3UVJA

Crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
191
Chain Sequence
b'QVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Guanylate cyclase soluble subunit alpha-3
molecule tags Lyase
source organism Homo sapiens
publication title Crystal structures of the catalytic domain of human soluble guanylate cyclase.
pubmed doi rcsb
total genus 56
structure length 191
sequence length 192
chains with identical sequence C
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3uvjA00
1TL7A 4CLTA 5IV4A 4P2XA 1YBUA 2GVDA 4CM0A 1CJKA 5IV3A 4P2MA 4WP9A 3G82A 1YK9A 3C15B 1AZSB 1WC6A 3ET6B 4CLSA 1CJKB 4NI2B 1CJUB 3UVJB 1FX2A 4OYXA 4WP8A 1CS4A 4OYBA 3ET6A 1AZSA 4CLUA 1CJVA 4OYMA 1CJVB 3G82B 2WZ1A 3MR7A 4CM2A 1WC4A 1CS4B 4CLZA 1CULB 4USUA 1CJUA 4NI2A 1CJTA 1YBTA 4CLWA 4OYIA 4P2FA 2W01A 5D0EA 4CLFA 4OZ2A 5D0RA 4WP3A 4CLLA 4OYOA 2BW7A 3C16A 2GVZB 3C14A 1AB8A 1CULA 4OYWA 1TL7B 4CLPA 1Y10A 4USWA 1Y11A 1WC5A 4OYAA 4WPAA 3C16B 4OYZA 4USTA 4OZ3A 4USVA 2GVZA 1WC1A 1CJTB 2GVDB 3UVJA 5D15A 4CLKA 1WC0A 3C15A 3R5GA 5D0HA 2QV6A 4OYPA 4CLYA 1U0HB 3MAAA 1U0HA 3MAAB 3C14B 5D0GA 1WC3A 1FX4A
chains in the Genus database with same CATH superfamily
3W5ZA 4ZPVR 2FIUA 4UQGA 2VJVA 3HX9A 4JI1J 2P2CB 3GJTB 2G2OA 2CZ4A 5JUMA 3I56S 3PYDA 4AD6A 2PEBA 3H5UA 4N8OA 3NG8A 2E66A 2MLZA 3GPAA 4ZPBA 1R43A 3BGUA 1WF2A 2DO0A 4J37A 4WYLA 2NYHA 4HLBA 3SCJE 1S99A 2MKJA 1EKRA 4IG3B 3J80Y 1R7IA 2B8QA 1S6QB 3QT8A 5EHHA 2W2QP 1JNRB 1VJWA 2E5HA 1SJQA 1YQHA 2DNHA 1YK9A 2C2ZB 3MCSA 3FEYB 2ACYA 3DCAA 2ZHOA 1IM6A 4CRJA 4JI2J 5F3ZA 4PQUA 3ET6B 4DX5A 1HBOB 1WORA 1MWQA 3IRXB 3OL9A 1PBAA 3M8ZA 2A0FB 2H5EA 2N7YA 3BSCA 4RBUA 3HVRA 1RBAA 1QE1B 2ASDA 1ZAVA 3EM1A 1DLOA 3JQMA 4JBCA 1T05A 5E3QA 4TQRA 4ETXA 4F4WA 4F36A 4RZRA 5KFRA 2R7XA 2UXCJ 1P27B 1VQMS 2ROGA 1Q8BA 2AYBA 2BQRA 3HJFA 1Q4RA 4L75A 2JHEA 3WC2A 4R0JA 2IDEA 2BJ1A 1LW2B 4LFAF 4X4OA 1HI1A 4ILRA 3FKBA 3MMCB 5T7LB 3RYLA 2CA9A 4ZITA 5KG5A 1FNOA 3H59A 4DV0J 4B3SF 3TZXA 2W2PP 3MUMP 3ILOA 4A47A 3RBDA 3HI9A 4B3OB 4X65F 2AKWB 1KC8T 2CJYB 3KMQA 1WKLA 3WQPA 4QPXA 1N5TA 4PRFA 5KFLA 3VAKA 2RD5C 2BM0A 3CIMA 4ECQA 3UO0A 3ZZZA 1O5JA 3NLCA 2D9OA 2XWYA 3MPUB 3FSXA 3MM6B 1FCAA 3OL7A 2R2RA 2FHMA 3R6LB 4EWTA 2H5JB 2BZ2A 2H48B 3BH6B 2EVZA 3LANA 2R42A 4NEYA 4X64F 1SKRA 1FK9B 2Y0BB 1R31A 3ADAC 4O3SA 5E3AA 2EG1A 4FF3A 2EBGA 4YR3A 2FLPA 2PSZA 1PYSB 2BANA 1RTDB 1F3FA 3BN4A 4PWUA 1RHRB 1NAQA 2NZCA 3MEGA 5LXYA 3R2DJ 4TY8B 3N6LA 5FJ4A 2YWWA 4KRWA 2IHR1 2VG7B 3TX0A 3NNAA 1HQ2A 4HTIA 2AYGA 1TL7B 5HJYA 4NMXA 3BS9A 1RYSA 3GYGA 4WXWA 3RBXA 3EICA 4IR9A 1BUXA 1ICEB 3MR5A 3AB4B 1FFGB 4DSIA 2BXJA 3U1LA 3CGIA 3GV8B 8RUCA 3NGUA 3M30B 1HQEB 1TUVA 3CE8A 4QIVA 2ALZA 5L39A 4USVA 2N82B 4C3MA 1U2RA 5ETQA 4X4VA 2RILA 5H9EK 1YIJS 2DNPA 3FCWA 1U8SA 3MECA 5I3QA 4R0EA 3QSYB 3GB0A 5IFMA 1C0TA 3POTB 4KGVB 3M2RA 4KHPJ 3MAAA 4RNOA 3AD8C 5C5JA 4P72A 2QLWA 3C14B 4OJ1A 1XMQF 1HNXJ 4QCLA 1T9WA 2O01C 3RAMA 1XNRJ 2FZGB 1SJ4P 4U8VA 1Y9OA 5JMNA 1JB0C 4RNNA 4NWBA 1ZS6A 4M1KA 2DXFA 2Y1RI 2NYIA 3BB5A 5F8MA 4ERDA 1MU2A 2FJDB 4JI8F 1HQEA 1YBUA 3SIPB 1X4EA 1SKSA 3PFOA 4DOZA 2YVSA 1S10A 2HIQA 4DR2J 4ANCA 2F3JA 2MZTA 3K5PA 1IKVA 4DPOA 1DHMA 5C42A 2VDIA 3AQPA 3B54A 3ZC4A 4DV3F 3R5DA 1NBEB 3I96A 4YUDA 1REGX 5C2CA 1VC6A 4LF6F 2ROEA 4B3RF 2YQ0A 4OIXA 4YB7A 3BKFA 1RE1B 4OMFG 1HLWA 1RWOB 1RXOB 2K06A 3C15B 3GG0A 5DZ7A 1WHVA 4DR6F 4K4UA 2BE7D 3HSDA 1R27B 3CMQA 3DLJA 4DG1B 5GADU 4DV7J 1U24A 1VQSA 2RS8A 2ADBA 1SKUB 2QA4G 2MY7A 2W7OA 3HFZB 1T05B 1FJEB 4EBEA 1YJTA 2JVOA 1CVJA 3AAWB 1FX2A 2LQJA 2QMXA 2XHWA 4IOCQ 2ACMA 1NK7A 1RKJA 1N34J 4EK2A 1IBLF 3CMES 2ZDPA 4QYZJ 2HQFA 4HEA9 4USIA 4H4KA 4IFYA 2ZH4A 4NLUA 5HL7Q 1S6OA 2VKRA 3PHTA 2E9TA 4I67A 1RT6A 5EX0A 3MDFA 3A8KA 3ITHB 2VZ9A 1SJ1A 2O66A 1X5OA 2MQPA 2YNIA 2E5LF 2JSXA 1T94A 1VC5A 3L95X 4CIOA 3K7RA 1BD6A 5KFYA 2JFDA 1RT3A 3NS5A 2R8JA 4U96A 1SC6A 2B43A 1NK4A 2J7KA 4CLZA 4I6YA 4DQQA 2J6UA 4C3KA 3R1HA 2DD8S 4NASA 1MMDA 1PAUB 4UW2A 1K47A 3MOJB 2BMBA 1X0FA 1RWVB 4FZVA 3BYPA 3JAMY 1E6VA 4LFCJ 4Q8FA 4F04B 2RSQA 2FVRA 1V3ZA 1RTHB 1C1CA 5IXUA 4ZOSA 1WEZA 1RBOB 1IKWB 2FYXA 3LGHA 2BQ3A 4B9LA 1R8CA 4QIGA 2EK6A 5GADI 1WF1A 2HFUA 2HBRB 3DRYA 3CUNA 4J9LA 3W62A 3KXDA 1H98A 1YRTA 2DNQA 2HSEB 5CYJA 2L9WA 5L9XA 4B3MF 3D1HA 2ZH7A 4PABA 3KLIB 1RAOA 1YZ7A 4DFKA 4DL5A 5KG4A 2RRAA 4X4QA 1QAIA 2UXBF 2KZZA 2Y8YA 1UTAA 3H20A 2XY5A 2MGZB 1NK6A 3RRHA 1H38A 1O8BA 1HR0J 2D7SA 2M9KA 2CNNB 3HZGA 3TJAA 2FC8A 2NUHA 5GAGI 5A8RB 2D3ZA 3ENQA 4F0MA 4PPZA 2CJ9A 2K3IA 1RHMB 5E7OB 3TA0A 1FNXH 1X8DA 1IWAA 4OI0A 2QL7B 1JXLA 1B7FA 4M5NA 2XB2D 4USWA 1P9YA 3KJVA 1SUQA 4RNHA 4UOFA 5J2NB 2B8PA 1FRMA 2F5GA 2HWTA 2RHQB 2KYZA 1S1UA 2WSFC 3A13A 2VFRA 3CJRA 4KT0C 3CCJS 3C3LA 3R27A 4ZDNA 4F50A 4C3LA 5MLCV 3GR0A 3HD2A 3N28A 4OYZA 3KLFB 4DFJA 1JXEA 2XMMA 3PG9A 4PXEA 4RWXA 1RWNB 3JQKA 1N6QA 1HA1A 1U1RA 4U7CA 2G4BA 5B08A 5D6GA 1KD1T 4DR6J 1R6VA 4LRAA 4H54A 1JLGA 1RAEB 2LLZA 2OPSB 3LTOA 4Y6IA 4BWJA 1EP4B 4A8OA 4CLYA 4DN9A 3JB9k 1FO1A 4KB7A 3QJLA 2EFQA 3AD9C 4CO1A 3JTNA 5E0OA 2DNYA 2YNFA 3OFEA 4ZPDA 3DU5A 4OX9F 1X5SA 3BKUA 3R6GB 2UVVA 5SUHA 1V9OA 2DPJA 1C1CB 4X4RA 5FLXY 3DLHA 4F02A 1KLMB 1TL7A 1UP1A 2EFNA 2F65A 4CYUA 4I4BA 2VG6B 3DFEA 3DM2A 5KFTA 1B0VA 3MAHA 5AE3A 4B9UA 1DAXA 3D66A 2BM1A 4G6VB 4KV8B 3T9ZA 1U48A 2YH1A 2HVHA 1ULRA 3HVWA 2B6AB 2KVIA 4Y00A 4ID8A 2YBVA 1JJHA 1S7HA 2K7KA 2QTWA 1SJ3P 3H98A 3Q8UA 2A2DA 5ETLA 3W61A 1IJFB 2DGQA 4BC9A 1I6JA 3DYAB 4Q44A 4ER8A 1WI8A 4RU2A 4ZCKA 2V4JB 1BY9A 3M2RB 2V6AA 2HAIA 1NO8A 1U02A 2V94A 2WVFA 3BJYA 4DCPB 2E5IA 3S01A 4XPCA 2I5JA 4BC7A 4P74A 3TUJC 3CCSS 2A18A 4GO7X 4GRSA 1Q8IA 1T95A 2KHDA 4WP8A 4KY3A 4F4AA 4IO9Q 2B51A 1FNMA 2DHAA 3EJMA 2DNGA 1HPZA 4ZLJA 2YY3A 5D3GB 4WTYA 1VQ6S 1HKAA 3GYXB 3ITHA 2W8KA 1CJVA 1YBAA 3GYNA 4LFBF 2CJKA 5I42B 4KFBA 3D0IE 4USKA 2V8PA 4L72B 3W1YC 5HLFB 2YNHA 5KFEA 2OEKA 4DX6A 4B3TJ 4OLOA 5CYMB 2N3OA 4QR1A 3MM9A 1ROFA 2VIHA 2ZD1B 4AL5A 1RBLA 3B6BA 5KAKA 1Q78A 2ZUAA 2DR6A 3RR7A 1NZAA 2HG4A 3H2UB 2EI5A 5B0GA 1E6VB 1UCNA 1A9NB 1L3KA 2HS0A 1A0OB 2P9CA 3D68A 2DY9A 3HF5A 2PD1A 2L48A 3KG4A 3ZXWA 3WZ0A 2COLA 3BGLA 2W7PA 3QFWA 4DPWA 2C3PA 4C48A 4DS4A 5KFNA 3AJDA 2EPIA 3LAMA 3IG1A 2UXBJ 2ZH3A 1RAFB 1LQ9A 4RW8B 3G96A 1C0UA 4TVAB 4EUVA 4DV0F 4KFBB 1OQ6A 1UEKA 4DUZJ 1Q95G 2D41A 2KI2A 2DH9A 2J0WA 1U1MA 5KTQA 1PYOB 1QE1A 4F4ZA 1DLOB 3CJTA 4WCEQ 1I94J 3M1VA 3VHQA 5HVGA 2BKNA 1UW9A 3UDEA 2Z4PA 4LF5F 2QL9B 3HHKA 4K5RA 3M2VB 3UDCA 5HMZA 2RKIA 3CO9A 2HFVA 4LSLB 3VZHA 4C8YA 3W65A 3V4IA 2MPUA 3I5CA 1VI7A 3MMAA 4FVMA 1Q81T 1IBCB 3OTDA 2CG8A 2KN4A 1YJ9S 1Q8LA 1I51B 1MMNA 1TVRA 3SI8A 2IAJB 4MK8A 3CO0P 4RW7A 5LJ3Y 2GMLA 1S9EA 1L3SA 4K4YA 1S1TB 1TQLA 1WUUA 3W7BA 4YB1P 4I64A 4WPAA 4QYRA 3K5LA 3VAFA 4DQRA 1V3RA 5HROA 3TI0A 2MKSA 3H2LA 4USTA 3TOQA 2DVIA 1LWFB 1Q5VA 3VV2B 3UVJA 3KLEA 2BJ9A 2C22A 3N79A 5HMXA 1GXTA 3AA9A 3GP9A 4A8FA 4HACB 2FJAB 4URQU 3V6JA 3CD6S 3NMAA 2IPOB 2J9CA 2B4VA 3TYTA 1RTZA 3W2WA 4JI5F 4UOHA 4ES1A 2DNMA 2WSCC 2VQEF 2OAUA 4FPIA 1UZHA 1MN9A 2BW2A 1EETA 4KGMA 5IQQA 3O2IA 3B82A 2JX2A 5A8RA 1QSSA 2IA6A 1IKXA 4OI2A 2LU1A 4ZJQA 3OL6A 2RJZA 4G1PA 1FHTA 1D0EA 5MAOA 3CXCR 2UP1A 3VQSA 3OUYB 4RKUC 4NZ7A 4ZVPB 1FRHA 4J9QA 2OSRA 2DGXA 5HBMA 4X62F 3V6KA 3CNQP 1HNVB 1REVA 1S0MA 2JEGA 1Q7LB 4LRDA 1EJ7L 2M5YA 2QLFB 2QLBB 3NBPB 5E2QA 3SCIE 3DLKB 3E51A 2HGMA 3GMGA 3W64A 4C0OC 5M2PA 1K73T 4OX8A 3OR2B 2XZTB 2EKYA 4QW9A 2V4RA 2G2YA 3BYRA 3F44A 3KJQB 4TU9A 2DIUA 4AT1B 2MKCA 3GJSB 2VBZA 3M2VA 3BV8A 3D2WA 1NKBA 1YZ6A 4OLPA 3BO2A 4FP9A 4DSJA 4DV1F 2MJUA 1CJUB 1TAQA 2GIQA 1CSJA 3I6PA 3R7BB 5KOWA 3CPWR 4DL3A 3PX6A 3SSSA 1EQ0A 4TXSA 3M7VA 1N4LA 3EVWA 4KGXB 2AHOB 3QT6A 4DV4J 1VHIA 1KLMA 1PILA 5E33A 3FBCA 3JTPA 4OI3A 3PFEA 3EVMA 2HHUA 4Q0BA 2WTFA 2E7VA 1I1GA 5K20B 4O3OA 5A0YB 1BGXT 3NXZA 3EGWB 3PRBA 2FJWA 4DSLA 3UCZP 3V2UC 3I9V9 4J9SA 4FN5A 4USHA 2D3OR 1WKJA 2GO9A 1V6HA 2AEFA 2PFDA 1FJCA 1BQXA 4Y0FA 3S7RA 1QLNA 4P6QA 2HK2A 4WBFA 3X1LB 1ACMB 4DV2J 4R8UB 5I3PA 2VASA 2D3UA 3HT0A 1EB0A 4GO5X 4LR8A 2YQ1A 3NL0A 3GV5B 3EZOA 1YG0A 3EDQB 1F60B 3QGIA 3GTYX 4RUCA 2R4FA 2VOOA 2V4JA 2C28A 4CCHA 4QU7A 4O4RA 5LSRA 1IKXB 2UVWA 4CLFA 2PI5A 4OZ0A 5D0RA 1K0VA 2QLXA 3V6DB 4Q45A 2QT7A 1T9VA 3OUYA 1NXIA 4LRFA 2Y1IA 4M94A 3FCVA 1YJ7A 2HBQB 3DOLB 3OJSA 5DDPC 2HFSA 3QLHB 3MPDA 4ZN1A 3CD7A 4Y34A 5AJ3F 3QRPA 2NXCA 2CDQA 2HEKA 3ELHA 4IOBA 5KFWA 1SIWB 3C6UB 3VZIA 1N32J 1TAUA 1QAYA 1TUWA 3EWGA 3I5BA 3U1MA 2XEXA 4IH5A 3H25A 2EFOA 4M5MA 1RAIB 1S1TA 3BSOA 4AL6A 4HI2A 4NYOA 3SQGA 2ATCB 2W9CB 2GIRA 5ETOA 4C2MA 4DL7A 3AD7C 4QIFA 3SV4A 4ZP7A 5HK4A 2JEFA 3P49B 4NLPA 2IAJA 1FF2A 3P4UB 4FNIA 1YJNS 3TNVA 3G8QA 1WHYA 1FKPB 3KFWX 3QPIA 2K2PA 4AYBD 2MQOA 1N56A 4QWCA 4PUOA 2WK4A 3C16B 4O23A 3T5HA 2FLLA 2E9RX 4WTOB 2QFIA 3CB4A 2CPEA 3R8YA 2W1BA 2JC1A 3M6VA 1N0VC 3L3CA 2C2RA 1NPKA 2AZ3A 1ZBTA 1G7CB 2MYFA 3HSZA 4KHMA 1QSYA 4B9VA 4LF9J 2N4CA 1FRXA 1VIXA 2VV5A 3W9JA 2N7CA 3P5TL 3NGDA 3MUVP 4K4SA 4PKDB 2DISA 5ITHA 3SQGB 4ECSA 1F2HA 1JLAA 3KUHA 4D3HA 5DQIA 4MKYA 1U0HA 1CEZA 5EWGA 1YITS 4IRDA 3KUEA 1RKIA 1DTQB 4DSEA 4B9SA 1HW9A 1X60A 3MMJA 2A1BA 4DR5J 1B0PA 2FVQA 3L9ZA 2IM3A 3CJ0A 3RTVA 2AJ0A 3GG1A 3NBPA 1JJCB 3D6FB 4CO4A 4JI2F 2NSBA 3KLGA 3T19A 2HLTA 4V19X 5HVFA 3JXOA 3K5OA 5FDLB 4M95A 4NLQA 1S97A 2F8MA 1ZA2B 2LDYA 2NXJA 4PQAA 2H1YA 5A8WA 3AJ2A 4FBTA 4DR1J 2CQIA 2WSEC 4X4UA 2IM2A 3D1OA 4NA3A 4YR2A 4LR9A 1ZTTA 1N5YB 4DQIA 1ZM4A 4P2MA 4UQTA 3A8EA 3LP1A 2E5GA 1VIOA 3T6BA 5ETPA 1NKCA 2B9YA 2DB1A 3GCWP 2Z8QA 2LMIA 5BYSA 4ZVHA 1C1BA 4G3IA 1ZAWA 3CMAS 4DV5F 4IRKA 3NNHA 1AZSB 3MEDA 1RZMA 3I31A 1KP6A 1LV5A 2E9ZA 4KH1B 3G2XA 4CWBA 2G1DA 3MZIA 2HFZA 3A1YG 3UNYA 2IRXA 2KB2A 5A6PA 2F8EX 3BR9A 3QIPB 4PWDB 5F8NA 1RWPB 3BEGB 3MD3A 2V69A 1R0BG 4O44B 2AEMA 1RB0A 2M52A 3HD1A 4OI1A 4O0IA 2JOQA 1YWXA 1TL3B 2XMUA 3WBZA 4LSZB 3MFHA 1D09B 1TR0A 1BWVA 4A8KA 3RRGA 2HNYA 1N32F 5FLXU 3G82B 1YJVA 2QFJA 2DGSA 3GIIA 1BQMA 1Q79A 2IBOA 4RW4A 1ZM3A 1T8EA 2HZVA 1REVB 3ONQA 1YGYA 3TVYA 2HYIB 1BQNA 2HNDA 4RW6B 2HVEA 5J2QA 1HFEL 3DM2B 3M6UA 1AXQA 3KTQA 3HMJG 2D74B 1Z2LA 4B02A 3GIKA 1G2EA 3EYZA 1QD1A 4DR3F 3OBIA 1RT5B 1U6BA 1GMWD 1N8RT 3DNCA 3OLBA 4PG7A 4RBTA 5IS2A 1FDNA 2CQ3A 4N7TA 1OWXA 3UE2A 3PNIA 3E2EA 4KIAA 3CCQS 4TY9A 3CD5A 4HDGA 2BQUA 2ZJPQ 1TKXA 4HR2A 4G65A 2UUWA 2XYHB 2JC0A 4Z7YA 2UUBJ 3PR4A 4NLDA 2BR0A 3RAXA 1IQTA 2N3LA 3RBZA 3TEHB 4Q0BB 1ZOTA 2MSTA 3IBCB 1UW4A 4ILLA 4P52A 2XS5A 4RW6A 4Q43A 1TK0A 2H4WB 2ILZA 1MU2B 3IMQJ 2J9DA 4B17A 3KNGA 3SMZA 4P7TA 2C2KB 4XPEA 4JI7F 5GMDA 1Y3KA 2CPXA 2GGPB 4HTJA 3M32A 1UA1A 1FTCA 4FXDA 2FJEB 1SXLA 3IBWA 3Q8VA 4I0WA 2A6OA 3KKFA 4TU8A 2U1AA 2V2ZA 4ZMMA 5BR8F 5ETKA 4QBUA 1ZPWX 4MYUA 3ZZRA 3QIPA 4PWDA 3CJ5A 1FD8A 1OY6A 3DXBA 4V1Ak 4OYAA 2Z2MA 4IQMA 2OP5A 3CT9A 1VQ7S 1KSPA 2FTRA 1FDDA 4RW9A 4MMOA 2CJXB 1WC1A 4E98A 4B3OA 4J9UE 4NOHA 1LWEA 2AF6A 1FI4A 3RZAA 5KFOA 3H5YA 3BN7A 5LMUJ 3B78A 1MWYA 2BV3A 2NS1B 1PJ5A 1RWMB 4JI5J 3TVKA 2FHJD 4QPTA 4RUHA 2HWHA 3OV7A 4IFYB 4V19J 1MWZA 1NU4A 4M5IA 3PACA 3K17A 1U8WA 5KG3A 1WF0A 3HKZD 1R0CB 2UUCF 3IO1A 5DS7A 4IR1A 1S77D 5HVHA 1KN6A 1JKHB 5ETVA 1VYAA 5KFDA 5JVGQ 5DJBA 1RAAB 2HS4A 2DGVA 5LT5A 1TV6A 5DG8A 1S9GA 4EYHB 1NK8A 4X4TA 3G71S 4C8LA 1N5VA 2MKYA 2GAHC 1WHWA 5DDQC 2XQCA 3IS9A 4ZVOB 1VCTA 1IJEB 2YX4A 3NGKA 2DHHA 2GC8A 2JLFA 2RU9A 4Q2MA 5FIIA 2JL9A 3DRSB 2GVDA 1J5OA 1K0TA 1BLUA 4NLSA 3A3OB 4C8KA 3BGOP 4ES2A 3FEXB 4OZNA 5HP1A 4ZS6A 4B9TA 1IR2A 1RTHA 2BACA 2LQ5A 3OJUA 1SL2A 3MURP 1T9YA 2K3KA 2OKQA 2H5IB 2ZC4A 1N36J 2F8HA 4NXMF 1M5KC 2XSJB 1HD1A 4ED0A 4K50A 3I9ZA 5HAOA 5KFAA 4R5PB 4LF7F 2DR9A 5A2QU 2XCAA 5K14B 1H72C 3J81j 3B4MA 2W2NP 3M6XA 4DR3J 2ZOGA 1TV6B 2I1RA 2F4VJ 2J0XA 1NH7A 2MQ8A 2CYYA 3J80U 1H74A 3LPYA 2CJQA 1VBXA 1FWKA 5E3PA 1HARA 2KJWA 2ZWPA 3VAGA 1M5PC 2HQDA 3C46A 1H7WA 2AJQA 3MR3A 3SCLE 2GV1A 1S48A 1ZPVA 4P7VA 2HNZB 5G0RA 3T5KA 3CEDA 2JNJA 3M8YA 3M05A 4ZJLA 1VLYA 4FKYA 4EZ9A 4RW4B 1LWEB 4ECXA 2PE8A 2BYCA 2WCXA 1KOHA 1CQNA 4BHQA 1FJGJ 3ETMA 3O44A 1NEEA 5LSLA 1NDKA 1FVSA 5GMKa 3TARA 1W26A 3D1QA 4I7FB 1X4DA 1NRKA 3IN5A 2CQDA 4AQYJ 5DO2A 2CIMA 3HVTA 3VAIA 4K59A 1TMJA 2NZ4A 1FE0A 3KG1A 1HWUA 1LW2A 1JKHA 1TMMA 2XMTA 5C42B 2ZM6F 2J8SA 2CG4A 4CT8A 2LXIA 1I5OB 1NDLA 3BREA 2RVJA 2HHQA 3J81U 2OTJS 4KAIA 4KGZB 3NNCA 4DDFA 3CC7S 2FHKA 1JIHA 3CSKA 2DEJA 2DH7A 2E1MC 2YQ3A 5CZXA 3HCXA 5AJ3J 1Y4ZB 3HZEA 5K9FA 4ED2A 4WZQA 4NYPA 4B3RJ 3K0JA 2KZMA 2PFFB 1S49A 3E3XA 4ZPWR 5KG0A 2IM0A 4DV6J 1RA6A 2XMJA 2EW9A 3I0SA 3OSNA 5BR8J 1MN7A 4CDIA 1ZETA 1U0SA 1XNRF 2MLYA 5B0FA 4JUZA 1RTIB 1OPIA 4I2QA 3DC2A 3JQJA 5DZ6A 5GAEI 3EMTA 4IG3A 4CTAA 3THVA 1C2PA 2ZNYA 4ZPAA 1KEKA 3T3FA 2DGUA 2PMWA 3RB3A 1S1XB 1TK8A 3SV3A 3S8SA 1KNZA 4KBIA 3AOAA 4IUFA 1KWMA 3NCQA 2YPZA 5HMYA 2J0QD 2M2BA 5L1JA 2Q1LA 1P8GA 2RUGA 3BBBA 5KFJA 5I4MA 1DFDA 2AX0A 1IR0A 2XM3A 2GQCA 1UPPA 3T41A 2OUGA 5KFPA 1CJTB 1N36F 4NXMJ 1NMEB 4GVLA 3OSPA 1HBUB 3QATA 3AH6A 4USJC 3KK2A 3TRGA 2LQ9A 2V68A 3R5GA 1RI7A 2CQ0A 4CO2A 5EWEA 4FKXA 4KPYA 5D78A 3UQSA 1SI9A 5M2UA 1UVJA 1H3DA 2KO1A 3M30A 3I87A 1ZA1B 3LALA 2SXLA 2DHXA 2EC2A 2OJ3A 1RT7B 3PDNA 3CTRA 4FYVB 2LU2A 3CJKB 2ZHAA 1GMVA 4GKKJ 2HLUA 2I0XA 3HDSA 2DRBA 2HMIB 1HNWF 2JEIA 3OFFA 2FVCA 2ZBIA 3L7OA 4OX7A 1JLGB 2BJ8A 4ZCIA 6FD1A 3JSMA 2VDHA 1VBYA 3W5YA 2IDLA 3W3SA 1J5OB 2GNKA 2G13A 3PZPA 2UUAF 4DFMA 2PO4A 1RT2B 1W2IA 1M5HA 2KHCA 4X64J 1DBDA 4QR0A 2XMAA 4URSA 4N5SA 1RU1A 5CXTA 1UJ4A 2HRUA 4W98A 4WFYA 1RACB 3GCXP 2YKMB 1SUQB 1SH0A 3E01A 1AFJA 2EEYA 4OJ3A 3MEGB 4LFBJ 3GJQB 2K8GA 2VFTA 4GVBB 4ED1A 3JS9A 1IWGA 2NLWA 2XYGB 3D9BA 1FESA 3NCPA 1TTHB 1HWIA 4O0NA 3VWSA 1U26A 5B0CA 5HQ8A 2H4YB 1HI8A 3PV8A 2AD9A 4ECZA 3DOMA 4IH7A 2B4UA 4NZ6A 3THTA 4DU7A 3PKMA 3J7A1 1HHSA 4DPXA 3BBFA 1QTMA 1S1XA 2ZOMA 4OZLA 4UY8T 3NMRA 1HYSA 3TJ9A 3H42A 3PVXA 1IM4A 5J1PA 1OSCA 1RT2A 3Q8RB 2AGPA 2M88A 5G0RB 3MMAB 4LFAJ 4OYMA 2UV8A 3DLLQ 2PI4A 4MAKA 3R7NB 2BJ3A 1GQEA 1GMUA 4ZPTR 4WU2A 4J7CA 3TEGA 3UI3A 1DZ5A 3BF4A 1QVFR 2B3TB 1CS4B 4F3MA 3KK2B 1Y3JA 3EX7B 1VRUA 3GLJA 1KS2A 4K4ZA 4IFVA 1SQFA 2PMHA 4KC5A 5ETSA 4DPUA 3QAUA 4R5PA 3RR8A 2BANB 2V2VA 4LF7J 3VQTA 2ZBRA 1RT7A 5AT1B 5DQGA 3OFGA 1LWCA 2PMZD 5ETMA 2OPPB 4JI6F 1QDUB 3CJ8A 2P5VA 2VOPA 1NUEA 3LP1B 4ZKAA 4LF5J 2OO4A 1N5SA 1F0XA 1GTEA 3AQOA 1D9DA 2HK3A 2YX1A 4CLLA 1UVNA 4DS5A 3SYZA 1JJ4A 1E6YA 3LUYA 2EWHA 2VFSA 1B0TA 1HNZF 1IKVB 2ZBCA 4ZN3A 2CNLB 2V2QA 4TY8A 2VICA 4DZ6A 1NB7A 1VRUB 1FD2A 1U1KA 1K8AT 2QEXS 3PJWA 1Q82T 2CNOB 2HQGA 1NSKL 5EUHA 2HHTA 1G4CA 5L38A 4F3OA 1OS5A 1JLFB 1M1KT 3HT3A 3UN2A 4FS1A 1CULA 1PG5B 2AMCB 3IR6B 4I2QB 4LBHA 5D4LA 3OXGA 1RLDA 1RHJB 5AXMA 6AT1B 2A2CA 4RUAA 1DQ8A 2MZJA 3DLGA 1NJXA 1LXNA 3VAHA 3UW1A 3OVBA 1PO6A 7AT1B 5LJ5Y 4EEYA 2X7IA 1WOSA 2L9DA 4LSLA 1NJZA 4DL6A 3IFEA 2D9PA 1SC1B 3UCUP 1B3TA 2DHGA 3PCOB 2HHHF 2J76E 3TJ8A 4TLRA 3RB0A 2DPIA 1JLEB 1PCAA 4LQ3A 2XHCA 2V2KA 1EARA 4YQWA 1VQPS 4ZHRB 4JP8A 2F63A 2C3UA 1ZAXA 2J5AA 2AP6A 5ETTA 4B3SJ 2CQBA 2KH9A 1VMBA 1R8AA 2HQ3A 3A12A 4HH0A 2QRRA 4ED3A 3OTEA 4YHHF 1S0NA 1S76D 3VR1A 2EG2A 2XG8A 4JI4J 2CNKB 4DMZA 4WK3A 3I32A 3DDIA 4IH6A 2XNRA 2Q3PA 2DNLA 2MXYA 2DXEA 2XLJA 3JSMB 2VG5A 1H7XA 3D0GE 4Q7AA 4YB6A 3LGMA 2R7QA 3HPOA 2RQCA 1YTYA 3QQCD 2EFVA 2EKNA 3B8HA 4U67Q 2CZ9A 2MQLA 1TKDA 4JYAJ 3LWLA 2F4VF 2GHVC 3DDKA 2RB7A 1RDRA 2FC9A 3D3BJ 3QRRA 1RQ0A 3KJFB 4LF9F 3N5FA 3KLVA 4IO1A 5AE1A 2AZ1A 2QGFB 3GJRB 4DX8H 5A2QY 2ZJRQ 1D9FA 1HBUA 1T9XA 4EGLA 4CZCA 2OIHA 1J5EJ 4YOEA 4A8XA 2A10A 1T11A 4RPFA 1KVKA 1UVLA 4RW9B 3O6QA 3ZNJ1 3MPYA 1DURA 2V9KA 5HROB 4WZMA 1FKOA 1T03A 2QA2A 3N6NA 1HWKA 5DRKA 3UVJB 4OYXA 2CQGA 2OLWA 1CS4A 4OYBA 2CVIA 1HQUB 1LEOA 3T1AA 3G8TA 1DJ0A 1SQEA 5HANA 1HW8A 3ZZUA 3B4DA 5KG1A 3SDEB 4IFVB 2CKWA 3PRVA 3FRYA 1SCJB 1IXKA 4NLXA 4F4XA 2YWKA 4I56A 1UKUA 4OJGA 1X5TA 5HSPA 2XLIA 3K59A 1N33F 3EGVA 3IGNA 2R7UA 3PW4A 3Q8SB 3TO8A 4X65J 1C4AA 1PBUA 3MEEA 1UETA 3MR7A 4OV1A 5B09A 4EMDA 3HHEA 5L9NA 3G6ES 2AJFE 1U45A 1Y5NB 1OIAA 2XWXA 3K8WA 3QT5A 3M8SA 1LFWA 1RT4A 3K5MA 1HWJA 1DQ9A 2VH7A 2YKQA 5J2PB 1LW0B 4QIWD 3TP2A 4ZLNA 4F8RA 1X4HA 4LSNA 5KFUA 5LXRA 3FEZA 4U95A 3AOBA 3JSRA 5U47A 1HNVA 2W01A 3Q8PB 2CZVC 3IM8A 2I38A 3J81Y 1FEHA 1Z4UA 2WVCA 5DETA 3T1HF 1VQ9S 1QSLA 4J9KA 4JYAF 2UV8G 1A6LA 3SEOA 2RDDA 4LIRA 2P6TA 4U6PA 4ED7A 1KVIA 3H0PA 2VBXA 4PZVA 2B6AA 5F41A 1Q7YT 2LXUA 3RGIA 2ASJA 4NLGA 2C2DA 1PKUA 3A3PB 4IG0B 4TN2A 4DL4A 4H4MB 4JV5F 3KLGB 4NE9C 2KM8C 1F1BB 4E2FB 3P45B 4EYIB 2QYGA 3AHPA 3MHYA 2IIHA 1T3NA 4GKJF 4KGKA 4OQJA 4PWWA 1U1PA 2VG7A 4O3QA 2WAQD 2J9DE 4OYWA 3M8QA 2WVEA 2I2YA 2HQCA 3MF5A 1LWCB 1RADB 1Y10A 2GW8A 1HNIB 3BO4A 2FY1A 2IC3B 5LOQA 2IFXA 1XWLA 1FE4A 3MM7B 2W24A 4A46A 1Y5LB 5D3GA 2MKIA 2XGPA 2VPWB 3G6VA 1KHVA 3F73A 1UFKA 3CF5Q 4RU9A 3ZZYA 3HVTB 2XYPB 4OZ1A 5CHCB 5I3UA 5RUBA 4H4MA 3G4SS 1TVRB 5D15A 1MG7A 2FJVA 4UOCA 4OHXA 5KFFA 2LFVA 2RF2A 1YDLA 1AYEA 4KR0B 4PXDA 1GT8A 4K5SA 4MH8A 3FRZA 2VONA 2WVDA 1IBLJ 2NQPA 5GAHU 3M8QB 3K5NA 3S1TA 2NPFA 4DV7F 2G0IA 2X1FA 1UWBA 2G0CA 4M8LA 1J2VA 1VQYA 5IC4B 4X4SA 1QY7A 4ECVA 4DUYF 5KFBA 3DLGB 2HBZB 4WWSA 4ED4A 2MKHA 3C6UA 1R8PA 2VQEJ 3CCES 4WFZA 4NRTA 4P2XA 2JJ4D 4ECRA 4DR4F 1V3SA 1R0AA 4I69A 1W7WA 1M5SA 2BEFA 2MMYA 2F40A 3W2VB 3LP0B 4J9NA 3MCMA 3DLBA 1CJKA 1FXDA 4HL9A 1J5EF 2R7WA 4LBPA 2FY8A 3P96A 1XIQA 3KHGA 4EI2A 4M5DA 3I4PA 4P9SA 4NA1A 2XBPA 3TQEA 2BA9A 3DU6A 2KM8B 4GKJJ 2NREA 1HI0P 2RKIB 4YS2A 3BGRB 2Z56B 3SDEA 2F9JA 2LQ8A 3GZ7A 4A8QA 1ZM2A 1L3VA 4EO8A 2VJUA 1U1QA 4NI2B 3TVZA 2LVWA 2GMHA 4IDKB 3KMSA 2NCKL 2DRAA 1APSA 4NL5A 2VPZB 4JOUA 3J7Z5 5IT0A 1HNIA 2OFGX 1XJWB 4FXVA 2GS8A 2C42A 3QSIA 3T1YJ 4HT7A 3KLHA 3Q2SC 3MTJA 2DNOA 4WU3A 3N9UC 3RUBL 1TZ0A 4XDDA 1XC9A 3VCDA 2CRLA 1RT1B 4LF8J 5HO4A 3PM9A 1SVDA 1VQLS 3PX4A 4O44A 1WSRA 2RF2B 2YKNA 3ZTQA 2W9BB 3CCZA 1UA0A 1FDAA 3DXSX 3Q86A 2XI2A 1SBRA 4K2JA 4LVOP 3R7SB 4CO3A 4CT9A 4UTGA 5IQ6A 4QWAA 4NI2A 2FHJA 1S57A 3OPKA 3K58A 1UFLA 1K1SA 5EDWA 3U02A 4JB8B 3WIVA 4JI3J 1CG2A 2CPFA 1WEXA 2QYCA 5KT2A 1BQNB 2Z57B 5DM7Q 1S12A 1P9QC 2IVMA 1U2CA 3C6TA 2P9EA 1H2TZ 1ZZNA 2YNGA 4K8RA 3D5MA 3DLEA 4R25A 2DNRA 1TKZB 4S0MA 3W2VA 2MB0B 2KT3A 3LP0A 1L3UA 3UPFA 1Y5IB 4Y2IA 2R2TA 2RHSB 3DRRB 3OTOJ 3KOAA 1R89A 2CPZA 2RE1A 2W9BA 1HR0F 4XO0A 1TU0B 3EVOA 4Z7CA 5LMNJ 3RG6A 2I9SA 4OV6A 2R8IA 3UD3P 4KPCA 2Z2YB 1GAOA 3SFUA 3LW5C 4ENOA 1ZM9A 1TL3A 3LOUA 4DF8A 3TWZA 3FVYA 1YKWA 2IVYA 1LWFA 2W2MP 4PAAA 4LF4F 3DDNA 3BO3A 1N52B 4WJBA 1JLCB 5HMWA 2BE9B 2OPRA 4A8MP 2GGPA 5DDOC 2IVFB 3KHHA 5DDRC 1JJ2R 4WF9Q 3PIOQ 2RQ4A 5KFGA 2DO4A 1KR4A 5H9FJ 5I3UB 2B7BB 2M8DB 5CABA 1Q8KA 2OEMA 5B0EA 4TKTA 1RAGB 2Y9HA 1B4SA 1UWAA 2KRBA 2Q6BA 2IM1A 4XIUA 2ZH9A 4ZVRB 2GJFA 1U1LA 5IM0A 4YHHJ 2R7RA 2HHSA 3F0NA 3I5AA 3W60A 3PJXA 1UMJA 3DI6B 3HP6A 2QX0A 4OHWA 1T7PA 1U2FA 3CDAA 4HI1A 2ERRA 1O6XA 2WOMB 3WDOA 5GMEA 1S1WA 5HQMA 1CC8A 3MUTP 5CD4H 4DWIA 1FX4A 2R9LA 2ZJQQ 4Z2XA 1RYRA 2XC9A 2V9WA 3GFZA 1FWLA 3R9LA 4WYWA 3PO4A 3Q2TC 1QUVA 2RNEA 4KSEB 1IBKJ 4X62J 3N6MA 4OHVA 4H4KC 3FZ2A 3TW0A 2XS2A 3CJ3A 5F0WA 4F2RA 2Q79A 1DTQA 3IA0A 2HGLA 1TKZA 5T7LA 4CH7A 3QNWB 3EDRB 2JRSA 3IWXA 1GNKA 3Q8YA 2EBEA 4FPRA 4KO0A 3TZWA 4FF2A 2EFGA 4DPTA 2P6SA 4RLEA 2IY5B 2NXEA 3R3TA 1PGZA 1TL5A 2HFOA 4LF6J 1KFDA 3HK2A 2VBYA 1AFIA 1U09A 2E44A 3KLHB 3NEKA 1JX4A 1LK5A 4CLSA 1YSJA 2R3VA 2MQQA 1BE4A 2BVZA 3IRXA 4LREA 1HBNB 1N5YA 2KXHA 4IDKA 3BR8A 4WFNQ 3TZYA 3NOGA 4I68A 2J8AA 1FT8A 2AJ1A 4B08A 4DV5J 3KDOA 3IBFB 2YKNB 3G86A 1URRA 3L7PA 2OD4A 1AZSA 2V34A 3CDUA 3OXFA 3UR0A 1FEEA 2C2EA 4GKKF 5C7PA 1HL6A 4HHJA 2MY8A 5CYQA 2JLEA 4FYXB 1HNZJ 2Z2ZA 4MKVA 4M5GA 4K2XA 3HHLD 1ZTWA 1S4FA 2FJXA 2IMWP 5G4DA 3PJ9A 4Q5VA 1RTDA 1WC4A 4JI7J 2HWIA 5GVQA 4DV2F 2HVIA 1X4AA 2ALYB 2J9EA 3ZFVA 2LECA 1NPRA 3UFCX 3ULHA 3VVTA 3IS9B 4USUA 1RSCA 4LUBA 1FFSB 2XCPA 1MSWD 3ZZPA 3WHIA 4Q2LA 4CLWA 8AT1B 4J5OA 1TL1B 1G1XA 2HW3A 4ZP8A 2RQMA 3V5RA 4IOAQ 1SV5A 2CQHA 2J7UA 2X51A 5D0EA 2AT1B 4A8WA 1EIYB 1K44A 3ZZ0A 1RWKB 1UJ6A 3SCKE 3CCWA 3OXLA 5D8HB 4PG8A 4J9OA 2BE2B 4NX9A 4OZ5A 2L41A 2XO7A 1M1GA 4MIAA 1VOMA 3FSYA 3MM6A 5K14A 3PYEA 2BX6A 5LM7E 3Q8QB 3CC4S 3CIZA 1D8ZA 4N77A 4NPOA 3C16A 2ZDOA 1TKTA 3MECB 1XQIA 2W9CA 3BSAA 1L5UA 2CJBA 4JI0F 5KFZA 4LQ9A 3CC2S 3PYFA 3MPWA 5H1SV 3C14A 3PW7A 2XLKA 5A8WB 5B0BA 1AW0A 3QWUA 4WIQA 1RU2A 4C8MA 4ZVTB 5BYRA 1SL1A 3D6TB 1LXJA 1H0HB 4KKOB 1GX5A 1F6TA 3ENVA 4RUBA 4QWEA 2LDIA 4DLGA 5L1IA 3W9IA 4RBVA 1NM2A 2JDJA 3I82A 1B99A 2CADA 4ID5B 4C7QA 1WWHA 4JI3F 1QUPA 5J1NA 4FVCA 2QMWA 1KKHA 2FGCA 4PEOA 4XK8C 3DRXA 3DI6A 3K89A 3UDLA 3VGVA 4ED6A 1KVJA 3J7ZT 4HKQA 2DIVA 4ZP9A 3ENAA 3BQ2A 2XMWA 5DGBA 2DR5A 3C2PA 2ZZMA 2DHSA 2Y1LB 1RHQB 5LL6d 1S1VB 2VPXB 4NLOA 3OQ2A 1RWXB 4OYPA 2CWKA 2XI3A 2M4MA 2ZBPA 1XN9A 3CJSA 3MAAB 4U9RA 4FDFA 5CQGA 3QWPA 3EPIA 2UVRA 2OPQA 5A8KA 1S72S 2G0JA 1QAJA 4UY85 3CDBA 1JK9B 1T9UA 3ZZOA 2PDAA 1XMOJ 1CC7A 1WOPA 4Y65A 3OFHA 2CUYA 3TAQA 4OI6A 1VQOS 4ZVGA 1KTVA 1T03B 4FS2A 1S6PA 1UAWA 2MEWA 3KWMA 4YDDB 2BJ7A 3LPEA 1D1UA 2Z30B 5AXKA 4I6AA 2BE2A 1NJYA 3HHDA 3D4JA 2OPRB 4CM0A 3O8WA 4ED5A 3JYTA 3OR1A 2CVEA 1D8YA 1SH2A 1RT5A 1RT3B 2DCLA 2PA3A 4KO0B 3U1NA 4DLEA 3I0RB 3KK3A 3M8RA 1U25A 3T1YF 5DLGA 3G82A 4BCAA 4C8OA 3KHLA 4KTQA 3OR2A 2W4DA 3CDWA 4ZK7M 3OTCA 3R97A 2RDJA 1FJ7A 3FBEA 2IJRA 1URNA 1T3OA 1LOUA 4F0KA 2E7WA 3JAMU 3EGNA 3J7YU 4IQXA 5DG7A 5C24A 2NXUA 1VISA 2BDPA 4C98A 4H4OB 2EXUA 1JWWA 4P10A 1M0SA 2AJ2A 7FDRA 5HJXA 5LSOA 2IYIA 1DTTB 4CQ1A 2KYXA 3AOCA 2O1PA 4PG6A 3W63A 2DEIA 5KFIA 3ET6A 5IWAJ 3ICLA 4AXJA 4DN0A 2UUCJ 1CPZA 4LIWA 3FQKA 2GQQA 2V67A 4PYDA 1BHNA 1UVKA 5A0YA 4DX7A 3QZ7A 3FMWA 2P8IA 3ILJA 3G6YA 4DSFA 5KG2A 3QFHA 1S6QA 2HVDA 2YXLA 3UN3A 3VALA 1EAYC 4LF2A 1VRTA 3MM5A 1SV5B 5KFQA 3J7YI 3R5AA 4DSKA 4NMLA 2V63A 5K8NA 1HBOA 1IKYA 3D6HB 2RIJA 2ZM6J 1L3TA 5CCLA 1NZ8A 4B3TF 1R0AB 3QO9A 4A4JA 4QOTA 5C24B 3M9NB 4J90A 1DQAA 4QIEA 2PGCA 4ITSA 1TL1A 5A8KB 1JLEA 1MLAA 1RHKB 5HN0A 1XTZA 4DFPA 2VA2A 1F2GA 3MMCA 5KFHA 5K8OA 4PYAA 3C8YA 4P2FA 2YWFA 3IWLA 1HMVB 4CNZA 1EZZB 1FKAF 1AT1B 2R2UA 2FVPA 3GR1A 2B7CB 3V6DA 3VAJA 4GC7A 5DM6Q 1LNQA 3P3DA 3MWBA 4KHRA 2ZH5A 5CCMA 2AGQA 3DHXA 3HO1A 2IRUA 2MJNA 3MI7X 4NA2A 4CH0S 3EGZA 1K1QA 2DGWA 3THPA 1GH8A 5K8MA 5KFSA 1KONA 3PY8A 4F2SA 1R8BA 2BBEA 3SFGA 4F0HA 5F8HA 2E7XA 8ATCB 2VB6A 1IKYB 1OY9A 3BM7A 2XZDB 3D54A 4ID5A 3ENWA 2B4OA 3AJ1A 3EUNA 4FBUA 2GHWA 5HATA 1M5VC 2W25A 5GAHI 4DR1F 2GMJA 3K2YA 3NS6A 4PQUB 2O67A 4PG5A 4KKOA 2E1RA 5BYQA 1Y7PA 1QTNB 5F3TA 4NXNF 4N76A 2WONB 2LEAA 1TP7A 2ZH8A 3SZ2A 2MZ1A 2NR0A 1QJHA 4ZP6A 1S1VA 1DTTA 2X3DA 2B9XA 3IXQA 3FGVA 3US5A 2AEJA 1RAHB 3PW2A 4W4MA 4ZVFA 2QLJB 2Y3YA 3LF0A 2C3MA 4P73A 4Y2AA 3AT1B 3QMQA 1S7IA 2DYAA 2M70A 4OZ3A 4DF4A 2R8GA 2GVDB 3CCLS 4C0HA 2KU7A 4LR7A 4DR7F 1RJJA 1RLCL 3DHWC 4CLKA 4ELUA 2LP4A 3PEHA 2OGUA 3IAM9 2FD2A 4ANDA 1U0HB 5CD4A 2D3O1 2DNKA 3T9NA 2B5JB 1KDNA 2YNFB 3DRSA 1F9HA 2YX7A 2CPDA 3L4BC 4A8SA 1WOOA 2XTJP 2R8HA 1FK9A 1IUJA 4KE5A 2W9AA 1X9SA 1MW7A 3R2CJ 1FFWB 2DNZA 3POTA 1SJRA 1QM9A 3FBBA 3W8PA 4W92B 1I3OB 4CI0B 3MM8B 2MLXA 2CDRB 4HHHA 1JLQA 1BXNA 5J2PA 5F8LA 5I42A 1F5AA 2ZWOA 1EKSA 3CJKA 2ZH1A 1OSDA 2XZWA 3OHAA 3Q23A 3GFYA 5F8JA 2B0GA 1UVMA 1WSVA 1C0TB 2JZ5A 2LYVA 3AXKA 1TL4A 3BZQA 1S5ZA 2C3YA 1B7YB 1JLCA 1X7VA 1Z1ZA 4OJHA 2AWZA 1NCLA 2B5JA 1Y0HA 3HFVA 4P2SA 4U7UK 1U6ZA 3MMBA 3SSRA 2W4CA 5KT7A 3LQVA 4RNMA 3OW2R 2J6SA 1NDCA 1JLAB 1O0PA 2CFXA 1N5QA 5D4NA 2WRMA 1NLKL 4LRCA 3KUGA 2NSCA 1Q53A 1TELA 2X3GA 5B7WA 4MK7A 4K4TA 4IG0A 3TAPA 3V81A 5H9FK 1YVFA 4EBDA 4EO6A 3I0SB 4J91A 4X66J 3T5JA 2Z0GA 2NXNA 3GSIA 1FRJA 4QWBA 4F26A 3H7HB 2HGNA 1BWEA 5A6WA 2GQ2A 3VVUA 1Q16B 4QW8A 3BQ0A 2U2FA 1X0PA 5JXSA 1CJVB 4YFUA 1FRKA 1S79A 4YB5A 4L73A 2Q43A 2QA4S 3BGFA 2K7JA 1RABB 2WZ1A 3HFKA 4WE1A 1SL0A 2DR8A 4KHPF 3CCRS 1HIYA 4OX9J 3OLAA 3BBCA 2KTQA 2BJDA 3MPVA 3UNGC 3QO9B 1OY8A 4CNYA 4TQSA 2ZD1A 1X4FA 2RH3A 4YR0A 1CJTA 2C2OB 2QN6B 1NHVA 1NB2A 2DGOA 3CCTA 2POKA 4OYIA 1PAEX 4UZCA 1GXUA 4CO0A 4ZLPA 4RX6A 3OHBA 3CCUS 3RJMB 1UVIA 3BPDA 3DOKA 3JTOA 4J9VA 3MR6A 4DL2A 3NGSA 4QR2A 2RMLA 4Y2CA 3ILLA 2FGOA 3MEKA 4DCJB 3TUZC 2VODA 1DARA 1N88A 3CULA 4ZVEA 2F1FA 4FF1A 3BQ1A 3HHNB 1NHUA 4P71A 1WDTA 3H4BA 3V6HA 2KKHA 3FNNA 2DTJA 4O3NA 2DNNA 5KT5A 5KFVA 2Y1JA 3I4HX 1FKOB 4OI4A 3DN9A 2LXFA 2WHOA 4OZJA 6FDRA 4DBQA 4WFAQ 3R5BA 4Y28C 1QAXA 1SH3A 3G6XA 1D3WA 1E6YB 5F0UA 3PO5A 3MCOA 2VL1A 3D3CJ 3MMBB 3MTKA 2KJVA 3SSQA 2PEHA 2M3DA 3CCMS 1K9MT 5CYQB 3HXMA 2RAQA 3DOKB 3SBMA 1RT6B 3MCNA 3UN5A 3JSYA 5E3RA 2AX1A 1X9MA 4M5DB 4RNFA 3E8OA 2C3OA 3UR3C 1CLFA 2GA7A 1UZDA 2AQ4A 3TR5A 2R8KA 4M5KA 4GC6A 1FWPA 2KFZA 1NJIT 2WW4A 4MIWA 2FDNA 2XMKA 2O5DA 4ECYA 1SIZA 4EBCA 3GFHA 4A48A 1LW0A 1ELOA 1TKXB 2X1BA 3U7JA 2MZQA 4C8NA 2F4FA 2LQBA 4F7VA 2BRLA 5ADZA 5KT6A 4HVZA 1XBWA 2DKOB 2JEJA 1S1UB 1S0OA 2RRNA 4DQSA 1IKWA 5CH7B 4MFBA 2QIFA 1EQMA 3KDNA 3KLFA 1FRLA 3NGRA 3GQCA 1B70B 2B9WA 3DGPB 3TAMA 1NKEA 3E01B 1MNEA 3I55S 1F9FA 1WC3A 4HYKA 3KJVB 2HAFA 2ASLA 4ZHRA 3F41A 2DT9A 2E1AA 3W9HA 1XR6A 4NXNJ 3AFGA 4YY3F 4C8ZA 3LP2B 1HHQA 1VLOA 2KT2A 3SXLA 2VD3A 1GMWA 3CDEA 3LWMA 4JV2A 1XERA 4LFCF 2KFNA 5DQHA 5K8PA 1F3VA 3M2UA 4C11B 1RCOB 1UPMB 4UUXA 4ATNA 3IC1A 3EZUA 3CD0A 5IV3A 1NK0A 4DV6F 3D6MB 3IWNC 4MFBB 3O5TB 1S59A 2OPSA 3ISNC 3FJ2A 3TX8A 1IQZA 3DLKA 3H8YA 4ECWA 1RWUA 1JLFA 2RDIA 2VHGA 2IYGA 2DRDA 3C66A 4WKRA 3FMBA 4XTTA 3LGNA 1CJKB 4NLYA 3MR2A 4N41A 1VC0A 1TFYA 2V50A 3G9CA 1VS3A 4O4GB 1OMSA 3M8WA 2FLNA 2OI2A 1DY3A 2A6MA 3PHEA 4Y2MA 4CH1A 2RUSA 3QRQA 3MXHP 1N33J 4MTPA 5L46A 2QG9B 2BOPA 3PRDA 1H73A 5J2NA 3PEJA 1SC4B 1W25A 5FD1A 1Y00A 5CAAA 4HH1A 4DV3J 3FDSA 3PW0A 2KG1A 2R7TA 1FVQA 2V8DA 2MZSA 3ETOA 1O51A 5D4PA 4ZA1A 1NSPA 3UCGA 1U4BA 2GHPA 5F9LA 4Z37A 4DR2F 1PJ6A 4DUTA 2YWEA 2OPPA 2K1RB 5THWA 2JVRA 3KYLA 2GFFA 1VQ8S 2ZKUA 3IR7B 1FDBA 4DPYA 1S4EA 2OELA 3TZZA 5IOLA 2KL8A 3W5XA 4I7FA 2IA0A 4UZBA 1S0VA 5GAGU 3H5SA 3TANA 4CYUB 1RHUB 1JNZB 1OQ3A 2VG6A 4R8UA 4M63A 3RAQA 4TU7A 2IBKA 4JI6J 1HNWJ 1SC3B 4W90B 2BKPA 3UD4P 1IBKF 2VA3A 4RL1A 1U1OA 3UD5A 3MEEB 4YY3J 2GAGC 2L3MA 3JSBA 2UUTA 1GX6A 2G2ZA 4PPDA 4Y2KA 5IM0B 4PUOB 2YWHA 4WP3A 9ATCB 1HHTP 3FZBA 4X4NA 3AODA 4X66F 1V5IB 2QL5B 3WC0A 4JV0A 2OTLS 2UUBF 3O1LA 1GK8A 3QBCA 1U1NA 4F25A 3QYYA 2MKKA 1VQ4S 3ZTRA 2I6WA 4ZPCA 1GFWB 4H4OA 2W4PA 4FNHA 4NCGA 2FZKB 3DKDA 4K4XA 2GVZB 2I5JB 2V8GA 1P6TA 2CJAA 5HQLA 5DLFA 2LEPA 3HULA 1KRPA 2BKOA 4ES3A 3IR5B 1EX8A 1F5BA 2PC6A 2RS2A 3DYAA 2ZH6A 4DCOB 4ALZA 3KHRA 4MJKA 5IT4A 2MHNA 1KQFB 1ZYQA 1U6FA 2PN6A 3V4MA 3WX8A 1RISA 3MM5B 4C97A 4DV1J 1N6QB 4B9NA 2ZZNA 2H3EB 2HIYA 2RRBA 4MKBA 4PXBA 1FRIA 5EWFA 3V4IB 4O3RA 3MM9B 5AXNA 4DQPA 1TFWA 2BRKA 4M5HA 4L6V3 2Y0SD 1G3OA 1KHWA 2GVZA 1OO0B 1S6UA 2XMVA 3M1VB 4L76A 4NLWA 3P6YC 1PYTA 2HRYA 4AE5A 4DR5F 1C1BB 1BC6A 5E5NA 1WHXA 2ILYA 2DBBA 3H4DA 4EZ6A 2C1EB 2IC3A 1X9WA 2YNHB 3LP2A 2Z2LA 2OMOA 1RWWB 1NPPA 2VG5B 3HHLA 2XO6A 5EN1A 3FFIA 3D67A 3SQOP 1C0UB 4LVNP 4ANEA 5F8GA 4LSNB 3M9MB 3M2UB 4C11A 2M8HA 3RW7A 2LEBA 2ZZTA 4I6WA 3Q24A 5T14A 2R7SA 2UXCF 2CQCA 4F4YA 2ZVIA 3NAIA 3FCHA 3NOCA 2CXEA 1VRQC 2B56A 1WTFA 3KK1B 3Q83A 2HNYB 1EETB 3KLEB 4L3KA 1S1WB 1VJQA 5KG7A 2V4QA 2EK1A 2FLOA 3OTBA 4O4GA 1KQKA 3WX4A 5IC6B 1WKKA 4L3NA 2RT3A 4F67A 1WEYA 4J9PA 4U7UD 2VBWA 3GU0A 1AUSL 4MK9A 4TYBA 2AYEA 2OFHX 4I2PB 1YRXA 2BUNA 2GCFA 2VF3A 1N54B 3KG0A 2WBMA 3GV7B 1FXLA 2IJFA 1Q86T 2HBYB 2E1CA 1VQKS 1NK9A 1ZH5A 2KFYA 2PT0A 1YHQS 3F56A 1LFPA 1H2UX 1OJ4A 3DOMB 2YNIB 3DMJB 2HMIA 2R7OA 5ETNA 2HVZA 4ICLA 4A8YA 3A8IA 2FPHX 4RW7B 4AUKA 3ZZTA 3T5LA 2GZOA 3ILIA 1N48A 2E5JA 1I94F 4OL8A 2R7VA 3S6EA 2ZITA 2B9EA 4AFFA 1FERA 4CLUA 1PSDA 3KJNB 5E3CA 2NPIA 1JLBB 2FZCB 2QMUB 1XR5A 1KBRA 2W7AA 1AROP 2H9ZA 1YRUA 3AA8A 4BBYA 2ZE2A 5A76A 3OVSA 5AE2A 2K1RA 1TUGB 2ZOFA 2LCWA 4DJBA 5IT9Y 3P8BB 1HD0A 4G1QB 4B9MA 2IMOA 2H51B 3A3NB 4NLRA 2M7SA 1G6BA 1NNDA 3M6WA 4I1TA 4MKAA 4PG4A 5J2QB 4K0KF 2DCUB 3X3UA 2CWXA 1CJUA 2OD6A 4N47A 2BABA 1WI6A 3EZ5A 5B0DA 3IP0A 4GVBA 1W2BR 4ICLB 2QO3A 4DL0C 2HHHJ 2E29A 1RT1A 2VFVA 2VUGA 2QJ3A 4L74A 4U8YA 3KLIA 3ZTSA 4FXWA 2XSFA 5M2RA 2DXDA 2F7VA 2LA6A 4WK1A 5J2MA 1RUSA 4IRCA 4ILMA 3QT7A 1FJGF 3AXMA 3LH2S 3M9OB 3UWTA 1T0TV 1KOOA 4DG1A 2YKOA 3QGGA 3BSNA 5DGAA 1QVGR 4C4WA 3HKWA 5KOXA 5HBMB 1KLNA 3TA1A 1IVZA 4NCGB 4DZDA 4ZCMA 4YP3A 3MAQA 3VAMA 4JI8J 5EX3A 3Q0AA 2V8VA 3TA2A 3RBEA 1VGYA 1XMBA 2YTCA 2WW8A 3NWGA 4DR7J 1R8HA 1U7LA 4YMEA 2J6TA 1OPZA 4EU0A 3BGRA 5K5MA 1VQNS 1JQGA 4IYQA 3MM7A 1VK8A 2B4PA 2ROPA 4LF8F 3QLHA 4ZJOA 2EFPA 3VGSA 3G8SA 3QGPA 1YI2S 1VR6A 2CAJA 5IZHA 3I0RA 1T02A 1UFWA 3FK4A 3EXYA 4DV4F 2ASYA 5C2GA 2G1HA 2JLGA 2V5HG 4YDXA 1U47A 3UDVA 1X4GA 2BOAA 2FHOB 4DI6A 1VHFA 3D28A 1YLXA 5HI7A 1SPBP 3EXCX 3FC9A 2OSQA 3N0VA 1XNQJ 3GIRA 4TLQA 4HT5A 1X4BA 2ZE2B 3FUYA 4JI4F 3H5XA 1F5CA 1SKWA 1MROA 1FKPA 3HSJA 2L08A 2JWNA 4FYWB 4HDHA 3QJJA 3LO3A 1YJRA 3ZTOA 2Q6CA 4X2BA 4TNOA 3FFIB 1Z2ZA 3IAS9 2VPYB 2E5LJ 4J9RA 1CQMA 2ABYA 5JVHQ 2OEJA 3GSDA 1WG4A 2A3JA 4KV8A 2AYMA 4K4WA 1VDHA 4BWMA 1NSAA 3NY0A 1YJUA 5KT4A 4OX6A 1TKTB 3T1HJ 1XMOF 1RK8A 5CYMA 3OVAA 1GXLA 2MGZA 3NRBA 1RA7A 3QJPA 1N34F 2LKZA 1Q5YA 3HHLC 5C25A 2KG0A 3ISND 1UEUA 4XAKA 5F9NA 4LF1A 5D77A 4PR6A 4NCAA 4DU8A 5LMUF 4QU6A 2YH0A 3N01A 3GE9A 2UUAJ 3RU0A 1IR1A 4URGA 3MFIA 2ADCA 2DITA 2OHDA 3IG1B 4RJVA 3OTOF 3KNAA 4RW8A 3J7AN 2AU0A 5AXLA 2FJBB 1UEVA 3N4WA 2Q66A 1WDDA 2WBRA 4FYYB 4K0KJ 3DLEB 3CJ2A 1WC6A 1JXVA 1UJ5A 3HM9A 3GFXA 3OR1B 4K7QA 3HHLB 4QZVB 4E0DA 3PIPQ 2J7WA 1HBMA 1ZZFA 2JFKA 2X1GA 3HVAA 3MOZA 2X1AA 1M5OC 2AW0A 3DMJA 2W8LA 1N0UA 1LKZA 4LBIA 2PA8D 2V8HA 4G1QA 5HLFA 2H65B 3FBFA 3KK1A 1J27A 3NKYA 3VF0B 3LA0A 1OYEA 2FUG9 1H6KX 2HHPA 2V0NA 3L7UA 2HURA 2YNGB 1JLBA 2UZAA 4NRUA 4Y3CA 2ZUGA 4JI0J 1X31C 3Q22A 2C2NA 2MHEA 3U27A 2C2MB 4CM2A 2QSFA 4X84A 4PXCA 4WFBQ 3BKTA 3T6JA 4AXIA 1MROB 2Z58B 1HWLA 4KQZA 3ZO7A 1WNEA 1H2VZ 4JV5J 5J1EB 3DRPA 5B0AA 2XS7A 3W66A 3C19A 2PIIA 3IM9A 4ZIVA 1HBMB 5DG9A 4QJVA 3PX0A 1XNQF 2UVUA 2CPIA 3N5BA 1YBTA 1SJFA 3DOLA 2W2OP 1CBKA 1D9AA 1BQMB 4J9MA 1GEHA 1SQGA 1P1TA 2GJ2A 1PJ7A 3DRRA 4DHVA 5J2MB 1JMTA 4ECUA 1VFJA 3BPSP 3K8VA 5FDLA 1VBKA 2HHXA 1HQUA 1XEZA 4QWDA 3GILA 2BW7A 2GX8A 1RAJA 2ZC3A 3OL8A 5KFCA 1WELA 2AJ4A 2MZRA 2ZNZA 2ZVSA 2ATLA 2MTLA 2XULA 1BMQB 4WXOA 5LMNF 3DRPB 5L1KA 1NSQA 3P5BP 4OHZA 2R2SA 4USMA 2UU9J 3D7SB 1XR7A 4NCBA 3DGVA 1R3NA 2DY1A 3Q89A 3IGVA 4TYAA 2HZAA 1S9EB 3MEDB 3NP5A 3R5CA 4AQYF 1RT4B 1R6YA 4RWWA 4UOGA 1RTIA 1C4CA 2CQPA 2E1PA 1TK5A 4CLPA 4ZIWA 4OHYA 4LMZA 3H2VE 1NH8A 3HLUA 3HSGA 4ZVQB 4N8NA 5D4OA 5IWAF 2MSSA 1KQSR 1A7GE 2KXFA 1S9FA 1GTHA 5KFMA 3PXGa 4HACA 5SZTA 1WC5A 3G87A 3IRWP 1NDPA 3M32B 4K4VA 4QYZK 3AY0A 2HNDB 1M1HA 2DJWA 1HBNA 2CPJA 2FB0A 2KRRA 3TUIC 3EPGA 2CPYA 4KYZA 3CVKA 3PKYA 1XK8A 4OFZA 2J0SD 3QZ8A 4IKAA 2YKMA 4NYZA 3H40A 1WC0A 3NWRA 3M4XA 3CJ4A 1FTRA 2QV6A 1Q1KA 5ETRA 5KFXA 3W8GA 1RTJA 5T41A 2M0GB 4X4PA 2CQ1A 3TUPA 1KFSA 1T9TA 2HS3A 3QIDA 3QAEA 2HPUA 3MD1A 4M5LA 1XMQJ 3OD2A 1RP5A 1RCXB 1HNXF 1VQ5S 2HHVA 3L09A 2D1CA 2ZH2A 2L9NA 3H90A 4ZCLA 3BDEA 2VFUA 2MDAA 4YN3B 4ZVSB 5KT3A 2MQMA 4LJMA 1HYSB 4BDPA 4CLTA 5IT9U 5IV4A 5L8RC 2FQQB 4ELTA 1OYDA 1WJ9A 4RR5A 4WIIA 1V5VA 3WIUA 2VQFF 4AL7A 2XY6A 4O3PA 2FVSA 4HHUA 2GIFA 2LA4A 3GWCA 4NLVA 4E8UA 2UXDJ 2F9DA 2DH8A 3CWJA 2IRYA 3FQLA 4M5JA 2KT5A 2KDOA 4WP9A 3ZTPA 1RTJB 4NEZA 4MT1A 3D0HE 2YKPA 3RRKA 2KXNB 4KH0B 4DUZF 2ZKTA 2NUUG 2I8EA 2QZ8A 2HQIA 4UT4A 5HP1B 5CA5A 3CW2C 2H54B 2ZBQA 3JYTB 2VC0A 4C9DA 4LF4J 3PYGA 4WKYA 3RB4A 1EHWA 1SB6A 3HJVA 3NGTA 1UWBB 5KG6A 3CCVS 4QQBA 3CJQA 1U49A 1UL3A 4JI1F 7FD1A 1PC5A 3W2WB 2P9GA 9RUBA 4KJIA 2G9OA 1X5PA 2BJEA 4UUWA 1B64A 1ITPA 2HFNA 4P75A 4UF4A 4BLGA 5C25B 4EFAC 3V81B 2WVBA 2CQ4A 4LRBA 4F4KA 2APOA 1IBMF 1S9GB 2D69A 4ECTA 1CULB 1MMLA 1YX2A 1WTBA 2UU9F 2VU5A 2AGOA 2MQNA 3MM8A 4G1IA 4DEZA 1VK3A 1JLQB 2HZCA 2XNQA 2YKAA 4ETZA 2VKZG 2WB4A 2HHWA 1AA1B 4YEAA 3NAHA 2KVQE 4WE1B 2GO8A 3K57A 1NK5A 1DRZA 4ELVA 2QC3A 3M8PA 3R1LA 4OZ2A 4NLTA 2QE5A 3C6TB 4LT6A 4F3QA 2DGTA 3R5JB 4I2PA 4DXLA 4D3GA 5KFKA 2RU3A 2XSJA 1Q0NA 2OMLA 3BDPA 1EP4A 3DGPA 3TAMB 2HRTA 1X4CA 1LK7A 4OYOA 4GMKA 5BXIA 2DK2A 3FSIA 4MYTA 3VTIA 1KTQA 2GJIA 2QSWA 3VGTA 4ZLLA 3MGJA 4ZVUB 5E41A 4B3MJ 1IN0A 1FXRA 2VQFJ 3A8JA 2CPHA 3BH7B 4JV1A 5BJRA 5EGYA 4RO0A 3AB2B 1PIEA 4ED8A 2UXDF 3RW6A 2XY7A 4CO5A 1AB8A 1NHKL 5J1EA 1RGVA 4C6AA 2O3DA 2JH3A 2HNZA 3M8PB 5H9EJ 2WB1D 3KK3B 3QGHA 2OPQB 4MIBA 3PW5A 1PC4A 1YJWS 3PTWA 3TQ1A 5JJBA 2VC1A 2OH2A 2HKEA 2YPYA 4XDCA 4BS2A 3O3LA 3A4TA 1Y11A 2YWGA 3NCRA 3NS7B 5CZVA 1VBZA 1KQGB 1WD6A 5F8IA 2CQ2A 1S6PB 2N4DA 3LAKA 3EE3A 2IJNA 1P1LA 4C0BA 2ZHBA 1AUDA 4Q8EA 4FF4A 2RQKA 4N56A 3RB6A 2EC0A 1VRTB 2WONA 4NZ0A 2XGQA 1WG5A 1IBMJ 4DR4J 2AV5A 3C15A 4WFXA 4CP5A 5GAEU 1FA0A 2QA1A 5D0HA 4FYDA 1M90T 4PCQA 1HPZB 2Y8WA 3ISZA 1WACA 2AIRB 3ZNUA 3OT9A 3GIMA 3PR5B 4CTAB 3GONA 1F9EB 2ZFHA 2WOMA 1WG1A 5D0GA 3GIJA 5L1LA 2DR7A 4DUYJ 1LWXA 3VGUA 2ZEJA 1HMVA 1NJWA
chains in the Genus database with same CATH topology
1TL7A 4CLTA 5IV4A 4P2XA 1YBUA 2GVDA 4CM0A 1CJKA 5IV3A 4P2MA 4WP9A 3G82A 1YK9A 3C15B 1AZSB 1WC6A 3ET6B 4CLSA 1CJKB 4NI2B 1CJUB 3UVJB 1FX2A 4OYXA 4WP8A 1CS4A 4OYBA 3ET6A 1AZSA 4CLUA 1CJVA 4OYMA 1CJVB 3G82B 2WZ1A 3MR7A 4CM2A 1WC4A 1CS4B 4CLZA 1CULB 4USUA 1CJUA 4NI2A 1CJTA 1YBTA 4CLWA 4OYIA 4P2FA 2W01A 5D0EA 4CLFA 4OZ2A 5D0RA 4WP3A 4CLLA 4OYOA 2BW7A 3C16A 2GVZB 3C14A 1AB8A 1CULA 4OYWA 1TL7B 4CLPA 1Y10A 4USWA 1Y11A 1WC5A 4OYAA 4WPAA 3C16B 4OYZA 4USTA 4OZ3A 4USVA 2GVZA 1WC1A 1CJTB 2GVDB 3UVJA 5D15A 4CLKA 1WC0A 3C15A 3R5GA 5D0HA 2QV6A 4OYPA 4CLYA 1U0HB 3MAAA 1U0HA 3MAAB 3C14B 5D0GA 1WC3A 1FX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TL7 A;  4CLT A;  5IV4 A;  4P2X A;  1YBU A;  2GVD A;  4CM0 A;  1CJK A;  5IV3 A;  4P2M A;  4WP9 A;  3G82 A;  1YK9 A;  3C15 B;  1AZS B;  1WC6 A;  3ET6 B;  4CLS A;  1CJK B;  4NI2 B;  1CJU B;  3UVJ B;  1FX2 A;  4OYX A;  4WP8 A;  1CS4 A;  4OYB A;  3ET6 A;  1AZS A;  4CLU A;  1CJV A;  4OYM A;  1CJV B;  3G82 B;  2WZ1 A;  3MR7 A;  4CM2 A;  1WC4 A;  1CS4 B;  4CLZ A;  1CUL B;  4USU A;  1CJU A;  4NI2 A;  1CJT A;  1YBT A;  4CLW A;  4OYI A;  4P2F A;  2W01 A;  5D0E A;  4CLF A;  4OZ2 A;  5D0R A;  4WP3 A;  4CLL A;  4OYO A;  2BW7 A;  3C16 A;  2GVZ B;  3C14 A;  1AB8 A;  1CUL A;  4OYW A;  1TL7 B;  4CLP A;  1Y10 A;  4USW A;  1Y11 A;  1WC5 A;  4OYA A;  4WPA A;  3C16 B;  4OYZ A;  4UST A;  4OZ3 A;  4USV A;  2GVZ A;  1WC1 A;  1CJT B;  2GVD B;  3UVJ A;  5D15 A;  4CLK A;  1WC0 A;  3C15 A;  3R5G A;  5D0H A;  2QV6 A;  4OYP A;  4CLY A;  1U0H B;  3MAA A;  1U0H A;  3MAA B;  3C14 B;  5D0G A;  1WC3 A;  1FX4 A; 
#chains in the Genus database with same CATH topology
 3W5Z A;  4ZPV R;  2FIU A;  4UQG A;  2VJV A;  3HX9 A;  4JI1 J;  2P2C B;  3GJT B;  2G2O A;  2CZ4 A;  5JUM A;  3I56 S;  3PYD A;  4AD6 A;  2PEB A;  3H5U A;  4N8O A;  3NG8 A;  2E66 A;  2MLZ A;  3GPA A;  4ZPB A;  1R43 A;  3BGU A;  1WF2 A;  2DO0 A;  4J37 A;  4WYL A;  2NYH A;  4HLB A;  3SCJ E;  1S99 A;  2MKJ A;  1EKR A;  4IG3 B;  3J80 Y;  1R7I A;  2B8Q A;  1S6Q B;  3QT8 A;  5EHH A;  2W2Q P;  1JNR B;  1VJW A;  2E5H A;  1SJQ A;  1YQH A;  2DNH A;  1YK9 A;  2C2Z B;  3MCS A;  3FEY B;  2ACY A;  3DCA A;  2ZHO A;  1IM6 A;  4CRJ A;  4JI2 J;  5F3Z A;  4PQU A;  3ET6 B;  4DX5 A;  1HBO B;  1WOR A;  1MWQ A;  3IRX B;  3OL9 A;  1PBA A;  3M8Z A;  2A0F B;  2H5E A;  2N7Y A;  3BSC A;  4RBU A;  3HVR A;  1RBA A;  1QE1 B;  2ASD A;  1ZAV A;  3EM1 A;  1DLO A;  3JQM A;  4JBC A;  1T05 A;  5E3Q A;  4TQR A;  4ETX A;  4F4W A;  4F36 A;  4RZR A;  5KFR A;  2R7X A;  2UXC J;  1P27 B;  1VQM S;  2ROG A;  1Q8B A;  2AYB A;  2BQR A;  3HJF A;  1Q4R A;  4L75 A;  2JHE A;  3WC2 A;  4R0J A;  2IDE A;  2BJ1 A;  1LW2 B;  4LFA F;  4X4O A;  1HI1 A;  4ILR A;  3FKB A;  3MMC B;  5T7L B;  3RYL A;  2CA9 A;  4ZIT A;  5KG5 A;  1FNO A;  3H59 A;  4DV0 J;  4B3S F;  3TZX A;  2W2P P;  3MUM P;  3ILO A;  4A47 A;  3RBD A;  3HI9 A;  4B3O B;  4X65 F;  2AKW B;  1KC8 T;  2CJY B;  3KMQ A;  1WKL A;  3WQP A;  4QPX A;  1N5T A;  4PRF A;  5KFL A;  3VAK A;  2RD5 C;  2BM0 A;  3CIM A;  4ECQ A;  3UO0 A;  3ZZZ A;  1O5J A;  3NLC A;  2D9O A;  2XWY A;  3MPU B;  3FSX A;  3MM6 B;  1FCA A;  3OL7 A;  2R2R A;  2FHM A;  3R6L B;  4EWT A;  2H5J B;  2BZ2 A;  2H48 B;  3BH6 B;  2EVZ A;  3LAN A;  2R42 A;  4NEY A;  4X64 F;  1SKR A;  1FK9 B;  2Y0B B;  1R31 A;  3ADA C;  4O3S A;  5E3A A;  2EG1 A;  4FF3 A;  2EBG A;  4YR3 A;  2FLP A;  2PSZ A;  1PYS B;  2BAN A;  1RTD B;  1F3F A;  3BN4 A;  4PWU A;  1RHR B;  1NAQ A;  2NZC A;  3MEG A;  5LXY A;  3R2D J;  4TY8 B;  3N6L A;  5FJ4 A;  2YWW A;  4KRW A;  2IHR 1;  2VG7 B;  3TX0 A;  3NNA A;  1HQ2 A;  4HTI A;  2AYG A;  1TL7 B;  5HJY A;  4NMX A;  3BS9 A;  1RYS A;  3GYG A;  4WXW A;  3RBX A;  3EIC A;  4IR9 A;  1BUX A;  1ICE B;  3MR5 A;  3AB4 B;  1FFG B;  4DSI A;  2BXJ A;  3U1L A;  3CGI A;  3GV8 B;  8RUC A;  3NGU A;  3M30 B;  1HQE B;  1TUV A;  3CE8 A;  4QIV A;  2ALZ A;  5L39 A;  4USV A;  2N82 B;  4C3M A;  1U2R A;  5ETQ A;  4X4V A;  2RIL A;  5H9E K;  1YIJ S;  2DNP A;  3FCW A;  1U8S A;  3MEC A;  5I3Q A;  4R0E A;  3QSY B;  3GB0 A;  5IFM A;  1C0T A;  3POT B;  4KGV B;  3M2R A;  4KHP J;  3MAA A;  4RNO A;  3AD8 C;  5C5J A;  4P72 A;  2QLW A;  3C14 B;  4OJ1 A;  1XMQ F;  1HNX J;  4QCL A;  1T9W A;  2O01 C;  3RAM A;  1XNR J;  2FZG B;  1SJ4 P;  4U8V A;  1Y9O A;  5JMN A;  1JB0 C;  4RNN A;  4NWB A;  1ZS6 A;  4M1K A;  2DXF A;  2Y1R I;  2NYI A;  3BB5 A;  5F8M A;  4ERD A;  1MU2 A;  2FJD B;  4JI8 F;  1HQE A;  1YBU A;  3SIP B;  1X4E A;  1SKS A;  3PFO A;  4DOZ A;  2YVS A;  1S10 A;  2HIQ A;  4DR2 J;  4ANC A;  2F3J A;  2MZT A;  3K5P A;  1IKV A;  4DPO A;  1DHM A;  5C42 A;  2VDI A;  3AQP A;  3B54 A;  3ZC4 A;  4DV3 F;  3R5D A;  1NBE B;  3I96 A;  4YUD A;  1REG X;  5C2C A;  1VC6 A;  4LF6 F;  2ROE A;  4B3R F;  2YQ0 A;  4OIX A;  4YB7 A;  3BKF A;  1RE1 B;  4OMF G;  1HLW A;  1RWO B;  1RXO B;  2K06 A;  3C15 B;  3GG0 A;  5DZ7 A;  1WHV A;  4DR6 F;  4K4U A;  2BE7 D;  3HSD A;  1R27 B;  3CMQ A;  3DLJ A;  4DG1 B;  5GAD U;  4DV7 J;  1U24 A;  1VQS A;  2RS8 A;  2ADB A;  1SKU B;  2QA4 G;  2MY7 A;  2W7O A;  3HFZ B;  1T05 B;  1FJE B;  4EBE A;  1YJT A;  2JVO A;  1CVJ A;  3AAW B;  1FX2 A;  2LQJ A;  2QMX A;  2XHW A;  4IOC Q;  2ACM A;  1NK7 A;  1RKJ A;  1N34 J;  4EK2 A;  1IBL F;  3CME S;  2ZDP A;  4QYZ J;  2HQF A;  4HEA 9;  4USI A;  4H4K A;  4IFY A;  2ZH4 A;  4NLU A;  5HL7 Q;  1S6O A;  2VKR A;  3PHT A;  2E9T A;  4I67 A;  1RT6 A;  5EX0 A;  3MDF A;  3A8K A;  3ITH B;  2VZ9 A;  1SJ1 A;  2O66 A;  1X5O A;  2MQP A;  2YNI A;  2E5L F;  2JSX A;  1T94 A;  1VC5 A;  3L95 X;  4CIO A;  3K7R A;  1BD6 A;  5KFY A;  2JFD A;  1RT3 A;  3NS5 A;  2R8J A;  4U96 A;  1SC6 A;  2B43 A;  1NK4 A;  2J7K A;  4CLZ A;  4I6Y A;  4DQQ A;  2J6U A;  4C3K A;  3R1H A;  2DD8 S;  4NAS A;  1MMD A;  1PAU B;  4UW2 A;  1K47 A;  3MOJ B;  2BMB A;  1X0F A;  1RWV B;  4FZV A;  3BYP A;  3JAM Y;  1E6V A;  4LFC J;  4Q8F A;  4F04 B;  2RSQ A;  2FVR A;  1V3Z A;  1RTH B;  1C1C A;  5IXU A;  4ZOS A;  1WEZ A;  1RBO B;  1IKW B;  2FYX A;  3LGH A;  2BQ3 A;  4B9L A;  1R8C A;  4QIG A;  2EK6 A;  5GAD I;  1WF1 A;  2HFU A;  2HBR B;  3DRY A;  3CUN A;  4J9L A;  3W62 A;  3KXD A;  1H98 A;  1YRT A;  2DNQ A;  2HSE B;  5CYJ A;  2L9W A;  5L9X A;  4B3M F;  3D1H A;  2ZH7 A;  4PAB A;  3KLI B;  1RAO A;  1YZ7 A;  4DFK A;  4DL5 A;  5KG4 A;  2RRA A;  4X4Q A;  1QAI A;  2UXB F;  2KZZ A;  2Y8Y A;  1UTA A;  3H20 A;  2XY5 A;  2MGZ B;  1NK6 A;  3RRH A;  1H38 A;  1O8B A;  1HR0 J;  2D7S A;  2M9K A;  2CNN B;  3HZG A;  3TJA A;  2FC8 A;  2NUH A;  5GAG I;  5A8R B;  2D3Z A;  3ENQ A;  4F0M A;  4PPZ A;  2CJ9 A;  2K3I A;  1RHM B;  5E7O B;  3TA0 A;  1FNX H;  1X8D A;  1IWA A;  4OI0 A;  2QL7 B;  1JXL A;  1B7F A;  4M5N A;  2XB2 D;  4USW A;  1P9Y A;  3KJV A;  1SUQ A;  4RNH A;  4UOF A;  5J2N B;  2B8P A;  1FRM A;  2F5G A;  2HWT A;  2RHQ B;  2KYZ A;  1S1U A;  2WSF C;  3A13 A;  2VFR A;  3CJR A;  4KT0 C;  3CCJ S;  3C3L A;  3R27 A;  4ZDN A;  4F50 A;  4C3L A;  5MLC V;  3GR0 A;  3HD2 A;  3N28 A;  4OYZ A;  3KLF B;  4DFJ A;  1JXE A;  2XMM A;  3PG9 A;  4PXE A;  4RWX A;  1RWN B;  3JQK A;  1N6Q A;  1HA1 A;  1U1R A;  4U7C A;  2G4B A;  5B08 A;  5D6G A;  1KD1 T;  4DR6 J;  1R6V A;  4LRA A;  4H54 A;  1JLG A;  1RAE B;  2LLZ A;  2OPS B;  3LTO A;  4Y6I A;  4BWJ A;  1EP4 B;  4A8O A;  4CLY A;  4DN9 A;  3JB9 k;  1FO1 A;  4KB7 A;  3QJL A;  2EFQ A;  3AD9 C;  4CO1 A;  3JTN A;  5E0O A;  2DNY A;  2YNF A;  3OFE A;  4ZPD A;  3DU5 A;  4OX9 F;  1X5S A;  3BKU A;  3R6G B;  2UVV A;  5SUH A;  1V9O A;  2DPJ A;  1C1C B;  4X4R A;  5FLX Y;  3DLH A;  4F02 A;  1KLM B;  1TL7 A;  1UP1 A;  2EFN A;  2F65 A;  4CYU A;  4I4B A;  2VG6 B;  3DFE A;  3DM2 A;  5KFT A;  1B0V A;  3MAH A;  5AE3 A;  4B9U A;  1DAX A;  3D66 A;  2BM1 A;  4G6V B;  4KV8 B;  3T9Z A;  1U48 A;  2YH1 A;  2HVH A;  1ULR A;  3HVW A;  2B6A B;  2KVI A;  4Y00 A;  4ID8 A;  2YBV A;  1JJH A;  1S7H A;  2K7K A;  2QTW A;  1SJ3 P;  3H98 A;  3Q8U A;  2A2D A;  5ETL A;  3W61 A;  1IJF B;  2DGQ A;  4BC9 A;  1I6J A;  3DYA B;  4Q44 A;  4ER8 A;  1WI8 A;  4RU2 A;  4ZCK A;  2V4J B;  1BY9 A;  3M2R B;  2V6A A;  2HAI A;  1NO8 A;  1U02 A;  2V94 A;  2WVF A;  3BJY A;  4DCP B;  2E5I A;  3S01 A;  4XPC A;  2I5J A;  4BC7 A;  4P74 A;  3TUJ C;  3CCS S;  2A18 A;  4GO7 X;  4GRS A;  1Q8I A;  1T95 A;  2KHD A;  4WP8 A;  4KY3 A;  4F4A A;  4IO9 Q;  2B51 A;  1FNM A;  2DHA A;  3EJM A;  2DNG A;  1HPZ A;  4ZLJ A;  2YY3 A;  5D3G B;  4WTY A;  1VQ6 S;  1HKA A;  3GYX B;  3ITH A;  2W8K A;  1CJV A;  1YBA A;  3GYN A;  4LFB F;  2CJK A;  5I42 B;  4KFB A;  3D0I E;  4USK A;  2V8P A;  4L72 B;  3W1Y C;  5HLF B;  2YNH A;  5KFE A;  2OEK A;  4DX6 A;  4B3T J;  4OLO A;  5CYM B;  2N3O A;  4QR1 A;  3MM9 A;  1ROF A;  2VIH A;  2ZD1 B;  4AL5 A;  1RBL A;  3B6B A;  5KAK A;  1Q78 A;  2ZUA A;  2DR6 A;  3RR7 A;  1NZA A;  2HG4 A;  3H2U B;  2EI5 A;  5B0G A;  1E6V B;  1UCN A;  1A9N B;  1L3K A;  2HS0 A;  1A0O B;  2P9C A;  3D68 A;  2DY9 A;  3HF5 A;  2PD1 A;  2L48 A;  3KG4 A;  3ZXW A;  3WZ0 A;  2COL A;  3BGL A;  2W7P A;  3QFW A;  4DPW A;  2C3P A;  4C48 A;  4DS4 A;  5KFN A;  3AJD A;  2EPI A;  3LAM A;  3IG1 A;  2UXB J;  2ZH3 A;  1RAF B;  1LQ9 A;  4RW8 B;  3G96 A;  1C0U A;  4TVA B;  4EUV A;  4DV0 F;  4KFB B;  1OQ6 A;  1UEK A;  4DUZ J;  1Q95 G;  2D41 A;  2KI2 A;  2DH9 A;  2J0W A;  1U1M A;  5KTQ A;  1PYO B;  1QE1 A;  4F4Z A;  1DLO B;  3CJT A;  4WCE Q;  1I94 J;  3M1V A;  3VHQ A;  5HVG A;  2BKN A;  1UW9 A;  3UDE A;  2Z4P A;  4LF5 F;  2QL9 B;  3HHK A;  4K5R A;  3M2V B;  3UDC A;  5HMZ A;  2RKI A;  3CO9 A;  2HFV A;  4LSL B;  3VZH A;  4C8Y A;  3W65 A;  3V4I A;  2MPU A;  3I5C A;  1VI7 A;  3MMA A;  4FVM A;  1Q81 T;  1IBC B;  3OTD A;  2CG8 A;  2KN4 A;  1YJ9 S;  1Q8L A;  1I51 B;  1MMN A;  1TVR A;  3SI8 A;  2IAJ B;  4MK8 A;  3CO0 P;  4RW7 A;  5LJ3 Y;  2GML A;  1S9E A;  1L3S A;  4K4Y A;  1S1T B;  1TQL A;  1WUU A;  3W7B A;  4YB1 P;  4I64 A;  4WPA A;  4QYR A;  3K5L A;  3VAF A;  4DQR A;  1V3R A;  5HRO A;  3TI0 A;  2MKS A;  3H2L A;  4UST A;  3TOQ A;  2DVI A;  1LWF B;  1Q5V A;  3VV2 B;  3UVJ A;  3KLE A;  2BJ9 A;  2C22 A;  3N79 A;  5HMX A;  1GXT A;  3AA9 A;  3GP9 A;  4A8F A;  4HAC B;  2FJA B;  4URQ U;  3V6J A;  3CD6 S;  3NMA A;  2IPO B;  2J9C A;  2B4V A;  3TYT A;  1RTZ A;  3W2W A;  4JI5 F;  4UOH A;  4ES1 A;  2DNM A;  2WSC C;  2VQE F;  2OAU A;  4FPI A;  1UZH A;  1MN9 A;  2BW2 A;  1EET A;  4KGM A;  5IQQ A;  3O2I A;  3B82 A;  2JX2 A;  5A8R A;  1QSS A;  2IA6 A;  1IKX A;  4OI2 A;  2LU1 A;  4ZJQ A;  3OL6 A;  2RJZ A;  4G1P A;  1FHT A;  1D0E A;  5MAO A;  3CXC R;  2UP1 A;  3VQS A;  3OUY B;  4RKU C;  4NZ7 A;  4ZVP B;  1FRH A;  4J9Q A;  2OSR A;  2DGX A;  5HBM A;  4X62 F;  3V6K A;  3CNQ P;  1HNV B;  1REV A;  1S0M A;  2JEG A;  1Q7L B;  4LRD A;  1EJ7 L;  2M5Y A;  2QLF B;  2QLB B;  3NBP B;  5E2Q A;  3SCI E;  3DLK B;  3E51 A;  2HGM A;  3GMG A;  3W64 A;  4C0O C;  5M2P A;  1K73 T;  4OX8 A;  3OR2 B;  2XZT B;  2EKY A;  4QW9 A;  2V4R A;  2G2Y A;  3BYR A;  3F44 A;  3KJQ B;  4TU9 A;  2DIU A;  4AT1 B;  2MKC A;  3GJS B;  2VBZ A;  3M2V A;  3BV8 A;  3D2W A;  1NKB A;  1YZ6 A;  4OLP A;  3BO2 A;  4FP9 A;  4DSJ A;  4DV1 F;  2MJU A;  1CJU B;  1TAQ A;  2GIQ A;  1CSJ A;  3I6P A;  3R7B B;  5KOW A;  3CPW R;  4DL3 A;  3PX6 A;  3SSS A;  1EQ0 A;  4TXS A;  3M7V A;  1N4L A;  3EVW A;  4KGX B;  2AHO B;  3QT6 A;  4DV4 J;  1VHI A;  1KLM A;  1PIL A;  5E33 A;  3FBC A;  3JTP A;  4OI3 A;  3PFE A;  3EVM A;  2HHU A;  4Q0B A;  2WTF A;  2E7V A;  1I1G A;  5K20 B;  4O3O A;  5A0Y B;  1BGX T;  3NXZ A;  3EGW B;  3PRB A;  2FJW A;  4DSL A;  3UCZ P;  3V2U C;  3I9V 9;  4J9S A;  4FN5 A;  4USH A;  2D3O R;  1WKJ A;  2GO9 A;  1V6H A;  2AEF A;  2PFD A;  1FJC A;  1BQX A;  4Y0F A;  3S7R A;  1QLN A;  4P6Q A;  2HK2 A;  4WBF A;  3X1L B;  1ACM B;  4DV2 J;  4R8U B;  5I3P A;  2VAS A;  2D3U A;  3HT0 A;  1EB0 A;  4GO5 X;  4LR8 A;  2YQ1 A;  3NL0 A;  3GV5 B;  3EZO A;  1YG0 A;  3EDQ B;  1F60 B;  3QGI A;  3GTY X;  4RUC A;  2R4F A;  2VOO A;  2V4J A;  2C28 A;  4CCH A;  4QU7 A;  4O4R A;  5LSR A;  1IKX B;  2UVW A;  4CLF A;  2PI5 A;  4OZ0 A;  5D0R A;  1K0V A;  2QLX A;  3V6D B;  4Q45 A;  2QT7 A;  1T9V A;  3OUY A;  1NXI A;  4LRF A;  2Y1I A;  4M94 A;  3FCV A;  1YJ7 A;  2HBQ B;  3DOL B;  3OJS A;  5DDP C;  2HFS A;  3QLH B;  3MPD A;  4ZN1 A;  3CD7 A;  4Y34 A;  5AJ3 F;  3QRP A;  2NXC A;  2CDQ A;  2HEK A;  3ELH A;  4IOB A;  5KFW A;  1SIW B;  3C6U B;  3VZI A;  1N32 J;  1TAU A;  1QAY A;  1TUW A;  3EWG A;  3I5B A;  3U1M A;  2XEX A;  4IH5 A;  3H25 A;  2EFO A;  4M5M A;  1RAI B;  1S1T A;  3BSO A;  4AL6 A;  4HI2 A;  4NYO A;  3SQG A;  2ATC B;  2W9C B;  2GIR A;  5ETO A;  4C2M A;  4DL7 A;  3AD7 C;  4QIF A;  3SV4 A;  4ZP7 A;  5HK4 A;  2JEF A;  3P49 B;  4NLP A;  2IAJ A;  1FF2 A;  3P4U B;  4FNI A;  1YJN S;  3TNV A;  3G8Q A;  1WHY A;  1FKP B;  3KFW X;  3QPI A;  2K2P A;  4AYB D;  2MQO A;  1N56 A;  4QWC A;  4PUO A;  2WK4 A;  3C16 B;  4O23 A;  3T5H A;  2FLL A;  2E9R X;  4WTO B;  2QFI A;  3CB4 A;  2CPE A;  3R8Y A;  2W1B A;  2JC1 A;  3M6V A;  1N0V C;  3L3C A;  2C2R A;  1NPK A;  2AZ3 A;  1ZBT A;  1G7C B;  2MYF A;  3HSZ A;  4KHM A;  1QSY A;  4B9V A;  4LF9 J;  2N4C A;  1FRX A;  1VIX A;  2VV5 A;  3W9J A;  2N7C A;  3P5T L;  3NGD A;  3MUV P;  4K4S A;  4PKD B;  2DIS A;  5ITH A;  3SQG B;  4ECS A;  1F2H A;  1JLA A;  3KUH A;  4D3H A;  5DQI A;  4MKY A;  1U0H A;  1CEZ A;  5EWG A;  1YIT S;  4IRD A;  3KUE A;  1RKI A;  1DTQ B;  4DSE A;  4B9S A;  1HW9 A;  1X60 A;  3MMJ A;  2A1B A;  4DR5 J;  1B0P A;  2FVQ A;  3L9Z A;  2IM3 A;  3CJ0 A;  3RTV A;  2AJ0 A;  3GG1 A;  3NBP A;  1JJC B;  3D6F B;  4CO4 A;  4JI2 F;  2NSB A;  3KLG A;  3T19 A;  2HLT A;  4V19 X;  5HVF A;  3JXO A;  3K5O A;  5FDL B;  4M95 A;  4NLQ A;  1S97 A;  2F8M A;  1ZA2 B;  2LDY A;  2NXJ A;  4PQA A;  2H1Y A;  5A8W A;  3AJ2 A;  4FBT A;  4DR1 J;  2CQI A;  2WSE C;  4X4U A;  2IM2 A;  3D1O A;  4NA3 A;  4YR2 A;  4LR9 A;  1ZTT A;  1N5Y B;  4DQI A;  1ZM4 A;  4P2M A;  4UQT A;  3A8E A;  3LP1 A;  2E5G A;  1VIO A;  3T6B A;  5ETP A;  1NKC A;  2B9Y A;  2DB1 A;  3GCW P;  2Z8Q A;  2LMI A;  5BYS A;  4ZVH A;  1C1B A;  4G3I A;  1ZAW A;  3CMA S;  4DV5 F;  4IRK A;  3NNH A;  1AZS B;  3MED A;  1RZM A;  3I31 A;  1KP6 A;  1LV5 A;  2E9Z A;  4KH1 B;  3G2X A;  4CWB A;  2G1D A;  3MZI A;  2HFZ A;  3A1Y G;  3UNY A;  2IRX A;  2KB2 A;  5A6P A;  2F8E X;  3BR9 A;  3QIP B;  4PWD B;  5F8N A;  1RWP B;  3BEG B;  3MD3 A;  2V69 A;  1R0B G;  4O44 B;  2AEM A;  1RB0 A;  2M52 A;  3HD1 A;  4OI1 A;  4O0I A;  2JOQ A;  1YWX A;  1TL3 B;  2XMU A;  3WBZ A;  4LSZ B;  3MFH A;  1D09 B;  1TR0 A;  1BWV A;  4A8K A;  3RRG A;  2HNY A;  1N32 F;  5FLX U;  3G82 B;  1YJV A;  2QFJ A;  2DGS A;  3GII A;  1BQM A;  1Q79 A;  2IBO A;  4RW4 A;  1ZM3 A;  1T8E A;  2HZV A;  1REV B;  3ONQ A;  1YGY A;  3TVY A;  2HYI B;  1BQN A;  2HND A;  4RW6 B;  2HVE A;  5J2Q A;  1HFE L;  3DM2 B;  3M6U A;  1AXQ A;  3KTQ A;  3HMJ G;  2D74 B;  1Z2L A;  4B02 A;  3GIK A;  1G2E A;  3EYZ A;  1QD1 A;  4DR3 F;  3OBI A;  1RT5 B;  1U6B A;  1GMW D;  1N8R T;  3DNC A;  3OLB A;  4PG7 A;  4RBT A;  5IS2 A;  1FDN A;  2CQ3 A;  4N7T A;  1OWX A;  3UE2 A;  3PNI A;  3E2E A;  4KIA A;  3CCQ S;  4TY9 A;  3CD5 A;  4HDG A;  2BQU A;  2ZJP Q;  1TKX A;  4HR2 A;  4G65 A;  2UUW A;  2XYH B;  2JC0 A;  4Z7Y A;  2UUB J;  3PR4 A;  4NLD A;  2BR0 A;  3RAX A;  1IQT A;  2N3L A;  3RBZ A;  3TEH B;  4Q0B B;  1ZOT A;  2MST A;  3IBC B;  1UW4 A;  4ILL A;  4P52 A;  2XS5 A;  4RW6 A;  4Q43 A;  1TK0 A;  2H4W B;  2ILZ A;  1MU2 B;  3IMQ J;  2J9D A;  4B17 A;  3KNG A;  3SMZ A;  4P7T A;  2C2K B;  4XPE A;  4JI7 F;  5GMD A;  1Y3K A;  2CPX A;  2GGP B;  4HTJ A;  3M32 A;  1UA1 A;  1FTC A;  4FXD A;  2FJE B;  1SXL A;  3IBW A;  3Q8V A;  4I0W A;  2A6O A;  3KKF A;  4TU8 A;  2U1A A;  2V2Z A;  4ZMM A;  5BR8 F;  5ETK A;  4QBU A;  1ZPW X;  4MYU A;  3ZZR A;  3QIP A;  4PWD A;  3CJ5 A;  1FD8 A;  1OY6 A;  3DXB A;  4V1A k;  4OYA A;  2Z2M A;  4IQM A;  2OP5 A;  3CT9 A;  1VQ7 S;  1KSP A;  2FTR A;  1FDD A;  4RW9 A;  4MMO A;  2CJX B;  1WC1 A;  4E98 A;  4B3O A;  4J9U E;  4NOH A;  1LWE A;  2AF6 A;  1FI4 A;  3RZA A;  5KFO A;  3H5Y A;  3BN7 A;  5LMU J;  3B78 A;  1MWY A;  2BV3 A;  2NS1 B;  1PJ5 A;  1RWM B;  4JI5 J;  3TVK A;  2FHJ D;  4QPT A;  4RUH A;  2HWH A;  3OV7 A;  4IFY B;  4V19 J;  1MWZ A;  1NU4 A;  4M5I A;  3PAC A;  3K17 A;  1U8W A;  5KG3 A;  1WF0 A;  3HKZ D;  1R0C B;  2UUC F;  3IO1 A;  5DS7 A;  4IR1 A;  1S77 D;  5HVH A;  1KN6 A;  1JKH B;  5ETV A;  1VYA A;  5KFD A;  5JVG Q;  5DJB A;  1RAA B;  2HS4 A;  2DGV A;  5LT5 A;  1TV6 A;  5DG8 A;  1S9G A;  4EYH B;  1NK8 A;  4X4T A;  3G71 S;  4C8L A;  1N5V A;  2MKY A;  2GAH C;  1WHW A;  5DDQ C;  2XQC A;  3IS9 A;  4ZVO B;  1VCT A;  1IJE B;  2YX4 A;  3NGK A;  2DHH A;  2GC8 A;  2JLF A;  2RU9 A;  4Q2M A;  5FII A;  2JL9 A;  3DRS B;  2GVD A;  1J5O A;  1K0T A;  1BLU A;  4NLS A;  3A3O B;  4C8K A;  3BGO P;  4ES2 A;  3FEX B;  4OZN A;  5HP1 A;  4ZS6 A;  4B9T A;  1IR2 A;  1RTH A;  2BAC A;  2LQ5 A;  3OJU A;  1SL2 A;  3MUR P;  1T9Y A;  2K3K A;  2OKQ A;  2H5I B;  2ZC4 A;  1N36 J;  2F8H A;  4NXM F;  1M5K C;  2XSJ B;  1HD1 A;  4ED0 A;  4K50 A;  3I9Z A;  5HAO A;  5KFA A;  4R5P B;  4LF7 F;  2DR9 A;  5A2Q U;  2XCA A;  5K14 B;  1H72 C;  3J81 j;  3B4M A;  2W2N P;  3M6X A;  4DR3 J;  2ZOG A;  1TV6 B;  2I1R A;  2F4V J;  2J0X A;  1NH7 A;  2MQ8 A;  2CYY A;  3J80 U;  1H74 A;  3LPY A;  2CJQ A;  1VBX A;  1FWK A;  5E3P A;  1HAR A;  2KJW A;  2ZWP A;  3VAG A;  1M5P C;  2HQD A;  3C46 A;  1H7W A;  2AJQ A;  3MR3 A;  3SCL E;  2GV1 A;  1S48 A;  1ZPV A;  4P7V A;  2HNZ B;  5G0R A;  3T5K A;  3CED A;  2JNJ A;  3M8Y A;  3M05 A;  4ZJL A;  1VLY A;  4FKY A;  4EZ9 A;  4RW4 B;  1LWE B;  4ECX A;  2PE8 A;  2BYC A;  2WCX A;  1KOH A;  1CQN A;  4BHQ A;  1FJG J;  3ETM A;  3O44 A;  1NEE A;  5LSL A;  1NDK A;  1FVS A;  5GMK a;  3TAR A;  1W26 A;  3D1Q A;  4I7F B;  1X4D A;  1NRK A;  3IN5 A;  2CQD A;  4AQY J;  5DO2 A;  2CIM A;  3HVT A;  3VAI A;  4K59 A;  1TMJ A;  2NZ4 A;  1FE0 A;  3KG1 A;  1HWU A;  1LW2 A;  1JKH A;  1TMM A;  2XMT A;  5C42 B;  2ZM6 F;  2J8S A;  2CG4 A;  4CT8 A;  2LXI A;  1I5O B;  1NDL A;  3BRE A;  2RVJ A;  2HHQ A;  3J81 U;  2OTJ S;  4KAI A;  4KGZ B;  3NNC A;  4DDF A;  3CC7 S;  2FHK A;  1JIH A;  3CSK A;  2DEJ A;  2DH7 A;  2E1M C;  2YQ3 A;  5CZX A;  3HCX A;  5AJ3 J;  1Y4Z B;  3HZE A;  5K9F A;  4ED2 A;  4WZQ A;  4NYP A;  4B3R J;  3K0J A;  2KZM A;  2PFF B;  1S49 A;  3E3X A;  4ZPW R;  5KG0 A;  2IM0 A;  4DV6 J;  1RA6 A;  2XMJ A;  2EW9 A;  3I0S A;  3OSN A;  5BR8 J;  1MN7 A;  4CDI A;  1ZET A;  1U0S A;  1XNR F;  2MLY A;  5B0F A;  4JUZ A;  1RTI B;  1OPI A;  4I2Q A;  3DC2 A;  3JQJ A;  5DZ6 A;  5GAE I;  3EMT A;  4IG3 A;  4CTA A;  3THV A;  1C2P A;  2ZNY A;  4ZPA A;  1KEK A;  3T3F A;  2DGU A;  2PMW A;  3RB3 A;  1S1X B;  1TK8 A;  3SV3 A;  3S8S A;  1KNZ A;  4KBI A;  3AOA A;  4IUF A;  1KWM A;  3NCQ A;  2YPZ A;  5HMY A;  2J0Q D;  2M2B A;  5L1J A;  2Q1L A;  1P8G A;  2RUG A;  3BBB A;  5KFJ A;  5I4M A;  1DFD A;  2AX0 A;  1IR0 A;  2XM3 A;  2GQC A;  1UPP A;  3T41 A;  2OUG A;  5KFP A;  1CJT B;  1N36 F;  4NXM J;  1NME B;  4GVL A;  3OSP A;  1HBU B;  3QAT A;  3AH6 A;  4USJ C;  3KK2 A;  3TRG A;  2LQ9 A;  2V68 A;  3R5G A;  1RI7 A;  2CQ0 A;  4CO2 A;  5EWE A;  4FKX A;  4KPY A;  5D78 A;  3UQS A;  1SI9 A;  5M2U A;  1UVJ A;  1H3D A;  2KO1 A;  3M30 A;  3I87 A;  1ZA1 B;  3LAL A;  2SXL A;  2DHX A;  2EC2 A;  2OJ3 A;  1RT7 B;  3PDN A;  3CTR A;  4FYV B;  2LU2 A;  3CJK B;  2ZHA A;  1GMV A;  4GKK J;  2HLU A;  2I0X A;  3HDS A;  2DRB A;  2HMI B;  1HNW F;  2JEI A;  3OFF A;  2FVC A;  2ZBI A;  3L7O A;  4OX7 A;  1JLG B;  2BJ8 A;  4ZCI A;  6FD1 A;  3JSM A;  2VDH A;  1VBY A;  3W5Y A;  2IDL A;  3W3S A;  1J5O B;  2GNK A;  2G13 A;  3PZP A;  2UUA F;  4DFM A;  2PO4 A;  1RT2 B;  1W2I A;  1M5H A;  2KHC A;  4X64 J;  1DBD A;  4QR0 A;  2XMA A;  4URS A;  4N5S A;  1RU1 A;  5CXT A;  1UJ4 A;  2HRU A;  4W98 A;  4WFY A;  1RAC B;  3GCX P;  2YKM B;  1SUQ B;  1SH0 A;  3E01 A;  1AFJ A;  2EEY A;  4OJ3 A;  3MEG B;  4LFB J;  3GJQ B;  2K8G A;  2VFT A;  4GVB B;  4ED1 A;  3JS9 A;  1IWG A;  2NLW A;  2XYG B;  3D9B A;  1FES A;  3NCP A;  1TTH B;  1HWI A;  4O0N A;  3VWS A;  1U26 A;  5B0C A;  5HQ8 A;  2H4Y B;  1HI8 A;  3PV8 A;  2AD9 A;  4ECZ A;  3DOM A;  4IH7 A;  2B4U A;  4NZ6 A;  3THT A;  4DU7 A;  3PKM A;  3J7A 1;  1HHS A;  4DPX A;  3BBF A;  1QTM A;  1S1X A;  2ZOM A;  4OZL A;  4UY8 T;  3NMR A;  1HYS A;  3TJ9 A;  3H42 A;  3PVX A;  1IM4 A;  5J1P A;  1OSC A;  1RT2 A;  3Q8R B;  2AGP A;  2M88 A;  5G0R B;  3MMA B;  4LFA J;  4OYM A;  2UV8 A;  3DLL Q;  2PI4 A;  4MAK A;  3R7N B;  2BJ3 A;  1GQE A;  1GMU A;  4ZPT R;  4WU2 A;  4J7C A;  3TEG A;  3UI3 A;  1DZ5 A;  3BF4 A;  1QVF R;  2B3T B;  1CS4 B;  4F3M A;  3KK2 B;  1Y3J A;  3EX7 B;  1VRU A;  3GLJ A;  1KS2 A;  4K4Z A;  4IFV A;  1SQF A;  2PMH A;  4KC5 A;  5ETS A;  4DPU A;  3QAU A;  4R5P A;  3RR8 A;  2BAN B;  2V2V A;  4LF7 J;  3VQT A;  2ZBR A;  1RT7 A;  5AT1 B;  5DQG A;  3OFG A;  1LWC A;  2PMZ D;  5ETM A;  2OPP B;  4JI6 F;  1QDU B;  3CJ8 A;  2P5V A;  2VOP A;  1NUE A;  3LP1 B;  4ZKA A;  4LF5 J;  2OO4 A;  1N5S A;  1F0X A;  1GTE A;  3AQO A;  1D9D A;  2HK3 A;  2YX1 A;  4CLL A;  1UVN A;  4DS5 A;  3SYZ A;  1JJ4 A;  1E6Y A;  3LUY A;  2EWH A;  2VFS A;  1B0T A;  1HNZ F;  1IKV B;  2ZBC A;  4ZN3 A;  2CNL B;  2V2Q A;  4TY8 A;  2VIC A;  4DZ6 A;  1NB7 A;  1VRU B;  1FD2 A;  1U1K A;  1K8A T;  2QEX S;  3PJW A;  1Q82 T;  2CNO B;  2HQG A;  1NSK L;  5EUH A;  2HHT A;  1G4C A;  5L38 A;  4F3O A;  1OS5 A;  1JLF B;  1M1K T;  3HT3 A;  3UN2 A;  4FS1 A;  1CUL A;  1PG5 B;  2AMC B;  3IR6 B;  4I2Q B;  4LBH A;  5D4L A;  3OXG A;  1RLD A;  1RHJ B;  5AXM A;  6AT1 B;  2A2C A;  4RUA A;  1DQ8 A;  2MZJ A;  3DLG A;  1NJX A;  1LXN A;  3VAH A;  3UW1 A;  3OVB A;  1PO6 A;  7AT1 B;  5LJ5 Y;  4EEY A;  2X7I A;  1WOS A;  2L9D A;  4LSL A;  1NJZ A;  4DL6 A;  3IFE A;  2D9P A;  1SC1 B;  3UCU P;  1B3T A;  2DHG A;  3PCO B;  2HHH F;  2J76 E;  3TJ8 A;  4TLR A;  3RB0 A;  2DPI A;  1JLE B;  1PCA A;  4LQ3 A;  2XHC A;  2V2K A;  1EAR A;  4YQW A;  1VQP S;  4ZHR B;  4JP8 A;  2F63 A;  2C3U A;  1ZAX A;  2J5A A;  2AP6 A;  5ETT A;  4B3S J;  2CQB A;  2KH9 A;  1VMB A;  1R8A A;  2HQ3 A;  3A12 A;  4HH0 A;  2QRR A;  4ED3 A;  3OTE A;  4YHH F;  1S0N A;  1S76 D;  3VR1 A;  2EG2 A;  2XG8 A;  4JI4 J;  2CNK B;  4DMZ A;  4WK3 A;  3I32 A;  3DDI A;  4IH6 A;  2XNR A;  2Q3P A;  2DNL A;  2MXY A;  2DXE A;  2XLJ A;  3JSM B;  2VG5 A;  1H7X A;  3D0G E;  4Q7A A;  4YB6 A;  3LGM A;  2R7Q A;  3HPO A;  2RQC A;  1YTY A;  3QQC D;  2EFV A;  2EKN A;  3B8H A;  4U67 Q;  2CZ9 A;  2MQL A;  1TKD A;  4JYA J;  3LWL A;  2F4V F;  2GHV C;  3DDK A;  2RB7 A;  1RDR A;  2FC9 A;  3D3B J;  3QRR A;  1RQ0 A;  3KJF B;  4LF9 F;  3N5F A;  3KLV A;  4IO1 A;  5AE1 A;  2AZ1 A;  2QGF B;  3GJR B;  4DX8 H;  5A2Q Y;  2ZJR Q;  1D9F A;  1HBU A;  1T9X A;  4EGL A;  4CZC A;  2OIH A;  1J5E J;  4YOE A;  4A8X A;  2A10 A;  1T11 A;  4RPF A;  1KVK A;  1UVL A;  4RW9 B;  3O6Q A;  3ZNJ 1;  3MPY A;  1DUR A;  2V9K A;  5HRO B;  4WZM A;  1FKO A;  1T03 A;  2QA2 A;  3N6N A;  1HWK A;  5DRK A;  3UVJ B;  4OYX A;  2CQG A;  2OLW A;  1CS4 A;  4OYB A;  2CVI A;  1HQU B;  1LEO A;  3T1A A;  3G8T A;  1DJ0 A;  1SQE A;  5HAN A;  1HW8 A;  3ZZU A;  3B4D A;  5KG1 A;  3SDE B;  4IFV B;  2CKW A;  3PRV A;  3FRY A;  1SCJ B;  1IXK A;  4NLX A;  4F4X A;  2YWK A;  4I56 A;  1UKU A;  4OJG A;  1X5T A;  5HSP A;  2XLI A;  3K59 A;  1N33 F;  3EGV A;  3IGN A;  2R7U A;  3PW4 A;  3Q8S B;  3TO8 A;  4X65 J;  1C4A A;  1PBU A;  3MEE A;  1UET A;  3MR7 A;  4OV1 A;  5B09 A;  4EMD A;  3HHE A;  5L9N A;  3G6E S;  2AJF E;  1U45 A;  1Y5N B;  1OIA A;  2XWX A;  3K8W A;  3QT5 A;  3M8S A;  1LFW A;  1RT4 A;  3K5M A;  1HWJ A;  1DQ9 A;  2VH7 A;  2YKQ A;  5J2P B;  1LW0 B;  4QIW D;  3TP2 A;  4ZLN A;  4F8R A;  1X4H A;  4LSN A;  5KFU A;  5LXR A;  3FEZ A;  4U95 A;  3AOB A;  3JSR A;  5U47 A;  1HNV A;  2W01 A;  3Q8P B;  2CZV C;  3IM8 A;  2I38 A;  3J81 Y;  1FEH A;  1Z4U A;  2WVC A;  5DET A;  3T1H F;  1VQ9 S;  1QSL A;  4J9K A;  4JYA F;  2UV8 G;  1A6L A;  3SEO A;  2RDD A;  4LIR A;  2P6T A;  4U6P A;  4ED7 A;  1KVI A;  3H0P A;  2VBX A;  4PZV A;  2B6A A;  5F41 A;  1Q7Y T;  2LXU A;  3RGI A;  2ASJ A;  4NLG A;  2C2D A;  1PKU A;  3A3P B;  4IG0 B;  4TN2 A;  4DL4 A;  4H4M B;  4JV5 F;  3KLG B;  4NE9 C;  2KM8 C;  1F1B B;  4E2F B;  3P45 B;  4EYI B;  2QYG A;  3AHP A;  3MHY A;  2IIH A;  1T3N A;  4GKJ F;  4KGK A;  4OQJ A;  4PWW A;  1U1P A;  2VG7 A;  4O3Q A;  2WAQ D;  2J9D E;  4OYW A;  3M8Q A;  2WVE A;  2I2Y A;  2HQC A;  3MF5 A;  1LWC B;  1RAD B;  1Y10 A;  2GW8 A;  1HNI B;  3BO4 A;  2FY1 A;  2IC3 B;  5LOQ A;  2IFX A;  1XWL A;  1FE4 A;  3MM7 B;  2W24 A;  4A46 A;  1Y5L B;  5D3G A;  2MKI A;  2XGP A;  2VPW B;  3G6V A;  1KHV A;  3F73 A;  1UFK A;  3CF5 Q;  4RU9 A;  3ZZY A;  3HVT B;  2XYP B;  4OZ1 A;  5CHC B;  5I3U A;  5RUB A;  4H4M A;  3G4S S;  1TVR B;  5D15 A;  1MG7 A;  2FJV A;  4UOC A;  4OHX A;  5KFF A;  2LFV A;  2RF2 A;  1YDL A;  1AYE A;  4KR0 B;  4PXD A;  1GT8 A;  4K5S A;  4MH8 A;  3FRZ A;  2VON A;  2WVD A;  1IBL J;  2NQP A;  5GAH U;  3M8Q B;  3K5N A;  3S1T A;  2NPF A;  4DV7 F;  2G0I A;  2X1F A;  1UWB A;  2G0C A;  4M8L A;  1J2V A;  1VQY A;  5IC4 B;  4X4S A;  1QY7 A;  4ECV A;  4DUY F;  5KFB A;  3DLG B;  2HBZ B;  4WWS A;  4ED4 A;  2MKH A;  3C6U A;  1R8P A;  2VQE J;  3CCE S;  4WFZ A;  4NRT A;  4P2X A;  2JJ4 D;  4ECR A;  4DR4 F;  1V3S A;  1R0A A;  4I69 A;  1W7W A;  1M5S A;  2BEF A;  2MMY A;  2F40 A;  3W2V B;  3LP0 B;  4J9N A;  3MCM A;  3DLB A;  1CJK A;  1FXD A;  4HL9 A;  1J5E F;  2R7W A;  4LBP A;  2FY8 A;  3P96 A;  1XIQ A;  3KHG A;  4EI2 A;  4M5D A;  3I4P A;  4P9S A;  4NA1 A;  2XBP A;  3TQE A;  2BA9 A;  3DU6 A;  2KM8 B;  4GKJ J;  2NRE A;  1HI0 P;  2RKI B;  4YS2 A;  3BGR B;  2Z56 B;  3SDE A;  2F9J A;  2LQ8 A;  3GZ7 A;  4A8Q A;  1ZM2 A;  1L3V A;  4EO8 A;  2VJU A;  1U1Q A;  4NI2 B;  3TVZ A;  2LVW A;  2GMH A;  4IDK B;  3KMS A;  2NCK L;  2DRA A;  1APS A;  4NL5 A;  2VPZ B;  4JOU A;  3J7Z 5;  5IT0 A;  1HNI A;  2OFG X;  1XJW B;  4FXV A;  2GS8 A;  2C42 A;  3QSI A;  3T1Y J;  4HT7 A;  3KLH A;  3Q2S C;  3MTJ A;  2DNO A;  4WU3 A;  3N9U C;  3RUB L;  1TZ0 A;  4XDD A;  1XC9 A;  3VCD A;  2CRL A;  1RT1 B;  4LF8 J;  5HO4 A;  3PM9 A;  1SVD A;  1VQL S;  3PX4 A;  4O44 A;  1WSR A;  2RF2 B;  2YKN A;  3ZTQ A;  2W9B B;  3CCZ A;  1UA0 A;  1FDA A;  3DXS X;  3Q86 A;  2XI2 A;  1SBR A;  4K2J A;  4LVO P;  3R7S B;  4CO3 A;  4CT9 A;  4UTG A;  5IQ6 A;  4QWA A;  4NI2 A;  2FHJ A;  1S57 A;  3OPK A;  3K58 A;  1UFL A;  1K1S A;  5EDW A;  3U02 A;  4JB8 B;  3WIV A;  4JI3 J;  1CG2 A;  2CPF A;  1WEX A;  2QYC A;  5KT2 A;  1BQN B;  2Z57 B;  5DM7 Q;  1S12 A;  1P9Q C;  2IVM A;  1U2C A;  3C6T A;  2P9E A;  1H2T Z;  1ZZN A;  2YNG A;  4K8R A;  3D5M A;  3DLE A;  4R25 A;  2DNR A;  1TKZ B;  4S0M A;  3W2V A;  2MB0 B;  2KT3 A;  3LP0 A;  1L3U A;  3UPF A;  1Y5I B;  4Y2I A;  2R2T A;  2RHS B;  3DRR B;  3OTO J;  3KOA A;  1R89 A;  2CPZ A;  2RE1 A;  2W9B A;  1HR0 F;  4XO0 A;  1TU0 B;  3EVO A;  4Z7C A;  5LMN J;  3RG6 A;  2I9S A;  4OV6 A;  2R8I A;  3UD3 P;  4KPC A;  2Z2Y B;  1GAO A;  3SFU A;  3LW5 C;  4ENO A;  1ZM9 A;  1TL3 A;  3LOU A;  4DF8 A;  3TWZ A;  3FVY A;  1YKW A;  2IVY A;  1LWF A;  2W2M P;  4PAA A;  4LF4 F;  3DDN A;  3BO3 A;  1N52 B;  4WJB A;  1JLC B;  5HMW A;  2BE9 B;  2OPR A;  4A8M P;  2GGP A;  5DDO C;  2IVF B;  3KHH A;  5DDR C;  1JJ2 R;  4WF9 Q;  3PIO Q;  2RQ4 A;  5KFG A;  2DO4 A;  1KR4 A;  5H9F J;  5I3U B;  2B7B B;  2M8D B;  5CAB A;  1Q8K A;  2OEM A;  5B0E A;  4TKT A;  1RAG B;  2Y9H A;  1B4S A;  1UWA A;  2KRB A;  2Q6B A;  2IM1 A;  4XIU A;  2ZH9 A;  4ZVR B;  2GJF A;  1U1L A;  5IM0 A;  4YHH J;  2R7R A;  2HHS A;  3F0N A;  3I5A A;  3W60 A;  3PJX A;  1UMJ A;  3DI6 B;  3HP6 A;  2QX0 A;  4OHW A;  1T7P A;  1U2F A;  3CDA A;  4HI1 A;  2ERR A;  1O6X A;  2WOM B;  3WDO A;  5GME A;  1S1W A;  5HQM A;  1CC8 A;  3MUT P;  5CD4 H;  4DWI A;  1FX4 A;  2R9L A;  2ZJQ Q;  4Z2X A;  1RYR A;  2XC9 A;  2V9W A;  3GFZ A;  1FWL A;  3R9L A;  4WYW A;  3PO4 A;  3Q2T C;  1QUV A;  2RNE A;  4KSE B;  1IBK J;  4X62 J;  3N6M A;  4OHV A;  4H4K C;  3FZ2 A;  3TW0 A;  2XS2 A;  3CJ3 A;  5F0W A;  4F2R A;  2Q79 A;  1DTQ A;  3IA0 A;  2HGL A;  1TKZ A;  5T7L A;  4CH7 A;  3QNW B;  3EDR B;  2JRS A;  3IWX A;  1GNK A;  3Q8Y A;  2EBE A;  4FPR A;  4KO0 A;  3TZW A;  4FF2 A;  2EFG A;  4DPT A;  2P6S A;  4RLE A;  2IY5 B;  2NXE A;  3R3T A;  1PGZ A;  1TL5 A;  2HFO A;  4LF6 J;  1KFD A;  3HK2 A;  2VBY A;  1AFI A;  1U09 A;  2E44 A;  3KLH B;  3NEK A;  1JX4 A;  1LK5 A;  4CLS A;  1YSJ A;  2R3V A;  2MQQ A;  1BE4 A;  2BVZ A;  3IRX A;  4LRE A;  1HBN B;  1N5Y A;  2KXH A;  4IDK A;  3BR8 A;  4WFN Q;  3TZY A;  3NOG A;  4I68 A;  2J8A A;  1FT8 A;  2AJ1 A;  4B08 A;  4DV5 J;  3KDO A;  3IBF B;  2YKN B;  3G86 A;  1URR A;  3L7P A;  2OD4 A;  1AZS A;  2V34 A;  3CDU A;  3OXF A;  3UR0 A;  1FEE A;  2C2E A;  4GKK F;  5C7P A;  1HL6 A;  4HHJ A;  2MY8 A;  5CYQ A;  2JLE A;  4FYX B;  1HNZ J;  2Z2Z A;  4MKV A;  4M5G A;  4K2X A;  3HHL D;  1ZTW A;  1S4F A;  2FJX A;  2IMW P;  5G4D A;  3PJ9 A;  4Q5V A;  1RTD A;  1WC4 A;  4JI7 J;  2HWI A;  5GVQ A;  4DV2 F;  2HVI A;  1X4A A;  2ALY B;  2J9E A;  3ZFV A;  2LEC A;  1NPR A;  3UFC X;  3ULH A;  3VVT A;  3IS9 B;  4USU A;  1RSC A;  4LUB A;  1FFS B;  2XCP A;  1MSW D;  3ZZP A;  3WHI A;  4Q2L A;  4CLW A;  8AT1 B;  4J5O A;  1TL1 B;  1G1X A;  2HW3 A;  4ZP8 A;  2RQM A;  3V5R A;  4IOA Q;  1SV5 A;  2CQH A;  2J7U A;  2X51 A;  5D0E A;  2AT1 B;  4A8W A;  1EIY B;  1K44 A;  3ZZ0 A;  1RWK B;  1UJ6 A;  3SCK E;  3CCW A;  3OXL A;  5D8H B;  4PG8 A;  4J9O A;  2BE2 B;  4NX9 A;  4OZ5 A;  2L41 A;  2XO7 A;  1M1G A;  4MIA A;  1VOM A;  3FSY A;  3MM6 A;  5K14 A;  3PYE A;  2BX6 A;  5LM7 E;  3Q8Q B;  3CC4 S;  3CIZ A;  1D8Z A;  4N77 A;  4NPO A;  3C16 A;  2ZDO A;  1TKT A;  3MEC B;  1XQI A;  2W9C A;  3BSA A;  1L5U A;  2CJB A;  4JI0 F;  5KFZ A;  4LQ9 A;  3CC2 S;  3PYF A;  3MPW A;  5H1S V;  3C14 A;  3PW7 A;  2XLK A;  5A8W B;  5B0B A;  1AW0 A;  3QWU A;  4WIQ A;  1RU2 A;  4C8M A;  4ZVT B;  5BYR A;  1SL1 A;  3D6T B;  1LXJ A;  1H0H B;  4KKO B;  1GX5 A;  1F6T A;  3ENV A;  4RUB A;  4QWE A;  2LDI A;  4DLG A;  5L1I A;  3W9I A;  4RBV A;  1NM2 A;  2JDJ A;  3I82 A;  1B99 A;  2CAD A;  4ID5 B;  4C7Q A;  1WWH A;  4JI3 F;  1QUP A;  5J1N A;  4FVC A;  2QMW A;  1KKH A;  2FGC A;  4PEO A;  4XK8 C;  3DRX A;  3DI6 A;  3K89 A;  3UDL A;  3VGV A;  4ED6 A;  1KVJ A;  3J7Z T;  4HKQ A;  2DIV A;  4ZP9 A;  3ENA A;  3BQ2 A;  2XMW A;  5DGB A;  2DR5 A;  3C2P A;  2ZZM A;  2DHS A;  2Y1L B;  1RHQ B;  5LL6 d;  1S1V B;  2VPX B;  4NLO A;  3OQ2 A;  1RWX B;  4OYP A;  2CWK A;  2XI3 A;  2M4M A;  2ZBP A;  1XN9 A;  3CJS A;  3MAA B;  4U9R A;  4FDF A;  5CQG A;  3QWP A;  3EPI A;  2UVR A;  2OPQ A;  5A8K A;  1S72 S;  2G0J A;  1QAJ A;  4UY8 5;  3CDB A;  1JK9 B;  1T9U A;  3ZZO A;  2PDA A;  1XMO J;  1CC7 A;  1WOP A;  4Y65 A;  3OFH A;  2CUY A;  3TAQ A;  4OI6 A;  1VQO S;  4ZVG A;  1KTV A;  1T03 B;  4FS2 A;  1S6P A;  1UAW A;  2MEW A;  3KWM A;  4YDD B;  2BJ7 A;  3LPE A;  1D1U A;  2Z30 B;  5AXK A;  4I6A A;  2BE2 A;  1NJY A;  3HHD A;  3D4J A;  2OPR B;  4CM0 A;  3O8W A;  4ED5 A;  3JYT A;  3OR1 A;  2CVE A;  1D8Y A;  1SH2 A;  1RT5 A;  1RT3 B;  2DCL A;  2PA3 A;  4KO0 B;  3U1N A;  4DLE A;  3I0R B;  3KK3 A;  3M8R A;  1U25 A;  3T1Y F;  5DLG A;  3G82 A;  4BCA A;  4C8O A;  3KHL A;  4KTQ A;  3OR2 A;  2W4D A;  3CDW A;  4ZK7 M;  3OTC A;  3R97 A;  2RDJ A;  1FJ7 A;  3FBE A;  2IJR A;  1URN A;  1T3O A;  1LOU A;  4F0K A;  2E7W A;  3JAM U;  3EGN A;  3J7Y U;  4IQX A;  5DG7 A;  5C24 A;  2NXU A;  1VIS A;  2BDP A;  4C98 A;  4H4O B;  2EXU A;  1JWW A;  4P10 A;  1M0S A;  2AJ2 A;  7FDR A;  5HJX A;  5LSO A;  2IYI A;  1DTT B;  4CQ1 A;  2KYX A;  3AOC A;  2O1P A;  4PG6 A;  3W63 A;  2DEI A;  5KFI A;  3ET6 A;  5IWA J;  3ICL A;  4AXJ A;  4DN0 A;  2UUC J;  1CPZ A;  4LIW A;  3FQK A;  2GQQ A;  2V67 A;  4PYD A;  1BHN A;  1UVK A;  5A0Y A;  4DX7 A;  3QZ7 A;  3FMW A;  2P8I A;  3ILJ A;  3G6Y A;  4DSF A;  5KG2 A;  3QFH A;  1S6Q A;  2HVD A;  2YXL A;  3UN3 A;  3VAL A;  1EAY C;  4LF2 A;  1VRT A;  3MM5 A;  1SV5 B;  5KFQ A;  3J7Y I;  3R5A A;  4DSK A;  4NML A;  2V63 A;  5K8N A;  1HBO A;  1IKY A;  3D6H B;  2RIJ A;  2ZM6 J;  1L3T A;  5CCL A;  1NZ8 A;  4B3T F;  1R0A B;  3QO9 A;  4A4J A;  4QOT A;  5C24 B;  3M9N B;  4J90 A;  1DQA A;  4QIE A;  2PGC A;  4ITS A;  1TL1 A;  5A8K B;  1JLE A;  1MLA A;  1RHK B;  5HN0 A;  1XTZ A;  4DFP A;  2VA2 A;  1F2G A;  3MMC A;  5KFH A;  5K8O A;  4PYA A;  3C8Y A;  4P2F A;  2YWF A;  3IWL A;  1HMV B;  4CNZ A;  1EZZ B;  1FKA F;  1AT1 B;  2R2U A;  2FVP A;  3GR1 A;  2B7C B;  3V6D A;  3VAJ A;  4GC7 A;  5DM6 Q;  1LNQ A;  3P3D A;  3MWB A;  4KHR A;  2ZH5 A;  5CCM A;  2AGQ A;  3DHX A;  3HO1 A;  2IRU A;  2MJN A;  3MI7 X;  4NA2 A;  4CH0 S;  3EGZ A;  1K1Q A;  2DGW A;  3THP A;  1GH8 A;  5K8M A;  5KFS A;  1KON A;  3PY8 A;  4F2S A;  1R8B A;  2BBE A;  3SFG A;  4F0H A;  5F8H A;  2E7X A;  8ATC B;  2VB6 A;  1IKY B;  1OY9 A;  3BM7 A;  2XZD B;  3D54 A;  4ID5 A;  3ENW A;  2B4O A;  3AJ1 A;  3EUN A;  4FBU A;  2GHW A;  5HAT A;  1M5V C;  2W25 A;  5GAH I;  4DR1 F;  2GMJ A;  3K2Y A;  3NS6 A;  4PQU B;  2O67 A;  4PG5 A;  4KKO A;  2E1R A;  5BYQ A;  1Y7P A;  1QTN B;  5F3T A;  4NXN F;  4N76 A;  2WON B;  2LEA A;  1TP7 A;  2ZH8 A;  3SZ2 A;  2MZ1 A;  2NR0 A;  1QJH A;  4ZP6 A;  1S1V A;  1DTT A;  2X3D A;  2B9X A;  3IXQ A;  3FGV A;  3US5 A;  2AEJ A;  1RAH B;  3PW2 A;  4W4M A;  4ZVF A;  2QLJ B;  2Y3Y A;  3LF0 A;  2C3M A;  4P73 A;  4Y2A A;  3AT1 B;  3QMQ A;  1S7I A;  2DYA A;  2M70 A;  4OZ3 A;  4DF4 A;  2R8G A;  2GVD B;  3CCL S;  4C0H A;  2KU7 A;  4LR7 A;  4DR7 F;  1RJJ A;  1RLC L;  3DHW C;  4CLK A;  4ELU A;  2LP4 A;  3PEH A;  2OGU A;  3IAM 9;  2FD2 A;  4AND A;  1U0H B;  5CD4 A;  2D3O 1;  2DNK A;  3T9N A;  2B5J B;  1KDN A;  2YNF B;  3DRS A;  1F9H A;  2YX7 A;  2CPD A;  3L4B C;  4A8S A;  1WOO A;  2XTJ P;  2R8H A;  1FK9 A;  1IUJ A;  4KE5 A;  2W9A A;  1X9S A;  1MW7 A;  3R2C J;  1FFW B;  2DNZ A;  3POT A;  1SJR A;  1QM9 A;  3FBB A;  3W8P A;  4W92 B;  1I3O B;  4CI0 B;  3MM8 B;  2MLX A;  2CDR B;  4HHH A;  1JLQ A;  1BXN A;  5J2P A;  5F8L A;  5I42 A;  1F5A A;  2ZWO A;  1EKS A;  3CJK A;  2ZH1 A;  1OSD A;  2XZW A;  3OHA A;  3Q23 A;  3GFY A;  5F8J A;  2B0G A;  1UVM A;  1WSV A;  1C0T B;  2JZ5 A;  2LYV A;  3AXK A;  1TL4 A;  3BZQ A;  1S5Z A;  2C3Y A;  1B7Y B;  1JLC A;  1X7V A;  1Z1Z A;  4OJH A;  2AWZ A;  1NCL A;  2B5J A;  1Y0H A;  3HFV A;  4P2S A;  4U7U K;  1U6Z A;  3MMB A;  3SSR A;  2W4C A;  5KT7 A;  3LQV A;  4RNM A;  3OW2 R;  2J6S A;  1NDC A;  1JLA B;  1O0P A;  2CFX A;  1N5Q A;  5D4N A;  2WRM A;  1NLK L;  4LRC A;  3KUG A;  2NSC A;  1Q53 A;  1TEL A;  2X3G A;  5B7W A;  4MK7 A;  4K4T A;  4IG0 A;  3TAP A;  3V81 A;  5H9F K;  1YVF A;  4EBD A;  4EO6 A;  3I0S B;  4J91 A;  4X66 J;  3T5J A;  2Z0G A;  2NXN A;  3GSI A;  1FRJ A;  4QWB A;  4F26 A;  3H7H B;  2HGN A;  1BWE A;  5A6W A;  2GQ2 A;  3VVU A;  1Q16 B;  4QW8 A;  3BQ0 A;  2U2F A;  1X0P A;  5JXS A;  1CJV B;  4YFU A;  1FRK A;  1S79 A;  4YB5 A;  4L73 A;  2Q43 A;  2QA4 S;  3BGF A;  2K7J A;  1RAB B;  2WZ1 A;  3HFK A;  4WE1 A;  1SL0 A;  2DR8 A;  4KHP F;  3CCR S;  1HIY A;  4OX9 J;  3OLA A;  3BBC A;  2KTQ A;  2BJD A;  3MPV A;  3UNG C;  3QO9 B;  1OY8 A;  4CNY A;  4TQS A;  2ZD1 A;  1X4F A;  2RH3 A;  4YR0 A;  1CJT A;  2C2O B;  2QN6 B;  1NHV A;  1NB2 A;  2DGO A;  3CCT A;  2POK A;  4OYI A;  1PAE X;  4UZC A;  1GXU A;  4CO0 A;  4ZLP A;  4RX6 A;  3OHB A;  3CCU S;  3RJM B;  1UVI A;  3BPD A;  3DOK A;  3JTO A;  4J9V A;  3MR6 A;  4DL2 A;  3NGS A;  4QR2 A;  2RML A;  4Y2C A;  3ILL A;  2FGO A;  3MEK A;  4DCJ B;  3TUZ C;  2VOD A;  1DAR A;  1N88 A;  3CUL A;  4ZVE A;  2F1F A;  4FF1 A;  3BQ1 A;  3HHN B;  1NHU A;  4P71 A;  1WDT A;  3H4B A;  3V6H A;  2KKH A;  3FNN A;  2DTJ A;  4O3N A;  2DNN A;  5KT5 A;  5KFV A;  2Y1J A;  3I4H X;  1FKO B;  4OI4 A;  3DN9 A;  2LXF A;  2WHO A;  4OZJ A;  6FDR A;  4DBQ A;  4WFA Q;  3R5B A;  4Y28 C;  1QAX A;  1SH3 A;  3G6X A;  1D3W A;  1E6Y B;  5F0U A;  3PO5 A;  3MCO A;  2VL1 A;  3D3C J;  3MMB B;  3MTK A;  2KJV A;  3SSQ A;  2PEH A;  2M3D A;  3CCM S;  1K9M T;  5CYQ B;  3HXM A;  2RAQ A;  3DOK B;  3SBM A;  1RT6 B;  3MCN A;  3UN5 A;  3JSY A;  5E3R A;  2AX1 A;  1X9M A;  4M5D B;  4RNF A;  3E8O A;  2C3O A;  3UR3 C;  1CLF A;  2GA7 A;  1UZD A;  2AQ4 A;  3TR5 A;  2R8K A;  4M5K A;  4GC6 A;  1FWP A;  2KFZ A;  1NJI T;  2WW4 A;  4MIW A;  2FDN A;  2XMK A;  2O5D A;  4ECY A;  1SIZ A;  4EBC A;  3GFH A;  4A48 A;  1LW0 A;  1ELO A;  1TKX B;  2X1B A;  3U7J A;  2MZQ A;  4C8N A;  2F4F A;  2LQB A;  4F7V A;  2BRL A;  5ADZ A;  5KT6 A;  4HVZ A;  1XBW A;  2DKO B;  2JEJ A;  1S1U B;  1S0O A;  2RRN A;  4DQS A;  1IKW A;  5CH7 B;  4MFB A;  2QIF A;  1EQM A;  3KDN A;  3KLF A;  1FRL A;  3NGR A;  3GQC A;  1B70 B;  2B9W A;  3DGP B;  3TAM A;  1NKE A;  3E01 B;  1MNE A;  3I55 S;  1F9F A;  1WC3 A;  4HYK A;  3KJV B;  2HAF A;  2ASL A;  4ZHR A;  3F41 A;  2DT9 A;  2E1A A;  3W9H A;  1XR6 A;  4NXN J;  3AFG A;  4YY3 F;  4C8Z A;  3LP2 B;  1HHQ A;  1VLO A;  2KT2 A;  3SXL A;  2VD3 A;  1GMW A;  3CDE A;  3LWM A;  4JV2 A;  1XER A;  4LFC F;  2KFN A;  5DQH A;  5K8P A;  1F3V A;  3M2U A;  4C11 B;  1RCO B;  1UPM B;  4UUX A;  4ATN A;  3IC1 A;  3EZU A;  3CD0 A;  5IV3 A;  1NK0 A;  4DV6 F;  3D6M B;  3IWN C;  4MFB B;  3O5T B;  1S59 A;  2OPS A;  3ISN C;  3FJ2 A;  3TX8 A;  1IQZ A;  3DLK A;  3H8Y A;  4ECW A;  1RWU A;  1JLF A;  2RDI A;  2VHG A;  2IYG A;  2DRD A;  3C66 A;  4WKR A;  3FMB A;  4XTT A;  3LGN A;  1CJK B;  4NLY A;  3MR2 A;  4N41 A;  1VC0 A;  1TFY A;  2V50 A;  3G9C A;  1VS3 A;  4O4G B;  1OMS A;  3M8W A;  2FLN A;  2OI2 A;  1DY3 A;  2A6M A;  3PHE A;  4Y2M A;  4CH1 A;  2RUS A;  3QRQ A;  3MXH P;  1N33 J;  4MTP A;  5L46 A;  2QG9 B;  2BOP A;  3PRD A;  1H73 A;  5J2N A;  3PEJ A;  1SC4 B;  1W25 A;  5FD1 A;  1Y00 A;  5CAA A;  4HH1 A;  4DV3 J;  3FDS A;  3PW0 A;  2KG1 A;  2R7T A;  1FVQ A;  2V8D A;  2MZS A;  3ETO A;  1O51 A;  5D4P A;  4ZA1 A;  1NSP A;  3UCG A;  1U4B A;  2GHP A;  5F9L A;  4Z37 A;  4DR2 F;  1PJ6 A;  4DUT A;  2YWE A;  2OPP A;  2K1R B;  5THW A;  2JVR A;  3KYL A;  2GFF A;  1VQ8 S;  2ZKU A;  3IR7 B;  1FDB A;  4DPY A;  1S4E A;  2OEL A;  3TZZ A;  5IOL A;  2KL8 A;  3W5X A;  4I7F A;  2IA0 A;  4UZB A;  1S0V A;  5GAG U;  3H5S A;  3TAN A;  4CYU B;  1RHU B;  1JNZ B;  1OQ3 A;  2VG6 A;  4R8U A;  4M63 A;  3RAQ A;  4TU7 A;  2IBK A;  4JI6 J;  1HNW J;  1SC3 B;  4W90 B;  2BKP A;  3UD4 P;  1IBK F;  2VA3 A;  4RL1 A;  1U1O A;  3UD5 A;  3MEE B;  4YY3 J;  2GAG C;  2L3M A;  3JSB A;  2UUT A;  1GX6 A;  2G2Z A;  4PPD A;  4Y2K A;  5IM0 B;  4PUO B;  2YWH A;  4WP3 A;  9ATC B;  1HHT P;  3FZB A;  4X4N A;  3AOD A;  4X66 F;  1V5I B;  2QL5 B;  3WC0 A;  4JV0 A;  2OTL S;  2UUB F;  3O1L A;  1GK8 A;  3QBC A;  1U1N A;  4F25 A;  3QYY A;  2MKK A;  1VQ4 S;  3ZTR A;  2I6W A;  4ZPC A;  1GFW B;  4H4O A;  2W4P A;  4FNH A;  4NCG A;  2FZK B;  3DKD A;  4K4X A;  2GVZ B;  2I5J B;  2V8G A;  1P6T A;  2CJA A;  5HQL A;  5DLF A;  2LEP A;  3HUL A;  1KRP A;  2BKO A;  4ES3 A;  3IR5 B;  1EX8 A;  1F5B A;  2PC6 A;  2RS2 A;  3DYA A;  2ZH6 A;  4DCO B;  4ALZ A;  3KHR A;  4MJK A;  5IT4 A;  2MHN A;  1KQF B;  1ZYQ A;  1U6F A;  2PN6 A;  3V4M A;  3WX8 A;  1RIS A;  3MM5 B;  4C97 A;  4DV1 J;  1N6Q B;  4B9N A;  2ZZN A;  2H3E B;  2HIY A;  2RRB A;  4MKB A;  4PXB A;  1FRI A;  5EWF A;  3V4I B;  4O3R A;  3MM9 B;  5AXN A;  4DQP A;  1TFW A;  2BRK A;  4M5H A;  4L6V 3;  2Y0S D;  1G3O A;  1KHW A;  2GVZ A;  1OO0 B;  1S6U A;  2XMV A;  3M1V B;  4L76 A;  4NLW A;  3P6Y C;  1PYT A;  2HRY A;  4AE5 A;  4DR5 F;  1C1B B;  1BC6 A;  5E5N A;  1WHX A;  2ILY A;  2DBB A;  3H4D A;  4EZ6 A;  2C1E B;  2IC3 A;  1X9W A;  2YNH B;  3LP2 A;  2Z2L A;  2OMO A;  1RWW B;  1NPP A;  2VG5 B;  3HHL A;  2XO6 A;  5EN1 A;  3FFI A;  3D67 A;  3SQO P;  1C0U B;  4LVN P;  4ANE A;  5F8G A;  4LSN B;  3M9M B;  3M2U B;  4C11 A;  2M8H A;  3RW7 A;  2LEB A;  2ZZT A;  4I6W A;  3Q24 A;  5T14 A;  2R7S A;  2UXC F;  2CQC A;  4F4Y A;  2ZVI A;  3NAI A;  3FCH A;  3NOC A;  2CXE A;  1VRQ C;  2B56 A;  1WTF A;  3KK1 B;  3Q83 A;  2HNY B;  1EET B;  3KLE B;  4L3K A;  1S1W B;  1VJQ A;  5KG7 A;  2V4Q A;  2EK1 A;  2FLO A;  3OTB A;  4O4G A;  1KQK A;  3WX4 A;  5IC6 B;  1WKK A;  4L3N A;  2RT3 A;  4F67 A;  1WEY A;  4J9P A;  4U7U D;  2VBW A;  3GU0 A;  1AUS L;  4MK9 A;  4TYB A;  2AYE A;  2OFH X;  4I2P B;  1YRX A;  2BUN A;  2GCF A;  2VF3 A;  1N54 B;  3KG0 A;  2WBM A;  3GV7 B;  1FXL A;  2IJF A;  1Q86 T;  2HBY B;  2E1C A;  1VQK S;  1NK9 A;  1ZH5 A;  2KFY A;  2PT0 A;  1YHQ S;  3F56 A;  1LFP A;  1H2U X;  1OJ4 A;  3DOM B;  2YNI B;  3DMJ B;  2HMI A;  2R7O A;  5ETN A;  2HVZ A;  4ICL A;  4A8Y A;  3A8I A;  2FPH X;  4RW7 B;  4AUK A;  3ZZT A;  3T5L A;  2GZO A;  3ILI A;  1N48 A;  2E5J A;  1I94 F;  4OL8 A;  2R7V A;  3S6E A;  2ZIT A;  2B9E A;  4AFF A;  1FER A;  4CLU A;  1PSD A;  3KJN B;  5E3C A;  2NPI A;  1JLB B;  2FZC B;  2QMU B;  1XR5 A;  1KBR A;  2W7A A;  1ARO P;  2H9Z A;  1YRU A;  3AA8 A;  4BBY A;  2ZE2 A;  5A76 A;  3OVS A;  5AE2 A;  2K1R A;  1TUG B;  2ZOF A;  2LCW A;  4DJB A;  5IT9 Y;  3P8B B;  1HD0 A;  4G1Q B;  4B9M A;  2IMO A;  2H51 B;  3A3N B;  4NLR A;  2M7S A;  1G6B A;  1NND A;  3M6W A;  4I1T A;  4MKA A;  4PG4 A;  5J2Q B;  4K0K F;  2DCU B;  3X3U A;  2CWX A;  1CJU A;  2OD6 A;  4N47 A;  2BAB A;  1WI6 A;  3EZ5 A;  5B0D A;  3IP0 A;  4GVB A;  1W2B R;  4ICL B;  2QO3 A;  4DL0 C;  2HHH J;  2E29 A;  1RT1 A;  2VFV A;  2VUG A;  2QJ3 A;  4L74 A;  4U8Y A;  3KLI A;  3ZTS A;  4FXW A;  2XSF A;  5M2R A;  2DXD A;  2F7V A;  2LA6 A;  4WK1 A;  5J2M A;  1RUS A;  4IRC A;  4ILM A;  3QT7 A;  1FJG F;  3AXM A;  3LH2 S;  3M9O B;  3UWT A;  1T0T V;  1KOO A;  4DG1 A;  2YKO A;  3QGG A;  3BSN A;  5DGA A;  1QVG R;  4C4W A;  3HKW A;  5KOX A;  5HBM B;  1KLN A;  3TA1 A;  1IVZ A;  4NCG B;  4DZD A;  4ZCM A;  4YP3 A;  3MAQ A;  3VAM A;  4JI8 J;  5EX3 A;  3Q0A A;  2V8V A;  3TA2 A;  3RBE A;  1VGY A;  1XMB A;  2YTC A;  2WW8 A;  3NWG A;  4DR7 J;  1R8H A;  1U7L A;  4YME A;  2J6T A;  1OPZ A;  4EU0 A;  3BGR A;  5K5M A;  1VQN S;  1JQG A;  4IYQ A;  3MM7 A;  1VK8 A;  2B4P A;  2ROP A;  4LF8 F;  3QLH A;  4ZJO A;  2EFP A;  3VGS A;  3G8S A;  3QGP A;  1YI2 S;  1VR6 A;  2CAJ A;  5IZH A;  3I0R A;  1T02 A;  1UFW A;  3FK4 A;  3EXY A;  4DV4 F;  2ASY A;  5C2G A;  2G1H A;  2JLG A;  2V5H G;  4YDX A;  1U47 A;  3UDV A;  1X4G A;  2BOA A;  2FHO B;  4DI6 A;  1VHF A;  3D28 A;  1YLX A;  5HI7 A;  1SPB P;  3EXC X;  3FC9 A;  2OSQ A;  3N0V A;  1XNQ J;  3GIR A;  4TLQ A;  4HT5 A;  1X4B A;  2ZE2 B;  3FUY A;  4JI4 F;  3H5X A;  1F5C A;  1SKW A;  1MRO A;  1FKP A;  3HSJ A;  2L08 A;  2JWN A;  4FYW B;  4HDH A;  3QJJ A;  3LO3 A;  1YJR A;  3ZTO A;  2Q6C A;  4X2B A;  4TNO A;  3FFI B;  1Z2Z A;  3IAS 9;  2VPY B;  2E5L J;  4J9R A;  1CQM A;  2ABY A;  5JVH Q;  2OEJ A;  3GSD A;  1WG4 A;  2A3J A;  4KV8 A;  2AYM A;  4K4W A;  1VDH A;  4BWM A;  1NSA A;  3NY0 A;  1YJU A;  5KT4 A;  4OX6 A;  1TKT B;  3T1H J;  1XMO F;  1RK8 A;  5CYM A;  3OVA A;  1GXL A;  2MGZ A;  3NRB A;  1RA7 A;  3QJP A;  1N34 F;  2LKZ A;  1Q5Y A;  3HHL C;  5C25 A;  2KG0 A;  3ISN D;  1UEU A;  4XAK A;  5F9N A;  4LF1 A;  5D77 A;  4PR6 A;  4NCA A;  4DU8 A;  5LMU F;  4QU6 A;  2YH0 A;  3N01 A;  3GE9 A;  2UUA J;  3RU0 A;  1IR1 A;  4URG A;  3MFI A;  2ADC A;  2DIT A;  2OHD A;  3IG1 B;  4RJV A;  3OTO F;  3KNA A;  4RW8 A;  3J7A N;  2AU0 A;  5AXL A;  2FJB B;  1UEV A;  3N4W A;  2Q66 A;  1WDD A;  2WBR A;  4FYY B;  4K0K J;  3DLE B;  3CJ2 A;  1WC6 A;  1JXV A;  1UJ5 A;  3HM9 A;  3GFX A;  3OR1 B;  4K7Q A;  3HHL B;  4QZV B;  4E0D A;  3PIP Q;  2J7W A;  1HBM A;  1ZZF A;  2JFK A;  2X1G A;  3HVA A;  3MOZ A;  2X1A A;  1M5O C;  2AW0 A;  3DMJ A;  2W8L A;  1N0U A;  1LKZ A;  4LBI A;  2PA8 D;  2V8H A;  4G1Q A;  5HLF A;  2H65 B;  3FBF A;  3KK1 A;  1J27 A;  3NKY A;  3VF0 B;  3LA0 A;  1OYE A;  2FUG 9;  1H6K X;  2HHP A;  2V0N A;  3L7U A;  2HUR A;  2YNG B;  1JLB A;  2UZA A;  4NRU A;  4Y3C A;  2ZUG A;  4JI0 J;  1X31 C;  3Q22 A;  2C2N A;  2MHE A;  3U27 A;  2C2M B;  4CM2 A;  2QSF A;  4X84 A;  4PXC A;  4WFB Q;  3BKT A;  3T6J A;  4AXI A;  1MRO B;  2Z58 B;  1HWL A;  4KQZ A;  3ZO7 A;  1WNE A;  1H2V Z;  4JV5 J;  5J1E B;  3DRP A;  5B0A A;  2XS7 A;  3W66 A;  3C19 A;  2PII A;  3IM9 A;  4ZIV A;  1HBM B;  5DG9 A;  4QJV A;  3PX0 A;  1XNQ F;  2UVU A;  2CPI A;  3N5B A;  1YBT A;  1SJF A;  3DOL A;  2W2O P;  1CBK A;  1D9A A;  1BQM B;  4J9M A;  1GEH A;  1SQG A;  1P1T A;  2GJ2 A;  1PJ7 A;  3DRR A;  4DHV A;  5J2M B;  1JMT A;  4ECU A;  1VFJ A;  3BPS P;  3K8V A;  5FDL A;  1VBK A;  2HHX A;  1HQU A;  1XEZ A;  4QWD A;  3GIL A;  2BW7 A;  2GX8 A;  1RAJ A;  2ZC3 A;  3OL8 A;  5KFC A;  1WEL A;  2AJ4 A;  2MZR A;  2ZNZ A;  2ZVS A;  2ATL A;  2MTL A;  2XUL A;  1BMQ B;  4WXO A;  5LMN F;  3DRP B;  5L1K A;  1NSQ A;  3P5B P;  4OHZ A;  2R2S A;  4USM A;  2UU9 J;  3D7S B;  1XR7 A;  4NCB A;  3DGV A;  1R3N A;  2DY1 A;  3Q89 A;  3IGV A;  4TYA A;  2HZA A;  1S9E B;  3MED B;  3NP5 A;  3R5C A;  4AQY F;  1RT4 B;  1R6Y A;  4RWW A;  4UOG A;  1RTI A;  1C4C A;  2CQP A;  2E1P A;  1TK5 A;  4CLP A;  4ZIW A;  4OHY A;  4LMZ A;  3H2V E;  1NH8 A;  3HLU A;  3HSG A;  4ZVQ B;  4N8N A;  5D4O A;  5IWA F;  2MSS A;  1KQS R;  1A7G E;  2KXF A;  1S9F A;  1GTH A;  5KFM A;  3PXG a;  4HAC A;  5SZT A;  1WC5 A;  3G87 A;  3IRW P;  1NDP A;  3M32 B;  4K4V A;  4QYZ K;  3AY0 A;  2HND B;  1M1H A;  2DJW A;  1HBN A;  2CPJ A;  2FB0 A;  2KRR A;  3TUI C;  3EPG A;  2CPY A;  4KYZ A;  3CVK A;  3PKY A;  1XK8 A;  4OFZ A;  2J0S D;  3QZ8 A;  4IKA A;  2YKM A;  4NYZ A;  3H40 A;  1WC0 A;  3NWR A;  3M4X A;  3CJ4 A;  1FTR A;  2QV6 A;  1Q1K A;  5ETR A;  5KFX A;  3W8G A;  1RTJ A;  5T41 A;  2M0G B;  4X4P A;  2CQ1 A;  3TUP A;  1KFS A;  1T9T A;  2HS3 A;  3QID A;  3QAE A;  2HPU A;  3MD1 A;  4M5L A;  1XMQ J;  3OD2 A;  1RP5 A;  1RCX B;  1HNX F;  1VQ5 S;  2HHV A;  3L09 A;  2D1C A;  2ZH2 A;  2L9N A;  3H90 A;  4ZCL A;  3BDE A;  2VFU A;  2MDA A;  4YN3 B;  4ZVS B;  5KT3 A;  2MQM A;  4LJM A;  1HYS B;  4BDP A;  4CLT A;  5IT9 U;  5IV4 A;  5L8R C;  2FQQ B;  4ELT A;  1OYD A;  1WJ9 A;  4RR5 A;  4WII A;  1V5V A;  3WIU A;  2VQF F;  4AL7 A;  2XY6 A;  4O3P A;  2FVS A;  4HHU A;  2GIF A;  2LA4 A;  3GWC A;  4NLV A;  4E8U A;  2UXD J;  2F9D A;  2DH8 A;  3CWJ A;  2IRY A;  3FQL A;  4M5J A;  2KT5 A;  2KDO A;  4WP9 A;  3ZTP A;  1RTJ B;  4NEZ A;  4MT1 A;  3D0H E;  2YKP A;  3RRK A;  2KXN B;  4KH0 B;  4DUZ F;  2ZKT A;  2NUU G;  2I8E A;  2QZ8 A;  2HQI A;  4UT4 A;  5HP1 B;  5CA5 A;  3CW2 C;  2H54 B;  2ZBQ A;  3JYT B;  2VC0 A;  4C9D A;  4LF4 J;  3PYG A;  4WKY A;  3RB4 A;  1EHW A;  1SB6 A;  3HJV A;  3NGT A;  1UWB B;  5KG6 A;  3CCV S;  4QQB A;  3CJQ A;  1U49 A;  1UL3 A;  4JI1 F;  7FD1 A;  1PC5 A;  3W2W B;  2P9G A;  9RUB A;  4KJI A;  2G9O A;  1X5P A;  2BJE A;  4UUW A;  1B64 A;  1ITP A;  2HFN A;  4P75 A;  4UF4 A;  4BLG A;  5C25 B;  4EFA C;  3V81 B;  2WVB A;  2CQ4 A;  4LRB A;  4F4K A;  2APO A;  1IBM F;  1S9G B;  2D69 A;  4ECT A;  1CUL B;  1MML A;  1YX2 A;  1WTB A;  2UU9 F;  2VU5 A;  2AGO A;  2MQN A;  3MM8 A;  4G1I A;  4DEZ A;  1VK3 A;  1JLQ B;  2HZC A;  2XNQ A;  2YKA A;  4ETZ A;  2VKZ G;  2WB4 A;  2HHW A;  1AA1 B;  4YEA A;  3NAH A;  2KVQ E;  4WE1 B;  2GO8 A;  3K57 A;  1NK5 A;  1DRZ A;  4ELV A;  2QC3 A;  3M8P A;  3R1L A;  4OZ2 A;  4NLT A;  2QE5 A;  3C6T B;  4LT6 A;  4F3Q A;  2DGT A;  3R5J B;  4I2P A;  4DXL A;  4D3G A;  5KFK A;  2RU3 A;  2XSJ A;  1Q0N A;  2OML A;  3BDP A;  1EP4 A;  3DGP A;  3TAM B;  2HRT A;  1X4C A;  1LK7 A;  4OYO A;  4GMK A;  5BXI A;  2DK2 A;  3FSI A;  4MYT A;  3VTI A;  1KTQ A;  2GJI A;  2QSW A;  3VGT A;  4ZLL A;  3MGJ A;  4ZVU B;  5E41 A;  4B3M J;  1IN0 A;  1FXR A;  2VQF J;  3A8J A;  2CPH A;  3BH7 B;  4JV1 A;  5BJR A;  5EGY A;  4RO0 A;  3AB2 B;  1PIE A;  4ED8 A;  2UXD F;  3RW6 A;  2XY7 A;  4CO5 A;  1AB8 A;  1NHK L;  5J1E A;  1RGV A;  4C6A A;  2O3D A;  2JH3 A;  2HNZ A;  3M8P B;  5H9E J;  2WB1 D;  3KK3 B;  3QGH A;  2OPQ B;  4MIB A;  3PW5 A;  1PC4 A;  1YJW S;  3PTW A;  3TQ1 A;  5JJB A;  2VC1 A;  2OH2 A;  2HKE A;  2YPY A;  4XDC A;  4BS2 A;  3O3L A;  3A4T A;  1Y11 A;  2YWG A;  3NCR A;  3NS7 B;  5CZV A;  1VBZ A;  1KQG B;  1WD6 A;  5F8I A;  2CQ2 A;  1S6P B;  2N4D A;  3LAK A;  3EE3 A;  2IJN A;  1P1L A;  4C0B A;  2ZHB A;  1AUD A;  4Q8E A;  4FF4 A;  2RQK A;  4N56 A;  3RB6 A;  2EC0 A;  1VRT B;  2WON A;  4NZ0 A;  2XGQ A;  1WG5 A;  1IBM J;  4DR4 J;  2AV5 A;  3C15 A;  4WFX A;  4CP5 A;  5GAE U;  1FA0 A;  2QA1 A;  5D0H A;  4FYD A;  1M90 T;  4PCQ A;  1HPZ B;  2Y8W A;  3ISZ A;  1WAC A;  2AIR B;  3ZNU A;  3OT9 A;  3GIM A;  3PR5 B;  4CTA B;  3GON A;  1F9E B;  2ZFH A;  2WOM A;  1WG1 A;  5D0G A;  3GIJ A;  5L1L A;  2DR7 A;  4DUY J;  1LWX A;  3VGU A;  2ZEJ A;  1HMV A;  1NJW A; 
#chains in the Genus database with same CATH homology
 1TL7 A;  4CLT A;  5IV4 A;  4P2X A;  1YBU A;  2GVD A;  4CM0 A;  1CJK A;  5IV3 A;  4P2M A;  4WP9 A;  3G82 A;  1YK9 A;  3C15 B;  1AZS B;  1WC6 A;  3ET6 B;  4CLS A;  1CJK B;  4NI2 B;  1CJU B;  3UVJ B;  1FX2 A;  4OYX A;  4WP8 A;  1CS4 A;  4OYB A;  3ET6 A;  1AZS A;  4CLU A;  1CJV A;  4OYM A;  1CJV B;  3G82 B;  2WZ1 A;  3MR7 A;  4CM2 A;  1WC4 A;  1CS4 B;  4CLZ A;  1CUL B;  4USU A;  1CJU A;  4NI2 A;  1CJT A;  1YBT A;  4CLW A;  4OYI A;  4P2F A;  2W01 A;  5D0E A;  4CLF A;  4OZ2 A;  5D0R A;  4WP3 A;  4CLL A;  4OYO A;  2BW7 A;  3C16 A;  2GVZ B;  3C14 A;  1AB8 A;  1CUL A;  4OYW A;  1TL7 B;  4CLP A;  1Y10 A;  4USW A;  1Y11 A;  1WC5 A;  4OYA A;  4WPA A;  3C16 B;  4OYZ A;  4UST A;  4OZ3 A;  4USV A;  2GVZ A;  1WC1 A;  1CJT B;  2GVD B;  3UVJ A;  5D15 A;  4CLK A;  1WC0 A;  3C15 A;  3R5G A;  5D0H A;  2QV6 A;  4OYP A;  4CLY A;  1U0H B;  3MAA A;  1U0H A;  3MAA B;  3C14 B;  5D0G A;  1WC3 A;  1FX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...