1I94J

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1i94J00
1XMOJ 3T1YJ 4KY3A 3J7AN 5LM7E 2MTLA 2UXBJ 4DR1J 4NXMJ 4DV6J 4B3RJ 4LFBJ 2KL8A 4JI2J 2UU9J 4JI6J 4DR7J 4LF5J 4DV3J 4JI7J 3IMQJ 4DV0J 4B3TJ 1HNXJ 1XNQJ 4V1Ak 1FJGJ 2UXCJ 1IBLJ 1HNZJ 2VQFJ 4GKKJ 4DR6J 3W1YC 4DV2J 5LMNJ 4LF4J 5AJ3J 4DV5J 1HR0J 4X62J 4K0KJ 3J80U 4JI8J 4YHHJ 4LFAJ 2E5LJ 4LF6J 3J81U 3R2CJ 2MEWA 4DR4J 4X66J 2HHHJ 4DUZJ 4DR2J 4JI1J 4AQYJ 4KYZA 3D3BJ 4JI4J 4KHPJ 3D3CJ 4B3MJ 2ZM6J 5IWAJ 4LF9J 1N34J 4NEZA 4B3SJ 4HHUA 4NXNJ 4JI3J 4DR3J 1N32J 4DV7J 4DV1J 4NEYA 4YY3J 3OTOJ 1N36J 4LFCJ 4JYAJ 3JAMU 2F4VJ 4LF8J 4DR5J 2UUAJ 4X65J 2VQEJ 2UUCJ 1N33J 4JI5J 4OX9J 1XMQJ 2UUBJ 4DV4J 4LF7J 3T1HJ 4PWWA 4X64J 5A2QU 1HNWJ 2MQ8A 1IBKJ 5FLXU 5LMUJ 2UXDJ 4JV5J 5IT9U 1IBMJ 1I94J 2KVQE 1J5EJ 4DUYJ 4JI0J 5BR8J 3R2DJ 4GKJJ 1XNRJ 4RJVA
chains in the Genus database with same CATH superfamily
3BO4A 4MYUA 3DOKB 3PCOB 5KFUA 4DX6A 3ZZTA 4I7FB 2DH9A 1RT7B 2R2TA 4Z2XA 1X4GA 1WACA 4GRSA 4YY3F 4DV3J 5D6GA 4O3SA 4WFAQ 5L46A 1QSSA 2J9CA 2QL9B 1APSA 1MN9A 4L75A 4ZVGA 1FESA 3ENQA 1IBLJ 3LW5C 3OBIA 2DPJA 4LF4J 2KDOA 3I5CA 3KNAA 4CZCA 1IBMF 3FGVA 2W9AA 5IM0B 4WP8A 2MEWA 2DGWA 1TFYA 4XPEA 4RBTA 4ZVPB 1Q1KA 2ZBQA 1U4BA 3CCES 4Y2KA 1F3FA 3QO9B 2BUNA 4UZBA 3ZZRA 1QAYA 3DNCA 4DV0F 3HVAA 2ILZA 2FHJD 4DR6F 3DXBA 4GVLA 2DNHA 3EM1A 2NS1B 2I9SA 4JI0J 4CWBA 2HLTA 4OQJA 2C3UA 4KRWA 2RQKA 2C2NA 1HD1A 4I2PA 1TKZB 4E0DA 3LPYA 1K44A 2VUGA 1M5OC 2XYHB 1XJWB 1A7GE 4NXNF 4JI3F 4B9VA 1IKXA 3CIZA 5K5MA 3OTOF 2MSTA 1FEEA 3O5TB 4Y2AA 1NJWA 1S6PA 3G9CA 4ANCA 1S57A 3MURP 2RB7A 4OX7A 1E6YB 5FD1A 3W64A 1CJKA 1YBTA 2DRBA 1S1VB 3QMQA 4QIGA 2CXEA 5D0EA 5GAEI 1HL6A 2JRSA 3T19A 2GHWA 3K5NA 4ZCLA 1UWBB 2ZM6J 5U47A 5C2GA 4OYWA 3Q2TC 1CEZA 1M5PC 4LF2A 4KPYA 4DR7F 4ZPTR 3X1LB 3JTOA 2HFSA 2DNQA 1CJVA 1HNIB 1QE1B 3H8YA 2X3DA 2HYIB 2V67A 2C2OB 3Q8YA 2B5JA 3R7NB 2UXDJ 1X0PA 2HBRB 3VGUA 2GS8A 3NNCA 2C3YA 3R2DJ 2DGTA 5E3CA 2PD1A 1DAXA 2HNDA 3UN5A 2RKIA 2KT2A 1N0UA 4CO1A 1RU2A 3SQGA 1VOMA 3RU0A 4DUTA 1HNXJ 4WKYA 2UUAF 3MGJA 5DDQC 3WIVA 1HI0P 3NXZA 3FJ2A 4RR5A 4ES3A 5HATA 3GV7B 4KKOB 1YJVA 3MECA 3QLHB 2QLJB 3J81j 3CULA 3EGNA 2YKNA 3NCQA 2X7IA 3ITHA 2R7UA 2VHGA 3R5CA 4U9RA 2FHJA 4RW4B 1DZ5A 4IG3A 3UNYA 2XMMA 4PCQA 2IBKA 1AW0A 3D1QA 1L5UA 4Q45A 3BB5A 1T9UA 4OYMA 1G7CB 4FXDA 2A3JA 3WQPA 2IBOA 2YKOA 4Q0BA 3GQCA 4ECTA 3VAIA 2QL7B 4NLUA 3MR7A 2BYCA 4PWWA 4X64J 4MKVA 3PO5A 5EWFA 3OUYB 1X4CA 4YB1P 1KHVA 3NNAA 1X60A 2YPYA 2I6WA 1EIYB 5KFBA 1NJIT 2FDNA 1X31C 4M63A 4HKQA 2J76E 2R3VA 1WTBA 4MKAA 2NUUG 1S0NA 4IOCQ 5E3RA 4HR2A 3TWZA 3M9OB 3DLGB 4MFBA 3R5BA 3AJ2A 2YBVA 3M32A 2CQCA 2ADBA 3F73A 4Q8EA 1YJRA 2L9NA 3PHEA 3BGRB 1VC0A 1JJ4A 2JX2A 5LMUF 2HPUA 1DRZA 1BY9A 1PYTA 5IZHA 2XCPA 3NS7B 3GU0A 3M8RA 5F9LA 4OJHA 3ETMA 1JLCA 7AT1B 1TV6A 5G0RB 3RBXA 3FUYA 2BJ1A 2CQ3A 1FT8A 1JLBA 2CNKB 1W25A 4C8LA 5J2NA 4I64A 3K59A 1FKPB 3U1LA 2XMTA 2IY5B 2XS7A 4WXWA 3KLEB 4GO7X 2YKAA 3JTNA 1AFIA 2B9WA 2FHOB 2GVDA 2YQ3A 4NMLA 3FBBA 4CO0A 3NGKA 4FS1A 4USTA 3L7PA 3N4WA 2GX8A 1OYDA 2GGPA 4IUFA 2LP4A 4QJVA 4QYZK 4R5PA 2UXCJ 1QVGR 5D0RA 3MAAA 2C2EA 2ROEA 2EI5A 4WIIA 3BPDA 4RBVA 3MTKA 4KAIA 2FIUA 3NEKA 4J9NA 1B70B 2D74B 1DLOA 3I5BA 3AXKA 4P2SA 1X7VA 1NB2A 3VQSA 5A8WA 1RAFB 2BJ7A 3TZYA 4EYHB 3GMGA 2F65A 1P9QC 3UVJA 3K7RA 2H48B 5JVGQ 1RZMA 1TR0A 4URGA 2BX6A 4JI2F 3PW7A 1Q53A 2AZ1A 2EWHA 2KZMA 2DKOB 1U0SA 2G2YA 4FYYB 3GCWP 2GNKA 4C3KA 3DGPA 1SH2A 3VVUA 1XC9A 3RB0A 3HXMA 3WC2A 1ZETA 4WIQA 1GTHA 2DGQA 4A8SA 1TUGB 3UN3A 3BEGB 1KQSR 4KHPF 2ZH7A 1TL3A 3MOJB 2CPZA 4YR2A 3DRPB 3ADAC 1VCTA 3BBBA 1W26A 4K5SA 4UOHA 4NA1A 5HAOA 3V81B 4CO5A 3GIJA 1P27B 3MMBA 2RRBA 2ASLA 2XZWA 2LXUA 3NLCA 2Y1RI 2P9EA 4RNHA 2WBMA 4F26A 5BR8F 1RU1A 4OV1A 2IRUA 1AA1B 3EE3A 3QJPA 5F9NA 4IH6A 2OPQB 4MKYA 2HKEA 3C15A 3SCIE 4MMOA 1S6QB 1WWHA 4W98A 3P49B 4B08A 1UZDA 4IR9A 2CG8A 1L3KA 4C8YA 3DOLA 3J7AN 1T05A 2IMOA 4TY8A 4LSNA 4UTGA 1QTMA 4TU8A 2CQBA 2HAIA 4M5DB 3DGVA 2HQGA 2HFVA 2D3O1 2YNHB 2BOAA 3OL8A 1U47A 3DI6B 5AT1B 1FXLA 4CQ1A 2DT9A 2A6MA 3BF4A 4JI5F 2R7OA 2KHCA 2WK4A 6FDRA 2B4UA 1I3OB 2JZ5A 1F1BB 1Q16B 2CRLA 4ZJOA 4BC7A 2H5EA 3TR5A 2UUWA 1Y11A 5CH7B 1J5EF 1UVKA 2HFOA 5J1EA 4CCHA 1XIQA 4B9SA 1OQ6A 4KE5A 3GJQB 4D3HA 5GMDA 4DV7J 2VB6A 2XMWA 4C11A 3HKZD 5KG7A 3SZ2A 1JIHA 2R8KA 4FYWB 4K7QA 3PFOA 4UOFA 3D6FB 1MMDA 4F04B 1HNZF 1LXJA 1NK9A 5G4DA 4DSFA 1WHWA 1EP4B 2UV8A 4RLEA 3EVOA 1XMOJ 4TN2A 4Q2LA 1TKTA 2LA6A 4NLYA 3V6DB 1HNVB 4NA3A 2OUGA 4IO9Q 1RWMB 3PKYA 3FFIB 4J5OA 5KG1A 2A0FB 4U95A 1SJFA 1KLMB 5HO4A 3CNQP 1UPMB 3UD3P 4C7QA 2IDEA 1RTDA 3KLVA 4N47A 2ZH8A 1NHUA 1TELA 4XPCA 2ZH9A 3KNGA 3GYXB 2AF6A 1HYSB 4NXMF 3OT9A 4IRKA 3W2VB 4PYAA 2KFYA 3GLJA 4ZPBA 4C8ZA 3ZZUA 3C19A 4B3TF 4C8NA 4ZVRB 3KLFB 1FK9B 4Y3CA 3B4DA 3CT9A 3I4PA 3HSDA 3H7HB 1CJUB 1PYOB 4RZRA 2YKMA 3CCQS 2OPPB 3IC1A 4F2SA 2YNGB 2R2UA 2FQQB 4DWIA 1NSPA 1R0CB 1T95A 2KVQE 3V5RA 2ILYA 3FRZA 3N6LA 3EXYA 2AJ4A 2HNYA 3EMTA 2J0WA 1FD8A 4IFYA 4J9QA 3R1HA 3OR2A 3TX0A 1SKSA 4B3MF 1C4AA 2MQNA 2E9TA 2CQ4A 3BR9A 3UDEA 2EVZA 1IKYB 3W2WB 3KHRA 4QIFA 1BWEA 2RQCA 1J2VA 2DGSA 2EBGA 2CQDA 2XG8A 1LV5A 2VJUA 3TJAA 3KHGA 4DPUA 1YZ7A 3SXLA 2DEJA 4C8OA 2Y0SD 4X4VA 2BOPA 2JL9A 2HVZA 2RNEA 2HK2A 3WIUA 3JQMA 5IV3A 4N5SA 1RHKB 1NK0A 2BVZA 4UY85 4C3MA 1BHNA 3K0JA 5I42A 4FN5A 3R5AA 3DRSA 2J0QD 3JSMB 2YNIB 4TNOA 1NUEA 1XMQJ 2BKPA 3KXDA 2KRBA 3MR2A 2DHAA 3H90A 2A1BA 1CLFA 1NEEA 1S1WA 3W5XA 3VV2B 2MJUA 2YKPA 2UUTA 2VBXA 3UWTA 2CADA 2E9ZA 2OFGX 5LXRA 1G3OA 1H0HB 4ZP9A 1TFWA 1EETB 4FF2A 1FRHA 3OVBA 1NKBA 4DR5F 3GIKA 4DJBA 3AOCA 3OLAA 3RW6A 2XYPB 2YWEA 3FVYA 4OZNA 1WD6A 1NPKA 5DS7A 4TU7A 1RE1B 2E44A 5HP1A 3DC2A 1UEKA 2JLEA 1BC6A 2YVSA 3S8SA 4NI2A 3W9HA 3QT5A 1VRTB 1R27B 4MIWA 5CZXA 3EPIA 5F8NA 2B9YA 2F7VA 3I31A 4UUXA 2FUG9 4I67A 4ED5A 4CLKA 4U7CA 2W4DA 1RLCL 3QGPA 4P2MA 2VG6B 2BBEA 3MMAA 3L09A 3SYZA 5HMZA 3BV8A 2OJ3A 2XS5A 2JSXA 3AOAA 5KFOA 1K8AT 1IJFB 2HQ3A 5HSPA 2YWKA 4OX6A 2VICA 1IXKA 3C6TA 2ZUAA 2BABA 1KDNA 2HVHA 1URRA 2ZJRQ 4QU6A 2J0SD 4NL5A 1KLNA 3NS6A 1TP7A 3R5DA 4FYDA 1U6BA 1VI7A 3PVXA 2Y1LB 1X9MA 1TTHB 3G6YA 3IM8A 1K1QA 2IYGA 4ZJQA 4IG0A 5D3GB 2RAQA 4NZ7A 4RW7A 1FDDA 1JMTA 2AYMA 2LQBA 2DYAA 2JJ4D 3QJJA 1IUJA 4WP9A 3DDNA 3PNIA 1OY9A 1PC5A 5B0FA 3D67A 1GFWB 1HQ2A 2GA7A 3RRHA 5KT5A 3QT6A 4HYKA 5CCMA 2ABYA 4FYXB 3HVWA 4F50A 5KFQA 1IBCB 2ZBRA 4UOGA 3N0VA 5F8GA 2JC1A 4KH1B 5AE2A 1RHUB 4DOZA 8RUCA 2KH9A 2MSSA 1HNWJ 2GMJA 3BH7B 3LGMA 5EHHA 5AXKA 4L73A 2RS2A 2E5LF 1C1BB 1LK7A 3FMWA 4DFMA 1N5YB 3TANA 1UAWA 3PXGa 1FNMA 3OTEA 2LQ8A 2CPHA 2F4FA 3M8QA 2DVIA 2XSJA 3OXGA 4JI7J 2ZZNA 1S0MA 4J37A 2IM0A 4WPAA 3A3NB 2ZD1B 4QIVA 4N8OA 1YX2A 4DSJA 3ZNUA 3VAJA 1PYSB 4PG8A 1OO0B 4AL6A 2RJZA 4DCJB 1Q4RA 4DL5A 4IOBA 5HL7Q 3J81U 5I3UB 1KFSA 1CPZA 1TMMA 4DR2J 2OHDA 1HLWA 1V3SA 1CULB 4MH8A 1S76D 1HKAA 4DU8A 4ZPAA 2XNRA 1UW4A 2F3JA 3CE8A 5A8RB 2RF2A 4ZA1A 2LLZA 3BR8A 5IQQA 2V8GA 3PX6A 2J7UA 3MM7B 4S0MA 3OQ2A 2GV1A 3HJVA 4OHWA 1XNRJ 1KTQA 4Q43A 3IGNA 2KYZA 3HSJA 3UPFA 4QU7A 3DLLQ 1WELA 1C0TB 4LF9F 4B3SF 1N32F 2NYIA 4ED1A 1S9EB 3IMQJ 2MGZA 3G96A 4K59A 3KLHB 3QRPA 1U25A 1KONA 4IYQA 4J7CA 3NGSA 4I1TA 1N0VC 2HHWA 4M1KA 4PG7A 1TL5A 1EHWA 3OSNA 4R0EA 3R2CJ 3KK3A 3FEYB 3MR3A 4MTPA 3T5HA 3VAFA 2HHPA 1F9EB 3F56A 1NPPA 2VA2A 4JYAJ 4DQQA 3KJVB 2CQ1A 2UP1A 1IWAA 4FKXA 3PX0A 1LFWA 4FKYA 2DNYA 4DV4J 2V4RA 2UVWA 3FCWA 1JKHB 3UCGA 1FDBA 2JEFA 3P96A 3UR3C 4WFXA 4PAAA 2J6SA 2PA8D 2LU1A 4HH1A 3DM2B 4LFBJ 2B8PA 1QD1A 3SSQA 3PKMA 4Y0FA 1RT3B 4LF5J 2HWTA 3IAS9 4RWXA 2V68A 3IBFB 4Y28C 3FQKA 4F0MA 4DX7A 4U7UK 2ZKTA 3CO0P 1NK7A 1VQ5S 1JNZB 4WYWA 2CNNB 3C6UA 4OV6A 2QFIA 1ROFA 3A8EA 3LPEA 2HFUA 2VPYB 5DG9A 5HLFA 2OPSA 4USJC 4OI2A 1UWAA 5DDRC 2E1CA 3Q0AA 1S99A 4DV3F 1JNRB 1XR6A 1WNEA 1IBLF 3RJMB 5J2PB 3GIRA 1FRXA 3GJRB 3IWNC 4ZVQB 3NL0A 4LF4F 2KZZA 1HARA 4ECRA 2ZVIA 2B43A 1SI9A 4I56A 3J81Y 4RJVA 3CJKA 1F2HA 2DCLA 2XI3A 2D41A 2DR6A 3M1VB 3TNVA 2BMBA 4RUCA 1R8CA 3FNNA 3BYRA 5CHCB 2F8EX 3M8WA 1PJ6A 2FJXA 1JLGA 2WVFA 3SQOP 4H4MB 1KOHA 2VOOA 3MEGB 3E8OA 4M5HA 3KHLA 4B02A 2AV5A 2DXEA 4Z37A 2J0XA 1HD0A 2YX4A 2AZ3A 4X62J 4M94A 2DY9A 4YHHJ 4JI0F 2LKZA 2CJKA 1RA6A 3T9NA 3CD7A 4L74A 2YNFB 3DOMB 2MXYA 4P75A 3I5AA 2OELA 2O1PA 2AGPA 2Y3YA 2WBRA 3KK1B 1HBUA 1TL7A 1UVNA 4ZVSB 4CYUA 4MK7A 4TYAA 1CJKB 1V5VA 2CPFA 2QSFA 4FYVB 1G2EA 4IQXA 1KEKA 2OEKA 2QX0A 1NSKL 5HMYA 4ZJLA 2DISA 3KUEA 3IBWA 2G2OA 1NDLA 1U6ZA 2FTRA 1RBLA 3CIMA 2BM0A 3D2WA 1U2FA 3MUTP 4OYIA 1OSCA 2EFQA 1RDRA 5C7PA 1NB7A 2HURA 2N82B 3K17A 1YZ6A 1HR0J 2UXDF 2ZOMA 2ASYA 2J8SA 2QLFB 3H0PA 1EARA 2HS4A 2WVCA 5LOQA 4MKBA 2OTLS 4C48A 4L3KA 1UCNA 5JJBA 3D1OA 2YX7A 2FHMA 3HF5A 5A8KA 3IRXB 1SC4B 1RBAA 1RTZA 2VG5A 2HVIA 3MFIA 2E5HA 1HNXF 1RUSA 1SUQB 3CWJA 2PSZA 1FJCA 5HROA 2YKNB 1VQLS 4G1QA 4OLPA 3ITHB 4OYOA 5ADZA 3V4MA 3M9NB 4ED6A 2Z0GA 4IG3B 3HCXA 3H2LA 2VC0A 4UF4A 3GV5B 4RU9A 2CNLB 1TVRA 4Q0BB 2DIVA 1S97A 1GXTA 2BEFA 4YUDA 4OX8A 1TKDA 3D5MA 2LYVA 2GZOA 2EEYA 2X1FA 3CGIA 2YY3A 2ZH4A 4K2JA 2LQJA 4ZCIA 4X64F 5AJ3J 1VQPS 4RWWA 4MJKA 1HHTP 5H9EJ 3GP9A 1YRTA 2VG7B 1HQUB 2FYXA 5KFCA 1EKRA 3G6ES 3L4BC 4WTOB 1FRLA 1S1UB 3PACA 2ZITA 2VV5A 3M32B 1LOUA 1VQYA 3RTVA 1FF2A 2KT3A 2NCKL 2Q79A 2XMJA 1P1LA 2HIYA 1F5BA 2SXLA 4DN0A 1D9AA 2B56A 3BO2A 2R7QA 3CCMS 1WG1A 3GG0A 3M2RA 2IM1A 3M8YA 1LW2B 2BE2B 4OZ1A 3O8WA 2V9KA 1MSWD 2W4CA 1JLBB 4LVOP 2RDDA 1RHJB 4EGLA 2NYHA 1AFJA 1RTJB 1OQ3A 4F4WA 3TOQA 2VA3A 1FWPA 2CQ0A 4DV5J 2OAUA 1NK6A 1YDLA 4DS5A 1FNOA 1N52B 1U1LA 4G65A 1ICEB 2OPRA 3RBZA 4PABA 1H2VZ 2V4JA 2MZJA 1CBKA 4R5PB 2BRLA 2GQQA 3MM9A 2K7KA 2CQGA 2UXCF 4YS2A 1RXOB 3VZHA 1C1CA 3MUVP 1RT5B 5EUHA 4CLUA 2AIRB 2LDIA 3DRRB 5A8WB 1RWKB 1V9OA 1Q86T 3P3DA 5JMNA 3UVJB 1YGYA 1QUPA 3LF0A 2YH0A 3L3CA 3IXQA 3M2UA 4NWBA 2UVUA 4E98A 3KKFA 1UVMA 2DNLA 4MYTA 3CDAA 4ICLA 4PUOA 3EDRB 1FA0A 1ZBTA 2PFFB 4GVBB 3BQ1A 4BCAA 2PFDA 5HN0A 3R5JB 1C4CA 2MKHA 4USUA 1U0HA 1NO8A 3LH2S 4DLEA 4I68A 3VQTA 3K5OA 3E2EA 2D3UA 1GAOA 4NCGB 2IYIA 2OD4A 4L72B 5DGAA 1MU2A 1P9YA 2MQOA 2XMAA 4F02A 1M90T 3LWLA 3TAQA 3NBPA 4X65J 4KHRA 1RGVA 3LP2B 4R8UA 3TX8A 2K3IA 3KDNA 4C0HA 3W65A 3PY8A 1RYRA 2HW3A 1GXUA 3ET6A 1WC6A 1IKWA 2MKCA 1YG0A 2IC3A 5SUHA 2XWYA 2RE1A 3SV4A 1WKLA 1JWWA 3Q23A 1HA1A 1KNZA 1Q7YT 2OMLA 3C15B 1R8PA 5CYJA 3AD7C 3MM5A 2I1RA 1GMUA 3W63A 4ECZA 2XWXA 1TUVA 1N5SA 1I1GA 1ZH5A 5EX0A 3ZZZA 1UMJA 4BWJA 2VKZG 1VLOA 2VD3A 4NLSA 3DLEA 1IKVB 4ECQA 3KLIB 2R2RA 1BLUA 3CJ2A 4LF6J 5IS2A 1S4FA 2VBZA 4JI1J 4UZCA 4NOHA 3O44A 2JOQA 3OXLA 2FLOA 4J91A 4CT9A 5KFMA 1V3ZA 5B09A 1OY6A 1MROA 1N8RT 4WFBQ 4ES2A 1IR2A 1GNKA 1ZM3A 5E2QA 1RT6A 1T3OA 5DETA 5DQIA 4N41A 4ZHRB 1G1XA 2D3OR 3CJRA 4O3PA 4H54A 3H5UA 1SKRA 3MM6A 3TRGA 4ER8A 2V2VA 5GMKa 3BGFA 3CTRA 1TMJA 5F41A 4PZVA 4DV7F 1Q79A 2VFUA 1YITS 2VPWB 2J9EA 3IAM9 4RUBA 4V1Ak 2YWHA 1U1OA 4UW2A 3OR1B 4QR2A 2ALYB 5DLFA 2ZHOA 3QRRA 3SEOA 2DTJA 1UJ5A 1OS5A 1XMOF 1VIOA 2RQ4A 3H4BA 5DZ7A 3D3BJ 2ZKUA 1YJWS 3MEEA 3FEZA 1Q82T 2V50A 4RW6A 5I3QA 4K2XA 3KG1A 4WWSA 4E8UA 3QZ8A 3OJSA 4B3OA 1FFSB 4X4NA 4P71A 3D0GE 3IG1B 1LWXA 4Z7CA 2DITA 2EFVA 4J9RA 1OPZA 3M6UA 3HX9A 3F0NA 2CZ9A 2YQ1A 4DR1J 4K50A 2JHEA 3MD3A 2DBBA 1FKOB 1RAGB 2VIHA 2R7SA 2EK6A 3R6GB 4LR7A 4EZ6A 4PQUA 3MPDA 2D69A 2O01C 1T9WA 2YKMB 4IH7A 5FDLB 2B6AB 2AW0A 1E6VA 4CP5A 3OFGA 2M8DB 5LMNJ 3KWMA 1Z2LA 3LANA 2PEBA 2HNYB 3RB3A 4LSZB 1QAJA 2P5VA 2YWWA 3BDPA 1B0VA 4LVNP 1MMLA 1NDCA 2RRAA 2VOPA 2DJWA 5B08A 4IFVA 1NSQA 4M5IA 2QLBB 2EK1A 2PEHA 1GMVA 1NMEB 4PWUA 5C5JA 3THTA 1DBDA 2VFVA 4LBHA 5ETNA 5KFSA 4FPRA 3VAGA 3MPUB 5KFVA 5KT7A 2Z8QA 1VHFA 3G6VA 1CS4B 1VISA 1VRUB 3ZXWA 3GV8B 2GJ2A 2ZH1A 4DX5A 2QGFB 2NXCA 4Q44A 2K7JA 3OXFA 3I55S 3RB4A 2JEJA 1S12A 1AROP 5BXIA 1OMSA 3Q86A 1WOPA 1NJZA 2OIHA 2CQPA 2L9WA 3KG4A 4WKRA 3FSXA 2WVBA 3W7BA 1XMQF 1JLFB 2I5JA 1DTTA 2W9CA 2BM1A 2HZVA 2R8JA 3TZXA 3CDWA 1VIXA 4ANDA 4DR4J 4RW8A 4ETZA 3HJFA 2J6UA 1U1NA 3NCRA 2MQMA 1U2RA 3LP0B 3HKWA 3IA0A 2KT5A 1RA7A 4ID5A 1HMVA 4ECVA 3NP5A 2NZCA 3NOGA 3KDOA 2FVQA 1UA1A 4KO0B 5B0GA 1RT2B 1LWFB 1ZA1B 4I6AA 1R3NA 3C46A 3KUGA 1PKUA 1U8WA 4AL7A 1OJ4A 1D8YA 1R43A 2D3ZA 1O6XA 1YI2S 3TA1A 4IKAA 4DU7A 5J1NA 2P8IA 2GAGC 4WFYA 3AHPA 2HFNA 3B8HA 1LWEB 2X1BA 4QPXA 3OJUA 5K9FA 1H2UX 4CM0A 2CZ4A 4NZ0A 5H9EK 2HIQA 4G6VB 5BYQA 1S1XB 2LU2A 1M1GA 4KTQA 3EDQB 5AE1A 1IM6A 4KB7A 1SIZA 3PFEA 2IAJA 1YJNS 3K8VA 4X66J 5GMEA 4NYZA 1YJTA 5F0UA 1Y9OA 4KPCA 2Z2YB 2ZE2A 1F6TA 2KG1A 4LFCJ 3CCJS 1FTCA 4IG0B 2Z30B 3TZZA 3GR1A 4ZLJA 2W2QP 1QSYA 4FP9A 3AY0A 3H2UB 2XCAA 4YN3B 2C2MB 2MYFA 3E51A 2PA3A 3MCMA 3UE2A 3DOKA 3TEHB 4DHVA 5ITHA 3X3UA 3ZTOA 2OD6A 2QMUB 4I7FA 2O5DA 1RT7A 3V4IB 2U2FA 3R27A 1NHKL 4HHHA 2I38A 2ERRA 2ZWPA 4DV6J 2XO7A 2ADCA 5ETMA 3W5YA 2ZUGA 1V3RA 1HW9A 3CCZA 3PX4A 4ZLPA 4NMXA 2LQ5A 2RUGA 3PW5A 3ONQA 2MZTA 2UZAA 2DNPA 5IM0A 1FTRA 3U1NA 1S6OA 4GO5X 3A13A 3TZWA 2ROGA 1HNWF 2JLGA 4A8KA 1PBAA 3AQPA 4LFAJ 4TXSA 3PYFA 3QO9A 3N6MA 3HFZB 4QPTA 3WHIA 5CCLA 4FVMA 4OZJA 5B7WA 3MEKA 1S77D 3M8QB 5KG5A 1K1SA 2J5AA 1NM2A 1S0VA 2QTWA 5E0OA 4JI7F 4DX8H 1YWXA 3CCVS 5B0BA 4A8MP 1FDAA 1SC6A 4RO0A 1NPRA 2VONA 2A2CA 1S1TB 1TKZA 2CPIA 4ECYA 3T6JA 1RT1B 1UL3A 1KQKA 3CO9A 1IQZA 2R7VA 4DR2F 1N54B 4F3OA 2XM3A 2HHVA 2JEGA 2G4BA 1E6YA 1H7WA 2D1CA 4F3QA 4K4TA 4ZMMA 7FDRA 4C6AA 4NLRA 1QAXA 1S1VA 4NYPA 3KK2B 5KFEA 1RWNB 4B9TA 1KSPA 1AUDA 1SKUB 5KFZA 4DL7A 1UWBA 2CIMA 2MY8A 2C3OA 2KHDA 2QC3A 4HEA9 2IFXA 2HHSA 1XNRF 4BBYA 3M8SA 3TUIC 1QTNB 2GFFA 4RUHA 2R7RA 1QE1A 4NEYA 5KFLA 1H2TZ 5HMXA 1LEOA 4U8YA 5CA5A 2O3DA 1HQEB 1R31A 4K4YA 2U1AA 3KHHA 4U96A 5IQ6A 3QAUA 5F8HA 1VQ6S 5BJRA 4WTYA 2APOA 1S10A 4DPYA 2XBPA 1QM9A 3KK3B 2DGOA 2CAJA 1VDHA 4NE9C 1SL1A 3K5LA 4YFUA 1UVIA 1VFJA 3PM9A 5ETVA 4JI6J 3EICA 4CO2A 4ES1A 3PHTA 2BQ3A 4KSEB 4JYAF 5ETPA 4AYBD 2MQPA 2AQ4A 2B4PA 4J9SA 3D0IE 3QLHA 4QW8A 1U1KA 3FZ2A 3EZOA 4DV4F 2B51A 4RW4A 1WOSA 2FGCA 4AD6A 3OHAA 2N3OA 2G1DA 2BJEA 5K14B 2HK3A 5C24A 3IR7B 2QE5A 3CJQA 4DPTA 4LFBF 2ZNYA 1LQ9A 1X4BA 1N36J 3JSYA 4PEOA 1FWKA 3BSCA 4LF5F 5KFYA 3G82B 3OUYA 2ZZTA 2VQEJ 2RDJA 3ELHA 1RTIA 2F1FA 1AXQA 2J6TA 3N79A 1Y5IB 1VJQA 4ZIWA 2OMOA 1DFDA 4X4PA 3AODA 4CM2A 4PXCA 1YQHA 5HLFB 2Y8WA 3B6BA 2EFNA 1R8BA 2M0GB 4CRJA 3BGRA 1WC4A 3UQSA 4F4XA 5DQHA 5EX3A 2E7XA 2LMIA 3HFVA 4XO0A 2XO6A 2B9XA 3JQKA 2B3TB 4LSLB 1VQ7S 2L48A 4GKKJ 2Y1IA 2AYBA 2MB0B 4CLWA 4FS2A 2RH3A 1YVFA 2FVPA 2UV8G 5G0RA 3DN9A 2YPZA 3LGHA 5DJBA 1C0UB 2MQQA 5DQGA 4EZ9A 2WTFA 2PI4A 1SC1B 3T9ZA 5GVQA 1Y10A 1JJ2R 3QNWB 4FVCA 1UVLA 1EQ0A 1XTZA 2BJ9A 1JLGB 1X9WA 1FKPA 3TQEA 2XC9A 5J2QA 3KLEA 4EYIB 3C16B 2V8PA 2KKHA 3B82A 4X4SA 1W2BR 1KRPA 4MT1A 1X4HA 4X62F 4CI0B 4YHHF 4PPZA 4PQAA 2DNKA 2JWNA 3U1MA 4X84A 2KM8B 3TVZA 4HDHA 1FI4A 3MTJA 3SBMA 2QEXS 5C25A 2NPFA 3G86A 4C8KA 5CAAA 1TL7B 1FKAF 1FVQA 3DLHA 1SBRA 3MM8B 1XEZA 2HVEA 2OP5A 2BE7D 4NCAA 5L9NA 3TQ1A 2Z58B 5LJ5Y 3B78A 3J80U 3BS9A 1QSLA 3LWMA 2I8EA 4N77A 4M5NA 3PZPA 1J5OB 3I6PA 1I6JA 3W9IA 1PCAA 3QQCD 2E5IA 2JFKA 3BZQA 1SKWA 1RKJA 1F5AA 1FX4A 3QGGA 5T14A 3CEDA 5ETSA 1ZM2A 4WFZA 1UP1A 1HR0F 1O51A 5LSOA 1YLXA 2XNQA 3DRPA 2QO3A 4ZIVA 5KFJA 2M7SA 3SDEB 1CG2A 2QT7A 2VFRA 4JOUA 5A8KB 3V81A 3BYPA 1F60B 1VQ9S 4HLBA 4TU9A 3I82A 2VJVA 2DHXA 1U7LA 2LXFA 4NPOA 2KJWA 3GPAA 4LRCA 2DR5A 2DGVA 3I0RB 2OFHX 2WVDA 2DXFA 1VYAA 2HZAA 5E3QA 4FBTA 4JI4J 5F8LA 1T03B 1S6QA 3U27A 5IWAJ 1WC3A 4LJMA 1RP5A 1WEYA 3HHLB 2MHNA 1KN6A 4FXVA 4BC9A 1SVDA 1G4CA 2IIHA 2CFXA 2XYGB 1VQ8S 4H4OB 5K8MA 5CABA 4PG6A 2KG0A 2L08A 5DM6Q 5AJ3F 1RAIB 4P52A 1JQGA 3DMJA 5D78A 4M5DA 3RGIA 2ZOFA 4MK9A 3SMZA 1UPPA 2XHWA 4KT0C 3DI6A 1JXVA 5LM7E 4M5LA 2EKNA 2E1MC 4OHYA 3DLKB 4OYAA 2W7PA 1I5OB 1Q8LA 4WK3A 4EWTA 1EX8A 5IC6B 4A8OA 1CJTB 3C66A 1HHQA 3VCDA 3UO0A 3UW1A 3NGRA 3DLBA 1LWCA 2H51B 5CYQB 4OI1A 1JLEB 2ROPA 1BD6A 3Q2SC 5HVHA 3OL6A 4OIXA 5HI7A 2V8VA 4PRFA 2L9DA 3TUZC 4H4KC 1VQSA 2CPDA 2G13A 1EP4A 4F36A 5DRKA 5AXNA 2IDLA 4F0KA 4RBUA 3VVTA 2RILA 3CCUS 4LMZA 1EAYC 2FVRA 4NASA 3J80Y 2HBQB 4DV5F 5I4MA 3V6DA 1TL1B 3Q8QB 1HNVA 2W24A 1U1RA 2J7KA 1RJJA 3QYYA 3T5JA 1B0TA 1N56A 1IJEB 2KXFA 2I2YA 2QLWA 2X1GA 2UU9J 1YJ9S 2HNZB 3MM9B 2CZVC 2F8MA 5M2RA 5BYSA 2LFVA 3G8SA 2QMWA 5FIIA 5LT5A 3QZ7A 5KT6A 1HBOB 5IT4A 3RW7A 5HQLA 3ISZA 3P5TL 1RTHB 1HYSA 3L7OA 4WZMA 4ED0A 2CJXB 4OYXA 4QIEA 4J9PA 1WHYA 4MIBA 5KFPA 2MKIA 3JYTB 4KGVB 4PUOB 3EVMA 2AD9A 1FK9A 3KLFA 5SZTA 2IA0A 2R4FA 2C2RA 2AX1A 4O4RA 2OPPA 4KIAA 4OZ2A 4DFPA 2EBEA 2YNGA 2AU0A 2PIIA 2BKOA 3N5FA 3NRBA 1S9GB 2FJDB 3B54A 3CXCR 1TK0A 1VHIA 3Q22A 4HDGA 4W4MA 2NXEA 2Y8YA 4PG5A 3V6JA 4O4GB 2M4MA 4P73A 1WC0A 1RCXB 4PXBA 4U7UD 3W2WA 4CO3A 3I0SB 1Y3KA 1T0TV 1HBNB 4OYPA 1IR0A 2E5GA 2CPEA 2VBYA 3FDSA 3V2UC 2HVDA 1FX2A 2CNOB 2KYXA 1RLDA 3K5PA 4IOAQ 1FJGJ 4X65F 1NSAA 3ET6B 1ZYQA 2XY7A 2BJ8A 4IR1A 2HHUA 5DDOC 4RPFA 1RT4B 3H25A 1N48A 3MCNA 2CPXA 5DG8A 2W01A 3VTIA 4NLDA 2XGPA 3MM5B 5F3TA 1R0AB 2YNIA 4C98A 1PJ5A 3ILOA 5KFKA 1YHQS 4K0KF 2R7XA 2NXNA 4ECUA 5HJYA 4WU3A 2VDHA 3US5A 3TJ8A 1DTQB 3VF0B 1B64A 1SJ3P 4FF4A 1WC1A 4DUYJ 3RRKA 1EKSA 1UZHA 4DS4A 1EETA 4LF6F 3HO1A 2ZBCA 4U8VA 4JI1F 3D6TB 2H4YB 3E01B 2AGQA 1N5TA 4QW9A 1M0SA 3K5MA 4ELTA 4HH0A 1MROB 4NLTA 2ZC3A 4A47A 3PEJA 1L3SA 2ACYA 2FVSA 3HSZA 4LRBA 3TUPA 1YTYA 4AXIA 3CJ5A 3Q24A 1TZ0A 2BQRA 1KTVA 1VRTA 2ZZMA 3AFGA 1V6HA 1M1KT 3CMAS 3VWSA 4ZVUB 2E7WA 3BM7A 4KYZA 4LQ3A 3GFZA 3V6KA 4HACB 3VALA 3CJ8A 2VG6A 3A3PB 4LUBA 2MZSA 1RHQB 1X8DA 1BXNA 3IN5A 4P2XA 2D9PA 2AYEA 2HG4A 1U45A 4PPDA 4ZVHA 2EC2A 1RWXB 4L3NA 3MMJA 3AJ1A 1SL2A 3ZZ0A 1JLQA 2OI2A 2ZNZA 1BQMB 2CQIA 5E7OB 1T11A 2LVWA 3A4TA 4XDCA 1A0OB 5DZ6A 1S48A 6FD1A 2V8HA 1RK8A 3THPA 3KJFB 5D3GA 4F25A 5A0YB 2CPJA 3DDIA 2JNJA 3AB4B 1A6LA 3I4HX 2QFJA 1ZA2B 4CLLA 5KG4A 4Y2IA 3PG9A 3GYGA 3HDSA 3SCJE 3AQOA 5HBMB 1MW7A 5L1IA 4KFBB 1Q81T 1T9XA 3RYLA 1SCJB 2HHHJ 1YSJA 3BBCA 3IR6B 2N4CA 2YX1A 4DR1F 3M7VA 4TVAB 4M95A 3UN2A 5A76A 4UUWA 1SQEA 4BWMA 2MLZA 3NG8A 1Z2ZA 4DG1B 2HAFA 3DXSX 5GAGU 5D4PA 4KGKA 5L1LA 2E9RX 1UFWA 3PV8A 1C1BA 2KO1A 1S4EA 5LMNF 4PWDA 1NK5A 3PIPQ 1N5YA 1BMQB 3FEXB 4QR0A 1AYEA 3TJ9A 3F41A 3UD5A 3MAQA 5CQGA 1RWVB 3KJQB 4P7TA 3H59A 3PJWA 5HMWA 2ZD1A 3MR5A 4URSA 3JXOA 1S0OA 4YMEA 2QG9B 1VRQC 1XNQJ 1KVKA 3A12A 4R25A 1YBUA 5D15A 5I3UA 3SCLE 2CWKA 3DCAA 5JVHQ 1P8GA 3WX8A 1CULA 1PSDA 4CLPA 4QQBA 4Q8FA 2V2ZA 2MJNA 4G3IA 5KOWA 3P45B 5A8RA 2AMCB 2X51A 1RAJA 2BA9A 3N6NA 1GXLA 1O0PA 2RT3A 1H72C 2VBWA 3MM7A 4NZ6A 3EGZA 2I5JB 2UUBJ 2WSEC 5B0CA 4DCOB 1XWLA 1D3WA 4LR9A 1C0TA 1VQNS 1JLAA 5CYMA 3AD8C 4GKJJ 3VZIA 3H20A 2YWGA 1S9EA 2GO8A 4DR4F 1DY3A 5HANA 2MTLA 3KLHA 5JXSA 1WDTA 4QWAA 2KL8A 3ZFVA 2JC0A 4DXLA 4O44B 2FY8A 2A18A 2WAQD 3M2VB 4NLVA 4XIUA 3R5GA 5M2UA 3MCOA 4DL4A 1KS2A 2QA1A 4QR1A 2RVJA 4C97A 1K0VA 3TVKA 1IR1A 3KJVA 4NLOA 3FBFA 1DQ9A 4Q7AA 4WK1A 3ZZOA 2PGCA 4QWCA 2F9DA 4NCBA 1BQNA 3G87A 5CXTA 2DEIA 1H98A 1AZSB 1TKXB 3EJMA 4OI6A 1JKHA 5KFHA 4GC7A 2Z2MA 1N33J 2FJVA 4ZP8A 1HPZA 2ZBPA 3C14B 3IBCB 3I87A 3KJNB 3BKFA 4DSEA 4UQGA 3T1HJ 5B0AA 4CLTA 3G6XA 4RW9B 4RNNA 3BPSP 3DM2A 5IT9U 5AXMA 1BUXA 1I94J 1KQGB 2W2NP 1SV5B 3B4MA 5I3PA 1RT3A 2XMKA 2FHKA 4TQRA 1HBMA 1U09A 1OY8A 4X66F 2G1HA 5CZVA 2H4WB 4X4OA 1B99A 3DDKA 2CG4A 4HI1A 1QDUB 2Z57B 1JXLA 4LFCF 3BBFA 4I6WA 2CPYA 1NJXA 2EFPA 4RKUC 1RI7A 2VH7A 2HSEB 4B17A 1O8BA 1REVB 3BN4A 1UA0A 1UJ4A 4QOTA 3RRGA 3IS9B 3JSRA 3T5KA 4OJGA 3HHDA 4EBCA 3I9ZA 3VHQA 2AGOA 3OTCA 3RAMA 4C8MA 4DV6F 4DPOA 4TKTA 4FXWA 5J2PA 4O3NA 2Y1JA 1TUWA 1BE4A 4BS2A 1WF1A 2B4OA 4P6QA 1SC3B 2KFNA 4LF7J 2RS8A 1X4DA 4LBIA 3M1VA 5FLXU 1K73T 2KU7A 3QPIA 3GFHA 3D1HA 2H5IB 5HVGA 2Z4PA 4LFAF 2CA9A 3Q8UA 2HS3A 4A8FA 3UFCX 2HEKA 3NGTA 4CLYA 1SH0A 4H4MA 4LQ9A 2Z2LA 3MEGA 4DBQA 4IDKA 3Q83A 3AB2B 5GAHU 2VODA 1KD1T 1SQFA 3M8PB 3P5BP 4X2BA 2GVZB 3GZ7A 4AT1B 2YKQA 2XY6A 3PEHA 3FBCA 2R42A 3CCWA 2YNFA 4DQPA 2IVYA 3DOMA 4URQU 1N5VA 3IRWP 2N7CA 2G9OA 1VBZA 3DRXA 1NK4A 5DLGA 3OFEA 3KK1A 2VC1A 2WZ1A 2R8GA 2W2PP 3VAKA 3JS9A 3M30B 3MF5A 2EFGA 4BLGA 2M9KA 4V19J 4F2RA 1VR6A 1XR5A 2MDAA 2P9CA 4ZS6A 4DN9A 1Q8BA 4ZPCA 2HRTA 2F63A 4KBIA 4WJBA 3AH6A 2HQDA 3VGSA 3VAMA 4K4UA 3HMJG 4OMFG 4EMDA 3LQVA 1Q78A 4KV8B 2V2KA 4I69A 2DNGA 5C42B 2HRYA 3ZNJ1 9ATCB 2R8HA 3ZTQA 2PMZD 1FXDA 4H4KA 2FY1A 5ETTA 2LEPA 3EWGA 1B7FA 1RWPB 4EI2A 2CQ2A 2LEBA 4QWBA 3BSOA 5IT9Y 4WCEQ 3EUNA 4F4KA 2AEMA 1H3DA 5KFGA 2FJEB 2W9BB 3IRXA 2AEJA 4TLQA 4ILMA 3NOCA 5B0DA 5ETKA 2EXUA 4M5KA 3TW0A 1TAUA 3GR0A 4YOEA 5J2MB 3Q8SB 4DR3J 1SUQA 4JI6F 2F9JA 4L76A 3TAMB 4F4ZA 2IHR1 2BANB 1NKCA 2XLJA 3ENVA 1Q5VA 5GAGI 1S72S 1JK9B 2QMXA 2M5YA 2FZKB 3HHKA 1GX5A 5C24B 3BKTA 1YBAA 2ZC4A 4ED2A 2FC9A 5T41A 2GIQA 2JEIA 4USVA 3WC0A 3RB6A 1PC4A 1NCLA 3QWUA 1LKZA 5KAKA 1UTAA 1N36F 1Q7LB 1RTIB 2VQEF 3QGIA 3BQ2A 2VG7A 4P10A 4DV2J 4JV0A 5H9FJ 5FLXY 2JH3A 3KMQA 1HQUA 3QRQA 1S1UA 5AXLA 2DPIA 1RHRB 5KT2A 4AFFA 3CF5Q 1S7HA 4DV1J 3IWXA 3CCSS 3NGDA 2FD2A 3HLUA 3CJ0A 4P72A 4W90B 4GKKF 2RDIA 3OTDA 4G1IA 4LBPA 1LW2A 2BE2A 1YJ7A 1YRXA 4P2FA 2K1RA 2OH2A 2CDRB 3HVTA 4YR3A 3Q8RB 2ZOGA 1NU4A 1AUSL 2RIJA 4AE5A 4ZVEA 3QBCA 3H40A 3LUYA 3GIIA 2HQFA 4I4BA 4ZPVR 5C2CA 1RTJA 1R0BG 5J2QB 4DL6A 1N4LA 4I2PB 1J27A 3HZGA 3GG1A 4NLGA 3POTA 1RACB 3D4JA 2MZRA 2BR0A 1IKXB 5DG7A 1FNXH 1GTEA 4ILLA 4NA2A 3FKBA 1S6PB 2DHGA 2MZQA 4JV1A 2Y9HA 4KH0B 5K8NA 5C25B 5KFFA 1M5SA 2C1EB 2HWHA 2JVRA 4GC6A 1RT5A 1N6QA 3DRRA 1QVFR 3WDOA 4P9SA 2DGUA 4PG4A 4M5JA 2ZM6F 4DEZA 4YB7A 1IBKJ 4O3RA 1CJVB 2AJ2A 1OPIA 4GVBA 2B5JB 4DPWA 4EEYA 4I0WA 3HPOA 4WE1A 5E5NA 4YQWA 2HNDB 2RKIB 3QFHA 4OJ3A 3NGUA 3SQGB 4NCGA 1CQMA 4A8XA 4USHA 4USIA 3A3OB 3PIOQ 3UDLA 2DR7A 1K9MT 1FERA 1NRKA 2IM3A 1NBEB 2DGXA 3DYAA 3MD1A 2OSRA 4DUZJ 1AT1B 2KTQA 1BQXA 3LP2A 3MECB 3NWGA 1RHMB 3CMES 3DU5A 2XLIA 2BE9B 3IWLA 5DGBA 2BZ2A 3JAMU 4LF8J 1DURA 4TYBA 3MXHP 3I96A 4F7VA 1WUUA 2UUCJ 4OX9J 1DJ0A 4QCLA 1KOOA 2WOMA 4AL5A 5M2PA 3G8TA 3OVSA 3VGTA 2V8DA 3ZTRA 1K0TA 1HHSA 3T1YJ 3QAEA 2ATLA 4JV2A 2PDAA 2G0IA 4CTAA 3RR7A 2DRDA 2W2OP 2BDPA 4B3RJ 4JI4F 5IWAF 1HWKA 2HZCA 4YP3A 2FB0A 2KB2A 2XZTB 3OTBA 1IKVA 5GAHI 1X5OA 3KLIA 1PAUB 1GX6A 2LQ9A 4UT4A 3CDUA 4ZVFA 3A8JA 4MFBB 3DMJB 3U7JA 3QIDA 2KM8C 2BV3A 1IWGA 1IN0A 1S7IA 2OEJA 3C2PA 2Q3PA 3IM9A 2WONA 4I2QA 4LREA 1HI1A 4X4UA 2FPHX 2H9ZA 2IVMA 4K8RA 4QYRA 1DQAA 1HWLA 1N34J 4OI4A 2FZGB 4A46A 4IO1A 3FRYA 1WG5A 1PAEX 1JLCB 1SQGA 1CSJA 1MMNA 1TV6B 4ZHRA 1NXIA 3EZ5A 4DQRA 1LWCB 1N5QA 1VC5A 4C3LA 2XI2A 1X5TA 4HHJA 2AP6A 3T41A 1B3TA 4IRCA 4C9DA 1AB8A 4MK8A 5J2NB 4KY3A 4Y6IA 1KVIA 4EFAC 4B9MA 1WSRA 3OL9A 3OR1A 3PO4A 1ELOA 2Q6CA 4CLSA 3S7RA 1RABB 3QT8A 3CC4S 2GVDB 1XR7A 4C2MA 3MOZA 3LP1A 2GJIA 1SIWB 1O5JA 3W1YC 3DLJA 1JJHA 2GGPB 3QSIA 4CT8A 1FXRA 2W25A 4PXEA 4V19X 4JI8J 3MAAB 3M4XA 2LEAA 1OIAA 2G0JA 2FLLA 4ZPWR 4TY9A 1WG4A 5A6WA 4RUAA 1DLOB 2GJFA 2B7CB 2PMWA 2Q66A 1EQMA 2LECA 2UU9F 2GO9A 5KG2A 1X9SA 4OYBA 3FSYA 5L39A 2VL1A 4FNIA 3IG1A 2B7BB 3OD2A 2HHTA 2NQPA 1D1UA 3UR0A 3R7SB 5KFAA 3NS5A 1B4SA 3FSIA 4Y65A 1JX4A 4OLOA 1YJUA 4FZVA 4A8QA 2CJ9A 2JFDA 1FKOA 1F2GA 3DGPB 3GTYX 1Q8KA 3HHLC 2Z2ZA 1FEHA 5FDLA 2B6AA 3SFGA 2VFTA 3KG0A 2H3EB 3JAMY 2PO4A 4WZQA 3D28A 4DF4A 2MMYA 2MQLA 1DQ8A 1XERA 5EDWA 3UNGC 3MAHA 1XBWA 4EUVA 1TL3B 4DZ6A 4DI6A 2BJDA 5DM7Q 4LF1A 5IFMA 4J9LA 1UETA 2CVIA 1MWYA 3ULHA 5KFRA 3MMBB 4ZITA 1S6UA 1U6FA 3M6WA 4EO8A 1RWOB 2F5GA 1QLNA 1PO6A 3G71S 1GH8A 4RNOA 1HIYA 1CS4A 3D66A 1VRUA 3TA2A 1FJGF 3CPWR 2OEMA 5E33A 4OL8A 3I32A 2KVIA 3NKYA 4WFNQ 3IFEA 3MUMP 1SL0A 4NX9A 1WKKA 2NPIA 3FCHA 3FQLA 3MMCA 3G4SS 4LRDA 2AJ0A 3HVRA 3K89A 1WTFA 2A10A 3JQJA 2UXBJ 4FDFA 3BO3A 3TO8A 1FRKA 5L8RC 2HLUA 3MHYA 3PYDA 2C3MA 1JLFA 4B9NA 3DOLB 2AJ1A 4DCPB 1T05B 1VGYA 2H54B 4TY8B 4LSNB 1YKWA 2OKQA 3TA0A 3DU6A 4ZVOB 1WI8A 3EZUA 3OW2R 1SH3A 3A8IA 3I9V9 2ZFHA 3HD1A 3LP0A 2X1AA 1H6KX 3THVA 3AT1B 4DUYF 1R6VA 4X4TA 2RU9A 3BGUA 5LJ3Y 2OSQA 2WSCC 2KI2A 2C42A 2HBZB 4KO0A 4JP8A 4LR8A 2QN6B 2HMIA 1RT2A 5J1EB 1LWFA 3LO3A 3O2IA 2EPIA 3ZO7A 2MZ1A 4C11B 5KFWA 2FGOA 4K4ZA 2ZHBA 4JV5J 4DL3A 3N9UC 2WW4A 1FE0A 1LWEA 1QJHA 8AT1B 4TQSA 1H73A 2C2DA 3ILIA 3PYGA 4YDDB 4K4WA 3N01A 4C0OC 2VFSA 1S1XA 3PYEA 3PTWA 5H9FK 2B0GA 5ETOA 1TKTB 2GW8A 1JJCB 2XULA 1ZZNA 5D4LA 3VGVA 3AA9A 4O3OA 3Q8PB 1D9DA 3JB9k 3TUJC 2KJVA 1JLQB 2W8LA 3MR6A 1Y5LB 3M6VA 5ETLA 2RHSB 2M3DA 2AX0A 4A8YA 3UD4P 3D3CJ 1RTDB 2Q6BA 4NRTA 2YQ0A 2FJWA 4ZOSA 2KXHA 1EZZB 1D0EA 2P6SA 2PE8A 5FJ4A 1VBXA 2XSFA 4WU2A 1RADB 1D09B 3V4IA 2G2ZA 1ZTWA 1M1HA 3CD5A 4DMZA 1RB0A 5A2QU 3BQ0A 1ZM9A 2ZH6A 5KFXA 2DO4A 3OFFA 4PXDA 2EFOA 3S1TA 4WP3A 1R8AA 3W8PA 3RAQA 2AHOB 1Z4UA 2HHHF 5BYRA 2DNZA 3BH6B 4J9VA 1VLYA 3H5XA 2DIUA 1FRJA 4F67A 4IFYB 3NWRA 3OR2B 2O66A 1LK5A 1WORA 3UDCA 2VQFJ 4YR0A 3H4DA 4ETXA 4PWDB 1X4FA 3CD0A 4P74A 1Y0HA 2MLYA 1VBKA 3ICLA 4BDPA 1C2PA 3KLGA 3JSBA 4AQYJ 1LW0A 2ALZA 3Q89A 3PRDA 1KWMA 3PRVA 4Q2MA 3RAXA 2NLWA 5CD4A 4M8LA 2W8KA 3UI3A 2F4VJ 1S1TA 4DFJA 2GQ2A 1ITPA 1XNQF 1IM4A 1WOOA 1RT1A 1FRMA 1NLKL 5I42B 3OHBA 4Y2MA 2ZH5A 3DRSB 2HGLA 4YEAA 5IXUA 4U67Q 4UY8T 3R97A 3RUBL 5GADU 2N7YA 1UW9A 2RRNA 3KK2A 3M9MB 5T7LA 3OSPA 3FC9A 1S1WB 3WX4A 5IC4B 1JXEA 2A2DA 2R7TA 2EG2A 4FNHA 5F8MA 5IOLA 2C28A 1WKJA 4XK8C 2CQHA 2UUBF 1JLAB 2DR8A 5CYMB 3KMSA 5DDPC 1T9YA 1RAOA 2DH7A 2DNOA 4GKJF 2ZJPQ 1ZPWX 1ZAXA 4BHQA 2N4DA 3O6QA 2AJFE 1FJ7A 1P1TA 3MEDA 1HQEA 1ZM4A 3BREA 1S79A 5HP1B 3MPWA 4NI2B 3N5BA 5JUMA 3D54A 1L3VA 2NXUA 1SJ1A 2WB4A 5HK4A 3A8KA 3GYNA 4TLRA 3JTPA 3MMAB 3QIPA 2B4VA 4WF9Q 5F3ZA 4XTTA 3C3LA 1BQNB 3T6BA 2GQCA 1MN7A 3C6TB 1V5IB 3NCPA 1HPZB 1PIEA 4Y2CA 2QLXA 5CD4H 3ISNC 3N28A 2IPOB 1NJYA 1S5ZA 4PYDA 3TARA 1N33F 1M5VC 5K14A 2R2SA 1G6BA 3KOAA 1KFDA 5A2QY 1R89A 2DK2A 4FBUA 3T1HF 3BGLA 4KHMA 3BDEA 2Q1LA 1GT8A 1I94F 1HBMB 3CD6S 1ZS6A 1S59A 3PDNA 1XMBA 2V63A 4RW7B 1RSCA 4HT5A 3G82A 1KVJA 2ACMA 4YY3J 1Y7PA 4K5RA 2CJYB 1RISA 2DXDA 2HFZA 3D68A 3AXMA 4ZN3A 1WSVA 4ZPDA 2K3KA 3RR8A 1NNDA 1IBMJ 1Y5NB 4J9KA 1RQ0A 3W9JA 4UOCA 2P9GA 2CJQA 4OHXA 1HI8A 4F4AA 3CW2C 4LSLA 4J9OA 1RBOB 1PG5B 4DV0J 3UCZP 3GILA 3ZTPA 3R9LA 3K58A 4I6YA 3CSKA 1Y4ZB 4DR6J 1C0UA 4LF7F 2QIFA 2XSJB 1WHVA 4CLFA 3EYZA 4ECXA 3PJXA 2D9OA 3FK4A 4G1PA 1IVZA 1FCAA 2X3GA 4OYZA 4O23A 4AUKA 4O3QA 4OI3A 5KG3A 2IVFB 2IRYA 4D3GA 2JLFA 4NXNJ 2ZDPA 4JI3J 2BRKA 4IDKB 3IGVA 3C16A 1HFEL 2E1AA 1KHWA 3OTOJ 1S9FA 4ANEA 2V5HG 5KG0A 3HHLD 2RQMA 5KFIA 1H38A 4DSIA 2AEFA 2KN4A 2DB1A 2DHSA 3QATA 1NDKA 1PJ7A 2FLNA 1NHVA 4OFZA 2AKWB 3GIMA 3SI8A 2RF2B 2ZDOA 4UQTA 2GHPA 4OZLA 3CDEA 3QGHA 4X4QA 3O1LA 4F8RA 3MM8A 4DR7J 2XS2A 1YIJS 3CJTA 2K06A 1TK8A 4QIWD 1WDDA 3S01A 5EN1A 2GC8A 1BWVA 3K8WA 2V69A 1HNIA 2MGZB 2E5JA 1EB0A 1J5OA 5D77A 5L1JA 2HWIA 2EKYA 2DNNA 3BGOP 3HI9A 1B0PA 3GB0A 2W7OA 3BSNA 5D8HB 4A4JA 4KJIA 1RYSA 1SB6A 4O0IA 2UUAJ 2D7SA 2V34A 4NLPA 4YB6A 2CUYA 4OZ5A 4DLGA 3SDEA 3ENAA 1VC6A 3FMBA 2NSCA 4GMKA 4KKOA 2DNMA 4HI2A 5K8OA 1U49A 2C2KB 1VJWA 3P4UB 4EBDA 4ZN1A 5IV4A 4HTIA 4DR3F 2RSQA 4ZCKA 4DZDA 1ZOTA 3I0RA 3R1LA 1TU0B 4ECSA 4OZ3A 3HZEA 4RNFA 1NH7A 3KTQA 1UFKA 1T03A 1YRUA 2CYYA 1KBRA 1KQFB 4F0HA 3ZZPA 1VK8A 3HHLA 1UVJA 3NY0A 4K4SA 5H1SV 5L1KA 1T94A 4ZDNA 4H4OA 5F0WA 3V6HA 3C6UB 1FRIA 3HK2A 2YTCA 3DLGA 4LRAA 1X5SA 2VASA 3BN7A 2QRRA 2OPSB 1FJEB 4CIOA 1T8EA 4B9LA 2O67A 1HW8A 4DV2F 5LMUJ 1T9TA 1VQKS 4ALZA 3GSIA 1PBUA 3J7Z5 3EX7B 3DLKA 3K2YA 2IJNA 4KGZB 3RG6A 2BACA 2VPXB 3CJSA 1H74A 4ED3A 2DNRA 2QA4S 1ZPVA 1CJTA 8ATCB 5GADI 1UJ6A 2MKYA 1CC7A 1OWXA 2GIRA 3G2XA 1SJQA 5HQ8A 4DV1F 3CJKB 3S6EA 4ENOA 2LXIA 5CYQA 3MPVA 1JLEA 2XB2D 2UVVA 4CDIA 4CH7A 1SXLA 2V94A 1FO1A 3MCSA 1UKUA 2K1RB 3HVTB 3SSSA 3MDFA 1WEXA 1RAEB 4N56A 2BQUA 4NLQA 3CCRS 1HWIA 3ZTSA 2V0NA 3W60A 1UEVA 3D6HB 2ZHAA 3WZ0A 5KG6A 3QJLA 3VAHA 7FD1A 4YB5A 2XHCA 2VU5A 5EWEA 4ZK7M 2L3MA 3SSRA 3POTB 3TYTA 3D9BA 4C0BA 1TL1A 1TL4A 3HD2A 3E3XA 1DHMA 3SV3A 1HBUB 2Y0BB 1Q95G 1ULRA 4CYUB 2E29A 2BKNA 1NAQA 1NDPA 3C8YA 2HNZA 1U48A 3W3SA 2RMLA 5J1PA 3CVKA 4KGMA 3U02A 1RWUA 3RZAA 4Q5VA 1OYEA 1N6QB 1HWUA 4JI2J 4JUZA 1NKEA 1HBOA 2WVEA 1RTHA 1NK8A 2C2ZB 1X5PA 2J9DA 4NLWA 3JYTA 2W7AA 2GIFA 5AE3A 3D6MB 1IBKF 3NAHA 2IA6A 2CJAA 1X0FA 3H5SA 2W4PA 2V9WA 1T3NA 4N8NA 4KHPJ 1A9NB 4WE1B 4K4VA 1L3UA 1GMWD 2M52A 5MAOA 3Q8VA 2AJQA 2KFZA 5EWGA 3PR4A 4ZP6A 2AWZA 2WRMA 1S9GA 1F9FA 3QT7A 3HSGA 5E3PA 1CQNA 5D4NA 2GCFA 2CJBA 2ZH2A 4O4GA 2OO4A 1F3VA 4HL9A 2ZVSA 4DPXA 1WF2A 3TAPA 4ECWA 1MWQA 2ZJQQ 5KT3A 1RAHB 3H2VE 3I0SA 3GSDA 3UDVA 2B9EA 3M05A 2VG5B 1HBNA 4RX6A 2V2QA 5F8IA 1D9FA 1K47A 3DYAB 5BR8J 2RUSA 3SIPB 3J7A1 1R7IA 1WJ9A 3HHEA 3HP6A 2V6AA 3W62A 4DUZF 2IRXA 1VS3A 5HROB 3NMAA 2BXJA 4G1QB 4FPIA 4WXOA 3BJYA 2DRAA 5F8JA 4OJ1A 2VZ9A 2OPQA 2AYGA 4LRFA 1VK3A 4CNZA 4LF8F 1RT4A 3LAMA 4CLZA 2UUCF 3CMQA 3SCKE 2WOMB 1TVRB 4OX9F 3M6XA 2LA4A 1VQMS 3CC7S 4ED7A 3L95X 4K0KJ 1VBYA 2CDQA 1R0AA 2QYCA 3ETOA 3T3FA 4X4RA 2K8GA 4CTAB 2YWFA 1U02A 1B7YB 1LNQA 3T1YF 4HT7A 3PW4A 4USMA 2EW9A 3LTOA 2VF3A 4B3RF 1YK9A 4NLXA 2E66A 4MIAA 1DTQA 2OLWA 1GQEA 1U8SA 2A6OA 1VQ4S 4LIRA 4E2FB 2YNHA 5D0HA 3GWCA 1Z1ZA 1NZAA 5IT0A 4JI5J 4XAKA 3PW0A 4C4WA 3MWBA 2Z56B 3J7YU 5LSRA 2MQ8A 4DL0C 3E01A 1J5EJ 2WONB 4I2QB 3CDBA 4IRDA 1KR4A 4U6PA 2YH1A 3ISND 4USKA 2UVRA 1ZZFA 2N3LA 5HVFA 3DRYA 1XQIA 3OFHA 3J7ZT 2J8AA 4J90A 3RBDA 1N34F 1KC8T 3M2RB 3TI0A 2ATCB 4A48A 3CB4A 1MNEA 1OSDA 4Y00A 3AD9C 1TAQA 1HNZJ 3BSAA 4KC5A 2F8HA 1GMWA 1Q0NA 2DCUB 3PW2A 4K4XA 4HACA 2AT1B 4KQZA 5MLCV 5LL6d 2DR9A 3R8YA 4KR0B 4DQIA 3HHNB 2L41A 2NUHA 4QZVB 5DO2A 4RU2A 4EK2A 3LP1B 4RL1A 3CJ4A 2OPRB 3LOUA 2V4JB 4ZLLA 1Y00A 2EG1A 3F44A 4AXJA 3FFIA 1BQMA 3MI7X 5KTQA 1QY7A 2DY1A 1MLAA 2C22A 3NAIA 1KLMA 4W92B 1WI6A 4Y34A 5L9XA 4F3MA 1FE4A 1XK8A 5E3AA 1FVSA 4JI8F 1C1CB 1ZAVA 5A0YA 2RU3A 1R6YA 2R9LA 3FCVA 4NXMJ 2HHXA 1TK5A 2WCXA 3DFEA 2GAHC 3LA0A 4B3TJ 3M2UB 3W2VA 5HBMA 3H5YA 4KFBA 1XN9A 4ICLB 2MKJA 3TP2A 3CJ3A 2GMHA 2HGMA 4OI0A 1FFGB 1CJUA 1SPBP 1UEUA 2E1PA 3AJDA 5D0GA 2ZH3A 2MKKA 3CUNA 3H98A 1U0HB 3NNHA 4WYLA 3IO1A 4DG1A 1PGZA 4B3MJ 4DSLA 4NEZA 3CCLS 5KFDA 3GCXP 2IJRA 3AOBA 4OZ0A 1IKYA 2QZ8A 3ZC4A 3IP0A 3IR5B 2QA4G 1MU2B 1GEHA 3QFWA 2E7VA 4IH5A 2MHEA 3NBPB 1H7XA 3UCUP 2EC0A 2XEXA 2HRUA 4EBEA 3A1YG 4R8UB 2HHQA 4N76A 4NYOA 4CO4A 1IKWB 1BGXT 2QSWA 2IC3B 3MFHA 4A8WA 4ZCMA 2C3PA 2OGUA 3GJTB 2G0CA 1U2CA 5HJXA 2WB1D 2DHHA 2XLKA 3QSYB 2NR0A 2M2BA 1RCOB 1W7WA 2K2PA 1T9VA 2Q43A 3EPGA 3JSMA 1ACMB 1UFLA 2HBYB 3MMCB 3O3LA 4FF3A 3OVAA 2R8IA 2CKWA 2PC6A 3G8QA 2FJBB 1Q5YA 1EJ7L 1I51B 2MY7A 1M5KC 1HWJA 2R7WA 2W1BA 2FVCA 2NZ4A 1WC5A 3VR1A 2UXBF 4HVZA 3DLEB 4L6V3 3PJ9A 3T5LA 1FHTA 4CH1A 2JDJA 4R0JA 5LXYA 2LDYA 2QV6A 4DR5J 3GE9A 1QAIA 2WW8A 3LGNA 2NREA 3GFXA 5K20B 3FBEA 1ZAWA 3BKUA 3DHWC 2E1RA 2COLA 1N88A 1U24A 3RBEA 2B8QA 2BW7A 5B0EA 2P6TA 4O44A 1RAAB 2M70A 2PN6A 1RT6B 2I0XA 3GFYA 3HFKA 2WSFC 3WBZA 9RUBA 3P6YC 5ETRA 2RHQB 4ID8A 3M2VA 2MPUA 2HMIB 1KKHA 4ELUA 3K57A 3EVWA 1GK8A 1CC8A 1L3TA 3MM6B 4CH0S 2JVOA 4JB8B 4M5GA 4P7VA 4IQMA 3H42A 1D8ZA 4J9UE 4DFKA 1VQOS 2HQCA 4ELVA 1F5CA 2ZWOA 4NRUA 4JV5F 5GAEU 4EU0A 3GJSB 1W2IA 3R7BB 1M5HA 1AZSA 4N7TA 1TKXA 2PT0A 1CVJA 4HHUA 2J7WA 1U1QA 3C14A 2FJAB 3OPKA 2PI5A 1FD2A 4RW9A 2H1YA 3MEEB 2XQCA 1SV5A 3NMRA 2XGQA 4DDFA 4RW6B 1REGX 4J9MA 3L9ZA 4ZKAA 3ENWA 5ETQA 4USWA 4KGXB 4B3OB 2PMHA 6AT1B 3HULA 4F4YA 3DHXA 1DARA 1S49A 3CCTA 1Q8IA 2HS0A 4ILRA 1MWZA 3PR5B 1X4AA 4ED4A 3KFWX 1NH8A 3EGVA 1REVA 2YXLA 5KT4A 2KRRA 2HQIA 3T1AA 3IS9A 2BW2A 1R8HA 3LAKA 3ZZYA 3MPYA 4PQUB 3HT0A 3W8GA 4Z7YA 4QYZJ 2GMLA 2J9DE 3D7SB 1E6VB 2IJFA 2XMVA 2KXNB 2E5LJ 2XZDB 5THWA 4DSKA 5KOXA 2ZEJA 3FZBA 3TEGA 4ERDA 4JBCA 5KFNA 4HTJA 2FLPA 2DO0A 2VDIA 2QJ3A 4O0NA 1LXNA 1KP6A 4LIWA 3DKDA 5EGYA 1X4EA 1F9HA 4IFVB 1MG7A 3M8ZA 2VQFF 4WBFA 5K8PA 1NZ8A 1P6TA 3J7YI 5HQMA 3LALA 3R6LB 5E41A 3TVYA 3ILLA 2XY5A 3AAWB 3KLGB 4ED8A 2W2MP 1LW0B 4QBUA 4YDXA 3GONA 2BJ3A 5L38A 4AQYF 3M8PA 3HM9A 2GVZA 2MKSA 1VMBA 4DL2A 2ASDA 3ILJA 1U26A 2VKRA 2LCWA 2F4VF 2IMWP 1PILA 2M88A 4PKDB 2XMUA 2POKA 4OHZA 4ITSA 1WHXA 3EXCX 1Y3JA 3M30A 2P2CB 3SFUA 4ATNA 3CC2S 5T7LB 1DTTB 2W9CB 2QA2A 3W66A 2CWXA 3HT3A 1WF0A 4LF9J 2VPZB 2RD5C 5KFTA 4B3SJ 2ZBIA 1N32J 3OL7A 3KYLA 3AA8A 3R3TA 4RW8B 4QWDA 1F0XA 4XDDA 2WHOA 4ZVTB 2HGNA 5A6PA 2QYGA 4ID5B 1HMVB 1JB0C 1T02A 1SJ4P 3W61A 2CVEA 1T7PA 4KV8A 3D0HE 4ZP7A 3MZIA 1IQTA 4QWEA 1QUVA 5C42A 4ZLNA 1U1MA 3MEDB 3OLBA 3P8BB 5LSLA 2FZCB 2MLXA 1LFPA 2QL5B 4EO6A 1FDNA 5RUBA 3L7UA 2NSBA 4M5MA 2F40A 2OTJS 2H5JB 2W9BA 2DD8S 3I56S 1ZTTA 3W5ZA 3QIPB 1RWWB 5J2MA 2DH8A 3EGWB 4RNMA 2NXJA 1TQLA 3TAMA 4LT6A 2BANA 2GHVC 2XTJP 2IAJB 3QWPA 2FC8A 3KUHA 4PR6A 1FWLA 2M8HA 2V4QA 2H65B 2ZE2B 4DF8A 1SJRA 4OHVA 1URNA 2IM2A 3PRBA 1U1PA 4MAKA 4B9UA 4FF1A 2ASJA 3OV7A 1FFWB 4DQSA 1WEZA 4CNYA 1RKIA 5D4OA
chains in the Genus database with same CATH topology
1XMOJ 3T1YJ 4KY3A 3J7AN 5LM7E 2MTLA 2UXBJ 4DR1J 4NXMJ 4DV6J 4B3RJ 4LFBJ 2KL8A 4JI2J 2UU9J 4JI6J 4DR7J 4LF5J 4DV3J 4JI7J 3IMQJ 4DV0J 4B3TJ 1HNXJ 1XNQJ 4V1Ak 1FJGJ 2UXCJ 1IBLJ 1HNZJ 2VQFJ 4GKKJ 4DR6J 3W1YC 4DV2J 5LMNJ 4LF4J 5AJ3J 4DV5J 1HR0J 4X62J 4K0KJ 3J80U 4JI8J 4YHHJ 4LFAJ 2E5LJ 4LF6J 3J81U 3R2CJ 2MEWA 4DR4J 4X66J 2HHHJ 4DUZJ 4DR2J 4JI1J 4AQYJ 4KYZA 3D3BJ 4JI4J 4KHPJ 3D3CJ 4B3MJ 2ZM6J 5IWAJ 4LF9J 1N34J 4NEZA 4B3SJ 4HHUA 4NXNJ 4JI3J 4DR3J 1N32J 4DV7J 4DV1J 4NEYA 4YY3J 3OTOJ 1N36J 4LFCJ 4JYAJ 3JAMU 2F4VJ 4LF8J 4DR5J 2UUAJ 4X65J 2VQEJ 2UUCJ 1N33J 4JI5J 4OX9J 1XMQJ 2UUBJ 4DV4J 4LF7J 3T1HJ 4PWWA 4X64J 5A2QU 1HNWJ 2MQ8A 1IBKJ 5FLXU 5LMUJ 2UXDJ 4JV5J 5IT9U 1IBMJ 1I94J 2KVQE 1J5EJ 4DUYJ 4JI0J 5BR8J 3R2DJ 4GKJJ 1XNRJ 4RJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO J;  3T1Y J;  4KY3 A;  3J7A N;  5LM7 E;  2MTL A;  2UXB J;  4DR1 J;  4NXM J;  4DV6 J;  4B3R J;  4LFB J;  2KL8 A;  4JI2 J;  2UU9 J;  4JI6 J;  4DR7 J;  4LF5 J;  4DV3 J;  4JI7 J;  3IMQ J;  4DV0 J;  4B3T J;  1HNX J;  1XNQ J;  4V1A k;  1FJG J;  2UXC J;  1IBL J;  1HNZ J;  2VQF J;  4GKK J;  4DR6 J;  3W1Y C;  4DV2 J;  5LMN J;  4LF4 J;  5AJ3 J;  4DV5 J;  1HR0 J;  4X62 J;  4K0K J;  3J80 U;  4JI8 J;  4YHH J;  4LFA J;  2E5L J;  4LF6 J;  3J81 U;  3R2C J;  2MEW A;  4DR4 J;  4X66 J;  2HHH J;  4DUZ J;  4DR2 J;  4JI1 J;  4AQY J;  4KYZ A;  3D3B J;  4JI4 J;  4KHP J;  3D3C J;  4B3M J;  2ZM6 J;  5IWA J;  4LF9 J;  1N34 J;  4NEZ A;  4B3S J;  4HHU A;  4NXN J;  4JI3 J;  4DR3 J;  1N32 J;  4DV7 J;  4DV1 J;  4NEY A;  4YY3 J;  3OTO J;  1N36 J;  4LFC J;  4JYA J;  3JAM U;  2F4V J;  4LF8 J;  4DR5 J;  2UUA J;  4X65 J;  2VQE J;  2UUC J;  1N33 J;  4JI5 J;  4OX9 J;  1XMQ J;  2UUB J;  4DV4 J;  4LF7 J;  3T1H J;  4PWW A;  4X64 J;  5A2Q U;  1HNW J;  2MQ8 A;  1IBK J;  5FLX U;  5LMU J;  2UXD J;  4JV5 J;  5IT9 U;  1IBM J;  1I94 J;  2KVQ E;  1J5E J;  4DUY J;  4JI0 J;  5BR8 J;  3R2D J;  4GKJ J;  1XNR J;  4RJV A; 
#chains in the Genus database with same CATH topology
 3BO4 A;  4MYU A;  3DOK B;  3PCO B;  5KFU A;  4DX6 A;  3ZZT A;  4I7F B;  2DH9 A;  1RT7 B;  2R2T A;  4Z2X A;  1X4G A;  1WAC A;  4GRS A;  4YY3 F;  4DV3 J;  5D6G A;  4O3S A;  4WFA Q;  5L46 A;  1QSS A;  2J9C A;  2QL9 B;  1APS A;  1MN9 A;  4L75 A;  4ZVG A;  1FES A;  3ENQ A;  1IBL J;  3LW5 C;  3OBI A;  2DPJ A;  4LF4 J;  2KDO A;  3I5C A;  3KNA A;  4CZC A;  1IBM F;  3FGV A;  2W9A A;  5IM0 B;  4WP8 A;  2MEW A;  2DGW A;  1TFY A;  4XPE A;  4RBT A;  4ZVP B;  1Q1K A;  2ZBQ A;  1U4B A;  3CCE S;  4Y2K A;  1F3F A;  3QO9 B;  2BUN A;  4UZB A;  3ZZR A;  1QAY A;  3DNC A;  4DV0 F;  3HVA A;  2ILZ A;  2FHJ D;  4DR6 F;  3DXB A;  4GVL A;  2DNH A;  3EM1 A;  2NS1 B;  2I9S A;  4JI0 J;  4CWB A;  2HLT A;  4OQJ A;  2C3U A;  4KRW A;  2RQK A;  2C2N A;  1HD1 A;  4I2P A;  1TKZ B;  4E0D A;  3LPY A;  1K44 A;  2VUG A;  1M5O C;  2XYH B;  1XJW B;  1A7G E;  4NXN F;  4JI3 F;  4B9V A;  1IKX A;  3CIZ A;  5K5M A;  3OTO F;  2MST A;  1FEE A;  3O5T B;  4Y2A A;  1NJW A;  1S6P A;  3G9C A;  4ANC A;  1S57 A;  3MUR P;  2RB7 A;  4OX7 A;  1E6Y B;  5FD1 A;  3W64 A;  1CJK A;  1YBT A;  2DRB A;  1S1V B;  3QMQ A;  4QIG A;  2CXE A;  5D0E A;  5GAE I;  1HL6 A;  2JRS A;  3T19 A;  2GHW A;  3K5N A;  4ZCL A;  1UWB B;  2ZM6 J;  5U47 A;  5C2G A;  4OYW A;  3Q2T C;  1CEZ A;  1M5P C;  4LF2 A;  4KPY A;  4DR7 F;  4ZPT R;  3X1L B;  3JTO A;  2HFS A;  2DNQ A;  1CJV A;  1HNI B;  1QE1 B;  3H8Y A;  2X3D A;  2HYI B;  2V67 A;  2C2O B;  3Q8Y A;  2B5J A;  3R7N B;  2UXD J;  1X0P A;  2HBR B;  3VGU A;  2GS8 A;  3NNC A;  2C3Y A;  3R2D J;  2DGT A;  5E3C A;  2PD1 A;  1DAX A;  2HND A;  3UN5 A;  2RKI A;  2KT2 A;  1N0U A;  4CO1 A;  1RU2 A;  3SQG A;  1VOM A;  3RU0 A;  4DUT A;  1HNX J;  4WKY A;  2UUA F;  3MGJ A;  5DDQ C;  3WIV A;  1HI0 P;  3NXZ A;  3FJ2 A;  4RR5 A;  4ES3 A;  5HAT A;  3GV7 B;  4KKO B;  1YJV A;  3MEC A;  3QLH B;  2QLJ B;  3J81 j;  3CUL A;  3EGN A;  2YKN A;  3NCQ A;  2X7I A;  3ITH A;  2R7U A;  2VHG A;  3R5C A;  4U9R A;  2FHJ A;  4RW4 B;  1DZ5 A;  4IG3 A;  3UNY A;  2XMM A;  4PCQ A;  2IBK A;  1AW0 A;  3D1Q A;  1L5U A;  4Q45 A;  3BB5 A;  1T9U A;  4OYM A;  1G7C B;  4FXD A;  2A3J A;  3WQP A;  2IBO A;  2YKO A;  4Q0B A;  3GQC A;  4ECT A;  3VAI A;  2QL7 B;  4NLU A;  3MR7 A;  2BYC A;  4PWW A;  4X64 J;  4MKV A;  3PO5 A;  5EWF A;  3OUY B;  1X4C A;  4YB1 P;  1KHV A;  3NNA A;  1X60 A;  2YPY A;  2I6W A;  1EIY B;  5KFB A;  1NJI T;  2FDN A;  1X31 C;  4M63 A;  4HKQ A;  2J76 E;  2R3V A;  1WTB A;  4MKA A;  2NUU G;  1S0N A;  4IOC Q;  5E3R A;  4HR2 A;  3TWZ A;  3M9O B;  3DLG B;  4MFB A;  3R5B A;  3AJ2 A;  2YBV A;  3M32 A;  2CQC A;  2ADB A;  3F73 A;  4Q8E A;  1YJR A;  2L9N A;  3PHE A;  3BGR B;  1VC0 A;  1JJ4 A;  2JX2 A;  5LMU F;  2HPU A;  1DRZ A;  1BY9 A;  1PYT A;  5IZH A;  2XCP A;  3NS7 B;  3GU0 A;  3M8R A;  5F9L A;  4OJH A;  3ETM A;  1JLC A;  7AT1 B;  1TV6 A;  5G0R B;  3RBX A;  3FUY A;  2BJ1 A;  2CQ3 A;  1FT8 A;  1JLB A;  2CNK B;  1W25 A;  4C8L A;  5J2N A;  4I64 A;  3K59 A;  1FKP B;  3U1L A;  2XMT A;  2IY5 B;  2XS7 A;  4WXW A;  3KLE B;  4GO7 X;  2YKA A;  3JTN A;  1AFI A;  2B9W A;  2FHO B;  2GVD A;  2YQ3 A;  4NML A;  3FBB A;  4CO0 A;  3NGK A;  4FS1 A;  4UST A;  3L7P A;  3N4W A;  2GX8 A;  1OYD A;  2GGP A;  4IUF A;  2LP4 A;  4QJV A;  4QYZ K;  4R5P A;  2UXC J;  1QVG R;  5D0R A;  3MAA A;  2C2E A;  2ROE A;  2EI5 A;  4WII A;  3BPD A;  4RBV A;  3MTK A;  4KAI A;  2FIU A;  3NEK A;  4J9N A;  1B70 B;  2D74 B;  1DLO A;  3I5B A;  3AXK A;  4P2S A;  1X7V A;  1NB2 A;  3VQS A;  5A8W A;  1RAF B;  2BJ7 A;  3TZY A;  4EYH B;  3GMG A;  2F65 A;  1P9Q C;  3UVJ A;  3K7R A;  2H48 B;  5JVG Q;  1RZM A;  1TR0 A;  4URG A;  2BX6 A;  4JI2 F;  3PW7 A;  1Q53 A;  2AZ1 A;  2EWH A;  2KZM A;  2DKO B;  1U0S A;  2G2Y A;  4FYY B;  3GCW P;  2GNK A;  4C3K A;  3DGP A;  1SH2 A;  3VVU A;  1XC9 A;  3RB0 A;  3HXM A;  3WC2 A;  1ZET A;  4WIQ A;  1GTH A;  2DGQ A;  4A8S A;  1TUG B;  3UN3 A;  3BEG B;  1KQS R;  4KHP F;  2ZH7 A;  1TL3 A;  3MOJ B;  2CPZ A;  4YR2 A;  3DRP B;  3ADA C;  1VCT A;  3BBB A;  1W26 A;  4K5S A;  4UOH A;  4NA1 A;  5HAO A;  3V81 B;  4CO5 A;  3GIJ A;  1P27 B;  3MMB A;  2RRB A;  2ASL A;  2XZW A;  2LXU A;  3NLC A;  2Y1R I;  2P9E A;  4RNH A;  2WBM A;  4F26 A;  5BR8 F;  1RU1 A;  4OV1 A;  2IRU A;  1AA1 B;  3EE3 A;  3QJP A;  5F9N A;  4IH6 A;  2OPQ B;  4MKY A;  2HKE A;  3C15 A;  3SCI E;  4MMO A;  1S6Q B;  1WWH A;  4W98 A;  3P49 B;  4B08 A;  1UZD A;  4IR9 A;  2CG8 A;  1L3K A;  4C8Y A;  3DOL A;  3J7A N;  1T05 A;  2IMO A;  4TY8 A;  4LSN A;  4UTG A;  1QTM A;  4TU8 A;  2CQB A;  2HAI A;  4M5D B;  3DGV A;  2HQG A;  2HFV A;  2D3O 1;  2YNH B;  2BOA A;  3OL8 A;  1U47 A;  3DI6 B;  5AT1 B;  1FXL A;  4CQ1 A;  2DT9 A;  2A6M A;  3BF4 A;  4JI5 F;  2R7O A;  2KHC A;  2WK4 A;  6FDR A;  2B4U A;  1I3O B;  2JZ5 A;  1F1B B;  1Q16 B;  2CRL A;  4ZJO A;  4BC7 A;  2H5E A;  3TR5 A;  2UUW A;  1Y11 A;  5CH7 B;  1J5E F;  1UVK A;  2HFO A;  5J1E A;  4CCH A;  1XIQ A;  4B9S A;  1OQ6 A;  4KE5 A;  3GJQ B;  4D3H A;  5GMD A;  4DV7 J;  2VB6 A;  2XMW A;  4C11 A;  3HKZ D;  5KG7 A;  3SZ2 A;  1JIH A;  2R8K A;  4FYW B;  4K7Q A;  3PFO A;  4UOF A;  3D6F B;  1MMD A;  4F04 B;  1HNZ F;  1LXJ A;  1NK9 A;  5G4D A;  4DSF A;  1WHW A;  1EP4 B;  2UV8 A;  4RLE A;  3EVO A;  1XMO J;  4TN2 A;  4Q2L A;  1TKT A;  2LA6 A;  4NLY A;  3V6D B;  1HNV B;  4NA3 A;  2OUG A;  4IO9 Q;  1RWM B;  3PKY A;  3FFI B;  4J5O A;  5KG1 A;  2A0F B;  4U95 A;  1SJF A;  1KLM B;  5HO4 A;  3CNQ P;  1UPM B;  3UD3 P;  4C7Q A;  2IDE A;  1RTD A;  3KLV A;  4N47 A;  2ZH8 A;  1NHU A;  1TEL A;  4XPC A;  2ZH9 A;  3KNG A;  3GYX B;  2AF6 A;  1HYS B;  4NXM F;  3OT9 A;  4IRK A;  3W2V B;  4PYA A;  2KFY A;  3GLJ A;  4ZPB A;  4C8Z A;  3ZZU A;  3C19 A;  4B3T F;  4C8N A;  4ZVR B;  3KLF B;  1FK9 B;  4Y3C A;  3B4D A;  3CT9 A;  3I4P A;  3HSD A;  3H7H B;  1CJU B;  1PYO B;  4RZR A;  2YKM A;  3CCQ S;  2OPP B;  3IC1 A;  4F2S A;  2YNG B;  2R2U A;  2FQQ B;  4DWI A;  1NSP A;  1R0C B;  1T95 A;  2KVQ E;  3V5R A;  2ILY A;  3FRZ A;  3N6L A;  3EXY A;  2AJ4 A;  2HNY A;  3EMT A;  2J0W A;  1FD8 A;  4IFY A;  4J9Q A;  3R1H A;  3OR2 A;  3TX0 A;  1SKS A;  4B3M F;  1C4A A;  2MQN A;  2E9T A;  2CQ4 A;  3BR9 A;  3UDE A;  2EVZ A;  1IKY B;  3W2W B;  3KHR A;  4QIF A;  1BWE A;  2RQC A;  1J2V A;  2DGS A;  2EBG A;  2CQD A;  2XG8 A;  1LV5 A;  2VJU A;  3TJA A;  3KHG A;  4DPU A;  1YZ7 A;  3SXL A;  2DEJ A;  4C8O A;  2Y0S D;  4X4V A;  2BOP A;  2JL9 A;  2HVZ A;  2RNE A;  2HK2 A;  3WIU A;  3JQM A;  5IV3 A;  4N5S A;  1RHK B;  1NK0 A;  2BVZ A;  4UY8 5;  4C3M A;  1BHN A;  3K0J A;  5I42 A;  4FN5 A;  3R5A A;  3DRS A;  2J0Q D;  3JSM B;  2YNI B;  4TNO A;  1NUE A;  1XMQ J;  2BKP A;  3KXD A;  2KRB A;  3MR2 A;  2DHA A;  3H90 A;  2A1B A;  1CLF A;  1NEE A;  1S1W A;  3W5X A;  3VV2 B;  2MJU A;  2YKP A;  2UUT A;  2VBX A;  3UWT A;  2CAD A;  2E9Z A;  2OFG X;  5LXR A;  1G3O A;  1H0H B;  4ZP9 A;  1TFW A;  1EET B;  4FF2 A;  1FRH A;  3OVB A;  1NKB A;  4DR5 F;  3GIK A;  4DJB A;  3AOC A;  3OLA A;  3RW6 A;  2XYP B;  2YWE A;  3FVY A;  4OZN A;  1WD6 A;  1NPK A;  5DS7 A;  4TU7 A;  1RE1 B;  2E44 A;  5HP1 A;  3DC2 A;  1UEK A;  2JLE A;  1BC6 A;  2YVS A;  3S8S A;  4NI2 A;  3W9H A;  3QT5 A;  1VRT B;  1R27 B;  4MIW A;  5CZX A;  3EPI A;  5F8N A;  2B9Y A;  2F7V A;  3I31 A;  4UUX A;  2FUG 9;  4I67 A;  4ED5 A;  4CLK A;  4U7C A;  2W4D A;  1RLC L;  3QGP A;  4P2M A;  2VG6 B;  2BBE A;  3MMA A;  3L09 A;  3SYZ A;  5HMZ A;  3BV8 A;  2OJ3 A;  2XS5 A;  2JSX A;  3AOA A;  5KFO A;  1K8A T;  1IJF B;  2HQ3 A;  5HSP A;  2YWK A;  4OX6 A;  2VIC A;  1IXK A;  3C6T A;  2ZUA A;  2BAB A;  1KDN A;  2HVH A;  1URR A;  2ZJR Q;  4QU6 A;  2J0S D;  4NL5 A;  1KLN A;  3NS6 A;  1TP7 A;  3R5D A;  4FYD A;  1U6B A;  1VI7 A;  3PVX A;  2Y1L B;  1X9M A;  1TTH B;  3G6Y A;  3IM8 A;  1K1Q A;  2IYG A;  4ZJQ A;  4IG0 A;  5D3G B;  2RAQ A;  4NZ7 A;  4RW7 A;  1FDD A;  1JMT A;  2AYM A;  2LQB A;  2DYA A;  2JJ4 D;  3QJJ A;  1IUJ A;  4WP9 A;  3DDN A;  3PNI A;  1OY9 A;  1PC5 A;  5B0F A;  3D67 A;  1GFW B;  1HQ2 A;  2GA7 A;  3RRH A;  5KT5 A;  3QT6 A;  4HYK A;  5CCM A;  2ABY A;  4FYX B;  3HVW A;  4F50 A;  5KFQ A;  1IBC B;  2ZBR A;  4UOG A;  3N0V A;  5F8G A;  2JC1 A;  4KH1 B;  5AE2 A;  1RHU B;  4DOZ A;  8RUC A;  2KH9 A;  2MSS A;  1HNW J;  2GMJ A;  3BH7 B;  3LGM A;  5EHH A;  5AXK A;  4L73 A;  2RS2 A;  2E5L F;  1C1B B;  1LK7 A;  3FMW A;  4DFM A;  1N5Y B;  3TAN A;  1UAW A;  3PXG a;  1FNM A;  3OTE A;  2LQ8 A;  2CPH A;  2F4F A;  3M8Q A;  2DVI A;  2XSJ A;  3OXG A;  4JI7 J;  2ZZN A;  1S0M A;  4J37 A;  2IM0 A;  4WPA A;  3A3N B;  2ZD1 B;  4QIV A;  4N8O A;  1YX2 A;  4DSJ A;  3ZNU A;  3VAJ A;  1PYS B;  4PG8 A;  1OO0 B;  4AL6 A;  2RJZ A;  4DCJ B;  1Q4R A;  4DL5 A;  4IOB A;  5HL7 Q;  3J81 U;  5I3U B;  1KFS A;  1CPZ A;  1TMM A;  4DR2 J;  2OHD A;  1HLW A;  1V3S A;  1CUL B;  4MH8 A;  1S76 D;  1HKA A;  4DU8 A;  4ZPA A;  2XNR A;  1UW4 A;  2F3J A;  3CE8 A;  5A8R B;  2RF2 A;  4ZA1 A;  2LLZ A;  3BR8 A;  5IQQ A;  2V8G A;  3PX6 A;  2J7U A;  3MM7 B;  4S0M A;  3OQ2 A;  2GV1 A;  3HJV A;  4OHW A;  1XNR J;  1KTQ A;  4Q43 A;  3IGN A;  2KYZ A;  3HSJ A;  3UPF A;  4QU7 A;  3DLL Q;  1WEL A;  1C0T B;  4LF9 F;  4B3S F;  1N32 F;  2NYI A;  4ED1 A;  1S9E B;  3IMQ J;  2MGZ A;  3G96 A;  4K59 A;  3KLH B;  3QRP A;  1U25 A;  1KON A;  4IYQ A;  4J7C A;  3NGS A;  4I1T A;  1N0V C;  2HHW A;  4M1K A;  4PG7 A;  1TL5 A;  1EHW A;  3OSN A;  4R0E A;  3R2C J;  3KK3 A;  3FEY B;  3MR3 A;  4MTP A;  3T5H A;  3VAF A;  2HHP A;  1F9E B;  3F56 A;  1NPP A;  2VA2 A;  4JYA J;  4DQQ A;  3KJV B;  2CQ1 A;  2UP1 A;  1IWA A;  4FKX A;  3PX0 A;  1LFW A;  4FKY A;  2DNY A;  4DV4 J;  2V4R A;  2UVW A;  3FCW A;  1JKH B;  3UCG A;  1FDB A;  2JEF A;  3P96 A;  3UR3 C;  4WFX A;  4PAA A;  2J6S A;  2PA8 D;  2LU1 A;  4HH1 A;  3DM2 B;  4LFB J;  2B8P A;  1QD1 A;  3SSQ A;  3PKM A;  4Y0F A;  1RT3 B;  4LF5 J;  2HWT A;  3IAS 9;  4RWX A;  2V68 A;  3IBF B;  4Y28 C;  3FQK A;  4F0M A;  4DX7 A;  4U7U K;  2ZKT A;  3CO0 P;  1NK7 A;  1VQ5 S;  1JNZ B;  4WYW A;  2CNN B;  3C6U A;  4OV6 A;  2QFI A;  1ROF A;  3A8E A;  3LPE A;  2HFU A;  2VPY B;  5DG9 A;  5HLF A;  2OPS A;  4USJ C;  4OI2 A;  1UWA A;  5DDR C;  2E1C A;  3Q0A A;  1S99 A;  4DV3 F;  1JNR B;  1XR6 A;  1WNE A;  1IBL F;  3RJM B;  5J2P B;  3GIR A;  1FRX A;  3GJR B;  3IWN C;  4ZVQ B;  3NL0 A;  4LF4 F;  2KZZ A;  1HAR A;  4ECR A;  2ZVI A;  2B43 A;  1SI9 A;  4I56 A;  3J81 Y;  4RJV A;  3CJK A;  1F2H A;  2DCL A;  2XI3 A;  2D41 A;  2DR6 A;  3M1V B;  3TNV A;  2BMB A;  4RUC A;  1R8C A;  3FNN A;  3BYR A;  5CHC B;  2F8E X;  3M8W A;  1PJ6 A;  2FJX A;  1JLG A;  2WVF A;  3SQO P;  4H4M B;  1KOH A;  2VOO A;  3MEG B;  3E8O A;  4M5H A;  3KHL A;  4B02 A;  2AV5 A;  2DXE A;  4Z37 A;  2J0X A;  1HD0 A;  2YX4 A;  2AZ3 A;  4X62 J;  4M94 A;  2DY9 A;  4YHH J;  4JI0 F;  2LKZ A;  2CJK A;  1RA6 A;  3T9N A;  3CD7 A;  4L74 A;  2YNF B;  3DOM B;  2MXY A;  4P75 A;  3I5A A;  2OEL A;  2O1P A;  2AGP A;  2Y3Y A;  2WBR A;  3KK1 B;  1HBU A;  1TL7 A;  1UVN A;  4ZVS B;  4CYU A;  4MK7 A;  4TYA A;  1CJK B;  1V5V A;  2CPF A;  2QSF A;  4FYV B;  1G2E A;  4IQX A;  1KEK A;  2OEK A;  2QX0 A;  1NSK L;  5HMY A;  4ZJL A;  2DIS A;  3KUE A;  3IBW A;  2G2O A;  1NDL A;  1U6Z A;  2FTR A;  1RBL A;  3CIM A;  2BM0 A;  3D2W A;  1U2F A;  3MUT P;  4OYI A;  1OSC A;  2EFQ A;  1RDR A;  5C7P A;  1NB7 A;  2HUR A;  2N82 B;  3K17 A;  1YZ6 A;  1HR0 J;  2UXD F;  2ZOM A;  2ASY A;  2J8S A;  2QLF B;  3H0P A;  1EAR A;  2HS4 A;  2WVC A;  5LOQ A;  4MKB A;  2OTL S;  4C48 A;  4L3K A;  1UCN A;  5JJB A;  3D1O A;  2YX7 A;  2FHM A;  3HF5 A;  5A8K A;  3IRX B;  1SC4 B;  1RBA A;  1RTZ A;  2VG5 A;  2HVI A;  3MFI A;  2E5H A;  1HNX F;  1RUS A;  1SUQ B;  3CWJ A;  2PSZ A;  1FJC A;  5HRO A;  2YKN B;  1VQL S;  4G1Q A;  4OLP A;  3ITH B;  4OYO A;  5ADZ A;  3V4M A;  3M9N B;  4ED6 A;  2Z0G A;  4IG3 B;  3HCX A;  3H2L A;  2VC0 A;  4UF4 A;  3GV5 B;  4RU9 A;  2CNL B;  1TVR A;  4Q0B B;  2DIV A;  1S97 A;  1GXT A;  2BEF A;  4YUD A;  4OX8 A;  1TKD A;  3D5M A;  2LYV A;  2GZO A;  2EEY A;  2X1F A;  3CGI A;  2YY3 A;  2ZH4 A;  4K2J A;  2LQJ A;  4ZCI A;  4X64 F;  5AJ3 J;  1VQP S;  4RWW A;  4MJK A;  1HHT P;  5H9E J;  3GP9 A;  1YRT A;  2VG7 B;  1HQU B;  2FYX A;  5KFC A;  1EKR A;  3G6E S;  3L4B C;  4WTO B;  1FRL A;  1S1U B;  3PAC A;  2ZIT A;  2VV5 A;  3M32 B;  1LOU A;  1VQY A;  3RTV A;  1FF2 A;  2KT3 A;  2NCK L;  2Q79 A;  2XMJ A;  1P1L A;  2HIY A;  1F5B A;  2SXL A;  4DN0 A;  1D9A A;  2B56 A;  3BO2 A;  2R7Q A;  3CCM S;  1WG1 A;  3GG0 A;  3M2R A;  2IM1 A;  3M8Y A;  1LW2 B;  2BE2 B;  4OZ1 A;  3O8W A;  2V9K A;  1MSW D;  2W4C A;  1JLB B;  4LVO P;  2RDD A;  1RHJ B;  4EGL A;  2NYH A;  1AFJ A;  1RTJ B;  1OQ3 A;  4F4W A;  3TOQ A;  2VA3 A;  1FWP A;  2CQ0 A;  4DV5 J;  2OAU A;  1NK6 A;  1YDL A;  4DS5 A;  1FNO A;  1N52 B;  1U1L A;  4G65 A;  1ICE B;  2OPR A;  3RBZ A;  4PAB A;  1H2V Z;  2V4J A;  2MZJ A;  1CBK A;  4R5P B;  2BRL A;  2GQQ A;  3MM9 A;  2K7K A;  2CQG A;  2UXC F;  4YS2 A;  1RXO B;  3VZH A;  1C1C A;  3MUV P;  1RT5 B;  5EUH A;  4CLU A;  2AIR B;  2LDI A;  3DRR B;  5A8W B;  1RWK B;  1V9O A;  1Q86 T;  3P3D A;  5JMN A;  3UVJ B;  1YGY A;  1QUP A;  3LF0 A;  2YH0 A;  3L3C A;  3IXQ A;  3M2U A;  4NWB A;  2UVU A;  4E98 A;  3KKF A;  1UVM A;  2DNL A;  4MYT A;  3CDA A;  4ICL A;  4PUO A;  3EDR B;  1FA0 A;  1ZBT A;  2PFF B;  4GVB B;  3BQ1 A;  4BCA A;  2PFD A;  5HN0 A;  3R5J B;  1C4C A;  2MKH A;  4USU A;  1U0H A;  1NO8 A;  3LH2 S;  4DLE A;  4I68 A;  3VQT A;  3K5O A;  3E2E A;  2D3U A;  1GAO A;  4NCG B;  2IYI A;  2OD4 A;  4L72 B;  5DGA A;  1MU2 A;  1P9Y A;  2MQO A;  2XMA A;  4F02 A;  1M90 T;  3LWL A;  3TAQ A;  3NBP A;  4X65 J;  4KHR A;  1RGV A;  3LP2 B;  4R8U A;  3TX8 A;  2K3I A;  3KDN A;  4C0H A;  3W65 A;  3PY8 A;  1RYR A;  2HW3 A;  1GXU A;  3ET6 A;  1WC6 A;  1IKW A;  2MKC A;  1YG0 A;  2IC3 A;  5SUH A;  2XWY A;  2RE1 A;  3SV4 A;  1WKL A;  1JWW A;  3Q23 A;  1HA1 A;  1KNZ A;  1Q7Y T;  2OML A;  3C15 B;  1R8P A;  5CYJ A;  3AD7 C;  3MM5 A;  2I1R A;  1GMU A;  3W63 A;  4ECZ A;  2XWX A;  1TUV A;  1N5S A;  1I1G A;  1ZH5 A;  5EX0 A;  3ZZZ A;  1UMJ A;  4BWJ A;  2VKZ G;  1VLO A;  2VD3 A;  4NLS A;  3DLE A;  1IKV B;  4ECQ A;  3KLI B;  2R2R A;  1BLU A;  3CJ2 A;  4LF6 J;  5IS2 A;  1S4F A;  2VBZ A;  4JI1 J;  4UZC A;  4NOH A;  3O44 A;  2JOQ A;  3OXL A;  2FLO A;  4J91 A;  4CT9 A;  5KFM A;  1V3Z A;  5B09 A;  1OY6 A;  1MRO A;  1N8R T;  4WFB Q;  4ES2 A;  1IR2 A;  1GNK A;  1ZM3 A;  5E2Q A;  1RT6 A;  1T3O A;  5DET A;  5DQI A;  4N41 A;  4ZHR B;  1G1X A;  2D3O R;  3CJR A;  4O3P A;  4H54 A;  3H5U A;  1SKR A;  3MM6 A;  3TRG A;  4ER8 A;  2V2V A;  5GMK a;  3BGF A;  3CTR A;  1TMJ A;  5F41 A;  4PZV A;  4DV7 F;  1Q79 A;  2VFU A;  1YIT S;  2VPW B;  2J9E A;  3IAM 9;  4RUB A;  4V1A k;  2YWH A;  1U1O A;  4UW2 A;  3OR1 B;  4QR2 A;  2ALY B;  5DLF A;  2ZHO A;  3QRR A;  3SEO A;  2DTJ A;  1UJ5 A;  1OS5 A;  1XMO F;  1VIO A;  2RQ4 A;  3H4B A;  5DZ7 A;  3D3B J;  2ZKU A;  1YJW S;  3MEE A;  3FEZ A;  1Q82 T;  2V50 A;  4RW6 A;  5I3Q A;  4K2X A;  3KG1 A;  4WWS A;  4E8U A;  3QZ8 A;  3OJS A;  4B3O A;  1FFS B;  4X4N A;  4P71 A;  3D0G E;  3IG1 B;  1LWX A;  4Z7C A;  2DIT A;  2EFV A;  4J9R A;  1OPZ A;  3M6U A;  3HX9 A;  3F0N A;  2CZ9 A;  2YQ1 A;  4DR1 J;  4K50 A;  2JHE A;  3MD3 A;  2DBB A;  1FKO B;  1RAG B;  2VIH A;  2R7S A;  2EK6 A;  3R6G B;  4LR7 A;  4EZ6 A;  4PQU A;  3MPD A;  2D69 A;  2O01 C;  1T9W A;  2YKM B;  4IH7 A;  5FDL B;  2B6A B;  2AW0 A;  1E6V A;  4CP5 A;  3OFG A;  2M8D B;  5LMN J;  3KWM A;  1Z2L A;  3LAN A;  2PEB A;  2HNY B;  3RB3 A;  4LSZ B;  1QAJ A;  2P5V A;  2YWW A;  3BDP A;  1B0V A;  4LVN P;  1MML A;  1NDC A;  2RRA A;  2VOP A;  2DJW A;  5B08 A;  4IFV A;  1NSQ A;  4M5I A;  2QLB B;  2EK1 A;  2PEH A;  1GMV A;  1NME B;  4PWU A;  5C5J A;  3THT A;  1DBD A;  2VFV A;  4LBH A;  5ETN A;  5KFS A;  4FPR A;  3VAG A;  3MPU B;  5KFV A;  5KT7 A;  2Z8Q A;  1VHF A;  3G6V A;  1CS4 B;  1VIS A;  1VRU B;  3ZXW A;  3GV8 B;  2GJ2 A;  2ZH1 A;  4DX5 A;  2QGF B;  2NXC A;  4Q44 A;  2K7J A;  3OXF A;  3I55 S;  3RB4 A;  2JEJ A;  1S12 A;  1ARO P;  5BXI A;  1OMS A;  3Q86 A;  1WOP A;  1NJZ A;  2OIH A;  2CQP A;  2L9W A;  3KG4 A;  4WKR A;  3FSX A;  2WVB A;  3W7B A;  1XMQ F;  1JLF B;  2I5J A;  1DTT A;  2W9C A;  2BM1 A;  2HZV A;  2R8J A;  3TZX A;  3CDW A;  1VIX A;  4AND A;  4DR4 J;  4RW8 A;  4ETZ A;  3HJF A;  2J6U A;  1U1N A;  3NCR A;  2MQM A;  1U2R A;  3LP0 B;  3HKW A;  3IA0 A;  2KT5 A;  1RA7 A;  4ID5 A;  1HMV A;  4ECV A;  3NP5 A;  2NZC A;  3NOG A;  3KDO A;  2FVQ A;  1UA1 A;  4KO0 B;  5B0G A;  1RT2 B;  1LWF B;  1ZA1 B;  4I6A A;  1R3N A;  3C46 A;  3KUG A;  1PKU A;  1U8W A;  4AL7 A;  1OJ4 A;  1D8Y A;  1R43 A;  2D3Z A;  1O6X A;  1YI2 S;  3TA1 A;  4IKA A;  4DU7 A;  5J1N A;  2P8I A;  2GAG C;  4WFY A;  3AHP A;  2HFN A;  3B8H A;  1LWE B;  2X1B A;  4QPX A;  3OJU A;  5K9F A;  1H2U X;  4CM0 A;  2CZ4 A;  4NZ0 A;  5H9E K;  2HIQ A;  4G6V B;  5BYQ A;  1S1X B;  2LU2 A;  1M1G A;  4KTQ A;  3EDQ B;  5AE1 A;  1IM6 A;  4KB7 A;  1SIZ A;  3PFE A;  2IAJ A;  1YJN S;  3K8V A;  4X66 J;  5GME A;  4NYZ A;  1YJT A;  5F0U A;  1Y9O A;  4KPC A;  2Z2Y B;  2ZE2 A;  1F6T A;  2KG1 A;  4LFC J;  3CCJ S;  1FTC A;  4IG0 B;  2Z30 B;  3TZZ A;  3GR1 A;  4ZLJ A;  2W2Q P;  1QSY A;  4FP9 A;  3AY0 A;  3H2U B;  2XCA A;  4YN3 B;  2C2M B;  2MYF A;  3E51 A;  2PA3 A;  3MCM A;  3UE2 A;  3DOK A;  3TEH B;  4DHV A;  5ITH A;  3X3U A;  3ZTO A;  2OD6 A;  2QMU B;  4I7F A;  2O5D A;  1RT7 A;  3V4I B;  2U2F A;  3R27 A;  1NHK L;  4HHH A;  2I38 A;  2ERR A;  2ZWP A;  4DV6 J;  2XO7 A;  2ADC A;  5ETM A;  3W5Y A;  2ZUG A;  1V3R A;  1HW9 A;  3CCZ A;  3PX4 A;  4ZLP A;  4NMX A;  2LQ5 A;  2RUG A;  3PW5 A;  3ONQ A;  2MZT A;  2UZA A;  2DNP A;  5IM0 A;  1FTR A;  3U1N A;  1S6O A;  4GO5 X;  3A13 A;  3TZW A;  2ROG A;  1HNW F;  2JLG A;  4A8K A;  1PBA A;  3AQP A;  4LFA J;  4TXS A;  3PYF A;  3QO9 A;  3N6M A;  3HFZ B;  4QPT A;  3WHI A;  5CCL A;  4FVM A;  4OZJ A;  5B7W A;  3MEK A;  1S77 D;  3M8Q B;  5KG5 A;  1K1S A;  2J5A A;  1NM2 A;  1S0V A;  2QTW A;  5E0O A;  4JI7 F;  4DX8 H;  1YWX A;  3CCV S;  5B0B A;  4A8M P;  1FDA A;  1SC6 A;  4RO0 A;  1NPR A;  2VON A;  2A2C A;  1S1T B;  1TKZ A;  2CPI A;  4ECY A;  3T6J A;  1RT1 B;  1UL3 A;  1KQK A;  3CO9 A;  1IQZ A;  2R7V A;  4DR2 F;  1N54 B;  4F3O A;  2XM3 A;  2HHV A;  2JEG A;  2G4B A;  1E6Y A;  1H7W A;  2D1C A;  4F3Q A;  4K4T A;  4ZMM A;  7FDR A;  4C6A A;  4NLR A;  1QAX A;  1S1V A;  4NYP A;  3KK2 B;  5KFE A;  1RWN B;  4B9T A;  1KSP A;  1AUD A;  1SKU B;  5KFZ A;  4DL7 A;  1UWB A;  2CIM A;  2MY8 A;  2C3O A;  2KHD A;  2QC3 A;  4HEA 9;  2IFX A;  2HHS A;  1XNR F;  4BBY A;  3M8S A;  3TUI C;  1QTN B;  2GFF A;  4RUH A;  2R7R A;  1QE1 A;  4NEY A;  5KFL A;  1H2T Z;  5HMX A;  1LEO A;  4U8Y A;  5CA5 A;  2O3D A;  1HQE B;  1R31 A;  4K4Y A;  2U1A A;  3KHH A;  4U96 A;  5IQ6 A;  3QAU A;  5F8H A;  1VQ6 S;  5BJR A;  4WTY A;  2APO A;  1S10 A;  4DPY A;  2XBP A;  1QM9 A;  3KK3 B;  2DGO A;  2CAJ A;  1VDH A;  4NE9 C;  1SL1 A;  3K5L A;  4YFU A;  1UVI A;  1VFJ A;  3PM9 A;  5ETV A;  4JI6 J;  3EIC A;  4CO2 A;  4ES1 A;  3PHT A;  2BQ3 A;  4KSE B;  4JYA F;  5ETP A;  4AYB D;  2MQP A;  2AQ4 A;  2B4P A;  4J9S A;  3D0I E;  3QLH A;  4QW8 A;  1U1K A;  3FZ2 A;  3EZO A;  4DV4 F;  2B51 A;  4RW4 A;  1WOS A;  2FGC A;  4AD6 A;  3OHA A;  2N3O A;  2G1D A;  2BJE A;  5K14 B;  2HK3 A;  5C24 A;  3IR7 B;  2QE5 A;  3CJQ A;  4DPT A;  4LFB F;  2ZNY A;  1LQ9 A;  1X4B A;  1N36 J;  3JSY A;  4PEO A;  1FWK A;  3BSC A;  4LF5 F;  5KFY A;  3G82 B;  3OUY A;  2ZZT A;  2VQE J;  2RDJ A;  3ELH A;  1RTI A;  2F1F A;  1AXQ A;  2J6T A;  3N79 A;  1Y5I B;  1VJQ A;  4ZIW A;  2OMO A;  1DFD A;  4X4P A;  3AOD A;  4CM2 A;  4PXC A;  1YQH A;  5HLF B;  2Y8W A;  3B6B A;  2EFN A;  1R8B A;  2M0G B;  4CRJ A;  3BGR A;  1WC4 A;  3UQS A;  4F4X A;  5DQH A;  5EX3 A;  2E7X A;  2LMI A;  3HFV A;  4XO0 A;  2XO6 A;  2B9X A;  3JQK A;  2B3T B;  4LSL B;  1VQ7 S;  2L48 A;  4GKK J;  2Y1I A;  2AYB A;  2MB0 B;  4CLW A;  4FS2 A;  2RH3 A;  1YVF A;  2FVP A;  2UV8 G;  5G0R A;  3DN9 A;  2YPZ A;  3LGH A;  5DJB A;  1C0U B;  2MQQ A;  5DQG A;  4EZ9 A;  2WTF A;  2PI4 A;  1SC1 B;  3T9Z A;  5GVQ A;  1Y10 A;  1JJ2 R;  3QNW B;  4FVC A;  1UVL A;  1EQ0 A;  1XTZ A;  2BJ9 A;  1JLG B;  1X9W A;  1FKP A;  3TQE A;  2XC9 A;  5J2Q A;  3KLE A;  4EYI B;  3C16 B;  2V8P A;  2KKH A;  3B82 A;  4X4S A;  1W2B R;  1KRP A;  4MT1 A;  1X4H A;  4X62 F;  4CI0 B;  4YHH F;  4PPZ A;  4PQA A;  2DNK A;  2JWN A;  3U1M A;  4X84 A;  2KM8 B;  3TVZ A;  4HDH A;  1FI4 A;  3MTJ A;  3SBM A;  2QEX S;  5C25 A;  2NPF A;  3G86 A;  4C8K A;  5CAA A;  1TL7 B;  1FKA F;  1FVQ A;  3DLH A;  1SBR A;  3MM8 B;  1XEZ A;  2HVE A;  2OP5 A;  2BE7 D;  4NCA A;  5L9N A;  3TQ1 A;  2Z58 B;  5LJ5 Y;  3B78 A;  3J80 U;  3BS9 A;  1QSL A;  3LWM A;  2I8E A;  4N77 A;  4M5N A;  3PZP A;  1J5O B;  3I6P A;  1I6J A;  3W9I A;  1PCA A;  3QQC D;  2E5I A;  2JFK A;  3BZQ A;  1SKW A;  1RKJ A;  1F5A A;  1FX4 A;  3QGG A;  5T14 A;  3CED A;  5ETS A;  1ZM2 A;  4WFZ A;  1UP1 A;  1HR0 F;  1O51 A;  5LSO A;  1YLX A;  2XNQ A;  3DRP A;  2QO3 A;  4ZIV A;  5KFJ A;  2M7S A;  3SDE B;  1CG2 A;  2QT7 A;  2VFR A;  4JOU A;  5A8K B;  3V81 A;  3BYP A;  1F60 B;  1VQ9 S;  4HLB A;  4TU9 A;  3I82 A;  2VJV A;  2DHX A;  1U7L A;  2LXF A;  4NPO A;  2KJW A;  3GPA A;  4LRC A;  2DR5 A;  2DGV A;  3I0R B;  2OFH X;  2WVD A;  2DXF A;  1VYA A;  2HZA A;  5E3Q A;  4FBT A;  4JI4 J;  5F8L A;  1T03 B;  1S6Q A;  3U27 A;  5IWA J;  1WC3 A;  4LJM A;  1RP5 A;  1WEY A;  3HHL B;  2MHN A;  1KN6 A;  4FXV A;  4BC9 A;  1SVD A;  1G4C A;  2IIH A;  2CFX A;  2XYG B;  1VQ8 S;  4H4O B;  5K8M A;  5CAB A;  4PG6 A;  2KG0 A;  2L08 A;  5DM6 Q;  5AJ3 F;  1RAI B;  4P52 A;  1JQG A;  3DMJ A;  5D78 A;  4M5D A;  3RGI A;  2ZOF A;  4MK9 A;  3SMZ A;  1UPP A;  2XHW A;  4KT0 C;  3DI6 A;  1JXV A;  5LM7 E;  4M5L A;  2EKN A;  2E1M C;  4OHY A;  3DLK B;  4OYA A;  2W7P A;  1I5O B;  1Q8L A;  4WK3 A;  4EWT A;  1EX8 A;  5IC6 B;  4A8O A;  1CJT B;  3C66 A;  1HHQ A;  3VCD A;  3UO0 A;  3UW1 A;  3NGR A;  3DLB A;  1LWC A;  2H51 B;  5CYQ B;  4OI1 A;  1JLE B;  2ROP A;  1BD6 A;  3Q2S C;  5HVH A;  3OL6 A;  4OIX A;  5HI7 A;  2V8V A;  4PRF A;  2L9D A;  3TUZ C;  4H4K C;  1VQS A;  2CPD A;  2G13 A;  1EP4 A;  4F36 A;  5DRK A;  5AXN A;  2IDL A;  4F0K A;  4RBU A;  3VVT A;  2RIL A;  3CCU S;  4LMZ A;  1EAY C;  2FVR A;  4NAS A;  3J80 Y;  2HBQ B;  4DV5 F;  5I4M A;  3V6D A;  1TL1 B;  3Q8Q B;  1HNV A;  2W24 A;  1U1R A;  2J7K A;  1RJJ A;  3QYY A;  3T5J A;  1B0T A;  1N56 A;  1IJE B;  2KXF A;  2I2Y A;  2QLW A;  2X1G A;  2UU9 J;  1YJ9 S;  2HNZ B;  3MM9 B;  2CZV C;  2F8M A;  5M2R A;  5BYS A;  2LFV A;  3G8S A;  2QMW A;  5FII A;  5LT5 A;  3QZ7 A;  5KT6 A;  1HBO B;  5IT4 A;  3RW7 A;  5HQL A;  3ISZ A;  3P5T L;  1RTH B;  1HYS A;  3L7O A;  4WZM A;  4ED0 A;  2CJX B;  4OYX A;  4QIE A;  4J9P A;  1WHY A;  4MIB A;  5KFP A;  2MKI A;  3JYT B;  4KGV B;  4PUO B;  3EVM A;  2AD9 A;  1FK9 A;  3KLF A;  5SZT A;  2IA0 A;  2R4F A;  2C2R A;  2AX1 A;  4O4R A;  2OPP A;  4KIA A;  4OZ2 A;  4DFP A;  2EBE A;  2YNG A;  2AU0 A;  2PII A;  2BKO A;  3N5F A;  3NRB A;  1S9G B;  2FJD B;  3B54 A;  3CXC R;  1TK0 A;  1VHI A;  3Q22 A;  4HDG A;  4W4M A;  2NXE A;  2Y8Y A;  4PG5 A;  3V6J A;  4O4G B;  2M4M A;  4P73 A;  1WC0 A;  1RCX B;  4PXB A;  4U7U D;  3W2W A;  4CO3 A;  3I0S B;  1Y3K A;  1T0T V;  1HBN B;  4OYP A;  1IR0 A;  2E5G A;  2CPE A;  2VBY A;  3FDS A;  3V2U C;  2HVD A;  1FX2 A;  2CNO B;  2KYX A;  1RLD A;  3K5P A;  4IOA Q;  1FJG J;  4X65 F;  1NSA A;  3ET6 B;  1ZYQ A;  2XY7 A;  2BJ8 A;  4IR1 A;  2HHU A;  5DDO C;  4RPF A;  1RT4 B;  3H25 A;  1N48 A;  3MCN A;  2CPX A;  5DG8 A;  2W01 A;  3VTI A;  4NLD A;  2XGP A;  3MM5 B;  5F3T A;  1R0A B;  2YNI A;  4C98 A;  1PJ5 A;  3ILO A;  5KFK A;  1YHQ S;  4K0K F;  2R7X A;  2NXN A;  4ECU A;  5HJY A;  4WU3 A;  2VDH A;  3US5 A;  3TJ8 A;  1DTQ B;  3VF0 B;  1B64 A;  1SJ3 P;  4FF4 A;  1WC1 A;  4DUY J;  3RRK A;  1EKS A;  1UZH A;  4DS4 A;  1EET A;  4LF6 F;  3HO1 A;  2ZBC A;  4U8V A;  4JI1 F;  3D6T B;  2H4Y B;  3E01 B;  2AGQ A;  1N5T A;  4QW9 A;  1M0S A;  3K5M A;  4ELT A;  4HH0 A;  1MRO B;  4NLT A;  2ZC3 A;  4A47 A;  3PEJ A;  1L3S A;  2ACY A;  2FVS A;  3HSZ A;  4LRB A;  3TUP A;  1YTY A;  4AXI A;  3CJ5 A;  3Q24 A;  1TZ0 A;  2BQR A;  1KTV A;  1VRT A;  2ZZM A;  3AFG A;  1V6H A;  1M1K T;  3CMA S;  3VWS A;  4ZVU B;  2E7W A;  3BM7 A;  4KYZ A;  4LQ3 A;  3GFZ A;  3V6K A;  4HAC B;  3VAL A;  3CJ8 A;  2VG6 A;  3A3P B;  4LUB A;  2MZS A;  1RHQ B;  1X8D A;  1BXN A;  3IN5 A;  4P2X A;  2D9P A;  2AYE A;  2HG4 A;  1U45 A;  4PPD A;  4ZVH A;  2EC2 A;  1RWX B;  4L3N A;  3MMJ A;  3AJ1 A;  1SL2 A;  3ZZ0 A;  1JLQ A;  2OI2 A;  2ZNZ A;  1BQM B;  2CQI A;  5E7O B;  1T11 A;  2LVW A;  3A4T A;  4XDC A;  1A0O B;  5DZ6 A;  1S48 A;  6FD1 A;  2V8H A;  1RK8 A;  3THP A;  3KJF B;  5D3G A;  4F25 A;  5A0Y B;  2CPJ A;  3DDI A;  2JNJ A;  3AB4 B;  1A6L A;  3I4H X;  2QFJ A;  1ZA2 B;  4CLL A;  5KG4 A;  4Y2I A;  3PG9 A;  3GYG A;  3HDS A;  3SCJ E;  3AQO A;  5HBM B;  1MW7 A;  5L1I A;  4KFB B;  1Q81 T;  1T9X A;  3RYL A;  1SCJ B;  2HHH J;  1YSJ A;  3BBC A;  3IR6 B;  2N4C A;  2YX1 A;  4DR1 F;  3M7V A;  4TVA B;  4M95 A;  3UN2 A;  5A76 A;  4UUW A;  1SQE A;  4BWM A;  2MLZ A;  3NG8 A;  1Z2Z A;  4DG1 B;  2HAF A;  3DXS X;  5GAG U;  5D4P A;  4KGK A;  5L1L A;  2E9R X;  1UFW A;  3PV8 A;  1C1B A;  2KO1 A;  1S4E A;  5LMN F;  4PWD A;  1NK5 A;  3PIP Q;  1N5Y A;  1BMQ B;  3FEX B;  4QR0 A;  1AYE A;  3TJ9 A;  3F41 A;  3UD5 A;  3MAQ A;  5CQG A;  1RWV B;  3KJQ B;  4P7T A;  3H59 A;  3PJW A;  5HMW A;  2ZD1 A;  3MR5 A;  4URS A;  3JXO A;  1S0O A;  4YME A;  2QG9 B;  1VRQ C;  1XNQ J;  1KVK A;  3A12 A;  4R25 A;  1YBU A;  5D15 A;  5I3U A;  3SCL E;  2CWK A;  3DCA A;  5JVH Q;  1P8G A;  3WX8 A;  1CUL A;  1PSD A;  4CLP A;  4QQB A;  4Q8F A;  2V2Z A;  2MJN A;  4G3I A;  5KOW A;  3P45 B;  5A8R A;  2AMC B;  2X51 A;  1RAJ A;  2BA9 A;  3N6N A;  1GXL A;  1O0P A;  2RT3 A;  1H72 C;  2VBW A;  3MM7 A;  4NZ6 A;  3EGZ A;  2I5J B;  2UUB J;  2WSE C;  5B0C A;  4DCO B;  1XWL A;  1D3W A;  4LR9 A;  1C0T A;  1VQN S;  1JLA A;  5CYM A;  3AD8 C;  4GKJ J;  3VZI A;  3H20 A;  2YWG A;  1S9E A;  2GO8 A;  4DR4 F;  1DY3 A;  5HAN A;  2MTL A;  3KLH A;  5JXS A;  1WDT A;  4QWA A;  2KL8 A;  3ZFV A;  2JC0 A;  4DXL A;  4O44 B;  2FY8 A;  2A18 A;  2WAQ D;  3M2V B;  4NLV A;  4XIU A;  3R5G A;  5M2U A;  3MCO A;  4DL4 A;  1KS2 A;  2QA1 A;  4QR1 A;  2RVJ A;  4C97 A;  1K0V A;  3TVK A;  1IR1 A;  3KJV A;  4NLO A;  3FBF A;  1DQ9 A;  4Q7A A;  4WK1 A;  3ZZO A;  2PGC A;  4QWC A;  2F9D A;  4NCB A;  1BQN A;  3G87 A;  5CXT A;  2DEI A;  1H98 A;  1AZS B;  1TKX B;  3EJM A;  4OI6 A;  1JKH A;  5KFH A;  4GC7 A;  2Z2M A;  1N33 J;  2FJV A;  4ZP8 A;  1HPZ A;  2ZBP A;  3C14 B;  3IBC B;  3I87 A;  3KJN B;  3BKF A;  4DSE A;  4UQG A;  3T1H J;  5B0A A;  4CLT A;  3G6X A;  4RW9 B;  4RNN A;  3BPS P;  3DM2 A;  5IT9 U;  5AXM A;  1BUX A;  1I94 J;  1KQG B;  2W2N P;  1SV5 B;  3B4M A;  5I3P A;  1RT3 A;  2XMK A;  2FHK A;  4TQR A;  1HBM A;  1U09 A;  1OY8 A;  4X66 F;  2G1H A;  5CZV A;  2H4W B;  4X4O A;  1B99 A;  3DDK A;  2CG4 A;  4HI1 A;  1QDU B;  2Z57 B;  1JXL A;  4LFC F;  3BBF A;  4I6W A;  2CPY A;  1NJX A;  2EFP A;  4RKU C;  1RI7 A;  2VH7 A;  2HSE B;  4B17 A;  1O8B A;  1REV B;  3BN4 A;  1UA0 A;  1UJ4 A;  4QOT A;  3RRG A;  3IS9 B;  3JSR A;  3T5K A;  4OJG A;  3HHD A;  4EBC A;  3I9Z A;  3VHQ A;  2AGO A;  3OTC A;  3RAM A;  4C8M A;  4DV6 F;  4DPO A;  4TKT A;  4FXW A;  5J2P A;  4O3N A;  2Y1J A;  1TUW A;  1BE4 A;  4BS2 A;  1WF1 A;  2B4O A;  4P6Q A;  1SC3 B;  2KFN A;  4LF7 J;  2RS8 A;  1X4D A;  4LBI A;  3M1V A;  5FLX U;  1K73 T;  2KU7 A;  3QPI A;  3GFH A;  3D1H A;  2H5I B;  5HVG A;  2Z4P A;  4LFA F;  2CA9 A;  3Q8U A;  2HS3 A;  4A8F A;  3UFC X;  2HEK A;  3NGT A;  4CLY A;  1SH0 A;  4H4M A;  4LQ9 A;  2Z2L A;  3MEG A;  4DBQ A;  4IDK A;  3Q83 A;  3AB2 B;  5GAH U;  2VOD A;  1KD1 T;  1SQF A;  3M8P B;  3P5B P;  4X2B A;  2GVZ B;  3GZ7 A;  4AT1 B;  2YKQ A;  2XY6 A;  3PEH A;  3FBC A;  2R42 A;  3CCW A;  2YNF A;  4DQP A;  2IVY A;  3DOM A;  4URQ U;  1N5V A;  3IRW P;  2N7C A;  2G9O A;  1VBZ A;  3DRX A;  1NK4 A;  5DLG A;  3OFE A;  3KK1 A;  2VC1 A;  2WZ1 A;  2R8G A;  2W2P P;  3VAK A;  3JS9 A;  3M30 B;  3MF5 A;  2EFG A;  4BLG A;  2M9K A;  4V19 J;  4F2R A;  1VR6 A;  1XR5 A;  2MDA A;  2P9C A;  4ZS6 A;  4DN9 A;  1Q8B A;  4ZPC A;  2HRT A;  2F63 A;  4KBI A;  4WJB A;  3AH6 A;  2HQD A;  3VGS A;  3VAM A;  4K4U A;  3HMJ G;  4OMF G;  4EMD A;  3LQV A;  1Q78 A;  4KV8 B;  2V2K A;  4I69 A;  2DNG A;  5C42 B;  2HRY A;  3ZNJ 1;  9ATC B;  2R8H A;  3ZTQ A;  2PMZ D;  1FXD A;  4H4K A;  2FY1 A;  5ETT A;  2LEP A;  3EWG A;  1B7F A;  1RWP B;  4EI2 A;  2CQ2 A;  2LEB A;  4QWB A;  3BSO A;  5IT9 Y;  4WCE Q;  3EUN A;  4F4K A;  2AEM A;  1H3D A;  5KFG A;  2FJE B;  2W9B B;  3IRX A;  2AEJ A;  4TLQ A;  4ILM A;  3NOC A;  5B0D A;  5ETK A;  2EXU A;  4M5K A;  3TW0 A;  1TAU A;  3GR0 A;  4YOE A;  5J2M B;  3Q8S B;  4DR3 J;  1SUQ A;  4JI6 F;  2F9J A;  4L76 A;  3TAM B;  4F4Z A;  2IHR 1;  2BAN B;  1NKC A;  2XLJ A;  3ENV A;  1Q5V A;  5GAG I;  1S72 S;  1JK9 B;  2QMX A;  2M5Y A;  2FZK B;  3HHK A;  1GX5 A;  5C24 B;  3BKT A;  1YBA A;  2ZC4 A;  4ED2 A;  2FC9 A;  5T41 A;  2GIQ A;  2JEI A;  4USV A;  3WC0 A;  3RB6 A;  1PC4 A;  1NCL A;  3QWU A;  1LKZ A;  5KAK A;  1UTA A;  1N36 F;  1Q7L B;  1RTI B;  2VQE F;  3QGI A;  3BQ2 A;  2VG7 A;  4P10 A;  4DV2 J;  4JV0 A;  5H9F J;  5FLX Y;  2JH3 A;  3KMQ A;  1HQU A;  3QRQ A;  1S1U A;  5AXL A;  2DPI A;  1RHR B;  5KT2 A;  4AFF A;  3CF5 Q;  1S7H A;  4DV1 J;  3IWX A;  3CCS S;  3NGD A;  2FD2 A;  3HLU A;  3CJ0 A;  4P72 A;  4W90 B;  4GKK F;  2RDI A;  3OTD A;  4G1I A;  4LBP A;  1LW2 A;  2BE2 A;  1YJ7 A;  1YRX A;  4P2F A;  2K1R A;  2OH2 A;  2CDR B;  3HVT A;  4YR3 A;  3Q8R B;  2ZOG A;  1NU4 A;  1AUS L;  2RIJ A;  4AE5 A;  4ZVE A;  3QBC A;  3H40 A;  3LUY A;  3GII A;  2HQF A;  4I4B A;  4ZPV R;  5C2C A;  1RTJ A;  1R0B G;  5J2Q B;  4DL6 A;  1N4L A;  4I2P B;  1J27 A;  3HZG A;  3GG1 A;  4NLG A;  3POT A;  1RAC B;  3D4J A;  2MZR A;  2BR0 A;  1IKX B;  5DG7 A;  1FNX H;  1GTE A;  4ILL A;  4NA2 A;  3FKB A;  1S6P B;  2DHG A;  2MZQ A;  4JV1 A;  2Y9H A;  4KH0 B;  5K8N A;  5C25 B;  5KFF A;  1M5S A;  2C1E B;  2HWH A;  2JVR A;  4GC6 A;  1RT5 A;  1N6Q A;  3DRR A;  1QVF R;  3WDO A;  4P9S A;  2DGU A;  4PG4 A;  4M5J A;  2ZM6 F;  4DEZ A;  4YB7 A;  1IBK J;  4O3R A;  1CJV B;  2AJ2 A;  1OPI A;  4GVB A;  2B5J B;  4DPW A;  4EEY A;  4I0W A;  3HPO A;  4WE1 A;  5E5N A;  4YQW A;  2HND B;  2RKI B;  3QFH A;  4OJ3 A;  3NGU A;  3SQG B;  4NCG A;  1CQM A;  4A8X A;  4USH A;  4USI A;  3A3O B;  3PIO Q;  3UDL A;  2DR7 A;  1K9M T;  1FER A;  1NRK A;  2IM3 A;  1NBE B;  2DGX A;  3DYA A;  3MD1 A;  2OSR A;  4DUZ J;  1AT1 B;  2KTQ A;  1BQX A;  3LP2 A;  3MEC B;  3NWG A;  1RHM B;  3CME S;  3DU5 A;  2XLI A;  2BE9 B;  3IWL A;  5DGB A;  2BZ2 A;  3JAM U;  4LF8 J;  1DUR A;  4TYB A;  3MXH P;  3I96 A;  4F7V A;  1WUU A;  2UUC J;  4OX9 J;  1DJ0 A;  4QCL A;  1KOO A;  2WOM A;  4AL5 A;  5M2P A;  3G8T A;  3OVS A;  3VGT A;  2V8D A;  3ZTR A;  1K0T A;  1HHS A;  3T1Y J;  3QAE A;  2ATL A;  4JV2 A;  2PDA A;  2G0I A;  4CTA A;  3RR7 A;  2DRD A;  2W2O P;  2BDP A;  4B3R J;  4JI4 F;  5IWA F;  1HWK A;  2HZC A;  4YP3 A;  2FB0 A;  2KB2 A;  2XZT B;  3OTB A;  1IKV A;  5GAH I;  1X5O A;  3KLI A;  1PAU B;  1GX6 A;  2LQ9 A;  4UT4 A;  3CDU A;  4ZVF A;  3A8J A;  4MFB B;  3DMJ B;  3U7J A;  3QID A;  2KM8 C;  2BV3 A;  1IWG A;  1IN0 A;  1S7I A;  2OEJ A;  3C2P A;  2Q3P A;  3IM9 A;  2WON A;  4I2Q A;  4LRE A;  1HI1 A;  4X4U A;  2FPH X;  2H9Z A;  2IVM A;  4K8R A;  4QYR A;  1DQA A;  1HWL A;  1N34 J;  4OI4 A;  2FZG B;  4A46 A;  4IO1 A;  3FRY A;  1WG5 A;  1PAE X;  1JLC B;  1SQG A;  1CSJ A;  1MMN A;  1TV6 B;  4ZHR A;  1NXI A;  3EZ5 A;  4DQR A;  1LWC B;  1N5Q A;  1VC5 A;  4C3L A;  2XI2 A;  1X5T A;  4HHJ A;  2AP6 A;  3T41 A;  1B3T A;  4IRC A;  4C9D A;  1AB8 A;  4MK8 A;  5J2N B;  4KY3 A;  4Y6I A;  1KVI A;  4EFA C;  4B9M A;  1WSR A;  3OL9 A;  3OR1 A;  3PO4 A;  1ELO A;  2Q6C A;  4CLS A;  3S7R A;  1RAB B;  3QT8 A;  3CC4 S;  2GVD B;  1XR7 A;  4C2M A;  3MOZ A;  3LP1 A;  2GJI A;  1SIW B;  1O5J A;  3W1Y C;  3DLJ A;  1JJH A;  2GGP B;  3QSI A;  4CT8 A;  1FXR A;  2W25 A;  4PXE A;  4V19 X;  4JI8 J;  3MAA B;  3M4X A;  2LEA A;  1OIA A;  2G0J A;  2FLL A;  4ZPW R;  4TY9 A;  1WG4 A;  5A6W A;  4RUA A;  1DLO B;  2GJF A;  2B7C B;  2PMW A;  2Q66 A;  1EQM A;  2LEC A;  2UU9 F;  2GO9 A;  5KG2 A;  1X9S A;  4OYB A;  3FSY A;  5L39 A;  2VL1 A;  4FNI A;  3IG1 A;  2B7B B;  3OD2 A;  2HHT A;  2NQP A;  1D1U A;  3UR0 A;  3R7S B;  5KFA A;  3NS5 A;  1B4S A;  3FSI A;  4Y65 A;  1JX4 A;  4OLO A;  1YJU A;  4FZV A;  4A8Q A;  2CJ9 A;  2JFD A;  1FKO A;  1F2G A;  3DGP B;  3GTY X;  1Q8K A;  3HHL C;  2Z2Z A;  1FEH A;  5FDL A;  2B6A A;  3SFG A;  2VFT A;  3KG0 A;  2H3E B;  3JAM Y;  2PO4 A;  4WZQ A;  3D28 A;  4DF4 A;  2MMY A;  2MQL A;  1DQ8 A;  1XER A;  5EDW A;  3UNG C;  3MAH A;  1XBW A;  4EUV A;  1TL3 B;  4DZ6 A;  4DI6 A;  2BJD A;  5DM7 Q;  4LF1 A;  5IFM A;  4J9L A;  1UET A;  2CVI A;  1MWY A;  3ULH A;  5KFR A;  3MMB B;  4ZIT A;  1S6U A;  1U6F A;  3M6W A;  4EO8 A;  1RWO B;  2F5G A;  1QLN A;  1PO6 A;  3G71 S;  1GH8 A;  4RNO A;  1HIY A;  1CS4 A;  3D66 A;  1VRU A;  3TA2 A;  1FJG F;  3CPW R;  2OEM A;  5E33 A;  4OL8 A;  3I32 A;  2KVI A;  3NKY A;  4WFN Q;  3IFE A;  3MUM P;  1SL0 A;  4NX9 A;  1WKK A;  2NPI A;  3FCH A;  3FQL A;  3MMC A;  3G4S S;  4LRD A;  2AJ0 A;  3HVR A;  3K89 A;  1WTF A;  2A10 A;  3JQJ A;  2UXB J;  4FDF A;  3BO3 A;  3TO8 A;  1FRK A;  5L8R C;  2HLU A;  3MHY A;  3PYD A;  2C3M A;  1JLF A;  4B9N A;  3DOL B;  2AJ1 A;  4DCP B;  1T05 B;  1VGY A;  2H54 B;  4TY8 B;  4LSN B;  1YKW A;  2OKQ A;  3TA0 A;  3DU6 A;  4ZVO B;  1WI8 A;  3EZU A;  3OW2 R;  1SH3 A;  3A8I A;  3I9V 9;  2ZFH A;  3HD1 A;  3LP0 A;  2X1A A;  1H6K X;  3THV A;  3AT1 B;  4DUY F;  1R6V A;  4X4T A;  2RU9 A;  3BGU A;  5LJ3 Y;  2OSQ A;  2WSC C;  2KI2 A;  2C42 A;  2HBZ B;  4KO0 A;  4JP8 A;  4LR8 A;  2QN6 B;  2HMI A;  1RT2 A;  5J1E B;  1LWF A;  3LO3 A;  3O2I A;  2EPI A;  3ZO7 A;  2MZ1 A;  4C11 B;  5KFW A;  2FGO A;  4K4Z A;  2ZHB A;  4JV5 J;  4DL3 A;  3N9U C;  2WW4 A;  1FE0 A;  1LWE A;  1QJH A;  8AT1 B;  4TQS A;  1H73 A;  2C2D A;  3ILI A;  3PYG A;  4YDD B;  4K4W A;  3N01 A;  4C0O C;  2VFS A;  1S1X A;  3PYE A;  3PTW A;  5H9F K;  2B0G A;  5ETO A;  1TKT B;  2GW8 A;  1JJC B;  2XUL A;  1ZZN A;  5D4L A;  3VGV A;  3AA9 A;  4O3O A;  3Q8P B;  1D9D A;  3JB9 k;  3TUJ C;  2KJV A;  1JLQ B;  2W8L A;  3MR6 A;  1Y5L B;  3M6V A;  5ETL A;  2RHS B;  2M3D A;  2AX0 A;  4A8Y A;  3UD4 P;  3D3C J;  1RTD B;  2Q6B A;  4NRT A;  2YQ0 A;  2FJW A;  4ZOS A;  2KXH A;  1EZZ B;  1D0E A;  2P6S A;  2PE8 A;  5FJ4 A;  1VBX A;  2XSF A;  4WU2 A;  1RAD B;  1D09 B;  3V4I A;  2G2Z A;  1ZTW A;  1M1H A;  3CD5 A;  4DMZ A;  1RB0 A;  5A2Q U;  3BQ0 A;  1ZM9 A;  2ZH6 A;  5KFX A;  2DO4 A;  3OFF A;  4PXD A;  2EFO A;  3S1T A;  4WP3 A;  1R8A A;  3W8P A;  3RAQ A;  2AHO B;  1Z4U A;  2HHH F;  5BYR A;  2DNZ A;  3BH6 B;  4J9V A;  1VLY A;  3H5X A;  2DIU A;  1FRJ A;  4F67 A;  4IFY B;  3NWR A;  3OR2 B;  2O66 A;  1LK5 A;  1WOR A;  3UDC A;  2VQF J;  4YR0 A;  3H4D A;  4ETX A;  4PWD B;  1X4F A;  3CD0 A;  4P74 A;  1Y0H A;  2MLY A;  1VBK A;  3ICL A;  4BDP A;  1C2P A;  3KLG A;  3JSB A;  4AQY J;  1LW0 A;  2ALZ A;  3Q89 A;  3PRD A;  1KWM A;  3PRV A;  4Q2M A;  3RAX A;  2NLW A;  5CD4 A;  4M8L A;  2W8K A;  3UI3 A;  2F4V J;  1S1T A;  4DFJ A;  2GQ2 A;  1ITP A;  1XNQ F;  1IM4 A;  1WOO A;  1RT1 A;  1FRM A;  1NLK L;  5I42 B;  3OHB A;  4Y2M A;  2ZH5 A;  3DRS B;  2HGL A;  4YEA A;  5IXU A;  4U67 Q;  4UY8 T;  3R97 A;  3RUB L;  5GAD U;  2N7Y A;  1UW9 A;  2RRN A;  3KK2 A;  3M9M B;  5T7L A;  3OSP A;  3FC9 A;  1S1W B;  3WX4 A;  5IC4 B;  1JXE A;  2A2D A;  2R7T A;  2EG2 A;  4FNH A;  5F8M A;  5IOL A;  2C28 A;  1WKJ A;  4XK8 C;  2CQH A;  2UUB F;  1JLA B;  2DR8 A;  5CYM B;  3KMS A;  5DDP C;  1T9Y A;  1RAO A;  2DH7 A;  2DNO A;  4GKJ F;  2ZJP Q;  1ZPW X;  1ZAX A;  4BHQ A;  2N4D A;  3O6Q A;  2AJF E;  1FJ7 A;  1P1T A;  3MED A;  1HQE A;  1ZM4 A;  3BRE A;  1S79 A;  5HP1 B;  3MPW A;  4NI2 B;  3N5B A;  5JUM A;  3D54 A;  1L3V A;  2NXU A;  1SJ1 A;  2WB4 A;  5HK4 A;  3A8K A;  3GYN A;  4TLR A;  3JTP A;  3MMA B;  3QIP A;  2B4V A;  4WF9 Q;  5F3Z A;  4XTT A;  3C3L A;  1BQN B;  3T6B A;  2GQC A;  1MN7 A;  3C6T B;  1V5I B;  3NCP A;  1HPZ B;  1PIE A;  4Y2C A;  2QLX A;  5CD4 H;  3ISN C;  3N28 A;  2IPO B;  1NJY A;  1S5Z A;  4PYD A;  3TAR A;  1N33 F;  1M5V C;  5K14 A;  2R2S A;  1G6B A;  3KOA A;  1KFD A;  5A2Q Y;  1R89 A;  2DK2 A;  4FBU A;  3T1H F;  3BGL A;  4KHM A;  3BDE A;  2Q1L A;  1GT8 A;  1I94 F;  1HBM B;  3CD6 S;  1ZS6 A;  1S59 A;  3PDN A;  1XMB A;  2V63 A;  4RW7 B;  1RSC A;  4HT5 A;  3G82 A;  1KVJ A;  2ACM A;  4YY3 J;  1Y7P A;  4K5R A;  2CJY B;  1RIS A;  2DXD A;  2HFZ A;  3D68 A;  3AXM A;  4ZN3 A;  1WSV A;  4ZPD A;  2K3K A;  3RR8 A;  1NND A;  1IBM J;  1Y5N B;  4J9K A;  1RQ0 A;  3W9J A;  4UOC A;  2P9G A;  2CJQ A;  4OHX A;  1HI8 A;  4F4A A;  3CW2 C;  4LSL A;  4J9O A;  1RBO B;  1PG5 B;  4DV0 J;  3UCZ P;  3GIL A;  3ZTP A;  3R9L A;  3K58 A;  4I6Y A;  3CSK A;  1Y4Z B;  4DR6 J;  1C0U A;  4LF7 F;  2QIF A;  2XSJ B;  1WHV A;  4CLF A;  3EYZ A;  4ECX A;  3PJX A;  2D9O A;  3FK4 A;  4G1P A;  1IVZ A;  1FCA A;  2X3G A;  4OYZ A;  4O23 A;  4AUK A;  4O3Q A;  4OI3 A;  5KG3 A;  2IVF B;  2IRY A;  4D3G A;  2JLF A;  4NXN J;  2ZDP A;  4JI3 J;  2BRK A;  4IDK B;  3IGV A;  3C16 A;  1HFE L;  2E1A A;  1KHW A;  3OTO J;  1S9F A;  4ANE A;  2V5H G;  5KG0 A;  3HHL D;  2RQM A;  5KFI A;  1H38 A;  4DSI A;  2AEF A;  2KN4 A;  2DB1 A;  2DHS A;  3QAT A;  1NDK A;  1PJ7 A;  2FLN A;  1NHV A;  4OFZ A;  2AKW B;  3GIM A;  3SI8 A;  2RF2 B;  2ZDO A;  4UQT A;  2GHP A;  4OZL A;  3CDE A;  3QGH A;  4X4Q A;  3O1L A;  4F8R A;  3MM8 A;  4DR7 J;  2XS2 A;  1YIJ S;  3CJT A;  2K06 A;  1TK8 A;  4QIW D;  1WDD A;  3S01 A;  5EN1 A;  2GC8 A;  1BWV A;  3K8W A;  2V69 A;  1HNI A;  2MGZ B;  2E5J A;  1EB0 A;  1J5O A;  5D77 A;  5L1J A;  2HWI A;  2EKY A;  2DNN A;  3BGO P;  3HI9 A;  1B0P A;  3GB0 A;  2W7O A;  3BSN A;  5D8H B;  4A4J A;  4KJI A;  1RYS A;  1SB6 A;  4O0I A;  2UUA J;  2D7S A;  2V34 A;  4NLP A;  4YB6 A;  2CUY A;  4OZ5 A;  4DLG A;  3SDE A;  3ENA A;  1VC6 A;  3FMB A;  2NSC A;  4GMK A;  4KKO A;  2DNM A;  4HI2 A;  5K8O A;  1U49 A;  2C2K B;  1VJW A;  3P4U B;  4EBD A;  4ZN1 A;  5IV4 A;  4HTI A;  4DR3 F;  2RSQ A;  4ZCK A;  4DZD A;  1ZOT A;  3I0R A;  3R1L A;  1TU0 B;  4ECS A;  4OZ3 A;  3HZE A;  4RNF A;  1NH7 A;  3KTQ A;  1UFK A;  1T03 A;  1YRU A;  2CYY A;  1KBR A;  1KQF B;  4F0H A;  3ZZP A;  1VK8 A;  3HHL A;  1UVJ A;  3NY0 A;  4K4S A;  5H1S V;  5L1K A;  1T94 A;  4ZDN A;  4H4O A;  5F0W A;  3V6H A;  3C6U B;  1FRI A;  3HK2 A;  2YTC A;  3DLG A;  4LRA A;  1X5S A;  2VAS A;  3BN7 A;  2QRR A;  2OPS B;  1FJE B;  4CIO A;  1T8E A;  4B9L A;  2O67 A;  1HW8 A;  4DV2 F;  5LMU J;  1T9T A;  1VQK S;  4ALZ A;  3GSI A;  1PBU A;  3J7Z 5;  3EX7 B;  3DLK A;  3K2Y A;  2IJN A;  4KGZ B;  3RG6 A;  2BAC A;  2VPX B;  3CJS A;  1H74 A;  4ED3 A;  2DNR A;  2QA4 S;  1ZPV A;  1CJT A;  8ATC B;  5GAD I;  1UJ6 A;  2MKY A;  1CC7 A;  1OWX A;  2GIR A;  3G2X A;  1SJQ A;  5HQ8 A;  4DV1 F;  3CJK B;  3S6E A;  4ENO A;  2LXI A;  5CYQ A;  3MPV A;  1JLE A;  2XB2 D;  2UVV A;  4CDI A;  4CH7 A;  1SXL A;  2V94 A;  1FO1 A;  3MCS A;  1UKU A;  2K1R B;  3HVT B;  3SSS A;  3MDF A;  1WEX A;  1RAE B;  4N56 A;  2BQU A;  4NLQ A;  3CCR S;  1HWI A;  3ZTS A;  2V0N A;  3W60 A;  1UEV A;  3D6H B;  2ZHA A;  3WZ0 A;  5KG6 A;  3QJL A;  3VAH A;  7FD1 A;  4YB5 A;  2XHC A;  2VU5 A;  5EWE A;  4ZK7 M;  2L3M A;  3SSR A;  3POT B;  3TYT A;  3D9B A;  4C0B A;  1TL1 A;  1TL4 A;  3HD2 A;  3E3X A;  1DHM A;  3SV3 A;  1HBU B;  2Y0B B;  1Q95 G;  1ULR A;  4CYU B;  2E29 A;  2BKN A;  1NAQ A;  1NDP A;  3C8Y A;  2HNZ A;  1U48 A;  3W3S A;  2RML A;  5J1P A;  3CVK A;  4KGM A;  3U02 A;  1RWU A;  3RZA A;  4Q5V A;  1OYE A;  1N6Q B;  1HWU A;  4JI2 J;  4JUZ A;  1NKE A;  1HBO A;  2WVE A;  1RTH A;  1NK8 A;  2C2Z B;  1X5P A;  2J9D A;  4NLW A;  3JYT A;  2W7A A;  2GIF A;  5AE3 A;  3D6M B;  1IBK F;  3NAH A;  2IA6 A;  2CJA A;  1X0F A;  3H5S A;  2W4P A;  2V9W A;  1T3N A;  4N8N A;  4KHP J;  1A9N B;  4WE1 B;  4K4V A;  1L3U A;  1GMW D;  2M52 A;  5MAO A;  3Q8V A;  2AJQ A;  2KFZ A;  5EWG A;  3PR4 A;  4ZP6 A;  2AWZ A;  2WRM A;  1S9G A;  1F9F A;  3QT7 A;  3HSG A;  5E3P A;  1CQN A;  5D4N A;  2GCF A;  2CJB A;  2ZH2 A;  4O4G A;  2OO4 A;  1F3V A;  4HL9 A;  2ZVS A;  4DPX A;  1WF2 A;  3TAP A;  4ECW A;  1MWQ A;  2ZJQ Q;  5KT3 A;  1RAH B;  3H2V E;  3I0S A;  3GSD A;  3UDV A;  2B9E A;  3M05 A;  2VG5 B;  1HBN A;  4RX6 A;  2V2Q A;  5F8I A;  1D9F A;  1K47 A;  3DYA B;  5BR8 J;  2RUS A;  3SIP B;  3J7A 1;  1R7I A;  1WJ9 A;  3HHE A;  3HP6 A;  2V6A A;  3W62 A;  4DUZ F;  2IRX A;  1VS3 A;  5HRO B;  3NMA A;  2BXJ A;  4G1Q B;  4FPI A;  4WXO A;  3BJY A;  2DRA A;  5F8J A;  4OJ1 A;  2VZ9 A;  2OPQ A;  2AYG A;  4LRF A;  1VK3 A;  4CNZ A;  4LF8 F;  1RT4 A;  3LAM A;  4CLZ A;  2UUC F;  3CMQ A;  3SCK E;  2WOM B;  1TVR B;  4OX9 F;  3M6X A;  2LA4 A;  1VQM S;  3CC7 S;  4ED7 A;  3L95 X;  4K0K J;  1VBY A;  2CDQ A;  1R0A A;  2QYC A;  3ETO A;  3T3F A;  4X4R A;  2K8G A;  4CTA B;  2YWF A;  1U02 A;  1B7Y B;  1LNQ A;  3T1Y F;  4HT7 A;  3PW4 A;  4USM A;  2EW9 A;  3LTO A;  2VF3 A;  4B3R F;  1YK9 A;  4NLX A;  2E66 A;  4MIA A;  1DTQ A;  2OLW A;  1GQE A;  1U8S A;  2A6O A;  1VQ4 S;  4LIR A;  4E2F B;  2YNH A;  5D0H A;  3GWC A;  1Z1Z A;  1NZA A;  5IT0 A;  4JI5 J;  4XAK A;  3PW0 A;  4C4W A;  3MWB A;  2Z56 B;  3J7Y U;  5LSR A;  2MQ8 A;  4DL0 C;  3E01 A;  1J5E J;  2WON B;  4I2Q B;  3CDB A;  4IRD A;  1KR4 A;  4U6P A;  2YH1 A;  3ISN D;  4USK A;  2UVR A;  1ZZF A;  2N3L A;  5HVF A;  3DRY A;  1XQI A;  3OFH A;  3J7Z T;  2J8A A;  4J90 A;  3RBD A;  1N34 F;  1KC8 T;  3M2R B;  3TI0 A;  2ATC B;  4A48 A;  3CB4 A;  1MNE A;  1OSD A;  4Y00 A;  3AD9 C;  1TAQ A;  1HNZ J;  3BSA A;  4KC5 A;  2F8H A;  1GMW A;  1Q0N A;  2DCU B;  3PW2 A;  4K4X A;  4HAC A;  2AT1 B;  4KQZ A;  5MLC V;  5LL6 d;  2DR9 A;  3R8Y A;  4KR0 B;  4DQI A;  3HHN B;  2L41 A;  2NUH A;  4QZV B;  5DO2 A;  4RU2 A;  4EK2 A;  3LP1 B;  4RL1 A;  3CJ4 A;  2OPR B;  3LOU A;  2V4J B;  4ZLL A;  1Y00 A;  2EG1 A;  3F44 A;  4AXJ A;  3FFI A;  1BQM A;  3MI7 X;  5KTQ A;  1QY7 A;  2DY1 A;  1MLA A;  2C22 A;  3NAI A;  1KLM A;  4W92 B;  1WI6 A;  4Y34 A;  5L9X A;  4F3M A;  1FE4 A;  1XK8 A;  5E3A A;  1FVS A;  4JI8 F;  1C1C B;  1ZAV A;  5A0Y A;  2RU3 A;  1R6Y A;  2R9L A;  3FCV A;  4NXM J;  2HHX A;  1TK5 A;  2WCX A;  3DFE A;  2GAH C;  3LA0 A;  4B3T J;  3M2U B;  3W2V A;  5HBM A;  3H5Y A;  4KFB A;  1XN9 A;  4ICL B;  2MKJ A;  3TP2 A;  3CJ3 A;  2GMH A;  2HGM A;  4OI0 A;  1FFG B;  1CJU A;  1SPB P;  1UEU A;  2E1P A;  3AJD A;  5D0G A;  2ZH3 A;  2MKK A;  3CUN A;  3H98 A;  1U0H B;  3NNH A;  4WYL A;  3IO1 A;  4DG1 A;  1PGZ A;  4B3M J;  4DSL A;  4NEZ A;  3CCL S;  5KFD A;  3GCX P;  2IJR A;  3AOB A;  4OZ0 A;  1IKY A;  2QZ8 A;  3ZC4 A;  3IP0 A;  3IR5 B;  2QA4 G;  1MU2 B;  1GEH A;  3QFW A;  2E7V A;  4IH5 A;  2MHE A;  3NBP B;  1H7X A;  3UCU P;  2EC0 A;  2XEX A;  2HRU A;  4EBE A;  3A1Y G;  4R8U B;  2HHQ A;  4N76 A;  4NYO A;  4CO4 A;  1IKW B;  1BGX T;  2QSW A;  2IC3 B;  3MFH A;  4A8W A;  4ZCM A;  2C3P A;  2OGU A;  3GJT B;  2G0C A;  1U2C A;  5HJX A;  2WB1 D;  2DHH A;  2XLK A;  3QSY B;  2NR0 A;  2M2B A;  1RCO B;  1W7W A;  2K2P A;  1T9V A;  2Q43 A;  3EPG A;  3JSM A;  1ACM B;  1UFL A;  2HBY B;  3MMC B;  3O3L A;  4FF3 A;  3OVA A;  2R8I A;  2CKW A;  2PC6 A;  3G8Q A;  2FJB B;  1Q5Y A;  1EJ7 L;  1I51 B;  2MY7 A;  1M5K C;  1HWJ A;  2R7W A;  2W1B A;  2FVC A;  2NZ4 A;  1WC5 A;  3VR1 A;  2UXB F;  4HVZ A;  3DLE B;  4L6V 3;  3PJ9 A;  3T5L A;  1FHT A;  4CH1 A;  2JDJ A;  4R0J A;  5LXY A;  2LDY A;  2QV6 A;  4DR5 J;  3GE9 A;  1QAI A;  2WW8 A;  3LGN A;  2NRE A;  3GFX A;  5K20 B;  3FBE A;  1ZAW A;  3BKU A;  3DHW C;  2E1R A;  2COL A;  1N88 A;  1U24 A;  3RBE A;  2B8Q A;  2BW7 A;  5B0E A;  2P6T A;  4O44 A;  1RAA B;  2M70 A;  2PN6 A;  1RT6 B;  2I0X A;  3GFY A;  3HFK A;  2WSF C;  3WBZ A;  9RUB A;  3P6Y C;  5ETR A;  2RHQ B;  4ID8 A;  3M2V A;  2MPU A;  2HMI B;  1KKH A;  4ELU A;  3K57 A;  3EVW A;  1GK8 A;  1CC8 A;  1L3T A;  3MM6 B;  4CH0 S;  2JVO A;  4JB8 B;  4M5G A;  4P7V A;  4IQM A;  3H42 A;  1D8Z A;  4J9U E;  4DFK A;  1VQO S;  2HQC A;  4ELV A;  1F5C A;  2ZWO A;  4NRU A;  4JV5 F;  5GAE U;  4EU0 A;  3GJS B;  1W2I A;  3R7B B;  1M5H A;  1AZS A;  4N7T A;  1TKX A;  2PT0 A;  1CVJ A;  4HHU A;  2J7W A;  1U1Q A;  3C14 A;  2FJA B;  3OPK A;  2PI5 A;  1FD2 A;  4RW9 A;  2H1Y A;  3MEE B;  2XQC A;  1SV5 A;  3NMR A;  2XGQ A;  4DDF A;  4RW6 B;  1REG X;  4J9M A;  3L9Z A;  4ZKA A;  3ENW A;  5ETQ A;  4USW A;  4KGX B;  4B3O B;  2PMH A;  6AT1 B;  3HUL A;  4F4Y A;  3DHX A;  1DAR A;  1S49 A;  3CCT A;  1Q8I A;  2HS0 A;  4ILR A;  1MWZ A;  3PR5 B;  1X4A A;  4ED4 A;  3KFW X;  1NH8 A;  3EGV A;  1REV A;  2YXL A;  5KT4 A;  2KRR A;  2HQI A;  3T1A A;  3IS9 A;  2BW2 A;  1R8H A;  3LAK A;  3ZZY A;  3MPY A;  4PQU B;  3HT0 A;  3W8G A;  4Z7Y A;  4QYZ J;  2GML A;  2J9D E;  3D7S B;  1E6V B;  2IJF A;  2XMV A;  2KXN B;  2E5L J;  2XZD B;  5THW A;  4DSK A;  5KOX A;  2ZEJ A;  3FZB A;  3TEG A;  4ERD A;  4JBC A;  5KFN A;  4HTJ A;  2FLP A;  2DO0 A;  2VDI A;  2QJ3 A;  4O0N A;  1LXN A;  1KP6 A;  4LIW A;  3DKD A;  5EGY A;  1X4E A;  1F9H A;  4IFV B;  1MG7 A;  3M8Z A;  2VQF F;  4WBF A;  5K8P A;  1NZ8 A;  1P6T A;  3J7Y I;  5HQM A;  3LAL A;  3R6L B;  5E41 A;  3TVY A;  3ILL A;  2XY5 A;  3AAW B;  3KLG B;  4ED8 A;  2W2M P;  1LW0 B;  4QBU A;  4YDX A;  3GON A;  2BJ3 A;  5L38 A;  4AQY F;  3M8P A;  3HM9 A;  2GVZ A;  2MKS A;  1VMB A;  4DL2 A;  2ASD A;  3ILJ A;  1U26 A;  2VKR A;  2LCW A;  2F4V F;  2IMW P;  1PIL A;  2M88 A;  4PKD B;  2XMU A;  2POK A;  4OHZ A;  4ITS A;  1WHX A;  3EXC X;  1Y3J A;  3M30 A;  2P2C B;  3SFU A;  4ATN A;  3CC2 S;  5T7L B;  1DTT B;  2W9C B;  2QA2 A;  3W66 A;  2CWX A;  3HT3 A;  1WF0 A;  4LF9 J;  2VPZ B;  2RD5 C;  5KFT A;  4B3S J;  2ZBI A;  1N32 J;  3OL7 A;  3KYL A;  3AA8 A;  3R3T A;  4RW8 B;  4QWD A;  1F0X A;  4XDD A;  2WHO A;  4ZVT B;  2HGN A;  5A6P A;  2QYG A;  4ID5 B;  1HMV B;  1JB0 C;  1T02 A;  1SJ4 P;  3W61 A;  2CVE A;  1T7P A;  4KV8 A;  3D0H E;  4ZP7 A;  3MZI A;  1IQT A;  4QWE A;  1QUV A;  5C42 A;  4ZLN A;  1U1M A;  3MED B;  3OLB A;  3P8B B;  5LSL A;  2FZC B;  2MLX A;  1LFP A;  2QL5 B;  4EO6 A;  1FDN A;  5RUB A;  3L7U A;  2NSB A;  4M5M A;  2F40 A;  2OTJ S;  2H5J B;  2W9B A;  2DD8 S;  3I56 S;  1ZTT A;  3W5Z A;  3QIP B;  1RWW B;  5J2M A;  2DH8 A;  3EGW B;  4RNM A;  2NXJ A;  1TQL A;  3TAM A;  4LT6 A;  2BAN A;  2GHV C;  2XTJ P;  2IAJ B;  3QWP A;  2FC8 A;  3KUH A;  4PR6 A;  1FWL A;  2M8H A;  2V4Q A;  2H65 B;  2ZE2 B;  4DF8 A;  1SJR A;  4OHV A;  1URN A;  2IM2 A;  3PRB A;  1U1P A;  4MAK A;  4B9U A;  4FF1 A;  2ASJ A;  3OV7 A;  1FFW B;  4DQS A;  1WEZ A;  4CNY A;  1RKI A;  5D4O A; 
#chains in the Genus database with same CATH homology
 1XMO J;  3T1Y J;  4KY3 A;  3J7A N;  5LM7 E;  2MTL A;  2UXB J;  4DR1 J;  4NXM J;  4DV6 J;  4B3R J;  4LFB J;  2KL8 A;  4JI2 J;  2UU9 J;  4JI6 J;  4DR7 J;  4LF5 J;  4DV3 J;  4JI7 J;  3IMQ J;  4DV0 J;  4B3T J;  1HNX J;  1XNQ J;  4V1A k;  1FJG J;  2UXC J;  1IBL J;  1HNZ J;  2VQF J;  4GKK J;  4DR6 J;  3W1Y C;  4DV2 J;  5LMN J;  4LF4 J;  5AJ3 J;  4DV5 J;  1HR0 J;  4X62 J;  4K0K J;  3J80 U;  4JI8 J;  4YHH J;  4LFA J;  2E5L J;  4LF6 J;  3J81 U;  3R2C J;  2MEW A;  4DR4 J;  4X66 J;  2HHH J;  4DUZ J;  4DR2 J;  4JI1 J;  4AQY J;  4KYZ A;  3D3B J;  4JI4 J;  4KHP J;  3D3C J;  4B3M J;  2ZM6 J;  5IWA J;  4LF9 J;  1N34 J;  4NEZ A;  4B3S J;  4HHU A;  4NXN J;  4JI3 J;  4DR3 J;  1N32 J;  4DV7 J;  4DV1 J;  4NEY A;  4YY3 J;  3OTO J;  1N36 J;  4LFC J;  4JYA J;  3JAM U;  2F4V J;  4LF8 J;  4DR5 J;  2UUA J;  4X65 J;  2VQE J;  2UUC J;  1N33 J;  4JI5 J;  4OX9 J;  1XMQ J;  2UUB J;  4DV4 J;  4LF7 J;  3T1H J;  4PWW A;  4X64 J;  5A2Q U;  1HNW J;  2MQ8 A;  1IBK J;  5FLX U;  5LMU J;  2UXD J;  4JV5 J;  5IT9 U;  1IBM J;  1I94 J;  2KVQ E;  1J5E J;  4DUY J;  4JI0 J;  5BR8 J;  3R2D J;  4GKJ J;  1XNR J;  4RJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...