2QLWA 1QAXA 2NYIA 4CZCA 4ZLJA 5D4NA 3I5CA 4DV2F 1FRHA 2XULA 2BYCA 2IRUA 5J1PA 1RWNB 2W2PP 4K4YA 1S1WB 2Y1RI 2H5IB 3D6MB 1NSKL 4M8LA 3BM7A 3M05A 2IMOA 4UUXA 2R9LA 2RHQB 4QR2A 2PMZD 3KNAA 2L9WA 1IBCB 2KN4A 1AUSL 5C2CA 4KKOA 5C42B 2CNNB 3K5OA 5HVGA 3BDEA 5J2QB 4OYZA 4F0MA 1AZSB 4HYKA 3UVJB 2GAGC 2OH2A 5CYMB 1GX6A 1S6UA 3B4DA 3CCES 4PWWA 2W4DA 4TY8A 2HQGA 3ZZYA 3CJQA 1VJWA 3P96A 2Z58B 2GFFA 4LRAA 1SB6A 3MFIA 3IR7B 3W60A 2OMOA 3UFCX 3U1MA 1Z4UA 2KYZA 2RQMA 3QJLA 3THPA 2YX7A 4ZHRA 1Y4ZB 2GZOA 2JLGA 3GE9A 1VQPS 1KHWA 1D1UA 3UN2A 1VMBA 2RF2B 2C2OB 3MEDB 4QIGA 5A8WA 3W2VA 4NLWA 3C15A 4F4ZA 2N7CA 4CO2A 1VQOS 4C48A 1GMWD 3X1LB 2AX0A 2QA4G 1A6LA 2MZQA 2MGZA 1CJUB 3DRYA 4ENOA 3TA1A 2HLUA 3E3XA 4USWA 1WACA 4C3KA 4Q2MA 1VQ4S 3TVYA 2YKAA 5GAEI 4X65F 2B43A 4AE5A 4RW9A 3Q8SB 4ECYA 1HNVB 5E33A 1NK6A 2M5YA 1WC3A 2XO6A 5DLFA 3PR5B 2W9BB 2Q6CA 1F3VA 2AZ1A 3TNVA 1TTHB 2G0CA 3PIPQ 3C19A 5KT5A 4XPEA 1LNQA 4DV3J 1TVRA 2EKYA 2W9CB 1XC9A 4EUVA 2ILZA 4E8UA 4MYUA 1KQFB 3HT3A 1U49A 3VALA 1AXQA 3W2WA 4C0OC 4G1IA 3M2RB 4KTQA 1Q79A 1RT3A 1S1XA 4KIAA 1R31A 3CCWA 3N28A 1WI8A 2MQQA 2V9KA 2ZDPA 1RHMB 1YRXA 2XZTB 1SH2A 5IV3A 2YNGA 4F4YA 1LFPA 2NR0A 2MJNA 3NAIA 3M8PB 3ILJA 4WFZA 4WXWA 3G86A 2QMWA 5D77A 4RWWA 1V5IB 2HBYB 5ETLA 4RNNA 2KXFA 5HI7A 3GJTB 4X64J 4A8FA 1RAOA 4JV0A 1RYSA 3R5JB 4AQYJ 2VG6B 4DX8H 3LAMA 2MKYA 4IRKA 1RWVB 3C3LA 5A2QU 1IBLJ 4A8KA 1ZA2B 2CQ4A 4ID5B 1TFYA 1N5QA 2HFNA 1YKWA 3Q83A 1L3KA 4PCQA 3IRXA 1NSQA 4QIWD 2JH3A 2ZZTA 3V4IB 2EFGA 4DR1J 4WTYA 2VPWB 3ZTRA 1UEVA 5KFHA 2C2EA 1ZM3A 1YQHA 3HVRA 4TQSA 2XSJA 1HR0J 1LK5A 2XO7A 3BZQA 5KTQA 3FQKA 4N5SA 1RT7B 3T9NA 2JHEA 3UCGA 3DHWC 2LEBA 1B3TA 1S0OA 3CCJS 4LVOP 5J2PB 3TZXA 1U2FA 3DLLQ 1NH7A 3BF4A 3VAMA 2OPPA 1KLMB 4CT9A 2XMJA 4IG3B 1XBWA 1ZPWX 3S01A 2JX2A 3DKDA 1JWWA 4AXJA 4CYUB 1YJ9S 4JI7J 4N47A 2NPIA 1LWCB 3PR4A 2R2RA 4DPXA 2CVIA 4B02A 2VDHA 1NBEB 3BO3A 2V2QA 5D0RA 3IR5B 5D0EA 3M8QA 1U09A 3OFEA 5I3PA 1FTRA 2CQIA 3MM6B 1HPZA 3C66A 2VL1A 3ITHA 4C11A 4OLOA 3JAMY 3UDVA 4DLEA 3CC2S 1D8ZA 4QJVA 1X5TA 1Q1KA 1C0TA 2ZZMA 1AW0A 3J81Y 5HBMB 2ZHAA 1SI9A 4MKVA 1LV5A 4NMXA 1BLUA 3N6NA 4U9RA 2PC6A 4X4SA 1RT6A 3MR7A 4MJKA 2XSFA 4DV5F 3CJKB 3OTDA 3MM9A 3QT7A 3EX7B 1NDCA 3KHLA 1S9EB 5C24A 2J76E 3EDRB 5HATA 5KFBA 3DLHA 4ZPCA 3T1YJ 5E3AA 4P7TA 4ZP9A 1KOHA 3R7NB 2IJFA 4FYVB 3PTWA 2DNYA 4B3SJ 2IVMA 3MMCA 3RB6A 8RUCA 4DI6A 1UMJA 2KT2A 2MQPA 1TL5A 1RZMA 3T9ZA 1U02A 3FZ2A 2DEJA 1H2UX 1RGVA 7FDRA 1VDHA 1N36F 1TAQA 1VRTA 1YRTA 3T5KA 4M5NA 1LW2B 2FVPA 2K06A 3RBDA 3R5GA 2DR9A 3L7OA 4EFAC 2BBEA 4URGA 1FO1A 1B0VA 2Q43A 2UXBF 1CULA 4CLLA 1BY9A 3AY0A 3TQ1A 3M9MB 3UW1A 1U6FA 4KHRA 3MM7A 1FFGB 3V4MA 1QSYA 3G6YA 2RRAA 2RKIA 1VJQA 1N8RT 2GVDA 5KFFA 3TZYA 1GXUA 2DR7A 1X4DA 3CMAS 1HHQA 2Q3PA 2ACYA 2V2KA 1CVJA 2BJ1A 2J0QD 3SIPB 2HKEA 1WF2A 1O8BA 3BDPA 7FD1A 3QYYA 2HURA 3HCXA 4DR6J 1ELOA 3U7JA 3P4UB 3R2DJ 2DH8A 1FFWB 3I5AA 2BR0A 3V81A 2OEMA 4J9OA 3BPDA 2PMWA 5ETOA 2HHWA 1RU2A 1IJFB 4OI3A 4LFBJ 3RZAA 2XS2A 2XI2A 1SIWB 3T5JA 3CDEA 2J0XA 3R97A 3O8WA 1PILA 3TVZA 1SIZA 2IC3B 2AF6A 3VQSA 1PG5B 3AODA 3JSMA 4GVBA 1R6YA 1NK9A 4QYZJ 1U0HA 2Z2ZA 4YEAA 4AFFA 4RW6A 4QR1A 1KP6A 2GX8A 1R0AA 4NLUA 2B9XA 5IOLA 4LF2A 4UZBA 3MDFA 2GIFA 2ZH8A 2W2NP 1Y7PA 2HVIA 1D3WA 1DQ9A 4FBUA 2XLKA 3QSIA 4EU0A 3OR1A 3DOMA 3FCVA 3P5BP 3KJVB 2XG8A 2CAJA 4PQUB 2C3YA 4USKA 2QSFA 1XK8A 4F0HA 4IFYB 5HSPA 5KFUA 2MEWA 2RRNA 1IBKF 4LSNB 2EC2A 2V8DA 4R8UA 1WC6A 3M6VA 1GQEA 4J9MA 1T03A 4WCEQ 1YDLA 3TUJC 3JTNA 4DG1A 4UQGA 3GU0A 2QX0A 2BM1A 1DBDA 2R2TA 5L9NA 2HMIA 3SDEB 3WBZA 4WYWA 3QQCD 4EGLA 2UXDJ 2UXCJ 1U1NA 1LWEA 4CIOA 3WC0A 5AE3A 3FBBA 3D28A 2ZJPQ 3W64A 1U45A 1B70B 2UUCJ 1NO8A 4FXDA 3I9ZA 3SQGB 3M32A 3KK3A 2HBZB 3MTJA 2DPIA 4OYWA 3G6ES 3VF0B 3TI0A 1RTJA 2FUG9 5AT1B 1TUVA 1RABB 4A8WA 1HNIA 1DY3A 2NZCA 1CEZA 3HO1A 4B17A 1VBXA 3TX8A 3CMES 4DV2J 4YDDB 2W2OP 4TQRA 1Q82T 5CCLA 3U1LA 3G87A 4PXDA 4EWTA 5KG2A 3ILLA 2JRSA 4WTOB 3M6WA 5A0YB 5HQ8A 2Q6BA 3L4BC 4JI5F 5A76A 2Q79A 1HBNB 1DTTB 4O4GB 5ETRA 1XJWB 1GAOA 2CZVC 3N6LA 1U48A 2PDAA 3FEXB 1B4SA 3DCAA 4U6PA 3V2UC 1L3SA 1T05B 2BJDA 3T5LA 1N32F 4ECRA 2BANB 4J7CA 2VICA 3VAKA 1YJVA 1T9VA 3KUEA 2W01A 4P2SA 2EFOA 3KTQA 2QV6A 2RT3A 4NLTA 3QIPB 3BN4A 5F8MA 1SUQB 2BE2A 4ED5A 2N4DA 2MXYA 4IH6A 1JXEA 1RWXB 1LWFB 2W4CA 2BVZA 3J7A1 3R8YA 3WIVA 4RR5A 3OLBA 2DD8S 3F56A 4DN0A 2OGUA 5J1EB 3BJYA 4HR2A 2IYGA 2DGTA 2MZTA 4S0MA 3NWGA 4LRCA 4KAIA 3ENVA 1NJXA 1RT2B 3CCLS 4H4OA 5LT5A 3BKTA 2BM0A 2QMXA 3IXQA 5LMUF 2I38A 1FRMA 5D78A 2CPIA 4KY3A 4ZS6A 1WKJA 1XR6A 1FA0A 5LSRA 3KOAA 2Z2YB 1Y9OA 1RU1A 1NK8A 3MEGA 3LP0A 1T3NA 3H20A 4FNHA 1IWAA 3HVTA 3DLBA 1HYSA 1U2CA 3FEYB 3CJ2A 1IKWA 4DPWA 1NKEA 2RRBA 4XAKA 4F4WA 3A8IA 1X9SA 4RW4B 4W90B 3T6BA 3OV7A 3PRBA 4DL3A 1HNWF 4ZIWA 2R4FA 2HSEB 1OYDA 5CYQB 4LBPA 3CDWA 4BC9A 3QJPA 4A8MP 3NNAA 1I1GA 5HROA 5DM7Q 1I6JA 3ZTSA 5B0GA 2XY7A 5LXYA 4OI4A 1VR6A 3MUTP 2XEXA 3QRPA 3MWBA 4DL4A 1QUPA 3D1QA 3UQSA 1WD6A 2WSEC 2V8HA 4YMEA 1IQZA 4OZ2A 3VZIA 2E5IA 1AYEA 3RB3A 2BQRA 2UUTA 2HVZA 3HZEA 4F7VA 5HJYA 5JVGQ 3IS9B 1JKHB 5KG7A 3R27A 4OV6A 3JB9k 2V63A 2LP4A 4YB1P 4ITSA 4WFBQ 2P6SA 4J9NA 3MPUB 1C1BA 3GR0A 2D9OA 4ZVGA 2OPSB 2BV3A 5F3ZA 4HDHA 4EMDA 3W8GA 4NCGB 4LF5F 3JSRA 1KVJA 1H74A 5FDLA 2NQPA 2NS1B 2UUAF 4ZN1A 1S76D 2GO8A 1NJYA 1A9NB 1SJ1A 1EB0A 2YKOA 3P6YC 4CLYA 4QIVA 3HPOA 1Y00A 5KFGA 3U1NA 2BEFA 3MMAA 2DNKA 2KYXA 3KLIB 2WBRA 5C25B 2JVOA 2B4VA 5F8JA 5LL6d 2HEKA 3NBPB 2FHJD 3I56S 4NOHA 2FJWA 4CH1A 1KLNA 1TKXB 4NPOA 2YKMA 2HK2A 4U8VA 2VA3A 2E5LF 4X4RA 1PBAA 2J9CA 2LEPA 4G1PA 2RMLA 2ZE2B 3DRRB 4MTPA 1WUUA 1JLBA 3IFEA 5H1SV 3EZOA 5E2QA 3DMJA 4X4NA 4NLOA 1W7WA 2OFHX 5L1LA 4RBTA 3CJ5A 4TLQA 2DO4A 1QUVA 4AT1B 1YJUA 2AEJA 1J5OB 5J2NB 2HQDA 3D1OA 2ZM6F 4CI0B 1OY8A 2HFUA 3LPEA 1H0HB 5DO2A 4USTA 3EYZA 2YPYA 2M4MA 1YBUA 2KRBA 1GTHA 3QO9B 4FPRA 5JMNA 3P49B 4CLFA 3H42A 2BW2A 3M4XA 2KHDA 4ILRA 3NGKA 8ATCB 4NCAA 2FDNA 4L72B 2GHVC 1H38A 4I6YA 4KGMA 1VQMS 4DV5J 3TWZA 2NCKL 1S1VA 1GMUA 4K50A 2MKSA 5D4PA 3WC2A 2XWYA 1HBUB 2QN6B 2DNGA 2BJ9A 2R7RA 2DIVA 1S0MA 4JI6F 2UV8A 2V4RA 3DU6A 1TKDA 1HQEB 2YPZA 3J81U 4WK3A 5IWAF 4LIRA 4ALZA 4J5OA 3VAFA 4UY85 3NY0A 4ZCLA 4KB7A 2DNNA 2XC9A 5C2GA 2DT9A 3AOBA 2IAJA 2HNYB 2H51B 5E41A 3IG1A 1XQIA 4DF4A 1FK9B 2UP1A 4I2PB 1QAYA 1N36J 2OPRA 4BHQA 3Q8VA 1UWBB 3ISZA 4PRFA 2CIMA 3BBFA 3TAMB 2MKIA 2HZAA 2QJ3A 4EBDA 1RKJA 5KT3A 3CIMA 3SSQA 3FJ2A 1VQ9S 1REVB 2FVCA 2B5JB 4BBYA 2UXBJ 2IY5B 2G0JA 4UUWA 1EKSA 4OJ1A 4OIXA 2IFXA 1KN6A 2ALYB 4ZCKA 3AQOA 4XO0A 2W7AA 2DR6A 3JQKA 4ZITA 3BO4A 5THWA 2AJQA 1N0VC 5DJBA 4IG0A 4C8OA 1GXLA 3I0SB 1J27A 2LU2A 4O3PA 2ZH4A 4H4KA 3B6BA 3H59A 1LXNA 2K1RA 4USHA 3MMJA 1ZTTA 4FZVA 4OHYA 5HVFA 4MKBA 5KFAA 4A4JA 2KI2A 3PIOQ 5KFOA 4CO1A 1XEZA 4M63A 3TX0A 1HWIA 3UN3A 2GQQA 2E1CA 3H4BA 2EI5A 1S6OA 4ZPTR 1FDAA 2J9DA 2DPJA 4OZ1A 3DLGA 1NDLA 3GIIA 4KGKA 3CCZA 2V94A 1UFWA 4LVNP 1JJ4A 2POKA 1FTCA 2D74B 1KTQA 2QT7A 2MY7A 3KFWX 1YITS 5DG7A 1R8AA 2HW3A 1FVQA 5B0BA 2UU9F 2BRLA 2HIYA 4LT6A 3TEGA 4NXNJ 1KQKA 2OPQB 2VZ9A 1C4CA 4ZJOA 1I3OB 1VQNS 5HJXA 4X66F 4ETZA 2GGPA 1K73T 4FYWB 1DLOB 3GV8B 3RTVA 3RRHA 2JLEA 5KFSA 1JLGB 1T95A 5E3CA 2IM2A 1D8YA 1JLEA 3Q8UA 3ISNC 2W25A 2QLBB 1S7HA 3KYLA 4U7UD 1H7XA 2EBGA 2YBVA 1IBKJ 2IJNA 3EZ5A 2VBYA 4BLGA 2X1BA 3AHPA 3NOCA 2EG2A 1X7VA 4MAKA 2LU1A 4ECTA 1TK5A 1B0PA 1FXLA 4C8YA 3C2PA 2GIQA 2PEBA 3NNCA 2YXLA 4G1QA 3OQ2A 5G0RB 4F0KA 1FT8A 5M2RA 3W66A 1YG0A 2UUBF 3ET6B 1Y11A 3KLGA 5IT0A 3VAJA 2I5JB 4WFYA 3W5ZA 4C0HA 1KONA 3CT9A 4JV1A 2A2DA 2XZWA 4UW2A 2FD2A 3SCJE 3EJMA 3MI7X 2E1PA 1M5OC 3ZZ0A 3PRVA 3CC4S 3TARA 1KRPA 5HO4A 2G0IA 1QE1A 2UUWA 4IO1A 4DV0F 4ZKAA 3TJ8A 4GO5X 3BKUA 4DZDA 2ZVIA 1M90T 3D6TB 4OHWA 2MKCA 5IS2A 2QA4S 1DQAA 3TO8A 2RUSA 2WONB 2WW8A 5SZTA 4OJGA 2YKQA 4EYIB 4DL5A 1FFSB 3PW2A 5AXNA 4QW9A 5I4MA 4OHZA 5KFXA 1IKYA 2VG7A 4KKOB 5EGYA 2CYYA 3J80U 2QGFB 1ZZFA 2RIJA 1TL1A 3DXSX 1TL7A 1X4BA 2Y9HA 1UAWA 4DLGA 4G3IA 1N32J 2AJ2A 2GV1A 3OL6A 2QO3A 3NG8A 4TY8B 1H98A 3L3CA 1X4GA 5BYRA 2DK2A 3R1HA 2NXEA 4OHVA 4HHHA 1X0FA 2WAQD 5HMWA 5CXTA 3H5SA 3I82A 1Q8KA 3M8YA 2J7WA 1PIEA 2I9SA 1SH0A 1LW0B 2HAIA 4G65A 2UVRA 2YNHA 2XCAA 2DHHA 3EXCX 1JLQA 2L48A 1IQTA 4J9PA 2BKPA 5A8WB 3HHNB 3W2VB 1CC7A 1TQLA 1BWVA 3TRGA 2BJ3A 5FIIA 3PKYA 3HHDA 3C15B 1FJCA 4QYRA 2DGSA 3X3UA 2BMBA 2PSZA 3HFKA 5D15A 4MK7A 3NGDA 3TQEA 5AE2A 4DPTA 1WC4A 2GMJA 2MGZB 1VFJA 1UFLA 2LA4A 1CPZA 3GTYX 1NB2A 2DKOB 5LMUJ 5CZXA 4PG8A 2MQOA 3RW6A 4ES1A 2V50A 5ETSA 1XMBA 1MLAA 3VV2B 2V4JA 3M2VA 2Y8WA 2OLWA 3H0PA 3KXDA 1MWQA 1PC5A 4PPDA 4HKQA 1T8EA 3DC2A 2HQ3A 2CG8A 1FXRA 1TVRB 1Y0HA 1URRA 4AL5A 3TUPA 4K0KF 1VQ5S 2A6OA 4LR9A 4WU3A 2OEJA 3MECB 5K8NA 3FUYA 4P2MA 3LA0A 1HNWJ 4TY9A 1RT3B 1S1XB 2Y8YA 3ICLA 4OZNA 3I5BA 3PYFA 2JZ5A 1NPPA 1VS3A 3CJSA 1RT4A 2WBMA 3CCVS 4LFAF 3TYTA 1CJVA 1T02A 2FVRA 2M7SA 1EIYB 4Z7YA 4YN3B 2PFDA 2YNGB 4WK1A 1D0EA 2ASJA 4DR5J 5H9EK 1RCXB 4U96A 1PBUA 1M1GA 1SPBP 1ZETA 2WVEA 3BS9A 2V6AA 1U2RA 5IC4B 2HZVA 1G3OA 2XWXA 3BH6B 1FNMA 1J5EF 3MM5A 2N82B 1NB7A 2VA2A 4CH0S 2ZFHA 2HHQA 2DXDA 1ZOTA 3IP0A 1OY9A 4CLZA 3W62A 4F8RA 3LO3A 2KG0A 3KJNB 4ECXA 2EKNA 1FD8A 1ULRA 4UF4A 2AMCB 4DJBA 4LF5J 3ENWA 2CPDA 4WU2A 3SBMA 3VAHA 2CJYB 2UUAJ 3AA9A 5KT7A 4LSZB 4DEZA 3MR3A 4PKDB 3IRXB 4LSLA 1UP1A 5C5JA 4ER8A 4OJHA 2KH9A 1N56A 3QAUA 1GMVA 3QT5A 3PW0A 4DHVA 5DDOC 5GVQA 2FY1A 3Q8RB 2AX1A 2P9GA 3NP5A 4JYAF 5F41A 4D3GA 2XSJB 1U25A 4I68A 5ETKA 2YX4A 4W98A 4I1TA 2RS8A 3GIJA 2DISA 2NXNA 4CLSA 1Q0NA 2VJVA 5DS7A 2AZ3A 1L5UA 1OSDA 2N4CA 2D3O1 4ID8A 3DYAA 3PHTA 4RNOA 2QIFA 2E5LJ 3R5AA 2IRXA 1GMWA 2M2BA 2OPPB 4F50A 4AL7A 1WG1A 4QZVB 2E5GA 2OMLA 4C3MA 4ZPVR 5A6PA 1SJFA 5J1NA 3FRZA 2EG1A 5KFMA 2HHSA 3H2LA 3S6EA 4E2FB 4M5KA 2NZ4A 2K3KA 4CTAB 2VKRA 5GMDA 3CJ0A 1UEKA 3JTOA 1AFIA 3KK1A 1FJGJ 4ZPAA 3AOAA 1OSCA 2ZM6J 3M8QB 3MGJA 2RD5C 3K58A 4MK9A 4X4OA 4DX7A 3SCLE 2V8PA 2HS3A 3HK2A 1HPZB 4ZP7A 5I42B 3L7UA 3ITHB 4C11B 1TMJA 5KFKA 2CQCA 2Q66A 1H6KX 4A47A 1OMSA 1C0TB 5HMZA 4CLPA 2LXIA 2H5EA 2V2ZA 4PUOA 1BWEA 3HT0A 3OD2A 3MPVA 2R8IA 3AD8C 1RT6B 2XS7A 3FSYA 2A10A 2W7OA 1UW4A 1Y3JA 3DI6A 2Z4PA 1P1TA 4OX9J 1TAUA 3MAAB 4B9UA 5C24B 3MR5A 4WBFA 4ED2A 2ZH5A 1M5HA 5KG3A 4I56A 3A3PB 4JI6J 4LJMA 4KSEB 4JI4J 3IBFB 4ZIVA 1OS5A 4NLYA 3T5HA 5D6GA 3BR8A 1U1QA 4KFBA 3MMCB 4DQPA 2W24A 4A8QA 3ZNUA 3KDOA 2RDDA 2V8VA 3IM9A 3IR6B 2ZNYA 3UO0A 3O2IA 5LMNF 2EFVA 1FEEA 1KD1T 1NK4A 1SH3A 1VRTB 3HD2A 3CPWR 1WTFA 4L73A 5A2QY 5A8KA 4B9TA 3CXCR 1UVIA 1S4FA 2RQCA 2F7VA 4DCPB 3OFGA 1ZPVA 1CULB 5CAAA 3C8YA 3W9IA 2E5JA 5B0DA 3R5DA 1XNRJ 4O44A 5KOWA 2KM8C 4GC6A 5AE1A 4USIA 3PYEA 5IT9U 1KC8T 1PCAA 4NI2A 1FKPA 3MM7B 2XGQA 3TOQA 2RKIB 1BGXT 4IDKA 1HHTP 2V68A 3JTPA 1RUSA 4Y00A 2R3VA 3GONA 1S99A 3UD4P 1Q7YT 3SFUA 1XMOF 3K5MA 1PKUA 1WC1A 5GAGI 2CJKA 1NZ8A 1ZTWA 2NUHA 5HN0A 4KBIA 1HL6A 3UVJA 2L9DA 3ZTPA 2FHMA 4YFUA 4DR1F 4P71A 4IUFA 1H73A 1VC6A 3E8OA 2JNJA 4K2XA 4MK8A 4ZVOB 2ZDOA 4RU2A 1MG7A 4RO0A 4KGXB 3V81B 4ANDA 2ACMA 1UVLA 3RGIA 1XMQF 3HJVA 3SV4A 4U7UK 4PABA 5KAKA 3RRKA 1HI8A 1NHKL 4R5PB 4X4VA 2UU9J 5EX0A 3JSMB 4GVBB 3TEHB 3RYLA 1U0HB 3SMZA 2HHXA 3AXMA 1R0AB 4OYAA 4DS5A 2DGVA 1RAJA 5D0GA 4UOFA 1R43A 4X66J 4JI7F 3FBEA 4FBTA 4MT1A 2AD9A 3Q2TC 4DF8A 3CDUA 3OR1B 4O3QA 3DOMB 1LEOA 4GKJF 4DR7J 4RZRA 3OUYA 1WKLA 4LF8F 2DGQA 2MKKA 1C0UA 3QT8A 1K0VA 4R8UB 1SBRA 2J6SA 2VQFJ 3VCDA 1T03B 2W1BA 3DFEA 4DG1B 4LIWA 5T41A 2D41A 3P5TL 3IA0A 4PXCA 1N6QA 2CQ1A 4O3SA 4F26A 2M8HA 4DCOB 2HMIB 1LWEB 3AH6A 4RNFA 2OKQA 2O3DA 2RUGA 1M1HA 1LK7A 2UUBJ 2MLZA 4EI2A 2MQ8A 4C7QA 4KO0A 4L74A 2KB2A 3POTA 5ETPA 1UA0A 3M2RA 3M8ZA 3H7HB 3DDKA 1YJNS 1Q8IA 1U1LA 2F4FA 5F3TA 3ULHA 3KK3B 1U6BA 5LOQA 2ZKTA 4KPYA 5KFVA 2DY9A 3UN5A 1HNIB 2HWHA 3BGRA 2DXEA 4BDPA 2FJDB 4Q5VA 4NL5A 4AD6A 5KT4A 4KC5A 2YTCA 2YKNB 1XR5A 4B3OA 6AT1B 4IQXA 1YBTA 1FWKA 4ELTA 2C2ZB 2ATCB 4P6QA 4HACA 3FSIA 1FRJA 3MCSA 5AXKA 3VZHA 1RXOB 2C3UA 1UTAA 3FSXA 4TLRA 1HW8A 2LEAA 1K44A 3QZ7A 4JP8A 3JSBA 3ZZZA 2VG6A 3P45B 3O3LA 5CD4H 3PM9A 2F1FA 4ES2A 4CDIA 4M5JA 4PG4A 2AGQA 2VFTA 2C3PA 1RA6A 2APOA 3V6DA 1WHVA 4RW7B 3MPDA 2CJ9A 3V4IA 1QVGR 5ETMA 2W8KA 4RW8B 2HHHJ 2CQ3A 3QBCA 1EQ0A 4NYOA 1XWLA 2BE2B 2HFOA 2RVJA 3F41A 3EPIA 2DRBA 3D3BJ 1HKAA 3HFVA 4HEA9 4AL6A 5J2PA 2IYIA 1H2TZ 2H65B 2ZBRA 4OV1A 2YWWA 3US5A 1EJ7L 3UWTA 4DXLA 4C98A 5JJBA 2PA3A 3D0GE 4LFBF 4LREA 3LGHA 4M94A 2BABA 4ZVTB 3G8TA 2MLYA 3D6HB 1AUDA 4BCAA 4LBIA 4R25A 3EM1A 2H54B 3QFWA 2LQBA 4WP3A 2ZWOA 2DHGA 2XCPA 2Y1JA 2AT1B 1RT5A 1SQEA 1VK8A 1FCAA 2B6AB 3RAMA 2AKWB 2OJ3A 2NXUA 4JI1F 3R5CA 3CE8A 1YSJA 3CCTA 2IRYA 2OTLS 3MEGB 4X62F 5HP1A 1G2EA 1HARA 3HVTB 3CUNA 3H8YA 2C2NA 1WKKA 1RWOB 1S57A 3UDLA 1RHKB 2XS5A 3WX4A 1DZ5A 1JLFB 3SXLA 3M8WA 2YWKA 2B7BB 4FKXA 3UD5A 3ZXWA 1M0SA 3T19A 3PFEA 2MZ1A 2Y3YA 5JXSA 3K5PA 2R2SA 2D1CA 1YIJS 3W9HA 1DARA 2YWHA 2VIHA 4ECZA 1W25A 4LFAJ 4ELVA 2B8PA 1S9EA 5LM7E 3HVWA 1Y10A 4C2MA 2WVCA 5RUBA 4DSJA 3G82B 2CPZA 1U1MA 4Q8FA 3OL8A 1RADB 2CDQA 3OSNA 3NLCA 1C1CB 4X4QA 2LXUA 5GAGU 1IBMF 3PZPA 4WJBA 5DGAA 5HL7Q 3OSPA 1YJWS 1T3OA 1J5EJ 1Q7LB 1X0PA 2QMUB 3M8RA 3PW4A 3FBCA 4RUHA 1C1BB 1S1UB 4I0WA 2F3JA 2M0GB 4DV6F 4RWXA 3NCQA 4Y6IA 2BDPA 3J7ZT 1SL1A 3M30A 3D54A 4RNMA 3OHAA 3GFXA 2OO4A 4TYBA 2CJBA 4HI1A 2VFVA 2B56A 5FDLB 1ZBTA 5T7LA 1X60A 1HBMA 3TP2A 1X5SA 1RDRA 2ZOGA 3IGVA 1DTQA 4USUA 3BSCA 1T9XA 2K8GA 2D3ZA 1TKTA 2IPOB 4WFAQ 2FJBB 2U1AA 3M6UA 4M95A 4YOEA 2YNFA 2MMYA 1GNKA 4JYAJ 1WF0A 1R7IA 3RBEA 3QRRA 2KT5A 2FQQB 4WPAA 3TUZC 2FLLA 5KG4A 4CP5A 4WKRA 2X3DA 2ZC4A 2YKMB 3V6JA 3K89A 1MWYA 1Q78A 1RTDA 1X4HA 5GMKa 3HHLA 3U02A 3FVYA 3B54A 2J8AA 4AUKA 2RH3A 1JLBB 3FRYA 3I96A 4KE5A 3K7RA 2KG1A 3DMJB 3I55S 1SJ4P 3IWNC 3S7RA 2LKZA 3BV8A 5EWFA 4ZJQA 3TA2A 2G2ZA 2C2MB 3FNNA 2CXEA 2H1YA 2AV5A 2M9KA 2Y1IA 4BWMA 1FRKA 5L46A 4EBEA 1YJTA 2KU7A 4K4WA 2ZBIA 1WC5A 4EBCA 4FYYB 5KFRA 3PCOB 3ZZOA 3O5TB 4ED6A 3LGMA 1RHRB 3H5XA 5H9EJ 1M5SA 2BUNA 4MKYA 1S79A 4LRDA 1VQ7S 3NGUA 4IH5A 4MIAA 4ED0A 2YQ1A 4N77A 2VODA 3BQ2A 1YRUA 1SJRA 2FJAB 4IFYA 3CW2C 1GEHA 1U1KA 4ZLPA 4LSNA 3D3CJ 1KOOA 3AOCA 2XYGB 4YB5A 4EZ9A 2KZMA 2ILYA 1OPIA 4UT4A 1I51B 4B3RJ 1S1VB 3QMQA 4WZMA 2C1EB 2IDEA 4ECVA 2K2PA 2MLXA 2ZJRQ 2VUGA 6FDRA 4OX8A 5IXUA 1FKOA 2N3LA 4DFMA 1D9DA 4I2QA 3N5FA 1YLXA 1WDTA 1ZAWA 3GMGA 4UQTA 2E9TA 2HAFA 2IAJB 4H4KC 1X5PA 2ASLA 3IG1B 4ZPWR 2DEIA 1N54B 2MDAA 3ZZRA 2ZNZA 3RB4A 3LTOA 1L3VA 5LMNJ 1L3UA 2OPRB 2Z0GA 1KVIA 2NXCA 4C8KA 2C22A 3GLJA 3UPFA 5L9XA 4F36A 2XY6A 3MCMA 1F9EB 5D8HB 4WE1B 2DGUA 3ZNJ1 2FIUA 1WEYA 4PPZA 1Q81T 5AXMA 5HMXA 3WZ0A 1RAEB 1A7GE 3KMQA 3HP6A 4IG0B 1M5VC 2ZD1A 2KTQA 1QAIA 2FHJA 2HLTA 4J37A 2EBEA 5GADU 2ABYA 2MQNA 4OZ5A 3LQVA 3UD3P 2UZAA 1XMOJ 2K1RB 3EGNA 3BGOP 4HDGA 3DRPA 4FF4A 1FNXH 4FXVA 5BYSA 4PYAA 3BEGB 2PMHA 2HK3A 2KKHA 4Y2MA 1G4CA 3VAGA 1RACB 2DRDA 3DLGB 4F02A 4N8NA 3BYRA 3OXLA 3PYGA 3EDQB 3H40A 1OQ6A 3LWMA 1XMQJ 2XY5A 4URQU 2DVIA 2NYHA 3N79A 2FC8A 2VOPA 5CD4A 5MAOA 2H48B 4P10A 3J7AN 3PO4A 1TELA 3PACA 1S6PB 4RBVA 1FRIA 5B0EA 2IM3A 3NOGA 3KLFA 2GGPB 1SKWA 2WSFC 5J1EA 5F9LA 4DR3J 1S1TA 2F5GA 1SV5A 2ZHOA 2V9WA 4GKJJ 2XLIA 2C3MA 4ZK7M 2IM0A 1T9YA 2J9DE 4Q7AA 4LF8J 2HQFA 1ZYQA 4WZQA 3E51A 3W1YC 3ZFVA 2HRUA 3C46A 2VFRA 3CDBA 2B4UA 3HULA 4PG6A 3LAKA 3UDCA 2DJWA 1SL2A 2MQMA 1BQNA 4XDDA 1U1PA 1BXNA 5JVHQ 3HKWA 4PG7A 4ZJLA 3K17A 4RW4A 4G1QB 3DGVA 1V3SA 4XTTA 4NRTA 1NXIA 3KLGB 1KFSA 2HQIA 4LFCF 2GIRA 3QIDA 4C8LA 4EK2A 3ZZPA 3CGIA 2RS2A 1VC0A 1TMMA 4NA1A 1YVFA 4DV4F 3V6KA 3PKMA 5DZ6A 1GX5A 1VOMA 3MD3A 4DBQA 4JUZA 3EGVA 2ZH3A 4QW8A 3CTRA 4UOGA 2VF3A 1SQGA 4OI1A 4QCLA 2XMKA 4NLPA 2ZH6A 1TL3A 4JOUA 5HLFA 3OR2A 1ZM2A 2Z2LA 1JKHA 5F9NA 3FMBA 1N0UA 3OXFA 2PIIA 2E9RX 1ZAXA 3E01A 2MZRA 1Q86T 4NZ7A 5F8HA 4DQQA 3QLHA 1IKYB 2HWIA 2VG7B 3A8KA 4NCGA 1O0PA 4WKYA 4GC7A 2KVQE 4F3OA 2OUGA 4PXEA 1TL1B 3R5BA 2CG4A 4E0DA 2O1PA 3ILIA 4ZP6A 1HWUA 1NPKA 4J9VA 4U95A 1MN7A 2JC1A 2GA7A 2M88A 4NLGA 2KJWA 4YQWA 1RBLA 2MHEA 1BC6A 4KHPF 5CZVA 2G13A 3R9LA 1N5TA 3OLAA 4ED3A 2HNDB 1WOOA 1S7IA 3UCZP 2LA6A 3GJQB 1NCLA 3KLIA 2QLJB 3VWSA 2C3OA 1WEZA 4EZ6A 4ETXA 1S48A 3NBPA 4OYXA 1TKXA 1JLQB 2YWGA 1UZDA 3AT1B 4TKTA 4J91A 3I87A 1FJ7A 2HS4A 3CCMS 4I4BA 5L38A 3K8WA 3PV8A 1B7FA 1N5YA 2CJXB 1YHQS 5LJ3Y 2OP5A 1UJ6A 4B08A 1QVFR 1HBOA 4B3MF 4CRJA 4K5SA 1T7PA 4NXNF 1Y5IB 1HNZF 2AU0A 4LMZA 3IMQJ 4A8YA 3MPYA 1N33F 1D09B 1NM2A 3CWJA 3NGSA 1WWHA 3I4PA 2G1DA 1RAFB 3OBIA 5J2MA 1OJ4A 5CCMA 1FEHA 4JI1J 3FGVA 2XMWA 2K3IA 3H5UA 2V4JB 3M2VB 4TNOA 4X62J 4U7CA 4V19J 3HX9A 1BQMB 1J2VA 2V8GA 2B51A 2MZSA 2CPHA 3D66A
chains in the Genus database with same CATH topology
3OXGA 2KZZA 2OLWA 4TN2A 1S77D 1PC5A 3PR5B 3KLHA 5DLFA 3QO9A 4X2BA 2CZ4A 4PPDA 1HNVA 5BR8F 2FLPA 4HKQA 1VQSA 4C8ZA 3IO1A 1KR4A 2W9BB 3DC2A 2HQ3A 4QIEA 1T8EA 2Q6CA 4DV7F 3TNVA 5KFYA 1S6QB 1JNZB 4DL2A 1FXRA 1TVRB 1YJRA 2P5VA 2G0CA 3EZUA 1Y0HA 1URRA 3BB5A 4AL5A 3PIPQ 5DQGA 2W9BA 1DAXA 4OMFG 1VQKS 5KT5A 2L3MA 1S6QA 4XPEA 4K0KF 1VQ5S 1TVRA 2EKYA 2RQKA 2W9CB 2ZITA 3CD7A 1XC9A 3TAPA 4EUVA 2ILZA 4WU3A 3T3FA 1C4AA 1D9FA 3MECB 1CQMA 4HH1A 2AGOA 4E8UA 5K8NA 4MYUA 1YTYA 4DMZA 3M1VB 1KQFB 2W9CA 3HT3A 3PW5A 1U49A 4TY9A 1HBUA 1RT3B 1RT4B 3VALA 1S1XB 1AXQA 1HNXF 3W2WA 1DFDA 3ICLA 4OZNA 4USJC 1NK0A 3I5BA 1NNDA 4C0OC 4G1IA 1R8HA 2JZ5A 3M1VA 2EC0A 1VS3A 3M2RB 4KTQA 1Q79A 1RT3A 1RT4A 1XTZA 2WBMA 3TYTA 1S1XA 1MWZA 1T02A 3CB4A 4KIAA 4Y3CA 2F40A 3CCVS 1R31A 3CCWA 2FVRA 3DDNA 4EO6A 2M7SA 3AJ1A 1HQEA 1IN0A 1Q4RA 2BQ3A 3N28A 1N4LA 1WI8A 2MQQA 3TR5A 2V9KA 2YNGB 4WK1A 2IVYA 4FP9A 1D0EA 2ASJA 3M32B 4DSLA 2ZDPA 2VV5A 1YRXA 1NK5A 1SH2A 3OL9A 2FJXA 1MNEA 3QWUA 2B4PA 3IWXA 2YNGA 4FXWA 4X4TA 1ZETA 1NJZA 2VD3A 2YNIB 3BS9A 5KFCA 4F4YA 1LFPA 3MM5B 4MH8A 1U2RA 1RTJB 2NR0A 2R7UA 1G3OA 2XWXA 3MR6A 3BGFA 2MJNA 3NAIA 5D3GB 4DFPA 1FNMA 1P27B 3EXYA 1J5EF 3M8PB 5DETA 2W9AA 2O5DA 3MM5A 2YX1A 4WFZA 4WXWA 2C42A 2N82B 1NB7A 2VA2A 1S9GB 4CH0S 3G86A 1JJHA 2ZFHA 3OTEA 4RKUC 2CQGA 5D3GA 3KKFA 3B82A 2OTJS 3B78A 3M8PA 2PEHA 2D7SA 2QMWA 3R3TA 2HHQA 1ZOTA 4O4RA 1S9GA 5D77A 4F3QA 3J80Y 4ZP8A 2PA8D 4OHXA 4RWWA 4OZJA 4F8RA 3LO3A 4NZ6A 2KG0A 1QTMA 3D2WA 4ECXA 1GH8A 2HRYA 2P6TA 2ASYA 4RNNA 3DLJA 4CO4A 2KFNA 4H54A 2KXFA 4WE1A 1FD8A 5EWEA 5HI7A 1ULRA 3GV7B 3L09A 2Q1LA 4A8FA 2EPIA 4N8OA 4DJBA 1TR0A 4JV0A 1RYSA 3ENWA 1UJ5A 3T6JA 2CPDA 1JNRB 4WU2A 4ILMA 2VG6B 4DX8H 3SZ2A 1VQYA 2OAUA 3LAMA 4N56A 4YB7A 3VAHA 2L08A 3PXGa 4IRKA 3GIKA 3C3LA 4LSLB 1N52B 3GSDA 4B9LA 3AA9A 2PN6A 5KT7A 4DEZA 3KMSA 3MR3A 3DHXA 4PKDB 1CC8A 1SJQA 4A8KA 2CQ4A 3IRXB 3BO2A 4ID5B 3D5MA 1UP1A 4LSLA 5C5JA 1TFYA 1N5QA 2HFNA 2EK1A 1L3KA 2FLOA 4TU7A 1K0TA 4B9VA 4OJHA 4PCQA 2KH9A 1N56A 3I0SA 3QAUA 3IRXA 4ID5A 3SYZA 2E1RA 3PW0A 3BSAA 4DHVA 2GO9A 4F4XA 5DDOC 5GVQA 2FY1A 3Q8RB 2Y0SD 1NHUA 2AX1A 2P9GA 3NP5A 4QIWD 2JH3A 3UI3A 1RJJA 5F41A 4JYAF 4D3GA 2LXFA 3QGGA 3V4IB 2XSJB 2EFGA 4WTYA 4HH0A 3SEOA 4C4WA 2VPWB 5KT6A 1U25A 4I68A 2FVQA 3GILA 2B9WA 3FDSA 1UEVA 4MIWA 5KFHA 2C2EA 2DNMA 3N01A 4KQZA 4I67A 2YX4A 1ZM3A 4I1TA 1YQHA 4LF7F 3HVRA 4IOAQ 4TQSA 2XSJA 3DYAB 4D3HA 2RS8A 2YQ3A 3GIJA 2DISA 1LK5A 2LQ9A 2XO7A 1ZM4A 3BZQA 5KTQA 3FQKA 4ATNA 4N5SA 1RT7B 5DS7A 2ZH1A 2DGXA 1OSDA 1L5UA 2N4CA 3T9NA 2JHEA 4ID8A 2UVUA 2XHWA 3DYAA 3UCGA 5GAHI 5IM0B 4RNOA 2QZ8A 2QIFA 3DHWC 4PQAA 2LEBA 3R5AA 2IRXA 1RT7A 2LQJA 1S0OA 2VPXB 3CCJS 4LVOP 5J2PB 1TKZB 2M2BA 5IM0A 3FEZA 1JIHA 2OPPB 4F50A 4AL7A 1U2FA 2KT3A 1WG1A 3DLLQ 1D9AA 1JK9B 1NH7A 3BF4A 2CKWA 4ZA1A 4J9KA 2GC8A 4QZVB 3VAMA 2E5GA 4DFKA 2OMLA 4C3MA 1P1LA 1TKZA 2OPPA 1NKBA 1RKIA 4RNHA 2MJUA 2DH7A 4ZPVR 5A6PA 5J1NA 1KLMB 1SJFA 3FRZA 2EG1A 4CT9A 2XMJA 5KFMA 1B0TA 4IG3B 2OSRA 2HHSA 2NSCA 1XBWA 3H2LA 4XK8C 3S6EA 1ZPWX 3S01A 1G6BA 5IQQA 1S6PA 2JX2A 1KLMA 3T1AA 4ZPBA 1JWWA 2NZ4A 1KQSR 1HI0P 4AXJA 2K3KA 4IG3A 2MKHA 3LPYA 4CTAB 3KK1B 1YJ9S 4DR2F 1WI6A 3HHLD 4N47A 1PC4A 2VKRA 2NPIA 1LWCB 3PR4A 3QAEA 4JI8F 3CJ0A 3UNGC 2R2RA 3JTOA 5GADI 1AFIA 3KK1A 2FC9A 1FE0A 4ZPAA 1WTBA 4Y2IA 2CVIA 2HNZB 4B02A 1LWCA 1OSCA 4H4OB 1UL3A 1S0NA 1H2VZ 3M8QB 1VQ8S 1Q8BA 1SL0A 1MROB 3MGJA 4K4ZA 2RD5C 3BO3A 3K58A 4MK9A 4X4OA 3OFFA 4ECSA 2HNZA 3LP1B 5H9FJ 3IR5B 3SCLE 1X4CA 2HS3A 1LKZA 3M8QA 3KHRA 3PO5A 3HK2A 1MROA 1HPZB 1U09A 4ZP7A 5I42B 4QWEA 3OFEA 3ITHB 3MTKA 5I3PA 3RW7A 4C11B 2W7PA 4FF2A 1FTRA 3LP1A 5KFLA 5KFKA 2CQCA 4NX9A 3MF5A 2CQIA 2Q66A 1H6KX 3GWCA 3CEDA 3LP2B 3MM6B 1HPZA 4A47A 3C66A 1VLYA 4PUOB 2VL1A 3ITHA 4C11A 3EUNA 4OLOA 1C0TB 2K7JA 2OD4A 5HMZA 3LP0B 2G4BA 5KG0A 2GQCA 3D0HE 3JAMY 2LXIA 2H5EA 2A1BA 4DLEA 3CC2S 2J7KA 1D8ZA 2BRKA 4QJVA 3LP2A 3MM6A 4ZOSA 1X5TA 4P7VA 4PUOA 1HYSB 1X9WA 2AGPA 1Q1KA 3GIMA 1C0TA 2ZZMA 1H7WA 2E1MC 1IKWB 3HDSA 5CHCB 3OJUA 1AW0A 1BQXA 3MEKA 1BWEA 3J81Y 2A3JA 2AJFE 2B7CB 2J9EA 3VTIA 5HBMB 4Y2CA 2ZHAA 1SI9A 3DI6B 3MPVA 2R8IA 4ZVFA 1RT6B 4ECWA 1LV5A 2XS7A 4ZCIA 3FSYA 4Q0BB 2X1FA 1BLUA 2A10A 3N6NA 3PDNA 1ZZNA 1NJWA 3QZ8A 4U9RA 2W7OA 2PC6A 2ZOMA 1UW4A 1Y3JA 5HBMA 5L39A 3DI6A 4X4SA 3K0JA 1M5PC 1RT6A 3I31A 4MJKA 1R8CA 2Z4PA 4ECUA 3M6XA 1P1TA 1XERA 2XSFA 3LWLA 4DV5F 1TAUA 3CJKB 3OTDA 2EK6A 5LXRA 4B9UA 3MM9A 5C24B 3MR5A 2A18A 4ED2A 2ZH5A 1M5HA 5KG3A 2XMTA 4QWBA 4I56A 4OQJA 1NK7A 3EX7B 1WF1A 3KHLA 5KFWA 2CFXA 3CJKA 4LJMA 4KSEB 1S9EB 1Z1ZA 5C24A 2GMHA 2J76E 5KFBA 5HROB 3MMBB 1V3RA 1OS5A 2XMMA 3DLHA 4ZPCA 2I5JA 5E3AA 4P7TA 4KFBB 4NLYA 3NMRA 4ZP9A 4OI0A 3B8HA 1KOHA 5EWGA 3G71S 3T5HA 4WXOA 2IJFA 2VBWA 1P8GA 5D6GA 1F5AA 3BR8A 1U1QA 4KFBA 3MMCB 2DNYA 3HHEA 4DQPA 4IH7A 2W24A 2J0SD 1FNOA 4NMLA 4A8QA 2IVMA 3OL7A 1R8PA 3G9CA 1HD0A 3LUYA 5KFIA 2QRRA 5KFJA 2B4OA 2V8VA 3MMCA 1PGZA 3IR6B 3RB6A 2ZNYA 4ECQA 4DR5F 3O2IA 3THTA 4RU9A 1UMJA 2KT2A 2MQPA 3DM2B 5LMNF 2EFVA 1FEEA 3TVKA 4JV5F 1TL5A 3T9ZA 4HHJA 1KD1T 1NK4A 1SH3A 1VRTB 5A8KB 3CPWR 2IA0A 3FZ2A 1WTFA 2EW9A 2VONA 4A48A 4YB6A 2E1AA 3TW0A 1H2UX 1RGVA 7FDRA 5A2QY 1N36F 2DHSA 1QLNA 1TAQA 1VRTA 5A8KA 1YRTA 4B9TA 2HGLA 2BOPA 3GYNA 4HVZA 3CXCR 4O44B 3T5KA 1UVIA 1LW2B 2FVPA 4RLEA 1S4FA 1MMDA 3RBDA 4ICLB 4DSEA 2NPFA 2RQCA 2F7VA 1VGYA 3OFGA 2DR9A 2R7SA 4FS2A 2PFFB 1ZPVA 2AP6A 3C8YA 3BSNA 3PNIA 2E5JA 2WONA 3PEHA 5B0DA 3L7OA 3R5DA 4EFAC 4O44A 5KOWA 2BBEA 2KM8C 4URGA 1LW2A 1FO1A 5AE1A 4GC6A 2E9ZA 4USIA 4ICLA 1B0VA 1FKPB 2Q43A 2QA1A 1HA1A 5KT2A 2UXBF 1KC8T 2J6TA 5FJ4A 4IDKB 4YR2A 4A8SA 1BY9A 5B0AA 3AY0A 3TQ1A 1FKPA 3MM7B 3MUVP 4EEYA 2XGQA 3TOQA 3M9MB 3UW1A 1U6FA 1KEKA 5L8RC 2PT0A 2RKIB 1BGXT 4IDKA 4KHRA 1HHTP 4DR4F 2N3OA 4FF1A 3M9NB 3JTPA 3MM7A 2GCFA 1M1KT 1N88A 4Y00A 3V4MA 2FVSA 2M3DA 1QSYA 3G6YA 2RRAA 3UD4P 1S99A 2RKIA 1Q7YT 5K8OA 3SFUA 1N8RT 3MMAB 5KFFA 1NHVA 3OHBA 1GXUA 2DR7A 1XMOF 1X4DA 3CMAS 1WG4A 5F8NA 3MM8B 3K5MA 5E0OA 3D1HA 5JUMA 2Q3PA 3CVKA 5GAGI 2CJKA 2SXLA 3KG4A 1ZTWA 2ACYA 2NUHA 1ROFA 2V2KA 2HNDA 3QGIA 5HN0A 3MM8A 2V4QA 2DHXA 4KBIA 1HL6A 4WIIA 5B09A 2L9DA 3Q8PB 2J0QD 1CVJA 2FHMA 4YFUA 2X1AA 2EFQA 4O3NA 1KFDA 4DR1F 5B7WA 3GR1A 4IUFA 4DQRA 2ADCA 4MKAA 3RAXA 1VC6A 3E8OA 1WF2A 2GJIA 2KRRA 1O8BA 4K2XA 1VQLS 3MAHA 7FD1A 3QYYA 3BDPA 4MK8A 3Q22A 1ELOA 2ZDOA 4RU2A 3PRDA 5DQHA 2F4VF 3SSRA 2XMVA 5DDQC 3V81B 1IJEB 4I6WA 3U7JA 1LW0A 1UVLA 2DH8A 3H5YA 3F73A 4K4TA 1XMQF 5T14A 3I5AA 4Q43A 4KR0B 3UE2A 2BR0A 4NCBA 3V81A 3KLVA 3SV4A 1U1OA 4J9OA 4U7UK 2WSCC 4CO3A 2XNQA 2HHWA 5KAKA 1IJFB 4OI3A 3RRKA 1HI8A 1KQGB 2KO1A 3GFZA 4MYTA 3RZAA 2XS2A 2XI2A 1SIWB 4ZVEA 4PR6A 4R5PB 5DQIA 3T5JA 3CDEA 2J0XA 4O3RA 3O8WA 4X4VA 3LALA 2KJVA 1PILA 5EX0A 3TVZA 3JSMB 1SIZA 2IA6A 1HFEL 3M2UB 4U67Q 4QIFA 3RYLA 2IC3B 1YI2S 3CIZA 3SMZA 4HT7A 2HHXA 2AF6A 3VQSA 1S49A 4K5RA 1QSLA 4JI3F 3JSMA 1R0AB 2RQ4A 5A6WA 1R6YA 2AYGA 1XNQF 4DS5A 2R7OA 4R0JA 2GHWA 1NK9A 2DGVA 2IC3A 1RAJA 3A8EA 4QYZJ 5IT4A 4YEAA 4AFFA 4RW6A 5LSLA 2DNQA 4QR1A 1R43A 2GX8A 5F0UA 1R0AA 4JI7F 4NLUA 1FESA 2B9XA 4FBTA 3H2UB 2AD9A 3OUYB 3Q2TC 3MDFA 2ZH8A 3DOKB 4DF8A 1Y7PA 3CDUA 2E44A 2HVIA 1D3WA 2U2FA 3I32A 3OR1B 1DQ9A 3FZBA 4O3QA 2ZUGA 4FF3A 3W3SA 4GKJF 1FJGF 1DHMA 1YBAA 3MOZA 4FBUA 2ROGA 2JLFA 4RZRA 3OUYA 2XLKA 4EU0A 1G1XA 3DOKA 1C0UB 3OR1A 1VC5A 4LF8F 2M52A 3DOMA 3K5NA 3JYTB 3KJVB 2R7TA 2OD6A 4DSFA 2DGQA 4NZ0A 2MKKA 1T94A 2XG8A 1C0UA 1K0VA 4X84A 4PQUB 2C3YA 2JSXA 2AJ4A 1YWXA 3HZGA 4R8UB 3OVSA 2QSFA 1XK8A 1SBRA 2J6SA 5F8LA 2EFPA 4IFYB 3KJVA 3JYTA 1BQMA 5KFUA 4QPXA 4CNZA 3Q24A 2RRNA 2HHUA 1G7CB 1IBKF 2VQEF 4LSNB 3VCDA 1T03B 4PQUA 2VOOA 1P6TA 2V8DA 4NLQA 4R8UA 1GXTA 4FS1A 4TU9A 1VRUB 3DFEA 1N6QB 4LQ3A 1UVJA 1KS2A 4DG1B 3M6VA 4LIWA 2UVWA 2L9NA 5T41A 1GQEA 2D41A 3G6VA 1FDDA 4KV8B 4J9MA 3P5TL 1T03A 3OTOF 1Y5NB 3IA0A 4WCEQ 1VRUA 4PXCA 1N6QA 2CQ1A 3OVBA 3QPIA 5CA5A 3TUJC 2QE5A 3JTNA 4DG1A 4Z2XA 5K9FA 2L41A 1K1QA 4O3SA 3GQCA 1RTHB 4F26A 2M8HA 1S10A 1NZAA 4KV8A 2HMIB 1TL4A 5DGBA 4IO9Q 4IFVB 3NCRA 1E6VB 1HWLA 4HT5A 1LWEB 4UQGA 2C28A 2CPEA 2BM1A 1RTHA 1DBDA 4KO0B 5L9NA 2R2TA 2HMIA 3AH6A 3MECA 3SDEB 3WBZA 3DRXA 4WYWA 5K14B 2OKQA 4RNFA 2M70A 3V6HA 2O3DA 4IFVA 4JI0F 2RUGA 4EGLA 1LK7A 5K8MA 1IUJA 1U1NA 1LWEA 3POTB 4OX9F 4CIOA 2UVVA 3HJFA 1UVKA 4C7QA 4KO0A 4DL7A 3CC7S 3SDEA 3WC0A 5AE3A 1HWKA 5KFZA 4IR1A<