3UVJA

Crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
191
Chain Sequence
QVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Guanylate cyclase soluble subunit alpha-3
publication title Crystal structures of the catalytic domain of human soluble guanylate cyclase.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 191
sequence length 192
chains with identical sequence C
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3uvjA00
3G82A 5D15A 1CS4A 1YK9A 1CJVA 4CLUA 4USWA 3UVJB 4CLZA 1WC1A 4OYOA 4P2FA 4OZ2A 5D0RA 1CJUA 4P2MA 2W01A 4CLPA 1CJKA 1AZSA 4USTA 1CJTA 4CLLA 3C14A 5IV3A 4CLFA 4WP3A 2GVZA 3C15A 4CLKA 1TL7B 3C16A 4OYZA 2BW7A 4OYPA 1CULB 4OYIA 4NI2A 1AB8A 4CLYA 1U0HA 4CLWA 3MAAB 4OYWA 3G82B 1Y11A 1CS4B 1WC3A 1WC4A 1CJVB 5D0HA 3MR7A 3UVJA 3ET6A 4USVA 4USUA 3C16B 1CJUB 4CLSA 4CM0A 1CJKB 4P2XA 1AZSB 4WP9A 3R5GA 4NI2B 1CJTB 2GVDA 3C14B 1U0HB 5D0EA 1WC0A 1Y10A 1WC6A 5IV4A 1YBTA 2GVZB 3C15B 4CLTA 4OYBA 3ET6B 4OZ3A 4WP8A 4WPAA 5D0GA 1FX2A 1TL7A 4CM2A 1FX4A 2GVDB 1CULA 4OYXA 2WZ1A 4OYMA 1YBUA 2QV6A 4OYAA 1WC5A 3MAAA
chains in the Genus database with same CATH superfamily
2KKHA 4OV6A 3KUEA 1S10A 1Y3KA 3M9MB 3JS9A 4FPIA 3KMSA 3OTDA 1U1PA 3VTIA 1PGZA 2OEMA 3AAWB 1ZAVA 4C2MA 4XK8C 4L73A 1NLKL 1TL3B 3FK4A 3OTBA 4IO9Q 2LEAA 2ZBCA 3U1LA 2VU5A 3D0IE 4OJGA 4ED3A 1FVQA 4ZPDA 4AL5A 3P6YC 1GAOA 5F8NA 4RW4B 4B3MF 1NHVA 4NLPA 2F8HA 4YOEA 2MY7A 2K1RB 4EO8A 1RHQB 4ZVUB 4C11A 3ZZ0A 5KFBA 4OZ5A 1E6VA 3AD9C 4R0EA 2V34A 1SBRA 1R0AA 2XMVA 2HQ3A 1TL7A 1RKJA 1JLBA 2FVQA 3SIPB 3KWMA 3FNNA 2CNOB 1B0VA 5LXYA 4OYAA 1X4CA 2QIFA 1T9TA 4L3NA 4DUZJ 4UZBA 4EBCA 1FJEB 2PE8A 2R7WA 4EU0A 3MUVP 5IS2A 4IUFA 1SIWB 3BO2A 1NM2A 2CUYA 2ZH9A 4OZLA 3CE8A 3G71S 4QWBA 3W2WB 1KP6A 1HNXF 4B3SF 3W66A 2YKOA 3HVTB 5IC6B 3OLBA 4P9SA 5A0YA 4B02A 1WOOA 4Y28C 2K3KA 2FYXA 1RTDA 3BQ1A 2M8DB 4LVOP 1VR6A 1S4EA 1RT1B 1BQXA 2ZEJA 3PHTA 4ZHRA 2EXUA 4XDCA 1FKPB 1GXTA 1RWMB 3RR7A 2C3PA 1RT5B 5GAGI 2H65B 4NASA 4ZVQB 2NLWA 2QV6A 2ZD1B 2LQBA 4NEYA 7FDRA 4U7CA 2MKIA 3MOJB 3NAHA 4WTOB 4MAKA 2NQPA 1F2GA 1Q5YA 2AQ4A 2N4CA 4IG3B 1NKCA 1VQ5S 4C8KA 2ZVSA 4U6PA 2KFZA 3MM9A 2ZH3A 3J7AN 4DV0F 4USMA 4YHHJ 2R8KA 3TA2A 4DXLA 1OQ3A 4F50A 3MEKA 3CJRA 5DM6Q 5KFGA 4B9UA 4QYZJ 2LA6A 5F0UA 2QA4S 2QA4G 1VBXA 4FKYA 4ZPWR 4NMXA 2XY7A 4RBTA 2HG4A 5KFFA 3G9CA 4OJ1A 2WSCC 2FDNA 2M2BA 4OJHA 3G8TA 5C7PA 4Y65A 1RT4A 2CADA 1U0HB 2DGQA 2DR7A 1RABB 2D1CA 4NEZA 4JI7F 1MG7A 2VPZB 2VG5A 2W2PP 5EWEA 3KG4A 2W7PA 4X4RA 3TJAA 2MLXA 4TVAB 2E29A 4CH1A 3D6HB 1UJ6A 3QT7A 2CPEA 2UVRA 3DFEA 2Y0BB 2P2CB 1N33J 1J2VA 1PSDA 2W24A 2XI2A 2CXEA 2OFGX 3MMJA 2KVIA 2YQ1A 2ZHAA 5KT4A 1U2CA 2HS3A 1XNQJ 1ZZNA 2YWWA 4NCAA 4OX9J 4XIUA 3NY0A 2DR5A 3PM9A 2G0JA 3IRXB 1RXOB 3T5LA 2FVCA 3O8WA 5GAEI 4ZA1A 3POTB 5K8MA 4ED4A 4KV8A 1WEZA 3DGPA 1JXVA 1D9FA 3NG8A 5FIIA 4QR1A 4C8LA 2FJWA 2HFZA 4NXMF 1JNRB 4YUDA 4CLSA 3LOUA 3T6JA 4XPCA 4JYAJ 3BGOP 4N77A 2LXIA 1SUQA 1NNDA 1VRTB 1ZBTA 3QSYB 5LMNF 3PIPQ 4ZN3A 2W9BB 2DEIA 1TL1A 2WOMB 3HFVA 1FT8A 4KO0B 3U7JA 5C5JA 2QMUB 2ZE2A 4P6QA 2QL9B 3QJLA 3IRWP 1Y5LB 1KLNA 1S1VB 5AXLA 3MTKA 4A8YA 5DGBA 4AXJA 3NGDA 4WYWA 5I3UA 2VONA 1V3RA 3MMCB 4NLYA 1TZ0A 2R7VA 2FHMA 5D4LA 3K59A 1DFDA 4TYAA 1RU2A 1KKHA 2AGPA 2HIQA 5C24B 1NHKL 2JC1A 4KRWA 1HYSA 3V6DB 4ZCLA 3M4XA 3VAMA 3EZ5A 2C28A 3IM8A 5IWAF 3I5CA 4LRFA 1ZYQA 1AW0A 1TKTB 3G8QA 5LM7E 1LXJA 3SCLE 2OMOA 3BZQA 3MECA 1NSKL 2W7AA 3VAKA 2HW3A 4UUWA 4QU6A 2RRBA 2HQDA 3IBCB 4Y2MA 5KOWA 1WKJA 4URGA 2RMLA 1RTZA 4WF9Q 3TAMA 4RUHA 1UVIA 1JXEA 4LF2A 4E8UA 4PQUB 3UDEA 2R9LA 3TRGA 2C2MB 4KH0B 4EYIB 4DR3F 4KC5A 5B0FA 1C1BA 4DL0C 1SKSA 2LKZA 4UOHA 3C66A 4J9SA 3SBMA 1ZM4A 3KLVA 1HBNA 1UP1A 4DU8A 5KFDA 2OUGA 4Z7CA 1NRKA 3KNGA 5KFMA 3PHEA 2RIJA 4DSFA 4W90B 1XERA 4RNMA 4YB6A 1LXNA 2FZCB 4WFYA 3OL9A 1AFIA 3CJ8A 1X4FA 1NPRA 4FPRA 3ENVA 2YNGB 3K8VA 1PIEA 4MK8A 2B7BB 4ZMMA 1FKOB 3FSXA 1ITPA 2RUSA 5I3PA 2IBOA 4N41A 3PYGA 4C97A 2K7JA 3PO4A 4K50A 1O5JA 3AQOA 1Q81T 1WORA 1YJVA 4YY3J 3CCRS 2MGZA 3DMJA 4ZLJA 3VGUA 3TP2A 2GMJA 1IKXA 3B4DA 1GQEA 2KZMA 3QNWB 5CHCB 1LWFA 1HBMA 4A46A 1CPZA 4ZVSB 4NRUA 1XNQF 1S9FA 4QZVB 4C4WA 4LRAA 3N5FA 2B7CB 4OX9F 5LSRA 3HLUA 1AA1B 2H5EA 4PYAA 2CDQA 1VLOA 3AJ1A 2NCKL 4CIOA 2DO0A 3CDWA 2XY5A 3ZZRA 5CYMA 5GAHI 3EPIA 5KT3A 3BBBA 1OS5A 1XC9A 1O8BA 3NWGA 3JSMB 1IKYA 4CLFA 1BQMA 4ECXA 2E1RA 1SCJB 3W7BA 2R7RA 3WZ0A 1EX8A 3GR0A 1GMVA 4M5JA 2QLJB 2GGPA 1SC3B 1RYRA 2MKSA 5F3TA 3VVTA 2AEJA 2GV1A 1IR0A 5T41A 4J9RA 2P9CA 4JYAF 2PC6A 2XCAA 1FNOA 1Z1ZA 3PRBA 3S1TA 3BQ2A 1GNKA 2DIUA 4BHQA 3CCMS 1ZS6A 2LMIA 1RDRA 6AT1B 4HH0A 1RWUA 2DNOA 4WP8A 4WPAA 2H54B 5LL6d 2PO4A 1N88A 4C11B 1FRXA 1E6VB 3UPFA 3EPGA 2VOPA 1R0AB 5EHHA 4ECTA 3D68A 4OLOA 3T1AA 1F1BB 4QBUA 3KTQA 1PJ7A 3DLLQ 3EE3A 3WX8A 4L3KA 4LF5J 4TYBA 2CJKA 1NK0A 3A1YG 3D7SB 2OSQA 1TKXA 3LQVA 4CO2A 4ZOSA 2I6WA 3P45B 5E3AA 2HBZB 1HQEB 4Q7AA 3DXBA 1APSA 4QR2A 2YKPA 2O3DA 1U1LA 3BBFA 1HWKA 2MQQA 4NLUA 4M5DA 4IDKB 3UVJA 3MMBA 4JI4J 4OHYA 1UFLA 4P2SA 4I7FA 3C3LA 2GIQA 5LMUJ 2E5LJ 2ACMA 5A0YB 1FRLA 3HF5A 3R6LB 1RQ0A 1CJTB 1X60A 4IRCA 3D1HA 2WVEA 1RTDB 1DTTB 4OX6A 3H2VE 3MEDA 2OAUA 3TX0A 2DR9A 5DRKA 4WTYA 1YZ6A 3PJWA 5EUHA 2FJBB 5IZHA 3ZTOA 1KWMA 5ADZA 4UF4A 3G82A 3M6XA 1H0HB 1JJ2R 2HFOA 5A2QU 3A8JA 4DFJA 1K0VA 1UVKA 3M8QA 2KTQA 4QWAA 2XGPA 1V3ZA 3RAMA 4ZVFA 2Z0GA 4ED5A 4NOHA 2V4RA 3BGUA 1LWCA 2V4JA 1F60B 3VF0B 4MMOA 4Q0BA 2ZWOA 1QE1A 3PV8A 3IM9A 5D4OA 4YY3F 5HP1B 1D8ZA 3NOCA 1FJGJ 1N5VA 3L3CA 2BKNA 3DRXA 2BE2A 1EIYB 1KTVA 2DH9A 1DY3A 4NXNJ 4FXVA 2XS5A 2LVWA 3A12A 1OIAA 1FEHA 3HVWA 3LGMA 4CYUB 2OTLS 2PDAA 4Z2XA 2X7IA 1QVGR 1HPZB 1L5UA 4ZVOB 4K59A 3N01A 4OHVA 3T1HJ 2R2TA 1N0UA 5LXRA 3BSOA 2Y3YA 2HHQA 1P27B 4HVZA 2DGVA 4TY9A 2MJNA 1GFWB 3B54A 4QJVA 1NJYA 2D3UA 1RTIB 1NJIT 2AJ1A 1N48A 2CFXA 4DPTA 6FD1A 3AB4B 3BKTA 2YWFA 2UV8A 2IA6A 4YFUA 2IHR1 1VJQA 4NLWA 2F9DA 1UWBA 4NMLA 2AEMA 4DV2J 1JLAA 1VC5A 3MM8A 4J5OA 3OTCA 3LP1A 3K57A 3M30A 1RAHB 4DL3A 2AWZA 2M88A 1NSQA 1KD1T 1Z2LA 1NSAA 1G7CB 3CJKB 1FD8A 1C0UA 1HIYA 3A13A 1WF0A 5J2QA 1SQEA 2MQMA 2CQGA 2EFVA 1CS4A 2F9JA 4LF5F 1TL1B 4RL1A 2AIRB 4CLZA 3SFGA 5HROB 1FO1A 3NS6A 4X64J 2XMWA 4USTA 1FF2A 2NXEA 5HVFA 1G1XA 2OFHX 5FDLA 4BDPA 3KLGA 3B78A 5HLFA 1HARA 5I3UB 4RJVA 3RJMB 3OUYA 4OI1A 2WB1D 4JI4F 4UOCA 3HSJA 4J9OA 5A6WA 3D2WA 3GMGA 2C2EA 5C2CA 5LMUF 4FNHA 5L1JA 2FB0A 2X1AA 2XS2A 1S9GA 1P9QC 2BUNA 2LYVA 1NDPA 4DN0A 3BV8A 1HYSB 2CQHA 1YSJA 2IMOA 1MN7A 1VYAA 2KXNB 4H4MA 3R5GA 3TX8A 1PKUA 3HHNB 3AHPA 1VISA 3CCTA 2ADBA 1IM6A 1S4FA 3QRRA 1HNWJ 1GTEA 2EEYA 4DU7A 3CJ0A 3KLEA 1ACMB 2UVWA 5E7OB 1SL1A 2VC1A 3DGVA 2ZUAA 4JI6J 1DARA 2MQLA 2XCPA 2ZHOA 4EGLA 2QYGA 2WW4A 1U49A 4X4TA 1ZM2A 4Y2CA 4RUAA 4IH5A 1RT7A 2V2ZA 1B70B 1C1BB 2R2SA 2RQ4A 2ZBPA 2XY6A 4ZVEA 1SKUB 2R42A 2BQRA 2B9XA 3KLHB 1HBNB 2K8GA 3W61A 4IO1A 1FJGF 2EI5A 2DO4A 1PILA 3GIIA 4PPZA 3W64A 2BANB 3NEKA 2J7WA 2E5HA 1KNZA 2LQ9A 3ET6A 4HHHA 1X0FA 4NXNF 3IR7B 4HHJA 3HHKA 5KFNA 1CJKB 4GO7X 3D6TB 3T5JA 3DLBA 1Q8BA 5AXMA 4IR9A 2EK1A 4C98A 4DCJB 2FJVA 2YKNA 2F8MA 3T1HF 3ILOA 3DMJB 4I0WA 1T11A 3E51A 1YG0A 3GU0A 1IKXB 1WDDA 5G0RA 2IM0A 2FLPA 2F1FA 1AUSL 2WK4A 3EXYA 1HQ2A 4P7TA 1Q5VA 3CNQP 4USWA 4X4VA 2V63A 2XYHB 3DYAA 4LQ3A 1PYSB 2HNYA 4C9DA 2RDJA 2DGTA 3RB3A 1ZPVA 2RUGA 1ZAWA 2AEFA 4DV2F 3E3XA 2CRLA 4UQGA 3KLIA 1TK0A 2KFNA 1VHFA 2E7XA 2DY1A 3KK1B 3I4PA 2O67A 2ZUGA 1IWGA 4LMZA 1S1UA 1CJUB 1JMTA 2JRSA 5ETMA 4N7TA 2GIRA 1YJUA 3G86A 3KG0A 2HMIB 3GILA 3QPIA 2M70A 1WJ9A 2MQPA 4K5SA 1T9VA 4HEA9 3EMTA 4OYMA 1R8CA 1U1QA 4K4TA 3OPKA 2E1AA 3BGFA 2PT0A 1FRHA 3V6JA 2ZH2A 3FMBA 2J8SA 2FGOA 4NA1A 2WONB 3B82A 1X9MA 3QGPA 1K1QA 1FHTA 1FFSB 4RPFA 3PY8A 1N5TA 3N4WA 2OSRA 2GW8A 4O4GA 3PX4A 4I6WA 3R7NB 5MLCV 1N56A 2C2KB 5D6GA 2OELA 1MWQA 4OYZA 1CG2A 1NJWA 3GV5B 2ASJA 4FF3A 3MM5B 1TVRA 2UZAA 3CDBA 2I1RA 5HMXA 2CNLB 3AFGA 2KI2A 4CH0S 2UUWA 2BACA 3CCVS 3UN5A 2QLBB 3DLGA 4M5DB 2UXDF 1I6JA 1WKKA 1X4DA 3RW7A 2F5GA 4ES1A 1CBKA 1S6UA 3IAS9 4V19X 4JI6F 3GIJA 4URSA 3NGKA 3LWLA 1IBCB 5EN1A 1JX4A 3MEDB 1C1CA 1XBWA 1HKAA 4WIIA 3F0NA 2AHOB 4DX8H 4M5IA 4RU2A 1U1RA 2CPFA 4NWBA 3HHEA 1BY9A 2KYZA 2QA2A 4PZVA 2OPRB 3PFEA 2DY9A 2FTRA 3DC2A 2M7SA 3G6VA 3DU6A 2R8JA 4WE1B 2COLA 4IKAA 2OPPB 2QTWA 2YWGA 5CYQB 1REGX 5CH7B 1WG1A 4OJ3A 4FBUA 1N34J 2DXFA 1KLMA 4ZCMA 2U2FA 5K5MA 3R5DA 2LQ5A 4HHUA 4NCBA 5DJBA 3DHWC 1KOOA 3AD8C 2UUBJ 1RADB 1EETA 3PR5B 4UOFA 1NO8A 5DLGA 2N3OA 2R8IA 3MM6A 1UVJA 2CG4A 4ED7A 3M8RA 4ILMA 1U02A 3MAQA 1U0SA 4QIWD 5F8LA 5KFZA 3FKBA 1KQKA 1NBEB 3DRSB 1RT2B 1JKHA 2H4YB 2HHTA 2LA4A 3UO0A 1V5VA 4O3SA 1OQ6A 4DL5A 4M5KA 2OD4A 1GH8A 4OZ2A 2BJ3A 3TEHB 3H5XA 1WUUA 4HKQA 4PAAA 1V6HA 1VQOS 1LW0B 3D5MA 4ZP7A 3K5PA 4QWDA 4NZ0A 3KLFB 4O3OA 2VG7A 2VFVA 1RI7A 5J1NA 2ZNYA 2RVJA 3W9IA 3FBEA 4OMFG 1TP7A 2GAHC 4OL8A 2HBQB 3H0PA 4NLQA 3MM8B 4RNFA 5ETNA 3BM7A 3D0GE 1JLCA 4X4UA 1JXLA 5E3RA 2BXJA 1FJCA 4IOBA 3Q24A 2Q79A 3NMAA 2BMBA 3CD7A 2HKEA 2HQFA 4OX8A 2XBPA 1RGVA 4OHWA 1QJHA 3LH2S 3LWMA 4IFVB 1NMEB 3DRRA 4C3MA 1C0UB 1SJ3P 2UXBJ 2D3O1 3HKZD 5J2QB 2HGNA 4I69A 3UDCA 2ZFHA 1SV5A 1DHMA 2C1EB 2RDDA 5C25B 5H9EJ 1ZZFA 1RHJB 2HLTA 4DQIA 1Q4RA 2RF2A 4ID5B 1CULB 4DS4A 1RAOA 3CPWR 2UV8G 4FN5A 4DL7A 1CQMA 1CC8A 4TLQA 3OXFA 2FVPA 4CI0B 3HP6A 2HHVA 3M2RB 5D0EA 5JMNA 5D8HB 3N0VA 4ZJQA 5KFQA 4IQMA 4WK1A 1SC6A 1X4BA 2PIIA 3R1HA 2VPWB 4R0JA 3IAM9 2HFSA 5HANA 1RT3A 2DR6A 2BRLA 2V2KA 1SVDA 2ZBQA 1P9YA 2A3JA 5IT9Y 4Y2AA 4QW9A 1RHKB 4ANEA 3I5AA 2HQGA 4I2PB 3LP2A 2HYIB 5AE2A 2RU9A 3KLEB 1JLEA 1VBZA 1Q78A 2ASYA 2GQQA 3EDRB 7FD1A 2VG6A 3T5KA 4QCLA 5A8WB 1N34F 2EW9A 2VQEF 4HDGA 1KSPA 2J0QD 2R7TA 3M2UB 1PBUA 3Q89A 4KGKA 2MKKA 1RT7B 2RILA 3OL7A 1VC6A 2AW0A 3N9UC 4GRSA 3D1OA 1FTRA 4KPCA 4ZKAA 1FWLA 2RHSB 4C8NA 4JBCA 1N0VC 1P1LA 3PX6A 3ET6B 3W8GA 4BCAA 2HFVA 4O23A 3WC0A 1RAAB 1I94J 3MD1A 1XNRJ 1RTHA 5CABA 4NYPA 2MQ8A 2GHWA 4PXDA 2FHOB 1MN9A 1FJ7A 3BREA 4RUCA 3C6UB 4P2FA 3QWPA 1YVFA 3AH6A 2VUGA 3P49B 3QSIA 5DGAA 1JWWA 2FJAB 3GJRB 1F2HA 3JXOA 4PG8A 1UA0A 1J5OA 4KY3A 1D8YA 3K5MA 1RA7A 1TKDA 2L48A 4DWIA 1UTAA 3DYAB 1S9EA 4TLRA 1FVSA 2HNYB 1NEEA 3MEGB 3VAJA 1TL4A 1S0OA 2V8HA 2C2RA 1UPPA 2J6SA 4DR1F 1B99A 3M8PA 4MKYA 4NA2A 5D0HA 2VFRA 2V94A 3MD3A 4N56A 1WF1A 1VQNS 2ZDOA 3N28A 5F8JA 3GCXP 2GVDA 3P8BB 4U8YA 2ZH1A 1PBAA 1WC6A 5IV4A 3DRYA 2F7VA 5L9XA 4B3RJ 3M8YA 1S1UB 1ICEB 3D3CJ 2I5JA 2RQMA 1QDUB 2IRYA 2WAQD 1NK6A 3FSYA 2WZ1A 2YKMB 1VQ6S 3EJMA 3U1MA 3NCQA 3G6YA 5JJBA 3ZTRA 1RISA 5KFPA 1RAIB 2YQ0A 2IYIA 1CSJA 4DMZA 1HNIA 1WDTA 4ANDA 1KC8T 4RW7A 4YR3A 1NHUA 5J2MB 4A47A 3ETMA 1JIHA 1VIXA 2VD3A 2ZBRA 5LSLA 3Q83A 2FVSA 1WSVA 2RRAA 4RW8B 4F4KA 3PEJA 3F56A 4C0OC 3OFFA 1AXQA 1FXLA 3H42A 1UCNA 2AGOA 5J1EA 1UWAA 4O4GB 2L9NA 3CTRA 3KK2A 2Z2ZA 3MI7X 2Z2YB 2IM3A 4KHRA 3TUPA 3MGJA 1KVKA 3KJVA 4DR2F 3V81B 4U7UD 1R27B 4K4UA 1NK9A 9ATCB 1TVRB 2ZM6J 1M1GA 2B3TB 1HI1A 2GVZB 1YITS 3P5BP 3T9ZA 4K4SA 4LR9A 4FNIA 2CPHA 4O3RA 1U6BA 1EB0A 2VBXA 1X5TA 4PR6A 4M1KA 3PYDA 2NPIA 3MAAA 1EP4B 1L3KA 4DPUA 1LW2A 4DV6J 2DNYA 4IG0A 1KHVA 2QLFB 2QEXS 1NXIA 3H2LA 1B7FA 2KG0A 2DBBA 2VOOA 3QZ7A 3MZIA 3KG1A 1TKZB 1X4EA 4DZ6A 1YIJS 3L7PA 4A8XA 2C2NA 5J2PB 2GMHA 1T3NA 1AB8A 1UW4A 3QIPB 4JV0A 5CZXA 1VQSA 1FERA 1S0MA 2EC0A 3HO1A 2XHCA 1PG5B 3A3NB 1UVNA 3E2EA 1WNEA 4DBQA 2ZH8A 1S6QB 1KLMB 3CD0A 4XTTA 1I94F 2MZTA 1XNRF 1WI6A 3IMQJ 3MDFA 4J7CA 3JQMA 2N7CA 1FX2A 3CCUS 1TL3A 4M63A 3CT9A 1WEYA 2CPDA 2CAJA 4NX9A 4U95A 1H73A 3TA0A 1N5SA 3VAGA 2JH3A 3LF0A 3WQPA 1NK7A 1RBLA 2MTLA 4RW4A 5L39A 4KBIA 2ASLA 3ZXWA 4LSLA 3G6XA 4IQXA 3DLKA 3HZEA 4R5PB 2K1RA 3O3LA 2V9KA 4ZP9A 5B0AA 2RKIA 3OHBA 5MAOA 1C0TB 4QYZK 4PWDA 2OH2A 2WBMA 2VQFJ 1FA0A 1FKAF 5HI7A 5AJ3J 2ALYB 2Z56B 5BR8J 1R89A 4RX6A 4O0IA 4X65F 2AJ4A 4PEOA 5DQGA 4G1IA 4USVA 4C7QA 2KZZA 4LIWA 4JV2A 4WP9A 2R2UA 2A2DA 4B3RF 1XR6A 3W8PA 4ZS6A 3TVKA 1XK8A 2QX0A 1FNXH 2WSFC 2B6AA 3C15B 4OHZA 1WTFA 3LGHA 5B08A 2W2NP 4NCGB 3H59A 3HVTA 2CNKB 3DN9A 5JVGQ 5T7LB 4X62J 1S97A 3QRQA 3LO3A 1K1SA 4W4MA 4Z7YA 2V69A 1IM4A 3O2IA 2EKYA 5KG3A 3AA9A 4IYQA 4I6YA 3Q8UA 2M5YA 4H4KC 1XWLA 1RT1A 5IQQA 2IM2A 2GX8A 3VAFA 1DRZA 1FKPA 2KN4A 3CCQS 4DSLA 2BEFA 1K73T 3HX9A 1QSLA 3T3FA 2VKZG 2HZAA 2BE9B 4QYRA 4F02A 2SXLA 4RLEA 3MTJA 5EX3A 4ETZA 5KFCA 2MHEA 3I6PA 2BA9A 4G1PA 1SV5B 4TXSA 1S57A 2ZD1A 2HWHA 4DL4A 3TAQA 2MSSA 1ZTWA 1HW8A 2WW8A 3FDSA 2ZM6F 5LOQA 5F8HA 4YB1P 1B7YB 5I42A 4IG3A 1VK8A 1D0EA 2WSEC 2Z2MA 2VL1A 4UY85 5CCMA 4I68A 1N36F 2RB7A 2R7OA 4KGZB 1XMOJ 4YS2A 3H5UA 4N76A 3PJXA 5CD4A 3HKWA 4DV6F 4KAIA 2XMTA 1MROB 2IC3B 4O44B 4KKOB 1YK9A 3GWCA 4C6AA 4PG4A 4MKVA 1U1MA 5JUMA 3O5TB 5B0BA 1D1UA 3Q2SC 3GJSB 3GYNA 2M52A 3GONA 3KJNB 1WF2A 2IVMA 4OHXA 5E5NA 1X8DA 1HI8A 1JLFA 4KSEB 3LP2B 3C16A 3THVA 2AYGA 4Q2MA 2BE7D 4L74A 1F3VA 1JLEB 3QO9B 1QSSA 4P73A 1YRTA 4MIWA 3N6MA 4LSNA 3UDLA 1ZTTA 5E0OA 2PMWA 4OI0A 1F3FA 2DNZA 2IBKA 3J7YU 2KRRA 1SC1B 3D3BJ 4URQU 1S72S 5JXSA 2MDAA 5CZVA 4DLGA 3UDVA 5AE3A 5C42A 3IRXA 2MJUA 3FZ2A 2W2QP 3JTPA 1TK8A 3Q8QB 3SCIE 1S7HA 4ZN1A 1YQHA 2ASDA 4J9PA 3POTA 4D3GA 1T94A 2ZOMA 3PNIA 4F0HA 3NMRA 3A8IA 1S48A 2IA0A 2CPXA 4NA3A 2GS8A 2J6TA 1GMUA 5B09A 1D09B 2V67A 3RYLA 3EZOA 1S0NA 1J5EJ 4CLLA 1RTHB 2UUAJ 1U25A 3RG6A 3BR9A 4FF2A 2VQFF 1OYEA 3NS7B 5AJ3F 2VDHA 1S1XB 4J9QA 1YWXA 2WOMA 5BR8F 4AL6A 4KO0A 3R8YA 1PAUB 1O6XA 1ULRA 4D3HA 3NGTA 2N3LA 1W7WA 1HHSA 3H5SA 3FCWA 3JTNA 4MFBA 5J1PA 3FGVA 4LF8F 1HD0A 1IBLJ 2IAJA 1NAQA 3TW0A 1FI4A 4U8VA 2LECA 1UFKA 3TR5A 3TANA 2KM8C 3V5RA 3DOLB 3M8WA 8AT1B 2G0CA 2Y8WA 3V6DA 4X2BA 2GVDB 3I32A 4TU7A 2DHSA 3S01A 3CB4A 1X9WA 1Q79A 5KG4A 2QJ3A 4MJKA 1IR1A 4CLUA 4H4OB 1DQ9A 2HEKA 4AUKA 4ELVA 5ETLA 4B3SJ 3NLCA 2CQPA 3VQTA 3R3TA 1XR5A 1W2IA 1OJ4A 1VMBA 2B5JB 1HBOA 1HNIB 4F0MA 3AJDA 3HULA 2DEJA 2O66A 2RHQB 1HQUB 1PC5A 4F26A 1I51B 2GJ2A 3IN5A 1HFEL 3JSBA 1O51A 3GE9A 5D4PA 2DTJA 1UL3A 2ROPA 2OMLA 2EPIA 3ZNJ1 1VIOA 2XQCA 1QUPA 1YJ9S 3Q8VA 1RCXB 1XMOF 5J1EB 2E7VA 3I82A 2BJDA 3MEEB 1R8AA 3TARA 1KEKA 1U26A 2YKAA 2YNGA 4LF9J 5ETRA 1HL6A 2OI2A 4FBTA 1FKOA 3M7VA 1A6LA 1T0TV 4WYLA 1AFJA 4ED2A 3OD2A 3PYFA 4UOGA 4QWCA 1IN0A 3N6NA 4DV0J 4N8NA 3RBDA 5EDWA 4HACA 2AYBA 4QIFA 1LW2B 4K0KJ 1XTZA 1OY8A 5HK4A 2B8QA 3OTEA 4NE9C 3PXGa 2WVCA 2L08A 3D9BA 1NB7A 1NPPA 1IJEB 5LJ3Y 1TAUA 1OSCA 1Y0HA 3G6ES 2EFNA 3MCNA 2KXFA 3PACA 2C3YA 4RU9A 2AGQA 2UU9J 3H5YA 3TZYA 5SUHA 3EX7B 4P74A 3JSMA 1SI9A 3OXLA 2XSFA 3AB2B 3SV4A 3X1LB 4K4YA 2B9WA 1QAXA 3EGZA 2A6OA 3AT1B 1IR2A 1LNQA 4MIAA 1IKWB 3QJJA 5HVGA 3BJYA 4JI0J 3OL6A 4RBUA 3THPA 2V8DA 2EFOA 2BJ7A 2DHXA 2KFYA 3NS5A 3GIMA 2LFVA 4M8LA 1YJRA 2KT5A 5L38A 2AJQA 1J5EF 1SJFA 2UUAF 1RAGB 2P9GA 2M8HA 3IFEA 3TA1A 3NP5A 1N54B 1UZDA 4N5SA 3A3OB 3TZZA 3ILLA 5KFVA 4H4KA 2X1FA 2JL9A 1S1TA 5EX0A 5L1LA 2CJAA 4LSLB 3CCSS 4BS2A 3DLKB 4Z37A 2CNNB 1V9OA 1RP5A 5KT2A 5JVHQ 4NXMJ 1SJ1A 1U4BA 2RKIB 1RKIA 2DNGA 1IBLF 3OVAA 4DSKA 3L7OA 2VZ9A 4PWDB 3CMQA 3W62A 5LMNJ 5L1KA 5HAOA 1WI8A 1S99A 3FJ2A 1X4HA 4PQAA 5IC4B 2E9TA 2AT1B 4RBVA 1KVIA 1IUJA 2Y1RI 1HQEA 1WKLA 4LF4J 4P7VA 2B6AB 4C3KA 1KQSR 2J5AA 4IDKA 3F44A 3CF5Q 1WC1A 4F8RA 4F67A 3FEZA 3ZZTA 2CPJA 2V6AA 4CLPA 2U1AA 3W3SA 1OYDA 2B9YA 1CJTA 3IWLA 3J81Y 2HHXA 2CYYA 5FD1A 1K0TA 2PMZD 3GR1A 1DTTA 4K4WA 5IWAJ 4F4XA 4B9NA 2YTCA 3QRPA 2YVSA 1F9HA 2K7KA 4A8WA 4GVBB 4FVMA 4UTGA 3KUHA 3CC2S 4UQTA 3Q22A 1UVLA 4AT1B 3W2VB 4WKRA 2VJUA 4MTPA 2BBEA 4G65A 1GMWA 3C6TA 2BDPA 4EEYA 5KFKA 4LF9F 2ATLA 1LQ9A 3DLEB 4AE5A 4FS2A 1MNEA 3CJ5A 3QAEA 2HWTA 3BBCA 4DR3J 4ECZA 5I42B 2YPZA 1VGYA 4K7QA 2XHWA 4B9MA 3M32B 2Y1LB 5HP1A 4PUOA 4M5MA 2EBGA 1N5YA 2KXHA 2AZ3A 2JZ5A 3TQEA 2BZ2A 3OTOJ 3MCOA 4K0KF 1TMMA 4K2XA 1BWEA 3ZTQA 4ZIVA 4TY8A 4L6V3 1T7PA 1S5ZA 1SJRA 4R8UA 4QW8A 1M1KT 4CYUA 1RAJA 1U48A 2HS0A 2CA9A 3ILJA 5AT1B 2GHPA 1HPZA 3VCDA 2UU9F 3VVUA 3MXHP 3GSIA 1WC4A 1F9EB 1JLFB 2YNFB 4NLGA 3ITHB 3C16B 2ADCA 3CJ2A 3RAXA 2ZITA 1RTIA 3P5TL 3HT0A 4DN9A 2EVZA 1WELA 4LSNB 2R8GA 2D9PA 4JI0F 1D9AA 5ETQA 2BJEA 1WG4A 2FHKA 4F2RA 4LFCJ 3HD2A 4J9MA 2XEXA 4F4WA 3ZZZA 1H2TZ 3R7SB 1JB0C 4HL9A 5C42B 3BDEA 4ED1A 3NGRA 3I0SB 2QL7B 3JB9k 5F8MA 4TKTA 1UEVA 3KDOA 5KFEA 4LJMA 3KJFB 2JVOA 4A8SA 2XSJA 2HK2A 3RUBL 2Y9HA 3V4MA 2BV3A 5HBMB 4LBPA 1N6QB 1QVFR 3CJQA 1EZZB 4OI2A 2NSBA 1LWXA 3CJKA 3M2VB 2BM0A 5DLFA 2VA2A 2EFPA 2LEBA 2C3UA 2HHPA 2EFGA 1P1TA 4CT9A 3EGNA 3WC2A 4LFAF 1Z2ZA 2AD9A 2EC2A 4DLEA 3CCJS 5GADU 1W26A 5HROA 2QL5B 1QTNB 2O1PA 2F4VJ 2CVEA 4X4SA 2K2PA 3VWSA 5FLXY 3HVRA 2ZOGA 1KDNA 4MFBB 1KQFB 4U9RA 1M5HA 4DJBA 4LF4F 5KFLA 1OY9A 5IM0A 2IAJB 1T95A 2MLYA 2E9RX 4OYXA 1VFJA 1T9UA 1FEEA 1PYTA 2LU2A 3H90A 2DNQA 4LUBA 1MSWD 2VFUA 4G1QB 3DI6A 1RE1B 5HQMA 1XIQA 4C8YA 1FDBA 3QATA 4DV5F 3M1VA 3JAMY 4LQ9A 4FYVB 1NKBA 2DNLA 1RSCA 4JB8B 2AP6A 3S7RA 1XMQJ 3SV3A 4NLVA 1YJTA 3H20A 3LPEA 1S76D 5A76A 4NLRA 5HJYA 2W9AA 1F5BA 2NXUA 4AD6A 2JEFA 1HBOB 2XNQA 3MUMP 4ERDA 3CDUA 3OJUA 5DDPC 1R6YA 5H9FK 3BPDA 1V3SA 3CEDA 1SC4B 1HI0P 3B4MA 4KGVB 3C2PA 3PDNA 3BR8A 3R9LA 3KFWX 4RW9A 5IT9U 1U1KA 1HBUB 3BN4A 2PGCA 1KRPA 3KLHA 1JJHA 3OQ2A 1UJ5A 2IJRA 4O0NA 3J81j 2EFQA 2I8EA 3UD5A 1RWNB 2BANA 3OTOF 2IVFB 4FZVA 4DG1B 1VQYA 1U8WA 1WOSA 3IA0A 4M5GA 4PCQA 2JEGA 5B0CA 3PIOQ 1PCAA 2AF6A 1A7GE 1R7IA 2ZWPA 1CJKA 1EAYC 3PW4A 5K14B 3CMAS 2VB6A 1WWHA 4LF7J 2G2OA 1EKRA 2RAQA 2W8KA 3MUTP 3I0RB 1YRXA 4CH7A 3EVMA 4ECUA 2RQKA 2GCFA 4PG7A 4HACB 2CQIA 2Y8YA 4ZVTB 1VQMS 3MAHA 1NKEA 1RWVB 2IVYA 2MY8A 3MURP 2JFKA 3DXSX 2V0NA 2I0XA 3C14B 4LFCF 2PA8D 4WFAQ 3F41A 3LANA 2VICA 1ZPWX 2FHJA 5G4DA 4JI3F 3BB5A 1DQ8A 3TOQA 4ZPAA 3KK1A 1VQPS 3LA0A 3ELHA 4AYBD 2RD5C 5FJ4A 1DQAA 3QIDA 4ETXA 4CTAA 4ZJLA 2FZGB 3MPDA 4DPXA 5CXTA 3CJTA 1CJUA 1FDAA 5CQGA 4LIRA 1OPZA 2A18A 4NZ6A 1SL2A 1Y7PA 3VR1A 2HMIA 2YQ3A 2QC3A 1R31A 4NYZA 2X1BA 1OSDA 3FMWA 2YXLA 3EYZA 3SQGB 4N8OA 2BJ9A 4TQSA 2CJQA 4DR4J 1S1TB 3QFHA 5HJXA 1B64A 3NL0A 1KVJA 1F5AA 5KOXA 2F4VF 4PG5A 2WONA 5D78A 3V4IA 3D54A 1BD6A 2VBWA 4GKJJ 4DSJA 2LQJA 2K06A 2NR0A 2HFUA 4KFBB 2MHNA 4M5HA 3CUNA 4XPEA 2BQUA 2KHDA 5D0GA 4FVCA 1O0PA 3MR3A 2MLZA 4KYZA 1K44A 3SEOA 1HWLA 4HT5A 5CAAA 3IGNA 5BYQA 2D74B 3MM5A 3DOMB 1FK9B 2HVHA 4USJC 5D15A 2G1HA 4JI8J 2MPUA 3QAUA 2C3OA 3UWTA 4WFZA 2DNNA 3CIMA 2XLIA 2AYEA 2R7XA 2PEHA 2JDJA 3L9ZA 2QA1A 3OXGA 2VHGA 1Q0NA 4HI2A 3CCLS 1TFYA 4DFMA 1Q8LA 1T8EA 2J7KA 1XMQF 4I67A 1L3VA 2NREA 4IR1A 4ZCIA 4ECVA 3PCOB 2H5IB 3OV7A 4OYPA 4JP8A 1MWYA 3MPYA 4ICLB 1D9DA 1TV6B 3M6VA 4ECWA 4I1TA 3TQ1A 2GIFA 2F8EX 1NSPA 2DGUA 3UR0A 4UZCA 2OPRA 4EO6A 1VQLS 2PFDA 2BYCA 3MR5A 1ZH5A 4A48A 2R4FA 3MR6A 4WE1A 3HK2A 5ETOA 1SH0A 2OPPA 3KHRA 4WK3A 5CYQA 3C6TB 2C42A 3THTA 3GFYA 2JLFA 2O01C 3HD1A 1REVB 4CO5A 1CQNA 1M1HA 4R25A 3TVZA 4J90A 4MH8A 4PPDA 2YH0A 2J7UA 4LF7F 5H9EK 3SCKE 2EG1A 3LP0A 3EDQB 1KONA 4EZ9A 1PAEX 1JLQB 4PUOB 2ACYA 4A4JA 3CJ3A 1WHWA 2AX0A 1N5YB 1U47A 1X4AA 2ERRA 1QAIA 5B0DA 2V8PA 2A2CA 4DV3F 3DRSA 2HZVA 2G13A 1RLDA 1RT2A 4Y3CA 4TY8B 1AUDA 3AQPA 5GMDA 1Y4ZB 4R8UB 1FNMA 2H4WB 4ATNA 3DCAA 3KKFA 2QO3A 2HQCA 3TVYA 4C0BA 2HHHJ 3NGUA 2B51A 1Q82T 1F5CA 1UPMB 5DO2A 3DNCA 2XMAA 2W7OA 3PKYA 4MYUA 4ED0A 3S6EA 1BHNA 2V4QA 1LW0A 2A6MA 1R8BA 3RW6A 1N32F 1DTQA 3ENAA 5A8RB 1MMNA 5BYSA 4OIXA 1FCAA 3KLFA 3CIZA 3HT3A 3K0JA 2N82B 1K47A 4PWUA 4ANCA 4V1Ak 5AXNA 1S6PB 1AT1B 2MSTA 1BC6A 1TMJA 3K58A 4ED8A 2HRUA 1KFDA 1NB2A 5B0EA 5DM7Q 2VPYB 1U45A 1N5QA 2KM8B 3T19A 3L4BC 5HVHA 1S0VA 3KHGA 1RHMB 1NJXA 4FDFA 2Z57B 4DR4F 4CLKA 4DPOA 2QSFA 1ROFA 2XSJB 2JEJA 3BN7A 1BLUA 4CLYA 3BYRA 3CO9A 4NLXA 1FXDA 4GKJF 2AJ0A 3L7UA 4TQRA 1VS3A 1YJ7A 4IFVA 2X1GA 3Q23A 4EUVA 1TU0B 1AZSB 3UR3C 2I2YA 1UA1A 4LRCA 1RYSA 2Q6CA 5C25A 1YBTA 3MM7B 1SXLA 3Q0AA 2XMMA 1R0BG 3GG1A 3NAIA 3PRDA 2G2ZA 4ID5A 1NH7A 4LR8A 1WSRA 4RWXA 1IKVB 4JI8F 1CULA 4DF4A 2V8GA 2R8HA 4J9VA 3ZZOA 1SJQA 4FXDA 5IM0B 1X9SA 2VC0A 2MMYA 2F63A 3BO4A 4RZRA 2UUCJ 1DZ5A 3M2RA 2AMCB 2YWEA 2GHVC 1KFSA 2KHCA 3R7BB 1IQZA 1LWEB 1U1OA 5F41A 4JUZA 2L9DA 2AU0A 4JI2J 2YNHB 3DI6B 3TJ9A 3UFCX 3MMAB 1RK8A 2YX7A 3EVOA 2L9WA 5KFUA 2J9EA 4XO0A 1G4CA 3M1VB 5DDRC 2YH1A 2Q1LA 4HLBA 3OVBA 3D67A 1HLWA 1CJVB 3UCZP 4IOAQ 2B8PA 4I2PA 1VRUB 4NLTA 2FY1A 2UXDJ 3CD6S 2XMJA 1PJ6A 5BYRA 2DNRA 3SSSA 2GAGC 3OL8A 4K4XA 2WRMA 3I96A 2XYGB 5A8WA 2DCLA 3QGGA 3BPSP 1ELOA 4TU9A 1UAWA 1YKWA 3DOKA 3M2UA 3R97A 2E5JA 3FEYB 4K4ZA 4IRKA 4RW9B 3LAKA 1A9NB 4J9NA 3GP9A 4YR2A 5KG1A 3CC4S 4WU3A 2MKCA 2HGMA 2QRRA 4KR0B 1NDLA 2IRXA 1RHRB 2HSEB 2DT9A 4WP3A 2KO1A 1BQNB 2B4OA 4HI1A 3P4UB 1X5OA 3EGVA 3VGVA 1YGYA 3IG1B 4QR0A 3SMZA 3SDEA 3SZ2A 2ROGA 4CLWA 2CIMA 4LSZB 2YKQA 1TUGB 2HHHF 3C6UA 5KFOA 4XDDA 2YPYA 3PRVA 2DPJA 2JSXA 5HMZA 3BH6B 1VQ4S 3VGSA 5E33A 3BGRB 2J6UA 2BX6A 5L8RC 4CP5A 3GIRA 2Q6BA 1S77D 2IJFA 3ZO7A 5ETVA 4PXEA 1NK8A 2EKNA 3HHDA 1FRMA 1VOMA 4HDHA 3OSNA 3MEGA 3SSRA 4RW6A 2H3EB 5CCLA 3F73A 1L3UA 1BE4A 2V50A 2OTJS 3T6BA 4DV4J 4ZDNA 2D3ZA 1U6ZA 2AV5A 1QSYA 2UUTA 4CTAB 3BSAA 3D66A 2V5HG 1DLOB 2P6TA 1IWAA 2YKMA 3QLHA 1C4AA 3IXQA 1TL5A 1H6KX 1RB0A 4EBDA 3CSKA 2LU1A 3FFIB 1VBKA 1UEUA 3HJFA 2N7YA 5DS7A 2BVZA 1Z4UA 5J2MA 4I4BA 2JJ4D 1HNZJ 1QY7A 2HK3A 5DZ7A 1KS2A 2ZJQQ 3SXLA 2R7QA 2YBVA 3DDKA 1X0PA 1G6BA 2RH3A 3V4IB 4RW8A 4NL5A 2ZZTA 4ZPTR 4F7VA 4F3MA 2G4BA 1M90T 4PABA 1H7WA 2RDIA 4BBYA 2UUCF 3A3PB 3IWNC 2J0SD 5ITHA 4P2MA 2D9OA 3V81A 1FWPA 3I56S 4ELTA 4JI2F 4N47A 2N4DA 3PW2A 4O3QA 2UXCJ 2GVZA 4B3OB 1U2RA 1XEZA 2ZJPQ 3KK3B 3IO1A 2FGCA 2POKA 3HHLB 4P52A 3DRPA 1J27A 2AJFE 3OFEA 2X3DA 2AX1A 1EP4A 3KNAA 3KHLA 2A10A 3AD7C 4F3OA 2KRBA 3NGSA 3GJQB 2GNKA 5IT4A 3PTWA 2IM1A 2DNKA 3PO5A 1TKZA 4MK9A 1VLYA 1YI2S 4OYBA 4NLOA 2DNMA 5ETSA 1MU2A 3CWJA 2VBZA 4FKXA 5HQ8A 3KUGA 5J2PA 3NNHA 5HN0A 4MK7A 3QIPA 4ILLA 3TEGA 1JK9B 3ENWA 2BM1A 4F4ZA 1EQMA 4QIEA 4DUZF 3J80Y 1UETA 1S6QA 2VQEJ 2LDIA 1DBDA 3M6UA 1K8AT 2NXJA 2OD6A 1XN9A 2DHAA 3BF4A 2RRNA 1U8SA 3HPOA 2H1YA 3C19A 2E66A 3OW2R 3PW7A 2VJVA 4NLDA 3VGTA 3BS9A 2XB2D 3LP0B 9RUBA 4J9KA 4FF1A 2HNDB 3WX4A 1Y9OA 2DRAA 1MLAA 2OEKA 2HURA 3RB0A 2OLWA 2X51A 1WHYA 2RS8A 4R5PA 3BDPA 4DEZA 3JQKA 3DLHA 3J7A1 4OX7A 2M9KA 4NZ7A 1C0TA 1NK5A 3BKUA 3IC1A 2W9CB 2BQ3A 4CZCA 1HNVB 1RTJB 2VDIA 3NNCA 1KBRA 4ZP6A 3WHIA 4KIAA 4DDFA 1Q1KA 4PRFA 5LT5A 4DV4F 1B0PA 3CCZA 3OR2B 1DTQB 4J37A 2B43A 3TI0A 2FC8A 3G87A 5B0GA 4DHVA 4X4QA 4C8ZA 3HM9A 3N6LA 1VDHA 1D3WA 1XQIA 4X84A 3C15A 4Q8EA 3D6FB 3HFZB 4QU7A 4NCGA 3EZUA 3HFKA 1NUEA 4DR1J 4YHHF 4CO1A 1XR7A 2OPQB 5HATA 5T7LA 2CQ0A 4OYWA 1Y11A 2J0WA 2E7WA 1HNZF 3PR4A 1U24A 3QQCD 4USUA 5EWFA 1H38A 1OPIA 3VQSA 4C0HA 3PZPA 3RTVA 4DSIA 5DG7A 2FJXA 4OZNA 4W92B 1Y5NB 4DSEA 3HSZA 3GSDA 4I64A 3NNAA 1B0TA 3HMJG 4LRBA 1RWOB 4U67Q 4Q45A 1X5PA 5IT0A 3MCMA 2BOPA 3OR1B 2I38A 4DUYJ 1VCTA 4C48A 3J81U 1KQGB 1LK7A 4IH7A 3SCJE 2IRUA 3DM2A 2CQ1A 4J91A 2KVQE 4WXWA 5KTQA 1F0XA 3JTOA 1N33F 2HGLA 2F40A 2UXCF 5B7WA 1JQGA 4DR5J 2O5DA 2VBYA 2A1BA 5KT7A 2DR8A 3ENQA 2WVBA 1T03B 2YY3A 2BRKA 2OPSA 4QPTA 4DV1J 1VK3A 5KFWA 4KTQA 2VASA 3AXMA 3MPVA 3VAHA 2MZJA 1IJFB 5LSOA 3GTYX 1MROA 5BJRA 2IC3A 2ZHBA 4LBHA 4O44A 4KKOA 4DR2J 2APOA 1VQ9S 2M4MA 4J9LA 5A6PA 3SYZA 1WACA 3W60A 3E8OA 2QFIA 3D4JA 2R7SA 1WHXA 1GMWD 1U2FA 2G1DA 4LFBJ 1T05A 2ZDPA 2DXDA 3DKDA 4Y34A 1QLNA 4QIGA 3QO9A 5IFMA 3C8YA 3JSRA 4ZLNA 5THWA 3J7YI 3FQLA 4JI5J 3TYTA 4UW2A 5HMWA 4TU8A 1RU1A 1FE0A 3PFOA 3DOKB 1UJ4A 2B4VA 3LGNA 1YHQS 3FBCA 1VHIA 4AXIA 3G8SA 2UVVA 1KN6A 2DD8S 3FZBA 3RZAA 2EK6A 3MR2A 1M5VC 1TR0A 2OP5A 5KFXA 2DH8A 2DPIA 4P71A 2IY5B 3EVWA 3HSGA 1TL7B 2RSQA 1JLBB 2XGQA 2F3JA 5K8PA 4V19J 2GQCA 1IXKA 3CULA 3K5OA 2HLUA 3GJTB 3JYTA 2QLWA 1E6YA 1GTHA 4P72A 3A4TA 3SDEB 4G3IA 1L3TA 2R3VA 3QZ8A 5GVQA 1KTQA 1S1XA 2MQNA 1TAQA 4UY8T 1A0OB 3FCVA 4M5NA 4KT0C 1NDKA 2HAIA 3M6WA 3GG0A 3RBEA 2LDYA 1V5IB 2GO9A 4GC6A 4BC7A 3W9JA 3Q8RB 2DISA 4O3NA 3H2UB 1M5SA 3I9ZA 3BH7B 5KFJA 4ZCKA 4ZHRB 2HZCA 1LOUA 2GZOA 4RW6B 2ZH4A 4WXOA 2CQCA 4CO4A 3IR6B 4LF6J 3AODA 3US5A 5AE1A 3DOLA 4X65J 1QUVA 2W25A 2J9DE 1IBKJ 2AKWB 3WIVA 2PD1A 4U7UK 5ETKA 4AL7A 2ROEA 5GAGU 1N52B 4PWWA 2ATCB 4RNHA 5FLXU 3P3DA 2OJ3A 5KG2A 3K5NA 3ISND 4H4OA 5HSPA 4M5LA 4B9TA 5KFYA 3QLHB 3T5HA 5K9FA 3MM9B 1TTHB 2GQ2A 3J7ZT 4DUYF 2B5JA 4RWWA 2MQOA 3R1LA 5KFAA 5L1IA 5KFSA 1TFWA 2DYAA 2E1CA 1FE4A 3W65A 4PXCA 4M95A 1Q8KA 4CCHA 1HQUA 4ZVPB 2CQDA 2H48B 2P5VA 2JOQA 2BW2A 5M2PA 3JAMU 2WBRA 4DR5F 1QM9A 3O6QA 4DZDA 1IQTA 3G4SS 1RT4B 2R2RA 4DV1F 3Q86A 2BR0A 2JFDA 3KXDA 2YX4A 3HZGA 3QMQA 4X4PA 3RBZA 2VG5B 5DDOC 4DR7J 2R7UA 3R2CJ 3MEEA 5D3GA 2ILYA 2ZJRQ 2FJDB 3EXCX 2VV5A 3K2YA 2BW7A 1X5SA 2I9SA 4LVNP 3E01A 2D41A 4WJBA 2E1MC 3CD5A 3FUYA 4BWMA 4RR5A 1H3DA 2CKWA 5AXKA 1W2BR 3AA8A 2VKRA 4LFBF 2EWHA 2OGUA 3PVXA 4A8OA 3DRPB 1N36J 1RUSA 1WC0A 3IBWA 1GX6A 1NZ8A 3VZHA 3HVAA 2MZQA 1S49A 3L09A 4JI5F 2FZKB 3O44A 4YN3B 2OO4A 5SZTA 1BXNA 3MWBA 3G2XA 4FXWA 4KV8B 4YR0A 2RJZA 1CVJA 1FESA 3DGPB 4LR7A 4ZVRB 3ADAC 5GAEU 3DHXA 1MU2B 1XJWB 3U02A 4GKKJ 3N79A 2JWNA 3H98A 4PXBA 2XMKA 4CWBA 1SUQB 2DHGA 3PKMA 3QBCA 1TUWA 5I4MA 3SSQA 2Y0SD 1IKWA 4UUXA 1FDDA 2A0FB 2ZE2B 3GB0A 2X3GA 5M2UA 2XWYA 3NCPA 4WWSA 2QGFB 2HS4A 4WZMA 4B9LA 1WC3A 2VFTA 1UMJA 4DQPA 2E1PA 2XZWA 2DXEA 1RZMA 2Z2LA 3GQCA 2ZZNA 2MZ1A 2DKOB 2XZDB 2HVEA 1YRUA 3ICLA 2E5LF 1RWWB 2HAFA 4DS5A 4MIBA 1M5OC 2IMWP 1OY6A 1C2PA 2QN6B 4DOZA 4CM2A 5DQHA 2FHJD 2IDEA 4KHMA 4ITSA 3MECB 3UNYA 1VI7A 1HW9A 3A8KA 2VPXB 1RA6A 2P6SA 3CCWA 1T9XA 2KL8A 4LF6F 4CNYA 2ILZA 4DR6J 2Y1IA 1IBKF 2CZ4A 1ZM9A 3ZFVA 5KG6A 2CPIA 3RRGA 4ED6A 3TAMB 2XS7A 1ZA2B 2B9EA 2WB4A 4LF8J 3AOCA 1SPBP 3TNVA 5CD4H 1SQGA 2C3MA 2CQ2A 2F4FA 5DG8A 2UVUA 2E5IA 4DI6A 2FJEB 3PEHA 4OZ3A 2FQQB 3K8WA 2CG8A 1T02A 4GVLA 4TNOA 4GVBA 4Y6IA 1UZHA 1RLCL 3AXKA 2NUHA 4UT4A 3OSPA 1MW7A 2W2MP 2NZCA 3W2VA 2MGZB 2W01A 3QFWA 4DR7F 2KJWA 3NOGA 3HHLD 3JQJA 3DM2B 1CEZA 2AYMA 1GXUA 2KJVA 3UE2A 3GIKA 1LWFB 3DLEA 1HBMB 1LEOA 3VZIA 2NS1B 3KDNA 2CJBA 4WU2A 1UW9A 4GO5X 3M32A 3I5BA 8RUCA 3S8SA 2OPSB 1JNZB 4C3LA 2JLEA 2Q43A 3BGLA 3QWUA 4YB7A 4ZITA 5CYMB 3M8ZA 3V6KA 1YDLA 2PN6A 1IKYB 3D6MB 1BQMB 3AY0A 4CNZA 7AT1B 4IFYA 2XC9A 3LTOA 2RE1A 4JV1A 5GAHU 2GGPB 2J0XA 3WIUA 2B56A 4RNOA 3BEGB 4X66J 1F6TA 3FSIA 4H54A 5H9FJ 2DIVA 4RO0A 1T05B 4GKKF 1RAEB 3H4BA 4PKDB 4ZK7M 1TQLA 4DUTA 2FY8A 2YNFA 1I3OB 3ITHA 4Y2IA 5L46A 2DGWA 3MFHA 1W25A 3OHAA 3H40A 1NH8A 2DGXA 4Q44A 4HH1A 3SQOP 2GMLA 4X64F 4OZ1A 3RB4A 1Y3JA 2BKPA 3J7Z5 3MF5A 3EWGA 4OZ0A 5E3CA 1LFPA 2KB2A 2YWKA 4DQQA 4MT1A 1R0CB 1RBAA 1WG5A 3SFUA 1Q86T 3DLJA 3FBFA 2QE5A 1YLXA 4EMDA 3I0SA 3I4HX 3DU5A 2ZOFA 4ZP8A 4DPYA 1HMVA 4F3QA 4KH1B 4CM0A 3I9V9 3UD4P 1Y5IB 2GO8A 1TKXB 5HBMA 1N6QA 2MB0B 3JYTB 1SQFA 3K89A 1FRJA 1E6YB 1FFWB 3M2VA 4EYHB 3UN2A 1UVMA 1YTYA 2WVDA 5GADI 1HNWF 1RCOB 1U1NA 3UVJB 3MMBB 3BSCA 2MKYA 1B3TA 4I7FB 4DX5A 4DR6F 1I5OB 1M0SA 1EARA 2YWHA 4EWTA 2F65A 1N4LA 3Q8SB 2J9CA 3RBXA 4CQ1A 2CJXB 2V2VA 4F0KA 2NYHA 4YEAA 1YX2A 2DGOA 4I56A 3Q2TC 5KFTA 3UNGC 2W4DA 1NJZA 3G82B 4WFXA 3KOAA 4NLSA 1KHWA 2YX1A 2ABYA 1Y00A 5DZ6A 4ELUA 5F8IA 4EFAC 4G1QA 3M8QB 4KHPJ 2FUG9 3RB6A 3T9NA 3M8SA 2MZSA 3R5BA 4I2QA 5EWGA 1GX5A 2WHOA 1LWCB 3I55S 2V4JB 1RJJA 1HR0J 5A8KA 3ZNUA 2RU3A 2Z30B 4Q0BB 4OI6A 1QE1B 4GC7A 2B0GA 4DPWA 4B3TJ 1OO0B 4AFFA 5F8GA 3WDOA 5GMEA 3ISNC 2BABA 2BE2B 2XM3A 4NYOA 3TJ8A 3OFHA 3RRKA 1T9YA 5IV3A 2LLZA 2C2ZB 2OEJA 4E0DA 3GPAA 2XLJA 1HBUA 2JHEA 3CW2C 1T3OA 4ALZA 5RUBA 3BQ0A 1MMDA 4B08A 4DG1A 3MR7A 1DURA 5D3GB 1GXLA 3C46A 3BYPA 4ER8A 1H74A 2KH9A 1WD6A 4YDDB 2K3IA 3E01B 2BJ8A 4RNNA 5K14A 3CO0P 4F4YA 4KGXB 2E9ZA 1MMLA 4X66F 1X4GA 3HCXA 2C2OB 3T1YJ 1R8PA 3I0RA 2HHWA 1UWBB 4ECQA 1FX4A 2RQCA 1JLAB 3CMES 1FRKA 1VQKS 3QGIA 1WC5A 2HNZA 1SH3A 3LP1B 4DV7J 3M30B 1Q53A 4PYDA 4OYOA 3CVKA 4JI1J 2Y1JA 1G3OA 2IJNA 2FVRA 2H9ZA 2HVDA 3QT5A 3C14A 1GK8A 1RBOB 4LRDA 4EBEA 4MKBA 4DFPA 3W1YC 2KU7A 2HFNA 5F0WA 1LV5A 2HHUA 3V2UC 3R5AA 2CWXA 3IR5B 3ONQA 2VA3A 3PYEA 4BC9A 4NI2A 1HD1A 4DQSA 1RT6A 1R6VA 2FLNA 1CS4B 4OZJA 1P8GA 4WFBQ 3QJPA 2ZKTA 3ETOA 4K4VA 2MZRA 3N5BA 2IPOB 3IS9A 3ZZUA 5FDLB 4Y2KA 3M9NB 1BMQB 1HA1A 3KLGB 5HLFB 5KFHA 3M9OB 3OVSA 3IWXA 4I6AA 2IDLA 5GMKa 3MHYA 3OUYB 3SQGA 4WFNQ 4KGMA 3GV7B 3ILIA 2CWKA 1ZM3A 3W63A 1YZ7A 1JLGA 3NKYA 4ECYA 3W9HA 4G6VB 4ES3A 2YNIA 1S9GB 2JC0A 1FWKA 1SKRA 2Q66A 3BO3A 3GFHA 2CZ9A 1XMBA 4H4MB 4OFZA 3ZZYA 4ZVGA 2JX2A 3H7HB 1DAXA 4GMKA 4KFBA 3EGWB 1BUXA 1WOPA 1FFGB 3FEXB 1T9WA 3RRHA 1LFWA 4DCOB 2IIHA 1IVZA 1X31C 2DNPA 3GYGA 4LFAJ 1U6FA 4F2SA 1ZETA 2GJFA 3NCRA 5K20B 3DOMA 2CDRB 1FK9A 4KE5A 4FYXB 5C2GA 3TO8A 3QT6A 5KFRA 4IOCQ 4KHPF 5CA5A 4QQBA 4FF4A 1I1GA 2W4PA 2LXFA 5E3QA 4C8MA 1HR0F 2UUBF 1H72C 1NZAA 5F9LA 1YBAA 2JLGA 4LT6A 4CLTA 5HMYA 1LK5A 2VFSA 3CCES 3M05A 4TN2A 1MWZA 3MPWA 4B3TF 3UCGA 2W2OP 2B4PA 3D28A 2VIHA 2AJ2A 2PI4A 1SIZA 4ICLA 2MEWA 1TV6A 4P10A 1S1WA 2RT3A 5D77A 3FC9A 4Y0FA 2HRYA 5DETA 3U27A 4QWEA 4DF8A 2HBRB 5LJ5Y 4DV5J 4IRDA 4IH6A 1Q8IA 3BSNA 5D0RA 3FBBA 5DQIA 5I3QA 2RNEA 2QMXA 2KYXA 1HHTP 4CO0A 4USHA 2HVZA 2QZ8A 5KG0A 1QAYA 1VC0A 2WVFA 2YKNB 5H1SV 5IQ6A 2QLXA 1P6TA 4OQJA 1WTBA 2XULA 2PEBA 1NU4A 2MYFA 2E5GA 5G0RB 5J2NA 4KJIA 4ZPBA 1FRIA 3CDEA 1N8RT 1REVA 2J8AA 1EHWA 4Y00A 3T1YF 3HHLC 3EM1A 1JLQA 3KMQA 3IP0A 4ZLLA 4FYWB 3KLIB 4RUBA 3GV8B 4DV7F 3UW1A 4F4AA 4LREA 1SL0A 4JI1F 3J80U 5HL7Q 3I31A 3ZC4A 1S79A 5T14A 4YB5A 1NK4A 3AJ2A 1VBYA 4IFYB 1QD1A 4M94A 5KG7A 3OJSA 2CQ4A 5L9NA 4FP9A 1FXRA 2GJIA 1OMSA 2GC8A 2GFFA 1F9FA 4KQZA 1AROP 2UXBF 4B17A 2FLLA 2LCWA 3RGIA 3V6HA 2MXYA 2OIHA 5A8RA 2DH7A 1FDNA 3X3UA 2KT2A 2BOAA 1S6PA 2DB1A 4MKAA 2UP1A 3LALA 4E2FB 4ENOA 2DITA 3Q8PB 4ECRA 1RWXB 1H98A 2BJ1A 1SJ4P 2KT3A 2JEIA 4B9VA 3Q8YA 5KAKA 4JI3J 1S59A 2Z4PA 4NPOA 3LW5C 2JVRA 3NXZA 1NCLA 1HMVB 2E44A 2HBYB 3GFXA 2PI5A 4QIVA 2NSCA 2XZTB 2HWIA 3HSDA 4KB7A 3HI9A 4EK2A 2P8IA 3NBPA 4YQWA 4FYDA 2CZVC 4L75A 2M3DA 1AZSA 3ZTSA 1YJNS 3CC7S 4ZVHA 3PX0A 3HDSA 3I87A 1QAJA 5A2QY 3MM7A 3DLGB 3U1NA 2HHSA 1VQ8S 2L41A 4JV5J 1HWUA 1UEKA 3LPYA 2HVIA 4ID8A 1FTCA 3OT9A 1IKVA 5KT5A 1C1CB 4HTJA 3QGHA 3TUJC 4ECSA 3MFIA 1R3NA 2WCXA 3LUYA 2MKJA 2XO7A 1Y10A 4X4NA 1LWEA 1HWJA 2KDOA 4USIA 3H25A 2C2DA 4WKYA 4L76A 3ULHA 2YNHA 4F36A 2XI3A 2XWXA 3MMAA 1WEXA 4LF1A 5DDQC 4CO3A 1YBUA 3MOZA 3R5JB 4AQYJ 4I2QB 3CJ4A 1CJVA 4MYTA 1CC7A 1EJ7L 5A8KB 3EUNA 3KJQB 1VRUA 1EETB 2GA7A 2NYIA 4OI3A 1IBMJ 2XLKA 1KOHA 1S6OA 3MM6B 1NDCA 4K5RA 3EICA 4HR2A 2CPZA 2LXUA 4X4OA 4RKUC 5E41A 5E2QA 2BKOA 2KG1A 1JKHB 2HIYA 4WIQA 3KHHA 4HT7A 3GYXB 2H5JB 2ZC3A 2DHHA 4YMEA 3UQSA 3UD3P 2OHDA 1VQ7S 4KPYA 4WCEQ 4K2JA 1ZAXA 2NXNA 4U96A 3D1QA 1HHQA 2HPUA 3K5LA 1BQNA 4WZQA 3P96A 3RU0A 2NUUG 2VG7B 3IG1A 2G0IA 1WHVA 4ZPCA 4C8OA 1X7VA 3W2WA 1BWVA 3W5YA 1CLFA 1QTMA 1SKWA 3GZ7A 1PC4A 2ZH6A 3B6BA 5KT6A 2D69A 2D3OR 4DFKA 1TELA 2HNZB 1H7XA 3WBZA 2OKQA 3BGRA 4DV3J 3TUZC 4WBFA 4DL6A 1JLCB 3TAPA 4LBIA 1Q7YT 4FYYB 3VAIA 4CDIA 4E98A 5IXUA 4F25A 4OYIA 4ZPVR 3PW5A 2ZZMA 2D7SA 1SB6A 1RT5A 4Q43A 3DRRB 1YJWS 1Q16B 1LKZA 1RWKB 3CXCR 1RWPB 4YP3A 4NI2B 3UCUP 3VALA 2DJWA 3FRZA 1N32J 4A8FA 1RT6B 4ZIWA 4DX6A 4OLPA 6FDRA 2RF2B 4YDXA 4BWJA 1PO6A 4HTIA 1DLOA 1RHUB 2P9EA 1SH2A 2QT7A 1HWIA 2B4UA 3QT8A 3IS9B 1AYEA 2XTJP 3ISZA 5F3ZA 1JJ4A 4CRJA 3FFIA 1VJWA 3SI8A 2NXCA 4JOUA 3W5XA 4QOTA 1ZOTA 4JV5F 3IGVA 1Q95G 3O1LA 4ZLPA 1JLGB 2ZNZA 2YNIB 3VV2B 5BXIA 1R43A 1RT3B 3GFZA 2CQ3A 2QMWA 1L3SA 2XO6A 2NZ4A 4A8QA 2ZKUA 3GLJA 3NWRA 3CDAA 1U0HA 1C4CA 4NRTA 2DGSA 4B9SA 2H51B 3BKFA 1VRQC 2V8VA 2C22A 3K7RA 3AOBA 2EG2A 2CQBA 3PG9A 3TZWA 2VG6B 3FQKA 4B3OA 2PFFB 3D0HE 1U7LA 2CJYB 3KK3A 4BLGA 2MKHA 3HHLA 4AQYF 2FLOA 3DDNA 4CT8A 1B4SA 3R5CA 3HJVA 2LP4A 4A8MP 5D4NA 2V2QA 2PMHA 1IBMF 2ZBIA 5IOLA 2FC9A 1OWXA 3L95X 2CJ9A 1R8HA 3TWZA 2VODA 1PJ5A 2ZVIA 3B8HA 5ETPA 1S1WB 2RS2A 2Z58B 4QPXA 3DDIA 2JNJA 4ZJOA 1UFWA 2FD2A 1EKSA 1NPKA 3OFGA 5KG5A 1VRTA 2W9BA 3ZZPA 5CYJA 1RACB 5K8NA 5ETTA 2QSWA 1PYOB 2LEPA 5DG9A 5EGYA 4XAKA 4B3MJ 5F9NA 2VH7A 2IFXA 5J2NB 2J76E 2FIUA 1TUVA 3UI3A 1EQ0A 2DCUB 1J5OB 2AZ1A 2HRTA 3OBIA 2W8LA 1S1VA 1FD2A 3CJSA 3FRYA 2J9DA 1H2VZ 1S9EB 3VHQA 4J9UE 2QYCA 2PA3A 3MMCA 2HNDA 3NRBA 2DRBA 1RAFB 3R2DJ 3LAMA 3M8PB 4ES2A 1UKUA 3RR8A 3T41A 3W5ZA 5C24A 4K8RA 4X62F 1BGXT 2XMUA 4DQRA 3G96A 2G2YA 3TZXA 2XNRA 2G9OA 4USKA 2FPHX 1TKTA 1H2UX 4L72B 4A8KA 2W9CA 3JSYA 5U47A 4Q2LA 2I5JB 1HNVA 1RTJA 3A8EA 4DX7A 1HNXJ 2Q3PA 4OV1A 2ALZA 3OLAA 1G2EA 1S12A 3OR2A 4FS1A 1Q7LB 3R6GB 5E3PA 3MCSA 8ATCB 4DCPB 5HQLA 4RW7B 1U09A 4PQUA 2Z8QA 1KR4A 3QYYA 1TK5A 4DL2A 4OI4A 2DRDA 2ZH7A 4HYKA 2EBEA 3CGIA 2PSZA 1M5PC 2NPFA 1URRA 4EI2A 1GT8A 3TUIC 5M2RA 3PW0A 3GCWP 2OPQA 4EZ6A 2M0GB 5K8OA 3KK2B 2LQ8A 4O4RA 3H8YA 2XG8A 4F04B 2VF3A 2WTFA 3KJVB 1K9MT 1DJ0A 4ILRA 3PJ9A 3HXMA 2QFJA 2DNHA 2L3MA 3KYLA 5HO4A 3NBPB 3IBFB 3RAQA 1URNA 2DVIA 2V68A 4Q5VA 1S7IA 4P75A 3AOAA 3OR1A 3UN3A 2ZC4A 3MAAB 2W1BA 1ZA1B 4S0MA 4IG0B 2QG9B 2CVIA 1JJCB 3ZTPA 2V9WA 3FCHA 4P2XA 3H4DA 3K17A 2HQIA 2ZH5A 2DK2A 3R27A 1GEHA 4PG6A 2XYPB 1T03A 3FVYA 4Q8FA 2W4CA 4W98A 2IYGA 4JI7J 2CPYA 4O3PA 5KFIA 3MPUB 1M5KC
chains in the Genus database with same CATH topology
3G82A 5D15A 1CS4A 1YK9A 1CJVA 4CLUA 4USWA 3UVJB 4CLZA 1WC1A 4OYOA 4P2FA 4OZ2A 5D0RA 1CJUA 4P2MA 2W01A 4CLPA 1CJKA 1AZSA 4USTA 1CJTA 4CLLA 3C14A 5IV3A 4CLFA 4WP3A 2GVZA 3C15A 4CLKA 1TL7B 3C16A 4OYZA 2BW7A 4OYPA 1CULB 4OYIA 4NI2A 1AB8A 4CLYA 1U0HA 4CLWA 3MAAB 4OYWA 3G82B 1Y11A 1CS4B 1WC3A 1WC4A 1CJVB 5D0HA 3MR7A 3UVJA 3ET6A 4USVA 4USUA 3C16B 1CJUB 4CLSA 4CM0A 1CJKB 4P2XA 1AZSB 4WP9A 3R5GA 4NI2B 1CJTB 2GVDA 3C14B 1U0HB 5D0EA 1WC0A 1Y10A 1WC6A 5IV4A 1YBTA 2GVZB 3C15B 4CLTA 4OYBA 3ET6B 4OZ3A 4WP8A 4WPAA 5D0GA 1FX2A 1TL7A 4CM2A 1FX4A 2GVDB 1CULA 4OYXA 2WZ1A 4OYMA 1YBUA 2QV6A 4OYAA 1WC5A 3MAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G82 A;  5D15 A;  1CS4 A;  1YK9 A;  1CJV A;  4CLU A;  4USW A;  3UVJ B;  4CLZ A;  1WC1 A;  4OYO A;  4P2F A;  4OZ2 A;  5D0R A;  1CJU A;  4P2M A;  2W01 A;  4CLP A;  1CJK A;  1AZS A;  4UST A;  1CJT A;  4CLL A;  3C14 A;  5IV3 A;  4CLF A;  4WP3 A;  2GVZ A;  3C15 A;  4CLK A;  1TL7 B;  3C16 A;  4OYZ A;  2BW7 A;  4OYP A;  1CUL B;  4OYI A;  4NI2 A;  1AB8 A;  4CLY A;  1U0H A;  4CLW A;  3MAA B;  4OYW A;  3G82 B;  1Y11 A;  1CS4 B;  1WC3 A;  1WC4 A;  1CJV B;  5D0H A;  3MR7 A;  3UVJ A;  3ET6 A;  4USV A;  4USU A;  3C16 B;  1CJU B;  4CLS A;  4CM0 A;  1CJK B;  4P2X A;  1AZS B;  4WP9 A;  3R5G A;  4NI2 B;  1CJT B;  2GVD A;  3C14 B;  1U0H B;  5D0E A;  1WC0 A;  1Y10 A;  1WC6 A;  5IV4 A;  1YBT A;  2GVZ B;  3C15 B;  4CLT A;  4OYB A;  3ET6 B;  4OZ3 A;  4WP8 A;  4WPA A;  5D0G A;  1FX2 A;  1TL7 A;  4CM2 A;  1FX4 A;  2GVD B;  1CUL A;  4OYX A;  2WZ1 A;  4OYM A;  1YBU A;  2QV6 A;  4OYA A;  1WC5 A;  3MAA A; 
#chains in the Genus database with same CATH topology
 2KKH A;  4OV6 A;  3KUE A;  1S10 A;  1Y3K A;  3M9M B;  3JS9 A;  4FPI A;  3KMS A;  3OTD A;  1U1P A;  3VTI A;  1PGZ A;  2OEM A;  3AAW B;  1ZAV A;  4C2M A;  4XK8 C;  4L73 A;  1NLK L;  1TL3 B;  3FK4 A;  3OTB A;  4IO9 Q;  2LEA A;  2ZBC A;  3U1L A;  2VU5 A;  3D0I E;  4OJG A;  4ED3 A;  1FVQ A;  4ZPD A;  4AL5 A;  3P6Y C;  1GAO A;  5F8N A;  4RW4 B;  4B3M F;  1NHV A;  4NLP A;  2F8H A;  4YOE A;  2MY7 A;  2K1R B;  4EO8 A;  1RHQ B;  4ZVU B;  4C11 A;  3ZZ0 A;  5KFB A;  4OZ5 A;  1E6V A;  3AD9 C;  4R0E A;  2V34 A;  1SBR A;  1R0A A;  2XMV A;  2HQ3 A;  1TL7 A;  1RKJ A;  1JLB A;  2FVQ A;  3SIP B;  3KWM A;  3FNN A;  2CNO B;  1B0V A;  5LXY A;  4OYA A;  1X4C A;  2QIF A;  1T9T A;  4L3N A;  4DUZ J;  4UZB A;  4EBC A;  1FJE B;  2PE8 A;  2R7W A;  4EU0 A;  3MUV P;  5IS2 A;  4IUF A;  1SIW B;  3BO2 A;  1NM2 A;  2CUY A;  2ZH9 A;  4OZL A;  3CE8 A;  3G71 S;  4QWB A;  3W2W B;  1KP6 A;  1HNX F;  4B3S F;  3W66 A;  2YKO A;  3HVT B;  5IC6 B;  3OLB A;  4P9S A;  5A0Y A;  4B02 A;  1WOO A;  4Y28 C;  2K3K A;  2FYX A;  1RTD A;  3BQ1 A;  2M8D B;  4LVO P;  1VR6 A;  1S4E A;  1RT1 B;  1BQX A;  2ZEJ A;  3PHT A;  4ZHR A;  2EXU A;  4XDC A;  1FKP B;  1GXT A;  1RWM B;  3RR7 A;  2C3P A;  1RT5 B;  5GAG I;  2H65 B;  4NAS A;  4ZVQ B;  2NLW A;  2QV6 A;  2ZD1 B;  2LQB A;  4NEY A;  7FDR A;  4U7C A;  2MKI A;  3MOJ B;  3NAH A;  4WTO B;  4MAK A;  2NQP A;  1F2G A;  1Q5Y A;  2AQ4 A;  2N4C A;  4IG3 B;  1NKC A;  1VQ5 S;  4C8K A;  2ZVS A;  4U6P A;  2KFZ A;  3MM9 A;  2ZH3 A;  3J7A N;  4DV0 F;  4USM A;  4YHH J;  2R8K A;  3TA2 A;  4DXL A;  1OQ3 A;  4F50 A;  3MEK A;  3CJR A;  5DM6 Q;  5KFG A;  4B9U A;  4QYZ J;  2LA6 A;  5F0U A;  2QA4 S;  2QA4 G;  1VBX A;  4FKY A;  4ZPW R;  4NMX A;  2XY7 A;  4RBT A;  2HG4 A;  5KFF A;  3G9C A;  4OJ1 A;  2WSC C;  2FDN A;  2M2B A;  4OJH A;  3G8T A;  5C7P A;  4Y65 A;  1RT4 A;  2CAD A;  1U0H B;  2DGQ A;  2DR7 A;  1RAB B;  2D1C A;  4NEZ A;  4JI7 F;  1MG7 A;  2VPZ B;  2VG5 A;  2W2P P;  5EWE A;  3KG4 A;  2W7P A;  4X4R A;  3TJA A;  2MLX A;  4TVA B;  2E29 A;  4CH1 A;  3D6H B;  1UJ6 A;  3QT7 A;  2CPE A;  2UVR A;  3DFE A;  2Y0B B;  2P2C B;  1N33 J;  1J2V A;  1PSD A;  2W24 A;  2XI2 A;  2CXE A;  2OFG X;  3MMJ A;  2KVI A;  2YQ1 A;  2ZHA A;  5KT4 A;  1U2C A;  2HS3 A;  1XNQ J;  1ZZN A;  2YWW A;  4NCA A;  4OX9 J;  4XIU A;  3NY0 A;  2DR5 A;  3PM9 A;  2G0J A;  3IRX B;  1RXO B;  3T5L A;  2FVC A;  3O8W A;  5GAE I;  4ZA1 A;  3POT B;  5K8M A;  4ED4 A;  4KV8 A;  1WEZ A;  3DGP A;  1JXV A;  1D9F A;  3NG8 A;  5FII A;  4QR1 A;  4C8L A;  2FJW A;  2HFZ A;  4NXM F;  1JNR B;  4YUD A;  4CLS A;  3LOU A;  3T6J A;  4XPC A;  4JYA J;  3BGO P;  4N77 A;  2LXI A;  1SUQ A;  1NND A;  1VRT B;  1ZBT A;  3QSY B;  5LMN F;  3PIP Q;  4ZN3 A;  2W9B B;  2DEI A;  1TL1 A;  2WOM B;  3HFV A;  1FT8 A;  4KO0 B;  3U7J A;  5C5J A;  2QMU B;  2ZE2 A;  4P6Q A;  2QL9 B;  3QJL A;  3IRW P;  1Y5L B;  1KLN A;  1S1V B;  5AXL A;  3MTK A;  4A8Y A;  5DGB A;  4AXJ A;  3NGD A;  4WYW A;  5I3U A;  2VON A;  1V3R A;  3MMC B;  4NLY A;  1TZ0 A;  2R7V A;  2FHM A;  5D4L A;  3K59 A;  1DFD A;  4TYA A;  1RU2 A;  1KKH A;  2AGP A;  2HIQ A;  5C24 B;  1NHK L;  2JC1 A;  4KRW A;  1HYS A;  3V6D B;  4ZCL A;  3M4X A;  3VAM A;  3EZ5 A;  2C28 A;  3IM8 A;  5IWA F;  3I5C A;  4LRF A;  1ZYQ A;  1AW0 A;  1TKT B;  3G8Q A;  5LM7 E;  1LXJ A;  3SCL E;  2OMO A;  3BZQ A;  3MEC A;  1NSK L;  2W7A A;  3VAK A;  2HW3 A;  4UUW A;  4QU6 A;  2RRB A;  2HQD A;  3IBC B;  4Y2M A;  5KOW A;  1WKJ A;  4URG A;  2RML A;  1RTZ A;  4WF9 Q;  3TAM A;  4RUH A;  1UVI A;  1JXE A;  4LF2 A;  4E8U A;  4PQU B;  3UDE A;  2R9L A;  3TRG A;  2C2M B;  4KH0 B;  4EYI B;  4DR3 F;  4KC5 A;  5B0F A;  1C1B A;  4DL0 C;  1SKS A;  2LKZ A;  4UOH A;  3C66 A;  4J9S A;  3SBM A;  1ZM4 A;  3KLV A;  1HBN A;  1UP1 A;  4DU8 A;  5KFD A;  2OUG A;  4Z7C A;  1NRK A;  3KNG A;  5KFM A;  3PHE A;  2RIJ A;  4DSF A;  4W90 B;  1XER A;  4RNM A;  4YB6 A;  1LXN A;  2FZC B;  4WFY A;  3OL9 A;  1AFI A;  3CJ8 A;  1X4F A;  1NPR A;  4FPR A;  3ENV A;  2YNG B;  3K8V A;  1PIE A;  4MK8 A;  2B7B B;  4ZMM A;  1FKO B;  3FSX A;  1ITP A;  2RUS A;  5I3P A;  2IBO A;  4N41 A;  3PYG A;  4C97 A;  2K7J A;  3PO4 A;  4K50 A;  1O5J A;  3AQO A;  1Q81 T;  1WOR A;  1YJV A;  4YY3 J;  3CCR S;  2MGZ A;  3DMJ A;  4ZLJ A;  3VGU A;  3TP2 A;  2GMJ A;  1IKX A;  3B4D A;  1GQE A;  2KZM A;  3QNW B;  5CHC B;  1LWF A;  1HBM A;  4A46 A;  1CPZ A;  4ZVS B;  4NRU A;  1XNQ F;  1S9F A;  4QZV B;  4C4W A;  4LRA A;  3N5F A;  2B7C B;  4OX9 F;  5LSR A;  3HLU A;  1AA1 B;  2H5E A;  4PYA A;  2CDQ A;  1VLO A;  3AJ1 A;  2NCK L;  4CIO A;  2DO0 A;  3CDW A;  2XY5 A;  3ZZR A;  5CYM A;  5GAH I;  3EPI A;  5KT3 A;  3BBB A;  1OS5 A;  1XC9 A;  1O8B A;  3NWG A;  3JSM B;  1IKY A;  4CLF A;  1BQM A;  4ECX A;  2E1R A;  1SCJ B;  3W7B A;  2R7R A;  3WZ0 A;  1EX8 A;  3GR0 A;  1GMV A;  4M5J A;  2QLJ B;  2GGP A;  1SC3 B;  1RYR A;  2MKS A;  5F3T A;  3VVT A;  2AEJ A;  2GV1 A;  1IR0 A;  5T41 A;  4J9R A;  2P9C A;  4JYA F;  2PC6 A;  2XCA A;  1FNO A;  1Z1Z A;  3PRB A;  3S1T A;  3BQ2 A;  1GNK A;  2DIU A;  4BHQ A;  3CCM S;  1ZS6 A;  2LMI A;  1RDR A;  6AT1 B;  4HH0 A;  1RWU A;  2DNO A;  4WP8 A;  4WPA A;  2H54 B;  5LL6 d;  2PO4 A;  1N88 A;  4C11 B;  1FRX A;  1E6V B;  3UPF A;  3EPG A;  2VOP A;  1R0A B;  5EHH A;  4ECT A;  3D68 A;  4OLO A;  3T1A A;  1F1B B;  4QBU A;  3KTQ A;  1PJ7 A;  3DLL Q;  3EE3 A;  3WX8 A;  4L3K A;  4LF5 J;  4TYB A;  2CJK A;  1NK0 A;  3A1Y G;  3D7S B;  2OSQ A;  1TKX A;  3LQV A;  4CO2 A;  4ZOS A;  2I6W A;  3P45 B;  5E3A A;  2HBZ B;  1HQE B;  4Q7A A;  3DXB A;  1APS A;  4QR2 A;  2YKP A;  2O3D A;  1U1L A;  3BBF A;  1HWK A;  2MQQ A;  4NLU A;  4M5D A;  4IDK B;  3UVJ A;  3MMB A;  4JI4 J;  4OHY A;  1UFL A;  4P2S A;  4I7F A;  3C3L A;  2GIQ A;  5LMU J;  2E5L J;  2ACM A;  5A0Y B;  1FRL A;  3HF5 A;  3R6L B;  1RQ0 A;  1CJT B;  1X60 A;  4IRC A;  3D1H A;  2WVE A;  1RTD B;  1DTT B;  4OX6 A;  3H2V E;  3MED A;  2OAU A;  3TX0 A;  2DR9 A;  5DRK A;  4WTY A;  1YZ6 A;  3PJW A;  5EUH A;  2FJB B;  5IZH A;  3ZTO A;  1KWM A;  5ADZ A;  4UF4 A;  3G82 A;  3M6X A;  1H0H B;  1JJ2 R;  2HFO A;  5A2Q U;  3A8J A;  4DFJ A;  1K0V A;  1UVK A;  3M8Q A;  2KTQ A;  4QWA A;  2XGP A;  1V3Z A;  3RAM A;  4ZVF A;  2Z0G A;  4ED5 A;  4NOH A;  2V4R A;  3BGU A;  1LWC A;  2V4J A;  1F60 B;  3VF0 B;  4MMO A;  4Q0B A;  2ZWO A;  1QE1 A;  3PV8 A;  3IM9 A;  5D4O A;  4YY3 F;  5HP1 B;  1D8Z A;  3NOC A;  1FJG J;  1N5V A;  3L3C A;  2BKN A;  3DRX A;  2BE2 A;  1EIY B;  1KTV A;  2DH9 A;  1DY3 A;  4NXN J;  4FXV A;  2XS5 A;  2LVW A;  3A12 A;  1OIA A;  1FEH A;  3HVW A;  3LGM A;  4CYU B;  2OTL S;  2PDA A;  4Z2X A;  2X7I A;  1QVG R;  1HPZ B;  1L5U A;  4ZVO B;  4K59 A;  3N01 A;  4OHV A;  3T1H J;  2R2T A;  1N0U A;  5LXR A;  3BSO A;  2Y3Y A;  2HHQ A;  1P27 B;  4HVZ A;  2DGV A;  4TY9 A;  2MJN A;  1GFW B;  3B54 A;  4QJV A;  1NJY A;  2D3U A;  1RTI B;  1NJI T;  2AJ1 A;  1N48 A;  2CFX A;  4DPT A;  6FD1 A;  3AB4 B;  3BKT A;  2YWF A;  2UV8 A;  2IA6 A;  4YFU A;  2IHR 1;  1VJQ A;  4NLW A;  2F9D A;  1UWB A;  4NML A;  2AEM A;  4DV2 J;  1JLA A;  1VC5 A;  3MM8 A;  4J5O A;  3OTC A;  3LP1 A;  3K57 A;  3M30 A;  1RAH B;  4DL3 A;  2AWZ A;  2M88 A;  1NSQ A;  1KD1 T;  1Z2L A;  1NSA A;  1G7C B;  3CJK B;  1FD8 A;  1C0U A;  1HIY A;  3A13 A;  1WF0 A;  5J2Q A;  1SQE A;  2MQM A;  2CQG A;  2EFV A;  1CS4 A;  2F9J A;  4LF5 F;  1TL1 B;  4RL1 A;  2AIR B;  4CLZ A;  3SFG A;  5HRO B;  1FO1 A;  3NS6 A;  4X64 J;  2XMW A;  4UST A;  1FF2 A;  2NXE A;  5HVF A;  1G1X A;  2OFH X;  5FDL A;  4BDP A;  3KLG A;  3B78 A;  5HLF A;  1HAR A;  5I3U B;  4RJV A;  3RJM B;  3OUY A;  4OI1 A;  2WB1 D;  4JI4 F;  4UOC A;  3HSJ A;  4J9O A;  5A6W A;  3D2W A;  3GMG A;  2C2E A;  5C2C A;  5LMU F;  4FNH A;  5L1J A;  2FB0 A;  2X1A A;  2XS2 A;  1S9G A;  1P9Q C;  2BUN A;  2LYV A;  1NDP A;  4DN0 A;  3BV8 A;  1HYS B;  2CQH A;  1YSJ A;  2IMO A;  1MN7 A;  1VYA A;  2KXN B;  4H4M A;  3R5G A;  3TX8 A;  1PKU A;  3HHN B;  3AHP A;  1VIS A;  3CCT A;  2ADB A;  1IM6 A;  1S4F A;  3QRR A;  1HNW J;  1GTE A;  2EEY A;  4DU7 A;  3CJ0 A;  3KLE A;  1ACM B;  2UVW A;  5E7O B;  1SL1 A;  2VC1 A;  3DGV A;  2ZUA A;  4JI6 J;  1DAR A;  2MQL A;  2XCP A;  2ZHO A;  4EGL A;  2QYG A;  2WW4 A;  1U49 A;  4X4T A;  1ZM2 A;  4Y2C A;  4RUA A;  4IH5 A;  1RT7 A;  2V2Z A;  1B70 B;  1C1B B;  2R2S A;  2RQ4 A;  2ZBP A;  2XY6 A;  4ZVE A;  1SKU B;  2R42 A;  2BQR A;  2B9X A;  3KLH B;  1HBN B;  2K8G A;  3W61 A;  4IO1 A;  1FJG F;  2EI5 A;  2DO4 A;  1PIL A;  3GII A;  4PPZ A;  3W64 A;  2BAN B;  3NEK A;  2J7W A;  2E5H A;  1KNZ A;  2LQ9 A;  3ET6 A;  4HHH A;  1X0F A;  4NXN F;  3IR7 B;  4HHJ A;  3HHK A;  5KFN A;  1CJK B;  4GO7 X;  3D6T B;  3T5J A;  3DLB A;  1Q8B A;  5AXM A;  4IR9 A;  2EK1 A;  4C98 A;  4DCJ B;  2FJV A;  2YKN A;  2F8M A;  3T1H F;  3ILO A;  3DMJ B;  4I0W A;  1T11 A;  3E51 A;  1YG0 A;  3GU0 A;  1IKX B;  1WDD A;  5G0R A;  2IM0 A;  2FLP A;  2F1F A;  1AUS L;  2WK4 A;  3EXY A;  1HQ2 A;  4P7T A;  1Q5V A;  3CNQ P;  4USW A;  4X4V A;  2V63 A;  2XYH B;  3DYA A;  4LQ3 A;  1PYS B;  2HNY A;  4C9D A;  2RDJ A;  2DGT A;  3RB3 A;  1ZPV A;  2RUG A;  1ZAW A;  2AEF A;  4DV2 F;  3E3X A;  2CRL A;  4UQG A;  3KLI A;  1TK0 A;  2KFN A;  1VHF A;  2E7X A;  2DY1 A;  3KK1 B;  3I4P A;  2O67 A;  2ZUG A;  1IWG A;  4LMZ A;  1S1U A;  1CJU B;  1JMT A;  2JRS A;  5ETM A;  4N7T A;  2GIR A;  1YJU A;  3G86 A;  3KG0 A;  2HMI B;  3GIL A;  3QPI A;  2M70 A;  1WJ9 A;  2MQP A;  4K5S A;  1T9V A;  4HEA 9;  3EMT A;  4OYM A;  1R8C A;  1U1Q A;  4K4T A;  3OPK A;  2E1A A;  3BGF A;  2PT0 A;  1FRH A;  3V6J A;  2ZH2 A;  3FMB A;  2J8S A;  2FGO A;  4NA1 A;  2WON B;  3B82 A;  1X9M A;  3QGP A;  1K1Q A;  1FHT A;  1FFS B;  4RPF A;  3PY8 A;  1N5T A;  3N4W A;  2OSR A;  2GW8 A;  4O4G A;  3PX4 A;  4I6W A;  3R7N B;  5MLC V;  1N56 A;  2C2K B;  5D6G A;  2OEL A;  1MWQ A;  4OYZ A;  1CG2 A;  1NJW A;  3GV5 B;  2ASJ A;  4FF3 A;  3MM5 B;  1TVR A;  2UZA A;  3CDB A;  2I1R A;  5HMX A;  2CNL B;  3AFG A;  2KI2 A;  4CH0 S;  2UUW A;  2BAC A;  3CCV S;  3UN5 A;  2QLB B;  3DLG A;  4M5D B;  2UXD F;  1I6J A;  1WKK A;  1X4D A;  3RW7 A;  2F5G A;  4ES1 A;  1CBK A;  1S6U A;  3IAS 9;  4V19 X;  4JI6 F;  3GIJ A;  4URS A;  3NGK A;  3LWL A;  1IBC B;  5EN1 A;  1JX4 A;  3MED B;  1C1C A;  1XBW A;  1HKA A;  4WII A;  3F0N A;  2AHO B;  4DX8 H;  4M5I A;  4RU2 A;  1U1R A;  2CPF A;  4NWB A;  3HHE A;  1BY9 A;  2KYZ A;  2QA2 A;  4PZV A;  2OPR B;  3PFE A;  2DY9 A;  2FTR A;  3DC2 A;  2M7S A;  3G6V A;  3DU6 A;  2R8J A;  4WE1 B;  2COL A;  4IKA A;  2OPP B;  2QTW A;  2YWG A;  5CYQ B;  1REG X;  5CH7 B;  1WG1 A;  4OJ3 A;  4FBU A;  1N34 J;  2DXF A;  1KLM A;  4ZCM A;  2U2F A;  5K5M A;  3R5D A;  2LQ5 A;  4HHU A;  4NCB A;  5DJB A;  3DHW C;  1KOO A;  3AD8 C;  2UUB J;  1RAD B;  1EET A;  3PR5 B;  4UOF A;  1NO8 A;  5DLG A;  2N3O A;  2R8I A;  3MM6 A;  1UVJ A;  2CG4 A;  4ED7 A;  3M8R A;  4ILM A;  1U02 A;  3MAQ A;  1U0S A;  4QIW D;  5F8L A;  5KFZ A;  3FKB A;  1KQK A;  1NBE B;  3DRS B;  1RT2 B;  1JKH A;  2H4Y B;  2HHT A;  2LA4 A;  3UO0 A;  1V5V A;  4O3S A;  1OQ6 A;  4DL5 A;  4M5K A;  2OD4 A;  1GH8 A;  4OZ2 A;  2BJ3 A;  3TEH B;  3H5X A;  1WUU A;  4HKQ A;  4PAA A;  1V6H A;  1VQO S;  1LW0 B;  3D5M A;  4ZP7 A;  3K5P A;  4QWD A;  4NZ0 A;  3KLF B;  4O3O A;  2VG7 A;  2VFV A;  1RI7 A;  5J1N A;  2ZNY A;  2RVJ A;  3W9I A;  3FBE A;  4OMF G;  1TP7 A;  2GAH C;  4OL8 A;  2HBQ B;  3H0P A;  4NLQ A;  3MM8 B;  4RNF A;  5ETN A;  3BM7 A;  3D0G E;  1JLC A;  4X4U A;  1JXL A;  5E3R A;  2BXJ A;  1FJC A;  4IOB A;  3Q24 A;  2Q79 A;  3NMA A;  2BMB A;  3CD7 A;  2HKE A;  2HQF A;  4OX8 A;  2XBP A;  1RGV A;  4OHW A;  1QJH A;  3LH2 S;  3LWM A;  4IFV B;  1NME B;  3DRR A;  4C3M A;  1C0U B;  1SJ3 P;  2UXB J;  2D3O 1;  3HKZ D;  5J2Q B;  2HGN A;  4I69 A;  3UDC A;  2ZFH A;  1SV5 A;  1DHM A;  2C1E B;  2RDD A;  5C25 B;  5H9E J;  1ZZF A;  1RHJ B;  2HLT A;  4DQI A;  1Q4R A;  2RF2 A;  4ID5 B;  1CUL B;  4DS4 A;  1RAO A;  3CPW R;  2UV8 G;  4FN5 A;  4DL7 A;  1CQM A;  1CC8 A;  4TLQ A;  3OXF A;  2FVP A;  4CI0 B;  3HP6 A;  2HHV A;  3M2R B;  5D0E A;  5JMN A;  5D8H B;  3N0V A;  4ZJQ A;  5KFQ A;  4IQM A;  4WK1 A;  1SC6 A;  1X4B A;  2PII A;  3R1H A;  2VPW B;  4R0J A;  3IAM 9;  2HFS A;  5HAN A;  1RT3 A;  2DR6 A;  2BRL A;  2V2K A;  1SVD A;  2ZBQ A;  1P9Y A;  2A3J A;  5IT9 Y;  4Y2A A;  4QW9 A;  1RHK B;  4ANE A;  3I5A A;  2HQG A;  4I2P B;  3LP2 A;  2HYI B;  5AE2 A;  2RU9 A;  3KLE B;  1JLE A;  1VBZ A;  1Q78 A;  2ASY A;  2GQQ A;  3EDR B;  7FD1 A;  2VG6 A;  3T5K A;  4QCL A;  5A8W B;  1N34 F;  2EW9 A;  2VQE F;  4HDG A;  1KSP A;  2J0Q D;  2R7T A;  3M2U B;  1PBU A;  3Q89 A;  4KGK A;  2MKK A;  1RT7 B;  2RIL A;  3OL7 A;  1VC6 A;  2AW0 A;  3N9U C;  4GRS A;  3D1O A;  1FTR A;  4KPC A;  4ZKA A;  1FWL A;  2RHS B;  4C8N A;  4JBC A;  1N0V C;  1P1L A;  3PX6 A;  3ET6 B;  3W8G A;  4BCA A;  2HFV A;  4O23 A;  3WC0 A;  1RAA B;  1I94 J;  3MD1 A;  1XNR J;  1RTH A;  5CAB A;  4NYP A;  2MQ8 A;  2GHW A;  4PXD A;  2FHO B;  1MN9 A;  1FJ7 A;  3BRE A;  4RUC A;  3C6U B;  4P2F A;  3QWP A;  1YVF A;  3AH6 A;  2VUG A;  3P49 B;  3QSI A;  5DGA A;  1JWW A;  2FJA B;  3GJR B;  1F2H A;  3JXO A;  4PG8 A;  1UA0 A;  1J5O A;  4KY3 A;  1D8Y A;  3K5M A;  1RA7 A;  1TKD A;  2L48 A;  4DWI A;  1UTA A;  3DYA B;  1S9E A;  4TLR A;  1FVS A;  2HNY B;  1NEE A;  3MEG B;  3VAJ A;  1TL4 A;  1S0O A;  2V8H A;  2C2R A;  1UPP A;  2J6S A;  4DR1 F;  1B99 A;  3M8P A;  4MKY A;  4NA2 A;  5D0H A;  2VFR A;  2V94 A;  3MD3 A;  4N56 A;  1WF1 A;  1VQN S;  2ZDO A;  3N28 A;  5F8J A;  3GCX P;  2GVD A;  3P8B B;  4U8Y A;  2ZH1 A;  1PBA A;  1WC6 A;  5IV4 A;  3DRY A;  2F7V A;  5L9X A;  4B3R J;  3M8Y A;  1S1U B;  1ICE B;  3D3C J;  2I5J A;  2RQM A;  1QDU B;  2IRY A;  2WAQ D;  1NK6 A;  3FSY A;  2WZ1 A;  2YKM B;  1VQ6 S;  3EJM A;  3U1M A;  3NCQ A;  3G6Y A;  5JJB A;  3ZTR A;  1RIS A;  5KFP A;  1RAI B;  2YQ0 A;  2IYI A;  1CSJ A;  4DMZ A;  1HNI A;  1WDT A;  4AND A;  1KC8 T;  4RW7 A;  4YR3 A;  1NHU A;  5J2M B;  4A47 A;  3ETM A;  1JIH A;  1VIX A;  2VD3 A;  2ZBR A;  5LSL A;  3Q83 A;  2FVS A;  1WSV A;  2RRA A;  4RW8 B;  4F4K A;  3PEJ A;  3F56 A;  4C0O C;  3OFF A;  1AXQ A;  1FXL A;  3H42 A;  1UCN A;  2AGO A;  5J1E A;  1UWA A;  4O4G B;  2L9N A;  3CTR A;  3KK2 A;  2Z2Z A;  3MI7 X;  2Z2Y B;  2IM3 A;  4KHR A;  3TUP A;  3MGJ A;  1KVK A;  3KJV A;  4DR2 F;  3V81 B;  4U7U D;  1R27 B;  4K4U A;  1NK9 A;  9ATC B;  1TVR B;  2ZM6 J;  1M1G A;  2B3T B;  1HI1 A;  2GVZ B;  1YIT S;  3P5B P;  3T9Z A;  4K4S A;  4LR9 A;  4FNI A;  2CPH A;  4O3R A;  1U6B A;  1EB0 A;  2VBX A;  1X5T A;  4PR6 A;  4M1K A;  3PYD A;  2NPI A;  3MAA A;  1EP4 B;  1L3K A;  4DPU A;  1LW2 A;  4DV6 J;  2DNY A;  4IG0 A;  1KHV A;  2QLF B;  2QEX S;  1NXI A;  3H2L A;  1B7F A;  2KG0 A;  2DBB A;  2VOO A;  3QZ7 A;  3MZI A;  3KG1 A;  1TKZ B;  1X4E A;  4DZ6 A;  1YIJ S;  3L7P A;  4A8X A;  2C2N A;  5J2P B;  2GMH A;  1T3N A;  1AB8 A;  1UW4 A;  3QIP B;  4JV0 A;  5CZX A;  1VQS A;  1FER A;  1S0M A;  2EC0 A;  3HO1 A;  2XHC A;  1PG5 B;  3A3N B;  1UVN A;  3E2E A;  1WNE A;  4DBQ A;  2ZH8 A;  1S6Q B;  1KLM B;  3CD0 A;  4XTT A;  1I94 F;  2MZT A;  1XNR F;  1WI6 A;  3IMQ J;  3MDF A;  4J7C A;  3JQM A;  2N7C A;  1FX2 A;  3CCU S;  1TL3 A;  4M63 A;  3CT9 A;  1WEY A;  2CPD A;  2CAJ A;  4NX9 A;  4U95 A;  1H73 A;  3TA0 A;  1N5S A;  3VAG A;  2JH3 A;  3LF0 A;  3WQP A;  1NK7 A;  1RBL A;  2MTL A;  4RW4 A;  5L39 A;  4KBI A;  2ASL A;  3ZXW A;  4LSL A;  3G6X A;  4IQX A;  3DLK A;  3HZE A;  4R5P B;  2K1R A;  3O3L A;  2V9K A;  4ZP9 A;  5B0A A;  2RKI A;  3OHB A;  5MAO A;  1C0T B;  4QYZ K;  4PWD A;  2OH2 A;  2WBM A;  2VQF J;  1FA0 A;  1FKA F;  5HI7 A;  5AJ3 J;  2ALY B;  2Z56 B;  5BR8 J;  1R89 A;  4RX6 A;  4O0I A;  4X65 F;  2AJ4 A;  4PEO A;  5DQG A;  4G1I A;  4USV A;  4C7Q A;  2KZZ A;  4LIW A;  4JV2 A;  4WP9 A;  2R2U A;  2A2D A;  4B3R F;  1XR6 A;  3W8P A;  4ZS6 A;  3TVK A;  1XK8 A;  2QX0 A;  1FNX H;  2WSF C;  2B6A A;  3C15 B;  4OHZ A;  1WTF A;  3LGH A;  5B08 A;  2W2N P;  4NCG B;  3H59 A;  3HVT A;  2CNK B;  3DN9 A;  5JVG Q;  5T7L B;  4X62 J;  1S97 A;  3QRQ A;  3LO3 A;  1K1S A;  4W4M A;  4Z7Y A;  2V69 A;  1IM4 A;  3O2I A;  2EKY A;  5KG3 A;  3AA9 A;  4IYQ A;  4I6Y A;  3Q8U A;  2M5Y A;  4H4K C;  1XWL A;  1RT1 A;  5IQQ A;  2IM2 A;  2GX8 A;  3VAF A;  1DRZ A;  1FKP A;  2KN4 A;  3CCQ S;  4DSL A;  2BEF A;  1K73 T;  3HX9 A;  1QSL A;  3T3F A;  2VKZ G;  2HZA A;  2BE9 B;  4QYR A;  4F02 A;  2SXL A;  4RLE A;  3MTJ A;  5EX3 A;  4ETZ A;  5KFC A;  2MHE A;  3I6P A;  2BA9 A;  4G1P A;  1SV5 B;  4TXS A;  1S57 A;  2ZD1 A;  2HWH A;  4DL4 A;  3TAQ A;  2MSS A;  1ZTW A;  1HW8 A;  2WW8 A;  3FDS A;  2ZM6 F;  5LOQ A;  5F8H A;  4YB1 P;  1B7Y B;  5I42 A;  4IG3 A;  1VK8 A;  1D0E A;  2WSE C;  2Z2M A;  2VL1 A;  4UY8 5;  5CCM A;  4I68 A;  1N36 F;  2RB7 A;  2R7O A;  4KGZ B;  1XMO J;  4YS2 A;  3H5U A;  4N76 A;  3PJX A;  5CD4 A;  3HKW A;  4DV6 F;  4KAI A;  2XMT A;  1MRO B;  2IC3 B;  4O44 B;  4KKO B;  1YK9 A;  3GWC A;  4C6A A;  4PG4 A;  4MKV A;  1U1M A;  5JUM A;  3O5T B;  5B0B A;  1D1U A;  3Q2S C;  3GJS B;  3GYN A;  2M52 A;  3GON A;  3KJN B;  1WF2 A;  2IVM A;  4OHX A;  5E5N A;  1X8D A;  1HI8 A;  1JLF A;  4KSE B;  3LP2 B;  3C16 A;  3THV A;  2AYG A;  4Q2M A;  2BE7 D;  4L74 A;  1F3V A;  1JLE B;  3QO9 B;  1QSS A;  4P73 A;  1YRT A;  4MIW A;  3N6M A;  4LSN A;  3UDL A;  1ZTT A;  5E0O A;  2PMW A;  4OI0 A;  1F3F A;  2DNZ A;  2IBK A;  3J7Y U;  2KRR A;  1SC1 B;  3D3B J;  4URQ U;  1S72 S;  5JXS A;  2MDA A;  5CZV A;  4DLG A;  3UDV A;  5AE3 A;  5C42 A;  3IRX A;  2MJU A;  3FZ2 A;  2W2Q P;  3JTP A;  1TK8 A;  3Q8Q B;  3SCI E;  1S7H A;  4ZN1 A;  1YQH A;  2ASD A;  4J9P A;  3POT A;  4D3G A;  1T94 A;  2ZOM A;  3PNI A;  4F0H A;  3NMR A;  3A8I A;  1S48 A;  2IA0 A;  2CPX A;  4NA3 A;  2GS8 A;  2J6T A;  1GMU A;  5B09 A;  1D09 B;  2V67 A;  3RYL A;  3EZO A;  1S0N A;  1J5E J;  4CLL A;  1RTH B;  2UUA J;  1U25 A;  3RG6 A;  3BR9 A;  4FF2 A;  2VQF F;  1OYE A;  3NS7 B;  5AJ3 F;  2VDH A;  1S1X B;  4J9Q A;  1YWX A;  2WOM A;  5BR8 F;  4AL6 A;  4KO0 A;  3R8Y A;  1PAU B;  1O6X A;  1ULR A;  4D3H A;  3NGT A;  2N3L A;  1W7W A;  1HHS A;  3H5S A;  3FCW A;  3JTN A;  4MFB A;  5J1P A;  3FGV A;  4LF8 F;  1HD0 A;  1IBL J;  2IAJ A;  1NAQ A;  3TW0 A;  1FI4 A;  4U8V A;  2LEC A;  1UFK A;  3TR5 A;  3TAN A;  2KM8 C;  3V5R A;  3DOL B;  3M8W A;  8AT1 B;  2G0C A;  2Y8W A;  3V6D A;  4X2B A;  2GVD B;  3I32 A;  4TU7 A;  2DHS A;  3S01 A;  3CB4 A;  1X9W A;  1Q79 A;  5KG4 A;  2QJ3 A;  4MJK A;  1IR1 A;  4CLU A;  4H4O B;  1DQ9 A;  2HEK A;  4AUK A;  4ELV A;  5ETL A;  4B3S J;  3NLC A;  2CQP A;  3VQT A;  3R3T A;  1XR5 A;  1W2I A;  1OJ4 A;  1VMB A;  2B5J B;  1HBO A;  1HNI B;  4F0M A;  3AJD A;  3HUL A;  2DEJ A;  2O66 A;  2RHQ B;  1HQU B;  1PC5 A;  4F26 A;  1I51 B;  2GJ2 A;  3IN5 A;  1HFE L;  3JSB A;  1O51 A;  3GE9 A;  5D4P A;  2DTJ A;  1UL3 A;  2ROP A;  2OML A;  2EPI A;  3ZNJ 1;  1VIO A;  2XQC A;  1QUP A;  1YJ9 S;  3Q8V A;  1RCX B;  1XMO F;  5J1E B;  2E7V A;  3I82 A;  2BJD A;  3MEE B;  1R8A A;  3TAR A;  1KEK A;  1U26 A;  2YKA A;  2YNG A;  4LF9 J;  5ETR A;  1HL6 A;  2OI2 A;  4FBT A;  1FKO A;  3M7V A;  1A6L A;  1T0T V;  4WYL A;  1AFJ A;  4ED2 A;  3OD2 A;  3PYF A;  4UOG A;  4QWC A;  1IN0 A;  3N6N A;  4DV0 J;  4N8N A;  3RBD A;  5EDW A;  4HAC A;  2AYB A;  4QIF A;  1LW2 B;  4K0K J;  1XTZ A;  1OY8 A;  5HK4 A;  2B8Q A;  3OTE A;  4NE9 C;  3PXG a;  2WVC A;  2L08 A;  3D9B A;  1NB7 A;  1NPP A;  1IJE B;  5LJ3 Y;  1TAU A;  1OSC A;  1Y0H A;  3G6E S;  2EFN A;  3MCN A;  2KXF A;  3PAC A;  2C3Y A;  4RU9 A;  2AGQ A;  2UU9 J;  3H5Y A;  3TZY A;  5SUH A;  3EX7 B;  4P74 A;  3JSM A;  1SI9 A;  3OXL A;  2XSF A;  3AB2 B;  3SV4 A;  3X1L B;  4K4Y A;  2B9W A;  1QAX A;  3EGZ A;  2A6O A;  3AT1 B;  1IR2 A;  1LNQ A;  4MIA A;  1IKW B;  3QJJ A;  5HVG A;  3BJY A;  4JI0 J;  3OL6 A;  4RBU A;  3THP A;  2V8D A;  2EFO A;  2BJ7 A;  2DHX A;  2KFY A;  3NS5 A;  3GIM A;  2LFV A;  4M8L A;  1YJR A;  2KT5 A;  5L38 A;  2AJQ A;  1J5E F;  1SJF A;  2UUA F;  1RAG B;  2P9G A;  2M8H A;  3IFE A;  3TA1 A;  3NP5 A;  1N54 B;  1UZD A;  4N5S A;  3A3O B;  3TZZ A;  3ILL A;  5KFV A;  4H4K A;  2X1F A;  2JL9 A;  1S1T A;  5EX0 A;  5L1L A;  2CJA A;  4LSL B;  3CCS S;  4BS2 A;  3DLK B;  4Z37 A;  2CNN B;  1V9O A;  1RP5 A;  5KT2 A;  5JVH Q;  4NXM J;  1SJ1 A;  1U4B A;  2RKI B;  1RKI A;  2DNG A;  1IBL F;  3OVA A;  4DSK A;  3L7O A;  2VZ9 A;  4PWD B;  3CMQ A;  3W62 A;  5LMN J;  5L1K A;  5HAO A;  1WI8 A;  1S99 A;  3FJ2 A;  1X4H A;  4PQA A;  5IC4 B;  2E9T A;  2AT1 B;  4RBV A;  1KVI A;  1IUJ A;  2Y1R I;  1HQE A;  1WKL A;  4LF4 J;  4P7V A;  2B6A B;  4C3K A;  1KQS R;  2J5A A;  4IDK A;  3F44 A;  3CF5 Q;  1WC1 A;  4F8R A;  4F67 A;  3FEZ A;  3ZZT A;  2CPJ A;  2V6A A;  4CLP A;  2U1A A;  3W3S A;  1OYD A;  2B9Y A;  1CJT A;  3IWL A;  3J81 Y;  2HHX A;  2CYY A;  5FD1 A;  1K0T A;  2PMZ D;  3GR1 A;  1DTT A;  4K4W A;  5IWA J;  4F4X A;  4B9N A;  2YTC A;  3QRP A;  2YVS A;  1F9H A;  2K7K A;  4A8W A;  4GVB B;  4FVM A;  4UTG A;  3KUH A;  3CC2 S;  4UQT A;  3Q22 A;  1UVL A;  4AT1 B;  3W2V B;  4WKR A;  2VJU A;  4MTP A;  2BBE A;  4G65 A;  1GMW A;  3C6T A;  2BDP A;  4EEY A;  5KFK A;  4LF9 F;  2ATL A;  1LQ9 A;  3DLE B;  4AE5 A;  4FS2 A;  1MNE A;  3CJ5 A;  3QAE A;  2HWT A;  3BBC A;  4DR3 J;  4ECZ A;  5I42 B;  2YPZ A;  1VGY A;  4K7Q A;  2XHW A;  4B9M A;  3M32 B;  2Y1L B;  5HP1 A;  4PUO A;  4M5M A;  2EBG A;  1N5Y A;  2KXH A;  2AZ3 A;  2JZ5 A;  3TQE A;  2BZ2 A;  3OTO J;  3MCO A;  4K0K F;  1TMM A;  4K2X A;  1BWE A;  3ZTQ A;  4ZIV A;  4TY8 A;  4L6V 3;  1T7P A;  1S5Z A;  1SJR A;  4R8U A;  4QW8 A;  1M1K T;  4CYU A;  1RAJ A;  1U48 A;  2HS0 A;  2CA9 A;  3ILJ A;  5AT1 B;  2GHP A;  1HPZ A;  3VCD A;  2UU9 F;  3VVU A;  3MXH P;  3GSI A;  1WC4 A;  1F9E B;  1JLF B;  2YNF B;  4NLG A;  3ITH B;  3C16 B;  2ADC A;  3CJ2 A;  3RAX A;  2ZIT A;  1RTI A;  3P5T L;  3HT0 A;  4DN9 A;  2EVZ A;  1WEL A;  4LSN B;  2R8G A;  2D9P A;  4JI0 F;  1D9A A;  5ETQ A;  2BJE A;  1WG4 A;  2FHK A;  4F2R A;  4LFC J;  3HD2 A;  4J9M A;  2XEX A;  4F4W A;  3ZZZ A;  1H2T Z;  3R7S B;  1JB0 C;  4HL9 A;  5C42 B;  3BDE A;  4ED1 A;  3NGR A;  3I0S B;  2QL7 B;  3JB9 k;  5F8M A;  4TKT A;  1UEV A;  3KDO A;  5KFE A;  4LJM A;  3KJF B;  2JVO A;  4A8S A;  2XSJ A;  2HK2 A;  3RUB L;  2Y9H A;  3V4M A;  2BV3 A;  5HBM B;  4LBP A;  1N6Q B;  1QVF R;  3CJQ A;  1EZZ B;  4OI2 A;  2NSB A;  1LWX A;  3CJK A;  3M2V B;  2BM0 A;  5DLF A;  2VA2 A;  2EFP A;  2LEB A;  2C3U A;  2HHP A;  2EFG A;  1P1T A;  4CT9 A;  3EGN A;  3WC2 A;  4LFA F;  1Z2Z A;  2AD9 A;  2EC2 A;  4DLE A;  3CCJ S;  5GAD U;  1W26 A;  5HRO A;  2QL5 B;  1QTN B;  2O1P A;  2F4V J;  2CVE A;  4X4S A;  2K2P A;  3VWS A;  5FLX Y;  3HVR A;  2ZOG A;  1KDN A;  4MFB B;  1KQF B;  4U9R A;  1M5H A;  4DJB A;  4LF4 F;  5KFL A;  1OY9 A;  5IM0 A;  2IAJ B;  1T95 A;  2MLY A;  2E9R X;  4OYX A;  1VFJ A;  1T9U A;  1FEE A;  1PYT A;  2LU2 A;  3H90 A;  2DNQ A;  4LUB A;  1MSW D;  2VFU A;  4G1Q B;  3DI6 A;  1RE1 B;  5HQM A;  1XIQ A;  4C8Y A;  1FDB A;  3QAT A;  4DV5 F;  3M1V A;  3JAM Y;  4LQ9 A;  4FYV B;  1NKB A;  2DNL A;  1RSC A;  4JB8 B;  2AP6 A;  3S7R A;  1XMQ J;  3SV3 A;  4NLV A;  1YJT A;  3H20 A;  3LPE A;  1S76 D;  5A76 A;  4NLR A;  5HJY A;  2W9A A;  1F5B A;  2NXU A;  4AD6 A;  2JEF A;  1HBO B;  2XNQ A;  3MUM P;  4ERD A;  3CDU A;  3OJU A;  5DDP C;  1R6Y A;  5H9F K;  3BPD A;  1V3S A;  3CED A;  1SC4 B;  1HI0 P;  3B4M A;  4KGV B;  3C2P A;  3PDN A;  3BR8 A;  3R9L A;  3KFW X;  4RW9 A;  5IT9 U;  1U1K A;  1HBU B;  3BN4 A;  2PGC A;  1KRP A;  3KLH A;  1JJH A;  3OQ2 A;  1UJ5 A;  2IJR A;  4O0N A;  3J81 j;  2EFQ A;  2I8E A;  3UD5 A;  1RWN B;  2BAN A;  3OTO F;  2IVF B;  4FZV A;  4DG1 B;  1VQY A;  1U8W A;  1WOS A;  3IA0 A;  4M5G A;  4PCQ A;  2JEG A;  5B0C A;  3PIO Q;  1PCA A;  2AF6 A;  1A7G E;  1R7I A;  2ZWP A;  1CJK A;  1EAY C;  3PW4 A;  5K14 B;  3CMA S;  2VB6 A;  1WWH A;  4LF7 J;  2G2O A;  1EKR A;  2RAQ A;  2W8K A;  3MUT P;  3I0R B;  1YRX A;  4CH7 A;  3EVM A;  4ECU A;  2RQK A;  2GCF A;  4PG7 A;  4HAC B;  2CQI A;  2Y8Y A;  4ZVT B;  1VQM S;  3MAH A;  1NKE A;  1RWV B;  2IVY A;  2MY8 A;  3MUR P;  2JFK A;  3DXS X;  2V0N A;  2I0X A;  3C14 B;  4LFC F;  2PA8 D;  4WFA Q;  3F41 A;  3LAN A;  2VIC A;  1ZPW X;  2FHJ A;  5G4D A;  4JI3 F;  3BB5 A;  1DQ8 A;  3TOQ A;  4ZPA A;  3KK1 A;  1VQP S;  3LA0 A;  3ELH A;  4AYB D;  2RD5 C;  5FJ4 A;  1DQA A;  3QID A;  4ETX A;  4CTA A;  4ZJL A;  2FZG B;  3MPD A;  4DPX A;  5CXT A;  3CJT A;  1CJU A;  1FDA A;  5CQG A;  4LIR A;  1OPZ A;  2A18 A;  4NZ6 A;  1SL2 A;  1Y7P A;  3VR1 A;  2HMI A;  2YQ3 A;  2QC3 A;  1R31 A;  4NYZ A;  2X1B A;  1OSD A;  3FMW A;  2YXL A;  3EYZ A;  3SQG B;  4N8O A;  2BJ9 A;  4TQS A;  2CJQ A;  4DR4 J;  1S1T B;  3QFH A;  5HJX A;  1B64 A;  3NL0 A;  1KVJ A;  1F5A A;  5KOX A;  2F4V F;  4PG5 A;  2WON A;  5D78 A;  3V4I A;  3D54 A;  1BD6 A;  2VBW A;  4GKJ J;  4DSJ A;  2LQJ A;  2K06 A;  2NR0 A;  2HFU A;  4KFB B;  2MHN A;  4M5H A;  3CUN A;  4XPE A;  2BQU A;  2KHD A;  5D0G A;  4FVC A;  1O0P A;  3MR3 A;  2MLZ A;  4KYZ A;  1K44 A;  3SEO A;  1HWL A;  4HT5 A;  5CAA A;  3IGN A;  5BYQ A;  2D74 B;  3MM5 A;  3DOM B;  1FK9 B;  2HVH A;  4USJ C;  5D15 A;  2G1H A;  4JI8 J;  2MPU A;  3QAU A;  2C3O A;  3UWT A;  4WFZ A;  2DNN A;  3CIM A;  2XLI A;  2AYE A;  2R7X A;  2PEH A;  2JDJ A;  3L9Z A;  2QA1 A;  3OXG A;  2VHG A;  1Q0N A;  4HI2 A;  3CCL S;  1TFY A;  4DFM A;  1Q8L A;  1T8E A;  2J7K A;  1XMQ F;  4I67 A;  1L3V A;  2NRE A;  4IR1 A;  4ZCI A;  4ECV A;  3PCO B;  2H5I B;  3OV7 A;  4OYP A;  4JP8 A;  1MWY A;  3MPY A;  4ICL B;  1D9D A;  1TV6 B;  3M6V A;  4ECW A;  4I1T A;  3TQ1 A;  2GIF A;  2F8E X;  1NSP A;  2DGU A;  3UR0 A;  4UZC A;  2OPR A;  4EO6 A;  1VQL S;  2PFD A;  2BYC A;  3MR5 A;  1ZH5 A;  4A48 A;  2R4F A;  3MR6 A;  4WE1 A;  3HK2 A;  5ETO A;  1SH0 A;  2OPP A;  3KHR A;  4WK3 A;  5CYQ A;  3C6T B;  2C42 A;  3THT A;  3GFY A;  2JLF A;  2O01 C;  3HD1 A;  1REV B;  4CO5 A;  1CQN A;  1M1H A;  4R25 A;  3TVZ A;  4J90 A;  4MH8 A;  4PPD A;  2YH0 A;  2J7U A;  4LF7 F;  5H9E K;  3SCK E;  2EG1 A;  3LP0 A;  3EDQ B;  1KON A;  4EZ9 A;  1PAE X;  1JLQ B;  4PUO B;  2ACY A;  4A4J A;  3CJ3 A;  1WHW A;  2AX0 A;  1N5Y B;  1U47 A;  1X4A A;  2ERR A;  1QAI A;  5B0D A;  2V8P A;  2A2C A;  4DV3 F;  3DRS A;  2HZV A;  2G13 A;  1RLD A;  1RT2 A;  4Y3C A;  4TY8 B;  1AUD A;  3AQP A;  5GMD A;  1Y4Z B;  4R8U B;  1FNM A;  2H4W B;  4ATN A;  3DCA A;  3KKF A;  2QO3 A;  2HQC A;  3TVY A;  4C0B A;  2HHH J;  3NGU A;  2B51 A;  1Q82 T;  1F5C A;  1UPM B;  5DO2 A;  3DNC A;  2XMA A;  2W7O A;  3PKY A;  4MYU A;  4ED0 A;  3S6E A;  1BHN A;  2V4Q A;  1LW0 A;  2A6M A;  1R8B A;  3RW6 A;  1N32 F;  1DTQ A;  3ENA A;  5A8R B;  1MMN A;  5BYS A;  4OIX A;  1FCA A;  3KLF A;  3CIZ A;  3HT3 A;  3K0J A;  2N82 B;  1K47 A;  4PWU A;  4ANC A;  4V1A k;  5AXN A;  1S6P B;  1AT1 B;  2MST A;  1BC6 A;  1TMJ A;  3K58 A;  4ED8 A;  2HRU A;  1KFD A;  1NB2 A;  5B0E A;  5DM7 Q;  2VPY B;  1U45 A;  1N5Q A;  2KM8 B;  3T19 A;  3L4B C;  5HVH A;  1S0V A;  3KHG A;  1RHM B;  1NJX A;  4FDF A;  2Z57 B;  4DR4 F;  4CLK A;  4DPO A;  2QSF A;  1ROF A;  2XSJ B;  2JEJ A;  3BN7 A;  1BLU A;  4CLY A;  3BYR A;  3CO9 A;  4NLX A;  1FXD A;  4GKJ F;  2AJ0 A;  3L7U A;  4TQR A;  1VS3 A;  1YJ7 A;  4IFV A;  2X1G A;  3Q23 A;  4EUV A;  1TU0 B;  1AZS B;  3UR3 C;  2I2Y A;  1UA1 A;  4LRC A;  1RYS A;  2Q6C A;  5C25 A;  1YBT A;  3MM7 B;  1SXL A;  3Q0A A;  2XMM A;  1R0B G;  3GG1 A;  3NAI A;  3PRD A;  2G2Z A;  4ID5 A;  1NH7 A;  4LR8 A;  1WSR A;  4RWX A;  1IKV B;  4JI8 F;  1CUL A;  4DF4 A;  2V8G A;  2R8H A;  4J9V A;  3ZZO A;  1SJQ A;  4FXD A;  5IM0 B;  1X9S A;  2VC0 A;  2MMY A;  2F63 A;  3BO4 A;  4RZR A;  2UUC J;  1DZ5 A;  3M2R A;  2AMC B;  2YWE A;  2GHV C;  1KFS A;  2KHC A;  3R7B B;  1IQZ A;  1LWE B;  1U1O A;  5F41 A;  4JUZ A;  2L9D A;  2AU0 A;  4JI2 J;  2YNH B;  3DI6 B;  3TJ9 A;  3UFC X;  3MMA B;  1RK8 A;  2YX7 A;  3EVO A;  2L9W A;  5KFU A;  2J9E A;  4XO0 A;  1G4C A;  3M1V B;  5DDR C;  2YH1 A;  2Q1L A;  4HLB A;  3OVB A;  3D67 A;  1HLW A;  1CJV B;  3UCZ P;  4IOA Q;  2B8P A;  4I2P A;  1VRU B;  4NLT A;  2FY1 A;  2UXD J;  3CD6 S;  2XMJ A;  1PJ6 A;  5BYR A;  2DNR A;  3SSS A;  2GAG C;  3OL8 A;  4K4X A;  2WRM A;  3I96 A;  2XYG B;  5A8W A;  2DCL A;  3QGG A;  3BPS P;  1ELO A;  4TU9 A;  1UAW A;  1YKW A;  3DOK A;  3M2U A;  3R97 A;  2E5J A;  3FEY B;  4K4Z A;  4IRK A;  4RW9 B;  3LAK A;  1A9N B;  4J9N A;  3GP9 A;  4YR2 A;  5KG1 A;  3CC4 S;  4WU3 A;  2MKC A;  2HGM A;  2QRR A;  4KR0 B;  1NDL A;  2IRX A;  1RHR B;  2HSE B;  2DT9 A;  4WP3 A;  2KO1 A;  1BQN B;  2B4O A;  4HI1 A;  3P4U B;  1X5O A;  3EGV A;  3VGV A;  1YGY A;  3IG1 B;  4QR0 A;  3SMZ A;  3SDE A;  3SZ2 A;  2ROG A;  4CLW A;  2CIM A;  4LSZ B;  2YKQ A;  1TUG B;  2HHH F;  3C6U A;  5KFO A;  4XDD A;  2YPY A;  3PRV A;  2DPJ A;  2JSX A;  5HMZ A;  3BH6 B;  1VQ4 S;  3VGS A;  5E33 A;  3BGR B;  2J6U A;  2BX6 A;  5L8R C;  4CP5 A;  3GIR A;  2Q6B A;  1S77 D;  2IJF A;  3ZO7 A;  5ETV A;  4PXE A;  1NK8 A;  2EKN A;  3HHD A;  1FRM A;  1VOM A;  4HDH A;  3OSN A;  3MEG A;  3SSR A;  4RW6 A;  2H3E B;  5CCL A;  3F73 A;  1L3U A;  1BE4 A;  2V50 A;  2OTJ S;  3T6B A;  4DV4 J;  4ZDN A;  2D3Z A;  1U6Z A;  2AV5 A;  1QSY A;  2UUT A;  4CTA B;  3BSA A;  3D66 A;  2V5H G;  1DLO B;  2P6T A;  1IWA A;  2YKM A;  3QLH A;  1C4A A;  3IXQ A;  1TL5 A;  1H6K X;  1RB0 A;  4EBD A;  3CSK A;  2LU1 A;  3FFI B;  1VBK A;  1UEU A;  3HJF A;  2N7Y A;  5DS7 A;  2BVZ A;  1Z4U A;  5J2M A;  4I4B A;  2JJ4 D;  1HNZ J;  1QY7 A;  2HK3 A;  5DZ7 A;  1KS2 A;  2ZJQ Q;  3SXL A;  2R7Q A;  2YBV A;  3DDK A;  1X0P A;  1G6B A;  2RH3 A;  3V4I B;  4RW8 A;  4NL5 A;  2ZZT A;  4ZPT R;  4F7V A;  4F3M A;  2G4B A;  1M90 T;  4PAB A;  1H7W A;  2RDI A;  4BBY A;  2UUC F;  3A3P B;  3IWN C;  2J0S D;  5ITH A;  4P2M A;  2D9O A;  3V81 A;  1FWP A;  3I56 S;  4ELT A;  4JI2 F;  4N47 A;  2N4D A;  3PW2 A;  4O3Q A;  2UXC J;  2GVZ A;  4B3O B;  1U2R A;  1XEZ A;  2ZJP Q;  3KK3 B;  3IO1 A;  2FGC A;  2POK A;  3HHL B;  4P52 A;  3DRP A;  1J27 A;  2AJF E;  3OFE A;  2X3D A;  2AX1 A;  1EP4 A;  3KNA A;  3KHL A;  2A10 A;  3AD7 C;  4F3O A;  2KRB A;  3NGS A;  3GJQ B;  2GNK A;  5IT4 A;  3PTW A;  2IM1 A;  2DNK A;  3PO5 A;  1TKZ A;  4MK9 A;  1VLY A;  1YI2 S;  4OYB A;  4NLO A;  2DNM A;  5ETS A;  1MU2 A;  3CWJ A;  2VBZ A;  4FKX A;  5HQ8 A;  3KUG A;  5J2P A;  3NNH A;  5HN0 A;  4MK7 A;  3QIP A;  4ILL A;  3TEG A;  1JK9 B;  3ENW A;  2BM1 A;  4F4Z A;  1EQM A;  4QIE A;  4DUZ F;  3J80 Y;  1UET A;  1S6Q A;  2VQE J;  2LDI A;  1DBD A;  3M6U A;  1K8A T;  2NXJ A;  2OD6 A;  1XN9 A;  2DHA A;  3BF4 A;  2RRN A;  1U8S A;  3HPO A;  2H1Y A;  3C19 A;  2E66 A;  3OW2 R;  3PW7 A;  2VJV A;  4NLD A;  3VGT A;  3BS9 A;  2XB2 D;  3LP0 B;  9RUB A;  4J9K A;  4FF1 A;  2HND B;  3WX4 A;  1Y9O A;  2DRA A;  1MLA A;  2OEK A;  2HUR A;  3RB0 A;  2OLW A;  2X51 A;  1WHY A;  2RS8 A;  4R5P A;  3BDP A;  4DEZ A;  3JQK A;  3DLH A;  3J7A 1;  4OX7 A;  2M9K A;  4NZ7 A;  1C0T A;  1NK5 A;  3BKU A;  3IC1 A;  2W9C B;  2BQ3 A;  4CZC A;  1HNV B;  1RTJ B;  2VDI A;  3NNC A;  1KBR A;  4ZP6 A;  3WHI A;  4KIA A;  4DDF A;  1Q1K A;  4PRF A;  5LT5 A;  4DV4 F;  1B0P A;  3CCZ A;  3OR2 B;  1DTQ B;  4J37 A;  2B43 A;  3TI0 A;  2FC8 A;  3G87 A;  5B0G A;  4DHV A;  4X4Q A;  4C8Z A;  3HM9 A;  3N6L A;  1VDH A;  1D3W A;  1XQI A;  4X84 A;  3C15 A;  4Q8E A;  3D6F B;  3HFZ B;  4QU7 A;  4NCG A;  3EZU A;  3HFK A;  1NUE A;  4DR1 J;  4YHH F;  4CO1 A;  1XR7 A;  2OPQ B;  5HAT A;  5T7L A;  2CQ0 A;  4OYW A;  1Y11 A;  2J0W A;  2E7W A;  1HNZ F;  3PR4 A;  1U24 A;  3QQC D;  4USU A;  5EWF A;  1H38 A;  1OPI A;  3VQS A;  4C0H A;  3PZP A;  3RTV A;  4DSI A;  5DG7 A;  2FJX A;  4OZN A;  4W92 B;  1Y5N B;  4DSE A;  3HSZ A;  3GSD A;  4I64 A;  3NNA A;  1B0T A;  3HMJ G;  4LRB A;  1RWO B;  4U67 Q;  4Q45 A;  1X5P A;  5IT0 A;  3MCM A;  2BOP A;  3OR1 B;  2I38 A;  4DUY J;  1VCT A;  4C48 A;  3J81 U;  1KQG B;  1LK7 A;  4IH7 A;  3SCJ E;  2IRU A;  3DM2 A;  2CQ1 A;  4J91 A;  2KVQ E;  4WXW A;  5KTQ A;  1F0X A;  3JTO A;  1N33 F;  2HGL A;  2F40 A;  2UXC F;  5B7W A;  1JQG A;  4DR5 J;  2O5D A;  2VBY A;  2A1B A;  5KT7 A;  2DR8 A;  3ENQ A;  2WVB A;  1T03 B;  2YY3 A;  2BRK A;  2OPS A;  4QPT A;  4DV1 J;  1VK3 A;  5KFW A;  4KTQ A;  2VAS A;  3AXM A;  3MPV A;  3VAH A;  2MZJ A;  1IJF B;  5LSO A;  3GTY X;  1MRO A;  5BJR A;  2IC3 A;  2ZHB A;  4LBH A;  4O44 A;  4KKO A;  4DR2 J;  2APO A;  1VQ9 S;  2M4M A;  4J9L A;  5A6P A;  3SYZ A;  1WAC A;  3W60 A;  3E8O A;  2QFI A;  3D4J A;  2R7S A;  1WHX A;  1GMW D;  1U2F A;  2G1D A;  4LFB J;  1T05 A;  2ZDP A;  2DXD A;  3DKD A;  4Y34 A;  1QLN A;  4QIG A;  3QO9 A;  5IFM A;  3C8Y A;  3JSR A;  4ZLN A;  5THW A;  3J7Y I;  3FQL A;  4JI5 J;  3TYT A;  4UW2 A;  5HMW A;  4TU8 A;  1RU1 A;  1FE0 A;  3PFO A;  3DOK B;  1UJ4 A;  2B4V A;  3LGN A;  1YHQ S;  3FBC A;  1VHI A;  4AXI A;  3G8S A;  2UVV A;  1KN6 A;  2DD8 S;  3FZB A;  3RZA A;  2EK6 A;  3MR2 A;  1M5V C;  1TR0 A;  2OP5 A;  5KFX A;  2DH8 A;  2DPI A;  4P71 A;  2IY5 B;  3EVW A;  3HSG A;  1TL7 B;  2RSQ A;  1JLB B;  2XGQ A;  2F3J A;  5K8P A;  4V19 J;  2GQC A;  1IXK A;  3CUL A;  3K5O A;  2HLU A;  3GJT B;  3JYT A;  2QLW A;  1E6Y A;  1GTH A;  4P72 A;  3A4T A;  3SDE B;  4G3I A;  1L3T A;  2R3V A;  3QZ8 A;  5GVQ A;  1KTQ A;  1S1X A;  2MQN A;  1TAQ A;  4UY8 T;  1A0O B;  3FCV A;  4M5N A;  4KT0 C;  1NDK A;  2HAI A;  3M6W A;  3GG0 A;  3RBE A;  2LDY A;  1V5I B;  2GO9 A;  4GC6 A;  4BC7 A;  3W9J A;  3Q8R B;  2DIS A;  4O3N A;  3H2U B;  1M5S A;  3I9Z A;  3BH7 B;  5KFJ A;  4ZCK A;  4ZHR B;  2HZC A;  1LOU A;  2GZO A;  4RW6 B;  2ZH4 A;  4WXO A;  2CQC A;  4CO4 A;  3IR6 B;  4LF6 J;  3AOD A;  3US5 A;  5AE1 A;  3DOL A;  4X65 J;  1QUV A;  2W25 A;  2J9D E;  1IBK J;  2AKW B;  3WIV A;  2PD1 A;  4U7U K;  5ETK A;  4AL7 A;  2ROE A;  5GAG U;  1N52 B;  4PWW A;  2ATC B;  4RNH A;  5FLX U;  3P3D A;  2OJ3 A;  5KG2 A;  3K5N A;  3ISN D;  4H4O A;  5HSP A;  4M5L A;  4B9T A;  5KFY A;  3QLH B;  3T5H A;  5K9F A;  3MM9 B;  1TTH B;  2GQ2 A;  3J7Z T;  4DUY F;  2B5J A;  4RWW A;  2MQO A;  3R1L A;  5KFA A;  5L1I A;  5KFS A;  1TFW A;  2DYA A;  2E1C A;  1FE4 A;  3W65 A;  4PXC A;  4M95 A;  1Q8K A;  4CCH A;  1HQU A;  4ZVP B;  2CQD A;  2H48 B;  2P5V A;  2JOQ A;  2BW2 A;  5M2P A;  3JAM U;  2WBR A;  4DR5 F;  1QM9 A;  3O6Q A;  4DZD A;  1IQT A;  3G4S S;  1RT4 B;  2R2R A;  4DV1 F;  3Q86 A;  2BR0 A;  2JFD A;  3KXD A;  2YX4 A;  3HZG A;  3QMQ A;  4X4P A;  3RBZ A;  2VG5 B;  5DDO C;  4DR7 J;  2R7U A;  3R2C J;  3MEE A;  5D3G A;  2ILY A;  2ZJR Q;  2FJD B;  3EXC X;  2VV5 A;  3K2Y A;  2BW7 A;  1X5S A;  2I9S A;  4LVN P;  3E01 A;  2D41 A;  4WJB A;  2E1M C;  3CD5 A;  3FUY A;  4BWM A;  4RR5 A;  1H3D A;  2CKW A;  5AXK A;  1W2B R;  3AA8 A;  2VKR A;  4LFB F;  2EWH A;  2OGU A;  3PVX A;  4A8O A;  3DRP B;  1N36 J;  1RUS A;  1WC0 A;  3IBW A;  1GX6 A;  1NZ8 A;  3VZH A;  3HVA A;  2MZQ A;  1S49 A;  3L09 A;  4JI5 F;  2FZK B;  3O44 A;  4YN3 B;  2OO4 A;  5SZT A;  1BXN A;  3MWB A;  3G2X A;  4FXW A;  4KV8 B;  4YR0 A;  2RJZ A;  1CVJ A;  1FES A;  3DGP B;  4LR7 A;  4ZVR B;  3ADA C;  5GAE U;  3DHX A;  1MU2 B;  1XJW B;  3U02 A;  4GKK J;  3N79 A;  2JWN A;  3H98 A;  4PXB A;  2XMK A;  4CWB A;  1SUQ B;  2DHG A;  3PKM A;  3QBC A;  1TUW A;  5I4M A;  3SSQ A;  2Y0S D;  1IKW A;  4UUX A;  1FDD A;  2A0F B;  2ZE2 B;  3GB0 A;  2X3G A;  5M2U A;  2XWY A;  3NCP A;  4WWS A;  2QGF B;  2HS4 A;  4WZM A;  4B9L A;  1WC3 A;  2VFT A;  1UMJ A;  4DQP A;  2E1P A;  2XZW A;  2DXE A;  1RZM A;  2Z2L A;  3GQC A;  2ZZN A;  2MZ1 A;  2DKO B;  2XZD B;  2HVE A;  1YRU A;  3ICL A;  2E5L F;  1RWW B;  2HAF A;  4DS5 A;  4MIB A;  1M5O C;  2IMW P;  1OY6 A;  1C2P A;  2QN6 B;  4DOZ A;  4CM2 A;  5DQH A;  2FHJ D;  2IDE A;  4KHM A;  4ITS A;  3MEC B;  3UNY A;  1VI7 A;  1HW9 A;  3A8K A;  2VPX B;  1RA6 A;  2P6S A;  3CCW A;  1T9X A;  2KL8 A;  4LF6 F;  4CNY A;  2ILZ A;  4DR6 J;  2Y1I A;  1IBK F;  2CZ4 A;  1ZM9 A;  3ZFV A;  5KG6 A;  2CPI A;  3RRG A;  4ED6 A;  3TAM B;  2XS7 A;  1ZA2 B;  2B9E A;  2WB4 A;  4LF8 J;  3AOC A;  1SPB P;  3TNV A;  5CD4 H;  1SQG A;  2C3M A;  2CQ2 A;  2F4F A;  5DG8 A;  2UVU A;  2E5I A;  4DI6 A;  2FJE B;  3PEH A;  4OZ3 A;  2FQQ B;  3K8W A;  2CG8 A;  1T02 A;  4GVL A;  4TNO A;  4GVB A;  4Y6I A;  1UZH A;  1RLC L;  3AXK A;  2NUH A;  4UT4 A;  3OSP A;  1MW7 A;  2W2M P;  2NZC A;  3W2V A;  2MGZ B;  2W01 A;  3QFW A;  4DR7 F;  2KJW A;  3NOG A;  3HHL D;  3JQJ A;  3DM2 B;  1CEZ A;  2AYM A;  1GXU A;  2KJV A;  3UE2 A;  3GIK A;  1LWF B;  3DLE A;  1HBM B;  1LEO A;  3VZI A;  2NS1 B;  3KDN A;  2CJB A;  4WU2 A;  1UW9 A;  4GO5 X;  3M32 A;  3I5B A;  8RUC A;  3S8S A;  2OPS B;  1JNZ B;  4C3L A;  2JLE A;  2Q43 A;  3BGL A;  3QWU A;  4YB7 A;  4ZIT A;  5CYM B;  3M8Z A;  3V6K A;  1YDL A;  2PN6 A;  1IKY B;  3D6M B;  1BQM B;  3AY0 A;  4CNZ A;  7AT1 B;  4IFY A;  2XC9 A;  3LTO A;  2RE1 A;  4JV1 A;  5GAH U;  2GGP B;  2J0X A;  3WIU A;  2B56 A;  4RNO A;  3BEG B;  4X66 J;  1F6T A;  3FSI A;  4H54 A;  5H9F J;  2DIV A;  4RO0 A;  1T05 B;  4GKK F;  1RAE B;  3H4B A;  4PKD B;  4ZK7 M;  1TQL A;  4DUT A;  2FY8 A;  2YNF A;  1I3O B;  3ITH A;  4Y2I A;  5L46 A;  2DGW A;  3MFH A;  1W25 A;  3OHA A;  3H40 A;  1NH8 A;  2DGX A;  4Q44 A;  4HH1 A;  3SQO P;  2GML A;  4X64 F;  4OZ1 A;  3RB4 A;  1Y3J A;  2BKP A;  3J7Z 5;  3MF5 A;  3EWG A;  4OZ0 A;  5E3C A;  1LFP A;  2KB2 A;  2YWK A;  4DQQ A;  4MT1 A;  1R0C B;  1RBA A;  1WG5 A;  3SFU A;  1Q86 T;  3DLJ A;  3FBF A;  2QE5 A;  1YLX A;  4EMD A;  3I0S A;  3I4H X;  3DU5 A;  2ZOF A;  4ZP8 A;  4DPY A;  1HMV A;  4F3Q A;  4KH1 B;  4CM0 A;  3I9V 9;  3UD4 P;  1Y5I B;  2GO8 A;  1TKX B;  5HBM A;  1N6Q A;  2MB0 B;  3JYT B;  1SQF A;  3K89 A;  1FRJ A;  1E6Y B;  1FFW B;  3M2V A;  4EYH B;  3UN2 A;  1UVM A;  1YTY A;  2WVD A;  5GAD I;  1HNW F;  1RCO B;  1U1N A;  3UVJ B;  3MMB B;  3BSC A;  2MKY A;  1B3T A;  4I7F B;  4DX5 A;  4DR6 F;  1I5O B;  1M0S A;  1EAR A;  2YWH A;  4EWT A;  2F65 A;  1N4L A;  3Q8S B;  2J9C A;  3RBX A;  4CQ1 A;  2CJX B;  2V2V A;  4F0K A;  2NYH A;  4YEA A;  1YX2 A;  2DGO A;  4I56 A;  3Q2T C;  5KFT A;  3UNG C;  2W4D A;  1NJZ A;  3G82 B;  4WFX A;  3KOA A;  4NLS A;  1KHW A;  2YX1 A;  2ABY A;  1Y00 A;  5DZ6 A;  4ELU A;  5F8I A;  4EFA C;  4G1Q A;  3M8Q B;  4KHP J;  2FUG 9;  3RB6 A;  3T9N A;  3M8S A;  2MZS A;  3R5B A;  4I2Q A;  5EWG A;  1GX5 A;  2WHO A;  1LWC B;  3I55 S;  2V4J B;  1RJJ A;  1HR0 J;  5A8K A;  3ZNU A;  2RU3 A;  2Z30 B;  4Q0B B;  4OI6 A;  1QE1 B;  4GC7 A;  2B0G A;  4DPW A;  4B3T J;  1OO0 B;  4AFF A;  5F8G A;  3WDO A;  5GME A;  3ISN C;  2BAB A;  2BE2 B;  2XM3 A;  4NYO A;  3TJ8 A;  3OFH A;  3RRK A;  1T9Y A;  5IV3 A;  2LLZ A;  2C2Z B;  2OEJ A;  4E0D A;  3GPA A;  2XLJ A;  1HBU A;  2JHE A;  3CW2 C;  1T3O A;  4ALZ A;  5RUB A;  3BQ0 A;  1MMD A;  4B08 A;  4DG1 A;  3MR7 A;  1DUR A;  5D3G B;  1GXL A;  3C46 A;  3BYP A;  4ER8 A;  1H74 A;  2KH9 A;  1WD6 A;  4YDD B;  2K3I A;  3E01 B;  2BJ8 A;  4RNN A;  5K14 A;  3CO0 P;  4F4Y A;  4KGX B;  2E9Z A;  1MML A;  4X66 F;  1X4G A;  3HCX A;  2C2O B;  3T1Y J;  1R8P A;  3I0R A;  2HHW A;  1UWB B;  4ECQ A;  1FX4 A;  2RQC A;  1JLA B;  3CME S;  1FRK A;  1VQK S;  3QGI A;  1WC5 A;  2HNZ A;  1SH3 A;  3LP1 B;  4DV7 J;  3M30 B;  1Q53 A;  4PYD A;  4OYO A;  3CVK A;  4JI1 J;  2Y1J A;  1G3O A;  2IJN A;  2FVR A;  2H9Z A;  2HVD A;  3QT5 A;  3C14 A;  1GK8 A;  1RBO B;  4LRD A;  4EBE A;  4MKB A;  4DFP A;  3W1Y C;  2KU7 A;  2HFN A;  5F0W A;  1LV5 A;  2HHU A;  3V2U C;  3R5A A;  2CWX A;  3IR5 B;  3ONQ A;  2VA3 A;  3PYE A;  4BC9 A;  4NI2 A;  1HD1 A;  4DQS A;  1RT6 A;  1R6V A;  2FLN A;  1CS4 B;  4OZJ A;  1P8G A;  4WFB Q;  3QJP A;  2ZKT A;  3ETO A;  4K4V A;  2MZR A;  3N5B A;  2IPO B;  3IS9 A;  3ZZU A;  5FDL B;  4Y2K A;  3M9N B;  1BMQ B;  1HA1 A;  3KLG B;  5HLF B;  5KFH A;  3M9O B;  3OVS A;  3IWX A;  4I6A A;  2IDL A;  5GMK a;  3MHY A;  3OUY B;  3SQG A;  4WFN Q;  4KGM A;  3GV7 B;  3ILI A;  2CWK A;  1ZM3 A;  3W63 A;  1YZ7 A;  1JLG A;  3NKY A;  4ECY A;  3W9H A;  4G6V B;  4ES3 A;  2YNI A;  1S9G B;  2JC0 A;  1FWK A;  1SKR A;  2Q66 A;  3BO3 A;  3GFH A;  2CZ9 A;  1XMB A;  4H4M B;  4OFZ A;  3ZZY A;  4ZVG A;  2JX2 A;  3H7H B;  1DAX A;  4GMK A;  4KFB A;  3EGW B;  1BUX A;  1WOP A;  1FFG B;  3FEX B;  1T9W A;  3RRH A;  1LFW A;  4DCO B;  2IIH A;  1IVZ A;  1X31 C;  2DNP A;  3GYG A;  4LFA J;  1U6F A;  4F2S A;  1ZET A;  2GJF A;  3NCR A;  5K20 B;  3DOM A;  2CDR B;  1FK9 A;  4KE5 A;  4FYX B;  5C2G A;  3TO8 A;  3QT6 A;  5KFR A;  4IOC Q;  4KHP F;  5CA5 A;  4QQB A;  4FF4 A;  1I1G A;  2W4P A;  2LXF A;  5E3Q A;  4C8M A;  1HR0 F;  2UUB F;  1H72 C;  1NZA A;  5F9L A;  1YBA A;  2JLG A;  4LT6 A;  4CLT A;  5HMY A;  1LK5 A;  2VFS A;  3CCE S;  3M05 A;  4TN2 A;  1MWZ A;  3MPW A;  4B3T F;  3UCG A;  2W2O P;  2B4P A;  3D28 A;  2VIH A;  2AJ2 A;  2PI4 A;  1SIZ A;  4ICL A;  2MEW A;  1TV6 A;  4P10 A;  1S1W A;  2RT3 A;  5D77 A;  3FC9 A;  4Y0F A;  2HRY A;  5DET A;  3U27 A;  4QWE A;  4DF8 A;  2HBR B;  5LJ5 Y;  4DV5 J;  4IRD A;  4IH6 A;  1Q8I A;  3BSN A;  5D0R A;  3FBB A;  5DQI A;  5I3Q A;  2RNE A;  2QMX A;  2KYX A;  1HHT P;  4CO0 A;  4USH A;  2HVZ A;  2QZ8 A;  5KG0 A;  1QAY A;  1VC0 A;  2WVF A;  2YKN B;  5H1S V;  5IQ6 A;  2QLX A;  1P6T A;  4OQJ A;  1WTB A;  2XUL A;  2PEB A;  1NU4 A;  2MYF A;  2E5G A;  5G0R B;  5J2N A;  4KJI A;  4ZPB A;  1FRI A;  3CDE A;  1N8R T;  1REV A;  2J8A A;  1EHW A;  4Y00 A;  3T1Y F;  3HHL C;  3EM1 A;  1JLQ A;  3KMQ A;  3IP0 A;  4ZLL A;  4FYW B;  3KLI B;  4RUB A;  3GV8 B;  4DV7 F;  3UW1 A;  4F4A A;  4LRE A;  1SL0 A;  4JI1 F;  3J80 U;  5HL7 Q;  3I31 A;  3ZC4 A;  1S79 A;  5T14 A;  4YB5 A;  1NK4 A;  3AJ2 A;  1VBY A;  4IFY B;  1QD1 A;  4M94 A;  5KG7 A;  3OJS A;  2CQ4 A;  5L9N A;  4FP9 A;  1FXR A;  2GJI A;  1OMS A;  2GC8 A;  2GFF A;  1F9F A;  4KQZ A;  1ARO P;  2UXB F;  4B17 A;  2FLL A;  2LCW A;  3RGI A;  3V6H A;  2MXY A;  2OIH A;  5A8R A;  2DH7 A;  1FDN A;  3X3U A;  2KT2 A;  2BOA A;  1S6P A;  2DB1 A;  4MKA A;  2UP1 A;  3LAL A;  4E2F B;  4ENO A;  2DIT A;  3Q8P B;  4ECR A;  1RWX B;  1H98 A;  2BJ1 A;  1SJ4 P;  2KT3 A;  2JEI A;  4B9V A;  3Q8Y A;  5KAK A;  4JI3 J;  1S59 A;  2Z4P A;  4NPO A;  3LW5 C;  2JVR A;  3NXZ A;  1NCL A;  1HMV B;  2E44 A;  2HBY B;  3GFX A;  2PI5 A;  4QIV A;  2NSC A;  2XZT B;  2HWI A;  3HSD A;  4KB7 A;  3HI9 A;  4EK2 A;  2P8I A;  3NBP A;  4YQW A;  4FYD A;  2CZV C;  4L75 A;  2M3D A;  1AZS A;  3ZTS A;  1YJN S;  3CC7 S;  4ZVH A;  3PX0 A;  3HDS A;  3I87 A;  1QAJ A;  5A2Q Y;  3MM7 A;  3DLG B;  3U1N A;  2HHS A;  1VQ8 S;  2L41 A;  4JV5 J;  1HWU A;  1UEK A;  3LPY A;  2HVI A;  4ID8 A;  1FTC A;  3OT9 A;  1IKV A;  5KT5 A;  1C1C B;  4HTJ A;  3QGH A;  3TUJ C;  4ECS A;  3MFI A;  1R3N A;  2WCX A;  3LUY A;  2MKJ A;  2XO7 A;  1Y10 A;  4X4N A;  1LWE A;  1HWJ A;  2KDO A;  4USI A;  3H25 A;  2C2D A;  4WKY A;  4L76 A;  3ULH A;  2YNH A;  4F36 A;  2XI3 A;  2XWX A;  3MMA A;  1WEX A;  4LF1 A;  5DDQ C;  4CO3 A;  1YBU A;  3MOZ A;  3R5J B;  4AQY J;  4I2Q B;  3CJ4 A;  1CJV A;  4MYT A;  1CC7 A;  1EJ7 L;  5A8K B;  3EUN A;  3KJQ B;  1VRU A;  1EET B;  2GA7 A;  2NYI A;  4OI3 A;  1IBM J;  2XLK A;  1KOH A;  1S6O A;  3MM6 B;  1NDC A;  4K5R A;  3EIC A;  4HR2 A;  2CPZ A;  2LXU A;  4X4O A;  4RKU C;  5E41 A;  5E2Q A;  2BKO A;  2KG1 A;  1JKH B;  2HIY A;  4WIQ A;  3KHH A;  4HT7 A;  3GYX B;  2H5J B;  2ZC3 A;  2DHH A;  4YME A;  3UQS A;  3UD3 P;  2OHD A;  1VQ7 S;  4KPY A;  4WCE Q;  4K2J A;  1ZAX A;  2NXN A;  4U96 A;  3D1Q A;  1HHQ A;  2HPU A;  3K5L A;  1BQN A;  4WZQ A;  3P96 A;  3RU0 A;  2NUU G;  2VG7 B;  3IG1 A;  2G0I A;  1WHV A;  4ZPC A;  4C8O A;  1X7V A;  3W2W A;  1BWV A;  3W5Y A;  1CLF A;  1QTM A;  1SKW A;  3GZ7 A;  1PC4 A;  2ZH6 A;  3B6B A;  5KT6 A;  2D69 A;  2D3O R;  4DFK A;  1TEL A;  2HNZ B;  1H7X A;  3WBZ A;  2OKQ A;  3BGR A;  4DV3 J;  3TUZ C;  4WBF A;  4DL6 A;  1JLC B;  3TAP A;  4LBI A;  1Q7Y T;  4FYY B;  3VAI A;  4CDI A;  4E98 A;  5IXU A;  4F25 A;  4OYI A;  4ZPV R;  3PW5 A;  2ZZM A;  2D7S A;  1SB6 A;  1RT5 A;  4Q43 A;  3DRR B;  1YJW S;  1Q16 B;  1LKZ A;  1RWK B;  3CXC R;  1RWP B;  4YP3 A;  4NI2 B;  3UCU P;  3VAL A;  2DJW A;  3FRZ A;  1N32 J;  4A8F A;  1RT6 B;  4ZIW A;  4DX6 A;  4OLP A;  6FDR A;  2RF2 B;  4YDX A;  4BWJ A;  1PO6 A;  4HTI A;  1DLO A;  1RHU B;  2P9E A;  1SH2 A;  2QT7 A;  1HWI A;  2B4U A;  3QT8 A;  3IS9 B;  1AYE A;  2XTJ P;  3ISZ A;  5F3Z A;  1JJ4 A;  4CRJ A;  3FFI A;  1VJW A;  3SI8 A;  2NXC A;  4JOU A;  3W5X A;  4QOT A;  1ZOT A;  4JV5 F;  3IGV A;  1Q95 G;  3O1L A;  4ZLP A;  1JLG B;  2ZNZ A;  2YNI B;  3VV2 B;  5BXI A;  1R43 A;  1RT3 B;  3GFZ A;  2CQ3 A;  2QMW A;  1L3S A;  2XO6 A;  2NZ4 A;  4A8Q A;  2ZKU A;  3GLJ A;  3NWR A;  3CDA A;  1U0H A;  1C4C A;  4NRT A;  2DGS A;  4B9S A;  2H51 B;  3BKF A;  1VRQ C;  2V8V A;  2C22 A;  3K7R A;  3AOB A;  2EG2 A;  2CQB A;  3PG9 A;  3TZW A;  2VG6 B;  3FQK A;  4B3O A;  2PFF B;  3D0H E;  1U7L A;  2CJY B;  3KK3 A;  4BLG A;  2MKH A;  3HHL A;  4AQY F;  2FLO A;  3DDN A;  4CT8 A;  1B4S A;  3R5C A;  3HJV A;  2LP4 A;  4A8M P;  5D4N A;  2V2Q A;  2PMH A;  1IBM F;  2ZBI A;  5IOL A;  2FC9 A;  1OWX A;  3L95 X;  2CJ9 A;  1R8H A;  3TWZ A;  2VOD A;  1PJ5 A;  2ZVI A;  3B8H A;  5ETP A;  1S1W B;  2RS2 A;  2Z58 B;  4QPX A;  3DDI A;  2JNJ A;  4ZJO A;  1UFW A;  2FD2 A;  1EKS A;  1NPK A;  3OFG A;  5KG5 A;  1VRT A;  2W9B A;  3ZZP A;  5CYJ A;  1RAC B;  5K8N A;  5ETT A;  2QSW A;  1PYO B;  2LEP A;  5DG9 A;  5EGY A;  4XAK A;  4B3M J;  5F9N A;  2VH7 A;  2IFX A;  5J2N B;  2J76 E;  2FIU A;  1TUV A;  3UI3 A;  1EQ0 A;  2DCU B;  1J5O B;  2AZ1 A;  2HRT A;  3OBI A;  2W8L A;  1S1V A;  1FD2 A;  3CJS A;  3FRY A;  2J9D A;  1H2V Z;  1S9E B;  3VHQ A;  4J9U E;  2QYC A;  2PA3 A;  3MMC A;  2HND A;  3NRB A;  2DRB A;  1RAF B;  3R2D J;  3LAM A;  3M8P B;  4ES2 A;  1UKU A;  3RR8 A;  3T41 A;  3W5Z A;  5C24 A;  4K8R A;  4X62 F;  1BGX T;  2XMU A;  4DQR A;  3G96 A;  2G2Y A;  3TZX A;  2XNR A;  2G9O A;  4USK A;  2FPH X;  1TKT A;  1H2U X;  4L72 B;  4A8K A;  2W9C A;  3JSY A;  5U47 A;  4Q2L A;  2I5J B;  1HNV A;  1RTJ A;  3A8E A;  4DX7 A;  1HNX J;  2Q3P A;  4OV1 A;  2ALZ A;  3OLA A;  1G2E A;  1S12 A;  3OR2 A;  4FS1 A;  1Q7L B;  3R6G B;  5E3P A;  3MCS A;  8ATC B;  4DCP B;  5HQL A;  4RW7 B;  1U09 A;  4PQU A;  2Z8Q A;  1KR4 A;  3QYY A;  1TK5 A;  4DL2 A;  4OI4 A;  2DRD A;  2ZH7 A;  4HYK A;  2EBE A;  3CGI A;  2PSZ A;  1M5P C;  2NPF A;  1URR A;  4EI2 A;  1GT8 A;  3TUI C;  5M2R A;  3PW0 A;  3GCW P;  2OPQ A;  4EZ6 A;  2M0G B;  5K8O A;  3KK2 B;  2LQ8 A;  4O4R A;  3H8Y A;  2XG8 A;  4F04 B;  2VF3 A;  2WTF A;  3KJV B;  1K9M T;  1DJ0 A;  4ILR A;  3PJ9 A;  3HXM A;  2QFJ A;  2DNH A;  2L3M A;  3KYL A;  5HO4 A;  3NBP B;  3IBF B;  3RAQ A;  1URN A;  2DVI A;  2V68 A;  4Q5V A;  1S7I A;  4P75 A;  3AOA A;  3OR1 A;  3UN3 A;  2ZC4 A;  3MAA B;  2W1B A;  1ZA1 B;  4S0M A;  4IG0 B;  2QG9 B;  2CVI A;  1JJC B;  3ZTP A;  2V9W A;  3FCH A;  4P2X A;  3H4D A;  3K17 A;  2HQI A;  2ZH5 A;  2DK2 A;  3R27 A;  1GEH A;  4PG6 A;  2XYP B;  1T03 A;  3FVY A;  4Q8F A;  2W4C A;  4W98 A;  2IYG A;  4JI7 J;  2CPY A;  4O3P A;  5KFI A;  3MPU B;  1M5K C; 
#chains in the Genus database with same CATH homology
 3G82 A;  5D15 A;  1CS4 A;  1YK9 A;  1CJV A;  4CLU A;  4USW A;  3UVJ B;  4CLZ A;  1WC1 A;  4OYO A;  4P2F A;  4OZ2 A;  5D0R A;  1CJU A;  4P2M A;  2W01 A;  4CLP A;  1CJK A;  1AZS A;  4UST A;  1CJT A;  4CLL A;  3C14 A;  5IV3 A;  4CLF A;  4WP3 A;  2GVZ A;  3C15 A;  4CLK A;  1TL7 B;  3C16 A;  4OYZ A;  2BW7 A;  4OYP A;  1CUL B;  4OYI A;  4NI2 A;  1AB8 A;  4CLY A;  1U0H A;  4CLW A;  3MAA B;  4OYW A;  3G82 B;  1Y11 A;  1CS4 B;  1WC3 A;  1WC4 A;  1CJV B;  5D0H A;  3MR7 A;  3UVJ A;  3ET6 A;  4USV A;  4USU A;  3C16 B;  1CJU B;  4CLS A;  4CM0 A;  1CJK B;  4P2X A;  1AZS B;  4WP9 A;  3R5G A;  4NI2 B;  1CJT B;  2GVD A;  3C14 B;  1U0H B;  5D0E A;  1WC0 A;  1Y10 A;  1WC6 A;  5IV4 A;  1YBT A;  2GVZ B;  3C15 B;  4CLT A;  4OYB A;  3ET6 B;  4OZ3 A;  4WP8 A;  4WPA A;  5D0G A;  1FX2 A;  1TL7 A;  4CM2 A;  1FX4 A;  2GVD B;  1CUL A;  4OYX A;  2WZ1 A;  4OYM A;  1YBU A;  2QV6 A;  4OYA A;  1WC5 A;  3MAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...