2BZ2A

Solution structure of nelf e rrm
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
79
Chain Sequence
APRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the RNA-recognition motif of NELF E, a cellular negative transcription elongation factor involved in the regulation of HIV transcription.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
molecule keywords NEGATIVE ELONGATION FACTOR E
total genus 11
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bz2A00
4TU9A 1H2UX 2YH0A 1VQOS 1Q7YT 3G8TA 1FXLA 3G4SS 2DGTA 3CPWR 1HA1A 1U2FA 3P5TL 3NNHA 2DNKA 1D9AA 2OTJS 2DH9A 1VC6A 2DHAA 5GAGU 2M2BA 3CCUS 1WF0A 1WI6A 5JVHQ 2RNEA 2AYEA 1JJ2R 1WI8A 2DB1A 2M9KA 1WWHA 1O0PA 2MZSA 5GVQA 1KOHA 3SXLA 3VAGA 1X5TA 4ZKAA 1KQSR 2DNZA 1X4FA 2X1AA 1QM9A 1NU4A 2MJUA 3EX7B 3BO4A 1M5PC 2CQPA 1R8HA 1URNA 3VAJA 2JX2A 2KRRA 2RT3A 4PRFA 4A8XA 2CPZA 3UWTA 2UP1A 4Y0FA 1U1KA 1Q82T 4OZ1A 5JVGQ 2DH7A 3CCRS 3G9CA 4YOEA 3BO3A 2OSQA 3PIPQ 3VAFA 3S8SA 2MZTA 5CXTA 2CPFA 1VQ6S 2LXIA 4F26A 1YTYA 2KRBA 1U1LA 5FJ4A 1VBZA 1VQ9S 2DNRA 4IO9Q 2MY7A 1QVGR 4TU7A 2EK1A 2CQIA 1P1TA 2MQNA 2KI2A 5LXRA 2ADBA 2XB2D 2DNPA 3H2UB 3UD3P 5ITHA 3CF5Q 1RK8A 2MQQA 3NNAA 3VAHA 2DHGA 4LJMA 3TYTA 4WCEQ 1YJ9S 2G4BA 2RS8A 4FXWA 2DIVA 4WIIA 1OWXA 2XNQA 2AYBA 4TU8A 3DXBA 4LMZA 5D77A 2GO9A 1YIJS 2N7CA 2RQCA 3NS5A 5DDPC 2CQCA 1IQTA 1DRZA 3DLLQ 3UCZP 3MI7X 2MZQA 1H6KX 2CQ0A 4W92B 1VQ5S 2BZ2A 3I56S 1HD0A 5LSOA 2J76E 3S6EA 3TP2A 2LA6A 1A7GE 2MSTA 2CJKA 3CC4S 5LXYA 1B7FA 4WKRA 1U1QA 2DO0A 2AYMA 2FY1A 2RQ4A 2KHCA 2MKCA 2YWKA 2E5GA 1BY9A 1KD1T 2DHXA 1M5OC 2DH8A 2EVZA 1RKJA 4V19X 2VONA 1VQ7S 1M1KT 1XN9A 2LKZA 3MUVP 1HD1A 2JRSA 2DGUA 2MQPA 3THPA 4WFBQ 2MQMA 1ZZFA 3MDFA 2MQOA 4QPTA 2VOPA 1WHXA 2AD9A 2QA4S 1WG5A 2KH9A 1U1PA 1FJ7A 2KG1A 2RU3A 2DNOA 5GAEU 1SJ3P 3CD6S 3CCMS 4U67Q 2M7SA 1FT8A 4LIRA 2CPXA 2M8HA 1VC5A 1OIAA 2M0GB 1VQPS 3ZZZA 2DGWA 5BJRA 2N82B 2E5HA 2Q79A 2DHSA 1G2EA 1X0FA 2HZCA 4C0OC 4CH0S 4F02A 2LECA 2MJNA 2J0QD 4IUFA 2XS2A 1U6FA 2DNMA 3BO2A 2KYXA 2KXHA 5IQQA 4UQTA 4J5OA 3P6YC 1SJFA 1JJ4A 2MGZB 2O3DA 2A3JA 4C7QA 1WEZA 1VQ4S 2DNHA 3UE2A 1UAWA 2QFJA 1WG1A 1YI2S 2DIUA 1WEXA 2MKJA 4EGLA 1SJRA 2CQHA 2MHNA 2U2FA 1DHMA 2CPHA 3CCES 5H1SV 1X5OA 5LSLA 1F9FA 2KU7A 3TO8A 2LA4A 3G71S 1VC0A 2LXUA 2MZJA 1X4EA 3J7ZT 3MURP 2FHOB 2CPEA 3CMAS 2EK6A 5CYJA 3J7YU 1P27B 3Q2SC 1N52B 2G0CA 4W90B 4Y00A 1VQLS 1JMTA 3VF0B 2ZJRQ 2M4MA 3V4MA 5DDQC 2HGMA 2MXYA 1ZZNA 5GAHU 3EGNA 2DNGA 3HI9A 2SXLA 2RRBA 5D78A 1QVFR 3R27A 2I38A 1R8PA 3H2VE 2G1DA 2JVRA 3VAKA 5HO4A 3ZZYA 1U1RA 4QU7A 5IFMA 1WTBA 3CUNA 2YH1A 2KFYA 1AUDA 3OW2R 1UW4A 1FJEB 1KOOA 2CQ4A 2OJ3A 3LPYA 3UCGA 1X4CA 1N54B 2M8DB 4M5DB 1YITS 2DK2A 2QEXS 4WF9Q 2YTCA 2CQ3A 1VQKS 2MKHA 2NLWA 5LJ3Y 1NJIT 1SJ4P 1PGZA 2MB0B 3CMES 4F25A 1H2VZ 2DGOA 3CC2S 1WF1A 2CQ1A 2XS7A 1WHYA 3B4DA 1X4AA 1D8ZA 2I2YA 4UY8T 3B4MA 1YWXA 1KC8T 2FC8A 2XNRA 3JB9k 2CQBA 1M5VC 3NS6A 2E44A 2MZRA 2BOPA 3CC7S 3PIOQ 2M88A 1L3KA 2MSSA 1YJNS 4FXVA 2ERRA 1OO0B 2DGQA 2F9JA 2OSRA 3U1MA 1M90T 3HHNB 4YB1P 2K3KA 1VQNS 3CCSS 2D9PA 2CPYA 2VODA 1PO6A 3BEGB 3G6ES 1N8RT 3P49B 3THTA 1JJHA 3VAIA 2AYGA 4TLQA 2KT5A 3UD4P 1X4GA 4QQBA 2D9OA 1K73T 2RVJA 2HGNA 4PKDB 4ERDA 3RW6A 4CH1A 2MQLA 1S79A 4Z2XA 1M5KC 5MLCV 3MD3A 2FC9A 3US5A 2KM8C 3MXHP 2DGSA 2B0GA 2JWNA 2CQDA 5DETA 3P3DA 2E5IA 3VALA 2V94A 4P6QA 3N9UC 2RS2A 1W2BR 2VOOA 3SMZA 1X4DA 3NNCA 1H2TZ 2L08A 3MUTP 1WELA 5DM7Q 4IOAQ 3SDEA 3G8SA 4PR6A 2X1FA 3NMRA 3CCJS 3K0JA 4WFAQ 2X1BA 3MD1A 3U1LA 2MZ1A 3RW7A 5IM0B 3CCLS 3D2WA 1Q81T 2RUGA 2F9DA 2LEBA 2LEAA 2PE8A 2D3OR 2CPDA 2KN4A 2LMIA 5GMKa 2KVIA 3ULHA 2KXNB 2DNNA 1X4BA 2JVOA 1DZ5A 1NO8A 2DNLA 2MYFA 5CA5A 3G96A 4ED5A 2LYVA 2KXFA 1ZH5A 1SJQA 3CCVS 1N88A 3IWNC 4QU6A 5EN1A 2DO4A 3S7RA 2OTLS 3VAMA 5DM6Q 2N3LA 1U1MA 1U1OA 1Q86T 4RU2A 2N3OA 1X5SA 3IRWP 2J8AA 2MGZA 1WHVA 2CQ2A 1WHWA 2DISA 5HL7Q 2ZJQQ 1K9MT 2LQ5A 2K8GA 2CPIA 2XSFA 1OPIA 2M70A 1FJCA 1X4HA 2NZ4A 5LJ5Y 3CULA 3LQVA 3R1LA 2ADCA 1HL6A 2CQGA 2DGVA 1FHTA 2MMYA 3CCQS 2DNQA 2KG0A 1WEYA 1CVJA 5DDRC 2MKKA 3S01A 3FEXB 1K8AT 2RRAA 2HYIB 3CXCR 1VBXA 2YKAA 1U1NA 3Q2TC 1U6BA 2MKIA 3R1HA 1DBDA 3MOJB 2DNYA 1X5PA 2MKSA 2U1AA 2J0SD 3MUMP 3BS9A 3EGZA 2DITA 2MPUA 4C4WA 3CTRA 1WG4A 1SXLA 4CIOA 2GHPA 2L9WA 2PEHA 1VQ8S 4IOCQ 2HVZA 4WFNQ 5IM0A 1UP1A 3UCUP 1UFWA 1FNXH 5GADU 1A9NB 2ZJPQ 2E5JA 1FO1A 1VBYA 3FEYB 2MY8A 2X1GA 2LCWA 4CQ1A 3SDEB 2DGXA 4BS2A 4OZ0A 2WBRA 2CPJA 2HGLA 2FPHX 1YJWS 1WF2A 2XS5A 1S72S 2OIHA 2F3JA 1VQMS 5DDOC 2KM8B 1YHQS 2M52A 3L3CA 4YUDA 2L41A 3I55S
chains in the Genus database with same CATH superfamily
1WDDA 4UTGA 3EUNA 2XMWA 3OPKA 2ALZA 3MOZA 4NEYA 3G8TA 2YNGB 2UXDF 1C2PA 1N5TA 1RWPB 3K5LA 1RWOB 3GU0A 1N36J 4PWWA 1JK9B 4I68A 3CPWR 2ALYB 1HA1A 4ITSA 4JI7J 2CZVC 3FJ2A 4LT6A 1CJUA 4QWDA 3VR1A 1FI4A 4F0HA 1KBRA 4K4YA 3ZTSA 3H40A 2GC8A 4I2QA 4LBPA 1TFWA 5GAGU 1RAGB 4OI6A 1RT1A 1WF0A 1YGYA 2ZH7A 2D3ZA 1WI6A 3PR5B 4H4OB 4OLOA 5E41A 2YQ3A 4DR4F 3TUZC 2Q1LA 3P45B 4NCBA 3MEGB 1WOPA 3QO9A 2GVDA 5SUHA 5GVQA 3TR5A 4OZLA 2MZSA 1JJ2R 3GFZA 4DOZA 4NA3A 1ACMB 2YWHA 1R31A 4YQWA 2IRYA 5KT6A 3QIDA 2X1AA 1X4FA 1T95A 1NLKL 4AQYJ 1QM9A 1NU4A 3H90A 1N5YB 2MJUA 5M2UA 4KTQA 3KK2A 1R8CA 1RWVB 1M5PC 2BJ9A 2CQPA 1NPRA 1KP6A 3HSDA 1URNA 3AJ2A 2G0JA 4C11B 3X3UA 3BDEA 2KRRA 1JX4A 1FKAF 3D4JA 2BJEA 4XDCA 5J2PA 1JNZB 4QYZK 3NY0A 4HEA9 4MFBA 3M6UA 2VFUA 2ACYA 4X65J 2VA2A 1IBKF 4P7TA 4C0BA 1KQFB 4CLTA 2XCPA 1Q82T 1K44A 4O3SA 1ZAWA 2GGPA 1NHVA 5JVGQ 2FLLA 4NXNF 2BANA 2DH7A 1WSRA 4Q5VA 3CCRS 4NRUA 4ZS6A 2IVYA 2HVDA 4XAKA 3DLHA 3PIPQ 5ETKA 4R8UB 4MK7A 5EX3A 3T1HF 1H74A 2K06A 1GMUA 5JMNA 3FMWA 4QWCA 3OVSA 3VAFA 4AL7A 4DFMA 1A6LA 2HWTA 3B6BA 4OX7A 1RT3B 2LXIA 4BC9A 4MIBA 2VBXA 4Y28C 4RNHA 3T6BA 2KRBA 2CZ4A 2J7WA 3JXOA 2XO6A 1BWVA 4DV7J 1U1LA 2R7TA 2W4PA 3WX8A 2GX8A 1HMVA 2MY7A 3I0SA 3I5CA 4RW8B 5CD4A 5HAOA 2JEFA 3ITHA 1TP7A 3MCNA 1KQGB 4MK8A 5EUHA 1APSA 1JLAA 1NH8A 4RW9A 2VICA 1HNZF 3PFEA 3BR9A 2ADBA 1IBMJ 4CI0B 2DRAA 2PT0A 1RWNB 3VGTA 4K4ZA 1HWIA 1W25A 4K5RA 2LLZA 2HFZA 2HHPA 2IA0A 3NXZA 3FSYA 3VAHA 2VF3A 3P4UB 1LKZA 2DEJA 3DU6A 1S77D 4OI0A 3TZZA 2DIVA 3KK3A 4WIIA 1RDRA 3RZAA 4JV5J 2MLZA 1ZM4A 2XNQA 1Q8BA 4URSA 3C6UB 2W9CB 1H0HB 1KDNA 2W25A 4HHHA 4M5HA 5D77A 4DUYF 3AH6A 1XQIA 2UVWA 1Z1ZA 1RJJA 1RQ0A 4LF6J 5E3AA 2AJFE 2HHXA 1EP4A 1PIEA 2RHSB 3PDNA 4LFAF 3V6KA 1B0TA 1PAEX 3AOBA 3CWJA 1PCAA 4FYYB 5EWEA 2CQCA 4WFYA 3LP1B 2HWHA 1FTRA 1YVFA 5KFOA 3SFUA 3GR1A 5KFVA 1JLFA 1VIXA 3NAHA 2E66A 3UCZP 1D9FA 2MZQA 3FRYA 2W01A 4DR2F 4W92B 1VQ5S 4K8RA 2QO3A 1N0UA 2W2OP 2UUCF 2BZ2A 4JV1A 4DR1F 5KFRA 2P8IA 4O44B 2HRUA 5KFSA 2YQ1A 4M5KA 1MN7A 4QR0A 2R7OA 3S6EA 3QJLA 3CO9A 1CJVA 2BJDA 4RNFA 2LA6A 1A7GE 4DR7F 1N32F 1XC9A 4OYPA 1BQMB 4JI8J 1N32J 1R7IA 1TUVA 1F3FA 3HK2A 2AYMA 1K0VA 4B3TF 2KHCA 2MKCA 2YWKA 3WDOA 4DV5J 4ICLB 1SH0A 2E5GA 4OIXA 4Y2MA 2DHXA 2IIHA 1RKJA 2DD8S 1RISA 2HBYB 3BREA 3P8BB 5L8RC 3D9BA 3OT9A 1TKZB 1FESA 1EQMA 2PMHA 4B3OA 4H4MA 1YBTA 4MKBA 3HHLA 4LR7A 4K2JA 2GW8A 3FBFA 3M05A 4MMOA 2YKNB 5IT9Y 2DVIA 1S1WB 1QSLA 2NZCA 1TL1A 4DQRA 2MQMA 4KFBA 5GMDA 1ZZFA 4B17A 3HO1A 4QPTA 2VOPA 2H48B 3DI6B 1S6QA 1SIWB 1TZ0A 3HT0A 4LRBA 1P9QC 4LREA 5J1PA 1XMQF 5G0RB 3T1HJ 2KH9A 1U1PA 4Q8EA 3PYDA 4TY9A 4ZDNA 5A6WA 3G8QA 4TY8B 2UVVA 4FP9A 4QPXA 1RADB 3IM8A 5A8RA 1XK8A 4QU6A 3VVUA 5DJBA 1SC6A 4EBDA 2M7SA 2I1RA 3DOLB 4X4RA 1HNZJ 2MLYA 1FNOA 2V4JB 2LVWA 3LOUA 4OYBA 3T1YJ 1VC5A 3W5XA 1VQPS 2OD4A 4OJGA 3GFYA 1QTNB 2X3GA 3D0HE 5CYMB 3MM9A 5LMNJ 2Q79A 3HSGA 4FPRA 5K8PA 2YKOA 1RTJB 1UTAA 2XWYA 3C46A 3IWXA 1LK7A 1M1HA 4NE9C 1RSCA 1RA7A 3QGIA 3D6TB 1TMJA 4FF4A 1K1QA 3B8HA 3H98A 2EFNA 1SL0A 2XYHB 2CWXA 2ZZNA 1C1BA 2AGOA 2WVFA 2H65B 4HH1A 4OL8A 5KT7A 4KPYA 5IQQA 3V2UC 5L46A 2Z4PA 4USUA 5KFIA 3C15B 2WOMB 2BQ3A 2CZ9A 3FGVA 4X66F 3KDOA 1RTDB 2E9TA 4FYDA 1WC3A 1JJ4A 1PKUA 2COLA 2G13A 2RDIA 4OMFG 3KOAA 2ZH6A 2B43A 4EBEA 1JXLA 4RBVA 4ED4A 5EGYA 5D15A 4AT1B 1RXOB 3AA9A 1WEZA 1VQ4S 3NMAA 1M5SA 1LWXA 1WG1A 3L7OA 2DIUA 2RDJA 1Z2ZA 2RIJA 4UOFA 1SUQB 5K8OA 3TI0A 4K4UA 1SJRA 4DCOB 2MHNA 2LQJA 2HIYA 3CCES 4J9PA 5H1SV 1M0SA 3QFHA 4O23A 4AUKA 2B4VA 1F9FA 2KU7A 4KRWA 2R2RA 2ATLA 2CJ9A 2IMWP 4G3IA 2VFSA 3C6TA 3CJKB 4C3LA 3W5YA 1RZMA 2MZJA 2XYPB 5L9NA 4DQQA 3MHYA 2DR5A 2OLWA 3IGNA 3EWGA 4DU7A 2ZH2A 1JLEB 2FHOB 2WVDA 2IM2A 3HSJA 2Y1JA 1YK9A 2B9EA 1XTZA 2DPJA 4X2BA 3J7YU 1MN9A 1N52B 3BBBA 1Y3JA 3M1VB 3WC0A 4Y6IA 3M2RA 4WU2A 2ZJRQ 1P8GA 1XWLA 3KLIA 4ZVSB 2DHHA 3KK1A 4A8QA 5HP1A 2OEKA 4P52A 7FDRA 3M7VA 1QUPA 4GVBA 4Y2AA 2V0NA 4ZVHA 2HNDA 1AT1B 2P5VA 3OR1B 2IMOA 3OTEA 3OTBA 3KHHA 3ISZA 3PKYA 3FCWA 1Q8LA 1U6ZA 2ZE2B 2G1DA 2VASA 3HSZA 4O4GA 3F56A 4OHXA 4DR5J 5HO4A 3ZZYA 3SCLE 2C2MB 3O44A 3NCPA 5FDLB 4J9QA 3PO4A 2Y0BB 4QU7A 3BYPA 2RKIA 2YH1A 1UCNA 1B7YB 1L3SA 1VLYA 4Y34A 3FBBA 3MECB 3DHWC 3QLHA 2OJ3A 3LPYA 1RWXB 1EETA 1LW2A 2BV3A 2DXEA 3DRRA 4U6PA 1FE0A 3BSOA 4QZVB 1YITS 2QEXS 4AXJA 2A1BA 5B0BA 2YTCA 5H9EJ 4IDKA 1TK0A 2OPPB 1GNKA 3DLKA 4DV0F 3H0PA 3NGSA 1OPZA 1Q78A 4RW4A 3J7AN 2BE7D 2NPFA 3DOMB 5LJ3Y 2M5YA 2R2TA 1VK3A 1S0NA 1PGZA 4ELVA 1OS5A 1R3NA 1Y00A 4IKAA 5GADI 1H2VZ 2B8PA 4S0MA 4U8YA 4DL4A 5DLFA 1NDCA 1PILA 4W98A 5KG5A 4ZP8A 5J2NA 2UVRA 4C8LA 4A48A 2GAGC 3QT7A 1D8YA 4PCQA 4DQSA 3HZEA 4P2MA 5HBMB 4KHPJ 2CNNB 1D8ZA 5HSPA 3TW0A 2Y1LB 3ZZUA 4LF7F 3HVAA 2GMHA 4NI2B 3B54A 3GLJA 2LXFA 4OHZA 3CMQA 1YWXA 2WVEA 3M6WA 4PXDA 3OV7A 1REVA 2F65A 1NSQA 1FRJA 4JYAJ 3C66A 2PFFB 4G6VB 3PRVA 3CJ3A 4KH0B 2BDPA 2FC8A 4NRTA 4M5DA 2QA2A 4HR2A 1I94F 4WK3A 3DRPA 1RWUA 2B56A 1MNEA 4CLWA 5A6PA 3MR6A 1XMOF 1NK6A 1NSKL 6FD1A 1M5VC 1UVIA 2ZOMA 4ILLA 1WNEA 1AA1B 5F8IA 2M88A 2MSSA 1X31C 2FVQA 4FXVA 2NUHA 4A8WA 1KS2A 3NAIA 3QWUA 3U1MA 1M90T 2C42A 1NKCA 3G6XA 4YB1P 1IKWA 2C2OB 1VDHA 1VQNS 3UR0A 1N34J 1N33F 2B7CB 1T03A 1T05A 1TK5A 2R8KA 1BWEA 1FKOB 3BEGB 4GVLA 3G6ES 1QDUB 2Q6CA 3H25A 3VZHA 2XY6A 2V68A 3THTA 1JJHA 1QAJA 2FVSA 5KFDA 3SV4A 1UJ4A 1TL3A 2VPYB 1X4GA 3QPIA 5F41A 1K73T 2RVJA 4JBCA 1FXRA 2C2ZB 1S12A 1NK9A 1WUUA 5B0AA 5L1KA 2R8GA 3RW6A 5KFLA 2YNIB 4CH1A 1GX6A 4CM0A 1KVIA 3BPDA 2KL8A 2R8IA 3UR3C 3QT5A 1M5KC 3CIMA 2OUGA 3DOMA 3MMCA 4B08A 1SV5A 4ZCMA 4FN5A 2X51A 4P2FA 2KM8C 2YKMB 3GJTB 3K8VA 2OPPA 4OZ5A 2B0GA 4NCGA 3W63A 4MKYA 4I64A 4DR3J 2ZVSA 1TKTB 3VALA 2W9BB 3W64A 2CYYA 1PC4A 4ETZA 4DPYA 1TU0B 1R0BG 1FF2A 3FSXA 3CDEA 2OD6A 3BGFA 3GCXP 1RHRB 3N9UC 1W2BR 3QLHB 2GIFA 2VOOA 3BKFA 1CJKA 2FHMA 3FCHA 2K7JA 2V2VA 3SBMA 4DV4J 3QYYA 2C3MA 3AD7C 4OI2A 2FHJA 3PVXA 2J9CA 2KHDA 4EFAC 2PI5A 4DUTA 4M94A 2YWFA 3I4HX 2GV1A 4ED7A 2MDAA 2ZE2A 2EFQA 2FDNA 2Z0GA 3HF5A 3QGHA 5DM7Q 1S0MA 4IOAQ 1VRTA 3GV7B 3LP2B 2Z2MA 5D3GB 2HQFA 2W7OA 1IKYA 4P2XA 5K14B 5A76A 2X1FA 2AU0A 3I5AA 2VPZB 4D3GA 3DDIA 4O4GB 4M1KA 1ZPWX 3LP0B 2DPIA 4GKKF 2XSJB 5B0EA 3KHGA 3N6LA 3U1LA 4U7CA 2XC9A 2A10A 2YPZA 3EZOA 5HP1B 3KLIB 3KK1B 1Q81T 4DDFA 3PYEA 4FPIA 2IM1A 3M1VA 4KKOB 3V81A 4PXBA 3UQSA 1VRUA 1RAFB 3MM5B 5GMKa 3NBPA 4R0EA 2KVIA 3ZZOA 1AZSA 1U1QA 4Y2KA 5C25B 2DY9A 3NOCA 3VVTA 5C24B 2ZBIA 1NUEA 1HNVA 3PRBA 5CA5A 5IT4A 1MMDA 5IQ6A 3J80Y 2YBVA 1NJWA 4CRJA 4D3HA 5HROB 3EYZA 4ED5A 4RNOA 2ROPA 2R7WA 3UDLA 4BDPA 2GVZB 4DV6F 1IBMF 2UUWA 1SUQA 2BEFA 1XMOJ 2BQUA 1RGVA 3D28A 4LUBA 4PPZA 4CZCA 5KFPA 2R7RA 3QGGA 2VQFJ 3IWNC 1GX5A 3QIPA 4DPTA 2ZHBA 4ED1A 2N3LA 2CADA 1VCTA 5M2RA 4Q8FA 2VBYA 2H4WB 4N77A 3I31A 1GEHA 4DI6A 4ENOA 3IO1A 3J80U 2V5HG 2J8AA 3EDQB 4K4WA 2KZZA 2ZITA 1WHVA 2ZZTA 3PEJA 5HL7Q 1PBAA 2BJ1A 4KYZA 1K9MT 2LQ5A 3MM5A 1VRUB 4OJ3A 2CPIA 3AAWB 4UOHA 4DL5A 2DTJA 3DRXA 4YN3B 1HLWA 1MWYA 1HBNA 2D7SA 3RG6A 3UN2A 4FYXB 2HHTA 4CTAB 4GMKA 3QRQA 2JNJA 3JYTB 3CULA 3LQVA 1Q0NA 3MMAA 4JI3F 2CIMA 1DTQB 1JLCA 3LP0A 1RTJA 1KLMB 1MMNA 1SQEA 2ZVIA 2APOA 2XLJA 3KLHB 3KKFA 3JQMA 3LP2A 3AJ1A 4WIQA 4CYUA 2VJVA 5BR8F 1U7LA 4OHYA 5DDRC 2MKKA 4KT0C 3L7PA 3A4TA 3S01A 3OHAA 2JEIA 1RHJB 3VHQA 1NBEB 4KGXB 5C5JA 3Q8SB 2HYIB 3ZTOA 5IT0A 1VBXA 5I3QA 4EBCA 3R2CJ 1HYSA 4RW7B 1U6BA 1NK4A 5J1EA 3IAM9 2K1RA 3E3XA 1NXIA 4NYZA 2AKWB 4OV6A 5F3TA 5FLXU 1X5PA 4RUCA 2U1AA 1IR2A 1NK7A 2ZFHA 2OPSB 4C6AA 3BQ1A 3EGZA 1RUSA 4C3KA 5C2CA 3A3OB 1UVKA 3PW2A 1OMSA 2QL9B 2R7SA 4ZPCA 1SI9A 1CSJA 1SXLA 4X4PA 1Z2LA 4FZVA 1VQ8S 1SV5B 5F3ZA 4EI2A 4J9OA 4FF1A 3MWBA 2BE2A 2GNKA 2HMIA 1X7VA 3JSBA 1C4CA 4HLBA 1PYOB 1RWWB 3UCUP 3NL0A 2C2KB 1RHUB 4PYAA 2J7KA 1YZ6A 2LDYA 1RBLA 4C8ZA 2AJ4A 5F9NA 2GA7A 5CCMA 2FJXA 5GMEA 1PBUA 5IC4B 4H4KA 4ES2A 1YG0A 4KE5A 3SDEB 4DSLA 4F50A 2UXDJ 2OHDA 2ZOGA 4I0WA 4XDDA 3VQSA 2EBGA 3BB5A 2IM3A 3LGHA 2FPHX 2R2SA 3BPSP 4RLEA 4DF4A 3T5LA 1YJWS 4DFKA 1IKWB 3MEDB 1MWZA 2XZWA 1S72S 1YJUA 2F3JA 1ULRA 4G65A 2ZH3A 2KM8B 2AEJA 1VQMS 1QJHA 1GMWD 3BJYA 2PFDA 4DN9A 4F7VA 5IV4A 3ELHA 1RHQB 1UJ6A 2VPWB 3KJNB 3QAUA 2L9NA 5KT2A 4U95A 4WTOB 3TQ1A 3BQ0A 1IXKA 1DJ0A 4O44A 3VWSA 3AODA 2LQ8A 2J8SA 4HACA 4CT9A 3J81j 1YRTA 3LGMA 3PACA 1EARA 1D9AA 3CJ0A 3Q0AA 2FVPA 4JUZA 2H54B 4C3MA 1LW0B 3BV8A 3R8YA 4TQSA 1H72C 2OGUA 4ECYA 4LF4J 2GJ2A 1C0TB 4F0MA 5D4OA 4FBTA 4C8KA 3QGPA 1RLCL 2WSCC 3OR2A 1I51B 4MYUA 3GQCA 4U9RA 2QA4G 1WI8A 4FVMA 1F2GA 3FNNA 1O0PA 2JLGA 2ZH5A 3RRGA 4O3RA 3OSNA 3EE3A 1X5TA 3OTDA 4RW4B 4YR2A 2NREA 3DLKB 5HJYA 1LQ9A 1N5SA 2DNZA 3W2WB 4HL9A 2QLWA 2ZOFA 2KT2A 2QG9B 2YX4A 4F3MA 2EFOA 3LW5C 3L4BC 4C0HA 4DX5A 2VZ9A 1TQLA 3MAQA 4PUOB 4DG1B 2UUBJ 2H1YA 4RW9B 1T8EA 4RU9A 5AXNA 4QWAA 4A8XA 2CPZA 4HI2A 4I6WA 2RKIB 4ZP7A 1E6VA 1HMVB 2CNLB 3I0SB 4RW8A 4KBIA 4LF5F 2HW3A 3FDSA 1HQUB 3A8IA 4UUWA 1U1KA 4ZN1A 1JQGA 2P6TA 5I3UB 4TXSA 2VJUA 1U47A 1C0TA 2J0WA 2AEMA 2XG8A 4NLTA 3G9CA 4WP8A 3BO3A 2Q66A 1XIQA 1LW0A 2BKPA 2G2ZA 2HNDB 5DLGA 2E9ZA 3BBFA 3S8SA 2EFVA 3K5NA 2CPFA 4B9TA 3AQOA 3HVTA 4M5LA 4HACB 5A0YA 4F26A 3J7Z5 1ZOTA 1IKXA 3WBZA 2R8JA 3GYGA 4QIVA 4DWIA 5FJ4A 1FKPA 1WC1A 1R6YA 4IQXA 3DYAB 1C0UA 4TU7A 4OZNA 2EK1A 5KT3A 2CQIA 2FUG9 1P1TA 2MQNA 2KI2A 4UY85 3KLFA 8AT1B 2DNPA 4EZ6A 3ISNC 3A12A 1CQNA 2AP6A 3H2UB 4LSLB 4ZVEA 1RK8A 1T9XA 2V50A 2MQQA 4FF3A 5KFTA 3MEDA 2QMXA 3DC2A 1YJ9S 2W4CA 3RBEA 2QSWA 4P10A 2PI4A 2KDOA 3CIZA 4N7TA 6FDRA 5CCLA 5A2QY 3OTOJ 4TU8A 3M9NB 1NDKA 3DXBA 2I6WA 2KVQE 4DJBA 3PW0A 4KGZB 2FQQB 4NLXA 1RT6A 4DR1J 5KFGA 3WC2A 3CDWA 1N0VC 3GWCA 3MCOA 2XMMA 4DX6A 2VHGA 1REGX 3NS5A 3M8PA 4Y3CA 4C8NA 5DDPC 4JI0F 2O67A 3VCDA 5KFXA 3W5ZA 2GFFA 3OL6A 1GT8A 1DRZA 1FCAA 1VIOA 1KVKA 1QUVA 2NUUG 2H4YB 3PO5A 3CDUA 4RJVA 4RWWA 1H7WA 2HQCA 2NXJA 2V9KA 3MM6A 4QJVA 4X4SA 3T5HA 4DL3A 2HMIB 3DLLQ 2UV8A 5LMNF 1S4FA 1NJZA 1FRIA 4YEAA 1NK5A 1KFSA 2NSBA 3EPIA 2V63A 4BCAA 4XO0A 4ECXA 1X9SA 1SH2A 2V2QA 5DQHA 1U0SA 2C28A 4LF6F 4KHPF 2HHUA 2DEIA 2VG5A 4LFAJ 3V6HA 4ZCIA 5LSOA 4ECVA 2J76E 4ZVRB 4QIGA 3DNCA 1TELA 3TWZA 2V4QA 2IYIA 3TP2A 1J5EF 2BE9B 3CSKA 2CJKA 1HARA 3KDNA 1V5VA 3CC4S 5LXYA 3M32A 3DCAA 4WKRA 4F2SA 2VG6B 4PPDA 5F9LA 2QYGA 3Q8QB 3DDNA 5CABA 1FRXA 2WONA 2I0XA 3POTB 5E0OA 4JV2A 3T5KA 1BY9A 2UUCJ 5B09A 2ABYA 3TUJC 4YHHF 1M5OC 1KSPA 4V19X 4YDXA 5LSRA 1VQ7S 3L95X 3R5DA 3LAMA 4CDIA 1DTQA 2CA9A 2XHCA 3EDRB 4M63A 2WSFC 1M1KT 1XN9A 1IM6A 1RT2B 2YPYA 3FFIA 3ILLA 4DV7F 2RJZA 4WZMA 2X3DA 1H73A 3CB4A 2HHHJ 4ECSA 2VPXB 2C3OA 3MR5A 1UVLA 3HVWA 3Q86A 1FD8A 1S9GB 4G1QA 4IQMA 1N5VA 5E3QA 2CFXA 5HANA 3BN7A 3CE8A 2C3YA 2OFHX 4ZN3A 1HFEL 8RUCA 4WE1B 1KQKA 1FK9A 4WYWA 4JV0A 2YWWA 1MLAA 1FJ7A 1N48A 2RU3A 4JI3J 3QSIA 1KNZA 3M8PB 3R7SB 3M2VA 1YDLA 3MPVA 3W2VB 1Y5LB 4F4KA 2YKQA 2KZMA 3CDBA 4B3OB 3D7SB 1OJ4A 2ZZMA 3CCMS 2XI2A 4JI5F 4JI4F 2QLFB 1TL7A 1UWBA 4RW6B 5KFAA 1IUJA 2K7KA 3IGVA 2QN6B 4TYBA 3EJMA 4LIRA 4U67Q 3EVMA 4B9SA 2ILYA 2M8HA 1XR5A 2MLXA 3UW1A 2DBBA 2M0GB 3KHLA 3M8YA 1DLOB 2DJWA 2W2MP 3E01A 3ZZZA 1Y5IB 4L3NA 2ZH1A 4EYHB 3FUYA 2E9RX 4LFBJ 1BQMA 3BZQA 1G2EA 1K47A 2DHSA 2OI2A 5L1JA 4ED0A 1C0UB 1CC8A 1TUGB 2GHVC 2C2EA 1D0EA 4B9NA 3M8QB 2VFVA 4TQRA 1ZAVA 4X4TA 4CH0S 3QWPA 1OYEA 1BHNA 3DGPB 4AE5A 2RH3A 4PG8A 2K2PA 4F02A 5D0HA 2HFNA 2LECA 2XS2A 2CDQA 4X62J 2KYXA 3GJRB 3MTKA 1TL4A 1GH8A 4AL5A 3AD9C 4IRCA 2D74B 4OYMA 4UQTA 2CAJA 4O0IA 1RT7A 1JLFB 4G1IA 4AYBD 5KFHA 4B3TJ 3P6YC 1R6VA 4ZP9A 1RTHB 2YNFA 4N47A 2V8DA 2A3JA 2YWGA 1U48A 4WBFA 1JLGB 2ZD1B 5F8HA 1JLBA 3HM9A 3JSMB 2YX1A 2D1CA 4DG1A 2W9CA 4DSFA 4Z7CA 1B99A 1VK8A 3FEZA 1GK8A 2U2FA 1ICEB 2AX0A 3THVA 2CWKA 2HK2A 4B3MJ 1CEZA 4C8YA 1SPBP 2QJ3A 3ISND 3KWMA 4X84A 2LA4A 3G71S 3NGRA 2LXUA 3NNAA 4L3KA 1HBUA 4O4RA 3MMCB 4QIWD 1HNIA 2F8MA 1VFJA 4RR5A 1P9YA 2EK6A 2YY3A 2QTWA 1P27B 3GMGA 5CYJA 5U47A 1K0TA 3TAMA 4ANCA 2PD1A 4Y00A 4CO1A 1VQLS 1JMTA 3DDKA 3OR2B 5HMWA 4K4VA 1EQ0A 2DT9A 1RT4A 3MR3A 5L1LA 4JV5F 4CLFA 3FRZA 1BE4A 3FVYA 2IJRA 1GTEA 2PDAA 3TOQA 2KTQA 2EEYA 2SXLA 1JXEA 3CJ8A 4NOHA 3KG4A 2F40A 1SIZA 2PIIA 1KHVA 3N28A 1UA0A 1BD6A 3D67A 3MZIA 2EW9A 1S1TA 5EDWA 1AUSL 1RT2A 1V3RA 2GCFA 2AW0A 2BUNA 2WSEC 4DXLA 4WP9A 2NQPA 2JEJA 1WORA 4QR1A 4Q0BA 1OY6A 1WTBA 2ZNYA 2CJAA 3K5PA 4B02A 4GC6A 1FDDA 1KWMA 2HBQB 3Q89A 2QL5B 5J2PB 3CUNA 2J6TA 4J9SA 1UW4A 1U49A 2MHEA 2Z56B 2WAQD 4EMDA 5JXSA 4KHMA 4DUYJ 2BOAA 4UT4A 1FJEB 2HVEA 2PEBA 1X4CA 4WTYA 5DQIA 1FTCA 3DRPB 4NYPA 4MK9A 5HI7A 4M5DB 5AJ3J 2FIUA 5H9EK 2DK2A 4WF9Q 5AE2A 3K59A 3QFWA 2CQ3A 4BBYA 1VQKS 3CO0P 2MKHA 2VG5B 3L09A 2I9SA 4ZVFA 4LF5J 2YNHA 4I2PB 1NJIT 1VGYA 3U27A 2XTJP 1NK0A 4AQYF 3CMES 4HKQA 2DGOA 1TR0A 2J9DA 1JKHB 3I96A 5J1NA 1X60A 3TVYA 2HG4A 3CC2S 4F4ZA 1ZM2A 4DL7A 2W24A 2XS7A 2NSCA 3U1NA 4TYAA 3EM1A 1UJ5A 3M8ZA 1X4AA 3GJQB 4CT8A 3HVRA 1GAOA 2AIRB 2VH7A 4UY8T 1WKKA 1ZM3A 2W2QP 3QSYB 2B7BB 3V4IB 2HK3A 2LU1A 2RU9A 3KJFB 3OL9A 2XULA 1Y11A 3K8WA 1U8WA 3MR2A 3DRRB 2XNRA 1FVSA 5IV3A 1NB2A 2BOPA 3EICA 3Q8UA 4LRFA 4C98A 3CC7S 5J1EB 3UFCX 3PIOQ 2VC0A 1L3KA 4RW7A 1LFWA 2BA9A 2CG8A 3E8OA 4C8OA 1YJTA 4I1TA 4IO1A 1UFKA 1J2VA 3KLFB 3ZXWA 2F9JA 1UMJA 2H5JB 3HPOA 2W2PP 3HHNB 3IR6B 4BWMA 1IQTA 3DYAA 2JLFA 3ILJA 4KSEB 5BYQA 4M5JA 1GFWB 2WK4A 3OL7A 1SJ1A 3CCSS 2OPQB 3C16A 1IKXB 3SQGB 3P49B 2DKOB 1UVJA 4LF8J 1E6YB 3M2UA 4TLQA 1WJ9A 3RU0A 1UPMB 3UD4P 1ZTTA 4DX7A 1S1TB 3DMJB 3IG1B 4Q2LA 1QAYA 4CTAA 1KTQA 3VAKA 1HBNB 2OELA 2MQLA 1NPKA 2A0FB 1ZPVA 2N4DA 1EIYB 2UXBF 4K2XA 5MLCV 3MD3A 5HMXA 1JLEA 2FC9A 2FJEB 2X7IA 1PJ5A 1G3OA 3EVWA 5F8NA 1NHUA 5I3PA 3MXHP 3C6TB 5DETA 3P3DA 2E5IA 4WPAA 2E1CA 1RHMB 5CYQB 2V94A 4RUAA 2UU9J 4ED3A 4N56A 2B9XA 2BRKA 3RB4A 1N56A 3PRDA 3QATA 1WTFA 4PUOA 1FJGF 1HNXF 3QIPB 1TUWA 3SMZA 4ZIVA 2QV6A 3FZBA 4A8SA 1H2TZ 2FJVA 2GIRA 3QT6A 4DQPA 3GIJA 4L73A 4MYTA 1PC5A 1WELA 1S97A 3PTWA 4J9RA 4DR6F 5AJ3F 3G8SA 4PR6A 5C25A 4DR6J 1G6BA 2UV8G 4F8RA 3NMRA 4MAKA 4WFAQ 3K0JA 3NBPB 4KGKA 1R8BA 4P2SA 4XIUA 2X1BA 2B4PA 2QX0A 4DLGA 2JOQA 3S1TA 1I94J 3L9ZA 3RW7A 1T9WA 3RJMB 1O8BA 3ADAC 3G82A 4IH6A 3U7JA 4CNYA 1RAAB 1VHIA 4DS5A 4DHVA 5DGBA 4K59A 2LEAA 3ZZTA 4YB7A 2CPDA 2KN4A 3MM7B 3G6VA 1UVMA 4PQUA 4B3RJ 1VJQA 1S49A 2QL7B 5B0GA 1I5OB 3ENVA 3ULHA 3DGPA 5CYMA 4QYZJ 3D0IE 4LRCA 2ZNZA 2MYFA 2O01C 2ZHAA 1WC0A 3AQPA 1OSDA 2CRLA 2LYVA 3DOLA 2A6MA 1JNRB 3I9V9 1F0XA 4QW9A 2H3EB 4KB7A 1N88A 3Q22A 2OFGX 2DO4A 2WW8A 1RT5A 3MAAB 8ATCB 3VAMA 1MSWD 3MEKA 4DZ6A 1U1OA 4OI1A 2B3TB 3MFHA 3W60A 1AXQA 2EKYA 2WZ1A 3AFGA 3IRWP 4LRDA 1H38A 5D4NA 4DF8A 2W9BA 3PX6A 2EBEA 2LFVA 1WACA 2L48A 1S48A 2ZDOA 3HFKA 2XMKA 4QWEA 2CQ2A 2YKMA 4MTPA 2V2ZA 2DISA 4Q7AA 3UNYA 3E2EA 1VISA 2K8GA 1ITPA 4O3NA 1FK9B 3T1AA 1TL1B 1TVRB 2VQFF 2DRDA 4M5NA 1OPIA 4YB6A 1WOOA 5F8LA 1DARA 3T41A 3MMBA 1PYSB 3IC1A 1VBKA 2J5AA 3MAHA 4KAIA 4DCPB 5IC6B 1S6UA 1VRQC 1YKWA 4MJKA 5B0CA 4ED2A 2ADCA 3JSYA 2DGVA 3HDSA 3Q8PB 4KPCA 4USWA 4B3SJ 4ILRA 4FS1A 1IBCB 2MMYA 2ZC4A 3CCQS 3PW4A 2IJNA 5DGAA 1RT5B 3LGNA 1OY8A 3MAAA 4F3QA 2W1BA 3SEOA 5KFMA 4O3OA 4RNNA 1ZYQA 4OHVA 1EHWA 2UVUA 1T3NA 3H4BA 2UU9F 1QY7A 1DY3A 4H4KC 2GZOA 4OZJA 3QRRA 3R2DJ 4DU8A 1CJVB 4J37A 3R1HA 4RBUA 3RB6A 4JI6J 1GMVA 1T9UA 2CG4A 2ZKTA 3ZO7A 1W26A 3M32B 4N76A 2J0SD 3OJSA 4K7QA 1NDLA 3KUHA 1X9WA 3PYGA 3BF4A 3AT1B 4NLDA 1KLMA 1FFWB 2KFZA 1PJ6A 1OYDA 2XEXA 3HHLC 1WG4A 5BXIA 4NLOA 4NLQA 4RO0A 2EPIA 2CNOB 1FX4A 3TNVA 3I87A 3JYTA 2ZH8A 4RX6A 4A8FA 4GKJF 2AWZA 1FNMA 1H3DA 3GIKA 3C8YA 1Q4RA 1P6TA 1UP1A 1IBLF 4DN0A 2PC6A 5HBMA 1J5EJ 4FF2A 4QIEA 4IG0B 2ZJPQ 1SBRA 3VGSA 1GMWA 1N33J 4UZCA 1VBYA 3FEYB 2RQMA 3FK4A 4MIAA 3HT3A 4DUZJ 3QJPA 3MMJA 1LEOA 3MCSA 4CM2A 5IWAJ 3HJVA 1HBMA 4OZ0A 2I5JA 1S9EB 2WBRA 3IM9A 2XO7A 1F1BB 2VIHA 4OFZA 2HKEA 3MGJA 3T19A 5JUMA 3P96A 3KJQB 4F0KA 1KVJA 2FGOA 1WF2A 4ZPWR 4J9NA 2XS5A 5K8NA 2FLPA 2GVZA 4DV3J 2Z58B 3PJXA 1W7WA 4F4XA 2HFUA 2M52A 2JC1A 2DR8A 2HHHF 4YUDA 4USTA 4IRKA 2OMLA 2A2CA 3IRXA 2G9OA 4TU9A 3KNGA 1KFDA 5HROA 1H2UX 2YH0A 4ZP6A 1VQOS 1HHQA 1I6JA 4LSLA 4LF4F 3HJFA 1FXLA 3G4SS 1S4EA 1ZBTA 1OSCA 3HD2A 2DGTA 3BSNA 2AV5A 1UEUA 3WIUA 4F3OA 1S6OA 3P5TL 2RE1A 3VQTA 3SV3A 3V81B 2DNKA 1S6PA 3R6LB 3QBCA 4J9KA 4I4BA 3H5YA 2OTJS 5H9FJ 5A0YB 2W2NP 1UZDA 1GXLA 3JTPA 3PCOB 4HH0A 4OYWA 5CD4H 2J9EA 2HVHA 3W7BA 3FBCA 2HFOA 1HPZA 3M9MB 3IWLA 3A13A 5JVHQ 4DV0J 2OH2A 5D3GA 2QIFA 3C19A 2RNEA 1G7CB 2DCUB 4DFJA 4J9LA 2IY5B 1Y7PA 2DB1A 3R5CA 4R5PA 1WWHA 5HJXA 3VAGA 3PW5A 1KOHA 5DZ7A 3SXLA 1NK8A 1S0OA 3C2PA 1HW9A 3DN9A 5KAKA 4NLGA 4ZKAA 2CJBA 1KQSR 4J9MA 2ZUAA 4DV5F 1ZETA 3EX7B 3FQKA 3KNAA 1HWLA 3GG0A 3NGTA 4DV1F 3SSSA 1N5YA 2VBWA 2Z2LA 3K7RA 3G2XA 2JX2A 2R4FA 3FSIA 1P1LA 2VQEJ 3BGUA 4PRFA 3TX8A 2RUSA 1GTHA 3PFOA 4OJ1A 4RUBA 5ETSA 5AXKA 3V4IA 2UP1A 4FBUA 1IBKJ 4QCLA 2HFSA 4Y0FA 3K17A 3M30B 1RB0A 1VI7A 1YBAA 2HPUA 2I5JB 1RT1B 4C48A 3CD7A 3OL8A 1FRKA 3JQJA 3WHIA 4FNHA 4NEZA 4B9LA 4YOEA 4I2QB 3IP0A 3M9OB 1MROB 1VOMA 2AEFA 2IVMA 3C15A 4HTJA 5B0FA 1NCLA 4DSEA 1K1SA 2HVIA 3SCIE 4IG0A 1TL3B 2MZTA 5CXTA 1FDBA 4ANEA 1V9OA 1C1BB 3NGUA 2NXCA 4B9UA 1RU1A 3QMQA 4WP3A 1YTYA 4HHUA 5F0UA 1S5ZA 2H51B 3QQCD 2NXNA 4QIFA 4UUXA 4HTIA 1VBZA 3HFZB 2Q6BA 2WB1D 2YNGA 5CHCB 1QVGR 4GRSA 2HS3A 1BUXA 4ID8A 4Y2CA 1KHWA 4DLEA 5F8JA 1UEKA 5CH7B 5LXRA 3JAMU 4Q44A 1UPPA 3UD3P 1YJRA 1NMEB 3UD5A 3CF5Q 3I6PA 2DHGA 4WCEQ 1SKRA 4GO7X 4JI2J 2G4BA 3GZ7A 3KFWX 1NPPA 3KG1A 4ZHRA 4JI2F 3JSRA 1FFSB 3OTCA 2FLOA 2AYBA 2FZKB 4C9DA 4IR9A 1YIJS 1S57A 5FD1A 5BYRA 3BQ2A 1NZ8A 7FD1A 1CULA 2N7CA 2RQCA 3GFXA 4C97A 3JAMY 1N36F 4X4UA 2N7YA 3K57A 4USHA 4E2FB 4ECWA 4DV2J 3A8KA 3LWLA 4EO8A 3CJ4A 3DI6A 3D3CJ 2FHJD 3T9NA 3N01A 3MI7X 4KFBB 4PXEA 4PG5A 4K4TA 1TVRA 3CT9A 2R8HA 3OFHA 3WQPA 2HLUA 2YKNA 3R5GA 4EK2A 1FWKA 2BE2B 1KEKA 4YHHJ 3RB0A 1HD0A 5IZHA 1RLDA 2O5DA 4K5SA 5KFJA 1RYRA 3EZ5A 4ZVOB 4DQIA 1TKZA 1L3UA 5T41A 2KKHA 2WCXA 3CD0A 3OXGA 2HS4A 1LW2B 3BH7B 1B7FA 4JI1F 3AA8A 1EX8A 3CD5A 2K1RB 5D0RA 2FY1A 5H9FK 3TAQA 4IRDA 2JJ4D 4ZVQB 2CNKB 2ZEJA 1JLGA 2RHQB 1U09A 2ZD1A 1KD1T 3RR8A 2DH8A 2EVZA 3QNWB 4KO0A 3LWMA 2IC3A 4X64J 1AFJA 5AXLA 2HQ3A 5HLFA 2BABA 3D54A 3GILA 1NJXA 4KHRA 3IBFB 2OPRA 4LF9J 3TVZA 4USIA 5KG6A 3UVJB 2Q43A 4ALZA 1ZM9A 5ETRA 3SFGA 1WC6A 3MUVP 2WHOA 3GYNA 2JRSA 2HHSA 5T14A 2DGUA 4LR8A 4JI5J 3MPUB 2MQPA 3HKWA 3THPA 4WFBQ 4USVA 2XCAA 1TL5A 3KUEA 3MDFA 4J7CA 1WHXA 2AD9A 3VGUA 2BW2A 2QA4S 2VA3A 4B9VA 1WG5A 2ACMA 3M8QA 2IYGA 2HZAA 3ZZPA 4ANDA 4Z7YA 2IJFA 2IM0A 3OTOF 3ZNJ1 2R7QA 1HHTP 2W7PA 1SJ3P 2ROEA 1DLOA 3E01B 3GIIA 4X4VA 4NZ6A 1ZTWA 1YLXA 2NCKL 5L39A 4F4WA 1CPZA 4CO3A 9ATCB 2ATCB 5E2QA 4RW6A 2YWEA 2CPXA 2E7XA 5B0DA 3W9IA 3OUYB 1HNXJ 1IM4A 2V8VA 1RU2A 4XPCA 4CLKA 4UZBA 2VU5A 3BSAA 4MKAA 4NX9A 2E5HA 5F8MA 5KFEA 2N82B 3W1YC 4ED6A 1J5OA 3ITHB 1HQEA 3EZUA 4OYOA 1JB0C 4WE1A 3OXFA 1VYAA 4C0OC 1RE1B 4JI4J 3C14B 5J2QB 1AZSB 3LA0A 4IUFA 1RT3A 4FXDA 1U6FA 2DNMA 4YY3F 4G1QB 3RAQA 2KXHA 4LF7J 2EKNA 1IBLJ 2D3O1 3IXQA 2W7AA 3H59A 2OP5A 2RAQA 2HQDA 3DMJA 3IG1A 4J5OA 4M95A 3FQLA 2HAIA 1PYTA 1RCXB 1NSAA 1SJFA 3UI3A 4GC7A 2MGZB 1Q95G 2L3MA 4HDGA 1RYSA 1Q5YA 4HYKA 4L74A 5K14A 4C7QA 5K5MA 3GCWP 2XGQA 3HZGA 3H8YA 3MFIA 2QFJA 1YI2S 3TUIC 5KOWA 4BHQA 1WEXA 5K9FA 2V4JA 2VG6A 2B8QA 3GONA 2JHEA 4NZ7A 2CQHA 3RBDA 2Y8WA 2CXEA 4RKUC 4K50A 2CPHA 3B78A 3DLEB 3J81U 4DV3F 1B64A 3H5UA 1X5OA 3H42A 3M6VA 4LVNP 2PO4A 3TO8A 1D3WA 5A8RB 5LSLA 3KK2B 2ZH9A 1XNQF 4IFYA 1CJTB 4ECQA 4URQU 2PN6A 4BWJA 3MURP 1EKRA 1C4AA 2YVSA 3OFEA 5L9XA 3CMAS 3QO9B 2HWIA 2XLKA 4NCGB 1I1GA 1Q5VA 2GJFA 4OX6A 4H4OA 3VF0B 2QA1A 3J81Y 2XY7A 2AT1B 1HWJA 2R3VA 3ZC4A 2C22A 6AT1B 1OQ6A 1ZZNA 3EGNA 5HVGA 2DNGA 4KC5A 2YNIA 3I9ZA 2RRBA 1IJEB 1AW0A 2J7UA 2UXCF 3ICLA 5D78A 5HQMA 2DXFA 4LSNA 1JKHA 2JH3A 4PG4A 1R8PA 3R5AA 1KKHA 2NS1B 4H4MB 1RT6B 4WWSA 4O3PA 2M3DA 2OKQA 4ED8A 3T3FA 4LQ3A 2C2DA 4UW2A 3GFHA 4X4QA 4UOCA 1Q53A 4USKA 3UDVA 3P5BP 2NPIA 2Z8QA 4FKYA 3W8GA 1X9MA 5IFMA 1T03B 4ZOSA 5D0EA 1UETA 2G2YA 2HS0A 1T05B 3AD8C 5ETTA 2KFYA 3CDAA 2P9GA 3DKDA 1WD6A 3V6DB 1AUDA 2KB2A 1R8AA 4MH8A 1JLQB 1UW9A 1N54B 3BKUA 3IS9A 3M4XA 3T6JA 1DFDA 2M8DB 3CGIA 1RP5A 3R6GB 2AJ0A 3CJ5A 3KLEB 1Q16B 5C42B 2FYXA 4YMEA 1FKPB 3O6QA 5KG0A 1RAIB 4ZVPB 3VV2B 3CCTA 2V8HA 2UUTA 3HVTB 4I69A 1HHSA 3SI8A 1HR0F 4AXIA 2AJ1A 3ZNUA 1TFYA 1OY9A 1NDPA 1FRLA 1WF1A 1WDTA 2HNZA 3PM9A 4DBQA 3TUPA 1IKVA 2KT3A 3OVAA 3DXSX 3WX4A 3AOCA 3NOGA 5F8GA 3RBZA 4ZCKA 4F4YA 1RT4B 3R97A 2I2YA 2GQQA 2O1PA 1V5IB 4U7UK 1OQ3A 4E0DA 4R25A 4DL0C 4ZVGA 4F36A 2ZM6F 1KC8T 3CJRA 3TAMB 3RAXA 4ES1A 1QLNA 2JFDA 4PWDA 4KV8A 1IR0A 5KFYA 3KUGA 3B82A 3HHDA 1Q1KA 3W66A 1Y0HA 2RD5C 3LAKA 5KFCA 3JB9k 4EO6A 3NS6A 4LF8F 2BKOA 1BC6A 1U2CA 1BQNB 2QE5A 3AOAA 4A8OA 3KHRA 5HMYA 1R0AB 4LFCF 4OX8A 1ZAXA 1SH3A 4ZPVR 2QFIA 1DQAA 1EETB 1RWKB 1ZS6A 3TA2A 3TEGA 5B08A 2ERRA 1OO0B 2DGQA 1IQZA 3MECA 3PX4A 1JLBB 1YJVA 4YDDB 5E33A 2D9PA 5FDLA 2W9AA 2FVRA 2XY5A 4DL6A 2P6SA 4BC7A 5ETVA 5SZTA 3BYRA 1RAOA 1U0HB 2J9DE 2FJAB 1QE1A 1RTHA 2GAHC 2YNFB 3GSDA 1V6HA 1VHFA 2IFXA 4UOGA 5I42B 2BM1A 3VAIA 1YZ7A 2AYGA 4Q45A 2XWXA 1PG5B 1RT7B 3NG8A 2D9OA 1F9EB 1O5JA 3D68A 3K2YA 4QQBA 2HGNA 4HT5A 4ZLJA 3OLAA 3EPGA 1N6QB 1VQSA 2R7UA 1RAEB 4YR0A 3Q2TC 5M2PA 1S79A 1IWAA 4IFVB 2BANB 4CLYA 4Z2XA 1RABB 1R43A 2BXJA 2QRRA 1F5CA 3NLCA 2GQ2A 3QRPA 3US5A 4LRAA 2KYZA 1PAUB 3HHEA 3H4DA 3W3SA 2JWNA 4OX9F 3W65A 1XJWB 2CQDA 4CO4A 3KLEA 4FNIA 3HMJG 1B70B 2AZ1A 2UZAA 4P6QA 3IS9B 2EWHA 4C11A 4DR7J 2CVIA 1U24A 3GV5B 3OBIA 2DY1A 3FZ2A 3CJKA 3HX9A 4C8MA 1X4DA 2R9LA 1HBOA 1QSYA 3NNCA 3A8EA 3DOKB 3BM7A 3H7HB 5DG8A 1XR7A 1L5UA 4DV4F 1TL7B 1UWBB 5GAEI 1NZAA 3MUTP 1TAUA 1RHKB 5KTQA 1D09B 4K4XA 3MEGA 1MG7A 2VG7B 3NS7B 4PG7A 3I32A 3SDEA 1D1UA 2KJWA 4MIWA 2AMCB 3CVKA 1NH7A 1JXVA 4JI0J 4ILMA 1L3VA 2QLXA 1M1GA 2B9WA 2HSEB 4QYRA 2XMJA 4YS2A 1SB6A 2XLIA 2VBZA 2GO8A 4ZA1A 2GQCA 1FJGJ 2PA3A 3MD1A 1QAXA 4GKKJ 1LWCB 2VV5A 2HQIA 3KG0A 2E5LJ 2OO4A 3DU5A 1SVDA 3ONQA 4NLWA 2RB7A 2WB4A 2XMTA 1S9GA 2F9DA 3D6FB 1FRHA 1QAIA 2O66A 5GAHI 1CJUB 2BKNA 2LMIA 4NXNJ 3DHXA 3IAS9 2KXNB 1HIYA 4X64F 2VQEF 3FFIB 3HCXA 2ZHOA 3IMQJ 3BGRB 4N8OA 4NASA 5THWA 1NO8A 3ZTQA 1DZ5A 3TAPA 4IFYB 2V9WA 1ELOA 2DNLA 3EMTA 3NGKA 3ENQA 3PJWA 1FVQA 2D3UA 4L76A 3VGVA 5HVFA 5HMZA 4NPOA 3DLEA 4OI4A 3X1LB 4R0JA 2BBEA 3CJQA 3CCVS 3KLGB 2WONB 3CNQP 5EN1A 1VS3A 1NRKA 3S7RA 4CYUB 4P7VA 5DM6Q 1U1MA 2FLNA 4BLGA 2N3OA 1LK5A 1X5SA 2EFPA 5AE3A 1XBWA 2F5GA 4CH7A 5EHHA 3NCRA 5K20B 2UXBJ 2MGZA 3WZ0A 2FJWA 3MMAB 1WOSA 4U8VA 5ETMA 2Y0SD 2HHVA 4PG6A 2IHR1 4K0KF 1S0VA 3TZXA 2XSFA 3MM8B 1U25A 4FKXA 5G0RA 4KGVB 4WFZA 3OXLA 2M70A 1DTTB 1FJCA 2Q3PA 1X4HA 2B4UA 3C14A 3MM6B 5J2QA 5HVHA 1LWCA 5D0GA 3FKBA 5LJ5Y 2NZ4A 2B4OA 1S1WA 2ZBCA 2QYCA 2Y1IA 2HLTA 1HQEB 3GYXB 2RILA 2NR0A 3Q8VA 4DCJB 5ETPA 1FHTA 5EWFA 1J5OB 2PA8D 3GP9A 4H54A 3H20A 1HW8A 1MU2A 2DNQA 2XMVA 4P74A 2N4CA 2KG0A 3N6NA 3TANA 3OUYA 1CVJA 1HYSB 2ZDPA 1S1XB 4ID5A 2FGCA 5ETQA 2RRAA 4QBUA 1S10A 2B9YA 4ICLA 1V3ZA 2CJXB 3IA0A 3CXCR 1U1NA 2VFTA 1NSPA 5E3PA 2AF6A 2UUAF 5I4MA 2XMUA 3N4WA 3MOJB 3KJVA 3ZTRA 1TKXB 2DNYA 3JTNA 3MUMP 2J0XA 3RTVA 1IJFB 2DITA 2YQ0A 3MPYA 4ETXA 4YB5A 1S9FA 1B4SA 4C4WA 2EXUA 5E5NA 3CTRA 3ZFVA 3I5BA 2UXCJ 3EVOA 4G1PA 2DR9A 5A8KA 2JC0A 4A8MP 1RCOB 4IOCQ 2HVZA 2AX1A 5KT5A 2BQRA 1NB7A 2ASLA 4IFVA 1UFWA 1FNXH 1Q79A 1A9NB 3R3TA 3O3LA 2E5JA 2GMLA 1FO1A 4LIWA 2JZ5A 2Z57B 2E5LF 1FEHA 2X1GA 2LCWA 1IKYB 4CQ1A 1SL1A 3IFEA 1VRTB 3AB4B 2IA6A 3LP1A 4FVCA 2WBMA 1U0HA 5I3UA 5HLFB 3KTQA 3W61A 1HQUA 1U02A 2QLBB 1EP4B 2HGLA 4IYQA 1XMBA 4IH5A 4LQ9A 4ZPDA 4U7UD 3Q24A 3SSQA 1E6VB 3D1QA 4LF9F 1CJKB 4P72A 2XGPA 2OIHA 2D69A 3R7BB 2A2DA 2PMWA 3RBXA 1N8RT 3EXYA 3HHKA 4A8KA 1MWQA 2L41A 3I55S 4ZVTB 1F5AA 1HKAA 3HHLD 2F1FA 3DRSA 3I0RB 4OQJA 1TKTA 4EUVA 1BQNA 1NAQA 1Q7YT 3BR8A 3W2WA 5IWAF 2IPOB 2VB6A 3PW7A 3T1YF 1U2RA 1J27A 2F8EX 5T7LB 1QSSA 3H2LA 1CBKA 1U2FA 5RUBA 4KV8B 4EYIB 4OYAA 5KFBA 3NNHA 1AB8A 2W8LA 3F41A 3I82A 3W8PA 4L6V3 3W62A 2DH9A 3D1HA 5J2MB 2DHAA 1VC6A 4DSKA 2EG2A 3R5JB 3F0NA 4W4MA 3DLGB 3R7NB 5IT9U 1LFPA 3OD2A 4IOBA 4ZPBA 3U02A 2M2BA 2E1PA 4X4OA 3CCUS 1VQYA 2EC0A 2HNZB 4DZDA 1CG2A 4TNOA 1FKOA 3K89A 3K58A 3A3NB 3HKZD 2Y1RI 2HFVA 2AYEA 3CEDA 5FIIA 2M9KA 4QR2A 2GGPB 3Q23A 4NWBA 5LL6d 2IRUA 3AB2B 4I67A 2BMBA 2FJBB 2LDIA 4MFBB 4NZ0A 5HQLA 2XZTB 2AHOB 4P71A 3PZPA 3FC9A 2V34A 4EU0A 2BX6A 3BO4A 3RR7A 2WTFA 1R8HA 1R89A 4OZ2A 3VAJA 3TJAA 2HNYA 3FCVA 2Z2YB 1FDNA 1CC7A 1UL3A 2RT3A 3V6DA 1DQ9A 4NXMJ 1LNQA 1FE4A 1WC4A 3UWTA 1X0PA 1SL2A 1F9HA 1FX2A 1BXNA 3A3PB 5A8WB 1F3VA 4NI2A 3ZZ0A 3GV8B 2D41A 4OZ1A 4QOTA 2IAJB 4N41A 3OQ2A 2OSQA 1JWWA 2KJVA 5J2MA 2CVEA 2QSFA 2MQ8A 3PG9A 5J2NB 1MROA 5IXUA 5LT5A 5KFNA 1O6XA 1VR6A 2WRMA 3EGVA 1SQGA 3ET6A 1VQ6S 2CJQA 4DPWA 3KMSA 3HP6A 5T7LA 3T9ZA 2B51A 3M30A 1HWUA 2ASDA 1IN0A 2HQGA 2LQ9A 1FWPA 2YX7A 1VQ9S 2DNRA 5BYSA 4IO9Q 4CO0A 3O1LA 4RBTA 3DLJA 2OPSA 1SKUB 2ZBQA 2XB2D 2QMWA 4K4SA 1UKUA 3UDCA 5ITHA 4F2RA 3D3BJ 2A18A 3IBWA 4OHWA 3E51A 4LJMA 1RA6A 1B0PA 4XK8C 3TYTA 5C2GA 2A6OA 2F63A 2RS8A 1IR1A 1F60B 2IDLA 3FMBA 1C1CB 3N79A 3Q83A 1OWXA 2BW7A 2OEJA 4FXWA 5HN0A 1SKWA 3BN4A 3AXMA 4F67A 4P75A 4LMZA 1UZHA 2GO9A 5KT4A 5DQGA 4R5PB 2ASYA 4IG3A 4B9MA 1NM2A 4I56A 3TA0A 4PYDA 4ZPAA 3RYLA 3KLHA 4CLZA 4OYXA 4P9SA 3JS9A 3DM2B 3CW2C 2NYIA 1JLCB 1RI7A 4HHJA 5JJBA 5K8MA 4GVBB 3TJ9A 5LMUJ 3PY8A 3SSRA 2FB0A 2ZBRA 4DPOA 1CS4B 2V8PA 4M5MA 2OMOA 5LMUF 2IBKA 3BSCA 3Q8YA 2C3UA 2V2KA 3M2RB 1H6KX 3OFFA 4HVZA 2CQ0A 5E3RA 2HRYA 1S6PB 1S1UA 3VTIA 2YKPA 3MEEB 1LWEA 1EB0A 4DPUA 1XNRF 3I56S 4M5IA 5D4PA 1MMLA 4WU3A 3IR7B 2QC3A 1LXNA 4J9UE 5IOLA 2MSTA 2RF2A 4X65F 1I3OB 1F6TA 3ENWA 5KG2A 1O51A 1XEZA 1Y4ZB 1S59A 3D0GE 3ETOA 4MKVA 1S7IA 4KH1B 4O0NA 2V8GA 4NL5A 3KLVA 2DO0A 2NXUA 3HD1A 4LVOP 4RL1A 1Y10A 2B5JB 2RQ4A 2XQCA 4EEYA 1ZA1B 4DV6J 1L3TA 3A1YG 4B3RF 5AE1A 4ERDA 3R9LA 1RTIB 4PQAA 1XMQJ 2VONA 2RF2B 1TV6B 1HNVB 1HBMB 3BDPA 5C24A 1RTDA 1D9DA 1S1VB 2CDRB 2F8HA 4AD6A 2LKZA 5KFQA 4ZMMA 4Y65A 1QTMA 1HD1A 3MEEA 7AT1B 5KFZA 4KKOA 3V6JA 5DS7A 3MM8A 3TJ8A 2AQ4A 2BJ7A 2HEKA 4NLSA 3UN5A 1FA0A 1TAQA 3LO3A 2MQOA 2KFNA 2Y3YA 9RUBA 2LEPA 4Q2MA 1G4CA 3QZ8A 4YFUA 4JI7F 2HBZB 1RKIA 4HI1A 4X4NA 1KRPA 2XSJA 5L1IA 2KG1A 5BR8J 2DNOA 4U96A 5GAEU 1Y5NB 4NLVA 4LF2A 2BACA 4CLLA 3PHTA 3UVJA 5KG1A 2NYHA 2VD3A 3CD6S 4PWUA 4KIAA 4OX9J 2IC3B 2QMUB 1LV5A 4DFPA 2GIQA 2ZUGA 4K0KJ 1FT8A 1JJCB 2VKRA 5AXMA 3SQOP 1G1XA 4RZRA 4XPEA 2EC2A 4AFFA 3D66A 4ZITA 3GIMA 1OIAA 4LFBF 1YJ7A 4TY8A 3DLBA 4I6AA 2H5IB 2DGWA 5BJRA 1T3OA 4DR2J 4B3SF 2FZCB 4RPFA 2VUGA 3ZTPA 1S76D 1CLFA 3TQEA 4WK1A 1T11A 3LF0A 1AYEA 5CAAA 4ELUA 4ZLNA 1X0FA 2HZCA 1S6QB 2R2UA 3MMBB 1NKEA 2IRXA 2MJNA 2J0QD 4ZJLA 3G87A 4DMZA 4NCAA 2I8EA 4ZLPA 3BO2A 1HI1A 1TTHB 4JI8F 1HI0P 1T9YA 1LWFA 5ADZA 2DCLA 5G4DA 1YRUA 3AHPA 4JI1J 2KO1A 3GR0A 4HT7A 4WFXA 3HHLB 4DL2A 3SCJE 3PR4A 3VZIA 2ZH4A 1NKBA 3WIVA 4RWXA 1BLUA 1DQ8A 1RACB 3RGIA 2O3DA 4UF4A 2F4VJ 1HR0J 3GG1A 2V69A 4GKJJ 5KG4A 2E7WA 4CWBA 1XNRJ 2DNHA 4RUHA 1GXUA 3BGOP 4L75A 1NEEA 2BYCA 4M8LA 1UAWA 2ILZA 5F0WA 3UE2A 4F04B 1URRA 3M6XA 2Z30B 2MKJA 4EGLA 5KFUA 2HNYB 3RB3A 4EZ9A 4ZHRB 4TLRA 4ZJQA 1YQHA 2CUYA 1DHMA 2QT7A 3JQKA 3LANA 3OFGA 1VLOA 2ROGA 2IVFB 3PXGa 4USMA 5KFFA 5CZXA 3UDEA 3DRYA 2ZM6J 1XNQJ 2VDHA 3PHEA 1VC0A 2LU2A 2MKYA 4IH7A 3D1OA 4PEOA 4E8UA 1X4EA 4ES3A 3J7ZT 2R7XA 4KQZA 5ETOA 3D6HB 4I6YA 2CPEA 1U45A 1Q7LB 3MM7A 3Q2SC 5DG9A 1REVB 2G0CA 4DX8H 4FS2A 2HZVA 4W90B 2M4MA 3V4MA 5DDQC 3G82B 4JOUA 4ER8A 5E7OB 2FVCA 2HGMA 3MTJA 2MXYA 2ASJA 1SC4B 5GAHU 1N6QA 5KOXA 1UFLA 3OHBA 1EJ7L 4J90A 3HI9A 2NXEA 3J7YI 2Y9HA 1WKLA 4TVAB 2IBOA 4DPXA 5CZVA 2W4DA 3NEKA 3TVKA 1QVFR 2WW4A 4V1Ak 3R27A 1B0VA 2I38A 3SYZA 2J6UA 2YXLA 3D6MB 2ZC3A 4DV2F 1FD2A 3H2VE 1HNWJ 2JVRA 4LSZB 2BJ8A 1LOUA 3C6UA 3NCQA 1U1RA 1RTIA 2XHWA 1KN6A 2FJDB 4IDKB 3TA1A 1BGXT 3PNIA 1RWMB 3M8RA 4LF1A 3PYFA 3OW2R 1RTZA 1SC1B 1R0AA 1TMMA 3CCZA 4A46A 4EWTA 2JFKA 2CJYB 3AY0A 3K5OA 1KOOA 2CQ4A 5ETLA 4CLSA 2AJ2A 3UCGA 4NLYA 3A8JA 3EGWB 4UQGA 2RRNA 3AXKA 4CLPA 4DR4J 1Z4UA 3QZ7A 3F44A 2UUBF 3UO0A 4PWDB 3MPDA 1B3TA 3RRHA 5B7WA 2JL9A 2AJQA 1Y9OA 4DR5F 2P9CA 2NLWA 3MR7A 4I7FB 4X66J 2QLJB 3SZ2A 1T7PA 2Y8YA 3BH6B 2P9EA 1SJ4P 3R5BA 4J9VA 5EX0A 3QJJA 3H5SA 3GJSB 2MB0B 2Z2ZA 4NA1A 4F25A 2RMLA 1U4BA 4C2MA 1RAHB 2HRTA 2JDJA 2G1HA 3OR1A 1IKVB 2R42A 4ELTA 2CQ1A 3GE9A 4TN2A 4NLUA 4WJBA 1HPZB 4R8UA 1WHYA 3N0VA 4A47A 2BR0A 2HHWA 4LFCJ 3B4DA 2VC1A 2XM3A 3O8WA 3M2UB 1E6YA 3GPAA 4LBHA 1BMQB 1F5BA 3B4MA 1KONA 2BRLA 5A2QU 3FBEA 3TZYA 5D6GA 4QWBA 5C42A 1HWKA 4JB8B 4IG3B 2PMZD 2R7VA 4Z37A 3SIPB 4IR1A 1GQEA 4I7FA 2QZ8A 3D5MA 1U26A 2CQBA 2F4VF 1C1CA 1TKXA 2E44A 2C3PA 2MZRA 4V19J 3LTOA 1YJNS 2V6AA 3IRXB 4QW8A 3I4PA 3V5RA 1AFIA 2E7VA 3PEHA 4NMLA 1N4LA 3LPEA 2WVCA 3PX0A 2OSRA 5MAOA 2DR7A 3C3LA 1N5QA 4CO5A 2PSZA 3NWGA 4OLPA 2K3KA 2GVDB 4WXWA 5CQGA 5ETNA 2CPYA 1QD1A 5FLXY 2VODA 1H7XA 1WSVA 5KG3A 4CLUA 2J6SA 4LSNB 3PJ9A 1PO6A 1ZA2B 2DYAA 2GJIA 1S9EA 3Q8RB 3M8WA 5KFWA 3KMQA 5AT1B 3ET6B 2KT5A 2ZKUA 5D4LA 1NHKL 2W8KA 3NP5A 1YBUA 2WOMA 2FY8A 2XI3A 2VDIA 4PKDB 2F7VA 1DTTA 3N5FA 3TX0A 1H98A 1R27B 3GB0A 2EFGA 2E1MC 2IAJA 3MPWA 2HHQA 3UNGC 2YNHB 4I2PA 2XZDB 2FZGB 3IBCB 1FDAA 5A8WA 1KLNA 2MTLA 4PABA 1FEEA 4OV1A 3HXMA 2DGSA 1CJTA 1YSJA 3AJDA 1HQ2A 4ECTA 2E1AA 2H9ZA 3CJSA 3RAMA 2MEWA 2PGCA 2V67A 4M5GA 4URGA 5KG7A 3MM9B 3HLUA 1HNWF 3TARA 4N5SA 1V3SA 2EI5A 3O2IA 2RS2A 4O3QA 2JEGA 1VMBA 2CKWA 3KLGA 2OAUA 1X8DA 2C2NA 2L08A 3EXCX 2BM0A 4HDHA 1KR4A 3MF5A 4GO5X 4Q0BB 2G2OA 4DR3F 3OLBA 3UN3A 2E1RA 3BGRA 2BVZA 1Y3KA 4FDFA 4CP5A 4JYAF 3CCJS 1SC3B 2GMJA 4PZVA 4DS4A 3LALA 4YP3A 4ZK7M 1VJWA 3W9HA 1TK8A 4P73A 2UUAJ 3DLGA 2MZ1A 5IM0B 1UWAA 2P2CB 4DUZF 1RAJA 1T94A 3D2WA 3CCLS 1XERA 4ECRA 1LXJA 5D8HB 4WYLA 4ATNA 1LWFB 2RUGA 4NMXA 2LEBA 4CCHA 1FFGB 1SQFA 2PE8A 2D3OR 3G6YA 5HATA 3G86A 1IWGA 1M5HA 2L9DA 1DAXA 3KXDA 3TEHB 1HNIB 3ETMA 2DNNA 1X4BA 1HBUB 2JVOA 2RDDA 2VG7A 1FERA 2JLEA 2AZ3A 4KR0B 3CJTA 3DRSB 3I0RA 4J91A 2V4RA 4WXOA 3G96A 3BKTA 3K5MA 3W9JA 3GIRA 4KY3A 3TRGA 2KXFA 1FWLA 1ZH5A 1SJQA 3DOKA 3GTYX 1HBOB 3JSMA 2RSQA 3RRKA 1S7HA 5LOQA 2OTLS 4LBIA 3NWRA 3BBCA 1YRXA 3UPFA 5GAGI 1Q86T 2B6AB 4RU2A 2GS8A 2ZBPA 3IR5B 2QGFB 3OSPA 1NJYA 2DRBA 2FTRA 4CNZA 2FD2A 3O5TB 2C1EB 4NLPA 2K3IA 2LP4A 5HQ8A 4CO2A 5L38A 1WHWA 1HI8A 1WKJA 2HIQA 1AROP 3L7UA 5DO2A 1A0OB 2ZJQQ 2JSXA 4RNMA 4PQUB 4A4JA 2HAFA 4OJHA 4OYZA 4DSIA 3KYLA 1NNDA 1F2HA 3HULA 1T9VA 4YR3A 1SCJB 3NKYA 4Q43A 3SCKE 3ENAA 1Q8KA 3DGVA 1GXTA 3JTOA 3N5BA 3QT8A 4N8NA 4NLRA 4ZVUB 3RUBL 3OJUA 3PV8A 3OVBA 1TKDA 5A8KB 3R1LA 2BJ3A 3TZWA 2OPRB 2CQGA 1HL6A 3QAEA 1QE1B 1RBAA 4PXCA 4ZPTR 5I42A 1CQMA 4NYOA 2WVBA 4KO0B 3F73A 3T5JA 1BQXA 1S1VA 2B6AA 2EG1A 3CCWA 1UVNA 4Y2IA 1T02A 4KGMA 3KJVB 1WEYA 1UEVA 4DV1J 4USJC 5EWGA 1TV6A 3FEXB 3HFVA 4DEZA 5DG7A 1K8AT 3IN5A 4OI3A 3DFEA 1WC5A 1EZZB 3KK3B 1S1XA 4ID5B 3H5XA 2XYGB 2F4FA 2YKAA 4JI6F 2DXDA 4X62F 1U8SA 2B5JA 2GHWA 2MKIA 2DR6A 4ZJOA 3MCMA 1DBDA 4B3MF 2AGPA 4XTTA 1MU2B 2MKSA 3BS9A 2HURA 1Q8IA 3M2VB 3W2VA 1JLAB 4E98A 4WKYA 5DZ6A 2MPUA 4ZLLA 4MT1A 5CYQA 4LR9A 1XR6A 3ZZRA 4A8YA 5HK4A 1MW7A 3BGLA 4F4AA 2LQBA 4WZQA 4CIOA 2GHPA 2L9WA 2PEHA 3M8SA 2ZWPA 4FYVB 4ECZA 1T9TA 4YY3J 1R0CB 4NA2A 1LWEB 5LM7E 2C2RA 1S99A 2VFRA 1FRMA 3LH2S 4PAAA 4WFNQ 5IM0A 4AL6A 1S1UB 5IS2A 4ECUA 3PKMA 5GADU 4NXMF 2HBRB 2RQKA 2VKZG 5DRKA 4ZIWA 1YX2A 2ZWOA 1N34F 2E29A 1PSDA 5KFKA 2G0IA 2POKA 1CS4A 2MY8A 2VL1A 4JP8A 4OYIA 3NGDA 1CULB 1KTVA 3NRBA 1ROFA 4ZCLA 1EKSA 2XBPA 2AGQA 2DGXA 4OZ3A 1SKSA 2H5EA 2XMAA 4BS2A 3DM2A 4KJIA 2IDEA 1FXDA 4FYWB 2CPJA 1DURA 1W2IA 2OPQA 3C16B 3SQGA 4DSJA 1EAYC 5E3CA 3L3CA 4TKTA 3ILIA 1IVZA 2OEMA 1JIHA 3ILOA 3POTA 3CJ2A 4L72B 3GSIA 1UA1A 1PJ7A 1T0TV 1JLQA 5DDOC 3N6MA 1YHQS 3J7A1 5C7PA 1RBOB 3LUYA 2FHKA
chains in the Genus database with same CATH topology
3EUNA 2XMWA 3OPKA 2ALZA 3MOZA 3G8TA 2YNGB 2UXDF 1C2PA 1N5TA 3K5LA 1JK9B 4I68A 3CPWR 1HA1A 4ITSA 2CZVC 3FJ2A 4LT6A 4QWDA 3VR1A 4K4YA 2GC8A 4I2QA 1TFWA 5GAGU 4OI6A 1RT1A 1WF0A 1YGYA 2ZH7A 2D3ZA 1WI6A 3PR5B 4H4OB 4OLOA 5E41A 2YQ3A 4DR4F 3TUZC 2Q1LA 4NCBA 3MEGB 3QO9A 5SUHA 3TR5A 5GVQA 1JJ2R 4OZLA 2MZSA 3GFZA 4DOZA 4NA3A 4YQWA 2YWHA 1R31A 2IRYA 5KT6A 3QIDA 2X1AA 1X4FA 1T95A 1QM9A 1NU4A 1N5YB 4KTQA 2MJUA 5M2UA 3KK2A 1R8CA 1M5PC 2CQPA 1URNA 3AJ2A 4C11B 3X3UA 3BDEA 2KRRA 1JX4A 1FKAF 2BJEA 4XDCA 5J2PA 1JNZB 4HEA9 4MFBA 3M6UA 2VFUA 2ACYA 2VA2A 1IBKF 4P7TA 4C0BA 1KQFB 1Q82T 2XCPA 4O3SA 1ZAWA 2GGPA 1NHVA 5JVGQ 2FLLA 4NXNF 2BANA 2DH7A 4Q5VA 3CCRS 4NRUA 4ZS6A 2IVYA 3DLHA 4XAKA 3PIPQ 4R8UB 4MK7A 5EX3A 3T1HF 3VAFA 4AL7A 4QWCA 3FMWA 3OVSA 4DFMA 1A6LA 2HWTA 4OX7A 4BC9A 1RT3B 2LXIA 4MIBA 2VBXA 4Y28C 4RNHA 3T6BA 2KRBA 2CZ4A 2J7WA 1U1LA 2R7TA 2W4PA 2GX8A 1HMVA 2MY7A 3I0SA 3I5CA 4RW8B 2JEFA 2JEIA 1BWEA 3ITHA 1TP7A 4MK8A 1KQGB 5EUHA 1APSA 1JLAA 1NH8A 4RW9A 1HNZF 3PFEA 3BR9A 2ADBA 4CI0B 2DRAA 2PT0A 4K4ZA 1HWIA 1W25A 4K5RA 2LLZA 2HFZA 2HHPA 2IA0A 3FSYA 3VAHA 1LKZA 1S77D 3DU6A 4OI0A 3KK3A 2DIVA 5F8JA 4WIIA 1RDRA 3RZAA 2XNQA 1ZM4A 4URSA 1Q8BA 2W9CB 3C6UB 4DUYF 1H0HB 2W25A 4EBEA 2UVWA 5D77A 3AH6A 1Z1ZA 1RJJA 1RQ0A 5E3AA 2AJFE 2HHXA 1EP4A 3PDNA 4LFAF 3V6KA 1B0TA 3CWJA 5EWEA 2CQCA 4WFYA 3LP1B 2HWHA 1FTRA 1YVFA 5KFOA 3SFUA 3GR1A 5KFVA 1JLFA 1VIXA 3NAHA 2E66A 3UCZP 1D9FA 2MZQA 3FRYA 4DR2F 4W92B 1VQ5S 2QO3A 1N0UA 2UUCF 2BZ2A 4JV1A 4DR1F 5KFRA 4O44B 2HRUA 5KFSA 4QR0A 2R7OA 3S6EA 3CO9A 2BJDA 4RNFA 4DR7F 2LA6A 1A7GE 1N32F 1XC9A 1BQMB 1R7IA 1TUVA 3HK2A 2AYMA 1K0VA 4B3TF 2KHCA 2MKCA 2YWKA 3WDOA 4ICLB 1SH0A 2E5GA 4OIXA 4Y2MA 2DHXA 1RKJA 2DD8S 1RISA 3BREA 5L8RC 1TKZB 1FESA 2PMHA 4B3OA 4H4MA 4MKBA 3HHLA 2GW8A 3M05A 4MMOA 2YKNB 5IT9Y 2DVIA 1S1WB 1QSLA 1TL1A 4DQRA 2MQMA 4KFBA 1ZZFA 4B17A 3HO1A 4QPTA 2VOPA 3DI6B 1S6QA 1SIWB 1TZ0A 1XMQF 1P9QC 5J1PA 5G0RB 2KH9A 1U1PA 4Q8EA 4TY9A 4ZDNA 5A6WA 3G8QA 4TY8B 2UVVA 4FP9A 4QPXA 5A8RA 1XK8A 5DJBA 1SC6A 4EBDA 2M7SA 2I1RA 3DOLB 4X4RA 2V4JB 1FNOA 2LVWA 3LOUA 1VC5A 1VQPS 2OD4A 4OJGA 3GFYA 2X3GA 3D0HE 5CYMB 3MM9A 2Q79A 4FPRA 5K8PA 2YKOA 1RTJB 2XWYA 3C46A 3IWXA 1LK7A 1RA7A 3QGIA 1K1QA 3B8HA 3H98A 2EFNA 1SL0A 2ZZNA 1C1BA 2AGOA 4HH1A 5KT7A 4KPYA 5IQQA 3V2UC 2Z4PA 5KFIA 2BQ3A 2WOMB 3FGVA 4X66F 2E9TA 4FYDA 1RTDB 1JJ4A 2COLA 2G13A 2RDIA 4OMFG 3KOAA 2ZH6A 2B43A 1JXLA 4RBVA 5EGYA 3AA9A 1WEZA 1VQ4S 3NMAA 1M5SA 1WG1A 3L7OA 2DIUA 2RDJA 1Z2ZA 2RIJA 1SUQB 5K8OA 3TI0A 4K4UA 1SJRA 2MHNA 2LQJA 3CCES 4J9PA 5H1SV 1M0SA 4O23A 4AUKA 2B4VA 1F9FA 2KU7A 4KRWA 2R2RA 2ATLA 2CJ9A 2IMWP 4G3IA 2VFSA 3C6TA 3CJKB 4C3LA 2MZJA 4DQQA 5L9NA 3MHYA 2DR5A 2OLWA 3IGNA 2ZH2A 2Y1JA 3E2EA 1JLEB 2FHOB 2DPJA 2IM2A 4X2BA 1XTZA 3J7YU 1N52B 1Y3JA 3M1VB 3WC0A 4Y6IA 3M2RA 4WU2A 2ZJRQ 1P8GA 1XWLA 3KLIA 3KK1A 4A8QA 5HP1A 7FDRA 1QUPA 4Y2AA 2V0NA 4ZVHA 2HNDA 2P5VA 3OR1B 2IMOA 3OTEA 3OTBA 3KHHA 3ISZA 3PKYA 1Q8LA 1U6ZA 2ZE2B 2G1DA 2VASA 4O4GA 4OHXA 3F56A 5HO4A 3ZZYA 3SCLE 3O44A 4QU7A 3NCPA 5FDLB 4J9QA 3PO4A 2RKIA 2YH1A 1L3SA 1VLYA 4Y34A 3QLHA 3MECB 3DHWC 2OJ3A 3LPYA 2BV3A 1EETA 1LW2A 3DRRA 4U6PA 1FE0A 3BSOA 4QZVB 1YITS 2QEXS 4AXJA 2A1BA 5B0BA 2YTCA 5H9EJ 4IDKA 1TK0A 2OPPB 1GNKA 3DLKA 4DV0F 1OPZA 1Q78A 4RW4A 2NPFA 5LJ3Y 2R2TA 2M5YA 1VK3A 1S0NA 1PGZA 4ELVA 1OS5A 1R3NA 1Y00A 4IKAA 5GADI 1H2VZ 4DL4A 5DLFA 1PILA 5KG5A 5J2NA 4ZP8A 2UVRA 4C8LA 4A48A 1D8YA 4PCQA 4DQSA 3HZEA 5HBMB 1D8ZA 3TW0A 3ZZUA 3QJLA 4LF7F 3HVAA 2GMHA 3T5JA 2LXFA 4OHZA 3M6WA 1YWXA 3OV7A 4PXDA 1REVA 1FRJA 3C66A 2PFFB 4G6VB 2BDPA 3CJ3A 2FC8A 4NRTA 4M5DA 2QA2A 1I94F 4WK3A 3DRPA 1RWUA 2B56A 1MNEA 5A6PA 3MR6A 1XMOF 1NK6A 6FD1A 1M5VC 1UVIA 4ILLA 2ZOMA 1WNEA 5F8IA 2M88A 2MSSA 2FVQA 4FXVA 2NUHA 4A8WA 1KS2A 3NAIA 3QWUA 3U1MA 1M90T 2C42A 1NKCA 3G6XA 4YB1P 1IKWA 1VQNS 3UR0A 2B7CB 1T03A 1T05A 1TK5A 2R8KA 1FKOB 3BEGB 3G6ES 3H25A 2Q6CA 2XY6A 3VZHA 3THTA 1JJHA 1QAJA 2FVSA 5KFDA 3SV4A 1UJ4A 1TL3A 2VPYB 1X4GA 3QPIA 5F41A 1K73T 2RVJA 4JBCA 1FXRA 1NK9A 4ERDA 5B0AA 5L1KA 2R8GA 3RW6A 5KFLA 2YNIB 4CH1A 1GX6A 1KVIA 2R8IA 3UR3C 1M5KC 3CIMA 3DOMA 3MMCA 4B08A 1SV5A 4ZCMA 4FN5A 2X51A 2KM8C 2YKMB 3K8VA 2OPPA 4OZ5A 2B0GA 4NCGA 4MKYA 4I64A 2ZVSA 1TKTB 3VALA 2W9BB 2CYYA 1PC4A 4ETZA 1FF2A 3FSXA 3CDEA 2OD6A 3BGFA 3N9UC 1W2BR 3QLHB 2VOOA 2FHMA 3FCHA 2K7JA 3PVXA 3QYYA 2C3MA 4OI2A 2PI5A 2FHJA 2J9CA 2KHDA 4EFAC 4M94A 2YWFA 3I4HX 2GV1A 4ED7A 2MDAA 2ZE2A 2EFQA 2FDNA 2Z0GA 3HF5A 3QGHA 5DM7Q 1S0MA 4IOAQ 1VRTA 3GV7B 3LP2B 2Z2MA 5D3GB 2W7OA 1IKYA 5K14B 2X1FA 2AU0A 3I5AA 2VPZB 4D3GA 2DPIA 4M1KA 1ZPWX 3LP0B 4GKKF 2XSJB 5B0EA 3KHGA 3N6LA 3U1LA 4U7CA 2XC9A 2A10A 5HP1B 3KLIB 3KK1B 1Q81T 4DDFA 2IM1A 3M1VA 4KKOB 3V81A 4P