1RU2A

Crystal structure of a ternary complex of e.coli hppk(v83g/del84-89) with mgampcpp and 6-hydroxymethylpterin at 1.48 angstrom resolution (orthorhombic form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
146
Chain Sequence
b'TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPPDYLNAAVALETSLAPEELLNHTQRIELQQGRGGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
molecule tags Transferase
source organism Escherichia coli
publication title Essential Roles of a Dynamic Loop in the Catalysis of 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase.
pubmed doi rcsb
total genus 40
structure length 146
sequence length 152
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1ru2A00
3QBCA 3MCMA 3MCNA 5ETNA 1RU1A 4M5LA 2F65A 4M5NA 4M5KA 3HCXA 3HSJA 1HKAA 1RU2A 1KBRA 1DY3A 1RAOA 1G4CA 1Q0NA 3ILIA 1RTZA 5ETKA 4F7VA 2F63A 3IP0A 4M5GA 3ILOA 2CG8A 3ILJA 3MCOA 4AD6A 5ETQA 3ILLA 5ETOA 5ETLA 3KUGA 5ETSA 3HSZA 5ETVA 5ETRA 3UDEA 1RB0A 4M5IA 3KUHA 1TMMA 3HT0A 3HD2A 1EQMA 3HSGA 1F9HA 1TMJA 1EX8A 4M5MA 4PZVA 5ETTA 3UD5A 2BMBA 2QX0A 1CBKA 3HSDA 4CWBA 1IM6A 4M5HA 4CYUB 4CRJA 4M5JA 3UDVA 3HD1A 3KUEA 5ETPA 4CYUA 1EQ0A 1HQ2A 5ETMA
chains in the Genus database with same CATH superfamily
4O4RA 2PFDA 2YNIA 2YPZA 3DRPA 4LR9A 4MH8A 4PQAA 3Q8QB 1ZBTA 1JKHA 1Q78A 2I38A 1YWXA 1YSJA 3T19A 1K47A 4P75A 1SH2A 1TL3B 5B0AA 3FCHA 3MM8B 3TW0A 4WP8A 3W1YC 4DR3F 1NJZA 3KG1A 1IKXB 3NMRA 2VH7A 2JEIA 1PG5B 2F8HA 2M5YA 4DG1A 4YR3A 2ZM6J 1KVIA 1FKOB 1OPIA 4IG3B 2KM8C 2PC6A 3QJPA 1IR2A 3H5SA 5KFLA 3GV8B 2JVOA 3ZNJ1 2YNIB 3DRPB 3JTNA 2CZVC 4KBIA 3SCKE 3CC4S 2V2KA 3DLJA 1XK8A 4HT5A 2V63A 2KFYA 1TFYA 2AEMA 2C2KB 3LWMA 2G0JA 3BZQA 1X60A 1LWCA 2WRMA 3AD7C 3N5FA 3ADAC 4RW7B 3HO1A 4Y2CA 3VZHA 1WHWA 1QAYA 5HMYA 5LM7E 4DU7A 2JDJA 1YHQS 4LF7F 2P9EA 1UEUA 3PW2A 2W7OA 1W25A 2CQHA 4PYAA 1WWHA 2VPYB 1OO0B 4LIWA 2YKAA 3T5LA 4G6VB 2E7VA 4IFVB 2CQPA 2K1RA 4OYXA 3PCOB 5FDLB 3QT7A 4C0HA 5A76A 4X4VA 4WTYA 2BE7D 4OJHA 2EWHA 2QE5A 4NZ7A 3CW2C 1NZAA 3ENAA 4IDKB 6AT1B 2C22A 3WC2A 4DUYF 1SH3A 1B70B 3H0PA 3QFWA 4HH0A 1FXDA 2IHR1 2HQGA 3UW1A 4ED5A 2HHWA 5IT9Y 1B64A 4W92B 4GC6A 2RE1A 2Q79A 1H98A 3W62A 2HRYA 1H2VZ 5DRKA 2G2YA 3TYTA 4ECTA 3FFIA 4YHHJ 2Z56B 3W63A 2ZBPA 2ZH7A 2UP1A 1UJ6A 1NK0A 2XMJA 4AFFA 1IBMJ 1X4GA 3CT9A 5HI7A 3H5UA 4NA1A 1CVJA 1Q8KA 3I55S 3V6DA 2G2ZA 3BBFA 3K5PA 1RT3A 2AJ2A 4NEYA 3RRKA 3I6PA 4ZVHA 2J8SA 1X4AA 7FDRA 4B3RJ 1XMOJ 4K4TA 1RACB 2ZZTA 2DGOA 3MAAB 2DR7A 3NP5A 2GS8A 3LW5C 1HD0A 2A0FB 1H2TZ 1HI1A 4P52A 1XC9A 1WF2A 5L38A 4DV5F 4DPOA 1SV5B 2F1FA 4NASA 4ZPVR 3K5MA 3TRGA 1TK5A 2XM3A 2VJUA 1NKCA 2R7QA 2VG5B 2XMVA 3KLIA 4IO9Q 3J7A1 1U1RA 2IJFA 3CJQA 1C4AA 1RTJB 4HHHA 4A46A 4JI8J 1NKEA 1MROB 2DPIA 1MU2A 2ATLA 3MXHP 1TL1A 1NBEB 3GIMA 2PD1A 5DS7A 2QG9B 3M8YA 2KKHA 3TQ1A 1YJRA 1DJ0A 1BQNB 4EU0A 4CQ1A 3QZ8A 5KFCA 1TKTB 1RTZA 2OI2A 2PT0A 4ZJQA 2F9JA 5B0FA 2YWHA 3D4JA 4H4KC 1WD6A 1HI8A 3UQSA 1ZPVA 4QIVA 2FVQA 1JMTA 1Q8LA 2DNZA 3JTOA 2Z2YB 2EK1A 2MQQA 1RWNB 1NH8A 4DV5J 1BMQB 2OEKA 3MWBA 2HS0A 2QMUB 4ILLA 1RHUB 2K7JA 2RVJA 3QWUA 5L39A 2G2OA 3KMSA 4DV6F 1TELA 1TVRB 5KG0A 5LXYA 2FHOB 2IRYA 4JBCA 3JSBA 3LGMA 4BHQA 2B4UA 4GVBA 4KGXB 1CEZA 4EO6A 5C42B 3PRDA 1L3VA 3GFHA 3DLHA 4O3RA 5FJ4A 4MK7A 1ZOTA 2AF6A 2QLJB 3QPIA 5IT9U 2YNFA 3DXSX 3GLJA 2KT5A 3L09A 1HIYA 3QSIA 1CJKB 4RR5A 4MMOA 3EPIA 4Q0BA 5BYSA 1Q16B 1U2FA 2BJDA 3BKFA 4RW9B 3MM9A 3NCQA 5A2QY 2BE9B 1K44A 3LTOA 4RW8A 1J2VA 5HK4A 5I3UA 1JB0C 4QIGA 2UUAF 4LF6J 1GMWA 4LF5F 2HZAA 3NL0A 2XS5A 3FJ2A 4ZVUB 1RHMB 3THVA 1NJIT 4BBYA 4JV2A 5E2QA 3DOMB 1SJRA 3I82A 4FYXB 3FEXB 2GIQA 3UDLA 1HYSB 4RW8B 5B0EA 5I3UB 1RLDA 2VFRA 3GONA 1NCLA 3GFZA 3NGSA 2WSEC 4RW6A 4UQGA 4HYKA 1QAJA 2HRTA 2R8JA 2ZH9A 2MZSA 4K2JA 3BDEA 3ZZZA 4KAIA 4AXJA 4DX7A 3IBWA 3FUYA 1FESA 2Z2MA 3MMCB 3NAHA 3B82A 3M2RB 3M2VB 3NKYA 4LUBA 4WU2A 2E44A 3LALA 4ZPBA 5J1NA 5HN0A 4GVBB 2ZH4A 2UU9F 5ETPA 4UT4A 1IKWB 3KYLA 1T03B 5B7WA 4QQBA 2YWGA 3QNWB 3H5YA 3KDNA 4IR9A 1N5YB 5DO2A 2GC8A 1L5UA 4DR3J 4B3TJ 4PUOB 5J1EB 2NZCA 4TVAB 2EFNA 3JXOA 3MPUB 4KO0B 3MZIA 5CYQA 2O5DA 3R6LB 3FQKA 5E3QA 1RTDA 2IBKA 1SI9A 3GJTB 1WC5A 2UV8A 3OTEA 5H1SV 4ICLB 4NZ0A 2RHQB 4QOTA 2DK2A 5B09A 4NA3A 3ITHB 1RT5A 3V2UC 2B0GA 1UPPA 4CO5A 1VLYA 4ES1A 3MMBB 3HPOA 3T6JA 3KJVB 2F4VF 1NJXA 2RHSB 3WC0A 3QAUA 4F02A 4OYAA 2XMMA 1FDDA 3GFXA 1Q8IA 2WBRA 3QO9B 3N6LA 4NLSA 1C4CA 4FZVA 4OI3A 4QBUA 3OUYA 3AH6A 3CUNA 1X4DA 3H25A 3TJ9A 1B3TA 1SXLA 4WFBQ 3HXMA 1VQYA 1DTQB 2MZTA 2V8DA 4DPTA 4EEYA 2QC3A 1XMBA 4ZVTB 2DVIA 1U0SA 2B7BB 1XWLA 2CPZA 1NDLA 2E1CA 1ROFA 2LA4A 2LU2A 4K4YA 2PEBA 3OUYB 2N7YA 4WFYA 3PNIA 1S1WA 2C2NA 2MJNA 3A13A 3MI7X 3KLFA 5E3PA 4HL9A 2VA3A 4LRCA 1FWPA 2HAFA 3C6UB 3CEDA 3D6TB 4JI6F 3W2WA 3K5NA 4DL4A 1A6LA 1RWXB 1V3RA 2WW4A 5CZXA 5DDRC 1Z1ZA 1N33J 3M6VA 3CB4A 1YQHA 1N48A 4BDPA 1N4LA 1OY8A 5JVHQ 1RT6B 3I4PA 5HMZA 2CUYA 3I5BA 2BKNA 3EZ5A 3FZ2A 3CJSA 3J81j 2DH9A 4F26A 3DRSA 2UXBF 3DYAA 3SSSA 3DLEA 3ZTQA 5HQMA 3EE3A 2K1RB 1Y4ZB 5U47A 1ZM2A 4QWCA 1WOPA 2QL9B 3PKMA 2XMKA 3HFVA 1O6XA 2Q3PA 2R7UA 3KLHB 1RKIA 5L46A 5KFQA 5D4PA 4ETZA 3NLCA 5KFYA 1U1PA 2YWFA 3P49B 2OP5A 3M30A 3JQMA 4DUTA 2D3O1 1Y7PA 2HBQB 2WVFA 3W2VA 4YMEA 2CPHA 1KEKA 2HW3A 2YX4A 1DLOB 3OQ2A 4KB7A 4DQSA 4A8SA 4ERDA 1KTVA 2RUSA 4WFAQ 4N76A 1UVLA 5GAGU 5HVHA 1U1NA 3MF5A 1PAUB 3U02A 3ZTRA 1KOHA 4BLGA 4C2MA 4OX9F 3A8JA 2VL1A 2NQPA 4ZMMA 2KZMA 1E6YA 5DETA 1WTBA 1RT2A 4LF8J 3PY8A 2VFUA 1U45A 1TAUA 2ACMA 3LGHA 4LQ9A 3W8PA 2UVWA 2HFZA 3VGSA 1TKZB 4DR1J 2LEBA 2F7VA 1K1SA 5ETLA 3TVYA 1LW2B 2DXEA 1TU0B 2MTLA 4RU9A 3CJKA 3FVYA 3LP1A 3PHEA 4G1QA 4TY9A 3VF0B 1C0UB 3M8PB 3L3CA 4NLOA 5DDQC 1UFKA 4KE5A 1QE1A 1R3NA 4PR6A 3MCSA 2DH8A 2IBOA 5B0CA 5K9FA 1R0BG 1RAEB 2XGPA 2NXUA 4YR2A 2AW0A 4IG0B 3IS9B 2D3OR 3GYXB 1F9FA 2A2CA 3QFHA 2EW9A 2DR9A 3D54A 3OTBA 3OD2A 2XWYA 2ZE2B 3HCXA 2GW8A 4K2XA 4ZLJA 2J0QD 3OBIA 1B0VA 4L72B 1XNRF 1WC0A 2UVVA 3M4XA 5KG3A 1NLKL 1R8CA 4S0MA 3L7UA 5G0RB 1T94A 1W26A 4TNOA 4B3RF 1NM2A 3CVKA 3DLEB 3NS7B 2DGQA 1JXLA 4I6WA 2VFTA 4V19X 2WHOA 1JLFB 4TU9A 5GMEA 3PJWA 5D15A 3DLGA 1XBWA 2RDJA 3T5KA 1VQ7S 2QLFB 2MDAA 3IN5A 5EN1A 1E6VB 3TVKA 4JI0F 3KLIB 1FRIA 1KVJA 1QTNB 4OZ0A 3K7RA 4X2BA 3MCNA 3THPA 4DPXA 3UE2A 3OT9A 4YR0A 5IS2A 5CD4A 3QT5A 2BQRA 3AFGA 2KG0A 1EKSA 3G8TA 4WK1A 5F9NA 2Y1JA 4B9LA 2B56A 3IM8A 5D77A 3E3XA 1JK9B 1KQSR 3VGVA 4FN5A 5H9FK 1IKYB 1AA1B 2QJ3A 2DNKA 3I31A 4I7FA 4UOCA 2HFNA 5ETRA 1WF1A 4QWBA 1RAFB 2QYGA 3TJ8A 2CPDA 4NZ6A 2YKMA 4A47A 3AJDA 4DL2A 5HLFA 4BCAA 1MG7A 2EBEA 1PC5A 3IXQA 4NL5A 2WBMA 5M2UA 3MM5A 4OYWA 2R42A 2BR0A 3QO9A 2NR0A 1E6VA 4F25A 2MQ8A 1NHKL 1RWKB 2B43A 3WHIA 2VZ9A 2HNYB 1RT4A 4WYWA 2DHAA 2DNMA 2EKYA 3S01A 3MR2A 3CJ8A 4QW8A 1FRKA 5BJRA 1RCXB 3NWRA 2WOMB 3GILA 4O23A 4F4XA 2HHTA 3Q8PB 4U7UK 3EDQB 3EGZA 1T02A 3DDNA 1R6YA 1S5ZA 3CDAA 1R0CB 2CPIA 4ICLA 4EI2A 5GAEI 1Z4UA 2BM1A 2DKOB 1JLCA 1RUSA 2P5VA 4DU8A 1SC3B 1U6ZA 3CMES 4ZITA 2YNGA 2YTCA 2FJDB 3OL8A 3H2LA 4Y2AA 2FHJA 4OL8A 3W5ZA 3AB4B 5D0RA 4AT1B 2KHDA 4PZVA 4DPYA 4ZA1A 1SL2A 1RWVB 1TL7A 3EGVA 1MNEA 3MEGA 3V81A 2K06A 3C14A 1Q53A 3GIIA 4KR0B 3BO3A 5C2GA 2N3OA 2X3GA 3G6XA 4FBTA 2IA0A 3R9LA 2EC2A 2RH3A 2OSQA 4RU2A 2MGZB 4I64A 1DAXA 3UPFA 3HZEA 1RKJA 3DLBA 1MWQA 6FD1A 5KT5A 2QA4G 1FO1A 1S1XA 2QV6A 3AB2B 4I67A 1B7FA 4K8RA 2MKYA 2BANA 3MURP 4P6QA 4YB5A 4QJVA 1N0UA 3LP1B 3P96A 2NSCA 4G1QB 3JSMA 4CTAA 1OY9A 4WCEQ 2RIJA 3OL6A 4TLRA 4DLGA 4JI6J 1HWJA 1VOMA 2IRUA 4FXWA 4G1PA 4E98A 1L3KA 3MM6B 4J9NA 2PGCA 3PJ9A 4C8NA 2VBZA 4ED2A 3QGHA 2RT3A 3F0NA 3MAQA 1KLMA 4KKOB 3H90A 4Q2MA 1WEZA 1FTCA 2LA6A 4WPAA 3TOQA 3U1NA 5MAOA 2CDRB 4AL7A 1A9NB 1XR6A 1LW0B 4YEAA 3GJQB 2D41A 3N5BA 3C8YA 4KSEB 4B9UA 2ADBA 4PEOA 1RJJA 2BJ7A 3D0HE 3JSRA 2D74B 1WORA 1ZH5A 2CPJA 5K14B 1T8EA 4IQMA 2GGPA 2XO6A 1I1GA 4ZVOB 2F8EX 3MEGB 3V81B 2DD8S 1TK8A 1WKJA 5L9NA 1VQLS 1SPBP 4MKVA 1S99A 1RHJB 4ZJLA 5KFXA 2CNKB 4PWUA 3W5XA 1F3VA 3KLHA 5RUBA 2W9BB 1UVKA 3HHLC 1SKRA 4LSLB 1HWLA 3ILJA 4U67Q 2QN6B 1S1UA 1NEEA 4YUDA 1KOOA 2XZWA 2QGFB 2N7CA 2J9EA 4DR5F 3FBEA 1T9XA 2B4VA 2QTWA 4DSLA 1NSPA 2J0XA 3HSGA 1YJ9S 1LWXA 4R8UA 1N36F 4CH1A 2XCAA 2XLKA 2DNYA 4Z7CA 2UXCJ 3C16B 2ZDPA 4DR4J 4CRJA 3CF5Q 2YH0A 4CYUA 2K2PA 4LREA 3C2PA 3I0SB 3X3UA 2AX0A 3RJMB 5KT2A 1NRKA 3A1YG 2Y1LB 1F2HA 2BEFA 1LNQA 2XZTB 5KFNA 5A8KB 3KLGA 2LDYA 5L1JA 1TK0A 3KLEA 1TKXB 1DZ5A 3PRBA 4E8UA 1HBNB 1R89A 1GMUA 2CQGA 1DQ9A 4PG8A 2VQFJ 4DFPA 3IG1A 5A8KA 5DQIA 2RS8A 4DCPB 4M5IA 2MKSA 4GVLA 1TMMA 1YRTA 3V6DB 3TI0A 1JLQA 4E0DA 4F3MA 4NLGA 3G86A 4YFUA 2F3JA 5A8RB 4JV1A 5GADU 4IH5A 2ZHOA 9ATCB 1TV6B 4RNMA 3KK1B 3J80Y 3KUEA 5KFJA 2MHEA 4UY8T 3NCRA 3JS9A 2PSZA 3HF5A 2Z2LA 2ZD1A 2AGQA 2ZOGA 4ZPDA 4HACB 2OTLS 1HQUA 4M5LA 1G1XA 4YOEA 1X5SA 3RAMA 4Z7YA 1VQ4S 1KP6A 4WK3A 2NLWA 2MZQA 4AYBD 1WSRA 2GNKA 1Z2ZA 3NY0A 4J9OA 4OZNA 4DPWA 3WQPA 5J2PA 4RUBA 3DOKA 5E0OA 1DURA 5IFMA 2Y1IA 1J5OB 2VFSA 2E9RX 4Y2MA 4EZ9A 1SC1B 3LAMA 4P74A 2L08A 1KLNA 2ILYA 3SSRA 1AB8A 1TTHB 3QLHA 3IR6B 4USUA 1GK8A 2YQ0A 2DB1A 3BB5A 1WG1A 3GB0A 3LOUA 5IM0B 4X65F 2MKKA 2ERRA 1RISA 1SUQA 2PMWA 2ZFHA 3DHWC 4DV1J 2LVWA 1IWAA 1X0FA 1IKWA 1NXIA 1FNOA 1T03A 1ZPWX 2WW8A 4RUHA 4DUZF 2E5LF 3GJSB 1N56A 3NGKA 2E5LJ 1U8SA 2W2OP 3M2RA 1QE1B 2CKWA 4R0JA 4Y00A 4F67A 4NLYA 2JSXA 1LW0A 3DRRA 3OL9A 3I32A 1R31A 2NYHA 3CJTA 3PHTA 3PJXA 2J9CA 2CQBA 2QSWA 2QT7A 6FDRA 5DDOC 1HBUB 2CVEA 4DL7A 2N82B 4TU7A 2W4CA 3DOMA 4USWA 1IKXA 2J7UA 4MKYA 4XPEA 5ETOA 4CNZA 1L3TA 2B6AA 4J9VA 3CJRA 1X7VA 4PPDA 4PXBA 4WYLA 1PO6A 4XTTA 4YB7A 5A0YB 1V3ZA 3PX6A 2HHHF 4CLLA 2HS4A 3ONQA 1YRUA 3FMWA 1IN0A 3HJVA 2IFXA 5KG6A 3BO4A 1GNKA 2M70A 1Q8BA 2JEFA 1WOSA 2LQ5A 4O3QA 3W2VB 2D1CA 2MZ1A 2RJZA 3QBCA 2CNLB 3D68A 1NHUA 1X31C 2GV1A 3GCXP 5IC6B 3TUZC 5F8HA 3RUBL 1WG5A 4XAKA 2RDDA 2WVDA 2BA9A 3NOGA 2AIRB 4HDHA 4O3OA 1TFWA 4E2FB 1MLAA 2OD4A 4ZN3A 4CCHA 2IM0A 3FBBA 2BJ1A 5KFAA 4TU8A 4XIUA 4DSEA 2XULA 2WVBA 4HTJA 1A7GE 1JJ4A 3E01A 2B3TB 2OJ3A 3FEYB 2CJBA 3CCUS 5DM6Q 2HHQA 2QFIA 2D3UA 1N36J 5F41A 3W66A 4ECYA 1CS4B 2MEWA 4I6YA 1Q1KA 4K4VA 3AD8C 2R2UA 3UCUP 5KFDA 2FLNA 3CCJS 4P72A 2NUHA 1NPPA 4PG4A 5CA5A 4EFAC 3NWGA 2FZGB 2KH9A 3OVSA 2YKNB 2IDLA 1RYRA 1VRUA 4DR7F 2VG5A 3GWCA 5ADZA 1HNIB 2XGQA 2PN6A 3D2WA 4ELTA 4B3MF 4NLQA 4FF3A 1OY6A 3BPSP 2XWXA 4OHWA 3CC2S 2UXDF 4A48A 4QR2A 2YKMB 2HNDA 3T1AA 4UOFA 3UD3P 5K5MA 1REVB 4KJIA 3QQCD 1NSQA 2Q43A 1KRPA 5C24A 3MGJA 2IJRA 5FD1A 3ZFVA 3P8BB 3J7AN 1WSVA 3UN5A 3EWGA 2VC1A 4J7CA 4OHXA 1N6QA 1RSCA 4UQTA 2FVSA 1EJ7L 4UOGA 5KFOA 2ZKUA 2GMLA 3R5GA 2DPJA 3UD5A 9RUBA 3Q8VA 1Y0HA 2IJNA 3I0SA 1S6UA 3W3SA 2AQ4A 1G6BA 2DNQA 4HKQA 4ZLLA 1O51A 1QJHA 1RHKB 1RAHB 2CPXA 1PCAA 1XMQF 3I9ZA 1UKUA 5B08A 4PWDA 3NGUA 2R2SA 4Z2XA 2AEJA 3DMJB 3GU0A 5F3ZA 4LQ3A 7AT1B 4LSNA 2ALYB 1DY3A 1UP1A 1EETA 4WWSA 5T7LB 3UR3C 1N88A 4KPCA 1RTDB 2E9TA 1B99A 1S1UB 1U6FA 1WHXA 3KFWX 3PYEA 4H4MA 5G0RA 2V2QA 1HBMA 1Q4RA 4L73A 1UWBA 4BWJA 5GADI 4KFBB 1RI7A 4RWXA 2L9WA 1LWFA 4LRBA 5HO4A 1UL3A 3RB6A 3CCES 4ELVA 1XNRJ 4DV2F 1QVGR 3RAXA 1SJFA 2UUBJ 1PYOB 2HKEA 2M52A 3IS9A 1F60B 4N77A 2X1AA 1RT7A 4LT6A 5EHHA 4ECSA 1UW9A 1VDHA 2F4FA 4O44B 2OFHX 3MEEB 4NMXA 4WF9Q 1B0PA 3QZ7A 1NUEA 2KG1A 4C8MA 5JVGQ 2CNOB 1JLBB 3A3PB 3BS9A 1MWYA 4YDXA 4YB1P 3CCZA 3DOLB 4KKOA 2G1HA 4MFBA 4C97A 3DNCA 2RF2B 2WONA 2XYGB 5KFBA 2BVZA 2NCKL 3UCGA 1C1BA 4U95A 4H4OA 3W64A 5AE1A 2GHPA 3ILLA 1S76D 1D9AA 3DXBA 4I6AA 3H98A 1CJVA 2R7SA 3OXGA 1AZSA 1TR0A 2AJ1A 2BANB 1OQ3A 5LMNJ 4EYHB 2BQUA 1JLBA 4B3OB 1FE4A 1S7HA 4USHA 4WKYA 1HHTP 4O0NA 4NXNJ 1XJWB 5IWAJ 3HHNB 2DCLA 2N4DA 2Z2ZA 4O44A 4DMZA 4J9MA 2YH1A 5G4DA 3HD1A 2KHCA 3GG1A 3JQJA 4I2QA 4OI1A 3UN2A 4CLTA 4EZ6A 3EZOA 3KG4A 2H5JB 2QA4S 4GKKJ 4I1TA 2R7RA 1T05A 1UFLA 2XLIA 2K7KA 2MQLA 3DOKB 1JLCB 1AYEA 4X4RA 2PMZD 4TLQA 4ZIWA 1U25A 1RWWB 3F44A 3EZUA 3AA9A 1SQFA 1N54B 2GFFA 3D67A 3KG0A 4HACA 2KT3A 4NLWA 2UXBJ 2JX2A 4GKJJ 2RMLA 4X66F 3BO2A 4HH1A 4XO0A 2FY1A 3Q8YA 2A10A 2G1DA 3QGGA 4ID5A 1C0TA 1F5CA 3W2WB 1YRXA 3KHHA 2MZRA 1EAYC 4LJMA 2XS7A 1QY7A 4BC7A 5HQLA 2HFVA 4ED6A 2JWNA 4ILRA 3J7Z5 4ED3A 2YNHB 2UZAA 2MLXA 4PCQA 1F2GA 1JLEB 1Q0NA 5KTQA 2H51B 4DL5A 2F63A 2JVRA 4WE1A 1MN9A 3MPWA 2CG4A 2PIIA 4DF8A 2F5GA 1HBNA 2XZDB 1JLAA 2DNRA 4V1Ak 2ATCB 3PR4A 4B02A 1DTQA 1N0VC 1MMNA 3AOCA 4PXEA 5F8MA 3KK2A 3LPEA 4CO0A 1HNWJ 3BGRB 1V9OA 4CLWA 4A8WA 4NCBA 1VC5A 1CG2A 2DYAA 1Y5LB 5HMWA 5SZTA 3QJJA 2A2DA 3B78A 1KFDA 1Y3JA 1VGYA 2BJEA 2FZCB 3LA0A 5MLCV 1RBLA 1AFJA 4O4GA 2DHGA 2YKNA 3WDOA 5DGAA 1OJ4A 1KSPA 2WVEA 3CE8A 4URQU 2FY8A 1NDKA 4K0KF 3ITHA 4JOUA 2C28A 1P1TA 3D7SB 3V6JA 1VFJA 3IA0A 5K20B 1GTHA 2MPUA 4MK8A 4UZCA 4QYRA 4DEZA 3BJYA 5KFUA 1XERA 4UZBA 1ELOA 2HPUA 3A3NB 1BD6A 4KO0A 3CIMA 2M8HA 3TUPA 2ZNYA 4O3PA 2B5JB 2FC8A 4EUVA 5B0GA 1RB0A 4Q5VA 3PW7A 4FNIA 5EUHA 5CAAA 3Q8SB 4OHYA 5ETTA 2OHDA 5DZ6A 1U0HB 1G7CB 1RA7A 3IWXA 4BWMA 2R8IA 3C66A 5EGYA 4LFAJ 4ZPAA 1BUXA 2OPPA 1FJEB 1EQ0A 4K7QA 2I1RA 4ZDNA 3MTJA 3CD0A 4OI4A 2FYXA 1RBAA 2VV5A 1KS2A 4WIIA 5CZVA 4ZP6A 3GSDA 3UD4P 4PAAA 4G65A 2OPRA 4JYAJ 4J9KA 3W8GA 1D3WA 4NMLA 4RNFA 4F2SA 2EC0A 2CJYB 4LF2A 1RXOB 3PO4A 2XTJP 2QL7B 4QR0A 4K50A 1UAWA 2MHNA 3BGFA 3I5CA 5H9EK 2CRLA 2J7KA 2PA3A 4F3OA 1N33F 3FMBA 1FA0A 2J7WA 2HWHA 4C0OC 3RW6A 2ASLA 2MKCA 2VDHA 4WTOB 2XY5A 1U6BA 3KUHA 2HIQA 2HVDA 3D1OA 3NOCA 4I2PB 4TXSA 4DSIA 2QA1A 2HGMA 4LVOP 4XDDA 3ZO7A 1IR1A 1S4EA 3MEEA 2EFVA 4DBQA 2D9OA 4UOHA 5KG1A 3UNYA 5C42A 3AQPA 2BOPA 2F4VJ 2W2PP 1YLXA 2AYEA 3MUMP 3DDKA 4ECQA 3BN4A 1SJ3P 2C42A 3S7RA 2YX7A 3M30B 1TP7A 2WVCA 4DHVA 1RWPB 4F50A 1WDDA 4B08A 4YS2A 2E7WA 3GYNA 4URGA 5ETKA 2HBRB 1Y3KA 2HLUA 4Y28C 4IOCQ 4WJBA 2BM0A 1WKKA 2CG8A 3HHLA 4P2FA 3R97A 2DEJA 4F0KA 3PKYA 2GIRA 3HJFA 2EFOA 3PIOQ 2MZJA 3UWTA 3DRSB 2W24A 2VIHA 2OEJA 1HHQA 2ABYA 3BEGB 3IWNC 2R7OA 5FLXU 2FUG9 2RQ4A 4FS2A 1HWKA 1D9FA 1BY9A 3Q8RB 3LGNA 3QRRA 3NBPB 4OZLA 1RTJA 4DL3A 2KVIA 4C8LA 1HMVA 3BSCA 3MM5B 4IH7A 5A8RA 1RWUA 5KFWA 3R5CA 3PX0A 2Z30B 2CJ9A 2AYGA 2OTJS 1K9MT 4C98A 4FKYA 4QR1A 4JI7J 4M94A 2B4PA 5ITHA 1X9WA 2OELA 3DLLQ 3KK2B 3C15A 3N9UC 2B8QA 4CP5A 5C7PA 3QRPA 3HZGA 3IP0A 3RGIA 5KFSA 3PYFA 4F4KA 1YBUA 4RBUA 4C48A 1OIAA 4QIEA 2CQ0A 2ZVIA 3SQGB 3WZ0A 1UA1A 2NZ4A 2BBEA 4JUZA 1RT1B 1PYSB 3AY0A 3O1LA 2Q6CA 2BACA 4ECZA 1S10A 1IBKF 2APOA 3DGVA 4CNYA 3TNVA 3KLEB 1WHYA 1GMWD 2L41A 3B4DA 2D9PA 2R3VA 2ZBRA 2UUAJ 3K5OA 2VBWA 4FYVB 1Q95G 2P6SA 3M6XA 3DRYA 3KK3B 4DZDA 2HYIB 2ZBIA 1U24A 1NNDA 4EK2A 2AYMA 4JI2J 1PYTA 2VONA 4DR5J 2H4YB 1RT5B 5HAOA 4IH6A 7FD1A 1NDCA 2I5JA 2FDNA 2MJUA 1EKRA 1JXVA 4IDKA 2ZOFA 4OHVA 3VAIA 3BM7A 1HW9A 4JV0A 1HL6A 2LKZA 2UXCF 4N5SA 1FJCA 3QGIA 3RBXA 4ZK7M 3IO1A 4UF4A 4OZ5A 4PUOA 5DJBA 2OIHA 1FE0A 2BRKA 2ASYA 3D0GE 1UVIA 3TEGA 4UW2A 2MXYA 4OJGA 2NPIA 4OZ2A 3W9JA 5EWGA 2DHXA 1FDBA 4UTGA 4DDFA 4CIOA 5L1KA 2JLEA 5IQQA 3VAFA 1EIYB 4I2QB 1S9GA 1TUWA 4KGMA 2B7CB 2JLFA 2DO0A 5AXKA 3WX8A 1B7YB 1O5JA 2DJWA 2VG6B 2XHWA 2V2VA 5AJ3F 2R8KA 3KNAA 3LUYA 1IBKJ 4DR2J 1HHSA 3FRYA 3EVWA 1RA6A 4L3KA 4QPTA 5D0EA 2LP4A 3IGVA 4DV0J 3HK2A 2BYCA 4CH7A 3GP9A 1LW2A 1RAIB 4ZVGA 1MMLA 1OPZA 1TL3A 3CDUA 2KXHA 1R0AB 2ZM6F 1EP4B 3OR2A 2UVRA 1UW4A 1WUUA 3NG8A 3SV3A 1ZAVA 1CJKA 1X4FA 3SV4A 3PO5A 4OI0A 2OKQA 3RRHA 5D4LA 3BQ2A 5BYRA 3OJUA 2KVQE 1S0OA 3J81U 1I51B 1YVFA 4YHHF 2K3IA 1HNVA 2ZJPQ 4U7CA 5KFMA 1B4SA 1GMVA 2FLLA 5HMXA 2J6TA 4X4UA 1NZ8A 3CWJA 4B9MA 1U02A 3G96A 1YJ7A 2P8IA 3K2YA 2AJQA 1GH8A 3RAQA 1S7IA 3VAJA 3K8VA 4ZVSB 4ZPWR 3RYLA 2QEXS 2YNGB 3IAS9 1YK9A 1RYSA 4HI2A 2IVFB 4OX7A 3VVUA 4IRCA 2HAIA 4OQJA 3VZIA 3FCWA 5KOWA 4YN3B 1FFGB 2I8EA 1M5HA 4B3TF 5ETVA 2C2MB 1D9DA 2W4PA 2VF3A 4A8YA 1UVMA 2RKIA 2Y3YA 2WSCC 1XEZA 2V0NA 4DJBA 1IQTA 1K0VA 2B4OA 4IUFA 2KN4A 4IOAQ 2E1RA 1N8RT 4PWDB 1S9EA 4LSZB 2KTQA 2E66A 2YKPA 1HBOB 2W4DA 3MTKA 4ANDA 5IZHA 4RNNA 1QSSA 2J6SA 3C19A 3C6TA 1U48A 1SVDA 1T3NA 1P9QC 3AJ2A 2ZHAA 2AJFE 2JC0A 3CCQS 2XY7A 1S1WB 1U1QA 2GHWA 3AJ1A 1S0VA 4MT1A 5KFTA 3N28A 3TP2A 2EG2A 2HQ3A 3OL7A 3SI8A 2HHHJ 1XQIA 3MFHA 1HWUA 2IMWP 5J2MA 3CJ0A 4HLBA 5E5NA 2WK4A 1WKLA 1V3SA 2DHHA 2V8GA 1RT1A 3IG1B 1V5IB 2VASA 2X1BA 3KJFB 3MECB 4DV7F 4RW4A 1WG4A 5HANA 3U7JA 2YBVA 5EWFA 2HMIA 5HP1A 2HVIA 2HNZA 4LRFA 4NLUA 1NKBA 2EFQA 3KLGB 1TUVA 1MW7A 2GVDB 4USJC 4J9QA 3OFFA 3UVJB 3M8RA 1EQMA 2VFVA 2OPQA 5IV4A 2YKQA 4KT0C 1SIZA 3MEKA 3OFGA 5DDPC 2OAUA 2EEYA 4LRAA 2O01C 4RNHA 1C0TB 2XYPB 2W2NP 2ACYA 1T9UA 1ZZNA 3BYPA 2J8AA 3ZC4A 3P5BP 3GQCA 1ITPA 1S0MA 2QIFA 3TZXA 4IOBA 5ETNA 2H48B 5C25B 3CJ5A 1P6TA 3IFEA 1FFSB 3KKFA 1XNQJ 2FPHX 3Q22A 2FJVA 3N79A 5A2QU 3FK4A 5GAHI 1HQEB 1U09A 3GE9A 3TAQA 2UUCJ 2M9KA 4I0WA 5M2PA 3W65A 1IBLJ 2ZWPA 3PM9A 3SDEB 4LFBJ 3P4UB 2IVYA 5J1EA 5DLGA 1W2IA 1XR5A 3CD6S 3KJNB 2OLWA 4K59A 5CYMA 2YWKA 2OEMA 4YB6A 5KT4A 3GV7B 3LAKA 3M7VA 1WC4A 2DGVA 1LFPA 2ROEA 4NI2B 3P5TL 5KFHA 2ALZA 4RW7A 1IM6A 2FJWA 2BZ2A 4IYQA 3D1QA 1OMSA 5AXNA 2FJXA 3VALA 3L95X 2IM3A 1CC7A 5ETMA 2BE2A 1T95A 4C8OA 4ILMA 4PXDA 4YY3F 1VBZA 3OR2B 2OMLA 4OZ1A 2NUUG 4Q45A 2UUCF 1AROP 1R0AA 1TL4A 3ILOA 2DITA 3MM6A 3SCLE 4H4OB 4ANCA 1WC3A 2WSFC 2RRNA 1ZTTA 4M95A 3CULA 1TKDA 1T7PA 2LU1A 2L9DA 1HBUA 3R7BB 4P2SA 2MQOA 4AE5A 1JX4A 3R5DA 2R9LA 1SC4B 1SIWB 2PO4A 3BF4A 1YZ6A 1LFWA 3EVOA 4K5SA 4OV6A 2CPFA 1H0HB 1VK3A 4ATNA 3KLVA 3BR8A 2XS2A 1T11A 2IM1A 2I0XA 1UCNA 2Z4PA 2Q6BA 2WB1D 5K8PA 3CCLS 3LH2S 3QT8A 2QFJA 1S79A 1PIEA 3W60A 3M8ZA 1VJWA 3M6UA 2EI5A 3MOZA 1FKAF 1N32J 2GIFA 2ROGA 2JH3A 2C3OA 4OX9J 3GJRB 4FPRA 1KN6A 5IM0A 1AW0A 1Q5YA 2B9XA 2CPYA 3GTYX 3SIPB 2ROPA 3FZBA 3OHAA 4NE9C 2CPEA 2HQFA 5LJ3Y 4ED4A 1VIOA 3OVAA 3G6ES 4ECUA 1RHRB 4KGVB 5EX3A 1FCAA 2Y8WA 4XPCA 1X5TA 2V69A 1OQ6A 2LXIA 4X4TA 1KONA 4YP3A 3M32B 4X4QA 2MLZA 5T7LA 3IRWP 2I5JB 5JXSA 4O3SA 4WZQA 1RWMB 4NOHA 4BC9A 4KH0B 3PR5B 2FJBB 1TL1B 2AEFA 2FTRA 3HULA 1FXLA 3OHBA 3EVMA 2J9DE 4OJ3A 1TV6A 2NSBA 3HHLD 1JJ2R 4LF7J 3OTOJ 2K8GA 3TANA 3NNCA 3GR0A 1YBAA 3H2UB 4RUCA 2KYXA 4OYPA 3RB4A 2G4BA 4HHJA 1HPZA 3H8YA 4XK8C 3MOJB 4J9SA 3PYDA 4USIA 2PE8A 1VRTB 2N4CA 2PA8D 2DHSA 3T41A 2HRUA 1IVZA 3V4IB 5KAKA 5DLFA 2NXJA 3Q83A 4DX8H 3CD5A 4ID8A 5D3GA 3AOBA 4MIAA 4DOZA 3BKUA 3K57A 3I0RA 3Q24A 4B9SA 1RCOB 1UJ4A 2L3MA 3HSZA 1REVA 4I68A 3V4IA 1JLEA 3NMAA 2O66A 3T9NA 4ZCMA 1G3OA 3P6YC 3LQVA 2H5IB 3CJ2A 4Y6IA 4CLSA 4X65J 1HNIA 4Y2KA 3CMAS 3K17A 3TEHB 1HMVB 2VKRA 4XDCA 1U1KA 4DV1F 4P7TA 2XMTA 4CYUB 3A12A 2E1AA 3GYGA 2C2DA 2E1PA 3ZZUA 2NS1B 3KJVA 1KD1T 5KFIA 3KMQA 4WKRA 2LQJA 2AYBA 2Z8QA 1JLFA 3DCAA 5BR8J 4R8UB 3OXLA 1WHVA 1FKPA 4ECRA 3I56S 1XNQF 2QLXA 3UN3A 4DF4A 4LRDA 3THTA 1VQKS 2ZWOA 4RJVA 2HHSA 4KHPF 4PYDA 1ZAWA 1UMJA 4H4KA 1UEKA 2E29A 2CFXA 3PACA 2L9NA 3N0VA 2HWTA 2E5IA 4CM0A 2HQIA 1FWLA 2ZH5A 3ET6A 1J27A 4DR1F 1VQ9S 4L3NA 1H6KX 5FLXY 1FX4A 5IXUA 2V68A 3MPDA 4YQWA 5T41A 3BREA 3M6WA 1HR0F 1AUDA 2W01A 1JNZB 2QL5B 2LLZA 4TN2A 4WP9A 1VQOS 3M1VB 2JFDA 4Y65A 1PJ5A 4ZPCA 2H54B 4JI8F 1X9MA 3LP0A 5GAHU 2A6MA 5LSRA 1I94F 2HGNA 2HVHA 3MMCA 1FRMA 1IKVA 4ZP9A 4ZJOA 3F73A 2OH2A 1UTAA 3Q2SC 4QU7A 2W2QP 5KT3A 1KNZA 4JYAF 2G9OA 2F65A 3MM7A 4ZOSA 3TVZA 2XLJA 1O8BA 4KQZA 1S0NA 1YGYA 3VVTA 1NJYA 2Z0GA 3HHDA 2HBZB 2V94A 2J5AA 1QUVA 3MAHA 1VHFA 3D28A 2HEKA 5L8RC 3UCZP 2OFGX 2V34A 4ED8A 1GT8A 4ZP8A 1FRHA 4JI5J 4ANEA 2WONB 2XMWA 2CQIA 4ZCIA 3MM9B 3DOLA 4OI2A 3UO0A 1DFDA 4OIXA 2UXDJ 5B0BA 4PG6A 1TZ0A 5J2NA 2HFOA 3PYGA 1VBYA 2XB2D 1HW8A 2DY9A 4PG7A 3HFKA 3FCVA 1Y5NB 4W98A 2MGZA 2JEJA 2XNRA 2VUGA 5JJBA 3GMGA 5IT0A 1H7WA 3UI3A 1S1VB 3GV5B 4PKDB 1N32F 5M2RA 2WZ1A 1KWMA 2ZC4A 1CQMA 4KGKA 2J0WA 2IDEA 2MQMA 3LWLA 4DZ6A 3RU0A 2BOAA 2KRRA 3QATA 1KFSA 4NLXA 2LDIA 1OYEA 2BXJA 2P2CB 2OO4A 1EB0A 1N34F 3MCOA 2V8PA 2VG7A 1HQEA 4O3NA 1WC6A 2W8LA 1TKTA 4EBEA 1EETB 2AX1A 3CSKA 5F0WA 3L9ZA 3D6FB 2RS2A 1HQUB 2DXDA 4R0EA 5HJXA 3MEDB 5C25A 5LSLA 5DG7A 1DBDA 1VK8A 8ATCB 2XO7A 4WU3A 2QX0A 1YTYA 4DL6A 1M5KC 4ZPTR 2M88A 2IAJB 2CWXA 2KU7A 5KOXA 4JI3F 2JLGA 2HHVA 2VPXB 3KK3A 1H38A 2RQMA 1HQ2A 3EXYA 3TAPA 4U6PA 4FBUA 5HLFB 1SV5A 4IFYB 3Q8UA 1YJNS 2U2FA 2Z57B 3AQOA 3EJMA 3ISND 4L76A 1M1KT 2B9WA 3CDEA 4ED0A 4RLEA 4AL6A 1R6VA 3TAMA 3SQGA 4DSJA 2VJVA 2HZVA 2HMIB 1GTEA 4QZVB 1CJTB 3I5AA 4C0BA 2IM2A 1PJ6A 2YXLA 3M8QA 1T9YA 1RT3B 3KHLA 5J2MB 2HHXA 2RU9A 3GFYA 3ZZYA 1U2CA 5A8WA 4GKKF 3D66A 3RR7A 4J9UE 1SKUB 2DEIA 4OYZA 3US5A 3CCVS 2PI4A 3D6MB 3Q86A 3ISZA 1RP5A 4ID5B 1Y10A 2HVEA 2HS3A 5LJ5Y 1FEHA 3W9IA 2DRBA 2RAQA 4U96A 2NXNA 3TZYA 1PBUA 1SJ4P 3Q0AA 2CAJA 3LANA 3IR7B 5LMNF 1FX2A 3G71S 2AKWB 2FVPA 1NPRA 2J0SD 1FJ7A 2W1BA 5IWAF 1N5QA 5DZ7A 2DGXA 5IC4B 3ZTPA 3EICA 2PFFB 3R27A 4N8NA 2Y8YA 3EDRB 5KG5A 1IR0A 2IIHA 2LQ8A 3BH6B 2NXEA 5HJYA 4NRUA 2GZOA 2HZCA 3FEZA 4HVZA 1NO8A 3BSAA 5EDWA 2BRLA 2GMJA 4F04B 2ZZMA 1NHVA 2LQBA 5L1LA 4DFKA 2JEGA 3T1HF 3A8IA 4KC5A 1MSWD 3T5HA 5LMUJ 3DHXA 2GGPB 3NGDA 1CBKA 8RUCA 1AXQA 4FP9A 4C11A 4DV7J 5HBMB 1NSKL 2XI3A 5KG2A 3M2VA 1GXTA 1CJUA 1DARA 1FEEA 4J91A 5F8IA 3UFCX 1NK4A 3EMTA 3NNHA 3M9OB 3MDFA 1NPKA 3G9CA 4MYTA 2DO4A 1BGXT 3PEHA 2G13A 2EFPA 3L7PA 2HK2A 2W2MP 3TR5A 4K4ZA 4FYDA 4LF4J 2CJXB 4DG1B 3QMQA 1T9TA 4M5GA 1S6QB 3MR7A 3A8EA 4UUWA 5GMDA 2V6AA 4OX6A 4M8LA 3PW4A 3N01A 4PWWA 4C9DA 4NRTA 1QVFR 4DQPA 4FXDA 4RPFA 1E6YB 4DFMA 5JMNA 3BSOA 3MM7B 4USTA 4RNOA 2HURA 3W5YA 3BBBA 1FK9B 4DCJB 3ZXWA 4TQRA 4M5DA 3VGTA 4QW9A 2HG4A 4AL5A 3O44A 2KFNA 4KHPJ 2R7TA 4U8VA 4C11B 3B4MA 3D0IE 3PZPA 1RT7B 2YQ3A 1CULB 5AE2A 3KHGA 3JAMY 5J2QB 1W2BR 1Q86T 4NI2A 4JI0J 3QWPA 1SUQB 1VQ8S 3H5XA 3BGOP 2R8HA 1XN9A 4A8MP 3G82B 3ICLA 2HK3A 2UVUA 5E41A 5BYQA 4R5PB 2LEAA 1PSDA 3TQEA 4F7VA 1M1GA 3O2IA 3S6EA 1S48A 3CPWR 2IYIA 1R8BA 2F40A 2GAHC 3AHPA 1KC8T 2YY3A 3CNQP 3KUGA 4HI1A 1IJFB 2EKNA 1M5OC 2DISA 3ULHA 4DX6A 4NLRA 5AJ3J 4K0KJ 1REGX 5LSOA 3KNGA 2PEHA 3F41A 2GO8A 2D7SA 4DR2F 4ZS6A 2E5HA 4ECVA 3DMJA 5HROA 2DR8A 1F0XA 2A6OA 2BQ3A 2AT1B 4ECWA 3E2EA 3SMZA 4ZKAA 4ENOA 4ZN1A 5BXIA 4DV0F 1NJWA 1RT4B 3PRVA 4CM2A 2ZUGA 5CABA 3EPGA 3K59A 1FD8A 4O4GB 4NYPA 3EM1A 3TZZA 2H65B 5AXMA 1VC6A 4J9PA 1ZTWA 4C8YA 3IGNA 2GJ2A 2P9CA 2H1YA 4EWTA 1QAXA 2H3EB 4IRKA 1D09B 1X0PA 1WACA 1X4BA 1JLGA 2GVDA 2MB0B 1RAJA 1YX2A 2AP6A 3FBFA 1RTIB 3G8QA 3HKZD 4TY8B 5IT4A 4ECXA 3MAAA 1UVJA 2QRRA 1RTHA 1JLAB 2IVMA 2ZDOA 4AD6A 2C3MA 1YG0A 2MMYA 3BGLA 5D3GB 2IMOA 1SKSA 4KYZA 4TY8A 2MSSA 3JSYA 8AT1B 3FSYA 1NK8A 4FVCA 3RTVA 4A8KA 1ULRA 5IOLA 4BS2A 4M5MA 5DG9A 2KM8B 1HNXJ 1QUPA 1TMJA 3EGWB 4QYZJ 1PILA 2Y0BB 1OWXA 1AUSL 2WAQD 2EXUA 3CO9A 1F5BA 1Q7LB 4KIAA 4MYUA 4CT9A 3PFEA 2RQCA 1PKUA 1P9YA 2FZKB 4NLDA 1M90T 3HVAA 3MUVP 1EZZB 1EHWA 2DGUA 2A3JA 2AV5A 4CLYA 3C16A 3BGUA 3MMBA 4PABA 2BKPA 4IKAA 3VV2B 1Q7YT 1CS4A 4MKBA 5I42B 1HNZJ 2VBXA 1VLOA 3MD3A 4FS1A 4DUYJ 3E01B 2IYGA 2FC9A 1RAAB 1RAOA 2FGOA 2ZBCA 3D6HB 4CH0S 3JAMU 1BE4A 2KXNB 4PG5A 2GCFA 4ZVFA 2HVZA 3AD9C 5KG7A 3HM9A 3OSPA 2V2ZA 4FKXA 4HEA9 2HHPA 3KWMA 2DR6A 3D5MA 3SCJE 1H3DA 1SQGA 3AT1B 1T05B 4KV8A 4Y34A 1X8DA 3CO0P 3BDPA 3K0JA 4QU6A 3EUNA 3G82A 4JI7F 4NCGB 4CLUA 3R2DJ 1EX8A 2C3PA 2Y1RI 4L74A 4LFCJ 1RAGB 3FKBA 3RW7A 2V9KA 4IG0A 2X1GA 1UPMB 2YWEA 2ZC3A 4M5HA 3AXKA 4WXWA 2NPFA 3BSNA 3F56A 3FSIA 2DGWA 4AUKA 3MFIA 2ADCA 1FNXH 1RABB 5E3RA 2V4QA 1I3OB 2XHCA 4B3SJ 4KH1B 4WBFA 1RADB 3OR1A 2BV3A 3RZAA 1UWAA 1RWOB 3VCDA 3Q89A 1KLMB 1H7XA 2FJEB 4GKJF 3VAKA 1CJVB 4GC7A 3NEKA 2C2ZB 4DLEA 4LF5J 1TKZA 1VBXA 1IBLF 4LF6F 3I9V9 1S1TA 2QSFA 3NGRA 3VHQA 3CXCR 1CLFA 3MM8A 1S6QA 2CADA 1LKZA 3R7SB 5H9EJ 1FJGF 2WB4A 5E3CA 1PAEX 1UZDA 1P27B 1RT2B 4OJ1A 3FGVA 4L6V3 4WXOA 1HLWA 3I4HX 2C3UA 2ASJA 1NK9A 2YNFB 5CH7B 1IKVB 2R7XA 1CJUB 4F8RA 1ZA2B 2CQ4A 4CDIA 1XIQA 2OPPB 2AJ0A 2YQ1A 4NA2A 3FBCA 1DLOA 4PXCA 4DL0C 2LMIA 4L75A 3ZZRA 5HQ8A 1BHNA 1DTTA 2DRAA 2V9WA 1C1CB 3MCMA 4J5OA 2RB7A 4K4UA 4NCGA 4M5NA 4WZMA 3NNAA 2DNOA 2E7XA 3R5BA 1H73A 1ZAXA 3QLHB 4FNHA 2E1MC 2X3DA 1WTFA 3CMQA 2DNGA 4KFBA 1ZM4A 5E3AA 1HBMB 3FC9A 4LR8A 2P9GA 2Z58B 1KTQA 3SDEA 3QIPB 3AODA 3QJLA 5LT5A 1J5OA 3G6VA 3AOAA 3O6QA 3QGPA 3DYAB 4KHRA 3E51A 1BWVA 1VRQC 4MK9A 3SFUA 5B0DA 1NK7A 4KTQA 1S97A 3GPAA 5I42A 3S8SA 4DR6J 3OSNA 4HR2A 5GMKa 1SBRA 2RNEA 3OVBA 3GSIA 1M5SA 2LXUA 4TKTA 2W9AA 1YIJS 1J5EJ 3N6NA 4DR4F 3M8WA 3I96A 2BKOA 2RUGA 3C6UA 4B9VA 2FHMA 5LXRA 1OSDA 2VQEJ 3OTOF 2V50A 2LEPA 4DV3F 2OPSA 4DR7J 4PQUB 1FDNA 4U9RA 1JQGA 3D3CJ 3K58A 4ELUA 3UVJA 3CJ4A 5EWEA 4DV6J 5A8WB 5CD4H 2VKZG 1KBRA 4DV2J 5LMUF 2DR5A 4QCLA 1IKYA 1X4HA 4ITSA 5HP1B 4DV4F 2X51A 4CO1A 4USMA 2VQFF 2YWWA 3J7YU 1RTHB 3B6BA 1S77D 4WE1B 2GMHA 1R8HA 5T14A 4J90A 4K5RA 2EFGA 1FF2A 2RRBA 2VPWB 4RKUC 2NREA 1VBKA 2ZZNA 4IFYA 2FB0A 4LVNP 2FQQB 2QYCA 4OLOA 4CO3A 3PXGa 3DN9A 1CQNA 1H2UX 1VRUB 2MQPA 1WELA 1NB7A 3EGNA 1YKWA 3NRBA 3NBPA 1F9EB 4AXIA 2BABA 4Q7AA 1I6JA 2YX1A 2CXEA 1SKWA 1YJTA 1U4BA 4EYIB 1SB6A 1LOUA 2QMWA 2O3DA 3PFOA 2DIVA 1FERA 1QD1A 1U2RA 2CWKA 1RU2A 3JTPA 1FRJA 3CCSS 1I5OB 1D8ZA 1DQ8A 4DR6F 5KFZA 1EARA 4G3IA 1QLNA 4J9LA 1YDLA 3SCIE 3V4MA 4HT7A 4YDDB 1ZETA 3QIPA 3AAWB 2MQNA 4M63A 3OV7A 2R8GA 4F0HA 1P8GA 1JIHA 4A8XA 1GEHA 4GO5X 4DSKA 4CO4A 4JV5J 5DM7Q 3OFHA 3S1TA 2PMHA 1GXLA 3T6BA 1URNA 1UFWA 2FHJD 2DBBA 5C2CA 1K8AT 1HNVB 1R8PA 2CZ9A 1RBOB 2KO1A 2E5GA 5K14A 4CLPA 1CULA 1D0EA 3GCWP 3K8WA 3TA2A 2OGUA 3IBCB 4M5JA 3SFGA 1XMOF 1BQMA 4M5DB 4WFZA 1K1QA 2ZJQQ 4ZLNA 3VGUA 2ZJRQ 4LF1A 2POKA 2JFKA 2UUTA 4DI6A 1FHTA 2L48A 3DRXA 1VQ5S 2ZVSA 3DM2B 1Y9OA 2XSJB 5L1IA 2D69A 5A0YA 4B9TA 1FKOA 1GAOA 4IG3A 2IRXA 4ES2A 2HFUA 5L9XA 3R1HA 1IXKA 4N7TA 3DI6A 4P10A 4NWBA 2F8MA 4B17A 4F4ZA 3IWLA 3NAIA 3IRXB 3JSMB 2KJWA 4MFBB 1ZM3A 3FNNA 4F4YA 2VC0A 3OR1B 2V5HG 4RX6A 5HSPA 2C2OB 3TUJC 3T3FA 3PV8A 1VYAA 2BMBA 3G8SA 5A6PA 1NK6A 2Q66A 1YBTA 4CLZA 1TAQA 3CD7A 4W90B 4JI1F 3Q23A 4FF4A 4F3QA 3HVTB 3M1VA 3C14B 4J37A 3H4DA 1TVRA 2O1PA 2RD5C 1UEVA 4Y2IA 1S59A 4DQQA 2IC3B 2ILZA 3ZZOA 3A3OB 4OI6A 5CYMB 5F9LA 2B5JA 2ZOMA 4P71A 3M05A 3PW5A 2VDIA 1UWBB 5DQHA 3PX4A 4ZVEA 4LFCF 2E5JA 1X9SA 2EBGA 3W7BA 2J9DA 1HD1A 3BQ0A 2JC1A 3MMAB 1FI4A 4X4OA 2PI5A 4I56A 1R7IA 4OYMA 4GMKA 2NXCA 2V4JB 5CCLA 2PDAA 1BQNA 2CQCA 4LSNB 2B8PA 1DQAA 4DXLA 4F4WA 3R6GB 1UA0A 1LXNA 2RDIA 5F8LA 4R25A 1MROA 4NEZA 3DKDA 4X64F 1LK5A 1UJ5A 3IC1A 3NXZA 4DQRA 2DGTA 4KY3A 2W7AA 3WIUA 3MR6A 1LEOA 3J7ZT 3RB3A 4X84A 4CT8A 5HVFA 1JLQB 3T1HJ 4FPIA 3PDNA 1S72S 2GJFA 3LPYA 2UUBF 1SL0A 3OTDA 3KTQA 4DS5A 4I7FB 2AGOA 5HVGA 2MKHA 1MMDA 3TAMB 2DNNA 2YVSA 1CC8A 4NLVA 4K4WA 3R1LA 1S9FA 3BBCA 3QYYA 5F3TA 2AZ3A 3QT6A 4H54A 1LWEB 2LCWA 4D3HA 2HHUA 3M2UA 3U27A 2HNDB 5THWA 1VRTA 2YNHA 5I4MA 5KFEA 3VTIA 1F9HA 3IM9A 1L3UA 4OYIA 5GVQA 3VQSA 1UZHA 3TX8A 5CHCB 5I3QA 1S6PA 5KT6A 4QIWD 2GJIA 3FFIB 2CQ3A 3C6TB 3H42A 3HDSA 2P6TA 5FIIA 1M0SA 1U49A 4KPYA 1FJGJ 4WIQA 3JYTA 1KVKA 2XNQA 1XMQJ 2KB2A 2KFZA 5D8HB 1LQ9A 1SH0A 2B9EA 4N47A 4UY85 1OS5A 1U7LA 2GAGC 3ENWA 3H7HB 3HSJA 1T9WA 2VA2A 2UUWA 2RILA 1VHIA 1VQNS 3GG0A 2IA6A 3ZZTA 2VG7B 1PC4A 1VISA 3TARA 5C5JA 5D4NA 1TL5A 2HQCA 3HHLB 3OLBA 5CYQB 2WTFA 2VHGA 4ETXA 4EBCA 2XG8A 1ZM9A 2CNNB 3W61A 1URRA 2HWIA 4R5PA 4JV5F 2C2EA 1NU4A 1XTZA 3AXMA 3HD2A 3SEOA 3POTB 2R4FA 1U1OA 4NXMJ 5CXTA 3DLKA 1S1VA 5J2QA 4V19J 3C46A 4C3LA 2ZH3A 2CQ1A 5GAGI 1BC6A 1GQEA 3J7YI 3ETOA 1FDAA 4Y0FA 4QWDA 1WC1A 1N5VA 4F2RA 4JI4F 1RU1A 3SZ2A 3EYZA 1C0UA 2NYIA 3M8PA 2I9SA 2RU3A 3H40A 4RW6B 4ER8A 3IRXA 4B9NA 1EP4A 1HYSA 1HARA 3DI6B 1L3SA 4USKA 1GXUA 2W8KA 3QSYB 2QMXA 2ZITA 4DX5A 1K0TA 1OYDA 1IQZA 1M1HA 1C1BB 4HDGA 1KHVA 1IBMF 3RRGA 2AZ1A 3BR9A 3BV8A 2VODA 2RSQA 1JKHB 2CA9A 2OSRA 3H20A 3NGTA 1RZMA 2OPRB 3BN7A 3CDWA 4NXNF 2BE2B 3R7NB 2ZH6A 4WFXA 1S1XB 4OYOA 3PW0A 4DWIA 4IQXA 3MHYA 1BQMB 2LQ9A 1M5PC 3LP0B 4ZVPB 2EVZA 4NLPA 2AGPA 3GIKA 5CCMA 2V67A 3CGIA 4N8OA 1U0HA 3R3TA 3POTA 4OZ3A 3SXLA 3H2VE 4NYZA 2VQEF 4DV3J 2ZUAA 2R2RA 3GR1A 4QWAA 1PGZA 4OFZA 2J6UA 2XSFA 1WDTA 4M5KA 2G0CA 5F0UA 4X4PA 2W7PA 4KV8B 1KDNA 1WOOA 2KDOA 2WCXA 4JB8B 4LF9J 3KJQB 2XYHB 4ZHRB 5J1PA 3TA1A 3PIPQ 3TX0A 4H4MB 1KKHA 3HLUA 2N3LA 2R2TA 4GO7X 1I94J 1NSAA 4CZCA 1S12A 2K3KA 4P2MA 3BQ1A 2CJAA 1JWWA 4U7UD 1VCTA 1JNRB 1RT6A 1LXJA 3B54A 1ACMB 2ZD1B 2BJ8A 3IMQJ 2C2RA 2VOPA 1MU2B 1GFWB 3HSDA 3R8YA 2HNYA 1ICEB 3L7OA 4QIFA 2FLPA 3CC7S 4JI1J 4HTIA 3LP2B 3OTCA 4TYBA 3TZWA 5JUMA 2G0IA 1TQLA 3LF0A 2OPQB 1G2EA 2MSTA 5BR8F 2GQQA 1HFEL 2D3ZA 4ZCLA 1ZYQA 3M2UB 2GQCA 2BDPA 2W25A 3OW2R 1CJTA 1WI6A 2B51A 3I0RB 3A4TA 1BXNA 3EXCX 2EK6A 4DPUA 5C24B 3HMJG 4EBDA 5LOQA 3MECA 1MWZA 4ZIVA 4X4SA 3T1YJ 3T1YF 4B3SF 1TUGB 4JI3J 5E7OB 2DNPA 2M0GB 4LR7A 1JLGB 1VMBA 2QA2A 4WFNQ 1WI8A 4ES3A 2CVIA 3TO8A 3H4BA 3RBEA 3CTRA 3DGPA 4DCOB 1IJEB 3WX4A 3CIZA 2LECA 2GHVC 4FYYB 2I6WA 4PRFA 2M2BA 4Z37A 3NCPA 2V8VA 5F8GA 2GA7A 3HHKA 1KR4A 4OX8A 1FRXA 4MKAA 2MKIA 2EG1A 1RE1B 2BJ3A 4Y3CA 3ENVA 5HROB 3HT3A 1CPZA 3MUTP 4DS4A 1FT8A 2V4JA 4ZP7A 1U8WA 2LYVA 4KHMA 2H5EA 4FVMA 4EO8A 1RDRA 4D3GA 1FVSA 4IFVA 4W4MA 4P9SA 1RLCL 2DT9A 4ZHRA 2W9BA 3UDEA 3J80U 1F6TA 3QIDA 2LFVA 3SSQA 5D6GA 2ZE2A 4QYZK 1N5YA 4KGZB 1NMEB 2IY5B 2IC3A 1UETA 3HVRA 3SBMA 3K5LA 4EMDA 1IWGA 3K89A 4UUXA 5D0GA 1DTTB 2FHKA 5I3PA 5H9FJ 2ZH2A 1T9VA 2BX6A 2M3DA 4ALZA 3FDSA 4LFAF 2UU9J 2JL9A 3X1LB 1VIXA 3N6MA 1GX5A 4RWWA 1FFWB 2HBYB 3R5JB 3MR5A 3FSXA 4F4AA 2OMOA 1AFIA 1JXEA 2AD9A 3PEJA 1VS3A 1VQMS 3NS6A 4ZVRB 1N52B 3RB0A 1VC0A 4OZJA 1NH7A 2R7VA 1SJ1A 2CJKA 2AJ4A 4RBTA 1C2PA 1S1TB 2DNLA 1FD2A 4IRDA 1DRZA 4CTAB 3R2CJ 5D4OA 1V6HA 3U1MA 3M8SA 3DM2A 2Y9HA 3DRRB 4FXVA 2ZH1A 3V5RA 2JRSA 3ENQA 3RG6A 2B9YA 4KRWA 4ZLPA 5SUHA 4Q2LA 4A8OA 1F1BB 2XEXA 2RRAA 3B8HA 2X1FA 3V6KA 5HBMA 3A8KA 4C7QA 2YPYA 4MAKA 3OXFA 1SCJB 3ZNUA 3PVXA 3G6YA 1WEXA 3HVWA 1U1MA 1OSCA 1YJUA 4TQSA 3VAMA 3CCMS 2DY1A 4CI0B 4USVA 3CDBA 3IR5B 4C8KA 4A8FA 4P73A 5HATA 1U47A 3ET6B 4P7VA 1FVQA 1Y5IB 3G87A 4DN0A 1RGVA 1X5OA 1Y00A 5ETQA 3UDCA 1YI2S 3N4WA 4G1IA 1SJQA 5J2PB 3HX9A 3BH7B 3GIJA 4NPOA 3TWZA 1YZ7A 1NDPA 3WBZA 1Y11A 3ZTSA 2VB6A 3DC2A 4YY3J 2WOMA 4X4NA 4QPXA 4LF8F 1VQ6S 3UNGC 4X66J 3HFZB 4N41A 4MJKA 3E8OA 4P2XA 1V5VA 3DU6A 3OFEA 4NYOA 2GVZB 4LFBF 5F8NA 4GRSA 4LIRA 2ZHBA 1N5SA 1ZZFA 4JI2F 3KLFB 1B0TA 3GZ7A 2QLWA 4MIWA 2XBPA 3G4SS 3HP6A 4B3MJ 1D8YA 3HI9A 5LL6d 2JJ4D 1DHMA 2DCUB 3BGRA 2U1AA 1NAQA 1VR6A 2RQKA 1LWEA 2DH7A 3TA0A 3W9HA 2KRBA 4O0IA 3M9NB 3FRZA 3GIRA 1PJ7A 1R43A 4RO0A 4DV4J 1N6QB 4URSA 2FD2A 2VOOA 1FRLA 3RR8A 3PG9A 5KFVA 1QAIA 1KQKA 1GX6A 1RTIA 2M7SA 2ZEJA 1VI7A 2ZKTA 1QSYA 3VWSA 2XCPA 4OLPA 1HI0P 4WP3A 5CYJA 1J5EF 3MR3A 2OPSB 2FGCA 2FLOA 2MLYA 4QWEA 2XQCA 2GX8A 3QRQA 1P1LA 3T5JA 1NK5A 2FVRA 2I2YA 4JI5F 2OD6A 1Q82T 2DXFA 3DLGB 2FJAB 2KXFA 1S9EB 2XMUA 1F5AA 1O0PA 3MEDA 2AHOB 2OUGA 3R5AA 5DGBA 5KFGA 3KOAA 1YJVA 2V8HA 4OV1A 4U8YA 3O3LA 5HL7Q 1HKAA 4J9RA 4DQIA 1FTRA 2KI2A 2RKIB 5IV3A 3OJSA 2JOQA 2MKJA 2COLA 2GO9A 1S6OA 3I87A 3M32A 2XC9A 1WJ9A 1LV5A 4LF4F 4ZVQB 1NB2A 2H4WB 3MMAA 2AU0A 1T3OA 4I69A 4Q44A 4DN9A 2X7IA 4DSFA 2V4RA 3ISNC 3HHEA 1S4FA 1VQPS 2VD3A 2C3YA 1HR0J 4OMFG 3TUIC 1KHWA 1C1CA 1VJQA 2CYYA 3ELHA 4EGLA 2ASDA 3U1LA 2Y0SD 3HVTA 1IBCB 4DUZJ 4C4WA 1S49A 3VAGA 2W9CB 1S57A 1K73T 3ZZ0A 1FXRA 4A8QA 1Q81T 3H59A 1AT1B 2KL8A 4B3OA 5J2NB 4I2PA 4RZRA 5CQGA 3PTWA 1AZSB 1HNXF 2AWZA 3HKWA 1G4CA 3CJKB 1YJWS 2B6AB 2F9DA 1BQXA 4Q8FA 4PPZA 1MN7A 5KFFA 2CQDA 1CSJA 3O5TB 5DQGA 1D1UA 1T0TV 2DRDA 3CJ3A 2RF2A 1FWKA 1Q79A 1ZA1B 2CQ2A 4NX9A 4MIBA 4RW9A 5D78A 5A6WA 4Q43A 2XSJA 4K4XA 2XY6A 1YITS 2DGSA 4FF1A 3RBZA 3P3DA 5F8JA 1BWEA 1RK8A 1H72C 4Q0BB 2GQ2A 3QAEA 2KZZA 2C1EB 2VG6A 2QO3A 4OHZA 3SYZA 2W9CA 5K8MA 1X4EA 1JJHA 3BPDA 1QM9A 2DTJA 2H9ZA 1S9GB 1H74A 3L4BC 4A4JA 1UVNA 2QLBB 3DLKB 1JJCB 1X4CA 4LBPA 5K8OA 2M4MA 2XMAA 4MTPA 1TL7B 5D0HA 1HNWF 3EX7B 1LWFB 2BW7A 3IAM9 4FYWB 1QDUB 2ZBQA 3ILIA 2JNJA 3MMJA 1QTMA 4M1KA 3MD1A 1W7WA 2VPZB 1M5VC 4OYBA 4LF9F 4X62F 4IO1A 4JP8A 2CJQA 3LO3A 5KFKA 4FF2A 1F3FA 1U1LA 1KQGB 3DFEA 5IQ6A 2HFSA 2BW2A 4AQYF 1FKPB 3HT0A 4LBHA 1N5TA 3Q2TC 1LK7A 2MY7A 3ZTOA 2DNHA 2CIMA 4ZCKA 4CLKA 2EPIA 3ETMA 3FQLA 4CWBA 3JYTB 5DG8A 2Q1LA 3JQKA 5EX0A 3KK1A 3UDVA 2JHEA 1S6PB 3C3LA 2KT2A 4C8ZA 1X5PA 3DGPB 4I4BA 2CZ4A 4CO2A 1R27B 5K8NA 1HNZF 1WNEA 2MYFA 1ZS6A 4FDFA 4NXMF 3KHRA 2CDQA 2FVCA 2KYZA 3MPYA 3IBFB 3M8QB 3MPVA 1BLUA 1VQSA 3VQTA 3M9MB 1N34J 4HHUA 1SC6A 2HNZB 1R8AA 3NS5A 1HA1A 5AT1B 4C3KA 3V6HA 4DFJA 3UR0A 4RW4B 2YKOA 1QSLA 3TJAA 2ZH8A 1TKXA 5ETSA 4JI4J 3CCRS 5AXLA 4IR1A 1XR7A 1WEYA 3C15B 3D9BA 1U26A 4AQYJ 2VICA 2MY8A 4F36A 4K4SA 1HPZB 5AE3A 2M8DB 1Z2LA 4F0MA 4PQUA 4RBVA 1FNMA 3RBDA 3P45B 3LP2A 4X64J 2XI2A 2A1BA 1RQ0A 4LBIA 2GVZA 5KFPA 4X62J 2IAJA 1A0OB 2BJ9A 2SXLA 1HBOA 4CLFA 1IM4A 3CCWA 4RL1A 4N56A 2FIUA 2ZNZA 5GAEU 3OPKA 3KDOA 3D3BJ 2JZ5A 3BYRA 2QZ8A 3DU5A 2R7WA 2E9ZA 3G2XA 4ED7A 2HLTA 3O8WA 3J81Y 3D1HA 3BKTA 1SQEA 4NLTA 3DDIA 3AA8A 5FDLA 1HWIA 3VAHA 2VU5A 2A18A 4Q8EA 2DIUA 4LSLA 2KJVA 2UV8G 3WIVA 1SL1A 3CCTA 4TYAA 1PBAA 2HQDA 3KXDA 5E33A 1RHQB 1KQFB 2IPOB 2LXFA 2HIYA 2J76E 2HSEB 5KT7A 1WF0A 2O67A 3SQOP 2BUNA 2HGLA 3T9ZA 5KG4A 1Q5VA 3ZZPA 5KFRA 1IUJA 3OLAA 4RUAA 2AMCB 4C3MA 4ED1A 3JB9k 4NCAA 1LWCB 2VBYA 3VR1A 4C6AA 4LMZA 1APSA 1FK9A
chains in the Genus database with same CATH topology
3QBCA 3MCMA 3MCNA 5ETNA 1RU1A 4M5LA 2F65A 4M5NA 4M5KA 3HCXA 3HSJA 1HKAA 1RU2A 1KBRA 1DY3A 1RAOA 1G4CA 1Q0NA 3ILIA 1RTZA 5ETKA 4F7VA 2F63A 3IP0A 4M5GA 3ILOA 2CG8A 3ILJA 3MCOA 4AD6A 5ETQA 3ILLA 5ETOA 5ETLA 3KUGA 5ETSA 3HSZA 5ETVA 5ETRA 3UDEA 1RB0A 4M5IA 3KUHA 1TMMA 3HT0A 3HD2A 1EQMA 3HSGA 1F9HA 1TMJA 1EX8A 4M5MA 4PZVA 5ETTA 3UD5A 2BMBA 2QX0A 1CBKA 3HSDA 4CWBA 1IM6A 4M5HA 4CYUB 4CRJA 4M5JA 3UDVA 3HD1A 3KUEA 5ETPA 4CYUA 1EQ0A 1HQ2A 5ETMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBC A;  3MCM A;  3MCN A;  5ETN A;  1RU1 A;  4M5L A;  2F65 A;  4M5N A;  4M5K A;  3HCX A;  3HSJ A;  1HKA A;  1RU2 A;  1KBR A;  1DY3 A;  1RAO A;  1G4C A;  1Q0N A;  3ILI A;  1RTZ A;  5ETK A;  4F7V A;  2F63 A;  3IP0 A;  4M5G A;  3ILO A;  2CG8 A;  3ILJ A;  3MCO A;  4AD6 A;  5ETQ A;  3ILL A;  5ETO A;  5ETL A;  3KUG A;  5ETS A;  3HSZ A;  5ETV A;  5ETR A;  3UDE A;  1RB0 A;  4M5I A;  3KUH A;  1TMM A;  3HT0 A;  3HD2 A;  1EQM A;  3HSG A;  1F9H A;  1TMJ A;  1EX8 A;  4M5M A;  4PZV A;  5ETT A;  3UD5 A;  2BMB A;  2QX0 A;  1CBK A;  3HSD A;  4CWB A;  1IM6 A;  4M5H A;  4CYU B;  4CRJ A;  4M5J A;  3UDV A;  3HD1 A;  3KUE A;  5ETP A;  4CYU A;  1EQ0 A;  1HQ2 A;  5ETM A; 
#chains in the Genus database with same CATH topology
 4O4R A;  2PFD A;  2YNI A;  2YPZ A;  3DRP A;  4LR9 A;  4MH8 A;  4PQA A;  3Q8Q B;  1ZBT A;  1JKH A;  1Q78 A;  2I38 A;  1YWX A;  1YSJ A;  3T19 A;  1K47 A;  4P75 A;  1SH2 A;  1TL3 B;  5B0A A;  3FCH A;  3MM8 B;  3TW0 A;  4WP8 A;  3W1Y C;  4DR3 F;  1NJZ A;  3KG1 A;  1IKX B;  3NMR A;  2VH7 A;  2JEI A;  1PG5 B;  2F8H A;  2M5Y A;  4DG1 A;  4YR3 A;  2ZM6 J;  1KVI A;  1FKO B;  1OPI A;  4IG3 B;  2KM8 C;  2PC6 A;  3QJP A;  1IR2 A;  3H5S A;  5KFL A;  3GV8 B;  2JVO A;  3ZNJ 1;  2YNI B;  3DRP B;  3JTN A;  2CZV C;  4KBI A;  3SCK E;  3CC4 S;  2V2K A;  3DLJ A;  1XK8 A;  4HT5 A;  2V63 A;  2KFY A;  1TFY A;  2AEM A;  2C2K B;  3LWM A;  2G0J A;  3BZQ A;  1X60 A;  1LWC A;  2WRM A;  3AD7 C;  3N5F A;  3ADA C;  4RW7 B;  3HO1 A;  4Y2C A;  3VZH A;  1WHW A;  1QAY A;  5HMY A;  5LM7 E;  4DU7 A;  2JDJ A;  1YHQ S;  4LF7 F;  2P9E A;  1UEU A;  3PW2 A;  2W7O A;  1W25 A;  2CQH A;  4PYA A;  1WWH A;  2VPY B;  1OO0 B;  4LIW A;  2YKA A;  3T5L A;  4G6V B;  2E7V A;  4IFV B;  2CQP A;  2K1R A;  4OYX A;  3PCO B;  5FDL B;  3QT7 A;  4C0H A;  5A76 A;  4X4V A;  4WTY A;  2BE7 D;  4OJH A;  2EWH A;  2QE5 A;  4NZ7 A;  3CW2 C;  1NZA A;  3ENA A;  4IDK B;  6AT1 B;  2C22 A;  3WC2 A;  4DUY F;  1SH3 A;  1B70 B;  3H0P A;  3QFW A;  4HH0 A;  1FXD A;  2IHR 1;  2HQG A;  3UW1 A;  4ED5 A;  2HHW A;  5IT9 Y;  1B64 A;  4W92 B;  4GC6 A;  2RE1 A;  2Q79 A;  1H98 A;  3W62 A;  2HRY A;  1H2V Z;  5DRK A;  2G2Y A;  3TYT A;  4ECT A;  3FFI A;  4YHH J;  2Z56 B;  3W63 A;  2ZBP A;  2ZH7 A;  2UP1 A;  1UJ6 A;  1NK0 A;  2XMJ A;  4AFF A;  1IBM J;  1X4G A;  3CT9 A;  5HI7 A;  3H5U A;  4NA1 A;  1CVJ A;  1Q8K A;  3I55 S;  3V6D A;  2G2Z A;  3BBF A;  3K5P A;  1RT3 A;  2AJ2 A;  4NEY A;  3RRK A;  3I6P A;  4ZVH A;  2J8S A;  1X4A A;  7FDR A;  4B3R J;  1XMO J;  4K4T A;  1RAC B;  2ZZT A;  2DGO A;  3MAA B;  2DR7 A;  3NP5 A;  2GS8 A;  3LW5 C;  1HD0 A;  2A0F B;  1H2T Z;  1HI1 A;  4P52 A;  1XC9 A;  1WF2 A;  5L38 A;  4DV5 F;  4DPO A;  1SV5 B;  2F1F A;  4NAS A;  4ZPV R;  3K5M A;  3TRG A;  1TK5 A;  2XM3 A;  2VJU A;  1NKC A;  2R7Q A;  2VG5 B;  2XMV A;  3KLI A;  4IO9 Q;  3J7A 1;  1U1R A;  2IJF A;  3CJQ A;  1C4A A;  1RTJ B;  4HHH A;  4A46 A;  4JI8 J;  1NKE A;  1MRO B;  2DPI A;  1MU2 A;  2ATL A;  3MXH P;  1TL1 A;  1NBE B;  3GIM A;  2PD1 A;  5DS7 A;  2QG9 B;  3M8Y A;  2KKH A;  3TQ1 A;  1YJR A;  1DJ0 A;  1BQN B;  4EU0 A;  4CQ1 A;  3QZ8 A;  5KFC A;  1TKT B;  1RTZ A;  2OI2 A;  2PT0 A;  4ZJQ A;  2F9J A;  5B0F A;  2YWH A;  3D4J A;  4H4K C;  1WD6 A;  1HI8 A;  3UQS A;  1ZPV A;  4QIV A;  2FVQ A;  1JMT A;  1Q8L A;  2DNZ A;  3JTO A;  2Z2Y B;  2EK1 A;  2MQQ A;  1RWN B;  1NH8 A;  4DV5 J;  1BMQ B;  2OEK A;  3MWB A;  2HS0 A;  2QMU B;  4ILL A;  1RHU B;  2K7J A;  2RVJ A;  3QWU A;  5L39 A;  2G2O A;  3KMS A;  4DV6 F;  1TEL A;  1TVR B;  5KG0 A;  5LXY A;  2FHO B;  2IRY A;  4JBC A;  3JSB A;  3LGM A;  4BHQ A;  2B4U A;  4GVB A;  4KGX B;  1CEZ A;  4EO6 A;  5C42 B;  3PRD A;  1L3V A;  3GFH A;  3DLH A;  4O3R A;  5FJ4 A;  4MK7 A;  1ZOT A;  2AF6 A;  2QLJ B;  3QPI A;  5IT9 U;  2YNF A;  3DXS X;  3GLJ A;  2KT5 A;  3L09 A;  1HIY A;  3QSI A;  1CJK B;  4RR5 A;  4MMO A;  3EPI A;  4Q0B A;  5BYS A;  1Q16 B;  1U2F A;  2BJD A;  3BKF A;  4RW9 B;  3MM9 A;  3NCQ A;  5A2Q Y;  2BE9 B;  1K44 A;  3LTO A;  4RW8 A;  1J2V A;  5HK4 A;  5I3U A;  1JB0 C;  4QIG A;  2UUA F;  4LF6 J;  1GMW A;  4LF5 F;  2HZA A;  3NL0 A;  2XS5 A;  3FJ2 A;  4ZVU B;  1RHM B;  3THV A;  1NJI T;  4BBY A;  4JV2 A;  5E2Q A;  3DOM B;  1SJR A;  3I82 A;  4FYX B;  3FEX B;  2GIQ A;  3UDL A;  1HYS B;  4RW8 B;  5B0E A;  5I3U B;  1RLD A;  2VFR A;  3GON A;  1NCL A;  3GFZ A;  3NGS A;  2WSE C;  4RW6 A;  4UQG A;  4HYK A;  1QAJ A;  2HRT A;  2R8J A;  2ZH9 A;  2MZS A;  4K2J A;  3BDE A;  3ZZZ A;  4KAI A;  4AXJ A;  4DX7 A;  3IBW A;  3FUY A;  1FES A;  2Z2M A;  3MMC B;  3NAH A;  3B82 A;  3M2R B;  3M2V B;  3NKY A;  4LUB A;  4WU2 A;  2E44 A;  3LAL A;  4ZPB A;  5J1N A;  5HN0 A;  4GVB B;  2ZH4 A;  2UU9 F;  5ETP A;  4UT4 A;  1IKW B;  3KYL A;  1T03 B;  5B7W A;  4QQB A;  2YWG A;  3QNW B;  3H5Y A;  3KDN A;  4IR9 A;  1N5Y B;  5DO2 A;  2GC8 A;  1L5U A;  4DR3 J;  4B3T J;  4PUO B;  5J1E B;  2NZC A;  4TVA B;  2EFN A;  3JXO A;  3MPU B;  4KO0 B;  3MZI A;  5CYQ A;  2O5D A;  3R6L B;  3FQK A;  5E3Q A;  1RTD A;  2IBK A;  1SI9 A;  3GJT B;  1WC5 A;  2UV8 A;  3OTE A;  5H1S V;  4ICL B;  4NZ0 A;  2RHQ B;  4QOT A;  2DK2 A;  5B09 A;  4NA3 A;  3ITH B;  1RT5 A;  3V2U C;  2B0G A;  1UPP A;  4CO5 A;  1VLY A;  4ES1 A;  3MMB B;  3HPO A;  3T6J A;  3KJV B;  2F4V F;  1NJX A;  2RHS B;  3WC0 A;  3QAU A;  4F02 A;  4OYA A;  2XMM A;  1FDD A;  3GFX A;  1Q8I A;  2WBR A;  3QO9 B;  3N6L A;  4NLS A;  1C4C A;  4FZV A;  4OI3 A;  4QBU A;  3OUY A;  3AH6 A;  3CUN A;  1X4D A;  3H25 A;  3TJ9 A;  1B3T A;  1SXL A;  4WFB Q;  3HXM A;  1VQY A;  1DTQ B;  2MZT A;  2V8D A;  4DPT A;  4EEY A;  2QC3 A;  1XMB A;  4ZVT B;  2DVI A;  1U0S A;  2B7B B;  1XWL A;  2CPZ A;  1NDL A;  2E1C A;  1ROF A;  2LA4 A;  2LU2 A;  4K4Y A;  2PEB A;  3OUY B;  2N7Y A;  4WFY A;  3PNI A;  1S1W A;  2C2N A;  2MJN A;  3A13 A;  3MI7 X;  3KLF A;  5E3P A;  4HL9 A;  2VA3 A;  4LRC A;  1FWP A;  2HAF A;  3C6U B;  3CED A;  3D6T B;  4JI6 F;  3W2W A;  3K5N A;  4DL4 A;  1A6L A;  1RWX B;  1V3R A;  2WW4 A;  5CZX A;  5DDR C;  1Z1Z A;  1N33 J;  3M6V A;  3CB4 A;  1YQH A;  1N48 A;  4BDP A;  1N4L A;  1OY8 A;  5JVH Q;  1RT6 B;  3I4P A;  5HMZ A;  2CUY A;  3I5B A;  2BKN A;  3EZ5 A;  3FZ2 A;  3CJS A;  3J81 j;  2DH9 A;  4F26 A;  3DRS A;  2UXB F;  3DYA A;  3SSS A;  3DLE A;  3ZTQ A;  5HQM A;  3EE3 A;  2K1R B;  1Y4Z B;  5U47 A;  1ZM2 A;  4QWC A;  1WOP A;  2QL9 B;  3PKM A;  2XMK A;  3HFV A;  1O6X A;  2Q3P A;  2R7U A;  3KLH B;  1RKI A;  5L46 A;  5KFQ A;  5D4P A;  4ETZ A;  3NLC A;  5KFY A;  1U1P A;  2YWF A;  3P49 B;  2OP5 A;  3M30 A;  3JQM A;  4DUT A;  2D3O 1;  1Y7P A;  2HBQ B;  2WVF A;  3W2V A;  4YME A;  2CPH A;  1KEK A;  2HW3 A;  2YX4 A;  1DLO B;  3OQ2 A;  4KB7 A;  4DQS A;  4A8S A;  4ERD A;  1KTV A;  2RUS A;  4WFA Q;  4N76 A;  1UVL A;  5GAG U;  5HVH A;  1U1N A;  3MF5 A;  1PAU B;  3U02 A;  3ZTR A;  1KOH A;  4BLG A;  4C2M A;  4OX9 F;  3A8J A;  2VL1 A;  2NQP A;  4ZMM A;  2KZM A;  1E6Y A;  5DET A;  1WTB A;  1RT2 A;  4LF8 J;  3PY8 A;  2VFU A;  1U45 A;  1TAU A;  2ACM A;  3LGH A;  4LQ9 A;  3W8P A;  2UVW A;  2HFZ A;  3VGS A;  1TKZ B;  4DR1 J;  2LEB A;  2F7V A;  1K1S A;  5ETL A;  3TVY A;  1LW2 B;  2DXE A;  1TU0 B;  2MTL A;  4RU9 A;  3CJK A;  3FVY A;  3LP1 A;  3PHE A;  4G1Q A;  4TY9 A;  3VF0 B;  1C0U B;  3M8P B;  3L3C A;  4NLO A;  5DDQ C;  1UFK A;  4KE5 A;  1QE1 A;  1R3N A;  4PR6 A;  3MCS A;  2DH8 A;  2IBO A;  5B0C A;  5K9F A;  1R0B G;  1RAE B;  2XGP A;  2NXU A;  4YR2 A;  2AW0 A;  4IG0 B;  3IS9 B;  2D3O R;  3GYX B;  1F9F A;  2A2C A;  3QFH A;  2EW9 A;  2DR9 A;  3D54 A;  3OTB A;  3OD2 A;  2XWY A;  2ZE2 B;  3HCX A;  2GW8 A;  4K2X A;  4ZLJ A;  2J0Q D;  3OBI A;  1B0V A;  4L72 B;  1XNR F;  1WC0 A;  2UVV A;  3M4X A;  5KG3 A;  1NLK L;  1R8C A;  4S0M A;  3L7U A;  5G0R B;  1T94 A;  1W26 A;  4TNO A;  4B3R F;  1NM2 A;  3CVK A;  3DLE B;  3NS7 B;  2DGQ A;  1JXL A;  4I6W A;  2VFT A;  4V19 X;  2WHO A;  1JLF B;  4TU9 A;  5GME A;  3PJW A;  5D15 A;  3DLG A;  1XBW A;  2RDJ A;  3T5K A;  1VQ7 S;  2QLF B;  2MDA A;  3IN5 A;  5EN1 A;  1E6V B;  3TVK A;  4JI0 F;  3KLI B;  1FRI A;  1KVJ A;  1QTN B;  4OZ0 A;  3K7R A;  4X2B A;  3MCN A;  3THP A;  4DPX A;  3UE2 A;  3OT9 A;  4YR0 A;  5IS2 A;  5CD4 A;  3QT5 A;  2BQR A;  3AFG A;  2KG0 A;  1EKS A;  3G8T A;  4WK1 A;  5F9N A;  2Y1J A;  4B9L A;  2B56 A;  3IM8 A;  5D77 A;  3E3X A;  1JK9 B;  1KQS R;  3VGV A;  4FN5 A;  5H9F K;  1IKY B;  1AA1 B;  2QJ3 A;  2DNK A;  3I31 A;  4I7F A;  4UOC A;  2HFN A;  5ETR A;  1WF1 A;  4QWB A;  1RAF B;  2QYG A;  3TJ8 A;  2CPD A;  4NZ6 A;  2YKM A;  4A47 A;  3AJD A;  4DL2 A;  5HLF A;  4BCA A;  1MG7 A;  2EBE A;  1PC5 A;  3IXQ A;  4NL5 A;  2WBM A;  5M2U A;  3MM5 A;  4OYW A;  2R42 A;  2BR0 A;  3QO9 A;  2NR0 A;  1E6V A;  4F25 A;  2MQ8 A;  1NHK L;  1RWK B;  2B43 A;  3WHI A;  2VZ9 A;  2HNY B;  1RT4 A;  4WYW A;  2DHA A;  2DNM A;  2EKY A;  3S01 A;  3MR2 A;  3CJ8 A;  4QW8 A;  1FRK A;  5BJR A;  1RCX B;  3NWR A;  2WOM B;  3GIL A;  4O23 A;  4F4X A;  2HHT A;  3Q8P B;  4U7U K;  3EDQ B;  3EGZ A;  1T02 A;  3DDN A;  1R6Y A;  1S5Z A;  3CDA A;  1R0C B;  2CPI A;  4ICL A;  4EI2 A;  5GAE I;  1Z4U A;  2BM1 A;  2DKO B;  1JLC A;  1RUS A;  2P5V A;  4DU8 A;  1SC3 B;  1U6Z A;  3CME S;  4ZIT A;  2YNG A;  2YTC A;  2FJD B;  3OL8 A;  3H2L A;  4Y2A A;  2FHJ A;  4OL8 A;  3W5Z A;  3AB4 B;  5D0R A;  4AT1 B;  2KHD A;  4PZV A;  4DPY A;  4ZA1 A;  1SL2 A;  1RWV B;  1TL7 A;  3EGV A;  1MNE A;  3MEG A;  3V81 A;  2K06 A;  3C14 A;  1Q53 A;  3GII A;  4KR0 B;  3BO3 A;  5C2G A;  2N3O A;  2X3G A;  3G6X A;  4FBT A;  2IA0 A;  3R9L A;  2EC2 A;  2RH3 A;  2OSQ A;  4RU2 A;  2MGZ B;  4I64 A;  1DAX A;  3UPF A;  3HZE A;  1RKJ A;  3DLB A;  1MWQ A;  6FD1 A;  5KT5 A;  2QA4 G;  1FO1 A;  1S1X A;  2QV6 A;  3AB2 B;  4I67 A;  1B7F A;  4K8R A;  2MKY A;  2BAN A;  3MUR P;  4P6Q A;  4YB5 A;  4QJV A;  1N0U A;  3LP1 B;  3P96 A;  2NSC A;  4G1Q B;  3JSM A;  4CTA A;  1OY9 A;  4WCE Q;  2RIJ A;  3OL6 A;  4TLR A;  4DLG A;  4JI6 J;  1HWJ A;  1VOM A;  2IRU A;  4FXW A;  4G1P A;  4E98 A;  1L3K A;  3MM6 B;  4J9N A;  2PGC A;  3PJ9 A;  4C8N A;  2VBZ A;  4ED2 A;  3QGH A;  2RT3 A;  3F0N A;  3MAQ A;  1KLM A;  4KKO B;  3H90 A;  4Q2M A;  1WEZ A;  1FTC A;  2LA6 A;  4WPA A;  3TOQ A;  3U1N A;  5MAO A;  2CDR B;  4AL7 A;  1A9N B;  1XR6 A;  1LW0 B;  4YEA A;  3GJQ B;  2D41 A;  3N5B A;  3C8Y A;  4KSE B;  4B9U A;  2ADB A;  4PEO A;  1RJJ A;  2BJ7 A;  3D0H E;  3JSR A;  2D74 B;  1WOR A;  1ZH5 A;  2CPJ A;  5K14 B;  1T8E A;  4IQM A;  2GGP A;  2XO6 A;  1I1G A;  4ZVO B;  2F8E X;  3MEG B;  3V81 B;  2DD8 S;  1TK8 A;  1WKJ A;  5L9N A;  1VQL S;  1SPB P;  4MKV A;  1S99 A;  1RHJ B;  4ZJL A;  5KFX A;  2CNK B;  4PWU A;  3W5X A;  1F3V A;  3KLH A;  5RUB A;  2W9B B;  1UVK A;  3HHL C;  1SKR A;  4LSL B;  1HWL A;  3ILJ A;  4U67 Q;  2QN6 B;  1S1U A;  1NEE A;  4YUD A;  1KOO A;  2XZW A;  2QGF B;  2N7C A;  2J9E A;  4DR5 F;  3FBE A;  1T9X A;  2B4V A;  2QTW A;  4DSL A;  1NSP A;  2J0X A;  3HSG A;  1YJ9 S;  1LWX A;  4R8U A;  1N36 F;  4CH1 A;  2XCA A;  2XLK A;  2DNY A;  4Z7C A;  2UXC J;  3C16 B;  2ZDP A;  4DR4 J;  4CRJ A;  3CF5 Q;  2YH0 A;  4CYU A;  2K2P A;  4LRE A;  3C2P A;  3I0S B;  3X3U A;  2AX0 A;  3RJM B;  5KT2 A;  1NRK A;  3A1Y G;  2Y1L B;  1F2H A;  2BEF A;  1LNQ A;  2XZT B;  5KFN A;  5A8K B;  3KLG A;  2LDY A;  5L1J A;  1TK0 A;  3KLE A;  1TKX B;  1DZ5 A;  3PRB A;  4E8U A;  1HBN B;  1R89 A;  1GMU A;  2CQG A;  1DQ9 A;  4PG8 A;  2VQF J;  4DFP A;  3IG1 A;  5A8K A;  5DQI A;  2RS8 A;  4DCP B;  4M5I A;  2MKS A;  4GVL A;  1TMM A;  1YRT A;  3V6D B;  3TI0 A;  1JLQ A;  4E0D A;  4F3M A;  4NLG A;  3G86 A;  4YFU A;  2F3J A;  5A8R B;  4JV1 A;  5GAD U;  4IH5 A;  2ZHO A;  9ATC B;  1TV6 B;  4RNM A;  3KK1 B;  3J80 Y;  3KUE A;  5KFJ A;  2MHE A;  4UY8 T;  3NCR A;  3JS9 A;  2PSZ A;  3HF5 A;  2Z2L A;  2ZD1 A;  2AGQ A;  2ZOG A;  4ZPD A;  4HAC B;  2OTL S;  1HQU A;  4M5L A;  1G1X A;  4YOE A;  1X5S A;  3RAM A;  4Z7Y A;  1VQ4 S;  1KP6 A;  4WK3 A;  2NLW A;  2MZQ A;  4AYB D;  1WSR A;  2GNK A;  1Z2Z A;  3NY0 A;  4J9O A;  4OZN A;  4DPW A;  3WQP A;  5J2P A;  4RUB A;  3DOK A;  5E0O A;  1DUR A;  5IFM A;  2Y1I A;  1J5O B;  2VFS A;  2E9R X;  4Y2M A;  4EZ9 A;  1SC1 B;  3LAM A;  4P74 A;  2L08 A;  1KLN A;  2ILY A;  3SSR A;  1AB8 A;  1TTH B;  3QLH A;  3IR6 B;  4USU A;  1GK8 A;  2YQ0 A;  2DB1 A;  3BB5 A;  1WG1 A;  3GB0 A;  3LOU A;  5IM0 B;  4X65 F;  2MKK A;  2ERR A;  1RIS A;  1SUQ A;  2PMW A;  2ZFH A;  3DHW C;  4DV1 J;  2LVW A;  1IWA A;  1X0F A;  1IKW A;  1NXI A;  1FNO A;  1T03 A;  1ZPW X;  2WW8 A;  4RUH A;  4DUZ F;  2E5L F;  3GJS B;  1N56 A;  3NGK A;  2E5L J;  1U8S A;  2W2O P;  3M2R A;  1QE1 B;  2CKW A;  4R0J A;  4Y00 A;  4F67 A;  4NLY A;  2JSX A;  1LW0 A;  3DRR A;  3OL9 A;  3I32 A;  1R31 A;  2NYH A;  3CJT A;  3PHT A;  3PJX A;  2J9C A;  2CQB A;  2QSW A;  2QT7 A;  6FDR A;  5DDO C;  1HBU B;  2CVE A;  4DL7 A;  2N82 B;  4TU7 A;  2W4C A;  3DOM A;  4USW A;  1IKX A;  2J7U A;  4MKY A;  4XPE A;  5ETO A;  4CNZ A;  1L3T A;  2B6A A;  4J9V A;  3CJR A;  1X7V A;  4PPD A;  4PXB A;  4WYL A;  1PO6 A;  4XTT A;  4YB7 A;  5A0Y B;  1V3Z A;  3PX6 A;  2HHH F;  4CLL A;  2HS4 A;  3ONQ A;  1YRU A;  3FMW A;  1IN0 A;  3HJV A;  2IFX A;  5KG6 A;  3BO4 A;  1GNK A;  2M70 A;  1Q8B A;  2JEF A;  1WOS A;  2LQ5 A;  4O3Q A;  3W2V B;  2D1C A;  2MZ1 A;  2RJZ A;  3QBC A;  2CNL B;  3D68 A;  1NHU A;  1X31 C;  2GV1 A;  3GCX P;  5IC6 B;  3TUZ C;  5F8H A;  3RUB L;  1WG5 A;  4XAK A;  2RDD A;  2WVD A;  2BA9 A;  3NOG A;  2AIR B;  4HDH A;  4O3O A;  1TFW A;  4E2F B;  1MLA A;  2OD4 A;  4ZN3 A;  4CCH A;  2IM0 A;  3FBB A;  2BJ1 A;  5KFA A;  4TU8 A;  4XIU A;  4DSE A;  2XUL A;  2WVB A;  4HTJ A;  1A7G E;  1JJ4 A;  3E01 A;  2B3T B;  2OJ3 A;  3FEY B;  2CJB A;  3CCU S;  5DM6 Q;  2HHQ A;  2QFI A;  2D3U A;  1N36 J;  5F41 A;  3W66 A;  4ECY A;  1CS4 B;  2MEW A;  4I6Y A;  1Q1K A;  4K4V A;  3AD8 C;  2R2U A;  3UCU P;  5KFD A;  2FLN A;  3CCJ S;  4P72 A;  2NUH A;  1NPP A;  4PG4 A;  5CA5 A;  4EFA C;  3NWG A;  2FZG B;  2KH9 A;  3OVS A;  2YKN B;  2IDL A;  1RYR A;  1VRU A;  4DR7 F;  2VG5 A;  3GWC A;  5ADZ A;  1HNI B;  2XGQ A;  2PN6 A;  3D2W A;  4ELT A;  4B3M F;  4NLQ A;  4FF3 A;  1OY6 A;  3BPS P;  2XWX A;  4OHW A;  3CC2 S;  2UXD F;  4A48 A;  4QR2 A;  2YKM B;  2HND A;  3T1A A;  4UOF A;  3UD3 P;  5K5M A;  1REV B;  4KJI A;  3QQC D;  1NSQ A;  2Q43 A;  1KRP A;  5C24 A;  3MGJ A;  2IJR A;  5FD1 A;  3ZFV A;  3P8B B;  3J7A N;  1WSV A;  3UN5 A;  3EWG A;  2VC1 A;  4J7C A;  4OHX A;  1N6Q A;  1RSC A;  4UQT A;  2FVS A;  1EJ7 L;  4UOG A;  5KFO A;  2ZKU A;  2GML A;  3R5G A;  2DPJ A;  3UD5 A;  9RUB A;  3Q8V A;  1Y0H A;  2IJN A;  3I0S A;  1S6U A;  3W3S A;  2AQ4 A;  1G6B A;  2DNQ A;  4HKQ A;  4ZLL A;  1O51 A;  1QJH A;  1RHK B;  1RAH B;  2CPX A;  1PCA A;  1XMQ F;  3I9Z A;  1UKU A;  5B08 A;  4PWD A;  3NGU A;  2R2S A;  4Z2X A;  2AEJ A;  3DMJ B;  3GU0 A;  5F3Z A;  4LQ3 A;  7AT1 B;  4LSN A;  2ALY B;  1DY3 A;  1UP1 A;  1EET A;  4WWS A;  5T7L B;  3UR3 C;  1N88 A;  4KPC A;  1RTD B;  2E9T A;  1B99 A;  1S1U B;  1U6F A;  1WHX A;  3KFW X;  3PYE A;  4H4M A;  5G0R A;  2V2Q A;  1HBM A;  1Q4R A;  4L73 A;  1UWB A;  4BWJ A;  5GAD I;  4KFB B;  1RI7 A;  4RWX A;  2L9W A;  1LWF A;  4LRB A;  5HO4 A;  1UL3 A;  3RB6 A;  3CCE S;  4ELV A;  1XNR J;  4DV2 F;  1QVG R;  3RAX A;  1SJF A;  2UUB J;  1PYO B;  2HKE A;  2M52 A;  3IS9 A;  1F60 B;  4N77 A;  2X1A A;  1RT7 A;  4LT6 A;  5EHH A;  4ECS A;  1UW9 A;  1VDH A;  2F4F A;  4O44 B;  2OFH X;  3MEE B;  4NMX A;  4WF9 Q;  1B0P A;  3QZ7 A;  1NUE A;  2KG1 A;  4C8M A;  5JVG Q;  2CNO B;  1JLB B;  3A3P B;  3BS9 A;  1MWY A;  4YDX A;  4YB1 P;  3CCZ A;  3DOL B;  4KKO A;  2G1H A;  4MFB A;  4C97 A;  3DNC A;  2RF2 B;  2WON A;  2XYG B;  5KFB A;  2BVZ A;  2NCK L;  3UCG A;  1C1B A;  4U95 A;  4H4O A;  3W64 A;  5AE1 A;  2GHP A;  3ILL A;  1S76 D;  1D9A A;  3DXB A;  4I6A A;  3H98 A;  1CJV A;  2R7S A;  3OXG A;  1AZS A;  1TR0 A;  2AJ1 A;  2BAN B;  1OQ3 A;  5LMN J;  4EYH B;  2BQU A;  1JLB A;  4B3O B;  1FE4 A;  1S7H A;  4USH A;  4WKY A;  1HHT P;  4O0N A;  4NXN J;  1XJW B;  5IWA J;  3HHN B;  2DCL A;  2N4D A;  2Z2Z A;  4O44 A;  4DMZ A;  4J9M A;  2YH1 A;  5G4D A;  3HD1 A;  2KHC A;  3GG1 A;  3JQJ A;  4I2Q A;  4OI1 A;  3UN2 A;  4CLT A;  4EZ6 A;  3EZO A;  3KG4 A;  2H5J B;  2QA4 S;  4GKK J;  4I1T A;  2R7R A;  1T05 A;  1UFL A;  2XLI A;  2K7K A;  2MQL A;  3DOK B;  1JLC B;  1AYE A;  4X4R A;  2PMZ D;  4TLQ A;  4ZIW A;  1U25 A;  1RWW B;  3F44 A;  3EZU A;  3AA9 A;  1SQF A;  1N54 B;  2GFF A;  3D67 A;  3KG0 A;  4HAC A;  2KT3 A;  4NLW A;  2UXB J;  2JX2 A;  4GKJ J;  2RML A;  4X66 F;  3BO2 A;  4HH1 A;  4XO0 A;  2FY1 A;  3Q8Y A;  2A10 A;  2G1D A;  3QGG A;  4ID5 A;  1C0T A;  1F5C A;  3W2W B;  1YRX A;  3KHH A;  2MZR A;  1EAY C;  4LJM A;  2XS7 A;  1QY7 A;  4BC7 A;  5HQL A;  2HFV A;  4ED6 A;  2JWN A;  4ILR A;  3J7Z 5;  4ED3 A;  2YNH B;  2UZA A;  2MLX A;  4PCQ A;  1F2G A;  1JLE B;  1Q0N A;  5KTQ A;  2H51 B;  4DL5 A;  2F63 A;  2JVR A;  4WE1 A;  1MN9 A;  3MPW A;  2CG4 A;  2PII A;  4DF8 A;  2F5G A;  1HBN A;  2XZD B;  1JLA A;  2DNR A;  4V1A k;  2ATC B;  3PR4 A;  4B02 A;  1DTQ A;  1N0V C;  1MMN A;  3AOC A;  4PXE A;  5F8M A;  3KK2 A;  3LPE A;  4CO0 A;  1HNW J;  3BGR B;  1V9O A;  4CLW A;  4A8W A;  4NCB A;  1VC5 A;  1CG2 A;  2DYA A;  1Y5L B;  5HMW A;  5SZT A;  3QJJ A;  2A2D A;  3B78 A;  1KFD A;  1Y3J A;  1VGY A;  2BJE A;  2FZC B;  3LA0 A;  5MLC V;  1RBL A;  1AFJ A;  4O4G A;  2DHG A;  2YKN A;  3WDO A;  5DGA A;  1OJ4 A;  1KSP A;  2WVE A;  3CE8 A;  4URQ U;  2FY8 A;  1NDK A;  4K0K F;  3ITH A;  4JOU A;  2C28 A;  1P1T A;  3D7S B;  3V6J A;  1VFJ A;  3IA0 A;  5K20 B;  1GTH A;  2MPU A;  4MK8 A;  4UZC A;  4QYR A;  4DEZ A;  3BJY A;  5KFU A;  1XER A;  4UZB A;  1ELO A;  2HPU A;  3A3N B;  1BD6 A;  4KO0 A;  3CIM A;  2M8H A;  3TUP A;  2ZNY A;  4O3P A;  2B5J B;  2FC8 A;  4EUV A;  5B0G A;  1RB0 A;  4Q5V A;  3PW7 A;  4FNI A;  5EUH A;  5CAA A;  3Q8S B;  4OHY A;  5ETT A;  2OHD A;  5DZ6 A;  1U0H B;  1G7C B;  1RA7 A;  3IWX A;  4BWM A;  2R8I A;  3C66 A;  5EGY A;  4LFA J;  4ZPA A;  1BUX A;  2OPP A;  1FJE B;  1EQ0 A;  4K7Q A;  2I1R A;  4ZDN A;  3MTJ A;  3CD0 A;  4OI4 A;  2FYX A;  1RBA A;  2VV5 A;  1KS2 A;  4WII A;  5CZV A;  4ZP6 A;  3GSD A;  3UD4 P;  4PAA A;  4G65 A;  2OPR A;  4JYA J;  4J9K A;  3W8G A;  1D3W A;  4NML A;  4RNF A;  4F2S A;  2EC0 A;  2CJY B;  4LF2 A;  1RXO B;  3PO4 A;  2XTJ P;  2QL7 B;  4QR0 A;  4K50 A;  1UAW A;  2MHN A;  3BGF A;  3I5C A;  5H9E K;  2CRL A;  2J7K A;  2PA3 A;  4F3O A;  1N33 F;  3FMB A;  1FA0 A;  2J7W A;  2HWH A;  4C0O C;  3RW6 A;  2ASL A;  2MKC A;  2VDH A;  4WTO B;  2XY5 A;  1U6B A;  3KUH A;  2HIQ A;  2HVD A;  3D1O A;  3NOC A;  4I2P B;  4TXS A;  4DSI A;  2QA1 A;  2HGM A;  4LVO P;  4XDD A;  3ZO7 A;  1IR1 A;  1S4E A;  3MEE A;  2EFV A;  4DBQ A;  2D9O A;  4UOH A;  5KG1 A;  3UNY A;  5C42 A;  3AQP A;  2BOP A;  2F4V J;  2W2P P;  1YLX A;  2AYE A;  3MUM P;  3DDK A;  4ECQ A;  3BN4 A;  1SJ3 P;  2C42 A;  3S7R A;  2YX7 A;  3M30 B;  1TP7 A;  2WVC A;  4DHV A;  1RWP B;  4F50 A;  1WDD A;  4B08 A;  4YS2 A;  2E7W A;  3GYN A;  4URG A;  5ETK A;  2HBR B;  1Y3K A;  2HLU A;  4Y28 C;  4IOC Q;  4WJB A;  2BM0 A;  1WKK A;  2CG8 A;  3HHL A;  4P2F A;  3R97 A;  2DEJ A;  4F0K A;  3PKY A;  2GIR A;  3HJF A;  2EFO A;  3PIO Q;  2MZJ A;  3UWT A;  3DRS B;  2W24 A;  2VIH A;  2OEJ A;  1HHQ A;  2ABY A;  3BEG B;  3IWN C;  2R7O A;  5FLX U;  2FUG 9;  2RQ4 A;  4FS2 A;  1HWK A;  1D9F A;  1BY9 A;  3Q8R B;  3LGN A;  3QRR A;  3NBP B;  4OZL A;  1RTJ A;  4DL3 A;  2KVI A;  4C8L A;  1HMV A;  3BSC A;  3MM5 B;  4IH7 A;  5A8R A;  1RWU A;  5KFW A;  3R5C A;  3PX0 A;  2Z30 B;  2CJ9 A;  2AYG A;  2OTJ S;  1K9M T;  4C98 A;  4FKY A;  4QR1 A;  4JI7 J;  4M94 A;  2B4P A;  5ITH A;  1X9W A;  2OEL A;  3DLL Q;  3KK2 B;  3C15 A;  3N9U C;  2B8Q A;  4CP5 A;  5C7P A;  3QRP A;  3HZG A;  3IP0 A;  3RGI A;  5KFS A;  3PYF A;  4F4K A;  1YBU A;  4RBU A;  4C48 A;  1OIA A;  4QIE A;  2CQ0 A;  2ZVI A;  3SQG B;  3WZ0 A;  1UA1 A;  2NZ4 A;  2BBE A;  4JUZ A;  1RT1 B;  1PYS B;  3AY0 A;  3O1L A;  2Q6C A;  2BAC A;  4ECZ A;  1S10 A;  1IBK F;  2APO A;  3DGV A;  4CNY A;  3TNV A;  3KLE B;  1WHY A;  1GMW D;  2L41 A;  3B4D A;  2D9P A;  2R3V A;  2ZBR A;  2UUA J;  3K5O A;  2VBW A;  4FYV B;  1Q95 G;  2P6S A;  3M6X A;  3DRY A;  3KK3 B;  4DZD A;  2HYI B;  2ZBI A;  1U24 A;  1NND A;  4EK2 A;  2AYM A;  4JI2 J;  1PYT A;  2VON A;  4DR5 J;  2H4Y B;  1RT5 B;  5HAO A;  4IH6 A;  7FD1 A;  1NDC A;  2I5J A;  2FDN A;  2MJU A;  1EKR A;  1JXV A;  4IDK A;  2ZOF A;  4OHV A;  3VAI A;  3BM7 A;  1HW9 A;  4JV0 A;  1HL6 A;  2LKZ A;  2UXC F;  4N5S A;  1FJC A;  3QGI A;  3RBX A;  4ZK7 M;  3IO1 A;  4UF4 A;  4OZ5 A;  4PUO A;  5DJB A;  2OIH A;  1FE0 A;  2BRK A;  2ASY A;  3D0G E;  1UVI A;  3TEG A;  4UW2 A;  2MXY A;  4OJG A;  2NPI A;  4OZ2 A;  3W9J A;  5EWG A;  2DHX A;  1FDB A;  4UTG A;  4DDF A;  4CIO A;  5L1K A;  2JLE A;  5IQQ A;  3VAF A;  1EIY B;  4I2Q B;  1S9G A;  1TUW A;  4KGM A;  2B7C B;  2JLF A;  2DO0 A;  5AXK A;  3WX8 A;  1B7Y B;  1O5J A;  2DJW A;  2VG6 B;  2XHW A;  2V2V A;  5AJ3 F;  2R8K A;  3KNA A;  3LUY A;  1IBK J;  4DR2 J;  1HHS A;  3FRY A;  3EVW A;  1RA6 A;  4L3K A;  4QPT A;  5D0E A;  2LP4 A;  3IGV A;  4DV0 J;  3HK2 A;  2BYC A;  4CH7 A;  3GP9 A;  1LW2 A;  1RAI B;  4ZVG A;  1MML A;  1OPZ A;  1TL3 A;  3CDU A;  2KXH A;  1R0A B;  2ZM6 F;  1EP4 B;  3OR2 A;  2UVR A;  1UW4 A;  1WUU A;  3NG8 A;  3SV3 A;  1ZAV A;  1CJK A;  1X4F A;  3SV4 A;  3PO5 A;  4OI0 A;  2OKQ A;  3RRH A;  5D4L A;  3BQ2 A;  5BYR A;  3OJU A;  2KVQ E;  1S0O A;  3J81 U;  1I51 B;  1YVF A;  4YHH F;  2K3I A;  1HNV A;  2ZJP Q;  4U7C A;  5KFM A;  1B4S A;  1GMV A;  2FLL A;  5HMX A;  2J6T A;  4X4U A;  1NZ8 A;  3CWJ A;  4B9M A;  1U02 A;  3G96 A;  1YJ7 A;  2P8I A;  3K2Y A;  2AJQ A;  1GH8 A;  3RAQ A;  1S7I A;  3VAJ A;  3K8V A;  4ZVS B;  4ZPW R;  3RYL A;  2QEX S;  2YNG B;  3IAS 9;  1YK9 A;  1RYS A;  4HI2 A;  2IVF B;  4OX7 A;  3VVU A;  4IRC A;  2HAI A;  4OQJ A;  3VZI A;  3FCW A;  5KOW A;  4YN3 B;  1FFG B;  2I8E A;  1M5H A;  4B3T F;  5ETV A;  2C2M B;  1D9D A;  2W4P A;  2VF3 A;  4A8Y A;  1UVM A;  2RKI A;  2Y3Y A;  2WSC C;  1XEZ A;  2V0N A;  4DJB A;  1IQT A;  1K0V A;  2B4O A;  4IUF A;  2KN4 A;  4IOA Q;  2E1R A;  1N8R T;  4PWD B;  1S9E A;  4LSZ B;  2KTQ A;  2E66 A;  2YKP A;  1HBO B;  2W4D A;  3MTK A;  4AND A;  5IZH A;  4RNN A;  1QSS A;  2J6S A;  3C19 A;  3C6T A;  1U48 A;  1SVD A;  1T3N A;  1P9Q C;  3AJ2 A;  2ZHA A;  2AJF E;  2JC0 A;  3CCQ S;  2XY7 A;  1S1W B;  1U1Q A;  2GHW A;  3AJ1 A;  1S0V A;  4MT1 A;  5KFT A;  3N28 A;  3TP2 A;  2EG2 A;  2HQ3 A;  3OL7 A;  3SI8 A;  2HHH J;  1XQI A;  3MFH A;  1HWU A;  2IMW P;  5J2M A;  3CJ0 A;  4HLB A;  5E5N A;  2WK4 A;  1WKL A;  1V3S A;  2DHH A;  2V8G A;  1RT1 A;  3IG1 B;  1V5I B;  2VAS A;  2X1B A;  3KJF B;  3MEC B;  4DV7 F;  4RW4 A;  1WG4 A;  5HAN A;  3U7J A;  2YBV A;  5EWF A;  2HMI A;  5HP1 A;  2HVI A;  2HNZ A;  4LRF A;  4NLU A;  1NKB A;  2EFQ A;  3KLG B;  1TUV A;  1MW7 A;  2GVD B;  4USJ C;  4J9Q A;  3OFF A;  3UVJ B;  3M8R A;  1EQM A;  2VFV A;  2OPQ A;  5IV4 A;  2YKQ A;  4KT0 C;  1SIZ A;  3MEK A;  3OFG A;  5DDP C;  2OAU A;  2EEY A;  4LRA A;  2O01 C;  4RNH A;  1C0T B;  2XYP B;  2W2N P;  2ACY A;  1T9U A;  1ZZN A;  3BYP A;  2J8A A;  3ZC4 A;  3P5B P;  3GQC A;  1ITP A;  1S0M A;  2QIF A;  3TZX A;  4IOB A;  5ETN A;  2H48 B;  5C25 B;  3CJ5 A;  1P6T A;  3IFE A;  1FFS B;  3KKF A;  1XNQ J;  2FPH X;  3Q22 A;  2FJV A;  3N79 A;  5A2Q U;  3FK4 A;  5GAH I;  1HQE B;  1U09 A;  3GE9 A;  3TAQ A;  2UUC J;  2M9K A;  4I0W A;  5M2P A;  3W65 A;  1IBL J;  2ZWP A;  3PM9 A;  3SDE B;  4LFB J;  3P4U B;  2IVY A;  5J1E A;  5DLG A;  1W2I A;  1XR5 A;  3CD6 S;  3KJN B;  2OLW A;  4K59 A;  5CYM A;  2YWK A;  2OEM A;  4YB6 A;  5KT4 A;  3GV7 B;  3LAK A;  3M7V A;  1WC4 A;  2DGV A;  1LFP A;  2ROE A;  4NI2 B;  3P5T L;  5KFH A;  2ALZ A;  4RW7 A;  1IM6 A;  2FJW A;  2BZ2 A;  4IYQ A;  3D1Q A;  1OMS A;  5AXN A;  2FJX A;  3VAL A;  3L95 X;  2IM3 A;  1CC7 A;  5ETM A;  2BE2 A;  1T95 A;  4C8O A;  4ILM A;  4PXD A;  4YY3 F;  1VBZ A;  3OR2 B;  2OML A;  4OZ1 A;  2NUU G;  4Q45 A;  2UUC F;  1ARO P;  1R0A A;  1TL4 A;  3ILO A;  2DIT A;  3MM6 A;  3SCL E;  4H4O B;  4ANC A;  1WC3 A;  2WSF C;  2RRN A;  1ZTT A;  4M95 A;  3CUL A;  1TKD A;  1T7P A;  2LU1 A;  2L9D A;  1HBU A;  3R7B B;  4P2S A;  2MQO A;  4AE5 A;  1JX4 A;  3R5D A;  2R9L A;  1SC4 B;  1SIW B;  2PO4 A;  3BF4 A;  1YZ6 A;  1LFW A;  3EVO A;  4K5S A;  4OV6 A;  2CPF A;  1H0H B;  1VK3 A;  4ATN A;  3KLV A;  3BR8 A;  2XS2 A;  1T11 A;  2IM1 A;  2I0X A;  1UCN A;  2Z4P A;  2Q6B A;  2WB1 D;  5K8P A;  3CCL S;  3LH2 S;  3QT8 A;  2QFJ A;  1S79 A;  1PIE A;  3W60 A;  3M8Z A;  1VJW A;  3M6U A;  2EI5 A;  3MOZ A;  1FKA F;  1N32 J;  2GIF A;  2ROG A;  2JH3 A;  2C3O A;  4OX9 J;  3GJR B;  4FPR A;  1KN6 A;  5IM0 A;  1AW0 A;  1Q5Y A;  2B9X A;  2CPY A;  3GTY X;  3SIP B;  2ROP A;  3FZB A;  3OHA A;  4NE9 C;  2CPE A;  2HQF A;  5LJ3 Y;  4ED4 A;  1VIO A;  3OVA A;  3G6E S;  4ECU A;  1RHR B;  4KGV B;  5EX3 A;  1FCA A;  2Y8W A;  4XPC A;  1X5T A;  2V69 A;  1OQ6 A;  2LXI A;  4X4T A;  1KON A;  4YP3 A;  3M32 B;  4X4Q A;  2MLZ A;  5T7L A;  3IRW P;  2I5J B;  5JXS A;  4O3S A;  4WZQ A;  1RWM B;  4NOH A;  4BC9 A;  4KH0 B;  3PR5 B;  2FJB B;  1TL1 B;  2AEF A;  2FTR A;  3HUL A;  1FXL A;  3OHB A;  3EVM A;  2J9D E;  4OJ3 A;  1TV6 A;  2NSB A;  3HHL D;  1JJ2 R;  4LF7 J;  3OTO J;  2K8G A;  3TAN A;  3NNC A;  3GR0 A;  1YBA A;  3H2U B;  4RUC A;  2KYX A;  4OYP A;  3RB4 A;  2G4B A;  4HHJ A;  1HPZ A;  3H8Y A;  4XK8 C;  3MOJ B;  4J9S A;  3PYD A;  4USI A;  2PE8 A;  1VRT B;  2N4C A;  2PA8 D;  2DHS A;  3T41 A;  2HRU A;  1IVZ A;  3V4I B;  5KAK A;  5DLF A;  2NXJ A;  3Q83 A;  4DX8 H;  3CD5 A;  4ID8 A;  5D3G A;  3AOB A;  4MIA A;  4DOZ A;  3BKU A;  3K57 A;  3I0R A;  3Q24 A;  4B9S A;  1RCO B;  1UJ4 A;  2L3M A;  3HSZ A;  1REV A;  4I68 A;  3V4I A;  1JLE A;  3NMA A;  2O66 A;  3T9N A;  4ZCM A;  1G3O A;  3P6Y C;  3LQV A;  2H5I B;  3CJ2 A;  4Y6I A;  4CLS A;  4X65 J;  1HNI A;  4Y2K A;  3CMA S;  3K17 A;  3TEH B;  1HMV B;  2VKR A;  4XDC A;  1U1K A;  4DV1 F;  4P7T A;  2XMT A;  4CYU B;  3A12 A;  2E1A A;  3GYG A;  2C2D A;  2E1P A;  3ZZU A;  2NS1 B;  3KJV A;  1KD1 T;  5KFI A;  3KMQ A;  4WKR A;  2LQJ A;  2AYB A;  2Z8Q A;  1JLF A;  3DCA A;  5BR8 J;  4R8U B;  3OXL A;  1WHV A;  1FKP A;  4ECR A;  3I56 S;  1XNQ F;  2QLX A;  3UN3 A;  4DF4 A;  4LRD A;  3THT A;  1VQK S;  2ZWO A;  4RJV A;  2HHS A;  4KHP F;  4PYD A;  1ZAW A;  1UMJ A;  4H4K A;  1UEK A;  2E29 A;  2CFX A;  3PAC A;  2L9N A;  3N0V A;  2HWT A;  2E5I A;  4CM0 A;  2HQI A;  1FWL A;  2ZH5 A;  3ET6 A;  1J27 A;  4DR1 F;  1VQ9 S;  4L3N A;  1H6K X;  5FLX Y;  1FX4 A;  5IXU A;  2V68 A;  3MPD A;  4YQW A;  5T41 A;  3BRE A;  3M6W A;  1HR0 F;  1AUD A;  2W01 A;  1JNZ B;  2QL5 B;  2LLZ A;  4TN2 A;  4WP9 A;  1VQO S;  3M1V B;  2JFD A;  4Y65 A;  1PJ5 A;  4ZPC A;  2H54 B;  4JI8 F;  1X9M A;  3LP0 A;  5GAH U;  2A6M A;  5LSR A;  1I94 F;  2HGN A;  2HVH A;  3MMC A;  1FRM A;  1IKV A;  4ZP9 A;  4ZJO A;  3F73 A;  2OH2 A;  1UTA A;  3Q2S C;  4QU7 A;  2W2Q P;  5KT3 A;  1KNZ A;  4JYA F;  2G9O A;  2F65 A;  3MM7 A;  4ZOS A;  3TVZ A;  2XLJ A;  1O8B A;  4KQZ A;  1S0N A;  1YGY A;  3VVT A;  1NJY A;  2Z0G A;  3HHD A;  2HBZ B;  2V94 A;  2J5A A;  1QUV A;  3MAH A;  1VHF A;  3D28 A;  2HEK A;  5L8R C;  3UCZ P;  2OFG X;  2V34 A;  4ED8 A;  1GT8 A;  4ZP8 A;  1FRH A;  4JI5 J;  4ANE A;  2WON B;  2XMW A;  2CQI A;  4ZCI A;  3MM9 B;  3DOL A;  4OI2 A;  3UO0 A;  1DFD A;  4OIX A;  2UXD J;  5B0B A;  4PG6 A;  1TZ0 A;  5J2N A;  2HFO A;  3PYG A;  1VBY A;  2XB2 D;  1HW8 A;  2DY9 A;  4PG7 A;  3HFK A;  3FCV A;  1Y5N B;  4W98 A;  2MGZ A;  2JEJ A;  2XNR A;  2VUG A;  5JJB A;  3GMG A;  5IT0 A;  1H7W A;  3UI3 A;  1S1V B;  3GV5 B;  4PKD B;  1N32 F;  5M2R A;  2WZ1 A;  1KWM A;  2ZC4 A;  1CQM A;  4KGK A;  2J0W A;  2IDE A;  2MQM A;  3LWL A;  4DZ6 A;  3RU0 A;  2BOA A;  2KRR A;  3QAT A;  1KFS A;  4NLX A;  2LDI A;  1OYE A;  2BXJ A;  2P2C B;  2OO4 A;  1EB0 A;  1N34 F;  3MCO A;  2V8P A;  2VG7 A;  1HQE A;  4O3N A;  1WC6 A;  2W8L A;  1TKT A;  4EBE A;  1EET B;  2AX1 A;  3CSK A;  5F0W A;  3L9Z A;  3D6F B;  2RS2 A;  1HQU B;  2DXD A;  4R0E A;  5HJX A;  3MED B;  5C25 A;  5LSL A;  5DG7 A;  1DBD A;  1VK8 A;  8ATC B;  2XO7 A;  4WU3 A;  2QX0 A;  1YTY A;  4DL6 A;  1M5K C;  4ZPT R;  2M88 A;  2IAJ B;  2CWX A;  2KU7 A;  5KOX A;  4JI3 F;  2JLG A;  2HHV A;  2VPX B;  3KK3 A;  1H38 A;  2RQM A;  1HQ2 A;  3EXY A;  3TAP A;  4U6P A;  4FBU A;  5HLF B;  1SV5 A;  4IFY B;  3Q8U A;  1YJN S;  2U2F A;  2Z57 B;  3AQO A;  3EJM A;  3ISN D;  4L76 A;  1M1K T;  2B9W A;  3CDE A;  4ED0 A;  4RLE A;  4AL6 A;  1R6V A;  3TAM A;  3SQG A;  4DSJ A;  2VJV A;  2HZV A;  2HMI B;  1GTE A;  4QZV B;  1CJT B;  3I5A A;  4C0B A;  2IM2 A;  1PJ6 A;  2YXL A;  3M8Q A;  1T9Y A;  1RT3 B;  3KHL A;  5J2M B;  2HHX A;  2RU9 A;  3GFY A;  3ZZY A;  1U2C A;  5A8W A;  4GKK F;  3D66 A;  3RR7 A;  4J9U E;  1SKU B;  2DEI A;  4OYZ A;  3US5 A;  3CCV S;  2PI4 A;  3D6M B;  3Q86 A;  3ISZ A;  1RP5 A;  4ID5 B;  1Y10 A;  2HVE A;  2HS3 A;  5LJ5 Y;  1FEH A;  3W9I A;  2DRB A;  2RAQ A;  4U96 A;  2NXN A;  3TZY A;  1PBU A;  1SJ4 P;  3Q0A A;  2CAJ A;  3LAN A;  3IR7 B;  5LMN F;  1FX2 A;  3G71 S;  2AKW B;  2FVP A;  1NPR A;  2J0S D;  1FJ7 A;  2W1B A;  5IWA F;  1N5Q A;  5DZ7 A;  2DGX A;  5IC4 B;  3ZTP A;  3EIC A;  2PFF B;  3R27 A;  4N8N A;  2Y8Y A;  3EDR B;  5KG5 A;  1IR0 A;  2IIH A;  2LQ8 A;  3BH6 B;  2NXE A;  5HJY A;  4NRU A;  2GZO A;  2HZC A;  3FEZ A;  4HVZ A;  1NO8 A;  3BSA A;  5EDW A;  2BRL A;  2GMJ A;  4F04 B;  2ZZM A;  1NHV A;  2LQB A;  5L1L A;  4DFK A;  2JEG A;  3T1H F;  3A8I A;  4KC5 A;  1MSW D;  3T5H A;  5LMU J;  3DHX A;  2GGP B;  3NGD A;  1CBK A;  8RUC A;  1AXQ A;  4FP9 A;  4C11 A;  4DV7 J;  5HBM B;  1NSK L;  2XI3 A;  5KG2 A;  3M2V A;  1GXT A;  1CJU A;  1DAR A;  1FEE A;  4J91 A;  5F8I A;  3UFC X;  1NK4 A;  3EMT A;  3NNH A;  3M9O B;  3MDF A;  1NPK A;  3G9C A;  4MYT A;  2DO4 A;  1BGX T;  3PEH A;  2G13 A;  2EFP A;  3L7P A;  2HK2 A;  2W2M P;  3TR5 A;  4K4Z A;  4FYD A;  4LF4 J;  2CJX B;  4DG1 B;  3QMQ A;  1T9T A;  4M5G A;  1S6Q B;  3MR7 A;  3A8E A;  4UUW A;  5GMD A;  2V6A A;  4OX6 A;  4M8L A;  3PW4 A;  3N01 A;  4PWW A;  4C9D A;  4NRT A;  1QVF R;  4DQP A;  4FXD A;  4RPF A;  1E6Y B;  4DFM A;  5JMN A;  3BSO A;  3MM7 B;  4UST A;  4RNO A;  2HUR A;  3W5Y A;  3BBB A;  1FK9 B;  4DCJ B;  3ZXW A;  4TQR A;  4M5D A;  3VGT A;  4QW9 A;  2HG4 A;  4AL5 A;  3O44 A;  2KFN A;  4KHP J;  2R7T A;  4U8V A;  4C11 B;  3B4M A;  3D0I E;  3PZP A;  1RT7 B;  2YQ3 A;  1CUL B;  5AE2 A;  3KHG A;  3JAM Y;  5J2Q B;  1W2B R;  1Q86 T;  4NI2 A;  4JI0 J;  3QWP A;  1SUQ B;  1VQ8 S;  3H5X A;  3BGO P;  2R8H A;  1XN9 A;  4A8M P;  3G82 B;  3ICL A;  2HK3 A;  2UVU A;  5E41 A;  5BYQ A;  4R5P B;  2LEA A;  1PSD A;  3TQE A;  4F7V A;  1M1G A;  3O2I A;  3S6E A;  1S48 A;  3CPW R;  2IYI A;  1R8B A;  2F40 A;  2GAH C;  3AHP A;  1KC8 T;  2YY3 A;  3CNQ P;  3KUG A;  4HI1 A;  1IJF B;  2EKN A;  1M5O C;  2DIS A;  3ULH A;  4DX6 A;  4NLR A;  5AJ3 J;  4K0K J;  1REG X;  5LSO A;  3KNG A;  2PEH A;  3F41 A;  2GO8 A;  2D7S A;  4DR2 F;  4ZS6 A;  2E5H A;  4ECV A;  3DMJ A;  5HRO A;  2DR8 A;  1F0X A;  2A6O A;  2BQ3 A;  2AT1 B;  4ECW A;  3E2E A;  3SMZ A;  4ZKA A;  4ENO A;  4ZN1 A;  5BXI A;  4DV0 F;  1NJW A;  1RT4 B;  3PRV A;  4CM2 A;  2ZUG A;  5CAB A;  3EPG A;  3K59 A;  1FD8 A;  4O4G B;  4NYP A;  3EM1 A;  3TZZ A;  2H65 B;  5AXM A;  1VC6 A;  4J9P A;  1ZTW A;  4C8Y A;  3IGN A;  2GJ2 A;  2P9C A;  2H1Y A;  4EWT A;  1QAX A;  2H3E B;  4IRK A;  1D09 B;  1X0P A;  1WAC A;  1X4B A;  1JLG A;  2GVD A;  2MB0 B;  1RAJ A;  1YX2 A;  2AP6 A;  3FBF A;  1RTI B;  3G8Q A;  3HKZ D;  4TY8 B;  5IT4 A;  4ECX A;  3MAA A;  1UVJ A;  2QRR A;  1RTH A;  1JLA B;  2IVM A;  2ZDO A;  4AD6 A;  2C3M A;  1YG0 A;  2MMY A;  3BGL A;  5D3G B;  2IMO A;  1SKS A;  4KYZ A;  4TY8 A;  2MSS A;  3JSY A;  8AT1 B;  3FSY A;  1NK8 A;  4FVC A;  3RTV A;  4A8K A;  1ULR A;  5IOL A;  4BS2 A;  4M5M A;  5DG9 A;  2KM8 B;  1HNX J;  1QUP A;  1TMJ A;  3EGW B;  4QYZ J;  1PIL A;  2Y0B B;  1OWX A;  1AUS L;  2WAQ D;  2EXU A;  3CO9 A;  1F5B A;  1Q7L B;  4KIA A;  4MYU A;  4CT9 A;  3PFE A;  2RQC A;  1PKU A;  1P9Y A;  2FZK B;  4NLD A;  1M90 T;  3HVA A;  3MUV P;  1EZZ B;  1EHW A;  2DGU A;  2A3J A;  2AV5 A;  4CLY A;  3C16 A;  3BGU A;  3MMB A;  4PAB A;  2BKP A;  4IKA A;  3VV2 B;  1Q7Y T;  1CS4 A;  4MKB A;  5I42 B;  1HNZ J;  2VBX A;  1VLO A;  3MD3 A;  4FS1 A;  4DUY J;  3E01 B;  2IYG A;  2FC9 A;  1RAA B;  1RAO A;  2FGO A;  2ZBC A;  3D6H B;  4CH0 S;  3JAM U;  1BE4 A;  2KXN B;  4PG5 A;  2GCF A;  4ZVF A;  2HVZ A;  3AD9 C;  5KG7 A;  3HM9 A;  3OSP A;  2V2Z A;  4FKX A;  4HEA 9;  2HHP A;  3KWM A;  2DR6 A;  3D5M A;  3SCJ E;  1H3D A;  1SQG A;  3AT1 B;  1T05 B;  4KV8 A;  4Y34 A;  1X8D A;  3CO0 P;  3BDP A;  3K0J A;  4QU6 A;  3EUN A;  3G82 A;  4JI7 F;  4NCG B;  4CLU A;  3R2D J;  1EX8 A;  2C3P A;  2Y1R I;  4L74 A;  4LFC J;  1RAG B;  3FKB A;  3RW7 A;  2V9K A;  4IG0 A;  2X1G A;  1UPM B;  2YWE A;  2ZC3 A;  4M5H A;  3AXK A;  4WXW A;  2NPF A;  3BSN A;  3F56 A;  3FSI A;  2DGW A;  4AUK A;  3MFI A;  2ADC A;  1FNX H;  1RAB B;  5E3R A;  2V4Q A;  1I3O B;  2XHC A;  4B3S J;  4KH1 B;  4WBF A;  1RAD B;  3OR1 A;  2BV3 A;  3RZA A;  1UWA A;  1RWO B;  3VCD A;  3Q89 A;  1KLM B;  1H7X A;  2FJE B;  4GKJ F;  3VAK A;  1CJV B;  4GC7 A;  3NEK A;  2C2Z B;  4DLE A;  4LF5 J;  1TKZ A;  1VBX A;  1IBL F;  4LF6 F;  3I9V 9;  1S1T A;  2QSF A;  3NGR A;  3VHQ A;  3CXC R;  1CLF A;  3MM8 A;  1S6Q A;  2CAD A;  1LKZ A;  3R7S B;  5H9E J;  1FJG F;  2WB4 A;  5E3C A;  1PAE X;  1UZD A;  1P27 B;  1RT2 B;  4OJ1 A;  3FGV A;  4L6V 3;  4WXO A;  1HLW A;  3I4H X;  2C3U A;  2ASJ A;  1NK9 A;  2YNF B;  5CH7 B;  1IKV B;  2R7X A;  1CJU B;  4F8R A;  1ZA2 B;  2CQ4 A;  4CDI A;  1XIQ A;  2OPP B;  2AJ0 A;  2YQ1 A;  4NA2 A;  3FBC A;  1DLO A;  4PXC A;  4DL0 C;  2LMI A;  4L75 A;  3ZZR A;  5HQ8 A;  1BHN A;  1DTT A;  2DRA A;  2V9W A;  1C1C B;  3MCM A;  4J5O A;  2RB7 A;  4K4U A;  4NCG A;  4M5N A;  4WZM A;  3NNA A;  2DNO A;  2E7X A;  3R5B A;  1H73 A;  1ZAX A;  3QLH B;  4FNH A;  2E1M C;  2X3D A;  1WTF A;  3CMQ A;  2DNG A;  4KFB A;  1ZM4 A;  5E3A A;  1HBM B;  3FC9 A;  4LR8 A;  2P9G A;  2Z58 B;  1KTQ A;  3SDE A;  3QIP B;  3AOD A;  3QJL A;  5LT5 A;  1J5O A;  3G6V A;  3AOA A;  3O6Q A;  3QGP A;  3DYA B;  4KHR A;  3E51 A;  1BWV A;  1VRQ C;  4MK9 A;  3SFU A;  5B0D A;  1NK7 A;  4KTQ A;  1S97 A;  3GPA A;  5I42 A;  3S8S A;  4DR6 J;  3OSN A;  4HR2 A;  5GMK a;  1SBR A;  2RNE A;  3OVB A;  3GSI A;  1M5S A;  2LXU A;  4TKT A;  2W9A A;  1YIJ S;  1J5E J;  3N6N A;  4DR4 F;  3M8W A;  3I96 A;  2BKO A;  2RUG A;  3C6U A;  4B9V A;  2FHM A;  5LXR A;  1OSD A;  2VQE J;  3OTO F;  2V50 A;  2LEP A;  4DV3 F;  2OPS A;  4DR7 J;  4PQU B;  1FDN A;  4U9R A;  1JQG A;  3D3C J;  3K58 A;  4ELU A;  3UVJ A;  3CJ4 A;  5EWE A;  4DV6 J;  5A8W B;  5CD4 H;  2VKZ G;  1KBR A;  4DV2 J;  5LMU F;  2DR5 A;  4QCL A;  1IKY A;  1X4H A;  4ITS A;  5HP1 B;  4DV4 F;  2X51 A;  4CO1 A;  4USM A;  2VQF F;  2YWW A;  3J7Y U;  1RTH B;  3B6B A;  1S77 D;  4WE1 B;  2GMH A;  1R8H A;  5T14 A;  4J90 A;  4K5R A;  2EFG A;  1FF2 A;  2RRB A;  2VPW B;  4RKU C;  2NRE A;  1VBK A;  2ZZN A;  4IFY A;  2FB0 A;  4LVN P;  2FQQ B;  2QYC A;  4OLO A;  4CO3 A;  3PXG a;  3DN9 A;  1CQN A;  1H2U X;  1VRU B;  2MQP A;  1WEL A;  1NB7 A;  3EGN A;  1YKW A;  3NRB A;  3NBP A;  1F9E B;  4AXI A;  2BAB A;  4Q7A A;  1I6J A;  2YX1 A;  2CXE A;  1SKW A;  1YJT A;  1U4B A;  4EYI B;  1SB6 A;  1LOU A;  2QMW A;  2O3D A;  3PFO A;  2DIV A;  1FER A;  1QD1 A;  1U2R A;  2CWK A;  1RU2 A;  3JTP A;  1FRJ A;  3CCS S;  1I5O B;  1D8Z A;  1DQ8 A;  4DR6 F;  5KFZ A;  1EAR A;  4G3I A;  1QLN A;  4J9L A;  1YDL A;  3SCI E;  3V4M A;  4HT7 A;  4YDD B;  1ZET A;  3QIP A;  3AAW B;  2MQN A;  4M63 A;  3OV7 A;  2R8G A;  4F0H A;  1P8G A;  1JIH A;  4A8X A;  1GEH A;  4GO5 X;  4DSK A;  4CO4 A;  4JV5 J;  5DM7 Q;  3OFH A;  3S1T A;  2PMH A;  1GXL A;  3T6B A;  1URN A;  1UFW A;  2FHJ D;  2DBB A;  5C2C A;  1K8A T;  1HNV B;  1R8P A;  2CZ9 A;  1RBO B;  2KO1 A;  2E5G A;  5K14 A;  4CLP A;  1CUL A;  1D0E A;  3GCW P;  3K8W A;  3TA2 A;  2OGU A;  3IBC B;  4M5J A;  3SFG A;  1XMO F;  1BQM A;  4M5D B;  4WFZ A;  1K1Q A;  2ZJQ Q;  4ZLN A;  3VGU A;  2ZJR Q;  4LF1 A;  2POK A;  2JFK A;  2UUT A;  4DI6 A;  1FHT A;  2L48 A;  3DRX A;  1VQ5 S;  2ZVS A;  3DM2 B;  1Y9O A;  2XSJ B;  5L1I A;  2D69 A;  5A0Y A;  4B9T A;  1FKO A;  1GAO A;  4IG3 A;  2IRX A;  4ES2 A;  2HFU A;  5L9X A;  3R1H A;  1IXK A;  4N7T A;  3DI6 A;  4P10 A;  4NWB A;  2F8M A;  4B17 A;  4F4Z A;  3IWL A;  3NAI A;  3IRX B;  3JSM B;  2KJW A;  4MFB B;  1ZM3 A;  3FNN A;  4F4Y A;  2VC0 A;  3OR1 B;  2V5H G;  4RX6 A;  5HSP A;  2C2O B;  3TUJ C;  3T3F A;  3PV8 A;  1VYA A;  2BMB A;  3G8S A;  5A6P A;  1NK6 A;  2Q66 A;  1YBT A;  4CLZ A;  1TAQ A;  3CD7 A;  4W90 B;  4JI1 F;  3Q23 A;  4FF4 A;  4F3Q A;  3HVT B;  3M1V A;  3C14 B;  4J37 A;  3H4D A;  1TVR A;  2O1P A;  2RD5 C;  1UEV A;  4Y2I A;  1S59 A;  4DQQ A;  2IC3 B;  2ILZ A;  3ZZO A;  3A3O B;  4OI6 A;  5CYM B;  5F9L A;  2B5J A;  2ZOM A;  4P71 A;  3M05 A;  3PW5 A;  2VDI A;  1UWB B;  5DQH A;  3PX4 A;  4ZVE A;  4LFC F;  2E5J A;  1X9S A;  2EBG A;  3W7B A;  2J9D A;  1HD1 A;  3BQ0 A;  2JC1 A;  3MMA B;  1FI4 A;  4X4O A;  2PI5 A;  4I56 A;  1R7I A;  4OYM A;  4GMK A;  2NXC A;  2V4J B;  5CCL A;  2PDA A;  1BQN A;  2CQC A;  4LSN B;  2B8P A;  1DQA A;  4DXL A;  4F4W A;  3R6G B;  1UA0 A;  1LXN A;  2RDI A;  5F8L A;  4R25 A;  1MRO A;  4NEZ A;  3DKD A;  4X64 F;  1LK5 A;  1UJ5 A;  3IC1 A;  3NXZ A;  4DQR A;  2DGT A;  4KY3 A;  2W7A A;  3WIU A;  3MR6 A;  1LEO A;  3J7Z T;  3RB3 A;  4X84 A;  4CT8 A;  5HVF A;  1JLQ B;  3T1H J;  4FPI A;  3PDN A;  1S72 S;  2GJF A;  3LPY A;  2UUB F;  1SL0 A;  3OTD A;  3KTQ A;  4DS5 A;  4I7F B;  2AGO A;  5HVG A;  2MKH A;  1MMD A;  3TAM B;  2DNN A;  2YVS A;  1CC8 A;  4NLV A;  4K4W A;  3R1L A;  1S9F A;  3BBC A;  3QYY A;  5F3T A;  2AZ3 A;  3QT6 A;  4H54 A;  1LWE B;  2LCW A;  4D3H A;  2HHU A;  3M2U A;  3U27 A;  2HND B;  5THW A;  1VRT A;  2YNH A;  5I4M A;  5KFE A;  3VTI A;  1F9H A;  3IM9 A;  1L3U A;  4OYI A;  5GVQ A;  3VQS A;  1UZH A;  3TX8 A;  5CHC B;  5I3Q A;  1S6P A;  5KT6 A;  4QIW D;  2GJI A;  3FFI B;  2CQ3 A;  3C6T B;  3H42 A;  3HDS A;  2P6T A;  5FII A;  1M0S A;  1U49 A;  4KPY A;  1FJG J;  4WIQ A;  3JYT A;  1KVK A;  2XNQ A;  1XMQ J;  2KB2 A;  2KFZ A;  5D8H B;  1LQ9 A;  1SH0 A;  2B9E A;  4N47 A;  4UY8 5;  1OS5 A;  1U7L A;  2GAG C;  3ENW A;  3H7H B;  3HSJ A;  1T9W A;  2VA2 A;  2UUW A;  2RIL A;  1VHI A;  1VQN S;  3GG0 A;  2IA6 A;  3ZZT A;  2VG7 B;  1PC4 A;  1VIS A;  3TAR A;  5C5J A;  5D4N A;  1TL5 A;  2HQC A;  3HHL B;  3OLB A;  5CYQ B;  2WTF A;  2VHG A;  4ETX A;  4EBC A;  2XG8 A;  1ZM9 A;  2CNN B;  3W61 A;  1URR A;  2HWI A;  4R5P A;  4JV5 F;  2C2E A;  1NU4 A;  1XTZ A;  3AXM A;  3HD2 A;  3SEO A;  3POT B;  2R4F A;  1U1O A;  4NXM J;  5CXT A;  3DLK A;  1S1V A;  5J2Q A;  4V19 J;  3C46 A;  4C3L A;  2ZH3 A;  2CQ1 A;  5GAG I;  1BC6 A;  1GQE A;  3J7Y I;  3ETO A;  1FDA A;  4Y0F A;  4QWD A;  1WC1 A;  1N5V A;  4F2R A;  4JI4 F;  1RU1 A;  3SZ2 A;  3EYZ A;  1C0U A;  2NYI A;  3M8P A;  2I9S A;  2RU3 A;  3H40 A;  4RW6 B;  4ER8 A;  3IRX A;  4B9N A;  1EP4 A;  1HYS A;  1HAR A;  3DI6 B;  1L3S A;  4USK A;  1GXU A;  2W8K A;  3QSY B;  2QMX A;  2ZIT A;  4DX5 A;  1K0T A;  1OYD A;  1IQZ A;  1M1H A;  1C1B B;  4HDG A;  1KHV A;  1IBM F;  3RRG A;  2AZ1 A;  3BR9 A;  3BV8 A;  2VOD A;  2RSQ A;  1JKH B;  2CA9 A;  2OSR A;  3H20 A;  3NGT A;  1RZM A;  2OPR B;  3BN7 A;  3CDW A;  4NXN F;  2BE2 B;  3R7N B;  2ZH6 A;  4WFX A;  1S1X B;  4OYO A;  3PW0 A;  4DWI A;  4IQX A;  3MHY A;  1BQM B;  2LQ9 A;  1M5P C;  3LP0 B;  4ZVP B;  2EVZ A;  4NLP A;  2AGP A;  3GIK A;  5CCM A;  2V67 A;  3CGI A;  4N8O A;  1U0H A;  3R3T A;  3POT A;  4OZ3 A;  3SXL A;  3H2V E;  4NYZ A;  2VQE F;  4DV3 J;  2ZUA A;  2R2R A;  3GR1 A;  4QWA A;  1PGZ A;  4OFZ A;  2J6U A;  2XSF A;  1WDT A;  4M5K A;  2G0C A;  5F0U A;  4X4P A;  2W7P A;  4KV8 B;  1KDN A;  1WOO A;  2KDO A;  2WCX A;  4JB8 B;  4LF9 J;  3KJQ B;  2XYH B;  4ZHR B;  5J1P A;  3TA1 A;  3PIP Q;  3TX0 A;  4H4M B;  1KKH A;  3HLU A;  2N3L A;  2R2T A;  4GO7 X;  1I94 J;  1NSA A;  4CZC A;  1S12 A;  2K3K A;  4P2M A;  3BQ1 A;  2CJA A;  1JWW A;  4U7U D;  1VCT A;  1JNR B;  1RT6 A;  1LXJ A;  3B54 A;  1ACM B;  2ZD1 B;  2BJ8 A;  3IMQ J;  2C2R A;  2VOP A;  1MU2 B;  1GFW B;  3HSD A;  3R8Y A;  2HNY A;  1ICE B;  3L7O A;  4QIF A;  2FLP A;  3CC7 S;  4JI1 J;  4HTI A;  3LP2 B;  3OTC A;  4TYB A;  3TZW A;  5JUM A;  2G0I A;  1TQL A;  3LF0 A;  2OPQ B;  1G2E A;  2MST A;  5BR8 F;  2GQQ A;  1HFE L;  2D3Z A;  4ZCL A;  1ZYQ A;  3M2U B;  2GQC A;  2BDP A;  2W25 A;  3OW2 R;  1CJT A;  1WI6 A;  2B51 A;  3I0R B;  3A4T A;  1BXN A;  3EXC X;  2EK6 A;  4DPU A;  5C24 B;  3HMJ G;  4EBD A;  5LOQ A;  3MEC A;  1MWZ A;  4ZIV A;  4X4S A;  3T1Y J;  3T1Y F;  4B3S F;  1TUG B;  4JI3 J;  5E7O B;  2DNP A;  2M0G B;  4LR7 A;  1JLG B;  1VMB A;  2QA2 A;  4WFN Q;  1WI8 A;  4ES3 A;  2CVI A;  3TO8 A;  3H4B A;  3RBE A;  3CTR A;  3DGP A;  4DCO B;  1IJE B;  3WX4 A;  3CIZ A;  2LEC A;  2GHV C;  4FYY B;  2I6W A;  4PRF A;  2M2B A;  4Z37 A;  3NCP A;  2V8V A;  5F8G A;  2GA7 A;  3HHK A;  1KR4 A;  4OX8 A;  1FRX A;  4MKA A;  2MKI A;  2EG1 A;  1RE1 B;  2BJ3 A;  4Y3C A;  3ENV A;  5HRO B;  3HT3 A;  1CPZ A;  3MUT P;  4DS4 A;  1FT8 A;  2V4J A;  4ZP7 A;  1U8W A;  2LYV A;  4KHM A;  2H5E A;  4FVM A;  4EO8 A;  1RDR A;  4D3G A;  1FVS A;  4IFV A;  4W4M A;  4P9S A;  1RLC L;  2DT9 A;  4ZHR A;  2W9B A;  3UDE A;  3J80 U;  1F6T A;  3QID A;  2LFV A;  3SSQ A;  5D6G A;  2ZE2 A;  4QYZ K;  1N5Y A;  4KGZ B;  1NME B;  2IY5 B;  2IC3 A;  1UET A;  3HVR A;  3SBM A;  3K5L A;  4EMD A;  1IWG A;  3K89 A;  4UUX A;  5D0G A;  1DTT B;  2FHK A;  5I3P A;  5H9F J;  2ZH2 A;  1T9V A;  2BX6 A;  2M3D A;  4ALZ A;  3FDS A;  4LFA F;  2UU9 J;  2JL9 A;  3X1L B;  1VIX A;  3N6M A;  1GX5 A;  4RWW A;  1FFW B;  2HBY B;  3R5J B;  3MR5 A;  3FSX A;  4F4A A;  2OMO A;  1AFI A;  1JXE A;  2AD9 A;  3PEJ A;  1VS3 A;  1VQM S;  3NS6 A;  4ZVR B;  1N52 B;  3RB0 A;  1VC0 A;  4OZJ A;  1NH7 A;  2R7V A;  1SJ1 A;  2CJK A;  2AJ4 A;  4RBT A;  1C2P A;  1S1T B;  2DNL A;  1FD2 A;  4IRD A;  1DRZ A;  4CTA B;  3R2C J;  5D4O A;  1V6H A;  3U1M A;  3M8S A;  3DM2 A;  2Y9H A;  3DRR B;  4FXV A;  2ZH1 A;  3V5R A;  2JRS A;  3ENQ A;  3RG6 A;  2B9Y A;  4KRW A;  4ZLP A;  5SUH A;  4Q2L A;  4A8O A;  1F1B B;  2XEX A;  2RRA A;  3B8H A;  2X1F A;  3V6K A;  5HBM A;  3A8K A;  4C7Q A;  2YPY A;  4MAK A;  3OXF A;  1SCJ B;  3ZNU A;  3PVX A;  3G6Y A;  1WEX A;  3HVW A;  1U1M A;  1OSC A;  1YJU A;  4TQS A;  3VAM A;  3CCM S;  2DY1 A;  4CI0 B;  4USV A;  3CDB A;  3IR5 B;  4C8K A;  4A8F A;  4P73 A;  5HAT A;  1U47 A;  3ET6 B;  4P7V A;  1FVQ A;  1Y5I B;  3G87 A;  4DN0 A;  1RGV A;  1X5O A;  1Y00 A;  5ETQ A;  3UDC A;  1YI2 S;  3N4W A;  4G1I A;  1SJQ A;  5J2P B;  3HX9 A;  3BH7 B;  3GIJ A;  4NPO A;  3TWZ A;  1YZ7 A;  1NDP A;  3WBZ A;  1Y11 A;  3ZTS A;  2VB6 A;  3DC2 A;  4YY3 J;  2WOM A;  4X4N A;  4QPX A;  4LF8 F;  1VQ6 S;  3UNG C;  4X66 J;  3HFZ B;  4N41 A;  4MJK A;  3E8O A;  4P2X A;  1V5V A;  3DU6 A;  3OFE A;  4NYO A;  2GVZ B;  4LFB F;  5F8N A;  4GRS A;  4LIR A;  2ZHB A;  1N5S A;  1ZZF A;  4JI2 F;  3KLF B;  1B0T A;  3GZ7 A;  2QLW A;  4MIW A;  2XBP A;  3G4S S;  3HP6 A;  4B3M J;  1D8Y A;  3HI9 A;  5LL6 d;  2JJ4 D;  1DHM A;  2DCU B;  3BGR A;  2U1A A;  1NAQ A;  1VR6 A;  2RQK A;  1LWE A;  2DH7 A;  3TA0 A;  3W9H A;  2KRB A;  4O0I A;  3M9N B;  3FRZ A;  3GIR A;  1PJ7 A;  1R43 A;  4RO0 A;  4DV4 J;  1N6Q B;  4URS A;  2FD2 A;  2VOO A;  1FRL A;  3RR8 A;  3PG9 A;  5KFV A;  1QAI A;  1KQK A;  1GX6 A;  1RTI A;  2M7S A;  2ZEJ A;  1VI7 A;  2ZKT A;  1QSY A;  3VWS A;  2XCP A;  4OLP A;  1HI0 P;  4WP3 A;  5CYJ A;  1J5E F;  3MR3 A;  2OPS B;  2FGC A;  2FLO A;  2MLY A;  4QWE A;  2XQC A;  2GX8 A;  3QRQ A;  1P1L A;  3T5J A;  1NK5 A;  2FVR A;  2I2Y A;  4JI5 F;  2OD6 A;  1Q82 T;  2DXF A;  3DLG B;  2FJA B;  2KXF A;  1S9E B;  2XMU A;  1F5A A;  1O0P A;  3MED A;  2AHO B;  2OUG A;  3R5A A;  5DGB A;  5KFG A;  3KOA A;  1YJV A;  2V8H A;  4OV1 A;  4U8Y A;  3O3L A;  5HL7 Q;  1HKA A;  4J9R A;  4DQI A;  1FTR A;  2KI2 A;  2RKI B;  5IV3 A;  3OJS A;  2JOQ A;  2MKJ A;  2COL A;  2GO9 A;  1S6O A;  3I87 A;  3M32 A;  2XC9 A;  1WJ9 A;  1LV5 A;  4LF4 F;  4ZVQ B;  1NB2 A;  2H4W B;  3MMA A;  2AU0 A;  1T3O A;  4I69 A;  4Q44 A;  4DN9 A;  2X7I A;  4DSF A;  2V4R A;  3ISN C;  3HHE A;  1S4F A;  1VQP S;  2VD3 A;  2C3Y A;  1HR0 J;  4OMF G;  3TUI C;  1KHW A;  1C1C A;  1VJQ A;  2CYY A;  3ELH A;  4EGL A;  2ASD A;  3U1L A;  2Y0S D;  3HVT A;  1IBC B;  4DUZ J;  4C4W A;  1S49 A;  3VAG A;  2W9C B;  1S57 A;  1K73 T;  3ZZ0 A;  1FXR A;  4A8Q A;  1Q81 T;  3H59 A;  1AT1 B;  2KL8 A;  4B3O A;  5J2N B;  4I2P A;  4RZR A;  5CQG A;  3PTW A;  1AZS B;  1HNX F;  2AWZ A;  3HKW A;  1G4C A;  3CJK B;  1YJW S;  2B6A B;  2F9D A;  1BQX A;  4Q8F A;  4PPZ A;  1MN7 A;  5KFF A;  2CQD A;  1CSJ A;  3O5T B;  5DQG A;  1D1U A;  1T0T V;  2DRD A;  3CJ3 A;  2RF2 A;  1FWK A;  1Q79 A;  1ZA1 B;  2CQ2 A;  4NX9 A;  4MIB A;  4RW9 A;  5D78 A;  5A6W A;  4Q43 A;  2XSJ A;  4K4X A;  2XY6 A;  1YIT S;  2DGS A;  4FF1 A;  3RBZ A;  3P3D A;  5F8J A;  1BWE A;  1RK8 A;  1H72 C;  4Q0B B;  2GQ2 A;  3QAE A;  2KZZ A;  2C1E B;  2VG6 A;  2QO3 A;  4OHZ A;  3SYZ A;  2W9C A;  5K8M A;  1X4E A;  1JJH A;  3BPD A;  1QM9 A;  2DTJ A;  2H9Z A;  1S9G B;  1H74 A;  3L4B C;  4A4J A;  1UVN A;  2QLB B;  3DLK B;  1JJC B;  1X4C A;  4LBP A;  5K8O A;  2M4M A;  2XMA A;  4MTP A;  1TL7 B;  5D0H A;  1HNW F;  3EX7 B;  1LWF B;  2BW7 A;  3IAM 9;  4FYW B;  1QDU B;  2ZBQ A;  3ILI A;  2JNJ A;  3MMJ A;  1QTM A;  4M1K A;  3MD1 A;  1W7W A;  2VPZ B;  1M5V C;  4OYB A;  4LF9 F;  4X62 F;  4IO1 A;  4JP8 A;  2CJQ A;  3LO3 A;  5KFK A;  4FF2 A;  1F3F A;  1U1L A;  1KQG B;  3DFE A;  5IQ6 A;  2HFS A;  2BW2 A;  4AQY F;  1FKP B;  3HT0 A;  4LBH A;  1N5T A;  3Q2T C;  1LK7 A;  2MY7 A;  3ZTO A;  2DNH A;  2CIM A;  4ZCK A;  4CLK A;  2EPI A;  3ETM A;  3FQL A;  4CWB A;  3JYT B;  5DG8 A;  2Q1L A;  3JQK A;  5EX0 A;  3KK1 A;  3UDV A;  2JHE A;  1S6P B;  3C3L A;  2KT2 A;  4C8Z A;  1X5P A;  3DGP B;  4I4B A;  2CZ4 A;  4CO2 A;  1R27 B;  5K8N A;  1HNZ F;  1WNE A;  2MYF A;  1ZS6 A;  4FDF A;  4NXM F;  3KHR A;  2CDQ A;  2FVC A;  2KYZ A;  3MPY A;  3IBF B;  3M8Q B;  3MPV A;  1BLU A;  1VQS A;  3VQT A;  3M9M B;  1N34 J;  4HHU A;  1SC6 A;  2HNZ B;  1R8A A;  3NS5 A;  1HA1 A;  5AT1 B;  4C3K A;  3V6H A;  4DFJ A;  3UR0 A;  4RW4 B;  2YKO A;  1QSL A;  3TJA A;  2ZH8 A;  1TKX A;  5ETS A;  4JI4 J;  3CCR S;  5AXL A;  4IR1 A;  1XR7 A;  1WEY A;  3C15 B;  3D9B A;  1U26 A;  4AQY J;  2VIC A;  2MY8 A;  4F36 A;  4K4S A;  1HPZ B;  5AE3 A;  2M8D B;  1Z2L A;  4F0M A;  4PQU A;  4RBV A;  1FNM A;  3RBD A;  3P45 B;  3LP2 A;  4X64 J;  2XI2 A;  2A1B A;  1RQ0 A;  4LBI A;  2GVZ A;  5KFP A;  4X62 J;  2IAJ A;  1A0O B;  2BJ9 A;  2SXL A;  1HBO A;  4CLF A;  1IM4 A;  3CCW A;  4RL1 A;  4N56 A;  2FIU A;  2ZNZ A;  5GAE U;  3OPK A;  3KDO A;  3D3B J;  2JZ5 A;  3BYR A;  2QZ8 A;  3DU5 A;  2R7W A;  2E9Z A;  3G2X A;  4ED7 A;  2HLT A;  3O8W A;  3J81 Y;  3D1H A;  3BKT A;  1SQE A;  4NLT A;  3DDI A;  3AA8 A;  5FDL A;  1HWI A;  3VAH A;  2VU5 A;  2A18 A;  4Q8E A;  2DIU A;  4LSL A;  2KJV A;  2UV8 G;  3WIV A;  1SL1 A;  3CCT A;  4TYA A;  1PBA A;  2HQD A;  3KXD A;  5E33 A;  1RHQ B;  1KQF B;  2IPO B;  2LXF A;  2HIY A;  2J76 E;  2HSE B;  5KT7 A;  1WF0 A;  2O67 A;  3SQO P;  2BUN A;  2HGL A;  3T9Z A;  5KG4 A;  1Q5V A;  3ZZP A;  5KFR A;  1IUJ A;  3OLA A;  4RUA A;  2AMC B;  4C3M A;  4ED1 A;  3JB9 k;  4NCA A;  1LWC B;  2VBY A;  3VR1 A;  4C6A A;  4LMZ A;  1APS A;  1FK9 A; 
#chains in the Genus database with same CATH homology
 3QBC A;  3MCM A;  3MCN A;  5ETN A;  1RU1 A;  4M5L A;  2F65 A;  4M5N A;  4M5K A;  3HCX A;  3HSJ A;  1HKA A;  1RU2 A;  1KBR A;  1DY3 A;  1RAO A;  1G4C A;  1Q0N A;  3ILI A;  1RTZ A;  5ETK A;  4F7V A;  2F63 A;  3IP0 A;  4M5G A;  3ILO A;  2CG8 A;  3ILJ A;  3MCO A;  4AD6 A;  5ETQ A;  3ILL A;  5ETO A;  5ETL A;  3KUG A;  5ETS A;  3HSZ A;  5ETV A;  5ETR A;  3UDE A;  1RB0 A;  4M5I A;  3KUH A;  1TMM A;  3HT0 A;  3HD2 A;  1EQM A;  3HSG A;  1F9H A;  1TMJ A;  1EX8 A;  4M5M A;  4PZV A;  5ETT A;  3UD5 A;  2BMB A;  2QX0 A;  1CBK A;  3HSD A;  4CWB A;  1IM6 A;  4M5H A;  4CYU B;  4CRJ A;  4M5J A;  3UDV A;  3HD1 A;  3KUE A;  5ETP A;  4CYU A;  1EQ0 A;  1HQ2 A;  5ETM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...