4IOAQ

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ioaQ00
2KM8C 3D2WA 1ZZNA 4UY8T 1U6FA 1YI2S 1M90T 2DH9A 1U2FA 4IOAQ 1HL6A 3PIPQ 3EGZA 4WKRA 2GHPA 1YJ9S 2D3OR 3NS6A 2RNEA 5GAEU 1VQ7S 2CJKA 1WG1A 2KI2A 3VAIA 4IOCQ 1M5PC 4OZ1A 1KC8T 1A7GE 2L41A 2ZJPQ 2DNNA 2DNMA 1VQOS 1VQLS 2B0GA 2X1GA 3CXCR 2LXUA 1FJ7A 1P1TA 3LPYA 4WCEQ 3LQVA 3CC2S 3BEGB 2E5HA 2MYFA 3CD6S 1X4HA 2OSRA 2DH7A 2MZQA 4Y0FA 3MD3A 2DGUA 1YJNS 5CA5A 3BO4A 3H2UB 1YITS 1U1OA 3B4MA 1KOHA 2MQQA 2DGWA 2M0GB 1X4DA 1W2BR 2F9JA 3PIOQ 3S7RA 4IUFA 3DXBA 4FXVA 2OSQA 3TP2A 5CXTA 1X5TA 1YHQS 2DISA 2CQHA 1SXLA 1WI8A 1VBZA 2BZ2A 2FC9A 2J76E 2DNLA 2EK1A 2LYVA 2MQNA 1JJ2R 1KOOA 2DNQA 4A8XA 2MGZB 4CH1A 4WF9Q 3P6YC 3UCZP 3G4SS 1N54B 2DHSA 1S72S 1DZ5A 3MOJB 2EK6A 1WHXA 2MSSA 4YB1P 3H2VE 2DGVA 5IFMA 1SJQA 5DETA 4YOEA 2CPFA 2DIVA 2U1AA 1X4BA 4LJMA 1VBXA 1U1KA 3NNHA 2ADCA 2DNHA 1VC6A 2GO9A 1WEZA 2EVZA 3ZZZA 2DGTA 1NU4A 3NNCA 2JVOA 2HGLA 3DLLQ 2I38A 4LIRA 2DGQA 3VAKA 1ZZFA 3S8SA 1OPIA 2MSTA 5D78A 2NLWA 3CULA 2CPJA 1O0PA 1L3KA 1R8PA 3G71S 2J0QD 3CTRA 2E5JA 2HYIB 2HZCA 5BJRA 3CF5Q 3CPWR 2G1DA 4TU9A 1K73T 2G4BA 3MI7X 3L3CA 1SJ3P 3P49B 3HI9A 3THPA 2MQOA 4WFBQ 2CPDA 4QU7A 2PE8A 4C4WA 3CCRS 1UFWA 4V19X 2CQCA 2QFJA 2XS2A 5IQQA 1SJRA 3Q2SC 1WTBA 2I2YA 2M52A 3U1LA 5DDQC 1BY9A 4WFNQ 1M5OC 4QPTA 4YUDA 2AD9A 1FJCA 1VQNS 1NO8A 2KU7A 5IM0B 2D9PA 3SMZA 1WI6A 1NJIT 5IM0A 3MD1A 1URNA 3VAMA 5DDOC 3SDEB 2KXNB 1U1NA 1FJEB 1WF2A 2MZTA 2F3JA 1IQTA 1H2TZ 2DNGA 5DDPC 1WEXA 1M5KC 2MJUA 2JRSA 1VQ5S 2KM8B 3CC7S 2CQ0A 4BS2A 3ULHA 2RS8A 1H2VZ 1K8AT 2DK2A 3CMES 2MPUA 3NS5A 1PGZA 2M70A 1SJ4P 2YWKA 2AYEA 3IWNC 1DBDA 1VQMS 1N52B 2KXHA 2FY1A 5GVQA 2HGNA 1FHTA 2DNRA 3J7YU 5ITHA 4U67Q 4TLQA 5LXYA 1SJFA 1VQKS 2E44A 3Q2TC 2KYXA 1KQSR 2MKHA 3K0JA 2G0CA 4QQBA 3MURP 1N88A 2JX2A 1K9MT 2Q79A 3V4MA 1VQ6S 3MUTP 1A9NB 2DGXA 5JVGQ 2OIHA 1Q81T 1OWXA 1QM9A 1WHVA 2RU3A 2RT3A 4C0OC 4F26A 5GAHU 2OJ3A 1U1RA 1VQ9S 3NMRA 2LEAA 2MGZA 2RQCA 1U1LA 1KD1T 3UD3P 2CPEA 3CCUS 3VAJA 2YKAA 3OW2R 5FJ4A 3UWTA 2YH1A 2DGOA 3ZZYA 1VQPS 3B4DA 2MKKA 5GMKa 4ERDA 1WWHA 2DIUA 2RRAA 4WIIA 2LA6A 2LMIA 2X1AA 4RU2A 1WF0A 2ZJRQ 1YWXA 2HGMA 2DNOA 1JMTA 2K8GA 2QA4S 3S01A 1X0FA 1JJ4A 3UE2A 3CC4S 5GAGU 1X5SA 5LJ5Y 3VALA 2VOOA 5D77A 1WG4A 2DO0A 3CCMS 1JJHA 2XS7A 2MZRA 1M1KT 2ERRA 2NZ4A 2KRRA 2CPYA 3I56S 3NNAA 3VAGA 2CPXA 3P5TL 5LSOA 4W90B 4QU6A 1X4CA 2MJNA 2MKIA 2DO4A 5HL7Q 2ZJQQ 3R1HA 2MMYA 4M5DB 2MY8A 1DRZA 4UQTA 4PRFA 4ED5A 3FEYB 1H6KX 2DH8A 3TO8A 2MZJA 3VAFA 3J7ZT 2LCWA 2DNKA 2JVRA 2XSFA 1YIJS 3EX7B 3VF0B 1Q7YT 5DDRC 1X4EA 5DM7Q 2LKZA 1OO0B 2LEBA 1DHMA 5EN1A 3US5A 1XN9A 2YTCA 1X5PA 2VOPA 3UCUP 2M2BA 2CPIA 5LXRA 1ZH5A 1FNXH 2CQIA 4TU7A 5LJ3Y 2MQPA 2AYGA 1RK8A 2D9OA 3N9UC 1HA1A 2HVZA 3CUNA 2DHGA 2ADBA 3SDEA 1OIAA 1P27B 4OZ0A 2KRBA 1U1MA 2VODA 2M7SA 3G96A 1FT8A 1X5OA 2KT5A 1PO6A 2KVIA 2MKCA 3EGNA 5H1SV 2RVJA 2DGSA 1HD1A 2L9WA 1G2EA 3JB9k 2XNRA 1RKJA 1B7FA 2KFYA 1F9FA 2CQ1A 2MB0B 2BOPA 1U6BA 5DM6Q 2CPZA 3CCQS 1YTYA 1N8RT 1QVGR 3CCVS 1Q86T 2QEXS 4ZKAA 1AUDA 3IRWP 1WHYA 2N7CA 2DNPA 2KN4A 3TYTA 5CYJA 4TU8A 3HHNB 3MDFA 2VONA 2KXFA 2V94A 2X1FA 3UCGA 2UP1A 2FPHX 2JWNA 4WFAQ 2N82B 2E5GA 2CQ3A 4PR6A 3BS9A 2FC8A 2M88A 5MLCV 2RS2A 2F9DA 4FXWA 3S6EA 3MUVP 3I55S 2KHCA 1Q82T 4EGLA 2CQDA 1FO1A 1WG5A 2CQPA 1X4AA 2M4MA 5JVHQ 2KG1A 4W92B 2OTLS 4F25A 2KG0A 3UD4P 2MKJA 2LECA 2DNYA 1H2UX 2RRBA 2N3LA 3G9CA 4J5OA 2LA4A 3G6ES 4CQ1A 2RQ4A 2X1BA 2DNZA 1D9AA 2MHNA 2DB1A 4Y00A 4LMZA 2LQ5A 1UAWA 2A3JA 3CMAS 2PEHA 1U1QA 3VAHA 3CCES 3SXLA 5GADU 1X4GA 5LSLA 4PKDB 1UW4A 3U1MA 2K3KA 4CH0S 2O3DA 2DHXA 4IO9Q 1WHWA 2CQ2A 3CCSS 1YJWS 1CVJA 4Z2XA 2WBRA 1U1PA 1WF1A 2U2FA 3G8SA 5HO4A 1VQ8S 1M5VC 2XNQA 1VBYA 2CQ4A 3MUMP 3THTA 2DHAA 1X4FA 1FXLA 1UP1A 1VC5A 3MXHP 1R8HA 4C7QA 2XB2D 3BO2A 4CIOA 2MQLA 2J8AA 2FHOB 3G8TA 2RUGA 1WELA 2J0SD 2MY7A 4P6QA 2MKSA 1HD0A 3R1LA 2L08A 3R27A 2MQMA 3RW7A 2M8DB 2MZ1A 2AYBA 1WEYA 3CCJS 1VQ4S 2XS5A 3CCLS 1VC0A 2M8HA 1D8ZA 2OTJS 2LXIA 3P3DA 2N3OA 2YH0A 2AYMA 2M9KA 3BO3A 2MXYA 2MZSA 2SXLA 3FEXB 1QVFR 2CQGA 2KH9A 4F02A 2DITA 3RW6A 2CPHA 2CQBA 2E5IA 1S79A
chains in the Genus database with same CATH superfamily
4USIA 3ZO7A 1TAQA 1I94F 4ZJQA 3VWSA 3V6DA 3PRBA 1E6VA 2DNNA 2JEJA 1D3WA 3IS9A 4ZVOB 1U02A 2XYHB 4BBYA 4JI6J 2CNOB 3CXCR 1IR1A 1FJ7A 5AJ3J 1N33F 3H40A 1RT2A 4A47A 3SSSA 4F4ZA 1IKWA 1HW8A 2B3TB 1W2BR 2ZHBA 3LA0A 2UVVA 1ZM4A 4K8RA 4KH0B 4R5PA 1VBZA 2V5HG 5C5JA 2YKMA 2EK1A 2MQNA 1T9UA 2V8GA 2EC0A 1Z4UA 1DZ5A 3KK1A 1RCXB 2V34A 2GV1A 1SJQA 4OYIA 1ACMB 2R7QA 4OI2A 5DRKA 1WD6A 1J5OB 3CJKA 3DLLQ 1PJ7A 2FQQB 3VAKA 1OPIA 1UPMB 4OZLA 4NA3A 1O0PA 4QYZK 4X84A 5BR8F 5K14A 2G4BA 3EPGA 2CZVC 4ECWA 2YWEA 4CO1A 3HHLB 3TAMA 3W62A 4QU7A 3DLEB 4DF4A 5IC6B 1SL2A 3OL7A 2C2NA 5CD4H 2QFJA 1B4SA 4OYPA 2XQCA 3CE8A 2GHVC 2AD9A 4RBVA 3LUYA 3D1QA 4AFFA 2FHMA 5IM0B 3M1VA 1SC3B 3O44A 1URNA 3I96A 4I2PA 5D4LA 1S6PA 2IHR1 2HNZA 2VA2A 2IA6A 4DR5F 2MJUA 4B9NA 5L1LA 1WC0A 4ED4A 3MEGB 3A3NB 5KFLA 2V8HA 4AE5A 4NEZA 4EYHB 4AD6A 2E1PA 1FK9B 4G1IA 2AYEA 5LOQA 2FHKA 1AZSA 4NXMJ 4EWTA 2W9CA 2MKHA 1RZMA 3O3LA 1BE4A 4IOBA 3M7VA 1QD1A 3K5PA 2QSWA 4EBCA 2Y8WA 4DL3A 2I1RA 4URSA 2Z56B 5HN0A 3QRRA 3ZTQA 2RRAA 1L5UA 1P9QC 4KYZA 1WF0A 4OI1A 4FF1A 1JMTA 4NLSA 2LXFA 2F4FA 3WHIA 1S12A 2RHSB 5C2GA 1M1KT 3E2EA 2D3O1 2YKOA 1PCAA 5T7LA 4IG0B 2BJ8A 1HBOA 1KBRA 1HNVB 1HYSA 3D0GE 4Y6IA 3RUBL 2FY8A 2ZOGA 2HNDB 1OY9A 2GC8A 3B6BA 4H54A 4EZ9A 2QA2A 3K5NA 2LKZA 1OO0B 3VV2B 4LSLB 2N7YA 4LVNP 3A3PB 3UPFA 4K7QA 3FBEA 4W98A 5F41A 4IKAA 2D9OA 3W8PA 4KJIA 3GE9A 2UVWA 3ADAC 4FKYA 2M7SA 2ZZMA 4PXEA 2OPQA 1VJWA 1U24A 1SIWB 5DO2A 2BE9B 3GG1A 4A8QA 2CQ1A 2F8EX 4M5IA 3V5RA 1RHRB 3C16B 3DI6B 1IM6A 4NLOA 5D4PA 4Y2KA 5KFCA 5A0YB 1KFDA 3U02A 3UN2A 4C8MA 2V4JA 4X4NA 4DR7F 4PYDA 4JV1A 4DFMA 2FC8A 2IVYA 3QNWB 3R2DJ 1R8AA 3MUVP 4OHYA 4M5LA 1FERA 2B9XA 2KG1A 3H90A 1MNEA 4I67A 1FFSB 4P75A 4PZVA 3M8WA 1S99A 2H4WB 4OHZA 4LBPA 1R6VA 1X4GA 2E66A 4OI0A 4PWUA 2W4DA 4XAKA 3W9IA 4B9TA 4JI7F 1T03B 2UV8A 2XNQA 5HROA 1MW7A 3DHWC 1IVZA 4MH8A 2IPOB 3U7JA 3FRYA 5B0FA 2ILYA 1MWQA 2EBEA 1C0UB 1RYSA 5H9EK 1TL3B 3ZZUA 2HWIA 1L3TA 2XZWA 3P3DA 3UO0A 4YY3F 2VC1A 4GKKJ 1JNZB 2XGPA 3WBZA 2CPHA 4TKTA 3D2WA 3RBXA 3MM5B 1VISA 2JFKA 2GHPA 2IY5B 2QLJB 3M8QB 4IDKB 2KI2A 3TANA 1TKZA 2BRLA 3HJVA 2J7KA 2J0XA 3A8JA 1R6YA 4F8RA 5E5NA 2BKPA 2VFSA 1NJWA 2QT7A 1RT1A 1U1OA 4C9DA 2YNHA 1HQEB 1EP4A 1G3OA 2V68A 4Y34A 4FXVA 1LWCA 5KFBA 3LOUA 2FC9A 3KUHA 4QZVB 4U96A 3QJLA 2PIIA 3I5AA 2ZWOA 4K50A 1HNXF 4A8XA 2LQ9A 4X62J 2Z2YB 2RU9A 1FXDA 4PXBA 1CJVA 3GFZA 1WNEA 1X4BA 1K1QA 1G1XA 4ILMA 2IIHA 1GQEA 2QX0A 2GO9A 3NP5A 4EO8A 4MIAA 3TX0A 2BW2A 1AFJA 3MM9A 2DGQA 4KC5A 4NCGB 4CLZA 3THVA 4USVA 1L3KA 2J0QD 4ZPCA 2C3OA 4WIQA 1AB8A 1QE1A 1RBLA 1IBMF 2WVBA 2IM1A 2WW8A 2K2PA 3KJFB 1EETB 3NAHA 3M8PA 2PD1A 2XS2A 4DFJA 2M52A 5L1IA 3KLHA 1M5OC 4YUDA 3A8KA 2NXCA 5EWGA 1WI6A 1FVQA 4N77A 3IR5B 2IA0A 3MMJA 1R8BA 2CADA 2GZOA 4DCOB 1WEXA 4NE9C 2XMMA 3CC7S 2Y1LB 2JEIA 4CLKA 3RBEA 1SC6A 2XC9A 5H9EJ 4UOGA 5LSRA 5F8LA 4JI5F 5CYQB 3JXOA 4DUYF 4QR1A 3VGUA 4FNIA 5GVQA 3J7YU 1RLCL 1QAYA 1Y5LB 3Q2TC 2VBWA 4CM0A 2ASLA 1LQ9A 3DLHA 2XEXA 5HSPA 2VKRA 3KDOA 4QW9A 3IC1A 1FI4A 2VFTA 3UD3P 4X64J 2ZVIA 3PW2A 2WB1D 4FVCA 3UN3A 2BM0A 4ERDA 4X2BA 3AJDA 2AHOB 4KSEB 4WIIA 1T05B 4DV6F 2HHTA 2K8GA 3JQMA 4YR3A 3CC4S 3KJVB 1J5OA 4K5SA 4LRDA 4RX6A 3FCHA 3HZEA 4ZLLA 1CSJA 1Q5VA 3HKWA 3EVMA 3DNCA 2BXJA 1RWOB 1P1LA 5J2QB 4GC6A 3HCXA 3HHLA 3MR7A 3DLEA 1IR2A 4UQGA 3F56A 2LEBA 3EDQB 2R8JA 1DLOB 3US5A 1GXLA 2QE5A 1R7IA 4RNHA 2C3PA 3M2VB 2P6TA 4JUZA 5KFTA 3PDNA 3M05A 3FC9A 1U49A 1X31C 2KKHA 2RF2B 1Y5NB 2W25A 5J2NB 4J9LA 4P72A 3MEGA 2QC3A 4I69A 2DR7A 2BOPA 3LWMA 1FK9A 7FD1A 5ETKA 4HT7A 4BC7A 2WSCC 4NYOA 2R8GA 2JWNA 3T1HJ 3AB2B 3DHXA 4YB6A 3R2CJ 1AUSL 3MFIA 3OVBA 4IH6A 3T6BA 4EBDA 1AYEA 2CVEA 4DL0C 4B3MJ 2VC0A 2RQ4A 5M2PA 3EPIA 2BANB 2ZC4A 5CABA 4Y00A 1GEHA 2H5JB 3MECB 4CLPA 5KFPA 1ZA1B 1QY7A 3NGRA 3SBMA 1BMQB 5KFFA 4IG0A 3GYNA 3I5CA 4GVLA 4E8UA 3MXHP 1HNVA 1R8HA 2PSZA 2PFFB 4Y2CA 1AFIA 2H3EB 2HNDA 2MKSA 2N4CA 2OD6A 1ZS6A 2XMKA 2HBRB 5KOXA 4OX7A 1WEYA 4KB7A 1D8ZA 3OFEA 5J1NA 4LSLA 5KFOA 1YBTA 1JWWA 2B9EA 2GO8A 4MKBA 1QVFR 4IYQA 1N34J 2AEFA 1JK9B 1F9EB 2E5IA 2KJWA 4FS1A 1Y00A 2C1EB 1FEHA 3E51A 3I31A 2HFZA 2BR0A 1YJ9S 2D3OR 2J9EA 1RAHB 1RUSA 4MKYA 2BKOA 1KTVA 3C16A 3DI6A 3JTNA 1WUUA 3BBCA 3M4XA 5A0YA 5F3ZA 5I42B 3J7AN 2DRAA 1DQAA 2MYFA 3PKYA 2MZQA 3D6FB 4ZN3A 3BO4A 4DV4F 1YITS 3BQ2A 2HK2A 5A76A 3DXBA 2QMUB 3GQCA 5A8WB 3K7RA 3ZXWA 2CUYA 2IVFB 2JNJA 3U27A 2DNLA 2YNIB 2HAFA 5KFHA 4G3IA 4WF9Q 1SKRA 4MK9A 4ILLA 4K4WA 4DV3F 4CLFA 1OQ6A 4P73A 1I3OB 5IFMA 1IBLF 2DY9A 3LAKA 3K5LA 2PI4A 1T03A 5THWA 1UVKA 1FDBA 3E01B 1RAFB 4LFAJ 1HBNB 2MSTA 4BCAA 3PHTA 3UDEA 1TKXB 1C0UA 1TELA 2NCKL 5BJRA 4USUA 4ETZA 1TL3A 4NMLA 3CPWR 5KT3A 1TL7B 2E5LJ 3PX4A 3ETMA 4DL2A 1H98A 1Q95G 2BQUA 2RILA 1NKEA 5HBMB 4QPTA 4TY9A 2B8PA 4OYOA 1XMOJ 2YNGB 3MM5A 1PSDA 3QFWA 2ALZA 4L74A 2CDQA 3M8QA 3MPYA 4IDKA 1RB0A 1TKTB 2XLKA 4GRSA 3FQLA 1O51A 2BKNA 5DDPC 3G6XA 1T9VA 2W7AA 3BPDA 1UA0A 5BXIA 4KT0C 1YJUA 4I68A 4KGVB 2XI2A 2OPSA 1PGZA 2E1AA 2OD4A 1JLFB 3ISZA 4TVAB 1HQEA 1GT8A 1FFWB 4MK8A 2R7XA 2FY1A 4LT6A 4F4KA 4Q8EA 4KR0B 4P7TA 3PHEA 2W7PA 1R0BG 1MWZA 3N5FA 1VQ6S 3QIPB 4LF8F 1PYOB 4MMOA 4ED1A 1U1RA 4CT9A 1E6YB 5KT4A 2LEAA 4LF4F 1MMNA 2HKEA 2DGOA 4L72B 5MAOA 3GG0A 2LMIA 2ZJRQ 1UVMA 2AJFE 3OTEA 2R7VA 2NZ4A 1TMJA 2C2MB 4RNFA 1QUVA 3Q86A 2MY8A 5EGYA 1BUXA 5J2MB 2FLOA 2EG1A 4NX9A 2WSFC 3DGPB 4JI1F 1OMSA 2WK4A 4NASA 3PJXA 3S1TA 4ETXA 1LK7A 1EETA 2F1FA 5EN1A 3Q8UA 4R0JA 5DZ7A 4RU9A 3KNAA 4HDHA 4RBTA 1U45A 1XMBA 4J9NA 5ETMA 1XEZA 4OZ0A 2KHDA 4O3QA 1RTJB 1X5OA 3BJYA 1PO6A 1R31A 2B56A 4ELTA 3QT8A 3EE3A 2HFNA 4TXSA 4Q8FA 3KFWX 1DTTB 4RKUC 5E3CA 2A10A 1BQMB 2GIRA 4B3RF 5C2CA 1VIXA 1Q86T 5CYQA 3KUGA 2EKYA 3QQCD 2DNPA 4TY8B 4P10A 4M1KA 5IWAF 3Q89A 2V94A 1S76D 3UCGA 1NNDA 1CC7A 4DLEA 2F9DA 4RNNA 5CCMA 3AFGA 3UNYA 1OJ4A 2GGPB 6AT1B 1H2UX 4DPXA 2X1BA 2XHCA 1D9AA 1F2HA 2YX1A 1JLGB 1T05A 2W9AA 5B0AA 4IFVB 2V50A 3U1MA 3HVTB 4YEAA 4LFCJ 4IO9Q 3KJVA 2XO6A 2KB2A 1ZAVA 1TFYA 1Y9OA 3Q0AA 2R2RA 4KY3A 4RR5A 3WC0A 2HK3A 3HHLC 1FTRA 3OTOJ 2GNKA 2MQLA 3G8TA 2HLUA 4K4SA 5J2QA 1S1UB 1Q1KA 4DV0J 1QAXA 2R3VA 5IQ6A 4K4UA 1Y7PA 3GZ7A 5F8HA 2QL7B 2M8HA 4ELUA 1DLOA 4S0MA 1Q8IA 3M2VA 4NXNJ 3BO3A 4ICLB 2D3UA 4X65J 2CQGA 1RHQB 2PEBA 4LFBJ 2ZITA 4QWDA 4J9KA 4DQQA 3HHLD 1HL6A 2RF2A 3GIRA 3T1YJ 1HNIB 4FP9A 3R5CA 1SB6A 1KFSA 2OH2A 3KG4A 2GIQA 5KG2A 1FA0A 2NXUA 2XLJA 4MYUA 5KT5A 1Z2LA 1VOMA 1NM2A 1LWXA 3F41A 3LQVA 1SCJB 3FCWA 3B82A 2X3GA 1OYEA 2BM1A 3K59A 5A8KA 1KOHA 1I51B 4IQXA 2M0GB 1X4DA 4MKVA 1RWNB 1SXLA 2ZM6F 5IZHA 4ZJOA 5IXUA 2H9ZA 2BANA 2LYVA 2RQMA 3H4BA 3T41A 2VQEJ 2VPYB 3MECA 2BJ9A 1YZ7A 1RWXB 4Z7CA 4FDFA 3P96A 3N6NA 5DETA 3KMQA 1D0EA 4G6VB 3OHAA 3AD7C 2HS4A 3DN9A 1WEZA 1SQEA 1IKYB 5B0CA 3D0HE 2RE1A 3H59A 2ZBPA 3MMBB 1DAXA 2FLNA 4QWEA 3DDKA 2OFGX 1XMQF 4Q45A 3CF5Q 1BXNA 4NLDA 3MI7X 3PVXA 3HI9A 3THPA 8RUCA 2PE8A 1Z2ZA 6FD1A 3MR6A 4ZA1A 5E41A 3V6KA 2C2RA 3PRDA 4HVZA 5JXSA 3I87A 4K4ZA 4ZP8A 5FIIA 1K47A 2E9RX 1DARA 5IV4A 4Y28C 3OTCA 4K4VA 4JOUA 2QIFA 2JDJA 5I42A 4DR1J 2FJXA 2MPUA 2DEIA 3K17A 5GMEA 3G2XA 3CDWA 3BB5A 3VQTA 2ZVSA 4B3TJ 1PILA 4YMEA 2WVEA 3ITHB 1NZ8A 4U67Q 1F1BB 1CS4B 5A8WA 2BE2B 2KDOA 3MPDA 3NOGA 3HP6A 5HK4A 3GJRB 2YNIA 4DX7A 2YY3A 4ZVUB 2KFZA 5E2QA 2CPEA 2ZHOA 2YH1A 2I6WA 2UVRA 1REGX 3X3UA 2WAQD 3HKZD 2HRUA 2Y9HA 2DJWA 3E01A 1X5SA 2OPRB 3D3CJ 1HBNA 2NYIA 4QIWD 2CPXA 1FE0A 1U7LA 2MJNA 1OQ3A 5HL7Q 1DRZA 1TKXA 3G82B 3JSRA 1B3TA 4V1Ak 1ZTWA 1ZPVA 3JAMY 1RAGB 3BQ1A 2LCWA 1TL7A 3CJRA 1RHJB 2F4VF 4B02A 4MT1A 2R42A 4F3MA 2B4UA 4J9PA 3I6PA 1Z1ZA 1S0MA 4P52A 3K8WA 5HBMA 2VASA 2YNGA 1UWBB 3PCOB 1TKTA 4JI4F 2UV8G 3G96A 2DTJA 2KVIA 3IRXB 5AXKA 2RVJA 3QFHA 5FD1A 4O0IA 1UW9A 4JP8A 4WU3A 1YTYA 4GMKA 2PI5A 3WZ0A 1JLFA 2QLXA 1WHYA 4WE1B 2IJFA 1J5EF 2NR0A 3GU0A 2V2VA 4PR6A 4OZ3A 1KVKA 3W2WB 4FXWA 3QIPA 5KT2A 1E6YA 2B4VA 4CWBA 4DN0A 2A6OA 2XMTA 3UD4P 2N3LA 4OQJA 2FZGB 2GJIA 3PTWA 2UZAA 1IKVB 1M1HA 2ZKTA 3GJTB 1CULB 1HFEL 2VQFJ 1NZAA 1T8EA 4JV5J 2ZDOA 2HQFA 2ZOMA 3IAS9 4WXWA 3NGDA 4GKJF 2U2FA 1MMLA 1UETA 3RRHA 3TRGA 2Z0GA 2DR9A 5J2MA 2ABYA 2K06A 4DSIA 2J0SD 3DGPA 4ZVFA 1FRXA 2AGPA 2AGOA 1HLWA 3ENAA 5I4MA 5IS2A 4WYLA 5AXLA 4FBTA 2ROPA 3FEXB 2M3DA 4USMA 2CQBA 1M90T 1U2FA 1RJJA 1HR0F 2AW0A 1RTJA 3AY0A 3TZYA 5CZVA 2FIUA 5GAEU 1R3NA 1DTTA 2ZH2A 1BQMA 4RW7B 4JBCA 1F3VA 2IMOA 3N79A 1YGYA 5HMZA 1GXUA 4DL7A 4ELVA 2IYGA 1B70B 1PKUA 4TY8A 1Y5IB 2VU5A 2CJXB 5E3QA 4UW2A 3DMJB 4CNZA 4DCJB 4P2MA 2MQQA 2DVIA 1XIQA 1N32J 1F5AA 2COLA 3QAUA 5G0RB 3D7SB 1X5TA 1F9HA 2CQHA 2GGPA 2W2QP 3BGOP 1JLGA 2XHWA 3RAMA 2D69A 2MSSA 4IFVA 1RA7A 2RUSA 3H2LA 3CJ3A 3HVTA 1Q4RA 4NA1A 1LV5A 2ZC3A 4PPZA 3AQPA 1N48A 2DHHA 3DRRA 5KFYA 3J81U 4HYKA 2HURA 3OR2B 5A2QU 2Y8YA 1S1UA 2HHHF 3IM9A 1UFKA 5AT1B 4ZVPB 4CLTA 4ECSA 3PJWA 2KT3A 4CNYA 4CLYA 2CQCA 1GFWB 4ICLA 2BW7A 2VUGA 3GP9A 3U1LA 4JI8J 4NZ0A 5B0GA 4RUAA 2NXJA 3C14A 3MPWA 4FF4A 5I3PA 1HHQA 1HNIA 1KDNA 3MD1A 2A6MA 4L76A 5DDOC 2YWFA 3FNNA 2JLFA 4I4BA 4NZ6A 4EZ6A 4JI6F 1T11A 5AJ3F 2UU9J 2CKWA 4DL4A 4OLPA 2J5AA 1GH8A 3BYRA 2BE7D 3MTKA 3GV5B 3H5YA 5LXYA 1VQKS 3KLGA 3K0JA 3ZTSA 3JSMB 2JX2A 3M6VA 2HG4A 1WC1A 1TQLA 1VJQA 2OIHA 5EDWA 5JVGQ 4NPOA 3GCXP 3CJ4A 3CCUS 1DY3A 1SI9A 1TMMA 5B09A 7FDRA 1RYRA 1SC1B 4F4AA 2XGQA 1YJVA 2X3DA 1IKYA 5E3RA 5GAGU 5LJ5Y 4CP5A 2OMOA 1CG2A 5KFIA 4H4OB 3MMBA 2V2ZA 2MKIA 2DO4A 1FVSA 4UOCA 4ECQA 1IBKJ 2ZKUA 2FVRA 3G6VA 3FEYB 1H6KX 2R2SA 4DXLA 4XPCA 1AROP 2JVRA 4DU7A 4RUCA 1X4EA 4J91A 2FB0A 1MWYA 2RKIB 1S1VB 3PR4A 2ZBIA 4CT8A 4P7VA 3RRGA 4J9VA 3TEHB 1FT8A 3UI3A 1LK5A 4CLWA 1KONA 1EAYC 2M5YA 3JB9k 1RKJA 3DOLB 1RTDB 4DPOA 3ZTRA 2UXCJ 1O5JA 1NDKA 3D28A 3HHNB 4X66J 1YLXA 1FE4A 1URRA 1CS4A 4NXMF 2BE2A 1VK8A 5MLCV 3W2VA 3QLHB 4RUHA 4Z37A 1S9GA 1X9WA 2CQPA 4ZCMA 1NBEB 1S49A 4KH1B 1RLDA 2KZMA 2GCFA 5HATA 4LQ3A 2FDNA 4NEYA 4ZVEA 1H74A 4Y2IA 3IR6B 3MM8B 1RTHA 1FRKA 5KFQA 2LU2A 1UW4A 3D68A 1ZM2A 2O3DA 3PX0A 2OPRA 3HSJA 5DS7A 2CQ2A 4ED3A 1CVJA 2HHQA 4WFYA 2FJEB 1R0AB 4I64A 3G82A 2E1MC 3HT3A 2LVWA 1NHKL 1JLEB 2BVZA 1F5CA 3GIJA 3R1LA 1WC3A 4MIWA 2MLYA 1H3DA 3CW2C 1VC0A 3LO3A 5K20B 4TYBA 2LXIA 4NLWA 2Z57B 3KMSA 1ZM9A 3IBWA 4ZDNA 1RT7B 3ZZ0A 4JYAJ 1KLNA 1QDUB 1DJ0A 1UWBA 3IO1A 4QWBA 4X4TA 2BYCA 4B17A 3PO4A 1UEVA 1QLNA 3HHEA 1WDDA 3IRXA 1NK8A 4USWA 2LQ8A 2RNEA 1WG1A 3BZQA 3PYFA 3HXMA 4NLUA 3ISNC 2VJVA 1N5YB 5KG4A 2R8IA 2EBGA 1RAEB 3KG0A 2DPIA 3ONQA 3BH7B 2F40A 4WE1A 2DPJA 1YJRA 2O1PA 4TYAA 4OIXA 3TJ9A 1HPZB 3W2WA 2DGWA 3TR5A 3M30B 3CO9A 3CJ2A 5CXTA 4F50A 3PEHA 1M1GA 2E1CA 1ZYQA 2Q6BA 1IKVA 3ISND 1CULA 3G4SS 3W63A 4OJ1A 4FYYB 4LF2A 4WPAA 1LFWA 4OX6A 4N56A 1TZ0A 3RG6A 2AP6A 2A2CA 4DSFA 4KGXB 2XTJP 5CH7B 1RAOA 2QFIA 3SFUA 1ZZFA 2JH3A 4P74A 2G2YA 3ILJA 4ECTA 1R8PA 3Q8RB 3RB3A 1RWUA 5JJBA 3MMCB 1CJTB 1S7IA 4TU9A 2ZZTA 5I3UB 1UFWA 4V19X 2KO1A 4GKKF 1WKKA 2H5EA 4WFNQ 1KQKA 2W24A 3TVKA 2OUGA 2KXNB 2OO4A 1FJEB 1WF2A 3CMQA 4NYZA 2V63A 3M2UB 4RW7A 3AJ1A 3HO1A 2HFVA 3LP1B 1V5IB 2CQ0A 1IWAA 1BQXA 2OELA 3CEDA 3W60A 4I1TA 3DMJA 2YWKA 2HQ3A 4DPYA 2CA9A 1N5SA 3IA0A 5ITHA 1X7VA 4TLQA 4ZIVA 5G0RA 2ZH8A 4EUVA 3GILA 3L7OA 4ZPVR 2FHJA 3NMRA 1WC5A 2BA9A 1VQSA 1VLOA 2AKWB 4DR3J 1F60B 4X62F 4OI6A 4EYIB 3B4DA 3PACA 3M9MB 1Y3JA 1FJGF 3N5BA 4LF7J 5F8GA 5HI7A 1JJHA 3OR2A 4C3MA 2E7XA 2XSJB 3I56S 1JB0C 3D6MB 3KHGA 4QU6A 4N41A 4M5DB 2YKQA 3SV3A 3QATA 4DX8H 4NLVA 1PBAA 3HD2A 2JZ5A 3I5BA 3KUEA 4HHJA 3OV7A 3DXSX 1N5TA 3GJQB 5K5MA 2IMWP 3JS9A 2WRMA 4TU7A 2MQPA 3C66A 1HA1A 3M8RA 2K3IA 3BF4A 3QGIA 2YKNB 5EHHA 2B43A 5B0DA 2B4OA 1AT1B 1NPKA 3KYLA 4M95A 1MLAA 4ANCA 4N5SA 1YBUA 3CJSA 2KFYA 2MB0B 3OVSA 1JLBB 1Q53A 5DM6Q 3VCDA 3NCRA 4WTOB 4X4VA 4DZ6A 2CWKA 1AUDA 2HBQB 1TR0A 2VONA 2KXFA 2ALYB 3CCZA 3JSMA 1H73A 2RDIA 5D15A 1FKPB 1IJFB 2M4MA 3CCWA 4ITSA 3H25A 2DKOB 1YJ7A 2MKJA 2V8PA 2LA4A 4X64F 1U25A 3TOQA 3M9NB 2MHNA 3DOMB 3CDEA 1SVDA 3NXZA 4DBQA 4JI0F 4H4OA 2J6UA 3MUMP 4P2FA 1N5VA 2IAJB 4OJ3A 3L7UA 4I2QB 1NK4A 1N0VC 3J7YI 2NS1B 2GMLA 1Y0HA 4PWDB 3L4BC 3R27A 4HLBA 1XK8A 1LXNA 3C6UB 1KHVA 2RAQA 2D1CA 2AYMA 5D0HA 2RKIA 5D0RA 1S1VA 3PW7A 4UY85 5HMYA 2Y0SD 2BX6A 3K8VA 4IOAQ 2HHXA 2UVUA 3CCTA 3G8QA 5ETQA 1S0OA 3FSIA 4LRFA 1HHSA 4YHHJ 4ECUA 1NSKL 2IC3B 4OZ1A 3DOLA 1RTDA 2LP4A 2HHSA 1WC6A 1DFDA 1RSCA 2QYGA 5DQHA 2J7WA 3W1YC 1X4HA 3MGJA 2DGUA 1VIOA 1KEKA 3T1HF 3RR7A 4OYBA 3U1NA 3QLHA 1S4EA 1OS5A 3EZUA 3H8YA 4Q5VA 2DISA 4PYAA 2H1YA 3TJ8A 2FYXA 4B3MF 3MM8A 4CH1A 4DS4A 5KFXA 4UF4A 2F65A 1S72S 3N6MA 4A8OA 1S48A 2VG5A 2CRLA 4DSJA 3IXQA 2FVSA 1U1KA 4FVMA 3SEOA 4O4RA 1VC6A 1NEEA 4F4XA 4HDGA 1ZTTA 2B4PA 1L3SA 3FBCA 3DLKB 1R0AA 3OVAA 3NNCA 3QJJA 1FRIA 2AT1B 2HQCA 1R27B 4OMFG 4PWWA 2HYIB 4U95A 2E29A 2C42A 3CSKA 1T0TV 5DG9A 1IBCB 1NPRA 3DU6A 4RPFA 3CCRS 3C15B 3FKBA 1N34F 1FJCA 2VBXA 3T5KA 1NJIT 3NWGA 5IT9Y 2I8EA 2HLTA 1N5YA 1HBUB 1R8CA 1H7WA 4NLGA 2WB4A 4BS2A 3EVOA 4LRCA 4PCQA 4JI3J 2HQIA 3IWXA 1RAJA 4DF8A 1HPZA 1N52B 2HGNA 2HBYB 3GV7B 3D6HB 1SJFA 3UW1A 4BHQA 3MURP 4TN2A 3QZ8A 4LBIA 2R4FA 2OJ3A 3LWLA 3GSIA 2HIQA 3A3OB 1OY6A 4DV6J 3PYDA 2O67A 2EFQA 2XCPA 2BV3A 2GMJA 1YWXA 3FBBA 3OL9A 3FDSA 3QPIA 4UZBA 3S01A 1FWPA 4ZITA 2AWZA 3DKDA 1U6ZA 4ZLPA 1TK8A 4LFAF 1S9EB 3VAGA 2C3YA 1WC4A 1HNZJ 1M5HA 3AQOA 1CJTA 4LSNB 4WFXA 4A8WA 2HVIA 4DZDA 2EG2A 5I3UA 1NJZA 3BPSP 3RAQA 1DQ8A 2E5LF 4KV8B 4FNHA 4I56A 3C2PA 3IR7B 4B9VA 1X5PA 3UCUP 5SZTA 4H4KA 3AOCA 2G9OA 4C0BA 2CQIA 1GMWA 2BQRA 1XMOF 3N9UC 2HVZA 4Y65A 3CUNA 2H65B 3QGPA 3FFIB 2QGFB 4K5RA 3CIZA 1VS3A 4DR4J 3M2UA 2W7OA 3LP1A 4KHMA 2P2CB 5E3PA 4BDPA 2EFGA 2CPZA 2XMUA 3CCVS 2QEXS 1HKAA 2GIFA 1NDLA 2MDAA 1RACB 2KTQA 3TYTA 4HH1A 3ZC4A 4WXOA 1WSVA 4B3SJ 2I5JB 2HMIB 4AXIA 1IM4A 2DR6A 4DUTA 3H5XA 1YZ6A 2F7VA 4K0KJ 1Y3KA 4IFYB 5KFZA 4CYUB 2FVQA 4L75A 3TVZA 4WZQA 4KHPJ 3P45B 3KLFB 3WX4A 1RKIA 2QRRA 3RRKA 2FHJD 3QMQA 4KO0B 2ZWPA 4Z2XA 2XSJA 4K4XA 2BQ3A 1FXLA 1UP1A 4M5DA 2O5DA 4CIOA 2CZ4A 2MY7A 4P6QA 1UCNA 3DRSB 1OSDA 2VF3A 4NLQA 4URQU 1RHUB 4YB5A 5LMNJ 1HIYA 1QSSA 2RQKA 5E0OA 2VA3A 4MYTA 1S5ZA 3T19A 2OLWA 4DV2J 3UDCA 2OHDA 1LEOA 1RP5A 4USKA 2YKNA 3HLUA 2AX1A 2PA3A 5KFJA 5KAKA 2L41A 1JLBA 1HWKA 3D5MA 2DNMA 4KRWA 3NMAA 4C3LA 3MCSA 4KPCA 1NK9A 1ROFA 3CB4A 2DT9A 3BEGB 4C8OA 3G87A 4DV4J 5C42B 2Y1RI 4X4QA 5FLXY 1RI7A 2DH7A 4Y0FA 2CDRB 3J80U 1SQFA 2F9JA 3ZZPA 1FKPA 3S7RA 1HMVB 2O66A 1NCLA 4DPWA 2R7WA 1RTZA 3UDLA 1DTQB 3DOMA 2XG8A 3HMJG 3V6JA 1KOOA 2DNQA 2MGZB 2VV5A 3FK4A 4J90A 1TVRB 5DLFA 4YB1P 3EZ5A 1EHWA 2DGVA 1NJYA 4LFCF 3D6TB 3SQOP 4K2XA 2WSEC 3PY8A 2JVOA 4RBUA 2IAJA 3OTOF 4KIAA 4I2QA 3AOAA 1MSWD 2L3MA 2NLWA 2IYIA 4LF9J 4PWDA 3G71S 1WOSA 3DDNA 4DV0F 3C6UA 3C8YA 1YX2A 4NLPA 1V3RA 1KQFB 5KFNA 3ZFVA 1JNRB 5GMDA 2EKNA 3MCOA 3EXYA 1X8DA 1ZOTA 4NXNF 5E3AA 2Z30B 2DYAA 1SJRA 3Q2SC 3BV8A 2I2YA 4JI2J 4X65F 1BQNB 2HRTA 3QWUA 4LFBF 4I6WA 1F0XA 3H0PA 2XZDB 2V2QA 1KP6A 2HHVA 3T1YF 4OZJA 2BJ1A 2IC3A 3W5XA 4PPDA 3M9OB 2ATLA 1L3UA 2MZTA 4NCAA 4J9RA 2CG8A 4RW4B 1UJ4A 3IWLA 1M5KC 1T3NA 2AEJA 1H2VZ 5HQLA 1VLYA 3BREA 4F7VA 4B3OB 1C4CA 4QYZJ 5CHCB 4ZK7M 3Q24A 4RZRA 2VICA 1VQMS 3BM7A 3HF5A 3T5LA 2AIRB 4QQBA 5KFDA 1TK0A 3RR8A 4ENOA 3EGVA 3V4MA 1U2CA 1A9NB 1FRHA 4ES3A 1Q81T 1QM9A 1WHVA 1NSQA 2XWXA 4LRBA 2VQEF 3RB0A 1KVJA 3ILIA 2PT0A 3TEGA 1FFGB 4OYAA 1T9XA 2Z2ZA 3LP2A 5C24B 1JJ4A 5ETRA 1B7YB 1ELOA 3PYEA 3DLKA 2OP5A 3JYTB 3CCMS 2MZRA 2MLXA 2IJNA 3R1HA 1UVLA 4UQTA 1C1BB 1QSLA 3GFHA 5KFVA 1I1GA 4UUXA 2VKZG 2QLWA 1XR7A 2B51A 3TQ1A 4DU8A 1YQHA 2WBMA 4BWMA 2ROEA 3KNGA 3VF0B 5F9NA 5L1KA 4ZVGA 3E8OA 3C15A 2R7SA 4MFBB 4LF6J 2YTCA 4USTA 2CPIA 2L9NA 3OD2A 1RK8A 2UXDJ 2HVDA 4WJBA 2DHGA 1U1MA 2QG9B 4ANDA 4M5MA 2UUTA 2HAIA 4Q2MA 3CVKA 5KG7A 1S9FA 3I0SA 1HBUA 3VQSA 2XNRA 3R5AA 1LKZA 2W8KA 2EW9A 4USHA 4ZMMA 4DR1F 1T95A 2LFVA 2CVIA 2HRYA 2EPIA 4B3TF 1UVNA 1BWEA 1HWJA 4OJHA 3AA9A 3GFYA 3RB4A 4PABA 4F4WA 2LU1A 5JMNA 4W92B 4J9SA 3G9CA 4CQ1A 4TNOA 4Z7YA 4X4RA 3T5HA 4LMZA 3HFKA 2ASYA 2P6SA 2K3KA 1CPZA 2VJUA 3CD5A 4OHWA 2GVDB 4WK1A 1H72C 4G1QB 1S9EA 4XPEA 4K59A 3UR0A 4EMDA 5L9NA 2Z8QA 2FHOB 4LSNA 5H9FK 1VHFA 5D6GA 4F2SA 2FGCA 4H4KC 3PO5A 1TK5A 1S77D 4KV8A 3OFHA 2G13A 1YRTA 4AL5A 2E9ZA 2E7WA 3V2UC 4X4OA 1HQ2A 3RJMB 1NDCA 2MXYA 4DV1J 2XY5A 1RABB 5AE3A 4ECVA 2W2MP 3DM2B 3FFIA 1T94A 3OUYB 4QR2A 4F67A 1K1SA 1U2RA 1GMWD 2XCAA 2W01A 5C7PA 2QZ8A 1P1TA 4WCEQ 4U8VA 4A4JA 3BBBA 2WVDA 1RWMB 4IR9A 2I5JA 2HMIA 2AV5A 3B4MA 1U48A 2Z2LA 4U8YA 2OSQA 1FEEA 4RW9B 4LF5J 2GS8A 4QW8A 4DUZJ 3OJSA 4IFYA 4CYUA 3N01A 5LT5A 3TZZA 3Q8VA 3GMGA 4M5GA 3KLFA 2EFVA 1JXEA 2VQFF 3OBIA 4JV5F 1RE1B 4YOEA 4QIEA 4M8LA 2DNHA 1W26A 5KT6A 2RB7A 1DQ9A 3CJTA 3OL6A 4ER8A 3DLJA 5HQMA 2OEJA 4K2JA 4TLRA 3IBCB 2UXBJ 4PG7A 3DRSA 1WKJA 1RWKB 2HZCA 2YPYA 4WKYA 4KBIA 2MQOA 4ALZA 3CGIA 4DDFA 3DDIA 1BHNA 5DDQC 5FDLB 1GX5A 4A48A 1YVFA 5IM0A 3D54A 3VAMA 3NGSA 1GMUA 3SDEB 3MEDB 1U1NA 5J1EB 4ZCKA 3FZBA 2F3JA 2R8KA 1PC4A 2DXFA 5H9FJ 3VGTA 4YS2A 1LW2B 1PYSB 3CMES 4CM2A 5C42A 1M5SA 2R2UA 3GPAA 4NOHA 2CYYA 3KLVA 4XDDA 3MZIA 1N32F 1HMVA 1FX2A 2Z2MA 1N88A 4HKQA 2NSCA 3R9LA 4J9QA 4CDIA 1DTQA 1OWXA 2PFDA 1ZAWA 1WSRA 5GAHU 1RHMB 5KFAA 5KG3A 2MGZA 1U1LA 2JEGA 1TVRA 5FJ4A 5GAEI 1VQPS 2P8IA 1F3FA 3SI8A 3TZXA 4ZVTB 3ZNJ1 3EUNA 2D3ZA 3UE2A 4YR0A 3RBDA 3FSYA 2VOOA 1WG4A 2ZH1A 2BJ3A 5T7LB 1FCAA 4OYZA 3NOCA 4IR1A 5IC4B 2GW8A 2ZJQQ 3HULA 2IJRA 1X9MA 1LOUA 3J7Z5 1AA1B 3TO8A 1SL0A 2MZJA 3H7HB 4DX6A 4UT4A 2LLZA 5EX0A 3EX7B 4ZN1A 4XK8C 3D66A 1DHMA 2C2OB 2VPWB 2ZBQA 2VOPA 1BQNA 3CD7A 4JI8F 4CO3A 5LJ3Y 2L9DA 2ADBA 3IGVA 2VODA 2XWYA 4LUBA 5D4NA 4RW4A 2VDHA 3EGNA 1U8SA 1G2EA 3DLBA 4IRCA 2FVPA 4OX9J 2AJ2A 3QWPA 2UU9F 4B3OA 4DR6J 1FNOA 1D09B 3CT9A 2X1FA 2HBZB 3WX8A 3IMQJ 3BBFA 4KE5A 4CO0A 1RQ0A 1NB2A 3S6EA 2C3UA 3WIUA 4D3HA 1FO1A 3EWGA 1HI0P 3TZWA 2QL9B 3L7PA 3R3TA 5BYRA 1T3OA 4DQPA 2LQ5A 4FN5A 3CWJA 1RU1A 3FVYA 2J8SA 2D41A 5HP1B 2FD2A 3UNGC 5C24A 4QIGA 2JEFA 3JYTA 3CCSS 3QAEA 1SQGA 2WBRA 1M5VC 4M63A 3W66A 2MQ8A 4L6V3 4U9RA 4E98A 3FBFA 2NZCA 3BGLA 4ZPDA 1C1BA 2UUBJ 1IBKF 2FZKB 4CLSA 1FDAA 4G1PA 1WELA 3W8GA 2XMVA 3FQKA 4CH7A 2MQMA 2VPXB 2AYBA 1N36J 4IQMA 2WW4A 5A8RB 4MFBA 3TQEA 1B99A 2IDLA 2AF6A 3M8ZA 4MAKA 2M9KA 3BQ0A 3IBFB 2DITA 4IRDA 3HX9A 3LGNA 3EGZA 2QO3A 5GAGI 2GVZB 1AXQA 2VB6A 3AT1B 4N8NA 1TKZB 4Q43A 4OYWA 2ZJPQ 5F3TA 1GAOA 4JV2A 4QPXA 4KGZB 2CIMA 2UXCF 4ZPWR 2Y1JA 4NLTA 4FYXB 1RXOB 3KOAA 4X66F 2YNHB 4DEZA 2DRBA 1TL1B 2QMXA 2QYCA 1UJ6A 2CJBA 3TARA 2XY7A 2ASJA 2OFHX 2VIHA 2J76E 3PV8A 1D8YA 1VRQC 2ACMA 5B7WA 3P6YC 1Q8BA 3OFFA 3ENQA 1CJVB 1MU2B 2YXLA 3TAQA 1A0OB 2GVDA 1RWPB 2P5VA 3CD0A 3MR5A 4G1QA 5AXMA 3ZZZA 3WIVA 4XIUA 1Q8KA 2HGLA 3S8SA 2HHHJ 3CULA 3A1YG 4NCGA 4DL5A 2E5JA 4LR9A 3AH6A 3I9ZA 3P49B 4WFBQ 3CJQA 3HFZB 2DR8A 4GC7A 3R7BB 3I82A 4JYAF 2AJ1A 4N47A 2GHWA 1VQNS 3DM2A 5IV3A 1EIYB 3OUYA 2XY6A 3TJAA 4E2FB 1JIHA 1TUGB 1RGVA 1S1WB 3IG1B 1S6UA 2ZEJA 5KFUA 4PEOA 4OZ2A 5ETPA 2IDEA 2KT2A 1NLKL 4HL9A 3GIMA 4A8FA 2V6AA 3PG9A 3UD5A 3BDEA 2NREA 2E44A 4FYVB 4RW9A 1V5VA 2VZ9A 2Q79A 5M2RA 3MUTP 1TV6B 4NA2A 2RU3A 1ULRA 3HHKA 1VQ9S 5F8MA 3AXKA 2YKAA 3OW2R 2AEMA 3DRXA 3ZZYA 3NLCA 3N0VA 3LAMA 3OSNA 2W2OP 3IAM9 3PZPA 2E1RA 2FLPA 4ID8A 4USJC 2QL5B 4WYWA 4URGA 1T9WA 3SV4A 5L1JA 3R8YA 4C8LA 3NNAA 3P5TL 2NXEA 1RTIB 2V4RA 2JC1A 1MN7A 2WHOA 3VAFA 4OV6A 1XJWB 4B08A 1Q7YT 5CAAA 4O44B 1NUEA 2J9CA 4QR0A 4DS5A 2M2BA 3IGNA 1ZH5A 3ZZTA 3KK3B 5FDLA 3GR1A 4NWBA 5HLFB 1FWKA 1ZBTA 2B9YA 1UZDA 4FKXA 3PM9A 3BYPA 3SDEA 3MEDA 1P27B 5J1EA 1JLCB 4U7UD 4RNOA 2JFDA 4BLGA 1IJEB 1IKXB 1K0VA 2MKCA 3AAWB 3SCIE 1FD8A 4DV7J 3HD1A 2DGSA 5J2NA 3K57A 2I9SA 5I3QA 1LW2A 1OPZA 1SH3A 2W2NP 3RU0A 5KG0A 1UVIA 2HVHA 4WU2A 1L3VA 2C3MA 3IRWP 3O5TB 2ZD1B 1KRPA 4WFAQ 4PXDA 4C97A 2JOQA 3POTB 3BS9A 2M88A 2CZ9A 3A8IA 1NKCA 1X4AA 4OI4A 2E7VA 1GMVA 3MEKA 4ED2A 2LECA 3NEKA 2RRBA 4YDDB 2CNNB 1RA6A 3G6ES 4DV5J 1NKBA 4DR3F 3H98A 2YPZA 2B7BB 4OZNA 4PUOB 4DFPA 2B7CB 2CFXA 3CCES 1V3SA 1FDNA 3ZZOA 3CJ5A 2HFOA 1FX4A 2EI5A 3FMBA 1JKHB 2HZAA 4LF7F 3NGUA 2VD3A 3NGTA 2LQJA 4UUWA 1O8BA 1LWEB 3FCVA 2NUHA 5KFWA 1HNWJ 2HW3A 4ES1A 2RUGA 3KLEB 2EXUA 2ZH3A 2V4QA 1SKSA 4ZCLA 2G0IA 3LP0B 5F8IA 1X9SA 1XNQF 1VK3A 4F02A 1ZZNA 1YI2S 4ECYA 2Q3PA 5DZ6A 2V9WA 2DEJA 2CWXA 1YJTA 3GJSB 4IH5A 4ECZA 1EARA 4A8YA 2R7OA 1WDTA 4OZ5A 1FKOB 1SKUB 4O3SA 4P9SA 1FXRA 1YSJA 4FZVA 3VGSA 3CDAA 3I32A 3PIOQ 2ROGA 3GIIA 1CQNA 1JQGA 2G0JA 2BZ2A 1R89A 3KK2B 2GX8A 4NCBA 1T9TA 5HP1A 3AXMA 2DIVA 4ID5B 2HFUA 2ADCA 2PMWA 1U0SA 1D9FA 1R0CB 1KLMB 3FGVA 4DSKA 3R5GA 2ZUGA 4AQYJ 1FD2A 4HT5A 4AYBD 3ILOA 4KKOB 1YRXA 3R6GB 5A8RA 3EJMA 3L3CA 3SYZA 5D0GA 5K8OA 1G7CB 3Q8YA 2WVFA 1BD6A 1P8GA 1QTMA 2HWHA 5LMUJ 1X0PA 2GVZA 2RMLA 4YHHF 5D8HB 2DBBA 5RUBA 1YKWA 3HSZA 2FVCA 1GXTA 3I9V9 5J2PB 1N56A 2KM8B 2OPSB 5BYQA 2A0FB 4NRTA 1QAIA 3DLGB 1TL1A 3IWNC 4ECRA 3O2IA 3O6QA 4K4TA 4KTQA 4WWSA 2G0CA 3EYZA 1H38A 3FUYA 3OLBA 1HWLA 3MM6B 2H5IB 3SCKE 3PFEA 4AL7A 3VAJA 4C8NA 5L46A 4NLXA 1MU2A 4OL8A 1XNRJ 1R43A 2UUAJ 2DXDA 3P8BB 1NMEB 3OSPA 1FJGJ 3UR3C 1EQMA 6FDRA 2OAUA 2HGMA 4R25A 3OJUA 2QA4S 3OR1B 1VRTB 2MKYA 3JSBA 3JTPA 4PG6A 1RT3B 2GA7A 1SH2A 3D0IE 3HK2A 2HQDA 2MMYA 2G2ZA 4O3RA 3DOKB 3GFXA 5DQIA 4PRFA 2B9WA 2A18A 4QBUA 1GTEA 2V9KA 2XSFA 3OXLA 5DDRC 5DM7Q 2KJVA 5DGBA 3K58A 1HBMB 3IP0A 3EGWB 4EO6A 5T14A 3N6LA 4P2SA 5HVGA 3W7BA 3QBCA 1ZM3A 3LW5C 1BWVA 4C48A 2Q1LA 1OY8A 4O0NA 1S1WA 3IG1A 2XZTB 2WOMB 2HHPA 3MMAB 3T3FA 5DGAA 5KFEA 1FTCA 3UVJB 5H1SV 4EBEA 1Q16B 1PG5B 1F9FA 4UZCA 4HHHA 3LGHA 2VG7B 4M5JA 4JI3F 2NYHA 3MDFA 3TVYA 2LEPA 1UTAA 3CJ0A 2N82B 3OLAA 3Q8SB 1U09A 1WOPA 1TFWA 5IT4A 3ET6B 2A2DA 1TV6A 1K44A 3LF0A 3I55S 5M2UA 3PNIA 4NI2B 4F25A 2OTLS 1C4AA 1VBKA 2OKQA 3D4JA 1TL4A 1PAEX 1TUVA 3NAIA 1PAUB 2DXEA 2PEHA 1XQIA 4FPRA 4IO1A 3IFEA 4FF2A 2QN6B 2ZH6A 4JI0J 2HFSA 2VFUA 2ATCB 2DHXA 4MTPA 4AUKA 1WHWA 1YJWS 1U1PA 1VQ8S 5HO4A 2R2TA 3IM8A 3MM7B 1RTIA 3AD8C 5F8JA 1SKWA 5B0BA 3GLJA 5U47A 4J9UE 1HARA 5KFMA 3D3BJ 1S1XB 1HNZF 3W5ZA 2QMWA 7AT1B 5EWEA 1N6QB 3CCLS 4DX5A 3HVAA 4O44A 2GMHA 4AL6A 1WORA 4FBUA 2APOA 4ED0A 3M8SA 4KPYA 3KK3A 2I0XA 2Q43A 1NXIA 5HLFA 2MZSA 2BJ7A 2FJVA 1YDLA 2K7JA 4UY8T 1JLCA 1XTZA 2H4YB 1IKXA 2HS0A 2AJQA 1CJKB 3NS6A 4P71A 4DR4F 2V69A 4AT1B 4YR2A 3RTVA 3M6UA 4B9MA 1VQOS 4XO0A 2B5JB 2B0GA 2X1GA 1KNZA 2WVCA 3LPYA 3K89A 3GSDA 3CC2S 3LALA 4DLGA 2JHEA 2ZD1A 3MD3A 5A8KB 5KFRA 1XR5A 2MTLA 4LF1A 3POTA 4B3SF 2V8VA 2AX0A 3HVWA 4PG4A 4FS2A 2BRKA 1I5OB 4ANEA 2JLGA 2W9BB 3SIPB 4K0KF 3EVWA 3QO9B 2P9GA 3D1HA 3OTDA 4PUOA 3DCAA 4KHPF 2DHSA 2JC0A 2BUNA 1U8WA 1JKHA 2U1AA 3H20A 5ETNA 3NCQA 4B9SA 4FYWB 2EVZA 1LWEA 4LVOP 3BR9A 4ZS6A 4OLOA 4Q0BB 3I0RB 3E3XA 3W9HA 1EZZB 3KLEA 1LXJA 2EWHA 5ADZA 1WACA 1AW0A 3LP0A 5LMNF 4DSEA 2J9DE 3OFGA 2CPDA 4U6PA 2Y0BB 4DFKA 4C6AA 3Q8QB 1C0TB 3JQKA 1HI8A 4DV2F 4R0EA 3JAMU 1RISA 2PN6A 2D74B 2YX4A 1NJXA 2HHUA 4OX8A 4I6AA 1QSYA 5EX3A 3NS7B 3QRPA 3SCLE 2AGQA 4LR7A 1FKOA 1TU0B 4ATNA 2F8MA 3NRBA 3Q23A 1S4FA 4MK7A 2YQ1A 2XBPA 4LBHA 3PW0A 3B78A 4A8SA 3QJPA 1FHTA 2VBZA 3ITHA 1KQSR 2IRYA 4DR2J 3MCNA 3JQJA 4PG5A 2XMJA 3KK2A 2DY1A 4FPIA 1KD1T 5CQGA 2J0WA 1W25A 2DIUA 4ID5A 4RU2A 4WP3A 1GNKA 4BC9A 5T41A 1KLMA 1UJ5A 4HI2A 5D77A 2B6AB 3VVTA 2UUCJ 3D9BA 4W90B 1RT5B 1X4CA 1YBAA 4A8MP 5CYMB 4LF9F 2ZDPA 4KKOA 2MEWA 2HHWA 4V19J 4CZCA 4W4MA 5HMWA 4ZP9A 3GB0A 2Z58B 2IBKA 5CCLA 1XN9A 2XMWA 2QA4G 4JI2F 4F0MA 2R7RA 3NCPA 1UMJA 2AJ4A 2W8LA 2AYGA 3TA0A 4K4YA 1OIAA 3EMTA 3AA8A 3JSYA 2KT5A 5F0UA 5KG1A 1BGXT 1I94J 1V3ZA 2CJQA 5J2PA 2YWWA 2PA8D 3R6LB 1UA1A 4DWIA 1N33J 1JXVA 3DLGA 3H4DA 3PX6A 2RDJA 3TUPA 2AZ1A 2KL8A 5HVHA 2QSFA 3Q83A 3R7SB 4J9MA 1Q82T 2N4DA 2CQDA 4O4GB 3MM6A 3RB6A 3RZAA 2KG0A 2DNYA 5L39A 4J7CA 4Q44A 2WTFA 4GO5X 3T5JA 3QSIA 1REVB 9ATCB 3LPEA 2NSBA 5HANA 3SXLA 4LSZB 4DQIA 3OR1A 1VRTA 2Y1IA 2A1BA 1W7WA 1RT3A 3W5YA 3BDPA 1PBUA 3HM9A 2POKA 3DOKA 2XB2D 1ZPWX 3DYAB 3OTBA 2L08A 2CJYB 1K0TA 5KG5A 3KLIB 5BR8J 1HBMA 1PC5A 4QWAA 4LF6F 1S0NA 1SH0A 4OYMA 4TQRA 2SXLA 3ZZRA 2UXDF 3KDNA 3W65A 1U6FA 1UVJA 2GAGC 5KTQA 3ZTPA 3J7A1 4RWWA 3MMAA 2WOMA 1LW0B 2YVSA 3ICLA 3UVJA 2RJZA 2PMZD 5B08A 1VQ7S 2CJKA 3VAIA 1M5PC 1XR6A 1KC8T 3QZ7A 4DPTA 4DR5J 3MTJA 4QCLA 1U0HB 2VG7A 1RU2A 2OSRA 3V4IB 1OSCA 3AODA 4ZPBA 3ET6A 3BGFA 3F73A 1QUPA 1OYDA 3TP2A 2XM3A 4A8KA 4NI2A 1FESA 4LREA 2DRDA 4UTGA 4NL5A 3UCZP 4FXDA 1JJCB 3TI0A 3MOJB 1Y11A 2EK6A 4ZVSB 1Y10A 3H42A 2RIJA 4DCPB 2FLLA 1B0TA 2LDIA 2BJDA 3NWRA 3MM7A 3DRRB 1NB7A 2DGTA 3AOBA 3TUIC 4LIRA 1S1XA 3MEEB 2DCLA 1F5BA 3W3SA 1N6QA 4PQAA 2WCXA 1P9YA 2RD5C 1K73T 4DOZA 1SJ3P 2VG6B 4IH7A 4ES2A 4HR2A 4HHUA 1LFPA 2OEMA 4DV1F 1BY9A 2ZUAA 2BACA 2QA1A 1CC8A 1MG7A 2ZE2B 3N28A 3C14B 3PKMA 2IM2A 2AU0A 3MCMA 4XDCA 3NGKA 3DRPB 1CJKA 3FSXA 2PGCA 3VVUA 1Q7LB 4CRJA 4EI2A 1IQTA 4OHXA 2Y3YA 2B5JA 1VQ5S 2DK2A 2P9EA 5J1PA 1BC6A 2W1BA 1SPBP 3BSOA 2KXHA 4DQRA 4DR7J 3KLGB 2DNRA 4O3OA 4PAAA 3VZIA 3VZHA 1RCOB 1K9MT 4C8ZA 4LF5F 2V8DA 2W9BA 4DUZF 4CO2A 3GYXB 3QO9A 1NH7A 4ED7A 5K8MA 3J81Y 5F0WA 3SSQA 3FEZA 3UWTA 5A2QY 2MKKA 4CO5A 2HIYA 2LA6A 3HHDA 4ZLNA 3V6HA 4L3NA 2CJ9A 4JI7J 3ENWA 3F44A 4Q0BA 3I0RA 2CPYA 5LSOA 5K8NA 4ZVQB 2UXBF 1NDPA 2YWHA 1C2PA 3R7NB 2YNFB 4M5NA 2J7UA 4ILRA 2QLBB 2ZZNA 2H51B 1LWFB 3B54A 1IN0A 1C0TA 4YY3J 1VQYA 4R8UB 3VR1A 5GADI 5F9LA 1ZAXA 3BKTA 3NKYA 3HDSA 4NYPA 3LGMA 3WC2A 4HACB 3KHLA 3TA1A 3TW0A 1NAQA 1NSAA 2MHEA 1EKRA 1KVIA 2K1RB 1IQZA 3MAAB 2ACYA 3HVRA 2C2KB 1N8RT 1QVGR 2VH7A 4FYDA 1V6HA 5L38A 3TWZA 4NRUA 4LIWA 2N7CA 2KN4A 3A4TA 3A13A 5L8RC 2AQ4A 1N0UA 4KHRA 2E5GA 3W2VB 4CLUA 4ECXA 2ZNYA 2CJAA 1GTHA 1GK8A 1S9GB 3DRYA 2BBEA 2XYGB 1I6JA 3RAXA 1MMDA 1KWMA 1FWLA 1XWLA 3P4UB 4J5OA 2DNZA 1UFLA 1HNXJ 1RTHB 3CMAS 4N7TA 4WP8A 1NK6A 2YX7A 4DG1B 2IRUA 5LSLA 1VHIA 4PKDB 1N4LA 4CH0S 1TKDA 2B6AA 1WTFA 3G8SA 1VBYA 2DHAA 1RT5A 4QIVA 4I0WA 5CYMA 3M6WA 5LM7E 1F2GA 1RBAA 4X4UA 4PQUB 1HD0A 2KYZA 1JLEA 1EB0A 3G86A 2MZ1A 2GQ2A 2BDPA 5D3GB 4ZPAA 2XS5A 3IN5A 4GVBB 1IBMJ 4WTYA 5EUHA 5GAHI 2N3OA 2YH0A 1SUQB 1NPPA 3PRVA 1U26A 1RT7A 4C11B 1EKSA 4ZIWA 4DN9A 2F63A 4DPUA 2BOAA 2KM8C 3GWCA 3FRZA 1JLQB 1Q0NA 4IOCQ 4YFUA 2CNLB 4OX9F 5DQGA 2ZH4A 5HJYA 1KQGB 4DR6F 2E5HA 5CZXA 5DLGA 2O01C 4JI5J 4DUYJ 4BWJA 2FZCB 2QV6A 3PR5B 3RBZA 2V0NA 2EEYA 3M30A 4O4GA 2ASDA 2FTRA 3AD9C 3SQGB 4KFBB 4RJVA 4F0KA 3PFOA 1WJ9A 3VTIA 3DGVA 2IM3A 1REVA 1HHTP 3W64A 1VDHA 1WHXA 4ZP6A 2WZ1A 4ZLJA 3QT6A 3H2VE 1MROB 2H48B 2P9CA 4GO7X 3NNHA 1A6LA 4UOFA 3PW4A 1S7HA 3K5OA 2BMBA 1PYTA 2I38A 5IOLA 4AXJA 2UUBF 2XO7A 5D78A 3WQPA 4OJGA 3DYAA 1SL1A 3T9ZA 1VGYA 3KLIA 1N36F 2DCUB 3MMCA 4WP9A 4ZHRB 1O6XA 2MLZA 3NG8A 5K9FA 3GYGA 3MFHA 1B0VA 1T9YA 3CO0P 1ICEB 3HJFA 4MJKA 5IQQA 1WTBA 4ZOSA 2H54B 2JLEA 3HFVA 4PG8A 3GTYX 1NO8A 1VFJA 3SMZA 3AB4B 2HZVA 3KHHA 1LW0A 4LQ9A 2K7KA 1EX8A 2OMLA 2VDIA 1SV5B 2X51A 1H2TZ 3M32B 3GCWP 1U0HA 4I7FB 3B8HA 3ULHA 1VRUB 3KWMA 1YRUA 3D1OA 3V4IA 1D1UA 2FJWA 4N76A 1SJ4P 3UQSA 1NRKA 3EXCX 2Z4PA 4KGMA 1JXLA 3BR8A 2HS3A 2BEFA 2DGXA 8ATCB 2PO4A 2W2PP 1C1CB 1JX4A 4L73A 9RUBA 1IWGA 3TX8A 2NQPA 1GX6A 3BKFA 4CTAB 3HPOA 4YQWA 3DU5A 1WWHA 5LL6d 1SJ1A 4CLLA 2GAHC 3VALA 5HJXA 2XS7A 5A6PA 2NUUG 3MEEA 3NY0A 1RWVB 1JLAB 3KTQA 3HSDA 1VMBA 2DH8A 3OQ2A 2OPPB 4M5HA 3L09A 4KQZA 3J7ZT 2VG6A 2DNKA 2HPUA 1M0SA 1YIJS 5ETOA 2FJAB 3M8YA 3TA2A 4Q2LA 4JV0A 3FJ2A 1KN6A 1Y4ZB 2ZE2A 1TTHB 3EZOA 3TNVA 3DRPA 3M2RB 1CQMA 1SBRA 5K8PA 1T02A 4O3PA 1CLFA 1HI1A 3G6YA 2GJ2A 3Q22A 1HD1A 2AJ0A 4WFZA 1B7FA 3O1LA 2GFFA 4F0HA 1CJUB 1S97A 4WK3A 5SUHA 3T1AA 3I4PA 2IVMA 3X1LB 5CYJA 3FMWA 2ZH5A 3Q8PB 3MPVA 3SZ2A 4ZPTR 3N4WA 2RS2A 3KHRA 1RDRA 5JVHQ 5HVFA 3M6XA 1RHKB 1ZETA 3A12A 3H5SA 3LANA 1U4BA 3ILLA 1KKHA 2DB1A 1PJ6A 4DV3J 1UAWA 2A3JA 1RT6B 1P6TA 2QJ3A 2VFVA 2YBVA 1IBLJ 2GQQA 4H4MB 4E0DA 3THTA 3LTOA 2RSQA 2YNFA 2NXNA 3NBPB 2V2KA 3C46A 2M8DB 2VBYA 1LWFA 1S57A 2OTJS 2L48A 1XC9A 3T9NA 1FRMA 1RADB 5ETTA 5D4OA 4R8UA 4RLEA 1FRLA 5KG6A 1Q78A 2IRXA 3OL8A 3RW6A 3CNQP 1RBOB 4XTTA 1VCTA 4HACA 3PIPQ 5F8NA 4WKRA 3MAQA 4CCHA 2FJDB 3MWBA 3GIKA 3OHBA 5AE1A 4L3KA 2F8HA 2K1RA 3MAAA 4DV7F 2ZFHA 4EFAC 1VQLS 2LDYA 1IR0A 5AXNA 2LXUA 1S1TB 4PXCA 2IFXA 3QSYB 3CD6S 2VFRA 3TUJC 1YJNS 1W2IA 5IT9U 2ZH9A 3BSCA 3PEJA 2VPZB 2ZOFA 4WBFA 2NPIA 4LF8J 1WI8A 5ETVA 1RT4B 3UFCX 4DL6A 1EJ7L 1S6QB 4DV5F 4LF4J 1JJ2R 3BSNA 1NK5A 4F36A 1N54B 4DG1A 2VG5B 4QWCA 4J37A 1NK7A 2BJEA 4LJMA 4J9OA 3AHPA 4FF3A 1UEUA 5C25B 1HNWF 3OPKA 5AE2A 1J2VA 3W61A 4RW8B 4PQUA 2CPJA 2ZH7A 4B9LA 3ZNUA 5ETSA 3BGUA 3CTRA 3J81j 5D3GA 1FDDA 4GVBA 4JI1J 2KZZA 4HH0A 1TUWA 3CDUA 4G65A 4OYXA 2HWTA 4C4WA 1SUQA 5E7OB 4C11A 1FNMA 2G1HA 3R97A 1UL3A 3MR2A 3V81B 2KU7A 1JLQA 4MIBA 3C6TB 3L9ZA 3PYGA 4C3KA 2JSXA 1NH8A 3BGRB 1DURA 4EK2A 2UUWA 4IG3B 3PJ9A 2DNGA 3VHQA 4KGKA 2JRSA 4C98A 1IXKA 2RS8A 4B3RJ 1K8AT 4YP3A 3QT5A 3NS5A 1UEKA 3KG1A 2RRNA 5A6WA 4C0HA 5IWAJ 1DBDA 3A8EA 4NLRA 3QYYA 2KYXA 4RWXA 4I6YA 5KOWA 3QGGA 4O23A 3SQGA 4KFBA 2FGOA 2WONB 2C22A 2X7IA 1MROA 3KJQB 2R7UA 2W4PA 1S6OA 5HMXA 2HNYB 4M5KA 4X4SA 4C8KA 2RDDA 5KT7A 4RW6B 4OI3A 3CIMA 2DO0A 1NSPA 2ERRA 5BYSA 1TP7A 4AQYF 3GONA 4ED5A 4JB8B 1MN9A 3C19A 2GJFA 2CG4A 4EEYA 4ZHRA 3ETOA 4C2MA 1F6TA 4NZ7A 2C2DA 2R7TA 8AT1B 3PW5A 5B0EA 1LNQA 3MF5A 1KSPA 1XBWA 5LXRA 1TAUA 1UKUA 1FNXH 4P2XA 2G2OA 3QT7A 1HQUB 3RYLA 5LMUF 2KRBA 1RWWB 1SV5A 3BSAA 2RH3A 5HQ8A 1FKAF 3M32A 4TQSA 5EWFA 2C2ZB 4WZMA 3OT9A 2DR5A 4I7FA 2YQ3A 3MOZA 1VRUA 3V6DB 1E6VB 3IS9B 4ZKAA 3R5DA 1RT2B 1H7XA 4TU8A 1CBKA 1S59A 3C3LA 4OHVA 2FPHX 1IKWB 5E33A 2VHGA 1SIZA 1NK0A 4Y2AA 2ZM6J 1C1CA 5ETLA 4ED6A 4R5PB 5FLXU 2FJBB 2YKMB 2IBOA 4CTAA 3KXDA 3T6JA 1Q8LA 1XNRF 2UUAF 1U1QA 3VAHA 4CO4A 4F3QA 3KK1B 5GADU 3ENVA 4DQSA 4X4PA 2YWGA 4KO0A 4HEA9 1FRJA 4Y3CA 2CQ4A 1JLAA 2BABA 2CXEA 2ILZA 1X4FA 2C28A 4LRAA 3CJKB 3OXFA 3I4HX 1D9DA 1KS2A 2OPPA 3DFEA 4YN3B 1XMQJ 1NHVA 3BH6B 3BN7A 1VQ4S 4IRKA 2HQGA 4ZVHA 5K14B 1APSA 1XNQJ 5HAOA 1X60A 3TAMB 5CD4A 4C8YA 3VGVA 1PJ5A 2OEKA 2E9TA 4DI6A 3M2RA 2DH9A 2J6SA 4M94A 2OI2A 4DHVA 3M1VB 3HZGA 3SSRA 1VYAA 2QTWA 4F4YA 4I2PB 1S6PB 4KAIA 2CAJA 2HNZB 2XYPB 1A7GE 2V67A 4U7UK 1B64A 1CJUA 2PMHA 5G4DA 5DJBA 3BN4A 4F2RA 4HTIA 1YK9A 2JL9A 1G4CA 4RO0A 4DJBA 1UZHA 5CA5A 3H2UB 2YQ0A 1AZSB 1T7PA 2AZ3A 2B8QA 4IUFA 2W9CB 1YHQS 2EC2A 2XULA 1QAJA 3SFGA 1Q5YA 3DC2A 2RHQB 4ZP7A 2ZHAA 4NLYA 2ZNZA 2C2EA 1RT6A 2CPFA 3EDRB 4DSLA 1VBXA 1HW9A 4H4MA 4O3NA 4ZCIA 2R8HA 5DG7A 4ZVRB 1NU4A 4UOHA 3PXGa 3NBPA 2PC6A 2XLIA 3WDOA 1S10A 3RGIA 3EM1A 2EFPA 1HBOB 1HYSB 4A46A 3NL0A 2G1DA 3SCJE 4QOTA 1RAAB 2J9DA 2F4VJ 2IM0A 1G6BA 5D0EA 3H5UA 3FZ2A 3W9JA 3TUZC 2EFOA 1HWIA 1H0HB 3K2YA 2D9PA 2Q6CA 4Q7AA 2D7SA 4EU0A 4JI4J 2YKPA 2HSEB 2ZBCA 1U47A 3J80Y 4Y2MA 2OPQB 3JTOA 1YG0A 1S0VA 5IT0A 2VL1A 1S1TA 1EQ0A 3QIDA 2M70A 4QIFA 4B9UA 1J5EJ 3EICA 2V4JB 3F0NA 3UN5A 3MPUB 3KJNB 1RT4A 1UWAA 2RT3A 5KFGA 4C0OC 4F26A 1S6QA 1BLUA 1VR6A 1ZA2B 2RQCA 1QJHA 4YB7A 3GV8B 3D67A 2OGUA 1QTNB 3KKFA 4YDXA 5GMKa 3HT0A 3GR0A 2X1AA 3LP2B 2KVQE 1J27A 2DNOA 5KFKA 3BKUA 4DMZA 1X0FA 4GKJJ 5KFSA 4RUBA 5C25A 2KRRA 4OV1A 4RW8A 5HROB 1WOOA 1PIEA 2LQBA 2EFNA 1KHWA 4D3GA 3QGHA 2ZBRA 2Q66A 1HWUA 1B0PA 1RAIB 1Q79A 2PDAA 3V81A 4F3OA 3CJ8A 3CDBA 3C6TA 2XMAA 2F5GA 2W4CA 3BGRA 1KR4A 1HR0J 4HI1A 5DG8A 4IG3A 3I0SB 2XI3A 3QRQA 1TL5A 5JUMA 2L9WA 3R5JB 4QJVA 1U6BA 3CCQS 1CEZA 4OFZA 1N5QA 1XERA 2FUG9 2DD8S 3ELHA 2GQCA 4ZJLA 2KFNA 2UP1A 1SC4B 1RT1B 2CQ3A 3MAHA 4HTJA 4QYRA 1EP4B 4DR2F 1FF2A 2KHCA 4EGLA 1WG5A 1LWCB 2HEKA 2R9LA 2J6TA 5L9XA 2WONA 3R5BA 2HNYA 3HSGA 4ED8A 2QLFB 3TAPA 3MHYA 4RW6A 4NMXA 1KTQA 1ITPA 1WF1A 4MKAA 2NPFA 4CI0B 2UUCF 3MR3A 1NHUA 1VI7A 4F04B 1VC5A 4C7QA 3ZTOA 3BO2A 1IUJA 2J8AA 3MM9B 1WKLA 3K5MA 4LR8A 3LH2S 3RW7A 3CCJS 3AJ2A 4N8OA 3P5BP 3L95X 3UDVA 1QE1B 2AMCB 4RL1A 1V9OA 4U7CA 2HVEA 3OXGA 4RNMA 2CNKB 3M8PB 3O8WA 2JJ4D 2KH9A 1HQUA 3KLHB 1UPPA 1S79A
chains in the Genus database with same CATH topology
1U6FA 4USIA 5KTQA 4ECVA 1M90T 1UVJA 1U2FA 1RJJA 3DM2B 3FFIA 1HR0F 3J7A1 4RWWA 2AW0A 1RTJA 1LW0B 2WOMA 3MMAA 2YVSA 3ICLA 3AY0A 1T94A 1TAQA 3OUYB 2RJZA 5CZVA 1I94F 2FIUA 5GAEU 2PMZD 5B08A 1VQ7S 1R3NA 3VAIA 2CJKA 1M5PC 4QR2A 1XR6A 3VWSA 1KC8T 3V6DA 1DTTA 3QZ7A 4F67A 3PRBA 1K1SA 1E6VA 1U2RA 1BQMA 2DNNA 4RW7B 2XCAA 2ZH2A 4JBCA 2JEJA 3MTJA 1D3WA 3IS9A 4BBYA 4QCLA 2IMOA 3CXCR 2QZ8A 2VG7A 3N79A 1FJ7A 1N33F 1P1TA 1YGYA 5HMZA 1GXUA 3H40A 4DL7A 4ELVA 2IYGA 1RT2A 4WCEQ 4TY8A 4A47A 1Y5IB 2OSRA 3V4IB 4A4JA 1OSCA 3SSSA 5E3QA 4F4ZA 4IR9A 4UW2A 1IKWA 3DMJB 1HW8A 2I5JA 4CNZA 2HMIA 2AV5A 2B3TB 3B4MA 4ZPBA 1U48A 2Z2LA 2MQQA 2DVIA 3BGFA 1W2BR 1F5AA 2ZHBA 2COLA 3F73A 3QAUA 5G0RB 1QUPA 2UVVA 2OSQA 3TP2A 1FEEA 4RW9B 1X5TA 4A8KA 1ZM4A 2CQHA 4QW8A 2GGPA 4R5PA 3OJSA 4IFYA 1VBZA 5LT5A 3N01A 1FESA 2V5HG 5C5JA 2YKMA 2EK1A 2MQNA 3GMGA 2V8GA 2EC0A 4NL5A 1Z4UA 3KLFA 3UCZP 2EFVA 1JLGA 2XHWA 3RAMA 4FXDA 1JXEA 1DZ5A 3KK1A 3TI0A 3MOJB 2EK6A 2VQFF 2MSSA 4IFVA 2GV1A 3OBIA 1RA7A 3HVTA 3H2LA 3CJ3A 4JV5F 1SJQA 4YOEA 1Q4RA 2RIJA 2FLLA 4QIEA 2R7QA 4NA1A 1B0TA 2DNHA 4M8LA 1LV5A 2LDIA 2BJDA 2ZC3A 5KT6A 4OI2A 5DRKA 4PPZA 2RB7A 1DQ9A 3AQPA 3MM7A 1N48A 3DRRB 1NB7A 3OL6A 1WD6A 2DGTA 3DLJA 1J5OB 3DRRA 3CJKA 5KFYA 3TUIC 4HYKA 3DLLQ 4LIRA 3OR2B 3VAKA 1S1XA 3MEEB 1OPIA 4TLRA 2DCLA 1F5BA 4OZLA 4NA3A 4PG7A 3W3SA 3DRSA 1O0PA 1S1UA 2HHHF 1N6QA 4PQAA 2WCXA 2RD5C 2HZCA 4WKYA 4X84A 5BR8F 1K73T 5K14A 4KBIA 2G4BA 4DOZA 1SJ3P 3EPGA 2CZVC 4ECWA 2VG6B 2YWEA 4CO1A 2MQOA 3HHLB 4ECSA 4IH7A 3TAMA 4QU7A 4ES2A 3DLEB 4DF4A 3PJWA 1SL2A 2KT3A 3OL7A 4CNYA 4ALZA 5CD4H 1LFPA 2CQCA 3CGIA 4ICLA 2QFJA 2VUGA 4DDFA 4DV1F 3U1LA 5DDQC 1BY9A 2BACA 2GHVC 2QA1A 1CC8A 2ZE2B 3CE8A 3N28A 4NZ0A 5B0GA 4RBVA 4RUAA 2AD9A 3LUYA 3D1QA 5FDLB 4AFFA 1GX5A 2FHMA 4A48A 3PKMA 2IM2A 2AU0A 5IM0B 1YVFA 3MPWA 4FF4A 3M1VA 4XDCA 5IM0A 3NGKA 3D54A 3O44A 3MD1A 1HNIA 5I3PA 1URNA 3DRPB 3I96A 3VAMA 4I2PA 5DDOC 5D4LA 3SDEB 2YWFA 3FNNA 3MEDB 1U1NA 3FSXA 5J1EB 1S6PA 2PGCA 4ZCKA 2IHR1 2JLFA 2HNZA 1Q7LB 2VA2A 3FZBA 2F3JA 2R8KA 2IA6A 1IQTA 1PC4A 4OHXA 4I4BA 4NZ6A 2B5JA 5H9FJ 4DR5F 4EZ6A 2MJUA 4B9NA 5L1LA 3MEGB 4JI6F 5KFLA 1VQ5S 1LW2B 2V8HA 2DK2A 2P9EA 5AJ3F 4AE5A 3CMES 4EYHB 5C42A 1FK9B 2CKWA 5J1PA 1M5SA 4G1IA 2R2UA 4DL4A 4NOHA 2CYYA 2J5AA 2AYEA 4OLPA 1BC6A 1GH8A 3KLVA 2FHKA 3BSOA 2KXHA 3H5YA 3MTKA 3GV5B 4DQRA 3KLGB 2DNRA 4XDDA 4O3OA 3MZIA 1N32F 5LXYA 1VQKS 3KLGA 3VZIA 1HMVA 4EWTA 2W9CA 2MKHA 2Z2MA 3K0JA 3VZHA 1N88A 3JSMB 3O3LA 2JX2A 1K9MT 3M6VA 4HKQA 2NSCA 2HG4A 4LF5F 4C8ZA 4J9QA 2V8DA 2W9BA 4DUZF 4IOBA 1TQLA 5JVGQ 4CO2A 5EDWA 2OIHA 1DTQA 1OWXA 3K5PA 4NPOA 3GYXB 3QO9A 1NH7A 1ZAWA 5GAHU 2QSWA 5KFAA 3CJ4A 5KG3A 4EBCA 4ED7A 2MGZA 1U1LA 2JEGA 3CCUS 5K8MA 3J81Y 5F0WA 1TVRA 4DL3A 3SSQA 2I1RA 5FJ4A 3FEZA 4URSA 3UWTA 5A2QY 5GAEI 1VQPS 1SI9A 3SI8A 2MKKA 5B09A 4CO5A 5HN0A 2RRAA 7FDRA 1RYRA 1L5UA 1P9QC 2LA6A 3HHDA 1WF0A 4OI1A 4FF1A 2XGQA 1JMTA 4NLSA 3V6HA 1YJVA 3EUNA 2LXFA 4L3NA 2D3ZA 1IKYA 5E3RA 3UE2A 5GAGU 4YR0A 5LJ5Y 3RBDA 3FSYA 2CJ9A 2OMOA 3ENWA 3F44A 2VOOA 1WG4A 1CG2A 5KFIA 2ZH1A 4H4OB 1M1KT 3MMBA 3E2EA 4Q0BA 5T7LB 3I0RA 1FCAA 2YKOA 2CPYA 4IR1A 5LSOA 5T7LA 4IG0B 5K8NA 2GW8A 2MKIA 2DO4A 2ZJQQ 1FVSA 2UXBF 4UOCA 2YWHA 4ECQA 2ZKUA 1HBOA 1HNVB 2FVRA 1HYSA 3D0GE 1C2PA 1X9MA 2YNFB 1LOUA 3J7Z5 4Y6IA 3FEYB 3G6VA 1H6KX 2R2SA 2J7UA 2ZOGA 3TO8A 1SL0A 2HNDB 2MZJA 4XPCA 4ILRA 2GC8A 2LLZA 1AROP 2JVRA 4H54A 4EZ9A 4RUCA 5EX0A 2QA2A 3EX7B 2ZZNA 3K5NA 1X4EA 2LKZA 4XK8C 1OO0B 1LWFB 2FB0A 4LSLB 1DHMA 1IN0A 1C0TA 2VPWB 2N7YA 2VOPA 1MWYA 4LVNP 1VQYA 1BQNA 3CD7A 4R8UB 2RKIB 4JI8F 3VR1A 4CO3A 3UPFA 5GADI 1S1VB 5F41A 2ZBIA 4IKAA 4CT8A 5F9LA 1ZAXA 3PR4A 4P7VA 5LJ3Y 3NKYA 2D9OA 3HDSA 4KJIA 4NYPA 3RRGA 2L9DA 3LGMA 3WC2A 3GE9A 2ADBA 2UVWA 3IGVA 2VODA 3KHLA 3TA1A 2M7SA 3TW0A 2ZZMA 2XWYA 1NAQA 4PXEA 1FT8A 2OPQA 3UI3A 1VJWA 4LUBA 1U24A 1LK5A 1SIWB 2MHEA 5D4NA 4RW4A 1KONA 3EGNA 5DO2A 2M5YA 1U8SA 1KVIA 1G2EA 3JB9k 3GG1A 3DLBA 4IRCA 2K1RB 1IQZA 1RKJA 4A8QA 3DOLB 2CQ1A 2F8EX 1RTDB 2FVPA 3V5RA 3QWPA 4DPOA 2ACYA 3DI6B 3HVRA 1N8RT 4NLOA 1QVGR 2VH7A 1O5JA 4FYDA 5D4PA 4Y2KA 2UU9F 4B3OA 1V6HA 5KFCA 1FNOA 5A0YB 5L38A 4NRUA 4LIWA 1KFDA 3D28A 3CT9A 2N7CA 2KN4A 3HHNB 3U02A 5L8RC 2AQ4A 4C8MA 1N0UA 4KHRA 2X1FA 2V4JA 4X4NA 1FE4A 4DR7F 1URRA 4KE5A 2E5GA 4NXMF 3W2VB 4CO0A 4JV1A 4ECXA 2BE2A 4DFMA 2FC8A 1VK8A 5MLCV 3W2VA 2IVYA 1RQ0A 2ZNYA 2CJAA 3QLHB 4RUHA 1GTHA 1R8AA 3S6EA 4Z37A 1S9GB 3DRYA 3MUVP 2BBEA 2C3UA 4OHYA 1S9GA 1FO1A 4D3HA 2CQPA 1X9WA 4ZCMA 1I6JA 1HI0P 1FERA 2B9XA 1S49A 2KG1A 3RAXA 1MNEA 1MMDA 4I67A 2KZMA 2GCFA 3L7PA 1XWLA 3R3TA 4J5OA 5BYRA 4LQ3A 2FDNA 4ZVEA 2DNZA 4Y2IA 1UFLA 1T3OA 3IR6B 1RTHB 4DQPA 2LQ5A 3MM8B 4FN5A 1S99A 3CWJA 3CMAS 3FVYA 1RTHA 1NK6A