2ZUAA

Crystal structure of nucleoside diphosphate kinase from haloarcula quadrata
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
153
Chain Sequence
SEHERTFVMVKPDGVQRGLIGDIVSRFEDRGLKMVGGKFMQIDQELAEEHYGEHEDKPFFDGLVDFITSGPVFAMVWEGQDATRQVRTMMGETDPAESAPGTIRGDYGLDLGRNVIHGSDHEDEGANEREIELFFDEDELVDWDQIDSSWLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Molecular mechanism of distinct salt-dependent enzyme activity of two halophilic nucleoside diphosphate kinases
pubmed doi rcsb
source organism Haloarcula quadrata
total genus 43
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2zuaA00
3FCWA 1B99A 2DY9A 3EJMA 1VYAA 1NDPA 1KDNA 1NB2A 2B8PA 3BBBA 1NDKA 1NSQA 3VVTA 3PRVA 4ANCA 3EVWA 5CABA 3FBFA 3EE3A 1JXVA 4ENOA 3Q8UA 4FKYA 1S59A 1F3FA 1S5ZA 3DDIA 1K44A 4DZ6A 1LWXA 3NGSA 3VGSA 4ANEA 1BHNA 3ZTOA 1MN7A 4UOHA 4F4AA 1UCNA 3B6BA 1XIQA 3VGTA 2CWKA 3L7UA 3MPDA 3Q8YA 1BE4A 1PKUA 3NGUA 2DXDA 2AZ3A 1NDLA 4UOGA 1XQIA 1WKKA 3VGVA 2DXEA 3GPAA 4WBFA 1S57A 3PJ9A 3JS9A 2BEFA 4DUTA 5C7PA 2HURA 1WKJA 1PAEX 2HVEA 2ZUAA 4FKXA 3G2XA 3ENAA 3WX8A 3ZTSA 2NCKL 5CAAA 3DKDA 1B4SA 1LEOA 3ZTPA 3EVMA 1HIYA 3EVOA 1EHWA 2B8QA 1NSPA 3EM1A 3Q8VA 3Q89A 3B54A 1NHKL 5IOLA 1MN9A 3FBCA 2AZ1A 3EMTA 3FCVA 1U8WA 3ETMA 1HLWA 3NGTA 4ANDA 2DYAA 3VGUA 4CP5A 1F6TA 3VVUA 1BUXA 1NUEA 3GP9A 1HHQA 3Q83A 5BXIA 1WKLA 3BH6B 1NDCA 1NSKL 2BX6A 4S0MA 3FKBA 3FC9A 3EICA 3NGRA 3Q86A 4EK2A 2VU5A 4UOFA 1NPKA 3BBFA 1ZS6A 3BH7B 3ZTQA 2HVDA 4C6AA 1NLKL 1NCLA 4O0NA 4KPCA 4F36A 3FBBA 3ELHA 3ZTRA 2DXFA 3BBCA 4HR2A 4DI6A 3R9LA 1W7WA 4W98A 3FBEA
chains in the Genus database with same CATH superfamily
4I2QB 4HACB 4EYIB 3FEZA 3KG4A 3BO4A 2CJYB 1UVLA 3FFIA 5A8KA 1QSSA 4A8KA 1UETA 3QT8A 5A8RB 2DNKA 1U1NA 3ZTOA 1LXNA 2IM1A 4C8NA 3ZNUA 4NL5A 5CQGA 1BE4A 2R2SA 1X5TA 1LW0A 4U9RA 4ED8A 4RWWA 1UVMA 3BQ2A 2EFOA 1H2TZ 3HHLD 2HKEA 1RTIB 4ED2A 2J6TA 1S6QB 2GZOA 4PPZA 2LXFA 1TR0A 4C8ZA 3LP0B 3OL7A 3F44A 5K8PA 4CT9A 1Q81T 1RT1A 5F8HA 5M2UA 2ZH4A 4F25A 1WNEA 4O4GA 2R8JA 4TU8A 4WKRA 3H20A 3SQGB 1AUSL 1WTFA 5B09A 2AX0A 4L3NA 2DNGA 4BWJA 1PYOB 5A2QU 3MUTP 4FP9A 3EICA 4B3SF 3QSYB 3X3UA 4MIBA 2DR7A 3VAHA 5KG5A 1OJ4A 2G9OA 3T1HJ 1D9AA 4DJBA 1Y5IB 1SUQA 1B7YB 1XBWA 2JLGA 1NB2A 1IJFB 1G6BA 1HQUB 1PO6A 1AW0A 2BJ7A 3DYAA 4CH1A 4E8UA 3WHIA 1U6FA 5D0EA 3OFHA 2YY3A 1UTAA 2CG8A 3ZZRA 1XQIA 3ZC4A 3P3DA 4HEA9 4TYBA 2CWXA 3CCJS 4FVCA 3TEHB 2C3PA 2HWIA 2LDYA 4R0JA 1HNIA 3R5CA 2GW8A 3CJQA 2ZH7A 1NU4A 3B8HA 3J7ZT 1B4SA 2DGSA 1IBLF 1S1TA 2KG1A 2G0CA 3NXZA 4PKDB 1S1VA 5IS2A 2C2DA 1L3TA 2FGCA 2FC9A 4GVLA 2FLNA 3QIDA 3OTDA 3K8WA 4F7VA 1OYDA 4C3MA 3WIUA 1CSJA 2BX6A 3OR1B 3DMJB 3V6KA 3OTOF 2E7WA 4NZ7A 3HMJG 2A0FB 3KLGB 3PW0A 3ZZPA 5KT2A 3G6XA 1DZ5A 4N76A 2FQQB 2E5IA 1UPMB 1S1UB 1N8RT 5IFMA 1R0AB 4FYDA 2ZHOA 3LA0A 4EO8A 3IXQA 4MKAA 2E44A 5IV3A 2CQHA 1S5ZA 2MDAA 3I32A 4DL6A 1TMJA 2DGOA 2J9DA 2PFFB 2YKPA 4JI1J 5FDLB 4B9TA 5HSPA 5BYQA 1QAIA 3QRPA 4DU8A 2EKNA 4OJ3A 1KP6A 1TKDA 4OV1A 4DV0J 2Q43A 2UUCJ 1GAOA 4W92B 2IRYA 2KL8A 1L3UA 1J27A 1Q1KA 4PCQA 1VQLS 3MXHP 1HNVA 3A4TA 4F4ZA 4ZCIA 3CTRA 3KTQA 1NK4A 1RISA 2XTJP 2LEPA 4OX6A 5EN1A 1IKWA 2IM2A 1J5OA 1V3ZA 2HBZB 3KG1A 1QE1A 5ETTA 1CJKB 2VJVA 3K89A 1NO8A 3EJMA 3M8SA 1C0TB 5LT5A 5HQMA 5KFOA 1RT5B 4A8SA 1HBUA 1UFKA 3RBEA 2JVOA 3NRBA 2WVEA 3H5SA 1HYSB 2GFFA 3RB6A 3S7RA 2KN4A 1VBYA 1TZ0A 2EVZA 2ZBPA 2HRYA 3QPIA 5KFDA 4LR8A 4NMXA 2DGUA 1Q95G 1RHUB 3JAMU 2IM3A 4NLWA 5HL7Q 5HQ8A 4B3TJ 1S9FA 4NE9C 1IBMJ 3KK2A 1SQGA 2MQPA 3ZTPA 2E29A 2RS8A 1G2EA 4B9VA 1MN9A 2CPXA 4K5SA 2Z56B 3CUNA 2KI2A 4DR3J 1HFEL 2CRLA 4UTGA 3UCZP 3Q86A 2BRKA 4MJKA 2W7OA 1UEKA 1IJEB 4OJHA 4IOCQ 1VBZA 3M8PB 1S1XA 1FRMA 2WBRA 4ECVA 3TVYA 4DV5J 2HWTA 5B0FA 1SH2A 3LP1B 3MM8A 1M5OC 2IDEA 1ZYQA 3QYYA 1HWLA 1GQEA 1SC1B 2HIYA 2CYYA 3JYTB 2PD1A 1OQ3A 4NLRA 1RT3A 2MZSA 3H42A 3CNQP 1ZAXA 2F8EX 1IWGA 2GAGC 3M6WA 4WFXA 1SCJB 2D7SA 1CS4A 3AJ2A 3I9ZA 3OD2A 1EX8A 1YJRA 1VC6A 1Q5YA 1NKBA 3DLEB 3W3SA 3TA0A 4ZA1A 3AA9A 1H74A 1YX2A 2BR0A 1AZSA 4C8KA 4XTTA 1WI8A 2GA7A 2V68A 3GLJA 2W2QP 3R97A 4DL2A 2J7KA 2M9KA 1S0NA 4ZDNA 3E8OA 3THPA 1LKZA 5EX3A 3J81j 3TA1A 1YJ9S 4O0NA 2VONA 4FPIA 3HCXA 4DLGA 3OHAA 1DY3A 3T9ZA 1ROFA 1F60B 4Y2AA 1FD2A 2ERRA 1KRPA 4F3OA 5LL6d 1EARA 5ETKA 3L09A 1C1BB 3J7A1 3D3CJ 2QA4G 1HWUA 3B82A 5RUBA 4DR2J 3ULHA 3HLUA 3PJ9A 4LF4J 4JOUA 2YKMA 2CQ1A 1VS3A 1W25A 5CYQB 1SI9A 4DPTA 4WFAQ 4ZP8A 4KSEB 3PW7A 4EU0A 1RHJB 3GU0A 3LAMA 2FY1A 2KZZA 4M8LA 1J2VA 3HT0A 2HGMA 1OPIA 4PUOA 5HQLA 2WW4A 3E3XA 2UUCF 1KLMA 2X7IA 2XY5A 2E9ZA 1NKEA 1O6XA 2V4RA 1D09B 2VOPA 4F67A 3W64A 2LKZA 2UXCJ 3PCOB 4C0HA 1Y7PA 5GMKa 5LMNJ 1ZOTA 1N34J 3QGGA 1FXRA 2CPEA 4LRFA 3E51A 5E33A 3VAJA 4K4ZA 5I3QA 3AB4B 4DV3F 2AJ1A 4N7TA 1WG4A 3BPDA 3C16A 2A6OA 1T9TA 2UXBF 3NEKA 1MN7A 1GX6A 4WP9A 4NZ6A 3KLHA 3IFEA 1K0VA 4NCGA 1XNQF 3I9V9 3KK1A 3VQTA 2AGOA 5E0OA 4QOTA 2YWHA 3VZIA 1RTZA 2IA0A 1BQMA 2PT0A 1CQNA 2LQ8A 4DZDA 4HLBA 2HNDA 5BYSA 1KTQA 1V5IB 1KQGB 1T95A 2AGPA 4I2QA 4DS5A 1OWXA 1TKZB 4E0DA 3GFHA 4YMEA 4HACA 4NRTA 2AQ4A 5A76A 2CPYA 3V6JA 3N0VA 3VAIA 2LCWA 1IBMF 3DDNA 1BWVA 5A8RA 2C2OB 3MM7B 4TYAA 1VQ8S 2D41A 1GXLA 4CCHA 2QMWA 1Z4UA 1Q82T 3I82A 3DRXA 3VR1A 3QQCD 3J7YI 4X4PA 2NQPA 3HHDA 1JB0C 1RTIA 3MAHA 1T9XA 3SDEB 3GCXP 2EK1A 1S6QA 4OQJA 4OZJA 2DR8A 1FA0A 3K5OA 3PVXA 1RTHB 1FTCA 2X3GA 3T9NA 3LP0A 5DG9A 1UJ4A 4DZ6A 4ZVUB 4DV5F 5HAOA 4I67A 2VBXA 3SQGA 1S0OA 4C8MA 3S1TA 1YJNS 2QSFA 3PTWA 1QAJA 4FVMA 4P6QA 2OD4A 2Z8QA 4YDXA 2JFKA 1N88A 2Y1IA 2DNZA 3UO0A 3DGVA 4USVA 2YX1A 2XWYA 4CO1A 3GG1A 3RG6A 1HI0P 1NRKA 1HQUA 3TJAA 2N4DA 4YR3A 1ZA2B 1R8HA 3C3LA 5J2MB 2F8MA 2FZKB 3THVA 2DTJA 2K3KA 4DPYA 2QIFA 4F4KA 2VU5A 1U1OA 3HFVA 4IFYB 2MY8A 1TKXB 1DARA 5I3PA 4UQTA 1ZM2A 1KVKA 3FCHA 1EKSA 3HT3A 3BSOA 2C28A 2BQRA 5DM7Q 4DR5F 5LXYA 4AL7A 4P71A 4I2PB 2VDIA 4FYYB 4PXBA 5KFPA 3H5YA 1K44A 2HNZB 4L6V3 1HWKA 1AROP 2LA4A 2ZBIA 5C2CA 5KOWA 1A0OB 3PYDA 4NA2A 4DL0C 4HHJA 1XNRF 3MPUB 2FY8A 4M1KA 5CH7B 3OR1A 3DMJA 1Y5LB 3M1VB 3D2WA 1RDRA 1TK0A 3V6HA 1B0VA 2ZBCA 3GWCA 3KLGA 1DAXA 4ZHRB 4AXJA 1LEOA 3CD6S 4K8RA 1S76D 3CW2C 3MTJA 1S1UA 5ETMA 2MB0B 4LF4F 2VG5B 4DCOB 2XBPA 2AYBA 4DF8A 2APOA 1FCAA 2Y0SD 2Z0GA 4UF4A 5FDLA 3POTB 3RUBL 3TVZA 2NXJA 2CFXA 1D3WA 4KHRA 4JI0F 5GAEI 4P74A 2E9TA 2OSQA 3DU6A 3PR5B 5CCLA 3UDLA 1RACB 4NLYA 5LMNF 3OTEA 1I5OB 4LF7F 2IMWP 4XPEA 4EEYA 4DPUA 4OHZA 2AJQA 1VRQC 4QIVA 4AD6A 4B9NA 3NCRA 4A47A 1O0PA 1R6VA 5C5JA 4K4VA 1CJKA 1FXLA 1VDHA 1WOOA 3N28A 3NNAA 1C0TA 1SXLA 1RT5A 5IQQA 1TP7A 1X4HA 4ER8A 3W65A 4IH6A 1NUEA 4KHPJ 3G9CA 1HYSA 1LWFB 1ZZNA 1WWHA 4IRKA 1RKIA 2D69A 4JI7F 2QC3A 2QYGA 3QWUA 3MCSA 5GMEA 3D66A 4F3QA 4UY8T 2FLPA 2RUSA 3V4MA 1VYAA 4NA3A 2QO3A 3P8BB 2VHGA 1WACA 4PXDA 2V9KA 1Q78A 3WBZA 2O3DA 4HHHA 3ZZOA 3OHBA 3CJ2A 1TU0B 5KG4A 2BZ2A 1P1TA 4Z2XA 3CCRS 1GH8A 2GAHC 2GVDB 2POKA 3J81U 2A10A 3TOQA 5D3GB 3M6XA 5CYMB 4CO5A 1JNZB 1Y5NB 3H5UA 1Q86T 1SKUB 2JEGA 2ROEA 1VI7A 3IWLA 3BYRA 3M8PA 1T8EA 2MKCA 5E3RA 4AL6A 3RW6A 3GB0A 3HJFA 2KM8C 3LP1A 4DV1F 5DLFA 2EFQA 3ISNC 3DRSB 1WHXA 5KFZA 4ERDA 2VQEJ 3IP0A 2YH1A 3JYTA 2HVIA 4UW2A 2FLOA 2FVCA 3NAIA 4M5KA 1JLEB 1SIWB 3MURP 4Q0BB 8ATCB 4XIUA 1UEVA 5A6WA 3QRRA 1HL6A 4A8OA 2XM3A 3ENWA 3PRVA 1VLOA 3MCMA 2K1RB 3O8WA 3AB2B 3PO5A 4OMFG 3DLEA 5GVQA 2KU7A 1U09A 3CWJA 4KT0C 5L9NA 1LOUA 2HZVA 1SL1A 1N4LA 1KN6A 1F5BA 2BRLA 3T6JA 3ZNJ1 2A2CA 2JC1A 4OX8A 1LWCB 3EGZA 2DD8S 1UL3A 4MYUA 2GHWA 1IKXB 2CQPA 3EZ5A 4X65J 3A12A 3H2VE 1GX5A 3HO1A 3U1LA 2EG1A 4DFPA 4JI5J 1C1BA 1YTYA 4A4JA 2MZRA 4EBEA 1MROB 2RF2B 1JWWA 3J7YU 5D0GA 3NAHA 1J5EF 4NLOA 4YEAA 3BGLA 1VK3A 2YNGB 4QU6A 1M1HA 4ED0A 2XO6A 2WSFC 3K17A 4DL7A 2CJAA 4ECWA 4FZVA 5CYQA 2XG8A 5FIIA 4PG8A 5BR8J 2H4WB 4YHHF 1URRA 3J80U 1N52B 1CG2A 2FHJD 5K8OA 2PN6A 2VPYB 1O51A 1IR2A 3FEYB 1QUVA 1OY6A 1G3OA 4NEZA 4WF9Q 3ZO7A 2QE5A 1SL0A 3MFHA 1WKJA 2K7KA 1SC4B 3CCQS 1UW4A 2ZJPQ 2PO4A 3NMAA 1RLDA 2FZGB 2RRBA 4I6WA 3PHTA 1DTQB 5KFCA 2MPUA 3M32B 4J9QA 5ETOA 5DZ7A 3HVWA 4CP5A 5HP1B 1HHQA 2X51A 2DEIA 4KH1B 3NS5A 3UPFA 2E1AA 3BGRB 2D3O1 2K2PA 5B0AA 2CA9A 2KVQE 1N0VC 4Q7AA 3IO1A 3JQJA 1WDDA 4HTJA 3FK4A 1FEEA 3BPSP 3A8EA 5KT4A 2LQJA 1M5PC 1GK8A 4ZLNA 2A3JA 2C3YA 4DQRA 4G3IA 1TKZA 1RSCA 3CD0A 4KYZA 4QIFA 5DM6Q 4KC5A 2VOOA 3A1YG 1U49A 1T9UA 3FZBA 2NREA 3IBCB 3MM7A 4Y28C 3MMAB 4V1Ak 3A3OB 4QPXA 2DR9A 3W9HA 4RWXA 4NCBA 3JTPA 4Z7CA 4RNNA 3MM6B 2V2ZA 4QR1A 3SDEA 3L95X 3TZYA 4MT1A 1ELOA 3CF5Q 3NGTA 4W4MA 1NJIT 2V4JB 1K0TA 1RTHA 2CNLB 5IWAJ 2LLZA 1PJ7A 4ZMMA 3I4HX 4X66J 2K3IA 4RNHA 2JSXA 2EC2A 1HBOB 2E1CA 5GADI 1RAOA 4OYBA 2KXFA 2OPRB 4HI2A 4LF9F 1W7WA 4WXWA 3R7BB 2EEYA 1NDKA 1FRLA 5KFAA 3BN7A 1VQ9S 4Y34A 2R2UA 1X0FA 1IR1A 5CZXA 1K8AT 4IO1A 2VFUA 2EFGA 2CWKA 4CO2A 4IH7A 3SCIE 2RDJA 1RYRA 2XULA 4PYAA 4C98A 3OQ2A 4HVZA 5J2MA 3MCNA 3HKZD 3BQ0A 1RAFB 2C3UA 2HK3A 4F8RA 4C0OC 2D3OR 2HS0A 4IFYA 5KOXA 4B9MA 1TKXA 4IQMA 2E7XA 3CC7S 3Q8VA 4L76A 2V6AA 1H38A 1UFWA 2V94A 4I2PA 1SB6A 1APSA 5IM0B 2HNZA 4K2JA 2HYIB 5DDQC 2V34A 4CO3A 4X2BA 4JI5F 1UVNA 3OTCA 3SSQA 2DK2A 3M1VA 1RWNB 1S99A 2LXUA 1KFSA 1UJ6A 4ZCKA 3CT9A 2EK6A 2BOAA 3AD9C 3VVTA 3T1YJ 1VLYA 1S7HA 5ETQA 4ZHRA 2OEJA 3M8ZA 4ED7A 5J2NB 1R27B 3MPVA 2VG5A 2Q66A 3KNAA 1YJVA 2DIUA 2WOMB 3K8VA 4TNOA 2BXJA 2ADBA 4KE5A 4GKJF 2N3OA 1DTTB 2XMTA 1SJ3P 2IVFB 2VF3A 3POTA 1HBNB 1WF1A 4DV4F 3AJ1A 1RWWB 2ZH3A 3TQ1A 4UY85 1JXLA 3CJRA 1HLWA 3T5LA 3W2VB 3RB3A 1LWEB 1FJEB 5GAHI 3WC2A 3NGRA 5K14B 1FKPB 2B7CB 3DFEA 5HVHA 1ZH5A 1SQFA 3BREA 2HQ3A 3RR8A 2HBQB 1B99A 2CJXB 1IBKF 4FS2A 1IM4A 4HH1A 3MEDB 2XYGB 4OYPA 3FDSA 3OXFA 1REVB 3CC4S 2OI2A 4DSKA 2ZE2B 4O3OA 1XMQF 3QGPA 2DCLA 2QMUB 1FNMA 3N5BA 1RKJA 1T05B 5HBMB 1NJWA 2D1CA 4CYUB 5KT3A 1LWFA 1YK9A 2MJUA 2W1BA 1X60A 4QIEA 1P9YA 3DRYA 2ZH6A 3CDUA 4OZNA 3SQOP 4DV7J 4JI4J 5I42B 5E5NA 1U24A 1JJCB 2V4QA 1E6VB 5DZ6A 3Q89A 3M9MB 2MZJA 1FXDA 2HNYB 3HP6A 1VHIA 4IQXA 4P2XA 2OPSA 3DC2A 5ETVA 2BACA 2VL1A 4NLUA 2OJ3A 2BJ9A 1YLXA 1VMBA 4M5IA 1SKSA 4DR6J 2J0XA 4F36A 1VQMS 2GVDA 3ISZA 4LSZB 1L5UA 5EUHA 5IWAF 1TK8A 5DG8A 2I38A 3L4BC 5D3GA 3QAUA 3DHWC 5CYMA 4C3KA 4KTQA 1S6PB 1WC6A 4ECRA 2WB4A 2ZM6F 1WOPA 1L3KA 3BGFA 3M2RB 3TUJC 2MQLA 5IZHA 3LANA 5LSRA 3I5CA 3LGHA 4F4AA 3GIJA 3DRSA 4OZ0A 2KHDA 2DNNA 1X0PA 1MU2B 4CTAB 3AQPA 2X3DA 1JLEA 1X4DA 3HHLB 4AXIA 4Q0BA 1RWXB 2HZCA 2C42A 3PJWA 2M8DB 5JVHQ 2R8KA 2V50A 1CULB 2OHDA 3PJXA 8RUCA 1HIYA 4NLPA 1U0SA 2IVYA 1GFWB 2M4MA 2K1RA 1XC9A 2QLFB 4IFVB 2ASDA 2DNYA 2YWWA 5B0CA 4OI2A 5E3QA 1IXKA 3W60A 1U25A 2B7BB 3RB4A 1AA1B 1LWCA 4DUTA 2DGVA 1IKXA 2QL5B 3K57A 3IWNC 4F04B 1ZA1B 1YJWS 2VPWB 4MKYA 1KNZA 3NWGA 5K9FA 1K9MT 2O67A 2BJ1A 1HHTP 1FJGJ 2XCPA 2ZDOA 3S01A 1XMBA 1JNRB 2BOPA 3UN5A 5J1EB 3A3NB 4PAAA 3VAGA 3HVTB 3OL6A 1LXJA 3MR7A 4Q2MA 1WDTA 1VQ4S 3HJVA 1CJVB 5DGAA 2YNGA 5C2GA 4IR9A 4FYWB 4WFZA 1S7IA 3CD5A 4ZPTR 3M30B 3T3FA 7FDRA 1QDUB 1UMJA 4A8QA 2CQ2A 4QR0A 3IWXA 4B9UA 4CH0S 3VHQA 1UEUA 4HDGA 2WVBA 3CJ3A 2ALYB 1UZHA 3ZTRA 3R9LA 1Z2ZA 5A6PA 2R2TA 3C14B 1QSYA 3DDKA 2VG6B 4O3QA 3OVBA 5D4PA 2E5GA 3FEXB 1NJZA 1PGZA 1CJTB 1RT2B 2HS3A 1DTQA 3L3CA 2Q6CA 4F2RA 2QL7B 2NPFA 3UNYA 4DQSA 4LF5J 4FYXB 3M32A 5EGYA 1Q8LA 1HNWF 2V8PA 3OV7A 3QT5A 3GG0A 5HP1A 1HD1A 1SV5B 2M8HA 5DLGA 3GYGA 1U02A 3KMQA 3BGRA 2V0NA 4O3PA 3C15B 4AFFA 2VBWA 4RBVA 4ZIWA 2FJVA 1FI4A 1NSPA 4KGVB 2ZD1B 5JXSA 2XEXA 3R5JB 4N47A 2Y3YA 4ANDA 3MD1A 4I7FA 1BGXT 2W24A 4LIWA 4C2MA 4DX8H 4GRSA 2HPUA 1MMLA 4FPRA 2YWGA 4X64J 2JNJA 3C6UB 3TARA 2FHKA 4QW9A 4OHWA 1NMEB 1BD6A 4X4TA 5KFWA 3HSJA 2F4VJ 2MYFA 1MWZA 3MMAA 2XY7A 4WU2A 2KZMA 1PC4A 3SSSA 4DG1B 1T7PA 2XLJA 1RADB 3MM6A 3CMQA 4J37A 4X84A 5GMDA 2K06A 4R8UB 2YKOA 1WHWA 2KB2A 2O5DA 3MWBA 2V4JA 4LFBF 2ZDPA 3GSIA 4H4MB 1N32J 1Q53A 3BR9A 2QRRA 1HBOA 4DFMA 1RHRB 1S49A 2ZKUA 5HROB 4Q5VA 2OPRA 1WOSA 2V5HG 1NZAA 2FHMA 3VWSA 1KSPA 1NK7A 1RWVB 2F8HA 1NH7A 2B9YA 1RWPB 2HHXA 5BJRA 2V67A 1NSAA 2OFGX 1RWOB 3VVUA 1EKRA 2UXDJ 3R5AA 3OFFA 4CLWA 1WORA 2MQ8A 5ETNA 3N4WA 2HQIA 5E2QA 1HPZB 1N5QA 2JC0A 2XMUA 1PJ5A 1RBOB 3CJKB 1G4CA 2FZCB 3ENVA 2KT3A 2ACYA 5M2PA 3FNNA 4B3RF 3EWGA 1BC6A 4M5NA 4FS1A 1S4EA 4ZIVA 2HHTA 1S59A 4X4RA 1X9WA 1FHTA 2HK2A 1NHVA 3CCWA 3PW5A 3B4MA 5AT1B 4WE1B 1JLGB 3DCAA 2IA6A 3VGTA 2LFVA 3L7UA 2GGPB 1WC1A 4F02A 2VKZG 4LF1A 5HJYA 5T14A 2ZHAA 5IM0A 2VH7A 3CXCR 2DBBA 1UW9A 2QZ8A 2JJ4D 2BMBA 3D6TB 4USMA 2C1EB 4U7UD 4CLLA 3GJQB 3KDOA 1N6QB 1R43A 4ZPWR 4PG5A 2GIRA 3MCOA 4FKXA 3F0NA 3M05A 1WC3A 2P2CB 4Y3CA 2BM1A 4I69A 1JKHA 1N33J 1RBLA 2ZKTA 2QN6B 3AOBA 1OPZA 3G8TA 2KXNB 4P10A 5F0UA 5CD4H 3IA0A 1H6KX 5J2NA 2HSEB 1VRTB 2WVFA 2YKNB 2WOMA 4UOFA 4DX5A 1ZTWA 1N5VA 4K0KJ 3GIKA 5AXNA 4K4WA 1DTTA 2DY9A 2BM0A 4NEYA 4ZN1A 1X7VA 3EVWA 1BXNA 5L9XA 3D68A 2ZJRQ 4ENOA 2ZH2A 1HBNA 3UN3A 3M4XA 1WG1A 2E5JA 4O4RA 4OLPA 4XAKA 2DKOB 1UCNA 2YX4A 1R89A 4ZVOB 4DPXA 2HHWA 4NLXA 3W2VA 2VICA 2DR5A 3G71S 1O8BA 5K14A 1FKPA 2HHSA 3P4UB 1FNOA 3OL8A 3BF4A 4ELUA 4KGXB 1PCAA 3B4DA 2BE2B 3NLCA 4I1TA 4FXVA 1S97A 1SPBP 3MEDA 2C22A 2V8HA 2NR0A 1REVA 4CLYA 4X4QA 1NK8A 1DFDA 2ZE2A 2FJEB 3VAMA 4PG4A 2AEMA 1FVQA 2MLZA 2GV1A 2AT1B 5DRKA 4QIGA 1T05A 3HX9A 3SCJE 5HBMA 5AE2A 1VC0A 2I5JB 4YN3B 1RQ0A 4DQIA 4P7TA 2WBMA 1U8SA 2RDDA 3MFIA 2LP4A 3Q8SB 5I42A 2G1HA 3C6TB 1E6VA 1XR5A 5J2QB 4HL9A 3DM2B 2W2NP 2HNYA 4P9SA 1GMUA 3BDEA 2MKKA 1S6OA 4J9PA 5JJBA 2H65B 3KHRA 1RB0A 4OLOA 1U6ZA 3TZWA 3OBIA 1WUUA 3HHNB 5CAAA 1A9NB 3SBMA 2FUG9 1ICEB 3MHYA 4LR9A 2FGOA 2YKQA 4IKAA 1S6PA 2F7VA 2IIHA 2UU9F 3EDQB 2UZAA 4B08A 1QJHA 1XMOF 2P9EA 2HQGA 3ETMA 3CJ0A 4WIQA 3WZ0A 6FD1A 4K50A 4IR1A 3M2RA 3FQKA 5F3ZA 4A46A 1D9DA 2GIFA 2AYMA 4Q8EA 1LNQA 1VR6A 4AYBD 1NK9A 2CZ9A 2UXDF 4ZITA 1MU2A 2XYPB 4CTAA 1NZ8A 2PC6A 3TA2A 4YY3F 1RT4B 1GMWD 1KDNA 2HFNA 3HHLA 4WZMA 2MGZB 1RLCL 4R25A 5L38A 1T9WA 2CVIA 1GMVA 1CULA 1N5SA 3H7HB 4OJGA 1X9MA 4ZJLA 4DUYJ 1R6YA 4RNFA 2VFRA 4A8FA 4BC9A 5AXLA 3NOGA 4WFBQ 2BDPA 3BN4A 3RBDA 4IFVA 3OR2B 5HANA 1RCOB 3IAS9 2I0XA 4GO5X 3FUYA 3NCPA 5CD4A 2F63A 5IC4B 1AXQA 2XGQA 2HAFA 4YDDB 4AUKA 1Q16B 2MZQA 3MPYA 2VBYA 4ZVQB 4RO0A 2UUBF 2KHCA 4P72A 2C3OA 4ZVSB 1F6TA 1BUXA 2Q3PA 2NS1B 4RNOA 3A13A 1TFYA 5DO2A 4KAIA 1XWLA 4KQZA 2PA3A 3MEKA 5K5MA 4QWCA 2XWXA 2HMIB 4ED6A 3QZ7A 5ETLA 1KEKA 2KH9A 1EZZB 5L1KA 2DY1A 4Q44A 3CCMS 5J1EA 2IRUA 1U1QA 4U8YA 2JZ5A 3NG8A 3HVTA 2ZOFA 2L9NA 1QAXA 1IBLJ 1A7GE 3RAMA 5HMZA 3VAKA 2LEAA 1R3NA 3M30A 5LSOA 2FJBB 3OTOJ 1UKUA 2FVQA 2HGLA 1HR0F 1JXEA 2PMWA 2DRAA 3JQKA 1MW7A 1A6LA 2ZJQQ 2DVIA 2V8VA 3IC1A 3G6VA 4RBTA 2VG6A 3CE8A 3DOLB 4WIIA 2Z4PA 4EO6A 1CJTA 3OSNA 1RT2A 5B0GA 1DJ0A 3GP9A 1PAUB 2YVSA 2Y0BB 2AWZA 5KFNA 1Q7LB 3LH2S 2QA4S 1N48A 4WZQA 2ZH9A 3IG1B 3GQCA 1SV5A 2HBRB 1HNZJ 1C2PA 3BEGB 3BBCA 4L3KA 3H4BA 1FFSB 3C19A 4B3MF 2JLFA 2NYHA 3C15A 1FRIA 2HZAA 3EZUA 4OJ1A 3BQ1A 2VUGA 4ZVRB 1RT6A 3QFWA 3UNGC 2UUAF 5C42B 2B4UA 4NLSA 1FF2A 5A2QY 3OUYB 2R7VA 2ZNZA 4Y0FA 3ILLA 3KLFB 1XTZA 4MYTA 1IKYB 3QSIA 3K5MA 4U96A 5B0EA 3TUPA 3CCTA 1N36J 3AD8C 2Y8WA 5A0YB 4A8MP 2IBKA 4B02A 4F3MA 3C6UA 2KJVA 1VBKA 2DHXA 1JLAB 4F2SA 3EM1A 4NLTA 4IRCA 5IT4A 5KFJA 4DG1A 4JV2A 5D4OA 3PKYA 3CCES 3UVJB 2V2QA 2WONB 2R7QA 4R8UA 5E41A 4QWBA 3LPEA 5D0RA 1GEHA 5KTQA 5I3UB 2XMMA 4XK8C 4XPCA 4RJVA 4H4MA 5ETSA 2Z30B 3RAXA 4UUWA 4ES3A 2CQBA 2H5EA 2OMLA 2YXLA 1U47A 2RHSB 4M94A 5HROA 2Y9HA 4OZ5A 5DETA 1K1SA 3Q8UA 3R6LB 4DSEA 1F3FA 2XMVA 4RLEA 4X4SA 2NXNA 4QIWD 1X9SA 3O1LA 4LVNP 1XIQA 3PRBA 1FX4A 1PKUA 3JQMA 5KT5A 1U6BA 4DUYF 2E1MC 3KLEB 2FJWA 4J9VA 4WBFA 4RU2A 3T5KA 2HURA 1B0TA 2A6MA 2DRDA 1SQEA 1HPZA 5DQIA 3L7PA 3GJSB 3CJKA 2YQ0A 3DKDA 2RQ4A 2AEJA 3NGDA 5KG6A 5CXTA 1HQEB 5IQ6A 2DYAA 1QD1A 4K4SA 2WW8A 2BKOA 1BMQB 2C2NA 2QLWA 1R31A 4DSLA 4WE1A 1JLGA 1VQOS 2GGPA 1I6JA 5F8MA 3ELHA 1YRTA 3RGIA 3I0RB 2ZZMA 1N6QA 3BM7A 2JDJA 1EETB 5DJBA 2U2FA 2HHUA 3TP2A 5A8WB 4ZCLA 2X1FA 2AEFA 3UD5A 4ITSA 2AZ3A 3TWZA 2I9SA 3NBPB 1O5JA 2BW7A 4X62F 3T19A 1VRTA 3LO3A 5L46A 2V69A 2YKNA 4Y2KA 1IUJA 4A48A 4K4UA 4OFZA 2GIQA 2F3JA 1X4AA 4XO0A 3Q8RB 2B43A 2HBYB 4LQ9A 1VJQA 2MEWA 3AH6A 3U02A 4URQU 1GTEA 1PYTA 3EXCX 1U8WA 3G96A 4EYHB 4S0MA 2W9BB 2HHHF 9RUBA 4MMOA 1AT1B 4I64A 2EBGA 2BQUA 2SXLA 4ZLLA 4Y2MA 1KFDA 4WK3A 2WHOA 3DXBA 2MSSA 2VZ9A 3DHXA 1FERA 1X4EA 4NI2B 1HNZF 1RCXB 3W5YA 3MMBA 1T3NA 2BE2A 3LGNA 2QYCA 2VPZB 4MIWA 4IOBA 2RRNA 4V19X 1EQ0A 1QTMA 4O44B 1XK8A 4JI3F 3FRYA 3TAMB 1VQ6S 2H9ZA 4ZJQA 3VZHA 3QATA 1VRUB 2ZBQA 3D1QA 4F0KA 2I5JA 2XO7A 1IWAA 1NPRA 3NP5A 1JX4A 4LRBA 2CPHA 5LXRA 2HFZA 1N36F 3T5HA 2LU2A 3DLGB 2DT9A 2HRUA 4YB6A 1ITPA 4OI3A 4JYAJ 5CCMA 3D54A 4DV3J 2WRMA 5IT9U 4LUBA 3Q24A 2UXBJ 2ZH8A 3C6TA 2R42A 1JJHA 3PXGa 4AE5A 2BJEA 5J2QA 3IGNA 1XR7A 3DM2A 3AOAA 1XNQJ 2YWFA 4J91A 5GAGI 4OX7A 1TUVA 2DO0A 4NYOA 4HR2A 2HQDA 4KGMA 3MUMP 4DQQA 2HFVA 1VC5A 4X4VA 4Q45A 4BCAA 3Q0AA 3MUVP 2CJBA 1WF2A 3EGNA 2GO9A 2KVIA 1F3VA 2VFSA 2FVSA 3D6MB 4Y00A 1I94J 4TQRA 5JUMA 4LF2A 4JV5J 3MF5A 5F8IA 1K47A 3MM5B 2M0GB 2HLUA 5T7LB 4JI2F 4NLVA 3X1LB 4ID8A 3ONQA 1WC5A 3L9ZA 1RI7A 5BYRA 2I6WA 2CNNB 2AP6A 3W63A 2NLWA 2NUUG 4ID5B 1RT4A 2RU3A 2JHEA 2MGZA 4RNMA 4PZVA 1KQSR 2BJ3A 2NXEA 4DEZA 4WYLA 4PG7A 4ZPCA 3ICLA 1Y11A 1IVZA 3AA8A 2EWHA 4ZVHA 3OR2A 4QZVB 3TZZA 2ILYA 2H5IB 3CDEA 2DRBA 4NLDA 1Q0NA 2ATCB 3FBFA 2XC9A 2OP5A 4ECSA 3QWPA 4C0BA 3QGHA 2DNPA 4DX7A 1JQGA 4Y6IA 5G0RA 1WG5A 2V8DA 1HI8A 2B3TB 4NXMF 2R3VA 3SYZA 1X5SA 5KFLA 1X4FA 2XI2A 4OZLA 2ZH1A 2KFYA 1JLCB 3PKMA 1JK9B 2XZTB 3AY0A 4KHMA 1H98A 2Y8YA 2F65A 4J5OA 2HMIA 2ZUAA 5KFEA 4LBPA 2J6SA 2R7TA 3OT9A 5F9LA 3IBFB 1RBAA 2YQ1A 2EKYA 2DB1A 2HHQA 4DR5J 1WTBA 3MECB 2YWEA 5HVFA 4J9KA 2R8IA 2CKWA 2MZ1A 2CJQA 3KWMA 2CDQA 1KVJA 3ZZTA 4ZK7M 3HFZB 1XNRJ 1HMVB 2V9WA 2WVCA 3CD7A 3BB5A 2PMHA 3DXSX 4NRUA 3C46A 3HVRA 2P6TA 4KJIA 2B8PA 1NK5A 5DGBA 1H7XA 1NSQA 3WDOA 1KONA 2VIHA 3QT7A 3T41A 3M7VA 3D1OA 1NHUA 5CYJA 2J7WA 4QWEA 2D74B 2KT2A 3DDIA 2DHGA 3JXOA 3PNIA 4JI8F 2EW9A 3DOLA 4I68A 5T41A 1TL3B 4ZPDA 1U1MA 2J9DE 3QO9B 3IGVA 4NOHA 1WKKA 2JEJA 2OD6A 4USJC 2DHHA 2CPIA 4OYIA 2GCFA 5HLFB 3R6GB 3IG1A 1FX2A 2VC0A 4U95A 2H1YA 4DL5A 2RJZA 4KKOB 2NCKL 3MM9B 3KOAA 1RWKB 3MR2A 4JI0J 2ZNYA 3R7NB 1YZ6A 3ILIA 4RX6A 4DCJB 4N41A 3EGVA 2AZ1A 1FJ7A 5BXIA 5LMUF 3SV4A 5C42A 4LF7J 3OUYA 5ITHA 2CVEA 3KLFA 4H4OB 4JYAF 2FB0A 2NZ4A 1IKYA 3R7SB 2P9CA 4CLSA 5CA5A 5A0YA 1YRXA 4OX9J 1CJUB 2B0GA 4P2SA 1U26A 3Q2SC 3BSNA 4ETZA 5E3AA 4TLQA 1JLAA 3OFEA 4FNIA 4USTA 3N6MA 3E2EA 2V63A 1RAAB 4BHQA 1K1QA 1B0PA 4J9OA 1Q8KA 3UVJA 4JI7J 1Q7YT 2WONA 3OTBA 8AT1B 4CT8A 2I1RA 3UCUP 1YZ7A 5I3UA 1I94F 2Q1LA 4JV5F 4NXNF 3WX8A 3ZTSA 4FN5A 3UDEA 2CPFA 1U4BA 1KQFB 1GXTA 3KDNA 2KFNA 2L41A 1QE1B 2IPOB 3E01B 3LUYA 3G8SA 3BO3A 1SH3A 3SSRA 1SIZA 2PA8D 4ZP7A 2A2DA 4USKA 5J1PA 4O3NA 3DGPB 5EWFA 2CQIA 1U2FA 4OZ1A 2RKIB 4ES1A 2R7OA 1Y00A 3KLEA 4IG3B 3KHLA 2WK4A 4MKBA 4FNHA 4DFKA 4HTIA 1LK5A 4LJMA 2HVZA 4RW4B 4JUZA 3SIPB 3GR1A 4DV1J 4FXDA 1T9YA 2MKJA 3UDCA 3PW2A 1Y4ZB 3HSZA 2B6AB 4UOHA 2B51A 5KFGA 2OUGA 1NK6A 2XY6A 4NASA 1HQEA 5D4LA 2L48A 4MH8A 1PG5B 3ZXWA 5JVGQ 2DPJA 4W90B 3LF0A 1MNEA 2DXEA 4FDFA 1D8YA 1BWEA 4YOEA 2PGCA 2AX1A 4L75A 1V3RA 1SJ1A 2MQOA 3R3TA 1WEYA 3UD3P 1VIOA 2OKQA 3I0RA 3RR7A 4TKTA 4RW7B 3QAEA 2J8AA 4U6PA 1WD6A 1EETA 4DX6A 5A8WA 2ACMA 5GAGU 4RU9A 4IUFA 4D3GA 3KXDA 2K8GA 2HVHA 5ADZA 2NXCA 2F4FA 3D28A 3I5AA 1NCLA 1SC6A 2HAIA 3NBPA 4TY9A 3PY8A 1UWBB 1E6YB 2VQFF 2ZITA 3OL9A 1RGVA 4PWUA 2NXUA 2LU1A 4UT4A 4DF4A 4FKYA 5HMWA 2W8KA 4KPYA 3LWLA 4KGKA 1Z2LA 4KGZB 4F4WA 2G0JA 4FF3A 4RUCA 4M5JA 5KAKA 5FLXY 2BANB 4HHUA 2IM0A 4K4TA 2LQBA 1J5EJ 2W9BA 2L3MA 4TY8B 1R0AA 1AZSB 1FE4A 2WZ1A 4MK7A 3JS9A 4IG0B 3KUEA 4XDDA 2HHPA 1DQAA 4DSFA 2YH0A 3UR0A 4YFUA 2ZZTA 5AJ3F 5L8RC 3SEOA 4C8LA 3LW5C 1OY9A 3I31A 3T5JA 2RS2A 4NI2A 4ILRA 1UWAA 2MMYA 1RAHB 3I87A 4YHHJ 4CIOA 3TJ8A 2COLA 4DL3A 1FRXA 4HT7A 2R4FA 4O44A 2FHJA 4QR2A 3GZ7A 1NLKL 3TAMA 3GR0A 5KG0A 2EBEA 2M70A 1HNXF 3K59A 2XYHB 3CIZA 1VRUA 3CMAS 5KFRA 4NWBA 3GYXB 1GXUA 4YR2A 1VBXA 3DLGA 1RAIB 4IDKB 4WJBA 1QVFR 2HG4A 4OX9F 4O3SA 2M5YA 4HI1A 4FXWA 2C3MA 3C2PA 1U7LA 2UUWA 1N5TA 3W66A 4UZCA 1FT8A 2HVEA 3FRZA 4ECTA 2WSCC 4OI6A 2NSCA 1URNA 4DMZA 2UVUA 4DL4A 2B9WA 4YB1P 4EMDA 5LJ3Y 4TU9A 2P6SA 4YUDA 2J76E 4EK2A 4M63A 2VODA 2RU9A 4WP3A 4M5HA 2Z2MA 2GJFA 4KPCA 4QQBA 3MM5A 3ZZ0A 1U2CA 4KH0B 4NLGA 3A3PB 1UZDA 3TW0A 5T7LA 4DUZF 1NBEB 4OYZA 4OYAA 1R8AA 3O6QA 3A8IA 5HATA 4LVOP 2M52A 4DV6F 4RZRA 4TU7A 1HA1A 4ID5A 2HNDB 4NCAA 2JL9A 1VFJA 3D5MA 2CDRB 4M5DB 3NNCA 3SZ2A 1HWIA 1T3OA 1S0VA 4AL5A 4Z37A 2MQNA 1S57A 4OV6A 5IV4A 2HWHA 1KHVA 2PEHA 3FGVA 3KKFA 4LF9J 2LDIA 2H48B 1MG7A 3ITHB 4LFCF 2QA2A 2VJUA 3DI6B 5KFTA 1NHKL 1ZM3A 4RUHA 1ZPVA 1P8GA 2QFIA 1QM9A 3J80Y 4RR5A 4TVAB 2GHVC 2CQ4A 1B3TA 3IR6B 1F5CA 3KJQB 4ZVGA 1I51B 4WWSA 3W8PA 3JSMB 2YBVA 1WELA 3CMES 2QLBB 1JLCA 2XHWA 4CO4A 2KO1A 1KOOA 2IJNA 3K5LA 2RUGA 5L1IA 5L1JA 2DPIA 5B08A 3LPYA 3A8JA 2OPPB 2CJ9A 1M5VC 1X5PA 4CNZA 3EZOA 3MECA 4KIAA 2DNRA 1YHQS 3Q8YA 4QJVA 4EBCA 2H54B 3H98A 3ADAC 3CJTA 3H2LA 5J1NA 4OHVA 2J9EA 3VAFA 3NS6A 4X4OA 1HMVA 3K5NA 4K59A 2CG4A 5F8LA 2DHSA 4F4YA 1FRHA 7AT1B 4MK9A 5J2PB 1RHQB 3KLVA 1RU1A 2CQGA 2XHCA 4RUBA 1N0UA 2VDHA 4KO0B 1Q4RA 2ASYA 1UP1A 2RQMA 3EMTA 3BSAA 2NSBA 2RIJA 5KT6A 3EPGA 2PEBA 3W9IA 2JH3A 2AJ2A 3NY0A 1TKTB 1TL3A 4DPOA 3GJTB 4ZLPA 3QO9A 4JI6F 4DR4F 2BKPA 4GKJJ 1L3SA 2CZVC 3R2DJ 5DDRC 1T94A 2N82B 1FNXH 2IRXA 1OMSA 1TL7B 5HLFA 2GHPA 3UCGA 1F2HA 4ANCA 3CCUS 4CQ1A 4WCEQ 4DV4J 4KKOA 4LF8F 3MM9A 2MLYA 2BYCA 3ZZYA 3O3LA 4C48A 2UVWA 3PYFA 4TQSA 4PG6A 4M5LA 3FJ2A 3GYNA 3H2UB 4RPFA 2C2KB 1HQ2A 1UA0A 4WK1A 2E5LF 1S1WB 4H4OA 3T6BA 2QSWA 3M9OB 3NWRA 1TL5A 3Q2TC 1IBKJ 3LGMA 3RBXA 1YI2S 1NXIA 1NK0A 5B7WA 3UWTA 1CJUA 2MKSA 3W61A 4H54A 1XMQJ 3EGWB 4OYXA 4PABA 1VQPS 3R1LA 4B3OB 4PQUB 4I4BA 2R7XA 4DLEA 4WFYA 2YPYA 4Y65A 1SJRA 4LFAF 2AIRB 3GIMA 1RYSA 1YGYA 1YRUA 2PDAA 4BBYA 4NYZA 3Q23A 1IQTA 2KRRA 2P8IA 1YBUA 4JB8B 1NPPA 3TJ9A 4ZPVR 1F1BB 2DEJA 4TN2A 4USHA 5F8NA 3G8QA 2D9OA 4ICLB 2ZWOA 3E01A 3KJNB 2MHNA 2G2YA 1NB7A 1YJTA 1REGX 4RUAA 3DGPA 5THWA 4RW6B 3LWMA 1TMMA 2E7VA 4J9LA 3HM9A 4OHYA 4YB7A 2FLLA 2RKIA 2GX8A 4NYPA 4LSNB 1M5KC 4IG3A 1S4FA 3W2WB 2PSZA 2XMAA 2ZM6J 5GAEU 1HI1A 4RW4A 3VGUA 4OZ2A 5F8GA 3KUHA 3Q83A 2IJFA 3G4SS 3IRXB 2Y1JA 2VA2A 2HHVA 2B6AA 1U0HB 3CCSS 4LBIA 4OL8A 2KTQA 1QTNB 2ZHBA 1Y9OA 1V5VA 2GQ2A 2OIHA 3V6DB 4CRJA 1YWXA 2FJAB 1S6UA 1PBAA 3S6EA 3FSIA 2C2RA 5F9NA 4WXOA 3M8WA 3L7OA 4ZVFA 2ZVIA 1C0UB 3EE3A 4PPDA 3OW2R 4PQAA 4MFBB 1QAYA 2KYXA 3MPWA 3BSCA 1DQ8A 2GC8A 3C8YA 1HKAA 2GMHA 4RW7A 2HFUA 1KVIA 4LRCA 2DGQA 4I6YA 4PRFA 5EHHA 1FJCA 5IC6B 1MLAA 3NGUA 3RU0A 5LSLA 4ECZA 1V6HA 5E7OB 3QIPB 3T1HF 2QL9B 1PC5A 5KFIA 1RWMB 2BKNA 3P6YC 4NLQA 2OPQB 4TLRA 4R5PB 1UWBA 3MR6A 1E6YA 1T11A 3K5PA 1UPPA 3PHEA 1H72C 1KC8T 1AUDA 4J9MA 2XSJB 5K20B 4GC6A 4UOCA 2AYGA 4UZBA 2BANA 2C2MB 4ZLJA 4E98A 4FBUA 1RXOB 4TY8A 5U47A 4IG0A 3GCWP 1F5AA 1Q8IA 2ATLA 4ZVTB 1WF0A 1RAJA 2F40A 1FDDA 4N8NA 1VQYA 1LWXA 2FIUA 5CZVA 1Q8BA 1WSRA 1EB0A 4DR1J 3TNVA 3RAQA 1RHMB 2B9XA 1TL1B 2N3LA 2AGQA 1ACMB 3U1NA 3R5GA 3PFOA 1CC7A 2ZBRA 4I56A 3RB0A 1NEEA 2LECA 2YNHB 4OYWA 1IBCB 5KFBA 2N4CA 1V3SA 3IAM9 2KM8B 4CM2A 2DNMA 2VG7B 1HNWJ 4JI1F 3QLHB 3N6LA 2ZC3A 3D7SB 2OTLS 4IDKA 3G87A 4MAKA 2D3ZA 2H51B 4BC7A 2IYIA 3IS9B 3IBWA 4ECYA 2L08A 3DLHA 1OO0B 4DV0F 2ALZA 1HWJA 2RNEA 3B78A 4HDHA 2R7RA 4CLTA 1UFLA 3M6VA 3KFWX 4F50A 2FPHX 1U48A 3A8KA 4EUVA 2AF6A 3GSDA 5LOQA 1RE1B 4O23A 4B9SA 1D8ZA 1NM2A 2E1PA 2FDNA 1FDNA 3GFZA 4HT5A 2V8GA 2OLWA 4C7QA 1HW8A 4X4NA 3KG0A 2ROGA 3SMZA 3CCVS 4C97A 3KK3B 1DURA 3M6UA 1QY7A 6AT1B 3GIIA 2ASJA 2KFZA 2W4DA 3W1YC 3HK2A 2RILA 3LALA 1N54B 4Y2CA 3CDBA 4G1QB 1TUGB 3FKBA 1S48A 1KWMA 1H2UX 1M1GA 4WPAA 4LFBJ 1SH0A 4L74A 4M5DA 2J9CA 4B3TF 2O1PA 3IRWP 3UW1A 3UD4P 5B0BA 2UVVA 4WTYA 3QNWB 1S0MA 5D4NA 5KFFA 2XI3A 2DH9A 2GMJA 1RA6A 3ITHA 1PIEA 3P5BP 3OSPA 4YQWA 3DI6A 3THTA 3UQSA 3NKYA 4DR3F 1RZMA 1H0HB 3MEEB 4IO9Q 1U1RA 2DH8A 2QLJB 1FD8A 2XB2D 2HLTA 3JSMA 3HVAA 4EI2A 3J7Z5 3PIOQ 3ENAA 3HPOA 4B3RJ 3EVOA 5EDWA 3H59A 3HZEA 1DRZA 4CLKA 3RRGA 2XS2A 1PILA 1N56A 3ILJA 3FBCA 2OPPA 3K2YA 3NGKA 4JP8A 3I4PA 1DLOB 1SJQA 5D0HA 3HDSA 2CNKB 4FF2A 3W5XA 5KFKA 3JSRA 3RYLA 2IC3B 1G7CB 3BKTA 2MKIA 4J7CA 3ZFVA 1RTJB 3D3BJ 1MROA 2RF2A 4QPTA 2ASLA 4L72B 3FSYA 5J2PA 4USWA 1CC8A 2HFSA 2RVJA 2VD3A 5E3PA 1FFGB 1H73A 4ILMA 3CO9A 2IAJB 4KO0A 3DOMB 3B6BA 4P73A 4G1PA 3SXLA 1CQMA 2W2PP 2CPZA 1Q79A 4OHXA 2DNOA 2RB7A 3PYEA 2AJFE 1KHWA 1TKTA 5GADU 1HARA 2LYVA 3TAPA 3HSDA 1Y0HA 4CWBA 1WEZA 4DR1F 3Q8QB 3ET6B 4GKKJ 1TL7A 3LOUA 2Q6BA 4RW8B 1V9OA 1U1PA 4YP3A 4DSJA 2DGTA 3PX6A 1TVRB 1JJ4A 1FKOB 4DR2F 2Q79A 3KJVB 4ATNA 4RKUC 4BS2A 1FO1A 1TTHB 3FZ2A 3TRGA 3HZGA 5KG1A 2W8LA 2G2OA 1VK8A 5LM7E 3MDFA 1Y3KA 1RA7A 2OSRA 3FBEA 1UVJA 1RAGB 1S1WA 5DDPC 3AD7C 5D6GA 3P96A 4I6AA 1X5OA 1RK8A 3D0HE 2WCXA 4B3OA 4PQUA 1VOMA 2HGNA 3EXYA 4K4XA 2UXCF 4YS2A 3I0SB 2XZWA 2ZVSA 3G6YA 1N34F 1UVIA 2KYZA 2ZEJA 3EVMA 4K7QA 2J0SD 3W7BA 5IOLA 2J5AA 4ZN3A 3UFCX 1F0XA 5DQHA 4B17A 4BDPA 5HK4A 2BE9B 4OZ3A 2EFNA 1JLBB 3VCDA 1N5YB 1RABB 4KBIA 3R1HA 3LAKA 4ICLA 3W5ZA 1RWUA 4C9DA 4FYVB 1CBKA 3OPKA 1Y10A 2ZZNA 3UE2A 3FBBA 4C3LA 4EFAC 5ETRA 4DI6A 1JLFB 3HD2A 3MOZA 2HS4A 2F1FA 4RW6A 5E3CA 3CCLS 2QFJA 5F0WA 2VFVA 2CQ0A 2AD9A 5FLXU 4CLFA 4LSNA 3W2WA 4IRDA 2UU9J 3Q8PB 2PI4A 1ZZFA 4RW9B 1XMOJ 2RE1A 1MMNA 3M8YA 4KFBB 2GO8A 1RT7B 3PRDA 2YWKA 3IRXA 5GAHU 4A8YA 2IHR1 2LXIA 2J0QD 2LVWA 1RP5A 2JRSA 1U0HA 4LMZA 2IY5B 2OPSB 2R8HA 3V6DA 1NH8A 5FD1A 3OJSA 4YY3J 3RTVA 1NJXA 1YBTA 2BBEA 4L73A 4X4UA 3IR7B 3MMCB 1GMWA 2CXEA 1UVKA 3B54A 1C0UA 2D3UA 4LREA 5HMXA 1B70B 4MFBA 2DNQA 3JB9k 3NOCA 3BH6B 4DSIA 4J9NA 2I2YA 2W9AA 1YBAA 1FRKA 2W2OP 4OI4A 5LJ5Y 5KG2A 3QIPA 1XEZA 4O3RA 2XGPA 2UVRA 5D77A 3PDNA 1BQNB 3O2IA 2OPQA 1YIJS 3QZ8A 2X1GA 2PFDA 4R5PA 2UUBJ 2VC1A 1BHNA 1F9FA 3U7JA 3QJJA 4I0WA 2DXDA 2XSJA 4ED3A 4ZCMA 4DFJA 3CPWR 1S9GB 1MWQA 2B5JB 4RBUA 2R2RA 2CUYA 2BUNA 2CQDA 1TUWA 3AODA 1FWPA 2FTRA 3H8YA 4ZJOA 4M5GA 3OJUA 3MZIA 4XDCA 2ZFHA 2EG2A 2DNLA 4GKKF 3ETOA 5L39A 1FE0A 4F0MA 2QLXA 3AJDA 3AOCA 4P2MA 2ZWPA 4PWDB 1X31C 1UAWA 3N9UC 1TL1A 3TX0A 1FWKA 2FVPA 1HR0J 2Z2YB 4J9SA 2KDOA 2CZ4A 2B9EA 3SFGA 5D8HB 4DXLA 4LRDA 4PYDA 2M88A 1KLNA 2YNHA 4P7VA 1LWEA 9ATCB 3BZQA 3GFYA 3HD1A 3HSGA 5IT0A 4WTOB 3V81B 3R2CJ 3NL0A 3VGSA 4UUXA 5H9FK 5G4DA 3PIPQ 2VG7A 2CQ3A 2RHQB 1SBRA 4P2FA 1LK7A 3QLHA 2WTFA 3JSBA 3LTOA 3GPAA 1I1GA 3HHLC 4DU7A 3KUGA 3IS9A 3DLKB 1T02A 1HHSA 3BJYA 4B3MJ 1KBRA 2ZOMA 5F8JA 2DGWA 2IDLA 3TX8A 4CO0A 4ZP6A 3K7RA 4R0EA 2BV3A 4CYUA 4MKVA 2AHOB 2HRTA 2UUAJ 3OVSA 1Y3JA 1T03B 3HKWA 2MHEA 2OAUA 5AE3A 1HBMB 2IBOA 2FJXA 4DN9A 1ZM4A 3IMQJ 2Z58B 3BBFA 2WAQD 3MMJA 2ILZA 1OS5A 3ZZZA 4Q8FA 1TV6B 1KQKA 4W98A 4FBTA 2YNFB 2MQMA 2B4VA 4LT6A 2XS7A 1VISA 2VFTA 1QUPA 4MK8A 2JVRA 3PV8A 4KHPF 1QVGR 3KK3A 2EI5A 1WC4A 3C66A 1MWYA 3D6HB 3H0PA 2CPDA 4G1QA 1I3OB 4I7FB 3BKUA 3US5A 3CVKA 3MAQA 1NNDA 2IYGA 1AFIA 4C11B 2KG0A 3BV8A 1X4GA 4DQPA 2KT5A 1ZETA 2AMCB 1VCTA 3PX0A 4ILLA 2GNKA 4NZ0A 5KFYA 1S12A 4LQ3A 3JSYA 2BVZA 4OI0A 3JTNA 3CC2S 3I55S 1WSVA 3FC9A 1B7FA 5KFMA 2QG9B 5C24B 3MEEA 4H4KC 3DRRB 2VA3A 1NJYA 2JLEA 3R8YA 1U2RA 1TAUA 1D0EA 3BKFA 1TL4A 3R5DA 2W25A 2EPIA 1AFJA 1VQNS 2J6UA 1S9EB 5H9EK 4KY3A 3UN2A 2HIQA 4CLPA 4CDIA 4DV2J 4CI0B 2VQEF 1FDAA 2R7WA 2DCUB 4F4XA 2KJWA 2OEKA 1DLOA 2MSTA 1IR0A 2E1RA 4K4YA 3QFHA 3HXMA 2QA1A 3CDWA 5EWEA 3WQPA 2IC3A 2XZDB 4ZOSA 3M2VB 1C4AA 3MAAB 1YKWA 3UI3A 3GILA 4G65A 4KV8B 3H25A 4P75A 1RTJA 4BWMA 3K58A 4HKQA 3RRKA 1SL2A 1LW2B 5D15A 2IAJA 2CJKA 3DOMA 1FRJA 1CJVA 3CULA 2G13A 2HEKA 3CJ5A 2W7AA 4X62J 1PYSB 2MJNA 1MMDA 4X65F 3FCWA 1F9HA 1NDPA 2HW3A 3SFUA 3NCQA 2QGFB 3OLBA 3PEHA 1JXVA 1VIXA 2BABA 2YX7A 3ET6A 4CLUA 3KLIB 4RW8A 2GVZB 1P6TA 5KG3A 1EP4B 3KHGA 2FD2A 2OEMA 3I5BA 1TVRA 1FKOA 3C14A 1JKHB 3TVKA 2RMLA 2AW0A 2FVRA 3KJVA 4USIA 2HHHJ 3VTIA 3FMWA 2ADCA 2X1BA 4C8OA 4PR6A 2BJDA 3KJFB 2L9WA 3BDPA 1WC0A 2R9LA 1PBUA 1P27B 2BW2A 1H2VZ 1HD0A 1B64A 4HH0A 2AV5A 1FK9B 4Q2LA 5BR8F 3IM8A 3LP2B 2MKHA 3CDAA 2LEBA 1NDCA 3WX4A 3MEGB 2BQ3A 4ALZA 4GC7A 1ZBTA 3KMSA 3PYGA 4JI3J 3BH7B 4U7UK 4NA1A 1IKVB 3SCKE 2ZD1A 4DHVA 2BE7D 1AB8A 3I96A 1CPZA 2DJWA 3I0SA 3G82B 4UQGA 2WB1D 3KNGA 3PEJA 4KRWA 4DR7J 4ZS6A 1LV5A 4Q43A 3OVAA 3QGIA 1VHFA 4OI1A 1TELA 2MY7A 4N8OA 3CSKA 1JLBA 1N5YA 5IXUA 1OQ6A 4AT1B 1S72S 5DDOC 5C7PA 2F9DA 3CGIA 2XNQA 2OMOA 4J9RA 3OFGA 5MAOA 1JLFA 3R5BA 2MXYA 2CQCA 2BJ8A 1EHWA 4NPOA 2GJ2A 5K8NA 2LA6A 2HFOA 2QV6A 3DLBA 3FQLA 1OIAA 4LSLB 1WKLA 4RW9A 1VGYA 4DOZA 5KFHA 4ELTA 4KFBA 1OY8A 2AU0A 1RT7A 2F5GA 1S77D 4CH7A 3EUNA 1YSJA 4J90A 4JI2J 2QJ3A 3LQVA 5SUHA 1XERA 1HW9A 2LQ5A 3GFXA 4GMKA 4MIAA 2AJ0A 4IOAQ 4PWWA 4DWIA 4QWAA 4HYKA 3MMCA 3PACA 2P5VA 2RH3A 3BS9A 4FF1A 4X66F 1BY9A 1R8CA 5HMYA 5HJXA 4QU7A 4DV2F 3NS7B 3CB4A 4ZKAA 3FMBA 3V5RA 5SZTA 5DQGA 3AXMA 2RQKA 3IN5A 1GT8A 2C2EA 3IR5B 2VPXB 1RUSA 3TUIC 4OIXA 2OTJS 1FVSA 3CIMA 3ZZUA 3QRQA 1BQNA 3MR3A 1SKWA 1JLQB 2J7UA 3V4IB 3G6ES 4NXMJ 3DRPB 3O5TB 4EGLA 2XLKA 1NPKA 3M2UB 2HVDA 1F9EB 1FDBA 4A8XA 2EXUA 1S9GA 3MOJB 2B5JA 1X4BA 2YNIB 1PJ6A 2I8EA 3M8QB 2Y1RI 5HVGA 3U27A 3D67A 5C25B 3F73A 3DLJA 3EYZA 2NPIA 2M3DA 4CNYA 1RTDB 5IT9Y 3MR5A 4RL1A 2NUHA 3U1MA 3DOKB 4OYMA 1NDLA 1H3DA 3HFKA 2ZOGA 4WFNQ 1XJWB 4DN0A 4PWDA 2Z57B 1S79A 2FC8A 3HF5A 3T1YF 2JWNA 3HHEA 2J0WA 4QCLA 3I56S 1YJUA 1IN0A 3HULA 3JAMY 4QYZK 1SC3B 3FCVA 4WYWA 2K7JA 4JI8J 3V81A 2BA9A 4U67Q 4QWDA 3GTYX 3MD3A 4ZPAA 2YTCA 2RRAA 4FF4A 3VALA 1DQ9A 2UV8G 3PFEA 1C4CA 6FDRA 3GV8B 2YQ3A 2W2MP 5H9FJ 5H1SV 2QTWA 2W01A 2XCAA 2CPJA 2RT3A 2AKWB 1QSLA 3BBBA 1SVDA 3DLKA 1FESA 4EZ9A 5K8MA 4P52A 2MKYA 3NNHA 3N5FA 2Z2LA 1PSDA 5DG7A 4ANEA 5KG7A 1TK5A 5M2RA 3BR8A 2DR6A 5LMUJ 1KR4A 4GO7X 3BGUA 2JEFA 1T03A 1JIHA 3H4DA 3RJMB 4DR7F 1GNKA 1HBMA 1FFWB 3R27A 2KKHA 4D3HA 2JEIA 3BO2A 3OXGA 1TV6A 2EFPA 4EZ6A 3CJ8A 2B8QA 3HHKA 2Z2ZA 2YNFA 3WC0A 1WI6A 2PIIA 3P45B 3GE9A 4ED5A 2EFVA 4GVBB 3W62A 1W2BR 5AXMA 2XNRA 1LFWA 1BLUA 1RT6B 2N7YA 3RBZA 1OSDA 3OXLA 4DV7F 3D9BA 4JI4F 1UA1A 4NXNJ 2VKRA 4C11A 3TAQA 2A18A 3RW7A 2EC0A 1FKAF 3UR3C 4E2FB 1M1KT 3NGSA 1C1CB 4TXSA 3ILOA 3PO4A 1T0TV 2W9CB 3VV2B 2FHOB 2ROPA 1ZTTA 3RZAA 4UOGA 3W9JA 4N5SA 1SKRA 4C8YA 4DR6F 3D0IE 3QJPA 4MTPA 5C24A 2H4YB 3G86A 3DRRA 3FVYA 3D4JA 5HN0A 2XSFA 4ETXA 1YJ7A 4DPWA 2P9GA 2RQCA 4K2XA 3FFIB 2UUTA 5A8KB 2VASA 1CEZA 2ZH5A 1YITS 1S9EA 5KFQA 3QJLA 1FWLA 3PM9A 1LW0B 2KXHA 5H9EJ 2DHAA 5AXKA 2NZCA 1EQMA 1R7IA 1ZS6A 1R8PA 4A8WA 3V2UC 1TQLA 3I6PA 3MGJA 1VQKS 3DN9A 1Q5VA 2VBZA 1CLFA 5DS7A 4IH5A 1R8BA 1RT1B 3TQEA 4WP8A 4O4GB 1G1XA 3EDRB 3M2VA 3MAAA 3Q22A 3M8RA 2G0IA 4KV8A 2X1AA 2VB6A 4URSA 5I4MA 2XS5A 1U1KA 2MLXA 1F2GA 2XMJA 2R7SA 3AFGA 2U1AA 1W2IA 2KRBA 3WIVA 1LW2A 2H5JB 1SUQB 3H40A 1M90T 3QBCA 3D1HA 4ZVEA 1W26A 1VQ5S 3GONA 3DYAB 2VQFJ 2DO4A 4LRAA 3UDVA 2GJIA 3TYTA 2RDIA 2LMIA 3F56A 3GMGA 1WJ9A 2L9DA 1VQ7S 2UV8A 1LQ9A 2GS8A 4ED4A 2MQQA 3KLIA 1FJGF 2WSEC 2GVZA 4F0HA 1EP4A 5KFSA 1HNIB 5CHCB 3CCZA 3D6FB 2O66A 3ZTQA 4LF6J 1XN9A 1S1TB 4M5MA 2DGXA 1S1VB 4C4WA 5AJ3J 3QT6A 4ED1A 3J7AN 1OSCA 4ES2A 1FK9A 2QEXS 3LP2A 1SJFA 1FEHA 5EWGA 5JMNA 1T9VA 3MEGA 1MSWD 2AYEA 1JJ2R 4ZP9A 1ULRA 2CIMA 4BLGA 4O0IA 2B4PA 4JV0A 1ZAVA 1RAEB 2ZC4A 2CNOB 1IKVA 3G2XA 3TEGA 2B56A 1HNXJ 2G2ZA 4AQYJ 4WU3A 3TUZC 4PXCA 4LF5F 3EPIA 4LBHA 2LQ9A 3G82A 3DNCA 4Y2IA 3N79A 4IYQA 7FD1A 2IFXA 2YKAA 3MMBB 4G6VB 1JMTA 2GQQA 2H3EB 1OYEA 3H5XA 2R7UA 2G1DA 5KFXA 1KTVA 3SI8A 2J8SA 2HQFA 2D9PA 2FJDB 4PEOA 1Z1ZA 2QT7A 3M9NB 2RAQA 3AT1B 1HNVB 1RJJA 2OELA 4ZVPB 3H90A 3CEDA 1P9QC 1KKHA 4DBQA 1IKWB 1M0SA 2OGUA 4X64F 1S10A 4LSLA 1J5OB 2IVMA 5FJ4A 3VF0B 1QLNA 2E9RX 4DS4A 2MTLA 3P5TL 1WHVA 4NMLA 2BEFA 1VQSA 3DU5A 1RHKB 4EWTA 3PX4A 2F4VF 3D0GE 2GMLA 4NX9A 2M2BA 4ECQA 4N77A 1HBUB 4DUZJ 3MI7X 4CM0A 1KD1T 4DV6J 4ECXA 1NAQA 2QMXA 3CJ4A 5AE1A 2CAJA 3FSXA 2A1BA 2PMZD 1H7WA 2C2ZB 4QW8A 1WEXA 1N32F 3SV3A 2JOQA 2ABYA 2YPZA 1DBDA 2DXFA 4DCPB 1CVJA 3KK2B 1GTHA 2JX2A 2QX0A 3S8SA 3MTKA 5CABA 3AQOA 1P1LA 4QBUA 2W7PA 2O01C 4U8VA 4LFCJ 2OFHX 2AJ4A 1VJWA 3TZXA 3NMRA 5B0DA 3BGOP 1DHMA 1ZM9A 2RD5C 2W4CA 4K5RA 4DDFA 3MPDA 1JLQA 3F41A 4N56A 3V4IA 1EJ7L 4LR7A 3VGVA 3CO0P 1S1XB 3DRPA 3K0JA 3ENQA 4URGA 4J9UE 2IJRA 1TAQA 5ETPA 3MM8B 3M2UA 1D9FA 1IQZA 1PAEX 2OO4A 3BYPA 1IM6A 2YNIA 3T1AA 3M8QA 4B3SJ 2DNHA 5KFUA 4B9LA 4USUA 4KB7A 5C25A 1RT3B 3IM9A 3TANA 5KFVA 1X4CA 3JTOA 3PR4A 1RTDA 2Y1LB 1CS4B 3HI9A 3TI0A 3AHPA 3GV5B 1NKCA 5G0RB 3DOKA 3EX7B 2XMWA 2V2KA 2E66A 1LFPA 1FTRA 3AXKA 1RU2A 4M95A 4LF6F 2G4BA 2IMOA 1N33F 4WKYA 2M7SA 1YVFA 4ELVA 3W8GA 1BQXA 2PI5A 2UP1A 4Z7YA 1SJ4P 4F26A 2HQCA 4K0KF 4PXEA 1M5SA 4QYRA 4QYZJ 2RSQA 1D1UA 3RRHA 2F9JA 4JI6J 4DR4J 4LIRA 4ECUA 2XLIA 1ZPWX 4YB5A 1L3VA 3KHHA 2FYXA 4OYOA 3J81Y 2R8GA 3O44A 2WVDA 5KT7A 4LF8J 4H4KA 1EIYB 2OH2A 2DITA 1NSKL 4AQYF 5EX0A 3P49B 1YG0A 4YR0A 3CJSA 2YKMB 1KS2A 4KR0B 3GV7B 1YDLA 2MZTA 3ISND 1K73T 1KOHA 3N6NA 3TO8A 2E5LJ 4JV1A 1YQHA 5HI7A 3QMQA 3PZPA 3PW4A 3KYLA 4EBDA 4JBCA 2W4PA 4PUOB 2GQCA 1TFWA 1KLMB 1AYEA 1U45A 2B4OA 2NYIA 4ZPBA 2V2VA 1R0BG 4GVBA 1R0CB 3SCLE 4CLZA 3N01A 2E5HA 2ZUGA 2XQCA 3AAWB 4LFAJ 2JFDA 2CADA 5HO4A 3DLLQ 2DH7A 1U1LA 4V19J 3PG9A 3C16B 2VV5A 3TR5A 3VQSA 3GIRA 3KLHB 4CZCA 2N7CA 4NCGB 4G1IA 1XR6A 3KK1B 1ZAWA 1EAYC 1C1CA 1X8DA 5MLCV 5D78A 5F41A 2XMKA 4U7CA 3GJRB 1UJ5A 2W9CA 1BQMB 2PE8A 1M5HA 3OLAA 4C6AA 2DISA 2DIVA 5F3TA 1WHYA 5L1LA
chains in the Genus database with same CATH topology
3FCWA 1B99A 2DY9A 3EJMA 1VYAA 1NDPA 1KDNA 1NB2A 2B8PA 3BBBA 1NDKA 1NSQA 3VVTA 3PRVA 4ANCA 3EVWA 5CABA 3FBFA 3EE3A 1JXVA 4ENOA 3Q8UA 4FKYA 1S59A 1F3FA 1S5ZA 3DDIA 1K44A 4DZ6A 1LWXA 3NGSA 3VGSA 4ANEA 1BHNA 3ZTOA 1MN7A 4UOHA 4F4AA 1UCNA 3B6BA 1XIQA 3VGTA 2CWKA 3L7UA 3MPDA 3Q8YA 1BE4A 1PKUA 3NGUA 2DXDA 2AZ3A 1NDLA 4UOGA 1XQIA 1WKKA 3VGVA 2DXEA 3GPAA 4WBFA 1S57A 3PJ9A 3JS9A 2BEFA 4DUTA 5C7PA 2HURA 1WKJA 1PAEX 2HVEA 2ZUAA 4FKXA 3G2XA 3ENAA 3WX8A 3ZTSA 2NCKL 5CAAA 3DKDA 1B4SA 1LEOA 3ZTPA 3EVMA 1HIYA 3EVOA 1EHWA 2B8QA 1NSPA 3EM1A 3Q8VA 3Q89A 3B54A 1NHKL 5IOLA 1MN9A 3FBCA 2AZ1A 3EMTA 3FCVA 1U8WA 3ETMA 1HLWA 3NGTA 4ANDA 2DYAA 3VGUA 4CP5A 1F6TA 3VVUA 1BUXA 1NUEA 3GP9A 1HHQA 3Q83A 5BXIA 1WKLA 3BH6B 1NDCA 1NSKL 2BX6A 4S0MA 3FKBA 3FC9A 3EICA 3NGRA 3Q86A 4EK2A 2VU5A 4UOFA 1NPKA 3BBFA 1ZS6A 3BH7B 3ZTQA 2HVDA 4C6AA 1NLKL 1NCLA 4O0NA 4KPCA 4F36A 3FBBA 3ELHA 3ZTRA 2DXFA 3BBCA 4HR2A 4DI6A 3R9LA 1W7WA 4W98A 3FBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FCW A;  1B99 A;  2DY9 A;  3EJM A;  1VYA A;  1NDP A;  1KDN A;  1NB2 A;  2B8P A;  3BBB A;  1NDK A;  1NSQ A;  3VVT A;  3PRV A;  4ANC A;  3EVW A;  5CAB A;  3FBF A;  3EE3 A;  1JXV A;  4ENO A;  3Q8U A;  4FKY A;  1S59 A;  1F3F A;  1S5Z A;  3DDI A;  1K44 A;  4DZ6 A;  1LWX A;  3NGS A;  3VGS A;  4ANE A;  1BHN A;  3ZTO A;  1MN7 A;  4UOH A;  4F4A A;  1UCN A;  3B6B A;  1XIQ A;  3VGT A;  2CWK A;  3L7U A;  3MPD A;  3Q8Y A;  1BE4 A;  1PKU A;  3NGU A;  2DXD A;  2AZ3 A;  1NDL A;  4UOG A;  1XQI A;  1WKK A;  3VGV A;  2DXE A;  3GPA A;  4WBF A;  1S57 A;  3PJ9 A;  3JS9 A;  2BEF A;  4DUT A;  5C7P A;  2HUR A;  1WKJ A;  1PAE X;  2HVE A;  2ZUA A;  4FKX A;  3G2X A;  3ENA A;  3WX8 A;  3ZTS A;  2NCK L;  5CAA A;  3DKD A;  1B4S A;  1LEO A;  3ZTP A;  3EVM A;  1HIY A;  3EVO A;  1EHW A;  2B8Q A;  1NSP A;  3EM1 A;  3Q8V A;  3Q89 A;  3B54 A;  1NHK L;  5IOL A;  1MN9 A;  3FBC A;  2AZ1 A;  3EMT A;  3FCV A;  1U8W A;  3ETM A;  1HLW A;  3NGT A;  4AND A;  2DYA A;  3VGU A;  4CP5 A;  1F6T A;  3VVU A;  1BUX A;  1NUE A;  3GP9 A;  1HHQ A;  3Q83 A;  5BXI A;  1WKL A;  3BH6 B;  1NDC A;  1NSK L;  2BX6 A;  4S0M A;  3FKB A;  3FC9 A;  3EIC A;  3NGR A;  3Q86 A;  4EK2 A;  2VU5 A;  4UOF A;  1NPK A;  3BBF A;  1ZS6 A;  3BH7 B;  3ZTQ A;  2HVD A;  4C6A A;  1NLK L;  1NCL A;  4O0N A;  4KPC A;  4F36 A;  3FBB A;  3ELH A;  3ZTR A;  2DXF A;  3BBC A;  4HR2 A;  4DI6 A;  3R9L A;  1W7W A;  4W98 A;  3FBE A; 
#chains in the Genus database with same CATH topology
 4I2Q B;  4HAC B;  4EYI B;  3FEZ A;  3KG4 A;  3BO4 A;  2CJY B;  1UVL A;  3FFI A;  5A8K A;  1QSS A;  4A8K A;  1UET A;  3QT8 A;  5A8R B;  2DNK A;  1U1N A;  3ZTO A;  1LXN A;  2IM1 A;  4C8N A;  3ZNU A;  4NL5 A;  5CQG A;  1BE4 A;  2R2S A;  1X5T A;  1LW0 A;  4U9R A;  4ED8 A;  4RWW A;  1UVM A;  3BQ2 A;  2EFO A;  1H2T Z;  3HHL D;  2HKE A;  1RTI B;  4ED2 A;  2J6T A;  1S6Q B;  2GZO A;  4PPZ A;  2LXF A;  1TR0 A;  4C8Z A;  3LP0 B;  3OL7 A;  3F44 A;  5K8P A;  4CT9 A;  1Q81 T;  1RT1 A;  5F8H A;  5M2U A;  2ZH4 A;  4F25 A;  1WNE A;  4O4G A;  2R8J A;  4TU8 A;  4WKR A;  3H20 A;  3SQG B;  1AUS L;  1WTF A;  5B09 A;  2AX0 A;  4L3N A;  2DNG A;  4BWJ A;  1PYO B;  5A2Q U;  3MUT P;  4FP9 A;  3EIC A;  4B3S F;  3QSY B;  3X3U A;  4MIB A;  2DR7 A;  3VAH A;  5KG5 A;  1OJ4 A;  2G9O A;  3T1H J;  1D9A A;  4DJB A;  1Y5I B;  1SUQ A;  1B7Y B;  1XBW A;  2JLG A;  1NB2 A;  1IJF B;  1G6B A;  1HQU B;  1PO6 A;  1AW0 A;  2BJ7 A;  3DYA A;  4CH1 A;  4E8U A;  3WHI A;  1U6F A;  5D0E A;  3OFH A;  2YY3 A;  1UTA A;  2CG8 A;  3ZZR A;  1XQI A;  3ZC4 A;  3P3D A;  4HEA 9;  4TYB A;  2CWX A;  3CCJ S;  4FVC A;  3TEH B;  2C3P A;  2HWI A;  2LDY A;  4R0J A;  1HNI A;  3R5C A;  2GW8 A;  3CJQ A;  2ZH7 A;  1NU4 A;  3B8H A;  3J7Z T;  1B4S A;  2DGS A;  1IBL F;  1S1T A;  2KG1 A;  2G0C A;  3NXZ A;  4PKD B;  1S1V A;  5IS2 A;  2C2D A;  1L3T A;  2FGC A;  2FC9 A;  4GVL A;  2FLN A;  3QID A;  3OTD A;  3K8W A;  4F7V A;  1OYD A;  4C3M A;  3WIU A;  1CSJ A;  2BX6 A;  3OR1 B;  3DMJ B;  3V6K A;  3OTO F;  2E7W A;  4NZ7 A;  3HMJ G;  2A0F B;  3KLG B;  3PW0 A;  3ZZP A;  5KT2 A;  3G6X A;  1DZ5 A;  4N76 A;  2FQQ B;  2E5I A;  1UPM B;  1S1U B;  1N8R T;  5IFM A;  1R0A B;  4FYD A;  2ZHO A;  3LA0 A;  4EO8 A;  3IXQ A;  4MKA A;  2E44 A;  5IV3 A;  2CQH A;  1S5Z A;  2MDA A;  3I32 A;  4DL6 A;  1TMJ A;  2DGO A;  2J9D A;  2PFF B;  2YKP A;  4JI1 J;  5FDL B;  4B9T A;  5HSP A;  5BYQ A;  1QAI A;  3QRP A;  4DU8 A;  2EKN A;  4OJ3 A;  1KP6 A;  1TKD A;  4OV1 A;  4DV0 J;  2Q43 A;  2UUC J;  1GAO A;  4W92 B;  2IRY A;  2KL8 A;  1L3U A;  1J27 A;  1Q1K A;  4PCQ A;  1VQL S;  3MXH P;  1HNV A;  3A4T A;  4F4Z A;  4ZCI A;  3CTR A;  3KTQ A;  1NK4 A;  1RIS A;  2XTJ P;  2LEP A;  4OX6 A;  5EN1 A;  1IKW A;  2IM2 A;  1J5O A;  1V3Z A;  2HBZ B;  3KG1 A;  1QE1 A;  5ETT A;  1CJK B;  2VJV A;  3K89 A;  1NO8 A;  3EJM A;  3M8S A;  1C0T B;  5LT5 A;  5HQM A;  5KFO A;  1RT5 B;  4A8S A;  1HBU A;  1UFK A;  3RBE A;  2JVO A;  3NRB A;  2WVE A;  3H5S A;  1HYS B;  2GFF A;  3RB6 A;  3S7R A;  2KN4 A;  1VBY A;  1TZ0 A;  2EVZ A;  2ZBP A;  2HRY A;  3QPI A;  5KFD A;  4LR8 A;  4NMX A;  2DGU A;  1Q95 G;  1RHU B;  3JAM U;  2IM3 A;  4NLW A;  5HL7 Q;  5HQ8 A;  4B3T J;  1S9F A;  4NE9 C;  1IBM J;  3KK2 A;  1SQG A;  2MQP A;  3ZTP A;  2E29 A;  2RS8 A;  1G2E A;  4B9V A;  1MN9 A;  2CPX A;  4K5S A;  2Z56 B;  3CUN A;  2KI2 A;  4DR3 J;  1HFE L;  2CRL A;  4UTG A;  3UCZ P;  3Q86 A;  2BRK A;  4MJK A;  2W7O A;  1UEK A;  1IJE B;  4OJH A;  4IOC Q;  1VBZ A;  3M8P B;  1S1X A;  1FRM A;  2WBR A;  4ECV A;  3TVY A;  4DV5 J;  2HWT A;  5B0F A;  1SH2 A;  3LP1 B;  3MM8 A;  1M5O C;  2IDE A;  1ZYQ A;  3QYY A;  1HWL A;  1GQE A;  1SC1 B;  2HIY A;  2CYY A;  3JYT B;  2PD1 A;  1OQ3 A;  4NLR A;  1RT3 A;  2MZS A;  3H42 A;  3CNQ P;  1ZAX A;  2F8E X;  1IWG A;  2GAG C;  3M6W A;  4WFX A;  1SCJ B;  2D7S A;  1CS4 A;  3AJ2 A;  3I9Z A;  3OD2 A;  1EX8 A;  1YJR A;  1VC6 A;  1Q5Y A;  1NKB A;  3DLE B;  3W3S A;  3TA0 A;  4ZA1 A;  3AA9 A;  1H74 A;  1YX2 A;  2BR0 A;  1AZS A;  4C8K A;  4XTT A;  1WI8 A;  2GA7 A;  2V68 A;  3GLJ A;  2W2Q P;  3R97 A;  4DL2 A;  2J7K A;  2M9K A;  1S0N A;  4ZDN A;  3E8O A;  3THP A;  1LKZ A;  5EX3 A;  3J81 j;  3TA1 A;  1YJ9 S;  4O0N A;  2VON A;  4FPI A;  3HCX A;  4DLG A;  3OHA A;  1DY3 A;  3T9Z A;  1ROF A;  1F60 B;  4Y2A A;  1FD2 A;  2ERR A;  1KRP A;  4F3O A;  5LL6 d;  1EAR A;  5ETK A;  3L09 A;  1C1B B;  3J7A 1;  3D3C J;  2QA4 G;  1HWU A;  3B82 A;  5RUB A;  4DR2 J;  3ULH A;  3HLU A;  3PJ9 A;  4LF4 J;  4JOU A;  2YKM A;  2CQ1 A;  1VS3 A;  1W25 A;  5CYQ B;  1SI9 A;  4DPT A;  4WFA Q;  4ZP8 A;  4KSE B;  3PW7 A;  4EU0 A;  1RHJ B;  3GU0 A;  3LAM A;  2FY1 A;  2KZZ A;  4M8L A;  1J2V A;  3HT0 A;  2HGM A;  1OPI A;  4PUO A;  5HQL A;  2WW4 A;  3E3X A;  2UUC F;  1KLM A;  2X7I A;  2XY5 A;  2E9Z A;  1NKE A;  1O6X A;  2V4R A;  1D09 B;  2VOP A;  4F67 A;  3W64 A;  2LKZ A;  2UXC J;  3PCO B;  4C0H A;  1Y7P A;  5GMK a;  5LMN J;  1ZOT A;  1N34 J;  3QGG A;  1FXR A;  2CPE A;  4LRF A;  3E51 A;  5E33 A;  3VAJ A;  4K4Z A;  5I3Q A;  3AB4 B;  4DV3 F;  2AJ1 A;  4N7T A;  1WG4 A;  3BPD A;  3C16 A;  2A6O A;  1T9T A;  2UXB F;  3NEK A;  1MN7 A;  1GX6 A;  4WP9 A;  4NZ6 A;  3KLH A;  3IFE A;  1K0V A;  4NCG A;  1XNQ F;  3I9V 9;  3KK1 A;  3VQT A;  2AGO A;  5E0O A;  4QOT A;  2YWH A;  3VZI A;  1RTZ A;  2IA0 A;  1BQM A;  2PT0 A;  1CQN A;  2LQ8 A;  4DZD A;  4HLB A;  2HND A;  5BYS A;  1KTQ A;  1V5I B;  1KQG B;  1T95 A;  2AGP A;  4I2Q A;  4DS5 A;  1OWX A;  1TKZ B;  4E0D A;  3GFH A;  4YME A;  4HAC A;  4NRT A;  2AQ4 A;  5A76 A;  2CPY A;  3V6J A;  3N0V A;  3VAI A;  2LCW A;  1IBM F;  3DDN A;  1BWV A;  5A8R A;  2C2O B;  3MM7 B;  4TYA A;  1VQ8 S;  2D41 A;  1GXL A;  4CCH A;  2QMW A;  1Z4U A;  1Q82 T;  3I82 A;  3DRX A;  3VR1 A;  3QQC D;  3J7Y I;  4X4P A;  2NQP A;  3HHD A;  1JB0 C;  1RTI A;  3MAH A;  1T9X A;  3SDE B;  3GCX P;  2EK1 A;  1S6Q A;  4OQJ A;  4OZJ A;  2DR8 A;  1FA0 A;  3K5O A;  3PVX A;  1RTH B;  1FTC A;  2X3G A;  3T9N A;  3LP0 A;  5DG9 A;  1UJ4 A;  4DZ6 A;  4ZVU B;  4DV5 F;  5HAO A;  4I67 A;  2VBX A;  3SQG A;  1S0O A;  4C8M A;  3S1T A;  1YJN S;  2QSF A;  3PTW A;  1QAJ A;  4FVM A;  4P6Q A;  2OD4 A;  2Z8Q A;  4YDX A;  2JFK A;  1N88 A;  2Y1I A;  2DNZ A;  3UO0 A;  3DGV A;  4USV A;  2YX1 A;  2XWY A;  4CO1 A;  3GG1 A;  3RG6 A;  1HI0 P;  1NRK A;  1HQU A;  3TJA A;  2N4D A;  4YR3 A;  1ZA2 B;  1R8H A;  3C3L A;  5J2M B;  2F8M A;  2FZK B;  3THV A;  2DTJ A;  2K3K A;  4DPY A;  2QIF A;  4F4K A;  2VU5 A;  1U1O A;  3HFV A;  4IFY B;  2MY8 A;  1TKX B;  1DAR A;  5I3P A;  4UQT A;  1ZM2 A;  1KVK A;  3FCH A;  1EKS A;  3HT3 A;  3BSO A;  2C28 A;  2BQR A;  5DM7 Q;  4DR5 F;  5LXY A;  4AL7 A;  4P71 A;  4I2P B;  2VDI A;  4FYY B;  4PXB A;  5KFP A;  3H5Y A;  1K44 A;  2HNZ B;  4L6V 3;  1HWK A;  1ARO P;  2LA4 A;  2ZBI A;  5C2C A;  5KOW A;  1A0O B;  3PYD A;  4NA2 A;  4DL0 C;  4HHJ A;  1XNR F;  3MPU B;  2FY8 A;  4M1K A;  5CH7 B;  3OR1 A;  3DMJ A;  1Y5L B;  3M1V B;  3D2W A;  1RDR A;  1TK0 A;  3V6H A;  1B0V A;  2ZBC A;  3GWC A;  3KLG A;  1DAX A;  4ZHR B;  4AXJ A;  1LEO A;  3CD6 S;  4K8R A;  1S76 D;  3CW2 C;  3MTJ A;  1S1U A;  5ETM A;  2MB0 B;  4LF4 F;  2VG5 B;  4DCO B;  2XBP A;  2AYB A;  4DF8 A;  2APO A;  1FCA A;  2Y0S D;  2Z0G A;  4UF4 A;  5FDL A;  3POT B;  3RUB L;  3TVZ A;  2NXJ A;  2CFX A;  1D3W A;  4KHR A;  4JI0 F;  5GAE I;  4P74 A;  2E9T A;  2OSQ A;  3DU6 A;  3PR5 B;  5CCL A;  3UDL A;  1RAC B;  4NLY A;  5LMN F;  3OTE A;  1I5O B;  4LF7 F;  2IMW P;  4XPE A;  4EEY A;  4DPU A;  4OHZ A;  2AJQ A;  1VRQ C;  4QIV A;  4AD6 A;  4B9N A;  3NCR A;  4A47 A;  1O0P A;  1R6V A;  5C5J A;  4K4V A;  1CJK A;  1FXL A;  1VDH A;  1WOO A;  3N28 A;  3NNA A;  1C0T A;  1SXL A;  1RT5 A;  5IQQ A;  1TP7 A;  1X4H A;  4ER8 A;  3W65 A;  4IH6 A;  1NUE A;  4KHP J;  3G9C A;  1HYS A;  1LWF B;  1ZZN A;  1WWH A;  4IRK A;  1RKI A;  2D69 A;  4JI7 F;  2QC3 A;  2QYG A;  3QWU A;  3MCS A;  5GME A;  3D66 A;  4F3Q A;  4UY8 T;  2FLP A;  2RUS A;  3V4M A;  1VYA A;  4NA3 A;  2QO3 A;  3P8B B;  2VHG A;  1WAC A;  4PXD A;  2V9K A;  1Q78 A;  3WBZ A;  2O3D A;  4HHH A;  3ZZO A;  3OHB A;  3CJ2 A;  1TU0 B;  5KG4 A;  2BZ2 A;  1P1T A;  4Z2X A;  3CCR S;  1GH8 A;  2GAH C;  2GVD B;  2POK A;  3J81 U;  2A10 A;  3TOQ A;  5D3G B;  3M6X A;  5CYM B;  4CO5 A;  1JNZ B;  1Y5N B;  3H5U A;  1Q86 T;  1SKU B;  2JEG A;  2ROE A;  1VI7 A;  3IWL A;  3BYR A;  3M8P A;  1T8E A;  2MKC A;  5E3R A;  4AL6 A;  3RW6 A;  3GB0 A;  3HJF A;  2KM8 C;  3LP1 A;  4DV1 F;  5DLF A;  2EFQ A;  3ISN C;  3DRS B;  1WHX A;  5KFZ A;  4ERD A;  2VQE J;  3IP0 A;  2YH1 A;  3JYT A;  2HVI A;  4UW2 A;  2FLO A;  2FVC A;  3NAI A;  4M5K A;  1JLE B;  1SIW B;  3MUR P;  4Q0B B;  8ATC B;  4XIU A;  1UEV A;  5A6W A;  3QRR A;  1HL6 A;  4A8O A;  2XM3 A;  3ENW A;  3PRV A;  1VLO A;  3MCM A;  2K1R B;  3O8W A;  3AB2 B;  3PO5 A;  4OMF G;  3DLE A;  5GVQ A;  2KU7 A;  1U09 A;  3CWJ A;  4KT0 C;  5L9N A;  1LOU A;  2HZV A;  1SL1 A;  1N4L A;  1KN6 A;  1F5B A;  2BRL A;  3T6J A;  3ZNJ 1;  2A2C A;  2JC1 A;  4OX8 A;  1LWC B;  3EGZ A;  2DD8 S;  1UL3 A;  4MYU A;  2GHW A;  1IKX B;  2CQP A;  3EZ5 A;  4X65 J;  3A12 A;  3H2V E;  1GX5 A;  3HO1 A;  3U1L A;  2EG1 A;  4DFP A;  4JI5 J;  1C1B A;  1YTY A;  4A4J A;  2MZR A;  4EBE A;  1MRO B;  2RF2 B;  1JWW A;  3J7Y U;  5D0G A;  3NAH A;  1J5E F;  4NLO A;  4YEA A;  3BGL A;  1VK3 A;  2YNG B;  4QU6 A;  1M1H A;  4ED0 A;  2XO6 A;  2WSF C;  3K17 A;  4DL7 A;  2CJA A;  4ECW A;  4FZV A;  5CYQ A;  2XG8 A;  5FII A;  4PG8 A;  5BR8 J;  2H4W B;  4YHH F;  1URR A;  3J80 U;  1N52 B;  1CG2 A;  2FHJ D;  5K8O A;  2PN6 A;  2VPY B;  1O51 A;  1IR2 A;  3FEY B;  1QUV A;  1OY6 A;  1G3O A;  4NEZ A;  4WF9 Q;  3ZO7 A;  2QE5 A;  1SL0 A;  3MFH A;  1WKJ A;  2K7K A;  1SC4 B;  3CCQ S;  1UW4 A;  2ZJP Q;  2PO4 A;  3NMA A;  1RLD A;  2FZG B;  2RRB A;  4I6W A;  3PHT A;  1DTQ B;  5KFC A;  2MPU A;  3M32 B;  4J9Q A;  5ETO A;  5DZ7 A;  3HVW A;  4CP5 A;  5HP1 B;  1HHQ A;  2X51 A;  2DEI A;  4KH1 B;  3NS5 A;  3UPF A;  2E1A A;  3BGR B;  2D3O 1;  2K2P A;  5B0A A;  2CA9 A;  2KVQ E;  1N0V C;  4Q7A A;  3IO1 A;  3JQJ A;  1WDD A;  4HTJ A;  3FK4 A;  1FEE A;  3BPS P;  3A8E A;  5KT4 A;  2LQJ A;  1M5P C;  1GK8 A;  4ZLN A;  2A3J A;  2C3Y A;  4DQR A;  4G3I A;  1TKZ A;  1RSC A;  3CD0 A;  4KYZ A;  4QIF A;  5DM6 Q;  4KC5 A;  2VOO A;  3A1Y G;  1U49 A;  1T9U A;  3FZB A;  2NRE A;  3IBC B;  3MM7 A;  4Y28 C;  3MMA B;  4V1A k;  3A3O B;  4QPX A;  2DR9 A;  3W9H A;  4RWX A;  4NCB A;  3JTP A;  4Z7C A;  4RNN A;  3MM6 B;  2V2Z A;  4QR1 A;  3SDE A;  3L95 X;  3TZY A;  4MT1 A;  1ELO A;  3CF5 Q;  3NGT A;  4W4M A;  1NJI T;  2V4J B;  1K0T A;  1RTH A;  2CNL B;  5IWA J;  2LLZ A;  1PJ7 A;  4ZMM A;  3I4H X;  4X66 J;  2K3I A;  4RNH A;  2JSX A;  2EC2 A;  1HBO B;  2E1C A;  5GAD I;  1RAO A;  4OYB A;  2KXF A;  2OPR B;  4HI2 A;  4LF9 F;  1W7W A;  4WXW A;  3R7B B;  2EEY A;  1NDK A;  1FRL A;  5KFA A;  3BN7 A;  1VQ9 S;  4Y34 A;  2R2U A;  1X0F A;  1IR1 A;  5CZX A;  1K8A T;  4IO1 A;  2VFU A;  2EFG A;  2CWK A;  4CO2 A;  4IH7 A;  3SCI E;  2RDJ A;  1RYR A;  2XUL A;  4PYA A;  4C98 A;  3OQ2 A;  4HVZ A;  5J2M A;  3MCN A;  3HKZ D;  3BQ0 A;  1RAF B;  2C3U A;  2HK3 A;  4F8R A;  4C0O C;  2D3O R;  2HS0 A;  4IFY A;  5KOX A;  4B9M A;  1TKX A;  4IQM A;  2E7X A;  3CC7 S;  3Q8V A;  4L76 A;  2V6A A;  1H38 A;  1UFW A;  2V94 A;  4I2P A;  1SB6 A;  1APS A;  5IM0 B;  2HNZ A;  4K2J A;  2HYI B;  5DDQ C;  2V34 A;  4CO3 A;  4X2B A;  4JI5 F;  1UVN A;  3OTC A;  3SSQ A;  2DK2 A;  3M1V A;  1RWN B;  1S99 A;  2LXU A;  1KFS A;  1UJ6 A;  4ZCK A;  3CT9 A;  2EK6 A;  2BOA A;  3AD9 C;  3VVT A;  3T1Y J;  1VLY A;  1S7H A;  5ETQ A;  4ZHR A;  2OEJ A;  3M8Z A;  4ED7 A;  5J2N B;  1R27 B;  3MPV A;  2VG5 A;  2Q66 A;  3KNA A;  1YJV A;  2DIU A;  2WOM B;  3K8V A;  4TNO A;  2BXJ A;  2ADB A;  4KE5 A;  4GKJ F;  2N3O A;  1DTT B;  2XMT A;  1SJ3 P;  2IVF B;  2VF3 A;  3POT A;  1HBN B;  1WF1 A;  4DV4 F;  3AJ1 A;  1RWW B;  2ZH3 A;  3TQ1 A;  4UY8 5;  1JXL A;  3CJR A;  1HLW A;  3T5L A;  3W2V B;  3RB3 A;  1LWE B;  1FJE B;  5GAH I;  3WC2 A;  3NGR A;  5K14 B;  1FKP B;  2B7C B;  3DFE A;  5HVH A;  1ZH5 A;  1SQF A;  3BRE A;  2HQ3 A;  3RR8 A;  2HBQ B;  1B99 A;  2CJX B;  1IBK F;  4FS2 A;  1IM4 A;  4HH1 A;  3MED B;  2XYG B;  4OYP A;  3FDS A;  3OXF A;  1REV B;  3CC4 S;  2OI2 A;  4DSK A;  2ZE2 B;  4O3O A;  1XMQ F;  3QGP A;  2DCL A;  2QMU B;  1FNM A;  3N5B A;  1RKJ A;  1T05 B;  5HBM B;  1NJW A;  2D1C A;  4CYU B;  5KT3 A;  1LWF A;  1YK9 A;  2MJU A;  2W1B A;  1X60 A;  4QIE A;  1P9Y A;  3DRY A;  2ZH6 A;  3CDU A;  4OZN A;  3SQO P;  4DV7 J;  4JI4 J;  5I42 B;  5E5N A;  1U24 A;  1JJC B;  2V4Q A;  1E6V B;  5DZ6 A;  3Q89 A;  3M9M B;  2MZJ A;  1FXD A;  2HNY B;  3HP6 A;  1VHI A;  4IQX A;  4P2X A;  2OPS A;  3DC2 A;  5ETV A;  2BAC A;  2VL1 A;  4NLU A;  2OJ3 A;  2BJ9 A;  1YLX A;  1VMB A;  4M5I A;  1SKS A;  4DR6 J;  2J0X A;  4F36 A;  1VQM S;  2GVD A;  3ISZ A;  4LSZ B;  1L5U A;  5EUH A;  5IWA F;  1TK8 A;  5DG8 A;  2I38 A;  3L4B C;  5D3G A;  3QAU A;  3DHW C;  5CYM A;  4C3K A;  4KTQ A;  1S6P B;  1WC6 A;  4ECR A;  2WB4 A;  2ZM6 F;  1WOP A;  1L3K A;  3BGF A;  3M2R B;  3TUJ C;  2MQL A;  5IZH A;  3LAN A;  5LSR A;  3I5C A;  3LGH A;  4F4A A;  3GIJ A;  3DRS A;  4OZ0 A;  2KHD A;  2DNN A;  1X0P A;  1MU2 B;  4CTA B;  3AQP A;  2X3D A;  1JLE A;  1X4D A;  3HHL B;  4AXI A;  4Q0B A;  1RWX B;  2HZC A;  2C42 A;  3PJW A;  2M8D B;  5JVH Q;  2R8K A;  2V50 A;  1CUL B;  2OHD A;  3PJX A;  8RUC A;  1HIY A;  4NLP A;  1U0S A;  2IVY A;  1GFW B;  2M4M A;  2K1R A;  1XC9 A;  2QLF B;  4IFV B;  2ASD A;  2DNY A;  2YWW A;  5B0C A;  4OI2 A;  5E3Q A;  1IXK A;  3W60 A;  1U25 A;  2B7B B;  3RB4 A;  1AA1 B;  1LWC A;  4DUT A;  2DGV A;  1IKX A;  2QL5 B;  3K57 A;  3IWN C;  4F04 B;  1ZA1 B;  1YJW S;  2VPW B;  4MKY A;  1KNZ A;  3NWG A;  5K9F A;  1K9M T;  2O67 A;  2BJ1 A;  1HHT P;  1FJG J;  2XCP A;  2ZDO A;  3S01 A;  1XMB A;  1JNR B;  2BOP A;  3UN5 A;  5J1E B;  3A3N B;  4PAA A;  3VAG A;  3HVT B;  3OL6 A;  1LXJ A;  3MR7 A;  4Q2M A;  1WDT A;  1VQ4 S;  3HJV A;  1CJV B;  5DGA A;  2YNG A;  5C2G A;  4IR9 A;  4FYW B;  4WFZ A;  1S7I A;  3CD5 A;  4ZPT R;  3M30 B;  3T3F A;  7FDR A;  1QDU B;  1UMJ A;  4A8Q A;  2CQ2 A;  4QR0 A;  3IWX A;  4B9U A;  4CH0 S;  3VHQ A;  1UEU A;  4HDG A;  2WVB A;  3CJ3 A;  2ALY B;  1UZH A;  3ZTR A;  3R9L A;  1Z2Z A;  5A6P A;  2R2T A;  3C14 B;  1QSY A;  3DDK A;  2VG6 B;  4O3Q A;  3OVB A;  5D4P A;  2E5G A;  3FEX B;  1NJZ A;  1PGZ A;  1CJT B;  1RT2 B;  2HS3 A;  1DTQ A;  3L3C A;  2Q6C A;  4F2R A;  2QL7 B;  2NPF A;  3UNY A;  4DQS A;  4LF5 J;  4FYX B;  3M32 A;  5EGY A;  1Q8L A;  1HNW F;  2V8P A;  3OV7 A;  3QT5 A;  3GG0 A;  5HP1 A;  1HD1 A;  1SV5 B;  2M8H A;  5DLG A;  3GYG A;  1U02 A;  3KMQ A;  3BGR A;  2V0N A;  4O3P A;  3C15 B;  4AFF A;  2VBW A;  4RBV A;  4ZIW A;  2FJV A;  1FI4 A;  1NSP A;  4KGV B;  2ZD1 B;  5JXS A;  2XEX A;  3R5J B;  4N47 A;  2Y3Y A;  4AND A;  3MD1 A;  4I7F A;  1BGX T;  2W24 A;  4LIW A;  4C2M A;  4DX8 H;  4GRS A;  2HPU A;  1MML A;  4FPR A;  2YWG A;  4X64 J;  2JNJ A;  3C6U B;  3TAR A;  2FHK A;  4QW9 A;  4OHW A;  1NME B;  1BD6 A;  4X4T A;  5KFW A;  3HSJ A;  2F4V J;  2MYF A;  1MWZ A;  3MMA A;  2XY7 A;  4WU2 A;  2KZM A;  1PC4 A;  3SSS A;  4DG1 B;  1T7P A;  2XLJ A;  1RAD B;  3MM6 A;  3CMQ A;  4J37 A;  4X84 A;  5GMD A;  2K06 A;  4R8U B;  2YKO A;  1WHW A;  2KB2 A;  2O5D A;  3MWB A;  2V4J A;  4LFB F;  2ZDP A;  3GSI A;  4H4M B;  1N32 J;  1Q53 A;  3BR9 A;  2QRR A;  1HBO A;  4DFM A;  1RHR B;  1S49 A;  2ZKU A;  5HRO B;  4Q5V A;  2OPR A;  1WOS A;  2V5H G;  1NZA A;  2FHM A;  3VWS A;  1KSP A;  1NK7 A;  1RWV B;  2F8H A;  1NH7 A;  2B9Y A;  1RWP B;  2HHX A;  5BJR A;  2V67 A;  1NSA A;  2OFG X;  1RWO B;  3VVU A;  1EKR A;  2UXD J;  3R5A A;  3OFF A;  4CLW A;  1WOR A;  2MQ8 A;  5ETN A;  3N4W A;  2HQI A;  5E2Q A;  1HPZ B;  1N5Q A;  2JC0 A;  2XMU A;  1PJ5 A;  1RBO B;  3CJK B;  1G4C A;  2FZC B;  3ENV A;  2KT3 A;  2ACY A;  5M2P A;  3FNN A;  4B3R F;  3EWG A;  1BC6 A;  4M5N A;  4FS1 A;  1S4E A;  4ZIV A;  2HHT A;  1S59 A;  4X4R A;  1X9W A;  1FHT A;  2HK2 A;  1NHV A;  3CCW A;  3PW5 A;  3B4M A;  5AT1 B;  4WE1 B;  1JLG B;  3DCA A;  2IA6 A;  3VGT A;  2LFV A;  3L7U A;  2GGP B;  1WC1 A;  4F02 A;  2VKZ G;  4LF1 A;  5HJY A;  5T14 A;  2ZHA A;  5IM0 A;  2VH7 A;  3CXC R;  2DBB A;  1UW9 A;  2QZ8 A;  2JJ4 D;  2BMB A;  3D6T B;  4USM A;  2C1E B;  4U7U D;  4CLL A;  3GJQ B;  3KDO A;  1N6Q B;  1R43 A;  4ZPW R;  4PG5 A;  2GIR A;  3MCO A;  4FKX A;  3F0N A;  3M05 A;  1WC3 A;  2P2C B;  4Y3C A;  2BM1 A;  4I69 A;  1JKH A;  1N33 J;  1RBL A;  2ZKT A;  2QN6 B;  3AOB A;  1OPZ A;  3G8T A;  2KXN B;  4P10 A;  5F0U A;  5CD4 H;  3IA0 A;  1H6K X;  5J2N A;  2HSE B;  1VRT B;  2WVF A;  2YKN B;  2WOM A;  4UOF A;  4DX5 A;  1ZTW A;  1N5V A;  4K0K J;  3GIK A;  5AXN A;  4K4W A;  1DTT A;  2DY9 A;  2BM0 A;  4NEY A;  4ZN1 A;  1X7V A;  3EVW A;  1BXN A;  5L9X A;  3D68 A;  2ZJR Q;  4ENO A;  2ZH2 A;  1HBN A;  3UN3 A;  3M4X A;  1WG1 A;  2E5J A;  4O4R A;  4OLP A;  4XAK A;  2DKO B;  1UCN A;  2YX4 A;  1R89 A;  4ZVO B;  4DPX A;  2HHW A;  4NLX A;  3W2V A;  2VIC A;  2DR5 A;  3G71 S;  1O8B A;  5K14 A;  1FKP A;  2HHS A;  3P4U B;  1FNO A;  3OL8 A;  3BF4 A;  4ELU A;  4KGX B;  1PCA A;  3B4D A;  2BE2 B;  3NLC A;  4I1T A;  4FXV A;  1S97 A;  1SPB P;  3MED A;  2C22 A;  2V8H A;  2NR0 A;  1REV A;  4CLY A;  4X4Q A;  1NK8 A;  1DFD A;  2ZE2 A;  2FJE B;  3VAM A;  4PG4 A;  2AEM A;  1FVQ A;  2MLZ A;  2GV1 A;  2AT1 B;  5DRK A;  4QIG A;  1T05 A;  3HX9 A;  3SCJ E;  5HBM A;  5AE2 A;  1VC0 A;  2I5J B;  4YN3 B;  1RQ0 A;  4DQI A;  4P7T A;  2WBM A;  1U8S A;  2RDD A;  3MFI A;  2LP4 A;  3Q8S B;  5I42 A;  2G1H A;  3C6T B;  1E6V A;  1XR5 A;  5J2Q B;  4HL9 A;  3DM2 B;  2W2N P;  2HNY A;  4P9S A;  1GMU A;  3BDE A;  2MKK A;  1S6O A;  4J9P A;  5JJB A;  2H65 B;  3KHR A;  1RB0 A;  4OLO A;  1U6Z A;  3TZW A;  3OBI A;  1WUU A;  3HHN B;  5CAA A;  1A9N B;  3SBM A;  2FUG 9;  1ICE B;  3MHY A;  4LR9 A;  2FGO A;  2YKQ A;  4IKA A;  1S6P A;  2F7V A;  2IIH A;  2UU9 F;  3EDQ B;  2UZA A;  4B08 A;  1QJH A;  1XMO F;  2P9E A;  2HQG A;  3ETM A;  3CJ0 A;  4WIQ A;  3WZ0 A;  6FD1 A;  4K50 A;  4IR1 A;  3M2R A;  3FQK A;  5F3Z A;  4A46 A;  1D9D A;  2GIF A;  2AYM A;  4Q8E A;  1LNQ A;  1VR6 A;  4AYB D;  1NK9 A;  2CZ9 A;  2UXD F;  4ZIT A;  1MU2 A;  2XYP B;  4CTA A;  1NZ8 A;  2PC6 A;  3TA2 A;  4YY3 F;  1RT4 B;  1GMW D;  1KDN A;  2HFN A;  3HHL A;  4WZM A;  2MGZ B;  1RLC L;  4R25 A;  5L38 A;  1T9W A;  2CVI A;  1GMV A;  1CUL A;  1N5S A;  3H7H B;  4OJG A;  1X9M A;  4ZJL A;  4DUY J;  1R6Y A;  4RNF A;  2VFR A;  4A8F A;  4BC9 A;  5AXL A;  3NOG A;  4WFB Q;  2BDP A;  3BN4 A;  3RBD A;  4IFV A;  3OR2 B;  5HAN A;  1RCO B;  3IAS 9;  2I0X A;  4GO5 X;  3FUY A;  3NCP A;  5CD4 A;  2F63 A;  5IC4 B;  1AXQ A;  2XGQ A;  2HAF A;  4YDD B;  4AUK A;  1Q16 B;  2MZQ A;  3MPY A;  2VBY A;  4ZVQ B;  4RO0 A;  2UUB F;  2KHC A;  4P72 A;  2C3O A;  4ZVS B;  1F6T A;  1BUX A;  2Q3P A;  2NS1 B;  4RNO A;  3A13 A;  1TFY A;  5DO2 A;  4KAI A;  1XWL A;  4KQZ A;  2PA3 A;  3MEK A;  5K5M A;  4QWC A;  2XWX A;  2HMI B;  4ED6 A;  3QZ7 A;  5ETL A;  1KEK A;  2KH9 A;  1EZZ B;  5L1K A;  2DY1 A;  4Q44 A;  3CCM S;  5J1E A;  2IRU A;  1U1Q A;  4U8Y A;  2JZ5 A;  3NG8 A;  3HVT A;  2ZOF A;  2L9N A;  1QAX A;  1IBL J;  1A7G E;  3RAM A;  5HMZ A;  3VAK A;  2LEA A;  1R3N A;  3M30 A;  5LSO A;  2FJB B;  3OTO J;  1UKU A;  2FVQ A;  2HGL A;  1HR0 F;  1JXE A;  2PMW A;  2DRA A;  3JQK A;  1MW7 A;  1A6L A;  2ZJQ Q;  2DVI A;  2V8V A;  3IC1 A;  3G6V A;  4RBT A;  2VG6 A;  3CE8 A;  3DOL B;  4WII A;  2Z4P A;  4EO6 A;  1CJT A;  3OSN A;  1RT2 A;  5B0G A;  1DJ0 A;  3GP9 A;  1PAU B;  2YVS A;  2Y0B B;  2AWZ A;  5KFN A;  1Q7L B;  3LH2 S;  2QA4 S;  1N48 A;  4WZQ A;  2ZH9 A;  3IG1 B;  3GQC A;  1SV5 A;  2HBR B;  1HNZ J;  1C2P A;  3BEG B;  3BBC A;  4L3K A;  3H4B A;  1FFS B;  3C19 A;  4B3M F;  2JLF A;  2NYH A;  3C15 A;  1FRI A;  2HZA A;  3EZU A;  4OJ1 A;  3BQ1 A;  2VUG A;  4ZVR B;  1RT6 A;  3QFW A;  3UNG C;  2UUA F;  5C42 B;  2B4U A;  4NLS A;  1FF2 A;  5A2Q Y;  3OUY B;  2R7V A;  2ZNZ A;  4Y0F A;  3ILL A;  3KLF B;  1XTZ A;  4MYT A;  1IKY B;  3QSI A;  3K5M A;  4U96 A;  5B0E A;  3TUP A;  3CCT A;  1N36 J;  3AD8 C;  2Y8W A;  5A0Y B;  4A8M P;  2IBK A;  4B02 A;  4F3M A;  3C6U A;  2KJV A;  1VBK A;  2DHX A;  1JLA B;  4F2S A;  3EM1 A;  4NLT A;  4IRC A;  5IT4 A;  5KFJ A;  4DG1 A;  4JV2 A;  5D4O A;  3PKY A;  3CCE S;  3UVJ B;  2V2Q A;  2WON B;  2R7Q A;  4R8U A;  5E41 A;  4QWB A;  3LPE A;  5D0R A;  1GEH A;  5KTQ A;  5I3U B;  2XMM A;  4XK8 C;  4XPC A;  4RJV A;  4H4M A;  5ETS A;  2Z30 B;  3RAX A;  4UUW A;  4ES3 A;  2CQB A;  2H5E A;  2OML A;  2YXL A;  1U47 A;  2RHS B;  4M94 A;  5HRO A;  2Y9H A;  4OZ5 A;  5DET A;  1K1S A;  3Q8U A;  3R6L B;  4DSE A;  1F3F A;  2XMV A;  4RLE A;  4X4S A;  2NXN A;  4QIW D;  1X9S A;  3O1L A;  4LVN P;  1XIQ A;  3PRB A;  1FX4 A;  1PKU A;  3JQM A;  5KT5 A;  1U6B A;  4DUY F;  2E1M C;  3KLE B;  2FJW A;  4J9V A;  4WBF A;  4RU2 A;  3T5K A;  2HUR A;  1B0T A;  2A6M A;  2DRD A;  1SQE A;  1HPZ A;  5DQI A;  3L7P A;  3GJS B;  3CJK A;  2YQ0 A;  3DKD A;  2RQ4 A;  2AEJ A;  3NGD A;  5KG6 A;  5CXT A;  1HQE B;  5IQ6 A;  2DYA A;  1QD1 A;  4K4S A;  2WW8 A;  2BKO A;  1BMQ B;  2C2N A;  2QLW A;  1R31 A;  4DSL A;  4WE1 A;  1JLG A;  1VQO S;  2GGP A;  1I6J A;  5F8M A;  3ELH A;  1YRT A;  3RGI A;  3I0R B;  2ZZM A;  1N6Q A;  3BM7 A;  2JDJ A;  1EET B;  5DJB A;  2U2F A;  2HHU A;  3TP2 A;  5A8W B;  4ZCL A;  2X1F A;  2AEF A;  3UD5 A;  4ITS A;  2AZ3 A;  3TWZ A;  2I9S A;  3NBP B;  1O5J A;  2BW7 A;  4X62 F;  3T19 A;  1VRT A;  3LO3 A;  5L46 A;  2V69 A;  2YKN A;  4Y2K A;  1IUJ A;  4A48 A;  4K4U A;  4OFZ A;  2GIQ A;  2F3J A;  1X4A A;  4XO0 A;  3Q8R B;  2B43 A;  2HBY B;  4LQ9 A;  1VJQ A;  2MEW A;  3AH6 A;  3U02 A;  4URQ U;  1GTE A;  1PYT A;  3EXC X;  1U8W A;  3G96 A;  4EYH B;  4S0M A;  2W9B B;  2HHH F;  9RUB A;  4MMO A;  1AT1 B;  4I64 A;  2EBG A;  2BQU A;  2SXL A;  4ZLL A;  4Y2M A;  1KFD A;  4WK3 A;  2WHO A;  3DXB A;  2MSS A;  2VZ9 A;  3DHX A;  1FER A;  1X4E A;  4NI2 B;  1HNZ F;  1RCX B;  3W5Y A;  3MMB A;  1T3N A;  2BE2 A;  3LGN A;  2QYC A;  2VPZ B;  4MIW A;  4IOB A;  2RRN A;  4V19 X;  1EQ0 A;  1QTM A;  4O44 B;  1XK8 A;  4JI3 F;  3FRY A;  3TAM B;  1VQ6 S;  2H9Z A;  4ZJQ A;  3VZH A;  3QAT A;  1VRU B;  2ZBQ A;  3D1Q A;  4F0K A;  2I5J A;  2XO7 A;  1IWA A;  1NPR A;  3NP5 A;  1JX4 A;  4LRB A;  2CPH A;  5LXR A;  2HFZ A;  1N36 F;  3T5H A;  2LU2 A;  3DLG B;  2DT9 A;  2HRU A;  4YB6 A;  1ITP A;  4OI3 A;  4JYA J;  5CCM A;  3D54 A;  4DV3 J;  2WRM A;  5IT9 U;  4LUB A;  3Q24 A;  2UXB J;  2ZH8 A;  3C6T A;  2R42 A;  1JJH A;  3PXG a;  4AE5 A;  2BJE A;  5J2Q A;  3IGN A;  1XR7 A;  3DM2 A;  3AOA A;  1XNQ J;  2YWF A;  4J91 A;  5GAG I;  4OX7 A;  1TUV A;  2DO0 A;  4NYO A;  4HR2 A;  2HQD A;  4KGM A;  3MUM P;  4DQQ A;  2HFV A;  1VC5 A;  4X4V A;  4Q45 A;  4BCA A;  3Q0A A;  3MUV P;  2CJB A;  1WF2 A;  3EGN A;  2GO9 A;  2KVI A;  1F3V A;  2VFS A;  2FVS A;  3D6M B;  4Y00 A;  1I94 J;  4TQR A;  5JUM A;  4LF2 A;  4JV5 J;  3MF5 A;  5F8I A;  1K47 A;  3MM5 B;  2M0G B;  2HLU A;  5T7L B;  4JI2 F;  4NLV A;  3X1L B;  4ID8 A;  3ONQ A;  1WC5 A;  3L9Z A;  1RI7 A;  5BYR A;  2I6W A;  2CNN B;  2AP6 A;  3W63 A;  2NLW A;  2NUU G;  4ID5 B;  1RT4 A;  2RU3 A;  2JHE A;  2MGZ A;  4RNM A;  4PZV A;  1KQS R;  2BJ3 A;  2NXE A;  4DEZ A;  4WYL A;  4PG7 A;  4ZPC A;  3ICL A;  1Y11 A;  1IVZ A;  3AA8 A;  2EWH A;  4ZVH A;  3OR2 A;  4QZV B;  3TZZ A;  2ILY A;  2H5I B;  3CDE A;  2DRB A;  4NLD A;  1Q0N A;  2ATC B;  3FBF A;  2XC9 A;  2OP5 A;  4ECS A;  3QWP A;  4C0B A;  3QGH A;  2DNP A;  4DX7 A;  1JQG A;  4Y6I A;  5G0R A;  1WG5 A;  2V8D A;  1HI8 A;  2B3T B;  4NXM F;  2R3V A;  3SYZ A;  1X5S A;  5KFL A;  1X4F A;  2XI2 A;  4OZL A;  2ZH1 A;  2KFY A;  1JLC B;  3PKM A;  1JK9 B;  2XZT B;  3AY0 A;  4KHM A;  1H98 A;  2Y8Y A;  2F65 A;  4J5O A;  2HMI A;  2ZUA A;  5KFE A;  4LBP A;  2J6S A;  2R7T A;  3OT9 A;  5F9L A;  3IBF B;  1RBA A;  2YQ1 A;  2EKY A;  2DB1 A;  2HHQ A;  4DR5 J;  1WTB A;  3MEC B;  2YWE A;  5HVF A;  4J9K A;  2R8I A;  2CKW A;  2MZ1 A;  2CJQ A;  3KWM A;  2CDQ A;  1KVJ A;  3ZZT A;  4ZK7 M;  3HFZ B;  1XNR J;  1HMV B;  2V9W A;  2WVC A;  3CD7 A;  3BB5 A;  2PMH A;  3DXS X;  4NRU A;  3C46 A;  3HVR A;  2P6T A;  4KJI A;  2B8P A;  1NK5 A;  5DGB A;  1H7X A;  1NSQ A;  3WDO A;  1KON A;  2VIH A;  3QT7 A;  3T41 A;  3M7V A;  3D1O A;  1NHU A;  5CYJ A;  2J7W A;  4QWE A;  2D74 B;  2KT2 A;  3DDI A;  2DHG A;  3JXO A;  3PNI A;  4JI8 F;  2EW9 A;  3DOL A;  4I68 A;  5T41 A;  1TL3 B;  4ZPD A;  1U1M A;  2J9D E;  3QO9 B;  3IGV A;  4NOH A;  1WKK A;  2JEJ A;  2OD6 A;  4USJ C;  2DHH A;  2CPI A;  4OYI A;  2GCF A;  5HLF B;  3R6G B;  3IG1 A;  1FX2 A;  2VC0 A;  4U95 A;  2H1Y A;  4DL5 A;  2RJZ A;  4KKO B;  2NCK L;  3MM9 B;  3KOA A;  1RWK B;  3MR2 A;  4JI0 J;  2ZNY A;  3R7N B;  1YZ6 A;  3ILI A;  4RX6 A;  4DCJ B;  4N41 A;  3EGV A;  2AZ1 A;  1FJ7 A;  5BXI A;  5LMU F;  3SV4 A;  5C42 A;  4LF7 J;  3OUY A;  5ITH A;  2CVE A;  3KLF A;  4H4O B;  4JYA F;  2FB0 A;  2NZ4 A;  1IKY A;  3R7S B;  2P9C A;  4CLS A;  5CA5 A;  5A0Y A;  1YRX A;  4OX9 J;  1CJU B;  2B0G A;  4P2S A;  1U26 A;  3Q2S C;  3BSN A;  4ETZ A;  5E3A A;  4TLQ A;  1JLA A;  3OFE A;  4FNI A;  4UST A;  3N6M A;  3E2E A;  2V63 A;  1RAA B;  4BHQ A;  1K1Q A;  1B0P A;  4J9O A;  1Q8K A;  3UVJ A;  4JI7 J;  1Q7Y T;  2WON A;  3OTB A;  8AT1 B;  4CT8 A;  2I1R A;  3UCU P;  1YZ7 A;  5I3U A;  1I94 F;  2Q1L A;  4JV5 F;  4NXN F;  3WX8 A;  3ZTS A;  4FN5 A;  3UDE A;  2CPF A;  1U4B A;  1KQF B;  1GXT A;  3KDN A;  2KFN A;  2L41 A;  1QE1 B;  2IPO B;  3E01 B;  3LUY A;  3G8S A;  3BO3 A;  1SH3 A;  3SSR A;  1SIZ A;  2PA8 D;  4ZP7 A;  2A2D A;  4USK A;  5J1P A;  4O3N A;  3DGP B;  5EWF A;  2CQI A;  1U2F A;  4OZ1 A;  2RKI B;  4ES1 A;  2R7O A;  1Y00 A;  3KLE A;  4IG3 B;  3KHL A;  2WK4 A;  4MKB A;  4FNH A;  4DFK A;  4HTI A;  1LK5 A;  4LJM A;  2HVZ A;  4RW4 B;  4JUZ A;  3SIP B;  3GR1 A;  4DV1 J;  4FXD A;  1T9Y A;  2MKJ A;  3UDC A;  3PW2 A;  1Y4Z B;  3HSZ A;  2B6A B;  4UOH A;  2B51 A;  5KFG A;  2OUG A;  1NK6 A;  2XY6 A;  4NAS A;  1HQE A;  5D4L A;  2L48 A;  4MH8 A;  1PG5 B;  3ZXW A;  5JVG Q;  2DPJ A;  4W90 B;  3LF0 A;  1MNE A;  2DXE A;  4FDF A;  1D8Y A;  1BWE A;  4YOE A;  2PGC A;  2AX1 A;  4L75 A;  1V3R A;  1SJ1 A;  2MQO A;  3R3T A;  1WEY A;  3UD3 P;  1VIO A;  2OKQ A;  3I0R A;  3RR7 A;  4TKT A;  4RW7 B;  3QAE A;  2J8A A;  4U6P A;  1WD6 A;  1EET A;  4DX6 A;  5A8W A;  2ACM A;  5GAG U;  4RU9 A;  4IUF A;  4D3G A;  3KXD A;  2K8G A;  2HVH A;  5ADZ A;  2NXC A;  2F4F A;  3D28 A;  3I5A A;  1NCL A;  1SC6 A;  2HAI A;  3NBP A;  4TY9 A;  3PY8 A;  1UWB B;  1E6Y B;  2VQF F;  2ZIT A;  3OL9 A;  1RGV A;  4PWU A;  2NXU A;  2LU1 A;  4UT4 A;  4DF4 A;  4FKY A;  5HMW A;  2W8K A;  4KPY A;  3LWL A;  4KGK A;  1Z2L A;  4KGZ B;  4F4W A;  2G0J A;  4FF3 A;  4RUC A;  4M5J A;  5KAK A;  5FLX Y;  2BAN B;  4HHU A;  2IM0 A;  4K4T A;  2LQB A;  1J5E J;  2W9B A;  2L3M A;  4TY8 B;  1R0A A;  1AZS B;  1FE4 A;  2WZ1 A;  4MK7 A;  3JS9 A;  4IG0 B;  3KUE A;  4XDD A;  2HHP A;  1DQA A;  4DSF A;  2YH0 A;  3UR0 A;  4YFU A;  2ZZT A;  5AJ3 F;  5L8R C;  3SEO A;  4C8L A;  3LW5 C;  1OY9 A;  3I31 A;  3T5J A;  2RS2 A;  4NI2 A;  4ILR A;  1UWA A;  2MMY A;  1RAH B;  3I87 A;  4YHH J;  4CIO A;  3TJ8 A;  2COL A;  4DL3 A;  1FRX A;  4HT7 A;  2R4F A;  4O44 A;  2FHJ A;  4QR2 A;  3GZ7 A;  1NLK L;  3TAM A;  3GR0 A;  5KG0 A;  2EBE A;  2M70 A;  1HNX F;  3K59 A;  2XYH B;  3CIZ A;  1VRU A;  3CMA S;  5KFR A;  4NWB A;  3GYX B;  1GXU A;  4YR2 A;  1VBX A;  3DLG A;  1RAI B;  4IDK B;  4WJB A;  1QVF R;  2HG4 A;  4OX9 F;  4O3S A;  2M5Y A;  4HI1 A;  4FXW A;  2C3M A;  3C2P A;  1U7L A;  2UUW A;  1N5T A;  3W66 A;  4UZC A;  1FT8 A;  2HVE A;  3FRZ A;  4ECT A;  2WSC C;  4OI6 A;  2NSC A;  1URN A;  4DMZ A;  2UVU A;  4DL4 A;  2B9W A;  4YB1 P;  4EMD A;  5LJ3 Y;  4TU9 A;  2P6S A;  4YUD A;  2J76 E;  4EK2 A;  4M63 A;  2VOD A;  2RU9 A;  4WP3 A;  4M5H A;  2Z2M A;  2GJF A;  4KPC A;  4QQB A;  3MM5 A;  3ZZ0 A;  1U2C A;  4KH0 B;  4NLG A;  3A3P B;  1UZD A;  3TW0 A;  5T7L A;  4DUZ F;  1NBE B;  4OYZ A;  4OYA A;  1R8A A;  3O6Q A;  3A8I A;  5HAT A;  4LVO P;  2M52 A;  4DV6 F;  4RZR A;  4TU7 A;  1HA1 A;  4ID5 A;  2HND B;  4NCA A;  2JL9 A;  1VFJ A;  3D5M A;  2CDR B;  4M5D B;  3NNC A;  3SZ2 A;  1HWI A;  1T3O A;  1S0V A;  4AL5 A;  4Z37 A;  2MQN A;  1S57 A;  4OV6 A;  5IV4 A;  2HWH A;  1KHV A;  2PEH A;  3FGV A;  3KKF A;  4LF9 J;  2LDI A;  2H48 B;  1MG7 A;  3ITH B;  4LFC F;  2QA2 A;  2VJU A;  3DI6 B;  5KFT A;  1NHK L;  1ZM3 A;  4RUH A;  1ZPV A;  1P8G A;  2QFI A;  1QM9 A;  3J80 Y;  4RR5 A;  4TVA B;  2GHV C;  2CQ4 A;  1B3T A;  3IR6 B;  1F5C A;  3KJQ B;  4ZVG A;  1I51 B;  4WWS A;  3W8P A;  3JSM B;  2YBV A;  1WEL A;  3CME S;  2QLB B;  1JLC A;  2XHW A;  4CO4 A;  2KO1 A;  1KOO A;  2IJN A;  3K5L A;  2RUG A;  5L1I A;  5L1J A;  2DPI A;  5B08 A;  3LPY A;  3A8J A;  2OPP B;  2CJ9 A;  1M5V C;  1X5P A;  4CNZ A;  3EZO A;  3MEC A;  4KIA A;  2DNR A;  1YHQ S;  3Q8Y A;  4QJV A;  4EBC A;  2H54 B;  3H98 A;  3ADA C;  3CJT A;  3H2L A;  5J1N A;  4OHV A;  2J9E A;  3VAF A;  3NS6 A;  4X4O A;  1HMV A;  3K5N A;  4K59 A;  2CG4 A;  5F8L A;  2DHS A;  4F4Y A;  1FRH A;  7AT1 B;  4MK9 A;  5J2P B;  1RHQ B;  3KLV A;  1RU1 A;  2CQG A;  2XHC A;  4RUB A;  1N0U A;  2VDH A;  4KO0 B;  1Q4R A;  2ASY A;  1UP1 A;  2RQM A;  3EMT A;  3BSA A;  2NSB A;  2RIJ A;  5KT6 A;  3EPG A;  2PEB A;  3W9I A;  2JH3 A;  2AJ2 A;  3NY0 A;  1TKT B;  1TL3 A;  4DPO A;  3GJT B;  4ZLP A;  3QO9 A;  4JI6 F;  4DR4 F;  2BKP A;  4GKJ J;  1L3S A;  2CZV C;  3R2D J;  5DDR C;  1T94 A;  2N82 B;  1FNX H;  2IRX A;  1OMS A;  1TL7 B;  5HLF A;  2GHP A;  3UCG A;  1F2H A;  4ANC A;  3CCU S;  4CQ1 A;  4WCE Q;  4DV4 J;  4KKO A;  4LF8 F;  3MM9 A;  2MLY A;  2BYC A;  3ZZY A;  3O3L A;  4C48 A;  2UVW A;  3PYF A;  4TQS A;  4PG6 A;  4M5L A;  3FJ2 A;  3GYN A;  3H2U B;  4RPF A;  2C2K B;  1HQ2 A;  1UA0 A;  4WK1 A;  2E5L F;  1S1W B;  4H4O A;  3T6B A;  2QSW A;  3M9O B;  3NWR A;  1TL5 A;  3Q2T C;  1IBK J;  3LGM A;  3RBX A;  1YI2 S;  1NXI A;  1NK0 A;  5B7W A;  3UWT A;  1CJU A;  2MKS A;  3W61 A;  4H54 A;  1XMQ J;  3EGW B;  4OYX A;  4PAB A;  1VQP S;  3R1L A;  4B3O B;  4PQU B;  4I4B A;  2R7X A;  4DLE A;  4WFY A;  2YPY A;  4Y65 A;  1SJR A;  4LFA F;  2AIR B;  3GIM A;  1RYS A;  1YGY A;  1YRU A;  2PDA A;  4BBY A;  4NYZ A;  3Q23 A;  1IQT A;  2KRR A;  2P8I A;  1YBU A;  4JB8 B;  1NPP A;  3TJ9 A;  4ZPV R;  1F1B B;  2DEJ A;  4TN2 A;  4USH A;  5F8N A;  3G8Q A;  2D9O A;  4ICL B;  2ZWO A;  3E01 A;  3KJN B;  2MHN A;  2G2Y A;  1NB7 A;  1YJT A;  1REG X;  4RUA A;  3DGP A;  5THW A;  4RW6 B;  3LWM A;  1TMM A;  2E7V A;  4J9L A;  3HM9 A;  4OHY A;  4YB7 A;  2FLL A;  2RKI A;  2GX8 A;  4NYP A;  4LSN B;  1M5K C;  4IG3 A;  1S4F A;  3W2W B;  2PSZ A;  2XMA A;  2ZM6 J;  5GAE U;  1HI1 A;  4RW4 A;  3VGU A;  4OZ2 A;  5F8G A;  3KUH A;  3Q83 A;  2IJF A;  3G4S S;  3IRX B;  2Y1J A;  2VA2 A;  2HHV A;  2B6A A;  1U0H B;  3CCS S;  4LBI A;  4OL8 A;  2KTQ A;  1QTN B;  2ZHB A;  1Y9O A;  1V5V A;  2GQ2 A;  2OIH A;  3V6D B;  4CRJ A;  1YWX A;  2FJA B;  1S6U A;  1PBA A;  3S6E A;  3FSI A;  2C2R A;  5F9N A;  4WXO A;  3M8W A;  3L7O A;  4ZVF A;  2ZVI A;  1C0U B;  3EE3 A;  4PPD A;  3OW2 R;  4PQA A;  4MFB B;  1QAY A;  2KYX A;  3MPW A;  3BSC A;  1DQ8 A;  2GC8 A;  3C8Y A;  1HKA A;  2GMH A;  4RW7 A;  2HFU A;  1KVI A;  4LRC A;  2DGQ A;  4I6Y A;  4PRF A;  5EHH A;  1FJC A;  5IC6 B;  1MLA A;  3NGU A;  3RU0 A;  5LSL A;  4ECZ A;  1V6H A;  5E7O B;  3QIP B;  3T1H F;  2QL9 B;  1PC5 A;  5KFI A;  1RWM B;  2BKN A;  3P6Y C;  4NLQ A;  2OPQ B;  4TLR A;  4R5P B;  1UWB A;  3MR6 A;  1E6Y A;  1T11 A;  3K5P A;  1UPP A;  3PHE A;  1H72 C;  1KC8 T;  1AUD A;  4J9M A;  2XSJ B;  5K20 B;  4GC6 A;  4UOC A;  2AYG A;  4UZB A;  2BAN A;  2C2M B;  4ZLJ A;  4E98 A;  4FBU A;  1RXO B;  4TY8 A;  5U47 A;  4IG0 A;  3GCW P;  1F5A A;  1Q8I A;  2ATL A;  4ZVT B;  1WF0 A;  1RAJ A;  2F40 A;  1FDD A;  4N8N A;  1VQY A;  1LWX A;  2FIU A;  5CZV A;  1Q8B A;  1WSR A;  1EB0 A;  4DR1 J;  3TNV A;  3RAQ A;  1RHM B;  2B9X A;  1TL1 B;  2N3L A;  2AGQ A;  1ACM B;  3U1N A;  3R5G A;  3PFO A;  1CC7 A;  2ZBR A;  4I56 A;  3RB0 A;  1NEE A;  2LEC A;  2YNH B;  4OYW A;  1IBC B;  5KFB A;  2N4C A;  1V3S A;  3IAM 9;  2KM8 B;  4CM2 A;  2DNM A;  2VG7 B;  1HNW J;  4JI1 F;  3QLH B;  3N6L A;  2ZC3 A;  3D7S B;  2OTL S;  4IDK A;  3G87 A;  4MAK A;  2D3Z A;  2H51 B;  4BC7 A;  2IYI A;  3IS9 B;  3IBW A;  4ECY A;  2L08 A;  3DLH A;  1OO0 B;  4DV0 F;  2ALZ A;  1HWJ A;  2RNE A;  3B78 A;  4HDH A;  2R7R A;  4CLT A;  1UFL A;  3M6V A;  3KFW X;  4F50 A;  2FPH X;  1U48 A;  3A8K A;  4EUV A;  2AF6 A;  3GSD A;  5LOQ A;  1RE1 B;  4O23 A;  4B9S A;  1D8Z A;  1NM2 A;  2E1P A;  2FDN A;  1FDN A;  3GFZ A;  4HT5 A;  2V8G A;  2OLW A;  4C7Q A;  1HW8 A;  4X4N A;  3KG0 A;  2ROG A;  3SMZ A;  3CCV S;  4C97 A;  3KK3 B;  1DUR A;  3M6U A;  1QY7 A;  6AT1 B;  3GII A;  2ASJ A;  2KFZ A;  2W4D A;  3W1Y C;  3HK2 A;  2RIL A;  3LAL A;  1N54 B;  4Y2C A;  3CDB A;  4G1Q B;  1TUG B;  3FKB A;  1S48 A;  1KWM A;  1H2U X;  1M1G A;  4WPA A;  4LFB J;  1SH0 A;  4L74 A;  4M5D A;  2J9C A;  4B3T F;  2O1P A;  3IRW P;  3UW1 A;  3UD4 P;  5B0B A;  2UVV A;  4WTY A;  3QNW B;  1S0M A;  5D4N A;  5KFF A;  2XI3 A;  2DH9 A;  2GMJ A;  1RA6 A;  3ITH A;  1PIE A;  3P5B P;  3OSP A;  4YQW A;  3DI6 A;  3THT A;  3UQS A;  3NKY A;  4DR3 F;  1RZM A;  1H0H B;  3MEE B;  4IO9 Q;  1U1R A;  2DH8 A;  2QLJ B;  1FD8 A;  2XB2 D;  2HLT A;  3JSM A;  3HVA A;  4EI2 A;  3J7Z 5;  3PIO Q;  3ENA A;  3HPO A;  4B3R J;  3EVO A;  5EDW A;  3H59 A;  3HZE A;  1DRZ A;  4CLK A;  3RRG A;  2XS2 A;  1PIL A;  1N56 A;  3ILJ A;  3FBC A;  2OPP A;  3K2Y A;  3NGK A;  4JP8 A;  3I4P A;  1DLO B;  1SJQ A;  5D0H A;  3HDS A;  2CNK B;  4FF2 A;  3W5X A;  5KFK A;  3JSR A;  3RYL A;  2IC3 B;  1G7C B;  3BKT A;  2MKI A;  4J7C A;  3ZFV A;  1RTJ B;  3D3B J;  1MRO A;  2RF2 A;  4QPT A;  2ASL A;  4L72 B;  3FSY A;  5J2P A;  4USW A;  1CC8 A;  2HFS A;  2RVJ A;  2VD3 A;  5E3P A;  1FFG B;  1H73 A;  4ILM A;  3CO9 A;  2IAJ B;  4KO0 A;  3DOM B;  3B6B A;  4P73 A;  4G1P A;  3SXL A;  1CQM A;  2W2P P;  2CPZ A;  1Q79 A;  4OHX A;  2DNO A;  2RB7 A;  3PYE A;  2AJF E;  1KHW A;  1TKT A;  5GAD U;  1HAR A;  2LYV A;  3TAP A;  3HSD A;  1Y0H A;  4CWB A;  1WEZ A;  4DR1 F;  3Q8Q B;  3ET6 B;  4GKK J;  1TL7 A;  3LOU A;  2Q6B A;  4RW8 B;  1V9O A;  1U1P A;  4YP3 A;  4DSJ A;  2DGT A;  3PX6 A;  1TVR B;  1JJ4 A;  1FKO B;  4DR2 F;  2Q79 A;  3KJV B;  4ATN A;  4RKU C;  4BS2 A;  1FO1 A;  1TTH B;  3FZ2 A;  3TRG A;  3HZG A;  5KG1 A;  2W8L A;  2G2O A;  1VK8 A;  5LM7 E;  3MDF A;  1Y3K A;  1RA7 A;  2OSR A;  3FBE A;  1UVJ A;  1RAG B;  1S1W A;  5DDP C;  3AD7 C;  5D6G A;  3P96 A;  4I6A A;  1X5O A;  1RK8 A;  3D0H E;  2WCX A;  4B3O A;  4PQU A;  1VOM A;  2HGN A;  3EXY A;  4K4X A;  2UXC F;  4YS2 A;  3I0S B;  2XZW A;  2ZVS A;  3G6Y A;  1N34 F;  1UVI A;  2KYZ A;  2ZEJ A;  3EVM A;  4K7Q A;  2J0S D;  3W7B A;  5IOL A;  2J5A A;  4ZN3 A;  3UFC X;  1F0X A;  5DQH A;  4B17 A;  4BDP A;  5HK4 A;  2BE9 B;  4OZ3 A;  2EFN A;  1JLB B;  3VCD A;  1N5Y B;  1RAB B;  4KBI A;  3R1H A;  3LAK A;  4ICL A;  3W5Z A;  1RWU A;  4C9D A;  4FYV B;  1CBK A;  3OPK A;  1Y10 A;  2ZZN A;  3UE2 A;  3FBB A;  4C3L A;  4EFA C;  5ETR A;  4DI6 A;  1JLF B;  3HD2 A;  3MOZ A;  2HS4 A;  2F1F A;  4RW6 A;  5E3C A;  3CCL S;  2QFJ A;  5F0W A;  2VFV A;  2CQ0 A;  2AD9 A;  5FLX U;  4CLF A;  4LSN A;  3W2W A;  4IRD A;  2UU9 J;  3Q8P B;  2PI4 A;  1ZZF A;  4RW9 B;  1XMO J;  2RE1 A;  1MMN A;  3M8Y A;  4KFB B;  2GO8 A;  1RT7 B;  3PRD A;  2YWK A;  3IRX A;  5GAH U;  4A8Y A;  2IHR 1;  2LXI A;  2J0Q D;  2LVW A;  1RP5 A;  2JRS A;  1U0H A;  4LMZ A;  2IY5 B;  2OPS B;  2R8H A;  3V6D A;  1NH8 A;  5FD1 A;  3OJS A;  4YY3 J;  3RTV A;  1NJX A;  1YBT A;  2BBE A;  4L73 A;  4X4U A;  3IR7 B;  3MMC B;  1GMW A;  2CXE A;  1UVK A;  3B54 A;  1C0U A;  2D3U A;  4LRE A;  5HMX A;  1B70 B;  4MFB A;  2DNQ A;  3JB9 k;  3NOC A;  3BH6 B;  4DSI A;  4J9N A;  2I2Y A;  2W9A A;  1YBA A;  1FRK A;  2W2O P;  4OI4 A;  5LJ5 Y;  5KG2 A;  3QIP A;  1XEZ A;  4O3R A;  2XGP A;  2UVR A;  5D77 A;  3PDN A;  1BQN B;  3O2I A;  2OPQ A;  1YIJ S;  3QZ8 A;  2X1G A;  2PFD A;  4R5P A;  2UUB J;  2VC1 A;  1BHN A;  1F9F A;  3U7J A;  3QJJ A;  4I0W A;  2DXD A;  2XSJ A;  4ED3 A;  4ZCM A;  4DFJ A;  3CPW R;  1S9G B;  1MWQ A;  2B5J B;  4RBU A;  2R2R A;  2CUY A;  2BUN A;  2CQD A;  1TUW A;  3AOD A;  1FWP A;  2FTR A;  3H8Y A;  4ZJO A;  4M5G A;  3OJU A;  3MZI A;  4XDC A;  2ZFH A;  2EG2 A;  2DNL A;  4GKK F;  3ETO A;  5L39 A;  1FE0 A;  4F0M A;  2QLX A;  3AJD A;  3AOC A;  4P2M A;  2ZWP A;  4PWD B;  1X31 C;  1UAW A;  3N9U C;  1TL1 A;  3TX0 A;  1FWK A;  2FVP A;  1HR0 J;  2Z2Y B;  4J9S A;  2KDO A;  2CZ4 A;  2B9E A;  3SFG A;  5D8H B;  4DXL A;  4LRD A;  4PYD A;  2M88 A;  1KLN A;  2YNH A;  4P7V A;  1LWE A;  9ATC B;  3BZQ A;  3GFY A;  3HD1 A;  3HSG A;  5IT0 A;  4WTO B;  3V81 B;  3R2C J;  3NL0 A;  3VGS A;  4UUX A;  5H9F K;  5G4D A;  3PIP Q;  2VG7 A;  2CQ3 A;  2RHQ B;  1SBR A;  4P2F A;  1LK7 A;  3QLH A;  2WTF A;  3JSB A;  3LTO A;  3GPA A;  1I1G A;  3HHL C;  4DU7 A;  3KUG A;  3IS9 A;  3DLK B;  1T02 A;  1HHS A;  3BJY A;  4B3M J;  1KBR A;  2ZOM A;  5F8J A;  2DGW A;  2IDL A;  3TX8 A;  4CO0 A;  4ZP6 A;  3K7R A;  4R0E A;  2BV3 A;  4CYU A;  4MKV A;  2AHO B;  2HRT A;  2UUA J;  3OVS A;  1Y3J A;  1T03 B;  3HKW A;  2MHE A;  2OAU A;  5AE3 A;  1HBM B;  2IBO A;  2FJX A;  4DN9 A;  1ZM4 A;  3IMQ J;  2Z58 B;  3BBF A;  2WAQ D;  3MMJ A;  2ILZ A;  1OS5 A;  3ZZZ A;  4Q8F A;  1TV6 B;  1KQK A;  4W98 A;  4FBT A;  2YNF B;  2MQM A;  2B4V A;  4LT6 A;  2XS7 A;  1VIS A;  2VFT A;  1QUP A;  4MK8 A;  2JVR A;  3PV8 A;  4KHP F;  1QVG R;  3KK3 A;  2EI5 A;  1WC4 A;  3C66 A;  1MWY A;  3D6H B;  3H0P A;  2CPD A;  4G1Q A;  1I3O B;  4I7F B;  3BKU A;  3US5 A;  3CVK A;  3MAQ A;  1NND A;  2IYG A;  1AFI A;  4C11 B;  2KG0 A;  3BV8 A;  1X4G A;  4DQP A;  2KT5 A;  1ZET A;  2AMC B;  1VCT A;  3PX0 A;  4ILL A;  2GNK A;  4NZ0 A;  5KFY A;  1S12 A;  4LQ3 A;  3JSY A;  2BVZ A;  4OI0 A;  3JTN A;  3CC2 S;  3I55 S;  1WSV A;  3FC9 A;  1B7F A;  5KFM A;  2QG9 B;  5C24 B;  3MEE A;  4H4K C;  3DRR B;  2VA3 A;  1NJY A;  2JLE A;  3R8Y A;  1U2R A;  1TAU A;  1D0E A;  3BKF A;  1TL4 A;  3R5D A;  2W25 A;  2EPI A;  1AFJ A;  1VQN S;  2J6U A;  1S9E B;  5H9E K;  4KY3 A;  3UN2 A;  2HIQ A;  4CLP A;  4CDI A;  4DV2 J;  4CI0 B;  2VQE F;  1FDA A;  2R7W A;  2DCU B;  4F4X A;  2KJW A;  2OEK A;  1DLO A;  2MST A;  1IR0 A;  2E1R A;  4K4Y A;  3QFH A;  3HXM A;  2QA1 A;  3CDW A;  5EWE A;  3WQP A;  2IC3 A;  2XZD B;  4ZOS A;  3M2V B;  1C4A A;  3MAA B;  1YKW A;  3UI3 A;  3GIL A;  4G65 A;  4KV8 B;  3H25 A;  4P75 A;  1RTJ A;  4BWM A;  3K58 A;  4HKQ A;  3RRK A;  1SL2 A;  1LW2 B;  5D15 A;  2IAJ A;  2CJK A;  3DOM A;  1FRJ A;  1CJV A;  3CUL A;  2G13 A;  2HEK A;  3CJ5 A;  2W7A A;  4X62 J;  1PYS B;  2MJN A;  1MMD A;  4X65 F;  3FCW A;  1F9H A;  1NDP A;  2HW3 A;  3SFU A;  3NCQ A;  2QGF B;  3OLB A;  3PEH A;  1JXV A;  1VIX A;  2BAB A;  2YX7 A;  3ET6 A;  4CLU A;  3KLI B;  4RW8 A;  2GVZ B;  1P6T A;  5KG3 A;  1EP4 B;  3KHG A;  2FD2 A;  2OEM A;  3I5B A;  1TVR A;  1FKO A;  3C14 A;  1JKH B;  3TVK A;  2RML A;  2AW0 A;  2FVR A;  3KJV A;  4USI A;  2HHH J;  3VTI A;  3FMW A;  2ADC A;  2X1B A;  4C8O A;  4PR6 A;  2BJD A;  3KJF B;  2L9W A;  3BDP A;  1WC0 A;  2R9L A;  1PBU A;  1P27 B;  2BW2 A;  1H2V Z;  1HD0 A;  1B64 A;  4HH0 A;  2AV5 A;  1FK9 B;  4Q2L A;  5BR8 F;  3IM8 A;  3LP2 B;  2MKH A;  3CDA A;  2LEB A;  1NDC A;  3WX4 A;  3MEG B;  2BQ3 A;  4ALZ A;  4GC7 A;  1ZBT A;  3KMS A;  3PYG A;  4JI3 J;  3BH7 B;  4U7U K;  4NA1 A;  1IKV B;  3SCK E;  2ZD1 A;  4DHV A;  2BE7 D;  1AB8 A;  3I96 A;  1CPZ A;  2DJW A;  3I0S A;  3G82 B;  4UQG A;  2WB1 D;  3KNG A;  3PEJ A;  4KRW A;  4DR7 J;  4ZS6 A;  1LV5 A;  4Q43 A;  3OVA A;  3QGI A;  1VHF A;  4OI1 A;  1TEL A;  2MY7 A;  4N8O A;  3CSK A;  1JLB A;  1N5Y A;  5IXU A;  1OQ6 A;  4AT1 B;  1S72 S;  5DDO C;  5C7P A;  2F9D A;  3CGI A;  2XNQ A;  2OMO A;  4J9R A;  3OFG A;  5MAO A;  1JLF A;  3R5B A;  2MXY A;  2CQC A;  2BJ8 A;  1EHW A;  4NPO A;  2GJ2 A;  5K8N A;  2LA6 A;  2HFO A;  2QV6 A;  3DLB A;  3FQL A;  1OIA A;  4LSL B;  1WKL A;  4RW9 A;  1VGY A;  4DOZ A;  5KFH A;  4ELT A;  4KFB A;  1OY8 A;  2AU0 A;  1RT7 A;  2F5G A;  1S77 D;  4CH7 A;  3EUN A;  1YSJ A;  4J90 A;  4JI2 J;  2QJ3 A;  3LQV A;  5SUH A;  1XER A;  1HW9 A;  2LQ5 A;  3GFX A;  4GMK A;  4MIA A;  2AJ0 A;  4IOA Q;  4PWW A;  4DWI A;  4QWA A;  4HYK A;  3MMC A;  3PAC A;  2P5V A;  2RH3 A;  3BS9 A;  4FF1 A;  4X66 F;  1BY9 A;  1R8C A;  5HMY A;  5HJX A;  4QU7 A;  4DV2 F;  3NS7 B;  3CB4 A;  4ZKA A;  3FMB A;  3V5R A;  5SZT A;  5DQG A;  3AXM A;  2RQK A;  3IN5 A;  1GT8 A;  2C2E A;  3IR5 B;  2VPX B;  1RUS A;  3TUI C;  4OIX A;  2OTJ S;  1FVS A;  3CIM A;  3ZZU A;  3QRQ A;  1BQN A;  3MR3 A;  1SKW A;  1JLQ B;  2J7U A;  3V4I B;  3G6E S;  4NXM J;  3DRP B;  3O5T B;  4EGL A;  2XLK A;  1NPK A;  3M2U B;  2HVD A;  1F9E B;  1FDB A;  4A8X A;  2EXU A;  1S9G A;  3MOJ B;  2B5J A;  1X4B A;  2YNI B;  1PJ6 A;  2I8E A;  3M8Q B;  2Y1R I;  5HVG A;  3U27 A;  3D67 A;  5C25 B;  3F73 A;  3DLJ A;  3EYZ A;  2NPI A;  2M3D A;  4CNY A;  1RTD B;  5IT9 Y;  3MR5 A;  4RL1 A;  2NUH A;  3U1M A;  3DOK B;  4OYM A;  1NDL A;  1H3D A;  3HFK A;  2ZOG A;  4WFN Q;  1XJW B;  4DN0 A;  4PWD A;  2Z57 B;  1S79 A;  2FC8 A;  3HF5 A;  3T1Y F;  2JWN A;  3HHE A;  2J0W A;  4QCL A;  3I56 S;  1YJU A;  1IN0 A;  3HUL A;  3JAM Y;  4QYZ K;  1SC3 B;  3FCV A;  4WYW A;  2K7J A;  4JI8 J;  3V81 A;  2BA9 A;  4U67 Q;  4QWD A;  3GTY X;  3MD3 A;  4ZPA A;  2YTC A;  2RRA A;  4FF4 A;  3VAL A;  1DQ9 A;  2UV8 G;  3PFE A;  1C4C A;  6FDR A;  3GV8 B;  2YQ3 A;  2W2M P;  5H9F J;  5H1S V;  2QTW A;  2W01 A;  2XCA A;  2CPJ A;  2RT3 A;  2AKW B;  1QSL A;  3BBB A;  1SVD A;  3DLK A;  1FES A;  4EZ9 A;  5K8M A;  4P52 A;  2MKY A;  3NNH A;  3N5F A;  2Z2L A;  1PSD A;  5DG7 A;  4ANE A;  5KG7 A;  1TK5 A;  5M2R A;  3BR8 A;  2DR6 A;  5LMU J;  1KR4 A;  4GO7 X;  3BGU A;  2JEF A;  1T03 A;  1JIH A;  3H4D A;  3RJM B;  4DR7 F;  1GNK A;  1HBM A;  1FFW B;  3R27 A;  2KKH A;  4D3H A;  2JEI A;  3BO2 A;  3OXG A;  1TV6 A;  2EFP A;  4EZ6 A;  3CJ8 A;  2B8Q A;  3HHK A;  2Z2Z A;  2YNF A;  3WC0 A;  1WI6 A;  2PII A;  3P45 B;  3GE9 A;  4ED5 A;  2EFV A;  4GVB B;  3W62 A;  1W2B R;  5AXM A;  2XNR A;  1LFW A;  1BLU A;  1RT6 B;  2N7Y A;  3RBZ A;  1OSD A;  3OXL A;  4DV7 F;  3D9B A;  4JI4 F;  1UA1 A;  4NXN J;  2VKR A;  4C11 A;  3TAQ A;  2A18 A;  3RW7 A;  2EC0 A;  1FKA F;  3UR3 C;  4E2F B;  1M1K T;  3NGS A;  1C1C B;  4TXS A;  3ILO A;  3PO4 A;  1T0T V;  2W9C B;  3VV2 B;  2FHO B;  2ROP A;  1ZTT A;  3RZA A;  4UOG A;  3W9J A;  4N5S A;  1SKR A;  4C8Y A;  4DR6 F;  3D0I E;  3QJP A;  4MTP A;  5C24 A;  2H4Y B;  3G86 A;  3DRR A;  3FVY A;  3D4J A;  5HN0 A;  2XSF A;  4ETX A;  1YJ7 A;  4DPW A;  2P9G A;  2RQC A;  4K2X A;  3FFI B;  2UUT A;  5A8K B;  2VAS A;  1CEZ A;  2ZH5 A;  1YIT S;  1S9E A;  5KFQ A;  3QJL A;  1FWL A;  3PM9 A;  1LW0 B;  2KXH A;  5H9E J;  2DHA A;  5AXK A;  2NZC A;  1EQM A;  1R7I A;  1ZS6 A;  1R8P A;  4A8W A;  3V2U C;  1TQL A;  3I6P A;  3MGJ A;  1VQK S;  3DN9 A;  1Q5V A;  2VBZ A;  1CLF A;  5DS7 A;  4IH5 A;  1R8B A;  1RT1 B;  3TQE A;  4WP8 A;  4O4G B;  1G1X A;  3EDR B;  3M2V A;  3MAA A;  3Q22 A;  3M8R A;  2G0I A;  4KV8 A;  2X1A A;  2VB6 A;  4URS A;  5I4M A;  2XS5 A;  1U1K A;  2MLX A;  1F2G A;  2XMJ A;  2R7S A;  3AFG A;  2U1A A;  1W2I A;  2KRB A;  3WIV A;  1LW2 A;  2H5J B;  1SUQ B;  3H40 A;  1M90 T;  3QBC A;  3D1H A;  4ZVE A;  1W26 A;  1VQ5 S;  3GON A;  3DYA B;  2VQF J;  2DO4 A;  4LRA A;  3UDV A;  2GJI A;  3TYT A;  2RDI A;  2LMI A;  3F56 A;  3GMG A;  1WJ9 A;  2L9D A;  1VQ7 S;  2UV8 A;  1LQ9 A;  2GS8 A;  4ED4 A;  2MQQ A;  3KLI A;  1FJG F;  2WSE C;  2GVZ A;  4F0H A;  1EP4 A;  5KFS A;  1HNI B;  5CHC B;  3CCZ A;  3D6F B;  2O66 A;  3ZTQ A;  4LF6 J;  1XN9 A;  1S1T B;  4M5M A;  2DGX A;  1S1V B;  4C4W A;  5AJ3 J;  3QT6 A;  4ED1 A;  3J7A N;  1OSC A;  4ES2 A;  1FK9 A;  2QEX S;  3LP2 A;  1SJF A;  1FEH A;  5EWG A;  5JMN A;  1T9V A;  3MEG A;  1MSW D;  2AYE A;  1JJ2 R;  4ZP9 A;  1ULR A;  2CIM A;  4BLG A;  4O0I A;  2B4P A;  4JV0 A;  1ZAV A;  1RAE B;  2ZC4 A;  2CNO B;  1IKV A;  3G2X A;  3TEG A;  2B56 A;  1HNX J;  2G2Z A;  4AQY J;  4WU3 A;  3TUZ C;  4PXC A;  4LF5 F;  3EPI A;  4LBH A;  2LQ9 A;  3G82 A;  3DNC A;  4Y2I A;  3N79 A;  4IYQ A;  7FD1 A;  2IFX A;  2YKA A;  3MMB B;  4G6V B;  1JMT A;  2GQQ A;  2H3E B;  1OYE A;  3H5X A;  2R7U A;  2G1D A;  5KFX A;  1KTV A;  3SI8 A;  2J8S A;  2HQF A;  2D9P A;  2FJD B;  4PEO A;  1Z1Z A;  2QT7 A;  3M9N B;  2RAQ A;  3AT1 B;  1HNV B;  1RJJ A;  2OEL A;  4ZVP B;  3H90 A;  3CED A;  1P9Q C;  1KKH A;  4DBQ A;  1IKW B;  1M0S A;  2OGU A;  4X64 F;  1S10 A;  4LSL A;  1J5O B;  2IVM A;  5FJ4 A;  3VF0 B;  1QLN A;  2E9R X;  4DS4 A;  2MTL A;  3P5T L;  1WHV A;  4NML A;  2BEF A;  1VQS A;  3DU5 A;  1RHK B;  4EWT A;  3PX4 A;  2F4V F;  3D0G E;  2GML A;  4NX9 A;  2M2B A;  4ECQ A;  4N77 A;  1HBU B;  4DUZ J;  3MI7 X;  4CM0 A;  1KD1 T;  4DV6 J;  4ECX A;  1NAQ A;  2QMX A;  3CJ4 A;  5AE1 A;  2CAJ A;  3FSX A;  2A1B A;  2PMZ D;  1H7W A;  2C2Z B;  4QW8 A;  1WEX A;  1N32 F;  3SV3 A;  2JOQ A;  2ABY A;  2YPZ A;  1DBD A;  2DXF A;  4DCP B;  1CVJ A;  3KK2 B;  1GTH A;  2JX2 A;  2QX0 A;  3S8S A;  3MTK A;  5CAB A;  3AQO A;  1P1L A;  4QBU A;  2W7P A;  2O01 C;  4U8V A;  4LFC J;  2OFH X;  2AJ4 A;  1VJW A;  3TZX A;  3NMR A;  5B0D A;  3BGO P;  1DHM A;  1ZM9 A;  2RD5 C;  2W4C A;  4K5R A;  4DDF A;  3MPD A;  1JLQ A;  3F41 A;  4N56 A;  3V4I A;  1EJ7 L;  4LR7 A;  3VGV A;  3CO0 P;  1S1X B;  3DRP A;  3K0J A;  3ENQ A;  4URG A;  4J9U E;  2IJR A;  1TAQ A;  5ETP A;  3MM8 B;  3M2U A;  1D9F A;  1IQZ A;  1PAE X;  2OO4 A;  3BYP A;  1IM6 A;  2YNI A;  3T1A A;  3M8Q A;  4B3S J;  2DNH A;  5KFU A;  4B9L A;  4USU A;  4KB7 A;  5C25 A;  1RT3 B;  3IM9 A;  3TAN A;  5KFV A;  1X4C A;  3JTO A;  3PR4 A;  1RTD A;  2Y1L B;  1CS4 B;  3HI9 A;  3TI0 A;  3AHP A;  3GV5 B;  1NKC A;  5G0R B;  3DOK A;  3EX7 B;  2XMW A;  2V2K A;  2E66 A;  1LFP A;  1FTR A;  3AXK A;  1RU2 A;  4M95 A;  4LF6 F;  2G4B A;  2IMO A;  1N33 F;  4WKY A;  2M7S A;  1YVF A;  4ELV A;  3W8G A;  1BQX A;  2PI5 A;  2UP1 A;  4Z7Y A;  1SJ4 P;  4F26 A;  2HQC A;  4K0K F;  4PXE A;  1M5S A;  4QYR A;  4QYZ J;  2RSQ A;  1D1U A;  3RRH A;  2F9J A;  4JI6 J;  4DR4 J;  4LIR A;  4ECU A;  2XLI A;  1ZPW X;  4YB5 A;  1L3V A;  3KHH A;  2FYX A;  4OYO A;  3J81 Y;  2R8G A;  3O44 A;  2WVD A;  5KT7 A;  4LF8 J;  4H4K A;  1EIY B;  2OH2 A;  2DIT A;  1NSK L;  4AQY F;  5EX0 A;  3P49 B;  1YG0 A;  4YR0 A;  3CJS A;  2YKM B;  1KS2 A;  4KR0 B;  3GV7 B;  1YDL A;  2MZT A;  3ISN D;  1K73 T;  1KOH A;  3N6N A;  3TO8 A;  2E5L J;  4JV1 A;  1YQH A;  5HI7 A;  3QMQ A;  3PZP A;  3PW4 A;  3KYL A;  4EBD A;  4JBC A;  2W4P A;  4PUO B;  2GQC A;  1TFW A;  1KLM B;  1AYE A;  1U45 A;  2B4O A;  2NYI A;  4ZPB A;  2V2V A;  1R0B G;  4GVB A;  1R0C B;  3SCL E;  4CLZ A;  3N01 A;  2E5H A;  2ZUG A;  2XQC A;  3AAW B;  4LFA J;  2JFD A;  2CAD A;  5HO4 A;  3DLL Q;  2DH7 A;  1U1L A;  4V19 J;  3PG9 A;  3C16 B;  2VV5 A;  3TR5 A;  3VQS A;  3GIR A;  3KLH B;  4CZC A;  2N7C A;  4NCG B;  4G1I A;  1XR6 A;  3KK1 B;  1ZAW A;  1EAY C;  1C1C A;  1X8D A;  5MLC V;  5D78 A;  5F41 A;  2XMK A;  4U7C A;  3GJR B;  1UJ5 A;  2W9C A;  1BQM B;  2PE8 A;  1M5H A;  3OLA A;  4C6A A;  2DIS A;  2DIV A;  5F3T A;  1WHY A;  5L1L A; 
#chains in the Genus database with same CATH homology
 3FCW A;  1B99 A;  2DY9 A;  3EJM A;  1VYA A;  1NDP A;  1KDN A;  1NB2 A;  2B8P A;  3BBB A;  1NDK A;  1NSQ A;  3VVT A;  3PRV A;  4ANC A;  3EVW A;  5CAB A;  3FBF A;  3EE3 A;  1JXV A;  4ENO A;  3Q8U A;  4FKY A;  1S59 A;  1F3F A;  1S5Z A;  3DDI A;  1K44 A;  4DZ6 A;  1LWX A;  3NGS A;  3VGS A;  4ANE A;  1BHN A;  3ZTO A;  1MN7 A;  4UOH A;  4F4A A;  1UCN A;  3B6B A;  1XIQ A;  3VGT A;  2CWK A;  3L7U A;  3MPD A;  3Q8Y A;  1BE4 A;  1PKU A;  3NGU A;  2DXD A;  2AZ3 A;  1NDL A;  4UOG A;  1XQI A;  1WKK A;  3VGV A;  2DXE A;  3GPA A;  4WBF A;  1S57 A;  3PJ9 A;  3JS9 A;  2BEF A;  4DUT A;  5C7P A;  2HUR A;  1WKJ A;  1PAE X;  2HVE A;  2ZUA A;  4FKX A;  3G2X A;  3ENA A;  3WX8 A;  3ZTS A;  2NCK L;  5CAA A;  3DKD A;  1B4S A;  1LEO A;  3ZTP A;  3EVM A;  1HIY A;  3EVO A;  1EHW A;  2B8Q A;  1NSP A;  3EM1 A;  3Q8V A;  3Q89 A;  3B54 A;  1NHK L;  5IOL A;  1MN9 A;  3FBC A;  2AZ1 A;  3EMT A;  3FCV A;  1U8W A;  3ETM A;  1HLW A;  3NGT A;  4AND A;  2DYA A;  3VGU A;  4CP5 A;  1F6T A;  3VVU A;  1BUX A;  1NUE A;  3GP9 A;  1HHQ A;  3Q83 A;  5BXI A;  1WKL A;  3BH6 B;  1NDC A;  1NSK L;  2BX6 A;  4S0M A;  3FKB A;  3FC9 A;  3EIC A;  3NGR A;  3Q86 A;  4EK2 A;  2VU5 A;  4UOF A;  1NPK A;  3BBF A;  1ZS6 A;  3BH7 B;  3ZTQ A;  2HVD A;  4C6A A;  1NLK L;  1NCL A;  4O0N A;  4KPC A;  4F36 A;  3FBB A;  3ELH A;  3ZTR A;  2DXF A;  3BBC A;  4HR2 A;  4DI6 A;  3R9L A;  1W7W A;  4W98 A;  3FBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...