3OQ2A

Structure of a crispr associated protein cas2 from desulfovibrio vulgaris
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
NDAMLVLISYDVSFEDPGGQRRLRRIAKACQDYGQRVQYSVFECVVDPAQWAKLKHRLLSEMDKEKDCLRFYYLGANWRNKVEHVGAKPAYDPEGPLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR-associated protein Cas2
publication title Structure of a CRISPR-associated protein Cas2 from Desulfovibrio vulgaris.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Immune system
total genus 21
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3oq2A00
2NPFA 3B78A 1VI7A 1ZM4A 4MYUA 2WBMA 4ES2A 4ZCLA 2L9NA 1FNMA 2XEXA 2ZITA 3EXCX 3ZZUA 1U2RA 2E1RA 1ZM9A 2BM1A 2I0XA 2I8EA 3OQ2A 1ELOA 5G4DA 4ES1A 3B82A 1ZPWX 4QR0A 4FN5A 4ZCIA 3ZZ0A 3E3XA 4QR1A 4ZCKA 2CVEA 3UI3A 2BM0A 2KDOA 4MYTA 1DARA 1T95A 1KTVA 4M1KA 1N0UA 2EFGA 1N0VC 1ZM2A 4ZCMA 4MAKA 1ZM3A 2IVYA 2BV3A 1P9QC 4QR2A 4TNOA 3LH2S 3ZZTA 4ES3A 3B8HA 2J7KA
chains in the Genus database with same CATH superfamily
2YXLA 1HPZB 4EFAC 4CH7A 2VDIA 1HLWA 2LEPA 2OEMA 4HVZA 3SCKE 4J5OA 3T5JA 1P27B 2RUSA 2ZC4A 4H4KA 4ZK7M 1NKEA 3LP0B 2BACA 5KAKA 1HQUA 2C22A 5A0YB 2KRBA 2CJKA 2GGPB 3D54A 2BDPA 2OSRA 4X62J 1TU0B 3MMJA 2AZ3A 3OL7A 2ASDA 4K0KJ 2NXJA 3MAAA 3HHDA 2DRDA 2Z2ZA 3PRDA 1U8WA 1DURA 2PMHA 1R43A 2WVFA 4LF7J 1U1OA 1Q5YA 3QQCD 2IVMA 4GC7A 4OJHA 1NAQA 4WP8A 4FKXA 4DLEA 3MUMP 1HI0P 2GHVC 2OUGA 3RB0A 3M9NB 1N36J 4ZJOA 2XNRA 2MQ8A 2HHUA 2YH1A 3QZ7A 1NM2A 1BXNA 1S1TA 4CLSA 2BJ8A 3D4JA 3PYEA 2WBRA 4CO2A 4AL7A 1N6QB 2R7SA 3LPEA 1FTCA 3NBPB 3NWGA 1KRPA 2BJ1A 1VQ8S 4ECWA 3DU6A 4AE5A 3MEEA 1S9GA 2W01A 3T6BA 1U45A 2AU0A 3JQMA 4OJ3A 4X66F 1KFSA 1HWIA 2DEIA 1F3FA 2QMUB 1Z4UA 5I3PA 2QA2A 3V6HA 4K5RA 2L3MA 1S7HA 4DX6A 4G6VB 4ZPTR 2OPRA 4OHYA 2W24A 2WVCA 4GVBA 1HIYA 3KLIB 1W2IA 1UW9A 3QJLA 3BO2A 1TAQA 1JLEA 2N4CA 1HYSB 1VJWA 4FKYA 4X2BA 3I5BA 3ZZUA 2ASYA 1VHFA 4Z2XA 2DR8A 1XR5A 2AW0A 4RJVA 2Z2LA 2IMWP 1WF2A 1M5PC 1WC5A 3N28A 4YDDB 2HGMA 3ZZPA 1N4LA 3W8PA 2GIQA 1KS2A 4MIBA 3LF0A 2HVIA 4ZCIA 2AJ4A 2R3VA 2PO4A 3MUVP 2CQGA 4OX9J 4Z7CA 3OT9A 4ZVPB 2V63A 5K8NA 2ROPA 4DR1J 2OKQA 1OIAA 5DETA 1HNXJ 5IZHA 4ZPAA 4OYBA 2EFGA 2B5JA 3C66A 1FHTA 3AXKA 3RGIA 3TAPA 2E5LF 1YDLA 2J9DE 3MMAB 3EDQB 5ITHA 1ZM9A 2IJNA 3PX0A 1J27A 2HLUA 3HK2A 4KHPF 2AGQA 5CCMA 5L38A 1T95A 2UV8A 4KHRA 3IP0A 2CIMA 3NS6A 5F9NA 1HNVB 2J0XA 3ZO7A 4WJBA 1VQ9S 3BV8A 3M8WA 2FZGB 4USIA 2E7WA 1JJHA 1WI6A 5KT6A 3L3CA 3OQ2A 4PWWA 2ZFHA 2HWHA 3DU5A 5ADZA 2Q6BA 5KFHA 4B3SJ 1EHWA 1S6QB 3AH6A 2E9RX 3DLLQ 2QEXS 3UCUP 3DRXA 2HFSA 5KFPA 2MZRA 2XQCA 5EN1A 1RT1B 2VL1A 3QJJA 3V6JA 1JIHA 3ILOA 4WCEQ 1IBMJ 1T11A 2RQMA 1N48A 3AXMA 1RT6B 1M5HA 3OFEA 2YNFA 2RKIB 2PMZD 2AKWB 2YKMA 1OPZA 3OD2A 2E7VA 2LQ5A 3EVOA 4PWUA 4FXVA 2ZH8A 1T3OA 4OZJA 5KFRA 1C1BA 4LF1A 3OW2R 3NOGA 2V2KA 3CCTA 4AT1B 1OPIA 4JYAF 2NYIA 3G6XA 4I68A 3KUEA 1PAUB 1S12A 3WQPA 4OZ0A 2RSQA 4LSLA 2UVWA 3A13A 4JI0F 2FHJA 2W7PA 2QSFA 5J2QB 1NDLA 1XMOJ 4OZ3A 2V8VA 1TKDA 3DYAA 4DR6F 3KK1B 2VBXA 3DLHA 3RYLA 2XI2A 4OHVA 5F8IA 3OJSA 1Q79A 1E6VA 2UVRA 2DR6A 1IR1A 1S1UB 1RB0A 3TOQA 2KL8A 1P1TA 1QAJA 4LRFA 2F3JA 3OFHA 1FA0A 2ZC3A 4RUAA 2XSJA 1I94F 1UEVA 1FCAA 2NZCA 5A6PA 1XNQF 5AE3A 1VRUA 4DPUA 3N6NA 4Q8FA 4DPTA 3A12A 3PR4A 1EB0A 1C0UB 2UXBJ 4UZBA 4O4GB 1TL5A 3BJYA 5KFTA 4DUYF 4OHZA 4GKKF 2UUCJ 2B7BB 5H9FK 3BGOP 2N7YA 5A8KB 2J0QD 4F26A 1PYTA 2MY7A 3CCLS 3BGFA 4GC6A 2V8GA 2YKQA 2YVSA 3T5HA 1Y10A 4ECQA 4I6AA 1EQ0A 5ETSA 3H5XA 4AUKA 1BQMB 3D1OA 1FX4A 5MLCV 5J2PB 1RAEB 2LU2A 3VTIA 1MSWD 3MR7A 1Q81T 2FJAB 2VH7A 3GB0A 3HHLA 1PIEA 1QE1B 3AJ1A 2VPWB 3T5KA 4QR2A 3OXLA 4WYWA 1IJEB 5CYQA 4CCHA 3UN2A 4HI1A 1CJUB 1R89A 4ED1A 2DO4A 3T1HF 5D0RA 1RA6A 4ZP8A 4ES1A 3T5LA 2YNIA 1OSCA 1Q16B 3BDEA 5CYMB 1LW0A 1EETB 4HL9A 2B9YA 1XEZA 2ATLA 1RAAB 3T1AA 3GU0A 2JVRA 4DI6A 4CLYA 5IS2A 2YTCA 5GMDA 5KFFA 2PIIA 4BC9A 5HROB 1RWXB 1N34J 3W2VB 5LSRA 2LCWA 4DN0A 3ZZOA 1J5OB 3CJQA 5LJ5Y 3M2UA 2LP4A 2YNHB 5E3CA 1HBMA 1XMQJ 2OD6A 1FRJA 3IS9B 3HVAA 2XB2D 2XMWA 1BY9A 1FRIA 3OSNA 2DHGA 1M1HA 2FJEB 2IJRA 1JLBA 4ZVOB 1UFLA 2Q6CA 2EW9A 4MTPA 4ZVSB 3LWMA 4DQSA 4ILRA 2AEJA 2DGTA 1BC6A 7AT1B 2ZBIA 2Y0BB 2KG1A 2B9EA 4F25A 5ETOA 5HBMA 2RRAA 2HHHF 1E6YA 3B54A 3M30A 1HHSA 4RW4A 4X64F 1JLCB 4WIQA 3DFEA 2HIYA 2Y1JA 4PWDB 3PW2A 4PRFA 1EP4A 2Z30B 1FT8A 3KFWX 4KPCA 4JI5J 2DNGA 4KKOB 3IBWA 1XN9A 3IRXA 3ZC4A 3ZTPA 1UEKA 2V50A 3NCPA 4OLPA 3MURP 2VFSA 3W61A 1I1GA 3EPIA 1SJ3P 3DGPB 1UZDA 1FTRA 2KT2A 2OLWA 2L9DA 4Q0BA 2MB0B 2A2CA 4PCQA 5IT4A 5BJRA 3EYZA 3IMQJ 1SJRA 1NKBA 2QV6A 4NCBA 3PYDA 4P75A 2IYGA 1YJ9S 2ZM6J 1YZ6A 1A0OB 2GMJA 2I1RA 1C1CA 3UCZP 1U1LA 3T6JA 1T05A 5HN0A 2OPPA 5AXMA 4NXMF 4HKQA 5GMKa 4E98A 3BZQA 2XYHB 2IVYA 3HFZB 1SH2A 1NJXA 1H0HB 3RRHA 1P1LA 4ITSA 1IKXB 2EFQA 2HW3A 3MPYA 4ECVA 3ISND 2DPIA 4CLZA 1KNZA 3BBBA 4NLYA 5FLXY 1RCXB 4Y00A 2EFNA 2KM8B 3TQ1A 2BW2A 1NHKL 3A8EA 3RAXA 2IM0A 4DSFA 3QT8A 4X4QA 2B8QA 3MEDA 4N7TA 1UWBB 4MFBA 4H4OB 3EMTA 4PUOA 4GMKA 1RWPB 3HHKA 4H4KC 1GFWB 5BR8F 1EKSA 1TMMA 2HNZA 1RISA 2HHWA 3DDNA 3O3LA 1JB0C 3CD6S 2EFPA 4JI4F 4QPXA 3UFCX 5D77A 5K20B 2DYAA 5CAAA 1OY9A 2PA3A 2QSWA 2AT1B 1OS5A 4CLKA 1SJ1A 2DJWA 4LF9J 4DR3F 2B9XA 4O3PA 1RTDA 3NMAA 3S1TA 3EE3A 3T1YJ 5KG2A 2Z8QA 4FF3A 4EYIB 5HLFA 5T41A 2MSTA 3MD3A 1B70B 3FZBA 3T9ZA 3KK2B 2UVUA 5F8JA 3DNCA 5HJYA 2C28A 3CD5A 4K4XA 4QWDA 2XMMA 2DNZA 2FZKB 3CT9A 1Y4ZB 4YR3A 3WX8A 3WDOA 4XDDA 4C8LA 1S1WB 4PZVA 3RUBL 1OWXA 1NU4A 2RT3A 3SMZA 1U24A 3C16B 4DS4A 1UW4A 3TAMA 5HK4A 2FB0A 4IDKB 1U6FA 2WVDA 5HJXA 5JMNA 2R8IA 2UXDF 4D3HA 4OI1A 4IRDA 4HHUA 3WC0A 3CC4S 3AD9C 3Q8YA 4HHJA 1P9QC 3SEOA 4ECUA 2H4WB 4KH0B 2OH2A 3V4IB 3Q8QB 1PJ6A 4CZCA 3QLHB 1URNA 4RL1A 1T0TV 2YWGA 1QSYA 4AXIA 4I0WA 1KLMA 4WP9A 2RHSB 2X7IA 2W1BA 4C97A 3MAHA 3VAKA 3BPDA 3D1QA 2HYIB 3LPYA 1TV6B 4GVLA 4M63A 1XBWA 4NLXA 4LFCJ 2AX0A 2VQFF 4KIAA 3CJ8A 3DLEA 3BQ0A 1SIZA 4EBEA 2MMYA 1FNMA 4AQYJ 2ROEA 3GG0A 4DPOA 3JSMA 2BOPA 1HQEA 2KN4A 4OI0A 4ZHRB 5D15A 2RQKA 2CNLB 4G65A 3GWCA 3IC1A 3NCRA 4QIVA 1T9XA 1B64A 4DHVA 4WBFA 4PEOA 2VFTA 1RWVB 5J2MB 2MZJA 4PABA 4NYZA 4ZIVA 4ID8A 5DLGA 5DZ6A 3GCWP 3C6UA 2VA2A 1VK8A 3BGRB 4RBUA 4KT0C 3M05A 4DX8H 3KXDA 3KUHA 3PO4A 5KT4A 2KVQE 3CCWA 4M5JA 1CEZA 4TU9A 1X4EA 5CQGA 4O4RA 2DY9A 2QTWA 4WU3A 1T9WA 5H9EJ 2GAHC 5JJBA 2G2OA 3WBZA 5J2NA 1R0CB 2G0JA 4B9NA 1WD6A 4DV6J 3J80Y 5B0BA 5A2QY 3FMWA 3MXHP 2OTJS 3LTOA 4CRJA 1HNWJ 1JLFA 2DBBA 2W4CA 2GHPA 3LGMA 4EU0A 5T14A 1LWFB 3GJTB 4NYPA 4KGZB 1DQ8A 2W8KA 2QL5B 4CM0A 3KK3B 5C42B 2KFYA 3HSJA 1BE4A 4ER8A 4ZPCA 4RW7B 3RB6A 4I4BA 1NK5A 1ZTWA 2HVHA 3M1VB 4F0MA 2XS7A 3G8SA 1S76D 1VK3A 3CUNA 1S6UA 3M8SA 9RUBA 4ZPDA 4EBCA 2VPXB 1D9FA 2E9TA 3V81A 1RACB 1KD1T 4RW8A 4K4YA 3BN7A 3K58A 1VI7A 5IT0A 3NGTA 1LXNA 3PFOA 5IFMA 5KT2A 3G8QA 3MMBB 3JYTA 1TL4A 4O44B 2RF2A 3W8GA 1HW9A 3NY0A 1U7LA 2RJZA 2R7VA 4WXWA 3M8ZA 2W2MP 4LFAJ 1S97A 4KGXB 2DNQA 1IWGA 2HG4A 1VC6A 2ZOFA 1PYSB 2C2OB 4Q44A 4LVNP 3GFXA 3KLHA 3H2UB 3HM9A 3P4UB 3ENAA 4NA1A 3PW0A 1U2FA 1TKZB 3VQTA 2UXCF 3H90A 4LSZB 2QRRA 2XGPA 5DS7A 1ZM4A 3VAFA 1D8YA 1S9EB 3RU0A 2XYPB 3Q83A 4M5DB 2MGZB 1TK0A 2P6SA 1QAYA 3QFWA 3L7UA 1YBTA 3M6XA 2BANA 1FXDA 4DV2F 4ZLPA 4LF7F 4OYPA 1FVSA 1OYEA 3JSBA 4F4XA 2K7KA 3TX8A 5B7WA 4PXBA 3IO1A 4OL8A 1RBLA 3NKYA 3SSQA 1WKKA 2VQEJ 3MMCA 2A1BA 1X7VA 4CI0B 1TL7B 3K7RA 1YJRA 4I2QA 1Q53A 2R9LA 3VAJA 3FEXB 1JQGA 4DF4A 1X0PA 3UDVA 3N9UC 1P9YA 2B4PA 4PR6A 2MKHA 3V5RA 3OV7A 2ZH7A 5LOQA 1N52B 4D3GA 5FJ4A 2KG0A 1NJZA 4ED4A 4X4PA 2CJXB 3DHXA 3O8WA 2F4VJ 5KG0A 2LVWA 4A8OA 1ULRA 2MXYA 1WC3A 3OR1B 1KVIA 2GV1A 3HHLC 3PEJA 3TVKA 2CJ9A 3H4BA 5THWA 4B3RJ 2EKYA 2CJYB 3H5YA 1SKRA 2HK2A 3M8QB 3SFUA 2XY5A 3BB5A 3MM8B 3CF5Q 1W26A 2PA8D 4OHWA 2XO7A 2L41A 3QRQA 3NNCA 1KDNA 4U8YA 3H2LA 3NL0A 5GAEU 2QYGA 2ZKTA 2Y1IA 3OR2A 3TA2A 5KTQA 3CDEA 5K8MA 3UDLA 4KO0B 2D3OR 4LF5J 4G1QA 3U1LA 4RZRA 1VISA 2W4DA 4OI2A 1VBYA 1R0BG 3KG0A 4CTAA 3R2DJ 4YB7A 2BM0A 2FLLA 1VQYA 4HT7A 2O66A 1K1SA 1MG7A 1T9VA 3HT0A 3HVRA 1U4BA 4A4JA 5F9LA 1GXTA 3BSCA 5B0GA 4LIRA 3P5TL 5BYQA 1VDHA 2HFVA 3IA0A 1Z2LA 4YMEA 3OTDA 4B17A 5KFEA 5HP1B 1YHQS 3W5ZA 5E3AA 3D6TB 2QLBB 2C3YA 3GJRB 3V6KA 2Z56B 3ZZZA 4Q7AA 4LRAA 6AT1B 1FERA 1YSJA 2DGUA 2A18A 3QWUA 4DR2F 2IAJA 3FFIA 2ZD1B 3ENWA 2Y3YA 4NZ0A 1GXLA 1Y5NB 4R5PA 3DOMB 2GQQA 4GKJF 2J8AA 1S7IA 1I5OB 2HHTA 2CYYA 1KQKA 2IRUA 4IUFA 4K2JA 3KJNB 3W66A 1JLGA 5KT7A 3LOUA 4K5SA 1CJKB 1UWAA 1HNIA 4Q2MA 2XHCA 3VGSA 3R8YA 1HMVB 1QVGR 2HQIA 3PKMA 3KG1A 1EARA 1GH8A 1U09A 3DKDA 5L9XA 5B0FA 4O0NA 1CJTB 2YWKA 4LT6A 2RQ4A 5HVHA 3KJVA 3Q22A 3CJKA 5D0EA 1WACA 2WOMB 3VALA 2HRYA 2CQIA 2HNYB 5F0WA 1VQMS 4L72B 4LQ9A 5GAEI 4DFJA 2LU1A 3NNAA 1TK8A 2ZHOA 5IQQA 4K4UA 4OYWA 2FJDB 2X1BA 3KMSA 1IXKA 1OMSA 3RW7A 3CB4A 1ZAXA 4EGLA 1S1XB 3D6FB 5BYSA 1M5OC 3SDEA 3S7RA 2C2ZB 3DRSA 3MCNA 1LFPA 3CE8A 1Q8BA 1NLKL 1ZPWX 4X66J 3Q23A 1XMOF 4LFBF 5CABA 3NEKA 3DLKB 3QFHA 1X5SA 4FVMA 4ZOSA 1KHVA 3WC2A 1QAIA 4O3RA 3W65A 2ZH6A 3W5XA 1FO1A 4WPAA 1X4GA 2OO4A 2AJ2A 5K14B 3D5MA 2YH0A 5KFBA 4ECSA 1ZETA 2Y9HA 2U1AA 1HNZF 1SH3A 4CYUA 3TEGA 2KJWA 1S77D 1U0HA 3GR0A 2CKWA 3PEHA 2DPJA 1UMJA 1WTFA 3RB3A 2RH3A 4DQIA 2NYHA 4C0BA 1V3SA 1IQZA 4N8OA 2JLGA 4B9SA 3CJ4A 3CMES 3THPA 2DRAA 4NLOA 2QA4G 2W9BB 3CJ0A 3S01A 5IM0A 2LQ8A 1VBXA 1UA1A 2UUCF 1F2HA 5DG8A 2JWNA 2BZ2A 3N5FA 3A1YG 2GO9A 4OMFG 1S48A 3ZFVA 4I2PB 3HKWA 3NWRA 1NB7A 3UI3A 4EYHB 3H25A 4ICLA 2E5LJ 1VCTA 2BE7D 5KFNA 1S9FA 1NJWA 4B9MA 4LF6F 2UUBF 4OI3A 4KHPJ 1X9WA 4QPTA 1RTJA 1V5IB 1UVIA 5DRKA 3SV4A 1HKAA 2CDRB 5C5JA 2EPIA 1V3RA 3QSYB 3EXCX 5IWAF 2B4VA 2BQ3A 2HFUA 1HQUB 1Y9OA 1IWAA 1QTMA 3M6VA 4DR4J 3KLGA 4N77A 4I6YA 2J9EA 1SKWA 2YWEA 1H2VZ 3W1YC 2AWZA 1ZZNA 4LR8A 3EGZA 2JVOA 2XWYA 1KVJA 3MAAB 4B3OA 3BGLA 2NXNA 1TUWA 4JI6F 2HHSA 1SJFA 1SV5A 2I6WA 1M0SA 4CLPA 1F5BA 2VPYB 4IOCQ 1WKJA 2O1PA 4DSEA 5KFUA 1DQAA 3D6HB 4XO0A 4M5MA 2OJ3A 4OX7A 1UVMA 1S1TB 5B0CA 3CD0A 2XGQA 3LA0A 4DXLA 3KLFA 2CNOB 5D8HB 2Z4PA 1R8AA 2DR9A 3I0RA 3MEEB 1S9GB 3MTKA 4UT4A 4JYAJ 2XLKA 4R8UA 4YY3F 4E0DA 3DDIA 4F2RA 1FRHA 5DJBA 4Y34A 4JI0J 3PRBA 2B7CB 2ASLA 1H98A 4DS5A 3RBEA 4USMA 1NH7A 2FIUA 4DQPA 1M90T 3Q2TC 2OPRB 1R8CA 4GVBB 1N8RT 4PPDA 2JEFA 2GJ2A 2B4UA 3DOKA 1CJVA 4YQWA 1JLEB 1LV5A 2CG4A 2V9WA 4LBHA 3MEGA 2YKOA 2NXUA 2B56A 2BRLA 4JI5F 2BQUA 1FJCA 4EMDA 4KAIA 5HL7Q 5H9FJ 3DLGA 3HVTA 1GT8A 2WW4A 1WHXA 1SKSA 3QJPA 1QUPA 1I94J 1Q95G 1ZOTA 3MAQA 1F0XA 2CQCA 3OFGA 1XNQJ 3CJ2A 3MFIA 2G1DA 3PIOQ 3HULA 1V9OA 3VQSA 5GAHU 1F5CA 2V4RA 3F56A 1SL2A 3THVA 1ZBTA 4J9SA 3JAMU 2VBWA 4DL0C 2WSEC 3H59A 2XZDB 1NMEB 1WDDA 3AT1B 3ZZYA 3OXGA 4DUYJ 4OYAA 3KMQA 3OL8A 4GKKJ 2N3LA 2HFOA 4ZDNA 2B5JB 2B0GA 2H1YA 2H5IB 1RTIA 2QA4S 1J5EF 3POTA 1K9MT 4HACA 2E5HA 4NX9A 2VKZG 5HQ8A 4L76A 4NZ7A 1FKPA 4FNIA 1HBUA 1KONA 2ASJA 4K8RA 5AJ3F 2GFFA 4B3TJ 1MWZA 4YOEA 1PSDA 1MLAA 2LFVA 4JI3J 3HFKA 2KT5A 1QSSA 4O0IA 1Q7YT 5L1IA 4L3NA 4EWTA 2VG6A 3K5MA 3RBXA 2G9OA 4J9VA 3T1HJ 3PVXA 1X4FA 4J90A 1S72S 2IDLA 4FPIA 3MGJA 1RKJA 1SB6A 3DGVA 3CJRA 2NREA 1GQEA 3AODA 1SI9A 3BSNA 1AB8A 4ED8A 2VKRA 3NP5A 1HL6A 2QYCA 2CDQA 2WW8A 1UFKA 3TI0A 2VA3A 4U7CA 2NSCA 4RWXA 2ZZTA 2KTQA 2ZOMA 4DPXA 1H6KX 1BD6A 4CM2A 1RAIB 4IKAA 2BBEA 1JJ4A 2YNFB 2XCAA 2YKMB 1Y5LB 4X4RA 2MZSA 1VLOA 5LMNJ 3TUJC 3P8BB 1C1BB 2ROGA 1FK9A 4JI2F 1RHUB 3BR9A 2JC1A 2SXLA 3CCQS 1P8GA 4LF2A 3FK4A 1U0SA 3NCQA 3ICLA 1RT4A 3KOAA 3D1HA 3MECA 2J6TA 2QG9B 4LSLB 3L4BC 1YBUA 4CNYA 3CJSA 5GAHI 1QJHA 4NOHA 1GTHA 1WNEA 2E1MC 5F3TA 3W7BA 1MN9A 3SBMA 1KOHA 3DYAB 5F8MA 2WONA 1FRLA 2ACYA 2DGSA 1JMTA 2B9WA 1E6VB 1WF0A 1FFSB 5HO4A 3O5TB 2HHHJ 1CC7A 4X64J 1CQMA 2J6SA 2GCFA 3R5AA 1HR0F 1K44A 2GS8A 2ZKUA 5DG7A 4RLEA 1Y3JA 2XSJB 1U6ZA 4WFXA 4DL5A 4Q8EA 3HSDA 3QRRA 1UPMB 1S0NA 4ZP6A 1VRUB 4RBTA 3VCDA 1Y11A 3FBEA 4KR0B 4F50A 1X4CA 2LYVA 3BKFA 5ETLA 4V19J 1OYDA 1R3NA 2BM1A 1D8ZA 5E41A 2PFDA 2R2SA 2HVZA 4TU8A 2JFKA 2DNMA 4M5DA 4DFPA 3R7SB 1J2VA 3E2EA 2MZ1A 2BJDA 3GMGA 3KKFA 2GIFA 2YKPA 2IY5B 4NXMJ 4NLPA 2JX2A 4PQAA 3K59A 4JV1A 3SXLA 2V0NA 1NZAA 2EBEA 4F0HA 4DV4F 2AP6A 2BOAA 2KVIA 3BN4A 1DFDA 1NRKA 3JSRA 3OPKA 3ZNUA 1Y3KA 1C4AA 3HHLB 3P5BP 1T9UA 4KYZA 2MYFA 3TJ8A 4GO5X 2QA1A 1RT5A 5CYQB 2M2BA 1VIXA 3BM7A 1M5VC 2QGFB 1TVRA 3UNGC 2EBGA 2YNIB 2DGOA 1VC0A 2J76E 5EWFA 2R42A 1LW0B 3G82A 5CZVA 5E2QA 5CD4H 1WHYA 3EICA 4YB6A 2MQOA 3EUNA 3PV8A 3RRGA 5CCLA 2DGXA 4IOAQ 1XNRF 5BR8J 3SQOP 2VBZA 1JWWA 3A4TA 4DV6F 2K3KA 3H42A 4OHXA 1WOSA 1PJ7A 2AZ1A 4JI4J 2VB6A 2AQ4A 3F73A 1YQHA 4Y6IA 1R6VA 2PSZA 1HNWF 2MQNA 2P9GA 2FVCA 5BXIA 4QR1A 4Z37A 2YY3A 4RU9A 2MEWA 3M2UB 2IC3A 4DR3J 3T9NA 1UEUA 1LWXA 2CA9A 2H9ZA 1HBMB 1GMWA 2MKYA 5A2QU 4WXOA 3PFEA 3LP1A 2V2QA 2WRMA 1S0MA 3MUTP 4WKRA 1WC4A 1UZHA 4FYYB 2E1PA 4FNHA 1JLBB 2OEJA 3M8RA 4B9LA 1P6TA 4RU2A 2QT7A 2U2FA 4UF4A 4K4VA 2YQ3A 2LMIA 3EDRB 2L9NA 3ITHA 5KOXA 1HA1A 1VRQC 2ALYB 1U1KA 2GX8A 2C3UA 2EC0A 1Q7LB 2D3O1 5JXSA 4QU7A 2ZJQQ 3RTVA 2A6MA 2QLFB 5G0RA 3I32A 2JEGA 1F1BB 2UU9F 3TZYA 5IT9Y 1VOMA 2HQGA 5HBMB 3EWGA 4C11A 1E6YB 3M30B 4RW4B 3PX6A 5FDLA 4NL5A 1ZM3A 3ULHA 4QWAA 1CBKA 3PRVA 1EP4B 1A6LA 1V6HA 3N5BA 2CG8A 1U47A 2HGLA 1LFWA 3GQCA 2ZEJA 3IRXB 3ENVA 2V67A 2OFHX 4K59A 4NI2A 3VAGA 4Q0BB 4E2FB 2NCKL 4DUZF 2VODA 4OZ2A 2JJ4D 2ZDOA 3QIPB 2DXFA 4LBPA 2UV8G 4OLOA 4F8RA 1WWHA 2DNPA 2LECA 5LMUF 1C1CB 4ED7A 1U1NA 1T05B 2OPPB 4CNZA 2VFRA 2C3MA 2PD1A 4DEZA 2VQFJ 2AEMA 3LQVA 3OTBA 2FY8A 2HS4A 2V4QA 4FF4A 1CULB 2NXEA 4OV1A 2H65B 2QLXA 5LXYA 3GV8B 3D9BA 3LWLA 3V6DA 2DNRA 3FRZA 3TNVA 3TAQA 5GADU 2Z2MA 4NLQA 3DN9A 3G87A 4BBYA 4NXNF 1UFWA 2ZBQA 1K1QA 5F8NA 5C24A 2MY8A 4YB1P 1TQLA 1KR4A 3EJMA 3ENQA 2ZH1A 4P2FA 2XI3A 4J9NA 4ANEA 2CJBA 3RR7A 3MEDB 4MFBB 4C6AA 4NE9C 4PUOB 4J7CA 1NDKA 1UJ6A 2F40A 3GIMA 1CC8A 2GVZA 4X4OA 2HNZB 2JDJA 3DLKA 4BS2A 4OQJA 1C0TA 2R8HA 2XHWA 1NCLA 1WUUA 4ZPBA 4R25A 5I3UA 3HFVA 3IGVA 1T8EA 3PKYA 2VC0A 2YWWA 1XERA 2ZDPA 3WIUA 4ZVTB 4P72A 1BMQB 4LF5F 2HPUA 2GVDA 2AJFE 4WFBQ 2LXUA 1VIOA 2GIRA 2M0GB 9ATCB 1RTDB 3TA1A 3D66A 2RB7A 1RGVA 2QFJA 1L3KA 2K8GA 2OIHA 1RADB 5HLFB 1SC6A 1X5PA 5E5NA 4OX6A 2HQ3A 1HD0A 4OJGA 3KLEA 4ED3A 4YN3B 1GEHA 2OELA 3M4XA 3BGUA 2OEKA 3JS9A 1X4HA 5KT5A 4AL6A 2UP1A 5EX3A 2EKNA 3OTCA 3DMJA 2HWTA 4Y65A 4J9MA 3K5NA 3CDBA 1SUQA 1HBNA 3GYXB 1NSKL 1I51B 4IO1A 3CNQP 1LOUA 5KFVA 3ZTRA 2Q3PA 3TAMB 3R5DA 4LF8F 2V8DA 2XMVA 3FZ2A 4M5IA 3E01A 2D9PA 3WHIA 1B99A 2HURA 2B6AA 4H4MA 2YBVA 4MIAA 5DQGA 3IAS9 2X3GA 4M5HA 2PE8A 3RW6A 1YX2A 2ZH9A 5KFOA 4W4MA 2XY7A 2UUWA 3PHEA 5ETNA 4LF4F 2CNKB 2R7QA 1RBOB 2BJ9A 2UXCJ 5ETPA 1G2EA 1KLMB 3NGRA 2J5AA 3GCXP 1SQGA 1RTHA 3P49B 4DV3J 3VGUA 3IR5B 2MJNA 4MYTA 1IM6A 5CA5A 1N5QA 4TKTA 4V19X 4K7QA 4DV2J 3F44A 3LAKA 2R2UA 3DLEB 3CPWR 4LRDA 2R7RA 4J9QA 2W7AA 2DO0A 2JHEA 2Y1RI 2CRLA 1NZ8A 3N01A 3JSMB 1RU1A 2Q66A 3UVJA 1X5TA 2JH3A 3G6YA 2C2KB 1VQ4S 4L74A 2KJVA 2AD9A 1HQEB 1W2BR 1KVKA 3CIZA 2CQDA 3HD1A 3K5PA 1TP7A 3OTOF 1V5VA 5GAGI 4HDHA 3TQEA 2X1FA 1XK8A 2V9KA 3EGNA 3RBZA 4NRTA 3NGSA 2DEJA 3RRKA 4LQ3A 2J6UA 1T03A 1TMJA 3C6UB 3BH6B 1H7XA 5AXNA 2FHKA 3R5CA 1R8BA 2ZUAA 4KGKA 1CS4A 4KFBA 2M5YA 2IM2A 1IR0A 7FDRA 3K89A 4A8WA 2W4PA 5F8LA 4RR5A 4B02A 1VRTA 1RA7A 2MLZA 1NK7A 2XZWA 1WEYA 4W98A 2FHJD 1L3UA 3SCJE 2DNKA 5J2NB 4QIWD 1H7WA 3RBDA 1Z1ZA 2G4BA 2QIFA 1YLXA 4MKVA 1RHJB 2FQQB 1YZ7A 2ILZA 2ZH4A 1JLFB 1WKLA 3Q86A 2R7OA 2BRKA 2R8GA 3NS5A 3IR7B 1FE0A 2AYMA 3PJWA 5DDRC 2HEKA 2CQ1A 4ZP9A 3AOAA 1A7GE 1EKRA 3G8TA 4K4ZA 3D6MB 3O2IA 3D3BJ 3TO8A 1SBRA 2DHHA 1FE4A 2MZQA 4NWBA 5HQLA 4OZ1A 2EK6A 5KG7A 3K8VA 3ZNJ1 4DZ6A 2DVIA 4X4TA 1H2TZ 3HJFA 2IHR1 2IVFB 8ATCB 1KSPA 3FBCA 5DDOC 3E51A 3V81B 3TX0A 4RW8B 3OUYA 3LUYA 3MCOA 3C6TA 8AT1B 1OQ6A 3GV5B 4WZMA 1DRZA 1MN7A 3MF5A 3JYTB 5ETQA 1HI1A 2RF2B 2CPDA 2AHOB 2GMHA 3TZWA 3W2WA 5IV4A 4P71A 3M8PA 3KLHB 5T7LA 4DR2J 2AJ1A 1TKTA 2XTJP 4DR4F 3N6MA 3HHLD 5KT3A 3VAMA 3R2CJ 4GKJJ 1NH8A 1WG5A 4NEZA 3BS9A 3VVTA 2P9CA 3GONA 1FDAA 1B7FA 2VUGA 1PBAA 4F4WA 2BANB 4RNHA 2XO6A 4X65F 3VGVA 1K8AT 4B3MF 4FBTA 2ZOGA 2PEHA 4WYLA 4K4WA 2DH8A 5KFKA 3QO9A 4P9SA 3G6ES 2YX7A 3MMCB 4RUHA 4I64A 2VU5A 4IH6A 3Q8SB 4J9RA 4IG0A 5JVGQ 1FJEB 4YUDA 2CNNB 3I5AA 4I2QB 1EQMA 3SSSA 3D7SB 4PXDA 2BJ3A 1WC0A 1RAJA 1DJ0A 3HLUA 3BKTA 1DTTA 1RP5A 2JSXA 1Q0NA 2I9SA 1UJ5A 5M2PA 3EVMA 1G1XA 1JLQA 3PJ9A 3I31A 1RBAA 2C3PA 1N5YA 1RU2A 3CJ3A 2ZJRQ 2PN6A 2PEBA 2AYEA 1X5OA 1T02A 3AHPA 1S49A 4K50A 4JI7F 1KEKA 5I3QA 2CPJA 3ZZ0A 4LFBJ 5C25A 1U02A 3R1HA 3C15A 2MKCA 3GV7B 3UD4P 4C48A 4HYKA 2OI2A 4YR0A 3UWTA 1SL0A 1H2UX 1YJWS 4ZITA 1RI7A 3OR2B 3MCMA 1YWXA 3UNYA 3TZXA 2R8KA 4L6V3 2FJVA 1XR7A 4P52A 4G1QB 1HNZJ 3UW1A 4QBUA 4DCPB 1T9TA 3PM9A 4CTAB 2JNJA 2QX0A 1ROFA 1FKAF 4G1IA 3ZXWA 2CXEA 3LH2S 4FYDA 2HBQB 2W9AA 3R7NB 3W5YA 3D0HE 1WELA 4USUA 3UE2A 2PC6A 4NCGA 3K8WA 4ETXA 2XWXA 1SQFA 4DOZA 2IM1A 2ZNYA 3ZTOA 3PW5A 2JFDA 2ZBRA 3QWPA 1RDRA 3TR5A 2CPYA 3KHGA 3LP2A 1X8DA 2DISA 2QL9B 1QD1A 2VHGA 3MCSA 4XK8C 3H0PA 5CD4A 4LJMA 4O3QA 4MYUA 4LF6J 2UUBJ 2A10A 4B3TF 3JTNA 2EXUA 1NPPA 5I42A 3UD5A 1VC5A 2IAJB 2O01C 1UETA 3UQSA 4FXDA 2V6AA 2ATCB 4JI3F 3FFIB 4Q5VA 4ENOA 4R5PB 1FD2A 2I5JA 3PO5A 1FVQA 5IWAJ 1MU2A 1R0AA 3HMJG 3PYFA 2CQHA 3QT7A 2V8HA 3RZAA 2AEFA 2XY6A 1JLGB 4WU2A 4LR7A 1HNIB 4WTYA 2FJBB 2BE2A 1DBDA 2F7VA 4U67Q 1SPBP 2FPHX 2XYGB 4Y2IA 2HNDA 1YITS 2HIQA 5SUHA 4JI6J 3KJVB 2G1HA 3HF5A 2K7JA 3CJKB 3FEYB 3PTWA 4ILMA 2ILYA 4MK9A 2Z0GA 4CIOA 3W3SA 5LMNF 3NRBA 3KDNA 1DTQA 2QC3A 3TVYA 4DMZA 3R5JB 4PG7A 1JLAA 4DU8A 3QBCA 2L48A 4ZVFA 2F8HA 3ZTQA 2LQBA 3MM6A 4G1PA 3GG1A 2F4FA 1G3OA 3EZUA 5L1JA 2XULA 3SDEB 1YJTA 3DRSB 2HVEA 1YKWA 3FJ2A 2EK1A 1B0PA 4YY3J 3CIMA 2WZ1A 3ISZA 3X3UA 2X1GA 1GTEA 1VGYA 2MQQA 1LWEA 3N0VA 3T19A 4ZVHA 5ETTA 3DLBA 1UVJA 2Y8WA 5J1EA 2Y1LB 3P45B 2DR5A 1FWPA 3RJMB 4LMZA 4DX5A 2CPIA 4WP3A 1D1UA 3BYPA 4OI4A 3EX7B 4CLWA 3HSGA 4JBCA 4PAAA 4CYUB 2OAUA 1A9NB 4NLGA 3TP2A 1U0HB 1JNZB 3ELHA 5K9FA 1H3DA 3JAMY 4FYXB 1SXLA 3TWZA 2MKKA 1G7CB 1HWKA 3PACA 1YG0A 1WF1A 4CLFA 5KFAA 2FLOA 2GZOA 3K5OA 2G2ZA 2CPHA 1JXVA 3JB9k 1HHQA 4NLWA 3GSDA 1RHQB 3ADAC 3C8YA 1NSPA 2DCUB 3J7YU 3QIPA 5IM0B 4KGMA 5H9EK 2M7SA 1OY8A 2LDIA 4C8YA 3GYNA 4F04B 3AB2B 4M5NA 1ZYQA 4B9TA 4USHA 5JUMA 4FVCA 4A8YA 3E3XA 3MM5A 1FXRA 4Q45A 1PJ5A 4RNFA 1ZZFA 1K47A 4ICLB 3U1MA 1AW0A 2AJQA 3SQGA 1J5EJ 4URGA 1DLOA 2C3OA 2M8DB 1CULA 1WORA 1RTJB 3I9ZA 2FDNA 1Y0HA 4XTTA 2MZTA 4Y0FA 5AJ3J 4AD6A 3VZIA 1FKOA 4NA2A 3N4WA 1XC9A 2HKEA 3PW7A 3FCHA 3P96A 3KLGB 3UO0A 1FEEA 2CQ2A 1Y00A 3ZZRA 2L08A 3MR2A 4XAKA 4YS2A 4N8NA 3GP9A 3VWSA 2KO1A 2FD2A 4B3OB 2LXIA 4CT9A 2RNEA 1RABB 4MK7A 2HQDA 5L1LA 1VBKA 1REGX 1VQ7S 1RAHB 1Q8KA 4IH5A 1SV5B 4KV8A 2W2QP 4DR7F 2BABA 3KWMA 4RW6A 4DU7A 3G96A 2XMKA 1RHMB 3M9MB 3KLFB 1RT7A 4DPWA 1WTBA 3MM9A 4JI2J 3T3FA 5DGAA 3B78A 3I0RB 5L39A 3HDSA 3C3LA 3IGNA 1TFWA 4DF8A 3QT6A 4R8UB 2OP5A 4UOFA 4NLRA 2BYCA 2KHCA 4C7QA 4BHQA 1N33F 1IKWA 2H48B 4IYQA 4OYOA 1OJ4A 1HBOA 2XM3A 3Q0AA 1N54B 5CZXA 2POKA 3GIRA 4CLUA 1R8PA 3DRPA 4YB5A 4UOGA 2X51A 1U1QA 1O5JA 3DOKB 1CJVB 3JXOA 1QY7A 1YJ7A 1IR2A 4FP9A 3UR0A 4C3MA 2RD5C 3MEGB 3GIKA 3D3CJ 5KFQA 1NSQA 2O3DA 5IT9U 4HEA9 2W9CA 2BJ7A 2KT3A 4WF9Q 1TAUA 4JB8B 4QYZJ 2I38A 2VFVA 1HR0J 3NAHA 3DLGB 2N7CA 2ZH5A 3HVTB 3L09A 4OV6A 2VOOA 1CQNA 1B3TA 2AGPA 2HZVA 5DO2A 3I0SA 1U1RA 1OSDA 3VV2B 3CMQA 2RS2A 2YNGA 4Y2AA 3BO4A 3MM7A 3NMRA 1VMBA 1FDNA 1BQNA 3KG4A 1W7WA 2GNKA 5A8RA 3TJ9A 3VVUA 1U1MA 2JEIA 1LQ9A 4KRWA 3G71S 3CWJA 1TFYA 4ZLJA 2W2OP 1RTIB 4DFMA 2LA4A 3POTB 1LK5A 1H73A 3GJSB 2B3TB 3B4DA 4HACB 1RT3A 3ILLA 3KJFB 3CCES 1WC6A 2BVZA 4DV4J 1FKPB 2N4DA 1NSAA 3MWBA 1HBUB 3W64A 3VAIA 4B9UA 3U1NA 3BR8A 2I8EA 4U96A 4DCJB 3FBBA 2HBYB 4PQUA 4HH0A 2C2NA 3TYTA 1FWKA 1TUGB 3L7OA 2VG6B 1IUJA 1B4SA 1KBRA 2D41A 2CUYA 2CWXA 4LBIA 1LEOA 3OHAA 4LR9A 2HS3A 2XLIA 4ELTA 2H51B 4BC7A 4Y2CA 5D4LA 1T7PA 5HATA 3PR5B 2YX4A 4A46A 1GAOA 4QIFA 4JUZA 1XNRJ 4UW2A 1PILA 2IJFA 2CZ9A 3HT3A 3CCRS 4IFVA 1NK6A 3MFHA 3M2VA 4X4UA 2ERRA 1KKHA 5LL6d 3C46A 5D3GA 4NCAA 4QWCA 2DGVA 1FJGJ 3BBFA 5DDQC 4TY8A 1GX6A 1VS3A 1FK9B 4IFYA 2M4MA 3M2RA 5D6GA 4J9LA 3UN5A 2YQ0A 4ZKAA 1L3SA 2XMAA 1TL3A 2BUNA 2RU3A 4YR2A 1RT4B 4A8FA 1QAXA 1EX8A 4CQ1A 3MECB 3EZ5A 1S0VA 2W2NP 4W92B 1TL1A 1N32F 1AUSL 3CULA 4CT8A 2V4JA 2WVBA 4RNOA 2LA6A 4F02A 3R97A 4IG3A 3I87A 2GQCA 2WONB 5LJ3Y 3OXFA 5DGBA 2M9KA 5B08A 2E29A 2UU9J 3H8YA 2R8JA 3BSOA 1T3NA 3MDFA 2VD3A 3CCVS 5MAOA 1KFDA 1I3OB 2DGQA 4DSIA 2NQPA 4BWJA 3QMQA 1RK8A 3D67A 4N76A 3R27A 1NDCA 1NDPA 3PW4A 2CQ0A 4O3OA 3JQJA 1QUVA 1IKYA 1F2GA 1DARA 4NLSA 4LRBA 2NZ4A 3A8IA 1FDBA 3CDWA 2WTFA 2H3EB 1NPRA 4DUZJ 4DV3F 3W60A 1FDDA 4I1TA 4ZMMA 3RB4A 3RR8A 3AD8C 4TY9A 3KLVA 1CPZA 1N0VC 4F0KA 3E8OA 2J9CA 4H54A 4NMLA 4QW9A 1UA0A 1YVFA 3C19A 2XG8A 5LMUJ 1SQEA 1U26A 1VQSA 4PG6A 3QRPA 1Q8IA 3FSXA 1NJYA 4UTGA 3AJDA 1S57A 2AV5A 4NA3A 3GSIA 3H4DA 4UY85 4I7FA 1AROP 2IIHA 4AL5A 1JXEA 5C2GA 4X4NA 3IG1A 2XNQA 1RT5B 4NXNJ 1TVRB 2QO3A 3DOLA 2DKOB 5A8WA 4P7TA 3HZGA 3PYGA 1NB2A 3G82B 4PG4A 3QGIA 2D3UA 2FZCB 1I6JA 5CHCB 3FEZA 1QLNA 2EG2A 4ZN1A 2F5GA 4OJ1A 2HZCA 3TUIC 3FSIA 1F9FA 3P3DA 3VR1A 4RO0A 3TANA 1S59A 2JOQA 3KDOA 2CZ4A 4KQZA 3BF4A 2IC3B 4KHMA 3PZPA 1JK9B 3DM2A 1MWYA 3W62A 3LP1B 3GIJA 4PKDB 3KYLA 3G9CA 1RXOB 3NGUA 1XR6A 3FCWA 4C3LA 5LSOA 1DHMA 2KZZA 4URQU 1RWNB 4ECYA 2E1CA 2ABYA 3GZ7A 4JOUA 1S1VA 1S4FA 3ITHB 3LGHA 5HQMA 5GVQA 2LEAA 2KXHA 2M3DA 3NAIA 3W9IA 4IR1A 3MOZA 5G0RB 3F0NA 5HANA 2E5GA 1XQIA 4C8KA 3CGIA 4C11B 2K06A 2BXJA 4CO1A 2LXFA 4DG1A 5FDLB 4LF8J 4KH1B 2FC8A 2ZHAA 2OPSA 1AT1B 5KFWA 3H5UA 2FYXA 1Y7PA 3AD7C 3GFYA 3CC2S 5EWGA 2AIRB 1HWJA 5AXLA 2BV3A 2E7XA 1F9HA 2FJWA 2ADCA 4NI2B 3OVAA 4LF4J 3SV3A 3BDPA 4B08A 1CLFA 4M94A 2DCLA 3TA0A 4BLGA 1IKVA 2JZ5A 4ZVGA 4YDXA 3HD2A 1MW7A 4DSJA 3X1LB 4WTOB 3J7AN 3WX4A 1ICEB 4Y2KA 2V8PA 2CAJA 3MEKA 1KLNA 1YJNS 2AYGA 2Q43A 4C0HA 3KNGA 1N88A 4P7VA 4F4KA 1R27B 3DI6A 3V6DB 1YI2S 1OQ3A 4TN2A 4A8SA 4C3KA 4OZ5A 3TEHB 2D3ZA 2FGCA 3K2YA 1VJQA 3NLCA 4ZPVR 4WFZA 4ANCA 3OTOJ 3A8JA 5E3QA 5C24B 1LWCA 4IOBA 4PPZA 2KB2A 2K2PA 2YWFA 2Z2YB 3UDEA 2ZH2A 2KI2A 1AUDA 1PAEX 4DV1F 2PT0A 1QM9A 1OY6A 2GVZB 4C0OC 2GC8A 1C0TB 1DZ5A 2R7WA 2BKNA 6FD1A 2COLA 4KC5A 5I3UB 3C14A 3ILJA 2EVZA 2LQ9A 2CVEA 3T41A 2KH9A 3EM1A 4PYDA 4QIEA 3D0IE 3I82A 2GVDB 5D78A 4RW9A 2VZ9A 4UOHA 3HHEA 1XWLA 2JL9A 4USWA 1PKUA 3C2PA 3A8KA 4F3OA 3CCMS 1G6BA 2P2CB 3D2WA 3VZHA 3JSYA 3OL6A 4DL3A 1RE1B 3KLEB 2RDIA 1FNXH 4WE1A 2C2RA 3IBFB 2B43A 3P6YC 4WFYA 2DH7A 3FC9A 2EFOA 2NR0A 3DMJB 3UN3A 1SUQB 2BJEA 4KTQA 1TKXA 1HBNB 3HI9A 1JKHA 1REVA 1RT2A 3V4MA 3I4PA 2HHXA 4HTJA 4F2SA 1SL1A 2DIUA 5KFGA 4ID5A 4OYZA 5DDPC 4FDFA 3TZZA 1FRKA 2YPYA 1U2RA 2DNLA 3E01B 2B4OA 3CVKA 4LRCA 1JXLA 2B6AB 2GO8A 4ECTA 4H4MB 3HSZA 5D4PA 2JC0A 3KJQB 4N41A 5HMXA 3BH7B 5SZTA 1ZA1B 2GMLA 4NPOA 3AY0A 1U48A 2K3IA 2ZE2A 3AOCA 4FPRA 2CPZA 1PGZA 4M95A 4UUWA 3QT5A 5AXKA 1RTHB 3HX9A 1TK5A 5IQ6A 1WEXA 2HQFA 1NHUA 4EO6A 3MTJA 3AFGA 2YKNA 3I56S 2BX6A 2M52A 4X65J 5H1SV 2HMIA 2VJVA 4B3MJ 1RYSA 4P2SA 3G6VA 2RMLA 2JLEA 4IH7A 4UUXA 4HLBA 3IN5A 2DNYA 2R4FA 4WK3A 4KSEB 2VASA 3UVJB 2HQCA 1WOPA 2QL7B 1FI4A 4LVOP 2OPQA 2CZVC 3QGGA 3OVBA 3HO1A 4J9OA 1KP6A 2IM3A 2DIVA 1LW2A 5ETRA 4N56A 2RIJA 3SFGA 2CPFA 2KXFA 1HWLA 2QLJB 1ZM2A 4CH0S 2K1RA 1KN6A 3H20A 3R6LB 1LK7A 3K5LA 2NLWA 1SC3B 2GW8A 1RTZA 1T03B 2OFGX 3CDUA 1FD8A 2MLXA 5JVHQ 1CS4B 4KFBB 1JJCB 1MROA 4HR2A 1VRTB 4A8QA 4JI7J 2FGOA 4RUBA 1UVNA 1NPKA 5HSPA 3IAM9 4I67A 4HTIA 2VG7A 5C2CA 3FVYA 4ZVRB 3M32A 3THTA 3SSRA 1S99A 2Y0SD 4MH8A 1AZSA 3DXSX 3CMAS 2VG5A 1EIYB 1KWMA 3ET6A 4JI8F 2AGOA 1AFJA 1PCAA 1M5KC 5KFIA 4MKBA 2ZJPQ 3SYZA 3Q8UA 4DV0F 5D0HA 1CVJA 3R6GB 2QMWA 1RWMB 3MPVA 4TQRA 1ACMB 4LSNA 4DPYA 1YBAA 4G3IA 2DTJA 4MIWA 4NYOA 2PMWA 3I96A 2F8EX 2J9DA 3VHQA 4C4WA 4HDGA 1YJVA 2E66A 4LIWA 3M7VA 2J8SA 5KG5A 4DL2A 3M6WA 5KG6A 1RAOA 2DH9A 3DRRA 1S6PB 2CFXA 1M1KT 2EG1A 2A0FB 4WZQA 4USJC 3OUYB 1IN0A 3W9HA 3C6TB 3OTEA 4ES2A 3A3OB 1R7IA 4GO7X 2AYBA 2XS2A 4IQMA 4OFZA 4TQSA 5J1NA 1QTNB 1V3ZA 4P2MA 3VAHA 2LDYA 1D09B 4YHHF 3W2WB 1HPZA 2XZTB 4K2XA 3M8PB 2DY1A 4OYIA 5T7LB 2LLZA 1GNKA 1TKTB 2FY1A 4F67A 4OX8A 4JI1F 1Q1KA 4JV2A 3I5CA 4C2MA 2BQRA 1S10A 2V2ZA 2ZVIA 4AXJA 2QFIA 3BPSP 1BLUA 3HPOA 5ETVA 1YGYA 3PX4A 3LP0A 2IA0A 2L9WA 5A0YA 5LM7E 2E44A 2GGPA 4DV7F 1VYAA 5D0GA 1DAXA 1FXLA 2J7UA 1QVFR 4P10A 3N79A 4F4ZA 3FCVA 2BA9A 3M9OB 1BQXA 4U7UK 3QO9B 3DLJA 1ZAWA 2KKHA 2VF3A 2O67A 4IG0B 1K0VA 3F41A 2HAFA 4C9DA 4IRCA 1YJUA 4QW8A 2R2TA 5F0UA 2RQCA 5KFZA 3LALA 4DDFA 2UUAF 2ACMA 1DTTB 4QQBA 4J37A 5EWEA 4TLQA 4GRSA 1C4CA 2C42A 3J81Y 5HI7A 1GMWD 5B0EA 2J0SD 1N6QA 4DZDA 3QIDA 4ELUA 1JLQB 3FBFA 3FQKA 3NBPA 3Q2SC 1N5YB 2JRSA 2R7TA 3AA9A 4F4YA 4A47A 1GK8A 3D0GE 4PYAA 1RUSA 5C25B 4ERDA 3C15B 2ZUGA 3HP6A 1DQ9A 1AYEA 1NJIT 3S8SA 2F8MA 1WJ9A 2ZWOA 1UVLA 1KQGB 1IBLF 2DITA 3CCSS 1SH0A 2HRTA 3KLIA 4ED5A 4PXEA 2NUUG 1KQFB 1AXQA 1HYSA 1YIJS 4CLLA 1HFEL 4J9UE 4UY8T 1RKIA 1IVZA 3W63A 4ZN3A 2DHAA 3OBIA 4JV5J 2CADA 2HRUA 3AJ2A 4JV0A 1NK8A 1NK9A 1SJ4P 3FKBA 4NCGB 5KFYA 3TVZA 2EWHA 1YRTA 4HI2A 1NK4A 3WIVA 2MPUA 1G4CA 2YKAA 4P6QA 3OVSA 4L3KA 2RILA 1XIQA 3LP2B 3PG9A 2IBOA 2MKIA 2PFFB 4V1Ak 4WFNQ 1HD1A 4EI2A 2FLNA 1NHVA 2WB4A 4S0MA 2WB1D 1U6BA 4DV5F 3VF0B 1ITPA 2DGWA 2LKZA 4DX7A 4ZVUB 4TXSA 3MMAA 4FYVB 1LKZA 1LXJA 2F9JA 1RLCL 4U95A 4USTA 2DNOA 5I42B 2IFXA 3R5BA 4ZPWR 2EC2A 4F3QA 3FMBA 3GILA 3J7Z5 2I5JB 5C7PA 1MU2B 1HNVA 1R0AB 2E5JA 1U8SA 1UPPA 3BEGB 2VPZB 4USKA 2WSCC 5KFCA 1VQPS 4F3MA 4UZCA 3OJUA 4X62F 2VICA 2BE2B 4DWIA 3HCXA 3SCLE 5HMYA 3CO9A 3TW0A 3K17A 3OL9A 4K0KF 2RRBA 2HNDB 3H40A 4U6PA 3M8YA 4J91A 1S6QA 2NXCA 4DR7J 2GJIA 1YK9A 2HFNA 3SZ2A 4EZ9A 4DUTA 1TELA 3TUZC 1JNRB 1RT1A 4P2XA 4TU7A 4YEAA 3GR1A 2BEFA 1FFGB 1FJGF 3IRWP 1N56A 5IOLA 5CYJA 1O6XA 1N36F 2DR7A 4CO3A 3MPUB 2H5JB 4RBVA 2VONA 1RT6A 5AT1B 1DTQB 4M5LA 2ZWPA 1JLAB 2RKIA 5EUHA 3CC7S 3GFHA 4DR5J 1WSRA 1UTAA 3KTQA 2LQJA 2M8HA 3MM6B 1RSCA 4C8OA 2V68A 3AQPA 1MMDA 3BO3A 3H2VE 2RU9A 3CW2C 4KB7A 3EPGA 2QLWA 2HK3A 2KDOA 1N33J 1Y5IB 1NNDA 3QAUA 4ZJQA 1H74A 1LWEB 4BWMA 2D7SA 3I6PA 5J1EB 4QR0A 1SKUB 5J2QA 2FTRA 4E8UA 2MLYA 2PI5A 1WOOA 5FD1A 1EZZB 4ECZA 3G86A 3KK1A 4ED0A 5EGYA 1L3TA 3GE9A 1S1UA 2KFZA 2RAQA 3NOCA 3NS7B 5LXRA 4A8KA 2PDAA 4LUBA 4O23A 3QSIA 2IPOB 3IXQA 1D9DA 2E5IA 4FN5A 3NG8A 3H98A 4NLDA 4C8NA 3HZEA 4OX9F 4RPFA 1KHWA 5HVFA 2UVVA 4B9VA 1D3WA 1C0UA 1IBKJ 2AF6A 5LT5A 4O4GA 2MKJA 4DR1F 3MM5B 4U9RA 4FXWA 5E0OA 5IC6B 1HNXF 1VQLS 1NBEB 2HWIA 5CXTA 3L9ZA 1RLDA 2E1AA 3SQGB 1DLOB 5A8KA 4M5GA 2XEXA 3LANA 1K73T 2CPXA 2MQMA 4EK2A 1TUVA 1X9SA 2QMXA 3AOBA 3H5SA 2HLTA 1ZAVA 5KG4A 4RX6A 4Q2LA 3K57A 1BQMA 1LNQA 2RE1A 2GJFA 2RRNA 4Y28C 1FWLA 1FKOB 5J2PA 3DDKA 4BDPA 3MOJB 1XMBA 1VQKS 4URSA 1KTQA 4ECRA 1VHIA 3RG6A 2P6TA 1QE1A 5U47A 3VGTA 1TR0A 4ATNA 4W90B 1YTYA 1CJUA 2YQ1A 2DHSA 2F1FA 2MDAA 5CYMA 5EX0A 2NSBA 4QYRA 1EETA 3UD3P 1K0TA 1VR6A 3NNHA 1NKCA 4B3SF 2X1AA 4F7VA 1SC1B 3KHHA 4KV8B 2R7XA 5IXUA 1KC8T 3HKZD 2W2PP 3B4MA 2G2YA 4XPCA 5L46A 3MPDA 3UPFA 3EGWB 3L7PA 1EJ7L 1UP1A 3I55S 2MTLA 1IBMF 2CQ4A 2R7UA 4RW6B 4ES3A 5KG3A 5HROA 3H7HB 3PY8A 2HVDA 4I56A 3W2VA 2KRRA 4ZS6A 3GFZA 2AX1A 2VJUA 1J5OA 1RT7B 3HHNB 4DBQA 4X84A 4DL7A 2YNHA 3MM9B 4IQXA 3BREA 4RKUC 1NO8A 2CPEA 2IMOA 2J0WA 3IS9A 4ZLNA 1OO0B 2ZZMA 1GXUA 3NGDA 1MMNA 1VQNS 2P8IA 4KJIA 4U8VA 1XTZA 1PG5B 5KFJA 2VV5A 3FNNA 1PC5A 3PJXA 1IKWB 2E9ZA 1N32J 1HBOB 1HARA 2F65A 1HQ2A 2VBYA 1FF2A 1TTHB 1X9MA 4DCOB 2ZNZA 3ILIA 4XPEA 3DRPB 2DB1A 4O3SA 3IR6B 4WFAQ 3DCAA 3O6QA 2G13A 4WKYA 3JQKA 2YWHA 5J1PA 1VQ6S 1U49A 2W9CB 4P74A 1EAYC 4CO4A 5DQHA 1JLCA 3D68A 1RAFB 4PWDA 4FYWB 2F9DA 2PGCA 5GADI 1YRXA 1B0TA 1HI8A 4KKOA 4R0JA 3I0SB 1RAGB 3QAEA 3PIPQ 4OZLA 3DGPA 2G0CA 2YNGB 2OGUA 3DRYA 2HGNA 4OYMA 2FHMA 3MM7B 2UXBF 4TLRA 2C2EA 1BQNB 2CQBA 3CDAA 2HBZB 2A2DA 3EVWA 2OMOA 4RNNA 5A8RB 1KTVA 1BUXA 1CSJA 5IC4B 3IWLA 2M70A 5E33A 1GMUA 2D9OA 1RJJA 1NK0A 4DSLA 4YP3A 4ANDA 4M5KA 5DG9A 4OI6A 1RT3B 1F60B 3BYRA 3S6EA 4IR9A 2MJUA 2J7KA 2OMLA 1APSA 2F63A 2OSQA 4DQQA 1IKXA 3MPWA 2X3DA 2P5VA 2WAQD 2MQLA 2MSSA 5K8OA 4ED2A 2QE5A 4PQUB 2V34A 2YX1A 3FSYA 2BW7A 3CSKA 4QCLA 3MR5A 2GHWA 2GQ2A 2HBRB 5I4MA 1HW8A 3SI8A 3TARA 2V69A 3RAQA 5GMEA 4DN9A 2OTLS 4EBDA 2GA7A 2KU7A 2WBMA 4A8XA 1UWBA 4H4OA 5B0AA 2XSFA 4TVAB 4Z7YA 2ZVSA 1VQ5S 4DLGA 2VOPA 4ZCKA 2FVRA 3DHWC 2O5DA 4IFVB 1S0OA 3M2VB 1CG2A 3HVWA 1N34F 3R7BB 1NEEA 5D3GB 2VFUA 1MWQA 1Q86T 3OHBA 4FS1A 1X4AA 2RDDA 4M8LA 3OFFA 4TY8B 2ZH3A 5KFXA 2EEYA 4IFYB 2C2DA 3M2RB 3BBCA 1XMQF 5M2UA 2CVIA 2E1RA 4ZJLA 1T9YA 3ISNC 1TL3B 3R5GA 3GTYX 3G2XA 2IYIA 1RHKB 5ETMA 2CJAA 3GYGA 4DL4A 4MAKA 2GAGC 3CCZA 3KK2A 3NGKA 1TL1B 4KBIA 2RUGA 1FRMA 2V4JB 5CH7B 1F9EB 1S6PA 2D1CA 3TUPA 2RVJA 1IQTA 4IG3B 2WVEA 4EO8A 5KFMA 2KXNB 2NUHA 2FVQA 4FBUA 5A6WA 1S1WA 2H54B 2V2VA 4NEYA 5KOWA 2N82B 2WCXA 3US5A 1WSVA 4I6WA 4RUCA 3C16A 2KFNA 3BSAA 1WDTA 4DR6J 4KY3A 3PNIA 4N5SA 1WI8A 2MHNA 2Q79A 4IDKA 2XMTA 4MMOA 2FUG9 3LO3A 2C1EB 3JTPA 4R0EA 1RHRB 1IKYB 4EUVA 4X4VA 4K4SA 3MR3A 4KPYA 2Q1LA 2QN6B 3EGVA 4DJBA 3V4IA 1RZMA 2KHDA 3O44A 3QLHA 3BQ1A 4QIGA 3ETMA 5ETKA 3FDSA 3LGNA 2FLPA 3Q8VA 1JX4A 2IBKA 4ZVQB 1S4EA 4CH1A 2Z57B 1KQSR 1NUEA 4XIUA 5IV3A 3L95X 2AJ0A 2ZM6F 4C8MA 1SC4B 3AA8A 4WWSA 3EZOA 1TV6A 1X60A 2JLFA 2R2RA 2XMUA 4WIIA 3CD7A 3CTRA 3R9LA 2HHQA 3LAMA 4TYBA 1D9AA 4NLUA 4FZVA 4I7FB 5A76A 4CP5A 4AYBD 4QWBA 1BHNA 3IG1B 1SJQA 4A8MP 1VBZA 2BMBA 2NS1B 4ZHRA 2LEBA 3FUYA 4PXCA 3OLBA 3DOLB 2DD8S 1RYRA 5L8RC 5A8WB 5J2MA 1H38A 4TNOA 2HSEB 4X4SA 5DM6Q 3JTOA 4PG8A 3BGRA 4ALZA 4DV1J 5FLXU 1ZH5A 4MKYA 2FC9A 6FDRA 3IFEA 3BQ2A 2B8PA 4HT5A 4DL6A 3QZ8A 2VIHA 4QU6A 2Y8YA 1BWEA 3U27A 5LSLA 3RAMA 1H72C 4M1KA 1B0VA 3J81j 5DLFA 1IBCB 3DC2A 1U25A 4LF9F 3DM2B 2XS5A 1O0PA 5G4DA 5B0DA 2HZAA 3GJQB 2HHVA 3T1YF 1LWFA 2G0IA 1N0UA 1C2PA 3AQOA 4ETZA 3J7ZT 3KK3A 1FJ7A 1VQOS 5C42A 1S1VB 3CXCR 4NZ6A 2V94A 4RW7A 3IWXA 4MKAA 4L73A 1Z2ZA 1PBUA 2RHQB 3M1VA 5AE2A 4IO9Q 3A3NB 4NRUA 5KG1A 1YRUA 4QWEA 4RWWA 4UQTA 4OZNA 2CJQA 2P9EA 3QYYA 2C2MB 4DG1B 1X0FA 3GIIA 2ALZA 2OPSB 2A6OA 1ZPVA 1AFIA 3B82A 3MMBA 4O44A 2D69A 3IM9A 2BR0A 5EHHA 3I4HX 2XMJA 1VFJA 1FRXA 4FS2A 2ZBCA 5K8PA 3W9JA 3HXMA 2DHXA 4Y2MA 1URRA 1TKZA 3QATA 1IKVB 2DRBA 2WK4A 5BYRA 2ZZNA 1S9EA 4ECXA 4MJKA 1UKUA 3O1LA 1O8BA 2MKSA 2HAIA 3MR6A 3CCJS 1UAWA 2XCPA 1VLYA 2MGZA 3GLJA 1UJ4A 4LFCF 4QYZK 3AAWB 1BGXT 2KYZA 1O51A 3DI6B 4AQYF 2XLJA 1SCJB 3ZTSA 4CLTA 2QJ3A 3TJAA 5M2RA 3ETOA 1Q4RA 8RUCA 1TL7A 3U02A 1RWKB 2FJXA 2W7OA 4ED6A 1MNEA 5F8HA 4BCAA 3Q24A 2W8LA 2I0XA 1U1PA 4PG5A 1LWCB 1W25A 3QPIA 5F3ZA 4ZLLA 4C8ZA 3CO0P 3Q8RB 3J81U 5K5MA 1RWUA 3FQLA 5HVGA 4DFKA 1ZA2B 4ELVA 2YPZA 4CWBA 3OR1A 1D0EA 3OLAA 1ZTTA 1R8HA 3R3TA 4N47A 4QJVA 4EEYA 3C14B 2A3JA 3QNWB 3M8QA 4WK1A 1RQ0A 3A3PB 3UR3C 3MM8A 4DSKA 5F8GA 1IM4A 1UVKA 3UCGA 1R31A 3LW5C 4RW9B 4JI8J 3MI7X 4NMXA 4DQRA 3KHRA 4DV0J 5L1KA 4QZVB 3EXYA 1AA1B 4JV5F 1U2CA 4C98A 5D4NA 4KO0A 1X4DA 3U7JA 1HHTP 1FEHA 2W25A 3J80U 2XBPA 2H4YB 2EI5A 2CWKA 4ZP7A 4WE1B 3IWNC 5KFLA 2BE9B 2Z58B 4Y3CA 1F6TA 1N5TA 2DNHA 1Q82T 1TKXB 1M1GA 1JKHB 1S79A 1XJWB 1REVB 4RNMA 2J7WA 1RT2B 2IA6A 2HHPA 2H5EA 3WZ0A 3QGHA 2IRXA 1UCNA 3V2UC 4ID5B 3PCOB 1UL3A 5HP1A 2MQPA 2VDHA 2KYXA 1GX5A 3CEDA 3J7A1 2KZMA 1FFWB 3SCIE 4A48A 2UZAA 3MD1A 2ADBA 5KFDA 4YHHJ 4Q43A 2NPFA 7FD1A 4LFAF 2UXDJ 5DQIA 5E3PA 5KFSA 2ZE2B 4OIXA 2DT9A 4KE5A 3M6UA 1HWUA 3MHYA 4JI1J 2CQPA 5FIIA 1KOOA 3KHLA 4ZCMA 4NLVA 2ZD1A 2EFVA 1B7YB 2I2YA 3DOMA 4YFUA 5F41A 4J9PA 2FHOB 4AFFA 1WG4A 3UDCA 2OHDA 2YKNB 4DV7J 3HJVA 2PI4A 3IM8A 1CJKA 2XC9A 2V5HG 2FVPA 2FVSA 3R1LA 2HMIB 1FESA 4J9KA 1HMVA 4K4TA 5E3RA 3CJTA 1N5VA 2WHOA 3K0JA 5DZ7A 1L3VA 1CJTA 1WC1A 3PXGa 1GMVA 5E7OB 3I9V9 2VQEF 2CQ3A 2DK2A 2HS0A 5D4OA 2OPQB 2WOMA 4ZCLA 2ZITA 2HNYA 2ZBPA 2UUAJ 1L5UA 1LW2B 4DR5F 5HAOA 2M88A 4TYAA 4HH1A 4U7UD 3CCUS 4P73A 2K1RB 3Q8PB 1NXIA 1ZS6A 3ONQA 4MK8A 4CO0A 5RUBA 4ZVEA 2MHEA 3KUGA 2F4VF 1S1XA 2BKPA 4UQGA 4FF2A 2DXDA 1DY3A 2D74B 3IBCB 3AB4B 5DM7Q 1BWVA 2VC1A 1MROB 3ZZTA 3GPAA 3KNAA 1X31C 3J7YI 2HFZA 4ILLA 4B3RF 1T94A 4IRKA 3CJ5A 3PHTA 1RCOB 3FGVA 4USVA 1SVDA 2KM8C 4NLTA 1QDUB 2VG7B 3NXZA 1FX2A 2B51A 3M32B 1TZ0A 1QSLA 1AZSB 2VG5B 2DNNA 3ET6B 5AE1A 4EZ6A 4JP8A 1IBLJ 1WEZA 4XDCA 2QZ8A 1RWOB 3MZIA 1RWWB 4ZA1A 1M5SA 3DXBA 5K14A 1MMLA 3SIPB 4LSNB 5HMWA 2OD4A 1FNOA 3G4SS 5GAGU 1X4BA 1JJ2R 1N5SA 1F5AA 2APOA 4F36A 4ZIWA 1WHWA 4NASA 2ZHBA 2AMCB 4O3NA 3OSPA 3FRYA 2IRYA 4QOTA 3QGPA 1Q8LA 1IBKF 4L75A 1Q78A 1PYOB 2BKOA 2JEJA 3DRRB 2DXEA 2WSFC 3B6BA 1PC4A 2W9BA 1R6YA 1IJFB 3BKUA 3PDNA 1PO6A 3B8HA 4FF1A 4UOCA 3N6LA 2RS8A 1S6OA 3TRGA 4CO5A 5HMZA 4HHHA 1WG1A 4I69A 3Q89A 4CDIA 2UUTA 4I2PA 4KGVB 1ELOA 2N3OA 1WHVA 5EDWA 1SIWB 5B09A 4OYXA 1F3VA 3D28A 2RDJA 1Q5VA 2IDEA 4DV5J 4MT1A 2NPIA 5L9NA 4F4AA 1S5ZA 4LREA
chains in the Genus database with same CATH topology
3DRSA 4F4YA 4MYUA 1LFPA 4A47A 1HPZB 3CE8A 1Q8BA 4EFAC 4CH7A 3D0GE 2A10A 4B3TF 3JTNA 1ZPWX 2LEPA 5I42A 4HVZA 3Q23A 3SCKE 5C25B 2IAJB 2O01C 1UETA 3UQSA 1VC5A 1XMOF 4FXDA 4LFBF 4J5OA 4ERDA 4JI3F 3T5JA 2ZUGA 3FFIB 3HP6A 3DLKB 1P27B 1DQ9A 4Q5VA 1X5SA 4R5PB 1FD2A 2I5JA 1NJIT 3PO5A 4FVMA 3S8SA 1FVQA 2F8MA 4ZOSA 1KHVA 1MU2A 2ZC4A 4H4KA 4ZK7M 1R0AA 3HMJG 1UVLA 3WC2A 1QAIA 4O3RA 1KQGB 2ZH6A 2CQHA 1NKEA 3RZAA 2V8HA 2DITA 3LP0B 3CCSS 1IBLF 1FO1A 1X4GA 2BACA 1SH0A 5KAKA 1HQUA 2XY6A 2C22A 5A0YB 3KLIA 2KRBA 4ED5A 2CJKA 2GGPB 4PXEA 1JLGB 2OO4A 3D54A 4WU2A 2NUUG 2BDPA 2OSRA 5K14B 1HNIB 3D5MA 4WTYA 2YH0A 1KQFB 2FJBB 5KFBA 1AXQA 4ECSA 1ZETA 3MMJA 2BE2A 1HYSA 1YIJS 2U1AA 3OL7A 1DBDA 2ASDA 1HNZF 1HFEL 2F7VA 1SH3A 4U67Q 4UY8T 1RKIA 2FPHX 2DHAA 3HHDA 2KJWA 3OBIA 1S77D 3GR0A 2CKWA 4Y2IA 2HNDA 3PEHA 1YITS 2DPJA 2HIQA 5SUHA 1UMJA 3PRDA 3KJVB 1WTFA 3RB3A 2RH3A 2HRUA 3AJ2A 4DQIA 3HF5A 1DURA 2K7JA 4JV0A 3CJKB 1NK8A 2PMHA 1R43A 1NK9A 1U1OA 3FEYB 1SJ4P 4ILMA 2IVMA 2ILYA 4GC7A 4MK9A 4C0BA 1V3SA 1IQZA 4N8OA 4NCGB 5KFYA 4WKRA 3TVZA 4OJHA 2EWHA 1NAQA 2Z0GA 2JLGA 1YRTA 4B9SA 4HI2A 3CJ4A 4CIOA 1NK4A 4DLEA 3CMES 3THPA 2MPUA 2DRAA 3MUMP 4NLOA 2QA4G 2W9BB 3CJ0A 1HI0P 2GHVC 3RB0A 3M9NB 2YKAA 4P6QA 3S01A 2XNRA 5IM0A 3OVSA 1VBXA 3W3SA 1UA1A 2UUCF 5LMNF 3NRBA 5DG8A 2HHUA 2YH1A 2RILA 3QZ7A 2JWNA 3LP2B 2BZ2A 1DTQA 3TVYA 1S1TA 4DMZA 3N5FA 3A1YG 2GO9A 4OMFG 2WBRA 1S48A 2IBOA 4PG7A 3ZFVA 4CO2A 2MKIA 4AL7A 2PFFB 1JLAA 1N6QB 4I2PB 2R7SA 4WFNQ 3HKWA 1HD1A 1NB7A 2FLNA 2L48A 1NHVA 2WB4A 1FTCA 3UI3A 4ZVFA 2F8HA 2LQBA 3NBPB 3MM6A 3NWGA 1KRPA 4G1PA 4EYHB 2WB1D 3H25A 3GG1A 4ICLA 1U6BA 4DV5F 3VF0B 1G3OA 3EZUA 1VQ8S 5L1JA 4ECWA 2DGWA 2LKZA 2XULA 3SDEB 5KFNA 1YJTA 3DU6A 1S9FA 4AE5A 3DRSB 4TXSA 3MEEA 3MMAA 1S9GA 3T6BA 1NJWA 4B9MA 1U45A 1LKZA 1LXJA 3FJ2A 2F9JA 2AU0A 2UUBF 2EK1A 4OI3A 4LF6F 1X9WA 1B0PA 3CIMA 4OJ3A 2DNOA 1RTJA 4QPTA 5I42B 4X66F 2IFXA 1HWIA 3ISZA 3R5BA 4ZPWR 2X1GA 3X3UA 1KFSA 4F3QA 3FMBA 1GTEA 1Z4UA 1UVIA 1VGYA 5I3PA 2QA2A 2MQQA 3GILA 5DRKA 1LWEA 3V6HA 3J7Z5 2I5JB 3SV4A 3N0VA 3T19A 5C5JA 2EPIA 1MU2B 1HNVA 1V3RA 4K5RA 1R0AB 2L3MA 3EXCX 5IWAF 2B4VA 1S7HA 4ZVHA 2E5JA 1U8SA 3DLBA 1UVJA 5J1EA 4G6VB 2BQ3A 3BEGB 4ZPTR 2VPZB 2OPRA 4OHYA 2W24A 1HQUB 1Y9OA 1QTMA 3KLIB 3M6VA 1W2IA 2DR5A 3KLGA 4N77A 2WSCC 5KFCA 1VQPS 4F3MA 4I6YA 3QJLA 2J9EA 3BO2A 3OJUA 4LMZA 1TAQA 1SKWA 4X62F 1JLEA 2YWEA 2CPIA 2N4CA 1D1UA 1H2VZ 1HYSB 2BE2B 4OI4A 1VJWA 4DWIA 3EX7B 2AWZA 3SCLE 4X2BA 1ZZNA 4JBCA 5HMYA 3I5BA 3CO9A 2JVOA 3ZZUA 2XWYA 3EGZA 3TW0A 2ASYA 1KVJA 1VHFA 2OAUA 3OL9A 1A9NB 4K0KF 4Z2XA 4NLGA 2DR8A 3TP2A 4B3OA 2RRBA 1XR5A 2HNDB 3BGLA 1JNZB 2AW0A 3H40A 5K9FA 2Z2LA 2IMWP 1H3DA 1WF2A 4U6PA 4JI6F 3JAMY 1SXLA 2HHSA 2MKKA 1G7CB 1S6QA 1M5PC 1HWKA 1SJFA 1SV5A 3PACA 1YG0A 1M0SA 1WF1A 3N28A 4YDDB 2HGMA 3ZZPA 1N4LA 5KFAA 1F5BA 2GJIA 2VPYB 2HFNA 2FLOA 3SZ2A 2GIQA 4IOCQ 1KS2A 3K5OA 4EZ9A 3TUZC 4MIBA 3LF0A 2O1PA 1JNRB 1RT1A 2HVIA 2CPHA 4TU7A 4YEAA 3GR1A 4ZCIA 2AJ4A 3JB9k 4NLWA 5KFUA 4DSEA 1DQAA 3GSDA 1FJGF 2PO4A 3MUVP 3IRWP 1N56A 3C8YA 5CYJA 2DCUB 3J7YU 2CQGA 3QIPA 5IM0B 4KGMA 1N36F 2M7SA 2DR7A 4CO3A 4XO0A 2LDIA 4RBVA 2OJ3A 4OX7A 2VONA 4C8YA 1RT6A 1DTQB 1UVMA 3GYNA 1S1TB 5B0CA 5K8NA 3AB2B 3CD0A 2XGQA 2ROPA 1ZYQA 1JLAB 4B9TA 4USHA 2RKIA 2OKQA 5EUHA 3CC7S 5JUMA 3GFHA 1OIAA 3KLFA 4FVCA 4A8YA 3E3XA 3MM5A 5DETA 5D8HB 1FXRA 3KTQA 4Q45A 2LQJA 5IZHA 2M8HA 2Z4PA 3MM6B 4C8OA 4ZPAA 2EFGA 4RNFA 1ZZFA 2B5JA 3C66A 1FHTA 4ICLB 3U1MA 1R8AA 1AW0A 2DR9A 3TAPA 2E5LF 2AJQA 3SQGA 3I0RA 4URGA 3MEEB 1DLOA 2C3OA 3AQPA 2J9DE 3MMAB 1S9GB 1MMDA 3BO3A 2M8DB 3H2VE 2RU9A 3MTKA 5ITHA 1ZM9A 2IJNA 3PX0A 4KB7A 3EPGA 2XLKA 2HLUA 4R8UA 3HK2A 4KHPF 1RTJB 3I9ZA 2AGQA 4YY3F 2QLWA 4E0DA 2KDOA 5CCMA 5L38A 4F2RA 1Y5IB 1NNDA 1FRHA 1T95A 2FDNA 2UV8A 3QAUA 4KHRA 2CIMA 1Y0HA 5DJBA 1LWEB 3NS6A 4Y34A 2MZTA 3PRBA 4Y0FA 5F9NA 2B7CB 2ASLA 1H98A 3VZIA 1FKOA 1HNVB 4NA2A 4BWMA 4DS5A 2D7SA 3N4WA 1XC9A 3RBEA 3I6PA 1NH7A 2FIUA 5J1EB 4DQPA 3PW7A 4QR0A 1M90T 5J2QA 2FTRA 3Q2TC 2OPRB 1R8CA 4E8UA 2J0XA 3FCHA 4WJBA 1N8RT 4PPDA 2PI5A 2JEFA 3P96A 1VQ9S 5FD1A 2GJ2A 3KLGB 4ECZA 2B4UA 1FEEA 3DOKA 3G86A 4YQWA 3KK1A 4ED0A 1JLEB 5EGYA 1LV5A 4USIA 2CG4A 2E7WA 1L3TA 2V9WA 2CQ2A 1JJHA 1WI6A 1Y00A 3ZZRA 2L08A 3MR2A 3MEGA 4XAKA 2YKOA 2NXUA 5KT6A 3L3CA 2B56A 4N8NA 3VWSA 2BRLA 2KO1A 3OQ2A 3GE9A 1S1UA 4JI5F 2FD2A 4B3OB 2LXIA 2ZFHA 2BQUA 1FJCA 4CT9A 2HWHA 2RNEA 3DU5A 5HL7Q 4KAIA 5ADZA 4MK7A 2Q6BA 2KFZA 5KFHA 5H9FJ 5L1LA 3DLGA 5LXRA 3HVTA 4A8KA 1VQ7S 1GT8A 2PDAA 1S6QB 4LUBA 1WHXA 3AH6A 4O23A 1SKSA 3DLLQ 2E9RX 3QJPA 1QUPA 4IH5A 2QEXS 1SV5B 4KV8A 1ZOTA 3UCUP 4DR7F 3DRXA 5KFPA 3MAQA 1F0XA 2MZRA 3IXQA 2CQCA 3OFGA 1D9DA 2E5IA 5EN1A 1RT1B 3CJ2A 4FN5A 3MFIA 2G1DA 3NG8A 2VL1A 3H98A 3V6JA 3PIOQ 3QJJA 1JIHA 1V9OA 3VQSA 5GAHU 4WCEQ 1F5CA 2V4RA 2BABA 3F56A 3KWMA 4NLDA 1SL2A 4C8NA 3HZEA 3THVA 2RQMA 4RW6A 1ZBTA 4OX9F 4J9SA 1KHWA 1N48A 2UVVA 2VBWA 1RT6B 3G96A 2XMKA 2WSEC 1M5HA 4DL0C 4B9VA 1D3WA 1C0UA 3H59A 2AF6A 3OFEA 2YNFA 3ZZYA 3M9MB 3OXGA 5LT5A 2RKIB 4O4GA 2PMZD 2YKMA 2MKJA 1OPZA 3KLFB 4DR1F 3KMQA 3OL8A 3MM5B 4U9RA 1RT7A 2LQ5A 2N3LA 2HFOA 4FXWA 4PWUA 4FXVA 5E0OA 1HNXF 1VQLS 4ZDNA 2B5JB 2HWIA 2ZH8A 1WTBA 3MM9A 1T3OA 2B0GA 4OZJA 5KFRA 5CXTA 1C1BA 3T3FA 5DGAA 2E1AA 3B78A 3SQGB 3I0RB 5L39A 3OW2R 1DLOB 2V2KA 1RTIA 3HDSA 5A8KA 2QA4S 3C3LA 1J5EF 3CCTA 3IGNA 2XEXA 3LANA 3POTA 1K73T 1TFWA 1OPIA 4DF8A 2CPXA 1K9MT 2MQMA 4R8UB 2OP5A 4JYAF 2E5HA 2NYIA 4NLRA 1TUVA 2BYCA 2QMXA 1X9SA 2KHCA 3H5SA 3G6XA 2HLTA 4I68A 4C7QA 4NX9A 1ZAVA 5KG4A 4BHQA 1N33F 2VKZG 4RX6A 4Q2LA 5HQ8A 4NZ7A 1IKWA 4OZ0A 4IYQA 2RSQA 4LSLA 1FKPA 3K57A 2UVWA 1BQMA 4FNIA 1HBUA 2RE1A 1KONA 2ASJA 4JI0F 1HBOA 2FHJA 5AJ3F 2RRNA 4Y28C 3Q0AA 1FKOB 2W7PA 5J2PA 2GFFA 3DDKA 2QSFA 4BDPA 3MOJB 1N54B 5CZXA 1XMBA 5J2QB 1MWZA 1VQKS 2POKA 4URSA 1R8PA 1KTQA 3DRPA 4YB5A 2X51A 1U1QA 1PSDA 4ECRA 4YOEA 2P6TA 1QE1A 2V8VA 3HFKA 1O5JA 1TKDA 2KT5A 3DYAA 1QSSA 3DOKB 4O0IA 5U47A 4DR6F 1Q7YT 5L1IA 3KK1B 1TR0A 2VBXA 4ATNA 1QY7A 3DLHA 4L3NA 3RYLA 4EWTA 2XI2A 4FP9A 4OHVA 3UR0A 2VG6A 5F8IA 4C3MA 3K5MA 1YTYA 2G9OA 2RD5C 3MEGB 3PVXA 3OJSA 3GIKA 1Q79A 1X4FA 1E6VA 5KFQA 1S72S 2DHSA 2UVRA 1S1UB 2O3DA 3TOQA 2F1FA 3MGJA 4HEA9 2MDAA 2W9CA 5CYMA 1RKJA 1SB6A 2KT3A 5EX0A 2NSBA 4WF9Q 1TAUA 4QYRA 2NREA 1EETA 4QYZJ 2I38A 2VFVA 3UD3P 1GQEA 1P1TA 3DLGB 3NAHA 3HVTB 2N7CA 2ZH5A 1QAJA 1K0TA 3NNHA 1SI9A 1NKCA 4B3SF 2X1AA 3BSNA 2F3JA 3OFHA 1FA0A 2ZC3A 3KHHA 4KV8B 4RUAA 3L09A 2R7XA 5IXUA 4ED8A 2XSJA 2VKRA 3HKZD 3NP5A 1KC8T 3B4MA 1HL6A 1I94F 2QYCA 2VOOA 1UEVA 1CQNA 2CDQA 2WW8A 4XPCA 1FCAA 5A6PA 3UPFA 2AGPA 3TI0A 2VA3A 3EGWB 5DO2A 3I0SA 1XNQF 5AE3A 3L7PA 1U1RA 4U7CA 1UP1A 1OSDA 1VRUA 2NSCA 4RWXA 2RS2A 3I55S 3N6NA 4Q8FA 2KTQA 1IBMF 2CQ4A 2R7UA 2ZOMA 2YNGA 4RW6B 1H6KX 5KG3A 1BD6A 4ES3A 5HROA 4Y2AA 4IKAA 3PR4A 3BO4A 3PY8A 3MM7A 3NMRA 2BBEA 1C0UB 4I56A 3W2VA 2KRRA 4ZS6A 1JJ4A 3GFZA 2AX1A 2YNFB 1VMBA 2XCAA 1FDNA 4O4GB 1J5OA 2YKMB 1BQNA 1TL5A 3BJYA 3KG4A 1Y5LB 5KFTA 4DUYF 4X4RA 1RT7B 2GNKA 3HHNB 4DBQA 2MZSA 4X84A 5A8RA 4OHZA 4GKKF 1U1MA 4DL7A 2JEIA 2YNHA 1LQ9A 4KRWA 3TUJC 3MM9B 4IQXA 3BREA 4RKUC 1C1BB 2B7BB 3G71S 2ROGA 1FK9A 3CWJA 4JI2F 2N7YA 1TFYA 3BR9A 1NO8A 5A8KB 1RTIB 4DFMA 2CPEA 2J0QD 4F26A 2LA4A 2IMOA 2J0WA 2MY7A 3IS9A 3CCLS 2JC1A 3POTB 1OO0B 3BGFA 1LK5A 2SXLA 3CCQS 2B3TB 1P8GA 3B4DA 4GC6A 1GXUA 3NGDA 2ZZMA 1MMNA 1VQNS 1RT3A 3NCQA 4KJIA 2V8GA 2YKQA 2YVSA 3ICLA 1RT4A 3T5HA 1XTZA 3KOAA 3CCES 3D1HA 5KFJA 2VV5A 3FNNA 1PC5A 3MECA 4I6AA 4ECQA 2BVZA 3PJXA 2J6TA 1IKWB 3H5XA 2E9ZA 4LSLB 1FKPB 4AUKA 2N4DA 4CNYA 1BQMB 5GAHI 3MWBA 1HBUB 1QJHA 3D1OA 3VAIA 4NOHA 1HBOB 4B9UA 5MLCV 5J2PB 1HARA 3BR8A 3U1NA 2VBYA 1FF2A 1GTHA 2LU2A 1X9MA 3VTIA 2I8EA 1MSWD 2ZNZA 1WNEA 2E1MC 5F3TA 2FJAB 2VH7A 4XPEA 1Q81T 3DRPB 2DB1A 4HH0A 4PQUA 3GB0A 3W7BA 4O3SA 3HHLA 3IR6B 1QE1B 4WFAQ 3AJ1A 2VPWB 3DCAA 3T5KA 1KOHA 3DYAB 5F8MA 4QR2A 2WONA 3TYTA 3O6QA 3OXLA 1FRLA 2ACYA 2G13A 3L7OA 4WYWA 1IJEB 2DGSA 5CYQA 4CCHA 4HI1A 1JMTA 2VG6B 1IUJA 2B9WA 4WKYA 1R89A 1E6VB 4ED1A 2DO4A 3T1HF 2D41A 1RA6A 2YWHA 4ZP8A 1WF0A 4ES1A 5J1PA 5HO4A 3T5LA 2YNIA 3O5TB 1OSCA 1CC7A 1VQ6S 1Q16B 3BDEA 3OHAA 2W9CB 5CYMB 1U49A 1CQMA 2HS3A 4CO4A 5DQHA 1JLCA 2GCFA 2XLIA 2J6SA 1LW0A 4ELTA 1EETB 3R5AA 4PWDA 4BC7A 4HL9A 1HR0F 4Y2CA 2B9YA 5D4LA 2ZKUA 2F9DA 5DG7A 2PGCA 5GADI 4RLEA 1Y3JA 1XEZA 2ATLA 1T7PA<