1RU2A

Crystal structure of a ternary complex of e.coli hppk(v83g/del84-89) with mgampcpp and 6-hydroxymethylpterin at 1.48 angstrom resolution (orthorhombic form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
146
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPPDYLNAAVALETSLAPEELLNHTQRIELQQGRGGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Essential Roles of a Dynamic Loop in the Catalysis of 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 146
sequence length 152
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1ru2A00
4M5IA 2CG8A 2BMBA 3HSZA 1KBRA 3KUHA 1EX8A 4M5JA 3KUGA 1CBKA 3HT0A 3HD1A 1TMMA 3ILOA 3MCNA 4PZVA 1TMJA 5ETKA 4CRJA 1IM6A 3UDVA 5ETSA 1RU1A 3UD5A 4M5HA 4CYUA 1RTZA 3HSJA 4M5GA 3HCXA 3QBCA 4M5KA 5ETNA 4M5MA 1RAOA 3MCMA 1RU2A 3ILIA 4M5NA 5ETMA 3HD2A 4M5LA 1DY3A 2F63A 5ETLA 1F9HA 1HQ2A 5ETTA 5ETVA 1Q0NA 5ETPA 4CYUB 1EQMA 3IP0A 3ILJA 5ETQA 3MCOA 1G4CA 2F65A 4AD6A 3HSDA 3KUEA 1EQ0A 5ETOA 4F7VA 4CWBA 3ILLA 3UDEA 1HKAA 1RB0A 2QX0A 5ETRA 3HSGA
chains in the Genus database with same CATH superfamily
3C15A 4RBVA 2OEKA 3TQEA 1CULB 3G2XA 3PR4A 4NX9A 4OI6A 1UVNA 3IWLA 4DUZF 4RLEA 2ZM6J 3FQLA 2VF3A 3M05A 5KT7A 1Z4UA 3E51A 3G9CA 2B8QA 4O3OA 4DL5A 4DEZA 5L38A 1CULA 1U6BA 3ETMA 3HULA 3UN5A 2PI5A 3CC7S 3T6JA 2ROGA 3NS5A 2HEKA 3RR8A 3T19A 1UW4A 3KG0A 2APOA 2C2MB 1RTIA 2RUSA 4P72A 1H3DA 3AH6A 2DNPA 2JJ4D 2GIRA 4KV8B 1ZZFA 2R7OA 1T9TA 1N5QA 4A47A 1WEXA 2E7VA 4NZ6A 3ZNJ1 2UUBJ 2NSCA 1JQGA 3EDQB 3GIKA 4L76A 1MW7A 2WW4A 3DI6B 4FBUA 1G1XA 3OR2B 5DG9A 2NXUA 4JI7F 1XIQA 4KV8A 4K4VA 3TQ1A 5ETMA 2DGUA 2FLNA 4TY8B 4Y2IA 3HVRA 4KY3A 2MGZA 1DURA 2CZ4A 1TUGB 3BREA 3PX0A 1TMMA 4LF4J 2Z8QA 1BE4A 2ILZA 3DI6A 1ITPA 3OR2A 3CC2S 2XNQA 1REGX 1N5YB 2GO9A 4CLPA 5DG8A 4TY8A 2R8IA 2VC1A 3MMJA 8RUCA 3FCVA 3H2UB 1PAUB 1UA0A 1B99A 3AB4B 2C3YA 4TLRA 1FESA 2AT1B 4ZPVR 4DV4F 1FKPB 3PHEA 3F0NA 2IFXA 1N5YA 3DRRB 1OQ6A 1A7GE 1J5OB 4ZJOA 3TA1A 4PQAA 4C8YA 1U2FA 4ZLNA 3SFGA 1EIYB 4GKJF 3A1YG 2KL8A 5C42B 3H90A 2PC6A 1BC6A 4LQ9A 4RW4B 4FXVA 2UVRA 3H20A 4DL3A 2XQCA 4IRCA 1FKPA 3HO1A 4DV2J 1VC6A 3JTOA 2YX1A 1TTHB 4YHHJ 3M8ZA 1J5OA 5CCMA 1DARA 3AQOA 1REVB 1NO8A 5C42A 2AU0A 4CTAB 3M1VA 1WHVA 1O8BA 4RW4A 2H5EA 2Y9HA 5F8MA 1U09A 2KB2A 2X51A 4KIAA 4Y2CA 1VQNS 4X62J 4B9UA 3K0JA 1PSDA 2GX8A 2FVCA 5I4MA 3LPEA 5KFNA 2AWZA 5E3RA 3BSOA 1YJ9S 2GQQA 4RNMA 4Y00A 3AA8A 2R7VA 1REVA 2C2EA 4CTAA 2BXJA 3DLGA 5KT4A 2CJYB 3D28A 4ITSA 4IQMA 1FDDA 4KH1B 4URQU 4PCQA 2F4VF 2ADCA 2CZVC 5MLCV 3HVTB 3NGTA 1JK9B 2HG4A 2UP1A 3TANA 5D4OA 1X4HA 2X7IA 1SL1A 2ZUAA 1KFDA 3MWBA 1Q8LA 2PA8D 4DG1A 3LALA 1YJUA 2JNJA 4UZCA 3LP0B 2M7SA 2HBZB 1PBUA 2HS0A 2RNEA 2BBEA 3HVTA 2OPSB 2Z2YB 2Y0BB 3EM1A 4HT5A 2A0FB 2HFVA 2LDYA 1AUDA 4PXCA 3FFIB 2VU5A 1T0TV 4B3RF 1IJEB 3KHRA 3LP0A 1E6YB 1M5PC 4DCJB 1U1LA 5CXTA 1RP5A 2CXEA 3M7VA 2OPSA 4K4YA 4CH7A 1K8AT 4AQYF 2OUGA 4Q8EA 1NB2A 2HNDB 1RBOB 2Y1JA 4ZCIA 1T7PA 1RAEB 1NU4A 4WYWA 1S57A 1E6YA 2PEHA 4URGA 4AL6A 3ONQA 4J91A 2HNDA 2CJKA 1K0VA 1MMLA 4ECTA 5D78A 2HLTA 4IH7A 4ATNA 1SC4B 4B9NA 2KVIA 1RYSA 2EEYA 1DAXA 5E3QA 4U7UD 2ZH5A 3D3BJ 1F5AA 4O4RA 3KK2B 2FD2A 2YY3A 3MPYA 1FFGB 2UUAF 2AEJA 1M1GA 3M6VA 4W90B 4TLQA 3BGRB 1NHVA 3QGGA 1PG5B 2LQJA 1F9HA 3MCOA 1K44A 2UV8A 4EBDA 5GAHI 4E98A 3P5BP 4K5RA 5CABA 1URRA 3CE8A 1QSSA 4G65A 2MB0B 3KK2A 2Y1RI 1JXEA 1S79A 3BGRA 2K8GA 3I31A 5A8KA 3UPFA 4F7VA 5LMUF 1NSQA 3VCDA 4LR8A 2QMXA 3FNNA 2BUNA 2H9ZA 2R8HA 3ZZYA 3AD9C 2RQ4A 3HM9A 4C4WA 3BKFA 3O3LA 1NAQA 4ETXA 3NG8A 1QE1B 3BQ2A 3PDNA 4JYAJ 2BJ3A 3MD1A 2IA0A 4CWBA 2FJDB 2GMHA 3H5YA 1Y10A 2E5JA 2ATCB 3PCOB 3PFOA 3FBBA 3ZZUA 1UVMA 2YWEA 1IM4A 5J1EB 4GKKF 1QE1A 2YH0A 1OS5A 2QYCA 2CPZA 2KXFA 1FRXA 5B0FA 3TUZC 1WEYA 2LEPA 5GADU 3QQCD 4A46A 4OV1A 1M1HA 3F56A 2MZRA 3MR7A 4DV7J 1U7LA 2AYGA 2RE1A 2B9XA 2V8GA 2MHNA 3MMBB 3H59A 4DUYF 4WZMA 4KPCA 4LFCF 3OFHA 3A13A 4Y2MA 2MKYA 3OTEA 4QIVA 2DXEA 4XK8C 1RWNB 2GCFA 3I5AA 2DO0A 5I3UB 5ETOA 3U1MA 1WG4A 3N79A 4ECYA 4ED1A 4B9SA 3MMBA 3I9V9 3RBXA 1VBYA 1MROB 4OZ2A 1F1BB 3EXYA 1U1QA 3GFZA 4QR1A 3JTPA 2G2YA 3W62A 2DJWA 1OYDA 3B8HA 4PXBA 5I3UA 1GAOA 5ETKA 4GVLA 3R5GA 3ZTSA 3K8VA 1MROA 1UWBB 3CIZA 4IFYA 3KDNA 2BJ9A 5D4PA 4BCAA 1KC8T 3KUGA 2Q1LA 1LWEB 1X4GA 1VRTA 3T9NA 1RAGB 4ES2A 2C2DA 4JV5F 3UCUP 3CD5A 1S6QB 5ETTA 3HKZD 4IOCQ 5HQMA 4YQWA 1UWBA 2J6UA 2F40A 3ILOA 4RW8B 1Q5YA 2FZGB 2BKNA 2H5IB 2WSFC 3K17A 1CEZA 1RAAB 2VFUA 2XWXA 3DRYA 5KG3A 1S6QA 2DY9A 3ULHA 2GHWA 2YKMA 3QJPA 2M3DA 1QVGR 1NDPA 5D3GB 2EFOA 4PYAA 3ZZTA 2OD4A 4RW8A 4EGLA 3OHBA 1AFJA 4DPYA 1EARA 3HFKA 4KQZA 3I9ZA 1YJVA 2JEJA 4K4WA 4WK3A 2VQEJ 5D3GA 1HHQA 2FVPA 4OX9J 1WJ9A 1Y9OA 1BY9A 2W4CA 5F8NA 4KGVB 4ZP6A 4X65J 3W2VB 2YX4A 4FKXA 4CO0A 1YJNS 5KFDA 2HHHJ 5KFQA 2OLWA 1ZM2A 1VQYA 3W60A 2ZBCA 4ZCLA 1V5IB 1UKUA 4C3KA 4B9TA 1U02A 2DCUB 1JJ4A 2XMKA 2GFFA 4BLGA 2X3GA 1JX4A 3CNQP 4C8NA 5L8RC 3W2VA 3BN4A 2R8JA 2HSEB 1OQ3A 1NDKA 2JC1A 2KDOA 1RLCL 3B4MA 1APSA 5SUHA 4HH0A 2QA1A 1RHJB 1RCXB 3HHLD 1XJWB 4I7FB 5LM7E 4DF4A 2HKEA 1RACB 1HHSA 1S1UB 4DCOB 2F63A 4MKBA 3HP6A 2LYVA 4QCLA 1L3SA 5GMKa 3CJQA 4ZDNA 1WC3A 2KRBA 4IR1A 1JLQB 1DHMA 1FI4A 1FFWB 1QD1A 4I1TA 5K5MA 1GFWB 4F3QA 4J7CA 1Y0HA 1IKXB 1S1UA 3QZ7A 3A8EA 2DR7A 2ZC4A 1VQ5S 7AT1B 1N33J 3A3NB 3H4DA 3OTDA 2L9WA 2V68A 3CEDA 4ED3A 2W9CB 2Z57B 1FJ7A 2J5AA 4HHJA 2GV1A 4EWTA 3V4MA 1JLQA 3DLKB 3W3SA 4ZJLA 3CCLS 1KQKA 1IKXA 4U7UK 4DX6A 1PJ6A 4Q7AA 4C11B 4C8OA 3AD7C 5IWAF 4BS2A 2ZHAA 1UFLA 3TAMB 2W9CA 1U2RA 4GO5X 1WI6A 3Q8YA 5LJ3Y 3DLKA 2CPEA 3DDNA 4CO2A 1VQOS 5J2PB 1UL3A 3PZPA 2E1CA 1N0UA 2Q66A 1KP6A 1YLXA 4C11A 5B09A 3M2UB 4M94A 1MNEA 3M8PB 3TAMA 5B7WA 4ILLA 4KHMA 2FZKB 2DGVA 1XBWA 4JI8F 4DR2F 1R8AA 4DR3J 4E8UA 4ED4A 2XHCA 3TRGA 1XR6A 4B17A 4RJVA 2DXFA 1X5PA 3M2UA 1M5HA 1NJYA 1FJCA 1WEZA 4DPWA 3M8PA 2DEIA 1TVRB 2IVMA 1CJKB 2HQGA 4C48A 1QTNB 3MDFA 2EFNA 4USIA 2A18A 4WCEQ 1C1CB 3D1QA 3DFEA 1UWAA 2OMLA 2C3OA 1TL7B 4GC6A 1RTJB 1PJ7A 3NGDA 1GMWD 2F8MA 1NBEB 3TX8A 1WOSA 2RS2A 3FK4A 1TVRA 3TZZA 4EO8A 1CJKA 2VUGA 5LT5A 1H98A 3GIIA 1OY9A 3HZGA 1C1CA 2EC2A 3RW6A 1F6TA 2X1BA 1TL7A 1R7IA 1RTJA 3N4WA 1XEZA 1G4CA 4PKDB 3T5LA 2WB1D 1PYSB 4QWCA 2LEBA 3MOJB 4F50A 3CC4S 4UQTA 2CFXA 1RISA 3OHAA 2NREA 2XSJB 2E9ZA 3LP1B 1LOUA 4OHWA 3HHLB 1VCTA 2XCPA 4N8NA 4C6AA 3KJNB 1AXQA 3CSKA 1SC6A 3IGVA 1IBKF 5KFYA 3AD8C 1RT6B 2ZBRA 4KRWA 1S6UA 4USVA 1U1KA 4Y28C 2XSJA 2CRLA 1Q86T 4DLEA 3LP1A 2LXUA 3HHLA 3E01B 1ULRA 3G6XA 3H5SA 2HZAA 2XS5A 3PIPQ 4LRDA 2H1YA 3R5DA 5C2CA 2ZDOA 2BQ3A 1AT1B 2UVWA 1RT6A 5GVQA 2YNHB 3CT9A 2R42A 1HBOB 2D74B 3OTOF 3E01A 1P9YA 2KYZA 3QT8A 4ELUA 3Q86A 3NEKA 4DOZA 1TK0A 3TZXA 2RKIB 3RBZA 2XO7A 2YNHA 1HWIA 2F1FA 3PO5A 1HBOA 4WFYA 4E2FB 2VJVA 2AV5A 4YDXA 2KM8C 4MK9A 4QYZJ 4Z7YA 4OV6A 1VQ9S 3EGZA 1HI1A 2QTWA 2WONB 3A12A 3DC2A 2RKIA 2CIMA 2OPQB 3A3OB 2E44A 5CD4A 1S1XB 2KT2A 4OYPA 3EGVA 2OGUA 4QOTA 3KLHA 2BQRA 1NK0A 4Y6IA 2VH7A 4OZ1A 4DV5F 3A4TA 4C2MA 2HNYA 5L1IA 3W63A 1B4SA 2GHPA 2WONA 4ICLB 1KTQA 2I38A 4ZITA 2OPQA 4NLSA 4UTGA 5DDPC 2AX1A 1MLAA 3E3XA 2ZHOA 1FF2A 1S1XA 1SPBP 1VK3A 1RWPB 2XS7A 4CO5A 4RU2A 2VFVA 1F9EB 5GAHU 3TA2A 4D3HA 2B9WA 3NNAA 3MPVA 4MK7A 3MEDB 4OZNA 3JB9k 4MT1A 2C2KB 1NCLA 1FA0A 4ES3A 5JXSA 2O01C 4OJ3A 2IRYA 4YY3F 3K57A 3D66A 5HAOA 3OVAA 5F8GA 2CG8A 1X4AA 3EWGA 5KG6A 4NZ0A 2QSFA 2C42A 1GMWA 3R7SB 1RCOB 3MEDA 1Q8KA 1S6OA 4WFBQ 4U8YA 1GX6A 3VR1A 3R2DJ 3PVXA 1JJHA 2P6TA 2YKPA 3GONA 1NJWA 1FRJA 4NASA 2N4DA 3KFWX 2ZM6F 3NNHA 4K8RA 2BKOA 2JFKA 3IM8A 4PWWA 3LF0A 4F3OA 2CZ9A 4L6V3 1YHQS 3UO0A 5HANA 4ZPBA 1R0BG 2MQNA 3WC0A 1I6JA 2XNRA 3QAEA 2MKKA 4JI2F 3EGNA 2HHXA 1RT2B 2H48B 5FJ4A 1GT8A 1XERA 2VBWA 3FKBA 2AHOB 3KHGA 1TMJA 2DRBA 5KG2A 3BH6B 3GJQB 2LLZA 2UUBF 2W9AA 2D41A 1ZZNA 5L9XA 1H72C 3KJQB 5RUBA 1RT2A 1FDNA 3J81Y 3UD3P 2ZVIA 1N0VC 3DHXA 2JDJA 3EVMA 2H4WB 2FHMA 1N56A 1YX2A 3MZIA 4IOAQ 4G1QB 2JEFA 2L9NA 4AXJA 4LF4F 2KO1A 2A10A 1FK9A 1PBAA 3DOMB 1NKBA 1KNZA 3M8QA 1H73A 3FZ2A 3HI9A 1KVIA 3L4BC 3W9IA 2WVDA 2X1AA 3GFYA 4JI1J 3ZO7A 3NGUA 2P9CA 3HF5A 2W2MP 4F26A 2PMWA 3HK2A 3IFEA 3HT0A 4PYDA 1BWVA 4G1QA 5KFIA 3UN2A 2GZOA 1VBKA 1YZ7A 3DOMA 1D9DA 1LWXA 4QZVB 1HW9A 4BHQA 2BOAA 1M1KT 2CJQA 5B0GA 4UY8T 4MK8A 4U8VA 3UDVA 4TY9A 3RR7A 3V6DA 1U6FA 4WXWA 2MZSA 2DYAA 4OYWA 3HZEA 3CDAA 4DV2F 4RWWA 2KFYA 2DPJA 3IXQA 2FJVA 3IS9B 2ZJQQ 4DR4J 1Q95G 4I4BA 4KTQA 2AF6A 5HN0A 5ITHA 3CF5Q 4OZ3A 3W9HA 4A8XA 2BDPA 3G8TA 2XGPA 4FKYA 4X62F 4KFBB 1Q7LB 3NLCA 1HWUA 4J9UE 1M5VC 3IS9A 3UE2A 2I1RA 3VGTA 2QEXS 2C2RA 3M9NB 1TKTB 4EMDA 1UEUA 1L3VA 2XLJA 2I8EA 4LFAJ 1BHNA 5D0RA 2RILA 1OSDA 3DDIA 3D1HA 3N6LA 4QU7A 2F65A 4ZCKA 2F8EX 3BZQA 5DG7A 4KFBA 1HR0J 3JSRA 4WFNQ 3MTKA 4ECRA 4ANCA 3T5KA 1TKTA 2EK6A 4DS5A 5H9EK 1D0EA 2V63A 2N4CA 5HLFB 2ZOMA 4TNOA 2MY7A 3CD6S 1UMJA 2A3JA 2VFRA 1FFSB 2RB7A 4H4KA 4J9MA 1C0TB 1IKVB 3IR7B 3R5BA 4ANDA 4DR6J 2JOQA 1A6LA 2Q79A 1XTZA 5HLFA 2PGCA 1UJ4A 4OYXA 4PPDA 1RE1B 4UY85 4C97A 1G6BA 4TVAB 3KJFB 2DGTA 2ZH1A 3GYXB 4JB8B 2XZWA 4DL2A 1R8PA 3NY0A 2AGOA 2E1RA 4DQIA 1JJ2R 7FDRA 1SJFA 1PC4A 4QWEA 4PG6A 1D9AA 4KT0C 1GXTA 5DLGA 4ZMMA 1SV5B 1LWCB 2JLEA 2OHDA 3NBPB 4Z37A 2NYHA 3P6YC 2EVZA 2RSQA 1YQHA 2KXHA 3M9MB 1S4EA 3TVZA 2RIJA 2PIIA 3UNYA 2Z0GA 3QSIA 3IM9A 2JEGA 4B9VA 3BO4A 3MFHA 3H5XA 2ZEJA 1SV5A 3TVYA 3W8GA 4PXEA 4LBHA 3NBPA 2ZOFA 2JRSA 3W5ZA 3BDPA 5E3PA 1X9SA 5KT3A 1NZ8A 4WTOB 4EO6A 3BBCA 2W7OA 2DR9A 3CO9A 2KYXA 1F3FA 1C1BB 5DO2A 3BM7A 3NCQA 4QWDA 2A2CA 1VGYA 1MWZA 4ALZA 4DQSA 3D6TB 4O23A 4L3KA 2G4BA 2VL1A 3FDSA 4DXLA 3RBDA 1TUWA 1Q0NA 1MU2B 1FE0A 4AD6A 1DJ0A 4C9DA 3MTJA 3K58A 2C22A 4CIOA 1C1BA 4L75A 2MZ1A 2COLA 2D1CA 2XTJP 1URNA 1OMSA 3N0VA 3GILA 3MUTP 3ENVA 4I0WA 1HI0P 3LAMA 4OYAA 1QUPA 2XY7A 3C6UB 1MU2A 4F4ZA 3LOUA 3GYNA 2HHSA 3CD0A 1IQZA 2NXNA 2V8DA 1S1VB 3HMJG 3PW4A 3PM9A 5D4NA 4JYAF 2PMZD 3CJKB 4ERDA 3ENQA 3ELHA 4WXOA 1FCAA 1JNRB 4M1KA 3BGLA 2KG0A 2XMUA 2B4PA 4WFXA 1S1VA 4UUWA 3ITHB 4YR3A 5KG5A 1NK6A 1C0UB 1LXJA 3PW2A 3OQ2A 2DK2A 1H0HB 3AXKA 2R9LA 1P9QC 4JV1A 1T95A 2E66A 2B9YA 4PAAA 4QIFA 3UFCX 2YTCA 5B0DA 2W4PA 3ITHA 4DV7F 1N8RT 1WOPA 4UW2A 1C0UA 4CLYA 2EFPA 3B78A 4DSLA 5IQQA 1MMNA 5IC4B 1YJRA 4QW8A 2YWFA 3MD3A 1CC7A 1FT8A 3QZ8A 4OYZA 4OHVA 5DJBA 1M0SA 2YQ1A 4HL9A 4QIEA 4X4SA 3T5JA 2KXNB 4CM0A 2BZ2A 4L74A 1XMOF 1N5TA 2V4JB 1IWAA 3N6MA 3R1LA 7FD1A 2L3MA 2R7QA 1ACMB 4D3GA 2CPIA 1I3OB 5DQIA 4Q0BB 4LFBJ 2VFTA 2DITA 3BSNA 3GFXA 1QSYA 4K7QA 2UXBJ 3BO3A 2RJZA 3FBCA 3ADAC 2V4JA 2JX2A 2C1EB 1DTTB 3R3TA 1DZ5A 2DNHA 3LP2B 4Q0BA 3NRBA 2M8HA 5KFHA 4F4AA 1WDDA 3M8YA 3QYYA 2FDNA 2HVEA 1SC3B 1RWVB 1R6VA 4F4KA 5C25B 3GIMA 3CJ0A 2MZQA 2WRMA 1H38A 2CNNB 4NYPA 3LP2A 1SCJB 1EHWA 1N52B 4YB7A 5HK4A 2H54B 4A8YA 1BQXA 4DN9A 4Q2LA 3NGKA 1FX4A 3W66A 2FHKA 5C25A 5M2PA 3Q83A 4MH8A 1HWLA 3E2EA 1FKOA 5LJ5Y 2RQMA 2W4DA 2DNZA 1D8YA 1R0AB 2BKPA 4DFMA 2E9RX 1C2PA 2ADBA 1UETA 4QWBA 3HKWA 5DGBA 2YPYA 1U6ZA 1MN9A 3CJ2A 2DIUA 4F2SA 4N56A 4GRSA 2O1PA 5KFJA 1UVLA 5CYQB 4KSEB 1IBCB 3KUHA 4FBTA 1XQIA 4I2QB 1WHXA 2VQEF 2IPOB 2MEWA 4OX9F 1U8SA 3OR1B 4C3LA 4XO0A 2C28A 2B43A 2NUUG 5BYQA 5K14B 4X65F 1SJ1A 3MM7A 3SCIE 4ZHRB 5J1PA 5CYQA 1R8CA 1LKZA 3D2WA 1FDBA 3M4XA 2MQ8A 2AJ0A 2FJBB 2BE2B 4FXWA 4I2QA 4NLOA 3PACA 3PO4A 2MZTA 3OR1A 2RRNA 3FSIA 2QJ3A 2VA3A 1K0TA 2HQ3A 1WSVA 1NHKL 2WVFA 5K14A 5A8WB 1Y4ZB 1IN0A 4ZHRA 3J80Y 1FTRA 1YJTA 3C14B 2IM3A 4I68A 4QJVA 4WU3A 1H2TZ 4V19X 3GFHA 1NPRA 3I87A 4U9RA 2VPYB 4RW6B 4BWMA 4WIIA 2DHGA 1GTHA 1E6VB 3R2CJ 5A8WA 1L5UA 3MM8B 3C14A 3I5CA 3VGVA 4C0BA 3P49B 1T05A 5EN1A 4IOBA 4CO4A 2FIUA 2DH7A 3MM5B 2VJUA 2HFOA 2G13A 3MEGB 3G6YA 3L7UA 2HHTA 5KG7A 4DX5A 4RW6A 2Q6CA 4EEYA 1SB6A 3OXFA 2FLOA 4KR0B 1N33F 1E6VA 1JXLA 4DV3J 2VG7B 4NCGB 3MM8A 2V2ZA 3IAM9 4FYYB 4BC9A 2N82B 1S6PB 3MM5A 2E5GA 3MEGA 3OVBA 3THPA 3GE9A 2VQFF 1WACA 2BW2A 5LXYA 3QRRA 4PG4A 4KGKA 4P2XA 1AB8A 3TW0A 1U8WA 2POKA 1H2UX 1LNQA 3ZZPA 4YN3B 1K1QA 4LF5J 5KFLA 2VKZG 2N3OA 3SFUA 2I9SA 1B7FA 2R7SA 3H7HB 4M5KA 4OYIA 4I64A 4A48A 1RSCA 1NUEA 2V69A 5CYJA 2JEIA 3MR5A 5AE1A 1FHTA 4R8UB 3ICLA 1IR0A 4WU2A 1QY7A 1FRKA 4P10A 1IBLJ 2FJXA 3QT6A 4LRCA 2BA9A 2MLXA 1X0PA 2EXUA 4X2BA 2W2PP 1FNOA 4KGMA 3JAMY 2QG9B 1TL5A 4KHRA 4WK1A 2CNOB 3UCZP 3CUNA 2V2KA 5CCLA 4ECQA 1IQTA 1FVQA 1Q4RA 4R8UA 2HRUA 5JVGQ 3V4IB 1UFKA 2LU2A 1RWUA 2XMMA 4WYLA 1SKRA 5T7LB 2GIQA 3PX4A 2WSEC 2CYYA 5A76A 1X5OA 5KFMA 1KN6A 4J9SA 3M8WA 2ZE2A 2AZ3A 3Q2TC 3W5YA 1WKLA 2ASYA 3PTWA 4OI0A 1RQ0A 3SMZA 3M6XA 3OL6A 2XS2A 2XY5A 1NSAA 2IRUA 5T7LA 4ZVUB 2W01A 4FF2A 1Q78A 3BPDA 3OJSA 2FJWA 3OL9A 2W24A 5A6WA 3EMTA 1WC0A 2XZTB 3GJTB 4X4OA 2K2PA 3W8PA 4BWJA 4PEOA 1VQMS 4YB6A 2XLKA 1XNRJ 3CCSS 2E1MC 4LF6J 4LMZA 1S12A 1MMDA 1T3OA 1B64A 1JLAB 1N5SA 2CPJA 4O0IA 5J1NA 2QT7A 3VZIA 5BXIA 3SCJE 1FERA 3DXBA 3EXCX 4OMFG 4RUBA 5IM0A 2J6TA 4G1IA 1S9GB 4L72B 3CCUS 3BBFA 2B56A 4G6VB 4R0EA 3QGHA 4Q2MA 1GTEA 1JLAA 5E2QA 3BGUA 4CM2A 2RDDA 2J9DE 1HBUA 1RWWB 4CLSA 4IO1A 1S9GA 2ZUGA 4HDHA 4DWIA 4AXIA 2CVIA 5BJRA 1EAYC 4M95A 5KFPA 1WDTA 3V6KA 3T41A 1VC5A 1FRIA 2C2ZB 2BJ8A 3I4HX 5KFXA 1RWKB 3W5XA 4X4UA 1XNQF 2QX0A 3EX7B 1KDNA 4K59A 4OZLA 3FCHA 1NEEA 2VZ9A 3FCWA 4ZVHA 3NS7B 3MURP 3AJ1A 3EICA 4EBEA 4ZPDA 5K8MA 2ROPA 2DBBA 2W8LA 2ZBIA 1NKEA 4JV2A 1UTAA 4ZJQA 2J8SA 2UVUA 3FJ2A 5L46A 4J9PA 2GAHC 5BR8J 3QT5A 3JSMB 1V9OA 2FY8A 5A0YB 3I5BA 3CWJA 3NAHA 3DRPB 2V8VA 2IRXA 4XPEA 4P7VA 5DZ7A 4IG3B 3RJMB 3EVWA 2OTJS 2NR0A 4PRFA 4FF3A 3NGSA 3MM9A 4ZOSA 1Y5LB 2KJVA 4KO0B 3BEGB 3JSMA 2HGLA 1DQ9A 1PC5A 5A0YA 1ZS6A 2HGNA 6FD1A 4CDIA 1GH8A 3DRPA 1F2GA 1J27A 4JV0A 2J0QD 4LVNP 1KRPA 3IWXA 1PJ5A 3RW7A 2QA2A 2E7WA 1X5TA 3H5UA 1XMQJ 2F9JA 3T1YJ 1HNXJ 2HHPA 4KO0A 3OT9A 1IM6A 4IRDA 2RH3A 4OHYA 1R89A 1QAXA 1T9WA 2MKHA 4R25A 2J0XA 3PYGA 2FB0A 1N4LA 2XBPA 1ZH5A 4NLGA 1FNXH 2BVZA 1FJGJ 2Q6BA 4ZIVA 4N7TA 2CA9A 2EWHA 1G2EA 1FVSA 3DN9A 3DGPB 2KZMA 3ZTQA 1S49A 3FGVA 5HBMB 2ZH6A 3TUJC 3PY8A 1M90T 1TU0B 3HX9A 1RHKB 5BYRA 1UVKA 1UCNA 4YB5A 2D69A 1HA1A 3G87A 4FYXB 2EC0A 1IVZA 1P6TA 2BRLA 3DLEB 1YTYA 1S0OA 3GPAA 4YOEA 2JHEA 3DGPA 5KFKA 4A8WA 5HBMA 3PV8A 1X4DA 1U49A 3PJXA 2PSZA 4O3PA 2IY5B 2VG6A 3QSYB 3GYGA 2WTFA 2CDQA 3MM6A 2MKCA 4ECZA 3TVKA 2BQUA 4Q43A 2YH1A 1UPPA 3DLEA 2IA6A 5EHHA 3Q22A 4CNZA 1R0CB 1TFWA 3HVWA 1F5CA 4TKTA 2FYXA 2Y8YA 1RB0A 4EZ9A 2IJFA 5HJXA 3O2IA 1KHWA 4X4VA 2HRYA 4FVMA 4BC7A 1RU2A 2RS8A 4RKUC 4DX8H 2DR6A 3C66A 4WWSA 2K06A 3TEHB 1BGXT 2R7XA 5IV4A 1JKHA 2RDJA 4DL0C 4KHPJ 1F60B 3MGJA 2CPFA 1FRLA 1UPMB 1YK9A 3DLLQ 4OHXA 2ZD1B 4J9OA 3HFZB 2H4YB 2F4VJ 1YWXA 2DHXA 2HAFA 1UZDA 1TV6B 3TI0A 3BQ0A 2OD6A 4HTJA 3PEJA 4OI2A 4M63A 2ASDA 4CYUB 2LEAA 2BACA 2HW3A 3T9ZA 2DKOB 1TZ0A 3K5LA 2DNGA 4I6WA 3ZTOA 1IXKA 2ZD1A 1S5ZA 3QRPA 2QRRA 3OFEA 3KNGA 3H25A 3ZC4A 4DR4F 1YRUA 2LDIA 4RUCA 4LUBA 2EBEA 1TV6A 4DU8A 1U1MA 4B02A 3PXGa 4CYUA 4H4OB 5HMYA 1H6KX 5AT1B 2VA2A 5H9FK 2DGSA 2X1GA 3NOCA 4ZLPA 4FP9A 3IRXB 2CQ2A 4P7TA 4IG0B 4RR5A 1RT1B 2UXCF 2GGPB 2A2DA 2RRAA 2WCXA 3LW5C 4V19J 3NS6A 4JUZA 4HH1A 3ZTRA 1DLOB 1VQ6S 4LFAF 2VICA 2B51A 2JLFA 4H4OA 3V81B 2P9EA 5FD1A 3IRXA 3QATA 1GXUA 4XDCA 1PYOB 1ICEB 2BJ7A 4NLQA 2N7YA 4IG0A 5B0AA 1RT1A 2GGPA 2IIHA 1NPKA 4HDGA 3M8SA 1TELA 1UEKA 2XYHB 1DLOA 1PO6A 2FHJD 1SQGA 4DSEA 3I56S 2DEJA 1Z2LA 4EFAC 3PYFA 4IO9Q 3PW5A 4K0KF 4ILRA 2Q43A 2O5DA 5BYSA 2KKHA 1RT4B 2BX6A 5DS7A 2QO3A 1VLYA 4DR6F 3MR6A 4IDKB 2SXLA 1X9WA 1YZ6A 3DRRA 4ZN3A 2FLLA 3CCQS 3NP5A 2E1PA 1S59A 2NXCA 1QLNA 4NE9C 1SJ4P 4E0DA 1RT4A 2HVZA 4UQGA 4IDKA 3K5MA 1UEVA 1IBMJ 3AQPA 4F0HA 1RLDA 3MR2A 3PJ9A 2ZH2A 1HFEL 1EX8A 4NLDA 4USWA 1U48A 4Y0FA 1X7VA 2H3EB 4N77A 2IMOA 5I42B 2DGXA 4WPAA 2G1DA 2BJDA 4F4XA 3O1LA 2UUCJ 4DSIA 2ZITA 2G9OA 1NDLA 4TYBA 1YBUA 4Y3CA 2KU7A 1MWQA 1CPZA 4IFVB 3MPWA 5KG0A 4CH1A 2DGWA 3H2VE 4UUXA 5F8HA 3M30B 2IJNA 2LA4A 1RHRB 1ZPWX 4JI0F 3TZYA 3G6VA 4WZQA 4C7QA 2YX7A 4URSA 2E29A 2LMIA 3W61A 1WC5A 3AT1B 4AFFA 3OJUA 2RQKA 3OFFA 2YNGB 2XM3A 3M30A 5KFUA 1LW2B 1T94A 2E1AA 1T9UA 3CJTA 3MUMP 2OJ3A 3SV3A 1CS4B 1TL3B 2Z58B 2KHCA 3MHYA 3E8OA 3FFIA 2HFSA 2FC8A 2YNGA 2DPIA 1BUXA 1WWHA 4NLWA 2UUTA 2JVRA 2PD1A 4YS2A 2EFVA 4CT9A 3AXMA 2J7KA 4WIQA 1RHUB 4ZK7M 4LFCJ 3I4PA 1CS4A 1TL3A 1MG7A 3BBBA 1BMQB 5C7PA 3VAGA 3QJLA 3MMAB 3OL8A 1SVDA 1FD2A 2G2OA 4PZVA 4OI4A 3EPIA 1K73T 2GW8A 2XWYA 3WX8A 4I69A 2W2OP 5FIIA 3F41A 3CIMA 2YPZA 5GAEI 4ZVQB 3KLEB 3M2VB 1RAIB 2Z30B 1ZETA 2E5IA 1VQKS 3BB5A 2IDEA 3MMAA 4ECWA 4HKQA 2FHJA 1RU1A 4WJBA 3Q89A 5K8NA 3FEXB 1HW8A 4PR6A 3B4DA 2NCKL 5KAKA 2Y1IA 2NQPA 2KFZA 1AZSB 3KLEA 3CMAS 3M2VA 3M6UA 2MZJA 3Q8RB 5LSRA 2A6MA 2R8GA 4GMKA 1SQEA 1IR2A 2CPDA 2RUGA 2HLUA 2DD8S 1GXLA 4X66J 1VQ8S 1Q7YT 4OHZA 4OLOA 5HMZA 5HMXA 4JI4J 2UVVA 4LT6A 2XG8A 1AZSA 4HLBA 2V0NA 3DRXA 5H9FJ 1T9YA 3D0GE 2U2FA 1FRMA 1JLGB 3CJ3A 1HNWJ 1IKYB 4DPOA 1M5OC 3MFIA 1YRTA 2GMLA 2ZNYA 4ES1A 3MAAB 2UXBF 4RUAA 3QMQA 4P75A 3SYZA 3PHTA 4FF1A 5CZVA 5G0RB 3KNAA 1YI2S 2YWWA 3PFEA 4AYBD 1EKRA 1XMBA 2V9KA 2YKAA 2EKNA 4P2MA 1OY8A 1LFWA 1JLGA 1IKYA 1KLMB 1HNIB 2VBZA 3WBZA 2Z2LA 4PG7A 4M5GA 4TQRA 4J5OA 3MAAA 2XC9A 4XIUA 4EK2A 1X31C 2GA7A 2LVWA 5G0RA 1CJTB 4YP3A 5J2MB 2RRBA 4X4PA 1HD0A 4DL4A 5HVHA 4IRKA 2R2UA 1LW0B 4TYAA 3HVAA 4LF7J 2B4VA 1KLMA 2ZKTA 1WORA 4QPXA 1CC8A 4FPRA 5J1EA 4U95A 3I6PA 2R2TA 3D6MB 1UAWA 5KFVA 1CJTA 1WELA 3CCTA 3LTOA 3PRDA 4HI1A 2PFFB 5J2MA 5K8OA 2VFSA 3ZZ0A 2C3MA 2XCAA 1R6YA 2GJIA 1LW0A 5E33A 3J7A1 1VBXA 3UQSA 3CJRA 1HNVB 4J9QA 2NYIA 3S6EA 2WVEA 3SQOP 4OJGA 1EB0A 1Q1KA 3W64A 1OYEA 3D7SB 3VAKA 5K20B 1TAQA 2M70A 2CDRB 3KYLA 4PWDB 3DU5A 4ELTA 1P8GA 4LREA 2IC3B 4CRJA 3HHNB 3ENAA 1TAUA 1HNVA 1U0SA 4RNHA 2CQ0A 4HT7A 3J81U 4YB1P 3PW0A 4NEYA 4LVOP 4OQJA 2D3O1 3T1AA 2LCWA 1YITS 2BYCA 4ZLJA 1HQUB 2JH3A 1T9VA 1FD8A 2IC3A 1W2IA 5SZTA 1WKJA 2ASJA 3MAHA 2CQPA 2NZCA 2MKSA 2W9BB 3PNIA 1TKZB 1Q79A 2OI2A 5DDRC 3UNGC 3AODA 4EI2A 1TUVA 4OJ1A 3FZBA 3IR6B 3MEEB 3QFHA 4F4WA 3AHPA 5IWAJ 1A0OB 2LQ5A 5D8HB 2W9BA 1WC6A 1TKZA 1IWGA 2OSRA 4ZA1A 3Q8QB 3WQPA 4L73A 5DRKA 2W1BA 1RBLA 1LWEA 3UCGA 2XLIA 3MEEA 3R6LB 3R5AA 3O6QA 1JLEB 3D68A 2AGPA 4C98A 2FPHX 4RNOA 4RBTA 5CYMB 1VQLS 1VYAA 2O66A 4JI8J 1ROFA 1YJWS 5M2UA 4Q5VA 1CQNA 4DV3F 4TQSA 2W2NP 2MPUA 2LFVA 2FY1A 2M8DB 5LXRA 4B3SJ 5CYMA 1T03B 3T1HF 5U47A 4ZVOB 3PJWA 4CI0B 2DIVA 4FDFA 1N36J 4NCAA 4A8FA 1RAOA 1J5EF 2FTRA 4P2FA 3TR5A 3FUYA 4Z7CA 3CD7A 5KFSA 3VQSA 1B7YB 1TP7A 1T03A 4TN2A 2YKQA 4LRBA 5IQ6A 1UJ5A 2MHEA 1S10A 3M8RA 4PQUB 4X4TA 3GIJA 1NK9A 1VC0A 1D8ZA 3DOKB 2YBVA 4GVBB 1XR5A 3PKYA 3Q8VA 1GMVA 3M2RB 5GADI 5DQGA 1YGYA 2NXEA 2K1RB 2B3TB 3ZZOA 2RMLA 3ISND 1KOHA 1FTCA 1XK8A 3EE3A 4PQUA 2VDHA 3BDEA 2VBXA 5KOWA 3N6NA 3DOKA 4C8LA 4GVBA 4KH0B 2F3JA 3HXMA 2RAQA 2MQLA 5CZXA 3OSNA 2OSQA 3NCRA 4MKYA 2R4FA 4I7FA 4FF4A 1NRKA 1VISA 4AL7A 1LQ9A 3GSIA 2XMWA 1F0XA 2J9DA 3UI3A 5L9NA 3FRYA 5FDLB 3QGIA 1N6QB 1LEOA 3HSGA 1X4BA 4F3MA 3UWTA 1G7CB 4HYKA 4FNHA 3BV8A 2W7AA 3R27A 2XSFA 5KFOA 2EK1A 2HHWA 2B5JB 2NXJA 5DM7Q 3HHLC 4ELVA 2AQ4A 1D3WA 3CMES 2DH9A 4DFJA 5FDLA 1WOOA 3ISNC 3R5JB 5HQLA 5E7OB 3SCLE 2WOMB 4KPYA 4TXSA 2AIRB 4MYTA 1WD6A 2FQQB 1S7HA 4LF6F 2AJFE 2EG1A 1V5VA 1NHUA 3H2LA 2LA6A 2MKJA 3D3CJ 5AE2A 1V3SA 6AT1B 4KGXB 4DR5J 2WOMA 5J2PA 1A9NB 5KFEA 2WSCC 2B4UA 1UJ6A 2R2SA 4C0OC 2G1HA 3GV8B 5KG1A 1B0TA 4CLFA 1YVFA 1XWLA 2XYPB 5HMWA 2UZAA 5IT9Y 2HVIA 4B3MF 3ISZA 5AXNA 3GLJA 4USMA 3H98A 8ATCB 3N01A 2BEFA 2CQHA 2YXLA 3OLAA 4MTPA 2J9CA 3KUEA 3OLBA 5M2RA 2CQBA 2PT0A 5GMEA 2K3KA 3IR5B 2RF2B 2CJXB 3QLHB 4LRFA 4ZVEA 3AY0A 3G71S 3GCXP 3JTNA 3V2UC 3DDKA 2KG1A 4F2RA 3ILIA 3TYTA 1N54B 1KTVA 2VPZB 4MMOA 3I82A 5IT4A 1Q82T 3IAS9 1VDHA 4PG8A 4DV1J 2BJEA 2QSWA 3RYLA 3CB4A 3CPWR 4KB7A 4RZRA 3KTQA 2JC0A 4EZ6A 2RF2A 2D3ZA 3QLHA 5K9FA 2G0CA 1NK5A 1G3OA 4NMXA 4YY3J 3Q8UA 3N9UC 4DLGA 6FDRA 2BR0A 2YQ3A 3QFWA 2DHSA 3D5MA 4NMLA 5HROB 4OYMA 3J7ZT 2UV8G 1RTIB 5BR8F 4ETZA 4LIRA 1U0HB 2IYIA 4PWUA 2PA3A 4OL8A 3SBMA 3QIDA 1FEHA 5HROA 2MLYA 5F3TA 4JI3J 5HQ8A 3LGNA 2OP5A 4JI2J 4DV6F 2LU1A 4DQPA 1HBMB 1WC1A 4TU8A 1QUVA 2ZHBA 1U0HA 2HS3A 2HQDA 1T02A 1OWXA 4GO7X 3SSRA 2CQCA 3VV2B 2D9PA 2EBGA 5A2QY 3G4SS 2P5VA 5EWFA 1T11A 1XMQF 2VPWB 3T1YF 2L9DA 2MGZB 1HNXF 1W26A 3OTBA 3NOGA 1JXVA 1SJ3P 3JXOA 1HBMA 4DZDA 5T41A 3HT3A 4OLPA 1R43A 3IBFB 2FHOB 4NLXA 4YFUA 1T8EA 4NI2B 1VHFA 2BRKA 1S0VA 2AZ1A 1FJGF 2KJWA 2JSXA 5KFRA 5ETSA 2E7XA 5KFAA 5FLXY 5DGAA 1NZAA 1DFDA 2A1BA 4RU9A 1RAJA 3K89A 1S4FA 4NI2A 4O0NA 3KK1B 2IYGA 3IG1B 1FXRA 5GAEU 1WTFA 5IOLA 3CO0P 4J9VA 3D1OA 4OFZA 2ZH9A 1RA7A 4NYZA 2NZ4A 3G96A 1OJ4A 1RXOB 2VOPA 2YQ0A 4DBQA 3KHLA 3OW2R 2MQMA 1DRZA 3J7Z5 3KK1A 5ETLA 1YRXA 4ICLA 3IG1A 3M1VB 5F0UA 1JMTA 1T3NA 2R7TA 3TO8A 1F5BA 4O3QA 2DTJA 4NLRA 2VHGA 2AEMA 1PYTA 1B0PA 4N41A 5ADZA 2DISA 3VHQA 3UD4P 2QIFA 4HHUA 3BSAA 2WVCA 2ZVSA 4HR2A 2MXYA 3DLGB 1RHMB 3SI8A 3GB0A 2IDLA 1RJJA 4B3OB 1O0PA 2M88A 4ED0A 4O3RA 3LA0A 5EUHA 3LUYA 4NWBA 2VB6A 1VRUB 3JQMA 1SI9A 1AW0A 2XY6A 3KLIB 4KHPF 4LQ3A 2HK2A 4ZKAA 4A8MP 1NLKL 4DG1B 4B3OA 4K2XA 4WE1B 2DHAA 2R7WA 1VRUA 2ZJRQ 4W98A 4K50A 4MFBB 2YVSA 4FYDA 2V2QA 3KG1A 3WIVA 2KT5A 2W7PA 3KLIA 2ALZA 1RK8A 4F02A 2MJUA 3QT7A 3KK3B 3J80U 3U1LA 4IH6A 2HHUA 2EG2A 4WE1A 2HGMA 5J2NB 2W8KA 2EFQA 1WHYA 4RW9B 4MFBA 1CVJA 3DCAA 3TARA 2LQ9A 3UN3A 2M4MA 2DGQA 1KQSR 4C3MA 2QFIA 3SIPB 1N5VA 2HIQA 4N8OA 3KK3A 5KFZA 4LSLB 5KT5A 4O4GB 2Y8WA 3CJ8A 3RAMA 3CDEA 5J2NA 1I1GA 4NRUA 1UVJA 3ILLA 1HPZB 4RW9A 2IM0A 2HURA 1D09B 1N48A 3GR1A 4H4KC 1VJQA 2QA4G 2CWXA 2GO8A 3GZ7A 4HACB 4LSLA 1KQGB 4O4GA 3VVUA 1QTMA 4QW9A 2M0GB 3BO2A 2IJRA 3TJ9A 4LBPA 1HPZA 1Y5NB 4FN5A 1QAIA 3S8SA 2BANB 2DO4A 2XMVA 1RAHB 3MI7X 2HBYB 3NMRA 1SQFA 3EDRB 4HACA 3HHEA 1FNMA 3QJJA 1UW9A 3T5HA 2I0XA 3LGHA 4DR7J 3RUBL 3CGIA 3VAJA 3SQGB 5DLFA 4Y65A 4QYRA 4X64J 3MCMA 3KJVB 1Y00A 3SSQA 2BANA 1RGVA 4UZBA 4MIWA 4ZIWA 3IMQJ 1V6HA 1ZTTA 5J2QB 3KLFB 3MCNA 4YHHF 1CJVB 1CJUB 3DM2B 1JWWA 1HHTP 4P71A 5A8KB 2W25A 1HQ2A 2V6AA 2F5GA 3SQGA 1TK5A 1DQAA 3KJVA 2MYFA 2OEJA 4DS4A 2M52A 1IBMF 1WF1A 1Y5IB 5J2QA 3KLFA 5F8JA 1Q53A 2LXIA 3JAMU 3SSSA 1CJVA 2WBRA 4P73A 1CJUA 3DM2A 5D0GA 5F9LA 2QZ8A 5E5NA 3HJFA 4FXDA 2ZWOA 2DHHA 5D6GA 3OFGA 4NLYA 4CH0S 2GHVC 3QAUA 4B9MA 3BF4A 1BXNA 2OKQA 1Y3KA 3CDBA 3P4UB 1U25A 3IO1A 3CJ4A 2UUCF 1MN7A 2P8IA 3KOAA 1UVIA 3LANA 2KFNA 1MSWD 1YSJA 3R6GB 1X9MA 1YKWA 1F9FA 2J0WA 1EZZB 2M9KA 3G8SA 4CLTA 2WW8A 2ZJPQ 2AYEA 3UD5A 4ED2A 3OXGA 4ED8A 2L48A 2CJAA 2F9DA 4DCPB 1NMEB 2WHOA 3VAMA 4PPZA 4F0KA 3T6BA 3DGVA 3S1TA 3U1NA 5KFCA 1SL0A 2HZVA 1HMVB 3GG1A 5IZHA 3B82A 1C0TA 5G4DA 4Y34A 3CCMS 1IKVA 4WF9Q 4DR1J 4AUKA 5H1SV 1HWJA 3CVKA 3VVTA 4IR9A 3QBCA 2CQDA 2PE8A 2ZNZA 5D77A 4FZVA 4K4XA 4DL6A 1RYRA 2G2ZA 3UDEA 4G1PA 5E3AA 3IN5A 1HMVA 1VHIA 3A8JA 1FE4A 4KYZA 1XMOJ 4KC5A 4J9LA 5B08A 2J8AA 4JI6J 3PYEA 2V50A 3DLHA 2JWNA 2CQGA 1X4CA 5A6PA 3K2YA 1WI8A 1TK8A 2HFNA 4M5HA 2QLWA 4IFYB 4LF1A 5IV3A 1LWCA 1L3TA 5CH7B 1BD6A 3AA9A 4ZN1A 4X4NA 2HRTA 2KH9A 4DMZA 4WP9A 4NZ7A 2U1AA 1AYEA 2FVRA 3CCVS 1VRTB 3TJAA 1VRQC 3FSYA 1NSPA 1FEEA 4A4JA 2P9GA 3QGPA 1RUSA 4WP8A 3BYPA 4F0MA 2LECA 1GNKA 2EW9A 3VALA 5CAAA 3H40A 2HVDA 4UOHA 3J7AN 3QPIA 2YKMB 4X66F 4OZJA 4RWXA 2CWKA 1K9MT 2FJAB 4JI4F 4DZ6A 4ECSA 3KMQA 1B0VA 3JSYA 1ZM3A 4J37A 1HNWF 2MSTA 2ZC3A 4DSKA 1NJXA 5F9NA 3MMCB 2QA4S 1VQSA 2XYGB 4KE5A 2DNRA 3GJRB 3ET6B 2BM1A 3JS9A 4YUDA 3Q23A 2BOPA 1VFJA 2BE7D 1DQ8A 2AP6A 1WKKA 3R1HA 1FJEB 2PI4A 3QNWB 1S9EB 3UR3C 3RB3A 3C6UA 3MMCA 5LOQA 4JP8A 3AOAA 1KVKA 3AJDA 5AE3A 3HHDA 3LWLA 3ET6A 3IP0A 3UW1A 1NM2A 3CJKA 3WZ0A 2V4RA 4ZVGA 4OI1A 4QYZK 1KLNA 1SIZA 1S9EA 2LKZA 1SL2A 3CW2C 4LF7F 2UU9J 4N76A 1S97A 1BWEA 1IR1A 4W92B 1PCAA 2F4FA 2DNNA 4V1Ak 3NCPA 2QGFB 4LR9A 1KQFB 2IM2A 1S1TB 1HNZJ 4J9RA 2MLZA 3EGWB 4ZS6A 4OX6A 1KHVA 2VIHA 3C46A 2BW7A 4RBUA 1NK8A 3P8BB 1FXDA 1NH7A 3B6BA 2M2BA 3EZUA 3VF0B 1S1TA 2H65B 3BKUA 1Q81T 3K8WA 2ZWPA 2QE5A 1IUJA 5HP1B 1RAFB 1TR0A 4A8KA 2GS8A 3CTRA 1I5OB 3OL7A 4A8QA 2MTLA 1RT7B 1NPPA 2KN4A 4PG5A 2V8HA 1OY6A 2AX0A 4RO0A 1FWLA 2DNLA 2IM1A 4WP3A 3EUNA 1OPIA 2QMUB 5KT2A 2GMJA 3LQVA 5HP1A 4OX7A 1DY3A 5B0BA 3VTIA 2QV6A 4ED6A 1HQEB 1SKSA 1B3TA 4W4MA 3GCWP 1RT7A 3I0SB 2CNKB 5H9EJ 4LF8J 1PIEA 4C0HA 1DTTA 1KS2A 5F8IA 2VQFJ 3G86A 2AYMA 3MR3A 3QWUA 4C8KA 4RW7B 3O5TB 3K5OA 1O5JA 2R2RA 3BYRA 3ZTPA 2AJQA 3VAIA 3R97A 2B7CB 5EDWA 2K3IA 1HQEA 1U26A 3I0SA 3TA0A 1VQ4S 2HMIB 4LBIA 4IYQA 1NSKL 2ASLA 4RW7A 2XI3A 1OPZA 2C2OB 2KT3A 1JJCB 1Y3JA 4HTIA 1Y7PA 3OD2A 2QL5B 4LSZB 2OPPB 3HSJA 3D4JA 1C4AA 1U47A 1RBAA 3KHHA 3UR0A 1N34J 3MAQA 2HMIA 2HPUA 3I0RB 1EETB 1R0AA 3OUYB 1KD1T 3TJ8A 4N47A 5E3CA 4O3NA 2XO6A 4B3SF 2ZOGA 4OX8A 3P3DA 4YMEA 2OPPA 1R8BA 3MPDA 5DQHA 3MEKA 2GQ2A 1N36F 2AJ1A 4CLUA 2HHHF 3I0RA 4FS2A 4I6AA 1EETA 4M5MA 3SDEB 3OUYA 2FC9A 3BKTA 4NRTA 4ZPTR 1VIXA 3NAIA 4R5PB 1RKJA 2HS4A 1ELOA 2HHQA 4USUA 2DCLA 4OIXA 2J7UA 4B3TJ 4CO1A 4NXMJ 3SDEA 2BE2A 2EPIA 2VDIA 4MKVA 4K2JA 2RHQB 5JMNA 4Q45A 2XMTA 2B0GA 2R7RA 4R5PA 1S77D 3BQ1A 4EU0A 1BQNB 1VOMA 5LMNJ 2E5LJ 3BGOP 4AT1B 4DL7A 1H7XA 3PRBA 3F44A 2JVOA 1Q8BA 4F25A 2LXFA 3TUPA 4UOGA 3QWPA 2QL7B 3NKYA 2B9EA 5HJYA 3L95X 2MY8A 3DMJB 3P96A 4EBCA 2OO4A 1BQNA 4P6QA 4KBIA 2HBRB 3EPGA 1PGZA 1D1UA 2ZDPA 2GVDB 1MWYA 1X0FA 5DDQC 1OSCA 4NLPA 3R7NB 4F4YA 2PN6A 2HHVA 2NPFA 5B0EA 3GV5B 1X4FA 2A6OA 4CLKA 2CNLB 3DMJA 4OJHA 5C2GA 4CP5A 1UP1A 3CDUA 2VG7A 4NCGA 1QVFR 2XMJA 2GVDA 1N32J 2HK3A 3GMGA 2WVBA 2X1FA 1S6PA 1ZYQA 5F8LA 4B08A 5B0CA 3TX0A 1LV5A 3VQTA 2MQOA 3ZXWA 3KLHB 1FDAA 1Z2ZA 3AOBA 1LK7A 2O3DA 1U2CA 3RAQA 2HNYB 2ERRA 1KBRA 5LSOA 2GJ2A 3OV7A 1XNQJ 5GAGI 4O3SA 4DV0J 4DR5F 2KVQE 1YG0A 2NUHA 4DR3F 5CD4H 2OTLS 3HD2A 4U67Q 1V3ZA 2D9OA 1SXLA 1XC9A 1OIAA 2DGOA 4B9LA 2VD3A 4YR2A 2GC8A 4NA3A 4QU6A 1YBTA 1YIJS 2AW0A 2UXDJ 2V4QA 5D0HA 5ETRA 5F41A 4P2SA 1JB0C 1EJ7L 4C8MA 2ZH7A 3AB2B 4ZP9A 4CQ1A 4OI3A 4WKYA 3T3FA 2PDAA 4DV1F 3V4IA 2H5JB 3RRKA 4AE5A 2OIHA 4AL5A 4NOHA 3HPOA 4M8LA 2JLGA 4A8OA 3VGSA 1IJFB 3ZZRA 4RNNA 4QIGA 2G0JA 5EWEA 1N88A 3OSPA 3ZZZA 4LF9J 2KTQA 2XULA 4K4TA 1GMUA 1VS3A 2J9EA 3L7OA 4M5LA 4J9KA 1QDUB 3K5NA 1SKWA 4NXNJ 2ZH3A 3F73A 3FRZA 3R7BB 4RNFA 1RWXB 3PX6A 3LGMA 2YKNB 2ZH8A 2I2YA 4RUHA 1WC4A 2KM8B 5LSLA 1GEHA 3NL0A 3CJ5A 3C19A 2DT9A 5AJ3J 1ZOTA 4JI3F 2FZCB 2QLBB 1KONA 2YKNA 5F3ZA 2JFDA 1S7IA 1PAEX 3D54A 2IMWP 3GG0A 3WDOA 3KWMA 2KRRA 2ACYA 4JI5J 5IXUA 1I94J 2V34A 3A8IA 1RWOB 4NCBA 1T9XA 4NA1A 4ZVPB 1FK9B 1P27B 5I3QA 3M8QB 2GJFA 1H74A 2CQ4A 3AFGA 2MQPA 1ZAWA 4DDFA 1YBAA 1NNDA 2R8KA 2DB1A 3CDWA 1SJQA 4F04B 1S1WB 4ZLLA 5F0WA 4I56A 2ILYA 4LIWA 1FKAF 3J81j 1Q16B 1ZM4A 3DLJA 4OYBA 2WB4A 4BDPA 1S0NA 3KG4A 3HSDA 3RB0A 2PO4A 3CCZA 3HSZA 4RX6A 4DUZJ 3V6DB 3N5FA 1O51A 3HDSA 4ZVFA 1S1WA 1H2VZ 3FVYA 4PUOB 4X4QA 1R27B 3GR0A 4USJC 5CA5A 4ZP7A 4ECXA 2CPHA 4KJIA 2RU3A 4ED5A 3RG6A 2HWIA 1U24A 1UFWA 2RU9A 2AD9A 2KZZA 1Q5VA 4ED7A 4PUOA 3CMQA 4DQRA 5JJBA 3DLBA 4NEZA 2FGOA 1EP4B 2QYGA 4ZPAA 2VBYA 4MAKA 5ETNA 4HVZA 3NXZA 4IG3A 2ZBQA 1SKUB 1RKIA 5KFGA 3RB6A 3J7YI 4J90A 5EGYA 1WTBA 2L41A 2B8PA 1NJZA 4JI7J 3OVSA 4NYOA 1EP4A 2UXCJ 1LWFB 4Y2KA 1B70B 2K7KA 2V94A 2F8HA 4NPOA 3KXDA 4QPTA 3H4BA 2DXDA 2ZZMA 1XR7A 2YNIB 3IA0A 5THWA 4M5NA 4EYIB 4ZPCA 3U02A 4NL5A 3I96A 4K4SA 2NPIA 1BLUA 5IFMA 1NXIA 1LWFA 4WKRA 4WFAQ 3RTVA 2VV5A 3MECB 2EFGA 3C8YA 2IHR1 2CKWA 1JLBB 4FYWB 4DV4J 2YNIA 1I51B 1C4CA 5DM6Q 3X3UA 1PILA 1HIYA 4DJBA 1QAJA 1KR4A 2ABYA 2QN6B 3CCWA 4GKJJ 4K0KJ 1L3UA 2XB2D 1R3NA 2QC3A 1ZBTA 2RVJA 3MECA 3K59A 4IKAA 1RTHB 1JLBA 2QLJB 3SXLA 1FRHA 1NK7A 4DSFA 1X8DA 4U7CA 1K1SA 2BV3A 5HATA 3THVA 3S7RA 3KDOA 2CVEA 2ZBPA 4IQXA 1RTHA 2CPXA 2AJ4A 1W2BR 4JI1F 2MQQA 2H51B 2CAJA 4K4ZA 5IT0A 4O44B 3PKMA 4DPTA 2KI2A 5KFWA 5EWGA 3P5TL 3Q8PB 3U27A 3IC1A 2V5HG 3JQJA 2R3VA 4TU9A 4M5DB 3FEYB 3PYDA 1LK5A 4DR7F 4LF2A 4O44A 4PABA 4X64F 2EI5A 5KFBA 3GJSB 5EX3A 3CXCR 3IBCB 4LR7A 3WIUA 2HVHA 4NLUA 4L3NA 9RUBA 2PMHA 4M5DA 1RTZA 3JSBA 4JI0J 3KKFA 2MJNA 4DI6A 1M5SA 2IBOA 1FWKA 2QMWA 3D6FB 4B3RJ 2CADA 4XAKA 4DHVA 4FNIA 3CCRS 1HLWA 3C3LA 2GAGC 2IVYA 3BN7A 4FS1A 4I67A 4MIBA 4AQYJ 3NMAA 4K4UA 4XDDA 3JQKA 2C2NA 1HR0F 2B6AB 1SH2A 3IRWP 3FEZA 5KOXA 1W25A 1K47A 3RAXA 4ZVTB 4JBCA 1VK8A 2IAJB 2CQ3A 1VBZA 4QR2A 3V81A 5ETVA 1HL6A 9ATCB 2ALYB 3PR5B 3BR9A 1RDRA 1UZHA 5AXMA 2B6AA 2HFZA 3MPUB 4QWAA 3W65A 2DH8A 3C6TB 2M5YA 2OEMA 4ID5B 2IAJA 2OFGX 2O67A 2J7WA 1W7WA 2P2CB 3L3CA 1YJ7A 3M6WA 1KEKA 3IGNA 3RZAA 2RHSB 2XMAA 1X5SA 4CLZA 2DY1A 4DF8A 2UUAJ 4HEA9 4I2PB 3CCES 1EKSA 3W7BA 3BGFA 3C6TA 3G82B 5LL6d 1VJWA 4DR1F 4ID5A 4ZP8A 4CLLA 3VZHA 2EKYA 1P1LA 2VG5B 3W2WB 1OO0B 3DOLB 1FX2A 1CG2A 1X4EA 4DN0A 5IT9U 4NA2A 4I2PA 2LQ8A 2FVQA 2BM0A 2E5HA 1CBKA 2ACMA 3G82A 5LMUJ 1PKUA 4H54A 2YWKA 2FJEB 2OH2A 3UDLA 1WF2A 1HWKA 2D7SA 1HD1A 3RGIA 2XHWA 5D15A 2HYIB 2VG5A 4USKA 1S0MA 3W2WA 2RQCA 2JZ5A 4JI6F 4F8RA 3DOLA 2X3DA 2CJBA 4MYUA 4PXDA 1RI7A 3L09A 3H42A 2JL9A 1NB7A 3S01A 4C8ZA 4RL1A 5I42A 3D9BA 2FVSA 2BE9B 3DHWC 1VI7A 4LSNB 3RRGA 2RD5C 2IVFB 2GIFA 2HWHA 3TEGA 4JOUA 4IFVA 2GVZB 4GKKJ 2HZCA 5C5JA 3HHKA 2HFUA 1YDLA 3GWCA 1HI8A 3WX4A 3H0PA 1FKOB 3R5CA 2OFHX 3K5PA 3R8YA 4LSNA 3I55S 1Z1ZA 4ZCMA 3IBWA 2VASA 5GAGU 4MIAA 2FUG9 2DVIA 4QIWD 5L1LA 1NK4A 2GVZA 3A3PB 3EYZA 3LH2S 3NGRA 5GMDA 1TKXB 1LW2A 4EUVA 2ZZNA 2L08A 1TKDA 4ECUA 1LXNA 3FBEA 4UT4A 1V3RA 4DUYJ 4M5JA 4Q44A 1S48A 3QRQA 3GQCA 3VGUA 1RA6A 4CNYA 1RZMA 4ER8A 4H4MB 1S99A 2Q3PA 4X84A 5A2QU 2Y3YA 1TKXA 3MM7B 3POTB 3X1LB 3HLUA 3W9JA 1Y11A 2NSBA 3KMSA 2I5JB 5AXKA 2RT3A 2RDIA 3MCSA 1WF0A 3MUVP 4DSJA 5T14A 4FPIA 3EZOA 2MKIA 2HQCA 3WHIA 2NLWA 4H4MA 3G6ES 1RWMB 3SV4A 3RRHA 1AA1B 4USHA 3LPYA 2C3PA 3POTA 2UU9F 1FWPA 5I3PA 4RPFA 2I5JA 3M9OB 2DRAA 3P45B 4QR0A 1GK8A 4NLTA 4LRAA 5FLXU 3PW7A 1RT3B 4ECVA 2AGQA 3EVOA 3ETOA 3US5A 1HNZF 3NWGA 1VR6A 4S0MA 2VC0A 4K5SA 4JV5J 3TUIC 3JYTB 2YNFB 4DFPA 1Q8IA 1T05B 2Z2ZA 4CT8A 2I6WA 5L1KA 1HBNB 3DYAB 1BQMB 1RT3A 1FO1A 2OELA 3NNCA 2VODA 4NLVA 2C3UA 2IBKA 4EYHB 2MMYA 2D3UA 1U1RA 4LFBF 3JYTA 2HBQB 2YNFA 4QBUA 1R8HA 2B4OA 4OZ5A 4WBFA 3TNVA 1HBNA 2CUYA 2HNZB 5KG4A 1TL4A 3SZ2A 3DYAA 1BQMA 2YWHA 3ZNUA 1ZAXA 2AYBA 1WNEA 3O44A 3N28A 3TWZA 2DR5A 3CJSA 1JLCB 3SEOA 1QM9A 4YDDB 4CZCA 5C24B 2XEXA 3GSDA 2OPRB 2HNZA 1KOOA 4M5IA 4LF8F 1TL1B 3T1HJ 2V8PA 1M5KC 1H7WA 3BS9A 1AROP 1HNIA 2DNQA 4UOCA 1RT5B 1JLCA 1J5EJ 2BJ1A 1TFYA 4DPXA 3K7RA 4BBYA 2DNYA 2BMBA 5C24A 1HARA 3O8WA 2OPRA 3DU6A 2AEFA 1KWMA 1J2VA 1KFSA 3AJ2A 1RABB 1SJRA 3C16B 1TL1A 3RB4A 3RU0A 2N3LA 3TZWA 2ZFHA 2Z56B 3GP9A 3QIPB 3GTYX 1LFPA 1RT5A 1GQEA 3Q24A 5HVGA 1DBDA 3FMBA 2ZH4A 3FMWA 3TP2A 2WBMA 3OBIA 1WG1A 4YEAA 2VKRA 3D0HE 1U4BA 3ENWA 2AKWB 3FBFA 4HI2A 4DX7A 5DETA 3C16A 1N34F 3D6HB 2FGCA 1ZTWA 5L1JA 2D3OR 3D67A 1NH8A 2ZE2B 4CLWA 3QIPA 1SIWB 5HO4A 3TAQA 4F36A 4DQQA 1QAYA 1WUUA 1EQMA 2LP4A 5L39A 1QJHA 2UUWA 5AXLA 1EQ0A 1P1TA 4ZPWR 4PWDA 1AFIA 2HWTA 1NDCA 2QFJA 1DTQB 2HQFA 1ZAVA 3Q2SC 3PEHA 1SUQB 4F67A 2E9TA 2F7VA 1SC1B 3GV7B 5CQGA 5HVFA 1O6XA 3J7YU 2MSSA 3AOCA 2WZ1A 1JLFB 4KKOB 3Q0AA 2P6SA 2V67A 5D0EA 3V6HA 2QLXA 2Z4PA 4ZVRB 1VIOA 4ILMA 4B3TF 1HQUA 4NXMF 3HFVA 1U45A 4Z2XA 1DTQA 4WTYA 1SUQA 4IUFA 1NKCA 3OXLA 2ZKUA 2Z2MA 3VAFA 2VONA 1JLFA 2OAUA 5KT6A 4KKOA 3WC2A 5IS2A 3EZ5A 4USTA 4J9NA 4XPCA 4HHHA 5LMNF 1R31A 2E5LF 2NS1B 4ENOA 1RHQB 2Y0SD 5IM0B 4ZVSB 1CQMA 3HD1A 3L7PA 5K8PA 1JIHA 4MKAA 4N5SA 3BH7B 5E0OA 1VMBA 3FQKA 2V9WA 1D9FA 5ETQA 4DR2J 4YR0A 2ZZTA 4GC7A 3KLGB 1HBUB 1JLEA 2PEBA 3FSXA 2W2QP 3UDCA 4I6YA 3I32A 2CG4A 2AMCB 4A8SA 1F2HA 2K7JA 3G8QA 5IC6B 4B3MJ 1S9FA 3UVJB 1NJIT 1UA1A 3AAWB 1CSJA 4X4RA 3V5RA 3OPKA 3H8YA 4DPUA 3KLGA 1VQPS 2XGQA 1XN9A 3N5BA 5CHCB 5ETPA 1N32F 4P52A 2HIYA 3ZFVA 2YKOA 4LF5F 2G0IA 2VPXB 3UVJA 2ATLA 1KKHA 3GIRA 5A8RB 3BPSP 2VOOA 2FLPA 2PFDA 3LAKA 1SH0A 3LO3A 3PIOQ 5HI7A 3OTCA 4WFZA 1CLFA 2WAQD 5MAOA 4DV0F 5DDOC 1IBLF 3B54A 3VWSA 3GU0A 4P74A 2DR8A 2CPYA 5A8RA 4P9SA 1S76D 3KLVA 3PRVA 5HL7Q 1X60A 4KAIA 1F3VA 2YWGA 4U96A 5HSPA 3MM9B 1VLOA 3M2RA 1IBKJ 2BABA 2UXDF 3L9ZA 5EX0A 2K1RA 4CCHA 3CULA 3IWNC 4ID8A 4FYVB 2XZDB 3TOQA 4Q8FA 2KHDA 3DKDA 8AT1B 3U7JA 2HQIA 3BJYA 4DV6J 3C2PA 5DZ6A 5E41A 1FXLA 3M32B 1HYSB 5KFTA 3OTOJ 3W1YC 4DUTA 2DNMA 5KFFA 2N7CA 1U1PA 3MXHP 4ANEA 3TAPA 4IH5A 2CQIA 4DU7A 4QQBA 2J6SA 4LF9F 1ZA2B 4UOFA 1N6QA 1RADB 1IKWB 3LWMA 4DFKA 1U1OA 1ZPVA 1L3KA 5D4LA 1XNRF 3M32A 4LJMA 2XI2A 1TQLA 1WSRA 1HYSA 4NXNF 2DNOA 3BSCA 2MDAA 1KVJA 3EJMA 2QLFB 2J76E 2B5JA 1GX5A 2R7UA 4G3IA 3NWRA 2AJ2A 4U6PA 2DRDA 3Q8SB 4OZ0A 4XTTA 1S72S 4UF4A 1KSPA 1WG5A 1IKWA 2OMOA 3A8KA 1ZA1B 2B7BB 3DRSB 3ILJA 4TU7A 4CO3A 5AJ3F 4MJKA 3FC9A 2GNKA 5JUMA 3MF5A 3PG9A 4DV5J 1ZM9A 1RTDB 2HAIA 3RBEA 2VG6B 2DNKA 1U1NA 3MM6B 1SBRA 4Y2AA 3HJVA 4JI5F 3DRSA 1I94F 4OYOA 5JVHQ 3QO9B 4FVCA 3D0IE 4KGZB 3DXSX 2CQ1A 2GQCA 1VQ7S 2QL9B 3HCXA 1RTDA 2WK4A 2CJ9A 2LQBA 3R9LA 3MOZA 3C15B 2ROEA 1HKAA 1AUSL 3SCKE 1SH3A 1JNZB 1WHWA 5KTQA 3DNCA 1QSLA 4R0JA 3THTA 3QO9A 3CCJS 2J0SD 2Y1LB 3V6JA 2V2VA 3BR8A 3VAHA 1JKHB
chains in the Genus database with same CATH topology
4M5IA 2CG8A 2BMBA 3HSZA 1KBRA 3KUHA 1EX8A 4M5JA 3KUGA 1CBKA 3HT0A 3HD1A 1TMMA 3ILOA 3MCNA 4PZVA 1TMJA 5ETKA 4CRJA 1IM6A 3UDVA 5ETSA 1RU1A 3UD5A 4M5HA 4CYUA 1RTZA 3HSJA 4M5GA 3HCXA 3QBCA 4M5KA 5ETNA 4M5MA 1RAOA 3MCMA 1RU2A 3ILIA 4M5NA 5ETMA 3HD2A 4M5LA 1DY3A 2F63A 5ETLA 1F9HA 1HQ2A 5ETTA 5ETVA 1Q0NA 5ETPA 4CYUB 1EQMA 3IP0A 3ILJA 5ETQA 3MCOA 1G4CA 2F65A 4AD6A 3HSDA 3KUEA 1EQ0A 5ETOA 4F7VA 4CWBA 3ILLA 3UDEA 1HKAA 1RB0A 2QX0A 5ETRA 3HSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M5I A;  2CG8 A;  2BMB A;  3HSZ A;  1KBR A;  3KUH A;  1EX8 A;  4M5J A;  3KUG A;  1CBK A;  3HT0 A;  3HD1 A;  1TMM A;  3ILO A;  3MCN A;  4PZV A;  1TMJ A;  5ETK A;  4CRJ A;  1IM6 A;  3UDV A;  5ETS A;  1RU1 A;  3UD5 A;  4M5H A;  4CYU A;  1RTZ A;  3HSJ A;  4M5G A;  3HCX A;  3QBC A;  4M5K A;  5ETN A;  4M5M A;  1RAO A;  3MCM A;  1RU2 A;  3ILI A;  4M5N A;  5ETM A;  3HD2 A;  4M5L A;  1DY3 A;  2F63 A;  5ETL A;  1F9H A;  1HQ2 A;  5ETT A;  5ETV A;  1Q0N A;  5ETP A;  4CYU B;  1EQM A;  3IP0 A;  3ILJ A;  5ETQ A;  3MCO A;  1G4C A;  2F65 A;  4AD6 A;  3HSD A;  3KUE A;  1EQ0 A;  5ETO A;  4F7V A;  4CWB A;  3ILL A;  3UDE A;  1HKA A;  1RB0 A;  2QX0 A;  5ETR A;  3HSG A; 
#chains in the Genus database with same CATH topology
 3C15 A;  4RBV A;  2OEK A;  3TQE A;  1CUL B;  3G2X A;  3PR4 A;  4NX9 A;  4OI6 A;  1UVN A;  3IWL A;  4DUZ F;  4RLE A;  2ZM6 J;  3FQL A;  2VF3 A;  3M05 A;  5KT7 A;  1Z4U A;  3E51 A;  3G9C A;  2B8Q A;  4O3O A;  4DL5 A;  4DEZ A;  5L38 A;  1CUL A;  1U6B A;  3ETM A;  3HUL A;  3UN5 A;  2PI5 A;  3CC7 S;  3T6J A;  2ROG A;  3NS5 A;  2HEK A;  3RR8 A;  3T19 A;  1UW4 A;  3KG0 A;  2APO A;  2C2M B;  1RTI A;  2RUS A;  4P72 A;  1H3D A;  3AH6 A;  2DNP A;  2JJ4 D;  2GIR A;  4KV8 B;  1ZZF A;  2R7O A;  1T9T A;  1N5Q A;  4A47 A;  1WEX A;  2E7V A;  4NZ6 A;  3ZNJ 1;  2UUB J;  2NSC A;  1JQG A;  3EDQ B;  3GIK A;  4L76 A;  1MW7 A;  2WW4 A;  3DI6 B;  4FBU A;  1G1X A;  3OR2 B;  5DG9 A;  2NXU A;  4JI7 F;  1XIQ A;  4KV8 A;  4K4V A;  3TQ1 A;  5ETM A;  2DGU A;  2FLN A;  4TY8 B;  4Y2I A;  3HVR A;  4KY3 A;  2MGZ A;  1DUR A;  2CZ4 A;  1TUG B;  3BRE A;  3PX0 A;  1TMM A;  4LF4 J;  2Z8Q A;  1BE4 A;  2ILZ A;  3DI6 A;  1ITP A;  3OR2 A;  3CC2 S;  2XNQ A;  1REG X;  1N5Y B;  2GO9 A;  4CLP A;  5DG8 A;  4TY8 A;  2R8I A;  2VC1 A;  3MMJ A;  8RUC A;  3FCV A;  3H2U B;  1PAU B;  1UA0 A;  1B99 A;  3AB4 B;  2C3Y A;  4TLR A;  1FES A;  2AT1 B;  4ZPV R;  4DV4 F;  1FKP B;  3PHE A;  3F0N A;  2IFX A;  1N5Y A;  3DRR B;  1OQ6 A;  1A7G E;  1J5O B;  4ZJO A;  3TA1 A;  4PQA A;  4C8Y A;  1U2F A;  4ZLN A;  3SFG A;  1EIY B;  4GKJ F;  3A1Y G;  2KL8 A;  5C42 B;  3H90 A;  2PC6 A;  1BC6 A;  4LQ9 A;  4RW4 B;  4FXV A;  2UVR A;  3H20 A;  4DL3 A;  2XQC A;  4IRC A;  1FKP A;  3HO1 A;  4DV2 J;  1VC6 A;  3JTO A;  2YX1 A;  1TTH B;  4YHH J;  3M8Z A;  1J5O A;  5CCM A;  1DAR A;  3AQO A;  1REV B;  1NO8 A;  5C42 A;  2AU0 A;  4CTA B;  3M1V A;  1WHV A;  1O8B A;  4RW4 A;  2H5E A;  2Y9H A;  5F8M A;  1U09 A;  2KB2 A;  2X51 A;  4KIA A;  4Y2C A;  1VQN S;  4X62 J;  4B9U A;  3K0J A;  1PSD A;  2GX8 A;  2FVC A;  5I4M A;  3LPE A;  5KFN A;  2AWZ A;  5E3R A;  3BSO A;  1YJ9 S;  2GQQ A;  4RNM A;  4Y00 A;  3AA8 A;  2R7V A;  1REV A;  2C2E A;  4CTA A;  2BXJ A;  3DLG A;  5KT4 A;  2CJY B;  3D28 A;  4ITS A;  4IQM A;  1FDD A;  4KH1 B;  4URQ U;  4PCQ A;  2F4V F;  2ADC A;  2CZV C;  5MLC V;  3HVT B;  3NGT A;  1JK9 B;  2HG4 A;  2UP1 A;  3TAN A;  5D4O A;  1X4H A;  2X7I A;  1SL1 A;  2ZUA A;  1KFD A;  3MWB A;  1Q8L A;  2PA8 D;  4DG1 A;  3LAL A;  1YJU A;  2JNJ A;  4UZC A;  3LP0 B;  2M7S A;  2HBZ B;  1PBU A;  2HS0 A;  2RNE A;  2BBE A;  3HVT A;  2OPS B;  2Z2Y B;  2Y0B B;  3EM1 A;  4HT5 A;  2A0F B;  2HFV A;  2LDY A;  1AUD A;  4PXC A;  3FFI B;  2VU5 A;  1T0T V;  4B3R F;  1IJE B;  3KHR A;  3LP0 A;  1E6Y B;  1M5P C;  4DCJ B;  1U1L A;  5CXT A;  1RP5 A;  2CXE A;  3M7V A;  2OPS A;  4K4Y A;  4CH7 A;  1K8A T;  4AQY F;  2OUG A;  4Q8E A;  1NB2 A;  2HND B;  1RBO B;  2Y1J A;  4ZCI A;  1T7P A;  1RAE B;  1NU4 A;  4WYW A;  1S57 A;  1E6Y A;  2PEH A;  4URG A;  4AL6 A;  3ONQ A;  4J91 A;  2HND A;  2CJK A;  1K0V A;  1MML A;  4ECT A;  5D78 A;  2HLT A;  4IH7 A;  4ATN A;  1SC4 B;  4B9N A;  2KVI A;  1RYS A;  2EEY A;  1DAX A;  5E3Q A;  4U7U D;  2ZH5 A;  3D3B J;  1F5A A;  4O4R A;  3KK2 B;  2FD2 A;  2YY3 A;  3MPY A;  1FFG B;  2UUA F;  2AEJ A;  1M1G A;  3M6V A;  4W90 B;  4TLQ A;  3BGR B;  1NHV A;  3QGG A;  1PG5 B;  2LQJ A;  1F9H A;  3MCO A;  1K44 A;  2UV8 A;  4EBD A;  5GAH I;  4E98 A;  3P5B P;  4K5R A;  5CAB A;  1URR A;  3CE8 A;  1QSS A;  4G65 A;  2MB0 B;  3KK2 A;  2Y1R I;  1JXE A;  1S79 A;  3BGR A;  2K8G A;  3I31 A;  5A8K A;  3UPF A;  4F7V A;  5LMU F;  1NSQ A;  3VCD A;  4LR8 A;  2QMX A;  3FNN A;  2BUN A;  2H9Z A;  2R8H A;  3ZZY A;  3AD9 C;  2RQ4 A;  3HM9 A;  4C4W A;  3BKF A;  3O3L A;  1NAQ A;  4ETX A;  3NG8 A;  1QE1 B;  3BQ2 A;  3PDN A;  4JYA J;  2BJ3 A;  3MD1 A;  2IA0 A;  4CWB A;  2FJD B;  2GMH A;  3H5Y A;  1Y10 A;  2E5J A;  2ATC B;  3PCO B;  3PFO A;  3FBB A;  3ZZU A;  1UVM A;  2YWE A;  1IM4 A;  5J1E B;  4GKK F;  1QE1 A;  2YH0 A;  1OS5 A;  2QYC A;  2CPZ A;  2KXF A;  1FRX A;  5B0F A;  3TUZ C;  1WEY A;  2LEP A;  5GAD U;  3QQC D;  4A46 A;  4OV1 A;  1M1H A;  3F56 A;  2MZR A;  3MR7 A;  4DV7 J;  1U7L A;  2AYG A;  2RE1 A;  2B9X A;  2V8G A;  2MHN A;  3MMB B;  3H59 A;  4DUY F;  4WZM A;  4KPC A;  4LFC F;  3OFH A;  3A13 A;  4Y2M A;  2MKY A;  3OTE A;  4QIV A;  2DXE A;  4XK8 C;  1RWN B;  2GCF A;  3I5A A;  2DO0 A;  5I3U B;  5ETO A;  3U1M A;  1WG4 A;  3N79 A;  4ECY A;  4ED1 A;  4B9S A;  3MMB A;  3I9V 9;  3RBX A;  1VBY A;  1MRO B;  4OZ2 A;  1F1B B;  3EXY A;  1U1Q A;  3GFZ A;  4QR1 A;  3JTP A;  2G2Y A;  3W62 A;  2DJW A;  1OYD A;  3B8H A;  4PXB A;  5I3U A;  1GAO A;  5ETK A;  4GVL A;  3R5G A;  3ZTS A;  3K8V A;  1MRO A;  1UWB B;  3CIZ A;  4IFY A;  3KDN A;  2BJ9 A;  5D4P A;  4BCA A;  1KC8 T;  3KUG A;  2Q1L A;  1LWE B;  1X4G A;  1VRT A;  3T9N A;  1RAG B;  4ES2 A;  2C2D A;  4JV5 F;  3UCU P;  3CD5 A;  1S6Q B;  5ETT A;  3HKZ D;  4IOC Q;  5HQM A;  4YQW A;  1UWB A;  2J6U A;  2F40 A;  3ILO A;  4RW8 B;  1Q5Y A;  2FZG B;  2BKN A;  2H5I B;  2WSF C;  3K17 A;  1CEZ A;  1RAA B;  2VFU A;  2XWX A;  3DRY A;  5KG3 A;  1S6Q A;  2DY9 A;  3ULH A;  2GHW A;  2YKM A;  3QJP A;  2M3D A;  1QVG R;  1NDP A;  5D3G B;  2EFO A;  4PYA A;  3ZZT A;  2OD4 A;  4RW8 A;  4EGL A;  3OHB A;  1AFJ A;  4DPY A;  1EAR A;  3HFK A;  4KQZ A;  3I9Z A;  1YJV A;  2JEJ A;  4K4W A;  4WK3 A;  2VQE J;  5D3G A;  1HHQ A;  2FVP A;  4OX9 J;  1WJ9 A;  1Y9O A;  1BY9 A;  2W4C A;  5F8N A;  4KGV B;  4ZP6 A;  4X65 J;  3W2V B;  2YX4 A;  4FKX A;  4CO0 A;  1YJN S;  5KFD A;  2HHH J;  5KFQ A;  2OLW A;  1ZM2 A;  1VQY A;  3W60 A;  2ZBC A;  4ZCL A;  1V5I B;  1UKU A;  4C3K A;  4B9T A;  1U02 A;  2DCU B;  1JJ4 A;  2XMK A;  2GFF A;  4BLG A;  2X3G A;  1JX4 A;  3CNQ P;  4C8N A;  5L8R C;  3W2V A;  3BN4 A;  2R8J A;  2HSE B;  1OQ3 A;  1NDK A;  2JC1 A;  2KDO A;  1RLC L;  3B4M A;  1APS A;  5SUH A;  4HH0 A;  2QA1 A;  1RHJ B;  1RCX B;  3HHL D;  1XJW B;  4I7F B;  5LM7 E;  4DF4 A;  2HKE A;  1RAC B;  1HHS A;  1S1U B;  4DCO B;  2F63 A;  4MKB A;  3HP6 A;  2LYV A;  4QCL A;  1L3S A;  5GMK a;  3CJQ A;  4ZDN A;  1WC3 A;  2KRB A;  4IR1 A;  1JLQ B;  1DHM A;  1FI4 A;  1FFW B;  1QD1 A;  4I1T A;  5K5M A;  1GFW B;  4F3Q A;  4J7C A;  1Y0H A;  1IKX B;  1S1U A;  3QZ7 A;  3A8E A;  2DR7 A;  2ZC4 A;  1VQ5 S;  7AT1 B;  1N33 J;  3A3N B;  3H4D A;  3OTD A;  2L9W A;  2V68 A;  3CED A;  4ED3 A;  2W9C B;  2Z57 B;  1FJ7 A;  2J5A A;  4HHJ A;  2GV1 A;  4EWT A;  3V4M A;  1JLQ A;  3DLK B;  3W3S A;  4ZJL A;  3CCL S;  1KQK A;  1IKX A;  4U7U K;  4DX6 A;  1PJ6 A;  4Q7A A;  4C11 B;  4C8O A;  3AD7 C;  5IWA F;  4BS2 A;  2ZHA A;  1UFL A;  3TAM B;  2W9C A;  1U2R A;  4GO5 X;  1WI6 A;  3Q8Y A;  5LJ3 Y;  3DLK A;  2CPE A;  3DDN A;  4CO2 A;  1VQO S;  5J2P B;  1UL3 A;  3PZP A;  2E1C A;  1N0U A;  2Q66 A;  1KP6 A;  1YLX A;  4C11 A;  5B09 A;  3M2U B;  4M94 A;  1MNE A;  3M8P B;  3TAM A;  5B7W A;  4ILL A;  4KHM A;  2FZK B;  2DGV A;  1XBW A;  4JI8 F;  4DR2 F;  1R8A A;  4DR3 J;  4E8U A;  4ED4 A;  2XHC A;  3TRG A;  1XR6 A;  4B17 A;  4RJV A;  2DXF A;  1X5P A;  3M2U A;  1M5H A;  1NJY A;  1FJC A;  1WEZ A;  4DPW A;  3M8P A;  2DEI A;  1TVR B;  2IVM A;  1CJK B;  2HQG A;  4C48 A;  1QTN B;  3MDF A;  2EFN A;  4USI A;  2A18 A;  4WCE Q;  1C1C B;  3D1Q A;  3DFE A;  1UWA A;  2OML A;  2C3O A;  1TL7 B;  4GC6 A;  1RTJ B;  1PJ7 A;  3NGD A;  1GMW D;  2F8M A;  1NBE B;  3TX8 A;  1WOS A;  2RS2 A;  3FK4 A;  1TVR A;  3TZZ A;  4EO8 A;  1CJK A;  2VUG A;  5LT5 A;  1H98 A;  3GII A;  1OY9 A;  3HZG A;  1C1C A;  2EC2 A;  3RW6 A;  1F6T A;  2X1B A;  1TL7 A;  1R7I A;  1RTJ A;  3N4W A;  1XEZ A;  1G4C A;  4PKD B;  3T5L A;  2WB1 D;  1PYS B;  4QWC A;  2LEB A;  3MOJ B;  4F50 A;  3CC4 S;  4UQT A;  2CFX A;  1RIS A;  3OHA A;  2NRE A;  2XSJ B;  2E9Z A;  3LP1 B;  1LOU A;  4OHW A;  3HHL B;  1VCT A;  2XCP A;  4N8N A;  4C6A A;  3KJN B;  1AXQ A;  3CSK A;  1SC6 A;  3IGV A;  1IBK F;  5KFY A;  3AD8 C;  1RT6 B;  2ZBR A;  4KRW A;  1S6U A;  4USV A;  1U1K A;  4Y28 C;  2XSJ A;  2CRL A;  1Q86 T;  4DLE A;  3LP1 A;  2LXU A;  3HHL A;  3E01 B;  1ULR A;  3G6X A;  3H5S A;  2HZA A;  2XS5 A;  3PIP Q;  4LRD A;  2H1Y A;  3R5D A;  5C2C A;  2ZDO A;  2BQ3 A;  1AT1 B;  2UVW A;  1RT6 A;  5GVQ A;  2YNH B;  3CT9 A;  2R42 A;  1HBO B;  2D74 B;  3OTO F;  3E01 A;  1P9Y A;  2KYZ A;  3QT8 A;  4ELU A;  3Q86 A;  3NEK A;  4DOZ A;  1TK0 A;  3TZX A;  2RKI B;  3RBZ A;  2XO7 A;  2YNH A;  1HWI A;  2F1F A;  3PO5 A;  1HBO A;  4WFY A;  4E2F B;  2VJV A;  2AV5 A;  4YDX A;  2KM8 C;  4MK9 A;  4QYZ J;  4Z7Y A;  4OV6 A;  1VQ9 S;  3EGZ A;  1HI1 A;  2QTW A;  2WON B;  3A12 A;  3DC2 A;  2RKI A;  2CIM A;  2OPQ B;  3A3O B;  2E44 A;  5CD4 A;  1S1X B;  2KT2 A;  4OYP A;  3EGV A;  2OGU A;  4QOT A;  3KLH A;  2BQR A;  1NK0 A;  4Y6I A;  2VH7 A;  4OZ1 A;  4DV5 F;  3A4T A;  4C2M A;  2HNY A;  5L1I A;  3W63 A;  1B4S A;  2GHP A;  2WON A;  4ICL B;  1KTQ A;  2I38 A;  4ZIT A;  2OPQ A;  4NLS A;  4UTG A;  5DDP C;  2AX1 A;  1MLA A;  3E3X A;  2ZHO A;  1FF2 A;  1S1X A;  1SPB P;  1VK3 A;  1RWP B;  2XS7 A;  4CO5 A;  4RU2 A;  2VFV A;  1F9E B;  5GAH U;  3TA2 A;  4D3H A;  2B9W A;  3NNA A;  3MPV A;  4MK7 A;  3MED B;  4OZN A;  3JB9 k;  4MT1 A;  2C2K B;  1NCL A;  1FA0 A;  4ES3 A;  5JXS A;  2O01 C;  4OJ3 A;  2IRY A;  4YY3 F;  3K57 A;  3D66 A;  5HAO A;  3OVA A;  5F8G A;  2CG8 A;  1X4A A;  3EWG A;  5KG6 A;  4NZ0 A;  2QSF A;  2C42 A;  1GMW A;  3R7S B;  1RCO B;  3MED A;  1Q8K A;  1S6O A;  4WFB Q;  4U8Y A;  1GX6 A;  3VR1 A;  3R2D J;  3PVX A;  1JJH A;  2P6T A;  2YKP A;  3GON A;  1NJW A;  1FRJ A;  4NAS A;  2N4D A;  3KFW X;  2ZM6 F;  3NNH A;  4K8R A;  2BKO A;  2JFK A;  3IM8 A;  4PWW A;  3LF0 A;  4F3O A;  2CZ9 A;  4L6V 3;  1YHQ S;  3UO0 A;  5HAN A;  4ZPB A;  1R0B G;  2MQN A;  3WC0 A;  1I6J A;  2XNR A;  3QAE A;  2MKK A;  4JI2 F;  3EGN A;  2HHX A;  1RT2 B;  2H48 B;  5FJ4 A;  1GT8 A;  1XER A;  2VBW A;  3FKB A;  2AHO B;  3KHG A;  1TMJ A;  2DRB A;  5KG2 A;  3BH6 B;  3GJQ B;  2LLZ A;  2UUB F;  2W9A A;  2D41 A;  1ZZN A;  5L9X A;  1H72 C;  3KJQ B;  5RUB A;  1RT2 A;  1FDN A;  3J81 Y;  3UD3 P;  2ZVI A;  1N0V C;  3DHX A;  2JDJ A;  3EVM A;  2H4W B;  2FHM A;  1N56 A;  1YX2 A;  3MZI A;  4IOA Q;  4G1Q B;  2JEF A;  2L9N A;  4AXJ A;  4LF4 F;  2KO1 A;  2A10 A;  1FK9 A;  1PBA A;  3DOM B;  1NKB A;  1KNZ A;  3M8Q A;  1H73 A;  3FZ2 A;  3HI9 A;  1KVI A;  3L4B C;  3W9I A;  2WVD A;  2X1A A;  3GFY A;  4JI1 J;  3ZO7 A;  3NGU A;  2P9C A;  3HF5 A;  2W2M P;  4F26 A;  2PMW A;  3HK2 A;  3IFE A;  3HT0 A;  4PYD A;  1BWV A;  4G1Q A;  5KFI A;  3UN2 A;  2GZO A;  1VBK A;  1YZ7 A;  3DOM A;  1D9D A;  1LWX A;  4QZV B;  1HW9 A;  4BHQ A;  2BOA A;  1M1K T;  2CJQ A;  5B0G A;  4UY8 T;  4MK8 A;  4U8V A;  3UDV A;  4TY9 A;  3RR7 A;  3V6D A;  1U6F A;  4WXW A;  2MZS A;  2DYA A;  4OYW A;  3HZE A;  3CDA A;  4DV2 F;  4RWW A;  2KFY A;  2DPJ A;  3IXQ A;  2FJV A;  3IS9 B;  2ZJQ Q;  4DR4 J;  1Q95 G;  4I4B A;  4KTQ A;  2AF6 A;  5HN0 A;  5ITH A;  3CF5 Q;  4OZ3 A;  3W9H A;  4A8X A;  2BDP A;  3G8T A;  2XGP A;  4FKY A;  4X62 F;  4KFB B;  1Q7L B;  3NLC A;  1HWU A;  4J9U E;  1M5V C;  3IS9 A;  3UE2 A;  2I1R A;  3VGT A;  2QEX S;  2C2R A;  3M9N B;  1TKT B;  4EMD A;  1UEU A;  1L3V A;  2XLJ A;  2I8E A;  4LFA J;  1BHN A;  5D0R A;  2RIL A;  1OSD A;  3DDI A;  3D1H A;  3N6L A;  4QU7 A;  2F65 A;  4ZCK A;  2F8E X;  3BZQ A;  5DG7 A;  4KFB A;  1HR0 J;  3JSR A;  4WFN Q;  3MTK A;  4ECR A;  4ANC A;  3T5K A;  1TKT A;  2EK6 A;  4DS5 A;  5H9E K;  1D0E A;  2V63 A;  2N4C A;  5HLF B;  2ZOM A;  4TNO A;  2MY7 A;  3CD6 S;  1UMJ A;  2A3J A;  2VFR A;  1FFS B;  2RB7 A;  4H4K A;  4J9M A;  1C0T B;  1IKV B;  3IR7 B;  3R5B A;  4AND A;  4DR6 J;  2JOQ A;  1A6L A;  2Q79 A;  1XTZ A;  5HLF A;  2PGC A;  1UJ4 A;  4OYX A;  4PPD A;  1RE1 B;  4UY8 5;  4C97 A;  1G6B A;  4TVA B;  3KJF B;  2DGT A;  2ZH1 A;  3GYX B;  4JB8 B;  2XZW A;  4DL2 A;  1R8P A;  3NY0 A;  2AGO A;  2E1R A;  4DQI A;  1JJ2 R;  7FDR A;  1SJF A;  1PC4 A;  4QWE A;  4PG6 A;  1D9A A;  4KT0 C;  1GXT A;  5DLG A;  4ZMM A;  1SV5 B;  1LWC B;  2JLE A;  2OHD A;  3NBP B;  4Z37 A;  2NYH A;  3P6Y C;  2EVZ A;  2RSQ A;  1YQH A;  2KXH A;  3M9M B;  1S4E A;  3TVZ A;  2RIJ A;  2PII A;  3UNY A;  2Z0G A;  3QSI A;  3IM9 A;  2JEG A;  4B9V A;  3BO4 A;  3MFH A;  3H5X A;  2ZEJ A;  1SV5 A;  3TVY A;  3W8G A;  4PXE A;  4LBH A;  3NBP A;  2ZOF A;  2JRS A;  3W5Z A;  3BDP A;  5E3P A;  1X9S A;  5KT3 A;  1NZ8 A;  4WTO B;  4EO6 A;  3BBC A;  2W7O A;  2DR9 A;  3CO9 A;  2KYX A;  1F3F A;  1C1B B;  5DO2 A;  3BM7 A;  3NCQ A;  4QWD A;  2A2C A;  1VGY A;  1MWZ A;  4ALZ A;  4DQS A;  3D6T B;  4O23 A;  4L3K A;  2G4B A;  2VL1 A;  3FDS A;  4DXL A;  3RBD A;  1TUW A;  1Q0N A;  1MU2 B;  1FE0 A;  4AD6 A;  1DJ0 A;  4C9D A;  3MTJ A;  3K58 A;  2C22 A;  4CIO A;  1C1B A;  4L75 A;  2MZ1 A;  2COL A;  2D1C A;  2XTJ P;  1URN A;  1OMS A;  3N0V A;  3GIL A;  3MUT P;  3ENV A;  4I0W A;  1HI0 P;  3LAM A;  4OYA A;  1QUP A;  2XY7 A;  3C6U B;  1MU2 A;  4F4Z A;  3LOU A;  3GYN A;  2HHS A;  3CD0 A;  1IQZ A;  2NXN A;  2V8D A;  1S1V B;  3HMJ G;  3PW4 A;  3PM9 A;  5D4N A;  4JYA F;  2PMZ D;  3CJK B;  4ERD A;  3ENQ A;  3ELH A;  4WXO A;  1FCA A;  1JNR B;  4M1K A;  3BGL A;  2KG0 A;  2XMU A;  2B4P A;  4WFX A;  1S1V A;  4UUW A;  3ITH B;  4YR3 A;  5KG5 A;  1NK6 A;  1C0U B;  1LXJ A;  3PW2 A;  3OQ2 A;  2DK2 A;  1H0H B;  3AXK A;  2R9L A;  1P9Q C;  4JV1 A;  1T95 A;  2E66 A;  2B9Y A;  4PAA A;  4QIF A;  3UFC X;  2YTC A;  5B0D A;  2W4P A;  3ITH A;  4DV7 F;  1N8R T;  1WOP A;  4UW2 A;  1C0U A;  4CLY A;  2EFP A;  3B78 A;  4DSL A;  5IQQ A;  1MMN A;  5IC4 B;  1YJR A;  4QW8 A;  2YWF A;  3MD3 A;  1CC7 A;  1FT8 A;  3QZ8 A;  4OYZ A;  4OHV A;  5DJB A;  1M0S A;  2YQ1 A;  4HL9 A;  4QIE A;  4X4S A;  3T5J A;  2KXN B;  4CM0 A;  2BZ2 A;  4L74 A;  1XMO F;  1N5T A;  2V4J B;  1IWA A;  3N6M A;  3R1L A;  7FD1 A;  2L3M A;  2R7Q A;  1ACM B;  4D3G A;  2CPI A;  1I3O B;  5DQI A;  4Q0B B;  4LFB J;  2VFT A;  2DIT A;  3BSN A;  3GFX A;  1QSY A;  4K7Q A;  2UXB J;  3BO3 A;  2RJZ A;  3FBC A;  3ADA C;  2V4J A;  2JX2 A;  2C1E B;  1DTT B;  3R3T A;  1DZ5 A;  2DNH A;  3LP2 B;  4Q0B A;  3NRB A;  2M8H A;  5KFH A;  4F4A A;  1WDD A;  3M8Y A;  3QYY A;  2FDN A;  2HVE A;  1SC3 B;  1RWV B;  1R6V A;  4F4K A;  5C25 B;  3GIM A;  3CJ0 A;  2MZQ A;  2WRM A;  1H38 A;  2CNN B;  4NYP A;  3LP2 A;  1SCJ B;  1EHW A;  1N52 B;  4YB7 A;  5HK4 A;  2H54 B;  4A8Y A;  1BQX A;  4DN9 A;  4Q2L A;  3NGK A;  1FX4 A;  3W66 A;  2FHK A;  5C25 A;  5M2P A;  3Q83 A;  4MH8 A;  1HWL A;  3E2E A;  1FKO A;  5LJ5 Y;  2RQM A;  2W4D A;  2DNZ A;  1D8Y A;  1R0A B;  2BKP A;  4DFM A;  2E9R X;  1C2P A;  2ADB A;  1UET A;  4QWB A;  3HKW A;  5DGB A;  2YPY A;  1U6Z A;  1MN9 A;  3CJ2 A;  2DIU A;  4F2S A;  4N56 A;  4GRS A;  2O1P A;  5KFJ A;  1UVL A;  5CYQ B;  4KSE B;  1IBC B;  3KUH A;  4FBT A;  1XQI A;  4I2Q B;  1WHX A;  2VQE F;  2IPO B;  2MEW A;  4OX9 F;  1U8S A;  3OR1 B;  4C3L A;  4XO0 A;  2C28 A;  2B43 A;  2NUU G;  5BYQ A;  5K14 B;  4X65 F;  1SJ1 A;  3MM7 A;  3SCI E;  4ZHR B;  5J1P A;  5CYQ A;  1R8C A;  1LKZ A;  3D2W A;  1FDB A;  3M4X A;  2MQ8 A;  2AJ0 A;  2FJB B;  2BE2 B;  4FXW A;  4I2Q A;  4NLO A;  3PAC A;  3PO4 A;  2MZT A;  3OR1 A;  2RRN A;  3FSI A;  2QJ3 A;  2VA3 A;  1K0T A;  2HQ3 A;  1WSV A;  1NHK L;  2WVF A;  5K14 A;  5A8W B;  1Y4Z B;  1IN0 A;  4ZHR A;  3J80 Y;  1FTR A;  1YJT A;  3C14 B;  2IM3 A;  4I68 A;  4QJV A;  4WU3 A;  1H2T Z;  4V19 X;  3GFH A;  1NPR A;  3I87 A;  4U9R A;  2VPY B;  4RW6 B;  4BWM A;  4WII A;  2DHG A;  1GTH A;  1E6V B;  3R2C J;  5A8W A;  1L5U A;  3MM8 B;  3C14 A;  3I5C A;  3VGV A;  4C0B A;  3P49 B;  1T05 A;  5EN1 A;  4IOB A;  4CO4 A;  2FIU A;  2DH7 A;  3MM5 B;  2VJU A;  2HFO A;  2G13 A;  3MEG B;  3G6Y A;  3L7U A;  2HHT A;  5KG7 A;  4DX5 A;  4RW6 A;  2Q6C A;  4EEY A;  1SB6 A;  3OXF A;  2FLO A;  4KR0 B;  1N33 F;  1E6V A;  1JXL A;  4DV3 J;  2VG7 B;  4NCG B;  3MM8 A;  2V2Z A;  3IAM 9;  4FYY B;  4BC9 A;  2N82 B;  1S6P B;  3MM5 A;  2E5G A;  3MEG A;  3OVB A;  3THP A;  3GE9 A;  2VQF F;  1WAC A;  2BW2 A;  5LXY A;  3QRR A;  4PG4 A;  4KGK A;  4P2X A;  1AB8 A;  3TW0 A;  1U8W A;  2POK A;  1H2U X;  1LNQ A;  3ZZP A;  4YN3 B;  1K1Q A;  4LF5 J;  5KFL A;  2VKZ G;  2N3O A;  3SFU A;  2I9S A;  1B7F A;  2R7S A;  3H7H B;  4M5K A;  4OYI A;  4I64 A;  4A48 A;  1RSC A;  1NUE A;  2V69 A;  5CYJ A;  2JEI A;  3MR5 A;  5AE1 A;  1FHT A;  4R8U B;  3ICL A;  1IR0 A;  4WU2 A;  1QY7 A;  1FRK A;  4P10 A;  1IBL J;  2FJX A;  3QT6 A;  4LRC A;  2BA9 A;  2MLX A;  1X0P A;  2EXU A;  4X2B A;  2W2P P;  1FNO A;  4KGM A;  3JAM Y;  2QG9 B;  1TL5 A;  4KHR A;  4WK1 A;  2CNO B;  3UCZ P;  3CUN A;  2V2K A;  5CCL A;  4ECQ A;  1IQT A;  1FVQ A;  1Q4R A;  4R8U A;  2HRU A;  5JVG Q;  3V4I B;  1UFK A;  2LU2 A;  1RWU A;  2XMM A;  4WYL A;  1SKR A;  5T7L B;  2GIQ A;  3PX4 A;  2WSE C;  2CYY A;  5A76 A;  1X5O A;  5KFM A;  1KN6 A;  4J9S A;  3M8W A;  2ZE2 A;  2AZ3 A;  3Q2T C;  3W5Y A;  1WKL A;  2ASY A;  3PTW A;  4OI0 A;  1RQ0 A;  3SMZ A;  3M6X A;  3OL6 A;  2XS2 A;  2XY5 A;  1NSA A;  2IRU A;  5T7L A;  4ZVU B;  2W01 A;  4FF2 A;  1Q78 A;  3BPD A;  3OJS A;  2FJW A;  3OL9 A;  2W24 A;  5A6W A;  3EMT A;  1WC0 A;  2XZT B;  3GJT B;  4X4O A;  2K2P A;  3W8P A;  4BWJ A;  4PEO A;  1VQM S;  4YB6 A;  2XLK A;  1XNR J;  3CCS S;  2E1M C;  4LF6 J;  4LMZ A;  1S12 A;  1MMD A;  1T3O A;  1B64 A;  1JLA B;  1N5S A;  2CPJ A;  4O0I A;  5J1N A;  2QT7 A;  3VZI A;  5BXI A;  3SCJ E;  1FER A;  3DXB A;  3EXC X;  4OMF G;  4RUB A;  5IM0 A;  2J6T A;  4G1I A;  1S9G B;  4L72 B;  3CCU S;  3BBF A;  2B56 A;  4G6V B;  4R0E A;  3QGH A;  4Q2M A;  1GTE A;  1JLA A;  5E2Q A;  3BGU A;  4CM2 A;  2RDD A;  2J9D E;  1HBU A;  1RWW B;  4CLS A;  4IO1 A;  1S9G A;  2ZUG A;  4HDH A;  4DWI A;  4AXI A;  2CVI A;  5BJR A;  1EAY C;  4M95 A;  5KFP A;  1WDT A;  3V6K A;  3T41 A;  1VC5 A;  1FRI A;  2C2Z B;  2BJ8 A;  3I4H X;  5KFX A;  1RWK B;  3W5X A;  4X4U A;  1XNQ F;  2QX0 A;  3EX7 B;  1KDN A;  4K59 A;  4OZL A;  3FCH A;  1NEE A;  2VZ9 A;  3FCW A;  4ZVH A;  3NS7 B;  3MUR P;  3AJ1 A;  3EIC A;  4EBE A;  4ZPD A;  5K8M A;  2ROP A;  2DBB A;  2W8L A;  2ZBI A;  1NKE A;  4JV2 A;  1UTA A;  4ZJQ A;  2J8S A;  2UVU A;  3FJ2 A;  5L46 A;  4J9P A;  2GAH C;  5BR8 J;  3QT5 A;  3JSM B;  1V9O A;  2FY8 A;  5A0Y B;  3I5B A;  3CWJ A;  3NAH A;  3DRP B;  2V8V A;  2IRX A;  4XPE A;  4P7V A;  5DZ7 A;  4IG3 B;  3RJM B;  3EVW A;  2OTJ S;  2NR0 A;  4PRF A;  4FF3 A;  3NGS A;  3MM9 A;  4ZOS A;  1Y5L B;  2KJV A;  4KO0 B;  3BEG B;  3JSM A;  2HGL A;  1DQ9 A;  1PC5 A;  5A0Y A;  1ZS6 A;  2HGN A;  6FD1 A;  4CDI A;  1GH8 A;  3DRP A;  1F2G A;  1J27 A;  4JV0 A;  2J0Q D;  4LVN P;  1KRP A;  3IWX A;  1PJ5 A;  3RW7 A;  2QA2 A;  2E7W A;  1X5T A;  3H5U A;  1XMQ J;  2F9J A;  3T1Y J;  1HNX J;  2HHP A;  4KO0 A;  3OT9 A;  1IM6 A;  4IRD A;  2RH3 A;  4OHY A;  1R89 A;  1QAX A;  1T9W A;  2MKH A;  4R25 A;  2J0X A;  3PYG A;  2FB0 A;  1N4L A;  2XBP A;  1ZH5 A;  4NLG A;  1FNX H;  2BVZ A;  1FJG J;  2Q6B A;  4ZIV A;  4N7T A;  2CA9 A;  2EWH A;  1G2E A;  1FVS A;  3DN9 A;  3DGP B;  2KZM A;  3ZTQ A;  1S49 A;  3FGV A;  5HBM B;  2ZH6 A;  3TUJ C;  3PY8 A;  1M90 T;  1TU0 B;  3HX9 A;  1RHK B;  5BYR A;  1UVK A;  1UCN A;  4YB5 A;  2D69 A;  1HA1 A;  3G87 A;  4FYX B;  2EC0 A;  1IVZ A;  1P6T A;  2BRL A;  3DLE B;  1YTY A;  1S0O A;  3GPA A;  4YOE A;  2JHE A;  3DGP A;  5KFK A;  4A8W A;  5HBM A;  3PV8 A;  1X4D A;  1U49 A;  3PJX A;  2PSZ A;  4O3P A;  2IY5 B;  2VG6 A;  3QSY B;  3GYG A;  2WTF A;  2CDQ A;  3MM6 A;  2MKC A;  4ECZ A;  3TVK A;  2BQU A;  4Q43 A;  2YH1 A;  1UPP A;  3DLE A;  2IA6 A;  5EHH A;  3Q22 A;  4CNZ A;  1R0C B;  1TFW A;  3HVW A;  1F5C A;  4TKT A;  2FYX A;  2Y8Y A;  1RB0 A;  4EZ9 A;  2IJF A;  5HJX A;  3O2I A;  1KHW A;  4X4V A;  2HRY A;  4FVM A;  4BC7 A;  1RU2 A;  2RS8 A;  4RKU C;  4DX8 H;  2DR6 A;  3C66 A;  4WWS A;  2K06 A;  3TEH B;  1BGX T;  2R7X A;  5IV4 A;  1JKH A;  2RDJ A;  4DL0 C;  4KHP J;  1F60 B;  3MGJ A;  2CPF A;  1FRL A;  1UPM B;  1YK9 A;  3DLL Q;  4OHX A;  2ZD1 B;  4J9O A;  3HFZ B;  2H4Y B;  2F4V J;  1YWX A;  2DHX A;  2HAF A;  1UZD A;  1TV6 B;  3TI0 A;  3BQ0 A;  2OD6 A;  4HTJ A;  3PEJ A;  4OI2 A;  4M63 A;  2ASD A;  4CYU B;  2LEA A;  2BAC A;  2HW3 A;  3T9Z A;  2DKO B;  1TZ0 A;  3K5L A;  2DNG A;  4I6W A;  3ZTO A;  1IXK A;  2ZD1 A;  1S5Z A;  3QRP A;  2QRR A;  3OFE A;  3KNG A;  3H25 A;  3ZC4 A;  4DR4 F;  1YRU A;  2LDI A;  4RUC A;  4LUB A;  2EBE A;  1TV6 A;  4DU8 A;  1U1M A;  4B02 A;  3PXG a;  4CYU A;  4H4O B;  5HMY A;  1H6K X;  5AT1 B;  2VA2 A;  5H9F K;  2DGS A;  2X1G A;  3NOC A;  4ZLP A;  4FP9 A;  3IRX B;  2CQ2 A;  4P7T A;  4IG0 B;  4RR5 A;  1RT1 B;  2UXC F;  2GGP B;  2A2D A;  2RRA A;  2WCX A;  3LW5 C;  4V19 J;  3NS6 A;  4JUZ A;  4HH1 A;  3ZTR A;  1DLO B;  1VQ6 S;  4LFA F;  2VIC A;  2B51 A;  2JLF A;  4H4O A;  3V81 B;  2P9E A;  5FD1 A;  3IRX A;  3QAT A;  1GXU A;  4XDC A;  1PYO B;  1ICE B;  2BJ7 A;  4NLQ A;  2N7Y A;  4IG0 A;  5B0A A;  1RT1 A;  2GGP A;  2IIH A;  1NPK A;  4HDG A;  3M8S A;  1TEL A;  1UEK A;  2XYH B;  1DLO A;  1PO6 A;  2FHJ D;  1SQG A;  4DSE A;  3I56 S;  2DEJ A;  1Z2L A;  4EFA C;  3PYF A;  4IO9 Q;  3PW5 A;  4K0K F;  4ILR A;  2Q43 A;  2O5D A;  5BYS A;  2KKH A;  1RT4 B;  2BX6 A;  5DS7 A;  2QO3 A;  1VLY A;  4DR6 F;  3MR6 A;  4IDK B;  2SXL A;  1X9W A;  1YZ6 A;  3DRR A;  4ZN3 A;  2FLL A;  3CCQ S;  3NP5 A;  2E1P A;  1S59 A;  2NXC A;  1QLN A;  4NE9 C;  1SJ4 P;  4E0D A;  1RT4 A;  2HVZ A;  4UQG A;  4IDK A;  3K5M A;  1UEV A;  1IBM J;  3AQP A;  4F0H A;  1RLD A;  3MR2 A;  3PJ9 A;  2ZH2 A;  1HFE L;  1EX8 A;  4NLD A;  4USW A;  1U48 A;  4Y0F A;  1X7V A;  2H3E B;  4N77 A;  2IMO A;  5I42 B;  2DGX A;  4WPA A;  2G1D A;  2BJD A;  4F4X A;  3O1L A;  2UUC J;  4DSI A;  2ZIT A;  2G9O A;  1NDL A;  4TYB A;  1YBU A;  4Y3C A;  2KU7 A;  1MWQ A;  1CPZ A;  4IFV B;  3MPW A;  5KG0 A;  4CH1 A;  2DGW A;  3H2V E;  4UUX A;  5F8H A;  3M30 B;  2IJN A;  2LA4 A;  1RHR B;  1ZPW X;  4JI0 F;  3TZY A;  3G6V A;  4WZQ A;  4C7Q A;  2YX7 A;  4URS A;  2E29 A;  2LMI A;  3W61 A;  1WC5 A;  3AT1 B;  4AFF A;  3OJU A;  2RQK A;  3OFF A;  2YNG B;  2XM3 A;  3M30 A;  5KFU A;  1LW2 B;  1T94 A;  2E1A A;  1T9U A;  3CJT A;  3MUM P;  2OJ3 A;  3SV3 A;  1CS4 B;  1TL3 B;  2Z58 B;  2KHC A;  3MHY A;  3E8O A;  3FFI A;  2HFS A;  2FC8 A;  2YNG A;  2DPI A;  1BUX A;  1WWH A;  4NLW A;  2UUT A;  2JVR A;  2PD1 A;  4YS2 A;  2EFV A;  4CT9 A;  3AXM A;  2J7K A;  4WIQ A;  1RHU B;  4ZK7 M;  4LFC J;  3I4P A;  1CS4 A;  1TL3 A;  1MG7 A;  3BBB A;  1BMQ B;  5C7P A;  3VAG A;  3QJL A;  3MMA B;  3OL8 A;  1SVD A;  1FD2 A;  2G2O A;  4PZV A;  4OI4 A;  3EPI A;  1K73 T;  2GW8 A;  2XWY A;  3WX8 A;  4I69 A;  2W2O P;  5FII A;  3F41 A;  3CIM A;  2YPZ A;  5GAE I;  4ZVQ B;  3KLE B;  3M2V B;  1RAI B;  2Z30 B;  1ZET A;  2E5I A;  1VQK S;  3BB5 A;  2IDE A;  3MMA A;  4ECW A;  4HKQ A;  2FHJ A;  1RU1 A;  4WJB A;  3Q89 A;  5K8N A;  3FEX B;  1HW8 A;  4PR6 A;  3B4D A;  2NCK L;  5KAK A;  2Y1I A;  2NQP A;  2KFZ A;  1AZS B;  3KLE A;  3CMA S;  3M2V A;  3M6U A;  2MZJ A;  3Q8R B;  5LSR A;  2A6M A;  2R8G A;  4GMK A;  1SQE A;  1IR2 A;  2CPD A;  2RUG A;  2HLU A;  2DD8 S;  1GXL A;  4X66 J;  1VQ8 S;  1Q7Y T;  4OHZ A;  4OLO A;  5HMZ A;  5HMX A;  4JI4 J;  2UVV A;  4LT6 A;  2XG8 A;  1AZS A;  4HLB A;  2V0N A;  3DRX A;  5H9F J;  1T9Y A;  3D0G E;  2U2F A;  1FRM A;  1JLG B;  3CJ3 A;  1HNW J;  1IKY B;  4DPO A;  1M5O C;  3MFI A;  1YRT A;  2GML A;  2ZNY A;  4ES1 A;  3MAA B;  2UXB F;  4RUA A;  3QMQ A;  4P75 A;  3SYZ A;  3PHT A;  4FF1 A;  5CZV A;  5G0R B;  3KNA A;  1YI2 S;  2YWW A;  3PFE A;  4AYB D;  1EKR A;  1XMB A;  2V9K A;  2YKA A;  2EKN A;  4P2M A;  1OY8 A;  1LFW A;  1JLG A;  1IKY A;  1KLM B;  1HNI B;  2VBZ A;  3WBZ A;  2Z2L A;  4PG7 A;  4M5G A;  4TQR A;  4J5O A;  3MAA A;  2XC9 A;  4XIU A;  4EK2 A;  1X31 C;  2GA7 A;  2LVW A;  5G0R A;  1CJT B;  4YP3 A;  5J2M B;  2RRB A;  4X4P A;  1HD0 A;  4DL4 A;  5HVH A;  4IRK A;  2R2U A;  1LW0 B;  4TYA A;  3HVA A;  4LF7 J;  2B4V A;  1KLM A;  2ZKT A;  1WOR A;  4QPX A;  1CC8 A;  4FPR A;  5J1E A;  4U95 A;  3I6P A;  2R2T A;  3D6M B;  1UAW A;  5KFV A;  1CJT A;  1WEL A;  3CCT A;  3LTO A;  3PRD A;  4HI1 A;  2PFF B;  5J2M A;  5K8O A;  2VFS A;  3ZZ0 A;  2C3M A;  2XCA A;  1R6Y A;  2GJI A;  1LW0 A;  5E33 A;  3J7A 1;  1VBX A;  3UQS A;  3CJR A;  1HNV B;  4J9Q A;  2NYI A;  3S6E A;  2WVE A;  3SQO P;  4OJG A;  1EB0 A;  1Q1K A;  3W64 A;  1OYE A;  3D7S B;  3VAK A;  5K20 B;  1TAQ A;  2M70 A;  2CDR B;  3KYL A;  4PWD B;  3DU5 A;  4ELT A;  1P8G A;  4LRE A;  2IC3 B;  4CRJ A;  3HHN B;  3ENA A;  1TAU A;  1HNV A;  1U0S A;  4RNH A;  2CQ0 A;  4HT7 A;  3J81 U;  4YB1 P;  3PW0 A;  4NEY A;  4LVO P;  4OQJ A;  2D3O 1;  3T1A A;  2LCW A;  1YIT S;  2BYC A;  4ZLJ A;  1HQU B;  2JH3 A;  1T9V A;  1FD8 A;  2IC3 A;  1W2I A;  5SZT A;  1WKJ A;  2ASJ A;  3MAH A;  2CQP A;  2NZC A;  2MKS A;  2W9B B;  3PNI A;  1TKZ B;  1Q79 A;  2OI2 A;  5DDR C;  3UNG C;  3AOD A;  4EI2 A;  1TUV A;  4OJ1 A;  3FZB A;  3IR6 B;  3MEE B;  3QFH A;  4F4W A;  3AHP A;  5IWA J;  1A0O B;  2LQ5 A;  5D8H B;  2W9B A;  1WC6 A;  1TKZ A;  1IWG A;  2OSR A;  4ZA1 A;  3Q8Q B;  3WQP A;  4L73 A;  5DRK A;  2W1B A;  1RBL A;  1LWE A;  3UCG A;  2XLI A;  3MEE A;  3R6L B;  3R5A A;  3O6Q A;  1JLE B;  3D68 A;  2AGP A;  4C98 A;  2FPH X;  4RNO A;  4RBT A;  5CYM B;  1VQL S;  1VYA A;  2O66 A;  4JI8 J;  1ROF A;  1YJW S;  5M2U A;  4Q5V A;  1CQN A;  4DV3 F;  4TQS A;  2W2N P;  2MPU A;  2LFV A;  2FY1 A;  2M8D B;  5LXR A;  4B3S J;  5CYM A;  1T03 B;  3T1H F;  5U47 A;  4ZVO B;  3PJW A;  4CI0 B;  2DIV A;  4FDF A;  1N36 J;  4NCA A;  4A8F A;  1RAO A;  1J5E F;  2FTR A;  4P2F A;  3TR5 A;  3FUY A;  4Z7C A;  3CD7 A;  5KFS A;  3VQS A;  1B7Y B;  1TP7 A;  1T03 A;  4TN2 A;  2YKQ A;  4LRB A;  5IQ6 A;  1UJ5 A;  2MHE A;  1S10 A;  3M8R A;  4PQU B;  4X4T A;  3GIJ A;  1NK9 A;  1VC0 A;  1D8Z A;  3DOK B;  2YBV A;  4GVB B;  1XR5 A;  3PKY A;  3Q8V A;  1GMV A;  3M2R B;  5GAD I;  5DQG A;  1YGY A;  2NXE A;  2K1R B;  2B3T B;  3ZZO A;  2RML A;  3ISN D;  1KOH A;  1FTC A;  1XK8 A;  3EE3 A;  4PQU A;  2VDH A;  3BDE A;  2VBX A;  5KOW A;  3N6N A;  3DOK A;  4C8L A;  4GVB A;  4KH0 B;  2F3J A;  3HXM A;  2RAQ A;  2MQL A;  5CZX A;  3OSN A;  2OSQ A;  3NCR A;  4MKY A;  2R4F A;  4I7F A;  4FF4 A;  1NRK A;  1VIS A;  4AL7 A;  1LQ9 A;  3GSI A;  2XMW A;  1F0X A;  2J9D A;  3UI3 A;  5L9N A;  3FRY A;  5FDL B;  3QGI A;  1N6Q B;  1LEO A;  3HSG A;  1X4B A;  4F3M A;  3UWT A;  1G7C B;  4HYK A;  4FNH A;  3BV8 A;  2W7A A;  3R27 A;  2XSF A;  5KFO A;  2EK1 A;  2HHW A;  2B5J B;  2NXJ A;  5DM7 Q;  3HHL C;  4ELV A;  2AQ4 A;  1D3W A;  3CME S;  2DH9 A;  4DFJ A;  5FDL A;  1WOO A;  3ISN C;  3R5J B;  5HQL A;  5E7O B;  3SCL E;  2WOM B;  4KPY A;  4TXS A;  2AIR B;  4MYT A;  1WD6 A;  2FQQ B;  1S7H A;  4LF6 F;  2AJF E;  2EG1 A;  1V5V A;  1NHU A;  3H2L A;  2LA6 A;  2MKJ A;  3D3C J;  5AE2 A;  1V3S A;  6AT1 B;  4KGX B;  4DR5 J;  2WOM A;  5J2P A;  1A9N B;  5KFE A;  2WSC C;  2B4U A;  1UJ6 A;  2R2S A;  4C0O C;  2G1H A;  3GV8 B;  5KG1 A;  1B0T A;  4CLF A;  1YVF A;  1XWL A;  2XYP B;  5HMW A;  2UZA A;  5IT9 Y;  2HVI A;  4B3M F;  3ISZ A;  5AXN A;  3GLJ A;  4USM A;  3H98 A;  8ATC B;  3N01 A;  2BEF A;  2CQH A;  2YXL A;  3OLA A;  4MTP A;  2J9C A;  3KUE A;  3OLB A;  5M2R A;  2CQB A;  2PT0 A;  5GME A;  2K3K A;  3IR5 B;  2RF2 B;  2CJX B;  3QLH B;  4LRF A;  4ZVE A;  3AY0 A;  3G71 S;  3GCX P;  3JTN A;  3V2U C;  3DDK A;  2KG1 A;  4F2R A;  3ILI A;  3TYT A;  1N54 B;  1KTV A;  2VPZ B;  4MMO A;  3I82 A;  5IT4 A;  1Q82 T;  3IAS 9;  1VDH A;  4PG8 A;  4DV1 J;  2BJE A;  2QSW A;  3RYL A;  3CB4 A;  3CPW R;  4KB7 A;  4RZR A;  3KTQ A;  2JC0 A;  4EZ6 A;  2RF2 A;  2D3Z A;  3QLH A;  5K9F A;  2G0C A;  1NK5 A;  1G3O A;  4NMX A;  4YY3 J;  3Q8U A;  3N9U C;  4DLG A;  6FDR A;  2BR0 A;  2YQ3 A;  3QFW A;  2DHS A;  3D5M A;  4NML A;  5HRO B;  4OYM A;  3J7Z T;  2UV8 G;  1RTI B;  5BR8 F;  4ETZ A;  4LIR A;  1U0H B;  2IYI A;  4PWU A;  2PA3 A;  4OL8 A;  3SBM A;  3QID A;  1FEH A;  5HRO A;  2MLY A;  5F3T A;  4JI3 J;  5HQ8 A;  3LGN A;  2OP5 A;  4JI2 J;  4DV6 F;  2LU1 A;  4DQP A;  1HBM B;  1WC1 A;  4TU8 A;  1QUV A;  2ZHB A;  1U0H A;  2HS3 A;  2HQD A;  1T02 A;  1OWX A;  4GO7 X;  3SSR A;  2CQC A;  3VV2 B;  2D9P A;  2EBG A;  5A2Q Y;  3G4S S;  2P5V A;  5EWF A;  1T11 A;  1XMQ F;  2VPW B;  3T1Y F;  2L9D A;  2MGZ B;  1HNX F;  1W26 A;  3OTB A;  3NOG A;  1JXV A;  1SJ3 P;  3JXO A;  1HBM A;  4DZD A;  5T41 A;  3HT3 A;  4OLP A;  1R43 A;  3IBF B;  2FHO B;  4NLX A;  4YFU A;  1T8E A;  4NI2 B;  1VHF A;  2BRK A;  1S0V A;  2AZ1 A;  1FJG F;  2KJW A;  2JSX A;  5KFR A;  5ETS A;  2E7X A;  5KFA A;  5FLX Y;  5DGA A;  1NZA A;  1DFD A;  2A1B A;  4RU9 A;  1RAJ A;  3K89 A;  1S4F A;  4NI2 A;  4O0N A;  3KK1 B;  2IYG A;  3IG1 B;  1FXR A;  5GAE U;  1WTF A;  5IOL A;  3CO0 P;  4J9V A;  3D1O A;  4OFZ A;  2ZH9 A;  1RA7 A;  4NYZ A;  2NZ4 A;  3G96 A;  1OJ4 A;  1RXO B;  2VOP A;  2YQ0 A;  4DBQ A;  3KHL A;  3OW2 R;  2MQM A;  1DRZ A;  3J7Z 5;  3KK1 A;  5ETL A;  1YRX A;  4ICL A;  3IG1 A;  3M1V B;  5F0U A;  1JMT A;  1T3N A;  2R7T A;  3TO8 A;  1F5B A;  4O3Q A;  2DTJ A;  4NLR A;  2VHG A;  2AEM A;  1PYT A;  1B0P A;  4N41 A;  5ADZ A;  2DIS A;  3VHQ A;  3UD4 P;  2QIF A;  4HHU A;  3BSA A;  2WVC A;  2ZVS A;  4HR2 A;  2MXY A;  3DLG B;  1RHM B;  3SI8 A;  3GB0 A;  2IDL A;  1RJJ A;  4B3O B;  1O0P A;  2M88 A;  4ED0 A;  4O3R A;  3LA0 A;  5EUH A;  3LUY A;  4NWB A;  2VB6 A;  1VRU B;  3JQM A;  1SI9 A;  1AW0 A;  2XY6 A;  3KLI B;  4KHP F;  4LQ3 A;  2HK2 A;  4ZKA A;  4A8M P;  1NLK L;  4DG1 B;  4B3O A;  4K2X A;  4WE1 B;  2DHA A;  2R7W A;  1VRU A;  2ZJR Q;  4W98 A;  4K50 A;  4MFB B;  2YVS A;  4FYD A;  2V2Q A;  3KG1 A;  3WIV A;  2KT5 A;  2W7P A;  3KLI A;  2ALZ A;  1RK8 A;  4F02 A;  2MJU A;  3QT7 A;  3KK3 B;  3J80 U;  3U1L A;  4IH6 A;  2HHU A;  2EG2 A;  4WE1 A;  2HGM A;  5J2N B;  2W8K A;  2EFQ A;  1WHY A;  4RW9 B;  4MFB A;  1CVJ A;  3DCA A;  3TAR A;  2LQ9 A;  3UN3 A;  2M4M A;  2DGQ A;  1KQS R;  4C3M A;  2QFI A;  3SIP B;  1N5V A;  2HIQ A;  4N8O A;  3KK3 A;  5KFZ A;  4LSL B;  5KT5 A;  4O4G B;  2Y8W A;  3CJ8 A;  3RAM A;  3CDE A;  5J2N A;  1I1G A;  4NRU A;  1UVJ A;  3ILL A;  1HPZ B;  4RW9 A;  2IM0 A;  2HUR A;  1D09 B;  1N48 A;  3GR1 A;  4H4K C;  1VJQ A;  2QA4 G;  2CWX A;  2GO8 A;  3GZ7 A;  4HAC B;  4LSL A;  1KQG B;  4O4G A;  3VVU A;  1QTM A;  4QW9 A;  2M0G B;  3BO2 A;  2IJR A;  3TJ9 A;  4LBP A;  1HPZ A;  1Y5N B;  4FN5 A;  1QAI A;  3S8S A;  2BAN B;  2DO4 A;  2XMV A;  1RAH B;  3MI7 X;  2HBY B;  3NMR A;  1SQF A;  3EDR B;  4HAC A;  3HHE A;  1FNM A;  3QJJ A;  1UW9 A;  3T5H A;  2I0X A;  3LGH A;  4DR7 J;  3RUB L;  3CGI A;  3VAJ A;  3SQG B;  5DLF A;  4Y65 A;  4QYR A;  4X64 J;  3MCM A;  3KJV B;  1Y00 A;  3SSQ A;  2BAN A;  1RGV A;  4UZB A;  4MIW A;  4ZIW A;  3IMQ J;  1V6H A;  1ZTT A;  5J2Q B;  3KLF B;  3MCN A;  4YHH F;  1CJV B;  1CJU B;  3DM2 B;  1JWW A;  1HHT P;  4P71 A;  5A8K B;  2W25 A;  1HQ2 A;  2V6A A;  2F5G A;  3SQG A;  1TK5 A;  1DQA A;  3KJV A;  2MYF A;  2OEJ A;  4DS4 A;  2M52 A;  1IBM F;  1WF1 A;  1Y5I B;  5J2Q A;  3KLF A;  5F8J A;  1Q53 A;  2LXI A;  3JAM U;  3SSS A;  1CJV A;  2WBR A;  4P73 A;  1CJU A;  3DM2 A;  5D0G A;  5F9L A;  2QZ8 A;  5E5N A;  3HJF A;  4FXD A;  2ZWO A;  2DHH A;  5D6G A;  3OFG A;  4NLY A;  4CH0 S;  2GHV C;  3QAU A;  4B9M A;  3BF4 A;  1BXN A;  2OKQ A;  1Y3K A;  3CDB A;  3P4U B;  1U25 A;  3IO1 A;  3CJ4 A;  2UUC F;  1MN7 A;  2P8I A;  3KOA A;  1UVI A;  3LAN A;  2KFN A;  1MSW D;  1YSJ A;  3R6G B;  1X9M A;  1YKW A;  1F9F A;  2J0W A;  1EZZ B;  2M9K A;  3G8S A;  4CLT A;  2WW8 A;  2ZJP Q;  2AYE A;  3UD5 A;  4ED2 A;  3OXG A;  4ED8 A;  2L48 A;  2CJA A;  2F9D A;  4DCP B;  1NME B;  2WHO A;  3VAM A;  4PPZ A;  4F0K A;  3T6B A;  3DGV A;  3S1T A;  3U1N A;  5KFC A;  1SL0 A;  2HZV A;  1HMV B;  3GG1 A;  5IZH A;  3B82 A;  1C0T A;  5G4D A;  4Y34 A;  3CCM S;  1IKV A;  4WF9 Q;  4DR1 J;  4AUK A;  5H1S V;  1HWJ A;  3CVK A;  3VVT A;  4IR9 A;  3QBC A;  2CQD A;  2PE8 A;  2ZNZ A;  5D77 A;  4FZV A;  4K4X A;  4DL6 A;  1RYR A;  2G2Z A;  3UDE A;  4G1P A;  5E3A A;  3IN5 A;  1HMV A;  1VHI A;  3A8J A;  1FE4 A;  4KYZ A;  1XMO J;  4KC5 A;  4J9L A;  5B08 A;  2J8A A;  4JI6 J;  3PYE A;  2V50 A;  3DLH A;  2JWN A;  2CQG A;  1X4C A;  5A6P A;  3K2Y A;  1WI8 A;  1TK8 A;  2HFN A;  4M5H A;  2QLW A;  4IFY B;  4LF1 A;  5IV3 A;  1LWC A;  1L3T A;  5CH7 B;  1BD6 A;  3AA9 A;  4ZN1 A;  4X4N A;  2HRT A;  2KH9 A;  4DMZ A;  4WP9 A;  4NZ7 A;  2U1A A;  1AYE A;  2FVR A;  3CCV S;  1VRT B;  3TJA A;  1VRQ C;  3FSY A;  1NSP A;  1FEE A;  4A4J A;  2P9G A;  3QGP A;  1RUS A;  4WP8 A;  3BYP A;  4F0M A;  2LEC A;  1GNK A;  2EW9 A;  3VAL A;  5CAA A;  3H40 A;  2HVD A;  4UOH A;  3J7A N;  3QPI A;  2YKM B;  4X66 F;  4OZJ A;  4RWX A;  2CWK A;  1K9M T;  2FJA B;  4JI4 F;  4DZ6 A;  4ECS A;  3KMQ A;  1B0V A;  3JSY A;  1ZM3 A;  4J37 A;  1HNW F;  2MST A;  2ZC3 A;  4DSK A;  1NJX A;  5F9N A;  3MMC B;  2QA4 S;  1VQS A;  2XYG B;  4KE5 A;  2DNR A;  3GJR B;  3ET6 B;  2BM1 A;  3JS9 A;  4YUD A;  3Q23 A;  2BOP A;  1VFJ A;  2BE7 D;  1DQ8 A;  2AP6 A;  1WKK A;  3R1H A;  1FJE B;  2PI4 A;  3QNW B;  1S9E B;  3UR3 C;  3RB3 A;  3C6U A;  3MMC A;  5LOQ A;  4JP8 A;  3AOA A;  1KVK A;  3AJD A;  5AE3 A;  3HHD A;  3LWL A;  3ET6 A;  3IP0 A;  3UW1 A;  1NM2 A;  3CJK A;  3WZ0 A;  2V4R A;  4ZVG A;  4OI1 A;  4QYZ K;  1KLN A;  1SIZ A;  1S9E A;  2LKZ A;  1SL2 A;  3CW2 C;  4LF7 F;  2UU9 J;  4N76 A;  1S97 A;  1BWE A;  1IR1 A;  4W92 B;  1PCA A;  2F4F A;  2DNN A;  4V1A k;  3NCP A;  2QGF B;  4LR9 A;  1KQF B;  2IM2 A;  1S1T B;  1HNZ J;  4J9R A;  2MLZ A;  3EGW B;  4ZS6 A;  4OX6 A;  1KHV A;  2VIH A;  3C46 A;  2BW7 A;  4RBU A;  1NK8 A;  3P8B B;  1FXD A;  1NH7 A;  3B6B A;  2M2B A;  3EZU A;  3VF0 B;  1S1T A;  2H65 B;  3BKU A;  1Q81 T;  3K8W A;  2ZWP A;  2QE5 A;  1IUJ A;  5HP1 B;  1RAF B;  1TR0 A;  4A8K A;  2GS8 A;  3CTR A;  1I5O B;  3OL7 A;  4A8Q A;  2MTL A;  1RT7 B;  1NPP A;  2KN4 A;  4PG5 A;  2V8H A;  1OY6 A;  2AX0 A;  4RO0 A;  1FWL A;  2DNL A;  2IM1 A;  4WP3 A;  3EUN A;  1OPI A;  2QMU B;  5KT2 A;  2GMJ A;  3LQV A;  5HP1 A;  4OX7 A;  1DY3 A;  5B0B A;  3VTI A;  2QV6 A;  4ED6 A;  1HQE B;  1SKS A;  1B3T A;  4W4M A;  3GCW P;  1RT7 A;  3I0S B;  2CNK B;  5H9E J;  4LF8 J;  1PIE A;  4C0H A;  1DTT A;  1KS2 A;  5F8I A;  2VQF J;  3G86 A;  2AYM A;  3MR3 A;  3QWU A;  4C8K A;  4RW7 B;  3O5T B;  3K5O A;  1O5J A;  2R2R A;  3BYR A;  3ZTP A;  2AJQ A;  3VAI A;  3R97 A;  2B7C B;  5EDW A;  2K3I A;  1HQE A;  1U26 A;  3I0S A;  3TA0 A;  1VQ4 S;  2HMI B;  4LBI A;  4IYQ A;  1NSK L;  2ASL A;  4RW7 A;  2XI3 A;  1OPZ A;  2C2O B;  2KT3 A;  1JJC B;  1Y3J A;  4HTI A;  1Y7P A;  3OD2 A;  2QL5 B;  4LSZ B;  2OPP B;  3HSJ A;  3D4J A;  1C4A A;  1U47 A;  1RBA A;  3KHH A;  3UR0 A;  1N34 J;  3MAQ A;  2HMI A;  2HPU A;  3I0R B;  1EET B;  1R0A A;  3OUY B;  1KD1 T;  3TJ8 A;  4N47 A;  5E3C A;  4O3N A;  2XO6 A;  4B3S F;  2ZOG A;  4OX8 A;  3P3D A;  4YME A;  2OPP A;  1R8B A;  3MPD A;  5DQH A;  3MEK A;  2GQ2 A;  1N36 F;  2AJ1 A;  4CLU A;  2HHH F;  3I0R A;  4FS2 A;  4I6A A;  1EET A;  4M5M A;  3SDE B;  3OUY A;  2FC9 A;  3BKT A;  4NRT A;  4ZPT R;  1VIX A;  3NAI A;  4R5P B;  1RKJ A;  2HS4 A;  1ELO A;  2HHQ A;  4USU A;  2DCL A;  4OIX A;  2J7U A;  4B3T J;  4CO1 A;  4NXM J;  3SDE A;  2BE2 A;  2EPI A;  2VDI A;  4MKV A;  4K2J A;  2RHQ B;  5JMN A;  4Q45 A;  2XMT A;  2B0G A;  2R7R A;  4R5P A;  1S77 D;  3BQ1 A;  4EU0 A;  1BQN B;  1VOM A;  5LMN J;  2E5L J;  3BGO P;  4AT1 B;  4DL7 A;  1H7X A;  3PRB A;  3F44 A;  2JVO A;  1Q8B A;  4F25 A;  2LXF A;  3TUP A;  4UOG A;  3QWP A;  2QL7 B;  3NKY A;  2B9E A;  5HJY A;  3L95 X;  2MY8 A;  3DMJ B;  3P96 A;  4EBC A;  2OO4 A;  1BQN A;  4P6Q A;  4KBI A;  2HBR B;  3EPG A;  1PGZ A;  1D1U A;  2ZDP A;  2GVD B;  1MWY A;  1X0F A;  5DDQ C;  1OSC A;  4NLP A;  3R7N B;  4F4Y A;  2PN6 A;  2HHV A;  2NPF A;  5B0E A;  3GV5 B;  1X4F A;  2A6O A;  4CLK A;  2CNL B;  3DMJ A;  4OJH A;  5C2G A;  4CP5 A;  1UP1 A;  3CDU A;  2VG7 A;  4NCG A;  1QVF R;  2XMJ A;  2GVD A;  1N32 J;  2HK3 A;  3GMG A;  2WVB A;  2X1F A;  1S6P A;  1ZYQ A;  5F8L A;  4B08 A;  5B0C A;  3TX0 A;  1LV5 A;  3VQT A;  2MQO A;  3ZXW A;  3KLH B;  1FDA A;  1Z2Z A;  3AOB A;  1LK7 A;  2O3D A;  1U2C A;  3RAQ A;  2HNY B;  2ERR A;  1KBR A;  5LSO A;  2GJ2 A;  3OV7 A;  1XNQ J;  5GAG I;  4O3S A;  4DV0 J;  4DR5 F;  2KVQ E;  1YG0 A;  2NUH A;  4DR3 F;  5CD4 H;  2OTL S;  3HD2 A;  4U67 Q;  1V3Z A;  2D9O A;  1SXL A;  1XC9 A;  1OIA A;  2DGO A;  4B9L A;  2VD3 A;  4YR2 A;  2GC8 A;  4NA3 A;  4QU6 A;  1YBT A;  1YIJ S;  2AW0 A;  2UXD J;  2V4Q A;  5D0H A;  5ETR A;  5F41 A;  4P2S A;  1JB0 C;  1EJ7 L;  4C8M A;  2ZH7 A;  3AB2 B;  4ZP9 A;  4CQ1 A;  4OI3 A;  4WKY A;  3T3F A;  2PDA A;  4DV1 F;  3V4I A;  2H5J B;  3RRK A;  4AE5 A;  2OIH A;  4AL5 A;  4NOH A;  3HPO A;  4M8L A;  2JLG A;  4A8O A;  3VGS A;  1IJF B;  3ZZR A;  4RNN A;  4QIG A;  2G0J A;  5EWE A;  1N88 A;  3OSP A;  3ZZZ A;  4LF9 J;  2KTQ A;  2XUL A;  4K4T A;  1GMU A;  1VS3 A;  2J9E A;  3L7O A;  4M5L A;  4J9K A;  1QDU B;  3K5N A;  1SKW A;  4NXN J;  2ZH3 A;  3F73 A;  3FRZ A;  3R7B B;  4RNF A;  1RWX B;  3PX6 A;  3LGM A;  2YKN B;  2ZH8 A;  2I2Y A;  4RUH A;  1WC4 A;  2KM8 B;  5LSL A;  1GEH A;  3NL0 A;  3CJ5 A;  3C19 A;  2DT9 A;  5AJ3 J;  1ZOT A;  4JI3 F;  2FZC B;  2QLB B;  1KON A;  2YKN A;  5F3Z A;  2JFD A;  1S7I A;  1PAE X;  3D54 A;  2IMW P;  3GG0 A;  3WDO A;  3KWM A;  2KRR A;  2ACY A;  4JI5 J;  5IXU A;  1I94 J;  2V34 A;  3A8I A;  1RWO B;  4NCB A;  1T9X A;  4NA1 A;  4ZVP B;  1FK9 B;  1P27 B;  5I3Q A;  3M8Q B;  2GJF A;  1H74 A;  2CQ4 A;  3AFG A;  2MQP A;  1ZAW A;  4DDF A;  1YBA A;  1NND A;  2R8K A;  2DB1 A;  3CDW A;  1SJQ A;  4F04 B;  1S1W B;  4ZLL A;  5F0W A;  4I56 A;  2ILY A;  4LIW A;  1FKA F;  3J81 j;  1Q16 B;  1ZM4 A;  3DLJ A;  4OYB A;  2WB4 A;  4BDP A;  1S0N A;  3KG4 A;  3HSD A;  3RB0 A;  2PO4 A;  3CCZ A;  3HSZ A;  4RX6 A;  4DUZ J;  3V6D B;  3N5F A;  1O51 A;  3HDS A;  4ZVF A;  1S1W A;  1H2V Z;  3FVY A;  4PUO B;  4X4Q A;  1R27 B;  3GR0 A;  4USJ C;  5CA5 A;  4ZP7 A;  4ECX A;  2CPH A;  4KJI A;  2RU3 A;  4ED5 A;  3RG6 A;  2HWI A;  1U24 A;  1UFW A;  2RU9 A;  2AD9 A;  2KZZ A;  1Q5V A;  4ED7 A;  4PUO A;  3CMQ A;  4DQR A;  5JJB A;  3DLB A;  4NEZ A;  2FGO A;  1EP4 B;  2QYG A;  4ZPA A;  2VBY A;  4MAK A;  5ETN A;  4HVZ A;  3NXZ A;  4IG3 A;  2ZBQ A;  1SKU B;  1RKI A;  5KFG A;  3RB6 A;  3J7Y I;  4J90 A;  5EGY A;  1WTB A;  2L41 A;  2B8P A;  1NJZ A;  4JI7 J;  3OVS A;  4NYO A;  1EP4 A;  2UXC J;  1LWF B;  4Y2K A;  1B70 B;  2K7K A;  2V94 A;  2F8H A;  4NPO A;  3KXD A;  4QPT A;  3H4B A;  2DXD A;  2ZZM A;  1XR7 A;  2YNI B;  3IA0 A;  5THW A;  4M5N A;  4EYI B;  4ZPC A;  3U02 A;  4NL5 A;  3I96 A;  4K4S A;  2NPI A;  1BLU A;  5IFM A;  1NXI A;  1LWF A;  4WKR A;  4WFA Q;  3RTV A;  2VV5 A;  3MEC B;  2EFG A;  3C8Y A;  2IHR 1;  2CKW A;  1JLB B;  4FYW B;  4DV4 J;  2YNI A;  1I51 B;  1C4C A;  5DM6 Q;  3X3U A;  1PIL A;  1HIY A;  4DJB A;  1QAJ A;  1KR4 A;  2ABY A;  2QN6 B;  3CCW A;  4GKJ J;  4K0K J;  1L3U A;  2XB2 D;  1R3N A;  2QC3 A;  1ZBT A;  2RVJ A;  3MEC A;  3K59 A;  4IKA A;  1RTH B;  1JLB A;  2QLJ B;  3SXL A;  1FRH A;  1NK7 A;  4DSF A;  1X8D A;  4U7C A;  1K1S A;  2BV3 A;  5HAT A;  3THV A;  3S7R A;  3KDO A;  2CVE A;  2ZBP A;  4IQX A;  1RTH A;  2CPX A;  2AJ4 A;  1W2B R;  4JI1 F;  2MQQ A;  2H51 B;  2CAJ A;  4K4Z A;  5IT0 A;  4O44 B;  3PKM A;  4DPT A;  2KI2 A;  5KFW A;  5EWG A;  3P5T L;  3Q8P B;  3U27 A;  3IC1 A;  2V5H G;  3JQJ A;  2R3V A;  4TU9 A;  4M5D B;  3FEY B;  3PYD A;  1LK5 A;  4DR7 F;  4LF2 A;  4O44 A;  4PAB A;  4X64 F;  2EI5 A;  5KFB A;  3GJS B;  5EX3 A;  3CXC R;  3IBC B;  4LR7 A;  3WIU A;  2HVH A;  4NLU A;  4L3N A;  9RUB A;  2PMH A;  4M5D A;  1RTZ A;  3JSB A;  4JI0 J;  3KKF A;  2MJN A;  4DI6 A;  1M5S A;  2IBO A;  1FWK A;  2QMW A;  3D6F B;  4B3R J;  2CAD A;  4XAK A;  4DHV A;  4FNI A;  3CCR S;  1HLW A;  3C3L A;  2GAG C;  2IVY A;  3BN7 A;  4FS1 A;  4I67 A;  4MIB A;  4AQY J;  3NMA A;  4K4U A;  4XDD A;  3JQK A;  2C2N A;  1HR0 F;  2B6A B;  1SH2 A;  3IRW P;  3FEZ A;  5KOX A;  1W25 A;  1K47 A;  3RAX A;  4ZVT B;  4JBC A;  1VK8 A;  2IAJ B;  2CQ3 A;  1VBZ A;  4QR2 A;  3V81 A;  5ETV A;  1HL6 A;  9ATC B;  2ALY B;  3PR5 B;  3BR9 A;  1RDR A;  1UZH A;  5AXM A;  2B6A A;  2HFZ A;  3MPU B;  4QWA A;  3W65 A;  2DH8 A;  3C6T B;  2M5Y A;  2OEM A;  4ID5 B;  2IAJ A;  2OFG X;  2O67 A;  2J7W A;  1W7W A;  2P2C B;  3L3C A;  1YJ7 A;  3M6W A;  1KEK A;  3IGN A;  3RZA A;  2RHS B;  2XMA A;  1X5S A;  4CLZ A;  2DY1 A;  4DF8 A;  2UUA J;  4HEA 9;  4I2P B;  3CCE S;  1EKS A;  3W7B A;  3BGF A;  3C6T A;  3G82 B;  5LL6 d;  1VJW A;  4DR1 F;  4ID5 A;  4ZP8 A;  4CLL A;  3VZH A;  2EKY A;  1P1L A;  2VG5 B;  3W2W B;  1OO0 B;  3DOL B;  1FX2 A;  1CG2 A;  1X4E A;  4DN0 A;  5IT9 U;  4NA2 A;  4I2P A;  2LQ8 A;  2FVQ A;  2BM0 A;  2E5H A;  1CBK A;  2ACM A;  3G82 A;  5LMU J;  1PKU A;  4H54 A;  2YWK A;  2FJE B;  2OH2 A;  3UDL A;  1WF2 A;  1HWK A;  2D7S A;  1HD1 A;  3RGI A;  2XHW A;  5D15 A;  2HYI B;  2VG5 A;  4USK A;  1S0M A;  3W2W A;  2RQC A;  2JZ5 A;  4JI6 F;  4F8R A;  3DOL A;  2X3D A;  2CJB A;  4MYU A;  4PXD A;  1RI7 A;  3L09 A;  3H42 A;  2JL9 A;  1NB7 A;  3S01 A;  4C8Z A;  4RL1 A;  5I42 A;  3D9B A;  2FVS A;  2BE9 B;  3DHW C;  1VI7 A;  4LSN B;  3RRG A;  2RD5 C;  2IVF B;  2GIF A;  2HWH A;  3TEG A;  4JOU A;  4IFV A;  2GVZ B;  4GKK J;  2HZC A;  5C5J A;  3HHK A;  2HFU A;  1YDL A;  3GWC A;  1HI8 A;  3WX4 A;  3H0P A;  1FKO B;  3R5C A;  2OFH X;  3K5P A;  3R8Y A;  4LSN A;  3I55 S;  1Z1Z A;  4ZCM A;  3IBW A;  2VAS A;  5GAG U;  4MIA A;  2FUG 9;  2DVI A;  4QIW D;  5L1L A;  1NK4 A;  2GVZ A;  3A3P B;  3EYZ A;  3LH2 S;  3NGR A;  5GMD A;  1TKX B;  1LW2 A;  4EUV A;  2ZZN A;  2L08 A;  1TKD A;  4ECU A;  1LXN A;  3FBE A;  4UT4 A;  1V3R A;  4DUY J;  4M5J A;  4Q44 A;  1S48 A;  3QRQ A;  3GQC A;  3VGU A;  1RA6 A;  4CNY A;  1RZM A;  4ER8 A;  4H4M B;  1S99 A;  2Q3P A;  4X84 A;  5A2Q U;  2Y3Y A;  1TKX A;  3MM7 B;  3POT B;  3X1L B;  3HLU A;  3W9J A;  1Y11 A;  2NSB A;  3KMS A;  2I5J B;  5AXK A;  2RT3 A;  2RDI A;  3MCS A;  1WF0 A;  3MUV P;  4DSJ A;  5T14 A;  4FPI A;  3EZO A;  2MKI A;  2HQC A;  3WHI A;  2NLW A;  4H4M A;  3G6E S;  1RWM B;  3SV4 A;  3RRH A;  1AA1 B;  4USH A;  3LPY A;  2C3P A;  3POT A;  2UU9 F;  1FWP A;  5I3P A;  4RPF A;  2I5J A;  3M9O B;  2DRA A;  3P45 B;  4QR0 A;  1GK8 A;  4NLT A;  4LRA A;  5FLX U;  3PW7 A;  1RT3 B;  4ECV A;  2AGQ A;  3EVO A;  3ETO A;  3US5 A;  1HNZ F;  3NWG A;  1VR6 A;  4S0M A;  2VC0 A;  4K5S A;  4JV5 J;  3TUI C;  3JYT B;  2YNF B;  4DFP A;  1Q8I A;  1T05 B;  2Z2Z A;  4CT8 A;  2I6W A;  5L1K A;  1HBN B;  3DYA B;  1BQM B;  1RT3 A;  1FO1 A;  2OEL A;  3NNC A;  2VOD A;  4NLV A;  2C3U A;  2IBK A;  4EYH B;  2MMY A;  2D3U A;  1U1R A;  4LFB F;  3JYT A;  2HBQ B;  2YNF A;  4QBU A;  1R8H A;  2B4O A;  4OZ5 A;  4WBF A;  3TNV A;  1HBN A;  2CUY A;  2HNZ B;  5KG4 A;  1TL4 A;  3SZ2 A;  3DYA A;  1BQM A;  2YWH A;  3ZNU A;  1ZAX A;  2AYB A;  1WNE A;  3O44 A;  3N28 A;  3TWZ A;  2DR5 A;  3CJS A;  1JLC B;  3SEO A;  1QM9 A;  4YDD B;  4CZC A;  5C24 B;  2XEX A;  3GSD A;  2OPR B;  2HNZ A;  1KOO A;  4M5I A;  4LF8 F;  1TL1 B;  3T1H J;  2V8P A;  1M5K C;  1H7W A;  3BS9 A;  1ARO P;  1HNI A;  2DNQ A;  4UOC A;  1RT5 B;  1JLC A;  1J5E J;  2BJ1 A;  1TFY A;  4DPX A;  3K7R A;  4BBY A;  2DNY A;  2BMB A;  5C24 A;  1HAR A;  3O8W A;  2OPR A;  3DU6 A;  2AEF A;  1KWM A;  1J2V A;  1KFS A;  3AJ2 A;  1RAB B;  1SJR A;  3C16 B;  1TL1 A;  3RB4 A;  3RU0 A;  2N3L A;  3TZW A;  2ZFH A;  2Z56 B;  3GP9 A;  3QIP B;  3GTY X;  1LFP A;  1RT5 A;  1GQE A;  3Q24 A;  5HVG A;  1DBD A;  3FMB A;  2ZH4 A;  3FMW A;  3TP2 A;  2WBM A;  3OBI A;  1WG1 A;  4YEA A;  2VKR A;  3D0H E;  1U4B A;  3ENW A;  2AKW B;  3FBF A;  4HI2 A;  4DX7 A;  5DET A;  3C16 A;  1N34 F;  3D6H B;  2FGC A;  1ZTW A;  5L1J A;  2D3O R;  3D67 A;  1NH8 A;  2ZE2 B;  4CLW A;  3QIP A;  1SIW B;  5HO4 A;  3TAQ A;  4F36 A;  4DQQ A;  1QAY A;  1WUU A;  1EQM A;  2LP4 A;  5L39 A;  1QJH A;  2UUW A;  5AXL A;  1EQ0 A;  1P1T A;  4ZPW R;  4PWD A;  1AFI A;  2HWT A;  1NDC A;  2QFJ A;  1DTQ B;  2HQF A;  1ZAV A;  3Q2S C;  3PEH A;  1SUQ B;  4F67 A;  2E9T A;  2F7V A;  1SC1 B;  3GV7 B;  5CQG A;  5HVF A;  1O6X A;  3J7Y U;  2MSS A;  3AOC A;  2WZ1 A;  1JLF B;  4KKO B;  3Q0A A;  2P6S A;  2V67 A;  5D0E A;  3V6H A;  2QLX A;  2Z4P A;  4ZVR B;  1VIO A;  4ILM A;  4B3T F;  1HQU A;  4NXM F;  3HFV A;  1U45 A;  4Z2X A;  1DTQ A;  4WTY A;  1SUQ A;  4IUF A;  1NKC A;  3OXL A;  2ZKU A;  2Z2M A;  3VAF A;  2VON A;  1JLF A;  2OAU A;  5KT6 A;  4KKO A;  3WC2 A;  5IS2 A;  3EZ5 A;  4UST A;  4J9N A;  4XPC A;  4HHH A;  5LMN F;  1R31 A;  2E5L F;  2NS1 B;  4ENO A;  1RHQ B;  2Y0S D;  5IM0 B;  4ZVS B;  1CQM A;  3HD1 A;  3L7P A;  5K8P A;  1JIH A;  4MKA A;  4N5S A;  3BH7 B;  5E0O A;  1VMB A;  3FQK A;  2V9W A;  1D9F A;  5ETQ A;  4DR2 J;  4YR0 A;  2ZZT A;  4GC7 A;  3KLG B;  1HBU B;  1JLE A;  2PEB A;  3FSX A;  2W2Q P;  3UDC A;  4I6Y A;  3I32 A;  2CG4 A;  2AMC B;  4A8S A;  1F2H A;  2K7J A;  3G8Q A;  5IC6 B;  4B3M J;  1S9F A;  3UVJ B;  1NJI T;  1UA1 A;  3AAW B;  1CSJ A;  4X4R A;  3V5R A;  3OPK A;  3H8Y A;  4DPU A;  3KLG A;  1VQP S;  2XGQ A;  1XN9 A;  3N5B A;  5CHC B;  5ETP A;  1N32 F;  4P52 A;  2HIY A;  3ZFV A;  2YKO A;  4LF5 F;  2G0I A;  2VPX B;  3UVJ A;  2ATL A;  1KKH A;  3GIR A;  5A8R B;  3BPS P;  2VOO A;  2FLP A;  2PFD A;  3LAK A;  1SH0 A;  3LO3 A;  3PIO Q;  5HI7 A;  3OTC A;  4WFZ A;  1CLF A;  2WAQ D;  5MAO A;  4DV0 F;  5DDO C;  1IBL F;  3B54 A;  3VWS A;  3GU0 A;  4P74 A;  2DR8 A;  2CPY A;  5A8R A;  4P9S A;  1S76 D;  3KLV A;  3PRV A;  5HL7 Q;  1X60 A;  4KAI A;  1F3V A;  2YWG A;  4U96 A;  5HSP A;  3MM9 B;  1VLO A;  3M2R A;  1IBK J;  2BAB A;  2UXD F;  3L9Z A;  5EX0 A;  2K1R A;  4CCH A;  3CUL A;  3IWN C;  4ID8 A;  4FYV B;  2XZD B;  3TOQ A;  4Q8F A;  2KHD A;  3DKD A;  8AT1 B;  3U7J A;  2HQI A;  3BJY A;  4DV6 J;  3C2P A;  5DZ6 A;  5E41 A;  1FXL A;  3M32 B;  1HYS B;  5KFT A;  3OTO J;  3W1Y C;  4DUT A;  2DNM A;  5KFF A;  2N7C A;  1U1P A;  3MXH P;  4ANE A;  3TAP A;  4IH5 A;  2CQI A;  4DU7 A;  4QQB A;  2J6S A;  4LF9 F;  1ZA2 B;  4UOF A;  1N6Q A;  1RAD B;  1IKW B;  3LWM A;  4DFK A;  1U1O A;  1ZPV A;  1L3K A;  5D4L A;  1XNR F;  3M32 A;  4LJM A;  2XI2 A;  1TQL A;  1WSR A;  1HYS A;  4NXN F;  2DNO A;  3BSC A;  2MDA A;  1KVJ A;  3EJM A;  2QLF B;  2J76 E;  2B5J A;  1GX5 A;  2R7U A;  4G3I A;  3NWR A;  2AJ2 A;  4U6P A;  2DRD A;  3Q8S B;  4OZ0 A;  4XTT A;  1S72 S;  4UF4 A;  1KSP A;  1WG5 A;  1IKW A;  2OMO A;  3A8K A;  1ZA1 B;  2B7B B;  3DRS B;  3ILJ A;  4TU7 A;  4CO3 A;  5AJ3 F;  4MJK A;  3FC9 A;  2GNK A;  5JUM A;  3MF5 A;  3PG9 A;  4DV5 J;  1ZM9 A;  1RTD B;  2HAI A;  3RBE A;  2VG6 B;  2DNK A;  1U1N A;  3MM6 B;  1SBR A;  4Y2A A;  3HJV A;  4JI5 F;  3DRS A;  1I94 F;  4OYO A;  5JVH Q;  3QO9 B;  4FVC A;  3D0I E;  4KGZ B;  3DXS X;  2CQ1 A;  2GQC A;  1VQ7 S;  2QL9 B;  3HCX A;  1RTD A;  2WK4 A;  2CJ9 A;  2LQB A;  3R9L A;  3MOZ A;  3C15 B;  2ROE A;  1HKA A;  1AUS L;  3SCK E;  1SH3 A;  1JNZ B;  1WHW A;  5KTQ A;  3DNC A;  1QSL A;  4R0J A;  3THT A;  3QO9 A;  3CCJ S;  2J0S D;  2Y1L B;  3V6J A;  2V2V A;  3BR8 A;  3VAH A;  1JKH B; 
#chains in the Genus database with same CATH homology
 4M5I A;  2CG8 A;  2BMB A;  3HSZ A;  1KBR A;  3KUH A;  1EX8 A;  4M5J A;  3KUG A;  1CBK A;  3HT0 A;  3HD1 A;  1TMM A;  3ILO A;  3MCN A;  4PZV A;  1TMJ A;  5ETK A;  4CRJ A;  1IM6 A;  3UDV A;  5ETS A;  1RU1 A;  3UD5 A;  4M5H A;  4CYU A;  1RTZ A;  3HSJ A;  4M5G A;  3HCX A;  3QBC A;  4M5K A;  5ETN A;  4M5M A;  1RAO A;  3MCM A;  1RU2 A;  3ILI A;  4M5N A;  5ETM A;  3HD2 A;  4M5L A;  1DY3 A;  2F63 A;  5ETL A;  1F9H A;  1HQ2 A;  5ETT A;  5ETV A;  1Q0N A;  5ETP A;  4CYU B;  1EQM A;  3IP0 A;  3ILJ A;  5ETQ A;  3MCO A;  1G4C A;  2F65 A;  4AD6 A;  3HSD A;  3KUE A;  1EQ0 A;  5ETO A;  4F7V A;  4CWB A;  3ILL A;  3UDE A;  1HKA A;  1RB0 A;  2QX0 A;  5ETR A;  3HSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...