1CC7A

Crystal structure of the atx1 metallochaperone protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
AEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Atx1 metallochaperone protein at 1.02 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
molecule keywords PROTEIN (METALLOCHAPERONE ATX1)
total genus 18
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 1999-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cc7A00
2OFGX 1Y3KA 5A6WA 2GV1A 2PGCA 2LQ9A 2RSQA 4DL0C 1VQYA 2GCFA 4FNHA 2XMTA 2K7JA 3IWXA 3CJKA 2EW9A 3IWLA 4YEAA 3FRYA 4OJGA 1N5QA 1CPZA 2XMKA 1X8DA 2XMVA 3GZ7A 5B0CA 2PD1A 4OIXA 3DXSX 2KKHA 4DN9A 1FE0A 1Q8LA 1VQSA 2IYGA 1S6UA 2OD6A 2QYCA 2RILA 1TR0A 2KYZA 2Q3PA 2IFXA 5B0GA 5B0FA 2K1RB 3QMQA 2N4CA 1TUVA 2AJ1A 1AW0A 3MCSA 2W4PA 3T9NA 2BJEA 5B0AA 1IUJA 2BJDA 4F67A 1AFIA 1FVQA 1QUPA 4HI2A 2LDIA 4OJ1A 4HI1A 2XMUA 2K1RA 5KAKA 1CC8A 1P8GA 5F0UA 2BBEA 1WD6A 2HFNA 1Q8BA 5K9FA 2BUNA 2CRLA 5B08A 3KNGA 2KT2A 1JK9B 1LQ9A 1YJTA 4Y2IA 1N5VA 4FNIA 1N5TA 4A48A 2OKQA 2ROGA 3KG0A 2OFHX 1SI9A 3E8OA 5B0BA 3BDEA 4YDXA 2K7KA 2AJ0A 3BGUA 5F0WA 1K0VA 3FGVA 3VTIA 2FIUA 1GXTA 4U9RA 2QLXA 3HDSA 3HX9A 3WDOA 3TRGA 2OD4A 1N5SA 2G9OA 4A47A 4EFAC 2ROPA 1SQEA 2IYIA 3BB5A 3KG1A 1AFJA 5T7LA 1JWWA 2L3MA 3HHLC 1GXUA 1Y3JA 2W4CA 3HHLA 2HLUA 3TNVA 4A46A 2XMJA 3F44A 2N7YA 5B09A 3UDCA 4OJHA 3I9ZA 1KVJA 3BN7A 1CC7A 4HH0A 4ZOSA 1S6OA 1P6TA 1Q53A 5IXUA 4Q2LA 1OQ6A 1FESA 2N4DA 4ZA1A 2HFOA 2W4DA 2HIQA 2XMWA 2GGPB 1MWYA 1MWZA 1TZ0A 1YJUA 2OAUA 2QIFA 3MZIA 4A4JA 3QGPA 1APSA 4Y2MA 2GGPA 3LO3A 1OSDA 2LXFA 3HFKA 1KQKA 1SB6A 2FB0A 2K2PA 2RMLA 2ZDPA 2VH7A 3K7RA 4OJ3A 4Q2MA 2HLTA 3CJKB 5A6PA 5T7LB 1RJJA 4NL5A 1FE4A 2XMMA 3HF5A 3KKFA 5B0DA 1ULRA 1KVIA 3BM7A 1U7LA 2FHMA 1Y0HA 1FVSA 1Y9OA 2ACYA 2LQBA 1FEEA 1Q4RA 1X0PA 2OMOA 1W2IA 3BR8A 3DCAA 3LGNA 4DPOA 2JDJA 1OPZA 1YG0A 1YJRA 2GA7A 2GFFA 2BYCA 2HQIA 1TL5A 4NPOA 3LGMA 2ROEA 3HHLB 1X7VA 1TL4A 2GO8A 2KT3A 2VV5A 4HL9A 1YJVA 3TOQA 2ASYA 2AW0A 2FTRA 1FD8A 4HH1A 1YRXA 1V3ZA 2RU9A 2ZDOA 1XBWA 4QOTA 4Y2KA 1R6YA 3BF4A 3HHLD 2AP6A 1OQ3A 2OP5A 3FMBA 1URRA 5B0EA 2QLWA
chains in the Genus database with same CATH superfamily
3OVSA 3PKMA 1IKWA 2MKCA 1BQMA 2GV1A 3Q86A 2UXCJ 2NPFA 3PG9A 1GAOA 4ZLLA 1QAXA 2GCFA 2HNYA 1EETA 4P75A 4RKUC 4CNYA 3KHRA 2K7JA 2RQKA 4RW9B 1NPRA 2F3JA 3CJKA 3TVYA 3T5JA 4DQSA 4JV2A 5KFVA 3I6PA 3G2XA 4DCJB 3NMAA 3GSDA 1HQUB 2RJZA 4JP8A 2Z2YB 3DRRB 2NXNA 4WKYA 1ZAWA 3NWGA 2HHHF 3PR5B 4AL7A 3TUPA 2MTLA 2JSXA 4K5SA 1RT5A 4M5GA 2DGSA 4N8OA 5DJBA 2PEHA 4C9DA 3CD7A 3R97A 1GQEA 2R7OA 3H8YA 5DDPC 1SVDA 2KG0A 3IR6B 4IDKB 5ETLA 1WOOA 4ZP7A 2MLXA 2XYHB 1HPZA 3HKZD 3ILOA 2MKHA 3WBZA 3Q23A 1S1XA 1SJ3P 1D9FA 2DR5A 2BEFA 5B0AA 3R3TA 1MLAA 2XI3A 5C2CA 2E5GA 3QT7A 3VF0B 1TTHB 4WFYA 3W5YA 2R7XA 2EBEA 3B4DA 2G2YA 1FJ7A 1WD6A 3DRPA 5BYQA 2GIFA 1HBMA 3N5BA 2CJYB 2QE5A 3EUNA 4M5DA 4EUVA 1TKTA 3C3LA 2F8EX 2ATCB 2IIHA 2Y1LB 3R5BA 2UZAA 1IKWB 2MEWA 2MYFA 4IH6A 1OY6A 1LEOA 1CJKA 5EGYA 3EWGA 2V0NA 3GG1A 5LMUJ 2FGOA 1TUWA 3G6ES 3H2UB 5CZXA 1X4BA 3BN4A 1F9FA 2W9CA 1YX2A 1XMQF 4WTYA 2EC2A 3LP0B 1U2CA 4MKAA 5EX0A 2RQMA 2HGMA 1N5SA 4HR2A 3UD3P 3DU6A 1JXLA 1SQEA 2IYIA 4FYDA 4RWWA 2CAJA 1ZAXA 4G65A 4TLQA 4K4UA 1X4DA 2F7VA 1GX6A 4NYPA 1OMSA 3GV7B 3F73A 1S1TA 2R9LA 2EKYA 3UW1A 3FUYA 1T05B 5EWGA 1BC6A 2DGXA 4P74A 4CLZA 2H3EB 1RISA 5J1EB 3HK2A 2HFZA 4JI2J 1S6OA 2VUGA 5CYJA 3B4MA 3I5CA 2CADA 3T19A 3KG4A 1EARA 2N4DA 3DGPA 5LSOA 3LP2A 2VPXB 4O3OA 3OJUA 2HS4A 2Z58B 2AGOA 1EHWA 2QL7B 3R9LA 3KHGA 2QIFA 2RQ4A 2DBBA 3LANA 2ZOFA 5AT1B 1V5VA 4AXIA 5KG7A 1Z2ZA 4KV8A 1RLDA 4QWCA 2Q43A 4OZNA 3SBMA 2VQEF 4DL2A 3IS9B 4OZ0A 4ZJLA 1MNEA 2ZH3A 4ED6A 1NHVA 2B9YA 1WEZA 3I32A 3KLEB 1PO6A 2LP4A 3BZQA 3WZ0A 3DLHA 5L9XA 1NK4A 2F4VJ 4H4KA 5ETSA 3UNGC 3KKFA 2B9WA 2K3KA 4DR3J 3RRHA 3BBFA 1S1WB 1GEHA 2B6AA 2WZ1A 5KFKA 2KHCA 5JVGQ 3Q8UA 3RR7A 5HK4A 3LAKA 1RCXB 1T03B 1FD2A 1YG0A 4OX8A 4CT8A 5AJ3F 4OZ3A 1N52B 3C14B 4NASA 3UN3A 2DNQA 3KK2A 4A8MP 1FJEB 3PFEA 2HAIA 4C11B 2W2QP 1U2FA 3HSJA 2VFRA 4ZDNA 2CPDA 5KFMA 2VFSA 3AXKA 2XNQA 1PBUA 5CD4A 4LFCJ 4ECUA 3TVZA 2DIUA 2VV5A 2F9JA 3DDIA 2NSBA 1BQXA 3SFUA 2ZJRQ 3R2CJ 2COLA 5LOQA 2GQCA 4CZCA 3TUJC 2QA4G 3HHLD 2ZD1A 1A7GE 2BE2B 2BMBA 1RA7A 4KO0B 4XAKA 4F25A 4K4TA 1URRA 1XMOF 5IZHA 3BSCA 1RT1B 4IO9Q 5D0HA 2F5GA 2H9ZA 4LSLB 2DNNA 2XYPB 3H42A 3IXQA 5F41A 1KNZA 3TZYA 1CS4A 3NAIA 2W9BA 3CT9A 4EMDA 3CIZA 1FTCA 3CUNA 4NE9C 3GZ7A 4AT1B 4ZLJA 1PKUA 3SCKE 1S1WA 4YR0A 4EYHB 4CO4A 1NAQA 3BGRA 3JSMA 3GR1A 1RU1A 5F9LA 1NDPA 1RTDA 4H4MA 2J5AA 4MH8A 1V9OA 4NMLA 4OYAA 3U27A 1T03A 1NK6A 4I7FA 2UU9F 2V2QA 3ISZA 4O4GA 2C2NA 1RT6A 2DNMA 4QR1A 5KOXA 4KKOA 3HP6A 4R5PB 1U1NA 1R0BG 2A2DA 5CAAA 4RUCA 1RCOB 3D6MB 3HPOA 2IRXA 3CCZA 4DV1J 4N77A 3GV5B 2V69A 2CPYA 1ZS6A 3R7SB 1JXEA 3TA2A 2E9RX 2Y1IA 2VBZA 1BHNA 2K1RA 2R7TA 1NPPA 2QTWA 3IM8A 4ES3A 2EXUA 1UAWA 4C8LA 1VJQA 4D3GA 3T5HA 5F8HA 2NXJA 2OMLA 1D9DA 3FKBA 3FVYA 5B08A 1LQ9A 1S1UA 3ISNC 3HJVA 4JYAF 5IQ6A 4CTAA 3OLBA 1VS3A 1NDLA 1RAHB 2BE7D 5KOWA 4AQYF 5B0BA 4C8OA 1LWFA 3DLGA 4MAKA 5K14A 4ILMA 3VCDA 4CI0B 4DPWA 3PV8A 2ZBPA 1WF1A 4TXSA 4I2QA 3DI6B 2V4JB 2Y0BB 1FKOB 4UT4A 3F0NA 2Q66A 2F8HA 2FJBB 4I4BA 4PG5A 5IS2A 4OYWA 2QV6A 1F3FA 3ZTQA 4F50A 2VC0A 1S6QA 1QAJA 2J9DA 1NU4A 2OEKA 3AD8C 3DOMB 4CO3A 3CMAS 2HRUA 3M05A 2LDYA 5I42B 3MUMP 1S7HA 5HI7A 2ZZNA 4A8FA 2ACMA 1WC4A 1BQNB 3TNVA 4A46A 3KUEA 3F44A 3G8TA 3N6NA 5HANA 5HLFB 3QT8A 3RGIA 2HNYB 2ZC4A 1SJRA 3KFWX 3MFIA 1PGZA 1WI8A 1P6TA 1Q53A 1SUQB 3H5YA 3KLGA 3C6TA 3NGRA 2EKNA 4DPYA 4DUYJ 1NK7A 2YWKA 3P5TL 1NJYA 2I38A 3V4IB 3UO0A 2CQ4A 4LF6F 2VG6A 4WFNQ 5LSLA 5J2QB 1ZPVA 2FB0A 3HHEA 3GSIA 1PCAA 2OO4A 3VAFA 2XSJB 4USWA 4U8YA 3POTB 2CQDA 1MW7A 3RB6A 2CJAA 4LMZA 4OX9J 3PYGA 2BDPA 3ZZZA 3LPYA 2A10A 4WK3A 4ZPAA 2XMAA 5F0WA 3VTIA 2QX0A 4NLOA 2VG7B 1HI1A 2OPSB 2ZC3A 3MEDA 4I2PA 3KMSA 4NLGA 3ENQA 5ETQA 2H4YB 2BYCA 2EG2A 2JVRA 1KSPA 3W3SA 1EKSA 1JKHA 2CPFA 1R27B 3C66A 2CPJA 2CZVC 1HW8A 1X7VA 2KRBA 2WONA 1ZYQA 4ZVQB 2DR8A 4C2MA 1C4CA 2RH3A 5CCLA 2IBKA 2HHSA 5DGBA 5A2QY 3OSPA 1V3ZA 4YOEA 1VOMA 1V3RA 3MWBA 2KZZA 2B7CB 4QOTA 1K0TA 4UQGA 4I67A 1Q95G 3H0PA 4RNMA 1UEKA 3D5MA 3MDFA 3T1YF 1JLAA 2R42A 3OBIA 1UA1A 4RR5A 2OFGX 3EPGA 1RBAA 4BBYA 2W01A 3DLGB 2ADCA 1N54B 2E9TA 4O0IA 2LA4A 1E6YB 4A8YA 1WC5A 3CCTA 4UQTA 2CVEA 4PXCA 2YX7A 3N9UC 1VQPS 4UZCA 4IDKA 1N33J 1RBOB 3M1VA 2UXBF 2VONA 4ECXA 3PX6A 2B8QA 4OIXA 3DXSX 3H59A 3LF0A 3OR1A 2RF2B 4LBIA 4P6QA 5BXIA 4LF7J 1YLXA 5I3QA 2DNKA 1X5PA 4KE5A 4TYBA 1RACB 2AEFA 1HW9A 1NPKA 2KJVA 3BGLA 3LQVA 4USUA 3UN5A 4J91A 3PZPA 2K1RB 4MFBA 4LF7F 2Z0GA 3JXOA 2J7WA 4DU8A 3DOMA 3FSXA 3OXFA 2IRUA 2J8SA 2O3DA 3K8VA 1KBRA 2N3OA 2CG8A 3QATA 3K59A 4ZCLA 3ZTRA 2VICA 5I3UA 1QUVA 4CQ1A 4RUHA 3M8QA 3MCOA 2XGQA 2Z57B 3G8QA 1Q8BA 2VPYB 3ILIA 2YPZA 5GAEU 1YJNS 1VI7A 4AYBD 5HMZA 5J2MB 4ZCIA 4NX9A 3Q22A 5D4LA 2BM0A 3CCRS 3OTEA 2OFHX 1NEEA 2IAJA 2W2PP 1S6PA 3C6UB 3LUYA 5HQ8A 1KVKA 3GFXA 2K7KA 2FHJD 1U6FA 3AXMA 4C3LA 2BA9A 3KLEA 2HS3A 3M2RA 2G9OA 4A47A 1K8AT 3BB5A 4IKAA 5J2NA 1XN9A 3MAAA 1OPIA 4XTTA 1NKEA 2BE2A 3T41A 4J9NA 3ULHA 3EVMA 3CCSS 2W4CA 1ACMB 3HHLA 1QM9A 2X1AA 2X51A 3Q89A 4JI8F 1N36J 2FJVA 4KV8B 1RT4B 1X9SA 4DR5J 2F40A 3SI8A 4GKJJ 2YNHA 3H2VE 4FYWB 3W60A 3CC7S 2HQ3A 5HROA 2BJ3A 4ZA1A 2XS7A 1F5CA 1OWXA 2PFFB 4F0KA 5L38A 2D41A 1FX2A 4WF9Q 4A4JA 1FXDA 1BLUA 3HULA 1RWUA 5DDQC 3JSMB 4DL7A 2HWTA 5JMNA 3MM9A 2LKZA 2OPRA 2CZ9A 4E0DA 1RHKB 3QRPA 1YBAA 3ETOA 2HHWA 2HURA 3IP0A 4HHJA 4ZP8A 2HLTA 2KVQE 5CYMA 1U45A 4LF9J 3KLFB 3PNIA 4KGXB 4CO1A 4WZQA 3CDBA 3VAKA 1RJJA 3MR7A 2X7IA 2GO9A 1HI0P 1G3OA 1S48A 3DM2A 2F4VF 5C24B 4Y2KA 3DCAA 2QRRA 2MJUA 3TVKA 5JJBA 4X4PA 4UZBA 2A18A 3CCVS 2J8AA 4WYLA 2A1BA 2PDAA 3MHYA 4NLDA 2PN6A 4X65F 4NPOA 3LGMA 1RXOB 1V6HA 1WEXA 2ROEA 1IKXA 1X5SA 2OSRA 3HHLB 5KFYA 4OYIA 4WBFA 4B08A 3Q2SC 3KK2B 5KT2A 1HYSA 2AJQA 1IXKA 4HL9A 2DGTA 2FGCA 3HO1A 2ZOGA 3GG0A 2B9EA 5CYQA 3QJJA 1KHVA 2GVDA 2NQPA 4USHA 4AQYJ 1DARA 3SCIE 4QPXA 1S5ZA 1W7WA 4FF1A 1XEZA 4NLQA 3I55S 1W2BR 4WTOB 1M5OC 1H6KX 1HBNB 4LUBA 1VYAA 4A8XA 1FKAF 1S77D 2WBRA 1N6QA 1IKYA 3OTDA 4PUOB 4MYTA 5KG3A 4FS2A 5EWFA 2Z8QA 2L9NA 1D8YA 3K89A 2X1GA 1S59A 3M8PB 1K44A 5IC6B 4B3OB 3CVKA 4OZ1A 4LFBJ 3CCUS 1IR0A 4IFVA 4KHRA 4MFBB 2F8MA 4OI0A 4L72B 5CD4H 4E8UA 4OZ2A 4PXDA 4F04B 1FT8A 2L9DA 1D9AA 2AHOB 2KT5A 3FDSA 4PXEA 4O3PA 4DR7J 4YN3B 3THPA 4NCBA 3QMQA 2H54B 2CNKB 2N4CA 4M1KA 3W63A 3MUVP 2H1YA 2JRSA 3GFYA 3IC1A 4RL1A 4Z37A 5IM0A 1E6VA 3TW0A 4F67A 1RWWB 3C2PA 3M6VA 4DCOB 5BYSA 5AJ3J 2WK4A 4DZ6A 1QSLA 5E2QA 4ETXA 3PR4A 1M5PC 2JEJA 3MM6B 3QWPA 3MUTP 2N7CA 1JQGA 1XTZA 2VF3A 4CLTA 2BW7A 1NK9A 5K9FA 4PCQA 1OJ4A 2DRDA 1RYRA 1TVRA 2CRLA 2L48A 2MMYA 4C8MA 4JV0A 2E1PA 2KT2A 5DRKA 1VQ6S 3VZIA 4QZVB 1I94J 3PJ9A 2RKIB 1NH8A 3PHTA 1S1UB 1UP1A 3MM7B 3M2UB 2J76E 2NCKL 4WFAQ 1HLWA 1SI9A 4YS2A 1SKRA 2Y0SD 4U6PA 2WHOA 4MT1A 3DRPB 4WP9A 5MLCV 4YFUA 1B7FA 4O0NA 1KQGB 4IFYA 4RW9A 3DYAB 4U9RA 5C24A 4JI3J 3VAGA 1C1CA 5GAEI 4DV4J 3G6VA 1TKTB 3AD9C 4F4WA 2G13A 1OIAA 3KG1A 4JI5J 1RTHA 2E1MC 5H9FK 1X4EA 2A6OA 2JEIA 4C7QA 1UVJA 1X9MA 2NYHA 2NSCA 1HL6A 1S7IA 2AJFE 3I0RB 4NRUA 4OQJA 3Q83A 2DH7A 1L5UA 1RGVA 4QIWD 4Q8EA 5KFEA 4O44A 3F41A 2PO4A 3T1YJ 9RUBA 1YWXA 1RTIB 1M1GA 2OEJA 1AYEA 1KOOA 3EJMA 1VHIA 5ETNA 4IR1A 1OSCA 3H2LA 1R43A 2D69A 3DRXA 4MIBA 3W8PA 5C5JA 3CD0A 2B4OA 4OLOA 2WOMA 3MEEA 2HHQA 2DB1A 4BDPA 1VC0A 4AL6A 2R7UA 2XHWA 1RTZA 3LO3A 4K5RA 2BABA 2A2CA 2IVYA 4ANDA 1VQ7S 4X2BA 3CB4A 1OY8A 2YX4A 1VQOS 3KLGB 2K8GA 1JJ4A 4ILRA 3JTNA 1TL3A 5G4DA 4URSA 2FJEB 3QLHA 3N0VA 5ITHA 2DVIA 3GE9A 3SCLE 1KVIA 2ADBA 1Z1ZA 4PEOA 5AXKA 1WSVA 2HBZB 3R1HA 2QO3A 3LP1B 3DHXA 1HFEL 4ZVOB 1HNVA 1Q5YA 1RSCA 3W9IA 1BD6A 2HHPA 3H20A 1DBDA 1B99A 3FBBA 4ZPBA 1ZA1B 4C97A 3PX4A 1TL1A 1ZM4A 3F56A 4L73A 1LWCA 2LQ8A 1F0XA 3OPKA 4NLUA 4QIFA 1PJ6A 1RAAB 4ED7A 4IO1A 1RTDB 2GHWA 3A1YG 4J5OA 4ANEA 4DFPA 1MROB 2ZVIA 4DF4A 2I9SA 3TA1A 1S0VA 3SSRA 4QIEA 1UVLA 3AJ2A 1M5KC 3MM5B 1GMVA 4DL5A 4NLYA 1H2TZ 6FDRA 2FVQA 2D9OA 1TV6A 3N28A 3FCWA 5A8RB 3AODA 1R0AB 3GWCA 3ZZUA 1OQ3A 4RU2A 3UFCX 2A0FB 3ILLA 2HK2A 1FRXA 1RHJB 3W2WA 1Y3KA 3K0JA 3IS9A 1P1TA 3NBPA 4DCPB 2RB7A 4DS4A 2ZZTA 3Q8PB 2V8GA 1EX8A 1FKPA 2HNZB 2MKSA 4OJGA 5IOLA 3RBEA 1N4LA 1VQ9S 4O4GB 2E9ZA 2ZOMA 2DO0A 4DPXA 3HCXA 4C11A 3TX0A 3KLHB 1Q8LA 5F8JA 2UXDJ 2WVEA 1KDNA 3I4HX 3JYTB 4B3SF 2IFXA 1B7YB 3NY0A 3MM5A 4OX9F 1GH8A 4ZN1A 1TUVA 4PG4A 3BJYA 2KI2A 1S9EB 2U2FA 3I31A 2ZUAA 4ZVHA 4F4XA 2XULA 1UA0A 4OI6A 3AB4B 2CQIA 1GMWD 1AFIA 2MLZA 2ZWOA 4TY8A 4ZVSB 2VZ9A 1SH2A 4KGKA 1PC4A 2HS0A 2YNHB 1LW2B 1D3WA 2AX0A 4X4VA 3PYEA 1IKVA 3N4WA 4GC6A 1QVFR 2WVFA 2OKQA 2H48B 2BANB 4DL4A 2RRAA 5DG7A 3GR0A 2Z2LA 3ICLA 1NLKL 1MN7A 3DLKB 4P2SA 2IAJB 5GVQA 5KG1A 1HR0J 3KLVA 4DV0F 1GXTA 4HKQA 1NHKL 3WHIA 2GHPA 1N34J 5AXMA 2IBOA 1B70B 2XWYA 3CW2C 4DX5A 3D0GE 2YKPA 2YX1A 4RW8A 3UDVA 1R3NA 1TK8A 1S9EA 4QQBA 1KKHA 2Q6BA 1S6PB 1ZPWX 2U1AA 1T05A 2AZ3A 3A8JA 2XS2A 4XDDA 3MPUB 1RWOB 2MKJA 1FWLA 5J1PA 3O44A 3FFIA 4NCAA 3FJ2A 4R0EA 1RQ0A 3TZZA 2Y1JA 4KHMA 2AIRB 1PSDA 2BRLA 1YZ6A 2ZITA 1VQLS 2KVIA 2BXJA 3UPFA 4M63A 1O6XA 2QLBB 4Z7YA 4LF2A 2HMIA 1IR1A 1IBKJ 3UDLA 2M9KA 5A0YB 4ZHRA 4QIVA 3AJDA 5DETA 2R7RA 2OTLS 4GVBA 4DLEA 3BREA 3QO9A 5CCMA 4DDFA 2OHDA 2O66A 3QZ7A 4N56A 2VHGA 3NAHA 2IM0A 3AT1B 4W4MA 4XIUA 1KLMA 2LXFA 2NUHA 3Q8SB 3V6HA 2RMLA 3RZAA 4K4WA 2EFQA 1AT1B 1FRIA 4DWIA 2JLGA 2CQPA 1JNZB 4X64F 4YHHF 3CWJA 3TQEA 5DQIA 1MG7A 1W25A 3ET6B 3RU0A 1H98A 2OPQB 3HF5A 4L76A 3OL7A 2CQ2A 2ZH4A 1YI2S 4JI1F 4K0KJ 1V5IB 3MTJA 1S1TB 2VC1A 2ZVSA 3L09A 3VZHA 1VBZA 1Q4RA 1X0PA 2CJKA 1W2IA 3A12A 2HZVA 4PQAA 1CLFA 2RDJA 4RW6A 4DV2J 3D0HE 1GMWA 5C2GA 1U8SA 4GO7X 4F0MA 1DQAA 5BR8F 2UUAJ 3NNAA 4N47A 2HHXA 1LWEB 4YB1P 3AY0A 2KT3A 4MYUA 3WQPA 1PIEA 1DURA 4Z2XA 3C16B 1WC3A 4YY3J 2GX8A 3CTRA 4X65J 2VQFJ 4J9RA 3CJTA 4ZLNA 4WJBA 1F1BB 3A8EA 2LMIA 1KLMB 1Q82T 2ZDOA 4LR7A 4RZRA 4F2RA 2BJ9A 3QRQA 2V9KA 2ZBCA 1CJVA 3ILJA 4USTA 4WYWA 4PAAA 5DO2A 5DQHA 1RLCL 3AOAA 1N36F 2I5JB 1ZA2B 2DNRA 3FQKA 4AD6A 4CLKA 4LRBA 5F8IA 3C8YA 3H25A 2ZHAA 2AGQA 4ELTA 2ZBQA 2PGCA 1HIYA 5G0RA 3MR5A 1F3VA 4IQMA 1RTJB 1VQYA 2FLOA 4HTIA 5EWEA 3SSSA 2V50A 1L3KA 3L7PA 1DZ5A 2DNOA 2HYIB 3MEDB 1HMVA 1CPZA 4C8NA 4J90A 3IO1A 2XYGB 3M2UA 2BZ2A 1KONA 5FLXU 4J9PA 1SKWA 5GMDA 2UU9J 1UZDA 2DCUB 2E7VA 4G6VB 4AXJA 2OD6A 4ZS6A 3D7SB 1JLBB 2HZAA 2KYZA 2Q3PA 3NS5A 5KG0A 4RNFA 2KM8B 1AUDA 3KTQA 2FZKB 3MM8A 2M88A 1SJ1A 3EGVA 5U47A 3GCXP 4NLVA 4LF6J 2DNZA 2GAHC 2BJDA 8RUCA 4FS1A 2NZCA 3IGNA 4ID5B 5A2QU 2KG1A 3RRGA 4USKA 3JS9A 2LDIA 1TKDA 2GMHA 1RWNB 3A8KA 1HWUA 2HRYA 2RRNA 3QO9B 3PO5A 3ONQA 4RLEA 2HFSA 2JHEA 3A8IA 2V4RA 3V6DA 3BBCA 3PX0A 1FRMA 1RAIB 3GFZA 4RWXA 3IAS9 1VQNS 3KK1A 3O2IA 1VGYA 3W9JA 1P27B 1TK5A 2KJWA 4IR9A 3CJRA 4GVBB 1EQMA 3GIMA 4EZ6A 3MFHA 3HHKA 4ZJOA 1CJUA 1CULA 3OTOF 2IDLA 3R8YA 3OVAA 1S0NA 1HHTP 1S9GB 2FHOB 2RRBA 1K0VA 3BDPA 2JJ4D 3KWMA 3ZTPA 4A8SA 2HWIA 2QLXA 2RDDA 1EIYB 1TU0B 3RYLA 4N76A 3QGIA 1B64A 4ZMMA 2JZ5A 1U6ZA 2XCPA 3CMES 1DTQA 1JLCB 2C3PA 5L9NA 3BGRB 5EHHA 4F02A 3CCQS 3R27A 3MPVA 4QWDA 4UF4A 3QT5A 4LFBF 1Y5NB 3HD2A 2QLFB 3R6LB 5KG4A 1FRLA 1XERA 4I6AA 5B09A 3EX7B 4L75A 1T7PA 1RWVB 2MZQA 2AWZA 1CC7A 1QJHA 3OFEA 4HH0A 2NPIA 1T02A 4RBTA 1PYTA 2YNFB 1MMLA 2SXLA 4F3QA 3MMAB 4ZVPB 5IXUA 3KDOA 1OQ6A 1HYSB 4QU6A 5E41A 5L46A 2E5HA 1VQ5S 2PC6A 1BXNA 1MWZA 4H4MB 1S1VA 1XR5A 3DRSB 3D9BA 4YB6A 4Q0BB 3ZZPA 2VA2A 3M8ZA 2DJWA 2WRMA 4CYUB 5HP1B 1PILA 2K2PA 2GJIA 4C0BA 2CKWA 4Q44A 2NREA 3CD6S 3OV7A 2EEYA 2ZH8A 4OHWA 2FLNA 1DTQB 1JLCA 3VWSA 1EP4A 2XMMA 4B3MJ 1C0UA 3M9MB 3BM7A 3LWLA 3SEOA 4A8OA 3BPDA 1YTYA 3BPSP 4I2QB 1Y0HA 2VKZG 4NI2A 4I56A 1I94F 1FNMA 4DFMA 5JXSA 2XGPA 3LGNA 4ZCMA 1RABB 1OPZA 1NJWA 2GFFA 2HNDB 4K2JA 3SFGA 1JLQB 1IQTA 1U0HA 2KYXA 1LXNA 2OPPB 4ZVTB 2YNFA 3G4SS 3V81B 3TAMB 3I56S 3BQ1A 1SL2A 2CFXA 4CLFA 1NSKL 4U67Q 1QDUB 4HVZA 3C46A 4KH1B 2XO7A 4OHVA 1HNVB 1NCLA 2DT9A 4ZCKA 2MZ1A 3R5CA 4L6V3 4K4XA 2DEJA 5DLFA 1C0TA 5H9FJ 3CO9A 3MMAA 3NBPB 3HMJG 4K59A 5DGAA 1VISA 4JI1J 1E6YA 4ID5A 4C8ZA 2BVZA 1RHUB 2LU2A 3V4MA 1S76D 1RK8A 5CYMB 2ASDA 4ALZA 1KEKA 1XNQJ 3LGHA 4ZJQA 5B0EA 3DU5A 1S9GA 1DLOB 1N48A 4ITSA 1NJIT 2DR7A 2MJNA 4DFKA 1XC9A 5ETOA 4ECYA 1H3DA 2G1HA 1HQ2A 4UUXA 3R5AA 2G0JA 1X8DA 2PMZD 5KFFA 4DR1F 1PAUB 3RAQA 1YBUA 5KFZA 2UUBF 1QD1A 2ALYB 1KOHA 2QLJB 1VQSA 4ICLA 3IN5A 3KUHA 3R7BB 1YK9A 3RUBL 2AYBA 2RILA 1QAYA 1NK0A 2GAGC 4O3RA 3J7ZT 3CC2S 2R8KA 4GO5X 2ATLA 3K5PA 1J5OA 1RP5A 1T9UA 2APOA 4DF8A 3H5XA 3ZTSA 2OEMA 4PUOA 3RW6A 3HZEA 3HHNB 2VJVA 4CDIA 3SV4A 4XPEA 2RKIA 1BUXA 1H72C 3DHWC 1FRJA 1RE1B 5HAOA 2G0CA 4DUTA 1S4EA 4ETZA 2FJXA 3CXCR 4OZJA 4W92B 4OYPA 3BSAA 1TKXA 1R6VA 5D0GA 5GAHU 3QSIA 3FEZA 1GX5A 3H5SA 3RBZA 1PG5B 1VIOA 3ENAA 5LT5A 1Y11A 3J81j 3DMJA 5K8NA 4ED1A 4KHPF 1HNWF 4DSIA 2AF6A 2M2BA 3CJSA 4IG0A 2KFZA 3EDQB 1SJ4P 4L74A 1CJKB 2V94A 4GC7A 1F2GA 1FO1A 2FIUA 4CLUA 3ADAC 2O67A 1X4FA 8ATCB 4BS2A 3NNCA 4ILLA 1HNWJ 4O44B 2OD4A 2B0GA 2M52A 5KFXA 4LF5F 2XS5A 3H4BA 3FBFA 2G2ZA 2C3MA 2RUGA 3JAMY 2UV8G 2DK2A 3WC2A 2PI4A 4ZHRB 1RZMA 2DHGA 3CO0P 1GXUA 3IRXB 4IFYB 2EK6A 4LSNB 4PR6A 1N34F 4Q7AA 4GKJF 2XMJA 2DGWA 4MK8A 4WU2A 1U8WA 3GILA 2K06A 1KVJA 3BN7A 3HHDA 4HT5A 5IQQA 3W64A 2UUTA 3AQPA 1JLFB 3GMGA 3UWTA 4IRKA 1TKXB 3AOBA 4CLLA 1TVRB 4ED4A 1S12A 2FJAB 4EBCA 2D1CA 2NZ4A 3FC9A 4U8VA 1VQKS 3MM6A 4Q45A 2PI5A 2CIMA 1K47A 3WX8A 4UTGA 5GADU 3G8SA 4TY9A 1OYDA 2DCLA 3SQGB 4CP5A 3JB9k 4PG6A 5E3AA 3HFKA 5C25A 5GAGI 2ZDPA 1CEZA 1D09B 1M5VC 1DJ0A 5E3QA 1KQSR 3TUZC 2VASA 1WHWA 4NRTA 2W7AA 2MLYA 4WXOA 3W5ZA 1IBMJ 5T7LB 3K57A 3MPWA 3IG1A 2DKOB 2ZBIA 1SV5B 4F8RA 3CCLS 4MKYA 1I6JA 1MU2B 4U7UD 5G0RB 1T11A 2GQQA 2OPQA 3DYAA 1KLNA 5DDOC 1WTFA 1FEEA 4DPOA 5HMYA 1TKZA 4FDFA 5HBMA 1C2PA 3I4PA 5IWAF 2H5EA 1UKUA 2N82B 5B7WA 2W2MP 2C2ZB 3OR2A 4MKBA 3KJFB 4PQUB 2R8HA 2CDQA 2Q79A 1UPPA 1UVKA 3PM9A 1U48A 4CLWA 4C8KA 1UVIA 2DR6A 4P72A 3M2VB 1T9WA 4ECWA 1L3UA 2XY7A 4ZVEA 1RB0A 5K20B 3NL0A 1T3NA 4RJVA 3NGSA 2HHTA 3G87A 4J9KA 4FYXB 8AT1B 3MM9B 3LALA 1X0FA 1XBWA 2V4JA 4P7TA 1KFSA 4JI7F 1RKIA 1MMDA 1WC6A 3PO4A 5IT9U 1NNDA 2PMWA 3OFHA 3KLFA 2OP5A 4USJC 1N5YA 2LQ5A 2C2KB 4CTAB 1U1QA 1IQZA 4KO0A 4JI5F 1ZM2A 4PXBA 2E5LJ 3HSGA 4CH0S 2CJQA 3DDNA 4NLWA 1GMUA 2DXFA 3BO4A 2EW9A 5DG9A 3MD1A 3IWLA 3NLCA 2MZJA 4YEAA 3ZO7A 1X5TA 1J5OB 1T9XA 3AA8A 3L7UA 3HSZA 2HPUA 2W25A 1NSPA 2HSEB 4ZVFA 3S01A 2IYGA 2ZM6F 4FPIA 4X64J 1TR0A 2M5YA 1BGXT 1BQNA 1AZSA 2G1DA 5HATA 4DSLA 3TAPA 1REGX 2D9PA 3VVTA 3PIOQ 4I7FB 4QIGA 1RT7B 4M95A 1RT6B 1ZZFA 2AV5A 1X4GA 3IR5B 5HBMB 3DLEB 3D3BJ 1SJQA 4MK7A 4P2XA 3BGOP 3CJ0A 5KFRA 4A8WA 4HI1A 4LJMA 3JSRA 2UVWA 4DV2F 3C15A 4DL6A 4DLGA 1LW0A 1H7XA 2H65B 1NDKA 3AOCA 5BR8J 3LA0A 4OZ5A 2BUNA 3ITHA 4DXLA 3HT0A 2AYGA 4B3MF 1SCJB 3P96A 1YJTA 1FRKA 2YY3A 5CA5A 4O3QA 2B4PA 4F4KA 1Z4UA 5KFHA 4B9TA 4DSFA 2ILZA 1RWPB 1U49A 2ZZMA 2QN6B 2XG8A 4WKRA 4CIOA 3QIPB 3W8GA 2AJ4A 1LXJA 1NB7A 1LNQA 2UVVA 1FKPB 2HNZA 3HX9A 3OTOJ 1H74A 1HWLA 4FP9A 2XNRA 1ZBTA 3T5KA 3IG1B 1JWWA 4L3KA 2YWEA 1S9FA 4TQRA 1L3SA 1Q0NA 1WKLA 5J2PB 3TQ1A 4B3TF 1M0SA 2E29A 1CG2A 1WSRA 2EK1A 2B9XA 4BLGA 2IRYA 1FWKA 4CO2A 3JYTA 2IVFB 2CYYA 5HVFA 4DQRA 1RTIA 3QFWA 3EVWA 3C14A 1XNQF 1JLQA 2KXFA 3CD5A 2XY6A 4TVAB 4G1QA 2DEIA 2EFOA 3NWRA 1FESA 5E3RA 1WJ9A 5IT0A 5D4NA 3VGSA 2J9CA 2BOAA 2RS8A 1FNXH 5FLXY 1NKBA 2R7SA 3QZ8A 3CF5Q 1SBRA 1ZH5A 2V6AA 5K5MA 4Y00A 4F0HA 3PW2A 1HWIA 3SSQA 3K5MA 1JIHA 2O5DA 2YKMB 2FUG9 2FDNA 1JJ2R 3WX4A 4KT0C 2B8PA 4OI3A 3PJXA 5C7PA 3BQ2A 4RX6A 1RTHB 2R7QA 1UPMB 2BE9B 4DUZF 2NS1B 2DGUA 2WSCC 2VBWA 3EGWB 1CQMA 2DXDA 3IFEA 4QYZJ 4P7VA 2WVDA 2VD3A 1C1CB 5GADI 1ZZNA 2ACYA 4UY85 3BR8A 1PYSB 3KXDA 1URNA 2MPUA 2AMCB 3E3XA 3B8HA 4MIAA 1XNRJ 2W7PA 3GYNA 3KHLA 2J0QD 2YWGA 1TL5A 3B54A 4PWUA 1HD0A 4M5MA 2H4WB 4OYZA 5DZ6A 4HEA9 2J6SA 2M7SA 4K4VA 4TKTA 2AEJA 1VLYA 3C6UA 5J1NA 1FD8A 4YR2A 4AL5A 2HVHA 2KXNB 3G6XA 1D8ZA 1ZETA 3BSOA 4HYKA 4R8UA 4Q5VA 1DAXA 4F4ZA 4OV1A 4JI6F 3TAQA 3U1NA 2YQ0A 3JSBA 3I5BA 5LXYA 4ZITA 2KRRA 2V8HA 3QT6A 2M70A 3UCUP 4C0OC 3GONA 4JI6J 4WCEQ 2J6UA 3KOAA 1Y4ZB 2F9DA 2VOOA 2JX2A 2C3OA 4YUDA 3KK1B 3IWXA 2AQ4A 1HWKA 3CCMS 1LK5A 2PFDA 4K50A 4XO0A 2HBQB 2XMVA 3IBFB 2CVIA 3MM8B 3NGUA 3ZTOA 1ITPA 3WC0A 3D6FB 4DN9A 4QW8A 2VG7A 1WF2A 4TN2A 4USIA 2JEGA 1J2VA 2QG9B 4K2XA 4NA1A 3OR1B 2J0XA 2IMOA 4TYAA 1O0PA 2WVBA 1RAFB 2ILYA 4Y65A 2UUBJ 4RW6B 2QEXS 5HMWA 5LJ5Y 3HVWA 2IY5B 2MSSA 4FKYA 2XY5A 1H38A 1FCAA 2VQEJ 3BH7B 3BKTA 5K8PA 4RW4B 3HFZB 1FFWB 3EGNA 3D54A 7FD1A 1QUPA 1S1XB 3SMZA 3UCZP 1SXLA 4OJ1A 4H4OA 2X1FA 1UCNA 4NCGA 4YHHJ 1CC8A 4BC7A 2HHVA 1SUQA 4F2SA 4K8RA 3GIRA 4W90B 4RU9A 3NEKA 1PJ7A 2IC3A 3M30A 2E7XA 1CJVB 2GMLA 3C6TB 4TLRA 2IM2A 3VAIA 3ZZOA 2HGNA 2LU1A 5HO4A 3CEDA 4Y2CA 3KYLA 1T8EA 4PQUA 2OTJS 1HD1A 3VAMA 3BGFA 1VRTB 4IUFA 4HDGA 2GHVC 1JMTA 2AJ0A 4YDXA 3BS9A 1AUSL 2RQCA 2LQJA 3RBXA 4ECVA 2YBVA 2DRBA 3FFIB 1A0OB 2DHHA 1UL3A 3PIPQ 1TL7B 3OL9A 1AFJA 1Y00A 1UWAA 5D4OA 2UXCF 4BHQA 1TP7A 2GNKA 2NYIA 4FF2A 5KFTA 2DH8A 2FY1A 4IG0B 3BKUA 3TARA 4IRDA 2VFTA 3FBEA 1Y3JA 5HVHA 1HBNA 3D6TB 2VIHA 3EDRB 4LR8A 1CVJA 4DR1J 1C1BB 1KP6A 4JOUA 5KFOA 1RWXB 3Q8VA 3I9ZA 2ZH6A 3V4IA 2DISA 1KRPA 1Z2LA 3K5OA 3PFOA 4LRFA 3MOZA 4QR0A 2YQ1A 5CYQB 3R5GA 5I3PA 4BC9A 4LQ9A 3TEGA 3T1HJ 1FTRA 4IRCA 3JTPA 2G4BA 4XDCA 3J80Y 3FSIA 4Y28C 4PG8A 1YJUA 2IVMA 3KJQB 2ZH7A 2BANA 1APSA 4LVNP 1GTHA 2CUYA 2LVWA 2GGPA 1RAEB 2KDOA 4H4KC 4WWSA 2BQRA 2UUCF 2V8VA 3LW5C 4KSEB 3TO8A 1SB6A 4U95A 4DI6A 3PW4A 4LSZB 3FSYA 3M32A 2XCAA 3R1LA 1TFWA 3LH2S 3M8PA 2RIJA 1PYOB 4CM0A 5AXNA 4B3OA 1FE4A 1VIXA 4J9MA 1ULRA 1DLOA 3TAMA 4O4RA 4C3MA 4KJIA 2UP1A 1WEYA 2LQBA 4DPTA 2MSTA 2D3ZA 3UVJA 1Q1KA 1RWKB 3H7HB 2DNHA 1LW0B 4M5KA 4RW8B 2GA7A 2VBXA 2WBMA 4RO0A 2HQIA 2XLJA 4PWDA 4B9UA 4YY3F 4LFAJ 1XMQJ 5KFGA 1DTTB 2XI2A 4DX6A 2BV3A 3H5UA 4L3NA 3DLKA 5F9NA 2KO1A 2GO8A 1QSSA 1S4FA 2LLZA 1YJVA 5JVHQ 2PEBA 2HBRB 3QGGA 1GXLA 5ETRA 1RUSA 2QGFB 4GRSA 4IOCQ 3BH6B 3R6GB 4NZ7A 1S0MA 3V81A 4M5LA 2ZD1B 3M9NB 4ZN3A 4X4QA 5DM6Q 1GK8A 1D1UA 1BMQB 1GNKA 1RWMB 2C1EB 2RE1A 2BOPA 1VHFA 4OYXA 1JLEB 3FMBA 4RW7B 4HHHA 1U1PA 2XMUA 3OT9A 3Q8YA 4FN5A 3UD4P 3W5XA 2LQ9A 1C0UB 2KU7A 2VDIA 1ZM9A 2HQGA 4ICLB 1IR2A 4FNHA 2XMTA 5KFSA 5F8LA 2NR0A 2B43A 1EAYC 1QE1A 4ECRA 3LP2B 2XMKA 4WP8A 4B3RF 4XK8C 4PWDB 1H2UX 4OL8A 4P10A 1OS5A 3CJ5A 3UN2A 5F3ZA 1YHQS 3O1LA 2XZDB 2ALZA 3QBCA 1HNXF 2V2VA 1QVGR 3Q8RB 1IBMF 4B9NA 2XWXA 1SC1B 4UUWA 1YIJS 1FI4A 4EGLA 3D3CJ 2DY9A 2YVSA 1VQMS 3QQCD 3QYYA 3KJVA 3M8QB 1BWVA 2BACA 3OXGA 3OJSA 2PA3A 3EE3A 3T9NA 4ATNA 3MR2A 1RBLA 4DG1A 5IWAJ 1U47A 3KNAA 1RT3A 2HVDA 4J7CA 1L3VA 1SC6A 4KH0B 2J9EA 3J80U 4NLSA 3MEEB 2HFUA 4KPCA 2WB4A 4OX6A 3KLIA 2C28A 3HM9A 1IVZA 2CQ3A 2FHJA 2FD2A 2XZTB 3BR9A 2J6TA 1U1MA 1YITS 4LFCF 2B7BB 3KNGA 2VODA 1T3OA 3I87A 3WIUA 2DTJA 3CIMA 1W26A 4FNIA 1AROP 1KD1T 2DNGA 3KG0A 4ZPTR 4S0MA 2HW3A 2BKNA 3SYZA 4LIWA 1AA1B 4M5JA 2FZGB 2YWHA 3FGVA 3SXLA 2DXEA 1R8CA 2YWWA 3BYRA 4GVLA 2V9WA 3HDSA 4KB7A 3WDOA 4EFAC 3T6BA 3O5TB 4B9SA 3IWNC 1ICEB 2QL9B 1HNZF 1SQGA 4EI2A 5D0EA 2YKQA 4R25A 3DRRA 1HPZB 4NWBA 4OI2A 3DLJA 4IG3A 2F4FA 4DJBA 3J81U 2PA8D 3SZ2A 1Y7PA 4JBCA 3DRSA 1VC5A 3OR2B 1JB0C 1NO8A 2HBYB 2P9EA 2W2NP 2WW8A 3P8BB 3ZZTA 3MAQA 2FQQB 3V6DB 3AD7C 3FRZA 3MCMA 5KT5A 3M4XA 5HSPA 3M2VA 4LSNA 2GS8A 4P52A 1KQFB 3BO3A 5I42A 2CG4A 1WDTA 2MZRA 4ERDA 1S57A 1HQEB 1TZ0A 5L1IA 1N33F 2MHNA 4NLTA 3GQCA 1KTVA 3KUGA 4Y2MA 2WOMB 1U02A 4CO5A 2R2UA 1HBMB 2MZTA 4ZKAA 3AA9A 5JUMA 4DV1F 1BQMB 1NZ8A 3P4UB 5E0OA 5DZ7A 3Q2TC 1YRUA 4DV3F 3QRRA 3MR3A 1NK8A 4IYQA 3VGUA 4Y2AA 3MEGB 4F3MA 3MR6A 3PEJA 3G82B 2PIIA 5THWA 2FHMA 4BCAA 2JH3A 1FVSA 2C2OB 3B78A 3D4JA 3R5DA 4HHUA 2DPIA 4KTQA 2HHUA 1LFPA 2ZJQQ 5CXTA 1YJRA 5GAHI 1KS2A 3ELHA 4B17A 1FWPA 4C6AA 2BR0A 1DQ9A 4USMA 1WELA 2KM8C 1WI6A 4OZLA 3G86A 4ZVRB 4X4SA 4WE1B 1YJ7A 1H73A 1R0CB 2HVEA 1P1LA 1VRTA 2GW8A 2OPSA 2FTRA 3AB2B 4J9VA 1YRXA 4LR9A 2ZWPA 2EFVA 2D3O1 2BQUA 3M8RA 5IV3A 3N79A 4M5HA 2E44A 4B3TJ 4J9OA 3RJMB 1WHYA 2E5JA 2CNOB 3VQSA 1O8BA 4X84A 3K2YA 3HVTB 2CJBA 2GZOA 2GJFA 4UOGA 3IAM9 4P71A 4USVA 4ZIWA 3D67A 3IR7B 5CH7B 3UI3A 1IWAA 5ETKA 2XHCA 4TQSA 1FXRA 1PJ5A 3O8WA 2KH9A 3J7Z5 1JNRB 1VR6A 2E1AA 5D77A 3M6XA 2CPXA 3FRYA 3KJNB 1MSWD 3T9ZA 3IM9A 5LSRA 4DU7A 4ELUA 4C0HA 2RHSB 3IMQJ 5B0CA 1R8PA 3ZZRA 3FEYB 4HACA 3SV3A 1RT5B 2DNYA 2Z2ZA 1SJFA 3PRDA 3D0IE 3JQKA 3T1HF 3R7NB 2XLIA 3V6JA 1JX4A 1RT3B 2B51A 2HZCA 2FC8A 3SDEA 1U0HB 2OPPA 2DPJA 4QU7A 1RDRA 1UEVA 2L9WA 2F65A 3G9CA 2X3DA 4DS5A 5KT7A 2DHAA 4QWEA 1CSJA 4LF1A 2HG4A 2CDRB 3D1QA 4EBEA 4I6WA 5M2UA 2VU5A 1XNRF 4I68A 1DFDA 2HKEA 2UV8A 1GFWB 4LBHA 3KHHA 3GJTB 3CSKA 1WHXA 2HFNA 5K8OA 3QGHA 1S97A 4RBVA 2P5VA 5F8MA 1FA0A 3TA0A 4N7TA 2MQMA 1CS4B 3Q24A 1RT2A 1NH7A 2V4QA 1SKUB 3D6HB 3EYZA 4DV5F 4ED5A 2M3DA 1WUUA 3E8OA 3K8WA 1SPBP 2MQ8A 3MF5A 5KFCA 4E2FB 3DNCA 1F60B 1Q7LB 2FY8A 4DR6F 3LP1A 3MXHP 2IHR1 2B6AB 4FF4A 1S10A 2ROPA 3HT3A 1VJWA 2AGPA 2B5JA 2IM3A 2OGUA 3M2RB 2L3MA 2V8DA 1O51A 5L8RC 4R5PA 1RT7A 3TYTA 4EBDA 3L95X 3MAAB 4JB8B 5DG8A 3QJLA 4RW7A 4BWJA 3SDEB 3PKYA 4KRWA 3L3CA 5GMKa 2RUSA 1I51B 4KGVB 1EB0A 2R7WA 1HBOA 3PVXA 3H4DA 4X66F 5HJXA 1KR4A 2RNEA 1QAIA 3KK3B 4OFZA 3W9HA 3A3OB 3CNQP 1XIQA 2NXCA 1LFWA 1QE1B 3OLAA 2R7VA 3MTKA 1RT2B 2GQ2A 4WXWA 3S1TA 2UVRA 4ZPCA 4CO0A 4KR0B 3MPYA 4X4OA 3VGTA 1NKCA 2JEFA 1T9TA 3UVJB 3OXLA 2CPHA 2VPZB 2OPRB 3S6EA 2OUGA 5HVGA 2IPOB 3L7OA 2FC9A 5SUHA 2ZKTA 4DR7F 2GMJA 3I96A 4UOCA 1X60A 3RAXA 3RB0A 5A76A 1U0SA 3EXYA 3UCGA 4W98A 2DGOA 4DSKA 4MMOA 3K58A 3H40A 2V67A 2GVZB 2JDJA 2K3IA 2B5JB 4DN0A 3N5FA 1R89A 4V19J 4C4WA 1UW4A 3V2UC 2MQPA 3HJFA 3DGPB 4WP3A 5HQLA 4ZP6A 2KFYA 4I2PB 3JTOA 2FVCA 3ZNJ1 5J1EA 5DDRC 4FXDA 3PHEA 3HFVA 2DO4A 3PW0A 3THVA 5IT9Y 4FKXA 5C25B 5D3GA 1UJ5A 1FDAA 4DR4F 4WU3A 3BF4A 4ZIVA 3EGZA 2E5LF 3MOJB 1N32F 2LECA 2YKAA 3K5NA 4KYZA 2XSJA 3AQOA 4DR5F 2YPYA 2E7WA 2RVJA 2QLWA 3NS7B 1IBKF 1XR7A 2I5JA 1S72S 2ZJPQ 2QL5B 4NXMF 3QJPA 1U1KA 4LQ3A 4EEYA 1WTBA 1KC8T 3L9ZA 3LWMA 1RTJA 1YVFA 3B6BA 3DDKA 2P8IA 4NZ6A 4ZLPA 4JI4F 5D0RA 4V1Ak 1WF0A 2V34A 5E3CA 3ZNUA 1KFDA 1VDHA 2EVZA 1CJUB 2UUWA 3MI7X 5BYRA 3OD2A 2AEMA 3ZZYA 2UUCJ 4OV6A 2ZH9A 2KKHA 4B9VA 2QMWA 3P49B 4IOAQ 3X1LB 2QYCA 3PYFA 5L1JA 4J9SA 5EN1A 3NGKA 4NCGB 2J0WA 3M1VB 2CA9A 4Q8FA 2CJ9A 3MCSA 1FXLA 1LWEA 1SV5A 2LEBA 1IUJA 3HVRA 1X4HA 2C3YA 1ZTTA 4ZVGA 1C1BA 2NXEA 1K1SA 4DX7A 2QC3A 4LFAF 4M94A 4J9LA 5A8KB 2BBEA 2ZEJA 2GIRA 1M1KT 5A8WB 1I5OB 3R5JB 1TELA 4YP3A 1IKXB 4K4SA 5CZVA 4DR2J 1YSJA 2W1BA 3QAEA 4OLPA 5MAOA 3ET6A 2DHXA 3T1AA 4Q43A 1HWJA 4N5SA 2RAQA 5F3TA 1O5JA 4RBUA 3KLIB 4IG3B 5KFLA 3MURP 3GIIA 4DR2F 4YQWA 5GAGU 2CZ4A 2KXHA 1NSQA 3QFHA 4IH7A 1IJFB 4ID8A 2ABYA 2CNNB 3THTA 4B02A 4QYZK 2IM1A 3OUYA 4IQXA 4ES1A 4UW2A 5AE3A 4N41A 2F63A 3NOGA 4FXVA 3VV2B 1G4CA 3U1MA 2RD5C 1J5EJ 3PW7A 2JLFA 2F1FA 2RHQB 3BBBA 2XC9A 3CULA 4D3HA 2G0IA 4GKKF 3CDWA 1X4AA 1BY9A 4OMFG 4AUKA 3VAHA 2DD8S 2BM1A 2W24A 5T41A 3W7BA 5C42A 4GKKJ 1U25A 2DY1A 4KC5A 1N88A 1R8HA 2HFOA 3OTCA 4OI4A 2ZH1A 5L1LA 1MWYA 4UOFA 3MEGA 1U4BA 1HBUB 2GJ2A 3N6LA 3QGPA 4DEZA 3W66A 1B3TA 2R3VA 4LRAA 2EWHA 1XWLA 4PPDA 4TU9A 4DUZJ 4JI0F 4DPUA 2QSWA 3TZWA 3PXGa 3RB3A 2MKIA 1RI7A 3IGVA 2QFJA 1XMBA 2UXDF 3TWZA 4ZK7M 3CJKB 1M5HA 3A3NB 4B3SJ 4NL5A 1D0EA 2FZCB 7AT1B 2C2DA 1RAOA 4NOHA 4WK1A 2FYXA 2EI5A 1X4CA 3JAMU 2OMOA 1UMJA 1YJ9S 2MQOA 3V5RA 2POKA 4FF3A 1RHRB 2DIVA 1UTAA 2Z2MA 4R8UB 5D3GB 1F9HA 2YH0A 1TAUA 1SC3B 3U7JA 4G3IA 4NEYA 3PRVA 5FDLB 2JNJA 1FDNA 3S7RA 4CLSA 2QZ8A 4RUBA 3U02A 3GIKA 4EZ9A 4UY8T 1UFLA 4TU8A 1HNZJ 2J7KA 4HH1A 2X3GA 3HD1A 4Z7CA 5K8MA 2CPIA 2MXYA 2R8IA 5I3UB 1PAEX 2RU9A 4G1QB 2C3UA 3OHBA 1NM2A 1C0TB 3M8YA 2C2EA 2BW2A 4LF8F 2AP6A 3RAMA 3PEHA 4DV0J 1Q8KA 5EUHA 3M9OB 1U1OA 1LV5A 3OSNA 1SIWB 3AHPA 1JLGA 3O3LA 4M8LA 5CQGA 4X62J 4MTPA 5H9EJ 4CYUA 4GMKA 2L08A 1WWHA 3EICA 1YRTA 5DS7A 3QSYB 1MN9A 3ISND 4WFZA 1VCTA 5A8RA 3NP5A 4YB7A 2WCXA 4DHVA 3GJRB 2W8LA 2BJ8A 2MKKA 1T9VA 3FMWA 4A8KA 3BSNA 4WFBQ 1N56A 5SZTA 2HMIB 4U96A 2P6TA 2HK3A 5FIIA 3VALA 4DV3J 4OHYA 4DG1B 1DTTA 3DN9A 3CDUA 5EDWA 1U26A 1FFSB 3TJ8A 2CXEA 2YWFA 4FBTA 2LA6A 5B0GA 1HHSA 3NCRA 1FHTA 1SIZA 2AJ1A 2KL8A 3CDAA 2ASLA 2Y9HA 4TY8B 3MMCA 3I82A 3KLHA 1RHQB 3OTBA 4QBUA 1FJCA 2WSFC 2JL9A 3EM1A 2XQCA 1Q8IA 1S1VB 2R4FA 4I0WA 3NNHA 2MZSA 2NUUG 2JFDA 2EC0A 4DQQA 7FDRA 1UFKA 4DV6J 4ED0A 2M8DB 1TKZB 3OVBA 3IA0A 1M1HA 2QMUB 4CH7A 1DRZA 1FJGF 5D8HB 2I0XA 4F4YA 4WPAA 1N5VA 1UVNA 3TI0A 2CWXA 3DFEA 4A48A 4DV6F 3P45B 2ZNYA 3PW5A 2DYAA 1VBYA 1P9YA 1NBEB 1T0TV 1GT8A 2BX6A 3DM2B 3MGJA 4ZOSA 1K9MT 1NSAA 2I8EA 4PABA 4Y6IA 4Y3CA 4ZPDA 1Q5VA 4TU7A 1R0AA 2IMWP 2M0GB 2Z30B 5T7LA 1Y5LB 2BKOA 2PT0A 2RF2A 4KQZA 2HWHA 2WAQD 4G1IA 3ZXWA 1RHMB 5ETMA 5C42B 4DR4J 1N5YB 1S49A 3H98A 3T3FA 3T5LA 1U24A 2EFNA 2NLWA 3CMQA 3CE8A 4P9SA 3UDCA 3LP0A 4OJHA 3ZZ0A 3CPWR 2R2TA 4Y34A 1KHWA 4X4UA 1PC5A 2HHHJ 3TJAA 2HEKA 1NUEA 1VBXA 1OYEA 1UJ6A 4DSJA 2J0SD 3I0SB 4LREA 2LCWA 4K7QA 1DQ8A 2EPIA 2OH2A 5RUBA 2N3LA 2HIQA 4NYZA 2GGPB 4RNOA 2OAUA 1S99A 1YZ7A 3MM7A 4LF9F 4I1TA 2UVUA 2IC3B 3M30B 4DQIA 2A6MA 2EFPA 2YTCA 3M32B 3D2WA 4N8NA 4X4NA 1LOUA 2VH7A 1K1QA 3D66A 4M5NA 2VA3A 5KFIA 1SC4B 1CQNA 1NXIA 1UETA 3D68A 2BJ1A 3NOCA 4I69A 4I64A 3ZFVA 3M6UA 5A6PA 1IBLJ 3VHQA 3EXCX 4UOHA 5B0DA 4LIRA 4F3OA 1U7LA 3VQTA 3RBDA 1U6BA 1VRUB 2QT7A 2AZ1A 4CWBA 1IM6A 1IBLF 1FK9A 2EFGA 3G71S 2ZNZA 3K17A 2JOQA 5DLGA 2VG5A 4IOBA 2XO6A 1WACA 1CJTB 1NB2A 3DXBA 4MKVA 2MQNA 4ED8A 1HR0F 5KFJA 4EU0A 2J9DE 5F8NA 3L4BC 3O6QA 1E6VB 4P2MA 2QJ3A 4CNZA 2O01C 3QAUA 3QIDA 2H5JB 3TP2A 3HSDA 4NYOA 3NS6A 4OYBA 2CQBA 1WHVA 1OY9A 1TL7A 3E51A 3JSYA 4U7CA 3EZ5A 1WKKA 1IJEB 1F9EB 1VBKA 3MECB 4M5DB 3AFGA 2WSEC 2Y8YA 5KFDA 3OUYB 2HAFA 2VL1A 2YNIB 2RDIA 4X66J 4DX8H 4JI2F 9ATCB 2P9CA 3C16A 5A6WA 4CRJA 5HJYA 4JI7J 2KZMA 2V2KA 4B3RJ 1TAQA 2W2OP 2KB2A 3GCWP 3FZBA 5A8WA 2KFNA 1S79A 1J5EF 3MMJA 2E1CA 1N5QA 1ZOTA 3CJ3A 1L3TA 2HVZA 2PD1A 5M2PA 1HMVB 2BRKA 2P2CB 5K14B 3A3PB 1S6QB 4CH1A 3FEXB 2FLLA 4JI4J 3J7AN 1B4SA 5HQMA 4P73A 1S6UA 2MDAA 5H1SV 2W9AA 4DFJA 1SL0A 5ETPA 1WNEA 2FPHX 1FKOA 3OL6A 2QA1A 3A4TA 4FXWA 4LF4J 2JC0A 1WORA 1IM4A 5A8KA 5HN0A 1ROFA 5IM0B 4DR3F 4ECZA 5H9EK 1KWMA 1U1RA 4K0KF 2ZM6J 2W4PA 4TNOA 1AW0A 5J2PA 2ZUGA 4FPRA 2YH1A 3PCOB 2AD9A 2D74B 2KN4A 4PZVA 1HARA 2HRTA 3W1YC 2JWNA 5IV4A 4WIQA 4JV1A 3D1HA 3MAHA 5CHCB 1P8GA 2W8KA 4I6YA 3GB0A 4ZVUB 4K4ZA 4X4TA 1YGYA 2WVCA 3EPIA 4KKOB 3CC4S 2XLKA 1MMNA 3I0SA 4C3KA 4C98A 2CQCA 3BQ0A 5D15A 4AFFA 2QMXA 1NHUA 4FVMA 4LT6A 1Y5IB 4Y2IA 2VQFF 2R2RA 5KT3A 2DHSA 2OLWA 3NCQA 5D6GA 2ZE2B 4NXNJ 1FERA 5D78A 1VC6A 2Q6CA 2CQ0A 2JLEA 4KFBB 4EWTA 1SKSA 3BGUA 3FNNA 3PDNA 1VRUA 4P2FA 5LMNJ 1MWQA 4CLYA 3LAMA 2DR9A 3TRGA 4CM2A 3DI6A 4LRDA 1HBOB 3J81Y 2VG5B 3UNYA 1R8BA 3KMQA 5KG2A 1LWFB 4ZPWR 1NDCA 4K4YA 1RU2A 2HLUA 1TMJA 1AZSB 2CPEA 2MY8A 3E01B 3TR5A 1NJXA 1SQFA 4LF8J 3GLJA 3MMBA 2PMHA 3SCJE 3TJ9A 2C42A 2M4MA 2H5IB 2O1PA 2V2ZA 2VKRA 3CJ2A 6FD1A 3US5A 4CCHA 1BWEA 3CJQA 1WDDA 3PTWA 3SIPB 5KT4A 2XMWA 4PWWA 1IKVB 3MZIA 4BWMA 2MGZA 5D4PA 1C4AA 5AXLA 4FZVA 4RNNA 5E5NA 5HLFA 3ITHB 5KG6A 4RNHA 1LW2A 1IKYB 1V3SA 2GC8A 1T9YA 1FX4A 2AKWB 2D3UA 4IH5A 4U7UK 3CGIA 3P5BP 4EK2A 4NZ0A 1CBKA 5IT4A 4DSEA 1IWGA 2MQLA 2Y1RI 4EO8A 3D1OA 4DV7F 1VQ4S 1TMMA 1DHMA 2FVSA 3BKFA 5M2RA 2DNPA 2WW4A 1FDBA 1VMBA 1F2HA 4RPFA 4ED2A 1Q86T 4JI0J 1RT1A 1XMOJ 2R2SA 4DBQA 4J37A 1EP4B 2KTQA 2VBYA 1Y9OA 2FHKA 3NRBA 1LKZA 2WTFA 2DH9A 1VK3A 1RKJA 2KHDA 1KTQA 1UWBB 2LXUA 3QPIA 4QPTA 4QR2A 3I9V9 2BKPA 4WFXA 4PKDB 2FJDB 4X4RA 3TANA 3KK3A 4XPCA 1NJZA 4H54A 5KT6A 2VDHA 5F8GA 4F26A 2ZHOA 1TL4A 3TOQA 5LJ3Y 1M90T 1S0OA 2HVIA 3FBCA 2I2YA 4JUZA 1JXVA 3DGVA 1XR6A 4YR3A 4DV5J 1UW9A 3VVUA 5LMUF 4G1PA 2ZHBA 1R6YA 4PRFA 4LVOP 1Q79A 3MMCB 4RW4A 2MHEA 1HHQA 3FCVA 4DR6J 1TL3B 1R31A 3ENWA 1SL1A 3RB4A 3NMRA 2CWKA 4LF5J 1XQIA 2DRAA 2RSQA 4OI1A 4DL0C 4ES2A 4DUYF 1H7WA 3SQOP 4R0JA 3RR8A 3M7VA 1YDLA 3EMTA 3KDNA 3TEHB 1HQUA 6AT1B 2CJXB 4KIAA 2MB0B 2ZE2A 2HQFA 1H2VZ 4QYRA 3BYPA 1EJ7L 2PE8A 4KFBA 3UE2A 4A8QA 3DOKB 3IBCB 4OYOA 4LSLA 5KFQA 4EYIB 2BQ3A 4FBUA 5AE2A 1WC0A 3NCPA 3Q8QB 1UVMA 3E01A 4ED3A 2I1RA 1UFWA 2Z4PA 3GYGA 5B0FA 4QWBA 2I6WA 2RU3A 3E2EA 3RTVA 4PYAA 3IBWA 3M8WA 1VK8A 2OELA 2YKNB 1HA1A 2AJ2A 2OJ3A 4WE1A 2BJEA 3VR1A 1FF2A 5HMXA 1FVQA 3G82A 4WIIA 1JLBA 2VFVA 3ETMA 3OQ2A 4HI2A 2FVPA 4LF4F 4O3SA 1WC1A 2E66A 3AAWB 3W2WB 2YNGA 4O23A 3U1LA 2H51B 4YMEA 4ELVA 2Y3YA 2Y8WA 4E98A 4YB5A 5HL7Q 2EBGA 1G6BA 5E33A 1REVB 3DMJB 4MJKA 2L41A 2IJFA 3MPDA 4LBPA 1N5TA 3MEKA 5J2MA 3PACA 2ROGA 2HQCA 2LYVA 3POTA 3HKWA 4ZP9A 2VJUA 4JV5J 2V8PA 2VOPA 4RUAA 1FJGJ 3VAJA 1RAGB 4KPYA 1U09A 1U2RA 3CJ4A 4OHXA 2CQ1A 2GIQA 3AJ1A 3HVTA 5FD1A 3RG6A 3MECA 3IRXA 3GV8B 4NEZA 2YKNA 2ERRA 3NXZA 1JJHA 4J9UE 4NLRA 1B0TA 2YNIA 3HXMA 2IA6A 4B9MA 4QJVA 1N8RT 5KTQA 1N32J 1HBUA 3PJWA 3MD3A 5LM7E 2DNLA 1JKHB 2V5HG 3CCWA 1ZTWA 3P6YC 1F5BA 1OO0B 3DRYA 4NXMJ 3DKDA 2VB6A 1G1XA 3D28A 1XK8A 3H90A 4IFVB 4NMXA 1P9QC 2V63A 5BJRA 3SQGA 1UZHA 2YNGB 1AB8A 4KY3A 2ZH5A 1M5SA 3DOLA 3ENVA 4FYYB 5T14A 2XB2D 4B9LA 3NG8A 1N6QB 1REVA 2LFVA 2B4VA 1WOPA 3GTYX 2FLPA 4HDHA 3P3DA 5KFPA 5FJ4A 2P6SA 4O3NA 1EQ0A 1QSYA 1WKJA 2OI2A 2VG6B 1LK7A 4PYDA 3J7YU 2J7UA 3PY8A 3LOUA 3S8SA 2IA0A 2M8HA 2Q1LA 2HQDA 4OX7A 2DITA 4ECTA 1IN0A 3N01A 2E1RA 2NXUA 3OHAA 5L1KA 2AT1B 2UUAF 1WG1A 3CCES 5EX3A 3V6KA 5LL6d 1R7IA 4ANCA 4M5IA 1BE4A 3DOKA 2FVRA 1NK5A 2BJ7A 3CJ8A 1CJTA 2MY7A 5KFWA 2IJNA 3HI9A 2ZKUA 3K5LA 2ASYA 2D3OR 1SH0A 1TQLA 2EG1A 2XZWA 3HLUA 4FVCA 4H4OB 1QY7A 2IDEA 1Q81T 3X3UA 5ETVA 1I1GA 3MCNA 1VQ8S 3LTOA 4V19X 4YDDB 2GVDB 5E7OB 3TZXA 4DOZA 2RS2A 2P9GA 1G2EA 4JI8J 3BEGB 3HZGA 2R8JA 1UJ4A 2B56A 2ZFHA 2QFIA 1H0HB 1NRKA 2C2MB 4HTJA 1F5AA 1JLEA 4NA3A 3EZOA 4KGMA 3OL8A 5KFBA 2QSFA 4LRCA 3BO2A 3FQLA 1X5OA 2DGQA 1RA6A 2OSQA 1RYSA 5GMEA 4KHPJ 2GVZA 2XTJP 4NA2A 4MK9A 1T95A 1TFYA 3JQJA 5A0YA 4F4AA 4DZDA 2UXBJ 1NMEB 1F6TA 1JLGB 1SH3A 3PRBA 5ETTA 2X1BA 3B82A 3WIVA 1JJCB 3UR3C 4NI2B 1FE0A 1EETB 2B4UA 2C22A 3GP9A 5ADZA 1QTNB 2XEXA 5DM7Q 2QA2A 2YKMA 1Q16B 2LXIA 1HNXJ 1YBTA 4QW9A 1QTMA 2WB1D 2MKYA 2E5IA 4PG7A 5I4MA 1FRHA 4HT7A 3GPAA 3ZC4A 1VFJA 3M8SA 5KFNA 3IRWP 3W65A 1XJWB 2JC1A 1IBCB 3FZ2A 3QNWB 3Q0AA 3DLEA 4ENOA 2ZH2A 5KAKA 1FNOA 5F0UA 1HNIB 3W2VA 3FCHA 5KFAA 3RRKA 3C15B 5HROB 1FFGB 2DGVA 2YKOA 4CT9A 4Y0FA 1JK9B 5KFUA 5HP1A 2OIHA 2W9BB 3UD5A 1HI8A 4J9QA 4ER8A 2AX1A 1WG4A 2C2RA 3W62A 3N6MA 4KAIA 3J7A1 1VLOA 3QIPA 3W61A 1VRQC 3TX8A 2JFKA 1LWXA 3BDEA 2HIYA 1QLNA 1PBAA 1EZZB 1A6LA 1AXQA 4ECQA 1TUGB 2XSFA 3GFHA 4HLBA 2Z56B 3MMBB 2AYEA 3TUIC 2CPZA 1UEUA 3EZUA 1Q78A 1NZAA 3JQMA 2CQHA 4NLXA 4F36A 1TV6B 2HNDA 1EKRA 2W7OA 3CCJS 4DL3A 1ELOA 2ZBRA 4HACB 5LMNF 1U1LA 3DLLQ 3HHLC 2MQQA 4JI3F 2XM3A 1Y10A 1FDDA 1FEHA 3GJSB 2JVOA 1N0VC 1ZAVA 5IC4B 3R2DJ 3QWUA 1B0VA 2N7YA 2FJWA 3C19A 3DOLB 1UWBA 3G6YA 4WZMA 2QYGA 4C48A 5LXRA 2CQGA 2B3TB 1HNIA 3W2VB 3I5AA 4CLPA 4X62F 2CNLB 1J27A 1KN6A 1RAJA 4Q2LA 4ZPVR 3M6WA 3EVOA 4OHZA 3I0RA 1YJWS 3UDEA 1HKAA 3G96A 3CDEA 4KGZB 1MROA 2W4DA 2D7SA 3T6JA 3UQSA 4Q0BA 3BV8A 1CULB 2HFVA 1RT4A 3A13A 3NGTA 4DMZA 1WG5A 4KBIA 3LPEA 3FK4A 1OSDA 2LEPA 3PYDA 4URQU 5KG5A 3OFGA 1KQKA 3K7RA 5CABA 2RT3A 4Q2MA 4OJ3A 1R8AA 5L39A 2W9CB 1TK0A 4DQPA 5DQGA 2VFUA 5IFMA 3NGDA 4C8YA 1I3OB 2VPWB 3AH6A 5J2NB 3KJVB 3HVAA 2MGZB 1A9NB 3GYXB 3QLHB 1WOSA 4QCLA 4FYVB 1YKWA 2AU0A 1RADB 4DV7J 3GIJA 3NKYA 3VGVA 1X9WA 4JYAJ 2ASJA 4URGA 3OW2R 1YQHA 3RW7A 4NXNF 4OYMA 1N0UA 5FDLA 2WONB 5AE1A 4PPZA 1MU2A 3DC2A 1Q7YT 4AE5A 2YXLA 1TL1B 2A3JA 2IJRA 3UR0A 4MIWA 4DV4F 3DLBA 3J7YI 1K73T 1JLAB 2G2OA 1FK9B 2AW0A 2XBPA 1G7CB 2PSZA 4NLPA 5E3PA 2R8GA 1T94A 3GU0A 1X31C 4QWAA 1JLFA 1B0PA 5J2QA 4JV5F 1GTEA 1LWCB 4EO6A 2AYMA 2QA4S 2YQ3A 1DY3A 4F7VA 4ECSA 1HQEA 1ZM3A 3GJQB 3OFFA 2V68A 2HGLA 2LEAA
chains in the Genus database with same CATH topology
3OVSA 3PKMA 1IKWA 2MKCA 1BQMA 2GV1A 2NPFA 1GAOA 1QAXA 2GCFA 2HNYA 1EETA 4CNYA 4RKUC 3KHRA 2K7JA 2RQKA 4RW9B 3TVYA 2F3JA 3CJKA 3T5JA 4JV2A 4DQSA 5KFVA 3I6PA 3NMAA 3GSDA 1HQUB 2RJZA 4WKYA 3DRRB 1ZAWA 3NWGA 2HHHF 3PR5B 4AL7A 4K5SA 2JSXA 1RT5A 4N8OA 2DGSA 5DJBA 2PEHA 4C9DA 3CD7A 5DDPC 1GQEA 2R7OA 3H8YA 2KG0A 3IR6B 4IDKB 4F4WA 4ZP7A 3WBZA 1HPZA 3HKZD 1D9FA 2MKHA 3Q23A 1S1XA 1SJ3P 2DR5A 5B0AA 3R3TA 2XI3A 2E5GA 3VF0B 4WFYA 2R7XA 2EBEA 3B4DA 1FJ7A 1WD6A 3DRPA 5BYQA 1HBMA 3N5BA 2QE5A 3EUNA 4M5DA 4EUVA 1TKTA 3C3LA 2F8EX 3R5BA 2UZAA 1IKWB 2MYFA 4IH6A 5EGYA 2V0NA 3GG1A 2FGOA 3G6ES 3H2UB 5CZXA 1X4BA 3BN4A 1F9FA 2W9CA 1XMQF 4WTYA 3LP0B 4MKAA 5EX0A 2RQMA 2HGMA 1N5SA 3UD3P 1JXLA 3DU6A 1SQEA 2IYIA 4FYDA 4RWWA 1ZAXA 4TLQA 4K4UA 1X4DA 2F7VA 1GX6A 4NYPA 3F73A 3GV7B 1S1TA 2R9LA 2EKYA 3UW1A 1T05B 1BC6A 5EWGA 2DGXA 1RISA 5J1EB 3HK2A 2HFZA 1S6OA 2VUGA 5CYJA 3B4MA 3I5CA 3T19A 3KG4A 2N4DA 3DGPA 5LSOA 2BOPA 3LP2A 2VPXB 4O3OA 3OJUA 2HS4A 2AGOA 3KHGA 2QIFA 2RQ4A 2DBBA 3LANA 2ZOFA 4AXIA 5KG7A 3KJVA 3PZPA 1Z2ZA 4KV8A 4QWCA 2VQEF 2Q43A 4OZNA 4DL2A 3IS9B 4OZ0A 2ZH3A 1MNEA 4ED6A 1NHVA 2B9YA 1WEZA 3I32A 3KLEB 1PO6A 3BZQA 3WZ0A 3DLHA 5L9XA 1NK4A 4H4KA 3UNGC 3KKFA 2B9WA 2K3KA 3RRHA 1S1WB 5KFKA 2B6AA 5JVGQ 2KHCA 3RR7A 3LAKA 1T03B 1FD2A 1YG0A 4OX8A 4CT8A 5AJ3F 4A8MP 1N52B 3KK2A 2DNQA 1FJEB 3PFEA 2HAIA 4C11B 5KFMA 1U2FA 4ZDNA 2VFRA 2CPDA 2VFSA 2XNQA 4ECUA 3TVZA 2DIUA 2VV5A 2F9JA 2NSBA 1BQXA 3SFUA 2ZJRQ 2COLA 2GQCA 4CZCA 3TUJC 2QA4G 3HHLD 2ZD1A 1A7GE 2BE2B 1RA7A 4KO0B 4XAKA 4F25A 4K4TA 1URRA 1XMOF 5IZHA 3BSCA 1RT1B 4IO9Q 2H9ZA 4LSLB 2DNNA 3IXQA 5F41A 1KNZA 3NAIA 2W9BA 3CT9A 3CUNA 3CIZA 1FTCA 3GZ7A 3SCKE 4YR0A 1S1WA 4EYHB 4CO4A 1NAQA 3BGRA 3JSMA 3GR1A 5F9LA 1RTDA 4H4MA 2J5AA 4MH8A 1V9OA 4NMLA 3U27A 1T03A 1NK6A 4I7FA 2UU9F 3ISZA 4O4GA 3HP6A 1RT6A 2DNMA 4QR1A 5KOXA 4KKOA 1U1NA 4R5PB 2A2DA 4RUCA 3HPOA 2IRXA 3CCZA 4N77A 3GV5B 2CPYA 1JXEA 3TA2A 2Y1IA 2VBZA 2K1RA 2R7TA 4ES3A 1UAWA 4C8LA 4D3GA 3T5HA 5F8HA 2OMLA 1D9DA 3FVYA 5B08A 1LQ9A 1S1UA 3ISNC 4JYAF 5IQ6A 4CTAA 3OLBA 1VS3A 5KOWA 4AQYF 1HD1A 4C8OA 5B0BA 1LWFA 3DLGA 4MAKA 5K14A 3VCDA 4CI0B 3PV8A 1WF1A 4TXSA 4I2QA 3DI6B 2V4JB 1FKOB 2Q66A 2F8HA 2FJBB 4I4BA 4PG5A 5IS2A 2QV6A 4F50A 2VC0A 1S6QA 1QAJA 2J9DA 1NU4A 4CO3A 3CMAS 2HRUA 3M05A 2LDYA 5I42B 3MUMP 1S7HA 5HI7A 2ZZNA 4A8FA 1BQNB 3TNVA 4A46A 3F44A 3G8TA 3N6NA 5HLFB 2HNYB 2ZC4A 1SJRA 3KFWX 3MFIA 1PGZA 1WI8A 1P6TA 1Q53A 1SUQB 3H5YA 3KLGA 3C6TA 1NK7A 2YWKA 3P5TL 1NJYA 2I38A 3V4IB 2CQ4A 4LF6F 2VG6A 4WFNQ 5LSLA 5J2QB 1ZPVA 2FB0A 3HHEA 2OO4A 3VAFA 2XSJB 3POTB 2CQDA 1MW7A 3RB6A 2CJAA 4LMZA 2BDPA 3ZZZA 3LPYA 2A10A 4WK3A 4ZPAA 5F0WA 3VTIA 4NLOA 2VG7B 1HI1A 2OPSB 2ZC3A 3MEDA 4I2PA 3KMSA 4NLGA 3ENQA 2BYCA 2EG2A 2JVRA 1KSPA 3W3SA 1JKHA 2CPFA 1R27B 3C66A 2CPJA 2CZVC 1HW8A 1X7VA 2KRBA 2WONA 1ZYQA 2DR8A 4C2MA 1C4CA 2RH3A 5CCLA 2IBKA 2HHSA 5DGBA 5A2QY 3OSPA 1V3ZA 4YOEA 1VOMA 1V3RA 3MWBA 2KZZA 2B7CB 4QOTA 1K0TA 4UQGA 4I67A 4RNMA 3D5MA 3MDFA 3T1YF 1JLAA 3OBIA 1UA1A 2OFGX 3EPGA 4BBYA 3DLGB 2ADCA 1N54B 2E9TA 4O0IA 2LA4A 1E6YB 4A8YA 3CCTA 4UQTA 2CVEA 4PXCA 2YX7A 3N9UC 1VQPS 4IDKA 3M1VA 2VONA 4ECXA 3PX6A 4OIXA 3DXSX 3H59A 3LF0A 3OR1A 2RF2B 4P6QA 5I3QA 2DNKA 1X5PA 4KE5A 4TYBA 3BGLA 1HW9A 2KJVA 3LQVA 4ILMA 2K1RB 4MFBA 4LF7F 2Z0GA 2J7WA 3DOMA 3FSXA 3OXFA 2IRUA 2O3DA 3K8VA 2N3OA 3K59A 4ZCLA 5I3UA 1QUVA 4CQ1A 4RUHA 3M8QA 2XGQA 3G8QA 1Q8BA 2VPYB 1YJNS 5GAEU 1VI7A 4AYBD 5HMZA 5J2MB 4ZCIA 4NX9A 3Q22A 5D4LA 2BM0A 3CCRS 3OTEA 2OFHX 1NEEA 2IAJA 3C6UB 1S6PA 3LUYA 5HQ8A 3GFXA 2K7KA 2FHJD 1U6FA 4C3LA 2BA9A 3KLEA 2HS3A 3M2RA 2G9OA 4A47A 1K8AT 3BB5A 4IKAA 5J2NA 1XN9A 1OPIA 1NKEA 2BE2A 4J9NA 3ULHA 3CCSS 2W4CA 3HHLA 1QM9A 2X1AA 2X51A 4JI8F 2FJVA 4KV8B 1RT4B 1X9SA 2F40A 3SI8A 2YNHA 3H2VE 3CC7S 2HQ3A 5HROA 4ZA1A 2XS7A 1F5CA 1OWXA 5L38A 2D41A 4WF9Q 4A4JA 1FXDA 1BLUA 5DDQC 1RWUA 3JSMB 4DL7A 2HWTA 3MM9A 2LKZA 2OPRA 4E0DA 1YBAA 3ETOA 4ZP8A 4HHJA 2HLTA 5CYMA 1U45A 3KLFB 3PNIA 4CO1A 4WZQA 3CDBA 3VAKA 1RJJA 2GO9A 1HI0P 1G3OA 1S48A 3DM2A 2F4VF 5C24B 4Y2KA 3DCAA 2QRRA 2MJUA 3TVKA 5JJBA 4X4PA 2A18A 3CCVS 2J8AA 4WYLA 2A1BA 2PDAA 3MHYA 4NLDA 2PN6A 4X65F 4NPOA 3LGMA 1WEXA 1V6HA 2ROEA 5KFYA 1IKXA 1X5SA 2OSRA 3HHLB 4B08A 3KK2B 3Q2SC 1HYSA 5KT2A 2AJQA 1IXKA 4HL9A 2DGTA 2FGCA 3HO1A 2ZOGA 3GG0A 5CYQA 3QJJA 1KHVA 2NQPA 4USHA 1DARA 3SCIE 4QPXA 4FF1A 1XEZA 4NLQA 3I55S 1W2BR 1M5OC 1H6KX 1HBNB 4LUBA 4A8XA 1FKAF 1S77D 2WBRA 1N6QA 1IKYA 3OTDA 4PUOB 4MYTA 5KG3A 4FS2A 5EWFA 2Z8QA 2L9NA 1D8YA 3M8PB 2X1GA 4B3OB 3CVKA 4OZ1A 3CCUS 1IR0A 4IFVA 4KHRA 4MFBB 2F8MA 4OI0A 4L72B 5CD4H 4E8UA 4PXDA 1FT8A 2L9DA 1D9AA 2KT5A 3FDSA 4PXEA 4O3PA 3THPA 4NCBA 3QMQA 2N4CA 4M1KA 3MUVP 2JRSA 3GFYA 3IC1A 4Z37A 5IM0A 1E6VA 3TW0A 4F67A 3C2PA 3M6VA 5BYSA 2WK4A 1QSLA 5E2QA 4ETXA 3PR4A 1M5PC 2JEJA 3MM6B 3QWPA 3MUTP 2N7CA 1XTZA 1NK9A 5K9FA 4PCQA 1RYRA 1TVRA 2CRLA 2L48A 2MMYA 4C8MA 4JV0A 2KT2A 5DRKA 1VQ6S 3VZIA 4QZVB 2RKIB 1NH8A 1S1UB 1UP1A 3MM7B 3M2UB 2J76E 4WFAQ 4YB1P 1SI9A 1SKRA 2Y0SD 4U6PA 2WHOA 5MLCV 3DRPB 4YFUA 1B7FA 1KQGB 4IFYA 4RW9A 3DYAB 4U9RA 5C24A 3VAGA 1C1CA 5GAEI 3G6VA 1TKTB 2G13A 1OIAA 3KG1A 1RTHA 2E1MC 1X4EA 2JEIA 4C7QA 1UVJA 1X9MA 2NSCA 1HL6A 2AJFE 3I0RB 4NRUA 4OQJA 1L5UA 2DH7A 1RGVA 4QIWD 4Q8EA 5KFEA 4O44A 3F41A 2PO4A 1YWXA 1RTIB 1KOOA 1OSCA 3H2LA 1R43A 3DRXA 4MIBA 5C5JA 3CD0A 2B4OA 4OLOA 2WOMA 3MEEA 2HHQA 2DB1A 4BDPA 1VC0A 4AL6A 2R7UA 2XHWA 4K5RA 3LO3A 4X2BA 2BABA 2A2CA 2IVYA 1VQ7S 3CB4A 2YX4A 1VQOS 3KLGB 2K8GA 1JJ4A 4ILRA 3JTNA 1TL3A 5G4DA 4URSA 2FJEB 3QLHA 3N0VA 5ITHA 2DVIA 3GE9A 3SCLE 1KVIA 2ADBA 1Z1ZA 5AXKA 3R1HA 2QO3A 3LP1B 3DHXA 1HFEL 1HNVA 1BD6A 2HHPA 3H20A 1DBDA 4C97A 4ZPBA 3PX4A 4DWIA 1TL1A 1ZM4A 3F56A 1LWCA 1F0XA 3OPKA 4NLUA 4QIFA 4ED7A 4IO1A 1RTDB 2GHWA 3A1YG 4J5OA 4DFPA 1MROB 4DF4A 1S0VA 2I9SA 3TA1A 3SSRA 4QIEA 1UVLA 3AJ2A 1M5KC 3MM5B 4DL5A 4NLYA 1H2TZ 6FDRA 2FVQA 2D9OA 1TV6A 3N28A 5A8RB 1R0AB 3GWCA 3ZZUA 1OQ3A 4RU2A 3UFCX 1FRXA 3W2WA 1Y3KA 3K0JA 3IS9A 1P1TA 3NBPA 2RB7A 4DS4A 3Q8PB 2V8GA 1FKPA 2HNZB 2MKSA 4OJGA 3RBEA 1N4LA 1VQ9S 2E9ZA 4O4GB 2ZOMA 2DO0A 4C11A 3KLHB 1Q8LA 5F8JA 3I4HX 3JYTB 4B3SF 2IFXA 4OX9F 3MM5A 1GH8A 1TUVA 4PG4A 3BJYA 2KI2A 1S9EB 2U2FA 3I31A 4ZVHA 4F4XA 2XULA 1UA0A 4OI6A 3AB4B 2CQIA 1AFIA 4TY8A 2VZ9A 1SH2A 4KGKA 1PC4A 2HS0A 2YNHB 1LW2B 1D3WA 2AX0A 4X4VA 1IKVA 3N4WA 4GC6A 1QVFR 2OKQA 4DL4A 2BANB 2RRAA 5DG7A 3GR0A 2Z2LA 3ICLA 3DLKB 4P2SA 5KG1A 2IAJB 5GVQA 4HKQA 3KLVA 4DV0F 1GXTA 2GHPA 5AXMA 2IBOA 2XWYA 3D0GE 2YKPA 2YX1A 4RW8A 1TK8A 1R3NA 1S9EA 4QQBA 2Q6BA 1S6PB 1ZPWX 2U1AA 1T05A 2XS2A 4XDDA 2MKJA 5J1PA 3O44A 3FFIA 4NCAA 3FJ2A 4R0EA 1RQ0A 2Y1JA 4KHMA 1PSDA 2BRLA 2ZITA 1VQLS 2KVIA 2BXJA 3UPFA 4M63A 2HMIA 3UDLA 2M9KA 5A0YB 4ZHRA 4QIVA 5DETA 2R7RA 2OTLS 4DLEA 3BREA 3QO9A 5CCMA 4DDFA 3QZ7A 2O66A 4N56A 3NAHA 2IM0A 4XIUA 3Q8SB 1KLMA 2LXFA 2NUHA 3V6HA 2RMLA 3RZAA 4K4WA 2EFQA 1FRIA 2JLGA 2CQPA 1JNZB 4X64F 4YHHF 3CWJA 5DQIA 4LF4F 1W25A 3RU0A 1H98A 2OPQB 3HF5A 3OL7A 1YI2S 2CQ2A 2ZH4A 4JI1F 3MTJA 1S1TB 2VC1A 2ZVSA 3L09A 3VZHA 1VBZA 1Q4RA 1X0PA 2CJKA 1W2IA 4PQAA 1CLFA 2RDJA 4RW6A