4IOAQ

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ioaQ00
2FPHX 3B4DA 1K9MT 1OWXA 2OSQA 4F02A 2LYVA 1YTYA 2XB2D 5CXTA 2AYGA 1YJNS 2DH8A 2JVRA 2QA4S 2A3JA 2LEAA 1PGZA 3CCLS 2KRRA 2FC8A 1VQNS 1X5OA 4CH0S 1WI8A 2HYIB 2K8GA 2XSFA 3NNHA 2B0GA 2ADBA 1N8RT 4EGLA 3S8SA 1PO6A 2M0GB 2DHGA 2V94A 1WHWA 2KXFA 3MDFA 2GO9A 1WTBA 5HL7Q 3MOJB 3MURP 1SJ3P 1U1MA 4WFBQ 2SXLA 2DNQA 4LMZA 4CQ1A 4FXVA 1FT8A 1L3KA 2RS2A 4PKDB 2LMIA 1WELA 2PE8A 3TP2A 5DM7Q 1FXLA 3J7YU 1G2EA 1VQLS 2RNEA 4LJMA 1F9FA 3CCMS 1H2VZ 1N88A 2CQCA 2DGUA 2DIVA 2JRSA 5LSLA 2DO4A 3ZZYA 2DISA 3CCVS 3VAKA 4TU7A 1U1OA 1NJIT 2OIHA 2HGNA 1M1KT 1VBZA 2E44A 2M52A 4ERDA 2MKKA 2J8AA 3CF5Q 3TO8A 2HGLA 1VC5A 3IWNC 2MJNA 5MLCV 3MD3A 1VQ4S 3THTA 3VAFA 4F26A 1FO1A 1BY9A 3DLLQ 2YH1A 2DGQA 2M9KA 3VAIA 1NU4A 2LA4A 1U1KA 1P1TA 2YKAA 1VC0A 4V19X 2MJUA 4BS2A 1NO8A 1FNXH 4Y00A 3SXLA 1HL6A 4ED5A 2DGTA 3CCJS 1WHXA 1YWXA 4FXWA 2DNOA 2LXUA 2DO0A 2MGZB 2BZ2A 4WIIA 2CQ2A 5GMKa 5LJ3Y 1U1LA 1WEZA 2RQCA 2RRAA 2J0SD 1HD0A 5LXRA 3VAJA 1FJ7A 4QQBA 4RU2A 2XS5A 2AYBA 4QU6A 1S79A 1HD1A 2N3OA 1K8AT 5JVGQ 2DH7A 3Q2TC 3VAHA 2CPIA 3SMZA 3CCSS 1UP1A 3TYTA 4WKRA 3G71S 2MZSA 3LPYA 3R1LA 2D9OA 2MZTA 2PEHA 3G6ES 3CC7S 4C7QA 2KN4A 2M8HA 2UP1A 2CQ3A 5H1SV 1JMTA 2E5JA 5DDOC 1A9NB 1URNA 3U1LA 4YOEA 1VQ6S 3S6EA 4J5OA 5D78A 1SJQA 5IFMA 1H6KX 2VODA 3U1MA 2MSTA 1WHVA 3V4MA 3CCES 2DH9A 3HI9A 2G1DA 3BS9A 2KM8C 4IOAQ 3EGZA 3G4SS 3MXHP 3PIPQ 2U2FA 2CPJA 2RS8A 2CPEA 3FEYB 2FHOB 3UD4P 3R1HA 2DNGA 1VQMS 5DM6Q 4PRFA 2D3OR 2CQDA 5DDPC 2X1FA 2MMYA 4U67Q 2KFYA 3FEXB 1KOOA 1WG1A 2XS7A 2MHNA 5LJ5Y 1M90T 5IQQA 2MZ1A 3NMRA 2ZJPQ 2DNMA 3S7RA 2KXNB 1X4CA 1VQKS 2MSSA 3UCGA 2CQ0A 1H2UX 2RVJA 2L9WA 5GVQA 4WCEQ 3MI7X 2M2BA 5GADU 2KVIA 5BJRA 1UW4A 1U2FA 5DDRC 5DDQC 1Q86T 5FJ4A 2FC9A 3VF0B 3CTRA 1YJWS 1W2BR 4Z2XA 2X1AA 4C4WA 4UQTA 3US5A 3ULHA 2NLWA 1R8PA 2D9PA 3G8TA 2AYEA 2L41A 1FHTA 2MKJA 2E5HA 2QEXS 1S72S 1U6FA 2I38A 5HO4A 2MKCA 2CQIA 1H2TZ 2CQHA 3H2UB 1WG4A 2I2YA 4QU7A 1U1RA 2N3LA 4CH1A 4TU8A 3L3CA 2DB1A 1KD1T 2QFJA 3G96A 1VBYA 4UY8T 1YJ9S 2DGVA 2KRBA 2KYXA 1WEYA 1WHYA 2OJ3A 2CPHA 1FJCA 1P27B 1WWHA 3Q2SC 2X1GA 5IM0A 5DETA 1B7FA 2MKIA 5JVHQ 2GHPA 3H2VE 5LXYA 2JX2A 2N7CA 2U1AA 1M5VC 1SXLA 5GAGU 2KG1A 2KT5A 2ERRA 1RK8A 1U1QA 3PIOQ 3CCQS 2FY1A 2RU3A 3CC4S 4Y0FA 1YHQS 3UCZP 4P6QA 2ADCA 2MY8A 1FJEB 1ZH5A 1ZZFA 3RW6A 2MQQA 2DNNA 2NZ4A 1QM9A 3B4MA 2DNZA 1DRZA 2MGZA 4IOCQ 1X4BA 3VALA 5D77A 1X4FA 2DGXA 1Q7YT 4F25A 2RUGA 4TLQA 1X4DA 3THPA 1M5PC 2CPYA 2MPUA 2M70A 2F9JA 1VC6A 4A8XA 4PR6A 2LEBA 2MQLA 2KH9A 2MXYA 2DNLA 1VBXA 3HHNB 3BO2A 2M4MA 4OZ0A 3UD3P 2F9DA 1X4AA 2EK6A 2F3JA 1KOHA 2N82B 2WBRA 3CPWR 3IRWP 2HZCA 2MQPA 4W92B 2MZJA 1AUDA 3EX7B 2DHSA 3MD1A 2M8DB 2KI2A 1JJ4A 3EGNA 1CVJA 2KM8B 3BO3A 3BO4A 4CIOA 2DHAA 2CPDA 2O3DA 1D9AA 2HGMA 1Q81T 3G8SA 1YIJS 1Q82T 2M7SA 3G9CA 3CC2S 2RT3A 3VAMA 4M5DB 1KQSR 4IUFA 2RRBA 3UCUP 1RKJA 2DNKA 2ZJQQ 3DXBA 1DBDA 2DNYA 1X5PA 1SJ4P 2KXHA 2M88A 3NS5A 2LXIA 1VQPS 2AD9A 2EVZA 1A7GE 2J0QD 3S01A 2LECA 2VONA 2E5IA 3P6YC 2VOPA 5CA5A 1OIAA 2J76E 2MKSA 4W90B 2YH0A 5ITHA 1SJRA 3JB9k 1WG5A 2E5GA 2LCWA 3P49B 2KU7A 3CMAS 2Q79A 1X4HA 3OW2R 2LKZA 5LSOA 2DIUA 4WFAQ 3MUVP 2X1BA 1VQ8S 2KHCA 3CD6S 2MQOA 5IM0B 4C0OC 4LIRA 3J7ZT 1ZZNA 2G0CA 2JVOA 1R8HA 2YTCA 1JJ2R 3CULA 1IQTA 2DNRA 2XS2A 2G4BA 2RQ4A 3SDEA 3D2WA 1JJHA 2LA6A 2OTLS 1OO0B 1VQ7S 2HVZA 1VQOS 1SJFA 3I55S 1UAWA 1WF1A 3N9UC 3NS6A 2CPXA 3CCRS 2ZJRQ 1O0PA 2DHXA 4QPTA 4IO9Q 4YB1P 2DGSA 1QVGR 1DZ5A 3K0JA 4WFNQ 4YUDA 1WEXA 3RW7A 2DNHA 1OPIA 3LQVA 1U1NA 3MUMP 2OTJS 1YITS 2JWNA 3SDEB 1U6BA 3ZZZA 3UWTA 1QVFR 4OZ1A 1UFWA 2CQGA 1D8ZA 5GAHU 2AYMA 4WF9Q 3MUTP 2CPZA 2OSRA 1M5OC 2VOOA 1WF2A 2DGOA 2MYFA 3P5TL 3P3DA 1KC8T 3I56S 1X4GA 3CCUS 3UE2A 1X0FA 2XNQA 2CPFA 2DNPA 2BOPA 1M5KC 2MY7A 2CQBA 1X5SA 2DK2A 3BEGB 2EK1A 2MZRA 2MB0B 2L08A 1X4EA 1VQ9S 2MQNA 2XNRA 1N54B 3CUNA 2DGWA 1HA1A 1VQ5S 3VAGA 1DHMA 2MKHA 3CMES 3R27A 2CQ1A 1N52B 2CQ4A 2CQPA 3NNCA 1WF0A 3NNAA 1XN9A 1K73T 1U1PA 1X5TA 5GAEU 2KG0A 2CJKA 1YI2S 4ZKAA 2MQMA 2LQ5A 4TU9A 2DITA 2YWKA 1WI6A 5EN1A 2K3KA 3CXCR 2MZQA 5CYJA
chains in the Genus database with same CATH superfamily
1OY6A 3IRXA 3QIDA 5T7LA 3EPIA 2QEXS 3HKWA 4FYVB 3OFHA 1FESA 1OWXA 1RT5A 3RG6A 2OSQA 5IT0A 1QJHA 3T5KA 3BR9A 3HJVA 2WHOA 1IKWA 2LYVA 1RHQB 1AROP 4OX8A 3I82A 3SFGA 3HULA 3KUHA 4ZVHA 4PEOA 1DTTB 2V2QA 9ATCB 2QA4S 3SBMA 3NCRA 5EGYA 5D4PA 1S5ZA 2R8KA 2FUG9 4KH1B 4H4KC 4USKA 4ZVPB 4F3MA 2ZH1A 3QGIA 3V6KA 3FMWA 1CS4A 5M2PA 3N5BA 4WP3A 4DR4J 1RT5B 5KT3A 4DV2J 3N4WA 1AA1B 4LF6F 3CIMA 2R7XA 1APSA 5J2MB 3T1YJ 1K1SA 1RTJB 2NXCA 3GJRB 1XK8A 2MDAA 1T3OA 4DG1B 4EGLA 3S8SA 1PO6A 1B0TA 1CBKA 3BQ0A 1WHWA 2Y3YA 3MDFA 1FERA 2F8MA 4HT7A 4OIXA 3BSNA 1IKWB 2HNYB 1F5AA 2KJVA 2XMKA 2Z2MA 4ZLPA 1URRA 1YJ7A 3RRHA 3FBCA 1UPPA 2FVCA 4PZVA 3U7JA 1FDAA 1FDDA 2G0IA 1BWVA 2BJDA 2MKYA 1R6YA 2QLBB 4P52A 2IPOB 4FXVA 4X84A 1JJCB 2EW9A 2V69A 3C15A 1N36F 3EVOA 2ZUAA 4DCPB 2VC0A 2LMIA 2J9EA 4WP8A 3TP2A 1G6BA 1PYSB 2IAJA 2ROPA 3H0PA 4DUYJ 3DI6B 2R7OA 3D6TB 1G2EA 1VQLS 3FK4A 2BANB 3LWLA 1QSSA 2BUNA 3AH6A 4TQSA 1YVFA 1F9FA 4LJMA 2VA3A 1K47A 4N41A 2CQCA 1IWAA 1REVB 4I69A 5LSLA 5B09A 3GIMA 4IQXA 1NJIT 2ROGA 1M1KT 1EP4B 4DPXA 1BUXA 4LR7A 1H0HB 4OI2A 3ISNC 1FRKA 3WBZA 4RNMA 1TFYA 2GQCA 3GV5B 2HWTA 3GSDA 2BE2A 2XQCA 1N5VA 2BBEA 3MM5A 1SUQA 4DPYA 2KO1A 2MJNA 1XNRF 4PABA 1TQLA 1FX2A 5KG1A 4DU7A 5KFMA 3UFCX 2R2RA 4USWA 3W7BA 2CG8A 2YKNA 3OFFA 1UVKA 4ES2A 3LAKA 2NCKL 2OEMA 3MMBB 3PX0A 1TVRB 3IAS9 4LRFA 4F3OA 2FIUA 2V50A 3OT9A 3JYTA 1FCAA 1U1KA 1HQ2A 4TYAA 3H90A 1ULRA 4I2QB 1FKPB 3LWMA 3BGRB 3CO9A 2PDAA 2CNOB 2NXNA 4NRUA 1XR6A 3V6JA 2CNKB 2MJUA 4DG1A 3QSIA 2QJ3A 5CHCB 3JTPA 3LGMA 3TUJC 3CW2C 1JLFA 2AX0A 2DGTA 1RADB 4G1QA 5HVGA 4K4TA 3TAMA 1LWFA 2BKOA 2DNOA 3QIPB 2ZHBA 3PW4A 3QJLA 2BZ2A 2QL9B 2IMWP 2CQ2A 5GMKa 1EJ7L 2D41A 5D3GA 3V6DA 2FVRA 4I7FA 4ZMMA 4G6VB 4B3OB 3NRBA 3RBZA 1WEZA 3Q23A 4CLWA 3C6TA 1HD0A 5LXRA 1KRPA 4DV5F 4HR2A 1N32J 2IBKA 1GTEA 4MKVA 3ZTPA 4ANDA 3IRXB 2XM3A 1KLNA 2E7XA 2Y8WA 5JJBA 5K8OA 1HBOB 2CWKA 2J9CA 3ET6B 4QYRA 1YJTA 1S79A 4DV7F 4ZVOB 2XS5A 1N6QA 4NCAA 4KHRA 4LF6J 1FNMA 3ILOA 3JQMA 4EO6A 2E1MC 3Q2TC 2CPIA 3CCSS 3FZ2A 4EWTA 1Y9OA 1DTTA 1UP1A 4LRCA 5H9FJ 5M2UA 2ABYA 5C2GA 1RAJA 2XULA 4LT6A 2IRUA 2A6MA 4ZHRB 2XMMA 5HANA 3QQCD 2HLUA 2R8HA 4HHUA 1FKOA 2OI2A 1Y3JA 3K8WA 3QWUA 5ETSA 5IV3A 3G2XA 4DQSA 4TYBA 1ZA1B 3LGHA 3M8YA 1YKWA 3CC7S 4OYPA 1TL5A 2J9DE 3DMJA 2ZITA 4DR2J 3W9JA 2UP1A 1S0VA 2RHQB 4LF4J 4DR7J 1RTHB 1HHSA 3C8YA 1URNA 1A9NB 1S4FA 5J1NA 2XEXA 3J81U 1EKSA 4KB7A 4AQYJ 1HNZF 1VQ6S 4YB5A 2JJ4D 2V4RA 5FDLA 2R2TA 5D78A 3IBFB 2Z58B 2VODA 3U1MA 3O2IA 4YFUA 1WHVA 1NB2A 1ZM2A 3V4MA 1Q53A 2JZ5A 2A2CA 1HBMA 4ZVEA 1GMUA 1BQMA 1Q1KA 3CCES 3DGVA 2QLFB 4B02A 4DL6A 1RLCL 2QN6B 2FVQA 3A8KA 1NCLA 3H98A 3PYFA 4MYTA 4PG6A 2JHEA 1S6PB 2DXEA 4IOAQ 1N5QA 1ZBTA 3HCXA 4R0JA 3OSPA 1FNOA 2LVWA 3MXHP 1IBMJ 1PKUA 1ZPWX 4WYLA 4KPYA 3G6VA 3E3XA 3DDNA 2H5JB 5FIIA 3P4UB 2J8SA 3CDUA 3CDBA 2P2CB 3DGPA 1WC4A 2YPYA 5IT4A 1U7LA 3HHDA 2XS7A 4IQMA 5LJ5Y 1NJYA 2XMTA 2MZ1A 3NMRA 3PG9A 3MECA 3UQSA 2CA9A 1Z1ZA 1HQUB 4DR2F 2A0FB 1X4CA 4TQRA 1VQKS 1GMWD 3M8RA 5KFRA 5DS7A 1N56A 4ED8A 2HHWA 1XMOF 2HW3A 3NBPA 3AB2B 4C8KA 5GVQA 1RP5A 3BZQA 1U09A 2UVUA 1NUEA 1FJGF 1OSCA 2KZMA 2IFXA 1IBKJ 1B64A 1XERA 4YY3J 5J1PA 5J2PA 4OI6A 3OL7A 2RDJA 4NLPA 3Q22A 4CT9A 5IC6B 1Q86T 4DWIA 2FC9A 1OQ6A 3IN5A 4NYPA 9RUBA 5KFCA 1AW0A 2X1AA 1A0OB 4OHZA 3US5A 4JI1F 5J1EB 4FNIA 4KE5A 4GO5X 4ICLB 1FHTA 3FQKA 2HBZB 4YB7A 3RBXA 3OTOJ 1WOOA 2ZH4A 1XC9A 4URSA 1S10A 2QLXA 3N79A 3ZTQA 4QIGA 2D1CA 3D5MA 1LWEA 2AD9A 1SIWB 2M3DA 5HO4A 4YR2A 2B4OA 3H2UB 1FRMA 2E1PA 4PXCA 1HWUA 5IT9Y 1O51A 4ID5A 1TMJA 2N4CA 4KH0B 3RAQA 3M30A 2I2YA 3BBFA 4HACA 5A6WA 1N34J 5KFPA 3L09A 5B0FA 3TUZC 3GONA 3FFIA 1RSCA 4J9MA 1JB0C 1FE4A 2JEFA 5ETLA 2QFJA 2J6TA 5J2MA 5HLFA 2EPIA 2W4DA 1VBYA 2QMXA 1RZMA 2UUCF 1Y5LB 2HSEB 5A8RA 3IG1B 2VA2A 4UY8T 1SQFA 2EBEA 5DG9A 1S97A 3I31A 3HHLC 4NOHA 4CDIA 2OPQB 5HMYA 2AGPA 3CJ4A 4CO4A 1FRIA 2K1RB 1B0VA 1CJKB 2XI3A 3KDNA 3SI8A 1QTMA 5CYQA 2OPRA 2OGUA 3AA9A 1EP4A 4HHHA 2YNHA 4KAIA 2ZHAA 3NGRA 4O3RA 4LSLA 3VVUA 4NMXA 4OJ3A 4NE9C 1F9HA 1UWBB 5DETA 4B9SA 3O44A 3CVKA 4R25A 2MKIA 2UXDJ 5LMNJ 6AT1B 1KP6A 3M2RA 3H2VE 1Q8KA 2N7CA 4ZIVA 2I9SA 2E9TA 3ONQA 2RE1A 4DZ6A 2KG1A 2ERRA 3AQOA 2ATCB 2A2DA 4LVOP 3TW0A 3QT5A 4OZ2A 3W2WB 2GAHC 1MU2A 4DOZA 3PIOQ 1U1QA 1S9GA 1S1XA 1T02A 1JQGA 3M6WA 4LSZB 4QR0A 3HT3A 1ZAVA 3CE8A 1YHQS 4X4NA 2GMJA 1MROB 3OHAA 2ZBPA 4DL5A 1FJEB 1UCNA 2GO8A 4ATNA 3MAQA 3FBBA 3THVA 1ZZFA 2OH2A 2R7SA 2XO6A 1IM6A 3BKFA 2NZ4A 1Z4UA 3BGLA 3I0RB 4OZLA 2L48A 2W8KA 2OFHX 3TRGA 3QLHB 1SKWA 4IOCQ 3G6XA 1S6QA 2H5IB 2J0WA 1FFSB 1X9WA 3VALA 1UL3A 4F7VA 2R7TA 3M1VA 2Q1LA 3W61A 4TLQA 2IDEA 4PCQA 2Y1LB 8RUCA 2XSJB 4P2MA 5HJYA 2F9JA 1VC6A 1IXKA 1C4AA 4H4MB 5GMDA 1D0EA 1YBAA 3R5CA 4CLTA 1QSLA 3BKTA 1OJ4A 4QIVA 4ICLA 3R7NB 4ED3A 1NKCA 3PR5B 4YB6A 3OTDA 3EM1A 4IOBA 5M2RA 2KH9A 1VBXA 2POKA 1LNQA 2Y1RI 3GCXP 3HHNB 1U25A 1X7VA 2YNGB 1CC8A 2ZOGA 3GU0A 2UV8A 1LEOA 3BO2A 4NLDA 4B3RJ 4OZ0A 2DEIA 2EK6A 2F8EX 3DRSB 3TR5A 1O6XA 2H3EB 1TKTA 1E6YB 3I0SB 4ZVFA 3T1HF 1TAQA 2D74B 3KLIB 4ZP7A 2QSWA 3HHKA 1OY8A 2MQPA 1TK5A 2MZJA 4OJHA 2F40A 4B9VA 1RWXB 4QCLA 1RWUA 2M8DB 5KFWA 4IR9A 4P7VA 1F9EB 2XHCA 2XO7A 1JJ4A 2C2OB 1CG2A 1CVJA 2IVMA 3CDAA 4JOUA 2O3DA 4DR5J 5B0BA 3HX9A 4WP9A 1Q81T 3NAHA 4K4ZA 1YIJS 2AIRB 3IGVA 4OYZA 1N4LA 5H9FK 5EWGA 1FF2A 3VAMA 4CYUA 4QPXA 3UCZP 3DM2B 4XK8C 2EEYA 2YXLA 1QAXA 1WD6A 3CSKA 1XR7A 3E51A 5F3TA 2JFKA 4LF4F 4NMLA 3UCUP 4FF1A 5E7OB 2MEWA 2VKRA 4P75A 1RKJA 3M4XA 2D3ZA 3DCAA 1JLAA 4L74A 1XQIA 3T41A 1BWEA 2AMCB 4ELVA 3ICLA 4TN2A 4RBUA 1HBNB 5AJ3J 1J5OA 2NSBA 4P10A 5D0HA 1EB0A 2JEIA 1TUWA 1QTNB 2J0QD 5IXUA 1CJTB 3J81j 1C1BB 4K4WA 5D6GA 4WK3A 2KHDA 1S1XB 2J0XA 1NK0A 2IMOA 4UOFA 2AV5A 4PAAA 4ZJQA 5KFNA 1SJRA 3C15B 4GRSA 1HNVB 2HFOA 3OPKA 2BYCA 3DM2A 3S1TA 1NPPA 4FPRA 4ECUA 2HBQB 3ISND 2QSFA 4E98A 4F4WA 2QGFB 3QMQA 2DIUA 2FJAB 3MUVP 2AEMA 4GVBB 3T5JA 4DF4A 2E1CA 2H48B 3W8GA 2HLTA 3ZTSA 3C2PA 5L9NA 2V9WA 2GA7A 3J7ZT 5H9EJ 5IWAF 4Q2MA 3PX6A 2G0CA 1LFWA 2R42A 3DLGB 2FJXA 4B9TA 2XMUA 1ROFA 2EKNA 2I8EA 2RKIA 2V63A 2YTCA 3KG0A 3HPOA 3NGSA 2AT1B 4ZVQB 1JJ2R 4FXDA 4L73A 3VWSA 2XS2A 1S57A 2DT9A 2LQ8A 4AXIA 4KHMA 2BEFA 1RT3A 2WB1D 4RO0A 5KG6A 3D2WA 4CI0B 1NSQA 2HK2A 2WTFA 2FLOA 1M1HA 3A12A 3ITHA 4M5MA 4RWXA 4DR3J 1KVJA 1WOPA 5KG7A 4U7CA 4X65J 1H7WA 4ECQA 2FLNA 1D3WA 1S1UB 4M5DA 5IWAJ 2FLPA 4OI1A 2R7RA 2YBVA 1A6LA 2YNFA 3PDNA 3TVZA 4QW9A 3GILA 4NPOA 1Q8LA 2NSCA 3D1QA 1XNQF 2CJXB 3K57A 1UJ4A 2G9OA 1QVGR 3MR7A 3SSSA 4JYAJ 4WFNQ 1WACA 3I96A 1VHFA 1WEXA 4YUDA 2DNHA 3LP2B 3Q8PB 4WZQA 1VMBA 2C2DA 1NPKA 1U0HA 1WSRA 1LWCB 2QL7B 3ZNUA 3N6LA 5A2QY 1YITS 2OTJS 1NM2A 1RT3B 3OR1A 1KONA 3SDEB 5ADZA 5HAOA 3RBDA 1FTCA 1U6BA 4XTTA 3R6LB 1VK8A 1RT1B 1VISA 5HSPA 1T9VA 5LMUF 4F4ZA 1N5YB 1TV6B 2HNDA 2J7UA 3BGUA 1TL3A 4OV1A 4WE1B 4EU0A 1H7XA 4DQQA 2UXCF 2XYGB 5E3AA 5ETRA 2YNGA 1S0NA 2MLXA 3DLKA 1R0CB 3EVMA 3TAMB 5FLXU 3MUTP 1JK9B 4YDXA 1WF2A 2Y0BB 3VVTA 3TAQA 4OLPA 1RUSA 1TK0A 2JFDA 3F41A 3I5AA 3KNGA 5A6PA 3FGVA 3UE2A 1X0FA 4KHPJ 4P2XA 1RHMB 2V68A 2XNQA 3OD2A 4LBIA 3SIPB 3KK3B 2KDOA 4USHA 3QT7A 4RU9A 1S6OA 1M5KC 2GS8A 2CJQA 2DK2A 2HVEA 2KFNA 2YWFA 3QO9A 2MZRA 4ZPTR 2L08A 4ED0A 3L7UA 2Y8YA 1X4EA 2WVEA 1VQ9S 3DGPB 1ZAWA 5JUMA 5FLXY 4HVZA 2DGWA 1SKUB 1HPZB 4NLUA 1FRXA 3FRYA 4ZVSB 3CMES 3NS7B 4NXNF 4PUOA 4AT1B 2ATLA 1DTQB 4JI4F 3U02A 4UOGA 2IM2A 4LF9J 4GKJJ 1T05A 3MWBA 3Q24A 4F67A 2UUAJ 4EZ6A 2CQPA 2CQ4A 2JNJA 1JXLA 1QY7A 4JV0A 4AQYF 1HNZJ 1N48A 3IS9A 2C3UA 1HHTP 3NNAA 3NKYA 4FF2A 3LPEA 3PY8A 2J6UA 2AJ1A 1Y5IB 1WC6A 1T7PA 3FSIA 2HRYA 5I3UA 1RAAB 1M1GA 3PCOB 2R2SA 4MIBA 3UNGC 1JNRB 2QL5B 3ZZPA 3G82B 4CTAA 4N8NA 2ALZA 4X62F 4TNOA 4FYXB 2CJKA 1KSPA 2Q66A 4ZN3A 4RX6A 2AZ1A 2DITA 2YWKA 3UDVA 5HQMA 4OYMA 5K8PA 2WCXA 4U7UD 1M0SA 2B7BB 1NHUA 2K3KA 3B78A 4U8YA 4DR6J 3NLCA 3C14A 3HHLA 2MZQA 2C3YA 5CYJA 2GW8A 4DR4F 1NJZA 2FPHX 2VFRA 2XYPB 1K9MT 2HMIA 3DLEB 3KKFA 4JUZA 2CZ4A 3D66A 2NXEA 3MCSA 4RNOA 3NGDA 1AFIA 5GAEI 3JTOA 1VJWA 1YTYA 1PBAA 3GFYA 5CXTA 4RW8B 3MM9A 4A8FA 2AYGA 1YJNS 1CQMA 1H74A 3PV8A 2EFPA 3SZ2A 1XEZA 1AFJA 4Y3CA 4Q7AA 2VFSA 3KHGA 2HQDA 2KRRA 3MGJA 1JLCB 2FC8A 2H4WB 1VOMA 4DV4J 3BJYA 1NKEA 4K5RA 2JC1A 5EUHA 2VICA 2DY1A 5BXIA 4I6YA 2DR7A 1DFDA 1RAEB 1W2IA 1JIHA 2HYIB 3IG1A 4LBHA 4I4BA 3EZ5A 1HKAA 2K8GA 2ZNZA 4KRWA 6FD1A 5IV4A 2ADBA 1ICEB 5HQ8A 1FWLA 1NLKL 4CH7A 5C7PA 2JOQA 2FJWA 3L7OA 4M94A 1RDRA 2BR0A 2C28A 4B08A 2UXCJ 2FD2A 4HTJA 5ETOA 1U1MA 4ED4A 4JV1A 3EJMA 1NDPA 2SXLA 4J91A 2HQCA 5K9FA 2DCLA 2OMOA 1GT8A 3BKUA 5HMXA 2ASJA 2UXBJ 4OJGA 2BVZA 2E1RA 3LGNA 3MFIA 2DR5A 1CJVB 1U4BA 4A48A 2ZH6A 2IRYA 3EZUA 2LDIA 2XGPA 2VDIA 4I64A 3MM7B 2IY5B 2PE8A 5DM7Q 3M2UB 3LP1B 3J7YU 4CTAB 3DLKB 2AJFE 4WWSA 3MMBA 4ZA1A 5IZHA 5D8HB 5I42B 3MAAB 3CCMS 2WW8A 1IBKF 1QUVA 5AXMA 1UZHA 1N88A 2GHVC 4O44B 3CCVS 3GFHA 4K0KJ 4PWDB 1S1TB 2DISA 4TU7A 1FXDA 1VYAA 2ASDA 4ZVTB 2HGNA 4M63A 1HI0P 3A3NB 2D7SA 3H20A 1F5CA 2E44A 3SFUA 4DV4F 3PZPA 2BANA 3W65A 5LL6d 3AOBA 3LP1A 5KFGA 5B0AA 4USTA 4UZBA 2Z8QA 2HHTA 3CF5Q 2UV8G 3HMJG 4MAKA 3TO8A 4M1KA 1H72C 3OTOF 2XLKA 1VC5A 1HNVA 1MLAA 3NCPA 1Z2LA 4DV0J 3M9NB 2X3DA 3IWXA 5MLCV 1IUJA 4Z37A 3H7HB 4O23A 1BY9A 1HPZA 2BW7A 3OUYA 1QUPA 3K5OA 3U27A 4DPUA 2W2OP 2YH1A 3DLLQ 4FBUA 2C2NA 4K4VA 4DR5F 1VRTA 4NXMF 4P2FA 5DZ6A 3JSMB 4U7UK 2ZH3A 2WAQD 3HSGA 1NK4A 5HN0A 3BV8A 4ELTA 1RYRA 1P1TA 2CNLB 1MN7A 3ZO7A 2YKAA 1VC0A 2BXJA 3AY0A 2VH7A 1NK7A 1R6VA 4KHPF 2VUGA 3OQ2A 4NZ6A 3DU5A 5D4OA 1LWEB 3AJ2A 1FK9B 1HL6A 4IG0A 1WHXA 3QBCA 4F04B 4CM0A 5KFBA 4FXWA 2F4VF 3L9ZA 2MGZB 2O66A 1E6VB 2ZVSA 4M5HA 3O6QA 4DN9A 2KFZA 1IKYB 1FRLA 2V8DA 3FSYA 3KDOA 4WFYA 3CWJA 3W8PA 2BJ7A 2J0SD 3KXDA 5KOXA 1LWFB 3ENVA 3DHWC 5DQIA 3VAJA 1X8DA 4OV6A 1L3UA 1TV6A 2HNDB 1IQZA 4RWWA 2C3OA 4NLWA 1CULA 2FTRA 3KUGA 2DBBA 3ETMA 3HVTB 2R9LA 4CWBA 4E8UA 1YJVA 2N3OA 3RR8A 3C66A 3I5CA 5JVGQ 1T9TA 3IO1A 2DH7A 4YEAA 1KLMA 2HQIA 1R7IA 1OPZA 3RBEA 1GTHA 4ZP6A 1T0TV 3PRBA 2VG7A 2ZE2A 5HBMA 2RF2B 2XZTB 3SMZA 1U8WA 5CABA 4O3OA 1UETA 5C25B 3QSYB 2NUUG 2DEJA 2MZSA 2ZNYA 1P9YA 4NLXA 1HBNA 4WTYA 3SCJE 5C2CA 4CLKA 3OTCA 2FHMA 1WOSA 2OELA 3O3LA 4NXNJ 4P2SA 5B7WA 1EKRA 3QZ8A 2D3O1 2KN4A 5A76A 1IR0A 3C6UA 1JMTA 4P72A 4JI0F 1T94A 4C97A 3CJKA 3CDEA 6FDRA 3IXQA 3JQKA 3S6EA 4MIAA 2HQFA 3V81A 1TAUA 4FKXA 1EQMA 1R43A 2ZBIA 3ILLA 5EX0A 2V0NA 3PJWA 2OD4A 4AFFA 4IR1A 1NDKA 4XIUA 2W7OA 1Y0HA 4L76A 2UVWA 5GMEA 2AU0A 2A18A 4KC5A 1UA0A 1HWLA 3FFIB 1S9EA 3R5JB 1PJ6A 3KMSA 3BN4A 4OMFG 2G1DA 4Q45A 1DLOA 1RA6A 1RU2A 3MEEB 4WYWA 2D3UA 3PHEA 2BW2A 2KM8C 3EICA 5KAKA 2IJNA 3DRRA 2YVSA 4YR3A 4KQZA 1BGXT 5ETKA 3PIPQ 2YWHA 3DOMB 2CPJA 2RS8A 3IM9A 3E01B 4CRJA 1DTQA 1IBCB 3AA8A 3O5TB 3CJKB 3UD4P 2DNGA 1VQMS 4PRFA 1KVKA 2Q6CA 3QFWA 1S6PA 1K44A 5HJXA 5DDPC 4CYUB 1VRTB 1KS2A 2Q3PA 4NLSA 4U67Q 1D9FA 2BV3A 4CLZA 4C8ZA 2PA8D 3BM7A 1CJTA 3KTQA 3T6JA 3VTIA 1FVSA 3FCHA 1HW9A 2I0XA 1N36J 2GVZA 2LDYA 1J5OB 1PC4A 1RWVB 3S7RA 4CLYA 1YRUA 3H5YA 1QDUB 2XMJA 3P96A 3H4DA 2PIIA 2HBRB 1Y4ZB 3QGPA 4E2FB 1KLMB 2CQ0A 1H2UX 2RVJA 2VC1A 3KLHA 1RT2B 3UDLA 2NYHA 2IC3B 2XHWA 2CAJA 3AFGA 2ZBRA 2IIHA 3HD1A 3MI7X 3UD5A 4C3KA 5EWFA 4LF8J 2FGOA 4OYIA 4LF1A 1UW4A 2XI2A 5K5MA 4WKYA 3L95X 5EWEA 4B9LA 2F1FA 3VF0B 3BSAA 1YJWS 1CJUB 2HKEA 2V4JA 4Y6IA 1Y10A 4UQTA 3DI6A 4HLBA 4MH8A 1N34F 2BJEA 1RT6B 4IG3B 4DL2A 3WHIA 1U48A 1UZDA 1S1VB 1RT2A 3N28A 2AYEA 3EVWA 4F0MA 4WFXA 2L41A 5DLGA 3RR7A 4B9MA 4U6PA 1R8BA 2E5HA 2HG4A 4Z7YA 5E3CA 4CLFA 4D3HA 3PFOA 3OVAA 4EBCA 2A1BA 3A8JA 1S72S 4FYDA 2HHSA 5CD4H 2VPXB 4NLYA 3FVYA 3MPDA 1RCOB 7FDRA 2KJWA 5F41A 3D28A 5E5NA 2HAIA 5A0YA 2OP5A 1U6ZA 4UOCA 4OHVA 2HZAA 2GIRA 3M2VA 3MEDB 4EYHB 3MEEA 4RW9A 4JI1J 1N33J 4UT4A 1SV5A 2J7KA 1NSPA 1SPBP 1U1RA 1RABB 1UEUA 2C2KB 4ZDNA 2V8HA 3WC2A 4K7QA 4OYWA 1UTAA 1KD1T 2CNNB 3R9LA 4RUCA 5HATA 1UFLA 2HNZB 1JLFB 3FCWA 1QAIA 4K59A 3C19A 3KJVB 2UXBF 4OYOA 2W7AA 2KB2A 2GV1A 4I1TA 2VDHA 1WEYA 4ZLLA 1WHYA 3PO4A 4RW6B 3Q83A 3UO0A 1RHJB 4MTPA 3PVXA 1Q0NA 2CPHA 3H8YA 3LP2A 1WWHA 3NWRA 2OPPA 2VPYB 3EMTA 2XCPA 3Q2SC 1NB7A 2EFGA 4TLRA 5L38A 3AJDA 3OL6A 1B7FA 3IBCB 3MEDA 5AXLA 4USVA 2GHPA 2RILA 4ELUA 1GMWA 3A13A 5I42A 3J80U 1NHKL 1UJ5A 3VHQA 3ZZTA 3TX0A 3DYAB 2YKOA 4G1IA 4DV1J 2AGQA 4DFJA 3M6XA 5L46A 2HIYA 2HHQA 1SXLA 4DV2F 4C8YA 3K8VA 3NOGA 3PYEA 3HXMA 1RK8A 2K1RA 3OFEA 2AKWB 2PO4A 4J7CA 3WIVA 3SEOA 2XTJP 2FY1A 1P1LA 4PG7A 3Q89A 3CC4S 4Y0FA 1PJ7A 2GGPB 3T6BA 3MR2A 3PEJA 3OVBA 3B54A 2MY8A 1MG7A 1DLOB 4UUWA 1VCTA 3TVYA 1UFKA 2BABA 4K5SA 3M2RB 1EAYC 1TL7A 2Z56B 1JLGB 3B8HA 5B0EA 3W9HA 2ZH9A 5D3GB 1T03A 3WX4A 3FDSA 2W2QP 4KV8B 2I6WA 3RRKA 3J80Y 2Z0GA 3IM8A 2IC3A 4OLOA 3MF5A 1QLNA 2CVIA 2MGZA 3DRSA 3KK1B 5KFKA 1T05B 1CJKA 3GYXB 4OJ1A 1YSJA 3WX8A 5F0UA 4C6AA 1Q7YT 1ZS6A 2BDPA 2E7VA 3MHYA 4ZVRB 5C5JA 2VBZA 4PUOB 3IR5B 3RB4A 3LO3A 1N5TA 1PYOB 4RJVA 4DX8H 2APOA 3GIIA 3DRPA 3HSZA 5C42A 4I2PA 1S1VA 3K5LA 2B8QA 4NXMJ 4TKTA 3KHHA 5F0WA 2ASLA 5E3QA 4M5NA 4YHHF 5RUBA 3AHPA 4QWCA 3H4BA 3FNNA 2B6AB 1RISA 1ACMB 2FYXA 2AP6A 2VG7B 2M4MA 2X3GA 2ZE2B 5HBMB 5KFEA 4JI3J 3X3UA 5KG2A 2UXDF 4LFCJ 2F9DA 1X4AA 4NLVA 3HDSA 1N5SA 1XTZA 1RJJA 2GZOA 4HH1A 4I2QA 4ZLJA 1C1CA 1KFDA 5THWA 3P45B 3ZZRA 1SL1A 3HVTA 3RAMA 3JSMA 5AXNA 2A6OA 2DRDA 2P9CA 4DBQA 3PJ9A 1NNDA 2EG2A 2DHHA 2V4JB 4BC7A 1HLWA 5JMNA 3EX7B 2AZ3A 3KWMA 2DHSA 2ZH8A 5LMUJ 3A3OB 3T3FA 4IG3A 2KI2A 4LF7F 2CWXA 3MM9B 2W2NP 3QT6A 4FPIA 4I2PB 1XWLA 2B51A 2W9AA 1NEEA 1D9AA 1MWYA 2HGMA 3Q8SB 3NMAA 4B3RF 1Q82T 1B3TA 4DR3F 1RT4A 1SJ1A 4DFKA 4Q0BA 2HHVA 2CG4A 4NI2A 1KQSR 1LK5A 2BJ9A 1HI8A 3AJ1A 3K89A 5E3PA 3J7YI 2HHHJ 4JI6J 1Q8IA 2RRBA 3I0SA 1KEKA 4G1PA 2Q6BA 3M8ZA 2ZFHA 5KFAA 1VRUA 3DXBA 4ILLA 3DDKA 5K8NA 3FUYA 4QJVA 3CJ2A 4DLGA 3FBEA 2K2PA 3DOKA 1H73A 3CNQP 2M88A 3UN3A 2ZZNA 2LXIA 1T03B 4B3MF 1QE1B 2EVZA 1S77D 2CZVC 4L75A 2O5DA 1QD1A 1MMLA 2UVRA 1WNEA 2VONA 2E5IA 3OUYB 3MFHA 2CJAA 2HNYA 3SQGB 2RH3A 3BH6B 3TJ8A 2E5LJ 3CD7A 2MKSA 1NDCA 5ETTA 5KFFA 2Y1JA 4ZOSA 3KG4A 3T1AA 4BC9A 3MCNA 4LBPA 1Y7PA 1NSAA 2LCWA 2ASYA 4BCAA 4F36A 4OI0A 4C0HA 1X4HA 3DOMA 3OW2R 2LKZA 1LXNA 4DX6A 1SC1B 3BF4A 2X1BA 4JI5F 2KHCA 3AT1B 4X66F 2R7WA 5KG0A 5IM0B 5AJ3F 3DLJA 2CZ9A 2V8VA 1TR0A 2YNHB 1H3DA 2Z57B 4D3GA 4IYQA 3LTOA 4DFMA 1R8HA 1HBMB 4ECTA 2IA6A 4EBEA 2QMUB 2DNRA 5K8MA 2HIQA 3SDEA 4CT8A 3TQEA 3VGTA 2BQRA 1RYSA 3IA0A 1XMQJ 4DSLA 3DFEA 3TA0A 3MEGB 1RT6A 1VQ7S 2R7UA 1HMVA 5E3RA 4EUVA 2P8IA 4K4YA 2PMWA 1Y3KA 2D69A 1U0SA 2IVFB 3I55S 3RGIA 1SJFA 2VL1A 3F56A 1ELOA 4HH0A 3UNYA 4DEZA 1N0VC 3N9UC 5C25A 1HNIA 3W5ZA 2CPXA 2GFFA 2RDDA 3SV3A 2RSQA 1V3SA 2DXFA 2ZJRQ 1I6JA 2DHXA 2ZDOA 2EXUA 5T7LB 3GWCA 1LW0B 5KFSA 2XMWA 3K0JA 1G7CB 5KG3A 4ED2A 3C14B 1FFWB 1UEVA 2WVBA 3HHLB 2EG1A 3MEGA 4JB8B 2YWGA 4PWUA 4ANEA 4G1QB 4FS1A 3T1YF 4ILMA 3MUMP 2H1YA 3SSQA 2JLGA 2ZDPA 2YQ1A 3NY0A 1Q7LB 1N0UA 2HBYB 3UI3A 5KT4A 4WFZA 4NA3A 3NAIA 4RPFA 4C11A 1B4SA 3ZZZA 4QWEA 4F8RA 3M8PA 4F3QA 4F4YA 1X31C 3TUIC 1UFWA 1GX6A 2OPSB 2HEKA 1K1QA 1R8CA 1NJWA 4QYZJ 2CQGA 3MAAA 4U96A 3HVRA 4DR7F 1KN6A 2AYMA 3E8OA 1JKHA 2V2ZA 3W5XA 3PW0A 3F0NA 3D54A 4DQRA 4I7FB 1T8EA 1JWWA 2CPZA 4EI2A 2V2KA 2VOOA 1PC5A 1KQFB 2ZBQA 1C1CB 1KC8T 3I9V9 1MW7A 3I56S 2CXEA 4USJC 5A0YB 4O4GB 2Y9HA 1HIYA 3C16A 4IRCA 1BD6A 3RU0A 3DRRB 2QRRA 4HHJA 2QG9B 4X66J 4FZVA 3D68A 2DR8A 2BRKA 4WKRA 3E01A 1AB8A 4WK1A 2X51A 2MY7A 3OHBA 3KLFA 4MKBA 1L5UA 4OZ3A 4CLPA 1YZ7A 1VLYA 2EK1A 4NLRA 2QX0A 7FD1A 4RL1A 3PW5A 2FQQB 1S12A 5J2NA 1PILA 3TA2A 3VV2B 1YLXA 4TY8B 5KT6A 5D0RA 1IR2A 4OHWA 3QT8A 2XNRA 1N54B 4IRKA 4WTOB 2VBWA 3FC9A 4N76A 4JV5F 4OX7A 1KBRA 4AXJA 2W9CB 4DUZF 1HR0J 4GKKJ 1VI7A 3D6FB 1FD8A 3ZTRA 1VRUB 5CCMA 4NLOA 2FJEB 1MN9A 4DXLA 5T14A 1UA1A 4LFBJ 1O5JA 3ENQA 1N52B 4XAKA 3V81B 2DVIA 5A8RB 3GR0A 4Y2AA 4ZPCA 3V4IA 2F4VJ 1WDTA 3NOCA 2DPIA 4DL4A 1K73T 3N6MA 1N32F 1U1PA 2IA0A 4U9RA 3OVSA 2OHDA 3OR2A 4ZP9A 1KFSA 3DLBA 4NRTA 3HHEA 2AWZA 4UUXA 5GAEU 1HQEA 4PWWA 4TY8A 2ZM6J 4G65A 1HNWJ 1TKXB 3CDWA 4TU9A 3R7SB 1UW9A 2OEKA 1JLQA 1RA7A 1YGYA 5HP1B 2OPPB 4A8OA 5EN1A 1HMVB 3QAUA 1HBOA 1CEZA 1DJ0A 2IBOA 3VGUA 3CXCR 2FHJA 3PHTA 3I87A 3HJFA 1GH8A 3HT0A 1UMJA 4IO1A 1S7HA 1KR4A 1HQEB 2XC9A 4GC6A 4F02A 2IHR1 1YRTA 2W4PA 4NASA 5SUHA 1WUUA 4ER8A 2FVPA 4WZMA 1FE0A 3D4JA 1I94J 3T5LA 2WVFA 1R8AA 3MAHA 3OR2B 5ETVA 1L3SA 4JV2A 1RBLA 2DH8A 2JVRA 3M8QA 2A3JA 2M5YA 4FS2A 1PGZA 1SV5B 5KG4A 8AT1B 3CCLS 4DI6A 1H98A 2CYYA 5L1KA 1EZZB 1Y11A 1FDNA 4CO2A 2PN6A 4IG0B 3JXOA 2XSFA 1IJEB 4OHXA 2VIHA 5KFLA 1N8RT 3J7A1 4W4MA 4DQIA 2M0GB 2B6AA 3PJXA 4DCJB 1JLCA 2DHGA 4OYAA 4B3SJ 4RW8A 1SC6A 3TNVA 4DUYF 4ZVUB 1WC0A 2BE7D 2UUWA 3GSIA 1WTBA 5F8MA 1IR1A 2O01C 5HL7Q 4RZRA 4FF3A 1RAHB 3M6VA 3QRQA 2YNFB 1S99A 2PT0A 4Y2KA 4U8VA 4B3TF 4LF5J 4CQ1A 1I5OB 4WU2A 1QAJA 4NCGB 5J2QA 2HFUA 1L3KA 2RS2A 4PKDB 3AQPA 2WSFC 4ID8A 2AGOA 3IMQJ 2W9BB 3CCWA 3SQGA 1ZAXA 3NCQA 3M6UA 3TARA 3OJUA 4P7TA 1JKHB 3AB4B 4A8SA 1BQNA 1UVMA 1TKXA 2DGUA 1H2VZ 3PW7A 2DIVA 1U1OA 2B5JB 2L9DA 1UKUA 1V3ZA 4RW4B 2WK4A 3ZZOA 4DQPA 3UVJB 3M2UA 2LFVA 2QA2A 3QO9B 1VBZA 1IBMF 4F2SA 4C3LA 2W9BA 3M32A 4DV6J 3QIPA 2M52A 2HVHA 4N56A 4XPEA 2HQ3A 4P73A 3MM7A 3KK2A 2HGLA 3GMGA 3IWNC 5LT5A 3DRXA 1DAXA 1Z2ZA 2UU9F 5AT1B 2RU9A 1X9MA 1F0XA 1GAOA 4F26A 3SV4A 2HWIA 5B08A 1IWGA 1F5BA 2M9KA 3D0GE 4LRDA 4C8OA 1RTIB 2BA9A 3VAIA 4DL3A 1NU4A 3G8QA 2XWYA 2LA4A 4NX9A 3W66A 3TJAA 3MOZA 1PJ5A 2IRXA 3DOKB 1WTFA 3D6HB 2XY6A 1CJVA 3I5BA 1NKBA 1QVFR 1K0VA 3FMBA 2VG5A 1HNXJ 5KFYA 2FZCB 1UVLA 3TWZA 3R3TA 1FNXH 5D15A 4BS2A 5IQ6A 4H4OB 1KKHA 3KJNB 1ITPA 3SXLA 2X7IA 4ED5A 4J9QA 3CCJS 1ZM9A 4TVAB 3ENWA 4CP5A 2LXUA 3NGKA 4EZ9A 5KFZA 1SQEA 3PYDA 5G0RB 2MTLA 1U1LA 3I0RA 2B56A 4CLLA 4RW9B 1RWWB 1MSWD 3E2EA 1TU0B 1SL0A 2RRAA 4JI4J 1HI1A 5KOWA 3GQCA 4ZJOA 2Y1IA 3BGFA 5KT5A 3MPYA 3OFGA 4HYKA 5FDLB 3H42A 1FFGB 2EFOA 2EWHA 2MQ8A 4QQBA 4RUAA 3M8PB 5CD4A 2FZGB 3TANA 1BXNA 2A10A 2QLWA 4DDFA 1XMQF 4K4SA 3Q8UA 5I3PA 2AYBA 4QU6A 2FJDB 3KLHB 1K8AT 3SSRA 1RHKB 4BBYA 4X4RA 2OD6A 1FKPA 3I4PA 1FDBA 2OKQA 3IGNA 4J9PA 2W4CA 3MR6A 4KJIA 1SVDA 2VBYA 1RB0A 4PYAA 1D8YA 3V2UC 1LW0A 4B17A 4Y2IA 4MIWA 2E66A 5L9XA 3G71S 1GMVA 1AXQA 2JLFA 4ECVA 3LPYA 4DU8A 4ZPDA 2QC3A 2W24A 4M8LA 4Y34A 2D9OA 1AZSA 1KTVA 2MZTA 1RACB 3G6ES 2FY8A 4C7QA 5KFHA 3KLEB 2G2OA 1FI4A 1D09B 2M8HA 3K5PA 5H1SV 3LH2S 3KK2B 2VPWB 5DDOC 2AX1A 1O8BA 5HMWA 4YOEA 4PG4A 3DKDA 2UUBF 2AEFA 2XLIA 5E41A 5BR8F 4MK9A 2E29A 5IFMA 2K3IA 5CYMA 4O0IA 2ZUGA 4NA2A 3Q8QB 5HLFB 4UZCA 2RDIA 1HWJA 5KFXA 3MEKA 4KFBB 2DH9A 2C42A 1TL7B 3R5GA 1S9FA 5I4MA 4EMDA 3NXZA 2HVDA 3BS9A 1KQGB 1VS3A 2YKMB 2ZKUA 3F73A 3V4IB 3VGVA 5DGBA 3BREA 4GO7X 2IM0A 4JI8F 1LOUA 3HHLD 3SCKE 4J9RA 4U95A 2UUBJ 4KT0C 4A46A 3G4SS 1SBRA 4DV7J 4F4XA 3EGZA 2U2FA 4LREA 3HM9A 2B9WA 2CKWA 2R4FA 3FEYB 3N01A 4I6WA 2GCFA 5KFVA 3R5BA 1TK8A 4RLEA 2I1RA 5DM6Q 4O3PA 2D3OR 3C3LA 1CPZA 2CQDA 3FKBA 2MMYA 2PEBA 8ATCB 5L1IA 1W7WA 4WIQA 2KFYA 4DS5A 5KG5A 3FEXB 1KOOA 1RWKB 3MMJA 1WG1A 2ZKTA 3Q8YA 4ZS6A 3WZ0A 3JQJA 4OHYA 3RJMB 4JV5J 4KO0B 2MHNA 1SH0A 2C2RA 1DQAA 4JI8J 5IQQA 5BYSA 2DY9A 2H51B 2VB6A 2NPIA 3D1HA 1GQEA 3PRDA 4AYBD 2DNMA 2K06A 5CCLA 1C0TB 1FWPA 2ZM6F 2ZJPQ 2KXNB 2H9ZA 4KKOB 2MSSA 2NS1B 4O3QA 3UCGA 2YX4A 4K0KF 1KTQA 1VHIA 4KYZA 1YDLA 1TKTB 5E2QA 1VIXA 5CAAA 4WCEQ 4ILRA 2W2MP 2CFXA 2DRAA 4P74A 4YP3A 2V6AA 3W63A 5DDRC 1HW8A 1TMMA 2QIFA 2VPZB 3OTBA 3BYPA 5EDWA 2G0JA 5FJ4A 4M5GA 2OPSA 4C8NA 4Z2XA 3CO0P 3JSBA 4XPCA 2NLWA 1R8PA 4J37A 4J9OA 1E6VA 4J9VA 5JXSA 2D9PA 4CO1A 3D6MB 2VHGA 4ECWA 3ITHB 2MKJA 2VU5A 5DRKA 3KJQB 1U6FA 4K2XA 4DZDA 4EYIB 2KKHA 4MFBB 2I38A 3GTYX 1U24A 2G1HA 2OUGA 1TP7A 2CQIA 2CQHA 4J9LA 1WG4A 3ISZA 4EK2A 4UTGA 3CJQA 3K5NA 4IRDA 3QLHA 4BDPA 1UVIA 3GB0A 3HFVA 3PKYA 1LK7A 4QU7A 3M9MB 2WRMA 2N3LA 4CH1A 3A8IA 3UN2A 4QIWD 5D0GA 4Y2CA 4HEA9 5KFIA 3L3CA 2DB1A 3I9ZA 2EFNA 1RQ0A 3G96A 3GYGA 4NZ7A 2CJYB 2Z2YB 3IFEA 4ZCKA 3BQ2A 3FSXA 1YJ9S 3JAMY 2DGVA 3RB0A 2R3VA 2R7QA 2WOMA 1LW2B 1IKVA 2KT2A 2ROEA 2AF6A 2OO4A 3OXFA 3M05A 4F2RA 4OQJA 4JI7J 1F60B 2BMBA 4CO3A 2OJ3A 1KHVA 4QW8A 5KFDA 4N7TA 1FJCA 2JC0A 2EI5A 2AEJA 2KYZA 2Y0SD 2XLJA 1TVRA 2X1GA 1CSJA 2HQGA 4LVNP 2WVDA 2QV6A 4KV8A 4DJBA 2ILYA 4A8KA 5HROA 1FKOB 3CD5A 3EPGA 2CRLA 1BQNB 1BE4A 1DQ9A 3G82A 4NLTA 2OFGX 2XBPA 1EARA 3EGWB 4M5KA 1SKSA 1M5VC 3R2DJ 4PQUB 4FNHA 3VGSA 1UWAA 1RTHA 4I68A 5KFJA 2FHKA 4IH6A 4KGXB 3TI0A 3CCQS 1Q5VA 3GE9A 3QATA 3SCLE 3T9NA 4BHQA 5HVHA 2BJ3A 1CULB 1C1BA 2QYCA 1LWXA 1U2RA 2KL8A 3HF5A 2Z2LA 4KGZB 3UVJA 4C98A 4CM2A 4DUTA 4DHVA 4OFZA 3LAMA 2ADCA 2LU1A 3GIRA 3RW6A 4UF4A 1V5VA 1B99A 2MQQA 1RE1B 3IP0A 5J2PB 1G3OA 2E9RX 1RHUB 1QM9A 3V6DB 1JLAB 3B4MA 1LQ9A 2GHWA 4PXEA 3ZZUA 3ET6A 1JLBB 4F4KA 2QLJB 4DV1F 2PA3A 1GK8A 3UDEA 5D77A 5KT2A 2DGXA 1Q8BA 2EFQA 4LF9F 2RUGA 1S0OA 4M5JA 4MK8A 1X4DA 3THPA 1M5PC 2MPUA 2Q43A 1YQHA 4ENOA 3MCOA 2GAGC 4PR6A 4WPAA 2LQ9A 1JLEB 3UW1A 4F0KA 3QZ7A 2LEBA 2ZHOA 2B8PA 4YY3F 3PM9A 2MQLA 4GC7A 4C8MA 2LU2A 2GJFA 2IVYA 2MXYA 1C4CA 4A8MP 1BLUA 1YBTA 2GMLA 5D0EA 1GEHA 3QNWB 2XMVA 2ZD1A 2WBMA 3M30B 1KVIA 3HZGA 2K7JA 3DRPB 5C42B 3UD3P 2BQ3A 5HK4A 5IT9U 4UW2A 4CO5A 1M5HA 2F3JA 1CQNA 4O4GA 1KOHA 3HZEA 1HBUB 2HRUA 3MPVA 5KFOA 3KUEA 2N82B 3F44A 2YX7A 4ED1A 2NREA 4MKAA 5DQHA 3R5DA 2ACMA 4J90A 4WXWA 1AUDA 4CLSA 3IWLA 5L8RC 1SB6A 1WKKA 3EGNA 4I0WA 4AL7A 1NZ8A 2KM8B 3BO3A 1V3RA 1IKYA 2DHAA 2CPDA 2OMLA 3BGOP 4H4MA 4O44A 3PNIA 4EEYA 1X9SA 2J6SA 1F2GA 2M7SA 3MMAA 3U1NA 2RQMA 4E0DA 2GX8A 2IM3A 1MROA 1RGVA 4M5DB 1IJFB 4RBTA 3CJ5A 4H4KA 1EQ0A 3BPDA 4IUFA 4F4AA 3KFWX 4DR1F 1VQSA 1NJXA 2GVZB 4KGKA 2DYAA 3PRVA 2LEPA 1RBAA 1G1XA 3H59A 2ZJQQ 1R0AA 1NK9A 1LXJA 2DNYA 2XG8A 2RB7A 2DKOB 1Y5NB 2VG6A 1SJ4P 2N4DA 2VQFF 3AD8C 3NS5A 1P8GA 2ILZA 3POTA 3KLGB 3KJFB 4C9DA 2AJ2A 3MTKA 3MECB 3OXLA 2LECA 2RF2A 1NK6A 2O1PA 2B9YA 1VGYA 5F8GA 3P6YC 2J76E 2WONB 1T9XA 4O3SA 4W90B 2F7VA 1VBKA 1NZAA 4YHHJ 3HO1A 4QIFA 1J2VA 2H5EA 5ITHA 4ZPAA 1GFWB 2VJVA 3R5AA 3JB9k 3ZZ0A 1SC4B 1WG5A 2JL9A 3MM6A 1YJRA 2E5GA 3H25A 3LP0A 3P49B 2CJ9A 2LXFA 1VQYA 2KU7A 3DYAA 1R31A 2Q79A 3MMCA 4KY3A 3VQSA 4YS2A 5K14B 2H4YB 5LSOA 2JEGA 2R2UA 2OEJA 3N5FA 4WFAQ 3PACA 1BQMB 4J9SA 4USMA 2MQOA 1HWIA 2FGCA 4Q43A 2HNZA 1NK8A 4LR9A 2E7WA 1NSKL 3JS9A 3BBBA 4LIRA 4C0OC 4C2MA 1ZZNA 2ZWPA 3PXGa 4LQ9A 3M8SA 3M8QB 2B43A 1S9EB 3QGGA 2HFNA 1Q79A 1YRXA 1NMEB 1XJWB 3OBIA 1R89A 2YKPA 2G13A 2IAJB 2IYGA 3R97A 4X4TA 1K0TA 4WBFA 3RYLA 1YK9A 4R8UA 1VFJA 1R3NA 3VZIA 3V5RA 4AL6A 3GV8B 3RRGA 5DGAA 5CZXA 4PPDA 1MU2B 2ZZTA 4BWJA 4X4VA 4WJBA 5B0CA 1OO0B 4GKJF 3BB5A 4Z7CA 2ZH2A 1VIOA 2BX6A 3BPSP 2GC8A 4KBIA 1MMNA 1UAWA 2P5VA 3CIZA 3OSNA 1QSYA 2JDJA 4AL5A 1WF1A 3MMAB 1ZTWA 3OXGA 3NL0A 3X1LB 4JP8A 4AE5A 4ID5B 4B9NA 2PSZA 1RWMB 2GIFA 4QPTA 3D3CJ 4V19J 5E33A 2DGSA 4KR0B 3UN5A 4YB1P 4F50A 2HMIB 2V4QA 2G2ZA 4P9SA 3RW7A 1RLDA 2CUYA 2ZZMA 1OPIA 1SH2A 3LQVA 2ZWOA 3IR7B 3QGHA 2EFVA 4LFAJ 4DV6F 1U1NA 4JI7F 2JWNA 1MWZA 1OSDA 1NAQA 4CZCA 4N47A 5IC4B 4ANCA 3UWTA 3QJJA 4OZ1A 4KKOA 3JAMU 4X4QA 3MR3A 4C0BA 2ZD1B 1TTHB 3OL9A 1L3VA 3GV7B 5GAHU 4WF9Q 1RTZA 5B0DA 3AXKA 1S4EA 2V67A 2YKNB 4GVBA 2DGOA 2L9NA 3NG8A 3P5TL 4MJKA 5G0RA 3GIJA 1X4GA 3MMCB 4KSEB 4Y65A 3CCUS 2AW0A 2B4UA 1BHNA 1OS5A 1DARA 4B3TJ 4LF5F 1F3VA 1S1WA 3QRRA 2KTQA 1RKIA 1S48A 1XMBA 2CPFA 2F5GA 4URGA 2DNPA 4QR2A 2BOPA 3ELHA 2CQBA 1UVNA 1VDHA 4CNYA 5F9LA 3GR1A 2HK3A 3BEGB 2LQJA 2WONA 5GAHI 5LSRA 4ECZA 3G86A 3BR8A 1SIZA 2HZVA 2DTJA 2ALYB 1WC5A 1VRQC 4KGMA 2GQQA 2BE9B 4MK7A 4YMEA 1SCJB 4NEYA 1HA1A 2IJFA 1S0MA 1Q5YA 3VAGA 1DHMA 4IFYB 1S1WB 2I5JA 4CLUA 5CQGA 2ZBCA 4O4RA 4X4PA 1Q4RA 1N33F 2QT7A 3O1LA 2OAUA 2V8PA 3R27A 2CQ1A 3KJVA 4YN3B 7AT1B 4K4XA 3KLEA 3VCDA 2V5HG 3GJQB 1S1TA 1XN9A 4RUBA 4O3NA 3QPIA 4OI3A 3HK2A 1XNRJ 4PQUA 3GFZA 4Q2LA 5C24A 1SI9A 1GNKA 1GXUA 3GCWP 3TA1A 2B5JA 5CYMB 2HHXA 1ZYQA 2JLEA 2MQMA 4IFVB 4ZKAA 4ED6A 2E5LF 4JI2J 1OYDA 2GNKA 4KTQA 1WI6A 4ZHRA 1N6QB 3WIUA 3KHRA 3RAXA 4ZCMA 1S6UA 1U45A 2K7KA 1PYTA 5HMZA 2DNKA 3I32A 4IDKA 1D9DA 2XWXA 5IOLA 4J9UE 1ZTTA 3B4DA 2DR9A 3CGIA 3DMJB 4ECRA 4X65F 4Q0BB 3CT9A 2C2MB 3AXMA 5DLFA 2QYGA 2V2VA 3C6TB 4K2JA 1TELA 4WXOA 1CS4B 4LQ3A 1HYSB 3PKMA 3CEDA 3AODA 2XB2D 4P71A 3PW2A 2RHSB 3FBFA 2YWEA 3I4HX 5KT7A 2LEAA 2BKPA 2HWHA 3DC2A 1TL3B 4WE1A 1XNQJ 1V5IB 4QWDA 2H54B 4FVCA 4IKAA 4CNZA 1X5OA 4CH0S 3EE3A 4DX7A 2EKYA 2YKQA 1W26A 3HSJA 4DN0A 1WI8A 3ZC4A 3CB4A 1NK5A 3JSRA 1HR0F 4L72B 3NNHA 4GKKF 1PCAA 2B0GA 1ZM3A 3EDQB 3P5BP 4IDKB 5EHHA 1NRKA 3EXYA 5B0GA 4HDHA 2MHEA 3GP9A 2V94A 4ECSA 2KXFA 3H40A 2VV5A 2GO9A 2QFIA 4NLGA 1WDDA 2HFVA 2BACA 3KHLA 2GVDA 2VF3A 4LF2A 1YX2A 3CMQA 2VQEF 1FRJA 3D3BJ 1KNZA 3MOJB 1FX4A 3MURP 1SJ3P 1Q16B 4IH7A 4ZCIA 4RR5A 3G6YA 4WFBQ 3RB6A 2HVIA 1WSVA 3GJSB 4QIEA 5H9EK 2DNQA 1L3TA 2AJ4A 3MPUB 4LMZA 2L3MA 1FEEA 2VG6B 5FD1A 1U02A 1FT8A 4L6V3 1NH8A 2NQPA 2HS3A 3T1HJ 1HWKA 1VQNS 4XDCA 3BGRA 1V6HA 1WELA 2CIMA 2IJRA 4NWBA 1FTRA 1PBUA 1FXLA 3TJ9A 3PTWA 2FHJD 4X62J 1S7IA 2RNEA 3KG1A 1UEKA 3W2VB 4IFVA 3DLGA 1HQUA 4X4SA 3EYZA 1DRZA 4TY9A 2LP4A 3VAKA 2JRSA 5GAGI 2DO4A 3ZZYA 1RTDB 2OIHA 1RT7B 4ZPVR 1IVZA 4DX5A 3SQOP 4XO0A 3ZNJ1 1X0PA 5J2NB 5I3UB 2IDLA 4C8LA 3LUYA 1UVJA 2Z4PA 3FQLA 1YJUA 2UUAF 4AUKA 2XZDB 1XMOJ 4NI2B 4ERDA 1IKVB 1LW2A 1I1GA 2J8AA 4HT5A 4OX6A 4QWBA 2MKKA 3KK3A 2W9CA 2AJQA 3KNAA 1XR5A 2B9XA 3O8WA 4QZVB 3ILIA 3TZZA 3C46A 2GIQA 3OLBA 3BDEA 2BM1A 3J7AN 2G2YA 3MD3A 1VQ4S 3THTA 3VAFA 3TUPA 1FO1A 2HS4A 2DGQA 4ES1A 2YKMA 3LOUA 4PG5A 3TZYA 1QE1A 3H5UA 4DSKA 2HFSA 4X64F 3FRZA 1U47A 2HHUA 2CADA 2BKNA 5CZVA 2E9ZA 2FB0A 3K5MA 2PMZD 5DZ7A 4R0EA 3Q86A 5IS2A 4HDGA 4JI2F 1F3FA 1MMDA 2V8GA 4KPCA 2F4FA 4V19X 1NO8A 4W98A 2XY5A 2PFFB 3PR4A 4Y00A 4DV3F 4DV0F 2GJIA 2E1AA 2UU9J 1IBLF 2GQ2A 1YWXA 3EGVA 4IH5A 2RD5C 4FYYB 2DO0A 3IC1A 4WIIA 3HD2A 3QRPA 5AXKA 2W01A 5LJ3Y 4DL7A 3TVKA 1M5SA 2DCUB 4A4JA 3R6GB 1LFPA 2PD1A 2RQCA 5U47A 2N7YA 2R8GA 5AE2A 3GFXA 5AE3A 3D7SB 5L1JA 1WC3A 1HNWF 1IKXB 1PSDA 3PYGA 3K59A 1JXVA 4ED7A 4RU2A 3DU6A 3W1YC 4H4OA 4A47A 2C3MA 3DN9A 1HD1A 3T19A 2V34A 2KZZA 4HKQA 3HKZD 3MTJA 3T5HA 3VAHA 4OL8A 5F8NA 4CCHA 3ENAA 3FCVA 1Y00A 3TYTA 3D0IE 4HI1A 1IKXA 3GYNA 4LF8F 5L1LA 3POTB 3R1LA 1R0BG 3QWPA 4USUA 3GIKA 1HNIB 1OMSA 3QYYA 2JSXA 2XGQA 2YY3A 2PEHA 1NDLA 3DDIA 5EX3A 2ACYA 4DPTA 4ZN1A 1U8SA 5G4DA 3W2WA 3G87A 1EIYB 1TUVA 3M8WA 2CQ3A 3AOCA 2E5JA 2EC2A 5CYQB 3FEZA 3RZAA 3GLJA 2BE2B 3U1LA 4DMZA 3IR6B 3MR5A 4YQWA 2PFDA 1ZM4A 4J5OA 4LRAA 1SJQA 2LLZA 1H6KX 3I6PA 2W7PA 2ZEJA 1RWOB 2MSTA 2ZC4A 1SL2A 3A3PB 4K4UA 3DOLA 3GG1A 4JI5J 1AUSL 1JLGA 1T9YA 3CJRA 3EWGA 1VK3A 2IYIA 2RMLA 3HI9A 1C0UB 1X60A 1J5EF 1P6TA 5I3QA 2YPZA 4RW6A 4DV5J 1TZ0A 2J9DA 4M5LA 2F8HA 2DJWA 4OZNA 3WQPA 2EC0A 4EFAC 5LOQA 3M7VA 3K7RA 2FVSA 3DLEA 2CPEA 1Q78A 1FJGJ 4ETZA 2FHOB 3R1HA 5L39A 2BJ1A 2W2PP 5DQGA 4J9KA 1T3NA 3A8EA 4QOTA 4OZJA 3C6UB 3C16B 4EO8A 2X1FA 2HPUA 1RAGB 1RAFB 1C0UA 3KLGA 1TL4A 1AZSB 1FD2A 1WJ9A 3DLHA 2QE5A 3CJSA 3GJTB 3DOLB 2UUCJ 1W25A 1VJQA 1M90T 3SCIE 2R7VA 4AD6A 2PI4A 1TUGB 2Z30B 2VZ9A 3BSOA 2MLZA 1ZA2B 2IM1A 4B9UA 3R8YA 1RTJA 2VBXA 2XZWA 3Q0AA 1LWCA 3AOAA 3KLIA 1RT1A 2BJ8A 2L9WA 1R27B 3CCZA 1T11A 1PAEX 2C1EB 3M32B 1RAOA 2WSCC 2M2BA 5J1EA 2C2ZB 4BLGA 2KVIA 5GADU 2P9EA 4OX9J 1DQ8A 3KOAA 5BJRA 1BMQB 1U2FA 3PEHA 5DDQC 1FWKA 5ETQA 5F3ZA 3KMQA 3LF0A 3CTRA 2XCAA 2FJVA 1W2BR 1BC6A 1DURA 4C4WA 1TL1A 4F0HA 1RBOB 2BQUA 3ULHA 4ETXA 2WSEC 4DL0C 3OV7A 3NGUA 1E6YA 1KWMA 2NXJA 2ZVIA 3HP6A 3G8TA 1ZPVA 1S49A 5A8KA 5A8WA 3KLVA 3D1OA 3HFKA 3LANA 4DSFA 5F8HA 4R8UB 4OX9F 5SZTA 1ZOTA 1HHQA 1WKLA 5GADI 1B70B 1EX8A 2VFTA 5HP1A 1T9UA 2MKCA 1MWQA 1H2TZ 1EETB 2VG5B 2VFVA 3HSDA 3JSYA 1S76D 4ZK7M 2UUTA 4KO0A 3KYLA 3TEGA 4ZITA 4R5PB 1KDNA 4QWAA 2R8JA 1FA0A 4LSLB 4TU8A 1RHRB 4USIA 2BRLA 1HNXF 5F8LA 2QA1A 3D67A 3HLUA 4FKYA 1B0PA 1F2HA 2EBGA 2J5AA 2H65B 2WVCA 4HI2A 2LQBA 2GGPA 3DRYA 4I67A 5AE1A 5BR8J 4JBCA 2KRBA 3ZFVA 2FDNA 2KYXA 4K50A 1FRHA 4ZCLA 2YQ3A 3MM8B 1HYSA 3JYTB 5F8IA 1P27B 1RWPB 3WDOA 1YZ6A 1G4CA 1P9QC 5KTQA 4YR0A 5IM0A 3W64A 4ECYA 1Q95G 2B3TB 2BOAA 2P6TA 2YQ0A 3NWGA 3PFEA 4MMOA 1LKZA 4R5PA 5JVHQ 1J5EJ 3BYRA 3EZOA 4G3IA 3QJPA 5LXYA 3D0HE 4N8OA 1ZETA 2JX2A 3ADAC 5KFQA 2U1AA 1T95A 3ZXWA 3M9OB 2AHOB 4LR8A 1IM4A 4MFBA 1FVQA 3EUNA 3EXCX 4PXBA 3VR1A 2KT5A 3MM8A 5GAGU 1FXRA 3PO5A 1R0AB 2NUHA 5F9NA 4NCGA 2RQKA 5J2QB 3L7PA 2RU3A 4UQGA 3TZWA 2MLYA 2NYIA 2KT3A 2O67A 2RJZA 3DNCA 4XDDA 3DHXA 2UZAA 1FEHA 2DXDA 4PPZA 1RT7A 1RWNB 4I6AA 2HHHF 1TL1B 4RW7A 4B3SF 2PI5A 2WB4A 4P6QA 2ZC3A 1EHWA 3BBCA 2HHPA 3D9BA 3R2CJ 4PWDA 2RIJA 2RRNA 1ZH5A 2DNNA 2DRBA 5CH7B 3UR3C 1B7YB 3NEKA 2DNZA 3TEHB 2WOMB 4NYZA 3QFHA 3OR1B 4GMKA 1HBUA 1X4BA 5HI7A 5DO2A 4DUZJ 4J9NA 1EETA 1X4FA 2PMHA 4F25A 2V9KA 4HL9A 4C3MA 2VQFJ 2CVEA 3BQ1A 2CPYA 4IFYA 4ES3A 2M70A 2WZ1A 2F65A 3A4TA 4LRBA 4A8XA 2C3PA 2B4PA 2YWWA 3Q8RB 1XBWA 4DPOA 4NA1A 3MPWA 2P9GA 4LSNA 4HACB 5BYRA 5KFUA 2FJBB 1D1UA 3W5YA 1NHVA 5DJBA 2DNLA 1OQ3A 3MCMA 4MYUA 2W8LA 4LF7J 5ETNA 4DS4A 3M2VB 1YG0A 5E0OA 2KVQE 4MKYA 1F6TA 1RAIB 1JX4A 1IBLJ 1S6QB 2WBRA 4V1Ak 3W60A 1SH3A 4KIAA 1H38A 2HURA 3H2LA 3IRWP 3CPWR 2HZCA 4JI6F 4ZIWA 3WC0A 3KK1A 2VJUA 4W92B 3MD1A 1C0TA 3Q8VA 3DXSX 4LSNB 2CDQA 3BO4A 4Q44A 4CIOA 4C48A 4JI3F 1SUQB 2NXUA 3BH7B 4X64J 3G8SA 1J27A 2QA4G 2F63A 3G9CA 3LA0A 1PG5B 3CC2S 2P6SA 2J7WA 2RT3A 3RTVA 3LP0B 4FYWB 4DSEA 4QR1A 1WORA 4ITSA 4LIWA 2AQ4A 3ZTOA 2JEJA 4DV3J 1S9GB 1HARA 1TKZA 3HVWA 4FN5A 4K8RA 2COLA 1DBDA 3BN7A 3K17A 2XY7A 3PX4A 1X5PA 3IAM9 3K2YA 1REVA 1QAYA 2GJ2A 1RU1A 2KXHA 3CJ3A 4NZ0A 4DPWA 1WC1A 3JTNA 4PG8A 4L3NA 4PQAA 3TZXA 1HFEL 1VQPS 4WU3A 3T9ZA 3UDCA 1NH7A 1A7GE 5C24B 3BSCA 3FJ2A 3S01A 1S1UA 2VQEJ 1NPRA 1I51B 2VOPA 5CA5A 1OIAA 2W25A 1DY3A 3UR0A 3IS9B 2PC6A 3ETOA 1TKZB 2YH0A 3LALA 3KLFB 1UPMB 1SKRA 3MM5B 5DG8A 2HS0A 4UY85 1FKAF 4X4OA 4QBUA 2C2EA 3CMAS 4I56A 3M1VB 1RT4B 3P8BB 2HAFA 2RKIB 3CD0A 4B3MJ 2NPFA 2HFZA 3UPFA 4HTIA 1VQ8S 1JNZB 3R7BB 1T9WA 5HVFA 4FF4A 4RBVA 3CD6S 5F8JA 1UWBA 2YX1A 3K58A 4DF8A 2B4VA 3N6NA 1GXTA 1C2PA 2QMWA 2JVOA 4KFBA 4LUBA 2VASA 1V9OA 4ZVGA 5K14A 3SYZA 3CCTA 3CJTA 4L3KA 3MZIA 3CULA 2B7CB 3AAWB 1IQTA 1RI7A 4NLQA 3MM6B 1VLOA 4RNFA 2PGCA 1SC3B 2RQ4A 2G4BA 3EDRB 3H5SA 2WW4A 4OYBA 4JI0J 3GPAA 3AD7C 3B82A 1SQGA 2BM0A 4X2BA 1JJHA 1U0HB 3RUBL 2LA6A 4RUHA 2OTLS 4Q8EA 4KGVB 2ZH7A 2HVZA 1VQOS 1XIQA 4FP9A 1RTIA 1AT1B 1JLQB 4PXDA 3BDPA 3NS6A 2JH3A 3CCRS 2YNIB 1GXLA 3CJ0A 4Y28C 1O0PA 4NCBA 4IO9Q 4X4UA 4TXSA 1N5YA 1DZ5A 4QYZK 4LFCF 5DG7A 3W3SA 3NBPB 2OPRB 1AYEA 1RXOB 3A1YG 3L4BC 2B9EA 4OZ5A 4RNHA 4DLEA 4OI4A 3GG0A 4BWMA 3GZ7A 2OPQA 5KFTA 4ZPBA 1JLBA 1PIEA 1OY9A 4Q8FA 3IBWA 4URQU 3N0VA 4A8YA 2VFUA 5D4LA 1CC7A 2YNIA 4PYDA 1RCXB 1KHWA 1CJUA 4RKUC 5ETMA 3V6HA 1UJ6A 4FVMA 3OL8A 1D8ZA 2NZCA 2RUSA 3NP5A 4Y2MA 1NXIA 5LMNF 1NBEB 4N77A 2VD3A 4JYAF 1BQXA 3LW5C 4Q5VA 1M5OC 1U26A 2OSRA 1FK9A 4NYOA 4N5SA 3TQ1A 1JXEA 2ZOFA 4A8QA 2MYFA 2C22A 3P3DA 3W62A 4M95A 4DR1J 2XYHB 4GVLA 3QAEA 3OTEA 1JLEA 4UOHA 5HQLA 4MT1A 4ZJLA 3RB3A 2DD8S 1WKJA 4YDDB 1I3OB 2AJ0A 1IN0A 2XMAA 4A8WA 3HVAA 4LFAF 4M5IA 1F1BB 4LFBF 1X5SA 4S0MA 5ETPA 5A8WB 5A8KB 4O0NA 2GVDB 2CDRB 2QTWA 4DFPA 2MB0B 4FBTA 5BYQA 3FZBA 1I94F 4FDFA 4H54A 4DSIA 2Z2ZA 2MQNA 1KQKA 3CUNA 4DCOB 4ZLNA 2OLWA 3J81Y 3OJSA 4EBDA 3B6BA 1VQ5S 4NL5A 2MKHA 2XSJA 4DSJA 5A2QU 3OLAA 3VQTA 4ECXA 1GX5A 2GMHA 1VR6A 4DR6F 2QZ8A 2DR6A 3AD9C 2VKZG 3HFZB 1YBUA 4B3OA 1S59A 3NNCA 1REGX 5K20B 2R8IA 2W1BA 1WF0A 4RW4A 5LM7E 1OYEA 1PAUB 2I5JB 3ILJA 4NEZA 5MAOA 1U49A 1TKDA 3W9IA 1X5TA 3W2VA 3TOQA 3TAPA 1U2CA 2FLLA 2DPJA 1RTDA 1LV5A 2HRTA 4RW7B 3NGTA 4ZP8A 4CO0A 4RNNA 1MNEA 2KG0A 2ZH5A 2FZKB 5D4NA 5T41A 4C11B 5HROB 1YI2S 2LQ5A 3H5XA 2ZOMA 2UVVA 3CJ8A 4ZPWR 1CLFA 3TX8A 1FJ7A 2RAQA 4ALZA 3J7Z5 2CJBA 1TFWA 4OYXA 2QO3A 2NR0A 3VZHA
chains in the Genus database with same CATH topology
3IRXA 3QIDA 5T7LA 3EPIA 3HKWA 3OFHA 1FESA 1OWXA 1RT5A 2OSQA 5IT0A 1QJHA 3T5KA 3BR9A 2WHOA 1IKWA 2LYVA 1AROP 4OX8A 3I82A 3SFGA 4ZVHA 1DTTB 2QA4S 3NCRA 5EGYA 5D4PA 2R8KA 2FUG9 2ZH1A 4H4KC 4F3MA 3QGIA 3V6KA 3FMWA 5M2PA 3N5BA 1RT5B 5KT3A 4LF6F 3N4WA 3CIMA 2R7XA 1APSA 5J2MB 1K1SA 1RTJB 5H9EJ 4EGLA 1XK8A 2MDAA 1T3OA 4DG1B 3S8SA 1PO6A 1B0TA 3BQ0A 1WHWA 3MDFA 1FERA 2F8MA 4HT7A 4OIXA 3BSNA 1IKWB 2HNYB 1F5AA 2KJVA 2XMKA 2Z2MA 4ZLPA 1URRA 2FVCA 3U7JA 1FDAA 1FDDA 2BJDA 4KHPF 1R6YA 4X84A 4FXVA 2EW9A 1N36F 2VC0A 2LMIA 2J9EA 3TP2A 1G6BA 2ROPA 2IAJA 3DI6B 2R7OA 1G2EA 1VQLS 2BANB 3LWLA 1QSSA 2BUNA 3AH6A 4TQSA 1YVFA 1F9FA 4LJMA 2VA3A 4N41A 2CQCA 1REVB 4I69A 5LSLA 3GIMA 5B09A 4IQXA 1NJIT 2ROGA 1M1KT 1EP4B 4OI2A 1H0HB 3ISNC 1FRKA 3WBZA 4RNMA 1TFYA 2GQCA 3GV5B 2HWTA 3GSDA 2BE2A 1N5VA 2BBEA 3MM5A 1SUQA 2KO1A 2MJNA 1XNRF 5KFMA 1TQLA 5KG1A 2R2RA 3UFCX 3W7BA 2YKNA 3OFFA 1UVKA 4ES2A 3LAKA 3MMBB 3PX0A 1TVRB 3IAS9 4F3OA 2FIUA 3JYTA 1FCAA 1U1KA 4TYAA 1ULRA 4I2QB 1FKPB 3LWMA 3BGRB 3CO9A 2PDAA 4NRUA 3V6JA 1XR6A 2MJUA 4DG1A 5CHCB 3JTPA 3LGMA 3TUJC 2UUBF 1JLFA 2AX0A 2DGTA 4K4TA 4G1QA 1H38A 3QJLA 3TAMA 1LWFA 3PW4A 2DNOA 3QIPB 2ZHBA 2BZ2A 2IMWP 2CQ2A 5GMKa 2D41A 3V6DA 2FVRA 4I7FA 4ZMMA 4G6VB 3NRBA 1WEZA 3Q23A 3C6TA 1HD0A 5LXRA 1KRPA 4DV5F 2IBKA 1GTEA 3IRXB 1KLNA 2E7XA 5JJBA 5K8OA 1HBOB 4QYRA 2J9CA 4DV7F 2XS5A 1YJTA 1S79A 1N6QA 4NCAA 4KHRA 1FNMA 4EO6A 2E1MC 3Q2TC 2CPIA 3CCSS 3FZ2A 4EWTA 1Y9OA 1DTTA 1UP1A 5M2UA 5H9FJ 2ABYA 1RAJA 2XULA 4LT6A 2IRUA 4ZHRB 2XMMA 2R8HA 2HLUA 1FKOA 3TQ1A 1Y3JA 3K8WA 3QWUA 1HYSA 4TYBA 3CC7S 1TL5A 2J9DE 3DMJA 2ZITA 1S0VA 2UP1A 1RTHB 1HHSA 3C8YA 1URNA 1A9NB 1S4FA 5J1NA 2XEXA 1HNZF 4KB7A 1VQ6S 4YB5A 2JJ4D 2V4RA 5FDLA 2R2TA 5D78A 2VODA 3U1MA 3O2IA 4YFUA 1WHVA 1ZM2A 3V4MA 1Q53A 2JZ5A 2A2CA 1HBMA 4ZVEA 1BQMA 1Q1KA 3CCES 4B02A 4DL6A 2FVQA 3H98A 4MYTA 4PG6A 2JHEA 1S6PB 4IOAQ 1N5QA 1ZBTA 4R0JA 3OSPA 1FNOA 2LVWA 3MXHP 1ZPWX 4WYLA 4KPYA 3G6VA 3E3XA 3DDNA 5FIIA 3CDUA 3CDBA 3DGPA 5IT4A 1U7LA 3HHDA 2XS7A 4IQMA 5LJ5Y 1NJYA 2XMTA 2MZ1A 3NMRA 3MECA 3UQSA 1Z1ZA 1HQUB 4DR2F 1X4CA 4TQRA 1VQKS 3M8RA 5KFRA 5DS7A 1N56A 4ED8A 2HHWA 1XMOF 2HW3A 3NBPA 3AB2B 4C8KA 5GVQA 1RP5A 3BZQA 1U09A 2UVUA 1FJGF 1OSCA 2KZMA 2IFXA 1B64A 1XERA 5J1PA 5J2PA 4OI6A 3OL7A 2RDJA 4NLPA 3Q22A 4CT9A 1Q86T 4DWIA 2FC9A 1OQ6A 3IN5A 4NYPA 5KFCA 1AW0A 2X1AA 4OHZA 3US5A 4JI1F 5J1EB 4FNIA 4KE5A 4GO5X 4ICLB 1FHTA 3FQKA 4YB7A 2ZH4A 1XC9A 1NJXA 4URSA 1S10A 2QLXA 3N79A 4QIGA 2D1CA 3D5MA 1LWEA 1SIWB 2M3DA 5HO4A 4YR2A 2B4OA 3H2UB 1FRMA 4PXCA 1HWUA 5IT9Y 1O51A 4ID5A 2I2YA 2N4CA 3RAQA 3M30A 5A6WA 5KFPA 3L09A 5B0FA 3TUZC 3FFIA 4J9MA 1JB0C 1FE4A 2JEFA 2J6TA 5J2MA 5HLFA 2EPIA 2W4DA 1VBYA 2QMXA 2UUCF 2HHSA 1Y5LB 5A8RA 2VA2A 3IG1B 4UY8T 2EBEA 5DG9A 1S97A 3I31A 3HHLC 4NOHA 2OPQB 5HMYA 2AGPA 3CJ4A 4CO4A 1FRIA 2K1RB 1B0VA 3SI8A 2XI3A 1QTMA 5CYQA 2OPRA 3AA9A 1EP4A 2ZHAA 2YNHA 4KAIA 4O3RA 4LSLA 4OJ3A 1UWBB 5DETA 4B9SA 3O44A 3CVKA 4R25A 2MKIA 3M2RA 3H2VE 2N7CA 2I9SA 2E9TA 3ONQA 2RE1A 2KG1A 2ERRA 3AQOA 4LVOP 2A2DA 3TW0A 4DOZA 3W2WB 3PIOQ 1MU2A 1U1QA 1S9GA 1S1XA 1T02A 3M6WA 4QR0A 3HT3A 1ZAVA 3CE8A 1YHQS 4X4NA 2GMJA 1MROB 3OHAA 4DL5A 1FJEB 4ATNA 2GO8A 3THVA 3MAQA 2OH2A 2R7SA 1ZZFA 2NZ4A 1Z4UA 3BGLA 3I0RB 4OZLA 2L48A 2W8KA 2OFHX 3TRGA 3QLHB 1SKWA 4IOCQ 3G6XA 1S6QA 1X9WA 2J0WA 3VALA 1UL3A 2R7TA 3M1VA 2Q1LA 4TLQA 4PCQA 2XSJB 1VC6A 2F9JA 1IXKA 1C4AA 4H4MB 1D0EA 1YBAA 3R5CA 1QSLA 4QIVA 4ICLA 4ED3A 1NKCA 3PR5B 4YB6A 3OTDA 5M2RA 4IOBA 2KH9A 1VBXA 2POKA 3HHNB 2Y1RI 1U25A 1X7VA 2YNGB 1CC8A 2ZOGA 2UV8A 3BO2A 4NLDA 4OZ0A 2EK6A 2F8EX 3DRSB 3TR5A 1TKTA 1E6YB 3I0SB 4ZVFA 3T1HF 1TAQA 2D74B 3KLIB 4ZP7A 2QSWA 3HHKA 2MQPA 1TK5A 2MZJA 4OJHA 2F40A 4B9VA 4QCLA 1RWUA 2M8DB 5KFWA 4IR9A 4P7VA 2XO7A 1JJ4A 1CG2A 1CVJA 3CDAA 2IVMA 4JOUA 2O3DA 5B0BA 3HX9A 1Q81T 3NAHA 4K4ZA 1YIJS 3IGVA 1N4LA 5EWGA 1FF2A 3VAMA 4QPXA 3DM2B 4XK8C 4QWEA 1QAXA 1WD6A 3CSKA 1XR7A 3E51A 5F3TA 2JFKA 4LF4F 4NMLA 3UCUP 4FF1A 5E7OB 2VKRA 1RKJA 3M4XA 2D3ZA 3DCAA 1JLAA 4ELVA 3ICLA 4TN2A 4RBUA 1HBNB 1J5OA 2NSBA 2JEIA 2J0QD 5IXUA 1C1BB 4K4WA 5D6GA 4WK3A 2KHDA 1S1XB 2J0XA 1NK0A 2IMOA 2AV5A 5KFNA 1SJRA 1HNVB 2HFOA 3OPKA 2BYCA 3DM2A 3S1TA 4FPRA 4ECUA 3ISND 2QSFA 4E98A 4F4WA 3QMQA 2E1CA 2DIUA 2FJAB 3MUVP 3T5JA 4DF4A 2HLTA 3C2PA 5L9NA 2V9WA 2GA7A 3J7ZT 5IWAF 4Q2MA 3PX6A 2G0CA 1LFWA 3DLGB 2FJXA 4B9TA 2XMUA 1ROFA 3KG0A 2I8EA 2RKIA 2YTCA 3HPOA 1JJ2R 4FXDA 2XS2A 3VWSA 2DT9A 4AXIA 4KHMA 2WB1D 1RT3A 5KG6A 3D2WA 4CI0B 2WTFA 2FLOA 3ITHA 4RWXA 1KVJA 5KG7A 4U7CA 1H7WA 4ECQA 2FLNA 1D3WA 1S1UB 4M5DA 2FLPA 4OI1A 2R7RA 2YNFA 1A6LA 3PDNA 3TVZA 4QW9A 3GILA 4NPOA 1Q8LA 2NSCA 3D1QA 1XNQF 3K57A 1UJ4A 2G9OA 1QVGR 3SSSA 4WFNQ 1WACA 3I96A 1VHFA 1WEXA 4YUDA 2DNHA