2BZ2A

Solution structure of nelf e rrm
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
79
Chain Sequence
APRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEGATIVE ELONGATION FACTOR E
publication title Structural studies on the RNA-recognition motif of NELF E, a cellular negative transcription elongation factor involved in the regulation of HIV transcription.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 11
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bz2A00
3CXCR 2DNHA 3BEGB 2F9JA 2CQ4A 3L3CA 2X1FA 3CCMS 1YITS 2LEAA 2LYVA 2Q79A 1U1RA 2MZ1A 1M5VC 1F9FA 2VOOA 1N54B 3J7YU 1VC0A 2B0GA 2DNQA 1ZH5A 3MD3A 3P6YC 2MYFA 1X4DA 5GMKa 1X5PA 2MZRA 2I2YA 2ZJRQ 2PEHA 1X4BA 2D9PA 2MGZB 2AD9A 2E5JA 2CPIA 1UAWA 1Q86T 2MJNA 1SJ3P 3G9CA 2KXHA 2XS5A 5IM0A 2MZQA 3NS5A 4WIIA 2MSSA 2QA4S 1N88A 1WELA 2DNYA 2RQCA 2LQ5A 3SMZA 5GAGU 3THTA 2QFJA 3LQVA 1WI8A 3MD1A 1SJQA 2G0CA 3CC4S 1M1KT 2LMIA 1DHMA 4WFAQ 3NNHA 4Y0FA 3VAIA 2X1GA 3SXLA 2A3JA 1U1LA 4CH1A 2XSFA 2DGXA 3CPWR 1NJIT 1X4HA 1KOOA 1WF2A 5LXRA 2DNLA 1G2EA 4TU7A 3IRWP 5CYJA 4IO9Q 2E5HA 1U1QA 3EGZA 3S8SA 2FPHX 1YJWS 2LA6A 2GHPA 3UCUP 2RNEA 2N3OA 1YIJS 2DNOA 2M8DB 5GADU 2MKIA 1RK8A 2KN4A 3CCSS 3R1HA 3VAKA 2DHXA 1U1KA 4PRFA 5DM7Q 2KHCA 3PIOQ 1M5OC 1WF0A 2EVZA 2MB0B 1VQOS 2E5IA 2MSTA 3MUVP 3VAFA 2KG1A 2DNNA 2M70A 2K3KA 1VC6A 2MKSA 2DB1A 2DNPA 1HL6A 1VQ6S 2D9OA 1YJ9S 5D77A 1OO0B 2DH9A 1R8HA 1WHXA 1N8RT 3BO3A 2DISA 2AYBA 2M2BA 1VQLS 1VQ7S 2RUGA 2J0QD 2YH1A 3DLLQ 2LA4A 2RQ4A 1WHYA 2KFYA 2AYEA 3CCES 1U1MA 3D2WA 1VBXA 3K0JA 1FJCA 1U1OA 1WF1A 3NS6A 2KM8C 1U2FA 3TO8A 2KI2A 1PGZA 3MOJB 3UWTA 2DHSA 2OJ3A 1OWXA 2M88A 3CC2S 3J7ZT 3SDEB 3VAMA 2HGMA 5DETA 2L41A 1AUDA 3HI9A 1VQNS 2KRRA 4OZ0A 2DK2A 5FJ4A 1X5SA 1FJ7A 4FXVA 3UD3P 2MY8A 3CCVS 1QM9A 5LXYA 2DIVA 1VQ4S 1D9AA 2I38A 5DDPC 2ADCA 2KH9A 2XS2A 2MMYA 1SJFA 3CC7S 5LJ5Y 1U1PA 2FHOB 2CQ2A 2MKKA 1ZZFA 2LXUA 2JX2A 1P1TA 2G1DA 2RVJA 3N9UC 3NMRA 4ERDA 1VQKS 2M9KA 4P6QA 1NU4A 1HA1A 2MKCA 5LJ3Y 1H6KX 1SJ4P 4ED5A 2U2FA 1Q82T 5DDOC 3CCQS 2CQ3A 3LPYA 2G4BA 2MXYA 2MJUA 5LSLA 3FEYB 3CUNA 2M4MA 1ZZNA 3MUMP 3V4MA 4FXWA 1KD1T 1A9NB 2V94A 3H2VE 4Z2XA 3H2UB 2YWKA 2NZ4A 1KQSR 1X4FA 4YB1P 2GO9A 2FC9A 1IQTA 2JVOA 1VQPS 2CQHA 1FNXH 2KM8B 4IOCQ 2VOPA 2JWNA 2RRAA 1VBYA 2BOPA 2DGSA 2RS8A 5DDRC 5DM6Q 1YI2S 4Y00A 3VF0B 2FY1A 1FHTA 1XN9A 2CPZA 2PE8A 2NLWA 1URNA 1SXLA 1FXLA 5GAHU 2MQOA 3UCGA 2KT5A 1VQ9S 3P49B 2DH8A 2O3DA 5IFMA 3CCRS 1HD0A 2N82B 1YHQS 4TLQA 1SJRA 1YTYA 3G4SS 4IOAQ 2DGUA 3EGNA 4UQTA 5IQQA 5JVGQ 2OTJS 3MURP 4UY8T 2YTCA 2AYGA 3G8SA 3CULA 1Q7YT 2N3LA 5LSOA 1WWHA 3JB9k 3UCZP 2MY7A 1JMTA 1CVJA 1X4AA 2MZTA 1X4EA 1X5OA 2M8HA 1U6BA 4F02A 1OIAA 3ZZZA 2RRBA 5H1SV 2DGOA 2ERRA 1DZ5A 3RW6A 3ZZYA 1VQ8S 3VAHA 1DRZA 1H2VZ 4WFNQ 1WHVA 4YOEA 1D8ZA 2CJKA 1JJ2R 2DNZA 3MXHP 1UW4A 2HVZA 2MPUA 4PKDB 3B4MA 3CF5Q 2DO4A 2LKZA 1BY9A 2MQLA 4C4WA 2FC8A 1R8PA 2XNQA 1L3KA 3BO4A 2E44A 1X4GA 1PO6A 4ZKAA 3VAGA 5D78A 3EX7B 1VQMS 2DNMA 2SXLA 2AYMA 2X1BA 2CPHA 1Q81T 2JRSA 3CTRA 1WTBA 4QU7A 2OSQA 1WG4A 1NO8A 3P5TL 5GAEU 2CQ1A 3BO2A 2MKJA 2U1AA 1UP1A 2CQDA 4WCEQ 4M5DB 1X4CA 3VALA 2KU7A 3TYTA 2VONA 1WG1A 2KXNB 2KXFA 1VC5A 2CQPA 3Q2TC 1X5TA 2J0SD 2ZJPQ 3IWNC 2CQCA 5IM0B 5EN1A 3UE2A 1FT8A 3S6EA 3OW2R 2DH7A 2MQNA 2XNRA 3U1MA 1FO1A 2M0GB 2YKAA 4YUDA 2CPEA 2CPXA 1RKJA 5GVQA 4V19X 2LEBA 4F25A 2DGQA 3CMAS 2DO0A 2DHGA 3U1LA 4RU2A 4J5OA 4C0OC 2CPYA 2CPDA 2L9WA 3FEXB 2QEXS 2RT3A 3HHNB 1M5KC 2MQQA 3RW7A 3G71S 4TU9A 2ZJQQ 2N7CA 4W92B 3US5A 4W90B 4WF9Q 3CCUS 2DHAA 1HD1A 1A7GE 2MGZA 2KVIA 1WEYA 1H2UX 2OTLS 2OSRA 3I56S 1S72S 1WEXA 2BZ2A 1M90T 1B7FA 5HL7Q 4CQ1A 3MUTP 1UFWA 2CQ0A 2L08A 3ULHA 5DDQC 5CA5A 5HO4A 2RU3A 2HZCA 3R1LA 2RS2A 3THPA 1YWXA 2KYXA 2HGNA 1OPIA 2X1AA 4CH0S 3NNCA 1VBZA 1U1NA 4QPTA 4OZ1A 4TU8A 4IUFA 3R27A 3UD4P 2MHNA 1QVFR 1YJNS 4C7QA 1K9MT 2DNGA 2OIHA 3S7RA 4WKRA 2EK1A 2F3JA 3NNAA 1QVGR 2F9DA 1W2BR 3G8TA 2JVRA 2MKHA 3P3DA 4QQBA 1O0PA 4LJMA 4F26A 2E5GA 1K73T 2DNKA 3PIPQ 4QU6A 4U67Q 3G6ES 2D3OR 3CCLS 2DITA 2XB2D 2DGTA 5ITHA 2CPFA 1S79A 2EK6A 4BS2A 2ADBA 2UP1A 2WBRA 1WEZA 4PR6A 2LECA 1VQ5S 2MQPA 2KG0A 1P27B 3MI7X 2DGVA 2VODA 3VAJA 3CMES 2DGWA 4WFBQ 4A8XA 4LMZA 1WG5A 2M7SA 2KRBA 3I55S 5CXTA 4LIRA 1KOHA 3CCJS 2DNRA 2XS7A 2MZSA 1WI6A 2M52A 1FJEB 5MLCV 3Q2SC 1WHWA 1DBDA 2CQGA 3MDFA 2HGLA 4EGLA 3BS9A 2LCWA 2CQIA 3G96A 1M5PC 2J76E 2CQBA 3S01A 2CPJA 3CD6S 5BJRA 2MQMA 1JJHA 2J8AA 2MZJA 3B4DA 1JJ4A 3SDEA 1H2TZ 3TP2A 2DIUA 5JVHQ 1U6FA 1K8AT 1KC8T 3DXBA 4CIOA 2HYIB 2YH0A 2LXIA 2K8GA 1X0FA 1N52B
chains in the Genus database with same CATH superfamily
4PQUB 4XK8C 1HBOB 4NXNJ 4CLKA 3HVWA 3LOUA 3AY0A 4FZVA 9RUBA 3KK2A 4X4NA 1PJ7A 5B0BA 3TQ1A 2JNJA 3PTWA 1FD8A 3W5XA 2HNZA 2XS5A 1RT5B 2H65B 4UOHA 3PR5B 4ZHRB 5BXIA 4XPCA 3BH6B 3H5UA 2ZOMA 1TKZB 4DR7J 3C6UB 1U4BA 2JLEA 3PNIA 1WF2A 2DNLA 2J8SA 3LANA 5CYMA 1SV5B 2CFXA 2A2DA 5CYJA 2YWGA 4IO9Q 2GMJA 2VFSA 4EK2A 1JLEA 2Y1RI 1TKXA 1IJEB 3OJUA 3KUHA 3VAKA 1LK5A 2DCLA 2EVZA 2MB0B 2A6OA 1BMQB 4QWCA 1BGXT 3VAFA 4ICLA 1VC6A 1V3RA 4G1PA 3NG8A 3VGUA 1OO0B 3BO3A 4DPYA 2PFDA 5KFEA 3DLLQ 2KT3A 4J9VA 1WF1A 4QWAA 2KM8C 5A2QY 2FDNA 1VFJA 1GTEA 2P8IA 2PD1A 4RWWA 1PBAA 2V9WA 1ZAVA 4ZVFA 2XI2A 3ZXWA 1X5SA 4AL5A 2XWXA 2IPOB 2DYAA 1TL7A 2ROPA 1RTDA 4MIAA 4YR3A 2LVWA 2IDLA 4DMZA 2ZDOA 5D3GA 1SC3B 5LJ5Y 4DV3F 3QAUA 2ZH7A 5DO2A 4K4WA 1IR2A 3N9UC 4NXNF 3Q8YA 3EVOA 2V4JB 5C42A 3D0HE 2XO7A 2GAGC 3MPWA 3T19A 3CUNA 3T5KA 4YFUA 2LQJA 5D0HA 4Y34A 4N76A 3NBPB 1UWAA 2Y9HA 4P2MA 5HP1B 4FDFA 2C3MA 3AB4B 5DQIA 3H8YA 2J6UA 1T3NA 2Y1IA 1FXLA 4WWSA 1NBEB 2EXUA 3MMJA 1D1UA 3UN5A 1SKRA 1CJTA 2ZH4A 3F56A 4IOAQ 1P8GA 2Y0SD 3GLJA 3M2UB 3IO1A 3LAKA 4CLSA 4OYOA 1UETA 2OEMA 4JV1A 3OVSA 1X4AA 5DZ7A 3OBIA 2B8QA 1L3UA 3PG9A 1NK0A 1X9MA 1KRPA 4DR4J 4URGA 2VBZA 1FA0A 5SUHA 1PILA 3QZ8A 3C19A 3L7OA 3HF5A 4K4UA 1MW7A 1R8PA 3CDUA 4KKOA 2M3DA 3EX7B 1GXUA 2AYMA 1H7XA 2BJEA 3DLGA 3NOGA 4GO7X 1VRTA 4F0HA 1WTBA 4DU8A 3W2VB 1UP1A 1MMDA 5GMEA 1XMOJ 4OJHA 2VONA 3TANA 1KLMB 3U1NA 2YY3A 5KT3A 5ETPA 1XEZA 3QGPA 2W7OA 3MFIA 3I87A 4RW4B 3B6BA 3G82B 5LMUJ 3T1HJ 4F4WA 2OELA 2LEBA 1C0TA 3AJ1A 1N56A 5KFXA 3M8QA 3GWCA 2JEIA 1N5QA 2BXJA 2IIHA 1S7IA 3GIIA 4OFZA 4OYAA 3MECB 1MROB 2K1RA 1FJGJ 3TVYA 2R7VA 1X8DA 4RNNA 2E1MC 1NHVA 4DSKA 2FGOA 2YNFA 3ULHA 2R7OA 3OXLA 1S99A 3HDSA 4BHQA 4QYZJ 4PWDA 1GH8A 2YQ1A 1EZZB 1QVFR 1FK9A 2O5DA 1V6HA 1UVIA 4O3OA 4DL0C 2GGPA 2R8HA 3BR8A 1GMWD 3MEEA 5B0EA 3QGGA 4DR4F 2OFGX 3C16A 2HK3A 3BSAA 2NXJA 1ZAXA 2QL7B 4Q45A 3FK4A 2B5JB 3QSYB 1U24A 2E7XA 2BQUA 4ZN1A 3BGFA 1CULA 4HDGA 4NLWA 3P4UB 2CZ4A 2YX1A 4RLEA 3CCJS 5J1NA 1WI6A 2UVVA 2V69A 2B4PA 3K5PA 3BDEA 1VQYA 4NPOA 3LW5C 1XMOF 3TQEA 1UKUA 1LW2B 1U6FA 2HURA 4TXSA 3V6KA 5LM7E 4CIOA 4LF4J 2K8GA 4YY3J 3R5BA 4OJ1A 3T1HF 4D3GA 5LMUF 4X4UA 2LEAA 3C3LA 1BQNA 2E1AA 2BR0A 3S1TA 3VWSA 3FSIA 1VI7A 3GB0A 4NE9C 1WJ9A 3LP0B 4O3QA 3H5YA 3NS5A 2HQIA 3OLAA 5B0GA 5DG7A 3D6FB 1N88A 4HTJA 2C3PA 4Z7YA 5GAGU 3M9NB 4LF8J 4TVAB 4CYUB 4U7UK 5KFUA 3TNVA 1RQ0A 3I31A 2Q6BA 2A10A 2VH7A 3LUYA 3A3NB 1R0AB 3LP2B 4OYPA 2WHOA 2JJ4D 3RYLA 1WC4A 2VG6A 2PT0A 2W2MP 3D3CJ 1HL6A 2GIRA 2D1CA 1WHXA 2QL5B 3R2CJ 3ZZ0A 1HKAA 3BBBA 3D2WA 2YWFA 1DJ0A 1SH2A 3QT7A 1RWOB 4PYDA 4NEZA 3T41A 2HLUA 4OZ0A 1TZ0A 3SQOP 2O67A 2ALYB 3Q8QB 2DIVA 1VQ4S 5CAAA 4ANCA 2A0FB 1HYSB 2VQEJ 1TL1B 2MKKA 1XNRJ 2FVPA 1E6YA 2VASA 3M6XA 5K8NA 2NXEA 1NXIA 3POTA 4LSLB 3HMJG 1SJ4P 1KVJA 1MU2B 3ISZA 4UOFA 3CJ4A 2NYIA 5L1KA 4ZCKA 1S1WB 1FRMA 1OY6A 4NYPA 2BOPA 4LT6A 4ECXA 4O44A 2P6SA 5G0RB 4U7UD 2A1BA 3UQSA 1HNIB 2ZE2B 2RDDA 4DUYJ 1RAEB 3EVMA 1IKYA 3EXCX 2BJ3A 5IQQA 2K7KA 3BPSP 2EWHA 3G8SA 5MAOA 2XYHB 5LSOA 1FI4A 2MLYA 2FVRA 1FERA 2W7PA 3ZZYA 2IM0A 3VAHA 1NJXA 3MR3A 5A0YB 2DEJA 5KFDA 1CJKA 1QAJA 1I1GA 3CJQA 5D8HB 1Y00A 1C2PA 5HSPA 3ZC4A 5HVFA 1Y3JA 2CPHA 4OZ2A 3RB0A 3K58A 2ZBRA 3HK2A 1XJWB 4YP3A 3VQSA 1WG4A 5THWA 2CJAA 2ATCB 1DTTA 4X66F 2VQEF 4WCEQ 1R8CA 2XLIA 1XNRF 3BM7A 2KXNB 2N7YA 1XC9A 4G65A 4EUVA 1VK8A 2ZJPQ 2CQCA 5IM0B 2XM3A 3R5GA 4CTAA 2AGOA 2J9EA 3WDOA 2HRTA 2ZVSA 3N79A 3HHLB 4X2BA 3CO9A 4C8YA 3GJTB 1M5KC 1MG7A 1I94J 2FJVA 1AZSA 1IN0A 3US5A 4ETZA 4RNOA 3KK3B 5IOLA 4OI2A 2V68A 2J9DE 3HXMA 1UFWA 1EKSA 1LWCA 4HACB 4ZVHA 4GC6A 4DUYF 2KYXA 3KKFA 3CJTA 4CH0S 1Q8IA 3O5TB 4ES1A 4PPDA 2C2ZB 4DQIA 4N56A 2A18A 2YNHA 4ZA1A 3BQ1A 4I2QB 2G13A 3SI8A 4QIEA 3PJ9A 3QO9A 2J7UA 4B9VA 2DITA 4HVZA 4DL6A 2P5VA 3QJPA 1A0OB 1NSKL 4CLLA 2CAJA 4K4SA 1X9SA 5K9FA 4IG3B 4I68A 1Q79A 2NZCA 5MLCV 4DL3A 2ZDPA 2XMJA 3MAAA 1ZA2B 3SCIE 2W8LA 1S48A 4K4ZA 2VG5B 1UW9A 3GSDA 3ZZTA 3CD0A 1YJRA 2CJ9A 4ZITA 2OO4A 6FD1A 2I1RA 3ZTOA 2F8EX 2DNHA 1WKKA 1YKWA 4QW8A 5HI7A 2HFSA 4AUKA 3M9MB 4IG0A 4XPEA 1QJHA 4USIA 1Y3KA 2D9PA 3C66A 4I69A 2C2NA 3PM9A 2VHGA 2DNYA 5E3CA 2LQ5A 4EI2A 2DJWA 2E9ZA 2QFJA 3E01A 3TAPA 3GONA 3H20A 3D0GE 4ES2A 2BRKA 2HQCA 1X4HA 2BV3A 1T9TA 2JZ5A 1E6VB 3JSMB 2ROEA 3F41A 2YNIB 4GO5X 1C0UA 2M8DB 2XYGB 1U8SA 1PIEA 1DFDA 1M5OC 5C5JA 3MUVP 5KFFA 2HK2A 1R8HA 3L7PA 2Y8WA 2M2BA 4QIVA 3DM2A 3HHKA 5HANA 4PYAA 4CO4A 4L6V3 3JSBA 3M32A 3I5AA 3LPEA 1AT1B 2ZBCA 1VGYA 4OYXA 2ASLA 4F0MA 5C2CA 1HWUA 3HFKA 1QDUB 5GAGI 2GFFA 2LU1A 5K8MA 5F3TA 4P6QA 2ZEJA 2MLXA 5KTQA 3VQTA 3HPOA 4M5KA 2HKEA 4QWDA 3CCQS 2CQ3A 5DG9A 4OX9J 2KVQE 3ONQA 5KG5A 1N34J 4RBTA 4FXWA 1WC0A 2EBEA 3H2UB 1SC4B 2GO9A 2Q43A 2BW2A 4NCAA 2JLFA 4ZIWA 3NGUA 2RRAA 2CYYA 3FMWA 3VF0B 2PE8A 2UXCJ 2V5HG 5J2QB 2XC9A 3P45B 3DGPB 4LR8A 1F0XA 2DH8A 2O3DA 2G9OA 4DV7F 2CADA 1ZETA 1CC8A 4X62J 3OR2B 2B4OA 5L1JA 1FEHA 2LEPA 4NLSA 1LWFB 4MK8A 4WU2A 4HDHA 4NLOA 4F02A 4C6AA 3PX6A 4DS4A 2OI2A 1JLQB 3NGSA 1JJ2R 5J1EA 3A3PB 2HVZA 1FRHA 4OHXA 5A2QU 2BUNA 2QN6B 5AXMA 1WOPA 3CJ3A 4ZK7M 3RRHA 2ZH2A 4ZLLA 3BBCA 1BLUA 2ZOGA 4M95A 4IFVB 1UWBB 3CD5A 5D78A 3N6LA 2IFXA 2UU9J 4IH6A 1IBLF 5L46A 4UT4A 1WSRA 4I1TA 4RUBA 3TUJC 2V8HA 3SV4A 1VC5A 3Q2TC 1T8EA 4P75A 4YS2A 2GVDB 1JX4A 3ZNJ1 4LBHA 1X31C 2ZKUA 5F8NA 2ZBIA 4OX9F 3OTOJ 1S12A 2QSWA 4PG5A 1N34F 3SBMA 5K8OA 3FEXB 2AV5A 2VPYB 3N0VA 1HBMB 3GJQB 2B4UA 3MCSA 4W90B 4NLUA 4CLWA 3CEDA 4CRJA 1NK7A 4R0EA 1VISA 2IC3A 2UXCF 3NOCA 1RADB 2CQ0A 5HO4A 3N01A 3PFEA 1FE0A 2EG1A 1TL3A 4I0WA 4USKA 3NGRA 4X62F 4IR1A 1VBZA 5AXKA 1RKIA 2OIHA 1UJ6A 2IJRA 2MHEA 2EK1A 2E5LJ 3NNAA 2IRUA 4RW7B 3C6TB 4ZPTR 5RUBA 4UZBA 2KL8A 4NA2A 1OY8A 1RU1A 3DCAA 3OJSA 3ENWA 2HMIA 3JQMA 2EKNA 4M5HA 2NQPA 2ZZTA 3MR6A 3HFZB 2Z56B 2H9ZA 4R25A 4DL5A 5M2UA 2VC1A 1LFWA 3I55S 3SFUA 1VJQA 2FLPA 4RNFA 1RWPB 2MZSA 1EP4B 4URQU 2UU9F 2CQGA 5KFZA 2RILA 1GEHA 4OYMA 2ACMA 4RW9A 5LMNJ 2R8IA 2V8VA 4RNHA 3RUBL 1M5SA 4OI1A 3KHHA 2ZM6J 1FXDA 3DRRB 2G0JA 2D3UA 2LYVA 3UI3A 3OTOF 2MYFA 2RJZA 1X5PA 1WD6A 4G1QA 2KDOA 3DLEA 3MM8B 2AD9A 2BE2A 2V0NA 1SJ3P 3BF4A 4JUZA 4ED6A 2MSSA 3KLHB 3Q8UA 4OZLA 3PYEA 2RQCA 3M8WA 3PW5A 2IRYA 5T7LA 3C14A 4DI6A 4DPOA 3HSJA 1KTVA 3CPWR 2DR5A 4WP8A 5LXRA 2EFVA 4DXLA 4LF9J 4DFJA 1YJWS 4LQ9A 2BJDA 3KG4A 3I0RA 2J7WA 2E5LF 1NUEA 1RK8A 4C3LA 2IJFA 4IFYB 1MLAA 2B56A 2MKSA 4DS5A 2DB1A 2FGCA 5KG4A 3E8OA 1U2CA 2K7JA 2DISA 2V9KA 3GG0A 1JXLA 4I7FB 1JWWA 1RYSA 1NH8A 1XMQJ 3GFHA 3CCES 4FF2A 4V1Ak 3M2VA 3MEDA 3TO8A 2DY1A 1NSPA 3CC2S 1AXQA 3I9V9 2OUGA 1U0HB 4DLEA 3T1YJ 4YQWA 5LMNF 2FJEB 4X4VA 3PJWA 1D9AA 5HLFB 1SJFA 4PAAA 1U1PA 2ZM6F 3KHRA 4C8OA 1YRXA 2H5JB 3TJ9A 1NPPA 1AFIA 3K8WA 1SC1B 1Y10A 3H4BA 2VKRA 1FESA 3OL7A 5CYQB 2I0XA 1QAXA 3MUMP 5KFNA 5L1IA 4J9OA 3OR1B 2BKPA 4L74A 2YKOA 4JV0A 1A9NB 3THVA 4UOGA 4RW8A 4Z2XA 1RT1B 4YB1P 4LF6F 3AD9C 4DR1J 4KY3A 3I4PA 3G2XA 3IN5A 1N5YB 5F8LA 1HW8A 1S1XA 1RWXB 1URNA 3MM9B 3K5LA 3V81B 1EIYB 3Q8PB 3HVTB 4LF9F 4AT1B 1Y9OA 4C98A 3CJ8A 2QL9B 2RUSA 1FKPB 3PRBA 2GQQA 2BX6A 3R7SB 3KLFB 4O23A 1AFJA 3PVXA 1B3TA 1RAGB 5E3AA 4J91A 1CVJA 1Z4UA 1SUQA 2E7VA 1UVLA 2ZH3A 1JLCB 1RTIA 1XMQF 3DRSB 2W9CA 4IQMA 4CM0A 2LKZA 2RKIB 1HLWA 5HVHA 4I56A 2FC8A 2P9CA 1U25A 2FLLA 1OY9A 4LREA 3BQ0A 3I5BA 3HKZD 3T1YF 2OSQA 1HI8A 1LW0B 2AJ0A 5H9EK 2CQDA 3AAWB 4ID8A 4PXDA 1HBNA 3VALA 5IWAF 3KJVA 1T03B 3EICA 2YQ0A 3MMBB 4CT8A 1PCAA 2HG4A 2OFHX 2RMLA 4JI2F 4ZJLA 3I6PA 1TVRB 1ZM4A 3DLKA 4PQUA 2RT3A 2PI5A 1RSCA 1KNZA 4DR1F 3VTIA 1H2UX 1U48A 3R5DA 3I56S 5KFVA 3EZOA 2DKOB 1RT5A 2FYXA 4JI4J 4EO6A 2VV5A 5HVGA 4FKXA 3R1LA 4ZHRA 3A8JA 2WVCA 4RPFA 4XDCA 2HS4A 1YJNS 2Y1JA 3C6UA 4JI6F 1DTQB 2NXNA 1W2BR 1Z2ZA 9ATCB 5A6PA 3NWGA 4ED3A 2QIFA 2D3OR 4P74A 3QAEA 2Z2MA 2AZ1A 4R0JA 1FRJA 2HVIA 1V5VA 2KG0A 2H48B 4NMXA 3PYDA 5KG1A 2KZMA 1CPZA 2LQ9A 1YVFA 2XQCA 1GFWB 1TV6B 1SBRA 4ZP9A 2FLNA 2ZH6A 4YB6A 2J76E 1RGVA 1Q5YA 2XHCA 2CDRB 5KG6A 5KT4A 3D7SB 3M7VA 1M0SA 3PJXA 1NKEA 1TTHB 2IVMA 3LGMA 3CJKB 1YITS 5BYQA 2DXFA 2FB0A 3BN4A 1NJWA 3DN9A 2HSEB 4KGKA 3GCXP 4OMFG 2MGZB 2BE9B 3R5AA 4KHPF 4DV6F 1GK8A 2LQ8A 4RNMA 5DJBA 3D1HA 3GZ7A 1U8WA 3THTA 1N6QB 4JI4F 4AL7A 1HNVA 2BDPA 3ADAC 4K5RA 5IC4B 1YGYA 1U1LA 4B9NA 3NAHA 2YKNA 2JLGA 1VIOA 1KP6A 1UL3A 2GHPA 1ZOTA 1VRUB 3QT8A 2YXLA 4N77A 4WE1B 3OUYA 3TUIC 4DSEA 1FVSA 2OD6A 4BWMA 4IKAA 1RE1B 1CJUA 3LP1B 2B8PA 4OI6A 3M2UA 1HNZF 1XQIA 5A8WB 1VQLS 1U6ZA 4JI7J 3DOMA 5I3UB 3G8QA 2DHSA 3IFEA 3EZ5A 1U26A 4ZVUB 2FZKB 3OHAA 2XWYA 3V5RA 1MMLA 2I38A 2VQFJ 4FVMA 3PXGa 3M8PB 3ZTRA 1IM4A 3NMRA 5F0WA 1FDBA 3W2VA 4QW9A 5LJ3Y 1JXVA 1FD2A 4Z7CA 4B9UA 4WFXA 4J37A 3ZTQA 4WTYA 3GIKA 2AGQA 3SZ2A 3G82A 1X4FA 4B3OB 5I42B 3ILLA 3CIZA 2QRRA 2UZAA 3BKFA 1JLBA 2LU2A 1U7LA 5GAHU 1HWIA 2ZC3A 5C25B 3M4XA 5CD4H 3P49B 1HHTP 3KNGA 3C2PA 4UQTA 2QGFB 2XBPA 3RR8A 4FXDA 4A46A 1CJVA 1NDKA 3KLIA 4PZVA 5F8IA 4MKAA 1JNRB 1YBTA 2EFOA 4JI7F 4X4QA 1FWKA 3CDEA 1BHNA 1K1SA 4LFAJ 1Z2LA 4HR2A 2IBOA 2B5JA 4UY85 1PO6A 1CG2A 4ZVTB 1Q1KA 4WTOB 4P10A 3BKTA 2C3OA 4L72B 2CWKA 4URSA 4M5DB 5EDWA 1X4CA 1GX5A 1LKZA 1F2GA 1EQ0A 4I6AA 3GYGA 3S6EA 2BOAA 1J27A 4M63A 2M0GB 1WC6A 4R5PB 4HYKA 2YWEA 2HNDB 4LF5J 3CMAS 4RU2A 2VFRA 1O51A 1F5CA 1PBUA 2R7XA 2YQ3A 3BGLA 2XHWA 4PWUA 2GC8A 4KHMA 4DF8A 2KVIA 3OLBA 1YDLA 1UTAA 3LP0A 3SV3A 2WAQD 3IMQJ 2L08A 4ZPCA 1C1BA 1S0OA 2YWHA 3TARA 5CABA 4QPTA 2GNKA 5E3PA 1OJ4A 1RAIB 1OYEA 4ILRA 3TEGA 1UVNA 3CJRA 1R0AA 1TELA 4CNZA 4KGXB 4USUA 1RT4B 2CJXB 3R7NB 2PC6A 5IXUA 3MEGB 4BS2A 3Q86A 4LFAF 2WBMA 5KFYA 2NUHA 3LTOA 2PGCA 4JI0J 3CMES 2D3O1 4A8XA 3R5CA 2OMLA 3SQGB 5KFIA 3HFVA 1WHWA 5G4DA 3CCZA 4QR2A 2YKQA 2LCWA 1SPBP 3S01A 3CD6S 3UNGC 4CLPA 4EYHB 4MFBB 1WACA 2FHJA 2COLA 3NL0A 1RBAA 1S6UA 3DXBA 2CJBA 2LXIA 3BGUA 3PDNA 3SSSA 4C8ZA 3LA0A 3L3CA 4HI1A 3CCMS 2YVSA 3Q83A 1GQEA 4LF5F 4ENOA 3P6YC 1TKTB 4WPAA 4E98A 4USMA 2ZJRQ 3AXMA 2HFNA 4LSLA 2NS1B 3I4HX 1MU2A 4ZVQB 2GS8A 4OQJA 4DG1B 1S9FA 1M1KT 3QMQA 1S1WA 2OPRA 1AB8A 4KSEB 2HVDA 3V6DB 3KXDA 3IRWP 4UUXA 1J2VA 2RF2B 3GP9A 2P9GA 3D6TB 2ZNZA 1SIZA 4OHYA 3MEKA 5G0RA 2UVUA 1HNIA 3NCRA 3Q23A 2KHCA 5DQGA 2BQRA 1PSDA 3W9HA 1SL0A 1VQ6S 2D9OA 4YDXA 1XBWA 4DR6J 2WONB 4X4RA 4LUBA 3BYRA 2HAIA 3IM8A 1NCLA 2RQ4A 2WB4A 2XTJP 4JI0F 5IS2A 1VIXA 4X65J 5A0YA 3MAHA 3HI9A 2PMWA 3L9ZA 1IM6A 1BQMA 3MZIA 1YJ7A 5CCLA 1FRLA 3W61A 3D54A 4C3MA 2BJ7A 3MMCA 2BYCA 2XEXA 3H5SA 1T9XA 1Y5NB 3IAM9 5F3ZA 1UVJA 4NL5A 3RU0A 4DV0J 2ZH5A 3HVAA 1RTJB 3J7AN 1TUVA 3OFFA 2QA1A 4AYBD 2BA9A 2FVQA 4HHUA 1TMJA 1QSSA 1VQPS 3HHLA 1IQZA 2WB1D 2BMBA 4H4OB 2YKMB 1VCTA 3QFWA 5CHCB 4EBEA 2CPZA 3RG6A 1F3VA 3ZTSA 2ZITA 3KK3A 1B0VA 1HD0A 3G4SS 2XMWA 1MWZA 4DFPA 5LT5A 3RZAA 4YR0A 1Q7YT 3TZXA 5D4NA 3ZZUA 3UCZP 3DNCA 3FRZA 4UOCA 3FSXA 3GQCA 1JQGA 2JOQA 1OIAA 1YZ7A 2RRBA 2WOMB 4CO2A 4YOEA 2DNZA 1SL1A 1HW9A 4I2QA 5K20B 4ZVSB 3B4MA 3OSPA 4CT9A 4OI4A 4R8UB 4OYZA 4C4WA 4X65F 1L3KA 4M5NA 5KFBA 3TAMB 2KO1A 3EYZA 5HQLA 5EGYA 4ZCIA 2J0WA 1Q81T 2EFPA 3MCMA 3PR4A 1NO8A 2XMAA 2MKJA 5C24B 2BJ9A 1RA6A 2B4VA 3H42A 3KK2B 3RAXA 3H25A 4J9QA 2VG5A 5GAHI 1NJZA 1LNQA 1FDAA 2VD3A 5L9XA 1U09A 3NGTA 1B64A 5B09A 1XR5A 3RGIA 4YN3B 4TQRA 4J5OA 2DY9A 3D28A 2QEXS 4TNOA 2L3MA 2MQQA 4GKJJ 3NS7B 3FBEA 4KBIA 5CYMB 4HT5A 3OTDA 5KG2A 2OLWA 5HQ8A 2ZZMA 3O44A 1QE1A 1XR6A 1TKXB 4J90A 2KJWA 5DDQC 1KVKA 2B7CB 3N6NA 3N28A 1R0CB 1YWXA 3FQLA 3B8HA 2P6TA 2L9DA 1C1CB 1U1NA 3AT1B 2V4RA 4C7QA 4K4TA 2C2KB 4YHHJ 4CLZA 4WKRA 2CVIA 4L76A 3JSMA 1BWEA 3HSGA 3I82A 3W2WA 1FKOA 4RO0A 2MDAA 3CO0P 4F26A 1RU2A 1YRTA 4QU6A 3D9BA 3LGNA 5KFAA 1TUWA 2RU9A 1S79A 2BACA 3CMQA 4WFYA 1L3VA 1IBMF 4I4BA 3ZZOA 1TL7B 4EO8A 3BYPA 1RHMB 5EWGA 4A8SA 2RRNA 5D4PA 5CXTA 5D3GB 4RKUC 2XS7A 3Q2SC 4EBCA 2HGLA 1UFKA 3EJMA 4LRFA 2B6AA 2JHEA 2V2QA 2LP4A 1IBCB 4N7TA 1JJ4A 5C42B 3MCNA 5BR8J 2V6AA 2BJ8A 3DI6A 1RCOB 1KC8T 4IQXA 2AX0A 5B7WA 3MTJA 1RT3A 4LFBJ 2Q79A 5IV3A 3LALA 4PPZA 4ZVGA 1F9FA 2VOOA 5F9LA 3NWRA 1VC0A 2CNKB 1KSPA 1Y4ZB 2I2YA 2QLBB 1OS5A 4IOBA 4OX6A 4ZLPA 3V6HA 4GKJF 3G9CA 4P2SA 3PCOB 3AA9A 2ROGA 4XTTA 2NXUA 3TJAA 4NLVA 2CKWA 6FDRA 3T9NA 3ISND 3R6LB 2X3DA 3H59A 3QRQA 1VQSA 3WX8A 4WJBA 4NXMJ 3LWMA 5ETNA 2FPHX 4YHHF 2RNEA 2N3OA 3CCSS 5J2QA 1RAJA 1I3OB 3BBFA 4OHWA 3OFEA 2R7TA 1C4AA 3RR7A 4DSIA 2G0IA 2G2YA 3AQOA 1FRXA 2I8EA 4KKOB 2DH9A 2V8DA 3UVJA 1JNZB 1LWFA 2KFYA 3K5NA 2NCKL 4O3RA 4IRKA 4HHJA 2ZHOA 1S1UA 1U2FA 3CJ5A 1T02A 4USTA 3KDOA 2RHSB 1JLQA 3TOQA 3MR2A 1W2IA 3SDEB 4M8LA 4YR2A 1IWAA 2JC0A 2O66A 2PMHA 3DOLA 3GSIA 3CCVS 1QM9A 1UWBA 1C0TB 3ENAA 1WDTA 3QATA 2FHOB 3N4WA 3M8QB 2R8JA 3O3LA 3NAIA 2G1DA 3H0PA 1G4CA 3JXOA 5ETLA 3ET6A 3I5CA 2K1RB 4I2PA 3GIRA 1F3FA 3VZIA 4HHHA 3KUEA 7FDRA 4UW2A 2YNFB 4ZCMA 3EDRB 1KD1T 3OPKA 2DRDA 3DXSX 5JJBA 4OZ3A 3A12A 5I3QA 2JEFA 4MKYA 2RS8A 5DDRC 1FHTA 3NCPA 1XN9A 2AJFE 4X4PA 3LF0A 4NXMF 3BGRB 1Y11A 3C16B 4FBUA 3V2UC 1YTYA 1KR4A 3GYNA 5IC6B 1D9FA 4XDDA 1B4SA 4ES3A 1RT6B 5HJYA 4ATNA 2QYCA 3D3BJ 4ECSA 1Q53A 4M5LA 1FWLA 1CULB 1U6BA 3QGIA 1H2VZ 1WHVA 4LRCA 4RW7A 1D8ZA 4DV1J 5E2QA 2VA3A 4O0NA 2CNOB 3QFHA 4ED0A 2OPPA 3GYXB 1S1VB 3QRRA 5F8JA 1BQNB 3P5TL 3DOKA 1Q4RA 3R7BB 2U1AA 1U47A 1EP4A 2R7WA 1X0PA 2RE1A 4PWWA 3E3XA 3TYTA 3TA1A 2F8MA 3PACA 3HHEA 4WKYA 2CDQA 2QX0A 1O6XA 3UPFA 3J7A1 3U1LA 3DRRA 4OJ3A 1FF2A 3AJDA 3FBCA 3G71S 4KIAA 2ZH8A 2XCAA 5H9FJ 4W92B 1RXOB 3QIPA 4DR5F 4WF9Q 3AFGA 1HD1A 3MM8A 2OTLS 1IKWB 4D3HA 5EWEA 1B0PA 4LRDA 2AJ2A 4F3QA 2I5JB 2VG6B 3Q22A 2PI4A 4OHZA 3THPA 5B08A 1K0VA 2GQCA 3VGTA 4IUFA 3GJSB 3QIDA 1K9MT 3OL8A 4FBTA 4ZIVA 4ELTA 2HBYB 4F36A 2IMWP 3KFWX 3W66A 5HROA 4CLFA 3OFGA 5D0GA 1SKUB 4DV1F 4MKVA 2DGTA 1XNQJ 3CGIA 1F5BA 3ISNC 4AL6A 2DGWA 3W65A 4I7FA 2M7SA 4B3RJ 2KRBA 1RT7A 5HJXA 1NB7A 4ECQA 3B78A 1E6YB 4HKQA 5KFLA 3TWZA 2XG8A 5D0RA 2FZCB 2MQMA 2QA4G 1JJHA 3M1VB 3U27A 2OHDA 3I0SA 5DQHA 4DL4A 3UD5A 1U0HA 5BYSA 4RR5A 1U02A 3EVWA 2MEWA 4ZVRB 1J5OB 1M5VC 3SSRA 1W25A 2HHWA 1ZH5A 3MD3A 1S7HA 4J9MA 4A8YA 1H74A 4UZCA 3NMAA 2CPIA 2H5EA 2MTLA 1PAUB 4BBYA 4O44B 1VR6A 2W8KA 2G1HA 2BVZA 3EWGA 1IKYB 7AT1B 3A3OB 3KWMA 1UJ4A 3OR1A 3V4IA 2HQFA 4DUTA 4WFAQ 1RT1A 2EPIA 4V19J 2DGXA 3IA0A 2E9RX 1AROP 4C8LA 1N5YA 3MWBA 5KFCA 4W98A 3GR0A 2QA2A 2KN4A 3R1HA 3I32A 3A8EA 3IP0A 3HVTA 1N0UA 3EPGA 1CJKB 4P2FA 3M6VA 2M70A 1FTRA 3PW4A 4Y28C 3DDIA 1XNQF 1N8RT 3KLFA 4DX6A 2ZH9A 5SZTA 1GMWA 1IXKA 2RUGA 2DT9A 5FD1A 2AEFA 1FJCA 3AOCA 1NMEB 1DTTB 4B3RF 2WVEA 1JLFA 4TY8A 3DDKA 2HGMA 4EU0A 2J9DA 1FDNA 4P71A 2ZUAA 4K2XA 5FDLB 2YKPA 2AHOB 5DDPC 3DFEA 2HHUA 1I5OB 5K5MA 2VDHA 3FFIB 3AJ2A 2JX2A 3KLEA 4ERDA 2M9KA 2JC1A 3UR0A 1Q82T 4ILMA 2MXYA 2MJUA 4Q43A 3VHQA 3ENVA 1UZHA 3MMBA 1N4LA 4C0HA 1AA1B 1UJ5A 2RAQA 3MR7A 2C2RA 2X51A 2RQKA 3H2VE 5M2PA 2JEJA 4NCGA 4J9RA 2FC9A 1TVRA 4NLPA 3VCDA 4ZJQA 1XK8A 4PG7A 1KFSA 4AXIA 3PW0A 1KHWA 1RWNB 2NLWA 2YX4A 5L39A 5B0AA 4WYWA 2HBZB 2R4FA 2QTWA 1RHUB 5HBMA 3EGNA 4A8KA 2AYGA 5KFSA 1N0VC 5E3RA 5HK4A 5ETOA 2HFZA 4KAIA 3L95X 1HMVA 2XZTB 1DRZA 1SQFA 3IM9A 4K5SA 2CJKA 2JFKA 2G2OA 4KHRA 1UW4A 5D4OA 3MAAB 5AE1A 2GCFA 3IR5B 3UDEA 3FNNA 2XNQA 3ELHA 2HHVA 2ATLA 3JQKA 2F63A 1VHIA 2XMVA 4ZKAA 2CZ9A 1KTQA 3G86A 4OYWA 1EETA 2X1BA 1NAQA 1NDCA 1X9WA 4FS1A 4E2FB 1H0HB 4I6YA 4C97A 1TV6A 4IG0B 3G6YA 3OVBA 1NHKL 1G7CB 4PG6A 1F2HA 2BRLA 3UE2A 3IAS9 1LV5A 2MQNA 2UV8A 4C48A 5HMWA 4QOTA 2R7SA 5ADZA 3G87A 3FRYA 2HAFA 2DGQA 3KDNA 2BW7A 3IS9B 4C0OC 2L9WA 8RUCA 2VC0A 3ITHA 3N5BA 1RUSA 5CZXA 2QSFA 4OJGA 4P73A 1CSJA 2W01A 2HHQA 2DRAA 2MGZA 3BSOA 2OSRA 3SFGA 4KQZA 1C0UB 4C11A 3LWLA 2A6MA 3MUTP 1N48A 2AX1A 4FF4A 4ECYA 5CA5A 3MFHA 2V8GA 4C3KA 2Z2ZA 1KN6A 3NNCA 2W9BA 4Y2MA 2LLZA 1D0EA 2WK4A 4ETXA 1O5JA 3DM2B 1M1GA 4KH1B 2MKHA 3H90A 2E5GA 1HNWF 2R2SA 4JI3J 3CCLS 3JS9A 4WE1A 1T3OA 3NXZA 1RTHA 1KFDA 4PR6A 1JB0C 4QR1A 2D3ZA 2J0XA 4LIRA 1R0BG 3MDFA 2W4PA 2HBRB 3P5BP 5I3UA 3G6XA 1H98A 1H2TZ 4KV8A 4B9TA 5K8PA 4PXBA 4X66J 4I67A 1X0FA 3CXCR 4J7CA 3M8ZA 4NLRA 4HT7A 1XIQA 3M8PA 2HWTA 2XO6A 5KFMA 2CA9A 5GMKa 2R2TA 1TP7A 3U02A 3AA8A 2ZHAA 1H38A 2AKWB 4NLXA 3CJ2A 1ULRA 6AT1B 3K59A 1NDLA 1RHQB 2BABA 3LQVA 3QGHA 4O4GA 3AODA 1SL2A 2MKYA 3PX4A 4B3OA 2VBYA 4Y0FA 2DXEA 3SXLA 2V8PA 2DR9A 1KOOA 3VGVA 5I4MA 1O8BA 1U1QA 3WIUA 2GJFA 1R43A 5HN0A 4Y3CA 5J1EB 5KOXA 2FHKA 5C25A 1WF0A 5JMNA 1VQOS 1YLXA 4OI3A 1HHSA 4JI3F 3FVYA 3KOAA 5ETRA 1JLAA 4NWBA 4FPIA 2J0QD 2IM3A 4EZ9A 3HJFA 2HRUA 5KFHA 1VBXA 3P96A 1QSLA 2PDAA 1KLNA 2M88A 1R8BA 3H2LA 4RW6A 4K7QA 3MTKA 4DSFA 3CT9A 1R27B 5LSRA 2DK2A 2Q1LA 1VOMA 4ZP7A 2FJXA 2MY8A 2BANB 1IR1A 3O6QA 1WKJA 2MMYA 4B9LA 2VJUA 4HH0A 3KJFB 4QYRA 5K14B 3Q89A 1TAUA 1NU4A 1HA1A 3QRPA 4M5DA 4DV2F 3CSKA 2U2FA 4MK9A 4GMKA 2NXCA 1OPZA 1N5SA 4CI0B 5A8KB 2IC3B 3V4MA 2EFQA 3EUNA 3G6VA 2HNDA 1NRKA 2EBGA 4I6WA 2Z58B 4DV5J 2ZZNA 2Y3YA 2YX7A 2GQ2A 5CCMA 3N6MA 5DM6Q 3QPIA 4ZS6A 3MM6B 2ZD1A 4ZOSA 2LQBA 1VQ9S 1B7YB 5ETVA 5IFMA 5KAKA 1SJRA 1L3TA 4DL7A 2JEGA 2OPSA 3O8WA 3VVUA 2GMLA 3AH6A 4UY8T 3BH7B 2XLKA 3T5JA 3CULA 3BV8A 5F9NA 2DRBA 1ZM2A 1X5OA 4KRWA 4A8OA 2M8HA 2OMOA 2VB6A 3ZZZA 2DGOA 1S76D 2FLOA 1VQ8S 3FUYA 4ID5B 2DPIA 4F4ZA 1BY9A 2MQ8A 4JI5F 1RT4A 2RB7A 2GJIA 3OQ2A 3MEGA 2VBXA 2X3GA 3PHTA 2XLJA 1IKVB 5E41A 2QMUB 4ECRA 1JKHA 4LF7J 1NH7A 3Q24A 4ECVA 4LSZB 4G1QB 3DLEB 1UA0A 2WSCC 4KPYA 3TAQA 4MFBA 1FO1A 2W9AA 3FCVA 2VG7B 2AJ1A 1REGX 4U95A 4LQ3A 2FY8A 2UUCF 3OD2A 2CPDA 4ZDNA 3DRYA 4ZJOA 1PC4A 2XSJA 1TKTA 4DV5F 3Q8VA 5J2MA 4ZVOB 1YRUA 2AJQA 4RX6A 1V9OA 4PXCA 4HEA9 3GE9A 3R6GB 1XMBA 1ACMB 5J2PA 4XAKA 3FBBA 3MPDA 1PG5B 4LBPA 3D4JA 2W2OP 4LR7A 2RS2A 1SC6A 4WBFA 2HGNA 1K1QA 4E8UA 2W2QP 4F4YA 3R27A 2VL1A 2D41A 2WSFC 4RUAA 2J7KA 3V6DA 1HI0P 4DV7J 1NHUA 4PUOB 4ED1A 1S57A 3T5LA 2JVRA 3M2VB 3MEDB 3C15B 2HQDA 2GVZB 1ROFA 5ITHA 2BM0A 2KFZA 4ED4A 2ADBA 4NOHA 1WEZA 2W2NP 1PJ6A 3PY8A 2DGVA 2VODA 3BZQA 4MYUA 2RH3A 3VAJA 1D9DA 2FUG9 1KOHA 4N5SA 4FYWB 2LFVA 3HP6A 1NDPA 1UCNA 4B08A 5A8RA 3DU6A 4JB8B 4LF7F 4K0KF 3I96A 5HQMA 2PN6A 5JVHQ 3QNWB 1IBLJ 2IDEA 3AD7C 1DQ8A 2Z2LA 4K59A 1RWWB 3W62A 4F8RA 4RW8B 1NSAA 2I6WA 4H4MB 4P7TA 2MZ1A 3M30A 3QQCD 3W3SA 3TUPA 2PEHA 4FYVB 2APOA 2WVDA 2OD4A 5E3QA 1S1XB 3RTVA 1QTMA 3GIJA 3PKMA 4P2XA 4Q2LA 1EX8A 4ED8A 3NLCA 1RTJA 1WELA 1YBUA 2XMUA 2FJAB 1SJQA 1U49A 4ZVEA 4RWXA 1BUXA 2LMIA 3NNHA 2UXDF 3GILA 2F4FA 3EGWB 1VDHA 1SUQB 1X60A 4DX7A 3LO3A 3UCUP 3IGNA 1RTIB 5ETTA 4WYLA 2MKIA 3H4DA 3W7BA 2DCUB 2W9CB 3M6WA 1U1KA 3PIOQ 3DMJB 3M8SA 1Q0NA 4N8OA 2E5IA 5EWFA 5I3PA 1F1BB 2DNPA 4QPXA 1YJ9S 1F6TA 4NLTA 4EFAC 1LXNA 4ELUA 4WP3A 1DARA 5DG8A 4X4OA 2YH1A 4BC7A 2CXEA 4ECWA 1H7WA 5B0FA 1R31A 3BKUA 2CNLB 3KJVB 2HEKA 1S59A 5DETA 2DPJA 1AUDA 4O3NA 3KYLA 1WC1A 3KLGB 1ZBTA 3TAMA 5LXYA 3RAQA 4AQYJ 1CBKA 2KH9A 3DRPA 2D69A 3DLKB 4OYBA 5A76A 3RBXA 1OQ6A 4JP8A 1P1TA 3HLUA 5C24A 4B3TF 1NK8A 2ZVIA 3SCJE 2Z30B 4P52A 4B9SA 3OL9A 3H7HB 1T7PA 4N8NA 3PEJA 3EMTA 4LSNA 2VKZG 4HI2A 4OIXA 1S0NA 3GV7B 2VJVA 2JL9A 1IQTA 2R3VA 4A8WA 3HT3A 4DPUA 3DC2A 3V6JA 4K4XA 4ZPBA 3NP5A 2J6TA 4B3MJ 3GU0A 2FTRA 2ASJA 2HIYA 4OZNA 2BKNA 1LWEA 4TN2A 4Y2IA 4OX8A 1FRIA 4TLQA 1HR0F 3BB5A 3JAMY 2W24A 2OTJS 4OL8A 3VV2B 3GTYX 2C42A 1C1CA 1T94A 1R7IA 2IAJA 1XERA 4MKBA 4IDKA 1QSYA 1QAIA 2QLXA 3GV5B 2ERRA 3RW6A 4WFNQ 3CDAA 1TMMA 5DS7A 4PKDB 3FKBA 3DKDA 1R6VA 1Y5IB 2B7BB 1KHVA 4DBQA 4U8YA 2BKOA 1N5VA 4PG8A 3VR1A 5M2RA 1RT2B 3M2RA 4ECZA 3QYYA 3D0IE 1M1HA 4MK7A 2EFGA 2JRSA 4JI8F 4AQYF 3E51A 2HWHA 2KYZA 2AEJA 2VICA 1J5EJ 3FC9A 1KKHA 4M5IA 3MPYA 3FZBA 2FJDB 5C2GA 1TAQA 2Z0GA 2J0SD 4G1IA 1HBUA 3FEZA 1URRA 1NZAA 1Q7LB 1DQ9A 1RTZA 3J81U 1WOOA 1VBKA 2R2RA 1RKJA 4P72A 4V19X 5GADI 2R7UA 2J6SA 1S6PB 2CPYA 2K06A 1SIWB 1HNVB 4GVBA 2JSXA 2PIIA 2ZUGA 4F3OA 4I64A 3RJMB 3AQPA 2YKNB 2H4WB 4KB7A 1U0SA 1WEYA 2XMMA 4DR7F 4LF6J 4B02A 3W60A 5HL7Q 4NASA 2HLTA 3RB6A 4B3MF 1VYAA 3OUYB 2QMWA 2D7SA 1CJUB 4FYXB 1RP5A 2QG9B 3UD4P 2W1BA 1EJ7L 3MOZA 5D15A 1QVGR 1SB6A 1HQUB 2E66A 2X7IA 2IA0A 3DOMB 1KQKA 1F60B 1Q8BA 5KT5A 1U2RA 5L38A 2KTQA 2DNKA 1SQGA 3G6ES 2YNGA 1TKDA 2VZ9A 2CPFA 3L4BC 4Y65A 4B3SJ 4BC9A 1ZPWX 4KYZA 1UFLA 3WIVA 4IRCA 4WFBQ 2XULA 5IT4A 2OPQA 3M8YA 1CLFA 2M52A 3FBFA 1JIHA 2OEJA 4EGLA 4W4MA 2GHVC 2MZJA 3SDEA 1J5EF 3BJYA 3ENQA 2F7VA 3HSDA 5IWAJ 1Z1ZA 1U1RA 8ATCB 2B0GA 1X4DA 3D66A 2OKQA 1JLBB 3D1QA 4JI2J 1UAWA 2YPZA 1GX6A 1RHRB 2MZQA 5DGAA 2DBBA 4WIIA 4L75A 1GTHA 2EC2A 3EZUA 4OV6A 3GPAA 2A3JA 2C1EB 2XSFA 1CJVB 3KLIB 3HZGA 4RZRA 4LBIA 3MM5B 3MMAA 1JLGB 4KR0B 2QZ8A 3F0NA 4USHA 4BCAA 3BGRA 4U96A 1NK5A 2KG1A 2EW9A 4JI6J 5KOWA 5D77A 3ICLA 3W8PA 2ZHBA 5KFJA 2B51A 3R2DJ 1L5UA 4NA3A 1HPZB 1RT6A 3CDWA 4B3SF 5IT0A 1WHYA 3O2IA 1GXLA 4ECTA 4PEOA 3QLHB 3M8RA 2CVEA 3DDNA 3TR5A 1NLKL 2KT2A 5CH7B 3UWTA 3GMGA 2IY5B 1P6TA 1BD6A 1N33J 3IG1A 1S97A 3MM7A 3UD3P 2IM2A 4LVNP 4LR9A 1S0VA 1FKAF 5F0UA 2VPWB 2DR8A 1S1TA 2XS2A 2IRXA 4WIQA 4KFBB 3T3FA 1S1VA 3CB4A 2FHMA 2GAHC 3CNQP 1AUSL 4DQRA 2VFVA 3RAMA 1T9UA 3J7Z5 1F9HA 3JSRA 3LPYA 3HVRA 1XR7A 3Q8RB 4Y2AA 5D4LA 2VIHA 1C1BB 1HBOA 3GR1A 1FJGF 2FD2A 2VF3A 3B82A 4QIGA 4KHPJ 4DV6J 2RDIA 4YEAA 3TEHB 4K2JA 1DQAA 3SIPB 3IXQA 1RI7A 2E7WA 1SXLA 1IR0A 1T11A 1IKWA 2KT5A 1V3SA 3FQKA 3J81j 1YHQS 2I5JA 2XMTA 2HW3A 2WCXA 2HHSA 1HQEB 2W25A 1TKZA 1JMTA 2VUGA 1HFEL 3KUGA 3E2EA 1SV5A 2ZH1A 5H1SV 1TK5A 1WTFA 2C3YA 4ZLNA 4A8MP 3W63A 3KMSA 1HNZJ 5DRKA 5J2NB 2L48A 3ZNUA 3UDLA 3BN7A 3RB3A 1N33F 1VQMS 1HI1A 2DNMA 4KT0C 4QU7A 3EPIA 4DEZA 2C2EA 1CC7A 4LF4F 2XMKA 4YY3F 2GV1A 2ASYA 4GVLA 4MAKA 1BWVA 3CJ0A 1T0TV 4ITSA 4CNYA 3M1VA 1NZ8A 3HSZA 4U9RA 4U7CA 1TUGB 4Z37A 1YJUA 2W2PP 4YB5A 2HZVA 2IHR1 3D68A 4UUWA 2IYGA 5AXNA 2OPRB 3J80U 1J5OA 3T5HA 1QLNA 5E33A 4DZ6A 2POKA 2V4JA 2AZ3A 1A7GE 4NZ6A 3WC0A 4LF8F 3TI0A 1APSA 2DTJA 5D0EA 4CQ1A 3JYTB 2GIQA 3NGKA 1HWJA 1Q5VA 2CWXA 3NBPA 1MWYA 5HP1A 4BLGA 4RJVA 1IKXB 2F3JA 2F9DA 2QT7A 4ANEA 2DD8S 2WRMA 1MSWD 1RHKB 1WOSA 2CUYA 2XB2D 3OXFA 4Q0BB 1BQMB 2WBRA 5KT2A 4NZ0A 2VU5A 3IR7B 2MQPA 2V63A 3MI7X 3MMCB 4A8QA 4IH5A 5F8GA 1CQNA 3FCHA 1DBDA 1FFGB 2PO4A 4DN9A 3GFZA 1SKSA 1M5HA 1KWMA 3L7UA 4EMDA 2CZVC 2DIUA 3GFXA 2R7RA 1VRQC 1LQ9A 4P9SA 1RA7A 2HWIA 2NR0A 1G1XA 1T9VA 4A48A 5FDLA 2ZBQA 4DSJA 1EB0A 2PSZA 2NUUG 4KGZB 3BDPA 5ETKA 4DOZA 1S4FA 3FFIA 4FNIA 5F8HA 3A1YG 2UVWA 2E5JA 3PHEA 5U47A 1KLMA 1Q86T 4ZN3A 3CWJA 3CDBA 1UPMB 4RW4A 3RBZA 4ZPVR 4J9NA 1YJVA 4RUHA 8AT1B 3CC4S 4DFMA 1H72C 4WK3A 1NPRA 1U45A 2HFUA 4IYQA 1ZM9A 4CLYA 3MECA 1MROA 1YJTA 2HS0A 3EE3A 2IVFB 3FJ2A 2Z57B 3ILJA 4J9UE 4DUZJ 2HFVA 1PYOB 2V34A 5FLXY 2K3KA 3HD1A 1KONA 4U6PA 1S77D 3IGVA 2VA2A 3X1LB 3QT5A 4C9DA 1UZDA 2C2MB 1G3OA 1LEOA 1RWMB 3UW1A 2L41A 3ILOA 1VQNS 4F4KA 2C2DA 4RU9A 1OSCA 3GG1A 1FX2A 1REVB 3FZ2A 1TFYA 1H73A 4NI2B 4KTQA 1NSQA 2JFDA 4CCHA 2H1YA 2AJ4A 3KHLA 1LOUA 3MAQA 5F41A 3HHDA 1S9EB 2LXUA 2RVJA 3KJNB 1Q8KA 2KJVA 1MN9A 3DYAB 1I94F 1LW2A 1QE1B 2M4MA 4F2RA 3BSCA 4M5GA 3H40A 2YWKA 3QJLA 5JUMA 3IS9A 2JVOA 3H5XA 2CQHA 2KM8B 2VOPA 1KS2A 1T05B 4Y00A 1RLDA 1VJWA 3W2WB 2GX8A 1FKOB 2MQOA 2K3IA 3CCRS 2UUBJ 3RRGA 4HL9A 3FGVA 4F67A 3BQ2A 4DUZF 4HH1A 4CYUA 1S4EA 3PFOA 4TY9A 4PXEA 3PW7A 4DQSA 3LP2A 1C4CA 3KG0A 2R9LA 3MHYA 2D74B 1S6QB 4PQAA 2MPUA 4DDFA 2DO4A 2B6AB 2F8HA 3M9OB 3QJJA 5KFGA 4L73A 3ZZPA 3HO1A 1LFPA 3DI6B 2HNYB 4NLDA 5L1LA 1JJCB 2CG8A 3NGDA 3BPDA 1DLOB 2V4QA 3JTOA 2QLFB 2KHDA 1RT3B 5EUHA 4DV4J 3AB2B 4P7VA 1W26A 4H4KA 4F04B 3AD8C 3P8BB 4FS2A 3IWNC 3TA2A 2YKAA 4YUDA 3DLJA 5C7PA 5KG3A 4NZ7A 3DLHA 3PKYA 1HYSA 5IT9Y 1TL1A 1UEKA 1JK9B 3T9ZA 1GXTA 3TZYA 3TVKA 2ZJQQ 5ETSA 4G3IA 3UO0A 2XYPB 3CCUS 2DHAA 4LF2A 2QV6A 3PW2A 4ZP8A 4CWBA 1WEXA 3TRGA 2H54B 3TUZC 2V50A 3KK1B 3RB4A 2XY6A 1VHFA 3JAMU 1OPIA 2UUBF 1NM2A 4OZ1A 4TU8A 2IA6A 1RAHB 2MHNA 3UVJB 3CVKA 3FSYA 3KTQA 3OVAA 3IRXB 4K4VA 3K17A 4WFZA 4N41A 2ZE2A 1S1UB 1FX4A 3TZWA 2EG2A 1O0PA 4F4AA 3KMQA 2HHXA 3T1AA 3A13A 2GA7A 3ETOA 2Q6CA 2UP1A 3DOLB 2H3EB 5AT1B 4DZDA 1K0TA 1ELOA 4QZVB 2EKYA 2AWZA 4O0IA 5AXLA 5IQ6A 2Y0BB 2LDIA 4PCQA 3ZZRA 5KFKA 2CQBA 2ZWOA 4DV4F 2B9YA 3ET6B 3WZ0A 4I2PB 3TP2A 2DEIA 2F1FA 2NYHA 1NKBA 1RAFB 1PYSB 2HYIB 2YH0A 4OYIA 4CLUA 5LOQA 3KHGA 2BANA 1SJ1A 2AIRB 4M5MA 1GMUA 5K14A 1W7WA 3K89A 2EEYA 2QC3A 1YQHA 3TW0A 2KXHA 1PC5A 5IM0A 3K5MA 1RBOB 2QA4S 1S9GB 4LF1A 4WZMA 4X64J 2LDYA 5A8KA 3MD1A 1N36J 1FNOA 3RBEA 1DHMA 2WVFA 4NEYA 2EFNA 4ELVA 1IUJA 4ED7A 3F44A 1NJIT 3TJ8A 1G2EA 4TU7A 2RIJA 5HMXA 3QZ7A 2E5HA 2EC0A 4TYAA 3W64A 3MM6A 3PEHA 3ETMA 4JBCA 4HACA 2CIMA 1IVZA 1RCXB 1GMVA 2DNNA 4IO1A 4DFKA 5L9NA 1DURA 4DCOB 1FXRA 3D6HB 4A4JA 2OPPB 3R3TA 2B3TB 1CS4B 1U1MA 3DOKB 4ID5A 1EKRA 1IBMJ 1OWXA 4DU7A 2C3UA 3C46A 4C8NA 3W5YA 1X7VA 2ZC4A 2PA8D 5FJ4A 1FJ7A 2L9NA 4FXVA 4KO0B 4F3MA 4IG3A 1IKVA 1TR0A 2E1CA 3HKWA 1Q95G 4AD6A 2QJ3A 4CO5A 3PO4A 5E7OB 4ZMMA 5H9EJ 3QIPB 1ITPA 2HNZB 2FVSA 1ICEB 4K8RA 2A2CA 4NYOA 3DU5A 3T6BA 2VG7A 4X64F 2HQ3A 1N36F 1NEEA 3W5ZA 4UTGA 4X4TA 3RBDA 2FY1A 1T9YA 4RUCA 1JLEB 4MJKA 2IJNA 5DLGA 2ZKTA 4CO1A 5HROB 1KQFB 3U7JA 4ICLB 4CZCA 5IZHA 1TK8A 1HWLA 1VK3A 2AF6A 2MY7A 1E6VA 1RISA 2FVCA 2FZGB 4C8KA 1RT7B 2N4DA 4PUOA 2YNIA 1YZ6A 3NCQA 3OHBA 3C15A 2GVZA 4S0MA 3I0SB 5LL6d 3BO4A 4CO0A 2E44A 1RTDB 2AQ4A 2SXLA 4FF3A 3CTRA 2B43A 4IH7A 5KG7A 5GAEU 1D09B 3BO2A 4TLRA 4MTPA 4KGMA 1FTCA 4BWJA 1HARA 2KU7A 2BEFA 4NA1A 3D6MB 2KXFA 2CQPA 5EN1A 2ZOFA 1FT8A 1AYEA 1NB2A 4ZCLA 2CPEA 5GVQA 2DHGA 2JH3A 3V4IB 3KLVA 5ETMA 2XGPA 1YBAA 4H4MA 3RW7A 4TU9A 4L3KA 1ZAWA 4LFCJ 4TYBA 2B9EA 4DN0A 5CD4A 2XGQA 1UPPA 2OH2A 4IR9A 4OX7A 4NRTA 1PAEX 4H4KC 2BZ2A 1CJTB 3QWUA 2HBQB 2PMZD 1ZA1B 1RDRA 1FWPA 2RU3A 4NMLA 1TFWA 1CEZA 4Y6IA 1HHQA 2ACYA 3Q8SB 3W1YC 4A8FA 2YPYA 7FD1A 1WKLA 2E1RA 3O1LA 3DGPA 2W4CA 1V3ZA 1R6YA 2RQMA 4LJMA 1VLYA 1JLFB 3F73A 3MF5A 2O1PA 4TY8B 5JXSA 4ECUA 3OR2A 5HMZA 3DMJA 1UMJA 4NLGA 3OFHA 2LECA 2XCPA 3DLGB 1VRTB 1B0TA 3IC1A 4YMEA 4ALZA 3M05A 4DCJB 4QR0A 1PKUA 3IBWA 3KLEB 2K2PA 2NREA 3G96A 2J8AA 4GRSA 2NSBA 4WZQA 4CM2A 1K8AT 2F40A 4IFVA 3KLGA 1UEUA 3MPVA 5EX0A 2CQ4A 3NY0A 1WDDA 4NCGB 3K57A 2LXFA 2OGUA 1N54B 2DR6A 2ZBPA 1X4BA 3DLBA 1D3WA 3ZTPA 2V67A 2GVDA 4LFCF 4NYZA 3VZHA 3IWLA 4UF4A 5HBMB 2G0CA 4PWDB 2WW8A 4DR5J 1WORA 5GMDA 4E0DA 1FK9B 1GNKA 1HBMA 2IVYA 1HMVB 4DX8H 2GGPB 3MEEB 1FDDA 4JI1J 4L3NA 4KE5A 2QMXA 4DL2A 2DHXA 4PRFA 2EI5A 4F0KA 3UDCA 1PYTA 4KC5A 4MMOA 5B0CA 1P1LA 4EYIB 2OEKA 1EETB 1IJFB 3DRXA 3AHPA 2AU0A 1WUUA 3C6TA 3LGHA 3NS6A 3TA0A 2OJ3A 3CCWA 4FP9A 3FMBA 4ER8A 1KVIA 2WZ1A 1WC5A 4MIBA 2VDIA 1RT2A 2R2UA 2NPIA 3CC7S 5L8RC 1WC3A 1Y7PA 1YG0A 1ZZFA 3ITHB 1ZTWA 2FIUA 1VQKS 3HD2A 2HQGA 1H6KX 1S49A 3R8YA 2Z2YB 4DWIA 1YX2A 1XWLA 2QE5A 4C11B 4KJIA 2BQ3A 4B9MA 4QIWD 4WXWA 4QIFA 1QUVA 2ABYA 2FJWA 3OV7A 2V94A 4DQQA 2NZ4A 3L09A 1HNXJ 1Y0HA 1S10A 1S6PA 3NEKA 4NX9A 2W9BB 1SCJB 1B70B 3WHIA 2JWNA 3AOBA 4J9KA 3SCLE 4LVOP 2VFTA 1BC6A 1S0MA 4ED2A 2F65A 5HATA 1RAOA 3UCGA 3KLHA 3A4TA 1RWUA 2QLWA 4JI1F 4N47A 3ZFVA 3HZEA 2DGUA 5CQGA 5FLXU 3MURP 4FF1A 1RTHB 1WWHA 3HM9A 2MZTA 1X4EA 2F5GA 3HULA 1KEKA 4QBUA 3OTBA 3PV8A 4XIUA 1HQUA 2M5YA 2Y1LB 4A47A 1ZPVA 4OV1A 1T9WA 1DY3A 4IFYA 3IWXA 4LRBA 4TQSA 2KZZA 1FFWB 4KV8B 3TX8A 1X4GA 3K7RA 1YSJA 3VAGA 1TU0B 1UVMA 1S5ZA 1OSDA 1KQGB 2CQ1A 1N5TA 3POTB 2XI3A 4ILLA 2QO3A 1WG1A 1SVDA 1X5TA 4F50A 2C22A 4DCPB 1RLCL 2FJBB 4O4GB 4EWTA 5HLFA 2Z8QA 2NPFA 2O01C 1MNEA 2VPXB 2GHWA 1HNXF 1YK9A 4OZJA 3WC2A 3TVZA 4J9LA 3EGVA 2WW4A 2KB2A 3D5MA 4BDPA 2DR7A 5J1PA 5CYQA 2ILZA 2AP6A 3CD7A 4DPXA 3LH2S 5KFQA 2F4VJ 1EQMA 2HVEA 4YB7A 1JLAB 2DNGA 5EX3A 3A8IA 4JYAJ 3MM9A 3MM5A 1NJYA 3HT0A 3V81A 3R9LA 5GAEI 4QQBA 1JLGA 3PYFA 1P9YA 3MGJA 4RW6B 2OAUA 1SH0A 1HWKA 2H5IB 2EK6A 1FKPA 2ALZA 2Q3PA 1SH3A 2XY7A 4RBUA 3EXYA 4G6VB 5KFWA 2C28A 1P27B 4USWA 3OT9A 1HPZA 1OMSA 3GIMA 2DNRA 4RBVA 1JLCA 3UFCX 3DRSA 3QLHA 3BS9A 5AJ3J 2VQFF 2CPJA 2RKIA 2R7QA 4CTAB 4DPWA 5KFRA 4C0BA 4ZLJA 1K44A 4WP9A 3TX0A 1K47A 1QAYA 3BEGB 2F9JA 4CO3A 2X1FA 5IT9U 1LW0A 5H9FK 1AZSB 3J7YU 1TQLA 2DNQA 4KFBA 1OQ3A 2MZRA 1NNDA 4USJC 1T03A 2MJNA 3J81Y 2ZD1B 3DGVA 5KT7A 1LWCB 2HIQA 2UVRA 3SMZA 4F4XA 2OPSB 2R8KA 2RSQA 3VAIA 3VGSA 4CH1A 4CDIA 2F4VF 2RDJA 3KNAA 2YNHB 4DHVA 2BBEA 3EGZA 3S8SA 2DXDA 3W8GA 3QO9B 2WSEC 1YIJS 2YWWA 1RB0A 4JYAF 1EARA 1UVKA 3UR3C 2P9EA 4GKKJ 1FVQA 4XO0A 3QSIA 1HQEA 3R5JB 4KH0B 5KFOA 1HNWJ 1DTQA 2WVBA 1JKHB 2AYEA 3W9IA 3SYZA 3ZO7A 5T14A 4J9SA 3MOJB 3NKYA 4WU3A 3D1OA 3J7ZT 3VAMA 2J5AA 4IRDA 3HCXA 2KRRA 5AJ3F 2HRYA 4PG4A 5J2NA 1DAXA 1S6OA 4PABA 2B9XA 4FYYB 2ADCA 1AW0A 2CQ2A 1QUPA 2AW0A 2IYIA 2FQQB 2H4YB 4H54A 3B54A 3PRVA 1V5IB 2XSJB 2W4DA 2UXBJ 4DX5A 2MKCA 5J2MB 4ED5A 2HHHJ 4GC7A 2G4BA 2QLJB 5LSLA 1QD1A 4AXJA 5J2PB 3E01B 4U8VA 3PRDA 4K4YA 2I9SA 1RJJA 3CJKA 1KQSR 3DHXA 2HHPA 4WXOA 1RWKB 4CH7A 1FNXH 2ZNYA 4Q2MA 1SI9A 2MLZA 3MCOA 2AMCB 3FDSA 3R97A 4DR2J 3JTPA 3IBCB 5HAOA 4FKYA 2N82B 4DSLA 3IBFB 1N6QA 5B0DA 5JVGQ 3JYTA 3EM1A 2BM1A 3H98A 4DPTA 3BSNA 2N3LA 2PA3A 1NK9A 4GKKF 1DZ5A 4DLGA 1IKXA 3M32B 1VRUA 2QYGA 5A8RB 4FN5A 3WX4A 1RABB 2DHHA 3LP1A 4Q0BA 3HX9A 2E29A 5A8WA 2VPZB 3GJRB 1KDNA 2FHJD 3PO5A 3PZPA 4DJBA 2XZDB 3M30B 1BE4A 3EDQB 2UXBF 4OLPA 2DH7A 4YDDB 3U1MA 4FPRA 2HHHF 2CPXA 2V2VA 5EHHA 2R42A 1I51B 4F25A 4Q8EA 4DV2J 4OLOA 2GIFA 1XTZA 5DGBA 1F9EB 1IBKJ 1PJ5A 1S72S 2CG4A 2UUWA 4MT1A 4DR2F 1B7FA 4QYZK 1BQXA 4TKTA 2UV8G 2HZCA 4Q44A 1UEVA 2ZWPA 1GT8A 2J9CA 1TK0A 5T41A 4Q7AA 5I42A 1RWVB 4EEYA 4USVA 4CLTA 3S7RA 2KKHA 4M94A 3NRBA 1P9QC 3GCWP 3G8TA 4DR6F 3ILIA 3PYGA 3P3DA 2E9TA 1BXNA 2Y8YA 3T6JA 4KGVB 2ZFHA 3UDVA 3PIPQ 1Y5LB 3CCTA 3X3UA 4Q5VA 4HTIA 2ASDA 1FNMA 2VFUA 1NK6A 4DQPA 3AOAA 4NRUA 5A6WA 2AT1B 3RRKA 4MH8A 1ZS6A 3D67A 1RBLA 1WG5A 3DRPB 4JI5J 2ILYA 1FJEB 2HVHA 5F8MA 2HZAA 1M5PC 1B99A 2Z4PA 3BREA 2G2ZA 3B4DA 2UUTA 1L3SA 2IMOA 1Q16B 4NLYA 1NPKA 4LRAA 4DV0F 1REVA 2HS3A 4LSNB 1N52B 4NI2A 1FCAA 2CNNB 3BR9A 2B9WA 4UQGA 1S9EA 1UA1A 4B17A 3HHLD 4FNHA 4DR3J 2YBVA 3KJQB 2UUCJ 3CW2C 3Q0AA 3DYAA 1MWQA 1IBKF 1LWEB 1RZMA 4R5PA 1TL3B 2HPUA 3SCKE 1WI8A 4DF4A 3J80Y 2X1GA 4LIWA 2IAJB 1VS3A 4IDKB 4OI0A 2NSCA 1T05A 3UN2A 2LA6A 2DNOA 5GADU 4J9PA 2HMIB 3VVTA 5DM7Q 3JTNA 4NLQA 2MSTA 3TZZA 5E0OA 3BGOP 3M2RB 3QT6A 2R8GA 1HQ2A 4NCBA 2GJ2A 2AYBA 4KPCA 1VQ7S 4QWBA 3FCWA 5KT6A 2LA4A 4QCLA 4X84A 3K0JA 1U1OA 2P2CB 3J7YI 4ZPWR 2KI2A 3GFYA 1PGZA 3WBZA 3PX0A 1S6QA 4JV5J 3N5FA 4RW9B 2V2ZA 1ZTTA 3QBCA 1HBUB 5HMYA 5E5NA 3SEOA 1T95A 2CJQA 2VBWA 1R3NA 2HNYA 5AE2A 2C2OB 1R89A 4FYDA 1DLOA 3SQGA 4K0KJ 4GVBB 4ZP6A 3CE8A 3HJVA 3OTEA 5ETQA 2BE2B 2RHQB 3OTCA 4ZVPB 5DLFA 5DDOC 3OSNA 5KFTA 3FEYB 1ZZNA 1IWGA 4DR3F 1RAAB 1ZM3A 4F2SA 1H3DA 2QFIA 1ZYQA 3K2YA 4OHVA 5T7LB 3C14B 3DHWC 1TL4A 2W7AA 4IOCQ 1VBYA 2GZOA 2UUAJ 2DGSA 1EAYC 2PFFB 1YI2S 1LXJA 4EBDA 1QY7A 2HFOA 3I0RB 1RACB 1FFSB 1WNEA 4AE5A 2UXDJ 1NK4A 3KK1A 3AXKA 3UN3A 2YNGB 4DG1A 1EHWA 1SQEA 2YTCA 5BYRA 2JDJA 3JB9k 3OXGA 1LK7A 3I9ZA 5KFPA 1FEEA 2RF2A 3LAMA 2RD5C 2OPQB 4Y2KA 4X4SA 2E1PA 2GMHA 3IRXA 3MXHP 3CF5Q 4HLBA 1Q78A 3UNYA 3IR6B 2WTFA 4O3SA 2MQLA 2PEBA 4JV5F 1OYDA 2IBKA 1Q8LA 3QWPA 2WONA 3CJSA 5CZVA 2HHTA 5BR8F 4JOUA 4RL1A 1RYRA 1R8AA 3KG1A 5D6GA 4K50A 1FE4A 4LFBF 4OZ5A 4ZPDA 3C8YA 2OP5A 3OL6A 1N32J 2XY5A 3OW2R 2XNRA 2V2KA 1JXEA 2DVIA 4Y2CA 3JQJA 4ZPAA 3MR5A 1D8YA 2CRLA 5AE3A 2GO8A 1GAOA 2DO0A 4FVCA 4F7VA 4B3TJ 1RHJB 5KG0A 2Q66A 4MIWA 3K8VA 3HHNB 3GV8B 2N7CA 3SSQA 1A6LA 2IM1A 1NKCA 3A8KA 2BE7D 2AEMA 3MMAB 2GW8A 2UUAF 3K5OA 1M90T 1F5AA 4C8MA 4CP5A 1SKWA 3JSYA 3W9JA 1S9GA 1TL5A 2XZWA 2X1AA 1I6JA 2N4CA 4JV2A 1WSVA 1CQMA 4H4OA 1QTNB 2YKMA 4EZ6A 2CJYB 4WK1A 1HR0J 2AGPA 5FIIA 3HHLC 2BJ1A 1HIYA 1G6BA 1K73T 3WQPA 4U67Q 3IG1B 3M6UA 3MM7B 4QWEA 4ANDA 3MPUB 1LWXA 4AFFA 1VQ5S 4QJVA 5DZ6A 4LMZA 1S1TB 2WOMA 4C2MA 2KFNA 1VMBA 4M5JA 1KBRA 1CS4A 4MYTA 1HBNB 4M1KA 4O3PA 2CQIA 5IV4A 4R8UA 3CIMA 5BJRA 4Q8FA 1MN7A 1MMNA 4JI8J 1N32F 1FRKA 4KO0A 4DV3J 2H51B 4O4RA 1VLOA
chains in the Genus database with same CATH topology
3CXCR 4PQUB 4XK8C 2BANA 2IVMA 1HBOB 3LGMA 3CJKB 1YITS 3HVWA 4NLRA 1SJ1A 4HT7A 5BYQA 3LOUA 3AY0A 2HWTA 3M8PA 2FB0A 3BN4A 5KFMA 5GMKa 1NJWA 3DN9A 4FZVA 5K14A 4KGKA 2R2TA 1TP7A 3U02A 3KK2A 4OMFG 4X4NA 5B0BA 3TQ1A 2MGZB 3AA8A 1FD8A 2ZHAA 3R5AA 1H38A 4KHPF 4DV6F 1YQHA 2HNZA 3TW0A 2KXHA 1PC5A 5IM0A 2XS5A 1RT5B 4RNMA 3K5MA 4NLXA 3CJ2A 2QA4S 3PR5B 1ULRA 5DJBA 1S9GB 3D1HA 3K59A 3GZ7A 4WZMA 4ZHRB 3THTA 2BABA 2LDYA 5A8KA 1N6QB 3LQVA 3MD1A 3QGHA 4O4GA 1FNOA 4JI4F 4AL7A 1SL2A 3RBEA 1HNVA 2BDPA 1DHMA 4XPCA 3PX4A 4K5RA 2EFNA 2VBYA 4Y0FA 4B3OA 1YGYA 3H5UA 3SXLA 1U1LA 4ELVA 1IUJA 4ED7A 2ZOMA 1TKZB 2DR9A 3C6UB 3F44A 1NJIT 1U4BA 1KOOA 2JLEA 1WF2A 3PNIA 2DNLA 1G2EA 3LANA 2RIJA 5CYMA 5HMXA 5I4MA 4TU7A 1O8BA 4B9NA 1SV5B 2CFXA 2A2DA 3NAHA 5CYJA 3QZ7A 2YWGA 4IO9Q 2YKNA 2E5HA 1U1QA 2JLGA 2GMJA 1VIOA 2VFSA 2EC0A 1R43A 1UL3A 1JLEA 2GHPA 2Y1RI 1TKXA 4Y3CA 1IJEB 5HN0A 5J1EB 3OJUA 4TYAA 1ZOTA 3MM6A 5KOXA 1VRUB 3VAKA 1LK5A 3PEHA 2FHKA 5C25A 4JBCA 2DCLA 1WF0A 4N77A 4WE1B 2EVZA 3OUYA 2CIMA 1VQOS 2MB0B 3TUIC 4QWCA 1BGXT 3VAFA 4DSEA 2DNNA 4ICLA 4OI3A 1VC6A 1FVSA 2OD6A 1V3RA 1HHSA 4IKAA 4IO1A 4BWMA 4JI3F 3FVYA 4G1PA 3NG8A 4DFKA 5L9NA 3KOAA 1DURA 3LP1B 1OO0B 4OI6A 3BO3A 1JLAA 3M2UA 1FXRA 1HNZF 5A8WB 1VQLS 4NWBA 1U6ZA 4A4JA 2J0QD 2IM3A 2OPPB 3R3TA 5KFEA 3DLLQ 2B3TB 2KT3A 1U1MA 4EZ9A 3HJFA 2HRUA 5KFHA 1VBXA 3DOMA 3P96A 3DOKB 1WF1A 4QWAA 2KM8C 1QSLA 2PDAA 5I3UB 3G8QA 4ID5A 5A2QY 1KLNA 2DHSA 1VFJA 2FDNA 1OWXA 2M88A 1R8BA 1GTEA 3H2LA 4RW6A 4RWWA 2PD1A 2C3UA 3C46A 4C8NA 3IFEA 2V9WA 3EZ5A 1X7VA 2ZC4A 1U26A 3MTKA 4DSFA 3CT9A 1R27B 5LSRA 2DK2A 2Q1LA 1VOMA 1ZAVA 3OHAA 4ZVFA 2PA8D 2XI2A 5FJ4A 1X5SA 2L9NA 2XWYA 4FXVA 2XWXA 4KO0B 4ZP7A 2FJXA 3V5RA 4AL5A 1MMLA 2MY8A 2ROPA 1RTDA 4F3MA 2BANB 4MIAA 3O6QA 1IKVA 4IG3A 4YR3A 1TR0A 2I38A 2LVWA 3HKWA 4DMZA 2E1CA 2MMYA 4B9LA 2ZDOA 5D3GA 4FVMA 3PXGa 3M8PB 5LJ5Y 4DV3F 4HH0A 3QAUA 4QYRA 5K14B 2ZH7A 4CO5A 5DO2A 1IM4A 3PO4A 5E7OB 4K4WA 3NMRA 3N9UC 5F0WA 4ZMMA 4NXNF 1FDBA 3W2VA 4QW9A 5H9EJ 3QIPB 1TAUA 2HNZB 2FVSA 1NU4A 1HA1A 2V4JB 5LJ3Y 4M5DA 4DV2F 3CSKA 2U2FA 4MK9A 3D0HE 4GMKA 5C42A 2XO7A 1OPZA 1FD2A 3MPWA 4B9UA 3T19A 4WFXA 4J37A 3CUNA 2A2CA 4YFUA 4WTYA 1N5SA 2LQJA 3GIKA 3T5KA 2AGQA 4NYOA 4CI0B 5A8KB 2IC3B 3SZ2A 3DU5A 3V4MA 3T6BA 2EFQA 2VG7A 4Y34A 3EUNA 3G6VA 1X4FA 2HNDA 4N76A 1NRKA 4B3OB 3NBPB 2EBGA 4I6WA 5I42B 4X64F 3CIZA 5HP1B 2ZZNA 2HQ3A 1N36F 1NEEA 2YX7A 2GQ2A 2QRRA 5CCMA 2UZAA 1JLBA 2LU2A 3N6MA 5DM6Q 4X4TA 2C3MA 3QPIA 3RBDA 2FY1A 3AB4B 4ZS6A 5DQIA 4RUCA 1JLEB 1U7LA 4MJKA 3H8YA 2J6UA 1T3NA 2IJNA 5DLGA 2Y1IA 2ZKTA 1FXLA 4CO1A 5GAHU 3MM6B 2ZD1A 4ZOSA 1HWIA 2LQBA 2ZC3A 5C25B 3M4XA 5HROB 3MMJA 5CD4H 1HHTP 1D1UA 1VQ9S 1KQFB 5IFMA 3P49B 3U7JA 1SKRA 5KAKA 1SJRA 4ICLB 2ZH4A 4DL7A 1L3TA 2JEGA 3KNGA 3C2PA 3F56A 4IOAQ 2OPSA 1P8GA 3O8WA 4UQTA 2Y0SD 4CZCA 2GMLA 3AH6A 2XBPA 4UY8T 5IZHA 3RR8A 2XLKA 3T5JA 1HWLA 3M2UB 1TK8A 1VK3A 3IO1A 3LAKA 3CULA 4FXDA 4A46A 1UETA 2AF6A 2MY7A 5F9NA 4JV1A 3OVSA 3KLIA 2DRBA 1X4AA 1E6VA 1ZM2A 1RISA 3OBIA 5F8IA 1X5OA 4KRWA 4A8OA 2M8HA 1L3UA 2OMOA 2FVCA 2VB6A 4MKAA 3ZZZA 1X9MA 1NK0A 1JNRB 2DGOA 1KRPA 1S76D 2FLOA 4URGA 1VQ8S 2EFOA 4C8KA 2VBZA 1RT7B 2N4DA 4PUOA 2YNIA 4ID5B 1FA0A 5SUHA 1PILA 4JI7F 3QZ8A 3NCQA 4X4QA 3CDEA 2DPIA 4F4ZA 3OHBA 1BY9A 1K1SA 3L7OA 3HF5A 1Z2LA 4K4UA 1MW7A 4JI5F 3T1HF 1RT4A 2RB7A 1R8PA 2GJIA 3OQ2A 3I0SB 5LL6d 3BO4A 3CDUA 4CO0A 2IBOA 2E44A 4KKOA 2B5JA 1RTDB 2AQ4A 3MEGA 2VBXA 2X3GA 4UY85 1PO6A 2XLJA 1IKVB 1CG2A 2M3DA 5E41A 3EX7B 1GXUA 2SXLA 2AYMA 4FF3A 1H7XA 4ECRA 2BJEA 3DLGA 1JKHA 3CTRA 1Q1KA 1VRTA 2B43A 4GO7X 1WTBA 4IH7A 5KG7A 5GAEU 3BO2A 4TLRA 4MTPA 1NH7A 4KGMA 3W2VB 1FTCA 1MMDA 1UP1A 4BWJA 2C3OA 4L72B 3Q24A 4ECVA 4URSA 4M5DB 4OJHA 1X4CA 5EDWA 4G1QB 1HARA 2KU7A 3DLEB 1GX5A 1UA0A 1LKZA 1F2GA 2VONA 2WSCC 4I6AA 3TANA 1KLMB 4NA1A 3U1NA 2YY3A 5KT3A 2KXFA 2CQPA 5EN1A 2ZOFA 1XEZA 3QGPA 1FT8A 4ZCLA 3S6EA 2W7OA 3MFIA 4KPYA 3I87A 4RW4B 3TAQA 4M63A 1FO1A 2M0GB 4MFBA 2W9AA 2CPEA 4R5PB 2VG7B 5GVQA 4F4WA 2AJ1A 2LEBA 4HYKA 4LQ3A 2YWEA 2HNDB 1C0TA 3CMAS 2DHGA 2UUCF 2JH3A 3AJ1A 4RU2A 1N56A 5KFXA 2VFRA 3V4IB 1O51A 3KLVA 2CPDA 1F5CA 2XGPA 4ZDNA 1YBAA 4H4MA 3M8QA 2R7XA 2YQ3A 3DRYA 3BGLA 1PC4A 3GWCA 3RW7A 2JEIA 1N5QA 2XHWA 4TU9A 4PWUA 2XSJA 1ZAWA 2BXJA 2GC8A 3GIIA 4TYBA 4KHMA 1TKTA 4OFZA 4DV5F 5J2MA 4DF8A 3MECB 4DN0A 2XGQA 1MROB 4IR9A 2K1RA 2KVIA 2OH2A 1YRUA 2AJQA 4OX7A 4RX6A 3OLBA 1V9OA 4PXCA 4HEA9 3GE9A 3LP0A 1XMBA 4NRTA 3TVYA 4H4KC 5J2PA 2BZ2A 2R7VA 1X8DA 4XAKA 3SV3A 3QWUA 4RNNA 2E1MC 2PMZD 1NHVA 2WAQD 4DSKA 2FGOA 2YNFA 1RDRA 2L08A 3ULHA 4ZPCA 1C1BA 2RU3A 1S0OA 2YWHA 2RS2A 2R7OA 1SC6A 3OXLA 2HGNA 1S99A 3HDSA 1K1QA 4BHQA 4NMLA 4QYZJ 3TARA 4E8UA 4PWDA 4QPTA 1TFWA