1I94J

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1i94J00
4HHUA 5BR8J 1HNXJ 1N32J 1XMQJ 4DV1J 3J81U 4NXMJ 4K0KJ 4LF9J 1IBMJ 3J7AN 4LF7J 2UUCJ 2UXBJ 4JI3J 4JI0J 4NEYA 4JI4J 3R2CJ 4YHHJ 2MEWA 5FLXU 2UU9J 1N33J 1IBLJ 4NXNJ 2F4VJ 4JI8J 4DR3J 1IBKJ 3D3CJ 1XNQJ 4V1Ak 4X64J 5LMUJ 5AJ3J 4LF8J 4DV4J 5IT9U 5IWAJ 5LMNJ 2UUAJ 4DR5J 3D3BJ 4DV7J 4DR6J 4JI1J 2E5LJ 4DUZJ 1HR0J 4KYZA 1N34J 4DUYJ 3J80U 4JI6J 4LF5J 4LF6J 4GKKJ 2VQEJ 3T1HJ 4KHPJ 2UUBJ 4LFBJ 4X65J 4DV3J 3W1YC 1N36J 4JV5J 4JI2J 2ZM6J 4DV0J 4JI5J 4B3TJ 2KVQE 4DR4J 1I94J 1XNRJ 4DV6J 4X62J 4B3RJ 2KL8A 1J5EJ 4JYAJ 5LM7E 4LF4J 4AQYJ 2MTLA 4YY3J 5A2QU 4B3SJ 1HNWJ 4DR7J 3IMQJ 2VQFJ 2HHHJ 4B3MJ 4NEZA 4OX9J 4PWWA 1HNZJ 4KY3A 4DR2J 4X66J 2MQ8A 3R2DJ 4DR1J 3T1YJ 4DV5J 4GKJJ 4LFCJ 1FJGJ 2UXCJ 4RJVA 3OTOJ 1XMOJ 4JI7J 3JAMU 4DV2J 2UXDJ 4LFAJ
chains in the Genus database with same CATH superfamily
4A8WA 4ZP8A 3B6BA 4IFVB 4O3PA 1NDKA 2QJ3A 5A6WA 4UY85 4CTAB 1FDDA 4S0MA 1N0VC 3SSSA 3BYPA 1NH7A 1NSPA 3KHGA 3OL8A 4CO2A 2WZ1A 2Y1LB 2QEXS 4RNMA 4LUBA 2L3MA 3NNCA 2YH0A 2CPJA 4AUKA 3M8SA 3GILA 1VIXA 1H38A 1ZTTA 1C4CA 3PKYA 1TKZA 5K14A 3CD6S 3GR0A 4DL4A 4JI1F 5A8WB 2W25A 2I9SA 3MMCA 4WP3A 1RT6A 3R1LA 5DDRC 3G6ES 5ETRA 1RBLA 3EPGA 1M1GA 4NLGA 4DPWA 3ZZYA 4B3RJ 4JYAJ 2KRBA 3C6UA 2DH9A 3J7YU 3H5XA 4Q8FA 2HS3A 2NQPA 2VL1A 3M1VA 3FMWA 1VQLS 4O4GB 2HAFA 4DG1B 3RBEA 1BHNA 3R5BA 3KJVB 2RVJA 2OTLS 1SQGA 3LUYA 1X4EA 3DYAB 3K59A 3MTJA 1HW8A 2GS8A 4MYUA 4DL6A 2G0JA 1HW9A 1F9FA 3PO4A 4U96A 2LQBA 3M2UA 3R2CJ 3FCHA 1TK5A 5HLFA 1TL5A 5B0AA 3GSIA 3MEEB 1SI9A 4HI2A 5K20B 1OJ4A 1R0CB 4V19X 1WHYA 1VC5A 1RTZA 2Z4PA 2FB0A 1O0PA 3IBWA 1KOOA 4BHQA 2HQGA 1AB8A 2CQ1A 2UXBF 2DH7A 1R0AA 1RWUA 1VQNS 2XNQA 2ALYB 1TR0A 3TO8A 3KUGA 6AT1B 3F0NA 4X65F 3CCES 2Z0GA 4J7CA 4F25A 4ZS6A 1U1RA 1VQSA 1LFPA 3M32A 4C8LA 1E6VA 3AJ1A 1TUVA 3BGRA 2POKA 2NREA 2VPWB 3JTPA 3G8QA 1MWZA 1LK7A 4NA3A 3OTOJ 1Y0HA 4ZIVA 2WONA 4NA1A 4P75A 4DV1J 1B4SA 1VBKA 3GQCA 5KG6A 1WSVA 4JI0J 4MJKA 1YDLA 4DSFA 1LW0B 4YHHJ 5EX0A 1VOMA 3R5CA 4OI6A 3OL7A 2VC0A 4ZVPB 3GCXP 1S1WB 2LU1A 3EWGA 4OJ1A 3SSRA 3L4BC 2P6TA 4HI1A 1IBLF 4OZ1A 4LSNA 5DRKA 3KMSA 4AL5A 1LXNA 1ULRA 2GVZB 3MHYA 1TKDA 3EGZA 3QJLA 1JQGA 3CO9A 4ZVFA 3IG1A 4DR5F 3CJKB 1Y9OA 1BD6A 3SCJE 3EUNA 3FRZA 1YIJS 2A6OA 2H48B 2KJVA 3HHLC 3EXCX 1RBAA 4DV3F 2AV5A 1NSQA 4X4SA 1TKTB 1KTVA 2MHNA 1YX2A 5CCMA 2LLZA 1GXLA 1X4GA 1JJ4A 2GIFA 1YQHA 3NMRA 4B3SF 2L08A 1S49A 3MM5B 3SI8A 3Q86A 1PC5A 5CAAA 3TUPA 1S5ZA 1RAIB 1EP4B 1UCNA 5T7LA 2RH3A 4DFKA 3HF5A 4OMFG 2CZ4A 1RKJA 6FDRA 3V81A 4OYBA 1YJNS 5FDLB 3KK2B 2WSFC 5DZ6A 1KEKA 2SXLA 3HSDA 2CXEA 3VGVA 3MR3A 3QO9A 3HHEA 5SZTA 2HGMA 3ADAC 1CJTA 1IKXA 1T0TV 1SV5A 4I2PB 2CQ2A 2DNPA 4HDGA 4EYIB 4PCQA 2DNKA 4DR6F 2C3UA 1DJ0A 3ISNC 5H9FK 2HS4A 4DUYF 3Q83A 4UOHA 4QQBA 2KM8C 1ZM4A 1YKWA 2UV8A 1TL3B 2FQQB 2MLZA 4BWJA 5CZVA 3H4BA 1JLQB 3BM7A 1WHXA 1LWEA 4H4MA 3KK1B 1KWMA 3H7HB 4IFYB 2ZC4A 3OR2A 4ES1A 4PWUA 1VQ8S 5E3CA 4LSLB 3DRRB 2OPPA 1HNZF 1SVDA 1ZM9A 4LIRA 2ZH7A 3NAHA 1S9GA 4M5DA 1YBUA 4B9NA 1URNA 2ZZNA 2HLTA 2ACYA 5IV4A 1G2EA 2KYZA 2XSJB 4K2XA 3TEGA 4LFAF 2DY9A 3TAQA 1HNXF 2WOMB 1RE1B 2MGZB 2YXLA 4RU2A 4WWSA 3ENVA 2IA6A 4JI1J 2DH8A 1SBRA 3DMJA 3TQ1A 2RAQA 3R97A 3PACA 2E1PA 5KFVA 2MQLA 3FZBA 4L3NA 3H2LA 2DXFA 2VPZB 3ICLA 2B6AB 1N5TA 3UD3P 1X9WA 2I6WA 1NMEB 1HNVB 5LSRA 3CJSA 1RT3A 2HFVA 3FCVA 3L7UA 4ZCMA 1Q95G 1WG4A 2CPEA 5GAEI 2DKOB 5KFHA 3P5TL 3V6HA 4FN5A 4PXCA 4WIIA 4HHHA 1SIZA 1VLYA 5C5JA 4CM0A 4LR9A 5HROA 5EWGA 4LFCF 3JYTB 3THTA 2EKNA 4I1TA 3EMTA 1KSPA 2FJBB 3D4JA 2C1EB 1RADB 2UU9F 1TFWA 3KLGB 2C2DA 2D3OR 5KFRA 1F6TA 3HPOA 1LFWA 4WFYA 2IM0A 4X65J 4WYLA 3CJ2A 2FIUA 2FJXA 4NLSA 2KZMA 1D9AA 2DNNA 1RTIA 4Z2XA 3IS9A 3PRBA 1JKHA 2ZVSA 4QOTA 3CCQS 4ELUA 2D9OA 3W61A 3MPYA 1IWGA 4YY3J 4K4ZA 3HHLB 1Y00A 4FVMA 4D3HA 4PWDB 3QWUA 3OQ2A 4KY3A 1K9MT 3CJ0A 2MQOA 3NBPB 3F56A 1EB0A 2YPYA 5CABA 3OLAA 2E9RX 2EFVA 4A8MP 3I56S 4NX9A 4WK3A 1O5JA 1N5SA 3OVSA 4P2SA 2E66A 2NUHA 3P96A 2C3YA 2I5JA 4ZPCA 4F2RA 1G4CA 2DNYA 3O1LA 2CUYA 1IBLJ 2CPDA 4DCPB 3UWTA 3PVXA 2O3DA 5GVQA 3N5FA 5DS7A 4DPYA 1AROP 1REVA 2CJAA 4Q43A 4DL5A 4DR5J 3IO1A 1WF1A 4PQAA 3ZXWA 1WC3A 5DQHA 3IRWP 4KJIA 1P1TA 2HNYB 2OEMA 4MKBA 1XNQF 2JOQA 1T3OA 2FLLA 3KG4A 3E3XA 4DV3J 3N6LA 1R8CA 3MPDA 1UETA 2GMLA 2BJ7A 5ETMA 2HIYA 5KFKA 4CO1A 3TANA 2JZ5A 2CQ4A 3SFUA 4LREA 4PR6A 3HX9A 3RUBL 3TZXA 2UUBF 5A8RB 2YBVA 4B3SJ 1HYSA 3OSPA 3ELHA 1ZTWA 4EZ9A 1ACMB 2DGXA 2OPSB 3MFHA 1EETA 5L8RC 3WQPA 3GZ7A 5I3UB 3NGRA 3BPDA 3V2UC 1XR5A 2EW9A 1PYOB 4DR7F 1WC6A 2KXHA 3GWCA 2ZNZA 1KOHA 2JLEA 4LVNP 4OYZA 3OFHA 1LEOA 1TU0B 2R4FA 2QL7B 1PYTA 1MN7A 2F4FA 1V3RA 2ZBIA 1U02A 2E1CA 1FKAF 4B3OA 1FDAA 3W64A 4DR6J 3MM6B 4LBHA 4ECUA 1FKPA 3NGDA 4DUYJ 3I4PA 3SEOA 3RB3A 1LOUA 2VPYB 1PAUB 2QMUB 4K7QA 2R7VA 1ZYQA 1UA0A 4OYXA 4AXJA 1A7GE 2CNOB 2W7AA 1NHUA 3L95X 3V6DB 3R6GB 2CQBA 1U24A 7FDRA 4YB6A 1AZSB 1XC9A 4DSKA 1DTTA 3BH7B 4OHZA 5DLFA 1HNZJ 2MY8A 5DLGA 3CD7A 2APOA 2HNDA 1VRTB 4DV5J 1GFWB 2V8DA 5C2GA 4KGXB 3JQMA 4LFAJ 4E98A 3GLJA 1HNXJ 4O23A 3TAPA 2BR0A 1L3TA 4KV8A 4KBIA 3OV7A 2MJUA 3HHNB 2D9PA 2O1PA 4A8XA 3VCDA 2A1BA 4NRTA 2ZH4A 1RLCL 3UN2A 1C0UA 3CCVS 4TU9A 2MKIA 3KHLA 4M5LA 2MKJA 1FKOB 3TZYA 3J7A1 2K1RA 1HBNB 4B9MA 1FA0A 1RT4A 1VQ9S 4ANDA 4CLWA 2G9OA 3BREA 1GX5A 1PBUA 4PQUA 1KQKA 1VQMS 1N54B 1ZZNA 4LRAA 2J0XA 1B99A 2XLIA 5AT1B 4ZVSB 3U1LA 1WHWA 4ZPDA 1TMMA 3CJTA 1T7PA 1WTFA 3GFXA 1T03A 3MZIA 1JLEA 4FF2A 3N79A 1CPZA 3W3SA 2N7CA 2YKNB 3M2RB 4WP9A 4QPTA 3DM2B 1RKIA 4LFCJ 5CH7B 2J9CA 5KG2A 3L3CA 2DEJA 4DX5A 1NHKL 3ENWA 3EM1A 3KK3B 1N5YB 1YVFA 3H98A 1RYSA 3T3FA 3DC2A 3DRYA 1SJ4P 2UU9J 3CDAA 2CYYA 1U1OA 4DV2F 1ZS6A 2E44A 2M52A 4ZHRA 3Q89A 2ZE2A 1DHMA 1VCTA 4K4UA 4NLUA 1H98A 3VZHA 1N48A 4M1KA 1CJVA 4C11B 3NXZA 2HQFA 3J80U 1FNXH 1NNDA 1Y7PA 4IR1A 2IAJA 2F63A 3CWJA 3NNAA 1NK5A 5MLCV 3DLGA 2KZZA 3MMAB 1B0PA 4ZK7M 3OL9A 3AODA 2PIIA 2MQMA 1I1GA 5LT5A 1BWVA 4PYDA 1KQSR 3ENQA 2ZDPA 3UCZP 4DV4F 3D6FB 3DLLQ 3NCQA 2CNKB 2XMMA 4DF8A 1GMVA 3R5GA 1KDNA 1LW2B 1HFEL 5DJBA 4DMZA 3OJUA 3QBCA 4F26A 1HNWF 1NBEB 3FMBA 3UFCX 2MQPA 5KFGA 1NU4A 4ECTA 1YJRA 2KH9A 2BQ3A 1Q53A 2X1BA 3DOMB 1XMQF 1XNQJ 5HN0A 2KKHA 3IC1A 3UVJA 2I1RA 4TYBA 1UWBA 3RB4A 3RBXA 3CT9A 2WVCA 5M2PA 2NSBA 4CH7A 2XI2A 2UUBJ 4CYUB 1S57A 1X9SA 2W4CA 5FD1A 4DL7A 5D77A 3OSNA 2J9DA 4NL5A 2RD5C 2G4BA 3IWXA 4MKVA 2F8HA 4DQQA 1YJWS 4ANCA 3KNAA 3DKDA 2CJBA 2O66A 1NPPA 4DR7J 3B4MA 4USWA 3H59A 4DSEA 3FC9A 1U8SA 2ATCB 2HVHA 3VZIA 4IOAQ 1C1CA 1K1SA 3W60A 2KXFA 4ED3A 1D9FA 1XK8A 3QGGA 4Q45A 4EFAC 3EICA 1WHVA 2C3PA 2JRSA 4G3IA 2HHTA 1WWHA 1UPPA 1S0MA 3D0GE 2BUNA 4NXNJ 4EU0A 3P3DA 2GO9A 4FBTA 1VQ6S 3VGSA 1X4FA 3PRVA 3DGVA 1IXKA 2CPYA 1R6VA 5KG5A 1SUQB 2RS8A 5ETSA 1A9NB 2YWEA 4TY9A 1FEHA 2CJXB 2VFRA 5LMUF 1TL1A 2J7KA 3SQGB 4F0HA 4DX7A 3OLBA 4OHVA 3C14B 3MGJA 3S6EA 1GMWD 5LJ3Y 1IUJA 2M8HA 4ED6A 2PN6A 1G7CB 3TA0A 3AAWB 1JLAB 4RBTA 4MH8A 1TKXB 2YQ3A 4USUA 3PDNA 3BKTA 1MU2B 1W2BR 2MJNA 1RTDA 3BBCA 2HWTA 3PNIA 3E01A 1R3NA 5E7OB 2OO4A 7AT1B 5L1LA 3GSDA 1S10A 5KT5A 4ECVA 1FXDA 4CH1A 3M8QA 2UUCJ 2AQ4A 2VDIA 2D3O1 1JLCA 4ZVEA 1IKWB 2PO4A 1WC0A 2DPIA 2X3DA 4RWWA 3UDLA 3BS9A 2M5YA 1HA1A 4F4ZA 3PJWA 4DHVA 4M5GA 3NCRA 3QT5A 4ZVRB 3I6PA 1VISA 1D0EA 1KLMA 4GVBA 4URGA 3R6LB 1S6UA 2RQKA 4QJVA 1T05B 2V9KA 1T8EA 5AJ3F 3JSMA 2RHSB 2XYPB 4OLPA 2E5LF 3MAAB 2KFYA 3HSZA 5J1PA 1Q7YT 2RMLA 1OYDA 1RWVB 4AL7A 4ED0A 1FD2A 3CC4S 2HURA 1CULA 5CYQB 5LM7E 2YKMB 3TWZA 4OJGA 2V4RA 1QTNB 2KG0A 4JI5F 3PR4A 2ZBCA 5FJ4A 2P8IA 1NO8A 4F04B 4NOHA 4E8UA 4O3RA 1GTEA 4ZPWR 5D6GA 4ZN1A 3IRXB 1U2FA 4KKOA 4AQYF 4FF4A 4DV2J 2M2BA 4CZCA 1SPBP 5DG7A 3C3LA 1X0PA 2F8MA 2CA9A 1NJXA 5JMNA 2UXCF 1S6QA 2QZ8A 2X1GA 4TQSA 3LA0A 4FNIA 1V6HA 4RNNA 2XI3A 4LF7F 4IRCA 4JI3F 3CJQA 5LL6d 5HANA 5GADU 1WC1A 2L9WA 2BE2B 3GIJA 1AUSL 3DU6A 4ELVA 4I6AA 1LQ9A 2U1AA 4RW4B 4YR3A 2Y0SD 4XPEA 3ZNUA 3PW0A 2QSWA 4YFUA 4B3TJ 3KG0A 2DR6A 1RXOB 2K3IA 4FS1A 3DRSA 5J2QB 4GO7X 2DHGA 5J2PB 2VF3A 4CNYA 1SCJB 2MZ1A 4C0OC 1Q4RA 3I9V9 3A8JA 1HNWJ 3N4WA 5IS2A 2J0WA 2B5JA 1QAIA 5B0DA 1TQLA 1SB6A 1KFSA 2RRNA 3UNGC 5I42A 2HZAA 2W2MP 1KQGB 1XMQJ 4KGKA 1Y4ZB 5F8LA 1B64A 1UFLA 1FXRA 3OUYA 2OH2A 2MEWA 7FD1A 4PG5A 4ZVHA 2B7CB 4NXMF 2ASYA 4C2MA 2BE9B 2ZITA 4PG7A 1JXEA 1TUWA 2HW3A 2NXNA 4Y2KA 1JJHA 2CAJA 2ZFHA 3J81j 2B4PA 1GTHA 5LXYA 4F3OA 3VALA 4I69A 3GPAA 3T6BA 4OI3A 4RKUC 3M6WA 2CJ9A 2RDIA 3VF0B 3HVWA 2P5VA 5GAGU 1H7WA 3HSJA 1WKKA 3M9NB 3R3TA 5L1JA 2J9EA 4MFBB 2G0IA 4CNZA 1NDLA 3CMQA 2BRLA 2LDIA 1NJWA 3BQ1A 2HHXA 3LGMA 1J2VA 2WSCC 5B09A 2FY8A 2KYXA 2HHPA 4WPAA 1Z1ZA 5EHHA 1F5CA 4QW8A 4ZPVR 1GEHA 4DEZA 2QT7A 2XB2D 3KLFA 2CPZA 2IM2A 1NLKL 1TKZB 5K14B 5KFUA 2A3JA 1JLGA 5F8GA 4W98A 3MMCB 1RT6B 2HWIA 1KN6A 2DPJA 3DLHA 5KFEA 4Y2CA 3C6UB 1SQFA 2Q3PA 3MPUB 5LMUJ 3DHXA 4F02A 3DI6B 1WKLA 4DS5A 1KTQA 2ZKUA 2F4VF 3OW2R 3MTKA 3M9MB 1M5HA 5J1EA 1HQEB 2UVUA 2V8GA 1Q86T 5LJ5Y 2D3UA 4MK9A 4NLYA 5E3RA 3M2UB 1YWXA 4LT6A 5HLFB 2VG5B 3NS6A 2V67A 4MKAA 3M7VA 2JEFA 5E33A 5B0EA 4OL8A 2KU7A 4CO5A 2VHGA 4L75A 1DQ9A 2OHDA 1FTCA 4RBVA 2LQJA 2KJWA 2E1AA 3MM7A 3CGIA 1C1BB 3CPWR 3OD2A 2ERRA 2GFFA 4OI4A 3H25A 4DFJA 4OFZA 2MMYA 2YWHA 2LQ8A 4C8NA 4ZCIA 2AHOB 1XN9A 2R8GA 1HD1A 3UD5A 2F65A 3LP1B 5JVHQ 4ED1A 3EVMA 4KFBA 1N32F 3HLUA 3BDEA 5AJ3J 3M32B 5ITHA 2HEKA 1E6VB 5EUHA 3BGRB 2FHKA 2AEFA 1ZM2A 1WF0A 4Q7AA 2E5LJ 3KLEA 1WUUA 4DQPA 2VFVA 4RW7A 2M7SA 4N47A 2XQCA 1YJ9S 1B3TA 2WONB 4YMEA 1AYEA 1QUVA 3I31A 3T5LA 5KFOA 2H4YB 3CJ4A 2HK3A 3GJQB 4K8RA 4JI5J 2B3TB 1BQNB 4WKRA 2P9GA 5DDPC 1Z2ZA 1VK3A 1WC4A 5A0YA 3MUMP 3QIPA 2AW0A 1KR4A 1H2TZ 2ZH1A 2V8VA 4FVCA 4AQYJ 2EWHA 3VTIA 3W9IA 1T9WA 1M0SA 1F2GA 4LSNB 1YZ7A 1XIQA 2UXCJ 4MYTA 3BR8A 1RU1A 4ZOSA 3K5LA 1KVJA 4DX6A 3IG1B 5KAKA 5DGBA 1VYAA 4LF7J 4JI3J 3CO0P 2ACMA 2V69A 3X1LB 3Q8QB 4OLOA 2GAHC 1WD6A 2AKWB 2QG9B 4Y3CA 3ZNJ1 3FFIB 1RWKB 1S0OA 2ZNYA 4WU2A 1OSDA 5CD4H 3WIVA 3LGHA 1IBKF 1RABB 2H1YA 2XGPA 3US5A 3THPA 5B0FA 1VMBA 3MR7A 1U0SA 4OZ2A 4CWBA 1HR0F 1I5OB 2IC3A 2RS2A 2WW8A 5T7LB 3IFEA 2AP6A 2W7PA 3T1AA 2DHXA 3V81B 3QMQA 1DZ5A 4M95A 4NLPA 1NEEA 1WORA 1YGYA 2IFXA 3OPKA 2HG4A 5I3QA 3JSBA 3QO9B 3VQTA 2RUGA 5J2NA 4ZLPA 1CJTB 3EVOA 1RHKB 3Q8VA 4GVLA 1SV5B 3R5JB 4G1QA 4NXMJ 3DGPA 4OZJA 2P9EA 3GYXB 2AYGA 1NUEA 2XMUA 4URSA 1RK8A 2IYIA 3Q24A 1Y10A 3PIOQ 1XTZA 5E5NA 4USTA 1UEUA 1X5OA 4K4YA 2F9DA 4RWXA 1LWEB 2YKAA 5CD4A 2ZWOA 3R27A 4O44A 2DGWA 2HQ3A 2G13A 2UV8G 5LMNF 3TJ8A 1FJ7A 1S9EA 1FRLA 4M5DB 2BA9A 3IXQA 4OV1A 4QR2A 2PA3A 3K5NA 2B43A 1P9QC 2DNLA 3ET6A 4BC9A 2FGOA 4TN2A 2G0CA 1LWCA 1U49A 1Q7LB 4DN0A 1X60A 3DMJB 3GFHA 3RB6A 2GIQA 3E8OA 1R8HA 1H7XA 3JSRA 1FWKA 3AA9A 2CZ9A 2YWWA 3LH2S 2RU3A 3GMGA 3RTVA 2BV3A 1EIYB 1HWLA 2R7SA 2BRKA 1RT3B 4XIUA 2VG7B 1BXNA 1W7WA 5K5MA 5K8OA 2F4VJ 3HVTB 1FK9A 1BY9A 3EGNA 3C6TA 1EKSA 1CS4B 3IBCB 4X4OA 3T41A 2V68A 2UVRA 2B51A 4A8FA 1LWFB 2FDNA 5IV3A 2YX1A 4LVOP 1HNIB 2OP5A 5IQ6A 5KFXA 5K8NA 2H65B 4KHPJ 4K59A 3K5PA 4I0WA 3MFIA 2AX1A 3GG0A 2NZCA 3WX4A 3TVYA 1YTYA 4EEYA 3KYLA 3NG8A 3H20A 3BGLA 4Q0BB 2YNGB 2W24A 5CCLA 3MXHP 3RG6A 2B0GA 1UVNA 3G82A 3KJFB 4DV7F 1QVGR 5F41A 2GA7A 4EUVA 4TU8A 3OXFA 1UPMB 4UZCA 3WC0A 2Z30B 3CIZA 1KVKA 1SKSA 2ADCA 1K73T 1RHQB 4MIBA 1N32J 1GXTA 4O3NA 3T1YF 2MKHA 4ATNA 3D54A 3IS9B 1I51B 1R7IA 2DO0A 2AGPA 3Q8SB 4OV6A 1FJCA 1JKHB 3X3UA 1CQMA 5I4MA 2EC0A 2V4JA 3W9HA 2LEPA 5RUBA 1KP6A 3O2IA 1D09B 4EZ6A 1NXIA 1HHQA 1RISA 3HI9A 3A12A 4FYYB 2JEJA 1CQNA 5HMZA 2ROPA 4G65A 2NPFA 3G71S 3FBCA 1NB2A 2H5IB 3M6VA 2I5JB 3NGKA 2CPIA 5KT2A 2XHWA 4R8UA 3T1HF 3UPFA 5C24B 1TZ0A 2CQPA 2H5EA 2W9AA 3IMQJ 5HBMA 3W9JA 1U6BA 2DNOA 4CLSA 5KT4A 1A0OB 1OQ6A 4M5HA 5HP1B 1T94A 3WBZA 5D3GA 1X5TA 5J1NA 1GH8A 1EQMA 2GNKA 3KLHA 2MSSA 2W9BA 5K8PA 1KBRA 4CP5A 2EFNA 2J8SA 1PCAA 5ETVA 2R7WA 3CCUS 3DRXA 3C15B 2HFOA 3FBEA 2YVSA 4JI7F 2DISA 1AA1B 3FZ2A 1IBKJ 2B9YA 1IKYA 1IBMF 4YOEA 5KG3A 1ICEB 1K1QA 5KFIA 1EETB 2CZVC 3A8IA 1O6XA 3CC2S 1HR0J 1S1UA 5H9EK 3BSCA 3D28A 1QSLA 3C19A 4LF8F 1S1VA 5EX3A 4C8KA 2AJ4A 3CJ8A 3TUIC 2Z2ZA 1NSKL 1QSYA 2W4PA 1T9UA 2IM1A 2WBRA 3M8ZA 3HZGA 4KGVB 2GV1A 1DBDA 4QW9A 2MLXA 1FKPB 2I0XA 4ED8A 3UNYA 4TNOA 4NRUA 2V9WA 1RQ0A 2VODA 4F7VA 1JNZB 4RUHA 3QZ8A 2XZDB 1S1TB 4OHWA 4F4YA 3NAIA 3BH6B 2M88A 1T9TA 1WEXA 2E5IA 1YI2S 1P1LA 3NMAA 3ZTQA 4FF3A 4K0KF 1S99A 1WJ9A 3HT0A 3F44A 1MROA 1HMVA 3VGUA 5LMNJ 3DDKA 2YKPA 4R0EA 4LQ9A 1N33F 2HNDB 3RAXA 4TLQA 3V4IA 3MOJB 2IVFB 3GJRB 3CCSS 4C4WA 2XMTA 1QE1B 2F9JA 5F9LA 2V8PA 3P45B 4KV8B 2PGCA 5H9FJ 1VQ5S 3MMBA 2BW7A 3MOZA 4H4OB 4O3OA 2BXJA 3HCXA 4U8VA 2VDHA 5HVGA 4X4PA 3FGVA 4IFVA 3FBBA 2R3VA 1I94F 2NXUA 2K1RB 1F2HA 2VB6A 1SQEA 1YJUA 1WC5A 2BKOA 3DNCA 1FVSA 1RT4B 1EJ7L 4EK2A 3D68A 4Y2AA 4PQUB 1SIWB 3RRGA 4RNOA 3CE8A 1VQ7S 2VA2A 2RIJA 1RSCA 1XR7A 4CO0A 3SV4A 1JLEB 2G1HA 4RW9B 1JXVA 3CJ5A 3KLIB 4KT0C 2CQ3A 1GX6A 3W5ZA 2VOPA 1CBKA 1OYEA 3NGTA 1YJ7A 2R7OA 4P10A 1QVFR 2YNHA 2WVEA 3K58A 1UEVA 4J9VA 3GV8B 3MEGB 4YDXA 2QN6B 2BZ2A 4HDHA 4DG1A 3KJVA 1YRTA 3DYAA 1SXLA 4RBUA 4HT5A 2ZE2B 2DK2A 1OIAA 3LWLA 3EDQB 2CPXA 1HBMB 2FVCA 2UZAA 3T1YJ 1CJVB 1RAJA 3I55S 4P2MA 2HNZA 2V2KA 2DT9A 3OFFA 3QAUA 2IAJB 2FPHX 3OVBA 3DOLA 1R43A 3AY0A 1HKAA 1XMOF 3OTCA 2VG6A 4ECZA 2PI4A 4WFZA 1NAQA 1CEZA 1U2RA 3H0PA 1BLUA 3D2WA 1U1KA 4WU3A 1IR0A 1F5AA 1IBCB 5IOLA 1OO0B 3D67A 5GAHI 5ETQA 3EZ5A 1UL3A 3FVYA 2ROEA 2HHQA 1HBUB 3J7Z5 5B7WA 3T1HJ 1B0VA 2J5AA 3VGTA 3TOQA 3NY0A 5ETOA 5L9NA 2VFTA 2HFUA 4B9UA 4DL0C 1JLBA 2R8JA 2ZJPQ 3U1NA 2WSEC 5I3PA 3UVJB 1OY9A 3NOCA 1S6PA 2OEJA 1LW0A 3IM9A 3S8SA 2RKIB 1WSRA 4JI7J 5AE2A 2ZUAA 4OYPA 1B0TA 3DCAA 1DQ8A 2AJ0A 1IBMJ 1S1WA 2DJWA 2YNFB 2L48A 2VBZA 1F3VA 2GQCA 3ZZPA 1ZZFA 2HK2A 2UXDF 3BQ2A 1FHTA 4C0HA 2R2TA 2HBZB 1H6KX 4WXWA 2R7QA 4LF8J 2R9LA 4WBFA 2VKRA 2A6MA 4GRSA 1QLNA 4Y2IA 2O01C 4PPDA 2IYGA 3PM9A 2ZBRA 5EGYA 2O5DA 3RBDA 2HVDA 3J81Y 2Z2MA 2QFJA 1APSA 3KDNA 1TKTA 5D15A 3ISZA 1X31C 1FI4A 2R7TA 1U1QA 2UVVA 3MAQA 5GMDA 3TAMA 2J9DE 2D7SA 3MM5A 3K7RA 4MIAA 4OHYA 4ETZA 3G4SS 4DCOB 4IO1A 3QGIA 1UVKA 1SL2A 1H2UX 1TL1B 2WRMA 1Q81T 2Q43A 3QPIA 2V5HG 4K0KJ 3ETMA 4DN9A 1PJ7A 2DY1A 3AFGA 1RT7A 2IDEA 2ZDOA 1S97A 1B7YB 3AT1B 3I9ZA 1N33J 1KQFB 3QQCD 4WXOA 4U9RA 4WTYA 3VHQA 1HLWA 3HHKA 1FRXA 2KFNA 2OD4A 3E51A 1XEZA 4K5RA 4F2SA 5HQLA 2OSRA 2NPIA 2Z2LA 1JJCB 3AOCA 4MK8A 2K06A 1EKRA 4BCAA 2C3MA 1S7HA 3B4DA 1TL3A 3QJPA 3PJ9A 5KFTA 3DFEA 1RT5B 4CLPA 4ANEA 1JLCB 1I94J 2PMWA 3KK1A 2D3ZA 1VDHA 4IFYA 2A2DA 2F8EX 2LMIA 3U1MA 5C2CA 1XR6A 2B7BB 4LSLA 3BEGB 4XO0A 2D74B 2ZKTA 1KLMB 3SBMA 3TA2A 1Y3JA 2VFSA 4GVBB 1L3UA 2OD6A 3FRYA 2XSJA 2HMIB 1Q82T 5KG1A 4ALZA 2NXEA 1RAOA 2MGZA 3O6QA 4DR4F 3BSAA 2E9ZA 1FFWB 4NCAA 2HSEB 4NZ0A 4HYKA 3DRPA 2JDJA 3I32A 1VJQA 2DCUB 4DPXA 3TJAA 2YQ0A 1UFKA 3K5MA 3I0SA 3MUTP 3KHRA 3AOBA 2V50A 4KKOB 3PRDA 3N5BA 3TP2A 3BQ0A 1JNRB 2RILA 4CI0B 3UI3A 4DZDA 4AE5A 4O0NA 3HP6A 3FQKA 1IM6A 2ZHAA 3VAHA 1S6QB 1L5UA 1S12A 5FLXY 1F5BA 2EK1A 1U1PA 2NUUG 1QTMA 5IFMA 2MSTA 3RW7A 1RAFB 3O5TB 1LKZA 2CQGA 2M4MA 2HVEA 3V6KA 2AMCB 1VR6A 1FNMA 4N41A 4F67A 3OR1A 3D6MB 1Q79A 3R2DJ 1DFDA 3MF5A 3TX0A 1XMOJ 2GIRA 5CHCB 2I2YA 2CVIA 4ZA1A 1GMWA 2XEXA 1FRJA 3AQOA 2DITA 1MNEA 2EI5A 4Y2MA 1FJGF 5CYJA 2FVPA 3KLGA 4ZIWA 2ABYA 4USJC 3GJSB 3EX7B 1RWOB 4G1IA 4OI2A 2B5JB 2KHCA 3DOKA 4RZRA 1CSJA 3PW5A 1QAXA 1E6YA 4ZITA 3SV3A 3JSYA 3PEJA 3POTB 5I42B 1GNKA 2FTRA 4YS2A 3GCWP 3LAMA 2FC8A 3FKBA 4CLLA 4PWDA 3GIIA 2FLPA 1PGZA 4D3GA 2YKOA 2MKYA 1NJYA 2EFOA 5GAEU 3IP0A 3KHHA 2N4CA 2FHOB 3HZEA 5E41A 3QNWB 1Q5VA 1UFWA 3P5BP 4NYZA 3IR6B 2N3LA 2F3JA 4O3QA 1M5OC 1RB0A 2C3OA 4QWEA 2QC3A 3AB4B 5T41A 2UVWA 3QYYA 1KONA 2UXDJ 4QYZJ 5KT7A 1IWAA 2HZCA 2XC9A 2JC0A 2V6AA 3GP9A 1JXLA 3UD4P 4OZNA 3AB2B 2KI2A 4KPCA 4Q2LA 4UUXA 3P4UB 4MK7A 2E7WA 2HNYA 3AHPA 3VAGA 1NK4A 2CQHA 3M2VA 4H54A 2V2VA 2EFPA 3PW4A 2JLGA 1UTAA 1DLOA 1WI8A 3KLFB 2NR0A 2YY3A 1UKUA 2UUAF 3UN5A 2CQCA 3HXMA 3HJVA 1DTQA 2QYGA 2CDQA 1IR2A 4ILRA 3ZC4A 2DXDA 1HI1A 5I3UA 1C0TA 1C2PA 1I6JA 1F3FA 1LNQA 4OX9J 1P8GA 2WB4A 3NGSA 4NYPA 2U2FA 2ZJRQ 3CCMS 2VD3A 1FRKA 5J1EB 3ZO7A 3UCUP 4X4TA 2ZOFA 4DSIA 1OY8A 2RRBA 1HBOB 1PO6A 4NLOA 3RAQA 3AD7C 1UVLA 4OIXA 3QGHA 2RT3A 4WTOB 1RWMB 2DHSA 5D8HB 4M5IA 2BKNA 2DNRA 2C28A 3PYFA 3AD9C 4Q2MA 2PDAA 3LO3A 1NHVA 2BOPA 3NOGA 3G2XA 4BWMA 4EO8A 3GG1A 1Q5YA 4OJHA 4DU8A 1T9VA 2MQQA 3GONA 3VV2B 1AZSA 5HATA 4JI4F 4DUZF 2MKKA 4OX8A 2QTWA 2M3DA 4LF5F 2EBEA 3AJ2A 2O67A 3T5HA 1J5OA 3OJSA 5T14A 3HM9A 1UVMA 1IKVB 2H9ZA 2DBBA 2LECA 4QIGA 1IQZA 3KLEB 1AFIA 2RSQA 1TP7A 4F36A 1VI7A 2HQIA 8RUCA 3QLHA 1QAYA 3JAMU 4HKQA 1U4BA 4HHUA 5KFCA 5IXUA 1BGXT 4DR2F 3J7AN 1UW4A 2B8PA 1S9FA 1FKOA 2DEIA 2PMZD 1HBNA 5A0YB 1WI6A 4QCLA 2XS2A 1P9YA 1C4AA 3AA8A 1FRIA 1OY6A 1RI7A 5D0RA 4F4KA 3RBZA 3D9BA 4DF4A 3QFWA 4FYDA 3VAKA 2BQRA 1PJ5A 3WC2A 4FYVB 3S1TA 4MAKA 3N6NA 1WTBA 1RCXB 3IBFB 4J91A 5BYRA 3PW7A 5D4NA 5HVHA 4C7QA 2RF2B 3KUHA 2LXFA 2A2CA 4G6VB 2YKNA 4K4WA 3IGVA 3LGNA 3M2RA 5BJRA 5AXKA 2W01A 2X3GA 3BKFA 4CH0S 3FEXB 2XG8A 2AEJA 2GGPA 1SJ1A 4JB8B 3KK3A 4DQIA 3MECA 1X4BA 1N5YA 1CLFA 2NSCA 1R8PA 3LW5C 5F8MA 4B17A 1FJGJ 1N56A 2PFDA 4C97A 4CT9A 3BSNA 2L9DA 3SDEA 2VASA 1NKEA 1YBAA 3CD5A 2BVZA 4RUAA 2UXBJ 2GMHA 2IC3B 1X4CA 2YKQA 2H54B 3J7ZT 1D3WA 2DRDA 1KC8T 4U67Q 4DUTA 4X2BA 4V1Ak 1ELOA 2JEIA 5HAOA 2A18A 3KTQA 2HQCA 2XM3A 1PG5B 3P49B 5J2NB 3MD1A 3K89A 4DR3F 5G0RA 2WW4A 4G1QB 1JK9B 2W9CB 2J0SD 3PJXA 4HTJA 3ONQA 3DGPB 3ZTSA 1GAOA 2XCPA 3LWMA 1R31A 3FNNA 3R7SB 4HR2A 1FJEB 5AE3A 1UVIA 1LW2A 3BB5A 2KL8A 4BBYA 2JVOA 4TQRA 2HBYB 4PWWA 2M70A 3SYZA 5H1SV 5HMYA 2C42A 1RAAB 2MY7A 4O44B 1J5EF 1IJFB 4DXLA 2GJFA 2NYHA 2PEHA 1JIHA 2IVMA 1NH8A 4F0MA 4KH0B 3RAMA 3R7NB 1S9EB 2ZH6A 2DGSA 2XNRA 9ATCB 2GVDB 2XY6A 1RU2A 2AT1B 4UTGA 2P6SA 3F73A 2Z58B 5E3QA 1FVQA 1AXQA 4J37A 1S7IA 1TAUA 1LWCB 4ZP6A 4CYUA 2UUAJ 3SFGA 2C2EA 3TA1A 2LP4A 1CJUB 2X7IA 5E0OA 5A8KA 1MN9A 1CJKA 3OBIA 3S7RA 2KM8B 2HBRB 4ZLJA 1QDUB 3L7OA 5KFFA 2QLWA 2HYIB 3ILJA 5BYQA 4EI2A 3A3OB 1FE0A 2E5GA 3DLEA 2OFHX 4I7FA 4O0IA 3C6TB 2OPQB 1UJ6A 1WDDA 3HKWA 3DN9A 2A0FB 2MQ8A 3PV8A 4B9SA 3QSYB 2XMJA 4FYWB 1M90T 3G6YA 3NS5A 1YZ6A 3MCSA 3QATA 2DCLA 3CCZA 4ZPTR 1PSDA 3MI7X 6FD1A 4B3RF 3O8WA 3RR7A 1RP5A 2UUTA 3AXMA 3SQGA 3JTOA 3C14A 4FXWA 2KXNB 1XBWA 1UZDA 5IT0A 1RYRA 1HWKA 4DUZJ 2HHSA 3PHEA 4NCGA 3QIDA 4LF5J 4MIWA 3G9CA 1RTHA 4I64A 2AJ2A 1K0VA 4UY8T 3A3NB 4J9SA 4DSJA 2QA2A 4CLFA 1N8RT 4CLZA 3PW2A 4V19J 3W5XA 3TR5A 4USHA 1U48A 4PG8A 2DIVA 4DR2J 2DR8A 1TVRB 4EYHB 5KFQA 2DRAA 1IKWA 3TJ9A 2FC9A 3DXSX 1EQ0A 1K44A 3K8VA 2DNHA 4DDFA 3MM9B 2F7VA 4JV0A 5K9FA 2JL9A 1S1XA 1T05A 1PC4A 2LQ9A 5L39A 3IAM9 1SJQA 2AJ1A 3LOUA 4C8YA 5HBMB 2IY5B 2Y3YA 2MXYA 2XYHB 5HO4A 1ZOTA 3BGFA 4DZ6A 1SH3A 4X64F 3KLHB 2WB1D 4P7TA 2YKMA 1BMQB 1BC6A 3VAFA 1RA7A 4IOBA 1S0NA 4HL9A 4JI6F 5DG8A 5C25A 4LF1A 5KFAA 3UR3C 1IKYB 2V8HA 1FDBA 3BBFA 3LP0B 3H5UA 2MZSA 1D1UA 3SSQA 3JB9k 4LQ3A 4E0DA 1N52B 4KR0B 4ECWA 4PAAA 5IM0B 4DL2A 2ZD1A 3T9NA 3J81U 3CCWA 4C6AA 1AUDA 4DS4A 2PSZA 1PAEX 5F9NA 2BE2A 2OFGX 4DR3J 1SC1B 5EN1A 4O3SA 3BO4A 4RW4A 3W65A 2XSFA 2PD1A 1TAQA 1N6QA 5CZXA 1B7FA 1H74A 1X4DA 2FLNA 4UT4A 2BE7D 5AXNA 3VR1A 5J2PA 1S0VA 3EZUA 4Q5VA 5F8NA 2KRRA 4GO5X 4MTPA 3EDRB 3WZ0A 1WACA 2IJRA 4ECRA 4PRFA 1J5EJ 1VIOA 3UE2A 1LV5A 1RT1B 4QIEA 1QY7A 4LRBA 5HVFA 5E3PA 1SH2A 3HK2A 1MROB 1HMVB 4A8SA 1HWIA 3V4IB 1HL6A 3HHDA 4FKYA 2IRYA 1S76D 2KT3A 1WOSA 3KOAA 3QRRA 3CDUA 4OI0A 2HRUA 3LP2B 2OJ3A 4FNHA 4IDKB 3W62A 4CLTA 3ILLA 5KG0A 2XS7A 4QWCA 2R7RA 3VAIA 2LFVA 2MPUA 3PZPA 2FJVA 1H73A 5B0CA 8AT1B 3MEDB 3A8KA 2JVRA 3GIKA 1QAJA 4AD6A 2VICA 4MFBA 3RYLA 5HQ8A 2HVIA 2QFIA 3BGUA 1IN0A 1IQTA 2CQ0A 4IKAA 2J7UA 2AZ1A 3MM8A 4M5NA 3MPWA 4F50A 4HACB 1Q8BA 1DARA 3PIPQ 5JUMA 3W7BA 1VC0A 4XTTA 3LAKA 4KQZA 2GHWA 1NZ8A 3AD8C 1OPZA 3GJTB 2OPRB 1NK0A 3QT6A 4Z7YA 2W2QP 3G8SA 2G2ZA 3W63A 1H72C 2XYGB 4DPUA 3D7SB 3I0RB 2MLYA 2V4QA 4UOFA 5D0HA 2YNHB 2HHWA 2XHCA 3G6XA 5JVGQ 3DI6A 4I56A 2AZ3A 5KOWA 3VQSA 1VHIA 1TV6A 4QPXA 4FP9A 3GV5B 5ETPA 5DM6Q 5FLXU 2R7XA 3ZZTA 1M1KT 1HQEA 3RRKA 1AW0A 4X84A 1VRQC 4F4WA 3MR5A 2OUGA 5C42A 2HNZB 2VG5A 3H2VE 1URRA 1X4HA 2JFKA 3FQLA 3JQKA 4N56A 3Q8YA 4IG3A 4ZVQB 3BDPA 2RRAA 5CXTA 3HMJG 1V5IB 3DOLB 3QT7A 1T11A 4HTIA 2VG6B 1SC3B 4P71A 3I4HX 2QGFB 2XGQA 3N0VA 5ETNA 2ZH3A 4LFBF 1C1BA 2MZQA 1VQYA 4NLRA 4JOUA 4PEOA 2ADBA 3KDOA 3HHLD 2RHQB 4RUBA 4YB1P 1IJEB 2RU9A 1TK8A 5B08A 3TNVA 5CA5A 3BSOA 3LP1A 1VQOS 2CG8A 3C16B 3M6UA 2HHUA 4NZ7A 3B78A 4ED4A 4AYBD 3OTEA 3DLBA 1EARA 1S77D 3MDFA 4EO6A 2VIHA 2R8HA 4KB7A 1R89A 3NGUA 4WP8A 3N01A 2DVIA 2IJFA 2BDPA 4HH1A 1KVIA 4IH6A 1VQ4S 1JLBB 1FCAA 4ZP7A 4YY3F 4ED2A 4X64J 3W66A 3D0IE 5D4PA 4RUCA 2XY5A 1R8AA 4A8YA 1S6PB 2FZCB 5KFSA 2FHJD 1BQNA 2GJ2A 2E29A 3PEHA 1YK9A 3B8HA 4JI6J 1WG1A 1VK8A 2HAIA 2D41A 1FEEA 4KE5A 4UQTA 1X5SA 4USVA 4W4MA 1TELA 3FJ2A 2N82B 2AYBA 4YQWA 4LR8A 5DZ7A 4LF6F 4P74A 4YP3A 3ISND 2RB7A 2QMWA 3K5OA 4OYAA 4DJBA 3SCLE 4ID5A 3CDEA 1SL0A 1U47A 1S72S 3NNHA 4DV6F 4TVAB 4PKDB 5GMEA 2GZOA 5U47A 1RT2B 1V9OA 3VAJA 1DURA 4L72B 4IQMA 5CYMB 1IR1A 4XAKA 2HHVA 3FFIA 2FZKB 4CQ1A 4ZCLA 5F8JA 1TUGB 1SKRA 3TAMB 4QWBA 3P8BB 4CT8A 1M5PC 3Q0AA 4DI6A 2RDJA 2G2YA 3GR1A 4KC5A 4DV4J 3VAMA 1D8YA 3PFEA 1ZA1B 5H9EJ 2VFUA 5F0WA 3ILIA 4OYWA 1TL7A 1V3ZA 4KRWA 1RT7B 2KVQE 3CUNA 1Y11A 1JWWA 2ZH9A 1GXUA 2QLXA 1U0HA 4K5SA 3MURP 1NPRA 4WF9Q 4GKKF 5F8HA 2R8IA 4ILMA 4FKXA 3OTDA 4FPIA 2ZH2A 4HH0A 4RW6A 2Z57B 2AYMA 3TEHB 1OSCA 2CG4A 3J7YI 2N4DA 2W2OP 5J2MB 5AXMA 1UMJA 1RTJB 4CLUA 1D9DA 1FNOA 2ATLA 3IA0A 1M5VC 2I8EA 3TZWA 4WK1A 2BANB 2E7VA 3FCWA 3SCIE 4X4NA 3O3LA 3H5YA 2QA4G 3C2PA 1M5SA 4F4AA 4M63A 4TLRA 4KHRA 4DV5F 4M8LA 3MEKA 3NWRA 1MWYA 2WBMA 2PT0A 2V63A 4A8OA 4GC6A 5KFNA 3NCPA 5LOQA 3ETOA 8ATCB 3N9UC 3M30A 3CMES 3BYRA 4OQJA 4DPTA 2YPZA 4YUDA 3TVZA 4DFPA 3B54A 3IAS9 2HLUA 3DRPB 1N36F 3TX8A 1M1HA 1VBXA 4KO0A 3I0SB 5ETTA 4ER8A 3H4DA 2VG7A 5HI7A 5LSOA 3IR5B 3HVTA 3M1VB 2QIFA 1CS4A 3A13A 4WFNQ 3QRQA 1YSJA 2QO3A 1LWFA 3T5JA 5D78A 2VKZG 3D0HE 4RPFA 1HNIA 1TTHB 2KTQA 4WFAQ 3MMJA 3BN4A 4J9NA 1BWEA 2LXUA 1UJ4A 2V94A 3D3BJ 3OR1B 4F8RA 5ETLA 2HZVA 4Q0BA 2YNGA 2ZJQQ 3BF4A 4LFBJ 1MMLA 5IZHA 2DGOA 4U7CA 2PE8A 4ILLA 1WEZA 1IM4A 3PTWA 2NCKL 5L1IA 4J5OA 2X1AA 1S6OA 2FLOA 1YJTA 2FD2A 1VQKS 5HJXA 2LXIA 1NSAA 1OS5A 3DOKB 3C46A 1R0AB 1E6YB 2LEAA 2GQ2A 2Q66A 2AJFE 2RQMA 3ZZZA 1FWLA 3ZTPA 4DOZA 2RQCA 1HQUA 1NM2A 2J0QD 1MSWD 4OZLA 3CTRA 4IH5A 2KT5A 3MR2A 1X9MA 1RHUB 2QYCA 3K57A 1CC7A 4WJBA 4NPOA 4DBQA 1JLFA 2Z56B 3ILOA 4USIA 3PX0A 1FX2A 3JQJA 4P7VA 3UDCA 3LPYA 3M8PA 2ROGA 3LQVA 4YB5A 4LF6J 5C24A 4CO4A 2C22A 2FVSA 1TL4A 2B8QA 2AX0A 4DU7A 2VV5A 4ZCKA 4DV6J 2CRLA 5HP1A 4ELTA 5DDQC 2BJ9A 1UZHA 2ZZTA 2W1BA 1FD8A 2C2MB 3M2VB 4HEA9 1NKCA 3PYGA 2ASLA 4BC7A 3QJJA 2J6UA 2K7JA 1DLOB 4N77A 3C15A 1W2IA 4C8MA 1QM9A 3TUJC 1ZAVA 3OXGA 5DM7Q 2EXUA 2KN4A 4X66F 4RLEA 1DTQB 5KOXA 1L3SA 3FSIA 1G6BA 3BN7A 1C0TB 4P52A 2DIUA 2VZ9A 2YNIA 3W2VA 4ZMMA 4J9MA 5EWFA 4LMZA 3NL0A 3CCLS 2BJ1A 1I3OB 4TY8A 2Q6BA 4C0BA 4JV2A 4GKKJ 2NXJA 2PEBA 4IO9Q 2JEGA 1BE4A 3HVRA 1O51A 4NXNF 3CDBA 1IKXB 4ICLA 2XMWA 3DDIA 4KGMA 4DPOA 3FSYA 3V5RA 2ZM6F 3CXCR 1LK5A 4I2QA 5K8MA 2OELA 1XNRF 4O4RA 1S1TA 3M05A 4QIFA 4RR5A 2B4VA 3W5YA 1U1NA 4TU7A 2CDRB 3H8YA 2XMVA 2ZH5A 2CNLB 1VRUA 3IR7B 4Y6IA 3DLKA 2VBYA 2EG1A 3NP5A 2AF6A 2HS0A 4H4MB 2RE1A 1FFGB 2QLJB 2CQDA 3OR2B 1WDTA 1NDCA 2H4WB 5BR8F 1J5OB 2OPPB 3SCKE 3HSGA 2QSFA 2RQ4A 1QE1A 4A4JA 1S9GB 3SIPB 4OYIA 1YLXA 4PXBA 2CQIA 3QLHB 1XQIA 2IMOA 5KFDA 4H4OA 4IQXA 1RJJA 2V2ZA 1N36J 3JXOA 1KHVA 2UUCF 4J9RA 3WHIA 3W2WA 5G4DA 3KXDA 3O44A 3CD0A 2AGOA 5A6PA 3PR5B 1N88A 2FZGB 1UAWA 4ENOA 4QZVB 1SC4B 1T02A 2CJKA 2H5JB 1X0FA 3M8WA 1S59A 2AGQA 4KSEB 4NE9C 2FY1A 4PABA 3LF0A 4RW9A 2ZHBA 2WVDA 3SXLA 3KLIA 4RU9A 2VA3A 2UUWA 2R7UA 1IVZA 2E5JA 2P9CA 3PYEA 4P6QA 4UF4A 4NZ6A 1HD0A 2YQ1A 2GGPB 2VONA 4B9LA 3MECB 5HROB 3FDSA 3MEGA 3PX4A 2EC2A 2E9TA 4PYAA 1PBAA 2OKQA 4XDDA 4ZPAA 2R8KA 2PC6A 4XDCA 3SDEB 3ZZOA 2P2CB 3IWLA 3D66A 1NK9A 2NS1B 3HULA 2WTFA 3I5AA 2ZEJA 4QBUA 1HBMA 2Y1IA 2PA8D 3F41A 3HT3A 1S79A 3I87A 2EBGA 3TARA 1FF2A 3KJNB 3M6XA 1W26A 4A48A 4K4TA 1R8BA 1SH0A 2DGVA 1RTIB 4OHXA 4C3KA 3C8YA 4PXEA 4LF4F 2RUSA 3ZTRA 5G0RB 3Q8UA 2VU5A 2GCFA 4PZVA 4B3TF 1XERA 2LCWA 2JFDA 1AFJA 4LR7A 2AYEA 1GQEA 2LA6A 4WE1A 1EHWA 2VH7A 3JAMY 1HBUA 1SC6A 2DNMA 3M8RA 5A2QY 3ITHA 9RUBA 4QYZK 1HQ2A 2QV6A 3MUVP 5F0UA 3R5AA 3SMZA 4J90A 1Q8LA 3TW0A 2R2UA 1REVB 2LVWA 4X4RA 1FE4A 2DR9A 1HPZA 2QLFB 1YJVA 3P6YC 1YBTA 4PUOA 2RKIA 3CJ3A 1P6TA 1MG7A 2PFFB 3NEKA 4R5PA 1PIEA 1Q8IA 1UVJA 1V3SA 1Q16B 5GMKa 4RW8A 2VBWA 2IHR1 4X66J 2YNFA 5HMXA 4C48A 2BJ3A 4NYOA 4DQSA 2BQUA 2IJNA 1MMNA 4ZJQA 2KT2A 3RGIA 5A8KB 2DNQA 1CJKB 4PG6A 4B3MF 2IMWP 1HYSB 2HRYA 2XCAA 3THVA 4ZKAA 2C2ZB 4EBCA 5DG9A 3DLEB 2IRUA 4I7FB 2OSQA 5GAHU 1UP1A 2FYXA 2JNJA 3AJDA 1KFDA 4YN3B 3CDWA 3R1HA 2EKYA 4WZMA 4B08A 4CDIA 2VPXB 3S01A 3R9LA 4OZ3A 3A3PB 3RW6A 4L6V3 1N5VA 3CSKA 4NLQA 3MCOA 1H3DA 4B3OB 5IWAF 5IC4B 2CIMA 1ZAXA 2ZM6J 4NI2A 2GQQA 2BX6A 5B0GA 1RHJB 2HFSA 1BQMA 2CPHA 5E3AA 1XNRJ 2BYCA 1NKBA 3GIRA 4KGZB 1NK6A 4J9OA 2JSXA 5B0BA 3Q2SC 5IT9Y 2JHEA 1RZMA 3A8EA 2FJWA 3MAHA 1VGYA 2EG2A 4LRFA 2XY7A 2F40A 4AFFA 2FJDB 3PKMA 4NCGB 3AOAA 3KMQA 2HVZA 5BR8J 1Y5IB 1DTTB 4LRCA 1VJWA 1RTHB 1DRZA 1FFSB 3GFZA 3H5SA 1M5KC 2WHOA 3IGNA 1HARA 2GW8A 3BR9A 5KFWA 2X51A 1WNEA 3G87A 1PKUA 4ED7A 4TYAA 4DLGA 3SQOP 2KB2A 2DD8S 1RT5A 2OIHA 4IG0A 4OZ0A 4Q44A 2LDYA 2WK4A 1OWXA 3L7PA 1C0UB 1DAXA 1N4LA 4FDFA 1WOOA 4ZVUB 4CIOA 4F0KA 4ECQA 4WYWA 4OYOA 3G86A 4DCJB 3UW1A 3OHAA 1S1XB 4FXVA 5DQIA 3OFEA 2VOOA 2IIHA 4UZBA 5EDWA 2XBPA 2JC1A 4CTAA 5KFYA 2HMIA 1WELA 3GE9A 4DV0F 2HRTA 2HFZA 4X4UA 5HL7Q 1SJRA 1SKWA 1V5VA 4KPYA 1ITPA 1T03B 2E7XA 4P9SA 4H4KA 2M0GB 4RO0A 2VQFF 3FUYA 3HJFA 1QJHA 4JP8A 1JB0C 5HQMA 5A8WA 5KFZA 4M5KA 2GJIA 1K47A 5C25B 4OX6A 4FPRA 4ECYA 2H3EB 1HI8A 2ZWPA 1NK8A 2B9EA 4DFMA 2EFGA 1JJ2R 3TI0A 3WX8A 4NCBA 4O4GA 5HMWA 3KUEA 4WZQA 4WFBQ 4I67A 4DV7J 4QU7A 4CCHA 5AXLA 2ZBQA 3UDEA 3TQEA 3PCOB 4ZHRB 4NWBA 4BDPA 2LKZA 1F9HA 3L9ZA 4I6WA 2GMJA 2ZD1B 2ASJA 2NYIA 4KTQA 1B70B 4C3LA 2KDOA 1YRXA 1U6FA 2XZWA 2B9XA 2Q79A 2CPFA 3MEEA 4LF4J 5KFMA 4NLDA 3DLGB 3OXLA 2DYAA 1N6QB 2W2NP 2FVRA 2IBOA 2XMAA 2K7KA 4FS2A 2CWXA 1RAEB 2ILYA 1NCLA 1FDNA 1RHRB 4NEYA 2DO4A 3GFYA 3I96A 3BJYA 3KJQB 3POTA 4P2FA 3M8YA 5KG7A 1KNZA 1KS2A 2CWKA 2XO6A 4JI8F 4I4BA 4M5MA 4KYZA 1H0HB 2K3KA 1WKJA 2QL9B 3ZFVA 1U26A 4J9QA 3AXKA 2E5HA 4ITSA 3UQSA 2LEBA 1UWBB 2ALZA 4YB7A 4ZLNA 2Y8WA 2J6SA 3MR6A 2Z2YB 2CKWA 3Q8PB 5DQGA 1FO1A 3GTYX 4B3MJ 4K4XA 2BM0A 2LA4A 4RJVA 2DTJA 3DXBA 1U7LA 1RCOB 2AJQA 3NLCA 2GVZA 3MM8B 3W1YC 4EMDA 1RWXB 3CJKA 3R7BB 4LIWA 3FSXA 5ETKA 4B9VA 3EGWB 1MWQA 2V0NA 3MCMA 2Y1RI 1NPKA 2DNZA 3TUZC 1C1CB 1U1MA 2EPIA 1FRHA 1U25A 3PXGa 2LYVA 4ECXA 3OVAA 5IWAJ 1RWWB 3CJRA 2C2KB 4U6PA 4U7UK 3CCTA 1FT8A 3CC7S 1JX4A 4ES3A 4BS2A 4ZDNA 1Y3KA 1N0UA 2ZBPA 2CJQA 4IRDA 1TV6B 2QMXA 2R42A 2EFQA 3BO3A 4PXDA 1EP4A 4IYQA 4QR1A 3ZZRA 3TZZA 2QL5B 1RUSA 3U27A 1PYSB 3HD2A 3A4TA 3N6MA 5FDLA 2MZTA 3KK2A 3PY8A 2N3OA 1RWPB 4A46A 1ZETA 1HBOA 3ZZ0A 1BQXA 4R25A 5C42B 4ZN3A 5HK4A 1FWPA 1ZAWA 4KHPF 4IG3B 4KAIA 4HVZA 4I2PA 1X7VA 3LALA 2C2NA 5JJBA 3BO2A 4E2FB 2MZRA 1RTDB 3D6HB 4DQRA 3E01B 3NWGA 2WAQD 3KNGA 3T19A 1RDRA 4UOCA 3D3CJ 3CNQP 2BJDA 2UP1A 3M8QB 1FESA 1WOPA 2ILZA 2DHHA 3CMAS 1JLQA 4L76A 2HFNA 2IDLA 1PJ6A 1VS3A 4UW2A 2AU0A 2YH1A 1WEYA 2MDAA 4A8KA 2LU2A 3QZ7A 3DRRA 5GADI 3CB4A 4ERDA 2K8GA 1IKVA 4DV0J 4KH1B 1R6YA 2BEFA 3N28A 1N34F 2MQNA 1EZZB 1KKHA 2HIQA 2YX7A 3JSMB 2VQEF 1Q0NA 1O8BA 1YHQS 2WOMA 4L3KA 2EK6A 2GX8A 3EXYA 2VQFJ 4M94A 2L9NA 4QR0A 3D1OA 1CULB 1KHWA 3HD1A 3CVKA 4UUWA 1DQAA 3HFVA 4FF1A 3KFWX 4IH7A 3HDSA 2B6AA 3CEDA 3R5DA 1ROFA 2G1DA 1HNVA 1S4EA 3HFZB 4IUFA 2OGUA 1RGVA 4L74A 4TKTA 3E2EA 2DXEA 2G2OA 4ID5B 4OI1A 1U09A 2RF2A 1DY3A 1GMUA 3H40A 4ED5A 4HLBA 1MW7A 2HGLA 1TK0A 3G96A 1N5QA 2VC1A 1U8WA 1XJWB 3T5KA 2MKSA 4X4QA 3KG1A 2MKCA 4ZJLA 3HO1A 4YDDB 3JYTA 3K8WA 3MCNA 3CF5Q 3FBFA 5GAGI 2DR5A 3RJMB 2RJZA 3HKZD 4IRKA 2V34A 2ZVIA 1YITS 2D1CA 5L38A 2MTLA 2GO8A 1A6LA 1Q78A 4U95A 4ECSA 5M2RA 1U6ZA 4RNHA 3DRSB 2Z8QA 1CG2A 3TYTA 2XS5A 1Z2LA 2E1MC 2C2OB 2ZOMA 4JBCA 4F3QA 4RX6A 4DX8H 1TL7B 3BPSP 2YWKA 2JX2A 3D1QA 4RNFA 4ID8A 2LQ5A 1NJZA 5JXSA 4GKJF 1VC6A 2N7YA 1QD1A 1U0HB 4JI8J 1MLAA 4P73A 4F3MA 1KD1T 2W9CA 5E2QA 3HHLA 4RW6B 3RU0A 1VBYA 4BLGA 3OUYB 3LANA 4JV1A 2IPOB 4K50A 3NBPA 2QLBB 3G8TA 5D0GA 3NRBA 1X5PA 1MMDA 4Y0FA 4DL3A 5M2UA 1S4FA 1Y5LB 4J9LA 1R27B 2B56A 2XULA 2RNEA 2M8DB 1LWXA 2Y8YA 2JWNA 4JI2F 4J9UE 3OT9A 2KG1A 4XK8C 5IQQA 2FHJA 4A8QA 4CRJA 2GVDA 2ZZMA 3K2YA 4Z37A 4P2XA 3Q22A 3M9OB 4L73A 4Z7CA 3M30B 1U1LA 3MD3A 3ULHA 1T95A 1PILA 3K17A 4URQU 4GC7A 2XLJA 1CJUA 1JLGB 4OZ5A 4KHMA 5A8RA 3L09A 2EVZA 2QRRA 1G3OA 4ZVOB 4KO0B 2QX0A 2OPSA 2OEKA 3BGOP 3I5CA 4A47A 3PG9A 1VHFA 4QWDA 1UEKA 3IWNC 5EWEA 1H2VZ 5C7PA 2B4OA 1HHSA 3MPVA 2OPQA 2QA4S 2KO1A 1XWLA 3JTNA 2XMKA 3H42A 2R2SA 4B02A 2Y1JA 2IBKA 2NZ4A 4OYMA 4LF2A 1WG5A 3PO5A 5D4LA 3VWSA 2YWFA 4LSZB 5L1KA 3GIMA 5KFBA 3MM6A 2ZHOA 4X62F 2DHAA 4CM2A 1P27B 4EGLA 5DDOC 4QU6A 5KG4A 2HHHF 2Q1LA 1HWUA 4K2JA 3U02A 4DR1F 3MM7B 2D69A 1Q8KA 1VQPS 2FHMA 3IN5A 3V6DA 4PPZA 1NB7A 2WVBA 5THWA 1Z4UA 4W92B 2GC8A 1OPIA 2RDDA 4OJ3A 3PFOA 1VLOA 3MWBA 3DU5A 4N8OA 3EGVA 1NJIT 2MB0B 1VRTA 4KFBB 1N34J 4NASA 4UQGA 2BM1A 4XPCA 3HFKA 1HQUB 2VQEJ 3BZQA 4WFXA 1U45A 2M9KA 3DHWC 4I6YA 2IVYA 1GK8A 3EE3A 4DR4J 3PHTA 2H51B 2CADA 4RW7B 3H2UB 3D5MA 1TVRA 3ZZUA 3KKFA 2R2RA 1FERA 1JLFB 2XTJP 3QSIA 2NLWA 5A2QU 4NMLA 2KHDA 2F1FA 3B82A 1CVJA 1GT8A 3MM9A 3M8PB 3VVTA 3QIPB 4U8YA 2DRBA 1NDPA 4QIVA 3UR0A 3CULA 5SUHA 3EPIA 3FK4A 2KVIA 2Y0BB 3ENAA 3IM8A 1WF2A 1AT1B 4AT1B 4MKYA 1QSSA 4LBPA 1RACB 4Y28C 2IA0A 2MYFA 1NZAA 4NMXA 2WVFA 4K4VA 1S48A 4Y00A 2FJEB 3NS7B 5F8IA 3DM2A 1FTRA 1HWJA 4B9TA 1ZH5A 4OX7A 3LP0A 2BW2A 1OQ3A 4USKA 2DR7A 3QAEA 2BMBA 4AXIA 1NK7A 3T6JA 5IM0A 3CCJS 3GV7B 1UA1A 4JV5F 2ZC3A 3DDNA 5AE1A 2YNIB 3W2VB 3QT8A 3Q8RB 3EYZA 1ZBTA 2IRXA 1RWNB 4GKJJ 4TY8B 4C11A 3GU0A 2CJYB 3DLJA 3BV8A 2Q6CA 5KFLA 2XWXA 1QUPA 2J76E 3M4XA 3MMAA 4ZP9A 1FRMA 3AQPA 2YTCA 4MMOA 1BUXA 4ICLB 4QYRA 2DGTA 2HGNA 4LF9F 3QGPA 4I2QB 2COLA 1L3VA 5IT9U 4LJMA 4EWTA 2VJUA 4NA2A 2QA1A 2W8KA 4M5JA 2OMLA 5HJYA 1UW9A 3A1YG 1RT1A 1VRUB 3DLKB 4JI2J 5L46A 1U2CA 4Q8EA 3D1HA 3AH6A 1REGX 2J6TA 4J9PA 3DOMA 2KFZA 3LP2A 4IDKA 4NEZA 4RL1A 3QFHA 1F1BB 4EBEA 1F0XA 3ZTOA 1KRPA 1F60B 2IM3A 3CCRS 5FIIA 1RAHB 5F3TA 2VJVA 3ET6B 2J7WA 1T9XA 4R0JA 3MEDA 3BBBA 4C98A 3W2WB 3K0JA 1HHTP 3RZAA 2A10A 2WCXA 1ZPVA 2BJ8A 2ZUGA 3I82A 2OMOA 4DSLA 3CIMA 1K8AT 2DB1A 4G1PA 3V6JA 4HACA 3QRPA 4N76A 3H90A 4N5SA 1JMTA 4ES2A 3R8YA 3NKYA 1L3KA 1FK9B 2MHEA 4TXSA 4ETXA 2BKPA 1VFJA 2OPRA 4IOCQ 3BKUA 2ASDA 4F4XA 3RR8A 1YRUA 4CO3A 4DWIA 4C8OA 3OTBA 1ZA2B 3I0RA 1EAYC 4X62J 4EBDA 2GHPA 4C3MA 4HHJA 1W25A 2QE5A 3UCGA 5KTQA 2AD9A 3V4MA 2E1RA 2HKEA 4DLEA 2HHHJ 3OHBA 4MT1A 2X1FA 1SUQA 4Y34A 2FJAB 2F5GA 4DR1J 4JYAF 2W7OA 1VBZA 4N8NA 4K4SA 3G82B 5MAOA 1TMJA 5KFJA 3PYDA 4JI4J 2BJEA 2BABA 5DETA 1G1XA 4IR9A 5DO2A 1JLAA 2C2RA 4JUZA 1TKXA 3G6VA 2HQDA 4NLXA 5D4OA 4W90B 4WIQA 2AIRB 1MU2A 3HVAA 3TVKA 1SJ3P 5L9XA 2XZTB 3C66A 4H4KC 3TRGA 2EEYA 4PG4A 4YR0A 2PMHA 2V4JB 1Q1KA 5KT6A 1LXJA 3Q2TC 1TFYA 1FXLA 3OFGA 4P72A 5D0EA 2BACA 4LBIA 3KLVA 4CLYA 4LRDA 3WDOA 4CLKA 3W8PA 2B9WA 4NLTA 2XLKA 3GYGA 3FEYB 2AWZA 4WE1B 2HWHA 1CC8A 1YG0A 2VBXA 2ZH8A 3C16A 1KLNA 3ITHB 1X4AA 4I68A 4Y65A 5IC6B 3GYNA 1RHMB 4HT7A 4ZVGA 2GHVC 4R8UB 3VVUA 4ZLLA 1D8ZA 2J8AA 3PX6A 2BOAA 2AEMA 4J9KA 4X4VA 1J27A 3WIUA 2B4UA 5BXIA 3MAAA 4U7UD 3OTOF 1HPZB 2XWYA 5D3GB 2XO7A 3I5BA 4PUOB 3Q23A 5CYQA 5KT3A 4DV1F 2W9BB 2NXCA 4R5PB 1UJ5A 4YEAA 4JI0F 4RW8B 4YHHF 2Y9HA 4QWAA 1X8DA 2GAGC 2VUGA 3IRXA 1UWAA 2JLFA 3JS9A 5LSLA 1RLDA 2OI2A 4JV5J 2W8LA 2I38A 4USMA 1SKUB 3RRHA 2FVQA 1S1UB 2W4DA 2HBQB 2YX4A 1RBOB 2CVEA 3EJMA 2OTJS 1K0TA 4YR2A 1RT2A 1RAGB 1RA6A 4ZVTB 2FUG9 2CNNB 1SJFA 5CYMA 3UO0A 1S1VB 5F3ZA 4N7TA 1HI0P 3OL6A 1T3NA 1T9YA 4FYXB 1ZPWX 3J80Y 4KIAA 3T9ZA 4FBUA 4ZJOA 2L41A 1F9EB 3QWPA 4UOGA 5HSPA 2DGQA 4NI2B 4LF9J 5DGAA 4FXDA 4NLVA 1BQMB 5ADZA 5BYSA 3CW2C 1ZM3A 3U7JA 4AL6A 1NRKA 5A76A 1R0BG 5J2QA 4C9DA 4OX9F 2YWGA 3D6TB 3W8GA 2MZJA 4NLWA 2DGUA 5CQGA 3SZ2A 1XMBA 2DNGA 2FGCA 4WKYA 4FZVA 3UN3A 4ZPBA 4GMKA 2JJ4D 1FX4A 2HPUA 3LPEA 4WCEQ 3RB0A 3FEZA 1HIYA 3EZOA 1EX8A 1OMSA 2ZOGA 2PI5A 5J2MA 3KWMA 1SL1A 1RTJA 5LXRA 3UDVA 4QIWD 3LTOA 2W2PP 2JH3A 2V2QA 5KFPA 4C8ZA 2CFXA 4IG0B 3MMBB 5IT4A 2BBEA 3GB0A 2K2PA 2BANA 1Y5NB 2OAUA 2OLWA 3EVWA
chains in the Genus database with same CATH topology
4HHUA 5BR8J 1HNXJ 1N32J 1XMQJ 4DV1J 3J81U 4NXMJ 4K0KJ 4LF9J 1IBMJ 3J7AN 4LF7J 2UUCJ 2UXBJ 4JI3J 4JI0J 4NEYA 4JI4J 3R2CJ 4YHHJ 2MEWA 5FLXU 2UU9J 1N33J 1IBLJ 4NXNJ 2F4VJ 4JI8J 4DR3J 1IBKJ 3D3CJ 1XNQJ 4V1Ak 4X64J 5LMUJ 5AJ3J 4LF8J 4DV4J 5IT9U 5IWAJ 5LMNJ 2UUAJ 4DR5J 3D3BJ 4DV7J 4DR6J 4JI1J 2E5LJ 4DUZJ 1HR0J 4KYZA 1N34J 4DUYJ 3J80U 4JI6J 4LF5J 4LF6J 4GKKJ 2VQEJ 3T1HJ 4KHPJ 2UUBJ 4LFBJ 4X65J 4DV3J 3W1YC 1N36J 4JV5J 4JI2J 2ZM6J 4DV0J 4JI5J 4B3TJ 2KVQE 4DR4J 1I94J 1XNRJ 4DV6J 4X62J 4B3RJ 2KL8A 1J5EJ 4JYAJ 5LM7E 4LF4J 4AQYJ 2MTLA 4YY3J 5A2QU 4B3SJ 1HNWJ 4DR7J 3IMQJ 2VQFJ 2HHHJ 4B3MJ 4NEZA 4OX9J 4PWWA 1HNZJ 4KY3A 4DR2J 4X66J 2MQ8A 3R2DJ 4DR1J 3T1YJ 4DV5J 4GKJJ 4LFCJ 1FJGJ 2UXCJ 4RJVA 3OTOJ 1XMOJ 4JI7J 3JAMU 4DV2J 2UXDJ 4LFAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HHU A;  5BR8 J;  1HNX J;  1N32 J;  1XMQ J;  4DV1 J;  3J81 U;  4NXM J;  4K0K J;  4LF9 J;  1IBM J;  3J7A N;  4LF7 J;  2UUC J;  2UXB J;  4JI3 J;  4JI0 J;  4NEY A;  4JI4 J;  3R2C J;  4YHH J;  2MEW A;  5FLX U;  2UU9 J;  1N33 J;  1IBL J;  4NXN J;  2F4V J;  4JI8 J;  4DR3 J;  1IBK J;  3D3C J;  1XNQ J;  4V1A k;  4X64 J;  5LMU J;  5AJ3 J;  4LF8 J;  4DV4 J;  5IT9 U;  5IWA J;  5LMN J;  2UUA J;  4DR5 J;  3D3B J;  4DV7 J;  4DR6 J;  4JI1 J;  2E5L J;  4DUZ J;  1HR0 J;  4KYZ A;  1N34 J;  4DUY J;  3J80 U;  4JI6 J;  4LF5 J;  4LF6 J;  4GKK J;  2VQE J;  3T1H J;  4KHP J;  2UUB J;  4LFB J;  4X65 J;  4DV3 J;  3W1Y C;  1N36 J;  4JV5 J;  4JI2 J;  2ZM6 J;  4DV0 J;  4JI5 J;  4B3T J;  2KVQ E;  4DR4 J;  1I94 J;  1XNR J;  4DV6 J;  4X62 J;  4B3R J;  2KL8 A;  1J5E J;  4JYA J;  5LM7 E;  4LF4 J;  4AQY J;  2MTL A;  4YY3 J;  5A2Q U;  4B3S J;  1HNW J;  4DR7 J;  3IMQ J;  2VQF J;  2HHH J;  4B3M J;  4NEZ A;  4OX9 J;  4PWW A;  1HNZ J;  4KY3 A;  4DR2 J;  4X66 J;  2MQ8 A;  3R2D J;  4DR1 J;  3T1Y J;  4DV5 J;  4GKJ J;  4LFC J;  1FJG J;  2UXC J;  4RJV A;  3OTO J;  1XMO J;  4JI7 J;  3JAM U;  4DV2 J;  2UXD J;  4LFA J; 
#chains in the Genus database with same CATH topology
 4A8W A;  4ZP8 A;  3B6B A;  4IFV B;  4O3P A;  1NDK A;  2QJ3 A;  5A6W A;  4UY8 5;  4CTA B;  1FDD A;  4S0M A;  1N0V C;  3SSS A;  3BYP A;  1NH7 A;  1NSP A;  3KHG A;  3OL8 A;  4CO2 A;  2WZ1 A;  2Y1L B;  2QEX S;  4RNM A;  4LUB A;  2L3M A;  3NNC A;  2YH0 A;  2CPJ A;  4AUK A;  3M8S A;  3GIL A;  1VIX A;  1H38 A;  1ZTT A;  1C4C A;  3PKY A;  1TKZ A;  5K14 A;  3CD6 S;  3GR0 A;  4DL4 A;  4JI1 F;  5A8W B;  2W25 A;  2I9S A;  3MMC A;  4WP3 A;  1RT6 A;  3R1L A;  5DDR C;  3G6E S;  5ETR A;  1RBL A;  3EPG A;  1M1G A;  4NLG A;  4DPW A;  3ZZY A;  4B3R J;  4JYA J;  2KRB A;  3C6U A;  2DH9 A;  3J7Y U;  3H5X A;  4Q8F A;  2HS3 A;  2NQP A;  2VL1 A;  3M1V A;  3FMW A;  1VQL S;  4O4G B;  2HAF A;  4DG1 B;  3RBE A;  1BHN A;  3R5B A;  3KJV B;  2RVJ A;  2OTL S;  1SQG A;  3LUY A;  1X4E A;  3DYA B;  3K59 A;  3MTJ A;  1HW8 A;  2GS8 A;  4MYU A;  4DL6 A;  2G0J A;  1HW9 A;  1F9F A;  3PO4 A;  4U96 A;  2LQB A;  3M2U A;  3R2C J;  3FCH A;  1TK5 A;  5HLF A;  1TL5 A;  5B0A A;  3GSI A;  3MEE B;  1SI9 A;  4HI2 A;  5K20 B;  1OJ4 A;  1R0C B;  4V19 X;  1WHY A;  1VC5 A;  1RTZ A;  2Z4P A;  2FB0 A;  1O0P A;  3IBW A;  1KOO A;  4BHQ A;  2HQG A;  1AB8 A;  2CQ1 A;  2UXB F;  2DH7 A;  1R0A A;  1RWU A;  1VQN S;  2XNQ A;  2ALY B;  1TR0 A;  3TO8 A;  3KUG A;  6AT1 B;  3F0N A;  4X65 F;  3CCE S;  2Z0G A;  4J7C A;  4F25 A;  4ZS6 A;  1U1R A;  1VQS A;  1LFP A;  3M32 A;  4C8L A;  1E6V A;  3AJ1 A;  1TUV A;  3BGR A;  2POK A;  2NRE A;  2VPW B;  3JTP A;  3G8Q A;  1MWZ A;  1LK7 A;  4NA3 A;  3OTO J;  1Y0H A;  4ZIV A;  2WON A;  4NA1 A;  4P75 A;  4DV1 J;  1B4S A;  1VBK A;  3GQC A;  5KG6 A;  1WSV A;  4JI0 J;  4MJK A;  1YDL A;  4DSF A;  1LW0 B;  4YHH J;  5EX0 A;  1VOM A;  3R5C A;  4OI6 A;  3OL7 A;  2VC0 A;  4ZVP B;  3GCX P;  1S1W B;  2LU1 A;  3EWG A;  4OJ1 A;  3SSR A;  3L4B C;  2P6T A;  4HI1 A;  1IBL F;  4OZ1 A;  4LSN A;  5DRK A;  3KMS A;  4AL5 A;  1LXN A;  1ULR A;  2GVZ B;  3MHY A;  1TKD A;  3EGZ A;  3QJL A;  1JQG A;  3CO9 A;  4ZVF A;  3IG1 A;  4DR5 F;  3CJK B;  1Y9O A;  1BD6 A;  3SCJ E;  3EUN A;  3FRZ A;  1YIJ S;  2A6O A;  2H48 B;  2KJV A;  3HHL C;  3EXC X;  1RBA A;  4DV3 F;  2AV5 A;  1NSQ A;  4X4S A;  1TKT B;  1KTV A;  2MHN A;  1YX2 A;  5CCM A;  2LLZ A;  1GXL A;  1X4G A;  1JJ4 A;  2GIF A;  1YQH A;  3NMR A;  4B3S F;  2L08 A;  1S49 A;  3MM5 B;  3SI8 A;  3Q86 A;  1PC5 A;  5CAA A;  3TUP A;  1S5Z A;  1RAI B;  1EP4 B;  1UCN A;  5T7L A;  2RH3 A;  4DFK A;  3HF5 A;  4OMF G;  2CZ4 A;  1RKJ A;  6FDR A;  3V81 A;  4OYB A;  1YJN S;  5FDL B;  3KK2 B;  2WSF C;  5DZ6 A;  1KEK A;  2SXL A;  3HSD A;  2CXE A;  3VGV A;  3MR3 A;  3QO9 A;  3HHE A;  5SZT A;  2HGM A;  3ADA C;  1CJT A;  1IKX A;  1T0T V;  1SV5 A;  4I2P B;  2CQ2 A;  2DNP A;  4HDG A;  4EYI B;  4PCQ A;  2DNK A;  4DR6 F;  2C3U A;  1DJ0 A;  3ISN C;  5H9F K;  2HS4 A;  4DUY F;  3Q83 A;  4UOH A;  4QQB A;  2KM8 C;  1ZM4 A;  1YKW A;  2UV8 A;  1TL3 B;  2FQQ B;  2MLZ A;  4BWJ A;  5CZV A;  3H4B A;  1JLQ B;  3BM7 A;  1WHX A;  1LWE A;  4H4M A;  3KK1 B;  1KWM A;  3H7H B;  4IFY B;  2ZC4 A;  3OR2 A;  4ES1 A;  4PWU A;  1VQ8 S;  5E3C A;  4LSL B;  3DRR B;  2OPP A;  1HNZ F;  1SVD A;  1ZM9 A;  4LIR A;  2ZH7 A;  3NAH A;  1S9G A;  4M5D A;  1YBU A;  4B9N A;  1URN A;  2ZZN A;  2HLT A;  2ACY A;  5IV4 A;  1G2E A;  2KYZ A;  2XSJ B;  4K2X A;  3TEG A;  4LFA F;  2DY9 A;  3TAQ A;  1HNX F;  2WOM B;  1RE1 B;  2MGZ B;  2YXL A;  4RU2 A;  4WWS A;  3ENV A;  2IA6 A;  4JI1 J;  2DH8 A;  1SBR A;  3DMJ A;  3TQ1 A;  2RAQ A;  3R97 A;  3PAC A;  2E1P A;  5KFV A;  2MQL A;  3FZB A;  4L3N A;  3H2L A;  2DXF A;  2VPZ B;  3ICL A;  2B6A B;  1N5T A;  3UD3 P;  1X9W A;  2I6W A;  1NME B;  1HNV B;  5LSR A;  3CJS A;  1RT3 A;  2HFV A;  3FCV A;  3L7U A;  4ZCM A;  1Q95 G;  1WG4 A;  2CPE A;  5GAE I;  2DKO B;  5KFH A;  3P5T L;  3V6H A;  4FN5 A;  4PXC A;  4WII A;  4HHH A;  1SIZ A;  1VLY A;  5C5J A;  4CM0 A;  4LR9 A;  5HRO A;  5EWG A;  4LFC F;  3JYT B;  3THT A;  2EKN A;  4I1T A;  3EMT A;  1KSP A;  2FJB B;  3D4J A;  2C1E B;  1RAD B;  2UU9 F;  1TFW A;  3KLG B;  2C2D A;  2D3O R;  5KFR A;  1F6T A;  3HPO A;  1LFW A;  4WFY A;  2IM0 A;  4X65 J;  4WYL A;  3CJ2 A;  2FIU A;  2FJX A;  4NLS A;  2KZM A;  1D9A A;  2DNN A;  1RTI A;  4Z2X A;  3IS9 A;  3PRB A;  1JKH A;  2ZVS A;  4QOT A;  3CCQ S;  4ELU A;  2D9O A;  3W61 A;  3MPY A;  1IWG A;  4YY3 J;  4K4Z A;  3HHL B;  1Y00 A;  4FVM A;  4D3H A;  4PWD B;  3QWU A;  3OQ2 A;  4KY3 A;  1K9M T;  3CJ0 A;  2MQO A;  3NBP B;  3F56 A;  1EB0 A;  2YPY A;  5CAB A;  3OLA A;  2E9R X;  2EFV A;  4A8M P;  3I56 S;  4NX9 A;  4WK3 A;  1O5J A;  1N5S A;  3OVS A;  4P2S A;  2E66 A;  2NUH A;  3P96 A;  2C3Y A;  2I5J A;  4ZPC A;  4F2R A;  1G4C A;  2DNY A;  3O1L A;  2CUY A;  1IBL J;  2CPD A;  4DCP B;  3UWT A;  3PVX A;  2O3D A;  5GVQ A;  3N5F A;  5DS7 A;  4DPY A;  1ARO P;  1REV A;  2CJA A;  4Q43 A;  4DL5 A;  4DR5 J;  3IO1 A;  1WF1 A;  4PQA A;  3ZXW A;  1WC3 A;  5DQH A;  3IRW P;  4KJI A;  1P1T A;  2HNY B;  2OEM A;  4MKB A;  1XNQ F;  2JOQ A;  1T3O A;  2FLL A;  3KG4 A;  3E3X A;  4DV3 J;  3N6L A;  1R8C A;  3MPD A;  1UET A;  2GML A;  2BJ7 A;  5ETM A;  2HIY A;  5KFK A;  4CO1 A;  3TAN A;  2JZ5 A;  2CQ4 A;  3SFU A;  4LRE A;  4PR6 A;  3HX9 A;  3RUB L;  3TZX A;  2UUB F;  5A8R B;  2YBV A;  4B3S J;  1HYS A;  3OSP A;  3ELH A;  1ZTW A;  4EZ9 A;  1ACM B;  2DGX A;  2OPS B;  3MFH A;  1EET A;  5L8R C;  3WQP A;  3GZ7 A;  5I3U B;  3NGR A;  3BPD A;  3V2U C;  1XR5 A;  2EW9 A;  1PYO B;  4DR7 F;  1WC6 A;  2KXH A;  3GWC A;  2ZNZ A;  1KOH A;  2JLE A;  4LVN P;  4OYZ A;  3OFH A;  1LEO A;  1TU0 B;  2R4F A;  2QL7 B;  1PYT A;  1MN7 A;  2F4F A;  1V3R A;  2ZBI A;  1U02 A;  2E1C A;  1FKA F;  4B3O A;  1FDA A;  3W64 A;  4DR6 J;  3MM6 B;  4LBH A;  4ECU A;  1FKP A;  3NGD A;  4DUY J;  3I4P A;  3SEO A;  3RB3 A;  1LOU A;  2VPY B;  1PAU B;  2QMU B;  4K7Q A;  2R7V A;  1ZYQ A;  1UA0 A;  4OYX A;  4AXJ A;  1A7G E;  2CNO B;  2W7A A;  1NHU A;  3L95 X;  3V6D B;  3R6G B;  2CQB A;  1U24 A;  7FDR A;  4YB6 A;  1AZS B;  1XC9 A;  4DSK A;  1DTT A;  3BH7 B;  4OHZ A;  5DLF A;  1HNZ J;  2MY8 A;  5DLG A;  3CD7 A;  2APO A;  2HND A;  1VRT B;  4DV5 J;  1GFW B;  2V8D A;  5C2G A;  4KGX B;  3JQM A;  4LFA J;  4E98 A;  3GLJ A;  1HNX J;  4O23 A;  3TAP A;  2BR0 A;  1L3T A;  4KV8 A;  4KBI A;  3OV7 A;  2MJU A;  3HHN B;  2D9P A;  2O1P A;  4A8X A;  3VCD A;  2A1B A;  4NRT A;  2ZH4 A;  1RLC L;  3UN2 A;  1C0U A;  3CCV S;  4TU9 A;  2MKI A;  3KHL A;  4M5L A;  2MKJ A;  1FKO B;  3TZY A;  3J7A 1;  2K1R A;  1HBN B;  4B9M A;  1FA0 A;  1RT4 A;  1VQ9 S;  4AND A;  4CLW A;  2G9O A;  3BRE A;  1GX5 A;  1PBU A;  4PQU A;  1KQK A;  1VQM S;  1N54 B;  1ZZN A;  4LRA A;  2J0X A;  1B99 A;  2XLI A;  5AT1 B;  4ZVS B;  3U1L A;  1WHW A;  4ZPD A;  1TMM A;  3CJT A;  1T7P A;  1WTF A;  3GFX A;  1T03 A;  3MZI A;  1JLE A;  4FF2 A;  3N79 A;  1CPZ A;  3W3S A;  2N7C A;  2YKN B;  3M2R B;  4WP9 A;  4QPT A;  3DM2 B;  1RKI A;  4LFC J;  5CH7 B;  2J9C A;  5KG2 A;  3L3C A;  2DEJ A;  4DX5 A;  1NHK L;  3ENW A;  3EM1 A;  3KK3 B;  1N5Y B;  1YVF A;  3H98 A;  1RYS A;  3T3F A;  3DC2 A;  3DRY A;  1SJ4 P;  2UU9 J;  3CDA A;  2CYY A;  1U1O A;  4DV2 F;  1ZS6 A;  2E44 A;  2M52 A;  4ZHR A;  3Q89 A;  2ZE2 A;  1DHM A;  1VCT A;  4K4U A;  4NLU A;  1H98 A;  3VZH A;  1N48 A;  4M1K A;  1CJV A;  4C11 B;  3NXZ A;  2HQF A;  3J80 U;  1FNX H;  1NND A;  1Y7P A;  4IR1 A;  2IAJ A;  2F63 A;  3CWJ A;  3NNA A;  1NK5 A;  5MLC V;  3DLG A;  2KZZ A;  3MMA B;  1B0P A;  4ZK7 M;  3OL9 A;  3AOD A;  2PII A;  2MQM A;  1I1G A;  5LT5 A;  1BWV A;  4PYD A;  1KQS R;  3ENQ A;  2ZDP A;  3UCZ P;  4DV4 F;  3D6F B;  3DLL Q;  3NCQ A;  2CNK B;  2XMM A;  4DF8 A;  1GMV A;  3R5G A;  1KDN A;  1LW2 B;  1HFE L;  5DJB A;  4DMZ A;  3OJU A;  3QBC A;  4F26 A;  1HNW F;  1NBE B;  3FMB A;  3UFC X;  2MQP A;  5KFG A;  1NU4 A;  4ECT A;  1YJR A;  2KH9 A;  2BQ3 A;  1Q53 A;  2X1B A;  3DOM B;  1XMQ F;  1XNQ J;  5HN0 A;  2KKH A;  3IC1 A;  3UVJ A;  2I1R A;  4TYB A;  1UWB A;  3RB4 A;  3RBX A;  3CT9 A;  2WVC A;  5M2P A;  2NSB A;  4CH7 A;  2XI2 A;  2UUB J;  4CYU B;  1S57 A;  1X9S A;  2W4C A;  5FD1 A;  4DL7 A;  5D77 A;  3OSN A;  2J9D A;  4NL5 A;  2RD5 C;  2G4B A;  3IWX A;  4MKV A;  2F8H A;  4DQQ A;  1YJW S;  4ANC A;  3KNA A;  3DKD A;  2CJB A;  2O66 A;  1NPP A;  4DR7 J;  3B4M A;  4USW A;  3H59 A;  4DSE A;  3FC9 A;  1U8S A;  2ATC B;  2HVH A;  3VZI A;  4IOA Q;  1C1C A;  1K1S A;  3W60 A;  2KXF A;  4ED3 A;  1D9F A;  1XK8 A;  3QGG A;  4Q45 A;  4EFA C;  3EIC A;  1WHV A;  2C3P A;  2JRS A;  4G3I A;  2HHT A;  1WWH A;  1UPP A;  1S0M A;  3D0G E;  2BUN A;  4NXN J;  4EU0 A;  3P3D A;  2GO9 A;  4FBT A;  1VQ6 S;  3VGS A;  1X4F A;  3PRV A;  3DGV A;  1IXK A;  2CPY A;  1R6V A;  5KG5 A;  1SUQ B;  2RS8 A;  5ETS A;  1A9N B;  2YWE A;  4TY9 A;  1FEH A;  2CJX B;  2VFR A;  5LMU F;  1TL1 A;  2J7K A;  3SQG B;  4F0H A;  4DX7 A;  3OLB A;  4OHV A;  3C14 B;  3MGJ A;  3S6E A;  1GMW D;  5LJ3 Y;  1IUJ A;  2M8H A;  4ED6 A;  2PN6 A;  1G7C B;  3TA0 A;  3AAW B;  1JLA B;  4RBT A;  4MH8 A;  1TKX B;  2YQ3 A;  4USU A;  3PDN A;  3BKT A;  1MU2 B;  1W2B R;  2MJN A;  1RTD A;  3BBC A;  2HWT A;  3PNI A;  3E01 A;  1R3N A;  5E7O B;  2OO4 A;  7AT1 B;  5L1L A;  3GSD A;  1S10 A;  5KT5 A;  4ECV A;  1FXD A;  4CH1 A;  3M8Q A;  2UUC J;  2AQ4 A;  2VDI A;  2D3O 1;  1JLC A;  4ZVE A;  1IKW B;  2PO4 A;  1WC0 A;  2DPI A;  2X3D A;  4RWW A;  3UDL A;  3BS9 A;  2M5Y A;  1HA1 A;  4F4Z A;  3PJW A;  4DHV A;  4M5G A;  3NCR A;  3QT5 A;  4ZVR B;  3I6P A;  1VIS A;  1D0E A;  1KLM A;  4GVB A;  4URG A;  3R6L B;  1S6U A;  2RQK A;  4QJV A;  1T05 B;  2V9K A;  1T8E A;  5AJ3 F;  3JSM A;  2RHS B;  2XYP B;  4OLP A;  2E5L F;  3MAA B;  2KFY A;  3HSZ A;  5J1P A;  1Q7Y T;  2RML A;  1OYD A;  1RWV B;  4AL7 A;  4ED0 A;  1FD2 A;  3CC4 S;  2HUR A;  1CUL A;  5CYQ B;  5LM7 E;  2YKM B;  3TWZ A;  4OJG A;  2V4R A;  1QTN B;  2KG0 A;  4JI5 F;  3PR4 A;  2ZBC A;  5FJ4 A;  2P8I A;  1NO8 A;  4F04 B;  4NOH A;  4E8U A;  4O3R A;  1GTE A;  4ZPW R;  5D6G A;  4ZN1 A;  3IRX B;  1U2F A;  4KKO A;  4AQY F;  4FF4 A;  4DV2 J;  2M2B A;  4CZC A;  1SPB P;  5DG7 A;  3C3L A;  1X0P A;  2F8M A;  2CA9 A;  1NJX A;  5JMN A;  2UXC F;  1S6Q A;  2QZ8 A;  2X1G A;  4TQS A;  3LA0 A;  4FNI A;  1V6H A;  4RNN A;  2XI3 A;  4LF7 F;  4IRC A;  4JI3 F;  3CJQ A;  5LL6 d;  5HAN A;  5GAD U;  1WC1 A;  2L9W A;  2BE2 B;  3GIJ A;  1AUS L;  3DU6 A;  4ELV A;  4I6A A;  1LQ9 A;  2U1A A;  4RW4 B;  4YR3 A;  2Y0S D;  4XPE A;  3ZNU A;  3PW0 A;  2QSW A;  4YFU A;  4B3T J;  3KG0 A;  2DR6 A;  1RXO B;  2K3I A;  4FS1 A;  3DRS A;  5J2Q B;  4GO7 X;  2DHG A;  5J2P B;  2VF3 A;  4CNY A;  1SCJ B;  2MZ1 A;  4C0O C;  1Q4R A;  3I9V 9;  3A8J A;  1HNW J;  3N4W A;  5IS2 A;  2J0W A;  2B5J A;  1QAI A;  5B0D A;  1TQL A;  1SB6 A;  1KFS A;  2RRN A;  3UNG C;  5I42 A;  2HZA A;  2W2M P;  1KQG B;  1XMQ J;  4KGK A;  1Y4Z B;  5F8L A;  1B64 A;  1UFL A;  1FXR A;  3OUY A;  2OH2 A;  2MEW A;  7FD1 A;  4PG5 A;  4ZVH A;  2B7C B;  4NXM F;  2ASY A;  4C2M A;  2BE9 B;  2ZIT A;  4PG7 A;  1JXE A;  1TUW A;  2HW3 A;  2NXN A;  4Y2K A;  1JJH A;  2CAJ A;  2ZFH A;  3J81 j;  2B4P A;  1GTH A;  5LXY A;  4F3O A;  3VAL A;  4I69 A;  3GPA A;  3T6B A;  4OI3 A;  4RKU C;  3M6W A;  2CJ9 A;  2RDI A;  3VF0 B;  3HVW A;  2P5V A;  5GAG U;  1H7W A;  3HSJ A;  1WKK A;  3M9N B;  3R3T A;  5L1J A;  2J9E A;  4MFB B;  2G0I A;  4CNZ A;  1NDL A;  3CMQ A;  2BRL A;  2LDI A;  1NJW A;  3BQ1 A;  2HHX A;  3LGM A;  1J2V A;  2WSC C;  5B09 A;  2FY8 A;  2KYX A;  2HHP A;  4WPA A;  1Z1Z A;  5EHH A;  1F5C A;  4QW8 A;  4ZPV R;  1GEH A;  4DEZ A;  2QT7 A;  2XB2 D;  3KLF A;  2CPZ A;  2IM2 A;  1NLK L;  1TKZ B;  5K14 B;  5KFU A;  2A3J A;  1JLG A;  5F8G A;  4W98 A;  3MMC B;  1RT6 B;  2HWI A;  1KN6 A;  2DPJ A;  3DLH A;  5KFE A;  4Y2C A;  3C6U B;  1SQF A;  2Q3P A;  3MPU B;  5LMU J;  3DHX A;  4F02 A;  3DI6 B;  1WKL A;  4DS5 A;  1KTQ A;  2ZKU A;  2F4V F;  3OW2 R;  3MTK A;  3M9M B;  1M5H A;  5J1E A;  1HQE B;  2UVU A;  2V8G A;  1Q86 T;  5LJ5 Y;  2D3U A;  4MK9 A;  4NLY A;  5E3R A;  3M2U B;  1YWX A;  4LT6 A;  5HLF B;  2VG5 B;  3NS6 A;  2V67 A;  4MKA A;  3M7V A;  2JEF A;  5E33 A;  5B0E A;  4OL8 A;  2KU7 A;  4CO5 A;  2VHG A;  4L75 A;  1DQ9 A;  2OHD A;  1FTC A;  4RBV A;  2LQJ A;  2KJW A;  2E1A A;  3MM7 A;  3CGI A;  1C1B B;  3CPW R;  3OD2 A;  2ERR A;  2GFF A;  4OI4 A;  3H25 A;  4DFJ A;  4OFZ A;  2MMY A;  2YWH A;  2LQ8 A;  4C8N A;  4ZCI A;  2AHO B;  1XN9 A;  2R8G A;  1HD1 A;  3UD5 A;  2F65 A;  3LP1 B;  5JVH Q;  4ED1 A;  3EVM A;  4KFB A;  1N32 F;  3HLU A;  3BDE A;  5AJ3 J;  3M32 B;  5ITH A;  2HEK A;  1E6V B;  5EUH A;  3BGR B;  2FHK A;  2AEF A;  1ZM2 A;  1WF0 A;  4Q7A A;  2E5L J;  3KLE A;  1WUU A;  4DQP A;  2VFV A;  4RW7 A;  2M7S A;  4N47 A;  2XQC A;  1YJ9 S;  1B3T A;  2WON B;  4YME A;  1AYE A;  1QUV A;  3I31 A;  3T5L A;  5KFO A;  2H4Y B;  3CJ4 A;  2HK3 A;  3GJQ B;  4K8R A;  4JI5 J;  2B3T B;  1BQN B;  4WKR A;  2P9G A;  5DDP C;  1Z2Z A;  1VK3 A;  1WC4 A;  5A0Y A;  3MUM P;  3QIP A;  2AW0 A;  1KR4 A;  1H2T Z;  2ZH1 A;  2V8V A;  4FVC A;  4AQY J;  2EWH A;  3VTI A;  3W9I A;  1T9W A;  1M0S A;  1F2G A;  4LSN B;  1YZ7 A;  1XIQ A;  2UXC J;  4MYT A;  3BR8 A;  1RU1 A;  4ZOS A;  3K5L A;  1KVJ A;  4DX6 A;  3IG1 B;  5KAK A;  5DGB A;  1VYA A;  4LF7 J;  4JI3 J;  3CO0 P;  2ACM A;  2V69 A;  3X1L B;  3Q8Q B;  4OLO A;  2GAH C;  1WD6 A;  2AKW B;  2QG9 B;  4Y3C A;  3ZNJ 1;  3FFI B;  1RWK B;  1S0O A;  2ZNY A;  4WU2 A;  1OSD A;  5CD4 H;  3WIV A;  3LGH A;  1IBK F;  1RAB B;  2H1Y A;  2XGP A;  3US5 A;  3THP A;  5B0F A;  1VMB A;  3MR7 A;  1U0S A;  4OZ2 A;  4CWB A;  1HR0 F;  1I5O B;  2IC3 A;  2RS2 A;  2WW8 A;  5T7L B;  3IFE A;  2AP6 A;  2W7P A;  3T1A A;  2DHX A;  3V81 B;  3QMQ A;  1DZ5 A;  4M95 A;  4NLP A;  1NEE A;  1WOR A;  1YGY A;  2IFX A;  3OPK A;  2HG4 A;  5I3Q A;  3JSB A;  3QO9 B;  3VQT A;  2RUG A;  5J2N A;  4ZLP A;  1CJT B;  3EVO A;  1RHK B;  3Q8V A;  4GVL A;  1SV5 B;  3R5J B;  4G1Q A;  4NXM J;  3DGP A;  4OZJ A;  2P9E A;  3GYX B;  2AYG A;  1NUE A;  2XMU A;  4URS A;  1RK8 A;  2IYI A;  3Q24 A;  1Y10 A;  3PIO Q;  1XTZ A;  5E5N A;  4UST A;  1UEU A;  1X5O A;  4K4Y A;  2F9D A;  4RWX A;  1LWE B;  2YKA A;  5CD4 A;  2ZWO A;  3R27 A;  4O44 A;  2DGW A;  2HQ3 A;  2G13 A;  2UV8 G;  5LMN F;  3TJ8 A;  1FJ7 A;  1S9E A;  1FRL A;  4M5D B;  2BA9 A;  3IXQ A;  4OV1 A;  4QR2 A;  2PA3 A;  3K5N A;  2B43 A;  1P9Q C;  2DNL A;  3ET6 A;  4BC9 A;  2FGO A;  4TN2 A;  2G0C A;  1LWC A;  1U49 A;  1Q7L B;  4DN0 A;  1X60 A;  3DMJ B;  3GFH A;  3RB6 A;  2GIQ A;  3E8O A;  1R8H A;  1H7X A;  3JSR A;  1FWK A;  3AA9 A;  2CZ9 A;  2YWW A;  3LH2 S;  2RU3 A;  3GMG A;  3RTV A;  2BV3 A;  1EIY B;  1HWL A;  2R7S A;  2BRK A;  1RT3 B;  4XIU A;  2VG7 B;  1BXN A;  1W7W A;  5K5M A;  5K8O A;  2F4V J;  3HVT B;  1FK9 A;  1BY9 A;  3EGN A;  3C6T A;  1EKS A;  1CS4 B;  3IBC B;  4X4O A;  3T41 A;  2V68 A;  2UVR A;  2B51 A;  4A8F A;  1LWF B;  2FDN A;  5IV3 A;  2YX1 A;  4LVO P;  1HNI B;  2OP5 A;  5IQ6 A;  5KFX A;  5K8N A;  2H65 B;  4KHP J;  4K59 A;  3K5P A;  4I0W A;  3MFI A;  2AX1 A;  3GG0 A;  2NZC A;  3WX4 A;  3TVY A;  1YTY A;  4EEY A;  3KYL A;  3NG8 A;  3H20 A;  3BGL A;  4Q0B B;  2YNG B;  2W24 A;  5CCL A;  3MXH P;  3RG6 A;  2B0G A;  1UVN A;  3G82 A;  3KJF B;  4DV7 F;  1QVG R;  5F41 A;  2GA7 A;  4EUV A;  4TU8 A;  3OXF A;  1UPM B;  4UZC A;  3WC0 A;  2Z30 B;  3CIZ A;  1KVK A;  1SKS A;  2ADC A;  1K73 T;  1RHQ B;  4MIB A;  1N32 J;  1GXT A;  4O3N A;  3T1Y F;  2MKH A;  4ATN A;  3D54 A;  3IS9 B;  1I51 B;  1R7I A;  2DO0 A;  2AGP A;  3Q8S B;  4OV6 A;  1FJC A;  1JKH B;  3X3U A;  1CQM A;  5I4M A;  2EC0 A;  2V4J A;  3W9H A;  2LEP A;  5RUB A;  1KP6 A;  3O2I A;  1D09 B;  4EZ6 A;  1NXI A;  1HHQ A;  1RIS A;  3HI9 A;  3A12 A;  4FYY B;  2JEJ A;  1CQN A;  5HMZ A;  2ROP A;  4G65 A;  2NPF A;  3G71 S;  3FBC A;  1NB2 A;  2H5I B;  3M6V A;  2I5J B;  3NGK A;  2CPI A;  5KT2 A;  2XHW A;  4R8U A;  3T1H F;  3UPF A;  5C24 B;  1TZ0 A;  2CQP A;  2H5E A;  2W9A A;  3IMQ J;  5HBM A;  3W9J A;  1U6B A;  2DNO A;  4CLS A;  5KT4 A;  1A0O B;  1OQ6 A;  4M5H A;  5HP1 B;  1T94 A;  3WBZ A;  5D3G A;  1X5T A;  5J1N A;  1GH8 A;  1EQM A;  2GNK A;  3KLH A;  2MSS A;  2W9B A;  5K8P A;  1KBR A;  4CP5 A;  2EFN A;  2J8S A;  1PCA A;  5ETV A;  2R7W A;  3CCU S;  3DRX A;  3C15 B;  2HFO A;  3FBE A;  2YVS A;  4JI7 F;  2DIS A;  1AA1 B;  3FZ2 A;  1IBK J;  2B9Y A;  1IKY A;  1IBM F;  4YOE A;  5KG3 A;  1ICE B;  1K1Q A;  5KFI A;  1EET B;  2CZV C;  3A8I A;  1O6X A;  3CC2 S;  1HR0 J;  1S1U A;  5H9E K;  3BSC A;  3D28 A;  1QSL A;  3C19 A;  4LF8 F;  1S1V A;  5EX3 A;  4C8K A;  2AJ4 A;  3CJ8 A;  3TUI C;  2Z2Z A;  1NSK L;  1QSY A;  2W4P A;  1T9U A;  2IM1 A;  2WBR A;  3M8Z A;  3HZG A;  4KGV B;  2GV1 A;  1DBD A;  4QW9 A;  2MLX A;  1FKP B;  2I0X A;  4ED8 A;  3UNY A;  4TNO A;  4NRU A;  2V9W A;  1RQ0 A;  2VOD A;  4F7V A;  1JNZ B;  4RUH A;  3QZ8 A;  2XZD B;  1S1T B;  4OHW A;  4F4Y A;  3NAI A;  3BH6 B;  2M88 A;  1T9T A;  1WEX A;  2E5I A;  1YI2 S;  1P1L A;  3NMA A;  3ZTQ A;  4FF3 A;  4K0K F;  1S99 A;  1WJ9 A;  3HT0 A;  3F44 A;  1MRO A;  1HMV A;  3VGU A;  5LMN J;  3DDK A;  2YKP A;  4R0E A;  4LQ9 A;  1N33 F;  2HND B;  3RAX A;  4TLQ A;  3V4I A;  3MOJ B;  2IVF B;  3GJR B;  3CCS S;  4C4W A;  2XMT A;  1QE1 B;  2F9J A;  5F9L A;  2V8P A;  3P45 B;  4KV8 B;  2PGC A;  5H9F J;  1VQ5 S;  3MMB A;  2BW7 A;  3MOZ A;  4H4O B;  4O3O A;  2BXJ A;  3HCX A;  4U8V A;  2VDH A;  5HVG A;  4X4P A;  3FGV A;  4IFV A;  3FBB A;  2R3V A;  1I94 F;  2NXU A;  2K1R B;  1F2H A;  2VB6 A;  1SQE A;  1YJU A;  1WC5 A;  2BKO A;  3DNC A;  1FVS A;  1RT4 B;  1EJ7 L;  4EK2 A;  3D68 A;  4Y2A A;  4PQU B;  1SIW B;  3RRG A;  4RNO A;  3CE8 A;  1VQ7 S;  2VA2 A;  2RIJ A;  1RSC A;  1XR7 A;  4CO0 A;  3SV4 A;  1JLE B;  2G1H A;  4RW9 B;  1JXV A;  3CJ5 A;  3KLI B;  4KT0 C;  2CQ3 A;  1GX6 A;  3W5Z A;  2VOP A;  1CBK A;  1OYE A;  3NGT A;  1YJ7 A;  2R7O A;  4P10 A;  1QVF R;  2YNH A;  2WVE A;  3K58 A;  1UEV A;  4J9V A;  3GV8 B;  3MEG B;  4YDX A;  2QN6 B;  2BZ2 A;  4HDH A;  4DG1 A;  3KJV A;  1YRT A;  3DYA A;  1SXL A;  4RBU A;  4HT5 A;  2ZE2 B;  2DK2 A;  1OIA A;  3LWL A;  3EDQ B;  2CPX A;  1HBM B;  2FVC A;  2UZA A;  3T1Y J;  1CJV B;  1RAJ A;  3I55 S;  4P2M A;  2HNZ A;  2V2K A;  2DT9 A;  3OFF A;  3QAU A;  2IAJ B;  2FPH X;  3OVB A;  3DOL A;  1R43 A;  3AY0 A;  1HKA A;  1XMO F;  3OTC A;  2VG6 A;  4ECZ A;  2PI4 A;  4WFZ A;  1NAQ A;  1CEZ A;  1U2R A;  3H0P A;  1BLU A;  3D2W A;  1U1K A;  4WU3 A;  1IR0 A;  1F5A A;  1IBC B;  5IOL A;  1OO0 B;  3D67 A;  5GAH I;  5ETQ A;  3EZ5 A;  1UL3 A;  3FVY A;  2ROE A;  2HHQ A;  1HBU B;  3J7Z 5;  5B7W A;  3T1H J;  1B0V A;  2J5A A;  3VGT A;  3TOQ A;  3NY0 A;  5ETO A;  5L9N A;  2VFT A;  2HFU A;  4B9U A;  4DL0 C;  1JLB A;  2R8J A;  2ZJP Q;  3U1N A;  2WSE C;  5I3P A;  3UVJ B;  1OY9 A;  3NOC A;  1S6P A;  2OEJ A;  1LW0 A;  3IM9 A;  3S8S A;  2RKI B;  1WSR A;  4JI7 J;  5AE2 A;  2ZUA A;  4OYP A;  1B0T A;  3DCA A;  1DQ8 A;  2AJ0 A;  1IBM J;  1S1W A;  2DJW A;  2YNF B;  2L48 A;  2VBZ A;  1F3V A;  2GQC A;  3ZZP A;  1ZZF A;  2HK2 A;  2UXD F;  3BQ2 A;  1FHT A;  4C0H A;  2R2T A;  2HBZ B;  1H6K X;  4WXW A;  2R7Q A;  4LF8 J;  2R9L A;  4WBF A;  2VKR A;  2A6M A;  4GRS A;  1QLN A;  4Y2I A;  2O01 C;  4PPD A;  2IYG A;  3PM9 A;  2ZBR A;  5EGY A;  2O5D A;  3RBD A;  2HVD A;  3J81 Y;  2Z2M A;  2QFJ A;  1APS A;  3KDN A;  1TKT A;  5D15 A;  3ISZ A;  1X31 C;  1FI4 A;  2R7T A;  1U1Q A;  2UVV A;  3MAQ A;  5GMD A;  3TAM A;  2J9D E;  2D7S A;  3MM5 A;  3K7R A;  4MIA A;  4OHY A;  4ETZ A;  3G4S S;  4DCO B;  4IO1 A;  3QGI A;  1UVK A;  1SL2 A;  1H2U X;  1TL1 B;  2WRM A;  1Q81 T;  2Q43 A;  3QPI A;  2V5H G;  4K0K J;  3ETM A;  4DN9 A;  1PJ7 A;  2DY1 A;  3AFG A;  1RT7 A;  2IDE A;  2ZDO A;  1S97 A;  1B7Y B;  3AT1 B;  3I9Z A;  1N33 J;  1KQF B;  3QQC D;  4WXO A;  4U9R A;  4WTY A;  3VHQ A;  1HLW A;  3HHK A;  1FRX A;  2KFN A;  2OD4 A;  3E51 A;  1XEZ A;  4K5R A;  4F2S A;  5HQL A;  2OSR A;  2NPI A;  2Z2L A;  1JJC B;  3AOC A;  4MK8 A;  2K06 A;  1EKR A;  4BCA A;  2C3M A;  1S7H A;  3B4D A;  1TL3 A;  3QJP A;  3PJ9 A;  5KFT A;  3DFE A;  1RT5 B;  4CLP A;  4ANE A;  1JLC B;  1I94 J;  2PMW A;  3KK1 A;  2D3Z A;  1VDH A;  4IFY A;  2A2D A;  2F8E X;  2LMI A;  3U1M A;  5C2C A;  1XR6 A;  2B7B B;  4LSL A;  3BEG B;  4XO0 A;  2D74 B;  2ZKT A;  1KLM B;  3SBM A;  3TA2 A;  1Y3J A;  2VFS A;  4GVB B;  1L3U A;  2OD6 A;  3FRY A;  2XSJ A;  2HMI B;  1Q82 T;  5KG1 A;  4ALZ A;  2NXE A;  1RAO A;  2MGZ A;  3O6Q A;  4DR4 F;  3BSA A;  2E9Z A;  1FFW B;  4NCA A;  2HSE B;  4NZ0 A;  4HYK A;  3DRP A;  2JDJ A;  3I32 A;  1VJQ A;  2DCU B;  4DPX A;  3TJA A;  2YQ0 A;  1UFK A;  3K5M A;  3I0S A;  3MUT P;  3KHR A;  3AOB A;  2V50 A;  4KKO B;  3PRD A;  3N5B A;  3TP2 A;  3BQ0 A;  1JNR B;  2RIL A;  4CI0 B;  3UI3 A;  4DZD A;  4AE5 A;  4O0N A;  3HP6 A;  3FQK A;  1IM6 A;  2ZHA A;  3VAH A;  1S6Q B;  1L5U A;  1S12 A;  5FLX Y;  1F5B A;  2EK1 A;  1U1P A;  2NUU G;  1QTM A;  5IFM A;  2MST A;  3RW7 A;  1RAF B;  3O5T B;  1LKZ A;  2CQG A;  2M4M A;  2HVE A;  3V6K A;  2AMC B;  1VR6 A;  1FNM A;  4N41 A;  4F67 A;  3OR1 A;  3D6M B;  1Q79 A;  3R2D J;  1DFD A;  3MF5 A;  3TX0 A;  1XMO J;  2GIR A;  5CHC B;  2I2Y A;  2CVI A;  4ZA1 A;  1GMW A;  2XEX A;  1FRJ A;  3AQO A;  2DIT A;  1MNE A;  2EI5 A;  4Y2M A;  1FJG F;  5CYJ A;  2FVP A;  3KLG A;  4ZIW A;  2ABY A;  4USJ C;  3GJS B;  3EX7 B;  1RWO B;  4G1I A;  4OI2 A;  2B5J B;  2KHC A;  3DOK A;  4RZR A;  1CSJ A;  3PW5 A;  1QAX A;  1E6Y A;  4ZIT A;  3SV3 A;  3JSY A;  3PEJ A;  3POT B;  5I42 B;  1GNK A;  2FTR A;  4YS2 A;  3GCW P;  3LAM A;  2FC8 A;  3FKB A;  4CLL A;  4PWD A;  3GII A;  2FLP A;  1PGZ A;  4D3G A;  2YKO A;  2MKY A;  1NJY A;  2EFO A;  5GAE U;  3IP0 A;  3KHH A;  2N4C A;  2FHO B;  3HZE A;  5E41 A;  3QNW B;  1Q5V A;  1UFW A;  3P5B P;  4NYZ A;  3IR6 B;  2N3L A;  2F3J A;  4O3Q A;  1M5O C;  1RB0 A;  2C3O A;  4QWE A;  2QC3 A;  3AB4 B;  5T41 A;  2UVW A;  3QYY A;  1KON A;  2UXD J;  4QYZ J;  5KT7 A;  1IWA A;  2HZC A;  2XC9 A;  2JC0 A;  2V6A A;  3GP9 A;  1JXL A;  3UD4 P;  4OZN A;  3AB2 B;  2KI2 A;  4KPC A;  4Q2L A;  4UUX A;  3P4U B;  4MK7 A;  2E7W A;  2HNY A;  3AHP A;  3VAG A;  1NK4 A;  2CQH A;  3M2V A;  4H54 A;  2V2V A;  2EFP A;  3PW4 A;  2JLG A;  1UTA A;  1DLO A;  1WI8 A;  3KLF B;  2NR0 A;  2YY3 A;  1UKU A;  2UUA F;  3UN5 A;  2CQC A;  3HXM A;  3HJV A;  1DTQ A;  2QYG A;  2CDQ A;  1IR2 A;  4ILR A;  3ZC4 A;  2DXD A;  1HI1 A;  5I3U A;  1C0T A;  1C2P A;  1I6J A;  1F3F A;  1LNQ A;  4OX9 J;  1P8G A;  2WB4 A;  3NGS A;  4NYP A;  2U2F A;  2ZJR Q;  3CCM S;  2VD3 A;  1FRK A;  5J1E B;  3ZO7 A;  3UCU P;  4X4T A;  2ZOF A;  4DSI A;  1OY8 A;  2RRB A;  1HBO B;  1PO6 A;  4NLO A;  3RAQ A;  3AD7 C;  1UVL A;  4OIX A;  3QGH A;  2RT3 A;  4WTO B;  1RWM B;  2DHS A;  5D8H B;  4M5I A;  2BKN A;  2DNR A;  2C28 A;  3PYF A;  3AD9 C;  4Q2M A;  2PDA A;  3LO3 A;  1NHV A;  2BOP A;  3NOG A;  3G2X A;  4BWM A;  4EO8 A;  3GG1 A;  1Q5Y A;  4OJH A;  4DU8 A;  1T9V A;  2MQQ A;  3GON A;  3VV2 B;  1AZS A;  5HAT A;  4JI4 F;  4DUZ F;  2MKK A;  4OX8 A;  2QTW A;  2M3D A;  4LF5 F;  2EBE A;  3AJ2 A;  2O67 A;  3T5H A;  1J5O A;  3OJS A;  5T14 A;  3HM9 A;  1UVM A;  1IKV B;  2H9Z A;  2DBB A;  2LEC A;  4QIG A;  1IQZ A;  3KLE B;  1AFI A;  2RSQ A;  1TP7 A;  4F36 A;  1VI7 A;  2HQI A;  8RUC A;  3QLH A;  1QAY A;  3JAM U;  4HKQ A;  1U4B A;  4HHU A;  5KFC A;  5IXU A;  1BGX T;  4DR2 F;  3J7A N;  1UW4 A;  2B8P A;  1S9F A;  1FKO A;  2DEI A;  2PMZ D;  1HBN A;  5A0Y B;  1WI6 A;  4QCL A;  2XS2 A;  1P9Y A;  1C4A A;  3AA8 A;  1FRI A;  1OY6 A;  1RI7 A;  5D0R A;  4F4K A;  3RBZ A;  3D9B A;  4DF4 A;  3QFW A;  4FYD A;  3VAK A;  2BQR A;  1PJ5 A;  3WC2 A;  4FYV B;  3S1T A;  4MAK A;  3N6N A;  1WTB A;  1RCX B;  3IBF B;  4J91 A;  5BYR A;  3PW7 A;  5D4N A;  5HVH A;  4C7Q A;  2RF2 B;  3KUH A;  2LXF A;  2A2C A;  4G6V B;  2YKN A;  4K4W A;  3IGV A;  3LGN A;  3M2R A;  5BJR A;  5AXK A;  2W01 A;  2X3G A;  3BKF A;  4CH0 S;  3FEX B;  2XG8 A;  2AEJ A;  2GGP A;  1SJ1 A;  4JB8 B;  3KK3 A;  4DQI A;  3MEC A;  1X4B A;  1N5Y A;  1CLF A;  2NSC A;  1R8P A;  3LW5 C;  5F8M A;  4B17 A;  1FJG J;  1N56 A;  2PFD A;  4C97 A;  4CT9 A;  3BSN A;  2L9D A;  3SDE A;  2VAS A;  1NKE A;  1YBA A;  3CD5 A;  2BVZ A;  4RUA A;  2UXB J;  2GMH A;  2IC3 B;  1X4C A;  2YKQ A;  2H54 B;  3J7Z T;  1D3W A;  2DRD A;  1KC8 T;  4U67 Q;  4DUT A;  4X2B A;  4V1A k;  1ELO A;  2JEI A;  5HAO A;  2A18 A;  3KTQ A;  2HQC A;  2XM3 A;  1PG5 B;  3P49 B;  5J2N B;  3MD1 A;  3K89 A;  4DR3 F;  5G0R A;  2WW4 A;  4G1Q B;  1JK9 B;  2W9C B;  2J0S D;  3PJX A;  4HTJ A;  3ONQ A;  3DGP B;  3ZTS A;  1GAO A;  2XCP A;  3LWM A;  1R31 A;  3FNN A;  3R7S B;  4HR2 A;  1FJE B;  5AE3 A;  1UVI A;  1LW2 A;  3BB5 A;  2KL8 A;  4BBY A;  2JVO A;  4TQR A;  2HBY B;  4PWW A;  2M70 A;  3SYZ A;  5H1S V;  5HMY A;  2C42 A;  1RAA B;  2MY7 A;  4O44 B;  1J5E F;  1IJF B;  4DXL A;  2GJF A;  2NYH A;  2PEH A;  1JIH A;  2IVM A;  1NH8 A;  4F0M A;  4KH0 B;  3RAM A;  3R7N B;  1S9E B;  2ZH6 A;  2DGS A;  2XNR A;  9ATC B;  2GVD B;  2XY6 A;  1RU2 A;  2AT1 B;  4UTG A;  2P6S A;  3F73 A;  2Z58 B;  5E3Q A;  1FVQ A;  1AXQ A;  4J37 A;  1S7I A;  1TAU A;  1LWC B;  4ZP6 A;  4CYU A;  2UUA J;  3SFG A;  2C2E A;  3TA1 A;  2LP4 A;  1CJU B;  2X7I A;  5E0O A;  5A8K A;  1MN9 A;  1CJK A;  3OBI A;  3S7R A;  2KM8 B;  2HBR B;  4ZLJ A;  1QDU B;  3L7O A;  5KFF A;  2QLW A;  2HYI B;  3ILJ A;  5BYQ A;  4EI2 A;  3A3O B;  1FE0 A;  2E5G A;  3DLE A;  2OFH X;  4I7F A;  4O0I A;  3C6T B;  2OPQ B;  1UJ6 A;  1WDD A;  3HKW A;  3DN9 A;  2A0F B;  2MQ8 A;  3PV8 A;  4B9S A;  3QSY B;  2XMJ A;  4FYW B;  1M90 T;  3G6Y A;  3NS5 A;  1YZ6 A;  3MCS A;  3QAT A;  2DCL A;  3CCZ A;  4ZPT R;  1PSD A;  3MI7 X;  6FD1 A;  4B3R F;  3O8W A;  3RR7 A;  1RP5 A;  2UUT A;  3AXM A;  3SQG A;  3JTO A;  3C14 A;  4FXW A;  2KXN B;  1XBW A;  1UZD A;  5IT0 A;  1RYR A;  1HWK A;  4DUZ J;  2HHS A;  3PHE A;  4NCG A;  3QID A;  4LF5 J;  4MIW A;  3G9C A;  1RTH A;  4I64 A;  2AJ2 A;  1K0V A;  4UY8 T;  3A3N B;  4J9S A;  4DSJ A;  2QA2 A;  4CLF A;  1N8R T;  4CLZ A;  3PW2 A;  4V19 J;  3W5X A;  3TR5 A;  4USH A;  1U48 A;  4PG8 A;  2DIV A;  4DR2 J;  2DR8 A;  1TVR B;  4EYH B;  5KFQ A;  2DRA A;  1IKW A;  3TJ9 A;  2FC9 A;  3DXS X;  1EQ0 A;  1K44 A;  3K8V A;  2DNH A;  4DDF A;  3MM9 B;  2F7V A;  4JV0 A;  5K9F A;  2JL9 A;  1S1X A;  1T05 A;  1PC4 A;  2LQ9 A;  5L39 A;  3IAM 9;  1SJQ A;  2AJ1 A;  3LOU A;  4C8Y A;  5HBM B;  2IY5 B;  2Y3Y A;  2MXY A;  2XYH B;  5HO4 A;  1ZOT A;  3BGF A;  4DZ6 A;  1SH3 A;  4X64 F;  3KLH B;  2WB1 D;  4P7T A;  2YKM A;  1BMQ B;  1BC6 A;  3VAF A;  1RA7 A;  4IOB A;  1S0N A;  4HL9 A;  4JI6 F;  5DG8 A;  5C25 A;  4LF1 A;  5KFA A;  3UR3 C;  1IKY B;  2V8H A;  1FDB A;  3BBF A;  3LP0 B;  3H5U A;  2MZS A;  1D1U A;  3SSQ A;  3JB9 k;  4LQ3 A;  4E0D A;  1N52 B;  4KR0 B;  4ECW A;  4PAA A;  5IM0 B;  4DL2 A;  2ZD1 A;  3T9N A;  3J81 U;  3CCW A;  4C6A A;  1AUD A;  4DS4 A;  2PSZ A;  1PAE X;  5F9N A;  2BE2 A;  2OFG X;  4DR3 J;  1SC1 B;  5EN1 A;  4O3S A;  3BO4 A;  4RW4 A;  3W65 A;  2XSF A;  2PD1 A;  1TAQ A;  1N6Q A;  5CZX A;  1B7F A;  1H74 A;  1X4D A;  2FLN A;  4UT4 A;  2BE7 D;  5AXN A;  3VR1 A;  5J2P A;  1S0V A;  3EZU A;  4Q5V A;  5F8N A;  2KRR A;  4GO5 X;  4MTP A;  3EDR B;  3WZ0 A;  1WAC A;  2IJR A;  4ECR A;  4PRF A;  1J5E J;  1VIO A;  3UE2 A;  1LV5 A;  1RT1 B;  4QIE A;  1QY7 A;  4LRB A;  5HVF A;  5E3P A;  1SH2 A;  3HK2 A;  1MRO B;  1HMV B;  4A8S A;  1HWI A;  3V4I B;  1HL6 A;  3HHD A;  4FKY A;  2IRY A;  1S76 D;  2KT3 A;  1WOS A;  3KOA A;  3QRR A;  3CDU A;  4OI0 A;  2HRU A;  3LP2 B;  2OJ3 A;  4FNH A;  4IDK B;  3W62 A;  4CLT A;  3ILL A;  5KG0 A;  2XS7 A;  4QWC A;  2R7R A;  3VAI A;  2LFV A;  2MPU A;  3PZP A;  2FJV A;  1H73 A;  5B0C A;  8AT1 B;  3MED B;  3A8K A;  2JVR A;  3GIK A;  1QAJ A;  4AD6 A;  2VIC A;  4MFB A;  3RYL A;  5HQ8 A;  2HVI A;  2QFI A;  3BGU A;  1IN0 A;  1IQT A;  2CQ0 A;  4IKA A;  2J7U A;  2AZ1 A;  3MM8 A;  4M5N A;  3MPW A;  4F50 A;  4HAC B;  1Q8B A;  1DAR A;  3PIP Q;  5JUM A;  3W7B A;  1VC0 A;  4XTT A;  3LAK A;  4KQZ A;  2GHW A;  1NZ8 A;  3AD8 C;  1OPZ A;  3GJT B;  2OPR B;  1NK0 A;  3QT6 A;  4Z7Y A;  2W2Q P;  3G8S A;  2G2Z A;  3W63 A;  1H72 C;  2XYG B;  4DPU A;  3D7S B;  3I0R B;  2MLY A;  2V4Q A;  4UOF A;  5D0H A;  2YNH B;  2HHW A;  2XHC A;  3G6X A;  5JVG Q;  3DI6 A;  4I56 A;  2AZ3 A;  5KOW A;  3VQS A;  1VHI A;  1TV6 A;  4QPX A;  4FP9 A;  3GV5 B;  5ETP A;  5DM6 Q;  5FLX U;  2R7X A;  3ZZT A;  1M1K T;  1HQE A;  3RRK A;  1AW0 A;  4X84 A;  1VRQ C;  4F4W A;  3MR5 A;  2OUG A;  5C42 A;  2HNZ B;  2VG5 A;  3H2V E;  1URR A;  1X4H A;  2JFK A;  3FQL A;  3JQK A;  4N56 A;  3Q8Y A;  4IG3 A;  4ZVQ B;  3BDP A;  2RRA A;  5CXT A;  3HMJ G;  1V5I B;  3DOL B;  3QT7 A;  1T11 A;  4HTI A;  2VG6 B;  1SC3 B;  4P71 A;  3I4H X;  2QGF B;  2XGQ A;  3N0V A;  5ETN A;  2ZH3 A;  4LFB F;  1C1B A;  2MZQ A;  1VQY A;  4NLR A;  4JOU A;  4PEO A;  2ADB A;  3KDO A;  3HHL D;  2RHQ B;  4RUB A;  4YB1 P;  1IJE B;  2RU9 A;  1TK8 A;  5B08 A;  3TNV A;  5CA5 A;  3BSO A;  3LP1 A;  1VQO S;  2CG8 A;  3C16 B;  3M6U A;  2HHU A;  4NZ7 A;  3B78 A;  4ED4 A;  4AYB D;  3OTE A;  3DLB A;  1EAR A;  1S77 D;  3MDF A;  4EO6 A;  2VIH A;  2R8H A;  4KB7 A;  1R89 A;  3NGU A;  4WP8 A;  3N01 A;  2DVI A;  2IJF A;  2BDP A;  4HH1 A;  1KVI A;  4IH6 A;  1VQ4 S;  1JLB B;  1FCA A;  4ZP7 A;  4YY3 F;  4ED2 A;  4X64 J;  3W66 A;  3D0I E;  5D4P A;  4RUC A;  2XY5 A;  1R8A A;  4A8Y A;  1S6P B;  2FZC B;  5KFS A;  2FHJ D;  1BQN A;  2GJ2 A;  2E29 A;  3PEH A;  1YK9 A;  3B8H A;  4JI6 J;  1WG1 A;  1VK8 A;  2HAI A;  2D41 A;  1FEE A;  4KE5 A;  4UQT A;  1X5S A;  4USV A;  4W4M A;  1TEL A;  3FJ2 A;  2N82 B;  2AYB A;  4YQW A;  4LR8 A;  5DZ7 A;  4LF6 F;  4P74 A;  4YP3 A;  3ISN D;  2RB7 A;  2QMW A;  3K5O A;  4OYA A;  4DJB A;  3SCL E;  4ID5 A;  3CDE A;  1SL0 A;  1U47 A;  1S72 S;  3NNH A;  4DV6 F;  4TVA B;  4PKD B;  5GME A;  2GZO A;  5U47 A;  1RT2 B;  1V9O A;  3VAJ A;  1DUR A;  4L72 B;  4IQM A;  5CYM B;  1IR1 A;  4XAK A;  2HHV A;  3FFI A;  2FZK B;  4CQ1 A;  4ZCL A;  5F8J A;  1TUG B;  1SKR A;  3TAM B;  4QWB A;  3P8B B;  4CT8 A;  1M5P C;  3Q0A A;  4DI6 A;  2RDJ A;  2G2Y A;  3GR1 A;  4KC5 A;  4DV4 J;  3VAM A;  1D8Y A;  3PFE A;  1ZA1 B;  5H9E J;  2VFU A;  5F0W A;  3ILI A;  4OYW A;  1TL7 A;  1V3Z A;  4KRW A;  1RT7 B;  2KVQ E;  3CUN A;  1Y11 A;  1JWW A;  2ZH9 A;  1GXU A;  2QLX A;  1U0H A;  4K5S A;  3MUR P;  1NPR A;  4WF9 Q;  4GKK F;  5F8H A;  2R8I A;  4ILM A;  4FKX A;  3OTD A;  4FPI A;  2ZH2 A;  4HH0 A;  4RW6 A;  2Z57 B;  2AYM A;  3TEH B;  1OSC A;  2CG4 A;  3J7Y I;  2N4D A;  2W2O P;  5J2M B;  5AXM A;  1UMJ A;  1RTJ B;  4CLU A;  1D9D A;  1FNO A;  2ATL A;  3IA0 A;  1M5V C;  2I8E A;  3TZW A;  4WK1 A;  2BAN B;  2E7V A;  3FCW A;  3SCI E;  4X4N A;  3O3L A;  3H5Y A;  2QA4 G;  3C2P A;  1M5S A;  4F4A A;  4M63 A;  4TLR A;  4KHR A;  4DV5 F;  4M8L A;  3MEK A;  3NWR A;  1MWY A;  2WBM A;  2PT0 A;  2V63 A;  4A8O A;  4GC6 A;  5KFN A;  3NCP A;  5LOQ A;  3ETO A;  8ATC B;  3N9U C;  3M30 A;  3CME S;  3BYR A;  4OQJ A;  4DPT A;  2YPZ A;  4YUD A;  3TVZ A;  4DFP A;  3B54 A;  3IAS 9;  2HLU A;  3DRP B;  1N36 F;  3TX8 A;  1M1H A;  1VBX A;  4KO0 A;  3I0S B;  5ETT A;  4ER8 A;  3H4D A;  2VG7 A;  5HI7 A;  5LSO A;  3IR5 B;  3HVT A;  3M1V B;  2QIF A;  1CS4 A;  3A13 A;  4WFN Q;  3QRQ A;  1YSJ A;  2QO3 A;  1LWF A;  3T5J A;  5D78 A;  2VKZ G;  3D0H E;  4RPF A;  1HNI A;  1TTH B;  2KTQ A;  4WFA Q;  3MMJ A;  3BN4 A;  4J9N A;  1BWE A;  2LXU A;  1UJ4 A;  2V94 A;  3D3B J;  3OR1 B;  4F8R A;  5ETL A;  2HZV A;  4Q0B A;  2YNG A;  2ZJQ Q;  3BF4 A;  4LFB J;  1MML A;  5IZH A;  2DGO A;  4U7C A;  2PE8 A;  4ILL A;  1WEZ A;  1IM4 A;  3PTW A;  2NCK L;  5L1I A;  4J5O A;  2X1A A;  1S6O A;  2FLO A;  1YJT A;  2FD2 A;  1VQK S;  5HJX A;  2LXI A;  1NSA A;  1OS5 A;  3DOK B;  3C46 A;  1R0A B;  1E6Y B;  2LEA A;  2GQ2 A;  2Q66 A;  2AJF E;  2RQM A;  3ZZZ A;  1FWL A;  3ZTP A;  4DOZ A;  2RQC A;  1HQU A;  1NM2 A;  2J0Q D;  1MSW D;  4OZL A;  3CTR A;  4IH5 A;  2KT5 A;  3MR2 A;  1X9M A;  1RHU B;  2QYC A;  3K57 A;  1CC7 A;  4WJB A;  4NPO A;  4DBQ A;  1JLF A;  2Z56 B;  3ILO A;  4USI A;  3PX0 A;  1FX2 A;  3JQJ A;  4P7V A;  3UDC A;  3LPY A;  3M8P A;  2ROG A;  3LQV A;  4YB5 A;  4LF6 J;  5C24 A;  4CO4 A;  2C22 A;  2FVS A;  1TL4 A;  2B8Q A;  2AX0 A;  4DU7 A;  2VV5 A;  4ZCK A;  4DV6 J;  2CRL A;  5HP1 A;  4ELT A;  5DDQ C;  2BJ9 A;  1UZH A;  2ZZT A;  2W1B A;  1FD8 A;  2C2M B;  3M2V B;  4HEA 9;  1NKC A;  3PYG A;  2ASL A;  4BC7 A;  3QJJ A;  2J6U A;  2K7J A;  1DLO B;  4N77 A;  3C15 A;  1W2I A;  4C8M A;  1QM9 A;  3TUJ C;  1ZAV A;  3OXG A;  5DM7 Q;  2EXU A;  2KN4 A;  4X66 F;  4RLE A;  1DTQ B;  5KOX A;  1L3S A;  3FSI A;  1G6B A;  3BN7 A;  1C0T B;  4P52 A;  2DIU A;  2VZ9 A;  2YNI A;  3W2V A;  4ZMM A;  4J9M A;  5EWF A;  4LMZ A;  3NL0 A;  3CCL S;  2BJ1 A;  1I3O B;  4TY8 A;  2Q6B A;  4C0B A;  4JV2 A;  4GKK J;  2NXJ A;  2PEB A;  4IO9 Q;  2JEG A;  1BE4 A;  3HVR A;  1O51 A;  4NXN F;  3CDB A;  1IKX B;  4ICL A;  2XMW A;  3DDI A;  4KGM A;  4DPO A;  3FSY A;  3V5R A;  2ZM6 F;  3CXC R;  1LK5 A;  4I2Q A;  5K8M A;  2OEL A;  1XNR F;  4O4R A;  1S1T A;  3M05 A;  4QIF A;  4RR5 A;  2B4V A;  3W5Y A;  1U1N A;  4TU7 A;  2CDR B;  3H8Y A;  2XMV A;  2ZH5 A;  2CNL B;  1VRU A;  3IR7 B;  4Y6I A;  3DLK A;  2VBY A;  2EG1 A;  3NP5 A;  2AF6 A;  2HS0 A;  4H4M B;  2RE1 A;  1FFG B;  2QLJ B;  2CQD A;  3OR2 B;  1WDT A;  1NDC A;  2H4W B;  5BR8 F;  1J5O B;  2OPP B;  3SCK E;  3HSG A;  2QSF A;  2RQ4 A;  1QE1 A;  4A4J A;  1S9G B;  3SIP B;  4OYI A;  1YLX A;  4PXB A;  2CQI A;  3QLH B;  1XQI A;  2IMO A;  5KFD A;  4H4O A;  4IQX A;  1RJJ A;  2V2Z A;  1N36 J;  3JXO A;  1KHV A;  2UUC F;  4J9R A;  3WHI A;  3W2W A;  5G4D A;  3KXD A;  3O44 A;  3CD0 A;  2AGO A;  5A6P A;  3PR5 B;  1N88 A;  2FZG B;  1UAW A;  4ENO A;  4QZV B;  1SC4 B;  1T02 A;  2CJK A;  2H5J B;  1X0F A;  3M8W A;  1S59 A;  2AGQ A;  4KSE B;  4NE9 C;  2FY1 A;  4PAB A;  3LF0 A;  4RW9 A;  2ZHB A;  2WVD A;  3SXL A;  3KLI A;  4RU9 A;  2VA3 A;  2UUW A;  2R7U A;  1IVZ A;  2E5J A;  2P9C A;  3PYE A;  4P6Q A;  4UF4 A;  4NZ6 A;  1HD0 A;  2YQ1 A;  2GGP B;  2VON A;  4B9L A;  3MEC B;  5HRO B;  3FDS A;  3MEG A;  3PX4 A;  2EC2 A;  2E9T A;  4PYA A;  1PBA A;  2OKQ A;  4XDD A;  4ZPA A;  2R8K A;  2PC6 A;  4XDC A;  3SDE B;  3ZZO A;  2P2C B;  3IWL A;  3D66 A;  1NK9 A;  2NS1 B;  3HUL A;  2WTF A;  3I5A A;  2ZEJ A;  4QBU A;  1HBM A;  2Y1I A;  2PA8 D;  3F41 A;  3HT3 A;  1S79 A;  3I87 A;  2EBG A;  3TAR A;  1FF2 A;  3KJN B;  3M6X A;  1W26 A;  4A48 A;  4K4T A;  1R8B A;  1SH0 A;  2DGV A;  1RTI B;  4OHX A;  4C3K A;  3C8Y A;  4PXE A;  4LF4 F;  2RUS A;  3ZTR A;  5G0R B;  3Q8U A;  2VU5 A;  2GCF A;  4PZV A;  4B3T F;  1XER A;  2LCW A;  2JFD A;  1AFJ A;  4LR7 A;  2AYE A;  1GQE A;  2LA6 A;  4WE1 A;  1EHW A;  2VH7 A;  3JAM Y;  1HBU A;  1SC6 A;  2DNM A;  3M8R A;  5A2Q Y;  3ITH A;  9RUB A;  4QYZ K;  1HQ2 A;  2QV6 A;  3MUV P;  5F0U A;  3R5A A;  3SMZ A;  4J90 A;  1Q8L A;  3TW0 A;  2R2U A;  1REV B;  2LVW A;  4X4R A;  1FE4 A;  2DR9 A;  1HPZ A;  2QLF B;  1YJV A;  3P6Y C;  1YBT A;  4PUO A;  2RKI A;  3CJ3 A;  1P6T A;  1MG7 A;  2PFF B;  3NEK A;  4R5P A;  1PIE A;  1Q8I A;  1UVJ A;  1V3S A;  1Q16 B;  5GMK a;  4RW8 A;  2VBW A;  2IHR 1;  4X66 J;  2YNF A;  5HMX A;  4C48 A;  2BJ3 A;  4NYO A;  4DQS A;  2BQU A;  2IJN A;  1MMN A;  4ZJQ A;  2KT2 A;  3RGI A;  5A8K B;  2DNQ A;  1CJK B;  4PG6 A;  4B3M F;  2IMW P;  1HYS B;  2HRY A;  2XCA A;  3THV A;  4ZKA A;  2C2Z B;  4EBC A;  5DG9 A;  3DLE B;  2IRU A;  4I7F B;  2OSQ A;  5GAH U;  1UP1 A;  2FYX A;  2JNJ A;  3AJD A;  1KFD A;  4YN3 B;  3CDW A;  3R1H A;  2EKY A;  4WZM A;  4B08 A;  4CDI A;  2VPX B;  3S01 A;  3R9L A;  4OZ3 A;  3A3P B;  3RW6 A;  4L6V 3;  1N5V A;  3CSK A;  4NLQ A;  3MCO A;  1H3D A;  4B3O B;  5IWA F;  5IC4 B;  2CIM A;  1ZAX A;  2ZM6 J;  4NI2 A;  2GQQ A;  2BX6 A;  5B0G A;  1RHJ B;  2HFS A;  1BQM A;  2CPH A;  5E3A A;  1XNR J;  2BYC A;  1NKB A;  3GIR A;  4KGZ B;  1NK6 A;  4J9O A;  2JSX A;  5B0B A;  3Q2S C;  5IT9 Y;  2JHE A;  1RZM A;  3A8E A;  2FJW A;  3MAH A;  1VGY A;  2EG2 A;  4LRF A;  2XY7 A;  2F40 A;  4AFF A;  2FJD B;  3PKM A;  4NCG B;  3AOA A;  3KMQ A;  2HVZ A;  5BR8 J;  1Y5I B;  1DTT B;  4LRC A;  1VJW A;  1RTH B;  1DRZ A;  1FFS B;  3GFZ A;  3H5S A;  1M5K C;  2WHO A;  3IGN A;  1HAR A;  2GW8 A;  3BR9 A;  5KFW A;  2X51 A;  1WNE A;  3G87 A;  1PKU A;  4ED7 A;  4TYA A;  4DLG A;  3SQO P;  2KB2 A;  2DD8 S;  1RT5 A;  2OIH A;  4IG0 A;  4OZ0 A;  4Q44 A;  2LDY A;  2WK4 A;  1OWX A;  3L7P A;  1C0U B;  1DAX A;  1N4L A;  4FDF A;  1WOO A;  4ZVU B;  4CIO A;  4F0K A;  4ECQ A;  4WYW A;  4OYO A;  3G86 A;  4DCJ B;  3UW1 A;  3OHA A;  1S1X B;  4FXV A;  5DQI A;  3OFE A;  2VOO A;  2IIH A;  4UZB A;  5EDW A;  2XBP A;  2JC1 A;  4CTA A;  5KFY A;  2HMI A;  1WEL A;  3GE9 A;  4DV0 F;  2HRT A;  2HFZ A;  4X4U A;  5HL7 Q;  1SJR A;  1SKW A;  1V5V A;  4KPY A;  1ITP A;  1T03 B;  2E7X A;  4P9S A;  4H4K A;  2M0G B;  4RO0 A;  2VQF F;  3FUY A;  3HJF A;  1QJH A;  4JP8 A;  1JB0 C;  5HQM A;  5A8W A;  5KFZ A;  4M5K A;  2GJI A;  1K47 A;  5C25 B;  4OX6 A;  4FPR A;  4ECY A;  2H3E B;  1HI8 A;  2ZWP A;  1NK8 A;  2B9E A;  4DFM A;  2EFG A;  1JJ2 R;  3TI0 A;  3WX8 A;  4NCB A;  4O4G A;  5HMW A;  3KUE A;  4WZQ A;  4WFB Q;  4I67 A;  4DV7 J;  4QU7 A;  4CCH A;  5AXL A;  2ZBQ A;  3UDE A;  3TQE A;  3PCO B;  4ZHR B;  4NWB A;  4BDP A;  2LKZ A;  1F9H A;  3L9Z A;  4I6W A;  2GMJ A;  2ZD1 B;  2ASJ A;  2NYI A;  4KTQ A;  1B70 B;  4C3L A;  2KDO A;  1YRX A;  1U6F A;  2XZW A;  2B9X A;  2Q79 A;  2CPF A;  3MEE A;  4LF4 J;  5KFM A;  4NLD A;  3DLG B;  3OXL A;  2DYA A;  1N6Q B;  2W2N P;  2FVR A;  2IBO A;  2XMA A;  2K7K A;  4FS2 A;  2CWX A;  1RAE B;  2ILY A;  1NCL A;  1FDN A;  1RHR B;  4NEY A;  2DO4 A;  3GFY A;  3I96 A;  3BJY A;  3KJQ B;  3POT A;  4P2F A;  3M8Y A;  5KG7 A;  1KNZ A;  1KS2 A;  2CWK A;  2XO6 A;  4JI8 F;  4I4B A;  4M5M A;  4KYZ A;  1H0H B;  2K3K A;  1WKJ A;  2QL9 B;  3ZFV A;  1U26 A;  4J9Q A;  3AXK A;  2E5H A;  4ITS A;  3UQS A;  2LEB A;  1UWB B;  2ALZ A;  4YB7 A;  4ZLN A;  2Y8W A;  2J6S A;  3MR6 A;  2Z2Y B;  2CKW A;  3Q8P B;  5DQG A;  1FO1 A;  3GTY X;  4B3M J;  4K4X A;  2BM0 A;  2LA4 A;  4RJV A;  2DTJ A;  3DXB A;  1U7L A;  1RCO B;  2AJQ A;  3NLC A;  2GVZ A;  3MM8 B;  3W1Y C;  4EMD A;  1RWX B;  3CJK A;  3R7B B;  4LIW A;  3FSX A;  5ETK A;  4B9V A;  3EGW B;  1MWQ A;  2V0N A;  3MCM A;  2Y1R I;  1NPK A;  2DNZ A;  3TUZ C;  1C1C B;  1U1M A;  2EPI A;  1FRH A;  1U25 A;  3PXG a;  2LYV A;  4ECX A;  3OVA A;  5IWA J;  1RWW B;  3CJR A;  2C2K B;  4U6P A;  4U7U K;  3CCT A;  1FT8 A;  3CC7 S;  1JX4 A;  4ES3 A;  4BS2 A;  4ZDN A;  1Y3K A;  1N0U A;  2ZBP A;  2CJQ A;  4IRD A;  1TV6 B;  2QMX A;  2R42 A;  2EFQ A;  3BO3 A;  4PXD A;  1EP4 A;  4IYQ A;  4QR1 A;  3ZZR A;  3TZZ A;  2QL5 B;  1RUS A;  3U27 A;  1PYS B;  3HD2 A;  3A4T A;  3N6M A;  5FDL A;  2MZT A;  3KK2 A;  3PY8 A;  2N3O A;  1RWP B;  4A46 A;  1ZET A;  1HBO A;  3ZZ0 A;  1BQX A;  4R25 A;  5C42 B;  4ZN3 A;  5HK4 A;  1FWP A;  1ZAW A;  4KHP F;  4IG3 B;  4KAI A;  4HVZ A;  4I2P A;  1X7V A;  3LAL A;  2C2N A;  5JJB A;  3BO2 A;  4E2F B;  2MZR A;  1RTD B;  3D6H B;  4DQR A;  3E01 B;  3NWG A;  2WAQ D;  3KNG A;  3T19 A;  1RDR A;  4UOC A;  3D3C J;  3CNQ P;  2BJD A;  2UP1 A;  3M8Q B;  1FES A;  1WOP A;  2ILZ A;  2DHH A;  3CMA S;  1JLQ A;  4L76 A;  2HFN A;  2IDL A;  1PJ6 A;  1VS3 A;  4UW2 A;  2AU0 A;  2YH1 A;  1WEY A;  2MDA A;  4A8K A;  2LU2 A;  3QZ7 A;  3DRR A;  5GAD I;  3CB4 A;  4ERD A;  2K8G A;  1IKV A;  4DV0 J;  4KH1 B;  1R6Y A;  2BEF A;  3N28 A;  1N34 F;  2MQN A;  1EZZ B;  1KKH A;  2HIQ A;  2YX7 A;  3JSM B;  2VQE F;  1Q0N A;  1O8B A;  1YHQ S;  2WOM A;  4L3K A;  2EK6 A;  2GX8 A;  3EXY A;  2VQF J;  4M94 A;  2L9N A;  4QR0 A;  3D1O A;  1CUL B;  1KHW A;  3HD1 A;  3CVK A;  4UUW A;  1DQA A;  3HFV A;  4FF1 A;  3KFW X;  4IH7 A;  3HDS A;  2B6A A;  3CED A;  3R5D A;  1ROF A;  2G1D A;  1HNV A;  1S4E A;  3HFZ B;  4IUF A;  2OGU A;  1RGV A;  4L74 A;  4TKT A;  3E2E A;  2DXE A;  2G2O A;  4ID5 B;  4OI1 A;  1U09 A;  2RF2 A;  1DY3 A;  1GMU A;  3H40 A;  4ED5 A;  4HLB A;  1MW7 A;  2HGL A;  1TK0 A;  3G96 A;  1N5Q A;  2VC1 A;  1U8W A;  1XJW B;  3T5K A;  2MKS A;  4X4Q A;  3KG1 A;  2MKC A;  4ZJL A;  3HO1 A;  4YDD B;  3JYT A;  3K8W A;  3MCN A;  3CF5 Q;  3FBF A;  5GAG I;  2DR5 A;  3RJM B;  2RJZ A;  3HKZ D;  4IRK A;  2V34 A;  2ZVI A;  1YIT S;  2D1C A;  5L38 A;  2MTL A;  2GO8 A;  1A6L A;  1Q78 A;  4U95 A;  4ECS A;  5M2R A;  1U6Z A;  4RNH A;  3DRS B;  2Z8Q A;  1CG2 A;  3TYT A;  2XS5 A;  1Z2L A;  2E1M C;  2C2O B;  2ZOM A;  4JBC A;  4F3Q A;  4RX6 A;  4DX8 H;  1TL7 B;  3BPS P;  2YWK A;  2JX2 A;  3D1Q A;  4RNF A;  4ID8 A;  2LQ5 A;  1NJZ A;  5JXS A;  4GKJ F;  1VC6 A;  2N7Y A;  1QD1 A;  1U0H B;  4JI8 J;  1MLA A;  4P73 A;  4F3M A;  1KD1 T;  2W9C A;  5E2Q A;  3HHL A;  4RW6 B;  3RU0 A;  1VBY A;  4BLG A;  3OUY B;  3LAN A;  4JV1 A;  2IPO B;  4K50 A;  3NBP A;  2QLB B;  3G8T A;  5D0G A;  3NRB A;  1X5P A;  1MMD A;  4Y0F A;  4DL3 A;  5M2U A;  1S4F A;  1Y5L B;  4J9L A;  1R27 B;  2B56 A;  2XUL A;  2RNE A;  2M8D B;  1LWX A;  2Y8Y A;  2JWN A;  4JI2 F;  4J9U E;  3OT9 A;  2KG1 A;  4XK8 C;  5IQQ A;  2FHJ A;  4A8Q A;  4CRJ A;  2GVD A;  2ZZM A;  3K2Y A;  4Z37 A;  4P2X A;  3Q22 A;  3M9O B;  4L73 A;  4Z7C A;  3M30 B;  1U1L A;  3MD3 A;  3ULH A;  1T95 A;  1PIL A;  3K17 A;  4URQ U;  4GC7 A;  2XLJ A;  1CJU A;  1JLG B;  4OZ5 A;  4KHM A;  5A8R A;  3L09 A;  2EVZ A;  2QRR A;  1G3O A;  4ZVO B;  4KO0 B;  2QX0 A;  2OPS A;  2OEK A;  3BGO P;  3I5C A;  4A47 A;  3PG9 A;  1VHF A;  4QWD A;  1UEK A;  3IWN C;  5EWE A;  1H2V Z;  5C7P A;  2B4O A;  1HHS A;  3MPV A;  2OPQ A;  2QA4 S;  2KO1 A;  1XWL A;  3JTN A;  2XMK A;  3H42 A;  2R2S A;  4B02 A;  2Y1J A;  2IBK A;  2NZ4 A;  4OYM A;  4LF2 A;  1WG5 A;  3PO5 A;  5D4L A;  3VWS A;  2YWF A;  4LSZ B;  5L1K A;  3GIM A;  5KFB A;  3MM6 A;  2ZHO A;  4X62 F;  2DHA A;  4CM2 A;  1P27 B;  4EGL A;  5DDO C;  4QU6 A;  5KG4 A;  2HHH F;  2Q1L A;  1HWU A;  4K2J A;  3U02 A;  4DR1 F;  3MM7 B;  2D69 A;  1Q8K A;  1VQP S;  2FHM A;  3IN5 A;  3V6D A;  4PPZ A;  1NB7 A;  2WVB A;  5THW A;  1Z4U A;  4W92 B;  2GC8 A;  1OPI A;  2RDD A;  4OJ3 A;  3PFO A;  1VLO A;  3MWB A;  3DU5 A;  4N8O A;  3EGV A;  1NJI T;  2MB0 B;  1VRT A;  4KFB B;  1N34 J;  4NAS A;  4UQG A;  2BM1 A;  4XPC A;  3HFK A;  1HQU B;  2VQE J;  3BZQ A;  4WFX A;  1U45 A;  2M9K A;  3DHW C;  4I6Y A;  2IVY A;  1GK8 A;  3EE3 A;  4DR4 J;  3PHT A;  2H51 B;  2CAD A;  4RW7 B;  3H2U B;  3D5M A;  1TVR A;  3ZZU A;  3KKF A;  2R2R A;  1FER A;  1JLF B;  2XTJ P;  3QSI A;  2NLW A;  5A2Q U;  4NML A;  2KHD A;  2F1F A;  3B82 A;  1CVJ A;  1GT8 A;  3MM9 A;  3M8P B;  3VVT A;  3QIP B;  4U8Y A;  2DRB A;  1NDP A;  4QIV A;  3UR0 A;  3CUL A;  5SUH A;  3EPI A;  3FK4 A;  2KVI A;  2Y0B B;  3ENA A;  3IM8 A;  1WF2 A;  1AT1 B;  4AT1 B;  4MKY A;  1QSS A;  4LBP A;  1RAC B;  4Y28 C;  2IA0 A;  2MYF A;  1NZA A;  4NMX A;  2WVF A;  4K4V A;  1S48 A;  4Y00 A;  2FJE B;  3NS7 B;  5F8I A;  3DM2 A;  1FTR A;  1HWJ A;  4B9T A;  1ZH5 A;  4OX7 A;  3LP0 A;  2BW2 A;  1OQ3 A;  4USK A;  2DR7 A;  3QAE A;  2BMB A;  4AXI A;  1NK7 A;  3T6J A;  5IM0 A;  3CCJ S;  3GV7 B;  1UA1 A;  4JV5 F;  2ZC3 A;  3DDN A;  5AE1 A;  2YNI B;  3W2V B;  3QT8 A;  3Q8R B;  3EYZ A;  1ZBT A;  2IRX A;  1RWN B;  4GKJ J;  4TY8 B;  4C11 A;  3GU0 A;  2CJY B;  3DLJ A;  3BV8 A;  2Q6C A;  5KFL A;  2XWX A;  1QUP A;  2J76 E;  3M4X A;  3MMA A;  4ZP9 A;  1FRM A;  3AQP A;  2YTC A;  4MMO A;  1BUX A;  4ICL B;  4QYR A;  2DGT A;  2HGN A;  4LF9 F;  3QGP A;  4I2Q B;  2COL A;  1L3V A;  5IT9 U;  4LJM A;  4EWT A;  2VJU A;  4NA2 A;  2QA1 A;  2W8K A;  4M5J A;  2OML A;  5HJY A;  1UW9 A;  3A1Y G;  1RT1 A;  1VRU B;  3DLK B;  4JI2 J;  5L46 A;  1U2C A;  4Q8E A;  3D1H A;  3AH6 A;  1REG X;  2J6T A;  4J9P A;  3DOM A;  2KFZ A;  3LP2 A;  4IDK A;  4NEZ A;  4RL1 A;  3QFH A;  1F1B B;  4EBE A;  1F0X A;  3ZTO A;  1KRP A;  1F60 B;  2IM3 A;  3CCR S;  5FII A;  1RAH B;  5F3T A;  2VJV A;  3ET6 B;  2J7W A;  1T9X A;  4R0J A;  3MED A;  3BBB A;  4C98 A;  3W2W B;  3K0J A;  1HHT P;  3RZA A;  2A10 A;  2WCX A;  1ZPV A;  2BJ8 A;  2ZUG A;  3I82 A;  2OMO A;  4DSL A;  3CIM A;  1K8A T;  2DB1 A;  4G1P A;  3V6J A;  4HAC A;  3QRP A;  4N76 A;  3H90 A;  4N5S A;  1JMT A;  4ES2 A;  3R8Y A;  3NKY A;  1L3K A;  1FK9 B;  2MHE A;  4TXS A;  4ETX A;  2BKP A;  1VFJ A;  2OPR A;  4IOC Q;  3BKU A;  2ASD A;  4F4X A;  3RR8 A;  1YRU A;  4CO3 A;  4DWI A;  4C8O A;  3OTB A;  1ZA2 B;  3I0R A;  1EAY C;  4X62 J;  4EBD A;  2GHP A;  4C3M A;  4HHJ A;  1W25 A;  2QE5 A;  3UCG A;  5KTQ A;  2AD9 A;  3V4M A;  2E1R A;  2HKE A;  4DLE A;  2HHH J;  3OHB A;  4MT1 A;  2X1F A;  1SUQ A;  4Y34 A;  2FJA B;  2F5G A;  4DR1 J;  4JYA F;  2W7O A;  1VBZ A;  4N8N A;  4K4S A;  3G82 B;  5MAO A;  1TMJ A;  5KFJ A;  3PYD A;  4JI4 J;  2BJE A;  2BAB A;  5DET A;  1G1X A;  4IR9 A;  5DO2 A;  1JLA A;  2C2R A;  4JUZ A;  1TKX A;  3G6V A;  2HQD A;  4NLX A;  5D4O A;  4W90 B;  4WIQ A;  2AIR B;  1MU2 A;  3HVA A;  3TVK A;  1SJ3 P;  5L9X A;  2XZT B;  3C66 A;  4H4K C;  3TRG A;  2EEY A;  4PG4 A;  4YR0 A;  2PMH A;  2V4J B;  1Q1K A;  5KT6 A;  1LXJ A;  3Q2T C;  1TFY A;  1FXL A;  3OFG A;  4P72 A;  5D0E A;  2BAC A;  4LBI A;  3KLV A;  4CLY A;  4LRD A;  3WDO A;  4CLK A;  3W8P A;  2B9W A;  4NLT A;  2XLK A;  3GYG A;  3FEY B;  2AWZ A;  4WE1 B;  2HWH A;  1CC8 A;  1YG0 A;  2VBX A;  2ZH8 A;  3C16 A;  1KLN A;  3ITH B;  1X4A A;  4I68 A;  4Y65 A;  5IC6 B;  3GYN A;  1RHM B;  4HT7 A;  4ZVG A;  2GHV C;  4R8U B;  3VVU A;  4ZLL A;  1D8Z A;  2J8A A;  3PX6 A;  2BOA A;  2AEM A;  4J9K A;  4X4V A;  1J27 A;  3WIU A;  2B4U A;  5BXI A;  3MAA A;  4U7U D;  3OTO F;  1HPZ B;  2XWY A;  5D3G B;  2XO7 A;  3I5B A;  4PUO B;  3Q23 A;  5CYQ A;  5KT3 A;  4DV1 F;  2W9B B;  2NXC A;  4R5P B;  1UJ5 A;  4YEA A;  4JI0 F;  4RW8 B;  4YHH F;  2Y9H A;  4QWA A;  1X8D A;  2GAG C;  2VUG A;  3IRX A;  1UWA A;  2JLF A;  3JS9 A;  5LSL A;  1RLD A;  2OI2 A;  4JV5 J;  2W8L A;  2I38 A;  4USM A;  1SKU B;  3RRH A;  2FVQ A;  1S1U B;  2W4D A;  2HBQ B;  2YX4 A;  1RBO B;  2CVE A;  3EJM A;  2OTJ S;  1K0T A;  4YR2 A;  1RT2 A;  1RAG B;  1RA6 A;  4ZVT B;  2FUG 9;  2CNN B;  1SJF A;  5CYM A;  3UO0 A;  1S1V B;  5F3Z A;  4N7T A;  1HI0 P;  3OL6 A;  1T3N A;  1T9Y A;  4FYX B;  1ZPW X;  3J80 Y;  4KIA A;  3T9Z A;  4FBU A;  4ZJO A;  2L41 A;  1F9E B;  3QWP A;  4UOG A;  5HSP A;  2DGQ A;  4NI2 B;  4LF9 J;  5DGA A;  4FXD A;  4NLV A;  1BQM B;  5ADZ A;  5BYS A;  3CW2 C;  1ZM3 A;  3U7J A;  4AL6 A;  1NRK A;  5A76 A;  1R0B G;  5J2Q A;  4C9D A;  4OX9 F;  2YWG A;  3D6T B;  3W8G A;  2MZJ A;  4NLW A;  2DGU A;  5CQG A;  3SZ2 A;  1XMB A;  2DNG A;  2FGC A;  4WKY A;  4FZV A;  3UN3 A;  4ZPB A;  4GMK A;  2JJ4 D;  1FX4 A;  2HPU A;  3LPE A;  4WCE Q;  3RB0 A;  3FEZ A;  1HIY A;  3EZO A;  1EX8 A;  1OMS A;  2ZOG A;  2PI5 A;  5J2M A;  3KWM A;  1SL1 A;  1RTJ A;  5LXR A;  3UDV A;  4QIW D;  3LTO A;  2W2P P;  2JH3 A;  2V2Q A;  5KFP A;  4C8Z A;  2CFX A;  4IG0 B;  3MMB B;  5IT4 A;  2BBE A;  3GB0 A;  2K2P A;  2BAN A;  1Y5N B;  2OAU A;  2OLW A;  3EVW A; 
#chains in the Genus database with same CATH homology
 4HHU A;  5BR8 J;  1HNX J;  1N32 J;  1XMQ J;  4DV1 J;  3J81 U;  4NXM J;  4K0K J;  4LF9 J;  1IBM J;  3J7A N;  4LF7 J;  2UUC J;  2UXB J;  4JI3 J;  4JI0 J;  4NEY A;  4JI4 J;  3R2C J;  4YHH J;  2MEW A;  5FLX U;  2UU9 J;  1N33 J;  1IBL J;  4NXN J;  2F4V J;  4JI8 J;  4DR3 J;  1IBK J;  3D3C J;  1XNQ J;  4V1A k;  4X64 J;  5LMU J;  5AJ3 J;  4LF8 J;  4DV4 J;  5IT9 U;  5IWA J;  5LMN J;  2UUA J;  4DR5 J;  3D3B J;  4DV7 J;  4DR6 J;  4JI1 J;  2E5L J;  4DUZ J;  1HR0 J;  4KYZ A;  1N34 J;  4DUY J;  3J80 U;  4JI6 J;  4LF5 J;  4LF6 J;  4GKK J;  2VQE J;  3T1H J;  4KHP J;  2UUB J;  4LFB J;  4X65 J;  4DV3 J;  3W1Y C;  1N36 J;  4JV5 J;  4JI2 J;  2ZM6 J;  4DV0 J;  4JI5 J;  4B3T J;  2KVQ E;  4DR4 J;  1I94 J;  1XNR J;  4DV6 J;  4X62 J;  4B3R J;  2KL8 A;  1J5E J;  4JYA J;  5LM7 E;  4LF4 J;  4AQY J;  2MTL A;  4YY3 J;  5A2Q U;  4B3S J;  1HNW J;  4DR7 J;  3IMQ J;  2VQF J;  2HHH J;  4B3M J;  4NEZ A;  4OX9 J;  4PWW A;  1HNZ J;  4KY3 A;  4DR2 J;  4X66 J;  2MQ8 A;  3R2D J;  4DR1 J;  3T1Y J;  4DV5 J;  4GKJ J;  4LFC J;  1FJG J;  2UXC J;  4RJV A;  3OTO J;  1XMO J;  4JI7 J;  3JAM U;  4DV2 J;  2UXD J;  4LFA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...