1CC7A

Crystal structure of the atx1 metallochaperone protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
AEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords PROTEIN (METALLOCHAPERONE ATX1)
publication title Crystal structure of the Atx1 metallochaperone protein at 1.02 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 1999-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cc7A00
2RILA 4OJ3A 1N5SA 3F44A 4HL9A 2QLXA 2KKHA 2W4DA 4EFAC 1XBWA 1FVSA 2AW0A 2K1RA 2ZDOA 3HHLD 1JK9B 3QMQA 1N5VA 1TL4A 1OSDA 3HFKA 4A48A 2QIFA 1CC8A 2HFNA 1TZ0A 1Y3KA 1YJTA 3BGUA 3KG0A 1SQEA 2GA7A 2OP5A 2ACYA 2K1RB 3GZ7A 2AJ0A 1N5QA 2VH7A 4YEAA 1AFJA 1N5TA 5B0FA 3I9ZA 2FIUA 2N7YA 2XMVA 1GXUA 1RJJA 1TL5A 1TUVA 2FTRA 2RU9A 3HX9A 5B0GA 4DPOA 1KVIA 2GCFA 1URRA 3QGPA 4HI2A 5IXUA 2LXFA 3TRGA 2AP6A 2BBEA 2ZDPA 1VQYA 2QYCA 2N4DA 2GV1A 3BN7A 1MWZA 1R6YA 2G9OA 2RSQA 4OJHA 3DXSX 4NPOA 5T7LA 3BF4A 1SB6A 2LDIA 4A46A 2LQ9A 2W4CA 2XMJA 2ROPA 2N4CA 2QLWA 3HDSA 4HH0A 3CJKA 1CC7A 5B0EA 3FRYA 5KAKA 2KT2A 2HLTA 2HLUA 4DL0C 1OQ6A 1JWWA 4Y2IA 2IYIA 2K2PA 5T7LB 2HQIA 3MCSA 2XMUA 2BUNA 4A47A 5B0DA 2ROGA 3CJKB 5A6WA 1FE4A 1Q4RA 1QUPA 3HF5A 2CRLA 1AFIA 5F0WA 3MZIA 1Q8LA 1OQ3A 3HHLA 3KKFA 2OMOA 3IWLA 1FD8A 4ZOSA 1P6TA 4U9RA 4ZA1A 1FESA 1WD6A 1V3ZA 3HHLC 2Q3PA 2K7JA 1IUJA 4OIXA 1FE0A 3BR8A 1YJVA 1GXTA 1FVQA 2BJDA 2FB0A 3HHLB 1AW0A 2VV5A 1TR0A 1YJRA 3FMBA 3TNVA 2W4PA 2OFHX 2LQBA 1P8GA 4A4JA 2FHMA 5A6PA 1Y3JA 1FEEA 5B0AA 2XMKA 2HFOA 5B09A 3E8OA 3TOQA 1SI9A 2BJEA 1K0VA 1OPZA 1YRXA 3BB5A 1ULRA 4NL5A 2XMMA 4Y2MA 3VTIA 1CPZA 1VQSA 4FNIA 1S6UA 3FGVA 1Y9OA 2ROEA 1MWYA 1Q53A 1X8DA 3BM7A 1KQKA 1YJUA 3DCAA 4OJ1A 1LQ9A 5F0UA 2OD6A 4QOTA 3T9NA 2OAUA 4FNHA 1YG0A 2BYCA 3LO3A 5K9FA 4HH1A 1KVJA 2XMTA 2PD1A 2IYGA 4DN9A 4Q2LA 1APSA 3IWXA 2GFFA 2GGPA 4Y2KA 2IFXA 3UDCA 4F67A 5B0BA 3KG1A 3WDOA 5B08A 3LGMA 3K7RA 2KT3A 2ASYA 5B0CA 2XMWA 1S6OA 2PGCA 1X7VA 3LGNA 3BDEA 2AJ1A 2EW9A 2OD4A 1X0PA 4YDXA 2GO8A 1U7LA 2KYZA 2GGPB 1Y0HA 2JDJA 2OFGX 1Q8BA 2OKQA 4Q2MA 2HIQA 2L3MA 2RMLA 3KNGA 4OJGA 1W2IA 4HI1A 2K7KA
chains in the Genus database with same CATH superfamily
3LF0A 3PO5A 3CW2C 2J6TA 4AL7A 5E3QA 3BGFA 2GO9A 3N9UC 4ENOA 1S5ZA 3TEHB 3CPWR 3LPYA 5ETVA 1T8EA 4Q0BA 4NRTA 5DETA 2FPHX 3H2LA 2LQ8A 2HHXA 3MFHA 3T3FA 1WWHA 1KOOA 1PILA 3PHEA 1UZDA 3JSRA 3M2RB 3EICA 5C25B 2VIHA 1IR0A 4MTPA 5KFPA 3EE3A 4O44A 5B7WA 1P8GA 4C0HA 2P9GA 2J8SA 4DV0F 1K47A 1CS4A 2NREA 1GH8A 3QWUA 2IMWP 2IJNA 4G6VB 3DLBA 5AJ3F 1KR4A 3H59A 3DGVA 4LUBA 5D4LA 5C2GA 3QSYB 2XHCA 1S6OA 4UQGA 4Q44A 1FXRA 1NH7A 3RJMB 3DDIA 1R0AB 3LGHA 1KD1T 1VOMA 4GRSA 2C42A 2ZOGA 4PQUB 3FK4A 1S1WB 1ZZFA 3R2CJ 4CLWA 4IFVB 1HBOB 3R5DA 3Q8UA 1NDLA 5ETPA 1CG2A 5D0RA 2HHTA 2XGPA 1NB2A 4NLVA 3W9HA 3OUYA 1KNZA 4RBTA 2DIVA 3HHLC 2H9ZA 2IA0A 2OEJA 5GVQA 4Y2AA 1TL3A 3GV7B 5K8MA 5A8WB 2ERRA 3LP0B 1TK5A 1OMSA 1ZAVA 3PYDA 3MM7A 1RTDA 3QJJA 2DK2A 3QGGA 4QQBA 4NI2A 4IFYA 1QAJA 1EETA 5HVGA 1W2IA 4JV0A 4HL9A 4DWIA 3WBZA 5IM0B 3RBZA 4DLEA 2B9YA 2QJ3A 3E51A 2N7YA 3IXQA 4ED2A 3HVTB 1S79A 4DJBA 1TUWA 4Q45A 5G4DA 3IMQJ 5MAOA 4OHWA 2IDLA 2AX1A 4KO0B 2IJFA 1BWEA 4CLKA 4X4SA 5F0WA 3QGHA 3UPFA 1PYSB 2FYXA 1T0TV 4OIXA 2V0NA 3EUNA 1FTRA 2HQFA 2XSJB 3SEOA 2VBYA 1SPBP 2A2DA 4NLQA 5L1LA 1B64A 2Y0BB 3K5OA 5I3QA 1OYDA 1YQHA 5L9XA 5HQ8A 3NGRA 3MEGB 1VS3A 4Y2KA 3DRRB 2RHSB 2V50A 3M30B 3NL0A 2PE8A 5E7OB 3TWZA 1K8AT 4H4OB 1SH0A 2FLNA 3TAQA 1YHQS 4RKUC 2XWXA 2EK6A 5B0FA 1Q7LB 1HI8A 3RBXA 1FJ7A 1TKXA 2OEMA 2IRUA 3NEKA 4ZK7M 1X4CA 4M5KA 2LCWA 3O5TB 3OLBA 3UDVA 2PI4A 4OL8A 4Z37A 3WHIA 1W25A 1YZ7A 2WOMB 1GMUA 1RTHA 5K14B 4TXSA 4F4XA 4U96A 3ITHB 3H20A 4PPZA 2F5GA 2VFRA 1SH3A 2VC0A 3KK3A 3JSMA 1PYTA 3AQOA 2B51A 5HANA 1HKAA 4CO0A 2KM8B 2A6MA 3JXOA 2UV8A 1RCOB 3D1OA 3VVUA 1S97A 1NDKA 2J6UA 3ZXWA 1CJKB 1UWBB 4KGMA 4O3SA 3M8RA 4GKKJ 1FKOB 5JMNA 2LECA 1WF1A 2HRTA 3GCXP 3KLFA 1VQ6S 3V6DB 2HGMA 1OY8A 5HMWA 2ZEJA 5J2MB 1CJTB 3KG4A 5KFYA 3EPGA 1MG7A 3GIMA 2RF2B 3VAHA 2YKPA 2KI2A 4RW4B 5T7LB 5K5MA 3ULHA 2JLEA 1FHTA 2DR6A 5C5JA 2HIYA 3N6LA 2KRRA 2KXHA 3MR5A 3DLGA 3QIPA 4ECYA 1UVLA 2ADBA 4LSLA 1N33J 4DU7A 2ZBIA 3GV5B 1RWOB 2DH8A 2XMMA 4JI8J 1LW2A 3RB6A 4FF4A 4ID8A 1L3UA 3M8WA 1DLOB 2OD4A 2E29A 3GJSB 3RTVA 1GEHA 1HBNB 3JQJA 1RT5B 4ANCA 3W2VA 5IZHA 2Y3YA 3RU0A 2R2TA 1S49A 2ZKUA 1U45A 5EX0A 3MMCB 1DRZA 3T5KA 3K59A 4N7TA 2WONA 5CQGA 4C0BA 4GKKF 3C66A 2N3OA 2ZH9A 3HCXA 4KPYA 4JV2A 2DVIA 1Q0NA 3H5YA 4L3KA 3PYEA 2XZWA 5KFZA 1IKYA 3OJUA 2ZH2A 3D54A 3K0JA 1ZETA 1RAOA 5HVHA 4UOHA 2ZM6J 1YBUA 1Y5IB 4NEYA 1PCAA 3TNVA 1YK9A 4OI4A 1JLBB 4QYZJ 5FJ4A 4AXJA 4YR3A 2R7VA 1N33F 3JB9k 1U49A 2QLBB 1WUUA 3EVOA 1EJ7L 4JI8F 3BKTA 2B56A 4WE1A 5A0YA 2F40A 4DHVA 2OKQA 3R6GB 3SCKE 3CJ0A 2BW2A 2G1DA 2K1RA 2HBRB 4J91A 2UUWA 3CJQA 2KG0A 2C2RA 3DMJB 4XTTA 2OP5A 4USHA 4M5MA 2R2RA 2VG5A 1EX8A 2J7WA 4HI2A 1IKWA 1VQYA 2XYGB 4C11A 4PG8A 3NGDA 1UFKA 4NE9C 1VQNS 4MMOA 3D68A 3OR2A 4O3QA 1VQMS 3L7UA 5GAGU 3R2DJ 2B9EA 2V8VA 1OJ4A 5MLCV 1OQ3A 3UCGA 3NGKA 3QO9B 3SFUA 3DRPA 3G4SS 2OUGA 4U9RA 3VR1A 5KFWA 2J0XA 2C3UA 1FTCA 4NCBA 1GQEA 1IJFB 2YPYA 3BR9A 4X65J 2ZM6F 2ZHOA 1UMJA 4C2MA 2Y8YA 2V2VA 2GVZB 4O4RA 1WELA 2VOOA 3KK2A 1KVJA 3C14A 3KJNB 4C8NA 5KFMA 2RUGA 4F4WA 2CDQA 3KLGB 1I5OB 4PWDB 2DNHA 4CM2A 2DITA 4ID5A 4OYPA 5JVHQ 4CO4A 4ED8A 1SJFA 2BW7A 4M8LA 1WI6A 1SKSA 1XBWA 3NMAA 1AUDA 5KFFA 2M2BA 1TTHB 4OYMA 3QLHA 4KY3A 3BGRB 4R8UA 1QDUB 4DFMA 3IBFB 3H2UB 5HATA 3AOAA 1OIAA 3PV8A 2HHHJ 5DM6Q 4NLGA 5KT4A 4P2XA 4LQ3A 4KGKA 3JTNA 3QZ8A 5DGBA 2V67A 5HI7A 3K57A 1WEXA 4Y2IA 1SL2A 3CDBA 2IC3A 1E6VA 5F8IA 3D1HA 5EUHA 1FDDA 4ANEA 2D3OR 5HJXA 1NSAA 5GAEI 3EYZA 2FJWA 1HBMA 1VRTA 3QWPA 4E2FB 1C4AA 4ILMA 3KXDA 1EP4A 3GP9A 3VTIA 1WC6A 5A8RA 1S0MA 5DDOC 1C0UA 4ZN3A 4X65F 3DHXA 2XZDB 1YZ6A 2G2ZA 3CJ5A 3D67A 4IQXA 5I42A 2CPYA 2IRYA 2JDJA 3PVXA 2D7SA 2Z2YB 3OFEA 4NYOA 2HRYA 5FLXY 2ZH4A 2VG6B 3T6BA 1X9MA 5KG0A 1Y10A 3OSPA 2M5YA 1T7PA 3N5BA 1TZ0A 1P9YA 2DY9A 3BYPA 4AQYF 2G1HA 2B4VA 2QL7B 5FLXU 9RUBA 2HHHF 2DNPA 1FA0A 3IA0A 1OQ6A 1NLKL 2O01C 2JNJA 4QWBA 3PKYA 3PFOA 2P2CB 4CIOA 4NOHA 2F9JA 3UDLA 3NP5A 1HMVA 5DS7A 1M1KT 5CCLA 3CMES 4USWA 1NZ8A 2Z0GA 5IQQA 1YWXA 3ILLA 2O5DA 4B9MA 1GMVA 1XWLA 3I4HX 4CO3A 5HBMB 3OVBA 3ZZZA 1D3WA 4RW9A 2CZ4A 2HIQA 3B6BA 4D3GA 3KJVA 2GMLA 1RT6A 4HACA 2NUHA 2PEBA 2QLJB 2ZH6A 1PC5A 4IO1A 2DXEA 4R25A 1HWLA 1B70B 3TRGA 2ZDPA 3TAMB 3KLHB 3KHLA 2F1FA 1WHYA 4QIVA 4BBYA 2GIFA 4JV1A 2GHVC 1KQSR 1EKRA 1HW9A 3M8QA 5IFMA 1JJCB 4LREA 3HFVA 1VRUB 4B9LA 2EG1A 3IAM9 2YVSA 2MKCA 2Q79A 1CJVB 1ULRA 4DN0A 4H54A 1HL6A 2HK3A 1U1PA 1YJUA 4IRDA 1C0TB 3DRYA 1RUSA 4R0EA 2MYFA 2CQIA 3MTKA 2HZVA 2ZJQQ 3I82A 2K3IA 4OLOA 3OXFA 1FFGB 1H7XA 3UCZP 1U47A 2ZBPA 4NCGA 2MLZA 2DHXA 1N5YA 4P75A 1HNVA 3DKDA 2Q43A 2U1AA 1KFDA 5FIIA 3CUNA 3MPDA 1SQEA 4DUTA 3WIUA 1UVNA 4YB6A 4DCPB 1NZAA 4DL5A 1MWZA 1SB6A 3G86A 2GMJA 3RZAA 3A1YG 2MXYA 5C42A 2RS8A 3KTQA 4FN5A 3IR7B 1K1QA 3OXGA 2CRLA 4CO1A 5KG4A 4ZVPB 1KTVA 4DS5A 1SUQB 2BM0A 1IUJA 2J9CA 2JWNA 2MQQA 1RAAB 2G0CA 4FS2A 2VBWA 5ETNA 2AZ1A 2R8JA 4Y2MA 1HIYA 2HNDA 4HVZA 6FDRA 5HP1B 2QG9B 1N6QB 1RBAA 5CA5A 3RB0A 4DS4A 2EFQA 3GIKA 3CD0A 2AT1B 3KNGA 2OPSA 2XNRA 2CNKB 1IKXA 4CH1A 3FEXB 2YQ0A 1ZPVA 5LMNJ 4ZLPA 4CNYA 3DGPB 3GYNA 4X4PA 2R3VA 2WVBA 2I8EA 3Q2SC 2XNQA 3TX8A 1P1TA 4KPCA 4IOBA 3ILJA 2R9LA 5KT3A 4DCJB 1SQFA 1D9DA 4ZVUB 2RUSA 3L4BC 1RU2A 1H73A 1HQ2A 2CVIA 3IG1B 1U0HB 1S48A 3QBCA 2KG1A 1K73T 5D4NA 1B7FA 2VA3A 1TL7A 2HAIA 2AQ4A 2QSWA 1Q82T 2QA1A 4F50A 5KFRA 3KHRA 3BBBA 3NOGA 1P9QC 5I3UB 2FHOB 4KR0B 2DGVA 3UN5A 5B0BA 4E98A 1R3NA 4X4UA 4DR6J 4RUCA 3AJ2A 4YDXA 2Y1LB 2IBOA 3QAEA 3BGLA 4Y3CA 3NWGA 3EWGA 4JI3J 4X2BA 1XNQJ 2PN6A 2R7TA 5B0EA 4WIIA 4OJ3A 2OMLA 3CCRS 2W7PA 1D9AA 3C6TA 1X4FA 1SL0A 2HHSA 3IRXA 4J90A 2UVRA 1VYAA 5LMNF 2VZ9A 3R5CA 3A13A 2FTRA 5KT2A 1MWQA 1G4CA 1R8BA 2BBEA 2IDEA 3AAWB 5ITHA 4ZPCA 1LWEA 2FY1A 4OI1A 2GJFA 3W66A 5KTQA 1FK9B 5LXYA 4R0JA 1D0EA 1S1TB 2QGFB 2FC9A 1FI4A 2DEJA 3BEGB 3QIDA 1N32F 3P5TL 1QE1A 1QVFR 3CJ3A 4WBFA 4R5PA 3KDNA 5KFXA 3FBBA 4CNZA 2CQ3A 2EC2A 4K4TA 3GR0A 5CAAA 1Q8IA 1KN6A 1YG0A 3M9NB 3AY0A 2IAJA 4FPRA 4IDKA 4X4TA 4ICLB 4FXDA 1JLFA 3I0RB 2Q1LA 1J2VA 5KFNA 2FJEB 2QX0A 2DNLA 2XEXA 1TL1A 4DR6F 1ZS6A 3UI3A 3UCUP 3KLEB 4DG1A 4JI3F 5DG7A 1XNQF 3R5BA 4RJVA 1YVFA 3MEEB 4RO0A 2IVFB 2OO4A 5IT4A 4M5JA 1NSQA 3CD5A 2X3GA 3G82A 3O1LA 2QLWA 4OQJA 3OTCA 3C15B 4FBUA 2YY3A 4QZVB 2W2MP 1A7GE 2UVWA 2V2QA 1CQNA 1SC6A 3R9LA 1U1RA 3HK2A 4QR0A 5KFLA 1SC4B 4M5IA 1F6TA 3AD7C 4E8UA 1M5VC 3DLEB 3DRXA 3VCDA 3W9JA 2AZ3A 3QJPA 1VQ8S 1B0VA 1EIYB 1RTIB 3NGTA 1GXLA 3PEJA 2NSCA 2ZZMA 3G87A 3A3OB 2J5AA 3LO3A 3N01A 4OZ5A 2RQCA 3PYGA 4LF5J 4DXLA 1Q86T 4F4ZA 2XM3A 2E7VA 3FZ2A 1WOPA 4FF3A 2VJVA 4EYIB 3JTPA 3IM8A 4RZRA 2AF6A 3CNQP 2UV8G 2K3KA 4JUZA 1C1CA 3SZ2A 3DM2B 1BQMA 4IH5A 1RLCL 2M70A 3PJ9A 3Q24A 1Q8KA 2D3UA 5D0HA 2YXLA 5L8RC 5JXSA 1UPMB 5KFDA 3N28A 2N4DA 1TUGB 4TYBA 2GQCA 1NCLA 5LMUJ 4CLLA 1JLAA 3OFHA 3B54A 5CHCB 1KWMA 5DRKA 3W2WB 2ZVSA 3DN9A 4PABA 1GFWB 2L08A 3L9ZA 4GC7A 1VBXA 2C3OA 3KKFA 3PEHA 3FQKA 3TUZC 2QMXA 1FJGJ 3SSSA 1URNA 4JBCA 4B9UA 4N76A 4XDCA 3C16B 4DBQA 1RT1B 4ELUA 3SQGB 2KJWA 1B4SA 4CYUA 3HPOA 3P5BP 5GADU 3UR3C 3ZNUA 1T05B 4B9VA 1UETA 1WC5A 4F67A 4WKYA 3MPYA 3HLUA 1N36J 1RA6A 4KYZA 4LF5F 2Y0SD 5M2RA 2H4WB 2R7WA 1ZA1B 2ATLA 3CDUA 4IO9Q 1TMJA 4ZPDA 8AT1B 4AL5A 1TMMA 2AW0A 3HSDA 3HD1A 2ZDOA 1N5VA 2PFDA 1YJTA 3EX7B 4CH7A 2AJ0A 3JQKA 3U1MA 2KXNB 2I5JA 3NKYA 1FT8A 2BX6A 2MY8A 2QYCA 4J7CA 3KNAA 4CLPA 2W4CA 2BJ8A 3HZEA 2XMUA 1U09A 4L73A 1Q4RA 1Z2LA 3W64A 5LMUF 2FZGB 2Q3PA 3IS9A 4O3OA 1BQXA 4ELVA 2RD5C 4NEZA 1L3TA 1ZAWA 1FJGF 1UKUA 2XMKA 1PG5B 3ZZRA 4QR1A 4OHVA 2HQGA 1QTMA 2C22A 1LOUA 2BYCA 4KJIA 4CLSA 1TKDA 2HS0A 3OL8A 1HQEA 4NLPA 1DZ5A 2YNFA 3MEDA 4BC7A 2O66A 4KFBA 4Q2MA 5CH7B 2LP4A 3FBEA 3V6KA 1HI0P 4DZ6A 4ECRA 1RHRB 3M1VA 1R43A 2BJ7A 1N36F 2OLWA 4USKA 4YB1P 3RW7A 2RRAA 1H3DA 4K4ZA 1F2GA 1DAXA 4H4MA 1LW0B 3UO0A 2Y1IA 1VC6A 2CQHA 4G1IA 4G3IA 3L7PA 4HH0A 3FKBA 1QSLA 2VB6A 4G1QA 1IXKA 4I6YA 4B3OB 2XSFA 1X4EA 1QUPA 3FRZA 4GMKA 2XO6A 5J2NB 4EK2A 4EI2A 1DQAA 4B3TJ 4DSEA 4MYUA 1R8CA 1EB0A 5F8JA 2E1PA 1GTEA 3MAQA 1RBOB 4NL5A 2QFIA 2EEYA 2QSFA 2OD6A 5KG1A 2M52A 4FNHA 1RACB 3PIPQ 1RT7A 3H40A 2FJVA 1JNZB 4PYAA 5D8HB 5HO4A 4DX6A 3MM7B 2LU2A 3KK1A 2DJWA 3GSIA 3ZNJ1 1Y0HA 6FD1A 2CQ2A 4UZCA 1I3OB 2DB1A 4FYWB 2WHOA 2XLJA 3R3TA 3AJ1A 3BGUA 2AYEA 4PEOA 1JLCB 1NRKA 1S72S 2ZH7A 4QR2A 3CIZA 4MIBA 4J9RA 2FDNA 4EYHB 1CJUB 4OX9J 4K50A 4J37A 2V8DA 2YX4A 1IKVA 4HLBA 1U25A 4RWXA 2IYIA 4TLQA 2CIMA 1XMQJ 1S4EA 1X9SA 1PKUA 3T9ZA 4ZMMA 2BANB 1XC9A 1Y11A 3VHQA 1TKTB 2VDIA 4ZKAA 3G6XA 4B3TF 3DLKA 1B3TA 3NY0A 1TVRB 4OJ1A 4USIA 4EBCA 3IC1A 4KKOA 1O6XA 2OAUA 4OZ1A 2W9AA 5D6GA 3MM8A 2GFFA 3PW7A 5JVGQ 1MMNA 2QA4S 4RNNA 1RAJA 2RQMA 1N0VC 3CDEA 2YNHA 1UA1A 2F4FA 5GMEA 1DBDA 4K2JA 2IM0A 1Q16B 2HHQA 2CZ9A 3CC4S 4DV6J 3Q0AA 3MCNA 2CADA 5L1KA 5DJBA 3CMAS 2Z2LA 2M8DB 1RWVB 2DNQA 2W24A 2Y8WA 4F3MA 3MXHP 1M90T 2X51A 4LBIA 2JOQA 4Z7CA 4A46A 3KMSA 5DDRC 2KT2A 2KU7A 3FEYB 2QC3A 4OX9F 3GB0A 1RAIB 2XMAA 2DHGA 3JYTB 3WC0A 1U48A 3JTOA 5H1SV 1S1XA 4QPTA 1NSKL 4MAKA 2J9EA 1JB0C 1FEEA 1UP1A 3FDSA 1FWPA 4WXWA 2YX7A 2GAHC 3BREA 1GAOA 1JXEA 3I0SB 2DGOA 2CDRB 5G0RB 3PNIA 3O6QA 3Q8YA 2PD1A 2JVOA 3IWXA 5IS2A 3KK3B 2JC0A 3D3BJ 2BKNA 1V6HA 3MPVA 1RDRA 4FP9A 3ENQA 1ZH5A 2ZE2B 4IG0B 1HI1A 1DY3A 1CC8A 2OPPB 4DPTA 2HFUA 4QIGA 4TLRA 2AIRB 1NEEA 2YWHA 1T9TA 2XZTB 3CD7A 5ETKA 4DV6F 2BE2A 5IC6B 3CMQA 4RU9A 4DR5J 2ZVIA 4Y6IA 4H4KC 1QD1A 2EKYA 2YWWA 4C8ZA 3MMAA 3NCRA 4F3QA 3KFWX 1RWNB 3TO8A 1RT4A 4HHJA 1LWCA 3M32A 1LK7A 2I38A 3UWTA 4HT7A 3B78A 2KDOA 1F9FA 4LBHA 3M05A 1J5OA 2PC6A 3N0VA 2G0IA 2P9EA 2WRMA 3MOZA 2HQDA 4LSLB 9ATCB 3BM7A 3RYLA 4J9PA 2V68A 2KM8C 1YGYA 2H5EA 2NUUG 3N6MA 4LJMA 2E5IA 4XK8C 2KYXA 1B7YB 3IGNA 1E6YA 1LW2B 3OD2A 1S0OA 2PFFB 4DSLA 5F8HA 1ZA2B 5F9LA 3BSNA 2WK4A 1MMDA 1RAFB 2ASJA 2HNYA 2MQLA 2QMWA 3J7ZT 3CO0P 4DV3J 4WFYA 3DRSA 1MN9A 1SL1A 1WSRA 3EXCX 1N5QA 3NBPA 2R8GA 1RI7A 4IH7A 1RWPB 4FXWA 3FEZA 4P2MA 2J9DE 3HDSA 3J81Y 1CULB 4RNHA 1S6PA 3MCSA 4DR5F 2VODA 2E1AA 3HSZA 4A47A 3PCOB 1FDNA 1RGVA 5GAHU 1V3ZA 1T9XA 2HEKA 1IKYB 1S0VA 1Q78A 3IBWA 3J81U 2NXNA 3T41A 4HEA9 3LAMA 2VG7A 4FNIA 2A1BA 4DQRA 1VLYA 1NPPA 2KT3A 1FRXA 3ADAC 3VWSA 5ETMA 8ATCB 3KOAA 2LDYA 1NK4A 1NKCA 4NLRA 1B0TA 3M2UB 2RT3A 1C1BB 1S9EA 4ZP9A 2DR9A 3JS9A 4WE1B 2R8IA 5A0YB 3ETOA 1G1XA 5KT7A 2OTJS 2QA2A 4MFBA 5IQ6A 2K1RB 4ZP7A 4M5GA 1BLUA 4OV6A 2XI3A 4DV3F 3M9MB 1HPZA 2Z8QA 4N47A 2O67A 1P1LA 2Y9HA 1MROB 2MQNA 3R5JB 3RAXA 2NXCA 3SCLE 4C11B 2XC9A 4DI6A 4PPDA 2KO1A 2YNIB 3M8YA 3C6UA 2KZMA 1FVQA 1ICEB 2X1GA 1U0SA 2PMWA 3ZZYA 4ECUA 3DRPB 4WZQA 4DQIA 2WSEC 4W4MA 3ZTPA 1DARA 4LQ9A 3I5BA 5I4MA 1RZMA 1ZTTA 2QN6B 4G65A 5GAHI 4HDGA 1A6LA 5LJ3Y 4IQMA 1T03A 2RHQB 4ZCIA 1RT3A 3KK2B 3C14B 3M6VA 4UZBA 3BS9A 3THPA 2VD3A 3B82A 1QSSA 3VVTA 1W7WA 4O4GA 4PR6A 4DSFA 1TL4A 3S7RA 4WP3A 4BDPA 3PTWA 1VQ7S 3NRBA 1TL5A 3W1YC 5KFOA 2FUG9 1UTAA 2W9BA 3VGSA 4ZCLA 5F3ZA 1PJ7A 3K2YA 1IM6A 2IVYA 3GPAA 1ZM9A 4CT9A 2PA3A 4I64A 1E6VB 2AYBA 3PRVA 3M2RA 2JEGA 2Z56B 3FVYA 4FVMA 4DL4A 1QSYA 1R8PA 4OYIA 1Q81T 2QEXS 2RIJA 1S9GB 1JLEB 5KFEA 2YX1A 1X4DA 1KRPA 4ES2A 1KHVA 1YBTA 3PW4A 1F9EB 4P7TA 1S4FA 2L3MA 3HFZB 3I87A 4C8OA 4LRFA 3VZIA 2JJ4D 4DX8H 4A48A 4MKYA 1FFWB 5EX3A 1HNIB 1VQOS 4WK1A 4NLXA 4DR3J 1VJQA 3BSOA 4N56A 5F8NA 4FXVA 2UUAJ 4F04B 2IHR1 1R0AA 1T9VA 4PQUA 8RUCA 1WG4A 1S1WA 4I67A 4BWMA 1HHTP 3J7Z5 2DGUA 2ZWPA 3Q89A 2HW3A 3PYFA 3IGVA 4ZVHA 1T95A 2JFKA 2MY7A 3OL6A 1UEVA 2FY8A 3ONQA 1CBKA 4PUOB 3M2VA 4OZ0A 5B0AA 4K7QA 4C9DA 1VI7A 2XLKA 4CLTA 5A8WA 4F2SA 3LP0A 3MR2A 2JFDA 4KE5A 4P72A 1VLOA 2XB2D 3G9CA 1R89A 3DLJA 4RLEA 3ZZTA 3PZPA 4K0KJ 2ZZNA 3QMQA 1I51B 1KHWA 4Y0FA 1H98A 1DQ9A 4RR5A 1LWXA 2YKMA 2YNGB 4LBPA 3ZTQA 4QWAA 1KOHA 4K8RA 4DR3F 1A0OB 4YS2A 2N4CA 3DOKA 3RB3A 1NJYA 2UUAF 3DNCA 1JWWA 4HTJA 1BC6A 1SV5A 3HVTA 3U1LA 3CT9A 2W2QP 4EZ9A 2W9CB 2COLA 4MT1A 1RYRA 3UD4P 2ZH3A 2UXCJ 4KO0A 1X4GA 2FHKA 3GLJA 2XBPA 1WEYA 4JI5J 4F0HA 5HL7Q 4OZNA 1RISA 2BJEA 1YRXA 2XSJA 3PJWA 2MSSA 5CXTA 4GKJF 1RHUB 1PSDA 4ED7A 3MEGA 3K17A 2KT5A 2ZBCA 2VU5A 3CC7S 5BYRA 3FCWA 2W2NP 2CQCA 1LFPA 3HJFA 2UVUA 3DRRA 2EWHA 3M30A 5IT0A 3ENWA 3HHEA 1MSWD 1JMTA 3MM6B 2FHJA 2ZKTA 4K0KF 1WORA 2AU0A 4C8YA 4H4OA 4N8NA 3JAMY 1OY6A 2V2KA 2RQ4A 3BSCA 1TP7A 1WSVA 4NLUA 1FKAF 1M1HA 2MZ1A 2Z57B 3I6PA 4LIRA 1FNOA 2ZBRA 4Z2XA 1QAXA 1HNWJ 4EU0A 5HSPA 3LWMA 1HLWA 4H4KA 2H51B 3AJDA 3GE9A 2WOMA 1HHSA 3OBIA 3FMBA 4YMEA 4A4JA 5K14A 3QRQA 2UXCF 3POTB 2BR0A 4HHHA 3LANA 4O0NA 1Q53A 1XR7A 2VPXB 1UFLA 3X3UA 4JI5F 4OX8A 3R5AA 4ZHRA 1X31C 4CLYA 4ECZA 1EKSA 2CJXB 1WDDA 1LXNA 1NM2A 2LXIA 1U7LA 4K2XA 3UD3P 1HQUA 5D4PA 1U1LA 2PT0A 1F9HA 4ZLJA 2OPSB 2CQGA 4U7UK 4L72B 2XYHB 3I55S 2DD8S 2HSEB 3UE2A 4GO5X 4IUFA 3HX9A 4KIAA 3S8SA 3W60A 2YQ1A 4ZVGA 4EUVA 4W92B 2JEIA 4DCOB 1KKHA 2LQ9A 3U1NA 3V81B 1N4LA 3CCMS 1VISA 3CJRA 3V6DA 4U95A 5A2QU 2RF2A 5KG7A 5HVFA 3VGUA 4B9NA 3TA2A 4RW4A 1FD8A 2BRKA 1TV6B 2VQEJ 2WAQD 2DRDA 1F5CA 2EFPA 2HGLA 4RX6A 1VC5A 1HNWF 2CG8A 2HHPA 4J9QA 3QYYA 3TUPA 4NLSA 4L3NA 3TOQA 1BUXA 4K4YA 1TELA 1X8DA 3OR1A 1FRLA 2P8IA 3UW1A 3D7SB 4F4AA 2VKRA 4NA3A 4X62J 2B5JA 2CPIA 1T3OA 5I3PA 3HHNB 2YWEA 1S76D 3L7OA 3CDWA 1S57A 4DV2J 2DGWA 4RPFA 3LP1B 4FYYB 1OSDA 2NZCA 2YWKA 1XR5A 3MM5A 1H72C 1NHVA 4CO2A 1HBNA 1RT5A 3BPSP 2VQFJ 1RHJB 2XTJP 3A8KA 1REVB 3RR8A 1RWKB 4DPOA 4O3NA 2RSQA 3VAGA 3MMCA 3UNGC 1RAHB 3L09A 1NUEA 4U67Q 4BWJA 4LFAJ 2B4PA 2IBKA 3CF5Q 2ZJRQ 3CCVS 2BJDA 4YB5A 1FWKA 2WVCA 4CM0A 1QE1B 5L46A 4ZP6A 1JLGB 4LRBA 2VQEF 2MKIA 2YH1A 5GMDA 3JSBA 1VK3A 1O8BA 5CD4H 1JLBA 1G2EA 2FVRA 3UDCA 3D28A 2GIQA 3LW5C 3M8ZA 3E01B 3O2IA 1EHWA 4LT6A 4NA1A 1FF2A 4X62F 3HT3A 4EFAC 1JLFB 4C6AA 5HAOA 2E1MC 4ED6A 3EZ5A 3FMWA 4I6WA 4DV2F 3CJ4A 3DOMB 4LR7A 2B4OA 2JEJA 5E3PA 4WZMA 3DMJA 1H0HB 2VQFF 3QFWA 1S1VB 4ZPBA 4QIFA 1DTQB 2CKWA 4XIUA 1CSJA 4OZ2A 2DCUB 2RH3A 3BQ0A 4Y2CA 2CPEA 2NYHA 4UQTA 4DR7J 4A8OA 2BQ3A 2R2UA 5E41A 2OPRB 2FJBB 2KFNA 2BXJA 4LFAF 1IQZA 1SVDA 3QO9A 2V5HG 5CD4A 5LSOA 2X7IA 2E1CA 5J1PA 3RAQA 1NJWA 1ZTWA 4WTYA 4PQAA 2HZCA 3UNYA 2Z2MA 5J1EB 1X7VA 3UR0A 1Y4ZB 4DQPA 3J80Y 3RBEA 4X4VA 1VBZA 2YKAA 3KLGA 2BRLA 4PWDA 1TKZB 4TY9A 3HFKA 2W7OA 2AKWB 1RP5A 4FDFA 2Q66A 2DY1A 4L76A 3H5XA 1RHMB 3SDEA 1AZSB 3D9BA 2V34A 3EZOA 3Q83A 3J80U 1OPIA 2H4YB 4HKQA 2MZQA 2YKNB 3BGRA 2DRAA 1RYSA 2NXEA 2AYGA 3QRRA 4M5DB 2WBRA 2OPQB 2HLUA 2VBXA 2MLXA 2HQIA 1JX4A 3LWLA 3GG1A 1UPPA 5DM7Q 3IFEA 3W62A 3A8EA 1IWAA 3JQMA 2RJZA 1GXTA 1ZZNA 1LK5A 4DR7F 3NCPA 3E8OA 2V2ZA 1ZYQA 1VQSA 1M5PC 2MZSA 5DLGA 2BA9A 4ZVSB 2MZRA 2IYGA 4OV1A 2IFXA 3CULA 3WDOA 5F8MA 2MJUA 1BQNB 2PEHA 4DF4A 3T5LA 2D3ZA 3ZFVA 1KP6A 1XERA 3ELHA 4NLOA 2V8HA 5DZ6A 4DDFA 2VFSA 2QL5B 1DTTB 3FC9A 2PA8D 2VG6A 1WOOA 3GZ7A 3MR6A 3D6HB 5ETTA 1MLAA 3NCQA 2CJAA 1ELOA 4IR1A 2CAJA 3TZYA 2HK2A 3IM9A 2I5JB 4J9UE 5KFKA 3AOCA 2OHDA 3D0GE 4AUKA 4RNMA 3MAHA 1IBCB 2ASLA 5SUHA 2RVJA 4K4XA 1TR0A 1T94A 3DOLB 4PRFA 4ZPAA 3PHTA 3CCLS 2NQPA 1I1GA 3W8PA 1U02A 1MWYA 3DCAA 1NKBA 5F0UA 4XAKA 4C8KA 2EBEA 4M5HA 1S1UB 2R7OA 1RAEB 4BHQA 1HYSA 2GHPA 1YITS 4LMZA 1WDTA 1NBEB 2XMWA 3Q8RB 3BV8A 1J27A 2BMBA 2Q6CA 2JVRA 1HQEB 3EJMA 4HI1A 4NX9A 3BH6B 1WJ9A 2L9NA 1QTNB 5HBMA 4MIWA 4NLYA 3MEDB 1WEZA 4RUAA 4AE5A 1RT2B 2F7VA 4IH6A 1WC3A 3ISND 5KT6A 4A8FA 1NHUA 3Q8QB 4DQSA 2RS2A 3SBMA 3TR5A 3KLIB 3CIMA 4ZJQA 2YBVA 2E7XA 2LXFA 2KFZA 2N7CA 2X3DA 4FPIA 2FGCA 1TAUA 1CC7A 2V4RA 5D3GB 7AT1B 5SZTA 4K5SA 2HVDA 4NA2A 1W26A 3TAMA 1SKWA 4DL2A 4G1QB 3C19A 5EWFA 2D41A 3MUMP 1YJRA 5L39A 1KSPA 1XQIA 2J0SD 2MKYA 1VCTA 2VASA 4ED4A 1VRUA 4V19X 4TU9A 2GAGC 3UQSA 4GVBB 4IG3B 2ZC4A 2R7SA 4NLTA 2GGPA 4TVAB 1CJVA 4ZPTR 1JIHA 3H4DA 1QAIA 2PGCA 1WOSA 2IMOA 1C0TA 2BQRA 3TA1A 1RT7B 4NYZA 2F8HA 2G4BA 1HR0J 3A12A 3C8YA 4OI6A 1NHKL 4YR2A 2ZD1A 2MZJA 1FX2A 2LU1A 2AYMA 2WVDA 4P9SA 4DPYA 2VUGA 1H7WA 4S0MA 1VQKS 3F41A 3NNCA 3CEDA 1FXDA 3BKUA 3PX0A 1LFWA 1WC4A 2AJ2A 3IAS9 3IWNC 2W8LA 3TJ8A 1R0CB 1REGX 4CCHA 1AFIA 1RKIA 2AV5A 2H3EB 4URSA 4ECTA 4TKTA 5K20B 2K7JA 4KB7A 3W3SA 2E9RX 2QFJA 4A8KA 4KSEB 3H25A 4ZP8A 4KGZB 2LXUA 1SUQA 2DT9A 1QUVA 2VICA 4ZJLA 2L48A 2MQ8A 1FWLA 1KQKA 1NNDA 3QQCD 3T19A 1RADB 5HROB 5H9EJ 4OHXA 3LGMA 4PXEA 2MGZB 2DPIA 4P52A 1F60B 4KKOB 4FYVB 5KFCA 3I4PA 1X0PA 1L3SA 4OYAA 3OT9A 5A8KB 2PMHA 2MKJA 1N6QA 2ILZA 3ICLA 4RBUA 3QJLA 2B4UA 5GAEU 1KS2A 1LV5A 4WFXA 4W98A 5CZVA 3M7VA 3CO9A 4LF6J 1K0TA 4X4RA 2X1AA 3PJXA 2NR0A 4PXCA 2CPXA 2JX2A 1OO0B 4NXMJ 3HSGA 4EBDA 1ROFA 3DLHA 1DHMA 4DOZA 3PIOQ 4AFFA 2IM3A 4OHYA 1UL3A 2PSZA 3V4IB 2QT7A 1FRHA 4WK3A 2WVFA 3MFIA 3TUIC 4O23A 4ALZA 2KL8A 2W4PA 3IG1A 3HXMA 4LR9A 2VPZB 1Y5NB 1SJQA 1SJ4P 1RE1B 2WBMA 3NNAA 1ACMB 4K4SA 2RDDA 1FERA 5K9FA 4YB7A 2E1RA 2MPUA 3L95X 3ETMA 4J5OA 4KV8B 2FJDB 3LGNA 3Q8SB 1SIWB 5I3UA 2I2YA 1N48A 1FRJA 1VMBA 3TQ1A 2DYAA 3THVA 2MTLA 3DI6A 3OL9A 4JP8A 2IPOB 3M8SA 3K58A 3QGIA 5C2CA 1M5HA 1P27B 2UVVA 4FF1A 3MM9A 4B3RJ 5B0GA 3W61A 2AD9A 2GV1A 2EG2A 2B6AB 4LF6F 2V8PA 3PFEA 4BLGA 4Q8FA 2Y1RI 3ET6B 4YDDB 3DU5A 4V1Ak 2EFVA 2BE2B 3G6ES 3TANA 3MGJA 3BGOP 3G6YA 2LFVA 3D3CJ 4NXMF 3K8WA 3HHLA 3IWLA 2IY5B 1OY9A 4RW7B 1P6TA 1NJZA 1S1TA 4NASA 3B8HA 3HKZD 5J2QB 3K8VA 2J7KA 3FNNA 3H98A 3CTRA 1Y3JA 4UOCA 5KG5A 1NK6A 5EN1A 3VF0B 1J5OB 2WTFA 3LTOA 2MLYA 1LQ9A 5H9FJ 3TVZA 5KFIA 3KG1A 3HJVA 1FRKA 1R6VA 3BJYA 2E5LJ 2U2FA 4LRCA 1B0PA 4U6PA 1JJ2R 1XEZA 4FF2A 4X84A 3W63A 3BSAA 3VGTA 2DEIA 3TAPA 4ICLA 4I2PB 5FDLA 3I0RA 2HWHA 4CH0S 5D15A 3OJSA 1RTJB 2P6TA 4RW8B 2HNYB 1S59A 2YH0A 5RUBA 1NAQA 3GV8B 3KLEA 1RJJA 4C97A 4PAAA 3MEEA 1R6YA 1RABB 4OX6A 4B3RF 3W5ZA 2GJ2A 3A8JA 2B43A 4YFUA 2YQ3A 1EAYC 1KFSA 3AHPA 4ED5A 4OI3A 4TY8B 3MZIA 1Q8LA 4LF8J 3NMRA 3C15A 1S6PB 4CI0B 5HN0A 3B4MA 3IR5B 1JLQB 5IT9U 3TVKA 3T5JA 1VQ5S 4J9LA 4ZVEA 3UFCX 4DR2J 2BOPA 5J2PB 2FD2A 5K8OA 1YBAA 3DDKA 4KRWA 3G2XA 3MECB 4ZIWA 3DLEA 2R7UA 2UUCJ 4KT0C 4ZVTB 3ENVA 3MMBA 4RL1A 1RTIA 4QU6A 3OW2R 1U1KA 4RU2A 4RW6B 2OFGX 2H48B 1IWGA 4OYWA 5EWGA 4IRCA 1KDNA 2E5LF 2QLXA 4EWTA 3CSKA 2OSRA 4L74A 1RA7A 4DZDA 4WPAA 1HBUB 3U27A 3AODA 1SH2A 2C3MA 2W25A 3PX4A 3O3LA 2MQOA 4QIEA 1UCNA 1GXUA 2GCFA 2NSBA 5D0EA 3DM2A 3NXZA 4MFBB 2BE9B 4NCAA 4JI6J 1R31A 3T1YJ 2P9CA 4EZ6A 4FBTA 4E0DA 1HD0A 2EK1A 2UXDJ 3TZWA 5A6WA 4KTQA 2AEMA 1D9FA 2DCLA 3MCOA 1VC0A 1Q7YT 3FFIA 2HMIB 2R2SA 2NCKL 3W2WA 2B9WA 1XIQA 2RRBA 4LF8F 2APOA 2M9KA 4CRJA 2ZNYA 2W2OP 1KLMA 4NMXA 3PW2A 1F5AA 2B8QA 5DQGA 3PACA 4DR2F 3PX6A 3C16A 3IR6B 1RT1A 2L41A 1VRQC 4DV0J 3WQPA 4ZVFA 2OGUA 5D4OA 5B08A 5E33A 1RU1A 2UUCF 2GHWA 2DRBA 4JI2J 3HHDA 2GJIA 2D9PA 1YKWA 3E2EA 3OL7A 1N5SA 4K4WA 1JKHB 3W5YA 5KFVA 3HHKA 4A8SA 4OZLA 1FO1A 4LR8A 3HULA 3TA0A 3QT5A 1ZAXA 1X9WA 4PWWA 2MEWA 1XMBA 2YKQA 4BC9A 3PRBA 1GX6A 2OEKA 5LL6d 1S7IA 4ZVOB 5KAKA 2W9BB 2BJ3A 1NK7A 4I0WA 2HBYB 4JI6F 1U4BA 3T1YF 5KOWA 2J0QD 5BYSA 4CTAB 1OWXA 5ETLA 1VBYA 2UXDF 4NZ6A 2CJQA 2JSXA 2OH2A 1QJHA 3SIPB 5L9NA 2BABA 4C8LA 1M5KC 4DX7A 2HQCA 3OXLA 4GC6A 1VK8A 1K0VA 2F3JA 2IA6A 1SC3B 4MK8A 3CC2S 2XY7A 1G7CB 4P74A 2FC8A 2AHOB 2LA6A 4LF2A 5CYQB 4JI7J 1KQGB 2HNZB 5KFQA 3GJRB 1KEKA 4ED1A 3QSIA 4JI2F 4U8YA 2XI2A 1NDCA 1IR2A 3W8GA 4EO6A 2B3TB 3ZC4A 2CJKA 4K4VA 3ZO7A 2LA4A 2RU9A 1UW9A 4B9TA 5EGYA 3V2UC 3QATA 2BEFA 3UVJB 1LW0A 3TP2A 1GX5A 1O0PA 2LEBA 3WZ0A 4DPXA 4USTA 3CXCR 2FZCB 1RLDA 3FBCA 3BH7B 2C1EB 2V4JB 4UF4A 3IBCB 3M6UA 4B3OA 2YKOA 3AB2B 5J2NA 3EVWA 1N0UA 4USVA 1SCJB 2VJUA 1M1GA 3SXLA 2FVCA 4DV1J 1UAWA 2OTLS 2A2CA 5BXIA 3M2VB 4CDIA 3P96A 5HQMA 1NKEA 3VALA 2W7AA 3HO1A 1Z1ZA 2GZOA 2FJAB 1XNRJ 1VDHA 3EVMA 4TQRA 2K8GA 1S12A 4UUXA 2VHGA 3CGIA 4PG4A 4YHHJ 4B02A 3TX0A 4NYPA 3PW0A 2A10A 1TFWA 4FYDA 2B0GA 4F36A 4JI7F 2NZ4A 3KG0A 1BE4A 3EM1A 2V94A 2BM1A 4ZCMA 3QRPA 4P2SA 5D77A 3I9ZA 2DNMA 2D74B 3WIVA 3BQ2A 2I9SA 2YKMB 5ETRA 5JJBA 5LSRA 1JLCA 4ECWA 3C2PA 4F02A 3BKFA 1HHQA 3KUHA 4I2QB 5E0OA 1UVJA 2K2PA 1CJUA 2C2NA 4I7FB 3CCWA 3DOKB 3CCJS 4ZS6A 5CZXA 3KHHA 3RW6A 1SV5B 4UOGA 1FE0A 2VPYB 3PY8A 3PW5A 1AW0A 2LMIA 3DDNA 3GJTB 2DNKA 4GO7X 1HWKA 2G13A 1ZM3A 2HFOA 3NGSA 2BANA 2ACMA 1L3KA 2C2MB 2FHJD 1VBKA 4F26A 3RBDA 2FLOA 1TKTA 1T9WA 4DV1F 4JI1J 5F8LA 4UUWA 3TZXA 1UW4A 1XN9A 5B0CA 2RB7A 1TVRA 4P71A 3SQOP 3K5NA 1XNRF 1WC1A 1F5BA 2VF3A 2AGPA 1G6BA 5DG8A 4YHHF 5KFTA 2WCXA 1TAQA 4OYOA 4LSZB 4ZPWR 3R97A 3U7JA 5D0GA 2C3YA 3WX4A 3DXSX 2V4QA 2GVDB 1S77D 5AE2A 1H6KX 3CDAA 4F3OA 1PGZA 3UN2A 3UN3A 2W1BA 1IM4A 4QIWD 4M95A 2VDHA 1X60A 2NXUA 5J1NA 4MK7A 2B9XA 4WKRA 3JYTA 1WKJA 1YDLA 1W2BR 2EI5A 4WIQA 3DFEA 2B7CB 3GFZA 3GMGA 3I0SA 5G0RA 3RGIA 1RQ0A 3BDEA 2HWIA 4DV4J 2RE1A 3DYAB 3UDEA 4ZHRB 4JI1F 5IOLA 1U24A 1OYEA 1GMWD 1WI8A 3GFXA 4OZ3A 2QO3A 1VGYA 2IM1A 3GSDA 1HQUB 1MNEA 2M4MA 2ZE2A 1WG1A 2GA7A 3LP2A 4Q7AA 4IG0A 1JXVA 1N5TA 2VA2A 4I1TA 5LSLA 5ADZA 3RAMA 4B08A 2OPPA 2PDAA 3L3CA 2R42A 2E7WA 1U6BA 5B09A 2N82B 4DV5J 3EXYA 2G9OA 3D1QA 2H65B 2LDIA 3S6EA 4B3SJ 3T1AA 1B99A 1L5UA 2AJFE 2BUNA 2DNZA 2MHNA 3W5XA 4PXBA 4QJVA 3OVAA 4QPXA 4CLUA 1YJVA 2E5HA 4WYWA 4F4KA 1MU2B 1F1BB 3FZBA 1FKPA 1RAGB 4LRDA 1NK9A 1U8WA 3K5MA 3BBFA 2XY5A 4L6V3 2CZVC 4DR1J 1AYEA 3EGWB 3OR1B 1FDBA 5AT1B 2CQ0A 1SXLA 2NPIA 2B5JB 4X64J 4NZ0A 1WTBA 4DV4F 3HI9A 4Q0BB 3GYXB 2V9WA 1V5IB 3KJQB 4OMFG 3MM5B 5C24A 1UVKA 3GFHA 1BD6A 1WNEA 1PAEX 3J7A1 4YQWA 1KC8T 3SYZA 2FJXA 4QWDA 3DC2A 4ITSA 5HMYA 4DV5F 2VPWB 4DL7A 4O44B 4M5NA 4JI0J 4QW9A 4B3SF 1QY7A 2DNOA 1JNRB 2CYYA 1N88A 1CULA 2GQ2A 4ATNA 4ZLNA 2E5JA 4J9MA 1CS4B 5ETSA 1F2HA 5L1JA 2VOPA 1HA1A 3U02A 3R7NB 4MKAA 2B8PA 3EDQB 4TYAA 5F41A 3QZ7A 3B4DA 1I94J 3H2VE 3OTDA 2CPJA 1LWFA 4HDHA 2ALZA 2WW8A 3ZTSA 2DO4A 2OI2A 3CVKA 4DR1F 3FBFA 2P6SA 2K7KA 1H2TZ 1RWUA 3D6MB 4W90B 3AT1B 2OSQA 3M2UA 1C1BA 1JXLA 4X64F 2HHWA 1DFDA 3NG8A 2GMHA 2MSTA 2PIIA 2ZJPQ 3FCHA 3UD5A 3QGPA 4V19J 2KJVA 6AT1B 4ER8A 2W2PP 2VC1A 2C2KB 4ZPVR 3OUYB 2LYVA 2EFGA 5IWAJ 5DDPC 2N3LA 1UA0A 2XS5A 4I56A 1MROA 3PXGa 2UXBJ 4ZCKA 1TL3B 4EO8A 2E9ZA 4ZOSA 4ZVRB 5KFGA 4JI0F 3ILOA 1VQPS 1WF2A 1RTDB 3AXKA 3J81j 2YNIA 4NI2B 4IFYB 1QM9A 4WXOA 4NXNJ 1I6JA 4C48A 4O0IA 2JZ5A 3V6HA 1EETB 5FD1A 1X5OA 3MAAA 3VAJA 4P10A 4C8MA 2KVQE 2DH9A 2FZKB 4A8MP 1M5SA 2BDPA 4CQ1A 5KT5A 1H74A 1Q8BA 1I94F 2GS8A 1SJRA 2D3O1 3QPIA 3EMTA 4NLWA 3NAIA 4N8OA 1T3NA 4ES3A 2HGNA 4C3MA 3NS6A 4EGLA 1S9FA 3GTYX 3SDEB 1UJ4A 1FCAA 1N52B 1WKLA 2ZHBA 3CJKA 2MMYA 3NAHA 4MKVA 3LOUA 4M1KA 4O3RA 4AQYJ 3SV4A 2BJ1A 3H0PA 4P2FA 1FRMA 1MMLA 5LOQA 5IWAF 5L1IA 3N5FA 2UXBF 2EVZA 1Z2ZA 3MI7X 4FYXB 2KH9A 3TI0A 2J76E 2M7SA 3IP0A 4QOTA 4Y28C 3VAKA 4USUA 4NLDA 4NXNF 3D2WA 4ED3A 1IJEB 5GAGI 1S9GA 1JLEA 4KH1B 2ABYA 2FVQA 1HWUA 3R1HA 2XWYA 2LEAA 1ZM2A 4FKYA 2MJNA 3SFGA 1TKXB 1KQFB 2F63A 2CG4A 2XMVA 4KQZA 1KTQA 1KVIA 1HNIA 2HFSA 4M94A 1XMQF 2IVMA 2ZWOA 3HMJG 4QBUA 2DIUA 4P7VA 1MW7A 1RTHB 4MIAA 1RB0A 5AE1A 1FX4A 1XK8A 3ZTOA 4X4OA 3A8IA 4CZCA 4RNOA 1TQLA 4BS2A 5F9NA 3H5UA 3JSMB 1EQMA 2A18A 5BYQA 1H38A 2M8HA 4JB8B 1XTZA 4HT5A 2K06A 1OPZA 2F8MA 4M63A 4DF8A 1DURA 4PUOA 2OELA 4ES1A 1NPRA 4DPWA 1AB8A 2HHUA 5KG6A 4WTOB 5HLFA 2GNKA 1D1UA 2FVSA 2EPIA 2EW9A 3A4TA 1RHKB 4HYKA 4OLPA 4C4WA 1HYSB 1X0FA 2QLFB 4PKDB 2KKHA 4DL6A 3KLFB 3AD8C 1OS5A 3GIIA 3US5A 3V6JA 5CYMA 5KG3A 3QFHA 2HG4A 3MR3A 2XHWA 1X5PA 2YNGA 2CQDA 3MHYA 1H2VZ 2JC1A 3KDOA 1WG5A 1RSCA 4RNFA 4CP5A 4OI2A 3DLGB 2DHHA 3QIPB 1RHQB 3LALA 1T9YA 4G1PA 1NK0A 1V5VA 2HHVA 1PBAA 4IYQA 4Q8EA 2GW8A 2W9CA 5F3TA 1D8YA 2VV5A 3O8WA 2CQ1A 4I4BA 3E3XA 1LXJA 4ERDA 1Y9OA 3GCWP 4AT1B 4F4YA 2WB1D 3NS5A 3M4XA 4HHUA 2POKA 4WFNQ 1S99A 3KLVA 5CABA 1OSCA 3W2VB 4XPCA 1S6QA 2EBGA 5GMKa 3BQ1A 3KMQA 1C2PA 1Q95G 2GGPB 3VZHA 2JRSA 3M8PA 1QAYA 1NU4A 2WONB 1LNQA 1IN0A 4LSNA 4UW2A 4YEAA 1L3VA 2ZD1B 3A3PB 2AX0A 4KBIA 2W01A 3AOBA 3HM9A 4I6AA 1HW8A 3P45B 1QLNA 3MM6A 4PCQA 4LF7J 4LF1A 2CXEA 2VFTA 2QRRA 2D9OA 3OQ2A 5BJRA 3GILA 2XQCA 4ZN1A 4A8WA 4ZA1A 3DU6A 1D8ZA 4JI4J 3ISNC 1BXNA 2E5GA 4ILLA 4C3LA 1SI9A 1RK8A 2R7XA 3MURP 4LF4J 4OYZA 3ILIA 2QE5A 1VJWA 2DGTA 2LQ5A 3BDPA 2XMTA 4LF9J 3M6XA 3FCVA 2CJYB 3CJTA 3POTA 4KAIA 3H42A 4URQU 2GO8A 1FEHA 2B7BB 5BR8J 4J9KA 2CQ4A 2VG5B 2CNLB 2QIFA 1IKWB 1N34J 2RKIA 4WP9A 1U1QA 3PR4A 1NPKA 4ZITA 1YJ9S 4ECXA 1Q79A 1T9UA 3OR2B 1X5TA 5A76A 3R8YA 2FLLA 2F65A 2UUTA 3FQLA 4LVNP 3KYLA 4WJBA 3TVYA 3D4JA 1NB7A 1HNXJ 4LF7F 3V81A 4DX5A 2DR5A 1FRIA 4TQSA 5DGAA 4FZVA 2QTWA 4WCEQ 1N32J 1XR6A 2C2ZB 4DFPA 4IOCQ 3I9V9 2R4FA 1TV6A 2BKOA 3N6NA 4JI4F 4IRKA 5E3RA 4ID5B 4RUBA 3F73A 2F9DA 1CVJA 4MKBA 2MKKA 4LF4F 4JYAJ 3K7RA 4DQQA 4D3HA 2AJQA 2KYZA 2X1BA 4LF9F 4OX7A 3QLHB 3CB4A 1TFYA 1RWMB 4R8UB 3CCQS 4YY3J 5M2PA 3HHLD 3SI8A 1JJHA 3K89A 2IM2A 5BR8F 3DI6B 2HURA 3LP1A 2FIUA 3HVAA 1IR1A 3EPIA 1N34F 3BN7A 4OJHA 4F7VA 2IC3B 3MM9B 4ZVQB 3VAFA 1NO8A 3J7YU 1HARA 1REVA 1K44A 3GU0A 3RG6A 5C25A 3KUGA 3I5CA 1HBMB 1VRTB 2GIRA 3I31A 3KJFB 3OTEA 1EP4B 1SKRA 3Q8VA 1BY9A 5A8RB 5CYJA 3HHLB 1HNXF 3MD1A 4YUDA 1C0UB 2CNOB 4PZVA 2J6SA 5I42B 4HH1A 2C3PA 1JLGA 5E5NA 3LA0A 4F0KA 2MQMA 1NH8A 2BJ9A 1VFJA 3AXMA 4JYAF 3E01A 3JSYA 4C3KA 3GIRA 2YWGA 4RBVA 2DR7A 4IFVA 1HBOA 5HQLA 4USJC 3HVRA 4YY3F 5FDLB 1AT1B 3EGVA 3CCUS 4Z7YA 5D78A 1Y7PA 1IVZA 4WU3A 4TNOA 2HBZB 4FS1A 4ANDA 3DOMA 3V4MA 3W7BA 2FLPA 1X4HA 1V3RA 3IO1A 2QMUB 1HMVB 2ZUGA 3H8YA 3CCTA 1S1VA 3CCSS 1DTQA 3J7YI 1N56A 1YJ7A 2KFYA 1M5OC 4X66J 2DH7A 1RKJA 2WVEA 1RTZA 2OPRA 2KN4A 2BV3A 4DPUA 2BZ2A 4C7QA 3SCIE 1VHFA 5ETOA 1VR6A 2ZBQA 4RW9B 1APSA 2AEJA 3MCMA 4KHPJ 2UUBJ 4OFZA 3KJVB 3AB4B 1RT6B 4HACB 4DUZJ 3PRDA 2CPHA 2AJ1A 2VL1A 3MMBB 2I1RA 3F56A 2RMLA 5IM0A 2CWXA 4I68A 2AEFA 5J1EA 1ZPWX 4ELTA 2BOAA 3T6JA 3PO4A 1JK9B 5IV3A 4ZLLA 5EWEA 2KB2A 2VFUA 4ETXA 1TK8A 4EMDA 2XCPA 2V69A 1K1SA 5HJYA 2VH7A 1TKZA 1BWVA 3FSIA 1URRA 1YLXA 3AA8A 4PYDA 4DMZA 1AZSA 2V63A 3EDRB 4C0OC 3M8QB 5H9EK 4LFBJ 2YKNA 4F2RA 2KXFA 1AUSL 3GQCA 3MUTP 2H1YA 4M5DA 1RXOB 2OPQA 1X4BA 2W8KA 3R1LA 3HP6A 3R6LB 3AFGA 1RWXB 3EGZA 3FFIB 1ITPA 2AJ4A 3TARA 4Y00A 4DU8A 5AXKA 3D6TB 2DTJA 3BB5A 2LLZA 4YP3A 1YJNS 1NMEB 2SXLA 4X66F 2PMZD 3G96A 2DXDA 1KLMB 4NCGB 5DO2A 1N5YB 1HNVB 2CFXA 2HBQB 4KHPF 2UUBF 3RB4A 1O5JA 2XY6A 4DUZF 1BQNA 3QT8A 4ECSA 5IXUA 5C42B 3PR5B 1DTTA 3EGNA 1PC4A 1CLFA 1EARA 3OSNA 4QWEA 1AROP 2XS7A 3HVWA 1KBRA 2E44A 1F3VA 2BVZA 4ECQA 3GJQB 5AE3A 4WYLA 3ITHA 3W65A 4LFBF 1V3SA 3LQVA 2CQBA 1NJXA 1R8HA 1UZHA 3AD9C 4J9NA 3R27A 2HNDB 1VQ9S 2C2OB 7FD1A 2ZH8A 5CCMA 2QYGA 1WKKA 3DOLA 2YTCA 4DN9A 2RU3A 3VQTA 1IKXB 5A2QY 1CJKA 3ISZA 1UWBA 1S1UA 3CE8A 1YSJA 2M0GB 2BE7D 2Z58B 1FKOA 3G8SA 2HS3A 2BACA 1Y3KA 1O51A 2DO0A 4MH8A 1C4CA 1FJEB 5J2MA 1CJTA 5GADI 4ED0A 1RT2A 2ZFHA 5T7LA 4NPOA 3X1LB 5H9FK 3I5AA 2DXFA 3KLIA 3PM9A 1VIXA 2C2DA 1H2UX 1GT8A 2ZH5A 5L38A 2V8GA 2OIHA 3OPKA 2Z30B 1TL7B 4UY8T 4A8YA 5D3GA 5LJ5Y 3AA9A 5U47A 2NYIA 1LKZA 4O3PA 1VQ4S 2DGQA 2D1CA 2OFHX 3OTOJ 2DNGA 1PAUB 1V9OA 1Z4UA 1NK8A 1DLOA 3OV7A 5HMXA 3W9IA 3VGVA 3HKWA 4GVBA 1KVKA 4IG3A 2AGOA 3BPDA 3C6TB 2RNEA 2HRUA 3IN5A 3Q86A 4EBEA 3RRHA 1EZZB 3IRXB 3KUEA 2ZC3A 4WFAQ 2XYPB 3TJAA 5M2UA 2CNNB 3BO4A 4DFKA 1IBKJ 5K8PA 2HQ3A 2F8EX 1WHXA 3NOCA 1AFJA 1LWEB 4GVLA 3PG9A 5C7PA 3TJ9A 1YTYA 1UFWA 4Y34A 2Z4PA 2Q6BA 4AD6A 4CLFA 3NGUA 2O1PA 2DBBA 2XG8A 4KGXB 4R5PB 1FE4A 3HD2A 3ZZ0A 1PJ6A 4CT8A 4U7UD 4FVCA 2FGOA 2ZOFA 3VAIA 1MN7A 1YRTA 2IAJB 2KRBA 1Y5LB 4IDKB 3SMZA 2ROEA 4Q43A 4J9SA 3OTOF 5LM7E 1U8SA 3OTBA 5ETQA 4N5SA 2PI5A 3DHWC 2ZOMA 3SSQA 3P4UB 3T5HA 5LT5A 2R7QA 1TL1B 1FXLA 3OLAA 4KH0B 1YRUA 1S10A 1FNMA 1PBUA 2FQQB 1T02A 5HROA 4DG1B 3GWCA 2I6WA 3F44A 2MGZA 1FVSA 2LVWA 2GC8A 1U2FA 3CCZA 3FJ2A 5A8KA 3G82B 1LEOA 1R27B 4MK9A 4ZIVA 4OZJA 2KTQA 3OFFA 1YX2A 1TUVA 1IBKF 4J9VA 2ASDA 4L75A 4CLZA 2EFOA 3NS7B 2DPJA 3ZTRA 1XMOJ 5AXMA 5K8NA 3R5GA 5B0DA 3KHGA 4A8XA 2G2OA 5HMZA 4JOUA 3OVSA 2YWFA 2HVHA 3TUJC 2DGSA 2L9DA 2HZAA 2EKNA 1U1NA 2GVZA 1FFSB 2CPFA 3V4IA 1GNKA 3MUVP 2HVZA 2A6OA 2AMCB 4DSJA 1SKUB 2NPFA 2OJ3A 3FGVA 1KONA 3CJ2A 1SBRA 3BYRA 4WF9Q 4P73A 1C1CB 3GR1A 3QT6A 1BQMB 4QYRA 4RUHA 4KV8A 1UWAA 3HZGA 1RWWB 2VKZG 2HFNA 3VV2B 3TZZA 4Y65A 4KHMA 5T41A 2ZH1A 2ALYB 4WP8A 1HNZJ 1AXQA 1UEKA 3LH2S 5E3CA 1JLAB 5DZ7A 3LP2B 3SSRA 3R7SB 3ZZUA 2VBZA 4XDDA 3LPEA 2B6AA 2Z2ZA 1XMOF 3MOJB 3ET6A 2OMOA 3N4WA 2RQKA 5F8GA 7FDRA 4PWUA 2HS4A 4CYUB 4Q5VA 3BR8A 1HWIA 2LQBA 5DQIA 3M9OB 1D09B 1ZBTA 4RW7A 1JJ4A 5J2QA 4YOEA 4LIWA 2YPZA 4UY85 1FKPB 3CJSA 4Q2LA 3M6WA 4U7CA 1EQ0A 3EZUA 2HFZA 5DG9A 2RDIA 4B3MJ 1M0SA 2CPDA 3S01A 3FSYA 2VONA 2MB0B 2WSFC 3DLLQ 5AXNA 3BO3A 1CEZA 2KZZA 3RRGA 4I2PA 1WHVA 1RTJA 4RW8A 2XULA 3D5MA 4CWBA 4LFCJ 1HNZF 3TQEA 2ZITA 3FRYA 3BZQA 5C24B 3IS9B 3P6YC 3Q22A 4U8VA 1R8AA 3D66A 3MF5A 1N8RT 4N41A 5E2QA 1RCXB 2NXJA 3TYTA 4BCAA 4TY8A 2MHEA 1VQLS 2J9DA 1JLQA 4NZ7A 2GX8A 4N77A 3D6FB 2YNFB 5J2PA 1WF0A 3T9NA 4KFBB 2DKOB 3GIJA 3P49B 3FUYA 1R0BG 3MECA 3QNWB 3M1VB 1FD2A 2CWKA 1Y00A 3MPUB 1LWFB 4H4MB 1U2CA 2ADCA 2R7RA 4RW6A 4B3MF 4MJKA 1JQGA 1XJWB 1BGXT 2M3DA 4TU8A 2E9TA 3KLHA 2QL9B 3NNHA 1U6ZA 4YR0A 3D0IE 1HBUA 3BF4A 1YJWS 4RWWA 4NWBA 4QWCA 3PKMA 1TU0B 3GFYA 3P8BB 4LFCF 2DNRA 2G0JA 1NDPA 3K5LA 1IQTA 3I96A 1NJIT 1U2RA 2DNYA 3N79A 3OHAA 4K5RA 1SQGA 4UT4A 4PG7A 4NRUA 3H7HB 1RBLA 5A6PA 4URGA 2HMIA 3QT7A 2XLIA 3I32A 1CPZA 2A0FB 2VFVA 3ZZPA 1S6UA 2JLFA 1NXIA 3KK1B 2EFNA 5IC4B 2J0WA 2MKHA 2QZ8A 1IBMJ 4WWSA 2V9KA 2ASYA 2ZNZA 3MAAB 4IKAA 4XPEA 5DLFA 2NLWA 2LEPA 1U1OA 3MDFA 4NMLA 5JUMA 2G2YA 4X4NA 3PDNA 2L9WA 4KGVB 1VHIA 4CO5A 1Q5VA 3D0HE 3MR7A 4DSIA 4WU2A 2UU9J 1ZOTA 1JKHA 2ACYA 1IKVB 3CCES 4KC5A 4OI0A 1DQ8A 3Q2TC 2HWTA 1BMQB 2CQPA 2ROPA 4PG5A 1KLNA 2CJ9A 3G6VA 4DSKA 5KFJA 2EXUA 4I69A 2RAQA 1WHWA 3G8TA 3CJKB 4A8QA 2HVIA 2H5JB 3H4BA 1PYOB 2LKZA 4HTIA 1X4AA 3DLKB 4AL6A 2MDAA 5KFBA 3TW0A 4AYBD 1GTHA 4CTAA 5HP1A 3MM8B 4MYTA 5KFUA 3MD3A 4C98A 2HAFA 3HSJA 2V6AA 2WW4A 2YNHB 5HK4A 3O44A 1HR0F 2EC0A 3G8QA 1IBMF 2HPUA 4OJGA 4F0MA 3DGPA 1Q1KA 4EEYA 1Q5YA 1IBLJ 2DGXA 2J7UA 4ILRA 1FNXH 4LRAA 5CYQA 3RRKA 1U1MA 2HNZA 1DJ0A 4PXDA 1PJ5A 1SJ3P 3NWRA 3AH6A 2DISA 2UU9F 4J9OA 1R7IA 2HLTA 1U0HA 1UVIA 2UP1A 3MMJA 3VAMA 1AA1B 3C3LA 2F4VJ 1QVGR 1S1XB 3UVJA 2WB4A 5KFSA 4QCLA 4TU7A 3RR7A 2KHDA 2HVEA 2MQPA 3C46A 2V4JA 1YI2S 2FHMA 4IOAQ 2P5VA 2O3DA 4OHZA 2NS1B 2RDJA 3TEGA 1PIEA 3RUBL 4K4UA 2IIHA 3HT0A 3CD6S 4X4QA 2DNNA 4DFJA 2ILYA 3A3NB 1S0NA 1WTFA 4DUYJ 4GKJJ 2HKEA 5HLFB 3CWJA 2WZ1A 2RILA 3V5RA 5DDQC 2MZTA 3KWMA 3F0NA 4WFBQ 3T1HJ 4TN2A 4LVOP 3IRWP 1IBLF 4WFZA 1UEUA 5KG2A 3AQPA 4DEZA 4P6QA 1NSPA 3MMAB 1U26A 2R8KA 2C2EA 1FK9A 5CYMB 2AWZA 4UOFA 1F0XA 1RT4B 5IV4A 2QA4G 1LWCB 4JV5J 3M32B 2R8HA 4XO0A 2I0XA 2DHAA 1TK0A 2A3JA 3K5PA 5E3AA 3DXBA 1SC1B 1NK5A 1CQMA 2QV6A 2JLGA 4QYZK 3NLCA 4I2QA 4DL3A 1FESA 2D69A 2F4VF 2DR8A 3J7AN 4I7FA 3WX8A 3Q8PB 5EDWA 2PO4A 1BHNA 3BBCA 4AXIA 1E6YB 5DQHA 1HD1A 5THWA 2XCAA 3SV3A 3GONA 1VIOA 3FSXA 3LUYA 4F25A 2CPZA 3OFGA 2DHSA 2KHCA 3LAKA 4ZJOA 3SCJE 3DRSB 5IT9Y 1S6QB 5KFAA 2W4DA 1WC0A 3NBPB 4DUYF 2H54B 4KHRA 3ENAA 3M8PB 2HYIB 2ZUAA 3P3DA 4PG6A 1A9NB 2MKSA 4DR4J 4DV7J 2IJRA 4LSNB 2AP6A 3T1HF 4QW8A 2M88A 1WACA 5LXRA 2XS2A 2ATCB 1G3OA 1F3FA 1FJCA 3VQSA 2KVIA 4DL0C 3BN4A 2JHEA 1HFEL 3GYGA 4JV5F 4K59A 3HF5A 2GVDA 4B17A 2XO7A 2ZHAA 4OYBA 1SJ1A 1WD6A 2VG7B 4USMA 2IRXA 3ZZOA 4ETZA 2JL9A 2C28A 1K9MT 1T11A 5EHHA 4F8RA 3H5SA 1N54B 3OHBA 3MPWA 2AGQA 2CJBA 2RRNA 3JAMU 4ECVA 1PO6A 3QAUA 1FDAA 5KOXA 1J5EJ 4HR2A 1S9EB 1X5SA 2CA9A 2X1FA 1ZM4A 3MWBA 2JH3A 1GK8A 2FVPA 3DYAA 2BQUA 1HPZB 1S7HA 2BKPA 3R7BB 1SIZA 3THTA 3WC2A 4QU7A 2J8AA 2RKIB 2LQJA 3I56S 4DLGA 1YIJS 4YN3B 3BO2A 2WSCC 2XMJA 4DR4F 4DV7F 1UVMA 2XGQA 4OYXA 2CUYA 2ZZTA 3C6UB 2H5IB 2ROGA 1U6FA 4FKXA 3H90A 2CVEA 3SQGA 1UJ5A 3G71S 4UTGA 2FB0A 3GG0A 3S1TA 1T05A 4IR9A 5KFHA 3Q23A 5T14A 5AJ3J 1UJ6A 1GMWA 1HWJA 1T03B 4B9SA 3CJ8A 1RT3B 2E66A 2HFVA 1MU2A 2GQQA 3MEKA 4ZDNA 2Y1JA 4M5LA 2JEFA 4O4GB 5AXLA 1J5EF 2UZAA 3MTJA
chains in the Genus database with same CATH topology
3LF0A 3V6KA 1HI0P 4ECRA 3PO5A 3M1VA 1R43A 2J6TA 4J9KA 3C8YA 4OI6A 4AL7A 1N36F 2OLWA 2CQ4A 2VG5B 4YR2A 5E3QA 4YB1P 3RW7A 2QIFA 2ZD1A 3BGFA 2GO9A 1H3DA 1IKWB 2MZJA 2RRAA 4K4ZA 2LU1A 3N9UC 2AYMA 2RKIA 1F2GA 1DAXA 1U1QA 3PR4A 4H4MA 2VUGA 1YJ9S 1H7WA 4ECXA 1Q79A 1VQKS 3F41A 1LW0B 3CPWR 3LPYA 3OR2B 1T8EA 1X5TA 2Y1IA 4Q0BA 4NRTA 1VC6A 5DETA 2FPHX 3NNCA 3H2LA 2FLLA 2CQHA 3CEDA 4G1IA 4G3IA 3L7PA 5HP1A 2HHXA 4HH0A 3MFHA 3T3FA 1WWHA 1QSLA 1FXDA 3PX0A 1LFWA 2VB6A 2UUTA 3IAS9 4G1QA 3FQLA 1KOOA 1PILA 4LVNP 1IXKA 4I6YA 3KYLA 3PHEA 4WJBA 2W8LA 3TVYA 4B3OB 2XSFA 1X4EA 1QUPA 3FRZA 4GMKA 1NB7A 4CCHA 3JSRA 1AFIA 4LF7F 3V81A 3M2RB 1RKIA 2AV5A 4URSA 5J2NB 2DR5A 5C25B 4ECTA 1DQAA 4TKTA 1IR0A 1FRIA 4DSEA 4MTPA 4MYUA 2K7JA 4TQSA 1R8CA 5KFPA 4KB7A 5DGAA 5F8JA 4O44A 4FZVA 3W3SA 2E9RX 4WCEQ 2QFJA 1GTEA 4A8KA 4KSEB 3MAQA 3H25A 4ZP8A 1XR6A 5B7WA 1P8GA 4DFPA 4C0HA 2P9GA 4IOCQ 2LXUA 1SUQA 3I9V9 2DT9A 2R4FA 4DV0F 1TV6A 4NL5A 1QUVA 3N6NA 4JI4F 2L48A 2NREA 4IRKA 1KQKA 5E3RA 2QSFA 1NNDA 1GH8A 3QWUA 2OD6A 4ID5B 2M52A 4FNHA 3T19A 5KG1A 2IJNA 5HROB 4G6VB 2IMWP 3F73A 5H9EJ 2F9DA 1CVJA 3PIPQ 1RT7A 3H40A 5AJ3F 2FJVA 1KR4A 3DLBA 1JNZB 3H59A 4OHXA 4LUBA 5D8HB 4MKBA 5D4LA 3LGMA 4PXEA 5HO4A 2MKKA 3MM7B 3K7RA 4LF4F 2LU2A 3KK1A 2MGZB 4DQQA 2DPIA 1F60B 1S6OA 4KKOB 4UQGA 4D3HA 2DJWA 5KFCA 3I4PA 1X0PA 1L3SA 4Q44A 2AJQA 1FXRA 1NH7A 2KYZA 2X1BA 5A8KB 1Y0HA 4LF9F 2PMHA 4OX7A 2MKJA 3QLHB 3CB4A 1TFYA 4R8UB 1N6QA 6FD1A 2ILZA 3ICLA 3CCQS 4RBUA 2CQ2A 3IWNC 5M2PA 2DB1A 3HHLD 3QJLA 2B4UA 2WHOA 5GAEU 2XLJA 3R3TA 3AJ1A 1KS2A 3SI8A 3BGUA 1JJHA 1R0AB 4WFXA 1LV5A 2AYEA 5CZVA 2IM2A 1KD1T 1VOMA 5BR8F 1JLCB 2C42A 2ZOGA 4PQUB 3DI6B 3CO9A 1NRKA 1S1WB 1K0TA 1ZZFA 3LP1A 2FIUA 4X4RA 1S72S 2ZH7A 3HVAA 2X1AA 4QR2A 3CIZA 3PJXA 4MIBA 2NR0A 4PXCA 3EPIA 4IFVB 2CPXA 2FDNA 1HBOB 4J9RA 1N34F 4EYHB 3BN7A 4OJHA 2JX2A 3R5DA 2IC3B 4K50A 1OO0B 4J37A 3MM9B 4EBDA 2V8DA 2YX4A 3VAFA 1IKVA 1NO8A 3J7YU 1ROFA 1HARA 1REVA 4HLBA 3DLHA 1CG2A 1U25A 4RWXA 1DHMA 2IYIA 4TLQA 2CIMA 2HHTA 5C25A 2B7BB 4DOZA 3PIOQ 4AFFA 3I5CA 4NLVA 2XGPA 1X9SA 1HBMB 2IM3A 1VRTB 4OHYA 3OUYA 2GIRA 3T9ZA 1UL3A 3I31A 1KNZA 2PSZA 4ZMMA 3V4IB 4RBTA 2DIVA 3HHLC 3OTEA 2QT7A 2H9ZA 2IA0A 1FRHA 1EP4B 4WK3A 1SKRA 2BANB 3MFIA 3TUIC 1BY9A 5A8RB 4O23A 5GVQA 3HHLB 4Y2AA 4ALZA 5CYJA 1XC9A 3MD1A 1HNXF 2W4PA 1TL3A 3IG1A 4YUDA 3GV7B 5K8MA 1TKTB 3HXMA 5A8WB 2ERRA 1C0UB 4ZKAA 3G6XA 3LP0B 4B3TF 1TK5A 3DLKA 2VPZB 1Y5NB 1SJQA 1ZAVA 1SJ4P 2WBMA 3MM7A 3NNAA 1RTDA 1TVRB 4K4SA 2J6SA 4OJ1A 4USIA 4EBCA 3IC1A 4KKOA 3QJJA 1FERA 2OAUA 5I42B 5K9FA 4HH1A 4OZ1A 2W9AA 2DK2A 2C3PA 4YB7A 3QGGA 4QQBA 2E1RA 2GFFA 3MM8A 1JLGA 4IFYA 5D6GA 3PW7A 5E5NA 1QAJA 5JVGQ 1MMNA 2MQMA 2MPUA 3L95X 2QA4S 4RNNA 4J5OA 4KV8B 1NH8A 2FJDB 3LGNA 3Q8SB 1EETA 1SIWB 5I3UA 1RAJA 2RQMA 1N48A 2I2YA 1FRJA 1N0VC 3CDEA 2YNHA 1W2IA 1UA1A 1VFJA 1VMBA 4JYAF 4JV0A 4HL9A 3TQ1A 1DBDA 3E01A 2IM0A 3JSYA 1Q16B 4C3KA 3THVA 4DWIA 2HHQA 3DI6A 3OL9A 2YWGA 3M8SA 3CC4S 3WBZA 4RBVA 3K58A 3Q0AA 5IM0B 3QGIA 1M5HA 2DR7A 4DLEA 5L1KA 4IFVA 1HBOA 5DJBA 1P27B 2B9YA 4USJC 3CMAS 2UVVA 2Z2LA 3HVRA 4YY3F 5FDLB 2M8DB 4FF1A 3MM9A 2DNQA 2W24A 3E51A 3CCUS 2N7YA 3IXQA 4ED2A 5B0GA 4F3MA 3MXHP 5D78A 1M90T 3HVTB 2AD9A 1S79A 2X51A 4DJBA 1Y7PA 2GV1A 2JOQA 2EG2A 4WU3A 2B6AB 4A46A 4TNOA 4FS1A 4LF6F 3DOMA 3PFEA 3V4MA 3W7BA 3KMSA 4Q8FA 2Y1RI 5DDRC 4YDDB 3DU5A 2KT2A 2KU7A 3FEYB 2FLPA 4Q45A 1X4HA 5G4DA 2EFVA 2BE2B 5MAOA 3G6ES 3TANA 3MGJA 1V3RA 3IO1A 4OX9F 3G6YA 4OHWA 2AX1A 4KO0B 2IJFA 1BWEA 4NXMF 1HMVB 2ZUGA 3GB0A 3H8YA 3K8WA 4X4SA 3CCTA 3QGHA 5F0WA 3UPFA 1S1VA 3HHLA 3CCSS 2DHGA 1DTQA 3IWLA 3JYTB 4RW7B 1P6TA 3WC0A 1NJZA 1S1TA 4OIXA 3B8HA 3HKZD 2V0NA 3EUNA 1U48A 3J7YI 1N56A 1FTRA 2XSJB 3JTOA 3SEOA 5H1SV 2VBYA 5J2QB 2KFYA 1S1XA 2A2DA 4QPTA 1M5OC 3K8VA 4NLQA 5L1LA 2J7KA 3FNNA 4MAKA 1B64A 3H98A 3CTRA 1Y3JA 2J9EA 1JB0C 1FEEA 1UP1A 2DH7A 3K5OA 4UOCA 5I3QA 1RKJA 3FDSA 5KG5A 4WXWA 2YX7A 1NK6A 2OPRA 1YQHA 5EN1A 5L9XA 5HQ8A 2KN4A 3BREA 3VF0B 1J5OB 1GAOA 2BV3A 3MEGB 1JXEA 3I0SB 2DGOA 2BZ2A 5G0RB 4C7QA 2WTFA 3SCIE 1VS3A 1LQ9A 1VHFA 3PNIA 5H9FJ 3TVZA 3O6QA 2PD1A 4RW9B 2JVOA 3IWXA 1APSA 4Y2KA 5KFIA 5IS2A 3KK3B 2JC0A 3KG1A 4OFZA 3KJVB 1FRKA 3AB4B 1RT6B 3DRRB 3BJYA 1V6HA 3PRDA 3MPVA 2U2FA 1B0PA 2AJ1A 1RDRA 2CPHA 4FP9A 4U6PA 1JJ2R 3M30B 3NL0A 3ENQA 2VL1A 3MMBB 2I1RA 2PE8A 3F56A 1XEZA 2RMLA 5E7OB 5IM0A 4FF2A 1ZH5A 4X84A 2ZE2B 4I68A 1K8AT 3BSAA 5J1EA 1ZPWX 4IG0B 4ELTA 3TAPA 4ICLA 4I2PB 5FDLA 1HI1A 3I0RA 3T6JA 4H4OB 1JK9B 3PO4A 2HWHA 1SH0A 5EWEA 4CH0S 2KB2A 2FLNA 1CC8A 3TAQA 2OPPB 1YHQS 2VFUA 4ETXA 4QIGA 4TLRA 1RTJB 3OJSA 1TK8A 2P6TA 4RW8B 2XCPA 2YWHA 1NEEA 1K1SA 4RKUC 2XWXA 2HNYB 2EK6A 2VH7A 2YH0A 1NAQA 1TKZA 5B0FA 3GV8B 3CD7A 3KLEA 1Q7LB 1RJJA 3FSIA 4DV6F 1URRA 1HI8A 4C97A 3AA8A 4DMZA 2BE2A 1FJ7A 3MEEA 4RU9A 1R6YA 4Y6IA 4C0OC 1TKXA 4H4KC 4OX6A 2IRUA 2EKYA 4ZK7M 1X4CA 4B3RF 2LCWA 3O5TB 3OLBA 3M8QB 4C8ZA 2GJ2A 2PI4A 4OL8A 4Z37A 3MMAA 3NCRA 4F3QA 3KFWX 2B43A 2YKNA 4YFUA 4F2RA 2YQ3A 1W25A 2WOMB 2KXFA 1RT4A 4HHJA 3TO8A 3GQCA 1LWCA 1KFSA 3AHPA 4ED5A 4OI3A 4TY8B 3MZIA 1Q8LA 3MUTP 3M32A 3NMRA 4M5DA 1RTHA 1LK7A 2I38A 2OPQA 3UWTA 4HT7A 5K14B 1X4BA 3B78A 1S6PB 2KDOA 4CI0B 5HN0A 3B4MA 3IR5B 1JLQB 1F9FA 2W8KA 4TXSA 3R1LA 3TVKA 4F4XA 3T5JA 1VQ5S 4J9LA 3M05A 3HP6A 4ZVEA 3UFCX 1J5OA 3ITHB 2BOPA 5J2PB 3EGZA 2PC6A 3FFIB 2FD2A 2AJ4A 1YBAA 5K8OA 4Y00A 3N0VA 3TARA 3DDKA 3H20A 5AXKA 4PPZA 2P9EA 4KRWA 2VFRA 2DTJA 3BB5A 2WRMA 2LLZA 1SH3A 4YP3A 2VC0A 3MECB 3MOZA 3KK3A 3DLEA 3JSMA 4LSLB 1YJNS 2R7UA 3BM7A 3RYLA 2SXLA 3AQOA 2B51A 4J9PA 4X66F 2KM8C 1YGYA 4KT0C 3ENVA 2PMZD 4CO0A 3G96A 1KLMB 2H5EA 2NUUG 3N6MA 2E5IA 3MMBA 4LJMA 4XK8C 1RTIA 2KYXA 2KM8B 4NCGB 4QU6A 3OW2R 3IGNA 5DO2A 1E6YA 1N5YB 1LW2B 1HNVB 1U1KA 2CFXA 2UV8A 1S0OA 2PFFB 4RU2A 4DSLA 5F8HA 5F9LA 3BSNA 4RW6B 2OFGX 3D1OA 5EWGA 4KHPF 2WK4A 2UUBF 4IRCA 3RB4A 1S97A 1MMDA 1O5JA 2XY6A 2E5LF 2QLXA 4DUZF 4EWTA 2J6UA 3CSKA 2ASJA 2HNYA 2MQLA 1BQNA 2QMWA 2OSRA 1UWBB 4KGMA 3J7ZT 4O3SA 3M8RA 1RA7A 4WFYA 1FKOB 2LECA 3DRSA 1WF1A 4ECSA 1HBUB 3U27A 1SL1A 1SH2A 2C3MA 2W25A 3EXCX 3PX4A 1N5QA 3KLFA 3NBPA 3O3LA 2MQOA 2R8GA 1RI7A 4QIEA 4IH7A 1VQ6S 1GXUA 4FXWA 3V6DB 2GCFA 2NSBA 3FEZA 2HGMA 5IXUA 5C42B 3PR5B 1DTTA 5HMWA 3DM2A 3EGNA 1PC4A 4MFBB 4NCAA 5J2MB 2J9DE 3KG4A 5KFYA 3EPGA 1CLFA 3GIMA 3HDSA 4QWEA 3OSNA 1R31A 2RF2B 3VAHA 1AROP 2P9CA 4EZ6A 4FBTA 3J81Y 2YKPA 2XS7A 2KI2A 3HVWA 4RW4B 4RNHA 4E0DA 2BVZA 2E44A 1HD0A 2EK1A 5T7LB 1S6PA 3MCSA 5K5MA 3ULHA 2JLEA 4DR5F 2VODA 2E1AA 4ECQA 1FHTA 4A47A 5C5JA 5A6WA 4KTQA 5AE3A 1D9FA 2DCLA 4WYLA 3ITHA 3N6LA 1FDNA 1VC0A 1Q7YT 2KRRA 3FFIA 2KXHA 2HMIB 2R2SA 1RGVA 1V3SA 3MR5A 3DLGA 3LQVA 3QIPA 1V3ZA 5GAHU 2CQBA 4LFBF 4ECYA 1NJXA 1S0VA 1IKYB 1R8HA 1Q78A 1UVLA 3W2WA 2B9WA 4J9NA 2RRBA 3R27A 2ADBA 4LF8F 2HNDB 4LSLA 2APOA 3IBWA 2ZBIA 2M9KA 3GV5B 2DH8A 1VQ9S 2ZNYA 4HEA9 3LAMA 1KLMA 3PW2A 1F5AA 2XMMA 2VG7A 4FNIA 7FD1A 5DQGA 3PACA 2ZH8A 4DR2F 5CCMA 3PX6A 3IR6B 1LW2A 1RT1A 3DOLA 2L41A 2YTCA 3RB6A 2A1BA 4DN9A 2RU3A 4DQRA 4ZVFA 3VQTA 1VLYA 5D4OA 5B08A 1IKXB 5E33A 4FF4A 2KT3A 1FRXA 4ID8A <