2ZUAA

Crystal structure of nucleoside diphosphate kinase from haloarcula quadrata
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
153
Chain Sequence
SEHERTFVMVKPDGVQRGLIGDIVSRFEDRGLKMVGGKFMQIDQELAEEHYGEHEDKPFFDGLVDFITSGPVFAMVWEGQDATRQVRTMMGETDPAESAPGTIRGDYGLDLGRNVIHGSDHEDEGANEREIELFFDEDELVDWDQIDSSWLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of distinct salt-dependent enzyme activity of two halophilic nucleoside diphosphate kinases
pubmed doi rcsb
source organism Haloarcula quadrata
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 43
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2zuaA00
2CWKA 1K44A 3Q86A 1WKKA 4UOFA 4FKXA 2AZ1A 2DXFA 3Q8UA 3R9LA 3FCWA 2DXEA 3L7UA 1VYAA 3VGVA 3BBFA 1NDKA 3PRVA 4UOGA 3NGRA 3GPAA 3VVTA 2HVDA 1NSQA 1HLWA 3GP9A 4DUTA 5C7PA 1XIQA 1WKJA 1U8WA 4DI6A 3DDIA 3Q83A 3PJ9A 1NDPA 3ENAA 3Q8VA 4ENOA 3NGSA 3B6BA 1S57A 2AZ3A 5IOLA 3Q8YA 3EVMA 2VU5A 1NHKL 1JXVA 4UOHA 1WKLA 3VGSA 4C6AA 3DKDA 3EVWA 2NCKL 4ANCA 3EMTA 1F6TA 3ELHA 2DYAA 1MN9A 3G2XA 4KPCA 1KDNA 1NDCA 3ZTQA 1NUEA 3ZTSA 4EK2A 4FKYA 4CP5A 4HR2A 1PAEX 3NGUA 3FCVA 1LEOA 3BH7B 3EM1A 1NCLA 3ZTPA 1UCNA 1B4SA 2BEFA 3Q89A 4S0MA 4ANEA 1NLKL 3EE3A 1W7WA 3BBCA 4WBFA 1BUXA 2BX6A 2HURA 1BE4A 3EVOA 3FBEA 3EICA 1S5ZA 1S59A 3FBFA 1MN7A 1F3FA 5BXIA 1NPKA 1NSKL 1LWXA 3ETMA 1XQIA 4O0NA 1HIYA 3BBBA 3B54A 2B8PA 2DY9A 3FBBA 1NB2A 4ANDA 1BHNA 3VGUA 4W98A 1HHQA 2DXDA 3BH6B 4F4AA 3WX8A 5CAAA 4DZ6A 3VGTA 1ZS6A 1NSPA 1EHWA 1PKUA 2HVEA 3EJMA 3JS9A 2B8QA 1NDLA 5CABA 3ZTOA 3MPDA 3FC9A 3ZTRA 4F36A 2ZUAA 3VVUA 3NGTA 3FKBA 1B99A 3FBCA
chains in the Genus database with same CATH superfamily
2EPIA 2HPUA 4CH0S 2LDYA 4A48A 1HWKA 3GU0A 4J37A 4FBTA 1TFWA 2GHPA 1RU2A 3D66A 4RW9B 3QIPA 5B7WA 4RWWA 5F8IA 2FQQB 2MKHA 3GFZA 3ET6A 4X84A 2UVWA 2ZITA 3R9LA 5KFMA 3DM2A 4ZVGA 2B6AA 1JKHB 1DLOA 2HNZA 2R4FA 1WACA 4FVMA 2EVZA 2Z2ZA 2W4DA 5EUHA 4UT4A 3OLAA 4USHA 4KT0C 3OR2B 1FD2A 5HP1B 1HARA 3GP9A 1W2IA 2YNHA 2KG0A 1YJTA 2XLKA 3BKUA 3QT6A 4J90A 3MPWA 4DOZA 4PXDA 1NXIA 2IYIA 4JV5F 4FP9A 3RR7A 3NGDA 4XDCA 4LFCF 2XMTA 3KHGA 5L1KA 2NZCA 3CCWA 3CCZA 4OYIA 3M6WA 1H7WA 2GQCA 3IS9B 4DEZA 1YZ7A 4Z2XA 2KM8B 3V4IB 4FDFA 2RMLA 1K1QA 2CPDA 2FJXA 3A1YG 2C2KB 1EP4B 1OO0B 1FKOA 4MFBA 1XK8A 3MEGA 3MM9A 5A0YB 1JXVA 1Q53A 3DKDA 2GFFA 5AT1B 3I4PA 3OR1B 1DBDA 2CDQA 2KHDA 3KJQB 1H3DA 1V5VA 2P9GA 1T9UA 4KHMA 3T5HA 2W7AA 4UQTA 4XTTA 3SSSA 2ZC4A 4ZPWR 1R6YA 2HS3A 2MMYA 3AA9A 2ZOFA 4WK3A 2OD4A 3C15A 4Y28C 1NK5A 1C0UB 2YKMB 3QO9B 1QM9A 4DSFA 2IRUA 3TZWA 2GQQA 3W7BA 4RNNA 1TL3B 3EZUA 1V3ZA 4TYBA 3OTDA 4WFYA 3OJSA 3K5MA 2LKZA 1EQ0A 1PYSB 2BV3A 3LP0A 1TL3A 1U26A 3C15B 2LXUA 2MQMA 3D6HB 1QE1B 2V4QA 3TARA 2EFPA 3PRDA 1JIHA 1SB6A 1SCJB 2HZCA 3DLKA 2ZVIA 3N5BA 4GVBA 2XLJA 3DLGB 4KO0B 2I38A 3OR1A 1F1BB 4DR7F 2C3OA 3RB4A 1VBYA 2A0FB 1TFYA 3B78A 2BANB 2H4WB 2C3YA 3R5CA 4MFBB 4NYPA 3FDSA 2KXNB 4MJKA 1F3FA 4GMKA 3H5XA 1N5TA 1N34F 3L9ZA 1B7FA 3M2UA 2VBXA 4F2SA 1RSCA 1CBKA 1X4EA 4WIQA 3D6TB 2AEFA 2YPYA 2ACYA 3PZPA 2KZMA 2W24A 4ZK7M 3BBBA 2GC8A 3E2EA 2BE7D 2HFSA 3BSOA 1YKWA 2NXJA 1UWAA 1YSJA 2ROEA 2J0XA 1JLFA 1RCOB 4P2XA 4A8OA 2UXCF 4C0OC 3SQGA 4ZVRB 4ED4A 3HSZA 1XWLA 2QMXA 4DV3J 1D9FA 3M8QB 5IT9U 3FFIA 4DR3J 4DQSA 3MR2A 2ZH9A 2UXBJ 1NO8A 4DZ6A 2BM0A 1G1XA 5H9EJ 2FYXA 1RT4B 3G4SS 1ZAXA 1RWUA 2BJ1A 1FESA 1QY7A 1KQGB 5K14A 3KYLA 2V9WA 3IRXA 2QYGA 2I5JB 3GJRB 3KHLA 3T6BA 3T19A 3CC2S 2HWHA 4PPZA 2WSEC 4ZP9A 3RYLA 2UXCJ 1FKPB 3M6XA 5F9NA 2HRYA 5IC6B 1TUVA 2A18A 2LQ9A 1S9EA 2WW8A 3HHLD 4DV7J 1JNRB 1YJVA 2XMMA 4ILRA 4PABA 4DDFA 5GMKa 4FBUA 2HS0A 2HQIA 3JYTA 2CQHA 1KFDA 1RJJA 3M05A 4RLEA 1RAFB 1JLGA 4R5PB 5CH7B 2BA9A 2B7BB 5HO4A 1H7XA 1LV5A 4Y00A 3SZ2A 1VBXA 1NJIT 4UOGA 4GVLA 4RUHA 3KMSA 4QBUA 1X60A 1F5AA 1RTJB 4WIIA 2XHWA 2V0NA 2W2OP 4RUAA 4KGMA 1SBRA 1UL3A 2VFSA 3MAAA 3U27A 4DX7A 4DG1A 2ADBA 4WF9Q 4ZVQB 1GNKA 4IO1A 4MIWA 1RTDA 3DDIA 2GCFA 2K3IA 2E9RX 4LSNA 5J2MA 1WDDA 1KKHA 1IBKF 3ILLA 1DLOB 1UZDA 3IP0A 3FRZA 2ZJPQ 2OFGX 1RISA 3RB0A 4E98A 4DV0F 3QAEA 4B3OA 3H0PA 2HSEB 3H5SA 1YBUA 4OQJA 4TY8A 2QL7B 1NJWA 2A2CA 3SIPB 1S6QB 2EKNA 3G6ES 1RE1B 1HFEL 1FWKA 1QDUB 2GMLA 3PYDA 1UFWA 3Q8RB 3PY8A 2HYIB 1FXLA 3S7RA 4QJVA 3QWUA 1N34J 5DG8A 2ZH3A 1YVFA 4X62J 1Q0NA 3MMCA 3J7Z5 3DRYA 3QGIA 1S48A 4RO0A 3C19A 4BBYA 2MSSA 3QJPA 3R97A 2G13A 1T03B 1N6QA 2AMCB 2OD6A 4ZCLA 1LEOA 2ROPA 3MM6B 3EM1A 1NCLA 2ZE2A 3GLJA 4K0KJ 2W8LA 2OGUA 4FN5A 4Q8FA 5KG4A 4X64J 4CNZA 1PAUB 1DTTA 1WD6A 4DL3A 2J6TA 1F2GA 1VDHA 1U49A 4O3PA 4JI7J 1NLKL 4Q2LA 1TAQA 1A0OB 2PMHA 3H59A 3OTBA 2AYGA 4MKVA 1GMUA 4ELVA 4F2RA 2R7QA 3P3DA 3TVKA 4Q45A 2CNOB 2JFKA 1RA7A 3AXKA 4USMA 3C14B 5EWGA 3RTVA 3MECA 2BBEA 3L7PA 2KB2A 4ZA1A 5M2UA 3HK2A 3X1LB 1G2EA 3OFFA 1HNVA 4PG4A 3UE2A 3BQ2A 1B7YB 1IKYA 3MGJA 1Y7PA 3W8GA 1D8ZA 3DU6A 3MF5A 4JI0F 3P6YC 3NWRA 5CHCB 3T9NA 1GT8A 2FJAB 1GTEA 2ZOMA 4LRFA 1RZMA 3AA8A 4OI3A 4RWXA 1S1VB 4LREA 1REGX 4C0HA 3M9OB 3J7A1 5LOQA 1X7VA 1T02A 4IDKB 4ES2A 5DQHA 4M95A 4DV0J 3PX6A 4ZPCA 5ETTA 3QFHA 1LOUA 2QRRA 1EETB 1TL7A 4FNIA 2NLWA 1K0TA 1UJ4A 4NCAA 2GIRA 3LF0A 1H38A 2HW3A 4J9PA 4QYZJ 1LXJA 4M5DA 1X5TA 4ZVFA 4CYUA 4EBDA 2W4PA 2PGCA 2VC1A 2DNHA 1ZETA 2RAQA 2UV8A 4FNHA 3RR8A 3CD6S 2W2QP 2ZDOA 3L4BC 1P27B 1TKZB 3GJQB 1U6FA 4NLDA 5HMYA 2RVJA 3CCJS 1PJ7A 2Q3PA 2YKPA 2HFNA 3AB4B 3M7VA 5C2CA 2CUYA 3M8YA 4RW6A 4JI6F 3IWNC 3V4IA 3K5NA 4JI2J 1PKUA 4UY85 2DY1A 5CCMA 4KTQA 4UZBA 1MSWD 1TQLA 2BJ3A 2QA1A 1FO1A 2RJZA 3G8QA 3J81j 1YBTA 3ZTRA 2UUCJ 2BYCA 2ZUAA 3NRBA 4DR5J 2ZJRQ 1NKBA 4USWA 2YQ3A 5CYMA 3OUYA 2IVFB 4IFVB 3VR1A 1CJKA 4ETXA 2K2PA 1HBOA 3ITHA 4WWSA 1S1UA 1DAXA 1HBOB 4DG1B 4B9VA 4OHZA 5CYMB 3OUYB 1GK8A 3ISNC 3NXZA 2A10A 2DD8S 3QBCA 4FKXA 4FYWB 3ZO7A 3OVBA 3D5MA 3ZZ0A 4HTJA 2XS7A 3LP0B 2WVCA 3PEHA 2XM3A 1CQNA 4P74A 5FDLB 3QGGA 5F8NA 1RWXB 1C4AA 2CQGA 1UW9A 4QIVA 4Y6IA 4DL0C 4JYAF 3VGVA 1EAYC 3SYZA 4DF8A 2YKQA 1FXRA 4WFXA 3I31A 4ZHRA 4JI3F 1HNWJ 4PWDA 1G4CA 2HQDA 2IYGA 1UKUA 1YJ9S 4OZ5A 4QIFA 4K50A 3F56A 4B02A 2DR6A 2HHXA 3P8BB 1NRKA 3IBCB 3SDEA 2IIHA 4AQYJ 3GYGA 3OW2R 4PPDA 1Y3KA 4DMZA 4OL8A 2I5JA 2CJXB 4ZHRB 2IDEA 2H4YB 5E5NA 4PWDB 2C2DA 3UVJA 1CJVB 5DDPC 3VZIA 5I3UA 4TYAA 1HNWF 2AZ3A 1FRJA 4ELTA 3TA1A 1IJFB 2A3JA 1FFGB 2MZRA 3A8IA 4NLXA 4OZLA 3GQCA 2WOMA 3VAGA 3J80Y 1FWPA 3HT0A 3PXGa 3SQGB 2WTFA 1VRUA 4X4SA 1YJRA 4QQBA 4WKYA 4JI0J 1PC4A 4OIXA 2WVBA 3C16B 2YNGA 4YEAA 4TQRA 2KZZA 4AUKA 3BN7A 2W2NP 2OSQA 3QIDA 1N54B 1FNMA 4E8UA 2OUGA 3GV5B 4QYRA 4CCHA 3DRPB 2RQCA 1N36F 2DNOA 1SVDA 1Y3JA 3MM9B 5J2QB 2CZ9A 3NNHA 2IY5B 3HKWA 3AB2B 1CC7A 3IBWA 2CJYB 2MQNA 1U8SA 1WF2A 3M8WA 4P7TA 4TKTA 2BEFA 2C22A 2ZDPA 5HQ8A 1RT3A 3NS6A 3DHWC 4PZVA 3ZZUA 3RB3A 2Y1RI 3QIPB 4FPIA 1S99A 4KGKA 1RBAA 1DY3A 1HHSA 1T03A 4MMOA 2R7SA 4LF4F 1GMWA 4C11B 1C1CA 5D4NA 1EETA 1TL7B 7FDRA 3MUTP 2FVQA 2G4BA 2YH1A 4CT9A 1FRKA 2RH3A 1RHJB 3R3TA 3VQSA 2AGOA 1ZM9A 3W60A 4CNYA 3CCES 3CCSS 3T41A 3CF5Q 3RBEA 3FBFA 4BCAA 1S77D 1NHVA 4FXDA 3HD1A 2EK6A 1KS2A 2E1CA 4LF7J 3D3CJ 2O5DA 2Q43A 1TV6B 4ZVPB 4G1QA 2XWXA 3Q2SC 3V4MA 3NS7B 4Y3CA 3W5XA 1U0HB 1N0UA 3PX0A 1F60B 2A2DA 2BKNA 2EW9A 3SQOP 3I56S 2N3OA 1XNQF 3ZZRA 4DX8H 4ANDA 3VAJA 1N56A 2LDIA 1YJWS 2X3DA 3QQCD 3PIOQ 2LA4A 3MM8B 3KUHA 5IXUA 4KH0B 3TANA 2E1AA 2HRUA 2IHR1 2PEHA 5KFEA 2DRBA 1R8BA 2HEKA 4NLRA 1RGVA 4B3MJ 3MOJB 4ZPVR 3KOAA 3VAHA 2AX1A 5DLFA 1LQ9A 3SV3A 3R27A 2VKZG 1Q7LB 3GSIA 4F0KA 3CWJA 4OV6A 1P9QC 1IN0A 2YX1A 5F41A 4OYZA 4WYWA 2VFTA 5AE1A 2FLOA 3U1NA 1ZPVA 4QYZK 4PG7A 4LVOP 2EG1A 1QVGR 4USVA 2HFZA 5KFLA 2YWHA 4LIWA 3VQTA 5KG7A 2ZH7A 2PO4A 2J9CA 5KFJA 2D3OR 3MOZA 2H1YA 3MEDB 1N6QB 3T1HJ 2VFVA 4DWIA 2LU2A 5AXMA 4CO0A 4GKKF 2FC9A 3W9JA 4CIOA 2IAJA 5KAKA 2R2UA 3GJTB 3UCZP 3R7SB 2VASA 3FGVA 1KONA 2DHAA 4UOFA 4B17A 3DLHA 5DM6Q 2QEXS 2QFJA 1RHQB 4DR6J 1IKWA 1TKXB 1T0TV 2BVZA 4OYWA 4PYDA 3RBZA 2XLIA 3BO4A 1H2UX 3H90A 1RCXB 5KT3A 2C42A 4RW4B 2GGPB 2HNYB 3A8KA 2YBVA 1LWFB 2VD3A 5HANA 1TKTA 1NBEB 4ECVA 5ETSA 3M8SA 4CH7A 3VTIA 2Q6CA 5KG0A 1U45A 5H9FK 4LF7F 4MTPA 2VG6A 3R5JB 1KQKA 4FS1A 2GS8A 2VH7A 3UI3A 1RWKB 3PJ9A 4X65J 1R27B 1JLFB 2XWYA 4P52A 2R8GA 1NK4A 4P10A 1HBUA 2CRLA 1FRHA 3B6BA 4PQAA 2R7UA 3C3LA 1SUQB 2J0SD 5G0RB 1YRTA 3PACA 1S76D 2FDNA 5IQ6A 3QZ8A 2XI3A 1V6HA 1CULB 2P9CA 3MPVA 4YQWA 2UXDF 1ZAVA 1ZZFA 1NAQA 2G0CA 4XPEA 5GMEA 2KJVA 1RT6B 4I1TA 4ICLA 2BANA 3ZFVA 4LR9A 4QWDA 1RTHB 1S9EB 2FUG9 2KDOA 1KTQA 2VF3A 4LFBF 4IYQA 1O6XA 3SDEB 2G1DA 4EYIB 3EPIA 4LFCJ 1MWQA 2KXFA 2O67A 3BV8A 5D0RA 1FKPA 1Q1KA 4O4RA 1SJFA 2CQDA 1QAXA 1L3VA 2HHVA 2MKIA 2AEMA 2DIVA 3EZ5A 4M5JA 2OTJS 3BH7B 1FFSB 2CPYA 5I3PA 1VC6A 3BQ0A 3WC2A 1Q8IA 5KFKA 2IA6A 2W01A 3R5DA 2AV5A 3R1LA 4L76A 4DSKA 1NKCA 1JLCB 1P6TA 3NNAA 1OQ6A 5F0WA 1P9YA 2LYVA 4DZDA 4OV1A 3CJTA 3FBEA 4PG6A 1S7HA 4IG0B 4YR3A 2HHTA 1ZH5A 2DNZA 2Z57B 2V8PA 3H8YA 3AOBA 3J7ZT 3MFIA 2WZ1A 2U2FA 3CGIA 1U1MA 1HBMA 3DOKB 2DHHA 3HHLC 5IZHA 3THVA 1G6BA 1VRQC 3DXSX 3ZC4A 1VHIA 4DFKA 1WF0A 1SIZA 4HHJA 3FNNA 1EZZB 3GIJA 1XJWB 2HFOA 4V19J 4JV0A 4DUZF 1U48A 3W63A 3D67A 3UD5A 3F44A 2X7IA 4DR4F 2X1FA 3W5ZA 2JWNA 1RB0A 2KI2A 3E01B 3ZXWA 3DLEB 4R8UB 1U1LA 4IRDA 1NK6A 5DGBA 1PG5B 3LWMA 1T8EA 3QZ7A 3TR5A 4F3OA 4RBVA 3K17A 1CC8A 2BRLA 1JLCA 3HFZB 4ZP6A 5HN0A 3N6LA 3W1YC 1QE1A 5CAAA 1VQSA 4ZJOA 4WZQA 2H3EB 3V2UC 2B9WA 2M8HA 3K0JA 3PYGA 1YDLA 1JWWA 3QT8A 1P8GA 1UMJA 3KHHA 3LH2S 3TAPA 3H7HB 4HH1A 1DQ8A 1Y4ZB 1WELA 3J81U 1YJ7A 1SKSA 3NNCA 1FRIA 3KK3B 2QMUB 3OJUA 3CO9A 1QVFR 2F9JA 2VUGA 2BXJA 5EWFA 1AW0A 4I56A 4WPAA 4L74A 4QW8A 2R8JA 1U1QA 4C8KA 2RKIA 2W4CA 3N6MA 3PVXA 2GA7A 1EP4A 3DYAB 1XR6A 4X2BA 1AZSB 3OFGA 5ETRA 3MEGB 2KT5A 2W9AA 4OZ3A 3PW4A 1ROFA 3M32B 4IFYB 4CLTA 2RQKA 2C2MB 4AXIA 3MUVP 4P2MA 3G8SA 2BQUA 2LQJA 2V8HA 1H98A 3KWMA 3NGRA 2P6SA 4OZ2A 3OSNA 3MFHA 5F3TA 2DEIA 5DO2A 2W7PA 3ISND 3IRWP 4DV7F 4DQQA 3K2YA 1HBUB 1TK8A 2DCUB 2FB0A 3H2LA 4Q2MA 5EHHA 2YWKA 3I32A 1WKJA 3UCGA 4UUWA 4C2MA 1VQ7S 1M5OC 3AQOA 3PR4A 1JLQA 1FEEA 2QGFB 3AD7C 4RZRA 3MXHP 4AE5A 4DFPA 4AXJA 5SZTA 4C97A 4ENOA 3NGSA 4ECYA 3BGFA 3D0HE 4GO7X 3LOUA 3PW0A 1J2VA 1FDDA 5KFAA 2DNGA 1JB0C 5B09A 5CD4H 4ZPBA 1TKZA 1IKVA 1JLBB 2EEYA 2P9EA 4KC5A 4DCPB 4EO6A 5AJ3J 2ZH5A 2JEGA 3DXBA 2BKPA 3MR6A 3EXCX 5HMXA 2XCAA 4MYUA 1SI9A 2IDLA 2V50A 1ULRA 4AL7A 3W2VB 4W90B 2K7KA 2LLZA 4WP3A 3NP5A 5IC4B 1VMBA 1KDNA 5C42A 3BYRA 3C6UA 5DETA 5JVGQ 1OY8A 2IVYA 3HSJA 1NK9A 3TJ8A 4IDKA 5F8JA 2GIFA 2LA6A 2QSFA 3MD3A 3R6LB 2ZH6A 2R7RA 5GADI 1ZTWA 4LQ3A 1IQZA 2QL9B 1S6PB 2Z2LA 5D6GA 2ZVSA 1S6PA 3D4JA 5D0HA 2HHPA 2ERRA 4AQYF 2DRDA 4I69A 3HFVA 2BE2A 2P6TA 4OJ1A 2APOA 4ZVUB 2ACMA 2VPZB 2BJ9A 1UPPA 2RIJA 4KFBB 4WBFA 3D6FB 2E5GA 4AFFA 4DUYJ 4KPYA 1TVRB 2VZ9A 1YK9A 2KRBA 3PKYA 3OL7A 3TI0A 4KE5A 1KEKA 4RL1A 1ITPA 3W2VA 1TUWA 1S4EA 2O01C 1TKTB 4R0JA 4QPXA 1B64A 2CAJA 2AEJA 1S5ZA 3MEEB 1HW8A 3UW1A 2C2RA 3OTOF 4RNHA 3Q2TC 5D3GB 5A2QY 5A8KB 5IM0B 4RW4A 1UVNA 1SXLA 2UXBF 5F9LA 4B3SJ 4X4RA 3BREA 1KBRA 2LFVA 3LUYA 5B0GA 5J2MB 3V81B 2DGVA 2UUAF 5KG3A 3ENVA 4FYVB 3KK1A 1RTDB 1JX4A 3Q8PB 4KHPJ 3HJFA 1HHQA 3CJQA 5E0OA 2K8GA 5D77A 4KR0B 2RS2A 4I6YA 2MPUA 1VJWA 3R7NB 4DV2F 4F8RA 2ZFHA 4P2FA 1PYTA 1WWHA 1A6LA 3QLHA 4EUVA 2PDAA 1A9NB 1HYSA 3J81Y 4ZVSB 3CDBA 1EIYB 4LF4J 2OPSB 1WG4A 3CJ2A 5KFFA 4KKOB 1EHWA 1WC5A 1B0VA 2HVEA 3Q8SB 4DV5F 2R7XA 5A6WA 4ZCIA 5EDWA 3MWBA 4MIAA 1FVSA 9RUBA 1U2RA 2ILZA 3KJVA 5L1IA 1G7CB 5L1JA 5J2QA 2YPZA 2QLXA 1S79A 5T14A 1KHWA 2H5IB 3FKBA 4DLEA 4NA2A 4LF6F 2R7VA 3K5OA 3KUGA 4OHWA 3HXMA 2QX0A 4A47A 3PG9A 4EBEA 4Y2AA 4DSLA 4I6AA 1U1RA 1QTNB 4FF3A 4JI6J 4OYAA 4JUZA 4JI2F 4ER8A 1R8AA 2E5JA 2E1RA 3F73A 1FJEB 2C1EB 1HI8A 2HLTA 4K4XA 1NM2A 3H98A 1NKEA 5IT4A 3KUEA 3RAMA 2MQPA 1HPZA 4AYBD 1ELOA 2B4PA 2QE5A 3JQJA 3D2WA 4CLPA 4Z7CA 4JOUA 4PWWA 5L8RC 2EXUA 2VJVA 3EX7B 1XIQA 2VL1A 3FRYA 1PC5A 2BQRA 2JVRA 2HG4A 5AE2A 1D1UA 3HSDA 4NCBA 4IRCA 5KFXA 2NPFA 2YWGA 2YNFB 2OPQB 2IM0A 5A0YA 3L09A 2YX4A 4IFYA 4GKKJ 3IAM9 1FDAA 2XMWA 2MXYA 1VI7A 5DDOC 3M8RA 2HWTA 3H40A 2QG9B 4DU7A 3QJJA 2VU5A 4J9LA 2RKIB 1LWCA 2YKNB 5KFVA 4NXNJ 2OPQA 1T9TA 4EWTA 4C98A 2F4VF 1N36J 1Z4UA 4BLGA 4DN9A 3OTOJ 4L73A 3CJ4A 5HQLA 2WB4A 4UF4A 2VBYA 2XMVA 1HBNB 1RK8A 2IFXA 4MAKA 3J80U 2VICA 3MAQA 4EBCA 1JXEA 4IH7A 4KPCA 1Q5YA 1WEXA 2FLLA 1OSCA 3ZTSA 4N5SA 2QO3A 3MR5A 2MDAA 2LQBA 1LWCB 2Z2MA 4RR5A 1HPZB 2BOPA 1S1XB 5KOXA 1F2HA 2KL8A 3ONQA 3CJ8A 3CD5A 1RYSA 3DI6A 2DH9A 4B3RF 5HLFB 1S9FA 3BGOP 1R8PA 2E66A 4DV2J 4QZVB 1RAGB 4OX9F 4QWAA 2FZKB 3RBDA 3MM7B 1VC5A 3MCMA 1UA0A 1FEHA 4YY3F 5M2PA 3R2CJ 4YDXA 1BUXA 2CPJA 4NCGB 3TZZA 1VQNS 2UUAJ 4FF1A 3DC2A 3W62A 5I42B 3H4BA 2DB1A 4KSEB 5D4LA 2EK1A 4B3TF 1NK0A 4UY8T 1WNEA 2V94A 1UVJA 4A8QA 2IBOA 2CZ4A 2BE2B 2D41A 2V8VA 3QSIA 2KYZA 1OIAA 5G0RA 4J9QA 1HR0F 1LXNA 5FDLA 3D9BA 3BGLA 1LWXA 2ZZMA 4ITSA 3VF0B 3DLLQ 3WHIA 4OHVA 1IWAA 1F9HA 1HIYA 2M4MA 2QLFB 4H4MB 3M6UA 4NI2A 4P73A 1BY9A 4R25A 3T1AA 2HNDB 5BR8J 3FBBA 3FVYA 4JI4F 4YR0A 1FWLA 5JUMA 3OL6A 3VGUA 4ED8A 4W98A 1AA1B 2FHJA 2B56A 3IR7B 4LJMA 3HO1A 4DCOB 5KT7A 1YIJS 2PSZA 3CC7S 4F4AA 1C2PA 1ZZNA 4JI5F 4Q5VA 5IWAF 2AKWB 4C3KA 4L6V3 1FKAF 5F3ZA 3W5YA 2UUBJ 4WP9A 4ZS6A 2F63A 4C4WA 1GEHA 1NSPA 1AUSL 5KFNA 1O51A 1HQEA 1M5HA 2CQBA 2FZCB 2LVWA 4O44A 2RS8A 5KFIA 5A8WB 5CABA 1QD1A 1KNZA 1AT1B 3POTB 4RW8A 1RADB 2R42A 1C1BA 3MCNA 4HACB 3D7SB 5J2PA 2DVIA 2XSJB 4U95A 2MZTA 1TMJA 5FD1A 2MSTA 3UFCX 3RW6A 3KLGA 3CMAS 2J7WA 4U96A 1URRA 3IM9A 3PW5A 4OJHA 2GJIA 2OKQA 4DXLA 4QIGA 3KLHA 4DR4J 1JNZB 4NLTA 1RTJA 3SMZA 2ROGA 3AOAA 5KFWA 2IC3B 1S6QA 1HQUB 1LKZA 2E1PA 2QZ8A 2V2QA 2VG7A 1HWIA 2M2BA 3FCWA 3ILOA 4JBCA 4ECTA 4K4TA 3SCIE 2I6WA 3TQ1A 2H5JB 3HVTA 3JSMB 3Q22A 5KT2A 3T5JA 1KN6A 1D09B 1KHVA 1Q8LA 1RHMB 2NXUA 1NSQA 4K7QA 5LL6d 3HM9A 3CIZA 2FTRA 1HLWA 5ETLA 1CPZA 2ABYA 2J8SA 3D0GE 3MM8A 4OYBA 2FY8A 2MTLA 4LFAF 3F0NA 4DI6A 1R8HA 2XG8A 3H5UA 3NBPB 2ZWPA 5DGAA 2M70A 1JK9B 1MWZA 1ZM4A 3MAAB 1AROP 4YFUA 1RWMB 4ATNA 2V69A 2E5IA 3RZAA 3AOCA 5AE3A 2Y8WA 3RB6A 4Y2KA 5GAEU 3SI8A 4NOHA 2DGSA 4KH1B 1VBZA 3MDFA 4OYMA 1X4FA 1UEUA 1D8YA 3MMBB 1S97A 1N88A 3FZBA 1U09A 1NNDA 2K1RB 2WVDA 3EMTA 4IRKA 4C9DA 1K47A 1U47A 3PV8A 2ZHAA 1XMQJ 2ZBRA 3HPOA 1UFLA 1MW7A 3DLEA 1FRMA 1FT8A 2J6SA 4ZPTR 3SCKE 1PAEX 5GVQA 3TUJC 2BUNA 1I6JA 1R0AA 2CIMA 4HT5A 5CZVA 5I4MA 2NR0A 1R6VA 3PIPQ 2V6AA 2Y0SD 1B4SA 4MT1A 3W2WA 1RAAB 3KNAA 1Z2ZA 4DSJA 4Z37A 3OL8A 5KFZA 4ZPAA 4DR7J 2RDDA 4JI5J 2DO4A 3L7OA 1W7WA 2ZKTA 3ZZTA 3VAKA 4ECSA 2R7TA 1AB8A 3KLFA 5DG9A 3C66A 3M2RB 1RP5A 3CDEA 3HLUA 2VONA 1EARA 4EU0A 2OFHX 3DHXA 3KJNB 2OPRA 1CSJA 3EVOA 1X4GA 2PC6A 1EQMA 2LEPA 3T5KA 4LFAJ 3GG1A 5KFRA 3UDVA 4H4MA 1IWGA 4FPRA 1UWBA 4ZVEA 2D3O1 3BSCA 1ZYQA 1WUUA 2DISA 4G3IA 3AD9C 1Q8KA 4O4GA 1MROA 4GC7A 4LFBJ 1WC0A 2ZH4A 1X9WA 1V9OA 1UAWA 3D28A 2MKKA 3MCSA 3AAWB 3NL0A 2XZTB 3IN5A 4OX7A 1XQIA 2AGQA 3R2DJ 4LSLB 2AD9A 5CQGA 3M4XA 2X1AA 2AJ0A 2XS5A 4NCGA 3LGHA 4J9MA 2E7WA 4ZCMA 1BHNA 4NLYA 2HWIA 5C25B 2ZOGA 3DFEA 5I42A 2HZVA 2Q79A 5KFHA 2QTWA 5DQGA 1IQTA 3UNYA 1RDRA 3T1HF 2JVOA 1D0EA 2RQMA 3HP6A 2HS4A 1M90T 1X4CA 2MLYA 1UEKA 2E5LJ 3MM7A 2IM1A 2EFQA 2FHOB 1RT6A 3K8WA 3KXDA 4G1PA 4OJGA 4ZN3A 3NG8A 1JJ4A 3WIUA 5HBMA 3HHEA 4ED5A 4LMZA 2IMWP 2NXEA 1KD1T 1V5IB 2HHQA 2QN6B 3C8YA 4HHUA 4QPTA 3IS9A 5LMNJ 1RWNB 4TU7A 1SUQA 2CG8A 5E3QA 4JI8F 3M8QA 4KIAA 2OPRB 1IXKA 1FE0A 2ZEJA 3HVAA 1OS5A 3NGTA 2XEXA 2MKYA 5E3RA 2RSQA 3PX4A 3DGVA 3P4UB 1U2CA 1YRUA 4GO5X 3Q86A 1X9SA 5E2QA 2B7CB 2F40A 3N6NA 1DJ0A 3QWPA 3G6VA 2RHQB 4ECQA 4B3SF 3DMJB 3DDKA 3IR6B 4WCEQ 5IT0A 3NMAA 4H4OA 2NREA 1LWFA 1IBCB 2VBZA 2HNYA 3UVJB 5K8OA 1Q5VA 2IRYA 4CT8A 3QJLA 4D3GA 3TEGA 1RA6A 1T9YA 4YB6A 2YKOA 5KOWA 2N3LA 3A3NB 2R3VA 3DRSB 2YY3A 4WK1A 3ZNUA 4OHXA 2K1RA 3HHDA 1FD8A 1VFJA 2LEAA 2QJ3A 2MJUA 3CD0A 3O5TB 5A76A 5GAGI 4EYHB 2DPJA 4HI2A 1VR6A 3MHYA 4LF5F 4DF4A 2ZD1B 4X4OA 5ETPA 2ASYA 2VPWB 1SH2A 3M1VB 4NLGA 1S4FA 5SUHA 1EKSA 1PYOB 4ZVOB 1Q7YT 3MM5A 2CJ9A 2V8GA 4J9VA 1C0TB 2AX0A 2DTJA 3TAMB 3WBZA 3UDEA 5C2GA 2V2VA 3BSNA 5D3GA 1N33J 1SJQA 2DHXA 1JLEA 3AY0A 1C4CA 2VA2A 3BR8A 1BLUA 2W1BA 2UP1A 4O3SA 1PO6A 5ITHA 5HROA 3UD3P 5FLXY 4L3NA 2DGUA 2HBQB 4RW7A 1N0VC 4C3LA 2WK4A 3WQPA 5JJBA 4I7FA 3M30A 3OQ2A 2J76E 2BABA 3CT9A 4RNMA 3K7RA 1W2BR 4JI7F 1EB0A 3CJ0A 1Y9OA 1CJUB 3ZZZA 2XGQA 2MQLA 3T9ZA 1SV5B 1FHTA 3T1YF 1Q86T 2JEJA 4DPUA 1GTHA 4FVCA 3SSRA 4ED3A 3OXLA 3ZZPA 2ILYA 3Q8QB 2E1MC 4P71A 5E3AA 3EE3A 1X4BA 1OYEA 3KG1A 4LRCA 4MK8A 8ATCB 3HFKA 2Y1IA 3CDAA 3CW2C 4YOEA 1F5BA 5C24A 5C24B 5D4OA 4ILLA 3IC1A 3DOLA 4A8KA 3WX4A 2XNQA 3OPKA 3QT5A 5A8RA 5F8LA 3P96A 1ZTTA 1WOOA 1RT5B 1YG0A 5LJ5Y 2DNKA 3M8ZA 2FIUA 3T1YJ 1GQEA 2YH0A 1S1WA 3GR0A 3RAQA 3DM2B 2WHOA 1IKVB 1JLBA 1S0NA 3P49B 1O0PA 1IKYB 2J0WA 4A46A 1R0AB 4TY8B 3ETMA 3LP1A 4FZVA 5KG5A 3GJSB 3OTCA 1IKXA 1OQ3A 2CPXA 1RT5A 2GMHA 3B54A 1I5OB 3FMBA 3JTNA 4M5GA 4DLGA 4U67Q 2MKCA 1SJ4P 4PYAA 4HKQA 4NLQA 2IA0A 2OTLS 3THTA 2EFNA 3O8WA 1YBAA 2M5YA 2OPPB 3BH6B 3PYFA 5HQMA 4X64F 5H9EK 2J9DA 1N48A 3FSYA 4TVAB 4G65A 1I94J 2JDJA 4JB8B 2B4VA 2E5HA 2GJFA 5J1PA 4K4WA 2D3ZA 2NYHA 2CVIA 3H2UB 1TP7A 2AJ4A 1X8DA 2V63A 4G1QB 1QAYA 6FDRA 1RBLA 4N8OA 3ISZA 4I64A 3D54A 4NZ7A 4PAAA 3UPFA 3NWGA 3QNWB 1LW2A 1SQFA 5M2RA 1L3TA 4OMFG 2QYCA 1AZSA 4NRUA 2F7VA 5BJRA 1LWEA 4F36A 1VIXA 3HT3A 2E9ZA 1ZOTA 3MPUB 4M5NA 2YWWA 5J1NA 4IQXA 1OJ4A 3I82A 3FBCA 3UN5A 3HMJG 3QSYB 2G0IA 2MZSA 3PJWA 4UQGA 1SC3B 3BPSP 3ICLA 1M1HA 4LRBA 4WFZA 3IMQJ 4O3NA 1Q4RA 4F67A 5GADU 1TKDA 1X4DA 4QCLA 4Y0FA 1W26A 1HQEB 2AZ1A 2COLA 4WKRA 1NMEB 2LQ5A 3NY0A 4J7CA 1B70B 1KOHA 1X31C 3EPGA 2DXFA 2V68A 2CPHA 2VB6A 3GR1A 3I96A 4N77A 3HVRA 4KHPF 4F25A 2VQEF 1F9FA 2YNIA 1QSYA 3FFIB 4LF6J 3VVTA 2D74B 2CKWA 4I2PB 1Y5IB 2G2OA 2XCPA 4C7QA 1R43A 1JLQB 4K5RA 3G8TA 3K5LA 2IM3A 1HBNA 1F9EB 3MEKA 1YLXA 4HDGA 4U8VA 2QLJB 4LRDA 3TRGA 2XQCA 4ZDNA 2M88A 2HNDA 4PQUB 3TQEA 2FVRA 2KU7A 3VV2B 3E01A 4R8UA 1SJRA 4DV1F 1YJUA 2WBMA 3M2UB 3SSQA 2BW7A 7FD1A 4B9NA 2F4VJ 3VHQA 5KFYA 3NCQA 2FJDB 4F0HA 3IA0A 4LQ9A 1HL6A 4HYKA 4FF4A 2L08A 4ZLJA 4X62F 2A1BA 4Y65A 4BC9A 1DRZA 2DGWA 2ZUGA 4PR6A 3CE8A 3EVWA 3M30B 2X1BA 3T6JA 4CO2A 2CDRB 1QLNA 1XMOF 1R31A 1CVJA 4LR7A 3DGPB 2V9KA 1MG7A 4WFNQ 2EC0A 1YQHA 2YNGB 2G0JA 3JSRA 4RUBA 3GIMA 3PO4A 1T94A 2VIHA 1NUEA 5CYQA 5K14B 5CCLA 1X0FA 4HR2A 4XO0A 1KFSA 2MHNA 2E44A 2RU9A 2QC3A 2I1RA 2CA9A 2DGXA 1R7IA 1RAOA 3G82B 4TQSA 1PJ5A 5GAHI 2W9CA 2NS1B 2A6MA 1CQMA 3TJAA 1RT7B 2VG5A 3G82A 2PI4A 1RT7A 2VG5B 5ETKA 1CJVA 3DOMB 2W9CB 3MZIA 1XC9A 4S0MA 4ANEA 7AT1B 5CYQB 4U6PA 3QYYA 1GX5A 4B08A 2NPIA 5IFMA 3G9CA 3HX9A 3TUIC 2ALZA 1BMQB 4K4ZA 1FJCA 4WU3A 1GAOA 2IMOA 5AXNA 3PRBA 1XERA 3NOCA 3VAIA 2K3KA 1X9MA 2JL9A 1RT3B 4Q43A 5THWA 2OJ3A 3CD7A 1HWJA 2PN6A 5H1SV 2OMOA 1YHQS 5F8HA 1MU2A 3H25A 4KYZA 1MU2B 4J5OA 5JXSA 2F65A 3CJ5A 2FJVA 2XY5A 5EWEA 5CYJA 1HYSB 1VOMA 4FYYB 4NL5A 4BS2A 2B0GA 4EGLA 1U1PA 1Q95G 4JV5J 1M0SA 3GZ7A 2B8PA 4IG0A 4ZKAA 2GVDB 4WE1B 2AJQA 5LSLA 3MD1A 2UUBF 2PT0A 3VALA 3BGRB 2HBZB 1RYRA 1RTIB 2J7KA 2ASDA 1KVIA 2WW4A 4IKAA 1UJ6A 3CPWR 4BC7A 2CNNB 2Z2YB 1P1TA 3MMBA 3NKYA 3UR0A 4CH1A 3OR2A 2B6AB 1TUGB 2FVPA 3SXLA 2UVVA 3TUZC 3BEGB 3VGTA 2MZJA 1JKHA 2HNZB 4OYPA 3HD2A 2FJBB 5K5MA 5BR8F 4ELUA 4KRWA 3JS9A 4U7UK 2BJ8A 3FUYA 1ZBTA 1OYDA 4DS5A 5BYRA 3IG1A 5DM7Q 4Q0BB 1GFWB 2ZH8A 2J9EA 1WI8A 4NEYA 5KFDA 5ETNA 2GNKA 3UN2A 2KT3A 3GYNA 2LXFA 5KFQA 1LW0A 3AJ2A 1RAIB 1M1GA 8AT1B 2GVZA 1I3OB 1VRTA 1CULA 3B4MA 2H9ZA 3NS5A 1VQ5S 2I8EA 3KLVA 2ZZTA 3GWCA 2BMBA 1FRLA 3EGVA 4OJ3A 5KFTA 1KP6A 3CJRA 2XO7A 3LWLA 1VQ8S 1RT1B 2ZHBA 1J5OA 2QV6A 4TLRA 2J6UA 3KLEB 1M5VC 4M94A 1N5VA 3EDRB 3KNGA 2B9EA 4CO4A 3N9UC 3JTPA 3MECB 4F02A 1KLMA 4OX6A 2MQ8A 5C7PA 2VG6B 1XN9A 1XBWA 3GE9A 3VAMA 3TZXA 2HHHF 4B9LA 1DQAA 4U7CA 4IOAQ 2GW8A 1WTFA 1PSDA 4CLSA 3AJDA 3DLBA 1REVA 2JSXA 3D6MB 4EI2A 4X4QA 1RWVB 3POTA 3RRHA 4X4NA 3LP1B 1IKXB 2F8HA 3D1QA 2RRNA 3DRXA 4RW6B 2AF6A 1S0VA 5ETOA 3GFHA 3VWSA 1FX4A 1UEVA 4NRTA 2AP6A 2CQ2A 3HKZD 3SCLE 1RT4A 1TKXA 2C2EA 3V6JA 3BQ1A 4NLVA 3PYEA 2N82B 3BM7A 4PXEA 3ILIA 1KTVA 3O2IA 4N47A 1BGXT 4ANCA 5J1EB 3EGZA 2VDHA 5B0EA 3CCUS 4IO9Q 1RTZA 4K8RA 4F26A 4WTYA 2HGNA 2DYAA 2IAJB 3U1LA 4WTOB 5L39A 3ZNJ1 1CLFA 4EK2A 4XPCA 3CB4A 2GAGC 5K8PA 2WBRA 2ZBPA 2E7VA 2F3JA 5ADZA 1LFWA 2C28A 1TK0A 3J7YI 2NSCA 3DN9A 1ZA2B 5HL7Q 1CJUA 2J8AA 1IBMJ 3IM8A 3FSIA 1PIEA 1YGYA 4FF2A 2YVSA 3CJ3A 3GTYX 3OXFA 4LBIA 1JLGB 3D1HA 2F8MA 2HQCA 3PFEA 3C46A 1HKAA 2BQ3A 1U6BA 3LPYA 1X5PA 2HBYB 1XMBA 2V2KA 2YWEA 3N01A 1GXLA 4HL9A 4OI0A 4HDHA 2RF2A 4UW2A 2R7OA 2B5JB 3NBPA 1SL2A 4LBPA 5MAOA 2DH8A 2NYIA 1R3NA 4NA1A 4DX5A 2RDJA 5LMUF 4WXOA 2BW2A 5HI7A 2RF2B 2V2ZA 2RUGA 2UV8G 4QIWD 4YB5A 2KM8C 3UCUP 1U1NA 3RRGA 2MEWA 1M5PC 2WRMA 2MQOA 2H48B 4NE9C 3IRXB 1VRUB 4ZLNA 1B0PA 3MURP 5GAHU 1FVQA 2LP4A 2WB1D 1WG1A 5GAGU 2OI2A 3Q23A 1VCTA 4NX9A 4H54A 2PMZD 2AW0A 1C0TA 2OO4A 2QT7A 2VG7B 3IO1A 3W9HA 2XY7A 2ASLA 4NMLA 4DQRA 1GXTA 2PIIA 2ZH1A 1K73T 2AQ4A 3QFWA 5LMUJ 5A8RB 1GX6A 4IH6A 3LAKA 4J91A 3AODA 2ZD1A 2VPYB 3GSDA 2HFUA 2L48A 3LA0A 4L75A 2UVUA 1IBKJ 2HHUA 2Q1LA 1ZAWA 3TX8A 1HNXF 3DCAA 3TA0A 2V8DA 2NSBA 4K4YA 1BD6A 1C1CB 2PMWA 1WF1A 2JRSA 3BGUA 3HULA 1BQXA 4TY9A 2B51A 5MLCV 3GV8B 1V3SA 4DR1F 4NEZA 4J9OA 1Q82T 2JFDA 2WONA 3GILA 2NQPA 1KC8T 2Q6BA 3OHBA 3KDNA 3K59A 4M8LA 1TK5A 1WC6A 2OSRA 3C6TA 2NXNA 4ID5B 3ZZYA 3GIKA 2JLGA 1OPIA 4ECUA 4DSEA 2B9XA 2YQ1A 2B8QA 4I7FB 1UFKA 1NDLA 4IH5A 4LSNB 4PEOA 3CTRA 5L1LA 1U1KA 4U7UD 2CQ1A 3BO3A 4OZ0A 3UN3A 4B3RJ 1K8AT 3C16A 1IBLJ 3DLGA 4KO0A 2XYGB 3UD4P 2BR0A 3OV7A 3TVYA 4EZ9A 5LSRA 3JSYA 4CO1A 1HWLA 1K44A 1DTQB 4P9SA 1B3TA 3DRRB 4F04B 4IUFA 4DPWA 3KLEA 9ATCB 3NEKA 4IQMA 3DOMA 3QT7A 3M9NB 3SV4A 1U1OA 3AJ1A 3M1VA 2J0QD 5U47A 1RLCL 2XS2A 5HVHA 4K2JA 2VDIA 2DXEA 3BKFA 5IT9Y 1PCAA 4ZLPA 4USKA 4P6QA 3GCXP 2HVDA 4NLOA 2E5LF 1T9XA 3LANA 1FJGF 1SL0A 1UW4A 1WTBA 5K20B 2WONB 1U8WA 4BWJA 4JV1A 1RWWB 4JP8A 4CLLA 2OEKA 4RNFA 4ED0A 2VKRA 4M5DB 1J5EF 2LCWA 1GXUA 3ENAA 4ETZA 2VODA 1NZAA 3OVAA 2XNRA 2CPEA 4I68A 3H4DA 4OI1A 4RNOA 1MROB 3HF5A 5IOLA 2MZ1A 2FHKA 4F0MA 1U02A 4NYZA 3IWLA 2PI5A 1QUVA 4YB7A 1KQSR 2VPXB 2BKOA 1VQPS 2XI2A 2G2YA 5AXKA 4X4TA 3WC0A 1WKLA 4YN3B 4PG8A 2BZ2A 1HNVB 3NAHA 3N28A 1WC1A 3E3XA 1KR4A 4UTGA 3V5RA 2VJUA 3HHLA 3CDWA 1S1UB 1U25A 1WC3A 2CYYA 3ELHA 4K59A 1O8BA 4IFVA 1MN9A 4MKBA 4USJC 2F9DA 1WEYA 3S1TA 3TA2A 2W7OA 1AUDA 2HMIB 2GO9A 1BQNB 4F4YA 1IBLF 3FCVA 3OTEA 4YP3A 2E9TA 2NUUG 3W2WB 5GAEI 3HHKA 5HBMB 1UCNA 1HD1A 4QW9A 1SKWA 1HD0A 2CJAA 1S49A 4N76A 2CQCA 2CFXA 2PFFB 2EWHA 4ZVTB 2UU9F 2O66A 3CJSA 5B0DA 3VAFA 4LF5J 1DZ5A 3HVWA 4JI1J 4OLPA 2ZM6J 3AFGA 3LGMA 4HLBA 2PE8A 3WZ0A 3KTQA 4NA3A 2I2YA 3CSKA 2MY7A 2HURA 2GO8A 5KFSA 4LSLA 4Y2CA 4PXCA 5AJ3F 1HNXJ 1IM4A 1N5QA 3SFUA 3I9ZA 5D15A 1SC6A 3QGPA 1F3VA 2CVEA 3M8PB 4YUDA 5HVFA 4DUZJ 4DR2F 4LIRA 5D78A 4DSIA 3M2VB 3M6VA 5IS2A 3V6DB 1QSLA 1RQ0A 3U02A 2OP5A 1MMNA 3N79A 3W64A 2W9BA 5EX0A 2HHWA 5AXLA 4KB7A 1IVZA 2DNPA 1EX8A 2ZHOA 1S6UA 2F8EX 4DV3F 1CEZA 4O3QA 2GZOA 3RRKA 2CG4A 1HHTP 2B5JA 2EKYA 2LEBA 3DGPA 2P8IA 2OEMA 3MAHA 3UQSA 2FJEB 1N4LA 4OZNA 2RUSA 2ZBQA 2RQ4A 1WOPA 1NHUA 4OFZA 1TL1B 1S10A 1UVIA 1JLEB 1L3KA 2UUWA 1AYEA 4DUYF 1DTTB 1HNIB 2DGQA 2E7XA 3MM5B 1SH0A 1ZS6A 2KJWA 3KFWX 4U8YA 3TAMA 3MUMP 4X4VA 1RAJA 3N4WA 4DR3F 1RT2B 2D69A 2RILA 3IR5B 2RU3A 4CO3A 2YQ0A 3RU0A 3MPDA 3MMJA 3FC9A 3PM9A 4CM2A 3KLHB 3VVUA 4F4KA 4DPYA 2UZAA 3HZEA 2X51A 2DY9A 1R0BG 5B0FA 2C2NA 2YNHB 4C8OA 2HVHA 5DZ7A 4P7VA 3LP2B 3KK2A 1VQKS 5LJ3Y 2MJNA 2Y8YA 4ZN1A 2DNRA 1FNXH 2ASJA 5CZXA 3MTJA 2JC1A 4G1IA 3IG1B 4Q0BA 1GH8A 2GX8A 4O23A 1UA1A 1SJ3P 2DR8A 2XSFA 2DGTA 2DITA 3MR3A 4LF9F 3K57A 3WDOA 4MH8A 3R1HA 2FZGB 4DS4A 4NYOA 1VIOA 4F50A 3BF4A 2HIYA 1TL5A 1WHXA 2AT1B 5CA5A 2L41A 3BKTA 4I67A 1NJXA 2VOPA 5JVHQ 1FE4A 2UVRA 1S0OA 4HHHA 3PW7A 2Z8QA 2YKAA 2J9DE 5D0GA 1LNQA 2ZNYA 1RTIA 4ZP8A 4CLYA 1Q79A 3JAMU 4A8SA 4N56A 5L38A 4ZLLA 4I6WA 1Q16B 3US5A 3N5FA 1TZ0A 2GVDA 2GV1A 3HJVA 4WE1A 4OYXA 3HVTB 3TNVA 3JSMA 1RT2A 3AHPA 1FERA 4HVZA 1G3OA 2ZH2A 4ID8A 4WYLA 1OSDA 2NXCA 3I6PA 1YJNS 2DR7A 4LBHA 3I0RA 1TAUA 3M32A 5HATA 2JNJA 3A13A 3MPYA 1VK3A 4TN2A 3G71S 4P75A 2AYEA 4ALZA 1NJZA 1JMTA 2QMWA 3TO8A 4C6AA 4YHHJ 4L3KA 5HAOA 1VK8A 4B3MF 3SEOA 4OI2A 4R0EA 4C11A 3NAIA 4RW7B 5KT5A 4BDPA 1YX2A 1Z2LA 2K7JA 2KRRA 4A8WA 2CQ3A 3PKMA 4K0KF 3G2XA 4HI1A 1RU1A 1FDBA 2KYXA 1DURA 2CPZA 2M3DA 3EGNA 3GCWP 4OLOA 1MWYA 4KV8A 3G6XA 1TV6A 3CCMS 1IUJA 1H6KX 2WCXA 1E6YA 4DV4F 4H4KA 3ZTPA 4LF8J 4V19X 2B3TB 5BYQA 1N5YA 3M8PA 1S1XA 2AU0A 1U4BA 4F3MA 4QU7A 5HJXA 2DCLA 2B9YA 3DI6B 4H4OB 4GC6A 3BDEA 4J9SA 4FS2A 4ZOSA 2DNYA 2EBEA 4LSZB 4X4PA 3BO2A 3GFXA 3BJYA 2X1GA 3UDCA 2DRAA 2MYFA 1F0XA 3ITHB 1SPBP 3BGRA 4ZJLA 3AD8C 2BX6A 4Z7YA 4NXMF 4K4VA 2JC0A 1BE4A 3GONA 4P2SA 2EFVA 1UVLA 4M5IA 4EMDA 3EICA 3TVZA 4C8NA 2FJWA 4X4UA 3GFYA 3KDOA 2XZDB 2XZWA 2YKNA 2CZVC 2VFUA 4GRSA 1JQGA 3IFEA 1FCAA 3FEXB 5L9XA 2R2TA 3UWTA 4M5MA 1QSSA 1H73A 2CJQA 1BQNA 1D3WA 3OVSA 1K9MT 5A2QU 3DLKB 4GVBB 2R8HA 4DL7A 4CYUB 4IR9A 2KN4A 2AHOB 3L95X 2L9DA 3TZYA 3OD2A 2FHMA 1RKIA 1V3RA 4CWBA 1EKRA 2EG2A 2ALYB 4ZIVA 1RTHA 1TTHB 2UXDJ 3WX8A 4EFAC 1ZA1B 3TX0A 4DHVA 1MNEA 2RD5C 4YDDB 1FRXA 1LK7A 4ZPDA 3MMAB 5HSPA 2R8IA 3LTOA 3R5BA 2ZZNA 2Y3YA 1U6ZA 1UWBB 3J7YU 2UUCF 2IJFA 1UTAA 3FCHA 5IWAJ 3LAMA 2E29A 4EO8A 2CNLB 4J9NA 5FLXU 2W2PP 3BS9A 5KG6A 2VQEJ 1VLYA 3V6KA 3B8HA 4B9UA 2IJRA 4LF8F 2CJKA 2MQQA 4USIA 3I5CA 3SFGA 3A4TA 5C25A 1NZ8A 1VLOA 2KVQE 4ZMMA 6AT1B 4C8MA 2C3MA 2WSFC 3CNQP 2KKHA 1SJ1A 1X4HA 5T7LA 2WAQD 1RAEB 3CJKA 1Y5NB 3KLIA 1YITS 3EZOA 3KJVB 3M9MB 1BQMB 3DLJA 4UOCA 2R9LA 1HNZJ 4CTAB 1VHFA 4XK8C 2KTQA 2AYBA 4KGXB 2FLNA 4DV1J 1VYAA 1AFIA 1MMLA 2SXLA 1NDKA 3BBFA 1HQUA 5DDQC 2HHSA 1WHVA 2OPSA 3S01A 1ICEB 3BYPA 4DBQA 1JJ2R 2O3DA 3K89A 4HEA9 5LSOA 1APSA 4D3HA 2KH9A 5T41A 3KKFA 3W3SA 2VHGA 4H4KC 3LP2A 5IV4A 2ZKUA 3KK2B 4ED7A 4PQUA 1IR1A 2CPIA 2FHJD 5HP1A 2BOAA 2BM1A 2JZ5A 4RUCA 2W25A 3G86A 1XNRJ 2FVSA 4DV6F 4G6VB 5B0BA 1RLDA 2HQGA 4F3QA 3V81A 2DEJA 4LVNP 4O44B 5A8WA 3QRQA 3JTOA 4ZVHA 3C6TB 3PEJA 1R0CB 4ID5A 2AIRB 3O3LA 3Q8YA 3WIVA 4O3RA 3AH6A 3T3FA 1E6YB 2DK2A 2N4CA 1S1TA 2AJ2A 3IGNA 5A8KA 5IM0A 2CADA 1WOSA 4DV4J 1OWXA 3TAQA 2M0GB 2QIFA 3CCTA 3VGSA 1Y00A 2OAUA 4FXVA 4X66F 2XHCA 3I55S 3CCLS 4XIUA 1VQYA 3C14A 4ZCKA 5KG2A 2GAHC 2VA3A 3KJFB 4ED1A 4KQZA 1VISA 1Q8BA 3R5GA 2J5AA 3K58A 3ZTQA 1NDCA 2D9PA 1T11A 5D0EA 1J27A 2DNQA 5A6PA 2I9SA 1OY9A 3EUNA 5B0CA 6FD1A 1QAJA 1FDNA 2VV5A 4A8FA 3OHAA 3NGUA 3D68A 1ZM2A 1S1VA 2D9OA 1U0HA 1SKUB 1UETA 1RT1A 4NLSA 1AFJA 1T9VA 1WC4A 4B9MA 4UUXA 2KFZA 2KO1A 1VC0A 4DCJB 4O3OA 4B3OB 1S9GB 1VQOS 5DS7A 1QAIA 3H20A 3O6QA 2F4FA 3H42A 3MR7A 2X3GA 4NWBA 3RBXA 2DH7A 3BDPA 1KVKA 3EYZA 4C8LA 2YXLA 4M5KA 4BHQA 1NU4A 1YWXA 1T9WA 3CMQA 3LALA 5D4PA 3UDLA 4ES3A 5J2PB 2KFYA 1S72S 1FXDA 5EGYA 4XAKA 1DFDA 2P5VA 3A8JA 1S1TB 2XC9A 4DFJA 4PUOB 1UP1A 2HHHJ 1S59A 1MN7A 2ADCA 4NZ0A 2KG1A 1KRPA 2POKA 1SL1A 2KT2A 3MM6A 3CXCR 1NSKL 2FGOA 2QSWA 5DZ6A 5HLFA 2IC3A 2OELA 1T95A 2V4JA 3I4HX 3PFOA 5KT4A 4DV6J 1XMQF 1FK9B 2OH2A 4PRFA 2CWXA 2AJ1A 3IAS9 1REVB 4AL6A 3DOLB 3HI9A 4AL5A 3W8PA 2DIUA 3PW2A 4NPOA 2HMIA 4E0DA 5F8GA 4ED6A 1IM6A 1H2TZ 1JLAB 5EX3A 1T05A 1O5JA 4DN0A 2GHWA 4QR0A 2HFVA 4A8YA 3IWXA 4I0WA 4QIEA 1YZ6A 4ZITA 2IM2A 2PFDA 3MEDA 3JXOA 3QAUA 4MYTA 5LMNF 4LRAA 4M5HA 5DLGA 5E33A 2MGZA 1YTYA 2VFRA 1KSPA 1I1GA 3GIRA 4IR1A 1HNIA 4OHYA 4WXWA 3MTKA 1WI6A 2GHVC 3DYAA 4CTAA 2EBGA 2GVZB 2V34A 4M63A 1KLNA 4LUBA 1SC4B 2WSCC 1FF2A 1VQ6S 1NB7A 4QWBA 1M5SA 3P5BP 1WJ9A 4EZ6A 4CLKA 4YB1P 1VQMS 3OFHA 2XB2D 3EDQB 2JOQA 4OX9J 2KVIA 3HHLB 4RJVA 4B9TA 2Y9HA 2O1PA 4K4SA 1Q81T 4NASA 2IPOB 1OPZA 1HMVB 1RWPB 3O44A 3EWGA 3PCOB 4F4XA 2HZAA 1FTRA 5ETQA 2HKEA 4E2FB 1XNRF 1TMMA 1PGZA 3MMAA 3ADAC 4DPXA 3TJ9A 1JXLA 2K06A 2OHDA 2RRBA 3ULHA 3R8YA 4URGA 2DNNA 3GPAA 4DR1J 1VS3A 5KFUA 3JYTB 3Q0AA 2QFIA 2OIHA 1HMVA 4DUTA 3CCQS 4UZCA 3DRSA 4LF1A 2Y1LB 1L5UA 2JJ4D 4K5SA 3Q83A 2A6OA 2GIQA 1HA1A 4F4ZA 1NDPA 4A8XA 1CS4A 3CDUA 1WEZA 3MCOA 4OYOA 4CDIA 2AWZA 4L72B 2AYMA 3B82A 2RNEA 2U1AA 3EVMA 4N8NA 1LK5A 4USTA 3CJKB 4CI0B 5LXYA 4DQPA 1FJGJ 2RB7A 1SQEA 3BZQA 4TNOA 3E51A 3EGWB 1RHRB 1B0TA 2C2OB 1CS4B 3Q24A 1TELA 2HVIA 3LQVA 1N5SA 1DTQA 1F6TA 4W92B 1AXQA 3AQPA 5KFGA 3OFEA 3PJXA 3GIIA 5FIIA 4CRJA 2R7WA 3RJMB 3H5YA 1MMDA 4YR2A 2L9WA 4KGZB 2CXEA 3K8VA 2XYPB 3QRRA 3D1OA 1SH3A 4DV5J 5DG7A 4I2QB 2HK3A 2WOMB 4K4UA 4DX6A 3ENQA 2FY1A 2ZWOA 3PDNA 1J5EJ 3GYXB 3Q89A 5H9FJ 2L9NA 3THPA 3MEEA 4USUA 1RACB 2ZBCA 4RW9A 2G1HA 2V5HG 2DR5A 2XMJA 5K8NA 1CJTB 3C2PA 2VQFJ 2MLXA 2CQ0A 4MK9A 5KFCA 1WHYA 4U9RA 4DR2J 3ILJA 4NMXA 2LMIA 4CM0A 3A8EA 4ICLB 2JLFA 2M9KA 3GMGA 1UJ5A 5E41A 2KXHA 4JYAJ 3DU5A 4KFBA 2JEFA 3FJ2A 2DPIA 3G96A 2OEJA 3ENWA 4P72A 2XO6A 2LQ8A 3ETOA 2W8KA 3KG4A 1HBMB 3BB5A 3DOKA 4IOCQ 2R2RA 3FK4A 1IR0A 2UU9J 2W2MP 3TP2A 3CMES 1S6OA 2VC0A 2MHEA 3FQKA 4LR8A 2F1FA 4KHRA 4MKAA 4PXBA 4I2QA 2M7SA 3NCRA 5KG1A 3HSGA 2MGZB 1TR0A 3HHNB 1C0UA 1GMVA 2YKMA 3QO9A 2M8DB 2KFNA 2DHSA 1VQ4S 3CC4S 5KFOA 4RU9A 4ECWA 4Y2IA 2P2CB 2OPPA 2AGPA 4GKJF 4WU2A 2DHGA 3MMCB 2RDIA 4QR1A 3M2RA 4J9RA 1W25A 1CG2A 2B4OA 2DXDA 3I9V9 4QWCA 3KLFB 1TL4A 1SKRA 2H54B 4F4WA 2CQIA 3CCVS 1RI7A 4CO5A 4CLFA 2DO0A 2BJEA 2D7SA 1FK9A 1S7IA 2M52A 2QLBB 3SBMA 2CQPA 5F0UA 3T5LA 2V4JB 4DL6A 3K5PA 5D8HB 4Q8EA 1BWEA 5CXTA 1NK7A 1BC6A 1ZPWX 1TU0B 2CPFA 4KV8B 2IRXA 3BPDA 2CNKB 2Z56B 3D3BJ 3EJMA 3GG0A 4HH0A 3EXYA 4HT7A 3QLHB 3PHEA 3W61A 2MKJA 2YNFA 5L9NA 1T7PA 3TUPA 4ERDA 1IKWB 2CQ4A 1IBMF 3JSBA 3RAXA 4TLQA 4Y2MA 1KOOA 2CJBA 5E3PA 1T05B 5J2NB 3RG6A 3FQLA 1RAHB 5J2NA 3P45B 1WKKA 5IV3A 3MI7X 5F8MA 3CVKA 3U7JA 1KLMB 2HRTA 5B08A 5HJYA 1OMSA 1U7LA 2VQFF 4URSA 1X0PA 3V6HA 2VBWA 4LF2A 4MKYA 2Z4PA 1M5KC 2IVMA 2Y1JA 3Q8UA 1HI0P 2HAIA 2JX2A 2I0XA 4XDDA 4W4MA 2R2SA 3L7UA 2HQFA 4DPOA 2Y0BB 3PRVA 4YY3J 4OI6A 2MKSA 1JJCB 2HK2A 2OMLA 3RUBL 2QL5B 4AT1B 5T7LB 3C6UB 1KQFB 2H51B 2DBBA 3I0SA 4M1KA 4ZIWA 1UVKA 4N41A 2FGCA 1X5OA 2AJFE 3QGHA 1HW9A 4J9UE 1LWEB 1NH8A 2BE9B 2F5GA 3PNIA 3TW0A 5KFBA 3KMQA 1IJEB 2QLWA 3FEYB 1N33F 1LW2B 3UNGC 1FNOA 1H2VZ 1S57A 4KKOA 1L3UA 3QATA 1J5OB 3BR9A 5K8MA 1VJQA 2FC8A 2RRAA 1SC1B 1S1WB 1N52B 4EEYA 4DQIA 4AD6A 4KAIA 4QWEA 4UOHA 1URNA 1XTZA 2ZNZA 2PEBA 3DNCA 2BJDA 3TWZA 2NCKL 1BWVA 5C42B 2GMJA 3L3CA 1L3SA 3H2VE 4HACA 1RHKB 5KTQA 5E7OB 3KLGB 1A7GE 3OBIA 4ECXA 4WFAQ 1NK8A 5LM7E 4JI1F 3KG0A 3A12A 4WFBQ 4NXNF 2PA3A 1C1BB 4FKYA 4CP5A 8RUCA 3A3PB 1U0SA 2NUHA 5LT5A 4IG3A 3UR3C 3I87A 4K2XA 1RHUB 1NSAA 2OLWA 5EN1A 4RPFA 2DKOB 1E6VB 4YMEA 3I5AA 1TL1A 3NOGA 2HLUA 3RW7A 3F41A 3OLBA 3S6EA 4DR5F 4CLZA 4ECZA 3DMJA 3CUNA 2MLZA 5GMDA 2ZBIA 5E3CA 3BBCA 3G87A 5HVGA 4DL4A 4DR6F 3NLCA 1FX2A 4J9KA 2Z30B 3X3UA 5DQIA 2JLEA 5HROB 2HVZA 1FFWB 4DL5A 4NI2B 2DJWA 4GKJJ 5DRKA 4DU8A 4PWUA 1I51B 3CCRS 2EI5A 4RX6A 1D9AA 3JQMA 2JEIA 3PO5A 2B43A 3OL9A 3M2VA 4NLUA 4QR2A 3A3OB 4OZJA 3V6DA 2R8KA 2Z0GA 5HMZA 3J7AN 1P1LA 1Y11A 1T3NA 5HK4A 1BQMA 4DJBA 2N7CA 2Q66A 4A4JA 4B3TJ 3PTWA 4KBIA 4R5PA 1LFPA 3IGVA 3LGNA 3LW5C 3W65A 1PJ6A 2C3PA 2HQ3A 3FMWA 4NXMJ 1F5CA 3NMRA 1JJHA 1UPMB 1RABB 4Q7AA 4OZ1A 1K1SA 1CJTA 4KJIA 1VQLS 1WHWA 1S12A 4FYDA 3R5AA 1RWOB 4KY3A 2J7UA 3TOQA 3OSPA 2BACA 1UVMA 3VCDA 3AT1B 1DARA 4MK7A 2C2ZB 4ZP7A 1BXNA 2LU1A 2MZQA 2YX7A 3LO3A 4FYXB 4PCQA 2G2ZA 2LXIA 3DDNA 4C48A 4CZCA 4TXSA 2ZJQQ 1HWUA 3IBFB 5LXRA 2YWFA 3DRPA 5B0AA 1PILA 1KVJA 3G6YA 3DRRA 4PUOA 1UZHA 4NLPA 4C8ZA 2EFGA 2JHEA 3CEDA 4M5LA 4A8MP 4DFMA 1B99A 2L3MA 1WORA 4JV2A 4C8YA 1K0VA 1T3OA 2DNLA 2CWKA 1VQ9S 1MLAA 2GQ2A 2FD2A 2JH3A 1WDTA 2KHCA 2RE1A 2YTCA 3E8OA 4LT6A 5DJBA 3GV7B 4URQU 5BYSA 2ZM6F 2XMUA 4I2PA 2XYHB 2FPHX 1U2FA 4NLWA 1FKOB 2FVCA 1FI4A 1R8CA 1Y5LB 3OT9A 1N5YB 3LPEA 4HTIA 2HAFA 4NZ6A 2ATLA 2XTJP 2ZC3A 3IXQA 1XEZA 1S0MA 4RU2A 5K9FA 1H72C 2ATCB 3I5BA 4ILMA 2EFOA 4RBUA 2FLPA 3BSAA 3ZZOA 2XGPA 2UUTA 2WVFA 3HCXA 5RUBA 2BDPA 4YHHF 4JI3J 3CULA 1NH7A 4C3MA 2C3UA 3KK3A 5JMNA 1WSRA 4B9SA 2HBRB 3Q8VA 1NPRA 4BWMA 5L46A 5CD4A 1ACMB 1Q78A 1H0HB 1Y0HA 3OXGA 2EC2A 4RKUC 1WSVA 2V4RA 4X66J 2MY8A 1N8RT 4MIBA 3FZ2A 3I0RB 4ECRA 1KWMA 2N7YA 4QU6A 4Q44A 3QMQA 1I94F 2XBPA 1NHKL 3QPIA 4TU9A 3PR5B 2RT3A 2RHSB 2VOOA 2QA2A 1RUSA 3D0IE 1CJKB 4I4BA 4OX8A 5C5JA 2H5EA 4WJBA 3UO0A 2D1CA 3HZGA 1XR7A 1QUPA 2N4DA 3SCJE 3TEHB 1GMWD 1VBKA 2G9OA 1HQ2A 1TVRA 5FJ4A 1RXOB 1RBOB 1NJYA 1QJHA 2QA4S 1YI2S 1U24A 3B4DA 4QOTA 4PKDB 1X5SA 2BJ7A 4JI8J 3AXMA 4O4GB 2GGPA 3CIMA 3NCPA 3O1LA 1SQGA 5HMWA 4N7TA 1PBAA 2HIQA 2PD1A 2PA8D 3JQKA 1HI1A 2NZ4A 2IBKA 1NEEA 1PBUA 3U1MA 2DNMA 1HNZF 2MB0B 2GJ2A 3BN4A 1JLAA 4DPTA 1ZM3A 2DR9A 4PG5A 4Y34A 3W66A 3JB9k 4RBTA 1XNQJ 1XR5A 4ES1A 2WVEA 5I3QA 1VGYA 3KK1B 4RW8B 1H74A 5J1EA 2IJNA 5G4DA 3TYTA 2YNIB 3W9IA 1RKJA 1E6VA 3PHTA 1FJ7A 5IQQA 5BXIA 4YS2A 3R7BB 1NPKA 4JI4J 3QRPA 1QTMA 4IG3B 4DL2A 3N0VA 2LECA 3ET6B 4O0NA 4F7VA 4ZJQA 3NGKA 4TU8A 4IOBA 3R6GB 3JAMY 2D3UA 2DGOA 4C0BA 2HGLA 1NB2A 4CLWA 3FEZA 5KT6A 1HR0J 4WP8A 4LF9J 1M1KT 1FTCA 3I0SB 5KFPA 1D9DA 1OY6A 4ED2A 1SIWB 4V1Ak 1X4AA 2XY6A 1N32J 2B4UA 3VZHA 2XMKA 1IR2A 1XMOJ 5DDRC 1Y10A 3FSXA 2DT9A 5ETMA 2V67A 2XULA 2ZE2B 4O0IA 2W9BB 1S9GA 1R89A 3GB0A 1YRXA 1WG5A 2BRKA 1DHMA 1SV5A 2HGMA 3HDSA 4X65F 1Z1ZA 3CO0P 3KHRA 1FA0A 5I3UB 4WZMA 3ZTOA 1LW0B 2Z58B 3KLIB 4KGVB 5ETVA 1NPPA 4OI4A 4CQ1A 1VRTB 3S8SA 2QA4G 2H65B 1EJ7L 1N32F 2XSJA 3RGIA 4CLUA 3P5TL 4FXWA 2XMAA 1DQ9A
chains in the Genus database with same CATH topology
2CWKA 1K44A 3Q86A 1WKKA 4UOFA 4FKXA 2AZ1A 2DXFA 3Q8UA 3R9LA 3FCWA 2DXEA 3L7UA 1VYAA 3VGVA 3BBFA 1NDKA 3PRVA 4UOGA 3NGRA 3GPAA 3VVTA 2HVDA 1NSQA 1HLWA 3GP9A 4DUTA 5C7PA 1XIQA 1WKJA 1U8WA 4DI6A 3DDIA 3Q83A 3PJ9A 1NDPA 3ENAA 3Q8VA 4ENOA 3NGSA 3B6BA 1S57A 2AZ3A 5IOLA 3Q8YA 3EVMA 2VU5A 1NHKL 1JXVA 4UOHA 1WKLA 3VGSA 4C6AA 3DKDA 3EVWA 2NCKL 4ANCA 3EMTA 1F6TA 3ELHA 2DYAA 1MN9A 3G2XA 4KPCA 1KDNA 1NDCA 3ZTQA 1NUEA 3ZTSA 4EK2A 4FKYA 4CP5A 4HR2A 1PAEX 3NGUA 3FCVA 1LEOA 3BH7B 3EM1A 1NCLA 3ZTPA 1UCNA 1B4SA 2BEFA 3Q89A 4S0MA 4ANEA 1NLKL 3EE3A 1W7WA 3BBCA 4WBFA 1BUXA 2BX6A 2HURA 1BE4A 3EVOA 3FBEA 3EICA 1S5ZA 1S59A 3FBFA 1MN7A 1F3FA 5BXIA 1NPKA 1NSKL 1LWXA 3ETMA 1XQIA 4O0NA 1HIYA 3BBBA 3B54A 2B8PA 2DY9A 3FBBA 1NB2A 4ANDA 1BHNA 3VGUA 4W98A 1HHQA 2DXDA 3BH6B 4F4AA 3WX8A 5CAAA 4DZ6A 3VGTA 1ZS6A 1NSPA 1EHWA 1PKUA 2HVEA 3EJMA 3JS9A 2B8QA 1NDLA 5CABA 3ZTOA 3MPDA 3FC9A 3ZTRA 4F36A 2ZUAA 3VVUA 3NGTA 3FKBA 1B99A 3FBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWK A;  1K44 A;  3Q86 A;  1WKK A;  4UOF A;  4FKX A;  2AZ1 A;  2DXF A;  3Q8U A;  3R9L A;  3FCW A;  2DXE A;  3L7U A;  1VYA A;  3VGV A;  3BBF A;  1NDK A;  3PRV A;  4UOG A;  3NGR A;  3GPA A;  3VVT A;  2HVD A;  1NSQ A;  1HLW A;  3GP9 A;  4DUT A;  5C7P A;  1XIQ A;  1WKJ A;  1U8W A;  4DI6 A;  3DDI A;  3Q83 A;  3PJ9 A;  1NDP A;  3ENA A;  3Q8V A;  4ENO A;  3NGS A;  3B6B A;  1S57 A;  2AZ3 A;  5IOL A;  3Q8Y A;  3EVM A;  2VU5 A;  1NHK L;  1JXV A;  4UOH A;  1WKL A;  3VGS A;  4C6A A;  3DKD A;  3EVW A;  2NCK L;  4ANC A;  3EMT A;  1F6T A;  3ELH A;  2DYA A;  1MN9 A;  3G2X A;  4KPC A;  1KDN A;  1NDC A;  3ZTQ A;  1NUE A;  3ZTS A;  4EK2 A;  4FKY A;  4CP5 A;  4HR2 A;  1PAE X;  3NGU A;  3FCV A;  1LEO A;  3BH7 B;  3EM1 A;  1NCL A;  3ZTP A;  1UCN A;  1B4S A;  2BEF A;  3Q89 A;  4S0M A;  4ANE A;  1NLK L;  3EE3 A;  1W7W A;  3BBC A;  4WBF A;  1BUX A;  2BX6 A;  2HUR A;  1BE4 A;  3EVO A;  3FBE A;  3EIC A;  1S5Z A;  1S59 A;  3FBF A;  1MN7 A;  1F3F A;  5BXI A;  1NPK A;  1NSK L;  1LWX A;  3ETM A;  1XQI A;  4O0N A;  1HIY A;  3BBB A;  3B54 A;  2B8P A;  2DY9 A;  3FBB A;  1NB2 A;  4AND A;  1BHN A;  3VGU A;  4W98 A;  1HHQ A;  2DXD A;  3BH6 B;  4F4A A;  3WX8 A;  5CAA A;  4DZ6 A;  3VGT A;  1ZS6 A;  1NSP A;  1EHW A;  1PKU A;  2HVE A;  3EJM A;  3JS9 A;  2B8Q A;  1NDL A;  5CAB A;  3ZTO A;  3MPD A;  3FC9 A;  3ZTR A;  4F36 A;  2ZUA A;  3VVU A;  3NGT A;  3FKB A;  1B99 A;  3FBC A; 
#chains in the Genus database with same CATH topology
 2EPI A;  2HPU A;  4CH0 S;  2LDY A;  4A48 A;  1HWK A;  3GU0 A;  4J37 A;  4FBT A;  1TFW A;  2GHP A;  1RU2 A;  3D66 A;  4RW9 B;  3QIP A;  5B7W A;  4RWW A;  5F8I A;  2FQQ B;  2MKH A;  3GFZ A;  3ET6 A;  4X84 A;  2UVW A;  2ZIT A;  3R9L A;  5KFM A;  3DM2 A;  4ZVG A;  2B6A A;  1JKH B;  1DLO A;  2HNZ A;  2R4F A;  1WAC A;  4FVM A;  2EVZ A;  2Z2Z A;  2W4D A;  5EUH A;  4UT4 A;  3OLA A;  4USH A;  4KT0 C;  3OR2 B;  1FD2 A;  5HP1 B;  1HAR A;  3GP9 A;  1W2I A;  2YNH A;  2KG0 A;  1YJT A;  2XLK A;  3BKU A;  3QT6 A;  4J90 A;  3MPW A;  4DOZ A;  4PXD A;  1NXI A;  2IYI A;  4JV5 F;  4FP9 A;  3RR7 A;  3NGD A;  4XDC A;  4LFC F;  2XMT A;  3KHG A;  5L1K A;  2NZC A;  3CCW A;  3CCZ A;  4OYI A;  3M6W A;  1H7W A;  2GQC A;  3IS9 B;  4DEZ A;  1YZ7 A;  4Z2X A;  2KM8 B;  3V4I B;  4FDF A;  2RML A;  1K1Q A;  2CPD A;  2FJX A;  3A1Y G;  2C2K B;  1EP4 B;  1OO0 B;  1FKO A;  4MFB A;  1XK8 A;  3MEG A;  3MM9 A;  5A0Y B;  1JXV A;  1Q53 A;  3DKD A;  2GFF A;  5AT1 B;  3I4P A;  3OR1 B;  1DBD A;  2CDQ A;  2KHD A;  3KJQ B;  1H3D A;  1V5V A;  2P9G A;  1T9U A;  4KHM A;  3T5H A;  2W7A A;  4UQT A;  4XTT A;  3SSS A;  2ZC4 A;  4ZPW R;  1R6Y A;  2HS3 A;  2MMY A;  3AA9 A;  2ZOF A;  4WK3 A;  2OD4 A;  3C15 A;  4Y28 C;  1NK5 A;  1C0U B;  2YKM B;  3QO9 B;  1QM9 A;  4DSF A;  2IRU A;  3TZW A;  2GQQ A;  3W7B A;  4RNN A;  1TL3 B;  3EZU A;  1V3Z A;  4TYB A;  3OTD A;  4WFY A;  3OJS A;  3K5M A;  2LKZ A;  1EQ0 A;  1PYS B;  2BV3 A;  3LP0 A;  1TL3 A;  1U26 A;  3C15 B;  2LXU A;  2MQM A;  3D6H B;  1QE1 B;  2V4Q A;  3TAR A;  2EFP A;  3PRD A;  1JIH A;  1SB6 A;  1SCJ B;  2HZC A;  3DLK A;  2ZVI A;  3N5B A;  4GVB A;  2XLJ A;  3DLG B;  4KO0 B;  2I38 A;  3OR1 A;  1F1B B;  4DR7 F;  2C3O A;  3RB4 A;  1VBY A;  2A0F B;  1TFY A;  3B78 A;  2BAN B;  2H4W B;  2C3Y A;  3R5C A;  4MFB B;  4NYP A;  3FDS A;  2KXN B;  4MJK A;  1F3F A;  4GMK A;  3H5X A;  1N5T A;  1N34 F;  3L9Z A;  1B7F A;  3M2U A;  2VBX A;  4F2S A;  1RSC A;  1CBK A;  1X4E A;  4WIQ A;  3D6T B;  2AEF A;  2YPY A;  2ACY A;  3PZP A;  2KZM A;  2W24 A;  4ZK7 M;  3BBB A;  2GC8 A;  3E2E A;  2BE7 D;  2HFS A;  3BSO A;  1YKW A;  2NXJ A;  1UWA A;  1YSJ A;  2ROE A;  2J0X A;  1JLF A;  1RCO B;  4P2X A;  4A8O A;  2UXC F;  4C0O C;  3SQG A;  4ZVR B;  4ED4 A;  3HSZ A;  1XWL A;  2QMX A;  4DV3 J;  1D9F A;  3M8Q B;  5IT9 U;  3FFI A;  4DR3 J;  4DQS A;  3MR2 A;  2ZH9 A;  2UXB J;  1NO8 A;  4DZ6 A;  2BM0 A;  1G1X A;  5H9E J;  2FYX A;  1RT4 B;  3G4S S;  1ZAX A;  1RWU A;  2BJ1 A;  1FES A;  1QY7 A;  1KQG B;  5K14 A;  3KYL A;  2V9W A;  3IRX A;  2QYG A;  2I5J B;  3GJR B;  3KHL A;  3T6B A;  3T19 A;  3CC2 S;  2HWH A;  4PPZ A;  2WSE C;  4ZP9 A;  3RYL A;  2UXC J;  1FKP B;  3M6X A;  5F9N A;  2HRY A;  5IC6 B;  1TUV A;  2A18 A;  2LQ9 A;  1S9E A;  2WW8 A;  3HHL D;  4DV7 J;  1JNR B;  1YJV A;  2XMM A;  4ILR A;  4PAB A;  4DDF A;  5GMK a;  4FBU A;  2HS0 A;  2HQI A;  3JYT A;  2CQH A;  1KFD A;  1RJJ A;  3M05 A;  4RLE A;  1RAF B;  1JLG A;  4R5P B;  5CH7 B;  2BA9 A;  2B7B B;  5HO4 A;  1H7X A;  1LV5 A;  4Y00 A;  3SZ2 A;  1VBX A;  1NJI T;  4UOG A;  4GVL A;  4RUH A;  3KMS A;  4QBU A;  1X60 A;  1F5A A;  1RTJ B;  4WII A;  2XHW A;  2V0N A;  2W2O P;  4RUA A;  4KGM A;  1SBR A;  1UL3 A;  2VFS A;  3MAA A;  3U27 A;  4DX7 A;  4DG1 A;  2ADB A;  4WF9 Q;  4ZVQ B;  1GNK A;  4IO1 A;  4MIW A;  1RTD A;  3DDI A;  2GCF A;  2K3I A;  2E9R X;  4LSN A;  5J2M A;  1WDD A;  1KKH A;  1IBK F;  3ILL A;  1DLO B;  1UZD A;  3IP0 A;  3FRZ A;  2ZJP Q;  2OFG X;  1RIS A;  3RB0 A;  4E98 A;  4DV0 F;  3QAE A;  4B3O A;  3H0P A;  2HSE B;  3H5S A;  1YBU A;  4OQJ A;  4TY8 A;  2QL7 B;  1NJW A;  2A2C A;  3SIP B;  1S6Q B;  2EKN A;  3G6E S;  1RE1 B;  1HFE L;  1FWK A;  1QDU B;  2GML A;  3PYD A;  1UFW A;  3Q8R B;  3PY8 A;  2HYI B;  1FXL A;  3S7R A;  4QJV A;  3QWU A;  1N34 J;  5DG8 A;  2ZH3 A;  1YVF A;  4X62 J;  1Q0N A;  3MMC A;  3J7Z 5;  3DRY A;  3QGI A;  1S48 A;  4RO0 A;  3C19 A;  4BBY A;  2MSS A;  3QJP A;  3R97 A;  2G13 A;  1T03 B;  1N6Q A;  2AMC B;  2OD6 A;  4ZCL A;  1LEO A;  2ROP A;  3MM6 B;  3EM1 A;  1NCL A;  2ZE2 A;  3GLJ A;  4K0K J;  2W8L A;  2OGU A;  4FN5 A;  4Q8F A;  5KG4 A;  4X64 J;  4CNZ A;  1PAU B;  1DTT A;  1WD6 A;  4DL3 A;  2J6T A;  1F2G A;  1VDH A;  1U49 A;  4O3P A;  4JI7 J;  1NLK L;  4Q2L A;  1TAQ A;  1A0O B;  2PMH A;  3H59 A;  3OTB A;  2AYG A;  4MKV A;  1GMU A;  4ELV A;  4F2R A;  2R7Q A;  3P3D A;  3TVK A;  4Q45 A;  2CNO B;  2JFK A;  1RA7 A;  3AXK A;  4USM A;  3C14 B;  5EWG A;  3RTV A;  3MEC A;  2BBE A;  3L7P A;  2KB2 A;  4ZA1 A;  5M2U A;  3HK2 A;  3X1L B;  1G2E A;  3OFF A;  1HNV A;  4PG4 A;  3UE2 A;  3BQ2 A;  1B7Y B;  1IKY A;  3MGJ A;  1Y7P A;  3W8G A;  1D8Z A;  3DU6 A;  3MF5 A;  4JI0 F;  3P6Y C;  3NWR A;  5CHC B;  3T9N A;  1GT8 A;  2FJA B;  1GTE A;  2ZOM A;  4LRF A;  1RZM A;  3AA8 A;  4OI3 A;  4RWX A;  1S1V B;  4LRE A;  1REG X;  4C0H A;  3M9O B;  3J7A 1;  5LOQ A;  1X7V A;  1T02 A;  4IDK B;  4ES2 A;  5DQH A;  4M95 A;  4DV0 J;  3PX6 A;  4ZPC A;  5ETT A;  3QFH A;  1LOU A;  2QRR A;  1EET B;  1TL7 A;  4FNI A;  2NLW A;  1K0T A;  1UJ4 A;  4NCA A;  2GIR A;  3LF0 A;  1H38 A;  2HW3 A;  4J9P A;  4QYZ J;  1LXJ A;  4M5D A;  1X5T A;  4ZVF A;  4CYU A;  4EBD A;  2W4P A;  2PGC A;  2VC1 A;  2DNH A;  1ZET A;  2RAQ A;  2UV8 A;  4FNH A;  3RR8 A;  3CD6 S;  2W2Q P;  2ZDO A;  3L4B C;  1P27 B;  1TKZ B;  3GJQ B;  1U6F A;  4NLD A;  5HMY A;  2RVJ A;  3CCJ S;  1PJ7 A;  2Q3P A;  2YKP A;  2HFN A;  3AB4 B;  3M7V A;  5C2C A;  2CUY A;  3M8Y A;  4RW6 A;  4JI6 F;  3IWN C;  3V4I A;  3K5N A;  4JI2 J;  1PKU A;  4UY8 5;  2DY1 A;  5CCM A;  4KTQ A;  4UZB A;  1MSW D;  1TQL A;  2BJ3 A;  2QA1 A;  1FO1 A;  2RJZ A;  3G8Q A;  3J81 j;  1YBT A;  3ZTR A;  2UUC J;  2BYC A;  2ZUA A;  3NRB A;  4DR5 J;  2ZJR Q;  1NKB A;  4USW A;  2YQ3 A;  5CYM A;  3OUY A;  2IVF B;  4IFV B;  3VR1 A;  1CJK A;  4ETX A;  2K2P A;  1HBO A;  3ITH A;  4WWS A;  1S1U A;  1DAX A;  1HBO B;  4DG1 B;  4B9V A;  4OHZ A;  5CYM B;  3OUY B;  1GK8 A;  3ISN C;  3NXZ A;  2A10 A;  2DD8 S;  3QBC A;  4FKX A;  4FYW B;  3ZO7 A;  3OVB A;  3D5M A;  3ZZ0 A;  4HTJ A;  2XS7 A;  3LP0 B;  2WVC A;  3PEH A;  2XM3 A;  1CQN A;  4P74 A;  5FDL B;  3QGG A;  5F8N A;  1RWX B;  1C4A A;  2CQG A;  1UW9 A;  4QIV A;  4Y6I A;  4DL0 C;  4JYA F;  3VGV A;  1EAY C;  3SYZ A;  4DF8 A;  2YKQ A;  1FXR A;  4WFX A;  3I31 A;  4ZHR A;  4JI3 F;  1HNW J;  4PWD A;  1G4C A;  2HQD A;  2IYG A;  1UKU A;  1YJ9 S;  4OZ5 A;  4QIF A;  4K50 A;  3F56 A;  4B02 A;  2DR6 A;  2HHX A;  3P8B B;  1NRK A;  3IBC B;  3SDE A;  2IIH A;  4AQY J;  3GYG A;  3OW2 R;  4PPD A;  1Y3K A;  4DMZ A;  4OL8 A;  2I5J A;  2CJX B;  4ZHR B;  2IDE A;  2H4Y B;  5E5N A;  4PWD B;  2C2D A;  3UVJ A;  1CJV B;  5DDP C;  3VZI A;  5I3U A;  4TYA A;  1HNW F;  2AZ3 A;  1FRJ A;  4ELT A;  3TA1 A;  1IJF B;  2A3J A;  1FFG B;  2MZR A;  3A8I A;  4NLX A;  4OZL A;  3GQC A;  2WOM A;  3VAG A;  3J80 Y;  1FWP A;  3HT0 A;  3PXG a;  3SQG B;  2WTF A;  1VRU A;  4X4S A;  1YJR A;  4QQB A;  4WKY A;  4JI0 J;  1PC4 A;  4OIX A;  2WVB A;  3C16 B;  2YNG A;  4YEA A;  4TQR A;  2KZZ A;  4AUK A;  3BN7 A;  2W2N P;  2OSQ A;  3QID A;  1N54 B;  1FNM A;  4E8U A;  2OUG A;  3GV5 B;  4QYR A;  4CCH A;  3DRP B;  2RQC A;  1N36 F;  2DNO A;  1SVD A;  1Y3J A;  3MM9 B;  5J2Q B;  2CZ9 A;  3NNH A;  2IY5 B;  3HKW A;  3AB2 B;  1CC7 A;  3IBW A;  2CJY B;  2MQN A;  1U8S A;  1WF2 A;  3M8W A;  4P7T A;  4TKT A;  2BEF A;  2C22 A;  2ZDP A;  5HQ8 A;  1RT3 A;  3NS6 A;  3DHW C;  4PZV A;  3ZZU A;  3RB3 A;  2Y1R I;  3QIP B;  4FPI A;  1S99 A;  4KGK A;  1RBA A;  1DY3 A;  1HHS A;  1T03 A;  4MMO A;  2R7S A;  4LF4 F;  1GMW A;  4C11 B;  1C1C A;  5D4N A;  1EET A;  1TL7 B;  7FDR A;  3MUT P;  2FVQ A;  2G4B A;  2YH1 A;  4CT9 A;  1FRK A;  2RH3 A;  1RHJ B;  3R3T A;  3VQS A;  2AGO A;  1ZM9 A;  3W60 A;  4CNY A;  3CCE S;  3CCS S;  3T41 A;  3CF5 Q;  3RBE A;  3FBF A;  4BCA A;  1S77 D;  1NHV A;  4FXD A;  3HD1 A;  2EK6 A;  1KS2 A;  2E1C A;  4LF7 J;  3D3C J;  2O5D A;  2Q43 A;  1TV6 B;  4ZVP B;  4G1Q A;  2XWX A;  3Q2S C;  3V4M A;  3NS7 B;  4Y3C A;  3W5X A;  1U0H B;  1N0U A;  3PX0 A;  1F60 B;  2A2D A;  2BKN A;  2EW9 A;  3SQO P;  3I56 S;  2N3O A;  1XNQ F;  3ZZR A;  4DX8 H;  4AND A;  3VAJ A;  1N56 A;  2LDI A;  1YJW S;  2X3D A;  3QQC D;  3PIO Q;  2LA4 A;  3MM8 B;  3KUH A;  5IXU A;  4KH0 B;  3TAN A;  2E1A A;  2HRU A;  2IHR 1;  2PEH A;  5KFE A;  2DRB A;  1R8B A;  2HEK A;  4NLR A;  1RGV A;  4B3M J;  3MOJ B;  4ZPV R;  3KOA A;  3VAH A;  2AX1 A;  5DLF A;  1LQ9 A;  3SV3 A;  3R27 A;  2VKZ G;  1Q7L B;  3GSI A;  4F0K A;  3CWJ A;  4OV6 A;  1P9Q C;  1IN0 A;  2YX1 A;  5F41 A;  4OYZ A;  4WYW A;  2VFT A;  5AE1 A;  2FLO A;  3U1N A;  1ZPV A;  4QYZ K;  4PG7 A;  4LVO P;  2EG1 A;  1QVG R;  4USV A;  2HFZ A;  5KFL A;  2YWH A;  4LIW A;  3VQT A;  5KG7 A;  2ZH7 A;  2PO4 A;  2J9C A;  5KFJ A;  2D3O R;  3MOZ A;  2H1Y A;  3MED B;  1N6Q B;  3T1H J;  2VFV A;  4DWI A;  2LU2 A;  5AXM A;  4CO0 A;  4GKK F;  2FC9 A;  3W9J A;  4CIO A;  2IAJ A;  5KAK A;  2R2U A;  3GJT B;  3UCZ P;  3R7S B;  2VAS A;  3FGV A;  1KON A;  2DHA A;  4UOF A;  4B17 A;  3DLH A;  5DM6 Q;  2QEX S;  2QFJ A;  1RHQ B;  4DR6 J;  1IKW A;  1TKX B;  1T0T V;  2BVZ A;  4OYW A;  4PYD A;  3RBZ A;  2XLI A;  3BO4 A;  1H2U X;  3H90 A;  1RCX B;  5KT3 A;  2C42 A;  4RW4 B;  2GGP B;  2HNY B;  3A8K A;  2YBV A;  1LWF B;  2VD3 A;  5HAN A;  1TKT A;  1NBE B;  4ECV A;  5ETS A;  3M8S A;  4CH7 A;  3VTI A;  2Q6C A;  5KG0 A;  1U45 A;  5H9F K;  4LF7 F;  4MTP A;  2VG6 A;  3R5J B;  1KQK A;  4FS1 A;  2GS8 A;  2VH7 A;  3UI3 A;  1RWK B;  3PJ9 A;  4X65 J;  1R27 B;  1JLF B;  2XWY A;  4P52 A;  2R8G A;  1NK4 A;  4P10 A;  1HBU A;  2CRL A;  1FRH A;  3B6B A;  4PQA A;  2R7U A;  3C3L A;  1SUQ B;  2J0S D;  5G0R B;  1YRT A;  3PAC A;  1S76 D;  2FDN A;  5IQ6 A;  3QZ8 A;  2XI3 A;  1V6H A;  1CUL B;  2P9C A;  3MPV A;  4YQW A;  2UXD F;  1ZAV A;  1ZZF A;  1NAQ A;  2G0C A;  4XPE A;  5GME A;  2KJV A;  1RT6 B;  4I1T A;  4ICL A;  2BAN A;  3ZFV A;  4LR9 A;  4QWD A;  1RTH B;  1S9E B;  2FUG 9;  2KDO A;  1KTQ A;  2VF3 A;  4LFB F;  4IYQ A;  1O6X A;  3SDE B;  2G1D A;  4EYI B;  3EPI A;  4LFC J;  1MWQ A;  2KXF A;  2O67 A;  3BV8 A;  5D0R A;  1FKP A;  1Q1K A;  4O4R A;  1SJF A;  2CQD A;  1QAX A;  1L3V A;  2HHV A;  2MKI A;  2AEM A;  2DIV A;  3EZ5 A;  4M5J A;  2OTJ S;  3BH7 B;  1FFS B;  2CPY A;  5I3P A;  1VC6 A;  3BQ0 A;  3WC2 A;  1Q8I A;  5KFK A;  2IA6 A;  2W01 A;  3R5D A;  2AV5 A;  3R1L A;  4L76 A;  4DSK A;  1NKC A;  1JLC B;  1P6T A;  3NNA A;  1OQ6 A;  5F0W A;  1P9Y A;  2LYV A;  4DZD A;  4OV1 A;  3CJT A;  3FBE A;  4PG6 A;  1S7H A;  4IG0 B;  4YR3 A;  2HHT A;  1ZH5 A;  2DNZ A;  2Z57 B;  2V8P A;  3H8Y A;  3AOB A;  3J7Z T;  3MFI A;  2WZ1 A;  2U2F A;  3CGI A;  1U1M A;  1HBM A;  3DOK B;  2DHH A;  3HHL C;  5IZH A;  3THV A;  1G6B A;  1VRQ C;  3DXS X;  3ZC4 A;  1VHI A;  4DFK A;  1WF0 A;  1SIZ A;  4HHJ A;  3FNN A;  1EZZ B;  3GIJ A;  1XJW B;  2HFO A;  4V19 J;  4JV0 A;  4DUZ F;  1U48 A;  3W63 A;  3D67 A;  3UD5 A;  3F44 A;  2X7I A;  4DR4 F;  2X1F A;  3W5Z A;  2JWN A;  1RB0 A;  2KI2 A;  3E01 B;  3ZXW A;  3DLE B;  4R8U B;  1U1L A;  4IRD A;  1NK6 A;  5DGB A;  1PG5 B;  3LWM A;  1T8E A;  3QZ7 A;  3TR5 A;  4F3O A;  4RBV A;  3K17 A;  1CC8 A;  2BRL A;  1JLC A;  3HFZ B;  4ZP6 A;  5HN0 A;  3N6L A;  3W1Y C;  1QE1 A;  5CAA A;  1VQS A;  4ZJO A;  4WZQ A;  2H3E B;  3V2U C;  2B9W A;  2M8H A;  3K0J A;  3PYG A;  1YDL A;  1JWW A;  3QT8 A;  1P8G A;  1UMJ A;  3KHH A;  3LH2 S;  3TAP A;  3H7H B;  4HH1 A;  1DQ8 A;  1Y4Z B;  1WEL A;  3J81 U;  1YJ7 A;  1SKS A;  3NNC A;  1FRI A;  3KK3 B;  2QMU B;  3OJU A;  3CO9 A;  1QVF R;  2F9J A;  2VUG A;  2BXJ A;  5EWF A;  1AW0 A;  4I56 A;  4WPA A;  4L74 A;  4QW8 A;  2R8J A;  1U1Q A;  4C8K A;  2RKI A;  2W4C A;  3N6M A;  3PVX A;  2GA7 A;  1EP4 A;  3DYA B;  1XR6 A;  4X2B A;  1AZS B;  3OFG A;  5ETR A;  3MEG B;  2KT5 A;  2W9A A;  4OZ3 A;  3PW4 A;  1ROF A;  3M32 B;  4IFY B;  4CLT A;  2RQK A;  2C2M B;  4AXI A;  3MUV P;  4P2M A;  3G8S A;  2BQU A;  2LQJ A;  2V8H A;  1H98 A;  3KWM A;  3NGR A;  2P6S A;  4OZ2 A;  3OSN A;  3MFH A;  5F3T A;  2DEI A;  5DO2 A;  2W7P A;  3ISN D;  3IRW P;  4DV7 F;  4DQQ A;  3K2Y A;  1HBU B;  1TK8 A;  2DCU B;  2FB0 A;  3H2L A;  4Q2M A;  5EHH A;  2YWK A;  3I32 A;  1WKJ A;  3UCG A;  4UUW A;  4C2M A;  1VQ7 S;  1M5O C;  3AQO A;  3PR4 A;  1JLQ A;  1FEE A;  2QGF B;  3AD7 C;  4RZR A;  3MXH P;  4AE5 A;  4DFP A;  4AXJ A;  5SZT A;  4C97 A;  4ENO A;  3NGS A;  4ECY A;  3BGF A;  3D0H E;  4GO7 X;  3LOU A;  3PW0 A;  1J2V A;  1FDD A;  5KFA A;  2DNG A;  1JB0 C;  5B09 A;  5CD4 H;  4ZPB A;  1TKZ A;  1IKV A;  1JLB B;  2EEY A;  2P9E A;  4KC5 A;  4DCP B;  4EO6 A;  5AJ3 J;  2ZH5 A;  2JEG A;  3DXB A;  2BKP A;  3MR6 A;  3EXC X;  5HMX A;  2XCA A;  4MYU A;  1SI9 A;  2IDL A;  2V50 A;  1ULR A;  4AL7 A;  3W2V B;  4W90 B;  2K7K A;  2LLZ A;  4WP3 A;  3NP5 A;  5IC4 B;  1VMB A;  1KDN A;  5C42 A;  3BYR A;  3C6U A;  5DET A;  5JVG Q;  1OY8 A;  2IVY A;  3HSJ A;  1NK9 A;  3TJ8 A;  4IDK A;  5F8J A;  2GIF A;  2LA6 A;  2QSF A;  3MD3 A;  3R6L B;  2ZH6 A;  2R7R A;  5GAD I;  1ZTW A;  4LQ3 A;  1IQZ A;  2QL9 B;  1S6P B;  2Z2L A;  5D6G A;  2ZVS A;  1S6P A;  3D4J A;  5D0H A;  2HHP A;  2ERR A;  4AQY F;  2DRD A;  4I69 A;  3HFV A;  2BE2 A;  2P6T A;  4OJ1 A;  2APO A;  4ZVU B;  2ACM A;  2VPZ B;  2BJ9 A;  1UPP A;  2RIJ A;  4KFB B;  4WBF A;  3D6F B;  2E5G A;  4AFF A;  4DUY J;  4KPY A;  1TVR B;  2VZ9 A;  1YK9 A;  2KRB A;  3PKY A;  3OL7 A;  3TI0 A;  4KE5 A;  1KEK A;  4RL1 A;  1ITP A;  3W2V A;  1TUW A;  1S4E A;  2O01 C;  1TKT B;  4R0J A;  4QPX A;  1B64 A;  2CAJ A;  2AEJ A;  1S5Z A;  3MEE B;  1HW8 A;  3UW1 A;  2C2R A;  3OTO F;  4RNH A;  3Q2T C;  5D3G B;  5A2Q Y;  5A8K B;  5IM0 B;  4RW4 A;  1UVN A;  1SXL A;  2UXB F;  5F9L A;  4B3S J;  4X4R A;  3BRE A;  1KBR A;  2LFV A;  3LUY A;  5B0G A;  5J2M B;  3V81 B;  2DGV A;  2UUA F;  5KG3 A;  3ENV A;  4FYV B;  3KK1 A;  1RTD B;  1JX4 A;  3Q8P B;  4KHP J;  3HJF A;  1HHQ A;  3CJQ A;  5E0O A;  2K8G A;  5D77 A;  4KR0 B;  2RS2 A;  4I6Y A;  2MPU A;  1VJW A;  3R7N B;  4DV2 F;  4F8R A;  2ZFH A;  4P2F A;  1PYT A;  1WWH A;  1A6L A;  3QLH A;  4EUV A;  2PDA A;  1A9N B;  1HYS A;  3J81 Y;  4ZVS B;  3CDB A;  1EIY B;  4LF4 J;  2OPS B;  1WG4 A;  3CJ2 A;  5KFF A;  4KKO B;  1EHW A;  1WC5 A;  1B0V A;  2HVE A;  3Q8S B;  4DV5 F;  2R7X A;  5A6W A;  4ZCI A;  5EDW A;  3MWB A;  4MIA A;  1FVS A;  9RUB A;  1U2R A;  2ILZ A;  3KJV A;  5L1I A;  1G7C B;  5L1J A;  5J2Q A;  2YPZ A;  2QLX A;  1S79 A;  5T14 A;  1KHW A;  2H5I B;  3FKB A;  4DLE A;  4NA2 A;  4LF6 F;  2R7V A;  3K5O A;  3KUG A;  4OHW A;  3HXM A;  2QX0 A;  4A47 A;  3PG9 A;  4EBE A;  4Y2A A;  4DSL A;  4I6A A;  1U1R A;  1QTN B;  4FF3 A;  4JI6 J;  4OYA A;  4JUZ A;  4JI2 F;  4ER8 A;  1R8A A;  2E5J A;  2E1R A;  3F73 A;  1FJE B;  2C1E B;  1HI8 A;  2HLT A;  4K4X A;  1NM2 A;  3H98 A;  1NKE A;  5IT4 A;  3KUE A;  3RAM A;  2MQP A;  1HPZ A;  4AYB D;  1ELO A;  2B4P A;  2QE5 A;  3JQJ A;  3D2W A;  4CLP A;  4Z7C A;  4JOU A;  4PWW A;  5L8R C;  2EXU A;  2VJV A;  3EX7 B;  1XIQ A;  2VL1 A;  3FRY A;  1PC5 A;  2BQR A;  2JVR A;  2HG4 A;  5AE2 A;  1D1U A;  3HSD A;  4NCB A;  4IRC A;  5KFX A;  2NPF A;  2YWG A;  2YNF B;  2OPQ B;  2IM0 A;  5A0Y A;  3L09 A;  2YX4 A;  4IFY A;  4GKK J;  3IAM 9;  1FDA A;  2XMW A;  2MXY A;  1VI7 A;  5DDO C;  3M8R A;  2HWT A;  3H40 A;  2QG9 B;  4DU7 A;  3QJJ A;  2VU5 A;  4J9L A;  2RKI B;  1LWC A;  2YKN B;  5KFV A;  4NXN J;  2OPQ A;  1T9T A;  4EWT A;  4C98 A;  2F4V F;  1N36 J;  1Z4U A;  4BLG A;  4DN9 A;  3OTO J;  4L73 A;  3CJ4 A;  5HQL A;  2WB4 A;  4UF4 A;  2VBY A;  2XMV A;  1HBN B;  1RK8 A;  2IFX A;  4MAK A;  3J80 U;  2VIC A;  3MAQ A;  4EBC A;  1JXE A;  4IH7 A;  4KPC A;  1Q5Y A;  1WEX A;  2FLL A;  1OSC A;  3ZTS A;  4N5S A;  2QO3 A;  3MR5 A;  2MDA A;  2LQB A;  1LWC B;  2Z2M A;  4RR5 A;  1HPZ B;  2BOP A;  1S1X B;  5KOX A;  1F2H A;  2KL8 A;  3ONQ A;  3CJ8 A;  3CD5 A;  1RYS A;  3DI6 A;  2DH9 A;  4B3R F;  5HLF B;  1S9F A;  3BGO P;  1R8P A;  2E66 A;  4DV2 J;  4QZV B;  1RAG B;  4OX9 F;  4QWA A;  2FZK B;  3RBD A;  3MM7 B;  1VC5 A;  3MCM A;  1UA0 A;  1FEH A;  4YY3 F;  5M2P A;  3R2C J;  4YDX A;  1BUX A;  2CPJ A;  4NCG B;  3TZZ A;  1VQN S;  2UUA J;  4FF1 A;  3DC2 A;  3W62 A;  5I42 B;  3H4B A;  2DB1 A;  4KSE B;  5D4L A;  2EK1 A;  4B3T F;  1NK0 A;  4UY8 T;  1WNE A;  2V94 A;  1UVJ A;  4A8Q A;  2IBO A;  2CZ4 A;  2BE2 B;  2D41 A;  2V8V A;  3QSI A;  2KYZ A;  1OIA A;  5G0R A;  4J9Q A;  1HR0 F;  1LXN A;  5FDL A;  3D9B A;  3BGL A;  1LWX A;  2ZZM A;  4ITS A;  3VF0 B;  3DLL Q;  3WHI A;  4OHV A;  1IWA A;  1F9H A;  1HIY A;  2M4M A;  2QLF B;  4H4M B;  3M6U A;  4NI2 A;  4P73 A;  1BY9 A;  4R25 A;  3T1A A;  2HND B;  5BR8 J;  3FBB A;  3FVY A;  4JI4 F;  4YR0 A;  1FWL A;  5JUM A;  3OL6 A;  3VGU A;  4ED8 A;  4W98 A;  1AA1 B;  2FHJ A;  2B56 A;  3IR7 B;  4LJM A;  3HO1 A;  4DCO B;  5KT7 A;  1YIJ S;  2PSZ A;  3CC7 S;  4F4A A;  1C2P A;  1ZZN A;  4JI5 F;  4Q5V A;  5IWA F;  2AKW B;  4C3K A;  4L6V 3;  1FKA F;  5F3Z A;  3W5Y A;  2UUB J;  4WP9 A;  4ZS6 A;  2F63 A;  4C4W A;  1GEH A;  1NSP A;  1AUS L;  5KFN A;  1O51 A;  1HQE A;  1M5H A;  2CQB A;  2FZC B;  2LVW A;  4O44 A;  2RS8 A;  5KFI A;  5A8W B;  5CAB A;  1QD1 A;  1KNZ A;  1AT1 B;  3POT B;  4RW8 A;  1RAD B;  2R42 A;  1C1B A;  3MCN A;  4HAC B;  3D7S B;  5J2P A;  2DVI A;  2XSJ B;  4U95 A;  2MZT A;  1TMJ A;  5FD1 A;  2MST A;  3UFC X;  3RW6 A;  3KLG A;  3CMA S;  2J7W A;  4U96 A;  1URR A;  3IM9 A;  3PW5 A;  4OJH A;  2GJI A;  2OKQ A;  4DXL A;  4QIG A;  3KLH A;  4DR4 J;  1JNZ B;  4NLT A;  1RTJ A;  3SMZ A;  2ROG A;  3AOA A;  5KFW A;  2IC3 B;  1S6Q A;  1HQU B;  1LKZ A;  2E1P A;  2QZ8 A;  2V2Q A;  2VG7 A;  1HWI A;  2M2B A;  3FCW A;  3ILO A;  4JBC A;  4ECT A;  4K4T A;  3SCI E;  2I6W A;  3TQ1 A;  2H5J B;  3HVT A;  3JSM B;  3Q22 A;  5KT2 A;  3T5J A;  1KN6 A;  1D09 B;  1KHV A;  1Q8L A;  1RHM B;  2NXU A;  1NSQ A;  4K7Q A;  5LL6 d;  3HM9 A;  3CIZ A;  2FTR A;  1HLW A;  5ETL A;  1CPZ A;  2ABY A;  2J8S A;  3D0G E;  3MM8 A;  4OYB A;  2FY8 A;  2MTL A;  4LFA F;  3F0N A;  4DI6 A;  1R8H A;  2XG8 A;  3H5U A;  3NBP B;  2ZWP A;  5DGA A;  2M70 A;  1JK9 B;  1MWZ A;  1ZM4 A;  3MAA B;  1ARO P;  4YFU A;  1RWM B;  4ATN A;  2V69 A;  2E5I A;  3RZA A;  3AOC A;  5AE3 A;  2Y8W A;  3RB6 A;  4Y2K A;  5GAE U;  3SI8 A;  4NOH A;  2DGS A;  4KH1 B;  1VBZ A;  3MDF A;  4OYM A;  1X4F A;  1UEU A;  1D8Y A;  3MMB B;  1S97 A;  1N88 A;  3FZB A;  1U09 A;  1NND A;  2K1R B;  2WVD A;  3EMT A;  4IRK A;  4C9D A;  1K47 A;  1U47 A;  3PV8 A;  2ZHA A;  1XMQ J;  2ZBR A;  3HPO A;  1UFL A;  1MW7 A;  3DLE A;  1FRM A;  1FT8 A;  2J6S A;  4ZPT R;  3SCK E;  1PAE X;  5GVQ A;  3TUJ C;  2BUN A;  1I6J A;  1R0A A;  2CIM A;  4HT5 A;  5CZV A;  5I4M A;  2NR0 A;  1R6V A;  3PIP Q;  2V6A A;  2Y0S D;  1B4S A;  4MT1 A;  3W2W A;  1RAA B;  3KNA A;  1Z2Z A;  4DSJ A;  4Z37 A;  3OL8 A;  5KFZ A;  4ZPA A;  4DR7 J;  2RDD A;  4JI5 J;  2DO4 A;  3L7O A;  1W7W A;  2ZKT A;  3ZZT A;  3VAK A;  4ECS A;  2R7T A;  1AB8 A;  3KLF A;  5DG9 A;  3C66 A;  3M2R B;  1RP5 A;  3CDE A;  3HLU A;  2VON A;  1EAR A;  4EU0 A;  2OFH X;  3DHX A;  3KJN B;  2OPR A;  1CSJ A;  3EVO A;  1X4G A;  2PC6 A;  1EQM A;  2LEP A;  3T5K A;  4LFA J;  3GG1 A;  5KFR A;  3UDV A;  4H4M A;  1IWG A;  4FPR A;  1UWB A;  4ZVE A;  2D3O 1;  3BSC A;  1ZYQ A;  1WUU A;  2DIS A;  4G3I A;  3AD9 C;  1Q8K A;  4O4G A;  1MRO A;  4GC7 A;  4LFB J;  1WC0 A;  2ZH4 A;  1X9W A;  1V9O A;  1UAW A;  3D28 A;  2MKK A;  3MCS A;  3AAW B;  3NL0 A;  2XZT B;  3IN5 A;  4OX7 A;  1XQI A;  2AGQ A;  3R2D J;  4LSL B;  2AD9 A;  5CQG A;  3M4X A;  2X1A A;  2AJ0 A;  2XS5 A;  4NCG A;  3LGH A;  4J9M A;  2E7W A;  4ZCM A;  1BHN A;  4NLY A;  2HWI A;  5C25 B;  2ZOG A;  3DFE A;  5I42 A;  2HZV A;  2Q79 A;  5KFH A;  2QTW A;  5DQG A;  1IQT A;  3UNY A;  1RDR A;  3T1H F;  2JVO A;  1D0E A;  2RQM A;  3HP6 A;  2HS4 A;  1M90 T;  1X4C A;  2MLY A;  1UEK A;  2E5L J;  3MM7 A;  2IM1 A;  2EFQ A;  2FHO B;  1RT6 A;  3K8W A;  3KXD A;  4G1P A;  4OJG A;  4ZN3 A;  3NG8 A;  1JJ4 A;  3WIU A;  5HBM A;  3HHE A;  4ED5 A;  4LMZ A;  2IMW P;  2NXE A;  1KD1 T;  1V5I B;  2HHQ A;  2QN6 B;  3C8Y A;  4HHU A;  4QPT A;  3IS9 A;  5LMN J;  1RWN B;  4TU7 A;  1SUQ A;  2CG8 A;  5E3Q A;  4JI8 F;  3M8Q A;  4KIA A;  2OPR B;  1IXK A;  1FE0 A;  2ZEJ A;  3HVA A;  1OS5 A;  3NGT A;  2XEX A;  2MKY A;  5E3R A;  2RSQ A;  3PX4 A;  3DGV A;  3P4U B;  1U2C A;  1YRU A;  4GO5 X;  3Q86 A;  1X9S A;  5E2Q A;  2B7C B;  2F40 A;  3N6N A;  1DJ0 A;  3QWP A;  3G6V A;  2RHQ B;  4ECQ A;  4B3S F;  3DMJ B;  3DDK A;  3IR6 B;  4WCE Q;  5IT0 A;  3NMA A;  4H4O A;  2NRE A;  1LWF A;  1IBC B;  2VBZ A;  2HNY A;  3UVJ B;  5K8O A;  1Q5V A;  2IRY A;  4CT8 A;  3QJL A;  4D3G A;  3TEG A;  1RA6 A;  1T9Y A;  4YB6 A;  2YKO A;  5KOW A;  2N3L A;  3A3N B;  2R3V A;  3DRS B;  2YY3 A;  4WK1 A;  3ZNU A;  4OHX A;  2K1R A;  3HHD A;  1FD8 A;  1VFJ A;  2LEA A;  2QJ3 A;  2MJU A;  3CD0 A;  3O5T B;  5A76 A;  5GAG I;  4EYH B;  2DPJ A;  4HI2 A;  1VR6 A;  3MHY A;  4LF5 F;  4DF4 A;  2ZD1 B;  4X4O A;  5ETP A;  2ASY A;  2VPW B;  1SH2 A;  3M1V B;  4NLG A;  1S4F A;  5SUH A;  1EKS A;  1PYO B;  4ZVO B;  1Q7Y T;  3MM5 A;  2CJ9 A;  2V8G A;  4J9V A;  1C0T B;  2AX0 A;  2DTJ A;  3TAM B;  3WBZ A;  3UDE A;  5C2G A;  2V2V A;  3BSN A;  5D3G A;  1N33 J;  1SJQ A;  2DHX A;  1JLE A;  3AY0 A;  1C4C A;  2VA2 A;  3BR8 A;  1BLU A;  2W1B A;  2UP1 A;  4O3S A;  1PO6 A;  5ITH A;  5HRO A;  3UD3 P;  5FLX Y;  4L3N A;  2DGU A;  2HBQ B;  4RW7 A;  1N0V C;  4C3L A;  2WK4 A;  3WQP A;  5JJB A;  4I7F A;  3M30 A;  3OQ2 A;  2J76 E;  2BAB A;  3CT9 A;  4RNM A;  3K7R A;  1W2B R;  4JI7 F;  1EB0 A;  3CJ0 A;  1Y9O A;  1CJU B;  3ZZZ A;  2XGQ A;  2MQL A;  3T9Z A;  1SV5 B;  1FHT A;  3T1Y F;  1Q86 T;  2JEJ A;  4DPU A;  1GTH A;  4FVC A;  3SSR A;  4ED3 A;  3OXL A;  3ZZP A;  2ILY A;  3Q8Q B;  2E1M C;  4P71 A;  5E3A A;  3EE3 A;  1X4B A;  1OYE A;  3KG1 A;  4LRC A;  4MK8 A;  8ATC B;  3HFK A;  2Y1I A;  3CDA A;  3CW2 C;  4YOE A;  1F5B A;  5C24 A;  5C24 B;  5D4O A;  4ILL A;  3IC1 A;  3DOL A;  4A8K A;  3WX4 A;  2XNQ A;  3OPK A;  3QT5 A;  5A8R A;  5F8L A;  3P96 A;  1ZTT A;  1WOO A;  1RT5 B;  1YG0 A;  5LJ5 Y;  2DNK A;  3M8Z A;  2FIU A;  3T1Y J;  1GQE A;  2YH0 A;  1S1W A;  3GR0 A;  3RAQ A;  3DM2 B;  2WHO A;  1IKV B;  1JLB A;  1S0N A;  3P49 B;  1O0P A;  1IKY B;  2J0W A;  4A46 A;  1R0A B;  4TY8 B;  3ETM A;  3LP1 A;  4FZV A;  5KG5 A;  3GJS B;  3OTC A;  1IKX A;  1OQ3 A;  2CPX A;  1RT5 A;  2GMH A;  3B54 A;  1I5O B;  3FMB A;  3JTN A;  4M5G A;  4DLG A;  4U67 Q;  2MKC A;  1SJ4 P;  4PYA A;  4HKQ A;  4NLQ A;  2IA0 A;  2OTL S;  3THT A;  2EFN A;  3O8W A;  1YBA A;  2M5Y A;  2OPP B;  3BH6 B;  3PYF A;  5HQM A;  4X64 F;  5H9E K;  2J9D A;  1N48 A;  3FSY A;  4TVA B;  4G65 A;  1I94 J;  2JDJ A;  4JB8 B;  2B4V A;  2E5H A;  2GJF A;  5J1P A;  4K4W A;  2D3Z A;  2NYH A;  2CVI A;  3H2U B;  1TP7 A;  2AJ4 A;  1X8D A;  2V63 A;  4G1Q B;  1QAY A;  6FDR A;  1RBL A;  4N8O A;  3ISZ A;  4I64 A;  3D54 A;  4NZ7 A;  4PAA A;  3UPF A;  3NWG A;  3QNW B;  1LW2 A;  1SQF A;  5M2R A;  1L3T A;  4OMF G;  2QYC A;  1AZS A;  4NRU A;  2F7V A;  5BJR A;  1LWE A;  4F36 A;  1VIX A;  3HT3 A;  2E9Z A;  1ZOT A;  3MPU B;  4M5N A;  2YWW A;  5J1N A;  4IQX A;  1OJ4 A;  3I82 A;  3FBC A;  3UN5 A;  3HMJ G;  3QSY B;  2G0I A;  2MZS A;  3PJW A;  4UQG A;  1SC3 B;  3BPS P;  3ICL A;  1M1H A;  4LRB A;  4WFZ A;  3IMQ J;  4O3N A;  1Q4R A;  4F67 A;  5GAD U;  1TKD A;  1X4D A;  4QCL A;  4Y0F A;  1W26 A;  1HQE B;  2AZ1 A;  2COL A;  4WKR A;  1NME B;  2LQ5 A;  3NY0 A;  4J7C A;  1B70 B;  1KOH A;  1X31 C;  3EPG A;  2DXF A;  2V68 A;  2CPH A;  2VB6 A;  3GR1 A;  3I96 A;  4N77 A;  3HVR A;  4KHP F;  4F25 A;  2VQE F;  1F9F A;  2YNI A;  1QSY A;  3FFI B;  4LF6 J;  3VVT A;  2D74 B;  2CKW A;  4I2P B;  1Y5I B;  2G2O A;  2XCP A;  4C7Q A;  1R43 A;  1JLQ B;  4K5R A;  3G8T A;  3K5L A;  2IM3 A;  1HBN A;  1F9E B;  3MEK A;  1YLX A;  4HDG A;  4U8V A;  2QLJ B;  4LRD A;  3TRG A;  2XQC A;  4ZDN A;  2M88 A;  2HND A;  4PQU B;  3TQE A;  2FVR A;  2KU7 A;  3VV2 B;  3E01 A;  4R8U A;  1SJR A;  4DV1 F;  1YJU A;  2WBM A;  3M2U B;  3SSQ A;  2BW7 A;  7FD1 A;  4B9N A;  2F4V J;  3VHQ A;  5KFY A;  3NCQ A;  2FJD B;  4F0H A;  3IA0 A;  4LQ9 A;  1HL6 A;  4HYK A;  4FF4 A;  2L08 A;  4ZLJ A;  4X62 F;  2A1B A;  4Y65 A;  4BC9 A;  1DRZ A;  2DGW A;  2ZUG A;  4PR6 A;  3CE8 A;  3EVW A;  3M30 B;  2X1B A;  3T6J A;  4CO2 A;  2CDR B;  1QLN A;  1XMO F;  1R31 A;  1CVJ A;  4LR7 A;  3DGP B;  2V9K A;  1MG7 A;  4WFN Q;  2EC0 A;  1YQH A;  2YNG B;  2G0J A;  3JSR A;  4RUB A;  3GIM A;  3PO4 A;  1T94 A;  2VIH A;  1NUE A;  5CYQ A;  5K14 B;  5CCL A;  1X0F A;  4HR2 A;  4XO0 A;  1KFS A;  2MHN A;  2E44 A;  2RU9 A;  2QC3 A;  2I1R A;  2CA9 A;  2DGX A;  1R7I A;  1RAO A;  3G82 B;  4TQS A;  1PJ5 A;  5GAH I;  2W9C A;  2NS1 B;  2A6M A;  1CQM A;  3TJA A;  1RT7 B;  2VG5 A;  3G82 A;  2PI4 A;  1RT7 A;  2VG5 B;  5ETK A;  1CJV A;  3DOM B;  2W9C B;  3MZI A;  1XC9 A;  4S0M A;  4ANE A;  7AT1 B;  5CYQ B;  4U6P A;  3QYY A;  1GX5 A;  4B08 A;  2NPI A;  5IFM A;  3G9C A;  3HX9 A;  3TUI C;  2ALZ A;  1BMQ B;  4K4Z A;  1FJC A;  4WU3 A;  1GAO A;  2IMO A;  5AXN A;  3PRB A;  1XER A;  3NOC A;  3VAI A;  2K3K A;  1X9M A;  2JL9 A;  1RT3 B;  4Q43 A;  5THW A;  2OJ3 A;  3CD7 A;  1HWJ A;  2PN6 A;  5H1S V;  2OMO A;  1YHQ S;  5F8H A;  1MU2 A;  3H25 A;  4KYZ A;  1MU2 B;  4J5O A;  5JXS A;  2F65 A;  3CJ5 A;  2FJV A;  2XY5 A;  5EWE A;  5CYJ A;  1HYS B;  1VOM A;  4FYY B;  4NL5 A;  4BS2 A;  2B0G A;  4EGL A;  1U1P A;  1Q95 G;  4JV5 J;  1M0S A;  3GZ7 A;  2B8P A;  4IG0 A;  4ZKA A;  2GVD B;  4WE1 B;  2AJQ A;  5LSL A;  3MD1 A;  2UUB F;  2PT0 A;  3VAL A;  3BGR B;  2HBZ B;  1RYR A;  1RTI B;  2J7K A;  2ASD A;  1KVI A;  2WW4 A;  4IKA A;  1UJ6 A;  3CPW R;  4BC7 A;  2CNN B;  2Z2Y B;  1P1T A;  3MMB A;  3NKY A;  3UR0 A;  4CH1 A;  3OR2 A;  2B6A B;  1TUG B;  2FVP A;  3SXL A;  2UVV A;  3TUZ C;  3BEG B;  3VGT A;  2MZJ A;  1JKH A;  2HNZ B;  4OYP A;  3HD2 A;  2FJB B;  5K5M A;  5BR8 F;  4ELU A;  4KRW A;  3JS9 A;  4U7U K;  2BJ8 A;  3FUY A;  1ZBT A;  1OYD A;  4DS5 A;  5BYR A;  3IG1 A;  5DM7 Q;  4Q0B B;  1GFW B;  2ZH8 A;  2J9E A;  1WI8 A;  4NEY A;  5KFD A;  5ETN A;  2GNK A;  3UN2 A;  2KT3 A;  3GYN A;  2LXF A;  5KFQ A;  1LW0 A;  3AJ2 A;  1RAI B;  1M1G A;  8AT1 B;  2GVZ A;  1I3O B;  1VRT A;  1CUL A;  3B4M A;  2H9Z A;  3NS5 A;  1VQ5 S;  2I8E A;  3KLV A;  2ZZT A;  3GWC A;  2BMB A;  1FRL A;  3EGV A;  4OJ3 A;  5KFT A;  1KP6 A;  3CJR A;  2XO7 A;  3LWL A;  1VQ8 S;  1RT1 B;  2ZHB A;  1J5O A;  2QV6 A;  4TLR A;  2J6U A;  3KLE B;  1M5V C;  4M94 A;  1N5V A;  3EDR B;  3KNG A;  2B9E A;  4CO4 A;  3N9U C;  3JTP A;  3MEC B;  4F02 A;  1KLM A;  4OX6 A;  2MQ8 A;  5C7P A;  2VG6 B;  1XN9 A;  1XBW A;  3GE9 A;  3VAM A;  3TZX A;  2HHH F;  4B9L A;  1DQA A;  4U7C A;  4IOA Q;  2GW8 A;  1WTF A;  1PSD A;  4CLS A;  3AJD A;  3DLB A;  1REV A;  2JSX A;  3D6M B;  4EI2 A;  4X4Q A;  1RWV B;  3POT A;  3RRH A;  4X4N A;  3LP1 B;  1IKX B;  2F8H A;  3D1Q A;  2RRN A;  3DRX A;  4RW6 B;  2AF6 A;  1S0V A;  5ETO A;  3GFH A;  3VWS A;  1FX4 A;  1UEV A;  4NRT A;  2AP6 A;  2CQ2 A;  3HKZ D;  3SCL E;  1RT4 A;  1TKX A;  2C2E A;  3V6J A;  3BQ1 A;  4NLV A;  3PYE A;  2N82 B;  3BM7 A;  4PXE A;  3ILI A;  1KTV A;  3O2I A;  4N47 A;  1BGX T;  4ANC A;  5J1E B;  3EGZ A;  2VDH A;  5B0E A;  3CCU S;  4IO9 Q;  1RTZ A;  4K8R A;  4F26 A;  4WTY A;  2HGN A;  2DYA A;  2IAJ B;  3U1L A;  4WTO B;  5L39 A;  3ZNJ 1;  1CLF A;  4EK2 A;  4XPC A;  3CB4 A;  2GAG C;  5K8P A;  2WBR A;  2ZBP A;  2E7V A;  2F3J A;  5ADZ A;  1LFW A;  2C28 A;  1TK0 A;  3J7Y I;  2NSC A;  3DN9 A;  1ZA2 B;  5HL7 Q;  1CJU A;  2J8A A;  1IBM J;  3IM8 A;  3FSI A;  1PIE A;  1YGY A;  4FF2 A;  2YVS A;  3CJ3 A;  3GTY X;  3OXF A;  4LBI A;  1JLG B;  3D1H A;  2F8M A;  2HQC A;  3PFE A;  3C46 A;  1HKA A;  2BQ3 A;  1U6B A;  3LPY A;  1X5P A;  2HBY B;  1XMB A;  2V2K A;  2YWE A;  3N01 A;  1GXL A;  4HL9 A;  4OI0 A;  4HDH A;  2RF2 A;  4UW2 A;  2R7O A;  2B5J B;  3NBP A;  1SL2 A;  4LBP A;  5MAO A;  2DH8 A;  2NYI A;  1R3N A;  4NA1 A;  4DX5 A;  2RDJ A;  5LMU F;  4WXO A;  2BW2 A;  5HI7 A;  2RF2 B;  2V2Z A;  2RUG A;  2UV8 G;  4QIW D;  4YB5 A;  2KM8 C;  3UCU P;  1U1N A;  3RRG A;  2MEW A;  1M5P C;  2WRM A;  2MQO A;  2H48 B;  4NE9 C;  3IRX B;  1VRU B;  4ZLN A;  1B0P A;  3MUR P;  5GAH U;  1FVQ A;  2LP4 A;  2WB1 D;  1WG1 A;  5GAG U;  2OI2 A;  3Q23 A;  1VCT A;  4NX9 A;  4H54 A;  2PMZ D;  2AW0 A;  1C0T A;  2OO4 A;  2QT7 A;  2VG7 B;  3IO1 A;  3W9H A;  2XY7 A;  2ASL A;  4NML A;  4DQR A;  1GXT A;  2PII A;  2ZH1 A;  1K73 T;  2AQ4 A;  3QFW A;  5LMU J;  5A8R B;  1GX6 A;  4IH6 A;  3LAK A;  4J91 A;  3AOD A;  2ZD1 A;  2VPY B;  3GSD A;  2HFU A;  2L48 A;  3LA0 A;  4L75 A;  2UVU A;  1IBK J;  2HHU A;  2Q1L A;  1ZAW A;  3TX8 A;  1HNX F;  3DCA A;  3TA0 A;  2V8D A;  2NSB A;  4K4Y A;  1BD6 A;  1C1C B;  2PMW A;  1WF1 A;  2JRS A;  3BGU A;  3HUL A;  1BQX A;  4TY9 A;  2B51 A;  5MLC V;  3GV8 B;  1V3S A;  4DR1 F;  4NEZ A;  4J9O A;  1Q82 T;  2JFD A;  2WON A;  3GIL A;  2NQP A;  1KC8 T;  2Q6B A;  3OHB A;  3KDN A;  3K59 A;  4M8L A;  1TK5 A;  1WC6 A;  2OSR A;  3C6T A;  2NXN A;  4ID5 B;  3ZZY A;  3GIK A;  2JLG A;  1OPI A;  4ECU A;  4DSE A;  2B9X A;  2YQ1 A;  2B8Q A;  4I7F B;  1UFK A;  1NDL A;  4IH5 A;  4LSN B;  4PEO A;  3CTR A;  5L1L A;  1U1K A;  4U7U D;  2CQ1 A;  3BO3 A;  4OZ0 A;  3UN3 A;  4B3R J;  1K8A T;  3C16 A;  1IBL J;  3DLG A;  4KO0 A;  2XYG B;  3UD4 P;  2BR0 A;  3OV7 A;  3TVY A;  4EZ9 A;  5LSR A;  3JSY A;  4CO1 A;  1HWL A;  1K44 A;  1DTQ B;  4P9S A;  1B3T A;  3DRR B;  4F04 B;  4IUF A;  4DPW A;  3KLE A;  9ATC B;  3NEK A;  4IQM A;  3DOM A;  3QT7 A;  3M9N B;  3SV4 A;  1U1O A;  3AJ1 A;  3M1V A;  2J0Q D;  5U47 A;  1RLC L;  2XS2 A;  5HVH A;  4K2J A;  2VDI A;  2DXE A;  3BKF A;  5IT9 Y;  1PCA A;  4ZLP A;  4USK A;  4P6Q A;  3GCX P;  2HVD A;  4NLO A;  2E5L F;  1T9X A;  3LAN A;  1FJG F;  1SL0 A;  1UW4 A;  1WTB A;  5K20 B;  2WON B;  1U8W A;  4BWJ A;  4JV1 A;  1RWW B;  4JP8 A;  4CLL A;  2OEK A;  4RNF A;  4ED0 A;  2VKR A;  4M5D B;  1J5E F;  2LCW A;  1GXU A;  3ENA A;  4ETZ A;  2VOD A;  1NZA A;  3OVA A;  2XNR A;  2CPE A;  4I68 A;  3H4D A;  4OI1 A;  4RNO A;  1MRO B;  3HF5 A;  5IOL A;  2MZ1 A;  2FHK A;  4F0M A;  1U02 A;  4NYZ A;  3IWL A;  2PI5 A;  1QUV A;  4YB7 A;  1KQS R;  2VPX B;  2BKO A;  1VQP S;  2XI2 A;  2G2Y A;  5AXK A;  4X4T A;  3WC0 A;  1WKL A;  4YN3 B;  4PG8 A;  2BZ2 A;  1HNV B;  3NAH A;  3N28 A;  1WC1 A;  3E3X A;  1KR4 A;  4UTG A;  3V5R A;  2VJU A;  3HHL A;  3CDW A;  1S1U B;  1U25 A;  1WC3 A;  2CYY A;  3ELH A;  4K59 A;  1O8B A;  4IFV A;  1MN9 A;  4MKB A;  4USJ C;  2F9D A;  1WEY A;  3S1T A;  3TA2 A;  2W7O A;  1AUD A;  2HMI B;  2GO9 A;  1BQN B;  4F4Y A;  1IBL F;  3FCV A;  3OTE A;  4YP3 A;  2E9T A;  2NUU G;  3W2W B;  5GAE I;  3HHK A;  5HBM B;  1UCN A;  1HD1 A;  4QW9 A;  1SKW A;  1HD0 A;  2CJA A;  1S49 A;  4N76 A;  2CQC A;  2CFX A;  2PFF B;  2EWH A;  4ZVT B;  2UU9 F;  2O66 A;  3CJS A;  5B0D A;  3VAF A;  4LF5 J;  1DZ5 A;  3HVW A;  4JI1 J;  4OLP A;  2ZM6 J;  3AFG A;  3LGM A;  4HLB A;  2PE8 A;  3WZ0 A;  3KTQ A;  4NA3 A;  2I2Y A;  3CSK A;  2MY7 A;  2HUR A;  2GO8 A;  5KFS A;  4LSL A;  4Y2C A;  4PXC A;  5AJ3 F;  1HNX J;  1IM4 A;  1N5Q A;  3SFU A;  3I9Z A;  5D15 A;  1SC6 A;  3QGP A;  1F3V A;  2CVE A;  3M8P B;  4YUD A;  5HVF A;  4DUZ J;  4DR2 F;  4LIR A;  5D78 A;  4DSI A;  3M2V B;  3M6V A;  5IS2 A;  3V6D B;  1QSL A;  1RQ0 A;  3U02 A;  2OP5 A;  1MMN A;  3N79 A;  3W64 A;  2W9B A;  5EX0 A;  2HHW A;  5AXL A;  4KB7 A;  1IVZ A;  2DNP A;  1EX8 A;  2ZHO A;  1S6U A;  2F8E X;  4DV3 F;  1CEZ A;  4O3Q A;  2GZO A;  3RRK A;  2CG4 A;  1HHT P;  2B5J A;  2EKY A;  2LEB A;  3DGP A;  2P8I A;  2OEM A;  3MAH A;  3UQS A;  2FJE B;  1N4L A;  4OZN A;  2RUS A;  2ZBQ A;  2RQ4 A;  1WOP A;  1NHU A;  4OFZ A;  1TL1 B;  1S10 A;  1UVI A;  1JLE B;  1L3K A;  2UUW A;  1AYE A;  4DUY F;  1DTT B;  1HNI B;  2DGQ A;  2E7X A;  3MM5 B;  1SH0 A;  1ZS6 A;  2KJW A;  3KFW X;  4U8Y A;  3TAM A;  3MUM P;  4X4V A;  1RAJ A;  3N4W A;  4DR3 F;  1RT2 B;  2D69 A;  2RIL A;  3IR5 B;  2RU3 A;  4CO3 A;  2YQ0 A;  3RU0 A;  3MPD A;  3MMJ A;  3FC9 A;  3PM9 A;  4CM2 A;  3KLH B;  3VVU A;  4F4K A;  4DPY A;  2UZA A;  3HZE A;  2X51 A;  2DY9 A;  1R0B G;  5B0F A;  2C2N A;  2YNH B;  4C8O A;  2HVH A;  5DZ7 A;  4P7V A;  3LP2 B;  3KK2 A;  1VQK S;  5LJ3 Y;  2MJN A;  2Y8Y A;  4ZN1 A;  2DNR A;  1FNX H;  2ASJ A;  5CZX A;  3MTJ A;  2JC1 A;  4G1I A;  3IG1 B;  4Q0B A;  1GH8 A;  2GX8 A;  4O23 A;  1UA1 A;  1SJ3 P;  2DR8 A;  2XSF A;  2DGT A;  2DIT A;  3MR3 A;  4LF9 F;  3K57 A;  3WDO A;  4MH8 A;  3R1H A;  2FZG B;  4DS4 A;  4NYO A;  1VIO A;  4F50 A;  3BF4 A;  2HIY A;  1TL5 A;  1WHX A;  2AT1 B;  5CA5 A;  2L41 A;  3BKT A;  4I67 A;  1NJX A;  2VOP A;  5JVH Q;  1FE4 A;  2UVR A;  1S0O A;  4HHH A;  3PW7 A;  2Z8Q A;  2YKA A;  2J9D E;  5D0G A;  1LNQ A;  2ZNY A;  1RTI A;  4ZP8 A;  4CLY A;  1Q79 A;  3JAM U;  4A8S A;  4N56 A;  5L38 A;  4ZLL A;  4I6W A;  1Q16 B;  3US5 A;  3N5F A;  1TZ0 A;  2GVD A;  2GV1 A;  3HJV A;  4WE1 A;  4OYX A;  3HVT B;  3TNV A;  3JSM A;  1RT2 A;  3AHP A;  1FER A;  4HVZ A;  1G3O A;  2ZH2 A;  4ID8 A;  4WYL A;  1OSD A;  2NXC A;  3I6P A;  1YJN S;  2DR7 A;  4LBH A;  3I0R A;  1TAU A;  3M32 A;  5HAT A;  2JNJ A;  3A13 A;  3MPY A;  1VK3 A;  4TN2 A;  3G71 S;  4P75 A;  2AYE A;  4ALZ A;  1NJZ A;  1JMT A;  2QMW A;  3TO8 A;  4C6A A;  4YHH J;  4L3K A;  5HAO A;  1VK8 A;  4B3M F;  3SEO A;  4OI2 A;  4R0E A;  4C11 A;  3NAI A;  4RW7 B;  5KT5 A;  4BDP A;  1YX2 A;  1Z2L A;  2K7J A;  2KRR A;  4A8W A;  2CQ3 A;  3PKM A;  4K0K F;  3G2X A;  4HI1 A;  1RU1 A;  1FDB A;  2KYX A;  1DUR A;  2CPZ A;  2M3D A;  3EGN A;  3GCW P;  4OLO A;  1MWY A;  4KV8 A;  3G6X A;  1TV6 A;  3CCM S;  1IUJ A;  1H6K X;  2WCX A;  1E6Y A;  4DV4 F;  4H4K A;  3ZTP A;  4LF8 J;  4V19 X;  2B3T B;  5BYQ A;  1N5Y A;  3M8P A;  1S1X A;  2AU0 A;  1U4B A;  4F3M A;  4QU7 A;  5HJX A;  2DCL A;  2B9Y A;  3DI6 B;  4H4O B;  4GC6 A;  3BDE A;  4J9S A;  4FS2 A;  4ZOS A;  2DNY A;  2EBE A;  4LSZ B;  4X4P A;  3BO2 A;  3GFX A;  3BJY A;  2X1G A;  3UDC A;  2DRA A;  2MYF A;  1F0X A;  3ITH B;  1SPB P;  3BGR A;  4ZJL A;  3AD8 C;  2BX6 A;  4Z7Y A;  4NXM F;  4K4V A;  2JC0 A;  1BE4 A;  3GON A;  4P2S A;  2EFV A;  1UVL A;  4M5I A;  4EMD A;  3EIC A;  3TVZ A;  4C8N A;  2FJW A;  4X4U A;  3GFY A;  3KDO A;  2XZD B;  2XZW A;  2YKN A;  2CZV C;  2VFU A;  4GRS A;  1JQG A;  3IFE A;  1FCA A;  3FEX B;  5L9X A;  2R2T A;  3UWT A;  4M5M A;  1QSS A;  1H73 A;  2CJQ A;  1BQN A;  1D3W A;  3OVS A;  1K9M T;  5A2Q U;  3DLK B;  4GVB B;  2R8H A;  4DL7 A;  4CYU B;  4IR9 A;  2KN4 A;  2AHO B;  3L95 X;  2L9D A;  3TZY A;  3OD2 A;  2FHM A;  1RKI A;  1V3R A;  4CWB A;  1EKR A;  2EG2 A;  2ALY B;  4ZIV A;  1RTH A;  1TTH B;  2UXD J;  3WX8 A;  4EFA C;  1ZA1 B;  3TX0 A;  4DHV A;  1MNE A;  2RD5 C;  4YDD B;  1FRX A;  1LK7 A;  4ZPD A;  3MMA B;  5HSP A;  2R8I A;  3LTO A;  3R5B A;  2ZZN A;  2Y3Y A;  1U6Z A;  1UWB B;  3J7Y U;  2UUC F;  2IJF A;  1UTA A;  3FCH A;  5IWA J;  3LAM A;  2E29 A;  4EO8 A;  2CNL B;  4J9N A;  5FLX U;  2W2P P;  3BS9 A;  5KG6 A;  2VQE J;  1VLY A;  3V6K A;  3B8H A;  4B9U A;  2IJR A;  4LF8 F;  2CJK A;  2MQQ A;  4USI A;  3I5C A;  3SFG A;  3A4T A;  5C25 A;  1NZ8 A;  1VLO A;  2KVQ E;  4ZMM A;  6AT1 B;  4C8M A;  2C3M A;  2WSF C;  3CNQ P;  2KKH A;  1SJ1 A;  1X4H A;  5T7L A;  2WAQ D;  1RAE B;  3CJK A;  1Y5N B;  3KLI A;  1YIT S;  3EZO A;  3KJV B;  3M9M B;  1BQM B;  3DLJ A;  4UOC A;  2R9L A;  1HNZ J;  4CTA B;  1VHF A;  4XK8 C;  2KTQ A;  2AYB A;  4KGX B;  2FLN A;  4DV1 J;  1VYA A;  1AFI A;  1MML A;  2SXL A;  1NDK A;  3BBF A;  1HQU A;  5DDQ C;  2HHS A;  1WHV A;  2OPS A;  3S01 A;  1ICE B;  3BYP A;  4DBQ A;  1JJ2 R;  2O3D A;  3K89 A;  4HEA 9;  5LSO A;  1APS A;  4D3H A;  2KH9 A;  5T41 A;  3KKF A;  3W3S A;  2VHG A;  4H4K C;  3LP2 A;  5IV4 A;  2ZKU A;  3KK2 B;  4ED7 A;  4PQU A;  1IR1 A;  2CPI A;  2FHJ D;  5HP1 A;  2BOA A;  2BM1 A;  2JZ5 A;  4RUC A;  2W25 A;  3G86 A;  1XNR J;  2FVS A;  4DV6 F;  4G6V B;  5B0B A;  1RLD A;  2HQG A;  4F3Q A;  3V81 A;  2DEJ A;  4LVN P;  4O44 B;  5A8W A;  3QRQ A;  3JTO A;  4ZVH A;  3C6T B;  3PEJ A;  1R0C B;  4ID5 A;  2AIR B;  3O3L A;  3Q8Y A;  3WIV A;  4O3R A;  3AH6 A;  3T3F A;  1E6Y B;  2DK2 A;  2N4C A;  1S1T A;  2AJ2 A;  3IGN A;  5A8K A;  5IM0 A;  2CAD A;  1WOS A;  4DV4 J;  1OWX A;  3TAQ A;  2M0G B;  2QIF A;  3CCT A;  3VGS A;  1Y00 A;  2OAU A;  4FXV A;  4X66 F;  2XHC A;  3I55 S;  3CCL S;  4XIU A;  1VQY A;  3C14 A;  4ZCK A;  5KG2 A;  2GAH C;  2VA3 A;  3KJF B;  4ED1 A;  4KQZ A;  1VIS A;  1Q8B A;  3R5G A;  2J5A A;  3K58 A;  3ZTQ A;  1NDC A;  2D9P A;  1T11 A;  5D0E A;  1J27 A;  2DNQ A;  5A6P A;  2I9S A;  1OY9 A;  3EUN A;  5B0C A;  6FD1 A;  1QAJ A;  1FDN A;  2VV5 A;  4A8F A;  3OHA A;  3NGU A;  3D68 A;  1ZM2 A;  1S1V A;  2D9O A;  1U0H A;  1SKU B;  1UET A;  1RT1 A;  4NLS A;  1AFJ A;  1T9V A;  1WC4 A;  4B9M A;  4UUX A;  2KFZ A;  2KO1 A;  1VC0 A;  4DCJ B;  4O3O A;  4B3O B;  1S9G B;  1VQO S;  5DS7 A;  1QAI A;  3H20 A;  3O6Q A;  2F4F A;  3H42 A;  3MR7 A;  2X3G A;  4NWB A;  3RBX A;  2DH7 A;  3BDP A;  1KVK A;  3EYZ A;  4C8L A;  2YXL A;  4M5K A;  4BHQ A;  1NU4 A;  1YWX A;  1T9W A;  3CMQ A;  3LAL A;  5D4P A;  3UDL A;  4ES3 A;  5J2P B;  2KFY A;  1S72 S;  1FXD A;  5EGY A;  4XAK A;  1DFD A;  2P5V A;  3A8J A;  1S1T B;  2XC9 A;  4DFJ A;  4PUO B;  1UP1 A;  2HHH J;  1S59 A;  1MN7 A;  2ADC A;  4NZ0 A;  2KG1 A;  1KRP A;  2POK A;  1SL1 A;  2KT2 A;  3MM6 A;  3CXC R;  1NSK L;  2FGO A;  2QSW A;  5DZ6 A;  5HLF A;  2IC3 A;  2OEL A;  1T95 A;  2V4J A;  3I4H X;  3PFO A;  5KT4 A;  4DV6 J;  1XMQ F;  1FK9 B;  2OH2 A;  4PRF A;  2CWX A;  2AJ1 A;  3IAS 9;  1REV B;  4AL6 A;  3DOL B;  3HI9 A;  4AL5 A;  3W8P A;  2DIU A;  3PW2 A;  4NPO A;  2HMI A;  4E0D A;  5F8G A;  4ED6 A;  1IM6 A;  1H2T Z;  1JLA B;  5EX3 A;  1T05 A;  1O5J A;  4DN0 A;  2GHW A;  4QR0 A;  2HFV A;  4A8Y A;  3IWX A;  4I0W A;  4QIE A;  1YZ6 A;  4ZIT A;  2IM2 A;  2PFD A;  3MED A;  3JXO A;  3QAU A;  4MYT A;  5LMN F;  4LRA A;  4M5H A;  5DLG A;  5E33 A;  2MGZ A;  1YTY A;  2VFR A;  1KSP A;  1I1G A;  3GIR A;  4IR1 A;  1HNI A;  4OHY A;  4WXW A;  3MTK A;  1WI6 A;  2GHV C;  3DYA A;  4CTA A;  2EBG A;  2GVZ B;  2V34 A;  4M63 A;  1KLN A;  4LUB A;  1SC4 B;  2WSC C;  1FF2 A;  1VQ6 S;  1NB7 A;  4QWB A;  1M5S A;  3P5B P;  1WJ9 A;  4EZ6 A;  4CLK A;  4YB1 P;  1VQM S;  3OFH A;  2XB2 D;  3EDQ B;  2JOQ A;  4OX9 J;  2KVI A;  3HHL B;  4RJV A;  4B9T A;  2Y9H A;  2O1P A;  4K4S A;  1Q81 T;  4NAS A;  2IPO B;  1OPZ A;  1HMV B;  1RWP B;  3O44 A;  3EWG A;  3PCO B;  4F4X A;  2HZA A;  1FTR A;  5ETQ A;  2HKE A;  4E2F B;  1XNR F;  1TMM A;  1PGZ A;  3MMA A;  3ADA C;  4DPX A;  3TJ9 A;  1JXL A;  2K06 A;  2OHD A;  2RRB A;  3ULH A;  3R8Y A;  4URG A;  2DNN A;  3GPA A;  4DR1 J;  1VS3 A;  5KFU A;  3JYT B;  3Q0A A;  2QFI A;  2OIH A;  1HMV A;  4DUT A;  3CCQ S;  4UZC A;  3DRS A;  4LF1 A;  2Y1L B;  1L5U A;  2JJ4 D;  4K5S A;  3Q83 A;  2A6O A;  2GIQ A;  1HA1 A;  4F4Z A;  1NDP A;  4A8X A;  1CS4 A;  3CDU A;  1WEZ A;  3MCO A;  4OYO A;  4CDI A;  2AWZ A;  4L72 B;  2AYM A;  3B82 A;  2RNE A;  2U1A A;  3EVM A;  4N8N A;  1LK5 A;  4UST A;  3CJK B;  4CI0 B;  5LXY A;  4DQP A;  1FJG J;  2RB7 A;  1SQE A;  3BZQ A;  4TNO A;  3E51 A;  3EGW B;  1RHR B;  1B0T A;  2C2O B;  1CS4 B;  3Q24 A;  1TEL A;  2HVI A;  3LQV A;  1N5S A;  1DTQ A;  1F6T A;  4W92 B;  1AXQ A;  3AQP A;  5KFG A;  3OFE A;  3PJX A;  3GII A;  5FII A;  4CRJ A;  2R7W A;  3RJM B;  3H5Y A;  1MMD A;  4YR2 A;  2L9W A;  4KGZ B;  2CXE A;  3K8V A;  2XYP B;  3QRR A;  3D1O A;  1SH3 A;  4DV5 J;  5DG7 A;  4I2Q B;  2HK3 A;  2WOM B;  4K4U A;  4DX6 A;  3ENQ A;  2FY1 A;  2ZWO A;  3PDN A;  1J5E J;  3GYX B;  3Q89 A;  5H9F J;  2L9N A;  3THP A;  3MEE A;  4USU A;  1RAC B;  2ZBC A;  4RW9 A;  2G1H A;  2V5H G;  2DR5 A;  2XMJ A;  5K8N A;  1CJT B;  3C2P A;  2VQF J;  2MLX A;  2CQ0 A;  4MK9 A;  5KFC A;  1WHY A;  4U9R A;  4DR2 J;  3ILJ A;  4NMX A;  2LMI A;  4CM0 A;  3A8E A;  4ICL B;  2JLF A;  2M9K A;  3GMG A;  1UJ5 A;  5E41 A;  2KXH A;  4JYA J;  3DU5 A;  4KFB A;  2JEF A;  3FJ2 A;  2DPI A;  3G96 A;  2OEJ A;  3ENW A;  4P72 A;  2XO6 A;  2LQ8 A;  3ETO A;  2W8K A;  3KG4 A;  1HBM B;  3BB5 A;  3DOK A;  4IOC Q;  2R2R A;  3FK4 A;  1IR0 A;  2UU9 J;  2W2M P;  3TP2 A;  3CME S;  1S6O A;  2VC0 A;  2MHE A;  3FQK A;  4LR8 A;  2F1F A;  4KHR A;  4MKA A;  4PXB A;  4I2Q A;  2M7S A;  3NCR A;  5KG1 A;  3HSG A;  2MGZ B;  1TR0 A;  3HHN B;  1C0U A;  1GMV A;  2YKM A;  3QO9 A;  2M8D B;  2KFN A;  2DHS A;  1VQ4 S;  3CC4 S;  5KFO A;  4RU9 A;  4ECW A;  4Y2I A;  2P2C B;  2OPP A;  2AGP A;  4GKJ F;  4WU2 A;  2DHG A;  3MMC B;  2RDI A;  4QR1 A;  3M2R A;  4J9R A;  1W25 A;  1CG2 A;  2B4O A;  2DXD A;  3I9V 9;  4QWC A;  3KLF B;  1TL4 A;  1SKR A;  2H54 B;  4F4W A;  2CQI A;  3CCV S;  1RI7 A;  4CO5 A;  4CLF A;  2DO0 A;  2BJE A;  2D7S A;  1FK9 A;  1S7I A;  2M52 A;  2QLB B;  3SBM A;  2CQP A;  5F0U A;  3T5L A;  2V4J B;  4DL6 A;  3K5P A;  5D8H B;  4Q8E A;  1BWE A;  5CXT A;  1NK7 A;  1BC6 A;  1ZPW X;  1TU0 B;  2CPF A;  4KV8 B;  2IRX A;  3BPD A;  2CNK B;  2Z56 B;  3D3B J;  3EJM A;  3GG0 A;  4HH0 A;  3EXY A;  4HT7 A;  3QLH B;  3PHE A;  3W61 A;  2MKJ A;  2YNF A;  5L9N A;  1T7P A;  3TUP A;  4ERD A;  1IKW B;  2CQ4 A;  1IBM F;  3JSB A;  3RAX A;  4TLQ A;  4Y2M A;  1KOO A;  2CJB A;  5E3P A;  1T05 B;  5J2N B;  3RG6 A;  3FQL A;  1RAH B;  5J2N A;  3P45 B;  1WKK A;  5IV3 A;  3MI7 X;  5F8M A;  3CVK A;  3U7J A;  1KLM B;  2HRT A;  5B08 A;  5HJY A;  1OMS A;  1U7L A;  2VQF F;  4URS A;  1X0P A;  3V6H A;  2VBW A;  4LF2 A;  4MKY A;  2Z4P A;  1M5K C;  2IVM A;  2Y1J A;  3Q8U A;  1HI0 P;  2HAI A;  2JX2 A;  2I0X A;  4XDD A;  4W4M A;  2R2S A;  3L7U A;  2HQF A;  4DPO A;  2Y0B B;  3PRV A;  4YY3 J;  4OI6 A;  2MKS A;  1JJC B;  2HK2 A;  2OML A;  3RUB L;  2QL5 B;  4AT1 B;  5T7L B;  3C6U B;  1KQF B;  2H51 B;  2DBB A;  3I0S A;  4M1K A;  4ZIW A;  1UVK A;  4N41 A;  2FGC A;  1X5O A;  2AJF E;  3QGH A;  1HW9 A;  4J9U E;  1LWE B;  1NH8 A;  2BE9 B;  2F5G A;  3PNI A;  3TW0 A;  5KFB A;  3KMQ A;  1IJE B;  2QLW A;  3FEY B;  1N33 F;  1LW2 B;  3UNG C;  1FNO A;  1H2V Z;  1S57 A;  4KKO A;  1L3U A;  3QAT A;  1J5O B;  3BR9 A;  5K8M A;  1VJQ A;  2FC8 A;  2RRA A;  1SC1 B;  1S1W B;  1N52 B;  4EEY A;  4DQI A;  4AD6 A;  4KAI A;  4QWE A;  4UOH A;  1URN A;  1XTZ A;  2ZNZ A;  2PEB A;  3DNC A;  2BJD A;  3TWZ A;  2NCK L;  1BWV A;  5C42 B;  2GMJ A;  3L3C A;  1L3S A;  3H2V E;  4HAC A;  1RHK B;  5KTQ A;  5E7O B;  3KLG B;  1A7G E;  3OBI A;  4ECX A;  4WFA Q;  1NK8 A;  5LM7 E;  4JI1 F;  3KG0 A;  3A12 A;  4WFB Q;  4NXN F;  2PA3 A;  1C1B B;  4FKY A;  4CP5 A;  8RUC A;  3A3P B;  1U0S A;  2NUH A;  5LT5 A;  4IG3 A;  3UR3 C;  3I87 A;  4K2X A;  1RHU B;  1NSA A;  2OLW A;  5EN1 A;  4RPF A;  2DKO B;  1E6V B;  4YME A;  3I5A A;  1TL1 A;  3NOG A;  2HLU A;  3RW7 A;  3F41 A;  3OLB A;  3S6E A;  4DR5 F;  4CLZ A;  4ECZ A;  3DMJ A;  3CUN A;  2MLZ A;  5GMD A;  2ZBI A;  5E3C A;  3BBC A;  3G87 A;  5HVG A;  4DL4 A;  4DR6 F;  3NLC A;  1FX2 A;  4J9K A;  2Z30 B;  3X3U A;  5DQI A;  2JLE A;  5HRO B;  2HVZ A;  1FFW B;  4DL5 A;  4NI2 B;  2DJW A;  4GKJ J;  5DRK A;  4DU8 A;  4PWU A;  1I51 B;  3CCR S;  2EI5 A;  4RX6 A;  1D9A A;  3JQM A;  2JEI A;  3PO5 A;  2B43 A;  3OL9 A;  3M2V A;  4NLU A;  4QR2 A;  3A3O B;  4OZJ A;  3V6D A;  2R8K A;  2Z0G A;  5HMZ A;  3J7A N;  1P1L A;  1Y11 A;  1T3N A;  5HK4 A;  1BQM A;  4DJB A;  2N7C A;  2Q66 A;  4A4J A;  4B3T J;  3PTW A;  4KBI A;  4R5P A;  1LFP A;  3IGV A;  3LGN A;  3LW5 C;  3W65 A;  1PJ6 A;  2C3P A;  2HQ3 A;  3FMW A;  4NXM J;  1F5C A;  3NMR A;  1JJH A;  1UPM B;  1RAB B;  4Q7A A;  4OZ1 A;  1K1S A;  1CJT A;  4KJI A;  1VQL S;  1WHW A;  1S12 A;  4FYD A;  3R5A A;  1RWO B;  4KY3 A;  2J7U A;  3TOQ A;  3OSP A;  2BAC A;  1UVM A;  3VCD A;  3AT1 B;  1DAR A;  4MK7 A;  2C2Z B;  4ZP7 A;  1BXN A;  2LU1 A;  2MZQ A;  2YX7 A;  3LO3 A;  4FYX B;  4PCQ A;  2G2Z A;  2LXI A;  3DDN A;  4C48 A;  4CZC A;  4TXS A;  2ZJQ Q;  1HWU A;  3IBF B;  5LXR A;  2YWF A;  3DRP A;  5B0A A;  1PIL A;  1KVJ A;  3G6Y A;  3DRR A;  4PUO A;  1UZH A;  4NLP A;  4C8Z A;  2EFG A;  2JHE A;  3CED A;  4M5L A;  4A8M P;  4DFM A;  1B99 A;  2L3M A;  1WOR A;  4JV2 A;  4C8Y A;  1K0V A;  1T3O A;  2DNL A;  2CWK A;  1VQ9 S;  1MLA A;  2GQ2 A;  2FD2 A;  2JH3 A;  1WDT A;  2KHC A;  2RE1 A;  2YTC A;  3E8O A;  4LT6 A;  5DJB A;  3GV7 B;  4URQ U;  5BYS A;  2ZM6 F;  2XMU A;  4I2P A;  2XYH B;  2FPH X;  1U2F A;  4NLW A;  1FKO B;  2FVC A;  1FI4 A;  1R8C A;  1Y5L B;  3OT9 A;  1N5Y B;  3LPE A;  4HTI A;  2HAF A;  4NZ6 A;  2ATL A;  2XTJ P;  2ZC3 A;  3IXQ A;  1XEZ A;  1S0M A;  4RU2 A;  5K9F A;  1H72 C;  2ATC B;  3I5B A;  4ILM A;  2EFO A;  4RBU A;  2FLP A;  3BSA A;  3ZZO A;  2XGP A;  2UUT A;  2WVF A;  3HCX A;  5RUB A;  2BDP A;  4YHH F;  4JI3 J;  3CUL A;  1NH7 A;  4C3M A;  2C3U A;  3KK3 A;  5JMN A;  1WSR A;  4B9S A;  2HBR B;  3Q8V A;  1NPR A;  4BWM A;  5L46 A;  5CD4 A;  1ACM B;  1Q78 A;  1H0H B;  1Y0H A;  3OXG A;  2EC2 A;  4RKU C;  1WSV A;  2V4R A;  4X66 J;  2MY8 A;  1N8R T;  4MIB A;  3FZ2 A;  3I0R B;  4ECR A;  1KWM A;  2N7Y A;  4QU6 A;  4Q44 A;  3QMQ A;  1I94 F;  2XBP A;  1NHK L;  3QPI A;  4TU9 A;  3PR5 B;  2RT3 A;  2RHS B;  2VOO A;  2QA2 A;  1RUS A;  3D0I E;  1CJK B;  4I4B A;  4OX8 A;  5C5J A;  2H5E A;  4WJB A;  3UO0 A;  2D1C A;  3HZG A;  1XR7 A;  1QUP A;  2N4D A;  3SCJ E;  3TEH B;  1GMW D;  1VBK A;  2G9O A;  1HQ2 A;  1TVR A;  5FJ4 A;  1RXO B;  1RBO B;  1NJY A;  1QJH A;  2QA4 S;  1YI2 S;  1U24 A;  3B4D A;  4QOT A;  4PKD B;  1X5S A;  2BJ7 A;  4JI8 J;  3AXM A;  4O4G B;  2GGP A;  3CIM A;  3NCP A;  3O1L A;  1SQG A;  5HMW A;  4N7T A;  1PBA A;  2HIQ A;  2PD1 A;  2PA8 D;  3JQK A;  1HI1 A;  2NZ4 A;  2IBK A;  1NEE A;  1PBU A;  3U1M A;  2DNM A;  1HNZ F;  2MB0 B;  2GJ2 A;  3BN4 A;  1JLA A;  4DPT A;  1ZM3 A;  2DR9 A;  4PG5 A;  4Y34 A;  3W66 A;  3JB9 k;  4RBT A;  1XNQ J;  1XR5 A;  4ES1 A;  2WVE A;  5I3Q A;  1VGY A;  3KK1 B;  4RW8 B;  1H74 A;  5J1E A;  2IJN A;  5G4D A;  3TYT A;  2YNI B;  3W9I A;  1RKJ A;  1E6V A;  3PHT A;  1FJ7 A;  5IQQ A;  5BXI A;  4YS2 A;  3R7B B;  1NPK A;  4JI4 J;  3QRP A;  1QTM A;  4IG3 B;  4DL2 A;  3N0V A;  2LEC A;  3ET6 B;  4O0N A;  4F7V A;  4ZJQ A;  3NGK A;  4TU8 A;  4IOB A;  3R6G B;  3JAM Y;  2D3U A;  2DGO A;  4C0B A;  2HGL A;  1NB2 A;  4CLW A;  3FEZ A;  5KT6 A;  1HR0 J;  4WP8 A;  4LF9 J;  1M1K T;  1FTC A;  3I0S B;  5KFP A;  1D9D A;  1OY6 A;  4ED2 A;  1SIW B;  4V1A k;  1X4A A;  2XY6 A;  1N32 J;  2B4U A;  3VZH A;  2XMK A;  1IR2 A;  1XMO J;  5DDR C;  1Y10 A;  3FSX A;  2DT9 A;  5ETM A;  2V67 A;  2XUL A;  2ZE2 B;  4O0I A;  2W9B B;  1S9G A;  1R89 A;  3GB0 A;  1YRX A;  1WG5 A;  2BRK A;  1DHM A;  1SV5 A;  2HGM A;  3HDS A;  4X65 F;  1Z1Z A;  3CO0 P;  3KHR A;  1FA0 A;  5I3U B;  4WZM A;  3ZTO A;  1LW0 B;  2Z58 B;  3KLI B;  4KGV B;  5ETV A;  1NPP A;  4OI4 A;  4CQ1 A;  1VRT B;  3S8S A;  2QA4 G;  2H65 B;  1EJ7 L;  1N32 F;  2XSJ A;  3RGI A;  4CLU A;  3P5T L;  4FXW A;  2XMA A;  1DQ9 A; 
#chains in the Genus database with same CATH homology
 2CWK A;  1K44 A;  3Q86 A;  1WKK A;  4UOF A;  4FKX A;  2AZ1 A;  2DXF A;  3Q8U A;  3R9L A;  3FCW A;  2DXE A;  3L7U A;  1VYA A;  3VGV A;  3BBF A;  1NDK A;  3PRV A;  4UOG A;  3NGR A;  3GPA A;  3VVT A;  2HVD A;  1NSQ A;  1HLW A;  3GP9 A;  4DUT A;  5C7P A;  1XIQ A;  1WKJ A;  1U8W A;  4DI6 A;  3DDI A;  3Q83 A;  3PJ9 A;  1NDP A;  3ENA A;  3Q8V A;  4ENO A;  3NGS A;  3B6B A;  1S57 A;  2AZ3 A;  5IOL A;  3Q8Y A;  3EVM A;  2VU5 A;  1NHK L;  1JXV A;  4UOH A;  1WKL A;  3VGS A;  4C6A A;  3DKD A;  3EVW A;  2NCK L;  4ANC A;  3EMT A;  1F6T A;  3ELH A;  2DYA A;  1MN9 A;  3G2X A;  4KPC A;  1KDN A;  1NDC A;  3ZTQ A;  1NUE A;  3ZTS A;  4EK2 A;  4FKY A;  4CP5 A;  4HR2 A;  1PAE X;  3NGU A;  3FCV A;  1LEO A;  3BH7 B;  3EM1 A;  1NCL A;  3ZTP A;  1UCN A;  1B4S A;  2BEF A;  3Q89 A;  4S0M A;  4ANE A;  1NLK L;  3EE3 A;  1W7W A;  3BBC A;  4WBF A;  1BUX A;  2BX6 A;  2HUR A;  1BE4 A;  3EVO A;  3FBE A;  3EIC A;  1S5Z A;  1S59 A;  3FBF A;  1MN7 A;  1F3F A;  5BXI A;  1NPK A;  1NSK L;  1LWX A;  3ETM A;  1XQI A;  4O0N A;  1HIY A;  3BBB A;  3B54 A;  2B8P A;  2DY9 A;  3FBB A;  1NB2 A;  4AND A;  1BHN A;  3VGU A;  4W98 A;  1HHQ A;  2DXD A;  3BH6 B;  4F4A A;  3WX8 A;  5CAA A;  4DZ6 A;  3VGT A;  1ZS6 A;  1NSP A;  1EHW A;  1PKU A;  2HVE A;  3EJM A;  3JS9 A;  2B8Q A;  1NDL A;  5CAB A;  3ZTO A;  3MPD A;  3FC9 A;  3ZTR A;  4F36 A;  2ZUA A;  3VVU A;  3NGT A;  3FKB A;  1B99 A;  3FBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...