3UVJA

Crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
191
Chain Sequence
QVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Guanylate cyclase soluble subunit alpha-3
publication title Crystal structures of the catalytic domain of human soluble guanylate cyclase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 56
structure length 191
sequence length 192
chains with identical sequence C
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3uvjA00
3MAAB 4CLSA 4WP3A 1FX4A 2QV6A 2GVZA 3ET6B 1CJTA 2W01A 4OYZA 4CLYA 3C14A 3C16A 1CJKB 4OYPA 4USVA 4NI2B 1CJUA 4OYIA 1WC6A 1AB8A 4CLFA 1WC1A 2BW7A 1CJVB 1WC3A 4OYAA 4CLPA 4P2XA 4WP8A 1Y10A 1AZSA 1CS4B 5D15A 4OYBA 2GVDA 3G82B 3R5GA 4OYMA 1TL7B 3ET6A 1CULB 4CLUA 4CLWA 1YBUA 5D0GA 1CJKA 1CJUB 5D0HA 1U0HA 4NI2A 1WC0A 3C15A 4CLKA 4OZ3A 5D0EA 5IV4A 3UVJB 4USWA 1CJVA 4USUA 2GVZB 1CJTB 3MAAA 1Y11A 4USTA 3C14B 4CLTA 4CLLA 3C16B 4OZ2A 2GVDB 5D0RA 4OYOA 3G82A 1YK9A 1TL7A 4CLZA 5IV3A 2WZ1A 4P2MA 1CULA 4WPAA 3MR7A 4OYWA 1YBTA 4OYXA 1FX2A 1U0HB 4CM0A 3C15B 1AZSB 1WC4A 4WP9A 1CS4A 4CM2A 1WC5A 4P2FA 3UVJA
chains in the Genus database with same CATH superfamily
4PUOB 2I5JB 2Q6BA 2RB7A 4DL7A 2GO9A 3TQEA 1NDLA 3JSYA 1GEHA 2CQCA 3I0SB 5F8NA 1AB8A 3VGSA 4W90B 5B09A 3MR5A 2DGXA 4N8NA 1SC4B 2HBRB 2K2PA 4ANCA 1QAXA 1VQLS 3QYYA 1SH0A 4NLWA 1JJ2R 4E8UA 2GHWA 3GILA 4G1IA 3AJ2A 4EBDA 1JLEB 2NQPA 5IOLA 4OQJA 2CWXA 2XS5A 4DMZA 2W8KA 3ZZZA 5AXMA 4LVOP 2H5JB 3OVSA 4J9NA 5KG6A 3W8GA 3G4SS 1NPPA 2QL5B 3DLKB 3X3UA 2XYGB 3DU6A 2ZITA 4LF6F 2PT0A 2NZCA 3LPYA 3UE2A 1WI6A 5KT3A 5A2QU 1NK7A 1KNZA 3PEHA 4ZPCA 1YQHA 3RBXA 1HNWF 4K4UA 2UUTA 2I6WA 3MM5B 2B3TB 3HM9A 4ECSA 3DKDA 2VKZG 1QVFR 2WVFA 4PUOA 2I5JA 2C1EB 4IOAQ 3JTNA 1KHWA 4OZ0A 4IRKA 4LF9F 1GT8A 3EGWB 3PX0A 5JXSA 5DJBA 3W9IA 1N4LA 3HD1A 2CQ3A 2MKCA 3I0SA 3BZQA 1NXIA 2RD5C 2XHWA 3KTQA 5IC6B 4Y2AA 4F4XA 1S1UB 1VLYA 5D0RA 4ATNA 3I5AA 4BLGA 5F8JA 1VIOA 5A76A 2CKWA 2AEJA 2YQ3A 4AXIA 1WC4A 3M9MB 1JLEA 3HSGA 5IXUA 2W1BA 5KFGA 3J81Y 1NAQA 2HQ3A 3H98A 4EU0A 3KUHA 3G8QA 4LBIA 2H48B 4O3RA 3DLKA 5CZVA 1Y00A 2XLKA 4DR5F 4ZP7A 2UVUA 2DRDA 3GJRB 1YG0A 3R5GA 1UMJA 2EFQA 1S4EA 3V81A 2YBVA 3R27A 2C3UA 5DS7A 1WF2A 2N4DA 3CEDA 1U0HA 5DRKA 3V4IB 2YKMB 2PMHA 3LAMA 3LWMA 4R5PB 3MM5A 4RKUC 3OV7A 1CPZA 3EPIA 3IC1A 3H5SA 5THWA 4D3GA 4QWEA 5E3RA 1Q5YA 3RUBL 5K5MA 4YDXA 3NOGA 1RU2A 2HWTA 1HNXF 3VZIA 2X51A 3RW6A 3NNCA 2G9OA 3AAWB 4GC6A 4AYBD 4WZMA 3HHLB 2DGOA 3A1YG 3BH6B 4RW8B 2LEBA 1S1UA 1SL1A 4J9QA 4ZPWR 2AX0A 3VAIA 1WDDA 2ZM6J 1GK8A 4IG0A 1WF0A 3ENVA 3IR7B 5MAOA 1R8CA 4M5LA 2IFXA 5CA5A 5F8IA 3W5ZA 3NBPA 4QBUA 4ZLPA 4DCPB 1YGYA 1HMVB 1FRKA 5IWAF 2OIHA 4KT0C 1C4AA 3U7JA 3J81U 5H1SV 3QJPA 2L41A 3Q2TC 2Y8WA 2R8IA 5BXIA 2QLJB 3JSMA 4O0IA 4URSA 4AXJA 1V9OA 1S7IA 3AOAA 4MMOA 4CZCA 2BOAA 2ZOGA 2B43A 4X4QA 3T41A 2RUGA 4GKKF 4IG3B 4R0JA 5FLXY 3HI9A 4DR2F 3I5BA 2B56A 4DG1B 5HAOA 3MPWA 2VJUA 2DNOA 3V4IA 2YKMA 4DCOB 1CLFA 4ED1A 4R5PA 1FX4A 2UV8A 1D1UA 3QRPA 3HZGA 4ZK7M 3HT0A 3TUZC 2GAGC 3W60A 4OX9J 1WJ9A 3KWMA 2I38A 4ZHRB 5CAAA 1VBZA 4NI2B 3SV3A 4Q5VA 3UFCX 2HZCA 1CSJA 1R6YA 2R8JA 3HHLA 5D15A 1UP1A 1M5KC 2CDRB 1VQ7S 1HWJA 1Q8IA 2Y1LB 1FA0A 3T19A 1HBMB 3IAS9 1FI4A 5D0HA 2B5JA 4ZIWA 4Q8EA 2E1RA 5HJXA 2WSEC 3PRVA 3EMTA 3M8RA 2G1DA 5JMNA 4MKVA 1JJHA 3C14B 2K06A 4NLXA 3J7Z5 2WVEA 5HLFB 1HMVA 2HHSA 5KFQA 1T03B 1EQMA 1D3WA 4ICLB 2WTFA 4ZLNA 2RAQA 1NK4A 4LBPA 4FPRA 3RBZA 1H6KX 5DQGA 4DSKA 4YR0A 1SL2A 1G7CB 2QC3A 4X65J 1TFWA 1SV5B 4J9LA 1ULRA 5U47A 3HVWA 3K5MA 4HR2A 3HHLD 3D67A 1TKDA 4IG3A 1VQ8S 1EHWA 3LTOA 4ETZA 2HZAA 2JSXA 2ALZA 1A7GE 3TANA 3CJ8A 2LYVA 3M7VA 2GMHA 4USJC 4B3RF 3RB3A 1Y5NB 4FXVA 1SL0A 4JUZA 2GHVC 3CCSS 3P6YC 2PO4A 4ZHRA 4NI2A 5EWFA 3PYEA 2CQHA 1HQEB 1QUVA 1RYRA 1CC8A 3MGJA 1IBMJ 2ZOFA 3FEZA 1IJFB 3CCMS 1RKIA 1BQMB 1PJ7A 2DBBA 4P9SA 4N77A 4ECXA 4CDIA 3TVZA 1KEKA 3CCZA 1P1TA 2KN4A 3CC2S 4OX8A 4IOCQ 4TKTA 3C14A 3E01A 4NZ0A 1NJYA 1KQFB 5KT6A 3CCRS 2QZ8A 5HLFA 1XQIA 2IJFA 5GMEA 1T03A 3HX9A 3A3PB 4ICLA 4KO0A 3W8PA 2YH1A 4Z7YA 1SH2A 3ELHA 2LVWA 2W2QP 1U1LA 2MY7A 3QGPA 1H74A 4EGLA 4ZDNA 4C3KA 5LMUF 4HVZA 4ZCIA 2BQRA 2P9CA 1WHWA 4ZKAA 1WWHA 3TYTA 4QWCA 4URQU 1F5BA 1TK0A 1OPIA 4NXNF 1S97A 4RWWA 4K4YA 4FYYB 3DRSB 4WTOB 3VAGA 2AJQA 1IBKF 2F65A 2HHUA 3PV8A 1H3DA 1YLXA 3SCJE 4EYIB 4NCGB 2DGSA 3OD2A 3EGVA 4Y2KA 3I4PA 4URGA 2V9WA 1T11A 2G2OA 2AZ1A 1L5UA 3ENWA 1HQEA 2V8HA 1U45A 1BE4A 2NS1B 1BQMA 5D4PA 3CJTA 1VOMA 2ROEA 4OJ3A 1U1NA 1GMWD 1LFWA 3EZUA 1RK8A 4LSNB 2KYZA 1RE1B 3PKMA 2FPHX 4C7QA 1F5AA 4DV6F 3BF4A 4HTJA 2DY9A 4RL1A 3FCVA 3DOKB 4L72B 4KSEB 1CJUB 5K8PA 4P2SA 4YB7A 3CNQP 2ZH7A 3MPUB 3MEGB 1C4CA 3K5OA 2YXLA 3MPYA 4WIQA 3OVAA 2ZJQQ 4EI2A 1FRMA 2KU7A 2UXCJ 1FWKA 2WHOA 3BM7A 3PW5A 4C11B 2MJUA 3VGUA 4YR3A 4BS2A 3FKBA 3AA9A 5DDPC 3BB5A 1XC9A 2R7UA 2XYPB 3RZAA 2R4FA 5B0EA 1FVSA 1J27A 4RU9A 5DG8A 3GR0A 2XBPA 4QIVA 4ECWA 4ZP6A 2G0CA 2MLYA 3DRSA 2O67A 1N5TA 2HQCA 4UUWA 5EX3A 3J7ZT 5FDLB 4NCGA 4Q44A 4NRUA 2H65B 4PR6A 4XIUA 4YP3A 2FJBB 2XULA 4Q45A 3BPDA 4ZJLA 2UUWA 4CP5A 1LOUA 1H98A 2HK2A 4GMKA 3KKFA 1UKUA 1IBCB 2OMLA 3HHEA 4FXDA 2CJXB 3G71S 2MPUA 3R5CA 3HD2A 3AHPA 4LFAF 4LSNA 1JXLA 1NH7A 2XMKA 2E5JA 3KYLA 2BVZA 4WFZA 1N6QB 4F0HA 5CH7B 3P8BB 2GC8A 3LP2B 3EVOA 1YJNS 1U2RA 4CQ1A 1NHUA 4DV3F 4ITSA 5LMNF 2DISA 2FY8A 2DR7A 3DOKA 2C2RA 4CM0A 4DR1J 2MB0B 2DGUA 2CQ2A 1C0TA 5KFAA 3MAQA 1VBYA 1RHRB 3MEDB 3MEGA 2DNZA 4DX6A 4FPIA 2HMIB 1UZHA 2CPJA 5E3PA 1U48A 3W9JA 2VIHA 1UWAA 1RHQB 1U6FA 1BQNA 2Y0BB 4C11A 1RWVB 1HI1A 4C98A 1RLDA 2KXNB 5DLFA 1J5OB 1WHVA 1EZZB 1VQ6S 3GCXP 2XQCA 2XI3A 4HT7A 2MSSA 5HI7A 1P8GA 2PFDA 2ATLA 2ZWPA 2RQKA 2H3EB 2LA6A 2OEKA 1MU2B 5FDLA 2KRRA 1WORA 4CI0B 4YR2A 2FVCA 3T9ZA 5B0GA 2MQPA 2XC9A 2ZH9A 3SIPB 2JC1A 3WZ0A 1WHYA 3SXLA 4O3NA 2B4VA 4OX7A 3VAJA 5D4NA 4ZITA 3M2RB 2VASA 1VQPS 1Q53A 1WKKA 4CNYA 1F3VA 1KRPA 4X66F 3UR3C 4J9OA 4MIBA 1HWUA 4LFBF 4CIOA 2IIHA 2J8AA 4K0KF 3ILOA 4I6WA 1FHTA 2B9EA 1VS3A 3OVBA 1N6QA 3BN4A 3CO0P 4DV4F 2WVCA 3LP2A 3AQOA 3OJUA 3CCTA 1EB0A 2DH9A 3V6HA 1X9SA 5L39A 4OYAA 3NWRA 4JBCA 4QOTA 4P2XA 1TP7A 3FMWA 2IY5B 1WEXA 1KVKA 4B9TA 5CHCB 1UCNA 5EUHA 3DI6B 3MEDA 2V34A 3DLLQ 3OTBA 4JOUA 4P72A 2HMIA 4RW9A 4ZP8A 2DITA 2RF2B 4A8MP 3THVA 2ZFHA 3GZ7A 2GHPA 3N4WA 3PDNA 1IWAA 1FDBA 1DQ9A 4YY3F 3IXQA 3DU5A 3CTRA 3NCQA 5GAGU 4MK9A 3N79A 2PFFB 2KTQA 4ZA1A 4WFAQ 4KGVB 3IWXA 4XTTA 4NEZA 3MEEB 4LT6A 3BYPA 2K7KA 3V2UC 1MU2A 1HNZF 2W4DA 2JEGA 2EG1A 3TOQA 3EJMA 2VDIA 4JP8A 2VPYB 4NL5A 4FXWA 3MPDA 5L1LA 2ZUGA 3AH6A 2J0QD 2JFDA 4EZ6A 3R2CJ 2W2OP 3RB0A 3MEKA 2FZCB 1PC5A 3M2RA 4Q7AA 3CMQA 3NGDA 4KHPJ 4WP8A 2WW8A 3D0HE 3L7PA 2MHNA 3J7A1 5GAEI 1RT3B 4K4XA 3DFEA 1F5CA 3D9BA 1HWKA 3K17A 4D3HA 1CEZA 2GJIA 2CJ9A 1XBWA 2ZVSA 1QJHA 2I2YA 1OPZA 3HJFA 2HHHF 2ZH1A 1WC0A 4F04B 3IS9B 1X5TA 3N01A 2CQ0A 3N9UC 1RCXB 1NMEB 2OFHX 2DYAA 1WG5A 1OMSA 4LFCF 3M6WA 3W61A 3DI6A 3QWPA 2CZ4A 4Y0FA 3DMJB 4A4JA 4I6YA 4N5SA 1U1RA 4L75A 1FKPB 2W9BA 2HWIA 3RAXA 4M8LA 5HP1B 2KVQE 3QJJA 4F2SA 3I0RB 4GO7X 4C0HA 5B0DA 3A12A 4RW7A 2RQ4A 2WVBA 5T41A 1HWIA 4PXCA 2AX1A 3MEEA 2VA3A 3BSOA 1PAEX 4A8SA 1GFWB 1YIJS 1V3SA 4OHYA 2RS8A 1Q82T 4OLPA 2KVIA 2PMZD 2BANB 5HMWA 3E8OA 3AD7C 2Q3PA 2HVHA 4N8OA 4W92B 2VG6B 3H40A 5KG5A 3ZZTA 1Q7LB 2AGQA 4CH1A 3EVWA 1OSDA 1B70B 1DLOB 1YJRA 4WTYA 5KFCA 1UAWA 3GV5B 3FK4A 1VQ9S 2LCWA 3CDEA 2CPFA 2OGUA 1RT3A 1VGYA 4K4WA 2EKYA 3OQ2A 2RVJA 4MIWA 3FEYB 1MWQA 5HANA 2IRXA 3IS9A 4PXEA 3NNAA 1J5EF 1O8BA 5ITHA 3OT9A 1VQSA 1B7YB 3BV8A 3O5TB 1Y5LB 1NK6A 1RA7A 2ILYA 2HQIA 4WFYA 1I94F 2V4RA 2F63A 2HWHA 4WFBQ 3R5DA 2APOA 3P5TL 2EFNA 2XS7A 1H7WA 1NSPA 1FKPA 1HHTP 3M8WA 3O6QA 5IT4A 4DQSA 1BUXA 2MKHA 1N0UA 2IYIA 3AB4B 5HP1A 2HHTA 2NUUG 3G6YA 4DS4A 2HFUA 3I0RA 2Z2LA 5B0CA 4ZP9A 4JV5F 1R0AA 3CJ5A 4GKJF 1HHSA 1TKXB 2Y9HA 2ZHBA 4OZLA 3TJAA 3GJTB 1UWBB 1FE0A 2W9AA 1HHQA 1RA6A 3ZTOA 5HSPA 4LRBA 3DXBA 2BANA 3K5NA 2ZBCA 4J37A 4WCEQ 2KH9A 3TO8A 4LSZB 2VG6A 4HHJA 2F4FA 4ZVRB 2W2PP 2DH8A 3RBDA 2FY1A 3DGVA 2ASLA 4OLOA 5HVFA 1CS4A 1W2IA 1U1PA 3WC0A 2C42A 5A8RB 1DURA 1GX5A 2FJWA 4LF6J 4JI3F 2ZH3A 2E7WA 2QSFA 4DV7F 3J80Y 2CRLA 4OYPA 4RNHA 3KMSA 5KFTA 3SI8A 2P6TA 2KFNA 1FVQA 4QW8A 2D9OA 1NJWA 3MOZA 1HNWJ 3NGUA 2QTWA 3MFHA 4NASA 1S5ZA 2HVIA 1WDTA 3TVKA 5C24A 2A2DA 5DLGA 2CJKA 3U1MA 2VFTA 3M05A 4LF9J 1U8SA 1OQ3A 2QX0A 5KFJA 2G2ZA 2BJ3A 4FYWB 2YWKA 1K9MT 4DOZA 1BY9A 4B3SF 2HQDA 1NDCA 1UFWA 4KV8B 2E9TA 1SJ3P 3VWSA 3PW4A 2W2MP 5ETKA 2QA1A 3R5JB 1TKXA 1MMDA 1LWFB 3M2UB 1U49A 2RUSA 1UWBA 1OY9A 3DGPB 2DCUB 4A8WA 2IM2A 1F9HA 3P96A 4ED6A 5H9EJ 3VQSA 1OQ6A 3SSQA 1FWPA 2XSFA 5HQLA 2L9WA 3HSDA 2X3DA 2X1FA 2H9ZA 2J0XA 4M1KA 5GADU 4DR5J 2CG4A 5A8RA 3UD5A 3LWLA 3KJQB 3TAPA 4KJIA 4IH5A 3H59A 1YI2S 2ZJPQ 1YBUA 1Q4RA 2A10A 3LALA 3CB4A 4OL8A 1PO6A 2ILZA 1J2VA 3FZ2A 4U6PA 5J2MA 4DV2F 1X4DA 4I7FB 1RAGB 4ID5A 1M5SA 1S9GB 1WF1A 3CE8A 3DN9A 4S0MA 2CJAA 2GIQA 3T1YF 5EN1A 2YNFB 2Z30B 2YKQA 3QGIA 2IA0A 1IJEB 1TMJA 3VVTA 5FD1A 3NRBA 1DRZA 3EVMA 1HNXJ 4AE5A 3I82A 2BKNA 4KGKA 3ZTRA 1CJKB 3P49B 4YHHF 3QRRA 4C8ZA 4KV8A 2ALYB 2FJXA 1G2EA 3CVKA 5CCMA 3OHAA 2WBRA 1MW7A 2DNYA 1FT8A 4DL2A 4DSJA 3M2UA 4A8QA 1U47A 4DU8A 2K7JA 5LL6d 3DGPA 3PACA 4DHVA 3TUJC 4Q2LA 2DR6A 4KC5A 5IWAJ 1S6QB 1SKUB 3MMJA 3UDEA 2ZD1B 1IKXB 4USTA 2M88A 4RJVA 3OUYA 5LXRA 2FVQA 2ASYA 2LXIA 1ZM3A 1RT5B 5AJ3F 1FNXH 4KRWA 4HLBA 5CYJA 3IGVA 3HF5A 3J7AN 5IS2A 5CD4A 4M5IA 1ZM4A 4GKKJ 2JX2A 3O8WA 2ZOMA 2MY8A 4I7FA 4DR2J 1X31C 1PBUA 3ETOA 3CCVS 4ED7A 1S9GA 4Y34A 3EICA 2HZVA 1WC6A 1YRUA 3MD3A 2ZH4A 1T02A 1UPMB 1WEYA 4QWAA 4CWBA 1R27B 2CQ1A 1CG2A 4KB7A 1RACB 1CJKA 4FYDA 4P7TA 5DETA 1NZ8A 2YNGB 3PO5A 1JXEA 1Z2ZA 4PYDA 4USWA 4BWJA 1PKUA 3IM8A 4ZS6A 2CNLB 2V0NA 2HFZA 3DLBA 1VMBA 1IKVA 3Q8QB 3CIZA 1K0VA 1KVJA 3ZXWA 5I3QA 3RGIA 3KFWX 3B82A 1TL3B 3C8YA 3OFGA 4CO4A 1BWVA 2WK4A 3KUEA 2IA6A 3T1HF 2C2OB 4DFPA 2VC0A 3G6ES 2KB2A 4XK8C 1S6QA 1ZS6A 4K59A 2G2YA 2ZD1A 1IKXA 5B7WA 2VQFF 3T3FA 4DPTA 1KTVA 3K5LA 1RAHB 3PG9A 2FC8A 4HHHA 1VQKS 4TXSA 1NJXA 1RT5A 3FNNA 1FTCA 2NYIA 2HHWA 2HQGA 3B4DA 1B0PA 2MZTA 2HVEA 3ILJA 2B8QA 1TAQA 3R2DJ 2JVOA 2ZBRA 3MF5A 4ANDA 3T9NA 3PYDA 4L6V3 3CUNA 2CZ9A 4YDDB 1F9FA 2XCPA 3QIPA 4EK2A 2W2NP 4QYRA 3VZHA 4OZJA 4FF4A 2YQ0A 4B3RJ 3RB6A 3OXLA 4J9SA 2M2BA 3CT9A 1IXKA 2FHMA 4DX8H 2E5GA 1QSYA 3EX7B 2EEYA 4OZ5A 3NGRA 3TEGA 1JWWA 1YHQS 4ILRA 4IOBA 3OR1B 4Y2IA 3CCWA 1VDHA 5KFFA 1G3OA 2HGLA 4ZCLA 2YNGA 1YRXA 3IP0A 3CD5A 1Q8BA 1YVFA 2NXUA 4NXMF 1NRKA 2HBYB 4LR9A 4O3OA 1NO8A 3R6LB 4EBEA 2R2RA 2VPXB 3TNVA 1TL3A 3JYTB 4RW6B 4FKXA 4UT4A 2O5DA 3BO3A 2VFVA 3MHYA 1QVGR 3GQCA 2MZ1A 3CJSA 1IM4A 3FCWA 3GFHA 3JB9k 1VQ4S 1P1LA 1FXLA 4WXOA 3FQLA 5LMUJ 1H38A 2ZDOA 2F4VF 3BR8A 2DD8S 4A8YA 1CJTB 2GFFA 5CCLA 3M6UA 3BGUA 4DL3A 4NA2A 3MUMP 4X4PA 3UNGC 2B0GA 1UVJA 1G6BA 4NXNJ 3HFZB 4W98A 3RYLA 5LOQA 3GB0A 1X60A 3AQPA 1Q5VA 3SMZA 4A8KA 1IM6A 4DDFA 1Y4ZB 2MGZB 1IBKJ 2XSJA 4IO9Q 1TL1B 2IPOB 2LDYA 2DH7A 1IUJA 2W25A 3R7SB 3FGVA 1I6JA 2GZOA 2F8HA 2DK2A 3OR1A 4RNMA 2YNHB 3ITHB 1FFWB 1HBNA 1DZ5A 1T9VA 3MUVP 2IDEA 3TW0A 3NXZA 1O5JA 2OKQA 3F73A 1SJFA 3OLAA 1N34F 3HP6A 3HO1A 4PG8A 4CLUA 4G3IA 4WXWA 2XEXA 4B9SA 1VBXA 1IVZA 4YB6A 4ER8A 2F5GA 3GIRA 3QIDA 1NEEA 2OPSB 2VKRA 1XNQF 1U6ZA 1YSJA 1OJ4A 1Q0NA 4RW6A 2FUG9 4Y00A 5KAKA 5KG0A 3UO0A 2ADCA 1NPKA 1Y5IB 3L09A 3KLEA 5KG7A 4HDGA 2IVMA 1WSRA 3K57A 2XB2D 1NKEA 2A1BA 2W7AA 1WELA 1WC5A 2VB6A 4Z37A 4HEA9 3MR6A 2PEBA 4U7UK 3WIVA 1CJTA 1RTJB 4NLDA 2AYGA 2B4OA 1LK5A 2CVEA 3LF0A 1RT2A 3AD8C 4USVA 4KHMA 2VV5A 4ZCMA 2V2ZA 1T9TA 3IG1B 5KFNA 3KK2B 2KM8B 1FWLA 2MGZA 4ZJOA 3WX8A 3CO9A 1TL1A 4KH0B 1TL7B 2HHXA 3QFHA 2P2CB 5M2UA 4MH8A 3AFGA 2GW8A 4Z2XA 4U95A 3UR0A 4HHUA 4DSEA 4H54A 3W7BA 1RYSA 3D68A 5KFLA 2YNHA 2DGQA 3ITHA 3PJ9A 3AXKA 1FERA 3UDCA 1NPRA 4JB8B 2O1PA 4OI6A 1DQAA 2D3ZA 2VBWA 1D8YA 1M5OC 4KPYA 5BYQA 4LSLA 3M6XA 3O44A 4LFAJ 5C7PA 4WPAA 2C2KB 5EHHA 4PWWA 2YKOA 4F0MA 3LO3A 4UQTA 3A8IA 3H5UA 4DV3J 5KG1A 4JI0F 2OPSA 5LMNJ 1Y7PA 3FDSA 1M5PC 4DXLA 2ABYA 3OR2B 3RR7A 3MCMA 4IH6A 1R89A 1TR0A 3M8YA 2MDAA 4L74A 4O0NA 3V6JA 4I2QB 3H42A 1TKTB 3WQPA 2HNDA 3MR3A 4FVMA 2Z8QA 2KJWA 3TX0A 3DOLB 4OYBA 3EPGA 2VPWB 1HBOB 1Q7YT 4TVAB 2QLWA 4P7VA 5DQHA 3Q8PB 3IN5A 2ZWOA 1XR5A 3MOJB 4XAKA 4CH0S 4F4ZA 2QFJA 4EFAC 3SEOA 3WBZA 4USUA 5HROB 2DIVA 3KK2A 1HIYA 1EAYC 1RWUA 1KLMB 3UNYA 2XO7A 2C28A 3RR8A 3R1LA 5E0OA 1TL7A 4IH7A 3W3SA 4WKRA 3NMAA 2GJ2A 3C3LA 4KIAA 3KLGB 3G9CA 3M8QB 2IRYA 3EXYA 4EO8A 3CXCR 1URNA 4XDDA 2PMWA 1AFJA 2JEIA 2W4PA 4GRSA 2IBKA 2RH3A 3IBWA 3ET6B 4DSLA 2JEFA 2LQ5A 4X66J 4LFBJ 2CPIA 3WDOA 4K0KJ 4NLPA 1JLQB 4LF1A 4OI2A 3ENAA 5CYMB 2WW4A 4DV4J 1HWLA 6FD1A 5H9FK 1ZA2B 1TV6B 5F0UA 3HMJG 3NOCA 5K9FA 3Q23A 3GLJA 3OR2A 4DZDA 4M5JA 3LW5C 2WB4A 3R97A 5I42B 3GONA 4I2QA 4OV6A 1Q8KA 4CYUB 1TKTA 2ZC4A 2BOPA 5DZ7A 3ZNJ1 1S1VA 3I6PA 1HNVB 3GU0A 3DOLA 3NMRA 4UW2A 1MROB 4YY3J 1HBOA 2GMJA 1RWPB 3GFYA 1NK8A 3M32B 1WNEA 4FBTA 4RBVA 3HJVA 1CQMA 2GGPB 2FVPA 1S1TA 5KFPA 1S6PB 4IUFA 4J9RA 2FJAB 3MAAB 5HROA 2OSQA 1RSCA 2AEFA 2D1CA 1FE4A 1KLMA 1HNZJ 3C19A 2QMXA 3MMAB 1JJ4A 1JX4A 2EI5A 3KLGA 1VC5A 3M8QA 5BYSA 2DXFA 1U4BA 1TK5A 1S4FA 4A48A 1RP5A 5KG2A 4JV2A 3JTOA 3UCGA 1C0UB 2GVDA 3IFEA 3OFHA 2XM3A 3ET6A 2M8DB 1K1SA 4G6VB 5K14A 5IFMA 3NNHA 1JLQA 1RABB 1T94A 3GV7B 2WVDA 4CNZA 2RSQA 2IHR1 4BWMA 2HHHJ 2MQNA 4LF5F 2E7XA 1UEVA 1FRJA 1Y0HA 2BJEA 4B9VA 2LLZA 4QU6A 4UOGA 1AFIA 1L3TA 3SBMA 3FRZA 3UI3A 4LFCJ 2H4YB 5E2QA 1KQGB 5HO4A 5I42A 2UUCF 4LMZA 3LGNA 3BKFA 5BYRA 1T0TV 1M1KT 3NCPA 2Q6CA 2FJEB 1HNVA 3D1QA 4F3MA 4Y65A 1MROA 4DV5F 2MTLA 2V6AA 2V8GA 2BW7A 1N56A 3M32A 1SQFA 2GGPA 2EBEA 4PCQA 3TI0A 3GG1A 4TNOA 1XNRF 2EFVA 1S6PA 4B9LA 1HA1A 2ZKUA 5CYQB 2DY1A 1HBUB 3MMAA 1NCLA 3QBCA 4OZ3A 2QL9B 2VH7A 3ZZUA 2QL7B 5AE1A 1S99A 2R2TA 3R3TA 4ZVTB 3D6MB 2KZZA 4R0EA 1C0UA 2ERRA 4UQGA 3CCUS 3P45B 5ETMA 1YBTA 2FJVA 4G1QA 3SQGB 3NGKA 3HPOA 4DLEA 2CUYA 2PA3A 3ZZPA 3QJLA 4B3OB 5KOXA 3DM2B 1OIAA 3WHIA 2QJ3A 2X1GA 5ETPA 2XLIA 3UW1A 2CNOB 1WKJA 3TR5A 2MQLA 4Y2MA 1VRTB 1IWGA 2XZDB 1J5EJ 4DR6F 2VD3A 2RS2A 3W65A 2ZBIA 4NCBA 3BBBA 1U1QA 2V8VA 1I94J 2RIJA 2C2DA 5GAHU 3DRXA 4RNNA 4USMA 2OPPB 3QLHB 2AZ3A 5A2QY 1BWEA 2ROPA 4AUKA 4M95A 2H5IB 1LEOA 2YQ1A 3K0JA 1T95A 2HHVA 2OPRB 2UVVA 3AB2B 3KDNA 4NLVA 1KR4A 2BX6A 3TA0A 4CT8A 4JV5J 2LQ8A 3EE3A 1RTDB 2CAJA 2M0GB 2ZC3A 4GKJJ 3DC2A 1RWKB 1QE1B 1T3OA 2E5LF 3HXMA 2A6OA 3EGNA 1RBAA 4ECVA 5CYQA 2FHJA 3MTKA 2IC3B 2RDJA 4NMXA 3V5RA 1HBUA 1KTQA 3AOCA 4DN9A 4YN3B 3B4MA 3WIUA 4B9UA 2R2UA 4CLSA 2AYBA 4DF8A 1PIEA 1PJ6A 1YJUA 2AP6A 3I32A 5HBMB 2G13A 2JZ5A 1RAIB 1SUQB 2MKSA 3KNAA 4BDPA 5IC4B 1N8RT 1DFDA 2JEJA 4RW4B 4JI3J 4LQ9A 1Q86T 4GO5X 4DV7J 5L46A 3E3XA 1RBLA 2HFSA 3QZ8A 4K2JA 2DNNA 1PC4A 2KM8C 1T9YA 3SQGA 9RUBA 2IYGA 2VU5A 4U96A 3P5BP 5C42A 3KLFA 2MQMA 1EP4A 1ROFA 4B3OA 3SZ2A 3DM2A 4I64A 4LRFA 1U24A 3CJ3A 1VRTA 1FD8A 1X5PA 1NB7A 1FTRA 3ISNC 3PR4A 2HS0A 2J6SA 1QLNA 2OLWA 1ZETA 2OPPA 3QLHA 2FHJD 1SVDA 3DDKA 4ALZA 3G6XA 3V81B 4CLZA 2M7SA 3ETMA 3D0IE 1QSSA 4ELUA 4NA1A 5D3GB 2B7BB 2OPRA 2EVZA 4B3SJ 1U0HB 1D8ZA 3KHRA 1REVB 3VAMA 2HFVA 1RTDA 2AYEA 2DJWA 4P10A 1N32F 1NSAA 3DXSX 1FNOA 1QE1A 4MT1A 5KFIA 2RE1A 4I67A 2H1YA 5HN0A 4OYIA 2LXFA 2M4MA 3BO2A 2ZVIA 1LWCB 2IC3A 4ZVEA 4LIRA 1UTAA 3R7BB 2R3VA 2CA9A 2XY7A 4GVBA 1ZPVA 1DHMA 4OMFG 1KFDA 5HBMA 4TN2A 1SUQA 5L8RC 3SV4A 4RW4A 2D74B 3OPKA 3UVJB 6FDRA 5KFXA 4IG0B 4DWIA 1SH3A 7AT1B 4H4OB 3NBPB 3PW2A 4DV2J 5D8HB 1W2BR 1HKAA 2ZZMA 5I4MA 4DSFA 5T7LB 3QAEA 1BMQB 4DEZA 4HDHA 4OYXA 2GA7A 3AXMA 1SB6A 1UEKA 3OXGA 3T1YJ 4JI7F 3JSMB 3TA1A 3I87A 2R7TA 1JJCB 4FYVB 2IDLA 4OYZA 4F26A 4YEAA 1BHNA 3C66A 2EXUA 1RT1B 3BYRA 2Q1LA 2ZDPA 2A0FB 4A46A 4ED4A 1AT1B 3KHGA 1FKAF 1SJ1A 5D3GA 2EK1A 1RT6B 4B9NA 5EDWA 2VZ9A 4YHHJ 2CQDA 4RPFA 5HVHA 4DZ6A 1REVA 1VISA 2OPQB 2BRKA 1XR7A 3M4XA 2V4JB 1IN0A 2LP4A 1KOOA 5E3AA 3FQKA 4IDKB 1REGX 2AJ1A 2Z2ZA 4A8OA 1SXLA 4Q8FA 3D4JA 3FBFA 3D1HA 4DPXA 4JI5F 1LWCA 4ZVHA 1XMOF 3TEHB 5L9NA 3OTDA 1YJTA 4OFZA 5IM0B 2GCFA 1M5HA 4P52A 3CD0A 1M5VC 2QYCA 2VQEF 2B5JB 3PEJA 4DPWA 1YTYA 4MKAA 4E98A 3PJWA 1EIYB 4HL9A 1W25A 2BE9B 2CJBA 5AJ3J 2XYHB 3UVJA 3V6DB 1F60B 4H4OA 3NEKA 3CC7S 3OL7A 3CWJA 1U7LA 3PW7A 2YTCA 1WTFA 2Y1RI 2VA2A 5T7LA 2OELA 5GAHI 2RRAA 1ZAXA 4H4MB 1FRIA 4CLPA 4WKYA 3KMQA 2PD1A 1O6XA 3OFFA 2CJQA 1NKCA 4QPXA 4OYMA 3LQVA 4IR9A 1S0OA 1S12A 3BDEA 2RHQB 2CZVC 4K7QA 4KH1B 2R9LA 1RT1A 2OEJA 4HH0A 4O4RA 2J5AA 2D41A 2J9CA 3H20A 3CMAS 4L3KA 1HQUB 4C0OC 3UD4P 3GE9A 1RT6A 3MMCB 3KK3B 5IT9U 4YOEA 2A2CA 2DEIA 3LP0B 1Y3JA 2CQPA 4NE9C 4FNIA 4ZVPB 3MXHP 4OZ2A 1X4EA 2OPQA 3D2WA 4KE5A 3IAM9 2XY6A 2V4JA 2BABA 1HPZB 5KFMA 1AYEA 2WCXA 1S1WB 4IDKA 2Z0GA 2BJDA 1T3NA 1F2HA 2AMCB 4M5KA 2BRLA 4U9RA 2EFOA 3T1HJ 4HYKA 2MHEA 2YWHA 3W63A 4NEYA 1FF2A 3ILIA 5IM0A 2XZTB 2HLTA 3CDBA 2VQFJ 2HAFA 3TP2A 2R7SA 3KOAA 1B0VA 4TYAA 4C3MA 5DM7Q 4DU7A 5F3ZA 1B64A 1U09A 3E01B 4X4TA 4QR1A 3V6DA 1H2VZ 4CLWA 3MCOA 4LF4F 2O01C 1NK0A 4C0BA 2YWFA 4KO0B 5BR8F 1HD1A 4A47A 1Z4UA 1AW0A 1S9EB 4H4MA 4ZVOB 3I9V9 1T9UA 1YJVA 2XWXA 3HKWA 4LR7A 2E1CA 2QIFA 1X4AA 3RRHA 4MTPA 3BKTA 1R8PA 1ICEB 3FZBA 2J9EA 2FYXA 1VHFA 1CVJA 3E2EA 2VFUA 3G8SA 4RLEA 1HQUA 4QIFA 4EWTA 4IFYB 4YFUA 3MMCA 3KK3A 4TQRA 3LP0A 3HSJA 1ZPWX 1RWMB 3ZZ0A 2R7OA 2EW9A 1HPZA 1F6TA 4X4RA 1S1WA 3TAQA 2DR5A 4NXMJ 4C2MA 4BC9A 3O1LA 4DUZF 2PE8A 4UUXA 4DL0C 1JKHB 5E5NA 4FS1A 4MJKA 4B9MA 2FD2A 1BGXT 1NM2A 4AD6A 1RHMB 4UF4A 3C15A 3OTEA 3PHTA 1YX2A 2KJVA 3QAUA 2F7VA 5F8LA 3Q8VA 1DBDA 2BMBA 2WOMB 5C2GA 2F4VJ 1ZTWA 1NZAA 1VFJA 3BGRA 1DTTA 4AFFA 4F7VA 1FNMA 1PYSB 2GX8A 5B08A 2FGCA 3DRPB 2KG0A 3H4BA 3M1VB 3GTYX 2EC0A 1S9EA 4RO0A 5ETVA 2UUAF 4YUDA 2XMWA 1GMWA 4ES3A 3LGHA 4DBQA 1SC6A 3RW7A 1F2GA 4I6AA 3ZTPA 2CJYB 2JJ4D 3LAKA 1ZA1B 1XN9A 3NS6A 4ED0A 4OZNA 2V8PA 3PFOA 1LWEB 4Z7CA 3RB4A 4IFYA 2K3IA 2MZRA 1VCTA 2J6TA 5D0GA 4KR0B 3G86A 1N34J 3GIKA 5CQGA 1XR6A 1S0VA 4J91A 4ILMA 4F8RA 4YS2A 4IR1A 5A6PA 3GIIA 2LECA 4B08A 2ACMA 2FLNA 4LBHA 1XNQJ 1JKHA 1X9MA 2YVSA 3PX6A 4PQUB 3D6FB 2ZNYA 1S9FA 2HURA 2HRUA 3QNWB 5LM7E 2VBXA 3ULHA 2POKA 1X7VA 4MIAA 1SPBP 1T9WA 2LEAA 1W7WA 3GCWP 1XERA 2J0WA 3TRGA 2WOMA 3GFXA 5HL7Q 2HPUA 2EKNA 2FHKA 1D9DA 4L73A 5GAEU 4C9DA 3L9ZA 4ZPVR 2MYFA 3DRPA 2IMWP 1C0TB 3M1VA 5A0YB 5DG7A 2JWNA 1Q78A 3DLEB 4WFNQ 3KNGA 3K5PA 4N47A 1R8BA 2R2SA 2VPZB 3U27A 3RRGA 2B9XA 1WD6A 1BQNB 4Y2CA 1D9AA 2V8DA 2ZH5A 4KAIA 2MZJA 2KG1A 2RDIA 1MWZA 1M0SA 5F9NA 2BJ9A 4Y3CA 2XY5A 2CQIA 1VK8A 2W8LA 1LWEA 1MN9A 1WKLA 3TARA 2BV3A 2LEPA 1FFSB 2VODA 2YX1A 1KQKA 3OXFA 3OJSA 4P75A 2UUBF 3C6TA 1MSWD 4G1PA 4WJBA 4UTGA 2JFKA 1UEUA 8AT1B 2CXEA 4L76A 4AL7A 5AE2A 2YKNB 3QPIA 4CO5A 1N52B 2BEFA 5KTQA 2EK6A 1YRTA 2VG5B 3L7OA 3SSSA 3SQOP 3A8EA 2ZH8A 2QV6A 4NLQA 3O2IA 1NLKL 3GJQB 5J2QA 4JI0J 2MKJA 2LXUA 2ZEJA 4PQUA 4CO0A 3IWLA 1T05B 4JV0A 3LA0A 5HQMA 1SKWA 3CCJS 3PNIA 3FMBA 5J1EB 4LUBA 4LF2A 2NXEA 1P9YA 3ZC4A 3D5MA 3P4UB 3KLIB 2DNHA 2OI2A 2GIFA 4O3SA 3FFIB 1DJ0A 3MM6B 5KFVA 2E1MC 1C1BB 2CPEA 1Q79A 3HHLC 4CLTA 1S59A 4JYAF 5A0YA 1OO0B 4C8YA 2L3MA 4RW9B 5KFOA 1GMVA 3DLEA 3HLUA 4F4YA 2R7VA 4ED3A 1TUWA 2X7IA 2FGOA 1BC6A 3QRQA 2OTJS 2X1BA 1L3VA 1U25A 2QA4G 3BGLA 3FJ2A 3OW2R 5C5JA 4C8KA 3PFEA 3QQCD 5DM6Q 1RT7B 2HHPA 2D69A 2I8EA 3BSAA 5A8WB 1X4GA 3MCSA 2YKNA 4WYLA 4O3QA 2VG5A 2BQUA 4FP9A 2OJ3A 1CC7A 2PC6A 2KFYA 2QLXA 1LW2B 1N33F 4UZCA 3DYAB 4DF4A 5C2CA 3FSXA 4USIA 4DV0F 4OJHA 5D0EA 4PQAA 3BH7B 1JMTA 2QT7A 1T05A 3OL6A 2VF3A 5J1EA 4OHXA 1PAUB 1JLBB 3ZFVA 4B3MF 3KLIA 1IQTA 4LRAA 3FFIA 1S6OA 1AZSB 3EXCX 2GQQA 2J8SA 3MM6A 2MQ8A 4OIXA 3I96A 1C1BA 4WF9Q 4JI6F 4EBCA 2UXDF 4BC7A 2P6SA 1TTHB 2ASJA 1VQYA 2J7UA 1FJGF 4NRTA 2AW0A 2DIUA 1TL5A 4OJGA 2IJRA 2V94A 2W9BB 1GMUA 2Y0SD 3M8PA 2D3OR 4DLGA 4RUCA 2UVRA 4Q43A 3DRRB 4ZLJA 5M2RA 2BR0A 3HFVA 1TZ0A 4X64F 2XMJA 5KFEA 3QT5A 1NSQA 3R5AA 4PZVA 3H25A 1K8AT 3SCLE 1U2FA 3RG6A 1URRA 3IRXB 1VK3A 2JLFA 2OSRA 2UZAA 4RW7B 1RT7A 1SJQA 2DGWA 2WB1D 1RAJA 2YX4A 5A8WA 1X4HA 4XPCA 1RADB 4ZN3A 4H4KA 1NHKL 2YH0A 1NH8A 3GYGA 4LF5J 3O3LA 1UPPA 1LW2A 5KFDA 3DYAA 1N5SA 2GQ2A 3T6BA 1SQGA 2DHHA 2W01A 1LNQA 2RKIB 8ATCB 3JS9A 2UUCJ 3LPEA 5B0FA 2DNRA 1JLBA 4WU2A 5M2PA 2D9PA 3MM8B 5F9LA 1H7XA 1KSPA 4TLQA 1YZ6A 3DLGB 3HK2A 2HGMA 4PRFA 3R6GB 1AZSA 4LR8A 4DV5J 2V5HG 1ITPA 1E6YA 3CC4S 3VCDA 4DR7F 1S6UA 1XNRJ 1JQGA 4KPCA 3MZIA 2M3DA 1PYTA 1RTHB 1PBAA 3M9NB 1TELA 5DZ6A 3Q0AA 4KFBB 3IM9A 1Y9OA 2ZNZA 2QLBB 3DRRA 1ZOTA 3D7SB 1PCAA 2OD6A 4NLYA 4DR4F 1R0AB 2HW3A 2H54B 1LXJA 1WG1A 5HJYA 4C8OA 4MYTA 3IRXA 5KT5A 2EFGA 1UW4A 4PG5A 4DSIA 2Z2YB 2QN6B 4CLYA 2KT2A 2FHOB 1SJ4P 3EYZA 3TJ9A 3IA0A 4LREA 2DR8A 2LMIA 3UCUP 2D3O1 5LJ5Y 2AD9A 5DDRC 4DR6J 1FCAA 2V2QA 4ZOSA 1CS4B 2AGPA 3S7RA 1B3TA 3F44A 3ZO7A 4KHRA 3MMBB 1RAAB 4QYZK 5DGBA 4WU3A 4C8NA 2RKIA 3HDSA 5ETNA 3G96A 3MM8A 3PIPQ 3NY0A 1GAOA 1RAEB 3DLGA 5H9FJ 3H90A 2RDDA 2QRRA 2FLOA 1MLAA 2CQBA 3NS5A 2PI5A 1RTZA 2F8MA 5EWGA 2DNMA 4DQQA 4CO3A 4QWBA 3D54A 2Z4PA 3RTVA 4DUYF 5C24B 5IQ6A 3H2LA 2E5LJ 1TU0B 1UVLA 1V5IB 1GH8A 3HHNB 1OS5A 1RTHA 3N6NA 1KWMA 2HIQA 4A8FA 4X62F 3PM9A 4KFBA 4B3TF 4UY85 3MFIA 4F2RA 3C6UB 2HK3A 3VAFA 3M8SA 4DR3F 1APSA 4LF7F 2B51A 5HQ8A 1OYEA 1DTQB 1S7HA 2HFOA 3GWCA 2DB1A 2YPYA 3R1HA 4TU8A 1X0PA 1ELOA 1O0PA 4A8XA 4TQSA 1KN6A 4I2PB 4I1TA 4BCAA 2LQBA 3NP5A 4JI2F 2GNKA 3FUYA 2H51B 1NJIT 2RU3A 4ZMMA 4B17A 5JJBA 1QAYA 2C2NA 3ICLA 3CMES 3HZEA 1Q1KA 1IBLF 4ENOA 2YPZA 3MMBA 1FXRA 1MWYA 1V6HA 4IFVB 2M8HA 3WC2A 4UZBA 1JNZB 1KONA 2BE7D 5J2MB 2G4BA 3OTOF 2JDJA 4ID5B 2IVFB 1FKOB 3BO4A 3BKUA 3N6MA 4DFMA 3JAMY 2MEWA 3CCLS 3CCQS 3W62A 1N32J 3D3BJ 2RQMA 3HFKA 2PSZA 2AF6A 5HVGA 2BM1A 3I9ZA 3KLVA 3T5KA 2YWEA 1S49A 2E44A 3AT1B 1XJWB 1K73T 3QO9B 3SYZA 3EDQB 4KYZA 2UV8G 1FJ7A 3C6UA 3A3OB 1N36F 2HYIB 3H2VE 2MKYA 1QAJA 2FVRA 3NGSA 1X8DA 1LQ9A 4O44B 1N5YB 1DTQA 2GVZB 5KFYA 4RW8A 1FEHA 5KFHA 3A3NB 2BXJA 1WEZA 2ZHOA 3VAKA 5L1JA 3SCKE 5C25B 3PRDA 1U1MA 2A18A 2XNRA 4I2PA 2K1RB 1KHVA 5CZXA 1IR1A 4XDCA 2HS4A 4FF3A 2B6AB 4ETXA 2M5YA 4X4NA 4QCLA 5DQIA 2C2MB 2DO0A 4KGZB 4NCAA 5D4LA 4U67Q 3OUYB 2AV5A 2YKAA 2EWHA 4JI7J 2NZ4A 4U7UD 4LF8F 2W7OA 1JNRB 3QT6A 4PKDB 2E9RX 1VI7A 4IFVA 4H4KC 1WACA 1KC8T 3KHLA 2NR0A 3K8WA 2KXHA 1ZZFA 3CPWR 1FKOA 2PGCA 3JXOA 3RAQA 3Q89A 3LOUA 2QA2A 1NUEA 2Z57B 3HHKA 3JAMU 4DG1A 3J81j 3QT8A 4R8UB 5FLXU 3AOBA 1S72S 1VQNS 4OI0A 1H73A 4IRCA 2V68A 1EKRA 1UJ4A 5LSLA 4JI5J 1XMOJ 2J9DE 1WSVA 4O4GB 1U26A 2H4WB 3U1NA 3QO9A 2VL1A 2WAQD 5A6WA 2V9KA 2KKHA 2N3OA 4M94A 4CM2A 1TKZB 1SC3B 2BUNA 1PYOB 4O44A 1N5YA 4WP3A 4OHZA 2ZHAA 2VQEJ 2GVZA 4FDFA 4GVLA 1LW0B 1VC6A 3ZNUA 2MKKA 1BQXA 2WONB 3VGVA 1IKVB 5DDQC 4ED5A 3B8HA 1HBMA 2UVWA 3BBFA 2XZWA 5C25A 2HHQA 2B8PA 4ZIVA 4M5GA 3FEXB 4MYUA 3JSRA 1N0VC 4HKQA 2K1RA 3SSRA 2UU9F 2MSTA 2ZBQA 5MLCV 2B6AA 1FK9B 2HRTA 4JI8F 4JI4F 1R3NA 5F8HA 2E7VA 1M1GA 3F0NA 3KG1A 1FESA 1VYAA 4UY8T 4ECTA 2F8EX 2DGVA 2DNKA 1YJ7A 2PEHA 3DDIA 3NKYA 4NMLA 1Y11A 1X4BA 1ZAVA 2OUGA 2C3MA 1LV5A 4AT1B 3EDRB 4ZPDA 4DL4A 1SV5A 2P9GA 2WZ1A 1Z2LA 3JQKA 1SKSA 1VR6A 3QIPB 2NPFA 1U0SA 2VJVA 2AJ2A 2JLGA 5AXLA 2GJFA 3MI7X 3GP9A 4LVNP 5GVQA 4DV1F 4R8UA 4M5DB 3N5FA 2R7RA 3AD9C 4F4AA 1A6LA 2CPZA 1XMBA 1MMNA 4OV1A 3HVTB 2QLFB 4K4SA 4O4GA 1HD0A 2CQGA 1S0NA 2Z2MA 2DTJA 3D6TB 5B0AA 4DJBA 4NYZA 4ES1A 2DGTA 1L3UA 1CQNA 1TKZA 2JVRA 1I1GA 3P3DA 4FNHA 3THPA 2OTLS 1SJRA 3KJNB 3U02A 1LW0A 1QAIA 2WONA 4J9PA 2CNKB 3VV2B 4ZN1A 3RRKA 1VLOA 5KFSA 1GX6A 4NLSA 4LF4J 2I1RA 5HK4A 4E0DA 4PG7A 2GAHC 5BR8J 1FK9A 3THTA 3AODA 2QA4S 5LT5A 4C6AA 3D66A 2VG7B 1VRQC 3UPFA 2VHGA 1KOHA 1RZMA 2CWKA 4RUAA 4FS2A 4C48A 4PABA 2RQCA 4RX6A 2RHSB 4K4VA 4DQIA 2MLZA 2OO4A 1T9XA 2OD4A 4ZPTR 1FRLA 1F0XA 1PG5B 3V6KA 4CLFA 3BSNA 3QSIA 1CJVB 2YX7A 1PSDA 1KD1T 3TUIC 3L7UA 2XSJB 3KK1B 1N5VA 3IRWP 4J9MA 4IYQA 1U8WA 4M5DA 3BREA 2GV1A 2OHDA 5KFZA 2OP5A 4PEOA 4DUZJ 2DHGA 3GIMA 4DFKA 1KLNA 3BS9A 4WIIA 3HVTA 5J1PA 4G65A 1HBNB 3M9OB 5LXYA 4DPOA 1V3ZA 4HI2A 3ZTSA 2BDPA 3G8TA 5I3UB 1RISA 5E41A 1CBKA 3AY0A 1UFLA 3B6BA 5E3CA 4QIWD 3M6VA 2HNYB 4PPDA 3C46A 3TJ8A 1HR0F 3MM9B 1DY3A 1GXTA 1NJZA 1SQEA 3FVYA 1CJUA 1H72C 5EWEA 2UUAJ 1JB0C 3KLEB 3BQ2A 3MAHA 2RNEA 2NXNA 3CDAA 4E2FB 4USHA 2VG7A 4F50A 4PWUA 1A9NB 4RUBA 3AA8A 5ETOA 1ZTTA 5KFUA 4ES2A 1RT2B 3PW0A 4LQ3A 4NLTA 4C8LA 4PYAA 1VQMS 4ELVA 3DDNA 1PGZA 2HLUA 1CJVA 4CCHA 5BJRA 1XMQF 4X4UA 2KFZA 3KK1A 2C3OA 2JC0A 1ZH5A 4DFJA 4K50A 2XMMA 3EWGA 3F56A 5CXTA 3BR9A 2R7QA 3RBEA 3KJVB 1YZ7A 2EFPA 2E1PA 2MJNA 4PXBA 2AT1B 4JI1F 4P73A 1Q16B 2K8GA 5ETQA 1RDRA 3PIOQ 4LSLB 3DCAA 3DRYA 2XG8A 2L08A 3OSNA 2GQCA 2DNGA 4DV6J 1MN7A 1Q95G 5I3UA 5LSOA 3SFGA 1SIZA 1WG4A 1D0EA 5F41A 3G82B 5L9XA 3W66A 1NHVA 1FO1A 3H5XA 2HNYA 2B4UA 3D6HB 4KGMA 1RTIB 3MM9A 2BJ1A 1OY8A 4P74A 3R8YA 3PKYA 5AXNA 2HNDB 2EG2A 4V19J 4NZ6A 3OSPA 2JLEA 3CDWA 2UXBF 1B7FA 4CLLA 2YY3A 3PRBA 3FBCA 3CIMA 4NPOA 4RWXA 2BA9A 1D09B 1FRXA 2LU2A 4K5SA 3HVAA 1Q81T 3GSIA 1L3KA 1LFPA 5FJ4A 1IR0A 2ZKTA 2UUBJ 1EETB 2CFXA 3T5JA 3GG0A 1ACMB 3S6EA 1G4CA 3NL0A 1J5OA 2MXYA 3ADAC 1Q8LA 2JL9A 1S79A 1XK8A 1HL6A 4FZVA 2XMVA 1JXVA 4M5NA 3N6LA 1YKWA 3VTIA 3KUGA 3S1TA 3QZ7A 4ECUA 3BPSP 3KJVA 4YB1P 2CPXA 4QQBA 3V4MA 2KRBA 2PIIA 3CJQA 3PYGA 3D0GE 2KZMA 2BJ8A 3OBIA 4ZPBA 4F3QA 1B99A 2AJFE 2L9NA 4WK3A 5K20B 3ZZYA 4PAAA 2YWGA 3LP1B 4OYOA 1UVNA 3G82A 5ETRA 4NYOA 5KT4A 4YQWA 3MURP 2WRMA 1UVKA 4RU2A 4ECZA 4JYAJ 1R0BG 2B9WA 1RTIA 1GQEA 3Q2SC 2XNQA 3A13A 2HSEB 4ERDA 4WBFA 3Q8UA 1I3OB 1S1VB 4F67A 1RAFB 5EX0A 2IM3A 1B4SA 2RF2A 2HAIA 3NG8A 4C97A 1UVMA 4UOCA 1K0TA 2OMOA 1HYSB 2KHDA 3OTCA 4IRDA 1S1TB 2DNQA 5J2PB 3H5YA 4OX6A 1EETA 3BN7A 2FTRA 3BQ1A 4FYXB 1WOPA 4DL6A 2CPDA 1W26A 2I9SA 2CPHA 3FCHA 4X4SA 2BYCA 3GV8B 4C4WA 2DPIA 1XWLA 4AQYF 2GMLA 4OI3A 3T5HA 2CQ4A 3HVRA 1O51A 4F36A 5K8OA 1N33J 1UJ5A 4OI1A 4DV0J 3C16B 2GVDB 3VGTA 1NDKA 1YK9A 2RT3A 2Z58B 4ZCKA 4P2MA 5K14B 2F40A 1RCOB 2BKPA 4FBUA 2V63A 3UN5A 1MMLA 4FF1A 2IAJB 4B3MJ 2P5VA 1YITS 3UD3P 2DXEA 2KL8A 3PO4A 3GFZA 3LP1A 7FDRA 2MKIA 3GIJA 2YNIB 1JLFB 2B4PA 3CSKA 4JI6J 3W2VB 4NLRA 2UXDJ 1LWXA 1OWXA 5F8GA 2COLA 1FJGJ 2M52A 2DT9A 4I69A 1SKRA 1F3FA 1NU4A 1GTHA 4O23A 4ED8A 1KP6A 2ZE2B 2JRSA 4P71A 3EZ5A 3R9LA 1NBEB 4PG4A 2GS8A 3UDVA 4QU7A 1VBKA 2FIUA 3DMJA 3L95X 3CD7A 1JK9B 1X4CA 2RMLA 3LH2S 1UVIA 4X64J 2W4CA 1R0CB 1HYSA 1IKWB 4MK7A 5J2PA 3TZYA 3PJXA 2SXLA 3X1LB 4Y6IA 3MPVA 3Q86A 4C8MA 3TZXA 3Q8RB 2Q79A 3SDEB 1JLAB 1X0FA 4I0WA 1RB0A 1U1KA 1R7IA 3IGNA 5L1IA 3FBEA 4MK8A 1HW8A 3W9HA 4ZVSB 4Y28C 3C16A 2J7KA 2HBZB 3A8JA 3TAMB 4RNFA 4TLRA 4WFXA 1KS2A 2Z56B 2G1HA 4G1QB 1DLOA 4EMDA 2MMYA 2N7YA 5HMZA 3H8YA 2IAJA 2V4QA 3TUPA 1EQ0A 4FF2A 1VIXA 3UQSA 3KG0A 2DHSA 3VQTA 1QTNB 1QD1A 4NA3A 1EARA 1TUVA 2YNIA 1JLFA 1KBRA 1VJQA 3W2VA 4CLKA 2BQ3A 4DR7J 3FBBA 2CIMA 3BSCA 4W4MA 2ZE2A 1OY6A 5IV3A 2BZ2A 1NKBA 1GNKA 2P9EA 3E51A 5GAGI 4V19X 2CVIA 1FD2A 2ZZTA 3T6JA 1TQLA 2ATCB 4X84A 3K89A 3CDUA 2PDAA 4DR4J 4EO6A 3VF0B 2ACYA 2QMWA 1U6BA 3EZOA 1IKWA 2RU9A 2N3LA 4OI4A 4J90A 2BW2A 2DR9A 2Q66A 4NLOA 1NSKL 3FRYA 2P8IA 1RWWB 4DPYA 2U2FA 3LGMA 3CD6S 4K4TA 1RAOA 4K5RA 6AT1B 1WI8A 3SDEA 1JLAA 2LQ9A 4QR2A 3BGFA 4YB5A 5I3PA 3N5BA 2LFVA 2D3UA 7FD1A 4HACB 2W9CB 4RR5A 4U7CA 3TAMA 3N28A 2QE5A 2R8HA 1QUPA 2NREA 3H0PA 2KYXA 3L4BC 4PXDA 2QG9B 2Y1JA 5C42B 3KLFB 1UA1A 3PY8A 2Q43A 4B02A 3QSYB 1EP4B 1NK9A 1KDNA 1RWNB 3IR5B 4N56A 3Q8SB 1VRUB 1UW9A 1HW9A 1UA0A 3K58A 4OYWA 4K4ZA 3J80U 5ETSA 1FX2A 4CO2A 1N54B 2NSBA 5E33A 3JQMA 4DUYJ 1WHXA 2DRBA 3A8KA 1XEZA 5JVGQ 1LK7A 1RGVA 4ILLA 2XO6A 4FKYA 4X62J 3GYNA 2L9DA 1WC1A 2BKOA 4B3TJ 2CADA 1M1HA 2C3PA 3VR1A 4ECRA 2NXJA 4DN0A 5G0RB 4DR3J 4LF7J 3W1YC 4LJMA 9ATCB 2KHCA 1NDPA 1FEEA 2AYMA 1KVIA 2A6MA 1R8HA 4DI6A 2AWZA 1RU1A 2LU1A 2MQOA 2C3YA 4JI2J 1P6TA 1LWFA 2BBEA 2DVIA 2D7SA 1UFKA 5GMKa 3TX8A 3MUTP 3PYFA 2M9KA 2QFIA 5F0WA 2HQFA 4GVBB 3T1AA 1KKHA 1R43A 1JLCB 3HKZD 1AUDA 3M30B 3KXDA 3MTJA 5E7OB 1IBLJ 5L1KA 4HACA 4KKOB 2W9CA 2FQQB 5KOWA 1K1QA 4ID8A 3KLHB 2X3GA 1M90T 5JUMA 3CF5Q 3DLHA 5SUHA 3OTOJ 2ZM6F 1RUSA 2PA8D 4QR0A 1VRUA 3D1OA 4F02A 1MNEA 1Y3KA 1ZM9A 2MZQA 1KQSR 2FLPA 2EPIA 4J5OA 4Q2MA 3IR6B 1H2UX 3BQ0A 1TVRB 2O66A 3VALA 1ZYQA 3ONQA 2R7XA 1S77D 1QDUB 2YNFA 5KFBA 4KY3A 5KT7A 3HCXA 2AGOA 1QM9A 5D77A 3AJDA 5IV4A 1N36J 5G0RA 2C2ZB 2V69A 4MAKA 2KT5A 5IZHA 1X9WA 3OL8A 3KDOA 1YBAA 4K8RA 3UN3A 4ZJQA 3ZZRA 3B78A 2HBQB 3GPAA 3MECB 3BDPA 3PHEA 2QEXS 4OX9F 2AEMA 2FLLA 2VOPA 5ADZA 1JIHA 4TU7A 4TU9A 2XCAA 2HKEA 1VC0A 5DO2A 1RI7A 3CW2C 1JLCA 3M30A 3FSIA 3TZZA 2A3JA 2R42A 4L3NA 2N4CA 3CJRA 4KKOA 2PI4A 3W2WB 4N7TA 4LF8J 2Y8YA 4OHWA 3T5LA 1S48A 1DQ8A 3N0VA 3KLHA 3PTWA 1CULB 3DHWC 2N82B 2IM1A 4F3OA 3W5YA 4HT5A 4RUHA 2IJNA 4QIGA 3BGOP 1RWOB 2XLJA 3VHQA 2WSCC 1S1XB 1TVRA 4CTAB 4NWBA 4QYZJ 3WX4A 4P6QA 4DQPA 2MZSA 1GXUA 5IT9Y 2ZBPA 8RUCA 4X65F 4P2FA 4ZPAA 1OYDA 3EM1A 1N88A 1WUUA 2W24A 1XTZA 4DPUA 3QATA 3GR1A 1TUGB 2FB0A 2IRUA 1RHKB 3EUNA 2DPJA 4BBYA 2IM0A 2CNNB 1I51B 1WC3A 2XMAA 2X1AA 1YJWS 1FRHA 3H4DA 3MECA 4ANEA 2KI2A 5HMXA 4OJ1A 3NWGA 3D3CJ 1SCJB 2UU9J 1EX8A 3G2XA 4I68A 5GADI 2B9YA 2V2KA 4JI4J 4JI8J 1IBMF 2ZJRQ 3IO1A 2VC1A 4JV1A 1S76D 1UL3A 5AE3A 3W2WA 2HNZB 3RAMA 4N41A 4WE1B 1C1CB 3SCIE 3I56S 1ZM2A 4RZRA 1CULA 1WOSA 3JQJA 1V5VA 3CGIA 4DCJB 5DG9A 4WP9A 1HI0P 3S8SA 4CH7A 5F8MA 4LRCA 2AHOB 2ADBA 4AL5A 4K2XA 2IVYA 1S1XA 1QTMA 4CTAA 4DV1J 5ETLA 1BXNA 4IO1A 2DEJA 5K8NA 2XMTA 4HTIA 3PZPA 1DAXA 3OHBA 3KJFB 1A0OB 3POTB 3DLJA 3DNCA 2ZH6A 2XTJP 3RU0A 5AT1B 4DX5A 1JLGB 3FSYA 3CJKB 4J9KA 2W7PA 3HHDA 3IBCB 2NSCA 4MKBA 5FIIA 4IQMA 1HQ2A 2NYHA 1X5OA 4FN5A 2F9JA 3TQ1A 1SI9A 2E29A 2GO8A 5KG4A 3ILLA 1FJCA 3NCRA 1AROP 4O3PA 2VFSA 2NXCA 2ASDA 4GC7A 4CT9A 2C2EA 2F3JA 2OEMA 5HATA 1IR2A 1PJ5A 4DS5A 4J9VA 2HIYA 2BACA 2EC2A 4IKAA 3GYXB 2AKWB 4UOHA 2CG8A 3C15B 1T8EA 3JYTA 1H0HB 1LXNA 2WBMA 3DHXA 2LA4A 3UDLA 2JHEA 4I56A 1QSLA 1BLUA 2WSFC 2XS2A 2GIRA 2FVSA 3ISZA 1WOOA 2HNZA 1TFYA 4M5MA 1GXLA 4WE1A 1V3RA 3TWZA 1C1CA 3BGRB 1VJWA 1K47A 1DTTB 2LQJA 2XGPA 1TL4A 2JNJA 1VQOS 4WK1A 3OFEA 4PG6A 2HS3A 4F25A 2ZZNA 3I5CA 1NB2A 3IWNC 2VBZA 3HSZA 1HARA 4V1Ak 1GTEA 1RKJA 4TYBA 2MLXA 2FJDB 2M70A 2CYYA 2E5HA 2UXCF 3JSBA 2B7CB 3VVUA 4OZ1A 4NX9A 2N7CA 3UCZP 1S10A 3POTA 2Y3YA 1ZBTA 3W64A 2O3DA 4EYHB 4QWDA 1JLGA 4R25A 3CJKA 5CABA 1FJEB 2AU0A 1ZZNA 3I55S 5D4OA 4KGXB 3I4HX 2RILA 4XO0A 4LRDA 2QO3A 2J9DA 2R8GA 4NZ7A 2DRAA 3MDFA 4MFBB 3US5A 3K7RA 2XHCA 2L48A 1HFEL 2JOQA 1EKSA 1HNIB 1RJJA 2V50A 1E6VB 1AUSL 4ZVUB 2DNLA 2RJZA 4KBIA 1HR0J 1TK8A 2NCKL 1R6VA 3OL9A 3K2YA 4QIEA 4ZVQB 1S0MA 3TVYA 3OLBA 3ZZOA 2G0JA 1R8AA 2AJ0A 5SZTA 2NLWA 4PWDB 3DOMB 4OHVA 3A4TA 2QMUB 3J7YU 2PN6A 3LANA 3KHHA 2HRYA 4IQXA 2VONA 4CRJA 1FXDA 1H2TZ 2IBOA 1YDLA 1QY7A 3W5XA 1RTJA 1MG7A 3NAHA 2HFNA 2BJ7A 2AQ4A 3IMQJ 2OFGX 3K59A 4DR1F 1N48A 1XMQJ 2CPYA 5T14A 1FDNA 2F1FA 3MM7B 2IMOA 3TZWA 4ECYA 1EJ7L 2RRNA 3IG1A 1LKZA 2E66A 1PILA 1X4FA 3NS7B 4M5HA 1F1BB 1Z1ZA 2F9DA 2FC9A 4ELTA 5KG3A 3C6TB 3Q22A 5IQQA 5J2NB 4JI1J 4RBUA 4TY8B 2XGQA 2VOOA 4EUVA 4NYPA 5LJ3Y 3BBCA 4DX7A 2K3KA 5B0BA 4QW9A 1TMMA 2QGFB 3C2PA 2E9ZA 2DXDA 2HVDA 4EEYA 1U1OA 3QGGA 4KTQA 5GMDA 3FC9A 1F9EB 1XIQA 4LIWA 5J2QB 3QWUA 1K44A 1I5OB 2XWYA 3KG4A 1IKYB 4MFBA 3Q83A 3BEGB 1X5SA 3PXGa 1HLWA 1HNIA 1RHUB 3Q8YA 1E6VA 3B54A 4USKA 4X4VA 2I0XA 4ZLLA 2MQQA 3GJSB 3U1LA 2OAUA 3GSDA 1RBOB 4ECQA 5KFWA 2UXBJ 2VICA 3MR7A 4PWDA 3DOMA 4RNOA 2AIRB 1HI8A 1RT4B 3CCES 4DUTA 1WTBA 5DGAA 4BHQA 2FZKB 2VDHA 3NLCA 4ZVGA 3CULA 3NAIA 3S01A 3JTPA 3G6VA 4U8YA 2QSWA 2U1AA 3ISND 3PCOB 4MKYA 5K8MA 3MM7A 3PVXA 1G1XA 3HT3A 4WYWA 5KT2A 1BD6A 1Y10A 5RUBA 4C3LA 3BJYA 4NOHA 2HEKA 4F0KA 4WWSA 1FDAA 2DO4A 3CJ2A 5L38A 5JVHQ 2DHXA 3L3CA 2BM0A 4X4OA 2ROGA 2EBGA 2NPIA 3MWBA 4M63A 5J2NA 4TY8A 3GMGA 1SC1B 2FZGB 5IT0A 5KFKA 1DARA 1UZDA 4UOFA 4TY9A 2J0SD 3VAHA 2KO1A 4I4BA 2LDIA 5D78A 3PX4A 1L3SA 3ZTQA 4Q0BB 2VUGA 3SFUA 3M2VB 1U2CA 2XI2A 1SBRA 2YWWA 5F3TA 4HI1A 5CYMA 1IKYA 5AXKA 1SIWB 1TV6A 2HGNA 2AJ4A 3NGTA 1NNDA 3MD1A 2YKPA 4ED2A 4YMEA 1VHIA 2ZH2A 2QYGA 4KHPF 1P9QC 5HMYA 4HH1A 4QZVB 3R7NB 2VBYA 5A8KB 1OSCA 4F4WA 1U02A 4DL5A 4CYUA 2E5IA 3CJ4A 1RT4A 3G87A 2DNPA 4CO1A 3QFWA 3D28A 3LUYA 4NLGA 2V67A 3HULA 3I31A 3QMQA 1FFGB 1AXQA 5ETTA 1AA1B 3IBFB 2BE2B 4WZQA 3M8ZA 2CDQA 4QPTA 3M8PB 2DHAA 3MAAA 2UP1A 4XPEA 1FDDA 4AQYJ 1ZAWA 5G4DA 4EZ9A 2Y1IA 2OH2A 2R8KA 5E3QA 2RRBA 5D6GA 5H9EK 1VQ5S 1N5QA 2LKZA 4NLUA 3EGZA 2HG4A 2VFRA 2V2VA 1IQZA 1YJ9S 1KFSA 1C2PA 2J76E 3QT7A 5EGYA 3ENQA 1UETA 4F4KA 2XMUA 2J6UA 3MCNA 1TAUA 1RXOB 2ZUAA 5CD4H 4Q0BA 5KFRA 1B0TA 4RBTA 3M2VA 1NK5A 1RQ0A 5DDOC 1S57A 1R31A 1P27B 3TA2A 3H7HB 2E1AA 2DCLA 4U8VA 1YWXA 4J9UE 3MR2A 2C22A 3RJMB 2FDNA 3J7YI 2KXFA 4QJVA 5J1NA 3R5BA 5LSRA 2HVZA 1UJ6A 4DQRA 2H5EA 2R7WA 5A8KA 2J7WA 4AL6A 1D9FA 3F41A 3CJ0A 3K8VA 1T7PA 3H2UB 2KDOA 2NUHA 1RLCL 2G0IA 1E6YB 4PPZA 3Q24A 4KQZA 3UN2A 4FVCA 2JH3A 3QGHA 4X2BA 3AJ1A 4ZVFA 1RWXB 2DKOB 3UWTA 2KT3A 4N76A 2BE2A 4J7CA 3PR5B 1RHJB
chains in the Genus database with same CATH topology
3MAAB 4CLSA 4WP3A 1FX4A 2QV6A 2GVZA 3ET6B 1CJTA 2W01A 4OYZA 4CLYA 3C14A 3C16A 1CJKB 4OYPA 4USVA 4NI2B 1CJUA 4OYIA 1WC6A 1AB8A 4CLFA 1WC1A 2BW7A 1CJVB 1WC3A 4OYAA 4CLPA 4P2XA 4WP8A 1Y10A 1AZSA 1CS4B 5D15A 4OYBA 2GVDA 3G82B 3R5GA 4OYMA 1TL7B 3ET6A 1CULB 4CLUA 4CLWA 1YBUA 5D0GA 1CJKA 1CJUB 5D0HA 1U0HA 4NI2A 1WC0A 3C15A 4CLKA 4OZ3A 5D0EA 5IV4A 3UVJB 4USWA 1CJVA 4USUA 2GVZB 1CJTB 3MAAA 1Y11A 4USTA 3C14B 4CLTA 4CLLA 3C16B 4OZ2A 2GVDB 5D0RA 4OYOA 3G82A 1YK9A 1TL7A 4CLZA 5IV3A 2WZ1A 4P2MA 1CULA 4WPAA 3MR7A 4OYWA 1YBTA 4OYXA 1FX2A 1U0HB 4CM0A 3C15B 1AZSB 1WC4A 4WP9A 1CS4A 4CM2A 1WC5A 4P2FA 3UVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAA B;  4CLS A;  4WP3 A;  1FX4 A;  2QV6 A;  2GVZ A;  3ET6 B;  1CJT A;  2W01 A;  4OYZ A;  4CLY A;  3C14 A;  3C16 A;  1CJK B;  4OYP A;  4USV A;  4NI2 B;  1CJU A;  4OYI A;  1WC6 A;  1AB8 A;  4CLF A;  1WC1 A;  2BW7 A;  1CJV B;  1WC3 A;  4OYA A;  4CLP A;  4P2X A;  4WP8 A;  1Y10 A;  1AZS A;  1CS4 B;  5D15 A;  4OYB A;  2GVD A;  3G82 B;  3R5G A;  4OYM A;  1TL7 B;  3ET6 A;  1CUL B;  4CLU A;  4CLW A;  1YBU A;  5D0G A;  1CJK A;  1CJU B;  5D0H A;  1U0H A;  4NI2 A;  1WC0 A;  3C15 A;  4CLK A;  4OZ3 A;  5D0E A;  5IV4 A;  3UVJ B;  4USW A;  1CJV A;  4USU A;  2GVZ B;  1CJT B;  3MAA A;  1Y11 A;  4UST A;  3C14 B;  4CLT A;  4CLL A;  3C16 B;  4OZ2 A;  2GVD B;  5D0R A;  4OYO A;  3G82 A;  1YK9 A;  1TL7 A;  4CLZ A;  5IV3 A;  2WZ1 A;  4P2M A;  1CUL A;  4WPA A;  3MR7 A;  4OYW A;  1YBT A;  4OYX A;  1FX2 A;  1U0H B;  4CM0 A;  3C15 B;  1AZS B;  1WC4 A;  4WP9 A;  1CS4 A;  4CM2 A;  1WC5 A;  4P2F A;  3UVJ A; 
#chains in the Genus database with same CATH topology
 4PUO B;  2I5J B;  2Q6B A;  2RB7 A;  4DL7 A;  2GO9 A;  3TQE A;  1NDL A;  3JSY A;  1GEH A;  2CQC A;  3I0S B;  5F8N A;  1AB8 A;  3VGS A;  4W90 B;  5B09 A;  3MR5 A;  2DGX A;  4N8N A;  1SC4 B;  2HBR B;  2K2P A;  4ANC A;  1QAX A;  1VQL S;  3QYY A;  1SH0 A;  4NLW A;  1JJ2 R;  4E8U A;  2GHW A;  3GIL A;  4G1I A;  3AJ2 A;  4EBD A;  1JLE B;  2NQP A;  5IOL A;  4OQJ A;  2CWX A;  2XS5 A;  4DMZ A;  2W8K A;  3ZZZ A;  5AXM A;  4LVO P;  2H5J B;  3OVS A;  4J9N A;  5KG6 A;  3W8G A;  3G4S S;  1NPP A;  2QL5 B;  3DLK B;  3X3U A;  2XYG B;  3DU6 A;  2ZIT A;  4LF6 F;  2PT0 A;  2NZC A;  3LPY A;  3UE2 A;  1WI6 A;  5KT3 A;  5A2Q U;  1NK7 A;  1KNZ A;  3PEH A;  4ZPC A;  1YQH A;  3RBX A;  1HNW F;  4K4U A;  2UUT A;  2I6W A;  3MM5 B;  2B3T B;  3HM9 A;  4ECS A;  3DKD A;  2VKZ G;  1QVF R;  2WVF A;  4PUO A;  2I5J A;  2C1E B;  4IOA Q;  3JTN A;  1KHW A;  4OZ0 A;  4IRK A;  4LF9 F;  1GT8 A;  3EGW B;  3PX0 A;  5JXS A;  5DJB A;  3W9I A;  1N4L A;  3HD1 A;  2CQ3 A;  2MKC A;  3I0S A;  3BZQ A;  1NXI A;  2RD5 C;  2XHW A;  3KTQ A;  5IC6 B;  4Y2A A;  4F4X A;  1S1U B;  1VLY A;  5D0R A;  4ATN A;  3I5A A;  4BLG A;  5F8J A;  1VIO A;  5A76 A;  2CKW A;  2AEJ A;  2YQ3 A;  4AXI A;  1WC4 A;  3M9M B;  1JLE A;  3HSG A;  5IXU A;  2W1B A;  5KFG A;  3J81 Y;  1NAQ A;  2HQ3 A;  3H98 A;  4EU0 A;  3KUH A;  3G8Q A;  4LBI A;  2H48 B;  4O3R A;  3DLK A;  5CZV A;  1Y00 A;  2XLK A;  4DR5 F;  4ZP7 A;  2UVU A;  2DRD A;  3GJR B;  1YG0 A;  3R5G A;  1UMJ A;  2EFQ A;  1S4E A;  3V81 A;  2YBV A;  3R27 A;  2C3U A;  5DS7 A;  1WF2 A;  2N4D A;  3CED A;  1U0H A;  5DRK A;  3V4I B;  2YKM B;  2PMH A;  3LAM A;  3LWM A;  4R5P B;  3MM5 A;  4RKU C;  3OV7 A;  1CPZ A;  3EPI A;  3IC1 A;  3H5S A;  5THW A;  4D3G A;  4QWE A;  5E3R A;  1Q5Y A;  3RUB L;  5K5M A;  4YDX A;  3NOG A;  1RU2 A;  2HWT A;  1HNX F;  3VZI A;  2X51 A;  3RW6 A;  3NNC A;  2G9O A;  3AAW B;  4GC6 A;  4AYB D;  4WZM A;  3HHL B;  2DGO A;  3A1Y G;  3BH6 B;  4RW8 B;  2LEB A;  1S1U A;  1SL1 A;  4J9Q A;  4ZPW R;  2AX0 A;  3VAI A;  1WDD A;  2ZM6 J;  1GK8 A;  4IG0 A;  1WF0 A;  3ENV A;  3IR7 B;  5MAO A;  1R8C A;  4M5L A;  2IFX A;  5CA5 A;  5F8I A;  3W5Z A;  3NBP A;  4QBU A;  4ZLP A;  4DCP B;  1YGY A;  1HMV B;  1FRK A;  5IWA F;  2OIH A;  4KT0 C;  1C4A A;  3U7J A;  3J81 U;  5H1S V;  3QJP A;  2L41 A;  3Q2T C;  2Y8W A;  2R8I A;  5BXI A;  2QLJ B;  3JSM A;  4O0I A;  4URS A;  4AXJ A;  1V9O A;  1S7I A;  3AOA A;  4MMO A;  4CZC A;  2BOA A;  2ZOG A;  2B43 A;  4X4Q A;  3T41 A;  2RUG A;  4GKK F;  4IG3 B;  4R0J A;  5FLX Y;  3HI9 A;  4DR2 F;  3I5B A;  2B56 A;  4DG1 B;  5HAO A;  3MPW A;  2VJU A;  2DNO A;  3V4I A;  2YKM A;  4DCO B;  1CLF A;  4ED1 A;  4R5P A;  1FX4 A;  2UV8 A;  1D1U A;  3QRP A;  3HZG A;  4ZK7 M;  3HT0 A;  3TUZ C;  2GAG C;  3W60 A;  4OX9 J;  1WJ9 A;  3KWM A;  2I38 A;  4ZHR B;  5CAA A;  1VBZ A;  4NI2 B;  3SV3 A;  4Q5V A;  3UFC X;  2HZC A;  1CSJ A;  1R6Y A;  2R8J A;  3HHL A;  5D15 A;  1UP1 A;  1M5K C;  2CDR B;  1VQ7 S;  1HWJ A;  1Q8I A;  2Y1L B;  1FA0 A;  3T19 A;  1HBM B;  3IAS 9;  1FI4 A;  5D0H A;  2B5J A;  4ZIW A;  4Q8E A;  2E1R A;  5HJX A;  2WSE C;  3PRV A;  3EMT A;  3M8R A;  2G1D A;  5JMN A;  4MKV A;  1JJH A;  3C14 B;  2K06 A;  4NLX A;  3J7Z 5;  2WVE A;  5HLF B;  1HMV A;  2HHS A;  5KFQ A;  1T03 B;  1EQM A;  1D3W A;  4ICL B;  2WTF A;  4ZLN A;  2RAQ A;  1NK4 A;  4LBP A;  4FPR A;  3RBZ A;  1H6K X;  5DQG A;  4DSK A;  4YR0 A;  1SL2 A;  1G7C B;  2QC3 A;  4X65 J;  1TFW A;  1SV5 B;  4J9L A;  1ULR A;  5U47 A;  3HVW A;  3K5M A;  4HR2 A;  3HHL D;  3D67 A;  1TKD A;  4IG3 A;  1VQ8 S;  1EHW A;  3LTO A;  4ETZ A;  2HZA A;  2JSX A;  2ALZ A;  1A7G E;  3TAN A;  3CJ8 A;  2LYV A;  3M7V A;  2GMH A;  4USJ C;  4B3R F;  3RB3 A;  1Y5N B;  4FXV A;  1SL0 A;  4JUZ A;  2GHV C;  3CCS S;  3P6Y C;  2PO4 A;  4ZHR A;  4NI2 A;  5EWF A;  3PYE A;  2CQH A;  1HQE B;  1QUV A;  1RYR A;  1CC8 A;  3MGJ A;  1IBM J;  2ZOF A;  3FEZ A;  1IJF B;  3CCM S;  1RKI A;  1BQM B;  1PJ7 A;  2DBB A;  4P9S A;  4N77 A;  4ECX A;  4CDI A;  3TVZ A;  1KEK A;  3CCZ A;  1P1T A;  2KN4 A;  3CC2 S;  4OX8 A;  4IOC Q;  4TKT A;  3C14 A;  3E01 A;  4NZ0 A;  1NJY A;  1KQF B;  5KT6 A;  3CCR S;  2QZ8 A;  5HLF A;  1XQI A;  2IJF A;  5GME A;  1T03 A;  3HX9 A;  3A3P B;  4ICL A;  4KO0 A;  3W8P A;  2YH1 A;  4Z7Y A;  1SH2 A;  3ELH A;  2LVW A;  2W2Q P;  1U1L A;  2MY7 A;  3QGP A;  1H74 A;  4EGL A;  4ZDN A;  4C3K A;  5LMU F;  4HVZ A;  4ZCI A;  2BQR A;  2P9C A;  1WHW A;  4ZKA A;  1WWH A;  3TYT A;  4QWC A;  4URQ U;  1F5B A;  1TK0 A;  1OPI A;  4NXN F;  1S97 A;  4RWW A;  4K4Y A;  4FYY B;  3DRS B;  4WTO B;  3VAG A;  2AJQ A;  1IBK F;  2F65 A;  2HHU A;  3PV8 A;  1H3D A;  1YLX A;  3SCJ E;  4EYI B;  4NCG B;  2DGS A;  3OD2 A;  3EGV A;  4Y2K A;  3I4P A;  4URG A;  2V9W A;  1T11 A;  2G2O A;  2AZ1 A;  1L5U A;  3ENW A;  1HQE A;  2V8H A;  1U45 A;  1BE4 A;  2NS1 B;  1BQM A;  5D4P A;  3CJT A;  1VOM A;  2ROE A;  4OJ3 A;  1U1N A;  1GMW D;  1LFW A;  3EZU A;  1RK8 A;  4LSN B;  2KYZ A;  1RE1 B;  3PKM A;  2FPH X;  4C7Q A;  1F5A A;  4DV6 F;  3BF4 A;  4HTJ A;  2DY9 A;  4RL1 A;  3FCV A;  3DOK B;  4L72 B;  4KSE B;  1CJU B;  5K8P A;  4P2S A;  4YB7 A;  3CNQ P;  2ZH7 A;  3MPU B;  3MEG B;  1C4C A;  3K5O A;  2YXL A;  3MPY A;  4WIQ A;  3OVA A;  2ZJQ Q;  4EI2 A;  1FRM A;  2KU7 A;  2UXC J;  1FWK A;  2WHO A;  3BM7 A;  3PW5 A;  4C11 B;  2MJU A;  3VGU A;  4YR3 A;  4BS2 A;  3FKB A;  3AA9 A;  5DDP C;  3BB5 A;  1XC9 A;  2R7U A;  2XYP B;  3RZA A;  2R4F A;  5B0E A;  1FVS A;  1J27 A;  4RU9 A;  5DG8 A;  3GR0 A;  2XBP A;  4QIV A;  4ECW A;  4ZP6 A;  2G0C A;  2MLY A;  3DRS A;  2O67 A;  1N5T A;  2HQC A;  4UUW A;  5EX3 A;  3J7Z T;  5FDL B;  4NCG A;  4Q44 A;  4NRU A;  2H65 B;  4PR6 A;  4XIU A;  4YP3 A;  2FJB B;  2XUL A;  4Q45 A;  3BPD A;  4ZJL A;  2UUW A;  4CP5 A;  1LOU A;  1H98 A;  2HK2 A;  4GMK A;  3KKF A;  1UKU A;  1IBC B;  2OML A;  3HHE A;  4FXD A;  2CJX B;  3G71 S;  2MPU A;  3R5C A;  3HD2 A;  3AHP A;  4LFA F;  4LSN A;  1JXL A;  1NH7 A;  2XMK A;  2E5J A;  3KYL A;  2BVZ A;  4WFZ A;  1N6Q B;  4F0H A;  5CH7 B;  3P8B B;  2GC8 A;  3LP2 B;  3EVO A;  1YJN S;  1U2R A;  4CQ1 A;  1NHU A;  4DV3 F;  4ITS A;  5LMN F;  2DIS A;  2FY8 A;  2DR7 A;  3DOK A;  2C2R A;  4CM0 A;  4DR1 J;  2MB0 B;  2DGU A;  2CQ2 A;  1C0T A;  5KFA A;  3MAQ A;  1VBY A;  1RHR B;  3MED B;  3MEG A;  2DNZ A;  4DX6 A;  4FPI A;  2HMI B;  1UZH A;  2CPJ A;  5E3P A;  1U48 A;  3W9J A;  2VIH A;  1UWA A;  1RHQ B;  1U6F A;  1BQN A;  2Y0B B;  4C11 A;  1RWV B;  1HI1 A;  4C98 A;  1RLD A;  2KXN B;  5DLF A;  1J5O B;  1WHV A;  1EZZ B;  1VQ6 S;  3GCX P;  2XQC A;  2XI3 A;  4HT7 A;  2MSS A;  5HI7 A;  1P8G A;  2PFD A;  2ATL A;  2ZWP A;  2RQK A;  2H3E B;  2LA6 A;  2OEK A;  1MU2 B;  5FDL A;  2KRR A;  1WOR A;  4CI0 B;  4YR2 A;  2FVC A;  3T9Z A;  5B0G A;  2MQP A;  2XC9 A;  2ZH9 A;  3SIP B;  2JC1 A;  3WZ0 A;  1WHY A;  3SXL A;  4O3N A;  2B4V A;  4OX7 A;  3VAJ A;  5D4N A;  4ZIT A;  3M2R B;  2VAS A;  1VQP S;  1Q53 A;  1WKK A;  4CNY A;  1F3V A;  1KRP A;  4X66 F;  3UR3 C;  4J9O A;  4MIB A;  1HWU A;  4LFB F;  4CIO A;  2IIH A;  2J8A A;  4K0K F;  3ILO A;  4I6W A;  1FHT A;  2B9E A;  1VS3 A;  3OVB A;  1N6Q A;  3BN4 A;  3CO0 P;  4DV4 F;  2WVC A;  3LP2 A;  3AQO A;  3OJU A;  3CCT A;  1EB0 A;  2DH9 A;  3V6H A;  1X9S A;  5L39 A;  4OYA A;  3NWR A;  4JBC A;  4QOT A;  4P2X A;  1TP7 A;  3FMW A;  2IY5 B;  1WEX A;  1KVK A;  4B9T A;  5CHC B;  1UCN A;  5EUH A;  3DI6 B;  3MED A;  2V34 A;  3DLL Q;  3OTB A;  4JOU A;  4P72 A;  2HMI A;  4RW9 A;  4ZP8 A;  2DIT A;  2RF2 B;  4A8M P;  3THV A;  2ZFH A;  3GZ7 A;  2GHP A;  3N4W A;  3PDN A;  1IWA A;  1FDB A;  1DQ9 A;  4YY3 F;  3IXQ A;  3DU5 A;  3CTR A;  3NCQ A;  5GAG U;  4MK9 A;  3N79 A;  2PFF B;  2KTQ A;  4ZA1 A;  4WFA Q;  4KGV B;  3IWX A;  4XTT A;  4NEZ A;  3MEE B;  4LT6 A;  3BYP A;  2K7K A;  3V2U C;  1MU2 A;  1HNZ F;  2W4D A;  2JEG A;  2EG1 A;  3TOQ A;  3EJM A;  2VDI A;  4JP8 A;  2VPY B;  4NL5 A;  4FXW A;  3MPD A;  5L1L A;  2ZUG A;  3AH6 A;  2J0Q D;  2JFD A;  4EZ6 A;  3R2C J;  2W2O P;  3RB0 A;  3MEK A;  2FZC B;  1PC5 A;  3M2R A;  4Q7A A;  3CMQ A;  3NGD A;  4KHP J;  4WP8 A;  2WW8 A;  3D0H E;  3L7P A;  2MHN A;  3J7A 1;  5GAE I;  1RT3 B;  4K4X A;  3DFE A;  1F5C A;  3D9B A;  1HWK A;  3K17 A;  4D3H A;  1CEZ A;  2GJI A;  2CJ9 A;  1XBW A;  2ZVS A;  1QJH A;  2I2Y A;  1OPZ A;  3HJF A;  2HHH F;  2ZH1 A;  1WC0 A;  4F04 B;  3IS9 B;  1X5T A;  3N01 A;  2CQ0 A;  3N9U C;  1RCX B;  1NME B;  2OFH X;  2DYA A;  1WG5 A;  1OMS A;  4LFC F;  3M6W A;  3W61 A;  3DI6 A;  3QWP A;  2CZ4 A;  4Y0F A;  3DMJ B;  4A4J A;  4I6Y A;  4N5S A;  1U1R A;  4L75 A;  1FKP B;  2W9B A;  2HWI A;  3RAX A;  4M8L A;  5HP1 B;  2KVQ E;  3QJJ A;  4F2S A;  3I0R B;  4GO7 X;  4C0H A;  5B0D A;  3A12 A;  4RW7 A;  2RQ4 A;  2WVB A;  5T41 A;  1HWI A;  4PXC A;  2AX1 A;  3MEE A;  2VA3 A;  3BSO A;  1PAE X;  4A8S A;  1GFW B;  1YIJ S;  1V3S A;  4OHY A;  2RS8 A;  1Q82 T;  4OLP A;  2KVI A;  2PMZ D;  2BAN B;  5HMW A;  3E8O A;  3AD7 C;  2Q3P A;  2HVH A;  4N8O A;  4W92 B;  2VG6 B;  3H40 A;  5KG5 A;  3ZZT A;  1Q7L B;  2AGQ A;  4CH1 A;  3EVW A;  1OSD A;  1B70 B;  1DLO B;  1YJR A;  4WTY A;  5KFC A;  1UAW A;  3GV5 B;  3FK4 A;  1VQ9 S;  2LCW A;  3CDE A;  2CPF A;  2OGU A;  1RT3 A;  1VGY A;  4K4W A;  2EKY A;  3OQ2 A;  2RVJ A;  4MIW A;  3FEY B;  1MWQ A;  5HAN A;  2IRX A;  3IS9 A;  4PXE A;  3NNA A;  1J5E F;  1O8B A;  5ITH A;  3OT9 A;  1VQS A;  1B7Y B;  3BV8 A;  3O5T B;  1Y5L B;  1NK6 A;  1RA7 A;  2ILY A;  2HQI A;  4WFY A;  1I94 F;  2V4R A;  2F63 A;  2HWH A;  4WFB Q;  3R5D A;  2APO A;  3P5T L;  2EFN A;  2XS7 A;  1H7W A;  1NSP A;  1FKP A;  1HHT P;  3M8W A;  3O6Q A;  5IT4 A;  4DQS A;  1BUX A;  2MKH A;  1N0U A;  2IYI A;  3AB4 B;  5HP1 A;  2HHT A;  2NUU G;  3G6Y A;  4DS4 A;  2HFU A;  3I0R A;  2Z2L A;  5B0C A;  4ZP9 A;  4JV5 F;  1R0A A;  3CJ5 A;  4GKJ F;  1HHS A;  1TKX B;  2Y9H A;  2ZHB A;  4OZL A;  3TJA A;  3GJT B;  1UWB B;  1FE0 A;  2W9A A;  1HHQ A;  1RA6 A;  3ZTO A;  5HSP A;  4LRB A;  3DXB A;  2BAN A;  3K5N A;  2ZBC A;  4J37 A;  4WCE Q;  2KH9 A;  3TO8 A;  4LSZ B;  2VG6 A;  4HHJ A;  2F4F A;  4ZVR B;  2W2P P;  2DH8 A;  3RBD A;  2FY1 A;  3DGV A;  2ASL A;  4OLO A;  5HVF A;  1CS4 A;  1W2I A;  1U1P A;  3WC0 A;  2C42 A;  5A8R B;  1DUR A;  1GX5 A;  2FJW A;  4LF6 J;  4JI3 F;  2ZH3 A;  2E7W A;  2QSF A;  4DV7 F;  3J80 Y;  2CRL A;  4OYP A;  4RNH A;  3KMS A;  5KFT A;  3SI8 A;  2P6T A;  2KFN A;  1FVQ A;  4QW8 A;  2D9O A;  1NJW A;  3MOZ A;  1HNW J;  3NGU A;  2QTW A;  3MFH A;  4NAS A;  1S5Z A;  2HVI A;  1WDT A;  3TVK A;  5C24 A;  2A2D A;  5DLG A;  2CJK A;  3U1M A;  2VFT A;  3M05 A;  4LF9 J;  1U8S A;  1OQ3 A;  2QX0 A;  5KFJ A;  2G2Z A;  2BJ3 A;  4FYW B;  2YWK A;  1K9M T;  4DOZ A;  1BY9 A;  4B3S F;  2HQD A;  1NDC A;  1UFW A;  4KV8 B;  2E9T A;  1SJ3 P;  3VWS A;  3PW4 A;  2W2M P;  5ETK A;  2QA1 A;  3R5J B;  1TKX A;  1MMD A;  1LWF B;  3M2U B;  1U49 A;  2RUS A;  1UWB A;  1OY9 A;  3DGP B;  2DCU B;  4A8W A;  2IM2 A;  1F9H A;  3P96 A;  4ED6 A;  5H9E J;  3VQS A;  1OQ6 A;  3SSQ A;  1FWP A;  2XSF A;  5HQL A;  2L9W A;  3HSD A;  2X3D A;  2X1F A;  2H9Z A;  2J0X A;  4M1K A;  5GAD U;  4DR5 J;  2CG4 A;  5A8R A;  3UD5 A;  3LWL A;  3KJQ B;  3TAP A;  4KJI A;  4IH5 A;  3H59 A;  1YI2 S;  2ZJP Q;  1YBU A;  1Q4R A;  2A10 A;  3LAL A;  3CB4 A;  4OL8 A;  1PO6 A;  2ILZ A;  1J2V A;  3FZ2 A;  4U6P A;  5J2M A;  4DV2 F;  1X4D A;  4I7F B;  1RAG B;  4ID5 A;  1M5S A;  1S9G B;  1WF1 A;  3CE8 A;  3DN9 A;  4S0M A;  2CJA A;  2GIQ A;  3T1Y F;  5EN1 A;  2YNF B;  2Z30 B;  2YKQ A;  3QGI A;  2IA0 A;  1IJE B;  1TMJ A;  3VVT A;  5FD1 A;  3NRB A;  1DRZ A;  3EVM A;  1HNX J;  4AE5 A;  3I82 A;  2BKN A;  4KGK A;  3ZTR A;  1CJK B;  3P49 B;  4YHH F;  3QRR A;  4C8Z A;  4KV8 A;  2ALY B;  2FJX A;  1G2E A;  3CVK A;  5CCM A;  3OHA A;  2WBR A;  1MW7 A;  2DNY A;  1FT8 A;  4DL2 A;  4DSJ A;  3M2U A;  4A8Q A;  1U47 A;  4DU8 A;  2K7J A;  5LL6 d;  3DGP A;  3PAC A;  4DHV A;  3TUJ C;  4Q2L A;  2DR6 A;  4KC5 A;  5IWA J;  1S6Q B;  1SKU B;  3MMJ A;  3UDE A;  2ZD1 B;  1IKX B;  4UST A;  2M88 A;  4RJV A;  3OUY A;  5LXR A;  2FVQ A;  2ASY A;  2LXI A;  1ZM3 A;  1RT5 B;  5AJ3 F;  1FNX H;  4KRW A;  4HLB A;  5CYJ A;  3IGV A;  3HF5 A;  3J7A N;  5IS2 A;  5CD4 A;  4M5I A;  1ZM4 A;  4GKK J;  2JX2 A;  3O8W A;  2ZOM A;  2MY8 A;  4I7F A;  4DR2 J;  1X31 C;  1PBU A;  3ETO A;  3CCV S;  4ED7 A;  1S9G A;  4Y34 A;  3EIC A;  2HZV A;  1WC6 A;  1YRU A;  3MD3 A;  2ZH4 A;  1T02 A;  1UPM B;  1WEY A;  4QWA A;  4CWB A;  1R27 B;  2CQ1 A;  1CG2 A;  4KB7 A;  1RAC B;  1CJK A;  4FYD A;  4P7T A;  5DET A;  1NZ8 A;  2YNG B;  3PO5 A;  1JXE A;  1Z2Z A;  4PYD A;  4USW A;  4BWJ A;  1PKU A;  3IM8 A;  4ZS6 A;  2CNL B;  2V0N A;  2HFZ A;  3DLB A;  1VMB A;  1IKV A;  3Q8Q B;  3CIZ A;  1K0V A;  1KVJ A;  3ZXW A;  5I3Q A;  3RGI A;  3KFW X;  3B82 A;  1TL3 B;  3C8Y A;  3OFG A;  4CO4 A;  1BWV A;  2WK4 A;  3KUE A;  2IA6 A;  3T1H F;  2C2O B;  4DFP A;  2VC0 A;  3G6E S;  2KB2 A;  4XK8 C;  1S6Q A;  1ZS6 A;  4K59 A;  2G2Y A;  2ZD1 A;  1IKX A;  5B7W A;  2VQF F;  3T3F A;  4DPT A;  1KTV A;  3K5L A;  1RAH B;  3PG9 A;  2FC8 A;  4HHH A;  1VQK S;  4TXS A;  1NJX A;  1RT5 A;  3FNN A;  1FTC A;  2NYI A;  2HHW A;  2HQG A;  3B4D A;  1B0P A;  2MZT A;  2HVE A;  3ILJ A;  2B8Q A;  1TAQ A;  3R2D J;  2JVO A;  2ZBR A;  3MF5 A;  4AND A;  3T9N A;  3PYD A;  4L6V 3;  3CUN A;  2CZ9 A;  4YDD B;  1F9F A;  2XCP A;  3QIP A;  4EK2 A;  2W2N P;  4QYR A;  3VZH A;  4OZJ A;  4FF4 A;  2YQ0 A;  4B3R J;  3RB6 A;  3OXL A;  4J9S A;  2M2B A;  3CT9 A;  1IXK A;  2FHM A;  4DX8 H;  2E5G A;  1QSY A;  3EX7 B;  2EEY A;  4OZ5 A;  3NGR A;  3TEG A;  1JWW A;  1YHQ S;  4ILR A;  4IOB A;  3OR1 B;  4Y2I A;  3CCW A;  1VDH A;  5KFF A;  1G3O A;  2HGL A;  4ZCL A;  2YNG A;  1YRX A;  3IP0 A;  3CD5 A;  1Q8B A;  1YVF A;  2NXU A;  4NXM F;  1NRK A;  2HBY B;  4LR9 A;  4O3O A;  1NO8 A;  3R6L B;  4EBE A;  2R2R A;  2VPX B;  3TNV A;  1TL3 A;  3JYT B;  4RW6 B;  4FKX A;  4UT4 A;  2O5D A;  3BO3 A;  2VFV A;  3MHY A;  1QVG R;  3GQC A;  2MZ1 A;  3CJS A;  1IM4 A;  3FCW A;  3GFH A;  3JB9 k;  1VQ4 S;  1P1L A;  1FXL A;  4WXO A;  3FQL A;  5LMU J;  1H38 A;  2ZDO A;  2F4V F;  3BR8 A;  2DD8 S;  4A8Y A;  1CJT B;  2GFF A;  5CCL A;  3M6U A;  3BGU A;  4DL3 A;  4NA2 A;  3MUM P;  4X4P A;  3UNG C;  2B0G A;  1UVJ A;  1G6B A;  4NXN J;  3HFZ B;  4W98 A;  3RYL A;  5LOQ A;  3GB0 A;  1X60 A;  3AQP A;  1Q5V A;  3SMZ A;  4A8K A;  1IM6 A;  4DDF A;  1Y4Z B;  2MGZ B;  1IBK J;  2XSJ A;  4IO9 Q;  1TL1 B;  2IPO B;  2LDY A;  2DH7 A;  1IUJ A;  2W25 A;  3R7S B;  3FGV A;  1I6J A;  2GZO A;  2F8H A;  2DK2 A;  3OR1 A;  4RNM A;  2YNH B;  3ITH B;  1FFW B;  1HBN A;  1DZ5 A;  1T9V A;  3MUV P;  2IDE A;  3TW0 A;  3NXZ A;  1O5J A;  2OKQ A;  3F73 A;  1SJF A;  3OLA A;  1N34 F;  3HP6 A;  3HO1 A;  4PG8 A;  4CLU A;  4G3I A;  4WXW A;  2XEX A;  4B9S A;  1VBX A;  1IVZ A;  4YB6 A;  4ER8 A;  2F5G A;  3GIR A;  3QID A;  1NEE A;  2OPS B;  2VKR A;  1XNQ F;  1U6Z A;  1YSJ A;  1OJ4 A;  1Q0N A;  4RW6 A;  2FUG 9;  4Y00 A;  5KAK A;  5KG0 A;  3UO0 A;  2ADC A;  1NPK A;  1Y5I B;  3L09 A;  3KLE A;  5KG7 A;  4HDG A;  2IVM A;  1WSR A;  3K57 A;  2XB2 D;  1NKE A;  2A1B A;  2W7A A;  1WEL A;  1WC5 A;  2VB6 A;  4Z37 A;  4HEA 9;  3MR6 A;  2PEB A;  4U7U K;  3WIV A;  1CJT A;  1RTJ B;  4NLD A;  2AYG A;  2B4O A;  1LK5 A;  2CVE A;  3LF0 A;  1RT2 A;  3AD8 C;  4USV A;  4KHM A;  2VV5 A;  4ZCM A;  2V2Z A;  1T9T A;  3IG1 B;  5KFN A;  3KK2 B;  2KM8 B;  1FWL A;  2MGZ A;  4ZJO A;  3WX8 A;  3CO9 A;  1TL1 A;  4KH0 B;  1TL7 B;  2HHX A;  3QFH A;  2P2C B;  5M2U A;  4MH8 A;  3AFG A;  2GW8 A;  4Z2X A;  4U95 A;  3UR0 A;  4HHU A;  4DSE A;  4H54 A;  3W7B A;  1RYS A;  3D68 A;  5KFL A;  2YNH A;  2DGQ A;  3ITH A;  3PJ9 A;  3AXK A;  1FER A;  3UDC A;  1NPR A;  4JB8 B;  2O1P A;  4OI6 A;  1DQA A;  2D3Z A;  2VBW A;  1D8Y A;  1M5O C;  4KPY A;  5BYQ A;  4LSL A;  3M6X A;  3O44 A;  4LFA J;  5C7P A;  4WPA A;  2C2K B;  5EHH A;  4PWW A;  2YKO A;  4F0M A;  3LO3 A;  4UQT A;  3A8I A;  3H5U A;  4DV3 J;  5KG1 A;  4JI0 F;  2OPS A;  5LMN J;  1Y7P A;  3FDS A;  1M5P C;  4DXL A;  2ABY A;  3OR2 B;  3RR7 A;  3MCM A;  4IH6 A;  1R89 A;  1TR0 A;  3M8Y A;  2MDA A;  4L74 A;  4O0N A;  3V6J A;  4I2Q B;  3H42 A;  1TKT B;  3WQP A;  2HND A;  3MR3 A;  4FVM A;  2Z8Q A;  2KJW A;  3TX0 A;  3DOL B;  4OYB A;  3EPG A;  2VPW B;  1HBO B;  1Q7Y T;  4TVA B;  2QLW A;  4P7V A;  5DQH A;  3Q8P B;  3IN5 A;  2ZWO A;  1XR5 A;  3MOJ B;  4XAK A;  4CH0 S;  4F4Z A;  2QFJ A;  4EFA C;  3SEO A;  3WBZ A;  4USU A;  5HRO B;  2DIV A;  3KK2 A;  1HIY A;  1EAY C;  1RWU A;  1KLM B;  3UNY A;  2XO7 A;  2C28 A;  3RR8 A;  3R1L A;  5E0O A;  1TL7 A;  4IH7 A;  3W3S A;  4WKR A;  3NMA A;  2GJ2 A;  3C3L A;  4KIA A;  3KLG B;  3G9C A;  3M8Q B;  2IRY A;  3EXY A;  4EO8 A;  3CXC R;  1URN A;  4XDD A;  2PMW A;  1AFJ A;  2JEI A;  2W4P A;  4GRS A;  2IBK A;  2RH3 A;  3IBW A;  3ET6 B;  4DSL A;  2JEF A;  2LQ5 A;  4X66 J;  4LFB J;  2CPI A;  3WDO A;  4K0K J;  4NLP A;  1JLQ B;  4LF1 A;  4OI2 A;  3ENA A;  5CYM B;  2WW4 A;  4DV4 J;  1HWL A;  6FD1 A;  5H9F K;  1ZA2 B;  1TV6 B;  5F0U A;  3HMJ G;  3NOC A;  5K9F A;  3Q23 A;  3GLJ A;  3OR2 A;  4DZD A;  4M5J A;  3LW5 C;  2WB4 A;  3R97 A;  5I42 B;  3GON A;  4I2Q A;  4OV6 A;  1Q8K A;  4CYU B;  1TKT A;  2ZC4 A;  2BOP A;  5DZ7 A;  3ZNJ 1;  1S1V A;  3I6P A;  1HNV B;  3GU0 A;  3DOL A;  3NMR A;  4UW2 A;  1MRO B;  4YY3 J;  1HBO A;  2GMJ A;  1RWP B;  3GFY A;  1NK8 A;  3M32 B;  1WNE A;  4FBT A;  4RBV A;  3HJV A;  1CQM A;  2GGP B;  2FVP A;  1S1T A;  5KFP A;  1S6P B;  4IUF A;  4J9R A;  2FJA B;  3MAA B;  5HRO A;  2OSQ A;  1RSC A;  2AEF A;  2D1C A;  1FE4 A;  1KLM A;  1HNZ J;  3C19 A;  2QMX A;  3MMA B;  1JJ4 A;  1JX4 A;  2EI5 A;  3KLG A;  1VC5 A;  3M8Q A;  5BYS A;  2DXF A;  1U4B A;  1TK5 A;  1S4F A;  4A48 A;  1RP5 A;  5KG2 A;  4JV2 A;  3JTO A;  3UCG A;  1C0U B;  2GVD A;  3IFE A;  3OFH A;  2XM3 A;  3ET6 A;  2M8D B;  1K1S A;  4G6V B;  5K14 A;  5IFM A;  3NNH A;  1JLQ A;  1RAB B;  1T94 A;  3GV7 B;  2WVD A;  4CNZ A;  2RSQ A;  2IHR 1;  4BWM A;  2HHH J;  2MQN A;  4LF5 F;  2E7X A;  1UEV A;  1FRJ A;  1Y0H A;  2BJE A;  4B9V A;  2LLZ A;  4QU6 A;  4UOG A;  1AFI A;  1L3T A;  3SBM A;  3FRZ A;  3UI3 A;  4LFC J;  2H4Y B;  5E2Q A;  1KQG B;  5HO4 A;  5I42 A;  2UUC F;  4LMZ A;  3LGN A;  3BKF A;  5BYR A;  1T0T V;  1M1K T;  3NCP A;  2Q6C A;  2FJE B;  1HNV A;  3D1Q A;  4F3M A;  4Y65 A;  1MRO A;  4DV5 F;  2MTL A;  2V6A A;  2V8G A;  2BW7 A;  1N56 A;  3M32 A;  1SQF A;  2GGP A;  2EBE A;  4PCQ A;  3TI0 A;  3GG1 A;  4TNO A;  1XNR F;  2EFV A;  1S6P A;  4B9L A;  1HA1 A;  2ZKU A;  5CYQ B;  2DY1 A;  1HBU B;  3MMA A;  1NCL A;  3QBC A;  4OZ3 A;  2QL9 B;  2VH7 A;  3ZZU A;  2QL7 B;  5AE1 A;  1S99 A;  2R2T A;  3R3T A;  4ZVT B;  3D6M B;  2KZZ A;  4R0E A;  1C0U A;  2ERR A;  4UQG A;  3CCU S;  3P45 B;  5ETM A;  1YBT A;  2FJV A;  4G1Q A;  3SQG B;  3NGK A;  3HPO A;  4DLE A;  2CUY A;  2PA3 A;  3ZZP A;  3QJL A;  4B3O B;  5KOX A;  3DM2 B;  1OIA A;  3WHI A;  2QJ3 A;  2X1G A;  5ETP A;  2XLI A;  3UW1 A;  2CNO B;  1WKJ A;  3TR5 A;  2MQL A;  4Y2M A;  1VRT B;  1IWG A;  2XZD B;  1J5E J;  4DR6 F;  2VD3 A;  2RS2 A;  3W65 A;  2ZBI A;  4NCB A;  3BBB A;  1U1Q A;  2V8V A;  1I94 J;  2RIJ A;  2C2D A;  5GAH U;  3DRX A;  4RNN A;  4USM A;  2OPP B;  3QLH B;  2AZ3 A;  5A2Q Y;  1BWE A;  2ROP A;  4AUK A;  4M95 A;  2H5I B;  1LEO A;  2YQ1 A;  3K0J A;  1T95 A;  2HHV A;  2OPR B;  2UVV A;  3AB2 B;  3KDN A;  4NLV A;  1KR4 A;  2BX6 A;  3TA0 A;  4CT8 A;  4JV5 J;  2LQ8 A;  3EE3 A;  1RTD B;  2CAJ A;  2M0G B;  2ZC3 A;  4GKJ J;  3DC2 A;  1RWK B;  1QE1 B;  1T3O A;  2E5L F;  3HXM A;  2A6O A;  3EGN A;  1RBA A;  4ECV A;  5CYQ A;  2FHJ A;  3MTK A;  2IC3 B;  2RDJ A;  4NMX A;  3V5R A;  1HBU A;  1KTQ A;  3AOC A;  4DN9 A;  4YN3 B;  3B4M A;  3WIU A;  4B9U A;  2R2U A;  4CLS A;  2AYB A;  4DF8 A;  1PIE A;  1PJ6 A;  1YJU A;  2AP6 A;  3I32 A;  5HBM B;  2G13 A;  2JZ5 A;  1RAI B;  1SUQ B;  2MKS A;  3KNA A;  4BDP A;  5IC4 B;  1N8R T;  1DFD A;  2JEJ A;  4RW4 B;  4JI3 J;  4LQ9 A;  1Q86 T;  4GO5 X;  4DV7 J;  5L46 A;  3E3X A;  1RBL A;  2HFS A;  3QZ8 A;  4K2J A;  2DNN A;  1PC4 A;  2KM8 C;  1T9Y A;  3SQG A;  9RUB A;  2IYG A;  2VU5 A;  4U96 A;  3P5B P;  5C42 A;  3KLF A;  2MQM A;  1EP4 A;  1ROF A;  4B3O A;  3SZ2 A;  3DM2 A;  4I64 A;  4LRF A;  1U24 A;  3CJ3 A;  1VRT A;  1FD8 A;  1X5P A;  1NB7 A;  1FTR A;  3ISN C;  3PR4 A;  2HS0 A;  2J6S A;  1QLN A;  2OLW A;  1ZET A;  2OPP A;  3QLH A;  2FHJ D;  1SVD A;  3DDK A;  4ALZ A;  3G6X A;  3V81 B;  4CLZ A;  2M7S A;  3ETM A;  3D0I E;  1QSS A;  4ELU A;  4NA1 A;  5D3G B;  2B7B B;  2OPR A;  2EVZ A;  4B3S J;  1U0H B;  1D8Z A;  3KHR A;  1REV B;  3VAM A;  2HFV A;  1RTD A;  2AYE A;  2DJW A;  4P10 A;  1N32 F;  1NSA A;  3DXS X;  1FNO A;  1QE1 A;  4MT1 A;  5KFI A;  2RE1 A;  4I67 A;  2H1Y A;  5HN0 A;  4OYI A;  2LXF A;  2M4M A;  3BO2 A;  2ZVI A;  1LWC B;  2IC3 A;  4ZVE A;  4LIR A;  1UTA A;  3R7B B;  2R3V A;  2CA9 A;  2XY7 A;  4GVB A;  1ZPV A;  1DHM A;  4OMF G;  1KFD A;  5HBM A;  4TN2 A;  1SUQ A;  5L8R C;  3SV4 A;  4RW4 A;  2D74 B;  3OPK A;  3UVJ B;  6FDR A;  5KFX A;  4IG0 B;  4DWI A;  1SH3 A;  7AT1 B;  4H4O B;  3NBP B;  3PW2 A;  4DV2 J;  5D8H B;  1W2B R;  1HKA A;  2ZZM A;  5I4M A;  4DSF A;  5T7L B;  3QAE A;  1BMQ B;  4DEZ A;  4HDH A;  4OYX A;  2GA7 A;  3AXM A;  1SB6 A;  1UEK A;  3OXG A;  3T1Y J;  4JI7 F;  3JSM B;  3TA1 A;  3I87 A;  2R7T A;  1JJC B;  4FYV B;  2IDL A;  4OYZ A;  4F26 A;  4YEA A;  1BHN A;  3C66 A;  2EXU A;  1RT1 B;  3BYR A;  2Q1L A;  2ZDP A;  2A0F B;  4A46 A;  4ED4 A;  1AT1 B;  3KHG A;  1FKA F;  1SJ1 A;  5D3G A;  2EK1 A;  1RT6 B;  4B9N A;  5EDW A;  2VZ9 A;  4YHH J;  2CQD A;  4RPF A;  5HVH A;  4DZ6 A;  1REV A;  1VIS A;  2OPQ B;  2BRK A;  1XR7 A;  3M4X A;  2V4J B;  1IN0 A;  2LP4 A;  1KOO A;  5E3A A;  3FQK A;  4IDK B;  1REG X;  2AJ1 A;  2Z2Z A;  4A8O A;  1SXL A;  4Q8F A;  3D4J A;  3FBF A;  3D1H A;  4DPX A;  4JI5 F;  1LWC A;  4ZVH A;  1XMO F;  3TEH B;  5L9N A;  3OTD A;  1YJT A;  4OFZ A;  5IM0 B;  2GCF A;  1M5H A;  4P52 A;  3CD0 A;  1M5V C;  2QYC A;  2VQE F;  2B5J B;  3PEJ A;  4DPW A;  1YTY A;  4MKA A;  4E98 A;  3PJW A;  1EIY B;  4HL9 A;  1W25 A;  2BE9 B;  2CJB A;  5AJ3 J;  2XYH B;  3UVJ A;  3V6D B;  1F60 B;  4H4O A;  3NEK A;  3CC7 S;  3OL7 A;  3CWJ A;  1U7L A;  3PW7 A;  2YTC A;  1WTF A;  2Y1R I;  2VA2 A;  5T7L A;  2OEL A;  5GAH I;  2RRA A;  1ZAX A;  4H4M B;  1FRI A;  4CLP A;  4WKY A;  3KMQ A;  2PD1 A;  1O6X A;  3OFF A;  2CJQ A;  1NKC A;  4QPX A;  4OYM A;  3LQV A;  4IR9 A;  1S0O A;  1S12 A;  3BDE A;  2RHQ B;  2CZV C;  4K7Q A;  4KH1 B;  2R9L A;  1RT1 A;  2OEJ A;  4HH0 A;  4O4R A;  2J5A A;  2D41 A;  2J9C A;  3H20 A;  3CMA S;  4L3K A;  1HQU B;  4C0O C;  3UD4 P;  3GE9 A;  1RT6 A;  3MMC B;  3KK3 B;  5IT9 U;  4YOE A;  2A2C A;  2DEI A;  3LP0 B;  1Y3J A;  2CQP A;  4NE9 C;  4FNI A;  4ZVP B;  3MXH P;  4OZ2 A;  1X4E A;  2OPQ A;  3D2W A;  4KE5 A;  3IAM 9;  2XY6 A;  2V4J A;  2BAB A;  1HPZ B;  5KFM A;  1AYE A;  2WCX A;  1S1W B;  4IDK A;  2Z0G A;  2BJD A;  1T3N A;  1F2H A;  2AMC B;  4M5K A;  2BRL A;  4U9R A;  2EFO A;  3T1H J;  4HYK A;  2MHE A;  2YWH A;  3W63 A;  4NEY A;  1FF2 A;  3ILI A;  5IM0 A;  2XZT B;  2HLT A;  3CDB A;  2VQF J;  2HAF A;  3TP2 A;  2R7S A;  3KOA A;  1B0V A;  4TYA A;  4C3M A;  5DM7 Q;  4DU7 A;  5F3Z A;  1B64 A;  1U09 A;  3E01 B;  4X4T A;  4QR1 A;  3V6D A;  1H2V Z;  4CLW A;  3MCO A;  4LF4 F;  2O01 C;  1NK0 A;  4C0B A;  2YWF A;  4KO0 B;  5BR8 F;  1HD1 A;  4A47 A;  1Z4U A;  1AW0 A;  1S9E B;  4H4M A;  4ZVO B;  3I9V 9;  1T9U A;  1YJV A;  2XWX A;  3HKW A;  4LR7 A;  2E1C A;  2QIF A;  1X4A A;  3RRH A;  4MTP A;  3BKT A;  1R8P A;  1ICE B;  3FZB A;  2J9E A;  2FYX A;  1VHF A;  1CVJ A;  3E2E A;  2VFU A;  3G8S A;  4RLE A;  1HQU A;  4QIF A;  4EWT A;  4IFY B;  4YFU A;  3MMC A;  3KK3 A;  4TQR A;  3LP0 A;  3HSJ A;  1ZPW X;  1RWM B;  3ZZ0 A;  2R7O A;  2EW9 A;  1HPZ A;  1F6T A;  4X4R A;  1S1W A;  3TAQ A;  2DR5 A;  4NXM J;  4C2M A;  4BC9 A;  3O1L A;  4DUZ F;  2PE8 A;  4UUX A;  4DL0 C;  1JKH B;  5E5N A;  4FS1 A;  4MJK A;  4B9M A;  2FD2 A;  1BGX T;  1NM2 A;  4AD6 A;  1RHM B;  4UF4 A;  3C15 A;  3OTE A;  3PHT A;  1YX2 A;  2KJV A;  3QAU A;  2F7V A;  5F8L A;  3Q8V A;  1DBD A;  2BMB A;  2WOM B;  5C2G A;  2F4V J;  1ZTW A;  1NZA A;  1VFJ A;  3BGR A;  1DTT A;  4AFF A;  4F7V A;  1FNM A;  1PYS B;  2GX8 A;  5B08 A;  2FGC A;  3DRP B;  2KG0 A;  3H4B A;  3M1V B;  3GTY X;  2EC0 A;  1S9E A;  4RO0 A;  5ETV A;  2UUA F;  4YUD A;  2XMW A;  1GMW A;  4ES3 A;  3LGH A;  4DBQ A;  1SC6 A;  3RW7 A;  1F2G A;  4I6A A;  3ZTP A;  2CJY B;  2JJ4 D;  3LAK A;  1ZA1 B;  1XN9 A;  3NS6 A;  4ED0 A;  4OZN A;  2V8P A;  3PFO A;  1LWE B;  4Z7C A;  3RB4 A;  4IFY A;  2K3I A;  2MZR A;  1VCT A;  2J6T A;  5D0G A;  4KR0 B;  3G86 A;  1N34 J;  3GIK A;  5CQG A;  1XR6 A;  1S0V A;  4J91 A;  4ILM A;  4F8R A;  4YS2 A;  4IR1 A;  5A6P A;  3GII A;  2LEC A;  4B08 A;  2ACM A;  2FLN A;  4LBH A;  1XNQ J;  1JKH A;  1X9M A;  2YVS A;  3PX6 A;  4PQU B;  3D6F B;  2ZNY A;  1S9F A;  2HUR A;  2HRU A;  3QNW B;  5LM7 E;  2VBX A;  3ULH A;  2POK A;  1X7V A;  4MIA A;  1SPB P;  1T9W A;  2LEA A;  1W7W A;  3GCW P;  1XER A;  2J0W A;  3TRG A;  2WOM A;  3GFX A;  5HL7 Q;  2HPU A;  2EKN A;  2FHK A;  1D9D A;  4L73 A;  5GAE U;  4C9D A;  3L9Z A;  4ZPV R;  2MYF A;  3DRP A;  2IMW P;  1C0T B;  3M1V A;  5A0Y B;  5DG7 A;  2JWN A;  1Q78 A;  3DLE B;  4WFN Q;  3KNG A;  3K5P A;  4N47 A;  1R8B A;  2R2S A;  2VPZ B;  3U27 A;  3RRG A;  2B9X A;  1WD6 A;  1BQN B;  4Y2C A;  1D9A A;  2V8D A;  2ZH5 A;  4KAI A;  2MZJ A;  2KG1 A;  2RDI A;  1MWZ A;  1M0S A;  5F9N A;  2BJ9 A;  4Y3C A;  2XY5 A;  2CQI A;  1VK8 A;  2W8L A;  1LWE A;  1MN9 A;  1WKL A;  3TAR A;  2BV3 A;  2LEP A;  1FFS B;  2VOD A;  2YX1 A;  1KQK A;  3OXF A;  3OJS A;  4P75 A;  2UUB F;  3C6T A;  1MSW D;  4G1P A;  4WJB A;  4UTG A;  2JFK A;  1UEU A;  8AT1 B;  2CXE A;  4L76 A;  4AL7 A;  5AE2 A;  2YKN B;  3QPI A;  4CO5 A;  1N52 B;  2BEF A;  5KTQ A;  2EK6 A;  1YRT A;  2VG5 B;  3L7O A;  3SSS A;  3SQO P;  3A8E A;  2ZH8 A;  2QV6 A;  4NLQ A;  3O2I A;  1NLK L;  3GJQ B;  5J2Q A;  4JI0 J;  2MKJ A;  2LXU A;  2ZEJ A;  4PQU A;  4CO0 A;  3IWL A;  1T05 B;  4JV0 A;  3LA0 A;  5HQM A;  1SKW A;  3CCJ S;  3PNI A;  3FMB A;  5J1E B;  4LUB A;  4LF2 A;  2NXE A;  1P9Y A;  3ZC4 A;  3D5M A;  3P4U B;  3KLI B;  2DNH A;  2OI2 A;  2GIF A;  4O3S A;  3FFI B;  1DJ0 A;  3MM6 B;  5KFV A;  2E1M C;  1C1B B;  2CPE A;  1Q79 A;  3HHL C;  4CLT A;  1S59 A;  4JYA F;  5A0Y A;  1OO0 B;  4C8Y A;  2L3M A;  4RW9 B;  5KFO A;  1GMV A;  3DLE A;  3HLU A;  4F4Y A;  2R7V A;  4ED3 A;  1TUW A;  2X7I A;  2FGO A;  1BC6 A;  3QRQ A;  2OTJ S;  2X1B A;  1L3V A;  1U25 A;  2QA4 G;  3BGL A;  3FJ2 A;  3OW2 R;  5C5J A;  4C8K A;  3PFE A;  3QQC D;  5DM6 Q;  1RT7 B;  2HHP A;  2D69 A;  2I8E A;  3BSA A;  5A8W B;  1X4G A;  3MCS A;  2YKN A;  4WYL A;  4O3Q A;  2VG5 A;  2BQU A;  4FP9 A;  2OJ3 A;  1CC7 A;  2PC6 A;  2KFY A;  2QLX A;  1LW2 B;  1N33 F;  4UZC A;  3DYA B;  4DF4 A;  5C2C A;  3FSX A;  4USI A;  4DV0 F;  4OJH A;  5D0E A;  4PQA A;  3BH7 B;  1JMT A;  2QT7 A;  1T05 A;  3OL6 A;  2VF3 A;  5J1E A;  4OHX A;  1PAU B;  1JLB B;  3ZFV A;  4B3M F;  3KLI A;  1IQT A;  4LRA A;  3FFI A;  1S6O A;  1AZS B;  3EXC X;  2GQQ A;  2J8S A;  3MM6 A;  2MQ8 A;  4OIX A;  3I96 A;  1C1B A;  4WF9 Q;  4JI6 F;  4EBC A;  2UXD F;  4BC7 A;  2P6S A;  1TTH B;  2ASJ A;  1VQY A;  2J7U A;  1FJG F;  4NRT A;  2AW0 A;  2DIU A;  1TL5 A;  4OJG A;  2IJR A;  2V94 A;  2W9B B;  1GMU A;  2Y0S D;  3M8P A;  2D3O R;  4DLG A;  4RUC A;  2UVR A;  4Q43 A;  3DRR B;  4ZLJ A;  5M2R A;  2BR0 A;  3HFV A;  1TZ0 A;  4X64 F;  2XMJ A;  5KFE A;  3QT5 A;  1NSQ A;  3R5A A;  4PZV A;  3H25 A;  1K8A T;  3SCL E;  1U2F A;  3RG6 A;  1URR A;  3IRX B;  1VK3 A;  2JLF A;  2OSR A;  2UZA A;  4RW7 B;  1RT7 A;  1SJQ A;  2DGW A;  2WB1 D;  1RAJ A;  2YX4 A;  5A8W A;  1X4H A;  4XPC A;  1RAD B;  4ZN3 A;  4H4K A;  1NHK L;  2YH0 A;  1NH8 A;  3GYG A;  4LF5 J;  3O3L A;  1UPP A;  1LW2 A;  5KFD A;  3DYA A;  1N5S A;  2GQ2 A;  3T6B A;  1SQG A;  2DHH A;  2W01 A;  1LNQ A;  2RKI B;  8ATC B;  3JS9 A;  2UUC J;  3LPE A;  5B0F A;  2DNR A;  1JLB A;  4WU2 A;  5M2P A;  2D9P A;  3MM8 B;  5F9L A;  1H7X A;  1KSP A;  4TLQ A;  1YZ6 A;  3DLG B;  3HK2 A;  2HGM A;  4PRF A;  3R6G B;  1AZS A;  4LR8 A;  4DV5 J;  2V5H G;  1ITP A;  1E6Y A;  3CC4 S;  3VCD A;  4DR7 F;  1S6U A;  1XNR J;  1JQG A;  4KPC A;  3MZI A;  2M3D A;  1PYT A;  1RTH B;  1PBA A;  3M9N B;  1TEL A;  5DZ6 A;  3Q0A A;  4KFB B;  3IM9 A;  1Y9O A;  2ZNZ A;  2QLB B;  3DRR A;  1ZOT A;  3D7S B;  1PCA A;  2OD6 A;  4NLY A;  4DR4 F;  1R0A B;  2HW3 A;  2H54 B;  1LXJ A;  1WG1 A;  5HJY A;  4C8O A;  4MYT A;  3IRX A;  5KT5 A;  2EFG A;  1UW4 A;  4PG5 A;  4DSI A;  2Z2Y B;  2QN6 B;  4CLY A;  2KT2 A;  2FHO B;  1SJ4 P;  3EYZ A;  3TJ9 A;  3IA0 A;  4LRE A;  2DR8 A;  2LMI A;  3UCU P;  2D3O 1;  5LJ5 Y;  2AD9 A;  5DDR C;  4DR6 J;  1FCA A;  2V2Q A;  4ZOS A;  1CS4 B;  2AGP A;  3S7R A;  1B3T A;  3F44 A;  3ZO7 A;  4KHR A;  3MMB B;  1RAA B;  4QYZ K;  5DGB A;  4WU3 A;  4C8N A;  2RKI A;  3HDS A;  5ETN A;  3G96 A;  3MM8 A;  3PIP Q;  3NY0 A;  1GAO A;  1RAE B;  3DLG A;  5H9F J;  3H90 A;  2RDD A;  2QRR A;  2FLO A;  1MLA A;  2CQB A;  3NS5 A;  2PI5 A;  1RTZ A;  2F8M A;  5EWG A;  2DNM A;  4DQQ A;  4CO3 A;  4QWB A;  3D54 A;  2Z4P A;  3RTV A;  4DUY F;  5C24 B;  5IQ6 A;  3H2L A;  2E5L J;  1TU0 B;  1UVL A;  1V5I B;  1GH8 A;  3HHN B;  1OS5 A;  1RTH A;  3N6N A;  1KWM A;  2HIQ A;  4A8F A;  4X62 F;  3PM9 A;  4KFB A;  4B3T F;  4UY8 5;  3MFI A;  4F2R A;  3C6U B;  2HK3 A;  3VAF A;  3M8S A;  4DR3 F;  1APS A;  4LF7 F;  2B51 A;  5HQ8 A;  1OYE A;  1DTQ B;  1S7H A;  2HFO A;  3GWC A;  2DB1 A;  2YPY A;  3R1H A;  4TU8 A;  1X0P A;  1ELO A;  1O0P A;  4A8X A;  4TQS A;  1KN6 A;  4I2P B;  4I1T A;  4BCA A;  2LQB A;  3NP5 A;  4JI2 F;  2GNK A;  3FUY A;  2H51 B;  1NJI T;  2RU3 A;  4ZMM A;  4B17 A;  5JJB A;  1QAY A;  2C2N A;  3ICL A;  3CME S;  3HZE A;  1Q1K A;  1IBL F;  4ENO A;  2YPZ A;  3MMB A;  1FXR A;  1MWY A;  1V6H A;  4IFV B;  2M8H A;  3WC2 A;  4UZB A;  1JNZ B;  1KON A;  2BE7 D;  5J2M B;  2G4B A;  3OTO F;  2JDJ A;  4ID5 B;  2IVF B;  1FKO B;  3BO4 A;  3BKU A;  3N6M A;  4DFM A;  3JAM Y;  2MEW A;  3CCL S;  3CCQ S;  3W62 A;  1N32 J;  3D3B J;  2RQM A;  3HFK A;  2PSZ A;  2AF6 A;  5HVG A;  2BM1 A;  3I9Z A;  3KLV A;  3T5K A;  2YWE A;  1S49 A;  2E44 A;  3AT1 B;  1XJW B;  1K73 T;  3QO9 B;  3SYZ A;  3EDQ B;  4KYZ A;  2UV8 G;  1FJ7 A;  3C6U A;  3A3O B;  1N36 F;  2HYI B;  3H2V E;  2MKY A;  1QAJ A;  2FVR A;  3NGS A;  1X8D A;  1LQ9 A;  4O44 B;  1N5Y B;  1DTQ A;  2GVZ B;  5KFY A;  4RW8 A;  1FEH A;  5KFH A;  3A3N B;  2BXJ A;  1WEZ A;  2ZHO A;  3VAK A;  5L1J A;  3SCK E;  5C25 B;  3PRD A;  1U1M A;  2A18 A;  2XNR A;  4I2P A;  2K1R B;  1KHV A;  5CZX A;  1IR1 A;  4XDC A;  2HS4 A;  4FF3 A;  2B6A B;  4ETX A;  2M5Y A;  4X4N A;  4QCL A;  5DQI A;  2C2M B;  2DO0 A;  4KGZ B;  4NCA A;  5D4L A;  4U67 Q;  3OUY B;  2AV5 A;  2YKA A;  2EWH A;  4JI7 J;  2NZ4 A;  4U7U D;  4LF8 F;  2W7O A;  1JNR B;  3QT6 A;  4PKD B;  2E9R X;  1VI7 A;  4IFV A;  4H4K C;  1WAC A;  1KC8 T;  3KHL A;  2NR0 A;  3K8W A;  2KXH A;  1ZZF A;  3CPW R;  1FKO A;  2PGC A;  3JXO A;  3RAQ A;  3Q89 A;  3LOU A;  2QA2 A;  1NUE A;  2Z57 B;  3HHK A;  3JAM U;  4DG1 A;  3J81 j;  3QT8 A;  4R8U B;  5FLX U;  3AOB A;  1S72 S;  1VQN S;  4OI0 A;  1H73 A;  4IRC A;  2V68 A;  1EKR A;  1UJ4 A;  5LSL A;  4JI5 J;  1XMO J;  2J9D E;  1WSV A;  4O4G B;  1U26 A;  2H4W B;  3U1N A;  3QO9 A;  2VL1 A;  2WAQ D;  5A6W A;  2V9K A;  2KKH A;  2N3O A;  4M94 A;  4CM2 A;  1TKZ B;  1SC3 B;  2BUN A;  1PYO B;  4O44 A;  1N5Y A;  4WP3 A;  4OHZ A;  2ZHA A;  2VQE J;  2GVZ A;  4FDF A;  4GVL A;  1LW0 B;  1VC6 A;  3ZNU A;  2MKK A;  1BQX A;  2WON B;  3VGV A;  1IKV B;  5DDQ C;  4ED5 A;  3B8H A;  1HBM A;  2UVW A;  3BBF A;  2XZW A;  5C25 A;  2HHQ A;  2B8P A;  4ZIV A;  4M5G A;  3FEX B;  4MYU A;  3JSR A;  1N0V C;  4HKQ A;  2K1R A;  3SSR A;  2UU9 F;  2MST A;  2ZBQ A;  5MLC V;  2B6A A;  1FK9 B;  2HRT A;  4JI8 F;  4JI4 F;  1R3N A;  5F8H A;  2E7V A;  1M1G A;  3F0N A;  3KG1 A;  1FES A;  1VYA A;  4UY8 T;  4ECT A;  2F8E X;  2DGV A;  2DNK A;  1YJ7 A;  2PEH A;  3DDI A;  3NKY A;  4NML A;  1Y11 A;  1X4B A;  1ZAV A;  2OUG A;  2C3M A;  1LV5 A;  4AT1 B;  3EDR B;  4ZPD A;  4DL4 A;  1SV5 A;  2P9G A;  2WZ1 A;  1Z2L A;  3JQK A;  1SKS A;  1VR6 A;  3QIP B;  2NPF A;  1U0S A;  2VJV A;  2AJ2 A;  2JLG A;  5AXL A;  2GJF A;  3MI7 X;  3GP9 A;  4LVN P;  5GVQ A;  4DV1 F;  4R8U A;  4M5D B;  3N5F A;  2R7R A;  3AD9 C;  4F4A A;  1A6L A;  2CPZ A;  1XMB A;  1MMN A;  4OV1 A;  3HVT B;  2QLF B;  4K4S A;  4O4G A;  1HD0 A;  2CQG A;  1S0N A;  2Z2M A;  2DTJ A;  3D6T B;  5B0A A;  4DJB A;  4NYZ A;  4ES1 A;  2DGT A;  1L3U A;  1CQN A;  1TKZ A;  2JVR A;  1I1G A;  3P3D A;  4FNH A;  3THP A;  2OTL S;  1SJR A;  3KJN B;  3U02 A;  1LW0 A;  1QAI A;  2WON A;  4J9P A;  2CNK B;  3VV2 B;  4ZN1 A;  3RRK A;  1VLO A;  5KFS A;  1GX6 A;  4NLS A;  4LF4 J;  2I1R A;  5HK4 A;  4E0D A;  4PG7 A;  2GAH C;  5BR8 J;  1FK9 A;  3THT A;  3AOD A;  2QA4 S;  5LT5 A;  4C6A A;  3D66 A;  2VG7 B;  1VRQ C;  3UPF A;  2VHG A;  1KOH A;  1RZM A;  2CWK A;  4RUA A;  4FS2 A;  4C48 A;  4PAB A;  2RQC A;  4RX6 A;  2RHS B;  4K4V A;  4DQI A;  2MLZ A;  2OO4 A;  1T9X A;  2OD4 A;  4ZPT R;  1FRL A;  1F0X A;  1PG5 B;  3V6K A;  4CLF A;  3BSN A;  3QSI A;  1CJV B;  2YX7 A;  1PSD A;  1KD1 T;  3TUI C;  3L7U A;  2XSJ B;  3KK1 B;  1N5V A;  3IRW P;  4J9M A;  4IYQ A;  1U8W A;  4M5D A;  3BRE A;  2GV1 A;  2OHD A;  5KFZ A;  2OP5 A;  4PEO A;  4DUZ J;  2DHG A;  3GIM A;  4DFK A;  1KLN A;  3BS9 A;  4WII A;  3HVT A;  5J1P A;  4G65 A;  1HBN B;  3M9O B;  5LXY A;  4DPO A;  1V3Z A;  4HI2 A;  3ZTS A;  2BDP A;  3G8T A;  5I3U B;  1RIS A;  5E41 A;  1CBK A;  3AY0 A;  1UFL A;  3B6B A;  5E3C A;  4QIW D;  3M6V A;  2HNY B;  4PPD A;  3C46 A;  3TJ8 A;  1HR0 F;  3MM9 B;  1DY3 A;  1GXT A;  1NJZ A;  1SQE A;  3FVY A;  1CJU A;  1H72 C;  5EWE A;  2UUA J;  1JB0 C;  3KLE B;  3BQ2 A;  3MAH A;  2RNE A;  2NXN A;  3CDA A;  4E2F B;  4USH A;  2VG7 A;  4F50 A;  4PWU A;  1A9N B;  4RUB A;  3AA8 A;  5ETO A;  1ZTT A;  5KFU A;  4ES2 A;  1RT2 B;  3PW0 A;  4LQ3 A;  4NLT A;  4C8L A;  4PYA A;  1VQM S;  4ELV A;  3DDN A;  1PGZ A;  2HLU A;  1CJV A;  4CCH A;  5BJR A;  1XMQ F;  4X4U A;  2KFZ A;  3KK1 A;  2C3O A;  2JC0 A;  1ZH5 A;  4DFJ A;  4K50 A;  2XMM A;  3EWG A;  3F56 A;  5CXT A;  3BR9 A;  2R7Q A;  3RBE A;  3KJV B;  1YZ7 A;  2EFP A;  2E1P A;  2MJN A;  4PXB A;  2AT1 B;  4JI1 F;  4P73 A;  1Q16 B;  2K8G A;  5ETQ A;  1RDR A;  3PIO Q;  4LSL B;  3DCA A;  3DRY A;  2XG8 A;  2L08 A;  3OSN A;  2GQC A;  2DNG A;  4DV6 J;  1MN7 A;  1Q95 G;  5I3U A;  5LSO A;  3SFG A;  1SIZ A;  1WG4 A;  1D0E A;  5F41 A;  3G82 B;  5L9X A;  3W66 A;  1NHV A;  1FO1 A;  3H5X A;  2HNY A;  2B4U A;  3D6H B;  4KGM A;  1RTI B;  3MM9 A;  2BJ1 A;  1OY8 A;  4P74 A;  3R8Y A;  3PKY A;  5AXN A;  2HND B;  2EG2 A;  4V19 J;  4NZ6 A;  3OSP A;  2JLE A;  3CDW A;  2UXB F;  1B7F A;  4CLL A;  2YY3 A;  3PRB A;  3FBC A;  3CIM A;  4NPO A;  4RWX A;  2BA9 A;  1D09 B;  1FRX A;  2LU2 A;  4K5S A;  3HVA A;  1Q81 T;  3GSI A;  1L3K A;  1LFP A;  5FJ4 A;  1IR0 A;  2ZKT A;  2UUB J;  1EET B;  2CFX A;  3T5J A;  3GG0 A;  1ACM B;  3S6E A;  1G4C A;  3NL0 A;  1J5O A;  2MXY A;  3ADA C;  1Q8L A;  2JL9 A;  1S79 A;  1XK8 A;  1HL6 A;  4FZV A;  2XMV A;  1JXV A;  4M5N A;  3N6L A;  1YKW A;  3VTI A;  3KUG A;  3S1T A;  3QZ7 A;  4ECU A;  3BPS P;  3KJV A;  4YB1 P;  2CPX A;  4QQB A;  3V4M A;  2KRB A;  2PII A;  3CJQ A;  3PYG A;  3D0G E;  2KZM A;  2BJ8 A;  3OBI A;  4ZPB A;  4F3Q A;  1B99 A;  2AJF E;  2L9N A;  4WK3 A;  5K20 B;  3ZZY A;  4PAA A;  2YWG A;  3LP1 B;  4OYO A;  1UVN A;  3G82 A;  5ETR A;  4NYO A;  5KT4 A;  4YQW A;  3MUR P;  2WRM A;  1UVK A;  4RU2 A;  4ECZ A;  4JYA J;  1R0B G;  2B9W A;  1RTI A;  1GQE A;  3Q2S C;  2XNQ A;  3A13 A;  2HSE B;  4ERD A;  4WBF A;  3Q8U A;  1I3O B;  1S1V B;  4F67 A;  1RAF B;  5EX0 A;  2IM3 A;  1B4S A;  2RF2 A;  2HAI A;  3NG8 A;  4C97 A;  1UVM A;  4UOC A;  1K0T A;  2OMO A;  1HYS B;  2KHD A;  3OTC A;  4IRD A;  1S1T B;  2DNQ A;  5J2P B;  3H5Y A;  4OX6 A;  1EET A;  3BN7 A;  2FTR A;  3BQ1 A;  4FYX B;  1WOP A;  4DL6 A;  2CPD A;  1W26 A;  2I9S A;  2CPH A;  3FCH A;  4X4S A;  2BYC A;  3GV8 B;  4C4W A;  2DPI A;  1XWL A;  4AQY F;  2GML A;  4OI3 A;  3T5H A;  2CQ4 A;  3HVR A;  1O51 A;  4F36 A;  5K8O A;  1N33 J;  1UJ5 A;  4OI1 A;  4DV0 J;  3C16 B;  2GVD B;  3VGT A;  1NDK A;  1YK9 A;  2RT3 A;  2Z58 B;  4ZCK A;  4P2M A;  5K14 B;  2F40 A;  1RCO B;  2BKP A;  4FBU A;  2V63 A;  3UN5 A;  1MML A;  4FF1 A;  2IAJ B;  4B3M J;  2P5V A;  1YIT S;  3UD3 P;  2DXE A;  2KL8 A;  3PO4 A;  3GFZ A;  3LP1 A;  7FDR A;  2MKI A;  3GIJ A;  2YNI B;  1JLF B;  2B4P A;  3CSK A;  4JI6 J;  3W2V B;  4NLR A;  2UXD J;  1LWX A;  1OWX A;  5F8G A;  2COL A;  1FJG J;  2M52 A;  2DT9 A;  4I69 A;  1SKR A;  1F3F A;  1NU4 A;  1GTH A;  4O23 A;  4ED8 A;  1KP6 A;  2ZE2 B;  2JRS A;  4P71 A;  3EZ5 A;  3R9L A;  1NBE B;  4PG4 A;  2GS8 A;  3UDV A;  4QU7 A;  1VBK A;  2FIU A;  3DMJ A;  3L95 X;  3CD7 A;  1JK9 B;  1X4C A;  2RML A;  3LH2 S;  1UVI A;  4X64 J;  2W4C A;  1R0C B;  1HYS A;  1IKW B;  4MK7 A;  5J2P A;  3TZY A;  3PJX A;  2SXL A;  3X1L B;  4Y6I A;  3MPV A;  3Q86 A;  4C8M A;  3TZX A;  3Q8R B;  2Q79 A;  3SDE B;  1JLA B;  1X0F A;  4I0W A;  1RB0 A;  1U1K A;  1R7I A;  3IGN A;  5L1I A;  3FBE A;  4MK8 A;  1HW8 A;  3W9H A;  4ZVS B;  4Y28 C;  3C16 A;  2J7K A;  2HBZ B;  3A8J A;  3TAM B;  4RNF A;  4TLR A;  4WFX A;  1KS2 A;  2Z56 B;  2G1H A;  4G1Q B;  1DLO A;  4EMD A;  2MMY A;  2N7Y A;  5HMZ A;  3H8Y A;  2IAJ A;  2V4Q A;  3TUP A;  1EQ0 A;  4FF2 A;  1VIX A;  3UQS A;  3KG0 A;  2DHS A;  3VQT A;  1QTN B;  1QD1 A;  4NA3 A;  1EAR A;  1TUV A;  2YNI A;  1JLF A;  1KBR A;  1VJQ A;  3W2V A;  4CLK A;  2BQ3 A;  4DR7 J;  3FBB A;  2CIM A;  3BSC A;  4W4M A;  2ZE2 A;  1OY6 A;  5IV3 A;  2BZ2 A;  1NKB A;  1GNK A;  2P9E A;  3E51 A;  5GAG I;  4V19 X;  2CVI A;  1FD2 A;  2ZZT A;  3T6J A;  1TQL A;  2ATC B;  4X84 A;  3K89 A;  3CDU A;  2PDA A;  4DR4 J;  4EO6 A;  3VF0 B;  2ACY A;  2QMW A;  1U6B A;  3EZO A;  1IKW A;  2RU9 A;  2N3L A;  4OI4 A;  4J90 A;  2BW2 A;  2DR9 A;  2Q66 A;  4NLO A;  1NSK L;  3FRY A;  2P8I A;  1RWW B;  4DPY A;  2U2F A;  3LGM A;  3CD6 S;  4K4T A;  1RAO A;  4K5R A;  6AT1 B;  1WI8 A;  3SDE A;  1JLA A;  2LQ9 A;  4QR2 A;  3BGF A;  4YB5 A;  5I3P A;  3N5B A;  2LFV A;  2D3U A;  7FD1 A;  4HAC B;  2W9C B;  4RR5 A;  4U7C A;  3TAM A;  3N28 A;  2QE5 A;  2R8H A;  1QUP A;  2NRE A;  3H0P A;  2KYX A;  3L4B C;  4PXD A;  2QG9 B;  2Y1J A;  5C42 B;  3KLF B;  1UA1 A;  3PY8 A;  2Q43 A;  4B02 A;  3QSY B;  1EP4 B;  1NK9 A;  1KDN A;  1RWN B;  3IR5 B;  4N56 A;  3Q8S B;  1VRU B;  1UW9 A;  1HW9 A;  1UA0 A;  3K58 A;  4OYW A;  4K4Z A;  3J80 U;  5ETS A;  1FX2 A;  4CO2 A;  1N54 B;  2NSB A;  5E33 A;  3JQM A;  4DUY J;  1WHX A;  2DRB A;  3A8K A;  1XEZ A;  5JVG Q;  1LK7 A;  1RGV A;  4ILL A;  2XO6 A;  4FKY A;  4X62 J;  3GYN A;  2L9D A;  1WC1 A;  2BKO A;  4B3T J;  2CAD A;  1M1H A;  2C3P A;  3VR1 A;  4ECR A;  2NXJ A;  4DN0 A;  5G0R B;  4DR3 J;  4LF7 J;  3W1Y C;  4LJM A;  9ATC B;  2KHC A;  1NDP A;  1FEE A;  2AYM A;  1KVI A;  2A6M A;  1R8H A;  4DI6 A;  2AWZ A;  1RU1 A;  2LU1 A;  2MQO A;  2C3Y A;  4JI2 J;  1P6T A;  1LWF A;  2BBE A;  2DVI A;  2D7S A;  1UFK A;  5GMK a;  3TX8 A;  3MUT P;  3PYF A;  2M9K A;  2QFI A;  5F0W A;  2HQF A;  4GVB B;  3T1A A;  1KKH A;  1R43 A;  1JLC B;  3HKZ D;  1AUD A;  3M30 B;  3KXD A;  3MTJ A;  5E7O B;  1IBL J;  5L1K A;  4HAC A;  4KKO B;  2W9C A;  2FQQ B;  5KOW A;  1K1Q A;  4ID8 A;  3KLH B;  2X3G A;  1M90 T;  5JUM A;  3CF5 Q;  3DLH A;  5SUH A;  3OTO J;  2ZM6 F;  1RUS A;  2PA8 D;  4QR0 A;  1VRU A;  3D1O A;  4F02 A;  1MNE A;  1Y3K A;  1ZM9 A;  2MZQ A;  1KQS R;  2FLP A;  2EPI A;  4J5O A;  4Q2M A;  3IR6 B;  1H2U X;  3BQ0 A;  1TVR B;  2O66 A;  3VAL A;  1ZYQ A;  3ONQ A;  2R7X A;  1S77 D;  1QDU B;  2YNF A;  5KFB A;  4KY3 A;  5KT7 A;  3HCX A;  2AGO A;  1QM9 A;  5D77 A;  3AJD A;  5IV4 A;  1N36 J;  5G0R A;  2C2Z B;  2V69 A;  4MAK A;  2KT5 A;  5IZH A;  1X9W A;  3OL8 A;  3KDO A;  1YBA A;  4K8R A;  3UN3 A;  4ZJQ A;  3ZZR A;  3B78 A;  2HBQ B;  3GPA A;  3MEC B;  3BDP A;  3PHE A;  2QEX S;  4OX9 F;  2AEM A;  2FLL A;  2VOP A;  5ADZ A;  1JIH A;  4TU7 A;  4TU9 A;  2XCA A;  2HKE A;  1VC0 A;  5DO2 A;  1RI7 A;  3CW2 C;  1JLC A;  3M30 A;  3FSI A;  3TZZ A;  2A3J A;  2R42 A;  4L3N A;  2N4C A;  3CJR A;  4KKO A;  2PI4 A;  3W2W B;  4N7T A;  4LF8 J;  2Y8Y A;  4OHW A;  3T5L A;  1S48 A;  1DQ8 A;  3N0V A;  3KLH A;  3PTW A;  1CUL B;  3DHW C;  2N82 B;  2IM1 A;  4F3O A;  3W5Y A;  4HT5 A;  4RUH A;  2IJN A;  4QIG A;  3BGO P;  1RWO B;  2XLJ A;  3VHQ A;  2WSC C;  1S1X B;  1TVR A;  4CTA B;  4NWB A;  4QYZ J;  3WX4 A;  4P6Q A;  4DQP A;  2MZS A;  1GXU A;  5IT9 Y;  2ZBP A;  8RUC A;  4X65 F;  4P2F A;  4ZPA A;  1OYD A;  3EM1 A;  1N88 A;  1WUU A;  2W24 A;  1XTZ A;  4DPU A;  3QAT A;  3GR1 A;  1TUG B;  2FB0 A;  2IRU A;  1RHK B;  3EUN A;  2DPJ A;  4BBY A;  2IM0 A;  2CNN B;  1I51 B;  1WC3 A;  2XMA A;  2X1A A;  1YJW S;  1FRH A;  3H4D A;  3MEC A;  4ANE A;  2KI2 A;  5HMX A;  4OJ1 A;  3NWG A;  3D3C J;  1SCJ B;  2UU9 J;  1EX8 A;  3G2X A;  4I68 A;  5GAD I;  2B9Y A;  2V2K A;  4JI4 J;  4JI8 J;  1IBM F;  2ZJR Q;  3IO1 A;  2VC1 A;  4JV1 A;  1S76 D;  1UL3 A;  5AE3 A;  3W2W A;  2HNZ B;  3RAM A;  4N41 A;  4WE1 B;  1C1C B;  3SCI E;  3I56 S;  1ZM2 A;  4RZR A;  1CUL A;  1WOS A;  3JQJ A;  1V5V A;  3CGI A;  4DCJ B;  5DG9 A;  4WP9 A;  1HI0 P;  3S8S A;  4CH7 A;  5F8M A;  4LRC A;  2AHO B;  2ADB A;  4AL5 A;  4K2X A;  2IVY A;  1S1X A;  1QTM A;  4CTA A;  4DV1 J;  5ETL A;  1BXN A;  4IO1 A;  2DEJ A;  5K8N A;  2XMT A;  4HTI A;  3PZP A;  1DAX A;  3OHB A;  3KJF B;  1A0O B;  3POT B;  3DLJ A;  3DNC A;  2ZH6 A;  2XTJ P;  3RU0 A;  5AT1 B;  4DX5 A;  1JLG B;  3FSY A;  3CJK B;  4J9K A;  2W7P A;  3HHD A;  3IBC B;  2NSC A;  4MKB A;  5FII A;  4IQM A;  1HQ2 A;  2NYH A;  1X5O A;  4FN5 A;  2F9J A;  3TQ1 A;  1SI9 A;  2E29 A;  2GO8 A;  5KG4 A;  3ILL A;  1FJC A;  3NCR A;  1ARO P;  4O3P A;  2VFS A;  2NXC A;  2ASD A;  4GC7 A;  4CT9 A;  2C2E A;  2F3J A;  2OEM A;  5HAT A;  1IR2 A;  1PJ5 A;  4DS5 A;  4J9V A;  2HIY A;  2BAC A;  2EC2 A;  4IKA A;  3GYX B;  2AKW B;  4UOH A;  2CG8 A;  3C15 B;  1T8E A;  3JYT A;  1H0H B;  1LXN A;  2WBM A;  3DHX A;  2LA4 A;  3UDL A;  2JHE A;  4I56 A;  1QSL A;  1BLU A;  2WSF C;  2XS2 A;  2GIR A;  2FVS A;  3ISZ A;  1WOO A;  2HNZ A;  1TFY A;  4M5M A;  1GXL A;  4WE1 A;  1V3R A;  3TWZ A;  1C1C A;  3BGR B;  1VJW A;  1K47 A;  1DTT B;  2LQJ A;  2XGP A;  1TL4 A;  2JNJ A;  1VQO S;  4WK1 A;  3OFE A;  4PG6 A;  2HS3 A;  4F25 A;  2ZZN A;  3I5C A;  1NB2 A;  3IWN C;  2VBZ A;  3HSZ A;  1HAR A;  4V1A k;  1GTE A;  1RKJ A;  4TYB A;  2MLX A;  2FJD B;  2M70 A;  2CYY A;  2E5H A;  2UXC F;  3JSB A;  2B7C B;  3VVU A;  4OZ1 A;  4NX9 A;  2N7C A;  3UCZ P;  1S10 A;  3POT A;  2Y3Y A;  1ZBT A;  3W64 A;  2O3D A;  4EYH B;  4QWD A;  1JLG A;  4R25 A;  3CJK A;  5CAB A;  1FJE B;  2AU0 A;  1ZZN A;  3I55 S;  5D4O A;  4KGX B;  3I4H X;  2RIL A;  4XO0 A;  4LRD A;  2QO3 A;  2J9D A;  2R8G A;  4NZ7 A;  2DRA A;  3MDF A;  4MFB B;  3US5 A;  3K7R A;  2XHC A;  2L48 A;  1HFE L;  2JOQ A;  1EKS A;  1HNI B;  1RJJ A;  2V50 A;  1E6V B;  1AUS L;  4ZVU B;  2DNL A;  2RJZ A;  4KBI A;  1HR0 J;  1TK8 A;  2NCK L;  1R6V A;  3OL9 A;  3K2Y A;  4QIE A;  4ZVQ B;  1S0M A;  3TVY A;  3OLB A;  3ZZO A;  2G0J A;  1R8A A;  2AJ0 A;  5SZT A;  2NLW A;  4PWD B;  3DOM B;  4OHV A;  3A4T A;  2QMU B;  3J7Y U;  2PN6 A;  3LAN A;  3KHH A;  2HRY A;  4IQX A;  2VON A;  4CRJ A;  1FXD A;  1H2T Z;  2IBO A;  1YDL A;  1QY7 A;  3W5X A;  1RTJ A;  1MG7 A;  3NAH A;  2HFN A;  2BJ7 A;  2AQ4 A;  3IMQ J;  2OFG X;  3K59 A;  4DR1 F;  1N48 A;  1XMQ J;  2CPY A;  5T14 A;  1FDN A;  2F1F A;  3MM7 B;  2IMO A;  3TZW A;  4ECY A;  1EJ7 L;  2RRN A;  3IG1 A;  1LKZ A;  2E66 A;  1PIL A;  1X4F A;  3NS7 B;  4M5H A;  1F1B B;  1Z1Z A;  2F9D A;  2FC9 A;  4ELT A;  5KG3 A;  3C6T B;  3Q22 A;  5IQQ A;  5J2N B;  4JI1 J;  4RBU A;  4TY8 B;  2XGQ A;  2VOO A;  4EUV A;  4NYP A;  5LJ3 Y;  3BBC A;  4DX7 A;  2K3K A;  5B0B A;  4QW9 A;  1TMM A;  2QGF B;  3C2P A;  2E9Z A;  2DXD A;  2HVD A;  4EEY A;  1U1O A;  3QGG A;  4KTQ A;  5GMD A;  3FC9 A;  1F9E B;  1XIQ A;  4LIW A;  5J2Q B;  3QWU A;  1K44 A;  1I5O B;  2XWY A;  3KG4 A;  1IKY B;  4MFB A;  3Q83 A;  3BEG B;  1X5S A;  3PXG a;  1HLW A;  1HNI A;  1RHU B;  3Q8Y A;  1E6V A;  3B54 A;  4USK A;  4X4V A;  2I0X A;  4ZLL A;  2MQQ A;  3GJS B;  3U1L A;  2OAU A;  3GSD A;  1RBO B;  4ECQ A;  5KFW A;  2UXB J;  2VIC A;  3MR7 A;  4PWD A;  3DOM A;  4RNO A;  2AIR B;  1HI8 A;  1RT4 B;  3CCE S;  4DUT A;  1WTB A;  5DGA A;  4BHQ A;  2FZK B;  2VDH A;  3NLC A;  4ZVG A;  3CUL A;  3NAI A;  3S01 A;  3JTP A;  3G6V A;  4U8Y A;  2QSW A;  2U1A A;  3ISN D;  3PCO B;  4MKY A;  5K8M A;  3MM7 A;  3PVX A;  1G1X A;  3HT3 A;  4WYW A;  5KT2 A;  1BD6 A;  1Y10 A;  5RUB A;  4C3L A;  3BJY A;  4NOH A;  2HEK A;  4F0K A;  4WWS A;  1FDA A;  2DO4 A;  3CJ2 A;  5L38 A;  5JVH Q;  2DHX A;  3L3C A;  2BM0 A;  4X4O A;  2ROG A;  2EBG A;  2NPI A;  3MWB A;  4M63 A;  5J2N A;  4TY8 A;  3GMG A;  1SC1 B;  2FZG B;  5IT0 A;  5KFK A;  1DAR A;  1UZD A;  4UOF A;  4TY9 A;  2J0S D;  3VAH A;  2KO1 A;  4I4B A;  2LDI A;  5D78 A;  3PX4 A;  1L3S A;  3ZTQ A;  4Q0B B;  2VUG A;  3SFU A;  3M2V B;  1U2C A;  2XI2 A;  1SBR A;  2YWW A;  5F3T A;  4HI1 A;  5CYM A;  1IKY A;  5AXK A;  1SIW B;  1TV6 A;  2HGN A;  2AJ4 A;  3NGT A;  1NND A;  3MD1 A;  2YKP A;  4ED2 A;  4YME A;  1VHI A;  2ZH2 A;  2QYG A;  4KHP F;  1P9Q C;  5HMY A;  4HH1 A;  4QZV B;  3R7N B;  2VBY A;  5A8K B;  1OSC A;  4F4W A;  1U02 A;  4DL5 A;  4CYU A;  2E5I A;  3CJ4 A;  1RT4 A;  3G87 A;  2DNP A;  4CO1 A;  3QFW A;  3D28 A;  3LUY A;  4NLG A;  2V67 A;  3HUL A;  3I31 A;  3QMQ A;  1FFG B;  1AXQ A;  5ETT A;  1AA1 B;  3IBF B;  2BE2 B;  4WZQ A;  3M8Z A;  2CDQ A;  4QPT A;  3M8P B;  2DHA A;  3MAA A;  2UP1 A;  4XPE A;  1FDD A;  4AQY J;  1ZAW A;  5G4D A;  4EZ9 A;  2Y1I A;  2OH2 A;  2R8K A;  5E3Q A;  2RRB A;  5D6G A;  5H9E K;  1VQ5 S;  1N5Q A;  2LKZ A;  4NLU A;  3EGZ A;  2HG4 A;  2VFR A;  2V2V A;  1IQZ A;  1YJ9 S;  1KFS A;  1C2P A;  2J76 E;  3QT7 A;  5EGY A;  3ENQ A;  1UET A;  4F4K A;  2XMU A;  2J6U A;  3MCN A;  1TAU A;  1RXO B;  2ZUA A;  5CD4 H;  4Q0B A;  5KFR A;  1B0T A;  4RBT A;  3M2V A;  1NK5 A;  1RQ0 A;  5DDO C;  1S57 A;  1R31 A;  1P27 B;  3TA2 A;  3H7H B;  2E1A A;  2DCL A;  4U8V A;  1YWX A;  4J9U E;  3MR2 A;  2C22 A;  3RJM B;  2FDN A;  3J7Y I;  2KXF A;  4QJV A;  5J1N A;  3R5B A;  5LSR A;  2HVZ A;  1UJ6 A;  4DQR A;  2H5E A;  2R7W A;  5A8K A;  2J7W A;  4AL6 A;  1D9F A;  3F41 A;  3CJ0 A;  3K8V A;  1T7P A;  3H2U B;  2KDO A;  2NUH A;  1RLC L;  2G0I A;  1E6Y B;  4PPZ A;  3Q24 A;  4KQZ A;  3UN2 A;  4FVC A;  2JH3 A;  3QGH A;  4X2B A;  3AJ1 A;  4ZVF A;  1RWX B;  2DKO B;  3UWT A;  2KT3 A;  4N76 A;  2BE2 A;  4J7C A;  3PR5 B;  1RHJ B; 
#chains in the Genus database with same CATH homology
 3MAA B;  4CLS A;  4WP3 A;  1FX4 A;  2QV6 A;  2GVZ A;  3ET6 B;  1CJT A;  2W01 A;  4OYZ A;  4CLY A;  3C14 A;  3C16 A;  1CJK B;  4OYP A;  4USV A;  4NI2 B;  1CJU A;  4OYI A;  1WC6 A;  1AB8 A;  4CLF A;  1WC1 A;  2BW7 A;  1CJV B;  1WC3 A;  4OYA A;  4CLP A;  4P2X A;  4WP8 A;  1Y10 A;  1AZS A;  1CS4 B;  5D15 A;  4OYB A;  2GVD A;  3G82 B;  3R5G A;  4OYM A;  1TL7 B;  3ET6 A;  1CUL B;  4CLU A;  4CLW A;  1YBU A;  5D0G A;  1CJK A;  1CJU B;  5D0H A;  1U0H A;  4NI2 A;  1WC0 A;  3C15 A;  4CLK A;  4OZ3 A;  5D0E A;  5IV4 A;  3UVJ B;  4USW A;  1CJV A;  4USU A;  2GVZ B;  1CJT B;  3MAA A;  1Y11 A;  4UST A;  3C14 B;  4CLT A;  4CLL A;  3C16 B;  4OZ2 A;  2GVD B;  5D0R A;  4OYO A;  3G82 A;  1YK9 A;  1TL7 A;  4CLZ A;  5IV3 A;  2WZ1 A;  4P2M A;  1CUL A;  4WPA A;  3MR7 A;  4OYW A;  1YBT A;  4OYX A;  1FX2 A;  1U0H B;  4CM0 A;  3C15 B;  1AZS B;  1WC4 A;  4WP9 A;  1CS4 A;  4CM2 A;  1WC5 A;  4P2F A;  3UVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...