2ZUAA

Crystal structure of nucleoside diphosphate kinase from haloarcula quadrata
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
153
Chain Sequence
SEHERTFVMVKPDGVQRGLIGDIVSRFEDRGLKMVGGKFMQIDQELAEEHYGEHEDKPFFDGLVDFITSGPVFAMVWEGQDATRQVRTMMGETDPAESAPGTIRGDYGLDLGRNVIHGSDHEDEGANEREIELFFDEDELVDWDQIDSSWLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Molecular mechanism of distinct salt-dependent enzyme activity of two halophilic nucleoside diphosphate kinases
pubmed doi rcsb
source organism Haloarcula quadrata
molecule tags Transferase
total genus 43
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2zuaA00
1WKJA 1WKLA 1LWXA 3EICA 1NDPA 4UOFA 2ZUAA 1S57A 3VVTA 1XIQA 4C6AA 3NGUA 1NUEA 4CP5A 3BBCA 4O0NA 3L7UA 5C7PA 3FC9A 1MN7A 1NSQA 2AZ1A 3FBCA 1BUXA 3EMTA 1PKUA 1EHWA 3B54A 4F36A 1HIYA 2CWKA 3EVMA 2BX6A 1S59A 3BBFA 3FBBA 1NCLA 2HVDA 4WBFA 3BBBA 3JS9A 1K44A 3NGSA 4DUTA 1NB2A 4UOGA 1NPKA 3ELHA 3FBEA 2AZ3A 3ETMA 2DXDA 4F4AA 3EVOA 1KDNA 4ANDA 1BE4A 3EE3A 2HURA 5BXIA 4ENOA 1LEOA 4FKYA 1XQIA 2DXEA 1NDLA 3B6BA 5CABA 2B8QA 1NSPA 1S5ZA 3MPDA 2B8PA 1MN9A 3FKBA 3VGUA 4S0MA 3VGTA 1BHNA 2DYAA 3Q86A 3ZTRA 2VU5A 4UOHA 3EM1A 3VGSA 3WX8A 3GP9A 4FKXA 5IOLA 3Q89A 4ANCA 3R9LA 2HVEA 1NHKL 3EJMA 3G2XA 4W98A 3BH7B 3DDIA 3EVWA 3Q8VA 1NDKA 4KPCA 3VGVA 3Q8YA 4ANEA 4DZ6A 1F3FA 1JXVA 1NSKL 3DKDA 1U8WA 1PAEX 1NLKL 3BH6B 3NGRA 3Q8UA 2DY9A 4HR2A 1WKKA 1B99A 1HLWA 3PJ9A 1W7WA 1HHQA 3GPAA 3ZTQA 3FCWA 4EK2A 2DXFA 3FBFA 4DI6A 3FCVA 1NDCA 5CAAA 3PRVA 1UCNA 3ENAA 1ZS6A 1F6TA 1VYAA 3ZTSA 3VVUA 2NCKL 2BEFA 3NGTA 3Q83A 3ZTOA 1B4SA 3ZTPA
chains in the Genus database with same CATH superfamily
4N41A 3OL9A 1KVIA 1B3TA 2O1PA 2CPXA 3OXFA 2DH9A 5A0YA 1SJFA 1AUSL 3MM9A 1ZAXA 4WE1B 1UEVA 4E8UA 1YITS 1S48A 2MYFA 3W1YC 5T41A 3V81A 1L3VA 1PJ7A 3L3CA 4RW6A 1HNXJ 4PQUA 2WOMB 1TL3A 1RT6B 2E9ZA 3D1QA 3OLAA 5J2NA 2LYVA 5AE2A 1M1KT 3CUNA 2FTRA 1YDLA 4C8YA 1OSDA 5HROB 4B9LA 3VR1A 1HBMA 2MQQA 2B5JA 3M2RA 1C1BA 3RW7A 2QMWA 1ROFA 2GO9A 2RUGA 2B4OA 4YY3F 4O0IA 1M5PC 4CO4A 4DL6A 3ZTQA 4PXCA 1ZA2B 1T94A 5THWA 3UW1A 1ZS6A 5K9FA 2MKIA 1VYAA 4DR2J 2CQCA 3CJ5A 1APSA 4CDIA 4JI1F 4FYYB 3HDSA 3PW2A 4NA1A 2H4YB 3EGVA 4A8WA 2E5HA 4ED8A 2X1FA 3K57A 1PGZA 3CDWA 1VQ8S 1M5HA 3K5OA 1D9AA 3TUIC 4ID5A 3I5BA 3MPUB 4P75A 2QMXA 4O3QA 5A2QU 2HGMA 1TAQA 1TV6A 4Q44A 3THVA 4MYUA 2RU3A 3VGUA 3ITHA 1FWKA 4Y00A 2UZAA 3MMCA 4GC6A 1OO0B 4X4NA 1U1NA 1HQ2A 1A6LA 3BO2A 1RWVB 2RIJA 1U2RA 2YBVA 2HAFA 1XR7A 3FRYA 4FNIA 4F0HA 1SCJB 2WTFA 3M32B 2J0XA 4U7UK 5H9EK 1YJUA 5E2QA 2DIUA 3BQ1A 5E5NA 2WVDA 3PW7A 4DV5J 5KFJA 2EG2A 4RBTA 1RHRB 3T5KA 4K0KJ 4MFBB 1MLAA 2GX8A 5KG3A 2AF6A 3LAKA 2ALYB 5GAEI 4KGXB 4RW4A 4DUTA 4DR4F 2FLOA 1WDTA 4IDKA 1VQ7S 2H5IB 2YKQA 3IWNC 3T1AA 2GGPA 4QOTA 1NK6A 3QWPA 1ZTWA 4FKXA 2LFVA 2LEAA 3FSYA 3SQGB 2NUUG 1NHKL 2UVVA 3UE2A 1BLUA 2G0CA 3P45B 5FDLA 1DLOB 1NH8A 5IT9Y 1PCAA 1H0HB 4DL0C 2XZDB 2RHQB 2E5IA 4EUVA 3GJSB 1B70B 3O3LA 1S6QB 4OI1A 3TO8A 4OYWA 4ZPCA 2NYIA 4DI6A 1NDCA 3FQKA 2Y0SD 5AT1B 4DR3F 3QFHA 2CPZA 1GTHA 1UEUA 4DR7F 1F9FA 2Z58B 3MMAB 2QA4S 3KNAA 4F4XA 2V8HA 4Z7YA 2M2BA 4KIAA 5J2PB 1FA0A 2F3JA 3V6KA 2HQDA 4CLZA 3HD1A 1BQNB 1AT1B 1X5OA 1IBMJ 3HCXA 3PRDA 1Q16B 4DLGA 3ETMA 4CLTA 1NK7A 2YKNB 3HJFA 3NL0A 2K3KA 4ICLB 3DRPB 4TLQA 2DBBA 2HNDB 1BHNA 2LMIA 4U8YA 1FT8A 3RB0A 2XY7A 4W4MA 3SFGA 3ZZ0A 4P2MA 2QX0A 5HBMA 2JNJA 1U6FA 1VR6A 3W65A 4UW2A 4CLLA 1O0PA 5B7WA 4B3RJ 1P1LA 1KOHA 5A8RA 2FHOB 2EFQA 1Q7YT 1FKPA 1XJWB 3FBFA 2IYGA 2VASA 2VDIA 1IKVA 3DC2A 4N7TA 3CD7A 1RWKB 3HHLB 2QG9B 2GIFA 2N3OA 5FD1A 4Q45A 4WXWA 5HI7A 1B7YB 5F3TA 4NYPA 2J9DA 4PWDB 3O2IA 4URQU 2BE7D 3O44A 2ZNZA 1AB8A 2VG5B 2MY7A 4HT7A 2FIUA 2EW9A 4AFFA 1HMVB 4ZIVA 1CJTA 5BYSA 4KJIA 4NRUA 5AE3A 3H42A 2RB7A 4CCHA 4DR6F 5IM0B 3K7RA 4DV1F 2DPJA 2HS3A 4DG1B 4N56A 2G1HA 1WI8A 3FVYA 4ED3A 5ETTA 3KLEA 4JB8B 4LR8A 4OZ3A 3PIOQ 2CUYA 2A18A 3HP6A 4LRDA 4PYAA 1UFKA 1ZH5A 2HK2A 1VGYA 3V2UC 2QJ3A 1OJ4A 1U49A 4NCAA 3GFYA 2KB2A 2AU0A 2PMWA 4EK2A 2DCUB 2BKOA 1LKZA 2NUHA 2IM2A 2R8JA 4KAIA 5KFRA 4F26A 3KLIB 1SV5B 3TA2A 1RKIA 4USVA 1C1CA 5EDWA 1FI4A 2ZM6F 4DX5A 1U45A 2XYGB 2DNKA 4DUYJ 1HNZJ 3D1OA 3GIKA 4LSLA 1N8RT 1Q5YA 5EN1A 3OL6A 3N79A 2EFGA 3FSXA 4NPOA 4DPUA 2DO4A 1CVJA 4AXIA 1T05B 2D9PA 4F4ZA 1SH2A 2F7VA 2N82B 3NMAA 5HMZA 3ICLA 4NXNF 1K0VA 4O3OA 4NLSA 5ITHA 1VJWA 1F9EB 2ZE2B 2DYAA 3V6DA 4J9PA 1CC7A 3SIPB 4HKQA 3DOMA 2MQPA 2XNQA 1NHUA 1S9EB 2JHEA 4CNYA 1UJ6A 2X1GA 3DFEA 1U1PA 1TELA 5IWAF 4QW8A 1RBAA 1FWLA 2PEHA 3NRBA 4DFKA 5I4MA 4M5IA 4AL6A 5C2GA 5IFMA 3M9MB 3AOAA 3VVUA 2ASYA 3V4MA 3A8EA 1LWEA 1H2TZ 3K8VA 1FKOA 1RTDA 3D54A 3RBDA 3DGPB 3W63A 3J7A1 2VPZB 1N36J 1EETB 3CCZA 3BN4A 1S4FA 1KKHA 3D0GE 3VWSA 5JJBA 4E98A 3UI3A 1R8HA 2J7WA 5CXTA 1VQ4S 2GVZB 1SXLA 2A6MA 3QRQA 4QWCA 3Q2SC 3M6UA 1S6OA 4WE1A 4DFPA 1X4EA 3HPOA 2O67A 1WJ9A 3VAIA 1TZ0A 1SVDA 2GO8A 3BB5A 2GHVC 3G2XA 1L3UA 1CLFA 2GC8A 1VRQC 2WOMA 4ED2A 3LWMA 4WFXA 3DLGB 3MHYA 1KD1T 2F63A 2VOOA 2XLIA 2CPFA 2MEWA 2ZVIA 5HROA 2O5DA 5J1PA 3G8TA 4U95A 1NH7A 2V9KA 5GMKa 3RBZA 1RISA 2HFOA 2QSWA 4DSEA 1FKAF 3I31A 1URNA 1RTHB 4KO0B 2BW7A 2VOPA 1X5TA 2RVJA 1A9NB 3PDNA 1B0PA 3AA9A 1KQSR 2OTJS 5HATA 2E1PA 4L75A 3M9NB 3KJVA 2UUTA 1HNVA 2GHWA 1V3ZA 4O3RA 4K4TA 3FBBA 2UUWA 2IJRA 4DSIA 2VA3A 3U7JA 5CH7B 2D3ZA 4M8LA 4NXMF 1WI6A 3BR9A 2CXEA 5BJRA 2HNZB 3GJTB 2R8KA 4QYZJ 4IO9Q 1HR0F 4KB7A 4X4UA 5D15A 3DRRB 1N5SA 3HT3A 3RB3A 2ZC3A 3C2PA 4DPTA 2ZDPA 2IM1A 4I2PB 2HHPA 3BSCA 4K4UA 3CE8A 1WSVA 4EZ6A 2AX0A 2V67A 2RQKA 4DPWA 2CG8A 2M8HA 2XI3A 3NCRA 4ELVA 3JSMA 1S76D 3KFWX 2POKA 4ED6A 2MZ1A 2W1BA 2OGUA 3TEGA 1NHVA 1Y10A 2RILA 2RRBA 3H4DA 2D9OA 1Q95G 2PC6A 3ZFVA 4Y2AA 5E7OB 1NJZA 3MWBA 4JI4F 5CYQB 1LNQA 1Y5NB 4HT5A 2QA2A 4J9LA 4OX9F 4ATNA 2XY5A 2DGVA 4D3GA 4MFBA 4O3NA 4DU8A 2ADCA 2AGOA 1NK9A 1U48A 2C2NA 4JI5F 4DV0J 3MURP 2CG4A 2MQOA 2D1CA 5F8LA 1TMMA 1J5OB 4KHRA 3IS9A 2HHWA 1N32J 5CA5A 3UD3P 1S1WB 1H38A 1RA7A 5J2MA 4DUZJ 3GV5B 3M8SA 1AFJA 1J5EF 1T9TA 2EFOA 4WP8A 2AHOB 2D7SA 3JSBA 1N52B 3LW5C 2DT9A 3MZIA 5IV3A 2HYIB 2NSCA 1YJRA 2IC3B 4L73A 4MJKA 3JYTB 3ILJA 3Q83A 1IQTA 4YFUA 1NUEA 4OJHA 3R5BA 3OUYA 5LL6d 1N6QA 1S6QA 1YJ9S 2DRBA 4M5GA 4MYTA 2WBMA 2VONA 1MN7A 4IRDA 3QYYA 3HKWA 4OI2A 4DWIA 2B9EA 2M88A 5I42A 3LQVA 1VC0A 4ZHRB 4TU7A 3O6QA 2GV1A 3MMAA 4U67Q 2VC1A 1NK4A 2ZD1B 2WBRA 4R5PB 4CO5A 4ZP8A 2DVIA 2CQGA 2ZEJA 4CZCA 1VS3A 3CDEA 5B0DA 2DHGA 3HHEA 3RAMA 1XEZA 3P49B 1HBNB 1LWFB 1SBRA 4K2XA 1RGVA 4ICLA 1UVJA 1SJ1A 5CCMA 4NYOA 2HNDA 5D8HB 2J5AA 3TUPA 4EO6A 2MPUA 4Q2MA 1X9SA 2HNYA 2FVCA 4TY8B 3A13A 3TZYA 2A6OA 1RHKB 4OYBA 4ECRA 4TYAA 3BKFA 4MIBA 5ADZA 3T1HF 3D28A 1ZYQA 4U6PA 1WC0A 2JVOA 3GV7B 4KYZA 3OV7A 1TP7A 4ZPWR 1UW9A 2CJAA 3BEGB 1JLBA 4QYRA 4JI3F 2W7AA 3H0PA 1JLAB 3ZZYA 1VQPS 1SJQA 5RUBA 4PUOA 3DOKA 3H2UB 2QTWA 4DSLA 3DMJA 2KJVA 1RT7A 3C6TA 1T9UA 1LEOA 1OMSA 2J6UA 2ATLA 4PWDA 2HLUA 3BPDA 4HHUA 4M5KA 1PILA 2DH8A 2YVSA 2W4CA 3TJAA 2V4QA 1LW2B 1CJUB 1T9XA 1HMVA 1X60A 1JX4A 2ABYA 4CLKA 1N5VA 4HH0A 4PEOA 2DGUA 4DG1A 1MW7A 4F2SA 1RAHB 5KG7A 2UXBF 4P7VA 1SL1A 2D69A 1V3SA 1FVSA 3AQOA 4KGVB 1UA1A 1KQFB 2DNGA 3GMGA 4Q0BB 2X3GA 3A3OB 6FD1A 1JXLA 2M7SA 1KQKA 1F0XA 1LFPA 4CLWA 3DNCA 1NKEA 2ERRA 4LFBF 2DIVA 3BBFA 5D4LA 2HQFA 4RW9A 3GONA 4CTAB 4N77A 4ZIWA 4F0MA 3L09A 3N28A 1UVIA 4ZOSA 1PJ5A 1IJEB 4OV1A 1HQEA 4DR1F 5HO4A 3CD5A 3I87A 3DU5A 2BJ3A 4JI6F 4I0WA 3GP9A 2CJXB 4HDHA 4U7UD 3OTOJ 4DCJB 2UXCF 4DV7F 1P6TA 2XMMA 3GG1A 3NAHA 4EBEA 2XCPA 2ZE2A 3K58A 1XN9A 1WKKA 4L3KA 2IYIA 3OSPA 3IBCB 1NK8A 2AYMA 4C8MA 1RUSA 2IMOA 4DN0A 2GVDB 5CAAA 4PRFA 2BOPA 2E1CA 4FYDA 5C5JA 3H5XA 2XM3A 2FDNA 1NJIT 2LDYA 2CZ4A 1U6BA 2R7TA 1QAYA 1XNRJ 1N33J 2GMHA 3I4HX 4Y2MA 2QSFA 2CQHA 5KT4A 2GJIA 2W24A 1NZAA 3CC7S 4J37A 4USKA 2Y0BB 4IFVA 4H4KC 1BC6A 1ZM2A 2ZBQA 2Z2ZA 1QVGR 1UKUA 3MR7A 3C15A 4HTIA 2WVBA 3W2WB 4MIWA 2GQCA 3PKYA 5D4OA 4X62J 2HWIA 2VF3A 2E5LJ 4XPCA 2OUGA 3DDIA 3ZZPA 2GVZA 2E66A 2RUSA 1A7GE 3R5DA 1IQZA 1WOPA 3ENQA 4DZ6A 1V3RA 1D9DA 2VICA 3R6GB 2DNOA 1YZ6A 3CGIA 5F0UA 2AJ4A 4AQYF 2I38A 4ED4A 2C3YA 2MZRA 2QEXS 1IR2A 3KWMA 5J1EB 2L9NA 4YEAA 2RQCA 2P6TA 2HEKA 4KRWA 2NCKL 2RQMA 1QDUB 1TKTB 1Z2LA 4DMZA 1TKXB 4X4QA 1S99A 3LH2S 4QR0A 2XO7A 1RZMA 3L95X 2K8GA 5E3AA 1RTJB 1R6YA 4Q2LA 4F36A 1MMLA 3M6XA 4KQZA 3BBBA 5KOXA 4KO0A 4I6YA 4L74A 4WFNQ 5GADU 4DR5J 1T7PA 4FYXB 4F4AA 2XWXA 1Q8BA 5KG6A 2BDPA 4CLPA 4JUZA 5IV4A 3AD8C 2JEIA 2AEJA 5HAOA 4BBYA 4X4OA 3MR2A 2LU1A 1TVRB 3DDKA 5H9EJ 2CADA 1CJKB 2WB1D 1XR6A 3TAQA 5KT2A 3FSIA 1S1XA 4DS5A 3VGVA 1VQYA 3MMJA 2ZH3A 1HHSA 2ASLA 4YN3B 3BGFA 5CD4A 5HVGA 1TKZA 3DRRA 1FRMA 4ERDA 2WSEC 3AODA 3SQOP 3HFVA 1M1HA 2HZVA 4C97A 5LMNF 4DV2F 4DV6J 3H20A 1AZSB 3HKZD 4C6AA 2R7VA 5M2UA 3H5YA 2WHOA 2UUCJ 2HBYB 2AGPA 5AXNA 1VI7A 3GG0A 2MKHA 4UT4A 1XNQJ 1VISA 4WIQA 3BGOP 4P74A 2I9SA 4YQWA 4G1QB 1M90T 1CS4B 3N6NA 4AUKA 3DOLA 1RADB 2MKYA 5A76A 2YNIB 3Q8SB 5DGBA 2VG7B 4OHXA 2WK4A 2B8PA 4X4VA 2DB1A 1RAAB 3G87A 5C42B 2XYPB 2V4JB 2OHDA 3KG4A 5CYQA 1U1KA 2R8GA 1MSWD 1WACA 3DU6A 4USHA 4LRAA 2A2CA 1DTTB 3DKDA 2X1AA 1HNIB 2LU2A 4WTOB 2VPWB 2HRYA 3D6MB 1HQUB 2UVUA 2JX2A 1S12A 1ZPWX 3FUYA 5F9NA 2Z8QA 2OPRB 1S1WA 3ZO7A 4OYMA 3BR8A 1L5UA 1E6YB 4NL5A 2JLFA 4LRCA 4EYHB 4NZ7A 4K4XA 3PTWA 5B0BA 2H4WB 2WW8A 1HNXF 2OEKA 4EZ9A 1S0VA 4OYOA 4K8RA 2L48A 3EZUA 4PPDA 4F25A 4B08A 3NEKA 2EBEA 2IC3A 2YXLA 3JYTA 3NMRA 4TQRA 4W92B 2VQFF 2BABA 2DK2A 3MTJA 4YUDA 2B9YA 3I5AA 1LW0A 2CNKB 4HHJA 4LF9J 3GWCA 1UVKA 3B82A 4MTPA 4ECXA 1H2UX 3BSOA 2E44A 4DDFA 3TOQA 4TKTA 4XTTA 2XO6A 4DR2F 2ZD1A 1FNOA 2V68A 4M5HA 3QATA 4B9NA 4Z2XA 1LQ9A 1YHQS 1VQKS 4LF1A 4YOEA 2IBOA 3I32A 3TAPA 1XMOF 2JC1A 1CQMA 5HMYA 5LMUJ 3V6HA 1RAIB 5E3CA 4X4PA 3QGIA 5B0CA 1HBNA 1LWFA 4PG6A 1F5AA 4RUCA 3BN7A 2YWKA 3TVKA 4F3OA 1N5YA 2ZUAA 2FB0A 3LWLA 4GKKF 4TY8A 2NS1B 2WSFC 2XULA 2F1FA 3PJXA 3EMTA 4USWA 2CWKA 4NA3A 1S1TB 3I6PA 2P5VA 3NGSA 4O4GB 4OYIA 1QLNA 4WCEQ 3VAFA 2F9DA 3DI6B 1IWGA 2EWHA 2G1DA 4NCBA 2MKKA 3V4IB 2BE9B 4KFBA 3MGJA 1T3NA 3JB9k 4F0KA 2FZKB 4X84A 3K5PA 2HQGA 5DZ6A 3QRRA 1U09A 4UTGA 2XZTB 1RT3A 2V5HG 2OI2A 1SIZA 1B0VA 2CWXA 2DY9A 1QSLA 1ZOTA 2NSBA 4Z7CA 3OL8A 2FYXA 3PXGa 4LVOP 1K47A 2CPIA 3TZZA 1URRA 3GQCA 1KTQA 4HI1A 4RUAA 2AYBA 1HNWF 1S4EA 2M9KA 4A8SA 3MPVA 4JYAJ 3BBCA 2PA8D 2OIHA 3FC9A 4ECUA 4B17A 3RJMB 5FLXU 3HHKA 4P52A 3RBXA 2UVWA 3VALA 2V8VA 4V19J 4I6WA 1BQMB 1PC4A 4EU0A 3KLHB 5BXIA 4UY8T 4ENOA 4B3SJ 1O51A 1TK0A 2CPDA 5AXLA 3KG1A 1FDNA 4YB7A 3UDEA 3QSYB 1MNEA 2YQ0A 4NMXA 3QT7A 2PIIA 2CQIA 2WZ1A 5A8KB 3MPYA 4J9NA 1UTAA 3OPKA 2Y8WA 5KG0A 3J81j 3BGUA 2K7KA 4YP3A 3SBMA 2Z57B 5HLFA 2BVZA 2FHJD 3Q8QB 1HHQA 3C6UB 4RBVA 4KR0B 4ALZA 3OHBA 5GMEA 1JNRB 4DOZA 2YQ1A 1KBRA 2JJ4D 2I5JA 3PY8A 3TQ1A 2RF2A 1YQHA 4ZJLA 5KFSA 4B3MF 1TL7B 4O3SA 1N0VC 1JJHA 4P2SA 2Z56B 1GAOA 3CF5Q 1R8CA 4IG3A 5AE1A 3CVKA 3OTEA 2IDEA 3TUZC 5EWFA 4UOCA 2BJ9A 2Y3YA 2V4RA 2RS2A 4J90A 3RR7A 2BV3A 1ZM3A 1VDHA 2WONA 1Q86T 1QTMA 5L1LA 3M30B 3HMJG 3PEHA 5KFVA 1R7IA 1SB6A 5KFDA 1M5SA 2U2FA 3ZTRA 4CRJA 1VQ6S 2W7OA 1FRHA 3K8WA 3PO4A 2BYCA 4DQRA 3K5LA 4J9SA 5GAEU 2CPJA 1TKDA 3CJ0A 1SC1B 1F3FA 4JI8J 1LWCA 3TX0A 5KT3A 3MR3A 1HBOA 1RHMB 2KYXA 3UVJA 1HARA 1XMQF 2OMLA 2OAUA 3FCWA 5SUHA 2R8HA 2DR5A 1X4DA 2M8DB 3QT8A 1IR1A 5BR8J 1CJVA 2BRLA 3NS7B 3JAMY 1SH3A 4ZP9A 3RZAA 1N4LA 2ALZA 2FJEB 4U7CA 2GCFA 2MZJA 3CC4S 5DLFA 3KK3B 2X7IA 1R0AA 3EVMA 4OYPA 3J81U 1NCLA 1TKTA 2YWHA 3MCSA 1RT5B 4DFMA 1NKBA 2IVYA 2MZSA 2AJ0A 4NCGB 3I5CA 2PD1A 1U24A 2KVIA 3S6EA 2EEYA 3G8QA 1XTZA 2VG6B 4TNOA 3CD6S 3RYLA 1RCXB 2D74B 5EWEA 3IWXA 4LF4F 3KUHA 5F41A 2ZH7A 3O8WA 1RAOA 3MXHP 4ILMA 2XHWA 2L9DA 3MAAB 2QN6B 5LT5A 2C2OB 3I56S 5F0WA 4B9SA 2EFNA 4IRCA 3NS6A 3FQLA 5DO2A 3PV8A 2C22A 1HNZF 4DUYF 1CJKA 1VK8A 3MFHA 4FYVB 1UCNA 4USMA 2V2QA 1QTNB 3HVAA 5L46A 4LFCJ 2HHSA 4WIIA 1Z4UA 4ECVA 3OVBA 1R43A 2HHTA 2ZBRA 4N47A 1AROP 1IKYB 2RS8A 5C24A 4RW7B 4CO3A 4RU9A 3B78A 3W3SA 1GXUA 3UN2A 4DSFA 2ACYA 1S7IA 2MKCA 5KG5A 1DRZA 3PM9A 1AZSA 1IXKA 5JVHQ 5EX3A 3B8HA 4YR3A 1ZETA 3D66A 2ZBIA 5C2CA 1LK5A 2HBZB 1LFWA 4O44B 1ZTTA 5LXRA 5A2QY 1KRPA 2HZAA 1IKXB 4MKYA 2XYHB 1CS4A 2P2CB 4KH1B 3BH7B 2JDJA 3O5TB 3EGNA 2YNIA 2VG7A 4KV8B 2IDLA 3HHLD 1CC8A 1TL1B 4V1Ak 2V4JA 3PJ9A 2BJ7A 4NEYA 3W61A 4LVNP 1PYSB 3UR0A 4AXJA 4J5OA 3LTOA 3KK1B 5B0EA 2VFTA 1M5VC 3A8KA 4LREA 1S10A 4ZP7A 3OBIA 1G1XA 1WKLA 1DTTA 5LJ3Y 3ILLA 2DISA 3BYRA 2VFVA 3A4TA 2K3IA 2YY3A 3KJQB 2Z4PA 1BWVA 3SI8A 2F5GA 2E9TA 1SPBP 4C2MA 1WC6A 3QAEA 1NK0A 4J9KA 2H51B 3QLHB 4O23A 3P8BB 5K20B 3MM8B 3THTA 4I2QB 1NM2A 3PIPQ 5L1IA 2B4UA 1HFEL 3MECB 1TTHB 2G2YA 4OIXA 3V5RA 5L1JA 5KFMA 2W9BB 5HVHA 3TZXA 1FRXA 2XTJP 2DNHA 5J2QB 2B3TB 3CO9A 2ZOFA 5C25B 4LMZA 3CJKB 1NLKL 3H7HB 5BYRA 1HWIA 1Y9OA 3OJUA 1OYDA 3KJNB 2J7UA 1FFSB 2JFDA 1CPZA 3KNGA 4L72B 2F9JA 2QA1A 4LF5J 2MGZA 4NLPA 2XEXA 2RKIB 1QE1B 4UZBA 3I4PA 2JL9A 3M8WA 2CQ3A 4A8OA 4OHZA 1GT8A 2WVFA 4WU3A 1WEXA 1JLEB 4OX7A 4RW8B 1MROB 1NRKA 5FJ4A 3A3PB 4JP8A 2YNGA 2ZC4A 3D2WA 1HWKA 2DXDA 2AP6A 1UVLA 4JV5J 2HURA 2FHKA 3K0JA 1UEKA 1Z1ZA 2IA0A 2BBEA 1S1TA 3R5GA 2PMHA 2ZZMA 1NEEA 3VGSA 1FESA 4F02A 3VAJA 2QA4G 2RSQA 4FYWB 3CWJA 4DCOB 3K89A 4KPYA 3DI6A 2JRSA 2GZOA 1JXVA 3DDNA 4GKJF 1F60B 3PW4A 2QL9B 2NZ4A 2UVRA 3WHIA 3CNQP 4QW9A 1T9VA 1YBTA 2FPHX 1U8SA 3PRBA 2KTQA 1RQ0A 2JEFA 2QE5A 1PBAA 1Q78A 4WP3A 2PDAA 2J8AA 3GTYX 2JC0A 4OI3A 3AD7C 3CC2S 3MEEA 2BANB 1ACMB 4OHWA 4LQ9A 2RRNA 4AYBD 3HULA 4A8KA 2KXFA 3QGGA 1RDRA 2KVQE 2CVEA 3N01A 4GO5X 3PNIA 2CDQA 4YY3J 1QD1A 3BJYA 1N32F 4DX8H 1X4BA 2DR7A 2EFPA 3M8PB 2CQPA 1FK9A 3MPDA 1SL2A 2X3DA 1SL0A 1BQMA 3A8IA 2D41A 2LKZA 1S6PB 4JI1J 1Y3JA 4OYAA 4RX6A 4JV0A 3BSNA 3KLHA 4LT6A 3PHTA 3DLKA 3MCOA 1LXNA 1NU4A 4J9UE 5A8KA 2VFSA 4LIRA 1FDDA 2XCAA 4A8YA 5E3RA 2KFZA 1DURA 1KLNA 2DNLA 5ETLA 3T5HA 4TXSA 4NLUA 2NQPA 2BRKA 2FY1A 4FS2A 4KKOB 2XS2A 1DBDA 3GIRA 4NMLA 5KFHA 4C11A 3R5AA 1VRTB 2IM0A 1YJ7A 4G3IA 4F3QA 4H54A 1TL7A 1K73T 1V5VA 2J9DE 3MCMA 3POTB 1IWAA 3GSDA 1WG5A 1VLYA 3MEKA 2C3MA 3QAUA 3IP0A 3TYTA 1TL5A 2XMWA 3GJRB 1VOMA 2CDRB 4CLFA 2FJDB 2H3EB 4PCQA 2NZCA 5LM7E 1UP1A 3H4BA 1RB0A 3TQEA 2LXFA 2W9CB 3BH6B 3NNAA 3D3BJ 4LRFA 4IR1A 2WVCA 5G0RB 1T3OA 2CNOB 5JUMA 1IVZA 1CG2A 4ZJOA 4DR4J 3AOCA 3NAIA 1SQFA 2EG1A 3PFOA 2IM3A 2FVPA 3UN5A 4B9TA 4C3LA 1WWHA 2QC3A 1Q53A 3F56A 2ROPA 7FDRA 1B64A 1XC9A 4WJBA 1S1UB 4DEZA 2AZ1A 4OI4A 1KC8T 3BGRB 4F50A 3ET6A 1FDAA 1BGXT 2RRAA 2KN4A 1JLFA 3G82B 2HHHF 1OIAA 1FCAA 1AXQA 1K44A 3I55S 1YJVA 1RHJB 4FVMA 4J9RA 2DTJA 1U1LA 3C14A 1R0CB 3C16A 2FZGB 1FO1A 3GR0A 4FBUA 3BF4A 4C9DA 4DR3J 2R2UA 3TA0A 1WOSA 2VG6A 1J2VA 4LBIA 4ECWA 2UV8G 2OP5A 3UDCA 3PX4A 5CQGA 1WHVA 2DGXA 2YWEA 1X4AA 2F40A 4KHPJ 1EB0A 2HRTA 1YX2A 2U1AA 3ZTOA 2YQ3A 2DD8S 1JQGA 4DBQA 4DPOA 2ROGA 4GC7A 4EGLA 2DHAA 5KFEA 3H5UA 3DYAB 2M0GB 5LSLA 3MI7X 1HI8A 3FBCA 1Y11A 1RT1A 3G4SS 1SUQB 3JS9A 2OPSA 4RBUA 1JJ4A 1UWBA 2BW2A 3CSKA 4RU2A 4ELUA 4XK8C 2VUGA 3ENWA 3J7YI 3BKTA 3CJ8A 4FDFA 5IS2A 2PO4A 1KS2A 1YJTA 3JAMU 1H2VZ 3UCZP 3WBZA 4NA2A 5KT6A 3RUBL 4ZVUB 1W2BR 3RRGA 3X3UA 4NLOA 4O44A 4A48A 3R1LA 2HFUA 4PYDA 3PJWA 5CYMB 1EP4B 1R8PA 2FJWA 3PYGA 1N0UA 3AJ1A 3DLEB 1MU2B 4IG0B 1RAJA 3D6FB 3MMBB 2PN6A 2V94A 1EAYC 1YG0A 4DR6J 1PO6A 3AAWB 2GNKA 2XGQA 4KV8A 7AT1B 3CCES 3VAMA 3IXQA 3RAXA 4F4YA 4O0NA 4EBDA 3L7UA 2CJ9A 1QUPA 2YKAA 1JLCB 1FE4A 2CQBA 2Y8YA 2FLLA 2FJAB 1U02A 4H4OB 2R7SA 3KKFA 5I3PA 2E5LF 1RT4A 1RK8A 5I3UB 3T19A 3X1LB 4P72A 4HI2A 4E2FB 1FEHA 2YWGA 1NAQA 1P1TA 4LBPA 4OZ2A 1X4GA 1JLGB 1RABB 2M70A 3QLHA 3HJVA 3AA8A 3VAHA 2XSJA 2YTCA 3MM8A 4PQAA 3H5SA 4N8NA 2ZM6J 4I7FB 1IBKJ 4ZVTB 3R6LB 3TARA 1FXDA 2B9WA 2HIYA 4XIUA 5A8WB 2V50A 3MECA 3CIMA 3MEDB 3CO0P 2ILYA 3M9OB 2KRBA 4J9QA 1DARA 5DRKA 4WWSA 1U25A 2W9BA 1SQGA 3AXKA 3R1HA 4LSNB 2WB4A 1TFWA 4DFJA 2XSFA 1PSDA 4NXNJ 1S9GB 3DM2B 3CJKA 2RDDA 2BACA 4DR5F 1OS5A 4IUFA 1YIJS 2M4MA 1U2CA 1U1OA 2KKHA 2C2EA 1WF1A 2HGLA 1FXRA 4ZPDA 2N4CA 4FXWA 1U47A 3MUTP 5DQIA 1QE1A 4WBFA 5IWAJ 1Q8KA 2A1BA 2XI2A 3U1LA 2QFJA 4RW8A 2DITA 1MROA 2OPQB 3MD3A 2UUBF 3TZWA 3WQPA 1QJHA 1QM9A 1VQMS 2K2PA 3NGDA 1C2PA 3RB6A 3PW0A 2B7CB 4H4MB 4RLEA 1HPZB 5HQ8A 5KFNA 4DV6F 3D68A 4B3OA 3BO4A 4WU2A 4P2XA 1NPPA 4ZCLA 2Y9HA 4TYBA 2ROEA 4WKYA 1WTBA 4CWBA 1XNQF 3QGPA 5D0HA 4ZVHA 1MWZA 1F1BB 4ZN1A 4QIEA 3HD2A 4UOFA 1HBUB 3JQMA 3LP0B 1RAFB 2J76E 1DAXA 2EK6A 1BUXA 2YX7A 4OZ1A 5DQGA 3M2UA 5F3ZA 2QYGA 1U0HB 1DTQA 3M8YA 4R0EA 2UV8A 4LFAF 3BS9A 2M3DA 4A8XA 4DZDA 1Q5VA 3AHPA 2DEJA 1W25A 4FZVA 3FNNA 3KLFB 2V34A 1FF2A 2J7KA 4ECQA 2ZH4A 5E3PA 3M8PA 3NWRA 4OX8A 2K1RA 3PVXA 4L76A 4Z37A 3GILA 4KSEB 4ED7A 3MR5A 3BM7A 2ZZNA 4R25A 2IVFB 5FIIA 1S6PA 3BREA 2CJKA 4I56A 3J80U 2J0WA 3DRSA 3JTNA 2B43A 2CJQA 3C8YA 5KFQA 3OFFA 4QIVA 1HR0J 1H7XA 1X5PA 3GYGA 4IKAA 2DH7A 3VVTA 3W5YA 1FD8A 3DXSX 5T7LA 4FXVA 3I0SA 4KHMA 4X66J 2R7OA 5HP1A 1BQXA 3RGIA 4KKOA 4OZLA 1RP5A 1ZM4A 4B3TJ 3CXCR 1D8ZA 3Q2TC 5ETMA 2W2PP 2V8GA 2QT7A 2R9LA 3D3CJ 1S5ZA 2LXUA 1ULRA 3RTVA 2R4FA 3DN9A 1WC5A 1RYSA 2VU5A 3SCLE 3WX8A 4ECZA 1ZZNA 1Y5IB 1AYEA 4WYWA 3N0VA 4K2JA 5KFCA 2I8EA 2CYYA 4PG8A 3W9JA 1Q82T 5GMDA 4CI0B 1ICEB 2OPPA 5EUHA 4WXOA 4M95A 1HI1A 1UA0A 1WSRA 4MKVA 1VLOA 2VD3A 3LF0A 3P6YC 4JI4J 2HVIA 2E7XA 3GYNA 4OX9J 4WYLA 3U02A 3PEJA 4JI7F 1WKJA 1CBKA 1YRXA 3IRXA 4MIAA 2RDIA 3O1LA 2AQ4A 4JI5J 2WSCC 5K5MA 3D9BA 3IBFB 3W60A 1OPIA 4ES3A 4PPZA 4BDPA 4RNHA 3IN5A 3MM9B 5A6WA 4IYQA 1YBAA 3EGWB 4RO0A 3SSSA 1WNEA 2G4BA 3W64A 2UU9J 4QU7A 1PAUB 2BOAA 3PCOB 2AZ3A 1J5EJ 3DGVA 5D3GB 1KDNA 2BM0A 1GK8A 4PQUB 1TL3B 1VCTA 5J2NB 1OPZA 1RWOB 3BGRA 3PO5A 3AT1B 1XMBA 4CLUA 1MN9A 4IOCQ 3G82A 3Q8RB 1TR0A 2B5JB 2YKMA 3H98A 3CMES 1FX2A 3EJMA 2CQ0A 3QFWA 4XDCA 1C1BB 3HXMA 4HL9A 1W26A 1KEKA 6AT1B 2CQ4A 4OZ5A 4P71A 4RZRA 3NNCA 3W5XA 3HM9A 4HLBA 1M5OC 3GFZA 5F8GA 3Q23A 4EO8A 3M2VA 3WC2A 1QAXA 1HD1A 2B6AB 2ATCB 1YI2S 5DQHA 2N4DA 1H6KX 3MF5A 1FE0A 5L8RC 3PYDA 2OMOA 4NLGA 4ZK7M 1DQAA 4NLYA 3HFZB 1KP6A 1S1VA 5JMNA 4YS2A 2NPIA 3IR7B 4LF7F 2VL1A 5T14A 5D4NA 4AL7A 3IR6B 1RE1B 3KOAA 1U1QA 3GIIA 1F5CA 3MEGA 2BM1A 1NDLA 3GLJA 3ITHB 1SUQA 3T1HJ 3WX4A 3PKMA 1Y0HA 2XGPA 1G2EA 4DX6A 1R3NA 5KTQA 1FHTA 1HI0P 2V6AA 3D0HE 1IJFB 4PG7A 1RU2A 2QLBB 2H65B 4F4WA 3FCVA 3DCAA 2AGQA 2VIHA 5DDQC 5B0AA 1RA6A 3TWZA 1EP4A 3ZNJ1 3NLCA 3VF0B 3DLEA 3S1TA 2DNYA 2PE8A 4IG0A 1CSJA 1RHQB 3MMBA 4ZVGA 1AW0A 3RB4A 1NMEB 4J9OA 2HVZA 2ZH2A 3NKYA 4QCLA 4WK3A 4RW4B 1U2FA 4A8QA 2EK1A 4IDKB 8AT1B 2EC2A 2J6TA 2ZWOA 1ZM9A 4PXEA 2HFZA 1NKCA 3FFIB 1M0SA 4ECYA 1RT6A 1JLCA 2GGPB 2ZOMA 1YBUA 4QWEA 2GJFA 4C8ZA 3TR5A 4RNOA 3SSQA 1QAJA 3CCLS 3GV8B 1U1RA 3PZPA 5I3UA 2KH9A 3IRWP 4NLXA 3NY0A 2BKNA 5BR8F 2MXYA 2ZHAA 2FLNA 4YDXA 1HW9A 2I0XA 1S0NA 2KI2A 3NCQA 5BYQA 1TK8A 1T9WA 2ZNYA 4I7FA 2HHXA 4Y34A 2MQNA 4ZPTR 3KHHA 2FHJA 4DR1J 5A8WA 3CJ3A 5LSOA 1QY7A 3MEDA 5ETSA 4JI6J 4CLYA 3CDAA 1RJJA 2HVHA 1EHWA 1VIOA 1S9GA 1W2IA 2UXCJ 2A0FB 2YH0A 1NO8A 2DR8A 1FTRA 2FD2A 3IBWA 2DGSA 5K8PA 3OHAA 4WZMA 3T9ZA 5MLCV 3M8ZA 1WDDA 4FF4A 4ES1A 2Y1JA 2BJ1A 2KT5A 3CMAS 4WPAA 3OR1B 1TFYA 3AB4B 3HZEA 4EI2A 1FJGF 2JWNA 2ACMA 4Q5VA 2FVQA 4FPIA 1EX8A 1PAEX 1U7LA 3EDRB 1VQLS 3T1YF 3M32A 4ILLA 3PACA 4H4MA 4ZLLA 3P3DA 3R3TA 1IKVB 1OQ6A 2FGCA 1HPZA 1SC4B 3CULA 1DQ8A 2H5JB 3LPYA 1S6UA 3ZTPA 5I3QA 2MQLA 4GRSA 1EKSA 4LF6J 2COLA 1UJ5A 1EZZB 4TQSA 3M8RA 2QV6A 1F2GA 3NXZA 1GXTA 3AJDA 4AQYJ 2MLZA 3UCUP 1R0BG 3D4JA 2BJEA 4TY9A 1NZ8A 3CCTA 3EPGA 5DLGA 3G6VA 1Y3KA 2RDJA 3PHEA 4P6QA 4N8OA 3CJTA 3HHDA 3TANA 1U0HA 3KLEB 2BQUA 2XS5A 3SQGA 5CD4H 5KT7A 5M2RA 3OTCA 4ZLNA 2IAJB 1MWYA 1DLOA 2VFRA 3A12A 3OXLA 1UAWA 3Q24A 1VBXA 3VAKA 4ED0A 3KLFA 3KLGB 3W2VB 3T6BA 3AQPA 1RHUB 4ETZA 1YLXA 5GAHI 3IGNA 4OMFG 4PXBA 3MPWA 3SFUA 4ZCMA 5HVFA 1HYSB 5GAGI 2I2YA 3GZ7A 3PG9A 1C1CB 2HIQA 3TAMB 2QLXA 2IRXA 4RNFA 5G4DA 5ETKA 1FRIA 3UO0A 4CO0A 2C1EB 3B54A 3EWGA 5J2PA 2XBPA 3W62A 1BQNA 4X4RA 3SDEB 1GTEA 3KTQA 2DO0A 4QJVA 2KFYA 1NJWA 3IGVA 5FLXY 1TUVA 2IJFA 1N34J 2YKNA 1RWUA 4B9VA 3RRHA 3DRPA 4ZCIA 3PFEA 4DSKA 2UXDF 3VGTA 3GIJA 4DV2J 3UN3A 1FEEA 2AEMA 3Q86A 4JI0J 4DHVA 3DOMB 4C48A 1T02A 1N5TA 3A3NB 2ZFHA 3UQSA 2PA3A 4X65F 1VRUB 4LF5F 1D3WA 2MHNA 2Y1RI 3HSJA 4JI2J 4WFBQ 4KC5A 3NGRA 4JV1A 1X0FA 3MCNA 2HLTA 4OZ0A 1NBEB 4DX7A 3HHLA 2ZJPQ 3M7VA 1S72S 1LWEB 1WG4A 5IC4B 3EGZA 3F73A 2KM8C 3CCSS 4JV5F 1FKOB 1RTDB 3KMSA 2JFKA 4F4KA 1PKUA 3S8SA 4ZJQA 3VV2B 2BKPA 1RWPB 4UZCA 2VG5A 2PFFB 3KJFB 4OI0A 4G6VB 2BZ2A 5KFBA 3FEYB 2XY6A 1BE4A 5IM0A 1XQIA 2CJBA 5M2PA 2ZBPA 1WHXA 4YHHF 3UNYA 2QO3A 2IHR1 3RRKA 4K4YA 3R9LA 4P2FA 2ZOGA 5JVGQ 5D3GA 2GAHC 2C28A 2HQ3A 4KPCA 1UW4A 2EBGA 1FFGB 1D9FA 2ZWPA 3R97A 2JZ5A 2VQFJ 4UUXA 2J6SA 1K0TA 3TNVA 3P5TL 2GFFA 3ENAA 3N5FA 1JXEA 4U96A 3KLIA 1SV5A 1Y00A 3NOGA 3T5LA 2O66A 2RE1A 4QIFA 3UD5A 4NX9A 5A6PA 3OD2A 3TVYA 2V8PA 4OYXA 2B6AA 3MD1A 2QLJB 5H9FJ 3KJVB 5AJ3J 1K9MT 1HNVB 2ZDOA 4TVAB 3SCIE 3RG6A 3JQJA 4TU9A 1T05A 1KHVA 2EKNA 1XMOJ 2WRMA 2YWWA 4C4WA 3CJRA 5HJYA 3J81Y 2DPIA 2V2VA 5D0GA 4GVBB 4ZVFA 4ZVQB 3CT9A 2HFNA 4PWUA 4ZITA 4UF4A 5IQQA 4K59A 4GKKJ 1IBLJ 1S9EA 1C0TB 3ULHA 1BXNA 1WEYA 1U8WA 3UR3C 1FJ7A 3M8QB 5KT5A 2UUAJ 2MKSA 1ITPA 4O4RA 5ETVA 2NR0A 3TW0A 4CH1A 5B09A 3LALA 5LJ5Y 4KBIA 3JSMB 1H72C 4BC9A 3TI0A 3LP1B 3QJJA 2RMLA 2AIRB 7FD1A 2QL7B 1NSQA 1HL6A 3DGPA 2IBKA 1UFWA 4MKBA 1EETA 1VQ9S 3UDVA 3DHXA 2AWZA 3GB0A 4RJVA 2IRUA 4JOUA 3AH6A 3GFXA 2HHQA 2WW4A 2KRRA 1EKRA 1H3DA 2FLPA 1UZDA 1SKWA 4IOAQ 3Q0AA 4ANCA 3HFKA 4YR2A 1HNWJ 2KJWA 3IS9B 4M94A 3FFIA 4DXLA 3DLGA 2APOA 3OW2R 5J2MB 2VPYB 3HZGA 2LLZA 3JTPA 2DGWA 1YWXA 1UJ4A 5CYJA 3OTBA 2VC0A 1FXLA 2FQQB 2V2ZA 1RTHA 1TAUA 2C2ZB 2L3MA 3OUYB 4ZP6A 1N6QB 5D77A 1RAGB 4YMEA 2AV5A 2E7VA 2FJXA 3SV4A 4FF2A 1B0TA 1DZ5A 2HQCA 4LIWA 3JQKA 4QR2A 3QZ7A 3CW2C 5I42B 4DSJA 3L7OA 5F9LA 5JXSA 2NYHA 1C0UB 2HNZA 3FZBA 1PYOB 4C8LA 2YKPA 4UUWA 1Q8LA 2HSEB 1YTYA 2SXLA 5AXKA 2LDIA 4S0MA 4NLTA 1XR5A 4M5MA 1IKWB 1FERA 4KHPF 2DCLA 3HO1A 2RNEA 5KFGA 4B3MJ 4X64J 3D1HA 1AUDA 3EPIA 2W4DA 9RUBA 1IN0A 1GMWA 4I2PA 3G71S 1CQNA 3OL7A 2HNYB 4Y65A 3SSRA 3H25A 3D6TB 3OR1A 2XWYA 3KDOA 3MUMP 2YNHB 1DFDA 1RWXB 3DLBA 3CCWA 1MG7A 2E1AA 1U6ZA 4QWDA 3OJSA 3OVSA 4I6AA 4RUHA 2K7JA 4QBUA 1JLBB 4GO7X 3TVZA 2J0SD 4NE9C 4ZN3A 2C2KB 2JEGA 1LV5A 3F44A 4PUOB 4ECSA 1UVMA 3DOKB 4WFAQ 3HSZA 2DNRA 1WHWA 3DMJB 3FBEA 3CJ4A 2YPZA 1RT7B 1X8DA 1XMQJ 3NGKA 3C6TB 2ZH5A 3CDBA 1WUUA 4FKYA 3QIPB 4C8OA 1GMVA 4IQXA 1EJ7L 3D6HB 4C3KA 1Q79A 1MWQA 4UOHA 1VC5A 4R8UB 2OTLS 1J5OA 3CTRA 4ZCKA 4TN2A 3CPWR 2XMAA 1N48A 4G1PA 1I94J 3MM5B 4Q7AA 3IA0A 2JH3A 2IAJA 1F6TA 4NZ6A 4HEA9 4ITSA 1O5JA 4C8KA 1EIYB 2C42A 2XMKA 2RHSB 4OX6A 3KLGA 5E33A 3W2VA 3NG8A 4LF4J 3FEXB 3DLJA 3EZOA 2CRLA 2VBZA 3N9UC 2FC9A 1VQ5S 1UFLA 1C4AA 5L9XA 3W66A 2W25A 3AFGA 3UCGA 1HYSA 4RW9B 2MQMA 3P96A 1WTFA 4ZHRA 3KHGA 4WFYA 3J7AN 4ZVOB 3TAMA 5ETRA 2D3UA 1IBKF 4ANDA 4NRTA 3NBPB 2QLFB 3F41A 1HQEB 4R5PA 3CIZA 4M5NA 4RNMA 6FDRA 2V2KA 2R2SA 4DL3A 2VH7A 4G65A 3SDEA 4CIOA 4H4KA 2KT3A 4BWMA 2MJUA 3OT9A 4ECTA 2W4PA 2M52A 2OFHX 3CCMS 2KL8A 4DF4A 5KAKA 1S79A 1HW8A 3H2VE 2IVMA 3W5ZA 2GQQA 3RAQA 3KK2B 1KONA 2LQJA 2VQEJ 4IH6A 3S7RA 4GVLA 2HAIA 5KOWA 2P9GA 1XBWA 3J7YU 4MKAA 1VRUA 3QWUA 1WELA 1SC6A 1F5BA 4UY85 4OYZA 5HN0A 3MOZA 3E51A 5E3QA 4A46A 2CAJA 1R6VA 2IRYA 2P6SA 2R2TA 1RWWB 4CT9A 3N6LA 1JLAA 5KFLA 2VV5A 2GIQA 4WFZA 4NOHA 4QIGA 3TUJC 1R27B 3ELHA 4IFVB 2B4VA 3FRZA 4DV5F 1VBKA 2H48B 1YKWA 2F4FA 2YH1A 3C15B 2HMIB 1LW2A 4BCAA 1CJUA 4K0KF 4I69A 5D0RA 4P9SA 1TUWA 2HS0A 2OKQA 3GR1A 4G1IA 4OI6A 1QAIA 3HSDA 3VZIA 2D3OR 1NSKL 2L41A 3W8GA 3Q8UA 1M1GA 5KFFA 1GFWB 1WORA 2C2RA 4DQSA 4A47A 1HHTP 4FPRA 1IUJA 2HGNA 4Q0BA 1U4BA 2ZBCA 2G0JA 2E7WA 4DJBA 2CFXA 2QYCA 3HHLC 4BHQA 2W8KA 1RWMB 3FGVA 4MK7A 3GYXB 2DNPA 4QIWD 3MDFA 5KFUA 1OYEA 4I67A 3UD4P 4CTAA 2DJWA 4V19X 1RXOB 2RH3A 4RR5A 3IMQJ 2V8DA 1LXJA 1X9WA 1VFJA 3LA0A 1WC3A 3GSIA 1ZAWA 4YB6A 3TA1A 3M4XA 4C0HA 2IFXA 1S1XB 2G2ZA 4ZPVR 1V9OA 2Q43A 3EYZA 2VPXB 3ZZRA 4AD6A 1RLDA 2VHGA 1IBMF 4GVBA 1TKZB 2H1YA 4ZPBA 4XAKA 2WVEA 3HX9A 2LEBA 2GVDA 3ETOA 4X66F 4OLOA 1C0TA 2J0QD 4JBCA 4DV3J 2LA6A 3M8QA 3NGUA 4B3TF 1R89A 4CP5A 1JMTA 2BUNA 1KHWA 1SQEA 2CIMA 1G3OA 2DNZA 2BX6A 4B3RF 2OSQA 1R8BA 2AKWB 2I6WA 1FJEB 4DV4J 4GKJJ 3LP1A 4K4WA 2E5GA 4USUA 3DOLB 3U27A 3KG0A 2VKRA 4ED1A 3SMZA 4M5LA 3W2WA 4EWTA 3G8SA 2KHDA 3KYLA 2HBQB 3C19A 2PFDA 3G6ES 1WOOA 3W9HA 1WEZA 3ENVA 3SZ2A 3DRYA 2WCXA 4AL5A 2GHPA 2GS8A 4CM2A 2PGCA 1F9HA 2GJ2A 3WIVA 3GPAA 4MMOA 4Y6IA 2DXFA 1Y7PA 2DEIA 4TU8A 1OSCA 3FMBA 5J1EA 1FX4A 4KT0C 3J7Z5 1XWLA 5K14B 2W2OP 2ZH6A 1QVFR 2R7QA 2UU9F 4IFYB 1TKXA 5AXMA 1OY8A 4K50A 4DPYA 4GMKA 3OVAA 2XG8A 3BZQA 4FS1A 2VBYA 1RTJA 5F8JA 4QPTA 1KQGB 2DNNA 2KDOA 3ZZUA 2Z2MA 4C8NA 3IWLA 2QRRA 3K5MA 2OFGX 3N4WA 2EI5A 2GA7A 2H5EA 5K8OA 3WC0A 1L3TA 3R7BB 4OHYA 1LW0B 4ZLPA 2YKOA 4RWXA 3EM1A 1KN6A 1TVRA 1BMQB 4PKDB 1C0UA 1SKSA 2LECA 4URSA 3UNGC 4Y28C 2OEJA 4OV6A 2IA6A 4HACB 1GXLA 1IKWA 2W7PA 3AY0A 2RT3A 3KDNA 2OD6A 4ED5A 1L3KA 3I0RB 1Q81T 1REGX 2LVWA 1S0OA 2ZKTA 3JSRA 2BEFA 3CMQA 1NDPA 3LOUA 1N5YB 1D8YA 2XS7A 2FY8A 3FJ2A 4LF2A 4OZNA 2MQ8A 2F8MA 2MB0B 3CJSA 3M05A 1SIWB 4KGKA 4DS4A 2YNHA 2QFIA 1HKAA 2B7BB 2EC0A 1NJXA 3M1VB 4G1QA 4XO0A 2G13A 4ER8A 4FXDA 5E0OA 3R7SB 4MK8A 1X5SA 4KFBB 4LF8J 5IT9U 5C42A 1P9QC 2F65A 5DM6Q 2IPOB 2JSXA 2W2QP 1GNKA 1SKRA 5L39A 3EXCX 2D3O1 1N36F 2PEBA 3QMQA 2CKWA 1CEZA 3I96A 1RT3B 2HKEA 1I1GA 3QIPA 1HNIA 4F7VA 3HHNB 4HR2A 2HHHJ 4QU6A 1FNXH 4R8UA 2ZZTA 1W7WA 4EMDA 2C2DA 3WIUA 4X2BA 1TU0B 1HQUA 2CJYB 3SXLA 3QNWB 2F4VJ 2QIFA 3Q22A 2HWTA 1HD0A 5EHHA 4NZ0A 2OPRA 4IH7A 4FF3A 3UFCX 2JLEA 5DG8A 5KFOA 3EICA 1E6YA 2A2DA 1HWLA 3MM5A 4Y2IA 1RTZA 2BQRA 4K4VA 5KFXA 1I6JA 2VJUA 1NNDA 2UP1A 2GMJA 2HVDA 4Q8EA 2Q1LA 2P8IA 2FC8A 1ZPVA 4R0JA 1JJCB 2A10A 5HANA 3IM9A 4M5DB 3IC1A 3LO3A 1V6HA 3EVOA 1RCOB 4FBTA 3R7NB 1TMJA 1RT2B 4FP9A 4NLDA 3HVTB 3HK2A 1AFIA 3NBPA 2W2MP 4ZS6A 1PYTA 5EGYA 2KG1A 5DGAA 2RU9A 3B4DA 2ZJRQ 4ZVPB 1IM4A 2HZCA 2ZVSA 1RBOB 4FN5A 1VBZA 3N5BA 5HLFB 1YJWS 4HTJA 2K06A 1P9YA 2FVSA 1JNZB 2PI5A 2DKOB 5DDRC 2HBRB 2I5JB 3KK2A 2RF2B 1S57A 4WF9Q 3CJ2A 2CPEA 3J80Y 1FNMA 3R5CA 1ZZFA 4IG3B 2DR9A 1HIYA 2DNQA 2HWHA 3M6VA 3T9NA 2ZHBA 4O4GA 4KTQA 4KY3A 4F04B 1P27B 4EYIB 3QJLA 2LCWA 3KXDA 2WONB 4ZVRB 2DR6A 4DQPA 3V4IA 4DLEA 4WTYA 4C3MA 4C7QA 4DCPB 1JLQB 2CNNB 1PIEA 1FRKA 1FDBA 3ISNC 3QGHA 2ADBA 2MY8A 5DG7A 1LWCB 1HBOB 3BYPA 2HMIA 3RR8A 1UETA 3UVJB 5U47A 2PI4A 2MZQA 2Z2LA 4LF6F 4OQJA 4CT8A 4N76A 2GMLA 4DV0F 1T95A 3K17A 2OEMA 1FTCA 3E8OA 1CJVB 3R5JB 1Y4ZB 3U1NA 3GCWP 1WF0A 4HH1A 1XIQA 2IIHA 2PSZA 1GQEA 2NXNA 4ZDNA 3BDEA 2A3JA 4DUZF 1R0AB 4F67A 3R2CJ 2JOQA 1KLMB 3G9CA 4UQTA 2KZZA 3MM7B 1NPKA 2RD5C 2AYEA 2NXEA 2ILZA 3B6BA 1UMJA 1WD6A 2C3PA 1U1MA 2R7RA 1QSYA 1AA1B 1UZHA 4A4JA 2HK3A 4IOBA 1YJNS 1U0SA 3OLBA 2R3VA 2G0IA 1SKUB 3C6UA 4J9VA 2KXNB 3LP2B 3HSGA 4WP9A 2X1BA 2L08A 4M63A 3IAS9 3ZTSA 1DQ9A 5IT0A 3VQTA 2FVRA 5KG2A 2UUBJ 3C46A 1N34F 5C24B 2YX4A 2ZITA 2AJ1A 1JK9B 1PBUA 2F8HA 4RUBA 1JKHB 2X51A 4JI0F 1B7FA 8RUCA 2F8EX 1GMWD 2KO1A 4DL2A 2FJBB 2IY5B 4U8VA 4JI2F 3QO9B 3M30A 2VBWA 2N7YA 4J7CA 4PZVA 4IO1A 5KFKA 1GX5A 3ILOA 5KFWA 2LEPA 2CQDA 4LR9A 5DG9A 5DDPC 3QT5A 2R42A 3Q8YA 3PYFA 3A8JA 1NK5A 1OWXA 4CNZA 4Y3CA 2EXUA 1B99A 4B9MA 1C4CA 3OR2B 1VBYA 1S9FA 1WC1A 4MH8A 1Q4RA 4XDDA 4OFZA 4P7TA 3NS5A 4LFAJ 1UPMB 1PG5B 1WF2A 3QZ8A 3H90A 3ZZZA 4BC7A 5KFZA 1QUVA 1FRLA 3KLVA 3KK3A 1I3OB 3OSNA 1S59A 3BKUA 2ASDA 1VJQA 3V6JA 5K14A 4IFYA 1RT5A 5KFIA 4FF1A 1SI9A 2WAQD 4NCGA 5LOQA 2R7WA 4DR7J 5HK4A 2ZHOA 5GAHU 2YPYA 2R7XA 2B8QA 2EKYA 4EFAC 2DGOA 5GAGU 4HHHA 3H59A 4N5SA 1S0MA 1I5OB 2E1RA 2GAGC 4DF8A 3MAAA 2XMJA 4DPXA 3AXMA 5F8HA 4LUBA 3SV3A 4HYKA 3K59A 2H9ZA 2NXCA 1M5KC 1DY3A 1CULB 1DHMA 3MOJB 2XHCA 4NYZA 1YVFA 5AJ3F 3FZ2A 1KVKA 2MGZB 3PX6A 4ZMMA 1WC4A 3OXGA 5J1NA 4HACA 2JEJA 4USTA 4J91A 1IKYA 2R7UA 3I0RA 4RW7A 3OTOF 5B0GA 3GCXP 4OZJA 3K2YA 2AT1B 3H8YA 5D0EA 2AW0A 5HL7Q 5E41A 2OELA 4A8MP 2Q3PA 4C0OC 1F2HA 4X4TA 3I9ZA 5H9FK 2CQ1A 2YNGB 4K5RA 5DM7Q 2DHSA 1IBLF 3ADAC 1H73A 4OJGA 4K7QA 2UUAF 2MKJA 4NASA 1KFDA 2NPFA 4NLRA 2KG0A 3I9V9 1N88A 2VBXA 2XMVA 3HF5A 4JI7J 1IKXA 2I1RA 5IOLA 1BD6A 3M1VA 2HVEA 5L9NA 2HRUA 3CEDA 2YNFB 5KFPA 1JWWA 1XNRF 1NDKA 2E1MC 1N33F 1RTIB 2FUG9 4DV1J 2KT2A 4NLQA 3IO1A 1VQSA 2ZUGA 1TL1A 4RWWA 1Z2ZA 2VA2A 2ZH9A 3LANA 1VK3A 2W01A 3KK1A 3ZZTA 4F3MA 1LK7A 2MHEA 5EX0A 3P5BP 2O01C 3TRGA 2Z30B 4X62F 3MEEB 2JLGA 3JSYA 4CYUB 3CCJS 2B0GA 2B51A 3IG1B 4BWJA 5C7PA 1ZBTA 2EVZA 4WKRA 2V9WA 2G2OA 1X4HA 1D09B 2XNRA 3OFGA 1T11A 4MAKA 2P9EA 4X4SA 2GW8A 4BS2A 4YDDB 3VZHA 1A0OB 2DXEA 4I2QA 3GU0A 1SH0A 3GFHA 3KUGA 1R31A 1FK9B 1H98A 1G6BA 4J9MA 1T03B 4DQQA 2J8SA 2KYZA 3FMWA 2BJ8A 4M5DA 3GJQB 4QR1A 1RKJA 5J2QA 3UDLA 1OY6A 3EXYA 2MZTA 5C25A 2LXIA 2R8IA 3JTOA 2BQ3A 3DLKB 4K4SA 4YR0A 1RT2A 4LF7J 2DRAA 2QGFB 3W9IA 1D1UA 2Z0GA 5L38A 3BO3A 3HVTA 5SZTA 2Y1LB 2XC9A 4E0DA 2RKIA 4USJC 1SJ3P 8ATCB 3GIMA 3AOBA 2KU7A 2RQ4A 3FDSA 2G9OA 5F8IA 1X31C 2DY1A 2N7CA 4C11B 1D0EA 1MMNA 1JLEA 4F2RA 4X64F 5D4PA 2AJ2A 2DRDA 4MK9A 1IM6A 1S49A 2AJQA 2FGOA 3FEZA 4ZVEA 3ILIA 3FKBA 4M5JA 2UUCF 4IRKA 2Q66A 1UPPA 3L7PA 1WHYA 3SYZA 4ANEA 1H74A 1PC5A 4RNNA 3T41A 3KMQA 1GMUA 3T3FA 1RWNB 2CPHA 4PG4A 2ZKUA 1VIXA 2LQ9A 1JLQA 2E5JA 4Q43A 1S7HA 2VFUA 2HG4A 3PR4A 2XLJA 4NEZA 2V63A 3PRVA 1H7WA 1LOUA 3DLHA 3D5MA 2JVRA 4Y2KA 3BGLA 1ZAVA 3W8PA 2BA9A 3LPEA 5DZ7A 3S01A 3LGNA 1XK8A 5ETQA 4LBHA 2BANA 5F8MA 3DRXA 3MM6B 1OQ3A 4I4BA 2DHHA 3ET6B 3ISZA 2ZH8A 2Q6BA 4DQIA 1JLFB 5DJBA 2N3LA 2BE2B 2MJNA 4UOGA 4A8FA 2O3DA 3G96A 2MDAA 3QBCA 1KSPA 3PW5A 3C14B 4DN9A 3C16B 1I94F 3KHLA 2GQ2A 1KLMA 1KTVA 1T9YA 3MM7A 2FJVA 4NXMJ 1SC3B 1EARA 2MTLA 3WDOA 4DL4A 1S77D 1WG1A 4NI2B 3TJ9A 3ZXWA 1HWUA 1RU1A 4B02A 1FRJA 5IT4A 3E01B 1REVB 4OJ3A 2B4PA 3FCHA 4LF9F 4B9UA 3DHWC 2VODA 3BSAA 4AE5A 1YRTA 1NXIA 4WK1A 3LGHA 2AYGA 4KGZB 3QIDA 4KH0B 1VHIA 4FVCA 1K1QA 5CZXA 1G7CB 3TX8A 4CH7A 1X4FA 1NB7A 3CCRS 3LP2A 4U9RA 1RT1B 1KWMA 1XERA 1E6VB 3MTKA 1VRTA 1FJGJ 2GIRA 1IR0A 4ID8A 2V0NA 2KFNA 4C98A 2BXJA 5LMUF 5KFTA 2OPSB 1NB2A 4CO1A 4URGA 4ELTA 3T1YJ 1KFSA 1UWBB 2OLWA 3EDQB 3POTA 4P73A 2E29A 5CABA 1NSPA 4I64A 2VQEF 2CZ9A 4F8RA 1JKHA 3J7ZT 2C3OA 3BQ2A 2NLWA 3LAMA 4ZA1A 4ZVSB 4ILRA 3EZ5A 3HVWA 5CHCB 4ZLJA 2CVIA 2EFVA 1TL4A 2LP4A 2QL5B 1RYRA 3QO9A 2W9CA 2DGTA 3G86A 2XZWA 3QT6A 5G0RA 1PJ6A 2HPUA 2CQ2A 3U1MA 3Q8PB 5A0YB 2OJ3A 3QPIA 3W7BA 4M1KA 4RKUC 5KG1A 3D67A 2OSRA 1YK9A 3NGTA 5HQLA 3V81B 4P10A 3HLUA 3EX7B 1Y5LB 4OLPA 2B56A 1RAEB 4RW6B 1S1UA 3OR2A 2C3UA 1NJYA 2W2NP 3IR5B 5IQ6A 4JV2A 2NXJA 5KG4A 2W8LA 1TQLA 3RU0A 1RLCL 3ZC4A 5HSPA 3HT0A 1HBMB 1RSCA 3CB4A 4QWAA 3IAM9 3BPSP 2AEFA 2DHXA 1RT4B 3M2RB 4I68A 1KNZA 1Q7LB 5LXYA 3H40A 1Q1KA 4EEYA 4CO2A 1BY9A 3VTIA 1YSJA 4JYAF 2V69A 1VQOS 2XSJB 2C2MB 2XMTA 4OJ1A 5ETNA 3Q8VA 3UPFA 4W90B 2Q79A 3NP5A 3T6JA 1O6XA 4PWWA 4YB5A 2RJZA 1FFWB 1HLWA 4CM0A 3VCDA 4B3SF 3D7SB 5L1KA 3PR5B 2M5YA 4ID5B 3QSIA 4NLWA 2AX1A 4HVZA 5HQMA 1V5IB 2UXDJ 1NSAA 2KZMA 4PG5A 1CULA 3GE9A 2VB6A 3DYAA 2J9CA 3OTDA 4EBCA 1TV6B 2VKZG 3OFHA 3HVRA 4X65J 5CZVA 5IXUA 1L3SA 2ZH1A 1X0PA 3L9ZA 3MMCB 3CCVS 5KFAA 3TJ8A 3ZNUA 4ZKAA 2Q6CA 3EE3A 2OO4A 4FNHA 4JI3J 2NREA 1P8GA 5B0FA 3E2EA 2XLKA 4IR9A 3VHQA 1NPRA 5DETA 3MAHA 3A1YG 2XMUA 3BDPA 2YX1A 3HI9A 3MFIA 4IH5A 2ZJQQ 3OQ2A 3P4UB 3H2LA 1I51B 4DV3F 4UQGA 1F3VA 4QYZK 4B3OB 1T0TV 4IQMA 5CYMA 3FK4A 2MSSA 1VC6A 3ONQA 5K8NA 1MU2A 2MLXA 3SCKE 3UWTA 1QSSA 2YNFA 4C0BA 5IZHA 1G4CA 1RTIA 1YZ7A 2LQBA 2NXUA 2FHMA 1JB0C 4XPEA 1KOOA 4DV4F 5HJXA 4YHHJ 1UL3A 2LA4A 2UXBJ 1DJ0A 1X9MA 1TK5A 4JI8F 1HA1A 3M2UB 5F8NA 1DTQB 4H4OA 3IM8A 5LSRA 4CYUA 1KR4A 1X7VA 3IG1A 3LUYA 5FDLB 5D6GA 2CNLB 2OD4A 4DU7A 4LFBJ 2HW3A 1JLGA 4DL5A 1JJ2R 3C3LA 2HFVA 1SJ4P 3R8YA 2H54B 5B08A 1UWAA 3EVWA 2LQ8A 3OFEA 2KXHA 4D3HA 2E9RX 4ZPAA 5KFYA 2K1RB 3QQCD 1T03A 1ZA1B 5H1SV 2BJDA 5ETPA 5EWGA 1GEHA 2PT0A 5GADI 2P9CA 2PMZD 3R27A 5GVQA 4CQ1A 1OY9A 3CDUA 3DRSB 4LSNA 2AMCB 4CLSA 4DV7J 2KM8B 3DM2A 1LWXA 4RPFA 3TP2A 1EQMA 2B9XA 2Y1IA 3QRPA 3B4MA 3MUVP 5T7LB 4Y0FA 1BWEA 2R2RA 3I0SB 3KHRA 2ASJA 4WZQA 5HP1B 3JXOA 3M6WA 1GH8A 2AD9A 3AJ2A 3KUEA 1RI7A 3LGMA 4LFCF 4LSZB 5HBMB 4TLRA 3US5A 4OL8A 2YWFA 2OPQA 3E3XA 4NWBA 3SCJE 2DNMA 5MAOA 5A8RB 4NLVA 3Q89A 1FKPB 5DDOC 4KGMA 1JIHA 2FZCB 4O3PA 4LJMA 4USIA 1YRUA 1ELOA 2OPPB 2VJVA 1KVJA 3F0NA 4L6V3 4QPXA 4PR6A 4L3NA 3G6XA 3QJPA 3R2DJ 3BV8A 1N54B 1SJRA 5K8MA 3RW6A 1VQNS 4DL7A 1N56A 3IRXB 3CCQS 1HBUA 3LP0A 1CJTB 1HWJA 2Z2YB 1Q8IA 3VQSA 2HFSA 1Q0NA 1R8AA 2CA9A 4LF8F 2QMUB 3NNHA 3PX0A 2VZ9A 1FJCA 2IJNA 4Y2CA 4Q8FA 3MR6A 3MM6A 3L4BC 2HQIA 2VDHA 5IC6B 5ETOA 4PAAA 2KHCA 5HMWA 2J9EA 2EPIA 3G6YA 1RBLA 3T5JA 1FVQA 2BE2A 2YKMB 2F4VF 3TEHB 2L9WA 2HS4A 4W98A 3N6MA 1O8BA 3NOCA 1MMDA 1TUGB 3DXBA 2W9AA 2QLWA 3DLLQ 3I82A 3EUNA 5HMXA 4LR7A 2LQ5A 3CJQA 4PXDA 4YB1P 3NCPA 3M2VB 1FD2A 4LSLB 5D78A 3PYEA 4ES2A 2HHUA 4NI2A 3SEOA 3RBEA 3C66A 5DS7A 1K1SA 2IMWP 3E01A 4CH0S 1REVA 2MLYA 1S1VB 3VAGA 4K5SA 1K8AT 3THPA 2RAQA 4ETXA 1X4CA 5LMNJ 3CCUS 4K4ZA 1EQ0A 3V6DB 3AB2B 2AJFE 4LQ3A 4RL1A 3ZZOA 4AT1B 3MEGB 4BLGA 1YGYA 1U26A 1FWPA 3AD9C 1VMBA 4PABA 1E6VA 4I1TA 1T8EA 3NWGA 4OHVA 2DGQA 3BQ0A 2BMBA 2CPYA 1N5QA 2BR0A 9ATCB 4KE5A 1IBCB 3WZ0A 1RACB 4QQBA 1GX6A 3K5NA 3IFEA 3D0IE 1J27A 3ISND 3CD0A 1S97A 2CZVC 4HDGA 2MSTA 4QWBA 2XQCA 4QZVB 2OH2A 2MMYA 4MT1A 1UVNA 1VHFA 3MAQA 4LRBA 2HHVA 2QZ8A 5CCLA 2XB2D 1B4SA
chains in the Genus database with same CATH topology
1WKJA 1WKLA 1LWXA 3EICA 1NDPA 4UOFA 2ZUAA 1S57A 3VVTA 1XIQA 4C6AA 3NGUA 1NUEA 4CP5A 3BBCA 4O0NA 3L7UA 5C7PA 3FC9A 1MN7A 1NSQA 2AZ1A 3FBCA 1BUXA 3EMTA 1PKUA 1EHWA 3B54A 4F36A 1HIYA 2CWKA 3EVMA 2BX6A 1S59A 3BBFA 3FBBA 1NCLA 2HVDA 4WBFA 3BBBA 3JS9A 1K44A 3NGSA 4DUTA 1NB2A 4UOGA 1NPKA 3ELHA 3FBEA 2AZ3A 3ETMA 2DXDA 4F4AA 3EVOA 1KDNA 4ANDA 1BE4A 3EE3A 2HURA 5BXIA 4ENOA 1LEOA 4FKYA 1XQIA 2DXEA 1NDLA 3B6BA 5CABA 2B8QA 1NSPA 1S5ZA 3MPDA 2B8PA 1MN9A 3FKBA 3VGUA 4S0MA 3VGTA 1BHNA 2DYAA 3Q86A 3ZTRA 2VU5A 4UOHA 3EM1A 3VGSA 3WX8A 3GP9A 4FKXA 5IOLA 3Q89A 4ANCA 3R9LA 2HVEA 1NHKL 3EJMA 3G2XA 4W98A 3BH7B 3DDIA 3EVWA 3Q8VA 1NDKA 4KPCA 3VGVA 3Q8YA 4ANEA 4DZ6A 1F3FA 1JXVA 1NSKL 3DKDA 1U8WA 1PAEX 1NLKL 3BH6B 3NGRA 3Q8UA 2DY9A 4HR2A 1WKKA 1B99A 1HLWA 3PJ9A 1W7WA 1HHQA 3GPAA 3ZTQA 3FCWA 4EK2A 2DXFA 3FBFA 4DI6A 3FCVA 1NDCA 5CAAA 3PRVA 1UCNA 3ENAA 1ZS6A 1F6TA 1VYAA 3ZTSA 3VVUA 2NCKL 2BEFA 3NGTA 3Q83A 3ZTOA 1B4SA 3ZTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKJ A;  1WKL A;  1LWX A;  3EIC A;  1NDP A;  4UOF A;  2ZUA A;  1S57 A;  3VVT A;  1XIQ A;  4C6A A;  3NGU A;  1NUE A;  4CP5 A;  3BBC A;  4O0N A;  3L7U A;  5C7P A;  3FC9 A;  1MN7 A;  1NSQ A;  2AZ1 A;  3FBC A;  1BUX A;  3EMT A;  1PKU A;  1EHW A;  3B54 A;  4F36 A;  1HIY A;  2CWK A;  3EVM A;  2BX6 A;  1S59 A;  3BBF A;  3FBB A;  1NCL A;  2HVD A;  4WBF A;  3BBB A;  3JS9 A;  1K44 A;  3NGS A;  4DUT A;  1NB2 A;  4UOG A;  1NPK A;  3ELH A;  3FBE A;  2AZ3 A;  3ETM A;  2DXD A;  4F4A A;  3EVO A;  1KDN A;  4AND A;  1BE4 A;  3EE3 A;  2HUR A;  5BXI A;  4ENO A;  1LEO A;  4FKY A;  1XQI A;  2DXE A;  1NDL A;  3B6B A;  5CAB A;  2B8Q A;  1NSP A;  1S5Z A;  3MPD A;  2B8P A;  1MN9 A;  3FKB A;  3VGU A;  4S0M A;  3VGT A;  1BHN A;  2DYA A;  3Q86 A;  3ZTR A;  2VU5 A;  4UOH A;  3EM1 A;  3VGS A;  3WX8 A;  3GP9 A;  4FKX A;  5IOL A;  3Q89 A;  4ANC A;  3R9L A;  2HVE A;  1NHK L;  3EJM A;  3G2X A;  4W98 A;  3BH7 B;  3DDI A;  3EVW A;  3Q8V A;  1NDK A;  4KPC A;  3VGV A;  3Q8Y A;  4ANE A;  4DZ6 A;  1F3F A;  1JXV A;  1NSK L;  3DKD A;  1U8W A;  1PAE X;  1NLK L;  3BH6 B;  3NGR A;  3Q8U A;  2DY9 A;  4HR2 A;  1WKK A;  1B99 A;  1HLW A;  3PJ9 A;  1W7W A;  1HHQ A;  3GPA A;  3ZTQ A;  3FCW A;  4EK2 A;  2DXF A;  3FBF A;  4DI6 A;  3FCV A;  1NDC A;  5CAA A;  3PRV A;  1UCN A;  3ENA A;  1ZS6 A;  1F6T A;  1VYA A;  3ZTS A;  3VVU A;  2NCK L;  2BEF A;  3NGT A;  3Q83 A;  3ZTO A;  1B4S A;  3ZTP A; 
#chains in the Genus database with same CATH topology
 4N41 A;  3OL9 A;  1KVI A;  1B3T A;  2O1P A;  2CPX A;  3OXF A;  2DH9 A;  5A0Y A;  1SJF A;  1AUS L;  3MM9 A;  1ZAX A;  4WE1 B;  1UEV A;  4E8U A;  1YIT S;  1S48 A;  2MYF A;  3W1Y C;  5T41 A;  3V81 A;  1L3V A;  1PJ7 A;  3L3C A;  4RW6 A;  1HNX J;  4PQU A;  2WOM B;  1TL3 A;  1RT6 B;  2E9Z A;  3D1Q A;  3OLA A;  5J2N A;  2LYV A;  5AE2 A;  1M1K T;  3CUN A;  2FTR A;  1YDL A;  4C8Y A;  1OSD A;  5HRO B;  4B9L A;  3VR1 A;  1HBM A;  2MQQ A;  2B5J A;  3M2R A;  1C1B A;  3RW7 A;  2QMW A;  1ROF A;  2GO9 A;  2RUG A;  2B4O A;  4YY3 F;  4O0I A;  1M5P C;  4CO4 A;  4DL6 A;  3ZTQ A;  4PXC A;  1ZA2 B;  1T94 A;  5THW A;  3UW1 A;  1ZS6 A;  5K9F A;  2MKI A;  1VYA A;  4DR2 J;  2CQC A;  3CJ5 A;  1APS A;  4CDI A;  4JI1 F;  4FYY B;  3HDS A;  3PW2 A;  4NA1 A;  2H4Y B;  3EGV A;  4A8W A;  2E5H A;  4ED8 A;  2X1F A;  3K57 A;  1PGZ A;  3CDW A;  1VQ8 S;  1M5H A;  3K5O A;  1D9A A;  3TUI C;  4ID5 A;  3I5B A;  3MPU B;  4P75 A;  2QMX A;  4O3Q A;  5A2Q U;  2HGM A;  1TAQ A;  1TV6 A;  4Q44 A;  3THV A;  4MYU A;  2RU3 A;  3VGU A;  3ITH A;  1FWK A;  4Y00 A;  2UZA A;  3MMC A;  4GC6 A;  1OO0 B;  4X4N A;  1U1N A;  1HQ2 A;  1A6L A;  3BO2 A;  1RWV B;  2RIJ A;  1U2R A;  2YBV A;  2HAF A;  1XR7 A;  3FRY A;  4FNI A;  4F0H A;  1SCJ B;  2WTF A;  3M32 B;  2J0X A;  4U7U K;  5H9E K;  1YJU A;  5E2Q A;  2DIU A;  3BQ1 A;  5E5N A;  2WVD A;  3PW7 A;  4DV5 J;  5KFJ A;  2EG2 A;  4RBT A;  1RHR B;  3T5K A;  4K0K J;  4MFB B;  1MLA A;  2GX8 A;  5KG3 A;  2AF6 A;  3LAK A;  2ALY B;  5GAE I;  4KGX B;  4RW4 A;  4DUT A;  4DR4 F;  2FLO A;  1WDT A;  4IDK A;  1VQ7 S;  2H5I B;  2YKQ A;  3IWN C;  3T1A A;  2GGP A;  4QOT A;  1NK6 A;  3QWP A;  1ZTW A;  4FKX A;  2LFV A;  2LEA A;  3FSY A;  3SQG B;  2NUU G;  1NHK L;  2UVV A;  3UE2 A;  1BLU A;  2G0C A;  3P45 B;  5FDL A;  1DLO B;  1NH8 A;  5IT9 Y;  1PCA A;  1H0H B;  4DL0 C;  2XZD B;  2RHQ B;  2E5I A;  4EUV A;  3GJS B;  1B70 B;  3O3L A;  1S6Q B;  4OI1 A;  3TO8 A;  4OYW A;  4ZPC A;  2NYI A;  4DI6 A;  1NDC A;  3FQK A;  2Y0S D;  5AT1 B;  4DR3 F;  3QFH A;  2CPZ A;  1GTH A;  1UEU A;  4DR7 F;  1F9F A;  2Z58 B;  3MMA B;  2QA4 S;  3KNA A;  4F4X A;  2V8H A;  4Z7Y A;  2M2B A;  4KIA A;  5J2P B;  1FA0 A;  2F3J A;  3V6K A;  2HQD A;  4CLZ A;  3HD1 A;  1BQN B;  1AT1 B;  1X5O A;  1IBM J;  3HCX A;  3PRD A;  1Q16 B;  4DLG A;  3ETM A;  4CLT A;  1NK7 A;  2YKN B;  3HJF A;  3NL0 A;  2K3K A;  4ICL B;  3DRP B;  4TLQ A;  2DBB A;  2HND B;  1BHN A;  2LMI A;  4U8Y A;  1FT8 A;  3RB0 A;  2XY7 A;  4W4M A;  3SFG A;  3ZZ0 A;  4P2M A;  2QX0 A;  5HBM A;  2JNJ A;  1U6F A;  1VR6 A;  3W65 A;  4UW2 A;  4CLL A;  1O0P A;  5B7W A;  4B3R J;  1P1L A;  1KOH A;  5A8R A;  2FHO B;  2EFQ A;  1Q7Y T;  1FKP A;  1XJW B;  3FBF A;  2IYG A;  2VAS A;  2VDI A;  1IKV A;  3DC2 A;  4N7T A;  3CD7 A;  1RWK B;  3HHL B;  2QG9 B;  2GIF A;  2N3O A;  5FD1 A;  4Q45 A;  4WXW A;  5HI7 A;  1B7Y B;  5F3T A;  4NYP A;  2J9D A;  4PWD B;  3O2I A;  4URQ U;  2BE7 D;  3O44 A;  2ZNZ A;  1AB8 A;  2VG5 B;  2MY7 A;  4HT7 A;  2FIU A;  2EW9 A;  4AFF A;  1HMV B;  4ZIV A;  1CJT A;  5BYS A;  4KJI A;  4NRU A;  5AE3 A;  3H42 A;  2RB7 A;  4CCH A;  4DR6 F;  5IM0 B;  3K7R A;  4DV1 F;  2DPJ A;  2HS3 A;  4DG1 B;  4N56 A;  2G1H A;  1WI8 A;  3FVY A;  4ED3 A;  5ETT A;  3KLE A;  4JB8 B;  4LR8 A;  4OZ3 A;  3PIO Q;  2CUY A;  2A18 A;  3HP6 A;  4LRD A;  4PYA A;  1UFK A;  1ZH5 A;  2HK2 A;  1VGY A;  3V2U C;  2QJ3 A;  1OJ4 A;  1U49 A;  4NCA A;  3GFY A;  2KB2 A;  2AU0 A;  2PMW A;  4EK2 A;  2DCU B;  2BKO A;  1LKZ A;  2NUH A;  2IM2 A;  2R8J A;  4KAI A;  5KFR A;  4F26 A;  3KLI B;  1SV5 B;  3TA2 A;  1RKI A;  4USV A;  1C1C A;  5EDW A;  1FI4 A;  2ZM6 F;  4DX5 A;  1U45 A;  2XYG B;  2DNK A;  4DUY J;  1HNZ J;  3D1O A;  3GIK A;  4LSL A;  1N8R T;  1Q5Y A;  5EN1 A;  3OL6 A;  3N79 A;  2EFG A;  3FSX A;  4NPO A;  4DPU A;  2DO4 A;  1CVJ A;  4AXI A;  1T05 B;  2D9P A;  4F4Z A;  1SH2 A;  2F7V A;  2N82 B;  3NMA A;  5HMZ A;  3ICL A;  4NXN F;  1K0V A;  4O3O A;  4NLS A;  5ITH A;  1VJW A;  1F9E B;  2ZE2 B;  2DYA A;  3V6D A;  4J9P A;  1CC7 A;  3SIP B;  4HKQ A;  3DOM A;  2MQP A;  2XNQ A;  1NHU A;  1S9E B;  2JHE A;  4CNY A;  1UJ6 A;  2X1G A;  3DFE A;  1U1P A;  1TEL A;  5IWA F;  4QW8 A;  1RBA A;  1FWL A;  2PEH A;  3NRB A;  4DFK A;  5I4M A;  4M5I A;  4AL6 A;  5C2G A;  5IFM A;  3M9M B;  3AOA A;  3VVU A;  2ASY A;  3V4M A;  3A8E A;  1LWE A;  1H2T Z;  3K8V A;  1FKO A;  1RTD A;  3D54 A;  3RBD A;  3DGP B;  3W63 A;  3J7A 1;  2VPZ B;  1N36 J;  1EET B;  3CCZ A;  3BN4 A;  1S4F A;  1KKH A;  3D0G E;  3VWS A;  5JJB A;  4E98 A;  3UI3 A;  1R8H A;  2J7W A;  5CXT A;  1VQ4 S;  2GVZ B;  1SXL A;  2A6M A;  3QRQ A;  4QWC A;  3Q2S C;  3M6U A;  1S6O A;  4WE1 A;  4DFP A;  1X4E A;  3HPO A;  2O67 A;  1WJ9 A;  3VAI A;  1TZ0 A;  1SVD A;  2GO8 A;  3BB5 A;  2GHV C;  3G2X A;  1L3U A;  1CLF A;  2GC8 A;  1VRQ C;  2WOM A;  4ED2 A;  3LWM A;  4WFX A;  3DLG B;  3MHY A;  1KD1 T;  2F63 A;  2VOO A;  2XLI A;  2CPF A;  2MEW A;  2ZVI A;  5HRO A;  2O5D A;  5J1P A;  3G8T A;  4U95 A;  1NH7 A;  2V9K A;  5GMK a;  3RBZ A;  1RIS A;  2HFO A;  2QSW A;  4DSE A;  1FKA F;  3I31 A;  1URN A;  1RTH B;  4KO0 B;  2BW7 A;  2VOP A;  1X5T A;  2RVJ A;  1A9N B;  3PDN A;  1B0P A;  3AA9 A;  1KQS R;  2OTJ S;  5HAT A;  2E1P A;  4L75 A;  3M9N B;  3KJV A;  2UUT A;  1HNV A;  2GHW A;  1V3Z A;  4O3R A;  4K4T A;  3FBB A;  2UUW A;  2IJR A;  4DSI A;  2VA3 A;  3U7J A;  5CH7 B;  2D3Z A;  4M8L A;  4NXM F;  1WI6 A;  3BR9 A;  2CXE A;  5BJR A;  2HNZ B;  3GJT B;  2R8K A;  4QYZ J;  4IO9 Q;  1HR0 F;  4KB7 A;  4X4U A;  5D15 A;  3DRR B;  1N5S A;  3HT3 A;  3RB3 A;  2ZC3 A;  3C2P A;  4DPT A;  2ZDP A;  2IM1 A;  4I2P B;  2HHP A;  3BSC A;  4K4U A;  3CE8 A;  1WSV A;  4EZ6 A;  2AX0 A;  2V67 A;  2RQK A;  4DPW A;  2CG8 A;  2M8H A;  2XI3 A;  3NCR A;  4ELV A;  3JSM A;  1S76 D;  3KFW X;  2POK A;  4ED6 A;  2MZ1 A;  2W1B A;  2OGU A;  3TEG A;  1NHV A;  1Y10 A;  2RIL A;  2RRB A;  3H4D A;  2D9O A;  1Q95 G;  2PC6 A;  3ZFV A;  4Y2A A;  5E7O B;  1NJZ A;  3MWB A;  4JI4 F;  5CYQ B;  1LNQ A;  1Y5N B;  4HT5 A;  2QA2 A;  4J9L A;  4OX9 F;  4ATN A;  2XY5 A;  2DGV A;  4D3G A;  4MFB A;  4O3N A;  4DU8 A;  2ADC A;  2AGO A;  1NK9 A;  1U48 A;  2C2N A;  4JI5 F;  4DV0 J;  3MUR P;  2CG4 A;  2MQO A;  2D1C A;  5F8L A;  1TMM A;  1J5O B;  4KHR A;  3IS9 A;  2HHW A;  1N32 J;  5CA5 A;  3UD3 P;  1S1W B;  1H38 A;  1RA7 A;  5J2M A;  4DUZ J;  3GV5 B;  3M8S A;  1AFJ A;  1J5E F;  1T9T A;  2EFO A;  4WP8 A;  2AHO B;  2D7S A;  3JSB A;  1N52 B;  3LW5 C;  2DT9 A;  3MZI A;  5IV3 A;  2HYI B;  2NSC A;  1YJR A;  2IC3 B;  4L73 A;  4MJK A;  3JYT B;  3ILJ A;  3Q83 A;  1IQT A;  4YFU A;  1NUE A;  4OJH A;  3R5B A;  3OUY A;  5LL6 d;  1N6Q A;  1S6Q A;  1YJ9 S;  2DRB A;  4M5G A;  4MYT A;  2WBM A;  2VON A;  1MN7 A;  4IRD A;  3QYY A;  3HKW A;  4OI2 A;  4DWI A;  2B9E A;  2M88 A;  5I42 A;  3LQV A;  1VC0 A;  4ZHR B;  4TU7 A;  3O6Q A;  2GV1 A;  3MMA A;  4U67 Q;  2VC1 A;  1NK4 A;  2ZD1 B;  2WBR A;  4R5P B;  4CO5 A;  4ZP8 A;  2DVI A;  2CQG A;  2ZEJ A;  4CZC A;  1VS3 A;  3CDE A;  5B0D A;  2DHG A;  3HHE A;  3RAM A;  1XEZ A;  3P49 B;  1HBN B;  1LWF B;  1SBR A;  4K2X A;  1RGV A;  4ICL A;  1UVJ A;  1SJ1 A;  5CCM A;  4NYO A;  2HND A;  5D8H B;  2J5A A;  3TUP A;  4EO6 A;  2MPU A;  4Q2M A;  1X9S A;  2HNY A;  2FVC A;  4TY8 B;  3A13 A;  3TZY A;  2A6O A;  1RHK B;  4OYB A;  4ECR A;  4TYA A;  3BKF A;  4MIB A;  5ADZ A;  3T1H F;  3D28 A;  1ZYQ A;  4U6P A;  1WC0 A;  2JVO A;  3GV7 B;  4KYZ A;  3OV7 A;  1TP7 A;  4ZPW R;  1UW9 A;  2CJA A;  3BEG B;  1JLB A;  4QYR A;  4JI3 F;  2W7A A;  3H0P A;  1JLA B;  3ZZY A;  1VQP S;  1SJQ A;  5RUB A;  4PUO A;  3DOK A;  3H2U B;  2QTW A;  4DSL A;  3DMJ A;  2KJV A;  1RT7 A;  3C6T A;  1T9U A;  1LEO A;  1OMS A;  2J6U A;  2ATL A;  4PWD A;  2HLU A;  3BPD A;  4HHU A;  4M5K A;  1PIL A;  2DH8 A;  2YVS A;  2W4C A;  3TJA A;  2V4Q A;  1LW2 B;  1CJU B;  1T9X A;  1HMV A;  1X60 A;  1JX4 A;  2ABY A;  4CLK A;  1N5V A;  4HH0 A;  4PEO A;  2DGU A;  4DG1 A;  1MW7 A;  4F2S A;  1RAH B;  5KG7 A;  2UXB F;  4P7V A;  1SL1 A;  2D69 A;  1V3S A;  1FVS A;  3AQO A;  4KGV B;  1UA1 A;  1KQF B;  2DNG A;  3GMG A;  4Q0B B;  2X3G A;  3A3O B;  6FD1 A;  1JXL A;  2M7S A;  1KQK A;  1F0X A;  1LFP A;  4CLW A;  3DNC A;  1NKE A;  2ERR A;  4LFB F;  2DIV A;  3BBF A;  5D4L A;  2HQF A;  4RW9 A;  3GON A;  4CTA B;  4N77 A;  4ZIW A;  4F0M A;  3L09 A;  3N28 A;  1UVI A;  4ZOS A;  1PJ5 A;  1IJE B;  4OV1 A;  1HQE A;  4DR1 F;  5HO4 A;  3CD5 A;  3I87 A;  3DU5 A;  2BJ3 A;  4JI6 F;  4I0W A;  3GP9 A;  2CJX B;  4HDH A;  4U7U D;  3OTO J;  4DCJ B;  2UXC F;  4DV7 F;  1P6T A;  2XMM A;  3GG1 A;  3NAH A;  4EBE A;  2XCP A;  2ZE2 A;  3K58 A;  1XN9 A;  1WKK A;  4L3K A;  2IYI A;  3OSP A;  3IBC B;  1NK8 A;  2AYM A;  4C8M A;  1RUS A;  2IMO A;  4DN0 A;  2GVD B;  5CAA A;  4PRF A;  2BOP A;  2E1C A;  4FYD A;  5C5J A;  3H5X A;  2XM3 A;  2FDN A;  1NJI T;  2LDY A;  2CZ4 A;  1U6B A;  2R7T A;  1QAY A;  1XNR J;  1N33 J;  2GMH A;  3I4H X;  4Y2M A;  2QSF A;  2CQH A;  5KT4 A;  2GJI A;  2W24 A;  1NZA A;  3CC7 S;  4J37 A;  4USK A;  2Y0B B;  4IFV A;  4H4K C;  1BC6 A;  1ZM2 A;  2ZBQ A;  2Z2Z A;  1QVG R;  1UKU A;  3MR7 A;  3C15 A;  4HTI A;  2WVB A;  3W2W B;  4MIW A;  2GQC A;  3PKY A;  5D4O A;  4X62 J;  2HWI A;  2VF3 A;  2E5L J;  4XPC A;  2OUG A;  3DDI A;  3ZZP A;  2GVZ A;  2E66 A;  2RUS A;  1A7G E;  3R5D A;  1IQZ A;  1WOP A;  3ENQ A;  4DZ6 A;  1V3R A;  1D9D A;  2VIC A;  3R6G B;  2DNO A;  1YZ6 A;  3CGI A;  5F0U A;  2AJ4 A;  4AQY F;  2I38 A;  4ED4 A;  2C3Y A;  2MZR A;  2QEX S;  1IR2 A;  3KWM A;  5J1E B;  2L9N A;  4YEA A;  2RQC A;  2P6T A;  2HEK A;  4KRW A;  2NCK L;  2RQM A;  1QDU B;  1TKT B;  1Z2L A;  4DMZ A;  1TKX B;  4X4Q A;  1S99 A;  3LH2 S;  4QR0 A;  2XO7 A;  1RZM A;  3L95 X;  2K8G A;  5E3A A;  1RTJ B;  1R6Y A;  4Q2L A;  4F36 A;  1MML A;  3M6X A;  4KQZ A;  3BBB A;  5KOX A;  4KO0 A;  4I6Y A;  4L74 A;  4WFN Q;  5GAD U;  4DR5 J;  1T7P A;  4FYX B;  4F4A A;  2XWX A;  1Q8B A;  5KG6 A;  2BDP A;  4CLP A;  4JUZ A;  5IV4 A;  3AD8 C;  2JEI A;  2AEJ A;  5HAO A;  4BBY A;  4X4O A;  3MR2 A;  2LU1 A;  1TVR B;  3DDK A;  5H9E J;  2CAD A;  1CJK B;  2WB1 D;  1XR6 A;  3TAQ A;  5KT2 A;  3FSI A;  1S1X A;  4DS5 A;  3VGV A;  1VQY A;  3MMJ A;  2ZH3 A;  1HHS A;  2ASL A;  4YN3 B;  3BGF A;  5CD4 A;  5HVG A;  1TKZ A;  3DRR A;  1FRM A;  4ERD A;  2WSE C;  3AOD A;  3SQO P;  3HFV A;  1M1H A;  2HZV A;  4C97 A;  5LMN F;  4DV2 F;  4DV6 J;  3H20 A;  1AZS B;  3HKZ D;  4C6A A;  2R7V A;  5M2U A;  3H5Y A;  2WHO A;  2UUC J;  2HBY B;  2AGP A;  5AXN A;  1VI7 A;  3GG0 A;  2MKH A;  4UT4 A;  1XNQ J;  1VIS A;  4WIQ A;  3BGO P;  4P74 A;  2I9S A;  4YQW A;  4G1Q B;  1M90 T;  1CS4 B;  3N6N A;  4AUK A;  3DOL A;  1RAD B;  2MKY A;  5A76 A;  2YNI B;  3Q8S B;  5DGB A;  2VG7 B;  4OHX A;  2WK4 A;  2B8P A;  4X4V A;  2DB1 A;  1RAA B;  3G87 A;  5C42 B;  2XYP B;  2V4J B;  2OHD A;  3KG4 A;  5CYQ A;  1U1K A;  2R8G A;  1MSW D;  1WAC A;  3DU6 A;  4USH A;  4LRA A;  2A2C A;  1DTT B;  3DKD A;  2X1A A;  1HNI B;  2LU2 A;  4WTO B;  2VPW B;  2HRY A;  3D6M B;  1HQU B;  2UVU A;  2JX2 A;  1S12 A;  1ZPW X;  3FUY A;  5F9N A;  2Z8Q A;  2OPR B;  1S1W A;  3ZO7 A;  4OYM A;  3BR8 A;  1L5U A;  1E6Y B;  4NL5 A;  2JLF A;  4LRC A;  4EYH B;  4NZ7 A;  4K4X A;  3PTW A;  5B0B A;  2H4W B;  2WW8 A;  1HNX F;  2OEK A;  4EZ9 A;  1S0V A;  4OYO A;  4K8R A;  2L48 A;  3EZU A;  4PPD A;  4F25 A;  4B08 A;  3NEK A;  2EBE A;  2IC3 A;  2YXL A;  3JYT A;  3NMR A;  4TQR A;  4W92 B;  2VQF F;  2BAB A;  2DK2 A;  3MTJ A;  4YUD A;  2B9Y A;  3I5A A;  1LW0 A;  2CNK B;  4HHJ A;  4LF9 J;  3GWC A;  1UVK A;  3B82 A;  4MTP A;  4ECX A;  1H2U X;  3BSO A;  2E44 A;  4DDF A;  3TOQ A;  4TKT A;  4XTT A;  2XO6 A;  4DR2 F;  2ZD1 A;  1FNO A;  2V68 A;  4M5H A;  3QAT A;  4B9N A;  4Z2X A;  1LQ9 A;  1YHQ S;  1VQK S;  4LF1 A;  4YOE A;  2IBO A;  3I32 A;  3TAP A;  1XMO F;  2JC1 A;  1CQM A;  5HMY A;  5LMU J;  3V6H A;  1RAI B;  5E3C A;  4X4P A;  3QGI A;  5B0C A;  1HBN A;  1LWF A;  4PG6 A;  1F5A A;  4RUC A;  3BN7 A;  2YWK A;  3TVK A;  4F3O A;  1N5Y A;  2ZUA A;  2FB0 A;  3LWL A;  4GKK F;  4TY8 A;  2NS1 B;  2WSF C;  2XUL A;  2F1F A;  3PJX A;  3EMT A;  4USW A;  2CWK A;  4NA3 A;  1S1T B;  3I6P A;  2P5V A;  3NGS A;  4O4G B;  4OYI A;  1QLN A;  4WCE Q;  3VAF A;  2F9D A;  3DI6 B;  1IWG A;  2EWH A;  2G1D A;  4NCB A;  2MKK A;  3V4I B;  2BE9 B;  4KFB A;  3MGJ A;  1T3N A;  3JB9 k;  4F0K A;  2FZK B;  4X84 A;  3K5P A;  2HQG A;  5DZ6 A;  3QRR A;  1U09 A;  4UTG A;  2XZT B;  1RT3 A;  2V5H G;  2OI2 A;  1SIZ A;  1B0V A;  2CWX A;  2DY9 A;  1QSL A;  1ZOT A;  2NSB A;  4Z7C A;  3OL8 A;  2FYX A;  3PXG a;  4LVO P;  1K47 A;  2CPI A;  3TZZ A;  1URR A;  3GQC A;  1KTQ A;  4HI1 A;  4RUA A;  2AYB A;  1HNW F;  1S4E A;  2M9K A;  4A8S A;  3MPV A;  4JYA J;  3BBC A;  2PA8 D;  2OIH A;  3FC9 A;  4ECU A;  4B17 A;  3RJM B;  5FLX U;  3HHK A;  4P52 A;  3RBX A;  2UVW A;  3VAL A;  2V8V A;  4V19 J;  4I6W A;  1BQM B;  1PC4 A;  4EU0 A;  3KLH B;  5BXI A;  4UY8 T;  4ENO A;  4B3S J;  1O51 A;  1TK0 A;  2CPD A;  5AXL A;  3KG1 A;  1FDN A;  4YB7 A;  3UDE A;  3QSY B;  1MNE A;  2YQ0 A;  4NMX A;  3QT7 A;  2PII A;  2CQI A;  2WZ1 A;  5A8K B;  3MPY A;  4J9N A;  1UTA A;  3OPK A;  2Y8W A;  5KG0 A;  3J81 j;  3BGU A;  2K7K A;  4YP3 A;  3SBM A;  2Z57 B;  5HLF A;  2BVZ A;  2FHJ D;  3Q8Q B;  1HHQ A;  3C6U B;  4RBV A;  4KR0 B;  4ALZ A;  3OHB A;  5GME A;  1JNR B;  4DOZ A;  2YQ1 A;  1KBR A;  2JJ4 D;  2I5J A;  3PY8 A;  3TQ1 A;  2RF2 A;  1YQH A;  4ZJL A;  5KFS A;  4B3M F;  1TL7 B;  4O3S A;  1N0V C;  1JJH A;  4P2S A;  2Z56 B;  1GAO A;  3CF5 Q;  1R8C A;  4IG3 A;  5AE1 A;  3CVK A;  3OTE A;  2IDE A;  3TUZ C;  5EWF A;  4UOC A;  2BJ9 A;  2Y3Y A;  2V4R A;  2RS2 A;  4J90 A;  3RR7 A;  2BV3 A;  1ZM3 A;  1VDH A;  2WON A;  1Q86 T;  1QTM A;  5L1L A;  3M30 B;  3HMJ G;  3PEH A;  5KFV A;  1R7I A;  1SB6 A;  5KFD A;  1M5S A;  2U2F A;  3ZTR A;  4CRJ A;  1VQ6 S;  2W7O A;  1FRH A;  3K8W A;  3PO4 A;  2BYC A;  4DQR A;  3K5L A;  4J9S A;  5GAE U;  2CPJ A;  1TKD A;  3CJ0 A;  1SC1 B;  1F3F A;  4JI8 J;  1LWC A;  3TX0 A;  5KT3 A;  3MR3 A;  1HBO A;  1RHM B;  2KYX A;  3UVJ A;  1HAR A;  1XMQ F;  2OML A;  2OAU A;  3FCW A;  5SUH A;  2R8H A;  2DR5 A;  1X4D A;  2M8D B;  3QT8 A;  1IR1 A;  5BR8 J;  1CJV A;  2BRL A;  3NS7 B;  3JAM Y;  1SH3 A;  4ZP9 A;  3RZA A;  1N4L A;  2ALZ A;  2FJE B;  4U7C A;  2GCF A;  2MZJ A;  3CC4 S;  5DLF A;  3KK3 B;  2X7I A;  1R0A A;  3EVM A;  4OYP A;  3J81 U;  1NCL A;  1TKT A;  2YWH A;  3MCS A;  1RT5 B;  4DFM A;  1NKB A;  2IVY A;  2MZS A;  2AJ0 A;  4NCG B;  3I5C A;  2PD1 A;  1U24 A;  2KVI A;  3S6E A;  2EEY A;  3G8Q A;  1XTZ A;  2VG6 B;  4TNO A;  3CD6 S;  3RYL A;  1RCX B;  2D74 B;  5EWE A;  3IWX A;  4LF4 F;  3KUH A;  5F41 A;  2ZH7 A;  3O8W A;  1RAO A;  3MXH P;  4ILM A;  2XHW A;  2L9D A;  3MAA B;  2QN6 B;  5LT5 A;  2C2O B;  3I56 S;  5F0W A;  4B9S A;  2EFN A;  4IRC A;  3NS6 A;  3FQL A;  5DO2 A;  3PV8 A;  2C22 A;  1HNZ F;  4DUY F;  1CJK A;  1VK8 A;  3MFH A;  4FYV B;  1UCN A;  4USM A;  2V2Q A;  1QTN B;  3HVA A;  5L46 A;  4LFC J;  2HHS A;  4WII A;  1Z4U A;  4ECV A;  3OVB A;  1R43 A;  2HHT A;  2ZBR A;  4N47 A;  1ARO P;  1IKY B;  2RS8 A;  5C24 A;  4RW7 B;  4CO3 A;  4RU9 A;  3B78 A;  3W3S A;  1GXU A;  3UN2 A;  4DSF A;  2ACY A;  1S7I A;  2MKC A;  5KG5 A;  1DRZ A;  3PM9 A;  1AZS A;  1IXK A;  5JVH Q;  5EX3 A;  3B8H A;  4YR3 A;  1ZET A;  3D66 A;  2ZBI A;  5C2C A;  1LK5 A;  2HBZ B;  1LFW A;  4O44 B;  1ZTT A;  5LXR A;  5A2Q Y;  1KRP A;  2HZA A;  1IKX B;  4MKY A;  2XYH B;  1CS4 A;  2P2C B;  4KH1 B;  3BH7 B;  2JDJ A;  3O5T B;  3EGN A;  2YNI A;  2VG7 A;  4KV8 B;  2IDL A;  3HHL D;  1CC8 A;  1TL1 B;  4V1A k;  2V4J A;  3PJ9 A;  2BJ7 A;  4NEY A;  3W61 A;  4LVN P;  1PYS B;  3UR0 A;  4AXJ A;  4J5O A;  3LTO A;  3KK1 B;  5B0E A;  2VFT A;  1M5V C;  3A8K A;  4LRE A;  1S10 A;  4ZP7 A;  3OBI A;  1G1X A;  1WKL A;  1DTT A;  5LJ3 Y;  3ILL A;  2DIS A;  3BYR A;  2VFV A;  3A4T A;  2K3I A;  2YY3 A;  3KJQ B;  2Z4P A;  1BWV A;  3SI8 A;  2F5G A;  2E9T A;  1SPB P;  4C2M A;  1WC6 A;  3QAE A;  1NK0 A;  4J9K A;  2H51 B;  3QLH B;  4O23 A;  3P8B B;  5K20 B;  3MM8 B;  3THT A;  4I2Q B;  1NM2 A;  3PIP Q;  5L1I A;  2B4U A;  1HFE L;  3MEC B;  1TTH B;  2G2Y A;  4OIX A;  3V5R A;  5L1J A;  5KFM A;  2W9B B;  5HVH A;  3TZX A;  1FRX A;  2XTJ P;  2DNH A;  5J2Q B;  2B3T B;  3CO9 A;  2ZOF A;  5C25 B;  4LMZ A;  3CJK B;  1NLK L;  3H7H B;  5BYR A;  1HWI A;  1Y9O A;  3OJU A;  1OYD A;  3KJN B;  2J7U A;  1FFS B;  2JFD A;  1CPZ A;  3KNG A;  4L72 B;  2F9J A;  2QA1 A;  4LF5 J;  2MGZ A;  4NLP A;  2XEX A;  2RKI B;  1QE1 B;  4UZB A;  3I4P A;  2JL9 A;  3M8W A;  2CQ3 A;  4A8O A;  4OHZ A;  1GT8 A;  2WVF A;  4WU3 A;  1WEX A;  1JLE B;  4OX7 A;  4RW8 B;  1MRO B;  1NRK A;  5FJ4 A;  3A3P B;  4JP8 A;  2YNG A;  2ZC4 A;  3D2W A;  1HWK A;  2DXD A;  2AP6 A;  1UVL A;  4JV5 J;  2HUR A;  2FHK A;  3K0J A;  1UEK A;  1Z1Z A;  2IA0 A;  2BBE A;  1S1T A;  3R5G A;  2PMH A;  2ZZM A;  1NEE A;  3VGS A;  1FES A;  4F02 A;  3VAJ A;  2QA4 G;  2RSQ A;  4FYW B;  3CWJ A;  4DCO B;  3K89 A;  4KPY A;  3DI6 A;  2JRS A;  2GZO A;  1JXV A;  3DDN A;  4GKJ F;  1F60 B;  3PW4 A;  2QL9 B;  2NZ4 A;  2UVR A;  3WHI A;  3CNQ P;  4QW9 A;  1T9V A;  1YBT A;  2FPH X;  1U8S A;  3PRB A;  2KTQ A;  1RQ0 A;  2JEF A;  2QE5 A;  1PBA A;  1Q78 A;  4WP3 A;  2PDA A;  2J8A A;  3GTY X;  2JC0 A;  4OI3 A;  3AD7 C;  3CC2 S;  3MEE A;  2BAN B;  1ACM B;  4OHW A;  4LQ9 A;  2RRN A;  4AYB D;  3HUL A;  4A8K A;  2KXF A;  3QGG A;  1RDR A;  2KVQ E;  2CVE A;  3N01 A;  4GO5 X;  3PNI A;  2CDQ A;  4YY3 J;  1QD1 A;  3BJY A;  1N32 F;  4DX8 H;  1X4B A;  2DR7 A;  2EFP A;  3M8P B;  2CQP A;  1FK9 A;  3MPD A;  1SL2 A;  2X3D A;  1SL0 A;  1BQM A;  3A8I A;  2D41 A;  2LKZ A;  1S6P B;  4JI1 J;  1Y3J A;  4OYA A;  4RX6 A;  4JV0 A;  3BSN A;  3KLH A;  4LT6 A;  3PHT A;  3DLK A;  3MCO A;  1LXN A;  1NU4 A;  4J9U E;  5A8K A;  2VFS A;  4LIR A;  1FDD A;  2XCA A;  4A8Y A;  5E3R A;  2KFZ A;  1DUR A;  1KLN A;  2DNL A;  5ETL A;  3T5H A;  4TXS A;  4NLU A;  2NQP A;  2BRK A;  2FY1 A;  4FS2 A;  4KKO B;  2XS2 A;  1DBD A;  3GIR A;  4NML A;  5KFH A;  4C11 A;  3R5A A;  1VRT B;  2IM0 A;  1YJ7 A;  4G3I A;  4F3Q A;  4H54 A;  1TL7 A;  1K73 T;  1V5V A;  2J9D E;  3MCM A;  3POT B;  1IWA A;  3GSD A;  1WG5 A;  1VLY A;  3MEK A;  2C3M A;  3QAU A;  3IP0 A;  3TYT A;  1TL5 A;  2XMW A;  3GJR B;  1VOM A;  2CDR B;  4CLF A;  2FJD B;  2H3E B;  4PCQ A;  2NZC A;  5LM7 E;  1UP1 A;  3H4B A;  1RB0 A;  3TQE A;  2LXF A;  2W9C B;  3BH6 B;  3NNA A;  3D3B J;  4LRF A;  4IR1 A;  2WVC A;  5G0R B;  1T3O A;  2CNO B;  5JUM A;  1IVZ A;  1CG2 A;  4ZJO A;  4DR4 J;  3AOC A;  3NAI A;  1SQF A;  2EG1 A;  3PFO A;  2IM3 A;  2FVP A;  3UN5 A;  4B9T A;  4C3L A;  1WWH A;  2QC3 A;  1Q53 A;  3F56 A;  2ROP A;  7FDR A;  1B64 A;  1XC9 A;  4WJB A;  1S1U B;  4DEZ A;  2AZ1 A;  4OI4 A;  1KC8 T;  3BGR B;  4F50 A;  3ET6 A;  1FDA A;  1BGX T;  2RRA A;  2KN4 A;  1JLF A;  3G82 B;  2HHH F;  1OIA A;  1FCA A;  1AXQ A;  1K44 A;  3I55 S;  1YJV A;  1RHJ B;  4FVM A;  4J9R A;  2DTJ A;  1U1L A;  3C14 A;  1R0C B;  3C16 A;  2FZG B;  1FO1 A;  3GR0 A;  4FBU A;  3BF4 A;  4C9D A;  4DR3 J;  2R2U A;  3TA0 A;  1WOS A;  2VG6 A;  1J2V A;  4LBI A;  4ECW A;  2UV8 G;  2OP5 A;  3UDC A;  3PX4 A;  5CQG A;  1WHV A;  2DGX A;  2YWE A;  1X4A A;  2F40 A;  4KHP J;  1EB0 A;  2HRT A;  1YX2 A;  2U1A A;  3ZTO A;  2YQ3 A;  2DD8 S;  1JQG A;  4DBQ A;  4DPO A;  2ROG A;  4GC7 A;  4EGL A;  2DHA A;  5KFE A;  3H5U A;  3DYA B;  2M0G B;  5LSL A;  3MI7 X;  1HI8 A;  3FBC A;  1Y11 A;  1RT1 A;  3G4S S;  1SUQ B;  3JS9 A;  2OPS A;  4RBU A;  1JJ4 A;  1UWB A;  2BW2 A;  3CSK A;  4RU2 A;  4ELU A;  4XK8 C;  2VUG A;  3ENW A;  3J7Y I;  3BKT A;  3CJ8 A;  4FDF A;  5IS2 A;  2PO4 A;  1KS2 A;  1YJT A;  3JAM U;  1H2V Z;  3UCZ P;  3WBZ A;  4NA2 A;  5KT6 A;  3RUB L;  4ZVU B;  1W2B R;  3RRG A;  3X3U A;  4NLO A;  4O44 A;  4A48 A;  3R1L A;  2HFU A;  4PYD A;  3PJW A;  5CYM B;  1EP4 B;  1R8P A;  2FJW A;  3PYG A;  1N0U A;  3AJ1 A;  3DLE B;  1MU2 B;  4IG0 B;  1RAJ A;  3D6F B;  3MMB B;  2PN6 A;  2V94 A;  1EAY C;  1YG0 A;  4DR6 J;  1PO6 A;  3AAW B;  2GNK A;  2XGQ A;  4KV8 A;  7AT1 B;  3CCE S;  3VAM A;  3IXQ A;  3RAX A;  4F4Y A;  4O0N A;  4EBD A;  3L7U A;  2CJ9 A;  1QUP A;  2YKA A;  1JLC B;  1FE4 A;  2CQB A;  2Y8Y A;  2FLL A;  2FJA B;  1U02 A;  4H4O B;  2R7S A;  3KKF A;  5I3P A;  2E5L F;  1RT4 A;  1RK8 A;  5I3U B;  3T19 A;  3X1L B;  4P72 A;  4HI2 A;  4E2F B;  1FEH A;  2YWG A;  1NAQ A;  1P1T A;  4LBP A;  4OZ2 A;  1X4G A;  1JLG B;  1RAB B;  2M70 A;  3QLH A;  3HJV A;  3AA8 A;  3VAH A;  2XSJ A;  2YTC A;  3MM8 A;  4PQA A;  3H5S A;  4N8N A;  2ZM6 J;  4I7F B;  1IBK J;  4ZVT B;  3R6L B;  3TAR A;  1FXD A;  2B9W A;  2HIY A;  4XIU A;  5A8W B;  2V50 A;  3MEC A;  3CIM A;  3MED B;  3CO0 P;  2ILY A;  3M9O B;  2KRB A;  4J9Q A;  1DAR A;  5DRK A;  4WWS A;  1U25 A;  2W9B A;  1SQG A;  3AXK A;  3R1H A;  4LSN B;  2WB4 A;  1TFW A;  4DFJ A;  2XSF A;  1PSD A;  4NXN J;  1S9G B;  3DM2 B;  3CJK A;  2RDD A;  2BAC A;  4DR5 F;  1OS5 A;  4IUF A;  1YIJ S;  2M4M A;  1U2C A;  1U1O A;  2KKH A;  2C2E A;  1WF1 A;  2HGL A;  1FXR A;  4ZPD A;  2N4C A;  4FXW A;  1U47 A;  3MUT P;  5DQI A;  1QE1 A;  4WBF A;  5IWA J;  1Q8K A;  2A1B A;  2XI2 A;  3U1L A;  2QFJ A;  4RW8 A;  2DIT A;  1MRO A;  2OPQ B;  3MD3 A;  2UUB F;  3TZW A;  3WQP A;  1QJH A;  1QM9 A;  1VQM S;  2K2P A;  3NGD A;  1C2P A;  3RB6 A;  3PW0 A;  2B7C B;  4H4M B;  4RLE A;  1HPZ B;  5HQ8 A;  5KFN A;  4DV6 F;  3D68 A;  4B3O A;  3BO4 A;  4WU2 A;  4P2X A;  1NPP A;  4ZCL A;  2Y9H A;  4TYB A;  2ROE A;  4WKY A;  1WTB A;  4CWB A;  1XNQ F;  3QGP A;  5D0H A;  4ZVH A;  1MWZ A;  1F1B B;  4ZN1 A;  4QIE A;  3HD2 A;  4UOF A;  1HBU B;  3JQM A;  3LP0 B;  1RAF B;  2J76 E;  1DAX A;  2EK6 A;  1BUX A;  2YX7 A;  4OZ1 A;  5DQG A;  3M2U A;  5F3Z A;  2QYG A;  1U0H B;  1DTQ A;  3M8Y A;  4R0E A;  2UV8 A;  4LFA F;  3BS9 A;  2M3D A;  4A8X A;  4DZD A;  1Q5V A;  3AHP A;  2DEJ A;  1W25 A;  4FZV A;  3FNN A;  3KLF B;  2V34 A;  1FF2 A;  2J7K A;  4ECQ A;  2ZH4 A;  5E3P A;  3M8P A;  3NWR A;  4OX8 A;  2K1R A;  3PVX A;  4L76 A;  4Z37 A;  3GIL A;  4KSE B;  4ED7 A;  3MR5 A;  3BM7 A;  2ZZN A;  4R25 A;  2IVF B;  5FII A;  1S6P A;  3BRE A;  2CJK A;  4I56 A;  3J80 U;  2J0W A;  3DRS A;  3JTN A;  2B43 A;  2CJQ A;  3C8Y A;  5KFQ A;  3OFF A;  4QIV A;  1HR0 J;  1H7X A;  1X5P A;  3GYG A;  4IKA A;  2DH7 A;  3VVT A;  3W5Y A;  1FD8 A;  3DXS X;  5T7L A;  4FXV A;  3I0S A;  4KHM A;  4X66 J;  2R7O A;  5HP1 A;  1BQX A;  3RGI A;  4KKO A;  4OZL A;  1RP5 A;  1ZM4 A;  4B3T J;  3CXC R;  1D8Z A;  3Q2T C;  5ETM A;  2W2P P;  2V8G A;  2QT7 A;  2R9L A;  3D3C J;  1S5Z A;  2LXU A;  1ULR A;  3RTV A;  2R4F A;  3DN9 A;  1WC5 A;  1RYS A;  2VU5 A;  3SCL E;  3WX8 A;  4ECZ A;  1ZZN A;  1Y5I B;  1AYE A;  4WYW A;  3N0V A;  4K2J A;  5KFC A;  2I8E A;  2CYY A;  4PG8 A;  3W9J A;  1Q82 T;  5GMD A;  4CI0 B;  1ICE B;  2OPP A;  5EUH A;  4WXO A;  4M95 A;  1HI1 A;  1UA0 A;  1WSR A;  4MKV A;  1VLO A;  2VD3 A;  3LF0 A;  3P6Y C;  4JI4 J;  2HVI A;  2E7X A;  3GYN A;  4OX9 J;  4WYL A;  3U02 A;  3PEJ A;  4JI7 F;  1WKJ A;  1CBK A;  1YRX A;  3IRX A;  4MIA A;  2RDI A;  3O1L A;  2AQ4 A;  4JI5 J;  2WSC C;  5K5M A;  3D9B A;  3IBF B;  3W60 A;  1OPI A;  4ES3 A;  4PPZ A;  4BDP A;  4RNH A;  3IN5 A;  3MM9 B;  5A6W A;  4IYQ A;  1YBA A;  3EGW B;  4RO0 A;  3SSS A;  1WNE A;  2G4B A;  3W64 A;  2UU9 J;  4QU7 A;  1PAU B;  2BOA A;  3PCO B;  2AZ3 A;  1J5E J;  3DGV A;  5D3G B;  1KDN A;  2BM0 A;  1GK8 A;  4PQU B;  1TL3 B;  1VCT A;  5J2N B;  1OPZ A;  1RWO B;  3BGR A;  3PO5 A;  3AT1 B;  1XMB A;  4CLU A;  1MN9 A;  4IOC Q;  3G82 A;  3Q8R B;  1TR0 A;  2B5J B;  2YKM A;  3H98 A;  3CME S;  1FX2 A;  3EJM A;  2CQ0 A;  3QFW A;  4XDC A;  1C1B B;  3HXM A;  4HL9 A;  1W26 A;  1KEK A;  6AT1 B;  2CQ4 A;  4OZ5 A;  4P71 A;  4RZR A;  3NNC A;  3W5X A;  3HM9 A;  4HLB A;  1M5O C;  3GFZ A;  5F8G A;  3Q23 A;  4EO8 A;  3M2V A;  3WC2 A;  1QAX A;  1HD1 A;  2B6A B;  2ATC B;  1YI2 S;  5DQH A;  2N4D A;  1H6K X;  3MF5 A;  1FE0 A;  5L8R C;  3PYD A;  2OMO A;  4NLG A;  4ZK7 M;  1DQA A;  4NLY A;  3HFZ B;  1KP6 A;  1S1V A;  5JMN A;  4YS2 A;  2NPI A;  3IR7 B;  4LF7 F;  2VL1 A;  5T14 A;  5D4N A;  4AL7 A;  3IR6 B;  1RE1 B;  3KOA A;  1U1Q A;  3GII A;  1F5C A;  3MEG A;  2BM1 A;  1NDL A;  3GLJ A;  3ITH B;  1SUQ A;  3T1H J;  3WX4 A;  3PKM A;  1Y0H A;  2XGP A;  1G2E A;  4DX6 A;  1R3N A;  5KTQ A;  1FHT A;  1HI0 P;  2V6A A;  3D0H E;  1IJF B;  4PG7 A;  1RU2 A;  2QLB B;  2H65 B;  4F4W A;  3FCV A;  3DCA A;  2AGQ A;  2VIH A;  5DDQ C;  5B0A A;  1RA6 A;  3TWZ A;  1EP4 A;  3ZNJ 1;  3NLC A;  3VF0 B;  3DLE A;  3S1T A;  2DNY A;  2PE8 A;  4IG0 A;  1CSJ A;  1RHQ B;  3MMB A;  4ZVG A;  1AW0 A;  3RB4 A;  1NME B;  4J9O A;  2HVZ A;  2ZH2 A;  3NKY A;  4QCL A;  4WK3 A;  4RW4 B;  1U2F A;  4A8Q A;  2EK1 A;  4IDK B;  8AT1 B;  2EC2 A;  2J6T A;  2ZWO A;  1ZM9 A;  4PXE A;  2HFZ A;  1NKC A;  3FFI B;  1M0S A;  4ECY A;  1RT6 A;  1JLC A;  2GGP B;  2ZOM A;  1YBU A;  4QWE A;  2GJF A;  4C8Z A;  3TR5 A;  4RNO A;  3SSQ A;  1QAJ A;  3CCL S;  3GV8 B;  1U1R A;  3PZP A;  5I3U A;  2KH9 A;  3IRW P;  4NLX A;  3NY0 A;  2BKN A;  5BR8 F;  2MXY A;  2ZHA A;  2FLN A;  4YDX A;  1HW9 A;  2I0X A;  1S0N A;  2KI2 A;  3NCQ A;  5BYQ A;  1TK8 A;  1T9W A;  2ZNY A;  4I7F A;  2HHX A;  4Y34 A;  2MQN A;  4ZPT R;  3KHH A;  2FHJ A;  4DR1 J;  5A8W A;  3CJ3 A;  5LSO A;  1QY7 A;  3MED A;  5ETS A;  4JI6 J;  4CLY A;  3CDA A;  1RJJ A;  2HVH A;  1EHW A;  1VIO A;  1S9G A;  1W2I A;  2UXC J;  2A0F B;  2YH0 A;  1NO8 A;  2DR8 A;  1FTR A;  2FD2 A;  3IBW A;  2DGS A;  5K8P A;  3OHA A;  4WZM A;  3T9Z A;  5MLC V;  3M8Z A;  1WDD A;  4FF4 A;  4ES1 A;  2Y1J A;  2BJ1 A;  2KT5 A;  3CMA S;  4WPA A;  3OR1 B;  1TFY A;  3AB4 B;  3HZE A;  4EI2 A;  1FJG F;  2JWN A;  2ACM A;  4Q5V A;  2FVQ A;  4FPI A;  1EX8 A;  1PAE X;  1U7L A;  3EDR B;  1VQL S;  3T1Y F;  3M32 A;  4ILL A;  3PAC A;  4H4M A;  4ZLL A;  3P3D A;  3R3T A;  1IKV B;  1OQ6 A;  2FGC A;  1HPZ A;  1SC4 B;  3CUL A;  1DQ8 A;  2H5J B;  3LPY A;  1S6U A;  3ZTP A;  5I3Q A;  2MQL A;  4GRS A;  1EKS A;  4LF6 J;  2COL A;  1UJ5 A;  1EZZ B;  4TQS A;  3M8R A;  2QV6 A;  1F2G A;  3NXZ A;  1GXT A;  3AJD A;  4AQY J;  2MLZ A;  3UCU P;  1R0B G;  3D4J A;  2BJE A;  4TY9 A;  1NZ8 A;  3CCT A;  3EPG A;  5DLG A;  3G6V A;  1Y3K A;  2RDJ A;  3PHE A;  4P6Q A;  4N8O A;  3CJT A;  3HHD A;  3TAN A;  1U0H A;  3KLE B;  2BQU A;  2XS5 A;  3SQG A;  5CD4 H;  5KT7 A;  5M2R A;  3OTC A;  4ZLN A;  2IAJ B;  1MWY A;  1DLO A;  2VFR A;  3A12 A;  3OXL A;  1UAW A;  3Q24 A;  1VBX A;  3VAK A;  4ED0 A;  3KLF A;  3KLG B;  3W2V B;  3T6B A;  3AQP A;  1RHU B;  4ETZ A;  1YLX A;  5GAH I;  3IGN A;  4OMF G;  4PXB A;  3MPW A;  3SFU A;  4ZCM A;  5HVF A;  1HYS B;  5GAG I;  2I2Y A;  3GZ7 A;  3PG9 A;  1C1C B;  2HIQ A;  3TAM B;  2QLX A;  2IRX A;  4RNF A;  5G4D A;  5ETK A;  1FRI A;  3UO0 A;  4CO0 A;  2C1E B;  3B54 A;  3EWG A;  5J2P A;  2XBP A;  3W62 A;  1BQN A;  4X4R A;  3SDE B;  1GTE A;  3KTQ A;  2DO0 A;  4QJV A;  2KFY A;  1NJW A;  3IGV A;  5FLX Y;  1TUV A;  2IJF A;  1N34 J;  2YKN A;  1RWU A;  4B9V A;  3RRH A;  3DRP A;  4ZCI A;  3PFE A;  4DSK A;  2UXD F;  3VGT A;  3GIJ A;  4DV2 J;  3UN3 A;  1FEE A;  2AEM A;  3Q86 A;  4JI0 J;  4DHV A;  3DOM B;  4C48 A;  1T02 A;  1N5T A;  3A3N B;  2ZFH A;  3UQS A;  2PA3 A;  4X65 F;  1VRU B;  4LF5 F;  1D3W A;  2MHN A;  2Y1R I;  3HSJ A;  4JI2 J;  4WFB Q;  4KC5 A;  3NGR A;  4JV1 A;  1X0F A;  3MCN A;  2HLT A;  4OZ0 A;  1NBE B;  4DX7 A;  3HHL A;  2ZJP Q;  3M7V A;  1S72 S;  1LWE B;  1WG4 A;  5IC4 B;  3EGZ A;  3F73 A;  2KM8 C;  3CCS S;  4JV5 F;  1FKO B;  1RTD B;  3KMS A;  2JFK A;  4F4K A;  1PKU A;  3S8S A;  4ZJQ A;  3VV2 B;  2BKP A;  1RWP B;  4UZC A;  2VG5 A;  2PFF B;  3KJF B;  4OI0 A;  4G6V B;  2BZ2 A;  5KFB A;  3FEY B;  2XY6 A;  1BE4 A;  5IM0 A;  1XQI A;  2CJB A;  5M2P A;  2ZBP A;  1WHX A;  4YHH F;  3UNY A;  2QO3 A;  2IHR 1;  3RRK A;  4K4Y A;  3R9L A;  4P2F A;  2ZOG A;  5JVG Q;  5D3G A;  2GAH C;  2C28 A;  2HQ3 A;  4KPC A;  1UW4 A;  2EBG A;  1FFG B;  1D9F A;  2ZWP A;  3R97 A;  2JZ5 A;  2VQF J;  4UUX A;  2J6S A;  1K0T A;  3TNV A;  3P5T L;  2GFF A;  3ENA A;  3N5F A;  1JXE A;  4U96 A;  3KLI A;  1SV5 A;  1Y00 A;  3NOG A;  3T5L A;  2O66 A;  2RE1 A;  4QIF A;  3UD5 A;  4NX9 A;  5A6P A;  3OD2 A;  3TVY A;  2V8P A;  4OYX A;  2B6A A;  3MD1 A;  2QLJ B;  5H9F J;  3KJV B;  5AJ3 J;  1K9M T;  1HNV B;  2ZDO A;  4TVA B;  3SCI E;  3RG6 A;  3JQJ A;  4TU9 A;  1T05 A;  1KHV A;  2EKN A;  1XMO J;  2WRM A;  2YWW A;  4C4W A;  3CJR A;  5HJY A;  3J81 Y;  2DPI A;  2V2V A;  5D0G A;  4GVB B;  4ZVF A;  4ZVQ B;  3CT9 A;  2HFN A;  4PWU A;  4ZIT A;  4UF4 A;  5IQQ A;  4K59 A;  4GKK J;  1IBL J;  1S9E A;  1C0T B;  3ULH A;  1BXN A;  1WEY A;  1U8W A;  3UR3 C;  1FJ7 A;  3M8Q B;  5KT5 A;  2UUA J;  2MKS A;  1ITP A;  4O4R A;  5ETV A;  2NR0 A;  3TW0 A;  4CH1 A;  5B09 A;  3LAL A;  5LJ5 Y;  4KBI A;  3JSM B;  1H72 C;  4BC9 A;  3TI0 A;  3LP1 B;  3QJJ A;  2RML A;  2AIR B;  7FD1 A;  2QL7 B;  1NSQ A;  1HL6 A;  3DGP A;  2IBK A;  1UFW A;  4MKB A;  1EET A;  1VQ9 S;  3UDV A;  3DHX A;  2AWZ A;  3GB0 A;  4RJV A;  2IRU A;  4JOU A;  3AH6 A;  3GFX A;  2HHQ A;  2WW4 A;  2KRR A;  1EKR A;  1H3D A;  2FLP A;  1UZD A;  1SKW A;  4IOA Q;  3Q0A A;  4ANC A;  3HFK A;  4YR2 A;  1HNW J;  2KJW A;  3IS9 B;  4M94 A;  3FFI A;  4DXL A;  3DLG A;  2APO A;  3OW2 R;  5J2M B;  2VPY B;  3HZG A;  2LLZ A;  3JTP A;  2DGW A;  1YWX A;  1UJ4 A;  5CYJ A;  3OTB A;  2VC0 A;  1FXL A;  2FQQ B;  2V2Z A;  1RTH A;  1TAU A;  2C2Z B;  2L3M A;  3OUY B;  4ZP6 A;  1N6Q B;  5D77 A;  1RAG B;  4YME A;  2AV5 A;  2E7V A;  2FJX A;  3SV4 A;  4FF2 A;  1B0T A;  1DZ5 A;  2HQC A;  4LIW A;  3JQK A;  4QR2 A;  3QZ7 A;  3CW2 C;  5I42 B;  4DSJ A;  3L7O A;  5F9L A;  5JXS A;  2NYH A;  1C0U B;  2HNZ A;  3FZB A;  1PYO B;  4C8L A;  2YKP A;  4UUW A;  1Q8L A;  2HSE B;  1YTY A;  2SXL A;  5AXK A;  2LDI A;  4S0M A;  4NLT A;  1XR5 A;  4M5M A;  1IKW B;  1FER A;  4KHP F;  2DCL A;  3HO1 A;  2RNE A;  5KFG A;  4B3M J;  4X64 J;  3D1H A;  1AUD A;  3EPI A;  2W4D A;  9RUB A;  1IN0 A;  1GMW A;  4I2P A;  3G71 S;  1CQN A;  3OL7 A;  2HNY B;  4Y65 A;  3SSR A;  3H25 A;  3D6T B;  3OR1 A;  2XWY A;  3KDO A;  3MUM P;  2YNH B;  1DFD A;  1RWX B;  3DLB A;  3CCW A;  1MG7 A;  2E1A A;  1U6Z A;  4QWD A;  3OJS A;  3OVS A;  4I6A A;  4RUH A;  2K7J A;  4QBU A;  1JLB B;  4GO7 X;  3TVZ A;  2J0S D;  4NE9 C;  4ZN3 A;  2C2K B;  2JEG A;  1LV5 A;  3F44 A;  4PUO B;  4ECS A;  1UVM A;  3DOK B;  4WFA Q;  3HSZ A;  2DNR A;  1WHW A;  3DMJ B;  3FBE A;  3CJ4 A;  2YPZ A;  1RT7 B;  1X8D A;  1XMQ J;  3NGK A;  3C6T B;  2ZH5 A;  3CDB A;  1WUU A;  4FKY A;  3QIP B;  4C8O A;  1GMV A;  4IQX A;  1EJ7 L;  3D6H B;  4C3K A;  1Q79 A;  1MWQ A;  4UOH A;  1VC5 A;  4R8U B;  2OTL S;  1J5O A;  3CTR A;  4ZCK A;  4TN2 A;  3CPW R;  2XMA A;  1N48 A;  4G1P A;  1I94 J;  3MM5 B;  4Q7A A;  3IA0 A;  2JH3 A;  2IAJ A;  1F6T A;  4NZ6 A;  4HEA 9;  4ITS A;  1O5J A;  4C8K A;  1EIY B;  2C42 A;  2XMK A;  2RHS B;  4OX6 A;  3KLG A;  5E33 A;  3W2V A;  3NG8 A;  4LF4 J;  3FEX B;  3DLJ A;  3EZO A;  2CRL A;  2VBZ A;  3N9U C;  2FC9 A;  1VQ5 S;  1UFL A;  1C4A A;  5L9X A;  3W66 A;  2W25 A;  3AFG A;  3UCG A;  1HYS A;  4RW9 B;  2MQM A;  3P96 A;  1WTF A;  4ZHR A;  3KHG A;  4WFY A;  3J7A N;  4ZVO B;  3TAM A;  5ETR A;  2D3U A;  1IBK F;  4AND A;  4NRT A;  3NBP B;  2QLF B;  3F41 A;  1HQE B;  4R5P A;  3CIZ A;  4M5N A;  4RNM A;  6FDR A;  2V2K A;  2R2S A;  4DL3 A;  2VH7 A;  4G65 A;  3SDE A;  4CIO A;  4H4K A;  2KT3 A;  4BWM A;  2MJU A;  3OT9 A;  4ECT A;  2W4P A;  2M52 A;  2OFH X;  3CCM S;  2KL8 A;  4DF4 A;  5KAK A;  1S79 A;  1HW8 A;  3H2V E;  2IVM A;  3W5Z A;  2GQQ A;  3RAQ A;  3KK2 B;  1KON A;  2LQJ A;  2VQE J;  4IH6 A;  3S7R A;  4GVL A;  2HAI A;  5KOW A;  2P9G A;  1XBW A;  3J7Y U;  4MKA A;  1VRU A;  3QWU A;  1WEL A;  1SC6 A;  1F5B A;  4UY8 5;  4OYZ A;  5HN0 A;  3MOZ A;  3E51 A;  5E3Q A;  4A46 A;  2CAJ A;  1R6V A;  2IRY A;  2P6S A;  2R2T A;  1RWW B;  4CT9 A;  3N6L A;  1JLA A;  5KFL A;  2VV5 A;  2GIQ A;  4WFZ A;  4NOH A;  4QIG A;  3TUJ C;  1R27 B;  3ELH A;  4IFV B;  2B4V A;  3FRZ A;  4DV5 F;  1VBK A;  2H48 B;  1YKW A;  2F4F A;  2YH1 A;  3C15 B;  2HMI B;  1LW2 A;  4BCA A;  1CJU A;  4K0K F;  4I69 A;  5D0R A;  4P9S A;  1TUW A;  2HS0 A;  2OKQ A;  3GR1 A;  4G1I A;  4OI6 A;  1QAI A;  3HSD A;  3VZI A;  2D3O R;  1NSK L;  2L41 A;  3W8G A;  3Q8U A;  1M1G A;  5KFF A;  1GFW B;  1WOR A;  2C2R A;  4DQS A;  4A47 A;  1HHT P;  4FPR A;  1IUJ A;  2HGN A;  4Q0B A;  1U4B A;  2ZBC A;  2G0J A;  2E7W A;  4DJB A;  2CFX A;  2QYC A;  3HHL C;  4BHQ A;  2W8K A;  1RWM B;  3FGV A;  4MK7 A;  3GYX B;  2DNP A;  4QIW D;  3MDF A;  5KFU A;  1OYE A;  4I67 A;  3UD4 P;  4CTA A;  2DJW A;  4V19 X;  1RXO B;  2RH3 A;  4RR5 A;  3IMQ J;  2V8D A;  1LXJ A;  1X9W A;  1VFJ A;  3LA0 A;  1WC3 A;  3GSI A;  1ZAW A;  4YB6 A;  3TA1 A;  3M4X A;  4C0H A;  2IFX A;  1S1X B;  2G2Z A;  4ZPV R;  1V9O A;  2Q43 A;  3EYZ A;  2VPX B;  3ZZR A;  4AD6 A;  1RLD A;  2VHG A;  1IBM F;  4GVB A;  1TKZ B;  2H1Y A;  4ZPB A;  4XAK A;  2WVE A;  3HX9 A;  2LEB A;  2GVD A;  3ETO A;  4X66 F;  4OLO A;  1C0T A;  2J0Q D;  4JBC A;  4DV3 J;  2LA6 A;  3M8Q A;  3NGU A;  4B3T F;  1R89 A;  4CP5 A;  1JMT A;  2BUN A;  1KHW A;  1SQE A;  2CIM A;  1G3O A;  2DNZ A;  2BX6 A;  4B3R F;  2OSQ A;  1R8B A;  2AKW B;  2I6W A;  1FJE B;  4DV4 J;  4GKJ J;  3LP1 A;  4K4W A;  2E5G A;  4USU A;  3DOL B;  3U27 A;  3KG0 A;  2VKR A;  4ED1 A;  3SMZ A;  4M5L A;  3W2W A;  4EWT A;  3G8S A;  2KHD A;  3KYL A;  2HBQ B;  3C19 A;  2PFD A;  3G6E S;  1WOO A;  3W9H A;  1WEZ A;  3ENV A;  3SZ2 A;  3DRY A;  2WCX A;  4AL5 A;  2GHP A;  2GS8 A;  4CM2 A;  2PGC A;  1F9H A;  2GJ2 A;  3WIV A;  3GPA A;  4MMO A;  4Y6I A;  2DXF A;  1Y7P A;  2DEI A;  4TU8 A;  1OSC A;  3FMB A;  5J1E A;  1FX4 A;  4KT0 C;  3J7Z 5;  1XWL A;  5K14 B;  2W2O P;  2ZH6 A;  1QVF R;  2R7Q A;  2UU9 F;  4IFY B;  1TKX A;  5AXM A;  1OY8 A;  4K50 A;  4DPY A;  4GMK A;  3OVA A;  2XG8 A;  3BZQ A;  4FS1 A;  2VBY A;  1RTJ A;  5F8J A;  4QPT A;  1KQG B;  2DNN A;  2KDO A;  3ZZU A;  2Z2M A;  4C8N A;  3IWL A;  2QRR A;  3K5M A;  2OFG X;  3N4W A;  2EI5 A;  2GA7 A;  2H5E A;  5K8O A;  3WC0 A;  1L3T A;  3R7B B;  4OHY A;  1LW0 B;  4ZLP A;  2YKO A;  4RWX A;  3EM1 A;  1KN6 A;  1TVR A;  1BMQ B;  4PKD B;  1C0U A;  1SKS A;  2LEC A;  4URS A;  3UNG C;  4Y28 C;  2OEJ A;  4OV6 A;  2IA6 A;  4HAC B;  1GXL A;  1IKW A;  2W7P A;  3AY0 A;  2RT3 A;  3KDN A;  2OD6 A;  4ED5 A;  1L3K A;  3I0R B;  1Q81 T;  1REG X;  2LVW A;  1S0O A;  2ZKT A;  3JSR A;  2BEF A;  3CMQ A;  1NDP A;  3LOU A;  1N5Y B;  1D8Y A;  2XS7 A;  2FY8 A;  3FJ2 A;  4LF2 A;  4OZN A;  2MQ8 A;  2F8M A;  2MB0 B;  3CJS A;  3M05 A;  1SIW B;  4KGK A;  4DS4 A;  2YNH A;  2QFI A;  1HKA A;  2B7B B;  2EC0 A;  1NJX A;  3M1V B;  4G1Q A;  4XO0 A;  2G13 A;  4ER8 A;  4FXD A;  5E0O A;  3R7S B;  4MK8 A;  1X5S A;  4KFB B;  4LF8 J;  5IT9 U;  5C42 A;  1P9Q C;  2F65 A;  5DM6 Q;  2IPO B;  2JSX A;  2W2Q P;  1GNK A;  1SKR A;  5L39 A;  3EXC X;  2D3O 1;  1N36 F;  2PEB A;  3QMQ A;  2CKW A;  1CEZ A;  3I96 A;  1RT3 B;  2HKE A;  1I1G A;  3QIP A;  1HNI A;  4F7V A;  3HHN B;  4HR2 A;  2HHH J;  4QU6 A;  1FNX H;  4R8U A;  2ZZT A;  1W7W A;  4EMD A;  2C2D A;  3WIU A;  4X2B A;  1TU0 B;  1HQU A;  2CJY B;  3SXL A;  3QNW B;  2F4V J;  2QIF A;  3Q22 A;  2HWT A;  1HD0 A;  5EHH A;  4NZ0 A;  2OPR A;  4IH7 A;  4FF3 A;  3UFC X;  2JLE A;  5DG8 A;  5KFO A;  3EIC A;  1E6Y A;  2A2D A;  1HWL A;  3MM5 A;  4Y2I A;  1RTZ A;  2BQR A;  4K4V A;  5KFX A;  1I6J A;  2VJU A;  1NND A;  2UP1 A;  2GMJ A;  2HVD A;  4Q8E A;  2Q1L A;  2P8I A;  2FC8 A;  1ZPV A;  4R0J A;  1JJC B;  2A10 A;  5HAN A;  3IM9 A;  4M5D B;  3IC1 A;  3LO3 A;  1V6H A;  3EVO A;  1RCO B;  4FBT A;  3R7N B;  1TMJ A;  1RT2 B;  4FP9 A;  4NLD A;  3HVT B;  3HK2 A;  1AFI A;  3NBP A;  2W2M P;  4ZS6 A;  1PYT A;  5EGY A;  2KG1 A;  5DGA A;  2RU9 A;  3B4D A;  2ZJR Q;  4ZVP B;  1IM4 A;  2HZC A;  2ZVS A;  1RBO B;  4FN5 A;  1VBZ A;  3N5B A;  5HLF B;  1YJW S;  4HTJ A;  2K06 A;  1P9Y A;  2FVS A;  1JNZ B;  2PI5 A;  2DKO B;  5DDR C;  2HBR B;  2I5J B;  3KK2 A;  2RF2 B;  1S57 A;  4WF9 Q;  3CJ2 A;  2CPE A;  3J80 Y;  1FNM A;  3R5C A;  1ZZF A;  4IG3 B;  2DR9 A;  1HIY A;  2DNQ A;  2HWH A;  3M6V A;  3T9N A;  2ZHB A;  4O4G A;  4KTQ A;  4KY3 A;  4F04 B;  1P27 B;  4EYI B;  3QJL A;  2LCW A;  3KXD A;  2WON B;  4ZVR B;  2DR6 A;  4DQP A;  3V4I A;  4DLE A;  4WTY A;  4C3M A;  4C7Q A;  4DCP B;  1JLQ B;  2CNN B;  1PIE A;  1FRK A;  1FDB A;  3ISN C;  3QGH A;  2ADB A;  2MY8 A;  5DG7 A;  1LWC B;  1HBO B;  3BYP A;  2HMI A;  3RR8 A;  1UET A;  3UVJ B;  5U47 A;  2PI4 A;  2MZQ A;  2Z2L A;  4LF6 F;  4OQJ A;  4CT8 A;  4N76 A;  2GML A;  4DV0 F;  1T95 A;  3K17 A;  2OEM A;  1FTC A;  3E8O A;  1CJV B;  3R5J B;  1Y4Z B;  3U1N A;  3GCW P;  1WF0 A;  4HH1 A;  1XIQ A;  2IIH A;  2PSZ A;  1GQE A;  2NXN A;  4ZDN A;  3BDE A;  2A3J A;  4DUZ F;  1R0A B;  4F67 A;  3R2C J;  2JOQ A;  1KLM B;  3G9C A;  4UQT A;  2KZZ A;  3MM7 B;  1NPK A;  2RD5 C;  2AYE A;  2NXE A;  2ILZ A;  3B6B A;  1UMJ A;  1WD6 A;  2C3P A;  1U1M A;  2R7R A;  1QSY A;  1AA1 B;  1UZH A;  4A4J A;  2HK3 A;  4IOB A;  1YJN S;  1U0S A;  3OLB A;  2R3V A;  2G0I A;  1SKU B;  3C6U A;  4J9V A;  2KXN B;  3LP2 B;  3HSG A;  4WP9 A;  2X1B A;  2L08 A;  4M63 A;  3IAS 9;  3ZTS A;  1DQ9 A;  5IT0 A;  3VQT A;  2FVR A;  5KG2 A;  2UUB J;  3C46 A;  1N34 F;  5C24 B;  2YX4 A;  2ZIT A;  2AJ1 A;  1JK9 B;  1PBU A;  2F8H A;  4RUB A;  1JKH B;  2X51 A;  4JI0 F;  1B7F A;  8RUC A;  2F8E X;  1GMW D;  2KO1 A;  4DL2 A;  2FJB B;  2IY5 B;  4U8V A;  4JI2 F;  3QO9 B;  3M30 A;  2VBW A;  2N7Y A;  4J7C A;  4PZV A;  4IO1 A;  5KFK A;  1GX5 A;  3ILO A;  5KFW A;  2LEP A;  2CQD A;  4LR9 A;  5DG9 A;  5DDP C;  3QT5 A;  2R42 A;  3Q8Y A;  3PYF A;  3A8J A;  1NK5 A;  1OWX A;  4CNZ A;  4Y3C A;  2EXU A;  1B99 A;  4B9M A;  1C4C A;  3OR2 B;  1VBY A;  1S9F A;  1WC1 A;  4MH8 A;  1Q4R A;  4XDD A;  4OFZ A;  4P7T A;  3NS5 A;  4LFA J;  1UPM B;  1PG5 B;  1WF2 A;  3QZ8 A;  3H90 A;  3ZZZ A;  4BC7 A;  5KFZ A;  1QUV A;  1FRL A;  3KLV A;  3KK3 A;  1I3O B;  3OSN A;  1S59 A;  3BKU A;  2ASD A;  1VJQ A;  3V6J A;  5K14 A;  4IFY A;  1RT5 A;  5KFI A;  4FF1 A;  1SI9 A;  2WAQ D;  4NCG A;  5LOQ A;  2R7W A;  4DR7 J;  5HK4 A;  2ZHO A;  5GAH U;  2YPY A;  2R7X A;  2B8Q A;  2EKY A;  4EFA C;  2DGO A;  5GAG U;  4HHH A;  3H59 A;  4N5S A;  1S0M A;  1I5O B;  2E1R A;  2GAG C;  4DF8 A;  3MAA A;  2XMJ A;  4DPX A;  3AXM A;  5F8H A;  4LUB A;  3SV3 A;  4HYK A;  3K59 A;  2H9Z A;  2NXC A;  1M5K C;  1DY3 A;  1CUL B;  1DHM A;  3MOJ B;  2XHC A;  4NYZ A;  1YVF A;  5AJ3 F;  3FZ2 A;  1KVK A;  2MGZ B;  3PX6 A;  4ZMM A;  1WC4 A;  3OXG A;  5J1N A;  4HAC A;  2JEJ A;  4UST A;  4J91 A;  1IKY A;  2R7U A;  3I0R A;  4RW7 A;  3OTO F;  5B0G A;  3GCX P;  4OZJ A;  3K2Y A;  2AT1 B;  3H8Y A;  5D0E A;  2AW0 A;  5HL7 Q;  5E41 A;  2OEL A;  4A8M P;  2Q3P A;  4C0O C;  1F2H A;  4X4T A;  3I9Z A;  5H9F K;  2CQ1 A;  2YNG B;  4K5R A;  5DM7 Q;  2DHS A;  1IBL F;  3ADA C;  1H73 A;  4OJG A;  4K7Q A;  2UUA F;  2MKJ A;  4NAS A;  1KFD A;  2NPF A;  4NLR A;  2KG0 A;  3I9V 9;  1N88 A;  2VBX A;  2XMV A;  3HF5 A;  4JI7 J;  1IKX A;  2I1R A;  5IOL A;  1BD6 A;  3M1V A;  2HVE A;  5L9N A;  2HRU A;  3CED A;  2YNF B;  5KFP A;  1JWW A;  1XNR F;  1NDK A;  2E1M C;  1N33 F;  1RTI B;  2FUG 9;  4DV1 J;  2KT2 A;  4NLQ A;  3IO1 A;  1VQS A;  2ZUG A;  1TL1 A;  4RWW A;  1Z2Z A;  2VA2 A;  2ZH9 A;  3LAN A;  1VK3 A;  2W01 A;  3KK1 A;  3ZZT A;  4F3M A;  1LK7 A;  2MHE A;  5EX0 A;  3P5B P;  2O01 C;  3TRG A;  2Z30 B;  4X62 F;  3MEE B;  2JLG A;  3JSY A;  4CYU B;  3CCJ S;  2B0G A;  2B51 A;  3IG1 B;  4BWJ A;  5C7P A;  1ZBT A;  2EVZ A;  4WKR A;  2V9W A;  2G2O A;  1X4H A;  1D09 B;  2XNR A;  3OFG A;  1T11 A;  4MAK A;  2P9E A;  4X4S A;  2GW8 A;  4BS2 A;  4YDD B;  3VZH A;  1A0O B;  2DXE A;  4I2Q A;  3GU0 A;  1SH0 A;  3GFH A;  3KUG A;  1R31 A;  1FK9 B;  1H98 A;  1G6B A;  4J9M A;  1T03 B;  4DQQ A;  2J8S A;  2KYZ A;  3FMW A;  2BJ8 A;  4M5D A;  3GJQ B;  4QR1 A;  1RKJ A;  5J2Q A;  3UDL A;  1OY6 A;  3EXY A;  2MZT A;  5C25 A;  2LXI A;  2R8I A;  3JTO A;  2BQ3 A;  3DLK B;  4K4S A;  4YR0 A;  1RT2 A;  4LF7 J;  2DRA A;  2QGF B;  3W9I A;  1D1U A;  2Z0G A;  5L38 A;  3BO3 A;  3HVT A;  5SZT A;  2Y1L B;  2XC9 A;  4E0D A;  2RKI A;  4USJ C;  1SJ3 P;  8ATC B;  3GIM A;  3AOB A;  2KU7 A;  2RQ4 A;  3FDS A;  2G9O A;  5F8I A;  1X31 C;  2DY1 A;  2N7C A;  4C11 B;  1D0E A;  1MMN A;  1JLE A;  4F2R A;  4X64 F;  5D4P A;  2AJ2 A;  2DRD A;  4MK9 A;  1IM6 A;  1S49 A;  2AJQ A;  2FGO A;  3FEZ A;  4ZVE A;  3ILI A;  3FKB A;  4M5J A;  2UUC F;  4IRK A;  2Q66 A;  1UPP A;  3L7P A;  1WHY A;  3SYZ A;  4ANE A;  1H74 A;  1PC5 A;  4RNN A;  3T41 A;  3KMQ A;  1GMU A;  3T3F A;  1RWN B;  2CPH A;  4PG4 A;  2ZKU A;  1VIX A;  2LQ9 A;  1JLQ A;  2E5J A;  4Q43 A;  1S7H A;  2VFU A;  2HG4 A;  3PR4 A;  2XLJ A;  4NEZ A;  2V63 A;  3PRV A;  1H7W A;  1LOU A;  3DLH A;  3D5M A;  2JVR A;  4Y2K A;  3BGL A;  1ZAV A;  3W8P A;  2BA9 A;  3LPE A;  5DZ7 A;  3S01 A;  3LGN A;  1XK8 A;  5ETQ A;  4LBH A;  2BAN A;  5F8M A;  3DRX A;  3MM6 B;  1OQ3 A;  4I4B A;  2DHH A;  3ET6 B;  3ISZ A;  2ZH8 A;  2Q6B A;  4DQI A;  1JLF B;  5DJB A;  2N3L A;  2BE2 B;  2MJN A;  4UOG A;  4A8F A;  2O3D A;  3G96 A;  2MDA A;  3QBC A;  1KSP A;  3PW5 A;  3C14 B;  4DN9 A;  3C16 B;  1I94 F;  3KHL A;  2GQ2 A;  1KLM A;  1KTV A;  1T9Y A;  3MM7 A;  2FJV A;  4NXM J;  1SC3 B;  1EAR A;  2MTL A;  3WDO A;  4DL4 A;  1S77 D;  1WG1 A;  4NI2 B;  3TJ9 A;  3ZXW A;  1HWU A;  1RU1 A;  4B02 A;  1FRJ A;  5IT4 A;  3E01 B;  1REV B;  4OJ3 A;  2B4P A;  3FCH A;  4LF9 F;  4B9U A;  3DHW C;  2VOD A;  3BSA A;  4AE5 A;  1YRT A;  1NXI A;  4WK1 A;  3LGH A;  2AYG A;  4KGZ B;  3QID A;  4KH0 B;  1VHI A;  4FVC A;  1K1Q A;  5CZX A;  1G7C B;  3TX8 A;  4CH7 A;  1X4F A;  1NB7 A;  3CCR S;  3LP2 A;  4U9R A;  1RT1 B;  1KWM A;  1XER A;  1E6V B;  3MTK A;  1VRT A;  1FJG J;  2GIR A;  1IR0 A;  4ID8 A;  2V0N A;  2KFN A;  4C98 A;  2BXJ A;  5LMU F;  5KFT A;  2OPS B;  1NB2 A;  4CO1 A;  4URG A;  4ELT A;  3T1Y J;  1KFS A;  1UWB B;  2OLW A;  3EDQ B;  3POT A;  4P73 A;  2E29 A;  5CAB A;  1NSP A;  4I64 A;  2VQE F;  2CZ9 A;  4F8R A;  1JKH A;  3J7Z T;  2C3O A;  3BQ2 A;  2NLW A;  3LAM A;  4ZA1 A;  4ZVS B;  4ILR A;  3EZ5 A;  3HVW A;  5CHC B;  4ZLJ A;  2CVI A;  2EFV A;  1TL4 A;  2LP4 A;  2QL5 B;  1RYR A;  3QO9 A;  2W9C A;  2DGT A;  3G86 A;  2XZW A;  3QT6 A;  5G0R A;  1PJ6 A;  2HPU A;  2CQ2 A;  3U1M A;  3Q8P B;  5A0Y B;  2OJ3 A;  3QPI A;  3W7B A;  4M1K A;  4RKU C;  5KG1 A;  3D67 A;  2OSR A;  1YK9 A;  3NGT A;  5HQL A;  3V81 B;  4P10 A;  3HLU A;  3EX7 B;  1Y5L B;  4OLP A;  2B56 A;  1RAE B;  4RW6 B;  1S1U A;  3OR2 A;  2C3U A;  1NJY A;  2W2N P;  3IR5 B;  5IQ6 A;  4JV2 A;  2NXJ A;  5KG4 A;  2W8L A;  1TQL A;  3RU0 A;  1RLC L;  3ZC4 A;  5HSP A;  3HT0 A;  1HBM B;  1RSC A;  3CB4 A;  4QWA A;  3IAM 9;  3BPS P;  2AEF A;  2DHX A;  1RT4 B;  3M2R B;  4I68 A;  1KNZ A;  1Q7L B;  5LXY A;  3H40 A;  1Q1K A;  4EEY A;  4CO2 A;  1BY9 A;  3VTI A;  1YSJ A;  4JYA F;  2V69 A;  1VQO S;  2XSJ B;  2C2M B;  2XMT A;  4OJ1 A;  5ETN A;  3Q8V A;  3UPF A;  4W90 B;  2Q79 A;  3NP5 A;  3T6J A;  1O6X A;  4PWW A;  4YB5 A;  2RJZ A;  1FFW B;  1HLW A;  4CM0 A;  3VCD A;  4B3S F;  3D7S B;  5L1K A;  3PR5 B;  2M5Y A;  4ID5 B;  3QSI A;  4NLW A;  2AX1 A;  4HVZ A;  5HQM A;  1V5I B;  2UXD J;  1NSA A;  2KZM A;  4PG5 A;  1CUL A;  3GE9 A;  2VB6 A;  3DYA A;  2J9C A;  3OTD A;  4EBC A;  1TV6 B;  2VKZ G;  3OFH A;  3HVR A;  4X65 J;  5CZV A;  5IXU A;  1L3S A;  2ZH1 A;  1X0P A;  3L9Z A;  3MMC B;  3CCV S;  5KFA A;  3TJ8 A;  3ZNU A;  4ZKA A;  2Q6C A;  3EE3 A;  2OO4 A;  4FNH A;  4JI3 J;  2NRE A;  1P8G A;  5B0F A;  3E2E A;  2XLK A;  4IR9 A;  3VHQ A;  1NPR A;  5DET A;  3MAH A;  3A1Y G;  2XMU A;  3BDP A;  2YX1 A;  3HI9 A;  3MFI A;  4IH5 A;  2ZJQ Q;  3OQ2 A;  3P4U B;  3H2L A;  1I51 B;  4DV3 F;  4UQG A;  1F3V A;  4QYZ K;  4B3O B;  1T0T V;  4IQM A;  5CYM A;  3FK4 A;  2MSS A;  1VC6 A;  3ONQ A;  5K8N A;  1MU2 A;  2MLX A;  3SCK E;  3UWT A;  1QSS A;  2YNF A;  4C0B A;  5IZH A;  1G4C A;  1RTI A;  1YZ7 A;  2LQB A;  2NXU A;  2FHM A;  1JB0 C;  4XPE A;  1KOO A;  4DV4 F;  5HJX A;  4YHH J;  1UL3 A;  2LA4 A;  2UXB J;  1DJ0 A;  1X9M A;  1TK5 A;  4JI8 F;  1HA1 A;  3M2U B;  5F8N A;  1DTQ B;  4H4O A;  3IM8 A;  5LSR A;  4CYU A;  1KR4 A;  1X7V A;  3IG1 A;  3LUY A;  5FDL B;  5D6G A;  2CNL B;  2OD4 A;  4DU7 A;  4LFB J;  2HW3 A;  1JLG A;  4DL5 A;  1JJ2 R;  3C3L A;  2HFV A;  1SJ4 P;  3R8Y A;  2H54 B;  5B08 A;  1UWA A;  3EVW A;  2LQ8 A;  3OFE A;  2KXH A;  4D3H A;  2E9R X;  4ZPA A;  5KFY A;  2K1R B;  3QQC D;  1T03 A;  1ZA1 B;  5H1S V;  2BJD A;  5ETP A;  5EWG A;  1GEH A;  2PT0 A;  5GAD I;  2P9C A;  2PMZ D;  3R27 A;  5GVQ A;  4CQ1 A;  1OY9 A;  3CDU A;  3DRS B;  4LSN A;  2AMC B;  4CLS A;  4DV7 J;  2KM8 B;  3DM2 A;  1LWX A;  4RPF A;  3TP2 A;  1EQM A;  2B9X A;  2Y1I A;  3QRP A;  3B4M A;  3MUV P;  5T7L B;  4Y0F A;  1BWE A;  2R2R A;  3I0S B;  3KHR A;  2ASJ A;  4WZQ A;  5HP1 B;  3JXO A;  3M6W A;  1GH8 A;  2AD9 A;  3AJ2 A;  3KUE A;  1RI7 A;  3LGM A;  4LFC F;  4LSZ B;  5HBM B;  4TLR A;  3US5 A;  4OL8 A;  2YWF A;  2OPQ A;  3E3X A;  4NWB A;  3SCJ E;  2DNM A;  5MAO A;  5A8R B;  4NLV A;  3Q89 A;  1FKP B;  5DDO C;  4KGM A;  1JIH A;  2FZC B;  4O3P A;  4LJM A;  4USI A;  1YRU A;  1ELO A;  2OPP B;  2VJV A;  1KVJ A;  3F0N A;  4L6V 3;  4QPX A;  4PR6 A;  4L3N A;  3G6X A;  3QJP A;  3R2D J;  3BV8 A;  1N54 B;  1SJR A;  5K8M A;  3RW6 A;  1VQN S;  4DL7 A;  1N56 A;  3IRX B;  3CCQ S;  1HBU A;  3LP0 A;  1CJT B;  1HWJ A;  2Z2Y B;  1Q8I A;  3VQS A;  2HFS A;  1Q0N A;  1R8A A;  2CA9 A;  4LF8 F;  2QMU B;  3NNH A;  3PX0 A;  2VZ9 A;  1FJC A;  2IJN A;  4Y2C A;  4Q8F A;  3MR6 A;  3MM6 A;  3L4B C;  2HQI A;  2VDH A;  5IC6 B;  5ETO A;  4PAA A;  2KHC A;  5HMW A;  2J9E A;  2EPI A;  3G6Y A;  1RBL A;  3T5J A;  1FVQ A;  2BE2 A;  2YKM B;  2F4V F;  3TEH B;  2L9W A;  2HS4 A;  4W98 A;  3N6M A;  1O8B A;  3NOC A;  1MMD A;  1TUG B;  3DXB A;  2W9A A;  2QLW A;  3DLL Q;  3I82 A;  3EUN A;  5HMX A;  4LR7 A;  2LQ5 A;  3CJQ A;  4PXD A;  4YB1 P;  3NCP A;  3M2V B;  1FD2 A;  4LSL B;  5D78 A;  3PYE A;  4ES2 A;  2HHU A;  4NI2 A;  3SEO A;  3RBE A;  3C66 A;  5DS7 A;  1K1S A;  2IMW P;  3E01 A;  4CH0 S;  1REV A;  2MLY A;  1S1V B;  3VAG A;  4K5S A;  1K8A T;  3THP A;  2RAQ A;  4ETX A;  1X4C A;  5LMN J;  3CCU S;  4K4Z A;  1EQ0 A;  3V6D B;  3AB2 B;  2AJF E;  4LQ3 A;  4RL1 A;  3ZZO A;  4AT1 B;  3MEG B;  4BLG A;  1YGY A;  1U26 A;  1FWP A;  3AD9 C;  1VMB A;  4PAB A;  1E6V A;  4I1T A;  1T8E A;  3NWG A;  4OHV A;  2DGQ A;  3BQ0 A;  2BMB A;  2CPY A;  1N5Q A;  2BR0 A;  9ATC B;  4KE5 A;  1IBC B;  3WZ0 A;  1RAC B;  4QQB A;  1GX6 A;  3K5N A;  3IFE A;  3D0I E;  1J27 A;  3ISN D;  3CD0 A;  1S97 A;  2CZV C;  4HDG A;  2MST A;  4QWB A;  2XQC A;  4QZV B;  2OH2 A;  2MMY A;  4MT1 A;  1UVN A;  1VHF A;  3MAQ A;  4LRB A;  2HHV A;  2QZ8 A;  5CCL A;  2XB2 D;  1B4S A; 
#chains in the Genus database with same CATH homology
 1WKJ A;  1WKL A;  1LWX A;  3EIC A;  1NDP A;  4UOF A;  2ZUA A;  1S57 A;  3VVT A;  1XIQ A;  4C6A A;  3NGU A;  1NUE A;  4CP5 A;  3BBC A;  4O0N A;  3L7U A;  5C7P A;  3FC9 A;  1MN7 A;  1NSQ A;  2AZ1 A;  3FBC A;  1BUX A;  3EMT A;  1PKU A;  1EHW A;  3B54 A;  4F36 A;  1HIY A;  2CWK A;  3EVM A;  2BX6 A;  1S59 A;  3BBF A;  3FBB A;  1NCL A;  2HVD A;  4WBF A;  3BBB A;  3JS9 A;  1K44 A;  3NGS A;  4DUT A;  1NB2 A;  4UOG A;  1NPK A;  3ELH A;  3FBE A;  2AZ3 A;  3ETM A;  2DXD A;  4F4A A;  3EVO A;  1KDN A;  4AND A;  1BE4 A;  3EE3 A;  2HUR A;  5BXI A;  4ENO A;  1LEO A;  4FKY A;  1XQI A;  2DXE A;  1NDL A;  3B6B A;  5CAB A;  2B8Q A;  1NSP A;  1S5Z A;  3MPD A;  2B8P A;  1MN9 A;  3FKB A;  3VGU A;  4S0M A;  3VGT A;  1BHN A;  2DYA A;  3Q86 A;  3ZTR A;  2VU5 A;  4UOH A;  3EM1 A;  3VGS A;  3WX8 A;  3GP9 A;  4FKX A;  5IOL A;  3Q89 A;  4ANC A;  3R9L A;  2HVE A;  1NHK L;  3EJM A;  3G2X A;  4W98 A;  3BH7 B;  3DDI A;  3EVW A;  3Q8V A;  1NDK A;  4KPC A;  3VGV A;  3Q8Y A;  4ANE A;  4DZ6 A;  1F3F A;  1JXV A;  1NSK L;  3DKD A;  1U8W A;  1PAE X;  1NLK L;  3BH6 B;  3NGR A;  3Q8U A;  2DY9 A;  4HR2 A;  1WKK A;  1B99 A;  1HLW A;  3PJ9 A;  1W7W A;  1HHQ A;  3GPA A;  3ZTQ A;  3FCW A;  4EK2 A;  2DXF A;  3FBF A;  4DI6 A;  3FCV A;  1NDC A;  5CAA A;  3PRV A;  1UCN A;  3ENA A;  1ZS6 A;  1F6T A;  1VYA A;  3ZTS A;  3VVU A;  2NCK L;  2BEF A;  3NGT A;  3Q83 A;  3ZTO A;  1B4S A;  3ZTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...