1CC7A

Crystal structure of the atx1 metallochaperone protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
b'AEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (METALLOCHAPERONE ATX1)
publication title Crystal structure of the Atx1 metallochaperone protein at 1.02 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
total genus 18
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 1999-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cc7A00
1Q8BA 2BJEA 2HFNA 3IWXA 3LGMA 1JK9B 5F0UA 1TL4A 3KG0A 2K1RB 2LDIA 5F0WA 3HHLD 4NL5A 3TOQA 2ZDPA 3K7RA 2W4PA 5B0EA 3BN7A 3CJKB 3QMQA 3I9ZA 3DCAA 2KKHA 1FVQA 2OFGX 1URRA 1N5VA 1R6YA 2OAUA 4ZA1A 2XMVA 2AJ0A 4A48A 3MCSA 5T7LB 5B0BA 2HQIA 4Q2LA 2G9OA 5B0GA 5B0FA 2BYCA 2OD4A 1YJTA 4OJGA 2BBEA 2XMKA 5B0DA 4OIXA 2CRLA 4YDXA 4QOTA 1AFIA 2BUNA 2GO8A 3BGUA 4ZOSA 1FD8A 2OKQA 1KQKA 1QUPA 4EFAC 1KVJA 2GGPA 1SI9A 2KYZA 2OMOA 3BR8A 2AJ1A 1CC8A 4OJHA 4DL0C 1KVIA 3HHLA 1P6TA 3FMBA 3HFKA 3HHLC 2IYIA 1Q8LA 1Y3KA 4HL9A 2LXFA 1TZ0A 5K9FA 4F67A 1FE0A 1Y3JA 2OFHX 3F44A 1OQ6A 1S6OA 1YRXA 1X0PA 1P8GA 2W4DA 2QLXA 3BF4A 2GA7A 1ULRA 2K1RA 2N4CA 1CC7A 2XMTA 3GZ7A 4DN9A 1SB6A 3BM7A 3KKFA 1TUVA 1Q4RA 4OJ1A 4A46A 2XMWA 1YJRA 1WD6A 3CJKA 2JDJA 1AFJA 1FE4A 2KT3A 1FESA 5B09A 1FVSA 1MWZA 1APSA 2QLWA 2K7KA 1GXUA 1IUJA 1OSDA 1GXTA 5B08A 2N4DA 5A6WA 2IFXA 1AW0A 2FIUA 5T7LA 2VH7A 4DPOA 3KNGA 4Y2IA 1TL5A 1TR0A 2OP5A 1YJUA 4HH1A 5B0AA 2L3MA 1RJJA 2QIFA 4YEAA 1XBWA 1VQYA 2ROEA 3WDOA 2PD1A 2ACYA 2RMLA 2XMJA 5A6PA 3LGNA 4NPOA 1V3ZA 1JWWA 2ZDOA 1X8DA 4FNHA 4OJ3A 5B0CA 3BDEA 4A4JA 4Y2KA 2IYGA 4A47A 2RSQA 2RU9A 2GFFA 3FRYA 2HIQA 3QGPA 1Y9OA 2PGCA 1U7LA 3IWLA 1S6UA 3VTIA 1N5SA 1Q53A 4Y2MA 2AW0A 2FHMA 3MZIA 1YJVA 4Q2MA 2XMMA 2BJDA 2GV1A 4HI1A 3HF5A 2VV5A 2EW9A 2FTRA 3BB5A 2FB0A 1VQSA 3HX9A 4U9RA 1N5TA 5KAKA 4HI2A 2ASYA 2XMUA 2ROPA 2K2PA 2OD6A 1SQEA 3KG1A 2HLUA 1FEEA 3HDSA 2RILA 4HH0A 4FNIA 2K7JA 3TRGA 3UDCA 3E8OA 2Q3PA 1OPZA 1LQ9A 2GGPB 1K0VA 2QYCA 2KT2A 2LQBA 2W4CA 3FGVA 2GCFA 3TNVA 5IXUA 1W2IA 1YG0A 3HHLB 3DXSX 1MWYA 1OQ3A 2AP6A 2N7YA 1X7VA 3LO3A 1N5QA 1Y0HA 3T9NA 2HLTA 2ROGA 1CPZA 2HFOA 2LQ9A
chains in the Genus database with same CATH superfamily
1KKHA 2UXDJ 4MT1A 5E33A 4I6AA 2Y1RI 4XPCA 5L1JA 1VRTB 1RHUB 5C25A 2Y8YA 4IFVA 4FXWA 1NDKA 4TXSA 3TJ9A 2VQFF 2KM8C 3NNAA 4RL1A 3H5UA 4RJVA 1QD1A 2C2KB 4LVNP 1WDTA 5BR8F 2KZMA 3R9LA 2DPJA 4UTGA 4FVCA 5HBMA 1UVNA 2WTFA 4DUTA 2VFRA 2JFDA 3MM8A 4AYBD 2VD3A 2FJBB 4U96A 1IWGA 1RT7B 3SZ2A 2MYFA 5KG5A 1HKAA 1EKSA 4KFBA 2IVMA 3OJUA 1S79A 3QRPA 3MTJA 1U1KA 1LWFB 3ZZYA 2ZVIA 3K0JA 1BC6A 4DFPA 2DRAA 4PPDA 4DX6A 1L3UA 4MYTA 4LF7F 2YNHA 2DNQA 4X84A 5IT9U 1A0OB 2DJWA 3KNAA 4NMLA 5CYQB 1H98A 2KJVA 4EBCA 2JL9A 4JI2F 5KG0A 5ETKA 4WXWA 2BM0A 3N9UC 3W63A 1FD8A 3EICA 3CD5A 1JLQA 2OMOA 4JYAJ 3H42A 4H4KA 3M30B 1V3RA 5CAAA 3HM9A 4IR1A 3UNGC 2EVZA 1SBRA 5A0YB 5J1NA 1VRTA 2A10A 5F9NA 1SKRA 4P6QA 2B9WA 2KTQA 4QYRA 5KFIA 3Q0AA 2J6UA 1WOSA 5E5NA 3MPYA 3BBBA 3GR0A 1YIJS 3I0SB 4EU0A 1FWPA 3KYLA 3G6YA 5DZ7A 4HI1A 2CQCA 2BW7A 2YVSA 3OTBA 1U1LA 3J81U 1RT7A 4J9MA 4WZQA 3TWZA 3W2WB 2OEMA 4URGA 2FY1A 1RWVB 3VAGA 3T1HJ 2KB2A 1RK8A 1VQOS 2BJEA 2CAJA 2EFVA 2NYHA 4R8UB 2DR9A 3L7PA 4AT1B 1NM2A 3IBCB 1LWFA 3M9OB 1LWXA 2F4FA 1R6VA 2LECA 5EGYA 1RBLA 3UCUP 4M5IA 1NO8A 5SUHA 3IWNC 3G8TA 3BQ0A 2GA7A 5D77A 3CCUS 2YNFB 2J6TA 3ZNUA 1H72C 2YWKA 4NEYA 2VOOA 4ZLLA 5B08A 4DFKA 3U7JA 2LVWA 4WFXA 1FX4A 2DGTA 3KNGA 2CQ0A 3CDUA 1F5BA 3QSYB 1ZM9A 4KC5A 2MHEA 2ZDOA 4OL8A 4EBEA 4YMEA 1S10A 1GX5A 1K8AT 2E5GA 1KEKA 3LP0B 1LK7A 4BLGA 4I7FB 3Q8VA 2G1HA 5L38A 2NPFA 2HBYB 2MEWA 5A0YA 1KSPA 1B0TA 4MTPA 2EI5A 1N0VC 3R7NB 4LF8J 2AEFA 1OO0B 4LRFA 2MQNA 3BGFA 1IBKF 4LQ3A 2JVRA 4QW8A 2RT3A 4HYKA 3M4XA 3I0SA 4LRCA 3LAKA 1SV5B 3ISND 6AT1B 2CRLA 4WTOB 3TJ8A 3W2WA 3TA1A 3DLGB 2F9JA 3BR8A 4Y65A 1JMTA 2RJZA 3ELHA 4R8UA 4DU7A 1KR4A 2K7KA 2R2UA 2CJ9A 1HLWA 2YX4A 4DV6F 3F0NA 3UNYA 4JI8J 3MECB 5KFLA 1SH2A 4EO6A 2CWXA 1RWWB 1F0XA 1CJUB 2QL5B 4BBYA 1K47A 5A8RB 3CIMA 1FD2A 1IQZA 2JEFA 3HZEA 2YNFA 3PHEA 2DGXA 1OPZA 2D74B 4PG8A 1NAQA 1IBLF 2ZWPA 3I4PA 4RW7B 5EWEA 2KRRA 4A8YA 4WTYA 4NL5A 2HZCA 2PI5A 4Y34A 1IKWB 2HFVA 1U1NA 3LP0A 3HULA 4I7FA 3TARA 4FKXA 2WB4A 4B3RJ 2J8AA 3OFFA 4NCGB 2OKQA 2Z58B 3HT0A 4P7TA 3D0IE 4ID8A 2WW4A 5JVGQ 2HHHF 2F65A 3SV3A 2JH3A 3LGHA 5DG9A 3PR4A 3T1YJ 1SV5A 4WWSA 1RWOB 1F9HA 3CDBA 2XCPA 3H25A 1JWWA 4FNHA 3DLGA 4O44B 4OZLA 3QGPA 2DNYA 2VKRA 2E1CA 1LEOA 2QRRA 2DGWA 3TUJC 4DSLA 4ECZA 1I51B 1XNQF 2XULA 1C1BB 3T6BA 4NZ0A 4WYWA 4DV5F 4DV2F 1RA6A 1WORA 1Y0HA 5J1PA 4KO0B 3OFEA 3LGMA 3CO0P 1M1HA 3MECA 2P8IA 5M2RA 1GMUA 2BOAA 2E9TA 1CJKB 2UUBF 3CC7S 3W3SA 5A8RA 2L08A 1HBNB 2CJBA 4F02A 1EQ0A 3ILLA 1TMJA 5C42A 1Y3JA 4RW7A 2AMCB 2VQFJ 3KUGA 3BSCA 4AE5A 1CC7A 1HW8A 2E9RX 3PM9A 2F8HA 1IKWA 5LMUF 1YI2S 1N48A 2XSFA 2ZBCA 3FC9A 4GVBB 1TR0A 3WZ0A 1IWAA 2ROEA 3BPSP 1NB7A 2L41A 4NCGA 4GKJJ 2VIHA 1PGZA 2IM0A 1U2CA 2IJRA 4L3NA 3HK2A 1N33F 1RWMB 3PRDA 3M8SA 2CPEA 2OI2A 2MZRA 3PTWA 4KHPF 3K8VA 1RAAB 5FIIA 4K4XA 3GJQB 2MKSA 3AXKA 1M1KT 2ZUGA 5K5MA 2CPZA 2DCLA 1NK9A 3TVZA 2FLLA 3DRRB 4IG0B 2JRSA 4GMKA 2QTWA 2HIYA 2MHNA 3KUHA 1C1BA 1HNWJ 1OYDA 5IS2A 3DI6B 3OXLA 1YZ6A 1TQLA 3B78A 2VKZG 2JVOA 3HD2A 1S9EB 2UUCF 1ZAXA 4KO0A 1BXNA 1Y4ZB 1FERA 1SJQA 3HVAA 1CJKA 1H73A 1APSA 4J9UE 4PKDB 1YJUA 1HBNA 3RG6A 3ZTRA 3FBFA 3M6UA 2RMLA 3MR3A 2XYHB 2CZ4A 2CQHA 3UD3P 1R43A 4L74A 4DJBA 3D6TB 3IGNA 2Z56B 3MEDB 1FRJA 4WPAA 2K7JA 2XC9A 2NXEA 2Q79A 5DQHA 1XEZA 3W65A 2AP6A 1JNZB 2LXIA 4MK8A 4GVBA 5F3TA 4YR2A 4NLVA 3W62A 3VZIA 2DYAA 2I0XA 4HVZA 1GMWA 1RWPB 2RDDA 1T3OA 4RLEA 5KFAA 1FNXH 4JBCA 2HQIA 3M9NB 5KT6A 2XMKA 1SIZA 3E51A 4UF4A 4A8MP 4C8ZA 3N28A 4OI0A 3KLIB 1W26A 3I5CA 5HN0A 4JOUA 2KVQE 3IXQA 2PFFB 3EZUA 1MG7A 2DH9A 4CLLA 3JSRA 2N7CA 4UOHA 3TP2A 2FUG9 2KH9A 3DRRA 3IP0A 3IAS9 4IG0A 1OY9A 3LAMA 4IYQA 2C2MB 3G82B 4BC9A 2C22A 3DI6A 4A47A 1JLCB 1RGVA 2CFXA 3ZZZA 1S9EA 1MN9A 3RRKA 3MOJB 1FRKA 2BOPA 4F4WA 4AFFA 2DGUA 3M32B 5L39A 1XWLA 1RU2A 3LPEA 1RT3B 4NZ6A 3FFIB 3ZO7A 1BD6A 1NJYA 4IO1A 3CW2C 2W4PA 3HJFA 2KHCA 3TX0A 3DNCA 2CPHA 2YQ3A 1Y11A 2AJ0A 5KFMA 1YLXA 3W5ZA 3MEDA 5C7PA 1FJCA 2VODA 2Q1LA 1T0TV 1Q8IA 2AJ1A 4RUHA 4UUXA 3TX8A 3LP1B 2PC6A 2M88A 1UVKA 1C1CB 3PACA 4DN9A 2BJ1A 4DR2J 2UP1A 2RD5C 5KFPA 4F4YA 2V4JB 2QIFA 4EMDA 4MAKA 1HWLA 2DHXA 5IV4A 3MR2A 1HNXJ 2RU9A 1NPRA 4MIAA 3KLIA 2OPRB 4AQYJ 2MQOA 2HYIB 5AXMA 1U25A 3JSYA 3P5TL 2LYVA 3GSIA 1AT1B 1R3NA 1YG0A 4U8VA 4M5JA 4UT4A 4URQU 2IRUA 3FCVA 1SL2A 1M5SA 2J9EA 3LALA 3G82A 3IR5B 1F60B 1VK8A 3M6VA 4B3SF 1KP6A 2ZKUA 2LA4A 1RE1B 4LF2A 2M52A 4LF4J 2BYCA 1YJTA 2CQIA 3M32A 2QO3A 3DLHA 3FQLA 2AIRB 1RT3A 4TU8A 1RTHB 3FFIA 4KV8B 5LXYA 1CEZA 2FGCA 4ES2A 4TNOA 3BGOP 2AHOB 3L7OA 4NZ7A 3SEOA 1XTZA 1IQTA 2VFVA 3IR6B 1FKAF 4O4GB 3MI7X 4ANCA 1QAXA 2XLIA 4NCAA 4ZK7M 4DR5J 4G3IA 2ZZNA 1KDNA 4UUWA 2MPUA 3HPOA 3LP1A 4TY9A 4NXNF 1C1CA 1JJCB 2VICA 3AQOA 4DPWA 5CQGA 4OYAA 3DOMB 4XIUA 1MWYA 1OQ3A 2KG0A 2V4JA 1F1BB 3VAKA 2IMWP 3I9V9 2W1BA 3CJ5A 2V69A 3V6DB 3MMCB 3HMJG 4PWUA 5F8LA 5E3AA 2HAFA 4F0MA 2IA0A 2B4UA 2EFGA 4WF9Q 4DSEA 2FJXA 3BZQA 4KE5A 3K5NA 4TN2A 2WVDA 4N76A 3AAWB 2IYIA 2RB7A 4P52A 2BRLA 2AJFE 2VG6B 1NH8A 2A0FB 2YWEA 2M9KA 3DLKB 2IHR1 1NJIT 1EJ7L 1D3WA 4B3MF 5A8KB 2VU5A 5IWAF 4DL5A 3VV2B 3H2UB 4FPRA 5L1LA 2UVRA 4JI1F 5ETTA 5KG2A 3CTRA 3CCLS 4ICLB 1C0TB 1RTHA 4KV8A 2AW0A 1PYTA 5BXIA 1E6VB 2XNQA 2DNRA 4OZ5A 3BGLA 1R0BG 2XWYA 3DU6A 4P7VA 2QSFA 2YXLA 3AJDA 1REVB 2P6SA 5CYMB 3DKDA 4O4GA 4I64A 3NS7B 3NAIA 4KPYA 4DX5A 5I42A 1QSSA 3PEHA 3KK1B 2KXNB 5F8HA 4RNFA 3PY8A 4QR2A 3GG0A 1JLAB 1ZA1B 5KT4A 3DOMA 4DR7J 3VAHA 2EFPA 2ZNYA 4DQRA 2HFUA 3GTYX 4O3PA 3EGWB 4K7QA 2PEHA 1BUXA 1RISA 2OUGA 3V6DA 4BDPA 3MMCA 5KFYA 1D9DA 4E98A 3KLFB 1WHWA 4P2SA 3OLAA 3LA0A 1ELOA 1T7PA 3DLEB 1GMWD 2NXUA 1T94A 2VG6A 5F8MA 3OV7A 2I38A 3LANA 1PJ6A 1DRZA 1R8HA 3FGVA 1W2IA 5A8KA 1HBMB 4CQ1A 3PKYA 1CULB 1HA1A 1JK9B 3RZAA 3V4IB 2BV3A 5E0OA 3CD6S 5D0EA 3M2UB 4ICLA 1C0TA 4M5DB 2OTJS 1NJXA 1E6VA 3NL0A 3GCWP 2C2OB 2CPIA 2G9OA 4JP8A 3BEGB 3PJXA 2G13A 4JI7J 3AODA 2LMIA 2IJFA 5LOQA 1KNZA 1NZ8A 4OYBA 1REVA 4NRUA 1LNQA 4K4UA 3O3LA 5CYMA 1S72S 3TZWA 5FD1A 3H5YA 1NMEB 1M5PC 4KT0C 1RZMA 3KK1A 5DS7A 2CJQA 2FHOB 2GQCA 4DUYJ 3EX7B 1H7XA 1NB2A 1RSCA 2VOPA 2E5LF 1JLAA 3HZGA 3P3DA 1RWKB 3VTIA 1HI8A 3PYEA 2E7XA 4YB1P 4GC7A 4OZJA 3MPDA 2MKJA 1F2HA 1IKVB 4LBPA 1U24A 1CJVB 3T5KA 2BABA 2HQDA 4W90B 3VCDA 3KLFA 3M8YA 3N4WA 5DDQC 4HLBA 4OZ3A 4K2JA 1XMOJ 4ED1A 1DURA 1SJ1A 3DLEA 3L4BC 2PMWA 1KD1T 4ZS6A 3K5PA 2QG9B 1PKUA 2NQPA 2DY1A 1VLOA 2IVYA 2PMZD 2KYZA 4IKAA 2K3KA 4X4RA 1CULA 2H9ZA 3CCES 2JEGA 4ILLA 3V4IA 2M8HA 3BR9A 2M4MA 1NKBA 1HNVB 2APOA 5KG1A 3M2UA 1P27B 4M5DA 1IUJA 3HLUA 5DQIA 4QIFA 4I69A 4DPOA 5B0AA 5HQLA 1RAHB 3QT8A 3MFIA 4KH0B 5H9FJ 5DDRC 3OTDA 3LW5C 1VHFA 2P2CB 2KVIA 1FJ7A 1FEHA 2DNLA 4FYWB 2B4OA 3THVA 2NREA 4Y0FA 3LUYA 2DNZA 4B9TA 2V4RA 2LDIA 2X3DA 1KBRA 4X2BA 3CC2S 4Q7AA 3DOLB 3CNQP 3G8QA 2OFGX 4RKUC 3HI9A 1J5OB 2MZJA 4RBUA 3W61A 1P1TA 3QGHA 2YKQA 1WC5A 3HT3A 2H1YA 1IKVA 2J6SA 1NRKA 3E2EA 1P6TA 1CJVA 4C3MA 4OYPA 2OPPB 3A1YG 3BKUA 1XMQJ 2BJ7A 3OSPA 2U1AA 4ZP6A 4J7CA 3V6KA 1X9SA 2K8GA 2KYXA 2H4YB 3MMJA 4OLPA 1U0SA 5A6WA 3W9HA 1D1UA 3MR7A 2V9WA 1UTAA 2MGZB 3ENAA 3R7BB 3OL6A 2R7QA 2Z0GA 3NP5A 4Q2MA 3NNHA 2GV1A 1U1QA 2FZKB 5J2PB 1JB0C 1HNVA 3UN3A 1HHQA 1VC0A 2C2RA 3I32A 3UDEA 5F0UA 2MKHA 1WC4A 5T14A 4QIGA 1R6YA 3KHRA 3KJQB 3BO3A 2ZUAA 2BQUA 4ITSA 2EG2A 5EDWA 3NMRA 2CG4A 2GO8A 1HIYA 4EFAC 5D78A 2ATCB 4DL0C 2FC9A 2HVEA 5LM7E 3GV7B 4ECUA 4ED6A 5K9FA 2Y9HA 1OQ6A 3JTNA 4RW8B 5IT0A 4E2FB 1MWQA 2WSEC 1YJ7A 3ZZTA 1WD6A 4USIA 4FYXB 3DOLA 1SJ4P 1J5OA 3T5HA 1JXEA 2OLWA 3DGPA 2HPUA 1FRXA 4DWIA 1VDHA 1RAIB 1M5VC 2ZBPA 3OXGA 2DKOB 3PV8A 2F8MA 4QBUA 2FHMA 3MZIA 1U26A 2OPPA 3OD2A 5IWAJ 2V4QA 1WTFA 2EKNA 3C6UB 4ED4A 1WC0A 4NXMJ 4BHQA 2BKNA 4CNYA 1EHWA 3DDNA 1W7WA 3U1LA 3EGZA 3W9JA 4X65F 3UPFA 1TTHB 1HBUA 3POTB 4GKKF 3SSSA 1BGXT 4YQWA 4UZBA 5JJBA 5J2PA 3OTCA 3I96A 4K4TA 4KGMA 3UWTA 2ZNZA 1I3OB 3TUZC 2QFIA 1WG1A 4OLOA 4F04B 4PYDA 3SXLA 3T9ZA 3GMGA 1MWZA 3IR7B 3EGNA 2ATLA 2DNGA 1HNZF 2ZBQA 4W4MA 4DL6A 1Z1ZA 3RJMB 3C46A 5A6PA 4USWA 3EYZA 4UOFA 4A4JA 1F5CA 3EE3A 2DNKA 3W7BA 1BE4A 4ZPCA 2ZH2A 4QWAA 3WC2A 1I94F 2EPIA 4RW8A 2GHVC 1UWAA 1GFWB 2R4FA 2MMYA 1YRUA 4IQXA 3GFYA 5GAHI 3N6MA 2FVCA 2F4VJ 3FZBA 5KFFA 5BYSA 1ZM4A 1PYOB 4WIIA 1N34J 1S0MA 1KQFB 1L5UA 2C42A 1FXLA 2RF2B 4UW2A 1KTVA 1RLDA 3DFEA 3G4SS 3HKZD 2WAQD 2DIUA 1G2EA 4DPXA 4OIXA 2CQDA 1I5OB 4YDXA 2RUGA 4AXJA 1U09A 4OJHA 1T05A 4V19J 2E5IA 1JXVA 2WK4A 1LK5A 2VQEJ 3FZ2A 2GMHA 2QLBB 5HQMA 5HJXA 3HCXA 2EFNA 3AOCA 4HACB 5DDPC 1SIWB 3POTA 5D4OA 1SL1A 2J5AA 4YEAA 4C2MA 4U8YA 1RLCL 4QWCA 2BANB 3BQ2A 1PJ7A 1Y00A 2P9EA 3HD1A 2DXFA 1U1OA 4FZVA 4FYDA 4DG1B 3AD9C 2RRNA 4OI1A 1R8AA 4CWBA 2ZBIA 3GR1A 4G1PA 9ATCB 2HMIB 3ET6B 2QMXA 2IAJA 1BQMB 1O51A 3T9NA 3B4DA 1RAJA 3H4DA 1WKJA 3RU0A 3FEXB 5D6GA 1JXLA 1WKKA 5ETQA 2ZDPA 2L9DA 1U49A 3FDSA 3CJ8A 1WF1A 3RYLA 4NEZA 3BYPA 3DMJB 1LWEB 1N36F 3TEHB 1N8RT 1WSRA 1F9FA 4J9VA 4ZVTB 1YK9A 3D1QA 2BE2B 3D9BA 1V6HA 2ZH4A 4DV7J 4U7CA 1NK6A 4CO2A 2BW2A 3ZZ0A 2VJUA 4HTIA 2RF2A 2H5JB 3E3XA 2ZM6J 3P6YC 4C98A 2AYGA 3G2XA 2Z2ZA 1U6ZA 1WG4A 2H54B 1K1SA 1G1XA 1FKOB 3RBEA 4PG5A 2YPZA 1UCNA 3AOAA 3M9MB 2UU9J 4PAAA 3G6ES 5KG4A 3HDSA 1DQ9A 5AXNA 4HACA 4A8SA 3GFXA 4Q8FA 2E7VA 4JI3J 1RHQB 5GAHU 2BANA 2DGOA 4JI0F 3BH7B 4QJVA 2ADBA 1PC5A 1MMLA 4M5LA 5H9FK 4ECTA 2J8SA 4DV3F 3IAM9 2HMIA 3F41A 2DPIA 3KMQA 3A3PB 1U45A 1DQAA 1GX6A 3TVYA 1JLEB 4LFAJ 3C14B 3C19A 1YJNS 3V4MA 1T9TA 1FE4A 1FHTA 1Z4UA 4M5KA 3NKYA 2G0IA 2R8IA 1NHVA 2QC3A 3DMJA 4RW6B 4TU9A 4JV5F 1LWEA 2MZ1A 3R2CJ 2ILZA 4FF3A 2O3DA 2IYGA 2LQ8A 3LF0A 2O1PA 4EO8A 2VG5B 2BE2A 3JQKA 2CJYB 2IC3B 5EHHA 4RNNA 1N5TA 3OTEA 1WKLA 3O2IA 3HHNB 2AGOA 2J0SD 1AUDA 2GCFA 4DZ6A 2UV8G 4F4KA 2NXJA 1VJQA 1SQFA 1PAUB 4KHRA 1S4FA 1ZTTA 4DR4F 2L48A 1VOMA 3FUYA 1FKOA 5IQ6A 2DHHA 3PYDA 3B54A 4LF6J 2B8QA 2V8PA 2YKMB 4FS1A 5K8NA 2YX1A 2KZZA 4K8RA 1WUUA 1U4BA 4YOEA 5K8MA 1N32F 4DR1J 1ZETA 1DTTB 1X5OA 2EG1A 2OGUA 3C8YA 2DT9A 2X1GA 1TELA 2MJNA 1MLAA 4JUZA 3KLGB 3HO1A 4YB7A 2CNLB 2HSEB 3PW0A 4L3KA 2OIHA 2MSSA 3PFOA 3O6QA 3NCPA 1JLEA 3R1LA 2UXCF 3M2VB 3VZHA 2ZE2B 3C14A 3VWSA 1WC6A 2JHEA 3QPIA 2HK3A 5BJRA 4PWWA 2HQCA 1N88A 3HX9A 3NXZA 3J7ZT 4RBVA 1NHKL 1PCAA 4OHVA 3MUVP 1YWXA 5HVFA 2VBZA 3QJLA 3PRBA 3OL9A 4M8LA 5HI7A 2VBYA 3MM7B 2XMJA 4RW6A 4X62F 2KFNA 3BN7A 3MHYA 2JZ5A 1HW9A 5D0RA 2FJDB 4PABA 2VG5A 4MFBB 2IC3A 1VRQC 5DQGA 4EZ6A 5AJ3F 1Y5IB 4BCAA 2NZCA 2GHPA 1RBOB 3TA2A 2PDAA 1FT8A 1T8EA 5LL6d 4O3QA 2VFUA 4OX9F 1V3SA 2PSZA 2UXDF 1RKIA 2VDIA 4LRAA 2B9YA 2BX6A 5DGBA 3IS9B 1M0SA 4FS2A 1RAGB 1X4CA 2PEBA 2YKMA 3TEGA 5L1IA 4K4YA 1CS4B 2QLJB 4B17A 3NNCA 2VV5A 1SKWA 2YTCA 4A8QA 2C2ZB 2FLNA 2E1RA 3KLGA 2D9PA 2MKYA 3DHXA 3S7RA 2X1BA 4KR0B 3CJ3A 4KGZB 2KKHA 4H4MB 2CVEA 3M2VA 2ZE2A 2MQ8A 2HBQB 5B0GA 5B0FA 4ZPDA 1U0HB 3NGUA 4XAKA 3HHEA 3K58A 2ZH1A 4KBIA 2XG8A 4ZN1A 2R7OA 1HARA 2VFTA 4USHA 3OFGA 2ZH6A 1Q8LA 2FJAB 1MN7A 2AYMA 2HNDA 3F44A 3MM7A 4NLTA 2KU7A 4J9NA 3W66A 4LFBJ 2XMTA 2UVVA 4S0MA 1U1RA 2Y0BB 4DX8H 2IFXA 2FYXA 4MFBA 2B9EA 1HQ2A 1BY9A 5EWGA 4N8NA 2V8GA 5HLFB 2PD1A 3DN9A 4RR5A 3GV8B 2RSQA 4ILRA 5FLXY 2PGCA 1WWHA 4JV0A 2HHTA 2F9DA 4JYAF 2XWXA 4NLQA 4ID5B 1SQEA 2AF6A 3DXSX 5DG8A 2D69A 3IS9A 4KY3A 5EN1A 2LQ9A 5F0WA 2ZD1A 1CS4A 2XTJP 1WF2A 2KHDA 1T9UA 1Q78A 2XS2A 1TL1A 3J7Z5 3ILIA 4H54A 2W7AA 2FZGB 4JI5J 2HZAA 1QTNB 5AE2A 4B9SA 1RDRA 2LXFA 1NZAA 5KFKA 2FJEB 3D54A 3SQGB 2XZDB 4CLSA 5K8OA 3HSJA 4CLPA 3ZXWA 2V2ZA 3T1HF 1HHSA 1RWUA 1YBAA 4H4MA 2QLWA 5DG7A 1OSDA 3M8PA 3K5OA 3BQ1A 2D3ZA 4UZCA 1U0HA 1RTDB 4NI2B 3LGNA 2HRYA 4B3TJ 2YWWA 3N6LA 2B51A 3AA9A 4ER8A 4KIAA 3D6HB 1S5ZA 3GYNA 3TJAA 3HF5A 4RUAA 2BZ2A 2BM1A 2K06A 5KFHA 2GX8A 4N77A 1L3SA 1VS3A 5IOLA 1A9NB 2F7VA 2CJKA 5HLFA 3MM5B 5KFTA 3AT1B 5GAGI 1UMJA 5LSRA 3R27A 4FKYA 2KFYA 2A1BA 1H38A 2GJFA 2XZTB 4ID5A 4HR2A 4LJMA 2X3GA 3H0PA 1DZ5A 1KRPA 3D5MA 3AFGA 4DFMA 2C2EA 1RT6B 3VGTA 1IJFB 4WP9A 3BF4A 5HSPA 2X51A 3D7SB 3IC1A 2IPOB 4LF8F 3AY0A 4M5HA 1TUGB 4IG3B 2NCKL 2CJXB 4MIWA 5HROA 4LFCJ 3GCXP 1FJEB 1ZPWX 2HVDA 1LW0B 5KFVA 5F9LA 4OI4A 1NHUA 3SI8A 2GIQA 4Y3CA 1XC9A 2QA1A 4YFUA 3KMSA 1PG5B 3SQGA 2QL7B 1Q5YA 2YNGB 1TKZB 4JV5J 4Z7CA 2F1FA 3JB9k 1X5SA 3BV8A 1ZH5A 1MROB 1ZA2B 3FSIA 4URSA 1QM9A 2IRYA 5JVHQ 3J7YI 1ZAWA 3OW2R 1LW2B 1IR2A 1OJ4A 4I2QB 4IQMA 1RTDA 3CF5Q 4NI2A 5J2QB 1KONA 2XM3A 2LEPA 4IRKA 4JI8F 1VIXA 3KWMA 4A48A 4DFJA 4KRWA 1WEXA 4X4VA 1AFIA 4ZOSA 1VQ6S 2BE9B 3MXHP 2RQCA 4NA1A 3QZ7A 3KHHA 2HS4A 3MM5A 5I3QA 4KHMA 4CLZA 3OR1A 1TV6B 2A2CA 2Z4PA 3OUYB 1GNKA 3IGVA 4LSZB 2OP5A 1NLKL 2AD9A 1S49A 3NGTA 3TW0A 1UEVA 3QAEA 4G65A 4DU8A 3MTKA 3QQCD 5KFRA 4B3RF 5HMWA 1RT6A 2GZOA 2JEIA 2HEKA 4ELUA 2B7CB 4PUOB 4HI2A 2JWNA 1R8PA 3KG1A 4CLFA 3NCQA 2WCXA 3RUBL 4IG3A 2MKIA 3FQKA 3FNNA 3C66A 4CRJA 4KJIA 1KHVA 2I1RA 4PR6A 4NLUA 4DV4J 3T1YF 4IH7A 4DSFA 1NKCA 4IRDA 4DF4A 2LQJA 1DQ8A 2MDAA 4DUZJ 3ZTOA 1J5EF 5GAEI 3IM8A 5BYRA 4DF8A 3CJ4A 5GAGU 4JV2A 3K2YA 5B0DA 2YNGA 1TKZA 4FP9A 4RU2A 1MROA 5GMEA 2Q43A 2QT7A 5D0HA 1VQNS 4YY3J 3IMQJ 4IUFA 1VBYA 1LW2A 2HRTA 4TY8B 4HDHA 4I2QA 2UUAJ 5J2QA 1N52B 2DVIA 1SC3B 1KLNA 1ITPA 2ALZA 1TK0A 1EKRA 4DV1J 1AUSL 2UZAA 1D09B 4F26A 4B02A 5LJ5Y 2W7OA 2RH3A 2WVEA 5ETVA 3ZZUA 2E7WA 2W8LA 4D3GA 1VQ5S 3EMTA 5AXLA 2IY5B 1TV6A 1SQGA 4FPIA 3MCNA 5L8RC 3PKMA 4EBDA 2QL9B 2V0NA 3OBIA 3VAMA 5ETLA 3OUYA 1RHRB 1RYSA 1S0OA 3I55S 4DDFA 1H7WA 2MQMA 3IO1A 3J7YU 5L46A 1IKYB 4IOBA 4X4SA 4GKJF 2POKA 3QYYA 4TYBA 4PUOA 3H5XA 2J9DA 1VQPS 3BSAA 5CA5A 3C3LA 1PC4A 2AU0A 2VF3A 1YTYA 5KFZA 2HWHA 5HMYA 4J91A 3K8WA 5ETSA 3RB6A 2CQPA 1FESA 4U95A 2QX0A 1HI0P 2VG7B 2B3TB 2XY7A 1W25A 4X64J 2WZ1A 4P9SA 2CPYA 1U7LA 1WTBA 1HNWF 4TY8A 4FYYB 2EK6A 4ZP7A 3D3BJ 2MY8A 2RILA 1NKEA 5EWFA 3NGKA 3JTOA 1KS2A 1YKWA 2JJ4D 2EKYA 4WFBQ 1B3TA 1YDLA 4PQUB 2QMWA 1RWXB 4AL6A 3PW2A 3GB0A 4D3HA 1VIOA 1KQSR 4OI3A 5ITHA 4RNOA 8AT1B 1S9GB 5I3UB 2WB1D 2GVZA 1IR0A 5ETMA 5J1EB 5GAEU 4IH6A 3UW1A 2H4WB 1NJWA 3VGUA 1VQKS 4ED0A 4OYZA 1F5AA 1UETA 3OTOJ 2R9LA 3SCKE 2CDQA 3CCSS 2KM8B 2DNNA 1IKYA 2G2OA 2HGLA 2CA9A 3TYTA 4ZP8A 2RDIA 4Z7YA 1Q53A 1UVJA 2HW3A 4WCEQ 3ZNJ1 5E3CA 1UEUA 2AGPA 4U9RA 1RI7A 1REGX 2OD6A 1KOHA 3D67A 3GYGA 4IOAQ 2VG7A 7FDRA 2RQKA 3HSGA 4ES1A 3UFCX 2J0QD 2K1RB 4WKRA 2FVSA 4EYIB 5FJ4A 5HK4A 1EIYB 1U6FA 3HHKA 3F73A 1AZSB 5A76A 3N01A 3OJSA 1NK5A 2RKIB 1RBAA 2FVRA 2KI2A 4A8OA 1T11A 4OYOA 4F4ZA 1TL7B 1O5JA 3SQOP 1PBUA 1BWVA 3OXFA 3FSXA 2HZVA 4PQUA 2R7RA 1OPIA 3DDIA 1FI4A 2DK2A 3CGIA 5AXKA 1S9GA 5I3UA 2E66A 4GRSA 5E2QA 1V5IB 3Q2TC 1YJWS 1UFLA 5J1EA 4JV1A 1Y9OA 5FDLB 1S6UA 5C2CA 1T9YA 4Y2MA 4F50A 3IA0A 2YY3A 4P2FA 4F3OA 1YX2A 2FTRA 5AT1B 4NASA 2ROPA 2ZVSA 9RUBA 1Q7YT 4F7VA 5IXUA 1ZAVA 3GQCA 8RUCA 3JSMB 1ACMB 4ED8A 4CM2A 4DR2F 4V19X 4P72A 1SC1B 1X9WA 4CT9A 3HSZA 2EK1A 5CCMA 4RZRA 4I68A 4LVOP 4C9DA 2RNEA 2E1AA 1HNXF 2FLPA 3GIRA 1S1TA 3Q8YA 1CQMA 2Z2MA 4AQYF 2BR0A 2VFSA 3R97A 3WX4A 2J7WA 1SI9A 1QVGR 3GG1A 2KJWA 4MK7A 4AXIA 2OFHX 1RTZA 3KLVA 1WG5A 1DLOB 3KG4A 2K1RA 1SCJB 4NRTA 2DO0A 3UQSA 4LMZA 3HKWA 3QRQA 4AUKA 4LR7A 3CDWA 1AZSA 2JOQA 2RKIA 2B5JA 3Q8RB 4F3MA 4LF4F 1TL7A 2WSCC 5C42B 3Q86A 2V68A 3PVXA 2R3VA 2MZSA 2DITA 3AJ2A 2AJ2A 2XI3A 1TK5A 3W8GA 4DCPB 2KFZA 1K1QA 2WOMB 3CIZA 4WFNQ 1B0VA 4QIVA 3MFHA 4YR0A 1JX4A 2Y1IA 2CQ3A 3ILOA 4KTQA 1IM4A 2AEMA 4OX7A 4LRDA 2GO9A 3CUNA 2MLXA 2YQ1A 3ZC4A 3EVMA 1JNRB 2VC0A 5FDLA 1E6YB 3MM6B 1S1WB 2XMVA 4DR5F 4ELVA 5LSOA 3MMAB 4ZJLA 2B7BB 1RA7A 4PWDB 1NEEA 4ECSA 3L9ZA 2MZQA 4ANEA 3BBFA 3CD0A 3JSMA 3W9IA 3RB4A 2ZC3A 1J5EJ 3HVWA 1YVFA 1WELA 1AROP 1ZYQA 3KKFA 5F8JA 1KLMA 4I56A 3CMAS 4O3NA 2QLFB 4NLRA 1XNRJ 2KL8A 1WOPA 3T6JA 1F9EB 1HBOB 3DU5A 3GSDA 2OEJA 4OZ1A 1VQLS 1H0HB 3LWMA 3EM1A 3LH2S 4KGKA 3DHWC 2Q66A 4X4QA 5HVHA 4C6AA 5SZTA 3G71S 1DLOA 3TI0A 3OFHA 4DR6F 2J9CA 1O0PA 4U6PA 4MKAA 2NSCA 3VAFA 2JC0A 5D8HB 5B7WA 3BN4A 3SCIE 4WXOA 3X3UA 4R25A 5CHCB 4TQSA 1NSKL 2N3LA 5DLGA 4LBIA 2JC1A 1B70B 1VYAA 3HFVA 4OI2A 2VPZB 1HQUB 1R27B 4ETXA 3AD8C 1UW9A 1T03B 2D3OR 4DS4A 3UR0A 1J2VA 3ZTPA 2WOMA 2UVWA 3MGJA 1M5HA 3H59A 4YR3A 1SC4B 2DNHA 4F0HA 4I0WA 2YKOA 2V63A 3Q8PB 2ZOFA 2JX2A 3W1YC 3R6LB 2A3JA 3R1HA 4I2PB 1TUVA 4OJ1A 4W98A 1YSJA 4YN3B 5ETRA 2Y1JA 3MPWA 3PNIA 2MB0B 3QGIA 1E6YA 3MM6A 2IBOA 3QZ8A 1BQNA 1S1WA 1OY6A 4CO0A 3MMAA 3VALA 2V5HG 2N82B 4PWDA 1FDAA 2HQFA 1Q79A 2GIFA 3MAHA 3ISNC 2YNIB 4KSEB 4LSLB 2FVQA 3BO4A 5KOWA 5GVQA 4UQTA 3RAMA 3T41A 4QZVB 4EI2A 4DR7F 2ZITA 2MLYA 3C15B 4A8XA 2FVPA 3D2WA 4LF9J 3FCWA 4TU7A 2CZVC 3L7UA 3A12A 3W64A 1HBOA 3FBCA 2FZCB 2RE1A 3PX6A 2XNRA 3GILA 4K4VA 2C28A 1KQGB 3THTA 5D4PA 2RQ4A 3KJNB 3PCOB 3NMAA 1WACA 2CPDA 3AJ1A 2KXHA 3TUIC 1B0PA 1GEHA 3PEJA 2MSTA 3DM2B 1U1MA 1VCTA 3MCOA 3HHLC 1U2RA 4ZVFA 1NCLA 5KG7A 4MYUA 4YHHJ 2O01C 3PJWA 1HQUA 4LIWA 1MNEA 2ERRA 3CCRS 1T03A 4ZVHA 1AW0A 1VHIA 1R89A 4K0KJ 4KPCA 1XR7A 3QATA 3R7SB 2C3YA 1SVDA 1NBEB 3R6GB 4K4ZA 4JI7F 3H4BA 4LSNB 2BJDA 1V5VA 1FF2A 4I2PA 5CD4A 4HH0A 1X0FA 2ZOMA 1UP1A 1H2TZ 3GJTB 3TNVA 4RU9A 5MLCV 1X7VA 4A8FA 2HNZB 1T3NA 4K50A 2PI4A 3KG0A 1M90T 1WNEA 1L3VA 4L75A 3PYFA 3P49B 4DUYF 2YNIA 1Q86T 4LSLA 1DJ0A 5ADZA 3KJFB 4NX9A 4U7UK 1UZHA 3GP9A 3C15A 1HWKA 1FDDA 1XJWB 4QOTA 2CADA 1HPZB 2BDPA 2NLWA 1D9AA 4EZ9A 3QSIA 2GJ2A 5E3PA 1TZ0A 1X0PA 1P8GA 1QDUB 2HHWA 1WC1A 4HT5A 3GIIA 2QYGA 4Y6IA 2O66A 4E8UA 2DR5A 2LLZA 4G1IA 1XMOF 3PXGa 3DM2A 1DHMA 3BDPA 3M2RB 3W5YA 2VPYB 1RCOB 1R31A 5HATA 1HHTP 1HR0J 1TKXB 2DNMA 3GIKA 2IIHA 1SUQB 1GTHA 2XYGB 2LP4A 3HHLB 4FVMA 3N0VA 1X4EA 3WIUA 2RIJA 2R2SA 5C2GA 4CTAB 3QIPB 2PFDA 2HFOA 1ZM2A 3FEYB 4XDDA 3MAQA 3ONQA 2UVUA 3TZXA 4AL5A 2XS5A 2Y0SD 4N41A 1Q1KA 2HFSA 3IBFB 5GMDA 1N5VA 4Y28C 3MCSA 4LSNA 4DPTA 1TKTB 3MD1A 4MJKA 2OD4A 4AL7A 2HHUA 3PX4A 5C24B 2B0GA 4Z2XA 2CNNB 1Y3KA 1LXJA 1IBMJ 1FRMA 2HNZA 1FE0A 2MZTA 3K89A 4QU7A 2HVHA 4MIBA 1N0UA 3AB2B 3V6JA 1OMSA 2KT3A 2KT5A 1RHJB 3RTVA 3CSKA 4FF4A 4HDGA 3UCZP 2ACYA 1XR5A 1UJ5A 3M1VB 1HPZA 1VFJA 2HIQA 5HL7Q 4WZMA 1BQXA 1RAEB 2E1MC 1I1GA 3DRPB 2KRBA 1XMQF 2HHPA 3M8WA 3O8WA 1LQ9A 2W4CA 4DLEA 2AZ1A 1SKSA 3N79A 2XQCA 4OMFG 4C0HA 2F63A 2LEAA 1RTIB 1X4AA 3M2RA 1K9MT 3FMWA 2AX0A 2PA8D 4OYWA 4M94A 1TKXA 4FF2A 4RBTA 3NEKA 1HL6A 3B8HA 1D8YA 1QVFR 1SUQA 1XERA 3KDNA 3HHLA 2W9BB 5K20B 2HHSA 4CTAA 3QIPA 4DV0J 2HAIA 4L73A 1ULRA 1RADB 1KVKA 5I42B 5D4LA 1YJRA 1X4HA 1UW4A 3N5BA 4PCQA 1TKTA 1DFDA 2CNKB 4ILMA 2UUTA 4RW4B 4IOCQ 5C24A 2Q6BA 4OYXA 4ED3A 1PO6A 3EZOA 1NPKA 2XY6A 1F3VA 4ZHRB 1C4CA 3A3NB 2ZJPQ 1NNDA 3QLHB 1R0CB 2XCAA 3KTQA 4M95A 2E5JA 1U6BA 2HRUA 2H5EA 1JQGA 4NLGA 4KH1B 5JMNA 4EUVA 3SYZA 2E29A 1VQMS 1IVZA 4DR6J 4FF1A 3M1VA 3CXCR 1NJZA 3R5AA 2Y1LB 1EARA 2OO4A 4OHWA 2ZWOA 4ZJOA 4OJGA 3DRPA 2K3IA 2DNPA 4F4XA 1FRHA 3V6HA 2R7UA 4JI4J 3UR3C 4NLXA 4NXMF 4WJBA 2B56A 1SXLA 2UXBJ 1LWCB 2JFKA 2ASDA 4Y2CA 1RTIA 4CDIA 4KB7A 2LFVA 1ICEB 4ZJQA 3SCLE 2X1AA 1N5YB 1QTMA 2CPXA 2RUSA 4OJ3A 3TZZA 3ZZOA 4KYZA 4J9KA 2W9BA 2U2FA 2LA6A 3H2VE 3X1LB 2FGOA 3OR2A 3DGVA 2WBMA 2V8HA 4DQIA 3C16B 2XSJB 2C3PA 4ZLNA 1HMVB 3V81B 2CQ4A 2NR0A 1EP4B 4O3OA 4C8MA 4X66F 4RW4A 4LR9A 1XR6A 3DCAA 3L95X 1RP5A 4LQ9A 2F3JA 5T7LB 5B0BA 3CCVS 1FK9B 4ZHRA 1JJHA 3QLHA 2GMLA 1NU4A 2W9AA 4ECYA 1NUEA 1S6OA 3S8SA 2F4VF 4X4NA 3MOZA 2BRKA 3M8QB 2AWZA 1N34F 4B9NA 2E1PA 3ETOA 2DEIA 2ASLA 1K0TA 2VZ9A 2LU2A 1S0NA 4U67Q 3PO5A 1C2PA 2G1DA 3NGRA 5LMNJ 1WC3A 4CT8A 2QJ3A 3BB5A 4F25A 2VQEF 1LWCA 5DZ6A 4XO0A 3DYAB 2IDLA 2V8VA 2H51B 4CH1A 2HLTA 2XEXA 1CPZA 1FA0A 4YDDB 3T5JA 3OLBA 1KTQA 5KT7A 4WP3A 4OQJA 1N5YA 1LXNA 3ENWA 3SSQA 2FPHX 3TAPA 2R8JA 1PSDA 3CWJA 1HNIB 2I5JB 2X1FA 1KFDA 3MR6A 3HFZB 5D3GB 5KG6A 4C8OA 3C16A 2XSJA 4KKOB 3SMZA 3R5GA 2V2QA 1HMVA 3V81A 4YS2A 5BYQA 1C4AA 2HGNA 4DQPA 1EP4A 2HVZA 2VL1A 3BREA 5B09A 3BGRB 2BVZA 1N54B 5T7LA 1IBCB 1RACB 3WIVA 3RAXA 1SL0A 1FK9A 1TUWA 3M8ZA 1S6PB 1VI7A 4B9UA 3FRYA 4DSKA 3A8JA 2PIIA 2M70A 3L3CA 5CYQA 5IQQA 3G9CA 2WVCA 2NZ4A 2F5GA 1M5OC 3AA8A 2HLUA 4DV7F 1YQHA 3M8QA 5DRKA 1RAOA 2E5HA 3NWGA 2DEJA 3SSRA 5EUHA 3M30A 5HJYA 2ASJA 2ZM6F 3P45B 1S7IA 3A8IA 4CNZA 4RPFA 4UY8T 4C8NA 4TVAB 2ZH9A 2DY9A 1Q81T 1SJFA 5IT9Y 2UU9F 2QGFB 1KVJA 2ABYA 2N3OA 2PN6A 5D15A 3AH6A 5G4DA 1NDLA 2QA4S 2FQQB 3DYAA 4HL9A 4NCBA 3WC0A 4USMA 3Q2SC 3GYXB 4DS5A 2VA2A 3GPAA 5KFQA 4JI3F 4CCHA 4FXDA 4NLSA 5KT3A 1HNIA 5KT5A 1G3OA 2I5JA 4KGVB 5J2NB 5D3GA 2YWGA 2DR8A 4KKOA 1WSVA 4DBQA 4KAIA 4I1TA 4B3OB 2EW9A 4LFAF 1FEEA 3TANA 3KJVB 4RO0A 3QRRA 1HI1A 2R7VA 3QT6A 1HYSB 3TA0A 1UWBB 2IBKA 1S7HA 3BGRA 3DGPB 2V94A 3GFHA 1B7FA 4L72B 3HHLD 3J81Y 1XK8A 1S6PA 4RWWA 3R5BA 4JI6J 4YUDA 3PG9A 3AD7C 3DLJA 3SDEB 4QWDA 3ILJA 3QT5A 4ELTA 3Q8UA 1JLBB 2YBVA 2NUHA 2AV5A 4TLRA 3WQPA 2W4DA 1VBKA 3NLCA 4LF5J 5KFNA 4IRCA 2XMWA 4NOHA 4CYUB 1HBUB 3ISZA 2WHOA 2M7SA 2GMJA 1VQ8S 2VUGA 4HH1A 2BJ8A 4DR3J 1V3ZA 4ZPAA 4LF6F 2BQRA 1Q8KA 3IWLA 3ZFVA 1S9FA 1DARA 1IKXB 2FLOA 3PW5A 3D1HA 2C2NA 1CVJA 4DR1F 3E8OA 3AOBA 1XMBA 4ECVA 5KFSA 2N7YA 3LO3A 4CO5A 3D1OA 2MXYA 2EC0A 3IWXA 1UVLA 3PW7A 2NXCA 5J2NA 1FXRA 4EWTA 2ZHBA 4CO4A 2YPYA 2WBRA 3A4TA 1X5PA 3BPDA 2AKWB 4GO5X 4B3OA 2FC8A 1RU1A 2BACA 3H98A 1Y5LB 4PG7A 4IDKB 3KJVA 2D1CA 3EDQB 2J76E 1HYSA 5CD4H 1VRUB 1UWBA 4R0JA 3W5XA 4DXLA 2RHQB 4X4TA 2CIMA 3T19A 1CJUA 2V9KA 2W7PA 3PHTA 3JQJA 3U27A 1LFPA 4NE9C 4DSJA 3BKTA 5U47A 1UVMA 4UY85 5JUMA 1TL5A 3SDEA 4BWJA 4X4PA 5CABA 1T05B 4NPOA 3UN2A 1D8ZA 3TZYA 2OELA 4DL3A 5D0GA 2QFJA 1PYSB 4CLKA 5IV3A 1JLBA 4OHYA 2EFOA 4BS2A 2XYPB 1U47A 5BR8J 4HEA9 3SFGA 1YHQS 1VQSA 2W2QP 4MK9A 3QIDA 3CJSA 5E3RA 4UOCA 1TAQA 4PXCA 4CH7A 4CYUA 3AHPA 1VC6A 5K8PA 2XZWA 2MKKA 2B6AB 4BC7A 3OT9A 4CM0A 4ECXA 4MMOA 2HQGA 1KN6A 1S0VA 4F8RA 1IKXA 2V67A 1FJGF 1YBUA 4H4OB 1LOUA 3EJMA 4ZLPA 2IAJB 3KLEB 4X66J 4C3LA 2ZH7A 2NPIA 4ZPTR 3HFKA 4O44A 1JJ2R 3JTPA 2V50A 2QLXA 1OY8A 2P6TA 4LF7J 1AFJA 1CSJA 1C0UB 2AQ4A 4C7QA 1DTQB 2GQQA 2L3MA 4YB5A 4DL4A 1HWJA 4JI2J 3Q24A 4IDKA 1H6KX 4RW9B 1VQ9S 3Q83A 1VRUA 4YB6A 1FKPB 2XMMA 4ZLJA 2XLKA 1R8CA 1U48A 4N5SA 1G4CA 3Q8QB 1Q7LB 2RAQA 4CZCA 3CDAA 3IM9A 3UDCA 4ALZA 2KT2A 4LFBF 4HT7A 3G8SA 3I56S 4NLWA 2W2MP 3TUPA 5DGAA 4CIOA 1H74A 2VHGA 3TOQA 4LUBA 5A2QU 3VVUA 2OAUA 1O8BA 2ZJQQ 4QIWD 1WEZA 4O0NA 3MURP 2R8KA 3JAMU 4TKTA 2QE5A 1NK8A 1N6QB 4L76A 4F4AA 3OHAA 3UDLA 2MQPA 2GIRA 2B43A 4DPYA 2B6AA 7FD1A 2HURA 3OL8A 1DBDA 2DD8S 2IDEA 4A8WA 4C8KA 5A8WB 2JDJA 4OX8A 4RNHA 2QEXS 4H4OA 4ED2A 3KLEA 2GHWA 2PA3A 4JI5F 2IA6A 1YGYA 3VAJA 3VR1A 2BKPA 3CB4A 3LTOA 3TRGA 4LF1A 3J7A1 4QQBA 1C0UA 5HQ8A 4FBUA 1DTQA 2LQ5A 3NGDA 3UVJB 1FX2A 4RW9A 3QNWB 4DHVA 1X4DA 5B0EA 2OJ3A 3I9ZA 3GFZA 3MM9B 1T9VA 4DX7A 3NWRA 2ZOGA 3C6TB 4N7TA 1GXLA 3BSNA 1FKPA 2QA4G 4QCLA 1CJTB 2CXEA 4B3TF 1M1GA 3W8PA 2BUNA 2DISA 2XHWA 3S1TA 2MTLA 3CO9A 3PDNA 2CWKA 4USVA 1DAXA 4RX6A 2NYIA 1R7IA 1UEKA 4O0IA 1FRLA 2MY7A 4J90A 3FBBA 1IBKJ 4J9SA 3KOAA 2HKEA 2I8EA 2ADCA 4C8YA 1FTCA 4OYMA 3M05A 1N6QA 4ECRA 4G1QB 4B9LA 3HP6A 1TP7A 1RT2B 5CYJA 3PW4A 3KFWX 2FJVA 5A8WA 4X4OA 1MMNA 4NYZA 4ECQA 3HVTB 2IM1A 2BMBA 1XQIA 5AE3A 2BKOA 5A2QY 4ED5A 4DV6J 4LFCF 1J27A 4E0DA 2ZJRQ 4B9VA 3P8BB 2J7UA 2R8GA 1TMMA 3CULA 5IFMA 3H90A 4GC6A 5CXTA 2OMLA 1NSAA 3JAMY 1GK8A 1B99A 3DOKB 3DRXA 3V2UC 3H5SA 1A7GE 2XS7A 2RS2A 3UI3A 3HVRA 3DLBA 1JLCA 4HHHA 3UVJA 5M2PA 4R5PB 3JSBA 2OPSB 1IBLJ 5IC4B 1T9XA 2R7WA 2CNOB 3MM9A 3JXOA 3C6TA 1CJTA 2GW8A 4ZCIA 2EC2A 1VQYA 3DLLQ 5F41A 1QSYA 4J5OA 2CQBA 2E9ZA 3CE8A 2WVFA 2AZ3A 4EEYA 4CLYA 3D28A 4FBTA 5CZXA 3RAQA 2HHHJ 4U7UD 1R8BA 2C3MA 1SJRA 2B4VA 2XY5A 4G1QA 4NLOA 3LP2B 1TFWA 3Q23A 2WONB 1RT2A 1VMBA 4Y2AA 2VASA 5F3ZA 3KLHB 1QAYA 3R5JB 3UO0A 2KN4A 3QGGA 4NLPA 1PJ5A 3D4JA 5CCLA 5F8IA 3HVTA 1ZTWA 1XNQJ 1S6QB 1VGYA 4DV5J 4ECWA 2OPRA 4DV2J 1NK4A 5FLXU 4M5GA 4DV4F 3E01B 4IH5A 3EPIA 4WYLA 1KC8T 2DB1A 1QE1B 3H20A 2M3DA 4W92B 3MDFA 3HHDA 4DUZF 3DOKA 3CPWR 2UUBJ 1X9MA 3UD5A 4OV1A 3B82A 1Y10A 2E44A 2HNDB 2GS8A 1N5SA 4OHXA 1F2GA 2FD2A 4NA3A 4P2XA 4XK8C 4OHZA 4R5PA 1OIAA 4YY3F 3CDEA 2OPSA 4N8OA 2G2YA 3C2PA 3F56A 4ZVOB 2UUAF 2LQBA 2HG4A 4ZVPB 1S1UB 4WU3A 1Q8BA 2Z30B 3B6BA 5LMUJ 1FWLA 4EYHB 2DXEA 4DV1F 3CJKB 1LKZA 1FWKA 1WHYA 3I87A 1FVQA 5I4MA 3RRGA 3EXCX 2VBWA 2RHSB 5IM0B 2EBGA 2XBPA 2ZEJA 2SXLA 4CH0S 1N33J 1JLFB 1CBKA 2DO4A 4F67A 1P9YA 3ZTSA 2H48B 2D7SA 2ZD1B 2N4CA 1SB6A 2J0XA 1FJGJ 4KHPJ 1GTEA 2Z57B 1WF0A 1H2UX 4DL2A 3LP2A 4ZN3A 1NDCA 2WONA 2OTLS 2W9CB 1UAWA 1CQNA 1TL1B 3KLHA 3MUMP 4PG6A 1XBWA 3WDOA 2DR6A 3MR5A 3G87A 3G6XA 1QJHA 1S6QA 3CCTA 5AE1A 1EAYC 3BYRA 3CT9A 1UA0A 4FYVB 3A13A 2UUCJ 2CUYA 5KFEA 3OQ2A 3E01A 2R7XA 5J2MB 3IG1B 4C11B 3T1AA 3M8PB 2Z8QA 1QE1A 3R2DJ 3FJ2A 3L09A 3IBWA 3D6MB 2LKZA 3TAMB 1ZZFA 3I5AA 2O67A 3DLKA 2ZH8A 4X64F 3HXMA 2W8KA 3MAAB 3VVTA 2X7IA 1IR1A 1WHXA 2IJNA 4ZPVR 2UUWA 1RXOB 1XN9A 4G6VB 1UFKA 1S1UA 2ALYB 3RW7A 4J9OA 1VK3A 4ZVUB 3CJKA 4HHUA 2CJAA 4EK2A 2G0CA 5IM0A 1RWNB 3EVOA 5KFOA 3MPUB 3FBEA 2FY8A 2XGQA 3MWBA 1R0AB 4HTJA 1JLFA 2IM3A 3CJTA 3CEDA 4QYZJ 2R7TA 4WKYA 2CZ9A 3CMQA 2QMUB 4K5RA 1SC6A 4ZVRB 4Q8EA 5HROB 3EUNA 4TYAA 3OTOF 4Q43A 4QWEA 1QLNA 2ZBRA 1CG2A 1X31C 4M5MA 4ZPWR 2W9CA 3KDOA 2DH8A 4PQAA 3DXBA 3VF0B 1S76D 1S77D 3D66A 3MD3A 3NG8A 1IM6A 1BMQB 4C3KA 4QR1A 1HWUA 4WP8A 3CJRA 5J2MA 3IG1A 3PZPA 4C11A 2EFQA 4BWMA 3QBCA 2ZHAA 3ENVA 3IFEA 2XB2D 3BM7A 3RR7A 2AYEA 3TAMA 1HQEB 2KDOA 4HKQA 2JLGA 2N4DA 4ZIWA 5KFWA 2CDRB 1IN0A 4UOGA 3MAAA 4R0EA 1RKJA 1HBMA 2DBBA 3K17A 1N56A 5B0CA 3ULHA 4ZIVA 2GFFA 2NSBA 3JS9A 5CZVA 2BXJA 1A6LA 2YQ0A 2XO6A 1S1VB 3ADAC 1X60A 4ZDNA 4PXBA 3OR1B 5LXRA 2HGMA 4USTA 2CG8A 3MMBB 2JNJA 3I82A 3U02A 3QAUA 2CYYA 3NY0A 4M5NA 3O5TB 1BHNA 4DEZA 1WHVA 3QFWA 3PIOQ 2BE7D 4C0BA 4P10A 1BWEA 1R0AA 3SIPB 4I67A 4DL7A 2QN6B 3Q22A 5H9EJ 4WIQA 2F8EX 1D0EA 4PZVA 1NH7A 3PJ9A 2QZ8A 4B08A 1RHMB 1Q5VA 1YRXA 3AXMA 3GZ7A 2RRBA 2FHJA 3DRSB 5IZHA 3KK2B 5HMXA 3CCWA 2YKPA 2VB6A 2M8DB 4B3SJ 3NS6A 1TK8A 4V1Ak 5THWA 5F8NA 4OZ2A 2DXDA 5ETNA 2NXNA 2JLEA 3MF5A 3UD4P 3GWCA 2BA9A 5HMZA 3K5MA 2IM2A 3ICLA 2FB0A 1BLUA 2CQ2A 4ZCLA 2YKAA 1HQEA 4ES3A 2A6OA 1UFWA 2ROGA 3NOGA 3N5FA 3CMES 3FEZA 1VISA 2W01A 4LR8A 1S1VA 1OWXA 2BBEA 5LSLA 2JLFA 2OSRA 2Z2YB 3BKFA 3MMBA 1QUPA 1X5TA 4NXNJ 2DRDA 2ZHOA 4NWBA 2R42A 1S12A 2EEYA 4DI6A 1Z2ZA 2HNYB 1FCAA 2G0JA 4A46A 2GC8A 2EXUA 2P5VA 5ETOA 1GXUA 5DDOC 3CCQS 2J9DE 1RUSA 1K73T 2VH7A 4F36A 1RCXB 4FXVA 4WK3A 1Q82T 3M6XA 4WBFA 2C3UA 2Y8WA 2BEFA 1X4BA 1GMVA 1JJ4A 1Y5NB 4DLGA 1LFWA 3DRSA 4K4SA 3QT7A 4B9MA 5DLFA 2QYCA 2IRXA 1UA1A 4P73A 1NDPA 3S01A 3KK2A 4DZDA 1VQ7S 3K5LA 1WJ9A 2UV8A 1XNRF 6FD1A 1Z2LA 4B3MJ 4P74A 2RQMA 1RB0A 2HFZA 3V5RA 2CVIA 4JI1J 2YWHA 3GV5B 2WRMA 3QWUA 1U2FA 3I0RB 4I6WA 2V2KA 2MGZA 2ZH3A 1KHWA 4ENOA 4IO9Q 4OFZA 3PX0A 3RB0A 3I31A 2GAHC 3B4MA 4DOZA 2MJUA 1SPBP 1ZS6A 2B9XA 3UN5A 1I6JA 4ERDA 3KXDA 1FVSA 3NBPB 1T02A 1F3FA 3H8YA 2FIUA 1HD0A 2ZKTA 2HBZB 1RTJB 2GVZB 3CCJS 2HHQA 4FDFA 1SJ3P 1QAIA 2OPQB 2V6AA 3LPYA 3S6EA 2D9OA 4QPXA 4ZPBA 4QIEA 1S57A 2HNYA 5KAKA 4Z37A 2Q6CA 3OSNA 2V2VA 5L9NA 1U02A 5KFBA 3CJ0A 2DHGA 1UZDA 2AEJA 5DM6Q 3GU0A 3N6NA 2C2DA 1HD1A 2KG1A 2CPFA 1YJ9S 3K7RA 3PR5B 4CLWA 1S4EA 1N4LA 4ZMMA 3BBCA 3VQSA 4CLUA 4WK1A 1FFGB 4F2RA 3HSDA 2V34A 2R7SA 1S97A 4PG4A 4GVLA 4ZVEA 3D0HE 2HQ3A 1FXDA 4LF9F 3LQVA 2CQGA 1NXIA 4QU6A 4CLTA 2QA2A 3C6UA 2CKWA 3TAQA 3BO2A 2DGQA 3I0RA 1FRIA 4LBHA 4DPUA 2P9CA 1T95A 1VBXA 2JEJA 3ETMA 1IXKA 5E7OB 3D0GE 1RT4B 3NBPA 3EDRB 5RUBA 2LCWA 5KFJA 1TFYA 4N47A 7AT1B 2I2YA 4YHHF 1N5QA 3R5CA 1RTJA 1H2VZ 1OS5A 1Q95G 2YH0A 4Q5VA 4K0KF 1WEYA 3QMQA 1Y7PA 2OPQA 5G0RB 4DSIA 2E5LJ 5M2UA 2W2PP 1U8SA 3RW6A 4PXDA 4QYZK 1KVIA 3RBXA 1PBAA 3K59A 3UDVA 3TVKA 3OVBA 4KGXB 4O3SA 4CO1A 3NOCA 5GADI 2FHKA 1B7YB 2GVDB 4XPEA 1OSCA 1S99A 3R3TA 3M8RA 4IR9A 4CP5A 1S1TB 3T3FA 3RBDA 1EZZB 4X4UA 3VAIA 3AQPA 3IRWP 4OZNA 4K5SA 3HJVA 4YP3A 2A6MA 1JKHB 2GAGC 2HK2A 3VGVA 2C3OA 2HHXA 1U8WA 2XMUA 3PO4A 4O4RA 3K57A 4WFAQ 2RDJA 1K0VA 2LXUA 1UVIA 2B5JB 1PIEA 4NA2A 1GH8A 4USJC 4JB8B 4XTTA 4ATNA 1TVRB 5KFUA 1EQMA 2KXFA 1YITS 2VC1A 1URNA 4PYAA 2ILYA 1URRA 3OL7A 1S48A 2FHJD 1HFEL 3FRZA 1QY7A 1KFSA 1FTRA 1HR0F 1RT4A 2A18A 3FMBA 1M5KC 1FNOA 4QW9A 4C48A 2QV6A 3BS9A 4I6YA 4C4WA 4DG1A 3NS5A 1Q4RA 2DGVA 2V8DA 3MEEB 5DO2A 1B64A 2COLA 3ET6A 5G0RA 3AB4B 4L6V3 4MH8A 4OYIA 1LV5A 1BQMA 2B8PA 1S1XB 5DJBA 1NK7A 1FO1A 3BH6B 1Q0NA 5H9EK 2RU3A 1YJVA 2VJVA 3QJPA 3CC4S 2GVDA 2HBRB 1KLMB 1IBMF 2CPJA 4CO3A 5HP1B 1L3KA 2RVJA 2BQ3A 3CVKA 3ZZPA 4NYOA 1RT5B 3GIJA 1RAFB 1JKHA 2FDNA 4WFYA 4KQZA 3CJ2A 2OSQA 3D3CJ 5MAOA 3QJJA 3OVAA 5KFGA 3ITHB 3BSOA 4WFZA 2QSWA 1ROFA 2XGPA 3QFHA 2MLZA 4ZVGA 2LEBA 1NK0A 4TLQA 4J9RA 1TVRA 1D9FA 2ZC4A 4P2MA 1TKDA 3SFUA 2ZZTA 3DC2A 5GADU 3SV4A 3CCZA 3BDEA 4ZVQB 1SKUB 2NUUG 2R2TA 3FVYA 3D68A 3A3OB 2DHAA 5KG3A 1Q16B 1L3TA 2XO7A 5KOXA 3JYTB 3WBZA 1S59A 2ASYA 2K2PA 4DV0F 3FKBA 1SH3A 1BQNB 1JIHA 3MEEA 1SH0A 1ZBTA 1ZZNA 2R2RA 4XDCA 1OYEA 4M1KA 2JSXA 3VGSA 1S1XA 3GONA 2RRAA 3DDKA 3T5LA 1F6TA 1AB8A 1NSQA 5HP1A 4ED7A 2B4PA 4DMZA 2HS0A 2XMAA 3ZTQA 1VLYA 1UKUA 5EX3A 3TQEA 3RRHA 1RT5A 3MEKA 1V9OA 4CI0B 2XHCA 3UE2A 1AA1B 2ZFHA 1K44A 1TL3B 1GXTA 2W2OP 4MKVA 3UCGA 4X65J 2GQ2A 3NAHA 3EZ5A 3J80U 3RB3A 3ITHA 3PIPQ 2DHSA 3P5BP 1W2BR 4GKKJ 1NPPA 1PILA 2HS3A 2DR7A 3VHQA 1RABB 5D4NA 3THPA 4JI4F 5EX0A 4FNIA 4ZP9A 2UXBF 3CD7A 5L1KA 4OV6A 3O44A 1WOOA 3M7VA 5CH7B 3BJYA 5E41A 2L9NA 1FDBA 2WW8A 3KK3B 4DQSA 1DTTA 1HNZJ 3R8YA 4ANDA 1CLFA 4IFYB 1IJEB 3W2VB 4J9PA 2MKCA 4DN0A 5LJ3Y 3JYTA 2BJ9A 3LWLA 2AX1A 4DCJB 2Z2LA 2DRBA 4WU2A 1I94J 5H1SV 4F0KA 2I9SA 4LRBA 3DRYA 1HWIA 3TQ1A 5GMKa 4P75A 3OHBA 2AYBA 2H5IB 3RBZA 2G4BA 2WVBA 2DGSA 1FNMA 1EX8A 3Q8SB 4ZCMA 3U1MA 2IMOA 3IRXB 3IN5A 1MU2B 1VJWA 4ZVSB 1UPMB 1ZOTA 4PPZA 3J81j 1NSPA 4Q0BB 3TO8A 4EGLA 4Q45A 5L9XA 3GLJA 5KTQA 3EWGA 3G96A 3H2LA 2YX7A 4QR0A 3P96A 1TL3A 1ZM3A 2VA3A 4Q44A 1FFWB 4WE1B 1UL3A 4PRFA 5E3QA 2HFNA 1KWMA 5HAOA 2H65B 3NCRA 4HHJA 4AD6A 3FCHA 4UQGA 2ZZMA 3SBMA 5KT2A 1VC5A 2D41A 3CCMS 5LMNF 3BGUA 1WI8A 3ENQA 1CC8A 1YRTA 1XIQA 2W2NP 4DCOB 4ETZA 1GAOA 4ZITA 2HHVA 1PAEX 3P4UB 2VDHA 3KK3A 4C97A 2CQ1A 3PRVA 2ACMA 2DIVA 2EBEA 1VQ4S 4IFYA 5DM7Q 3VQTA 2AGQA 2RS8A 1WDDA 3W2VA 3Q89A 3J80Y 1B4SA 1RJJA 3A8KA 4K59A 5KFXA 1X8DA 5KFCA 2VONA 2AJQA 3MEGB 1N36J 4K4WA 4C8LA 4FN5A 1X4GA 2A2DA 6FDRA 2M2BA 4O23A 1UJ4A 4O3RA 5IT4A 1QSLA 4TQRA 4OX6A 8ATCB 1UJ6A 4I4BA 3GJRB 2PO4A 3QO9B 2DTJA 3IRXA 1MU2A 2J7KA 5KFDA 2YKNB 2LU1A 2AT1B 5K14B 4Q0BA 2VPXB 1P9QC 2J0WA 1QAJA 2PT0A 4Q2LA 4PEOA 1FFSB 4MKYA 2OH2A 2P9GA 1UPPA 1TU0B 1KQKA 3D6FB 2FJWA 5HO4A 1YZ7A 1EETB 2WSFC 1EB0A 4WE1A 3M6WA 1JLGB 1MSWD 3LOUA 1G7CB 1RT1B 1TAUA 1G6BA 3OVSA 3GJSB 3OPKA 4ZKAA 3KHLA 2D3UA 2PE8A 4Y2IA 3PYGA 4JI0J 2IVFB 3RGIA 2M0GB 4F3QA 3GIMA 4GO7X 4N56A 2DH7A 3O1LA 2Y3YA 1MMDA 4LIRA 4DV3J 2PMHA 5JXSA 4Y00A 2VPWB 3PFEA 2NS1B 1U1PA 5I3PA 4NMXA 2GGPB 4PXEA 2D3O1 3H7HB 5IC6B 3R5DA 4MKBA 1RHKB 2DCUB 3H40A 5C5JA 4RNMA 4P71A 4A8KA 1ZPVA 3EVWA 3MEGA 4NYPA 4NLDA 3WHIA 3G86A 4J9QA 4LREA 5LT5A 3NRBA 4C0OC 1GT8A 3US5A 3KUEA 3W60A 1WI6A 2OEKA 5HANA 5ETPA 1H3DA 4J37A 2HVIA 2OHDA 3CJQA 4H4KC 3QO9A 2I6WA 3EXYA 1VR6A 3A8EA 2YKNA 4OZ0A 1FDNA 4DQQA 1X4FA 1DY3A 2KO1A 3KHGA 5K14A 4NLYA 3TR5A 4DR4J 3WX8A 2MQQA 4JI6F 2GJIA 1QUVA 3I4HX 2YH1A 3FSYA 3MUTP 3U1NA 2HWIA 4OI6A 5C25B 1EETA 2G2ZA 4IFVB 2VBXA 2W25A 4ZCKA 2LDYA 3RR8A 1JLGA 3I5BA 1RT1A 2L9WA 5T41A 4QWBA 3JQMA 4USKA 1N32J 2Q3PA 4USUA 4LF5F 2R8HA 5HBMB 2O5DA 1YBTA 3MM8B 2YWFA 4M63A 3G6VA 4LT6A 1TL4A 1RQ0A 2DNOA 4QPTA 1P1LA 3NGSA 4DR3F 3SCJE 2ZH5A 4ZA1A 3GE9A 3I6PA 4KFBB 3OR2B 1MW7A 2H3EB 4RUBA 3MPVA 4J9LA 2UXCJ 4K2XA 1LW0A 4RUCA 2GGPA 5DETA 2C1EB 5HVGA 2HWTA 3MCMA 1T9WA 2EWHA 3EGVA 2BJ3A 4RWXA 3J7AN 4X62J 1AXQA 5F8GA 2GNKA 1KOOA 2YNHB 2MQLA 3EPGA 2F40A 4Y2KA 2AJ4A 5AJ3J 3FK4A 1RYRA 2XLJA 1GQEA 2XI2A 1VBZA 3QWPA 1AYEA 1JLQB 2W24A 1O6XA 4F2SA 2M5YA 4OX9J 3ZZRA
chains in the Genus database with same CATH topology
1Q8BA 3U1LA 3X3UA 4EYHB 4R25A 5CHCB 4TQSA 5E33A 4I6AA 2Y1RI 3EGZA 2N3LA 5DLGA 4XPCA 5L1JA 2JC1A 1VRTB 4DV1F 4OI2A 4X65F 3CJKB 2VPZB 1LKZA 1HQUB 1R27B 4ETXA 1WHYA 5C25A 3I87A 1FVQA 5I4MA 3RRGA 3UPFA 3EXCX 4IFVA 1T03B 4FXWA 2VBWA 2D3OR 4TXSA 2VQFF 2KM8C 5IM0B 3UR0A 1J2VA 1HBUA 4DS4A 2EBGA 3NNAA 3POTB 2XBPA 4GKKF 3SSSA 3H5UA 4LVNP 1BGXT 4YQWA 2WOMA 2UVWA 3MGJA 1M5HA 5JJBA 3H59A 4YR3A 5J2PA 3OTCA 5BR8F 2DNHA 2SXLA 2KZMA 4I0WA 4CH0S 3I96A 2DPJA 4K4TA 2YKOA 1JLFB 4FVCA 5HBMA 4KGMA 3Q8PB 2WTFA 1UVNA 2DO4A 3UWTA 2ZOFA 2VFRA 2ZNZA 2JFDA 3MM8A 4F67A 2JX2A 3TUZC 1WG1A 4OLOA 2A3JA 4AYBD 2VD3A 2D7SA 2ZD1B 3SXLA 2N4CA 2FJBB 1SB6A 3R1HA 4I2PB 1RT7B 1TUVA 2J0XA 1YSJA 4OJ1A 3SZ2A 3T9ZA 1GTEA 3MPWA 3PNIA 2Y1JA 2MB0B 3GMGA 3QGIA 1MWZA 1WF0A 1H2UX 1E6YA 2MYFA 2IBOA 3EGNA 3IR7B 3LP2A 3MM6A 5KG5A 4DL2A 2ATLA 2DNGA 2WONA 1HNZF 3QZ8A 1BQNA 1S1WA 4CO0A 4KFBA 3MMAA 2OTLS 2W9CB 2IVMA 1UAWA 3VALA 4DL6A 1Z1ZA 1CQNA 1TL1B 2V5HG 3MUMP 3KLHA 4PG6A 1XBWA 3WDOA 2N82B 4PWDA 3C46A 1FDAA 5A6PA 3EYZA 3OJUA 3MR5A 4A4JA 1F5CA 1Q79A 3MAHA 1QJHA 3G6XA 3ISNC 2DNKA 2YNIB 1S79A 4KSEB 1S6QA 3CCTA 4LSLB 5AE1A 3MTJA 2FVQA 3BO4A 5KOWA 5GVQA 4UQTA 3RAMA 3W7BA 1U1KA 1LWFB 4ZPCA 3ZZYA 2ZH2A 4QZVB 4QWAA 3WC2A 1I94F 3K0JA 2EPIA 1BC6A 4RW8A 2GHVC 4DR7F 2R4FA 2ZITA 4A8XA 2FVPA 3CT9A 1UA0A 2MMYA 1YRUA 4DFPA 4IQXA 3GFYA 3D2WA 5GAHI 5KFEA 2DRAA 3OQ2A 3N6MA 3E01A 4TU7A 2FVCA 2R7XA 4PPDA 3IG1B 5J2MB 2CZVC 4C11B 1L3UA 3FZBA 3M8PB 3T1AA 5KFFA 5BYSA 4MYTA 4LF7F 2Z8QA 1QE1A 2YNHA 3FJ2A 3L09A 1HBOA 1ZM4A 3IBWA 2DNQA 4X84A 2RE1A 4WIIA 3PX6A 2XNRA 2DJWA 1S0MA 1KQFB 3GILA 4K4VA 1L5UA 2C42A 2C28A 2RF2B 1FXLA 3KNAA 4NMLA 4UW2A 5CYQB 1H98A 2KJVA 1KTVA 2LKZA 1KQGB 1ZZFA 2JL9A 2RQ4A 5D4PA 3I5AA 3TAMB 3THTA 3DFEA 2O67A 3DLKA 4JI2F 5KG0A 3G4SS 3HKZD 4X64F 3HXMA 2ZH8A 2WAQD 3NMAA 2W8KA 4WXWA 2DIUA 1WACA 2CPDA 1G2EA 3AJ1A 2KXHA 3TUIC 1TFWA 2BM0A 1WHXA 1B0PA 2CQDA 3N9UC 2IJNA 4OIXA 4ZPVR 4YDXA 2RUGA 2MSTA 2UUWA 3PEJA 3DM2B 4AXJA 1U1MA 1FD8A 1U09A 1XN9A 4G6VB 3CD5A 1JLQA 2OMOA 4OJHA 1T05A 4V19J 4H4KA 2E5IA 3HHLC 3M30B 2WK4A 1LK5A 1V3RA 1S1UA 1U2RA 4ZVFA 3FZ2A 3RW7A 3HM9A 4IR1A 2GMHA 3UNGC 2EVZA 5KG7A 1SBRA 1VK3A 4MYUA 4J9OA 2EFNA 5A0YB 5J1NA 1VRTA 2O01C 3PJWA 2A10A 3CJKA 1HQUA 4LIWA 1MNEA 5F9NA 1SKRA 2CJAA 2ERRA 3CCRS 1T03A 5DDPC 1SIWB 4ZVHA 4P6QA 1AW0A 2G0CA 2B9WA 5IM0A 1R89A 3POTA 5D4OA 2KTQA 1SL1A 5KFOA 2J5AA 4QYRA 5KFIA 4YEAA 1XR7A 4C2MA 2C3YA 4QWCA 2BANB 3Q0AA 2J6UA 2XGQA 3BQ2A 5E5NA 3MPYA 3MWBA 1R0AB 1Y00A 3GR0A 4K4ZA 4HTJA 2P9EA 1YIJS 1JLFA 2IM3A 3I0SB 4EU0A 4JI7F 3KYLA 1U1OA 3H4BA 4FZVA 3G6YA 4LSNB 4FYDA 3CEDA 4DG1B 4QYZJ 2BJDA 4HI1A 2RRNA 2R7TA 2CQCA 4WKYA 2YVSA 4OI1A 1R8AA 3OTBA 2ZBIA 1FF2A 3GR1A 4G1PA 1U1LA 2HMIB 4I2PA 1RT7A 4J9MA 4WZQA 4HH0A 3W2WB 1X0FA 4K5RA 1SC6A 2ZOMA 4URGA 1UP1A 4Q8EA 1H2TZ 3EUNA 5HROB 4TYAA 3OTOF 2QMXA 4Q43A 3TNVA 4QWEA 1QLNA 2IAJA 4RU9A 5MLCV 2FY1A 1BQMB 1CG2A 1X7VA 3VAGA 1O51A 3T9NA 4A8FA 2HNZB 3B4DA 1RAJA 4ZPWR 2W9CA 2DH8A 3RU0A 2KB2A 1RK8A 4PQAA 3H4DA 3DXBA 1VQOS 2BJEA 3FEXB 5D6GA 4K50A 1JXLA 2PI4A 3KG0A 1M90T 1WNEA 2EFVA 1L3VA 3VF0B 2ZDPA 4R8UB 2L9DA 1S76D 1S77D 3P49B 4DUYF 2DR9A 3L7PA 1U49A 2YNIA 1Q86T 3FDSA 4LSLA 1DJ0A 1WF1A 5ADZA 3RYLA 1LWFA 4NX9A 3M9OB 3MD3A 3NG8A 4U7UK 3DMJB 1LWEB 4C3KA 1HWKA 1FDDA 1N36F 4QR1A 2LECA 4QOTA 1HWUA 5EGYA 1N8RT 3UCUP 1NO8A 1HPZB 5SUHA 2BDPA 2NLWA 1D9AA 5J2MA 3IG1A 4EZ9A 3PZPA 4C11A 1F9FA 3IWNC 2GJ2A 5E3PA 2EFQA 3D1QA 4BWMA 1TZ0A 2ZHAA 2BE2B 3ENVA 3IFEA 1V6HA 2ZH4A 3G8TA 4U7CA 1X0PA 1P8GA 3BQ0A 2XB2D 2GA7A 5D77A 1NK6A 4CO2A 3CCUS 2BW2A 3BM7A 2HHWA 2YNFB 2J6TA 3ZZ0A 4HTIA 2RF2A 2YWKA 3RR7A 4HT5A 2VOOA 2AYEA 3GIIA 3TAMA 1HQEB 2KDOA 4HKQA 5B08A 2JLGA 2N4DA 3E3XA 4Y6IA 5KFWA 2O66A 3U7JA 4E8UA 4DFKA 2LVWA 3P6YC 4WFXA 1IN0A 2DR5A 2DGTA 2LLZA 4C98A 2AYGA 3KNGA 4G1IA 2CQ0A 1XMOF 3CDUA 4R0EA 1RKJA 1HBMA 1F5BA 3PXGa 1U6ZA 1WG4A 1ZM9A 2DBBA 4KC5A 3DM2A 2MHEA 2ZDOA 1N56A 4OL8A 5B0CA 1K1SA 3ULHA 4YMEA 4EBEA 1G1XA 1DHMA 1S10A 1GX5A 1FKOB 2GFFA 2NSBA 3RBEA 2E5GA 1K8AT 3BDPA 1KEKA 5CZVA 4PG5A 3LP0B 2BXJA 1A6LA 1LK7A 3M2RB 1S1VB 3M9MB 4I7FB 2VPYB 1R31A 4ZDNA 3G6ES 4PXBA 5KG4A 3OR1B 1HHTP 1TKXB 5L38A 2NPFA 2DNMA 3GIKA 5A0YA 5LXRA 1KSPA 1B0TA 2HGMA 3HDSA 3MMBB 4MTPA 1DQ9A 1SUQB 3I82A 1GTHA 5AXNA 2EI5A 3HHLB 4FVMA 1N0VC 3N0VA 4A8SA 1X4EA 3U02A 3QAUA 2RIJA 3GFXA 1OO0B 2CYYA 2MQNA 3QIPB 4CTAB 2R2SA 3BGFA 2HFOA 1IBKF 1ZM2A 3FEYB 4XDDA 3MAQA 4Q8FA 3ONQA 4LFBF 3O5TB 2UVUA 4DEZA 4LQ3A 5GAHU 1WHVA 2JVRA 2BANA 3PIOQ 4QW8A 4AL5A 2XS5A 2DGOA 2Y0SD 4C0BA 4N41A 4JI0F 1BWEA 1R0AA 1Q1KA 2RT3A 4HYKA 4QJVA 3M4XA 3I0SA 1N5VA 3LAKA 2ADBA 1PC5A 1SV5B 3ISND 4Y28C 4I67A 3MCSA 4LSNA 4DL7A 1MMLA 1TKTB 4ECTA 3MD1A 4MJKA 2OD4A 4DV3F 3IAM9 3Q22A 4AL7A 2CRLA 5H9EJ 2HMIA 3F41A 2HHUA 2DPIA 3KMQA 3W2WA 2F8EX 3DLGB 3TA1A 1D0EA 2F9JA 3PX4A 3BR8A 5C24B 1U45A 2B0GA 1DQAA 1GX6A 4Z2XA 1NH7A 1Y3KA 2QZ8A 4Y65A 3TVYA 4B08A 1JLEB 1JMTA 1LXJA 1FRMA 2HNZA 2RJZA 1FE0A 1YJNS 1YRXA 2MZTA 3V4MA 4QU7A 2HVHA 4MIBA 1N0UA 3GZ7A 3AB2B 2RRBA 4R8UA 2FHJA 3DRSB 3V6JA 1FE4A 2KT3A 1FHTA 1Z4UA 1KR4A 3NKYA 2K7KA 2KT5A 2CJ9A 2YX4A 2R2UA 4DV6F 3RTVA 5IZHA 3KK2B 3CSKA 4FF4A 4HDGA 2R8IA 1NHVA 5HMXA 3CCWA 3DMJA 2YKPA 4RW6B 2VB6A 3UCZP 4TU9A 2M8DB 4JV5F 1LWEA 3NS6A 3MECB 1TK8A 2MZ1A 5KFLA 4EBCA 2ACYA 1XR5A 5THWA 1SH2A 1UJ5A 5F8NA 2ILZA 4FF3A 4EO6A 3M1VB 1HPZA 2O3DA 2IYGA 1VFJA 2HIQA 5HL7Q 1F0XA 2JLEA 2O1PA 3LF0A 4BBYA 2VG5B 4EO8A 3MF5A 2BE2A 5A8RB 3CIMA 3UD4P 1FD2A 3GWCA 4WZMA 1IQZA 1BQXA 2BA9A 2JEFA 5HMZA 2IC3B 3K5MA 5EHHA 2IM2A 2E1MC 3ICLA 4RNNA 2FB0A 1N5TA 1BLUA 3OTEA 2CQ2A 3O2IA 4ZCLA 3HZEA 1I1GA 2YNFA 3DRPB 2KRBA 3PHEA 1XMQF 2YKAA 2DGXA 3HHNB 2HHPA 2AGOA 1OPZA 3O8WA 2J0SD 1LQ9A 2D74B 1HQEA 1AUDA 4ES3A 2W4CA 4PG8A 2GCFA 4DLEA 2UV8G 1NAQA 4F4KA 1SKSA 1UFWA 1IBLF 2ROGA 4KHRA 3N79A 3I4PA 4RW7B 5EWEA 1S4FA 2KRRA 4OMFG 4A8YA 4C0HA 1ZTTA 3N5FA 4WTYA 4NL5A 4DR4F 2HZCA 2L48A 1VOMA 2PI5A 4Y34A 1IKWB 3CMES 1FKOA 5IQ6A 1U1NA 2LEAA 3LP0A 1RTIB 3FEZA 1X4AA 3M2RA 1K9MT 1S1VA 2AX0A 3FMWA 4I7FA 3TARA 2PA8D 1OWXA 4M94A 1TKXA 4FF2A 4RBTA 2BBEA 2YKMB 5LSLA 2JLFA 2WB4A 4FS1A 5K8NA 2J8AA 2OSRA 2YX1A 3OFFA 3MMBA 1HL6A 4NCGB 2OKQA 2KZZA 1QUPA 1X5TA 3B8HA 1D8YA 1QVFR 1SUQA 1XERA 4P7TA 3HHLA 2ZHOA 4NWBA 2W9BB 3D0IE 1U4BA 4ID8A 4YOEA 5K8MA 2HHSA 4CTAA 3QIPA 1N32F 1ZETA 1DTTB 1X5OA 2EG1A 2HAIA 5JVGQ 3C8YA 1Z2ZA 2HHHF 1ULRA 1FCAA 2HNYB 2DT9A 2X1GA 5I42B 2MJNA 4A46A 5D4LA 3SV3A 1YJRA 2GC8A 1X4HA 2JH3A 2P5VA 4JUZA 5DG9A 1GXUA 5DDOC 3PR4A 1SV5A 1UW4A 3N5BA 3CCQS 2J9DE 3KLGB 4PCQA 1K73T 2VH7A 1TKTA 1DFDA 4FXVA 4WK3A 3HO1A 4YB7A 1Q82T 3CDBA 3PW0A 2XCPA 3M6XA 4ILMA 2UUTA 3H25A 4RW4B 2OIHA 1JWWA 2C3UA 4FNHA 2MSSA 3DLGA 4O44B 4OZLA 4IOCQ 5C24A 3PFOA 3QGPA 2DNYA 2VKRA 2E1CA 2Q6BA 1X4BA 3O6QA 2QRRA 4ED3A 3NCPA 1JLEA 3R1LA 2UXCF 3M2VB 1PO6A 3VZHA 2DGWA 2ZE2B 3TUJC 4DSLA 3VWSA 1JJ4A 2JHEA 2XY6A 3QPIA 4ECZA 5BJRA 1XNQF 4ZHRB 1N88A 1Y5NB 2XULA 3HX9A 4DLGA 1C4CA 1LFWA 3DRSA 3J7ZT 1C1BB 2ZJPQ 4RBVA 3T6BA 4NZ0A 4K4SA 1NNDA 4OHVA 3MUVP 4B9MA 4WYWA 1YWXA 3QLHB 4DV2F 4DV5F 5DLFA 2QYCA 2IRXA 2XCAA