4IOAQ

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ioaQ00
4FXVA 3CCUS 3UWTA 4IUFA 2CQDA 4PKDB 5DETA 4IOAQ 3S01A 2DITA 3V4MA 1U6BA 2XS2A 1QVGR 2YH0A 3JB9k 2DNNA 2N3OA 2M52A 1VQ7S 3UD3P 2HGLA 3SMZA 1X4DA 2XNRA 3CULA 1H6KX 2RUGA 4EGLA 3SDEA 3I55S 2KH9A 2CQBA 2F9JA 2YH1A 2RT3A 3NNAA 3LPYA 1M5OC 1VQ4S 1B7FA 3NS6A 1N52B 1X4GA 3H2UB 3HHNB 3VAFA 1VQMS 3DXBA 1JJHA 2DGSA 2CPHA 3G4SS 2MSTA 1U1OA 1M90T 1H2UX 1X5SA 1N54B 2CQ0A 1U1LA 2FY1A 4A8XA 2CPYA 3I56S 4TLQA 4V19X 1WEXA 2L9WA 3RW7A 2DISA 3J7ZT 3CCLS 5IM0B 1YI2S 2D9PA 4FXWA 2XNQA 3MURP 2ZJQQ 3MD3A 5D77A 2E5HA 2FC9A 2DK2A 3CC4S 3D2WA 4CH0S 5ITHA 3G9CA 2GHPA 2MY8A 2F9DA 4M5DB 2MZSA 2N7CA 2X1GA 2K3KA 1VQ5S 2CPXA 1FJEB 2KXNB 2LECA 1M1KT 2OIHA 3THTA 1VC6A 3Q2TC 3IWNC 2E44A 1P1TA 3CC2S 5DDOC 4RU2A 1WI6A 2O3DA 2LA6A 4LJMA 1RK8A 1Q86T 2MY7A 4LMZA 3G6ES 1DBDA 2MQLA 1VQ8S 2MMYA 3ZZYA 1U1RA 1UW4A 2M0GB 1M5PC 1BY9A 3BS9A 2LEBA 1X4AA 2L41A 1VQLS 1PGZA 1VQKS 2I2YA 2LEAA 2MGZB 2MXYA 5GAEU 2YKAA 3VAHA 2DNMA 2M7SA 2ZJPQ 1QVFR 4WFAQ 3CUNA 5HL7Q 1NO8A 5DDPC 1X5TA 4IO9Q 1X0FA 2A3JA 1JJ2R 1WHXA 2DHSA 2DNGA 3THPA 2RS2A 1PO6A 1FT8A 5BJRA 1YHQS 2CQPA 2MZRA 2DB1A 2VODA 2Q79A 3P3DA 2MHNA 5LXRA 2DH9A 2RQ4A 2ADCA 2MQNA 1XN9A 1U1MA 1SJFA 1K73T 2DNQA 5DM6Q 2RRBA 2DNLA 2KVIA 2X1BA 1UAWA 2KRBA 4U67Q 2MQMA 2MQOA 3OW2R 2CPDA 4CQ1A 1IQTA 2RQCA 4ED5A 2VONA 3UCGA 4UY8T 1WTBA 1YITS 2CPFA 2GO9A 3S7RA 5IFMA 5LJ5Y 4IOCQ 1K9MT 2OTJS 3R1HA 2XS7A 2DGUA 2DO0A 2DHAA 1WG5A 2M9KA 3S6EA 2E5GA 2HGNA 2L08A 3MDFA 3K0JA 5LSLA 1P27B 2DGVA 1RKJA 3ULHA 4WCEQ 1KQSR 2V94A 5JVHQ 2MPUA 1SXLA 2J0QD 2MQPA 3UCUP 2I38A 4C7QA 4WFNQ 2M8DB 3CD6S 1X4HA 1ZZNA 2LYVA 3UCZP 2G0CA 1D9AA 2MZTA 2CPZA 4Z2XA 2DNKA 3UD4P 1DZ5A 1FJCA 3PIOQ 3CMES 2JVRA 1HA1A 2VOPA 2RRAA 5FJ4A 1L3KA 1U6FA 2D3OR 3U1MA 4LIRA 2KT5A 2JX2A 5GVQA 2XSFA 2DH8A 2N82B 2N3LA 4OZ1A 2LXIA 4OZ0A 1WHWA 2PE8A 3CCVS 2MQQA 1U1PA 2CPJA 2XB2D 1FO1A 2JWNA 5GAHU 1WELA 4TU9A 1X5PA 3N9UC 1WEYA 1UP1A 1DRZA 4QQBA 1VBXA 1HD1A 1OPIA 1WF1A 3EGNA 2KG1A 5D78A 2G1DA 1S79A 2X1FA 3CTRA 5LXYA 4F26A 2DNYA 3FEYB 1X4BA 3EX7B 3MUTP 2AYGA 4QU7A 4QPTA 1U2FA 2LA4A 2KN4A 3SXLA 2B0GA 1AUDA 2U1AA 1X4CA 2QEXS 1YTYA 2CQ1A 2CQCA 1VBYA 1K8AT 4W90B 3TP2A 2KRRA 2DIVA 3NNHA 2JVOA 1O0PA 3MI7X 3R1LA 2HYIB 1WHVA 2KI2A 1ZH5A 1G2EA 2KXFA 2X1AA 2M88A 1VC0A 2MKCA 1JJ4A 2RS8A 2ZJRQ 4Y0FA 4J5OA 5DDQC 3MXHP 2WBRA 5DDRC 3SDEB 2CQ2A 2MKHA 3L3CA 3VAJA 1KD1T 2M8HA 1R8HA 1SJ4P 3BO3A 2HZCA 3VALA 1FNXH 4W92B 2J0SD 2LCWA 5IM0A 1HL6A 1NJIT 1A9NB 1FXLA 2NZ4A 2VOOA 3CCRS 1DHMA 2OTLS 1H2VZ 2YWKA 3G8SA 2BOPA 3G8TA 1FHTA 4CIOA 1M5VC 3BO4A 2F3JA 5GAGU 3P5TL 3RW6A 1VQ6S 1QM9A 3CCES 1SJRA 2MKJA 3Q2SC 1F9FA 1VQOS 4PR6A 1WF0A 2AYEA 2DGXA 1OIAA 2DHXA 3CF5Q 2RU3A 3MUVP 3VAMA 4WIIA 2LMIA 2EVZA 3UE2A 3MUMP 3VAIA 3FEXB 2KFYA 2LQ5A 2CQIA 2MZJA 2DNPA 1A7GE 2MJNA 2XS5A 2CPIA 1Q7YT 1OWXA 1YJWS 1S72S 4TU8A 2CQHA 2DGQA 3CMAS 2DO4A 2E5JA 1YJ9S 3EGZA 1KOHA 2KM8B 2MKSA 3HI9A 5EN1A 4C0OC 2YTCA 2J76E 2KG0A 3PIPQ 3VF0B 3LQVA 2ERRA 4Y00A 1H2TZ 2NLWA 5GADU 3H2VE 1YIJS 2CQGA 3TO8A 4F02A 2M2BA 2MGZA 2D9OA 3TYTA 4BS2A 2MZQA 1SJ3P 4F25A 2M4MA 2MKIA 5H1SV 2K8GA 2DNZA 2MYFA 2HVZA 3IRWP 1N8RT 2MB0B 3VAGA 2EK6A 3G96A 2J8AA 3G71S 5CXTA 3CCQS 3MD1A 1N88A 5CYJA 2DGOA 1U1KA 4YOEA 2LXUA 3CCSS 1VQNS 2CJKA 2MJUA 1W2BR 2CQ4A 2AYMA 1U1QA 1WEZA 3CPWR 3CCMS 2KXHA 1ZZFA 2LKZA 2AYBA 2DGWA 3B4MA 2KU7A 1OO0B 3J7YU 2MSSA 4ERDA 1KOOA 2AD9A 1WHYA 4QU6A 3P49B 4C4WA 5DM7Q 1VC5A 1JMTA 2MZ1A 3NS5A 2OJ3A 2FHOB 1WI8A 1WWHA 2FPHX 4P6QA 5LSOA 2DIUA 1VQ9S 1VQPS 1WG1A 1NU4A 3CC7S 1X4FA 4PRFA 5LJ3Y 1VBZA 2CPEA 3B4DA 1U1NA 2CQ3A 4YUDA 3VAKA 1D8ZA 4CH1A 2DGTA 1WF2A 2SXLA 4UQTA 2M70A 2EK1A 5GMKa 3MOJB 4ZKAA 2DHGA 3R27A 2QA4S 2U2FA 1CVJA 5CA5A 1X5OA 2JRSA 2DNHA 1YJNS 1YWXA 2KYXA 1Q82T 3DLLQ 1HD0A 2ADBA 2KHCA 1URNA 3CXCR 3NNCA 3BEGB 2OSQA 1Q81T 3BO2A 1KC8T 3US5A 1R8PA 2OSRA 3U1LA 2PEHA 3ZZZA 2DNOA 2G4BA 2BZ2A 2RNEA 3P6YC 5HO4A 2QFJA 2DNRA 4YB1P 4WFBQ 2HGMA 2KM8C 3CCJS 4TU7A 3S8SA 2E5IA 1UFWA 5MLCV 1M5KC 2UP1A 1FJ7A 2FC8A 2MKKA 3NMRA 5IQQA 4WF9Q 1WG4A 2RVJA 5JVGQ 4WKRA 1X4EA 2DH7A 1SJQA
chains in the Genus database with same CATH superfamily
1T05A 3S01A 2ZVIA 2D69A 2R2TA 4IRKA 3VWSA 5CZVA 1H6KX 3W60A 3KDOA 2QFIA 3A13A 4X4OA 4FF2A 5K8OA 2OPQB 3K58A 2XSJB 5E3PA 4LVOP 2CQ0A 3I56S 2VZ9A 4OHXA 3J7ZT 2CWKA 1F5CA 2WOMB 3PJ9A 3RBDA 1SQFA 1RISA 1TKZA 2FC9A 1HNXF 3DRXA 3QT5A 2XC9A 5HK4A 3GCWP 2QN6B 4KGKA 5IQ6A 3Q2TC 4LR9A 4DL5A 2DJWA 1DTQB 1IKWA 3F41A 2R2UA 8AT1B 2B4VA 5T41A 3KK3A 2H5EA 4X4UA 1BQNB 2BJ3A 1PBUA 3BKUA 1P6TA 3GWCA 1SV5B 3QRQA 1SKSA 1S1TB 1FVQA 1R8CA 3K5LA 4NOHA 2ZH9A 5B0EA 5AT1B 3T9NA 1HWUA 1JLAB 1ZTWA 3CMQA 1L3UA 2NS1B 1GNKA 1LWCA 2HW3A 1FK9B 3D7SB 3OQ2A 4CM2A 2J9EA 2HGNA 2YQ0A 2IYGA 2OGUA 2BE2B 1U8WA 2JZ5A 3QWUA 2J0QD 2DRBA 2W2OP 3JS9A 2W7PA 4UZCA 1NXIA 4CLPA 1I51B 3NGUA 1ZAXA 1L3KA 2HNYA 4LFCJ 4C97A 1NDPA 5KT7A 3P96A 4LF1A 4N7TA 2DXEA 3MM7A 1TMMA 3ISND 4NXNJ 1XMQF 1F2HA 3LAKA 4TKTA 1N5YA 3BM7A 4G65A 1N34J 5D78A 1YDLA 2X1FA 4IH5A 1F5BA 1FFWB 4XPCA 4JV1A 3EGVA 3WX8A 1I5OB 4KRWA 1PJ5A 4UUXA 3U1NA 2WK4A 3D6TB 5F8IA 5KFKA 3PX4A 2HHUA 4ZHRB 1RLCL 3UQSA 1HQEA 3VALA 1RAFB 5KT6A 1NJIT 3HKZD 2YWKA 2BJ1A 4CIOA 1SJRA 1F9FA 1OQ6A 2MLZA 2N4CA 2RU3A 1ZAVA 2RILA 2XULA 3H20A 1QE1B 4NI2B 2AGQA 3OL8A 2MJNA 3GYGA 5J2NA 3ENWA 3MCNA 4AXIA 5BR8F 5G0RB 1Q8IA 3DC2A 2YNIA 3DMJA 2ERRA 2ZOFA 5C2GA 3HJVA 4LF4J 4ZVUB 5ETLA 1KFDA 3G6VA 4DR5F 1XEZA 3SZ2A 4C3MA 2W4DA 1RWNB 1TMJA 2LEPA 1KLMB 1S99A 1EX8A 3NMAA 2E29A 2KU7A 5EX0A 4F0KA 1FEHA 1J5EF 2VDHA 1R31A 5CCMA 3MMCB 4BWMA 2H65B 4PQAA 1WI8A 4LQ3A 1IN0A 1WG1A 1P9QC 3HDSA 3JSRA 2YVSA 3P4UB 2SXLA 3KNAA 3I32A 4WK3A 1VYAA 3TUZC 1GEHA 2ZC4A 4ZKAA 2BKNA 3VHQA 4B3RJ 3IM8A 1C4AA 2WHOA 5LL6d 1FDBA 3L7PA 2H48B 1TAQA 3OR2B 3V4IB 4JI4J 2AX0A 2EC0A 4DR7J 3KTQA 3DOMB 5T14A 2G4BA 3KLIB 1NSAA 4WFBQ 4R5PA 4ZJOA 3IR7B 3IO1A 3K57A 4H4MB 1S9FA 1U47A 3EZ5A 4PUOB 4C8ZA 2A0FB 2PGCA 2VFSA 4QZVB 2WVDA 5A8KB 5LMNJ 3UWTA 4IUFA 1XERA 3N6NA 4AL7A 4HI2A 5AXNA 2ZH7A 5KFOA 1YBUA 1KWMA 4G1IA 6FD1A 1QY7A 1NDLA 1VOMA 2MEWA 1S6UA 3DGPA 3L95X 2QLXA 1SKRA 2QL9B 1X4GA 2FJEB 3N28A 3D6MB 5ETKA 1WJ9A 1VK3A 5I42B 2F8HA 1HQ2A 3B6BA 1U09A 4BBYA 1KONA 1N32F 2L9WA 3H40A 4P7TA 3ILIA 3SQOP 2IM2A 5CABA 2VC0A 1MWZA 4DV5J 4X66J 2HVIA 3CC4S 2IIHA 1S76D 1RAOA 3H5XA 3IWNC 1P1TA 3CC2S 4ZA1A 3OTBA 4MKBA 1RK8A 1CJTA 4OI4A 4CO2A 2F4VF 3D0GE 4QIVA 3NY0A 1CQMA 3ZZYA 5B08A 2Z2YB 5D8HB 1BWVA 1BY9A 1JXLA 3Q22A 3D1HA 2B4PA 3N5FA 2JEFA 1H7WA 1REVA 6AT1B 3M2UB 4JB8B 2EFPA 2V8HA 3CJKB 2MLYA 1CJVA 4I68A 2BEFA 3J7A1 2WONB 4DG1B 5ETVA 2W24A 2KRBA 4U67Q 1NEEA 5J2MA 2ASDA 3JYTA 1GQEA 2DGUA 3OUYA 1HNZF 1AB8A 4WCEQ 4F2SA 1H7XA 2PFDA 3FZ2A 1VI7A 4LF7J 1S48A 5A6PA 2LYVA 3UCZP 4ZCIA 2AHOB 2V0NA 3K8VA 2RDJA 2HSEB 2CPZA 4IYQA 3F0NA 4NLPA 2BJEA 2LU1A 2RRAA 2FLNA 3M2RB 2EI5A 2KT5A 4DV3J 2E1AA 1QAJA 3FMWA 1WHWA 3CE8A 3CCVS 2MQQA 2LQ9A 5C5JA 4UZBA 2KB2A 3MR6A 4C98A 2IFXA 5EWGA 4DUYJ 1S1XA 2OLWA 1I94F 4IG3B 2DXFA 4K0KJ 5E3CA 1UEVA 2B0GA 2GQQA 2CG8A 4L75A 3IWXA 1VBYA 3TP2A 5GAHI 3GIIA 4UUWA 4OZ2A 4KGZB 4C3KA 2XHCA 2XMJA 1WHVA 2KI2A 1ZH5A 3I0SA 1YJ7A 3RB6A 2G0JA 3PV8A 2BYCA 4DHVA 3N01A 1K44A 4PG4A 1UL3A 4UOCA 3DLBA 2YQ3A 5HVFA 1NPRA 1RAIB 1A9NB 2CKWA 2CZVC 3HFZB 1T7PA 3G8SA 5H9EK 3FJ2A 2NXJA 2GVDA 2MKJA 3IRXB 4CO1A 2ALYB 3HO1A 2O5DA 1HQUA 3EYZA 5B0AA 3VVTA 4ID5B 3JAMY 4LSNB 1B3TA 3LW5C 4FYYB 1WKKA 3AY0A 1UZDA 1YJ9S 2C3YA 3EGZA 3U27A 1FESA 1TK5A 3HP6A 3ZNUA 2WAQD 2VG7A 3AD8C 4W98A 1QSSA 4F3OA 5EHHA 4V1Ak 1TELA 1U0SA 2XZDB 3I9ZA 5DZ6A 2R7TA 2K1RB 2MYFA 5E3AA 3M8ZA 2R7XA 4CTAA 5CYJA 3CDUA 1RWMB 1WOPA 2EW9A 1CS4A 3U7JA 1H38A 2DPIA 3PDNA 3NAIA 5K20B 2RD5C 1U1QA 4DU7A 4F0MA 2ZBPA 3HSZA 3G2XA 3H7HB 4OIXA 4ED1A 3I5CA 2DY1A 5LMUJ 4WFYA 2HZVA 1PSDA 4HHUA 2VDIA 3AOAA 1IBMJ 4LFCF 4WZMA 5HMYA 2BVZA 1PBAA 2HMIA 4K4SA 4BCAA 1RWXB 1LWEA 3B4DA 2XY5A 2PIIA 2YNFB 1UA1A 3WX4A 3KHGA 1FJGJ 4DCPB 1YJNS 3RR8A 5KFDA 2PD1A 2ROGA 2NUUG 1BGXT 1S1WA 2BACA 4ZPTR 4PXCA 4I67A 2E7VA 1FJ7A 3BPDA 1MG7A 3BH7B 3KG0A 2K7KA 1NK8A 3QAUA 2VC1A 3R2CJ 3GP9A 1X9WA 1FX2A 3EVMA 2QYGA 2AT1B 1WNEA 2RDDA 3W2VA 4KQZA 2CA9A 2R8KA 5D0RA 3JSMA 1KQKA 2R7RA 1M5OC 3IXQA 3W66A 1QDUB 1NJYA 1JJHA 1B99A 4ZVFA 2PI5A 4WWSA 1M90T 1X5SA 4Q7AA 2XLIA 4A48A 1RTHA 4OFZA 3T5KA 1YG0A 2Y8YA 1OQ3A 3KKFA 4DV7F 4JI1F 5D77A 2PC6A 4DX6A 2E5HA 3NBPA 1H3DA 2GA7A 1L3TA 2DKOB 4W4MA 4LF4F 3M6VA 2IC3B 3THTA 4NLVA 1HNVB 2O3DA 5L39A 3QGGA 3THVA 3DLEB 3ZTSA 4LMZA 1V5IB 3ETOA 4RW6B 3L4BC 3QO9B 2C1EB 2DRDA 3W1YC 2I2YA 1NJXA 1FD8A 2GX8A 4EMDA 1RT2A 1LW0B 2YKAA 1FTRA 1F1BB 4IRCA 1NK6A 3HM9A 3M32A 2EPIA 4JI7F 3HSDA 3PHTA 2IAJA 1GXTA 4CT8A 1SJFA 1WOOA 1QAIA 2CJBA 1VRUB 4ILMA 3POTB 1HHTP 1UPMB 4ECUA 2IY5B 3KWMA 1F9HA 4CQ1A 4B3RF 3OTOJ 2ROPA 2XS7A 1NJZA 3Q24A 1QJHA 4A8OA 5MAOA 3CJQA 4FYXB 4DR7F 2JEJA 2KVQE 3OSPA 2PMZD 4HDHA 3LTOA 2HRTA 3MTKA 5KOWA 1X4HA 2IJNA 2AU0A 4KHMA 1D9AA 1S49A 2VOPA 4C3LA 5LMNF 5IZHA 4LIRA 3C16B 1GMVA 2RDIA 1R7IA 2E66A 5EUHA 2XYPB 2CPJA 3IBCB 5IT0A 3CJ8A 1GTEA 1EP4A 4ZOSA 4XO0A 3FMBA 5HROB 3DRPA 4MH8A 2PO4A 1S79A 2HNDA 2YWHA 3FEYB 2YKMB 3DHXA 1KHWA 3Q23A 4WXWA 3M2VA 4MIAA 2CQCA 3QIPB 4KAIA 2KRRA 2ZH4A 2YX7A 2BMBA 4P9SA 2P8IA 3EPGA 3R6GB 4DV5F 3N4WA 5DDRC 2ZH6A 3FRZA 2HS0A 2ZE2A 3DOLB 4IH7A 2WSFC 1FXLA 1ZYQA 3I96A 2BOPA 2B7CB 2VG6A 3RW6A 4ZVOB 3QQCD 4Y65A 4ICLB 2ZEJA 3MUVP 3VAMA 2IM3A 3GV5B 1XMOJ 2GW8A 2VICA 3Q8YA 4OJHA 3A1YG 3MEGB 2BANB 1CJKA 1HBOB 3W5YA 4B02A 4DSJA 1ELOA 2B8PA 2DRAA 1SC3B 1HHSA 2QE5A 1ACMB 1FRIA 3FBCA 3FCWA 2MDAA 5D4OA 2OD4A 4B3SJ 3H2VE 5CZXA 1RHQB 4DPYA 3R5CA 3SCLE 2P2CB 4FF1A 4ZP7A 4F25A 3A8EA 2ALZA 3M8SA 1N8RT 1K0TA 2EK6A 1NHVA 5E7OB 3NXZA 3SYZA 1AROP 1HI8A 2LXUA 4XTTA 1SH3A 2MJUA 3IS9B 3TEHB 4I1TA 3M8WA 2OO4A 2IA0A 4B9SA 3IR5B 2OHDA 3ENQA 1SIWB 4IG0A 4LRAA 4XDDA 2CJ9A 1VC5A 4JOUA 3ITHA 3NS5A 3UDVA 4ZVEA 4C8KA 2DBBA 2HBZB 4ZLJA 4YP3A 4ES1A 1UPPA 4DV3F 4UW2A 4USWA 4KO0B 2HNZB 3VAKA 4WKYA 2DGTA 4UQTA 3OXFA 2EK1A 1GMWA 1LFWA 4YR0A 4DUYF 2MTLA 3UR0A 2IRUA 4WTYA 1XIQA 2VL1A 4AL5A 3KLEA 1EKSA 4DN0A 4DSIA 1Q81T 1T9UA 1VHFA 5DG9A 3BYPA 3DLHA 3G82B 1NH8A 1FE0A 2BQRA 2RHQB 4XK8C 4J9SA 4MK8A 2ZD1B 1VRTB 2UXBJ 2OEJA 1EZZB 2Y8WA 1T03B 1FE4A 3MEEA 2YH0A 2ZNYA 2M52A 3EGWB 1U4BA 3CULA 2ZZMA 1FTCA 4EGLA 4ECVA 4LSLB 4ES3A 4DV6J 4RUHA 5DQHA 2ZH8A 2DGSA 2IA6A 4PEOA 1TL3A 4UQGA 3ENAA 1WKLA 2LFVA 1H2UX 1N54B 2DXDA 3J81j 5DRKA 4NLQA 1YLXA 4GO5X 3MMAB 3DDNA 4URQU 2F8EX 3NCQA 2VJUA 2GHPA 2MY8A 3W2WA 4ZVHA 3BGOP 3LGNA 1VQ5S 2BJ7A 2HFNA 4JV2A 1EAYC 3H4BA 3MM6A 2V9WA 4OHZA 1UEKA 1TP7A 2GQ2A 1LWFB 1DBDA 4OZJA 3R97A 3WBZA 2XMKA 4I2PA 4JI2J 2YNHB 1U1RA 2ZH5A 2H4WB 1VQLS 5T7LA 4YFUA 4AUKA 2G1HA 3VAHA 3DRRA 1FERA 2OPPB 2DHSA 2MZRA 2CIMA 2VV5A 4PG5A 5BXIA 1U2CA 1NZ8A 1UKUA 4C0BA 3CJRA 4TNOA 2JC0A 5DM6Q 1UA0A 1R0CB 1DAXA 2MQMA 3W65A 3OW2R 3SSQA 9ATCB 2KO1A 2CPFA 1K9MT 3R1HA 4DPUA 4JI6F 2DO0A 2DHAA 3QJPA 4RR5A 1NM2A 4U7CA 1IUJA 5LSLA 3D68A 2VQEF 1DY3A 4RNFA 3UNGC 3PW0A 2R7WA 1H98A 4WP9A 4LIWA 3PVXA 2OI2A 3NL0A 5CYMB 1DZ5A 2WBMA 1FRJA 3OLAA 1D09B 2XTJP 5IXUA 2YNGB 4Q8FA 3HT0A 1X60A 5GAHU 3NGDA 5L1IA 4QYZJ 4JI8F 4NLRA 1KQFB 3Q8SB 2AYGA 1N56A 3OV7A 3V6HA 1Q53A 1YRTA 4F7VA 1YTYA 3QYYA 4P7VA 2IM1A 1O5JA 4DX7A 4ZVQB 4B3MJ 4NEYA 1XK8A 1FXDA 5IWAJ 3E8OA 1T0TV 5HI7A 1Y7PA 2X1AA 1VC0A 4LF8F 5DDQC 3AT1B 4DPOA 1CJUA 2FJXA 1S6PB 1R8HA 3TAQA 1F6TA 2K7JA 3DFEA 2HZCA 2GQCA 2E7XA 4DV2F 3Q0AA 2E9ZA 3EZOA 3CO0P 3SSSA 3I9V9 3A8IA 2BJ9A 1EETB 1TL7B 4J9VA 1Q8KA 1YVFA 1IQZA 1VQYA 1RTDB 2DEIA 2L9NA 2PMWA 5K8MA 2HZAA 3LO3A 4FBTA 1CSJA 4TU8A 2W9CA 3Q8VA 5FD1A 1KOHA 4OX7A 2KG0A 3IBWA 2YBVA 7FDRA 4Y00A 4DJBA 2M2BA 3MCOA 2V50A 1SJ3P 4B9VA 2Y9HA 2M5YA 1HLWA 1ZM2A 3VAGA 1HBNA 4JV5F 3I82A 3H4DA 1TKTB 1RDRA 1U1KA 2RKIB 1U6ZA 1RWOB 4KJIA 4B17A 5ETOA 4NXMF 2KXHA 1RWKB 2X51A 4DXLA 5CYQB 5KG7A 1IR1A 4NCGB 4AFFA 4UT4A 3LPEA 3I5AA 4BC9A 2OJ3A 3HHLC 2FPHX 1B4SA 2BKPA 2FHJA 2NXCA 2AEFA 3DRSA 4ECYA 4HL9A 1RT4A 2WCXA 2Z2MA 2BJ8A 3CD5A 2C2NA 1JB0C 2U2FA 3KLGB 2YWGA 1T8EA 3LALA 4IFYA 1Q82T 3R7SB 1RBLA 2D7SA 4K7QA 4GKJJ 3B54A 7FD1A 3TI0A 5KFUA 2PEHA 1BQMB 2Z4PA 4O0NA 4YB1P 3RRKA 1HBUB 5A8WB 1Y11A 3T1HF 2XEXA 4HH1A 4O3QA 2GGPA 2R7QA 2XG8A 4KE5A 3LGMA 2Y1IA 2CQDA 3KHRA 2PFFB 2CRLA 4DEZA 1TZ0A 5A2QY 1IM6A 1WC4A 4DF8A 3VQTA 1WUUA 2BKOA 5HP1A 3BB5A 1SVDA 4G3IA 3T1YF 4YMEA 2KH9A 1GAOA 1F2GA 2HS3A 1XMOF 3KK1B 1Y5IB 2BJDA 3C15A 3T19A 4RO0A 1HPZA 5FDLB 3MCSA 4AD6A 3V6KA 4FXWA 3PACA 4DN9A 4J9PA 3OJSA 5IT9Y 4K4WA 4ATNA 3G9CA 2GAHC 5A8RA 4B3SF 4ZCMA 3DM2B 2X1GA 1UVJA 2CPXA 1JXVA 3AQOA 1XNQJ 4LT6A 3C19A 3PFOA 4UOFA 1VR6A 2LA6A 3T5LA 1Q86T 2UU9F 1HYSB 1JX4A 1ULRA 3BQ2A 3B82A 1VQ8S 4CI0B 2BM1A 2E1CA 1DQ8A 5HMZA 5KFEA 5LOQA 4ALZA 1JKHA 1RZMA 2DNMA 4NLSA 4WFAQ 3CUNA 3MPYA 1KS2A 2GFFA 3GFYA 1X0FA 1VK8A 4DX8H 2ACMA 1FT8A 4C11B 5BJRA 3MPVA 1J27A 1IKYB 2ADCA 3IN5A 4LBHA 3DYAB 1D9DA 5J1EB 4DZ6A 3SV4A 4FXDA 5IV3A 2VONA 3JSBA 4LRFA 2A2DA 3PRBA 3S6EA 3TZWA 3FGVA 3LH2S 5HJYA 2VPZB 3H25A 2ZM6J 4RW4A 5HMWA 1IVZA 1U2RA 1CLFA 1DARA 3VGTA 3KG1A 5HBMB 1FJCA 3QT8A 3BN4A 3DOKA 2W01A 1ZOTA 3GONA 4CO3A 4Z7CA 1UTAA 1TV6A 3E01B 4AQYJ 4H54A 3H98A 1FO1A 1N6QA 1HKAA 1TFYA 1QTNB 1VBXA 2YPZA 3DLGA 1D1UA 1HW8A 5L9XA 2VJVA 5CD4A 2DD8S 1X4BA 2LA4A 3BR8A 2BM0A 4DR1J 1T05B 2YWFA 3AOBA 1RCOB 5L38A 4FF3A 1JJ4A 4J5OA 2OEMA 2CQ2A 2PSZA 4OLOA 3BGUA 4RUBA 2RB7A 4R0JA 3QT6A 2Y3YA 2XY7A 2EFGA 2NREA 2I1RA 5E5NA 1UFKA 1WKJA 2B8QA 4ZCKA 2CJQA 1IBCB 5KFYA 2C2MB 1GTHA 5FIIA 3A3PB 3J81U 2EVZA 1TKZB 2ZBCA 2XMUA 5J2PA 3CW2C 2CPIA 3RU0A 1MMDA 3T1AA 2A6OA 1OSCA 5DG8A 2E5JA 2CWXA 4FYDA 4MMOA 3ZZPA 1T3NA 4RJVA 3OTCA 1G4CA 1IKWB 2FJDB 5J2QA 5H9FK 3KK3B 5KOXA 3UVJA 4LR7A 1JLEB 1RGVA 3ZO7A 3QNWB 3J7AN 4LF6F 4YOEA 2WZ1A 1MU2A 1UWBA 2CJKA 4RPFA 5U47A 2AYMA 4DLGA 2LKZA 2QL5B 4OLPA 3KFWX 1OPZA 4J9KA 4JV0A 1NKBA 3UN5A 4KFBA 2AZ1A 2I9SA 1LWCB 3CC7S 3PEJA 2KFZA 2UUTA 2JLFA 4DBQA 2G13A 4MIBA 3D4JA 1WF2A 3R3TA 4NLUA 4OI1A 4H4KC 4Q2LA 5L1LA 2RIJA 4FN5A 1JLBA 3RBEA 4X4NA 4QBUA 3R7NB 3D3CJ 3BEGB 3BZQA 3PRDA 4MIWA 2HNYB 4KHPF 3NGRA 3MM7B 2KM8C 4JYAJ 4B3MF 2HBYB 3DRYA 2FVPA 2JFDA 1N5YB 4ED6A 2DCLA 1B0PA 5JVGQ 2V2QA 2EXUA 4RNNA 3QLHA 3GV8B 1NZAA 3PKMA 2HAFA 1QD1A 2AWZA 1UVMA 2IM0A 1B64A 1SKWA 3UD3P 4X62F 2R8HA 2VKRA 4PXBA 3T3FA 3BR9A 4PG7A 2BRKA 1Y4ZB 1LWXA 2V4RA 1L3SA 4E0DA 3NGSA 2XI2A 3DCAA 5C42A 3M30A 1RUSA 4V19X 1HQEB 1WSVA 4L3KA 2QA4G 5F8MA 4MYUA 2C3OA 1R6VA 4P52A 5B0GA 4U7UD 1TUWA 4Y34A 4BLGA 2RQKA 1C1CA 3JXOA 5J2NB 1DQAA 2KZMA 4UOGA 4O3NA 3F44A 1M5SA 4FNHA 2FD2A 3ZTPA 2YNIB 2RUSA 2QLJB 1X4AA 3BBFA 5KFIA 4IO9Q 3Q8RB 3MEDA 2FZCB 3OSNA 4IDKA 4ZIVA 4JUZA 5KFGA 2QX0A 2MHNA 1XN9A 2IVMA 1K73T 2DNLA 1RT6A 4G1QA 3AD9C 2DVIA 3AB4B 4RW9A 2CVEA 3WC2A 4LFAJ 3C14A 2V5HG 3HZGA 1LW2A 4MK9A 2XHWA 3I31A 3KOAA 2I38A 4OHYA 1FRMA 2YWEA 3PIOQ 5KTQA 2JVRA 1S4FA 3BDEA 2E5LJ 1Q5VA 2JLEA 2FUG9 2XZWA 4OYOA 2Z2LA 4OZ5A 4OZ1A 3G6XA 2LXIA 4OZ0A 2RF2A 2J7KA 1FA0A 3KJVA 3GIKA 5DS7A 2R2RA 1ZETA 4RNMA 4R5PB 4QQBA 2APOA 4FVMA 1LFPA 4NMLA 3R6LB 5IS2A 3A8KA 4QU7A 3SXLA 1FVSA 2FJBB 1IBKJ 4RBUA 4ZPVR 3MI7X 1S5ZA 2HHTA 1FRLA 1G2EA 2HRUA 2M88A 1YJTA 2ZJRQ 2EWHA 3DGPB 1REGX 2EBGA 3L3CA 1KD1T 5ETRA 4KGMA 4A8YA 5GMEA 3VTIA 1Q0NA 4NE9C 4M5JA 3FQKA 1T3OA 3AJ2A 4EBCA 2FGOA 1FDAA 5GAGU 1VQOS 2HBQB 2ZHOA 2DHXA 2HK2A 4CLKA 4EUVA 3BGRA 4CM0A 4MFBA 2BR0A 3CCTA 1JQGA 5F8NA 1OY6A 3DN9A 3F56A 4C0OC 3EZUA 3LQVA 2V4JA 1CJTB 3CJ0A 1YX2A 2HAIA 2J9CA 3FSIA 4J9RA 4P71A 4LFBJ 1ICEB 2HVZA 1S9GA 3M8YA 4HH0A 1REVB 4TN2A 2C22A 2VFVA 1N88A 2P6TA 5I4MA 3AH6A 5J1NA 4DSKA 2ZM6F 1NK9A 2XY6A 4G1PA 1U0HA 3CCMS 1PC4A 1CJVB 1ZZFA 3B4MA 4TVAB 3KHLA 4C2MA 2KJVA 4QCLA 4A4JA 5J2MB 2ZVSA 4KC5A 3PHEA 1WWHA 4CLLA 5I3UA 3TARA 2BDPA 3OUYB 1XTZA 4MT1A 1ZAWA 2LQ8A 2C2KB 3H42A 1U1NA 4PXEA 5M2UA 4R0EA 3PFEA 3R5GA 1UEUA 3G86A 2KYXA 2KHCA 3NNCA 2BABA 2RH3A 3NRBA 4ECRA 2PT0A 2Y1LB 5F3ZA 3GIRA 5MLCV 1M5KC 2GIQA 5IQQA 1XMBA 1WG4A 4ZS6A 1DFDA 1J2VA 1S1XB 2HHVA 3D1OA 2DR9A 2YPYA 2DITA 4DUZJ 1OSDA 4TLRA 3JB9k 4ZN3A 2DPJA 2B9WA 2MQ8A 1VQ7S 1M5HA 4PQUA 3FVYA 4IR1A 2FZKB 5IOLA 3C6TA 4WYWA 3E2EA 1KHVA 3I0SB 4N56A 4P2SA 2OELA 3NS6A 1N52B 3H2UB 5CHCB 2E9TA 4URGA 5DQGA 4FZVA 3HVTA 2XLJA 3CD0A 2FJVA 1RWWB 2W4CA 3LWMA 3WDOA 3TOQA 4AT1B 4DL7A 3M7VA 2ZJQQ 3MD3A 2GVDB 3CT9A 4RUCA 1TKDA 1N36J 1HQUB 3CJ5A 1M1KT 3J7Z5 4NZ6A 1RHJB 4RL1A 2IMWP 3LANA 3GFHA 3TANA 2KJWA 1S6QA 5H9FJ 5IT4A 4X65F 5KFRA 4YS2A 3RB3A 3AODA 2ZWOA 2BBEA 3Q8UA 1TUVA 3GQCA 2VG7B 3Q89A 2C2EA 1DLOA 5GAEU 3CJ4A 1NK0A 2H54B 2JNJA 4CTAB 2LDIA 2ZFHA 1NH7A 1YHQS 3WC0A 2EG2A 3IWLA 2COLA 3OR1A 3GG0A 2XM3A 4OI3A 2AW0A 3L7UA 2W1BA 3QJJA 3LF0A 3QRPA 3ADAC 4JI5J 5GMDA 3HZEA 2F65A 3NP5A 5D0EA 3RYLA 2EFNA 1X8DA 2MQPA 4QYRA 2HMIB 1IWGA 3MAAA 3CD6S 1LWEB 2BQUA 3CJTA 3FFIA 3LA0A 2FVCA 5LT5A 2Q66A 2OFGX 4DPTA 3N6MA 4ZLNA 2D3OR 1QAYA 2P6SA 3GYXB 2XMMA 4YY3F 4KH1B 3TQEA 1CC8A 2PE8A 3HHLD 1X31C 1S1WB 5HANA 2JWNA 4QW9A 5F9NA 4O3SA 9RUBA 2FHKA 3EGNA 2NZCA 1Y10A 1S59A 1SQEA 4OI2A 3QRRA 3KK2A 5HJXA 2E1RA 3NNHA 3R1LA 3HK2A 2NQPA 3W2VB 2F63A 2MKCA 4CLUA 3JSMB 1FRHA 1Q7LB 3DU6A 5KG0A 2X3DA 3KLHA 2CXEA 3K5MA 4F4XA 2J7WA 4DFKA 3ET6A 3W61A 2J0SD 1N33F 1SUQA 1FCAA 2OTLS 1H2VZ 1HFEL 1RTHB 2VBWA 3PX6A 1HHQA 4OHVA 1FRXA 3P45B 4JBCA 4DR3F 3NBPB 2Y1JA 4GVBA 1MN7A 2AGPA 3MR7A 4DV4J 2QLWA 3D1QA 3OXGA 1VJQA 2C3PA 3M4XA 4WE1A 3GSIA 2NLWA 3FBBA 2NYIA 2IJRA 3NGKA 1SH2A 2MZQA 2C3UA 4JI0J 5H1SV 2J7UA 3OXLA 1HNWF 4P73A 1RT2B 3PR5B 1XR6A 2RSQA 1W7WA 2GO8A 4LFAF 4TYBA 1JNRB 4OYBA 3M32B 3NEKA 1S1VA 4OYZA 3W64A 5B0DA 1KVIA 3NAHA 2IAJB 2AYBA 1OO0B 1WC6A 5E33A 4GC7A 4DV0F 5FLXY 3DDKA 4B9NA 2UUAJ 1JMTA 4LQ9A 3N5BA 4KB7A 5D3GA 1FXRA 2DIUA 2UV8A 4ECSA 2E5LF 2F8MA 1RADB 1NU4A 2HHSA 2AEMA 3VZIA 5KFZA 2CPEA 1UJ4A 1G1XA 2VFTA 4ZPWR 1KNZA 2QA4S 5KT2A 5M2RA 2PEBA 2JC1A 4X84A 4ELUA 2RJZA 4ANCA 3US5A 4F36A 4ECZA 4CLSA 3EWGA 1RLDA 4LSZB 1ROFA 2R4FA 2UXDF 4YB7A 4B3TF 3NMRA 1EP4B 4CP5A 1BXNA 4I6YA 3DRPB 3Q83A 3CCUS 2HNDB 4NLYA 4NA2A 2PN6A 1U6BA 2XS2A 3VGUA 4QR1A 1NPKA 2L9DA 1UMJA 2CJYB 2ACYA 1O8BA 3RAQA 4K5SA 2RUGA 1B0TA 3W7BA 2KT3A 4ITSA 4OI0A 5CD4H 4QJVA 3D67A 1AXQA 1C0TA 2VD3A 1ZM4A 1VQMS 1TK8A 3D6FB 1NK7A 4YDXA 2ZE2B 4WU2A 4EU0A 1WEXA 3OL6A 1RU2A 1NMEB 2FLPA 3C3LA 2XNQA 2VG6B 5KFXA 4FYWB 4I56A 5ITHA 2EFOA 5F3TA 5F0UA 4KTQA 2ZKTA 4K4XA 4TYAA 4F8RA 1NB2A 4LF5J 1C0UA 2KXNB 2OIHA 5G4DA 2AJ2A 1CJKB 1QUVA 2UVWA 2W2MP 1W2IA 1M5PC 4F4AA 5KG5A 1IKVA 2FY8A 2ZJPQ 1QVFR 3W3SA 3EVOA 2OMLA 3SCJE 4USUA 5HROA 2EC2A 1QLNA 4ZVTB 1PAEX 1AUSL 2CQPA 1UJ6A 2BRLA 2CNLB 1HBMA 2Q79A 2RQ4A 3UN2A 3UFCX 4KPYA 1PCAA 2W8LA 4CO0A 2QT7A 3V2UC 4N47A 4IG0B 1FDDA 2B43A 2GO9A 2HIQA 2OTJS 4ANDA 3ITHB 4CCHA 2HK3A 3MM9B 4P10A 4CLYA 2WVFA 3MPDA 1YRUA 1TFWA 3QIDA 4IO1A 3UCUP 3M8PA 4YR3A 4JI3J 4ENOA 4DSFA 4A46A 1S9EA 3MCMA 2HVDA 2DNKA 1VDHA 4RW7A 3DNCA 2Q3PA 2VBZA 4YB6A 3KUEA 2E7WA 2W4PA 3KLEB 2ZHAA 2N3LA 1LEOA 5DZ7A 3CNQP 4CRJA 3W9IA 2GS8A 4C8LA 1XJWB 5DG7A 2HVHA 5EDWA 3KHHA 5HQMA 3OBIA 1XC9A 1AUDA 4QOTA 2XWYA 3MEEB 2XCAA 4A47A 2OFHX 3LUYA 2JL9A 3CJ2A 1F60B 3QGIA 1U48A 3WHIA 2KXFA 2VIHA 2YKNA 4DL3A 5AXMA 2OUGA 3CDBA 4QWAA 3RR7A 1N36F 4KBIA 2FVQA 3AAWB 1N0VC 4U96A 1NSKL 1TL3B 1YJVA 2LCWA 1RP5A 4TQRA 4YHHF 3R8YA 1FHTA 5KFTA 4IFVA 4DR6F 4PXDA 3BBCA 3PW2A 2AYEA 2F1FA 2DGXA 3P8BB 3J80Y 4OX8A 3W2WB 3CVKA 1HARA 3MECA 5B0CA 2LVWA 5HVHA 1CQNA 3RAXA 4HHJA 5DJBA 3MM6B 2J9DA 5EN1A 4DV1F 1H2TZ 5ETSA 3TZYA 4I2PB 2ZHBA 2DNZA 5T7LB 3TVKA 3PY8A 5DQIA 3V6DA 3DRRB 4ER8A 3K5OA 4J7CA 1LK7A 4LRBA 1FF2A 4R25A 2H1YA 1WHYA 4QWCA 3OTDA 4F4YA 3HF5A 2R9LA 3A3OB 3QAEA 1VRQC 3HXMA 4PRFA 2JJ4D 2AJ4A 1IKXA 2HHPA 1IXKA 3AFGA 3KG4A 2D3ZA 2K06A 3MPUB 4USMA 5GMKa 5D4NA 1JLCA 4K2JA 7AT1B 1YBTA 1SBRA 2J6TA 4ECTA 2QC3A 4DL0C 2O67A 5L8RC 1R8PA 2B4OA 2DNOA 4A8MP 5CQGA 2VFRA 3JTNA 1T9YA 2F5GA 2XCPA 1S0NA 2CDQA 2IBKA 2XZTB 1X4EA 2VQFJ 2QGFB 2CG4A 4O44A 5HSPA 3RRGA 4IH6A 4CLTA 1SL1A 1S0OA 1WSRA 3SQGA 2D3O1 1WOSA 2YH1A 3D0HE 4DR2J 4O3RA 4DFMA 4DF4A 1CJUB 4C6AA 4NYPA 2EEYA 4NCBA 2IJFA 4ETXA 4ZP9A 2R7VA 3CCLS 2Z8QA 3TR5A 3KMSA 4F4KA 5HQ8A 2HWHA 4C8OA 4C8YA 5AXKA 2K3KA 1Y5LB 2E44A 1PYOB 1UFLA 1AYEA 2JDJA 2VASA 3K8WA 3G87A 2UVVA 2W9CB 4OJ3A 1QAXA 4NLDA 1S7HA 3BKFA 2FLOA 5KFAA 1VS3A 4NZ0A 2FVSA 2VFUA 4ZPCA 4J9NA 4AYBD 4OHWA 1HBNB 3THPA 2H9ZA 3BSAA 3QSIA 3OFGA 1R27B 1B0VA 3ZZOA 2AJ0A 1U1MA 2P5VA 1Q79A 4NLXA 1NHKL 3UCGA 4M5MA 4IOCQ 1BE4A 2C2OB 2LU2A 2DCUB 2R8JA 2HFZA 3TA2A 2QRRA 3MDFA 4L6V3 4WXOA 2MPUA 1NKCA 1FKPB 4N8NA 3D9BA 3DRSB 3FCVA 3E3XA 1RT4B 3PJWA 2IDLA 4CZCA 5C2CA 1NSQA 4N5SA 3IG1A 1APSA 1U6FA 4IFYB 2VG5A 1JJCB 3AXMA 2XSFA 2DH8A 4WIQA 3AJ1A 5A0YA 3UN3A 1TL1A 2GVZA 1RTDA 1U1PA 1UZHA 4FKXA 4O4GA 2NSBA 2QA2A 3DDIA 3H90A 4NMXA 3ZC4A 1MROA 4PG8A 4OYAA 1L5UA 3UD5A 4K2XA 2GGPB 2FTRA 2KN4A 2L3MA 2BV3A 1VFJA 3CCZA 4W90B 2AJQA 2B51A 3ONQA 2RRNA 1SL0A 2VPYB 2HQ3A 1O51A 2RAQA 2EFVA 2HEKA 4NXNF 2ABYA 4HLBA 5HP1B 2RS8A 3GFXA 3FEZA 2HHWA 3MEKA 5BR8J 4LF5F 1N34F 2VB6A 2VPWB 1VHIA 5B09A 2W9BA 2HKEA 1N5QA 3C15B 1GXUA 3TVZA 5JXSA 1HPZB 3RBZA 3DKDA 2F3JA 1VQ6S 3CCES 1KRPA 4DPWA 4TY8A 3RRHA 4USVA 4DR5J 5KFJA 1X9MA 2HHHJ 5A8RB 2V8PA 5LM7E 3J81Y 4K5RA 2OAUA 3K59A 2ZUAA 3RG6A 1PIEA 2H4YB 3ZTOA 2ASYA 3GE9A 5F8HA 3KLFA 4UTGA 1RAGB 1J5EJ 1RTIA 5GADU 5KFHA 5E41A 4BWJA 3HMJG 2UUBJ 4NPOA 2KT2A 4MTPA 3ISZA 3SCKE 3QZ7A 3D3BJ 1RT1A 4R8UA 3MM8A 3GR0A 1AFJA 1JKHB 4KV8A 3EPIA 3M8QA 4ZN1A 1Q78A 4N77A 5F8JA 1Z4UA 5KG6A 3T5JA 2ZZNA 4HVZA 4IR9A 2FB0A 2IDEA 1FX4A 1NAQA 1AT1B 4M5IA 4HHHA 2LLZA 1T95A 3NLCA 1VQPS 1EQ0A 1UVNA 4C8MA 3KJFB 3L09A 3O6QA 2DEJA 4RW4B 4ILRA 3J7YI 4CH1A 1T11A 3R5DA 4LUBA 4K4TA 2FIUA 2O66A 1WD6A 5L9NA 2VA2A 3FK4A 3NOCA 1RKIA 2A10A 3D66A 1E6YB 4DMZA 4MYTA 1VGYA 1N5VA 2JFKA 3DOKB 4HT7A 2XQCA 3U1LA 1NPPA 3BPSP 1TKXA 3ZZZA 5HO4A 2QFJA 3LAMA 3UI3A 1G3OA 1TV6B 4OYWA 1S1UA 3W8PA 2GIRA 4F0HA 2XMAA 1N6QB 2FC8A 1AA1B 4LBPA 1JLFA 2GMJA 1VLOA 3DLGB 1N32J 1K0VA 2GV1A 4PKDB 5DLGA 4DL2A 2MHEA 4IOAQ 1H74A 2GNKA 1JLQA 2XO6A 3SMZA 5IC6B 4JI4F 1K47A 1MN9A 2DR8A 3HT3A 1S97A 2N4DA 1TL5A 2V8VA 3IR6B 2AV5A 3G6YA 3HHLA 4CWBA 3VAFA 3OT9A 2H5IB 1F9EB 1PKUA 1RT7A 2GIFA 4QIGA 1EARA 3VZHA 2HFOA 2FY1A 4D3HA 1R0BG 3C66A 4B9TA 2F4VJ 4U8YA 2DISA 2D9PA 5HQLA 3MURP 1GH8A 5B0BA 1RI7A 5K5MA 1FJEB 3O2IA 4LBIA 3GYNA 1WACA 1HMVA 5JUMA 1KDNA 1CEZA 2A18A 5J2PB 1SB6A 2BQ3A 2GHVC 3H2LA 3K5PA 2XWXA 4ZP6A 5KFWA 3G6ES 3TX0A 3V6JA 2JHEA 5KT3A 5J1PA 5J2QB 1HNZJ 4CO5A 4X66F 1H0HB 1BHNA 3OFFA 1D8YA 3UVJB 4M8LA 5DDPC 1ZA2B 2A3JA 2HLUA 1HNIA 2OPRA 2RS2A 3RGIA 3PX0A 2CVIA 2DH9A 1MU2B 1UWBB 4KKOA 3G8QA 2KHDA 3EE3A 2DNQA 3CB4A 5A2QU 3BSOA 4A8FA 2CPDA 4N76A 4HDGA 1IQTA 4LREA 4UY8T 1AZSA 4ZLLA 4PABA 5K8PA 2UUCJ 2R7OA 4KFBB 2VBXA 4EYIB 1S10A 1P27B 2HG4A 5KG4A 3GJRB 3ULHA 4NYZA 1I94J 4URSA 5K14A 3HKWA 1ZZNA 4ZITA 4PCQA 4UF4A 2I5JA 3GB0A 4NRUA 5IT9U 2VQFF 1JLBB 4CLZA 4Q0BA 1FI4A 4MK7A 1UW9A 3BQ1A 3DI6A 1F3FA 2V2KA 3I6PA 2QIFA 3HHKA 3TRGA 3PR4A 4DDFA 3N9UC 1URRA 1MSWD 4NLWA 1UETA 2G1DA 4LF7F 3V81A 1TL4A 8ATCB 3PO5A 4DR2F 4F26A 3QLHB 3K5NA 4OX9J 5E0OA 2QEXS 1S12A 4RBVA 4X4QA 2G2ZA 2HWIA 4HR2A 1JLEA 2YKOA 1YK9A 3B8HA 3CIMA 2OPSA 4KGVB 1RAHB 1MLAA 3LP0A 4LRCA 2VKZG 3BO3A 3T6BA 2D1CA 1GMWD 4K0KF 2VOOA 1YZ7A 5C42B 2NXNA 3M30B 3VV2B 2HPUA 1LOUA 2B6AA 2J6SA 1F5AA 2HFUA 4M5DA 4Y2MA 2JSXA 3O3LA 3IM9A 2DHHA 3EXYA 1EHWA 3GZ7A 2DNPA 3R9LA 4D3GA 1LXJA 4ELVA 2W2PP 1S72S 4A8WA 2N7YA 2W7AA 1WC5A 1C1CB 4ES2A 5I3PA 4DZDA 3IGNA 5SUHA 2WSEC 2QTWA 1JIHA 4J9UE 1YGYA 4EEYA 3IRWP 5THWA 4H4OA 2DT9A 4AL6A 5H9EJ 3H8YA 2ZOGA 2G0IA 3IGVA 3MEDB 1Y3JA 3CCSS 1YZ6A 1TQLA 4IDKB 2GZOA 2V9KA 1W2BR 2O1PA 2E1PA 1S77D 2QL7B 1X7VA 2HFVA 2CADA 2YWWA 3M1VA 4ERDA 4ZVPB 3GJSB 1RT6B 4G1QB 1P8GA 3S1TA 3TUPA 2B4UA 1W25A 4OI6A 2Z58B 4P6QA 4RW9B 1FEEA 4P2MA 3C14B 5KG2A 4CLFA 2QMUB 1ZPWX 4RBTA 1LW2B 3C8YA 3D0IE 3MOJB 3OHAA 2KKHA 3T6JA 2UV8G 2HVEA 4ZJLA 2QLBB 4I7FA 1C1BB 5LMUF 2L48A 1NNDA 1KC8T 4X4SA 2CZ9A 2VU5A 2DR7A 1R43A 3FDSA 1S4EA 2RNEA 2ILYA 1NJWA 1IBMF 2RF2B 1UFWA 5L46A 3KJVB 2UP1A 3MAHA 4CLWA 5D0GA 3EMTA 1DTTA 2DH7A 2VA3A 4KIAA 2A1BA 1FJGF 4WTOB 3V4MA 1QVGR 3ZNJ1 1WTFA 4DV7J 4JI1J 4RW8A 2MLXA 3FBEA 1CG2A 2XO7A 4LVNP 3SV3A 2IBOA 3SDEA 3TJ8A 3DHWC 2HHHF 6FDRA 3QATA 4ZPBA 4YR2A 3RTVA 1SPBP 3UW1A 4TLQA 3M9NB 3BF4A 1YI2S 4H4KA 1OJ4A 2W9AA 2AJFE 2DTJA 2ZWPA 3NS7B 4CH0S 3DLKA 2F9DA 3QSYB 2MZSA 2RMLA 2UUBF 3SIPB 1RCXB 2RE1A 3AXKA 3BGRB 4JI7J 1RSCA 2LECA 3MR5A 4MFBB 1MMNA 4N8OA 1VBKA 2VUGA 1WI6A 1CBKA 2B5JA 1K1SA 2DYAA 5KG3A 4B9UA 1UW4A 2ASJA 5HLFA 2V4JB 4I2QA 2MXYA 3GFZA 2CZ4A 4CYUA 1DJ0A 3HFVA 1NO8A 3FSYA 2ZH2A 1S9GB 3BKTA 2LDYA 3P3DA 3OFEA 1X9SA 1U0HB 2BXJA 4HTIA 4USJC 5C25A 2MQOA 2AKWB 3O8WA 2IMOA 5IFMA 3OD2A 3MTJA 5I3UB 2V94A 1RHMB 5JVHQ 4DL4A 1ZTTA 5GAGI 5HVGA 3D6HB 4ECQA 1PG5B 2NR0A 4F4ZA 1KEKA 4LF2A 3OVBA 2AEJA 1EB0A 1TVRB 2N82B 3GPAA 3OTOF 1R0AA 2B9XA 2Q43A 3KMQA 1WEYA 1UP1A 4PWDA 1UCNA 4S0MA 1X0PA 3T9ZA 1NLKL 1YJRA 3MUTP 3JTOA 4QPTA 1YQHA 1RT3A 1LQ9A 2WRMA 2CQ1A 3PJXA 3N79A 4DFJA 4PZVA 3W9HA 3R5JB 4PQUB 1AW0A 1YKWA 2FHJD 3LP2A 4RWWA 2Z2ZA 3C6TB 1RWPB 2M8HA 1M1HA 2PA3A 2JOQA 3CD7A 4F50A 2AZ3A 1SC4B 4LRDA 1LXNA 1MWQA 5IM0A 4B3OA 3BSCA 2NZ4A 3WQPA 3LP1A 3HVTB 3MR3A 3ZXWA 1F0XA 4WFZA 4WIIA 4RUAA 4I0WA 3GV7B 3MM5A 1A7GE 1Q1KA 1ZM9A 2XS5A 4M94A 1YJWS 1RB0A 3ZZTA 3T41A 2KL8A 4QW8A 4KHRA 1S6QB 3IP0A 2J5AA 2R3VA 4QWEA 3QT7A 1U49A 1RTJB 1YIJS 3TO8A 4F02A 2YX1A 3I0RB 2MGZA 3TYTA 4BS2A 2QMXA 4HACA 2GJIA 1VIOA 2K8GA 2ATLA 1DLOB 4DUTA 1KFSA 2DGOA 4M5KA 2UUCF 2LP4A 1HWIA 4CNZA 1UVLA 2VF3A 3TW0A 4U8VA 3J7YU 1P9YA 4OX6A 2HHXA 4E8UA 5DM7Q 4TY9A 3OR1B 1KLNA 4AE5A 3MOZA 4DSLA 1BQXA 1X4FA 2POKA 3GTYX 2YQ1A 1JLGA 2VH7A 5IC4B 3HSJA 3MAAB 2DHGA 2GJFA 1RT5A 4IOBA 3FFIB 3KLVA 1FFGB 1URNA 4DS4A 1CULA 3EM1A 4OX9F 4DPXA 1E6VB 3GILA 2HGMA 1FKOA 4TU7A 3IAM9 3RUBL 3AB2B 4Z37A 1KQGB 1NK5A 2ZBRA 4Q45A 3H5SA 2RVJA 3OL9A 4X4TA 4WKRA 2MKYA 1JNZB 5GAEI 4DSEA 3CEDA 3KK2B 4P72A 2HIYA 3EDRB 1X4DA 2FJAB 1QTMA 2ZITA 2ILZA 1GX5A 4ZLPA 3MMBA 3SBMA 4FS1A 4O0IA 4FDFA 4P75A 2XGQA 1ZM3A 5KFLA 1U1LA 5KFBA 5BYQA 3KLHB 4DU8A 2UXBF 4PWUA 3ET6B 3H5YA 2V68A 1SUQB 4FPIA 4J9QA 1SH0A 4M5NA 3D2WA 2V2ZA 3TAMB 1J5OA 3VCDA 1NDCA 4CDIA 1T9XA 2KFNA 4NZ7A 2ROEA 5C24A 4WPAA 2JLGA 3PEHA 4GVBB 3QZ8A 3HHEA 2DR5A 4OZ3A 4DV6F 3NCPA 1RA7A 2BW7A 3MZIA 4NLOA 2MY7A 4DOZA 3C46A 1R8AA 1TUGB 1T94A 4WE1B 2QSWA 3KJQB 4ZJQA 3ZTQA 5C7PA 4JI6J 1PGZA 2VBYA 3BDPA 1RAAB 5D6GA 1Q8BA 4ZDNA 3CJSA 1FWLA 2VQEJ 5HL7Q 1FDNA 3JQMA 4J91A 2X7IA 4IQMA 1JJ2R 4GVLA 4RNOA 3JQJA 3FKBA 1GT8A 3TX8A 4ZPAA 3ZFVA 1TR0A 1S1VB 4PYDA 2AJ1A 1BUXA 2X1BA 4Z7YA 4ED5A 4JI2F 4QYZK 3VQSA 3C6UA 1WTBA 2Y1RI 3IAS9 4IQXA 2BE7D 4HEA9 1WG5A 1M1GA 2L08A 5D3GB 4AXJA 5ETNA 2DGVA 4O23A 4FYVB 4JI8J 2IYIA 2EFQA 4WFNQ 3HD1A 2G0CA 1KVKA 3KUGA 2BOAA 4PPDA 5K8NA 1SC6A 1HA1A 1XR5A 3A4TA 1UWAA 3VGVA 4KY3A 1OMSA 2WVBA 1XNRJ 4ECWA 4LF8J 2G9OA 1D3WA 4M5HA 3EDQB 1DRZA 1RWUA 2OP5A 1WF1A 1V3SA 3RJMB 4DV2J 1VQSA 1VIXA 1S6OA 2CAJA 3AQPA 2OMOA 2PDAA 1LKZA 2DIVA 2FLLA 2O01C 3TUIC 4OYXA 2H3EB 2OPQA 2XSJA 3UDLA 2NXEA 2ZNZA 2HQGA 1PYTA 3FQLA 1C0TB 2V34A 4K4UA 1SJ4P 2V69A 1RHUB 2Z56B 2WOMA 4Q43A 1EIYB 1EQMA 3HFKA 3TJ9A 2WW8A 3PKYA 1R3NA 2E1MC 4GC6A 2XMVA 2QSFA 2UZAA 4ED8A 1WDDA 3MUMP 4JV5J 5L1KA 3PCOB 2CQIA 5IWAF 3UPFA 3KYLA 1Q7YT 1C0UB 2P9GA 4YB5A 4DLEA 4WK1A 1DTQA 4NXMJ 2CQHA 1RBAA 2DGQA 3MWBA 1OYEA 4TQSA 3E51A 5BYRA 2V63A 1BQNA 2CQGA 4M63A 2YKPA 4ZPDA 1SV5A 4K8RA 4WP8A 2MB0B 2X3GA 5CXTA 1IKVB 2HHQA 1S1TA 4DR4J 1NUEA 1HWKA 1R89A 4DS5A 4C9DA 4CNYA 5ETPA 1JLAA 3FSXA 1SIZA 1HBMB 4MKAA 3BBBA 3TA0A 1FK9A 1U24A 4F2RA 3PYEA 5LSOA 4FPRA 2BE2A 5L1JA 5I3QA 1ZS6A 2F4FA 3T1HJ 4ZIWA 2JEIA 1D8ZA 3ILJA 3D54A 2QMWA 5BYSA 3M8PB 2G2YA 1ITPA 1Q8LA 5CA5A 2IRYA 3UR3C 3DMJB 1S9EB 3OLBA 4Y2CA 3SI8A 3DLLQ 1HD0A 4RW7B 2HQDA 3T1YJ 4Q2MA 3QWPA 3CCJS 5AE2A 2CNNB 3IMQJ 2W8KA 3M6UA 3PO4A 3QBCA 3HCXA 1SC1B 4ZVGA 4FXVA 4OYMA 5CH7B 3AA8A 3L7OA 4K4VA 3TA1A 2BW2A 3PG9A 2QA1A 4GKJF 4K59A 1KTQA 4RKUC 4EO6A 4IRDA 4ZHRA 1T9TA 1NBEB 1VQ4S 1B7FA 3HJFA 3NGTA 1UVIA 3HHNB 3DXBA 1WORA 4USIA 4MKYA 2YKNB 1S0VA 2UU9J 4P2FA 3BH6B 2F40A 4V19J 5KAKA 5FLXU 3PYGA 3BQ0A 1V9OA 2FJWA 4F04B 4IFVB 1QE1A 4NI2A 5F8GA 4LR8A 2N7CA 3MM9A 3SSRA 3OJUA 2F7VA 3MECB 5G0RA 4RU2A 4GRSA 4NLTA 2GJ2A 2ZBQA 3FRYA 4HT5A 1QUPA 5A6WA 4K4YA 2MMYA 1TAUA 4WYLA 3BS9A 3A12A 2LEBA 3PRVA 3TZZA 4CO4A 1EJ7L 2M7SA 1RBOB 1DQ9A 1X5TA 1KLMA 1WHXA 5RUBA 1XNQF 1PO6A 3V6DB 2DB1A 3VGSA 2YKQA 4A8QA 4C8NA 4NWBA 2QG9B 2J8SA 5D15A 3GMGA 5DO2A 3MMCA 1MNEA 2W25A 4I6AA 2P9EA 1XWLA 1IR0A 3PM9A 3QFWA 1SXLA 1NCLA 3PZPA 1IKXB 1Z2LA 2PI4A 3F73A 3MFIA 5D0HA 2ZUGA 2NCKL 4B08A 1R8BA 3OR2A 3V4IA 3CMES 1JLCB 3CIZA 4C0HA 1GX6A 3DOMA 2JX2A 5GVQA 3KLIA 5SZTA 2V67A 2BX6A 3OL7A 5KT4A 4EFAC 4H4MA 2RU9A 2XLKA 1HD1A 4PUOA 1Y3KA 3UDCA 2KG1A 5A8KA 4F3QA 2BE9B 1P1LA 2DNYA 3EX7B 2C2DA 4U9RA 4C48A 2EG1A 1IJFB 1X4CA 3AD7C 4O44B 3JYTB 1O0PA 3MFHA 5LSRA 2FYXA 1VLYA 3K89A 3SQGB 3MXHP 4AQYF 1U7LA 5I42A 3PXGa 1I3OB 1V3ZA 4NASA 4ED3A 4USHA 1Z1ZA 1HL6A 3K2YA 1Y0HA 4DWIA 3RZAA 4N41A 1DHMA 2V6AA 2C2ZB 1M5VC 3BO4A 2YY3A 3P5TL 4DR1F 1QM9A 3Q2SC 4U7UK 5ETQA 1OIAA 2LMIA 3VAIA 2KFYA 1FKAF 1BC6A 2MZJA 4LF6J 5KFQA 1Q5YA 4ZK7M 1V6HA 4J9MA 2DO4A 4WU3A 1D0EA 4JP8A 4GKKJ 8RUCA 2J76E 2YX4A 1Y9OA 3HLUA 1IJEB 1N0UA 4O4RA 5F9LA 4L73A 3I4HX 4MKVA 1VISA 2D9OA 2ZH3A 5DGBA 3AOCA 3CDAA 5M2PA 4QR2A 2J8AA 2NUHA 3M2UA 3MD1A 1JK9B 3CJKA 1UJ5A 3CWJA 3ZZUA 1VQNS 1AFIA 2WTFA 1RYRA 2WONA 4DG1A 3CPWR 4Q5VA 5AE3A 4Y2KA 1RWVB 4QIWD 4M95A 2LQBA 4KHPJ 3SCIE 2FHOB 2GAGC 2AQ4A 4X64J 5LJ3Y 1RQ0A 1WC0A 2W2QP 2XMWA 4NA1A 1XNRF 4MAKA 2PMHA 3I5BA 1RHRB 4RU9A 3GG1A 1SJ1A 4DQRA 3CJ3A 3X1LB 1PYSB 2DNHA 3M2RA 4WBFA 4X62J 2R7SA 4FS2A 4ZMMA 1RAEB 3IG1B 2GC8A 3J80U 2OSQA 2R2SA 2J0WA 1NK4A 2VG5B 3QFHA 2GHWA 3S8SA 5A0YB 3JQKA 3L9ZA 2E5IA 1TL1B 2GVZB 2GMHA 3MF5A 4IG3A 1CS4B 3IFEA 1FD2A 4O4GB 2I6WA 4BC7A 1MROB 4I64A 4HTJA 3ILOA 3NCRA 3OVAA 5DETA 4USTA 3GIMA 2DNNA 2BUNA 3HVRA 2XNRA 5K9FA 4DQPA 1Y00A 1PAUB 2WSCC 4F4WA 2WB1D 1HIYA 4PG6A 2CQBA 3ICLA 4EBEA 2UVRA 1RACB 4QWBA 4NEZA 4JYAF 3EVWA 2WVEA 1SI9A 1H73A 3G4SS 4BDPA 4NL5A 1WC1A 4ZP8A 4KGXB 4U6PA 3BREA 2B9YA 2IVFB 2W9BB 2KTQA 3FC9A 1IBLJ 3IRXA 2HS4A 3UDEA 2HBRB 2DK2A 1H72C 2R8IA 4ID5A 4QIEA 4NA3A 4TY8B 4LSNA 1Q95G 2AMCB 2FQQB 1FKPA 5DDOC 1PJ6A 4LJMA 3SFUA 2NXUA 4DR4F 2LXFA 1IWAA 3KLFB 2MQLA 2LQJA 1RTIB 4F3MA 2L41A 2K1RA 4KR0B 1VQKS 4M5LA 2LEAA 2ZDPA 2P9CA 3H0PA 3ZZ0A 3NG8A 1YBAA 2J0XA 1RT1B 4J37A 1B7YB 4R8UB 3QGHA 3MM8B 4KV8B 3M8QB 3HVAA 4TXSA 2MQNA 1A0OB 2KVIA 1UAWA 2ZBIA 1VMBA 2RQCA 1YITS 4I4BA 5LJ5Y 2QLFB 2E5GA 3KJNB 2R42A 3PYDA 2YNFA 4O3OA 2Q6BA 3M05A 1UVKA 2M8DB 1OY9A 2Y0SD 1XQIA 1KSPA 1U02A 2HURA 5D4LA 2C42A 3TJAA 5KFMA 4NYOA 1TKXB 1WELA 3BN7A 5GADI 1S1UB 1LV5A 1DURA 5LXYA 3T5HA 3DXSX 4XPEA 4DQQA 2HQCA 2B7BB 1JLFB 2A2CA 2U1AA 1KKHA 4YN3B 4X4RA 3HULA 1JLQB 4IKAA 4DX5A 1YRXA 4Y0FA 2QJ3A 3OHBA 1BWEA 4L76A 3JTPA 3VAJA 2C2RA 3HHLB 3LWLA 1RT7B 1RHKB 3JSYA 4Y2IA 5E3QA 1NB7A 4PWWA 3QPIA 3CGIA 5KG1A 1HR0J 4PR6A 1WF0A 1LK5A 1IBKF 4YEAA 3JAMU 3GCXP 3OFHA 3UE2A 3GJTB 3FEXB 1PC5A 2LQ5A 2IC3A 3FZBA 1F3VA 2WVCA 1HNVA 4O3PA 3O1LA 1OWXA 2RQMA 1HMVB 3DLEA 4M5GA 3CMAS 2FGCA 2Q1LA 2MKSA 2UVUA 3SFGA 2HRYA 4RW6A 3QO9A 5HMXA 4U95A 4ECXA 2ZZTA 3M2VB 2AX1A 4G6VB 4J9OA 1E6YA 5EWFA 1LW0A 1N4LA 2B3TB 2ZDOA 4ZVSB 2UXCJ 3GR1A 4OYIA 5KFSA 1HI1A 4OZLA 1HNIB 2GMLA 2OPRB 2OKQA 2CQ4A 5D4PA 5AE1A 1VRUA 3ZTRA 4Q8EA 3POTA 3RBXA 4XIUA 3GSDA 2QZ8A 4KKOB 2MSSA 1KOOA 3A8JA 4QU6A 4YDDB 3NOGA 2MZ1A 3M9MB 3QJLA 3ISNC 3M6WA 1VQ9S 4LFBF 1AZSB 1PJ7A 2C3MA 4HI1A 4P2XA 1G7CB 2H5JB 1ZA1B 5K14B 2HLTA 2W7OA 5ETTA 1CVJA 1Z2ZA 1BD6A 3C16A 3TAPA 2I5JB 1B70B 4F67A 2M3DA 2V8DA 3W5XA 1T02A 4Q0BB 2BA9A 3KXDA 2DNRA 3V5RA 3DI6B 3DLJA 5AJ3J 4PYAA 2ATCB 5KFFA 2YKMA 1SJQA 4L3NA 1HWLA 3V81B 2GCFA 3NKYA 3Q8QB 3QIPA 1S57A 1KBRA 3HVWA 3Q86A 2YXLA 2HGLA 2V2VA 3MPWA 2OD6A 4L72B 4KH0B 5ETMA 3I55S 1QSLA 3HPOA 1K1QA 5HAOA 1S7IA 2OH2A 3DOLA 1I1GA 2CPHA 1BMQB 4X65J 2MSTA 2OPSB 4GMKA 4A8XA 3LP0B 2G2OA 2WB4A 3W62A 3RW7A 4GKKF 1NRKA 3PTWA 4Y3CA 4DUZF 3BGLA 4ICLA 3GLJA 2B6AB 5E2QA 1CPZA 2AF6A 3MEGA 2RHSB 2BANA 2I8EA 4M5DB 4A8KA 1HBOA 3R2DJ 3RB4A 1SQGA 4XAKA 2CDRB 5JJBA 3C2PA 3EUNA 1XR7A 1TK0A 2JH3A 3UNYA 4NX9A 3PW7A 2XYHB 1XBWA 3K7RA 4ED0A 1FWPA 2Y0BB 4WFXA 5ADZA 1FFSB 5B0FA 2CNOB 4ED7A 2IHR1 3HX9A 5EWEA 1JWWA 1N5TA 1GXLA 2DNGA 3IS9A 4H4OB 1Y5NB 4J9LA 4X64F 4EZ6A 1NDKA 2VODA 3EXCX 3TQ1A 5LXRA 3I4PA 1YSJA 2HWTA 4ED2A 2D41A 4B9LA 1RAJA 1ZPVA 2RRBA 4FF4A 5DGAA 3M1VB 3TWZA 3MMJA 2XI3A 3S7RA 2AGOA 4YY3J 4RX6A 4HYKA 3N0VA 3R5BA 3IA0A 1N5SA 2M9KA 4X4PA 3K0JA 4KO0A 1KQSR 2HNZA 3MHYA 4I6WA 1KP6A 4WP3A 1MMLA 1O6XA 3EICA 3M9OB 2WW4A 3H59A 1V3RA 2K2PA 5KFPA 2MZTA 2UUWA 2HQIA 3TVYA 4ZCLA 1C2PA 3ETMA 2IVYA 3IBFB 1KN6A 5FJ4A 2B56A 1I6JA 3U1MA 1U8SA 5DLFA 3AJDA 4I7FB 3G82A 4JI5F 3TZXA 3BSNA 5EX3A 2XB2D 1NSPA 3A3NB 2ZD1A 1VRTA 4KT0C 2K3IA 3GJQB 4NCAA 3CTRA 3UO0A 4DCJB 1N33J 1T03A 3HD2A 1N48A 4EWTA 5HN0A 1DTTB 1LNQA 1RYSA 3ILLA 4EZ9A 3FBFA 3BV8A 1V5VA 1K8AT 4OYPA 4RW8B 3AA9A 4DR3J 2JVOA 4ZVRB 1IBLF 4LSLA 3D5MA 2HYIB 4QWDA 1VJWA 3KDNA 4LF9J 1OY8A 1RA6A 1FNMA 2WBRA 4RZRA 3SDEB 2MKHA 3FNNA 3R5AA 5KFNA 2QV6A 3OVSA 4Y6IA 4W92B 3MMAA 2VPXB 3M6XA 2NSCA 4RWXA 3U02A 3KNGA 5KFVA 1HNWJ 5A76A 3H5UA 3O5TB 3DLKB 3VVUA 2XGPA 3WIVA 3EJMA 2C28A 2KM8B 1LWFA 4P74A 2YTCA 2B5JB 4OMFG 2YNHA 4DV0J 1HNXJ 1KR4A 2XBPA 3CCWA 4OZNA 5HATA 1NKEA 4KSEB 1C1BA 2FVRA 2MKIA 5HLFB 4OL8A 2ZH1A 4I2QB 2OPPA 2Z30B 3G96A 4NLGA 3G71S 1HW9A 4CYUB 3NWGA 3HHDA 4DV4F 1WEZA 2AP6A 2PA8D 2DGWA 2KDOA 1MWYA 3P49B 3LOUA 1U45A 5C25B 4JI0F 2I0XA 4B9MA 2W2NP 1MW7A 1A6LA 5KT5A 2UXDJ 4B3TJ 1VBZA 3PYFA 2QO3A 2EKYA 1VCTA 4ANEA 2M70A 5CYMA 3FUYA 1SCJB 1X5OA 2JRSA 3OPKA 2OEKA 1YWXA 3IC1A 4OJ1A 1U25A 2ADBA 2Z57B 2YNGA 3CXCR 2EBEA 1TU0B 2UUAF 2J9DE 2BZ2A 3P6YC 4E2FB 2R8GA 1R0AB 1T9WA 2D3UA 3O44A 3QMQA 1FRKA 4WF9Q 3GU0A 1IM4A 4PWDB 1ZBTA 4RNHA 4KPCA 1JXEA 2KYZA 5IV4A 2E9RX 1FWKA 1HI0P 4ILLA 1GMUA 2ASLA 2N3OA 1L3VA 1RT3B 1XMQJ 1BLUA 2CFXA 2A6MA 3ENVA 1HR0F 2F9JA 2V4QA 4A8SA 2RT3A 3NNAA 3LPYA 1S6PA 3CDEA 3BJYA 5CAAA 1T9VA 4QIFA 3LP2B 1U1OA 4FBUA 1HWJA 4FP9A 4WZQA 2CPYA 3CSKA 4E98A 5IM0B 4B3OB 1EETA 1TL7A 1EKRA 3LP1B 5F41A 3PW4A 3QGPA 1YJUA 1C4CA 4L74A 3N6LA 2EKNA 2CUYA 3MM5B 1VC6A 2UXCF 4EBDA 4EO8A 1M0SA 1GFWB 4DI6A 3W5ZA 4PPZA 2M0GB 4I69A 1TVRA 2HQFA 2MGZB 2ZC3A 4HACB 3W9JA 2QYCA 1TKTA 2RKIA 2IPOB 3RAMA 1WC3A 1S0MA 2JEGA 3PW5A 3SEOA 3R7BB 5CYQA 4NCGA 1KVJA 4K50A 1PILA 2DY9A 2NPIA 3NWRA 3VR1A 2KZZA 4ELTA 5F0WA 1RU1A 1Q4RA 5E3RA 5AXLA 4KYZA 4QR0A 3DU5A 2FDNA 1RKJA 3OTEA 1RTZA 3FCHA 4ETZA 4HKQA 4C7QA 1JLGB 4OJGA 4UY85 3KLGA 4DQIA 3KUHA 4WJBA 4Z2XA 3UD4P 5AJ3F 2R7UA 5CCLA 5EGYA 1RT5B 1QSYA 3TEGA 1OS5A 1SKUB 1BQMA 1G6BA 4PAAA 4USKA 2NPFA 4X2BA 1GK8A 1CULB 4J90A 2CJAA 4Y28C 3X3UA 4CT9A 1HBUA 5A8WA 4TU9A 1X5PA 3AHPA 1FKOB 1OPIA 2B9EA 2XYGB 4OV6A 4OQJA 4JI3F 4EK2A 4YHHJ 4ED4A 1U2FA 5KFCA 1SL2A 4DR6J 4CH7A 2VHGA 4ID8A 1RTJA 1Q16B 3I0RA 2CYYA 3MMBB 2J6UA 4FNIA 3W63A 3PNIA 3KK1A 2DR6A 1RABB 2AIRB 4X4VA 2HFSA 5FDLA 1IR2A 1FNXH 4DV1J 5B7WA 3CCRS 3GIJA 3G8TA 4M1KA 3HSGA 3DM2A 3CF5Q 3CDWA 1W26A 1R6YA 2FZGB 2XMTA 1J5OB 4XDCA 2Z0GA 3WZ0A 2CJXB 5C24B 1RJJA 1D9FA 3BYRA 1HYSA 1FNOA 1NHUA 3W8GA 3HI9A 3BGFA 3PIPQ 3VF0B 2H51B 3M8RA 3MR2A 4MJKA 2Q6CA 4NRTA 2M4MA 3LGHA 4QPXA 2IRXA 4DQSA 1E6VA 2ZOMA 2ZKUA 3ZZRA 3I87A 3CCQS 4C11A 2NYHA 1IKYA 3TUJC 4FVCA 3DYAA 4DCOB 1RXOB 1KTVA 3Q8PB 3RB0A 5J1EA 5JMNA 3MGJA 3TNVA 4RLEA 3ELHA 2AD9A 4C4WA 1CC7A 3DGVA 3C6UB 5F8LA 1RE1B 4GO7X 3P5BP 4EYHB 3WIUA 1OYDA 2CQ3A 4YUDA 5HBMA 4EI2A 4YQWA 4FKYA 3R27A 2FHMA 2V8GA 3B78A 2CNKB 3MAQA 4OV1A 4Y2AA 3CO9A 3E01A 3BO2A 3K17A 4BHQA 3TAMA 2OSRA 1WDTA 2D74B 4DFPA 4UOHA 1TTHB 4LF9F 2MKKA 1U26A 4K4ZA 4Q44A 3D28A 4DL6A
chains in the Genus database with same CATH topology
4FXVA 4KE5A 3LGMA 2Y1IA 2CQDA 3KHRA 1T05A 2PFFB 5CH7B 2CG4A 3S01A 2CRLA 3AA8A 4O44A 4DEZA 1TZ0A 3L7OA 4K4VA 3TA1A 5A2QY 2BW2A 2QA1A 2R2TA 4IRKA 3VWSA 4DF8A 3RRGA 4IH6A 4K59A 5CZVA 1H6KX 3VQTA 4GKJF 1SL1A 1S0OA 1KTQA 4RKUC 5HP1A 3BB5A 4EO6A 4IRDA 3SQGA 4G3IA 3T1YF 4YMEA 2KH9A 2YH1A 4ZHRA 4X4OA 1VQ4S 1B7FA 3HJFA 4FF2A 1UVIA 3D0HE 1GAOA 1F2GA 3HHNB 2HS3A 1XMOF 5K8OA 3DXBA 4USIA 2OPQB 3KK1B 3K58A 2XSJB 4MKYA 1Y5IB 2YKNB 4O3RA 5E3PA 4LVOP 4DFMA 4DF4A 1S0VA 2BJDA 2CQ0A 2F40A 4NYPA 3T19A 3I56S 1HPZA 4NCBA 5FDLB 4V19J 2IJFA 3MCSA 4ETXA 2VZ9A 5KAKA 4ZP9A 2R7VA 4OHXA 3CCLS 3J7ZT 1F5CA 2WOMB 2Z8QA 3TR5A 3V6KA 3BQ0A 3RBDA 3KMSA 4FXWA 1V9OA 4F4KA 3PACA 4DN9A 5HQ8A 4J9PA 2FJWA 3OJSA 1RISA 5IT9Y 4K4WA 1TKZA 4ATNA 4IFVB 2FC9A 2HWHA 1HNXF 4C8OA 4C8YA 3G9CA 3DRXA 5A8RA 4B3SF 4ZCMA 3DM2B 1QE1A 5F8GA 5AXKA 2N7CA 2X1GA 2K3KA 1Y5LB 1UVJA 2XC9A 3MM9A 2CPXA 3AQOA 4LT6A 4KGKA 5IQ6A 3SSRA 3OJUA 3Q2TC 2F7VA 2E44A 4DL5A 3MECB 5G0RA 4RU2A 1UFLA 3PFOA 2DJWA 2LA6A 2GJ2A 4NLTA 1DTQB 3T5LA 1Q86T 2UU9F 2JDJA 2VASA 3K8WA 1HYSB 2UVVA 2W9CB 1JX4A 1IKWA 3FRYA 3F41A 2R2UA 4OJ3A 4HT5A 1QAXA 4NLDA 1QUPA 1ULRA 3BQ2A 3B82A 2B4VA 5A6WA 1S7HA 4K4YA 2FLOA 5T41A 1VQ8S 2MMYA 3KK3A 5KFAA 1VS3A 2H5EA 1TAUA 4WYLA 2BM1A 4NZ0A 4CI0B 2E1CA 4X4UA 1DQ8A 3BS9A 1BQNB 2FVSA 2LEBA 2VFUA 5HMZA 5KFEA 4ALZA 1JKHA 4CO4A 2DNMA 4NLSA 2M7SA 1P6TA 4ZPCA 4WFAQ 3MPYA 1KS2A 4AYBD 1DQ9A 4OHWA 3CUNA 4J9NA 3GWCA 1X5TA 2GFFA 3GFYA 1X0FA 1SV5B 1KLMA 1VK8A 4DX8H 1WHXA 1HBNB 1XNQF 3THPA 1PO6A 1SKSA 1FT8A 4C11B 3V6DB 2H9ZA 3BSAA 5BJRA 1S1TB 1FVQA 1R8CA 3MPVA 1IKYB 2DB1A 3OFGA 1R27B 2ADCA 3IN5A 1B0VA 2YKQA 3K5LA 3ZZOA 2AJ0A 4NOHA 1U1MA 4A8QA 2ZH9A 3DYAB 5B0EA 4C8NA 4NWBA 1D9DA 3T9NA 5J1EB 1HWUA 1JLAB 1ZTWA 2P5VA 3SV4A 3GMGA 5DO2A 4FXDA 3MMCA 1L3UA 1Q79A 2NS1B 4NLXA 1MNEA 2VONA 3UCGA 1GNKA 1LWCA 2HW3A 2W25A 4IOCQ 1FK9B 4I6AA 2LU2A 2P9EA 3JSBA 1XWLA 3OQ2A 1IR0A 2DCUB 2R8JA 2HFZA 3TA2A 2A2DA 2QRRA 2J9EA 3PRBA 3S6EA 2HGNA 3MDFA 2IYGA 3FGVA 2BE2B 3LH2S 4L6V3 2JZ5A 2VPZB 3H25A 4RW4A 5HMWA 3PM9A 4WXOA 2MPUA 1SXLA 1NKCA 3QWUA 1FKPB 2DRBA 2J0QD 3PZPA 4N8NA 1U2RA 1CLFA 1IKXB 1Z2LA 2PI4A 3DRSB 3F73A 3MFIA 3E3XA 1RT4B 2W7PA 3PJWA 1DARA 2ZUGA 3KG1A 4CZCA 5HBMB 4B08A 4N5SA 1FJCA 1R8BA 3OR2A 3V4IA 3CMES 3IG1A 1JLCB 3CIZA 4C0HA 1APSA 1ZAXA 1L3KA 1U6FA 2HNYA 3BN4A 4IFYB 3DOKA 1GX6A 2VG5A 4C97A 3DOMA 5KT7A 1ZOTA 2JX2A 5GVQA 3KLIA 3P96A 2XSFA 4CO3A 5SZTA 2DH8A 3MM7A 3OL7A 3AJ1A 3ISND 5A0YA 1XMQF 3E01B 1TV6A 5KT4A 1TL1A 1RTDA 4EFAC 1U1PA 4H54A 4H4MA 3H98A 1FO1A 3LAKA 2RU9A 2XLKA 1N6QA 4O4GA 4TKTA 1N5YA 2NSBA 3BM7A 1TFYA 2QA2A 1VBXA 1HD1A 4PUOA 1Y3KA 3UDCA 2KG1A 3ZC4A 1MROA 3DLGA 5D78A 4PG8A 5A8KA 1D1UA 2X1FA 4IH5A 1HW8A 5L9XA 4F3QA 1F5BA 1P1LA 1L5UA 2DNYA 2DD8S 1X4BA 3EX7B 4K2XA 2C2DA 2GGPB 4XPCA 2FTRA 4U9RA 2LA4A 3BR8A 2EG1A 2KN4A 4JV1A 2BM0A 1IJFB 1T05B 1X4CA 2YWFA 2L3MA 2BV3A 4KRWA 1VFJA 3CCZA 4W90B 4O44B 2AJQA 2B51A 3JYTB 3ONQA 2RRNA 4UUXA 5L38A 1SL0A 1O0PA 2VPYB 2HQ3A 3MFHA 1O51A 3U1NA 2WK4A 2EFVA 5F8IA 5LSRA 5KFKA 4NXNF 2ABYA 4FF3A 4HLBA 5HP1B 1JJ4A 1VLYA 2RS8A 4J5OA 3SQGB 3PX4A 3MXHP 2CQ2A 1U7LA 2PSZA 3GFXA 4AQYF 4OLOA 3FEZA 3BGUA 5I42A 2HHUA 2RB7A 4ZHRB 3PXGa 4R0JA 2HHWA 3MEKA 1V3ZA 2XY7A 4LF5F 2EFGA 2NREA 2I1RA 1N34F 5E5NA 2VB6A 2VPWB 3UQSA 1HQEA 5B09A 3VALA 4ED3A 2W9BA 4USHA 4ZCKA 5KT6A 1Z1ZA 1HL6A 3K2YA 1Y0HA 1NJIT 3RZAA 4DWIA 4N41A 3HKZD 1N5QA 2CJQA 1DHMA 1GXUA 2YWKA 3TVZA 5JXSA 1HPZB 4CIOA 1M5VC 3BO4A 5KFYA 2F3JA 2YY3A 3P5TL 4DR1F 1VQ6S 1QM9A 3CCES 1SJRA 3Q2SC 1F9FA 1OQ6A 4U7UK 1GTHA 1OIAA 5FIIA 1KRPA 2N4CA 2RU3A 1ZAVA 4TY8A 3RRHA 2LMIA 2RILA 2EVZA 1TKZB 5KFJA 3VAIA 2ZBCA 2KFYA 1FKAF 1X9MA 2XULA 1BC6A 5A8RB 2MZJA 2XMUA 3H20A 5J2PA 5KFQA 1QE1B 2AGQA 3J81Y 3OL8A 2MJNA 4ZK7M 4K5RA 2OAUA 5J2NA 2CPIA 3RU0A 1MMDA 3T1AA 3K59A 3ENWA 1OSCA 1V6HA 4J9MA 5DG8A 4AXIA 2DO4A 2E5JA 4WU3A 1D0EA 5BR8F 2ASYA 3GE9A 4FYDA 5G0RB 1Q8IA 4MMOA 3ZZPA 5F8HA 3KLFA 2J76E 2YX4A 1Y9OA 3HLUA 1T3NA 1IJEB 1N0UA 3DC2A 2YNIA 3DMJA 4O4RA 3OTCA 5F9LA 1RTIA 2ERRA 5GADU 1IKWB 2FJDB 5KFHA 2ZOFA 5J2QA 3I4HX 5E41A 4BWJA 3HMJG 2D9OA 4NPOA 2KT2A 3KK3B 4MTPA 3ISZA 5KOXA 3SCKE 3QZ7A 2ZH3A 1JLEB 1KFDA 5DGBA 3G6VA 3CDAA 1RT1A 4DR5F 1XEZA 1RGVA 4R8UA 3SZ2A 5M2PA 4QR2A 4C3MA 3MM8A 2J8AA 2NUHA 3GR0A 3M2UA 1AFJA 1JKHB 2W4DA 3MD1A 4LF6F 4KV8A 3EPIA 1JK9B 2LEPA 3M8QA 3CJKA 4YOEA 1UJ5A 1Q78A 4N77A 3CWJA 1Z4UA 5F8JA 3ZZUA 1KLMB 5KG6A 1MU2A 1UWBA 1VQNS 1AFIA 3T5JA 2CJKA 2ZZNA 2WTFA 5U47A 4HVZA 1RYRA 4IR9A 2AYMA 2WONA 4DG1A 3CPWR 4DLGA 1S99A 4Q5VA 2FB0A 2LKZA 4OLPA 3NMAA 3KFWX 1OPZA 2E29A 2KU7A 5EX0A 5AE3A 4J9KA 4Y2KA 4QIWD 1NAQA 4M95A 1FEHA 2LQBA 4JV0A 1J5EF 1R31A 5CCMA 1NKBA 3MMCB 4BWMA 2LLZA 3SCIE 4PQAA 2FHOB 1WI8A 4KFBA 1T95A<