1I94J

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1i94J00
4JI1J 4NXNJ 4LF7J 4B3TJ 4LF5J 4LFCJ 4RJVA 2VQEJ 2MEWA 4DV2J 4LF9J 1IBMJ 2ZM6J 2E5LJ 2UXCJ 4OX9J 2UU9J 4B3MJ 4X62J 1FJGJ 1J5EJ 5IWAJ 5FLXU 4DR4J 4DV7J 3R2CJ 2UXDJ 4LF4J 3J81U 1N32J 4JI3J 4NXMJ 4NEZA 4KY3A 1XMQJ 4DR2J 4LF6J 3T1HJ 4DV0J 5AJ3J 3R2DJ 4JI2J 4X66J 4PWWA 2HHHJ 5A2QU 2VQFJ 4LFBJ 4NEYA 3JAMU 4JI7J 4DV4J 3IMQJ 4DV1J 4JI5J 2F4VJ 4GKJJ 4YHHJ 4DR3J 4LFAJ 1HNZJ 4DUZJ 1N34J 2KVQE 4DV6J 5BR8J 4DR7J 2MQ8A 1XNRJ 3T1YJ 3D3CJ 4GKKJ 4B3SJ 4DV3J 4X64J 4V1Ak 2UUAJ 2UUBJ 2MTLA 2KL8A 4HHUA 5LMNJ 5IT9U 3J7AN 4DV5J 4JI4J 4DR1J 4DR6J 5LMUJ 3J80U 4DUYJ 5LM7E 4LF8J 1HNXJ 4JI0J 1XMOJ 4YY3J 3OTOJ 1I94J 2UXBJ 1N33J 4JI6J 4JV5J 4KHPJ 4JYAJ 3D3BJ 1N36J 1HNWJ 2UUCJ 1XNQJ 4JI8J 1IBKJ 4B3RJ 1HR0J 4AQYJ 4X65J 3W1YC 4KYZA 4DR5J 4K0KJ 1IBLJ
chains in the Genus database with same CATH superfamily
2HG4A 9RUBA 3KLGB 4PRFA 1FO1A 3SCJE 3TA2A 1Q78A 1BD6A 1PBUA 5CHCB 1S7HA 3CDAA 5D4OA 1RTHA 3PYGA 3BQ1A 2FY1A 2ROGA 2XS2A 1NSQA 4RJVA 2UVWA 1ZPVA 2FGOA 1TVRA 5KFNA 2R2TA 1DTTA 2A0FB 3E3XA 4MK9A 1GMUA 4PWUA 4ZVEA 5A0YB 4R8UA 1NJIT 5AXLA 4UOCA 3MURP 3JQKA 4ZCIA 5HROA 4LQ3A 1ZAVA 2CQCA 2E5LJ 4DS5A 3PR4A 3W61A 1SH2A 1UVKA 1AZSB 1HPZA 2ZC4A 2GVDB 4A8KA 1LFPA 3ILOA 4RU9A 3HSDA 4DUZF 1ZPWX 2DNZA 1Q82T 1KS2A 3OPKA 3R8YA 1JIHA 2BJ9A 3DLKA 3MF5A 2MQQA 5HLFA 2BOAA 1ZTTA 1SUQB 1Q79A 4RNNA 2DNHA 3GQCA 4C8OA 1Y3KA 5LSOA 2FB0A 4Y2MA 2JJ4D 2VG6B 1QSLA 1AUSL 2R7VA 2H9ZA 4JI3J 3W2WB 1FHTA 2KZMA 2V2KA 3JS9A 3T1HJ 4DQPA 2JEFA 2KG0A 2PO4A 3DC2A 3LP2A 5JMNA 3TAMB 4LBPA 4ITSA 3W9IA 4JV1A 2HQFA 2QZ8A 5GAGU 2W9BA 3M32A 3OFHA 2VL1A 2VG5B 2H4YB 1HNIA 1JLCA 2D3O1 5I3UA 1CS4B 2KT2A 3KLFB 4DQQA 3SV3A 1S1UB 1R8CA 4K2JA 3JAMU 5L1KA 4NWBA 5L8RC 2MZ1A 1X4DA 4DV4J 4TY8A 3Q8RB 3IN5A 2BJEA 4X2BA 3BB5A 2AU0A 1Z2ZA 3BN4A 1FD8A 3I56S 4JI5J 2F4VJ 2MSTA 4ID5B 1D09B 3CO9A 1N5TA 2Z2ZA 1YG0A 1T05A 2BJ1A 2YNGB 2OPRB 4MYUA 1SV5A 4X4SA 2WOMB 1YZ6A 3G86A 1FA0A 2VFUA 2R8JA 2BRKA 2K7KA 3MPDA 2IM0A 3ET6B 3TJ8A 2A6MA 3G87A 1XC9A 1TL3A 4OJ1A 4DCPB 5KG2A 4CT8A 1AUDA 4NRTA 1W2BR 3KLVA 1U0SA 2PSZA 4DPXA 5J2PB 1JJ2R 2NUUG 4L75A 2AEMA 2K3IA 3R5AA 4NYZA 3TR5A 2MZSA 4OJGA 2RB7A 4JI8F 4OI0A 1TL3B 3MMJA 1Y7PA 2JVOA 4M5GA 4RUHA 5J2MB 5KFSA 2J9DA 4KTQA 1KVIA 1DJ0A 3NBPA 4OZLA 3J7YI 2EKYA 1U1OA 2LXIA 4CLWA 3J7AN 2VPYB 4ZVHA 3SEOA 2LU1A 5KFCA 1DLOB 3M8QB 4YN3B 5RUBA 2G0CA 2CNNB 3DLJA 1XBWA 2HQDA 2R7WA 4EBDA 1YJWS 4I7FB 5IV4A 5DZ7A 5LM7E 3T9NA 4CLUA 2GMHA 3R5JB 3OTEA 4E0DA 4A8FA 2BUNA 2BE2A 4WXOA 4Y28C 2KM8B 3QQCD 4NPOA 3MFHA 2K8GA 1K1QA 2NUHA 1P9QC 2F8HA 2E1PA 3BZQA 2VJUA 4X4RA 4KV8A 1NAQA 4QW9A 1DTQA 3DRSB 3DOMB 4LF1A 4L72B 4O3QA 2HZAA 2NCKL 3IP0A 4K7QA 5KT5A 3C3LA 1MSWD 2V4JB 2ZVIA 4QWAA 3BGRB 4ETZA 2FJXA 1CJTB 3HT3A 2WZ1A 4KPCA 4DX6A 4DZDA 1HI1A 4TVAB 2FJDB 4LRCA 4L76A 3DRRB 5M2RA 4ECTA 4WFYA 2G0IA 2KRBA 3ZNJ1 3HM9A 4GVBA 4HH0A 2FHOB 2R2UA 4EYHB 4A8YA 4ED8A 3AH6A 2HWTA 2JLEA 1L5UA 2BEFA 3KUEA 5KFLA 1RWNB 1IQZA 2HRUA 4CLYA 4ZVUB 1F5CA 3NGUA 3HFVA 4DFKA 1U45A 3M2RB 2VONA 1VQKS 3FEYB 3K8VA 3ZTRA 2FVRA 4NLWA 2BR0A 2CQ3A 2LQ9A 2KI2A 3NAHA 3JSMB 2ZUGA 4CM2A 1YI2S 4YP3A 2KFNA 1RT4A 4URSA 5B08A 2D3UA 1HW8A 4X66F 4OYAA 4B9NA 2VUGA 1GH8A 2XLIA 2C3OA 1FE4A 3S6EA 1MNEA 4L74A 3MM5A 1U47A 5E3AA 1FJCA 3SBMA 2ZD1B 3W8GA 1UCNA 1NK4A 2ZJQQ 4UY85 1PC4A 3F44A 4B08A 3M8PB 1SJ3P 1FRIA 1CSJA 5E2QA 3EMTA 2CZ9A 3F73A 5A6WA 3CPWR 3KLEA 3CCLS 2AX0A 4CCHA 3CC7S 2BW2A 3MM8A 3UWTA 2UXDJ 3MEDB 2XSJB 3MEGA 3CJSA 3D1OA 3GFXA 3H2VE 1MROA 3VR1A 4F0KA 3SSRA 5K5MA 1VQ8S 3X1LB 2FLPA 1N8RT 1RDRA 1S6UA 1GXUA 2HIQA 1FWLA 4KGKA 4W92B 4EMDA 3S8SA 3RW7A 4LF7F 3QMQA 5D3GB 2RDDA 2JNJA 1BQNA 1VJQA 3TZYA 2DHHA 3SSQA 1BY9A 3C6UB 3Q89A 2VA2A 4LRFA 4ZPVR 1XJWB 4EUVA 2D69A 3RAXA 2DRBA 4ZLNA 3DCAA 1ZH5A 3ZZOA 1R0BG 2KHDA 1BQXA 5D0EA 3PW0A 3BH7B 1SL2A 5FDLA 2BKPA 4FPRA 4NLYA 4BBYA 1U0HB 4P73A 5DQHA 4C8MA 3QRQA 3JXOA 2Z2YB 4CRJA 1NDKA 2V9KA 3Q0AA 3BSNA 1YZ7A 4OYIA 4ZPBA 2KH9A 3MM9A 1VK3A 5KFHA 1YK9A 3QT8A 1VQ4S 2CQPA 1KOHA 1W26A 2H5EA 3BGFA 4J5OA 4D3GA 4B3OA 4FBTA 2QLFB 2AMCB 1WNEA 2Z58B 3BGRA 1MMDA 1R6YA 4HR2A 1JLAA 1JK9B 3T5KA 2HNZA 2YQ1A 3JQJA 4XK8C 1HBOA 4M5HA 1S9FA 2NS1B 2C2OB 3HD2A 4ANDA 4ZLPA 4TLRA 2BQUA 2J9EA 3K59A 3V2UC 5HAOA 1FJEB 4CYUA 4C8KA 3ZZUA 3P6YC 1RT5A 1S76D 2IYGA 5IT9U 2VBXA 1NDCA 3HSGA 2GO9A 4Z7YA 2HS3A 3W2WA 5H9EJ 3T6BA 1QAYA 4EFAC 3CD6S 2DT9A 4DR6J 4FPIA 1DQ8A 1U6BA 4IRKA 3HJFA 4DXLA 4DU8A 2YX4A 2IM1A 2IYIA 2M70A 3M7VA 1A9NB 3T6JA 1R7IA 3M30A 3K17A 3DM2B 4CDIA 2YNIB 1T9TA 1HW9A 2JOQA 2ZBQA 5LJ3Y 2IMOA 1HD1A 1N33J 5I3PA 2GIQA 1NK0A 1M5PC 1CC7A 3ZTQA 1M1KT 3E8OA 1UVLA 4KHPJ 1S0MA 2MHNA 1S1WA 1DTTB 1TL5A 1AA1B 2PFFB 3P96A 2Y1LB 4ZVRB 4JI8J 3FBBA 2MQNA 4PXDA 4B3RJ 2NPFA 1NB7A 1L3KA 3HXMA 2QE5A 2JEGA 1S77D 4CI0B 2B7CB 2ZNYA 3A13A 3RRHA 3OUYB 2YH1A 2NXCA 1WHWA 3AY0A 4N8NA 1D1UA 5CYMA 5ETTA 2GVZA 1FRMA 2QMUB 3N5BA 3TEHB 1S6QA 2KKHA 5J1PA 2XTJP 2YQ0A 4M5MA 2ZH2A 4FYXB 1CLFA 4NOHA 4OYMA 5E3CA 3AA8A 5EUHA 5CABA 1XMBA 2ZD1A 3I0RA 2BJ7A 2G4BA 1IKVA 3N9UC 3N6LA 4NL5A 4JYAF 2DK2A 1WKKA 2WONA 4MH8A 2KT3A 1HWLA 1UFWA 3UN3A 4C48A 2VPZB 1RTHB 3QT6A 5L9XA 2I5JB 3QAUA 5KTQA 3ITHA 1TUWA 4LSLB 3MEDA 3VGSA 5IXUA 2F8EX 4I7FA 4RBVA 1NHVA 3FFIA 3FMBA 5F0WA 5B0AA 2MGZB 3IAS9 2VQFF 2J8AA 2VICA 5L1JA 2XGQA 1JXEA 1R31A 4NXNF 1F9EB 4DR4J 2WK4A 2XEXA 3GONA 4J91A 5HLFB 3DI6A 4O4RA 3O44A 5KOWA 1R89A 1FFWB 5J2QB 2D9PA 2HQIA 4C0BA 3I82A 4DU7A 4A48A 2BX6A 3KJQB 3GV5B 4DFMA 2ASDA 2QA4S 1U1KA 4K50A 2YNIA 3Q22A 2DYAA 1SC6A 4X4NA 3M30B 1N5SA 3ISZA 4RW4B 3H90A 3SDEA 2FJBB 3A4TA 3AQPA 3MD1A 3MM7B 4I4BA 5J2QA 1ZM4A 4GMKA 3MFIA 3JSRA 2V67A 2C2DA 5HQMA 1VRTA 2DCLA 3QO9A 2HHWA 1TTHB 2LDIA 2WVDA 2XZTB 4X4OA 2OPPB 1TAQA 1VBKA 2OP5A 2AYMA 2IBKA 2R8HA 2OI2A 1TMJA 3IMQJ 3PFEA 4FDFA 4CLZA 5L1LA 3UCUP 1RT5B 4G1QB 3CVKA 5CQGA 2H1YA 4LF8F 4B3MF 1B3TA 1CS4A 3EDQB 3KLFA 4PXEA 2FD2A 1HHSA 4CTAB 2W2QP 2A18A 1P6TA 3RUBL 4PUOA 5B0EA 3I0RB 1U09A 3CD7A 4I0WA 2CJYB 3GIRA 2GMLA 2P6SA 4BWMA 5K14A 1DQAA 4RKUC 3OFEA 2RRBA 4USIA 3C46A 3RYLA 3R7BB 3FEZA 3QLHB 1EB0A 1Y4ZB 2KXNB 4CP5A 5E3PA 1YJTA 2M7SA 2UUAJ 2ZOGA 4Q8FA 3GCXP 3OXLA 4NZ0A 1KQGB 3M8RA 5LMNJ 2XS7A 4RBTA 1T3NA 3AAWB 1NKBA 1QE1A 3Q8PB 1T11A 3UDLA 3PV8A 4K4VA 5KFIA 2DNYA 3V6DA 1C2PA 4JI4J 1R3NA 3GJSB 1RWWB 4JOUA 5DS7A 3QLHA 3TQEA 1GNKA 1GQEA 1RBLA 1SVDA 2W8LA 4I56A 2GQ2A 1REVB 2O01C 2A2CA 3KLHB 1P1LA 1E6YB 1RTIB 3VQSA 1CJKB 3D67A 2ROPA 6FDRA 1IWAA 2OO4A 1PYTA 4MKAA 5E3RA 4TQRA 4JI0J 2OFHX 3DM2A 4F3QA 3G6ES 4KPYA 5F8MA 3MOJB 2IDLA 3EWGA 1S7IA 2D74B 4RW8A 2B4VA 1T3OA 2RS8A 3L95X 1SKRA 4IR9A 2HRYA 4HEA9 3CWJA 2Y1IA 1FX4A 1OS5A 4OZ2A 1AB8A 1F3VA 2CKWA 1XEZA 2RD5C 5KFZA 5IWAF 1V5VA 1WI6A 3CIMA 4ID5A 4XAKA 2UUCJ 1E6VB 3LP1A 4KGZB 3DFEA 4D3HA 4NX9A 4DR4F 2V6AA 5HVFA 4J9QA 3EE3A 1AT1B 1KC8T 1VRTB 1J5EF 3A12A 4J9VA 5KFAA 3VVUA 1RBOB 2DEJA 3G82A 2PMWA 1YRUA 1V6HA 1X4GA 2VODA 1FTRA 2HS0A 1FJ7A 4K8RA 4J9OA 3KHRA 1IKXB 2DGWA 1FT8A 3UDEA 4DWIA 1AZSA 1WWHA 2BKOA 3TP2A 1SI9A 2XYHB 1RT4B 4ES1A 1RXOB 4H4KC 4ANEA 4DUYF 1X7VA 4PXCA 3D66A 1RHUB 2BABA 2DRDA 1RWUA 1FRKA 5MAOA 5AJ3F 3RB3A 4IFYA 2DNOA 3WHIA 1VHIA 2HIYA 2HQGA 4GRSA 2OD4A 5HP1A 1WTFA 4HI2A 1NK5A 4FF4A 4ED5A 4C11B 2B9YA 3BSOA 2XG8A 3M1VB 2I0XA 3UQSA 3AOAA 4RU2A 3NWRA 2EFPA 1B7YB 2K2PA 4EZ9A 2FVSA 4B3RF 3HHNB 4Y6IA 3IO1A 3C6TB 2KDOA 4G65A 1ELOA 1FI4A 1RWOB 1R6VA 2YKMA 4MKBA 4NI2A 4PZVA 3KMQA 4Z37A 1JLBA 3C16A 4DSIA 3D4JA 4EEYA 4G6VB 2DY9A 4OI3A 1VBZA 4IRDA 1UETA 7FD1A 3BV8A 2CAJA 4DFPA 4L3KA 3DGPB 1WC0A 3HDSA 1UWBA 1V5IB 1KP6A 2F1FA 1NU4A 3AFGA 1JLBB 3C16B 5AJ3J 4PR6A 4UQGA 3PY8A 5BJRA 4U6PA 2YQ3A 4YR0A 1GX6A 1PAEX 3B54A 1TP7A 4I2QB 2CADA 3GILA 3BO4A 3UCZP 3CJQA 4P75A 2OTLS 3VTIA 3NGRA 1C0TA 3HHDA 1X5OA 1IUJA 5AE3A 1RABB 3DOKB 1QAJA 1APSA 3KK2A 2ZDPA 2OTJS 1YRTA 3AQOA 4LBHA 1IKYB 1CEZA 5BXIA 5ETNA 3TUIC 2DH7A 5BYRA 1NUEA 4F3OA 1VISA 5KFRA 2P6TA 2LEBA 3H5XA 2JL9A 4FVMA 3HK2A 2R4FA 4QZVB 2YH0A 1JXVA 1ZS6A 2QRRA 4DR3J 2KO1A 2Y0SD 2LLZA 1S1XB 1FDBA 5F8IA 4J90A 1WG5A 2YKMB 4LR8A 3DDKA 2YNHA 1F1BB 5ADZA 1S4EA 2CJBA 2GJ2A 4ZHRB 5FJ4A 3KHHA 2V8DA 3NP5A 4RNHA 4EO6A 1U1RA 3OL6A 3AOCA 3SQGB 3I5BA 5T7LA 3WZ0A 4ECRA 2A1BA 1VJWA 3OR1A 4ZA1A 4YDDB 3PZPA 1RCXB 5CD4H 2R3VA 3RJMB 1SKUB 3TYTA 2W7PA 4G3IA 3ZZ0A 4DQIA 1TKZA 4KKOB 2O1PA 4XPCA 4LIRA 4NLRA 1X5SA 2MKIA 1YJ9S 4LVNP 1HR0F 3HFKA 2W9CB 2B51A 2CPHA 2GNKA 4I68A 1W2IA 1YRXA 2FHMA 2CQ1A 2F63A 3AB4B 5D0HA 5E41A 3VALA 1HMVB 4WPAA 3D68A 3IS9A 1IKXA 2QYCA 4IKAA 3C8YA 3HMJG 4C3KA 5H1SV 3DOMA 3HZGA 2GW8A 3KJVA 1VQYA 3BKTA 1PSDA 4RW6B 4JI1F 4IOAQ 3TAQA 4YY3J 1S6QB 5DGAA 3W64A 3EJMA 4FS2A 4V19J 1UVMA 4P2SA 1B4SA 2VFTA 4OYXA 1HL6A 2JSXA 1ZA2B 5E5NA 3J7Z5 3PX6A 1FEEA 3KYLA 1TU0B 1U0HA 5L39A 3CJ8A 2AJ2A 3NCPA 4TU9A 1JB0C 1CG2A 1NPRA 4ZCKA 3OL7A 3OD2A 4FNHA 4M63A 1V9OA 5HL7Q 1ITPA 3DOLA 2RUGA 2W7AA 2HGMA 4N7TA 2AX1A 1V3RA 1TELA 4DPYA 1RHKB 1KFDA 1YJ7A 2EG2A 4LSNB 2RF2A 5K14B 1FKAF 3TVKA 1D9AA 2E9ZA 3DDIA 3M6VA 4IOBA 2C2ZB 2YNFB 4NA2A 4CH1A 4MKYA 3FBEA 4ZN1A 5HQLA 2BW7A 4AFFA 1O5JA 1WHXA 1KSPA 1KOOA 2XZWA 4HHHA 4R0EA 2P2CB 4K4XA 3B8HA 2W2NP 3M2UA 3FEXB 4JI0F 1QJHA 1KVJA 1N5VA 3OW2R 3A3PB 5DDOC 2J7WA 2VKRA 4DZ6A 3KLGA 3GSIA 3SV4A 4LF9J 3HT0A 5JJBA 3GR1A 2PA3A 2J7KA 4ZCLA 2N4DA 3BSAA 4DDFA 1WC4A 2ATCB 2VFRA 1LWCB 2XWYA 4LSZB 4NRUA 1WSVA 3LWMA 2G2ZA 4WU2A 2OHDA 1XR5A 4O44B 1Y5LB 2EFNA 2MLZA 3DXBA 2V63A 4CWBA 4LF4J 2AHOB 3MECA 3O8WA 3WQPA 4NLUA 2RHQB 3OSPA 1FNOA 2VG7A 4OLPA 2XMJA 1S9EB 3LGNA 1ZAXA 4ED1A 2ADCA 2CQ2A 1BWEA 5IFMA 1TFYA 5D78A 2E29A 2XWXA 1EAYC 4HH1A 1S9GA 2LXUA 3BH6B 3ISNC 4F25A 3PW7A 1S0NA 5KFEA 1RB0A 1PYOB 2MLYA 5KFYA 3I6PA 1CPZA 1UJ4A 2B4OA 1HFEL 3QFWA 1KVKA 5KFBA 1RU2A 4PCQA 4X4TA 3Q8YA 1FK9A 3OL9A 1RAIB 3RTVA 3QBCA 3U27A 3D54A 3NNAA 1QLNA 3T9ZA 1RAFB 4YB1P 3QJPA 4Q0BA 3RBZA 3HFZB 4WTYA 3SDEB 4KO0A 2RVJA 4Y34A 2EBEA 3PFOA 2AYEA 2QN6B 2J0XA 1EQMA 4NLSA 1NJZA 1DHMA 4HTJA 2GIRA 1IKWA 2H48B 4PKDB 4DCOB 3J7YU 4YY3F 3H8YA 1TR0A 2DIVA 4R8UB 4XDCA 3N6MA 2UXDF 1JLQA 2O5DA 3POTA 4Q2LA 2FJEB 5CCMA 3GIJA 3EPGA 1WD6A 4PXBA 3QRPA 1G7CB 2R2RA 5L46A 4WP3A 4BHQA 5BR8J 3ZO7A 1F2HA 5I42A 4DV0J 2MLXA 2CG4A 2LCWA 1CJUB 2AW0A 1N56A 1BUXA 3R5DA 3WX8A 3FQKA 3BR9A 5IC4B 1XNRJ 3PTWA 1S79A 4GKKJ 3P5TL 4YB5A 2AZ1A 3W2VA 4DG1A 2G9OA 4PYDA 2ALZA 1F2GA 2WSEC 6FD1A 4MIAA 2W9AA 2F4FA 1DLOA 3M8QA 4IG3B 2LVWA 4HDHA 4N77A 4JI2F 1AXQA 2AEJA 2VASA 4DHVA 1X60A 4DR3F 4O3RA 5IT9Y 2LMIA 4UQTA 3DGPA 3MPWA 4AT1B 4WKYA 1Z4UA 2XZDB 3GG0A 4KSEB 1HNZF 4NCAA 1FDNA 3PKYA 2FLOA 2DISA 2N4CA 4HI1A 3CGIA 3CJTA 4J9NA 4P7VA 2AEFA 5KFVA 3KUGA 3PHEA 4OV1A 5DG8A 1E6YA 1KHVA 1RTIA 3QIPA 5JXSA 1N5YB 3FK4A 1F9HA 2QLWA 4TNOA 4ZITA 5HSPA 4JI7F 4IRCA 2RE1A 4OHXA 2ZEJA 4ICLA 3Q86A 3MUVP 3MMBA 4DV6F 2D41A 1LNQA 1RADB 3CSKA 3KFWX 5IOLA 4EWTA 5IT4A 2LECA 2ZNZA 3IG1A 3OFGA 2ACMA 4A8OA 4BS2A 3BKFA 1T05B 1YDLA 2B4UA 3LPEA 3EVOA 5ITHA 3FCHA 5K8MA 1OIAA 1WJ9A 3QAEA 1HWUA 3THTA 1SKWA 1FXLA 3CJKA 4ED7A 1ROFA 5SZTA 1SXLA 4PAAA 3TZXA 2BANB 1GAOA 2APOA 2G13A 2R8GA 2ZBPA 1VQNS 4DR5J 2Q6CA 2ZHAA 2OIHA 2O3DA 2F8MA 4EU0A 4B02A 4ZPDA 2HKEA 1CULA 1NDPA 4WWSA 3V81A 1Q53A 4KH1B 2R42A 2IJFA 2BM0A 3CB4A 5IM0A 2HNDA 3BBFA 3V4IB 1UEVA 3TRGA 4DL6A 3NG8A 1VQMS 3OR2B 2RQCA 3GV7B 5B0DA 2HHHF 2ZC3A 3RR7A 3QO9B 1T9WA 2V8HA 2G2OA 1EETB 2DIUA 1RWKB 4C97A 1M5OC 5KT4A 3CD5A 4F2SA 4F0HA 1CC8A 4DN9A 2N3OA 1X4FA 4J9PA 2HNYA 1N33F 3U1MA 1Y10A 1J5EJ 1KR4A 3I9ZA 1X4AA 4DSJA 2VF3A 2XNRA 5FLXU 3AD8C 1DURA 3DMJA 2XQCA 3T3FA 2VFVA 2H3EB 1VC0A 2OJ3A 4ZJOA 9ATCB 3LO3A 1N5YA 1PJ5A 4LFBF 1REVA 3KLHA 5KFXA 5ETMA 2M4MA 2X1AA 3DHXA 2L9WA 1H98A 4CT9A 2HHQA 4FYYB 1LOUA 3W60A 4BWJA 1JJHA 2IM3A 1OWXA 2YPYA 1U8WA 4Q43A 2H4WB 3BSCA 2Z0GA 2CPFA 3MTKA 3MZIA 4OX7A 4AL7A 3CDBA 5I4MA 5GAHU 1JLFB 2HBYB 2PFDA 3OXGA 2ZH1A 3DXSX 4DL7A 2IPOB 4A8XA 2LYVA 1O0PA 2KFYA 2GCFA 2EFOA 2EXUA 2Y0BB 1S10A 2ZZMA 3IFEA 5C42B 5I3UB 1YJNS 1U2FA 2K7JA 4OFZA 7FDRA 5CZVA 2Q66A 1F5BA 2HWHA 2OELA 2KN4A 1F0XA 1SJFA 4U96A 4LF9F 2CFXA 2IAJA 4KC5A 4PWDA 3OFFA 2KT5A 3OT9A 2QLXA 2U2FA 3MMCB 1HMVA 1SH3A 2V8PA 1P27B 5LMUF 3CJ2A 3X3UA 4RW7B 1KRPA 2B7BB 2XBPA 3O2IA 5HBMA 3PW5A 4IUFA 3PG9A 2CJKA 3DYAB 1FRJA 4X4PA 1RTJA 2V69A 3B4MA 1FVSA 1O51A 4WP8A 2QG9B 3FSXA 3VGTA 1QVGR 2VC1A 4A8QA 4B3SJ 2ASYA 4DI6A 2ZH9A 5HP1B 3BYRA 5AXKA 1RUSA 2EK1A 3R97A 2WTFA 1U49A 1GEHA 4ZJLA 3VQTA 3Q24A 3GG1A 2B8PA 3P3DA 3T1AA 4R5PA 4DR5F 2MTLA 3R1HA 1AFJA 2QLBB 3JTOA 5T41A 3LW5C 3HHLA 1S1XA 3G4SS 2IC3A 1NK6A 3C14B 2E7VA 2DR9A 1N0UA 1IBKF 1IVZA 1ZAWA 2LXFA 4CO3A 4CIOA 1RISA 2JC0A 5FIIA 2F9JA 5DDRC 3DOKA 4YFUA 3HVAA 2NXUA 1A6LA 4I64A 4LSLA 1B64A 1WOSA 4DCJB 4Q44A 3I4HX 3D5MA 3JYTA 1X4HA 3D3BJ 2ZFHA 1BWVA 1BMQB 2I1RA 1RAOA 3PCOB 1IJFB 1D8ZA 2RUSA 4M5KA 1U02A 3SFGA 1K47A 3CCWA 3RAMA 4ANCA 3LUYA 3DNCA 2RF2B 4HDGA 4USWA 4DV5F 3VZIA 5ETPA 2FZGB 3U1NA 4DLGA 1EARA 2IMWP 2ZKUA 4IOCQ 2B5JB 1SC3B 2CZVC 4FYVB 1C1BA 4YUDA 2MKCA 2G1DA 2N7CA 3MUMP 5DLFA 1EETA 1FTCA 2YKQA 4LF2A 3MUTP 4JI4F 2DNMA 2XNQA 2UUCF 2BE9B 2HFOA 2HAIA 1FWPA 2F5GA 1BGXT 3CCZA 1MU2B 3HHEA 3P4UB 1QY7A 4KAIA 2LEAA 2BJ3A 1IBMJ 2UXCJ 4RW9B 5E7OB 2CQBA 2AZ3A 1Y0HA 3G8QA 3LF0A 3QIPB 4A8MP 1GT8A 2J6UA 3CMES 2J0SD 4M8LA 1LK5A 5IS2A 1U4BA 4CO4A 2HAFA 4ECQA 1N34F 3CT9A 4X4VA 3JTPA 4QR0A 2MSSA 3K7RA 2P8IA 4EBCA 3AB2B 5A8WB 1WHYA 4DV7J 2F40A 3SIPB 2J0QD 2CNKB 2IA0A 3BM7A 2VA3A 4DOZA 2RHSB 3G6YA 2AIRB 3D0GE 2ILZA 4C6AA 5BYSA 1LWCA 3T19A 4H54A 4CM0A 4DL3A 2AGPA 4LFAF 4B9SA 4WTOB 2AF6A 2RSQA 4QR2A 5GMEA 2HPUA 1JLEB 1MW7A 1RA7A 1UA1A 1RT6B 2DY1A 4C0HA 3PIOQ 3EZ5A 1TKZB 2CNOB 2NXEA 3LAMA 4KQZA 1UP1A 5LOQA 1S0OA 2FHJD 1FDAA 4RLEA 4X66J 4PWWA 1EQ0A 2AJ4A 2HHXA 1SPBP 3T5JA 1VQ9S 5D4PA 4CNZA 4ICLB 3EYZA 2C28A 2Z57B 2KM8C 2Z56B 1RAJA 3EM1A 2E5IA 4LRBA 1N4LA 1JNZB 2E66A 2OPSB 1ICEB 4QBUA 3QRRA 3L3CA 3IRXB 4PPDA 1RT1A 4KE5A 2POKA 1HBUB 4LR9A 4WU3A 1RT3B 4JV0A 5EWEA 5FD1A 4DV0F 3TANA 3K0JA 5EWFA 3IA0A 2AJFE 3MM6B 1MWYA 2P9EA 4ZMMA 3OJUA 5GADU 1GMWD 1SJ4P 4QYZJ 2XYPB 3SMZA 3IWXA 4FYWB 1M1GA 3BF4A 1SIWB 3D6HB 1C1BB 3W9JA 3U7JA 4A8SA 3KOAA 1U1MA 4KGXB 2SXLA 4E98A 1I51B 1X0FA 1FERA 4DG1B 4QOTA 3TAPA 4C3MA 3SCLE 3CCES 1TL1B 2X3GA 2YNHB 2VKZG 3GYNA 4I2PB 1LV5A 4OI2A 1FEHA 2E1MC 4F0MA 3DRPB 3RBEA 1S6PA 2ZH5A 3ENWA 2DCUB 1RAGB 5B7WA 5KFQA 2KL8A 1VQPS 4NMLA 2ZKTA 2Q6BA 4QW8A 4JV5F 4WBFA 3MGJA 2M0GB 3H59A 4DL5A 3QFHA 1OY9A 3O3LA 1VLYA 3JSYA 4UW2A 3VHQA 4QIEA 3KTQA 3C6TA 1R8PA 2HURA 4NI2B 3VCDA 2J6TA 2WB1D 2CJAA 3L7OA 4O0NA 3UDCA 4O4GA 4DX7A 2W9CA 3ENAA 1JXLA 4C0OC 4K0KF 4UZBA 1S12A 1FFSB 1BC6A 2ZBRA 4USJC 2DNGA 2EWHA 1UWBB 4TXSA 3BBCA 2UXBJ 3K5LA 4MJKA 2MY8A 4X64F 1I3OB 2CDRB 3I5AA 5HK4A 1S1WB 1NJWA 3SQGA 3CNQP 2HQCA 4XIUA 5A8KA 2DGQA 2X7IA 1UMJA 4UF4A 5LMNF 4N56A 1VC6A 2Q43A 3OJSA 1R0AB 3DLBA 5GAHI 1UEKA 5M2UA 1IN0A 4PG7A 1N6QA 4E2FB 2BRLA 2OAUA 1RU1A 3PEJA 2CQIA 1G6BA 3NLCA 1R0CB 1RP5A 2CWXA 1NMEB 3IXQA 4MIBA 1HWJA 5GAGI 1DRZA 2ZOMA 1NBEB 2I38A 1VBXA 4NCGB 3P49B 2OPRA 3CCQS 3KG0A 2GIFA 3GE9A 3NOGA 4A47A 4UOGA 3FZ2A 3MR3A 1U24A 4P52A 3HHLC 3H25A 4DR6F 4WZMA 2H51B 4PABA 5G0RA 3OL8A 4DV2J 1N54B 2EC2A 2MZTA 2DPIA 1M5HA 1Q5VA 1UFKA 3PEHA 2W4PA 5B0BA 2ZH7A 1SBRA 4ZVQB 1TAUA 4OX9J 4ZVGA 4F36A 5F8HA 1RHRB 2LA6A 3LWLA 3MMAA 2OEJA 1KLMA 3GSDA 4AYBD 2CQHA 1X4BA 2GVZB 4TY9A 1DZ5A 1N0VC 4LIWA 1LQ9A 1Q16B 3RR8A 2DEIA 3MI7X 1Q8BA 1TKTA 1V3ZA 1X4EA 1FNXH 3R5CA 5IT0A 1GMWA 1QE1B 3ZFVA 4KY3A 1U6FA 4ALZA 1FRLA 3L9ZA 3J7ZT 2FVPA 4LREA 2CPIA 2HWIA 3SXLA 2RS2A 3ILJA 3P5BP 3VAKA 1H3DA 1RSCA 3DLGB 1YIJS 4JI2J 1LEOA 1KNZA 2FVCA 1S97A 1FFGB 3I32A 2OPSA 1CJKA 4X62F 2AQ4A 1Q1KA 3MR2A 3DMJB 2YKNB 3W62A 2DGTA 1YKWA 2W24A 2Y3YA 2FHJA 2YX1A 3DLGA 4OX6A 2E5HA 2NSBA 5D3GA 3CE8A 4JI3F 2B9WA 1Z1ZA 4WXWA 4ZPCA 3BPSP 1EKRA 5K20B 1KKHA 2DD8S 3DLEB 1K0TA 3OTBA 4YHHJ 1SV5B 3TW0A 2UXBF 2MDAA 2CYYA 1N34J 1P9YA 2XI2A 3I87A 1KN6A 3WBZA 4LF6F 3AJDA 3LP1B 3W2VB 3LTOA 4NE9C 1H7WA 2QA2A 4C98A 4DV6J 4ECUA 2HNDB 3W7BA 2UVVA 1NKCA 3H2UB 3LGHA 4KKOA 1HYSB 2RDJA 5J1EA 3HF5A 3TZWA 2B43A 2GJFA 4TQSA 1H2TZ 3T1YJ 2BA9A 3TEGA 1X0PA 3IR6B 1F60B 1JLQB 3U1LA 1SQFA 5C5JA 5A76A 5KG5A 1AROP 2I6WA 4WKRA 1CBKA 2WBRA 3ENQA 3HULA 5G0RB 3WC0A 1FWKA 2GQQA 4O3OA 4R25A 2MQOA 4F50A 3R6LB 1RWVB 2M8HA 2HZCA 3THVA 2WVEA 3PIPQ 4UOHA 1Q7LB 2WRMA 5HROB 4OZJA 3V6DB 5EWGA 4ILMA 4ZVFA 5D4LA 1QSYA 5AXMA 3OTDA 3DLKB 4DV1F 5HMYA 2DXEA 2HVHA 4F4YA 5C7PA 1RHMB 1RT7B 3HSZA 3QGHA 2XLJA 4I1TA 1I94J 2GGPB 1HBMA 2CDQA 3ITHB 2KRRA 2MKYA 4JI6J 1NSKL 2M9KA 5EDWA 2CQDA 1NSAA 2G0JA 4M1KA 2LFVA 4ELTA 2Y1RI 2B56A 2BACA 3L7PA 4KFBB 5EGYA 1NM2A 2ATLA 2DXDA 2QLJB 4ZVPB 4CTAA 2IHR1 2CPEA 3VZHA 2MPUA 4F8RA 1H2VZ 3HKWA 1YHQS 1H7XA 4RX6A 4X65J 4PPZA 1C0TB 3D6FB 4URGA 4X84A 3NNHA 4TYBA 4J9LA 4F2RA 2QL5B 3GLJA 4YR3A 2VOOA 4NYOA 4LVOP 4EI2A 3M8PA 4AXIA 2XSFA 3GV8B 2MKKA 2COLA 2GO8A 1FNMA 1H38A 1T0TV 4IQMA 4ZOSA 4LRDA 4USKA 3T41A 1FX2A 2YKNA 2R7QA 3TVZA 2BBEA 3I9V9 5C2GA 1FCAA 1SJQA 3NRBA 2UU9J 5CXTA 1Q5YA 5F8NA 4NLTA 5HANA 3UR0A 5KFOA 3UN5A 3GIKA 3G82B 3T5LA 1HBNA 1S0VA 2X3DA 1RAAB 2JFDA 1RGVA 2W4CA 2UV8A 4C8LA 3CULA 3AXMA 4WZQA 1UWAA 1VIOA 3BPDA 3M9OB 3KDOA 1RK8A 5DM7Q 3UNYA 1WEXA 3PO4A 2QJ3A 5AT1B 1U2RA 2YKOA 4W4MA 2UP1A 4IR1A 4DR2J 2M52A 1PO6A 2OEMA 1GTEA 2QT7A 3FC9A 5K8PA 2MJNA 5T14A 3N01A 1L3UA 4P74A 2DHAA 2V8VA 2ZE2B 4OJ3A 1CQNA 1T8EA 3TJ9A 3N6NA 3M4XA 3R5BA 3ZZZA 3IC1A 2E7XA 2JHEA 3FSIA 1WTBA 1J5OA 2NYIA 3K5OA 1T95A 2XHCA 4LFBJ 3IWLA 2Z2LA 4B17A 3PKMA 2WHOA 4NEYA 5AXNA 4OHVA 1HI0P 3N5FA 2GC8A 2RAQA 3IBFB 4FNIA 2B6AB 3A3OB 3CJ4A 4DV1J 2EC0A 2MKJA 3ICLA 1S99A 1WC3A 2LQ5A 4P71A 4OX9F 3O5TB 5KFMA 3I96A 3R6GB 4OQJA 5DQIA 1OPIA 2CVEA 3I5CA 3AJ2A 1RYSA 1WKLA 1HNZJ 4ZK7M 2F7VA 1XMQF 3NEKA 4MK8A 1B0PA 1OO0B 2AD9A 4U67Q 3R1LA 3RB0A 2RT3A 3K5MA 3N0VA 3R7NB 3WIUA 4Q5VA 4X4UA 3LQVA 1DBDA 3GZ7A 5HI7A 3AODA 2HLTA 2AP6A 1OMSA 3D3CJ 2UV8G 3UI3A 1VQOS 3OV7A 2OH2A 2NZ4A 1ZETA 4ECYA 2V0NA 1ZYQA 1UW4A 2HGNA 3PJXA 4W98A 3HD1A 1ZTWA 4HHUA 5F8GA 2OGUA 2RRAA 3LANA 2VC0A 2AV5A 3AT1B 4CNYA 1Q8KA 2WOMA 2Z2MA 4FYDA 3TZZA 1UPMB 4WJBA 4BC9A 4ECSA 4I69A 2LQBA 3PVXA 2R8IA 4QYZK 3KNAA 3V4IA 2VB6A 1F3FA 2WVCA 1CJUA 2QGFB 2VFSA 4RNFA 4C9DA 1IBMF 3KWMA 2YWHA 1PKUA 4ATNA 1NZ8A 3H7HB 3NS6A 4RNOA 2DGOA 2XMUA 2N7YA 2OMLA 4IG0B 3MM7A 5C24A 5GAEU 2DRAA 3QIDA 1NK9A 2Y8WA 3E2EA 1RAEB 5EX3A 2AYBA 1LKZA 1NJYA 4YB7A 1F9FA 1NB2A 3ZXWA 2C2EA 1IKWB 3KJFB 5CYQB 2OFGX 4MTPA 3KDNA 5KFFA 2HZVA 3CJKB 4CO1A 1WI8A 3AJ1A 3KKFA 1Y5IB 4KIAA 5HN0A 4V19X 3EGZA 2GFFA 5BYQA 1NXIA 1HR0J 2CQ4A 2XO6A 4EYIB 3HHKA 4K0KJ 1TKXA 2DGUA 4C2MA 5DETA 2BJ8A 3GPAA 5IV3A 3NY0A 4F26A 3JB9k 3C14A 1SC1B 3PHTA 2DGVA 2A10A 3MEEA 3O6QA 4R0JA 4RW4A 4B3TJ 4LF5J 1BE4A 3UVJB 4IO1A 3HP6A 2CXEA 2XS5A 4IO9Q 2RQMA 1HLWA 3G6VA 1J2VA 1S9EA 3VAHA 1GFWB 3PX0A 1VQ5S 3DLLQ 1XNQF 5LSRA 2X51A 1ZZFA 3HVWA 4NCBA 5HO4A 3MEEB 4ECVA 1WC5A 3I0SA 2ZM6J 4LUBA 3N79A 4IG0A 5C24B 2XO7A 4OZ1A 3GFZA 1WEZA 3TI0A 1IR2A 4OYOA 1BQMA 2K3KA 5EHHA 4YQWA 3J81j 3QT7A 4DX8H 2JEIA 5L1IA 1JKHB 3ILIA 4KB7A 4OL8A 2XSJA 3MCMA 4HVZA 1IWGA 5HBMB 2AGQA 1QAIA 3PM9A 1B70B 4I2QA 1JLFA 2LQJA 3KXDA 1KWMA 3KLIA 4UUXA 1CJTA 3EICA 5K9FA 3V6KA 3TVYA 2V4JA 3A1YG 2W2OP 3NBPB 4G1PA 1WG1A 1C0UB 1CJVB 4JB8B 5DDPC 1TKDA 2E5LF 1R8BA 4LF6J 4L73A 1TK5A 3MM5B 1NHKL 2BM1A 2BOPA 4TYAA 3SCKE 3PX4A 4B9LA 2HFVA 3R2DJ 5C42A 3DRPA 3PNIA 2PI4A 2ZITA 3E01B 2R9LA 3KG4A 3LA0A 4KBIA 4WFNQ 2D3ZA 3OSNA 4P6QA 3L7UA 3K5PA 2UXCF 5KT2A 3BEGB 2YTCA 3PXGa 2AJQA 5MLCV 2N82B 1I5OB 1U8SA 3VAGA 1LW2B 3MDFA 4ED6A 5F41A 4ECWA 3Q83A 2DNLA 2A2DA 3OLAA 2ZH6A 4NXMF 2DH9A 1XQIA 2OMOA 4EGLA 2KZZA 4G1IA 4TY8B 1V3SA 5KFKA 1K73T 4DBQA 2HFUA 2BVZA 2OPQB 2E5JA 2PIIA 1WG4A 1Q81T 1NPPA 4DPTA 3GIMA 1VHFA 4FBUA 4DL2A 1N32F 3CIZA 3R3TA 4KH0B 1J5OB 2RNEA 2HNYB 3OHAA 3IWNC 1EHWA 3UD3P 2J5AA 3KUHA 4BLGA 2GAHC 4Y00A 1YSJA 3LP2B 3VAFA 1L3SA 5J1EB 2C3MA 4P72A 2XY6A 4N47A 3C2PA 3NL0A 2R7SA 4DSKA 3OVSA 2D3OR 1LW0A 2L3MA 3H5YA 1S4FA 3G96A 1FDDA 4J9SA 4RO0A 4H4KA 2RQ4A 1EP4A 2XY5A 2E5GA 2DR6A 2DXFA 1SUQA 3B4DA 1LW2A 1YBTA 3B82A 2FLNA 2FGCA 4GVLA 5G4DA 4CLLA 4L6V3 3R9LA 3PACA 2L41A 5FLXY 4F04B 1OYEA 2FQQB 5C2CA 1QSSA 4DQRA 4KGVB 4ENOA 2OPQA 1XERA 3FUYA 3QYYA 4QU6A 2HFZA 2L9DA 3UVJA 4U95A 1JLGA 5HJXA 1PIEA 8AT1B 3D2WA 5CCLA 5HMXA 2XC9A 5C25A 5B09A 3FCVA 1YJVA 2V68A 3OQ2A 4DX5A 2HBQB 3BO2A 2OSRA 4ELUA 1UVIA 4URQU 3K89A 1RTJB 4AQYJ 3Q23A 4M5IA 1D8YA 1FKOB 1UPPA 2KJWA 1HNVA 1HQEB 2MHEA 2ROEA 3DYAA 1VC5A 1OQ3A 4QWEA 4ELVA 3IM9A 3KNGA 3L4BC 2R2SA 4OI6A 4B3OB 4C4WA 3NGTA 2RU3A 4LF7J 2R7XA 4H4OB 2IM2A 2LU2A 2IVYA 2JLGA 2D7SA 4LFCJ 2FIUA 1LWEA 1PCAA 2H54B 4OV6A 1IBCB 1O6XA 5JVGQ 4CLSA 3IBCB 1FKPB 2ALYB 3MTJA 4IG3A 2FLLA 1MROB 4Q45A 1XN9A 2HBZB 1WDTA 3M9MB 3UFCX 4C7QA 2GS8A 1R8HA 3TOQA 2X1FA 1AW0A 2JZ5A 4P9SA 2V2QA 5D6GA 2VG6A 3D7SB 1KBRA 4J7CA 5ETRA 1O8BA 1W25A 2GAGC 1TKXB 3ONQA 5IWAJ 3EX7B 4B3TF 1ZA1B 2C2KB 2W1BA 4ZLJA 5HMZA 1K1SA 2QTWA 5F9NA 2JEJA 2MMYA 4IH6A 1HNWF 3JTNA 2KFZA 1TV6A 2XMTA 2P9CA 5HVHA 3RB4A 2DR8A 1N32J 4GKJF 3W66A 2YWGA 2QL9B 4GC6A 5DZ6A 1C4AA 1RCOB 3GU0A 5EX0A 2VBZA 2BJDA 3W65A 4F4AA 2DNPA 1RKIA 5J2PA 1XMQJ 4O3SA 4TU7A 4ZVOB 2W7OA 3EZOA 4YDXA 2VDIA 3MECB 1N88A 4HLBA 4UUWA 5E33A 3DRSA 1TV6B 2ACYA 4IH7A 4OHZA 2VBWA 1XNRF 2XB2D 2RKIA 4QIVA 4DV2F 2BQRA 3I55S 2XCAA 1HKAA 3OTCA 1RT2B 2V2ZA 3H4DA 2VQFJ 5KG1A 1WF1A 3CCMS 4PQUA 4USTA 5J2MA 3UPFA 1YITS 4HKQA 2C42A 3UD5A 1RHJB 2MKSA 7AT1B 3HZEA 3NCQA 4MMOA 3HKZD 3WC2A 2RIJA 4O3NA 3NGKA 5GADI 3MMCA 1S1VB 4PG4A 2IY5B 1HNIB 1UL3A 3J81Y 3FMWA 1TQLA 4ZVSB 3NGSA 1B0VA 1VDHA 3JQMA 1DTQB 2D1CA 1LWEB 3MAHA 4P2FA 2PMZD 3HI9A 3ZTSA 4C3LA 5CA5A 2C3PA 2PN6A 3H42A 2IRUA 2VPXB 3QZ7A 1NK8A 2MQ8A 2ADBA 1XTZA 4A46A 2P5VA 2WSCC 4JV2A 1NH8A 2ZHBA 2J8SA 5CYMB 3BN7A 1QAXA 5KFWA 3C15B 4F4XA 1XMOF 5B0CA 4X64J 1G1XA 4Z2XA 2RJZA 3ZC4A 4ERDA 1T03B 3PO5A 2CWKA 3VV2B 1EIYB 3DU6A 5ETKA 1LWFA 4FF2A 2EFVA 3M8ZA 1FXDA 4DV5J 1TZ0A 2PC6A 3P45B 4WYLA 5C25B 2MXYA 4K4UA 1F5AA 2HGLA 3M6WA 1NHUA 1TKTB 2U1AA 1WOOA 4RWXA 3QWUA 3H40A 2QYGA 1VRUA 3QZ8A 4A8WA 3GFHA 2DJWA 5DG7A 4J9RA 1VQ6S 3M6UA 3NS7B 4OYWA 2VIHA 1KQFB 4K4SA 1JLCB 4NLDA 1PGZA 1NEEA 2ZOFA 5IZHA 1DY3A 1KEKA 1VK8A 4LF5F 4CO2A 5KFDA 2FZKB 1BXNA 2QFIA 3TAMA 2F65A 4DR7F 1RYRA 3M9NB 2DKOB 1NDLA 3IGVA 5ETLA 1HQUB 3A8IA 2CPXA 4ZPAA 3JYTB 2VV5A 3G6XA 2EPIA 4FS1A 5CD4A 1RT6A 1U1NA 3W5XA 2RH3A 1X9SA 5HJYA 1HNWJ 3HVRA 4AD6A 1IBKJ 2HHUA 2B6AA 1WACA 4OYZA 3Q8QB 1YVFA 1QTMA 1HQUA 3WX4A 1SIZA 1BQMB 3K5NA 3MAAA 2FY8A 5H9FK 2EBGA 2C1EB 4QCLA 3FZBA 3V6HA 2MQMA 2L48A 1VGYA 3POTB 4HTIA 1RLCL 3B78A 5J2NB 4ILRA 1DFDA 2JVRA 1S48A 4HL9A 4ZDNA 4EBEA 3T1HF 3RBXA 4ETXA 4NXNJ 2Y8YA 1VFJA 2BANA 3EUNA 1GXTA 4ZIVA 2DNNA 1QDUB 4PEOA 1RWXB 2DNQA 3H4BA 2PEHA 3M8WA 4OIXA 4LT6A 4Q2MA 1S59A 2EEYA 4MYTA 3HHLD 1FD2A 2V5HG 4PYAA 2NLWA 4DEZA 1MU2A 3UD4P 5A0YA 3M8SA 4Q0BB 2ZHOA 3DHWC 3DI6B 2WCXA 3MPYA 3TQ1A 1H74A 2EVZA 1U1LA 4FXDA 3IG1B 3E51A 1H73A 3TA1A 2UVUA 4KRWA 4B3MJ 2JLFA 4DF4A 4X62J 1UTAA 3BYPA 3OR1B 1IR0A 1KDNA 1OQ6A 1FJGJ 2VD3A 3MR5A 3FFIB 4NZ6A 2MY7A 3SYZA 2HYIB 1S49A 3RRGA 3CCTA 5BR8F 3R2CJ 2I5JA 3QSIA 3CC2S 3RB6A 2GHVC 5THWA 2J9CA 4ZVTB 4GC7A 4X65F 2V34A 2YWKA 3CDWA 3M6XA 3DRYA 1VS3A 2HVEA 4OZ0A 1VIXA 3QWPA 4HHJA 3A8EA 3NMRA 2MKHA 4WF9Q 1URRA 4DL0C 2HW3A 4O23A 3KLIB 3S01A 3MCNA 3EZUA 1NO8A 1WF0A 2BZ2A 2XI3A 3HLUA 4JP8A 4ZS6A 4NASA 1FKOA 4ZN3A 4M94A 1N5QA 1FF2A 4NLPA 4NMXA 1JKHA 4Y2AA 2HFSA 5DO2A 3W9HA 3ZZTA 5H9EK 5ETVA 1CVJA 4N8OA 4NCGA 4QIFA 3S1TA 3CC4S 4JI7J 2DR7A 3GYGA 5K8OA 2ABYA 1VCTA 3IM8A 4OZ5A 2XMAA 2IJNA 4UTGA 1TL7A 5F0UA 3KK3A 2HHVA 1HBUA 1U7LA 1TMMA 2WVBA 4MFBA 4Q7AA 3ZTPA 4DLEA 1R0AA 2Z4PA 1UEUA 1PJ6A 3H5UA 2VPWB 4J37A 3D6TB 3KHGA 3JSMA 1PG5B 1FESA 4DR7J 1G2EA 3I4PA 1KHWA 3LP0B 2OUGA 5D15A 1NNDA 1Y5NB 1Q4RA 3CD0A 3M2RA 3TNVA 3L09A 1PAUB 4A4JA 1ACMB 1IJEB 1RZMA 2XGPA 2AGOA 2QMXA 2E1RA 2FJAB 3CDEA 2E1CA 4P2MA 2EK6A 2YY3A 1C1CB 1TUGB 3HVTB 2XLKA 3ZZYA 2N3LA 1P1TA 4K4YA 2LEPA 3NWGA 1SQEA 2VHGA 1NPKA 5KG0A 2DHGA 4ED0A 2GJIA 1LWXA 1R43A 1VLOA 1WHVA 2PDAA 1TUVA 1FVQA 4RUBA 1TK0A 3MXHP 1FKPA 2H5IB 3DDNA 5AE1A 3VVTA 4K4TA 1SQGA 1UW9A 4YR2A 3PR5B 5IQ6A 2CZ4A 2GA7A 2IJRA 1R27B 2W9BB 4O44A 1X9MA 4LJMA 1Z2LA 1XMOJ 3RAQA 1M1HA 2HVDA 3VF0B 4F7VA 2OD6A 3OTOJ 4I2PA 2VBYA 2UUAF 4UOFA 5DRKA 1EJ7L 2YVSA 4QU7A 4MKVA 1FJGF 3RG6A 4USMA 2MJUA 1WUUA 4CO0A 1T02A 2V9WA 3EXYA 4CO5A 4B9TA 2O67A 1NRKA 4JV5J 2VOPA 2FPHX 2AWZA 2AJ0A 4F3MA 1KTVA 2AT1B 2DR5A 3VAIA 3PYFA 3CMQA 4DSFA 1NSPA 3IR7B 3GJQB 4QWBA 3GIIA 2I9SA 4M5JA 2CNLB 2R7RA 4CLKA 1XR7A 4BDPA 3AHPA 4ZHRA 1M5SA 4FP9A 2MQPA 3OVAA 4WYWA 1A0OB 4YEAA 3W8PA 1SJ1A 4LSNA 4BC7A 2NXNA 4LF4F 1OSDA 2EFGA 2BXJA 3G9CA 1ZM9A 1P8GA 1B0TA 2QSFA 1ZBTA 3MAQA 4P2XA 2B8QA 1I94F 1KLNA 2HMIA 1KONA 1LXNA 2RU9A 4MIWA 3TX0A 4DSLA 3ULHA 1RAHB 2GMJA 4YB6A 1B7FA 2WVFA 4ZP9A 1LWFB 5E0OA 3N28A 4X4QA 2YNGA 3D1HA 2QMWA 4DPWA 3G8SA 2C2RA 1EP4B 3FRYA 4P7TA 5KG7A 1NLKL 4M5LA 3KMSA 2BV3A 1RKJA 1SL0A 1MWZA 3MWBA 3M05A 3VAMA 4OHWA 1N48A 4CYUB 2KHCA 1WC6A 3BR8A 1RLDA 2YWEA 4H4MA 4DN0A 3ETMA 4PG6A 1WORA 1OPZA 2MZRA 2ZVSA 3MMAB 3G8TA 4OZ3A 4WK3A 4USVA 1IXKA 1HBOB 1WC1A 2WW4A 3RU0A 3I0SB 3JSBA 2KVIA 1PILA 2QX0A 2HBRB 3Q8UA 2J6SA 2CJXB 4GO7X 4NLGA 1F6TA 2EW9A 3RZAA 4Y2IA 2V4QA 4AE5A 5F9LA 1KD1T 5L9NA 4DMZA 1RJJA 2UUBF 4K4ZA 1KQKA 1U25A 1T9UA 2OPPA 4OI4A 4USUA 4N76A 5LXYA 1VQSA 2VU5A 2NSCA 1FRXA 1QD1A 3FRZA 2NREA 3AXKA 3MEKA 1LFWA 2HHHJ 4ILLA 3ETOA 2PD1A 1DARA 3K8WA 3MM6A 2R8KA 2E7WA 4DFJA 1REGX 2E9RX 1NK7A 3NNCA 4HYKA 4O3PA 1HA1A 2DHSA 1HPZB 3I31A 4S0MA 2ZM6F 3HO1A 2GZOA 3E01A 2JH3A 3MCOA 3MOZA 4DPUA 4U7UD 4LFAJ 2XHWA 1SL1A 4ED3A 2GX8A 1HHQA 1Q95G 3NXZA 4OMFG 1G3OA 3D1QA 1DQ9A 1WOPA 4FZVA 2KYXA 3CMAS 2YBVA 1S6PB 2ZZTA 3MAAB 2R7UA 3MR7A 3GYXB 5A8RA 3FCWA 4XDDA 5EN1A 2BE2B 1CQMA 3O1LA 3VGUA 1U2CA 1T9YA 3F56A 4ID8A 2FUG9 3BGLA 4LBIA 3TX8A 4CLPA 3CO0P 5D77A 3KLEB 3NMAA 4RW7A 3TARA 2FC8A 2MQLA 4V1Ak 1U1PA 2HSEB 2RILA 2Y9HA 3ZNUA 1JWWA 3GMGA 3EGVA 1IKVB 2IDEA 3SQOP 1WEYA 5A8WA 4KFBA 2PT0A 4KR0B 4NA1A 3R5GA 2IC3B 2QIFA 3WDOA 4IFVA 1ZOTA 3MCSA 5D4NA 3M8YA 4H4OA 4LR7A 4Z7CA 4C8NA 5LT5A 4DS4A 1HARA 4FVCA 1HD0A 1T9XA 2WBMA 1UA0A 1HNXJ 5DG9A 4ZPWR 3OUYA 2HHSA 4M5DA 1RT7A 2CJ9A 2DTJA 5AE2A 2C2NA 4U7CA 2MB0B 1YBUA 1EZZB 1YQHA 4RZRA 3V4MA 2HQ3A 5E3QA 1Y00A 4DUTA 4RPFA 2FC9A 5F3TA 4C11A 2C3UA 1IBLF 2UVRA 3PW2A 1T03A 2ZH3A 1M5VC 2GV1A 3K57A 3OR2A 3W3SA 2B9EA 5IC6B 4QWDA 4QYRA 2KB2A 3DRRA 3T1YF 5LL6d 3A8JA 1WKJA 4B3SF 4QWCA 3OXFA 2QV6A 3CCSS 2CPYA 1TFWA 4DV3F 2QA4G 2JFKA 1NZAA 1RTDA 4C8ZA 3K2YA 4GO5X 3KJNB 4MK7A 4QR1A 3T5HA 2W4DA 5J2NA 1M0SA 1IBLJ 2FJWA 3QJLA 2J9DE 2M88A 3ZZPA 5HVGA 3ELHA 2OSQA 1GTHA 4FXVA 4TN2A 4I67A 1GMVA 4C8YA 3M2VA 3ADAC 4DJBA 1K9MT 3DRXA 4Q8EA 4ZP8A 3V6JA 2Q3PA 2ZWPA 3V5RA 1AFIA 2ZH4A 5GMDA 4PQUB 4WIQA 3UW1A 4CQ1A 4FF1A 3EXCX 2HVIA 3KHLA 3PYDA 3LP0A 1GK8A 1JLAB 2WB4A 1SB6A 3CJRA 2FHKA 2QA1A 4F67A 2E44A 3GR0A 3PJWA 2Q79A 1FE0A 4J9MA 3J81U 3QJJA 1VRUB 4IFVB 4RW9A 3V81B 2CVIA 4DF8A 2NXJA 2HMIB 3HCXA 2PEBA 4ES2A 2ASLA 1A7GE 3MPVA 2JRSA 1C0UA 1CJVA 2UZAA 4NEZA 2XMWA 2VQEF 1ZZNA 2V8GA 4HACB 1VMBA 1W7WA 2K1RB 1NCLA 2ZWOA 1IM6A 2LDYA 3PYEA 1EKSA 5GAEI 1Q86T 2PI5A 4WP9A 1FRHA 1VI7A 3S7RA 1Q8IA 2C2MB 3PW4A 2DVIA 4W90B 2YX7A 3A8KA 3J7A1 2X1BA 1PC5A 3AOBA 2B0GA 3H98A 3Q8VA 5LXRA 5A2QU 4F4KA 4KHMA 1OYDA 4NLQA 1LXJA 2QO3A 4B9MA 1CULB 2GHWA 1BQNB 3FDSA 2AYGA 4WFZA 1K8AT 2VG5A 1K44A 1SC4B 2EI5A 2H5JB 4AUKA 3IGNA 3M32B 5ETQA 2ILYA 3QPIA 1RTDB 4QJVA 1X8DA 1U48A 1JMTA 1T9VA 2KXFA 1Q0NA 4K59A 2DB1A 5KG6A 5M2PA 4DUZJ 3OVBA 3UCGA 3CCVS 3PJ9A 3MEGB 2C3YA 4QPTA 4KO0B 4YS2A 1VRQC 1H72C 2KXHA 2BE7D 2RRNA 5A2QY 4N5SA 3CXCR 2A6OA 1QVFR 3HJVA 1YJUA 1D3WA 5LSLA 1LK7A 1BHNA 3Q2TC 1WSRA 3GB0A 4HACA 3OTOF 3MD3A 1S6OA 5DDQC 3J80Y 4JI1J 5HQ8A 5H9FJ 5KAKA 1PBAA 4IFYB 3MPUB 3MR6A 3DLHA 4ZCMA 4GVBB 3CCUS 2G2YA 1UJ6A 3Q2SC 5J1NA 1UKUA 1I6JA 4F4WA 1WF2A 2GVDA 5ETSA 3HHLB 1VBYA 2ZBIA 1Y11A 4OYBA 5CYQA 4MT1A 5HATA 2QL7B 1TK8A 1YGYA 4MFBB 3BS9A 5D0GA 4XO0A 3EPIA 4FF3A 1MLAA 5LMUJ 2NR0A 1RACB 3BJYA 2QEXS 4F02A 4P10A 4DUYJ 3FVYA 4KV8B 3UNGC 1JX4A 4LF8J 2PA8D 3LOUA 3G2XA 2ZBCA 1ZM3A 4H4MB 2XCPA 4B9VA 3LH2S 4L3NA 3CCJS 1IQTA 2DH8A 5KOXA 3HSJA 4M5NA 3W5ZA 5KT3A 1S9GB 2R7TA 3BBBA 4OYPA 2FDNA 4CH0S 1NKEA 2CPZA 3UN2A 2L9NA 3FBFA 1Q7YT 3KK1B 1B99A 4WIIA 2K1RA 4DR1F 2WONB 2IAJB 2M3DA 2V2VA 4RWWA 1YBAA 3GP9A 1KTQA 3KG1A 3K58A 1RA6A 3IBWA 1NJXA 1UZHA 1VOMA 3NAIA 2CA9A 4HT5A 2YPZA 2ZJRQ 5KG4A 4B9UA 2CG8A 2DGSA 5DQGA 3G71S 2HHPA 2CQGA 2XMMA 4IH5A 1X5PA 1XWLA 2IIHA 2V4RA 4USHA 1U6ZA 1G4CA 3MM9B 1HHTP 5CAAA 3H2LA 4AXJA 3C19A 3CTRA 1KFSA 3US5A 5IQQA 4KHRA 2FZCB 1FK9B 3H20A 4CH7A 4DR2F 2F3JA 1UVJA 2DGXA 2EFQA 3VAJA 2B4PA 3CJ3A 1UZDA 1ULRA 2KYZA 2DNRA 3RRKA 4KJIA 1QUPA 2PGCA 5IM0B 4OX8A 2YKPA 4KT0C 2MYFA 5JVHQ 2M2BA 4ZPTR 5B0FA 1I1GA 2KU7A 5JUMA 3NGDA 2MZJA 2VG7B 2HVZA 1JNRB 1AYEA 2Z8QA 3EGWB 4FN5A 3BO3A 2W2PP 2ZJPQ 3PRVA 2XMVA 3DKDA 4Y0FA 3OHBA 2XULA 1MG7A 3IS9B 3UDVA 1Q8LA 3HPOA 3BQ0A 4TKTA 1TL4A 2E9TA 4TU8A 2JDJA 1UVNA 1HYSA 2FYXA 2H65B 2KTQA 2HS4A 4OJHA 4MAKA 2VJVA 1X9WA 5ETOA 2ZZNA 1JLEA 3MM8B 4U9RA 1E6VA 3AD9C 3LPYA 1GXLA 1S57A 1X4CA 1YLXA 3QNWB 4NLVA 3WIVA 2NPIA 2FTRA 4XTTA 4YHHF 3Q8SB 1M5KC 1YTYA 1S1UA 3PRBA 4ED2A 1S5ZA 3DLEA 2RKIB 3R27A 4RW6A 3M2UB 3SI8A 2A3JA 1Y9OA 3KJVB 1JJCB 1S1TB 3BKUA 1MMNA 3THPA 4YOEA 4Y2KA 5GVQA 4M5DB 2IA6A 1SCJB 2YNFA 2PE8A 2MZQA 2W2MP 4K4WA 2ZE2A 3UO0A 2F9DA 4CLTA 1RHQB 2RDIA 3RBDA 1D0EA 5A8KB 3LAKA 4O0IA 2ASJA 1T7PA 4GKJJ 1D9FA 4UT4A 4IYQA 1TVRB 2PMHA 2WW8A 4PG8A 4RUAA 2CIMA 1H0HB 2KVQE 3F41A 8ATCB 3BQ2A 2DBBA 1X5TA 3AD7C 3H0PA 3BREA 5CZXA 5FDLB 2JC1A 2W25A 2XMKA 3D28A 5T7LB 3JAMY 4JI6F 4YMEA 4O4GB 3HX9A 3SZ2A 1N36F 1SJRA 5KFUA 3UE2A 3C15A 4FKXA 3TJAA 2HEKA 2DNKA 2QC3A 4ECXA 2IRXA 1RI7A 5A8RB 4Y3CA 4Y65A 1RWPB 3DN9A 2OKQA 1RWMB 2HFNA 4WCEQ 4WFBQ 2RMLA 2V94A 2BMBA 4WE1A 3W5YA 5KT6A 2B9XA 1MN9A 2YWFA 4I6YA 3DGVA 3VWSA 2QFJA 2LQ8A 4OZNA 2VH7A 4DR1J 1S72S 3C66A 3R7SB 3J80U 4RBUA 3FBCA 1HBMB 1UAWA 4OI1A 1HQ2A 2OEKA 1HNVB 1HQEA 4QIGA 1H6KX 5CH7B 2Z30B 2DHXA 2HRTA 2CPDA 3D0IE 3M1VA 4Y2CA 5SUHA 4AQYF 5F8JA 2W01A 2UUWA 1BLUA 4K5RA 1RT2A 3LGMA 2FVQA 3AA9A 3OLBA 2IFXA 4OLOA 2W8KA 1U26A 3FQLA 2E1AA 2UUTA 2CUYA 2M5YA 1WELA 2UU9F 2DO4A 1RT3A 3GJTB 4WFAQ 1N52B 2AJ1A 3QT5A 4HT7A 2Y1JA 3IRXA 2G1HA 4DV7F 3EVWA 3EDRB 4N41A 3A3NB 1VYAA 2BYCA 3D0HE 2ZH8A 2BKNA 2GGPA 1YX2A 2ZDOA 1MN7A 1DAXA 1FXRA 2OLWA 4LQ9A 3TUJC 4R5PB 3DOLB 4WFXA 2RQKA 1TL7B 1S1TA 3ET6A 5A6PA 4JBCA 3KK3B 2DPJA 3W1YC 4KYZA 2DITA 1L3TA 1OY6A 2LKZA 2P9GA 3B6BA 1IKYA 4NYPA 5F8LA 4IQXA 1RQ0A 1RTZA 2KJVA 2V50A 4DPOA 4KHPF 1K0VA 4RL1A 1IM4A 5KT7A 2ZUAA 4TLQA 1VQ7S 1LW0B 2K06A 2VQEJ 3CJ5A 3FNNA 1HIYA 1QUVA 1ZM2A 2MEWA 4DV4F 4RUCA 3BDEA 3BGOP 4EZ6A 2HLUA 3IR5B 3GJRB 3ISND 3TUZC 1UFLA 1OJ4A 3GCWP 4IDKB 1UJ5A 1QTNB 2EG1A 2HK3A 2J76E 2CPJA 4PG5A 2WSFC 4PQAA 1OY8A 1JJ4A 3FJ2A 2YXLA 4KGMA 3CCRS 4ECZA 5HMWA 2KG1A 4AL5A 4ZKAA 3EGNA 2J0WA 1U1QA 4UZCA 1TL1A 3DU5A 4UY8T 3N4WA 3BGUA 3F0NA 4NLXA 4ZJQA 1GX5A 3UR3C 4ZIWA 4QPXA 4DQSA 4RR5A 1RE1B 5KFPA 4NXMJ 1JQGA 1NH7A 1VR6A 3D6MB 4JI5F 2F4VF 4WK1A 5K8NA 3TWZA 3NS5A 5B0GA 1C4CA 3QGGA 2LA4A 3D9BA 2IVMA 3MMBB 3OBIA 2B5JA 1MWQA 4RW8B 4JUZA 3IRWP 1PJ7A 1QM9A 2JWNA 1D9DA 2IRYA 1JLGB 1OSCA 2DO0A 1RT1B 2WAQD 4LRAA 3ZTOA 4J9KA 4ER8A 3C6UA 4LFCF 1KQSR 4K5SA 1VQLS 1SH0A 4F4ZA 4NZ7A 1SKSA 1HWKA 3GWCA 1R8AA 2GHPA 3FSYA 3GFYA 4FKYA 2C22A 4PUOB 5LJ5Y 6AT1B 4J9UE 2NYHA 2BDPA 3NKYA 1S1VA 4I6AA 4LMZA 3ZZRA 3KK2B 3TA0A 4ZLLA 4XPEA 4RNMA 4DL4A 3ILLA 3P8BB 3TO8A 4AL6A 1H2UX 3GTYX 5L38A 2CRLA 3M2VB 4K2XA 2FJVA 2XYGB 1C1CA 3CEDA 3HVTA 1HWIA 2CQ0A 5KG3A 1HI8A 5KFJA 4CLFA 5I42B 1KLMB 3PDNA 2JX2A 4DSEA 3LALA 3CF5Q 1HNXF 1RBAA 5I3QA 1X31C 4ZP6A 5F3ZA 2HNZB 5CYJA 1M90T 4DV3J 4IDKA 4E8UA 4M95A 2X1GA 2LP4A 5GMKa 3TUPA 3CW2C 1XK8A 5D8HB 3EVMA 3SFUA 2UUBJ 3QSYB 2O66A 3IAM9 5D0RA 2CJQA 4U8YA 3U02A 4EO8A 3QGPA 2B3TB 1T94A 2EKNA 2XM3A 2M8DB 8RUCA 2VZ9A 1Y3JA 1XR6A 3FKBA 4ZP7A 3VGVA 2IBOA 3CUNA 4BCAA 2L08A 5DM6Q 3FGVA 3NCRA 5DJBA 5DLGA 4FXWA 5U47A 2IVFB 2Q1LA 5KFTA 3ENVA 1URNA 3SCIE 2NZCA 2GQCA 1MMLA 1HBNB 4U8VA 2QSWA 3BDPA 1WDDA 3PRDA 1L3VA 1N6QB 3CDUA 3RGIA 1J27A 1YWXA 4NA3A 3H5SA 4QIWD 4QQBA 5DGBA 4PWDB 4JYAJ 2BQ3A 2ERRA 2AKWB 2D9OA 2YWWA 3CJ0A 4WE1B 4CZCA 4ES3A 3NOCA 3QGIA 1N36J 1IR1A 1XNQJ 3SSSA 3QATA 3RW6A 4GKKF 2YKAA 1XIQA 4NLOA 2HK2A 4OHYA 4I6WA 4U7UK 5KFGA 2R7OA 3MHYA 3KK1A 2VDHA 3W63A 2XY7A 2I2YA 4EK2A 2HHTA 1PYSB 1EX8A 1YJRA 2MGZA 4G1QA 4ED4A 2NQPA 2J7UA 2I8EA
chains in the Genus database with same CATH topology
4JI1J 4NXNJ 4LF7J 4B3TJ 4LF5J 4LFCJ 4RJVA 2VQEJ 2MEWA 4DV2J 4LF9J 1IBMJ 2ZM6J 2E5LJ 2UXCJ 4OX9J 2UU9J 4B3MJ 4X62J 1FJGJ 1J5EJ 5IWAJ 5FLXU 4DR4J 4DV7J 3R2CJ 2UXDJ 4LF4J 3J81U 1N32J 4JI3J 4NXMJ 4NEZA 4KY3A 1XMQJ 4DR2J 4LF6J 3T1HJ 4DV0J 5AJ3J 3R2DJ 4JI2J 4X66J 4PWWA 2HHHJ 5A2QU 2VQFJ 4LFBJ 4NEYA 3JAMU 4JI7J 4DV4J 3IMQJ 4DV1J 4JI5J 2F4VJ 4GKJJ 4YHHJ 4DR3J 4LFAJ 1HNZJ 4DUZJ 1N34J 2KVQE 4DV6J 5BR8J 4DR7J 2MQ8A 1XNRJ 3T1YJ 3D3CJ 4GKKJ 4B3SJ 4DV3J 4X64J 4V1Ak 2UUAJ 2UUBJ 2MTLA 2KL8A 4HHUA 5LMNJ 5IT9U 3J7AN 4DV5J 4JI4J 4DR1J 4DR6J 5LMUJ 3J80U 4DUYJ 5LM7E 4LF8J 1HNXJ 4JI0J 1XMOJ 4YY3J 3OTOJ 1I94J 2UXBJ 1N33J 4JI6J 4JV5J 4KHPJ 4JYAJ 3D3BJ 1N36J 1HNWJ 2UUCJ 1XNQJ 4JI8J 1IBKJ 4B3RJ 1HR0J 4AQYJ 4X65J 3W1YC 4KYZA 4DR5J 4K0KJ 1IBLJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 J;  4NXN J;  4LF7 J;  4B3T J;  4LF5 J;  4LFC J;  4RJV A;  2VQE J;  2MEW A;  4DV2 J;  4LF9 J;  1IBM J;  2ZM6 J;  2E5L J;  2UXC J;  4OX9 J;  2UU9 J;  4B3M J;  4X62 J;  1FJG J;  1J5E J;  5IWA J;  5FLX U;  4DR4 J;  4DV7 J;  3R2C J;  2UXD J;  4LF4 J;  3J81 U;  1N32 J;  4JI3 J;  4NXM J;  4NEZ A;  4KY3 A;  1XMQ J;  4DR2 J;  4LF6 J;  3T1H J;  4DV0 J;  5AJ3 J;  3R2D J;  4JI2 J;  4X66 J;  4PWW A;  2HHH J;  5A2Q U;  2VQF J;  4LFB J;  4NEY A;  3JAM U;  4JI7 J;  4DV4 J;  3IMQ J;  4DV1 J;  4JI5 J;  2F4V J;  4GKJ J;  4YHH J;  4DR3 J;  4LFA J;  1HNZ J;  4DUZ J;  1N34 J;  2KVQ E;  4DV6 J;  5BR8 J;  4DR7 J;  2MQ8 A;  1XNR J;  3T1Y J;  3D3C J;  4GKK J;  4B3S J;  4DV3 J;  4X64 J;  4V1A k;  2UUA J;  2UUB J;  2MTL A;  2KL8 A;  4HHU A;  5LMN J;  5IT9 U;  3J7A N;  4DV5 J;  4JI4 J;  4DR1 J;  4DR6 J;  5LMU J;  3J80 U;  4DUY J;  5LM7 E;  4LF8 J;  1HNX J;  4JI0 J;  1XMO J;  4YY3 J;  3OTO J;  1I94 J;  2UXB J;  1N33 J;  4JI6 J;  4JV5 J;  4KHP J;  4JYA J;  3D3B J;  1N36 J;  1HNW J;  2UUC J;  1XNQ J;  4JI8 J;  1IBK J;  4B3R J;  1HR0 J;  4AQY J;  4X65 J;  3W1Y C;  4KYZ A;  4DR5 J;  4K0K J;  1IBL J; 
#chains in the Genus database with same CATH topology
 2HG4 A;  9RUB A;  3KLG B;  4PRF A;  1FO1 A;  3SCJ E;  3TA2 A;  1Q78 A;  1BD6 A;  1PBU A;  5CHC B;  1S7H A;  3CDA A;  5D4O A;  1RTH A;  3PYG A;  3BQ1 A;  2FY1 A;  2ROG A;  2XS2 A;  1NSQ A;  4RJV A;  2UVW A;  1ZPV A;  2FGO A;  1TVR A;  5KFN A;  2R2T A;  1DTT A;  2A0F B;  3E3X A;  4MK9 A;  1GMU A;  4PWU A;  4ZVE A;  5A0Y B;  4R8U A;  1NJI T;  5AXL A;  4UOC A;  3MUR P;  3JQK A;  4ZCI A;  5HRO A;  4LQ3 A;  1ZAV A;  2CQC A;  2E5L J;  4DS5 A;  3PR4 A;  3W61 A;  1SH2 A;  1UVK A;  1AZS B;  1HPZ A;  2ZC4 A;  2GVD B;  4A8K A;  1LFP A;  3ILO A;  4RU9 A;  3HSD A;  4DUZ F;  1ZPW X;  2DNZ A;  1Q82 T;  1KS2 A;  3OPK A;  3R8Y A;  1JIH A;  2BJ9 A;  3DLK A;  3MF5 A;  2MQQ A;  5HLF A;  2BOA A;  1ZTT A;  1SUQ B;  1Q79 A;  4RNN A;  2DNH A;  3GQC A;  4C8O A;  1Y3K A;  5LSO A;  2FB0 A;  4Y2M A;  2JJ4 D;  2VG6 B;  1QSL A;  1AUS L;  2R7V A;  2H9Z A;  4JI3 J;  3W2W B;  1FHT A;  2KZM A;  2V2K A;  3JS9 A;  3T1H J;  4DQP A;  2JEF A;  2KG0 A;  2PO4 A;  3DC2 A;  3LP2 A;  5JMN A;  3TAM B;  4LBP A;  4ITS A;  3W9I A;  4JV1 A;  2HQF A;  2QZ8 A;  5GAG U;  2W9B A;  3M32 A;  3OFH A;  2VL1 A;  2VG5 B;  2H4Y B;  1HNI A;  1JLC A;  2D3O 1;  5I3U A;  1CS4 B;  2KT2 A;  3KLF B;  4DQQ A;  3SV3 A;  1S1U B;  1R8C A;  4K2J A;  3JAM U;  5L1K A;  4NWB A;  5L8R C;  2MZ1 A;  1X4D A;  4DV4 J;  4TY8 A;  3Q8R B;  3IN5 A;  2BJE A;  4X2B A;  3BB5 A;  2AU0 A;  1Z2Z A;  3BN4 A;  1FD8 A;  3I56 S;  4JI5 J;  2F4V J;  2MST A;  4ID5 B;  1D09 B;  3CO9 A;  1N5T A;  2Z2Z A;  1YG0 A;  1T05 A;  2BJ1 A;  2YNG B;  2OPR B;  4MYU A;  1SV5 A;  4X4S A;  2WOM B;  1YZ6 A;  3G86 A;  1FA0 A;  2VFU A;  2R8J A;  2BRK A;  2K7K A;  3MPD A;  2IM0 A;  3ET6 B;  3TJ8 A;  2A6M A;  3G87 A;  1XC9 A;  1TL3 A;  4OJ1 A;  4DCP B;  5KG2 A;  4CT8 A;  1AUD A;  4NRT A;  1W2B R;  3KLV A;  1U0S A;  2PSZ A;  4DPX A;  5J2P B;  1JJ2 R;  2NUU G;  4L75 A;  2AEM A;  2K3I A;  3R5A A;  4NYZ A;  3TR5 A;  2MZS A;  4OJG A;  2RB7 A;  4JI8 F;  4OI0 A;  1TL3 B;  3MMJ A;  1Y7P A;  2JVO A;  4M5G A;  4RUH A;  5J2M B;  5KFS A;  2J9D A;  4KTQ A;  1KVI A;  1DJ0 A;  3NBP A;  4OZL A;  3J7Y I;  2EKY A;  1U1O A;  2LXI A;  4CLW A;  3J7A N;  2VPY B;  4ZVH A;  3SEO A;  2LU1 A;  5KFC A;  1DLO B;  3M8Q B;  4YN3 B;  5RUB A;  2G0C A;  2CNN B;  3DLJ A;  1XBW A;  2HQD A;  2R7W A;  4EBD A;  1YJW S;  4I7F B;  5IV4 A;  5DZ7 A;  5LM7 E;  3T9N A;  4CLU A;  2GMH A;  3R5J B;  3OTE A;  4E0D A;  4A8F A;  2BUN A;  2BE2 A;  4WXO A;  4Y28 C;  2KM8 B;  3QQC D;  4NPO A;  3MFH A;  2K8G A;  1K1Q A;  2NUH A;  1P9Q C;  2F8H A;  2E1P A;  3BZQ A;  2VJU A;  4X4R A;  4KV8 A;  1NAQ A;  4QW9 A;  1DTQ A;  3DRS B;  3DOM B;  4LF1 A;  4L72 B;  4O3Q A;  2HZA A;  2NCK L;  3IP0 A;  4K7Q A;  5KT5 A;  3C3L A;  1MSW D;  2V4J B;  2ZVI A;  4QWA A;  3BGR B;  4ETZ A;  2FJX A;  1CJT B;  3HT3 A;  2WZ1 A;  4KPC A;  4DX6 A;  4DZD A;  1HI1 A;  4TVA B;  2FJD B;  4LRC A;  4L76 A;  3DRR B;  5M2R A;  4ECT A;  4WFY A;  2G0I A;  2KRB A;  3ZNJ 1;  3HM9 A;  4GVB A;  4HH0 A;  2FHO B;  2R2U A;  4EYH B;  4A8Y A;  4ED8 A;  3AH6 A;  2HWT A;  2JLE A;  1L5U A;  2BEF A;  3KUE A;  5KFL A;  1RWN B;  1IQZ A;  2HRU A;  4CLY A;  4ZVU B;  1F5C A;  3NGU A;  3HFV A;  4DFK A;  1U45 A;  3M2R B;  2VON A;  1VQK S;  3FEY B;  3K8V A;  3ZTR A;  2FVR A;  4NLW A;  2BR0 A;  2CQ3 A;  2LQ9 A;  2KI2 A;  3NAH A;  3JSM B;  2ZUG A;  4CM2 A;  1YI2 S;  4YP3 A;  2KFN A;  1RT4 A;  4URS A;  5B08 A;  2D3U A;  1HW8 A;  4X66 F;  4OYA A;  4B9N A;  2VUG A;  1GH8 A;  2XLI A;  2C3O A;  1FE4 A;  3S6E A;  1MNE A;  4L74 A;  3MM5 A;  1U47 A;  5E3A A;  1FJC A;  3SBM A;  2ZD1 B;  3W8G A;  1UCN A;  1NK4 A;  2ZJQ Q;  4UY8 5;  1PC4 A;  3F44 A;  4B08 A;  3M8P B;  1SJ3 P;  1FRI A;  1CSJ A;  5E2Q A;  3EMT A;  2CZ9 A;  3F73 A;  5A6W A;  3CPW R;  3KLE A;  3CCL S;  2AX0 A;  4CCH A;  3CC7 S;  2BW2 A;  3MM8 A;  3UWT A;  2UXD J;  3MED B;  2XSJ B;  3MEG A;  3CJS A;  3D1O A;  3GFX A;  3H2V E;  1MRO A;  3VR1 A;  4F0K A;  3SSR A;  5K5M A;  1VQ8 S;  3X1L B;  2FLP A;  1N8R T;  1RDR A;  1S6U A;  1GXU A;  2HIQ A;  1FWL A;  4KGK A;  4W92 B;  4EMD A;  3S8S A;  3RW7 A;  4LF7 F;  3QMQ A;  5D3G B;  2RDD A;  2JNJ A;  1BQN A;  1VJQ A;  3TZY A;  2DHH A;  3SSQ A;  1BY9 A;  3C6U B;  3Q89 A;  2VA2 A;  4LRF A;  4ZPV R;  1XJW B;  4EUV A;  2D69 A;  3RAX A;  2DRB A;  4ZLN A;  3DCA A;  1ZH5 A;  3ZZO A;  1R0B G;  2KHD A;  1BQX A;  5D0E A;  3PW0 A;  3BH7 B;  1SL2 A;  5FDL A;  2BKP A;  4FPR A;  4NLY A;  4BBY A;  1U0H B;  4P73 A;  5DQH A;  4C8M A;  3QRQ A;  3JXO A;  2Z2Y B;  4CRJ A;  1NDK A;  2V9K A;  3Q0A A;  3BSN A;  1YZ7 A;  4OYI A;  4ZPB A;  2KH9 A;  3MM9 A;  1VK3 A;  5KFH A;  1YK9 A;  3QT8 A;  1VQ4 S;  2CQP A;  1KOH A;  1W26 A;  2H5E A;  3BGF A;  4J5O A;  4D3G A;  4B3O A;  4FBT A;  2QLF B;  2AMC B;  1WNE A;  2Z58 B;  3BGR A;  1MMD A;  1R6Y A;  4HR2 A;  1JLA A;  1JK9 B;  3T5K A;  2HNZ A;  2YQ1 A;  3JQJ A;  4XK8 C;  1HBO A;  4M5H A;  1S9F A;  2NS1 B;  2C2O B;  3HD2 A;  4AND A;  4ZLP A;  4TLR A;  2BQU A;  2J9E A;  3K59 A;  3V2U C;  5HAO A;  1FJE B;  4CYU A;  4C8K A;  3ZZU A;  3P6Y C;  1RT5 A;  1S76 D;  2IYG A;  5IT9 U;  2VBX A;  1NDC A;  3HSG A;  2GO9 A;  4Z7Y A;  2HS3 A;  3W2W A;  5H9E J;  3T6B A;  1QAY A;  4EFA C;  3CD6 S;  2DT9 A;  4DR6 J;  4FPI A;  1DQ8 A;  1U6B A;  4IRK A;  3HJF A;  4DXL A;  4DU8 A;  2YX4 A;  2IM1 A;  2IYI A;  2M70 A;  3M7V A;  1A9N B;  3T6J A;  1R7I A;  3M30 A;  3K17 A;  3DM2 B;  4CDI A;  2YNI B;  1T9T A;  1HW9 A;  2JOQ A;  2ZBQ A;  5LJ3 Y;  2IMO A;  1HD1 A;  1N33 J;  5I3P A;  2GIQ A;  1NK0 A;  1M5P C;  1CC7 A;  3ZTQ A;  1M1K T;  3E8O A;  1UVL A;  4KHP J;  1S0M A;  2MHN A;  1S1W A;  1DTT B;  1TL5 A;  1AA1 B;  2PFF B;  3P96 A;  2Y1L B;  4ZVR B;  4JI8 J;  3FBB A;  2MQN A;  4PXD A;  4B3R J;  2NPF A;  1NB7 A;  1L3K A;  3HXM A;  2QE5 A;  2JEG A;  1S77 D;  4CI0 B;  2B7C B;  2ZNY A;  3A13 A;  3RRH A;  3OUY B;  2YH1 A;  2NXC A;  1WHW A;  3AY0 A;  4N8N A;  1D1U A;  5CYM A;  5ETT A;  2GVZ A;  1FRM A;  2QMU B;  3N5B A;  3TEH B;  1S6Q A;  2KKH A;  5J1P A;  2XTJ P;  2YQ0 A;  4M5M A;  2ZH2 A;  4FYX B;  1CLF A;  4NOH A;  4OYM A;  5E3C A;  3AA8 A;  5EUH A;  5CAB A;  1XMB A;  2ZD1 A;  3I0R A;  2BJ7 A;  2G4B A;  1IKV A;  3N9U C;  3N6L A;  4NL5 A;  4JYA F;  2DK2 A;  1WKK A;  2WON A;  4MH8 A;  2KT3 A;  1HWL A;  1UFW A;  3UN3 A;  4C48 A;  2VPZ B;  1RTH B;  3QT6 A;  5L9X A;  2I5J B;  3QAU A;  5KTQ A;  3ITH A;  1TUW A;  4LSL B;  3MED A;  3VGS A;  5IXU A;  2F8E X;  4I7F A;  4RBV A;  1NHV A;  3FFI A;  3FMB A;  5F0W A;  5B0A A;  2MGZ B;  3IAS 9;  2VQF F;  2J8A A;  2VIC A;  5L1J A;  2XGQ A;  1JXE A;  1R31 A;  4NXN F;  1F9E B;  4DR4 J;  2WK4 A;  2XEX A;  3GON A;  4J91 A;  5HLF B;  3DI6 A;  4O4R A;  3O44 A;  5KOW A;  1R89 A;  1FFW B;  5J2Q B;  2D9P A;  2HQI A;  4C0B A;  3I82 A;  4DU7 A;  4A48 A;  2BX6 A;  3KJQ B;  3GV5 B;  4DFM A;  2ASD A;  2QA4 S;  1U1K A;  4K50 A;  2YNI A;  3Q22 A;  2DYA A;  1SC6 A;  4X4N A;  3M30 B;  1N5S A;  3ISZ A;  4RW4 B;  3H90 A;  3SDE A;  2FJB B;  3A4T A;  3AQP A;  3MD1 A;  3MM7 B;  4I4B A;  5J2Q A;  1ZM4 A;  4GMK A;  3MFI A;  3JSR A;  2V67 A;  2C2D A;  5HQM A;  1VRT A;  2DCL A;  3QO9 A;  2HHW A;  1TTH B;  2LDI A;  2WVD A;  2XZT B;  4X4O A;  2OPP B;  1TAQ A;  1VBK A;  2OP5 A;  2AYM A;  2IBK A;  2R8H A;  2OI2 A;  1TMJ A;  3IMQ J;  3PFE A;  4FDF A;  4CLZ A;  5L1L A;  3UCU P;  1RT5 B;  4G1Q B;  3CVK A;  5CQG A;  2H1Y A;  4LF8 F;  4B3M F;  1B3T A;  1CS4 A;  3EDQ B;  3KLF A;  4PXE A;  2FD2 A;  1HHS A;  4CTA B;  2W2Q P;  2A18 A;  1P6T A;  3RUB L;  4PUO A;  5B0E A;  3I0R B;  1U09 A;  3CD7 A;  4I0W A;  2CJY B;  3GIR A;  2GML A;  2P6S A;  4BWM A;  5K14 A;  1DQA A;  4RKU C;  3OFE A;  2RRB A;  4USI A;  3C46 A;  3RYL A;  3R7B B;  3FEZ A;  3QLH B;  1EB0 A;  1Y4Z B;  2KXN B;  4CP5 A;  5E3P A;  1YJT A;  2M7S A;  2UUA J;  2ZOG A;  4Q8F A;  3GCX P;  3OXL A;  4NZ0 A;  1KQG B;  3M8R A;  5LMN J;  2XS7 A;  4RBT A;  1T3N A;  3AAW B;  1NKB A;  1QE1 A;  3Q8P B;  1T11 A;  3UDL A;  3PV8 A;  4K4V A;  5KFI A;  2DNY A;  3V6D A;  1C2P A;  4JI4 J;  1R3N A;  3GJS B;  1RWW B;  4JOU A;  5DS7 A;  3QLH A;  3TQE A;  1GNK A;  1GQE A;  1RBL A;  1SVD A;  2W8L A;  4I56 A;  2GQ2 A;  1REV B;  2O01 C;  2A2C A;  3KLH B;  1P1L A;  1E6Y B;  1RTI B;  3VQS A;  1CJK B;  3D67 A;  2ROP A;  6FDR A;  1IWA A;  2OO4 A;  1PYT A;  4MKA A;  5E3R A;  4TQR A;  4JI0 J;  2OFH X;  3DM2 A;  4F3Q A;  3G6E S;  4KPY A;  5F8M A;  3MOJ B;  2IDL A;  3EWG A;  1S7I A;  2D74 B;  4RW8 A;  2B4V A;  1T3O A;  2RS8 A;  3L95 X;  1SKR A;  4IR9 A;  2HRY A;  4HEA 9;  3CWJ A;  2Y1I A;  1FX4 A;  1OS5 A;  4OZ2 A;  1AB8 A;  1F3V A;  2CKW A;  1XEZ A;  2RD5 C;  5KFZ A;  5IWA F;  1V5V A;  1WI6 A;  3CIM A;  4ID5 A;  4XAK A;  2UUC J;  1E6V B;  3LP1 A;  4KGZ B;  3DFE A;  4D3H A;  4NX9 A;  4DR4 F;  2V6A A;  5HVF A;  4J9Q A;  3EE3 A;  1AT1 B;  1KC8 T;  1VRT B;  1J5E F;  3A12 A;  4J9V A;  5KFA A;  3VVU A;  1RBO B;  2DEJ A;  3G82 A;  2PMW A;  1YRU A;  1V6H A;  1X4G A;  2VOD A;  1FTR A;  2HS0 A;  1FJ7 A;  4K8R A;  4J9O A;  3KHR A;  1IKX B;  2DGW A;  1FT8 A;  3UDE A;  4DWI A;  1AZS A;  1WWH A;  2BKO A;  3TP2 A;  1SI9 A;  2XYH B;  1RT4 B;  4ES1 A;  1RXO B;  4H4K C;  4ANE A;  4DUY F;  1X7V A;  4PXC A;  3D66 A;  1RHU B;  2BAB A;  2DRD A;  1RWU A;  1FRK A;  5MAO A;  5AJ3 F;  3RB3 A;  4IFY A;  2DNO A;  3WHI A;  1VHI A;  2HIY A;  2HQG A;  4GRS A;  2OD4 A;  5HP1 A;  1WTF A;  4HI2 A;  1NK5 A;  4FF4 A;  4ED5 A;  4C11 B;  2B9Y A;  3BSO A;  2XG8 A;  3M1V B;  2I0X A;  3UQS A;  3AOA A;  4RU2 A;  3NWR A;  2EFP A;  1B7Y B;  2K2P A;  4EZ9 A;  2FVS A;  4B3R F;  3HHN B;  4Y6I A;  3IO1 A;  3C6T B;  2KDO A;  4G65 A;  1ELO A;  1FI4 A;  1RWO B;  1R6V A;  2YKM A;  4MKB A;  4NI2 A;  4PZV A;  3KMQ A;  4Z37 A;  1JLB A;  3C16 A;  4DSI A;  3D4J A;  4EEY A;  4G6V B;  2DY9 A;  4OI3 A;  1VBZ A;  4IRD A;  1UET A;  7FD1 A;  3BV8 A;  2CAJ A;  4DFP A;  4L3K A;  3DGP B;  1WC0 A;  3HDS A;  1UWB A;  1V5I B;  1KP6 A;  2F1F A;  1NU4 A;  3AFG A;  1JLB B;  3C16 B;  5AJ3 J;  4PR6 A;  4UQG A;  3PY8 A;  5BJR A;  4U6P A;  2YQ3 A;  4YR0 A;  1GX6 A;  1PAE X;  3B54 A;  1TP7 A;  4I2Q B;  2CAD A;  3GIL A;  3BO4 A;  3UCZ P;  3CJQ A;  4P75 A;  2OTL S;  3VTI A;  3NGR A;  1C0T A;  3HHD A;  1X5O A;  1IUJ A;  5AE3 A;  1RAB B;  3DOK B;  1QAJ A;  1APS A;  3KK2 A;  2ZDP A;  2OTJ S;  1YRT A;  3AQO A;  4LBH A;  1IKY B;  1CEZ A;  5BXI A;  5ETN A;  3TUI C;  2DH7 A;  5BYR A;  1NUE A;  4F3O A;  1VIS A;  5KFR A;  2P6T A;  2LEB A;  3H5X A;  2JL9 A;  4FVM A;  3HK2 A;  2R4F A;  4QZV B;  2YH0 A;  1JXV A;  1ZS6 A;  2QRR A;  4DR3 J;  2KO1 A;  2Y0S D;  2LLZ A;  1S1X B;  1FDB A;  5F8I A;  4J90 A;  1WG5 A;  2YKM B;  4LR8 A;  3DDK A;  2YNH A;  1F1B B;  5ADZ A;  1S4E A;  2CJB A;  2GJ2 A;  4ZHR B;  5FJ4 A;  3KHH A;  2V8D A;  3NP5 A;  4RNH A;  4EO6 A;  1U1R A;  3OL6 A;  3AOC A;  3SQG B;  3I5B A;  5T7L A;  3WZ0 A;  4ECR A;  2A1B A;  1VJW A;  3OR1 A;  4ZA1 A;  4YDD B;  3PZP A;  1RCX B;  5CD4 H;  2R3V A;  3RJM B;  1SKU B;  3TYT A;  2W7P A;  4G3I A;  3ZZ0 A;  4DQI A;  1TKZ A;  4KKO B;  2O1P A;  4XPC A;  4LIR A;  4NLR A;  1X5S A;  2MKI A;  1YJ9 S;  4LVN P;  1HR0 F;  3HFK A;  2W9C B;  2B51 A;  2CPH A;  2GNK A;  4I68 A;  1W2I A;  1YRX A;  2FHM A;  2CQ1 A;  2F63 A;  3AB4 B;  5D0H A;  5E41 A;  3VAL A;  1HMV B;  4WPA A;  3D68 A;  3IS9 A;  1IKX A;  2QYC A;  4IKA A;  3C8Y A;  3HMJ G;  4C3K A;  5H1S V;  3DOM A;  3HZG A;  2GW8 A;  3KJV A;  1VQY A;  3BKT A;  1PSD A;  4RW6 B;  4JI1 F;  4IOA Q;  3TAQ A;  4YY3 J;  1S6Q B;  5DGA A;  3W64 A;  3EJM A;  4FS2 A;  4V19 J;  1UVM A;  4P2S A;  1B4S A;  2VFT A;  4OYX A;  1HL6 A;  2JSX A;  1ZA2 B;  5E5N A;  3J7Z 5;  3PX6 A;  1FEE A;  3KYL A;  1TU0 B;  1U0H A;  5L39 A;  3CJ8 A;  2AJ2 A;  3NCP A;  4TU9 A;  1JB0 C;  1CG2 A;  1NPR A;  4ZCK A;  3OL7 A;  3OD2 A;  4FNH A;  4M63 A;  1V9O A;  5HL7 Q;  1ITP A;  3DOL A;  2RUG A;  2W7A A;  2HGM A;  4N7T A;  2AX1 A;  1V3R A;  1TEL A;  4DPY A;  1RHK B;  1KFD A;  1YJ7 A;  2EG2 A;  4LSN B;  2RF2 A;  5K14 B;  1FKA F;  3TVK A;  1D9A A;  2E9Z A;  3DDI A;  3M6V A;  4IOB A;  2C2Z B;  2YNF B;  4NA2 A;  4CH1 A;  4MKY A;  3FBE A;  4ZN1 A;  5HQL A;  2BW7 A;  4AFF A;  1O5J A;  1WHX A;  1KSP A;  1KOO A;  2XZW A;  4HHH A;  4R0E A;  2P2C B;  4K4X A;  3B8H A;  2W2N P;  3M2U A;  3FEX B;  4JI0 F;  1QJH A;  1KVJ A;  1N5V A;  3OW2 R;  3A3P B;  5DDO C;  2J7W A;  2VKR A;  4DZ6 A;  3KLG A;  3GSI A;  3SV4 A;  4LF9 J;  3HT0 A;  5JJB A;  3GR1 A;  2PA3 A;  2J7K A;  4ZCL A;  2N4D A;  3BSA A;  4DDF A;  1WC4 A;  2ATC B;  2VFR A;  1LWC B;  2XWY A;  4LSZ B;  4NRU A;  1WSV A;  3LWM A;  2G2Z A;  4WU2 A;  2OHD A;  1XR5 A;  4O44 B;  1Y5L B;  2EFN A;  2MLZ A;  3DXB A;  2V63 A;  4CWB A;  4LF4 J;  2AHO B;  3MEC A;  3O8W A;  3WQP A;  4NLU A;  2RHQ B;  3OSP A;  1FNO A;  2VG7 A;  4OLP A;  2XMJ A;  1S9E B;  3LGN A;  1ZAX A;  4ED1 A;  2ADC A;  2CQ2 A;  1BWE A;  5IFM A;  1TFY A;  5D78 A;  2E29 A;  2XWX A;  1EAY C;  4HH1 A;  1S9G A;  2LXU A;  3BH6 B;  3ISN C;  4F25 A;  3PW7 A;  1S0N A;  5KFE A;  1RB0 A;  1PYO B;  2MLY A;  5KFY A;  3I6P A;  1CPZ A;  1UJ4 A;  2B4O A;  1HFE L;  3QFW A;  1KVK A;  5KFB A;  1RU2 A;  4PCQ A;  4X4T A;  3Q8Y A;  1FK9 A;  3OL9 A;  1RAI B;  3RTV A;  3QBC A;  3U27 A;  3D54 A;  3NNA A;  1QLN A;  3T9Z A;  1RAF B;  4YB1 P;  3QJP A;  4Q0B A;  3RBZ A;  3HFZ B;  4WTY A;  3SDE B;  4KO0 A;  2RVJ A;  4Y34 A;  2EBE A;  3PFO A;  2AYE A;  2QN6 B;  2J0X A;  1EQM A;  4NLS A;  1NJZ A;  1DHM A;  4HTJ A;  2GIR A;  1IKW A;  2H48 B;  4PKD B;  4DCO B;  3J7Y U;  4YY3 F;  3H8Y A;  1TR0 A;  2DIV A;  4R8U B;  4XDC A;  3N6M A;  2UXD F;  1JLQ A;  2O5D A;  3POT A;  4Q2L A;  2FJE B;  5CCM A;  3GIJ A;  3EPG A;  1WD6 A;  4PXB A;  3QRP A;  1G7C B;  2R2R A;  5L46 A;  4WP3 A;  4BHQ A;  5BR8 J;  3ZO7 A;  1F2H A;  5I42 A;  4DV0 J;  2MLX A;  2CG4 A;  2LCW A;  1CJU B;  2AW0 A;  1N56 A;  1BUX A;  3R5D A;  3WX8 A;  3FQK A;  3BR9 A;  5IC4 B;  1XNR J;  3PTW A;  1S79 A;  4GKK J;  3P5T L;  4YB5 A;  2AZ1 A;  3W2V A;  4DG1 A;  2G9O A;  4PYD A;  2ALZ A;  1F2G A;  2WSE C;  6FD1 A;  4MIA A;  2W9A A;  2F4F A;  1DLO A;  3M8Q A;  4IG3 B;  2LVW A;  4HDH A;  4N77 A;  4JI2 F;  1AXQ A;  2AEJ A;  2VAS A;  4DHV A;  1X60 A;  4DR3 F;  4O3R A;  5IT9 Y;  2LMI A;  4UQT A;  3DGP A;  3MPW A;  4AT1 B;  4WKY A;  1Z4U A;  2XZD B;  3GG0 A;  4KSE B;  1HNZ F;  4NCA A;  1FDN A;  3PKY A;  2FLO A;  2DIS A;  2N4C A;  4HI1 A;  3CGI A;  3CJT A;  4J9N A;  4P7V A;  2AEF A;  5KFV A;  3KUG A;  3PHE A;  4OV1 A;  5DG8 A;  1E6Y A;  1KHV A;  1RTI A;  3QIP A;  5JXS A;  1N5Y B;  3FK4 A;  1F9H A;  2QLW A;  4TNO A;  4ZIT A;  5HSP A;  4JI7 F;  4IRC A;  2RE1 A;  4OHX A;  2ZEJ A;  4ICL A;  3Q86 A;  3MUV P;  3MMB A;  4DV6 F;  2D41 A;  1LNQ A;  1RAD B;  3CSK A;  3KFW X;  5IOL A;  4EWT A;  5IT4 A;  2LEC A;  2ZNZ A;  3IG1 A;  3OFG A;  2ACM A;  4A8O A;  4BS2 A;  3BKF A;  1T05 B;  1YDL A;  2B4U A;  3LPE A;  3EVO A;  5ITH A;  3FCH A;  5K8M A;  1OIA A;  1WJ9 A;  3QAE A;  1HWU A;  3THT A;  1SKW A;  1FXL A;  3CJK A;  4ED7 A;  1ROF A;  5SZT A;  1SXL A;  4PAA A;  3TZX A;  2BAN B;  1GAO A;  2APO A;  2G13 A;  2R8G A;  2ZBP A;  1VQN S;  4DR5 J;  2Q6C A;  2ZHA A;  2OIH A;  2O3D A;  2F8M A;  4EU0 A;  4B02 A;  4ZPD A;  2HKE A;  1CUL A;  1NDP A;  4WWS A;  3V81 A;  1Q53 A;  4KH1 B;  2R42 A;  2IJF A;  2BM0 A;  3CB4 A;  5IM0 A;  2HND A;  3BBF A;  3V4I B;  1UEV A;  3TRG A;  4DL6 A;  3NG8 A;  1VQM S;  3OR2 B;  2RQC A;  3GV7 B;  5B0D A;  2HHH F;  2ZC3 A;  3RR7 A;  3QO9 B;  1T9W A;  2V8H A;  2G2O A;  1EET B;  2DIU A;  1RWK B;  4C97 A;  1M5O C;  5KT4 A;  3CD5 A;  4F2S A;  4F0H A;  1CC8 A;  4DN9 A;  2N3O A;  1X4F A;  4J9P A;  2HNY A;  1N33 F;  3U1M A;  1Y10 A;  1J5E J;  1KR4 A;  3I9Z A;  1X4A A;  4DSJ A;  2VF3 A;  2XNR A;  5FLX U;  3AD8 C;  1DUR A;  3DMJ A;  2XQC A;  3T3F A;  2VFV A;  2H3E B;  1VC0 A;  2OJ3 A;  4ZJO A;  9ATC B;  3LO3 A;  1N5Y A;  1PJ5 A;  4LFB F;  1REV A;  3KLH A;  5KFX A;  5ETM A;  2M4M A;  2X1A A;  3DHX A;  2L9W A;  1H98 A;  4CT9 A;  2HHQ A;  4FYY B;  1LOU A;  3W60 A;  4BWJ A;  1JJH A;  2IM3 A;  1OWX A;  2YPY A;  1U8W A;  4Q43 A;  2H4W B;  3BSC A;  2Z0G A;  2CPF A;  3MTK A;  3MZI A;  4OX7 A;  4AL7 A;  3CDB A;  5I4M A;  5GAH U;  1JLF B;  2HBY B;  2PFD A;  3OXG A;  2ZH1 A;  3DXS X;  4DL7 A;  2IPO B;  4A8X A;  2LYV A;  1O0P A;  2KFY A;  2GCF A;  2EFO A;  2EXU A;  2Y0B B;  1S10 A;  2ZZM A;  3IFE A;  5C42 B;  5I3U B;  1YJN S;  1U2F A;  2K7J A;  4OFZ A;  7FDR A;  5CZV A;  2Q66 A;  1F5B A;  2HWH A;  2OEL A;  2KN4 A;  1F0X A;  1SJF A;  4U96 A;  4LF9 F;  2CFX A;  2IAJ A;  4KC5 A;  4PWD A;  3OFF A;  2KT5 A;  3OT9 A;  2QLX A;  2U2F A;  3MMC B;  1HMV A;  1SH3 A;  2V8P A;  1P27 B;  5LMU F;  3CJ2 A;  3X3U A;  4RW7 B;  1KRP A;  2B7B B;  2XBP A;  3O2I A;  5HBM A;  3PW5 A;  4IUF A;  3PG9 A;  2CJK A;  3DYA B;  1FRJ A;  4X4P A;  1RTJ A;  2V69 A;  3B4M A;  1FVS A;  1O51 A;  4WP8 A;  2QG9 B;  3FSX A;  3VGT A;  1QVG R;  2VC1 A;  4A8Q A;  4B3S J;  2ASY A;  4DI6 A;  2ZH9 A;  5HP1 B;  3BYR A;  5AXK A;  1RUS A;  2EK1 A;  3R97 A;  2WTF A;  1U49 A;  1GEH A;  4ZJL A;  3VQT A;  3Q24 A;  3GG1 A;  2B8P A;  3P3D A;  3T1A A;  4R5P A;  4DR5 F;  2MTL A;  3R1H A;  1AFJ A;  2QLB B;  3JTO A;  5T41 A;  3LW5 C;  3HHL A;  1S1X A;  3G4S S;  2IC3 A;  1NK6 A;  3C14 B;  2E7V A;  2DR9 A;  1N0U A;  1IBK F;  1IVZ A;  1ZAW A;  2LXF A;  4CO3 A;  4CIO A;  1RIS A;  2JC0 A;  5FII A;  2F9J A;  5DDR C;  3DOK A;  4YFU A;  3HVA A;  2NXU A;  1A6L A;  4I64 A;  4LSL A;  1B64 A;  1WOS A;  4DCJ B;  4Q44 A;  3I4H X;  3D5M A;  3JYT A;  1X4H A;  3D3B J;  2ZFH A;  1BWV A;  1BMQ B;  2I1R A;  1RAO A;  3PCO B;  1IJF B;  1D8Z A;  2RUS A;  4M5K A;  1U02 A;  3SFG A;  1K47 A;  3CCW A;  3RAM A;  4ANC A;  3LUY A;  3DNC A;  2RF2 B;  4HDG A;  4USW A;  4DV5 F;  3VZI A;  5ETP A;  2FZG B;  3U1N A;  4DLG A;  1EAR A;  2IMW P;  2ZKU A;  4IOC Q;  2B5J B;  1SC3 B;  2CZV C;  4FYV B;  1C1B A;  4YUD A;  2MKC A;  2G1D A;  2N7C A;  3MUM P;  5DLF A;  1EET A;  1FTC A;  2YKQ A;  4LF2 A;  3MUT P;  4JI4 F;  2DNM A;  2XNQ A;  2UUC F;  2BE9 B;  2HFO A;  2HAI A;  1FWP A;  2F5G A;  1BGX T;  3CCZ A;  1MU2 B;  3HHE A;  3P4U B;  1QY7 A;  4KAI A;  2LEA A;  2BJ3 A;  1IBM J;  2UXC J;  4RW9 B;  5E7O B;  2CQB A;  2AZ3 A;  1Y0H A;  3G8Q A;  3LF0 A;  3QIP B;  4A8M P;  1GT8 A;  2J6U A;  3CME S;  2J0S D;  4M8L A;  1LK5 A;  5IS2 A;  1U4B A;  4CO4 A;  2HAF A;  4ECQ A;  1N34 F;  3CT9 A;  4X4V A;  3JTP A;  4QR0 A;  2MSS A;  3K7R A;  2P8I A;  4EBC A;  3AB2 B;  5A8W B;  1WHY A;  4DV7 J;  2F40 A;  3SIP B;  2J0Q D;  2CNK B;  2IA0 A;  3BM7 A;  2VA3 A;  4DOZ A;  2RHS B;  3G6Y A;  2AIR B;  3D0G E;  2ILZ A;  4C6A A;  5BYS A;  1LWC A;  3T19 A;  4H54 A;  4CM0 A;  4DL3 A;  2AGP A;  4LFA F;  4B9S A;  4WTO B;  2AF6 A;  2RSQ A;  4QR2 A;  5GME A;  2HPU A;  1JLE B;  1MW7 A;  1RA7 A;  1UA1 A;  1RT6 B;  2DY1 A;  4C0H A;  3PIO Q;  3EZ5 A;  1TKZ B;  2CNO B;  2NXE A;  3LAM A;  4KQZ A;  1UP1 A;  5LOQ A;  1S0O A;  2FHJ D;  1FDA A;  4RLE A;  4X66 J;  4PWW A;  1EQ0 A;  2AJ4 A;  2HHX A;  1SPB P;  3T5J A;  1VQ9 S;  5D4P A;  4CNZ A;  4ICL B;  3EYZ A;  2C28 A;  2Z57 B;  2KM8 C;  2Z56 B;  1RAJ A;  3EM1 A;  2E5I A;  4LRB A;  1N4L A;  1JNZ B;  2E66 A;  2OPS B;  1ICE B;  4QBU A;  3QRR A;  3L3C A;  3IRX B;  4PPD A;  1RT1 A;  4KE5 A;  2POK A;  1HBU B;  4LR9 A;  4WU3 A;  1RT3 B;  4JV0 A;  5EWE A;  5FD1 A;  4DV0 F;  3TAN A;  3K0J A;  5EWF A;  3IA0 A;  2AJF E;  3MM6 B;  1MWY A;  2P9E A;  4ZMM A;  3OJU A;  5GAD U;  1GMW D;  1SJ4 P;  4QYZ J;  2XYP B;  3SMZ A;  3IWX A;  4FYW B;  1M1G A;  3BF4 A;  1SIW B;  3D6H B;  1C1B B;  3W9J A;  3U7J A;  4A8S A;  3KOA A;  1U1M A;  4KGX B;  2SXL A;  4E98 A;  1I51 B;  1X0F A;  1FER A;  4DG1 B;  4QOT A;  3TAP A;  4C3M A;  3SCL E;  3CCE S;  1TL1 B;  2X3G A;  2YNH B;  2VKZ G;  3GYN A;  4I2P B;  1LV5 A;  4OI2 A;  1FEH A;  2E1M C;  4F0M A;  3DRP B;  3RBE A;  1S6P A;  2ZH5 A;  3ENW A;  2DCU B;  1RAG B;  5B7W A;  5KFQ A;  2KL8 A;  1VQP S;  4NML A;  2ZKT A;  2Q6B A;  4QW8 A;  4JV5 F;  4WBF A;  3MGJ A;  2M0G B;  3H59 A;  4DL5 A;  3QFH A;  1OY9 A;  3O3L A;  1VLY A;  3JSY A;  4UW2 A;  3VHQ A;  4QIE A;  3KTQ A;  3C6T A;  1R8P A;  2HUR A;  4NI2 B;  3VCD A;  2J6T A;  2WB1 D;  2CJA A;  3L7O A;  4O0N A;  3UDC A;  4O4G A;  4DX7 A;  2W9C A;  3ENA A;  1JXL A;  4C0O C;  4K0K F;  4UZB A;  1S12 A;  1FFS B;  1BC6 A;  2ZBR A;  4USJ C;  2DNG A;  2EWH A;  1UWB B;  4TXS A;  3BBC A;  2UXB J;  3K5L A;  4MJK A;  2MY8 A;  4X64 F;  1I3O B;  2CDR B;  3I5A A;  5HK4 A;  1S1W B;  1NJW A;  3SQG A;  3CNQ P;  2HQC A;  4XIU A;  5A8K A;  2DGQ A;  2X7I A;  1UMJ A;  4UF4 A;  5LMN F;  4N56 A;  1VC6 A;  2Q43 A;  3OJS A;  1R0A B;  3DLB A;  5GAH I;  1UEK A;  5M2U A;  1IN0 A;  4PG7 A;  1N6Q A;  4E2F B;  2BRL A;  2OAU A;  1RU1 A;  3PEJ A;  2CQI A;  1G6B A;  3NLC A;  1R0C B;  1RP5 A;  2CWX A;  1NME B;  3IXQ A;  4MIB A;  1HWJ A;  5GAG I;  1DRZ A;  2ZOM A;  1NBE B;  2I38 A;  1VBX A;  4NCG B;  3P49 B;  2OPR A;  3CCQ S;  3KG0 A;  2GIF A;  3GE9 A;  3NOG A;  4A47 A;  4UOG A;  3FZ2 A;  3MR3 A;  1U24 A;  4P52 A;  3HHL C;  3H25 A;  4DR6 F;  4WZM A;  2H51 B;  4PAB A;  5G0R A;  3OL8 A;  4DV2 J;  1N54 B;  2EC2 A;  2MZT A;  2DPI A;  1M5H A;  1Q5V A;  1UFK A;  3PEH A;  2W4P A;  5B0B A;  2ZH7 A;  1SBR A;  4ZVQ B;  1TAU A;  4OX9 J;  4ZVG A;  4F36 A;  5F8H A;  1RHR B;  2LA6 A;  3LWL A;  3MMA A;  2OEJ A;  1KLM A;  3GSD A;  4AYB D;  2CQH A;  1X4B A;  2GVZ B;  4TY9 A;  1DZ5 A;  1N0V C;  4LIW A;  1LQ9 A;  1Q16 B;  3RR8 A;  2DEI A;  3MI7 X;  1Q8B A;  1TKT A;  1V3Z A;  1X4E A;  1FNX H;  3R5C A;  5IT0 A;  1GMW A;  1QE1 B;  3ZFV A;  4KY3 A;  1U6F A;  4ALZ A;  1FRL A;  3L9Z A;  3J7Z T;  2FVP A;  4LRE A;  2CPI A;  2HWI A;  3SXL A;  2RS2 A;  3ILJ A;  3P5B P;  3VAK A;  1H3D A;  1RSC A;  3DLG B;  1YIJ S;  4JI2 J;  1LEO A;  1KNZ A;  2FVC A;  1S97 A;  1FFG B;  3I32 A;  2OPS A;  1CJK A;  4X62 F;  2AQ4 A;  1Q1K A;  3MR2 A;  3DMJ B;  2YKN B;  3W62 A;  2DGT A;  1YKW A;  2W24 A;  2Y3Y A;  2FHJ A;  2YX1 A;  3DLG A;  4OX6 A;  2E5H A;  2NSB A;  5D3G A;  3CE8 A;  4JI3 F;  2B9W A;  1Z1Z A;  4WXW A;  4ZPC A;  3BPS P;  1EKR A;  5K20 B;  1KKH A;  2DD8 S;  3DLE B;  1K0T A;  3OTB A;  4YHH J;  1SV5 B;  3TW0 A;  2UXB F;  2MDA A;  2CYY A;  1N34 J;  1P9Y A;  2XI2 A;  3I87 A;  1KN6 A;  3WBZ A;  4LF6 F;  3AJD A;  3LP1 B;  3W2V B;  3LTO A;  4NE9 C;  1H7W A;  2QA2 A;  4C98 A;  4DV6 J;  4ECU A;  2HND B;  3W7B A;  2UVV A;  1NKC A;  3H2U B;  3LGH A;  4KKO A;  1HYS B;  2RDJ A;  5J1E A;  3HF5 A;  3TZW A;  2B43 A;  2GJF A;  4TQS A;  1H2T Z;  3T1Y J;  2BA9 A;  3TEG A;  1X0P A;  3IR6 B;  1F60 B;  1JLQ B;  3U1L A;  1SQF A;  5C5J A;  5A76 A;  5KG5 A;  1ARO P;  2I6W A;  4WKR A;  1CBK A;  2WBR A;  3ENQ A;  3HUL A;  5G0R B;  3WC0 A;  1FWK A;  2GQQ A;  4O3O A;  4R25 A;  2MQO A;  4F50 A;  3R6L B;  1RWV B;  2M8H A;  2HZC A;  3THV A;  2WVE A;  3PIP Q;  4UOH A;  1Q7L B;  2WRM A;  5HRO B;  4OZJ A;  3V6D B;  5EWG A;  4ILM A;  4ZVF A;  5D4L A;  1QSY A;  5AXM A;  3OTD A;  3DLK B;  4DV1 F;  5HMY A;  2DXE A;  2HVH A;  4F4Y A;  5C7P A;  1RHM B;  1RT7 B;  3HSZ A;  3QGH A;  2XLJ A;  4I1T A;  1I94 J;  2GGP B;  1HBM A;  2CDQ A;  3ITH B;  2KRR A;  2MKY A;  4JI6 J;  1NSK L;  2M9K A;  5EDW A;  2CQD A;  1NSA A;  2G0J A;  4M1K A;  2LFV A;  4ELT A;  2Y1R I;  2B56 A;  2BAC A;  3L7P A;  4KFB B;  5EGY A;  1NM2 A;  2ATL A;  2DXD A;  2QLJ B;  4ZVP B;  4CTA A;  2IHR 1;  2CPE A;  3VZH A;  2MPU A;  4F8R A;  1H2V Z;  3HKW A;  1YHQ S;  1H7X A;  4RX6 A;  4X65 J;  4PPZ A;  1C0T B;  3D6F B;  4URG A;  4X84 A;  3NNH A;  4TYB A;  4J9L A;  4F2R A;  2QL5 B;  3GLJ A;  4YR3 A;  2VOO A;  4NYO A;  4LVO P;  4EI2 A;  3M8P A;  4AXI A;  2XSF A;  3GV8 B;  2MKK A;  2COL A;  2GO8 A;  1FNM A;  1H38 A;  1T0T V;  4IQM A;  4ZOS A;  4LRD A;  4USK A;  3T41 A;  1FX2 A;  2YKN A;  2R7Q A;  3TVZ A;  2BBE A;  3I9V 9;  5C2G A;  1FCA A;  1SJQ A;  3NRB A;  2UU9 J;  5CXT A;  1Q5Y A;  5F8N A;  4NLT A;  5HAN A;  3UR0 A;  5KFO A;  3UN5 A;  3GIK A;  3G82 B;  3T5L A;  1HBN A;  1S0V A;  2X3D A;  1RAA B;  2JFD A;  1RGV A;  2W4C A;  2UV8 A;  4C8L A;  3CUL A;  3AXM A;  4WZQ A;  1UWA A;  1VIO A;  3BPD A;  3M9O B;  3KDO A;  1RK8 A;  5DM7 Q;  3UNY A;  1WEX A;  3PO4 A;  2QJ3 A;  5AT1 B;  1U2R A;  2YKO A;  4W4M A;  2UP1 A;  4IR1 A;  4DR2 J;  2M52 A;  1PO6 A;  2OEM A;  1GTE A;  2QT7 A;  3FC9 A;  5K8P A;  2MJN A;  5T14 A;  3N01 A;  1L3U A;  4P74 A;  2DHA A;  2V8V A;  2ZE2 B;  4OJ3 A;  1CQN A;  1T8E A;  3TJ9 A;  3N6N A;  3M4X A;  3R5B A;  3ZZZ A;  3IC1 A;  2E7X A;  2JHE A;  3FSI A;  1WTB A;  1J5O A;  2NYI A;  3K5O A;  1T95 A;  2XHC A;  4LFB J;  3IWL A;  2Z2L A;  4B17 A;  3PKM A;  2WHO A;  4NEY A;  5AXN A;  4OHV A;  1HI0 P;  3N5F A;  2GC8 A;  2RAQ A;  3IBF B;  4FNI A;  2B6A B;  3A3O B;  3CJ4 A;  4DV1 J;  2EC0 A;  2MKJ A;  3ICL A;  1S99 A;  1WC3 A;  2LQ5 A;  4P71 A;  4OX9 F;  3O5T B;  5KFM A;  3I96 A;  3R6G B;  4OQJ A;  5DQI A;  1OPI A;  2CVE A;  3I5C A;  3AJ2 A;  1RYS A;  1WKL A;  1HNZ J;  4ZK7 M;  2F7V A;  1XMQ F;  3NEK A;  4MK8 A;  1B0P A;  1OO0 B;  2AD9 A;  4U67 Q;  3R1L A;  3RB0 A;  2RT3 A;  3K5M A;  3N0V A;  3R7N B;  3WIU A;  4Q5V A;  4X4U A;  3LQV A;  1DBD A;  3GZ7 A;  5HI7 A;  3AOD A;  2HLT A;  2AP6 A;  1OMS A;  3D3C J;  2UV8 G;  3UI3 A;  1VQO S;  3OV7 A;  2OH2 A;  2NZ4 A;  1ZET A;  4ECY A;  2V0N A;  1ZYQ A;  1UW4 A;  2HGN A;  3PJX A;  4W98 A;  3HD1 A;  1ZTW A;  4HHU A;  5F8G A;  2OGU A;  2RRA A;  3LAN A;  2VC0 A;  2AV5 A;  3AT1 B;  4CNY A;  1Q8K A;  2WOM A;  2Z2M A;  4FYD A;  3TZZ A;  1UPM B;  4WJB A;  4BC9 A;  4ECS A;  4I69 A;  2LQB A;  3PVX A;  2R8I A;  4QYZ K;  3KNA A;  3V4I A;  2VB6 A;  1F3F A;  2WVC A;  1CJU A;  2QGF B;  2VFS A;  4RNF A;  4C9D A;  1IBM F;  3KWM A;  2YWH A;  1PKU A;  4ATN A;  1NZ8 A;  3H7H B;  3NS6 A;  4RNO A;  2DGO A;  2XMU A;  2N7Y A;  2OML A;  4IG0 B;  3MM7 A;  5C24 A;  5GAE U;  2DRA A;  3QID A;  1NK9 A;  2Y8W A;  3E2E A;  1RAE B;  5EX3 A;  2AYB A;  1LKZ A;  1NJY A;  4YB7 A;  1F9F A;  1NB2 A;  3ZXW A;  2C2E A;  1IKW B;  3KJF B;  5CYQ B;  2OFG X;  4MTP A;  3KDN A;  5KFF A;  2HZV A;  3CJK B;  4CO1 A;  1WI8 A;  3AJ1 A;  3KKF A;  1Y5I B;  4KIA A;  5HN0 A;  4V19 X;  3EGZ A;  2GFF A;  5BYQ A;  1NXI A;  1HR0 J;  2CQ4 A;  2XO6 A;  4EYI B;  3HHK A;  4K0K J;  1TKX A;  2DGU A;  4C2M A;  5DET A;  2BJ8 A;  3GPA A;  5IV3 A;  3NY0 A;  4F26 A;  3JB9 k;  3C14 A;  1SC1 B;  3PHT A;  2DGV A;  2A10 A;  3MEE A;  3O6Q A;  4R0J A;  4RW4 A;  4B3T J;  4LF5 J;  1BE4 A;  3UVJ B;  4IO1 A;  3HP6 A;  2CXE A;  2XS5 A;  4IO9 Q;  2RQM A;  1HLW A;  3G6V A;  1J2V A;  1S9E A;  3VAH A;  1GFW B;  3PX0 A;  1VQ5 S;  3DLL Q;  1XNQ F;  5LSR A;  2X51 A;  1ZZF A;  3HVW A;  4NCB A;  5HO4 A;  3MEE B;  4ECV A;  1WC5 A;  3I0S A;  2ZM6 J;  4LUB A;  3N79 A;  4IG0 A;  5C24 B;  2XO7 A;  4OZ1 A;  3GFZ A;  1WEZ A;  3TI0 A;  1IR2 A;  4OYO A;  1BQM A;  2K3K A;  5EHH A;  4YQW A;  3J81 j;  3QT7 A;  4DX8 H;  2JEI A;  5L1I A;  1JKH B;  3ILI A;  4KB7 A;  4OL8 A;  2XSJ A;  3MCM A;  4HVZ A;  1IWG A;  5HBM B;  2AGQ A;  1QAI A;  3PM9 A;  1B70 B;  4I2Q A;  1JLF A;  2LQJ A;  3KXD A;  1KWM A;  3KLI A;  4UUX A;  1CJT A;  3EIC A;  5K9F A;  3V6K A;  3TVY A;  2V4J A;  3A1Y G;  2W2O P;  3NBP B;  4G1P A;  1WG1 A;  1C0U B;  1CJV B;  4JB8 B;  5DDP C;  1TKD A;  2E5L F;  1R8B A;  4LF6 J;  4L73 A;  1TK5 A;  3MM5 B;  1NHK L;  2BM1 A;  2BOP A;  4TYA A;  3SCK E;  3PX4 A;  4B9L A;  2HFV A;  3R2D J;  5C42 A;  3DRP A;  3PNI A;  2PI4 A;  2ZIT A;  3E01 B;  2R9L A;  3KG4 A;  3LA0 A;  4KBI A;  4WFN Q;  2D3Z A;  3OSN A;  4P6Q A;  3L7U A;  3K5P A;  2UXC F;  5KT2 A;  3BEG B;  2YTC A;  3PXG a;  2AJQ A;  5MLC V;  2N82 B;  1I5O B;  1U8S A;  3VAG A;  1LW2 B;  3MDF A;  4ED6 A;  5F41 A;  4ECW A;  3Q83 A;  2DNL A;  2A2D A;  3OLA A;  2ZH6 A;  4NXM F;  2DH9 A;  1XQI A;  2OMO A;  4EGL A;  2KZZ A;  4G1I A;  4TY8 B;  1V3S A;  5KFK A;  1K73 T;  4DBQ A;  2HFU A;  2BVZ A;  2OPQ B;  2E5J A;  2PII A;  1WG4 A;  1Q81 T;  1NPP A;  4DPT A;  3GIM A;  1VHF A;  4FBU A;  4DL2 A;  1N32 F;  3CIZ A;  3R3T A;  4KH0 B;  1J5O B;  2RNE A;  2HNY B;  3OHA A;  3IWN C;  1EHW A;  3UD3 P;  2J5A A;  3KUH A;  4BLG A;  2GAH C;  4Y00 A;  1YSJ A;  3LP2 B;  3VAF A;  1L3S A;  5J1E B;  2C3M A;  4P72 A;  2XY6 A;  4N47 A;  3C2P A;  3NL0 A;  2R7S A;  4DSK A;  3OVS A;  2D3O R;  1LW0 A;  2L3M A;  3H5Y A;  1S4F A;  3G96 A;  1FDD A;  4J9S A;  4RO0 A;  4H4K A;  2RQ4 A;  1EP4 A;  2XY5 A;  2E5G A;  2DR6 A;  2DXF A;  1SUQ A;  3B4D A;  1LW2 A;  1YBT A;  3B82 A;  2FLN A;  2FGC A;  4GVL A;  5G4D A;  4CLL A;  4L6V 3;  3R9L A;  3PAC A;  2L41 A;  5FLX Y;  4F04 B;  1OYE A;  2FQQ B;  5C2C A;  1QSS A;  4DQR A;  4KGV B;  4ENO A;  2OPQ A;  1XER A;  3FUY A;  3QYY A;  4QU6 A;  2HFZ A;  2L9D A;  3UVJ A;  4U95 A;  1JLG A;  5HJX A;  1PIE A;  8AT1 B;  3D2W A;  5CCL A;  5HMX A;  2XC9 A;  5C25 A;  5B09 A;  3FCV A;  1YJV A;  2V68 A;  3OQ2 A;  4DX5 A;  2HBQ B;  3BO2 A;  2OSR A;  4ELU A;  1UVI A;  4URQ U;  3K89 A;  1RTJ B;  4AQY J;  3Q23 A;  4M5I A;  1D8Y A;  1FKO B;  1UPP A;  2KJW A;  1HNV A;  1HQE B;  2MHE A;  2ROE A;  3DYA A;  1VC5 A;  1OQ3 A;  4QWE A;  4ELV A;  3IM9 A;  3KNG A;  3L4B C;  2R2S A;  4OI6 A;  4B3O B;  4C4W A;  3NGT A;  2RU3 A;  4LF7 J;  2R7X A;  4H4O B;  2IM2 A;  2LU2 A;  2IVY A;  2JLG A;  2D7S A;  4LFC J;  2FIU A;  1LWE A;  1PCA A;  2H54 B;  4OV6 A;  1IBC B;  1O6X A;  5JVG Q;  4CLS A;  3IBC B;  1FKP B;  2ALY B;  3MTJ A;  4IG3 A;  2FLL A;  1MRO B;  4Q45 A;  1XN9 A;  2HBZ B;  1WDT A;  3M9M B;  3UFC X;  4C7Q A;  2GS8 A;  1R8H A;  3TOQ A;  2X1F A;  1AW0 A;  2JZ5 A;  4P9S A;  2V2Q A;  5D6G A;  2VG6 A;  3D7S B;  1KBR A;  4J7C A;  5ETR A;  1O8B A;  1W25 A;  2GAG C;  1TKX B;  3ONQ A;  5IWA J;  3EX7 B;  4B3T F;  1ZA1 B;  2C2K B;  2W1B A;  4ZLJ A;  5HMZ A;  1K1S A;  2QTW A;  5F9N A;  2JEJ A;  2MMY A;  4IH6 A;  1HNW F;  3JTN A;  2KFZ A;  1TV6 A;  2XMT A;  2P9C A;  5HVH A;  3RB4 A;  2DR8 A;  1N32 J;  4GKJ F;  3W66 A;  2YWG A;  2QL9 B;  4GC6 A;  5DZ6 A;  1C4A A;  1RCO B;  3GU0 A;  5EX0 A;  2VBZ A;  2BJD A;  3W65 A;  4F4A A;  2DNP A;  1RKI A;  5J2P A;  1XMQ J;  4O3S A;  4TU7 A;  4ZVO B;  2W7O A;  3EZO A;  4YDX A;  2VDI A;  3MEC B;  1N88 A;  4HLB A;  4UUW A;  5E33 A;  3DRS A;  1TV6 B;  2ACY A;  4IH7 A;  4OHZ A;  2VBW A;  1XNR F;  2XB2 D;  2RKI A;  4QIV A;  4DV2 F;  2BQR A;  3I55 S;  2XCA A;  1HKA A;  3OTC A;  1RT2 B;  2V2Z A;  3H4D A;  2VQF J;  5KG1 A;  1WF1 A;  3CCM S;  4PQU A;  4UST A;  5J2M A;  3UPF A;  1YIT S;  4HKQ A;  2C42 A;  3UD5 A;  1RHJ B;  2MKS A;  7AT1 B;  3HZE A;  3NCQ A;  4MMO A;  3HKZ D;  3WC2 A;  2RIJ A;  4O3N A;  3NGK A;  5GAD I;  3MMC A;  1S1V B;  4PG4 A;  2IY5 B;  1HNI B;  1UL3 A;  3J81 Y;  3FMW A;  1TQL A;  4ZVS B;  3NGS A;  1B0V A;  1VDH A;  3JQM A;  1DTQ B;  2D1C A;  1LWE B;  3MAH A;  4P2F A;  2PMZ D;  3HI9 A;  3ZTS A;  4C3L A;  5CA5 A;  2C3P A;  2PN6 A;  3H42 A;  2IRU A;  2VPX B;  3QZ7 A;  1NK8 A;  2MQ8 A;  2ADB A;  1XTZ A;  4A46 A;  2P5V A;  2WSC C;  4JV2 A;  1NH8 A;  2ZHB A;  2J8S A;  5CYM B;  3BN7 A;  1QAX A;  5KFW A;  3C15 B;  4F4X A;  1XMO F;  5B0C A;  4X64 J;  1G1X A;  4Z2X A;  2RJZ A;  3ZC4 A;  4ERD A;  1T03 B;  3PO5 A;  2CWK A;  3VV2 B;  1EIY B;  3DU6 A;  5ETK A;  1LWF A;  4FF2 A;  2EFV A;  3M8Z A;  1FXD A;  4DV5 J;  1TZ0 A;  2PC6 A;  3P45 B;  4WYL A;  5C25 B;  2MXY A;  4K4U A;  1F5A A;  2HGL A;  3M6W A;  1NHU A;  1TKT B;  2U1A A;  1WOO A;  4RWX A;  3QWU A;  3H40 A;  2QYG A;  1VRU A;  3QZ8 A;  4A8W A;  3GFH A;  2DJW A;  5DG7 A;  4J9R A;  1VQ6 S;  3M6U A;  3NS7 B;  4OYW A;  2VIH A;  1KQF B;  4K4S A;  1JLC B;  4NLD A;  1PGZ A;  1NEE A;  2ZOF A;  5IZH A;  1DY3 A;  1KEK A;  1VK8 A;  4LF5 F;  4CO2 A;  5KFD A;  2FZK B;  1BXN A;  2QFI A;  3TAM A;  2F65 A;  4DR7 F;  1RYR A;  3M9N B;  2DKO B;  1NDL A;  3IGV A;  5ETL A;  1HQU B;  3A8I A;  2CPX A;  4ZPA A;  3JYT B;  2VV5 A;  3G6X A;  2EPI A;  4FS1 A;  5CD4 A;  1RT6 A;  1U1N A;  3W5X A;  2RH3 A;  1X9S A;  5HJY A;  1HNW J;  3HVR A;  4AD6 A;  1IBK J;  2HHU A;  2B6A A;  1WAC A;  4OYZ A;  3Q8Q B;  1YVF A;  1QTM A;  1HQU A;  3WX4 A;  1SIZ A;  1BQM B;  3K5N A;  3MAA A;  2FY8 A;  5H9F K;  2EBG A;  2C1E B;  4QCL A;  3FZB A;  3V6H A;  2MQM A;  2L48 A;  1VGY A;  3POT B;  4HTI A;  1RLC L;  3B78 A;  5J2N B;  4ILR A;  1DFD A;  2JVR A;  1S48 A;  4HL9 A;  4ZDN A;  4EBE A;  3T1H F;  3RBX A;  4ETX A;  4NXN J;  2Y8Y A;  1VFJ A;  2BAN A;  3EUN A;  1GXT A;  4ZIV A;  2DNN A;  1QDU B;  4PEO A;  1RWX B;  2DNQ A;  3H4B A;  2PEH A;  3M8W A;  4OIX A;  4LT6 A;  4Q2M A;  1S59 A;  2EEY A;  4MYT A;  3HHL D;  1FD2 A;  2V5H G;  4PYA A;  2NLW A;  4DEZ A;  1MU2 A;  3UD4 P;  5A0Y A;  3M8S A;  4Q0B B;  2ZHO A;  3DHW C;  3DI6 B;  2WCX A;  3MPY A;  3TQ1 A;  1H74 A;  2EVZ A;  1U1L A;  4FXD A;  3IG1 B;  3E51 A;  1H73 A;  3TA1 A;  2UVU A;  4KRW A;  4B3M J;  2JLF A;  4DF4 A;  4X62 J;  1UTA A;  3BYP A;  3OR1 B;  1IR0 A;  1KDN A;  1OQ6 A;  1FJG J;  2VD3 A;  3MR5 A;  3FFI B;  4NZ6 A;  2MY7 A;  3SYZ A;  2HYI B;  1S49 A;  3RRG A;  3CCT A;  5BR8 F;  3R2C J;  2I5J A;  3QSI A;  3CC2 S;  3RB6 A;  2GHV C;  5THW A;  2J9C A;  4ZVT B;  4GC7 A;  4X65 F;  2V34 A;  2YWK A;  3CDW A;  3M6X A;  3DRY A;  1VS3 A;  2HVE A;  4OZ0 A;  1VIX A;  3QWP A;  4HHJ A;  3A8E A;  3NMR A;  2MKH A;  4WF9 Q;  1URR A;  4DL0 C;  2HW3 A;  4O23 A;  3KLI B;  3S01 A;  3MCN A;  3EZU A;  1NO8 A;  1WF0 A;  2BZ2 A;  2XI3 A;  3HLU A;  4JP8 A;  4ZS6 A;  4NAS A;  1FKO A;  4ZN3 A;  4M94 A;  1N5Q A;  1FF2 A;  4NLP A;  4NMX A;  1JKH A;  4Y2A A;  2HFS A;  5DO2 A;  3W9H A;  3ZZT A;  5H9E K;  5ETV A;  1CVJ A;  4N8O A;  4NCG A;  4QIF A;  3S1T A;  3CC4 S;  4JI7 J;  2DR7 A;  3GYG A;  5K8O A;  2ABY A;  1VCT A;  3IM8 A;  4OZ5 A;  2XMA A;  2IJN A;  4UTG A;  1TL7 A;  5F0U A;  3KK3 A;  2HHV A;  1HBU A;  1U7L A;  1TMM A;  2WVB A;  4MFB A;  4Q7A A;  3ZTP A;  4DLE A;  1R0A A;  2Z4P A;  1UEU A;  1PJ6 A;  3H5U A;  2VPW B;  4J37 A;  3D6T B;  3KHG A;  3JSM A;  1PG5 B;  1FES A;  4DR7 J;  1G2E A;  3I4P A;  1KHW A;  3LP0 B;  2OUG A;  5D15 A;  1NND A;  1Y5N B;  1Q4R A;  3CD0 A;  3M2R A;  3TNV A;  3L09 A;  1PAU B;  4A4J A;  1ACM B;  1IJE B;  1RZM A;  2XGP A;  2AGO A;  2QMX A;  2E1R A;  2FJA B;  3CDE A;  2E1C A;  4P2M A;  2EK6 A;  2YY3 A;  1C1C B;  1TUG B;  3HVT B;  2XLK A;  3ZZY A;  2N3L A;  1P1T A;  4K4Y A;  2LEP A;  3NWG A;  1SQE A;  2VHG A;  1NPK A;  5KG0 A;  2DHG A;  4ED0 A;  2GJI A;  1LWX A;  1R43 A;  1VLO A;  1WHV A;  2PDA A;  1TUV A;  1FVQ A;  4RUB A;  1TK0 A;  3MXH P;  1FKP A;  2H5I B;  3DDN A;  5AE1 A;  3VVT A;  4K4T A;  1SQG A;  1UW9 A;  4YR2 A;  3PR5 B;  5IQ6 A;  2CZ4 A;  2GA7 A;  2IJR A;  1R27 B;  2W9B B;  4O44 A;  1X9M A;  4LJM A;  1Z2L A;  1XMO J;  3RAQ A;  1M1H A;  2HVD A;  3VF0 B;  4F7V A;  2OD6 A;  3OTO J;  4I2P A;  2VBY A;  2UUA F;  4UOF A;  5DRK A;  1EJ7 L;  2YVS A;  4QU7 A;  4MKV A;  1FJG F;  3RG6 A;  4USM A;  2MJU A;  1WUU A;  4CO0 A;  1T02 A;  2V9W A;  3EXY A;  4CO5 A;  4B9T A;  2O67 A;  1NRK A;  4JV5 J;  2VOP A;  2FPH X;  2AWZ A;  2AJ0 A;  4F3M A;  1KTV A;  2AT1 B;  2DR5 A;  3VAI A;  3PYF A;  3CMQ A;  4DSF A;  1NSP A;  3IR7 B;  3GJQ B;  4QWB A;  3GII A;  2I9S A;  4M5J A;  2CNL B;  2R7R A;  4CLK A;  1XR7 A;  4BDP A;  3AHP A;  4ZHR A;  1M5S A;  4FP9 A;  2MQP A;  3OVA A;  4WYW A;  1A0O B;  4YEA A;  3W8P A;  1SJ1 A;  4LSN A;  4BC7 A;  2NXN A;  4LF4 F;  1OSD A;  2EFG A;  2BXJ A;  3G9C A;  1ZM9 A;  1P8G A;  1B0T A;  2QSF A;  1ZBT A;  3MAQ A;  4P2X A;  2B8Q A;  1I94 F;  1KLN A;  2HMI A;  1KON A;  1LXN A;  2RU9 A;  4MIW A;  3TX0 A;  4DSL A;  3ULH A;  1RAH B;  2GMJ A;  4YB6 A;  1B7F A;  2WVF A;  4ZP9 A;  1LWF B;  5E0O A;  3N28 A;  4X4Q A;  2YNG A;  3D1H A;  2QMW A;  4DPW A;  3G8S A;  2C2R A;  1EP4 B;  3FRY A;  4P7T A;  5KG7 A;  1NLK L;  4M5L A;  3KMS A;  2BV3 A;  1RKJ A;  1SL0 A;  1MWZ A;  3MWB A;  3M05 A;  3VAM A;  4OHW A;  1N48 A;  4CYU B;  2KHC A;  1WC6 A;  3BR8 A;  1RLD A;  2YWE A;  4H4M A;  4DN0 A;  3ETM A;  4PG6 A;  1WOR A;  1OPZ A;  2MZR A;  2ZVS A;  3MMA B;  3G8T A;  4OZ3 A;  4WK3 A;  4USV A;  1IXK A;  1HBO B;  1WC1 A;  2WW4 A;  3RU0 A;  3I0S B;  3JSB A;  2KVI A;  1PIL A;  2QX0 A;  2HBR B;  3Q8U A;  2J6S A;  2CJX B;  4GO7 X;  4NLG A;  1F6T A;  2EW9 A;  3RZA A;  4Y2I A;  2V4Q A;  4AE5 A;  5F9L A;  1KD1 T;  5L9N A;  4DMZ A;  1RJJ A;  2UUB F;  4K4Z A;  1KQK A;  1U25 A;  1T9U A;  2OPP A;  4OI4 A;  4USU A;  4N76 A;  5LXY A;  1VQS A;  2VU5 A;  2NSC A;  1FRX A;  1QD1 A;  3FRZ A;  2NRE A;  3AXK A;  3MEK A;  1LFW A;  2HHH J;  4ILL A;  3ETO A;  2PD1 A;  1DAR A;  3K8W A;  3MM6 A;  2R8K A;  2E7W A;  4DFJ A;  1REG X;  2E9R X;  1NK7 A;  3NNC A;  4HYK A;  4O3P A;  1HA1 A;  2DHS A;  1HPZ B;  3I31 A;  4S0M A;  2ZM6 F;  3HO1 A;  2GZO A;  3E01 A;  2JH3 A;  3MCO A;  3MOZ A;  4DPU A;  4U7U D;  4LFA J;  2XHW A;  1SL1 A;  4ED3 A;  2GX8 A;  1HHQ A;  1Q95 G;  3NXZ A;  4OMF G;  1G3O A;  3D1Q A;  1DQ9 A;  1WOP A;  4FZV A;  2KYX A;  3CMA S;  2YBV A;  1S6P B;  2ZZT A;  3MAA B;  2R7U A;  3MR7 A;  3GYX B;  5A8R A;  3FCW A;  4XDD A;  5EN1 A;  2BE2 B;  1CQM A;  3O1L A;  3VGU A;  1U2C A;  1T9Y A;  3F56 A;  4ID8 A;  2FUG 9;  3BGL A;  4LBI A;  3TX8 A;  4CLP A;  3CO0 P;  5D77 A;  3KLE B;  3NMA A;  4RW7 A;  3TAR A;  2FC8 A;  2MQL A;  4V1A k;  1U1P A;  2HSE B;  2RIL A;  2Y9H A;  3ZNU A;  1JWW A;  3GMG A;  3EGV A;  1IKV B;  2IDE A;  3SQO P;  1WEY A;  5A8W A;  4KFB A;  2PT0 A;  4KR0 B;  4NA1 A;  3R5G A;  2IC3 B;  2QIF A;  3WDO A;  4IFV A;  1ZOT A;  3MCS A;  5D4N A;  3M8Y A;  4H4O A;  4LR7 A;  4Z7C A;  4C8N A;  5LT5 A;  4DS4 A;  1HAR A;  4FVC A;  1HD0 A;  1T9X A;  2WBM A;  1UA0 A;  1HNX J;  5DG9 A;  4ZPW R;  3OUY A;  2HHS A;  4M5D A;  1RT7 A;  2CJ9 A;  2DTJ A;  5AE2 A;  2C2N A;  4U7C A;  2MB0 B;  1YBU A;  1EZZ B;  1YQH A;  4RZR A;  3V4M A;  2HQ3 A;  5E3Q A;  1Y00 A;  4DUT A;  4RPF A;  2FC9 A;  5F3T A;  4C11 A;  2C3U A;  1IBL F;  2UVR A;  3PW2 A;  1T03 A;  2ZH3 A;  1M5V C;  2GV1 A;  3K57 A;  3OR2 A;  3W3S A;  2B9E A;  5IC6 B;  4QWD A;  4QYR A;  2KB2 A;  3DRR A;  3T1Y F;  5LL6 d;  3A8J A;  1WKJ A;  4B3S F;  4QWC A;  3OXF A;  2QV6 A;  3CCS S;  2CPY A;  1TFW A;  4DV3 F;  2QA4 G;  2JFK A;  1NZA A;  1RTD A;  4C8Z A;  3K2Y A;  4GO5 X;  3KJN B;  4MK7 A;  4QR1 A;  3T5H A;  2W4D A;  5J2N A;  1M0S A;  1IBL J;  2FJW A;  3QJL A;  2J9D E;  2M88 A;  3ZZP A;  5HVG A;  3ELH A;  2OSQ A;  1GTH A;  4FXV A;  4TN2 A;  4I67 A;  1GMV A;  4C8Y A;  3M2V A;  3ADA C;  4DJB A;  1K9M T;  3DRX A;  4Q8E A;  4ZP8 A;  3V6J A;  2Q3P A;  2ZWP A;  3V5R A;  1AFI A;  2ZH4 A;  5GMD A;  4PQU B;  4WIQ A;  3UW1 A;  4CQ1 A;  4FF1 A;  3EXC X;  2HVI A;  3KHL A;  3PYD A;  3LP0 A;  1GK8 A;  1JLA B;  2WB4 A;  1SB6 A;  3CJR A;  2FHK A;  2QA1 A;  4F67 A;  2E44 A;  3GR0 A;  3PJW A;  2Q79 A;  1FE0 A;  4J9M A;  3J81 U;  3QJJ A;  1VRU B;  4IFV B;  4RW9 A;  3V81 B;  2CVI A;  4DF8 A;  2NXJ A;  2HMI B;  3HCX A;  2PEB A;  4ES2 A;  2ASL A;  1A7G E;  3MPV A;  2JRS A;  1C0U A;  1CJV A;  2UZA A;  4NEZ A;  2XMW A;  2VQE F;  1ZZN A;  2V8G A;  4HAC B;  1VMB A;  1W7W A;  2K1R B;  1NCL A;  2ZWO A;  1IM6 A;  2LDY A;  3PYE A;  1EKS A;  5GAE I;  1Q86 T;  2PI5 A;  4WP9 A;  1FRH A;  1VI7 A;  3S7R A;  1Q8I A;  2C2M B;  3PW4 A;  2DVI A;  4W90 B;  2YX7 A;  3A8K A;  3J7A 1;  2X1B A;  1PC5 A;  3AOB A;  2B0G A;  3H98 A;  3Q8V A;  5LXR A;  5A2Q U;  4F4K A;  4KHM A;  1OYD A;  4NLQ A;  1LXJ A;  2QO3 A;  4B9M A;  1CUL B;  2GHW A;  1BQN B;  3FDS A;  2AYG A;  4WFZ A;  1K8A T;  2VG5 A;  1K44 A;  1SC4 B;  2EI5 A;  2H5J B;  4AUK A;  3IGN A;  3M32 B;  5ETQ A;  2ILY A;  3QPI A;  1RTD B;  4QJV A;  1X8D A;  1U48 A;  1JMT A;  1T9V A;  2KXF A;  1Q0N A;  4K59 A;  2DB1 A;  5KG6 A;  5M2P A;  4DUZ J;  3OVB A;  3UCG A;  3CCV S;  3PJ9 A;  3MEG B;  2C3Y A;  4QPT A;  4KO0 B;  4YS2 A;  1VRQ C;  1H72 C;  2KXH A;  2BE7 D;  2RRN A;  5A2Q Y;  4N5S A;  3CXC R;  2A6O A;  1QVF R;  3HJV A;  1YJU A;  1D3W A;  5LSL A;  1LK7 A;  1BHN A;  3Q2T C;  1WSR A;  3GB0 A;  4HAC A;  3OTO F;  3MD3 A;  1S6O A;  5DDQ C;  3J80 Y;  4JI1 J;  5HQ8 A;  5H9F J;  5KAK A;  1PBA A;  4IFY B;  3MPU B;  3MR6 A;  3DLH A;  4ZCM A;  4GVB B;  3CCU S;  2G2Y A;  1UJ6 A;  3Q2S C;  5J1N A;  1UKU A;  1I6J A;  4F4W A;  1WF2 A;  2GVD A;  5ETS A;  3HHL B;  1VBY A;  2ZBI A;  1Y11 A;  4OYB A;  5CYQ A;  4MT1 A;  5HAT A;  2QL7 B;  1TK8 A;  1YGY A;  4MFB B;  3BS9 A;  5D0G A;  4XO0 A;  3EPI A;  4FF3 A;  1MLA A;  5LMU J;  2NR0 A;  1RAC B;  3BJY A;  2QEX S;  4F02 A;  4P10 A;  4DUY J;  3FVY A;  4KV8 B;  3UNG C;  1JX4 A;  4LF8 J;  2PA8 D;  3LOU A;  3G2X A;  2ZBC A;  1ZM3 A;  4H4M B;  2XCP A;  4B9V A;  3LH2 S;  4L3N A;  3CCJ S;  1IQT A;  2DH8 A;  5KOX A;  3HSJ A;  4M5N A;  3W5Z A;  5KT3 A;  1S9G B;  2R7T A;  3BBB A;  4OYP A;  2FDN A;  4CH0 S;  1NKE A;  2CPZ A;  3UN2 A;  2L9N A;  3FBF A;  1Q7Y T;  3KK1 B;  1B99 A;  4WII A;  2K1R A;  4DR1 F;  2WON B;  2IAJ B;  2M3D A;  2V2V A;  4RWW A;  1YBA A;  3GP9 A;  1KTQ A;  3KG1 A;  3K58 A;  1RA6 A;  3IBW A;  1NJX A;  1UZH A;  1VOM A;  3NAI A;  2CA9 A;  4HT5 A;  2YPZ A;  2ZJR Q;  5KG4 A;  4B9U A;  2CG8 A;  2DGS A;  5DQG A;  3G71 S;  2HHP A;  2CQG A;  2XMM A;  4IH5 A;  1X5P A;  1XWL A;  2IIH A;  2V4R A;  4USH A;  1U6Z A;  1G4C A;  3MM9 B;  1HHT P;  5CAA A;  3H2L A;  4AXJ A;  3C19 A;  3CTR A;  1KFS A;  3US5 A;  5IQQ A;  4KHR A;  2FZC B;  1FK9 B;  3H20 A;  4CH7 A;  4DR2 F;  2F3J A;  1UVJ A;  2DGX A;  2EFQ A;  3VAJ A;  2B4P A;  3CJ3 A;  1UZD A;  1ULR A;  2KYZ A;  2DNR A;  3RRK A;  4KJI A;  1QUP A;  2PGC A;  5IM0 B;  4OX8 A;  2YKP A;  4KT0 C;  2MYF A;  5JVH Q;  2M2B A;  4ZPT R;  5B0F A;  1I1G A;  2KU7 A;  5JUM A;  3NGD A;  2MZJ A;  2VG7 B;  2HVZ A;  1JNR B;  1AYE A;  2Z8Q A;  3EGW B;  4FN5 A;  3BO3 A;  2W2P P;  2ZJP Q;  3PRV A;  2XMV A;  3DKD A;  4Y0F A;  3OHB A;  2XUL A;  1MG7 A;  3IS9 B;  3UDV A;  1Q8L A;  3HPO A;  3BQ0 A;  4TKT A;  1TL4 A;  2E9T A;  4TU8 A;  2JDJ A;  1UVN A;  1HYS A;  2FYX A;  2H65 B;  2KTQ A;  2HS4 A;  4OJH A;  4MAK A;  2VJV A;  1X9W A;  5ETO A;  2ZZN A;  1JLE A;  3MM8 B;  4U9R A;  1E6V A;  3AD9 C;  3LPY A;  1GXL A;  1S57 A;  1X4C A;  1YLX A;  3QNW B;  4NLV A;  3WIV A;  2NPI A;  2FTR A;  4XTT A;  4YHH F;  3Q8S B;  1M5K C;  1YTY A;  1S1U A;  3PRB A;  4ED2 A;  1S5Z A;  3DLE A;  2RKI B;  3R27 A;  4RW6 A;  3M2U B;  3SI8 A;  2A3J A;  1Y9O A;  3KJV B;  1JJC B;  1S1T B;  3BKU A;  1MMN A;  3THP A;  4YOE A;  4Y2K A;  5GVQ A;  4M5D B;  2IA6 A;  1SCJ B;  2YNF A;  2PE8 A;  2MZQ A;  2W2M P;  4K4W A;  2ZE2 A;  3UO0 A;  2F9D A;  4CLT A;  1RHQ B;  2RDI A;  3RBD A;  1D0E A;  5A8K B;  3LAK A;  4O0I A;  2ASJ A;  1T7P A;  4GKJ J;  1D9F A;  4UT4 A;  4IYQ A;  1TVR B;  2PMH A;  2WW8 A;  4PG8 A;  4RUA A;  2CIM A;  1H0H B;  2KVQ E;  3F41 A;  8ATC B;  3BQ2 A;  2DBB A;  1X5T A;  3AD7 C;  3H0P A;  3BRE A;  5CZX A;  5FDL B;  2JC1 A;  2W25 A;  2XMK A;  3D28 A;  5T7L B;  3JAM Y;  4JI6 F;  4YME A;  4O4G B;  3HX9 A;  3SZ2 A;  1N36 F;  1SJR A;  5KFU A;  3UE2 A;  3C15 A;  4FKX A;  3TJA A;  2HEK A;  2DNK A;  2QC3 A;  4ECX A;  2IRX A;  1RI7 A;  5A8R B;  4Y3C A;  4Y65 A;  1RWP B;  3DN9 A;  2OKQ A;  1RWM B;  2HFN A;  4WCE Q;  4WFB Q;  2RML A;  2V94 A;  2BMB A;  4WE1 A;  3W5Y A;  5KT6 A;  2B9X A;  1MN9 A;  2YWF A;  4I6Y A;  3DGV A;  3VWS A;  2QFJ A;  2LQ8 A;  4OZN A;  2VH7 A;  4DR1 J;  1S72 S;  3C66 A;  3R7S B;  3J80 U;  4RBU A;  3FBC A;  1HBM B;  1UAW A;  4OI1 A;  1HQ2 A;  2OEK A;  1HNV B;  1HQE A;  4QIG A;  1H6K X;  5CH7 B;  2Z30 B;  2DHX A;  2HRT A;  2CPD A;  3D0I E;  3M1V A;  4Y2C A;  5SUH A;  4AQY F;  5F8J A;  2W01 A;  2UUW A;  1BLU A;  4K5R A;  1RT2 A;  3LGM A;  2FVQ A;  3AA9 A;  3OLB A;  2IFX A;  4OLO A;  2W8K A;  1U26 A;  3FQL A;  2E1A A;  2UUT A;  2CUY A;  2M5Y A;  1WEL A;  2UU9 F;  2DO4 A;  1RT3 A;  3GJT B;  4WFA Q;  1N52 B;  2AJ1 A;  3QT5 A;  4HT7 A;  2Y1J A;  3IRX A;  2G1H A;  4DV7 F;  3EVW A;  3EDR B;  4N41 A;  3A3N B;  1VYA A;  2BYC A;  3D0H E;  2ZH8 A;  2BKN A;  2GGP A;  1YX2 A;  2ZDO A;  1MN7 A;  1DAX A;  1FXR A;  2OLW A;  4LQ9 A;  3TUJ C;  4R5P B;  3DOL B;  4WFX A;  2RQK A;  1TL7 B;  1S1T A;  3ET6 A;  5A6P A;  4JBC A;  3KK3 B;  2DPJ A;  3W1Y C;  4KYZ A;  2DIT A;  1L3T A;  1OY6 A;  2LKZ A;  2P9G A;  3B6B A;  1IKY A;  4NYP A;  5F8L A;  4IQX A;  1RQ0 A;  1RTZ A;  2KJV A;  2V50 A;  4DPO A;  4KHP F;  1K0V A;  4RL1 A;  1IM4 A;  5KT7 A;  2ZUA A;  4TLQ A;  1VQ7 S;  1LW0 B;  2K06 A;  2VQE J;  3CJ5 A;  3FNN A;  1HIY A;  1QUV A;  1ZM2 A;  2MEW A;  4DV4 F;  4RUC A;  3BDE A;  3BGO P;  4EZ6 A;  2HLU A;  3IR5 B;  3GJR B;  3ISN D;  3TUZ C;  1UFL A;  1OJ4 A;  3GCW P;  4IDK B;  1UJ5 A;  1QTN B;  2EG1 A;  2HK3 A;  2J76 E;  2CPJ A;  4PG5 A;  2WSF C;  4PQA A;  1OY8 A;  1JJ4 A;  3FJ2 A;  2YXL A;  4KGM A;  3CCR S;  4ECZ A;  5HMW A;  2KG1 A;  4AL5 A;  4ZKA A;  3EGN A;  2J0W A;  1U1Q A;  4UZC A;  1TL1 A;  3DU5 A;  4UY8 T;  3N4W A;  3BGU A;  3F0N A;  4NLX A;  4ZJQ A;  1GX5 A;  3UR3 C;  4ZIW A;  4QPX A;  4DQS A;  4RR5 A;  1RE1 B;  5KFP A;  4NXM J;  1JQG A;  1NH7 A;  1VR6 A;  3D6M B;  4JI5 F;  2F4V F;  4WK1 A;  5K8N A;  3TWZ A;  3NS5 A;  5B0G A;  1C4C A;  3QGG A;  2LA4 A;  3D9B A;  2IVM A;  3MMB B;  3OBI A;  2B5J A;  1MWQ A;  4RW8 B;  4JUZ A;  3IRW P;  1PJ7 A;  1QM9 A;  2JWN A;  1D9D A;  2IRY A;  1JLG B;  1OSC A;  2DO0 A;  1RT1 B;  2WAQ D;  4LRA A;  3ZTO A;  4J9K A;  4ER8 A;  3C6U A;  4LFC F;  1KQS R;  4K5S A;  1VQL S;  1SH0 A;  4F4Z A;  4NZ7 A;  1SKS A;  1HWK A;  3GWC A;  1R8A A;  2GHP A;  3FSY A;  3GFY A;  4FKY A;  2C22 A;  4PUO B;  5LJ5 Y;  6AT1 B;  4J9U E;  2NYH A;  2BDP A;  3NKY A;  1S1V A;  4I6A A;  4LMZ A;  3ZZR A;  3KK2 B;  3TA0 A;  4ZLL A;  4XPE A;  4RNM A;  4DL4 A;  3ILL A;  3P8B B;  3TO8 A;  4AL6 A;  1H2U X;  3GTY X;  5L38 A;  2CRL A;  3M2V B;  4K2X A;  2FJV A;  2XYG B;  1C1C A;  3CED A;  3HVT A;  1HWI A;  2CQ0 A;  5KG3 A;  1HI8 A;  5KFJ A;  4CLF A;  5I42 B;  1KLM B;  3PDN A;  2JX2 A;  4DSE A;  3LAL A;  3CF5 Q;  1HNX F;  1RBA A;  5I3Q A;  1X31 C;  4ZP6 A;  5F3Z A;  2HNZ B;  5CYJ A;  1M90 T;  4DV3 J;  4IDK A;  4E8U A;  4M95 A;  2X1G A;  2LP4 A;  5GMK a;  3TUP A;  3CW2 C;  1XK8 A;  5D8H B;  3EVM A;  3SFU A;  2UUB J;  3QSY B;  2O66 A;  3IAM 9;  5D0R A;  2CJQ A;  4U8Y A;  3U02 A;  4EO8 A;  3QGP A;  2B3T B;  1T94 A;  2EKN A;  2XM3 A;  2M8D B;  8RUC A;  2VZ9 A;  1Y3J A;  1XR6 A;  3FKB A;  4ZP7 A;  3VGV A;  2IBO A;  3CUN A;  4BCA A;  2L08 A;  5DM6 Q;  3FGV A;  3NCR A;  5DJB A;  5DLG A;  4FXW A;  5U47 A;  2IVF B;  2Q1L A;  5KFT A;  3ENV A;  1URN A;  3SCI E;  2NZC A;  2GQC A;  1MML A;  1HBN B;  4U8V A;  2QSW A;  3BDP A;  1WDD A;  3PRD A;  1L3V A;  1N6Q B;  3CDU A;  3RGI A;  1J27 A;  1YWX A;  4NA3 A;  3H5S A;  4QIW D;  4QQB A;  5DGB A;  4PWD B;  4JYA J;  2BQ3 A;  2ERR A;  2AKW B;  2D9O A;  2YWW A;  3CJ0 A;  4WE1 B;  4CZC A;  4ES3 A;  3NOC A;  3QGI A;  1N36 J;  1IR1 A;  1XNQ J;  3SSS A;  3QAT A;  3RW6 A;  4GKK F;  2YKA A;  1XIQ A;  4NLO A;  2HK2 A;  4OHY A;  4I6W A;  4U7U K;  5KFG A;  2R7O A;  3MHY A;  3KK1 A;  2VDH A;  3W63 A;  2XY7 A;  2I2Y A;  4EK2 A;  2HHT A;  1PYS B;  1EX8 A;  1YJR A;  2MGZ A;  4G1Q A;  4ED4 A;  2NQP A;  2J7U A;  2I8E A; 
#chains in the Genus database with same CATH homology
 4JI1 J;  4NXN J;  4LF7 J;  4B3T J;  4LF5 J;  4LFC J;  4RJV A;  2VQE J;  2MEW A;  4DV2 J;  4LF9 J;  1IBM J;  2ZM6 J;  2E5L J;  2UXC J;  4OX9 J;  2UU9 J;  4B3M J;  4X62 J;  1FJG J;  1J5E J;  5IWA J;  5FLX U;  4DR4 J;  4DV7 J;  3R2C J;  2UXD J;  4LF4 J;  3J81 U;  1N32 J;  4JI3 J;  4NXM J;  4NEZ A;  4KY3 A;  1XMQ J;  4DR2 J;  4LF6 J;  3T1H J;  4DV0 J;  5AJ3 J;  3R2D J;  4JI2 J;  4X66 J;  4PWW A;  2HHH J;  5A2Q U;  2VQF J;  4LFB J;  4NEY A;  3JAM U;  4JI7 J;  4DV4 J;  3IMQ J;  4DV1 J;  4JI5 J;  2F4V J;  4GKJ J;  4YHH J;  4DR3 J;  4LFA J;  1HNZ J;  4DUZ J;  1N34 J;  2KVQ E;  4DV6 J;  5BR8 J;  4DR7 J;  2MQ8 A;  1XNR J;  3T1Y J;  3D3C J;  4GKK J;  4B3S J;  4DV3 J;  4X64 J;  4V1A k;  2UUA J;  2UUB J;  2MTL A;  2KL8 A;  4HHU A;  5LMN J;  5IT9 U;  3J7A N;  4DV5 J;  4JI4 J;  4DR1 J;  4DR6 J;  5LMU J;  3J80 U;  4DUY J;  5LM7 E;  4LF8 J;  1HNX J;  4JI0 J;  1XMO J;  4YY3 J;  3OTO J;  1I94 J;  2UXB J;  1N33 J;  4JI6 J;  4JV5 J;  4KHP J;  4JYA J;  3D3B J;  1N36 J;  1HNW J;  2UUC J;  1XNQ J;  4JI8 J;  1IBK J;  4B3R J;  1HR0 J;  4AQY J;  4X65 J;  3W1Y C;  4KYZ A;  4DR5 J;  4K0K J;  1IBL J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...