1I94J

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1i94J00
4OX9J 4LF5J 2UUCJ 4RJVA 4LF7J 1I94J 4B3TJ 2KVQE 1HNZJ 4GKKJ 4KY3A 5FLXU 3R2DJ 1FJGJ 4DR6J 4DV4J 4PWWA 2F4VJ 4JI5J 4DR5J 4LF8J 3T1HJ 2HHHJ 2VQFJ 4DR2J 1XNQJ 1HR0J 4DR1J 4JI6J 1N33J 4DUZJ 4JI2J 4DV5J 5A2QU 5LM7E 4X62J 2UXCJ 4JYAJ 3D3BJ 4NEYA 4JI4J 4B3RJ 4LFCJ 4JI1J 4DV6J 1N34J 2MTLA 4NEZA 4AQYJ 3T1YJ 4GKJJ 1XMQJ 3J7AN 4JI0J 4YY3J 3OTOJ 4B3SJ 2ZM6J 4JI8J 4DV1J 4NXNJ 2UXDJ 5LMNJ 3R2CJ 1IBKJ 4DR4J 2KL8A 4X65J 4JV5J 3J80U 4LF4J 3JAMU 1N32J 4DR3J 2UUAJ 2MQ8A 1XNRJ 4DV7J 4NXMJ 1IBMJ 4KHPJ 1HNXJ 5BR8J 4X64J 4V1Ak 4KYZA 4LF6J 5IT9U 2UXBJ 4YHHJ 4X66J 5AJ3J 4JI3J 1J5EJ 4DR7J 1HNWJ 2E5LJ 5LMUJ 4DUYJ 2VQEJ 4LFBJ 4DV3J 1XMOJ 3IMQJ 1IBLJ 2UU9J 2UUBJ 4JI7J 4LF9J 3D3CJ 3J81U 2MEWA 4LFAJ 3W1YC 4HHUA 4DV0J 4B3MJ 1N36J 4K0KJ 4DV2J 5IWAJ
chains in the Genus database with same CATH superfamily
3K8VA 5CQGA 1XN9A 1TTHB 4DSKA 5DM6Q 1P1TA 3QRRA 1KLNA 3H42A 4ZPCA 2LECA 4YR2A 1WKLA 4OFZA 5ETSA 3PCOB 1VQ5S 5HMXA 2HQ3A 2KFYA 4URQU 2GS8A 2WCXA 3PVXA 2LDYA 5C2CA 3M2UB 3H98A 1MU2B 2AGQA 4DQSA 4EUVA 1NB7A 2ASJA 2HNZA 3IP0A 4DG1B 4B9LA 3QIPB 4ECYA 2J0WA 1LOUA 2KHDA 3HDSA 1R6YA 2CDQA 2M4MA 3PO5A 1YQHA 4C8OA 4F26A 4EMDA 3HSZA 5J2NA 1KSPA 3NL0A 1Y10A 1X4CA 1BY9A 3IWNC 2M8HA 4N5SA 1IKWA 4DV7F 2RS2A 4NI2A 5E3AA 1OY6A 3QZ8A 4ALZA 3BO4A 2DD8S 2DGQA 4TYBA 5C24A 1VQ9S 1MW7A 3DGPA 2W9CB 2F63A 4W98A 3J81j 3TUPA 4K5RA 2QL7B 4PPDA 4XTTA 4I7FA 4JI2J 5ETOA 1KNZA 1H2UX 1SV5A 5DM7Q 3C2PA 4QYZK 3IRWP 1BQMA 3I4HX 3RB4A 4DV6F 5B0AA 2WW4A 5JJBA 4ECUA 1S7IA 4CYUB 2OD6A 3SQGA 4DXLA 1JX4A 3MM6B 2HGNA 2FLLA 4HTJA 2QSFA 1SUQA 1JLCA 3V4MA 3A8KA 6FD1A 2V94A 4LR9A 4LF7F 1UMJA 1Y5NB 1LW2B 2GIQA 4EI2A 2YWHA 2FJXA 4ID5A 2N7YA 4DZDA 4C4WA 1HYSA 1CJTB 1RI7A 2C22A 1JNZB 5CD4A 2POKA 1BD6A 4Y2KA 2K2PA 4K4UA 2JLGA 4ZP9A 2OEJA 3THTA 2R7UA 4C8YA 2OGUA 4R0EA 3OD2A 4EZ9A 4Q43A 4GMKA 4B9TA 1F9HA 4DL6A 2B56A 2KYZA 2GVZA 2EBGA 4KGZB 3IRXB 5IFMA 3MDFA 5KT4A 3T5LA 1T7PA 2D3OR 4IFVB 2HAIA 1JNRB 2Z30B 1X31C 2ZM6F 4J9VA 3HF5A 1R8CA 1WORA 1TMJA 2AGPA 2FC9A 4RW4A 2L9DA 5E2QA 2GJFA 1CJKB 3I96A 4X66F 4RZRA 1Y7PA 2A6MA 2M0GB 1FKOA 4CCHA 1QVGR 4LF4J 4QU6A 5F8JA 3KUHA 5SUHA 3R97A 3N5BA 1Y5LB 1X4GA 4A8MP 5K14A 2DYAA 1VBZA 2BJ7A 1SH3A 3CCMS 1IBMJ 3CWJA 3QT5A 2OPRB 4QR1A 1FFWB 2FIUA 2YKPA 3BM7A 3C14A 2UUBF 3O8WA 1AFJA 2Q66A 1IM6A 1DHMA 3EMTA 4AL7A 4H4KC 4KYZA 3MPWA 4QWAA 4M8LA 2E7WA 1Q8BA 1KEKA 3OTBA 2IA6A 1FI4A 1YK9A 1QSSA 2R2UA 2B9YA 5BXIA 4OI6A 2YWKA 2CKWA 5B7WA 1RKJA 2RB7A 3HD1A 4P71A 4JUZA 3CUNA 1FRJA 3VAHA 2IIHA 2HNYA 4RW8A 2KG1A 4EK2A 3GSDA 4HT5A 4DR7F 3KYLA 1FXLA 3OLAA 4HT7A 3CJKA 4ECTA 3AB4B 1JLEB 3D1HA 3FQLA 1QAJA 4I68A 4R25A 2HHSA 3BDEA 1HIYA 5A6PA 3VVUA 3R5AA 3JYTA 5LL6d 2ZKTA 1N6QB 4NZ7A 1UZHA 4DL7A 1RAJA 2F40A 5I42A 3VAMA 3TRGA 4B3MJ 4WZQA 3VV2B 2BM1A 3DYAA 3R9LA 3HHNB 2ZNZA 1FWKA 2HLTA 4ECSA 1I3OB 1T11A 3T9ZA 1QE1B 2KRRA 3MM6A 4ZVQB 4AXJA 3SQGB 2ZBCA 5J2QA 4F8RA 2KT2A 4ZOSA 3SSSA 4X2BA 4OYZA 2IC3A 1B64A 1OWXA 1YVFA 3JYTB 1N6QA 3N5FA 3QWUA 1C1BA 4B3OA 4F0KA 4OYAA 2UZAA 2RQKA 3ITHA 3PEHA 3SYZA 4OX7A 4D3HA 1OO0B 3EXYA 2C3OA 4NE9C 4Y2MA 2QA4S 3CC4S 3DMJA 1A9NB 1VR6A 4J9KA 1U4BA 1U47A 3NY0A 3JSMB 4WP3A 3TVKA 1EIYB 2YWGA 2AZ1A 1NUEA 2NXCA 2YQ1A 1Z4UA 1WEXA 2VG7A 2YY3A 1QM9A 2GW8A 3IWXA 2R8KA 4PYDA 2G2ZA 2HMIB 1FXDA 4LR8A 3FCVA 4IG3B 4LFCF 1WKKA 1MU2A 4K4SA 2CQGA 3M2UA 1H0HB 2VIHA 2W4CA 3QLHA 5ETMA 4ZCIA 4EWTA 4L75A 1Q53A 5LM7E 4D3GA 2B3TB 4JI4J 5KFLA 2E44A 4F4XA 3H4BA 4DCJB 3JB9k 2V4JB 4ZP6A 4WU2A 3PX0A 3DLHA 1CJKA 1UW4A 2VF3A 3CCSS 1R31A 1MN9A 3RB6A 2ZJPQ 4NEZA 2FY8A 3NGDA 3SV4A 1UP1A 1X0PA 2BVZA 2IM0A 4KV8A 2E1MC 4J9NA 5HLFB 2I5JA 1IWAA 3T1YJ 4O3NA 5L38A 3DLLQ 4GKJJ 5L1KA 4KHPF 3J7AN 4X62F 3TAMB 1S0VA 2W7AA 4M5JA 2H54B 4UUWA 1LNQA 4CI0B 4CP5A 2B0GA 4O3PA 4TU7A 1WC0A 4IRCA 2YNIB 4RBUA 4EBDA 1OPZA 1JXVA 3PJ9A 1KC8T 1XR7A 2YKMB 1TL7B 4NOHA 1WC3A 4LSLB 3ZZTA 1NK4A 2N82B 4YP3A 1X5SA 1WDTA 2C2KB 3HHLB 3TR5A 2ERRA 2HVEA 2DISA 2R4FA 4X4OA 4NL5A 3PYGA 2GIRA 4CH7A 1WI6A 3CMES 1B0TA 1RHQB 1RT3A 3UVJB 1U48A 1WSVA 4N77A 2W2PP 1FVQA 1OSCA 3SMZA 3SSRA 3F41A 2UUAJ 5A8WA 2FVQA 4U95A 2MZRA 1FDDA 3UDLA 4C8KA 3U1NA 1RDRA 3MZIA 4DUTA 2VUGA 2MQQA 3QT7A 3HXMA 3A8JA 1FJEB 2J6UA 3MMJA 2BE2B 3BZQA 4IR9A 3NS6A 1GXLA 3MR5A 4J90A 3H8YA 1FKPB 3ENQA 4OV1A 1LWFB 1EKRA 1N5QA 4OIXA 4RUBA 2NXJA 3OHBA 2V8VA 3CULA 3KK2A 4Y65A 3D6HB 5J2PB 3SV3A 3KK3B 1U6FA 2BKNA 3VR1A 4KFBB 3HVRA 2DNNA 5J2NB 1IKYA 1DJ0A 3G8SA 4DR2F 4CQ1A 2OTLS 1X9SA 1NHUA 2QL9B 4I0WA 3GR0A 3DNCA 1BQNA 4RBTA 3MM7A 4LF9J 1MMDA 3OPKA 1NJYA 3K89A 4ZVTB 3TWZA 1KLMA 2XLIA 2J0XA 2NQPA 5IC4B 2PDAA 2WVCA 1HBOB 5HLFA 1WTFA 5F9LA 3DOLA 5KFBA 3NS7B 3F56A 4DSFA 1H6KX 2W2NP 3GCWP 3DI6A 2HHTA 3C66A 1NK7A 2FVRA 1KKHA 1RISA 1RXOB 3DI6B 2P6SA 3HI9A 5L9XA 3TUIC 3UE2A 5A8KA 3PW7A 2C28A 3OVSA 1BHNA 2ZBPA 3G87A 3UN2A 2XGPA 1HW8A 4RNHA 4TN2A 4LF7J 4H4OB 3ZTQA 2XSJB 4E98A 3M7VA 2U2FA 3VQSA 3THPA 3Q8QB 3OUYA 2MZSA 1SC3B 2HQFA 1BWEA 4QIWD 2P8IA 3OFFA 5GADI 5EDWA 4F4ZA 2R8GA 2J76E 4O4RA 2QTWA 4DV4J 1FRXA 4P10A 1U1LA 5M2UA 2X3DA 1XMQF 1DARA 3U27A 1WDDA 3CB4A 5KFCA 1DQAA 3FEXB 1ZAXA 5C2GA 2JWNA 1VJWA 1VRUA 1EHWA 3HFZB 2OPQB 3S01A 4DPXA 1AUDA 3KLIA 2XHWA 3V6KA 1RWOB 2GQ2A 2NS1B 2Y3YA 4L6V3 3AXMA 4DS4A 4F3OA 3C3LA 4LF4F 4OYIA 1DFDA 2BRKA 5DLGA 4TNOA 3PXGa 1NH7A 1FTRA 1EQMA 2UUWA 2VU5A 3CIMA 4YDXA 4DV5J 1XC9A 1H38A 3H5YA 3D6MB 4NLGA 1RT3B 2PMWA 2HFOA 3UVJA 2OPSA 2O66A 1T9VA 3PG9A 4JV1A 4TVAB 4EBCA 4QCLA 1DTQA 2RS8A 1XBWA 4NLQA 3Q86A 3T6BA 3CO0P 4OV6A 1CULA 2MMYA 4RR5A 2ZHBA 3RG6A 3ILJA 2XGQA 4WFBQ 2V8DA 3MCSA 3PRVA 3MURP 1ZOTA 1WNEA 4X64F 4MMOA 1FKAF 3I5AA 2CNOB 3LGNA 3ZZ0A 1VRTA 3QFHA 3I0SB 2YPZA 5GAHU 3TUJC 3NEKA 4PCQA 1KOOA 5GVQA 4NA1A 3NGKA 5HBMA 2HIQA 5EX0A 3OTOJ 1RT4B 2HPUA 4C0HA 1VBXA 2J6SA 3EZUA 4G1IA 5H9EJ 2WK4A 3D0HE 4ZPBA 5E33A 2OMOA 3N0VA 3RBEA 3OTEA 4U6PA 2J0SD 2KDOA 4KGXB 3I31A 4CRJA 1Z1ZA 1OSDA 4OX9F 3N28A 4P9SA 4IDKB 1EZZB 4X65F 3QGGA 4M63A 1ZM2A 4QW8A 3H4DA 2VOOA 1RZMA 3CGIA 2XQCA 1HNXJ 2YWWA 4C11B 2BMBA 4I2QB 4KRWA 3W9IA 5DDRC 5BR8J 2V2KA 2JC1A 2LEAA 2DK2A 2E1PA 4PYAA 1KBRA 3CMAS 3UPFA 2NUHA 4L76A 3DLEA 3W61A 1MWZA 4K2JA 1YITS 3FNNA 2W2QP 3MWBA 2CDRB 1PSDA 1FWPA 4DV1F 3QAEA 1J5OB 1Y00A 1HA1A 4RW7A 3OTDA 6AT1B 4JYAF 1HWIA 4QZVB 1U1KA 2IMOA 2CZVC 2ZOFA 2YH0A 3J7Z5 2BEFA 2DGSA 3OBIA 1XMOJ 1KRPA 3ITHB 1CEZA 4NRUA 1HNIB 2RIJA 4TY9A 3S6EA 1C1BB 2FC8A 2V5HG 2VQEF 4KAIA 3PFOA 4KBIA 4U7UD 2ZVSA 1WEYA 3OQ2A 3MEKA 4M1KA 4DF8A 4V19J 4GKJF 3IGVA 3MF5A 3CDEA 5MAOA 4DV4F 3RGIA 3KLHA 2NXUA 4KR0B 5DQGA 1TZ0A 2VFUA 2IYGA 5FDLA 2FQQB 3TZZA 1RTZA 3BGUA 2ADCA 1D1UA 1HQUA 5G0RB 1TL4A 1YIJS 1X4EA 2LEBA 3PV8A 3VAGA 4ZHRA 5DQIA 5ADZA 3FEZA 1U7LA 1G3OA 2VPWB 2LMIA 2IVYA 1FE0A 3FC9A 4DR5F 2UXDF 4GC7A 3KHRA 5CZXA 5CD4H 3DCAA 3R1LA 2VBYA 2E5GA 1FE4A 2IJRA 4HH1A 3L95X 3SCKE 2LKZA 2E5LF 2WVDA 3H5UA 5T7LA 1E6YB 3X3UA 4LF8J 2JSXA 2H65B 2WBMA 3GG0A 5ETRA 1NKBA 4DFPA 2OH2A 2VQFJ 2N3LA 2LLZA 2I2YA 4DR2J 4Q0BA 1XNQJ 4KE5A 2W7OA 3U7JA 4FN5A 4DSEA 2HNDB 3DHWC 2JLFA 4TU9A 4ILLA 1TR0A 2IVFB 2C1EB 2MKCA 1GXUA 1IM4A 1LK5A 2VFSA 2HWHA 4DU7A 2G2YA 3ILLA 1JIHA 3LA0A 4TKTA 1RYSA 4DOZA 4RU9A 4LFAF 5H9FK 1KN6A 3LO3A 1NDPA 1LWEB 4G1QB 1W26A 3SDEB 2ZH8A 3O2IA 4BS2A 2ZEJA 4NX9A 3G8TA 4P2SA 2KJWA 3LOUA 3I6PA 4YN3B 3F73A 2VOPA 4UQGA 2UXBF 3QRPA 4ED3A 3IA0A 3CEDA 1X5TA 4YR3A 3MECB 4F0HA 5DG8A 2M3DA 4QJVA 4DV0F 2QJ3A 1OMSA 4KSEB 4LSNB 1QY7A 4QPTA 1HARA 3G86A 3L7UA 4ZVPB 3AB2B 1HYSB 4NXNJ 4UQTA 5KFXA 1VRTB 3PEJA 4BCAA 4TLQA 3RB0A 4M94A 1LW2A 1YRUA 2V8HA 2CG8A 2ZFHA 4P7TA 2L9NA 3Q0AA 4DCOB 3VAFA 3PHTA 2NYIA 3M2RA 4F4YA 2RJZA 3T1YF 1VLOA 4I6AA 4YMEA 4CLPA 3MD3A 2E66A 3SI8A 3M05A 3CJQA 2H1YA 4C48A 2Q79A 2G0CA 2B4PA 1RWVB 4Q8EA 4OZ3A 1BQMB 2GMLA 4XIUA 3LANA 3J80U 1N32J 3W3SA 3VAKA 4ZA1A 1E6VA 2YKOA 1UEVA 2HK2A 1W7WA 2J5AA 4N7TA 4FYXB 3NG8A 4K5SA 4OZ0A 4ZDNA 1D0EA 3D4JA 5HANA 1Q1KA 2HVIA 4V1Ak 2O1PA 3OVBA 1UEUA 2BA9A 5CYQA 1S6OA 3BQ2A 2PD1A 3P45B 3TVZA 3R5CA 2EFPA 2QE5A 3OXFA 3CCWA 2VA2A 2QMUB 4ANEA 4KO0B 1TKZA 2CRLA 5T41A 1P8GA 3HSGA 3E2EA 1YJUA 1IKVA 2BR0A 3CD6S 4YOEA 2HNZB 2HWTA 4DG1A 4GC6A 1C4CA 1TKDA 8ATCB 1SJFA 4M95A 1J5EF 1JLGB 4HDGA 1XMBA 1HBUB 2EK6A 4YS2A 4MH8A 4MIWA 1KQFB 4KIAA 5IT0A 4DI6A 2EKNA 3LF0A 4M5GA 3MEDA 3EGNA 2RT3A 3DM2B 3ISND 2FVSA 2J7WA 1YG0A 2SXLA 3W1YC 1D9FA 4BHQA 2DJWA 4QWBA 4C8ZA 2HEKA 2I9SA 4M5NA 6FDRA 1PAEX 2D9OA 3GV8B 2YBVA 2G1DA 4KH0B 4WE1A 4QWDA 3C6TB 3DRPA 5BJRA 3DOMA 3GFXA 4Y6IA 9RUBA 3CCRS 3P6YC 3SCIE 1RHUB 3A8IA 4LBHA 1VQ6S 4KTQA 3BR9A 4YFUA 4CT8A 4K50A 1SBRA 2JLEA 1ZZNA 2MJNA 3R5GA 5C25A 5KFZA 1HBUA 1AZSA 1VBKA 2IRYA 2KYXA 2QA1A 1H74A 3P96A 1FJGF 3KLVA 1IWGA 4DR6J 1F9FA 3HVWA 3BBCA 1FNOA 1IKVB 5D3GA 1RE1B 4LUBA 1AFIA 3OFHA 3CJ2A 3R6GB 3ZTPA 2XM3A 3BO3A 1HBOA 3D9BA 3QGHA 4F2RA 1F60B 1S1WB 5LXRA 2K1RA 1JQGA 2Y1JA 4LRBA 1Q86T 4WBFA 4WTYA 5D4OA 1HWLA 2AHOB 3CC7S 3HX9A 2LP4A 4DUZJ 2H3EB 3JS9A 1VIOA 2OEMA 2RDDA 4KB7A 3UW1A 1E6VB 1UFLA 4CO1A 1VDHA 4EFAC 2W24A 4FYWB 3BGFA 3NGRA 5K20B 3FRYA 3RB3A 1YBTA 2JH3A 3CCZA 5H1SV 2DEIA 2CPZA 1K8AT 1RT6B 4OI1A 3HHKA 3KK2B 5BYQA 3BV8A 2HK3A 4HHJA 4DX7A 2B9WA 2KXNB 4I2PB 3P8BB 1H2TZ 1RK8A 5M2RA 2JHEA 4PG8A 1YJWS 1FK9A 2IBKA 2ZBQA 1S0MA 5L46A 4B9VA 3I56S 1VQ8S 3IC1A 3MMAB 4ZPAA 5KFEA 4OHWA 1XMQJ 1Y11A 4N47A 1HHTP 1ZYQA 1FDNA 1TKXA 4J9LA 1TUVA 2PEBA 2OPPB 4NLYA 4RW6A 2ZM6J 5KT6A 2XULA 5J2MB 3CCJS 1XK8A 1RTHB 2VPYB 3HKWA 5CAAA 3R6LB 5GAGU 1XWLA 5GADU 1X5PA 4F4KA 2HHVA 3K5NA 3IBCB 1XR6A 2Y8WA 2QLJB 4WIQA 1N48A 5JUMA 4IQXA 4A46A 1NK6A 2ABYA 1WHWA 3AA9A 4IO1A 4R8UA 4IG0B 1NK5A 2BUNA 2B6AA 5B0FA 4CLZA 1LWXA 3KJQB 2V4JA 1QVFR 3OVAA 3V6DA 1FFGB 1S6PA 2CAJA 4Y00A 3TAMA 2KH9A 1B7YB 3I55S 5LMUF 1UVMA 3NCPA 1WC6A 4KHPJ 1RT7A 1BXNA 2R8IA 2V2ZA 4FF1A 2B4UA 3O5TB 5IQQA 3B4DA 1WELA 2CQ0A 1GTEA 4RW9B 1TL1B 1UPPA 2CJBA 1EB0A 3KFWX 2VDIA 4JI3J 3AD9C 3I0RA 3ILIA 2R7SA 1KWMA 4LVNP 4B17A 1S6UA 2IJNA 3BYPA 2LA4A 2F9DA 1VYAA 3H20A 3R5BA 3LUYA 3P5BP 1U8WA 2RNEA 3CNQP 1REGX 4J37A 5D4PA 3G4SS 1M1KT 1GMUA 4DUYJ 4HI1A 3FQKA 1T03B 4ZVRB 4Y2AA 3EX7B 4NWBA 3GYGA 4IG3A 3RYLA 2A18A 3VGVA 2DNPA 4BDPA 2FLNA 4AT1B 1UW9A 3MAAA 1S9EB 1PC4A 1H98A 4ZP7A 2DNHA 4DV2F 2VG7B 4RNOA 4B3OB 3FCHA 4PWDA 1WD6A 1N0VC 1R8HA 5G0RA 3MM8A 2WSEC 3OXGA 4ES1A 2C2ZB 4DWIA 4ZJOA 3NNHA 4OQJA 2XC9A 1H7WA 3GILA 5FJ4A 1U0HA 2VG5B 4LRDA 4PPZA 2YKNA 3MCOA 1C0UA 3NKYA 1IJFB 3JSBA 2XSFA 4G1PA 4CTAA 4ZN1A 5HMYA 2UUCJ 1PG5B 2Z58B 4AE5A 3THVA 4PEOA 1M5VC 2RQCA 2KVQE 1M5PC 3LAMA 2AT1B 1TFWA 2QLXA 4P72A 1TL7A 2B8QA 1DBDA 2EFOA 1YBUA 3O3LA 5FLXU 4DV3F 2V63A 2ZH1A 2EC0A 1HLWA 2L08A 4PXEA 2IPOB 2PIIA 5I3PA 4HKQA 1PYSB 3AA8A 3PX6A 2B7CB 2BABA 4UT4A 3T1HJ 2YX7A 3EWGA 5D0GA 4K4TA 1YJNS 2CJAA 1NK0A 4O3RA 3KDNA 1FJ7A 2DHXA 4IQMA 2M70A 3VGUA 2MQLA 3QNWB 4FKXA 4ANDA 4MAKA 4OZ2A 4EU0A 2BKOA 2DIVA 2HKEA 2V69A 4DN0A 1X4AA 2MQPA 4IOCQ 1Q8IA 4ED8A 2RE1A 1X4DA 2AYGA 3MMCB 3L7OA 2QYCA 2QLBB 4P2XA 4UZCA 1HWJA 4B08A 4DPTA 3MAAB 1KTVA 2QA4G 3RRGA 3CJKB 3CJ4A 3AAWB 2HRUA 2XTJP 3M8QA 1D8YA 2VBWA 4GVBA 2R7OA 1FTCA 1XERA 2UV8A 3NWGA 2Z0GA 2CQ3A 1PBAA 2HVDA 1SB6A 1YJ9S 4IOAQ 2G1HA 1EX8A 2K3IA 4NEYA 3M32A 3TA1A 3AQPA 1FVSA 4LFCJ 4XPCA 2GQCA 1U25A 3RAXA 4PQUB 1Y9OA 2JNJA 2ILZA 2LYVA 1VC0A 1RAGB 1RU2A 1NZ8A 2CUYA 2HMIA 1J2VA 3CJSA 2CJXB 1NXIA 2M88A 3EVMA 2RU9A 4L74A 4M5IA 4PWUA 3C14B 3VZIA 1DAXA 1ZA2B 2FDNA 1MLAA 1UFWA 2QX0A 1BLUA 4MIAA 1G1XA 3V2UC 3H2VE 4USVA 4DU8A 1JJ2R 4ZCLA 2FZCB 2KU7A 4GVBB 1NPPA 3CO9A 5KFYA 5HBMB 3BSNA 3G2XA 3M30A 1T8EA 1WG1A 3RJMB 3GMGA 4USTA 2ASLA 2V0NA 3EVWA 1EAYC 2CPJA 1VOMA 3KLEA 3BGLA 4B02A 4RO0A 5KFHA 5IT9Y 3BH7B 1UZDA 3GR1A 3O6QA 4OI0A 3UNYA 2PA8D 1CULB 3UDEA 3ENAA 3R7SB 1RTHA 2E29A 3PKYA 5E0OA 3EE3A 3LGHA 1SUQB 5J1EB 2VONA 1FDAA 1IBKF 1FEEA 3GV7B 3GQCA 1X8DA 2GAGC 2RF2B 3GYXB 1KQKA 5KG3A 2V9WA 3M6WA 4PWDB 2MKSA 2MJUA 2QV6A 3PJXA 1FESA 2QYGA 4M5KA 4OYWA 1JLEA 4ZVSB 3M6UA 4DPWA 2UXCF 2Y9HA 2YNGB 4U7CA 3B78A 2FHMA 3QIDA 2FD2A 1HI1A 3O1LA 3W64A 5IXUA 2YKNB 3NAIA 3QPIA 1NO8A 3FSYA 2XMUA 3MD1A 5C24B 1T3NA 4C3MA 3BGOP 4RW8B 1IKWB 3P4UB 2HHHF 4AL5A 1RGVA 3BQ1A 1KHVA 1GMWD 1NAQA 2JL9A 1GXTA 2HZAA 4P2FA 3RR7A 3ZC4A 4F3MA 1JJ4A 4CLUA 3QO9A 3ADAC 1UJ4A 2KT5A 2HIYA 2UUBJ 1UJ5A 1AB8A 4ZKAA 1G7CB 2RQMA 3GJQB 5AE3A 3TA2A 8RUCA 4I69A 2V4RA 3MHYA 1S1WA 3R8YA 1NM2A 1P27B 2W01A 4B3RF 1J27A 4OJGA 4OHVA 1NMEB 3IBWA 1GH8A 4P2MA 3PYFA 3TUZC 2WAQD 3GJSB 1S10A 2Z57B 4J9PA 4C7QA 3KHHA 3OV7A 2DB1A 2ACYA 4IG0A 3HHEA 1S79A 3DOLB 1N0UA 2BYCA 2YWEA 4CH1A 4W4MA 2PI4A 1I94J 4FZVA 1F3FA 5F8GA 1HNZJ 1FO1A 2CQPA 3J7YI 3K8WA 2ADBA 1RAAB 3QJLA 4KY3A 1S4EA 3VWSA 1RSCA 2Z2MA 1H3DA 1RAIB 1ZAVA 3MPVA 4ETXA 4CLTA 3DRRB 5DDPC 1YZ6A 4FXVA 3S1TA 1RT5B 2ZH6A 5KT5A 2RDJA 5A8RA 1CBKA 4E8UA 2W9BA 3N9UC 2DY9A 1HPZB 1YHQS 1Q81T 1NJXA 1HNZF 3IAM9 3UN5A 2F4VF 3LP2A 4PABA 1NZAA 4USWA 4PKDB 1JLCB 4ZVUB 3I5CA 3PHEA 1HKAA 2J9DE 2B43A 3BN4A 2DHGA 1JJHA 3QYYA 5IC6B 4I64A 4WP9A 3MM8B 1TKXB 2Y0SD 5D78A 3UQSA 1B3TA 1HQ2A 5C5JA 5GAEI 4F36A 3TVYA 4UW2A 1S1VB 5HVGA 1TFYA 1AROP 2B9EA 4B3RJ 2QIFA 4ER8A 4DF4A 4ED2A 4DL0C 2DH8A 4OYOA 2J9EA 3MEEA 2VICA 1RWPB 2GFFA 5F9NA 2K1RB 4PRFA 2HHUA 3CCVS 2E9TA 1NK8A 3W2WA 3ET6A 3G6XA 3UD3P 2ATLA 1M5OC 1UAWA 4L73A 2GVDB 4J9QA 4WYLA 2AJFE 5F41A 1SQFA 2CQBA 2WBRA 2DXEA 2Z4PA 2ZBRA 4Z2XA 3V4IA 2RUSA 1IBLF 1GQEA 3CJ8A 1IR1A 2O3DA 5HJXA 1TKTB 3EGZA 1T3OA 2R7RA 3PIOQ 2ASDA 1HBNA 3HFVA 2QLWA 4F67A 5AXMA 1FERA 1F3VA 1U1MA 4I6WA 2NZ4A 2MKYA 2VPXB 4RNMA 3NBPB 5ETVA 3VAIA 2MSSA 3PYEA 2BJEA 1KVIA 2UUCF 2YNFA 4OYPA 2MHNA 4WTOB 2ZITA 3V4IB 2VHGA 1S1TB 1H72C 2ILYA 3CD7A 3TZYA 4ED0A 2JC0A 4NA3A 1Q0NA 1YJTA 4JI6F 5HL7Q 4UZBA 2OSRA 4NXMJ 4FF2A 3DU5A 1T9UA 3MEDB 3D1QA 4C98A 2ZDPA 4CZCA 1C1CA 2D69A 2OPPA 4HI2A 2E1CA 3NGUA 5HI7A 1F5BA 1ZH5A 3C6TA 2L3MA 2R8JA 1HMVB 2BQRA 2BBEA 4C97A 3FVYA 2C2RA 1W2BR 1N5VA 1S57A 2HBRB 3MMAA 4ZK7M 4DR7J 2GZOA 4OX8A 1YTYA 3DM2A 3GSIA 3JSMA 1D9DA 3EDQB 2E7XA 4LIWA 4RWXA 2BX6A 3CJ3A 2HFZA 2JRSA 4NMLA 1TU0B 4NLPA 2OELA 3UN3A 5B0CA 5IWAF 1JXLA 3UD5A 4F50A 5MLCV 3T1AA 4DL2A 3OTCA 2XG8A 1WOPA 2OI2A 1KONA 5KG6A 2HNDA 1I51B 1YWXA 3QAUA 3M1VB 3PJWA 2PMZD 3J81U 2JJ4D 3QGPA 4BWJA 2XYHB 3TEGA 5IQ6A 4X4TA 4WPAA 4I1TA 2YWFA 3ZZPA 5HSPA 2HRYA 2Y8YA 5D0RA 3ISZA 4O44A 4KC5A 2GMJA 1YI2S 2FUG9 5ETNA 5KFNA 4AL6A 2EXUA 5IWAJ 1HQEA 1CJVA 3ZTRA 3RBXA 1CS4A 4XK8C 1H2VZ 5HQ8A 1AT1B 1TL3B 4C9DA 3UR0A 3WZ0A 5DG9A 1OY8A 4WFXA 2GHPA 3UO0A 1JXEA 4F4AA 5L1IA 2P9CA 4Q5VA 2JOQA 1BWVA 3LP1A 1VRQC 4DCPB 4DQRA 3R1HA 2CPEA 1ZM3A 3I5BA 3ZTSA 4QWEA 2DCLA 1SH0A 2PSZA 2FJBB 2HNYB 4OLPA 4LQ3A 3FBFA 3BPDA 3BSAA 1T0TV 2XZWA 3DLKB 2IM2A 4FYVB 1CQMA 1SC4B 3B54A 5ETLA 2VL1A 1I6JA 3AJ1A 1HPZA 1SL0A 4X4PA 1ZPWX 1V5VA 4ZMMA 2M2BA 3MMBA 2DRAA 4JI2F 1BMQB 1RT5A 2HGLA 2UVWA 1V3SA 2K8GA 4NRTA 2J7UA 1NCLA 3CCES 1FRMA 5KFMA 1NJZA 3HD2A 3H40A 1YJ7A 1RADB 3LQVA 2ROPA 5H9FJ 5HROA 4FS1A 1NK9A 1HNWF 3OR2A 1P9YA 1RCXB 1F0XA 2FVPA 1HNVB 1KTQA 3D3BJ 4JYAJ 4ANCA 2H5EA 2ZC4A 2HS3A 3HZGA 3R27A 3CCLS 2OEKA 2GQQA 3LPEA 1N5YB 3CMQA 1PJ7A 2AYMA 3DOKA 4J7CA 4I4BA 2N7CA 2DH7A 3C15B 4KKOA 1U1QA 3PRDA 1WSRA 1ZZFA 1ZS6A 2D41A 2AEFA 2LQ5A 1VGYA 3GV5B 1TKZB 3EJMA 1T94A 2YKAA 4TQRA 4ZLPA 4NLXA 3X1LB 2NSCA 4K4YA 2KFZA 5D0HA 1T9XA 4JI3F 4K59A 3AT1B 2RD5C 1ZPVA 2P9EA 2UXDJ 3UCGA 1IQTA 3QO9B 3MMBB 3BJYA 1NPRA 2LFVA 4LREA 4MKBA 4O23A 1O0PA 1AXQA 1X4FA 3LH2S 3SXLA 3DLKA 1HQUB 4GO7X 5F8HA 2DNYA 4DR3F 2AD9A 1R43A 3EM1A 2PO4A 4LQ9A 4LF8F 3LWMA 1S72S 3I32A 3LW5C 4Y3CA 3AHPA 3M2RB 3A8EA 3KWMA 3KJVA 2F3JA 3RRHA 1DRZA 1UVKA 3GZ7A 1I94F 2CQ4A 2HHQA 4FXDA 1PJ6A 1XNRJ 4IYQA 5LXYA 1RTJA 2A2CA 1R0AA 3DRYA 2HHWA 2AWZA 2OFHX 2CPIA 4MKAA 3MPUB 2V9KA 4X64J 3RTVA 2CVEA 3M9MB 2LEPA 2DNZA 5I4MA 1HHQA 4B9MA 2JX2A 2ZHOA 2HHXA 1DTQB 3A12A 4ETZA 1J5EJ 3D68A 3OL7A 4KHMA 1EJ7L 4UOCA 5FD1A 5A6WA 3EGWB 4DLGA 4LF9F 3KNAA 1OQ3A 1UETA 1TK0A 2ZUGA 4UOHA 4OMFG 4S0MA 1NH8A 3PO4A 1PAUB 3DLGA 2B8PA 2DHAA 3I9ZA 3CF5Q 2DO4A 4OJ1A 2FPHX 3IMQJ 1N5YA 4FBTA 2MY8A 2W2MP 4BBYA 1SQEA 1F2HA 2ZE2B 3UDCA 2CJ9A 3CCUS 2XS7A 1L5UA 5HAOA 3W9HA 3CSKA 3FK4A 4PG7A 5THWA 4O3QA 3OHAA 1U1NA 1CLFA 4ZIWA 3BREA 2VD3A 2OPQA 2PE8A 3OSPA 7FD1A 3C19A 4X4SA 1I5OB 1SVDA 4TYAA 3SIPB 2FJAB 3JQMA 2QGFB 1JLQB 5KFUA 4FF4A 5D77A 2WB4A 3AODA 3V6JA 3JSYA 4RJVA 2DT9A 5IV3A 1HNVA 3W5XA 5H9EK 3AJ2A 3HK2A 4GKKJ 1FHTA 1KDNA 2CWXA 2FLOA 3DRSA 1E6YA 3CXCR 1WUUA 2HURA 4IDKA 5C42A 3G6VA 2F4FA 2VASA 4AQYF 1VQSA 2V2QA 2JEFA 4OZ5A 4NCAA 4PWWA 4R5PA 2MY7A 4QIFA 2Y1LB 4DBQA 1X5OA 3M6XA 2RAQA 1JWWA 1RKIA 1GX6A 4IR1A 2CJQA 2VZ9A 3MTJA 5B0EA 3NMAA 3K0JA 2BXJA 1O51A 5KFDA 1XR5A 4DR1J 4JI6J 1KLMB 1HBNB 4QQBA 4NXMF 2PGCA 2BKPA 1U2RA 2A3JA 1PILA 1S1XB 1VQYA 1B0PA 2ZZTA 4MK8A 2D3O1 2W9AA 1BQNB 4A47A 3IS9B 5KG7A 2ZZMA 2CNKB 4ECZA 1FF2A 1N34F 4RNFA 3PKMA 4QYZJ 4BC9A 2FB0A 1WC1A 4Y0FA 3K5MA 1IBMF 2HVHA 1KQGB 1HNIA 1NKCA 4JI1J 2XMWA 4URGA 1PBUA 4ZLLA 3E01A 3EZOA 2DHHA 1FKPA 1RTDB 2BRLA 2DGTA 5A76A 3GB0A 1NEEA 1RWXB 3OL8A 1UVJA 3KLIB 3HZEA 5GMDA 1N52B 2M5YA 2QC3A 4Q7AA 4DX6A 3Q8PB 4K4WA 1N88A 1S1VA 1C4AA 5EHHA 4FYYB 2KHCA 3T6JA 1XNQF 1HMVA 2QFIA 2AJ2A 1RWUA 2DR8A 2C3PA 3C16B 4N41A 1VS3A 2PA3A 3KG1A 1GAOA 2NCKL 3H25A 2FHJD 2FHJA 3ENWA 4EO8A 4LF5F 4J91A 1VQNS 4N76A 3G8QA 3QT8A 3HHLA 2VG6B 2IY5B 3QRQA 3CT9A 1MG7A 4YB5A 2PMHA 4F7VA 2FVCA 2VB6A 2IAJA 3JTOA 3KDOA 5E3QA 3ZO7A 1QUPA 3DRRA 1Y0HA 2EFNA 2QZ8A 3IM8A 2IFXA 4QOTA 3ZZUA 3SQOP 2B51A 1U2FA 4CH0S 1V6HA 1YBAA 5DQHA 3KK1B 3VHQA 2C3YA 2HYIB 5RUBA 3N4WA 5DO2A 4DR3J 3MM5A 5ETTA 5BYRA 5IS2A 5ITHA 4X4UA 2AQ4A 2BV3A 3VF0B 3N6LA 1B0VA 2A1BA 3FSIA 2XI3A 5KFAA 5CA5A 5L1JA 3S7RA 2WTFA 1VQPS 3FKBA 4IH7A 4ZVOB 4CO4A 3MCNA 5A8KB 5J1PA 5IT9U 3IFEA 1V3ZA 1BQXA 2FYXA 3I0SA 2H9ZA 1REVA 1BUXA 4TY8B 2MGZA 1RP5A 1N4LA 4R8UB 2AJQA 2GVDA 2HSEB 2V50A 3MEGB 4IFYA 3UDVA 4RLEA 4QIEA 4PG5A 3TJ9A 3OFGA 1NHVA 1S4FA 3W60A 4FVMA 4CM2A 2LQJA 3MOJB 2OFGX 3HHLC 3US5A 4M5HA 2KVIA 4WFZA 3KK3A 3EPGA 4F2SA 4CT9A 2RDIA 5LSLA 1BC6A 2WW8A 3GYNA 1TKTA 3DFEA 3F0NA 3ZFVA 3OL6A 2NZCA 4RNNA 4DUYF 3CD5A 4DL3A 2Y1IA 2C2DA 2LVWA 2Z2ZA 4UOFA 3HMJG 3RW7A 4JI7J 1FRHA 3D3CJ 4LRCA 4ZPDA 5AXLA 3LP0A 3C16A 1NSKL 2XY7A 3W7BA 4IH5A 3G6ES 1RABB 2YNHB 4I6YA 2CYYA 3QQCD 1G4CA 4PXCA 2DRBA 1TQLA 3HJFA 2KFNA 4RKUC 1NSQA 2EBEA 3HFKA 1K0VA 4ED7A 3CDWA 4F25A 4OX9J 3W2VB 3TJ8A 2RHQB 5C7PA 2R2SA 5B0DA 2ZH2A 3TZXA 3PW5A 5A8RB 1YX2A 5K8OA 1IN0A 1DQ9A 1TVRA 1PKUA 3OJSA 1NDKA 2RILA 3FUYA 1WI8A 3IAS9 1JLBA 1U24A 5F0WA 2R2TA 1UA0A 2B7BB 2DEJA 4AYBD 3VALA 3MR3A 3FDSA 4MIBA 1NDLA 2OLWA 3KHLA 3HHDA 4UOGA 5L9NA 2W8KA 3FSXA 1DLOA 2QMXA 3MEGA 2DR6A 4C3KA 3TX8A 3ICLA 3S8SA 2A10A 4L3KA 2VFVA 4LR7A 3M30B 3OJUA 3RZAA 1N33J 2AYEA 5DGBA 5K9FA 5C42B 3W62A 1SCJB 2RH3A 3MM9B 2I5JB 1Q5YA 4PG6A 4X62J 5AJ3F 3MAQA 3TAPA 3TJAA 2B5JB 3VAJA 3HSDA 5KFJA 1Q7LB 1Z2LA 4DV6J 3PFEA 1ZTTA 4P73A 2IA0A 1MMNA 3NGTA 2ACMA 4Y2CA 3GG1A 3NMRA 4Y2IA 1QAYA 3I4PA 1Q4RA 2M7SA 3HVTB 3VZHA 3KMQA 1SKRA 3CE8A 2IAJB 4J5OA 4J9RA 4DUZF 1F1BB 3QJJA 2EG2A 2C42A 2F8MA 3GJRB 1SIWB 2KZMA 2NXEA 1LWFA 3H90A 1AYEA 2CQ2A 2ROEA 3EVOA 1RAHB 4K8RA 2ZOGA 4HACA 2K7KA 3WHIA 3FMBA 2X1FA 2N4DA 3UD4P 5D15A 3TA0A 1R0BG 3V5RA 1JLGA 1RYRA 1SL2A 2CZ9A 4KGMA 5DLFA 5JMNA 1FJCA 3D0GE 3F44A 3R2CJ 4DQQA 2QFJA 3ZNJ1 2I38A 5E5NA 1D8ZA 1IQZA 2BE9B 2X1BA 4QWCA 2CPDA 1IBKJ 4DR4J 2GHWA 5A0YA 4X65J 4ZS6A 1RT1B 2CXEA 2R8HA 2AV5A 4ZP8A 1QD1A 3AH6A 3GPAA 1HNXF 3DYAB 1UWAA 2ALZA 1QJHA 2YNGA 1S97A 3V6HA 3NCQA 4YB7A 4NCBA 2V6AA 4FKYA 4LSLA 1WG4A 2NR0A 4ZJLA 3DC2A 2HFNA 3L09A 3BSOA 4EGLA 1VMBA 1YKWA 1VQKS 2IC3B 4ELTA 3Q2TC 3WC2A 2VH7A 2BW7A 1K1QA 1UKUA 4B9SA 3CJRA 9ATCB 5D4LA 1NRKA 2OUGA 3ZXWA 2MLYA 2Z2YB 3TW0A 3RBDA 5KOWA 2PI5A 1VIXA 3T1HF 1B70B 5F0UA 1F9EB 3NLCA 1CG2A 4DX5A 3RAMA 1MMLA 2X3GA 1RLDA 5I42B 4ECVA 1JKHA 3PR4A 4NA2A 1JLFB 3V81B 1B7FA 1SJ1A 2XI2A 1BGXT 1FCAA 3Q8SB 1OPIA 1NU4A 1S9EA 2ZVIA 3N6NA 2KRBA 2MQOA 4QYRA 3QSYB 2G0JA 1SH2A 3M4XA 4JV5F 5SZTA 3BSCA 4JV0A 1IBLJ 3M6VA 4DZ6A 4R0JA 5ETKA 4ITSA 2XS5A 2OPRA 5AE2A 1F2GA 3W65A 1VQLS 1U6ZA 4GO5X 4NI2B 1ULRA 2B4VA 2XBPA 3GLJA 3WQPA 3RW6A 3Q22A 3QLHB 1O5JA 2ZDOA 3RUBL 2NYHA 2W2OP 4RU2A 4OHYA 1VJQA 2DNKA 1PIEA 1RAEB 2F8HA 1D9AA 1H73A 3DU6A 3M8QB 1TL1A 1HBMA 2W25A 5L8RC 1T05A 3FJ2A 4EZ6A 4IRDA 1S99A 3GJTB 1T05B 1U02A 2CQHA 3MMCA 2M9KA 4HVZA 5CYMA 1K44A 4CLKA 4FYDA 2Y1RI 3MFIA 2WVBA 3FBEA 3JQKA 2GO9A 3BH6B 4A8OA 2FHOB 4KPCA 5EUHA 3CW2C 5K14B 3A4TA 3KKFA 1R0CB 4NPOA 4NLDA 3G6YA 2DNGA 3ETOA 3OR2B 3V6DB 4FNHA 5HATA 1DTTB 2XYPB 1X4BA 1PGZA 5D4NA 1KQSR 3H5SA 2R7WA 1WTBA 2F4VJ 4JI5J 3R5JB 5CABA 1LFPA 4N56A 3V81A 3G9CA 4ID5B 3N6MA 2UUTA 1WEZA 4Q2MA 3T5JA 4JI0F 5F8LA 3TYTA 4IFVA 5AE1A 4ILMA 2HFVA 4OX6A 2FHKA 1VFJA 1MWQA 4TLRA 2HS0A 3QATA 3SFGA 4DL4A 1QE1A 2NREA 1C0UB 1R8AA 2DNMA 2E5IA 2BJ1A 1U0HB 1Y3JA 2IDLA 2VG5A 2OO4A 2DIUA 4M5MA 4RW6B 1S0OA 4DPUA 7AT1B 4USUA 1S6QA 5DDQC 1L3VA 2PFFB 1TVRB 3I9V9 3ZNUA 2XO7A 3FBBA 2GMHA 1ZTWA 2ZKUA 3DXSX 4ES3A 4PZVA 5EGYA 5KFPA 2IRUA 1NNDA 2GO8A 2Q6CA 2ZH5A 1TL3A 4BC7A 1U8SA 5B0BA 2P6TA 2VV5A 3DGPB 3P5TL 2MTLA 4YHHF 5FDLB 2XZDB 2BJ9A 1SJQA 4ILRA 1CVJA 1XJWB 3FBCA 2QO3A 1F5CA 4OJHA 3NXZA 4HTIA 2YNHA 3NP5A 1S12A 4LSZB 3I0RB 4C6AA 2CWKA 1PO6A 3Q8YA 2JDJA 3WX8A 5KFTA 2HGMA 2WB1D 3HVAA 1U26A 3OXLA 2O5DA 3NS5A 1L3TA 2W9CA 1CC8A 5KFWA 1N54B 2LU2A 5KFRA 5I3UB 2RHSB 3LALA 1R8BA 3KG0A 3TANA 1SKWA 1DZ5A 2XLKA 4FBUA 1R27B 3EZ5A 5LMNJ 5T14A 3CDBA 2DR9A 2J6TA 1KVKA 2WZ1A 3PNIA 4ED1A 3JQJA 3D66A 4AFFA 5GAEU 2CQ1A 2MZJA 4WJBA 5J1NA 3SEOA 4IUFA 2UUAF 1M1GA 1REVB 2GA7A 3C15A 3AFGA 4RW9A 4TY8A 4XDDA 2RRAA 2KTQA 2FJVA 1WWHA 1HW9A 1T9WA 2B5JA 1WACA 5KFIA 1LK7A 2F8EX 4C8NA 3TX0A 2X1AA 1YGYA 1NKEA 4DR6F 3JAMU 2H5JB 1VK8A 3KUGA 1PJ5A 4TU8A 2MQ8A 1YSJA 2E7VA 2UVRA 1U49A 4FP9A 1CJUA 2DY1A 3L7PA 5KG4A 2DGVA 3CCTA 4OZ1A 2XMMA 1VQ4S 3NOCA 4NCGA 3G82A 7FDRA 2BACA 2C2OB 2KO1A 2NSBA 3POTA 5GAHI 4QU7A 2KZZA 3DLBA 2NUUG 3BF4A 3SCLE 4B9NA 3PDNA 1RACB 1SPBP 3AQOA 1TAUA 3J80Y 2DR5A 4K4VA 3Q2SC 2G4BA 4NYOA 2MKKA 1HR0F 1VC5A 4M5DA 1QAXA 4TXSA 3I82A 3KJFB 2CFXA 3GE9A 3M8PB 2JFDA 3D67A 1RCOB 4CLFA 1R89A 3IR6B 1RWNB 1RLCL 3DXBA 2AP6A 2Z2LA 4NZ6A 1CPZA 1Q8KA 3EXCX 1WOSA 3GCXP 5DJBA 5D0EA 1T02A 2MEWA 1N56A 1TMMA 2J9CA 2AU0A 1YZ7A 2JVRA 2Q43A 2R7XA 2ASYA 4I67A 1NDCA 4MJKA 5DETA 3NAHA 4RUCA 2ATCB 2HQGA 2U1AA 1ROFA 3HP6A 4DFMA 1WF2A 1GEHA 5CYQB 1K73T 3Q24A 2D1CA 2WOMA 4FPRA 4UY8T 3EDRB 3J7A1 3DHXA 3AD8C 1N36F 3HKZD 2Y0BB 2HAFA 1WKJA 3ILOA 2MZ1A 2NPFA 3BBBA 1IR2A 2CPFA 3LGMA 1RT2B 4C2MA 1EQ0A 2HS4A 4ZCMA 4MYTA 3ETMA 2G9OA 1FJGJ 3IR7B 2HG4A 5BR8F 1S1XA 3EICA 4OHXA 2JEIA 4MKVA 5KG1A 2MSTA 4U9RA 4MK7A 1AW0A 1VLYA 3JXOA 2GJ2A 4LT6A 3MFHA 2HWIA 2FGCA 2KM8B 1S59A 4MT1A 1NJIT 4JI1F 1GMWA 3H2UB 3LTOA 3W8GA 4W90B 3KOAA 2HW3A 1U45A 3QWPA 1TAQA 2J8SA 2YTCA 1FFSB 1RHMB 5IM0A 3P49B 3IG1B 3MI7X 1HD0A 1H7XA 3E3XA 4PXDA 2MXYA 3PIPQ 3OSNA 3G82B 3MECA 5LJ3Y 4DHVA 1JJCB 4NMXA 4Q2LA 1ZBTA 3K7RA 3ZTOA 1SQGA 1MWYA 1UTAA 2P9GA 2R9LA 3OUYB 1Y4ZB 1VBYA 2V34A 4IH6A 1RBLA 1S1TA 2YQ3A 8AT1B 4MFBA 3OTOF 2F65A 3DOMB 2GV1A 1NSPA 4WE1B 2LQBA 1GMVA 3ONQA 4NXNF 1ZM9A 2V67A 3SDEA 2VDHA 4ZLJA 5EWGA 2Z8QA 4ECRA 4AQYJ 1T9TA 1TK8A 2CPYA 3ENVA 1LFWA 3KTQA 1PC5A 4C0OC 2JFKA 2OD4A 5KFQA 4F02A 4QW9A 5JXSA 2ZZNA 2CADA 2CZ4A 4MYUA 5KT7A 1QSLA 1S77D 1RA6A 5I3UA 3PY8A 1EP4B 1HD1A 3MM7B 4LVOP 4RX6A 3B6BA 4ZITA 3LWLA 3BO2A 4JI8J 3NNCA 1M5SA 2KT3A 1A6LA 1YJVA 1OJ4A 2GGPA 4ICLA 1RJJA 1IUJA 4USKA 4PR6A 1KFDA 2RVJA 1AUSL 1IXKA 5L39A 3T5HA 4KO0A 3CJTA 3ULHA 4RPFA 2KL8A 5KAKA 4RBVA 5J2PA 1UVIA 4OI2A 2ZWOA 1LWCA 4K4ZA 1YLXA 4NYPA 4OZLA 4KGVB 3BQ0A 3CIZA 2O01C 3C46A 3MPYA 4OI4A 3B82A 3SCJE 4ES2A 2XMKA 2VBZA 4KJIA 1VI7A 3IS9A 2HVZA 3NGSA 1GT8A 1FXRA 3MR7A 1B99A 4NLOA 5A8WB 3KJVB 5DGAA 2RF2A 1S6QB 2XWYA 2ZH7A 4LF6J 3BDPA 2UXBJ 1TELA 2D9PA 2AJ1A 4FDFA 4OYBA 4CO2A 2FZGB 3JTPA 1FRKA 2I0XA 4OJ3A 1M90T 5EX3A 3W63A 4WFAQ 2V68A 2Z56B 1FWLA 4QR0A 4WYWA 3TNVA 4OZNA 1MROB 1CSJA 3K5LA 4WCEQ 3PW4A 2VQEJ 2YX1A 2ZD1A 3OW2R 4UY85 3HT0A 3WDOA 4JOUA 4Q8FA 1UA1A 2UVUA 1LWEA 4G1QA 4WU3A 4NCGB 3OT9A 2AEMA 2XB2D 4P6QA 5I3QA 1CC7A 1DTTA 3DRSB 4L72B 1UCNA 3GIMA 3K17A 1NB2A 1IKXB 4YR0A 2OSQA 1ZETA 2P5VA 5AXNA 2EG1A 2EKYA 1VQ7S 4KKOB 3I87A 4USHA 1LXNA 3BGRA 1HWKA 1P9QC 1PYOB 4QIGA 1RHKB 1HI8A 5AT1B 4CWBA 5K8NA 3KLGA 3TP2A 4DL5A 3KLGB 3OL9A 2GCFA 5HK4A 2MKHA 1S1UB 3G71S 2YH1A 1NBEB 4EYHB 4KGKA 2JEJA 4B3TJ 1UL3A 2KI2A 2ROGA 3E51A 3M32B 5CHCB 4YEAA 4WFNQ 4PXBA 4MTPA 4WKRA 3D7SB 2EPIA 5HP1A 4UUXA 4ZVGA 1QUVA 2HBZB 3H59A 2A2DA 3DLJA 2GNKA 4NLWA 2F1FA 5BYSA 2BOPA 2DXFA 1QTNB 3GIRA 5CYMB 2FJWA 1P6TA 4DR5J 3ELHA 5KTQA 2QN6B 3R7BB 4Y28C 1OS5A 3P3DA 4E2FB 2HQIA 4Z37A 2VKRA 2LQ9A 1UWBA 1FRLA 4Q0BB 2HHPA 4ZHRB 4HEA9 4DR1F 1PCAA 5CZVA 5F8IA 1FNXH 4E0DA 2DXDA 1RT4A 4TQSA 1W25A 2L41A 3EYZA 2BM0A 3C6UA 2V8GA 3KLHB 1FEHA 3PM9A 3DMJB 2RQ4A 2ZWPA 3JAMY 5HQMA 5DG7A 4DFKA 2OJ3A 2FJEB 1R0AB 3IM9A 3N79A 1Q7YT 2QG9B 4OHZA 2VJUA 3OR1B 4U96A 1KP6A 2RMLA 3UCZP 4DQIA 3UNGC 3K58A 4NLUA 3EPIA 3KUEA 1JMTA 1S76D 3SBMA 3PX4A 3MUTP 1LWCB 5LOQA 4CTAB 1C2PA 4USIA 1RQ0A 2PC6A 2X7IA 3JSRA 3ZZRA 3PYDA 3FGVA 1RT1A 1WC4A 2DNQA 2GIFA 4KT0C 4O44B 1FX4A 1R8PA 1EETA 4WKYA 2JEGA 2QEXS 2WVEA 4X4VA 2EFVA 1FNMA 2C2NA 2YX4A 3AXKA 4O4GA 4C8LA 4CLSA 4BLGA 4DSIA 2WONB 2MB0B 1MNEA 3KLEB 2HQDA 1CQNA 1LW0B 2RKIA 3DDNA 4YY3J 1S0NA 2DR7A 1SXLA 2Q6BA 2MQNA 2NXNA 3VCDA 1K47A 1RA7A 2GX8A 2J9DA 4DMZA 3QFWA 3DDIA 3Q89A 4OYMA 2G2OA 4C11A 4ECQA 3JTNA 1K9MT 1IR0A 3VVTA 3IN5A 2DNOA 1J5OA 3GFZA 1VQOS 4LBIA 2W4DA 3QJPA 1D3WA 3A1YG 3PRBA 2K06A 4ED6A 3T9NA 4F04B 3M9NB 4B9UA 2EEYA 2IM1A 5K5MA 3DLEB 3NWRA 2B4OA 4JB8B 1Q79A 4K0KF 3DOKB 4H4KA 3KMSA 4JV5J 1RHJB 2YQ0A 1RWWB 1HBMB 1NLKL 4OYXA 1F6TA 2AYBA 4JV2A 1JLAA 4I2QA 2XWXA 3PR5B 3SSQA 2AIRB 4USMA 4ZLNA 3G96A 2ZJQQ 2H4YB 1N32F 2HBYB 3TQ1A 1FA0A 3DKDA 3FFIA 4ID8A 2EI5A 5ETQA 3HVTA 3M8RA 3MAHA 2H5IB 2XMJA 4A8QA 2H4WB 2VC0A 4ZPTR 3KXDA 4ATNA 3NBPA 2K3KA 4CO5A 2DPIA 4RW4B 2AGOA 1QAIA 1JLFA 1UEKA 2N3OA 2IDEA 4LIRA 4LMZA 1WOOA 2BOAA 2IYIA 3PACA 1TUWA 3GONA 3IRXA 3DDKA 3PTWA 2V4QA 5J2MA 3W9JA 4C3LA 5HQLA 1QDUB 1WHYA 1RT2A 1ITPA 2OPSB 2F7VA 2QLFB 2DHSA 4LFBF 1DLOB 4NLRA 1RWMB 4W92B 4LFAJ 3H5XA 3PZPA 2GAHC 3BPSP 2CQCA 2CG4A 3NOGA 1RAFB 3SZ2A 1U1OA 1CJVB 1HQEB 1M0SA 2OP5A 4P7VA 1KFSA 1WC5A 1FK9B 1WHXA 2XO6A 1DY3A 2EK1A 4DX8H 4I2PA 2BE2A 2FTRA 3J7ZT 3OFEA 1S9FA 1O8BA 4RWWA 2WSCC 3VTIA 4ERDA 3MOZA 1L3SA 2UP1A 4A8KA 3MPDA 1U0SA 2G13A 2QT7A 4ZVEA 1ACMB 1S7HA 4RUHA 3AD7C 2FY1A 1GTHA 1Q78A 4I7FB 2BJ3A 3HJVA 1FT8A 2W4PA 5G4DA 2OKQA 5KG5A 4NLVA 3M8WA 4HACB 1FRIA 4KHRA 3MXHP 1TV6A 2ZBIA 3TOQA 3D6FB 2GJIA 2IJFA 5HMZA 1KVJA 4H4OA 4V19X 1EKSA 4ZIVA 2KG0A 2CNNB 1N33F 2AEJA 2FJDB 4A8XA 3RRKA 5FLXY 3KLFA 5JVHQ 1LXJA 1YRTA 5D3GB 2DTJA 1R6VA 2FLPA 2MGZB 3UR3C 2CJKA 2YNIA 2C3MA 2HLUA 1JB0C 5D8HB 3BKFA 2LDIA 1ICEB 1LQ9A 1CJUB 1WJ9A 2VPZB 5KFFA 2KXFA 4J9OA 5D6GA 4CLLA 1LV5A 1AZSB 2R7VA 4HR2A 2CPXA 4DSJA 3BBFA 4NLTA 2DGXA 3W5ZA 4ZCKA 3MUMP 4OZJA 1S6PB 2YVSA 3HHLD 4FPIA 4CLWA 2XEXA 2YNFB 1N5TA 4OI3A 4PG4A 4U8YA 4IFYB 2IBOA 4C0BA 2XMAA 3IBFB 4LF1A 4LF6F 1A0OB 4WF9Q 4J9MA 2B6AB 3CCQS 2YKQA 3DRPB 2BQ3A 4JI5F 1WG5A 2IVMA 2LQ8A 4ZJQA 4CIOA 2XCPA 4A8SA 3KLFB 3CDAA 4ZVFA 3MR6A 4KFBA 4HHHA 1FDBA 2X51A 3FZ2A 4G3IA 2ZUAA 3U1MA 4QBUA 5KFGA 3TI0A 4ELVA 3CTRA 4URSA 5HJYA 3A13A 1C0TB 3MM5B 2VG6A 4A4JA 3WIUA 3QBCA 2NLWA 1TV6B 2E1AA 1NHKL 1XMOF 1JLBB 2VFRA 3C8YA 4JI0J 5DZ6A 1JLAB 2BQUA 2V2VA 5E3RA 2I1RA 5IV4A 4DV1J 1SI9A 3KJNB 4QR2A 4F3QA 5M2PA 1RHRB 2WSFC 5KG2A 4WWSA 5EWEA 3MTKA 5B09A 3M9OB 3TARA 2AJ4A 4JI8F 5HVHA 2WRMA 3FCWA 3W2VA 2BZ2A 3RBZA 1TUGB 4KQZA 1XIQA 5FIIA 1RTDA 2RUGA 2A6OA 4FXWA 4XO0A 4UF4A 3PW0A 1Z2ZA 4B3TF 3IO1A 2EVZA 2MHEA 1KOHA 3QGIA 1FX2A 4Z7CA 5CYJA 3Q8UA 1X9MA 2XMTA 2YKMA 4HL9A 2CQIA 4O0IA 3QSIA 4Q44A 3GU0A 2VA3A 3LP0B 4LBPA 4JI7F 3T41A 5J2QB 2EFGA 2FZKB 2JVOA 3DN9A 3TAQA 4FF3A 2MDAA 1URRA 2XS2A 2XLJA 1OYEA 4IRKA 1C0TA 5A2QY 4ECWA 4N8OA 1N8RT 2UVVA 3GFYA 3DRXA 3MGJA 3Q8RB 1K1SA 4HLBA 2H51B 3GFHA 1SC1B 1KR4A 2WVFA 4KV8B 4N8NA 1U1PA 1HNWJ 5DS7A 2B9XA 3CC2S 1LKZA 4K7QA 5U47A 1KS2A 2XMVA 2I6WA 2E5LJ 4O0NA 5E3CA 4LFBJ 3EGVA 3W66A 5GMKa 1SIZA 1VC6A 4DQPA 3FMWA 2P2CB 1O6XA 3W5YA 3H2LA 4JBCA 2PN6A 2HRTA 4F0MA 3BKTA 3M8ZA 5F3TA 4USJC 2R7QA 3M8YA 4DS5A 3FEYB 2QA2A 5C25B 3FRZA 3TQEA 5LJ5Y 1G2EA 1ZA1B 2EW9A 3D5MA 3HM9A 4RL1A 2KM8C 1IVZA 3GP9A 4HHUA 4ZVHA 1G6BA 3KK1A 4CO3A 4K0KJ 2DO0A 2E5HA 4DV2J 1X9WA 2BDPA 4CO0A 3DGVA 4O3OA 1R3NA 1D09B 2MZTA 5HVFA 4R5PB 5LT5A 4PQUA 4LRFA 3ZZYA 4QPXA 2AF6A 1HL6A 2BANA 2R2RA 2XYGB 3R5DA 3BEGB 5F8MA 3TEHB 3AOAA 2YXLA 5K8MA 2QL5B 3EUNA 2I8EA 4O3SA 1WF1A 1YRXA 3NCRA 1S1UA 4Z7YA 2VJVA 4L3NA 3A3PB 1V3RA 3DLGB 3K59A 1KD1T 3CVKA 1URNA 3N01A 2F5GA 1N36J 5L1LA 2C2MB 3NRBA 3WIVA 4YUDA 1V5IB 4IO9Q 1JKHB 1FD8A 1M5HA 4X4NA 3CPWR 2GC8A 4EYIB 1B4SA 1IKXA 1RWKB 4IKAA 4Y34A 2Q3PA 2GVZB 3B4MA 3T19A 4YB1P 5LSRA 1HR0J 1A7GE 1T95A 3UI3A 3GIIA 3TO8A 1HHSA 2AKWB 3BR8A 2NPIA 4AXIA 3QMQA 1LW0A 2RKIB 3T3FA 2IM3A 1S49A 2WONA 1MROA 2CIMA 1ZAWA 5A2QU 1VHFA 3OR1A 2EFQA 4WFYA 5IT4A 4X4RA 2ZH9A 1EETB 2MPUA 3U1LA 4B3SF 1SC6A 1RAOA 4DEZA 1F5AA 2ZH4A 1U1RA 2LA6A 3E8OA 5J1EA 3HPOA 4FNIA 2BE7D 3BN7A 5A0YB 2DRDA 4DPOA 1UVLA 2XHCA 2DPJA 2WHOA 2X1GA 5KFSA 2QRRA 4ZN3A 1XQIA 3WC0A 2ZH3A 2APOA 1RTJB 2ZNYA 3GTYX 2E9RX 1NPKA 5E7OB 2OTJS 1DQ8A 5LMNF 2CNLB 2D74B 3W8PA 2EWHA 3D28A 2KN4A 2DGWA 1MN7A 3UWTA 3T5KA 1VQMS 2MQMA 2VFTA 4CM0A 1K0TA 5K8PA 4A8WA 5HP1B 3FFIB 4GKKF 4DFJA 2DGUA 1ELOA 4RW7B 2VC1A 1RU1A 4CDIA 2C2EA 2CVIA 2R42A 2OIHA 3D1OA 2E9ZA 1IJEB 5CH7B 2LXUA 1WHVA 1S9GB 3LAKA 4FVCA 2XCAA 5JVGQ 2G0IA 3IXQA 1OQ6A 3BGRB 4WK3A 5CCMA 2L9WA 3ZZOA 5EWFA 4KH1B 1LEOA 2ZHAA 2VQFF 3MM9A 2W1BA 2GHVC 3GIJA 2CA9A 1MSWD 1S5ZA 1VK3A 5DDOC 1RBOB 3MUVP 3K57A 4DV7J 2DITA 3Q8VA 2ALYB 1OYDA 1FKOB 2XZTB 3AOCA 2ZE2A 2M52A 4G65A 3GWCA 4YY3F 5DRKA 5KFKA 3AOBA 3HLUA 3MCMA 4ECXA 3RU0A 4CLYA 3TZWA 2W8LA 1CJTA 2FGOA 3K2YA 5IOLA 4MFBB 3UCUP 3CD0A 1S9GA 1Q16B 1GK8A 1VISA 4K2XA 4O4GB 2CJYB 5HMWA 2O67A 3A3OB 2RU3A 3A3NB 5F8NA 1X4HA 3PW2A 1Q95G 4LJMA 4KPYA 4ED4A 5LMUJ 1S48A 2J8AA 2OAUA 2OHDA 5B0GA 5LSOA 1W2IA 2LU1A 5T7LB 5KFVA 5HROB 2XY6A 2H48B 3K5OA 3IR5B 3MR2A 1Q82T 2UU9J 4PAAA 2DGOA 4NYZA 3BYRA 2VKZG 3IG1A 2AMCB 4NZ0A 3Q83A 4Q45A 3ISNC 1X60A 1YDLA 4HDHA 4XPEA 2MKIA 3OLBA 2KXHA 3ZZZA 5B08A 1TK5A 5KFOA 2HZCA 2XY5A 3O44A 5CXTA 2PT0A 3AJDA 3R7NB 1I1GA 4WIIA 4DV0J 4ELUA 2AJ0A 4OLOA 4HYKA 3C6UB 3IWLA 4ZPWR 2LCWA 2HZVA 1P1LA 3CJ5A 3J81Y 1RBAA 2LXIA 1UVNA 5DZ7A 1NJWA 4JI4F 4LF5J 3K5PA 5HN0A 1GX5A 2E5JA 3KHGA 2A0FB 3BKUA 1IBCB 3BS9A 4F4WA 2DCUB 4H4MA 1SV5B 1UWBB 5E41A 3L9ZA 1SJ3P 4DSLA 2BW2A 1M1HA 1WF0A 4OL8A 3LPYA 3QIPA 1GNKA 4A8YA 2RSQA 4P75A 2YPYA 3M1VA 2ZJRQ 2CPHA 3R2DJ 2UV8G 2ZC3A 1T03A 3KNGA 1EP4A 2DNRA 4A48A 2VODA 2RRBA 4A8FA 1CS4B 1Y5IB 3QT6A 3AY0A 2HFUA 3D6TB 2HBQB 4CYUA 3CJ0A 4RUAA 2HHHJ 1XEZA 4J9SA 1SKUB 4YDDB 1L3UA 2R3VA 4ED5A 5CCLA 1HI0P 1VRUB 2MYFA 3R3TA 2AX0A 1KHWA 2MKJA 4IOBA 5IZHA 1Q5VA 3UFCX 1HWUA 4DDFA 4JP8A 2K7JA 2M8DB 2IRXA 3BB5A 1RT7B 5ETPA 1OIAA 1EARA 1V9OA 1QSYA 2QSWA 2UXCJ 3WBZA 1U09A 4GVLA 4BWMA 3VQTA 5KT3A 1U2CA 2BANB 4U7UK 1T9YA 4PUOB 4EBEA 1N34J 2J7KA 1YJRA 2ZD1B 1GFWB 2IMWP 4M5LA 3HT3A 5IM0B 2HFSA 5KG0A 1RTIB 1XTZA 2N4CA 2C3UA 2MLZA 4AD6A 5AXKA 1QLNA 4MKYA 3FZBA 4WP8A 2AX1A 3J7YU 2EC2A 4X84A 4FS2A 4B3MF 4NASA 4K4XA 4DN9A 1Y3KA 5GAGI 2E1RA 2KJVA 4UTGA 4XDCA 2D7SA 2W7PA 5HO4A 3HSJA 2D3UA 4GRSA 1NSAA 1N5SA 3HO1A 3SFUA 4DR4F 3M2VA 3VGSA 3LP1B 4WK1A 3HULA 1QTMA 1U6BA 3IGNA 2XNRA 4LRAA 2QMWA 1ZM4A 2DBBA 4DV5F 4WXOA 4QIVA 4C8MA 1IKYB 2DKOB 3ET6B 2HQCA 3B8HA 3W2WB 4DJBA 4B3SJ 2R7TA 4YB6A 1SKSA 2V8PA 3U02A 2KB2A 2F9JA 3E01B 3M8SA 2L48A 2D3ZA 2DH9A 3WX4A 2DNLA 4XAKA 4U8VA 3MEEB 1RT6A 1SJRA 1VHIA 2BJ8A 5F3ZA 2KKHA 4U67Q 1Q8LA 4CNYA 1TP7A 3D0IE 4X4QA 2MLXA 4P74A 4LF2A 2GGPB 4ICLB 5E3PA 1X0FA 1M5KC 4H4MB 1HFEL 1VCTA 1APSA 5KOXA 3KG4A 2AZ3A 2WOMB 2JZ5A 5KT2A 4HH0A 3L3CA 4EO6A 4YQWA 1R7IA 4DPYA 1PYTA 1OY9A 1L3KA 3H7HB 1UJ6A 3VGTA 1UPMB 3M8PA 4YHHJ 1DURA 4X66J 1RUSA 5AJ3J 2J0QD 3NNAA 1SJ4P 3D54A 2RRNA 3Q23A 2W9BB 2DVIA 2PEHA 4J9UE 1RTIA 2ZOMA 3H0PA 5GMEA 1XNRF 3L4BC 3M2VB 4CNZA 2LXFA 4DV3J 4LSNA 3QZ7A 2IHR1 4I56A 4G6VB 3RAQA 2BJDA 4PUOA 2COLA 1C1CB 2PFDA 5EN1A 2UU9F 4AUKA 4EEYA 4ZPVR 4PQAA 3D2WA 3LP2B 1TL5A 4MK9A 4M5DB 1SL1A 4H54A 1BE4A 2CQDA 2XSJA 3HCXA 2VBXA 4DLEA 1X7VA 3GIKA 2MZQA 2AW0A 2OMLA 4ENOA 2XNQA 2Q1LA 1AA1B 1FD2A 1UFKA 4WXWA 1JLQA 3RR8A 1JK9B 4P52A 4NLSA 4WZMA 3POTB 1RB0A 3CDUA
chains in the Genus database with same CATH topology
4OX9J 4LF5J 2UUCJ 4RJVA 4LF7J 1I94J 4B3TJ 2KVQE 1HNZJ 4GKKJ 4KY3A 5FLXU 3R2DJ 1FJGJ 4DR6J 4DV4J 4PWWA 2F4VJ 4JI5J 4DR5J 4LF8J 3T1HJ 2HHHJ 2VQFJ 4DR2J 1XNQJ 1HR0J 4DR1J 4JI6J 1N33J 4DUZJ 4JI2J 4DV5J 5A2QU 5LM7E 4X62J 2UXCJ 4JYAJ 3D3BJ 4NEYA 4JI4J 4B3RJ 4LFCJ 4JI1J 4DV6J 1N34J 2MTLA 4NEZA 4AQYJ 3T1YJ 4GKJJ 1XMQJ 3J7AN 4JI0J 4YY3J 3OTOJ 4B3SJ 2ZM6J 4JI8J 4DV1J 4NXNJ 2UXDJ 5LMNJ 3R2CJ 1IBKJ 4DR4J 2KL8A 4X65J 4JV5J 3J80U 4LF4J 3JAMU 1N32J 4DR3J 2UUAJ 2MQ8A 1XNRJ 4DV7J 4NXMJ 1IBMJ 4KHPJ 1HNXJ 5BR8J 4X64J 4V1Ak 4KYZA 4LF6J 5IT9U 2UXBJ 4YHHJ 4X66J 5AJ3J 4JI3J 1J5EJ 4DR7J 1HNWJ 2E5LJ 5LMUJ 4DUYJ 2VQEJ 4LFBJ 4DV3J 1XMOJ 3IMQJ 1IBLJ 2UU9J 2UUBJ 4JI7J 4LF9J 3D3CJ 3J81U 2MEWA 4LFAJ 3W1YC 4HHUA 4DV0J 4B3MJ 1N36J 4K0KJ 4DV2J 5IWAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 J;  4LF5 J;  2UUC J;  4RJV A;  4LF7 J;  1I94 J;  4B3T J;  2KVQ E;  1HNZ J;  4GKK J;  4KY3 A;  5FLX U;  3R2D J;  1FJG J;  4DR6 J;  4DV4 J;  4PWW A;  2F4V J;  4JI5 J;  4DR5 J;  4LF8 J;  3T1H J;  2HHH J;  2VQF J;  4DR2 J;  1XNQ J;  1HR0 J;  4DR1 J;  4JI6 J;  1N33 J;  4DUZ J;  4JI2 J;  4DV5 J;  5A2Q U;  5LM7 E;  4X62 J;  2UXC J;  4JYA J;  3D3B J;  4NEY A;  4JI4 J;  4B3R J;  4LFC J;  4JI1 J;  4DV6 J;  1N34 J;  2MTL A;  4NEZ A;  4AQY J;  3T1Y J;  4GKJ J;  1XMQ J;  3J7A N;  4JI0 J;  4YY3 J;  3OTO J;  4B3S J;  2ZM6 J;  4JI8 J;  4DV1 J;  4NXN J;  2UXD J;  5LMN J;  3R2C J;  1IBK J;  4DR4 J;  2KL8 A;  4X65 J;  4JV5 J;  3J80 U;  4LF4 J;  3JAM U;  1N32 J;  4DR3 J;  2UUA J;  2MQ8 A;  1XNR J;  4DV7 J;  4NXM J;  1IBM J;  4KHP J;  1HNX J;  5BR8 J;  4X64 J;  4V1A k;  4KYZ A;  4LF6 J;  5IT9 U;  2UXB J;  4YHH J;  4X66 J;  5AJ3 J;  4JI3 J;  1J5E J;  4DR7 J;  1HNW J;  2E5L J;  5LMU J;  4DUY J;  2VQE J;  4LFB J;  4DV3 J;  1XMO J;  3IMQ J;  1IBL J;  2UU9 J;  2UUB J;  4JI7 J;  4LF9 J;  3D3C J;  3J81 U;  2MEW A;  4LFA J;  3W1Y C;  4HHU A;  4DV0 J;  4B3M J;  1N36 J;  4K0K J;  4DV2 J;  5IWA J; 
#chains in the Genus database with same CATH topology
 3K8V A;  5CQG A;  1XN9 A;  1TTH B;  4DSK A;  5DM6 Q;  1P1T A;  3QRR A;  1KLN A;  3H42 A;  4ZPC A;  2LEC A;  4YR2 A;  1WKL A;  4OFZ A;  5ETS A;  3PCO B;  1VQ5 S;  5HMX A;  2HQ3 A;  2KFY A;  4URQ U;  2GS8 A;  2WCX A;  3PVX A;  2LDY A;  5C2C A;  3M2U B;  3H98 A;  1MU2 B;  2AGQ A;  4DQS A;  4EUV A;  1NB7 A;  2ASJ A;  2HNZ A;  3IP0 A;  4DG1 B;  4B9L A;  3QIP B;  4ECY A;  2J0W A;  1LOU A;  2KHD A;  3HDS A;  1R6Y A;  2CDQ A;  2M4M A;  3PO5 A;  1YQH A;  4C8O A;  4F26 A;  4EMD A;  3HSZ A;  5J2N A;  1KSP A;  3NL0 A;  1Y10 A;  1X4C A;  1BY9 A;  3IWN C;  2M8H A;  4N5S A;  1IKW A;  4DV7 F;  2RS2 A;  4NI2 A;  5E3A A;  1OY6 A;  3QZ8 A;  4ALZ A;  3BO4 A;  2DD8 S;  2DGQ A;  4TYB A;  5C24 A;  1VQ9 S;  1MW7 A;  3DGP A;  2W9C B;  2F63 A;  4W98 A;  3J81 j;  3TUP A;  4K5R A;  2QL7 B;  4PPD A;  4XTT A;  4I7F A;  4JI2 J;  5ETO A;  1KNZ A;  1H2U X;  1SV5 A;  5DM7 Q;  3C2P A;  4QYZ K;  3IRW P;  1BQM A;  3I4H X;  3RB4 A;  4DV6 F;  5B0A A;  2WW4 A;  5JJB A;  4ECU A;  1S7I A;  4CYU B;  2OD6 A;  3SQG A;  4DXL A;  1JX4 A;  3MM6 B;  2HGN A;  2FLL A;  4HTJ A;  2QSF A;  1SUQ A;  1JLC A;  3V4M A;  3A8K A;  6FD1 A;  2V94 A;  4LR9 A;  4LF7 F;  1UMJ A;  1Y5N B;  1LW2 B;  2GIQ A;  4EI2 A;  2YWH A;  2FJX A;  4ID5 A;  2N7Y A;  4DZD A;  4C4W A;  1HYS A;  1CJT B;  1RI7 A;  2C22 A;  1JNZ B;  5CD4 A;  2POK A;  1BD6 A;  4Y2K A;  2K2P A;  4K4U A;  2JLG A;  4ZP9 A;  2OEJ A;  3THT A;  2R7U A;  4C8Y A;  2OGU A;  4R0E A;  3OD2 A;  4EZ9 A;  4Q43 A;  4GMK A;  4B9T A;  1F9H A;  4DL6 A;  2B56 A;  2KYZ A;  2GVZ A;  2EBG A;  4KGZ B;  3IRX B;  5IFM A;  3MDF A;  5KT4 A;  3T5L A;  1T7P A;  2D3O R;  4IFV B;  2HAI A;  1JNR B;  2Z30 B;  1X31 C;  2ZM6 F;  4J9V A;  3HF5 A;  1R8C A;  1WOR A;  1TMJ A;  2AGP A;  2FC9 A;  4RW4 A;  2L9D A;  5E2Q A;  2GJF A;  1CJK B;  3I96 A;  4X66 F;  4RZR A;  1Y7P A;  2A6M A;  2M0G B;  1FKO A;  4CCH A;  1QVG R;  4LF4 J;  4QU6 A;  5F8J A;  3KUH A;  5SUH A;  3R97 A;  3N5B A;  1Y5L B;  1X4G A;  4A8M P;  5K14 A;  2DYA A;  1VBZ A;  2BJ7 A;  1SH3 A;  3CCM S;  1IBM J;  3CWJ A;  3QT5 A;  2OPR B;  4QR1 A;  1FFW B;  2FIU A;  2YKP A;  3BM7 A;  3C14 A;  2UUB F;  3O8W A;  1AFJ A;  2Q66 A;  1IM6 A;  1DHM A;  3EMT A;  4AL7 A;  4H4K C;  4KYZ A;  3MPW A;  4QWA A;  4M8L A;  2E7W A;  1Q8B A;  1KEK A;  3OTB A;  2IA6 A;  1FI4 A;  1YK9 A;  1QSS A;  2R2U A;  2B9Y A;  5BXI A;  4OI6 A;  2YWK A;  2CKW A;  5B7W A;  1RKJ A;  2RB7 A;  3HD1 A;  4P71 A;  4JUZ A;  3CUN A;  1FRJ A;  3VAH A;  2IIH A;  2HNY A;  4RW8 A;  2KG1 A;  4EK2 A;  3GSD A;  4HT5 A;  4DR7 F;  3KYL A;  1FXL A;  3OLA A;  4HT7 A;  3CJK A;  4ECT A;  3AB4 B;  1JLE B;  3D1H A;  3FQL A;  1QAJ A;  4I68 A;  4R25 A;  2HHS A;  3BDE A;  1HIY A;  5A6P A;  3VVU A;  3R5A A;  3JYT A;  5LL6 d;  2ZKT A;  1N6Q B;  4NZ7 A;  1UZH A;  4DL7 A;  1RAJ A;  2F40 A;  5I42 A;  3VAM A;  3TRG A;  4B3M J;  4WZQ A;  3VV2 B;  2BM1 A;  3DYA A;  3R9L A;  3HHN B;  2ZNZ A;  1FWK A;  2HLT A;  4ECS A;  1I3O B;  1T11 A;  3T9Z A;  1QE1 B;  2KRR A;  3MM6 A;  4ZVQ B;  4AXJ A;  3SQG B;  2ZBC A;  5J2Q A;  4F8R A;  2KT2 A;  4ZOS A;  3SSS A;  4X2B A;  4OYZ A;  2IC3 A;  1B64 A;  1OWX A;  1YVF A;  3JYT B;  1N6Q A;  3N5F A;  3QWU A;  1C1B A;  4B3O A;  4F0K A;  4OYA A;  2UZA A;  2RQK A;  3ITH A;  3PEH A;  3SYZ A;  4OX7 A;  4D3H A;  1OO0 B;  3EXY A;  2C3O A;  4NE9 C;  4Y2M A;  2QA4 S;  3CC4 S;  3DMJ A;  1A9N B;  1VR6 A;  4J9K A;  1U4B A;  1U47 A;  3NY0 A;  3JSM B;  4WP3 A;  3TVK A;  1EIY B;  2YWG A;  2AZ1 A;  1NUE A;  2NXC A;  2YQ1 A;  1Z4U A;  1WEX A;  2VG7 A;  2YY3 A;  1QM9 A;  2GW8 A;  3IWX A;  2R8K A;  4PYD A;  2G2Z A;  2HMI B;  1FXD A;  4LR8 A;  3FCV A;  4IG3 B;  4LFC F;  1WKK A;  1MU2 A;  4K4S A;  2CQG A;  3M2U A;  1H0H B;  2VIH A;  2W4C A;  3QLH A;  5ETM A;  4ZCI A;  4EWT A;  4L75 A;  1Q53 A;  5LM7 E;  4D3G A;  2B3T B;  4JI4 J;  5KFL A;  2E44 A;  4F4X A;  3H4B A;  4DCJ B;  3JB9 k;  2V4J B;  4ZP6 A;  4WU2 A;  3PX0 A;  3DLH A;  1CJK A;  1UW4 A;  2VF3 A;  3CCS S;  1R31 A;  1MN9 A;  3RB6 A;  2ZJP Q;  4NEZ A;  2FY8 A;  3NGD A;  3SV4 A;  1UP1 A;  1X0P A;  2BVZ A;  2IM0 A;  4KV8 A;  2E1M C;  4J9N A;  5HLF B;  2I5J A;  1IWA A;  3T1Y J;  4O3N A;  5L38 A;  3DLL Q;  4GKJ J;  5L1K A;  4KHP F;  3J7A N;  4X62 F;  3TAM B;  1S0V A;  2W7A A;  4M5J A;  2H54 B;  4UUW A;  1LNQ A;  4CI0 B;  4CP5 A;  2B0G A;  4O3P A;  4TU7 A;  1WC0 A;  4IRC A;  2YNI B;  4RBU A;  4EBD A;  1OPZ A;  1JXV A;  3PJ9 A;  1KC8 T;  1XR7 A;  2YKM B;  1TL7 B;  4NOH A;  1WC3 A;  4LSL B;  3ZZT A;  1NK4 A;  2N82 B;  4YP3 A;  1X5S A;  1WDT A;  2C2K B;  3HHL B;  3TR5 A;  2ERR A;  2HVE A;  2DIS A;  2R4F A;  4X4O A;  4NL5 A;  3PYG A;  2GIR A;  4CH7 A;  1WI6 A;  3CME S;  1B0T A;  1RHQ B;  1RT3 A;  3UVJ B;  1U48 A;  1WSV A;  4N77 A;  2W2P P;  1FVQ A;  1OSC A;  3SMZ A;  3SSR A;  3F41 A;  2UUA J;  5A8W A;  2FVQ A;  4U95 A;  2MZR A;  1FDD A;  3UDL A;  4C8K A;  3U1N A;  1RDR A;  3MZI A;  4DUT A;  2VUG A;  2MQQ A;  3QT7 A;  3HXM A;  3A8J A;  1FJE B;  2J6U A;  3MMJ A;  2BE2 B;  3BZQ A;  4IR9 A;  3NS6 A;  1GXL A;  3MR5 A;  4J90 A;  3H8Y A;  1FKP B;  3ENQ A;  4OV1 A;  1LWF B;  1EKR A;  1N5Q A;  4OIX A;  4RUB A;  2NXJ A;  3OHB A;  2V8V A;  3CUL A;  3KK2 A;  4Y65 A;  3D6H B;  5J2P B;  3SV3 A;  3KK3 B;  1U6F A;  2BKN A;  3VR1 A;  4KFB B;  3HVR A;  2DNN A;  5J2N B;  1IKY A;  1DJ0 A;  3G8S A;  4DR2 F;  4CQ1 A;  2OTL S;  1X9S A;  1NHU A;  2QL9 B;  4I0W A;  3GR0 A;  3DNC A;  1BQN A;  4RBT A;  3MM7 A;  4LF9 J;  1MMD A;  3OPK A;  1NJY A;  3K89 A;  4ZVT B;  3TWZ A;  1KLM A;  2XLI A;  2J0X A;  2NQP A;  5IC4 B;  2PDA A;  2WVC A;  1HBO B;  5HLF A;  1WTF A;  5F9L A;  3DOL A;  5KFB A;  3NS7 B;  3F56 A;  4DSF A;  1H6K X;  2W2N P;  3GCW P;  3DI6 A;  2HHT A;  3C66 A;  1NK7 A;  2FVR A;  1KKH A;  1RIS A;  1RXO B;  3DI6 B;  2P6S A;  3HI9 A;  5L9X A;  3TUI C;  3UE2 A;  5A8K A;  3PW7 A;  2C28 A;  3OVS A;  1BHN A;  2ZBP A;  3G87 A;  3UN2 A;  2XGP A;  1HW8 A;  4RNH A;  4TN2 A;  4LF7 J;  4H4O B;  3ZTQ A;  2XSJ B;  4E98 A;  3M7V A;  2U2F A;  3VQS A;  3THP A;  3Q8Q B;  3OUY A;  2MZS A;  1SC3 B;  2HQF A;  1BWE A;  4QIW D;  2P8I A;  3OFF A;  5GAD I;  5EDW A;  4F4Z A;  2R8G A;  2J76 E;  4O4R A;  2QTW A;  4DV4 J;  1FRX A;  4P10 A;  1U1L A;  5M2U A;  2X3D A;  1XMQ F;  1DAR A;  3U27 A;  1WDD A;  3CB4 A;  5KFC A;  1DQA A;  3FEX B;  1ZAX A;  5C2G A;  2JWN A;  1VJW A;  1VRU A;  1EHW A;  3HFZ B;  2OPQ B;  3S01 A;  4DPX A;  1AUD A;  3KLI A;  2XHW A;  3V6K A;  1RWO B;  2GQ2 A;  2NS1 B;  2Y3Y A;  4L6V 3;  3AXM A;  4DS4 A;  4F3O A;  3C3L A;  4LF4 F;  4OYI A;  1DFD A;  2BRK A;  5DLG A;  4TNO A;  3PXG a;  1NH7 A;  1FTR A;  1EQM A;  2UUW A;  2VU5 A;  3CIM A;  4YDX A;  4DV5 J;  1XC9 A;  1H38 A;  3H5Y A;  3D6M B;  4NLG A;  1RT3 B;  2PMW A;  2HFO A;  3UVJ A;  2OPS A;  2O66 A;  1T9V A;  3PG9 A;  4JV1 A;  4TVA B;  4EBC A;  4QCL A;  1DTQ A;  2RS8 A;  1XBW A;  4NLQ A;  3Q86 A;  3T6B A;  3CO0 P;  4OV6 A;  1CUL A;  2MMY A;  4RR5 A;  2ZHB A;  3RG6 A;  3ILJ A;  2XGQ A;  4WFB Q;  2V8D A;  3MCS A;  3PRV A;  3MUR P;  1ZOT A;  1WNE A;  4X64 F;  4MMO A;  1FKA F;  3I5A A;  2CNO B;  3LGN A;  3ZZ0 A;  1VRT A;  3QFH A;  3I0S B;  2YPZ A;  5GAH U;  3TUJ C;  3NEK A;  4PCQ A;  1KOO A;  5GVQ A;  4NA1 A;  3NGK A;  5HBM A;  2HIQ A;  5EX0 A;  3OTO J;  1RT4 B;  2HPU A;  4C0H A;  1VBX A;  2J6S A;  3EZU A;  4G1I A;  5H9E J;  2WK4 A;  3D0H E;  4ZPB A;  5E33 A;  2OMO A;  3N0V A;  3RBE A;  3OTE A;  4U6P A;  2J0S D;  2KDO A;  4KGX B;  3I31 A;  4CRJ A;  1Z1Z A;  1OSD A;  4OX9 F;  3N28 A;  4P9S A;  4IDK B;  1EZZ B;  4X65 F;  3QGG A;  4M63 A;  1ZM2 A;  4QW8 A;  3H4D A;  2VOO A;  1RZM A;  3CGI A;  2XQC A;  1HNX J;  2YWW A;  4C11 B;  2BMB A;  4I2Q B;  4KRW A;  3W9I A;  5DDR C;  5BR8 J;  2V2K A;  2JC1 A;  2LEA A;  2DK2 A;  2E1P A;  4PYA A;  1KBR A;  3CMA S;  3UPF A;  2NUH A;  4L76 A;  3DLE A;  3W61 A;  1MWZ A;  4K2J A;  1YIT S;  3FNN A;  2W2Q P;  3MWB A;  2CDR B;  1PSD A;  1FWP A;  4DV1 F;  3QAE A;  1J5O B;  1Y00 A;  1HA1 A;  4RW7 A;  3OTD A;  6AT1 B;  4JYA F;  1HWI A;  4QZV B;  1U1K A;  2IMO A;  2CZV C;  2ZOF A;  2YH0 A;  3J7Z 5;  2BEF A;  2DGS A;  3OBI A;  1XMO J;  1KRP A;  3ITH B;  1CEZ A;  4NRU A;  1HNI B;  2RIJ A;  4TY9 A;  3S6E A;  1C1B B;  2FC8 A;  2V5H G;  2VQE F;  4KAI A;  3PFO A;  4KBI A;  4U7U D;  2ZVS A;  1WEY A;  3OQ2 A;  3MEK A;  4M1K A;  4DF8 A;  4V19 J;  4GKJ F;  3IGV A;  3MF5 A;  3CDE A;  5MAO A;  4DV4 F;  3RGI A;  3KLH A;  2NXU A;  4KR0 B;  5DQG A;  1TZ0 A;  2VFU A;  2IYG A;  5FDL A;  2FQQ B;  3TZZ A;  1RTZ A;  3BGU A;  2ADC A;  1D1U A;  1HQU A;  5G0R B;  1TL4 A;  1YIJ S;  1X4E A;  2LEB A;  3PV8 A;  3VAG A;  4ZHR A;  5DQI A;  5ADZ A;  3FEZ A;  1U7L A;  1G3O A;  2VPW B;  2LMI A;  2IVY A;  1FE0 A;  3FC9 A;  4DR5 F;  2UXD F;  4GC7 A;  3KHR A;  5CZX A;  5CD4 H;  3DCA A;  3R1L A;  2VBY A;  2E5G A;  1FE4 A;  2IJR A;  4HH1 A;  3L95 X;  3SCK E;  2LKZ A;  2E5L F;  2WVD A;  3H5U A;  5T7L A;  1E6Y B;  3X3U A;  4LF8 J;  2JSX A;  2H65 B;  2WBM A;  3GG0 A;  5ETR A;  1NKB A;  4DFP A;  2OH2 A;  2VQF J;  2N3L A;  2LLZ A;  2I2Y A;  4DR2 J;  4Q0B A;  1XNQ J;  4KE5 A;  2W7O A;  3U7J A;  4FN5 A;  4DSE A;  2HND B;  3DHW C;  2JLF A;  4TU9 A;  4ILL A;  1TR0 A;  2IVF B;  2C1E B;  2MKC A;  1GXU A;  1IM4 A;  1LK5 A;  2VFS A;  2HWH A;  4DU7 A;  2G2Y A;  3ILL A;  1JIH A;  3LA0 A;  4TKT A;  1RYS A;  4DOZ A;  4RU9 A;  4LFA F;  5H9F K;  1KN6 A;  3LO3 A;  1NDP A;  1LWE B;  4G1Q B;  1W26 A;  3SDE B;  2ZH8 A;  3O2I A;  4BS2 A;  2ZEJ A;  4NX9 A;  3G8T A;  4P2S A;  2KJW A;  3LOU A;  3I6P A;  4YN3 B;  3F73 A;  2VOP A;  4UQG A;  2UXB F;  3QRP A;  4ED3 A;  3IA0 A;  3CED A;  1X5T A;  4YR3 A;  3MEC B;  4F0H A;  5DG8 A;  2M3D A;  4QJV A;  4DV0 F;  2QJ3 A;  1OMS A;  4KSE B;  4LSN B;  1QY7 A;  4QPT A;  1HAR A;  3G86 A;  3L7U A;  4ZVP B;  3AB2 B;  1HYS B;  4NXN J;  4UQT A;  5KFX A;  1VRT B;  3PEJ A;  4BCA A;  4TLQ A;  3RB0 A;  4M94 A;  1LW2 A;  1YRU A;  2V8H A;  2CG8 A;  2ZFH A;  4P7T A;  2L9N A;  3Q0A A;  4DCO B;  3VAF A;  3PHT A;  2NYI A;  3M2R A;  4F4Y A;  2RJZ A;  3T1Y F;  1VLO A;  4I6A A;  4YME A;  4CLP A;  3MD3 A;  2E66 A;  3SI8 A;  3M05 A;  3CJQ A;  2H1Y A;  4C48 A;  2Q79 A;  2G0C A;  2B4P A;  1RWV B;  4Q8E A;  4OZ3 A;  1BQM B;  2GML A;  4XIU A;  3LAN A;  3J80 U;  1N32 J;  3W3S A;  3VAK A;  4ZA1 A;  1E6V A;  2YKO A;  1UEV A;  2HK2 A;  1W7W A;  2J5A A;  4N7T A;  4FYX B;  3NG8 A;  4K5S A;  4OZ0 A;  4ZDN A;  1D0E A;  3D4J A;  5HAN A;  1Q1K A;  2HVI A;  4V1A k;  2O1P A;  3OVB A;  1UEU A;  2BA9 A;  5CYQ A;  1S6O A;  3BQ2 A;  2PD1 A;  3P45 B;  3TVZ A;  3R5C A;  2EFP A;  2QE5 A;  3OXF A;  3CCW A;  2VA2 A;  2QMU B;  4ANE A;  4KO0 B;  1TKZ A;  2CRL A;  5T41 A;  1P8G A;  3HSG A;  3E2E A;  1YJU A;  1IKV A;  2BR0 A;  3CD6 S;  4YOE A;  2HNZ B;  2HWT A;  4DG1 A;  4GC6 A;  1C4C A;  1TKD A;  8ATC B;  1SJF A;  4M95 A;  1J5E F;  1JLG B;  4HDG A;  1XMB A;  1HBU B;  2EK6 A;  4YS2 A;  4MH8 A;  4MIW A;  1KQF B;  4KIA A;  5IT0 A;  4DI6 A;  2EKN A;  3LF0 A;  4M5G A;  3MED A;  3EGN A;  2RT3 A;  3DM2 B;  3ISN D;  2FVS A;  2J7W A;  1YG0 A;  2SXL A;  3W1Y C;  1D9F A;  4BHQ A;  2DJW A;  4QWB A;  4C8Z A;  2HEK A;  2I9S A;  4M5N A;  6FDR A;  1PAE X;  2D9O A;  3GV8 B;  2YBV A;  2G1D A;  4KH0 B;  4WE1 A;  4QWD A;  3C6T B;  3DRP A;  5BJR A;  3DOM A;  3GFX A;  4Y6I A;  9RUB A;  3CCR S;  3P6Y C;  3SCI E;  1RHU B;  3A8I A;  4LBH A;  1VQ6 S;  4KTQ A;  3BR9 A;  4YFU A;  4CT8 A;  4K50 A;  1SBR A;  2JLE A;  1ZZN A;  2MJN A;  3R5G A;  5C25 A;  5KFZ A;  1HBU A;  1AZS A;  1VBK A;  2IRY A;  2KYX A;  2QA1 A;  1H74 A;  3P96 A;  1FJG F;  3KLV A;  1IWG A;  4DR6 J;  1F9F A;  3HVW A;  3BBC A;  1FNO A;  1IKV B;  5D3G A;  1RE1 B;  4LUB A;  1AFI A;  3OFH A;  3CJ2 A;  3R6G B;  3ZTP A;  2XM3 A;  3BO3 A;  1HBO A;  3D9B A;  3QGH A;  4F2R A;  1F60 B;  1S1W B;  5LXR A;  2K1R A;  1JQG A;  2Y1J A;  4LRB A;  1Q86 T;  4WBF A;  4WTY A;  5D4O A;  1HWL A;  2AHO B;  3CC7 S;  3HX9 A;  2LP4 A;  4DUZ J;  2H3E B;  3JS9 A;  1VIO A;  2OEM A;  2RDD A;  4KB7 A;  3UW1 A;  1E6V B;  1UFL A;  4CO1 A;  1VDH A;  4EFA C;  2W24 A;  4FYW B;  3BGF A;  3NGR A;  5K20 B;  3FRY A;  3RB3 A;  1YBT A;  2JH3 A;  3CCZ A;  5H1S V;  2DEI A;  2CPZ A;  1K8A T;  1RT6 B;  4OI1 A;  3HHK A;  3KK2 B;  5BYQ A;  3BV8 A;  2HK3 A;  4HHJ A;  4DX7 A;  2B9W A;  2KXN B;  4I2P B;  3P8B B;  1H2T Z;  1RK8 A;  5M2R A;  2JHE A;  4PG8 A;  1YJW S;  1FK9 A;  2IBK A;  2ZBQ A;  1S0M A;  5L46 A;  4B9V A;  3I56 S;  1VQ8 S;  3IC1 A;  3MMA B;  4ZPA A;  5KFE A;  4OHW A;  1XMQ J;  1Y11 A;  4N47 A;  1HHT P;  1ZYQ A;  1FDN A;  1TKX A;  4J9L A;  1TUV A;  2PEB A;  2OPP B;  4NLY A;  4RW6 A;  2ZM6 J;  5KT6 A;  2XUL A;  5J2M B;  3CCJ S;  1XK8 A;  1RTH B;  2VPY B;  3HKW A;  5CAA A;  3R6L B;  5GAG U;  1XWL A;  5GAD U;  1X5P A;  4F4K A;  2HHV A;  3K5N A;  3IBC B;  1XR6 A;  2Y8W A;  2QLJ B;  4WIQ A;  1N48 A;  5JUM A;  4IQX A;  4A46 A;  1NK6 A;  2ABY A;  1WHW A;  3AA9 A;  4IO1 A;  4R8U A;  4IG0 B;  1NK5 A;  2BUN A;  2B6A A;  5B0F A;  4CLZ A;  1LWX A;  3KJQ B;  2V4J A;  1QVF R;  3OVA A;  3V6D A;  1FFG B;  1S6P A;  2CAJ A;  4Y00 A;  3TAM A;  2KH9 A;  1B7Y B;  3I55 S;  5LMU F;  1UVM A;  3NCP A;  1WC6 A;  4KHP J;  1RT7 A;  1BXN A;  2R8I A;  2V2Z A;  4FF1 A;  2B4U A;  3O5T B;  5IQQ A;  3B4D A;  1WEL A;  2CQ0 A;  1GTE A;  4RW9 B;  1TL1 B;  1UPP A;  2CJB A;  1EB0 A;  3KFW X;  2VDI A;  4JI3 J;  3AD9 C;  3I0R A;  3ILI A;  2R7S A;  1KWM A;  4LVN P;  4B17 A;  1S6U A;  2IJN A;  3BYP A;  2LA4 A;  2F9D A;  1VYA A;  3H20 A;  3R5B A;  3LUY A;  3P5B P;  1U8W A;  2RNE A;  3CNQ P;  1REG X;  4J37 A;  5D4P A;  3G4S S;  1M1K T;  1GMU A;  4DUY J;  4HI1 A;  3FQK A;  1T03 B;  4ZVR B;  4Y2A A;  3EX7 B;  4NWB A;  3GYG A;  4IG3 A;  3RYL A;  2A18 A;  3VGV A;  2DNP A;  4BDP A;  2FLN A;  4AT1 B;  1UW9 A;  3MAA A;  1S9E B;  1PC4 A;  1H98 A;  4ZP7 A;  2DNH A;  4DV2 F;  2VG7 B;  4RNO A;  4B3O B;  3FCH A;  4PWD A;  1WD6 A;  1N0V C;  1R8H A;  5G0R A;  3MM8 A;  2WSE C;  3OXG A;  4ES1 A;  2C2Z B;  4DWI A;  4ZJO A;  3NNH A;  4OQJ A;  2XC9 A;  1H7W A;  3GIL A;  5FJ4 A;  1U0H A;  2VG5 B;  4LRD A;  4PPZ A;  2YKN A;  3MCO A;  1C0U A;  3NKY A;  1IJF B;  3JSB A;  2XSF A;  4G1P A;  4CTA A;  4ZN1 A;  5HMY A;  2UUC J;  1PG5 B;  2Z58 B;  4AE5 A;  3THV A;  4PEO A;  1M5V C;  2RQC A;  2KVQ E;  1M5P C;  3LAM A;  2AT1 B;  1TFW A;  2QLX A;  4P72 A;  1TL7 A;  2B8Q A;  1DBD A;  2EFO A;  1YBU A;  3O3L A;  5FLX U;  4DV3 F;  2V63 A;  2ZH1 A;  2EC0 A;  1HLW A;  2L08 A;  4PXE A;  2IPO B;  2PII A;  5I3P A;  4HKQ A;  1PYS B;  3AA8 A;  3PX6 A;  2B7C B;  2BAB A;  4UT4 A;  3T1H J;  2YX7 A;  3EWG A;  5D0G A;  4K4T A;  1YJN S;  2CJA A;  1NK0 A;  4O3R A;  3KDN A;  1FJ7 A;  2DHX A;  4IQM A;  2M70 A;  3VGU A;  2MQL A;  3QNW B;  4FKX A;  4AND A;  4MAK A;  4OZ2 A;  4EU0 A;  2BKO A;  2DIV A;  2HKE A;  2V69 A;  4DN0 A;  1X4A A;  2MQP A;  4IOC Q;  1Q8I A;  4ED8 A;  2RE1 A;  1X4D A;  2AYG A;  3MMC B;  3L7O A;  2QYC A;  2QLB B;  4P2X A;  4UZC A;  1HWJ A;  4B08 A;  4DPT A;  3MAA B;  1KTV A;  2QA4 G;  3RRG A;  3CJK B;  3CJ4 A;  3AAW B;  2HRU A;  2XTJ P;  3M8Q A;  1D8Y A;  2VBW A;  4GVB A;  2R7O A;  1FTC A;  1XER A;  2UV8 A;  3NWG A;  2Z0G A;  2CQ3 A;  1PBA A;  2HVD A;  1SB6 A;  1YJ9 S;  4IOA Q;  2G1H A;  1EX8 A;  2K3I A;  4NEY A;  3M32 A;  3TA1 A;  3AQP A;  1FVS A;  4LFC J;  4XPC A;  2GQC A;  1U25 A;  3RAX A;  4PQU B;  1Y9O A;  2JNJ A;  2ILZ A;  2LYV A;  1VC0 A;  1RAG B;  1RU2 A;  1NZ8 A;  2CUY A;  2HMI A;  1J2V A;  3CJS A;  2CJX B;  1NXI A;  2M88 A;  3EVM A;  2RU9 A;  4L74 A;  4M5I A;  4PWU A;  3C14 B;  3VZI A;  1DAX A;  1ZA2 B;  2FDN A;  1MLA A;  1UFW A;  2QX0 A;  1BLU A;  4MIA A;  1G1X A;  3V2U C;  3H2V E;  4USV A;  4DU8 A;  1JJ2 R;  4ZCL A;  2FZC B;  2KU7 A;  4GVB B;  1NPP A;  3CO9 A;  5KFY A;  5HBM B;  3BSN A;  3G2X A;  3M30 A;  1T8E A;  1WG1 A;  3RJM B;  3GMG A;  4UST A;  2ASL A;  2V0N A;  3EVW A;  1EAY C;  2CPJ A;  1VOM A;  3KLE A;  3BGL A;  4B02 A;  4RO0 A;  5KFH A;  5IT9 Y;  3BH7 B;  1UZD A;  3GR1 A;  3O6Q A;  4OI0 A;  3UNY A;  2PA8 D;  1CUL B;  3UDE A;  3ENA A;  3R7S B;  1RTH A;  2E29 A;  3PKY A;  5E0O A;  3EE3 A;  3LGH A;  1SUQ B;  5J1E B;  2VON A;  1FDA A;  1IBK F;  1FEE A;  3GV7 B;  3GQC A;  1X8D A;  2GAG C;  2RF2 B;  3GYX B;  1KQK A;  5KG3 A;  2V9W A;  3M6W A;  4PWD B;  2MKS A;  2MJU A;  2QV6 A;  3PJX A;  1FES A;  2QYG A;  4M5K A;  4OYW A;  1JLE A;  4ZVS B;  3M6U A;  4DPW A;  2UXC F;  2Y9H A;  2YNG B;  4U7C A;  3B78 A;  2FHM A;  3QID A;  2FD2 A;  1HI1 A;  3O1L A;  3W64 A;  5IXU A;  2YKN B;  3NAI A;  3QPI A;  1NO8 A;  3FSY A;  2XMU A;  3MD1 A;  5C24 B;  1T3N A;  4C3M A;  3BGO P;  4RW8 B;  1IKW B;  3P4U B;  2HHH F;  4AL5 A;  1RGV A;  3BQ1 A;  1KHV A;  1GMW D;  1NAQ A;  2JL9 A;  1GXT A;  2HZA A;  4P2F A;  3RR7 A;  3ZC4 A;  4F3M A;  1JJ4 A;  4CLU A;  3QO9 A;  3ADA C;  1UJ4 A;  2KT5 A;  2HIY A;  2UUB J;  1UJ5 A;  1AB8 A;  4ZKA A;  1G7C B;  2RQM A;  3GJQ B;  5AE3 A;  3TA2 A;  8RUC A;  4I69 A;  2V4R A;  3MHY A;  1S1W A;  3R8Y A;  1NM2 A;  1P27 B;  2W01 A;  4B3R F;  1J27 A;  4OJG A;  4OHV A;  1NME B;  3IBW A;  1GH8 A;  4P2M A;  3PYF A;  3TUZ C;  2WAQ D;  3GJS B;  1S10 A;  2Z57 B;  4J9P A;  4C7Q A;  3KHH A;  3OV7 A;  2DB1 A;  2ACY A;  4IG0 A;  3HHE A;  1S79 A;  3DOL B;  1N0U A;  2BYC A;  2YWE A;  4CH1 A;  4W4M A;  2PI4 A;  1I94 J;  4FZV A;  1F3F A;  5F8G A;  1HNZ J;  1FO1 A;  2CQP A;  3J7Y I;  3K8W A;  2ADB A;  1RAA B;  3QJL A;  4KY3 A;  1S4E A;  3VWS A;  1RSC A;  2Z2M A;  1H3D A;  1RAI B;  1ZAV A;  3MPV A;  4ETX A;  4CLT A;  3DRR B;  5DDP C;  1YZ6 A;  4FXV A;  3S1T A;  1RT5 B;  2ZH6 A;  5KT5 A;  2RDJ A;  5A8R A;  1CBK A;  4E8U A;  2W9B A;  3N9U C;  2DY9 A;  1HPZ B;  1YHQ S;  1Q81 T;  1NJX A;  1HNZ F;  3IAM 9;  3UN5 A;  2F4V F;  3LP2 A;  4PAB A;  1NZA A;  4USW A;  4PKD B;  1JLC B;  4ZVU B;  3I5C A;  3PHE A;  1HKA A;  2J9D E;  2B43 A;  3BN4 A;  2DHG A;  1JJH A;  3QYY A;  5IC6 B;  4I64 A;  4WP9 A;  3MM8 B;  1TKX B;  2Y0S D;  5D78 A;  3UQS A;  1B3T A;  1HQ2 A;  5C5J A;  5GAE I;  4F36 A;  3TVY A;  4UW2 A;  1S1V B;  5HVG A;  1TFY A;  1ARO P;  2B9E A;  4B3R J;  2QIF A;  4ER8 A;  4DF4 A;  4ED2 A;  4DL0 C;  2DH8 A;  4OYO A;  2J9E A;  3MEE A;  2VIC A;  1RWP B;  2GFF A;  5F9N A;  2K1R B;  4PRF A;  2HHU A;  3CCV S;  2E9T A;  1NK8 A;  3W2W A;  3ET6 A;  3G6X A;  3UD3 P;  2ATL A;  1M5O C;  1UAW A;  4L73 A;  2GVD B;  4J9Q A;  4WYL A;  2AJF E;  5F41 A;  1SQF A;  2CQB A;  2WBR A;  2DXE A;  2Z4P A;  2ZBR A;  4Z2X A;  3V4I A;  2RUS A;  1IBL F;  1GQE A;  3CJ8 A;  1IR1 A;  2O3D A;  5HJX A;  1TKT B;  3EGZ A;  1T3O A;  2R7R A;  3PIO Q;  2ASD A;  1HBN A;  3HFV A;  2QLW A;  4F67 A;  5AXM A;  1FER A;  1F3V A;  1U1M A;  4I6W A;  2NZ4 A;  2MKY A;  2VPX B;  4RNM A;  3NBP B;  5ETV A;  3VAI A;  2MSS A;  3PYE A;  2BJE A;  1KVI A;  2UUC F;  2YNF A;  4OYP A;  2MHN A;  4WTO B;  2ZIT A;  3V4I B;  2VHG A;  1S1T B;  1H72 C;  2ILY A;  3CD7 A;  3TZY A;  4ED0 A;  2JC0 A;  4NA3 A;  1Q0N A;  1YJT A;  4JI6 F;  5HL7 Q;  4UZB A;  2OSR A;  4NXM J;  4FF2 A;  3DU5 A;  1T9U A;  3MED B;  3D1Q A;  4C98 A;  2ZDP A;  4CZC A;  1C1C A;  2D69 A;  2OPP A;  4HI2 A;  2E1C A;  3NGU A;  5HI7 A;  1F5B A;  1ZH5 A;  3C6T A;  2L3M A;  2R8J A;  1HMV B;  2BQR A;  2BBE A;  4C97 A;  3FVY A;  2C2R A;  1W2B R;  1N5V A;  1S57 A;  2HBR B;  3MMA A;  4ZK7 M;  4DR7 J;  2GZO A;  4OX8 A;  1YTY A;  3DM2 A;  3GSI A;  3JSM A;  1D9D A;  3EDQ B;  2E7X A;  4LIW A;  4RWX A;  2BX6 A;  3CJ3 A;  2HFZ A;  2JRS A;  4NML A;  1TU0 B;  4NLP A;  2OEL A;  3UN3 A;  5B0C A;  5IWA F;  1JXL A;  3UD5 A;  4F50 A;  5MLC V;  3T1A A;  4DL2 A;  3OTC A;  2XG8 A;  1WOP A;  2OI2 A;  1KON A;  5KG6 A;  2HND A;  1I51 B;  1YWX A;  3QAU A;  3M1V B;  3PJW A;  2PMZ D;  3J81 U;  2JJ4 D;  3QGP A;  4BWJ A;  2XYH B;  3TEG A;  5IQ6 A;  4X4T A;  4WPA A;  4I1T A;  2YWF A;  3ZZP A;  5HSP A;  2HRY A;  2Y8Y A;  5D0R A;  3ISZ A;  4O44 A;  4KC5 A;  2GMJ A;  1YI2 S;  2FUG 9;  5ETN A;  5KFN A;  4AL6 A;  2EXU A;  5IWA J;  1HQE A;  1CJV A;  3ZTR A;  3RBX A;  1CS4 A;  4XK8 C;  1H2V Z;  5HQ8 A;  1AT1 B;  1TL3 B;  4C9D A;  3UR0 A;  3WZ0 A;  5DG9 A;  1OY8 A;  4WFX A;  2GHP A;  3UO0 A;  1JXE A;  4F4A A;  5L1I A;  2P9C A;  4Q5V A;  2JOQ A;  1BWV A;  3LP1 A;  1VRQ C;  4DCP B;  4DQR A;  3R1H A;  2CPE A;  1ZM3 A;  3I5B A;  3ZTS A;  4QWE A;  2DCL A;  1SH0 A;  2PSZ A;  2FJB B;  2HNY B;  4OLP A;  4LQ3 A;  3FBF A;  3BPD A;  3BSA A;  1T0T V;  2XZW A;  3DLK B;  2IM2 A;  4FYV B;  1CQM A;  1SC4 B;  3B54 A;  5ETL A;  2VL1 A;  1I6J A;  3AJ1 A;  1HPZ A;  1SL0 A;  4X4P A;  1ZPW X;  1V5V A;  4ZMM A;  2M2B A;  3MMB A;  2DRA A;  4JI2 F;  1BMQ B;  1RT5 A;  2HGL A;  2UVW A;  1V3S A;  2K8G A;  4NRT A;  2J7U A;  1NCL A;  3CCE S;  1FRM A;  5KFM A;  1NJZ A;  3HD2 A;  3H40 A;  1YJ7 A;  1RAD B;  3LQV A;  2ROP A;  5H9F J;  5HRO A;  4FS1 A;  1NK9 A;  1HNW F;  3OR2 A;  1P9Y A;  1RCX B;  1F0X A;  2FVP A;  1HNV B;  1KTQ A;  3D3B J;  4JYA J;  4ANC A;  2H5E A;  2ZC4 A;  2HS3 A;  3HZG A;  3R27 A;  3CCL S;  2OEK A;  2GQQ A;  3LPE A;  1N5Y B;  3CMQ A;  1PJ7 A;  2AYM A;  3DOK A;  4J7C A;  4I4B A;  2N7C A;  2DH7 A;  3C15 B;  4KKO A;  1U1Q A;  3PRD A;  1WSR A;  1ZZF A;  1ZS6 A;  2D41 A;  2AEF A;  2LQ5 A;  1VGY A;  3GV5 B;  1TKZ B;  3EJM A;  1T94 A;  2YKA A;  4TQR A;  4ZLP A;  4NLX A;  3X1L B;  2NSC A;  4K4Y A;  2KFZ A;  5D0H A;  1T9X A;  4JI3 F;  4K59 A;  3AT1 B;  2RD5 C;  1ZPV A;  2P9E A;  2UXD J;  3UCG A;  1IQT A;  3QO9 B;  3MMB B;  3BJY A;  1NPR A;  2LFV A;  4LRE A;  4MKB A;  4O23 A;  1O0P A;  1AXQ A;  1X4F A;  3LH2 S;  3SXL A;  3DLK A;  1HQU B;  4GO7 X;  5F8H A;  2DNY A;  4DR3 F;  2AD9 A;  1R43 A;  3EM1 A;  2PO4 A;  4LQ9 A;  4LF8 F;  3LWM A;  1S72 S;  3I32 A;  3LW5 C;  4Y3C A;  3AHP A;  3M2R B;  3A8E A;  3KWM A;  3KJV A;  2F3J A;  3RRH A;  1DRZ A;  1UVK A;  3GZ7 A;  1I94 F;  2CQ4 A;  2HHQ A;  4FXD A;  1PJ6 A;  1XNR J;  4IYQ A;  5LXY A;  1RTJ A;  2A2C A;  1R0A A;  3DRY A;  2HHW A;  2AWZ A;  2OFH X;  2CPI A;  4MKA A;  3MPU B;  2V9K A;  4X64 J;  3RTV A;  2CVE A;  3M9M B;  2LEP A;  2DNZ A;  5I4M A;  1HHQ A;  4B9M A;  2JX2 A;  2ZHO A;  2HHX A;  1DTQ B;  3A12 A;  4ETZ A;  1J5E J;  3D68 A;  3OL7 A;  4KHM A;  1EJ7 L;  4UOC A;  5FD1 A;  5A6W A;  3EGW B;  4DLG A;  4LF9 F;  3KNA A;  1OQ3 A;  1UET A;  1TK0 A;  2ZUG A;  4UOH A;  4OMF G;  4S0M A;  1NH8 A;  3PO4 A;  1PAU B;  3DLG A;  2B8P A;  2DHA A;  3I9Z A;  3CF5 Q;  2DO4 A;  4OJ1 A;  2FPH X;  3IMQ J;  1N5Y A;  4FBT A;  2MY8 A;  2W2M P;  4BBY A;  1SQE A;  1F2H A;  2ZE2 B;  3UDC A;  2CJ9 A;  3CCU S;  2XS7 A;  1L5U A;  5HAO A;  3W9H A;  3CSK A;  3FK4 A;  4PG7 A;  5THW A;  4O3Q A;  3OHA A;  1U1N A;  1CLF A;  4ZIW A;  3BRE A;  2VD3 A;  2OPQ A;  2PE8 A;  3OSP A;  7FD1 A;  3C19 A;  4X4S A;  1I5O B;  1SVD A;  4TYA A;  3SIP B;  2FJA B;  3JQM A;  2QGF B;  1JLQ B;  5KFU A;  4FF4 A;  5D77 A;  2WB4 A;  3AOD A;  3V6J A;  3JSY A;  4RJV A;  2DT9 A;  5IV3 A;  1HNV A;  3W5X A;  5H9E K;  3AJ2 A;  3HK2 A;  4GKK J;  1FHT A;  1KDN A;  2CWX A;  2FLO A;  3DRS A;  1E6Y A;  3CXC R;  1WUU A;  2HUR A;  4IDK A;  5C42 A;  3G6V A;  2F4F A;  2VAS A;  4AQY F;  1VQS A;  2V2Q A;  2JEF A;  4OZ5 A;  4NCA A;  4PWW A;  4R5P A;  2MY7 A;  4QIF A;  2Y1L B;  4DBQ A;  1X5O A;  3M6X A;  2RAQ A;  1JWW A;  1RKI A;  1GX6 A;  4IR1 A;  2CJQ A;  2VZ9 A;  3MTJ A;  5B0E A;  3NMA A;  3K0J A;  2BXJ A;  1O51 A;  5KFD A;  1XR5 A;  4DR1 J;  4JI6 J;  1KLM B;  1HBN B;  4QQB A;  4NXM F;  2PGC A;  2BKP A;  1U2R A;  2A3J A;  1PIL A;  1S1X B;  1VQY A;  1B0P A;  2ZZT A;  4MK8 A;  2D3O 1;  2W9A A;  1BQN B;  4A47 A;  3IS9 B;  5KG7 A;  2ZZM A;  2CNK B;  4ECZ A;  1FF2 A;  1N34 F;  4RNF A;  3PKM A;  4QYZ J;  4BC9 A;  2FB0 A;  1WC1 A;  4Y0F A;  3K5M A;  1IBM F;  2HVH A;  1KQG B;  1HNI A;  1NKC A;  4JI1 J;  2XMW A;  4URG A;  1PBU A;  4ZLL A;  3E01 A;  3EZO A;  2DHH A;  1FKP A;  1RTD B;  2BRL A;  2DGT A;  5A76 A;  3GB0 A;  1NEE A;  1RWX B;  3OL8 A;  1UVJ A;  3KLI B;  3HZE A;  5GMD A;  1N52 B;  2M5Y A;  2QC3 A;  4Q7A A;  4DX6 A;  3Q8P B;  4K4W A;  1N88 A;  1S1V A;  1C4A A;  5EHH A;  4FYY B;  2KHC A;  3T6J A;  1XNQ F;  1HMV A;  2QFI A;  2AJ2 A;  1RWU A;  2DR8 A;  2C3P A;  3C16 B;  4N41 A;  1VS3 A;  2PA3 A;  3KG1 A;  1GAO A;  2NCK L;  3H25 A;  2FHJ D;  2FHJ A;  3ENW A;  4EO8 A;  4LF5 F;  4J91 A;  1VQN S;  4N76 A;  3G8Q A;  3QT8 A;  3HHL A;  2VG6 B;  2IY5 B;  3QRQ A;  3CT9 A;  1MG7 A;  4YB5 A;  2PMH A;  4F7V A;  2FVC A;  2VB6 A;  2IAJ A;  3JTO A;  3KDO A;  5E3Q A;  3ZO7 A;  1QUP A;  3DRR A;  1Y0H A;  2EFN A;  2QZ8 A;  3IM8 A;  2IFX A;  4QOT A;  3ZZU A;  3SQO P;  2B51 A;  1U2F A;  4CH0 S;  1V6H A;  1YBA A;  5DQH A;  3KK1 B;  3VHQ A;  2C3Y A;  2HYI B;  5RUB A;  3N4W A;  5DO2 A;  4DR3 J;  3MM5 A;  5ETT A;  5BYR A;  5IS2 A;  5ITH A;  4X4U A;  2AQ4 A;  2BV3 A;  3VF0 B;  3N6L A;  1B0V A;  2A1B A;  3FSI A;  2XI3 A;  5KFA A;  5CA5 A;  5L1J A;  3S7R A;  2WTF A;  1VQP S;  3FKB A;  4IH7 A;  4ZVO B;  4CO4 A;  3MCN A;  5A8K B;  5J1P A;  5IT9 U;  3IFE A;  1V3Z A;  1BQX A;  2FYX A;  3I0S A;  2H9Z A;  1REV A;  1BUX A;  4TY8 B;  2MGZ A;  1RP5 A;  1N4L A;  4R8U B;  2AJQ A;  2GVD A;  2HSE B;  2V50 A;  3MEG B;  4IFY A;  3UDV A;  4RLE A;  4QIE A;  4PG5 A;  3TJ9 A;  3OFG A;  1NHV A;  1S4F A;  3W60 A;  4FVM A;  4CM2 A;  2LQJ A;  3MOJ B;  2OFG X;  3HHL C;  3US5 A;  4M5H A;  2KVI A;  4WFZ A;  3KK3 A;  3EPG A;  4F2S A;  4CT9 A;  2RDI A;  5LSL A;  1BC6 A;  2WW8 A;  3GYN A;  1TKT A;  3DFE A;  3F0N A;  3ZFV A;  3OL6 A;  2NZC A;  4RNN A;  4DUY F;  3CD5 A;  4DL3 A;  2Y1I A;  2C2D A;  2LVW A;  2Z2Z A;  4UOF A;  3HMJ G;  3RW7 A;  4JI7 J;  1FRH A;  3D3C J;  4LRC A;  4ZPD A;  5AXL A;  3LP0 A;  3C16 A;  1NSK L;  2XY7 A;  3W7B A;  4IH5 A;  3G6E S;  1RAB B;  2YNH B;  4I6Y A;  2CYY A;  3QQC D;  1G4C A;  4PXC A;  2DRB A;  1TQL A;  3HJF A;  2KFN A;  4RKU C;  1NSQ A;  2EBE A;  3HFK A;  1K0V A;  4ED7 A;  3CDW A;  4F25 A;  4OX9 J;  3W2V B;  3TJ8 A;  2RHQ B;  5C7P A;  2R2S A;  5B0D A;  2ZH2 A;  3TZX A;  3PW5 A;  5A8R B;  1YX2 A;  5K8O A;  1IN0 A;  1DQ9 A;  1TVR A;  1PKU A;  3OJS A;  1NDK A;  2RIL A;  3FUY A;  1WI8 A;  3IAS 9;  1JLB A;  1U24 A;  5F0W A;  2R2T A;  1UA0 A;  2B7B B;  2DEJ A;  4AYB D;  3VAL A;  3MR3 A;  3FDS A;  4MIB A;  1NDL A;  2OLW A;  3KHL A;  3HHD A;  4UOG A;  5L9N A;  2W8K A;  3FSX A;  1DLO A;  2QMX A;  3MEG A;  2DR6 A;  4C3K A;  3TX8 A;  3ICL A;  3S8S A;  2A10 A;  4L3K A;  2VFV A;  4LR7 A;  3M30 B;  3OJU A;  3RZA A;  1N33 J;  2AYE A;  5DGB A;  5K9F A;  5C42 B;  3W62 A;  1SCJ B;  2RH3 A;  3MM9 B;  2I5J B;  1Q5Y A;  4PG6 A;  4X62 J;  5AJ3 F;  3MAQ A;  3TAP A;  3TJA A;  2B5J B;  3VAJ A;  3HSD A;  5KFJ A;  1Q7L B;  1Z2L A;  4DV6 J;  3PFE A;  1ZTT A;  4P73 A;  2IA0 A;  1MMN A;  3NGT A;  2ACM A;  4Y2C A;  3GG1 A;  3NMR A;  4Y2I A;  1QAY A;  3I4P A;  1Q4R A;  2M7S A;  3HVT B;  3VZH A;  3KMQ A;  1SKR A;  3CE8 A;  2IAJ B;  4J5O A;  4J9R A;  4DUZ F;  1F1B B;  3QJJ A;  2EG2 A;  2C42 A;  2F8M A;  3GJR B;  1SIW B;  2KZM A;  2NXE A;  1LWF A;  3H90 A;  1AYE A;  2CQ2 A;  2ROE A;  3EVO A;  1RAH B;  4K8R A;  2ZOG A;  4HAC A;  2K7K A;  3WHI A;  3FMB A;  2X1F A;  2N4D A;  3UD4 P;  5D15 A;  3TA0 A;  1R0B G;  3V5R A;  1JLG A;  1RYR A;  1SL2 A;  2CZ9 A;  4KGM A;  5DLF A;  5JMN A;  1FJC A;  3D0G E;  3F44 A;  3R2C J;  4DQQ A;  2QFJ A;  3ZNJ 1;  2I38 A;  5E5N A;  1D8Z A;  1IQZ A;  2BE9 B;  2X1B A;  4QWC A;  2CPD A;  1IBK J;  4DR4 J;  2GHW A;  5A0Y A;  4X65 J;  4ZS6 A;  1RT1 B;  2CXE A;  2R8H A;  2AV5 A;  4ZP8 A;  1QD1 A;  3AH6 A;  3GPA A;  1HNX F;  3DYA B;  1UWA A;  2ALZ A;  1QJH A;  2YNG A;  1S97 A;  3V6H A;  3NCQ A;  4YB7 A;  4NCB A;  2V6A A;  4FKY A;  4LSL A;  1WG4 A;  2NR0 A;  4ZJL A;  3DC2 A;  2HFN A;  3L09 A;  3BSO A;  4EGL A;  1VMB A;  1YKW A;  1VQK S;  2IC3 B;  4ELT A;  3Q2T C;  3WC2 A;  2VH7 A;  2BW7 A;  1K1Q A;  1UKU A;  4B9S A;  3CJR A;  9ATC B;  5D4L A;  1NRK A;  2OUG A;  3ZXW A;  2MLY A;  2Z2Y B;  3TW0 A;  3RBD A;  5KOW A;  2PI5 A;  1VIX A;  3T1H F;  1B70 B;  5F0U A;  1F9E B;  3NLC A;  1CG2 A;  4DX5 A;  3RAM A;  1MML A;  2X3G A;  1RLD A;  5I42 B;  4ECV A;  1JKH A;  3PR4 A;  4NA2 A;  1JLF B;  3V81 B;  1B7F A;  1SJ1 A;  2XI2 A;  1BGX T;  1FCA A;  3Q8S B;  1OPI A;  1NU4 A;  1S9E A;  2ZVI A;  3N6N A;  2KRB A;  2MQO A;  4QYR A;  3QSY B;  2G0J A;  1SH2 A;  3M4X A;  4JV5 F;  5SZT A;  3BSC A;  4JV0 A;  1IBL J;  3M6V A;  4DZ6 A;  4R0J A;  5ETK A;  4ITS A;  2XS5 A;  2OPR A;  5AE2 A;  1F2G A;  3W65 A;  1VQL S;  1U6Z A;  4GO5 X;  4NI2 B;  1ULR A;  2B4V A;  2XBP A;  3GLJ A;  3WQP A;  3RW6 A;  3Q22 A;  3QLH B;  1O5J A;  2ZDO A;  3RUB L;  2NYH A;  2W2O P;  4RU2 A;  4OHY A;  1VJQ A;  2DNK A;  1PIE A;  1RAE B;  2F8H A;  1D9A A;  1H73 A;  3DU6 A;  3M8Q B;  1TL1 A;  1HBM A;  2W25 A;  5L8R C;  1T05 A;  3FJ2 A;  4EZ6 A;  4IRD A;  1S99 A;  3GJT B;  1T05 B;  1U02 A;  2CQH A;  3MMC A;  2M9K A;  4HVZ A;  5CYM A;  1K44 A;  4CLK A;  4FYD A;  2Y1R I;  3MFI A;  2WVB A;  3FBE A;  3JQK A;  2GO9 A;  3BH6 B;  4A8O A;  2FHO B;  4KPC A;  5EUH A;  3CW2 C;  5K14 B;  3A4T A;  3KKF A;  1R0C B;  4NPO A;  4NLD A;  3G6Y A;  2DNG A;  3ETO A;  3OR2 B;  3V6D B;  4FNH A;  5HAT A;  1DTT B;  2XYP B;  1X4B A;  1PGZ A;  5D4N A;  1KQS R;  3H5S A;  2R7W A;  1WTB A;  2F4V J;  4JI5 J;  3R5J B;  5CAB A;  1LFP A;  4N56 A;  3V81 A;  3G9C A;  4ID5 B;  3N6M A;  2UUT A;  1WEZ A;  4Q2M A;  3T5J A;  4JI0 F;  5F8L A;  3TYT A;  4IFV A;  5AE1 A;  4ILM A;  2HFV A;  4OX6 A;  2FHK A;  1VFJ A;  1MWQ A;  4TLR A;  2HS0 A;  3QAT A;  3SFG A;  4DL4 A;  1QE1 A;  2NRE A;  1C0U B;  1R8A A;  2DNM A;  2E5I A;  2BJ1 A;  1U0H B;  1Y3J A;  2IDL A;  2VG5 A;  2OO4 A;  2DIU A;  4M5M A;  4RW6 B;  1S0O A;  4DPU A;  7AT1 B;  4USU A;  1S6Q A;  5DDQ C;  1L3V A;  2PFF B;  1TVR B;  3I9V 9;  3ZNU A;  2XO7 A;  3FBB A;  2GMH A;  1ZTW A;  2ZKU A;  3DXS X;  4ES3 A;  4PZV A;  5EGY A;  5KFP A;  2IRU A;  1NND A;  2GO8 A;  2Q6C A;  2ZH5 A;  1TL3 A;  4BC7 A;  1U8S A;  5B0B A;  2P6T A;  2VV5 A;  3DGP B;  3P5T L;  2MTL A;  4YHH F;  5FDL B;  2XZD B;  2BJ9 A;  1SJQ A;  4ILR A;  1CVJ A;  1XJW B;  3FBC A;  2QO3 A;  1F5C A;  4OJH A;  3NXZ A;  4HTI A;  2YNH A;  3NP5 A;  1S12 A;  4LSZ B;  3I0R B;  4C6A A;  2CWK A;  1PO6 A;  3Q8Y A;  2JDJ A;  3WX8 A;  5KFT A;  2HGM A;  2WB1 D;  3HVA A;  1U26 A;  3OXL A;  2O5D A;  3NS5 A;  1L3T A;  2W9C A;  1CC8 A;  5KFW A;  1N54 B;  2LU2 A;  5KFR A;  5I3U B;  2RHS B;  3LAL A;  1R8B A;  3KG0 A;  3TAN A;  1SKW A;  1DZ5 A;  2XLK A;  4FBU A;  1R27 B;  3EZ5 A;  5LMN J;  5T14 A;  3CDB A;  2DR9 A;  2J6T A;  1KVK A;  2WZ1 A;  3PNI A;  4ED1 A;  3JQJ A;  3D66 A;  4AFF A;  5GAE U;  2CQ1 A;  2MZJ A;  4WJB A;  5J1N A;  3SEO A;  4IUF A;  2UUA F;  1M1G A;  1REV B;  2GA7 A;  3C15 A;  3AFG A;  4RW9 A;  4TY8 A;  4XDD A;  2RRA A;  2KTQ A;  2FJV A;  1WWH A;  1HW9 A;  1T9W A;  2B5J A;  1WAC A;  5KFI A;  1LK7 A;  2F8E X;  4C8N A;  3TX0 A;  2X1A A;  1YGY A;  1NKE A;  4DR6 F;  3JAM U;  2H5J B;  1VK8 A;  3KUG A;  1PJ5 A;  4TU8 A;  2MQ8 A;  1YSJ A;  2E7V A;  2UVR A;  1U49 A;  4FP9 A;  1CJU A;  2DY1 A;  3L7P A;  5KG4 A;  2DGV A;  3CCT A;  4OZ1 A;  2XMM A;  1VQ4 S;  3NOC A;  4NCG A;  3G82 A;  7FDR A;  2BAC A;  2C2O B;  2KO1 A;  2NSB A;  3POT A;  5GAH I;  4QU7 A;  2KZZ A;  3DLB A;  2NUU G;  3BF4 A;  3SCL E;  4B9N A;  3PDN A;  1RAC B;  1SPB P;  3AQO A;  1TAU A;  3J80 Y;  2DR5 A;  4K4V A;  3Q2S C;  2G4B A;  4NYO A;  2MKK A;  1HR0 F;  1VC5 A;  4M5D A;  1QAX A;  4TXS A;  3I82 A;  3KJF B;  2CFX A;  3GE9 A;  3M8P B;  2JFD A;  3D67 A;  1RCO B;  4CLF A;  1R89 A;  3IR6 B;  1RWN B;  1RLC L;  3DXB A;  2AP6 A;  2Z2L A;  4NZ6 A;  1CPZ A;  1Q8K A;  3EXC X;  1WOS A;  3GCX P;  5DJB A;  5D0E A;  1T02 A;  2MEW A;  1N56 A;  1TMM A;  2J9C A;  2AU0 A;  1YZ7 A;  2JVR A;  2Q43 A;  2R7X A;  2ASY A;  4I67 A;  1NDC A;  4MJK A;  5DET A;  3NAH A;  4RUC A;  2ATC B;  2HQG A;  2U1A A;  1ROF A;  3HP6 A;  4DFM A;  1WF2 A;  1GEH A;  5CYQ B;  1K73 T;  3Q24 A;  2D1C A;  2WOM A;  4FPR A;  4UY8 T;  3EDR B;  3J7A 1;  3DHX A;  3AD8 C;  1N36 F;  3HKZ D;  2Y0B B;  2HAF A;  1WKJ A;  3ILO A;  2MZ1 A;  2NPF A;  3BBB A;  1IR2 A;  2CPF A;  3LGM A;  1RT2 B;  4C2M A;  1EQ0 A;  2HS4 A;  4ZCM A;  4MYT A;  3ETM A;  2G9O A;  1FJG J;  3IR7 B;  2HG4 A;  5BR8 F;  1S1X A;  3EIC A;  4OHX A;  2JEI A;  4MKV A;  5KG1 A;  2MST A;  4U9R A;  4MK7 A;  1AW0 A;  1VLY A;  3JXO A;  2GJ2 A;  4LT6 A;  3MFH A;  2HWI A;  2FGC A;  2KM8 B;  1S59 A;  4MT1 A;  1NJI T;  4JI1 F;  1GMW A;  3H2U B;  3LTO A;  3W8G A;  4W90 B;  3KOA A;  2HW3 A;  1U45 A;  3QWP A;  1TAQ A;  2J8S A;  2YTC A;  1FFS B;  1RHM B;  5IM0 A;  3P49 B;  3IG1 B;  3MI7 X;  1HD0 A;  1H7X A;  3E3X A;  4PXD A;  2MXY A;  3PIP Q;  3OSN A;  3G82 B;  3MEC A;  5LJ3 Y;  4DHV A;  1JJC B;  4NMX A;  4Q2L A;  1ZBT A;  3K7R A;  3ZTO A;  1SQG A;  1MWY A;  1UTA A;  2P9G A;  2R9L A;  3OUY B;  1Y4Z B;  1VBY A;  2V34 A;  4IH6 A;  1RBL A;  1S1T A;  2YQ3 A;  8AT1 B;  4MFB A;  3OTO F;  2F65 A;  3DOM B;  2GV1 A;  1NSP A;  4WE1 B;  2LQB A;  1GMV A;  3ONQ A;  4NXN F;  1ZM9 A;  2V67 A;  3SDE A;  2VDH A;  4ZLJ A;  5EWG A;  2Z8Q A;  4ECR A;  4AQY J;  1T9T A;  1TK8 A;  2CPY A;  3ENV A;  1LFW A;  3KTQ A;  1PC5 A;  4C0O C;  2JFK A;  2OD4 A;  5KFQ A;  4F02 A;  4QW9 A;  5JXS A;  2ZZN A;  2CAD A;  2CZ4 A;  4MYU A;  5KT7 A;  1QSL A;  1S77 D;  1RA6 A;  5I3U A;  3PY8 A;  1EP4 B;  1HD1 A;  3MM7 B;  4LVO P;  4RX6 A;  3B6B A;  4ZIT A;  3LWL A;  3BO2 A;  4JI8 J;  3NNC A;  1M5S A;  2KT3 A;  1A6L A;  1YJV A;  1OJ4 A;  2GGP A;  4ICL A;  1RJJ A;  1IUJ A;  4USK A;  4PR6 A;  1KFD A;  2RVJ A;  1AUS L;  1IXK A;  5L39 A;  3T5H A;  4KO0 A;  3CJT A;  3ULH A;  4RPF A;  2KL8 A;  5KAK A;  4RBV A;  5J2P A;  1UVI A;  4OI2 A;  2ZWO A;  1LWC A;  4K4Z A;  1YLX A;  4NYP A;  4OZL A;  4KGV B;  3BQ0 A;  3CIZ A;  2O01 C;  3C46 A;  3MPY A;  4OI4 A;  3B82 A;  3SCJ E;  4ES2 A;  2XMK A;  2VBZ A;  4KJI A;  1VI7 A;  3IS9 A;  2HVZ A;  3NGS A;  1GT8 A;  1FXR A;  3MR7 A;  1B99 A;  4NLO A;  5A8W B;  3KJV B;  5DGA A;  2RF2 A;  1S6Q B;  2XWY A;  2ZH7 A;  4LF6 J;  3BDP A;  2UXB J;  1TEL A;  2D9P A;  2AJ1 A;  4FDF A;  4OYB A;  4CO2 A;  2FZG B;  3JTP A;  1FRK A;  2I0X A;  4OJ3 A;  1M90 T;  5EX3 A;  3W63 A;  4WFA Q;  2V68 A;  2Z56 B;  1FWL A;  4QR0 A;  4WYW A;  3TNV A;  4OZN A;  1MRO B;  1CSJ A;  3K5L A;  4WCE Q;  3PW4 A;  2VQE J;  2YX1 A;  2ZD1 A;  3OW2 R;  4UY8 5;  3HT0 A;  3WDO A;  4JOU A;  4Q8F A;  1UA1 A;  2UVU A;  1LWE A;  4G1Q A;  4WU3 A;  4NCG B;  3OT9 A;  2AEM A;  2XB2 D;  4P6Q A;  5I3Q A;  1CC7 A;  1DTT A;  3DRS B;  4L72 B;  1UCN A;  3GIM A;  3K17 A;  1NB2 A;  1IKX B;  4YR0 A;  2OSQ A;  1ZET A;  2P5V A;  5AXN A;  2EG1 A;  2EKY A;  1VQ7 S;  4KKO B;  3I87 A;  4USH A;  1LXN A;  3BGR A;  1HWK A;  1P9Q C;  1PYO B;  4QIG A;  1RHK B;  1HI8 A;  5AT1 B;  4CWB A;  5K8N A;  3KLG A;  3TP2 A;  4DL5 A;  3KLG B;  3OL9 A;  2GCF A;  5HK4 A;  2MKH A;  1S1U B;  3G71 S;  2YH1 A;  1NBE B;  4EYH B;  4KGK A;  2JEJ A;  4B3T J;  1UL3 A;  2KI2 A;  2ROG A;  3E51 A;  3M32 B;  5CHC B;  4YEA A;  4WFN Q;  4PXB A;  4MTP A;  4WKR A;  3D7S B;  2EPI A;  5HP1 A;  4UUX A;  4ZVG A;  1QUV A;  2HBZ B;  3H59 A;  2A2D A;  3DLJ A;  2GNK A;  4NLW A;  2F1F A;  5BYS A;  2BOP A;  2DXF A;  1QTN B;  3GIR A;  5CYM B;  2FJW A;  1P6T A;  4DR5 J;  3ELH A;  5KTQ A;  2QN6 B;  3R7B B;  4Y28 C;  1OS5 A;  3P3D A;  4E2F B;  2HQI A;  4Z37 A;  2VKR A;  2LQ9 A;  1UWB A;  1FRL A;  4Q0B B;  2HHP A;  4ZHR B;  4HEA 9;  4DR1 F;  1PCA A;  5CZV A;  5F8I A;  1FNX H;  4E0D A;  2DXD A;  1RT4 A;  4TQS A;  1W25 A;  2L41 A;  3EYZ A;  2BM0 A;  3C6U A;  2V8G A;  3KLH B;  1FEH A;  3PM9 A;  3DMJ B;  2RQ4 A;  2ZWP A;  3JAM Y;  5HQM A;  5DG7 A;  4DFK A;  2OJ3 A;  2FJE B;  1R0A B;  3IM9 A;  3N79 A;  1Q7Y T;  2QG9 B;  4OHZ A;  2VJU A;  3OR1 B;  4U96 A;  1KP6 A;  2RML A;  3UCZ P;  4DQI A;  3UNG C;  3K58 A;  4NLU A;  3EPI A;  3KUE A;  1JMT A;  1S76 D;  3SBM A;  3PX4 A;  3MUT P;  1LWC B;  5LOQ A;  4CTA B;  1C2P A;  4USI A;  1RQ0 A;  2PC6 A;  2X7I A;  3JSR A;  3ZZR A;  3PYD A;  3FGV A;  1RT1 A;  1WC4 A;  2DNQ A;  2GIF A;  4KT0 C;  4O44 B;  1FX4 A;  1R8P A;  1EET A;  4WKY A;  2JEG A;  2QEX S;  2WVE A;  4X4V A;  2EFV A;  1FNM A;  2C2N A;  2YX4 A;  3AXK A;  4O4G A;  4C8L A;  4CLS A;  4BLG A;  4DSI A;  2WON B;  2MB0 B;  1MNE A;  3KLE B;  2HQD A;  1CQN A;  1LW0 B;  2RKI A;  3DDN A;  4YY3 J;  1S0N A;  2DR7 A;  1SXL A;  2Q6B A;  2MQN A;  2NXN A;  3VCD A;  1K47 A;  1RA7 A;  2GX8 A;  2J9D A;  4DMZ A;  3QFW A;  3DDI A;  3Q89 A;  4OYM A;  2G2O A;  4C11 A;  4ECQ A;  3JTN A;  1K9M T;  1IR0 A;  3VVT A;  3IN5 A;  2DNO A;  1J5O A;  3GFZ A;  1VQO S;  4LBI A;  2W4D A;  3QJP A;  1D3W A;  3A1Y G;  3PRB A;  2K06 A;  4ED6 A;  3T9N A;  4F04 B;  3M9N B;  4B9U A;  2EEY A;  2IM1 A;  5K5M A;  3DLE B;  3NWR A;  2B4O A;  4JB8 B;  1Q79 A;  4K0K F;  3DOK B;  4H4K A;  3KMS A;  4JV5 J;  1RHJ B;  2YQ0 A;  1RWW B;  1HBM B;  1NLK L;  4OYX A;  1F6T A;  2AYB A;  4JV2 A;  1JLA A;  4I2Q A;  2XWX A;  3PR5 B;  3SSQ A;  2AIR B;  4USM A;  4ZLN A;  3G96 A;  2ZJQ Q;  2H4Y B;  1N32 F;  2HBY B;  3TQ1 A;  1FA0 A;  3DKD A;  3FFI A;  4ID8 A;  2EI5 A;  5ETQ A;  3HVT A;  3M8R A;  3MAH A;  2H5I B;  2XMJ A;  4A8Q A;  2H4W B;  2VC0 A;  4ZPT R;  3KXD A;  4ATN A;  3NBP A;  2K3K A;  4CO5 A;  2DPI A;  4RW4 B;  2AGO A;  1QAI A;  1JLF A;  1UEK A;  2N3O A;  2IDE A;  4LIR A;  4LMZ A;  1WOO A;  2BOA A;  2IYI A;  3PAC A;  1TUW A;  3GON A;  3IRX A;  3DDK A;  3PTW A;  2V4Q A;  5J2M A;  3W9J A;  4C3L A;  5HQL A;  1QDU B;  1WHY A;  1RT2 A;  1ITP A;  2OPS B;  2F7V A;  2QLF B;  2DHS A;  4LFB F;  1DLO B;  4NLR A;  1RWM B;  4W92 B;  4LFA J;  3H5X A;  3PZP A;  2GAH C;  3BPS P;  2CQC A;  2CG4 A;  3NOG A;  1RAF B;  3SZ2 A;  1U1O A;  1CJV B;  1HQE B;  1M0S A;  2OP5 A;  4P7V A;  1KFS A;  1WC5 A;  1FK9 B;  1WHX A;  2XO6 A;  1DY3 A;  2EK1 A;  4DX8 H;  4I2P A;  2BE2 A;  2FTR A;  3J7Z T;  3OFE A;  1S9F A;  1O8B A;  4RWW A;  2WSC C;  3VTI A;  4ERD A;  3MOZ A;  1L3S A;  2UP1 A;  4A8K A;  3MPD A;  1U0S A;  2G13 A;  2QT7 A;  4ZVE A;  1ACM B;  1S7H A;  4RUH A;  3AD7 C;  2FY1 A;  1GTH A;  1Q78 A;  4I7F B;  2BJ3 A;  3HJV A;  1FT8 A;  2W4P A;  5G4D A;  2OKQ A;  5KG5 A;  4NLV A;  3M8W A;  4HAC B;  1FRI A;  4KHR A;  3MXH P;  1TV6 A;  2ZBI A;  3TOQ A;  3D6F B;  2GJI A;  2IJF A;  5HMZ A;  1KVJ A;  4H4O A;  4V19 X;  1EKS A;  4ZIV A;  2KG0 A;  2CNN B;  1N33 F;  2AEJ A;  2FJD B;  4A8X A;  3RRK A;  5FLX Y;  3KLF A;  5JVH Q;  1LXJ A;  1YRT A;  5D3G B;  2DTJ A;  1R6V A;  2FLP A;  2MGZ B;  3UR3 C;  2CJK A;  2YNI A;  2C3M A;  2HLU A;  1JB0 C;  5D8H B;  3BKF A;  2LDI A;  1ICE B;  1LQ9 A;  1CJU B;  1WJ9 A;  2VPZ B;  5KFF A;  2KXF A;  4J9O A;  5D6G A;  4CLL A;  1LV5 A;  1AZS B;  2R7V A;  4HR2 A;  2CPX A;  4DSJ A;  3BBF A;  4NLT A;  2DGX A;  3W5Z A;  4ZCK A;  3MUM P;  4OZJ A;  1S6P B;  2YVS A;  3HHL D;  4FPI A;  4CLW A;  2XEX A;  2YNF B;  1N5T A;  4OI3 A;  4PG4 A;  4U8Y A;  4IFY B;  2IBO A;  4C0B A;  2XMA A;  3IBF B;  4LF1 A;  4LF6 F;  1A0O B;  4WF9 Q;  4J9M A;  2B6A B;  3CCQ S;  2YKQ A;  3DRP B;  2BQ3 A;  4JI5 F;  1WG5 A;  2IVM A;  2LQ8 A;  4ZJQ A;  4CIO A;  2XCP A;  4A8S A;  3KLF B;  3CDA A;  4ZVF A;  3MR6 A;  4KFB A;  4HHH A;  1FDB A;  2X51 A;  3FZ2 A;  4G3I A;  2ZUA A;  3U1M A;  4QBU A;  5KFG A;  3TI0 A;  4ELV A;  3CTR A;  4URS A;  5HJY A;  3A13 A;  1C0T B;  3MM5 B;  2VG6 A;  4A4J A;  3WIU A;  3QBC A;  2NLW A;  1TV6 B;  2E1A A;  1NHK L;  1XMO F;  1JLB B;  2VFR A;  3C8Y A;  4JI0 J;  5DZ6 A;  1JLA B;  2BQU A;  2V2V A;  5E3R A;  2I1R A;  5IV4 A;  4DV1 J;  1SI9 A;  3KJN B;  4QR2 A;  4F3Q A;  5M2P A;  1RHR B;  2WSF C;  5KG2 A;  4WWS A;  5EWE A;  3MTK A;  5B09 A;  3M9O B;  3TAR A;  2AJ4 A;  4JI8 F;  5HVH A;  2WRM A;  3FCW A;  3W2V A;  2BZ2 A;  3RBZ A;  1TUG B;  4KQZ A;  1XIQ A;  5FII A;  1RTD A;  2RUG A;  2A6O A;  4FXW A;  4XO0 A;  4UF4 A;  3PW0 A;  1Z2Z A;  4B3T F;  3IO1 A;  2EVZ A;  2MHE A;  1KOH A;  3QGI A;  1FX2 A;  4Z7C A;  5CYJ A;  3Q8U A;  1X9M A;  2XMT A;  2YKM A;  4HL9 A;  2CQI A;  4O0I A;  3QSI A;  4Q44 A;  3GU0 A;  2VA3 A;  3LP0 B;  4LBP A;  4JI7 F;  3T41 A;  5J2Q B;  2EFG A;  2FZK B;  2JVO A;  3DN9 A;  3TAQ A;  4FF3 A;  2MDA A;  1URR A;  2XS2 A;  2XLJ A;  1OYE A;  4IRK A;  1C0T A;  5A2Q Y;  4ECW A;  4N8O A;  1N8R T;  2UVV A;  3GFY A;  3DRX A;  3MGJ A;  3Q8R B;  1K1S A;  4HLB A;  2H51 B;  3GFH A;  1SC1 B;  1KR4 A;  2WVF A;  4KV8 B;  4N8N A;  1U1P A;  1HNW J;  5DS7 A;  2B9X A;  3CC2 S;  1LKZ A;  4K7Q A;  5U47 A;  1KS2 A;  2XMV A;  2I6W A;  2E5L J;  4O0N A;  5E3C A;  4LFB J;  3EGV A;  3W66 A;  5GMK a;  1SIZ A;  1VC6 A;  4DQP A;  3FMW A;  2P2C B;  1O6X A;  3W5Y A;  3H2L A;  4JBC A;  2PN6 A;  2HRT A;  4F0M A;  3BKT A;  3M8Z A;  5F3T A;  4USJ C;  2R7Q A;  3M8Y A;  4DS5 A;  3FEY B;  2QA2 A;  5C25 B;  3FRZ A;  3TQE A;  5LJ5 Y;  1G2E A;  1ZA1 B;  2EW9 A;  3D5M A;  3HM9 A;  4RL1 A;  2KM8 C;  1IVZ A;  3GP9 A;  4HHU A;  4ZVH A;  1G6B A;  3KK1 A;  4CO3 A;  4K0K J;  2DO0 A;  2E5H A;  4DV2 J;  1X9W A;  2BDP A;  4CO0 A;  3DGV A;  4O3O A;  1R3N A;  1D09 B;  2MZT A;  5HVF A;  4R5P B;  5LT5 A;  4PQU A;  4LRF A;  3ZZY A;  4QPX A;  2AF6 A;  1HL6 A;  2BAN A;  2R2R A;  2XYG B;  3R5D A;  3BEG B;  5F8M A;  3TEH B;  3AOA A;  2YXL A;  5K8M A;  2QL5 B;  3EUN A;  2I8E A;  4O3S A;  1WF1 A;  1YRX A;  3NCR A;  1S1U A;  4Z7Y A;  2VJV A;  4L3N A;  3A3P B;  1V3R A;  3DLG B;  3K59 A;  1KD1 T;  3CVK A;  1URN A;  3N01 A;  2F5G A;  1N36 J;  5L1L A;  2C2M B;  3NRB A;  3WIV A;  4YUD A;  1V5I B;  4IO9 Q;  1JKH B;  1FD8 A;  1M5H A;  4X4N A;  3CPW R;  2GC8 A;  4EYI B;  1B4S A;  1IKX A;  1RWK B;  4IKA A;  4Y34 A;  2Q3P A;  2GVZ B;  3B4M A;  3T19 A;  4YB1 P;  5LSR A;  1HR0 J;  1A7G E;  1T95 A;  3UI3 A;  3GII A;  3TO8 A;  1HHS A;  2AKW B;  3BR8 A;  2NPI A;  4AXI A;  3QMQ A;  1LW0 A;  2RKI B;  3T3F A;  2IM3 A;  1S49 A;  2WON A;  1MRO A;  2CIM A;  1ZAW A;  5A2Q U;  1VHF A;  3OR1 A;  2EFQ A;  4WFY A;  5IT4 A;  4X4R A;  2ZH9 A;  1EET B;  2MPU A;  3U1L A;  4B3S F;  1SC6 A;  1RAO A;  4DEZ A;  1F5A A;  2ZH4 A;  1U1R A;  2LA6 A;  3E8O A;  5J1E A;  3HPO A;  4FNI A;  2BE7 D;  3BN7 A;  5A0Y B;  2DRD A;  4DPO A;  1UVL A;  2XHC A;  2DPJ A;  2WHO A;  2X1G A;  5KFS A;  2QRR A;  4ZN3 A;  1XQI A;  3WC0 A;  2ZH3 A;  2APO A;  1RTJ B;  2ZNY A;  3GTY X;  2E9R X;  1NPK A;  5E7O B;  2OTJ S;  1DQ8 A;  5LMN F;  2CNL B;  2D74 B;  3W8P A;  2EWH A;  3D28 A;  2KN4 A;  2DGW A;  1MN7 A;  3UWT A;  3T5K A;  1VQM S;  2MQM A;  2VFT A;  4CM0 A;  1K0T A;  5K8P A;  4A8W A;  5HP1 B;  3FFI B;  4GKK F;  4DFJ A;  2DGU A;  1ELO A;  4RW7 B;  2VC1 A;  1RU1 A;  4CDI A;  2C2E A;  2CVI A;  2R42 A;  2OIH A;  3D1O A;  2E9Z A;  1IJE B;  5CH7 B;  2LXU A;  1WHV A;  1S9G B;  3LAK A;  4FVC A;  2XCA A;  5JVG Q;  2G0I A;  3IXQ A;  1OQ6 A;  3BGR B;  4WK3 A;  5CCM A;  2L9W A;  3ZZO A;  5EWF A;  4KH1 B;  1LEO A;  2ZHA A;  2VQF F;  3MM9 A;  2W1B A;  2GHV C;  3GIJ A;  2CA9 A;  1MSW D;  1S5Z A;  1VK3 A;  5DDO C;  1RBO B;  3MUV P;  3K57 A;  4DV7 J;  2DIT A;  3Q8V A;  2ALY B;  1OYD A;  1FKO B;  2XZT B;  3AOC A;  2ZE2 A;  2M52 A;  4G65 A;  3GWC A;  4YY3 F;  5DRK A;  5KFK A;  3AOB A;  3HLU A;  3MCM A;  4ECX A;  3RU0 A;  4CLY A;  3TZW A;  2W8L A;  1CJT A;  2FGO A;  3K2Y A;  5IOL A;  4MFB B;  3UCU P;  3CD0 A;  1S9G A;  1Q16 B;  1GK8 A;  1VIS A;  4K2X A;  4O4G B;  2CJY B;  5HMW A;  2O67 A;  3A3O B;  2RU3 A;  3A3N B;  5F8N A;  1X4H A;  3PW2 A;  1Q95 G;  4LJM A;  4KPY A;  4ED4 A;  5LMU J;  1S48 A;  2J8A A;  2OAU A;  2OHD A;  5B0G A;  5LSO A;  1W2I A;  2LU1 A;  5T7L B;  5KFV A;  5HRO B;  2XY6 A;  2H48 B;  3K5O A;  3IR5 B;  3MR2 A;  1Q82 T;  2UU9 J;  4PAA A;  2DGO A;  4NYZ A;  3BYR A;  2VKZ G;  3IG1 A;  2AMC B;  4NZ0 A;  3Q83 A;  4Q45 A;  3ISN C;  1X60 A;  1YDL A;  4HDH A;  4XPE A;  2MKI A;  3OLB A;  2KXH A;  3ZZZ A;  5B08 A;  1TK5 A;  5KFO A;  2HZC A;  2XY5 A;  3O44 A;  5CXT A;  2PT0 A;  3AJD A;  3R7N B;  1I1G A;  4WII A;  4DV0 J;  4ELU A;  2AJ0 A;  4OLO A;  4HYK A;  3C6U B;  3IWL A;  4ZPW R;  2LCW A;  2HZV A;  1P1L A;  3CJ5 A;  3J81 Y;  1RBA A;  2LXI A;  1UVN A;  5DZ7 A;  1NJW A;  4JI4 F;  4LF5 J;  3K5P A;  5HN0 A;  1GX5 A;  2E5J A;  3KHG A;  2A0F B;  3BKU A;  1IBC B;  3BS9 A;  4F4W A;  2DCU B;  4H4M A;  1SV5 B;  1UWB B;  5E41 A;  3L9Z A;  1SJ3 P;  4DSL A;  2BW2 A;  1M1H A;  1WF0 A;  4OL8 A;  3LPY A;  3QIP A;  1GNK A;  4A8Y A;  2RSQ A;  4P75 A;  2YPY A;  3M1V A;  2ZJR Q;  2CPH A;  3R2D J;  2UV8 G;  2ZC3 A;  1T03 A;  3KNG A;  1EP4 A;  2DNR A;  4A48 A;  2VOD A;  2RRB A;  4A8F A;  1CS4 B;  1Y5I B;  3QT6 A;  3AY0 A;  2HFU A;  3D6T B;  2HBQ B;  4CYU A;  3CJ0 A;  4RUA A;  2HHH J;  1XEZ A;  4J9S A;  1SKU B;  4YDD B;  1L3U A;  2R3V A;  4ED5 A;  5CCL A;  1HI0 P;  1VRU B;  2MYF A;  3R3T A;  2AX0 A;  1KHW A;  2MKJ A;  4IOB A;  5IZH A;  1Q5V A;  3UFC X;  1HWU A;  4DDF A;  4JP8 A;  2K7J A;  2M8D B;  2IRX A;  3BB5 A;  1RT7 B;  5ETP A;  1OIA A;  1EAR A;  1V9O A;  1QSY A;  2QSW A;  2UXC J;  3WBZ A;  1U09 A;  4GVL A;  4BWM A;  3VQT A;  5KT3 A;  1U2C A;  2BAN B;  4U7U K;  1T9Y A;  4PUO B;  4EBE A;  1N34 J;  2J7K A;  1YJR A;  2ZD1 B;  1GFW B;  2IMW P;  4M5L A;  3HT3 A;  5IM0 B;  2HFS A;  5KG0 A;  1RTI B;  1XTZ A;  2N4C A;  2C3U A;  2MLZ A;  4AD6 A;  5AXK A;  1QLN A;  4MKY A;  3FZB A;  4WP8 A;  2AX1 A;  3J7Y U;  2EC2 A;  4X84 A;  4FS2 A;  4B3M F;  4NAS A;  4K4X A;  4DN9 A;  1Y3K A;  5GAG I;  2E1R A;  2KJV A;  4UTG A;  4XDC A;  2D7S A;  2W7P A;  5HO4 A;  3HSJ A;  2D3U A;  4GRS A;  1NSA A;  1N5S A;  3HO1 A;  3SFU A;  4DR4 F;  3M2V A;  3VGS A;  3LP1 B;  4WK1 A;  3HUL A;  1QTM A;  1U6B A;  3IGN A;  2XNR A;  4LRA A;  2QMW A;  1ZM4 A;  2DBB A;  4DV5 F;  4WXO A;  4QIV A;  4C8M A;  1IKY B;  2DKO B;  3ET6 B;  2HQC A;  3B8H A;  3W2W B;  4DJB A;  4B3S J;  2R7T A;  4YB6 A;  1SKS A;  2V8P A;  3U02 A;  2KB2 A;  2F9J A;  3E01 B;  3M8S A;  2L48 A;  2D3Z A;  2DH9 A;  3WX4 A;  2DNL A;  4XAK A;  4U8V A;  3MEE B;  1RT6 A;  1SJR A;  1VHI A;  2BJ8 A;  5F3Z A;  2KKH A;  4U67 Q;  1Q8L A;  4CNY A;  1TP7 A;  3D0I E;  4X4Q A;  2MLX A;  4P74 A;  4LF2 A;  2GGP B;  4ICL B;  5E3P A;  1X0F A;  1M5K C;  4H4M B;  1HFE L;  1VCT A;  1APS A;  5KOX A;  3KG4 A;  2AZ3 A;  2WOM B;  2JZ5 A;  5KT2 A;  4HH0 A;  3L3C A;  4EO6 A;  4YQW A;  1R7I A;  4DPY A;  1PYT A;  1OY9 A;  1L3K A;  3H7H B;  1UJ6 A;  3VGT A;  1UPM B;  3M8P A;  4YHH J;  1DUR A;  4X66 J;  1RUS A;  5AJ3 J;  2J0Q D;  3NNA A;  1SJ4 P;  3D54 A;  2RRN A;  3Q23 A;  2W9B B;  2DVI A;  2PEH A;  4J9U E;  1RTI A;  2ZOM A;  3H0P A;  5GME A;  1XNR F;  3L4B C;  3M2V B;  4CNZ A;  2LXF A;  4DV3 J;  4LSN A;  3QZ7 A;  2IHR 1;  4I56 A;  4G6V B;  3RAQ A;  2BJD A;  4PUO A;  2COL A;  1C1C B;  2PFD A;  5EN1 A;  2UU9 F;  4AUK A;  4EEY A;  4ZPV R;  4PQA A;  3D2W A;  3LP2 B;  1TL5 A;  4MK9 A;  4M5D B;  1SL1 A;  4H54 A;  1BE4 A;  2CQD A;  2XSJ A;  3HCX A;  2VBX A;  4DLE A;  1X7V A;  3GIK A;  2MZQ A;  2AW0 A;  2OML A;  4ENO A;  2XNQ A;  2Q1L A;  1AA1 B;  1FD2 A;  1UFK A;  4WXW A;  1JLQ A;  3RR8 A;  1JK9 B;  4P52 A;  4NLS A;  4WZM A;  3POT B;  1RB0 A;  3CDU A; 
#chains in the Genus database with same CATH homology
 4OX9 J;  4LF5 J;  2UUC J;  4RJV A;  4LF7 J;  1I94 J;  4B3T J;  2KVQ E;  1HNZ J;  4GKK J;  4KY3 A;  5FLX U;  3R2D J;  1FJG J;  4DR6 J;  4DV4 J;  4PWW A;  2F4V J;  4JI5 J;  4DR5 J;  4LF8 J;  3T1H J;  2HHH J;  2VQF J;  4DR2 J;  1XNQ J;  1HR0 J;  4DR1 J;  4JI6 J;  1N33 J;  4DUZ J;  4JI2 J;  4DV5 J;  5A2Q U;  5LM7 E;  4X62 J;  2UXC J;  4JYA J;  3D3B J;  4NEY A;  4JI4 J;  4B3R J;  4LFC J;  4JI1 J;  4DV6 J;  1N34 J;  2MTL A;  4NEZ A;  4AQY J;  3T1Y J;  4GKJ J;  1XMQ J;  3J7A N;  4JI0 J;  4YY3 J;  3OTO J;  4B3S J;  2ZM6 J;  4JI8 J;  4DV1 J;  4NXN J;  2UXD J;  5LMN J;  3R2C J;  1IBK J;  4DR4 J;  2KL8 A;  4X65 J;  4JV5 J;  3J80 U;  4LF4 J;  3JAM U;  1N32 J;  4DR3 J;  2UUA J;  2MQ8 A;  1XNR J;  4DV7 J;  4NXM J;  1IBM J;  4KHP J;  1HNX J;  5BR8 J;  4X64 J;  4V1A k;  4KYZ A;  4LF6 J;  5IT9 U;  2UXB J;  4YHH J;  4X66 J;  5AJ3 J;  4JI3 J;  1J5E J;  4DR7 J;  1HNW J;  2E5L J;  5LMU J;  4DUY J;  2VQE J;  4LFB J;  4DV3 J;  1XMO J;  3IMQ J;  1IBL J;  2UU9 J;  2UUB J;  4JI7 J;  4LF9 J;  3D3C J;  3J81 U;  2MEW A;  4LFA J;  3W1Y C;  4HHU A;  4DV0 J;  4B3M J;  1N36 J;  4K0K J;  4DV2 J;  5IWA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...