1FKAF

Structure of functionally activated small ribosomal subunit at 3.3 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkaF00
1HR0F 1G1XA 4B3TF 1N36F 2UUCF 5LMNF 2UXDF 1IJEB 2B7CB 4JYAF 1RISA 1XNRF 3ZZPA 1LOUA 4NXNF 1XNQF 4GKJF 4OX9F 4K0KF 2UUBF 4YY3F 4DR1F 1VMBA 2KJVA 2ZM6F 4LF8F 4DV7F 2F4VF 4JI6F 4LF9F 1IJFB 4X64F 5LMUF 3T1YF 2UXCF 2RJZA 1HNZF 4X62F 4YHHF 1XMQF 4DV5F 4LFBF 4KHPF 5IWAF 2KJWA 4JI4F 2UU9F 4JI7F 1CQNA 4DR4F 1F60B 2HHHF 1IBMF 1N34F 4JI0F 1HNWF 4DUZF 2J5AA 1IBKF 4GKKF 4JI3F 1QJHA 1GH8A 3OTOF 4DV6F 1XMOF 4AQYF 2YY3A 4LF5F 2BVZA 4DR5F 4DR2F 2UXBF 4DV0F 5BR8F 2VQFF 4X65F 1I94F 3T1HF 4DV1F 4DV2F 4DUYF 1HNXF 1N32F 1FJGF 4LFCF 5AJ3F 4X66F 4DV3F 1B64A 2VQEF 1IBLF 2UUAF 4LF7F 4B3RF 3R3TA 1J5EF 4JI2F 1CQMA 4LF6F 4B3MF 1FKAF 4DR6F 4DV4F 2E5LF 4B3SF 4DR7F 2BXJA 4LFAF 1N33F 2B7BB 4JI1F 4JI8F 4JV5F 4DR3F 4JI5F 1G7CB 4LF4F 4NXMF
chains in the Genus database with same CATH superfamily
3KHLA 2UXDJ 2ZHBA 2QE5A 1C4CA 2Q3PA 4L73A 4B9NA 2KXHA 3IM9A 4ANDA 5KFUA 4UQTA 2O3DA 3TAPA 4M5IA 1OY9A 1SV5B 1IR1A 3LGHA 1N5YA 5E41A 3HVTB 1U26A 1Q82T 2CQHA 1T05B 2V9KA 1T03B 1RXOB 2GVDB 1BQNA 4DN9A 2CIMA 2GGPA 4EBDA 5FIIA 1HNWF 4X2BA 1SQFA 1S1UA 3T5JA 4QWCA 2K8GA 5C42B 2CPFA 2WRMA 4NCGA 2BVZA 2OHDA 3CCJS 1G6BA 3BSCA 4NLYA 1F9HA 4RBVA 1HNXJ 1IBLF 4JI2J 1VBXA 3IGNA 2LQ8A 3H2UB 1FKAF 3UW1A 1OQ6A 1QUPA 2ZBIA 4DHVA 2EFNA 3BH6B 2DRBA 2HS3A 2CQDA 5A8WA 2Y1JA 2Y8WA 3K59A 1JJHA 1IKYA 3W7BA 1VCTA 3A8IA 5IFMA 1D9FA 3VAKA 2MQOA 3KTQA 1IJFB 2AX0A 4K4UA 4WFAQ 5DM6Q 2UXBJ 2DY9A 5DETA 1TKXB 1RAOA 2HIQA 4CIOA 2F63A 2P2CB 3NP5A 2PDAA 4OHWA 3PZPA 2AU0A 1NSPA 5KFGA 1HNIB 1NO8A 1EX8A 1SV5A 3IWXA 2VF3A 1TAUA 1S6OA 3HVTA 4Q2MA 2DO4A 4ETXA 5JUMA 1T05A 1T03A 1Q86T 2GVDA 2ALYB 3MCNA 3R3TA 4IKAA 3LH2S 1JXVA 2LEBA 2BKPA 2DGOA 1QSSA 4J9LA 4KSEB 1ZA1B 4F04B 1SVDA 4L3NA 3PTWA 5C42A 1WD6A 1BUXA 1HNVB 2AT1B 3VVTA 2CG4A 5ETQA 1PC5A 2Q43A 1TMMA 4NLGA 2EWHA 5KOXA 1X4DA 2GIFA 1SJQA 4B9TA 2MQQA 2X1AA 2GS8A 2PFFB 2NXUA 1BQXA 1PGZA 2FC8A 1REGX 8RUCA 3EYZA 1KVJA 2CFXA 4KFBB 3R2CJ 2V6AA 3CULA 1R0AB 5J1PA 1UFKA 3TA2A 1YJ9S 5HQ8A 4DQIA 4OYIA 3OSPA 2P6SA 4M5KA 1N0VC 3KUHA 3MPUB 1U47A 3QRRA 2RE1A 3MUTP 1FX2A 1RAEB 1S76D 4KJIA 4PXDA 3FRZA 2KZMA 2HQ3A 5L1JA 2Y1LB 1PAEX 1TKXA 2KHDA 3W8GA 3CJ8A 2C28A 4PWDB 4DQRA 2LQ5A 2BXJA 1NBEB 4L74A 1WHYA 3PYEA 2ZNZA 1NJIT 1YZ7A 1H38A 3AXMA 1FT8A 1HNIA 1SL2A 4J5OA 4NI2B 1UAWA 4ELTA 3OFFA 1QSYA 2WOMB 3LTOA 4PWUA 5EDWA 4EZ6A 4ZN1A 2ZHAA 2B3TB 3Q8VA 3PXGa 5A2QY 2MQMA 1S1WB 1PBUA 2YWHA 1HA1A 1JJ2R 3CCTA 1NHKL 4C3KA 4WIIA 1WEXA 4IQMA 1L3KA 4KHPJ 2GJIA 1ZM2A 3QT8A 3R97A 1HNVA 3R5JB 3PRBA 3KDOA 2HFUA 3VR1A 1Q4RA 4AXJA 4H4KA 3MM6B 1GK8A 2VOOA 2MKCA 2B9EA 5KG5A 3IRXB 3MD1A 1NB7A 9RUBA 3D6HB 1C0UB 4NZ6A 2MHNA 1QLNA 4OHZA 3FBCA 4J9QA 3MPWA 3ZC4A 3SSQA 3AA9A 2LECA 3JSMB 2GJFA 4OMFG 3S01A 3CIZA 3QT6A 2AP6A 4L72B 5M2UA 4P75A 2HBRB 4KFBA 2ZH2A 1HBMB 1ZPVA 4LREA 1R0AA 4JI1J 4IG3B 3JTOA 3GG1A 3AOBA 5KOWA 1HHQA 3OSNA 3C15B 3O2IA 1S7HA 5DJBA 2J0WA 1K9MT 4Q2LA 5JVHQ 3UDCA 3ISND 2IRXA 1U2FA 2MKKA 2F9JA 5IQ6A 1X5PA 1GX6A 4PWDA 4H4MB 4MK7A 2HZAA 2R7UA 3MZIA 3T5KA 4MK9A 2EFGA 2BE2B 4G3IA 2XMWA 1EAYC 2RJZA 1MMLA 2DKOB 1VC0A 2J6UA 4O3QA 4PRFA 3MM7B 3O8WA 3O6QA 4NI2A 2WOMA 1K73T 2FJVA 1IXKA 3BGRB 3GFHA 2CPYA 2QL9B 1XJWB 4DLEA 3AQPA 4P2FA 4PR6A 1CC8A 2BE9B 3HPOA 2ILYA 1S1WA 3PFOA 4HKQA 2RRAA 2V8GA 3US5A 5DS7A 1FI4A 1HI8A 3MAAB 1HHSA 2H54B 4CYUB 1LFPA 4JP8A 2VONA 5SUHA 3MM6A 5E3QA 1C0UA 1W2IA 3FZ2A 3CMES 3R5DA 1F9FA 3JSMA 5CQGA 3QGPA 4LT6A 2VOPA 1HBMA 4LF8F 4A4JA 1GXUA 4FS2A 3TEGA 2F5GA 3HDSA 4IG3A 1U1KA 2BW7A 3A8JA 3KJQB 3W5YA 3L95X 2MZQA 2AWZA 2JLFA 2LA4A 2GVZB 2R7QA 1X4HA 3C15A 1FNXH 3AA8A 1Q1KA 4PPDA 2RHQB 1KWMA 1K1SA 3LAMA 2P5VA 3KG4A 1NJYA 2MHEA 4FS1A 1I94F 4DV1J 2XSJB 4NYOA 2ZJRQ 1JJCB 4H4MA 2BE2A 1JLFB 2EKNA 2NXNA 3H40A 2BJ9A 5AXNA 2RDIA 4OJHA 2MGZB 3MM7A 5F0UA 2EPIA 1ZTWA 3OL6A 3BGRA 4MKBA 4J9MA 4IUFA 2JOQA 2BOPA 3M8PB 3OHAA 2EC2A 4DV7J 1R7IA 2QA4G 3HULA 2XG8A 1G3OA 1KHVA 1VQMS 4PQAA 5CCLA 1Q8BA 4WFZA 3SCKE 1W25A 3MAAA 3MCMA 3G71S 3UN3A 1IQZA 2FC9A 4CYUA 3FQLA 2E1AA 4ZA1A 2YWGA 4NYZA 3KJFB 4QIGA 4G1QB 4ED1A 1RT6B 2WVFA 4JI0F 4DUZF 3PW4A 3JSBA 4EWTA 4RBUA 1XMOF 1DTTB 3PM9A 2C3YA 3CTRA 4OFZA 2YY3A 4AUKA 1H98A 1OQ3A 3AT1B 1X0FA 3AB2B 4CO3A 3OXFA 1S5ZA 1WF1A 3FJ2A 4X66J 1ELOA 1SI9A 1U1OA 1ZH5A 5GAGI 2V4JB 2GVZA 3PIOQ 4KGMA 3K5OA 3CJQA 4TLQA 2LA6A 5HANA 4BDPA 2XSJA 4BWMA 4NXNF 3I9V9 4USJC 1JLFA 3I32A 3QWPA 4B9LA 4ED3A 4EFAC 2DK2A 1WEYA 3IC1A 2MGZA 4X84A 3SCLE 1F9EB 5HMYA 3W2VB 5D4OA 2XO6A 3M8PA 1OIAA 3WIUA 2FIUA 1IBLJ 1ZPWX 2EBGA 2JVRA 5KG3A 4ECTA 2YPYA 2V4QA 2J9DA 1YQHA 2KXFA 2XY7A 2CQIA 3GR1A 5EX0A 4ECXA 2O67A 3KK3B 2MZJA 2DH8A 1J5EF 2DIUA 4WFNQ 2HS0A 3HT3A 4G1QA 1RT6A 5G4DA 4X4SA 3G8TA 1RHQB 2R7WA 2BKNA 3D2WA 5D3GB 1DTTA 4DU7A 2MB0B 3EX7B 4JYAF 1SJ3P 2L48A 2VPYB 1XNRF 6FD1A 2UVVA 1WC3A 2HGLA 2A6OA 5IC6B 1G4CA 3D9BA 2ADBA 3M9OB 4K2XA 3HT0A 5D4NA 2VBXA 2D3OR 5DQGA 3K5NA 3RRGA 4MK8A 1CG2A 1X4EA 4ETZA 2JLGA 4C3LA 1TV6B 1TZ0A 4DPWA 5C2CA 1QTMA 3RB0A 3GG0A 1D8ZA 2JDJA 3SQGB 1AZSB 4GVBB 3GB0A 4DR2F 4WFYA 5ADZA 4O0IA 1YRTA 4C0HA 2B5JB 3AOAA 1YI2S 2UVWA 1JLQB 1ROFA 2MXYA 1CS4B 1RK8A 1WJ9A 1X9SA 3B4DA 3TUPA 3W2VA 4M5DB 3J80Y 1H2VZ 2CQCA 4LFAJ 3RU0A 4OI4A 4RR5A 4BC9A 5DG8A 4DR3J 2XYHB 3K8VA 5DQIA 3KG0A 5EUHA 4ZIVA 1CSJA 3ZTPA 3BQ1A 3M30B 1V5IB 4IRCA 4OYMA 3TUZC 3Q24A 4RW9B 1M5PC 4FVCA 4F0HA 2OGUA 4C8NA 3I31A 3KK3A 2VKRA 4LSLB 3EICA 2E7WA 1SIZA 4OYBA 1XERA 4QU6A 4G65A 3P3DA 5D3GA 2B9WA 2V8HA 3VGTA 1WC1A 3CJ0A 2AYGA 2NPIA 2KXNB 5C7PA 2ZH7A 3K5MA 1LQ9A 1IN0A 3TZWA 4ZVQB 5K14B 5D8HB 2YQ3A 4PXBA 2JHEA 1H73A 2O1PA 2DH7A 4YB5A 4TNOA 3WX8A 4WZQA 3NCRA 1FJGJ 4ZLLA 3R6GB 3IR6B 2B4OA 3I0SB 3A13A 2RRBA 4USVA 2OH2A 2R8KA 4B3RF 1DY3A 3HSZA 2OIHA 2CJXB 1U8WA 2ASYA 2V69A 2LXIA 2E5LJ 2CRLA 1TV6A 1X5SA 2IMOA 1PG5B 2CQ0A 4DSJA 4LSZB 3SQGA 1AZSA 3RBZA 4GVBA 5LSOA 2B5JA 2AEMA 2XI3A 3N9UC 1JLQA 2G2ZA 1CS4A 2OD4A 3TA1A 4DR1J 4ZCLA 4Q8FA 4M5DA 3BR8A 3WC0A 4WTOB 3MM9B 4LF9J 3CJ3A 4P10A 4ZN3A 2L41A 1ZETA 3T19A 2VU5A 3F56A 1KD1T 5AE3A 3NY0A 3GJQB 2E5GA 3M30A 3OW2R 4NYPA 3CCES 3X1LB 3L9ZA 4NMXA 2E5HA 4RW9A 2A6MA 3UCGA 5C2GA 2MZTA 5K9FA 2BJ3A 4LSLA 4WE1B 1YWXA 1TL5A 3L09A 2DNYA 2IFXA 4OX7A 1T3OA 4GRSA 4OLOA 1UWBB 3CXCR 3MD3A 1VQOS 2V2QA 3G6ES 2FZCB 4B9SA 3PDNA 2DPIA 5K14A 4URSA 1N36J 4GO5X 4C8MA 1WF0A 1DBDA 1I5OB 2Z2ZA 5DG9A 1KTVA 4OX9F 4FN5A 3I0SA 4WBFA 3FDSA 2PA8D 2OPRB 2XLJA 2ZM6J 2KJVA 4AXIA 2YTCA 4X64F 2XY6A 2RSQA 4O4GB 3PFEA 3G6XA 3D1HA 4NLDA 4K4SA 2DGUA 3OBIA 6AT1B 1ZTTA 1LK7A 4A46A 4ECUA 2D9OA 4UUXA 4HLBA 2H4WB 3DRXA 4AL6A 2CNKB 3CJ4A 2VDIA 3CD5A 2OEKA 2IJRA 2DHGA 3BKFA 4HR2A 3OL8A 5KG7A 1EKRA 3MM9A 3OHBA 3UWTA 4NA3A 5F8JA 2DHHA 4Q45A 4FYVB 2XNRA 3EPIA 3VZIA 2KT3A 2NUUG 2GW8A 2CVIA 1M1HA 4DL0C 4LF4J 2HWIA 5L39A 1SL1A 4WCEQ 2VUGA 2YNIB 4DBQA 1NZAA 1HBUB 1RT3B 2YWWA 3ZZRA 2FLNA 3LWMA 2Y0BB 4WE1A 5DGAA 1NHVA 3FCHA 3HHNB 3V81B 3J7YI 3BQ0A 2J76E 1UWBA 3GSIA 2D3ZA 5EGYA 2DY1A 2DISA 3PHTA 5IV4A 5HMZA 2CPDA 1XMQF 3E3XA 1UPPA 1X8DA 2HURA 2AIRB 4QWAA 2VL1A 4QIWD 2JVOA 1N34J 3BBFA 3KXDA 3IWLA 2R42A 2ZH1A 5DDQC 2MZ1A 3D66A 2IPOB 2HQFA 2OPRA 4ZVPB 4PYDA 2QYCA 2HSEB 3W60A 3NOCA 1DTQB 3TA0A 2ZC3A 3M6WA 1FDAA 4O4GA 3CCQS 5DQHA 4YUDA 4ZCIA 1UEVA 5KFSA 2RIJA 1HQEB 2JLEA 2ZJQQ 1RCOB 3X3UA 4IOCQ 2ZITA 4DCJB 3FMWA 2HNDB 1M90T 1S9FA 2DNMA 1PBAA 3K8WA 5E2QA 1RU2A 3NS5A 1QUVA 3OLBA 3LOUA 3LGMA 4F0KA 3VAMA 3VWSA 1XMBA 1UKUA 2VFTA 3UD4P 1KS2A 2YKQA 3BM7A 4QR0A 3SV3A 3KOAA 1HNZF 1LFWA 3MDFA 3GFXA 2YNIA 1F2GA 1HBUA 1RT3A 2BANB 3LUYA 2HRYA 4R25A 2YXLA 2NZ4A 1JJ4A 3V81A 4L76A 4ILMA 2QZ8A 1Y5LB 3OT9A 5K8OA 3HD1A 4R0EA 2P8IA 4C48A 2NLWA 4EYIB 2CDRB 2NSCA 3MTKA 4NXNJ 1TFWA 2JC1A 4RKUC 3HHKA 3LGNA 1F3VA 5U47A 3CCMS 3SSRA 2H5IB 4JI5F 1LW0B 1ZYQA 2DXEA 1KOOA 3D5MA 3KJVB 4TU7A 4DX6A 3F41A 2FHMA 1DTQA 4L3KA 4M1KA 2CNLB 2KM8C 3FGVA 2FHJD 3CMAS 4ZJQA 1JLBB 1SC3B 1I1GA 2JWNA 1HQEA 1HW9A 3UCZP 1LKZA 1NAQA 3OVAA 2M4MA 3B4MA 4ZPDA 2MTLA 4DQSA 2WB4A 2BDPA 3VAHA 2HNDA 3J81U 4YB1P 1Q81T 4CCHA 1UVNA 2M8HA 4DV6J 1RGVA 3CVKA 1RWXB 3QRQA 3SIPB 4I6YA 3S7RA 2HBYB 1TK5A 3NS6A 4M94A 2FLPA 4DV2F 4DV3J 2CAJA 4JYAJ 3RAXA 4CLKA 4RNFA 2QMWA 4OJ3A 2GQ2A 3B54A 4C8YA 2BANA 3HJVA 4F3MA 1RI7A 1FERA 4FYWB 3G96A 1UVLA 2BQUA 2HEKA 1O8BA 1KFSA 2HHXA 1WUUA 5B09A 2PN6A 3M9NB 3M8ZA 4LRCA 5HJXA 2PMHA 3ISNC 3ENWA 5KAKA 2V94A 4K4WA 2HQDA 2CPIA 4NLQA 3TAQA 2ZBCA 4PG8A 1LW0A 2W9AA 3DHWC 4A47A 2KO1A 1YJWS 2RS8A 3NAIA 4N7TA 1WDDA 3NCPA 3KJVA 2CQ1A 1NDKA 1YK9A 5BXIA 3CD6S 4ZJLA 4OJGA 3Q23A 1NKEA 1JLBA 3DLBA 2G2OA 2MQNA 4DUYF 5DZ7A 2IM0A 1WI6A 3OQ2A 1TKTB 4XDCA 4J37A 3C3LA 1JLCB 1K0VA 4DU8A 2QJ3A 3GCXP 4JI8J 1H7WA 3ICLA 5HN0A 4X4NA 1X0PA 4ED8A 3A3OB 1G7CB 1N5TA 2XEXA 4RNNA 3QFHA 5D77A 2HVHA 3D6TB 2FJBB 1Q95G 2IYGA 2UUBF 2J6SA 2K3KA 4RNHA 2QSWA 1B70B 4F2RA 2NS1B 4USKA 3AY0A 2FHKA 4YHHF 1V5VA 4TYBA 4CI0B 4QIEA 5A6WA 2BQ3A 2GNKA 2ROEA 1CQNA 4G1PA 4DR4F 4DFMA 2G0CA 1S6PB 3BO2A 3I56S 2IM2A 3CIMA 2C3UA 2OMLA 2UV8G 1EZZB 3U27A 3T6JA 1IBCB 2JRSA 4KC5A 2G1DA 5F8LA 1SIWB 3KG1A 3W9IA 2MLZA 1HD0A 3KMSA 1N88A 3PJ9A 3FK4A 1C0TB 2UUAF 4LRBA 2PC6A 2H48B 3BB5A 2QN6B 3MAQA 3H90A 1RT2B 2GHVC 2AYMA 5FD1A 3DOMB 2CZ9A 2C3MA 5B08A 2RAQA 4ZIWA 1RWKB 2IIHA 3CD7A 2ZKTA 1RWOB 4WP9A 4DPYA 2HBQB 1TKTA 4K0KJ 2ZH5A 5LJ3Y 1T8EA 1JLCA 1RT1B 3UD5A 1SCJB 3FCVA 3CC4S 3ILJA 5BYRA 3H5SA 3JTPA 2OJ3A 1QAXA 2A10A 1KTQA 4ZVTB 2HQIA 1PC4A 2BM0A 3TANA 3H5UA 2G0IA 2ZBPA 3DLGB 3HLUA 2DNKA 2E9RX 1FRMA 1S7IA 1HQ2A 3V5RA 4AQYJ 2W2NP 3ZTSA 3FC9A 3NLCA 1S0OA 2XZTB 3LAKA 2EFQA 1N32F 1C1CB 3FUYA 4DCOB 4F4AA 4LF7J 2GA7A 3SBMA 3UDVA 3U1LA 4C8ZA 2CQBA 4FYDA 5HATA 1K8AT 3AH6A 2KKHA 1S6PA 2OPPB 4RO0A 1MU2B 2H3EB 1HPZB 3N4WA 2XMUA 3OR2B 1XK8A 1R0BG 5EX3A 3KYLA 3BV8A 1BGXT 3ZZPA 2A3JA 3LQVA 4HI2A 4QPXA 3RBXA 1C0TA 2Q1LA 2B4VA 5CAAA 2WSCC 4N76A 4ED0A 3KKFA 3FRYA 4U7CA 4X4UA 1RT2A 1R31A 3T1YF 3DOMA 3TVYA 4X62J 4LIRA 4PXCA 1UCNA 3I6PA 1SC1B 4K5SA 4Y65A 4JI7J 3CCWA 3Q8YA 1W2BR 3D6MB 2X1GA 2MZRA 4FVMA 4JI3F 3CJTA 4CO0A 2R2SA 4HTJA 3DLJA 1Y3JA 1RT1A 5CZXA 3HVAA 5L9XA 1UJ6A 4B3OB 3TO8A 5IS2A 1RKIA 3T1HF 4R8UB 1XBWA 4CDIA 1DAXA 2Y3YA 4LVNP 4LFCF 1YJTA 2WAQD 3J81j 5LJ5Y 2KG0A 3OXGA 2JEJA 4X4VA 1G2EA 3A8EA 3QRPA 4IH7A 2K7KA 3DLGA 1VC6A 1QAIA 3M4XA 2GX8A 2OAUA 1S0VA 1UVKA 2V68A 3M8QB 4IYQA 2B56A 3IXQA 2AJ1A 1UEUA 1HMVB 2BOAA 3TNVA 1UFWA 5B0EA 3PKYA 4ZCKA 1C1CA 2FJDB 5KT7A 3W61A 2XI2A 2YQ0A 3MEKA 3MGJA 5FLXU 3GR0A 2V2KA 4WYWA 1OS5A 4ZPAA 3BGLA 1Q8IA 3GIMA 2UUWA 3MR6A 4KAIA 2OPPA 4C98A 1U6BA 1MU2A 3NOGA 2ERRA 2YKPA 5H9EJ 1HPZA 3CSKA 1OSCA 3OR2A 1YG0A 1IBKF 2LQ9A 3OTOJ 2CZ4A 3D28A 1XR5A 2JEIA 3QJPA 2GQQA 4MTPA 1N6QB 2QL7B 4HHHA 1QDUB 1HWUA 2ROGA 4W90B 1RAGB 1WSRA 4OL8A 1CQMA 3TZZA 4PQUA 1TL3B 2QA2A 2BJ8A 4Y2MA 3H2LA 1IM6A 4B3SF 1YJVA 4D3HA 3GYGA 1HR0J 1CC7A 2HS4A 3DRPB 3UO0A 1PJ6A 2C42A 2UXDF 4OLPA 5KFQA 4OX6A 4B3OA 5E3PA 1FE4A 1HNZJ 3T41A 3RBDA 3QLHB 2GMHA 4R5PB 4R8UA 1FTCA 2KFNA 3H5YA 2DGWA 4YP3A 1YJUA 2PE8A 3M05A 4FNIA 2D9PA 2M8DB 2VA3A 2DYAA 5LOQA 2MPUA 4JI6F 1HIYA 4QIFA 3RR7A 4F50A 1XQIA 4NL5A 2VD3A 3QT5A 3UDEA 3M8QA 4WP3A 1APSA 2LDYA 5IT9Y 2FD2A 2FY1A 3THTA 1HMVA 2CPEA 1YRUA 2LMIA 4DMZA 1JK9B 4KRWA 4CT8A 4NLUA 4DR5J 1WKJA 5E0OA 4X65J 2YBVA 2ZD1B 1TL1B 1HNXF 1KQKA 3MCOA 2W1BA 4NWBA 1H72C 2R2RA 4F4XA 4JI2F 1F6TA 2W2QP 5LXRA 2CG8A 4X4OA 1NB2A 2KN4A 3PKMA 1GEHA 1P9QC 3DXSX 1QVFR 1RISA 1KVKA 4ZCMA 4DL4A 3VAFA 1FKPB 4NLWA 1WI8A 3PW2A 1AROP 4I1TA 1N6QA 2E44A 3C19A 4TLRA 5EN1A 5A8KB 1X4GA 3EUNA 4ER8A 1TL3A 2ZZTA 3DM2A 1Q78A 1U1QA 4DG1B 1XC9A 2KB2A 4CO4A 1TAQA 4LFBJ 4RZRA 3G8QA 1MN7A 1T94A 2HGNA 2VC1A 5ITHA 4Q43A 1S49A 3DRPA 1YBUA 4N56A 4ZPCA 3N01A 3PYDA 3ILOA 4OYAA 1N5SA 3QLHA 4R5PA 4HDGA 4NA1A 3P49B 2F8HA 2I2YA 4ZPBA 2KVQE 3OV7A 3T9NA 5LT5A 2JZ5A 5I3PA 2ZWPA 5C5JA 3GYXB 4LR7A 1KDNA 2OP5A 2HFVA 3TR5A 1KRPA 5DG7A 3BZQA 8ATCB 5RUBA 3DGVA 2WSFC 2VFRA 2FLOA 3EPGA 4J9RA 4HEA9 2DVIA 5IQQA 3SDEA 3ZZ0A 3GJRB 4ID5B 2ZD1A 1TL1A 3M8YA 2W4PA 5D4LA 2BYCA 4O44B 3QQCD 4YY3J 1E6VB 3HSDA 4WIQA 2ASDA 3RW7A 3N79A 1B4SA 5B0CA 2ZH4A 1HLWA 1WOOA 4QU7A 4LJMA 3HX9A 4J7CA 5BJRA 3PRDA 1QSLA 4EU0A 2E7VA 3HHEA 2UU9J 2VA2A 2ASLA 3MFHA 1GMWA 1BMQB 1FKPA 2RHSB 3HHLB 2CQ4A 2QT7A 4NE9C 5BR8F 4P72A 2XLIA 4DZ6A 1OMSA 4FXDA 2IRYA 2Q6BA 2KT5A 3NL0A 2D41A 2RD5C 1XR7A 2YNGB 4DG1A 4TXSA 1VBYA 4UOFA 4N8OA 1R43A 2BJ7A 1FVQA 3MM5B 1NSAA 3BDEA 3ZZZA 2YKMB 1AFJA 4PWWA 2BJEA 5LMNF 4QYRA 1FDBA 2QV6A 1RTZA 1H7XA 3WC2A 3GJSB 1N56A 3S6EA 1B0VA 2ZH9A 2GIRA 4CM2A 2FVSA 4C8OA 2R9LA 1TR0A 3Q89A 2ACMA 4KHPF 4GO7X 3EGWB 4FXWA 2XO7A 2B43A 2HVIA 5KFJA 4ID5A 4C11B 3OPKA 2I0XA 2QLJB 4O44A 2RS2A 1VQNS 1E6VA 2DEJA 2HK2A 3HVRA 3SFUA 2AZ1A 3CDBA 3DN9A 3SCIE 3ZXWA 3D68A 3L4BC 1C1BB 2ATCB 5KFXA 3MOJB 3F73A 3BSOA 2JL9A 4F7VA 5ETVA 1O51A 2XMVA 2BM1A 2F65A 1CJKB 4JI1F 2HWTA 3ELHA 3QSIA 3FFIB 4NLTA 4OJ1A 3HHLA 2HMIB 2R8GA 2QA1A 3LP0B 1P8GA 3LPEA 3VTIA 2QRRA 2E66A 4PG4A 1C2PA 3CDAA 3PR4A 1B99A 1F3FA 4OZLA 1VYAA 3FMBA 2R8HA 2C2ZB 2YNGA 1YZ6A 4ERDA 2H51B 3MXHP 1TUVA 5AE1A 2AJ0A 1RLCL 4N5SA 3FBBA 3MM5A 5E3CA 2R7TA 1YJNS 1WORA 1VIOA 2CPJA 1S6UA 3QIPB 5IWAJ 2YKMA 1FVSA 4A48A 2NSBA 4DF8A 4NLPA 2XMTA 1HWJA 2DR5A 1F2HA 4X4TA 5HVHA 2VBYA 2ZVSA 2N4DA 1LXJA 2XWYA 4B17A 2IA6A 4RNOA 2XSFA 1RBOB 3IBFB 4LF6F 3K0JA 4WTYA 4WYLA 1DQ9A 4C11A 4USTA 1YDLA 5LM7E 5A76A 1TK0A 2OLWA 2QMXA 2QFJA 3T1YJ 3N6LA 2Z2MA 4HACB 1C1BA 4PPZA 2YH1A 1JNZB 2J9DE 1NDPA 4TN2A 4FYXB 2KU7A 2QLWA 2YWEA 4KBIA 1P27B 3MTJA 1FDNA 1FFGB 4ZP9A 3FFIA 3MPVA 1S10A 3OFGA 3Q2TC 3FSIA 4JI4J 4MYUA 3KMQA 3LP0A 1RAAB 4FXVA 5J2MB 3HO1A 1Y4ZB 1RTIB 2VPZB 2MQLA 2R7SA 4O3PA 4UZBA 1FDDA 2AJ2A 3OD2A 2VQFJ 3CCLS 4OZNA 2RQMA 4DV1F 1H0HB 4J91A 2HVEA 2R3VA 2F8EX 1BLUA 3QIPA 3D54A 3GFYA 3HZEA 2MEWA 4NCGB 3V6DB 2YPZA 2WSEC 2DNLA 4NXMJ 3I96A 4RPFA 3SQOP 1U7LA 5MAOA 3V4IB 1KP6A 3K2YA 3EXCX 1NRKA 1YITS 3I9ZA 2DB1A 3QPIA 4DLGA 1S1XB 2J9CA 1DQ8A 1MW7A 4EUVA 1WNEA 4HI1A 5GAHU 3RAMA 1X5TA 2DGTA 3FSXA 3KHHA 5JJBA 4PZVA 3QT7A 4DS5A 1M5VC 2D3UA 2F1FA 5J1EB 4ED7A 1RUSA 1DURA 1RWVB 4ICLB 4W98A 5CH7B 4HACA 4CQ1A 2XHCA 2KRRA 4OYPA 4B3SJ 3MEEB 4KPCA 4NCBA 2CJBA 3BR9A 4P7TA 4M95A 5GADU 4X66F 1NKBA 3IGVA 4LVOP 4ED2A 2HHUA 3BSAA 3QIDA 1B0PA 4B3MJ 4P73A 3GFZA 1T7PA 4CLWA 4C0OC 3GILA 1Y9OA 2ATLA 5J2MA 2VH7A 4FKXA 4F8RA 2ZVIA 3AD8C 2IHR1 1RTIA 2HHPA 4JI6J 2Z4PA 3HD2A 3W5ZA 2HAIA 2BR0A 5KFCA 1NU4A 1WG4A 2K06A 2C2EA 3OTEA 4I69A 3L7OA 1K0TA 3R7SB 2HFOA 4OHVA 1YRXA 3GIIA 2FB0A 4KYZA 5IV3A 3WQPA 3V6DA 3R7NB 4QWEA 4A8XA 5D6GA 5HQMA 3HKWA 5KFBA 1F5CA 1M1KT 3HKZD 3V4IA 3K5LA 3M2UB 5KFWA 2G4BA 4A8YA 5J2PB 1S1XA 2B4UA 5KG2A 1Y11A 2JFDA 5DDPC 2L3MA 3RJMB 4UY8T 3M8WA 3BS9A 4K59A 3ULHA 1VQ6S 5J1EA 1FD8A 4UZCA 2GC8A 4ICLA 1FRLA 5F8GA 3GCWP 4BHQA 3A4TA 5D4PA 1YJRA 3W1YC 3P5TL 3MEEA 4C7QA 2MY8A 3DLEB 2ZE2B 2LQJA 2VPWB 4ES3A 1Q53A 2WVCA 3P4UB 3VGUA 3TAMB 2KHCA 4FPIA 5KFZA 3HM9A 3E01B 2XM3A 2ZOGA 4CLPA 3O1LA 2PEBA 2A1BA 3I82A 3KNGA 4H4OB 1VK3A 3KLGB 3R5AA 5EWFA 1S57A 1S9GB 3DKDA 2D7SA 3ITHB 1HARA 2HQGA 3K57A 4KKOB 4DFJA 2L9DA 2HKEA 3MMCB 1TU0B 2W7PA 4NLVA 2FJWA 1RWUA 2JEFA 2RF2B 3RB4A 1VRQC 1N54B 4NZ0A 3D6FB 2KRBA 2HHSA 3NAHA 3AHPA 2DGXA 1P1TA 1ZOTA 1FF2A 1P9YA 3NGTA 1F1BB 1R27B 1SJFA 4A8SA 4LFAF 1OWXA 1YX2A 4F4WA 4DR3F 3D0GE 3CMQA 2RKIB 1D09B 3M2UA 3R7BB 2VHGA 4KHMA 2W7OA 4ECWA 5J2PA 2CA9A 4D3GA 2XBPA 1LOUA 4Y3CA 1D3WA 4DX7A 2IY5B 4B02A 2V8PA 2GAGC 3BJYA 1NNDA 4LBHA 4F4KA 1LWEB 5ETMA 1FFWB 2FVRA 2Z56B 3CC7S 2UXCJ 2QLXA 5BR8J 1H2TZ 2BKOA 5E3AA 4IR9A 1JXLA 2IC3B 2KDOA 2YX1A 5K8MA 2ZBQA 1HBNB 3DLEA 4GKKJ 1Y7PA 2ZE2A 2IJFA 3EXYA 4MIBA 1HHTP 4W4MA 2KFYA 2VG5A 5KFYA 5HQLA 3TAMA 2B4PA 1NZ8A 2M88A 1NEEA 1PILA 1FEHA 4KGZB 4O3NA 1FJGF 2J0XA 2AHOB 3E01A 1JLGB 4Y2AA 5LMNJ 5HK4A 4BWJA 3M9MB 4H4OA 4MYTA 3RZAA 4HHJA 2E5LF 3KLGA 1S9GA 3ITHA 3J81Y 2H1YA 3VAIA 4KKOA 1KQGB 3C46A 3NGSA 5KT6A 2H9ZA 4MIAA 3MMCA 4CWBA 4B3TJ 4O23A 5DDRC 3LO3A 1VIXA 2RF2A 1N48A 4CH7A 2R7VA 3HFKA 2V8VA 4IFVB 1FX4A 4ECVA 2HLTA 1JMTA 3HSGA 4DR1F 1KN6A 2POKA 4LF9F 1WHVA 4RUHA 2AEJA 2EC0A 2RKIA 2XZDB 2OELA 1NJXA 4MJKA 2JC0A 3H4BA 4BBYA 5GMDA 2PMZD 1WHXA 1SBRA 2W8LA 4I56A 2FUG9 4N8NA 4FBUA 2BABA 3J80U 5J2QB 1ZZFA 2JNJA 1UZHA 2HWHA 3ILIA 5CYQB 4AL5A 1LNQA 1LWEA 2PFDA 4UOGA 2K2PA 4A8OA 2MKIA 2VPXB 4KGKA 2IC3A 3MFIA 2XZWA 2FVQA 4QIVA 4P2XA 4CO1A 1FFSB 1HBNA 3I5AA 4BC7A 3UCUP 5JVGQ 4RU9A 1EP4A 5EHHA 3DLLQ 1ACMB 1N36F 3FSYA 5A8RB 2VV5A 4ZMMA 3UNYA 2AGOA 2V67A 1U2CA 3UVJB 2OKQA 5KFFA 1JLGA 4J90A 4P74A 2LP4A 2DRAA 1NSQA 2ZM6F 3QNWB 3CB4A 1HQUB 1RSCA 3HFVA 1SJ4P 3KLVA 3TX0A 4DV5F 4M63A 1V3SA 5GVQA 3A3NB 4I4BA 1RT7B 3CWJA 5F8NA 2LU1A 4ZPVR 4A8KA 4LF6J 4IFVA 3HZGA 3VGVA 3KUGA 3R2DJ 2C2RA 1BE4A 5J1NA 3UPFA 1HW8A 1WACA 3K5PA 2RU3A 2F8MA 1U6ZA 2H5JB 4OV6A 3FBFA 2JH3A 1VS3A 4Y34A 4DSIA 1GTEA 1BWVA 3PIPQ 2B7BB 1LWCB 5E33A 4OI0A 2ABYA 2SXLA 1FK9B 4TQRA 4LF4F 4O3SA 3PW7A 3D1QA 2QEXS 5HMWA 5J2QA 1WC4A 2PT0A 2CNOB 3A1YG 4IFYB 5I3UB 3R6LB 1VOMA 5CYQA 3DLKB 5KG0A 1BQMB 4QYZJ 5FJ4A 2B51A 4LF1A 3GIKA 1RJJA 2R4FA 1RHMB 4KTQA 1SH0A 1GMUA 1UA0A 2MSSA 4LRFA 1RWWB 2DD8S 2MJNA 2DNNA 4YR2A 4ZP8A 1B0TA 1VQ5S 5IT4A 2YKAA 1N34F 3H98A 3GE9A 2ROPA 5A8RA 3GP9A 1GH8A 1B3TA 3UVJA 2C3PA 3H2VE 4ELUA 2OEJA 4UY85 2C22A 2AMCB 1X7VA 2ZNYA 3ONQA 2WONB 1TK8A 1FHTA 1JB0C 1HQUA 2NCKL 5KG4A 3T5LA 2QC3A 2ZUGA 5L38A 3MF5A 3CUNA 1Q7YT 1AA1B 1RT7A 1QD1A 4URQU 4H4KC 4YDXA 1DARA 1RBLA 3ENAA 2FVCA 3QZ7A 2WW4A 3NGRA 2M52A 3P6YC 3M2VB 1IUJA 1PCAA 2MY7A 2MQ8A 1H6KX 4Y0FA 3PW5A 4P52A 2QMUB 2PEHA 3DFEA 3FCWA 2GCFA 1K47A 1LWCA 4WXOA 4NEZA 2FLLA 4DUTA 2X7IA 1WTFA 1FK9A 2A2CA 4DL6A 2W2MP 2HHHJ 4IFYA 5A6PA 1DZ5A 2J0QD 5I3UA 2ZZMA 4V19J 3DLKA 1BQMA 4RX6A 4LQ3A 4YOEA 4S0MA 3U1MA 1VQ8S 2C2KB 4DZDA 1B64A 3RYLA 5G0RB 4DPTA 5GAGU 2GO9A 4ID8A 1EARA 3RGIA 2OPQB 1SQEA 2J0SD 1S97A 4R0JA 2W7AA 2HFNA 2M9KA 4PG5A 2U2FA 2GO8A 5KFOA 2VICA 1HBOB 2WONA 3WDOA 4DS4A 2YX4A 4IR1A 2HZVA 4ZLJA 1RTJB 2FJXA 2OPSB 3CDUA 5F9LA 4U9RA 3EMTA 4DPXA 5CA5A 2F4VJ 3W62A 1JIHA 3KWMA 2X1FA 5AXLA 1KC8T 4YS2A 3GMGA 5LSLA 4XPCA 7FD1A 2NREA 3H4DA 1IKXB 2LFVA 4U8VA 4JV1A 4UOHA 1LEOA 2FJAB 4ES1A 3UE2A 4DV6F 3M2VA 2B6AB 2GMJA 3I5CA 2VASA 3LF0A 2F3JA 4ZS6A 3CJKB 2KYZA 5FLXY 4DFPA 1M5SA 1GT8A 2K7JA 4DV3F 5BYSA 2DNRA 4K2JA 1JXEA 2B9XA 2UP1A 4EYHB 1NUEA 1X9WA 4F25A 4EI2A 2BBEA 3HHDA 4HDHA 5CD4H 3HXMA 2H65B 1TKZB 4ZLNA 3VZHA 3D4JA 5DLGA 3F44A 4NEYA 4GKJJ 4LR9A 3B82A 1ICEB 1URRA 1MWYA 3C66A 2XMMA 1U1MA 4DXLA 5CD4A 4H54A 2MJUA 3IR5B 3MUVP 1KHWA 5G0RA 3IN5A 3RB3A 4NA2A 3K7RA 2OPQA 3OR1B 2Y0SD 5F8HA 4U7UK 5F41A 4ZLPA 4RJVA 1HBOA 1FRJA 4ZHRB 3R5BA 4PAAA 3KK2B 1RTJA 1X60A 2OPSA 4O0NA 3E8OA 3K58A 3TW0A 1EHWA 2CDQA 5L8RC 1OO0B 3UD3P 2VJUA 3MEGB 3HF5A 1KFDA 4DV4J 1T11A 3KLEB 2XMAA 1IKXA 3DDIA 1N33F 2OEMA 3MWBA 4JI8F 1NHUA 4IQXA 3OVBA 3SI8A 3UI3A 2B6AA 2HBZB 4QWDA 3BYRA 2DH9A 2DO0A 3CJKA 2X1BA 1NPPA 2PI4A 2IBKA 3IAM9 2FY8A 1T02A 1QE1B 5D0HA 3GV8B 1IKWB 3J7ZT 1Z2ZA 3KLHB 3BQ2A 2EG1A 1VHIA 1S0MA 3ET6B 4Z2XA 1TKZA 3UR3C 1XN9A 3POTB 4C9DA 3WHIA 3L3CA 3BKUA 1TQLA 1WKKA 2DXFA 2ASJA 2DEIA 2EFVA 1L3TA 4U6PA 2XGQA 2ILZA 3DI6B 2OO4A 4LMZA 4KT0C 1CJTB 3Q0AA 3G9CA 2VQEJ 1TP7A 4ZVRB 2GMLA 5L1IA 3OR1A 4DF4A 2ZC4A 5KFDA 2F40A 3A8KA 3S1TA 4ZHRA 4IRKA 2K3IA 3OL9A 3PX6A 5H9FJ 3KK2A 3W9JA 3QSYB 3V4MA 5F3ZA 5J2NB 2XS5A 1U25A 5E3RA 4K0KF 3WIVA 1Y00A 1VRUB 3GIRA 3MEGA 2RILA 4YR0A 2EI5A 1DJ0A 4M5JA 1ZA2B 3KLEA 4I2QB 4F3OA 3TUJC 2E1RA 2M2BA 1AT1B 5MLCV 5CYMB 3MR7A 4WP8A 4KB7A 1A9NB 1NK5A 1RA6A 4C8KA 1UWAA 2QLBB 3PEHA 2WBMA 4AQYF 5A0YB 4EBCA 2A2DA 3D0HE 4RUCA 4EEYA 5KFVA 1HI0P 2LCWA 3I55S 1QE1A 2HRUA 1IKWA 4NLRA 2F4FA 3KLHA 1CULB 1R8BA 3I4PA 3CW2C 1DQAA 4LF7F 3ET6A 4USMA 1KKHA 4F02A 2IVFB 4YEAA 2DHXA 2E9TA 3POTA 7AT1B 1N52B 1PYOB 2HZCA 3IM8A 3GONA 5H9EK 5KFPA 1T95A 1RABB 4QW9A 1LK5A 2DR9A 3DI6A 2XYPB 4ZP6A 4OI3A 4WWSA 1SKUB 1CJTA 4DV5J 1LWXA 1RACB 5D0EA 2O01C 2HVZA 5B0FA 2HYIB 4FF2A 4JB8B 3B78A 4J9PA 4V1Ak 2VC0A 2CQGA 2BMBA 1ZAWA 4Y28C 2AD9A 3R9LA 4X62F 3KNAA 5KG6A 3TVZA 2FPHX 4HH0A 1Q5VA 4JI7F 3AFGA 1FNMA 1VQPS 3P5BP 2IDEA 5J2NA 2N7CA 2X3GA 3M6VA 2J9EA 1S12A 1VRUA 4TY9A 4O3OA 3MR3A 4O3RA 1IR0A 1L3SA 3FEXB 3TRGA 4I2QA 4DPUA 1FRHA 2GQCA 3BBBA 1Q7LB 1IR2A 2X51A 4YB7A 4ALZA 5CYMA 4U8YA 5IXUA 3NXZA 5B0GA 2YWKA 3LP1B 4DSFA 2V34A 3R27A 5A0YA 1HKAA 3AOCA 2D69A 1IJEB 1VJWA 1X4BA 4P9SA 1CULA 4LIWA 3J7YU 3S8SA 1SPBP 4WPAA 3BDPA 3PYGA 4F26A 1CLFA 4ZKAA 4EO8A 3IR7B 1M5KC 4B9VA 3I4HX 3IAS9 3HVWA 4K7QA 3PV8A 3OTOF 1WSVA 3NNHA 1OY8A 4AT1B 5IT0A 3LALA 1KBRA 1R0CB 2MMYA 4FKYA 3G4SS 4K8RA 3BKTA 1RU1A 3ZTOA 1Q0NA 2YVSA 4HYKA 3J7AN 3DDNA 2LLZA 3HK2A 1T9WA 3CJ5A 1FD2A 5DDOC 4DSEA 4DR6J 1GTHA 1N0UA 2D1CA 3FEYB 2I6WA 1HR0F 3CCUS 4CP5A 2PIIA 1VDHA 4ZVUB 4ED4A 2XMJA 1NK0A 4IO9Q 4C97A 5L1LA 1GXTA 1GMVA 3AD7C 1UPMB 3PRVA 2VODA 5HLFB 1NK9A 2HFSA 3LP1A 2IVMA 1V3RA 1T9YA 4C3MA 3N5BA 3H25A 1S48A 3P45B 2VDHA 3Q8QB 3JAMY 1OY6A 4FF1A 4QZVB 3CPWR 3ETMA 3PG9A 1HL6A 3ZFVA 4N47A 4DR5F 1PKUA 1NPKA 1RWMB 1BC6A 1IWAA 4X65F 2N7YA 4WFXA 4GVLA 3T3FA 1MG7A 2DHAA 3QWUA 2DGQA 4HT7A 3ENVA 2MZSA 1FRIA 4PG6A 1UJ4A 1GMWD 1YJ7A 1AB8A 1SC4B 5E5NA 3QJLA 1XIQA 1Q8KA 3CO9A 5DGBA 2UUCF 2XMKA 4BLGA 1RT5B 4DQPA 1FCAA 2IM3A 3J7Z5 3MM8B 3BREA 5BYQA 4QPTA 4CRJA 2BJ1A 1ZS6A 1S77D 2MYFA 2WTFA 1EETB 2FDNA 2Q66A 1S4EA 2J7WA 4LBPA 4JUZA 4J9VA 1GQEA 2BACA 1UJ5A 4LFBF 2MKJA 1U1PA 3PX0A 2VZ9A 1AYEA 1E6YB 4DDFA 1PJ5A 5CHCB 4OZJA 3H42A 2LYVA 2J5AA 2CPZA 3FBEA 1RTHB 2D74B 2ZFHA 4KR0B 4AYBD 4USWA 2XNQA 4DFKA 4DV0J 4WZMA 1J27A 4GC7A 2GJ2A 2R8JA 4C4WA 5KG1A 1BWEA 3FEZA 3AB4B 5HLFA 2G2YA 5HAOA 4NRUA 3KK1B 3IG1B 5CYJA 4OZ1A 3G82B 2CQ2A 5AXKA 1RP5A 3W65A 1T3NA 4YFUA 2DGVA 1FESA 4V19X 2DHSA 2I1RA 4XAKA 2MQPA 2CPXA 2MDAA 4J9NA 4K4VA 4K5RA 1L5UA 1VJQA 1NJZA 1ZBTA 2ZDPA 4KV8B 4YY3F 2DR8A 4FBTA 2V5HG 5IT9U 3CO0P 3W64A 4JBCA 3IRXA 2JFKA 1MWQA 1RAHB 3QBCA 3HHLD 1Z4UA 2E1CA 3M1VB 1Y0HA 5DZ6A 5KFKA 2G0JA 3L7UA 3GIJA 5ETTA 1HYSB 2UU9F 2CWXA 2BUNA 2XULA 1RT5A 1FXRA 2CYYA 2HQCA 1VQ4S 3KDNA 3MM8A 3MECB 3OTCA 3IFEA 1TVRB 1N33J 4B9MA 4A8QA 1EETA 3AJDA 1D0EA 2I38A 3M32B 4ZVSB 3W5XA 1SH3A 2ZWOA 2FHOB 3QGHA 2I5JB 1NK7A 1E6YA 2EFOA 4N41A 3MI7X 1RTHA 4LR8A 1D1UA 3BPDA 3TQEA 2V2VA 3RG6A 2B7CB 3A3PB 4BCAA 2KZZA 1U1RA 4NMLA 4UW2A 2YWFA 1OYEA 4IRDA 3KK1A 3IG1A 3JSRA 3G82A 4YR3A 1O5JA 2EW9A 1CJUB 4TY8B 1J2VA 4J9KA 3PYFA 3ZNJ1 1VK8A 4MT1A 4B08A 3RRHA 1KR4A 2DNHA 4KH1B 2NPFA 4RNMA 4Y00A 1GAOA 4KV8A 4Q8EA 4OQJA 3GYNA 3IS9B 2IJNA 1NSKL 5HI7A 3NWRA 2BRKA 3DXBA 5AJ3J 1UVIA 5THWA 1M5HA 2AEFA 5HSPA 3M1VA 5HBMB 4USIA 1HYSA 4ZVFA 2C3OA 5LSRA 4FP9A 3BN7A 4JV5J 2AW0A 5KT5A 3MECA 2W4CA 3MPDA 1TVRA 1WOSA 1HD1A 1DRZA 3C16B 2NZCA 3JQKA 4N77A 2MLXA 3BH7B 2IDLA 3JQJA 2LEAA 3TARA 3M32A 3U1NA 3C6UB 1LXNA 3OUYB 5D0RA 2I5JA 4U67Q 5KFNA 3PVXA 5ETLA 2HHVA 2KH9A 3W63A 2Z30B 5IWAF 1BHNA 3B8HA 2G13A 1JNRB 1HNWJ 4J9SA 3OVSA 1SL0A 5F9NA 1NJWA 1Q79A 4PEOA 2X3DA 1CJUA 4CM0A 4QBUA 1U0SA 2W01A 4TY8A 3NEKA 4C2MA 2IAJB 3MAHA 4IH6A 2XLKA 2A18A 4F3QA 1VQ9S 4ZJOA 4XDDA 4WKYA 3NGKA 1VLOA 4EGLA 2ALZA 3H7HB 1YSJA 1LV5A 4G1IA 4K50A 1NDCA 4RW8B 4ITSA 1VBZA 4OIXA 3EDQB 2F9DA 2DJWA 3IS9A 1R8CA 1XNQF 2CJKA 4PQUB 2DNOA 4L75A 1Q16B 3UNGC 5LL6d 1R8AA 1NMEB 1KQFB 5HBMA 2HIYA 1EJ7L 1URNA 4Q44A 3BO4A 3R5CA 3Q2SC 4LQ9A 4G6VB 4JI4F 2KFZA 4P2SA 3C16A 1X9MA 3LP2B 2V4JA 1QM9A 3C2PA 4LF5F 1X31C 4ECYA 3C6UA 2E29A 2R8IA 1W7WA 3OUYA 2VQFF 3RB6A 1FE0A 3D0IE 4UT4A 1MN9A 3EGNA 4MFBB 3SEOA 3IRWP 1R3NA 4CO2A 4QCLA 4AFFA 2DCLA 1S9EB 4F4YA 1IM4A 1U0HB 4P6QA 3N28A 3FVYA 2FQQB 2ZH3A 2Z58B 4NXMF 1UEKA 3A12A 1XWLA 3RR8A 3CEDA 1RAFB 3SMZA 1SKSA 1WKLA 3JB9k 3NGDA 2H4YB 2IAJA 1UFLA 1REVB 1F5AA 3ISZA 3AXKA 1FJCA 3AAWB 2W2OP 2OD6A 4DL5A 2B0GA 2P9EA 1QAYA 5ETOA 5LMUF 3DRRB 4IDKB 3RUBL 2V4RA 4ANEA 4RW8A 5L46A 2C2MB 5CABA 2KL8A 3CCSS 1S4FA 4WKRA 2Y1RI 3EM1A 3THPA 5AXMA 4DL3A 3Q8PB 1HWLA 4E2FB 2OTLS 3TEHB 1BXNA 5K8PA 1T9VA 3C8YA 2DITA 3DM2B 2BW2A 4P2MA 2RMLA 2Y1IA 3GLJA 2XY5A 3DOKB 7FDRA 2IMWP 2RQKA 1H2UX 3I5BA 2Y8YA 4B3MF 1U4BA 2NXCA 3HSJA 1NH7A 4URGA 1I6JA 3LP2A 1TFYA 3JXOA 2CUYA 3CDWA 1KSPA 1PYTA 4MFBA 3MUMP 4XK8C 3TUIC 1CVJA 2KI2A 1NDLA 1S9EA 1U0HA 2VFSA 1NCLA 3D1OA 3G86A 3ZZUA 2LXUA 3RBEA 2M70A 5KFTA 2GIQA 3KLFB 2R2UA 4O4RA 2L9NA 3SDEB 1UA1A 2K1RB 2KM8B 3EDRB 2YNFB 4RUAA 1H3DA 3OTBA 5JXSA 3NBPB 2GHWA 1RWNB 1ULRA 3W2WB 3QAEA 4TYAA 1RQ0A 1H74A 3GPAA 2QGFB 1QVGR 3VV2B 3OFEA 1YGYA 4LUBA 1JWWA 1REVA 3J7A1 2AKWB 1NKCA 1PYSB 3BBCA 2OSRA 4JV0A 4YB6A 1YBAA 4ZP7A 3SV4A 4DX5A 5IOLA 4F4ZA 1IKVB 2UUTA 2UUCJ 2DGSA 3DRRA 2V63A 1NXIA 4IDKA 3KHGA 4WJBA 3QJJA 4PABA 4BS2A 1R8HA 2BV3A 3MEDB 2C2NA 1VHFA 1WF2A 4TQSA 2L9WA 5SZTA 3O44A 2BQRA 4OI2A 1AFIA 3QAUA 3VALA 3MR2A 4MIWA 3DOKA 2BZ2A 2AYBA 2YQ1A 1VISA 2ZHOA 3TX8A 2QA4S 1VR6A 1VGYA 3TWZA 3H5XA 3M6XA 5E7OB 2AGPA 3P96A 2VBZA 1CEZA 3B6BA 3BF4A 4LRDA 2CPHA 4OZ2A 3LWLA 2HRTA 3EVWA 3GV5B 4NZ7A 4P7VA 2EK6A 3T9ZA 2V0NA 2JEGA 3QFWA 2CJYB 2DBBA 1N5QA 2M5YA 3GZ7A 1U24A 4EO6A 2RQ4A 3KLFA 2HAFA 3Q8UA 3CJRA 2K1RA 2YNFA 4HVZA 5KTQA 2XCPA 1FWKA 3NBPA 4DCPB 1DFDA 3W2WA 1J5OB 1CBKA 2FJEB 2DXDA 4CLZA 1ZM4A 2IVYA 2ZEJA 1EQ0A 3DNCA 4F67A 5C25B 2W9BB 2WVBA 2LU2A 1W26A 2XS2A 1IKVA 4Q5VA 4K4XA 4A8MP 2AJFE 1B7FA 4LF8J 3D67A 3RTVA 3BO3A 3AQOA 3OLAA 3MOZA 2UXCF 3MEDA 3GV7B 2VG6B 2MKYA 5GMKa 3ETOA 3Q8RB 3NGUA 4CTAB 2I8EA 4OV1A 3KUEA 4M5NA 4GKKF 1QTNB 2BX6A 1YLXA 3EZOA 4U7UD 3DU6A 3GQCA 1I94J 3N6NA 1OYDA 1YHQS 2ZUAA 3GU0A 2DTJA 2J7UA 5ETPA 2HVDA 4K4TA 4RL1A 2EKYA 2Q79A 1RADB 4ZPWR 5M2RA 4K4YA 2KTQA 1V9OA 4B3TF 1X4AA 2XYGB 2ZDOA 2HG4A 1PO6A 2MKHA 1M5OC 2XTJP 2FTRA 4RWXA 3W66A 2KYXA 1PAUB 2J8SA 2N82B 2AGQA 4DL2A 1RTDB 1J5OA 2BJDA 3EZ5A 2N3LA 3E51A 1U49A 1IVZA 3DMJB 4RW7B 3EWGA 2RNEA 3ZO7A 5IZHA 4JI0J 4DUZJ 5C25A 2W9BA 2FGOA 2YX7A 1XMOJ 4J9OA 4PUOB 4Y2CA 5DM7Q 2YH0A 3UR0A 2EVZA 4QYZK 4K4ZA 4CLFA 3TJ9A 2W9CB 2MLYA 1GX5A 3VQTA 4RWWA 1WC5A 1M0SA 2VG6A 1U45A 1WWHA 4FF4A 3W8PA 1TUWA 3SZ2A 4CTAA 4I67A 1U1LA 4UF4A 2E7XA 3N6MA 2CZVC 2QSFA 5L1KA 1AXQA 2DPJA 3OFHA 3BGOP 4ZITA 3DLHA 4DX8H 3GWCA 4ILRA 1GFWB 2VG7B 2YKOA 4AE5A 1WTBA 3QGGA 2PSZA 5I42B 3MPYA 3CCZA 4AL7A 4E8UA 1UL3A 3ILLA 1SJRA 3N5FA 3MURP 4PCQA 1KLMB 2CWKA 1FKOB 1WEZA 4Q0BB 5KFHA 1SC6A 4WFBQ 2N4CA 1UW4A 2Z2LA 3VGSA 4U95A 3OXLA 1RBAA 4I6WA 1ZAXA 2NYHA 4L6V3 4ZVOB 4KPYA 1B7YB 4RUBA 2V8DA 2VJVA 1KOHA 3E2EA 1C4AA 1FNOA 3FZBA 3IBCB 5F8IA 1U8SA 4OZ0A 1JLAB 3UN5A 2P9GA 3ZTQA 4XO0A 5AE2A 1S1VB 1RTDA 1RAIB 3WX4A 1S6QB 5A2QU 3PR5B 1Y5NB 1J5EJ 4NLOA 2OUGA 3PCOB 1S0NA 2EXUA 1XNQJ 3DMJA 4RW7A 4DR7F 5KT2A 4ZVGA 3PNIA 2ZJPQ 4DPOA 3LPYA 3CC2S 2O66A 1YTYA 1FRKA 1WDTA 4PUOA 4NLXA 2APOA 2E5IA 4RW6B 4KH0B 1XNRJ 4FF3A 4KE5A 2ZZNA 2W9CA 1RT4B 1QY7A 1EKSA 1SB6A 3CD0A 1VLYA 1Z2LA 3M8RA 3PW0A 4DN0A 2CQPA 1OPZA 4LF5J 4TVAB 4I0WA 3HMJG 2N3OA 5KFMA 1EQMA 2PD1A 3JSYA 5B0DA 2BEFA 3UFCX 3AJ2A 1NK8A 2WCXA 1FJEB 3CDEA 2V2ZA 3F0NA 4P71A 3R1HA 4C6AA 4WK3A 3HI9A 1N5VA 3HP6A 1QJHA 1HFEL 4NPOA 4DR2J 2VG7A 2W2PP 5B0BA 1WG1A 3LA0A 5I42A 3PHEA 4I2PB 5EWGA 2B9YA 5L9NA 3QGIA 4UUWA 1RA7A 2RUGA 4PKDB 4QOTA 3SXLA 5B0AA 1R89A 1KLMA 1Y5IB 2CVEA 1FKOA 1D8YA 4Q0BA 5F3TA 2ADCA 4UQGA 2BA9A 3BPSP 4DSLA 1L3UA 1G1XA 4KQZA 5LMUJ 2LDIA 1GNKA 5ETRA 3IMQJ 1SKWA 3VHQA 4MH8A 1S59A 1JLAA 4AD6A 2O5DA 2OMOA 1S1VA 3NG8A 3BGFA 2PI5A 1S6QA 3K17A 2J6TA 4EZ9A 1VQ7S 3DRYA 5K20B 4CO5A 4IOBA 2EEYA 1VMBA 2UV8A 1S72S 2QL5B 2QLFB 3HHLC 2PGCA 2E1MC 5M2PA 4NCAA 2HHHF 5ETNA 4RW6A 1N4LA 3TOQA 1CPZA 5FDLB 5I3QA 1RT4A 2WVEA 1R6YA 2FYXA 4OI1A 2CJAA 4QR2A 2XQCA 3N0VA 3FNNA 4Y2KA 4B3RJ 5HROB 2LEPA 2IM1A 1FJ7A 5H1SV 3ZZOA 5C24B 1AUSL 4KO0B 4ECRA 2CNNB 3NRBA 2A0FB 3IA0A 4RBTA 1EB0A 4IOAQ 1PJ7A 3M2RB 4I2PA 4ZK7M 3IWNC 1CJVB 5F0WA 3TJAA 3CJSA 1NPRA 3JYTB 5B7WA 2XC9A 4YDDB 2CADA 4ENOA 3IP0A 1UZDA 2F4VF 3M6UA 2W25A 3TVKA 1ZZNA 1NK4A 3Q86A 2WB1D 2DR6A 4UOCA 2Z2YB 4GMKA 5AT1B 4HTIA 5GMEA 2EBEA 3RRKA 3HCXA 2ZH8A 4ECZA 4QQBA 3DOLB 3T1AA 4DJBA 2PMWA 4USHA 4ANCA 2VFVA 4DOZA 3U02A 2Q6CA 1K1QA 3C14B 1SQGA 5T7LB 2GV1A 2DIVA 3O5TB 3H59A 2IRUA 1U48A 4JOUA 1YIJS 1R6VA 2P9CA 5HO4A 1M1GA 2GAHC 2RU9A 2VG5B 4KGXB 5GAEI 3TZXA 1WC0A 3LANA 5FDLA 3SSSA 2P6TA 2AQ4A 2G1HA 2E9ZA 4LF2A 3I0RB 4GKJF 2CJQA 4OX9J 4Z7YA 3NKYA 1JLEB 2RDDA 5HROA 4WXWA 1JQGA 2BRLA 5GAEU 4Y6IA 1YVFA 5C24A 4X64J 2XS7A 3G6YA 4KO0A 5HL7Q 3P8BB 2UZAA 3SCJE 4OYWA 1BD6A 2RT3A 4ZVHA 3WBZA 3G87A 3KJNB 1F0XA 2WW8A 1FXDA 1SJ1A 4F0MA 5H9FK 2HHTA 2HPUA 2LVWA 3AJ1A 4FDFA 3M2RA 4DEZA 3PO5A 4CLTA 1CJVA 3OJUA 1MLAA 1FEEA 2OI2A 3JYTA 3BSNA 2OFGX 1QAJA 5HVFA 2DT9A 3I87A 2AZ3A 3DC2A 2GZOA 2VFUA 2ZH6A 3DDKA 2R7XA 3U7JA 4DSKA 5D15A 4B9UA 2DRDA 4OX8A 4DV4F 3NCQA 4IO1A 2B8PA 4E98A 1UETA 4CNYA 1A6LA 2IA0A 1WELA 2JJ4D 5KFLA 3G6VA 2DNQA 3W9HA 2NR0A 3DOLA 2NQPA 3DCAA 3VVUA 2CQ3A 3R5GA 2M7SA 4MAKA 3VAJA 4ILLA 3C14A 5T7LA 1VQLS 2YKNB 2HGMA 6FDRA 3Q22A 1P6TA 3VCDA 4OHXA 1EP4B 2EFPA 1VI7A 4WK1A 4ELVA 2F7VA 3DGPB 1V6HA 1ZAVA 3UDLA 3ZTRA 1XMQJ 4F36A 2DR7A 3MMAB 1Z1ZA 1T9XA 4KGVB 4XTTA 5ETKA 4JV2A 1IBMF 3I0RA 1GXLA 4M5GA 4EK2A 3ZNUA 1L3VA 2G9OA 1VC5A 3QZ8A 1RAJA 1JLEA 1X4FA 1MROB 3PX4A 3R1LA 2V50A 4I6AA 3IBWA 1IQTA 3EVMA 2AJQA 2DNPA 1KNZA 2Z57B 2VQEF 5IC4B 3NNCA 4QW8A 5KFEA 2WZ1A 1I3OB 1KEKA 4ED5A 8AT1B 3D3CJ 3K89A 3NS7B 4TU9A 2HHWA 1PIEA 1R8PA 1K44A 3OJSA 1Q5YA 4Y2IA 2QFIA 2D3O1 1TMJA 2AYEA 2ZKUA 2Z8QA 3AODA 3WZ0A 1AW0A 1N8RT 3JQMA 2QYGA 1MMNA 3DU5A 1RZMA 4I7FB 2RVJA 1JKHB 1LW2B 4ZOSA 5KT4A 2IBOA 2MSTA 1EIYB 4ZDNA 4ZPTR 1VQYA 1F60B 4OHYA 4MMOA 5K5MA 1NLKL 2LXFA 3ZZTA 2DNZA 2I9SA 5T14A 1U02A 1LWFB 2YKNA 2XB2D 4IG0B 2WK4A 5K8NA 2M3DA 3DGPA 2LQBA 4Z7CA 1BY9A 3MMAA 3QMQA 1S1TB 2OSQA 2HFZA 4JI5J 2EG2A 3KLIB 1U2RA 4E0DA 1OJ4A 4J9UE 1MROA 1OSDA 3CCRS 2FZKB 2RH3A 3EJMA 3RW6A 3T5HA 3QYYA 3V6HA 3NNAA 2NXJA 3TZYA 1FRXA 3PJWA 1VRTB 2RB7A 4I64A 2V9WA 2JSXA 3DRSB 4CLSA 4LBIA 2KT2A 1FTRA 2PA3A 2QG9B 4FZVA 1X5OA 1KQSR 3JS9A 4QJVA 2KJWA 2EK1A 3NMRA 2FZGB 3LW5C 3QATA 5D78A 2AF6A 3ENQA 2ZBRA 3C6TB 1RDRA 4DR7J 4NX9A 2FVPA 2UXBF 3MMBB 4HHUA 3BEGB 3PEJA 4DV2J 3V6JA 2NXEA 4CLUA 3O3LA 4I7FA 5I4MA 1JKHA 2DNGA 3T6BA 3GTYX 1LW2A 3ADAC 3VF0B 5HMXA 3CGIA 2VBWA 3H8YA 1LWFA 4M5LA 9ATCB 5DO2A 2NUHA 2HNZB 1SH2A 2E1PA 4IG0A 1HI1A 4CZCA 1UVJA 2LKZA 3RAQA 1XR6A 3EGVA 1MNEA 4PYAA 2QTWA 1RB0A 4RU2A 4ATNA 2CKWA 2W4DA 1S1TA 1NH8A 2W8KA 2R7OA 2AX1A 1TL7B 2DCUB 1U1NA 4Q7AA 1RLDA 3KLIA 4OZ5A 1Q8LA 4A8WA 3V2UC 2HLUA 1VFJA 2WBRA 5ETSA 3CNQP 1UMJA 5KFIA 2L08A 1D9AA 1TELA 3FQKA 3OL7A 1WG5A 1VRTA 4OYXA 2VKZG 3DYAB 3TP2A 4DUYJ 3DRSA 4Z37A 2E5JA 1SUQB 2FHJA 3HFZB 3TYTA 5EWEA 1AUDA 1O0PA 4DR6F 4ES2A 2RRNA 1XTZA 4RLEA 5A8KA 1Y3KA 3G8SA 3TQ1A 1A0OB 3EVOA 4U96A 1MSWD 1VBKA 2GHPA 2RQCA 3C6TA 4X4QA 4KHRA 3MMBA 1RWPB 2YNHB 1SKRA 2UUBJ 1XEZA 2ACYA 2M0GB 4LSNB 5KFAA 3GSDA 3ZZYA 4CH0S 1UW9A 4NASA 3TJ8A 2H5EA 3KFWX 4YHHJ 2HW3A 1RHRB 4DL7A 4RW4B 3NWGA 4DR4J 3CCVS 1FA0A 4C0BA 3DHXA 4PG7A 4HT5A 2HNZA 3D3BJ 1KVIA 4ECQA 3CJ2A 3PY8A 5HP1B 2WHOA 4OYOA 3MR5A 4NRTA 2U1AA 3SFGA 1TKDA 4W92B 2CXEA 2UUAJ 2UVUA 5T41A 1TL7A 5IM0B 3MHYA 4FPRA 4DQQA 1RCXB 1FWPA 4OI6A 3QO9B 3BYPA 1UVMA 2JX2A 4KY3A 4ED6A 5F8MA 1ZM9A 5DLFA 2B8QA 1ZM3A 1F5BA 4EMDA 1WC6A 2HHQA 3DYAA 2C2OB 4MKVA 4EBEA 1O6XA 1SUQA 3PO4A 4CNZA 1U6FA 3AD9C 4NOHA 3W3SA 4TU8A 4X4PA 4CH1A 3BN4A 2OFHX 3G2XA 4OYZA 1A7GE 4WF9Q 3MMJA 1V3ZA 3IO1A 1FO1A 4PXEA 2R2TA 3R8YA 4HH1A 2CJ9A 2ZOFA 3BGUA 3D7SB 2YNHA 2AJ4A 3UN2A 3THVA 4M5HA 4YQWA 1S79A 4DV0F 4LSNA 5KFRA 2XWXA 5CZVA 1MMDA 1P1LA 1N32J 2HNYB 1Y10A 4CLLA 1TL4A 1UTAA 4CT9A 3OTDA 4ECSA 1OPIA 5JMNA 4CLYA 4DWIA 2QO3A 1VQSA 1TTHB 2W24A 1KLNA 4RW4A 3CF5Q 2RDJA 4WU3A 3H20A 1I51B 2R7RA 1RKJA 3NMAA 2RUSA 1RHUB 1D9DA 2XGPA 5LXYA 3EGZA 5HP1A 4F2SA 4FYYB 4WU2A 3EZUA 3Q83A 3CT9A 1PSDA 4M8LA 2KG1A 3GJTB 2C2DA 3Q8SB 3KHRA 3JAMU 5IM0A 2Y9HA 1FWLA 3QO9A 2UVRA 1RHJB 2J7KA 4MKAA 3M8SA 4QR1A 3VAGA 4UTGA 3FKBA 2QIFA 4YN3B 2NYIA 3TI0A 3EE3A 3CE8A 4X4RA 4YMEA 4JI3J 1DLOB 1IWGA 2AV5A 1RE1B 1CJKA 1HWIA 4HL9A 1MWZA 1RHKB 4M5MA 4DI6A 4KIAA 2VB6A 3T1HJ 2HMIA 4LFCJ 2COLA 3JTNA 3M7VA 1YBTA 4QWBA 1N5YB 3SYZA 2PO4A 1WOPA 3UQSA 2GFFA 1RYSA 2C1EB 1FXLA 5HJYA 1NK6A 1BQNB 3PACA 2GGPB 1T9TA 5CXTA 3H0PA 2Z0GA 3V6KA 5DRKA 1T9UA 1S1UB 2ZOMA 1S99A 3VQSA 4A8FA 5CCMA 2HNYA 1T0TV 1YKWA 1JX4A 2IYIA 1IBMJ 3MCSA 4OZ3A 2WVDA 4GC6A 4IH5A 4NLSA 5GAHI 4DV7F 4FNHA 3L7PA 1NM2A 3HJFA 1ITPA 1HWKA 1SXLA 1TUGB 4MKYA 2QX0A 2BE7D 4ZVEA 2XHWA 5KT3A 2OTJS 1IBKJ 4C8LA 1UP1A 4LRAA 5HVGA 3PJXA 2FGCA 1DHMA 5A8WB 2XCAA 4I68A 4USUA 5GADI 1IKYB 1WHWA 1U09A 5AJ3F 4XIUA 1X4CA 1VQKS 4XPEA 1KONA 4TKTA 2MKSA 2J8AA 2KVIA 2HK3A 4JV5F 5D0GA 1DLOA 2VIHA 1RYRA
chains in the Genus database with same CATH topology
2QEXS 1WF2A 4TQSA 2L9WA 5HMWA 5SZTA 3KHLA 1N5TA 3O44A 2BQRA 5J2QA 2XEXA 2PT0A 2ZHBA 2QE5A 3A1YG 4IFYB 1C4CA 4RNNA 2Q3PA 5I3UB 4B9NA 1VOMA 2KXHA 5CYQA 5KFUA 4OI2A 4UQTA 2O3DA 5D77A 2HVHA 3DLKB 1AFIA 3TAPA 3QAUA 3VALA 5KG0A 2FJBB 3MR2A 1BQMB 2IYGA 4MIWA 3DOKA 2UUBF 2J6SA 2K3KA 2BZ2A 2AYBA 4QYZJ 2QA4S 2ZHOA 3TX8A 1SV5B 2B51A 4RNHA 5FJ4A 3GIKA 1RJJA 1VGYA 2R4FA 4KTQA 1N5YA 1SH0A 3H5XA 2QSWA 3M6XA 5E7OB 5E41A 2AGPA 4F2RA 3HVTB 2NS1B 1U26A 1Q82T 1UA0A 3P96A 2MSSA 2VBZA 2CQHA 1T05B 4LFBF 2V9KA 3AY0A 1T03B 2FHKA 1CEZA 2DD8S 2MJNA 2DNNA 3BF4A 4YR2A 1BQNA 4YHHF 4DN9A 2CIMA 2GGPA 4TYBA 2CPHA 4ZP8A 1B0TA 4CI0B 4EBDA 4QIEA 1VQ5S 5A6WA 5IT4A 2BQ3A 2GNKA 2ROEA 5FIIA 1CQNA 4G1PA 2YKAA 3LWLA 4DR4F 4DFMA 1N34F 3H98A 1HNWF 4X2BA 2G0CA 3GE9A 2ROPA 5A8RA 1S1UA 3GV5B 1S6PB 4NZ7A 4P7VA 3BO2A 2EK6A 3T9ZA 2V0NA 3I56S 1GH8A 3T5JA 2IM2A 2K8GA 4QWCA 2JEGA 2C3PA 3CIMA 2C3UA 3H2VE 5C42B 2CPFA 2OMLA 2WRMA 4NCGA 2UV8G 2DBBA 4ELUA 4UY85 1N5QA 2BVZA 2C22A 3U27A 2M5YA 3GZ7A 1X7VA 3CCJS 1U24A 1G6BA 2ZNYA 3BSCA 2JRSA 3ONQA 4KC5A 2G1DA 4NLYA 3T6JA 2WONB 1TK8A 4EO6A 1FHTA 5F8LA 1SIWB 4RBVA 3KG1A 1JB0C 1HQUA 2RQ4A 3KMSA 1HD0A 1N88A 3KLFA 5KG4A 3T5LA 1IBLF 2ZUGA 5L38A 1C0TB 3MF5A 2UUAF 2K1RA 2YNFA 1VBXA 3CUNA 4HVZA 3IGNA 2PC6A 5KTQA 3H2UB 2XCPA 3BB5A 1FKAF 1Q7YT 3NBPA 3MAQA 1DFDA 1RT7A 1RT2B 4URQU 3W2WA 2GHVC 3UW1A 1J5OB 2AYMA 5FD1A 4H4KC 4YDXA 1DARA 2FJEB 2C3MA 1OQ6A 1ZM4A 1QUPA 2IVYA 2ZBIA 5B08A 2FVCA 4DHVA 2EFNA 3QZ7A 3DNCA 4F67A 2DRBA 2HS3A 2CQDA 5C25B 2W9BB 5A8WA 3CD7A 2ZKTA 2LU2A 2Y1JA 2M52A 2XS2A 3K59A 3P6YC 3M2VB 1TKTA 1IUJA 1JJHA 1IKYA 1IKVA 2ZH5A 2MY7A 5LJ3Y 4Q5VA 4K4XA 3W7BA 1T8EA 1JLCA 1RT1B 4A8MP 2AJFE 1H6KX 1B7FA 3CC4S 4Y0FA 5IFMA 3PW5A 5BYRA 1D9FA 3VAKA 2MQOA 3KTQA 3H5SA 3RTVA 2PEHA 3JTPA 1IJFB 2AX0A 3DFEA 3BO3A 2OJ3A 4K4UA 1QAXA 2A10A 2GCFA 3AQOA 4WFAQ 3OLAA 1KTQA 5DM6Q 3MOZA 1LWCA 2UXCF 2HQIA 4WXOA 5DETA 3MEDA 2FLLA 1TKXB 3GV7B 1WTFA 1FK9A 2VG6B 1PC4A 2HIQA 2BM0A 3TANA 2A2CA 3H5UA 5GMKa 4CIOA 3ETOA 4DL6A 3Q8RB 3NP5A 3DLGB 3HLUA 2DNKA 4CTAB 4IFYA 5A6PA 2E9RX 1DZ5A 2J0QD 2I8EA 4OV1A 1FRMA 2PDAA 4OHWA 3PZPA 5I3UA 2AU0A 2ZZMA 4GKKF 4V19J 3DLKA 3V5RA 5KFGA 1BQMA 4RX6A 1HNIB 3DU6A 1NO8A 3GQCA 1SV5A 3NLCA 4LQ3A 1S0OA 4YOEA 3N6NA 1YHQS 3IWXA 1TAUA 3U1MA 1S6OA 3LAKA 3HVTA 1VQ8S 4Q2MA 2DO4A 2EFQA 1N32F 4ETXA 1C1CB 5JUMA 1T05A 1T03A 1B64A 2DTJA 1Q86T 2GA7A 2J7UA 3R3TA 4IKAA 3LH2S 4K4TA 2EKYA 3RYLA 3U1LA 2LEBA 2DGOA 2Q79A 4C8ZA 1QSSA 5G0RB 4J9LA 5GAGU 4KSEB 2CQBA 4ZPWR 4FYDA 2GO9A 4ID8A 5M2RA 1K8AT 3AH6A 2KKHA 1S6PA 2OPPB 2OPQB 4L3NA 1SQEA 1MU2B 1RYRA 2J0SD 1S97A 5C42A 1HPZB 3N4WA 4K4YA 4R0JA 2XMUA 2KTQA 1V9OA 2W7AA 1WD6A 3OR2B 2HFNA 4B3TF 2M9KA 1HNVB 1XK8A 1X4AA 4PG5A 2U2FA 2GO8A 5KFOA 5EX3A 3KYLA 1HBOB 2CG4A 2WONA 3WDOA 2ZDOA 1BGXT 2HG4A 2YX4A 3ZZPA 4DS4A 4IR1A 1PC5A 2A3JA 3LQVA 4HI2A 1PO6A 2Q43A 2MKHA 4QPXA 4NLGA 1RTJB 2FJXA 1M5OC 2OPSB 3CDUA 1C0TA 2Q1LA 5F9LA 2B4VA 2EWHA 2WSCC 4U9RA 2FTRA 4RWXA 4N76A 5KOXA 2KYXA 5CA5A 4ED0A 1X4DA 3KKFA 1SJQA 3FRYA 2N82B 4U7CA 1JIHA 3KWMA 2MQQA 5AXLA 4B9TA 2X1FA 2X1AA 4X4UA 2AGQA 1RT2A 4DL2A 1KC8T 1R31A 1RTDB 1J5OA 3T1YF 3DOMA 3GMGA 5LSLA 3TVYA 2PFFB 2NXUA 1BQXA 4XPCA 2FC8A 1PGZA 2BJDA 7FD1A 4LIRA 3EYZA 3EZ5A 1KVJA 4PXCA 2N3LA 3E51A 2CFXA 1U49A 4KFBB 3I6PA 4K5SA 2NREA 4Y65A 3DMJB 3H4DA 3CULA 3CCWA 1W2BR 4RW7B 1IKXB 1R0AB 5J1PA 2RNEA 3TA2A 5IZHA 4JV1A 4ES1A 2FJAB 5C25A 1YJ9S 2W9BA 2X1GA 2FGOA 2MZRA 4FVMA 4JI3F 2YX7A 5HQ8A 3UE2A 4CO0A 4DV6F 4DQIA 2R2SA 4HTJA 4J9OA 3DLJA 3M2VA 4Y2CA 4PUOB 2B6AB 2GMJA 3I5CA 3OSPA 2P6SA 1Y3JA 1N0VC 5DM7Q 1RT1A 5CZXA 1U47A 3HVAA 2YH0A 3UR0A 2VASA 2RE1A 2EVZA 2F3JA 3LF0A 4ZS6A 3CJKB 5L9XA 3MUTP 1UJ6A 4B3OB 1S76D 3TO8A 5IS2A 1RKIA 3T1HF 4K4ZA 4KJIA 4PXDA 2W9CB 2KYZA 1GX5A 3VQTA 1XBWA 1M5SA 4R8UB 5FLXY 1DAXA 4DFPA 4RWWA 4LVNP 1GT8A 3FRZA 4LFCF 2K7JA 4DV3F 5BYSA 2DNRA 1YJTA 2WAQD 2KZMA 1JXEA 5LJ5Y 2HQ3A 2KG0A 5L1JA 1M0SA 2B9XA 2UP1A 4EYHB 1TKXA 2KHDA 2VG6A 3OXGA 1U45A 1WWHA 2JEJA 4FF4A 4X4VA 2C28A 4PWDB 1X9WA 1G2EA 3A8EA 4DQRA 4F25A 2LQ5A 4IH7A 2K7KA 2BBEA 2BXJA 3DLGA 3SZ2A 1VC6A 4CTAA 1QAIA 1WHYA 4I67A 3HHDA 3M4XA 2GX8A 2ZNZA 1U1LA 1NJIT 2OAUA 4HDHA 5CD4H 3HXMA 1H38A 1S0VA 1UVKA 1TKZB 2E7XA 3N6MA 2CZVC 3M8QB 4IYQA 2B56A 1FT8A 3IXQA 1HNIA 2AJ1A 2QSFA 5L1KA 1UEUA 1AXQA 1SL2A 3OFHA 4J5OA 1HMVB 3VZHA 2DPJA 1UAWA 3TNVA 4ELTA 3OFFA 5DLGA 2WOMB 1QSYA 1UFWA 3F44A 5B0EA 4PWUA 4ZCKA 3PKYA 5EDWA 4EZ6A 3DLHA 4DX8H 1C1CA 3GWCA 4ILRA 3B82A 2FJDB 2ZHAA 1URRA 5KT7A 2XI2A 1MWYA 2B3TB 2VG7B 3C66A 2YKOA 2XMMA 3PXGa 4AE5A 1WTBA 3MEKA 3MGJA 1U1MA 3GR0A 3QGGA 4H54A 5A2QY 2MQMA 2PSZA 5I42B 2V2KA 2MJUA 3IR5B 3MPYA 1S1WB 3CCZA 3MUVP 4AL7A 1KHWA 5G0RA 2YWHA 1OS5A 1HA1A 4WYWA 1JJ2R 4ZPAA 3CCTA 3BGLA 4E8UA 3IN5A 1Q8IA 4C3KA 3RB3A 4NA2A 3GIMA 2UUWA 3MR6A 4KAIA 4WIIA 1WEXA 1UL3A 2OPPA 3K7RA 4IQMA 2OPQA 4C98A 1U6BA 1L3KA 1MU2A 3OR1B 2ERRA 1SJRA 3N5FA 2GJIA 2Y0SD 5F8HA 3MURP 2YKPA 5H9EJ 1HPZA 4U7UK 1ZM2A 3CSKA 4PCQA 1KLMB 5F41A 1OSCA 3OR2A 4ZLPA 1FKOB 1HNVA 1WEZA 1YG0A 4Q0BB 5KFHA 3PRBA 3VR1A 1SC6A 4WFBQ 2N4CA 1HBOA 1IBKF 1FRJA 1Q4RA 2LQ9A 1UW4A 2Z2LA 4ZHRB 4AXJA 3OXLA 3R5BA 4H4KA 4I6WA 3MM6B 2CZ4A 1ZAXA 2MKCA 4L6V3 5KG5A 3KK2B 4KPYA 2VOOA 2V8DA 1KOHA 3D28A 1XR5A 3IRXB 1C4AA 1RTJA 3MD1A 1NB7A 3E2EA 2JEIA 1FNOA 2OPSA 1C0UB 3E8OA 4NZ6A 2MHNA 1QLNA 3QJPA 4OHZA 2GQQA 3FZBA 3K58A 3TW0A 5F8IA 4J9QA 1U8SA 4MTPA 4OZ0A 2CDQA 5L8RC 3MPWA 3ZC4A 1N6QB 1JLAB 3SSQA 3AA9A 2P9GA 1OO0B 4XO0A 2LECA 3JSMB 4OMFG 5AE2A 1HWUA 3UD3P 1S1VB 1RTDA 3WX4A 1S6QB 3CIZA 3S01A 3PR5B 2AP6A 1Y5NB 4L72B 2ROGA 4W90B 4NLOA 5M2UA 3MEGB 3HF5A 4OL8A 1CQMA 1KFDA 1S0NA 4PQUA 1TL3B 4KFBA 2QA2A 2ZH2A 1HBMB 1ZPVA 3H2LA 4Y2MA 3DMJA 3KLEB 4RW7A 1IKXA 4B3SF 4DR7F 1R0AA 1N33F 3MWBA 1YJVA 4IG3B 4JI8F 1NHUA 3JTOA 5KT2A 4ZVGA 3PNIA 4IQXA 4D3HA 2ZJPQ 3OVBA 4DPOA 3LPYA 3CC2S 2O66A 3SI8A 1YTYA 3UI3A 1FRKA 3GG1A 1CC7A 2HS4A 4PUOA 5KOWA 2B6AA 4QWDA 3DRPB 4NLXA 2DH9A 3OSNA 2UXDF 2C42A 4OLPA 3O2IA 2APOA 2DO0A 1S7HA 2E5IA 4RW6B 5DJBA 3CJKA 5KFQA 4OX6A 2J0WA 1K9MT 4B3OA 5E3PA 2X1BA 1FE4A 4FF3A 4KE5A 3RBDA 2ZZNA 4Q2LA 3QLHB 2GMHA 2W9CA 5JVHQ 4R5PB 2PI4A 4R8UA 1RT4B 1QY7A 2IBKA 1FTCA 3UDCA 2KFNA 3ISND 1SB6A 3CD0A 3H5YA 2IRXA 1U2FA 1VLYA 1Z2LA 2DGWA 2MKKA 3M8RA 4YP3A 2F9JA 5IQ6A 1YJUA 3PW0A 3IAM9 2PE8A 1X5PA 3M05A 1T02A 2D9PA 4FNIA 4DN0A 2M8DB 1GX6A 4PWDA 1QE1B 3GV8B 2VA3A 1IKWB 4H4MB 2CQPA 4MK7A 3J7ZT 1OPZA 2R7UA 2MPUA 4JI6F 1Z2ZA 3MZIA 3T5KA 3KLHB 3HMJG 4I0WA 4MK9A 2N3OA 5KFMA 2PD1A 2EFGA 3JSYA 3BQ2A 2BE2B 4QIFA 2EG1A 5B0DA 4F50A 3RR7A 4G3IA 2XMWA 3UFCX 2RJZA 1S0MA 4Z2XA 4NL5A 3AJ2A 1MMLA 1TKZA 1NK8A 2VD3A 2WCXA 3UR3C 1FJEB 3M8QA 1APSA 3CDEA 1VC0A 1XN9A 2LDYA 3POTB 4O3QA 2J6UA 4C9DA 5IT9Y 2FD2A 4PRFA 2FY1A 3MM7B 3THTA 3L3CA 3O8WA 1HMVA 3O6QA 2CPEA 1YRUA 3R1HA 2LMIA 4DMZA 4WK3A 1TQLA 2WOMA 1N5VA 3HI9A 1K73T 1JK9B 3HP6A 4KRWA 2FJVA 2ASJA 1IXKA 1QJHA 3BGRB 2EFVA 1HFEL 1L3TA 4CT8A 4U6PA 3GFHA 2CPYA 2XGQA 2ILZA 3DI6B 4DLEA 4NLUA 2OO4A 3AQPA 4NPOA 5E0OA 2VG7A 4PR6A 4LMZA 5B0BA 1CC8A 1WG1A 3HPOA 2ZD1B 2ILYA 4KT0C 5I42A 1TL1B 3PHEA 4I2PB 1S1WA 3PFOA 1HNXF 3Q0AA 4HKQA 1KQKA 5EWGA 2RRAA 2V8GA 2B9YA 5L9NA 3QGIA 4NWBA 4UUWA 3US5A 5DS7A 3G9CA 1RA7A 2RUGA 1HI8A 1TP7A 4PKDB 2GMLA 5L1IA 2R2RA 4QOTA 4F4XA 3SXLA 4JI2F 3OR1A 4DF4A 5B0AA 2ZC4A 5LXRA 5KFDA 4X4OA 2F40A 1R89A 2KN4A 3PKMA 1KLMA 1Y5IB 2CVEA 1HHSA 1FKOA 1P9QC 3DXSX 3S1TA 1D8YA 4Q0BA 5F3TA 2ADCA 4ZHRA 1LFPA 4IRKA 2K3IA 3OL9A 4UQGA 3PX6A 2BA9A 5SUHA 5H9FJ 3MM6A 1QVFR 3KK2A 2VONA 4DSLA 1L3UA 3V4MA 5F3ZA 1G1XA 5E3QA 4KQZA 1C0UA 1W2IA 2LDIA 1RISA 1GNKA 4ZCMA 4DL4A 3FZ2A 3VAFA 1FKPB 4NLWA 5J2NB 1WI8A 3PW2A 1SKWA 3CMES 1AROP 2XS5A 4MH8A 1U25A 4I1TA 1N6QA 1JLAA 2E44A 3R5DA 4TLRA 5E3RA 1F9FA 5EN1A 4K0KF 2O5DA 3JSMA 5CQGA 2OMOA 1S1VA 3NG8A 3BGFA 2PI5A 3QGPA 1S6QA 5A8KB 2J6TA 4EZ9A 1Y00A 1VRUB 4LT6A 1VQ7S 1X4GA 3MEGA 2VOPA 3EUNA 2RILA 3DRYA 4CO5A 4YR0A 4IOBA 1TL3A 2EI5A 1VMBA 1DJ0A 2UV8A 1HBMA 4LF8F 4A4JA 1GXUA 1S72S 3KLEA 4FS2A 4I2QB 3DM2A 4F3OA 1Q78A