1FKAF

Structure of functionally activated small ribosomal subunit at 3.3 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution.
pubmed doi rcsb
total genus 14
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkaF00
4DR5F 4DR2F 4LFCF 1FKAF 4AQYF 4JV5F 2UXBF 2E5LF 1B64A 2UUBF 4JI0F 2RJZA 1VMBA 1I94F 2YY3A 1QJHA 1F60B 4DR6F 4LF4F 2B7BB 4NXNF 1N32F 4DUZF 4LF9F 2F4VF 2BVZA 4GKKF 1XNQF 4DV1F 1RISA 2UXDF 4DV6F 2B7CB 4LFAF 1XMQF 4OX9F 2HHHF 1CQMA 2ZM6F 4KHPF 3T1HF 1HNXF 2VQFF 4LF6F 2VQEF 2KJWA 4X64F 4JI1F 1LOUA 1IBMF 1HNWF 1CQNA 3T1YF 4B3TF 2KJVA 1XMOF 4JI2F 1N36F 2UUCF 1G1XA 1IJEB 5AJ3F 4DR7F 4JI4F 5BR8F 2UU9F 4JI7F 1HNZF 4JYAF 4DV3F 2UXCF 4X65F 4NXMF 4DUYF 4X66F 4K0KF 4JI3F 1N33F 1IJFB 4DR3F 1GH8A 1IBLF 4LF7F 4JI5F 3ZZPA 4B3SF 4LFBF 4YHHF 4DV4F 4DR1F 4DV7F 1FJGF 1XNRF 5IWAF 1G7CB 2J5AA 4LF5F 3R3TA 2BXJA 1J5EF 2UUAF 4DR4F 4GKJF 4B3MF 4YY3F 1HR0F 4DV5F 4JI6F 4DV2F 5LMUF 5LMNF 4JI8F 4B3RF 4DV0F 1N34F 1IBKF 4X62F 4LF8F 3OTOF
chains in the Genus database with same CATH superfamily
4HT5A 4TQRA 3OLAA 2MZTA 3HULA 4H4KC 2DH8A 3WDOA 2HNZA 5KT6A 3IN5A 4ELTA 1R7IA 4DV2J 2R8GA 4GC7A 1LWCB 5D4OA 4QYRA 1S6QA 1RWOB 4X4SA 4OYOA 2CWXA 3HP6A 1RWUA 5KFPA 3EJMA 5K8OA 1VISA 4F36A 2HLTA 1HNWF 4AL5A 4JI2F 4BLGA 4YQWA 5L38A 1MMNA 2WK4A 3K0JA 3PACA 3QSYB 1FDDA 1S79A 4HH1A 1WF2A 2AP6A 3BJYA 3R8YA 1GX5A 2DR7A 3GCXP 4N8OA 2OD6A 1NHUA 3ZNUA 4R8UB 3BPSP 4RW4A 3HFZB 2UUAF 3DKDA 4FXVA 4IR1A 4P2FA 4DV5F 1UVIA 4NLOA 2VG7A 2MKKA 1UVMA 1KQGB 2DGSA 4YHHJ 3PYFA 3R7BB 2GAGC 2FVSA 2MZRA 2PO4A 1RGVA 4OI1A 1FK9B 4C8YA 5EGYA 3WX8A 3TVKA 1VC5A 2NXEA 2DT9A 1CQMA 1RT5B 5M2RA 3DRPA 1MW7A 4QW8A 1RTJA 3I5CA 1MMLA 1T95A 9RUBA 2CXEA 1FJ7A 3M6VA 2J9DE 4MKYA 4NLYA 4ZN1A 3KG4A 1T9YA 2IRYA 2J9CA 3IA0A 3NKYA 1XQIA 5C24B 1HD0A 3N9UC 2NPIA 3GFYA 1KTVA 1WSRA 3LANA 5J2MB 5CQGA 2NXNA 3CJKA 5J2PA 2LDYA 4WTOB 4DSEA 2FJBB 2QLJB 3OL8A 2OMOA 5HI7A 1NK5A 5RUBA 1Y5IB 3A8IA 1RI7A 2IIHA 3AOCA 2APOA 2MGZB 4X65J 1QUVA 2L9WA 1N0VC 2VBYA 2HHWA 1BQNB 4DQSA 2FIUA 3TX0A 1RT4B 4Y00A 4XDDA 2F3JA 3O3LA 4C7QA 1PBUA 4ATNA 5I4MA 4V19J 2C2NA 2LEPA 2WSFC 3MEKA 3D7SB 2IDLA 5HO4A 2F7VA 4OZLA 1U1MA 1CS4B 5HANA 1PAEX 4UOCA 4QR2A 4DCPB 2NREA 3N01A 1TKXB 4O4RA 2MKYA 4EO8A 1RCOB 1RWXB 1VCTA 2HNYB 2IBOA 3OR1B 1RT6A 5KG2A 1G6BA 2YQ3A 5BYRA 1KN6A 2ZM6F 3T1HF 2MQ8A 4ZVEA 4AL7A 4LF6F 2Z57B 1ZM4A 4LQ9A 2CZ9A 4I1TA 3PO4A 2I6WA 3NWRA 3MF5A 3PYGA 3UFCX 4ZN3A 4NXNJ 3NBPA 5L8RC 2JVOA 2QJ3A 2VBZA 1G1XA 3QT8A 4DL7A 4ZPVR 4NWBA 2BYCA 3D0GE 3J80Y 2YWHA 2JLGA 1QTNB 3FEXB 1RTHB 3VAJA 2V0NA 2POKA 3ISND 2VF3A 1N54B 1AUSL 1NCLA 5KOWA 4WFXA 4M5MA 4JYAJ 1V9OA 1HBUB 1YBAA 2VODA 1FXRA 2K1RA 3EMTA 4U67Q 5LL6d 4DG1A 3NCPA 4F4KA 4NCAA 1KDNA 4ZVHA 3BH7B 3R6LB 3E2EA 4FYVB 1RAJA 4UW2A 4ZVOB 4CLKA 4LRBA 4TYBA 4CLWA 4DFPA 4AL6A 5G0RA 3OR2B 3I55S 4QIFA 2CQ0A 1MU2B 4WE1A 3KLIB 2XZTB 5FIIA 3R5GA 4TLQA 1U0HA 1KR4A 2I5JA 1VFJA 4CLSA 4NLQA 3C46A 4X64F 3H59A 4ID5B 1U0SA 3OXFA 4DL0C 1EQMA 2HQIA 5ETSA 5AXKA 3LQVA 2R8IA 2X51A 4WFNQ 1VS3A 3GYXB 4U95A 4A8OA 4WP3A 3MAAB 3MR7A 2CQ3A 3CSKA 4KAIA 1UL3A 3NMAA 3AOAA 3TX8A 1BD6A 4ZPWR 2P6SA 4NA3A 3OSPA 3PYEA 4YR2A 4ZJLA 3MFIA 2YKNA 3RAXA 1DZ5A 2ASJA 3LP2A 2XS2A 1X5TA 1UPPA 3GSIA 1FVSA 2DIUA 3T41A 3N28A 2JX2A 1NUEA 4ZCMA 2VFUA 3QLHB 2PDAA 5BYQA 1CULB 3LF0A 3HMJG 4PUOA 4RU9A 1N32F 5DG8A 1SKWA 4CO4A 2WW8A 1S0VA 4F8RA 1UEUA 2ZDOA 2QYCA 3GE9A 2LU2A 1YJNS 4EK2A 2IM0A 3AHPA 2D1CA 1FRMA 2YVSA 5BR8F 1N6QB 5KFFA 1P8GA 1N5YA 1NJYA 4Z2XA 2XMKA 1RXOB 4CT9A 4JV0A 4IYQA 2GVDA 2QE5A 4ES1A 1VQNS 3T1AA 1OIAA 3K59A 5F9LA 4PCQA 1RADB 1XN9A 4B3TJ 1R0CB 2MHEA 1R0AA 4RW6B 3X1LB 5IT4A 3QT7A 4ECXA 1FWKA 5FDLA 4H4OA 1U1PA 4C8ZA 3VAFA 1KEKA 3N4WA 1UVLA 2EK6A 2JOQA 4KH1B 1GEHA 7FDRA 4X4RA 2XMWA 4DV0F 1S9GA 4K4YA 1BQMA 1QY7A 3G6ES 5CHCB 1S1XA 1TL7B 3PFOA 3L7PA 4A8WA 1JXVA 3HHLB 3QO9A 3C2PA 1U49A 2V8PA 5IV4A 5CYJA 1YRUA 2RF2A 1EB0A 1FNXH 3O1LA 3P6YC 1E6YA 2QGFB 3DLJA 1HNIA 4PWWA 1FCAA 1RJJA 3DDNA 3QSIA 1EZZB 1HHTP 4F3QA 2WONB 4FDFA 4KSEB 1SJ4P 2XS5A 4GO5X 1VQ7S 4ZJQA 2DGTA 1NJXA 1V5VA 4GMKA 1VHFA 1NSAA 1X4HA 5HMWA 2CFXA 4K50A 4QU6A 4BCAA 3UVJA 1RAHB 3C6UB 2XC9A 1CJVA 2UP1A 1CJTB 3CJTA 2J5AA 3QT6A 4HDHA 2R7XA 2WAQD 4DUYJ 1VK8A 3K5OA 5ETQA 1O6XA 1TKTA 4DEZA 2LQBA 1FRKA 4KKOB 4QYZJ 3TUIC 2VASA 2ZOGA 1N0UA 3EZOA 3EVOA 4JP8A 3LP0B 4M5HA 4DPOA 3OJUA 1AROP 2FY1A 2B5JB 2KYXA 2DY1A 3MGJA 1QSSA 2X3DA 3T1HJ 4ED1A 4JOUA 4IDKA 1S0MA 3MPYA 4LF4J 1U47A 4LF9J 3K5MA 4ZKAA 3QAEA 3HZEA 2LCWA 4DV1J 2EKNA 4LSZB 3H5SA 1EKRA 2IPOB 4DSKA 3VZIA 1XMQJ 1RAEB 3PX0A 4F7VA 1IKXA 1TZ0A 2YKOA 3RAMA 1U1RA 4HKQA 3J7ZT 3AJDA 1UPMB 4U7UD 4DR1F 2M4MA 3RB4A 4YR3A 4ILRA 1FEHA 4ER8A 5AT1B 4PWUA 2KHCA 4J9UE 1LXNA 3SCLE 1S59A 1PAUB 1XR7A 5IWAJ 5LOQA 3RRKA 2DXEA 3OBIA 4ZA1A 4GO7X 3GYNA 3MPUB 2UXDF 4YB7A 3H2VE 2HHHF 1N5SA 4MKVA 3KJVB 4MAKA 1X9SA 2CQ4A 4IG0B 5AJ3F 2XSJA 2ROPA 2D74B 1S9EB 2GGPB 2CNNB 1NJZA 5KFUA 2C3UA 4O3PA 4DHVA 3FDSA 2ROGA 4ZHRA 1RTIA 2XZWA 4ES3A 2BXJA 3MM5B 3CJKB 2MQOA 4FYWB 1WG4A 2H65B 4JI5J 3CJ8A 1ACMB 3Q8YA 4K59A 2WVBA 2XWYA 5D78A 1I51B 2YNIB 4KBIA 3C19A 1J5EJ 4JBCA 4OHXA 3Q8RB 4HI2A 4ANCA 1N32J 1DTTA 2A6OA 4ELUA 3LGHA 3UN5A 4ICLB 3OFGA 2VICA 4XIUA 4EBEA 3HM9A 5DDPC 4O3RA 4N56A 4M95A 2I38A 3BB5A 2NQPA 2QMXA 1S1WA 3HJFA 4N77A 1JLAB 1UJ5A 4FF2A 1YJWS 2XCPA 1SJ1A 2N7CA 4GKKJ 3V6DB 3P49B 4NLTA 4I64A 1QAIA 4GVBA 3MTKA 4KFBB 2FVRA 1ZPVA 4NXMF 4RNHA 3HVRA 3R5DA 4OV6A 2MJUA 4LF7F 4K4ZA 2ZBPA 4NZ0A 4FKYA 3NBPB 3HSGA 2O67A 2LECA 1U2CA 2AHOB 2XNQA 3FRYA 3EGZA 3M8PB 3QWPA 1KQSR 1S1UB 1CC8A 3KOAA 2VOPA 2GQ2A 3FVYA 1K73T 4FZVA 3CMES 2KXNB 4UZCA 1OMSA 4R5PA 1SKSA 2IJRA 3C3LA 1RLCL 2YNGB 3DCAA 2QIFA 4DR5F 4TY9A 4ZVFA 3E3XA 4HDGA 1JKHA 2FLOA 2B4UA 3J7YI 4DN9A 4CT8A 4RNOA 4OYAA 1YGYA 3M8QB 3UDEA 5AE3A 3FBCA 3KTQA 3DOMB 2V4QA 5B0CA 4F04B 5T7LA 4YEAA 2QA4G 3HK2A 2P9CA 1IKVA 1WKLA 2W9AA 2K3IA 2HW3A 1F9FA 2ASLA 3DLGA 2XGQA 2ZVSA 2WCXA 3DOLA 3TUJC 4RUBA 3CD5A 3IS9B 2IJNA 1SL2A 3GQCA 4G1QA 2CQ2A 4J9KA 2E5IA 3H42A 4EGLA 1GMVA 4O3QA 4YOEA 2UUWA 7AT1B 4F67A 3QPIA 2OPQB 3GFHA 2DXDA 4J37A 5GAHI 1NJWA 2R7SA 3R27A 5B0BA 4M94A 3ETMA 2XSFA 1HBMA 1SV5B 2W01A 3FFIA 3ZTRA 2DNZA 2QYGA 2E5JA 3ENQA 2ZJPQ 5B7WA 2I1RA 3K5NA 4B3SJ 4IFYB 3J7Z5 4L76A 2BKOA 3PKMA 3GFZA 1YRXA 2ZZMA 2W2PP 2BEFA 1S99A 2HFUA 1RSCA 5ETMA 1HBOB 3QFHA 3CGIA 3EDRB 2QLFB 1FFGB 5H9EK 4DUZF 3RTVA 2WB4A 2YKNB 4B9NA 1EQ0A 4O44A 3DDKA 3CDEA 5IM0A 4U6PA 3MEDA 2QA4S 3CCSS 2XBPA 5KFTA 2BE2A 1O0PA 3KLHA 3ISNC 2VQFF 5MAOA 2YNHB 1I94J 3IO1A 4DSLA 3FMWA 1F3FA 1H6KX 5L39A 2DNOA 2W7AA 5EHHA 2ZKTA 1Q16B 4P6QA 4DX8H 3TQ1A 1RHQB 2NYIA 2OPPA 2HMIA 2RHSB 4LBHA 3KLVA 1FKOB 2FHJA 1UAWA 5DDQC 1R8BA 4F2SA 4DV4F 3D1QA 1SI9A 4OHZA 2MEWA 1RTZA 1LFWA 5E7OB 4USVA 4F4WA 4I0WA 2ACMA 3AJ2A 3JXOA 4XK8C 4YR0A 1ELOA 4DPTA 3TUPA 3L7UA 4RX6A 1S57A 5H9FJ 2FGOA 2CZ4A 2IRUA 2EPIA 3S8SA 2J6UA 1JIHA 3FGVA 3FEYB 3EVWA 4I67A 5HN0A 3SFUA 3UN3A 1HR0J 2HEKA 4WBFA 3LP1B 1K9MT 2C2ZB 1S9GB 4NCGB 1UA1A 2CPZA 4TY8A 2BQRA 3UDVA 4EYHB 3KKFA 2H4YB 1EAYC 5L9NA 1CJKA 2OUGA 2G4BA 4M5NA 3ZNJ1 3DRYA 1HMVA 1CSJA 2W24A 2QL7B 4RWXA 2UVRA 5LXYA 3GV8B 2D7SA 1W26A 3SQOP 5AXMA 3CO0P 3ZZ0A 5BJRA 1IBLF 3OVSA 1R8PA 1J5OA 1KTQA 2O66A 1UJ6A 2KG1A 1H7XA 3A8EA 3UNYA 2R2TA 4RBTA 2UU9J 1VBYA 4TN2A 1YLXA 1TFYA 3H7HB 4CYUA 2QV6A 2ILYA 4X4NA 2ZOMA 4YMEA 1F5AA 3UN2A 2W9BB 1Y11A 1TL4A 1ZM3A 4URSA 2EC0A 2V4JA 1RWPB 2FHJD 2EBEA 2KI2A 2ZEJA 2DCUB 3SZ2A 1SJQA 1SKUB 1FRXA 3TZZA 3F0NA 4MFBB 3IWXA 4IH7A 3W3SA 3B4MA 3MFHA 3Q23A 1CBKA 2A1BA 2OSQA 3TNVA 2UUCF 4ZOSA 2Y8WA 1N48A 1FHTA 1M5OC 1NDKA 5KAKA 3JYTB 4NZ7A 1GH8A 1LWEA 3M6UA 1KC8T 1UFWA 3BKTA 4WPAA 5E41A 1N88A 4OYXA 2E66A 5JMNA 2DB1A 5K5MA 2V8DA 1N52B 2IYGA 3DRXA 4PG7A 1UP1A 4L3NA 2YNFA 1GK8A 1P27B 2RE1A 1IKXB 2ZBQA 4ECRA 2HFZA 3NS5A 2AYMA 2GCFA 4B9MA 4DR2F 4FXWA 2C3OA 1N5QA 5J2QB 3OHAA 2JLFA 3M2VB 1C4AA 3LGMA 5HMXA 2N82B 3PKYA 4PQAA 2XLKA 3IP0A 5DQIA 3OTDA 1A0OB 4OX9F 5KG7A 2VFSA 3NNCA 3DI6B 3UD4P 4ED5A 1BQXA 4IG3B 2CQIA 1D0EA 2DO0A 2VFRA 3IGVA 2OO4A 5A8WB 1W2BR 3GCWP 2YQ1A 5HBMA 3NG8A 4QR0A 3UDLA 2DCLA 1BWEA 3IWLA 4RNFA 1D9AA 1N33F 3W2VA 5E3CA 5M2PA 4RW8B 2AX1A 2R4FA 1HQ2A 4RWWA 4A48A 2ZWPA 2KZMA 2RHQB 2R2UA 2YH1A 2DNYA 3E8OA 2IM2A 2ZITA 4DR7J 4JI4J 3C6TB 5CYMA 3I5BA 2W8LA 3U7JA 2V5HG 4FF3A 3BQ0A 3VAHA 3MMAA 1JLCA 1T9VA 4PG5A 2RRAA 3FK4A 2IC3A 2KDOA 2LU1A 5KOXA 1MN9A 1BHNA 3SQGA 4YUDA 4ZHRB 2LVWA 3PW4A 2HHTA 5C25B 3MUTP 2QRRA 4UZBA 5LJ5Y 4WP8A 4C0OC 7FD1A 1RK8A 4Q5VA 3GIJA 2I8EA 1Y9OA 2MKHA 2PA8D 2MY7A 4HI1A 4EI2A 1T05A 1SQGA 1Q79A 1YI2S 2IA0A 2FTRA 4M5IA 1HWLA 2VIHA 2P9EA 5HLFA 1FE4A 1FDNA 3NCRA 1KVJA 4NEZA 1H2VZ 1C1CA 1QE1A 3Q8UA 2VOOA 3BGOP 4AT1B 2F63A 4KHPJ 2HLUA 1CVJA 3PFEA 4USIA 3B6BA 4FYDA 3TVZA 1KOHA 2FVCA 2L08A 2QC3A 1N36J 1VRQC 4OYWA 3FCHA 1FKPB 5ETLA 2UXCJ 3GILA 4IO1A 2ZE2A 1S4EA 3CNQP 5D3GB 1UWBA 2MY8A 3D3CJ 3CPWR 2L3MA 3HSZA 1UCNA 5D4LA 2YWEA 3ZXWA 4I2QA 4KHMA 2RQ4A 2KXHA 2FHMA 3UO0A 4RW7A 3ENAA 2V2ZA 2K8GA 3KLEA 1VQPS 1C1BA 2CJQA 3MECA 1TL3B 1D9DA 4PQUB 3V5RA 1VRUA 4RL1A 5DM6Q 4I6AA 2CQ1A 1WC3A 3PX6A 4DXLA 3H5XA 2E5HA 3H98A 4YN3B 5KFSA 3MI7X 2E29A 3J81U 1UW4A 2AKWB 2VQEJ 1D9FA 3DLGB 1U1OA 3DLBA 3N6LA 4JI7J 3CO9A 1RLDA 1SIZA 2KL8A 5IT0A 2ZDPA 1M1HA 3C14A 2PE8A 1KONA 2CPYA 1ZZFA 3IGNA 1G2EA 3R5JB 2OMLA 5D4PA 2CPXA 3MEGA 2V8GA 2FZKB 4J9LA 1GMUA 3CB4A 4M5JA 3DRSA 3I5AA 2UUBF 3M1VA 3DRRA 3FFIB 2CRLA 2E1AA 1B0VA 3P5TL 1PC4A 1V3RA 2HURA 2IAJA 2XTJP 5A8KB 3OLBA 2YKQA 2E1RA 1UWAA 5KG5A 3N0VA 2NSCA 2F1FA 1NEEA 3CCQS 2X1BA 1RWVB 2BE2B 3C15B 3G8QA 3G96A 3IAM9 4FS2A 1X7VA 1JLBA 3JQKA 2HHXA 2ZH7A 4OYIA 2IYIA 3I4PA 2GZOA 3LA0A 3Q24A 1U1LA 1HNVA 1O51A 4PXBA 1RUSA 3ZTQA 2W2MP 2HQ3A 1JNRB 3CJ2A 3ISZA 1WJ9A 2PT0A 3G8SA 3CCES 4FNIA 2RB7A 2J0WA 3MM6A 5JJBA 4Q2MA 1X4BA 3GLJA 3KJNB 3MM9A 3RB0A 1UVKA 1RT7B 2ZHAA 2VJUA 3MEEA 1VI7A 5DQHA 1FJGJ 2GMHA 3NL0A 3OUYB 4DR6F 2CQPA 2AJQA 4DSFA 1RHUB 1RU1A 4KO0B 4HHUA 5HQMA 4O0IA 1KLNA 4CO3A 3D28A 2EC2A 4I6WA 1MN7A 4HACA 4FF4A 4AQYJ 1TELA 3E01A 1JMTA 2Q1LA 1OY8A 2VG5A 5EDWA 1S9FA 3QRQA 1S1TA 3QJLA 1OWXA 5K9FA 2AF6A 1BC6A 1OY6A 2YKMB 1QLNA 2YX7A 2DITA 1RA6A 1RAIB 1IBCB 5LSRA 4CO5A 2CZVC 1WOSA 2IHR1 2J9DA 1DRZA 3Q2SC 2OPSA 1OYEA 1TKZA 4A8YA 1XTZA 1RAAB 1K0VA 3T3FA 4U96A 5A8RA 3KK1B 2LMIA 3OTOF 3K8WA 1NHKL 3J7YU 1JJ2R 4C9DA 4NLRA 3SCJE 1AUDA 3DU6A 2DH9A 1IR1A 2EI5A 3OTBA 2I2YA 2HS4A 4RKUC 2BVZA 2PA3A 3PNIA 1NK0A 1VRTB 1GNKA 3TOQA 3I6PA 3MURP 4DS4A 2HIYA 2RU3A 4AYBD 3GR0A 3G4SS 3TJ8A 4IOCQ 2HHSA 4EZ9A 1U6FA 3QGGA 3I0SB 3T5JA 1PO6A 1IQTA 2MSSA 2JEGA 5IC6B 4I6YA 4DZ6A 4YFUA 4ED3A 2LP4A 4DV6J 4NRUA 2NS1B 4PABA 3AODA 4WFZA 1Q7LB 1IKYB 2JL9A 1XBWA 3RU0A 2OEKA 1X0FA 3A3NB 1M1KT 3HD2A 3ZZPA 2QO3A 5GAHU 4K4WA 9ATCB 2IBKA 2DNRA 3R3TA 4E0DA 4K4VA 4KTQA 1NSKL 3HVTA 3CCJS 2U1AA 2IMOA 2KH9A 4K0KJ 3MUMP 3GG1A 3AAWB 1OQ6A 2P2CB 1H0HB 1JLEA 4ZLLA 3PVXA 2Z58B 2MQMA 2BM0A 1JLQB 1HPZA 3K7RA 4QW9A 3F56A 3ZFVA 2EK1A 1Y5NB 4EUVA 1MROA 3HI9A 1C2PA 4XO0A 1TP7A 1MMDA 3KG0A 1NAQA 1ZA1B 1XNQF 1FJEB 1H98A 1FRHA 2F8HA 4P75A 3MPDA 4W98A 2V2VA 3W9IA 5GAGI 3FJ2A 4PG8A 4M1KA 2COLA 3H2LA 1KFSA 1DLOA 1K1QA 1PJ6A 1VBXA 3MMBB 4QIEA 3VQSA 3MHYA 3NGUA 4KHRA 2HWHA 1QVGR 2ATLA 3SFGA 2C2RA 5GVQA 1WF0A 2HZAA 3V81A 1EHWA 2B56A 3R5CA 2HBRB 3K8VA 1NK6A 4OI3A 2BKPA 4DL5A 5D0GA 1B7YB 2Q3PA 2AJ2A 4B08A 3PJWA 2HZVA 3BKUA 3R1HA 4ZITA 4C8KA 4DR4F 2CG4A 4FYXB 1FESA 5CYQA 4CH0S 2UV8A 2C2EA 3M32B 3KHRA 1TK5A 1RDRA 5T14A 4NEYA 3SDEA 1PYTA 4HEA9 1LNQA 3I9V9 3M2UA 2J0QD 1SJFA 1C4CA 4LQ3A 3A3OB 4JI0F 4LF5J 4LRDA 2LQ8A 3I96A 4Z37A 4BS2A 3BBBA 3HO1A 1CC7A 4B3MJ 4RBUA 3ZZTA 5J2NA 3NY0A 5EX3A 3M30B 2IC3B 4JV2A 2KN4A 3BM7A 4C4WA 5KG3A 3H20A 3CCWA 3BN4A 4JI1F 4Q45A 4X4UA 2N3LA 3J7A1 3D6MB 1RHKB 1IM4A 3K57A 1KKHA 2W2OP 2DNQA 4DPWA 5IQ6A 3A3PB 2WSCC 3DYAB 2JEJA 2C2OB 3QZ7A 3I4HX 4DOZA 1U25A 3POTB 3OQ2A 1LWCA 1S7IA 1NMEB 5HLFB 1B3TA 1RAFB 2L41A 3CD0A 1QDUB 1H38A 3EUNA 3NP5A 3QNWB 1X8DA 2BJ3A 3NEKA 3EM1A 4FYYB 3UW1A 2HHPA 2GX8A 3WIUA 1TV6B 5KG0A 3S01A 4AUKA 3MCSA 4ECUA 4C8LA 1RWWB 3G2XA 3H90A 2EG2A 1X4GA 1L3SA 4ECWA 3KUEA 1NPPA 2C22A 4LSNB 5A6PA 3SBMA 4B3RJ 5KFZA 4HR2A 4OHVA 4R8UA 3PY8A 5DDOC 5B0FA 3LWLA 4UY8T 3OVAA 2FHKA 3H8YA 3GTYX 2CNLB 2HK2A 1FJCA 3UR0A 2YH0A 2B3TB 3HVWA 2MQPA 4RW7B 4C11B 1X4CA 3MECB 4LT6A 1A6LA 1NXIA 2WVDA 3DLEB 1XMBA 3H0PA 4I7FB 2DGXA 1BY9A 1FK9A 3VGSA 3UR3C 3TUZC 1VIXA 2L9NA 3JSYA 4KGKA 1HWUA 1RT5A 4CRJA 1S7HA 3PEJA 1U6BA 1J27A 1PC5A 3DM2B 5C24A 3CDUA 4OX6A 4B3OB 4QWBA 1KHWA 1FXLA 4P71A 1FVQA 1ZTTA 1R89A 4Z7YA 5HVGA 4P2XA 4OHYA 1X4EA 4W90B 1GTHA 2ZD1B 2MXYA 2ZJRQ 5KG4A 2W8KA 1F2HA 3ILLA 2D3OR 5A0YA 2MGZA 4LFAF 1WTBA 5F41A 1GFWB 3VGTA 1BQNA 1S1VB 2E5LJ 3JSRA 1RT4A 2XMUA 1R0BG 4MK8A 1LEOA 1CS4A 4B17A 4URGA 4FN5A 1TKXA 2ZWOA 2HNYA 3OR1A 1X9WA 1EP4B 4A8XA 1SVDA 1NKBA 3PXGa 1TMMA 3FSYA 4J91A 4TU7A 3O8WA 3EWGA 4AXJA 4CDIA 3KLGB 2GHVC 3T6BA 2AEJA 2CVIA 2ASYA 4DV2F 1R6VA 2PSZA 1NSPA 2DYAA 3CJ4A 1R31A 1WSVA 3BYPA 3A12A 1UVNA 2QTWA 1S0NA 4M8LA 1U45A 4UOHA 1REVA 1RTHA 3BSCA 1Q5VA 3M9MB 3SYZA 4Y3CA 1GXLA 3DDIA 3UCUP 3I56S 3DXBA 2DTJA 5EN1A 1M0SA 1VQYA 1HBUA 3SV3A 3Q0AA 2W9CB 2DR8A 2K7KA 2WB1D 1F6TA 2GQCA 3U1LA 4CNZA 1F3VA 3IM8A 2DR5A 3PIPQ 3CMQA 2HVZA 1NDCA 1CPZA 4OX7A 2OELA 2ALZA 1WC4A 1KP6A 2FC9A 4OZJA 2DGOA 1C0TB 2FYXA 4HACB 1QAYA 3OR2A 3LOUA 3W66A 2ADBA 1MU2A 3KLIA 4X4VA 4YHHF 3D3BJ 3BF4A 3H5UA 4DZDA 2IM3A 1WDDA 4ID5A 3PW5A 1RB0A 3PYDA 4A8KA 3DU5A 1QVFR 5L1IA 2Y3YA 4O4GA 2N4DA 5LMNF 4CTAB 1DAXA 1RAOA 4OIXA 4W4MA 1YKWA 2HHQA 5HROA 1JWWA 1T9WA 3AA9A 3MAAA 3VCDA 4NMLA 4MIBA 2VKZG 2GV1A 4CWBA 4Y0FA 4KE5A 1HWIA 1X5SA 1SJ3P 4KH0B 4C2MA 4X62J 3OFHA 4HYKA 1BWVA 4S0MA 5L9XA 5HSPA 5DETA 5JUMA 2R7UA 1D1UA 1Y7PA 4C3LA 4NLUA 5GMEA 4LIRA 1P6TA 1GXUA 3SSSA 3K17A 3DFEA 5FLXU 2XLJA 5CZVA 3TVYA 3QLHA 3IMQJ 1CULA 4NLWA 4X65F 4Y28C 2MQNA 3TA1A 5GMDA 4J9NA 1LW0B 4IFVB 4MK7A 2BJ7A 1QTMA 2LDIA 2A2CA 3QJPA 3KK2B 2CIMA 1FWLA 1KVIA 3D6FB 1N6QA 1DARA 2QMUB 2L9DA 1IKWB 1U26A 3DMJB 1DQAA 3MMJA 3HFKA 2ZOFA 3L4BC 2DRBA 4MT1A 1X31C 4QPXA 4F26A 3AD9C 3HFVA 2KG0A 4NXNF 3W8GA 3AD7C 2PGCA 4RW6A 3HT3A 3CWJA 1YQHA 1R8HA 1Q8BA 2XHWA 1HD1A 2KU7A 3DOKB 3I0RB 2KFNA 4Y2IA 3BEGB 5JXSA 2KJVA 5B0DA 3MDFA 3DXSX 1TL7A 4CLUA 4JYAF 5THWA 1Y5LB 4ED6A 1JLFB 4PWDB 3HHLA 2ROEA 5GADU 4DL6A 2J9EA 1VJWA 3D0IE 2CDQA 2HHUA 3TAMA 4LUBA 2OJ3A 2ZHOA 1Q78A 5K8PA 2WONA 4WTYA 1TL1A 4LFBJ 4KIAA 4QBUA 2YX4A 3IR7B 4TYAA 5KFYA 3NCQA 5ETRA 3C6UA 1CJTA 2Y0BB 4LFAJ 1RA7A 2EG1A 2D9PA 4FP9A 3QZ8A 5KG1A 3JS9A 4NLSA 4KKOA 3EE3A 1XEZA 2GAHC 4B9TA 5J2NB 3M8ZA 1RZMA 4CP5A 1T3OA 2W4DA 2BACA 3M9OB 4DV3F 4ED2A 4ILMA 4DU8A 3CE8A 1N5VA 2YX1A 2B5JA 2OHDA 5AXNA 1B0TA 3TA0A 2JHEA 4NL5A 2CA9A 3VVUA 3IRWP 3DLKB 2P8IA 4ILLA 2LLZA 1UTAA 3ADAC 3V4IB 4LREA 1ZAVA 3T6JA 2XB2D 4ZVGA 5KFMA 2LA6A 3MR3A 4QOTA 2Z30B 1FD8A 2M2BA 1ZAWA 1DTQB 5J1NA 5K8MA 2OEMA 3M8RA 3Q86A 3CVKA 2ZH9A 5G4DA 2B9XA 1ZS6A 2HWIA 4LRAA 5K14B 1UZDA 3S6EA 1YJVA 3OT9A 3GV7B 3CJRA 3THPA 3OSNA 4NLXA 2K2PA 3EX7B 3M4XA 2BA9A 1F2GA 3GG0A 1RT1B 3VHQA 3WX4A 5A6WA 3BSAA 2Z8QA 4B3TF 2CQDA 5B0AA 4RUAA 2AJFE 2WVFA 4Q0BB 3P45B 1NZ8A 4I56A 3UNGC 3BO4A 2YKPA 4OZ3A 3UD3P 5KFQA 2PEBA 2VG6B 4AE5A 3MCMA 2R3VA 3KJVA 4P9SA 2RDJA 5D0RA 2MZSA 1SCJB 2ALYB 2FHOB 1H2TZ 1V6HA 4OX8A 2DKOB 4IG0A 1H73A 3GIMA 5LMNJ 3C16B 3C66A 3W65A 1F1BB 2FLPA 1A9NB 1APSA 1S9EA 3LAKA 2GGPA 1MWYA 1CJUB 4DS5A 1YJTA 3I9ZA 1PYOB 3RW7A 2LQ5A 4PXEA 2E5GA 2X1FA 5EUHA 2K06A 1GMWA 2HRUA 1X5OA 2JVRA 3ITHB 1S4FA 3IBFB 2NZCA 4LFCJ 4H4KA 3MM5A 3T19A 3G6YA 4JV5J 2C2MB 5J1EB 5KT5A 5GAGU 2DEJA 1ROFA 2EFPA 5AXLA 2MQQA 5A0YB 2PN6A 2YNIA 5E5NA 4C8MA 3VGVA 5JVHQ 4XAKA 3TEGA 4DUYF 3NNHA 3BPDA 1SC6A 2HFNA 2AJ0A 1DJ0A 4ICLA 3B78A 1HQEB 1SH2A 5IT9U 2B9WA 3TWZA 1JLAA 3NGTA 2ABYA 3SIPB 1VLOA 4X66J 3ZZRA 2RRNA 3V6DA 2BDPA 2NSBA 4KQZA 2PI4A 3CJSA 4KFBA 1SQFA 2PFDA 3FEZA 2J6TA 5IT9Y 1RBLA 4LF4F 4LF9F 1ZM9A 1RT2B 4DV1F 3F41A 3M8PA 3MD1A 2CWKA 1S1UA 1XMQF 1SQEA 4WK3A 4RNMA 3OL9A 4BC9A 1I3OB 3ZTPA 3RB6A 4N41A 4DLEA 1W7WA 1REVB 5IS2A 2YNGA 4DBQA 4FXDA 2WSEC 2ZH8A 4L3KA 2R9LA 1Q82T 4IOAQ 4ZP7A 2CADA 2ZKUA 4ED8A 3M8QA 4DQRA 1V3ZA 1J2VA 1G3OA 3DOMA 4OI6A 5LXRA 3T1YJ 3AFGA 1AZSB 3EDQB 1KQFB 3CXCR 1ZYQA 5IWAF 1HWJA 4KR0B 1VIOA 5A76A 3G6XA 3IS9A 2R7WA 1XC9A 3R7SB 2WOMA 2OTJS 4DN0A 3LH2S 3GFXA 2OAUA 4ETZA 2CUYA 1XNRJ 3M2RA 3H2UB 4HTJA 1KS2A 2OPQA 5IV3A 4O4GB 3Q22A 4ED0A 3CD6S 1SV5A 5FJ4A 4UF4A 1R8CA 4CH1A 5HROB 1HFEL 3FNNA 3JAMU 5HK4A 2G2OA 2Y9HA 5ETPA 1Y3JA 4B9UA 2AEMA 2UUTA 4IFYA 4QWDA 3AH6A 1G4CA 2ZH5A 2CJ9A 1OPZA 2DVIA 4DV3J 1HI1A 1HBOA 3MPVA 3TZYA 2CJXB 2NUHA 5KFIA 1Z2LA 3GJTB 4JI5F 1EJ7L 3B54A 4KRWA 2AYBA 5JVGQ 4A8SA 3D0HE 3KLFB 3JAMY 2OPRB 2YNHA 1J5EF 5CD4H 2AU0A 3KNGA 1LXJA 2DGWA 3UD5A 4JI3J 4C6AA 3UDCA 2BANB 1FA0A 4NCBA 2DGQA 1RWKB 3SSQA 1RTDA 3EPGA 1URNA 3GJSB 1FKOA 3O2IA 4F4ZA 2HRYA 4KC5A 4JI6J 2XG8A 4GKKF 1UVJA 4DI6A 3SXLA 5F0WA 3G87A 2VU5A 5EWEA 4RR5A 2XI3A 4ZMMA 1YBUA 2HSEB 1FDAA 1X4FA 2RD5C 4QQBA 4WIQA 2AIRB 3KUGA 1RT3B 2GNKA 2GIFA 3W5ZA 1U24A 2VD3A 2FZCB 3VAGA 1WORA 4OYBA 1MG7A 2V68A 1HNXJ 3THVA 3ZTSA 2QEXS 3LP1A 4CCHA 3UCZP 3KWMA 3GB0A 2CNOB 4NCGA 5I3UB 4NI2B 2J8SA 1U2FA 1YDLA 4X4OA 4H4MB 3JSMB 3W2WB 4F02A 3U27A 2CPIA 4Q43A 1K44A 3QT5A 4F4AA 4WKYA 5HQLA 2GJFA 3TAMB 3SSRA 4HVZA 4ZJOA 3WC0A 5ETNA 2WRMA 1TR0A 1LWFB 3JQJA 3P3DA 4EO6A 4I2PB 2M9KA 2BX6A 4U7CA 4Y2AA 2QT7A 2KFYA 4DL3A 1TL1B 3GV5B 4C0HA 2RT3A 1T0TV 3RBXA 4ZP6A 3NNAA 1HW9A 2YTCA 5DRKA 2FVQA 3JSBA 1IJEB 2W9BA 2HGLA 2E7XA 5E33A 2MQLA 2R8KA 3I31A 4J9PA 4USTA 2N4CA 3VZHA 4HHJA 3T9NA 4ES2A 1HYSB 3WQPA 2KKHA 3TW0A 3AB4B 3PRBA 3TANA 4B3SF 1UFLA 4IH6A 3W9HA 4MFBA 2H9ZA 1YTYA 2XMVA 2PIIA 1VBZA 2DO4A 2UVUA 2MYFA 2V2KA 2KTQA 3DNCA 1WEXA 4YB5A 2M8DB 2RNEA 3JYTA 5HQ8A 1I94F 1Y0HA 2BJ1A 5KFBA 3CCUS 1PJ5A 4KY3A 2MLZA 2RSQA 1FTCA 3CULA 2JC0A 2QA2A 1RYSA 3L09A 1XJWB 3W5XA 2B43A 1NB7A 3B82A 4KYZA 4PXDA 1R8AA 4ZPDA 3MAQA 5J2QA 5DDRC 1WKKA 5KTQA 3M2VA 4OL8A 2R7RA 5AE1A 3MM8B 4OZ0A 1L5UA 2B6AB 2Z56B 5EWGA 2FJVA 2XI2A 4DPUA 2VDHA 2G2ZA 1LWXA 4DPXA 4P2SA 3OJSA 3DI6A 5D0EA 3DGVA 1NPRA 1SH3A 4IG3A 3H4BA 1SPBP 2D3O1 4ANDA 2DNKA 1ZH5A 1HR0F 5A8WA 1RBAA 4ZCKA 1Q4RA 1PG5B 1WEZA 3GR1A 4KGXB 4LIWA 4RW8A 4AXIA 5KFLA 3MCOA 5HATA 1YITS 3G6VA 3C6TA 2AX0A 3RYLA 2QX0A 3R97A 2LYVA 4NLVA 4ZLJA 2KFZA 1EARA 2DXFA 3GWCA 2F4VJ 3BGLA 2DHHA 3GYGA 5C25A 2F9JA 2UU9F 4FVCA 1PJ7A 2NXUA 2MKIA 2OH2A 2EWHA 1OO0B 2XEXA 2ERRA 4K7QA 3OD2A 2C1EB 2V94A 1U4BA 4UUXA 1XMOJ 2R42A 2LFVA 3M8SA 1F9EB 2ZH3A 2I0XA 1KNZA 1LK7A 1PBAA 1Q1KA 2CJAA 4RW9B 5DGBA 1UEVA 1DFDA 2BQUA 2J8AA 4ECTA 4M5DB 1NNDA 4RNNA 1QJHA 4G65A 3CJ3A 3TAPA 3ZZYA 4QPTA 1AYEA 3U1NA 1FKPA 1RWMB 5E0OA 2C3PA 3OL6A 5D3GA 3HXMA 1QM9A 1IR2A 2G0CA 4NOHA 4EEYA 2A3JA 2HQCA 4PRFA 5KFDA 5KFVA 3D5MA 4ETXA 3VGUA 4DFJA 4OI0A 5B08A 2IVFB 1TL3A 2XCAA 2BZ2A 4ZCLA 4PQUA 3BQ2A 4KJIA 1VHIA 2VDIA 3MTJA 3L9ZA 3EXCX 2MTLA 5DM7Q 4IQXA 3RBDA 4F3MA 1S6OA 2JZ5A 2FJEB 3VTIA 1YJ7A 1ITPA 2LEBA 4OJ3A 3T5HA 4OHWA 1VQSA 1L3UA 4B02A 4YY3J 4UQGA 1E6VB 4IRKA 4NMXA 2WOMB 4P7VA 4WJBA 2RS2A 2ZVIA 3HSDA 3FQKA 1YHQS 3GSDA 3U1MA 5C42B 3RBZA 3M2RB 3W61A 1N5TA 3BSOA 3K58A 4MH8A 5GAEI 2MJNA 1NZAA 1WHWA 4GC6A 3PRVA 3EYZA 4LR8A 2NYHA 4CLPA 4DR7F 4JI4F 4BDPA 4J9OA 2VKRA 2AMCB 4D3HA 1F0XA 2F9DA 4V1Ak 1MWQA 3Q89A 2MLYA 3ZZZA 3HDSA 1SUQB 3SCKE 5A8KA 4P74A 1RHJB 3OXGA 1KFDA 1GT8A 2FJWA 2GW8A 4JI8F 4OI4A 1ULRA 4NLPA 5E3RA 3CCVS 2FZGB 2J6SA 2RAQA 5KFCA 3M6XA 5D6GA 1IWAA 5ITHA 1LW2B 2RH3A 3E51A 2XO7A 3TQEA 3C15A 4XPEA 4K4XA 5CCMA 2Y1LB 4MTPA 1RISA 1LKZA 1IBKJ 2O3DA 3ZZUA 3FZ2A 1T11A 2PFFB 3Q8SB 4KHPF 1XR6A 2WVEA 4B9SA 1RTDB 4WWSA 2DRDA 2J0SD 1RT7A 4ZP9A 1N36F 3H4DA 4OJ1A 3KYLA 3H40A 2E9RX 4MKAA 2CQCA 4RUCA 4U8VA 3CMAS 2UXCF 1NK7A 3OUYA 2Q66A 1PKUA 3DHXA 4CIOA 2DRAA 5FD1A 4KO0A 3T9ZA 1HA1A 1HBNB 5LSOA 2R8HA 5B0EA 4ITSA 4RUHA 1KQKA 3ENWA 4ZPTR 2XY6A 1B7FA 2YKMA 2H54B 2MSTA 1M5PC 4IUFA 4KV8B 1C0UA 2ZC4A 1NK9A 2BW2A 3BR9A 2LXIA 4TNOA 4P2MA 3BBCA 3TEHB 2QZ8A 2RQMA 2R8JA 5LMUJ 4O3OA 3MM7A 2XHCA 2KXFA 2CNKB 3RBEA 1OYDA 2VQEF 3KK1A 4W92B 1Q81T 2BABA 1I6JA 1NBEB 2BRLA 1TK0A 2JDJA 3CCRS 4JI7F 4PR6A 1CEZA 3PRDA 2DNMA 1EIYB 3D68A 2XMMA 2MZJA 1VRTA 3NLCA 1S12A 2AJ4A 4YS2A 6AT1B 1EETB 3KJFB 4KGZB 3IFEA 3CDBA 2E1MC 2EFOA 2DNHA 1JLGB 1TUVA 1D3WA 1S97A 3I0SA 2HBZB 4OZNA 5CCLA 2G9OA 4DL4A 4OFZA 4ZPAA 4LSLB 1WACA 3NRBA 5I42B 2JEIA 2FJAB 1JQGA 1IKYA 3PDNA 4ENOA 5LJ3Y 4GKJJ 3L3CA 2QA1A 2PMWA 4BC7A 3MUVP 3D9BA 3BSNA 1RACB 2YPZA 2XWXA 4NYZA 1VC0A 4OZ1A 1FX2A 2OKQA 3PHEA 3J80U 1JLQA 1GTEA 4LBIA 2HQFA 2DD8S 1TVRB 2HAIA 5L1JA 1K8AT 4F50A 2MLXA 3G82B 1IBMJ 2XULA 1M5SA 4ANEA 2VPZB 1Q0NA 4UQTA 2W7PA 2B4VA 1I1GA 1FJGF 3IG1A 3Q2TC 4F25A 3J7AN 3VAKA 2H1YA 2ILZA 4USHA 4OYMA 2N3OA 4FBUA 2DY9A 3QGIA 4DR3J 2X7IA 3RR8A 3PO5A 3MMBA 5CZXA 4NLGA 1URRA 2C3YA 3W9JA 3D6HB 4AQYF 1VLYA 3IRXA 4J90A 2DGVA 3KHHA 3ET6B 4HL9A 2ZJQQ 3MMCB 1V5IB 1N4LA 4WU3A 2CQHA 4ZVPB 1Q7YT 3AT1B 4CI0B 2YBVA 3F44A 3RAQA 1BE4A 3M32A 2VHGA 2D69A 2M70A 3US5A 2QFJA 1GX6A 1ZAXA 5IZHA 3JTPA 3SEOA 2AYEA 1L3KA 2PC6A 3ETOA 3HX9A 2VFTA 2BM1A 1Q5YA 3M30A 1FF2A 3DN9A 4CH7A 4ZLNA 4P7TA 2XMAA 3KK3B 4B9VA 1LFPA 3TA2A 5KFXA 3WZ0A 4HH0A 3KG1A 3GJRB 2HBQB 4RBVA 4WXOA 1JX4A 2KZZA 2EVZA 3BGRB 2RUSA 1T03B 1A7GE 3DGPB 4JI8J 1N34F 5F8HA 3DYAA 2DHXA 4DV7J 2GHWA 1EX8A 3OTCA 4DX5A 4RJVA 3POTA 2YWFA 2OI2A 1KLMB 1Z2ZA 3MR2A 4NLDA 6FD1A 2BJDA 2GVZB 1UEKA 2HS0A 3KDNA 3S1TA 2CKWA 1VQ4S 4NPOA 2ZC3A 3UE2A 3PIOQ 4DV6F 4U9RA 2B8QA 4BWJA 2D9OA 3JB9k 4LJMA 3J81j 1WI8A 2KRBA 5C7PA 1TV6A 5CA5A 2V67A 1T9UA 5KFEA 2QLXA 2C2KB 1WD6A 2M3DA 3WHIA 4WFBQ 2IM1A 2ZUAA 2OTLS 2ZHBA 4DUTA 4K0KF 4LSNA 2HGMA 3K89A 3V4MA 1HNWJ 1LK5A 3M7VA 1RQ0A 4JI2J 2MZ1A 2H4WB 2PMZD 2O1PA 2Z2ZA 4WXWA 3JTOA 3VV2B 1GAOA 2Q6BA 3TRGA 4FVMA 1R27B 4C11A 5D4NA 4OMFG 1WOOA 5E3QA 3R2DJ 3IWNC 3DLEA 1S10A 4I7FA 3G86A 3SI8A 3CJQA 3B8HA 2UXBF 2IMWP 4DMZA 2UUAJ 3R1LA 3PW7A 2RRBA 4DV5J 2R2SA 1DQ9A 2GO9A 4G1PA 4L72B 1S48A 3DM2A 2AJ1A 1TKDA 4ECQA 1FXDA 2QG9B 1FERA 3CC2S 1HW8A 1MLAA 4B3OA 2Y8YA 1TUGB 4A8FA 1TL5A 2IJFA 2E7VA 1YK9A 1DURA 5IFMA 4NASA 2PD1A 5IXUA 2CAJA 4OLOA 2ZD1A 4DDFA 1T9TA 3MR5A 1UZHA 3ELHA 2DNPA 4UOGA 3PZPA 2EFNA 4E98A 1S6PB 3J81Y 2W2QP 4ZPCA 4OZ5A 2HQDA 1S1VA 5F3TA 2ZUGA 1LV5A 3EGWB 4IRCA 4LF5F 3P96A 3PV8A 1WWHA 4B3MF 4N47A 4MMOA 4G3IA 3PJ9A 2KT3A 4FS1A 1YIJS 2VL1A 3GU0A 2RILA 4EBDA 2AGOA 1LQ9A 3RG6A 2GIQA 5KFRA 8ATCB 5IC4B 3R9LA 1EP4A 3HKWA 2BKNA 4ALZA 3EZ5A 2R7QA 4A46A 3KLGA 3LPYA 1OJ4A 4I68A 4PEOA 3W62A 1YJRA 5DGAA 3IBWA 5HP1B 1QSYA 3CCMS 3QQCD 2E1PA 1CQNA 1FNOA 2R7VA 3A13A 2V9WA 4DQQA 1RHMB 2ZM6J 4NA2A 1MSWD 1R43A 2H5IB 1WELA 4LF6J 1CG2A 1TFWA 5L1LA 3A8JA 2Y0SD 1U1QA 2HNZB 2E1CA 5I3QA 2JJ4D 2W4CA 4O23A 1SBRA 5C5JA 2W9CA 2CJYB 3TJ9A 4OYPA 5KFWA 4RLEA 3PG9A 1S6QB 1YRTA 1S0OA 1S5ZA 4K8RA 1FX4A 3VVTA 1RYRA 1BGXT 2XMJA 3HVAA 1WDTA 4B3RF 1VQOS 2AD9A 3QIDA 2D3ZA 1JXLA 2M52A 4F4YA 1C0TA 1KWMA 1VMBA 4C8NA 3HCXA 1MWZA 1XK8A 4P10A 2ZH4A 1U2RA 1DY3A 1C0UB 2NXCA 3D1OA 1NK4A 2KM8C 4RW4B 3TP2A 4CTAA 1S6UA 1FFWB 3FMBA 4Q7AA 5KT7A 1UFKA 3HT0A 2W1BA 4B9LA 1R3NA 4DX7A 2VG7B 4NYPA 1T3NA 3MM7B 2C42A 1WF1A 1UW9A 2AQ4A 4TQSA 2V9KA 4X64J 4LRCA 3LUYA 1TAUA 1ZA2B 1RKIA 1D09B 2CPDA 3DRPB 2GMJA 1RTJB 2X3GA 4ED4A 4OYZA 3EPIA 5ETKA 5HAOA 1L3TA 3CCLS 1N34J 4LF8F 3MZIA 3GIKA 5KT3A 1LW0A 4IFVA 4ZS6A 2YXLA 2E5LF 3AXKA 3IR5B 2HFOA 2CG8A 2EFGA 3NGKA 5J2PB 4OZ2A 1IUJA 4WYWA 3VF0B 3NWGA 4HTIA 2HFSA 3GJQB 3SV4A 2EBGA 3KK2A 3BZQA 5BXIA 3LAMA 4CLFA 1SXLA 1PGZA 3BO3A 5D0HA 5T41A 5GAEU 2P6TA 1IKWA 3DMJA 2A2DA 4KGMA 4N76A 4DU7A 3W63A 2FD2A 1TMJA 2AZ3A 1BXNA 3IXQA 1WC5A 1GQEA 3P5BP 3BH6B 4ZK7M 2FQQB 3D1HA 4J7CA 5GMKa 5BR8J 1RT6B 2H5EA 3DOKA 2Y1RI 2GS8A 3I0RA 1TTHB 3ILIA 5CABA 3HHNB 4WZQA 2AEFA 1WTFA 3CTRA 3IM9A 1REGX 5CXTA 5D77A 2NUUG 2R7TA 4CZCA 4TXSA 1JLFA 4PWDA 5KG6A 1B64A 4QU7A 4FBTA 2UXBJ 4YP3A 3IG1B 4K2JA 4DV0J 5CH7B 4AD6A 1RE1B 1IN0A 1IWGA 2EW9A 4CLYA 1DQ8A 1WHVA 1X4AA 1AT1B 3HHKA 1QD1A 4ECYA 3HHDA 3IRXB 2LXFA 4A8QA 1T9XA 1W25A 3HSJA 4NYOA 4RU2A 5DLGA 1FO1A 2K1RB 2JSXA 1UA0A 4USMA 2QFIA 1B70B 2J76E 4DG1B 2XYHB 1KD1T 3OVBA 3W60A 1WUUA 2KHDA 5IQQA 1TU0B 1RABB 2HVIA 3VALA 4NA1A 5G0RB 2RKIA 1JK9B 5EX0A 5LT5A 4DFMA 2XZDB 3MOZA 3SCIE 3D2WA 3R7NB 4WE1B 3DC2A 2IVMA 1U0HB 2I5JB 2HBYB 1OSDA 2DJWA 2G2YA 4X62F 1X9MA 1ZTWA 5H1SV 3MR6A 2KRRA 3GIRA 3DLLQ 2I9SA 5C2GA 3SMZA 3IR6B 3DLKA 5AE2A 2B7BB 2G1DA 4RZRA 3V4IA 3PM9A 2OFGX 1HHSA 3B4DA 2BQ3A 2OIHA 2Q79A 3BQ1A 2G13A 1HKAA 3EVMA 1VR6A 1DTQA 4I69A 3FCVA 4Y2CA 3TZWA 1U8WA 2ZH2A 4C48A 2FPHX 3LO3A 2BRKA 3LP2B 2GA7A 3GIIA 1TUWA 4BWMA 5K14A 3ILOA 1Y4ZB 3FSXA 1IM6A 1FE0A 4X2BA 4PUOB 3N6MA 3HHEA 1Q95G 1RT1A 1G7CB 2DNLA 2R2RA 4C3KA 2J0XA 3AQPA 1FRIA 1HL6A 4M5KA 2BMBA 3UPFA 4Q0BA 4IRDA 2AGPA 4WCEQ 3OHBA 1RAGB 1UKUA 1VQ9S 3EGVA 4BHQA 4DR1J 1T7PA 1K0TA 5H9EJ 2RDDA 4QIGA 2RJZA 1N5YB 4PG6A 5IOLA 2VG6A 1HHQA 3VWSA 3T5LA 2XGPA 3AQOA 2GVDB 4X4PA 3BDEA 1R0AB 3HJVA 1MNEA 2RU9A 2CVEA 2HNDA 4LVNP 3KXDA 1SKRA 5FDLB 3C16A 4H4OB 4H54A 1HIYA 2YKAA 4CM0A 2LEAA 4USJC 3CW2C 1CJUA 2BR0A 3K5PA 3G8TA 2UXDJ 1KSPA 2ZNYA 2HHHJ 2M88A 2FLNA 1BQMB 1S1XB 4ZVSB 3ITHA 5K8NA 2WBMA 3A1YG 4LFBF 3QO9B 2HRTA 3KMSA 5AJ3J 1QUPA 4YB1P 2WHOA 5J1EA 3PR4A 2RF2B 2M7SA 2HAFA 2ZNZA 1E6YB 2J7KA 4ZIVA 1AXQA 4ID8A 5L1KA 1HNIB 2BBEA 4ZVQB 1T8EA 1NRKA 2V2QA 2RS8A 2PMHA 4LF8J 2P9GA 4R0EA 4A47A 2Z2MA 1AFIA 3TJAA 2QLBB 1HQEA 3ULHA 4P72A 1S49A 1QAJA 1ZOTA 4DPYA 2DR6A 2UVVA 1VDHA 2J7UA 3UVJB 1YZ6A 5MLCV 3O5TB 3JQMA 3QBCA 1CJVB 4LRFA 1P9QC 5M2UA 2H3EB 1T94A 4OI2A 2LA4A 2V69A 4Y65A 5HMZA 3AJ1A 3TARA 1NSQA 4ZVUB 1S76D 1TKTB 4KB7A 4AFFA 2Q43A 1RT2A 2YQ0A 1O8BA 2G0IA 4K4SA 2BJ8A 1JNZB 2RVJA 1P1LA 2GQQA 4NXMJ 3HPOA 2CJBA 5DLFA 3KNAA 2X1GA 1M5VC 2Q6CA 1WI6A 2V50A 4IDKB 4GRSA 1K1SA 4LF7J 1Z4UA 2KB2A 2E44A 1WOPA 2KT2A 2KO1A 1YJUA 4OJGA 3N6NA 3BGUA 3HD1A 5KT4A 4WZMA 1AZSA 4FNHA 1WG5A 3V6JA 1TAQA 4DR5J 2HS3A 5ETVA 4QCLA 2XYPB 4QR1A 3V6KA 3R5AA 3V6HA 4N8NA 4TU9A 1TK8A 2B4PA 2C2DA 1HNZF 1FT8A 3G71S 1U6ZA 3K5LA 2QSFA 4DX6A 2NLWA 4FF1A 5I3PA 5EWFA 1IR0A 3RRHA 1VQ6S 2BE9B 2V6AA 3CC7S 3VAIA 1WC6A 4C3MA 3OL7A 3P4UB 1VYAA 1RWNB 2ZZNA 3RR7A 4J9RA 3I82A 4LFCF 1FKAF 3QRRA 4M63A 3OV7A 1V3SA 4CO1A 4JV5F 3F73A 5J1PA 2XSJB 4DJBA 4Q8EA 3PW0A 2XQCA 4J9QA 3LGNA 2CJKA 1YX2A 3KLFA 5K20B 2M8HA 2ADCA 3ZTOA 2OPRA 3CD7A 3NS6A 2VPYB 2F8MA 4NX9A 1RTIB 4ERDA 2BANA 2DNNA 1RCXB 3TO8A 1HQUA 2F65A 4DUZJ 3QJJA 1IVZA 1H72C 1H7WA 2V8HA 1FI4A 5ADZA 1IQZA 1BLUA 3AB2B 1NHVA 4X4TA 8RUCA 3QFWA 4ZP8A 1HI8A 3AA8A 2VQFJ 5DQGA 4X66F 1TQLA 4F0KA 5FLXY 2IA6A 3Q8VA 1OS5A 2RUGA 4QWCA 1OPIA 1Q8IA 2OLWA 1DTTB 1ZM2A 3ILJA 2EFVA 3Q8PB 1RT3A 2VA2A 1FDBA 2OGUA 1S1WB 3N79A 2VFVA 3QWUA 4HT7A 4LF1A 3M9NB 2VC0A 1VBKA 2PEHA 3NAIA 2MB0B 4DV4J 1JJCB 4FPIA 4X4QA 1AA1B 2ZBRA 4GVBB 2KM8B 3BKFA 2E9TA 4CM2A 4WFAQ 1VJQA 5I3UA 2JEFA 4NI2A 3BV8A 4EZ6A 2F4FA 5KFHA 3OXLA 4H4MA 1FWPA 1ZPWX 3JSMA 3W2WA 4RO0A 2XY7A 3RUBL 1SL0A 1NK8A 3GPAA 3OFFA 2YWGA 4EYIB 3BBFA 1LOUA 2UVWA 3T1YF 2D3UA 1NH7A 4R5PB 1Y10A 3ICLA 5D8HB 5F8GA 2JFKA 1LWFA 1XERA 1JKHB 3A8KA 4YB6A 4I2PA 1IJFB 1L3VA 1NJIT 3THTA 2NR0A 1FFSB 2HK3A 5L46A 3OTEA 4TKTA 1XNRF 2H51B 4OV1A 4ZPBA 5T7LB 3M8YA 4MYTA 1B0PA 1IKVB 2FJXA 1IBLJ 5HL7Q 3MCNA 3X3UA 1HARA 3DOLB 2FC8A 3CEDA 3I87A 2A0FB 2CPJA 2RKIB 1HYSA 1VQKS 2YY3A 2G0JA 4G1QB 2NPFA 3VR1A 3TAQA 2MHNA 4L6V3 2P5VA 1UMJA 3PW2A 5DJBA 4C98A 3M8WA 1HBMB 2BW7A 2ATCB 1M5HA 3QIPA 2IRXA 1U48A 1OSCA 3QATA 4A4JA 4TLRA 1JB0C 2RIJA 4JI3F 4KT0C 4BBYA 3CCTA 1UJ4A 2BJ9A 3HF5A 2A6MA 1SIWB 3QAUA 2O01C 2JLEA 2UUCJ 4X84A 2VUGA 4O44B 2X1AA 5IM0B 3MEDB 3W8PA 3HHLD 5U47A 4Q2LA 3DLHA 1SC1B 1VK3A 3KLHB 5DG7A 1NB2A 5E2QA 2DH7A 4JI6F 5GADI 3FZBA 3MAHA 4FPRA 4OLPA 2GHPA 2WZ1A 2DBBA 3FSIA 2EFQA 5KT2A 3MM8A 3Q83A 5C2CA 2ZH1A 2RQCA 2B6AA 2K3KA 2ZBCA 2VC1A 2OPPB 3IC1A 2HMIB 4DL2A 1YWXA 3N5FA 4DQIA 2MDAA 2QL9B 4NZ6A 2QSWA 4DR2J 1YBTA 4EMDA 2GC8A 2NCKL 1HNXF 4IQMA 3GP9A 5LM7E 1S72S 1NKCA 3HKZD 2KYZA 2CQGA 2VA3A 5B0GA 2DIVA 4WIIA 1SC3B 1VQ5S 1HNZJ 2VPXB 4ELVA 2ASDA 4OX9J 4WYLA 1B4SA 3QYYA 3H5YA 3V2UC 2KVIA 5DZ6A 3CCZA 4UTGA 3AD8C 1M5KC 2HNDB 2CPFA 2JNJA 1NU4A 3PEHA 3PCOB 1I5OB 3NS7B 1H2UX 3PX4A 4O0NA 2GIRA 4DSIA 4I4BA 2JH3A 4TY8B 1N33J 2AZ1A 1KRPA 4D3GA 2FJDB 4DCOB 1CJKB 2JWNA 4PXCA 5DG9A 1X0PA 5B09A 5F8IA 1HMVB 4NRTA 3ZC4A 1BMQB 1DBDA 3HLUA 1YVFA 5A2QU 3FRZA 1J5OB 4F4XA 4J9VA 3OPKA 1PSDA 3NGRA 3EZUA 3KHGA 1U1KA 4RW9A 1ZZNA 2HVEA 2UV8G 3MOJB 2C3MA 2DK2A 3PHTA 3BN7A 2BJEA 4M5DA 4CYUB 1QAXA 2W7OA 2GMLA 1ZETA 3LALA 4WK1A 4J9SA 1NLKL 3R5BA 4L73A 5DS7A 1O5JA 2FGCA 4JB8B 5A2QY 4Y6IA 2W2NP 2V4JB 2A18A 5HVFA 1M90T 1SH0A 1JJ4A 4J9MA 1AB8A 2CQBA 4QJVA 3KHLA 2XY5A 4QWAA 3CIMA 5HVHA 1CLFA 4XDCA 4MK9A 4IR9A 1K47A 2R7OA 2AYGA 1FRLA 4P52A 3CDWA 3FCWA 2MKSA 3VQTA 4N7TA 4LR9A 1Q86T 1LWEB 3NGDA 2V4RA 3FBBA 1Q53A 1U7LA 3WC2A 2F8EX 4Y34A 1PCAA 5ETTA 4MIWA 1GMWD 2YNFB 4NE9C 3G9CA 3UQSA 2B4OA 1R6YA 2Z2LA 2H48B 4ZDNA 4PPDA 3AXMA 2V8VA 3FQLA 2DNGA 1ICEB 3UCGA 3NOCA 2SXLA 2YPYA 1FTRA 2Z0GA 4IO9Q 1E6VA 2XMTA 2G1HA 4G1IA 4URQU 1SB6A 5KFGA 5C42A 3RGIA 2B9YA 5BYSA 3ONQA 3KJQB 3OFEA 2XS7A 5HJXA 3LWMA 2XO6A 2XYGB 4ECZA 4PZVA 5HBMB 1SJRA 2Y1IA 3NAHA 4CLTA 1WHXA 3KFWX 1SL1A 1NPKA 5F0UA 2F4VF 2IDEA 3N5BA 3W2VB 1SUQA 3BDPA 2JC1A 4L75A 1VGYA 2OP5A 4UT4A 4M5GA 1H74A 4ECVA 1NKEA 4R0JA 4PPZA 5CYMB 1B99A 2UUBJ 3MD3A 1EKSA 3JTNA 3MMAB 1JLCB 1DHMA 4IOBA 2FVPA 1XMOF 1LW2A 2FY8A 2B9EA 3QGHA 3LTOA 2NXJA 4MYUA 3SQGB 3CIZA 4C97A 3R6GB 3L7OA 4IKAA 4PAAA 2OSRA 2ZFHA 1NDPA 4RPFA 3W5YA 2U2FA 4WU2A 1HQUB 1WNEA 3D67A 2RQKA 2BV3A 4E8UA 1AW0A 5E3AA 1JXEA 5LSLA 4TU8A 1T05B 4YDDB 2YWWA 3I32A 2FB0A 2D41A 1Y00A 2BE7D 1WC1A 2VBXA 2F40A 2DHAA 4MIAA 3HZGA 2CPHA 3IBCB 2LQJA 3WIVA 5CD4A 2VB6A 1YG0A 4XPCA 4LF2A 4U7UK 1C1CB 5ETOA 3BO2A 1QE1B 2EXUA 4CNYA 1F60B 4CLLA 2KT5A 4DFKA 1HBNA 2JFDA 4C8OA 3S7RA 4FKXA 2VPWB 2C28A 1VOMA 2FLLA 5F8JA 8AT1B 2MMYA 2KJWA 1N56A 3W7BA 2CPEA 4DR6J 2ZE2B 4KV8A 5DZ7A 3RW6A 2LXUA 3LW5C 3K2YA 3D4JA 3Q8QB 1UWBB 3FBFA 2DPIA 4J5OA 4KPCA 4LVOP 2Y1JA 1Y3KA 1WKJA 4IH5A 4Z7CA 1YSJA 4UUWA 4I2QB 4WKRA 1KHVA 5F8LA 1VQLS 4EFAC 2UZAA 4OQJA 3CDAA 3KLEB 1C1BB 2DISA 2PI5A 5SUHA 4QIVA 4QYZK 1WG1A 3TI0A 1KBRA 4DSJA 4K5SA 1VRUB 1ZBTA 4YY3F 4ZVRB 4M5LA 1JJHA 1X5PA 5E3PA 2RDIA 4F0HA 3W64A 2MZQA 2CYYA 1RP5A 4EU0A 2BOAA 5KFAA 1GXTA 2A10A 4ZLPA 2XNRA 2HYIB 3BS9A 4O3NA 3O6QA 3PJXA 4Q44A 2YWKA 1EETA 3IAS9 4DF8A 3T5KA 2HZCA 2B7CB 5J2MA 2W25A 3C8YA 3OTOJ 1S77D 1JLGA 4PG4A 2VJVA 3BGFA 4MJKA 3O44A 4LSLA 1U02A 1KOOA 5I42A 1FNMA 3C14B 3NXZA 3MPWA 3EGNA 4TVAB 3UI3A 2M5YA 4DWIA 4G6VB 2WBRA 1YJ9S 3MEGB 4USWA 1U1NA 4K5RA 2HGNA 3DRSB 3M1VB 1NH8A 1BUXA 3DRRB 2N7YA 3QIPB 2W4PA 2DEIA 5KFJA 2GO8A 2Z4PA 3VAMA 3TZXA 2ZBIA 2IAJB 4DLGA 3FUYA 3RRGA 1TVRA 2MKCA 1IBKF 2HPUA 3PTWA 3MXHP 3BREA 2AT1B 3G82A 2KVQE 4QZVB 3WBZA 3CF5Q 4CQ1A 2BOPA 1QSLA 4PYDA 3AOBA 2H5JB 2WW4A 2JRSA 4ZCIA 1JLBB 4WP9A 2ACYA 2HQGA 3GMGA 1F5CA 1HNVB 3RZAA 3M6WA 2VV5A 1SC4B 1HI0P 6FDRA 1XNQJ 3MM6B 3ZO7A 3ZZOA 4ECSA 5HJYA 2QN6B 1KVKA 3MM9B 3ET6A 2HWTA 1Q8LA 3MMCA 2VONA 3H25A 4JV1A 4EWTA 5F9NA 5CAAA 3CUNA 3MEEB 4PKDB 3QGPA 4WF9Q 3L95X 2EKYA 3GZ7A 4K4TA 1FEEA 3PR5B 3CJ5A 3BR8A 4CO0A 4JUZA 1WEYA 3E01B 5LMUF 4KGVB 2J7WA 4U8YA 1RBOB 2VG5B 1S1TB 4ED7A 2IVYA 1U09A 1PYSB 4Y2MA 3RB3A 2MPUA 2E7WA 3CJ0A 2LKZA 2HVHA 2AGQA 4DR4J 2K7JA 3LPEA 3KK3A 3DHWC 1OQ3A 2DGUA 2AW0A 1AFJA 2OPSB 2HFVA 2LQ9A 1TKZB 3BGRA 2FDNA 1T03A 4O3SA 4GVLA 2QL5B 1M1GA 4YDXA 3DGPA 2B51A 4F2RA 4JI0J 4CO2A 4XTTA 1P9YA 5A8RB 1Z1ZA 2HHVA 3HHLC 2ZH6A 2WTFA 3QMQA 1KLMA 1RHRB 3D6TB 4Y2KA 3ENVA 3EICA 2GVZA 4ZVTB 2GJIA 4PYAA 4JI1J 2DHGA 2OFHX 3KMQA 2OD4A 2EEYA 2V63A 1RKJA 2WVCA 1D8ZA 1P1TA 1NDLA 4CLZA 4GKJF 4K2XA 2NZ4A 4UY85 2VH7A 3FKBA 3TR5A 1PIEA 2FUG9 1VC6A 5KFOA 4USUA 1FRJA 3BYRA 2OEJA 1N8RT 5F8NA 4KPYA 2CDRB 4UOFA 4WFYA 1VQ8S 4A8MP 4HHHA 2AV5A 3A4TA 2XM3A 2B0GA 4ZIWA 5KFKA 4LMZA 2HG4A 2B8PA 3TYTA 1IBMF 2RMLA 3HVTB 3EXYA 4L74A 1RU2A 1F9HA 3QRPA 3AY0A 3U02A 1XIQA 1JLEB 4DF4A 2HVDA 3UWTA 1HPZB 1WHYA 2ZZTA 1NO8A 5KFNA 3CT9A 3P8BB 2DR9A 4V19X 3NOGA 3MWBA 4DR3F 3FC9A 4MKBA 1MROB 1VQMS 2IY5B 3RJMB 1X4DA 3R2CJ 3W1YC 2E9ZA 1D8YA 3NGSA 2HKEA 1UETA 4DQPA 1X60A 3FBEA 4Q8FA 1XWLA 4F0MA 2QLWA 1FD2A 2GJ2A 1HWKA 3KDOA 4QWEA 3OW2R 1DLOB 2HIQA 4F3OA 4QIWD 1S6PA 2BUNA 1WC0A 3M05A 4E2FB 4OJHA 3NMRA 3V81B 1H3DA 4C0BA 5F3ZA 4LR7A 1HLWA 1F5BA 2GFFA 5D15A 5CYQB 4DCJB 2F5GA 4R25A 4EBCA 2DHSA 3CC4S 5DO2A 1OY9A 4N5SA 3D54A 2O5DA 3SDEB 3M2UB 2Z2YB 1Q8KA 1PILA 2IFXA 3D66A 5HMYA 4LBPA 5SZTA 5F8MA 1U8SA 4USKA 2AWZA 1T02A 3KUHA 3LP0A 1IXKA 2VZ9A 4DV7F 4K4UA 5H9FK 2V34A 2L48A 2MKJA 5HP1A 4HLBA 4P73A 2VBWA 1NM2A 3GONA 2QMWA 1W2IA 2DPJA 1YZ7A 2XLIA 2M0GB 1XR5A
chains in the Genus database with same CATH topology
4WCEQ 4WKYA 4HT5A 4TQRA 3OHBA 4J9LA 1UKUA 3TAMB 3CB4A 3SSRA 4HVZA 1VQ9S 4BHQA 3DRSA 3I5AA 3OLAA 1T7PA 1K0TA 5H9EJ 2UUBF 3WC0A 3M1VA 4QIGA 2RJZA 2MZTA 2WRMA 4H4KC 1N5YB 2DH8A 3DRRA 4PG6A 1TR0A 3WDOA 2HNZA 1LWFB 5KT6A 3IN5A 4ELTA 2VG6A 3VWSA 3P3DA 3FFIB 4EO6A 3AQOA 4I2PB 2XGPA 3T5LA 1R7IA 2M9KA 4U7CA 2CRLA 4X4PA 2R8GA 4Y2AA 2QT7A 2E1AA 2KFYA 1B0VA 4GC7A 1LWCB 3P5TL 4DL3A 1PC4A 5D4OA 1TL1B 4QYRA 1S6QA 3BDEA 4X4SA 3GV5B 1R0AB 4C0HA 1MNEA 2RT3A 2RU9A 2CVEA 1V3RA 3HP6A 2HNDA 4LVNP 2IAJA 1RWUA 5KFPA 4ZP6A 5A8KB 3OLBA 1SKRA 5FDLB 3NNAA 2YKQA 1HW9A 2YTCA 4H4OB 5K8OA 2E1RA 5DRKA 2HLTA 4H54A 5KG5A 1HNWF 2YKAA 2FVQA 4AL5A 2LEAA 3N0VA 4USJC 2NSCA 4JI2F 4YQWA 5L38A 3K5PA 2F1FA 2BR0A 1MMNA 3JSBA 1IJEB 3G8TA 2WK4A 2W9BA 3K0JA 2HGLA 2E7XA 5E33A 2MQLA 1NEEA 1KSPA 2R8KA 3I31A 2ZNYA 3PACA 4J9PA 1FDDA 2N4CA 3CCQS 2M88A 2X1BA 3VZHA 1S79A 4HH1A 4HHJA 1WF2A 2FLNA 3T9NA 4ES2A 2BE2B 1BQMB 2AP6A 3BJYA 1HYSB 1GX5A 1S1XB 3G8QA 3ITHA 5K8NA 2WBMA 2KKHA 3A1YG 3G96A 2DR7A 3TW0A 3IAM9 3AB4B 3PRBA 4FS2A 3TANA 4B3SF 1X7VA 1UFLA 3QO9B 1JLBA 4IH6A 4LFBF 4MFBA 4N8OA 3KMSA 2ZH7A 2HHXA 1QUPA 4YB1P 2OD6A 1NHUA 2IYIA 2H9ZA 1YTYA 2WHOA 2XMVA 4R8UB 5J1EA 3I4PA 4RW4A 2PIIA 3PR4A 1VBZA 2RF2B 3Q24A 2DO4A 4FXVA 2M7SA 1U1LA 2UUAF 2ZNZA 1HNVA 1O51A 4PXBA 1E6YB 2J7KA 1AXQA 4IR1A 4ID8A 5L1KA 2UVUA 2MYFA 1HNIB 2HQ3A 1JNRB 4DV5F 3CJ2A 3ISZA 2PT0A 2V2KA 4NLOA 3G8SA 3CCES 1UVIA 2VG7A 4FNIA 2RB7A 2BBEA 2MKKA 2J0WA 1NRKA 3MM6A 5JJBA 1T8EA 1UVMA 4Q2MA 1X4BA 2KTQA 1KQGB 3RB0A 3DNCA 3MM9A 2RS8A 2PMHA 1UVKA 1RT7B 1WEXA 2P9GA 2ZHAA 2DGSA 4YB5A 2M8DB 3MEEA 4R0EA 2RNEA 1VI7A 2Z2MA 4A47A 3JYTA 5HQ8A 5DQHA 1AFIA 2FVSA 2MZRA 2PO4A 1I94F 2GMHA 1RGVA 1Y0HA 4OI1A 3OUYB 3NL0A 4DR6F 1HQEA 2CQPA 3ULHA 2AJQA 5KFBA 3CCUS 1S49A 1QAJA 1FK9B 4C8YA 4DSFA 5EGYA 2RSQA 1FTCA 1ZOTA 3CULA 3TVKA 4KO0B 4O0IA 1VC5A 2JC0A 1KLNA 4CO3A 3D28A 2QA2A 2UVVA 2DT9A 4I6WA 1CQMA 2J7UA 5MLCV 1RYSA 3O5TB 1RT5B 5M2RA 3L09A 3DRPA 1MW7A 4QW8A 4FF4A 2B43A 1P9QC 1RTJA 5M2UA 3E01A 3I5CA 1NB7A 1JMTA 1MMLA 1T95A 2Q1LA 1T94A 2VG5A 3B82A 2J9DE 3M6VA 4OI2A 4MKYA 2LA4A 5EDWA 1FJ7A 1S9FA 4NLYA 4Y65A 3KG4A 1S1TA 3QJLA 1OWXA 2IRYA 5K9FA 2J9CA 4PXDA 1R8AA 2AF6A 4ZPDA 3IA0A 5HMZA 3NKYA 3AJ1A 3MAQA 5J2QA 3TARA 5C24B 1BC6A 2YKMB 5DDRC 1HD0A 3N9UC 1S76D 2NPIA 1QLNA 5KTQA 1TKTB 3GFYA 1KTVA 3M2VA 2YX7A 2DITA 4KB7A 1RA6A 4OL8A 3LANA 5J2MB 5CQGA 2R7RA 3CJKA 5AE1A 3MM8B 4OZ0A 5J2PA 2LDYA 1L5UA 4DSEA 4AFFA 2Q43A 2B6AB 5LSRA 1RT2A 4CO5A 1O8BA 2CZVC 2FJBB 2IHR1 5EWGA 2J9DA 3OL8A 2FJVA 1DRZA 2OMOA 2XI2A 3Q2SC 2OPSA 5HI7A 1TKZA 4K4SA 4A8YA 1NK5A 1JNZB 2RVJA 1Y5IB 4P2SA 3OJSA 1RI7A 3DI6A 1P1LA 1XTZA 2APOA 1SH3A 2GQQA 4IG3A 2MGZB 3H4BA 1K0VA 3T3FA 1QUVA 2DNKA 3HPOA 5A8RA 2L9WA 1N0VC 2CJBA 5DLFA 1ZH5A 2VBYA 1HR0F 5A8WA 2HHWA 1BQNB 3KNAA 2X1GA 4DQSA 1M5VC 2Q6CA 1WI6A 2FIUA 3KK1B 4ZCKA 1RT4B 4Y00A 4IDKB 4XDDA 2LMIA 1Q4RA 1K1SA 2F3JA 3O3LA 4C7QA 4ATNA 5I4MA 4V19J 1WEZA 2LEPA 3GR1A 3OTOF 1Z4UA 2WSFC 3MEKA 3K8WA 2KB2A 2E44A 4LIWA 3J7YU 1JJ2R 5HO4A 2F7VA 4RW8A 4OZLA 4C9DA 1U1MA 4NLRA 2KT2A 3SCJE 4AXIA 2KO1A 1AUDA 4UOCA 4QR2A 1YJUA 3DU6A 4OJGA 3N6NA 5KFLA 3BGUA 2DH9A 2NREA 3N01A 1TKXB 3OTBA 2EI5A 4O4RA 1YITS 2I2YA 5KT4A 2HS4A 4WZMA 4RKUC 4EO8A 2BVZA 4FNHA 2PA3A 3PNIA 2HNYB 3G6VA 1WG5A 1NK0A 3C6TA 2IBOA 3OR1B 1RT6A 5KG2A 2AX0A 1VRTB 3RYLA 1G6BA 1GNKA 3V6JA 3TOQA 3I6PA 3MURP 1TAQA 2YQ3A 4DS4A 5BYRA 2HS3A 1KN6A 2ZM6F 3T1HF 4QCLA 2RU3A 2LYVA 4NLVA 4ZVEA 4AL7A 4LF6F 4AYBD 1ZM4A 3GR0A 3G4SS 4LQ9A 4QR1A 4I1TA 2KFZA 4IOCQ 3PO4A 2HHSA 3V6KA 4EZ9A 1U6FA 3MF5A 3UFCX 3QGGA 3I0SB 3T5JA 3R5AA 3NBPA 5L8RC 2JVOA 3GWCA 2MSSA 3V6HA 1PO6A 2JEGA 2VBZA 1G1XA 4I6YA 4N8NA 4YFUA 4TU9A 4ED3A 3BGLA 5C25A 1TK8A 4DL7A 4ZPVR 2B4PA 4NWBA 2F9JA 2C2DA 2UU9F 2BYCA 1HNZF 4NRUA 4FVCA 2NXUA 3D0GE 2MKIA 2NS1B 2OH2A 1FT8A 3J80Y 2EWHA 4WFZA 3G71S 1U6ZA 1OO0B 1Q7LB 1IKYB 2JL9A 1XBWA 2YWHA 3RU0A 3K5LA 2JLGA 2XEXA 2ERRA 1X0FA 2QSFA 3FEXB 2NLWA 1RTHB 3VAJA 1M1KT 2V0NA 2POKA 4FF1A 2V94A 3ISND 1U4BA 3ZZPA 4UUXA 1N54B 5I3PA 2QO3A 5EWFA 1IR0A 5GAHU 5KOWA 3RRHA 4K4WA 4WFXA 3M8SA 1VQ6S 2IBKA 2ZH3A 2I0XA 2DNRA 3R3TA 3CC7S 4E0DA 1KNZA 1V9OA 1LK7A 3VAIA 1HBUB 1YBAA 4K4VA 4KTQA 3HVTA 3CCJS 2U1AA 2IMOA 2KH9A 2VODA 1FXRA 1Q1KA 2K1RA 4C3MA 2CJAA 4RW9B 3MUMP 3GG1A 3AAWB 3OL7A 1OQ6A 5DGBA 4U67Q 1UEVA 1DFDA 5LL6d 2BQUA 1H0HB 1JLEA 2J8AA 4DG1A 3PVXA 2MQMA 4ECTA 2ZZNA 3RR7A 4J9RA 2BM0A 3I82A 1JLQB 1HPZA 3K7RA 4M5DB 4LFCF 1FKAF 3NCPA 4F4KA 1NNDA 4RNNA 4NCAA 4ZVHA 4M63A 3OV7A 4QW9A 1V3SA 3E2EA 4CO1A 3F56A 3ZFVA 2EK1A 3F73A 4JV5F 5J1PA 2XSJB 1Y5NB 4DJBA 4EUVA 1RAJA 4Q8EA 1MROA 3HI9A 1C2PA 4UW2A 1TP7A 1QJHA 1MMDA 4XO0A 3PW0A 4J9QA 3CJ3A 3KG0A 3LGNA 4TYBA 2CJKA 4DFPA 1NAQA 4AL6A 5G0RA 3TAPA 3KLFA 3ZZYA 4QPTA 1XNQF 3OR2B 1FJEB 3I55S 2M8HA 3U1NA 2ADCA 1H98A 1FKPA 2OPRA 4QIFA 2CQ0A 1MU2B 4WE1A 5E0OA 1FRHA 3CD7A 2F8HA 3KLIB 2VPYB 2F8MA 3NS6A 4NX9A 2C3PA 5FIIA 4TLQA 3OL6A 1RTIB 5D3GA 1KR4A 4ERDA 3HXMA 2I5JA 2BANA 1QM9A 1VFJA 2G0CA 4NLQA 2DNNA 3C46A 4X64F 3H59A 5GAGI 4NOHA 4ID5B 4EEYA 3FJ2A 3TO8A 1HQUA 2A3JA 3OXFA 3QJJA 4DL0C 4PG8A 4M1KA 2HQIA 2COLA 1H7WA 2V8HA 3H2LA 1KFSA 5AXKA 5ADZA 1DLOA 3LQVA 1IQZA 1BLUA 1K1QA 3AB2B 2R8IA 1VBXA 3MMBB 4QIEA 4PRFA 3VQSA 2X51A 3MHYA 5KFDA 4WFNQ 1VS3A 1NHVA 4KHRA 3GYXB 3D5MA 5KFVA 4X4TA 4ZP8A 1HI8A 4ETXA 3AA8A 2HWHA 5DQGA 4X66F 4A8OA 4DFJA 1QVGR 1TQLA 5FLXY 2IA6A 2ATLA 3SFGA 4OI0A 5B08A 2C2RA 5GVQA 2CQ3A 2IVFB 1TL3A 1WF0A 1OS5A 3CSKA 2XCAA 2BZ2A 4ZCLA 3V81A 2RUGA 4PQUA 4KAIA 2B56A 3R5CA 1OPIA 4QWCA 3BQ2A 1Q8IA 1UL3A 3K8VA 2OLWA 4KJIA 1NK6A 4OI3A 3NMAA 1DTTB 4DL5A 3MTJA 3TX8A 1ZM2A 1BD6A 2Q3PA 2P6SA 4ZPWR 4B08A 3PJWA 4NA3A 2EFVA 3EXCX 3OSPA 3R1HA 3Q8PB 4C8KA 4DR4F 4YR2A 2CG4A 1RT3A 1FESA 3MFIA 2VA2A 1FDBA 2YKNA 5CYQA 4CH0S 2UV8A 3RAXA 1DZ5A 2C2EA 5DM7Q 1S1WB 2ASJA 3M32B 3KHRA 3LP2A 4IQXA 1TK5A 2XS2A 1X5TA 3RBDA 1RDRA 4F3MA 5T14A 3N79A 2VFVA 3QWUA 4HT7A 3M9NB 1S6OA 2JZ5A 1FVSA 2VC0A 2DIUA 3SDEA 2FJEB 4HEA9 2PEHA 3NAIA 3I9V9 3M2UA 3VTIA 3N28A 2JX2A 2J0QD 2LEBA 2MB0B 1SJFA 4X4QA 4ZCMA 1C4CA 4LQ3A 2VFUA 3QLHB 2PDAA 4JI0F 4OJ3A 3T5HA 5BYQA 4OHWA 1VQSA 2KM8B 1L3UA 3LF0A 2E9TA 3I96A 4Z37A 3HMJG 4WFAQ 4RU9A 4BS2A 4PUOA 4B02A 3HO1A 1CC7A 5I3UA 2JEFA 1N32F 4RBUA 3ZZTA 4UQGA 5J2NA 4EZ6A 5DG8A 5EX3A 3M30B 5KFHA 2IC3B 1SKWA 1E6VB 4JV2A 4IRKA 3OXLA 4CO4A 2KN4A 4H4MA 3BM7A 4C4WA 2WOMB 4P7VA 4WJBA 5KG3A 2WW8A 2RS2A 1ZPWX 3JSMA 3H20A 1S0VA 3W2WA 4F8RA 1UEUA 2ZDOA 2XY7A 2QYCA 3FQKA 1SL0A 1YHQS 1NK8A 3CCWA 3BN4A 3GE9A 3GSDA 3U1MA 3OFFA 5C42B 3M2RB 2LU2A 2YWGA 1YJNS 4EYIB 1N5TA 1LOUA 3BSOA 2UVWA 4Q45A 3K58A 2N3LA 4JI1F 4X4UA 4MH8A 5GAEI 3J7A1 2IM0A 2MJNA 1NZAA 3T1YF 1WHWA 4GC6A 1IM4A 2D3UA 1NH7A 3AHPA 3EYZA 2D1CA 4R5PB 3ICLA 3K57A 1FRMA 2YVSA 4DR7F 5D8HB 4JI4F 5F8GA 5BR8F 4BDPA 4J9OA 1N6QB 5KFFA 2DNQA 5IQ6A 1P8GA 1N5YA 2JFKA 1NJYA 2WSCC 4Z2XA 1LWFA 2VKRA 1XERA 2XMKA 4CT9A 3DYAB 1JKHB 2JEJA 4D3HA 1F0XA 4YB6A 2F9DA 4I2PA 4JV0A 4IYQA 4ES1A 2QE5A 3QZ7A 3I4HX 4DOZA 3T1AA 1VQNS 1OIAA 1U25A 3K59A 1IJFB 3POTB 3OQ2A 5F9LA 4PCQA 1L3VA 1NJIT 3THTA 2NR0A 1LWCA 1XN9A 3ZZZA 2MHEA 5HLFB 1R0AA 4RW6B 3X1LB 3HDSA 3OTEA 1SUQB 4TKTA 2L41A 5IT4A 1XNRF 3SCKE 4ECXA 5A8KA 3CD0A 4OV1A 4ZPBA 5FDLA 5T7LB 4H4OA 4MYTA 1U1PA 1H38A 4C8ZA 3OXGA 3VAFA 1KFDA 1KEKA 3EUNA 3N4WA 1UVLA 2EK6A 3NP5A 1B0PA 2JOQA 1X8DA 1GT8A 1IKVB 2FJWA 2FJXA 2GW8A 4JI8F 7FDRA 5HL7Q 3UW1A 2HHPA 2XMWA 1ULRA 2GX8A 4NLPA 4OI4A 4X4RA 4DV0F 5E3RA 1S9GA 3CCVS 1TV6B 3X3UA 1HARA 2J6SA 5KG0A 5KFCA 3M6XA 3DOLB 3S01A 4AUKA 5D6GA 2FC8A 3CEDA 3I87A 4K4YA 2CPJA 5ITHA 1LW2B 1BQMA 2RH3A 2RKIB 3E51A 3MCSA 1QY7A 2XO7A 3G6ES 4ECUA 1VQKS 1HYSA 4C8LA 5CHCB 1S1XA 3PFOA 2YY3A 4G1QB 2NPFA 2EG2A 1X4GA 4XPEA 1L3SA 4K4XA 3L7PA 4ECWA 5CCMA 4A8WA 3VR1A 3TAQA 3HHLB 2C22A 3QO9A 3C2PA 2MHNA 4LSNB 5A6PA 1U49A 4L6V3 2P5VA 5KFZA 4MTPA 1RISA 1UMJA 1LKZA 5CYJA 4OHVA 2O3DA 4R8UA 3ZZUA 5DDOC 3PY8A 5B0FA 1YRUA 3FZ2A 2RF2A 1FNXH 3LWLA 4UY8T 3OVAA 3O1LA 3P6YC 1E6YA 2FHKA 1XR6A 3Q8SB 3PW2A 4KHPF 2PFFB 3H8YA 5DJBA