3UVJA

Crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
191
Chain Sequence
QVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Guanylate cyclase soluble subunit alpha-3
publication title Crystal structures of the catalytic domain of human soluble guanylate cyclase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 56
structure length 191
sequence length 192
chains with identical sequence C
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3uvjA00
1CJKA 4WPAA 3C16A 1CJUB 3G82B 4USTA 4CLPA 1CJTA 1WC6A 4P2XA 3ET6A 4CLSA 3C15A 1WC4A 1AB8A 1CULB 4USUA 1CJVB 1WC0A 2GVZB 1FX4A 4OYWA 1Y10A 4OYAA 4CLUA 4OYOA 3C14B 5D0EA 4CLLA 3MAAA 4WP9A 1CS4A 4OYZA 4NI2A 1WC5A 1U0HA 4CM2A 1AZSA 4OYBA 4WP3A 4CLYA 3UVJB 3MR7A 1CJKB 1Y11A 1TL7A 4P2FA 5IV4A 3C16B 2QV6A 1CJTB 5D15A 4CLWA 3ET6B 4WP8A 3C15B 2BW7A 4OZ3A 2GVDA 4USVA 4P2MA 1CJUA 3G82A 4CLZA 1WC3A 1FX2A 1CULA 1CJVA 3MAAB 2GVDB 2GVZA 4USWA 1CS4B 2WZ1A 4NI2B 2W01A 1YK9A 1WC1A 1U0HB 1AZSB 4OYPA 5D0HA 5D0GA 1YBUA 3C14A 4OYMA 5IV3A 1TL7B 4OYIA 1YBTA 4CLFA 4CLTA 4OYXA 4CLKA 4OZ2A 4CM0A 3R5GA 5D0RA 3UVJA
chains in the Genus database with same CATH superfamily
3HF5A 1U49A 1NSPA 3VQTA 3W2VA 1CJUB 1RT7B 2RE1A 4MFBB 3SSRA 3G9CA 3V6DB 5J2PB 4XDCA 5A8RA 2WONB 3OXFA 2DBBA 1S0MA 1QUPA 2IRXA 1RT6B 3D3CJ 1UETA 1U1QA 2N7YA 3F73A 5KFQA 2FVSA 5A0YA 3TJ8A 4DPXA 2Z58B 4RW6A 1SPBP 1NPKA 3VV2B 1JNZB 3AFGA 3DN9A 4O3RA 2M9KA 5ETQA 1XEZA 2BRLA 3D7SB 4U95A 2CJYB 3FCWA 3I4HX 4EZ9A 2B9EA 1B64A 4OI1A 4OI4A 1EB0A 4DR3F 3U1MA 1X8DA 3MGJA 4DQQA 2RQ4A 3H25A 3T5LA 4Y00A 1YDLA 2IY5B 4BC7A 4IOBA 3KJVA 3TP2A 4CLSA 2MQOA 4RJVA 4P72A 3EVMA 1R3NA 3BKFA 4EMDA 2ZWPA 2LCWA 4FF2A 2BYCA 3SV3A 3W2WA 1VQ5S 3TYTA 2IYGA 1S0NA 1FE4A 2KHCA 1YLXA 3HI9A 4PG5A 3LO3A 4EK2A 4ELVA 4ES2A 3D5MA 3CSKA 3Q2TC 3BO3A 5D4NA 5HO4A 3CCZA 2GVZA 4DXLA 1RDRA 4O0NA 2AZ3A 1AZSB 4X4NA 1I6JA 1CC7A 3L95X 2R2TA 3UDVA 1PYTA 2GQ2A 5JUMA 3R5GA 3UVJA 1KFSA 4HHUA 4I68A 1RTDB 4QQBA 3ILOA 3UCZP 1XNQJ 2C3OA 1WF0A 4JI6F 2RF2A 1MN9A 2FZKB 4ECRA 4MKBA 3PW0A 4PG8A 2KU7A 4DF8A 4JI7J 3IWNC 4JI4J 3GWCA 3WQPA 2H5JB 4FPIA 1VR6A 4CZCA 1NEEA 3GJRB 2RIJA 3PX6A 2DXFA 1RAFB 1CG2A 5KFPA 4M5KA 2DVIA 1SV5A 5I3UB 1Q78A 2YX4A 4I67A 4QJVA 4J9QA 4Z7CA 5J2MA 2B51A 3HVTB 3RRHA 4JI1J 1VQSA 2RU3A 3QGGA 4TU8A 3PXGa 1HBOB 2FHJA 2IRUA 5KT6A 1YBUA 3RRKA 1Q0NA 1B99A 2HLTA 3DOKB 1S97A 5HP1B 4NYZA 3FBEA 4Q0BA 2MPUA 1F9EB 3ONQA 1IKWB 3RBXA 2F4VJ 2DHHA 2MKIA 4ECVA 4DS5A 1KFDA 4RUAA 4CO3A 2ROPA 2H65B 4DL7A 3ENQA 4URSA 2J8AA 1Q4RA 4G1IA 4HHJA 2HBYB 4TU9A 1CEZA 4WK1A 1LWXA 2KRRA 1E6YB 3G6ES 2KT5A 2DR8A 4NLOA 3TR5A 4DL2A 5ETTA 4LIRA 1KDNA 4KV8B 4P2FA 5KFRA 3BDEA 2VFVA 3FBFA 3C6UB 4U6PA 2Z2YB 2YNFB 3AXMA 4BDPA 1NK4A 4O44A 5KG2A 2DNMA 5T7LB 2V50A 4I1TA 5K8MA 3OT9A 1UA0A 1AFIA 1SC4B 4W98A 4B17A 3FMWA 5D6GA 3BKUA 3H59A 1C0UB 1UJ5A 4I2PB 2DNPA 1TK5A 1ZOTA 4HH0A 2VG7B 5CYJA 4OI6A 3LOUA 2MXYA 1C2PA 1RHJB 1RHKB 1NBEB 4X84A 2FZGB 2QA4G 3MTKA 1WEZA 3IWXA 1RYSA 3H42A 4DG1B 1FEEA 2BANA 1MU2A 2VH7A 4OL8A 3PCOB 2ZM6J 1WOPA 1N0VC 2CQIA 4CO4A 4DR5F 3D0IE 5B09A 3OR2A 1TFWA 3AY0A 5CCMA 2IM0A 4H4KC 1LK7A 1O0PA 3VAMA 2GGPA 5E0OA 5EHHA 2O5DA 4WP3A 3J81U 2YBVA 2DR7A 5HQLA 1RU2A 3EXYA 2KXFA 1C0TB 2GAGC 2YWHA 3OTOF 1FDNA 1QE1A 3KK2A 3U02A 2ALYB 2W9CB 1SXLA 3A13A 4Y34A 2ALZA 5KFEA 1D8ZA 2Z57B 4C0OC 4NLGA 1D9DA 4AYBD 1DBDA 2JFKA 1NCLA 5KFNA 4O3QA 1RTZA 5E3RA 3CCTA 3G96A 1S10A 4JBCA 4L75A 4YUDA 4CDIA 4LF5J 3TAMB 4RNFA 4R0EA 2VUGA 4IQXA 3I0SB 3Q89A 4NCGB 1EP4A 4KPCA 4PXDA 8ATCB 2ZH9A 4DPYA 1C1CA 2J8SA 1PYSB 2V34A 4NLYA 3JQKA 2PEHA 1RLDA 1OSCA 4N56A 1TKXA 3LGHA 5KFFA 2EKNA 1W7WA 2CJAA 1ZM4A 4PAAA 3HHLB 2R42A 1XBWA 1U47A 4IYQA 4NLVA 2HPUA 3MFIA 2Q79A 4UOHA 4DL4A 3RBEA 4DF4A 3WDOA 1HBUB 4J7CA 3HLUA 1XMOF 2UV8G 2F8MA 1BC6A 1VISA 1RT3A 3M6XA 2HWIA 4OYMA 4NLTA 2HQFA 2V8PA 3DYAB 1DARA 2VC0A 4LF2A 2CPJA 1KS2A 3SZ2A 2AQ4A 3KG0A 2UUTA 3IRXA 1TL5A 1KQFB 1XWLA 2CPHA 5CAAA 2E1PA 4ED4A 2K1RA 1FVQA 1FNXH 1F3FA 5G4DA 1K1SA 5DGBA 4KAIA 3UQSA 1J5OB 3FMBA 1BD6A 2D3ZA 3LQVA 2QLWA 4CT8A 3K5PA 2ZEJA 1REGX 1X0PA 2HVDA 1XMBA 1JX4A 2EFNA 4RW7B 1Q82T 3IBWA 4ZKAA 2HVEA 3C6TB 4A48A 3O5TB 3BPSP 5JMNA 2JLEA 1BGXT 1JJHA 2F5GA 3Q86A 2FC8A 1N36F 5BR8J 4KE5A 5CABA 3ICLA 3OHBA 1IWAA 4ITSA 1FKPA 3N6NA 2LLZA 1OS5A 3M30A 5HL7Q 2V4JB 4DV0J 2VKZG 6FD1A 3OFHA 5EX3A 4USTA 3TZYA 3QLHA 4ZHRA 1DURA 4JB8B 2A10A 1FK9B 4Y0FA 1IBKJ 4DU7A 3SXLA 4QIWD 2M3DA 4GKKF 2UUCJ 2OPRA 2MMYA 1T03A 5D4LA 3OVAA 1VQ7S 4F3OA 2OEJA 2UXBF 4CH1A 2P6SA 1BQNA 2DD8S 3PYGA 3VAKA 4FP9A 3W8PA 3M9MB 4ED1A 1N5YA 1GEHA 1HBMA 2HIYA 2WW4A 4MAKA 3PZPA 2PMZD 2NXCA 3ILLA 1MW7A 2PGCA 1WG4A 2ZH4A 2DRAA 2EXUA 4F26A 1X9WA 3B8HA 2HBQB 2BE2A 4NI2B 2KVQE 3EJMA 2H54B 1XERA 2KG1A 5KTQA 4OYIA 3NCQA 4H4OA 1F2GA 2FIUA 4PABA 3TQ1A 3DRPA 3IO1A 1VRTB 4ZDNA 4RKUC 2JSXA 4P2XA 2LXUA 2NXJA 4BWJA 4YN3B 5CQGA 2RRNA 1NZAA 3ZFVA 2X1AA 1QVFR 2KZMA 1FD8A 4LSNA 1SC6A 1S9GB 4TQRA 3I5CA 1FFGB 2EBEA 5ETMA 1S1UB 1W2BR 5DLFA 1E6VB 1UWBA 2VKRA 4J9RA 5IC4B 3DXBA 3TNVA 1X9SA 4DSLA 2DTJA 1ZZNA 2PI4A 3FRZA 4XIUA 4DZDA 3G8TA 2V8DA 2GHWA 2GHVC 3KNAA 2BMBA 2V2VA 3MPDA 4K4UA 1D0EA 3SSSA 3DOMA 3M6VA 1RWNB 2HFSA 3CJ4A 2AGQA 3B78A 4ERDA 4OYPA 1UCNA 3K7RA 1S6UA 3SQOP 5GAEU 3NL0A 2EG1A 5KT5A 3BO4A 2FJBB 2YXLA 4FPRA 3FDSA 1RT2B 3ZNUA 4O3OA 2CFXA 2LQ9A 3MEGA 4KH1B 3CJKB 4MJKA 3ET6A 1PJ5A 3PJXA 3DLEB 4RR5A 2MHNA 2Z56B 3AHPA 1WDDA 2BKPA 3GONA 3IM9A 3KK3A 3BM7A 2DITA 2FLNA 3C66A 4YDDB 2IBKA 3EM1A 4B9NA 2CKWA 1YRUA 4GO5X 1TP7A 4KFBB 1SKUB 2LYVA 3TANA 1FTRA 4B9UA 3HD2A 2V2QA 2K7JA 5KG4A 1U1NA 3M1VB 4WIIA 1N6QB 4DR3J 1H74A 1R8BA 2O1PA 2YNHB 4P10A 4FS2A 3KG1A 5D78A 1TKDA 3R5BA 3OR1A 4Y2IA 2XSJB 2RMLA 4QW9A 1WF1A 3WC2A 1U0SA 3IBFB 1FWKA 3PY8A 4DR2F 3QMQA 1SKSA 1TKTA 4WJBA 2CNLB 5DS7A 2AP6A 1B0VA 4OHVA 2AYEA 3DOLB 1YZ6A 1IBLF 1NK8A 5F3TA 3VVUA 2DGVA 3LP1A 1NDCA 5LSOA 2JLGA 3T6JA 2B3TB 1NJIT 1RAEB 2COLA 2W9BB 2HQ3A 3VTIA 3QO9A 1IUJA 1Q8LA 2AW0A 4KB7A 3DDIA 2FGOA 3H4DA 2VF3A 4BCAA 1LEOA 1B4SA 5A8WA 2BABA 3BSNA 2RKIB 4DUYF 1Q8IA 2OUGA 3QT6A 4N47A 3RBZA 1KVKA 3MPVA 1T9VA 4CCHA 1ACMB 1X5OA 1JJ2R 2D74B 2PFDA 3AA8A 4X62F 1WHXA 3OFFA 4CLWA 3ZTQA 3NLCA 1VQ4S 4U96A 4DLGA 4FKXA 5HVFA 3VZIA 2X1BA 4JI6J 3TEHB 4U7UD 1WORA 3PHTA 1TUWA 2EKYA 2MZRA 1SJ1A 1L3VA 2B6AB 1NRKA 3BQ2A 1S6QA 2LDIA 3NY0A 1NSAA 3PW5A 3DLGB 4ED7A 4EEYA 4MK9A 4DJBA 4EBCA 2HBZB 3CMQA 2WVCA 3KKFA 4RBTA 2C2RA 4FF3A 2FY8A 2OPPB 3BGOP 1U24A 4YOEA 4QU7A 3DLJA 3MEDA 3ENVA 4ZN3A 4F4KA 4K4SA 4ZA1A 3OXGA 1EETA 3GPAA 3PIPQ 3POTB 2IJFA 1IKXB 1S1VA 4CI0B 4RWWA 2NZ4A 4Y65A 2PI5A 4PUOA 3GIKA 4K2XA 3KLIA 3MMCB 3GR1A 3MTJA 1VRUB 3CD5A 2NZCA 4ID5B 4CNYA 2QGFB 2PA8D 7FD1A 2ZH6A 1JMTA 5CZXA 5LMNF 3ISNC 3OW2R 2QX0A 1OY6A 2MYFA 2WBRA 5EWEA 4GKJF 3J7YU 4LMZA 1HHQA 3HCXA 1ROFA 3MECA 3ELHA 5C2CA 2IM2A 2DY9A 1S9EB 4Q44A 3DRSB 2XG8A 3CC4S 1X4DA 1S12A 4YMEA 2OTJS 2MQNA 3T9ZA 3I82A 2LDYA 1XR7A 4YP3A 1RTIA 5LT5A 1GNKA 4RBVA 2CJ9A 3EVOA 2A2CA 4ZVFA 3J7AN 2HFNA 2N3LA 1RAAB 4TXSA 2BQUA 3M8ZA 3NAIA 5B0DA 5FDLA 3GQCA 2L9WA 1FVSA 1F5AA 2FJEB 4RUHA 3G6VA 5H9EK 2OPQA 2JC1A 5AE2A 3W1YC 2V4RA 4IO9Q 3D1HA 5J2NA 4OIXA 5I4MA 1S4EA 8RUCA 4OJ1A 3MFHA 4QWEA 2Q6CA 4BHQA 1ZBTA 5DZ7A 2ZKUA 1V3SA 2XMTA 3S01A 1DQAA 1SIWB 4OV1A 3NMRA 5J1EB 4KY3A 1SCJB 2NXUA 4AQYF 1WI6A 2EFQA 2MGZA 1RTJB 3OTCA 3N5BA 2F1FA 4C8MA 4DR5J 3PNIA 2CQ4A 2E29A 3V2UC 2YKNB 3TUIC 3MR2A 3EMTA 3VR1A 3Q83A 3DLBA 3KLEB 3UDLA 4E98A 3AQPA 2C1EB 3ETMA 1NO8A 2V69A 5E3QA 1Y5LB 4IR9A 3MM5A 5E3PA 4LQ9A 2OGUA 1WF2A 1RCXB 3RGIA 3OTOJ 2J6TA 3DMJB 3QBCA 4W4MA 2G2YA 3RTVA 4W90B 2R8KA 4IOCQ 2CVIA 1UVIA 1WACA 1G2EA 4K59A 2NREA 3QIPA 3CJRA 2YWGA 2FHJD 1SQFA 2GQCA 3SFGA 1WSVA 3B54A 1Y11A 1TL7A 2PIIA 4C6AA 4YB6A 5IOLA 2HS3A 2V68A 4L3KA 3Q23A 5E3AA 2QMWA 1R8PA 1SB6A 4L72B 3ISZA 3KHGA 4N8NA 4DLEA 2MHEA 2XWYA 4J9NA 2OJ3A 1F9FA 4CT9A 4LVOP 4NRTA 4NMLA 1FJGJ 4USWA 1CS4B 3SMZA 2KXHA 4QYZK 3BGUA 1RCOB 2XSFA 1MMNA 3CJ5A 3H2VE 2HW3A 2Z2MA 4XAKA 5IQQA 1B7YB 1VLOA 3LP2A 3QFHA 5I3QA 3EE3A 1CPZA 2PO4A 2PEBA 2DR6A 5AXLA 2LXIA 3PO4A 2QLFB 3DCAA 1VRQC 1S7IA 4P75A 3SSQA 1HQUA 2HMIB 4M5NA 4J91A 2WVBA 4AXIA 3RBDA 1FX4A 5KFBA 4P73A 2MQLA 2B5JB 3OJSA 4HI2A 2RB7A 2ZJRQ 5HK4A 2VA3A 2Q66A 2MKYA 3W9HA 4O4GB 3D6MB 1XMOJ 4FF4A 2LU2A 3H20A 2XMUA 1D3WA 2MJNA 2IIHA 5L1IA 2KFYA 1T05B 1HYSA 3B6BA 1VC6A 2BW7A 4IUFA 3D3BJ 2K3IA 3P5BP 1VI7A 3H2LA 4Q45A 4I64A 3T1YF 1GK8A 2QL9B 3K5NA 4G65A 1KEKA 2YWEA 2XLIA 3GYXB 2M70A 1SJ3P 1HNIA 1FXLA 2DCUB 3MOJB 1U8SA 2RVJA 4FDFA 2R2SA 4GC7A 3M6UA 4F0MA 1SL2A 1K9MT 3DI6B 4TVAB 2CRLA 3AXKA 1HPZA 5DRKA 1RWKB 2KHDA 2J9DE 1UL3A 3R3TA 2FZCB 2P9EA 3MAAA 1VJQA 1N36J 1FJ7A 1ZTWA 2KG0A 1LW0A 1N0UA 2U1AA 3C16B 3Q8UA 3RR7A 1R89A 1M90T 4R8UB 3J7A1 4ED5A 3MMBB 4LF9F 4LF7F 4C3LA 2RD5C 4F36A 2XLKA 2CNKB 1NJWA 1AROP 1NU4A 3VHQA 4GKKJ 1S79A 4WXWA 2KZZA 4NPOA 2E9RX 3HXMA 2MY7A 4IG0B 2UXBJ 1JK9B 4ZP9A 4Z37A 3NGTA 1TZ0A 5J2PA 4RW8B 3Q2SC 3IG1A 1FI4A 5GVQA 2F40A 1QAJA 4JV5F 1HARA 3GMGA 4JP8A 4LR8A 2QJ3A 5DG8A 1S49A 5HMYA 3SDEB 2LQBA 1KLMB 3H7HB 1QDUB 2YKMA 1KVJA 4NLDA 3TA1A 4N76A 3OXLA 1SKRA 2OD4A 1RB0A 2FDNA 1NMEB 2WVDA 3OLAA 4HKQA 3QJJA 5L9NA 3KLHB 1AFJA 4LFAF 1J2VA 5HI7A 3ZZPA 5D3GA 3I96A 5KT7A 2I9SA 1CULA 4TY9A 1XNRF 4ZPAA 1EKSA 1Q81T 2YQ3A 3BQ1A 1RGVA 1WDTA 3D6TB 4ANCA 4MYTA 1FRMA 3FZ2A 3MWBA 3PW2A 5HVGA 5A2QY 2XNRA 3AT1B 1V3RA 1CC8A 4OJHA 4F50A 2C3UA 2JLFA 1MWYA 1SI9A 2AYGA 3OL8A 1QSSA 4ZP8A 3UD5A 2HVZA 5HJYA 3HKZD 4ZLJA 1UJ4A 1D9AA 3LP0B 1U7LA 2JJ4D 3EVWA 2DY1A 3TUPA 2ASDA 1Z4UA 5DG7A 4EI2A 1HQ2A 4ZVPB 3EPIA 4YEAA 5B0GA 3FZBA 4LJMA 1U1LA 2D3UA 1IBCB 1UEUA 2H3EB 2HQGA 5D15A 4W92B 4WE1B 3M2UB 1KVIA 1QD1A 1IKYB 1T9YA 4KIAA 1R8CA 1WC3A 3FSXA 2BVZA 4IFYA 4TY8A 3KLGB 1FESA 4TN2A 4FYVB 2DH8A 1LNQA 4Q2MA 1RTDA 4O3PA 1KQKA 2FGCA 4U7CA 1SQEA 4F3QA 5HLFA 2FJVA 4DSFA 1YITS 3U7JA 1UAWA 4A47A 1RSCA 3VAJA 2ABYA 3AOCA 2IRYA 1TKZA 3HULA 3UDEA 1JXEA 4MKVA 1M1GA 2Z30B 3THPA 4DR2J 3W7BA 4Y2MA 3ZZ0A 2P6TA 4KSEB 1JLAB 3JSMA 2SXLA 3PKYA 1RLCL 1VQNS 4OYBA 1N5VA 1IBLJ 2GMHA 3NEKA 2G2ZA 1BMQB 3EDRB 1VBZA 4KHRA 4UOFA 1LXNA 2XI3A 4ELTA 1NH8A 2HHPA 2V8HA 3CIMA 1FCAA 1BQMB 1F3VA 4G1PA 4M5IA 1RISA 2N7CA 3I56S 2LXFA 5HMXA 3DOKA 5F0UA 4TQSA 5HP1A 2Q6BA 5IT4A 1HD0A 2EWHA 4ER8A 2DRBA 4UUXA 4DUZF 1YZ7A 4DUYJ 2ZBPA 4ETZA 2P8IA 1RKJA 1OQ6A 4G6VB 3PX4A 3DGPB 4V19X 4DSKA 1IKWA 1BLUA 3AAWB 3IBCB 3GJSB 2DHGA 2RQCA 4X62J 2XHCA 4NLWA 4CNZA 5KFMA 4QIGA 3K0JA 4NCAA 3H90A 3RUBL 2B4OA 2CIMA 1FT8A 2ERRA 3JTPA 1O6XA 4PRFA 2F4FA 2RHSB 4CLLA 4WK3A 1NM2A 2OPSB 1HLWA 3HMJG 4LF4F 4FZVA 3M05A 3N28A 3AODA 2CJBA 5ETVA 2BOAA 2UXDJ 3T5KA 2XB2D 2O67A 2VJVA 5H1SV 2QA4S 4PXBA 1PGZA 3W9JA 2W2MP 3ZZOA 2HNYA 3WX8A 2PDAA 3SQGA 5GAHU 2DNKA 4PQUA 5D4PA 3NKYA 1OPZA 4Y2AA 1C4CA 2MJUA 2U2FA 3LALA 2BEFA 2ZITA 2AX0A 2LU1A 1Y3JA 1XK8A 2CQ2A 1NHKL 4GC6A 4CLTA 3MD3A 5LMNJ 2KRBA 1AA1B 4MTPA 1MN7A 4GKJJ 3BQ0A 4RU9A 5FLXU 1U4BA 3FQKA 1VQLS 5DO2A 1Y3KA 1JLFA 1U1PA 3TA0A 2UP1A 2HHXA 1CJVB 5SUHA 2YX1A 4ZPWR 2A0FB 1VYAA 5CCLA 3HHNB 1H3DA 4USKA 2HVIA 4NEZA 3RR8A 2HHVA 2VD3A 1HA1A 1HBNA 1U2FA 3HSDA 3E2EA 4JV2A 4YB7A 2XS7A 3M2VB 2JEFA 4AFFA 5FD1A 4KBIA 4A8XA 3HJVA 4R5PB 2PMWA 1S48A 4OZ1A 4J9SA 2RS2A 3D66A 4FBTA 3VF0B 2DNHA 2BV3A 3JXOA 2B0GA 1HMVB 3TAMA 4WWSA 4X2BA 4K4WA 3MCSA 1SUQB 2IBOA 4X66F 1S4FA 2Q43A 1MROB 1HQEB 3RAXA 1JLGB 4AQYJ 4WYWA 4NWBA 3CDBA 2JOQA 1TL1A 1NLKL 2LKZA 2HGLA 2ZDPA 3AD8C 1TL3B 4AUKA 1J27A 4IRDA 5E2QA 1NKBA 2UUBF 1F6TA 3MM8A 2AF6A 3PRVA 2N4DA 3MR3A 1VFJA 3QT5A 3TOQA 3CO9A 4ED3A 1XTZA 4LBHA 4B9MA 3BBCA 3M8PB 2J0WA 4LF6F 3IRWP 2AJ4A 1SH0A 3HZGA 3W2VB 2DGSA 1P1LA 4F4AA 3V4IA 5J1NA 3FQLA 2DNNA 5AT1B 5A8RB 2C2NA 2XULA 3MCNA 4KQZA 1KC8T 1LW2A 4ZPBA 2EC0A 3VGUA 2W25A 5HATA 5A0YB 3GTYX 4X64F 2BW2A 3NGRA 4CIOA 3NWGA 2QRRA 3RG6A 1UZHA 5IT9Y 4X4VA 2YNIA 3LAKA 4WPAA 3NAHA 4ICLA 5KG1A 4G3IA 2CPFA 1N5SA 2MKJA 4GVLA 1MSWD 3OL7A 2Y3YA 3W5XA 2QIFA 3PRBA 3Q8RB 2E1MC 3QYYA 3RB4A 3UCGA 4RNMA 2AKWB 1U0HA 3M2RA 5F8IA 4TLRA 4C0BA 4JI5F 1S59A 4QCLA 3NS7B 2HLUA 3W63A 3C6TA 4HDHA 3FBCA 4ZVEA 2A18A 3KJVB 4OI2A 2RNEA 2R8IA 1TQLA 1YTYA 2CQ3A 3BH7B 3RU0A 1Y7PA 4WFZA 1S6OA 7FDRA 4PQAA 2GX8A 3H5SA 2OD6A 3QIDA 4OLPA 2H51B 4JUZA 2G9OA 2HBRB 2J0SD 2D3O1 3ETOA 1H6KX 4KO0B 3W2WB 3JSYA 4M5GA 5KG6A 4AL6A 2VPXB 3GP9A 1KHWA 4KGVB 2ADCA 1V5VA 2BRKA 2XMKA 1KR4A 3A3NB 4ZVSB 4I4BA 4HEA9 2AGPA 1FNMA 3C2PA 1CJKA 4BBYA 2XMMA 2UUWA 3UDCA 1NJXA 5HROA 1FRHA 1S1TA 4M5DA 1WELA 2BJ9A 1RT4A 2GVZB 1VCTA 1S1WA 1IM4A 3JSBA 2CNNB 1UZDA 3UVJB 3DU5A 1SQGA 4RNOA 2XQCA 1T8EA 3RJMB 2RF2B 2OMLA 1YWXA 4AL5A 5F41A 1N32F 1PO6A 4KC5A 4WXOA 1RT5A 2R7SA 3PIOQ 1DRZA 1OQ3A 1GMWA 5M2RA 3ZTRA 4B3MF 4OI0A 2MSSA 3M7VA 3GJTB 1YGYA 2RSQA 3LPYA 1ZTTA 2F9DA 4EUVA 1SIZA 3GJQB 1GX6A 3HSGA 2HRTA 1FKOA 1KBRA 3D67A 5J2MB 4K0KF 2YQ0A 3FVYA 1UW4A 2DB1A 1X4EA 3CJQA 3BDPA 2UXCJ 3GCWP 3PFEA 4C8LA 2NQPA 4B3SF 2B56A 1UP1A 4F4ZA 1ZETA 4EO8A 3G8SA 4KGKA 5FIIA 4EGLA 1C1BA 1MG7A 2KJVA 5I42A 2WTFA 4IDKA 2ZH3A 2V0NA 2XGPA 1QUVA 4LF9J 4LF7J 4DHVA 1B7FA 4OYOA 2WCXA 5LM7E 5K9FA 1ZAXA 3CT9A 5DQIA 2CQCA 4OYZA 3CJSA 3B82A 3KFWX 4YY3J 2QLXA 4EFAC 4JI0F 2ADBA 5L38A 2AJFE 1HNVA 2I5JA 1ZA2B 5DDRC 1M5KC 4DSJA 2E9ZA 1JQGA 3AB2B 1N34F 2HQDA 3UFCX 1D9FA 1G1XA 5L9XA 1MNEA 1JXLA 2PD1A 3BBFA 2V2ZA 3HFKA 4DN9A 2J0QD 1J5EF 4ILRA 4ZMMA 1VK8A 4KGXB 2DH9A 1LQ9A 4CLFA 3CC2S 2VC1A 3E51A 1TAUA 3GIJA 2NYHA 2HURA 2IM3A 1WKKA 3MEEA 3R1LA 1WUUA 1FNOA 1XJWB 5CXTA 2E7VA 3I6PA 4LFAJ 1ZAWA 3C46A 1R7IA 1XNRJ 2QA2A 1N5QA 1M5SA 5AJ3F 3Q8VA 2GIFA 2EFOA 1Z2ZA 3D54A 4USHA 1FDDA 1T3NA 2BANB 1MU2B 1JLBA 5GMEA 3H40A 3EGZA 4BWMA 3K17A 1U1OA 1QM9A 4I56A 2BKOA 1X4BA 2QN6B 4O4RA 5IM0A 3OR2B 3WHIA 2B9YA 1L3SA 1BUXA 1VOMA 3KJNB 2DCLA 5HN0A 2VA2A 4UOGA 2C42A 3OHAA 2GGPB 2JH3A 4C8ZA 4B3RF 1AXQA 2DNOA 4A46A 3EXCX 2DO4A 3PRDA 3K2YA 3JYTA 4DV2F 2R7XA 1QE1B 2HNDA 5F9NA 1NPRA 3CVKA 3KK2B 1TVRB 2CPXA 3MM7A 1U2RA 5DDOC 3CB4A 2L9DA 2G0CA 3M8SA 5KOWA 2HFVA 2G1DA 2MLZA 2M7SA 1D1UA 4GO7X 4NLSA 2ACMA 3QNWB 2ASYA 1IQTA 1EZZB 3US5A 4ILLA 3GR0A 2E5IA 1RU1A 2W7OA 2G0JA 3U1LA 3MUTP 3MXHP 4DV7F 1U26A 2GO8A 1KSPA 4PPZA 4UUWA 1EP4B 2CNOB 1Z2LA 1ZA1B 3ITHA 3DLGA 1RYRA 2EEYA 4JYAF 3BGRA 3UI3A 1X9MA 1NNDA 2CPEA 1C1CB 3QT7A 4F7VA 1R8AA 2H5IB 2HSEB 1H73A 3EWGA 4OHWA 5A2QU 2Z8QA 1X5TA 2GJIA 4I7FA 5BXIA 1TKXB 2M88A 3LANA 2HNZA 4C2MA 4PWDA 2ZZMA 4DV6F 2D41A 4UY8T 2QC3A 2ZHAA 1X31C 3TVYA 3DDKA 3DHXA 4FVMA 4ECQA 1X4HA 2G4BA 4BS2A 3ENAA 2BOPA 4PYDA 2PMHA 1JIHA 2F8EX 1R0AA 3GU0A 4QOTA 2KL8A 4UOCA 1RT3B 3FCHA 4FS1A 4M63A 4P2SA 4PCQA 4OX7A 1R6YA 4DUZJ 1VQ8S 1REVA 4N77A 3VZHA 2IVYA 2C2OB 3CD6S 1FRLA 2DNQA 3IRXB 4ZS6A 2IC3A 3BGFA 1S1XA 3MPYA 3PHEA 3OJUA 2K1RB 3I0RA 4O3NA 2Y1LB 1YJWS 2NS1B 4ZVOB 2C2EA 1BWEA 3TAQA 4QU6A 4A8SA 1S9FA 3CDUA 3IM8A 2I1RA 2WBMA 1F9HA 2JWNA 1U8WA 4QR1A 3DRRA 4ZCLA 3H0PA 1B0TA 4LF4J 1HWUA 3OQ2A 2DHXA 4UQGA 4C8OA 1RP5A 5G0RA 4E2FB 5M2PA 1G7CB 2YKQA 2POKA 1VQKS 4PXEA 3OBIA 1NAQA 3J81j 3FJ2A 2DXDA 4NLRA 2VZ9A 1TFYA 1VLYA 4WZMA 2ZNZA 1IVZA 5BYRA 4MK7A 4K4ZA 4OZ5A 5HJXA 1O5JA 1UJ6A 2FJWA 2PT0A 1CLFA 3VWSA 3C19A 4LRFA 1FKPB 4RO0A 3OSNA 3M30B 1URRA 3BO2A 4K5RA 4QWDA 3CJ3A 4NCBA 2X3DA 3MM6A 3QLHB 1U1MA 2JVOA 4ZHRB 3A8IA 1L3TA 3UWTA 4XO0A 4CP5A 4ZJLA 5EDWA 4A8MP 1KQGB 4DX5A 3LW5C 4NXNJ 1RZMA 2OPRB 2IMOA 1NK9A 1HI8A 1T03B 3N4WA 2RAQA 4QR2A 2OELA 1FRJA 2RH3A 1BQNB 1JLEA 2IMWP 1WJ9A 3CE8A 1HBMB 2C3MA 2GC8A 3CMES 1CJTA 1CSJA 1V6HA 3HD1A 1DTQA 3NGKA 1HHSA 2BE2B 1Y10A 5KOXA 1YHQS 3TA2A 4LR9A 4L3NA 1KOHA 3MCOA 2V9KA 4H4OB 4F3MA 3NCRA 5DGAA 4HACB 3DRPB 3SV4A 4Y3CA 4DN0A 2VBYA 3W62A 3MAHA 4WFXA 2I2YA 2EFGA 1X0FA 2M0GB 4X66J 1PCAA 5HQ8A 1DLOA 2R2UA 4DL5A 1JJ4A 1RHRB 2ZE2A 1F2HA 4XDDA 5LOQA 2JZ5A 4OI3A 3JAMY 2F9JA 4KT0C 1UWBB 1WC1A 2ZOFA 1KD1T 4ZLNA 2UUBJ 1VC0A 2K8GA 2ZZNA 3ZTOA 5F8HA 4I6YA 4OZ0A 2PA3A 2MZTA 3R2CJ 3PG9A 2P2CB 9RUBA 2C3PA 2QT7A 3C8YA 2ZHOA 3AB4B 1IM6A 4CM0A 2DGOA 2R7TA 7AT1B 3NS6A 4LF6J 1GMUA 3MURP 3NXZA 3E01A 3B4DA 2E7XA 4C3KA 2R7OA 2GHPA 3DOMB 3ZZZA 2XCPA 2V4QA 4LR7A 3FKBA 2DK2A 3TVKA 1FRXA 3D1QA 5A6WA 5KG3A 1M1HA 4ECYA 1GXTA 4DFJA 4L6V3 4CLYA 1JLQA 2IFXA 4RNHA 2FPHX 1FKAF 3CJ0A 4HTJA 2KXNB 4X64J 5KT4A 3MEGB 1WD6A 2FD2A 3ET6B 2CG4A 4DBQA 3J7ZT 1QSLA 2MZ1A 2QL5B 1IJFB 1OO0B 5CH7B 2C22A 3KK3B 1Q16B 1RHQB 2D69A 2PSZA 2DGUA 3L09A 4NA3A 4UZBA 3PACA 2ZFHA 3A1YG 1G3OA 2L9NA 2WOMA 3LTOA 1JKHB 1BY9A 4JI2F 1YK9A 4KKOA 3TX8A 4P52A 5H9EJ 3MM9A 1ULRA 3G71S 2H9ZA 3NGSA 4BLGA 1SKWA 2J9DA 1R0BG 4MYUA 3TO8A 3AQOA 3R9LA 4OX9F 4NASA 4JI5J 3OR1B 3DI6A 2KDOA 2HQCA 4YHHF 3RB3A 5HVHA 2CPZA 1KP6A 2D3OR 2FLOA 4LIWA 2DKOB 1TKTB 1KN6A 5KG7A 2HZVA 3GIRA 3HT0A 2YH0A 4U67Q 3N9UC 3HDSA 4RNNA 3CGIA 4NZ7A 2FJAB 3KK1A 1FRKA 4ZJQA 2AJ2A 3R7BB 2MZSA 3ZZRA 1XN9A 3LP1B 2E5JA 3L9ZA 3MMBA 4J90A 3ZXWA 2IDLA 3QO9B 5KFJA 3X3UA 3OVBA 4USVA 2XY6A 2Y0SD 5D8HB 1S6PA 4N8OA 2R7WA 3PFOA 4DV4F 4DQSA 4NXMF 1N54B 2EBGA 1HL6A 3P8BB 2W01A 2JEGA 5IT9U 4IG0A 2BDPA 4HTIA 5HANA 3DGVA 2W24A 5J2QA 1VBKA 2MDAA 4F4XA 1HNZF 1X7VA 5KT2A 2O01C 3P5TL 2RRBA 2VQFJ 1NKCA 3CJ2A 4HI1A 1RWMB 3O8WA 4MKAA 1UWAA 1WHYA 2QG9B 2DNLA 3SDEA 2OFGX 4G1QA 1N32J 4K4VA 1T02A 2NCKL 1S6QB 1PBUA 1RTHA 3L7PA 2C2MB 2HGMA 3M8QA 2I6WA 1PIEA 2YWWA 3RW6A 1K8AT 4B3MJ 2E66A 5CA5A 4DU8A 1IN0A 4QYZJ 2LQ5A 1N5TA 3MEDB 2WW8A 1T9UA 3MAQA 4IFVB 1FDBA 1EETB 4K0KJ 4PEOA 5IC6B 1H7WA 5GAGI 1S1VB 3ENWA 2MZQA 2AEFA 4PUOB 1UEVA 4B3SJ 2ZC4A 4OJ3A 1UKUA 5AXMA 2YNGB 4NZ6A 4CRJA 3O6QA 3PYFA 4DQRA 1DQ9A 3A12A 4CO1A 4Q7AA 4PXCA 4F8RA 1N52B 2VFSA 4F0KA 2K3KA 3MECB 1OYDA 1K0VA 2DNRA 4EO6A 2B8QA 4JI0J 4J9OA 2B43A 4F02A 1PYOB 3P3DA 3M32B 2IJNA 4JI3F 4C48A 4QBUA 4PWWA 3G6XA 4YDXA 3TJAA 3MUVP 2IAJA 4GVBA 3JB9k 1QAXA 1RTIB 3VGSA 5LL6d 1HI1A 1Q1KA 2J6UA 5B08A 2CQ1A 2R2RA 3SCKE 5FDLB 5AE3A 5AXNA 1I3OB 4YB5A 1YIJS 4DQPA 3KLGA 2ZUAA 2ASLA 5J2NB 3UNGC 5KFLA 4WYLA 2G0IA 3GG0A 2XY7A 4QW8A 2J7KA 3HZEA 5DETA 1URNA 3FSYA 3IR7B 2VFTA 3JQMA 3GFHA 5AJ3J 2C28A 2OEKA 1M5VC 1X4CA 4ENOA 4RBUA 4C98A 1F1BB 1UW9A 4DFKA 3EUNA 3N5FA 3QGHA 3F44A 2MGZB 3OLBA 4UT4A 3X1LB 2XHWA 3R7NB 3I32A 4OX6A 3S1TA 4I6AA 1S7HA 3SCJE 4KGMA 1VQYA 1HD1A 2HVHA 3V6HA 3HFZB 2AGOA 2CJXB 5CYMA 4H4MA 2GIRA 1S72S 2BE9B 2R7VA 1GMWD 1SJ4P 2WB4A 1U09A 3ISND 1SH3A 5KFTA 3BJYA 2ACYA 4D3GA 1QAIA 3MM5B 2OAUA 4PWUA 1TELA 2GZOA 3G8QA 4DV2J 1S77D 3QRQA 5HSPA 4C4WA 4CYUB 2V63A 4LUBA 2KYZA 2DR9A 1KLNA 4IH7A 1HIYA 5C42A 3OUYA 2B4PA 4M5HA 1MWZA 3S8SA 3SCLE 5IZHA 2I38A 4LQ3A 3QIPB 3DC2A 5B0EA 1FD2A 3RAQA 2LQ8A 3G2XA 2R7QA 3AH6A 1U02A 3I55S 1TL7B 1U48A 4QIFA 3LH2S 1T95A 1AUDA 2XZTB 1EARA 2B7CB 1TTHB 2VV5A 4DV7J 3DM2A 1FO1A 3BS9A 3EZOA 4NA1A 4DEZA 5D4OA 5KT3A 4JYAJ 5LSRA 1C4AA 2J76E 2MQMA 4UZCA 4QWAA 3TUJC 2MKHA 3QAUA 2HAFA 4RW9A 1WC5A 2FHMA 3LP2B 2D7SA 1A0OB 3D68A 1S0OA 3UO0A 1NUEA 3CEDA 3NBPB 4DV6J 4PYAA 4LSZB 1HQUB 4U9RA 5K20B 3HHLC 2E5GA 3H4BA 1TR0A 4ES3A 1BHNA 1NDPA 1NHUA 2XMAA 1RADB 4ECTA 2OO4A 4IG3A 1Y00A 4ECUA 1L5UA 1Y0HA 2QSWA 1FTCA 2KM8C 1G6BA 1UFKA 4NZ0A 4K4TA 3ULHA 3H98A 1HYSB 1H2TZ 1IBKF 1KNZA 4ATNA 4NLXA 4QIVA 4TNOA 3CIZA 4ZPDA 3BYPA 5HBMA 1VBYA 2P9CA 3A3OB 2ILYA 3HSZA 3W60A 2Y8WA 2KH9A 3L7OA 4DPWA 3KMQA 3RZAA 3CC7S 3F41A 2ZD1B 3BH6B 2Y1RI 4P9SA 2DJWA 2M8HA 1U6BA 4CM2A 2IM1A 4LSLA 3QJLA 2IYIA 2LA4A 1HNIB 5I3PA 4P74A 2OFHX 5B0CA 5C24A 4A4JA 3V81A 4Q8FA 2RT3A 3CD7A 5SZTA 1H7XA 2RHQB 3IS9A 3G86A 5JVHQ 2HFZA 1HPZB 5ETOA 1LWEA 3BR9A 3EGWB 5A6PA 2CZVC 3MAAB 4ZP7A 2CQ0A 1CQMA 5KAKA 2BX6A 2WZ1A 3AD7C 5IT0A 1LW0B 2MZJA 3Q8YA 1HKAA 4OYXA 5FLXY 3I4PA 4WTOB 4UQTA 3HM9A 3EZUA 3U27A 3TX0A 5DM6Q 1GT8A 2WB1D 5E5NA 3D1OA 3R27A 4YS2A 4K50A 2VOPA 3M8PA 3NGUA 4LT6A 1KWMA 2XMJA 2Z4PA 2CWKA 4PPDA 1RJJA 2Y0BB 2XMVA 2VG6A 4DR4F 3A3PB 1U25A 5THWA 2MEWA 1GXLA 1ZYQA 5ETSA 3TUZC 1RXOB 1WKJA 2DPJA 3IG1B 5LJ5Y 3CO0P 3FFIA 2R3VA 4FYYB 3V4MA 2VG5A 1QTNB 1EX8A 1DTTA 1YKWA 4L73A 2O3DA 3JSRA 3R5AA 3KMSA 2M8DB 4DPUA 4UF4A 2YKMB 1IR1A 4ELUA 3Q8PB 2DRDA 3QWUA 4AL7A 4X4QA 1BQXA 3MZIA 1PAUB 4B3OA 4WF9Q 1WG1A 2GA7A 5KFSA 5DLGA 2NXEA 1YRXA 2YX7A 2WVFA 4OZNA 2ASJA 2MKSA 3F0NA 4X4PA 4C7QA 1DZ5A 1A7GE 1Q8KA 2QEXS 1FA0A 2G1HA 3MOZA 2I8EA 2YPYA 2LECA 5B0BA 2KYXA 5D3GB 3IR5B 1CULB 2WSFC 4WFYA 4DI6A 1VQOS 1VBXA 2WRMA 3H2UB 2AJ0A 4ZLPA 2CAJA 1P1TA 1HWJA 4AE5A 2JDJA 1M0SA 4NYOA 1JLCA 1TUVA 1I51B 3M8WA 1KQSR 2A2DA 1Z1ZA 1X5SA 1GXUA 4KO0A 2QYCA 3G82A 2BJ3A 1Q86T 1LWFA 4V1Ak 2R8GA 2HWTA 1YJUA 2X1FA 4A8WA 3QZ8A 4PG6A 4RW4A 2D1CA 4O0IA 4QWCA 4IOAQ 5LMUF 3AJDA 2XGQA 3BSAA 5HMZA 1MLAA 4J9UE 4YFUA 5D0RA 2QMUB 4X4SA 4NYPA 2FJDB 3DLHA 5H9FJ 5IFMA 3O44A 4IFYB 3H5UA 2FVPA 4B3TF 4TY8B 3Q8QB 3T9NA 1MWQA 4AD6A 3TZXA 1RKIA 3JQJA 5KG5A 4X4TA 4C11A 2J7WA 4WKYA 1L3KA 4JI2J 2QLBB 1WI8A 4RX6A 2JEIA 5HLFB 1XMQF 3MR7A 2R9LA 2OEMA 3W8GA 4OX9J 1TKZB 1A9NB 4YHHJ 3QATA 2OH2A 5A8KA 2CA9A 3JAMU 3MPWA 2L3MA 2HAIA 2J7UA 1ZM3A 1QVGR 3ZNJ1 3JSMB 1LWCA 5FJ4A 2M5YA 3UNYA 3KHHA 3C14A 2BQ3A 3SBMA 2EVZA 3PDNA 4WFNQ 3GV8B 3CDAA 4OZ2A 1ZZFA 3ZC4A 4DDFA 3NCPA 2JX2A 2M4MA 4J37A 2DGXA 2B9WA 3N0VA 5CYQA 4ED6A 2F7VA 1K0TA 4JOUA 5JJBA 1NJYA 2AU0A 1M5OC 5KFXA 4OYAA 4UTGA 3RYLA 4DV4J 4NXMJ 3HX9A 1R31A 2LEPA 3W3SA 2QE5A 1PJ7A 3Q22A 4DX8H 2B4VA 1HNZJ 1S0VA 2FUG9 4LRAA 3N6MA 3VQSA 1NZ8A 5BYQA 2Q1LA 4OZ3A 4UY85 1GX5A 2CQHA 4Z7YA 1UFWA 2XNQA 3KJFB 1IKVA 5LXYA 1EJ7L 4ZN1A 2BKNA 2L41A 3C3LA 2DO0A 3BYRA 1HFEL 3U1NA 4M5LA 1WWHA 2D9OA 4QR0A 3K5MA 5IWAF 3NRBA 4OMFG 2HNYB 1X4GA 2NLWA 3SQGB 4CTAA 1TV6A 3OL9A 1PG5B 4I2QA 2RS8A 2RQKA 2E5LF 4PQUB 4Q43A 5HMWA 1YRTA 3ZZYA 2AYBA 3AOAA 3OV7A 1GQEA 2E1RA 3DLKA 5IXUA 2C2DA 3D9BA 2R8JA 4Q8EA 2MB0B 2V2KA 3KHRA 2MTLA 3BREA 1Q79A 3MDFA 3RB0A 2PC6A 5K14A 2W2NP 1K44A 4WZQA 5C7PA 5K8PA 2FY1A 1JLFB 2YWKA 4ETXA 2Y8YA 2VHGA 1Y9OA 3FEZA 1YX2A 4JI3J 3EGVA 5GAEI 4EBDA 4N5SA 3HT3A 3I9ZA 2W4PA 1HBNB 2QA1A 2ZC3A 4DUTA 5EX0A 1N48A 1NJZA 4C97A 1RAJA 3V6JA 3BN7A 5DQGA 1TVRA 2ZKTA 1Q7YT 4CLKA 3A8EA 1BXNA 1ZAVA 3O1LA 5KFGA 3PX0A 5J1PA 1W25A 4IRCA 3AD9C 3IMQJ 2R7RA 1UA1A 1HWKA 2YY3A 4ILMA 4O3SA 1UEKA 1N33F 2CXEA 3C15A 2W2OP 4M8LA 3PEHA 4R25A 1LOUA 1HWIA 4DS4A 2Z0GA 3EICA 2LVWA 2BUNA 2MQQA 1RA6A 3HKWA 2JC0A 1FERA 3H5XA 1M5HA 2Z2LA 2JRSA 4ZVRB 4GMKA 3VCDA 3G6YA 1RT1A 4NX9A 4CO2A 3HVWA 2L48A 3NNCA 5DG9A 3KOAA 1FJGF 2ZJPQ 3AA9A 2APOA 3EGNA 4U8YA 1TUGB 3QGIA 2LP4A 3KLFA 2VASA 1WEXA 1TL1B 2Q3PA 1CJUA 1RT7A 4A8FA 5GADU 4MFBA 5K5MA 2WK4A 3MM8B 4KHMA 4X65F 3V6DA 2ZBQA 2EK6A 4M5MA 1KONA 2WONA 1JNRB 5D0HA 3T1HF 4FXWA 2KT2A 2QLJB 1RWOB 1RT6A 3R5CA 3DRYA 1BE4A 3V4IB 4R0JA 5AE1A 4Y2CA 2LEAA 2HHSA 2KM8B 5LJ3Y 4P6QA 2HIQA 1OSDA 4Z2XA 4B9SA 4NEYA 2MSTA 4NA2A 1F0XA 2BM1A 3IAS9 1LW2B 1SVDA 2UVWA 4WP9A 5JVGQ 4LREA 1WHVA 2AHOB 1VDHA 2YNIB 3A4TA 2XYHB 4ICLB 1P9QC 1OJ4A 3OFGA 3OL6A 2HS0A 2J6SA 3MMAB 1K73T 2FQQB 4E0DA 1RACB 2MY8A 4OV6A 2NSCA 4FXVA 3TARA 4LFCF 2FLPA 1NSKL 2N82B 2AZ1A 2YTCA 4A8QA 1HHTP 1JWWA 1U0HB 4NLPA 2DXEA 3M2RB 1V3ZA 3K58A 1HI0P 2BR0A 4ZVUB 5BJRA 3M6WA 3CCLS 2FHKA 2CQDA 1WEYA 3K59A 1FWPA 1NHVA 5L1KA 1NK7A 5F0WA 2F65A 3JTNA 4KH0B 4BC9A 2EI5A 1IBMF 4CLPA 4J5OA 1A6LA 3FEXB 2GAHC 3J7Z5 4ANEA 2CQGA 4HHHA 1UMJA 4HT7A 3J7YI 4NRUA 1X4AA 2BM0A 4LBIA 1AZSA 5GMKa 4J9PA 1VIXA 1CJKB 3ZO7A 3I5BA 2MKKA 2DISA 4Y6IA 1ZS6A 1VS3A 5HROB 2GCFA 1S1TB 4M5DB 2H4WB 2GIQA 3H8YA 3LGMA 1RT4B 2XC9A 1OPIA 1S1WB 1YBAA 1N4LA 3EYZA 2IHR1 4PKDB 3UR0A 2ROEA 2V6AA 2IJRA 4ZVGA 1NK6A 3Q0AA 3LUYA 2AYMA 1OY9A 3GE9A 3GLJA 2CQBA 2RDIA 4PG7A 3MUMP 5K8NA 1XR6A 2BJ8A 4CQ1A 5I3UA 3DLLQ 2XYPB 2QO3A 5F8LA 1SC1B 2W7PA 1RT5B 4A8KA 1NKEA 2ZHBA 4HYKA 3HVTA 4HACA 3PM9A 4DR1F 1RAOA 2XTJP 1YJ9S 5LXRA 4KR0B 2Z2ZA 2K06A 2H5EA 3L7UA 4P71A 4B02A 5E33A 1FKOB 3BF4A 1HBOA 1CVJA 3S7RA 3J80Y 1FJEB 1AUSL 2WHOA 3NWRA 4TYBA 1WG5A 2YH1A 5ADZA 1C1BB 2HEKA 5I42B 4IDKB 2BJEA 4FXDA 3HP6A 4MIWA 3KWMA 2CDRB 1LXJA 5KFDA 1XQIA 1NDKA 4EYIB 4OLOA 2M52A 1M1KT 3N6LA 3DDNA 3W61A 3BV8A 1E6YA 2HHHF 2YPZA 1MMLA 2VONA 1HNVB 2LMIA 4DR4J 1RABB 4DR7F 2I5JB 2HRUA 5KFAA 2IVMA 2VFRA 3B4MA 4KV8A 3QWPA 1HNXF 3AJ2A 3CPWR 3C6UA 3R5DA 2YNFA 4Q5VA 1NK5A 4USIA 5C25B 2NPFA 3PO5A 2KJWA 1FFWB 1U6FA 3IC1A 2N4CA 2CUYA 4Q2LA 1B0PA 4B9LA 5T7LA 4WFBQ 3PJ9A 4XTTA 2VDHA 5F8JA 2VL1A 2J9EA 2CJKA 1C0UA 4I2PA 3MEEB 1WTBA 2AJ1A 4F2SA 1UVLA 5KFVA 3R1HA 2AJQA 1T9TA 4WU3A 1Q8BA 2VG7A 2VBZA 2VB6A 4LF8F 1WTFA 1X60A 3WZ0A 4K5SA 2W8KA 1JKHA 3LWMA 4DG1A 4NMXA 1T3OA 3M9NB 2GVDB 3V6KA 1RHUB 5M2UA 1U1RA 3RW7A 1VGYA 2XI2A 3CTRA 2A6OA 1JLBB 2QYGA 6FDRA 2VBWA 3DXSX 3RAMA 4QIEA 3IXQA 2XS5A 2KI2A 3KXDA 1C0TA 5IM0B 4YR0A 4XPEA 3W5YA 2GV1A 3QRPA 1D09B 2W9CA 2OIHA 4FNHA 2ZBCA 3JYTB 5E41A 3HPOA 2W8LA 1UFLA 5T41A 4B9VA 2DNGA 1VHFA 3MI7X 2J5AA 2HNDB 5LMUJ 1YI2S 3I87A 1RWXB 3MM7B 3SFUA 4HH1A 3UE2A 1OYEA 1ZPWX 1FE0A 3M9OB 4C0HA 1CBKA 1TL4A 2ZUGA 3I0SA 1ZH5A 2CPIA 1Y5IB 4B3TJ 3WC0A 4NCGA 3TRGA 2XO7A 4U7UK 2CVEA 1I1GA 3PW4A 3DHWC 4DX7A 4DMZA 1XMQJ 3O3LA 3T3FA 2R7UA 2A3JA 4DR6F 3HHLA 1GTHA 2XZWA 3ITHB 1F5CA 3BGRB 4DSIA 1NB2A 2RRAA 1KKHA 4ES1A 1JXVA 2E5HA 2W9AA 2UXDF 2AT1B 3FK4A 2ZVIA 4I7FB 1RAIB 4CLUA 4IFVA 1HBUA 2HNZB 3EX7B 3DRXA 1VQ9S 4PWDB 1PILA 3GYGA 4ZOSA 4H54A 4F67A 1Y5NB 3R97A 3GB0A 2PE8A 5ITHA 3DYAA 4LFBF 2YNGA 2C3YA 4FNIA 2KKHA 1K1QA 2DYAA 4FF1A 1RWUA 3N01A 1R0AB 2CJQA 3MCMA 3TJ9A 3IN5A 4RW6B 5GADI 3VAIA 2RUSA 4I0WA 2K2PA 4J9VA 2UU9F 2XEXA 1REVB 1UVKA 5D77A 4FVCA 3W65A 1HR0F 2XO6A 1RWVB 5BYSA 5DZ6A 2R8HA 3M32A 2X1GA 1J5OA 1FF2A 2IC3B 4WIQA 4EU0A 1S1XB 4MMOA 2UV8A 4YB1P 2RDDA 3I0RB 3UD4P 3BEGB 2OSQA 2JFDA 2JVRA 3TVZA 1VMBA 4RW7A 4L74A 3TAPA 4RLEA 1I94F 3D6FB 2BJDA 3CUNA 4JI8F 2GJ2A 2GS8A 4OYWA 1RWWB 2J9CA 3PR5B 1SBRA 5HAOA 4DFPA 2JNJA 3HJFA 3LF0A 1VQ6S 3DRRB 4N7TA 4DV1F 2XLJA 3SEOA 5L46A 3FNNA 5G0RB 3CD0A 3NP5A 2OI2A 5IWAJ 4NL5A 3OFEA 2V4JA 4K2JA 4ZCKA 5DQHA 5EN1A 2DHSA 3QZ7A 2E5LJ 4K8RA 3BKTA 2GFFA 2ZDOA 3R7SB 1YJVA 1FK9A 4QZVB 2HRYA 4RL1A 2AX1A 3DU6A 2EG2A 2FVQA 1IR0A 2BA9A 3CCJS 3CCUS 5ETKA 4K4XA 3MM6B 5L1LA 3FEYB 2NPIA 3L3CA 1H72C 1UPMB 1VC5A 4P7TA 3FUYA 3T1YJ 2G13A 3AOBA 3DKDA 4LRBA 1SC3B 3QSYB 4F04B 4A8YA 1DY3A 1V5IB 2WSEC 4C8KA 3M8RA 5A76A 3FCVA 3WX4A 1JLEB 3CCSS 4NI2A 4B9TA 4CYUA 1QLNA 4MT1A 1R6VA 1GTEA 1QTMA 4ID8A 3NNAA 3GCXP 4KRWA 3T5JA 3CXCR 3LWLA 2IA6A 3KUGA 4QYRA 3GYNA 1CJTB 1FXRA 1SV5B 4CWBA 1SJQA 1VRTA 3TZWA 1DTQB 4DPOA 3HVAA 4P2MA 3D6HB 4CLZA 2VICA 1PSDA 1TMJA 1N33J 1X5PA 1R0CB 5CZVA 1S76D 2W1BA 2GNKA 5KFKA 1S9GA 5IV3A 4ZVHA 4EYHB 4HLBA 1DFDA 1S1UA 1IWGA 1E6VA 2MLYA 2ZNYA 4D3HA 1KHVA 2BE7D 5DDQC 4M94A 4L76A 1L3UA 1DLOB 1YJNS 2QFJA 4S0MA 2ZE2B 1WC4A 4YQWA 4Q0BB 2QSFA 4WBFA 3ZZTA 4NLUA 2HWHA 4HDGA 4X65J 3NBPA 2CG8A 4WCEQ 3HHKA 5B0FA 2NXNA 3CDEA 3G4SS 3T1HJ 4ZITA 4JV5J 3E01B 2RQMA 3TZZA 2HFOA 2HK3A 5HQMA 1XIQA 1RT2A 4ZPCA 2VPZB 3BBBA 2P5VA 2V8VA 3CCMS 3BR8A 3GIIA 4DV3F 3SIPB 3CJKA 5CHCB 4F2RA 4MK8A 3DLEA 2XY5A 1Q5VA 2E1CA 2F63A 4URGA 4O44B 5KFUA 3KJQB 2RILA 1ITPA 1JLQB 2GW8A 2FHOB 2LA6A 3IAM9 4NOHA 3CCWA 4KFBA 4KHPF 4ZIVA 2RJZA 4IRKA 2XZDB 1FXDA 3M1VA 1RBAA 4I6WA 1N6QA 2AEJA 2YNHA 2ZD1A 1LFWA 2OLWA 2WOMB 2XSJA 3TW0A 2YKPA 3CW2C 4KKOB 3MM9B 4LFCJ 4GRSA 4OZJA 4IKAA 2W7AA 1GMVA 4DL6A 5ETRA 4K4YA 3PJWA 2EFVA 5GAHI 3DOLA 1RAGB 1I5OB 1RE1B 1RWPB 4DWIA 2W9BA 1IBMJ 1MMDA 3E8OA 5DM7Q 4EZ6A 1FEHA 3K8VA 4RPFA 2UXCF 3KK1B 1HW8A 3GFYA 4ZK7M 3LGNA 2MQ8A 5L8RC 4UW2A 1R43A 2RKIA 5KFCA 2K7KA 2KFZA 3UN3A 4LF1A 1QJHA 3UCUP 3RB6A 4HR2A 1QAYA 2QL7B 5EWGA 1KTVA 4OQJA 4J9MA 1S6PB 5MAOA 4DL0C 2ROGA 5ETNA 4YY3F 3UR3C 4PZVA 4DCJB 1WKLA 2FJXA 3MHYA 2ZH7A 1EQ0A 3WBZA 2FYXA 2BBEA 2B6AA 3GG1A 1SL0A 4CH0S 2M2BA 4TKTA 5J2QB 3GFZA 1N8RT 3ADAC 2O66A 2Y9HA 4ALZA 3IA0A 1F60B 3HO1A 2CDQA 2OPPA 3QFWA 5KFIA 3BSOA 2E44A 3LPEA 5EGYA 4G1QB 2W2QP 2R4FA 3BZQA 2KFNA 4FBUA 1RTHB 2DH7A 3POTA 2DT9A 3GSDA 1IKXA 1RK8A 4URQU 1B70B 2UZAA 3M8QB 4DR1J 1T7PA 4NLQA 3W64A 4OHXA 3MMCA 5F8GA 2KN4A 3CCVS 1VRUA 1OMSA 4ID5A 2XYGB 3OTDA 2VQEF 2DNYA 1OIAA 2OSRA 3CF5Q 4DX6A 3TWZA 2AWZA 3QGPA 1Q53A 2ZZTA 4H4KA 2IDEA 3P4UB 1OWXA 2LEBA 5F8MA 4ZPVR 4KTQA 1S9EA 1O51A 2HG4A 4YR2A 2GO9A 3DRSA 2HZCA 3WIUA 4RU2A 1CQNA 2YQ1A 3LA0A 4XK8C 2FVCA 1UTAA 3VAHA 4HT5A 2QMXA 1H2VZ 2DGQA 2ZOMA 1W2IA 1U2CA 1DHMA 1T11A 2GMLA 4USJC 3TQEA 2HHHJ 2BJ7A 4DCPB 3IGVA 5DJBA 1YSJA 2C2ZB 4DR7J 1HNXJ 1YG0A 1FWLA 2VU5A 3R6GB 3JTOA 2IAJB 4ZLLA 4GVBB 5KFWA 4LVNP 4DPTA 4OX8A 3NG8A 4DV5F 2DGWA 1TK8A 2HFUA 2ZBRA 2DR5A 2V8GA 2IVFB 2ZVSA 4WKRA 3EDQB 2CZ9A 4USMA 1N56A 2Y1JA 2DGTA 2HHQA 1TU0B 3NGDA 2UUAF 4YR3A 3F56A 2F3JA 3NS5A 3OSPA 4J9LA 2DEIA 2A6MA 4LF8J 3IFEA 4LRDA 1Q95G 5J1EA 1WC0A 1RTJA 3UD3P 1BWVA 4P7VA 1ICEB 1HNWF 1TAQA 2H4YB 3J80U 2G2OA 2H48B 2RUGA 3BN4A 4V19J 2A1BA 2HHTA 2AV5A 3M4XA 2ZOGA 2YKNA 3CWJA 3WIVA 3FSIA 3KLEA 1EQMA 2AIRB 3RRGA 4ZPTR 9ATCB 3ILJA 4X4RA 3OD2A 4X4UA 1S57A 3HFVA 4MIBA 5CYMB 4H4MB 2HHUA 3PW7A 5IQ6A 2AEMA 2DNZA 1T9WA 2BJ1A 3DMJA 2W4CA 2EW9A 3MEKA 1WHWA 5L1JA 3IR6B 2B4UA 1FX2A 1N5YB 3HK2A 1RBOB 1PJ6A 2UVRA 2BQRA 2LQJA 3MPUB 4KPYA 3O2IA 2ATCB 1OY8A 4DOZA 2I0XA 4PG4A 1LKZA 1QY7A 3OTEA 1RBLA 4U8VA 4O23A 2E9TA 3KLVA 4ZVQB 1P9YA 1F5BA 2CQPA 5C42B 3OUYB 3G87A 1UPPA 2UVVA 3P49B 3VGTA 1DQ8A 5E7OB 4F4YA 3QQCD 2AMCB 2HKEA 4JV0A 3AJ1A 3GILA 3W66A 3DNCA 2ZH1A 1EAYC 2YKOA 1W26A 2VBXA 4DQIA 1AW0A 1CS4A 1PKUA 3BGLA 3SI8A 1GH8A 1AT1B 1RUSA 1VQPS 4LSNB 2CYYA 4DZ6A 3DM2B 1NDLA 3S6EA 2NUHA 2XBPA 2MQPA 1RAHB 2YWFA 4DR6J 3W5ZA 1HW9A 2EFPA 1WNEA 1X4FA 2ZH2A 2NSBA 4ANDA 1IXKA 1NK0A 2HMIA 1N88A 3BPDA 4EWTA 5GMDA 4RW9B 3KUEA 1DJ0A 1KRPA 2RU9A 4ECZA 2B5JA 3IGNA 2W2PP 1RQ0A 2ZJQQ 4E8UA 2YKAA 1YBTA 3UN2A 2V5HG 4O4GA 3OPKA 5U47A 4ZP6A 4FN5A 2VODA 1WOOA 4RUCA 4LFBJ 1T05A 2MKCA 4IH6A 1WC6A 3KYLA 3GFXA 2QTWA 2DIVA 5KFOA 4IQMA 3PKMA 2W4DA 4USUA 2HYIB 3TI0A 5MLCV 3KNGA 1APSA 1DAXA 4IG3B 3L4BC 4DFMA 5B7WA 1JJCB 3UPFA 2JL9A 3KHLA 2UU9J 4LRCA 2YVSA 3GV5B 1HR0J 1R27B 2FTRA 5JXSA 4ZCMA 4NXNF 2V9WA 5AXKA 1XNQF 1FRIA 2DHAA 2VJUA 4OHYA 3CNQP 4AT1B 1Y4ZB 3MD1A 2VIHA 5HBMB 4FYWB 4QWBA 2XM3A 1XC9A 4JI7F 4B08A 3VGVA 4JI4F 3VAFA 5T14A 1I94J 4M95A 3CDWA 4C8NA 2B8PA 5C2GA 5H9FK 4JI8J 2B7BB 4M1KA 3MR5A 3EPGA 3OVSA 3PR4A 4LSLB 1LK5A 5D0GA 1Q5YA 4TYAA 5C24B 1YJ7A 3V81B 4DV1J 3PVXA 3CCQS 4MIAA 1IJEB 2VOOA 1VIOA 1EHWA 3IS9B 4ZVTB 3C16A 3CULA 4CO5A 1LWEB 4ECXA 4JI1F 4R8UA 2VPYB 2XS2A 5F9LA 4C8YA 1ZPVA 3VVTA 4DCOB 2BXJA 3GZ7A 3KDOA 5A8WB 2WVEA 1T9XA 5ETLA 5IV4A 1LFPA 3THTA 3R6LB 1RA7A 3FC9A 3TEGA 4K7QA 4WP8A 2F4VF 4WU2A 3HHLD 3J81Y 4WTYA 3QPIA 1P8GA 1H38A 4RW8A 1KTQA 3THVA 2PN6A 2EPIA 4QPTA 3T41A 2ZBIA 4IH5A 2H1YA 2VG6B 4KYZA 1U45A 4CH7A 1KLMA 1HWLA 2PFFB 4N41A 2V94A 2NUUG 4NE9C 4I69A 1FFSB 3FFIB 5KG0A 1Q7LB 2XCAA 2VG5B 3QSIA 1RI7A 2OKQA 1DTTB 5LSLA 2CZ4A 2JEJA 1K47A 5K8OA 1YVFA 3UN5A 3KLHA 3R2DJ 3M8YA 2HZAA 1SL1A 2P9GA 4FYXB 1S5ZA 4B3OB 1P27B 5EUHA 4JV1A 2IPOB 1NH7A 3N79A 3PV8A 2FB0A 3MMAA 3KLIB 1YJTA 3PEJA 5CD4A 4HL9A 4ECWA 3Q8SB 5B0AA 4C3MA 1B3TA 2ZM6F 3ILIA 3HHEA 4Y2KA 3MF5A 4F4WA 1EIYB 4DSEA 2X7IA 1U1KA 1JLCB 3LP0A 2CPDA 1UVMA 4ED0A 1N34J 2BZ2A 4OZLA 5CD4H 4ED2A 3QAEA 4OFZA 4PR6A 4C9DA 2VFUA 3D0GE 1RHMB 1SH2A 3G82B 2KVIA 1UVNA 1J5EJ 4AXJA 4F0HA 1V9OA 4WE1A 3M2UA 5IS2A 1LWFB 2ZH5A 2DPIA 4QPXA 1IKYA 2WSCC 2E7WA 1PC4A 4DV3J 2NR0A 2OP5A 3VALA 4RW4B 3D4JA 4ED8A 3BB5A 2FC9A 4LF5F 3KTQA 2OPQB 5E3CA 3EZ5A 2KB2A 3P6YC 3GV7B 4X4OA 2D9PA 2CADA 6AT1B 3R5JB 5L39A 3NOCA 4KHPJ 4M5JA 3D28A 2L08A 3NNHA 1LV5A 3IP0A 3IWLA 1D8YA 4TU7A 3K57A 5KFZA 1AYEA 1WOSA 1U6ZA 3T5HA 5KFHA 4EBEA 1NB7A 3K5LA 2BACA 2VQFF 1T94A 3K5OA 4C11B 3BSCA 3QJPA 2CWXA 2LFVA 2X3GA 4RWXA 2NYIA 2DIUA 1JLAA 2Y1IA 2EK1A 2ILZA 3T6BA 5F3ZA 2F8HA 2GMJA 3H5YA 5A8KB 3NOGA 2OHDA 4B3RJ 3KG4A 3CMAS 3QT8A 4ZIWA 1LWCB 2FVRA 1BQMA 3C14B 3VAGA 1SJRA 3ZZUA 1UVJA 1NPPA 1FJCA 2RDJA 4KJIA 3W9IA 3FBBA 2KO1A 4ZJOA 3ZTPA 3DGPA 1IQZA 1SJFA 1R8HA 3CCES 3FGVA 3A8JA 2GJFA 5CYQB 3FRYA 2IA0A 5RUBA 1KOOA 1JB0C 2DEJA 3UW1A 4A8OA 1VJWA 4OJGA 1GFWB 3P45B 4IR1A 1ZM9A 2C2KB 3V5RA 2OPSA 5C25A 3KDNA 2HQIA 1TK0A 2WAQD 2KTQA 3OTBA 2HS4A 2FLLA 3PTWA 1PBAA 1YQHA 3CJTA 1IKVB 4RUBA 1ELOA 1M5PC 1FHTA 3DFEA 3I5AA 1NXIA 5EWFA 5BR8F 5D0EA 2ZWOA 3K89A 3A8KA 1O8BA 4Y28C 2E1AA 4IO1A 3LAMA 5KFYA 8AT1B 4CTAB 1TV6B 3ZTSA 4I2QB 4DV0F 2UVUA 1XR5A 1H0HB 2QV6A 1TMMA 2VQEJ 3NMAA 3HSJA 4MKYA 1G4CA 2CPYA 2GVDA 4FYDA 3Q24A 3SCIE 1H98A 3DLKB 5ETPA 4OHZA 1CJVA 2UUCF 1QSYA 1T0TV 2HHWA 1NSQA 3CCRS 5K14B 3R8YA 2JHEA 3K8WA 3GSIA 2GQQA 3HVRA 1ZM2A 3M2VA 1WSRA 2AD9A 1S99A 4KGZB 2OTLS 2HGNA 3GIMA 1PAEX 4LBPA 2EC2A 4R5PA 1AB8A 1EKRA 3CJ8A 4DL3A 2V67A 2HK2A 3SYZA 3QRRA 4ECSA 3JS9A 3MR6A 4XPCA 4MH8A 4ZCIA 2N3OA 4DV5J 1VK3A 1FDAA 4HVZA 2B9XA 1HMVA 3MMJA 3T19A 4WFAQ 2MLXA 3I9V9 5F8NA 1H2UX 3KUHA 1P6TA 2ZH8A 2XMWA 1IR2A 2XWXA 5DDPC 1SUQA 2UUAJ 4RZRA 2X51A 3P96A 3PYDA 3C15B 2KT3A 2QZ8A 3D2WA 4TLQA 1MROA 1HQEA 2J0XA 5C5JA 1JLGA 1PC5A 1GAOA 3D0HE 2QFIA 4CO0A 3T1AA 3HHDA 5GAGU 2VDIA 1HNWJ 1TL3A 1VQMS 3PYEA 1RT1B 3I31A 1YJRA 4J9KA 4F25A 2ATLA 2VPWB 2OMOA 3E3XA 1VHIA 4FKYA 3KLFB
chains in the Genus database with same CATH topology
1CJKA 4WPAA 3C16A 1CJUB 3G82B 4USTA 4CLPA 1CJTA 1WC6A 4P2XA 3ET6A 4CLSA 3C15A 1WC4A 1AB8A 1CULB 4USUA 1CJVB 1WC0A 2GVZB 1FX4A 4OYWA 1Y10A 4OYAA 4CLUA 4OYOA 3C14B 5D0EA 4CLLA 3MAAA 4WP9A 1CS4A 4OYZA 4NI2A 1WC5A 1U0HA 4CM2A 1AZSA 4OYBA 4WP3A 4CLYA 3UVJB 3MR7A 1CJKB 1Y11A 1TL7A 4P2FA 5IV4A 3C16B 2QV6A 1CJTB 5D15A 4CLWA 3ET6B 4WP8A 3C15B 2BW7A 4OZ3A 2GVDA 4USVA 4P2MA 1CJUA 3G82A 4CLZA 1WC3A 1FX2A 1CULA 1CJVA 3MAAB 2GVDB 2GVZA 4USWA 1CS4B 2WZ1A 4NI2B 2W01A 1YK9A 1WC1A 1U0HB 1AZSB 4OYPA 5D0HA 5D0GA 1YBUA 3C14A 4OYMA 5IV3A 1TL7B 4OYIA 1YBTA 4CLFA 4CLTA 4OYXA 4CLKA 4OZ2A 4CM0A 3R5GA 5D0RA 3UVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJK A;  4WPA A;  3C16 A;  1CJU B;  3G82 B;  4UST A;  4CLP A;  1CJT A;  1WC6 A;  4P2X A;  3ET6 A;  4CLS A;  3C15 A;  1WC4 A;  1AB8 A;  1CUL B;  4USU A;  1CJV B;  1WC0 A;  2GVZ B;  1FX4 A;  4OYW A;  1Y10 A;  4OYA A;  4CLU A;  4OYO A;  3C14 B;  5D0E A;  4CLL A;  3MAA A;  4WP9 A;  1CS4 A;  4OYZ A;  4NI2 A;  1WC5 A;  1U0H A;  4CM2 A;  1AZS A;  4OYB A;  4WP3 A;  4CLY A;  3UVJ B;  3MR7 A;  1CJK B;  1Y11 A;  1TL7 A;  4P2F A;  5IV4 A;  3C16 B;  2QV6 A;  1CJT B;  5D15 A;  4CLW A;  3ET6 B;  4WP8 A;  3C15 B;  2BW7 A;  4OZ3 A;  2GVD A;  4USV A;  4P2M A;  1CJU A;  3G82 A;  4CLZ A;  1WC3 A;  1FX2 A;  1CUL A;  1CJV A;  3MAA B;  2GVD B;  2GVZ A;  4USW A;  1CS4 B;  2WZ1 A;  4NI2 B;  2W01 A;  1YK9 A;  1WC1 A;  1U0H B;  1AZS B;  4OYP A;  5D0H A;  5D0G A;  1YBU A;  3C14 A;  4OYM A;  5IV3 A;  1TL7 B;  4OYI A;  1YBT A;  4CLF A;  4CLT A;  4OYX A;  4CLK A;  4OZ2 A;  4CM0 A;  3R5G A;  5D0R A;  3UVJ A; 
#chains in the Genus database with same CATH topology
 3HF5 A;  1U49 A;  1NSP A;  3VQT A;  3W2V A;  1CJU B;  1RT7 B;  2RE1 A;  4MFB B;  3SSR A;  3G9C A;  3V6D B;  5J2P B;  4XDC A;  5A8R A;  2WON B;  3OXF A;  2DBB A;  1S0M A;  1QUP A;  2IRX A;  1RT6 B;  3D3C J;  1UET A;  1U1Q A;  2N7Y A;  3F73 A;  5KFQ A;  2FVS A;  5A0Y A;  3TJ8 A;  4DPX A;  2Z58 B;  4RW6 A;  1SPB P;  1NPK A;  3VV2 B;  1JNZ B;  3AFG A;  3DN9 A;  4O3R A;  2M9K A;  5ETQ A;  1XEZ A;  2BRL A;  3D7S B;  4U95 A;  2CJY B;  3FCW A;  3I4H X;  4EZ9 A;  2B9E A;  1B64 A;  4OI1 A;  4OI4 A;  1EB0 A;  4DR3 F;  3U1M A;  1X8D A;  3MGJ A;  4DQQ A;  2RQ4 A;  3H25 A;  3T5L A;  4Y00 A;  1YDL A;  2IY5 B;  4BC7 A;  4IOB A;  3KJV A;  3TP2 A;  4CLS A;  2MQO A;  4RJV A;  4P72 A;  3EVM A;  1R3N A;  3BKF A;  4EMD A;  2ZWP A;  2LCW A;  4FF2 A;  2BYC A;  3SV3 A;  3W2W A;  1VQ5 S;  3TYT A;  2IYG A;  1S0N A;  1FE4 A;  2KHC A;  1YLX A;  3HI9 A;  4PG5 A;  3LO3 A;  4EK2 A;  4ELV A;  4ES2 A;  3D5M A;  3CSK A;  3Q2T C;  3BO3 A;  5D4N A;  5HO4 A;  3CCZ A;  2GVZ A;  4DXL A;  1RDR A;  4O0N A;  2AZ3 A;  1AZS B;  4X4N A;  1I6J A;  1CC7 A;  3L95 X;  2R2T A;  3UDV A;  1PYT A;  2GQ2 A;  5JUM A;  3R5G A;  3UVJ A;  1KFS A;  4HHU A;  4I68 A;  1RTD B;  4QQB A;  3ILO A;  3UCZ P;  1XNQ J;  2C3O A;  1WF0 A;  4JI6 F;  2RF2 A;  1MN9 A;  2FZK B;  4ECR A;  4MKB A;  3PW0 A;  4PG8 A;  2KU7 A;  4DF8 A;  4JI7 J;  3IWN C;  4JI4 J;  3GWC A;  3WQP A;  2H5J B;  4FPI A;  1VR6 A;  4CZC A;  1NEE A;  3GJR B;  2RIJ A;  3PX6 A;  2DXF A;  1RAF B;  1CG2 A;  5KFP A;  4M5K A;  2DVI A;  1SV5 A;  5I3U B;  1Q78 A;  2YX4 A;  4I67 A;  4QJV A;  4J9Q A;  4Z7C A;  5J2M A;  2B51 A;  3HVT B;  3RRH A;  4JI1 J;  1VQS A;  2RU3 A;  3QGG A;  4TU8 A;  3PXG a;  1HBO B;  2FHJ A;  2IRU A;  5KT6 A;  1YBU A;  3RRK A;  1Q0N A;  1B99 A;  2HLT A;  3DOK B;  1S97 A;  5HP1 B;  4NYZ A;  3FBE A;  4Q0B A;  2MPU A;  1F9E B;  3ONQ A;  1IKW B;  3RBX A;  2F4V J;  2DHH A;  2MKI A;  4ECV A;  4DS5 A;  1KFD A;  4RUA A;  4CO3 A;  2ROP A;  2H65 B;  4DL7 A;  3ENQ A;  4URS A;  2J8A A;  1Q4R A;  4G1I A;  4HHJ A;  2HBY B;  4TU9 A;  1CEZ A;  4WK1 A;  1LWX A;  2KRR A;  1E6Y B;  3G6E S;  2KT5 A;  2DR8 A;  4NLO A;  3TR5 A;  4DL2 A;  5ETT A;  4LIR A;  1KDN A;  4KV8 B;  4P2F A;  5KFR A;  3BDE A;  2VFV A;  3FBF A;  3C6U B;  4U6P A;  2Z2Y B;  2YNF B;  3AXM A;  4BDP A;  1NK4 A;  4O44 A;  5KG2 A;  2DNM A;  5T7L B;  2V50 A;  4I1T A;  5K8M A;  3OT9 A;  1UA0 A;  1AFI A;  1SC4 B;  4W98 A;  4B17 A;  3FMW A;  5D6G A;  3BKU A;  3H59 A;  1C0U B;  1UJ5 A;  4I2P B;  2DNP A;  1TK5 A;  1ZOT A;  4HH0 A;  2VG7 B;  5CYJ A;  4OI6 A;  3LOU A;  2MXY A;  1C2P A;  1RHJ B;  1RHK B;  1NBE B;  4X84 A;  2FZG B;  2QA4 G;  3MTK A;  1WEZ A;  3IWX A;  1RYS A;  3H42 A;  4DG1 B;  1FEE A;  2BAN A;  1MU2 A;  2VH7 A;  4OL8 A;  3PCO B;  2ZM6 J;  1WOP A;  1N0V C;  2CQI A;  4CO4 A;  4DR5 F;  3D0I E;  5B09 A;  3OR2 A;  1TFW A;  3AY0 A;  5CCM A;  2IM0 A;  4H4K C;  1LK7 A;  1O0P A;  3VAM A;  2GGP A;  5E0O A;  5EHH A;  2O5D A;  4WP3 A;  3J81 U;  2YBV A;  2DR7 A;  5HQL A;  1RU2 A;  3EXY A;  2KXF A;  1C0T B;  2GAG C;  2YWH A;  3OTO F;  1FDN A;  1QE1 A;  3KK2 A;  3U02 A;  2ALY B;  2W9C B;  1SXL A;  3A13 A;  4Y34 A;  2ALZ A;  5KFE A;  1D8Z A;  2Z57 B;  4C0O C;  4NLG A;  1D9D A;  4AYB D;  1DBD A;  2JFK A;  1NCL A;  5KFN A;  4O3Q A;  1RTZ A;  5E3R A;  3CCT A;  3G96 A;  1S10 A;  4JBC A;  4L75 A;  4YUD A;  4CDI A;  4LF5 J;  3TAM B;  4RNF A;  4R0E A;  2VUG A;  4IQX A;  3I0S B;  3Q89 A;  4NCG B;  1EP4 A;  4KPC A;  4PXD A;  8ATC B;  2ZH9 A;  4DPY A;  1C1C A;  2J8S A;  1PYS B;  2V34 A;  4NLY A;  3JQK A;  2PEH A;  1RLD A;  1OSC A;  4N56 A;  1TKX A;  3LGH A;  5KFF A;  2EKN A;  1W7W A;  2CJA A;  1ZM4 A;  4PAA A;  3HHL B;  2R42 A;  1XBW A;  1U47 A;  4IYQ A;  4NLV A;  2HPU A;  3MFI A;  2Q79 A;  4UOH A;  4DL4 A;  3RBE A;  4DF4 A;  3WDO A;  1HBU B;  4J7C A;  3HLU A;  1XMO F;  2UV8 G;  2F8M A;  1BC6 A;  1VIS A;  1RT3 A;  3M6X A;  2HWI A;  4OYM A;  4NLT A;  2HQF A;  2V8P A;  3DYA B;  1DAR A;  2VC0 A;  4LF2 A;  2CPJ A;  1KS2 A;  3SZ2 A;  2AQ4 A;  3KG0 A;  2UUT A;  3IRX A;  1TL5 A;  1KQF B;  1XWL A;  2CPH A;  5CAA A;  2E1P A;  4ED4 A;  2K1R A;  1FVQ A;  1FNX H;  1F3F A;  5G4D A;  1K1S A;  5DGB A;  4KAI A;  3UQS A;  1J5O B;  3FMB A;  1BD6 A;  2D3Z A;  3LQV A;  2QLW A;  4CT8 A;  3K5P A;  2ZEJ A;  1REG X;  1X0P A;  2HVD A;  1XMB A;  1JX4 A;  2EFN A;  4RW7 B;  1Q82 T;  3IBW A;  4ZKA A;  2HVE A;  3C6T B;  4A48 A;  3O5T B;  3BPS P;  5JMN A;  2JLE A;  1BGX T;  1JJH A;  2F5G A;  3Q86 A;  2FC8 A;  1N36 F;  5BR8 J;  4KE5 A;  5CAB A;  3ICL A;  3OHB A;  1IWA A;  4ITS A;  1FKP A;  3N6N A;  2LLZ A;  1OS5 A;  3M30 A;  5HL7 Q;  2V4J B;  4DV0 J;  2VKZ G;  6FD1 A;  3OFH A;  5EX3 A;  4UST A;  3TZY A;  3QLH A;  4ZHR A;  1DUR A;  4JB8 B;  2A10 A;  1FK9 B;  4Y0F A;  1IBK J;  4DU7 A;  3SXL A;  4QIW D;  2M3D A;  4GKK F;  2UUC J;  2OPR A;  2MMY A;  1T03 A;  5D4L A;  3OVA A;  1VQ7 S;  4F3O A;  2OEJ A;  2UXB F;  4CH1 A;  2P6S A;  1BQN A;  2DD8 S;  3PYG A;  3VAK A;  4FP9 A;  3W8P A;  3M9M B;  4ED1 A;  1N5Y A;  1GEH A;  1HBM A;  2HIY A;  2WW4 A;  4MAK A;  3PZP A;  2PMZ D;  2NXC A;  3ILL A;  1MW7 A;  2PGC A;  1WG4 A;  2ZH4 A;  2DRA A;  2EXU A;  4F26 A;  1X9W A;  3B8H A;  2HBQ B;  2BE2 A;  4NI2 B;  2KVQ E;  3EJM A;  2H54 B;  1XER A;  2KG1 A;  5KTQ A;  4OYI A;  3NCQ A;  4H4O A;  1F2G A;  2FIU A;  4PAB A;  3TQ1 A;  3DRP A;  3IO1 A;  1VRT B;  4ZDN A;  4RKU C;  2JSX A;  4P2X A;  2LXU A;  2NXJ A;  4BWJ A;  4YN3 B;  5CQG A;  2RRN A;  1NZA A;  3ZFV A;  2X1A A;  1QVF R;  2KZM A;  1FD8 A;  4LSN A;  1SC6 A;  1S9G B;  4TQR A;  3I5C A;  1FFG B;  2EBE A;  5ETM A;  1S1U B;  1W2B R;  5DLF A;  1E6V B;  1UWB A;  2VKR A;  4J9R A;  5IC4 B;  3DXB A;  3TNV A;  1X9S A;  4DSL A;  2DTJ A;  1ZZN A;  2PI4 A;  3FRZ A;  4XIU A;  4DZD A;  3G8T A;  2V8D A;  2GHW A;  2GHV C;  3KNA A;  2BMB A;  2V2V A;  3MPD A;  4K4U A;  1D0E A;  3SSS A;  3DOM A;  3M6V A;  1RWN B;  2HFS A;  3CJ4 A;  2AGQ A;  3B78 A;  4ERD A;  4OYP A;  1UCN A;  3K7R A;  1S6U A;  3SQO P;  5GAE U;  3NL0 A;  2EG1 A;  5KT5 A;  3BO4 A;  2FJB B;  2YXL A;  4FPR A;  3FDS A;  1RT2 B;  3ZNU A;  4O3O A;  2CFX A;  2LQ9 A;  3MEG A;  4KH1 B;  3CJK B;  4MJK A;  3ET6 A;  1PJ5 A;  3PJX A;  3DLE B;  4RR5 A;  2MHN A;  2Z56 B;  3AHP A;  1WDD A;  2BKP A;  3GON A;  3IM9 A;  3KK3 A;  3BM7 A;  2DIT A;  2FLN A;  3C66 A;  4YDD B;  2IBK A;  3EM1 A;  4B9N A;  2CKW A;  1YRU A;  4GO5 X;  1TP7 A;  4KFB B;  1SKU B;  2LYV A;  3TAN A;  1FTR A;  4B9U A;  3HD2 A;  2V2Q A;  2K7J A;  5KG4 A;  1U1N A;  3M1V B;  4WII A;  1N6Q B;  4DR3 J;  1H74 A;  1R8B A;  2O1P A;  2YNH B;  4P10 A;  4FS2 A;  3KG1 A;  5D78 A;  1TKD A;  3R5B A;  3OR1 A;  4Y2I A;  2XSJ B;  2RML A;  4QW9 A;  1WF1 A;  3WC2 A;  1U0S A;  3IBF B;  1FWK A;  3PY8 A;  4DR2 F;  3QMQ A;  1SKS A;  1TKT A;  4WJB A;  2CNL B;  5DS7 A;  2AP6 A;  1B0V A;  4OHV A;  2AYE A;  3DOL B;  1YZ6 A;  1IBL F;  1NK8 A;  5F3T A;  3VVU A;  2DGV A;  3LP1 A;  1NDC A;  5LSO A;  2JLG A;  3T6J A;  2B3T B;  1NJI T;  1RAE B;  2COL A;  2W9B B;  2HQ3 A;  3VTI A;  3QO9 A;  1IUJ A;  1Q8L A;  2AW0 A;  4KB7 A;  3DDI A;  2FGO A;  3H4D A;  2VF3 A;  4BCA A;  1LEO A;  1B4S A;  5A8W A;  2BAB A;  3BSN A;  2RKI B;  4DUY F;  1Q8I A;  2OUG A;  3QT6 A;  4N47 A;  3RBZ A;  1KVK A;  3MPV A;  1T9V A;  4CCH A;  1ACM B;  1X5O A;  1JJ2 R;  2D74 B;  2PFD A;  3AA8 A;  4X62 F;  1WHX A;  3OFF A;  4CLW A;  3ZTQ A;  3NLC A;  1VQ4 S;  4U96 A;  4DLG A;  4FKX A;  5HVF A;  3VZI A;  2X1B A;  4JI6 J;  3TEH B;  4U7U D;  1WOR A;  3PHT A;  1TUW A;  2EKY A;  2MZR A;  1SJ1 A;  1L3V A;  2B6A B;  1NRK A;  3BQ2 A;  1S6Q A;  2LDI A;  3NY0 A;  1NSA A;  3PW5 A;  3DLG B;  4ED7 A;  4EEY A;  4MK9 A;  4DJB A;  4EBC A;  2HBZ B;  3CMQ A;  2WVC A;  3KKF A;  4RBT A;  2C2R A;  4FF3 A;  2FY8 A;  2OPP B;  3BGO P;  1U24 A;  4YOE A;  4QU7 A;  3DLJ A;  3MED A;  3ENV A;  4ZN3 A;  4F4K A;  4K4S A;  4ZA1 A;  3OXG A;  1EET A;  3GPA A;  3PIP Q;  3POT B;  2IJF A;  1IKX B;  1S1V A;  4CI0 B;  4RWW A;  2NZ4 A;  4Y65 A;  2PI5 A;  4PUO A;  3GIK A;  4K2X A;  3KLI A;  3MMC B;  3GR1 A;  3MTJ A;  1VRU B;  3CD5 A;  2NZC A;  4ID5 B;  4CNY A;  2QGF B;  2PA8 D;  7FD1 A;  2ZH6 A;  1JMT A;  5CZX A;  5LMN F;  3ISN C;  3OW2 R;  2QX0 A;  1OY6 A;  2MYF A;  2WBR A;  5EWE A;  4GKJ F;  3J7Y U;  4LMZ A;  1HHQ A;  3HCX A;  1ROF A;  3MEC A;  3ELH A;  5C2C A;  2IM2 A;  2DY9 A;  1S9E B;  4Q44 A;  3DRS B;  2XG8 A;  3CC4 S;  1X4D A;  1S12 A;  4YME A;  2OTJ S;  2MQN A;  3T9Z A;  3I82 A;  2LDY A;  1XR7 A;  4YP3 A;  1RTI A;  5LT5 A;  1GNK A;  4RBV A;  2CJ9 A;  3EVO A;  2A2C A;  4ZVF A;  3J7A N;  2HFN A;  2N3L A;  1RAA B;  4TXS A;  2BQU A;  3M8Z A;  3NAI A;  5B0D A;  5FDL A;  3GQC A;  2L9W A;  1FVS A;  1F5A A;  2FJE B;  4RUH A;  3G6V A;  5H9E K;  2OPQ A;  2JC1 A;  5AE2 A;  3W1Y C;  2V4R A;  4IO9 Q;  3D1H A;  5J2N A;  4OIX A;  5I4M A;  1S4E A;  8RUC A;  4OJ1 A;  3MFH A;  4QWE A;  2Q6C A;  4BHQ A;  1ZBT A;  5DZ7 A;  2ZKU A;  1V3S A;  2XMT A;  3S01 A;  1DQA A;  1SIW B;  4OV1 A;  3NMR A;  5J1E B;  4KY3 A;  1SCJ B;  2NXU A;  4AQY F;  1WI6 A;  2EFQ A;  2MGZ A;  1RTJ B;  3OTC A;  3N5B A;  2F1F A;  4C8M A;  4DR5 J;  3PNI A;  2CQ4 A;  2E29 A;  3V2U C;  2YKN B;  3TUI C;  3MR2 A;  3EMT A;  3VR1 A;  3Q83 A;  3DLB A;  3KLE B;  3UDL A;  4E98 A;  3AQP A;  2C1E B;  3ETM A;  1NO8 A;  2V69 A;  5E3Q A;  1Y5L B;  4IR9 A;  3MM5 A;  5E3P A;  4LQ9 A;  2OGU A;  1WF2 A;  1RCX B;  3RGI A;  3OTO J;  2J6T A;  3DMJ B;  3QBC A;  4W4M A;  2G2Y A;  3RTV A;  4W90 B;  2R8K A;  4IOC Q;  2CVI A;  1UVI A;  1WAC A;  1G2E A;  4K59 A;  2NRE A;  3QIP A;  3CJR A;  2YWG A;  2FHJ D;  1SQF A;  2GQC A;  3SFG A;  1WSV A;  3B54 A;  1Y11 A;  1TL7 A;  2PII A;  4C6A A;  4YB6 A;  5IOL A;  2HS3 A;  2V68 A;  4L3K A;  3Q23 A;  5E3A A;  2QMW A;  1R8P A;  1SB6 A;  4L72 B;  3ISZ A;  3KHG A;  4N8N A;  4DLE A;  2MHE A;  2XWY A;  4J9N A;  2OJ3 A;  1F9F A;  4CT9 A;  4LVO P;  4NRT A;  4NML A;  1FJG J;  4USW A;  1CS4 B;  3SMZ A;  2KXH A;  4QYZ K;  3BGU A;  1RCO B;  2XSF A;  1MMN A;  3CJ5 A;  3H2V E;  2HW3 A;  2Z2M A;  4XAK A;  5IQQ A;  1B7Y B;  1VLO A;  3LP2 A;  3QFH A;  5I3Q A;  3EE3 A;  1CPZ A;  2PO4 A;  2PEB A;  2DR6 A;  5AXL A;  2LXI A;  3PO4 A;  2QLF B;  3DCA A;  1VRQ C;  1S7I A;  4P75 A;  3SSQ A;  1HQU A;  2HMI B;  4M5N A;  4J91 A;  2WVB A;  4AXI A;  3RBD A;  1FX4 A;  5KFB A;  4P73 A;  2MQL A;  2B5J B;  3OJS A;  4HI2 A;  2RB7 A;  2ZJR Q;  5HK4 A;  2VA3 A;  2Q66 A;  2MKY A;  3W9H A;  4O4G B;  3D6M B;  1XMO J;  4FF4 A;  2LU2 A;  3H20 A;  2XMU A;  1D3W A;  2MJN A;  2IIH A;  5L1I A;  2KFY A;  1T05 B;  1HYS A;  3B6B A;  1VC6 A;  2BW7 A;  4IUF A;  3D3B J;  2K3I A;  3P5B P;  1VI7 A;  3H2L A;  4Q45 A;  4I64 A;  3T1Y F;  1GK8 A;  2QL9 B;  3K5N A;  4G65 A;  1KEK A;  2YWE A;  2XLI A;  3GYX B;  2M70 A;  1SJ3 P;  1HNI A;  1FXL A;  2DCU B;  3MOJ B;  1U8S A;  2RVJ A;  4FDF A;  2R2S A;  4GC7 A;  3M6U A;  4F0M A;  1SL2 A;  1K9M T;  3DI6 B;  4TVA B;  2CRL A;  3AXK A;  1HPZ A;  5DRK A;  1RWK B;  2KHD A;  2J9D E;  1UL3 A;  3R3T A;  2FZC B;  2P9E A;  3MAA A;  1VJQ A;  1N36 J;  1FJ7 A;  1ZTW A;  2KG0 A;  1LW0 A;  1N0U A;  2U1A A;  3C16 B;  3Q8U A;  3RR7 A;  1R89 A;  1M90 T;  4R8U B;  3J7A 1;  4ED5 A;  3MMB B;  4LF9 F;  4LF7 F;  4C3L A;  2RD5 C;  4F36 A;  2XLK A;  2CNK B;  1NJW A;  1ARO P;  1NU4 A;  3VHQ A;  4GKK J;  1S79 A;  4WXW A;  2KZZ A;  4NPO A;  2E9R X;  3HXM A;  2MY7 A;  4IG0 B;  2UXB J;  1JK9 B;  4ZP9 A;  4Z37 A;  3NGT A;  1TZ0 A;  5J2P A;  4RW8 B;  3Q2S C;  3IG1 A;  1FI4 A;  5GVQ A;  2F40 A;  1QAJ A;  4JV5 F;  1HAR A;  3GMG A;  4JP8 A;  4LR8 A;  2QJ3 A;  5DG8 A;  1S49 A;  5HMY A;  3SDE B;  2LQB A;  1KLM B;  3H7H B;  1QDU B;  2YKM A;  1KVJ A;  4NLD A;  3TA1 A;  4N76 A;  3OXL A;  1SKR A;  2OD4 A;  1RB0 A;  2FDN A;  1NME B;  2WVD A;  3OLA A;  4HKQ A;  3QJJ A;  5L9N A;  3KLH B;  1AFJ A;  4LFA F;  1J2V A;  5HI7 A;  3ZZP A;  5D3G A;  3I96 A;  5KT7 A;  2I9S A;  1CUL A;  4TY9 A;  1XNR F;  4ZPA A;  1EKS A;  1Q81 T;  2YQ3 A;  3BQ1 A;  1RGV A;  1WDT A;  3D6T B;  4ANC A;  4MYT A;  1FRM A;  3FZ2 A;  3MWB A;  3PW2 A;  5HVG A;  5A2Q Y;  2XNR A;  3AT1 B;  1V3R A;  1CC8 A;  4OJH A;  4F50 A;  2C3U A;  2JLF A;  1MWY A;  1SI9 A;  2AYG A;  3OL8 A;  1QSS A;  4ZP8 A;  3UD5 A;  2HVZ A;  5HJY A;  3HKZ D;  4ZLJ A;  1UJ4 A;  1D9A A;  3LP0 B;  1U7L A;  2JJ4 D;  3EVW A;  2DY1 A;  3TUP A;  2ASD A;  1Z4U A;  5DG7 A;  4EI2 A;  1HQ2 A;  4ZVP B;  3EPI A;  4YEA A;  5B0G A;  3FZB A;  4LJM A;  1U1L A;  2D3U A;  1IBC B;  1UEU A;  2H3E B;  2HQG A;  5D15 A;  4W92 B;  4WE1 B;  3M2U B;  1KVI A;  1QD1 A;  1IKY B;  1T9Y A;  4KIA A;  1R8C A;  1WC3 A;  3FSX A;  2BVZ A;  4IFY A;  4TY8 A;  3KLG B;  1FES A;  4TN2 A;  4FYV B;  2DH8 A;  1LNQ A;  4Q2M A;  1RTD A;  4O3P A;  1KQK A;  2FGC A;  4U7C A;  1SQE A;  4F3Q A;  5HLF A;  2FJV A;  4DSF A;  1YIT S;  3U7J A;  1UAW A;  4A47 A;  1RSC A;  3VAJ A;  2ABY A;  3AOC A;  2IRY A;  1TKZ A;  3HUL A;  3UDE A;  1JXE A;  4MKV A;  1M1G A;  2Z30 B;  3THP A;  4DR2 J;  3W7B A;  4Y2M A;  3ZZ0 A;  2P6T A;  4KSE B;  1JLA B;  3JSM A;  2SXL A;  3PKY A;  1RLC L;  1VQN S;  4OYB A;  1N5V A;  1IBL J;  2GMH A;  3NEK A;  2G2Z A;  1BMQ B;  3EDR B;  1VBZ A;  4KHR A;  4UOF A;  1LXN A;  2XI3 A;  4ELT A;  1NH8 A;  2HHP A;  2V8H A;  3CIM A;  1FCA A;  1BQM B;  1F3V A;  4G1P A;  4M5I A;  1RIS A;  2N7C A;  3I56 S;  2LXF A;  5HMX A;  3DOK A;  5F0U A;  4TQS A;  5HP1 A;  2Q6B A;  5IT4 A;  1HD0 A;  2EWH A;  4ER8 A;  2DRB A;  4UUX A;  4DUZ F;  1YZ7 A;  4DUY J;  2ZBP A;  4ETZ A;  2P8I A;  1RKJ A;  1OQ6 A;  4G6V B;  3PX4 A;  3DGP B;  4V19 X;  4DSK A;  1IKW A;  1BLU A;  3AAW B;  3IBC B;  3GJS B;  2DHG A;  2RQC A;  4X62 J;  2XHC A;  4NLW A;  4CNZ A;  5KFM A;  4QIG A;  3K0J A;  4NCA A;  3H90 A;  3RUB L;  2B4O A;  2CIM A;  1FT8 A;  2ERR A;  3JTP A;  1O6X A;  4PRF A;  2F4F A;  2RHS B;  4CLL A;  4WK3 A;  1NM2 A;  2OPS B;  1HLW A;  3HMJ G;  4LF4 F;  4FZV A;  3M05 A;  3N28 A;  3AOD A;  2CJB A;  5ETV A;  2BOA A;  2UXD J;  3T5K A;  2XB2 D;  2O67 A;  2VJV A;  5H1S V;  2QA4 S;  4PXB A;  1PGZ A;  3W9J A;  2W2M P;  3ZZO A;  2HNY A;  3WX8 A;  2PDA A;  3SQG A;  5GAH U;  2DNK A;  4PQU A;  5D4P A;  3NKY A;  1OPZ A;  4Y2A A;  1C4C A;  2MJU A;  2U2F A;  3LAL A;  2BEF A;  2ZIT A;  2AX0 A;  2LU1 A;  1Y3J A;  1XK8 A;  2CQ2 A;  1NHK L;  4GC6 A;  4CLT A;  3MD3 A;  5LMN J;  2KRB A;  1AA1 B;  4MTP A;  1MN7 A;  4GKJ J;  3BQ0 A;  4RU9 A;  5FLX U;  1U4B A;  3FQK A;  1VQL S;  5DO2 A;  1Y3K A;  1JLF A;  1U1P A;  3TA0 A;  2UP1 A;  2HHX A;  1CJV B;  5SUH A;  2YX1 A;  4ZPW R;  2A0F B;  1VYA A;  5CCL A;  3HHN B;  1H3D A;  4USK A;  2HVI A;  4NEZ A;  3RR8 A;  2HHV A;  2VD3 A;  1HA1 A;  1HBN A;  1U2F A;  3HSD A;  3E2E A;  4JV2 A;  4YB7 A;  2XS7 A;  3M2V B;  2JEF A;  4AFF A;  5FD1 A;  4KBI A;  4A8X A;  3HJV A;  4R5P B;  2PMW A;  1S48 A;  4OZ1 A;  4J9S A;  2RS2 A;  3D66 A;  4FBT A;  3VF0 B;  2DNH A;  2BV3 A;  3JXO A;  2B0G A;  1HMV B;  3TAM A;  4WWS A;  4X2B A;  4K4W A;  3MCS A;  1SUQ B;  2IBO A;  4X66 F;  1S4F A;  2Q43 A;  1MRO B;  1HQE B;  3RAX A;  1JLG B;  4AQY J;  4WYW A;  4NWB A;  3CDB A;  2JOQ A;  1TL1 A;  1NLK L;  2LKZ A;  2HGL A;  2ZDP A;  3AD8 C;  1TL3 B;  4AUK A;  1J27 A;  4IRD A;  5E2Q A;  1NKB A;  2UUB F;  1F6T A;  3MM8 A;  2AF6 A;  3PRV A;  2N4D A;  3MR3 A;  1VFJ A;  3QT5 A;  3TOQ A;  3CO9 A;  4ED3 A;  1XTZ A;  4LBH A;  4B9M A;  3BBC A;  3M8P B;  2J0W A;  4LF6 F;  3IRW P;  2AJ4 A;  1SH0 A;  3HZG A;  3W2V B;  2DGS A;  1P1L A;  4F4A A;  3V4I A;  5J1N A;  3FQL A;  2DNN A;  5AT1 B;  5A8R B;  2C2N A;  2XUL A;  3MCN A;  4KQZ A;  1KC8 T;  1LW2 A;  4ZPB A;  2EC0 A;  3VGU A;  2W25 A;  5HAT A;  5A0Y B;  3GTY X;  4X64 F;  2BW2 A;  3NGR A;  4CIO A;  3NWG A;  2QRR A;  3RG6 A;  1UZH A;  5IT9 Y;  4X4V A;  2YNI A;  3LAK A;  4WPA A;  3NAH A;  4ICL A;  5KG1 A;  4G3I A;  2CPF A;  1N5S A;  2MKJ A;  4GVL A;  1MSW D;  3OL7 A;  2Y3Y A;  3W5X A;  2QIF A;  3PRB A;  3Q8R B;  2E1M C;  3QYY A;  3RB4 A;  3UCG A;  4RNM A;  2AKW B;  1U0H A;  3M2R A;  5F8I A;  4TLR A;  4C0B A;  4JI5 F;  1S59 A;  4QCL A;  3NS7 B;  2HLU A;  3W63 A;  3C6T A;  4HDH A;  3FBC A;  4ZVE A;  2A18 A;  3KJV B;  4OI2 A;  2RNE A;  2R8I A;  1TQL A;  1YTY A;  2CQ3 A;  3BH7 B;  3RU0 A;  1Y7P A;  4WFZ A;  1S6O A;  7FDR A;  4PQA A;  2GX8 A;  3H5S A;  2OD6 A;  3QID A;  4OLP A;  2H51 B;  4JUZ A;  2G9O A;  2HBR B;  2J0S D;  2D3O 1;  3ETO A;  1H6K X;  4KO0 B;  3W2W B;  3JSY A;  4M5G A;  5KG6 A;  4AL6 A;  2VPX B;  3GP9 A;  1KHW A;  4KGV B;  2ADC A;  1V5V A;  2BRK A;  2XMK A;  1KR4 A;  3A3N B;  4ZVS B;  4I4B A;  4HEA 9;  2AGP A;  1FNM A;  3C2P A;  1CJK A;  4BBY A;  2XMM A;  2UUW A;  3UDC A;  1NJX A;  5HRO A;  1FRH A;  1S1T A;  4M5D A;  1WEL A;  2BJ9 A;  1RT4 A;  2GVZ B;  1VCT A;  1S1W A;  1IM4 A;  3JSB A;  2CNN B;  1UZD A;  3UVJ B;  3DU5 A;  1SQG A;  4RNO A;  2XQC A;  1T8E A;  3RJM B;  2RF2 B;  2OML A;  1YWX A;  4AL5 A;  5F41 A;  1N32 F;  1PO6 A;  4KC5 A;  4WXO A;  1RT5 A;  2R7S A;  3PIO Q;  1DRZ A;  1OQ3 A;  1GMW A;  5M2R A;  3ZTR A;  4B3M F;  4OI0 A;  2MSS A;  3M7V A;  3GJT B;  1YGY A;  2RSQ A;  3LPY A;  1ZTT A;  2F9D A;  4EUV A;  1SIZ A;  3GJQ B;  1GX6 A;  3HSG A;  2HRT A;  1FKO A;  1KBR A;  3D67 A;  5J2M B;  4K0K F;  2YQ0 A;  3FVY A;  1UW4 A;  2DB1 A;  1X4E A;  3CJQ A;  3BDP A;  2UXC J;  3GCW P;  3PFE A;  4C8L A;  2NQP A;  4B3S F;  2B56 A;  1UP1 A;  4F4Z A;  1ZET A;  4EO8 A;  3G8S A;  4KGK A;  5FII A;  4EGL A;  1C1B A;  1MG7 A;  2KJV A;  5I42 A;  2WTF A;  4IDK A;  2ZH3 A;  2V0N A;  2XGP A;  1QUV A;  4LF9 J;  4LF7 J;  4DHV A;  1B7F A;  4OYO A;  2WCX A;  5LM7 E;  5K9F A;  1ZAX A;  3CT9 A;  5DQI A;  2CQC A;  4OYZ A;  3CJS A;  3B82 A;  3KFW X;  4YY3 J;  2QLX A;  4EFA C;  4JI0 F;  2ADB A;  5L38 A;  2AJF E;  1HNV A;  2I5J A;  1ZA2 B;  5DDR C;  1M5K C;  4DSJ A;  2E9Z A;  1JQG A;  3AB2 B;  1N34 F;  2HQD A;  3UFC X;  1D9F A;  1G1X A;  5L9X A;  1MNE A;  1JXL A;  2PD1 A;  3BBF A;  2V2Z A;  3HFK A;  4DN9 A;  2J0Q D;  1J5E F;  4ILR A;  4ZMM A;  1VK8 A;  4KGX B;  2DH9 A;  1LQ9 A;  4CLF A;  3CC2 S;  2VC1 A;  3E51 A;  1TAU A;  3GIJ A;  2NYH A;  2HUR A;  2IM3 A;  1WKK A;  3MEE A;  3R1L A;  1WUU A;  1FNO A;  1XJW B;  5CXT A;  2E7V A;  3I6P A;  4LFA J;  1ZAW A;  3C46 A;  1R7I A;  1XNR J;  2QA2 A;  1N5Q A;  1M5S A;  5AJ3 F;  3Q8V A;  2GIF A;  2EFO A;  1Z2Z A;  3D54 A;  4USH A;  1FDD A;  1T3N A;  2BAN B;  1MU2 B;  1JLB A;  5GME A;  3H40 A;  3EGZ A;  4BWM A;  3K17 A;  1U1O A;  1QM9 A;  4I56 A;  2BKO A;  1X4B A;  2QN6 B;  4O4R A;  5IM0 A;  3OR2 B;  3WHI A;  2B9Y A;  1L3S A;  1BUX A;  1VOM A;  3KJN B;  2DCL A;  5HN0 A;  2VA2 A;  4UOG A;  2C42 A;  3OHA A;  2GGP B;  2JH3 A;  4C8Z A;  4B3R F;  1AXQ A;  2DNO A;  4A46 A;  3EXC X;  2DO4 A;  3PRD A;  3K2Y A;  3JYT A;  4DV2 F;  2R7X A;  1QE1 B;  2HND A;  5F9N A;  1NPR A;  3CVK A;  3KK2 B;  1TVR B;  2CPX A;  3MM7 A;  1U2R A;  5DDO C;  3CB4 A;  2L9D A;  2G0C A;  3M8S A;  5KOW A;  2HFV A;  2G1D A;  2MLZ A;  2M7S A;  1D1U A;  4GO7 X;  4NLS A;  2ACM A;  3QNW B;  2ASY A;  1IQT A;  1EZZ B;  3US5 A;  4ILL A;  3GR0 A;  2E5I A;  1RU1 A;  2W7O A;  2G0J A;  3U1L A;  3MUT P;  3MXH P;  4DV7 F;  1U26 A;  2GO8 A;  1KSP A;  4PPZ A;  4UUW A;  1EP4 B;  2CNO B;  1Z2L A;  1ZA1 B;  3ITH A;  3DLG A;  1RYR A;  2EEY A;  4JYA F;  3BGR A;  3UI3 A;  1X9M A;  1NND A;  2CPE A;  1C1C B;  3QT7 A;  4F7V A;  1R8A A;  2H5I B;  2HSE B;  1H73 A;  3EWG A;  4OHW A;  5A2Q U;  2Z8Q A;  1X5T A;  2GJI A;  4I7F A;  5BXI A;  1TKX B;  2M88 A;  3LAN A;  2HNZ A;  4C2M A;  4PWD A;  2ZZM A;  4DV6 F;  2D41 A;  4UY8 T;  2QC3 A;  2ZHA A;  1X31 C;  3TVY A;  3DDK A;  3DHX A;  4FVM A;  4ECQ A;  1X4H A;  2G4B A;  4BS2 A;  3ENA A;  2BOP A;  4PYD A;  2PMH A;  1JIH A;  2F8E X;  1R0A A;  3GU0 A;  4QOT A;  2KL8 A;  4UOC A;  1RT3 B;  3FCH A;  4FS1 A;  4M63 A;  4P2S A;  4PCQ A;  4OX7 A;  1R6Y A;  4DUZ J;  1VQ8 S;  1REV A;  4N77 A;  3VZH A;  2IVY A;  2C2O B;  3CD6 S;  1FRL A;  2DNQ A;  3IRX B;  4ZS6 A;  2IC3 A;  3BGF A;  1S1X A;  3MPY A;  3PHE A;  3OJU A;  2K1R B;  3I0R A;  4O3N A;  2Y1L B;  1YJW S;  2NS1 B;  4ZVO B;  2C2E A;  1BWE A;  3TAQ A;  4QU6 A;  4A8S A;  1S9F A;  3CDU A;  3IM8 A;  2I1R A;  2WBM A;  1F9H A;  2JWN A;  1U8W A;  4QR1 A;  3DRR A;  4ZCL A;  3H0P A;  1B0T A;  4LF4 J;  1HWU A;  3OQ2 A;  2DHX A;  4UQG A;  4C8O A;  1RP5 A;  5G0R A;  4E2F B;  5M2P A;  1G7C B;  2YKQ A;  2POK A;  1VQK S;  4PXE A;  3OBI A;  1NAQ A;  3J81 j;  3FJ2 A;  2DXD A;  4NLR A;  2VZ9 A;  1TFY A;  1VLY A;  4WZM A;  2ZNZ A;  1IVZ A;  5BYR A;  4MK7 A;  4K4Z A;  4OZ5 A;  5HJX A;  1O5J A;  1UJ6 A;  2FJW A;  2PT0 A;  1CLF A;  3VWS A;  3C19 A;  4LRF A;  1FKP B;  4RO0 A;  3OSN A;  3M30 B;  1URR A;  3BO2 A;  4K5R A;  4QWD A;  3CJ3 A;  4NCB A;  2X3D A;  3MM6 A;  3QLH B;  1U1M A;  2JVO A;  4ZHR B;  3A8I A;  1L3T A;  3UWT A;  4XO0 A;  4CP5 A;  4ZJL A;  5EDW A;  4A8M P;  1KQG B;  4DX5 A;  3LW5 C;  4NXN J;  1RZM A;  2OPR B;  2IMO A;  1NK9 A;  1HI8 A;  1T03 B;  3N4W A;  2RAQ A;  4QR2 A;  2OEL A;  1FRJ A;  2RH3 A;  1BQN B;  1JLE A;  2IMW P;  1WJ9 A;  3CE8 A;  1HBM B;  2C3M A;  2GC8 A;  3CME S;  1CJT A;  1CSJ A;  1V6H A;  3HD1 A;  1DTQ A;  3NGK A;  1HHS A;  2BE2 B;  1Y10 A;  5KOX A;  1YHQ S;  3TA2 A;  4LR9 A;  4L3N A;  1KOH A;  3MCO A;  2V9K A;  4H4O B;  4F3M A;  3NCR A;  5DGA A;  4HAC B;  3DRP B;  3SV4 A;  4Y3C A;  4DN0 A;  2VBY A;  3W62 A;  3MAH A;  4WFX A;  2I2Y A;  2EFG A;  1X0F A;  2M0G B;  4X66 J;  1PCA A;  5HQ8 A;  1DLO A;  2R2U A;  4DL5 A;  1JJ4 A;  1RHR B;  2ZE2 A;  1F2H A;  4XDD A;  5LOQ A;  2JZ5 A;  4OI3 A;  3JAM Y;  2F9J A;  4KT0 C;  1UWB B;  1WC1 A;  2ZOF A;  1KD1 T;  4ZLN A;  2UUB J;  1VC0 A;  2K8G A;  2ZZN A;  3ZTO A;  5F8H A;  4I6Y A;  4OZ0 A;  2PA3 A;  2MZT A;  3R2C J;  3PG9 A;  2P2C B;  9RUB A;  2C3P A;  2QT7 A;  3C8Y A;  2ZHO A;  3AB4 B;  1IM6 A;  4CM0 A;  2DGO A;  2R7T A;  7AT1 B;  3NS6 A;  4LF6 J;  1GMU A;  3MUR P;  3NXZ A;  3E01 A;  3B4D A;  2E7X A;  4C3K A;  2R7O A;  2GHP A;  3DOM B;  3ZZZ A;  2XCP A;  2V4Q A;  4LR7 A;  3FKB A;  2DK2 A;  3TVK A;  1FRX A;  3D1Q A;  5A6W A;  5KG3 A;  1M1H A;  4ECY A;  1GXT A;  4DFJ A;  4L6V 3;  4CLY A;  1JLQ A;  2IFX A;  4RNH A;  2FPH X;  1FKA F;  3CJ0 A;  4HTJ A;  2KXN B;  4X64 J;  5KT4 A;  3MEG B;  1WD6 A;  2FD2 A;  3ET6 B;  2CG4 A;  4DBQ A;  3J7Z T;  1QSL A;  2MZ1 A;  2QL5 B;  1IJF B;  1OO0 B;  5CH7 B;  2C22 A;  3KK3 B;  1Q16 B;  1RHQ B;  2D69 A;  2PSZ A;  2DGU A;  3L09 A;  4NA3 A;  4UZB A;  3PAC A;  2ZFH A;  3A1Y G;  1G3O A;  2L9N A;  2WOM A;  3LTO A;  1JKH B;  1BY9 A;  4JI2 F;  1YK9 A;  4KKO A;  3TX8 A;  4P52 A;  5H9E J;  3MM9 A;  1ULR A;  3G71 S;  2H9Z A;  3NGS A;  4BLG A;  1SKW A;  2J9D A;  1R0B G;  4MYU A;  3TO8 A;  3AQO A;  3R9L A;  4OX9 F;  4NAS A;  4JI5 J;  3OR1 B;  3DI6 A;  2KDO A;  2HQC A;  4YHH F;  3RB3 A;  5HVH A;  2CPZ A;  1KP6 A;  2D3O R;  2FLO A;  4LIW A;  2DKO B;  1TKT B;  1KN6 A;  5KG7 A;  2HZV A;  3GIR A;  3HT0 A;  2YH0 A;  4U67 Q;  3N9U C;  3HDS A;  4RNN A;  3CGI A;  4NZ7 A;  2FJA B;  3KK1 A;  1FRK A;  4ZJQ A;  2AJ2 A;  3R7B B;  2MZS A;  3ZZR A;  1XN9 A;  3LP1 B;  2E5J A;  3L9Z A;  3MMB A;  4J90 A;  3ZXW A;  2IDL A;  3QO9 B;  5KFJ A;  3X3U A;  3OVB A;  4USV A;  2XY6 A;  2Y0S D;  5D8H B;  1S6P A;  4N8O A;  2R7W A;  3PFO A;  4DV4 F;  4DQS A;  4NXM F;  1N54 B;  2EBG A;  1HL6 A;  3P8B B;  2W01 A;  2JEG A;  5IT9 U;  4IG0 A;  2BDP A;  4HTI A;  5HAN A;  3DGV A;  2W24 A;  5J2Q A;  1VBK A;  2MDA A;  4F4X A;  1HNZ F;  1X7V A;  5KT2 A;  2O01 C;  3P5T L;  2RRB A;  2VQF J;  1NKC A;  3CJ2 A;  4HI1 A;  1RWM B;  3O8W A;  4MKA A;  1UWA A;  1WHY A;  2QG9 B;  2DNL A;  3SDE A;  2OFG X;  4G1Q A;  1N32 J;  4K4V A;  1T02 A;  2NCK L;  1S6Q B;  1PBU A;  1RTH A;  3L7P A;  2C2M B;  2HGM A;  3M8Q A;  2I6W A;  1PIE A;  2YWW A;  3RW6 A;  1K8A T;  4B3M J;  2E66 A;  5CA5 A;  4DU8 A;  1IN0 A;  4QYZ J;  2LQ5 A;  1N5T A;  3MED B;  2WW8 A;  1T9U A;  3MAQ A;  4IFV B;  1FDB A;  1EET B;  4K0K J;  4PEO A;  5IC6 B;  1H7W A;  5GAG I;  1S1V B;  3ENW A;  2MZQ A;  2AEF A;  4PUO B;  1UEV A;  4B3S J;  2ZC4 A;  4OJ3 A;  1UKU A;  5AXM A;  2YNG B;  4NZ6 A;  4CRJ A;  3O6Q A;  3PYF A;  4DQR A;  1DQ9 A;  3A12 A;  4CO1 A;  4Q7A A;  4PXC A;  4F8R A;  1N52 B;  2VFS A;  4F0K A;  2K3K A;  3MEC B;  1OYD A;  1K0V A;  2DNR A;  4EO6 A;  2B8Q A;  4JI0 J;  4J9O A;  2B43 A;  4F02 A;  1PYO B;  3P3D A;  3M32 B;  2IJN A;  4JI3 F;  4C48 A;  4QBU A;  4PWW A;  3G6X A;  4YDX A;  3TJA A;  3MUV P;  2IAJ A;  4GVB A;  3JB9 k;  1QAX A;  1RTI B;  3VGS A;  5LL6 d;  1HI1 A;  1Q1K A;  2J6U A;  5B08 A;  2CQ1 A;  2R2R A;  3SCK E;  5FDL B;  5AE3 A;  5AXN A;  1I3O B;  4YB5 A;  1YIJ S;  4DQP A;  3KLG A;  2ZUA A;  2ASL A;  5J2N B;  3UNG C;  5KFL A;  4WYL A;  2G0I A;  3GG0 A;  2XY7 A;  4QW8 A;  2J7K A;  3HZE A;  5DET A;  1URN A;  3FSY A;  3IR7 B;  2VFT A;  3JQM A;  3GFH A;  5AJ3 J;  2C28 A;  2OEK A;  1M5V C;  1X4C A;  4ENO A;  4RBU A;  4C98 A;  1F1B B;  1UW9 A;  4DFK A;  3EUN A;  3N5F A;  3QGH A;  3F44 A;  2MGZ B;  3OLB A;  4UT4 A;  3X1L B;  2XHW A;  3R7N B;  3I32 A;  4OX6 A;  3S1T A;  4I6A A;  1S7H A;  3SCJ E;  4KGM A;  1VQY A;  1HD1 A;  2HVH A;  3V6H A;  3HFZ B;  2AGO A;  2CJX B;  5CYM A;  4H4M A;  2GIR A;  1S72 S;  2BE9 B;  2R7V A;  1GMW D;  1SJ4 P;  2WB4 A;  1U09 A;  3ISN D;  1SH3 A;  5KFT A;  3BJY A;  2ACY A;  4D3G A;  1QAI A;  3MM5 B;  2OAU A;  4PWU A;  1TEL A;  2GZO A;  3G8Q A;  4DV2 J;  1S77 D;  3QRQ A;  5HSP A;  4C4W A;  4CYU B;  2V63 A;  4LUB A;  2KYZ A;  2DR9 A;  1KLN A;  4IH7 A;  1HIY A;  5C42 A;  3OUY A;  2B4P A;  4M5H A;  1MWZ A;  3S8S A;  3SCL E;  5IZH A;  2I38 A;  4LQ3 A;  3QIP B;  3DC2 A;  5B0E A;  1FD2 A;  3RAQ A;  2LQ8 A;  3G2X A;  2R7Q A;  3AH6 A;  1U02 A;  3I55 S;  1TL7 B;  1U48 A;  4QIF A;  3LH2 S;  1T95 A;  1AUD A;  2XZT B;  1EAR A;  2B7C B;  1TTH B;  2VV5 A;  4DV7 J;  3DM2 A;  1FO1 A;  3BS9 A;  3EZO A;  4NA1 A;  4DEZ A;  5D4O A;  5KT3 A;  4JYA J;  5LSR A;  1C4A A;  2J76 E;  2MQM A;  4UZC A;  4QWA A;  3TUJ C;  2MKH A;  3QAU A;  2HAF A;  4RW9 A;  1WC5 A;  2FHM A;  3LP2 B;  2D7S A;  1A0O B;  3D68 A;  1S0O A;  3UO0 A;  1NUE A;  3CED A;  3NBP B;  4DV6 J;  4PYA A;  4LSZ B;  1HQU B;  4U9R A;  5K20 B;  3HHL C;  2E5G A;  3H4B A;  1TR0 A;  4ES3 A;  1BHN A;  1NDP A;  1NHU A;  2XMA A;  1RAD B;  4ECT A;  2OO4 A;  4IG3 A;  1Y00 A;  4ECU A;  1L5U A;  1Y0H A;  2QSW A;  1FTC A;  2KM8 C;  1G6B A;  1UFK A;  4NZ0 A;  4K4T A;  3ULH A;  3H98 A;  1HYS B;  1H2T Z;  1IBK F;  1KNZ A;  4ATN A;  4NLX A;  4QIV A;  4TNO A;  3CIZ A;  4ZPD A;  3BYP A;  5HBM A;  1VBY A;  2P9C A;  3A3O B;  2ILY A;  3HSZ A;  3W60 A;  2Y8W A;  2KH9 A;  3L7O A;  4DPW A;  3KMQ A;  3RZA A;  3CC7 S;  3F41 A;  2ZD1 B;  3BH6 B;  2Y1R I;  4P9S A;  2DJW A;  2M8H A;  1U6B A;  4CM2 A;  2IM1 A;  4LSL A;  3QJL A;  2IYI A;  2LA4 A;  1HNI B;  5I3P A;  4P74 A;  2OFH X;  5B0C A;  5C24 A;  4A4J A;  3V81 A;  4Q8F A;  2RT3 A;  3CD7 A;  5SZT A;  1H7X A;  2RHQ B;  3IS9 A;  3G86 A;  5JVH Q;  2HFZ A;  1HPZ B;  5ETO A;  1LWE A;  3BR9 A;  3EGW B;  5A6P A;  2CZV C;  3MAA B;  4ZP7 A;  2CQ0 A;  1CQM A;  5KAK A;  2BX6 A;  2WZ1 A;  3AD7 C;  5IT0 A;  1LW0 B;  2MZJ A;  3Q8Y A;  1HKA A;  4OYX A;  5FLX Y;  3I4P A;  4WTO B;  4UQT A;  3HM9 A;  3EZU A;  3U27 A;  3TX0 A;  5DM6 Q;  1GT8 A;  2WB1 D;  5E5N A;  3D1O A;  3R27 A;  4YS2 A;  4K50 A;  2VOP A;  3M8P A;  3NGU A;  4LT6 A;  1KWM A;  2XMJ A;  2Z4P A;  2CWK A;  4PPD A;  1RJJ A;  2Y0B B;  2XMV A;  2VG6 A;  4DR4 F;  3A3P B;  1U25 A;  5THW A;  2MEW A;  1GXL A;  1ZYQ A;  5ETS A;  3TUZ C;  1RXO B;  1WKJ A;  2DPJ A;  3IG1 B;  5LJ5 Y;  3CO0 P;  3FFI A;  2R3V A;  4FYY B;  3V4M A;  2VG5 A;  1QTN B;  1EX8 A;  1DTT A;  1YKW A;  4L73 A;  2O3D A;  3JSR A;  3R5A A;  3KMS A;  2M8D B;  4DPU A;  4UF4 A;  2YKM B;  1IR1 A;  4ELU A;  3Q8P B;  2DRD A;  3QWU A;  4AL7 A;  4X4Q A;  1BQX A;  3MZI A;  1PAU B;  4B3O A;  4WF9 Q;  1WG1 A;  2GA7 A;  5KFS A;  5DLG A;  2NXE A;  1YRX A;  2YX7 A;  2WVF A;  4OZN A;  2ASJ A;  2MKS A;  3F0N A;  4X4P A;  4C7Q A;  1DZ5 A;  1A7G E;  1Q8K A;  2QEX S;  1FA0 A;  2G1H A;  3MOZ A;  2I8E A;  2YPY A;  2LEC A;  5B0B A;  2KYX A;  5D3G B;  3IR5 B;  1CUL B;  2WSF C;  4WFY A;  4DI6 A;  1VQO S;  1VBX A;  2WRM A;  3H2U B;  2AJ0 A;  4ZLP A;  2CAJ A;  1P1T A;  1HWJ A;  4AE5 A;  2JDJ A;  1M0S A;  4NYO A;  1JLC A;  1TUV A;  1I51 B;  3M8W A;  1KQS R;  2A2D A;  1Z1Z A;  1X5S A;  1GXU A;  4KO0 A;  2QYC A;  3G82 A;  2BJ3 A;  1Q86 T;  1LWF A;  4V1A k;  2R8G A;  2HWT A;  1YJU A;  2X1F A;  4A8W A;  3QZ8 A;  4PG6 A;  4RW4 A;  2D1C A;  4O0I A;  4QWC A;  4IOA Q;  5LMU F;  3AJD A;  2XGQ A;  3BSA A;  5HMZ A;  1MLA A;  4J9U E;  4YFU A;  5D0R A;  2QMU B;  4X4S A;  4NYP A;  2FJD B;  3DLH A;  5H9F J;  5IFM A;  3O44 A;  4IFY B;  3H5U A;  2FVP A;  4B3T F;  4TY8 B;  3Q8Q B;  3T9N A;  1MWQ A;  4AD6 A;  3TZX A;  1RKI A;  3JQJ A;  5KG5 A;  4X4T A;  4C11 A;  2J7W A;  4WKY A;  1L3K A;  4JI2 J;  2QLB B;  1WI8 A;  4RX6 A;  2JEI A;  5HLF B;  1XMQ F;  3MR7 A;  2R9L A;  2OEM A;  3W8G A;  4OX9 J;  1TKZ B;  1A9N B;  4YHH J;  3QAT A;  2OH2 A;  5A8K A;  2CA9 A;  3JAM U;  3MPW A;  2L3M A;  2HAI A;  2J7U A;  1ZM3 A;  1QVG R;  3ZNJ 1;  3JSM B;  1LWC A;  5FJ4 A;  2M5Y A;  3UNY A;  3KHH A;  3C14 A;  2BQ3 A;  3SBM A;  2EVZ A;  3PDN A;  4WFN Q;  3GV8 B;  3CDA A;  4OZ2 A;  1ZZF A;  3ZC4 A;  4DDF A;  3NCP A;  2JX2 A;  2M4M A;  4J37 A;  2DGX A;  2B9W A;  3N0V A;  5CYQ A;  4ED6 A;  2F7V A;  1K0T A;  4JOU A;  5JJB A;  1NJY A;  2AU0 A;  1M5O C;  5KFX A;  4OYA A;  4UTG A;  3RYL A;  4DV4 J;  4NXM J;  3HX9 A;  1R31 A;  2LEP A;  3W3S A;  2QE5 A;  1PJ7 A;  3Q22 A;  4DX8 H;  2B4V A;  1HNZ J;  1S0V A;  2FUG 9;  4LRA A;  3N6M A;  3VQS A;  1NZ8 A;  5BYQ A;  2Q1L A;  4OZ3 A;  4UY8 5;  1GX5 A;  2CQH A;  4Z7Y A;  1UFW A;  2XNQ A;  3KJF B;  1IKV A;  5LXY A;  1EJ7 L;  4ZN1 A;  2BKN A;  2L41 A;  3C3L A;  2DO0 A;  3BYR A;  1HFE L;  3U1N A;  4M5L A;  1WWH A;  2D9O A;  4QR0 A;  3K5M A;  5IWA F;  3NRB A;  4OMF G;  2HNY B;  1X4G A;  2NLW A;  3SQG B;  4CTA A;  1TV6 A;  3OL9 A;  1PG5 B;  4I2Q A;  2RS8 A;  2RQK A;  2E5L F;  4PQU B;  4Q43 A;  5HMW A;  1YRT A;  3ZZY A;  2AYB A;  3AOA A;  3OV7 A;  1GQE A;  2E1R A;  3DLK A;  5IXU A;  2C2D A;  3D9B A;  2R8J A;  4Q8E A;  2MB0 B;  2V2K A;  3KHR A;  2MTL A;  3BRE A;  1Q79 A;  3MDF A;  3RB0 A;  2PC6 A;  5K14 A;  2W2N P;  1K44 A;  4WZQ A;  5C7P A;  5K8P A;  2FY1 A;  1JLF B;  2YWK A;  4ETX A;  2Y8Y A;  2VHG A;  1Y9O A;  3FEZ A;  1YX2 A;  4JI3 J;  3EGV A;  5GAE I;  4EBD A;  4N5S A;  3HT3 A;  3I9Z A;  2W4P A;  1HBN B;  2QA1 A;  2ZC3 A;  4DUT A;  5EX0 A;  1N48 A;  1NJZ A;  4C97 A;  1RAJ A;  3V6J A;  3BN7 A;  5DQG A;  1TVR A;  2ZKT A;  1Q7Y T;  4CLK A;  3A8E A;  1BXN A;  1ZAV A;  3O1L A;  5KFG A;  3PX0 A;  5J1P A;  1W25 A;  4IRC A;  3AD9 C;  3IMQ J;  2R7R A;  1UA1 A;  1HWK A;  2YY3 A;  4ILM A;  4O3S A;  1UEK A;  1N33 F;  2CXE A;  3C15 A;  2W2O P;  4M8L A;  3PEH A;  4R25 A;  1LOU A;  1HWI A;  4DS4 A;  2Z0G A;  3EIC A;  2LVW A;  2BUN A;  2MQQ A;  1RA6 A;  3HKW A;  2JC0 A;  1FER A;  3H5X A;  1M5H A;  2Z2L A;  2JRS A;  4ZVR B;  4GMK A;  3VCD A;  3G6Y A;  1RT1 A;  4NX9 A;  4CO2 A;  3HVW A;  2L48 A;  3NNC A;  5DG9 A;  3KOA A;  1FJG F;  2ZJP Q;  3AA9 A;  2APO A;  3EGN A;  4U8Y A;  1TUG B;  3QGI A;  2LP4 A;  3KLF A;  2VAS A;  1WEX A;  1TL1 B;  2Q3P A;  1CJU A;  1RT7 A;  4A8F A;  5GAD U;  4MFB A;  5K5M A;  2WK4 A;  3MM8 B;  4KHM A;  4X65 F;  3V6D A;  2ZBQ A;  2EK6 A;  4M5M A;  1KON A;  2WON A;  1JNR B;  5D0H A;  3T1H F;  4FXW A;  2KT2 A;  2QLJ B;  1RWO B;  1RT6 A;  3R5C A;  3DRY A;  1BE4 A;  3V4I B;  4R0J A;  5AE1 A;  4Y2C A;  2LEA A;  2HHS A;  2KM8 B;  5LJ3 Y;  4P6Q A;  2HIQ A;  1OSD A;  4Z2X A;  4B9S A;  4NEY A;  2MST A;  4NA2 A;  1F0X A;  2BM1 A;  3IAS 9;  1LW2 B;  1SVD A;  2UVW A;  4WP9 A;  5JVG Q;  4LRE A;  1WHV A;  2AHO B;  1VDH A;  2YNI B;  3A4T A;  2XYH B;  4ICL B;  1P9Q C;  1OJ4 A;  3OFG A;  3OL6 A;  2HS0 A;  2J6S A;  3MMA B;  1K73 T;  2FQQ B;  4E0D A;  1RAC B;  2MY8 A;  4OV6 A;  2NSC A;  4FXV A;  3TAR A;  4LFC F;  2FLP A;  1NSK L;  2N82 B;  2AZ1 A;  2YTC A;  4A8Q A;  1HHT P;  1JWW A;  1U0H B;  4NLP A;  2DXE A;  3M2R B;  1V3Z A;  3K58 A;  1HI0 P;  2BR0 A;  4ZVU B;  5BJR A;  3M6W A;  3CCL S;  2FHK A;  2CQD A;  1WEY A;  3K59 A;  1FWP A;  1NHV A;  5L1K A;  1NK7 A;  5F0W A;  2F65 A;  3JTN A;  4KH0 B;  4BC9 A;  2EI5 A;  1IBM F;  4CLP A;  4J5O A;  1A6L A;  3FEX B;  2GAH C;  3J7Z 5;  4ANE A;  2CQG A;  4HHH A;  1UMJ A;  4HT7 A;  3J7Y I;  4NRU A;  1X4A A;  2BM0 A;  4LBI A;  1AZS A;  5GMK a;  4J9P A;  1VIX A;  1CJK B;  3ZO7 A;  3I5B A;  2MKK A;  2DIS A;  4Y6I A;  1ZS6 A;  1VS3 A;  5HRO B;  2GCF A;  1S1T B;  4M5D B;  2H4W B;  2GIQ A;  3H8Y A;  3LGM A;  1RT4 B;  2XC9 A;  1OPI A;  1S1W B;  1YBA A;  1N4L A;  3EYZ A;  2IHR 1;  4PKD B;  3UR0 A;  2ROE A;  2V6A A;  2IJR A;  4ZVG A;  1NK6 A;  3Q0A A;  3LUY A;  2AYM A;  1OY9 A;  3GE9 A;  3GLJ A;  2CQB A;  2RDI A;  4PG7 A;  3MUM P;  5K8N A;  1XR6 A;  2BJ8 A;  4CQ1 A;  5I3U A;  3DLL Q;  2XYP B;  2QO3 A;  5F8L A;  1SC1 B;  2W7P A;  1RT5 B;  4A8K A;  1NKE A;  2ZHB A;  4HYK A;  3HVT A;  4HAC A;  3PM9 A;  4DR1 F;  1RAO A;  2XTJ P;  1YJ9 S;  5LXR A;  4KR0 B;  2Z2Z A;  2K06 A;  2H5E A;  3L7U A;  4P71 A;  4B02 A;  5E33 A;  1FKO B;  3BF4 A;  1HBO A;  1CVJ A;  3S7R A;  3J80 Y;  1FJE B;  1AUS L;  2WHO A;  3NWR A;  4TYB A;  1WG5 A;  2YH1 A;  5ADZ A;  1C1B B;  2HEK A;  5I42 B;  4IDK B;  2BJE A;  4FXD A;  3HP6 A;  4MIW A;  3KWM A;  2CDR B;  1LXJ A;  5KFD A;  1XQI A;  1NDK A;  4EYI B;  4OLO A;  2M52 A;  1M1K T;  3N6L A;  3DDN A;  3W61 A;  3BV8 A;  1E6Y A;  2HHH F;  2YPZ A;  1MML A;  2VON A;  1HNV B;  2LMI A;  4DR4 J;  1RAB B;  4DR7 F;  2I5J B;  2HRU A;  5KFA A;  2IVM A;  2VFR A;  3B4M A;  4KV8 A;  3QWP A;  1HNX F;  3AJ2 A;  3CPW R;  3C6U A;  3R5D A;  2YNF A;  4Q5V A;  1NK5 A;  4USI A;  5C25 B;  2NPF A;  3PO5 A;  2KJW A;  1FFW B;  1U6F A;  3IC1 A;  2N4C A;  2CUY A;  4Q2L A;  1B0P A;  4B9L A;  5T7L A;  4WFB Q;  3PJ9 A;  4XTT A;  2VDH A;  5F8J A;  2VL1 A;  2J9E A;  2CJK A;  1C0U A;  4I2P A;  3MEE B;  1WTB A;  2AJ1 A;  4F2S A;  1UVL A;  5KFV A;  3R1H A;  2AJQ A;  1T9T A;  4WU3 A;  1Q8B A;  2VG7 A;  2VBZ A;  2VB6 A;  4LF8 F;  1WTF A;  1X60 A;  3WZ0 A;  4K5S A;  2W8K A;  1JKH A;  3LWM A;  4DG1 A;  4NMX A;  1T3O A;  3M9N B;  2GVD B;  3V6K A;  1RHU B;  5M2U A;  1U1R A;  3RW7 A;  1VGY A;  2XI2 A;  3CTR A;  2A6O A;  1JLB B;  2QYG A;  6FDR A;  2VBW A;  3DXS X;  3RAM A;  4QIE A;  3IXQ A;  2XS5 A;  2KI2 A;  3KXD A;  1C0T A;  5IM0 B;  4YR0 A;  4XPE A;  3W5Y A;  2GV1 A;  3QRP A;  1D09 B;  2W9C A;  2OIH A;  4FNH A;  2ZBC A;  3JYT B;  5E41 A;  3HPO A;  2W8L A;  1UFL A;  5T41 A;  4B9V A;  2DNG A;  1VHF A;  3MI7 X;  2J5A A;  2HND B;  5LMU J;  1YI2 S;  3I87 A;  1RWX B;  3MM7 B;  3SFU A;  4HH1 A;  3UE2 A;  1OYE A;  1ZPW X;  1FE0 A;  3M9O B;  4C0H A;  1CBK A;  1TL4 A;  2ZUG A;  3I0S A;  1ZH5 A;  2CPI A;  1Y5I B;  4B3T J;  3WC0 A;  4NCG A;  3TRG A;  2XO7 A;  4U7U K;  2CVE A;  1I1G A;  3PW4 A;  3DHW C;  4DX7 A;  4DMZ A;  1XMQ J;  3O3L A;  3T3F A;  2R7U A;  2A3J A;  4DR6 F;  3HHL A;  1GTH A;  2XZW A;  3ITH B;  1F5C A;  3BGR B;  4DSI A;  1NB2 A;  2RRA A;  1KKH A;  4ES1 A;  1JXV A;  2E5H A;  2W9A A;  2UXD F;  2AT1 B;  3FK4 A;  2ZVI A;  4I7F B;  1RAI B;  4CLU A;  4IFV A;  1HBU A;  2HNZ B;  3EX7 B;  3DRX A;  1VQ9 S;  4PWD B;  1PIL A;  3GYG A;  4ZOS A;  4H54 A;  4F67 A;  1Y5N B;  3R97 A;  3GB0 A;  2PE8 A;  5ITH A;  3DYA A;  4LFB F;  2YNG A;  2C3Y A;  4FNI A;  2KKH A;  1K1Q A;  2DYA A;  4FF1 A;  1RWU A;  3N01 A;  1R0A B;  2CJQ A;  3MCM A;  3TJ9 A;  3IN5 A;  4RW6 B;  5GAD I;  3VAI A;  2RUS A;  4I0W A;  2K2P A;  4J9V A;  2UU9 F;  2XEX A;  1REV B;  1UVK A;  5D77 A;  4FVC A;  3W65 A;  1HR0 F;  2XO6 A;  1RWV B;  5BYS A;  5DZ6 A;  2R8H A;  3M32 A;  2X1G A;  1J5O A;  1FF2 A;  2IC3 B;  4WIQ A;  4EU0 A;  1S1X B;  4MMO A;  2UV8 A;  4YB1 P;  2RDD A;  3I0R B;  3UD4 P;  3BEG B;  2OSQ A;  2JFD A;  2JVR A;  3TVZ A;  1VMB A;  4RW7 A;  4L74 A;  3TAP A;  4RLE A;  1I94 F;  3D6F B;  2BJD A;  3CUN A;  4JI8 F;  2GJ2 A;  2GS8 A;  4OYW A;  1RWW B;  2J9C A;  3PR5 B;  1SBR A;  5HAO A;  4DFP A;  2JNJ A;  3HJF A;  3LF0 A;  1VQ6 S;  3DRR B;  4N7T A;  4DV1 F;  2XLJ A;  3SEO A;  5L46 A;  3FNN A;  5G0R B;  3CD0 A;  3NP5 A;  2OI2 A;  5IWA J;  4NL5 A;  3OFE A;  2V4J A;  4K2J A;  4ZCK A;  5DQH A;  5EN1 A;  2DHS A;  3QZ7 A;  2E5L J;  4K8R A;  3BKT A;  2GFF A;  2ZDO A;  3R7S B;  1YJV A;  1FK9 A;  4QZV B;  2HRY A;  4RL1 A;  2AX1 A;  3DU6 A;  2EG2 A;  2FVQ A;  1IR0 A;  2BA9 A;  3CCJ S;  3CCU S;  5ETK A;  4K4X A;  3MM6 B;  5L1L A;  3FEY B;  2NPI A;  3L3C A;  1H72 C;  1UPM B;  1VC5 A;  4P7T A;  3FUY A;  3T1Y J;  2G13 A;  3AOB A;  3DKD A;  4LRB A;  1SC3 B;  3QSY B;  4F04 B;  4A8Y A;  1DY3 A;  1V5I B;  2WSE C;  4C8K A;  3M8R A;  5A76 A;  3FCV A;  3WX4 A;  1JLE B;  3CCS S;  4NI2 A;  4B9T A;  4CYU A;  1QLN A;  4MT1 A;  1R6V A;  1GTE A;  1QTM A;  4ID8 A;  3NNA A;  3GCX P;  4KRW A;  3T5J A;  3CXC R;  3LWL A;  2IA6 A;  3KUG A;  4QYR A;  3GYN A;  1CJT B;  1FXR A;  1SV5 B;  4CWB A;  1SJQ A;  1VRT A;  3TZW A;  1DTQ B;  4DPO A;  3HVA A;  4P2M A;  3D6H B;  4CLZ A;  2VIC A;  1PSD A;  1TMJ A;  1N33 J;  1X5P A;  1R0C B;  5CZV A;  1S76 D;  2W1B A;  2GNK A;  5KFK A;  1S9G A;  5IV3 A;  4ZVH A;  4EYH B;  4HLB A;  1DFD A;  1S1U A;  1IWG A;  1E6V A;  2MLY A;  2ZNY A;  4D3H A;  1KHV A;  2BE7 D;  5DDQ C;  4M94 A;  4L76 A;  1L3U A;  1DLO B;  1YJN S;  2QFJ A;  4S0M A;  2ZE2 B;  1WC4 A;  4YQW A;  4Q0B B;  2QSF A;  4WBF A;  3ZZT A;  4NLU A;  2HWH A;  4HDG A;  4X65 J;  3NBP A;  2CG8 A;  4WCE Q;  3HHK A;  5B0F A;  2NXN A;  3CDE A;  3G4S S;  3T1H J;  4ZIT A;  4JV5 J;  3E01 B;  2RQM A;  3TZZ A;  2HFO A;  2HK3 A;  5HQM A;  1XIQ A;  1RT2 A;  4ZPC A;  2VPZ B;  3BBB A;  2P5V A;  2V8V A;  3CCM S;  3BR8 A;  3GII A;  4DV3 F;  3SIP B;  3CJK A;  5CHC B;  4F2R A;  4MK8 A;  3DLE A;  2XY5 A;  1Q5V A;  2E1C A;  2F63 A;  4URG A;  4O44 B;  5KFU A;  3KJQ B;  2RIL A;  1ITP A;  1JLQ B;  2GW8 A;  2FHO B;  2LA6 A;  3IAM 9;  4NOH A;  3CCW A;  4KFB A;  4KHP F;  4ZIV A;  2RJZ A;  4IRK A;  2XZD B;  1FXD A;  3M1V A;  1RBA A;  4I6W A;  1N6Q A;  2AEJ A;  2YNH A;  2ZD1 A;  1LFW A;  2OLW A;  2WOM B;  2XSJ A;  3TW0 A;  2YKP A;  3CW2 C;  4KKO B;  3MM9 B;  4LFC J;  4GRS A;  4OZJ A;  4IKA A;  2W7A A;  1GMV A;  4DL6 A;  5ETR A;  4K4Y A;  3PJW A;  2EFV A;  5GAH I;  3DOL A;  1RAG B;  1I5O B;  1RE1 B;  1RWP B;  4DWI A;  2W9B A;  1IBM J;  1MMD A;  3E8O A;  5DM7 Q;  4EZ6 A;  1FEH A;  3K8V A;  4RPF A;  2UXC F;  3KK1 B;  1HW8 A;  3GFY A;  4ZK7 M;  3LGN A;  2MQ8 A;  5L8R C;  4UW2 A;  1R43 A;  2RKI A;  5KFC A;  2K7K A;  2KFZ A;  3UN3 A;  4LF1 A;  1QJH A;  3UCU P;  3RB6 A;  4HR2 A;  1QAY A;  2QL7 B;  5EWG A;  1KTV A;  4OQJ A;  4J9M A;  1S6P B;  5MAO A;  4DL0 C;  2ROG A;  5ETN A;  4YY3 F;  3UR3 C;  4PZV A;  4DCJ B;  1WKL A;  2FJX A;  3MHY A;  2ZH7 A;  1EQ0 A;  3WBZ A;  2FYX A;  2BBE A;  2B6A A;  3GG1 A;  1SL0 A;  4CH0 S;  2M2B A;  4TKT A;  5J2Q B;  3GFZ A;  1N8R T;  3ADA C;  2O66 A;  2Y9H A;  4ALZ A;  3IA0 A;  1F60 B;  3HO1 A;  2CDQ A;  2OPP A;  3QFW A;  5KFI A;  3BSO A;  2E44 A;  3LPE A;  5EGY A;  4G1Q B;  2W2Q P;  2R4F A;  3BZQ A;  2KFN A;  4FBU A;  1RTH B;  2DH7 A;  3POT A;  2DT9 A;  3GSD A;  1IKX A;  1RK8 A;  4URQ U;  1B70 B;  2UZA A;  3M8Q B;  4DR1 J;  1T7P A;  4NLQ A;  3W64 A;  4OHX A;  3MMC A;  5F8G A;  2KN4 A;  3CCV S;  1VRU A;  1OMS A;  4ID5 A;  2XYG B;  3OTD A;  2VQE F;  2DNY A;  1OIA A;  2OSR A;  3CF5 Q;  4DX6 A;  3TWZ A;  2AWZ A;  3QGP A;  1Q53 A;  2ZZT A;  4H4K A;  2IDE A;  3P4U B;  1OWX A;  2LEB A;  5F8M A;  4ZPV R;  4KTQ A;  1S9E A;  1O51 A;  2HG4 A;  4YR2 A;  2GO9 A;  3DRS A;  2HZC A;  3WIU A;  4RU2 A;  1CQN A;  2YQ1 A;  3LA0 A;  4XK8 C;  2FVC A;  1UTA A;  3VAH A;  4HT5 A;  2QMX A;  1H2V Z;  2DGQ A;  2ZOM A;  1W2I A;  1U2C A;  1DHM A;  1T11 A;  2GML A;  4USJ C;  3TQE A;  2HHH J;  2BJ7 A;  4DCP B;  3IGV A;  5DJB A;  1YSJ A;  2C2Z B;  4DR7 J;  1HNX J;  1YG0 A;  1FWL A;  2VU5 A;  3R6G B;  3JTO A;  2IAJ B;  4ZLL A;  4GVB B;  5KFW A;  4LVN P;  4DPT A;  4OX8 A;  3NG8 A;  4DV5 F;  2DGW A;  1TK8 A;  2HFU A;  2ZBR A;  2DR5 A;  2V8G A;  2IVF B;  2ZVS A;  4WKR A;  3EDQ B;  2CZ9 A;  4USM A;  1N56 A;  2Y1J A;  2DGT A;  2HHQ A;  1TU0 B;  3NGD A;  2UUA F;  4YR3 A;  3F56 A;  2F3J A;  3NS5 A;  3OSP A;  4J9L A;  2DEI A;  2A6M A;  4LF8 J;  3IFE A;  4LRD A;  1Q95 G;  5J1E A;  1WC0 A;  1RTJ A;  3UD3 P;  1BWV A;  4P7V A;  1ICE B;  1HNW F;  1TAQ A;  2H4Y B;  3J80 U;  2G2O A;  2H48 B;  2RUG A;  3BN4 A;  4V19 J;  2A1B A;  2HHT A;  2AV5 A;  3M4X A;  2ZOG A;  2YKN A;  3CWJ A;  3WIV A;  3FSI A;  3KLE A;  1EQM A;  2AIR B;  3RRG A;  4ZPT R;  9ATC B;  3ILJ A;  4X4R A;  3OD2 A;  4X4U A;  1S57 A;  3HFV A;  4MIB A;  5CYM B;  4H4M B;  2HHU A;  3PW7 A;  5IQ6 A;  2AEM A;  2DNZ A;  1T9W A;  2BJ1 A;  3DMJ A;  2W4C A;  2EW9 A;  3MEK A;  1WHW A;  5L1J A;  3IR6 B;  2B4U A;  1FX2 A;  1N5Y B;  3HK2 A;  1RBO B;  1PJ6 A;  2UVR A;  2BQR A;  2LQJ A;  3MPU B;  4KPY A;  3O2I A;  2ATC B;  1OY8 A;  4DOZ A;  2I0X A;  4PG4 A;  1LKZ A;  1QY7 A;  3OTE A;  1RBL A;  4U8V A;  4O23 A;  2E9T A;  3KLV A;  4ZVQ B;  1P9Y A;  1F5B A;  2CQP A;  5C42 B;  3OUY B;  3G87 A;  1UPP A;  2UVV A;  3P49 B;  3VGT A;  1DQ8 A;  5E7O B;  4F4Y A;  3QQC D;  2AMC B;  2HKE A;  4JV0 A;  3AJ1 A;  3GIL A;  3W66 A;  3DNC A;  2ZH1 A;  1EAY C;  2YKO A;  1W26 A;  2VBX A;  4DQI A;  1AW0 A;  1CS4 A;  1PKU A;  3BGL A;  3SI8 A;  1GH8 A;  1AT1 B;  1RUS A;  1VQP S;  4LSN B;  2CYY A;  4DZ6 A;  3DM2 B;  1NDL A;  3S6E A;  2NUH A;  2XBP A;  2MQP A;  1RAH B;  2YWF A;  4DR6 J;  3W5Z A;  1HW9 A;  2EFP A;  1WNE A;  1X4F A;  2ZH2 A;  2NSB A;  4AND A;  1IXK A;  1NK0 A;  2HMI A;  1N88 A;  3BPD A;  4EWT A;  5GMD A;  4RW9 B;  3KUE A;  1DJ0 A;  1KRP A;  2RU9 A;  4ECZ A;  2B5J A;  3IGN A;  2W2P P;  1RQ0 A;  2ZJQ Q;  4E8U A;  2YKA A;  1YBT A;  3UN2 A;  2V5H G;  4O4G A;  3OPK A;  5U47 A;  4ZP6 A;  4FN5 A;  2VOD A;  1WOO A;  4RUC A;  4LFB J;  1T05 A;  2MKC A;  4IH6 A;  1WC6 A;  3KYL A;  3GFX A;  2QTW A;  2DIV A;  5KFO A;  4IQM A;  3PKM A;  2W4D A;  4USU A;  2HYI B;  3TI0 A;  5MLC V;  3KNG A;  1APS A;  1DAX A;  4IG3 B;  3L4B C;  4DFM A;  5B7W A;  1JJC B;  3UPF A;  2JL9 A;  3KHL A;  2UU9 J;  4LRC A;  2YVS A;  3GV5 B;  1HR0 J;  1R27 B;  2FTR A;  5JXS A;  4ZCM A;  4NXN F;  2V9W A;  5AXK A;  1XNQ F;  1FRI A;  2DHA A;  2VJU A;  4OHY A;  3CNQ P;  4AT1 B;  1Y4Z B;  3MD1 A;  2VIH A;  5HBM B;  4FYW B;  4QWB A;  2XM3 A;  1XC9 A;  4JI7 F;  4B08 A;  3VGV A;  4JI4 F;  3VAF A;  5T14 A;  1I94 J;  4M95 A;  3CDW A;  4C8N A;  2B8P A;  5C2G A;  5H9F K;  4JI8 J;  2B7B B;  4M1K A;  3MR5 A;  3EPG A;  3OVS A;  3PR4 A;  4LSL B;  1LK5 A;  5D0G A;  1Q5Y A;  4TYA A;  5C24 B;  1YJ7 A;  3V81 B;  4DV1 J;  3PVX A;  3CCQ S;  4MIA A;  1IJE B;  2VOO A;  1VIO A;  1EHW A;  3IS9 B;  4ZVT B;  3C16 A;  3CUL A;  4CO5 A;  1LWE B;  4ECX A;  4JI1 F;  4R8U A;  2VPY B;  2XS2 A;  5F9L A;  4C8Y A;  1ZPV A;  3VVT A;  4DCO B;  2BXJ A;  3GZ7 A;  3KDO A;  5A8W B;  2WVE A;  1T9X A;  5ETL A;  5IV4 A;  1LFP A;  3THT A;  3R6L B;  1RA7 A;  3FC9 A;  3TEG A;  4K7Q A;  4WP8 A;  2F4V F;  4WU2 A;  3HHL D;  3J81 Y;  4WTY A;  3QPI A;  1P8G A;  1H38 A;  4RW8 A;  1KTQ A;  3THV A;  2PN6 A;  2EPI A;  4QPT A;  3T41 A;  2ZBI A;  4IH5 A;  2H1Y A;  2VG6 B;  4KYZ A;  1U45 A;  4CH7 A;  1KLM A;  1HWL A;  2PFF B;  4N41 A;  2V94 A;  2NUU G;  4NE9 C;  4I69 A;  1FFS B;  3FFI B;  5KG0 A;  1Q7L B;  2XCA A;  2VG5 B;  3QSI A;  1RI7 A;  2OKQ A;  1DTT B;  5LSL A;  2CZ4 A;  2JEJ A;  1K47 A;  5K8O A;  1YVF A;  3UN5 A;  3KLH A;  3R2D J;  3M8Y A;  2HZA A;  1SL1 A;  2P9G A;  4FYX B;  1S5Z A;  4B3O B;  1P27 B;  5EUH A;  4JV1 A;  2IPO B;  1NH7 A;  3N79 A;  3PV8 A;  2FB0 A;  3MMA A;  3KLI B;  1YJT A;  3PEJ A;  5CD4 A;  4HL9 A;  4ECW A;  3Q8S B;  5B0A A;  4C3M A;  1B3T A;  2ZM6 F;  3ILI A;  3HHE A;  4Y2K A;  3MF5 A;  4F4W A;  1EIY B;  4DSE A;  2X7I A;  1U1K A;  1JLC B;  3LP0 A;  2CPD A;  1UVM A;  4ED0 A;  1N34 J;  2BZ2 A;  4OZL A;  5CD4 H;  4ED2 A;  3QAE A;  4OFZ A;  4PR6 A;  4C9D A;  2VFU A;  3D0G E;  1RHM B;  1SH2 A;  3G82 B;  2KVI A;  1UVN A;  1J5E J;  4AXJ A;  4F0H A;  1V9O A;  4WE1 A;  3M2U A;  5IS2 A;  1LWF B;  2ZH5 A;  2DPI A;  4QPX A;  1IKY A;  2WSC C;  2E7W A;  1PC4 A;  4DV3 J;  2NR0 A;  2OP5 A;  3VAL A;  4RW4 B;  3D4J A;  4ED8 A;  3BB5 A;  2FC9 A;  4LF5 F;  3KTQ A;  2OPQ B;  5E3C A;  3EZ5 A;  2KB2 A;  3P6Y C;  3GV7 B;  4X4O A;  2D9P A;  2CAD A;  6AT1 B;  3R5J B;  5L39 A;  3NOC A;  4KHP J;  4M5J A;  3D28 A;  2L08 A;  3NNH A;  1LV5 A;  3IP0 A;  3IWL A;  1D8Y A;  4TU7 A;  3K57 A;  5KFZ A;  1AYE A;  1WOS A;  1U6Z A;  3T5H A;  5KFH A;  4EBE A;  1NB7 A;  3K5L A;  2BAC A;  2VQF F;  1T94 A;  3K5O A;  4C11 B;  3BSC A;  3QJP A;  2CWX A;  2LFV A;  2X3G A;  4RWX A;  2NYI A;  2DIU A;  1JLA A;  2Y1I A;  2EK1 A;  2ILZ A;  3T6B A;  5F3Z A;  2F8H A;  2GMJ A;  3H5Y A;  5A8K B;  3NOG A;  2OHD A;  4B3R J;  3KG4 A;  3CMA S;  3QT8 A;  4ZIW A;  1LWC B;  2FVR A;  1BQM A;  3C14 B;  3VAG A;  1SJR A;  3ZZU A;  1UVJ A;  1NPP A;  1FJC A;  2RDJ A;  4KJI A;  3W9I A;  3FBB A;  2KO1 A;  4ZJO A;  3ZTP A;  3DGP A;  1IQZ A;  1SJF A;  1R8H A;  3CCE S;  3FGV A;  3A8J A;  2GJF A;  5CYQ B;  3FRY A;  2IA0 A;  5RUB A;  1KOO A;  1JB0 C;  2DEJ A;  3UW1 A;  4A8O A;  1VJW A;  4OJG A;  1GFW B;  3P45 B;  4IR1 A;  1ZM9 A;  2C2K B;  3V5R A;  2OPS A;  5C25 A;  3KDN A;  2HQI A;  1TK0 A;  2WAQ D;  2KTQ A;  3OTB A;  2HS4 A;  2FLL A;  3PTW A;  1PBA A;  1YQH A;  3CJT A;  1IKV B;  4RUB A;  1ELO A;  1M5P C;  1FHT A;  3DFE A;  3I5A A;  1NXI A;  5EWF A;  5BR8 F;  5D0E A;  2ZWO A;  3K89 A;  3A8K A;  1O8B A;  4Y28 C;  2E1A A;  4IO1 A;  3LAM A;  5KFY A;  8AT1 B;  4CTA B;  1TV6 B;  3ZTS A;  4I2Q B;  4DV0 F;  2UVU A;  1XR5 A;  1H0H B;  2QV6 A;  1TMM A;  2VQE J;  3NMA A;  3HSJ A;  4MKY A;  1G4C A;  2CPY A;  2GVD A;  4FYD A;  3Q24 A;  3SCI E;  1H98 A;  3DLK B;  5ETP A;  4OHZ A;  1CJV A;  2UUC F;  1QSY A;  1T0T V;  2HHW A;  1NSQ A;  3CCR S;  5K14 B;  3R8Y A;  2JHE A;  3K8W A;  3GSI A;  2GQQ A;  3HVR A;  1ZM2 A;  3M2V A;  1WSR A;  2AD9 A;  1S99 A;  4KGZ B;  2OTL S;  2HGN A;  3GIM A;  1PAE X;  4LBP A;  2EC2 A;  4R5P A;  1AB8 A;  1EKR A;  3CJ8 A;  4DL3 A;  2V67 A;  2HK2 A;  3SYZ A;  3QRR A;  4ECS A;  3JS9 A;  3MR6 A;  4XPC A;  4MH8 A;  4ZCI A;  2N3O A;  4DV5 J;  1VK3 A;  1FDA A;  4HVZ A;  2B9X A;  1HMV A;  3MMJ A;  3T19 A;  4WFA Q;  2MLX A;  3I9V 9;  5F8N A;  1H2U X;  3KUH A;  1P6T A;  2ZH8 A;  2XMW A;  1IR2 A;  2XWX A;  5DDP C;  1SUQ A;  2UUA J;  4RZR A;  2X51 A;  3P96 A;  3PYD A;  3C15 B;  2KT3 A;  2QZ8 A;  3D2W A;  4TLQ A;  1MRO A;  1HQE A;  2J0X A;  5C5J A;  1JLG A;  1PC5 A;  1GAO A;  3D0H E;  2QFI A;  4CO0 A;  3T1A A;  3HHD A;  5GAG U;  2VDI A;  1HNW J;  1TL3 A;  1VQM S;  3PYE A;  1RT1 B;  3I31 A;  1YJR A;  4J9K A;  4F25 A;  2ATL A;  2VPW B;  2OMO A;  3E3X A;  1VHI A;  4FKY A;  3KLF B; 
#chains in the Genus database with same CATH homology
 1CJK A;  4WPA A;  3C16 A;  1CJU B;  3G82 B;  4UST A;  4CLP A;  1CJT A;  1WC6 A;  4P2X A;  3ET6 A;  4CLS A;  3C15 A;  1WC4 A;  1AB8 A;  1CUL B;  4USU A;  1CJV B;  1WC0 A;  2GVZ B;  1FX4 A;  4OYW A;  1Y10 A;  4OYA A;  4CLU A;  4OYO A;  3C14 B;  5D0E A;  4CLL A;  3MAA A;  4WP9 A;  1CS4 A;  4OYZ A;  4NI2 A;  1WC5 A;  1U0H A;  4CM2 A;  1AZS A;  4OYB A;  4WP3 A;  4CLY A;  3UVJ B;  3MR7 A;  1CJK B;  1Y11 A;  1TL7 A;  4P2F A;  5IV4 A;  3C16 B;  2QV6 A;  1CJT B;  5D15 A;  4CLW A;  3ET6 B;  4WP8 A;  3C15 B;  2BW7 A;  4OZ3 A;  2GVD A;  4USV A;  4P2M A;  1CJU A;  3G82 A;  4CLZ A;  1WC3 A;  1FX2 A;  1CUL A;  1CJV A;  3MAA B;  2GVD B;  2GVZ A;  4USW A;  1CS4 B;  2WZ1 A;  4NI2 B;  2W01 A;  1YK9 A;  1WC1 A;  1U0H B;  1AZS B;  4OYP A;  5D0H A;  5D0G A;  1YBU A;  3C14 A;  4OYM A;  5IV3 A;  1TL7 B;  4OYI A;  1YBT A;  4CLF A;  4CLT A;  4OYX A;  4CLK A;  4OZ2 A;  4CM0 A;  3R5G A;  5D0R A;  3UVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...