2B5JB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r165481
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase P66 SUBUNIT
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 95
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b5jB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jB03
2AQ4A 1SUQB 3SFUA 2XC9A 2FVCA 1SV5A 4IH5A 3DRPA 4RNNA 2IM2A 4TN2A 2IM0A 4IRCA 3MTKA 3G86A 3KK2B 3NL0A 3LP2A 4LSNA 2VG7A 4RW6A 3FDSA 3N6MA 5KT4A 4G1QA 1TV6A 3EPGA 3SFGA 1WNEA 1D1UA 1FK9A 2WONA 3EPIA 4WXWA 2IAJA 3TAMA 3TQ1A 1S9EB 4LQ9A 1JLCB 3KLIB 4WE1A 2XCAA 5L1KA 4NCGB 3RAQA 2FLPA 2UVWA 1S9GB 1HPZA 4R0EA 2IM1A 3DI6A 3BREA 4R8UA 1UWBB 1IKVB 3MEEB 1S6QB 2D3UA 1SH0A 3E01A 5KFPA 1MU2A 4RW7B 1S9FA 3HHKA 4ZMMA 1RTHA 1T94A 2W8KA 1DTQB 2RF2B 4DL2A 1BQMB 1S1XB 1TVRB 3DOLA 4KO0A 5KG6A 1R0AA 1NHUA 3PJXA 3G6XA 1SV5B 3DRPB 3KLVA 4O3SA 2J6SA 2HWHA 2JEFA 5K14A 3NAIA 3I0SA 5KFSA 5KT5A 2F8EX 1HARA 2XI3A 3LP2B 4NLXA 4LSNB 2VG7B 2ZE2A 3LAMA 1TL1A 4RW6B 2XCPA 1N48A 4MKAA 4G1QB 1TV6B 1JLBA 2BANA 2YKMA 4ID5A 2JEJA 3V6KA 4IRDA 4NLWA 1T03A 4RNFA 3V6HA 1EETA 4IRKA 1FK9B 5J2NA 1OS5A 2WONB 5KFEA 5KFDA 4YQWA 1C0TA 4MIBA 4QWCA 4YR2A 2IAJB 3TAMB 4NYZA 5KG5A 1RTDA 5KT2A 4WE1B 5DQHA 1IKYA 3QGGA 3MR2A 5D3GA 2V4RA 4KAIA 4Q0BA 2B43A 4IFVA 1HPZB 3FRZA 3KLHA 1S1XA 5HLFA 3DMJA 4QW9A 3DI6B 5FDLA 5KFWA 4R8UB 4ED1A 3KOAA 4EO8A 3E01B 3PW7A 1RT4A 4WZQA 1MU2B 4Q8FA 4U7CA 4Y34A 1RTHB 2IC3A 4TY8A 4ZPCA 4I2QA 4KHRA 1DLOA 3DOLB 4KO0B 1T05A 1R0AB 3BJYA 3RB0A 5KFAA 4RNMA 1S49A 1TQLA 2R2RA 4ZP7A 3DLGA 3JSMA 2WK4A 3BR9A 4TLRA 5KG1A 3T19A 5K14B 5JUMA 3I0SB 3DLKA 4IFYA 4ZPAA 1DTTA 4O4GA 1RTIA 4ECRA 2VG6A 3RB6A 4J9MA 3QLHA 3V6JA 2ZE2B 2HWIA 1TL1B 4WFZA 2W8LA 2I5JA 1JLBB 2BANB 2YKMB 4ID5B 3FSIA 3N6LA 3T5JA 5F8IA 1T03B 5J2NB 1NHVA 4HKQA 5DG8A 3G6VA 5EWGA 4QWDA 3T5LA 1C0TB 5J2MA 5L1JA 2FJWA 3QIDA 5KG3A 3V6DA 1RTDB 1IKYB 5D3GB 2IBKA 4IH7A 3KK3A 4Q0BB 4IFVB 2YNGA 1QUVA 3TVKA 1LWFA 3KLHB 5HLFB 3QZ8A 5C24A 1J5OA 1N56A 3DMJB 1W25A 2UUTA 5FDLB 1IKXA 2R2TA 3ITHB 4O3QA 4ZPBA 1HMVA 5KT7A 3GV5B 4J9OA 2AGQA 1RT4B 3CO9A 2BRKA 4MK8A 5F8MA 1KHWA 2IC3B 4TY8B 5DLGA 2UUWA 4I2QB 4Y2AA 1DLOB 1T05B 2ATLA 3MEDA 2WRMA 3GIMA 2J6UA 2GC8A 4MFBA 2E9ZA 1LW2A 2JLEA 2GIRA 3DLGB 2OPQA 3JSMB 4Y2CA 3OLBA 3MR3A 4IFYB 3DLKB 3BQ2A 3PW2A 4IOBA 1DTTB 1TKZA 4O4GB 1RTIB 5KFUA 3N6NA 3KHLA 2VG6B 2AX1A 3MF5A 3QLHB 2FJXA 2I5JB 3IS9B 4M95A 2ZD1A 1S4FA 2VA2A 4URSA 3NKYA 4M94A 2V4QA 4O3RA 3H5SA 5F8NA 2WTFA 4NLRA 5J2MB 4EBEA 5KT6A 4YMEA 3LAKA 4ECZA 2BRLA 3OLAA 3V6DB 4NLYA 5KFCA 4ZHRA 2R8HA 4ECXA 3KK3B 2YNGB 1ZETA 4MK9A 1LWFB 5C24B 1J5OB 2R8KA 4NLSA 1IKXB 1RT6A 3NBPA 3DM2A 4PQUA 4ZVFA 1HMVB 2ZKUA 3H5YA 2HNDA 3JYTA 1S1VB 1ZTTA 4JV0A 2VG5A 3D28A 4FS2A 3MEDB 4KBIA 4O3NA 4MFBB 5KFNA 5EDWA 1LW2B 2W9BA 2AU0A 3QIPA 2OPQB 3CWJA 1T3NA 2VA3A 2UVUA 2FLNA 2C2RA 4H54A 4ED8A 4NLUA 3H4BA 4IDKA 1TKZB 1S10A 4JV1A 3E51A 4EBCA 4O44A 3MR5A 4PWDA 2IJFA 1HYSA 4J9QA 4GC6A 5F8LA 4ED6A 2ZD1B 5JXSA 3BSNA 4ED0A 4IH6A 2AWZA 2R8IA 3RBDA 4MKBA 2HAIA 4KSEB 2YNFA 3RB3A 3H59A 1VRTA 3ISND 4ZHRB 1S1UA 1N4LA 3CJ2A 4NLDA 5HBMA 3T5HA 4J9PA 1BQNA 2OPSA 4ECTA 1RT6B 3DM2B 3NBPB 4PQUB 2O5DA 3GIIA 3H40A 4TXSA 3H5UA 1JX4A 2HNDB 3JYTB 5I3UA 4IKAA 4O4RA 4RU9A 2QV6A 3KMSA 4J9SA 2VG5B 3DRSA 4NLPA 1Z4UA 1HNIA 2W9BB 1HNVA 3I0RA 3QIPB 4XPCA 4F4ZA 3PZPA 5L1IA 2BQ3A 3M9OB 4Y3CA 4DL4A 4IG0A 4IDKB 3RB4A 5J1EA 4O44B 4ECSA 4PWDB 1HYSB 2JC1A 3HKWA 4EYIB 4XPEA 2OH2A 4QW8A 3FQKA 4ZPDA 4RUCA 3RAXA 2ASDA 3ITHA 2WB4A 5KFLA 5KFFA 5DGBA 3UQSA 5I42A 3SI8A 1IKWA 1C1BA 1IM4A 4HYKA 4FBTA 4URGA 2YNFB 1XR5A 5KFYA 4QWEA 3KHHA 3BSOA 3H5XA 3ISNC 1VRTB 1GX6A 2W7PA 4EYHB 2RKIA 3UR0A 4QPXA 1S1UB 4WFYA 3GILA 5HBMB 1N5YA 1BQNB 2OPSB 3UDLA 2DPJA 5J2PA 2YNHA 5KG2A 3CDUA 2BQRA 2DPIA 3RBEA 4K4SA 1HQUA 4F4WA 5I3UB 5F9NA 3IS9A 2IMWP 1I6JA 3I5BA 1RDRA 4DL7A 3T5KA 3MECA 3DRSB 4RNOA 1EP4A 1RT7A 2BR0A 1HNIB 2D41A 1HNVB 3I0RB 3QGHA 3V81A 4ZP8A 4DG1A 2ILYA 4IG0B 3QZ7A 5KG7A 4KHMA 5J1EB 3KK1A 1K1SA 4MH8A 3OSPA 1LW0A 4WYWA 1RYRA 1S0OA 2E9TA 3GV8B 1S0NA 5KFHA 3Q8PB 1TL3A 5I42B 4WFXA 4WXOA 2W7OA 1S1WA 1IKWB 1C1BB 2CJQA 2R2UA 2D3ZA 4ZP6A 4K4YA 1S1VA 4RW9A 3G6YA 3MR6A 2WCXA 5C42A 3GIJA 5KFQA 4ED7A 1JLEA 5F8HA 3NGDA 2B5JA 3FFIA 2RKIB 4NRUA 2XGPA 3MFIA 4J9RA 4RZRA 1N5YB 2AGOA 3IGVA 1KLMA 2B6AA 1QE1A 5J2PB 2YNHB 1RT3A 3PVXA 1XR6A 3I5CA 4LQ3A 3Q8RB 2V9WA 3C6UA 4DL3A 4NLQA 1SH3A 2JC0A 3CJ3A 4GC7A 1QAJA 1HQUB 2XGQA 5EWFA 2C22A 3H4DA 3M8QA 3PW5A 3MECB 4NLTA 1CSJA 1S97A 1EP4B 1RT7B 1VRUA 5DLFA 4ECUA 3V81B 5KFIA 2C2EA 4DG1B 3KK1B 2JEIA 2AGPA 5C5JA 1D0EA 3NAHA 1LW0B 4YR3A 3KNAA 3KJVA 4O3OA 1HQEA 5KFJA 3DRRA 1C0UA 5KFOA 1TKXA 3PR4A 4ECQA 4I7FA 5C25A 1TL3B 2IJNA 1S1WB 3DLEA 3OL9A 3GV7B 2WHOA 2R8GA 1RT2A 4TY9A 4RW9B 1FKPA 5C42B 1JLEB 2IA6A 2B5JB 3FFIB 2EC0A 3PW4A 5KFRA 2YKNA 3D5MA 3KLEA 4FBUA 1KLMB 2B6AB 1JLGA 1QE1B 4DL5A 1RT3B 3HVTA 1U09A 4K4TA 3LP1A 3CDEA 3C6UB 2RDIA 3PR5B 1RT1A 4PUOA 4B3OA 2R2SA 3IG1A 4X2BA 3CIZA 2W9CA 4Q45A 1C1CA 3CVKA 5F8JA 3DOKA 3M8QB 4TQRA 3QGIA 3OHAA 4F50A 4EO6A 4F4XA 3QYYA 5KFVA 1VRUB 3NMAA 3ICLA 1RA6A 3M9MB 2UVRA 3PHEA 4KB7A 1S0MA 2FJVA 1RT5A 2QE5A 1JXLA 3OL7A 2ASJA 3CJ4A 3OHBA 2JEGA 4K4ZA 2UVVA 5CYQA 3KJVB 1HQEB 3C6TA 3DRRB 1C0UB 4MK7A 1TKXB 1RAJA 2BQUA 3M8PA 4I7FB 3LANA 5C25B 3KLGA 3IGNA 5KFBA 2XWYA 3KHRA 3GQCA 3DLEB 1YVFA 2IM3A 5DG9A 5DG7A 1RT2B 5F9LA 5T14A 4K50A 1FKPB 5KFZA 3IN5A 4NLOA 4RW8A 4NLGA 4NZ0A 1S1TA 4IQXA 4LSLA 1GX5A 2YKNB 1RTJA 3KLEB 2AX0A 4YP3A 1JLGB 4WZMA 3HVTB 1MMLA 3LP1B 2W9AA 4I2PA 3IRXA 4Q8EA 1RT1B 4PUOB 4B3OB 3IG1B 1LWCA 4YR0A 4R5PA 2W9CB 1C1CB 4JV2A 3DOKB 4J9NA 2I1RA 3H98A 2FVPA 1JIHA 4H4MA 5F8GA 4Q44A 1LWEA 4KFBB 4J9KA 3VQSA 3QO9A 3BSAA 2WOMA 4TYAA 4K4XA 2OPPA 3DYAA 2V0NA 1TKTA 2C2DA 4ECYA 4KV8A 1JKHA 4JUZA 1RT5B 3KLFA 5KFXA 1ZTWA 3Q8SB 4J9LA 4RW4A 5CYQB 2OPRA 3C6TB 3BQ0A 3BGRA 1REVA 2FVQA 3M8PB 3KLGB 1KHVA 1S6PA 5CYMA 4TYBA 3OL8A 5DGAA 3V4IA 2J6TA 3CJ0A 3KMQA 2HNYA 4XO0A 4IR9A 3MFHA 3KHGA 5KFKA 4U6PA 3UPFA 1FKOA 4RW8B 1RA7A 3I5AA 4F4YA 2C28A 1S1TB 3BSCA 4LSLB 2FVRA 1RTJB 5HP1A 2BE2A 4ZVEA 4IG3A 1JLAA 2YNIA 2GIQA 2ALZA 4I2PB 3IRXB 4ICLA 4ZP9A 4DEZA 2HNZA 3OL6A 5L1LA 5KG0A 1S48A 4FS1A 4RNHA 4ECVA 1LWCB 4R5PB 1N6QA 3GYNA 2ASLA 3MEGA 2FVSA 1XR7A 1K1QA 2ILZA 4H4MB 4G3IA 1LWEB 4QWAA 4KKOA 1JLFA 3QO9B 2WOMB 3LALA 2OPPB 3DYAB 1TKTB 4K4UA 4KV8B 1JKHB 1NNDA 2XI2A 4WYLA 3LP0A 5DQGA 3CDWA 2HMIA 1EETB 3H2LA 4ZVHA 3KLFB 5KFMA 4Q43A 1JLQA 1TP7A 4RW4B 5HROA 4KFBA 2OPRB 5J2QA 4H4OA 1SUQA 3BGRB 3DDKA 1REVB 3PW0A 1S6PB 5CYMB 4EEYA 3V4IB 5L9XA 5DQIA 3HVWA 2HNYB 4DL6A 4RUAA 4IR1A 3Q8QB 4URQU 2FLLA 2CKWA 1SH2A 4EBDA 3KK2A 1FKOB 5KG4A 4NRTA 4K4VA 5KT3A 4TQSA 3GIKA 4ED3A 5EUHA 5HP1B 2BE2B 4IG3B 4OL8A 1JLAB 2YNIB 3EZUA 2E9RX 5EWEA 4ICLB 2RDJA 2HNZB 5KFGA 4O3PA 1N6QB 4NLVA 1S9EA 3OSNA 1JLCA 3KLIA 3MEGB 4KE5A 4NCGA 4MIAA 4ED2A 1S9GA 4KKOB 1JLFB 3FQLA 3BQ1A 3HVAA 2R8JA 5KFTA 4ECWA 4K4WA 2D7SA 1UWBA 1IKVA 3LP0B 1S6QA 3MEEA 3T1AA 2HMIB 3CJ5A 1RYSA 3M9NB 1JLQB 4RW7A 4QWBA 1C2PA 1QAIA 5HROB 3PJWA 4ZVGA 1DTQA 2RF2A 5J2QB 1BQMA 4H4OB 1TVRA
chains in the Genus database with same CATH superfamily
1H2VZ 3TZZA 3PKMA 5LJ3Y 2IM2A 2DGUA 4X4PA 2KI2A 2V63A 3B8HA 4CRJA 3TAMA 3I9V9 2XCAA 1FRIA 4CI0B 3VAHA 4FF3A 3ZZOA 1NM2A 2E1CA 2HFVA 2MQOA 2XHCA 3RG6A 5GAHU 4KO0A 3OVSA 2VZ9A 1DQAA 4CDIA 3MCSA 5K14A 2DIUA 2OD4A 1HARA 3LAMA 3SZ2A 4CH7A 1RKIA 3V6KA 1NDLA 4YQWA 4I1TA 4N76A 4X62J 1QAYA 3TAMB 4I68A 1MN9A 3CEDA 5D3GA 4M5DA 1DQ9A 5F3ZA 3CCLS 3DMJA 1D9DA 2AJ0A 4DFPA 3CE8A 4Q8FA 3POTA 3GG1A 4KO0B 5K14B 4ECRA 1Q82T 3R7BB 4A8XA 6AT1B 2XZWA 2GAHC 1UZDA 5EWGA 3UO0A 5L1JA 3VZHA 5D3GB 4M5DB 3DMJB 4DV4J 3BGUA 4O3QA 5KT7A 3T1HF 1WTBA 3POTB 1IWGA 4OYOA 3KG4A 3UW1A 1XWLA 1U24A 2X1AA 1W2IA 2LDIA 1SC1B 3BH7B 1FRKA 2V4QA 2WTFA 1SC3B 3DN9A 3D0HE 1N88A 1QAXA 2DGWA 2J5AA 1QVFR 2VKRA 2R42A 2RDDA 3UVJA 1B64A 3BPDA 1T0TV 1VIOA 3VAFA 3EICA 1Q86T 1N34J 4W92B 1RWUA 3GJTB 3E8OA 4X62F 3W65A 4QBUA 3H59A 5A0YA 4CCHA 3UVJB 3IAS9 3GIIA 4ZS6A 2YWEA 1JX4A 1KONA 2DR9A 4B9MA 3NS7B 5JJBA 3DRSA 4L76A 1LWXA 3UNGC 1U1KA 4ECSA 1Q95G 1NJWA 2J9EA 2JC1A 4ZPDA 5J1NA 2XYGB 1HA1A 5KFYA 3KHHA 2GNKA 5A0YB 2CRLA 2RKIA 5CH7B 4DV4F 3CDUA 1PJ5A 4CT9A 3QQCD 3DRSB 1TL4A 3OTEA 2FD2A 2R7OA 2HQFA 3OVBA 1S1WA 2CJQA 4RW9A 2M7SA 3M1VA 2W2PP 2RKIB 4P7VA 4LF9J 2CQBA 2ZHBA 1QE1A 4DL3A 4GRSA 4GC7A 1T9VA 3GJQB 1HKAA 4OHVA 4WKYA 1V5IB 3RYLA 1N34F 3TUZC 5KFIA 4W98A 2P9EA 3W8PA 2POKA 1TKXA 4ECQA 4FXDA 1S1WB 4RW9B 3M1VB 1RSCA 1FE4A 3DC2A 1QE1B 3KTQA 3J80U 2RDIA 5AXMA 3W62A 4X2BA 2I6WA 2V50A 3TEGA 3NMAA 3SSRA 2PN6A 1D8YA 1ICEB 3C6TA 2IRUA 4MK7A 4C3LA 1TKXB 1HWUA 4DL0C 4ZVPB 5T14A 1FXDA 1J27A 4IQXA 2H5IB 1UA1A 4N41A 3CCJS 3AQOA 3W9JA 1LWCA 2K3KA 4QYZJ 3H98A 4ZKAA 3K5NA 1RB0A 2EBEA 2O66A 4RW4A 2KZMA 2ATCB 3C6TB 3NWRA 2MQNA 4PPDA 4RUBA 5CYMA 4Y2KA 2AYBA 3CJ0A 3NGUA 4KH1B 4LF9F 2MMYA 1KFSA 3TW0A 2W01A 2HZVA 1JLAA 4GKJJ 5BXIA 4F36A 1LWCB 1N6QA 2BJDA 1AUSL 1NH8A 3LP0A 4DQPA 3H2LA 3HHLC 4NYOA 2QGFB 4RW4B 1SVDA 2P9CA 2WBMA 5CYMB 3D0IE 4URQU 3OR1A 4CLFA 1SH2A 1HNZJ 3B82A 1JLAB 2RDJA 2OO4A 2ZJQQ 5KFGA 2B9WA 1N6QB 3HXMA 2YWWA 3LP0B 1W26A 3RR7A 1BQMA 1KQFB 2ZZMA 3OR1B 4J37A 4PR6A 3CTRA 4NXMJ 1WNEA 1FK9A 2IYIA 2WONA 2OEMA 2RJZA 2RSQA 3FJ2A 1PAEX 2FLPA 1GTHA 2VBYA 5KTQA 3OJUA 3O8WA 5ETSA 1BQMB 2WVFA 3HDSA 2EFOA 2JEFA 2FUG9 5KFSA 4RL1A 3HP6A 4ID5A 4GKJF 3KKFA 1FK9B 2WONB 1QLNA 1RZMA 1CJVA 4MIWA 2JFKA 3R3TA 2LU1A 2CQDA 3MD1A 2DGQA 3BR9A 2FGCA 4ZPAA 1I51B 1HNZF 1WOPA 4ID5B 5E2QA 1HBOA 1NHVA 3ILJA 2YY3A 5HO4A 1CJVB 1KEKA 1FJCA 2GVDA 2MKHA 1LWFA 5EX3A 2EFGA 2KFZA 1XIQA 1ZA2B 3EGWB 5CXTA 4QR0A 3TUIC 2LYVA 1NK7A 1HBOB 4O3RA 2HRYA 2C3PA 1FVQA 5HMYA 3IWXA 4ECXA 2GVDB 1LWFB 1VRQC 4KGXB 1WKKA 3DM2A 1DY3A 3MM6A 4ZVFA 1JNRB 2FY8A 3R5GA 3D28A 3Q2SC 1CJKA 2CQHA 2CPHA 1TFYA 2FLNA 2ZH8A 3LTOA 2YWGA 1JJ4A 3H0PA 2HAIA 3BKUA 2WVCA 2P9GA 5GMEA 3PXGa 3DM2B 3MM6B 2HS4A 4TXSA 2M52A 3WIUA 4O4RA 4M5KA 1CJKB 2XS5A 1VCTA 4B3RJ 4F2RA 3ULHA 4NA3A 3FQKA 3T3FA 4LVOP 3ZTOA 4JI1J 4PQAA 4OZ2A 4I0WA 1DQ8A 4OI0A 4MKYA 2Z57B 1VHFA 3ZTSA 4RNOA 2RQ4A 4KT0C 3QGHA 4FXWA 2V8VA 2ZZTA 2BA9A 3KUEA 3S8SA 4AL6A 2KO1A 3LH2S 1CJTA 2E5HA 5KFHA 3I9ZA 3HSDA 2GJIA 2QLJB 2LXFA 2ZOGA 4ZP6A 1R27B 5HATA 2CYYA 2G2YA 3NGDA 3ZZ0A 2XGPA 1SCJB 2HHPA 5IC6B 3TVZA 4LQ3A 4JI0F 4ZVOB 1MWYA 3J7AN 1KTVA 4X64J 2FY1A 1F9HA 3B4MA 2LCWA 2AGPA 4O3OA 1CJTB 3G8QA 1U47A 1UPMB 3KDNA 1FESA 3SCJE 1PC4A 2HVEA 3NGKA 3TX8A 2IA6A 3F56A 3CCMS 3K5LA 2Q3PA 2H4WB 1D9AA 3V5RA 3G87A 3LGNA 5DDOC 3SXLA 1FI4A 1YJUA 1JXEA 5L46A 4BBYA 3M9MB 4B3RF 1IWAA 3J7A1 1U2FA 5AJ3J 4F0KA 5L8RC 3M8PA 2HK2A 4PXCA 4JI1F 2F4VF 5KFZA 2CQ2A 4NLOA 4LF6J 1ZM9A 3LPEA 2HS0A 2GGPA 2FHOB 4OX9J 5CABA 1YX2A 1S72S 4P2XA 1AZSA 2I1RA 4J9NA 1TK8A 2FVPA 2HHWA 3UE2A 2V0NA 1Y9OA 2FIUA 4JI5J 1SJQA 1XJWB 1REVA 3M8PB 2R7RA 1Q8BA 3EWGA 1RHQB 1RA7A 3W5XA 1X4FA 2GIQA 2GGPB 1AZSB 4X64F 2J7UA 1HBNA 1SBRA 4M5JA 3NOGA 1JLQA 5HROA 4WK3A 2QYGA 1REVB 1W2BR 1YGYA 2XMWA 3O3LA 4IOCQ 3KG1A 1IJFB 1RAIB 4DXLA 4TKTA 3PX0A 1YTYA 2JVOA 1S9EA 3KJQB 1JLCA 3NCRA 1H0HB 2VPYB 3TRGA 4ELUA 1HBNB 2BBEA 4YFUA 5A6PA 1HWKA 2OTJS 5AJ3F 1JLQB 4OFZA 5HROB 1LXNA 5D8HB 2RF2A 1EX8A 3M2VA 3TUJC 4LF6F 5H1SV 2KYZA 3OUYA 4OX9F 3EUNA 1S9EB 1ZZNA 2HHXA 1JLCB 2ZBPA 1G1XA 4DSEA 1RHMB 3D6TB 4JI5F 2RF2B 2XMMA 5DM7Q 1S79A 2KRBA 2CJKA 3NAIA 3M2VB 4PG4A 4U8VA 2EKYA 2UXDJ 3LUYA 3WIVA 2IVFB 3OUYB 5J2NA 1FNXH 4LBIA 4Z7YA 3G71S 1X4EA 4KAIA 4MTPA 3R27A 2IVMA 4W90B 1KS2A 3FZBA 1OWXA 2C2KB 1VBXA 5F0UA 1O0PA 3UDVA 3T19A 2W1BA 3DLKA 2WZ1A 5T7LA 5F0WA 2NPIA 5J2NB 1IXKA 4K2JA 2WBRA 4TNOA 3HSGA 3R1HA 3MAQA 4CIOA 3ZTRA 1S99A 5F8MA 5A8RA 1SB6A 4YB7A 2GIRA 1VQLS 5D4NA 4MYTA 3DLKB 3TJAA 5T7LB 1LXJA 3KHLA 3Q24A 4X66J 1I3OB 4DU8A 1WC6A 1S4FA 5F8NA 2CJAA 1IBCB 4NLRA 2HBYB 2BW7A 4F2SA 1HNXJ 1Z2LA 3D6MB 3R5BA 1ZETA 2CPEA 2NXEA 2V2ZA 4CYUA 5A8RB 2DNKA 1KTQA 2B9EA 2DNHA 4ILRA 1P6TA 1ZA1B 1NKCA 1Y11A 1U1PA 1ZAWA 2XO6A 4KY3A 2IJFA 4OI6A 2VJVA 3IR5B 4WTYA 3FEZA 2XM3A 3PJ9A 4DZ6A 3HI9A 3HKZD 2F3JA 1G4CA 5HBMA 2HIYA 2PO4A 3H40A 1T02A 4CYUB 3EJMA 3THTA 4HT7A 2P5VA 4P10A 4UOFA 3PFOA 2HKEA 6FD1A 4YUDA 5DGBA 3UQSA 3PACA 1TL7A 4WFYA 5HBMB 2DPJA 1SL2A 1FDDA 4N56A 4X4TA 1F2HA 2RAQA 5DDQC 4OI1A 3X1LB 3V81A 3E2EA 4X66F 4MH8A 4UOGA 2GAGC 2W7OA 3PV8A 4MAKA 1HNXF 1TL7B 2WAQD 4Y00A 3IWNC 1K0VA 3SSQA 3M4XA 4NLQA 5HL7Q 1FFGB 4A8KA 4HDHA 3DLJA 4R25A 3FUYA 1NK0A 1R0CB 9RUBA 3V81B 4FYVB 3NAHA 3J7ZT 1LK5A 2CNKB 3KNAA 4LSZB 4C8MA 5KFOA 3AOBA 5A76A 2ZOFA 1EQMA 3A3NB 2MSTA 7FDRA 1FEHA 5E41A 1C1CA 2RQMA 2A2CA 1CC7A 2Q6CA 4F4XA 1BE4A 3GP9A 5KFVA 2DXDA 1RAOA 1RA6A 1S0MA 3H7HB 1YHQS 2J9DA 3O5TB 3AJ2A 5KFBA 2M9KA 2VFSA 4DPUA 3IN5A 2CQGA 3ADAC 4Q7AA 2GHPA 1GX5A 1TFWA 2F7VA 3S7RA 5D6GA 3PKYA 1JK9B 1C1CB 1JIHA 5F8GA 4NA2A 3TA0A 2WSCC 1N5SA 5KFXA 2YWKA 1CEZA 3BQ0A 3QT8A 3C16A 4LFAJ 2VPXB 4NE9C 3US5A 3QT6A 3ZNJ1 2YX7A 1S48A 1WI8A 3BV8A 5U47A 3N0VA 5IT9Y 3UDEA 2A18A 2XI2A 3H8YA 4UY85 1EETB 1MLAA 2HQIA 4EWTA 3ZTPA 3C16B 4LREA 3EZ5A 2FC8A 2XHWA 4RUAA 3ZZRA 3J7YU 3EDQB 2IFXA 2MGZA 1DBDA 1SPBP 2JVRA 2OUGA 4X84A 3RRGA 3MCMA 4KE5A 2U2FA 3ENAA 3T41A 2QTWA 3HVAA 5IFMA 3UD4P 1S6QA 3M9NB 3UCZP 2BJ8A 1DTQA 1YRTA 2PEBA 3HHDA 2V6AA 2G1DA 2MGZB 3FCHA 3CJRA 3PTWA 4GVBA 2IAJA 5E3RA 4U7UK 4JYAJ 2P8IA 3BREA 5GMKa 3ZO7A 2MZSA 2NSBA 1S6QB 3I87A 1DTQB 4C11A 2CQ0A 4LFAF 1HLWA 1NB2A 1FWPA 4C97A 3RGIA 5K9FA 1B7FA 1RU1A 1N48A 2BVZA 2EFPA 3V6HA 2CQPA 1OS5A 1X5OA 4QWCA 4GVBB 2IAJB 2AV5A 5DQHA 1C4CA 3TWZA 5FDLA 2HBRB 2LXUA 3DNCA 2DH7A 4C11B 4FNHA 3JSMA 4TLRA 1R0BG 4LRFA 3FRYA 4J9MA 4WFZA 2W8LA 4USMA 1FDAA 2DGXA 2UXCJ 4DV1J 2BOAA 5FDLB 2MDAA 2UUWA 2LEPA 2MZ1A 2DNPA 5D4PA 3JSMB 3BM7A 3RJMB 4IOBA 3R6LB 2AX1A 3OTCA 5SZTA 1ZZFA 2DK2A 2V34A 1H38A 2HQCA 2VA2A 1Z2ZA 3H5SA 1GXUA 4JYAF 4MK9A 3IC1A 2PSZA 3NBPA 4PQUA 2FYXA 2ZJPQ 4HDGA 5IQ6A 2V67A 4KBIA 1XERA 3QIPA 5HMXA 5AE1A 3HF5A 2AZ1A 3OD2A 2FQQB 2E5IA 5A8KA 3EZOA 1D8ZA 3Q0AA 2R8IA 1JJ2R 2Z58B 3JQJA 4DQSA 2EG2A 3CJ2A 3KFWX 3NBPB 4PQUB 1SXLA 1TELA 3K8WA 5IM0A 1RWMB 3QIPB 4DV2F 3PZPA 2J76E 4IG0A 2DR6A 3KNGA 4C8KA 2H51B 4MKVA 4EYIB 5A8KB 4RUCA 3SI8A 2UXCF 5I42A 1NK6A 3BSOA 2Z30B 3EGNA 1FT8A 3M2UA 4DV1F 2VOPA 1TUGB 4CLKA 5IWAJ 3MURP 3F44A 5I3PA 5IM0B 1RT7A 3KDOA 4IG0B 2VOOA 2YWHA 3CPWR 3PYEA 2ZVIA 5B7WA 2E9TA 1OO0B 2C2ZB 5I42B 2CPFA 2JL9A 1VFJA 2QN6B 3M2UB 2AGOA 3TARA 3PFEA 1X7VA 1VQNS 4AL5A 1HQ2A 4NLTA 1CSJA 3TANA 1RT7B 3AOCA 3DXSX 4OHXA 4ETXA 4PEOA 3BGFA 2JEIA 1SL1A 5LJ5Y 4UOHA 3TR5A 5IXUA 4C9DA 1RQ0A 3W60A 3MPWA 3N9UC 2R8GA 5DETA 1FTCA 2XSJA 1VI7A 2MKSA 3PYFA 1S4EA 2HZCA 2D9PA 2XWXA 3CIZA 4Q45A 3NGRA 2FC9A 1B0PA 4F50A 5LT5A 4KB7A 4B9SA 2QE5A 4OYPA 2HVHA 1M5OC 3KYLA 2PEHA 3IGNA 2ZHAA 3K89A 2XSJB 1VMBA 5FLXY 1N32J 1DRZA 1R8PA 5IWAF 3A12A 3TAPA 2OD6A 2C2DA 1IBMJ 3MPDA 2LVWA 4OIXA 2HFNA 3PM9A 2EI5A 3KHGA 5ETQA 4F4YA 3UD5A 4FS1A 2JFDA 3HSJA 4EK2A 3Q8RB 4HVZA 2R9LA 4ZLLA 2E7VA 3K5MA 1S59A 3MAAA 1NJZA 3DOMA 4J9UE 2DCUB 3HFKA 3MOZA 4OJHA 1SIZA 5EWEA 2MKCA 1KOOA 1V3RA 2B4OA 2R8JA 3MAAB 2HFOA 1E6VA 4IH5A 1IR1A 4DR7J 2KHDA 3RW6A 3DOMB 2ZFHA 5AE3A 3G86A 2QMUB 1N32F 3NNCA 3N6MA 2DR5A 3VAIA 3QRPA 1VS3A 5HJYA 1X31C 1IQTA 2XYPB 1F60B 2RT3A 2VODA 2XZDB 1SH0A 3L3CA 5KFPA 4HLBA 4DL2A 3VWSA 3ETMA 4ED5A 2VQEJ 1PBAA 1E6VB 4O3SA 2M2BA 2VHGA 4JI8F 2BANA 4ES1A 2CJBA 2HRTA 1EHWA 1RT4A 1R7IA 4Y34A 2OTLS 2GHVC 3DLGA 4B9UA 1R8BA 1VJWA 2MLYA 1IR2A 2I5JA 2BANB 2AF6A 1NAQA 4HKQA 1U1LA 5J2MA 2DISA 1QD1A 1N56A 4EFAC 2ZOMA 1IKXA 2R2TA 3ITHB 1X0PA 2DXEA 1RT4B 2W7AA 4PPZA 4AFFA 1SKSA 2E9ZA 4YS2A 4DQQA 3DLGB 1KDNA 3MR3A 2DD8S 3PW2A 1Y0HA 2R3VA 2J0SD 2I5JB 1I5OB 1IUJA 5J2MB 4NLYA 4A4JA 4ZHRA 2CZ4A 1OYEA 4M5GA 3W5ZA 1TAUA 4NLSA 1IKXB 1RT6A 2VUGA 4DOZA 2ZKUA 1U4BA 3H5YA 4RO0A 1QSSA 2HNDA 1S1VB 4JV0A 2VQEF 2GV1A 3QT7A 3UN5A 4PG8A 2VA3A 2OKQA 2KT3A 3H4BA 4IDKA 4H4KA 4EBCA 1XN9A 1WORA 2LEAA 2VFRA 2DGVA 3GLJA 4ZHRB 4K0KJ 1RT6B 2HAFA 2HNDB 4DV7J 3TA1A 4DF4A 1HNVA 3I0RA 1FDNA 3SEOA 4IDKB 1WEXA 3B6BA 2H4YB 2VICA 3RUBL 4HYKA 1HL6A 2V68A 2ZH4A 5LSRA 4C2MA 1N5YA 2A10A 4ZCLA 2BQRA 1TK5A 1BUXA 2QIFA 2DR7A 3QFWA 3I5BA 5L9NA 1HNVB 3I0RB 4GVLA 4KHMA 1FFSB 1FRXA 1RYRA 1M0SA 2QA1A 3SMZA 3DDNA 5B0FA 2AD9A 2BXJA 4OI3A 1LNQA 4RZRA 1N5YB 2V9WA 1Q8LA 2JC0A 1Y7PA 2XGQA 4ZPTR 3F73A 2DRAA 2VFTA 2XMUA 2C2EA 3IP0A 5E3CA 4UF4A 3P5TL 2DITA 3ZFVA 3GV7B 5RUBA 1UVMA 1CG2A 3A3PB 2L41A 3K2YA 4K0KF 4FVMA 4NCBA 4B3OA 2R2SA 1GH8A 4DV7F 2RU3A 4OZJA 2MJNA 4K5RA 1AYEA 3BO2A 1MG7A 1YJRA 2WW8A 1AROP 1RAEB 3NS6A 2IM3A 5DG9A 4V19X 2A1BA 3RAMA 4LSLA 1RTJA 2VU5A 2XS7A 4B3OB 1TMMA 3QO9A 2WOMA 2OPPA 2CQ1A 5HAOA 5K5MA 2OAUA 5IQQA 2CUYA 2ADCA 2RQCA 2B8QA 3TJ8A 2KTQA 5L38A 4LSLB 2PE8A 1RTJB 3F0NA 2HNZA 2ZUGA 5L1LA 4DPOA 2MHNA 3QO9B 4F25A 2WOMB 3LALA 2VL1A 2OPPB 1HI8A 1G6BA 4BS2A 3RR8A 2IMOA 1FCAA 3GYGA 4FKXA 4IR1A 2FLLA 4XDDA 5KG4A 3JAMY 3B4DA 4OJ3A 2HNZB 1K0TA 1YJ9S 2ZUAA 4ED2A 1S9GA 4X4NA 2DEJA 1L3TA 1UWBA 1KFDA 2ROEA 2DBBA 2BJ7A 1WDDA 1S1XA 1TVRA 3HULA 2AQ4A 1IBLJ 1SV5A 4RNNA 3OQ2A 3HLUA 2FLOA 3CDAA 1NDKA 4FZVA 3NL0A 4LSNA 4CLZA 2H3EB 3SCIE 3EPIA 4L3NA 4RBUA 2HEKA 2NYIA 1S9GB 2XEXA 3DI6A 1UWBB 4KRWA 2HVZA 4P52A 1S1XB 1TVRB 3P45B 3PJXA 5IT9U 1SV5B 4CLSA 2NQPA 2HWHA 4FNIA 2FHKA 2MB0B 4HH0A 4LBPA 1B0VA 3J7Z5 2F8EX 4LSNB 4MKAA 2JEJA 3W64A 4RNFA 3D1QA 4K8RA 1RTDA 1IKYA 3DI6B 2M88A 3KOAA 1TZ0A 2LA4A 4YB6A 4QYZK 2CNNB 1S49A 3RZAA 3NOCA 2U1AA 1DTTA 1OQ3A 2FDNA 2VG6A 3RB6A 4LUBA 3T5JA 2Y1LB 4ATNA 2D69A 3MUVP 2BJ9A 1RTDB 3EVMA 1IKYB 4CO2A 4M5LA 1J5OA 1N54B 2ROGA 2UV8G 1IBLF 5J1PA 4MFBA 2HURA 1DTTB 2J0XA 4DUZJ 2VQFJ 2VG6B 1N52B 2VV5A 1NCLA 1HW9A 4G65A 3MMCA 1KWMA 3UI3A 1YDLA 3KJNB 1P27B 3MEKA 3DGVA 1J5OB 2GMJA 2R8KA 2G2ZA 2UV8A 2HFUA 4B17A 1SL0A 4MFBB 2VKZG 2G1HA 3V2UC 4KH0B 4ED8A 4Y65A 4JV1A 2LKZA 4J9QA 2DGTA 2WVBA 2KRRA 3BPSP 2MZJA 4USVA 3P4UB 1N4LA 2ZNYA 4DU7A 5BJRA 5B09A 5IS2A 1BQNA 2LLZA 4L6V3 4USKA 2DCLA 4AXIA 2HYIB 2XMKA 4J9SA 3MD3A 1U6ZA 2OMLA 3OFHA 1RHJB 3HKWA 5HVFA 1A7GE 4WPAA 1LK7A 4QWEA 3U27A 2O1PA 3ZZZA 1BQNB 4ZDNA 3A8KA 2YNHA 4WIIA 4F4WA 5B0AA 1ZPVA 2IMWP 4DL7A 2QLFB 2OP5A 4DUZF 2VQFF 2H65B 1K1SA 5DO2A 1S0NA 2K8GA 3VCDA 4WXOA 2R2UA 2NXCA 3C66A 4I6AA 4NRUA 1R8HA 2YNHB 1G7CB 3NCPA 4AUKA 5A2QY 2V8DA 4M1KA 1Q5YA 4NCAA 1F9FA 1SIWB 1U48A 4OX6A 2CXEA 1WHXA 2YKNA 2C1EB 1JLGA 3HVTA 2IJRA 3CDEA 1TMJA 2ZJRQ 3IG1A 1BMQB 1SJ4P 3CCSS 3CVKA 2JNJA 3K8VA 4K59A 2VBZA 2CJXB 5F3TA 1YVFA 5DG7A 4P6QA 3QMQA 5E3AA 4QU6A 2YKNB 1JLGB 3HVTB 3IRXA 2Y1IA 3IG1B 3QWUA 3OT9A 4WFAQ 2ZITA 2QC3A 3IBWA 1QDUB 4CLLA 3CUNA 4RWXA 1FXRA 3L7UA 4KPYA 3CCRS 2QSWA 4CM0A 3LPYA 4PXBA 2OELA 3WX8A 3CJQA 2BE2A 3VQTA 3G96A 2ALZA 3IRXB 5LXRA 3K5OA 4HI1A 1EIYB 2RU9A 2FVSA 1XR7A 1BWVA 2A6MA 1JLFA 3D6HB 2A3JA 1YQHA 1U0HA 4LF1A 5DQGA 1P8GA 5J2QA 3NLCA 4NEYA 3TUPA 3AT1B 2YKOA 2QL7B 5HMWA 2GO9A 4C3KA 2BE2B 2E9RX 2I8EA 1PC5A 3GG0A 2V8PA 4ES2A 5G4DA 5FLXU 3OSNA 3FQLA 4AQYJ 1JLFB 4FYYB 4DS5A 1NK9A 1U0HB 1VYAA 2LMIA 1K8AT 2KL8A 2N3LA 5J2QB 3PIPQ 2RRNA 4CLUA 1S76D 4OHZA 3DLBA 1LV5A 2W25A 2CQ4A 2L9WA 3ETOA 5KT4A 3EMTA 4TU8A 2GZOA 2H9ZA 3ILLA 2CIMA 1EZZB 3TQ1A 2ZZNA 4P72A 3GFXA 3GZ7A 1B4SA 4YN3B 3CMES 3LF0A 3IBFB 2Z2ZA 2GIFA 4OMFG 3M6UA 1GMWA 2COLA 2CWKA 1Y10A 1TL1A 4M8LA 4NLWA 1T7PA 1FTRA 2BM0A 1UVKA 2EWHA 2ZEJA 3MPVA 1NKEA 4LRBA 3W1YC 4ED1A 4MMOA 4X4VA 1UCNA 4QPTA 1OSCA 5CZVA 3Q8VA 4C8ZA 4PXEA 1H74A 3W61A 1KQGB 2KXNB 3U7JA 1TL1B 5E7OB 2P2CB 4ILMA 2N4DA 1R8AA 4ZVSB 4P2SA 2KXHA 2CWXA 2FJWA 2QL5B 1W25A 2UUTA 3MM8A 3IM9A 3GONA 4Y2IA 2WRMA 1FJEB 1FEEA 1F5AA 3OLBA 2MLXA 1ITPA 1HHQA 2YPZA 4URSA 3UCGA 2GMHA 2O01C 4KGVB 1I94J 1T8EA 3OLAA 1FDBA 2R8HA 1NSPA 3D4JA 3AQPA 4RU2A 3MM8B 1U1MA 4A48A 4LFBJ 5KFNA 1VBYA 5E3QA 4HT5A 2QZ8A 4ZA1A 2PGCA 4HH1A 1X5TA 4F4KA 3C2PA 1ZAVA 3JSYA 1OY6A 4TU7A 1YZ6A 2RILA 3T5HA 1HWJA 3P96A 3UNYA 4DN9A 2CG8A 2LU2A 1RWVB 3QNWB 2E5LF 3EYZA 2E1PA 3VALA 1X5PA 3QATA 1VQ7S 4XPCA 2VB6A 3M8RA 3M9OB 4Y3CA 4DL4A 1WC0A 2ZDPA 1YJTA 4C8NA 2FZCB 3H20A 1HBUA 3BEGB 4U7UD 2WSFC 3MUMP 2DHXA 4BC7A 2APOA 4PXDA 1Q5VA 4EUVA 7AT1B 4DV3J 3KWMA 2YKAA 2Z8QA 5F9NA 3CB4A 3CJTA 1O5JA 4OHWA 2RD5C 3QZ7A 3WQPA 1YK9A 4O0NA 1VOMA 1QSYA 1HBUB 3Q8PB 3GWCA 1I94F 3M8SA 2MQPA 3S1TA 3MR6A 1EKSA 1VJQA 5F8HA 3MM9A 4L3KA 1PYTA 1KLMA 2B6AA 2E1MC 4NL5A 1N8RT 2OJ3A 4M5HA 2C22A 3CC4S 4LFBF 3NNAA 1PYSB 3O44A 4CLWA 1N0UA 3QAUA 3BKFA 4PG6A 2F1FA 3TOQA 1M1HA 1X4CA 4I7FA 1RT2A 1PJ7A 3NMRA 3HMJG 3MM9B 3FSXA 5KFRA 3D5MA 1KLMB 2B6AB 3C3LA 3CCQS 4HL9A 4RBTA 2IBOA 1PAUB 3UD3P 1Q81T 2MKKA 4ZCMA 5CYQA 3FCWA 4KGKA 4I7FB 1KQSR 1RT2B 3PEHA 3ZZPA 2V8HA 3FBEA 1HI1A 2X3DA 2Q79A 1S1TA 2AX0A 4NEZA 3LA0A 4DV3F 3F41A 4HI2A 3U1MA 1J2VA 2ZH2A 3AODA 3GFHA 4E98A 5AXLA 1EJ7L 4J9LA 4B9NA 5CYQB 2CZVC 2VF3A 1ZM4A 4XO0A 3MFHA 1S1TB 2ROPA 4PYAA 3OL6A 4F8RA 5ETMA 1X9MA 1RABB 2ASLA 2IDLA 2ASYA 3R5CA 3ILIA 4DQIA 1U7LA 1R6YA 4HHUA 1WEZA 3SV3A 4NA1A 1UJ6A 2G0CA 3CULA 4CH0S 1KR4A 5CYJA 2KKHA 1NPRA 5C2GA 3A13A 5KT3A 4JI2J 1R31A 2QEXS 4F26A 1VIXA 2G4BA 1SKWA 2HGLA 1PIEA 1SJRA 1DFDA 2DY9A 4B08A 4IRCA 3MMJA 1KNZA 1CULA 3CD6S 3W8GA 1RE1B 3GU0A 3IFEA 4M63A 3G9CA 1XK8A 4Y28C 2UVWA 5HVGA 3QRQA 1D3WA 4R8UA 1CS4A 2RHSB 5DDPC 2IDEA 4B3TJ 3G6XA 3M6WA 1R0AA 4OYBA 3GYXB 1CULB 2VONA 1F2GA 5KT5A 1KVJA 3LWMA 2KU7A 2UU9J 2LEBA 2CPJA 4C98A 2NXNA 4CO1A 5KFEA 2D74B 3DU6A 4CZCA 3JAMU 1RLCL 2GMLA 1N5TA 4R8UB 1CS4B 4WZQA 4KHRA 3BJYA 1R0AB 1RBAA 3H2VE 3QLHA 4JI2F 4ZN3A 3T5LA 3L9ZA 3QIDA 1PG5B 3HT3A 2IBKA 3KK3A 2HFSA 3CO0P 2WSEC 3AB4B 3R5JB 3SBMA 1UVJA 3FK4A 3QLHB 1UA0A 2CPXA 3BS9A 1WACA 3GJRB 3I4PA 2H5EA 2KG0A 3KK3B 1RADB 3W9HA 3AB2B 3JYTA 1ZTTA 3VAKA 4LF8J 1ZOTA 4B3TF 2VG5A 4FS2A 4A8SA 4LRCA 2PA8D 5EDWA 3CWJA 3THVA 1URNA 2W2QP 2UU9F 1UFKA 2QMWA 2ZBCA 4IH6A 2YXLA 3W66A 2J0WA 4EGLA 2LQ9A 2VBXA 2K06A 4DR4J 4DCJB 3JYTB 4IKAA 3C8YA 3DXBA 2VG5B 3D3CJ 1VC6A 4F4ZA 4OI4A 2WW4A 5D4LA 1QTMA 1C1BA 3Q8UA 2LECA 2C3OA 4FYWB 5DDRC 2B8PA 2CPZA 1M5SA 5J2PA 5M2UA 3TX0A 1HQUA 1SQFA 3IS9A 3OTDA 1RDRA 3G8TA 2BR0A 1OPIA 2FHMA 4ZP8A 3D1HA 5KG7A 1AXQA 4WYWA 4H4KC 1SC4B 4WFXA 4PRFA 2D3ZA 1C1BB 3GIJA 2B5JA 4A8QA 4J9RA 3IGVA 4DZDA 5J2PB 5K20B 1RT3A 3M32A 3CMAS 3VGVA 1HQUB 4LF8F 2M8DB 2MKIA 2OIHA 1TR0A 3PCOB 3PHTA 1Q7YT 4WK1A 4TY9A 3OW2R 2IIHA 2B5JB 4EU0A 4DR4F 3AD7C 4DL5A 1RT3B 3M32B 2PMZD 4CO0A 3OR2A 2YQ0A 1NMEB 2Z2MA 3DOKA 3KUHA 2R7VA 1SJFA 3CT9A 2FJVA 5LL6d 5LMUJ 2JEGA 2J8AA 1MNEA 3LANA 3KHRA 3R97A 5B08A 3K59A 2JJ4D 2GQQA 2XLIA 4OYWA 1O51A 3R7NB 2IY5B 3OR2B 3EXCX 3DOKB 1X60A 3N79A 3NWGA 1BD6A 1OY9A 2F63A 3D68A 4KGZB 5A2QU 4YEAA 5IOLA 5HMZA 1U1NA 2B56A 5JVHQ 4TYBA 2J6TA 3ENVA 3KUGA 4IR9A 2QFIA 4DR5J 5D77A 2NUHA 2FVRA 5HP1A 1RI7A 2IRXA 4WF9Q 2XULA 3BN7A 5GMDA 4OQJA 4OHYA 4PAAA 5A8WA 5H9FJ 2DNNA 4P2MA 4K7QA 2UXBJ 1VK8A 1SUQA 3L7PA 5L9XA 2CAJA 3L95X 1IM6A 3Q8QB 2OGUA 1U49A 2RHQB 5HP1B 2V5HG 2QMXA 1YLXA 2DHHA 3AHPA 1GK8A 3KLIA 1WTFA 4YDDB 2VJUA 5KFTA 4K4WA 2D7SA 2BACA 1IKVA 5A8WB 5LMUF 1CQMA 3MMBA 3L09A 1YBUA 1SUQB 1NSKL 2W4PA 2CNLB 4TN2A 2IM0A 4JI0J 3LP2A 2Y1RI 1NDPA 3QFHA 1X9WA 4WXWA 1GMVA 2BM1A 3KLIB 2F8HA 3PIOQ 4WKRA 1IKVB 3MMBB 4ERDA 1VR6A 2OLWA 4N5SA 3I0SA 1RJJA 4DR5F 1FJ7A 2DRBA 3PX6A 3LP2B 2XCPA 4USUA 2ZE2A 5K8PA 2XBPA 4PCQA 3IMQJ 3CJKA 5KFDA 2NZ4A 1F0XA 1BY9A 2DJWA 5KFWA 1FRJA 3A3OB 4ZPCA 4TY8A 2F4VJ 2UXBF 1WG4A 3NY0A 2PMHA 5KFAA 2R2RA 5KG1A 4WU3A 3I0SB 3IWLA 2CADA 1IQZA 2ZE2B 4JI7J 4QYRA 4F0MA 5DG8A 3GE9A 3CJKB 4OZ1A 2OI2A 2QFJA 2MY8A 3LGMA 3GV5B 2MQQA 4LIWA 4TY8B 4Y2AA 5HQLA 2XY5A 3R5DA 1SKUB 4JI6J 2KN4A 1WG1A 2V8GA 2EFNA 1VQOS 4EBEA 4YMEA 3LAKA 3Q8YA 3BDEA 4NPOA 4PWUA 1WHVA 5EX0A 3EGZA 4IUFA 1WEYA 1UFLA 4BCAA 5T41A 2W2OP 3TEHB 5CHCB 2HHSA 4CP5A 3ENQA 2C2RA 2FJAB 4PWDA 5JXSA 2BOPA 2DVIA 3RBDA 1VC0A 4KSEB 2HGMA 3W2WA 2UUAJ 4NLDA 3N5BA 2OPSA 1HWLA 4N7TA 4DR6J 5A6WA 1SQEA 1NLKL 1NO8A 4WP8A 2EEYA 2BEFA 4IYQA 1H3DA 3H25A 1AFIA 2PI4A 4PWDB 1RISA 4JI7F 2OH2A 2DB1A 4QW8A 3D54A 5KFLA 2O67A 2ZHOA 2HVIA 3W2WB 1NSAA 3ISNC 5D0RA 5DZ6A 3UR0A 1B70B 1LKZA 2OPSB 1M5VC 5KG2A 3X3UA 4ANDA 5EHHA 2Q6BA 2QJ3A 4JI6F 1N5VA 1EP4A 5B0BA 5M2PA 4IOAQ 1RP5A 3K7RA 2C42A 2Z4PA 3T9NA 2CJ9A 3TYTA 1RWOB 4LRAA 3HK2A 4BC9A 4ZVQB 4ZJQA 3MFIA 1OSDA 1WOSA 1FWKA 2VBWA 1WDTA 1GFWB 1EP4B 3CF5Q 4DWIA 1TKDA 4FXVA 4ZVUB 2Z56B 5BYRA 4YR3A 2AYGA 4F0HA 4OV1A 3B78A 2UUAF 1YRUA 5MLCV 2ADBA 2C3MA 3FKBA 4DR6F 4PUOA 1JJCB 1RWXB 1N33J 1B7YB 3AD9C 2JHEA 2UVRA 1X5SA 2BE9B 4LRDA 1NSQA 2LQ5A 2DHGA 1SJ1A 2XWYA 3GQCA 3DLHA 2HSEB 1UJ4A 1FFWB 1HNWF 4PUOB 4FKYA 4R5PA 1UJ5A 4J9KA 3MR7A 3VQSA 3ZC4A 4G1IA 5DRKA 1FF2A 4AT1B 4DCPB 5KOWA 2A2DA 4C0BA 2HQ3A 4WP9A 3BGRA 2HNYA 3Q83A 3VZIA 3UPFA 4A47A 4ICLA 1AT1B 1N0VC 5FD1A 4R5PB 4OYIA 5FJ4A 5G0RA 2NSCA 2HG4A 4B9VA 4K4UA 1NBEB 5KFMA 2MQ8A 4ANEA 4F3MA 3WC2A 4USHA 3NGTA 2LXIA 3RRKA 3BGRB 3DDKA 4ZPVR 1XMBA 2HNYB 5MAOA 3KK2A 1PCAA 4AXJA 1N36F 3NXZA 2FJBB 1SC6A 1M5PC 4ICLB 1L3UA 1N33F 4FYDA 1XNQJ 5G0RB 3PJWA 2I2YA 4QU7A 4DX5A 1TL5A 2M5YA 1UTAA 3KK2B 3MPYA 5M2RA 1T9YA 3FDSA 1TV6A 1UKUA 2OFHX 3SFGA 2MQMA 2G9OA 3W7BA 1VQKS 2XMJA 1F3FA 4R0EA 2DR8A 3HHKA 4OJGA 1EARA 4QIWD 5HQMA 2PMWA 1JNZB 4DS4A 4C0HA 1T95A 2XI3A 1JJHA 1TV6B 3JS9A 1T03A 2OFGX 3IRWP 1EKRA 4YR2A 5KG5A 1R43A 2Y0BB 3KLHA 4QW9A 4EO8A 4AYBD 4ZP7A 3C46A 3UFCX 4DR1J 5GAEI 2HWIA 1M90T 2UP1A 3GTYX 5F8IA 1T03B 2B51A 3M6XA 2ZH1A 3V6DA 1VQPS 4IH7A 3DRXA 1XNQF 3A8JA 3TVKA 3KLHB 2HWTA 1FD2A 2F40A 3CO9A 3AXKA 4YB1P 1SKRA 4P71A 3MI7X 5CD4A 3N6NA 2UUBJ 3NKYA 4OX8A 2X51A 2NCKL 2BV3A 2AT1B 3V6DB 2DGSA 4ZJOA 2N82B 3H90A 2GO8A 3K5PA 2JH3A 1S77D 2AJQA 2H54B 1B0TA 4OYAA 1OY8A 5ETVA 4LT6A 4H54A 2NPFA 2MKYA 1S10A 1FVSA 3Q86A 3IM8A 1FXLA 4ELVA 3HHNB 3EX7B 2C2MB 4I64A 4ZPWR 4PKDB 4LJMA 4ED0A 3PRDA 4MKBA 1S6UA 4UTGA 2XO7A 1VRTA 4DFMA 3QWPA 4KC5A 1FE0A 5D0HA 5ETTA 1O6XA 1VQSA 1BHNA 3FSYA 2F65A 5EN1A 1Q8KA 4UT4A 2Y9HA 4NLPA 2R7QA 4CLTA 2K7KA 4DR1F 2VDHA 2HHHJ 2HBQB 5E5NA 3L7OA 3T6JA 3ZTQA 3OFEA 1VRTB 4IO9Q 1FO1A 4LR9A 4A8FA 3I82A 2NS1B 3VVTA 3RW7A 4USIA 2ZH6A 3D9BA 4WJBA 1RAHB 3LW5C 3QSYB 2UUBF 2JLFA 2L48A 2M70A 1GQEA 4WCEQ 2G2OA 2DTJA 4HHJA 3EXYA 2GCFA 4K4YA 1CLFA 3G6YA 3WZ0A 1JLEA 3FZ2A 4FF4A 2HHTA 4NMLA 3ELHA 1U2RA 2HPUA 2QYCA 4Y2MA 3ISZA 1Q53A 1FRMA 2B3TB 3AAWB 3GFYA 3PR4A 3FCVA 2HS3A 5C25A 1NK5A 2IJNA 4ZLNA 3MOJB 1JLEB 3PW4A 2FB0A 3VR1A 3C14A 4FBUA 4LF5J 2B4VA 4C8YA 2EK6A 2N4CA 1W7WA 4B9LA 1UMJA 2KYXA 4GO5X 4EO6A 5LMNJ 2V9KA 2XYHB 1FA0A 4ZK7M 4A8OA 3OL7A 3EVWA 3K17A 3BKTA 2HHHF 4CQ1A 5C25B 1Q1KA 1IBKJ 1XEZA 4UY8T 3NNHA 3C14B 2DO0A 2X7IA 1BLUA 5D4OA 4X4OA 1ZYQA 2Y8YA 3TZWA 4BWMA 3QRRA 1VK3A 4K4XA 5CD4H 4A8WA 3DRYA 3VGSA 4ECYA 1X0FA 3LOUA 3Q8SB 2ZH9A 1T9UA 2FVQA 3H2UB 2GQCA 3GJSB 2K1RA 3AA8A 3VGTA 2R7XA 4P7TA 2GHWA 3CJ8A 4DV2J 4WWSA 1K1QA 5IT0A 1NPPA 1C4AA 1NNDA 4AD6A 3CDWA 2CVIA 4N47A 4KFBA 3MCOA 3HCXA 2D3O1 1QVGR 3PY8A 2K1RB 4EBDA 3M8WA 4K4VA 4ED3A 4LF5F 1UETA 5EUHA 2CJYB 2J7KA 2ZM6J 3DU5A 5LMNF 2ABYA 2FJDB 4OZ5A 3CJ5A 4ZVGA 4KFBB 1NJYA 2G13A 3DRPA 1IBKF 2DNOA 2GX8A 2VG7A 4G1QA 4E0DA 1D1UA 1P9YA 3NRBA 5DM6Q 2D3UA 1L3KA 4DBQA 3EGVA 1RTHA 2G0JA 3MWBA 1S7IA 2F4FA 1NHUA 3DRPB 4DPTA 4OX7A 2VG7B 2VASA 2HQDA 1HFEL 4G1QB 1JLBA 3W9IA 3BO4A 4IRDA 2E44A 3G8SA 1AFJA 6FDRA 1U02A 4DR2J 4LBHA 2V4RA 5HLFA 4X4RA 3OPKA 2ZBRA 1RTHB 2IC3A 3N28A 4I2QA 3MGJA 1DLOA 3SV4A 1VLYA 1GT8A 3I32A 1RWPB 1WF2A 4O4GA 4V19J 4NZ7A 2QA4G 2FJEB 2NYHA 1JLBB 1H6KX 3N6LA 5JVGQ 2ZM6F 2Y1JA 5KG3A 1QUVA 5HLFB 4L75A 4ZPBA 4J9OA 5ETKA 1VBZA 2IC3B 4I2QB 1DLOB 2PT0A 2J6UA 3TJ9A 3TA2A 7FD1A 1DJ0A 2AIRB 4O4GB 2X1GA 1M1GA 2JLGA 4M94A 4LVNP 4LF7J 3SYZA 2HZAA 3PX4A 5B0GA 4NX9A 1ZS6A 3LO3A 3ZZTA 5DJBA 2MZRA 3O1LA 3R7SB 2B9YA 4OZLA 4NLUA 4GC6A 2XG8A 1UVIA 1QSLA 1H2TZ 4PABA 1P1LA 1CVJA 4QJVA 4DR2F 3BGOP 2DY1A 5LSOA 4W4MA 4ZCIA 3EVOA 5I3UA 2QV6A 2HHUA 1S7HA 5L1IA 3HD2A 3BGLA 3IA0A 3OXGA 5J1EA 3THPA 2ASDA 5KFFA 1XBWA 4M5IA 3CW2C 1UFWA 1GX6A 3WHIA 2KH9A 3E3XA 2CDQA 4N77A 4BHQA 3RBEA 4XK8C 5I3UB 3CNQP 4I67A 1R3NA 4JI8J 2D41A 1EAYC 4EZ6A 4DG1A 1NDCA 3JXOA 5J1EB 1H2UX 4LF7F 1TL3A 2RNEA 1OJ4A 1GAOA 4ED7A 1GMUA 4QIVA 4DSIA 4AL7A 2GA7A 3C6UA 2IHR1 2R4FA 2ACYA 4NXMF 2NXUA 4CO4A 2EFVA 2E29A 4DG1B 1D0EA 1NZAA 5KFJA 3DRRA 1U0SA 2LFVA 5LSLA 2FZGB 1TL3B 4YOEA 4RWWA 2RMLA 1WI6A 4UOCA 2BDPA 1UW9A 1Y5IB 5ETLA 3PYDA 3PR5B 3C6UB 2JRSA 3CCWA 1T9XA 2W9CA 5F8JA 3M6VA 5LM7E 1CPZA 3OHAA 4DPXA 2NXJA 4O23A 3HX9A 2E5GA 3OHBA 1V9OA 3DRRB 2AMCB 4M5NA 5CZXA 1X8DA 5IC4B 1RK8A 5F9LA 2E66A 3CCTA 4Y6IA 1WKLA 1AUDA 2V94A 1ELOA 2W9AA 2PIIA 2RH3A 4KHPJ 2YPYA 2W9CB 2EPIA 1VC5A 3ZZYA 5BR8J 1ZAXA 2XSFA 2CG4A 4UUWA 2EW9A 1ZTWA 3C19A 5HVHA 3OL8A 5CCLA 1QY7A 4J5OA 5LOQA 2ZWOA 1LEOA 4DSFA 2KM8B 2XY6A 2YQ3A 4QR2A 4CM2A 1UWAA 3EM1A 1MWQA 1XNRJ 4OLOA 3T6BA 2AJ1A 3FC9A 2HMIA 1VQMS 3TAQA 4XDCA 3HVWA 4CTAA 1MWZA 2CKWA 3ILOA 4P9SA 4X4QA 2UUCJ 4KGMA 2YX1A 1GXTA 3GSIA 4ENOA 4Q2LA 3LGHA 3HT0A 4ECWA 3T1AA 2HMIB 4KQZA 4RW7A 4QWBA 3RBXA 4C48A 1TUVA 1VGYA 3KJFB 2XMVA 4CTAB 2ZDOA 4I56A 4RW6A 3MMAA 2L9DA 4RUHA 1FD8A 4KHPF 3DCAA 5BR8F 4WE1A 3RAQA 1RHUB 3Q22A 4MT1A 2QX0A 1DZ5A 4J7CA 4UQTA 4PYDA 4ZJLA 5AXKA 5L39A 3J81Y 4RW7B 3NCQA 2W8KA 2BKPA 2E7WA 3GSDA 4RW6B 4EMDA 4TVAB 3WBZA 3MMAB 4IRKA 3MZIA 3I31A 1OPZA 1XNRF 1A6LA 4WE1B 3QGGA 3MUTP 1PYOB 2RE1A 1Q16B 3DDIA 4P75A 2QG9B 3AJ1A 5JUMA 1RTIA 2UUCF 2LQBA 3V6JA 3OFFA 2JOQA 1XQIA 2PC6A 3QPIA 4QWDA 2DYAA 2LP4A 3VVUA 4L74A 1K44A 4KYZA 1FJGJ 2PDAA 5DLGA 4I6WA 2V4JA 1YBAA 3FBFA 2HFZA 4PZVA 1X4BA 2DT9A 1PSDA 1RTIB 1VQYA 4OJ1A 4I4BA 2FTRA 2AJFE 5C7PA 3TQEA 3TZXA 4DV5J 1NKBA 3BBCA 2UZAA 1PJ6A 2CA9A 2V4JB 2QO3A 1RLDA 4FN5A 2AU0A 1U1QA 4ZIVA 2AW0A 2XZTB 4E8UA 5GAHI 2I38A 4DCOB 1V3ZA 2QA2A 3MM5A 2PI5A 1Z1ZA 4USTA 3UDCA 3N4WA 2ALYB 3AJDA 1S1UA 2E1AA 4MYUA 3OVAA 1V3SA 4ECTA 5HI7A 2O5DA 1YSJA 3KMSA 3MHYA 1OQ6A 1X4HA 2Q1LA 5IZHA 4CWBA 3MM5B 3SQGA 4A46A 3RAXA 1IKWA 1IM4A 4EYHB 4QPXA 1S1UB 1YG0A 1NB7A 4NZ6A 4K4SA 1HHSA 1FJGF 2L08A 1I6JA 1YZ7A 5K8MA 3KK1A 1F5BA 3R1LA 2K2PA 3SQGB 1Q78A 3GV8B 2N3OA 1WELA 1IKWB 2QLXA 4DV5F 1RWWB 5ETOA 1WF0A 3TZYA 2BKOA 3PW5A 1S97A 1VRUA 5DLFA 3KK1B 3MM7A 1LOUA 1MMDA 2ZH3A 3D3BJ 4OYMA 1ZH5A 3H42A 2KXFA 4P74A 3GR1A 4CO5A 3W3SA 2D1CA 4K4TA 2AEJA 2UXDF 1OYDA 4I69A 4XTTA 3FMBA 4TQRA 3IR7B 3QYYA 1VRUB 1RT5A 4OLPA 1JXLA 1ZPWX 3MM7B 2ASJA 1AW0A 3CDBA 2KJWA 3P8BB 5CCMA 4RW8A 4NLGA 3VTIA 4C7QA 1B3TA 4OZ3A 1VHIA 2C3YA 5BYQA 4WIQA 1NK4A 4I2PA 1X4AA 1RUSA 4DSJA 2BUNA 1F5CA 1LWEA 4TYAA 3DYAA 4JUZA 1RT5B 4KTQA 2HLTA 3CD5A 3AOAA 1KHVA 1S6PA 1PILA 4C4WA 4UZBA 1RGVA 1Y3KA 3R2DJ 4RW8B 8ATCB 4DFKA 4IO1A 4I2PB 1RWNB 2W2MP 2NREA 2VH7A 1LWEB 4PG7A 1RKJA 4U95A 3DYAB 3FVYA 2FPHX 4Q43A 1B99A 1UVLA 1TP7A 4U96A 2VIHA 1R8CA 2CQCA 4DPYA 1S6PB 4DL6A 2V2QA 3CD7A 4N8OA 4OYXA 2KT2A 3NS5A 1T11A 2ZC4A 4OL8A 3EZUA 4NLVA 4MIAA 2MYFA 1WJ9A 4QCLA 5FIIA 1T9TA 1NU4A 5IV3A 2XQCA 1QAIA 3GB0A 2YWFA 5D0GA 1JXVA 4RLEA 1U1RA 1FRLA 2ERRA 4NASA 1YBTA 3PDNA 1Y5LB 5D0EA 3E01A 3OV7A 3MMCB 2GFFA 2H1YA 1S0VA 1T94A 3MCNA 5C2CA 4DSKA 3CSKA 1FNMA 2PA3A 2AJ2A 4WTOB 2DH9A 1KRPA 1VQ5S 1EETA 2DH8A 3S01A 1C0TA 4MIBA 2Y0SD 3I96A 1WSVA 3FRZA 4F3OA 2G0IA 3E01B 2J8SA 4U7CA 2BJ3A 2OSRA 4B02A 3TI0A 3RB0A 2B0GA 5BYSA 2F8MA 3BO3A 1X4GA 5ETRA 4QOTA 1NH7A 1Q79A 2E5JA 1C0TB 3FNNA 1QTNB 2AJ4A 5DZ7A 1MROA 2RS8A 4RX6A 3R6GB 4BDPA 3M7VA 4MK8A 3GIMA 2V2KA 4ANCA 2OPQA 1J5EJ 3BF4A 4ZOSA 1TKZA 4DLEA 4DLGA 5H9FK 3NGSA 1YI2S 2ZD1A 3D66A 3G2XA 1ZM2A 1U25A 1UL3A 2BRLA 1MROB 2VFUA 3J81j 1Y5NB 2WVDA 1UVNA 1T9WA 2VFVA 2W9BA 2KZZA 3HFVA 2OPQB 3JQKA 2M8HA 1TKZB 4O44A 1HYSA 3BYPA 4YB5A 4ITSA 2AYEA 2ZD1B 2Q43A 5ITHA 2YNFA 3G82A 1UZHA 4J9PA 1A0OB 3AY0A 2B7BB 3M30A 3H5UA 2JWNA 5H9EK 1VQ8S 1MSWD 2W9BB 4X65J 2X3GA 3RB4A 4O44B 2LDYA 1HYSB 2H5JB 4JBCA 4OZ0A 4B9TA 1WWHA 2YNFB 3G82B 2W7PA 2KVIA 3UDLA 9ATCB 2NR0A 3M30B 4LIRA 1AA1B 3MTJA 4J90A 1J5EF 4LFCJ 2DNZA 2J9CA 4D3GA 4YY3J 1LW0A 2VC0A 3CIMA 4JI4J 4PG5A 3JTOA 2XS2A 1X9SA 2WCXA 5C42A 4A8MP 5KFQA 3FFIA 3AD8C 1NEEA 1XR6A 1PO6A 3IAM9 2YH0A 1QAJA 5ETPA 2F9JA 2JDJA 2C3UA 3M8QA 2AEFA 3HJFA 1Q0NA 1ZBTA 4BWJA 4D3HA 3QGPA 1MMNA 1LW0B 1UW4A 1QM9A 5JMNA 1C0UA 3W5YA 1WHWA 1K9MT 1WC4A 4X4UA 2WHOA 3CCZA 5C42B 2F5GA 3FFIB 3LP1A 4WBFA 4X4SA 3D2WA 3M8QB 3UN3A 3SQOP 4X65F 2N7YA 4FYXB 3HPOA 1GEHA 2V69A 3OBIA 1C0UB 2C2OB 1Y4ZB 4K50A 4NZ0A 1RU2A 4YP3A 3TP2A 1MMLA 3LP1B 4JV2A 5I4MA 1LQ9A 2DNMA 3BSAA 1IVZA 3OTBA 4FPIA 2OEJA 4LFCF 1JKHA 4YY3F 3M2RA 2LA6A 2IPOB 4JI4F 4EZ9A 1NPKA 4UW2A 1RXOB 2CPYA 4OI2A 1CBKA 1BXNA 3I5AA 2YNIA 1U26A 4J91A 2E5LJ 2Z0GA 4DEZA 1VQ9S 2YVSA 2EC2A 2SXLA 1JKHB 4WYLA 2XY7A 3M2RB 4FF1A 4EEYA 5AXNA 2EK1A 4R0JA 2XMAA 1KC8T 2D9OA 3GIKA 4QIFA 2NLWA 2YNIB 3CCUS 4O3PA 2P6TA 1YKWA 3G4SS 3U1NA 2DGOA 3MEEA 3CCVS 1KOHA 5GADU 4DJBA 4FDFA 3SFUA 2XC9A 3MTKA 2J7WA 1L5UA 1IN0A 2AZ3A 4L72B 3EPGA 1IR0A 1T3OA 1WC5A 1O8BA 5L1KA 3AA9A 4HTJA 2H48B 3JTNA 3MEEB 1NRKA 3G6ES 3R8YA 3W63A 3DOLA 1NUEA 3HVRA 2J6SA 1PKUA 3DLLQ 2EXUA 3BH6B 2IYGA 2MSSA 1UAWA 1Q4RA 5KT2A 2X1BA 1SJ3P 2EFQA 2XB2D 2ZWPA 2ACMA 1FX2A 4WFBQ 1YITS 5GAGU 1IJEB 1WC1A 4S0MA 2A6OA 3CJSA 3DOLB 4LR7A 3SSSA 4DMZA 4ED4A 4XIUA 3MDFA 3KXDA 1CC8A 4F7VA 2KFYA 1DURA 2CPDA 2CQIA 3O6QA 2HIQA 5B0DA 1VLOA 1WHYA 5IT4A 1XC9A 4UQGA 1KHWA 4JP8A 1LW2A 4RR5A 1TU0B 3J81U 3BQ2A 4RBVA 1KP6A 5KFUA 4ZIWA 2FJXA 4GKKJ 1N5QA 4M95A 1YJ7A 2W2NP 4ECZA 1H7WA 1NXIA 1M5HA 3QSIA 3NP5A 2CDRB 1LW2B 4V1Ak 3CGIA 2V2VA 1IBMF 4ETZA 3PEJA 2RB7A 3NG8A 1TAQA 2BW2A 4KJIA 4Z2XA 3UCUP 2XTJP 4U67Q 2B9XA 3MAHA 1EQ0A 4RU9A 1I1GA 3W2VA 4OYZA 5KOXA 2OEKA 4Z37A 2VD3A 3ITHA 2WB4A 1URRA 1KVKA 2R7SA 1XR5A 3D1OA 3DHWC 3M8ZA 1HR0J 3NEKA 3GILA 3HHLD 4A8YA 4F4AA 1FRHA 2DPIA 1G2EA 3K57A 4JI3J 1QJHA 1TTHB 3W2VB 1UEKA 3T5KA 3IXQA 3BR8A 3I55S 1Y00A 5HSPA 1FERA 4GKKF 1BWEA 1DHMA 2GQ2A 1S1VA 5F41A 2LQJA 2KJVA 4DR7F 1RCOB 4IQMA 1NJXA 1GNKA 3P5BP 3H4DA 3M05A 1RWKB 4E2FB 8RUCA 2P6SA 1BQXA 2QLWA 3BB5A 1FKAF 3R9LA 5HN0A 1HQEA 3CC7S 1HWIA 3PYGA 4ZVRB 1RAGB 2ZNZA 3OL9A 2ZBQA 2YKPA 1FKPA 1KKHA 1F9EB 2MKJA 2KFNA 1WOOA 3JSBA 3SIPB 3A8EA 4I6YA 2YBVA 3IO1A 3HHLA 2I0XA 2E7XA 3QBCA 4MJKA 4FF2A 2UVVA 1HQEB 5CQGA 1WG5A 2BQUA 2AKWB 2KT5A 2KDOA 4ILLA 1HR0F 1FKPB 1D9FA 1JMTA 1A9NB 3EE3A 1TUWA 1CQNA 1F3VA 2QA4S 4WZMA 3RRHA 3O2IA 5KAKA 4JI3F 2YTCA 1CJUA 4Q44A 4H4MA 1LFPA 2DRDA 3BN4A 3HHLB 4KV8A 4Y0FA 2EKNA 1RTZA 1H7XA 2EVZA 3K0JA 2JX2A 2OPRA 3V4IA 1D09B 1P1TA 3PRVA 3DGPA 4U6PA 1FKOA 3UWTA 2C28A 3BSCA 4ZVEA 2VC1A 4G1PA 4ZP9A 2FGOA 4JB8B 3IBCB 1CJUB 3D6FB 4H4MB 4KKOA 1G3OA 4DV6J 4F04B 4KV8B 1S12A 1RHKB 3L4BC 2DNQA 3GIRA 3TO8A 3JSRA 2OPRB 4CNYA 5GAEU 3HD1A 2J9DE 2M4MA 3V4IB 3DGPB 1FKOB 1MN7A 4NI2A 4LF4J 2KM8C 4JV5J 3N01A 3ONQA 2RVJA 1U45A 1JQGA 3TVYA 4KKOB 4WFNQ 4C6AA 2RUSA 3PG9A 1C2PA 4HTIA 4HHHA 4NRTA 3JTPA 2BMBA 2M0GB 2AEMA 3OTOJ 4DSLA 2A0FB 4NI2B 2YKQA 2MQLA 3SDEA 2MJUA 3GCXP 4XAKA 4KIAA 4DHVA 5HQ8A 5E0OA 1FHTA 1S9FA 3AH6A 3KLVA 2DIVA 1RCXB 1F6TA 3Q2TC 4KPCA 3N5FA 4TLQA 4HR2A 2YKMA 3M8YA 3SDEB 3BDPA 3D0GE 2WB1D 2XLKA 4NYZA 1YJNS 1L3SA 3MR2A 1OMSA 1TK0A 2B43A 4IFVA 4DV6F 3HFZB 4F67A 2IA0A 1M1KT 1HD0A 1TQLA 1BGXT 3WX4A 4IFYA 3QT5A 2HBZB 2HLUA 4OV6A 4CT8A 3DFEA 1LFWA 3PNIA 4LF4F 2R7UA 2YKMB 4QIEA 3J7YI 4YDXA 1R6VA 1VISA 4JV5F 1ULRA 1H98A 2CNOB 3FGVA 1U6FA 1RHRB 4IFVB 2YNGA 2CZ9A 5C24A 1HMVA 2AGQA 1UPPA 2ATLA 3MEDA 1OIAA 2Z2YB 2GC8A 2JLEA 3OTOF 4Y2CA 4IFYB 1YJWS 3IS9B 4LR8A 1XTZA 2XLJA 1K47A 2DO4A 1SQGA 2YNGB 5C24B 1U1OA 1HMVB 5AE2A 4P73A 2X1FA 3MEDB 4O3NA 4QQBA 2RUGA 4HEA9 3E51A 8AT1B 3OFGA 3ZXWA 2YQ1A 5F8LA 4ED6A 3BSNA 4CLPA 2ZKTA 2DKOB 2AWZA 1JWWA 2LQ8A 3RB3A 3ISND 1JB0C 4DQRA 4DV0J 3OXLA 1HNIA 4DI6A 2BQ3A 3RTVA 2JZ5A 2IRYA 4XPEA 5SUHA 3VAMA 1E6YA 1H72C 4FBTA 2F9DA 3J80Y 4URGA 3H5XA 1FWLA 3CCES 2KVQE 4B3SJ 2Z2LA 4DUYJ 2QLBB 2RIJA 3CD0A 1Q7LB 3MECA 4C8OA 4GO7X 1HNIB 2PD1A 1NK8A 2ILYA 4ZITA 3AFGA 2KG1A 4F3QA 1E6YB 2HHQA 3UR3C 1NHKL 3ET6A 2ZH5A 1V5VA 1L3VA 4QZVB 1K73T 3I5CA 1HIYA 1SH3A 1YJVA 3HZEA 4ZCKA 1H73A 1WF1A 2DNRA 2Q66A 3D7SB 3MECB 3VF0B 3V4MA 4ECUA 1WKJA 5ETNA 2E1RA 4UUXA 5C5JA 1GXLA 1VDHA 3WDOA 4PWWA 2HHVA 3P3DA 3ET6B 2EC0A 3GPAA 1U09A 1YWXA 4DV0F 1RT1A 4DN0A 2AHOB 4JOUA 3RU0A 3QGIA 2KB2A 3QJLA 3ICLA 2R7WA 3B54A 5B0CA 4C0OC 5HANA 2ZH7A 3CJ4A 2W4DA 1F1BB 1REGX 2GW8A 5H9EJ 4P2FA 4USJC 1RAJA 3KLGA 3LWLA 3JB9k 4Q5VA 5THWA 1FX4A 1UEUA 4B3SF 2HQGA 2B4PA 4QIGA 1WC3A 4DUYF 3OJSA 3HJVA 2CVEA 1RT1B 2QSFA 4YR0A 2RQKA 2QL9B 2DNLA 4ER8A 1HBMA 4KR0B 3KLFA 4U8YA 3FEXB 3DHXA 4AE5A 2YX4A 3KLGB 4EI2A 3I6PA 3KMQA 3FBBA 2O3DA 5KFKA 2W4CA 4O0IA 2FZKB 3C15A 1PBUA 4ECVA 5KG0A 5E3PA 2MPUA 3GYNA 4G3IA 2ILZA 4QWAA 2PFDA 1APSA 3ENWA 4ZVHA 1HBMB 1GTEA 3KLFB 4F02A 2MXYA 4H4OA 2J0QD 3FMWA 2GS8A 3QAEA 4RJVA 4OZNA 3C15B 2ZVSA 2I9SA 3KG0A 4DX8H 3ZNUA 3EDRB 1YIJS 4YHHJ 4RKUC 2GVZA 5GADI 4NCGA 4Z7CA 2GJ2A 3BQ1A 1BC6A 4NWBA 1XMOJ 2PFFB 4H4OB 2FVCA 1SI9A 2RS2A 5K8OA 1R89A 2EG1A 3VAGA 2MTLA 5E33A 4DUTA 4NOHA 2BKNA 1KQKA 2BX6A 4DDFA 2D3OR 2GVZB 4LQ9A 4NCGB 3I56S 1HPZA 2IM1A 3U02A 3A4TA 2VDIA 1S57A 1MU2A 3BBFA 1S6OA 4ZMMA 5KG6A 4TU9A 2VPWB 4NMXA 3GMGA 4ZLJA 3PRBA 1U2CA 3I4HX 4NLXA 3IR6B 4WU2A 3HSZA 1FNOA 1X4DA 1HD1A 1QUPA 4DX6A 1VBKA 5GAGI 2BABA 4Q0BA 2NUUG 1HPZB 2M3DA 3GFZA 3S6EA 3PW7A 1MU2B 3HM9A 1T05A 2IVYA 4RNMA 2GJFA 2WK4A 3CMQA 3VAJA 2KHCA 1HNWJ 4U9RA 1GMWD 4FVCA 3BYRA 3FSIA 2CQ3A 2OHDA 4YHHF 3G6VA 2DNGA 5D78A 1HW8A 2MEWA 1VQ4S 2NZCA 4CO3A 4Q0BB 2C2NA 3QZ8A 4DF8A 2MY7A 4ZN1A 2L3MA 1XMOF 3FBCA 1M5KC 4WP3A 3VHQA 2BRKA 1XMQJ 4BLGA 4B3MJ 1T05B 4RPFA 1UEVA 2Y8WA 1WUUA 3MF5A 5HK4A 2HGNA 1EB0A 2BJ1A 2RRBA 4DFJA 3T1YJ 3CC2S 5KT6A 3QJJA 3WC0A 4HACA 5EGYA 1U6BA 5LXYA 2DEIA 2Y3YA 5KFCA 4C3MA 2R7TA 3PO5A 3GR0A 4DPWA 2DXFA 3BZQA 4ID8A 5ADZA 4DX7A 2QRRA 2BE7D 2DHAA 3K58A 2UVUA 1T3NA 1N36J 4K5SA 3MR5A 4USWA 1NJIT 2YH1A 1KBRA 1KVIA 2QT7A 4J9VA 4HACB 4FPRA 2B7CB 4ZVTB 1NZ8A 2MLZA 2XMTA 1Z4UA 4FP9A 3MXHP 3MPUB 5CAAA 4CNZA 1P9QC 3P6YC 2OMOA 4UZCA 1ACMB 2N7CA 1DARA 1AB8A 1ROFA 3R2CJ 3PO4A 1WSRA 5D15A 1KD1T 1XMQF 3P49B 2DNYA 4B3MF 2FHJD 1KLNA 2W24A 3A8IA 3A1YG 4AQYF 3OSPA 1S0OA 5IV4A 3T1YF 2XNQA 4NXNJ 1S5ZA 3QJPA 3PVXA 3CJ3A 4CLYA 5EWFA 3GCWP 3JQMA 5K8NA 3AXMA 4DR3J 2OSQA 3KJVA 3LQVA 2WVEA 3DLEA 3HO1A 2K3IA 4C8LA 1ZM3A 3KLEA 3FEYB 4Q2MA 3BBBA 2BZ2A 4N8NA 2MZTA 2B4UA 3VV2B 3PHEA 3UN2A 4LF2A 4K4ZA 1U8WA 3KJVB 2RRAA 2ZC3A 3HZGA 4GMKA 2BJEA 2FHJA 3DLEB 2HK3A 3U1LA 1VQ6S 3KLEB 4M5MA 2AP6A 3SCKE 1U8SA 2HVDA 3VGUA 4ZLPA 4Q8EA 4G6VB 2HRUA 1Y3JA 2CFXA 5GVQA 1TKTA 2VPZB 3DKDA 1KN6A 2JSXA 1HHTP 5DGAA 5DS7A 1MW7A 3OXFA 4ES3A 4NXNF 4IG3A 1V6HA 5I3QA 2DHSA 4ELTA 1YRXA 4RNHA 2BYCA 2EBGA 3MEGA 5B0EA 3R5AA 1WD6A 4DR3F 1RBOB 1UP1A 1TKTB 1RACB 2L9NA 2AYMA 3Q23A 2ZBIA 3PW0A 3D67A 3TNVA 1KSPA 3HHEA 5AT1B 1RAAB 5DQIA 4ALZA 5HJXA 1RBLA 2XNRA 4TQSA 5CA5A 4CH1A 4K2XA 1HI0P 2HW3A 4IG3B 1Q8IA 3SCLE 1PGZA 1DAXA 3Q89A 4NYPA 3RBZA 2CPIA 3MEGB 4LMZA 3ZZUA 2MHEA 4QR1A 2K7JA 3CXCR 2MZQA 1RYSA 4L73A 3T9ZA 3T1HJ 1RAFB
chains in the Genus database with same CATH topology
1SUQB 1H2VZ 1E6VA 4IH5A 3PKMA 5LJ3Y 2IM2A 2KHDA 4RLEA 2W4PA 1FRLA 1U1RA 3RW6A 2ZFHA 2IM0A 4TN2A 5AE3A 2DGUA 2ERRA 3G86A 3LP2A 1N32F 3NNCA 4X4PA 3N6MA 2DR5A 2Y1RI 2KI2A 3VAIA 3B8HA 1VS3A 1X9WA 4WXWA 1IQTA 3TAMA 2BM1A 1F60B 3KLIB 3I9V9 3PDNA 2XCAA 1Y5LB 2RT3A 1FRIA 4CI0B 3VAHA 4FF3A 3ZZOA 2F8HA 2E1CA 3PIOQ 2VODA 4WKRA 2MQOA 1IKVB 1SH0A 3E01A 3OV7A 3MMCB 5KFPA 3L3CA 2GFFA 1S0VA 4HLBA 1T94A 3MMBB 5GAHU 4DL2A 3VWSA 4ERDA 4KO0A 4ED5A 3OVSA 1E6VB 2VZ9A 1DQAA 4O3SA 2M2BA 3MCSA 4DSKA 2OLWA 4N5SA 5K14A 3I0SA 1RJJA 2DIUA 4DR5F 1FJ7A 2OD4A 2DRBA 3CSKA 1FNMA 4JI8F 3PX6A 1HARA 3LP2B 2PA3A 2XCPA 2DH9A 2ZE2A 3LAMA 1KRPA 3SZ2A 4CH7A 2BANA 5K8PA 1RKIA 4ES1A 1VQ5S 3V6KA 2CJBA 1EETA 2XBPA 4PCQA 2DH8A 3S01A 4YQWA 3CJKA 5KFDA 1C0TA 4I1TA 4MIBA 4N76A 1F0XA 2NZ4A 1QAYA 3TAMB 2Y0SD 4I68A 3CEDA 1BY9A 5D3GA 4M5DA 1DQ9A 3I96A 5F3ZA 3FRZA 3CCLS 4F3OA 3DMJA 1D9DA 2DJWA 2AJ0A 5KFWA 4DFPA 3CE8A 3E01B 1RT4A 1FRJA 4Q8FA 1R7IA 4U7CA 3POTA 4Y34A 2OSRA 4TY8A 4ZPCA 3GG1A 4B02A 2OTLS 1WG4A 2UXBF 4KO0B 3TI0A 3RB0A 2PMHA 2GHVC 2B0GA 5KFAA 2R2RA 5BYSA 3DLGA 5KG1A 4WU3A 5K14B 2F8MA 3BO3A 3I0SB 4B9UA 1X4GA 3IWLA 4QOTA 1R8BA 4ECRA 1NH7A 1VJWA 1Q82T 1Q79A 1IQZA 2ZE2B 4A8XA 2I5JA 4QYRA 2BANB 2XZWA 2E5JA 2AF6A 1NAQA 4HKQA 5DG8A 1U1LA 3GE9A 3CJKB 5EWGA 1C0TB 5J2MA 3FNNA 5L1JA 2DISA 2AJ4A 1MROA 3VZHA 4OZ1A 2RS8A 5D3GB 2QFJA 4M5DB 2MY8A 4RX6A 1N56A 3LGMA 4EFAC 2ZOMA 3DMJB 1IKXA 2R2TA 3ITHB 3BGUA 4O3QA 1X0PA 5KT7A 3GV5B 3T1HF 1WTBA 2MQQA 1RT4B 4LIWA 4BDPA 4MK8A 3POTB 2W7AA 4TY8B 4PPZA 4Y2AA 2XY5A 4AFFA 3KG4A 3R5DA 3GIMA 2V2KA 3UW1A 1SKSA 2KN4A 2E9ZA 1WG1A 4DQQA 3DLGB 2OPQA 1XWLA 1U24A 2V8GA 3MR3A 2DD8S 3BF4A 4ZOSA 3PW2A 1TKZA 1Y0HA 2X1AA 4DLEA 2J0SD 4DLGA 1W2IA 2LDIA 1YI2S 2I5JB 2ZD1A 1FRKA 2EFNA 2V4QA 2WTFA 3DN9A 1IUJA 1ZM2A 3D0HE 5J2MB 1N88A 1VQOS 4EBEA 1QAXA 1U25A 3LAKA 4YMEA 2DGWA 1UL3A