4IOAQ

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ioaQ00
1FJ7A 1U1QA 2DH8A 4CIOA 2MMYA 3OW2R 2YH1A 2LKZA 2JVOA 2MJNA 1VC5A 2J76E 2KG1A 1YITS 1R8PA 2EK6A 1VC0A 2OJ3A 3CCQS 4FXWA 1PGZA 1WEYA 2QFJA 2ADCA 4ED5A 3G71S 2F9DA 1Q86T 2KT5A 3G6ES 5FJ4A 1N54B 3MI7X 3NNHA 5HO4A 2RS8A 2KI2A 3B4MA 3NS6A 3VALA 1FNXH 2VOOA 1WHYA 4QQBA 3CF5Q 3CCVS 1BY9A 1HA1A 1M1KT 1SXLA 2KXFA 2MJUA 3LPYA 5CA5A 5DDRC 2GO9A 2KU7A 3G4SS 2LYVA 5LJ3Y 2ADBA 1VC6A 2OIHA 2HGLA 4OZ1A 1ZH5A 3K0JA 4IOCQ 2RS2A 2OSRA 2RRBA 5GAEU 5GAHU 3H2VE 5IM0B 1VBYA 1OPIA 2KVIA 3S01A 4OZ0A 2CPYA 2O3DA 2CPDA 2DNHA 1VQOS 3UCZP 2NZ4A 3I56S 5JVGQ 3BO2A 2CPFA 1WF1A 2XNQA 5DETA 1D9AA 3JB9k 2MY7A 2FC8A 3UCGA 2HZCA 5DM7Q 2DNMA 2KHCA 1VQNS 3BS9A 1SJ4P 2MSSA 1N88A 2LXIA 3P3DA 2FC9A 4QU6A 2M4MA 3CULA 2LA6A 3MUMP 3IWNC 2CQ4A 3RW6A 1P1TA 2RU3A 2RRAA 5IQQA 3VF0B 1YHQS 2QA4S 1VQ9S 2DIVA 2CQDA 2LXUA 2CPHA 2CPEA 2DGOA 2MZJA 5BJRA 2XS5A 2U1AA 2EVZA 3NMRA 5LXRA 2J0SD 1U6BA 2CQHA 1KQSR 4YOEA 4TLQA 3P49B 2CQGA 4ERDA 2RQCA 3PIPQ 2DHGA 1H2UX 2MY8A 4C7QA 2L41A 5DM6Q 2KM8B 3SDEB 2CPJA 2LEBA 1KOOA 1U1PA 3G96A 2B0GA 3BEGB 2ZJPQ 2MZ1A 2MKHA 4WIIA 3THPA 4TU9A 4C0OC 4IOAQ 2M0GB 2N3LA 4F02A 2RT3A 3HI9A 1H2TZ 2MZQA 1X4CA 2LECA 2VODA 2DGQA 1ZZFA 5LSOA 2DO4A 3FEXB 5LXYA 2CQ2A 3CCRS 2LEAA 4W92B 2XS2A 5LSLA 5JVHQ 3G9CA 2KRBA 2CJKA 2G1DA 1X4GA 4PKDB 5MLCV 2E5HA 2MYFA 2DNYA 1U1RA 4UY8T 2VONA 3HHNB 2SXLA 2ZJRQ 3MUTP 4Y00A 3DXBA 5D77A 1DRZA 2YH0A 1M90T 3MUVP 2LCWA 1G2EA 3U1MA 3EX7B 1X4AA 2DNOA 1SJ3P 2X1AA 1U1LA 1Q81T 5DDQC 3CD6S 1U1OA 2MKJA 3D2WA 2MZSA 3VAGA 2DGTA 1OO0B 5GVQA 2HGNA 1S72S 2CQ0A 1W2BR 1OIAA 2DGWA 5CXTA 1X4HA 2CPIA 2E44A 2DNPA 2MZTA 2U2FA 1UAWA 3MD3A 1YIJS 1KC8T 2M7SA 3VAMA 3CC4S 4CH0S 2FY1A 3CCUS 3LQVA 2MGZB 4Y0FA 2OTJS 1WG4A 2AYMA 3EGNA 1FJEB 2AYBA 2MKKA 1B7FA 1PO6A 2DH9A 3TO8A 2CQ3A 5CYJA 4QU7A 3UWTA 1NO8A 5EN1A 1JJHA 1YJ9S 1L3KA 2KG0A 1WI8A 4U67Q 2M2BA 2ERRA 1VQ6S 1X5OA 4W90B 1WG1A 3J7YU 2V94A 2BOPA 4C4WA 2X1FA 1M5PC 2JX2A 2K8GA 1X5TA 2DHAA 2KYXA 3MD1A 2XS7A 1U1KA 5LJ5Y 1QVFR 3MXHP 1FJCA 2G4BA 3Q2TC 2DNNA 3P5TL 3I55S 2PE8A 1WF2A 3CMAS 2I38A 2MQOA 2DNQA 1SJFA 1Q82T 2EK1A 2L9WA 2N3OA 1CVJA 3CUNA 1VQ8S 1UFWA 3R1LA 2F3JA 2CQCA 2GHPA 2MKCA 4WFAQ 1IQTA 2J8AA 5GMKa 4WKRA 3TP2A 3ZZYA 4WF9Q 3UD4P 2M8DB 2MQNA 3S8SA 4F26A 5IM0A 1VQKS 4V19X 1K8AT 2AYGA 2VOPA 3CTRA 2X1BA 2DIUA 2LMIA 2Q79A 3EGZA 3S7RA 4EGLA 2G0CA 4QPTA 3G8SA 5D78A 4A8XA 1UW4A 2MQPA 3CPWR 1QM9A 2MSTA 5GAGU 3BO3A 2CPXA 1WEZA 5DDOC 2XNRA 1JJ4A 2KXHA 2YTCA 1ZZNA 3VAFA 1RKJA 2D3OR 1N8RT 2DO0A 1F9FA 2JWNA 4UQTA 1X0FA 5H1SV 2MQQA 1X5PA 3L3CA 3R1HA 2MKIA 2LA4A 3US5A 2E5GA 2FHOB 2QEXS 4YB1P 3CCJS 1HD0A 3V4MA 4WFBQ 2M88A 3ULHA 2N82B 3H2UB 2MQLA 1VBZA 2DNKA 1JMTA 4F25A 1VQ7S 3NNAA 1X4BA 2DNLA 3MURP 3IRWP 4P6QA 1XN9A 2HGMA 1VQPS 1K9MT 1WHWA 4PR6A 1RK8A 3Q2SC 2DHSA 1VBXA 2KFYA 1P27B 3BO4A 1WHXA 2UP1A 1FHTA 3S6EA 3CCMS 3VAKA 3DLLQ 1M5OC 2DITA 2RQ4A 4YUDA 1YI2S 1VQ5S 2NLWA 3SMZA 4WCEQ 4Z2XA 5DDPC 1Q7YT 1KD1T 2KH9A 2MHNA 3ZZZA 2E5JA 1WHVA 1X5SA 2KXNB 2MXYA 4IUFA 3CCES 3CCSS 2DB1A 1URNA 4LJMA 1DBDA 1VQLS 1NU4A 4IO9Q 2DK2A 2YKAA 2L08A 3CCLS 3UCUP 2RUGA 1JJ2R 1U2FA 1H6KX 2KM8C 2I2YA 1O0PA 3FEYB 4CQ1A 2DH7A 4TU7A 1UP1A 1R8HA 1S79A 2MZRA 3SXLA 3CMES 1A9NB 4BS2A 2JRSA 2K3KA 2KRRA 1WG5A 1WEXA 1FO1A 1WI6A 1X4EA 2MPUA 2LQ5A 2DHXA 3VAIA 1WWHA 4CH1A 3UD3P 4TU8A 1U1NA 1OWXA 1YJNS 2M9KA 3G8TA 1D8ZA 4ZKAA 3VAHA 2CQIA 2HVZA 3RW7A 2CPZA 2PEHA 2DNZA 1KOHA 2CQPA 1WTBA 1U1MA 2MGZA 2J0QD 4WFNQ 4J5OA 5IFMA 2KN4A 2M70A 2DNRA 1N52B 3U1LA 2YWKA 4RU2A 2CQ1A 2JVRA 3VAJA 2WBRA 2A3JA 1SJRA 1X4FA 2D9OA 2XB2D 3P6YC 4LMZA 1SJQA 1M5KC 2MQMA 2AYEA 1YWXA 2DGUA 1HD1A 2RVJA 5HL7Q 2BZ2A 1A7GE 3MDFA 1DHMA 2E5IA 3B4DA 2ZJQQ 2DGVA 2DNGA 5GADU 2XSFA 3NS5A 1VQ4S 2DGXA 2DGSA 3UE2A 1QVGR 2OSQA 1WF0A 1H2VZ 1X4DA 2CQBA 2M52A 3R27A 3NNCA 1YTYA 1WELA 1K73T 4LIRA 2OTLS 3MOJB 2DISA 2X1GA 2N7CA 1FXLA 1M5VC 1NJIT 3J7ZT 1AUDA 1FT8A 3PIOQ 3N9UC 5ITHA 1U6FA 1HL6A 4M5DB 2MKSA 2FPHX 3TYTA 2MB0B 2F9JA 1VQMS 3CXCR 2D9PA 3THTA 2RNEA 1DZ5A 2HYIB 4PRFA 2AD9A 3SDEA 1YJWS 3CC2S 4FXVA 3CC7S 2M8HA
chains in the Genus database with same CATH superfamily
4N56A 4LRFA 3R5JB 2HNDA 3AXMA 4TKTA 1Q5YA 3EE3A 1N54B 4RW6B 3QLHA 3MM5B 3G4SS 2YNIA 3VTIA 2XYHB 1NKBA 2VIHA 4TY8B 5GAEU 2ALZA 1WDDA 3QNWB 3MM7B 2KFZA 2K1RB 1PKUA 3C16B 2CPYA 3MAHA 4W98A 4PUOB 2CPDA 5AXMA 3SSRA 5KFAA 2KHCA 4X62J 5FLXU 2IAJB 2FC9A 1IN0A 3HMJG 2V0NA 1FTRA 2Q43A 4KFBB 4PG6A 1TR0A 1L3TA 1FKOB 4DV0J 1KQSR 3P49B 1KN6A 3IXQA 2G0JA 3D68A 3AY0A 4CLTA 2AJ0A 1FDDA 2Z57B 5KFOA 4YB5A 4P72A 4CO3A 3G96A 3CJTA 4ED8A 3MEDA 3DLKA 1CPZA 3KG4A 4HDGA 4OJ1A 2XMVA 1X4CA 2QLFB 2DGQA 1EJ7L 3DM2B 2CZ9A 3LALA 2PEBA 1KSPA 3D67A 2EPIA 4WE1B 3BM7A 2R4FA 4C48A 1AZSB 4LFBF 2NXNA 2OFGX 4RU9A 3MUVP 2RE1A 4JV1A 4MAKA 5A0YA 3J81Y 4KC5A 4OMFG 2AMCB 3UDCA 4I6YA 3B8HA 4NLGA 2DBBA 3CJ4A 1RT1B 4H4KA 2HWIA 3G6VA 1B0PA 3A8EA 1MMNA 4B9VA 1DARA 4DR2F 2ACMA 2F40A 2R7SA 4RJVA 1V5IB 2R9LA 1A0OB 1N36J 1T9VA 2ERRA 4Z7CA 1X5OA 4G3IA 4RW8A 5B09A 3KJVB 2KHDA 4ICLB 2C2OB 4LF8J 4ED7A 1QTMA 3GZ7A 2B8QA 2RF2B 5L38A 4NLVA 2E1MC 2DRDA 2HIYA 4ZVRB 3GCWP 3RTVA 3L7PA 4K50A 3S8SA 2VFSA 1IBLJ 3G2XA 5D0RA 3V81B 3CD7A 4B9LA 2Q79A 2B6AB 3S7RA 1BMQB 1NK9A 5LMNJ 4ZVQB 3MPUB 4ILRA 4LF1A 1RKJA 2ZUAA 3LW5C 3HHLA 3GIJA 5T14A 1FRKA 2HNZB 3MM6B 2G0IA 4C2MA 1P9YA 3WIVA 1LWCA 2E66A 3C6TB 2HHHJ 3ZFVA 2XMKA 3N5FA 3HSDA 1V5VA 1VBZA 5GAGI 1RACB 4ZVUB 4PQUB 1XN9A 2J6SA 2HZAA 3N4WA 2V8DA 2AGOA 4FP9A 1XK8A 3PEHA 1X9SA 2RDIA 1RHMB 2C2MB 3F73A 5D0HA 3CJ8A 3DLLQ 1M5OC 3CCZA 5CH7B 1OY8A 2D69A 3SMZA 3OL9A 2AZ1A 4USWA 2ZDPA 3SCLE 4DDFA 4Z2XA 3J81U 4OYPA 1VS3A 3Q8RB 1FK9A 2IM0A 1HW9A 3QRRA 1VI7A 1KS2A 1DQ8A 4F4WA 1LOUA 2ZH1A 1REGX 1BD6A 2RUGA 3PW4A 1I94J 1U2FA 4IR1A 4TU7A 2BM0A 4ATNA 4HYKA 2VFTA 2ZVIA 2ASYA 1HKAA 4ED4A 1GXTA 4ZKAA 2HVZA 2KB2A 3DLGB 3LP0A 1TQLA 1VRUB 3CJKA 5IOLA 3MPYA 2F7VA 3DLEB 1YRXA 3A12A 1FFWB 2BJ9A 4NZ6A 1SJRA 3KNGA 5I3UA 1Q8LA 2OPSB 4Q2MA 3QAUA 2HURA 1DHMA 2DGXA 2HFSA 2A10A 2IM2A 2M52A 3NNCA 2W01A 3DMJA 1FESA 1EETA 1RTJA 2N7CA 1RWOB 3CJ3A 4UQGA 3GIKA 1AUDA 2ZHAA 5IWAF 4X4SA 3R5AA 2MB0B 1HI8A 3CIMA 3UVJB 3M8PA 1DTQB 5D3GB 4WK1A 3FEZA 4ED0A 1Z2LA 3A4TA 3PR5B 2NPFA 4RNMA 4DPXA 4J9RA 1IKVB 1LV5A 1NJZA 2OEKA 1L3UA 3B4MA 4HLBA 3LWLA 3NWGA 3QT8A 1EIYB 3UNYA 1SXLA 2IJRA 3K0JA 2EFQA 3NG8A 2V69A 1LK7A 5E3CA 1OPIA 1TV6A 2E29A 3PV8A 1VQOS 4ZHRB 2EBEA 4KHPF 4WZQA 1SJ4P 2MSSA 5C42B 3PRDA 4GVBB 1UMJA 5GAEI 3VF0B 4NCGB 2UV8G 3CT9A 4CDIA 1YZ6A 5F9LA 1DAXA 3IO1A 2ZH2A 2IIHA 5E5NA 1HYSA 1T05B 3H25A 2L41A 4XDCA 4MK9A 2L48A 4DCOB 1S49A 3BGRA 4DR2J 4B3SF 2GS8A 2H1YA 4IQXA 2N3LA 3SV4A 2V4QA 4DV7J 1FF2A 1RJJA 4LF5F 2H51B 1R3NA 2OD6A 3HDSA 4WK3A 2YNGA 4C0BA 2MYFA 1GXUA 2CIMA 2YH0A 1V3SA 2GVDA 1G2EA 2K2PA 4QR0A 5C2GA 1B70B 1RUSA 4DBQA 2PI4A 5EGYA 3BGOP 2YNHB 1KNZA 3MCNA 2B9XA 4Y34A 2PSZA 3QRPA 2D7SA 2DH9A 2V8PA 3I82A 4MFBA 5HVHA 2UXBF 3EZOA 1SKSA 4F3QA 4ES3A 2NS1B 3DOKA 1ZM4A 2X1FA 2AX1A 2JX2A 3JSRA 2B7BB 3FRYA 3FBFA 1FJCA 2HQIA 4MKVA 1TMMA 3EVMA 3PYEA 4ZVFA 3TEHB 2FHMA 2VBWA 4P73A 5LSRA 3D1OA 4O0IA 3HKZD 4URSA 2VBYA 1EAYC 3GJQB 2YY3A 2BXJA 5E7OB 4ZITA 3MR6A 3UD4P 2BJDA 4DUTA 3CTRA 1HHTP 2Y9HA 3R7BB 4LSNB 3Q0AA 3Q83A 1RWXB 1REVB 2HVHA 2H65B 2ZDOA 1SKUB 5H1SV 4M5MA 3L3CA 1CJKA 5EWFA 4FXDA 1IWAA 3W60A 2E5GA 2XGPA 4X4TA 2XLIA 5G0RA 2JEGA 4YQWA 1U4BA 4ES1A 3K7RA 5DQIA 2HBZB 1VQ7S 2W4DA 2C3YA 4N8NA 2BE2A 3JQJA 3FMBA 5L9XA 2ZM6F 4Y3CA 3QIPA 4B3OA 3TARA 2YX1A 3OXFA 3EUNA 3DI6B 2WVFA 1NKEA 1S99A 2DITA 1PSDA 2W2PP 5DGAA 1P9QC 4WFYA 3G86A 3ZZZA 3LGNA 3VCDA 4LJMA 5ETKA 1R7IA 1NU4A 2VJVA 1VHFA 3Q8VA 3LWMA 1RTIA 3BR9A 3FEYB 5IWAJ 2RUSA 3K2YA 4OYXA 4ZK7M 4JI1F 1B3TA 3K89A 3BGFA 1T8EA 3G6YA 3K5LA 3U1LA 3JSYA 1SC6A 4R5PB 1FJGF 2W1BA 5CYQA 4OX8A 3MZIA 4ZVOB 4MIWA 4NA1A 3T6JA 1CC8A 2WHOA 3TWZA 3TJ9A 3UI3A 3OD2A 5KFCA 1S6QB 4PQAA 4CP5A 1E6VA 3VHQA 4B3TJ 3PXGa 5JUMA 3J7ZT 1F5AA 2XZDB 2CJ9A 2Y1RI 3PW7A 4C6AA 4OZ2A 5EUHA 1T03B 2DY1A 2HYIB 4L75A 4DSIA 1IBKJ 1RE1B 4RUHA 2JL9A 3KDOA 2A0FB 2FZCB 1MROB 1TELA 3H5SA 1NSQA 2KG1A 2V67A 2EK6A 3K5OA 1G4CA 1U2RA 4G1QA 4NYZA 2DXFA 1KLMA 2KYZA 4ZJQA 3NNHA 1R8CA 1D8YA 2JC0A 1SKWA 4KO0B 3O2IA 4K2JA 5ETPA 5C24A 4IOCQ 3QGHA 1LWEB 2E1CA 3IBCB 4ZJLA 1QAXA 1RT3A 1VK3A 4KKOA 2P9EA 2DVIA 3KLHA 4I6WA 3BQ2A 4QYRA 3CB4A 1VQSA 2XNQA 2AEFA 4F7VA 2GIFA 2XI2A 4A8QA 2LDYA 1HBMA 1T94A 2IFXA 2LXIA 3I0SA 2Q6BA 4DX7A 2A18A 1P1LA 2Y1JA 3BDPA 2IBOA 3SSQA 3GIIA 3ITHA 1JXVA 5BJRA 1GMWD 3BQ0A 4CLZA 3ENAA 4ZVGA 1SI9A 8AT1B 4F4AA 2KM8B 1KHWA 3SV3A 1UZDA 2XSJA 3D5MA 4OI6A 4O44A 2P2CB 3KG0A 3BEGB 3D1QA 2R7TA 4TQRA 1LK5A 2ZNYA 1LXNA 3M05A 3IBFB 2LECA 4C8MA 1S1XA 2IYGA 4FBUA 4HACB 4LR7A 2GGPB 4PCQA 4XTTA 3P5BP 3Q24A 4NLPA 3DXBA 1WUUA 3TOQA 4DR7F 4KV8A 2DNOA 4DEZA 3GYGA 4RNFA 3DGPA 5J2QA 3I0RB 3Q22A 1QSSA 1RWVB 1U45A 4XPCA 2DNPA 3KDNA 1KC8T 2QA1A 1TU0B 2M7SA 2FY1A 2YQ0A 2NZCA 1CJUB 3D6HB 3NGKA 2W9BB 4M5LA 3TO8A 3R2DJ 4QWAA 4CT8A 3HSJA 1WI8A 4I67A 3EM1A 3J7YU 3K59A 1RISA 4O3OA 1FXDA 2G2ZA 1X5TA 1JLBB 1VR6A 1C1BA 3KUHA 3L7OA 2GJFA 1Y3JA 1Y4ZB 1WF2A 4GRSA 4O3QA 4CWBA 1RWPB 4IO1A 2EK1A 3HJVA 5BYQA 3G82A 2ZM6J 4A8WA 4WKRA 1B7YB 4RUBA 3TP2A 3ZZYA 5DS7A 2BABA 2MQNA 1F5CA 2IRXA 2HVDA 3H4BA 2IVYA 5THWA 3D9BA 2HHQA 4EGLA 1D3WA 2HQCA 2LVWA 1JXLA 4XDDA 4FS1A 4ZPAA 2VKRA 4H54A 3O8WA 5F8NA 2UVRA 8ATCB 1HI1A 2C3OA 1TVRB 2BJ1A 2ILZA 2GFFA 1S0OA 1FFSB 3PKYA 4JI8J 3DOMB 3GSIA 4JI1J 1KKHA 1QDUB 2OPPB 1FI4A 5GADI 1VRTA 5KFZA 4DSEA 5K8MA 3NY0A 1X7VA 2OHDA 1U0HB 3UR0A 4KY3A 1IBMJ 4CTAB 4F04B 2ZC3A 2FLLA 1SC3B 2I5JA 2IYIA 5BXIA 5HATA 4BDPA 2NQPA 3OLAA 1FRHA 1OSCA 1WC3A 3GMGA 1RT6B 1X8DA 3N79A 2DK2A 5JXSA 1H6KX 2HEKA 4C8NA 2VQEF 1S79A 3D6MB 4CLFA 4NI2B 3KK2A 2WCXA 1X4EA 2ATLA 4CH1A 3TEGA 1C4CA 3EPIA 2NXEA 1ZPWX 5IT4A 3ILJA 3PY8A 4B3RJ 3FZ2A 5CD4A 4ZVTB 4P2SA 4JI6F 1Q8IA 4L6V3 3FFIB 4RU2A 4LVNP 2CQ1A 3VAJA 5H9EK 1HNWJ 1G7CB 3P6YC 1KQFB 4RNNA 5DG8A 1QTNB 1N6QA 2DGVA 3C15B 5HN0A 4XO0A 1XWLA 3TX0A 1N56A 3GR0A 2RB7A 3PW5A 5F8GA 3R27A 4FYWB 3GJSB 4DPWA 2GQQA 1YJ7A 9ATCB 3BPDA 1FT8A 3H0PA 5E3PA 1JLFB 2PD1A 1PILA 1AFJA 4YR3A 1KEKA 4HEA9 3FDSA 2Z2MA 1KBRA 1TL3B 3THTA 4LRDA 2RNEA 3MTJA 5AXKA 2B3TB 3CC2S 2ZBPA 3SBMA 5D4NA 5F41A 1FRXA 1RAAB 3W66A 4H4OA 2J9DA 4PABA 1VC0A 5IV3A 3IWXA 4C8YA 2KI2A 5I4MA 1H38A 1DQAA 3IAS9 2YWHA 4X4OA 2KJVA 2RU9A 2HWHA 3ZTQA 2LYVA 1T11A 3UPFA 3AH6A 1FVQA 1JLQA 3QO9B 3RU0A 4OHVA 1R31A 2KVIA 3GLJA 4BWJA 2ZC4A 4X64J 4PXCA 1YLXA 4O23A 4GC7A 4DX6A 3UCGA 2RQKA 2DNMA 3F41A 5H9FJ 2BACA 3W8GA 1S0MA 4I2QB 1KTVA 2KDOA 3GFYA 2HS0A 1BQMB 4PXEA 3H7HB 5L9NA 3D66A 4Q8EA 3EDQB 1UEUA 4GKJF 4ER8A 2QX0A 3EDRB 1HFEL 5LXRA 2CQHA 1YDLA 4M5KA 5KFXA 4UT4A 1MMDA 2J7UA 4JI2J 1WNEA 4DQPA 2HG4A 4AE5A 2CPJA 1MLAA 1HNVA 4DUZF 3BKUA 3UN5A 3QZ7A 4A46A 3CJ2A 2Z4PA 3DDIA 4DPOA 4Y2CA 1RDRA 3WX4A 3AAWB 3KLFB 3X1LB 4KH1B 4Q7AA 4AXIA 3MTKA 1W7WA 4IDKA 4CH7A 2D3ZA 4W92B 3HHLD 4K5RA 5JVHQ 4R0EA 5E33A 3HPOA 1JKHB 2PIIA 3JS9A 4RNHA 4BWMA 5SZTA 1RLDA 2YWGA 3MM9B 8RUCA 3GFZA 1U1OA 2DTJA 5E0OA 4GO7X 1OY6A 2FUG9 4EBDA 1CJVA 2CQ0A 5KT5A 3W7BA 2PFFB 2RQMA 3PW2A 4WTYA 4HTJA 3V6DA 4IFYB 1SKRA 1M0SA 1NKCA 5L46A 2XY7A 3LQVA 1YKWA 3EGNA 4DG1A 3HHKA 2X7IA 1JLGB 4N8OA 1N5YA 3WIUA 4ZIVA 5HROB 4HDHA 4OYWA 1U8WA 4H4MA 3C6UA 1XNRF 2HHUA 4DR4F 4PEOA 1FCAA 2DNNA 1VMBA 2J0XA 4RWXA 5CCMA 1QSLA 2PMWA 2WW4A 1MWQA 2BKOA 4AUKA 2DEIA 3QYYA 3ZZUA 4QWEA 3J7YI 1T9WA 1K1SA 1H73A 4WF9Q 1RAIB 1HMVB 2ATCB 1KFSA 2ROPA 1S59A 2G0CA 1Q5VA 7FD1A 4WIQA 1QM9A 3BO3A 2CPXA 4ED2A 1UZHA 1FNOA 3OTEA 1S1TB 4WPAA 4OJGA 2PT0A 4B3MJ 4U7UK 3DDKA 2H5EA 2JWNA 3N01A 3B78A 2HNYB 1VCTA 1NZAA 3AB4B 2M88A 5ETRA 3TI0A 2H54B 2FVRA 3D28A 1SIWB 2J9DE 2DNLA 3NP5A 3UQSA 3QFWA 2HGMA 2C2NA 2AU0A 4A8SA 1O8BA 2ZZMA 1RTHA 2UP1A 2FIUA 1LXJA 5KFLA 3M32B 3CCMS 1N0UA 2MLXA 4FYVB 4DV4J 1MNEA 3OR2B 3BBFA 1K44A 2KH9A 2BJ8A 2WVEA 2ZHOA 4DQIA 2OEJA 3FRZA 2DB1A 4ZN1A 2RJZA 3DXSX 1MU2A 2E1AA 1NUEA 1M5SA 2KKHA 1Y3KA 1IVZA 1S9EA 2HLTA 1C1CB 3DGVA 2XMAA 1T9YA 3PHEA 1UA0A 3AHPA 2E7XA 3VAIA 5EWGA 4QOTA 1S6PB 4JI4J 2CQIA 1S4EA 3Q89A 4IH7A 1FWPA 1FDBA 2PEHA 3PX0A 2QG9B 1U1MA 4DR3F 2D3O1 3N5BA 3UR3C 5KG2A 3C14A 1SVDA 4KBIA 4KHRA 4IG3A 1WKJA 2J9EA 2XB2D 1V3ZA 1HD1A 1VYAA 2AW0A 2E5IA 3B4DA 2UUBJ 3BF4A 3C66A 3R7SB 3UE2A 3R5DA 3MGJA 5HMWA 4KT0C 1HI0P 2V2KA 5J2NA 2HVIA 1E6YB 2Z30B 3OJSA 1PJ6A 2FPHX 4RBVA 2J6TA 2E9TA 4NZ7A 4EBCA 3CCTA 4TYBA 3WZ0A 2UUWA 2MMYA 3A8KA 4JI5F 2XTJP 1VISA 2OJ3A 4Q0BA 4GKJJ 3JSMA 1SQGA 1IXKA 1SUQA 1RBAA 2UXCF 2W9AA 2GAGC 3IR7B 3IG1B 4JP8A 2CDQA 1F1BB 1RABB 3M1VB 2KL8A 3QBCA 4K4WA 3SCJE 3M6VA 2I6WA 3TR5A 2J0WA 3T3FA 5DETA 3CDAA 3OTOF 4U95A 5IS2A 4ELTA 1S10A 4K59A 4DL5A 3OUYB 3FCWA 4UOFA 1VQYA 5HQ8A 3CD5A 1SH3A 4URGA 3MFHA 1IUJA 3ZTRA 2V68A 1U6BA 1S9GB 2C28A 4X84A 1HNIA 1SV5B 4DZDA 1K1QA 3TA0A 2EC2A 3HFZB 3GQCA 1LFWA 1HNXJ 2AWZA 4J37A 3K5NA 2H4YB 3KK1A 2MZQA 2YKNA 1U09A 1TL7A 5LSOA 1S1VA 4FF1A 5LXYA 4J9OA 2FJDB 3M6WA 3M8QA 3DRPA 3DOLA 2WTFA 2CJKA 1UEVA 1HQUA 2ZD1A 2ASJA 3MM8B 1XMBA 4CLWA 5K9FA 3VGTA 1M90T 1D9DA 1X4AA 3DC2A 2WBMA 5L8RC 1RT4B 4Y2AA 1OO0B 1S72S 1W26A 1T95A 4F3OA 2V50A 4CH0S 2LU2A 5K14A 2OTJS 2AYMA 4AL6A 3NS7B 1FKPB 3UWTA 3V6JA 2JHEA 2WSEC 2YPZA 1S7IA 3MXHP 2R8IA 3Q2TC 1EZZB 4DSKA 4MKAA 2MQOA 2QV6A 5D0GA 1U6ZA 4GMKA 3VV2B 2VG5B 2GZOA 3R9LA 4OYMA 5KT3A 1X31C 4WYWA 4V19X 2X1BA 1RKIA 4CCHA 4YP3A 3MMAA 5B0FA 2KT2A 3PJWA 4NE9C 5KG4A 1UKUA 5E2QA 2AJ4A 1KQKA 2VFVA 2AJFE 3ENWA 2CJBA 2HNDB 3CJ0A 4IG0A 3Q23A 1M5HA 3B82A 3FJ2A 4K4ZA 1XNQF 1PJ7A 3ILLA 3QLHB 2JFKA 3U02A 2DCUB 4DL0C 2YNIB 4LFCF 3ULHA 1X0PA 1U48A 3ZNUA 1CC7A 4HL9A 4O3PA 3H42A 3K8VA 4M5NA 4DR3J 5I3QA 4QBUA 6FDRA 1CSJA 4Y6IA 2C22A 3SYZA 4YB6A 1PAUB 3GTYX 5AE2A 2W7PA 4JB8B 2JC1A 2VDIA 1N5SA 3NOCA 2BUNA 3GJRB 3W2VA 2P6TA 3RRGA 2BJ3A 5F8JA 3MECA 2CZVC 5KT6A 4YFUA 4OFZA 2I2YA 1DLOA 1WKKA 3NBPA 1UP1A 2JRSA 1UWAA 1WEXA 1XMQF 5KFJA 4DMZA 3H8YA 3MEDB 3DLKB 2XULA 5KTQA 4U9RA 4OJHA 4JI0J 3PHTA 1KOHA 4YN3B 2C2DA 2OAUA 2MGZA 2DY9A 4JI5J 4NXNF 3OQ2A 4CM0A 3RYLA 3TAPA 4ECTA 5KT4A 1X4FA 3C16A 4QWBA 3OBIA 1YWXA 1WACA 4PUOA 3ELHA 4DI6A 2UXCJ 2Z2YB 1F0XA 2LU1A 2OSQA 1WF0A 1X4DA 3KG1A 1MW7A 1UA1A 5A0YB 1HQ2A 2ZKTA 2DISA 2P5VA 5ETMA 1GMUA 4KSEB 2N4DA 3CW2C 3MPDA 3DLBA 1NXIA 1XJWB 2MKSA 1B64A 1WTFA 2AX0A 1RGVA 3GG0A 4RUCA 3OTOJ 2WSCC 4LFAJ 2QYGA 1N32F 1HQEA 5HP1A 2BQUA 2HS3A 4RW8B 3PRVA 2I8EA 3KJQB 1X9WA 2CZ4A 4ZVPB 1GT8A 1WEYA 3ISZA 2YPYA 3KLEA 5KFTA 1ZAWA 4NLYA 3G6ES 4LBPA 5KT2A 3NS6A 1TKXA 4I1TA 2VOOA 3KLIA 5H9FK 4ZIWA 2DPJA 1I5OB 1XR5A 5KFPA 1M1KT 4Q43A 4OYZA 2KU7A 2VG6A 3RJMB 1VC6A 1ZM9A 4OZ1A 3M8SA 4DV3F 2RRBA 5U47A 3H2VE 4LSLA 4LT6A 3CSKA 1MG7A 1YRUA 3S01A 2OPRA 3OTCA 3I56S 3V5RA 2EG1A 5HJYA 4C98A 4MT1A 4C8OA 3HHLB 4FPRA 3QJPA 1PAEX 4A8KA 4X4QA 5I42A 3DHXA 1LWCB 2Z56B 2DGOA 3CDUA 4K2XA 1OSDA 2AEJA 2BVZA 2V5HG 4DR5J 4CNZA 2G1HA 1LW2A 3LP2A 4C7QA 3C8YA 2VZ9A 1LFPA 3MWBA 1N0VC 2LEBA 5HSPA 1IR1A 1TKDA 1FA0A 3KHRA 2E7WA 4WIIA 3THPA 2V8VA 2JLEA 3BBBA 5CQGA 4LF4J 4F02A 2DXDA 3HI9A 4FN5A 2H48B 2FQQB 3GFHA 4Y28C 4J9UE 1FK9B 4TLRA 2VV5A 1WDTA 3M2RA 1X4GA 1APSA 4FNHA 3BKFA 2ZJRQ 4Y00A 4M5GA 4NYPA 1PBAA 1VFJA 3KJFB 5KFMA 3OTBA 3NCQA 2XHWA 2E9ZA 1W2BR 4ZCKA 4U6PA 3LP0B 2E44A 2CRLA 3ENVA 3CJKB 1UAWA 3ILOA 1MN7A 5CABA 2MKKA 2QE5A 4U96A 5AXNA 2GIRA 1I51B 1S57A 3DU5A 4KGKA 2KG0A 1S6OA 2M2BA 5I3UB 4ANCA 5EHHA 2UUTA 2J7WA 1VJQA 4NPOA 2COLA 5CZXA 1UETA 2GMJA 1XNQJ 2ILYA 2KYXA 3MD1A 3RB3A 2G4BA 3DMJB 2Y8YA 1S1WA 1EETB 2PE8A 3TA2A 4YY3J 1CVJA 5DLFA 9RUBA 2HPUA 1SJ1A 4USVA 3IC1A 2OELA 4WFAQ 3V4IA 1MWZA 1RHRB 3V2UC 1F2HA 2HHXA 3M8PB 3UN2A 4YDDB 4FZVA 2X3GA 3FSXA 1Y10A 1N5QA 4RW7A 3KOAA 4KH0B 3ETMA 2AV5A 1SPBP 4C3KA 2DHHA 1JLCB 2GA7A 5HMZA 3CPWR 2RDJA 3LA0A 2LEPA 1GK8A 3TZZA 1RHJB 3HZGA 4OYAA 1ELOA 5HANA 1XMQJ 1HR0F 1NRKA 3CCJS 3RR7A 4WFBQ 1FDNA 3KKFA 2MDAA 3MCSA 1JNZB 3AOCA 4PWDA 2GC8A 3CEDA 1TV6B 3J7A1 4AFFA 1RLCL 4OZNA 3DFEA 4QIWD 1I6JA 4AQYF 1ACMB 2MXYA 1VQLS 1T9UA 1F6TA 3OL7A 2VKZG 1AA1B 2EFOA 1HYSB 4CQ1A 1TUVA 1QAYA 3W3SA 4B9MA 4X4RA 1WG5A 2IY5B 1TZ0A 2CADA 3BGRB 4YR0A 3G8TA 3IM8A 1OY9A 3VAHA 3RW7A 1N32J 3KMQA 2UVUA 4LRAA 2HQFA 4WFNQ 4JOUA 1FE4A 4UOCA 3C46A 3LANA 2W4PA 2ZUGA 4P7TA 2ZH6A 1KRPA 2YNGB 2B5JA 5J1NA 2CJYB 5IC6B 3FSYA 4L3NA 3HM9A 4ZOSA 2GVDB 1QVGR 2CWXA 3M30A 4OYBA 2ZBCA 3AODA 4PZVA 2F4VJ 1R0BG 4DV6J 3MR5A 2XQCA 1FDAA 1RAJA 1H0HB 3T41A 3QT6A 3DDNA 2PN6A 4MFBB 1G1XA 2BANB 2M8HA 2XBPA 3CD0A 1FJ7A 4X62F 3DOKB 3OW2R 5LOQA 3TUIC 2H3EB 1NK6A 2I1RA 2QFJA 4DV5J 1Q86T 3LGMA 3UDLA 4DV0F 2WONA 3NGSA 4ECVA 1FRJA 2QT7A 2OSRA 1UFLA 4G1PA 3EGWB 3GU0A 2ZITA 3BO2A 3W2WA 2FZKB 3JB9k 2HAIA 1S1UA 4LQ9A 2NCKL 2R7QA 5HBMA 4EEYA 3MUMP 3IWNC 1NJWA 3ENQA 2BBEA 1XMOF 2RRAA 1YHQS 2EFPA 1CJKB 3CWJA 5G0RB 4TLQA 3UNGC 3PIPQ 2DHGA 4J9NA 3SQGA 3SDEB 2BE2B 1FFGB 2WW8A 3OVAA 2NXJA 4IFVA 3QIPB 4B3OB 1S5ZA 4P2XA 1PYOB 1H98A 2BE7D 2FY8A 4IOAQ 4OYIA 2CKWA 4F36A 3VGVA 2HFZA 1R0AA 2HMIA 4JI7J 3I5CA 2E1PA 2XLJA 3SIPB 4PKDB 2VPWB 3OHAA 2EI5A 1KONA 2SXLA 3JQMA 3HHEA 1QLNA 1RTIB 1REVA 4K4TA 1FKAF 3H5XA 4KJIA 4DN9A 4CLSA 1G3OA 2HGNA 3U7JA 5A6WA 3PTWA 1GMVA 1IBLF 3D3BJ 3ETOA 4M1KA 3NAIA 1TKZA 2HK3A 1JXEA 2YXLA 1RI7A 5LMNF 1NO8A 5EN1A 3WHIA 1XEZA 1YJ9S 3PRBA 3POTA 3I4HX 5CYQB 2W2MP 3PEJA 1NB7A 1YZ7A 5K8PA 4F50A 3PW0A 1M5PC 1P8GA 2DHAA 2VQFJ 4K7QA 1E6VB 2HHHF 1KR4A 4OL8A 4ZLLA 1ZM3A 1UFWA 4DPTA 3FQKA 2XZWA 2V8GA 2WVBA 3PKMA 3WX8A 3T6BA 2Q6CA 5A8WA 2JJ4D 4OV6A 4X4VA 4Q44A 4LF6J 3FVYA 4QR1A 3MFIA 3W5ZA 4Q5VA 3F56A 1UVLA 1FEHA 1HWLA 3EVWA 4CT9A 2R7UA 3TAMA 1YSJA 3G8QA 3MAAA 1LEOA 3FSIA 4G1QB 4DQQA 2WRMA 2VH7A 2GIQA 2DO0A 3W9IA 2F4FA 4IR9A 1HHQA 1I94F 3BBCA 2OKQA 4USJC 4ZA1A 3PFEA 4AL5A 5ETOA 5C24B 4JYAJ 3Q8SB 1C0UA 4IH5A 4P6QA 1RT3B 4C9DA 4KKOB 4KGZB 3DRRA 4O3NA 3KLHB 2ZE2A 1N5VA 1T0TV 2DHSA 1DTTA 2VA3A 4TN2A 3R97A 3U27A 1AFIA 3K58A 1FHTA 4X4NA 5GMDA 2W9CA 1C0TA 3F44A 4C8ZA 5CD4H 4OHYA 1FRLA 2Y3YA 1WSVA 2VG7A 2MHNA 4DSJA 3HF5A 1RWKB 3ITHB 5L1IA 4EI2A 2HFVA 1NDKA 4AT1B 4YB7A 2ROEA 2KM8C 4G1IA 3HO1A 1GXLA 2YWWA 3KWMA 4DL6A 3QPIA 1O6XA 5KFUA 2X3DA 1ICEB 3BGLA 1HW8A 2XSJB 4TY9A 1B4SA 4O44B 2NXUA 2OPQA 3HLUA 3M6XA 4M63A 3PM9A 1V9OA 1S1XB 3IGVA 4FBTA 2PMZD 3BB5A 3ZZOA 2D9OA 2AYEA 1MN9A 5HL7Q 3FMWA 1U7LA 4PG8A 4KV8B 3JYTA 5IXUA 2F65A 2HQ3A 2J5AA 3DGPB 5J2QB 2W2NP 3HSZA 2OFHX 1FRIA 4B9UA 1R43A 3KFWX 4ZPVR 2ZBRA 1UWBA 5KFGA 1XMOJ 1C1BB 4ED5A 4CYUA 2KT5A 2HQDA 4KQZA 3WC0A 5HO4A 3GJTB 3CF5Q 2VU5A 4OYOA 3OR1B 2HIQA 1JLAB 3G82B 2CUYA 2D1CA 5LJ3Y 2V9WA 5B08A 2GVZA 3IR6B 1HLWA 3T5KA 4CNYA 2AJ2A 4M8LA 1NSPA 5KG3A 4DV7F 2EW9A 3TW0A 1YRTA 1FERA 5CYMB 5DM7Q 3ICLA 2YX4A 4TYAA 2M4MA 5T41A 3RAXA 3GPAA 3V6HA 5ETQA 2RU3A 1K47A 2LDIA 2EVZA 4DS5A 2CQGA 3N6LA 1IR0A 1VRTB 4WU2A 3QIDA 2MY8A 3RB0A 3EGVA 2B4OA 2BYCA 3EWGA 2FJAB 2CFXA 1U1PA 4DL2A 5C5JA 5HQMA 2ZJPQ 3GFXA 1YQHA 1RA6A 4NEZA 4L72B 3T1HF 2I5JB 2YKOA 3LP1A 1ZZFA 4IOBA 4J9KA 2DO4A 3FEXB 3FQLA 3PJ9A 5B0AA 2LEAA 1W25A 3R6LB 3PACA 2VDHA 2VONA 3M8YA 4UUWA 2W25A 4FNIA 1XC9A 2QIFA 5E3AA 4J90A 2WVDA 1Q81T 3KK2B 5DDQC 4NEYA 3D2WA 1N48A 2U2FA 3ZZTA 2KFNA 1WG4A 4LREA 1N33F 1BHNA 1FJEB 2R8JA 1B7FA 1IJEB 4A8FA 2N4CA 5DQGA 3KLVA 1GTEA 1B99A 1JJHA 4OHXA 2O67A 3IRXA 4ZLNA 2XWXA 5DG7A 4W90B 1N6QB 2V94A 2KZMA 4ZN3A 1S9FA 2R7RA 1Y11A 2FLOA 3TX8A 1QVFR 2BRKA 5LJ5Y 1LWXA 2A6MA 4ZVHA 3I9ZA 3SZ2A 4G6VB 4LF2A 3BYPA 4IRKA 4JBCA 1NK7A 2QLWA 2CQCA 1AYEA 1N4LA 5DO2A 1S48A 5A76A 5GMKa 3OV7A 1RAEB 1RT7A 2C3PA 1K8AT 2IM3A 4OI2A 1SQFA 2NXCA 3RGIA 5D78A 4H4OB 4OV1A 2UU9J 3HK2A 1TFYA 3O44A 4F3MA 5IT9Y 4KR0B 3TRGA 1UVKA 2C2KB 2VBZA 3THVA 3I4PA 4KTQA 2Q1LA 5H9EJ 4RLEA 2FTRA 4TQSA 4ID5A 2NYIA 2R2UA 2DNKA 2W2OP 2JEJA 1JLQB 1KFDA 3J80Y 5A8RA 1K9MT 4ANDA 2G2YA 1ZAXA 4P74A 2QO3A 2H4WB 4X2BA 2QC3A 4OZJA 4YR2A 2RQ4A 4QCLA 1UTAA 1Q7YT 1F5BA 4QR2A 5B0EA 1CQMA 4RW9A 3CJQA 5KFKA 2IA6A 4B3TF 2E5LJ 4D3HA 1O0PA 2AIRB 1RA7A 5BR8J 2DH7A 1OYEA 2MZRA 3D0GE 1WC1A 3UFCX 2W4CA 1TTHB 1GNKA 1VJWA 1NBEB 1HNVB 4HT7A 1TK0A 4X66J 3RRHA 1IBKF 2KN4A 3WBZA 1YJTA 3TAQA 5DLGA 4IDKB 1PC5A 3ILIA 2UUAF 4PG7A 1M5KC 2MQMA 3MDFA 4UF4A 1TUGB 3PCOB 4NLTA 3T5LA 2CQBA 2XO7A 2X1GA 1MWYA 1Z1ZA 1CJVB 1CS4A 3H5UA 3V6DB 2VC1A 2LLZA 5F3ZA 1HWKA 3D6TB 1AT1B 4DG1B 3TVZA 5FDLA 4XIUA 4N77A 5I3PA 1NEEA 4JV0A 3Q8YA 1PIEA 1X9MA 4Q2LA 1YJWS 1N5YB 2MQ8A 1VIXA 4D3GA 4M5IA 2JFDA 2AP6A 2C3UA 4H4MB 2F1FA 3C6UB 2DH8A 3NGRA 3P4UB 4NLDA 2LKZA 1Y00A 4P52A 1R8PA 2ASLA 3J80U 3KK3A 4M94A 3HVTA 2G13A 3D0IE 5HVGA 1RP5A 4NLXA 4QQBA 3PG9A 1JLEA 3EJMA 2FVPA 2K7KA 2HGLA 4NWBA 1NPPA 2VFUA 3T1HJ 1VBYA 5HMYA 3N0VA 4OZ0A 4QYZK 5KOXA 4ILMA 3UCZP 3H5YA 3CJSA 4EYHB 1I3OB 4P10A 1VQNS 3BS9A 3ZZPA 3G6XA 2OD4A 3CULA 4HHHA 4DR1J 3UD5A 1I1GA 2CAJA 3RRKA 1GTHA 3TVYA 1YJVA 2J0SD 3U1NA 4DFJA 1U2CA 2FJEB 1YJUA 1IJFB 4DF4A 2V63A 1K0TA 4GVLA 4UZCA 1ZAVA 3QGGA 1RTDA 5KFWA 1N33J 4RO0A 2BW2A 1AUSL 4LUBA 1RTHB 3TUPA 2P9GA 4FF2A 1TFWA 4ED3A 4M5HA 2M0GB 4IQMA 1Q16B 3BV8A 1RWNB 5LSLA 4TXSA 3MF5A 2RAQA 4ELUA 4UY8T 3HHNB 3VQSA 1MU2B 4LF7F 4MK8A 1S9EB 5JMNA 1BQXA 2X1AA 1FNMA 5L1LA 4UTGA 2VASA 3VAGA 2HBYB 3RUBL 4DQRA 5GVQA 4O4GA 3ET6A 3M4XA 3RB4A 1GH8A 2DGWA 1X4HA 3DYAA 2CJAA 4EU0A 1D0EA 1ZPVA 2Z2LA 3CCUS 3KHGA 2XLKA 4X65J 3C14B 4CO1A 2Z58B 2VUGA 3BREA 4IG3B 1RSCA 4O3SA 1GQEA 4MKBA 4NLQA 2QMWA 2K8GA 5ADZA 1GFWB 2PO4A 2ABYA 4JI8F 1H72C 2DNQA 5J2NB 4QJVA 2F3JA 4LSZB 3WQPA 2BM1A 2JOQA 1WD6A 3ZXWA 1ITPA 3FKBA 1IBMF 5ETLA 4OX9J 2E9RX 2HAFA 4WXOA 1R8BA 4JV5J 4HHJA 3C19A 2LMIA 1SIZA 2BQ3A 3TJAA 4QPTA 4ZS6A 1QD1A 1SC1B 3L95X 2QLBB 5FD1A 4JUZA 4N41A 3OPKA 4Q0BB 3JSMB 4CRJA 1U49A 1SUQB 4QIVA 4DQSA 4NXMF 3A3PB 3K5MA 5K8NA 2YWEA 5E3RA 1PJ5A 5C25A 3OFGA 5J2PA 2D41A 3W63A 4PG5A 5F0UA 3BH7B 1KVIA 2YVSA 4DWIA 4F25A 4B3RF 3NEKA 3BKTA 3I5AA 4HT5A 2R7WA 4F4XA 2KFYA 2KT3A 3IA0A 1KVJA 2UUAJ 1HNWF 2ZH9A 4ZVEA 3ZZRA 2HBRB 2UVVA 2XMTA 4WCEQ 4BLGA 3I6PA 3ZC4A 1IKXA 2JEIA 1JJCB 5FIIA 3PZPA 5HVFA 2WK4A 2HHWA 5J1PA 3A8IA 1HNIB 3NL0A 4BS2A 2N7YA 4F67A 2MPUA 2DHXA 3VVUA 3R7NB 4I2PA 3T5HA 3ZZ0A 4C3LA 3UDVA 1HWUA 3IG1A 1WKLA 4KB7A 3KK1B 2YKNB 3R6GB 1IKYA 2IJFA 1TL7B 2P8IA 3EPGA 1BLUA 1S1VB 4ZCIA 2JVRA 3MHYA 3DRPB 3DOLB 4LBIA 1SJQA 3OVBA 2DGUA 1HQUB 2ZD1B 1S12A 2NREA 2GJIA 2ZJQQ 1CBKA 4X4PA 2APOA 4WXWA 4DFMA 1N5TA 3M8ZA 3MPWA 3BSAA 1K73T 2OTLS 1TK8A 3GV8B 2EWHA 2WVCA 4E98A 2C2EA 4WBFA 2QSWA 2ZHBA 5ITHA 4C11A 5K14B 3DRYA 3AJ2A 3VGUA 5CAAA 4HI2A 4X64F 2C3MA 2AGPA 4J9PA 3QAEA 1FEEA 3B6BA 1VC5A 4I6AA 2XCAA 2FVQA 4BCAA 3ISNC 1KVKA 3DU6A 3O6QA 3MI7X 1J27A 3M8WA 2R7OA 4JI2F 2EC0A 1BY9A 1HA1A 1RWWB 1NM2A 4RL1A 3CGIA 3GV7B 1S97A 2ZWOA 5GAHU 5FLXY 3GCXP 3N6NA 1HNZF 3MMAB 4L3KA 2C42A 4RPFA 5EX3A 5DRKA 2NZ4A 1ZETA 2CPFA 1RHKB 3TQ1A 1BC6A 4MIBA 4USKA 4IG0B 4LF7J 4I56A 2QL9B 2Z2ZA 2DIVA 2JLGA 2VPZB 4W4MA 5J2MA 2VICA 4YOEA 1F9EB 1PYSB 5DM6Q 1YJRA 2HQGA 2M5YA 1SH0A 2J8SA 2OGUA 5G4DA 3PO5A 1Q8BA 3QATA 4ZPDA 4P71A 2HWTA 5DG9A 3I5BA 4GKKJ 2QTWA 2XMUA 3TUZC 3I87A 3W2VB 3R3TA 2B4PA 2KRBA 2FJBB 4J9SA 3MECB 2AJQA 2UXDF 1H74A 1UVJA 4HH1A 1RAHB 3WC2A 1XR6A 3AA8A 5B0BA 1DLOB 4K0KJ 3NBPB 4I7FA 2QMUB 1UW9A 1FRMA 1LKZA 3VZHA 1YVFA 1F60B 5D15A 2P6SA 3W64A 3J81j 4YEAA 2AEMA 4LVOP 2YBVA 1SQEA 1EHWA 3MD3A 2QA2A 3GONA 3BZQA 2MGZB 4Y0FA 3DRSA 1LWFA 2QGFB 2OEMA 2J6UA 3QWUA 4R8UA 4U67Q 3R8YA 4Q8FA 3BSOA 1UVMA 2VBXA 1L5UA 4B3MF 2BOPA 1XTZA 1RT2A 4NXMJ 2DR8A 2A2DA 2J9CA 1CULA 4K4VA 3M2VA 3E8OA 4H4KC 4U7UD 1VQ8S 2HKEA 1L3VA 3PX4A 1MMLA 2J8AA 3TJ8A 3MEGA 1T02A 1JNRB 2CG4A 2E1RA 1H7XA 4PYDA 4F26A 4DFKA 5IM0A 2CVIA 1HQEB 5HP1B 2NR0A 4KHMA 4NL5A 3EXCX 4DV4F 3D4JA 2MQPA 3MMBA 3W9HA 2FHJA 2VHGA 2WOMB 2XCPA 3MCMA 3KLEB 4KPYA 3N28A 4IYQA 4UQTA 4ETXA 1X0FA 1TKXB 3OSNA 2LA4A 1Y5NB 5F0WA 2CG8A 3KLIB 4YB1P 2VG6B 1U8SA 1VK8A 2ZWPA 4LSLB 2MLYA 4JI4F 1TKTB 3R5GA 1T9XA 1VQPS 2OPRB 1RAGB 1BXNA 1UJ5A 4NOHA 2XY5A 2RILA 5F9NA 4FKXA 3HHLC 1CJTA 4DV2F 1UPPA 5AJ3J 1RT5A 2B7CB 2V9KA 4YUDA 4PWWA 3HT3A 1IQZA 4OQJA 1KD1T 2UUBF 4NLWA 2PA3A 5I42B 4IUFA 5KFYA 4ETZA 3PFOA 2EKNA 4DUYF 1LW2B 3LP2B 3O5TB 3JTNA 1Q53A 1C4AA 1BQNA 1TUWA 3ZO7A 3UD3P 1U1NA 4TU8A 1ROFA 4PG4A 1D8ZA 2RH3A 4OJ3A 4F4ZA 3K8WA 4QW8A 4P7VA 2HHPA 4B9TA 2PFDA 4RW4A 3M2RB 2UUCJ 3ONQA 1P6TA 2XSFA 1J5OA 2V4JA 1TK5A 2DGSA 3E01A 4OX6A 2ZH3A 1H2VZ 3PR4A 2YWFA 4LIRA 3TZYA 3MOJB 2YNFA 1QUPA 3CDEA 1QY7A 3M9NB 4RNOA 5A8KA 2VD3A 4TNOA 1N34F 3MMJA 4XPEA 1HNZJ 2OMLA 1VBKA 1LW0A 3IM9A 3EZ5A 1EB0A 2GMLA 1QE1A 2B4UA 3W8PA 1TL1A 2EFNA 3HD2A 4ECXA 5F8IA 4AYBD 5M2UA 3BQ1A 5LT5A 3MOZA 4B17A 2R2RA 3FK4A 3SFUA 2GJ2A 2HRTA 1WSRA 1S1WB 5L39A 3GV5B 4DCJB 3CDWA 1J5EJ 5ETVA 1QAIA 2RS8A 4EWTA 4U7CA 4NRUA 4C8LA 2MJUA 1CQNA 5DDRC 3V4IB 2EXUA 4R0JA 2B51A 1HNXF 4WJBA 4NX9A 4RW7B 2CJQA 2LQBA 2RKIA 4Y2IA 4B9NA 5JVGQ 5F8MA 2F8EX 7AT1B 2MY7A 3GE9A 4MYUA 2UXDJ 3IS9A 1NHVA 3MMCA 2CQ4A 1ULRA 5GAHI 3RBDA 4J7CA 2IM1A 2MZJA 2BRLA 3T1YF 2FVSA 4PWDB 3IAM9 2L9DA 1URRA 2VF3A 2B0GA 5HAOA 1XBWA 2MKHA 4X4UA 4NMLA 1QJHA 2B9WA 2BKPA 1IWGA 1K0VA 3QT7A 3LAKA 4QIGA 2AKWB 3NGUA 3V6KA 3QJLA 2G1DA 5MLCV 5KFSA 2DNYA 4ZJOA 1JLCA 3MUTP 3PO4A 4L76A 3FGVA 4ZP9A 4M5JA 1XR7A 2BW7A 2QMXA 2NSBA 4HR2A 2ASDA 2H9ZA 2Z0GA 3HT0A 4MKYA 2Y0BB 2L9NA 2BOAA 1V3RA 2B5JB 3LAMA 1WC5A 4C4WA 5B7WA 3ZTSA 5GMEA 1U1KA 3ADAC 4LFBJ 3M30B 1NDCA 1HBUB 3CMAS 3OFEA 3FC9A 1S6UA 1NPRA 3I32A 4ED1A 1S77D 2DCLA 2GHPA 3NCPA 4LR9A 4MMOA 1R27B 5E41A 4PXBA 2AQ4A 4DV2J 1Q0NA 2L3MA 4ID8A 1OS5A 4IRCA 1RZMA 1WEZA 1U25A 3GIMA 2XNRA 2ZH7A 4K4XA 3UN3A 4ZCMA 1ZZNA 3VAFA 5ETSA 1F9FA 4DUYJ 1IKWA 3R1HA 2WONB 2MKIA 1ZA2B 1U24A 3LGHA 4ZPWR 1BWEA 1FWLA 3M2UA 1HBNA 2ZOMA 2GV1A 1JMTA 3O3LA 2QL7B 4JI0F 1OPZA 1WHWA 2AZ3A 3T9ZA 4FF4A 4EZ9A 2RSQA 2D3UA 5EDWA 3TZXA 3LF0A 1VDHA 2V6AA 3W2WB 2C2ZB 2CJXB 4IH6A 5HLFA 1S1UB 2W2QP 1CG2A 5HBMB 2BEFA 2E5JA 1X5SA 5RUBA 2IVFB 3EZUA 4OZ5A 3CCES 1URNA 2BANA 5IZHA 4IO9Q 1KP6A 3CCLS 2FJXA 3JXOA 2EEYA 3MEEA 1N34J 2B43A 3SQGB 3SXLA 1R0CB 2YKMA 4IKAA 1D9FA 1WWHA 2HFOA 2QSFA 1OWXA 2KJWA 4IFVB 4B08A 4EO6A 2W8LA 1O5JA 2RRNA 4LQ3A 4LFAF 1KQGB 1WTBA 1VGYA 4QZVB 4DXLA 5KFDA 2F8HA 1R0AB 5KG6A 2HMIB 2RIJA 1EP4A 4MYTA 3GWCA 1GX5A 5AT1B 5KG1A 3AOBA 1AXQA 1NCLA 2YQ1A 5LM7E 4NRTA 3CCWA 5KFQA 4MJKA 2DNGA 3NWRA 5GADU 3A3OB 4E0DA 5KFBA 4N7TA 1FXLA 1YBUA 1M5VC 1PYTA 5KAKA 3CIZA 1HL6A 1UVNA 1VQMS 2V8HA 1TKZB 2LP4A 1DZ5A 3VR1A 2AD9A 2K3IA 4EFAC 3SDEA 2B9EA 2YKQA 2XC9A 3POTB 3CO9A 4HTIA 3UO0A 3SQOP 4CIOA 2YH1A 1YITS 3RAQA 2HZVA 1QAJA 3M7VA 4DR5F 3VALA 3T1YJ 2KO1A 5C2CA 2IRYA 2KXFA 5CA5A 1RBOB 1RAFB 1Y5IB 3BH6B 1W2IA 2OO4A 4KGMA 4ZP8A 5A8WB 2DR9A 2EKYA 2A2CA 4LF4F 3OJUA 3AOAA 4JI3F 4PYAA 3TAMB 3KLGA 1VLOA 1NLKL 3MAAB 3HSGA 3NAHA 4LIWA 5M2PA 1FX2A 2XM3A 1Q4RA 3CJ5A 1HPZA 3KXDA 1YGYA 4ZVSB 3KNAA 4ZP6A 4ERDA 3SCKE 4QWDA 2OLWA 2QFIA 1H2UX 3QJJA 1C0UB 3HVWA 5SUHA 3DRRB 2VB6A 2XG8A 2O01C 2ZE2B 3QRQA 1ZTWA 4LRCA 1DTTB 3TA1A 1HBOA 5IV4A 3H20A 2W9CB 1C0TB 5KFNA 4ZPTR 2H5JB 3H40A 5T7LA 2VG7B 4BC9A 4KHPJ 2IC3A 1A6LA 4CO5A 4WZMA 2VA2A 2VPXB 1EARA 1HHSA 1NPKA 4DZ6A 3DLJA 4OIXA 1U26A 1DRZA 3I31A 4YY3F 3U1MA 5HI7A 2AGQA 4CLUA 3CD6S 2OPQB 3OTDA 2XO6A 1YIJS 4M5DA 3CC4S 2R42A 4GC6A 2FB0A 4B3SJ 2FYXA 5J1EA 4LF5J 3L09A 4J9MA 4N76A 3HX9A 2ZBQA 3JYTB 4WYLA 1PC4A 3FBBA 3P5TL 2W8KA 3I55S 1IBCB 1SJFA 3CUNA 4NZ0A 4RW6A 5LMUF 2CWKA 3MM5A 2BR0A 4O0NA 3AJ1A 3AXKA 1IQTA 2QJ3A 2FLNA 4TY8A 2QYCA 3MM7A 1OQ6A 2K1RA 2HHSA 2DIUA 5KT7A 1UWBB 1G6BA 1ZTTA 3G8SA 2UXBJ 4DSLA 2NUHA 2MSTA 2R3VA 2XWYA 5ETTA 1JJ4A 2DXEA 1Y0HA 2IAJA 2FLPA 4CYUB 3NKYA 1N8RT 3BYRA 2IMOA 5KFVA 3JTOA 2VJUA 2JLFA 4PAAA 4EO8A 4KFBA 4QW9A 2V4RA 2QEXS 4EMDA 1FKOA 1NK4A 2MQLA 2GVZB 4FYYB 3M9OB 1IR2A 2G2OA 4NA3A 3NMAA 2QZ8A 6FD1A 1ZYQA 1RK8A 3Q2SC 1P27B 2DT9A 4DN0A 3LOUA 1YI2S 3RG6A 4PPZA 1VQ5S 5E3QA 3DM2A 1B0VA 3OLBA 1TMJA 1NHUA 1WHVA 2MHEA 4WE1A 3PJXA 1AZSA 1PG5B 4DV1F 4YHHF 1U47A 3MR3A 3CMES 4P9SA 2F4VF 4DV6F 1R89A 1T9TA 4A4JA 2ZBIA 4KE5A 4A8OA 4USMA 2QLJB 2WB1D 1RT1A 5AXLA 3H90A 3OR1A 1JLAA 3LP1B 2M70A 3KHHA 3K17A 4ZP7A 3TNVA 1F3FA 2Q66A 4LMZA 4UW2A 3D6FB 3W61A 2BZ2A 1NK8A 4DV5F 3KJVA 4O4RA 4OI1A 5CYMA 4ICLA 3I96A 4WP8A 1YTYA 3S1TA 4PWUA 1VHIA 1NJIT 1YK9A 2RF2A 2VL1A 4UZBA 2ZEJA 4UUXA 3ISND 4JI3J 4MIAA 4Y2MA 3V81A 1ZA1B 1UEKA 3AQOA 3IRXB 3H98A 2B6AA 1F9HA 1U1QA 1FJGJ 3FZBA 2MJNA 2JVOA 2C2RA 2IDEA 1VIOA 3CCQS 1RBLA 1QUVA 2DR6A 3G71S 1KWMA 5FJ4A 1HWIA 2RHQB 2HNZA 3MM6A 4S0MA 1WHYA 3C6TA 4FKYA 2R2SA 3LPYA 3GP9A 5A2QY 2ADBA 2PA8D 2OIHA 1FVSA 1RT7B 4PQUA 2GMHA 4ED6A 2IRUA 5DGBA 1NMEB 4OI4A 3E2EA 2DNHA 3LUYA 2CXEA 4JI7F 1D9AA 1NNDA 2HZCA 3PVXA 1MSWD 3P3DA 4QU6A 1RTJB 5DJBA 2PI5A 1NH8A 1P1TA 2X51A 1UFKA 4C3MA 1VQ9S 2CQDA 2LXUA 2CPHA 2XS5A 4ID5B 4I69A 1SL1A 2R8KA 1WOOA 2NUUG 1UJ6A 4DJBA 4ZLJA 5A8RB 3HFKA 3GYXB 2KTQA 1OQ3A 1KOOA 4XK8C 3JAMY 3N6MA 2DKOB 4OZLA 3DLGA 3AD9C 1VRUA 3TVKA 5K8OA 3FNNA 3DLEA 3QSYB 7FDRA 1T3OA 2FHJD 4F0HA 2XS2A 2VFRA 2VQFF 4OHZA 2OPSA 4RW9B 3QGPA 2J7KA 2BX6A 5LMUJ 1SJ3P 1SBRA 4F0KA 2DR7A 5K5MA 2IPOB 2DJWA 5CXTA 1WC4A 5F8HA 2MZTA 4Z37A 2UV8A 1Y9OA 3BR8A 3DHWC 4P2FA 4LF6F 1VOMA 2XEXA 2JDJA 3UVJA 5CYJA 4QU7A 2DPIA 1DTQA 5D3GA 2D74B 2GCFA 1XQIA 5KFFA 5A2QU 2MEWA 1NK5A 5KOWA 1IKVA 2RHSB 2FDNA 2XS7A 5D4OA 1Z2ZA 3E51A 3QZ8A 1NSAA 4DR7J 1XIQA 1CS4B 1S4FA 2RDDA 1Y7PA 4L74A 4JYAF 4KGVB 5CZVA 3DRXA 4KRWA 5HMXA 5FDLB 2EFVA 2DYAA 4DHVA 2W7AA 4ZMMA 4ZHRA 2I9SA 1KLNA 2AT1B 6AT1B 2YTCA 5KG0A 4DV1J 3KK3B 2D3OR 4YHHJ 5C42A 3HVTB 2M3DA 3JAMU 4GVBA 4NCGA 2RD5C 1JLEB 3MR2A 5IT0A 4FYXB 4ZPBA 1HD0A 3V4MA 3PYFA 3AD8C 1ZBTA 1H3DA 2ZVSA 1T05A 2B9YA 4RWWA 1C2PA 1X4BA 3UDEA 3SSSA 4PR6A 4DL4A 4DR6F 4J9LA 2GX8A 3VAKA 3NLCA 2F63A 2CVEA 4ECZA 2AJ1A 2V2ZA 4NCAA 4K5SA 2BDPA 3PDNA 2YKAA 3WDOA 2L08A 4DLGA 3UCUP 4WKYA 3VQTA 1A9NB 1R8HA 3FBEA 1J2VA 2K3KA 2ZH5A 1RTDB 1RYSA 4NA2A 1NB2A 1RCOB 3FBCA 1FE0A 5MAOA 1SB6A 2YNHA 4OLOA 4ECYA 2Y0SD 3IBWA 1H7WA 4B02A 1NDPA 4J5OA 1WOSA 3MPVA 4HKQA 1OYDA 2A3JA 1RAOA 3X3UA 3R5BA 1QSYA 4QYZJ 1VQ4S 4ZPCA 3HVRA 4WFZA 1RADB 1WELA 1Z4UA 1HWJA 3RZAA 2VQEJ 4O4GB 3ET6B 4F4YA 4LRBA 2P9CA 4DSFA 3DYAB 1U6FA 2F9JA 2PGCA 3GYNA 1KTQA 4KAIA 1RU2A 5BYRA 1TP7A 5L1JA 4FXVA 3CC7S 3AFGA 4LSNA 4JI6J 3MR7A 4F0MA 4J9QA 4CZCA 4DOZA 1R8AA 2J76E 3NGTA 4RBUA 3A1YG 3K5PA 4UOGA 2Y1IA 2ALYB 4AL7A 3FCVA 2F9DA 2ROGA 4KPCA 3I9V9 3EVOA 1ZOTA 4DL3A 1V6HA 2ZZNA 2O66A 2GO9A 3SEOA 2RS2A 3OFHA 3P8BB 4K8RA 4L73A 3IFEA 5D4LA 2NPIA 4I64A 5LL6d 1CEZA 4A8MP 4WWSA 3VWSA 1JX4A 2YX7A 4ZCLA 2WZ1A 3AD7C 3H2LA 5HJXA 2A6OA 3DI6A 3CE8A 2BJ7A 2KVQE 1RYRA 2CNNB 1N88A 3FUYA 3IP0A 2LA6A 2EFGA 4DL7A 3VZIA 1AB8A 5C25B 3H59A 4V1Ak 1FX4A 5J2PB 3NMRA 2DR5A 2R8GA 4AXJA 2K7JA 1NZ8A 2YQ3A 5F8LA 1WOPA 5D8HB 3ZTPA 2NYHA 4QIFA 1X60A 2MZ1A 2I0XA 3OHBA 2V2QA 4NLRA 2RT3A 1WJ9A 2ZFHA 2VODA 2PMHA 5AE3A 1KLMB 3Q8UA 4R5PA 3CCRS 3Q8PB 3NCRA 2IMWP 1IKXB 2FGCA 4ECWA 1RB0A 1NJYA 3BGUA 5D77A 2CNLB 3VVTA 1S6QA 2LCWA 5L1KA 1BGXT 3PYDA 4J9VA 4MTPA 4CM2A 3QMQA 3CO0P 4OI0A 4I2PB 2CPIA 5KFRA 4DUZJ 1HBMB 1T03A 1IKYB 1YBAA 4LBHA 2OH2A 1VRQC 2CQ3A 3I0SB 3R5CA 1DFDA 2B4VA 3CNQP 1PBUA 1T7PA 4LF9F 1L3KA 4NLUA 2UU9F 2BA9A 4IRDA 2ZOGA 1WG1A 1MROA 1Q1KA 3ZTOA 3CDBA 2JZ5A 2FJWA 4A47A 2ZOFA 2HS4A 1NSKL 1FD2A 1Q82T 2MLZA 4HH0A 4ES2A 4TVAB 4KO0A 2MKCA 3L9ZA 4ITSA 4C11B 5JJBA 4ELVA 1SL2A 4ZLPA 4DR6J 3BJYA 1LWEA 4WU3A 4FF3A 1DY3A 4U8VA 1UW4A 4DU7A 4QPXA 1LQ9A 2R7VA 4NLOA 3HFVA 2XGQA 1FD8A 3D3CJ 1F2GA 3AB2B 1XNRJ 2QLXA 4DX5A 1JWWA 4DR4J 3W5XA 5D0EA 4WFXA 2E5LF 5BR8F 1KDNA 2DRBA 1F3VA 2MTLA 2N82B 1D1UA 4CI0B 3O1LA 3NNAA 5BYSA 4X66F 5B0DA 5DQHA 1YBTA 3T1AA 3LTOA 4K4YA 3BO4A 2Q3PA 3S6EA 1S0VA 2F5GA 1YX2A 4Y65A 5DDPC 4FVCA 4HACA 2GGPA 2H5IB 3TUJC 2GW8A 3TQEA 3P45B 2XI3A 3HZEA 5J2MB 3H4DA 2DRAA 1UJ4A 1NH7A 4CO0A 1JJ2R 4HHUA 5EX0A 4I4BA 4BHQA 4UOHA 4ANEA 2KRRA 2GHVC 1Q7LB 1FO1A 3QQCD 5EWEA 3GILA 4RKUC 3I0RA 3AA9A 4N47A 2DNZA 5CCLA 2R8HA 2CQPA 2J0QD 1EKRA 1Q8KA 1CJUA 2V2VA 2UZAA 2W9BA 3OVSA 3T5JA 4ZDNA 1IM4A 2DD8S 2QA4G 1SC4B 1A7GE 4M95A 1Q95G 2IHR1 3W9JA 4I7FB 1JLBA 1GEHA 2B56A 4DPYA 2UVWA 1RWUA 2GHWA 3C2PA 1WORA 3QSIA 5M2RA 3CJRA 4V19J 4NYOA 3RBXA 1IM6A 3DRSB 1LWFB 3JSBA 3ZNJ1 2PC6A 2HRYA 3A3NB 3MEKA 4PRFA 4R8UB 2AF6A 2CDRB 2GNKA 1Y5LB 5DZ7A 1RT2B 2W7OA 2FZGB 1NK0A 3NRBA 4DR1F 2IDLA 4URQU 1NJXA 2XYGB 1CLFA 1PGZA 2IA0A 2XY6A 1CULB 3M2VB 1TVRA 1FNXH 3M6UA 2F8MA 2JH3A 4DU8A 2G9OA 3CCVS 4DX8H 3DOMA 4Q45A 1ZH5A 1HIYA 3MEGB 3OXGA 4USHA 2OPPA 4BBYA 5IM0B 4RR5A 1EX8A 1U0HA 1O51A 4CTAA 1WC0A 2O3DA 3BN7A 4XAKA 3MMBB 1SH2A 2JNJA 2W24A 3L4BC 3M9MB 2LQ9A 3RW6A 1RU1A 1RHQB 4DLEA 4RBTA 3QWPA 4FDFA 2U1AA 1RT6A 4ALZA 2RQCA 3OL6A 2WSFC 4NI2A 3IWLA 2LQJA 3DN9A 4X65F 4ECUA 4LF9J 4C0OC 1CJTB 3DKDA 3R2CJ 1H2TZ 1RT5B 3W5YA 2CQ2A 3AT1B 3FFIA 3QGIA 4WTOB 3PYGA 2EG2A 3SCIE 2HK2A 1GX6A 2B8PA 3B54A 1U1RA 5DZ6A 3C15A 2HSEB 3KTQA 3RB6A 2WOMA 5ETNA 1BQNB 3KHLA 2MKJA 5K20B 4K4UA 2MZSA 4CLYA 1OIAA 4OX9F 1JLFA 2CA9A 4EBEA 4N5SA 5HK4A 4JV5F 1TL3A 4Z7YA 4I68A 1PO6A 5HQLA 3PX6A 1TKTA 1D09B 1RTZA 4RW4B 2WB4A 1VQ6S 4YMEA 2OP5A 4NMXA 1J5OB 2RMLA 3OXLA 2V4JB 3GSDA 4DS4A 3E01B 2IVMA 2ZH8A 2YNFB 3IGNA 2I38A 2XMWA 5A8KB 2N3OA 3OFFA 3BDEA 1RWMB 4FS2A 1LW0B 3RBEA 4USIA 5F3TA 3QFHA 1QE1B 5AE1A 1NDLA 2M8DB 1TL1B 3QO9A 1VQKS 1BUXA 3EXYA 4C97A 4KYZA 4A8YA 4A8XA 2HHVA 4WP9A 5DDOC 3LO3A 5D6GA 1EKSA 2KXHA 4RX6A 4I2QA 1BQMA 4NLSA 3EMTA 2BKNA 2FJVA 4O3RA 1X5PA 3D1HA 2FHOB 3GR1A 2XMMA 4ECQA 3LH2S 5IT9U 1XERA 4OLPA 3VGSA 2Y1LB 4LR8A 1DURA 3KYLA 4OHWA 3IRWP 3MURP 2AHOB 1BWVA 2JSXA 1ZM2A 2HW3A 5D4PA 4CLKA 3M8RA 2RKIB 1VBXA 4RUAA 4E2FB 1U02A 3AQPA 3OT9A 1Q79A 3KLFA 3IS9B 1PCAA 3Q86A 2FHKA 3MMCB 2Z8QA 2BE9B 4EYIB 4C0HA 2ZNZA 5IC4B 1S7HA 2CYYA 1JKHA 1UPMB 3IMQJ 3W65A 4PPDA 3MM9A 1R6VA 1WI6A 4LFCJ 2LQ5A 2XYPB 2LQ8A 2M9KA 3T9NA 3HP6A 4DF8A 4IFYA 5KG7A 2BJEA 1OJ4A 3RAMA 3W1YC 5IFMA 3C3LA 1BE4A 2DNRA 2XMJA 2ACYA 1JLGA 1TAQA 2WBRA 4F2RA 5HROA 2RVJA 1SCJB 4KIAA 1FWKA 1YG0A 2C1EB 2BQRA 1UVIA 1RQ0A 1UCNA 3HXMA 3PNIA 4YS2A 3NXZA 4KGXB 3N9UC 1Q78A 3K57A 2YKPA 3KJNB 3HHDA 3IR5B 2D9PA 1L3SA 1KHVA 2OUGA 3AJDA 1HMVA 3EYZA 1UL3A 3IN5A 2A1BA 4P75A 4P2MA 4ECRA 4NXNJ 3GB0A 2BV3A 2POKA 1AW0A 1S1TA 2O5DA 2O1PA 4FXWA 2ADCA 1RXOB 4F2SA 1EQ0A 1VLYA 3G87A 3DLHA 2HNYA 3BPSP 1T3NA 3JTPA 4BC7A 3E3XA 3JQKA 1RHUB 1S76D 2HBQB 5B0CA 2HLUA 4GKKF 2ZZTA 1JQGA 1WF1A 2PDAA 4UY85 3D54A 1M1GA 2FC8A 3M32A 2CNKB 4USUA 4DPUA 3OR2A 4HVZA 2VC0A 1OMSA 3MCOA 2ZH4A 4ECSA 3GIRA 1IKWB 5IQQA 2QA4S 4K0KF 4YDXA 2CPEA 3FCHA 2V34A 5CHCB 2QRRA 5C7PA 3M2UB 1TAUA 1HBNB 1C1CA 1HBUA 2FD2A 4K4SA 4DV3J 1DJ0A 1S6PA 2MKYA 4TU9A 1RCXB 4I0WA 3UW1A 5HLFB 1LNQA 3HVAA 4DFPA 3G9CA 2E5HA 2Y8WA 2HVEA 4JV2A 3MEEB 3A8JA 1FTCA 3EX7B 2EBGA 2YKMB 1U1LA 2GAHC 2DGTA 1B0TA 4J91A 1E6YA 3RBZA 5B0GA 3VAMA 2HRUA 1GAOA 2AYBA 1U0SA 1EP4B 1JIHA 4Y2KA 1DQ9A 4G65A 2JEFA 3J7Z5 1R6YA 3LPEA 3OSPA 4WP3A 4NASA 2FVCA 2FGOA 2OI2A 4F4KA 3OL8A 4MH8A 3SFGA 4QIEA 2KZZA 4RZRA 3EICA 3NGDA 2VPYB 4B9SA 2L9WA 3KMSA 2IBKA 3R1LA 1JB0C 1GMWA 2ZKUA 2R2TA 3M1VA 2CNOB 3M8QB 3DNCA 2AYGA 2VOPA 1NAQA 2BMBA 3CVKA 3EGZA 3Q8QB 1NHKL 3P96A 5AJ3F 4ILLA 3HJFA 3BN4A 4A48A 5GAGU 4CO4A 1SL0A 3CMQA 2DEJA 3HD1A 5IQ6A 1N36F 5KFEA 4EUVA 4HI1A 3D0HE 2MQQA 3OUYA 4USTA 5KFIA 3US5A 3RR8A 4LF8F 4CLPA 2E7VA 1HARA 2GO8A 2OMOA 2QN6B 1S9GA 3H2UB 4U8YA 4MK7A 1SV5A 2XZTB 2HFNA 4NCBA 4C8KA 3TANA 1WHXA 4OX7A 3KLGB 3BSCA 2HFUA 3BSNA 2R7XA 4QWCA 3T19A 3KUEA 2UUCF 4F8RA 2NLWA 2LXFA 2HHTA 2KXNB 3KUGA 1TL5A 1HPZB 3CCSS 1DBDA 4E8UA 3NOGA 2IJNA 4FVMA 2GQCA 3TZWA 4CO2A 3MM8A 2WAQD 1AROP 1FXRA 3J7AN 1HR0J 3GG1A 1RT4A 4CLLA 1YJNS 5A6PA 1HBOB 2CPZA 3MAQA 3L7UA 4OI3A 4FYDA 4EK2A 4AD6A 3D7SB 1N52B 2NSCA 4GO5X 2GQ2A 3HCXA 1FKPA 5T7LB 2YWKA 2IC3B 4ENOA 3HKWA 4FPIA 1JK9B 4AQYJ 3NS5A 2LFVA 3A13A 1J5EF 1TL4A 4PXDA 3DCAA 5KFHA 4DCPB 2XHCA 1EQMA 4OZ3A 2K06A 3F0NA 3PIOQ 4EZ6A 4M5DB 2VG5A 3QT5A 3TYTA 3CXCR 3SI8A 1S0NA 3W62A 5KG5A 1ZS6A 1M1HA 3HULA 4R25A 5J1EB 1WC6A 2QL5B
chains in the Genus database with same CATH topology
2C3UA 3WZ0A 4H4MB 2F1FA 1U1QA 2UUWA 3C6UB 2DH8A 2MMYA 3FZBA 4N56A 4NLDA 2LKZA 2JVOA 2MJNA 1Y00A 4JI5F 2C2RA 1VIOA 1R8PA 2OJ3A 3CCQS 2ASLA 4Q0BA 1QUVA 2HNDA 3JSMA 3KK3A 3G71S 4M94A 1IXKA 1SUQA 4TKTA 5FJ4A 3HVTA 1HWIA 2UXCF 1N54B 2G13A 2HNZA 3D0IE 3MM6A 1RP5A 2W9AA 4NLXA 4RW6B 1WHYA 4QQBA 3IR7B 3QLHA 3MM5B 1JLEA 3C6TA 3IG1B 2R2SA 3LPYA 2CDQA 3G4SS 5A2QY 2YNIA 2ADBA 2PA8D 2FVPA 3M1VB 2K7KA 2OIHA 2HGLA 3VTIA 4NWBA 1NKBA 4TY8B 5GAEU 2ALZA 1FVSA 3MM7B 1RT7B 2VFUA 4PQUA 2KFZA 2K1RB 2GMHA 4ED6A 1VBYA 5HMYA 4K4WA 3SCJE 2IRUA 3N0VA 5DGBA 4OZ0A 2CPYA 3MAHA 3M6VA 4PUOB 4OI4A 3E2EA 2CPDA 2DNHA 3LUYA 5KOXA 5AXMA 3SSRA 4ILMA 3UCZP 3TR5A 3H5YA 2J0WA 4EYHB 3T3FA 4JI7F 5DETA 1D9AA 5KFAA 3CDAA 1NNDA 3OTOF 2HZCA 3PVXA 2KHCA 5IS2A 1VQNS 3BS9A 4ELTA 2IAJB 3ZZPA 3G6XA 1MSWD 2OD4A 3P3DA 2FC9A 1S10A 4QU6A 3CULA 1RTJB 5DJBA 1IN0A 4K59A 2PI5A 1NH8A 1P1TA 3HMJG 4DL5A 2X51A 3OUYB 2V0NA 1I1GA 1FTRA 4C3MA 1VQ9S 1VQYA 2Q43A 5HQ8A 2CQDA 2LXUA 2CPHA 3CD5A 4KFBB 4PG6A 3RRKA 1SH3A 4URGA 2XS5A 1TR0A 1GTHA 3MFHA 4ID5B 1IUJA 3TVYA 1L3TA 4I69A 1FKOB 1YJVA 1SL1A 2R8KA 1U6BA 1KQSR 1S9GB 2J0SD 3U1NA 4DFJA 2NUUG 2FJEB 3P49B 1YJUA 1UJ6A 1KN6A 1IJFB 4DJBA 3IXQA 2C28A 4X84A 1HNIA 4DF4A 1K0TA 3AY0A 1SV5B 2AJ0A 5A8RB 1K1QA 1ZAVA 1FDDA 3QGGA 3TA0A 3HFKA 3GYXB 5KFWA 1RTDA 1OQ3A 1KOOA 2KTQA 5KFOA 4YB5A 2BW2A 4XK8C 3GQCA 3JAMY 1LFWA 4CO3A 3N6MA 3G96A 4ED8A 4LUBA 3MEDA 1RTHB 2AWZA 2P9GA 3DLKA 4J37A 4ED3A 4FF2A 4OZLA 3K5NA 1TFWA 1CPZA 3DLGA 1VRUA 2M0GB 3KG4A 4IQMA 4HDGA 3TVKA 5K8OA 1Q16B 3FNNA 4OJ1A 3DLEA 2XMVA 3KK1A 2MZQA 7FDRA 1X4CA 2YKNA 1U09A 1T3OA 2DGQA 2FHJD 3DM2B 5LSOA 3LALA 1S1VA 4FF1A 5LXYA 1KSPA 4J9OA 2EPIA 2FJDB 3M6WA 2VFRA 3M8QA 4TXSA 5LSLA 2XS2A 3DRPA 3DOLA 2WTFA 2CJKA 3MF5A 4WE1B 2VQFF 3BM7A 4OHZA 4ELUA 1UEVA 2OPSA 2R4FA 4RW9B 4LFBF 1HQUA 2ZD1A 4UY8T 3QGPA 3HHNB 2J7KA 2ASJA 3VQSA 1MU2B 4LF7F 2OFGX 3MM8B 1XMBA 4MK8A 5K9FA 1S9EB 4RU9A 1M90T 3MUVP 2RE1A 4JV1A 4MAKA 1D9DA 1X4AA 3DC2A 1BQXA 2WBMA 5A0YA 1SJ3P 2X1AA 1FNMA 5L8RC 3J81Y 1RT4B 1SBRA 4KC5A 4OMFG 4Y2AA 2DR7A 5L1LA 2VASA 3VAGA 1OO0B 5GVQA 4DQRA 4O4GA 5K5MA 3UDCA 4I6YA 3M4XA 3RB4A 1S72S 2DGWA 3B8HA 4NLGA 1GH8A 2DJWA 5CXTA 2DBBA 1T95A 1X4HA 3CJ4A 1RT1B 5F8HA 2MZTA 4H4KA 4F3OA 2HWIA 3G6VA 3DYAA 4Z37A 2CJAA 1B0PA 2UV8A 4EU0A 1D0EA 1ZPVA 2Z2LA 4CH0S 3A8EA 2LU2A 3CCUS 1MMNA 5K14A 2OTJS 1Y9OA 2AYMA 3BR8A 3DHWC 3KHGA 4B9VA 2XLKA 4LF6F 4AL6A 1VOMA 2XEXA 1DARA 4CO1A 2VUGA 2JDJA 2F40A 4DR2F 3BREA 1FKPB 5CYJA 4QU7A 3UWTA 2DPIA 3V6JA 2R7SA 1DTQA 2R9LA 4IG3B 5D3GA 2D74B 2ERRA 4O3SA 2JHEA 1X5OA 2GCFA 4G3IA 1GQEA 2WSEC 4MKBA 4RW8A 5B09A 5KFFA 1NK5A 4NLQA 3KJVB 2KHDA 5KOWA 1IKVA 2FDNA 2QMWA 4ICLB 2K8GA 5ADZA 2XS7A 4ED7A 3MXHP 2R8IA 3Q2TC 5D4OA 2PO4A 1Z2ZA 2ABYA 4JI8F 4DSKA 4MKAA 3E51A 2MQOA 3QZ8A 2DNQA 2QV6A 5J2NB 1QTMA 1U6ZA 1S4FA 4QJVA 4GMKA 1Y7PA 4JYAF 3GZ7A 2RF2B 2F3JA 5CZVA 2BM1A 2VG5B 2JOQA 4NLVA 2E1MC 5L38A 1WD6A 1IBMF 3DRXA 4KRWA 5HMXA 5FDLB 3RTVA 3L7PA 4K50A 2EFVA 3S8SA 2VFSA 5KT3A 2E9RX 4WYWA 4V19X 4DHVA 4WXOA 3V81B 1R8BA 3CD7A 2W7AA 4HHJA 2X1BA 1RKIA 4CCHA 4B9LA 2LMIA 2Q79A 3MMAA 4YP3A 2B6AB 1SIZA 2BQ3A 3S7RA 5B0FA 4QPTA 4ZS6A 1NK9A 2KT2A 3PJWA 3L95X 4ZMMA 4ZHRA 5FD1A 4JUZA 5KG4A 2I9SA 1KLNA 4N41A 1UKUA 3OPKA 4ILRA 5E2QA 2AJ4A 1KQKA 2VFVA 2AJFE 4Q0BB 2YTCA 2CJBA 2HNDB 3ENWA 5KG0A 3JSMB 1RKJA 3LW5C 3HHLA 3KK3B 2D3OR 3GIJA 1U49A 5C42A 1SUQB 3CJ0A 5T14A 3HVTB 4IG0A 2M3DA 1FRKA 2HNZB 3Q23A 3MM6B 4QIVA 4DQSA 1M5HA 3B82A 4NXMF 4C2MA 3K5MA 3FJ2A 4NCGA 5K8NA 1XNQF 4K4ZA 2RD5C 2YWEA 1LWCA 2E66A 3QLHB 5E3RA 5C25A 1JLEB 3MR2A 2JFKA 3C6TB 3OFGA 3U02A 5IT0A 5J2PA 4ZPBA 1HD0A 2DCUB 2D41A 2YNIB 3V4MA 3ZFVA 4DL0C 2XMKA 4LFCF 3N5FA 3ULHA 1ZBTA 4PG5A 5F0UA 1X0PA 1VBZA 1H3DA 2ZVSA 1U48A 1KVIA 1T05A 2YVSA 4DWIA 5GAGI 2B9YA 1CC7A 4F25A 4HL9A 4RWWA 4O3PA 1C2PA 1X4BA 3K8VA 4PQUB 3SSSA 1XN9A 2J6SA 5I3QA 4B3RF 4QBUA 6FDRA 3N4WA 2V8DA 4PR6A 2AGOA 3I5AA 1CSJA 4HT5A 4Y6IA 2R7WA 4F4XA 4DL4A 4DR6F 4FP9A 2KT3A 2KFYA 1XK8A 3PEHA 3IA0A 1X9SA 2RDIA 2C22A 1KVJA 3SYZA 4YB6A 3F73A 5AE2A 4J9LA 2W7PA 2GX8A 3VAKA 3DLLQ 2JC1A 3NLCA 1M5OC 3CCZA 5CH7B 1N5SA 1HNWF 2ZH9A 2CVEA 4ZVEA 2BUNA 3ZZRA 2UVVA 4ECZA 2XMTA 2AJ1A 3SCLE 3SMZA 2ZDPA 4DDFA 4Z2XA 4WCEQ 3OL9A 1VS3A 3Q8RB 1FK9A 3I6PA 3W2VA 2P6TA 4NCAA 3RRGA 2IM0A 1HW9A 1VI7A 3ZC4A 1KS2A 4K5SA 1IKXA 1DQ8A 5F8JA 3MECA 4F4WA 1LOUA 2CZVC 2ZH1A 2JEIA 2BDPA 1BD6A 5FIIA 3PDNA 2YKAA 3WDOA 2L08A 4DLGA 3PZPA 3UCUP 2RUGA 5KT6A 3PW4A 1U2FA 4WKYA 4OFZA 4YFUA 4IR1A 2WK4A 2I2YA 2HHWA 1DLOA 5J1PA 3NBPA 3VQTA 1A9NB 4TU7A 1HNIB 1R8HA 1UP1A 3NL0A 4BS2A 2BM0A 1J2VA 4ATNA 2JRSA 2K3KA 2ZH5A 2N7YA 4HYKA 1RTDB 1WEXA 4F67A 2MPUA 2VFTA 1XMQF 1RYSA 2DHXA 4NA2A 5KFJA 2ASYA 4DMZA 3H8YA 3MEDB 1GXTA 4I2PA