2B5JB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r165481
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase P66 SUBUNIT
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 95
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b5jB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jB03
1Z4UA 3ICLA 5KFEA 2QV6A 4IH7A 3CIZA 4DEZA 1RYSA 5L1KA 3TAMB 5J2PB 5KFRA 5JUMA 4LQ9A 2VA3A 2HWHA 4RNHA 5HROB 1JIHA 5KFYA 3E01B 2AGOA 3JYTA 4Y2AA 1S9GB 1TL3B 5L1LA 3MEEB 3T19A 4ICLB 2IM3A 4WYWA 5DQGA 4EEYA 4ECQA 1LWFA 3BREA 2W9CB 4IH5A 4RW7A 2R8KA 5C42B 3KK2A 3C6TA 5C24B 4I2QA 3GIKA 3PZPA 3FQKA 5KG3A 1TV6A 1QAJA 3UPFA 4MK9A 3M9OB 1JLCA 4WFZA 4KO0A 3GIMA 2W8LA 1S0MA 1C0TB 4ZP9A 1RTJA 4YMEA 4KFBB 1MMLA 1RTIB 1WNEA 4Y2CA 1JLGB 2AU0A 3I5BA 5KFQA 3H5UA 4PUOB 5DQHA 1HYSB 3V6JA 1HNVB 3DOKB 4IFVB 3PW7A 3LAMA 2B5JB 2D41A 4QW8A 2J6SA 4QWBA 2RF2A 5CYQA 5KFJA 1LWEA 3NBPA 4DL5A 2BE2A 3DLKA 4ID5A 3I0SA 3FQLA 3OSNA 2YKMB 4DL7A 2HAIA 4LQ3A 1S1TA 1RTHA 3KHLA 3M8PA 3MECB 1IKXB 5K14A 5KFAA 4X2BA 1VRUB 1VRTB 5HBMA 3RB3A 4H4MB 4NLPA 1SV5B 3M9MB 3FFIA 1IKWB 2OPPB 1SH0A 1JLGA 2V4RA 1TVRA 2WTFA 4Q0BA 4ZVHA 3SFGA 1T05A 4PUOA 4K4ZA 1S1WB 3LP0A 1N56A 2HMIA 1TKZB 3DDKA 1RT1A 2AWZA 3V6DA 5KFCA 2WRMA 4ECZA 2GIQA 5KFDA 1N6QB 3EPIA 1OS5A 4DL3A 3RB4A 4O4GA 2ZE2A 4Q43A 1HMVA 1KHVA 3V81B 1FKPB 4ZPDA 3QIPB 4I2PB 1N4LA 2BQUA 1S1VB 1JLQB 2J6TA 4F4ZA 3Q8SB 4EO8A 5F9LA 2R2SA 4J9PA 5KFWA 4RW8B 3M8QA 1DTQA 4NCGB 3Q8RB 5KFXA 4K4TA 4ED7A 5C25B 1J5OA 4M94A 2XI2A 2VA2A 2OPSA 4XPEA 1YVFA 2ZKUA 1EP4B 3ISND 3I5CA 2W8KA 1C1CB 4K4UA 2YNGB 3LP1A 3KJVA 1FK9A 5D3GA 2WOMB 3I5AA 4IDKA 3DMJB 2D3ZA 4K4WA 1SH2A 2AX0A 2W7OA 4WZMA 2C2EA 1IKYA 1RT5A 1D0EA 1U09A 1D1UA 4O3NA 1S1UA 3MR3A 1REVB 5F8GA 3QIPA 4RUAA 2IM1A 2VG7A 4J9RA 3DLEB 1RT6B 3GV8B 3V6KA 3RAQA 3QO9B 4TY8B 3H5YA 4MH8A 1S6QA 1JLEB 1BQNB 2IJFA 1JLBA 1FKOB 4IG0B 5KFZA 5EWFA 4DL4A 4RW8A 2BQ3A 3MR5A 3DRRA 4XO0A 2YKNA 4ZMMA 5F8HA 4KHRA 1HARA 3OHBA 1NHVA 4TY9A 4IRKA 4QW9A 3BSNA 2R8JA 5KT3A 3HVTA 3JYTB 3SI8A 1HQEA 3IGNA 3KNAA 1RT4A 5KFNA 2V0NA 4Q45A 4WZQA 5F8NA 2FVPA 4ED0A 1LWFB 3DRSA 4RNNA 1T03A 1TKTA 4KSEB 3KK1A 2YNHB 4RW7B 4K50A 3KK2B 4IRCA 3PR5B 3C6TB 4I2QB 4EYIB 1TV6B 2IA6A 2J6UA 1DLOA 3T1AA 1JLCB 4F4XA 3IGVA 4IG0A 3H2LA 3QIDA 1JKHB 1LW2A 1RTJB 5CYMA 4DG1B 3ISNC 4NLOA 1S0NA 1S1XA 2ASDA 2RDJA 4B3OA 3CJ5A 1S97A 3BSOA 2HNDB 2E9TA 3E51A 1S49A 5KG2A 4ECXA 2RF2B 3LP2B 5CYQB 5HLFA 1LWEB 3NBPB 1XR6A 1SUQA 2I1RA 3CJ0A 2FJXA 4QWDA 2BE2B 3DLKB 5I42A 3DI6A 3I0SB 4ID5B 2QE5A 4KHMA 2FJWA 4ZVEA 3OLBA 2YNHA 3CJ2A 3OL8A 1S1TB 4K4YA 4JV1A 3BQ1A 1RTHB 4ZPCA 5KFGA 4TYAA 3M8PB 4NLRA 4WFYA 4GC6A 1UWBA 2XGQA 1SH3A 4G1QA 4K4SA 5KFTA 5J2NA 4NLDA 5K14B 4IR9A 5HBMB 2R2TA 2RKIA 1JKHA 2C2RA 3H4BA 1T3NA 2OPQA 4DG1A 3FFIB 3T5HA 4IR1A 4ED1A 1TVRB 3DLGA 4Q0BB 1RT3A 4FS1A 1T05B 3PVXA 2HNDA 3LP0B 2C28A 1R0AA 1LW0A 3IG1A 2HMIB 4F50A 1RT1B 3V4IA 4YR3A 3CVKA 3V6DB 1K1SA 3D5MA 3LP2A 4HKQA 4F4YA 2CKWA 4IOBA 2C2DA 3BJYA 1IKVA 4Q8EA 4O4GB 4RU9A 2ZE2B 2FVRA 2IMWP 4FBTA 1HMVB 3BSCA 4ZPBA 4KV8A 2VG5A 2HNZB 1W25A 5DGBA 4ED6A 1S0OA 4Q44A 4U7CA 1ZTWA 2E9RX 4ZP7A 4HYKA 3OL9A 1RDRA 4KE5A 3HKWA 5KFBA 4RUCA 3HHKA 5DLFA 4RZRA 3CDWA 3OHAA 3M8QB 1DTQB 4R5PA 2R2UA 1S9FA 2IM2A 1C1BA 1J5OB 2WCXA 2OPSB 4JV2A 4NLUA 2YNFA 3DRPA 4DL2A 3LP1B 3KJVB 1FK9B 5D3GB 2RDIA 3CDUA 5J2MB 4IDKB 1S4FA 3QGHA 5KFLA 3IS9A 3MFIA 4NLXA 1DTTB 1IKYB 1RT5B 4IG3A 1RA6A 2HNZA 1S1UB 1RT7A 3NAIA 4H54A 5KFKA 3MFHA 1JXLA 2W9BA 1S48A 2VG7B 2O5DA 3PJXA 3GQCA 3H40A 4TN2A 4YR0A 1HNIA 1S6QB 3LAKA 5J1EA 1JLBB 4KAIA 4FBUA 2FLLA 3DRRB 3PW0A 2YKNB 4ECRA 3MEGB 2GC8A 2AX1A 4IH6A 1RA7A 1TQLA 5DGAA 2FJVA 1XR5A 2B6AA 3QGGA 2ATLA 4ZHRA 5EWEA 4EBCA 2JLEA 2R2RA 5J2MA 5KFSA 3OLAA 5HP1A 3KK3A 3HVTB 1RYRA 2BQRA 4LSNA 3EPGA 4R0EA 2FVSA 3LALA 1HQEB 2FVCA 4WXWA 3T5LA 1RT4B 5EDWA 1RT2A 1DTTA 2W9AA 4J9OA 3DRSB 4RNOA 1JLAA 2JEIA 1T03B 1TKTB 3KLIA 3UR0A 3Q8QB 3KK1B 4ECSA 4O3RA 3BQ2A 4F4WA 4J9NA 3PW5A 3KLGA 4KKOA 4ZP6A 4ZVGA 4U6PA 4RNMA 3GIJA 1DLOB 2XC9A 3TVKA 4MK7A 4WYLA 2R8HA 2OPRA 4WFXA 5DG9A 1JX4A 4NLWA 1LW2B 5CYMB 4IKAA 4ZP8A 2CJQA 3KLFB 4K4XA 4LSLA 3MEGA 1S1XB 3QLHA 4B3OB 1MU2A 4J9MA 5FDLA 2ASJA 5KT6A 5KFOA 2WK4A 3FSIA 5HLFB 1SUQB 3PHEA 1TL1A 5I42B 2XGPA 3DI6B 1RTDB 2B43A 4MFBA 3H59A 4MKAA 5KFFA 4TQSA 3KHGA 3PW2A 2ALZA 3KLEA 3GV5B 4H4OA 1HPZA 3OL6A 4O44A 1QE1A 3RBEA 1S10A 3C6UA 1S9EA 2IC3A 2XCPA 4KB7A 3RB0A 4NZ0A 1UWBB 4ZPAA 4YQWA 4G1QB 5J2NB 3NAHA 1TP7A 4WE1B 2RKIB 4RW9A 2OPQB 3KLFA 1N5YA 5KG6A 3CO9A 2IAJA 3DLGB 2FLNA 1RT3B 5EUHA 1KLMA 2IBKA 2AGQA 1R0AB 4RW4A 1LW0B 3IG1B 3I0RA 3NKYA 3V4IB 3GYNA 4QWCA 4NRTA 2C22A 4RW6A 4PWDA 2ZD1A 4R8UA 4NLYA 1IKVB 4ZVFA 4ECVA 3HVWA 1RTDA 4NLSA 3QZ8A 3RAXA 4KV8B 2VG5B 1BQMA 3DYAA 1HQUA 2DPJA 2W7PA 3FDSA 4I7FA 3JSMA 4WE1A 1JLFA 4MKBA 5F8LA 5J2QA 4MIAA 4TLRA 3RBDA 4NLGA 3H5XA 2WONA 4R5PB 4YR2A 3V6HA 4NYZA 3CWJA 1C1BB 5F8MA 2HNYB 2I5JA 3IRXA 3QZ7A 4PQUA 2YNFB 3DRPB 3LANA 4URSA 4J9KA 2BANA 2R8GA 3D28A 4MK8A 3PJWA 5KT2A 4K4VA 3DM2A 3BSAA 3IS9B 3KLHA 5I3UA 5KT5A 4IRDA 2HWIA 3DOLA 3BR9A 3G86A 1S6PA 5F9NA 4IG3B 2VG6B 3SFUA 4URGA 5C5JA 1RT7B 2XI3A 4NRUA 2ILYA 2UUTA 3EZUA 3UDLA 5DG8A 4KBIA 3Q8PB 3OL7A 3M9NB 4MIBA 2W9BB 3RB6A 3PR4A 4DL6A 4OL8A 2AGPA 1N48A 1HNIB 5J1EB 4EBEA 2WHOA 4J9LA 4ECYA 2UVVA 5DLGA 3N6LA 3TAMA 5J2PA 3NMAA 1LWCB 4O3SA 3CJ3A 5HROA 5KFPA 1GX5A 3E01A 2HNYA 3N6NA 1S9GA 1TL3A 2B6AB 2F8EX 4ZHRB 3MTKA 3MEEA 2WB4A 4ICLA 4NLTA 4GC7A 4EO6A 3QGIA 3QYYA 5HP1B 3KK3B 3BQ0A 3PW4A 4LSNB 2W9CA 2JEGA 3ITHB 1C0UB 1K1QA 2AQ4A 5C42A 4Y3CA 1RT2B 2IJNA 4XPCA 4NLVA 5C24A 4QPXA 3G6XA 4J9SA 2VG6A 1JLAB 3GIIA 3KLIB 4O3QA 4QWEA 3KOAA 3KLGB 4KKOB 5KFHA 3KLVA 1C0TA 4ECUA 4G3IA 4IFYB 5L9XA 5KFVA 3T5KA 4KFBA 1RTIA 1KHWA 1QAIA 4NLQA 4Q8FA 4QWAA 2OPRB 5KFMA 3NGDA 5F8JA 1HYSA 1HNVA 4URQU 1CSJA 1LWCA 5KT7A 2JEJA 4LSLB 3QLHB 2ASLA 3DOKA 4IFVA 2V9WA 2B5JA 2ILZA 4ED2A 4ED8A 1MU2B 3BGRB 3H4DA 5FDLB 2FVQA 5T14A 4FS2A 2YNIB 5JXSA 3T5JA 2YKMA 3ITHA 4ED3A 1C0UA 2V4QA 2EC0A 4M95A 3H5SA 1TL1B 2XCAA 2UUWA 4MFBB 3HVAA 3MECA 3KLEB 1IKXA 2BRLA 4H4OB 1HPZB 5KG1A 4O44B 1QE1B 1VRUA 1VRTA 4RNFA 3C6UB 1IM4A 4H4MA 1S9EB 1SV5A 2IC3B 1T94A 1NNDA 3H98A 4IFYA 3UQSA 3MEDB 3IN5A 2JEFA 1IKWA 2OPPA 5F8IA 3MR6A 1RAJA 1EETB 1NHUA 2UVUA 1S1WA 4RW9B 1TKZA 1TKXB 1N5YB 5DG7A 2IM0A 2IAJB 1GX6A 4Y34A 4TQRA 3N6MA 1KLMB 3VQSA 1N6QA 1ZETA 5KG4A 3BGRA 4RW4B 4WXOA 3I0RB 4ECWA 5KFUA 2BRKA 3GILA 2YNIA 3MF5A 4TXSA 5KG0A 4RW6B 1FKPA 3V81A 2JC0A 5EWGA 3NL0A 1I6JA 4PWDB 2ZD1B 4R8UB 4I2PA 3OSPA 3G6YA 1S1VA 1JLQA 5DQIA 1BQMB 3DYAB 1HQUB 2JC1A 2E9ZA 3MEDA 4I7FB 4J9QA 4NCGA 1C2PA 3JSMB 4O3OA 3CDEA 5L1JA 1XR7A 1JLFB 4JUZA 1EETA 4EBDA 5C25A 2R8IA 4ECTA 3KMQA 3G6VA 5J2QB 1EP4A 2D7SA 3KHRA 5KT4A 4YP3A 1C1CA 1TKXA 2WONB 2YNGA 1ZTTA 3KMSA 2DPIA 2OH2A 2WOMA 2XWYA 4O3PA 5L1IA 3DMJA 2BR0A 2I5JB 3IRXB 3MR2A 2UVRA 4PQUB 3TQ1A 2BANB 3CJ4A 2GIRA 3DM2B 1REVA 3FRZA 1QUVA 5I3UB 3KLHB 5KFIA 5KG5A 3DOLB 1S6PB 5KG7A 2UVWA 3DLEA 4JV0A 3KHHA 1RT6A 4EYHB 4IQXA 4TYBA 3QO9A 4TY8A 3GV7B 1JLEA 1BQNA 4KO0B 2FLPA 2D3UA 1FKOA 4O4RA
chains in the Genus database with same CATH superfamily
3P6YC 3W7BA 2LQ9A 2E5GA 3NS7B 2JJ4D 4RNHA 3PFEA 2QL5B 4KRWA 5CYJA 2AEJA 3F0NA 2I38A 3FQKA 4WKYA 4MK9A 3W61A 4U8VA 2W8LA 2HIQA 3SBMA 2ZH7A 1RTIB 3KKFA 2FGCA 2J6SA 4DF8A 2LA4A 1WF1A 1AUSL 4DX8H 3F41A 2L9DA 4YHHF 4DV1J 1H0HB 4LQ3A 1TL5A 4OLOA 3KHLA 2DIUA 2HRTA 1TUGB 3T1YF 3NGTA 1RWPB 4NLPA 2KYZA 2ZDOA 3VVTA 1YX2A 2R7OA 3KDOA 1KS2A 4ZPDA 4C97A 3QJPA 2H3EB 1X4DA 4NCGB 2G0CA 4K4TA 4RUHA 4C98A 2W8KA 5ETNA 1KFDA 3MM5B 1SQFA 1SH2A 5THWA 2PMWA 4I64A 3QIPA 5T41A 4BCAA 1FEEA 1HNWF 2KVIA 1WHXA 4IRKA 3C3LA 1Q8BA 4RNNA 3D68A 2UU9J 1LXJA 4LBHA 1IQTA 3R27A 3WX8A 3AOAA 3OTDA 5K8PA 5HJXA 5CCMA 1U1OA 4X4SA 4CNZA 2XYPB 3GU0A 3QJJA 2RF2B 1XR6A 3I0SB 3CD5A 4JBCA 4NLRA 2BX6A 3MXHP 5JVHQ 2OPQA 1B64A 3IWNC 1EJ7L 1ZAXA 2QTWA 3VZIA 2XYHB 2A10A 3EGNA 2ZE2B 3BSCA 1D9AA 1RDRA 1NK9A 5HO4A 2BMBA 3N01A 2WCXA 2ZNYA 1SC6A 5J2MB 2VFRA 4IG3A 2MZTA 5HSPA 1UETA 3TA2A 2W9BA 3FC9A 1TK0A 1S6QB 4BHQA 4NYPA 4ER8A 3QGGA 1M90T 4PQAA 5HP1A 3LALA 3AAWB 3POTA 5CD4A 4C9DA 3PIPQ 3MM9A 4E98A 1S7IA 3OUYB 1BWEA 1AFIA 2JFDA 4UW2A 1RHQB 2H65B 2YWEA 2ASJA 2PSZA 2VF3A 2JNJA 3EYZA 3GTYX 5HLFB 1Y5IB 1SUQB 1TL1A 2WSEC 2DNMA 1QE1A 1PO6A 1HHTP 4DV7F 1WEZA 1G3OA 1Q8KA 3A12A 1ICEB 4E8UA 1CULA 3DGVA 2AGQA 1FDDA 3I0RA 3V4IB 4RW6A 1X7VA 1HR0F 3SEOA 4O0IA 2P8IA 2JZ5A 3ADAC 2W7PA 2HHQA 4ZA1A 1Q5YA 2VV5A 3CWJA 1JNZB 3DRPB 2IY5B 4DFJA 4ELVA 2MSTA 4DQSA 2UUAJ 4CTAA 4DSEA 1VC5A 3EZUA 1YDLA 3IWXA 4DV5J 1FE4A 2IYGA 4OL8A 3CNQP 2EBGA 4J9LA 3GCXP 4LFBJ 1FXDA 1NK0A 1Q79A 2HBQB 5HVFA 5EGYA 2HNYA 6FDRA 2GQCA 2WB4A 4ICLA 3QGIA 3PW4A 3BGFA 1N0UA 1FI4A 1UJ6A 4Y3CA 4J9SA 4QPXA 2VG6A 1JLAB 4DR1F 3KUGA 5L9XA 3T5KA 1ZAVA 1GAOA 2RT3A 1BY9A 1SQEA 4AD6A 1FERA 3BGRB 3QFHA 3RRKA 3D0IE 4MFBB 2BRLA 1RHJB 4KHPJ 3GWCA 3K5NA 1UJ4A 2DIVA 1S1WA 2Z4PA 3GJTB 4N5SA 4USHA 2YNIA 1NSKL 5GMDA 2ZBCA 1JLQA 1RXOB 2HVZA 4DR2J 1NDKA 1NH7A 1N34J 1UFKA 3VAMA 3W9JA 4X62F 2UVRA 1KDNA 2X1AA 5LSLA 5KFIA 4NZ6A 3DOLB 4TY8A 3PW0A 3DOMB 2QJ3A 1AUDA 3TAMB 2VODA 3VAHA 4K0KF 1KVIA 3PKMA 2B8QA 2ZKTA 2PFFB 4DV2F 2OLWA 7AT1B 1LWFA 4O23A 3MMBA 4Q2LA 4ILLA 4RO0A 3C6TA 4I2QA 4MTPA 5KG3A 4I56A 2LYVA 1RKJA 3TA1A 1C0TB 3UDVA 1T9TA 4HI2A 4OFZA 1FO1A 3RR8A 5CYQA 2DNHA 4P2XA 4JI2F 3NS6A 3DLKA 1FRMA 5LXRA 1VQ8S 1DURA 3MPVA 4G1IA 4EK2A 3BDPA 3HHEA 4B17A 2V8DA 4P75A 2E44A 4X84A 1XK8A 1UTAA 3QNWB 1SVDA 3RB4A 2VONA 2XG8A 4DQIA 3V81B 4IQMA 4I2PB 4DV4F 3QRRA 2BQUA 3KG4A 4CO3A 1X0FA 1Q0NA 1TR0A 2ZDPA 4K4UA 1URRA 3LP1A 2VPXB 5RUBA 2AJQA 4JI4J 2QRRA 2W7OA 1JJHA 2EFGA 2BV3A 4NXNJ 3EICA 5F8GA 4RUAA 4B3TJ 2IM1A 2VG7A 3FGVA 3W66A 4L76A 3V6KA 3OFEA 1PC4A 2M8HA 5ETKA 3MCSA 2FQQB 4P52A 1JNRB 4ED0A 5EX3A 4IRCA 1JMTA 2HBYB 3UN2A 4LF7J 2EPIA 4CYUA 2RDJA 5LJ3Y 3BSOA 3THPA 1ZZNA 3G71S 1IQZA 1AZSA 2BYCA 2LMIA 3CW2C 3DI6A 3GZ7A 2DGTA 2DR8A 4HHJA 1WOOA 1GEHA 3R9LA 3OR1B 4DG1A 3DHWC 5J1PA 3CULA 2PEHA 1X0PA 4O4GB 1GMVA 2X1BA 2GVDB 2VG5A 1W25A 4N77A 1HD1A 2FZCB 3OL9A 2A3JA 3QBCA 4KPYA 2NPIA 3CDWA 2DRAA 1DTQB 3HFZB 1PYOB 1J5OB 2V8HA 2OPSB 1FDNA 2ZHOA 3ZO7A 2AMCB 5IFMA 2AZ3A 2CJKA 5KFLA 3VAFA 2DGQA 2GFFA 2RQ4A 4FVMA 4OJHA 2DGWA 3CCWA 5U47A 4PG6A 2HQIA 3LAKA 3HHLA 1QTNB 2YY3A 1U1NA 3BKUA 2RJZA 2HFZA 1DTTA 4DR7F 4ZP6A 1RKIA 3GIJA 2HFVA 1DLOB 1L3UA 4DHVA 4CH1A 2GHWA 5DG9A 4NLWA 5D0EA 3TQEA 1HNXJ 4J9MA 2WK4A 1WKJA 3P49B 1XMQF 2J7UA 1RTDB 3GV5B 3C6UA 3SSQA 4CP5A 4A8OA 1W26A 1U25A 4USIA 3M2VA 1QY7A 5DM7Q 1H3DA 3KG0A 1NMEB 2I9SA 1IKVB 2HHPA 4LT6A 4EU0A 5GAHU 1WKLA 3R5BA 2JH3A 4MIAA 4QR1A 1E6VA 4URSA 1YITS 2VB6A 4MK8A 4DV6J 3KLHA 5KT5A 2LDYA 1FDAA 2BKNA 3CJQA 4S0MA 2GIFA 2XHWA 1VRQC 2AGPA 1HNIB 3CO0P 2NCKL 2KH9A 2HVHA 3DRXA 2P6TA 3FZ2A 3QMQA 4ZHRB 3PY8A 5IS2A 4DZ6A 4HACB 1RWWB 5L38A 3R7SB 3KLIB 1WTFA 2DGUA 1PYSB 5G4DA 4G3IA 2ZH9A 4GO7X 2IVYA 3QLHB 1HNZF 1KLNA 3H4DA 4AXIA 1R31A 1U49A 1QM9A 5KG1A 3KLEB 2G13A 3LA0A 3G8TA 1NHUA 4M5DB 2BBEA 5HN0A 5AXNA 2QYCA 5A8RA 3R7NB 1S4EA 1YJNS 2KM8B 5KG0A 2JC0A 5EWGA 3TP2A 3NL0A 3IM9A 3L7UA 2YTCA 1S1VA 3M8WA 2EFQA 3ZC4A 2WW8A 2BOPA 4M5HA 1SL2A 1R89A 4LF8J 2KZMA 3BF4A 3SQGB 2BR0A 1N32F 4PQUB 1N5SA 2BANB 3CJ4A 3OJUA 3NY0A 1I3OB 4LRBA 4O4RA 4JV5F 4DL0C 1OWXA 4DSLA 2J76E 2XSJB 1K44A 1ZA2B 2VC0A 2HWTA 1WG5A 3MEEB 1X5SA 3VAIA 2WVCA 4J9UE 1D8YA 1FCAA 1EIYB 3O1LA 3KTQA 3ZTOA 3BKTA 3I55S 4PR6A 4KFBB 1Y7PA 5D4NA 3M6XA 5IOLA 4DFKA 3DOKB 1NHKL 1XTZA 4DMZA 1LWEA 4DR5F 4HHHA 4DL5A 1YBUA 1LFWA 4BDPA 2H4YB 4B9TA 4X4UA 3TAPA 5F0WA 3M8SA 3RZAA 5KFAA 2ZH2A 4H4MB 3MPUB 3FMBA 4PPDA 8ATCB 1VS3A 4MT1A 3PRDA 4ECZA 1SBRA 4XDDA 4OI1A 2WBMA 1YK9A 3CCUS 1X4FA 3LWMA 1JXEA 3Q8RB 1QVGR 2JLFA 2VDHA 1IKYA 1B3TA 3BO2A 2A2DA 2G9OA 4C8LA 1RT6B 5D0RA 2UXCF 1KWMA 3W2WA 2KJVA 3P8BB 1VBKA 2Q6CA 4KHRA 1R7IA 4OJ1A 3A3PB 1R3NA 4J90A 3HM9A 3SI8A 4OZ3A 2UXDF 3PR5B 2GAGC 4LR7A 2HVIA 1S57A 3WIUA 5ETOA 4CO4A 2E9TA 3Q89A 1X9SA 4ID5B 4OI3A 4NEYA 4K4SA 4B08A 2RAQA 5A8WB 2VPZB 2DXEA 3M8YA 1T05B 2OGUA 1R0AA 2HMIB 2XMTA 2GQ2A 4Q8EA 4I67A 4JI3J 5E41A 4NE9C 2CNNB 1NKEA 2YNFA 1EQMA 3L3CA 4F0KA 4H54A 3H40A 2DYAA 3L4BC 2K3IA 1AT1B 1CJTB 2YKQA 1IR2A 4M5JA 2XMAA 4OZNA 4LFAJ 2QFIA 2E5IA 2YWKA 3UCUP 3JQKA 5J2MA 4JI6J 2BQRA 2R7UA 2FVSA 2Y0SD 2W9AA 2Q79A 3EWGA 1KQFB 1KTQA 1K47A 4ZVGA 2O67A 1B0PA 1RCXB 4ZP8A 5EHHA 2FC8A 2HLTA 5K8NA 3FJ2A 4ZN1A 2N3OA 5I42B 2MGZB 4NL5A 1S9EA 1N33J 2U1AA 3RB0A 1CJUB 4PG4A 1OPIA 2EEYA 2VIHA 2Z8QA 3OXLA 3D67A 4ID8A 1LW0B 2F63A 4OHZA 5DDOC 2Z2MA 1R8BA 4DPWA 3BH7B 1NPRA 3U27A 1H7WA 2DPJA 1K0TA 3HFVA 4XK8C 3GFYA 5IT0A 4MKBA 1K0VA 3L09A 5BYRA 3VWSA 5GAEU 3C15B 4IRDA 1VR6A 5C5JA 1CG2A 5A8KB 1HBNB 4ECYA 2PGCA 2AYEA 1T9XA 2GO9A 5HROA 3QWPA 1RBLA 2G2YA 1S9GA 4FF1A 5LXYA 4LSNB 1K1QA 3BZQA 2R7WA 2EFPA 1OIAA 5BYQA 1D3WA 1VBXA 1I94J 4DUYJ 5HQ8A 2EC2A 4IFYB 1LQ9A 5LL6d 4Q8FA 3LTOA 2H5EA 4F4AA 1CSJA 4LSLB 4ED8A 4LUBA 4FS2A 4ED3A 2UUCF 1R6VA 4FNIA 2Y8YA 1QUPA 1S72S 1Q1KA 4RNFA 1RJJA 2VBYA 1NNDA 4LJMA 2OEJA 4P10A 3RGIA 2FHKA 3NCQA 4Y34A 4AXJA 2CWKA 3BGRA 3KWMA 1JB0C 1FKPA 4FPIA 3MMCB 3JS9A 2KN4A 3HP6A 4ETXA 3P96A 3HSJA 3DYAB 2JC1A 4FXWA 2C2ZB 1WKKA 1CEZA 2M3DA 3JQJA 1BXNA 5J2QB 2OH2A 2I5JB 1OJ4A 4P2FA 4KGZB 3SSRA 2LQ5A 3BGUA 3QO9A 2IVFB 4AL5A 4B3RF 2IDLA 2OSQA 3OBIA 2V8GA 4USKA 7FDRA 1JIHA 1TL3B 3Q8VA 2HVEA 4IH5A 3WQPA 4HT5A 2LCWA 4ZP9A 1RTJA 5F0UA 1DZ5A 4PUOB 2JRSA 1O5JA 2QC3A 3BR8A 1NB7A 2VDIA 2VQEJ 4GMKA 1XNRF 5A2QY 1ZYQA 4LRCA 2W1BA 4C48A 1RWVB 3JB9k 2VU5A 4OYZA 1RT1A 3D1HA 3CT9A 4GVBA 3KDNA 2V63A 4J5OA 3ZFVA 1UWAA 1N4LA 3DRYA 3GR0A 5CQGA 2J6TA 1WJ9A 5G0RB 4PAAA 2GGPB 3VV2B 3ONQA 1YBAA 3CD6S 1YVFA 1IVZA 1FK9A 4IDKA 2MZRA 3DMJB 1X4HA 1N36J 3IBFB 3ZTPA 3GV8B 2IRUA 3GIRA 2LECA 1J5EF 2CPIA 3G2XA 4U7UD 5F8HA 3G8SA 4QZVB 6AT1B 4MYTA 5KT3A 1F1BB 1QDUB 1YJ7A 3JYTB 2O1PA 3OVBA 1CQMA 3K5MA 1HBUB 2VQFJ 4DF4A 4M1KA 5F41A 4JI0F 4YY3F 3ISNC 1PKUA 4DV0J 1S1XA 4X66J 2GJFA 3LPEA 5D8HB 2UXBF 1Q53A 1RHUB 1S79A 3ZTRA 3NBPB 4QWDA 2LU2A 5D78A 5BJRA 1RTHB 1UJ5A 4WFYA 5K14B 2DXFA 2C2RA 1VQSA 4ED1A 3D1QA 1U1QA 2HGNA 1JJCB 5IQ6A 2CDQA 5JMNA 4HKQA 4DUZJ 5IV3A 4OX9F 1HBMB 3AY0A 1HMVB 1R0BG 1RE1B 4CO0A 4ZN3A 1VLOA 2DVIA 2Z30B 3OFGA 3RW7A 2BKOA 3AA8A 4NLUA 2F4VJ 2YQ0A 2GHVC 2GVDA 4F0HA 5DDPC 1WC1A 1XNQJ 1RWUA 2BXJA 3GQCA 4O0NA 1DAXA 4Y2KA 2YKNB 2OO4A 3PYDA 2FIUA 4EBCA 2JLEA 5DO2A 3DLHA 4WBFA 4PXEA 2FVCA 4NXMF 1NUEA 2MZQA 1TKTB 3KLGA 3CB4A 4AUKA 3TVKA 1A7GE 4WYLA 3D6HB 3QAEA 2QLBB 3NGSA 2YBVA 4B3OB 1HI0P 1L5UA 3FSIA 3PHEA 1U0HB 3OL6A 3AXKA 2OSRA 1WC3A 4ZPAA 2MLYA 2OD6A 2J0SD 2IAJA 2P9EA 1KBRA 4F8RA 1M1HA 2G1DA 3B78A 3OTOJ 4ZVFA 1KC8T 1RTDA 4KV8B 2HBRB 3UNGC 2HEKA 3M30B 4NZ7A 1P27B 1I1GA 1H73A 2ADCA 4MIWA 1CS4A 3PHTA 3SV4A 2VFVA 1T8EA 3J80Y 3BKFA 3RB6A 4JI8J 1N48A 5IC4B 4EBEA 3CCES 2AEMA 2ZZNA 2BJ3A 2FB0A 2CPHA 1C0UB 4GKJJ 2KT3A 1KNZA 3LGMA 1KVJA 1U6BA 4QIEA 1MN7A 5K5MA 2XLKA 2JLGA 1HNVA 2PD1A 2U2FA 4URQU 3F44A 3VTIA 4OHWA 1NPPA 2Y1JA 2H1YA 4P72A 3CE8A 4DN9A 3HVAA 1WF0A 2VPWB 3M2RA 2UP1A 2NUHA 2DT9A 2HKEA 1LNQA 1VQ9S 3AQPA 2A6OA 4LF2A 3C16A 4DPYA 1X4CA 3DLBA 4ZCLA 2JVOA 5GMEA 4LF5J 2UZAA 2Y1LB 4HTJA 4O3OA 2MKSA 4WIQA 1GNKA 3MCMA 2DPIA 4ZIVA 4EGLA 1T9VA 4NCBA 3MPYA 2GIRA 2KXHA 2NXUA 2IDEA 4RLEA 3H42A 3TVYA 1CJVB 2FLPA 3ELHA 4B3SF 3ICLA 3AJ1A 1RYSA 2LEAA 5KFYA 2PIIA 3R5CA 4ED4A 4RW7A 1Y5NB 4OIXA 3GIMA 4W98A 3P3DA 5E3CA 4EWTA 2DD8S 1HYSB 2V2KA 2NPFA 4IFVB 1JXVA 4F04B 5B0DA 3IC1A 2HAIA 4J91A 3C46A 3R5JB 3FCWA 3MECB 4PCQA 4UOGA 2NZ4A 3DLLQ 1QTMA 5FD1A 2AWZA 5AXKA 4OJ3A 4CLWA 2DNOA 1YQHA 4ELTA 2ATCB 2BM0A 1ZM2A 3MTJA 4FKYA 2ZEJA 5ETSA 4OI2A 2MKKA 3THTA 5A76A 4WKRA 1U0SA 2CG8A 3HX9A 2XHCA 2IRXA 3CCZA 2UU9F 3K0JA 2VUGA 1RT5A 2V34A 5LMNF 2IJFA 2BQ3A 4XO0A 1Q5VA 2GMLA 3BO4A 3SCLE 3KG1A 3T1HJ 2N82B 3I87A 5HI7A 2YNHB 2AD9A 3R6GB 2G2OA 4HDHA 4JYAF 3UVJA 1VLYA 5GAGU 3LP2B 3CJ0A 4DLEA 3MD1A 3PFOA 4JV1A 5KFTA 5J2NA 4IR9A 5HBMB 3T5HA 1VISA 4QPTA 5MAOA 1IR1A 4F7VA 3V6DB 1KVKA 2IHR1 4AE5A 1NK7A 1IWGA 1RHRB 1LEOA 2QG9B 2C2DA 1JJ4A 4PYDA 1UL3A 1GMUA 4HT7A 4F67A 2HG4A 2DB1A 3AODA 4QYZK 2VFSA 2JFKA 3W5YA 1C1BA 3OTCA 4PPZA 3KJVB 3NNHA 3TAQA 5IT9U 2LU1A 3VALA 5T7LB 4WPAA 4ZKAA 2SXLA 1PC5A 3RRGA 1A0OB 1JXLA 3FVYA 4DQPA 3TANA 1VDHA 2DGVA 1SKUB 4WP9A 3BV8A 1RA7A 4ELUA 2ATLA 1F2GA 4UY85 2BJDA 5HMZA 2XC9A 4P71A 2JOQA 3HJFA 1UVKA 1VMBA 1FE0A 9ATCB 2LEBA 1U1MA 4MKAA 4A8SA 1GTHA 1TL7A 4CM0A 3ZNJ1 4TKTA 2CVEA 2RH3A 2RKIB 1VJWA 4PXBA 2K06A 2FLNA 4RW4A 2ROPA 4U96A 1WHWA 1KOHA 4DV3F 2LXUA 1CJKB 1SXLA 2V67A 1VQNS 3IM8A 1KN6A 1X5PA 1QSLA 5M2UA 1KKHA 2K1RA 2V9KA 2BUNA 4LFCF 3CGIA 1ZPWX 3QZ7A 3LH2S 4KTQA 1FWKA 3N5BA 3DM2A 3BSAA 2Z58B 1NPKA 1HWLA 3NMRA 1X31C 1RAGB 4KBIA 3I4HX 4Y2IA 1U8SA 5SZTA 1LWCB 4HHUA 3MCNA 4O3SA 3NLCA 2ASYA 3BQ0A 3C15A 1JWWA 2JEGA 1Q82T 2GVZA 3GIIA 6FD1A 5HL7Q 3D7SB 2PC6A 4DR3J 5D77A 4C0BA 2OPRB 5KT7A 3BM7A 2B5JA 4ED2A 2B56A 5J1NA 5JXSA 3GG1A 4QQBA 3GJSB 3K58A 2Z2YB 1FFWB 1N34F 3C8YA 4A8QA 4IFYA 3SDEB 5IXUA 1N5YB 1U2FA 2XMVA 4QYZJ 3OVAA 2A2CA 4ZLNA 2DK2A 5DQIA 2HHXA 2OFGX 3TUZC 2D9PA 2OTLS 3AA9A 4NCAA 1BD6A 3KMSA 2XWYA 2KFNA 2HQCA 1WHVA 1FKAF 4DN0A 2VASA 3MMCA 4QIFA 2VFTA 1R43A 1QUVA 2ZZTA 2RHSB 3KUEA 4JV0A 1DBDA 1BMQB 4CH0S 4DEZA 5L1KA 2KT5A 3VAJA 3E01B 2LA6A 3CD0A 2AGOA 2DNNA 4ECQA 3HXMA 3BREA 2DNPA 3KK2A 1REGX 4LRFA 3UPFA 3M1VB 4KGVB 4Y2CA 4Z7CA 2W4DA 3N5FA 4A8MP 3MM7A 4QWBA 5DZ7A 1ACMB 4GKKJ 2WVDA 2J0QD 2C3UA 3ENWA 5AJ3F 1GT8A 3R6LB 2H5JB 3IAS9 1SH0A 3SXLA 4PUOA 2CQDA 4JI4F 2ZVSA 1N6QB 1YRXA 5IWAF 2E1AA 1DRZA 1UW4A 3LGHA 4YB6A 4LF9F 1XIQA 4CLFA 3BPSP 1W7WA 3TEGA 4EUVA 2KG0A 1SC1B 1VQKS 3U02A 4FYWB 1OQ3A 1FKOB 4B3MF 5LJ5Y 5GAHI 2M70A 4ZMMA 3HHLD 2COLA 1XWLA 3ENVA 1ELOA 3FK4A 3PYFA 4WZQA 2MQLA 3DRSA 1L3TA 1U24A 2K7KA 2LQJA 1HA1A 1M5HA 3GCWP 2KU7A 2AJ2A 2NUUG 1TV6B 1HW8A 1NEEA 1CC8A 2ADBA 2G0IA 2D9OA 1NH8A 3NS5A 1U2CA 2GAHC 1SJ4P 3G9CA 2WB1D 3AXMA 2N4CA 3CJ2A 1S1TB 2QGFB 3R2CJ 4CH7A 1LXNA 3CCSS 4GRSA 2GA7A 2MJNA 2K7JA 3RJMB 5DGBA 4ZVRB 5H9EK 2ABYA 4U7CA 2LXIA 2DY9A 2YX4A 4RZRA 3OHAA 3M8QB 4L6V3 2CPXA 5A6PA 4NPOA 1AW0A 2JDJA 2PMHA 2DEIA 2E66A 4RBTA 4YHHJ 4YR0A 2CIMA 5J1EA 2N7YA 1JLBB 1HNXF 4DU7A 2CQ4A 3KXDA 2KM8C 5HMXA 1NK4A 1RT2A 4G65A 4ECSA 4KKOA 2O3DA 1JX4A 3SCKE 4K4XA 1MROB 4NWBA 1ZS6A 2QMUB 2C2OB 5HJYA 4C8MA 1K9MT 1WEXA 2PMZD 4FDFA 1QD1A 2V50A 3M32B 4G1QB 4WE1B 1FFGB 1HNWJ 5E7OB 3IG1B 4F3QA 3OFHA 1IR0A 2K2PA 2ZD1A 1S12A 5A0YA 5HANA 2J8AA 4I7FA 5KTQA 3JSMA 4PWWA 3D4JA 3H5XA 4IO9Q 2X3GA 4M5GA 3IS9B 2VJUA 1AFJA 4URGA 2KDOA 2M0GB 2MMYA 3FEYB 4QU7A 2HFUA 3B54A 1WSRA 2F8EX 4NEZA 4LVNP 3KK3B 1SL0A 3EGZA 3P45B 1X8DA 2IJNA 5C24A 3PEHA 1FA0A 2OFHX 4ZK7M 3KOAA 4I4BA 5LMUJ 1KHWA 3AOCA 5KFMA 1B70B 1KTVA 1FRIA 1C0UA 3SIPB 1FJGJ 1IKXA 3R2DJ 4KH0B 5CAAA 3FEXB 5H9EJ 4WCEQ 5IM0A 5KG4A 2HS4A 3GFHA 5CHCB 3OSPA 3K7RA 2CJXB 1HQUB 2IVMA 2EFVA 2E9ZA 4J9QA 1Y9OA 3GJQB 1S99A 2G2ZA 3Q22A 2D7SA 4CO1A 2YNGA 1S6OA 1RAEB 5L1IA 3M6UA 3AOBA 1GFWB 2MQNA 1S6PB 4TYBA 2UUBJ 4OZ0A 1F2HA 2CADA 3CIZA 2LVWA 5J2PB 5K20B 4K5SA 2MLXA 1HW9A 1D09B 1KQGB 5KOXA 4N76A 1GTEA 2DISA 1CJVA 4BWMA 1HR0J 2XEXA 1WNEA 1JLGB 1BE4A 1U48A 3VGTA 4QW8A 1X4AA 2PDAA 2BE2A 3UD5A 2CPFA 3MM6B 3CJTA 2XS7A 1UVIA 3D6FB 3D3BJ 1TFYA 1SV5B 1HI1A 3MMAA 1IKWB 1TVRA 2WTFA 1SI9A 2KL8A 4AFFA 2HYIB 2DNQA 2GIQA 2J9EA 3PX0A 3SCIE 4CM2A 3F56A 5GADU 1MWYA 3IO1A 1NDCA 3W5XA 4NI2A 3GONA 4DR1J 1SC4B 4QIVA 1EP4B 2Z57B 3BEGB 4K4WA 4ZLPA 3TA0A 4TU8A 3W64A 1B0TA 1W2IA 1HQ2A 2QA2A 3RAQA 4MH8A 1BQNB 4Y28C 5EWFA 1YJWS 2CQ2A 3PKYA 1IBMF 3UN3A 4ZJLA 1FNMA 2KVQE 2B4OA 3HVTA 1VHIA 2CJYB 1UKUA 1IUJA 2CQCA 2V0NA 5F8NA 2ZM6F 4W4MA 1MNEA 5GAEI 2N7CA 2J6UA 1PBUA 3DGPB 1LW2A 4XTTA 3UI3A 4NLOA 1EAYC 3W2VB 3O5TB 4OI0A 1VBYA 2V2VA 1P9YA 4X62J 4JI3F 2YNHA 4X4TA 2FD2A 4RBVA 1UWBA 1YJ9S 1NK6A 3O2IA 3TWZA 1RT3A 1KQKA 3CC7S 2XMWA 3LP2A 2OP5A 4K0KJ 2J9DE 4DV2J 4ED6A 4LFAF 2HPUA 4LF4J 4X65J 3JAMY 4CLZA 4ZDNA 4IO1A 3QT6A 3QGHA 4P2MA 4DFPA 5DZ6A 2ZOMA 4JI1F 2R3VA 2L9NA 5KFKA 4JI2J 3G87A 3GFXA 3MAAA 4K59A 5HATA 1VQ5S 3DLJA 2L08A 2F7VA 4TN2A 2VL1A 2FJEB 3TZWA 4F25A 2GC8A 2OKQA 1Z2ZA 2IMOA 2DTJA 3N4WA 3C14B 2K8GA 3EGVA 3QAUA 4ZJOA 5EDWA 1U1LA 3Q8QB 4O3RA 3W8GA 5D4OA 4ZVQB 3OVSA 3Q83A 5CYMB 2QSWA 2V5HG 4OZ2A 3G8QA 1MU2A 3V5RA 1J27A 3HT3A 2B8PA 2ZJRQ 3IR6B 4HDGA 2QLFB 1S10A 2XO7A 3DDNA 2ZOFA 4KB7A 1MLAA 4ALZA 1PIEA 2FJAB 1TU0B 4BLGA 1KLMA 2IBKA 3NKYA 3TX8A 4WK3A 4F3MA 4USMA 4NLYA 1N0VC 3QZ8A 5FLXY 4TU9A 2XWXA 1D9DA 4HTIA 2E7VA 4R5PB 1NU4A 3AFGA 1BUXA 3IRXA 3H20A 1B99A 1VCTA 2LKZA 1L3SA 2M8DB 2R8GA 2F3JA 5I3UA 3UO0A 1FRJA 3MAQA 3UDLA 2DY1A 2LEPA 2YH1A 2QSFA 1XC9A 4AQYF 4EO6A 1H2TZ 1RGVA 4F2RA 2W9CA 2MQPA 5B0EA 5IZHA 5B0GA 3VZHA 4O3QA 4M5NA 2HHHF 3UR3C 3HK2A 1LWCA 2BVZA 2RB7A 2JEJA 1EX8A 2JSXA 2HLUA 4HL9A 3Q2TC 4QOTA 1S6UA 5H1SV 4M95A 1IBKF 4WFNQ 4H4OB 2YWFA 1VRTA 2J0XA 3Q23A 3UQSA 4EMDA 4PXDA 2OPPA 3RBZA 4LVOP 1EETB 2CJBA 1HWJA 1VFJA 1TKZA 5EN1A 3VQSA 2C2KB 3D9BA 4WXOA 2HIYA 1SB6A 2RDDA 4N8NA 4PWDB 2ZBPA 1S7HA 2XLJA 2W2MP 4DR7J 2FJBB 2W2OP 5C25A 4ZVPB 3BDEA 1HD0A 4OYXA 2WOMA 1CBKA 3MR2A 1QVFR 5E3AA 2FJDB 2WW4A 4IQXA 3MDFA 1XMQJ 1JLEA 5K8OA 1Z4UA 2HWHA 1RAOA 2XZTB 2ZH1A 1PCAA 1PG5B 2VBWA 5C42B 1QAJA 1MW7A 1JLCA 3HULA 3I5BA 3H2UB 2KRBA 1AYEA 3M2UA 2RNEA 2R7TA 1IBLF 2LFVA 3M8PA 1S77D 3A4TA 1VRUB 2POKA 3UNYA 3M9MB 5HVHA 4K4ZA 3LP0A 3OT9A 3ZXWA 2ROGA 1PAEX 2FZKB 4BBYA 3HVRA 4X64F 5F9LA 2R2SA 3ZNUA 4XPEA 1KQSR 4DR6J 2BW2A 1F60B 1HFEL 2BJ1A 2QT7A 1HNZJ 1DY3A 4DLGA 4WZMA 1OSCA 1U09A 1IBCB 1S1UA 3MR3A 4ED5A 3QJLA 1N5VA 4DV0F 1SKRA 1DARA 1NHVA 5LOQA 3BSNA 4OV1A 3CD7A 1HQEA 4CCHA 2A6MA 2XYGB 2E1MC 1T03A 2NYIA 2E5LF 5BR8F 4ERDA 2CJ9A 2D3OR 4KIAA 2K3KA 2CYYA 1QAYA 1RBOB 4K5RA 3U7JA 1NJYA 2HAFA 2B3TB 4DUZF 4CLYA 2FJXA 4DPUA 1F9EB 4XDCA 1N32J 3GMGA 2FJWA 4K4YA 4Q2MA 1SJFA 3BQ1A 1VQMS 2HRYA 4PG7A 2XGQA 4Q7AA 1FT8A 1R27B 3DLGA 3UD4P 4JV5J 4CT8A 2C28A 4YR3A 4F4YA 1BGXT 1K1SA 3ZZPA 3BN7A 4OHVA 2CKWA 4IOBA 1XNQF 2EG1A 1WC4A 4OX8A 3NCPA 2CNKB 3J81U 1M0SA 3HKWA 2JWNA 1O0PA 4I6WA 4F4KA 2G0JA 3A3OB 2DXDA 1TELA 4NLXA 3CC2S 1RA6A 4DCJB 1RT7A 2LQ8A 5B0AA 4DPTA 4C0OC 2NSBA 3CMQA 2MQMA 1VOMA 4KAIA 1C4AA 2HS0A 2CAJA 2CA9A 3C66A 3MEGB 3ETOA 3QT5A 3GYXB 4WP8A 4R0EA 2OEKA 1XMOF 3W8PA 3NRBA 4DS4A 3C2PA 2E1RA 2MQOA 1X9WA 4EFAC 3CMES 5B0BA 5C2GA 1RUSA 1Y10A 1BQXA 5KT6A 1G2EA 1WG1A 5KFFA 4TQSA 1HPZA 2IC3A 4ZVUB 3UDCA 4YQWA 2KHDA 4RW9A 2OPQB 2UXCJ 3CO9A 3A8IA 1V9OA 4B9VA 1Q16B 1KR4A 2UV8A 2V4JA 2UXDJ 1BQMA 3F73A 4V1Ak 4Z2XA 4G6VB 4WE1A 1JLFA 2KTQA 3OR2A 4DX7A 2WONA 4Z37A 3V6HA 2KZZA 4GKJF 4J9KA 4M5IA 3G86A 4U9RA 4IG3B 1SJRA 2XI3A 3QT7A 2W9BB 4MIBA 3FZBA 4ES1A 4I68A 5DLGA 1G4CA 4X2BA 4GC7A 2CDRB 2P6SA 5HP1B 2AJ1A 3POTB 4JI7J 1Q4RA 3ZZ0A 3MM9B 4D3HA 1NKBA 4WU3A 2DO0A 5F8JA 4V19J 3G6ES 3CDBA 2AYGA 5T14A 3AD8C 2YKMA 3NNAA 1RQ0A 1TL1B 1UP1A 1FX2A 3EGWB 3CCLS 1L3VA 1QE1B 1RP5A 2KI2A 1RAJA 2DHGA 1OMSA 2C3MA 1CULB 2RIJA 1ZETA 1T7PA 3I0RB 5KAKA 3GILA 4RW6B 1DQ9A 2CZ9A 1M5OC 5ETRA 2XM3A 2VICA 2AF6A 3MPWA 2E29A 3MEKA 3KMQA 4ZLJA 4UT4A 1C1CA 2BJ9A 2F65A 2NR0A 2BJ8A 1REVA 2WSCC 4CTAB 3HMJG 3DLEA 4B9NA 1RK8A 3QPIA 1OY6A 4MAKA 2G4BA 4M5KA 2GS8A 2EBEA 3MZIA 4OJGA 1YWXA 4ICLB 3SMZA 2HFOA 3V2UC 3I96A 4OYIA 1UVJA 3HSZA 3BN4A 1RWXB 3H5UA 2B4PA 5DQHA 3JTNA 1FNOA 1RHMB 3EVWA 2KFYA 3W1YC 4OYBA 3FFIA 1JLGA 4Q0BA 3SFGA 1S1WB 1N56A 3MM8A 3DDKA 2B9XA 3I9V9 2YPYA 5KFDA 2F8MA 1KHVA 1Y11A 4L3KA 5ETTA 3JXOA 3RUBL 1JLQB 4F4ZA 3Q8SB 3OJSA 1ROFA 4YEAA 3UDEA 4A48A 5KFXA 4DSJA 1F9HA 2MPUA 5D3GA 3I5AA 3Q24A 1OY9A 2GW8A 2AX0A 1U8WA 4RKUC 1ZZFA 1V6HA 3I31A 2ZFHA 2UUCJ 4TY8B 1U1RA 4K2XA 4IG0B 2Q66A 1R8HA 3DRRA 2W24A 4TY9A 2C3OA 2RQCA 3UN5A 3KNAA 1RT4A 4CLPA 4KT0C 1LWFB 3MMBB 3KK1A 4FXVA 1GK8A 3C6TB 3KJQB 4I2QB 4EYIB 4I6AA 2R4FA 1NSPA 3WC0A 1PGZA 3PO4A 3CJ5A 4QCLA 1SKWA 2F4FA 5CYQB 3DLKB 3T9NA 2VBZA 3TUJC 3OL8A 4CNYA 1WG4A 2R2TA 4WU2A 1TUWA 4B3RJ 2NXEA 1VC0A 3G82B 1HWUA 2DRBA 3US5A 3CJ8A 4FBTA 1DQ8A 4MKYA 2HNZB 2GV1A 3U1NA 2MDAA 1N88A 4RBUA 4OQJA 1VQ6S 3HHKA 3Q0AA 5A6WA 4L3NA 3T6BA 3K5PA 1F5CA 3D54A 3MR7A 1RU1A 3LP1B 1WD6A 1RAFB 5HAOA 1S4FA 2HZVA 4I0WA 3PYGA 2RSQA 1XEZA 2DHSA 4OHXA 4UOHA 2VG7B 3NWRA 1FF2A 2OHDA 2XMUA 4PXCA 2EG2A 2XMJA 3M8RA 2MZ1A 4IH6A 2DR7A 2ZOGA 1HWKA 2CQ1A 5ETPA 2FJVA 2B6AA 3MAHA 3DC2A 1UW9A 4J9OA 4RNOA 4F4WA 3PW5A 3GG0A 3JTPA 2VBXA 2KHCA 4CYUB 4MKVA 1YTYA 5FDLA 1AZSB 2F9DA 3DI6B 2FZGB 4O44A 3ET6A 3J7ZT 1E6YA 2RU3A 2C2NA 1TP7A 5I3QA 2QN6B 1T0TV 1WI6A 1VQOS 1H38A 4PABA 4R8UA 4ECVA 3HVWA 3PYEA 3UE2A 2VG5B 3FDSA 4ANEA 4LBIA 1GH8A 2DBBA 4JI0J 4YY3J 3EUNA 2HSEB 2Z0GA 4PG5A 2UXBJ 3D0HE 2HBZB 2HWIA 3BR9A 4DU8A 4P7VA 1CC7A 2X51A 3GSDA 4I69A 3OQ2A 2WHOA 2BABA 3HHLB 3N6LA 4E0DA 1FHTA 5KFPA 2F5GA 3LUYA 3RRHA 1WHYA 4CLTA 4LF6J 2OAUA 4OX9J 4HR2A 1T3OA 1NLKL 4ECUA 3NOCA 4QBUA 3K5OA 1RTIA 1QAIA 4QWAA 4DOZA 3HZEA 1D8ZA 4Y65A 5B0CA 4LRDA 1VHFA 1AA1B 1PJ5A 3DFEA 4DL7A 3FSYA 3C6UB 3H98A 1Q95G 1SQGA 2CVIA 1B4SA 4TQRA 4DCPB 3IR7B 1QSYA 1I5OB 1I6JA 4NXMJ 4OYMA 4NCGA 1C2PA 4EBDA 1EETA 4YP3A 3MM5A 1PAUB 4DJBA 3KJNB 3HT0A 3SCJE 2HHTA 3KLHB 5KG5A 2LDIA 3R5DA 5KG7A 2ZWOA 3PEJA 3CCTA 4N41A 2MZSA 2BDPA 4B9MA 2RRNA 2MJUA 2VOOA 3T19A 2IM3A 4EEYA 4DUTA 3Q2SC 1QSSA 1FJEB 4H4KC 3J7AN 2E7WA 1YKWA 2HQFA 1RU2A 5KFQA 2AJFE 4CDIA 2DNZA 3HLUA 4BWJA 2RF2A 3I0SA 3OSNA 4C8OA 3TRGA 2CFXA 2GHPA 4C8YA 1H72C 3RB3A 1TK8A 3LQVA 1VBZA 2YWHA 1YIJS 1X60A 3L7OA 1X4EA 5A8RB 4LREA 2ZE2A 4Q43A 4HI1A 3OXGA 2IYIA 2DEJA 2Q43A 3PX4A 1YRUA 1S1VB 4RW8B 1F6TA 3M8ZA 1RACB 1HLWA 2DR6A 3VAGA 1TMJA 2YKAA 4JI5F 1DJ0A 3M05A 1S6QA 2EFOA 2B7CB 2HK2A 1UPMB 3ILJA 5AXMA 4C4WA 2RS2A 5FIIA 4DS5A 3VGSA 2XLIA 4X4QA 3W3SA 2CZVC 4F4XA 3OUYA 3LO3A 4WF9Q 4ES2A 2WSFC 5KG2A 5HLFA 4C3MA 1LWEB 1SUQA 4DDFA 1HWIA 1Y00A 4B3SJ 2FGOA 3V4IA 4UOFA 2GX8A 2IRYA 5L39A 2W2QP 1LWXA 2CPEA 4RU9A 5DJBA 2CQ0A 1FTRA 4OZLA 2CRLA 1X9MA 5KFBA 3T6JA 4RU2A 2AZ1A 3L7PA 1Y4ZB 2IM2A 1Q81T 2RQKA 4J37A 3DRPA 2RDIA 2ZH3A 2HRUA 4UQTA 2IIHA 2BOAA 1IKYB 3DHXA 3H0PA 1S48A 2JX2A 2RHQB 2VPYB 1FWLA 9RUBA 5FJ4A 2E5JA 3W2WB 5ETMA 3IA0A 1WSVA 1WACA 2FHJA 3FBCA 1JLAA 1V3SA 3CF5Q 4RNMA 1XJWB 5H9FK 4X4OA 3J7Z5 3MEGA 2ERRA 2PA3A 4P73A 1WWHA 2I6WA 3H59A 4MFBA 3PW2A 4FVCA 5EX0A 2DGSA 2CPYA 5LMNJ 3O8WA 4DSKA 2ALYB 3R7BB 4JP8A 4A47A 1R0AB 3NOGA 3RU0A 3K59A 4DR4F 3ULHA 4NLSA 2G1HA 3ZTSA 5JJBA 4U8YA 3WIVA 2YWWA 2FY8A 2YNFB 3HI9A 4JYAJ 1DFDA 2J8SA 3AB2B 3DOLA 1NCLA 5LMUF 5BXIA 2ILYA 3M9NB 5DG8A 3Q8PB 1AXQA 3DOMA 4NX9A 5GADI 3JSBA 2ZC4A 3TAMA 1FX4A 3IBWA 5DETA 2CQIA 2BJEA 3R5AA 1FJGF 3ITHB 2B4UA 2AQ4A 1YJTA 4FN5A 2A1BA 4QWEA 1C0TA 2V8VA 3SQOP 5KFVA 4NLQA 4N56A 5JVGQ 2ZVIA 3CCRS 4FF2A 2B0GA 1U47A 3J81j 1XBWA 1IXKA 2UUWA 1S9EB 1T94A 2F9JA 4AT1B 5DG7A 1TKXB 2IM0A 2M2BA 1WELA 4WFAQ 1RLCL 4ECWA 2GMHA 3H8YA 3V81A 4RR5A 4I2PA 4DI6A 2UUBF 5D0GA 4KH1B 1V3ZA 2CQGA 4CZCA 2LP4A 2R7XA 2C3YA 2RRAA 2CWXA 3HDSA 1NZ8A 5HK4A 2J7KA 1NK5A 3KHHA 3VGVA 1SJ3P 1WORA 2CPZA 3VCDA 5KFRA 5H9FJ 5JUMA 4K8RA 4NYOA 5HROB 2MQ8A 2BZ2A 1S9GB 1NO8A 2DO4A 2HZCA 1YRTA 1FRLA 2M7SA 1S0MA 4DV3J 4M63A 5B0FA 1U7LA 1FRKA 3PW7A 5KFJA 4LFCJ 3FQLA 2QIFA 4RJVA 3RW6A 4A8YA 3MGJA 2HFNA 3OR1A 1Q7LB 3ISZA 4AL6A 4RPFA 2OMOA 2ZC3A 3D6TB 1WDTA 2W4PA 1XMBA 3ENAA 4O4GA 3BBFA 3VAKA 1FKPB 4CI0B 3HHNB 4EI2A 1U45A 2OELA 3MD3A 1GMWA 1DTQA 4DX6A 1J5OA 4M94A 2GMJA 2OPSA 1FXLA 1YZ6A 3W9HA 3BYRA 4FF4A 1D9FA 3A1YG 2MTLA 3QO9B 2DR5A 2IBOA 4XIUA 1SJ1A 1WUUA 2D69A 3IGNA 2R7RA 4KC5A 1FTCA 1DLOA 2QA4G 4IG0A 1JKHB 3CJKB 1RTJB 4KGMA 3ILIA 4UF4A 2BKPA 4TVAB 2W7AA 1NDPA 2DNLA 5B08A 4M5MA 4ZVEA 3LW5C 4ZPCA 4ZCMA 2KKHA 4LF4F 1SH3A 5LM7E 3HD1A 4X65F 1RB0A 3H4BA 8AT1B 5GMKa 3PVXA 5CZVA 1RT1B 2ACYA 4R25A 1VQLS 2HHSA 3BJYA 1IKVA 4GVBB 2FVRA 2IMWP 2OIHA 3Q86A 4Y6IA 1YBTA 2NXCA 2E9RX 5E2QA 4FYDA 2RVJA 3MOZA 1VK3A 1Q86T 3G82A 4DL2A 1FK9B 4IDKB 2XMKA 3TARA 4USTA 2HNZA 3HF5A 1RTZA 2O5DA 4ZITA 1PJ6A 3N28A 5MLCV 1HNIA 4ZOSA 1WEYA 1SPBP 5AJ3J 3FUYA 1TQLA 2XB2D 1XR5A 4ZHRA 3E3XA 1NM2A 3OLAA 2QX0A 4ZIWA 1XQIA 4CLKA 4HACA 4FP9A 4QR0A 3KLIA 3IRWP 2MXYA 3R1HA 5IWAJ 3H90A 4U6PA 1VJQA 2EW9A 4IKAA 4LF9J 5A2QU 3QLHA 1S1XB 2HGLA 2OI2A 3VVUA 3KLEA 3RBEA 1U2RA 4P7TA 4M5DA 4B3MJ 3GYGA 4LIRA 4QJVA 1CPZA 3RAMA 2C22A 1R0CB 5E3RA 2CNOB 2AP6A 4LR9A 3H2VE 3MPDA 3SQGA 2KXNB 4KJIA 4DV1F 4PQUA 2BANA 1LK7A 1Q8IA 2QEXS 2DJWA 2UUTA 4CO5A 1A6LA 5DRKA 3GB0A 3J7YU 4RL1A 4WJBA 2ZH6A 2XSJA 1FVQA 1VQ4S 5D15A 3MEEA 1PJ7A 3QYYA 3AD9C 3RR7A 1MMDA 3KLGB 2BACA 5I3PA 4WTOB 2XS5A 4KFBA 2AYBA 1Y0HA 3DOKA 4OYPA 2WVFA 5GVQA 2XCAA 4H4MA 2YXLA 2DNKA 4IUFA 3NGKA 2IAJB 1GX6A 3TZXA 2R7VA 3N6MA 4DSFA 2OEMA 2C2MB 5E0OA 3M6WA 1NK8A 4LBPA 1H98A 2Q1LA 3DU5A 3DN9A 3CDEA 1MSWD 1ZTTA 2MKIA 1YG0A 1FJCA 1CS4B 3IP0A 3LOUA 1BLUA 2EK1A 2B9WA 3HFKA 1RT6A 2QA4S 4KO0B 1S97A 1NB2A 2YQ1A 2GJ2A 4Z7YA 3NXZA 1FXRA 4Y2AA 5L1LA 5DQGA 1IWAA 2YH0A 4OYWA 1PYTA 2R8KA 2VD3A 1KEKA 4ZLLA 2OMLA 1HNVB 1EQ0A 2QL9B 3LAMA 2B51A 3ZZZA 4NMLA 4ID5A 5HMYA 3W9IA 2M4MA 1UA1A 2IJRA 5A8WA 3CIMA 4CIOA 2BM1A 3PO5A 5M2PA 4ZVOB 4K2JA 4ZVHA 3M2RB 1T05A 5LSRA 4DR6F 5DDQC 2HMIA 4F0MA 1R8CA 2Y1IA 2R9LA 5KFCA 3EPIA 3BO3A 1OS5A 3C16B 1VGYA 4KY3A 3OFFA 4ZPVR 2Y9HA 1YGYA 2Y8WA 2GZOA 5M2RA 2GQQA 3FBEA 2RS8A 5D4LA 3I5CA 3C19A 3J80U 1Z1ZA 1D1UA 1UA0A 1FD2A 1RLDA 4PZVA 4YB5A 5E3QA 1CJTA 1U1KA 4RW8A 2MKHA 4UZCA 4C11B 5HMWA 3BGOP 1S5ZA 3OHBA 1WI8A 4A4JA 1VQYA 2AT1B 2DITA 4UUWA 2RMLA 4RW7B 4K50A 4EZ6A 3IMQJ 3PCOB 2HNDB 2UUAF 1DHMA 4RWWA 2N4DA 3K17A 1VQPS 2I1RA 5I42A 3P5TL 2MGZA 4DV5F 2ZNZA 2ZWPA 1CJUA 4LFBF 4FPRA 1V5IB 3R5GA 2VZ9A 1Q78A 1HBOB 2PE8A 2Y3YA 4LF1A 5KOWA 2E5HA 1LW0A 2QA1A 1Y3KA 4UQGA 3MOJB 4ZPBA 3TJ9A 1O51A 3UCZP 3WBZA 3V4MA 4KE5A 4TNOA 2V2QA 4A46A 4CT9A 4CQ1A 1X4BA 4JV2A 3ETMA 3HZGA 3J7A1 1S76D 4FNHA 2IPOB 4KHPF 3Q8YA 1RT5B 5A8KA 1HBNA 3PJXA 4KGXB 4X4VA 3CCQS 4FBUA 4NA3A 3U1MA 1RI7A 2W2NP 5EWEA 2R2RA 5KFSA 4LSNA 3CC4S 4DR2F 4J9NA 1H2UX 2AW0A 1SC3B 1WTBA 3X1LB 1MWZA 4DBQA 3L95X 4MK7A 4WFXA 4QU6A 1RADB 4LSLA 3UVJB 1OSDA 3MHYA 3QATA 4OX6A 2N3LA 4F26A 2PFDA 2B43A 2ALZA 2DNYA 2F8HA 3UFCX 4NZ0A 4V19X 4D3GA 5J2NB 3MWBA 3UCGA 3M7VA 2KT2A 1IJFB 1UMJA 5EUHA 3G4SS 2WAQD 2HHWA 1IBMJ 5B7WA 4NRTA 2WVEA 1UVNA 3HJVA 4N7TA 2YX1A 3DYAA 5E33A 2ZM6J 1EKRA 4HLBA 5J2QA 3RBDA 3EM1A 1RSCA 1C1BB 2I5JA 1FWPA 4IOAQ 4JI7F 3D6MB 3A8EA 2GCFA 4NRUA 4OI6A 1APSA 1NZAA 3QRQA 2UVVA 4KGKA 1GX5A 2RUGA 2LQBA 1TL3A 2P9GA 4DL4A 3MTKA 4NLTA 5IQQA 4DCOB 2FPHX 4M5LA 4B9LA 2XBPA 3RTVA 1F3FA 2XY5A 3K89A 3CJSA 4NXNF 2RQMA 2FVQA 4B3TF 3T5JA 3ITHA 1GXUA 2BE7D 1TL7B 3ZZTA 4JI1J 1ZBTA 5F3ZA 4U7UK 2XSFA 5F8IA 3MR6A 4FXDA 4C8ZA 2ZUGA 1UVLA 2Y1RI 4RW4B 2XY6A 5KFUA 3UWTA 4TXSA 3EMTA 4ZCIA 4LF7F 4CO2A 2ZHAA 1NJWA 5G0RA 2HHVA 1NSQA 5ADZA 2GGPA 5L1JA 3T3FA 5KT4A 1TKXA 2K1RB 3DMJA 1K8AT 3TQ1A 3DM2B 4BC7A 2CQ3A 4KHMA 2CZ4A 3VGUA 5CZXA 5HQMA 1GQEA 4IH7A 3EVMA 1EARA 2Z2ZA 2DHHA 2PO4A 4LQ9A 2F1FA 2AJ4A 3JYTA 2XTJP 3I9ZA 1HBUA 4M8LA 4ZJQA 3PZPA 2GVZB 3N9UC 3HD2A 2MHEA 1RWKB 3S01A 1FNXH 4YMEA 1T95A 3K2YA 4USWA 1MMLA 3PJ9A 2R42A 2DH9A 2B5JB 5I4MA 1S59A 3NBPA 3R97A 4TU7A 4R0JA 1RTHA 2VC1A 1HL6A 2X7IA 5K14A 1XERA 2AV5A 3B8HA 1ZAWA 4HH1A 2V4RA 1TMMA 2MKYA 2HS3A 1EHWA 5CXTA 4DL3A 3PDNA 1HBMA 1HMVA 2M9KA 1RISA 4AQYJ 2X3DA 4GVLA 1FVSA 4X4NA 4J9PA 5KFWA 3T1YJ 2A18A 2HHHJ 3ISND 1M1GA 2YWGA 3A3NB 3BH6B 3SV3A 5E5NA 2MY8A 3THVA 5KFZA 2E7XA 1IBKJ 4ZVTB 2YKNA 3NNCA 3FKBA 3OTEA 1JQGA 3GR1A 4QW9A 4DXLA 2XS2A 1TKTA 3KK2B 2CQPA 1R8PA 3DXBA 3QIDA 3QWUA 2ASDA 2LXFA 4B3OA 3TUPA 2HURA 3MM7B 4B9SA 4DV6F 3VQTA 3AD7C 2O01C 4ECXA 4GO5X 3TOQA 3I32A 1U0HA 3OLBA 3EJMA 3HHLC 1R8AA 1TTHB 3IWLA 1JKHA 3CJKA 4LSZB 1T3NA 3BS9A 2W01A 5ETQA 4IR1A 1Q7YT 1H6KX 2XNRA 2E1CA 2BA9A 2KO1A 2FDNA 2KYXA 4KV8A 5L8RC 2DNGA 4UOCA 1S0OA 3M30A 3PXGa 4HYKA 2GO8A 3AJDA 1PBAA 5DLFA 3W63A 2FYXA 1S9FA 3AB4B 1FRXA 3TVZA 5B09A 3MFIA 3E8OA 3TJAA 1SKSA 3MFHA 2Z56B 4IOCQ 3SZ2A 4FYYB 1IBLJ 1X5TA 3CCJS 2HVDA 4YN3B 3I82A 4Q5VA 3T41A 3FSXA 3KYLA 4P6QA 2EVZA 3DRSB 1AROP 1N8RT 4YS2A 4HEA9 3EDRB 2CQHA 4LF8F 5L9NA 3W62A 1HIYA 2QZ8A 2CJQA 3KLFB 3VHQA 4X64J 3WHIA 2QL7B 1KRPA 3EX7B 4KQZA 2DRDA 4F02A 2XGPA 3KFWX 3BBBA 2X1GA 1R6YA 3H7HB 1VQ7S 2DCLA 2B7BB 5ITHA 3EZ5A 1TL4A 4QWCA 4X4RA 1LOUA 2D1CA 2NLWA 3RAXA 2HFSA 3FMWA 2E5LJ 5BR8J 3MUMP 4OZJA 2OTJS 4DV7J 4NYZA 4WFBQ 4G1PA 3CCVS 4LF6F 1CQNA 3PJWA 5KT2A 4K4VA 3OV7A 3BGLA 4HVZA 1HHSA 3OL7A 3AJ2A 4DL6A 3FNNA 5J1EB 2BW7A 3GLJA 3S8SA 4DX5A 3TI0A 2OJ3A 1B7YB 1RT2B 3G6XA 4NLVA 1B7FA 5IT4A 4KKOB 4L74A 3TJ8A 3UD3P 1HYSA 2V9WA 4IFVA 1KONA 3KJFB 2JVRA 1I51B 4CWBA 1KOOA 3MECA 3CCMS 3MEDB 2A0FB 2L9WA 4Y2MA 2KFZA 1ULRA 2NREA 2H48B 2VOPA 3PRBA 4FYXB 2BRKA 1L3KA 2P2CB 4CLUA 4UY8T 2EXUA 2ZD1B 5A0YB 4ANCA 5SUHA 5LSOA 2L3MA 1XMOJ 2XMMA 4I7FB 3JSMB 4ECTA 2YKOA 2R8IA 2BJ7A 2C3PA 4ILMA 1TUVA 1NBEB 3EDQB 3BPDA 3TW0A 1WDDA 1UPPA 3FRZA 4P9SA 4L75A 1ITPA 4YB1P 4C3LA 2D3UA 1V3RA 4DQQA 5IT9Y 1H7XA 3AQOA 3GE9A 3EXCX 3EXYA 2J9DA 2DCUB 5C24B 3M9OB 4F2SA 4WFZA 4KO0A 1JJ2R 2AU0A 2NXNA 2V68A 4YDDB 3PNIA 4DPXA 1IKXB 5E3PA 5HBMA 3SYZA 5CD4H 2YQ3A 3Q8UA 3JSYA 4ZVSB 4ES3A 4ENOA 3UW1A 3BYPA 4JI6F 1TK5A 3GJRB 5IM0B 3V6DA 2V69A 4RWXA 3ZZRA 2B9EA 2PEBA 3TR5A 3CSKA 2ZBRA 3WC2A 3CEDA 4DZDA 1FD8A 2ZJQQ 2XI2A 3AHPA 1RAHB 2AHOB 2YNGB 3KJVA 2KB2A 1P8GA 4OYAA 5T7LA 3CXCR 2Z2LA 1M5PC 1N33F 1N54B 2AJ0A 1OYDA 1QJHA 3R8YA 4J9RA 4YDXA 1Q8LA 4OMFG 7FD1A 4DV4J 3HO1A 1F0XA 1M5SA 1P1LA 3S7RA 4C7QA 2HZAA 2FVPA 2FHJD 4KSEB 2VJVA 2IA6A 4RX6A 5AE3A 3DKDA 4C11A 3QT8A 4UUXA 5C7PA 2W4CA 2BE2B 1YI2S 1UEKA 1DQAA 4L72B 4DSIA 1OY8A 2RKIA 5AT1B 1JK9B 3MMAB 1GXTA 3T9ZA 2Q3PA 2RU9A 1TVRB 4FS1A 2HNDA 4F50A 2UV8G 4CRJA 3LWLA 1BHNA 1I94F 4LIWA 4DUYF 4Q44A 1CJKA 1ZTWA 3E2EA 4ZP7A 4NI2B 4RUCA 1HBOA 1KFSA 3EZOA 2HK3A 2L48A 1YJUA 3CDUA 3TNVA 1F5AA 4A8KA 1VI7A 5IV4A 1LV5A 1H2VZ 4X4PA 3R3TA 2FLLA 2R7SA 3MMJA 3O3LA 3HVTB 3EPGA 4WXWA 3RG6A 1KSPA 3U1LA 4DFMA 4FF3A 3ILOA 2R8HA 2OPRA 1LW2B 4KYZA 2ZHBA 2JHEA 5HVGA 2QO3A 1YLXA 5KFOA 3GP9A 4OV6A 2DR9A 2AYMA 2XY7A 1LKZA 2VH7A 2XCPA 2GNKA 1UWBB 3SDEA 4MYUA 3NAHA 1P1TA 2PI5A 1VIXA 1WOPA 1N5YA 5KG6A 1RT3B 2ZBIA 1IJEB 1ZM3A 1PSDA 4J7CA 2FUG9 4ZCKA 3DCAA 5F8LA 1RAIB 4NLGA 4TLRA 4YR2A 2XZWA 2VQEF 1RBAA 4OX7A 1SJQA 4I1TA 4WTYA 2NS1B 3B4DA 1J2VA 5CH7B 2RE1A 1YJRA 3SFUA 3MAAB 4I6YA 2KRRA 3D3CJ 2APOA 4QIGA 3GFZA 3HSDA 4KR0B 1AB8A 3NMAA 1UCNA 3CJ3A 3E01A 2WVBA 5C2CA 2MLZA 1SL1A 2CNLB 4XAKA 3M1VA 3KLVA 3PX6A 1W2BR 4PRFA 2ZH8A 2ASLA 1EKSA 3KUHA 3EVOA 2ILZA 1MU2B 1N36F 2CUYA 1T02A 2V4QA 3TX0A 2EC0A 3QQCD 3TUIC 2V2ZA 2BE9B 5DM6Q 3L9ZA 4WK1A 3DU6A 1TAQA 3BBCA 3MUVP 2V8PA 1FFSB 1X4GA 1U6ZA 1KLMB 1N6QA 2VQFF 3JAMU 3G6YA 1UFWA 2FLOA 2QYGA 4X66F 1XR7A 1GMWD 1PILA 2FY1A 3PTWA 3IRXB 3ZZUA 1KP6A 5I3UB 4W92B 1B0VA 2P5VA 2UVWA 4EYHB 1V5VA 1FKOA 1N5TA 1MN9A 2MSSA 2QV6A 3A13A 1S0VA 4OZ5A 2VA3A 4CLLA 4AYBD 4WYWA 4AL7A 2W9CB 3VR1A 3FBBA 5K8MA 3GIKA 3AT1B 5HQLA 2ZH5A 1TV6A 3V6JA 2F4VF 4NASA 3PV8A 3NWGA 3DXSX 3GSIA 1S1TA 4C2MA 3FRYA 1MMNA 1VRTB 1VC6A 4OYOA 2OPPB 3P4UB 1U26A 5FLXU 3HHDA 2DGXA 1TKZB 4ITSA 5L46A 4B02A 2YKPA 4ILRA 2WRMA 1N5QA 4DR5J 4N47A 3QIPB 2I2YA 3QRPA 4U95A 4H4KA 2EFNA 1TZ0A 1FESA 1ZM4A 4EO8A 2PI4A 3M8QA 4ED7A 3K8WA 5C25B 2VA2A 4ZPTR 2WOMB 4NA2A 2O66A 2DNRA 2H5IB 2D3ZA 4O3NA 1M5VC 4OI4A 5AXLA 1JLEB 1BC6A 1JLBA 4Y0FA 4J9VA 3LGNA 5D0HA 1FRHA 1HARA 3HCXA 3M4XA 3OTOF 2R8JA 2MQQA 4Q45A 2NZCA 4C8NA 3R1LA 1CVJA 1IN0A 3T1AA 1JLCB 3NCRA 3IGVA 2DHXA 1MROA 3QSIA 2VFUA 3J7YI 1VK8A 3E51A 4L73A 1S49A 2L41A 3M2UB 1UVMA 4JI8F 4TYAA 3M8PB 3M32A 4G1QA 4NLDA 3LF0A 1F9FA 3LP0B 2W2PP 3IG1A 3CVKA 3D5MA 1T9WA 2CXEA 4MJKA 3OD2A 1ZOTA 1YJVA 1RWOB 2DHAA 1NXIA 3I4PA 1M1KT 1G7CB 2XNQA 3WZ0A 2R2UA 2MYFA 1TAUA 3JTOA 3IS9A 4FYVB 1ZPVA 2C42A 1S1UB 2D74B 4ANDA 2BEFA 2WBRA 3HSGA 3IXQA 2EK6A 4WWSA 3PRVA 1U1PA 2MEWA 1C4CA 1NJIT 2Y0BB 4ECRA 4OLPA 3G96A 1WC5A 1NRKA 2NSCA 3CPWR 3KK3A 1YHQS 1OO0B 1HQEB 2HW3A 2YPZA 4LF5F 2JEIA 5CA5A 1T03B 2MY7A 1RHKB 2M5YA 2EI5A 3FCVA 1ZM9A 3I56S 4DWIA 3RYLA 3GPAA 2R7QA 4BS2A 1IM6A 4USUA 3N79A 5DS7A 5GAGI 3KNGA 4JI5J 3P5BP 3O6QA 4ZS6A 2XQCA 4C0HA 3KLFA 2RUSA 3DLGB 2NYHA 1U4BA 2J7WA 3VF0B 1UEUA 3S1TA 3NGUA 5D4PA 4C6AA 1NJZA 3CDAA 1HQUA 4N8OA 1LK5A 4NMXA 4EZ9A 2RD5C 1OQ6A 1WF2A 5F8MA 2HNYB 3N0VA 1HKAA 2CG4A 3CJRA 1OYEA 3D28A 2XO6A 4F3OA 1VYAA 2ZUAA 1S6PA 5F9NA 2VG6B 2KG1A 1RT7B 3IFEA 3ENQA 2NXJA 2NQPA 3SSSA 1NJXA 2JL9A 2EKNA 5J2PA 4ATNA 4A8XA 3N6NA 4B9UA 2HGMA 3AH6A 4FKXA 2QFJA 5ETLA 4C3KA 4USJC 4XPCA 4ZPWR 3ZZOA 1U6FA 5KFHA 1F5BA 8RUCA 2ZJPQ 1N52B 2AEFA 3NGDA 1RABB 1UZDA 3B6BA 4OZ1A 2DH7A 3JQMA 3PG9A 1SIZA 3I6PA 2YNIB 2I8EA 3MM6A 3OPKA 1EB0A 2ZH4A 2GJIA 2YVSA 2J9CA 3EE3A 3D1OA 4HH0A 1HPZB 1O8BA 1IM4A 2IC3B 1SV5A 2JEFA 1IKWA 1BWVA 4QYRA 3CTRA 3T1HF 4RW9B 1X5OA 2CJAA 4K7QA 4YB7A 2OD4A 3MF5A 2I0XA 4A8WA 3OXFA 1SCJB 3QFWA 2RILA 2HQ3A 3IR5B 2W25A 2V4JB 1BQMB 1F3VA 3MEDA 4JUZA 1JLFB 3MURP 3OR2B 1EP4A 3KHRA 2WONB 2B9YA 4O3PA 2M88A 1CLFA 3MCOA 4YUDA 1BQNA 2V6AA 5KFEA 3NEKA 4NOHA 3JSRA 2AIRB 1KD1T 4UTGA 2ACMA 3LPYA 1HHQA 1QLNA 3W60A 2ZZMA 4WP3A 1FDBA 4DR4J 4CLSA 4OHYA 2C1EB 1RWMB 3DGPA 1HI8A 3W2VA 4LRAA 3M6VA 3ILLA 4W90B 1UFLA 2D41A 2XZDB 2KXFA 5LT5A 1LFPA 4DQRA 1WC0A 2HQGA 4KPCA 2YKMB 3CMAS 1WOSA 1URNA 4UZBA 2MKJA 3QGPA 4WIIA 2LLZA 1XN9A 3DNCA 2DH8A 4RUBA 1QAXA 4YOEA 1T11A 2DKOB 2PN6A 1XNRJ 1H74A 5ETVA 3PIOQ 3K57A 3IAM9 1ZA1B 2ZKUA 1C1CB 1P6TA 1FJ7A 2J5AA 5K9FA 2C2EA 1D0EA 1REVB 2OUGA 1OPZA 3NGRA 3TYTA 3DLEB 2H54B 3H5YA 3A8KA 3MR5A 2XULA 1MG7A 1K73T 3ZTQA 1T9UA 3C14A 3OTBA 3FEZA 2FTRA 4Y00A 2FHOB 5F3TA 5KFNA 2ZITA 1TFWA 3IBCB 3WX4A 2MB0B 4JB8B 3H2LA 3D66A 5CYMA 4DG1B 2D3O1 3A8JA 1S0NA 2E1PA 1J5EJ 2J0WA 4PYAA 1G1XA 2PA8D 2YX7A 3OW2R 2QE5A 5KFGA 1RCOB 2MZJA 4GC6A 3W65A 5D6GA 3FFIB 4Q0BB 1UAWA 3MM8B 2VHGA 4A8FA 3B4MA 4DR3F 3W5ZA 1EZZB 3K5LA 1ZH5A 4P2SA 1YZ7A 1TKDA 2EKYA 2B4VA 2HQDA 3MI7X 2CPDA 4QR2A 4YFUA 4R5PA 5DDRC 5D3GB 4LMZA 2IA0A 2PT0A 3X3UA 3TZYA 1GXLA 1DTTB 2M52A 3NAIA 2QMXA 4USVA 2KJWA 4MMOA 3DRRB 3PACA 3RBXA 2AX1A 5DGAA 1RYRA 1Z2LA 1RWNB 3T5LA 1RT4B 1Y3JA 3UR0A 4JOUA 3KK1B 3BQ2A 4PEOA 4NA1A 4BC9A 3O44A 3NP5A 3M2VB 3TEHB 3K8VA 5IC6B 2V94A 2CPJA 3KHGA 1T9YA 3H25A 4H4OA 1MWQA 4PG8A 1P9QC 4F36A 2EWHA 5AE2A 1E6VB 3GYNA 2FC9A 4PWDA 2H9ZA 4FZVA 2F40A 3CUNA 3FCHA 3S6EA 4TLQA 4GKKF 3LANA 4DPOA 1U02A 3TO8A 3QSYB 1UZHA 4C8KA 1M5KC 1G6BA 3HKZD 4U67Q 4LR8A 3PR4A 1FEHA 4ETZA 1UEVA 2DGOA 1RZMA 2B6AB 2H51B 1NSAA 3D2WA 5CABA 2VKRA 3TZZA 3FBFA 3WDOA 3PM9A 1NAQA 5C42A 2MKCA 2QLWA 3B82A 1A9NB 2ROEA 2VKZG 2IFXA 5FDLB 3MUTP 3H5SA 2QLJB 1WC6A 4O44B 1VRUA 3ET6B 3IN5A 1E6YB 2P9CA 4E2FB 1YSJA 2RRBA 5AE1A 2UVUA 4PWUA 2MHNA 2AKWB 3BB5A 1VIOA 2CQBA 1RAAB 2QLXA 2WZ1A 5BYSA 4R8UB 1Y5LB 4PKDB 3ZZYA 2QMWA 2FHMA 2X1FA 3HPOA 3DDIA 4QIWD 3D0GE 1NDLA 3G6VA 2H4WB 2ZBQA 2HHUA 1O6XA 3NG8A 4P74A 5CCLA 3J81Y 1SIWB 2Q6BA 1NKCA 3GV7B 4IYQA
chains in the Genus database with same CATH topology
2CZ4A 3P6YC 4B3SF 3W7BA 3ICLA 1RK8A 5CZXA 1GQEA 3AJ1A 4IH7A 2LQ9A 1RYSA 2E5GA 3QPIA 4MAKA 2PO4A 2G4BA 4LQ9A 2JJ4D 2F1FA 2AJ4A 4RNHA 2EBEA 2LEAA 5KFYA 3PFEA 3MZIA 4OJGA 3JYTA 2PIIA 1YWXA 3R5CA 4ICLB 4KRWA 5CYJA 3I9ZA 3SMZA 2HFOA 3V2UC 1HBUA 4M8LA 4RW7A 3I96A 3PZPA 2I38A 3FQKA 1Y5NB 3N9UC 1UVJA 4OIXA 4MK9A 2MHEA 4WKYA 3S01A 3GIMA 2W8LA 2HIQA 1FNXH 4YMEA 1T95A 3K2YA 2ZH7A 1MMLA 1RTIB 3P3DA 3BN4A 5E3CA 3H5UA 4EWTA 3KKFA 2B4PA 2DD8S 2FGCA 1HYSB 5DQHA 2V2KA 2NPFA 4IFVB 2DH9A 2B5JB 5I4MA 4DF8A 2J6SA 2LA4A 1WF1A 3NBPA 3JTNA 4DX8H 5B0DA 1FNOA 3F41A 4TU7A 3IC1A 2KFYA 4R0JA 2L9DA 4YHHF 1H0HB 4LQ3A 2HAIA 1TL5A 3C46A 4OLOA 1RTHA 3KHLA 2DIUA 2VC1A 1HL6A 3MECB 5K14A 3T1YF 1XERA 4PCQA 2AV5A 4NLPA 3B8HA 1ZAWA 4HH1A 2KYZA 3FFIA 1JLGA 2V4RA 4Q0BA 2ZDOA 3SFGA 2NZ4A 1S1WB 3DLLQ 1N56A 2HS3A 1QTMA 3MM8A 3DDKA 5FD1A 2B9XA 2AWZA 2R7OA 3I9V9 5KFDA 5CXTA 5AXKA 4DL3A 3PDNA 4OJ3A 1HBMA 1KS2A 2F8MA 1HMVA 1KHVA 2DNOA 1YQHA 2M9KA 4ZPDA 4C97A 1RISA 3QJPA 4ELTA 2BM0A 1ZM2A 3MTJA 1X4DA 1FVSA 1JLQB 4F4ZA 3Q8SB 3OJSA 4X4NA 1ROFA 4J9PA 5KFWA 4OI2A 4YEAA 4NCGB 2G0CA 3THTA 4A48A 5KFXA 2MKKA 4RUHA 4K4TA 2A18A 4DSJA 4C98A 4WKRA 2W8KA 3ISND 2YWGA 3HX9A 2MPUA 5D3GA 1KFDA 3I5AA 3MM5B 3Q24A 2IRXA 3CCZA 2UU9F 2GW8A 1SH2A 2AX0A 3K0JA 5THWA 2VUGA 1RT5A 4I64A 4RKUC 1ZZFA 3QIPA 5LMNF 1V6HA 3I31A 2ZFHA 5E5NA 5T41A 3SV3A 2MY8A 3THVA 4TY8B 4BCAA 2IJFA 5KFZA 2E7XA 4K2XA 4IG0B 1U1RA 2Q66A 1FEEA 1HNWF 2KVIA 1R8HA 3DRRA 4XO0A 2BQ3A 2YKNA 3NNCA 2W24A 1WHXA 2GMLA 3OTEA 4TY9A 2C3OA 3BO4A 4IRKA 3GR1A 3SCLE 4QW9A 2RQCA 3KG1A 3C3LA 2N82B 1Q8BA 3KNAA 1RT4A 4KT0C 1LWFB 3I87A 2XS2A 3MMBB 4RNNA 1TKTA 3KK1A 5HI7A 2YNHB 1LXJA 4FXVA 2AD9A 1IQTA 3R27A 3KK2B 2CQPA 3C6TB 3OTDA 4I2QB 4EYIB 4I6AA 2R4FA 5K8PA 1R8PA 3DXBA 3QIDA 3QWUA 3WC0A 5CCMA 1U1OA 4HDHA 1PGZA 4X4SA 3PO4A 2ASDA 2LXFA 4B3OA 3CJ5A 4CNZA 4JYAF 4QCLA