4IOAQ

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ioaQ00
5LJ3Y 2OTJS 2MYFA 1X4HA 3Q2TC 4FXWA 4PRFA 1K9MT 2Q79A 2M7SA 2MJUA 3MDFA 1VBYA 2D9OA 3H2UB 1Q86T 1KOOA 2MZSA 3MD1A 2ZJQQ 2MB0B 2DHXA 2AD9A 1FT8A 2DGOA 2VOOA 1A9NB 2XS2A 1QVGR 3G9CA 3RW6A 2QA4S 2MPUA 3FEXB 4OZ1A 2EK6A 2KRRA 4W92B 2DNLA 1D9AA 1F9FA 2YH1A 3CC4S 3UD4P 2KXNB 4EGLA 3G96A 2E5GA 2GHPA 1YJ9S 1P1TA 4QPTA 2J0SD 2RQCA 2RVJA 1X4EA 1Q82T 2K3KA 2JVRA 2DH8A 3IWNC 5CYJA 3P49B 5DDOC 3THPA 3N9UC 3VALA 2MZTA 1U2FA 1JJ4A 3I56S 2L41A 2HZCA 2DH7A 2M70A 5DM7Q 2RT3A 1VQKS 2QEXS 2AYMA 2KVIA 1U6BA 2FPHX 1NJIT 2CQGA 5GAHU 3MURP 4WCEQ 1XN9A 1Q7YT 2DITA 2FHOB 2LA4A 2VONA 3P5TL 1R8HA 4CIOA 4LJMA 1WWHA 2XSFA 1FJ7A 1M1KT 1WF0A 2SXLA 1YWXA 3CULA 4C4WA 2O3DA 4F02A 1K73T 2GO9A 1VQPS 1UW4A 1KOHA 2PEHA 5MLCV 2JX2A 1YTYA 2FY1A 1YHQS 3BO3A 2XNRA 3US5A 2L08A 2MMYA 4WIIA 2MQOA 1S72S 2AYBA 5LSOA 1VQOS 1ZZNA 3CUNA 5LJ5Y 2KG1A 2DHAA 2MQNA 2KT5A 3K0JA 2DNZA 3CCRS 2DIVA 3NS5A 3B4DA 2DNOA 2X1GA 2DNGA 1OIAA 2KM8C 2G4BA 2G1DA 1KC8T 1JJ2R 2MGZB 2MKJA 3CCES 4WKRA 2U2FA 1ZZFA 1VQ4S 3S8SA 5HO4A 1VC6A 4RU2A 4PKDB 2CQBA 2VOPA 1X5TA 2B0GA 4ERDA 1X0FA 1VQLS 2DNMA 2AYEA 1YJNS 3CTRA 5LXYA 1X5PA 2CQIA 3U1MA 5EN1A 4J5OA 2KXHA 1R8PA 3HI9A 1SJQA 2I2YA 1SXLA 1N54B 2MKHA 3R1LA 2DGQA 5JVHQ 3V4MA 3MUVP 2MKSA 1H2TZ 1RKJA 2LEAA 2JRSA 2MQPA 1QM9A 4WFNQ 3BO2A 2X1AA 2MY8A 4YUDA 2DB1A 2DK2A 1JJHA 1M5KC 1HD0A 4M5DB 3CPWR 3H2VE 1H6KX 1DBDA 2DGSA 2E5HA 2DO4A 4P6QA 1P27B 2M8HA 4CH0S 5HL7Q 3G8SA 1YI2S 1WF2A 3CMAS 1U1MA 3MD3A 1WG4A 3EGNA 3MUTP 5GVQA 3U1LA 1SJ3P 2YH0A 1WI8A 1U1NA 2CPFA 3HHNB 2DNNA 3TO8A 2OIHA 4QU7A 1WEXA 2CQ3A 2DH9A 3RW7A 1X4FA 3ZZZA 3EGZA 4BS2A 2KXFA 2KFYA 2LA6A 2KU7A 3CCSS 1CVJA 1PGZA 2N7CA 1WELA 3S01A 1WEZA 2XB2D 2RS8A 3UD3P 4IUFA 1M5OC 1DRZA 1H2VZ 2F9JA 2DGUA 3CC7S 4IOAQ 3JB9k 3UWTA 2LCWA 2MGZA 3EX7B 2XS5A 4F25A 3VAJA 2FC9A 4UY8T 3THTA 2LECA 1VQ9S 2LXUA 2MSTA 2MJNA 3NNHA 1FHTA 2RRAA 2E5IA 2MKKA 2CQ1A 2CQCA 1BY9A 1FJCA 2MY7A 3PIOQ 2KG0A 3UE2A 1OWXA 5ITHA 2CPEA 4Z2XA 3DLLQ 2DNPA 2MZQA 1KQSR 1VBXA 2CJKA 1FJEB 1JMTA 2DHGA 3VAGA 1UAWA 3NS6A 3J7YU 2CQ0A 3G8TA 2RS2A 1WTBA 2V94A 3B4MA 4W90B 2CQDA 1Q81T 4U67Q 3I55S 2I38A 5DDPC 4TU7A 1VQMS 4Y00A 3L3CA 5FJ4A 5JVGQ 2X1BA 2MZ1A 3D2WA 2N82B 3P3DA 5DDRC 1U1RA 4Y0FA 1X4GA 1M5VC 3CC2S 2RU3A 3SDEA 3VAMA 3VAHA 2M4MA 1N88A 2CPZA 3UCGA 2LMIA 5BJRA 1WI6A 1U1PA 1VQNS 3SDEB 1WF1A 2CPDA 2E44A 1WG1A 2OSQA 1M90T 2RUGA 2MSSA 2HGLA 4C0OC 4CH1A 2X1FA 2G0CA 2LQ5A 1QVFR 2CPHA 3IRWP 4V19X 4WF9Q 1VQ6S 2MKIA 1VQ8S 2ZJRQ 4WFBQ 3CMES 2RRBA 3FEYB 2KN4A 2KH9A 2NLWA 3VAIA 1VC5A 4YOEA 2MHNA 1OO0B 2N3OA 4F26A 1IQTA 1U1QA 2M52A 4ZKAA 2ADBA 2MZRA 1FNXH 2MZJA 3NNAA 2CQ2A 2BZ2A 2CPIA 2RNEA 1X4BA 2KRBA 1YIJS 1WHWA 2EVZA 1U1OA 3S6EA 1VQ5S 4UQTA 3G4SS 4QU6A 3CF5Q 2M88A 4CQ1A 2NZ4A 1WHVA 3LQVA 1NU4A 2LYVA 2DGTA 2YWKA 3UCUP 3MUMP 2J0QD 5GADU 2OTLS 2D3OR 4A8XA 5GMKa 4IOCQ 1UP1A 1SJRA 2HVZA 3P6YC 2LEBA 1RK8A 2CPYA 5IM0A 2MQLA 2K8GA 3G6ES 2JVOA 3MI7X 5D77A 2PE8A 3R27A 2DGXA 3PIPQ 2KI2A 1N52B 1NO8A 1U1KA 3CCUS 3BEGB 5H1SV 3ZZYA 2XS7A 2HYIB 2MQQA 2XNQA 2AYGA 2WBRA 4LIRA 5CXTA 1K8AT 4WFAQ 1DZ5A 1AUDA 5IQQA 1VQ7S 2HGMA 2KHCA 3NNCA 3LPYA 1HD1A 3CD6S 1X4AA 1W2BR 3SXLA 2ZJPQ 2M8DB 4ED5A 4IO9Q 2DIUA 5GAEU 2N3LA 2DNRA 3S7RA 1X4DA 3CCQS 2CQ4A 4QQBA 2ERRA 2MQMA 2A3JA 2JWNA 1WHXA 2L9WA 1YITS 2DNHA 3OW2R 2KM8B 1N8RT 1ZH5A 1OPIA 3CCLS 2ADCA 1DHMA 5LSLA 5DDQC 3VAKA 3MXHP 1H2UX 2MXYA 5DETA 1WEYA 3VAFA 3R1HA 2DGWA 1S79A 1X5SA 5CA5A 2DNKA 5LXRA 2F9DA 1SJFA 3CCJS 2CQPA 2E5JA 2CPJA 1D8ZA 2M2BA 2U1AA 1FO1A 5GAGU 3TYTA 4TLQA 1PO6A 3DXBA 1KD1T 2J8AA 2D9PA 2DNQA 2FC8A 2M0GB 5IFMA 1B7FA 3J7ZT 1U6FA 3UCZP 1U1LA 2DNYA 5DM6Q 1UFWA 3SMZA 2CPXA 1WG5A 5IM0B 4LMZA 1L3KA 1X4CA 4YB1P 2BOPA 4OZ0A 4PR6A 1M5PC 2KYXA 1O0PA 3BO4A 3CCMS 1HA1A 2RQ4A 2DO0A 3BS9A 1URNA 2DISA 3NMRA 1VC0A 1G2EA 2YKAA 2M9KA 1SJ4P 1FXLA 2UP1A 3Q2SC 3G71S 2EK1A 2MKCA 3CXCR 1WHYA 2YTCA 3ULHA 2VODA 2J76E 5D78A 2OJ3A 3CCVS 1A7GE 2DGVA 2LKZA 2QFJA 4TU9A 4C7QA 3VF0B 3MOJB 2CQHA 4FXVA 3TP2A 2OSRA 2LXIA 1YJWS 2HGNA 2F3JA 1VBZA 4TU8A 1X5OA 1HL6A 2DHSA
chains in the Genus database with same CATH superfamily
2BEFA 4LSNB 4ETXA 3T9ZA 1WNEA 1R7IA 4ECZA 5IS2A 4NCGA 1X4HA 2B9WA 2V8PA 4FXWA 4PRFA 2WOMB 1E6YA 2OKQA 3T6JA 4F67A 4AL7A 4JI0J 2M7SA 2R2UA 5KFCA 3UNGC 3VWSA 3TAMB 5HMWA 2MJUA 2HFVA 1U4BA 4KIAA 5KFGA 4GKKJ 2HW3A 3ELHA 4DV5F 3H2UB 3MWBA 1ZTWA 3GWCA 1R8CA 2MZSA 3MD1A 2E1PA 1Q86T 1S1VB 4HTJA 2AD9A 4RW9B 4B9TA 1YJVA 3JAMY 2XS2A 3KMQA 3OXGA 1MG7A 2HKEA 3JQJA 1WOOA 3NWRA 4LUBA 2EFNA 1LWEA 1TV6A 3MZIA 5K14B 5J2QA 1HBUB 3FVYA 2PMHA 3PACA 3NLCA 5AJ3J 2DXDA 3RRGA 2GIQA 2DJWA 2YKNB 1HBNB 3LO3A 2F4VF 4DSIA 3GFZA 1OQ6A 2DNLA 1VK3A 1D9AA 1RCOB 3AT1B 1VRUA 3VCDA 3MR2A 1RB0A 4K4TA 3A1YG 2B9YA 4Q44A 4ZJOA 1H38A 1B64A 2C2NA 2RD5C 2KXNB 3QZ7A 3DLEA 4S0MA 4EGLA 4EMDA 4O4GA 3TUZC 2E5GA 1RKIA 3G96A 3PW7A 4DJBA 3GYGA 3MAHA 1HMVB 3W1YC 5ETRA 2IA0A 3HLUA 5DLGA 3EE3A 1VRUB 1HNZF 2HK2A 2MLYA 1LFWA 3KLHA 2B5JB 4WE1B 3KXDA 2HWTA 3O5TB 3EVMA 4MYTA 1Q82T 2JVRA 2DH8A 1M5OC 4EZ9A 4HKQA 2HHTA 4NI2A 3BGUA 4WFYA 3PEHA 4CWBA 1CULA 5DJBA 3ENAA 3TW0A 4KH0B 4DFMA 5F3TA 2XMWA 3OBIA 2BYCA 2GJIA 4ALZA 4HHJA 2QLXA 3THPA 3VGSA 1AUSL 2CNKB 1NK7A 2KDOA 1U2FA 2VBWA 1HBNA 1XR6A 5A6WA 3EPIA 2HRTA 3AXKA 2FJDB 2L41A 3K5LA 1GFWB 1KQFB 1SVDA 2DH7A 1WOPA 5J2QB 3M9OB 2OD4A 2VQEJ 4OJ1A 1N0UA 5DM7Q 2ZH4A 2DCUB 1VQKS 3NOCA 4EO8A 3EZUA 3MM5B 3TZWA 5HJYA 1RYSA 2CQGA 2QC3A 1S1VA 2Z8QA 4CTAB 4U8YA 3U7JA 1XN9A 1S1WB 3JXOA 3SFGA 4FN5A 2VA3A 2VONA 3ISZA 1RBAA 4CIOA 1FK9B 3T19A 4E0DA 1MN7A 3OXFA 4FPRA 5B0GA 2C28A 3MAAB 4KY3A 3HCXA 1M1KT 2VG7A 4ZCMA 4C4WA 2BMBA 3T6BA 1TL7A 4DEZA 4F02A 2QSFA 3A12A 1CG2A 2HLTA 3QJJA 2HHXA 4GO7X 2GO9A 1EARA 1LFPA 4I4BA 2UUTA 1RTZA 2PGCA 3POTB 5MLCV 1RWMB 2FY1A 1N36J 2XNRA 3US5A 3W2VB 2QA1A 1SC4B 2XMJA 2AYBA 3MEGB 4J9NA 2AEJA 3CUNA 2VG5B 4WPAA 2KG1A 3IA0A 2MQNA 4DSFA 1VS3A 4B3SJ 1T03B 2DNZA 3JSBA 1Q16B 4HACA 2R9LA 3I0RB 3TEGA 2BE2A 2CWKA 4KQZA 3W8GA 3BYPA 1BE4A 2DNOA 5JJBA 2JC0A 2X1GA 1JLFA 1UVJA 2AWZA 2OMOA 1Z1ZA 4YB7A 4MFBA 2NYHA 1S49A 4GC7A 3HSDA 3R7BB 1B3TA 1U6ZA 2DR8A 3ZFVA 4WKRA 2LQ8A 4OHWA 2HSEB 1HBOB 4R8UA 5A0YB 3DOMA 5EUHA 3QWPA 1RCXB 1VC6A 2UUAF 1R8AA 1MROB 2J8SA 1U24A 3OTDA 5D0HA 2XHCA 2YBVA 4YDDB 3RB0A 1GXTA 4PKDB 1UJ4A 4RU2A 2JNJA 2UUCJ 4ZJQA 2VIHA 2CQBA 2C1EB 2CG8A 2ASYA 2ZUGA 5AXLA 4HH0A 4IR1A 2W9AA 3TR5A 4J9MA 2ROPA 5EWEA 3OTCA 3OVSA 4ERDA 3C16B 3LGHA 4K4YA 4DV6F 3PW2A 1EQ0A 4PXDA 3DRRA 3MAQA 1HI8A 4FNHA 1RT6B 1YJNS 1Y0HA 5KFKA 1Q5YA 5M2RA 5KFAA 4ILMA 5IT0A 1HFEL 1D1UA 5EN1A 2RH3A 1MNEA 2KXHA 5HQMA 2HFSA 5GAGI 2EPIA 3OR1A 4F50A 3OFGA 3HI9A 1WSRA 2GMLA 1G3OA 2FLOA 2VH7A 1SJQA 4Y2IA 4Z37A 4LF7F 1HWKA 1F0XA 2JHEA 4MK9A 5GAEI 4DN0A 5T14A 3GJSB 3OL8A 3T1HJ 2HZVA 3H5YA 3R1LA 1HNIB 3HK2A 4ELTA 2DGQA 4NXMJ 4FYXB 5KFDA 3M8WA 2P8IA 4ER8A 1D8YA 3V4MA 4B9NA 4C8KA 5J1EA 1N34F 4NLQA 3OUYB 3QRRA 1FJGJ 5T41A 1OYDA 1TKXB 3D68A 4KB7A 4DLEA 1X8DA 5HVGA 2V8VA 4P7VA 1NK9A 1DQ9A 4WFNQ 1RT1B 4C8YA 4M5DA 5HVHA 4K2XA 3I87A 4R25A 2X1AA 2FJWA 2MY8A 4IDKB 3M2VB 4U8VA 3AODA 2DK2A 2VB6A 3FCWA 2C2DA 3HO1A 2GIRA 4NLDA 4DWIA 1GH8A 3IN5A 2WB4A 3AJ2A 3K5NA 2Z58B 4DL4A 1IM6A 2VASA 2J9EA 1HD0A 2Q43A 1FTRA 1H6KX 2V4JA 5HROB 3EZOA 1RABB 2DGSA 4X4VA 1YJRA 2FHMA 1NM2A 1PKUA 3PHTA 3T5HA 3D66A 1M1GA 2DO4A 2AJ2A 2FJBB 3NY0A 4DZDA 4CH0S 1SPBP 5EWGA 3EXCX 1TAUA 3AQOA 3FCVA 3HD2A 4B17A 3BBBA 1NRKA 5K5MA 1U1MA 1KHWA 3LW5C 1KFSA 3QJPA 3MD3A 4PXEA 2GVZB 4MT1A 3V2UC 1RHUB 3KUGA 1RWWB 4NA3A 2Z2ZA 5IC6B 3EGNA 3KJVB 3RAXA 5GVQA 5E3RA 2PI4A 3L09A 1MWYA 2E5LF 2YH0A 5H9EJ 2F63A 1SC3B 2JSXA 1GTHA 4DFJA 4USIA 2DY1A 4KKOA 4QU7A 1NJZA 5HQLA 3PJXA 2MLXA 3QT6A 6AT1B 3CDAA 3LP2A 1JX4A 4X4TA 4LSZB 3EGZA 2PN6A 2XULA 3GILA 3SQOP 3H5XA 2BUNA 4F4YA 5KFNA 4CO1A 3U02A 1GT8A 1QTMA 3QFHA 3AJ1A 4X4SA 4F2SA 3N6NA 4G1QB 4ZITA 3M2RB 1WEZA 3LUYA 3SFUA 3UD3P 3FSYA 4IUFA 5KFHA 2E7XA 4GVLA 1ZPWX 1XNQJ 2UXCF 2BJ3A 1SL2A 5ETTA 1CS4A 2IJFA 4C8NA 3ISND 3CC7S 5J2PB 2CVEA 1ZM4A 2GFFA 2HFUA 4RW7A 1DTQA 3UWTA 3VTIA 4FS1A 3RAQA 2MGZA 4DCPB 1D0EA 1YVFA 2I5JB 3ILJA 3Q8VA 3WQPA 5CCMA 2FC9A 5BYSA 4UY8T 2A10A 3THTA 1V6HA 1RT3B 1HHSA 1R43A 4L6V3 3Q23A 1VHFA 3NNHA 3AH6A 1HNZJ 1H98A 4H54A 4K4SA 1XBWA 3GTYX 4HH1A 1C1CA 2E5IA 5ETSA 3HPOA 3BSNA 2I0XA 3THVA 2JJ4D 2H48B 4JI7F 2ZWPA 2B8PA 1SI9A 1U0HA 2BRKA 2IIHA 4Y28C 4F4WA 1H73A 1FVQA 1Q8IA 3D67A 3DMJA 3MCSA 3PIOQ 3KLEA 2KG0A 1WC1A 4ANEA 2QIFA 1S6PA 1Y7PA 1PILA 1RTJB 2CPEA 2HQIA 2HS3A 4Z2XA 2DNPA 3J7AN 4B3MF 2OPQB 1VQYA 2CJKA 4NZ6A 5DGAA 4ZS6A 2XQCA 1FJEB 1JMTA 1TP7A 1OS5A 1XMBA 4ZCIA 2UVWA 3H5SA 1GQEA 3VGTA 4X4UA 2ACMA 2CQ0A 3G8TA 3OJSA 3B4MA 2VFVA 2HMIA 3OSPA 1TVRB 5CYMA 2OD6A 2CQDA 3MMCA 4J9UE 4K4ZA 3PEJA 5LMUJ 3EJMA 4DR7J 5LMUF 4CLPA 3SBMA 3PVXA 4NLUA 3L3CA 3O3LA 4L73A 2P9GA 3HVTB 3IFEA 3NCPA 4Z7YA 4IFYB 2N82B 4U7CA 2AJ1A 2OEKA 5KT5A 4WK3A 2HQ3A 1U1RA 4PWDA 2I8EA 4NLPA 2H5JB 2HNDA 4O23A 4PG7A 5E3AA 1GX5A 3LH2S 4JI0F 4ZN1A 5I42B 3PKYA 2ASLA 2CZ4A 4LF9F 2R7WA 5D6GA 3VAMA 3QLHB 1JLQA 1FI4A 2CPZA 4AXJA 1R0CB 2HRYA 1F3VA 4I6YA 1NK8A 3IG1B 3C3LA 5HJXA 4HI2A 5KFOA 1U1PA 1O5JA 2LQ9A 1NJYA 3DLGB 1M90T 1T7PA 4P74A 2MDAA 3W2VA 2RUGA 3LOUA 2MSSA 2ZOGA 5DLFA 4WJBA 1OSCA 1UZDA 4X65F 4GKJJ 2VFSA 3MEEB 2R42A 4KO0B 2LQ5A 5DS7A 5F8HA 3E2EA 4I67A 2EWHA 2KFNA 3BYRA 3GV7B 1U47A 4V19X 1T0TV 2HBZB 3NCRA 4YR2A 5M2UA 1VQ8S 3BQ1A 2ZJRQ 4YS2A 4WFBQ 3CMES 4PEOA 4ECXA 1IR1A 1P9YA 1YBTA 2C42A 1F9HA 4I7FB 1KBRA 2EBGA 3RBDA 4NLTA 2XBPA 1VC5A 2Z56B 3CJ3A 1NH7A 1OO0B 2FZKB 4R5PB 5JMNA 1RTDB 1LW0A 1WORA 4DV0J 4LF5F 3EDQB 4IH6A 1IQTA 1VOMA 3MHYA 4OZNA 2XLKA 2MZRA 4XPEA 4UOFA 2V34A 3NNAA 1JNRB 2C3MA 2YWGA 3PR4A 2GCFA 2HFZA 3RRKA 1S9GB 2ZUAA 3LP0A 1RA7A 2HBQB 3KK2A 2F4VJ 1OQ3A 4ZP9A 4UQTA 3G4SS 3OHBA 1SKSA 3A8JA 2YWWA 2HNZA 2M88A 3PRVA 2GC8A 4CQ1A 2JEJA 4C8MA 2W24A 3TNVA 2ATCB 3LQVA 1UVLA 2HEKA 3FBBA 1FX2A 3HHDA 1VISA 1FWLA 2YWKA 1FD8A 4O4RA 1OPZA 3QSIA 4OL8A 4QIEA 2YPZA 3MUMP 1KONA 2J0QD 3SQGA 2H9ZA 1DLOB 1ULRA 2B6AA 2WW8A 4IOCQ 3CJ2A 3VHQA 2E1AA 4N5SA 4QOTA 3O8WA 1NDKA 3L4BC 5LSRA 4XO0A 1NKCA 4JI3J 2MQLA 1SKWA 4DN9A 2W4CA 4OLPA 5L39A 2AIRB 3NBPA 1Y5NB 3GV5B 1QJHA 2PE8A 4CT9A 2KI2A 5KG7A 5HSPA 1LWEB 1TV6B 2C2KB 5K14A 2JLGA 4DV4F 4JI2F 4HT7A 4U6PA 4O0IA 1N52B 2C2RA 2UVUA 3DRPB 4PXBA 4JI2J 2ZZMA 3UPFA 4H4OB 3R5JB 3ZZYA 1PC5A 2IM2A 4UW2A 3GFXA 2B3TB 2PSZA 2DBBA 2DEIA 4OV1A 3UN5A 1TL1A 1RAFB 4WP8A 2R7XA 3SEOA 1NSKL 2XNQA 4USVA 5BYRA 3WHIA 4LIRA 1IKYA 1WTFA 4KFBA 4WP3A 4G6VB 4QIVA 2KHCA 4ZDNA 4PZVA 4CNYA 3GCWP 3PW5A 3NNCA 2G0IA 6FDRA 1TKTB 4DQIA 2HK3A 3BGRB 3IR6B 3HHKA 2W25A 1UJ6A 4IFYA 2GVZA 3PZPA 2OAUA 1W2BR 2FLLA 1JKHB 1GMWA 4L74A 4DR1J 4JYAJ 3OJUA 3NEKA 5KFMA 5HROA 1T11A 2VFUA 4L3NA 4ED5A 2LU2A 1YJTA 2N3LA 5IT9Y 5U47A 4DV2F 2DNRA 4OX6A 1N33F 1HBMB 1X4DA 4H4OA 4QQBA 4WZMA 2MQMA 5D8HB 3RB4A 3KLVA 1GEHA 2DY9A 2XMKA 2YNGB 3DLKA 5L9XA 1YITS 2DNHA 1GMWD 4USTA 1HQUA 3PXGa 4JI8F 4A47A 4OI3A 4EFAC 4F4KA 1N4LA 4EBCA 4KR0B 4NEYA 2V63A 4JV2A 1XK8A 3QIDA 1N5YA 3TJ8A 2ADCA 4UT4A 4P2FA 4ED3A 4HR2A 1DHMA 3FBCA 5LSLA 5DDQC 3CSKA 4K2JA 2VDIA 4OZJA 1T9YA 1H0HB 2IRXA 3IAS9 1S1UA 1RAOA 4I2PB 3JAMU 3W3SA 5D4LA 1WEYA 3H40A 2VF3A 3VAFA 3D9BA 4PQUA 1JLGB 3R1HA 2DGWA 1S79A 1S48A 5IWAF 1X5SA 3R97A 3OUYA 3T5JA 2IY5B 4U7UK 3FZ2A 4A48A 1SJFA 3KHRA 2E5JA 3IM9A 2Y0BB 2CPJA 1FKPA 1DTQB 4M5NA 2NS1B 1KWMA 4QZVB 5F8NA 2HNZB 3VVUA 2CYYA 2Q6BA 3A8EA 3MM6B 5HMYA 3CCWA 3KK2B 1Y5LB 2YKOA 3DXBA 3M2RA 4PPZA 5KFBA 3K17A 2HVEA 3QT7A 3F41A 5G4DA 1T8EA 1N6QB 1W25A 2D69A 2CJXB 2GVDB 3C6UA 1JWWA 1RWKB 1S1TB 4FYWB 3T5KA 4DQRA 2BJDA 3OLBA 3UCZP 3SCJE 1S7IA 5KFZA 5IXUA 1N5QA 5DM6Q 1UFWA 5L1KA 2QL5B 1RT2A 2CPXA 5IM0B 4LMZA 1L3KA 3BKTA 2IDEA 1IJEB 2N4DA 3BM7A 2VQFF 2NXCA 2BOPA 3B54A 2XYGB 1WC6A 4DQQA 3N28A 4RPFA 1NB7A 2FZGB 2ZE2B 1U7LA 4PR6A 5F8IA 3BO4A 4ZIVA 3DOMB 3J7YI 3JS9A 1HBOA 5A0YA 2GJFA 5IZHA 2RQ4A 4DL7A 4YB6A 1FJGF 2DO0A 4OYWA 2DISA 3NMRA 2R7QA 4EYHB 4YDXA 3DDKA 2M9KA 5DZ7A 1FXLA 2UP1A 1KVIA 1K44A 2DRBA 2H65B 4F4ZA 3TA2A 3J81U 2EK1A 2MKCA 3KLGA 2HWHA 2YTCA 4X66J 2LP4A 3OL9A 2C3OA 3TEHB 1JXEA 5D78A 2B43A 4AT1B 2VD3A 3I0RA 4X66F 2J6UA 1KLMA 1EP4B 1HWIA 2LKZA 1TMJA 2W7AA 3EMTA 1HW9A 2FGCA 3EPGA 4RUAA 5C5JA 3DRSB 2FVPA 3MOJB 2CQHA 2OSRA 2LXIA 3DNCA 4OYZA 3TP2A 2UUBF 4WZQA 2WAQD 2UUBJ 1C4AA 3MTJA 1J5EF 1X9WA 2RILA 1F9EB 3GR1A 3RB3A 3MCOA 2QLWA 1HL6A 1FERA 2DHSA 5EWFA 1AYEA 1QD1A 1W7WA 4PG5A 4LF6J 4LF6F 1RHMB 3E01B 1TMMA 1EAYC 4Q8FA 1BQNA 2R7RA 1FK9A 1TKXA 4Q0BB 2OTJS 3DDNA 2VG7B 1YKWA 3Q2TC 5J1EB 3H59A 1K9MT 2Q79A 4CTAA 2IDLA 1ACMB 1BQMA 4AFFA 4AL6A 2Y1IA 1K0TA 4RW6B 3MDFA 4AYBD 3PYFA 1TVRA 5CYMB 2D9OA 1QAIA 3DU6A 1S1WA 2ZDOA 2FVQA 4FF2A 3ENQA 2MB0B 2VOOA 1A9NB 2HVHA 2HHPA 4RX6A 5EX3A 3K5PA 5KT7A 1QVGR 1AB8A 2WRMA 3M8PB 4Y3CA 1HNVB 4DG1A 1OY6A 3M1VA 1CULB 4ES2A 2GS8A 1K1SA 4FXDA 1PYTA 3L7PA 5H9FJ 4IG3B 2ZZTA 4OZ1A 2CXEA 5HAOA 4W92B 2B5JA 5BR8J 2R7SA 2Q3PA 1F9FA 1I51B 1S12A 4P2MA 4CM2A 9RUBA 4ZA1A 2EFQA 3CC4S 4NI2B 4RJVA 2WSFC 2FJEB 2JDJA 5KG1A 4Q5VA 4AQYF 4ZPCA 1Q8BA 1RWPB 2GHPA 2Y9HA 1LWFA 3BF4A 4Q2MA 1NMEB 3TUJC 4R8UB 2AU0A 4NMXA 4OHXA 1Q7LB 2ZBPA 3O1LA 2RQCA 4C0BA 3C2PA 3CDWA 2K3KA 3NGRA 3QNWB 1YK9A 4O4GB 4ICLB 5F3ZA 3MEEA 5CYJA 4OHZA 2XY5A 3IGNA 1JLFB 4E2FB 1HBUA 3ILOA 2B4PA 3H0PA 1DQ8A 3FQLA 3VV2B 1LNQA 3CO9A 3CVKA 3VALA 1IBLJ 3MPVA 5HQ8A 2PD1A 4F3MA 3MEDB 4RUHA 5ETVA 2M70A 4DUTA 4ED8A 1SUQB 4LQ3A 1JLQB 3IAM9 2V0NA 3W66A 4Q43A 3HD1A 3NP5A 2FPHX 1C0TA 5FDLB 1NJIT 4C11A 1BD6A 2EC2A 4KJIA 3G6XA 4DSJA 2WOMA 1Q7YT 2LA4A 2OPRB 2R4FA 3TAMA 1S7HA 5LMNJ 1XMOJ 3Q0AA 1DQAA 3G86A 4J7CA 4YN3B 3NOGA 3DOLA 3N79A 1E6YB 3GJTB 4PG4A 4IKAA 2WVDA 4DLGA 1WC0A 3W65A 2O3DA 4NMLA 3H4BA 1U8SA 2OPRA 3MMCB 5E3PA 4DL0C 2AP6A 4GKKF 4YB5A 3M7VA 3WDOA 1Q8LA 2A18A 3KLFA 1YQHA 2HQCA 2IC3A 4O3RA 2GIFA 2L08A 2GMHA 2MMYA 2QYGA 4ZPBA 5HATA 4X4QA 1S72S 4OZLA 1F5CA 1RLDA 3MM8A 3SSQA 3ENWA 1T95A 4ZLNA 1M5HA 2OO4A 4X4PA 2DHAA 3TX0A 2XMAA 2JFKA 1MW7A 2XSJA 4CLFA 5KFSA 3QWUA 4CLYA 3K0JA 3FRYA 1K0VA 3H98A 4OFZA 5B0CA 3CCRS 3MGJA 1RAAB 2DIVA 3HVAA 3Q8RB 1I94F 1LW2B 3HHLB 1TAQA 5KG0A 2D3UA 2MQ8A 4LSLB 1FRHA 3W60A 1OIAA 2ZBCA 3MMBA 3D1HA 5AE2A 1XC9A 4R0JA 4WK1A 3IO1A 3QQCD 5KG3A 5K8OA 1NAQA 3CCES 1KC8T 1JJ2R 1F2GA 5DG9A 2B7CB 4C48A 1ICEB 5DQGA 3S8SA 2CA9A 4IYQA 4NXNF 1OSDA 4NXNJ 3I4PA 1X7VA 4OI6A 2JLFA 3G8QA 1CC7A 2L48A 4BC9A 5I4MA 1DJ0A 2IRUA 4WIQA 1V5VA 1YRTA 5FD1A 4DR3J 2BV3A 2BDPA 4EUVA 4LFBJ 1CPZA 2QMWA 3CCZA 2Z30B 1VQLS 2CDRB 1RT6A 2DNMA 5K9FA 3DRRB 4ID5B 5DZ6A 1HNXF 1AW0A 3CTRA 1CEZA 3AHPA 1F1BB 1S6QB 4RL1A 3R7NB 4ES1A 1FF2A 4TQRA 4B3TF 4B3TJ 4KHPJ 4J5OA 4NPOA 3LANA 1EKRA 1Q1KA 2AZ1A 3CJRA 4ILLA 2YNIA 1X9SA 2BOAA 3A3NB 4I69A 3ONQA 3W9IA 2I2YA 3R2DJ 4K0KF 3IBCB 4LF7J 1HNWF 3TJ9A 3SV3A 3FQKA 3H7HB 2IAJB 3P5BP 1AZSA 4DF8A 1UPPA 3TARA 1BWEA 4DCOB 1VDHA 1H2TZ 4I2QA 4P2XA 5E7OB 3R9LA 3VZIA 4DPXA 3CW2C 5H9EK 4NOHA 5D0GA 4IRDA 3V6KA 3NMAA 4DR6J 2AHOB 1QM9A 2VKRA 2V4JB 5IQ6A 3HT0A 2EG1A 2W9CA 3RBEA 3UR3C 2DR9A 1PCAA 4Y6IA 3IM8A 3BZQA 4M5IA 4DV2J 1N33J 2P2CB 3N0VA 3E51A 4A8SA 1IBCB 3V4IB 3W9HA 1QLNA 1N0VC 3ZTQA 5A8KB 4EBDA 3PKMA 1RACB 4LRBA 2IMWP 3MEGA 4M5HA 3QRPA 1SBRA 2HS4A 3SV4A 2FVRA 3OVAA 2FHKA 4B3SF 3D3CJ 3I9V9 4AD6A 1T05A 1EQMA 1PYOB 1S4EA 2NXNA 3H2VE 1ZETA 2FGOA 2CG4A 1G6BA 1NK5A 2E5HA 4RWXA 1Q0NA 3ZTOA 4FYDA 3G8SA 1S0NA 1QAXA 2R8JA 3CMAS 2IAJA 5CH7B 1O6XA 4DL3A 1S1XA 3R6LB 2K7KA 4FYVB 5CZVA 4URGA 3KLIA 2R8IA 5IV4A 3K8VA 4TY8A 3KHLA 2J9DE 3MUTP 1SJ3P 3EM1A 3F73A 1F2HA 3TWZA 2YNIB 3PRBA 2E9ZA 1I6JA 4TYBA 4DV3F 1XTZA 3MM5A 1U1NA 2CPFA 2P5VA 3M30A 2ZH6A 2UUCF 4BDPA 3HHNB 5CABA 1IWAA 1RT4B 1H7WA 2XSJB 4AE5A 4UOGA 2BRLA 3OTOF 2QTWA 5KFXA 1Y10A 2AF6A 3ZTRA 2KFYA 1GMUA 1U49A 1IUJA 5CQGA 2W9BB 3BN7A 5MAOA 2FLNA 1IKWA 3IRXB 1KFDA 3SCLE 3NRBA 3CCSS 2H5EA 2NZCA 5DRKA 3KLFB 4IFVB 3FC9A 3S01A 2QSWA 1NH8A 4FVCA 4DCJB 5KT4A 2XB2D 3CMQA 4QR0A 1HYSB 1FRJA 2HVIA 1XNRJ 4LF2A 2J9CA 3D54A 4C98A 5BR8F 5A8WB 4ECVA 1UEVA 3KLHB 4NRUA 2W2PP 5IV3A 1IXKA 2LCWA 2BQUA 2KJWA 4F25A 1X60A 2V68A 2ZVSA 3RB6A 4NXMF 1NK4A 2DPIA 2LECA 3VGUA 3MR3A 2A6MA 1TUVA 4E8UA 1M0SA 1ZM2A 1N34J 3AFGA 1NXIA 1TK8A 1S76D 1IQZA 1ZM9A 1FHTA 1RSCA 1XERA 2FY8A 1FD2A 4USKA 4CLKA 3RYLA 3HHEA 1ZYQA 1NJXA 1HW8A 4BLGA 2F7VA 5K8MA 2CQCA 5B0DA 4ZP7A 4M63A 5HVFA 1UEUA 2C2ZB 2MY7A 1YZ6A 5IT4A 2WTFA 1TFWA 3EVOA 2BACA 3FRZA 3HDSA 3UVJA 2XG8A 5ITHA 1N5YB 2VG5A 4JI4F 4GRSA 3CJTA 3GJRB 2PIIA 2A1BA 2DHGA 2W4PA 3PX6A 1CJVB 5HMXA 3NS6A 2VPWB 2BE7D 3KK3A 4W90B 2VPZB 1LV5A 2VDHA 4WXOA 3MMAA 5F0UA 3HXMA 2FVSA 2LU1A 3JSMA 3TVYA 5F9LA 3LGNA 4B9VA 2ZM6J 2CWXA 2Q1LA 3FZBA 4TU7A 3ENVA 3DOKA 3TAQA 4A8KA 2RE1A 1KVJA 2X1BA 3ZNUA 2MZ1A 3D2WA 3B6BA 3IGVA 2AZ3A 5A8WA 2BQRA 2VFTA 2RQMA 1ZM3A 1SV5A 2AGQA 4C8OA 1Y9OA 1RYRA 1XIQA 3IS9B 3TUIC 1FFGB 1X4GA 2V8HA 5AT1B 1MU2A 1UTAA 3DRXA 2MKYA 3KYLA 3QGHA 1RWOB 2RU3A 3ETMA 4FZVA 2BJ1A 2M4MA 1N88A 4HHUA 1S9EB 1HPZB 3FCHA 3UCGA 1E6VB 4ZLJA 1JB0C 3D3BJ 1T3NA 3X1LB 3NAIA 1QSSA 4ANDA 2DTJA 3SDEB 1H74A 2KYZA 1NLKL 3M05A 1J5EJ 3GONA 1TUGB 3LWLA 1D09B 4CH1A 3HJVA 1EZZB 2XGQA 4ICLA 1PIEA 1L3VA 2Y0SD 1I94J 3WX4A 1O8BA 2HBYB 2FHJD 2NXEA 3BN4A 4L3KA 5HLFA 1LWFB 1JNZB 2RRBA 3FEYB 4B02A 3IMQJ 2KN4A 2KH9A 4CCHA 5L38A 3VAIA 1YDLA 2YVSA 1JXVA 2ZWOA 3W5ZA 1GK8A 2ILYA 2W7OA 3ZO7A 5BYQA 3Q8YA 1MN9A 1D9DA 1CC8A 5HN0A 1IM4A 1AA1B 3T5LA 3MM9A 3DGVA 2ILZA 4ZKAA 2ADBA 4ZVTB 2VC0A 5T7LA 1JLBA 2BZ2A 2K2PA 2CPIA 2V4RA 3G2XA 2IBKA 1U0SA 2AJFE 4DDFA 4LREA 2EVZA 1U1OA 4NZ7A 4HI1A 4CO4A 1B4SA 1VQ5S 1MWQA 4OYBA 2FJAB 3DI6B 1FRLA 4QU6A 2YNFA 3CF5Q 5F9NA 2EFVA 5KT6A 5KFFA 1WHVA 4RW6A 3JQMA 1IKVB 1RT5A 4A46A 4AQYJ 4OI4A 2LYVA 2C3PA 3C6TA 3D1OA 1Y3KA 4KH1B 2BANB 3MPDA 4V1Ak 1PBUA 1B70B 2W2QP 5GADU 3JSRA 5EDWA 3GG0A 2V9WA 3H25A 2XZWA 1FDNA 4RNHA 3P6YC 1UP1A 2HVZA 3ET6B 4KHMA 2YWEA 2RF2A 3KJFB 1IN0A 1MLAA 2NUUG 4H4MB 2YX4A 5I3UA 1RK8A 2HRUA 2CKWA 4IQMA 1UFKA 1QUPA 1RT2B 4G1PA 1HQ2A 2K8GA 4KGMA 4CT8A 5IM0A 1S4FA 2QL9B 3MI7X 3PFEA 3TA0A 4JI3F 5D77A 2DGXA 4RW4A 2B51A 1C2PA 3KG1A 1RTHA 4JUZA 2XLIA 1CLFA 2HVDA 3ETOA 3CDBA 3ISNC 1BLUA 2V2ZA 4ANCA 3CCUS 4USWA 3D0IE 2V50A 3MCNA 3CT9A 5B08A 2O5DA 1U25A 2XS7A 1PC4A 2RIJA 3NGSA 4EZ6A 2CJBA 3QLHA 4PCQA 1T9VA 2AYGA 2AX1A 1SQEA 1SH3A 5B0EA 2R7TA 1YGYA 4WFAQ 1DZ5A 3R5AA 2CJ9A 5BXIA 2OLWA 2J5AA 4LRDA 3M2UA 2PDAA 4MKBA 4ELVA 2H1YA 3VVTA 2RDJA 3RGIA 2F8HA 4ECRA 3J7Z5 1S1UB 4KV8A 4DR1F 4K5SA 5GMDA 3RG6A 2XI3A 4WU2A 2DIUA 2QA2A 3LF0A 2W2OP 4OYOA 4LF8F 2DT9A 3FSXA 2Q66A 2EFPA 2CQ4A 1IR2A 4KGKA 3K59A 2JOQA 1EETA 1REVA 3EICA 1LEOA 4KC5A 1HHQA 4OMFG 4DR3F 1HQUB 1RP5A 2IVMA 1H72C 2VV5A 1I5OB 3AD8C 2IVFB 3VQSA 5KT3A 4C8ZA 4MYUA 2ZOFA 5KTQA 1T02A 2ZKUA 1RTJA 4ENOA 5A2QU 2FIUA 3TVZA 2ACYA 4ZHRB 4DV7J 3DMJB 1OMSA 2KHDA 2QRRA 1QY7A 3IC1A 3DLBA 2K3IA 3DOLB 1XNRF 2MXYA 2V69A 3A8IA 4ZCKA 2KL8A 5HP1A 1XEZA 2M5YA 1IKXA 1R0AB 3NGKA 4C2MA 1JLGA 1TKZB 2R3VA 3UW1A 4DSEA 2ZHAA 1NB2A 2DNKA 1U2CA 2F9DA 2G9OA 2B7BB 2QFIA 3CJ8A 3H5UA 2CQPA 4I2PA 2GAGC 4ZVEA 2WVBA 4M5MA 5FDLA 3KHGA 2ZH9A 4LFCJ 2XCPA 3OXLA 4RU9A 2M2BA 4Y2CA 4RNNA 5J2PA 2OFGX 4DR6F 1O51A 2XGPA 3C19A 1FO1A 2E1CA 2HQDA 1L3SA 3TYTA 4EK2A 8ATCB 3JYTA 1REGX 3QIPA 5KFWA 1KD1T 4DX8H 2GQCA 2H3EB 3Q8UA 4ZOSA 2AKWB 2KKHA 4CO2A 5CD4H 4DV4J 2GW8A 2DR5A 3J7ZT 2HS0A 2ZDPA 1U6FA 2J7WA 2AW0A 3QT5A 5KFEA 4KGXB 4J9LA 1KKHA 3PTWA 3EYZA 3SMZA 1YJ7A 1CJUB 4DR5J 4KAIA 3PR5B 3F0NA 4DR5F 4CYUA 4ZLLA 3IBFB 4YB1P 2GX8A 3ILIA 3E8OA 3ET6A 2ASJA 1LK7A 1NDLA 3FK4A 3M6UA 5C42B 1FKOA 4OYPA 4URQU 2VJVA 3GB0A 2YNHB 1R0AA 2VUGA 3CCMS 3WIUA 3C14A 1UWBB 2BVZA 2DXEA 2K7JA 3K58A 4KFBB 2KTQA 1Y11A 1URNA 3CO0P 4KRWA 1EHWA 3DHWC 4ED4A 2X51A 3BQ0A 1VC0A 3W5YA 1SJ4P 4OYIA 4YY3F 5F8GA 1FEEA 3U1NA 5D4PA 1BGXT 2K1RA 4OJGA 4UUWA 3CXCR 4OI0A 4DL6A 1RAHB 3CCVS 3DRYA 4MTPA 1F3FA 2CNLB 2DGVA 3G82A 1S9GA 2QFJA 3WC0A 4TU9A 5AXMA 3ZTPA 1VRQC 4JI8J 1UVMA 2HGNA 3KMSA 3T1AA 3OHAA 2CUYA 2RHSB 3DKDA 1C1BB 4NLSA 2ZH7A 1UJ5A 4DI6A 3MTKA 1VBZA 2C3YA 4TU8A 2ZFHA 1RWNB 1X5OA 3PJ9A 2QO3A 3J80U 3UDCA 4J9RA 1CJKA 2AEMA 5HBMA 2DRAA 2BKPA 1AFJA 2RRNA 1UPMB 2HLUA 2B4VA 4P73A 4U9RA 2HHQA 3M2UB 4OYXA 5HLFB 1CJTB 2VC1A 2EC0A 2ZOMA 4WYLA 3ZTSA 4UQGA 1WKJA 3PX0A 3CIMA 5C7PA 3PO4A 2GQQA 4JOUA 1GX6A 2ZJQQ 1WC3A 3BBCA 2ZD1B 1FT8A 1FESA 3TQ1A 3OV7A 3P8BB 3ICLA 4O0NA 3BJYA 4ZVRB 4DX5A 1N5VA 1RBLA 2RQKA 1RT7A 3DYAA 5GMEA 1ZA2B 4DQPA 2FVCA 2G1HA 3PV8A 2NXJA 4F36A 4EO6A 4Q8EA 2QA4S 3RW6A 3KTQA 1NDCA 1ZOTA 3TAPA 3H2LA 4DPOA 2CFXA 1VIOA 2EK6A 3T9NA 2Z2YB 3CE8A 1AXQA 2YKPA 3O6QA 4CNZA 2E1RA 1KLNA 3HMJG 1LW0B 4HTIA 4ZVQB 3Q8SB 1P1LA 2YH1A 1MMNA 2W7PA 2YKMB 4PG8A 1N32J 1SV5B 4X62J 3PG9A 2AX0A 4X62F 4DR2J 2W2NP 2BW2A 4USJC 2V67A 5D3GB 2GGPA 3UQSA 2BABA 3B82A 3DFEA 1NKBA 2HHSA 2OUGA 4YHHJ 3C6TB 2RVJA 1QAYA 1JLCA 3HSGA 5KFRA 4C3MA 5C25A 3T1YF 1NBEB 3QZ8A 2G4BA 1Z2ZA 4KO0A 3M32B 2YWHA 4K4XA 4RNFA 2HMIB 1FX4A 3A3OB 1BC6A 1Z2LA 3P49B 3AJDA 5JUMA 5DDOC 1WD6A 5LL6d 3WBZA 2MZTA 3UDLA 1TL3A 2FHJA 3SCIE 3NGTA 1JJ4A 3F44A 4A4JA 4RUBA 5KFJA 1T03A 1FEHA 2HZCA 4RBTA 1AROP 1XR7A 2UV8A 1P6TA 2RT3A 4J9QA 2CNNB 3KJNB 5CAAA 4J91A 2QEXS 2AYMA 4P9SA 1FKPB 2KVIA 1U6BA 1TR0A 2P6TA 5KFQA 5GAHU 2NYIA 3MURP 2ZD1A 5I42A 3HKZD 3POTA 4WCEQ 2DVIA 2PFFB 4EU0A 2NUHA 4G1IA 4ZK7M 3HT3A 2PA8D 1KS2A 2IM1A 3PCOB 2V6AA 4HL9A 4LJMA 1UL3A 1WWHA 2XSFA 3FDSA 4A8OA 3NWGA 3MR7A 2AGOA 1FJ7A 2P6SA 4RUCA 1QUVA 5C2GA 2A0FB 1WF0A 3BKFA 3CULA 1L3TA 2PC6A 1PYSB 4K4WA 1C4CA 1VQPS 1UW4A 4ZCLA 5C24A 4PUOB 1KOHA 4DV0F 4AXIA 1R6YA 3DCAA 4G1QA 3UN3A 1YTYA 1YHQS 2V2VA 1R0BG 1RI7A 4JI1J 2MQOA 3D0HE 2DXFA 5RUBA 2YQ3A 3IBWA 1REVB 2MHEA 3K89A 5KG6A 1VQOS 4TYAA 1ZZNA 2HNYA 2V4QA 4EYIB 1SKRA 4F0KA 4CLLA 2ZBQA 2FQQB 1G1XA 1HWJA 1LXJA 5AJ3F 2ZBIA 2Y1LB 3DLHA 4OYAA 2YY3A 4QYZK 4P10A 4C3KA 3PW4A 3NS5A 7FD1A 1YRUA 2K1RB 4KGZB 1NK0A 4M94A 2DNGA 2W4DA 1RT3A 4NLGA 1I3OB 1HQEA 2C2EA 2KM8C 1NKEA 2AJ4A 3RUBL 1LQ9A 4OQJA 4NA1A 3DU5A 3OLAA 1S1XB 2G1DA 1FE4A 2L9NA 2Z2LA 2MGZB 1SC1B 3DN9A 5ETLA 5AXKA 1FRMA 1U8WA 4GVBB 5KOXA 4CYUB 3PYGA 2QE5A 4RBVA 3CCJS 1VQ4S 5HO4A 2EW9A 4QBUA 3P45B 3ZXWA 5M2PA 1SC6A 3CIZA 4ZVFA 1PJ7A 3M4XA 5G0RB 2XMTA 2VOPA 1CJVA 2EFOA 3PO5A 5IT9U 1DAXA 1RTHB 2N7YA 2B0GA 4I6WA 2UU9F 1X0FA 4ZVHA 2XMMA 3QYYA 4J9SA 2UU9J 4N41A 3G6VA 3SIPB 2F40A 4LBHA 4BC7A 1FWPA 3I96A 2BM0A 4ZPAA 1KEKA 4XIUA 4CZCA 4FS2A 5LXYA 1X5PA 2Y8WA 5J2NA 4QCLA 4B9LA 2CQIA 1X31C 2GZOA 1VK8A 3FMBA 2P9EA 3U1MA 4B08A 1DURA 4W98A 1R8PA 2OELA 4ZPVR 3MR6A 3HHLD 4HLBA 2B6AB 3O2IA 2G2ZA 1EJ7L 3MECB 1SXLA 3KJVA 1A0OB 1YJUA 4P2SA 1NJWA 2UVVA 4QW8A 1S0MA 1HNWJ 1TUWA 1R31A 3CNQP 2YPYA 4J9OA 5JVHQ 4I64A 2NCKL 3KKFA 1BUXA 3MUVP 1LOUA 2MKSA 4GO5X 2I6WA 4BBYA 1PSDA 3O44A 1JQGA 1Q95G 3DI6A 3ZC4A 4C0HA 2JRSA 5KOWA 2FTRA 2JLEA 2QYCA 4WU3A 2MQPA 1Q78A 1G7CB 4DU8A 2XCAA 3ITHA 3D6FB 2XZTB 3DGPB 3LP0B 4N77A 4PABA 3BO2A 2YQ1A 3L95X 1LXNA 2FD2A 3H4DA 4LF8J 1T9TA 4Q7AA 3FFIB 2DB1A 2LLZA 2GO8A 3HFZB 4EBEA 1T9UA 3GSIA 1NPPA 1G4CA 1NSPA 1RHQB 4IG0B 3CJKB 3TRGA 1FTCA 1RAJA 2W01A 2B8QA 1PG5B 2IM3A 3C15B 4XAKA 3W64A 2XI2A 3BDPA 1ZAXA 4M5DB 5A8RB 2YX1A 1EETB 1V3RA 3G87A 4TNOA 5HK4A 3M9NB 4KBIA 3W63A 5B7WA 2W8LA 2BJEA 1RWVB 3BPDA 2R8GA 1R27B 3D6MB 4P6QA 3BH7B 4C6AA 4DR7F 1ZTTA 4TY8B 1WC4A 5KFYA 3CJQA 3SYZA 3TJAA 2A2DA 3PY8A 4K50A 2VL1A 2FJVA 3RJMB 3MM7A 2JL9A 3IR5B 2ZC3A 3WZ0A 1SH0A 1Q8KA 1WG4A 2JZ5A 4FKYA 3U1LA 2XC9A 2RMLA 4DUYF 1U2RA 1LW2A 2BW7A 1VCTA 2WBMA 2ROEA 1B0PA 2O66A 3RZAA 1FFSB 2X7IA 3TO8A 4WWSA 3IWXA 2CQ3A 4F2RA 4YR3A 3ZZZA 1APSA 4RW4B 1WC5A 3JSYA 2NPIA 3N4WA 4YP3A 4HT5A 1UW9A 5E3CA 3NL0A 2DHHA 3FUYA 1NNDA 2KU7A 2ZEJA 2ZC4A 3QO9B 1WOSA 2IC3B 3A3PB 4X65J 2YQ0A 2PEBA 2N7CA 4GKJF 2RS8A 2HNDB 5D0RA 4O44B 2D7SA 2DCLA 3W61A 1RTIA 1NZAA 1JLEA 1BHNA 1TL7B 2RJZA 2ASDA 3HVTA 1OYEA 3QAEA 3NGDA 5E3QA 4OZ3A 1BQXA 3K5MA 3JB9k 4H4MA 2IFXA 4XDDA 1J27A 5AE3A 1V3ZA 2ZITA 1LWXA 1AZSB 2BJ7A 1YBAA 2RSQA 2Z4PA 4JB8B 2GAHC 4JV0A 1TFYA 2C2OB 2LXUA 1KDNA 1FRKA 2H54B 3PYDA 4QWCA 2RRAA 4DV5J 3W7BA 3J81Y 3NAHA 1KHVA 4PAAA 5EHHA 2CRLA 1PJ5A 2MKKA 4M1KA 4F8RA 1ROFA 2J0XA 1FJCA 3I0SA 4RLEA 3P4UB 1QE1A 4C9DA 3UE2A 2QMXA 3QATA 3CJ4A 3LTOA 1JLBB 3UVJB 3KWMA 3DLLQ 1UCNA 1QDUB 4R0EA 2RKIB 3IP0A 1VBXA 3AQPA 2ZZNA 3VZHA 5FLXY 4DUZF 2XZDB 3UI3A 4DPUA 3FKBA 1UAWA 3RR8A 3Q8QB 2ZHOA 3LP1B 4MKYA 3K5OA 4FKXA 4AL5A 4MH8A 4U67Q 3TI0A 1X9MA 3I55S 3MEKA 4QWDA 4M5JA 3W5XA 3QBCA 2IJRA 4O3OA 4Y00A 3W8PA 4DBQA 4ECQA 1URRA 2IHR1 3B8HA 4LF1A 4OX9F 4OX9J 5FJ4A 5JVGQ 2UXBF 2FZCB 4ITSA 1FRIA 5DG8A 3V81B 1S5ZA 2AV5A 5DDRC 1UZHA 2MLZA 4LSLA 2VG6B 1CJKB 4NEZA 3Q86A 4Y0FA 1FVSA 3CC2S 1V5IB 4QIWD 4F4AA 4DQSA 2HQGA 3Q24A 2HZAA 2VBZA 3SDEA 2GHWA 4O3SA 4A8WA 4RR5A 2EEYA 1HLWA 3BSCA 3MFIA 1NDPA 3BGOP 3OFEA 2KVQE 1TZ0A 2IA6A 3OTOJ 2EBEA 2UXDF 1WF1A 2CPDA 2LVWA 1WG1A 2OSQA 3D0GE 4ZVOB 4CLZA 4CLSA 1EIYB 1PAEX 3EXYA 4C0OC 4LFAF 2QL7B 1E6VA 1JIHA 2NXUA 3PW0A 3HZEA 2DR6A 2KFZA 5C24B 3FGVA 2G0CA 4OZ2A 3J80Y 3AOCA 2BR0A 2UXCJ 1GXLA 3S1TA 1QVFR 2JEIA 1A6LA 2ZH1A 1FCAA 4H4KA 1T3OA 4OJHA 1QAJA 3GU0A 1HARA 2G2OA 4G65A 4WTYA 3U27A 1MU2B 4LF4F 1WKLA 2YNHA 4LF4J 2G2YA 2PMWA 4RNOA 2VKZG 3UDVA 1PAUB 1RWUA 3V81A 4JYAF 2NREA 3ILLA 4YOEA 2MHNA 2O1PA 3A8KA 2LFVA 1DTTB 3MCMA 1F60B 3AD9C 3PNIA 4ATNA 4C11B 4F26A 2N3OA 4BHQA 3KK1B 5B0FA 3EZ5A 2KZZA 1ZS6A 4NX9A 1U1QA 5KFLA 3BB5A 1FNXH 2EKNA 1JLAA 2CQ2A 1FDDA 1M5SA 1X4BA 3I5BA 5K8PA 4FPIA 4MJKA 2QZ8A 1RXOB 4Y2MA 3W2WA 3GIJA 4QR2A 1RT1A 1BXNA 1MMLA 2LQBA 3OPKA 2CJYB 3S6EA 4A8QA 5DG7A 1FWKA 3LAKA 4WFXA 4JV5F 2W1BA 3UR0A 4DXLA 4JV5J 2WSCC 3GSDA 5CYQB 1KQKA 3WIVA 4I2QB 4ED0A 3I31A 1N32F 2NZ4A 1NU4A 1SKUB 4PWUA 1H3DA 5A6PA 3PDNA 3UCUP 4QWAA 4NCGB 3GZ7A 2OHDA 5ETOA 5F0WA 3UFCX 2OTLS 4A8XA 3TVKA 1VJQA 1RTIB 2ZE2A 4QYRA 5D15A 4WBFA 4BCAA 5GMKa 4X2BA 2QV6A 3PX4A 3BDEA 4QJVA 4XPCA 3M8QB 1K1QA 4B3OB 1DFDA 1HWUA 4K8RA 1PBAA 4NRTA 5JXSA 4ZIWA 1JLEB 3WX8A 3H20A 3G6ES 2XYPB 4LF9J 3C46A 4IG3A 1HWLA 2OPPB 3UNYA 4O44A 2GMJA 2R2TA 4DV6J 2R8KA 3PIPQ 1IBMF 2WONA 4TVAB 3OTEA 4DX7A 2ZH5A 4ZVSB 4WFZA 4PXCA 1NO8A 2W9BA 1S99A 5J1PA 1S57A 3BEGB 4GMKA 4ECSA 4PG6A 5J2MB 1T9WA 2YXLA 3CB4A 3KUEA 3M8YA 2DRDA 2VQFJ 3AOAA 3KG4A 1D9FA 2HYIB 1MSWD 2QJ3A 3KLIB 3FMWA 3QPIA 2WBRA 3GIRA 4NCBA 2H5IB 5A2QY 1K8AT 4NL5A 1AUDA 2BKNA 4F04B 2J7UA 1VQ7S 2WHOA 2VG6A 4B9UA 2HHWA 4A8YA 4Q0BA 4ED6A 3MM7B 1BQNB 2KT2A 3SXLA 5AXNA 1HIYA 2ZJPQ 3RU0A 2FLPA 2RHQB 5D4OA 2PA3A 2OEJA 2V8DA 4LRAA 4OYMA 4RBUA 3W62A 2YX7A 4RW8A 2M8DB 5GAEU 2Z2MA 2J7KA 2VPYB 1KNZA 1CBKA 1RU1A 4OV6A 3CCQS 3BH6B 1SL1A 1RAEB 1KTVA 2HAFA 3BREA 3LP1A 2JWNA 1RISA 1VGYA 2A3JA 3MM8B 4KSEB 3V6DB 2NR0A 2FB0A 3V4IA 3KFWX 2C2MB 1RBOB 2AMCB 2IYIA 3I9ZA 4E98A 3TA1A 2RB7A 3IWLA 3KHHA 1N8RT 3EVWA 2OPPA 1F5BA 3H42A 1OPIA 5A8KA 1T94A 3KNGA 1QSLA 2WK4A 3HHLC 2GHVC 4NASA 3GIIA 4LR9A 4MMOA 1VYAA 4UZCA 1NK6A 3OR2A 3KOAA 2F8EX 3ITHB 5E33A 4IRCA 4Y2KA 5AE1A 2ZBRA 2ZH8A 3T41A 2R2SA 3BGRA 4K5RA 4M5GA 4NA2A 4PYAA 5K8NA 2BANA 1R8BA 2B9EA 4DPTA 1GTEA 4UY85 4RNMA 4LFCF 3AXMA 1V9OA 2U1AA 4TKTA 4X84A 4FBTA 4IR9A 3LA0A 5J2NB 3KDOA 4USHA 3ZNJ1 1RAIB 2FUG9 3N6MA 4GC6A 3UD5A 2E9RX 4ZPWR 5GAGU 1PO6A 4TLQA 4ZP8A 2R7VA 2ZH2A 1OJ4A 2G0JA 1J5OB 2HG4A 2M0GB 1HHTP 1UWAA 3R7SB 1L3UA 4WP9A 3V6DA 2I9SA 5G0RA 1RLCL 1LWCB 2DKOB 2HFNA 2EKYA 3JYTB 2AEFA 1U1LA 2E66A 3HVWA 4OIXA 3ZZTA 4YFUA 3K2YA 3PHEA 1WG5A 3AB2B 4NLOA 2VHGA 2JC1A 2HBRB 3BV8A 4YQWA 4MIBA 3HX9A 2XO6A 4J9KA 1Y00A 4ETZA 4X4NA 4LVNP 7AT1B 4LT6A 2KYXA 1R3NA 5E41A 1O0PA 2ATLA 2O67A 1HA1A 4GVBA 4PQUB 4MIAA 4X4RA 2X3GA 4IH5A 2Z0GA 1RHKB 1FDAA 3KDNA 4CI0B 3HP6A 1G2EA 2HURA 4NLVA 2YKAA 1ZA1B 4ZLPA 1WJ9A 4DUYJ 2LQJA 4LVOP 4N47A 2E7VA 3G71S 4X64F 3G6YA 1HNVA 4DG1B 4U95A 2OJ3A 4M5KA 4U7UD 2KB2A 1TQLA 3CJ5A 3TOQA 2BQ3A 4HDHA 4MKVA 1NEEA 2HWIA 4O3QA 1TKDA 4J37A 2QGFB 3TZYA 5ETKA 3CEDA 2WB1D 2Y1RI 3FFIA 1VHIA 3JTPA 2A2CA 2R7UA 2IRYA 3TX8A 1HKAA 3UN2A 4QWEA 2JH3A 4ED1A 3K7RA 2BKOA 4JBCA 4RWWA 1SCJB 5LMNF 1XMOF 1UKUA 3N5BA 5LJ3Y 1KSPA 4LSNA 2MYFA 2KJVA 4C3LA 3CD7A 4NYZA 3D1QA 4P7TA 4PYDA 2GJ2A 1IKYB 5B0AA 3QSYB 2P9CA 2POKA 1XJWB 4OI2A 3MR5A 1J5OA 4JV1A 1TL1B 1VBYA 1KOOA 2A6OA 3R5DA 1AT1B 2DHXA 2DGOA 3CCTA 3DRSA 4A8FA 4I6AA 2B56A 2UVRA 3BBFA 1WUUA 4OJ3A 1KLMB 1FXDA 3G9CA 2B9XA 1NHUA 1VMBA 1EX8A 3W2WB 1Q4RA 1S59A 4MIWA 2V9KA 1B99A 1KP6A 2H4WB 2Q6CA 3ZZUA 3HM9A 2MPUA 1QE1B 3GCXP 3FEXB 2OI2A 2ZKTA 3IR7B 3I0SB 4M8LA 4RO0A 4ES3A 2KRRA 1B7YB 4IO1A 4FBUA 4WTOB 3M6VA 4CRJA 1N5SA 1SIZA 3I5AA 3I6PA 1S9FA 3GE9A 4KHRA 4NYOA 2LDIA 3DM2A 3LWMA 3UD4P 4CO0A 1P9QC 5KFTA 1NSQA 4PWDB 4ZPDA 2L9DA 5C25B 2CZ9A 2QN6B 4AUKA 5K20B 2EG2A 3SQGB 4DS4A 1YJ9S 1JXLA 3JTOA 1OY8A 4DR2F 3WC2A 3CD0A 3DLJA 2VBYA 2GGPB 2GV1A 1P1TA 1TU0B 3HZGA 4QPTA 9ATCB 4FF1A 2J0SD 4LF5J 3MPWA 1X4EA 3TQEA 1SL0A 1HQEB 2Z57B 4M5LA 4P75A 3T1YJ 2FJXA 3E3XA 2VBXA 3GIKA 3IWNC 1HYSA 4FF3A 4CH7A 3M1VB 3C6UB 2F65A 3QO9A 3N9UC 4U96A 3C66A 3I56S 1TTHB 4DS5A 5E5NA 5C2CA 1VI7A 4DUZJ 2Y8YA 3BSAA 3OVBA 2VQEF 1HR0J 3MM6A 4USMA 2DEJA 4HVZA 2OFHX 3PFOA 2XM3A 1HR0F 1ZAVA 3KLEB 1HI0P 4KHPF 2DYAA 4W4MA 4B9MA 4LFAJ 3CD5A 2D41A 1R6VA 4I56A 3M8SA 1VQSA 2ZNYA 1CJTA 1S77D 4PUOA 5KFPA 4UOCA 2DITA 2FHOB 2XMVA 2XTJP 4Z7CA 3P5TL 1R8HA 2UXBJ 4QWBA 3QMQA 4OHYA 3HULA 2IMOA 2I5JA 3N6LA 2OMLA 4PWWA 1TK5A 2CIMA 1YWXA 2SXLA 3KUHA 3M8ZA 5SZTA 2NPFA 2XLJA 2AJQA 1SQFA 4DV1J 1C1BA 1K73T 1YLXA 4ZPTR 1S0OA 3D5MA 3PYEA 4FDFA 2PEHA 4P72A 2JX2A 4L75A 3BSOA 3BO3A 1YZ7A 4KPCA 2I1RA 3C15A 1EP4A 4WIIA 4DX6A 2MTLA 4P71A 5LSOA 2RKIA 4JI1F 4NLRA 2UXDJ 3QGPA 5LJ5Y 1RE1B 1HBMA 2HAIA 1FNMA 2KT5A 1GMVA 2BXJA 3CGIA 3H8YA 1RHJB 1S9EA 4NLYA 2HFOA 1C0UA 1EB0A 3PM9A 3FJ2A 1CQMA 5B09A 1J2VA 3B4DA 1VRTB 1I1GA 4YMEA 3NS7B 2H51B 3IS9A 3RRHA 1NCLA 2Y1JA 2QG9B 4MKAA 5B0BA 1JLCB 5L1IA 2QA4G 4L76A 5D4NA 3QFWA 2OPSB 2MKJA 4QIFA 2OP5A 1UWBA 4UUXA 5D3GA 2U2FA 3V5RA 1ZZFA 2YWFA 3MECA 1GAOA 2RAQA 4PQAA 1W2IA 4WYWA 1YRXA 3MF5A 5C42A 2WSEC 4DR4F 1JK9B 2XMUA 3R5GA 4DR4J 3MMAB 2AQ4A 2XEXA 2YKMA 4RKUC 1Z4UA 1U02A 2ZVIA 1UFLA 1FE0A 5E2QA 4OI1A 3KK3B 2IVYA 2PI5A 4RZRA 1X5TA 4CM0A 2ZH3A 1FDBA 3M6XA 4PPDA 4B9SA 3D4JA 2IBOA 1IBMJ 2AYEA 1S1TA 2G13A 2D1CA 2UUWA 1NPKA 4B3RF 4HEA9 2JEGA 2D74B 2QLBB 3ZZRA 3MMJA 3L7OA 4X4OA 4JI5F 1QSYA 5ETMA 2J9DA 4DOZA 3T1HF 2VZ9A 1CSJA 1N54B 2MKHA 2VFRA 3GQCA 1LK5A 5IWAJ 3Q22A 2RDDA 4LR8A 4NWBA 5HP1B 1FKAF 1KQGB 1IBKJ 4K4VA 1HNIA 5DQHA 5KG5A 2LDYA 1WSVA 2YKQA 3OL6A 4RW7B 3L9ZA 1RKJA 2X3DA 5ETNA 3MFHA 3SI8A 1IKXB 2LEAA 3I4HX 2B4UA 2EI5A 4MK8A 4O3PA 4FP9A 4JI7J 5HANA 1N56A 1EKSA 1QTNB 5F41A 3SSRA 1BWVA 3D28A 3N5FA 5IOLA 2DPJA 4LRCA 1YSJA 2V2QA 2YNGA 3N01A 4ID8A 4A8MP 4X64J 4YUDA 5KFIA 2MEWA 3W9JA 2PFDA 2HNYB 1YX2A 4IG0A 4DPYA 2CZVC 1JJHA 1ZAWA 4LR7A 3ZZPA 1M5KC 1Q53A 4MAKA 3CPWR 2CJAA 2HPUA 4YEAA 1DBDA 1N48A 7FDRA 1IVZA 1JKHA 5SUHA 4EWTA 1KRPA 1JJCB 4I7FA 3TZZA 1P27B 2CDQA 2F5GA 5FIIA 2M8HA 2QMUB 2WVCA 3HSZA 4LBPA 5HL7Q 2HHHJ 1YI2S 4KV8B 1WF2A 1GXUA 8AT1B 3KJQB 1XR5A 3GV8B 1KR4A 1RHRB 1RZMA 3RBXA 3C14B 2FYXA 4O3NA 4C97A 1FKOB 4FF4A 2BJ9A 1S6UA 3FNNA 4USUA 1UVNA 1BMQB 3OFFA 1TL4A 1XMQJ 3TUPA 4LBIA 1WI8A 2EFGA 1RUSA 3FBEA 4DFPA 1NHKL 2DNNA 1VR6A 4KGVB 2OIHA 1DY3A 1WEXA 2UV8G 4CO3A 1C0UB 4OX7A 2DH9A 3PRDA 1X4FA 3OD2A 3RW7A 1FFWB 3IG1A 1MWZA 4LFBF 2V8GA 4CLUA 4BS2A 4QYZJ 2KXFA 1LWCA 5H9FK 4OX8A 2CAJA 3DRPA 2OEMA 3I32A 5L8RC 2LA6A 4DMZA 4ECYA 2WW4A 1CVJA 3GJQB 4ZVGA 5DQIA 4IOAQ 4URSA 3CDUA 4HHHA 1PGZA 1WELA 4CLTA 2E1MC 4OHVA 4NLXA 3C8YA 3VQTA 1H2VZ 1T9XA 3NBPB 4DHVA 3V6HA 2F9JA 1DRZA 1DLOA 2D3ZA 4Q45A 1TL5A 2DGUA 3RTVA 1V3SA 2JFDA 4I0WA 2PMZD 4ZJLA 2NSBA 4K0KJ 2AT1B 4N8OA 2OPSA 3EX7B 4ELUA 2XS5A 1CQNA 3MAAA 3VAJA 3QT8A 4IQXA 3K57A 2GA7A 1KN6A 2BA9A 1TKZA 4F0MA 1VQ9S 2UZAA 4IRKA 3TZXA 2MSTA 2MJNA 4F7VA 3GMGA 1S97A 1WKKA 3HJFA 1M1HA 3F56A 4F4XA 3OR1B 3BGLA 3ZZOA 4F3OA 2CQ1A 2Y3YA 1IKVA 1RT5B 4KE5A 1TK0A 1BY9A 1OY9A 3OR2B 3D7SB 3M9MB 4ECTA 1S6QA 5LT5A 4KTQA 4KYZA 1OWXA 2W2MP 4Y2AA 5GADI 3MOZA 3GFHA 4B3MJ 2MZQA 1B0TA 3P96A 4ID5A 4OLOA 1KQSR 5THWA 5F8LA 4ECWA 3Q8PB 1U0HB 3I5CA 4WXWA 3VAGA 1RWXB 3PJWA 3RBZA 3BGFA 3J7YU 2RS2A 2V94A 4DF4A 1WTBA 1S10A 4UZBA 4N56A 3VR1A 3CJSA 1Q81T 4OZ5A 2COLA 4EI2A 2I38A 4FVMA 4WE1A 1SB6A 5DDPC 1ITPA 1VQMS 3M8RA 1LKZA 3V6JA 2KO1A 3Q83A 1PJ6A 3GG1A 3LALA 2AGPA 1RGVA 1VIXA 1SH2A 3P3DA 2ABYA 4XDCA 4Y34A 3E01A 4MFBB 5HBMB 4UOHA 1WACA 2K06A 1NPRA 2HHUA 3BPSP 1M5VC 5KAKA 1UVKA 1HI1A 3LPEA 1RQ0A 4DV3J 3DLGA 3VAHA 4V19J 3NG8A 4FYYB 3FSIA 2F8MA 3DHXA 3JQKA 3JTNA 3GP9A 2ALZA 2LMIA 3GYXB 1FRXA 5J2MA 5BJRA 3QGGA 1WI6A 4K7QA 1P8GA 4JI6F 4JI6J 1TL3B 4KKOB 1VQNS 3HF5A 2E44A 1X0PA 4TQSA 4RW9A 3KLGB 2HGLA 2J0WA 4J9PA 2X1FA 3UO0A 1HPZA 4IOBA 2V5HG 1F6TA 1Y3JA 1ZBTA 3CDEA 3M32A 3FEZA 2XY6A 1Q79A 4TY9A 2CPHA 3IRWP 4WF9Q 1KTQA 2E29A 2R7OA 3J7A1 1VQ6S 2XHWA 2MKIA 5I3UB 3LGMA 3D6HB 1W26A 2VPXB 2W8KA 3OL7A 1D3WA 4UTGA 2NLWA 5EGYA 3X3UA 1N5TA 5CZXA 5E0OA 4DL2A 4NYPA 5I3PA 4YHHF 5L1JA 4JP8A 4DSLA 4NZ0A 5DO2A 2BBEA 4ECUA 3BR8A 1C0TB 4DL5A 2R2RA 2VU5A 5HI7A 2FDNA 1U45A 2M52A 5KG2A 2KT3A 1RJJA 3OTBA 2MZJA 5CYQA 1SUQA 3DDIA 3OSNA 1UETA 3EGWB 2ZHBA 1IR0A 2RNEA 1S6PB 4IDKA 1RDRA 2KRBA 3MEDA 1RT7B 1WHWA 3DYAB 4CLWA 1YIJS 4JI4J 1AFIA 1S6OA 3QIPB 4BWMA 3I82A 4J9VA 2OPQA 2CNOB 2KZMA 1C1CB 1WDTA 4YR0A 1NSAA 5T7LB 1B0VA 2LXFA 3KNAA 3MM9B 2IM0A 3QJLA 3EWGA 2H4YB 3HFKA 2DGTA 2O01C 2ZM6F 2ZNZA 3AOBA 1S0VA 1DTTA 1HMVA 3R5CA 3QAUA 5KFUA 4CDIA 4ZN3A 3Q89A 5IC4B 3GR0A 2OH2A 3R5BA 1CS4B 1GNKA 5L1LA 1SQGA 2D3OR 1IBKF 3DLEB 2RDIA 4ZP6A 3BKUA 1SJRA 3R2CJ 1ZPVA 2PT0A 3UDEA 5LOQA 2LEBA 3TANA 4C8LA 2IJNA 1WDDA 3AAWB 2CVIA 4DV1F 1IKWB 1FNOA 2CPYA 2F4FA 1IWGA 2WVEA 2XYHB 3A13A 3IRXA 2JVOA 4P52A 4DPWA 2YKNA 4KT0C 4F3QA 4EEYA 1UA0A 5CHCB 4N7TA 5GAHI 3R27A 3LP2B 5ETPA 4DSKA 4XK8C 4Q2LA 1R89A 1HNXJ 2XO7A 4LRFA 1UEKA 3QGIA 3M8PA 3G82B 1RU2A 1U1KA 3NKYA 5EX0A 5H1SV 4IH7A 2J6SA 1XQIA 4N8NA 4KPYA 1MROA 3MPYA 4ZVPB 2RUSA 1RT4A 2XWYA 2EXUA 4G3IA 1VJWA 2RU9A 3R3TA 1Y5IB 2MQQA 2CJQA 4K59A 2GNKA 1BQMB 5CXTA 2C22A 5IQQA 2DD8S 2HGMA 1FXRA 4ED7A 3LPYA 2VJUA 1HD1A 3CD6S 4DZ6A 1TKTA 1X4AA 5KG4A 1VLYA 1XWLA 5LM7E 1VRTA 3HKWA 5L9NA 4TLRA 4YY3J 2ALYB 3DOKB 4IO9Q 2OGUA 5A76A 4CP5A 1CJUA 3DXSX 1XMQF 1DARA 1YBUA 3CJ0A 3JSMB 1N36F 4N76A 3S7RA 5FLXU 3DC2A 2ERRA 2DR7A 2J6TA 3QRQA 2GQ2A 4WKYA 1WHXA 4TXSA 1T05B 2L9WA 1RADB 2WVFA 4DFKA 1UA1A 3IXQA 5CD4A 2QT7A 3OW2R 2AJ0A 2KM8B 4NLWA 4TN2A 4DU7A 2E9TA 1ZH5A 4L72B 2QLFB 4I1TA 5I3QA 3CCLS 4K4UA 3M2VA 4J90A 2HHVA 2L3MA 1Q5VA 1K47A 1KVKA 2N4CA 3J81j 3VAKA 3MXHP 2W9CB 2WZ1A 4JI5J 1H2UX 1FA0A 2F1FA 3D6TB 3NGUA 1U26A 1VLOA 5DETA 1SIWB 2LEPA 4QW9A 2BX6A 2M3DA 1H7XA 4UF4A 5CA5A 3AB4B 1YG0A 5LXRA 5L46A 3BQ2A 2UUAJ 1ELOA 2E5LJ 3SSSA 4NE9C 3HFVA 4ZMMA 2HIYA 3H90A 3A4TA 1D8ZA 5HMZA 3K8WA 8RUCA 5F8MA 1NUEA 3EGVA 3EUNA 2C3UA 3RAMA 2YNFB 1RA6A 3EDRB 3KG0A 4ZHRA 3BR9A 5ADZA 4ZVUB 2PO4A 3AD7C 5DGBA 3GYNA 5J1NA 1L5UA 3AY0A 4IFVA 1U48A 2J8AA 3NCQA 4FNIA 1UVIA 2D9PA 2GVDA 2DNQA 1MMDA 2FC8A 2HIQA 5IFMA 1N6QA 3OQ2A 1TELA 4B3RJ 2XY7A 2WONB 1B7FA 2QX0A 4QPXA 5D0EA 2HQFA 2DNYA 3C16A 1XNQF 3GFYA 3LAMA 3OFHA 1Y4ZB 3AA9A 3NXZA 4I68A 2NQPA 4RW8B 2BE9B 1X4CA 4XTTA 5KFVA 5KT2A 4R5PA 1RTDA 3M30B 3R6GB 5ETQA 2BJ8A 5F8JA 4OZ0A 3GPAA 1M5PC 1RAGB 3FBFA 3L7UA 3MPUB 3M6WA 2QLJB 2E7WA 3DM2B 2APOA 3ADAC 3HHLA 2VICA 3HSJA 3T3FA 3BS9A 4BWJA 3ZZ0A 1VBKA 3OT9A 4D3GA 3CWJA 3MMBB 3R8YA 3RR7A 6FD1A 3VGVA 3GLJA 2BM1A 2XWXA 3Q2SC 3SZ2A 1WHYA 3ULHA 4QIGA 1SJ1A 3AA8A 1IBLF 2BE2B 2J76E 4H4KC 2VODA 1A7GE 4HYKA 4HACB 5A8RA 1VFJA 2WCXA 4LIWA 1NZ8A 5CCLA 3DLKB 4M95A 2IPOB 3B78A 2CADA 4MK7A 2V2KA 3VF0B 4FXVA 2NSCA 3CJKA 4C7QA 1NHVA 2R8HA 1YJWS 1JLAB 4F0HA 4HDGA 2JEFA 1IJFB 2F3JA 4Y65A 4LQ9A 4QR1A 4CO5A 3HVRA 4ED2A 2IYGA 2D3O1 2ROGA 2B4OA 4ILRA 1F5AA 3M8QA 3KK1A 3GIMA 4DV7F 2VA2A 4NCAA 3DGPA 4B3OA 1UMJA 2RF2B 3SCKE 2HHHF 4D3HA 1U09A
chains in the Genus database with same CATH topology
4LSNB 4ETXA 1WNEA 3T9ZA 1R7IA 4ECZA 5IS2A 4NCGA 1X4HA 2B9WA 4FXWA 4PRFA 2WOMB 1E6YA 2OKQA 3T6JA 4F67A 4AL7A 2M7SA 2R2UA 5KFCA 3UNGC 3VWSA 3TAMB 5HMWA 2MJUA 1U4BA 4KIAA 5KFGA 2HW3A 4DV5F 3H2UB 3MWBA 1ZTWA 3GWCA 1R8CA 2MZSA 3MD1A 1Q86T 1S1VB 4HTJA 2AD9A 4RW9B 4B9TA 1YJVA 3JAMY 2XS2A 3KMQA 3OXGA 4LUBA 2EFNA 1LWEA 1TV6A 3MZIA 5K14B 5J2QA 1HBUB 3FVYA 2PMHA 3PACA 3NLCA 3RRGA 2GIQA 2DJWA 2YKNB 1HBNB 3LO3A 2F4VF 4DSIA 3GFZA 1OQ6A 2DNLA 1VK3A 1D9AA 3MR2A 4K4TA 1VRUA 3VCDA 3A1YG 2B9YA 4Q44A 1H38A 1B64A 2KXNB 2RD5C 3QZ7A 3DLEA 4EGLA 4O4GA 3TUZC 2E5GA 1RKIA 3G96A 3PW7A 4DJBA 3MAHA 1HMVB 2IA0A 3HLUA 5DLGA 1VRUB 1HNZF 1LFWA 3KLHA 2B5JB 4WE1B 3O5TB 2HWTA 4MYTA 1Q82T 2JVRA 2DH8A 4EZ9A 4HKQA 2HHTA 4WFYA 3BGUA 3PEHA 5DJBA 3TW0A 4DFMA 5F3TA 2XMWA 3OBIA 2BYCA 2GJIA 4ALZA 4HHJA 2QLXA 3THPA 2KDOA 1U2FA 2VBWA 1HBNA 1XR6A 5A6WA 3EPIA 3K5LA 2FJDB 2L41A 1KQFB 2DH7A 5J2QB 3M9OB 2OD4A 5DM7Q 4OJ1A 1N0UA 2ZH4A 2DCUB 1VQKS 4EO8A 3EZUA 3MM5B 1RYSA 2CQGA 1S1VA 2Z8QA 4CTAB 3U7JA 1XN9A 1S1WB 3SFGA 4FN5A 2VA3A 2VONA 3ISZA 4CIOA 1FK9B 3T19A 5B0GA 3OXFA 4FPRA 2C28A 1M1KT 2VG7A 4ZCMA 4C4WA 3T6BA 4DEZA 4F02A 2QSFA 1CG2A 2HLTA 3QJJA 2HHXA 4GO7X 2GO9A 1LFPA 4I4BA 2UUTA 3POTB 2PGCA 5MLCV 2FY1A 2XNRA 3US5A 3W2VB 2QA1A 2XMJA 2AYBA 3MEGB 4J9NA 3CUNA 2VG5B 2KG1A 3IA0A 2MQNA 4DSFA 1VS3A 1T03B 2DNZA 3JSBA 1Q16B 2R9LA 3I0RB 2BE2A 4KQZA 5JJBA 2DNOA 1UVJA 2JC0A 2X1GA 1JLFA 2AWZA 2OMOA 1Z1ZA 4YB7A 4MFBA 1S49A 4GC7A 1U6ZA 2DR8A 3ZFVA 4WKRA 4OHWA 1HBOB 4R8UA 5A0YB 3DOMA 5EUHA 3QWPA 1VC6A 2UUAF 1R8AA 1MROB 1U24A 3OTDA 3RB0A 4YDDB 4RU2A 1GXTA 4PKDB 1UJ4A 2CQBA 2ASYA 2ZUGA 5AXLA 4HH0A 4IR1A 2W9AA 3TR5A 4J9MA 2ROPA 5EWEA 3OTCA 3OVSA 4ERDA 4K4YA 4DV6F 3PW2A 4PXDA 3DRRA 3MAQA 1HI8A 4FNHA 1RT6B 1YJNS 1Y0HA 5KFKA 4ILMA 5M2RA 5KFAA 5IT0A 1HFEL 1D1UA 5EN1A 2RH3A 1MNEA 2KXHA 5GAGI 2EPIA 3OR1A 4F50A 3OFGA 3HI9A 2GMLA 2VH7A 1G3OA 2FLOA 4Y2IA 1SJQA 4Z37A 4LF7F 1HWKA 1F0XA 2JHEA 4MK9A 5GAEI 4DN0A 5T14A 3OL8A 3H5YA 3R1LA 1HNIB 3HK2A 4ELTA 2DGQA 5KFDA 1D8YA 3V4MA 4B9NA 5J1EA 1N34F 4NLQA 3OUYB 5T41A 4KB7A 1TKXB 4DLEA 1X8DA 2V8VA 4P7VA 1NK9A 1DQ9A 4WFNQ 1RT1B 4C8YA 4M5DA 2X1AA 4K2XA 3I87A 4R25A 2FJWA 2MY8A 4IDKB 3M2VB 2DK2A 2VB6A 3HO1A 2C2DA 1GH8A 2GIRA 4NLDA 4DWIA 3IN5A 2WB4A 3AJ2A 3K5NA 4DL4A 2VASA 2J9EA 1HD0A 2Q43A 1FTRA 1H6KX 2V4JA 5HROB 2DGSA 4X4VA 1YJRA 2FHMA 3T5HA 2DO4A 2FJBB 4CH0S 5EWGA 3EXCX 1TAUA 3AQOA 4B17A 1NRKA 5K5MA 1U1MA 1KHWA 3LW5C 1KFSA 3QJPA 3MD3A 4PXEA 3V2UC 4NA3A 3KJVB 3RAXA 2PI4A 3EGNA 5GVQA 5E3RA 3L09A 1MWYA 2E5LF 2YH0A 5H9EJ 2JSXA 1GTHA 4DFJA 4USIA 4KKOA 4QU7A 1NJZA 3PJXA 3CDAA 3LP2A 1JX4A 4X4TA 3EGZA 2PN6A 2XULA 3GILA 3H5XA 2BUNA 4F4YA 5KFNA 4CO1A 3U02A 1GT8A 1QTMA 3AJ1A 4X4SA 4F2SA 3N6NA 4G1QB 3M2RB 1WEZA 3LUYA 3SFUA 3UD3P 3FSYA 4IUFA 5KFHA 2E7XA 2UXCF 1ZPWX 1SL2A 4C8NA 2IJFA 3ISND 3CC7S 5J2PB 2CVEA 1ZM4A 2GFFA 4RW7A 3UWTA 1DTQA 3VTIA 4FS1A 3RAQA 4C8KA 2MGZA 1D0EA 1YVFA 2I5JB 5CCMA 2FC9A 5BYSA 4UY8T 2A10A 3THTA 1V6HA 1RT3B 1HHSA 1R43A 4L6V3 3Q23A 1VHFA 3NNHA 3AH6A 4K4SA 1H98A 4H54A 1XBWA 4HH1A 3BSNA 1C1CA 2E5IA 3HPOA 2I0XA 3THVA 2JJ4D 4JI7F 4Y28C 1SI9A 2BRKA 4F4WA 1FVQA 3DMJA 1Q8IA 3MCSA 3KLEA 3PIOQ 2KG0A 1L3SA 2QIFA 1S6PA 1Y7PA 1PILA 1RTJB 2CPEA 2HQIA 2HS3A 4Z2XA 2DNPA 4B3MF 2OPQB 1VQYA 2CJKA 4NZ6A 5DGAA 4ZS6A 1FJEB 1JMTA 1TP7A 1OS5A 1XMBA 4ZCIA 2UVWA 3H5SA 1GQEA 4X4UA 3G8TA 2CQ0A 3OJSA 3B4MA 2VFVA 2HMIA 3OSPA 1TVRB 5CYMA 2OD6A 2CQDA 3MMCA 4K4ZA 3PEJA 5LMUF 3PVXA 4NLUA 3L3CA 3O3LA 2P9GA 3HVTB 3IFEA 3NCPA 4IFYB 2N82B 4U7CA 2AJ1A 5KT5A 4WK3A 2HQ3A 1U1RA 4PWDA 2I8EA 4NLPA 4O23A 2HNDA 4JI0F 4PG7A 5E3AA 1GX5A 3LH2S 3PKYA 5I42B 2ASLA 2CZ4A 4LF9F 2R7WA 5D6GA 3VAMA 3QLHB 1JLQA 2CPZA 4AXJA 2HRYA 4I6YA 1NK8A 3C3LA 3IG1B 4HI2A 5KFOA 1U1PA 1O5JA 2LQ9A 1NJYA 3DLGB 1M90T 1T7PA 2MDAA 3W2VA 2RUGA 3LOUA 2MSSA 2ZOGA 5DLFA 4WJBA 1OSCA 4X65F 2VFSA 3MEEB 4KO0B 2LQ5A 5DS7A 5F8HA 3E2EA 4I67A 2EWHA 2KFNA 3GV7B 1U47A 4V19X 3NCRA 4YR2A 5M2UA 1VQ8S 3BQ1A 2ZJRQ 4WFBQ 3CMES 4ECXA 2C42A 4I7FB 2EBGA 3RBDA 4NLTA 2XBPA 1VC5A 4IRDA 3CJ3A 1NH7A 1OO0B 4LF5F 4R5PB 1RTDB 1LW0A 4IH6A 1IQTA 1VOMA 3MHYA 4OZNA 2XLKA 2MZRA 4XPEA 3NNAA 1JNRB 2C3MA 2YWGA 3PR4A 2GCFA 2HFZA 3RRKA 1S9GB 3LP0A 1RA7A 3KK2A 1OQ3A 4ZP9A 4UQTA 3G4SS 3OHBA 1SKSA 2HNZA 2M88A 4CQ1A 2GC8A 2JEJA 4C8MA 2W24A 3TNVA 3LQVA 1UVLA 3HHDA 2YWKA 1FD8A 4O4RA 1OPZA 4OL8A 4QIEA 3MUMP 1KONA 2J0QD 3SQGA 2H9ZA 1DLOB 1ULRA 2B6AA 2WW8A 4IOCQ 3CJ2A 2E1AA 4N5SA 4QOTA 3O8WA 5LSRA 4XO0A 1NKCA 2MQLA 1SKWA 4DN9A 2W4CA 4OLPA 5L39A 3NBPA 1Y5NB 3GV5B 1QJHA 2PE8A 4CT9A 2KI2A 5KG7A 1LWEB 1TV6B 5K14A 2JLGA 4DV4F 2C2RA 4JI2F 4HT7A 4U6PA 4O0IA 1N52B 2UVUA 2ZZMA 3DRPB 4PXBA 3UPFA 4H4OB 3ZZYA 1PC5A 2IM2A 4UW2A 3GFXA 2B3TB 2PSZA 2DBBA 4OV1A