1CC7A

Crystal structure of the atx1 metallochaperone protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
AEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Atx1 metallochaperone protein at 1.02 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
molecule keywords PROTEIN (METALLOCHAPERONE ATX1)
total genus 18
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 1999-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cc7A00
3FGVA 1SB6A 5IXUA 2G9OA 3QMQA 2AJ0A 2N4CA 1Q8BA 1FVSA 2XMVA 2PGCA 2IYIA 4U9RA 3QGPA 4Y2IA 4ZOSA 1YG0A 1P6TA 1R6YA 2Q3PA 3GZ7A 3BM7A 2GA7A 2RILA 3KG0A 5B09A 1MWYA 3IWXA 5B0EA 1TL4A 3LO3A 2AJ1A 1Y3JA 3HX9A 1W2IA 1KQKA 2N7YA 2BJEA 2ASYA 4NL5A 2AW0A 2OD4A 3BF4A 3K7RA 4FNHA 1N5SA 1APSA 1Y9OA 3T9NA 4HH1A 2BBEA 2FTRA 3BB5A 2XMUA 1X0PA 1TZ0A 1YRXA 1YJTA 2HFOA 4OJHA 2W4CA 2ROPA 1OSDA 1FESA 2LDIA 2XMJA 2PD1A 2OMOA 4Y2MA 1FVQA 3FRYA 4OJGA 2HFNA 2KYZA 2VH7A 2K7JA 5KAKA 2BYCA 2LQBA 2GCFA 4DPOA 4EFAC 2AP6A 2ROEA 3VTIA 2GGPA 4F67A 5T7LB 2HLTA 1K0VA 1TR0A 4Q2LA 1U7LA 2OAUA 5F0WA 2OD6A 2L3MA 5A6WA 1AFJA 1FEEA 2OKQA 2ROGA 2W4DA 2QIFA 2QYCA 5B0BA 3LGMA 2XMWA 5F0UA 3BDEA 1AW0A 3IWLA 2OFGX 2JDJA 1GXTA 1TUVA 3HHLB 4QOTA 5K9FA 5B0CA 4DL0C 1FE4A 3KNGA 1RJJA 2K1RB 2KT3A 1P8GA 2ZDOA 4HH0A 3HDSA 2QLWA 1Q53A 4HI1A 2XMTA 1X7VA 2HIQA 2RU9A 3MCSA 2IYGA 3HFKA 1VQSA 2BUNA 2GFFA 2HQIA 1FE0A 2VV5A 3BR8A 4A47A 1KVJA 4ZA1A 1CC7A 2LXFA 1YJRA 2LQ9A 4YEAA 1CC8A 3DXSX 2EW9A 1YJVA 2HLUA 2RMLA 4A46A 2FIUA 1CPZA 1LQ9A 3F44A 1GXUA 1AFIA 1Q8LA 1MWZA 1X8DA 4HL9A 3TRGA 4DN9A 5B08A 1S6UA 3MZIA 3CJKB 3KKFA 3KG1A 3E8OA 1S6OA 2QLXA 4OIXA 3CJKA 1V3ZA 1JK9B 4A48A 2RSQA 2KKHA 4Y2KA 1ULRA 4HI2A 4A4JA 4OJ1A 1N5VA 4Q2MA 1N5QA 2ZDPA 1N5TA 2GV1A 2OFHX 2XMKA 1XBWA 2IFXA 3FMBA 2BJDA 2KT2A 2W4PA 5B0GA 2XMMA 2K1RA 2FB0A 2GGPB 2K7KA 2OP5A 3DCAA 1QUPA 2K2PA 3HF5A 5A6PA 3TOQA 1SI9A 1Y3KA 1OQ3A 2ACYA 1FD8A 5B0DA 1URRA 2CRLA 3LGNA 1YJUA 3HHLD 1SQEA 1Y0HA 5B0AA 2FHMA 4FNIA 3UDCA 4NPOA 1IUJA 1WD6A 3HHLA 3BN7A 4OJ3A 4YDXA 1JWWA 1VQYA 3WDOA 3HHLC 1TL5A 2GO8A 3BGUA 1OQ6A 5B0FA 3TNVA 1KVIA 3I9ZA 2N4DA 1OPZA 5T7LA 1Q4RA
chains in the Genus database with same CATH superfamily
2QLFB 1R8CA 1XR5A 4PEOA 3FCVA 2ZUAA 3FNNA 2N3LA 1TKDA 3D0IE 2KFYA 1IJEB 2PGCA 4CLTA 3QGPA 3PNIA 3O1LA 1K9MT 3NAIA 2QA1A 2EG2A 2DY1A 2K06A 4QQBA 3R7SB 4USMA 3N5BA 1WEXA 5B0EA 2E66A 3CIZA 1HBMA 3FJ2A 4R5PB 2QFIA 2ZH9A 3M8PA 2KFNA 1GQEA 5EUHA 1BWEA 2BQUA 1APSA 1Y9OA 2WB1D 3PIPQ 3ENWA 2FVCA 2C2RA 3NOGA 4LR7A 3KOAA 9RUBA 1Q95G 2BANB 2Y1JA 2UUBJ 4MYUA 3Q2SC 4OJHA 1PYOB 5GAHU 4LF9J 5IT9Y 4CYUB 3O3LA 4DWIA 5L1KA 3J7Z5 1NB7A 5IT9U 5EX0A 4LSLB 4JV5F 1RZMA 4MIBA 4UOCA 4BWMA 4UT4A 2WCXA 1ZA1B 2O3DA 3B78A 3QAEA 4WFZA 2CJQA 1KLMA 3WHIA 3PACA 5T7LB 3LWLA 4JI3F 2F9JA 1LNQA 2G2OA 4JI4J 3K0JA 2B0GA 2C3YA 1U7LA 2RNEA 2RU3A 2D3O1 2OD6A 4TY8A 3T1YJ 3UCUP 1O8BA 3MEEA 2JEFA 3KYLA 4X4UA 5C24A 3LH2S 3KLEA 2YY3A 1JX4A 5CHCB 1QM9A 2LECA 2YQ0A 2IPOB 4KGZB 4QWDA 2R7OA 3KJQB 4OI3A 1B0TA 2WSFC 1ZTWA 2XZDB 4JYAF 1DURA 1QAJA 4IG3B 1GXTA 4NI2B 4PQUB 3D66A 3Q8QB 2ZVIA 4GC6A 2XY5A 1TFYA 1TELA 4J9KA 4ECXA 2F4VJ 1I1GA 1KN6A 2RJZA 2GZOA 2KT3A 4DQSA 4U95A 5KTQA 1CJTB 2KN4A 2GMJA 4XK8C 3MXHP 1CULB 3KWMA 3OFHA 4DSIA 3FFIA 2HZVA 2G0JA 1AYEA 4M8LA 1X9MA 4LRDA 4CQ1A 2WW4A 1CJUB 1FDDA 2KVQE 3V5RA 1VISA 2HURA 4UZBA 4DG1B 3CD5A 1EHWA 2IRUA 4USJC 1XIQA 5KFJA 3VAIA 1HR0J 2W25A 3OL9A 2ZHOA 3CJ2A 3TAMA 4YHHF 2YNGB 2ERRA 3LOUA 1QD1A 3CXCR 4PABA 4Z7YA 1JIHA 2FHKA 2FHJA 2PN6A 2YNGA 1XC9A 4DUYF 4NZ7A 3M2UA 3OV7A 3NL0A 2JNJA 3H8YA 1JJ2R 3G9CA 2OGUA 4ANCA 2RB7A 4DUTA 4F04B 3CDWA 3ZZZA 3C66A 4NMLA 3SXLA 2ATCB 2CUYA 2KHDA 4JI1J 2LA4A 2B7CB 2HHPA 2CFXA 3MM7B 3OR1B 1ITPA 1F3FA 1TKTA 2OPQA 5D4LA 1JWWA 5K8NA 3MM7A 3OR1A 5B0GA 2LA6A 3DCAA 4URQU 2MQPA 1H2TZ 5KFNA 4LIWA 4WFNQ 1T05B 4J91A 1J5EJ 4R0EA 7FD1A 2HHQA 1OY8A 2VDHA 2E5GA 1R8AA 1Z2LA 1JKHA 3MM6B 2HNZA 3UVJA 3ZFVA 3ZTQA 4IFYB 5IZHA 2OUGA 3CCZA 1WUUA 3GU0A 1HKAA 4KHPJ 3NCRA 1IUJA 2CDQA 3C16B 3LQVA 4ZIWA 4RBVA 3H4DA 3SV4A 1H38A 2XNRA 2C3OA 4QPTA 3SZ2A 4NLVA 1RAFB 2N3OA 1U0HA 3MCOA 4QWEA 1S76D 3LP0B 3VGUA 3M1VA 2R8GA 2UXCF 3UNGC 3JS9A 3MFIA 2RIJA 2PDAA 3MR3A 4RNFA 1X4FA 1F60B 5CCLA 2A3JA 2CYYA 3QQCD 1FA0A 4LFAJ 4ELVA 1RT4B 1VQ4S 3A4TA 2JSXA 2EFVA 4YR2A 1V3RA 3GJRB 2LLZA 3CDUA 3MPVA 3FBEA 4L6V3 5DZ7A 1RAIB 1MLAA 5KFPA 2VBYA 1HL6A 5A2QU 3OUYA 2EWHA 1EZZB 5AJ3J 1KR4A 4F3QA 2AHOB 2N7CA 3GILA 1CLFA 4Z37A 5IT4A 2I0XA 4JB8B 2LDIA 3DRSB 2I38A 4KE5A 5KG3A 2WONB 3PR5B 1B7FA 4AT1B 5F8NA 5KAKA 3PTWA 2LQBA 3QFHA 4FYYB 2W1BA 1S0VA 4ES2A 3OL8A 3J80U 1BD6A 1N4LA 2F65A 2RUGA 3CJ5A 3Q24A 1KHVA 2GJIA 3AD7C 2ACMA 4V19J 2MZJA 1KFDA 1YQHA 2J76E 3M9NB 5KFQA 2VIHA 5CXTA 1JKHB 5B0BA 5K8PA 1J27A 3MM9B 1MN9A 2V2ZA 2EFNA 2JWNA 2XG8A 5IT0A 5GAEU 3T5KA 3OT9A 3MM9A 3I96A 4RUHA 3TYTA 2OJ3A 4K4XA 4ED6A 3D6MB 3JSYA 3C14A 4DL0C 4IOAQ 1HNIA 3FCHA 4KR0B 1F9HA 5E3PA 3U7JA 1RWXB 2F63A 1NJIT 5J2PB 4OZJA 4JI8J 2R2SA 3MTJA 2RKIB 2OEKA 1Q53A 4N47A 4Z7CA 3NEKA 1M5HA 4CI0B 4RUBA 2GIQA 2K3IA 2ZUGA 1I3OB 3O5TB 3QRPA 2CKWA 2BJ7A 2CQBA 4DFKA 2LXFA 3GG1A 4N8NA 2VODA 3IA0A 4M1KA 4M5DA 1YBUA 2C2MB 2R7UA 2EW9A 3ZO7A 4A46A 2ZH6A 4RW4A 1SC1B 3TJ8A 2FJXA 3DLGB 3SSQA 3TVZA 2MQOA 2YNHA 2H4WB 2JFKA 3AHPA 4JI5F 3F44A 2AQ4A 2AJQA 1RGVA 1F6TA 2IA0A 2YNHB 1X8DA 1H3DA 2XWXA 2DHSA 5BYSA 4CLUA 2L41A 5A76A 1RTJA 1U24A 1N52B 1WTBA 4UY8T 1P9QC 3CVKA 1RISA 2YKMA 3G86A 4IG3A 4ED4A 1Q82T 1QTNB 2Y0BB 1KBRA 1YTYA 1Z4UA 3H59A 4HHJA 4ID5B 3CJKA 2OPPA 1JK9B 1KQFB 5IV4A 2KTQA 1C0UA 1HBOB 4CT9A 4YB1P 2WONA 3LUYA 1NK0A 2X51A 2VG7A 4DX6A 1FD2A 1KONA 1WDTA 3QIPA 4H4OA 4RKUC 1FFWB 2Y1IA 1N5TA 1KC8T 1X5OA 5C2GA 4QIEA 2BKOA 2K7KA 4OX9F 1RT4A 1F5CA 5C42B 3M8RA 3H0PA 4KGVB 5A6PA 3G96A 1U0SA 2WVFA 2MJUA 4B9NA 2Q43A 1C4AA 3IRXA 4I6WA 2F7VA 3DDIA 2B6AA 1BHNA 2J9EA 5D4PA 3NGSA 2A2CA 2LYVA 4KGMA 3QT6A 4RUCA 3KHGA 4NLSA 2H5EA 4LF7J 3JSBA 2YWFA 1BLUA 4ZP9A 3EJMA 4HT5A 3TZWA 4QYZK 3DM2B 4XPCA 1HNVA 4X4RA 1IR0A 1G2EA 3CO9A 2VPWB 1KVIA 2GJFA 1YRTA 2COLA 1WC1A 1XEZA 4IYQA 1LWFB 4JI0J 1RAJA 2AZ3A 1RHJB 3QZ8A 1VBYA 2DR5A 1ICEB 4PWDA 1FJCA 4X62J 4PRFA 1HBUA 1DQAA 2LDYA 2ZE2A 3OTOJ 3GLJA 5KOXA 1NCLA 2A0FB 2YVSA 3OTBA 3NOCA 3R5CA 3U1LA 4N77A 1D9AA 4ELUA 5IWAF 2XHCA 3CEDA 3DOLB 3FDSA 3PCOB 3BJYA 5J2QB 1KQSR 1CG2A 2BKNA 3R6LB 2V68A 1Q16B 4HEA9 5KFCA 1D9FA 4OI1A 3NNAA 2XZTB 3V4MA 2WAQD 3MTKA 3TUIC 1FDBA 1YZ6A 2BKPA 2WVCA 4PG5A 1NSQA 1RT5B 3TQEA 4E0DA 3C16A 3V2UC 2YKMB 4MJKA 4O44B 1U1PA 4Q8EA 3ITHB 3Q86A 4JOUA 2HFUA 4DUYJ 4IG0B 4DLGA 4QR2A 1S9FA 2OO4A 1MNEA 4LF5F 4DJBA 2JFDA 2GHWA 5AE1A 2RDJA 5J2MB 3FRYA 2WVEA 2NSBA 3LF0A 1QLNA 2EC0A 2DT9A 2V50A 1CJKA 2VJUA 4DV5J 2DR9A 2V63A 3J7YI 4U6PA 4HTJA 3S01A 3VVUA 2KFZA 2YNFA 3CDEA 2XI3A 1CJKB 4X62F 1JLQB 3HKZD 1SC6A 2J5AA 2VFRA 4UQTA 4OX8A 3DGPB 3MEGA 2OKQA 4WKYA 1WTFA 1QSLA 4DOZA 1RABB 3NGUA 3DLEA 4C8KA 1RTJB 5HVGA 2UUAJ 1T9YA 1KOHA 3GSIA 4HYKA 2E5LF 3KLIA 5GMEA 2XQCA 3WC2A 5D3GA 3I87A 5LXYA 1S7HA 3Q23A 2CPDA 4CH1A 1NB2A 4CH0S 2W8LA 2GHPA 2WTFA 1XR7A 5L1IA 2W9CA 4IRCA 1BQMB 1HQEA 4BHQA 4ICLA 5K14B 4O3RA 3NNHA 2YH0A 2ZDOA 4DV6J 3QIDA 4UUXA 1H7XA 3IAM9 3AJ2A 2CVIA 3QNWB 2Q66A 1WOPA 4Q7AA 3D0HE 1X7VA 4ZLLA 1UVJA 1NDCA 4K4TA 2BUNA 4ZP8A 2FLNA 4OMFG 2GFFA 2VV5A 1QE1B 3DRXA 3IBWA 5KG1A 1SKUB 2C3MA 2WB4A 2WOMA 3TWZA 4C6AA 1KKHA 1J5OA 1S99A 1R0AB 4YQWA 1LV5A 1RDRA 1C0TB 1PAUB 3MM8B 4RBUA 2D3UA 2DHGA 4UF4A 5D77A 1RTIA 3U27A 3RR7A 5JUMA 3SDEB 3DYAA 4C4WA 2AEMA 3UE2A 4CNYA 1RT2A 1QVFR 4DMZA 1NHUA 3C8YA 3WX4A 2HS3A 3R5BA 2MQNA 4PXBA 4ZLNA 3JYTA 5H1SV 1ZYQA 1S6UA 4I1TA 3PKYA 4KYZA 4NLDA 2XGPA 2HYIB 2M3DA 4WTYA 1UJ6A 2AF6A 3OTCA 4K4ZA 3AXKA 2ALZA 2ZBIA 1B64A 4QWBA 3ISZA 4MIWA 2UVRA 1KEKA 2HZAA 3PJWA 3B54A 4O3PA 1AROP 2HGMA 4ED3A 3T3FA 2GIRA 2B7BB 4EK2A 1S0OA 3W2VA 5GAGI 2QN6B 2YX1A 2B8QA 4WIQA 1FJ7A 2AX0A 1HMVB 4AE5A 1M5PC 3N79A 1PBUA 1VIOA 4DL7A 3MAHA 2ZM6F 2H4YB 1HA1A 2B4UA 3AA9A 3KHLA 3CUNA 1FJEB 1HWJA 2V4JB 3HHLD 3VV2B 3IGVA 3H5SA 2AGQA 1XMOF 2MZQA 4NPOA 2B4PA 3THPA 1IBMF 2E5LJ 4ZJLA 2QTWA 2LEAA 3AA8A 1M1HA 1TL5A 2GO8A 3J7YU 4A8QA 2VC0A 3HVRA 4B9MA 3EVWA 1BQMA 5E41A 4EBDA 3G6VA 2XS7A 3JTNA 3PEHA 3SFGA 2JLGA 4UOHA 2BJ3A 4ALZA 3G87A 1WKJA 2R7RA 2E5JA 2EEYA 3O6QA 1RACB 1GMWD 2W7OA 2KDOA 2R7QA 1WG5A 3KUHA 4Y2IA 2MHNA 4DV3J 4XO0A 2P9EA 1EB0A 2VPZB 2BQ3A 1AB8A 2VASA 1JLAA 3GZ7A 2GA7A 3C6UB 3ZTOA 4RO0A 1X4CA 1NDPA 3T1YF 1S12A 3L95X 5D3GB 4C97A 2BJEA 4HACA 4NL5A 5L39A 3I5CA 3N9UC 3OHBA 4K0KF 3H2LA 5JVHQ 3M8SA 3EPIA 4FP9A 3T9NA 2ADBA 3RR8A 4L3KA 4DFJA 3GFXA 3UFCX 3PW0A 2C42A 4IH7A 1R31A 4C11A 3EPGA 4KFBA 4RBTA 1TTHB 2CPXA 4WFXA 3BN4A 1SUQB 5HBMB 1FESA 1M5SA 1PBAA 3GFYA 4USIA 1B0VA 3W2WA 3OVAA 2UUCF 2HS4A 1VC5A 4YDDB 1DJ0A 2ZH7A 5KT5A 4F26A 5I42A 1LFWA 2IC3B 2XSFA 1PJ5A 2VBZA 4ECYA 2OIHA 5C7PA 3PO5A 4F4KA 4TQSA 2HS0A 3MM8A 2FLLA 4DR5J 1N0VC 4PXCA 1YHQS 1SJFA 2FVSA 4EO8A 2R7XA 1Q8IA 1JJCB 1S4EA 2CNOB 3WBZA 2RQCA 1FEEA 1RT2B 3H90A 3T5HA 5J2QA 3DLBA 4JV2A 3HK2A 1UCNA 4MMOA 4DR2J 2XYHB 4IRDA 3D9BA 4DZDA 3KLHB 2FY1A 2XMWA 1FHTA 1N56A 5KFTA 5AXMA 5KG4A 3IWLA 1YJ7A 6FDRA 1FXRA 5U47A 3RBXA 4B3RF 1TUVA 4TU8A 5DG9A 1G1XA 5K9FA 1IBKF 3M2VB 2VG6A 1NK4A 1ZZFA 2ZBRA 1REVB 5AJ3F 4QWCA 2FZGB 2E9TA 2CPEA 2VG6B 3GYXB 2CPHA 3GJSB 5DLGA 3DOKA 3AD8C 3M2RB 5LMUJ 4QJVA 4B3SF 4OX9J 4KBIA 5H9EJ 1FCAA 1SJRA 4LF8J 3DGVA 1VFJA 1RB0A 3PW2A 4IUFA 5FLXU 1QAYA 1I94J 2IAJA 1EETA 3N5FA 3DRRB 4PUOB 1HW9A 1Q8KA 4E8UA 3KLFB 5KFZA 1XMOJ 1EP4A 4ZPAA 4X4OA 1MU2A 5CABA 3B4DA 1Q8LA 1UFWA 1YDLA 3GG0A 4KH1B 2XS5A 1SBRA 3JAMY 2UP1A 4WP9A 3DI6A 2E5IA 1SJQA 1YJWS 4ZVHA 4P72A 2C2NA 3QPIA 5E5NA 5BYRA 3LW5C 1IBLF 1IVZA 3ENAA 1IR2A 1SUQA 2WVBA 5AXLA 5HBMA 2R2TA 2CAJA 2F8HA 1MMLA 2F3JA 2PC6A 4CO1A 4LFCF 4LFBJ 3SSRA 4DR6J 4QIFA 4URGA 4OLPA 1N5QA 3UQSA 1TP7A 2IC3A 4IRKA 5EX3A 1BXNA 1ZM9A 3GR0A 2OP5A 2GGPB 2XULA 2AYMA 4U8VA 2DKOB 2HRYA 1CS4B 1U2FA 1UWBB 1WC3A 1Q81T 1V3SA 2IA6A 1WEZA 2HHUA 2NYHA 5KT2A 3VGSA 3H5YA 3AOBA 5A0YB 4ED8A 1U8WA 5E3RA 2CNNB 2N82B 3M9MB 5B0AA 4EYIB 2XSJB 4NMXA 2M8DB 4AL5A 1LWEB 2OPRA 1EX8A 2E7VA 2NXNA 3Q8UA 2RAQA 3DOMB 3EDQB 3HHLA 4FPIA 4MYTA 5DM6Q 2PIIA 3RAXA 3HHLC 4HTIA 2J6UA 2X3GA 5CD4A 1EQMA 1VQ5S 3Q2TC 2N4DA 2MZTA 2P6SA 2V2KA 3N6NA 3DRYA 2DXEA 1LWCB 3GIKA 4LQ9A 1VQOS 3IS9A 3LGHA 1U1LA 3ZZRA 2E7XA 4DV3F 1RK8A 4JI4F 5DDQC 3JQJA 1WOSA 4UOGA 2DGXA 3IAS9 5KT3A 4Q5VA 5IFMA 3BDPA 2R7SA 2OI2A 1RP5A 5FIIA 1T95A 4IO9Q 4J9NA 1VGYA 2BX6A 1JQGA 2Q1LA 2A6MA 1QAXA 1UVNA 3MPDA 1PIEA 3KJNB 3RBDA 3B4MA 2YKAA 3FSXA 2LEBA 5GMKa 1TUWA 3GIJA 2QX0A 1HYSA 5IC6B 2ZFHA 2F4VF 2LVWA 2UUWA 5SZTA 3V4IB 3R2DJ 3EGZA 5BR8J 4NCAA 2HRTA 4WIIA 2W7PA 1EARA 2KH9A 3W8PA 5D0EA 4IFVA 2ZBCA 3OXLA 1S1UB 3P3DA 1NZ8A 2UUCJ 1VBKA 2E1RA 4OYAA 2FZCB 1JLEB 3OUYB 3F73A 5HK4A 1SJ4P 3HVAA 3D6TB 5KT4A 3Q0AA 5KG5A 1HNVB 4LBIA 3W61A 4DDFA 3KK1A 2MQ8A 4FS1A 3FUYA 3MD3A 3OXGA 4PR6A 3UDLA 2VQEJ 3UCZP 2DNKA 1DRZA 1O5JA 2YXLA 1KHWA 4YB5A 5CCMA 2G0CA 3MAQA 2PI5A 3SSSA 3EDRB 4QYRA 1SIWB 1HNXF 1HNWJ 4NA3A 2AU0A 1M0SA 3GWCA 2AMCB 3UNYA 2HQGA 2R2UA 1RT6B 4QOTA 3A3PB 1H72C 2QG9B 4ZPCA 1HARA 3KK3B 4X66J 3SYZA 1KDNA 2HKEA 1RU2A 1SH2A 1HNZJ 3LPEA 3TEGA 2YTCA 4ECSA 4E98A 3BEGB 4ERDA 3ET6A 3TVKA 1Q78A 1WG4A 3KUEA 2HFZA 2XMTA 4JI0F 3UN3A 2QGFB 3G82A 1S0NA 3IG1A 1CS4A 4KSEB 5ETRA 3HVWA 1NDLA 4ZJOA 4AYBD 2CQDA 2NUHA 5F9NA 2MGZB 2GHVC 1SKWA 1XQIA 1RAOA 2DO4A 3HCXA 4C48A 1AFIA 1X60A 3DN9A 2JJ4D 4LF4J 4DUZF 4YB7A 4LR8A 4DN9A 3BZQA 2YNFB 3NGTA 1VJQA 4G1QA 5M2UA 1S6PA 4ECVA 4WZQA 2CG8A 2BE2B 2M7SA 2E1PA 4OI6A 1RE1B 2XMAA 2HWIA 2BE2A 2P9GA 1XMBA 2VG5B 1BE4A 2OSQA 4LRAA 2I5JA 1XWLA 1YVFA 3THVA 1VHFA 2ZDPA 2G1HA 3DMJB 3FMBA 3HFKA 3IM8A 2CIMA 3C19A 3OFEA 1N33J 5D4OA 2NXJA 2IM0A 2FB0A 2QA4S 1OYDA 2CA9A 4B17A 1P9YA 3D5MA 1SJ1A 3HHKA 2AWZA 4ENOA 2W9CB 2RUSA 2VZ9A 2AD9A 4FXVA 4PUOA 3E2EA 1FD8A 2DITA 4WK3A 5DJBA 1NKEA 5KG2A 3CIMA 3LGNA 3PW5A 2CJAA 4WJBA 3PHTA 2R42A 3G6YA 2VD3A 1EJ7L 5K5MA 4H4KA 5AXKA 2WOMB 5DS7A 3MMAB 5GAEI 4O0IA 1K1QA 2RRBA 2LCWA 2ZKTA 5A8WB 3MR2A 3TNVA 1NHVA 4J9OA 3VHQA 1JJ4A 3PX0A 1ZM3A 4ZVRB 4CH7A 4N5SA 4Q44A 4HHHA 4OYXA 2DGUA 3FGVA 4RLEA 1L3VA 5IXUA 2HGLA 1VLYA 3ILOA 2FLOA 2G9OA 2N4CA 4KQZA 4R0JA 4CNZA 1NJWA 3JSRA 4J9PA 1EAYC 1RHMB 3BS9A 1MROA 4ZOSA 4ECWA 3VGVA 2CQ2A 3U02A 3UDVA 3W9JA 5D4NA 4BLGA 3EXCX 3UR3C 5EWGA 3MUVP 1FXLA 4CCHA 5IV3A 1PC4A 1T05A 3ICLA 1RLCL 4M5DB 2OPRB 1NK5A 4ELTA 4LF7F 1U2CA 2FPHX 2VB6A 1K0TA 1X0PA 3FBCA 3GE9A 2W2MP 4PG7A 4DPWA 4DX7A 1KVKA 3DOLA 4KTQA 4LREA 4B9VA 4ZVOB 1WWHA 4NCGA 3DFEA 2OELA 1N34J 2DPIA 2A6OA 4NLOA 4RNOA 4JUZA 3QJJA 2LU2A 5KFYA 2BYCA 4YS2A 4ED7A 2GCFA 3T41A 1R6VA 3DMJA 1ZPVA 4DPOA 3R1LA 5H9FJ 1JXLA 2ROEA 2MKKA 3QJPA 3CCRS 4W90B 2C2EA 3PJ9A 3MMBA 4RW9A 4CO0A 5EN1A 2DNLA 2OTJS 2OPPB 5DQGA 3OSPA 2MPUA 1S1XB 4DF4A 1N48A 4RU2A 3PO4A 4K50A 4WZMA 2CADA 3EE3A 3QGHA 3D4JA 3VAHA 1NDKA 4CLSA 3DU5A 1OY6A 1VRUB 4RUAA 2GW8A 3FFIB 2DB1A 2BOAA 5F0UA 1AW0A 4RW8A 3S6EA 2FJAB 2Z0GA 3GR1A 3HHEA 2XLJA 2JDJA 1U1MA 4BC9A 4UUWA 3CCMS 2UUBF 2KRRA 3PR4A 4P2XA 3I4PA 4NEYA 4PKDB 4CRJA 2VPYB 3ZZ0A 5CYMA 4ZN1A 1OWXA 2H5JB 1LW0A 3KDOA 3MECB 4MTPA 3EM1A 4TLQA 5C25B 1NPRA 4UW2A 3VQTA 4J9QA 5C25A 2EK6A 1F2HA 2KG0A 1Y5LB 2DNYA 2FJBB 1NKBA 5HJXA 5CQGA 2UXCJ 2I8EA 3PW4A 1KQGB 3MPYA 1RHKB 4ZP7A 4X65F 1F2GA 1ZAXA 1BQXA 1M1GA 3BR8A 3HT0A 2JLEA 3L7PA 2DBBA 2IMWP 4I69A 4USKA 1OPIA 3JB9k 1JLCB 2LMIA 2DTJA 4JBCA 4ANDA 4C7QA 2XO7A 2NXCA 2ZJPQ 4I68A 1LQ9A 1VHIA 2KJVA 2VQEF 1L3TA 2DGOA 5CH7B 1U8SA 2HHHF 1K73T 1T02A 3M6UA 4P52A 4WPAA 1FT8A 1DLOA 3MI7X 4KGKA 2J6TA 3C46A 3N0VA 2L9DA 3IO1A 4QIGA 1PGZA 4F25A 2BW7A 1FF2A 2F8MA 2HQFA 3V6JA 2C3UA 2KXFA 1UPMB 2FLPA 3UI3A 2QLXA 4CLFA 1L5UA 4U8YA 4HVZA 3MOJB 3DYAB 4LMZA 2IMOA 1B99A 1TKZB 1WHVA 4F7VA 1X4DA 2GC8A 4J5OA 4L72B 4LBPA 1T8EA 2ALYB 4P6QA 1UEVA 2C3PA 2RDDA 3OL7A 1FJGJ 3M2VA 4KPCA 9ATCB 4I4BA 2CJBA 2QRRA 1FNOA 3HZGA 1DFDA 1Y3KA 4HDGA 4NLYA 4FKXA 2VONA 5HJYA 3HPOA 3DOKB 1RADB 4ZK7M 2BJ9A 1FTRA 1VS3A 1GXLA 2BW2A 4P2SA 5HMWA 2QA2A 4I7FA 3A3OB 4ZLJA 5J1EA 2W9AA 3GCXP 4M5NA 2CQ4A 3AFGA 5RUBA 3NS5A 1TL3B 1R8PA 4CLPA 4F02A 1ZAVA 3DGPA 4M5JA 2JVRA 1R8BA 3BGUA 4NYPA 5A8RB 2DGSA 3R5GA 2OLWA 2Y1RI 3LP2B 4WU3A 5HQLA 4K8RA 2HWHA 2X1GA 2EC2A 2IJFA 3OFFA 3K5LA 2HAFA 3M9OB 4QCLA 4HDHA 3T6JA 2AJ0A 1Q8BA 3RRKA 4CDIA 4NX9A 4OLOA 2AX1A 1DBDA 3DC2A 2R8JA 5DGAA 5J1PA 5H9FK 3DLJA 3GV7B 2KI2A 4XPEA 1VRUA 2W2OP 2AKWB 2KM8C 2JC1A 1PC5A 3FEXB 2V69A 3FZ2A 3HX9A 1W2IA 1ZPWX 4RW6A 3R7NB 2IIHA 2FY8A 4DR7F 2F9DA 1C1BA 1WHYA 2J7UA 3VALA 3PW7A 1N5SA 3DLHA 3NBPA 4YHHJ 4X4QA 1CJUA 2AEJA 3EVOA 4X2BA 5LMNF 4WP3A 2J8AA 3M7VA 2ZH3A 1M5OC 3V4IA 2NPIA 4YB6A 1YIJS 2PD1A 1G4CA 3NCPA 4DR1J 1TL1B 3H98A 2Y3YA 2HBQB 3HZEA 3MM5B 3ZZYA 5GVQA 3FEZA 4M5HA 4TN2A 2ZHBA 3RBZA 3ZNJ1 5DGBA 1Q1KA 4EO6A 3M2UB 1MROB 3M30A 3C14B 5ETNA 1S7IA 3RB3A 2AYEA 1A9NB 4USTA 5ETOA 4X4SA 1RWOB 4DR3F 4N56A 3T5LA 2ROGA 2E1AA 4J9LA 4JI2J 3THTA 5HMXA 2ZITA 3HD2A 3AODA 2ZE2B 1IBCB 3POTB 4FVCA 3TP2A 2BM0A 3PIOQ 3OW2R 5IQ6A 2JHEA 1IKWA 2A2DA 3CJ8A 3T1HJ 2V9KA 3R8YA 2ZZMA 2AGPA 4LF6F 3SFUA 1E6VB 4X4TA 1N36J 5KFDA 2XZWA 5KT6A 1U49A 1DQ9A 2IHR1 2VQFF 1WACA 3CCES 2AYBA 2DRAA 3NP5A 1VQ9S 2E29A 4U7UK 1H7WA 3NWRA 1R89A 2OSRA 2RQKA 1SJ3P 1CC8A 2Z2MA 1FJGF 5DZ6A 2C2OB 2KZMA 1UFKA 2FIUA 4ZVQB 3JTPA 3M1VB 1BQNA 4WWSA 3DLKA 5C2CA 3B82A 3TVYA 4LT6A 2X1AA 1R3NA 1D1UA 1C1BB 2FHOB 4WXOA 4V1Ak 1JLQA 3A8KA 4NOHA 3M6WA 4IQMA 1JLGB 3PDNA 1VQ6S 3IMQJ 1QVGR 4ZCLA 2W2NP 3H5XA 3BSOA 1RA6A 4ID8A 2CQCA 5LSLA 2Q6CA 2RSQA 4DR6F 3GV8B 1GEHA 3GFZA 1T7PA 1B4SA 4CLYA 2GIFA 1OYEA 4LRBA 1SQFA 2HK2A 4ILRA 4HACB 2PT0A 4M5IA 1NH8A 2Z58B 6FD1A 4TKTA 1TU0B 4X4VA 2MKHA 1YRUA 1MMNA 2WSCC 2EK1A 3TOQA 3H2VE 3W5XA 1O0PA 2Z2YB 5E7OB 4F4WA 1FO1A 1OQ3A 4X4PA 2UUAF 2U2FA 1HBMB 2GAHC 3PJXA 4IH5A 1URRA 2M70A 3CDAA 4USVA 4Y34A 4R5PA 4B08A 1N32J 1T0TV 2FQQB 3T9ZA 2MQMA 2FHMA 3BGOP 1XN9A 3IG1B 2JZ5A 3EZOA 3PYFA 4ZITA 3RB6A 4OJ3A 5D6GA 1VQYA 3WDOA 3M6VA 2DRBA 4CWBA 1VRTB 2I9SA 5CZVA 1Y5IB 2NXUA 3ETOA 4AXJA 1S4FA 2XWYA 1MWQA 2B51A 3FK4A 3KLHA 5F8IA 1PJ6A 2VQFJ 2ABYA 2NLWA 1E6YB 3W9IA 4O44A 1CJVA 3DDKA 5G0RA 5DG8A 2E9ZA 2OPSB 1NSPA 5AE3A 3M2RA 2LP4A 3CJQA 1UEUA 3LO3A 4EUVA 2CG4A 5J2MA 2J0SD 1UVMA 1BQNB 2QZ8A 2ZH4A 5D78A 4Z2XA 3W2VB 2HQCA 4I7FB 1S9EA 2CQ0A 5DDPC 4GKKF 4J9UE 1NHKL 2BBEA 4ZPTR 1ACMB 4C0BA 3Q89A 3J81U 2Z30B 4OI0A 3MAAB 3R5AA 4DPXA 1RBOB 4DN0A 3CF5Q 5L46A 2Z56B 4Y2MA 2LQ5A 1NRKA 1FVQA 2Z2ZA 5HL7Q 4OZ3A 4X64F 2HFNA 1NPPA 5F41A 3QZ7A 3R1HA 3RB0A 3BBBA 3BO4A 3FVYA 4DV4J 4B02A 1M1KT 1BMQB 2KRBA 3HLUA 4C8YA 4PG6A 3J7A1 5M2RA 2RD5C 3GB0A 1GK8A 1KP6A 2NREA 3SQGB 3M8WA 4FS2A 4FKYA 4FF1A 3K5OA 4CO5A 4OX6A 5JVGQ 1DY3A 4XIUA 4KHRA 3K5PA 1LFPA 1S79A 2YWWA 4NLXA 4NRUA 5FDLA 3W63A 2W2PP 5HANA 1PYSB 5KFLA 4DZ6A 2MY8A 5AXNA 1WNEA 2GVZB 5J2NB 3WC0A 3CC2S 1NAQA 2PO4A 3RBEA 3W7BA 4C9DA 2MTLA 2CNLB 4DUZJ 3SMZA 4DV6F 2RE1A 1C0TA 2H9ZA 5DLFA 2E1MC 3I31A 1P8GA 3QT7A 5L38A 3ZNUA 3BQ0A 4OL8A 3HDSA 1T9VA 3C6UA 5G4DA 3D67A 3PZPA 2V0NA 2KL8A 2R3VA 1R43A 2CJ9A 2ZVSA 4UQGA 3J80Y 4O4RA 3H42A 1Z1ZA 2HQIA 4UTGA 5ETVA 4C11B 5T14A 1I94F 4OZ5A 4TY9A 1LWEA 1KLMB 3BYPA 4F4XA 5KFFA 4ZPDA 1D9DA 1TFWA 1KTVA 3IS9B 1LEOA 2PFDA 1T9TA 4KHMA 1ZTTA 2Y8WA 5KFRA 3R27A 1TAUA 1F0XA 1GXUA 5F3ZA 2BABA 4ZCMA 3GFHA 4RU9A 2DH7A 3G8QA 3POTA 1FERA 4HHUA 4X66F 1T3OA 4I64A 4FXDA 5B08A 2MYFA 4IDKB 3MMBB 4RW9B 1S5ZA 2ZNZA 4MKAA 4ZIVA 1FK9A 4ZVTB 3IN5A 1X5TA 2Z8QA 1KOOA 2ZWPA 2A1BA 1S77D 1F5BA 4LF5J 4MKYA 3TR5A 1VBXA 1RAGB 3HO1A 4AQYF 4NA2A 3GYGA 2R8KA 1XNRJ 1TV6A 2GQ2A 3T1AA 5LMNJ 2J7WA 1HWUA 2V2VA 1IKVB 2Z4PA 2K1RA 4G65A 4DR5F 1C1CA 1HPZA 2MDAA 2VF3A 2K2PA 5F8GA 2FD2A 2BQRA 3N6LA 1HYSB 4ED5A 1JJHA 3BREA 4JI7J 1LXNA 2VU5A 2M9KA 1YBTA 4DG1A 1YI2S 2XYGB 2MQQA 5ETMA 3WZ0A 1K47A 1C4CA 4JI2F 5JXSA 4FNIA 4RNNA 2HG4A 2L9WA 3ETMA 4O23A 2IY5B 1Q79A 4XTTA 5I3UA 1NLKL 1CVJA 2MZ1A 1RXOB 3BR9A 2WHOA 3C15A 1HD0A 3OJSA 1IBKJ 1MU2B 3B6BA 4ZVEA 4LBHA 4FDFA 3WIUA 2V8PA 3A1YG 1PAEX 1UEKA 2MKSA 3AQPA 3ONQA 2W2QP 4M94A 2J9DE 1RT1B 2NZ4A 1NUEA 2KYXA 3AAWB 3V81A 4PXEA 3SQGA 1AXQA 1TKXA 2IYIA 3MMAA 4L3NA 1NK7A 3V81B 3KK2B 2AV5A 3RW7A 3RRGA 2Q3PA 2CPFA 5B09A 2DHXA 4DV1J 4ES3A 4ZHRA 4EYHB 4ECZA 4I0WA 4DQRA 4DSJA 4G3IA 4B3TF 4DU8A 3GIRA 4EMDA 2AYGA 5I42B 2DCLA 3CPWR 3CMAS 2BANA 3HVTA 1VMBA 4RW7A 3BGLA 3RJMB 3TARA 4B9UA 1NU4A 1TK5A 4CYUA 1S72S 2BV3A 2MGZA 2JC0A 3LAKA 3AJ1A 3T5JA 3WIVA 5BXIA 1VOMA 3Q8YA 4LQ3A 2F4FA 4F0KA 2VH7A 5SUHA 4DX8H 2DNOA 3QSYB 1CBKA 2EBGA 1TVRB 1RT3A 3OR2B 4LSLA 4TQRA 3D3BJ 3H25A 3V6HA 1RHRB 2HLTA 2MLYA 1TVRA 3G8TA 5F0WA 4RL1A 1R7IA 2IM2A 3CCUS 4RW4B 5GADI 5A2QY 1XJWB 2HNZB 2VFTA 3QGIA 1UL3A 2CPJA 1FDNA 1S6QA 2SXLA 4GVLA 4XDDA 3R97A 4AL6A 2FVQA 4LJMA 3VQSA 2UXBF 2ASLA 2HHTA 1S6QB 3OHAA 3JSMA 2W01A 4CLKA 1LWXA 4YMEA 3JSMB 3PRBA 2J8SA 3L4BC 5DG7A 1GMWA 1U0HB 2V2QA 2IDEA 3HD1A 3OPKA 4KO0A 1CULA 4QR0A 4RZRA 1IWGA 3FZBA 1YK9A 2QLWA 4WYWA 2M8HA 5KFAA 3CE8A 4Y0FA 2RU9A 3M32A 4P74A 4Y2AA 5LT5A 1HW8A 1ZM2A 4B9TA 2NPFA 5A8WA 2BEFA 2EFQA 1TKXB 2VBXA 2ZOFA 3OQ2A 3V6DB 3DXSX 2GJ2A 1P1TA 1ROFA 3NRBA 2RMLA 4Y6IA 3TAPA 3CD0A 5KFVA 5F9LA 1YLXA 3MMCA 4DLEA 1OO0B 1UETA 3C6TB 4GRSA 3EZUA 2DNPA 3U1MA 2H1YA 4A8KA 4B3OA 2OTLS 3ISNC 3CW2C 1SL1A 1HR0F 3OD2A 1KWMA 4C8NA 2XNQA 2YBVA 2FC8A 2HVDA 5I3UB 4B3OB 2KU7A 4FF3A 2EFGA 3BPDA 3MZIA 4L75A 1S48A 1YZ7A 3D6FB 5M2PA 1LXJA 2DHAA 1TUGB 3M8ZA 4ECQA 1S6OA 2RF2B 3K89A 2YWGA 1V3ZA 2P2CB 2UZAA 3HP6A 4OI4A 4LF9F 3DXBA 4J9VA 2R7VA 2WK4A 1N5VA 2M52A 1AZSB 5F8LA 1QY7A 4X64J 2IFXA 2V6AA 2W4PA 3ZZOA 4C3KA 2R4FA 2NS1B 2FVPA 2XEXA 3I32A 4BDPA 3BO3A 3KMSA 1N88A 3EGWB 1HHTP 3GQCA 3MF5A 1S1WB 1N32F 1X4GA 2HBRB 2YPYA 2I2YA 2IVMA 3GCWP 1GX5A 4IFYA 1W2BR 3DDNA 1IM4A 2DIVA 4YY3J 4QW9A 3DLGA 4J90A 3FQKA 3J81j 3KLEB 3BGFA 4O4GB 3SCKE 1HI1A 4Y28C 4YP3A 2G4BA 1NPKA 4ES1A 3KLGB 2D3OR 4PQUA 3HSJA 2ZJRQ 1PJ7A 1JMTA 1RLDA 2Q6BA 1R0BG 4FBTA 5MAOA 3CJRA 1L3SA 5BJRA 1ZAWA 1TK0A 4JV5J 3TA1A 1TL7B 3MR6A 4RW8B 2RH3A 3LP0A 1RT3B 3CJ0A 1C0UB 1HBOA 3OR2A 3WX8A 4BBYA 5ITHA 3QMQA 4DPTA 3OJUA 4USHA 3MCNA 5T41A 1NXIA 4C0HA 5L1LA 4DSFA 2MY7A 3GSDA 4O3NA 5KFOA 1C1CB 1HPZB 2OMLA 3NKYA 4NE9C 3TX8A 1N33F 1Y10A 4J7CA 2E5HA 3TI0A 3RAMA 5F8HA 1F9EB 1J5EF 2NXEA 2RS2A 5ETPA 8RUCA 5KT7A 2DYAA 4HT7A 2PA8D 4F0MA 1ZOTA 2DO0A 4OHZA 4ZJQA 2RRAA 3E01A 3CCTA 2H5IB 2HBYB 4OYIA 1HQ2A 2JEIA 1CSJA 2HFOA 3L09A 4KIAA 1ELOA 3ZXWA 3I5AA 1EETB 1RCOB 1WKKA 3NGRA 4ID5A 3K58A 4HKQA 2O01C 3R7BB 1QSSA 2HRUA 4MK8A 3Q8SB 2B43A 1N36F 4TVAB 2RRNA 1RTDB 3BKTA 5A8KB 1RT1A 1TKTB 2OPQB 2YX4A 3Q8PB 3LAMA 5HROA 2EFPA 1OJ4A 3N6MA 3TJ9A 4PWDB 2HGNA 3E51A 1K0VA 4NCBA 3IFEA 1ZS6A 1U02A 4X65J 3QWPA 1FKOB 1VQNS 1HD1A 3RUBL 3QO9A 4FZVA 5KG7A 3CWJA 2W4DA 3SIPB 1HLWA 3NS6A 3SDEA 4CLLA 4RNHA 4IO1A 3SCJE 1S1TA 2QJ3A 4YR3A 2CXEA 3JQMA 2DNRA 2PFFB 1S1TB 3LA0A 3ZZUA 3VZHA 2PI4A 1FRXA 2B5JA 4K2JA 2V8HA 4QYZJ 2YWEA 4PPZA 2QO3A 4M5GA 4MFBA 1RUSA 2H48B 3T19A 4DV2J 3N28A 4ZPWR 1SC3B 2MSSA 4MFBB 4ZDNA 3CCQS 3HJFA 2IYGA 4K2XA 3UWTA 4AUKA 4TYBA 4CO3A 3AQOA 2YQ1A 4TU7A 3NGDA 2C1EB 4X84A 1SIZA 1YKWA 4ZA1A 4OI2A 5CYQB 5KFWA 4DQPA 4N8OA 2EKYA 2RDIA 4RWXA 4TY8B 2EKNA 5ETKA 3RG6A 4ILLA 2VG5A 1N5YB 4N41A 1MG7A 2G1DA 4L74A 1BC6A 1JLFA 2IM3A 2HMIA 4P73A 2QL5B 3GONA 4U96A 2VFUA 2QMXA 3MEDA 3S1TA 1VCTA 3HULA 2HWTA 3KLIB 3NWGA 1X4AA 3CJKB 5L9XA 3VF0B 5HVHA 4U7CA 1WHWA 3E8OA 3OVSA 1OSCA 4DEZA 3PHEA 2YNIB 3QFWA 4DFPA 2RQ4A 3J7AN 2VG7B 2IRYA 4KKOB 4NXMJ 3P6YC 4CP5A 4EI2A 1NH7A 3AT1B 1LKZA 4QR1A 5KFUA 4DI6A 4OFZA 4ZLPA 1T3NA 5A8KA 5HROB 4RW6B 3HMJG 5CD4H 3UD3P 2XMMA 5CYMB 2GVDA 2VICA 4URSA 1QUPA 2DEIA 1A7GE 1NMEB 2MLXA 4M5LA 3OBIA 3OLBA 2O5DA 4OZLA 2KJWA 2YKPA 1TL1A 2XI2A 3MM5A 4MT1A 4DQQA 2Y9HA 2EG1A 4FXWA 3HSDA 1GMUA 2FJWA 4X4NA 1MMDA 3UN2A 2RHQB 1GTEA 3PRDA 3CCSS 4O0NA 2ILZA 3JQKA 5L8RC 4I67A 4I2PB 2UVVA 1IKYA 1ZA2B 2BOPA 1RWNB 3PM9A 1HIYA 4DV0F 3H4BA 2DNMA 2QLBB 2LQ8A 4A8FA 1HQUB 2QC3A 4M5MA 1P1LA 3CB4A 4NYZA 4NZ0A 2CQGA 1X9WA 1SQGA 4A8WA 3ZTPA 1JLCA 3RAQA 1GH8A 3K5NA 2QE5A 4F0HA 1C2PA 2RKIA 1PILA 4WFAQ 4AL7A 5KG6A 3KHRA 4DV2F 1NK9A 3TANA 4Q45A 1AZSA 2DISA 1S97A 2XMVA 3BKFA 1IKXB 3QYYA 2UV8G 1YG0A 2IDLA 1B3TA 4IR9A 4GKJF 2UUTA 3ELHA 3BM7A 3EWGA 1HMVA 4OYWA 1Y4ZB 2GQQA 2YKNB 3B8HA 3IWXA 3W60A 3VAKA 4NLWA 1E6VA 5B7WA 1X5SA 1FKAF 2BE7D 1SCJB 2ZH1A 2R7WA 3KMQA 1JLFB 1DAXA 4O4GA 3MR7A 4P10A 4V19X 2W8KA 3ITHA 4ZVSB 2HFVA 2K3KA 2D9PA 3LP1A 2DNHA 2FTRA 1BGXT 4NLTA 3BB5A 3VZIA 5ADZA 3QWUA 4KT0C 3QATA 5FD1A 1YRXA 4LF4F 1VJWA 2ROPA 2CQHA 2YNIA 1GMVA 2VFSA 3I6PA 4IG0A 1UZHA 3I9V9 2DD8S 4DL2A 1TL7A 2J0XA 4LF1A 2IM1A 1WSVA 3DLLQ 4Q0BB 3DU6A 2VBWA 1NM2A 2ZC4A 3W5YA 2ZD1B 5CYQA 3VTIA 3M8QA 1GT8A 1S49A 3CCLS 4NLUA 2HEKA 4WYLA 4O3OA 3A8EA 4FYVB 5HP1B 1YJ9S 2OAUA 4CM2A 3JXOA 4Y3CA 1LW0B 3MECA 2HVZA 4B3TJ 1SH3A 1VR6A 4AD6A 2M4MA 2DNNA 4MAKA 3O2IA 4C98A 5I3QA 1EIYB 4M95A 2OFGX 1R8HA 4K0KJ 3DM2A 1D3WA 1HQEB 2AEFA 3NY0A 4DCOB 3KLVA 1K8AT 2HVIA 1HQUA 1B7YB 3OLAA 3CCVS 5D15A 4YR0A 1U1NA 4B9LA 3QIPB 4PWWA 3I5BA 1DTTB 3FQLA 4BCAA 5KFKA 3H40A 4C8LA 1PSDA 3MDFA 1VBZA 4NASA 1YSJA 3HFZB 1FE0A 5C42A 4OQJA 1RT7B 3DKDA 2QEXS 1JNRB 2AJFE 3UPFA 2E7WA 3FRZA 3Q83A 3P5BP 5KFEA 2B4VA 3Q22A 1S59A 1SH0A 1FTCA 1TQLA 3IRXB 4MH8A 2HLUA 5HN0A 2DIUA 3CJSA 4K4YA 5KFMA 3R5JB 3LWMA 2VOPA 1H73A 4MIAA 3UVJB 5E3CA 2MMYA 2MXYA 3R9LA 1M90T 3NMRA 1IBMJ 2Y0SD 2XSJA 4LVOP 3HHNB 2CWKA 4TXSA 3D0GE 4DV7F 4TLRA 4F4AA 3AOAA 3HT3A 3TZXA 1JB0C 2HSEB 1AA1B 2LXIA 2ZZTA 5K8OA 4J9RA 2AGOA 3TQ1A 4H4MB 3NNCA 3QJLA 2DGQA 1RAHB 4B3SJ 2RT3A 4ILMA 1WI6A 3K17A 1IR1A 5IC4B 4ED0A 4NYOA 1N54B 2C2DA 2DH9A 1K1SA 2GMLA 4H54A 2CJKA 4CO4A 3CD7A 1WORA 3ILJA 2DR6A 4A8XA 1FWKA 3AXMA 5HLFA 1V6HA 2HVHA 2MJNA 1RWMB 4OYMA 5C5JA 1TK8A 2GNKA 1HHSA 2XGQA 1RWKB 2UXDF 2IAJB 4KPYA 3VCDA 3US5A 4GVBA 4DR7J 2YWHA 2H3EB 4IKAA 1FEHA 3AH6A 1X31C 4IR1A 2HQDA 1T9WA 3D6HB 3GJQB 1RI7A 1Y0HA 3LTOA 3MGJA 2I6WA 2C2ZB 4NEZA 5AT1B 3HXMA 5DDOC 2VKRA 3CTRA 5JMNA 3JAMU 4DV7J 4RR5A 1F9FA 5EGYA 2QLJB 5FDLB 1JNZB 2RQMA 1M5KC 1S1UA 3CCJS 4LF2A 3DNCA 2ZD1A 4Y2CA 4F50A 4W98A 2ZBPA 2WVDA 1FVSA 4B3MF 1D8YA 1CQMA 1QE1A 1URNA 3UO0A 3MURP 3HSZA 3IRWP 1RQ0A 2G2YA 1VQKS 4JI1F 2RF2A 3N01A 2R2RA 1XNQJ 2RILA 1MWYA 3DLEB 4PAAA 3D7SB 4L73A 2AJ1A 2QMWA 4N7TA 2D3ZA 1PKUA 4DFMA 4E2FB 2DH8A 4ECTA 5ETTA 1KS2A 2AW0A 3K7RA 2EBEA 3EXYA 1TAQA 1V5VA 2K8GA 4OHVA 4EWTA 2NR0A 4MKVA 3G6ES 3I0RB 1UPPA 1OSDA 1AUSL 4KFBB 2NYIA 1VRQC 1FX4A 4C8ZA 1HWKA 3BPSP 4IOCQ 2P6TA 3W2WB 3OSNA 3BO2A 1RWUA 3RRHA 3IXQA 1WI8A 2UV8A 4WXWA 4DBQA 1FK9B 3G71S 2GGPA 2HHVA 4LFAF 3AB2B 5DRKA 3MWBA 4WBFA 3PYGA 4GMKA 5A6WA 2WBMA 5HVFA 1HNWF 3K8VA 2B9YA 2MHEA 4RJVA 3PVXA 3BBCA 1S1VB 3GTYX 1N6QB 3D54A 1DHMA 4RWWA 3K59A 2FVRA 2P8IA 2JH3A 3BDEA 1FFGB 2LFVA 3EVMA 2BMBA 5ETQA 4DU7A 4PCQA 1WKLA 3DOMA 3HHLB 5B0CA 2GAGC 1XMQF 1FE4A 1RTHA 2K1RB 1D0EA 1HWIA 4P75A 3O44A 2HHXA 4AXIA 1GFWB 1VC6A 3CCWA 2F1FA 4K5SA 5HI7A 3W9HA 2V4RA 2X1FA 1WELA 3CJ4A 1UA0A 4FYXB 1WF0A 1HBNA 4IOBA 4DHVA 2HIQA 3OTOF 2DVIA 4ZMMA 4WP8A 3MR5A 2QSWA 3OTEA 1DARA 1HBNB 4U7UD 1KVJA 4KC5A 5CZXA 1XK8A 1TL3A 1CC7A 3IBFB 4YEAA 1K44A 4DV5F 1H2VZ 5D8HB 4QZVB 2B9EA 1UTAA 5A8RA 1YJVA 1RWVB 3KK1B 1CPZA 1FX2A 2V4JA 3OXFA 1CJTA 3SCIE 4QIVA 3G2XA 2DNGA 2RVJA 2BR0A 1QJHA 2MZSA 3KFWX 4CIOA 1XMQJ 2CJXB 3GYNA 2R7TA 3EZ5A 4UZCA 5DDRC 2J9DA 5D0HA 4A8OA 3QSIA 4ECRA 1Y7PA 3EMTA 3P4UB 1Q86T 3DI6B 4ZHRB 1BY9A 4DV0J 4B9SA 3I0RA 1KSPA 4FF4A 4NRTA 4QIWD 3QRRA 2PE8A 4KH0B 4A48A 4Q43A 2CDRB 4IFVB 1HI8A 1DTTA 5IOLA 4B3MJ 4OJ1A 2VPXB 5D0RA 2HHWA 1CEZA 3UDEA 2BA9A 4USUA 1MSWD 3QLHB 4WE1B 3EYZA 2ZH8A 4F3OA 2X1BA 2H65B 3HF5A 4OHYA 3P45B 1WC0A 4ETXA 4WE1A 1X5PA 3KXDA 4LSNA 2WW8A 4KAIA 2VC1A 4TNOA 5E3AA 2FGOA 3HKWA 4M5KA 4KV8A 1JXVA 2DGTA 5B0DA 3IGNA 4KV8B 3L9ZA 2XO6A 3BYRA 1EKRA 2LQJA 3ENQA 8ATCB 2X3DA 2MQLA 5LJ3Y 4YDXA 3J81Y 3M30B 3G8SA 4DCPB 2DNQA 1KD1T 2ZKUA 3I56S 3PFEA 1L3KA 1Q0NA 3P96A 4I6YA 2A18A 3A12A 4LSZB 5GMDA 7AT1B 3MM6A 4L76A 5KFIA 2ZH5A 4FYDA 2VDIA 3NGKA 3MEEB 1U1RA 3HFVA 4HLBA 3TO8A 3D1OA 3EGNA 3KHHA 2HPUA 2MKCA 2I5JB 3HI9A 2DXFA 4WU2A 5KG0A 3VWSA 3ZTRA 4ED2A 2HQ3A 5HLFB 3P49B 2CWXA 2FJEB 3P8BB 1HWLA 4IDKA 1S1XA 4JI3J 4ATNA 2B3TB 3IC1A 4NWBA 1UKUA 1N6QA 3DHWC 1FXDA 4GVBB 4ZS6A 5LOQA 4PG8A 1KTQA 4JV0A 2N7YA 2V8DA 1IKVA 2ASYA 4GO5X 2LXUA 1I51B 3GMGA 3CC7S 4HH1A 4G1QB 2WSEC 1FRKA 2L9NA 1HHQA 3SBMA 3TJAA 1X9SA 2D69A 3KTQA 1YJTA 3O8WA 3CC4S 1R0CB 4ZN3A 3R2CJ 1G6BA 4DL5A 2KO1A 3BH7B 1W26A 4HR2A 2HVEA 1S9GA 2HNDB 3Q8RB 4OX7A 1S10A 1T03A 1DQ8A 5FLXY 1J2VA 2JL9A 4Q8FA 4LFBF 3L7UA 1VK8A 3E01B 2XCAA 1EQ0A 2AP6A 5IM0A 2Z2LA 2M5YA 4DSEA 1Q5VA 1XTZA 1U25A 2CPYA 2J7KA 3AOCA 4Q2LA 4PZVA 4MK9A 5I4MA 3G4SS 2CQ3A 2ASJA 2FYXA 2QFJA 3PX4A 2QIFA 2XB2D 2DPJA 1RT6A 3FSYA 1HBUB 2MKJA 5IQQA 1NJZA 1RBLA 5LSRA 3GIMA 4NLRA 2DGVA 2YX7A 3OL6A 4NZ6A 4OV1A 5HMYA 3I55S 5H9EK 4XAKA 3ET6B 2XHWA 5LM7E 2VL1A 4DS5A 2IVYA 1B0PA 2NSCA 1H0HB 1RTZA 2PSZA 4HI1A 1FI4A 4CT8A 3R5DA 3PY8A 4KJIA 1H74A 3P5TL 3FC9A 4K5RA 1UWAA 1RKJA 4K7QA 4LSNB 2GS8A 4C3LA 4DV1F 1NK6A 1FRIA 4ER8A 1BUXA 4FYWB 2HZCA 1RU1A 3HVTB 5E0OA 5LL6d 4TU9A 4DSKA 5J2PA 2XCPA 2JVOA 2ZZNA 5KFXA 3A8IA 2MSTA 1SC4B 1GTHA 2V67A 3A13A 1T9UA 4RPFA 1FKPB 2DR7A 3MFHA 1GNKA 2UXDJ 3ILIA 2VUGA 4ZPVR 3CT9A 5KFSA 2U1AA 4DR2F 4MKBA 2CQIA 4OYZA 4XDCA 3L7OA 2CNKB 4USWA 1E6YA 3UD4P 3N4WA 2RHSB 3BSNA 3MD1A 4OHXA 1PCAA 2FJVA 1S6PB 3S7RA 2DGWA 2ZWOA 3F0NA 3T1HF 2Y1LB 4Y2KA 3TUZC 4DQIA 2HW3A 4LVNP 3IR6B 2VHGA 3CMQA 1QAIA 1AT1B 1X4BA 1JLEA 1L3UA 2O1PA 1S9EB 2BJDA 1OMSA 2KT2A 1KRPA 2DCUB 5AE2A 5IM0B 4JI7F 4NA1A 2XY7A 3SQOP 2IRXA 3A8JA 4KO0B 2HFSA 2PMHA 3DRSA 1T11A 1X4EA 1U09A 3MAAA 1SI9A 2QSFA 3ADAC 5HQMA 2HHHJ 3QRQA 1DTQB 3WQPA 3X3UA 4YUDA 1WF2A 2ZM6J 2ZOGA 3RW6A 1IWAA 2B56A 2J9CA 1KFSA 3CO0P 3HJVA 3M6XA 3M32B 3CD6S 1FKOA 2IBOA 2AZ1A 3IWNC 3CJ3A 4P2FA 4ZVUB 5KFGA 2DR8A 4KHPF 2HNYB 2GX8A 1F3VA 3RU0A 1Z2ZA 3BSCA 3TAMB 3UD5A 3I82A 4LF6J 2D74B 4DR4F 1SB6A 1NNDA 1NBEB 2BXJA 1SVDA 2JLFA 1IKYB 5JJBA 2I1RA 1TKZA 3LANA 1HNIB 4U9RA 4WKRA 1NSAA 2E44A 4DXLA 1WHXA 3J7ZT 1SKRA 2W7AA 1RCXB 1P6TA 1R6YA 1TMMA 2CQ1A 4YOEA 5LSOA 1VK3A 3W5ZA 4UY85 2CPIA 2D9OA 2FC9A 2IBKA 1RHUB 3QGGA 1F5AA 1BWVA 3LALA 1UP1A 3TZYA 5HO4A 2XLIA 2XC9A 1YWXA 1YJNS 4FNHA 1MW7A 3SCLE 4JI8F 1P27B 1WDDA 3BKUA 1A0OB 3FCWA 4OYBA 4OV6A 4O3QA 8AT1B 4ZVGA 1TZ0A 3EGVA 3S8SA 3TZZA 3MEKA 3GV5B 1PO6A 4DR1F 5LMUF 4JI6J 3BSAA 4N76A 4R25A 1I6JA 2M88A 2XMJA 1U45A 4DSLA 2FUG9 3QT5A 3HHDA 4DR4J 4ED1A 3I0SA 2ZJQQ 2KYZA 1MN7A 2HMIB 2XS2A 4F2RA 3LP2A 4NLQA 3ZZTA 4CTAA 3MHYA 1LK5A 4LFCJ 3KG4A 1YITS 4K4UA 2ILYA 2EVZA 2ZEJA 3D1HA 5HSPA 4U67Q 2R9LA 4YFUA 5KFBA 1PYTA 2D7SA 4MK7A 4EGLA 4K4SA 2V8GA 4BC7A 3KLGA 2J0WA 4C8OA 1AFJA 1O51A 3EUNA 2UVUA 2B9XA 3K57A 4PPDA 2EXUA 1ZETA 2HIYA 3AB4B 1UA1A 3BBFA 3MCMA 2KM8B 1OS5A 2KG1A 2V8VA 1RBAA 3VR1A 1HNZF 3M05A 1B70B 1Y00A 4P7TA 4WK1A 4WFYA 2HNYA 3D28A 3W64A 2C22A 2XTJP 4ANEA 1OIAA 2G2ZA 4HH0A 4QWAA 3MMCB 1S0MA 2MEWA 3ZC4A 5ETLA 4J9SA 4EBCA 5DM7Q 1T03B 4I6AA 3BV8A 2CZ9A 3IBCB 4DX5A 1YX2A 2BDPA 3CGIA 5GAGU 1FWLA 4RNMA 3ENVA 2IJNA 3PV8A 1UW4A 1XNRF 3W8GA 1F1BB 2X7IA 2HK3A 3NMAA 2ZOMA 4F2SA 2M0GB 3CNQP 4I56A 1RTDA 3SV3A 1NK8A 1DZ5A 1U6BA 3TUPA 4ITSA 1VYAA 4OZ2A 4C3MA 2GO9A 4WF9Q 2QL7B 3K8WA 4HL9A 1WJ9A 3IP0A 1G3OA 2UU9J 1VQ8S 1SKSA 3OVBA 1IKXA 3KG1A 5D0GA 1QUVA 3D2WA 1X0FA 2UU9F 4O3SA 4LRFA 2ZC3A 1XR6A 4EEYA 3MPWA 4NCGB 1WG1A 3F41A 2YKNA 1RT5A 2WRMA 2KXHA 2GV1A 2LEPA 3G82B 1FRJA 1XBWA 1Q7LB 3IM9A 1WSRA 3ZTSA 4JV1A 1JLBA 2XYPB 4RW7B 2JOQA 1FRMA 6AT1B 4P9SA 4QU6A 2NQPA 5FJ4A 3M8YA 3ILLA 2BE9B 2A10A 2ACYA 2O66A 5J1EB 4OZNA 1XNQF 2VOOA 5E2QA 4JYAJ 1YJUA 3X1LB 1N0UA 3SI8A 4ZVPB 2ZBQA 3QBCA 2XLKA 4F8RA 3RB4A 3W3SA 2C28A 2DK2A 5DQIA 3BN7A 2B4OA 3D1QA 2GMHA 4W92B 3M8QB 3K2YA 5B0FA 4BWJA 3DRRA 3VAFA 1S57A 5BYQA 1N5YA 5HP1A 1N8RT 1OPZA 2C2KB 1G7CB 1EP4B 2H51B 1Q4RA 5C24B 4F3MA 2YPZA 3H7HB 4ZPBA 2MLZA 3TEHB 3NLCA 4KGXB 4M63A 3KDNA 4R8UA 5CAAA 4DV4F 4NI2A 4CO2A 2JX2A 4R8UB 1HFEL 2DJWA 5CA5A 5EWFA 4ZCIA 2YH1A 1RWWB 1WC5A 3BH6B 3ISND 3KG0A 2FHJD 1HNXJ 1U6FA 4YN3B 2J6SA 1RKIA 1TL4A 4TYAA 3T6BA 1IJFB 3DLKB 4ICLB 4KKOA 3NBPB 4FPRA 5EDWA 3W1YC 4FVMA 1IQZA 1DLOB 2OD4A 3QLHA 2ZH2A 1NJXA 4H4OB 5MLCV 2M2BA 2PA3A 4JI6F 2XMUA 3NCQA 4OYOA 2O67A 4ZP6A 4KRWA 2W4CA 4F4ZA 1N34F 3R6GB 4DR3J 1M5VC 2B6AB 1FDAA 2BVZA 5CYJA 1R0AA 1QSYA 5A0YA 1WC6A 2VA2A 1D8ZA 4ZVFA 3C6TA 4OJGA 3QAUA 4DS4A 4J9MA 1RTIB 2K7JA 3JYTB 1T9XA 2KVIA 4EFAC 5KFHA 4DL3A 3PKMA 3PYEA 1VI7A 1NZAA 3I4HX 4LIRA 1TR0A 1I5OB 2B5JB 1SPBP 2LKZA 2POKA 1UFLA 1CQNA 1CJVB 2L3MA 5F3TA 4QBUA 5K8MA 1RYRA 2YKOA 1FFSB 2AJ4A 2OPSA 3E3XA 4G1IA 3L3CA 1AUDA 3FMWA 1LOUA 4H4MA 2JEJA 2F5GA 4K4WA 2OH2A 2D1CA 4CLWA 1YBAA 4JI5J 2ATLA 3RYLA 5IS2A 1X4HA 3AJDA 2PEBA 3PG9A 4CM0A 4ETZA 1V9OA 1VRTA 4DL4A 1U2RA 4G1PA 3TW0A 4GKKJ 2OEJA 3UW1A 4F36A 4C2MA 5DQHA 5LXRA 4LR9A 4NXNJ 1PG5B 4K4VA 3NG8A 2VKZG 3M4XA 4C0OC 2CZ4A 3MPUB 1VQSA 1O6XA 4G6VB 2BM1A 1UVIA 2QYGA 2BJ8A 2DXDA 2V9WA 2XBPA 2LQ9A 4W4MA 1QDUB 2ADCA 4NLPA 2E9RX 1NEEA 4PYAA 3FBBA 1SL2A 4P71A 1U26A 4LUBA 2R8HA 3PYDA 2CPZA 4PG4A 4DCJB 4Q0BA 1FRHA 1H2UX 3TRGA 3C3LA 1LW2B 5BR8F 2GVDB 4FBUA 2GVZA 5J2NA 2MB0B 3CSKA 3MEGB 3GIIA 4F4YA 5E3QA 1NJYA 3BQ1A 3CJTA 2V4QA 1H6KX 2QA4G 2KHCA 2G13A 4A8YA 1RHQB 2ZNYA 4KB7A 1ULRA 1UJ5A 2KXNB 1IXKA 4ZKAA 1U6ZA 4A4JA 4J37A 1U48A 1D09B 2OEMA 4Q2MA 3SEOA 3DRPB 2CVEA 2OFHX 2XMKA 4PYDA 4DPYA 2VA3A 4FF2A 2B9WA 4AFFA 2KZZA 3TAQA 5GAHI 2CZVC 3KK3A 3FEYB 5EHHA 2BRLA 5K14A 3VGTA 1ZBTA 1VDHA 2OHDA 3NXZA 2QT7A 3H20A 2FGCA 4IQXA 4K59A 2CRLA 4IH6A 4CLZA 2DNZA 1VC0A 1SQEA 3RGIA 1SV5A 1UMJA 4GO7X 4YY3F 3D3CJ 3UDCA 1J5OB 1WOOA 2ZHAA 4Y65A 1IKWB 2BZ2A 2G0IA 1GX6A 5HAOA 3CMES 1XERA 1QTMA 4A8MP 3W62A 2AT1B 2KB2A 3QO9B 1IN0A 3FKBA 3I9ZA 5I3PA 5HMZA 1W7WA 1VQPS 3KNAA 1REGX 1A6LA 1UVKA 3BQ2A 4RX6A 1OY9A 3MOZA 4Y00A 1FNXH 1S1VA 1W25A 2PMWA 2APOA 2VJVA 1RTHB 3BGRA 2W9BA 1VQ7S 3TA2A 1JLBB 2YKQA 5J1NA 4QW8A 3IR5B 1Y11A 4QPXA 1JXEA 2F40A 4ZCKA 4A8SA 2UVWA 5THWA 3F56A 2DHHA 1LWCA 2EI5A 3PRVA 1RWPB 1Y3JA 1WF1A 3HSGA 2QMUB 3OFGA 1KQKA 1IM6A 3TUJC 3ULHA 1TMJA 1U47A 3BF4A 5DO2A 2B8PA 4ECUA 3UR0A 1IBLJ 2DRDA 1RAEB 2P9CA 4I2QB 1VQMS 4QU7A 3KLFA 3W66A 3VAJA 3RTVA 1KLNA 4GC7A 3TX0A 2V94A 4PQAA 4WCEQ 3VVTA 1DTQA 2OMOA 4OYPA 3D68A 2AIRB 1T94A 2NCKL 4OZ1A 1EKSA 4D3GA 1U1QA 1TV6B 2V34A 3AD9C 3DRPA 2JEGA 1SL0A 1UVLA 2NZCA 2EFOA 1VQLS 3VAMA 4EZ9A 4F67A 3MEDB 2EPIA 2Q79A 3ZZPA 1ZH5A 3CULA 3RZAA 3H2UB 4LF8F 2HHSA 3UN5A 1VIXA 2WZ1A 2MZRA 3KK2A 2LU1A 2YWKA 3UCGA 3NAHA 2R8IA 1U1OA 2L08A 1UZDA 1RSCA 2UXBJ 1U1KA 2QYCA 3DHXA 3LGMA 4WFBQ 1IQTA 1WEYA 2FZKB 1SV5B 7FDRA 1JLGA 3M8PB 3Q8VA 4DPUA 2AJ2A 2J0QD 1UWBA 2FDNA 3PX6A 3IR7B 1RT7A 4LRCA 2GQCA 1HI0P 4FN5A 3KNGA 1RJJA 3C15B 3TA0A 2BACA 3H5UA 4UOFA 3MUTP 2CJYB 4B3RJ 2QL9B 4EU0A 3GJTB 4EBEA 4NLGA 3HM9A 4EZ6A 2HAIA 3G6XA 4JP8A 4NXMF 1UAWA 3MCSA 2CQPA 2P5VA 2BRKA 4DF8A 4I2PA 4OHWA 5LJ5Y 4BS2A 4A47A 3BGRB 2W9BB 2H54B 1NKCA 1UJ4A 2FJDB 1YJRA 3C2PA 3W65A 3VAGA 3PFOA 2XM3A 2D41A 1SXLA 1YGYA 5HQ8A 4D3HA 1S1WA 4S0MA 5L1JA 1KNZA 1ZZNA 1LWFA 3MMJA 3I0SB 5HATA 3OTDA 3PXGa 1H98A 2W24A 2PMZD 1MWZA 4CTAB 4KY3A 5E33A 2F8EX 2JRSA 3EICA 3JTOA 3KJFB 2V5HG 1NO8A 5EWEA 1NSKL 5L9NA 4P2MA 3V6KA 2Y8YA 3KKFA 3MUMP 4P7VA 1Q5YA 1FNMA 1V5IB 5ETSA 1R27B 3KUGA 4PXDA 1RAAB 1RA7A 1ZM4A 4OIXA 2KT5A 5K20B 4AQYJ 1Q7YT 2KKHA 3PEJA 1FKPA 4OZ0A 4DL6A 2RS8A 4HI2A 4PWUA 2HBZB 2MKYA 3KJVB 2ASDA 3EX7B 2Z57B 4NXNF 3NS7B 2DEJA 3KJVA 5G0RB 5T7LA 1REVA 5IWAJ 3LP1B 1FWPA 2BJ1A 3FSIA 1RYSA 2IVFB 1U4BA 3AY0A 2QV6A 1S9GB 2HNDA 4H4KC 3U1NA 5F8JA 3V6DA 4C8MA 4GKJJ 3R3TA 3LPYA 2IJRA 1LK7A 2WBRA 3CDBA 3QT8A 4CZCA 3FBFA 5F8MA 2MKIA 1UW9A 4I2QA 2NUUG 2VFVA 2DY9A 3GPAA 5GADU 3GP9A 1LW2A 1WD6A 2PEHA 2XY6A 1Y5NB 2E1CA 1OQ6A 2L48A 5DETA 5KOWA 1JLAB 1WC4A 2YQ3A 3K5MA 4WTOB 1GAOA 3A3NB 1VLOA 1FRLA
chains in the Genus database with same CATH topology
1R8CA 1XR5A 3FNNA 2N3LA 1TKDA 3D0IE 2KFYA 1IJEB 2PGCA 3QGPA 3PNIA 3O1LA 1K9MT 3NAIA 2QA1A 2EG2A 4QQBA 3N5BA 1WEXA 5B0EA 2E66A 3CIZA 1HBMA 3FJ2A 4R5PB 2ZH9A 3M8PA 2KFNA 1GQEA 5EUHA 1BWEA 2BQUA 1APSA 1Y9OA 2WB1D 3PIPQ 3ENWA 2FVCA 2C2RA 3KOAA 2BANB 2Y1JA 5IT9Y 4MYUA 3Q2SC 4OJHA 5GAHU 3O3LA 4DWIA 5L1KA 3J7Z5 1NB7A 5EX0A 4LSLB 4JV5F 4MIBA 4UOCA 4BWMA 2WCXA 2O3DA 3B78A 3QAEA 4WFZA 2CJQA 1KLMA 3PACA 5T7LB 3LWLA 4JI3F 2F9JA 3K0JA 2B0GA 2C3YA 1U7LA 2RNEA 2RU3A 2OD6A 4TY8A 3UCUP 1O8BA 3MEEA 2JEFA 3KYLA 4X4UA 5C24A 3LH2S 3KLEA 2YY3A 1JX4A 5CHCB 1QM9A 2LECA 4QWDA 4JYAF 2R7OA 4OI3A 1B0TA 2WSFC 1ZTWA 1DURA 1QAJA 4IG3B 1GXTA 4PQUB 3Q8QB 2XY5A 4GC6A 1TFYA 4J9KA 4ECXA 1I1GA 1KN6A 2RJZA 2KT3A 4DQSA 5KTQA 2KN4A 2GMJA 4XK8C 3MXHP 3KWMA 3OFHA 4DSIA 3FFIA 4M8LA 1X9MA 4CQ1A 1FDDA 3V5RA 4DG1B 3CD5A 2IRUA 4USJC 5KFJA 3VAIA 2W25A 3OL9A 2ZHOA 3CJ2A 3TAMA 4YHHF 2YNGB 2ERRA 3LOUA 3CXCR 1JIHA 2FHKA 2FHJA 2PN6A 2YNGA 1XC9A 4DUYF 4NZ7A 3M2UA 3OV7A 3NL0A 3H8YA 1JJ2R 3G9CA 2RB7A 3CDWA 3ZZZA 3C66A 4NMLA 3SXLA 2KHDA 2LA4A 2B7CB 2HHPA 2CFXA 3MM7B 3OR1B 1TKTA 2OPQA 5D4LA 1JWWA 5K8NA 3MM7A 3OR1A 5B0GA 2LA6A 3DCAA 4URQU 2MQPA 1H2TZ 5KFNA 4LIWA 4WFNQ 1T05B 4R0EA 7FD1A 2HHQA 2E5GA 1R8AA 1Z2LA 1JKHA 3MM6B 2HNZA 3ZFVA 4IFYB 5IZHA 3CCZA 3NCRA 1IUJA 2CDQA 3LQVA 3H4DA 3SV4A 4RBVA 1H38A 2XNRA 2C3OA 4QPTA 3SZ2A 4NLVA 2N3OA 4QWEA 1S76D 3LP0B 3M1VA 2R8GA 2UXCF 3UNGC 3MFIA 2RIJA 2PDAA 3MR3A 4RNFA 1X4FA 1F60B 5CCLA 2A3JA 2CYYA 1FA0A 4ELVA 1RT4B 1VQ4S 2EFVA 2JSXA 4YR2A 1V3RA 2LLZA 3CDUA 3MPVA 4L6V3 5KFPA 2VBYA 1HL6A 3OUYA 2EWHA 1KR4A 4F3QA 3GILA 2N7CA 1CLFA 4Z37A 5IT4A 2I0XA 2LDIA 3DRSB 2I38A 4KE5A 5KG3A 2WONB 3PR5B 1B7FA 5F8NA 5KAKA 2LQBA 1S0VA 4ES2A 3OL8A 1BD6A 1N4LA 2RUGA 3CJ5A 3Q24A 1KHVA 2GJIA 4V19J 2MZJA 1KFDA 1YQHA 2J76E 5KFQA 5CXTA 1JKHB 5B0BA 5K8PA 3MM9B 2EFNA 2JWNA 2XG8A 5IT0A 5GAEU 3T5KA 2OJ3A 3MM9A 3I96A 4RUHA 3TYTA 4K4XA 4ED6A 3JSYA 4DL0C 4IOAQ 1HNIA 3FCHA 4KR0B 5E3PA 3U7JA 1NJIT 5J2PB 4OZJA 2R2SA 3MTJA 2RKIB 1Q53A 4N47A 1M5HA 4CI0B 2GIQA 2K3IA 2ZUGA 3O5TB 2CKWA 2CQBA 4DFKA 2LXFA 3GG1A 4N8NA 2VODA 3IA0A 4M1KA 4M5DA 2R7UA 2EW9A 4KJIA 4A46A 2ZH6A 4RW4A 2FJXA 3DLGB 3SSQA 3TVZA 2MQOA 2YNHA 2JFKA 4JI5F 3AHPA 2AJQA 3F44A 2AQ4A 1RGVA 2IA0A 2YNHB 1X8DA 1H3DA 2XWXA 2DHSA 5BYSA 2L41A 1WTBA 4UY8T 1RTJA 1U24A 1N52B 1P9QC 3CVKA 1RISA 2YKMA 3G86A 4IG3A 1Q82T 1YTYA 1Z4UA 3H59A 4HHJA 4ID5B 3CJKA 2OPPA 1JK9B 1KQFB 1BC6A 1C0UA 1HBOB 4CT9A 4YB1P 2WONA 3LUYA 1NK0A 2X51A 2VG7A 1FD2A 1KONA 3QIPA 4RKUC 4H4OA 2Y1IA 1KC8T 1N5TA 1X5OA 4QIEA 2K7KA 4OX9F 1RT4A 1F5CA 5C42B 3M8RA 5A6PA 3G96A 2MJUA 4B9NA 2Q43A 1C4AA 3IRXA 4I6WA 2F7VA 2B6AA 4W92B 2J9EA 5D4PA 4RUCA 2A2CA 2LYVA 4KGMA 3KHGA 4NLSA 2H5EA 3JSBA 2YWFA 1BLUA 4ZP9A 4HT5A 3DM2B 4XPCA 1HNVA 4X4RA 1IR0A 1G2EA 3CO9A 2VPWB 1KVIA 1YRTA 2COLA 1XEZA 4IYQA 1LWFB 1RAJA 3QZ8A 1VBYA 2DR5A 4PWDA 1FJCA 4PRFA 1HBUA 1DQAA 2LDYA 2ZE2A 5KOXA 2YVSA 3R5CA 3OTBA 3U1LA 4N77A 1D9AA 4ELUA 5IWAF 3DOLB 3CEDA 3FDSA 3BJYA 5J2QB 1KQSR 1CG2A 1Q16B 4HEA9 5KFCA 1D9FA 4OI1A 3NNAA 3V4MA 2WAQD 3MTKA 3TUIC 1FDBA 4PG5A 1RT5B 4E0DA 3V2UC 2YKMB 4MJKA 4O44B 1U1PA 4Q8EA 3ITHB 4JOUA 4DLGA 1S9FA 4IG0B 4LF5F 4QR2A 2OO4A 1MNEA 4DJBA 2JFDA 2GHWA 5AE1A 2RDJA 5J2MB 3FRYA 3LF0A 2NSBA 1QLNA 2EC0A 2DT9A 2DR9A 2KFZA 3J7YI 4U6PA 4HTJA 3S01A 3CDEA 2YNFA 2XI3A 4X62F 1JLQB 3HKZD 1SC6A 2J5AA 2VFRA 4UQTA 4OX8A 3MEGA 2OKQA 4WKYA 1WTFA 1QSLA 4DOZA 3DLEA 4C8KA 1RTJB 1KOHA 4HYKA 2E5LF 3KLIA 3WC2A 5D3GA 3I87A 5LXYA 1S7HA 3Q23A 2CPDA 4CH1A 2W8LA 4CH0S 2GHPA 2WTFA 1XR7A 5L1IA 2W9CA 4IRCA 1BQMB 1HQEA 4BHQA 4ICLA 5K14B 3NNHA 2YH0A 2ZDOA 3QIDA 4UUXA 1H7XA 3IAM9 3AJ2A 2CVIA 2Q66A 4Q7AA 3D0HE 1X7VA 1UVJA 4K4TA 2BUNA 4ZP8A 2FLNA 4OMFG 2GFFA 2VV5A 1QE1B 3DRXA 3IBWA 5KG1A 2C3MA 2WB4A 2WOMA 1J5OA 1S99A 1R0AB 4YQWA 1LV5A 1RDRA 1C0TB 5D77A 3MM8B 4RBUA 2D3UA 2DHGA 3U27A 1RTIA 3RR7A 5JUMA 3SDEB 3DYAA 4C4WA 3UE2A 4CNYA 1RT2A 1QVFR 4DMZA 1NHUA 3C8YA 3WX4A 2HS3A 3R5BA 2MQNA 4PXBA 3JYTA 5H1SV 1ZYQA 1S6UA 4I1TA 3PKYA 4NLDA 2XGPA 2HYIB 2M3DA 4WTYA 1UJ6A 2AF6A 3OTCA 4K4ZA 2ALZA 2ZBIA 1B64A 4QWBA 3ISZA 4MIWA 2UVRA 1KEKA 3PJWA 4O3PA 1AROP 2HGMA 4ED3A 3T3FA 2GIRA 2B7BB 1S0OA 3W2VA 5GAGI 2YX1A 1FJ7A 2AX0A 1HMVB 4AE5A 1M5PC 3N79A 1VIOA 4DL7A 3MAHA 2ZM6F 1HA1A 2B4UA 3AA9A 3KHLA 3CUNA 1FJEB 1HWJA 2V4JB 3HHLD 3IGVA 3H5SA 2AGQA 1XMOF 2MZQA 4NPOA 2B4PA 3THPA 1IBMF 2LEAA 3AA8A 3J7YU 1TL5A 2GO8A 4A8QA 2VC0A 3HVRA 4B9MA 1BQMA 5E41A 4EBDA 3G6VA 2XS7A 3JTNA 3PEHA 3SFGA 2JLGA 4ALZA 2R7RA 2E5JA 3O6QA 2W7OA 2KDOA 2R7QA 1WG5A 4Y2IA 2MHNA 4XO0A 2P9EA 2VPZB 2BQ3A 2VASA 1JLAA 3GZ7A 2GA7A 3C6UB 1X4CA 3T1YF 3L95X 5D3GB 4C97A 2BJEA 5L39A 4NL5A 4K0KF 3I5CA 3N9UC 3OHBA 3H2LA 5JVHQ 3M8SA 3EPIA 4FP9A 3T9NA 2ADBA 3RR8A 4DFJA 3GFXA 3UFCX 3PW0A 2C42A 4IH7A 1R31A 4C11A 3EPGA 4KFBA 4RBTA 4WFXA 2CPXA 3BN4A 1SUQB 5HBMB 1FESA 1M5SA 3OVAA 3GFYA 4USIA 1B0VA 3W2WA 2UUCF 2HS4A 1VC5A 4YDDB 1DJ0A 2ZH7A 5KT5A 4F26A 5I42A 1LFWA 2IC3B 2XSFA 2VBZA 4ECYA 2OIHA 3PO5A 4TQSA 2HS0A 3MM8A 2FLLA 1N0VC 4PXCA 1YHQS 1SJFA 2FVSA 4EO8A 1Q8IA 3WBZA 2RQCA 3T5HA 5J2QA 3DLBA 1FEEA 1RT2B 4JV2A 3RW6A 3HK2A 4MMOA 4IRDA 3KLHB 2FY1A 1FHTA 2XMWA 1N56A 5KFTA 5AXMA 5KG4A 3IWLA 6FDRA 1FXRA 5U47A 4B3RF 1TUVA 4TU8A 5DG9A 1G1XA 5K9FA 1IBKF 3M2VB 2VG6A 1NK4A 1ZZFA 1REVB 5AJ3F 4QWCA 2E9TA 2CPEA 2VG6B 3GYXB 2CPHA 5DLGA 3DOKA 3M2RB 4QJVA 4B3SF 4KBIA 5H9EJ 1FCAA 1SJRA 1VFJA 3PW2A 4IUFA 1QAYA 2IAJA 1EETA 3N5FA 3DRRB 4PUOB 1HW9A 4E8UA 3KLFB 5KFZA 1EP4A 4ZPAA 4X4OA 1MU2A 3B4DA 1Q8LA 1UFWA 3GG0A 2XS5A 1SBRA 3JAMY 3DI6A 2E5IA 1SJQA 1YJWS 4ZVHA 3QPIA 5E5NA 5BYRA 3LW5C 1IBLF 5AXLA 1SUQA 5HBMA 2R2TA 2F8HA 1MMLA 2F3JA 2PC6A 4CO1A 4LFCF 3SSRA 4QIFA 4URGA 4OLPA 1N5QA 3UQSA 1TP7A 2IC3A 4IRKA 5EX3A 1ZM9A 3GR0A 2OP5A 2XULA 2GGPB 2AYMA 2HRYA 1U2FA 1Q81T 1UWBB 2IA6A 1V3SA 1WEZA 2HHUA 5KT2A 5A0YB 4ED8A 5E3RA 2N82B 3M9MB 5B0AA 4EYIB 2XSJB 2M8DB 4AL5A 1LWEB 2OPRA 5DM6Q 4MYTA 3HHLA 2PIIA 3RAXA 3HHLC 4HTIA 2J6UA 2X3GA 1VQ5S 3Q2TC 2N4DA 2MZTA 2P6SA 2V2KA 3N6NA 3DRYA 1LWCB 3GIKA 1VQOS 4LQ9A 3IS9A 1U1LA 3ZZRA 2E7XA 4DV3F 1RK8A 4JI4F 5DDQC 5KT3A 2DGXA 3IAS9 4Q5VA 5IFMA 3BDPA 2R7SA 1RP5A 5FIIA 1T95A 4IO9Q 4J9NA 1VGYA 2Q1LA 1QAXA 1UVNA 3RBDA 3B4MA 2YKAA 3FSXA 2LEBA 5GMKa 3GIJA 1HYSA 2ZFHA 2F4VF 2LVWA 2UUWA 5SZTA 3EGZA 4NCAA 4WIIA 2W7PA 2KH9A 4IFVA 2ZBCA 3OXLA 1S1UB 3P3DA 2E1RA 1JLEB 3OUYB 3F73A 1SJ4P 3HVAA 5KT4A 5KG5A 1HNVB 4FS1A 4DDFA 3KK1A 3UDLA 3MD3A 3OXGA 4PR6A 3UCZP 4F4KA 2DNKA 1DRZA 1O5JA 5CCMA 1KHWA 4YB5A 2G0CA 3MAQA 2PI5A 3SSSA 4QYRA 1SIWB 1HNXF 4NA3A 2AU0A 1M0SA 3GWCA 2R2UA 1RT6B 4QOTA 4ZPCA 1HARA 3KK3B 3SYZA 1SH2A 2YTCA 4ECSA 4E98A 3BEGB 4ERDA 3TVKA 1Q78A 1WG4A 2HFZA 2XMTA 4JI0F 1S0NA 3IG1A 4KSEB 3HVWA 4AYBD 2CQDA 2NUHA 5F9NA 2MGZB 2GHVC 1SKWA 2DO4A 1AFIA 3DN9A 2JJ4D 4DUZF 4YB7A 4DN9A 3BZQA 2YNFB 4G1QA 5M2UA 1S6PA 4ECVA 4WZQA 2BE2B 2M7SA 4OI6A 2HWIA 2BE2A 2P9GA 1XMBA 2VG5B 2OSQA 2I5JA 1XWLA 1YVFA 3THVA 1VHFA 2ZDPA 3DMJB 3FMBA 3HFKA 3OFEA 4DV2F 2CIMA 5D4OA 2IM0A 2FB0A 2QA4S 4B17A 3D5MA 2W9CB 1SJ1A 3HHKA 2AWZA 2AD9A 4PUOA 2VZ9A 4FXVA 3E2EA 1FD8A 2DITA 4WK3A