2BZ2A

Solution structure of nelf e rrm
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
79
Chain Sequence
b'APRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEGATIVE ELONGATION FACTOR E
publication title Structural studies on the RNA-recognition motif of NELF E, a cellular negative transcription elongation factor involved in the regulation of HIV transcription.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 11
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bz2A00
1X5PA 1OWXA 2LQ5A 3UD4P 5GMKa 3CC7S 2J0SD 2CPZA 1WHXA 3IWNC 2MZJA 2MGZB 2U2FA 2HVZA 2WBRA 3MOJB 1RKJA 3RW7A 1U6BA 1VQ5S 2KXHA 2RU3A 2E5JA 2MKSA 2AD9A 4QU7A 5FJ4A 3CCQS 2LXIA 2K3KA 3SMZA 1VC6A 1VQ8S 4QQBA 4F25A 2YWKA 5D77A 2OTLS 2KRBA 3UCGA 5IM0A 3PIOQ 2MPUA 3Q2TC 1R8HA 2RRAA 2E5GA 2CPDA 3D2WA 2DNYA 2KHCA 5DM6Q 2KG0A 2MQOA 4IO9Q 2LEBA 1Q86T 1WF1A 3U1LA 3G96A 2LA4A 3CCJS 3B4DA 3US5A 1OIAA 2KFYA 4ZKAA 1NU4A 2MSSA 2AYBA 2BOPA 3VALA 5HO4A 2L08A 1NO8A 3HHNB 2MQPA 2FY1A 1OPIA 2NLWA 2KU7A 5IQQA 4F02A 3S01A 1ZZFA 2MZTA 1NJIT 2YH0A 1XN9A 4A8XA 3FEYB 2YKAA 4W92B 4CIOA 2CQGA 1FJ7A 2X1BA 2MMYA 3THPA 1U2FA 1DHMA 4V19X 3EX7B 2EVZA 1ZZNA 3K0JA 2CQ4A 1DBDA 2KVIA 5DDQC 2DGSA 2DHSA 3CCES 2MJUA 1BY9A 1WHVA 4LIRA 5CYJA 1WI6A 2DNQA 3R1HA 2DGVA 1JJ4A 1X4FA 2XSFA 2L41A 2CQ2A 2KH9A 1L3KA 4TU8A 2RUGA 3P49B 4UQTA 2FHOB 4OZ1A 2CQCA 3UWTA 3ZZYA 4QPTA 3IRWP 3CULA 2F9JA 4FXWA 1KC8T 1X4HA 4TU7A 3G9CA 2I38A 2YTCA 1S72S 1YHQS 1K9MT 4C4WA 3BEGB 5EN1A 3G71S 5JVGQ 3G6ES 1KQSR 2DIVA 4WIIA 3ZZZA 3VAJA 5IM0B 1X5SA 3JB9k 2RQCA 2HYIB 1A7GE 1JMTA 2DNMA 4FXVA 3RW6A 4RU2A 1VQKS 3VAKA 1G2EA 1X4EA 4PRFA 3TP2A 2GHPA 5DDRC 2DNGA 1VC0A 3CXCR 2CPJA 2OTJS 3UE2A 4OZ0A 2JVRA 2G1DA 2RT3A 4UY8T 1VQLS 2XS2A 2DGOA 2DO0A 4F26A 2N7CA 2KM8C 2O3DA 2DNNA 4YB1P 2XNQA 1M5KC 2M88A 2ERRA 1X4GA 2CPYA 3MD1A 1WHYA 1VQ6S 2KRRA 2M8HA 2RNEA 2OJ3A 2KYXA 4U67Q 4ERDA 1H2UX 1YJWS 5JVHQ 3DXBA 1KOHA 3P5TL 3H2VE 4PKDB 3MD3A 2MZSA 2AYMA 2DNOA 3BS9A 3UCUP 1VQ7S 2CPIA 1U6FA 1VBXA 1HL6A 2HGLA 2SXLA 1X5OA 2D9PA 1JJ2R 2XS5A 2YH1A 3SDEB 4Y00A 1X4BA 2VONA 2I2YA 2VOPA 1WG5A 2MJNA 2MKJA 1IQTA 1P27B 2CQHA 5BJRA 3EGZA 1X4DA 1VQ9S 2KT5A 2B0GA 2XNRA 4Z2XA 4CQ1A 2JVOA 1X4CA 2DGWA 1WG4A 3J7YU 3CF5Q 2LECA 2PE8A 2EK6A 1SXLA 2DGQA 2OSQA 5CXTA 1DZ5A 1UFWA 2MQNA 5CA5A 5ITHA 2LEAA 2N3OA 2ZJQQ 1VC5A 4ED5A 2MKCA 5LXYA 5GADU 4CH1A 1H2VZ 3VAIA 1D9AA 1SJ4P 1FT8A 1WWHA 1QVFR 2MHNA 2DGXA 2RRBA 2MGZA 4Y0FA 1AUDA 2MZQA 2ADBA 1YITS 1M5PC 1A9NB 3UCZP 2D9OA 3CMES 2JX2A 1Q81T 4LMZA 2DB1A 2M0GB 1Q7YT 1UW4A 1URNA 2G4BA 2QFJA 2DNZA 3NS5A 2HZCA 5LJ3Y 4P6QA 2KI2A 5HL7Q 2DO4A 1SJ3P 5GAGU 5DDPC 3DLLQ 1VBYA 2E44A 2RS8A 2A3JA 3TYTA 2LYVA 2DHGA 3BO4A 3MUTP 2QEXS 3G4SS 5IFMA 1S79A 2FC8A 2N3LA 1B7FA 1X5TA 1HD1A 3BO2A 2DGUA 4IUFA 1Q82T 1D8ZA 2EK1A 1WI8A 3CCRS 1UP1A 2RQ4A 1WEYA 5DM7Q 1U1RA 1QVGR 2LCWA 5LSLA 5H1SV 3NS6A 2Q79A 3S7RA 3CUNA 2MY7A 2VOOA 4C0OC 2MQQA 1M1KT 1FXLA 3G8SA 1U1QA 1YWXA 1U1LA 2FC9A 2J0QD 1HA1A 2JRSA 5GAEU 2DIUA 2KXNB 1VQ4S 2AYEA 3THTA 1WHWA 1O0PA 4LJMA 1VQOS 1UAWA 2CPEA 2M52A 4EGLA 1FO1A 2DH9A 2CQDA 3MUMP 2DITA 4C7QA 3G8TA 1DRZA 1RK8A 3I55S 3MURP 2CQ1A 2J76E 1QM9A 3MI7X 3UD3P 1FJCA 2OSRA 1KD1T 2AYGA 2CQIA 2LXUA 1YTYA 4IOCQ 4WF9Q 1HD0A 2DNLA 2MQLA 1WELA 4WFNQ 4PR6A 2LKZA 1SJQA 3S6EA 5DETA 1X4AA 4CH0S 2U1AA 3TO8A 4J5OA 4BS2A 3LQVA 1X0FA 2BZ2A 3J7ZT 4WKRA 2OIHA 2MB0B 3EGNA 3VAHA 1FJEB 3MUVP 3VAFA 1SJFA 2JWNA 2DNRA 2DH8A 3CTRA 1K73T 3NNAA 2CQ0A 2MZRA 2V94A 3CC4S 3CCSS 1N8RT 1M90T 1R8PA 1WEZA 4WFAQ 2CPHA 2MKKA 2CQBA 2MSTA 2D3OR 3CD6S 2DNPA 1PO6A 2M2BA 2KXFA 2CPFA 3PIPQ 3BO3A 5LXRA 1JJHA 2ZJPQ 1YIJS 2M7SA 3P6YC 1H2TZ 2DHXA 3R27A 1WG1A 3N9UC 3L3CA 2HGMA 1YJNS 2J8AA 3SXLA 3VF0B 3ULHA 4TLQA 2M70A 2NZ4A 2KG1A 2LA6A 1FNXH 2X1AA 3VAMA 2VODA 4TU9A 2QA4S 3Q2SC 3FEXB 5GVQA 3CCLS 1P1TA 3I56S 2XB2D 2RS2A 3VAGA 3CCVS 5LSOA 5MLCV 2XS7A 4YOEA 1ZH5A 2X1GA 1U1NA 3CMAS 2CQPA 1OO0B 2DH7A 1F9FA 3H2UB 2M4MA 3NMRA 2DGTA 2G0CA 1VQMS 2CQ3A 1H6KX 1SJRA 1M5VC 2L9WA 3OW2R 3CC2S 2X1FA 3B4MA 1K8AT 1U1MA 2KM8B 3SDEA 1VBZA 1YI2S 2F9DA 2K8GA 1VQPS 1KOOA 1FHTA 1N54B 4QU6A 2GO9A 1M5OC 2DISA 5GAHU 1WEXA 2ADCA 3S8SA 2MKHA 2N82B 2PEHA 4YUDA 2MQMA 3CCUS 3CCMS 3NNCA 2KN4A 4IOAQ 3NNHA 1N52B 2RVJA 3R1LA 2E5HA 2FPHX 5D78A 2UP1A 4W90B 5DDOC 2F3JA 2DHAA 2E5IA 1VQNS 3CPWR 2DNHA 2HGNA 1PGZA 3MDFA 1U1PA 2LMIA 1W2BR 2DNKA 2MXYA 1WF2A 2MYFA 2CPXA 4M5DB 3LPYA 4WCEQ 1N88A 1WF0A 2CJKA 3MXHP 5LJ5Y 1U1KA 2M8DB 1U1OA 1WTBA 1CVJA 2MY8A 3HI9A 3P3DA 2ZJRQ 1YJ9S 4WFBQ 2DK2A 3V4MA 2MZ1A 3U1MA 2MKIA 2M9KA
chains in the Genus database with same CATH superfamily
1JXVA 3G8QA 3FSXA 1VQ5S 2RU3A 1D3WA 2QTWA 3DRPA 3UN2A 4ECQA 2WCXA 3ILOA 3PRBA 4J9RA 3NGUA 1T05A 3K7RA 3KK1A 4U8YA 2JLFA 3POTB 1C4AA 3IWXA 3D2WA 1QUVA 4IRDA 2YNGA 5IWAF 3CD7A 1FKPA 5C24A 3HXMA 3CD0A 1FEEA 4KGMA 1KLNA 4HEA9 4LUBA 4RW6A 3MGJA 4F4KA 1F0XA 4X65F 4I64A 2RQKA 2PT0A 2YH0A 4TY9A 2UXCJ 2CJBA 1YRTA 2CQ4A 3LPEA 3MEDB 2YKMA 3D6MB 2MJUA 1FVSA 1SKSA 3EZ5A 4LIRA 4ANDA 2EKNA 2GFFA 3BGOP 1L3SA 2HLUA 1RT4A 5DRKA 3FQKA 3N0VA 1M5HA 3I31A 3ZZYA 3QT5A 3J80U 3O2IA 2HZAA 1RCXB 1T3OA 4ED3A 4DPXA 4QWDA 1KR4A 4LR7A 2AHOB 1U49A 3UO0A 1MN9A 2CNLB 3VAJA 2YKNA 3KDNA 5A8RA 1GMWD 3QQCD 3U27A 2PMWA 3HDSA 4X4QA 1X4EA 2DCLA 2FJEB 2ZD1A 1Q8LA 2VC1A 2BM0A 5JUMA 1S0MA 4R25A 2W9BB 1FTRA 4KIAA 2WW4A 2BKOA 4C6AA 5EWGA 1RAFB 1RWVB 2CPYA 2KFZA 3TJ8A 5EGYA 3KKFA 3NGRA 4P9SA 4IH6A 4LFAF 5B0EA 5JVHQ 2OKQA 1OYDA 4N8NA 1RTHA 1WC3A 2SXLA 2VQFJ 4OYMA 5DO2A 2H51B 4FNHA 2I2YA 1UEUA 4MK8A 4ZVTB 1WG4A 2O66A 4I56A 1REVA 1TK5A 3A8KA 1UVJA 1MROA 3O5TB 4GMKA 2BE2B 3E8OA 5D15A 5LXYA 4I6YA 1GX6A 1PYSB 2DXFA 3SQOP 4LMZA 3RAQA 3KLHB 1URNA 4FKXA 3D3CJ 1NCLA 2HZCA 2W24A 1RAOA 4A8QA 4HI1A 2YKPA 4KRWA 1IKWA 2IBKA 3G6YA 1HBUA 2X7IA 1N56A 3Q8VA 4C3LA 2EK1A 2B9WA 1UP1A 4DR3F 3CJ2A 1H0HB 3D9BA 4DUTA 3NS6A 4B3MF 3CUNA 3G8SA 1XEZA 2DEIA 5L1KA 2FHKA 1VQOS 1HNVB 3H5SA 3R7SB 2CQDA 2EBEA 2YNHB 1T7PA 4DSLA 1RK8A 3I55S 4WXOA 2J76E 1S4EA 1FJCA 3OR2B 3TAQA 2DNLA 2BJ8A 5KFZA 1XQIA 1CC8A 4WZQA 1RI7A 1GEHA 5FDLA 4BLGA 1Q53A 2WOMB 3ZTQA 3ZZUA 4ZVRB 3C3LA 4CLUA 2B5JA 2KT3A 1R8PA 1RB0A 3ZTSA 4M5DA 2EC2A 2NZCA 2IBOA 2YNIA 5DJBA 2GVZB 3PYFA 2KG1A 1IBMF 3OTOJ 2GCFA 4FYVB 4DSEA 4TU9A 1S1TA 5B09A 1P1LA 2Y8WA 3MMBB 4B9NA 5IOLA 2VFSA 4WYWA 3VGUA 4X4OA 4I0WA 3PG9A 2M4MA 2Z2YB 4L73A 4EO8A 1FCAA 1UVKA 2B9EA 2K8GA 2UVVA 3KLEB 1M1HA 2HAIA 4DV3J 5D4LA 4RW9A 3J81Y 3GCXP 3D66A 4ZJQA 5KFYA 3DYAB 3KJNB 2RVJA 3LP0A 4RZRA 2FPHX 2GVDB 2HZVA 4EO6A 4PEOA 1PGZA 4CI0B 3MDFA 2LMIA 4M8LA 4ED4A 2JC0A 2FJDB 4MH8A 2ZOGA 1H72C 3PACA 2R2RA 2N4CA 3SYZA 4OJHA 3OXFA 4OJGA 3GFHA 1RISA 1H98A 3HI9A 3RBXA 5AXLA 2DK2A 5K8MA 3ILIA 3A1YG 5CYQB 3I9V9 3UNGC 3AY0A 3LA0A 1SQFA 3HVAA 2ZC4A 1U6BA 3H4DA 4EMDA 1FD8A 1TKXA 4UUXA 2P2CB 1HR0J 2R2TA 1LXNA 3K58A 2AT1B 4A8SA 3SI8A 1VQ8S 5FIIA 2VG6A 2K2PA 3QFWA 4B9TA 1C0TA 2CJQA 2KZMA 2PMZD 5LSRA 5FLXU 2ASJA 4NEYA 4KFBA 1HHTP 1PC4A 4KKOA 2GIQA 1IWAA 1J5EF 4X62J 3TR5A 3RBDA 3DI6A 2NUUG 3UVJA 4USHA 4B02A 5CCMA 2IY5B 4KSEB 4OHVA 1QD1A 5KFGA 1LK7A 3LALA 2X1BA 5DDQC 2IPOB 3DU6A 2DEJA 3CCES 3GMGA 3P45B 3RBEA 2IA6A 5HJXA 1X4FA 3HHLA 3DC2A 2RUGA 2Z0GA 2UV8G 2KHDA 3RB3A 3IRWP 3G82A 1X4HA 5D0EA 2X3DA 5HLFA 4DG1B 5G0RA 2RQCA 3WBZA 1SBRA 4NYPA 1AROP 4NXMJ 1IBCB 4FXVA 1FX4A 1OSCA 4PXEA 3N4WA 2GHPA 1U48A 1T8EA 4DR4J 5BR8J 2XYGB 5HMZA 1Y5LB 5KG6A 3GCWP 4LF1A 1HNWJ 2XEXA 2QN6B 2AJ1A 3H4BA 1SIWB 4ZHRA 2XMTA 5CYMA 4O0NA 4Y00A 4DR2J 3MM8B 2DVIA 4F4AA 1NHKL 4EI2A 3VZHA 2AW0A 3Q8YA 1Y00A 1RWOB 5AXMA 3CDBA 1N33J 3D4JA 5ITHA 1W25A 3QSYB 2N3OA 3G6XA 2UXBJ 2B6AA 1RSCA 1KHWA 4U7UK 3PZPA 4YFUA 1GAOA 3MECA 2ADBA 1M5PC 3T9NA 1YBUA 3BV8A 4USVA 2KB2A 2N7YA 1RT2A 5D0GA 3T5LA 1XNQJ 2MQ8A 3PYDA 1FK9A 1HD1A 3M2RB 5J2NA 4QWAA 2HK3A 1UWBA 4PQUA 1TAUA 5LSLA 4IFYB 1VI7A 3NAIA 2ZZMA 1W7WA 4F36A 4TY8A 1U1QA 4TQRA 1LFPA 2QL9B 3FUYA 5K8NA 1U4BA 1O0PA 3M9NB 1F5AA 1EQ0A 2EFOA 3W9IA 3HJVA 3MURP 4X64J 1R8BA 1HNXJ 2XZTB 3PJWA 2QLWA 1WELA 4I4BA 1SJQA 3I5CA 4PWDA 5KFBA 4MIAA 4P7VA 1KN6A 4X4RA 1NK6A 4UQGA 4IFVA 2E1CA 3VAFA 2JWNA 3QRQA 3BKFA 3QGIA 2COLA 2V6AA 1DARA 2C2RA 2WONB 3IM8A 1ZS6A 3PTWA 4DWIA 1JJHA 4IO1A 2Q6CA 2QIFA 2IYGA 2GHVC 3SXLA 1WC6A 2M70A 2XMKA 1U0SA 1FESA 1KKHA 4RNMA 2FTRA 2XS7A 3MCOA 4GKKF 4DV4J 3T6BA 4M5NA 2DH7A 3CC2S 4CP5A 1U1MA 1JNRB 1VBZA 5ADZA 4NX9A 3CJSA 1X9MA 5BYRA 3DU5A 1HNWF 4E2FB 4DUYF 4JI0J 3NNHA 2L3MA 2VFVA 4W90B 3CPWR 3QWUA 4RWWA 2LQ9A 1S10A 5J2QA 2AEMA 4C98A 4X4VA 1Z1ZA 4FF3A 1FE4A 1URRA 1U45A 5F9NA 1YJ9S 4MFBA 1N33F 4FS2A 3EE3A 3C16A 3KMSA 3IP0A 2J0SD 1HW8A 3LGNA 5GAGI 3KWMA 2HVZA 4QIVA 4DR6F 3BSCA 1HPZB 2G2YA 2ZHBA 4NZ7A 1LWCA 2WVBA 2CJXB 3SMZA 2W7OA 1F1BB 3F44A 3EYZA 4OJ1A 1RLCL 1AUSL 5KTQA 2I6WA 4WFZA 3PXGa 2VG5B 4C97A 3MF5A 2UXDJ 4J9NA 1OIAA 4NRUA 2RSQA 1NU4A 2MSSA 3R7NB 1UA1A 5A8WA 4GO5X 4CT8A 3HCXA 3DLGA 3ITHB 2ACMA 4HR2A 1S0VA 1QE1B 4X4UA 1ZTWA 1JLGA 3C6UA 4OL8A 3JQJA 3MZIA 5CH7B 3FEZA 4OIXA 2FGCA 4A8FA 4QIEA 5HSPA 2I8EA 1NPRA 2HK2A 1HNXF 1Y10A 3J80Y 2HHSA 2GAGC 2HLTA 2YTCA 5J1EB 2HVDA 1X31C 1CJKA 1UPPA 3G71S 3LH2S 2FYXA 4HL9A 5B08A 3EDRB 3DLBA 4ZVGA 2XY5A 4Z7CA 1NK8A 3DHWC 1G2EA 4JYAF 1UVLA 4CYUA 4DEZA 1HARA 3UDVA 1GTEA 1QY7A 4G1QA 3S1TA 3M9MB 2KRRA 3LP2A 3SCJE 3BQ0A 1YJWS 1PJ5A 4MKBA 1HL6A 4RUAA 2J5AA 1N32F 2FJBB 1VK3A 1NSPA 2XO6A 4K4ZA 3AAWB 5SUHA 1P27B 3LGMA 3FSIA 1LXJA 4Z2XA 3T19A 3CF5Q 5HROB 1LW0A 2G2OA 3GB0A 3Q89A 1AYEA 1RHKB 3EZUA 4K0KJ 3KLFB 4HVZA 3WDOA 1QVFR 1B0TA 3CMES 1Q81T 2QFIA 4QOTA 3LW5C 1REGX 1S6PA 3U7JA 2V4RA 3R6GB 5D4OA 2HNYB 1TU0B 3BPDA 4OX6A 3BO4A 1D1UA 2FC8A 1QTNB 2N3LA 1FRIA 4DMZA 5E5NA 5J1PA 2IM3A 1LW2B 1RP5A 2J0QD 2CVIA 5GAEU 3EJMA 3KJVA 1VHIA 2BMBA 5A6WA 2N4DA 4OI6A 1DQ9A 3GQCA 3TUZC 4KGVB 4RNHA 5B7WA 3PJ9A 4ID5B 1H38A 1KD1T 2XULA 1SIZA 2QLBB 3QATA 1TKTA 2AU0A 2D69A 3CJ8A 3GJTB 4TNOA 1XTZA 1EIYB 2BQUA 5CQGA 2A1BA 1HHSA 3CJQA 4OV1A 1KLMA 3AH6A 4RBTA 3GV5B 1TR0A 2V68A 1NZAA 2V94A 2D3OR 2ZDOA 3PVXA 3FKBA 1N6QA 1FERA 2QA4G 2ZH4A 1RA7A 2V34A 4KY3A 4WTYA 2BRLA 3SCLE 1IKXA 2OPPA 2RHQB 3EPGA 2HVEA 1BQNA 2C2NA 3C46A 4DV2F 1FNXH 4RW8B 1TFYA 2AX0A 3TQ1A 3DRRB 4OHZA 3R9LA 4J9VA 5LSOA 2UVUA 5KFNA 4LVNP 4F0HA 2X1GA 2VC0A 3EVMA 3ZZRA 3BQ1A 1OO0B 1F9FA 3ZXWA 1H6KX 2GQ2A 4LRBA 5D8HB 3W66A 2WSEC 1EARA 5KG2A 2AJ0A 2JHEA 4NI2B 5DGAA 1N54B 3HFVA 2Q1LA 4GO7X 1DTTA 3JQMA 4DR7J 1N52B 1GTHA 4KO0A 2F3JA 3MMCA 2VL1A 2PD1A 4M1KA 3WC2A 1W2BR 2A10A 5KG0A 2DNKA 3CO9A 4PWUA 2LU1A 2K1RA 2XMUA 3ZZ0A 2IDEA 4PPDA 5LJ5Y 1OWXA 3IG1B 3CC7S 1FRKA 2APOA 2F8MA 1CJUB 1IBLJ 4NXNF 1NDLA 5IQ6A 2YWKA 2F4VJ 3W2VB 2BQ3A 5FLXY 1F3VA 5AE2A 1NJYA 2KHCA 5ETOA 1WACA 4Y28C 4F4ZA 1Q86T 3DLEB 4CLZA 5J2MB 3AXKA 3CCJS 4LF7F 5I3QA 2EWHA 5I42B 2HS4A 4B9LA 2UUBF 1O8BA 2FY1A 3LP1B 4C8OA 3A8EA 1RAAB 1NJIT 4A8XA 1OY9A 4IRKA 2Q43A 4RJVA 4L75A 3HJFA 1EHWA 4RU9A 1Y7PA 3Q86A 1N36J 1Q1KA 2RF2A 4BBYA 2G1HA 5KG7A 2H4WB 1PBAA 3LAKA 2GX8A 2CQ2A 1TL3A 3B6BA 4NLGA 1M1GA 2YKOA 3A3OB 1AW0A 4ZDNA 1IKVB 4NLRA 4DBQA 2V9WA 4UY85 1X5SA 4QWCA 2CNNB 4LQ3A 5CZVA 3N01A 4GVLA 5DS7A 3FBBA 4ZN1A 3NOCA 4NZ0A 3KDOA 2JSXA 2DD8S 2N7CA 4YB1P 1RT7B 1FXDA 2NXJA 2HFZA 2O5DA 1DAXA 1Q8KA 2DRDA 3H7HB 3FBCA 4GKJJ 2W7AA 3PKYA 3SDEB 4R5PB 3T1AA 5SZTA 3UQSA 3QPIA 4Q5VA 2MJNA 5A0YB 5L46A 2J7WA 1VQ9S 1Q5YA 3TA0A 3PFEA 2EKYA 2V4QA 5GADU 1D9AA 1FT8A 2RRBA 4KPCA 1SUQB 3W2WB 3RBZA 3BN7A 4NYOA 1W2IA 1IN0A 1QUPA 3GFZA 1HNIA 1TQLA 4RO0A 4YP3A 3M2VB 4OZNA 2DCUB 2DR6A 3HVTA 3PRDA 3KJQB 1C1BA 1XMQJ 3H59A 1Q82T 1SKWA 4WFYA 5I3PA 4YR2A 2BE7D 3L4BC 2MY7A 2BVZA 1YWXA 3OUYA 3H5YA 5J2PB 2R7VA 2H5EA 1JX4A 3D0HE 4HT7A 1NZ8A 4EGLA 2W9CA 2ZFHA 4O23A 1SVDA 2RAQA 4DZDA 3M30A 3MI7X 1XR6A 4ZLLA 4HTJA 3Q22A 1RTDA 1VMBA 1RTIA 2U1AA 2Y9HA 4M5IA 1X0FA 3J7ZT 5KT7A 2OIHA 3C6TA 2J6SA 3TWZA 4M63A 5AE3A 1SJFA 1J27A 2CVEA 4OI4A 4WFAQ 4OV6A 2CPHA 3IBWA 3R8YA 2M2BA 1RWPB 3N6NA 4DU7A 2OEKA 4LF8J 2HQ3A 4I6AA 3UN5A 4NA3A 2IFXA 2LA6A 3CGIA 2B9XA 2YKNB 6AT1B 3EGWB 2R7SA 1YRXA 2FHJA 2DYAA 3CJRA 4HTIA 2HQFA 3BGRA 2KKHA 1TL1A 4PQAA 2BJDA 1RXOB 2W9AA 4KH0B 4EUVA 2C3PA 1PG5B 4B3RJ 4QU6A 3QZ8A 4JI8F 4CM2A 1TFWA 2OPQA 3S8SA 1L3VA 3JSYA 3MFIA 3GIRA 1RWWB 2E5IA 1D9DA 3V6DB 4GKJF 3T1HJ 3UNYA 2IHR1 4BC9A 1RHQB 2CPXA 4WIQA 1SC1B 1OJ4A 3LPYA 3VR1A 5K8OA 3R6LB 3EUNA 1HMVA 4KGZB 3KK2A 3M8QA 4YB7A 3SV3A 1ZM3A 3HM9A 1IBKJ 3MWBA 1NBEB 1WHXA 4JV2A 1ZM2A 4DR1J 4ED2A 1S6OA 3MOJB 2GQCA 2NQPA 3MR3A 3TJAA 4ZPCA 4K50A 3NBPB 2OUGA 1RGVA 2XMMA 1IQZA 2FD2A 3FFIA 2JFKA 2HBZB 1HBNB 3M4XA 1S1VB 5GAHI 4J9MA 4ZP6A 4IG0B 1T94A 1TVRB 4Y34A 1S1UA 2LA4A 1T03A 3ZNJ1 3IBCB 1S76D 2AP6A 3TA1A 2KFYA 1QAIA 4F2RA 3LTOA 4M5LA 1RT3A 1UL3A 1OPIA 1RWKB 3PW7A 4RL1A 4GRSA 4YN3B 3BQ2A 4CIOA 2RQMA 3ENAA 2ZOFA 2HQDA 4PYAA 3FNNA 3HKWA 2ACYA 1CULB 4C8MA 2ZKUA 3A8JA 2DNQA 3DRYA 5KFIA 3A8IA 1S9FA 3D1HA 2QJ3A 5C25A 2E9RX 1F2GA 3GJSB 5D6GA 2Y1LB 3DLKA 2IMOA 4OYZA 1JK9B 4DHVA 2CDRB 4ETXA 2RDJA 1FRMA 3V5RA 3W9HA 4CCHA 2LDYA 4DQSA 5KFMA 3PY8A 2HYIB 3KK3A 1WJ9A 2BEFA 3NGSA 3ZTRA 1H3DA 5KFQA 2GJIA 1JKHB 4G1PA 5A76A 4LF8F 4DL0C 2G1DA 5L38A 1FJGJ 1VQLS 4QIWD 1FEHA 2ILZA 4P7TA 1RWXB 4WK1A 2JJ4D 3Q8RB 5HP1B 4ICLA 3D6TB 2JEFA 2QL5B 3R97A 1QTMA 1BWVA 3CMQA 4Y2MA 2YQ0A 3IBFB 3BS9A 4YDDB 2W4PA 3MEGB 4WWSA 2FJWA 4JV5J 2WHOA 3PDNA 4TYBA 4KAIA 3D0IE 1HQEA 1X4DA 4RW9B 1C0UA 3U02A 1A6LA 2J7KA 2HFUA 1WC4A 2OMOA 3LGHA 3DGVA 5CHCB 3MCSA 2I9SA 1KONA 4OI3A 1FKOB 4H4MA 1TL4A 4ES2A 2H3EB 1VRTB 4DSKA 5KFXA 2QYGA 5IT9U 3DKDA 1AUDA 5KAKA 3MEEB 2QLXA 3N6LA 2EPIA 1IKYB 1VHFA 4FPRA 2JEJA 1TKZB 1TV6A 5GAGU 4FF4A 4MMOA 2BKPA 2KZZA 3OFGA 3DCAA 4DR1F 3A12A 3QO9A 1N34J 2FDNA 3VZIA 4DCOB 2RE1A 2B43A 3MPVA 3VVUA 3DOKB 4FF2A 4KHPJ 4IYQA 1YG0A 4KFBB 5T14A 3AODA 1WHWA 1IJFB 5C2CA 1L3UA 2XYHB 2QMXA 4C7QA 4CO0A 2WVEA 1AB8A 3BBCA 4ECVA 2VBYA 1I94F 2JLGA 4G65A 1K0VA 3M8ZA 4PR6A 3E51A 4BDPA 4LF9J 2RILA 4UW2A 1NJWA 1UKUA 1RTJB 2EFVA 4LFCJ 3TAMB 3M6XA 1X60A 2AJFE 3I0RA 1RACB 2HHTA 7AT1B 5IV3A 3KHLA 2NREA 3GG1A 1S6QB 3ULHA 2BJ7A 4C11B 3DGPB 4LQ9A 5D0RA 5DQIA 1CG2A 2ROGA 4CLTA 3M32B 4CRJA 1DURA 2XZWA 3TX8A 4AFFA 2RH3A 1WC5A 3AA9A 5KG4A 5T7LA 1Y9OA 4DS4A 5CABA 2GV1A 2FLOA 4B3SJ 4IR1A 3A4TA 1T0TV 4XAKA 4RNFA 5L1IA 5EWEA 2E7WA 4H4KC 2DNHA 2AMCB 4DV6J 3O8WA 4JV5F 2CWKA 4UZCA 4DUZJ 3TZXA 3W5XA 6FDRA 2B4VA 3OJSA 3FSYA 3WC0A 5LT5A 2NXEA 4DV0F 2OPRA 2B6AB 3HLUA 5KG1A 1GMUA 2LXFA 1KDNA 4FVMA 3MECB 1RKJA 3PEJA 1NKBA 2ATLA 3DMJA 2KRBA 3UCGA 4F4WA 5IM0A 2MPUA 2VHGA 4KT0C 2BKNA 1XR5A 5EWFA 3DOMB 4ED7A 3KYLA 4ZPWR 3HSJA 4LBPA 3ISNC 1TUGB 3UPFA 5DQGA 3NG8A 2GQQA 4B3TF 4ZKAA 3AJ1A 4O0IA 2MQPA 1AA1B 2NLWA 2MZTA 1MWQA 3E3XA 3CT9A 4CLFA 1HYSB 2OFGX 3W8GA 1HNZJ 1TAQA 4C8KA 4KC5A 3CB4A 5KFAA 1HHQA 3RR8A 1WDTA 4AT1B 3G86A 3GIKA 4RNOA 1IM4A 1KQKA 1FNMA 3DRSA 4QBUA 4F3MA 1FDBA 1KC8T 2RU9A 1FRXA 2W2OP 4LFBJ 1VRQC 3B8HA 1CJVB 5EN1A 3MMAA 4EBDA 2XY6A 1C1CA 3JTOA 2CKWA 1N5SA 3BF4A 4M5KA 2C3MA 3X3UA 2YNFB 4QWBA 1RAGB 1LFWA 4OI2A 1LKZA 2VBZA 1LWFA 1RHJB 3SQGB 1HBMA 2JVRA 4EK2A 3M7VA 2LVWA 1U09A 2DNNA 1M5KC 4F04B 4JI5F 2IVFB 2QT7A 1BGXT 2Z58B 4PZVA 4RX6A 4XIUA 1LWXA 4LSLA 3P5TL 4PXDA 3W7BA 1FD2A 2R7QA 2HGLA 2XS5A 4HHUA 4JB8B 3I96A 3NCPA 4USJC 2VOPA 3K17A 4JUZA 4FXDA 3HHKA 1VRUA 1BQMB 3UR0A 5K5MA 3T6JA 2JVOA 4B3SF 2IVYA 3MR7A 1DZ5A 4ZMMA 2BW7A 4NLTA 2DR7A 5H9EK 2QSFA 5J2QB 3HULA 1H2VZ 4P71A 1SJ4P 3D5MA 4EWTA 4JI4J 1Q95G 2JX2A 2CJAA 5KFSA 4UZBA 5ETSA 2M3DA 2KI2A 2KDOA 3V2UC 1X7VA 3BM7A 1RT1A 3R5JB 3H20A 2D74B 2J6TA 4ANCA 5EX3A 2DHGA 1U2RA 3CIZA 3DOLB 1DFDA 1SV5B 1D0EA 1D8ZA 3K5OA 4ZK7M 5H1SV 2E5LJ 1FXLA 3CCTA 2JRSA 3WIUA 1UAWA 4OX7A 3DM2A 4X66F 4ZPAA 3CWJA 5D3GB 1Z4UA 4MTPA 1WOPA 4KV8A 3QIPB 1PKUA 1IR2A 1JLBB 3M8PA 2C3UA 2UZAA 2Y0SD 1O5JA 4U8VA 2R8GA 4YS2A 4P72A 4FZVA 2DTJA 4MYUA 3C6UB 4NLUA 1VS3A 3K59A 2FQQB 1K0TA 1UEVA 1HNZF 4NA2A 5E3QA 4KQZA 4I2QA 2YX4A 2FZCB 2MSTA 5B0CA 3GR1A 4RNNA 5C42A 1YK9A 2Z2MA 3P6YC 1S97A 4GC7A 3R7BB 5AXNA 1VIXA 2CA9A 2V50A 3QGGA 1L5UA 5ETPA 2J6UA 3RJMB 2R9LA 2QA4S 1CPZA 4NCGB 4N77A 2GMHA 2MTLA 1GT8A 3QT7A 2E1PA 4NLVA 3L7PA 4CYUB 4OMFG 2HNDB 1F9HA 2ZOMA 3H2UB 2IIHA 3F41A 2P9GA 2POKA 1JLEA 1SJRA 3TZZA 5KG3A 1UETA 2XBPA 4NCBA 1HIYA 4DL5A 4WKYA 2G0IA 1CBKA 3NGKA 1WEXA 4QW8A 1FFGB 4LF2A 3V6KA 3R1LA 3AOAA 2LLZA 3PW2A 3F0NA 1DQ8A 2ATCB 4NLQA 4RUHA 3MEDA 2ZBCA 3ICLA 2OEJA 3HZGA 4LSNA 4K4XA 2Z56B 2XMVA 3IAS9 5KOWA 2VB6A 1MN7A 3NY0A 1RCOB 3V4IB 2OI2A 2V2VA 3ILLA 1S6PB 4DN0A 4YHHJ 4LF6F 4XTTA 1ZTTA 1S99A 1YRUA 1Q8IA 1FXRA 4N7TA 2RRAA 2HQIA 4JI6F 1SC6A 4LF5F 1H7XA 4KJIA 3R2DJ 2ZNZA 2GHWA 2PEBA 2JDJA 1UVMA 4B9MA 1M5SA 4DOZA 4LVOP 3FJ2A 2EFGA 4OX9F 3OVSA 4UOHA 5IQQA 3KJFB 1SL0A 1O51A 4DFJA 2AWZA 4O44B 1JLQB 3THPA 1D8YA 4YY3J 2IC3B 2DGSA 3UN3A 1TKTB 3JAMU 3T41A 2V4JB 2HHHF 1HKAA 5F8IA 3HHLD 2PA8D 1KLMB 3EVWA 1T9WA 4ECRA 3Q8QB 2RJZA 1BUXA 1KQSR 2DHHA 2CUYA 2VD3A 3MM5B 1XMOF 3TP2A 1IWGA 2H9ZA 4WFXA 3ZTOA 3GONA 1U0HB 1DLOB 3OXGA 3MD1A 1VQ6S 3AD9C 2B4PA 3EXYA 1UPMB 5ETNA 4CTAB 4USIA 1I51B 3MD3A 5CCLA 5AT1B 2KL8A 3UCUP 4R8UB 2KFNA 4LRAA 3EDQB 1X4BA 4LRCA 1WG5A 1NSQA 1HNVA 4OHWA 3MPYA 2YNHA 1V3RA 3J7YU 1NSKL 3OR2A 2MQNA 3DN9A 2ZJQQ 2R2UA 1EX8A 5IT9Y 2MKCA 3T1YJ 2W2NP 3ZNUA 3VCDA 4K4VA 4ZPTR 2WOMA 2P9EA 1KVJA 1VCTA 2M0GB 4LRFA 1R8AA 1FKAF 3ENQA 4XK8C 3CIMA 4I7FB 4WE1B 1N5TA 1HWUA 5H9EJ 5B0GA 3TYTA 2EG1A 3ETOA 3GILA 2K7KA 1S7HA 2HS3A 3TVZA 3TNVA 3PHTA 1B7FA 3F73A 2DGUA 3NLCA 1WI8A 1RBOB 2GVZA 4LRDA 2BQRA 1YX2A 4ZIVA 4YHHF 4ZLNA 3LF0A 2HFOA 2HFNA 3D28A 3MMBA 4DV7J 2FC9A 2XCPA 2GIRA 4N47A 4LJMA 2M52A 1PJ6A 1FX2A 3BSOA 5IXUA 1BWEA 1QM9A 2F8HA 1Q0NA 2BUNA 2MQLA 3QBCA 3BYPA 1OY6A 1TELA 3I82A 1HW9A 3DYAA 6FD1A 2GVDA 3JXOA 3MUVP 2WVCA 3DFEA 1YJTA 3KXDA 4Q8FA 4FF1A 4I6WA 2NYHA 3W8PA 2FGOA 3PR5B 4QYZK 4MT1A 3KMQA 1YIJS 4Q8EA 2QE5A 5GAEI 5CYQA 4NA1A 2R7XA 2PI5A 4DX7A 1FFSB 5GVQA 2OD4A 2FJXA 5MLCV 4DQIA 1Y4ZB 2ZKTA 2OH2A 2HHQA 3KFWX 3UW1A 2WSFC 4JI3F 3DDKA 5EDWA 3MAHA 1KFSA 4O3NA 3E2EA 5LMNJ 4DN9A 1RYSA 5LMUJ 2XC9A 3AB2B 5E7OB 2DR8A 3IRXA 3T5HA 1XBWA 5H9FK 3OR1B 1H73A 4XDDA 4M94A 4B3OB 1FE0A 2DY9A 2L9NA 4JI2J 3R3TA 2J0WA 3OTBA 2NSCA 3SV4A 1U1OA 3NCRA 1WTBA 2ZJRQ 3D54A 4DQRA 4WKRA 2LQ5A 4D3HA 2BV3A 1JLAB 2CNKB 1UMJA 4ZCMA 2BE9B 2MKSA 5I3UB 1YDLA 5KFEA 5FJ4A 4DG1A 2W4DA 5HMWA 1NK4A 3PIOQ 3Q2TC 1R8HA 3LANA 4X4SA 4AQYJ 3HVTB 1UJ6A 2KYZA 2YWWA 3M6UA 1WKJA 3SSQA 4O4GB 2PGCA 4JI7F 3M8SA 4NASA 2G2ZA 2Y1JA 2VJUA 1NO8A 3FCWA 1IM6A 5KT3A 4B9SA 3TVYA 3WX8A 3L95X 4W92B 1U2FA 1EP4B 1ZZNA 2VFRA 2IM0A 1EAYC 5K14B 1TMJA 2YBVA 4DV1J 3OQ2A 3GIMA 1RU1A 4UQTA 2FHOB 3W64A 1RZMA 3D67A 4X2BA 3QSIA 3UFCX 3GYNA 1F2HA 2DIVA 3KUGA 2E7VA 2DJWA 1RHMB 5KFHA 4AL7A 3C15A 1MU2A 2ZBIA 4M5MA 1FVQA 3RRKA 2GIFA 3NGDA 2C28A 2ZBRA 4UOCA 2M88A 2BX6A 2LP4A 1TL5A 4K4TA 3M2RA 2OJ3A 4IFYA 4P52A 5K9FA 4YMEA 1NK0A 1MMNA 3QWPA 4USUA 3J81j 2UXCF 1RT6B 3GLJA 4B17A 1TL7B 3KLGB 3BR8A 3GZ7A 1OQ6A 1RT5B 2C2MB 3SFUA 1J5OB 1SXLA 3JYTA 4KGKA 3TW0A 3VAIA 1N5YB 3OTCA 2MGZA 2GW8A 2VKZG 1BQXA 3TX0A 1Q8BA 3OVAA 2DB1A 1UW4A 4NLYA 5E3PA 3M8QB 4DX5A 3Q8SB 1NRKA 3UDCA 1P9QC 1YGYA 2V63A 2WONA 1VBYA 2C2EA 2LYVA 1K47A 2HVHA 1LWEB 2VFUA 4EYIB 2BXJA 4O4RA 3KNAA 1NKEA 4Q2LA 2F40A 2QX0A 2Q79A 1D09B 4GC6A 4LSZB 4KHRA 1U1LA 1RLDA 2KXNB 1AFIA 4AQYF 2VQFF 4M5JA 4GVBB 3BZQA 2R7WA 2HHPA 1T03B 3PV8A 2NXNA 5GADI 3BGLA 1R31A 4M5GA 3UD3P 3I5AA 1RHRB 4JOUA 4ILRA 1SI9A 4HH0A 1S5ZA 4BS2A 4ZCIA 2BZ2A 5EHHA 2L48A 3OTEA 4A48A 2XTJP 1MNEA 3M2UB 2ZE2B 1R89A 4I69A 3GE9A 3IS9B 4P2XA 4HHJA 2JEGA 2DPJA 1FA0A 2GO8A 2AJQA 3DLKB 2HHUA 2AV5A 5LXRA 4TQSA 1H2TZ 5HK4A 1WG1A 4A8YA 4QJVA 4MKVA 3X1LB 4JI1J 2W25A 5HAOA 5HI7A 3BDEA 5ETRA 1SQGA 3VAMA 4G1IA 1HPZA 4PG4A 3GYGA 4DJBA 4QYZJ 2LU2A 3TOQA 1V3SA 1D9FA 4OYIA 3L09A 4OYBA 3J7A1 2DGTA 1M5VC 3OPKA 2WBMA 3OJUA 1WKKA 2VG5A 3QAEA 2DISA 2OMLA 3EICA 1F6TA 2MQMA 3GJRB 3E01A 1AZSB 3H5UA 2UUAJ 1ZAVA 4OJ3A 1G4CA 1U1PA 4DL4A 3ITHA 4E8UA 4DL6A 2NYIA 4CLWA 1QE1A 1HQEB 2MXYA 1RHUB 3J7Z5 2F65A 1S12A 4F4XA 5JMNA 3CEDA 4NLWA 4P2FA 8RUCA 4JV1A 2ASYA 2YPZA 2F63A 3P3DA 3RB6A 5H9FJ 3U1MA 2RKIB 4JV0A 2RD5C 3NGTA 3TEGA 4RW7B 1E6VB 4OYOA 1JLFB 4PYDA 1JIHA 3RW7A 3OTOF 1JXLA 3GWCA 5J1EA 1SKUB 3O3LA 4WXWA 2OGUA 3TEHB 3EZOA 9RUBA 2YQ1A 2VU5A 5DM6Q 1XR7A 3MCNA 3G87A 2MQOA 4AYBD 5HVHA 3US5A 2WSCC 2AYBA 2BOPA 4DV3F 3MHYA 2PMHA 1N4LA 1V3ZA 3IM9A 3ONQA 1S59A 4QWEA 2W2QP 1U7LA 1KQFB 1NXIA 4V19X 4R0EA 3EX7B 1DJ0A 3IMQJ 1TKDA 4AXIA 3JAMY 5E41A 3O6QA 1VFJA 4P75A 1XMBA 4AXJA 2CIMA 1AFJA 4K59A 1XNRJ 2NPIA 4QPTA 3CULA 4HHHA 5DG7A 1RBAA 1V5IB 1FDDA 1H74A 4CO1A 3RB0A 3NP5A 1HR0F 1RAEB 5B0AA 1YSJA 1KQGB 3BPSP 4ILMA 3HHEA 4PXCA 5IT0A 2V2QA 1VQKS 2UUCJ 2HBQB 2A6OA 4ZOSA 3GJQB 5DDRC 1ACMB 4UT4A 2QA2A 2CPJA 3R2CJ 1CJTB 1R8CA 4J91A 1RJJA 1F9EB 1JLCA 4UY8T 4JI1F 2HNYA 4IKAA 4U6PA 1PAEX 4ZJLA 2J9DE 2O3DA 4X62F 4TVAB 3OHAA 1WHYA 4IDKB 3L7UA 3MR2A 1FTCA 3DXBA 1NPPA 5D0HA 2K7JA 4CT9A 2O1PA 4OQJA 1X5OA 2B4OA 2YH1A 1LW2A 1EB0A 3HKZD 2I1RA 2MKJA 2EI5A 2JNJA 4DR5J 1QSLA 4P74A 4N76A 5ETVA 5CXTA 3MAAB 4Y2IA 4C0HA 2P6SA 1N5VA 3PFOA 1JXEA 2UUAF 4C3KA 4HACB 2EFNA 5F3TA 3QMQA 2IAJB 1YITS 4Z7YA 4OYAA 3BB5A 1GX5A 3EM1A 4NXMF 5HL7Q 2J8SA 2ZH5A 2RS8A 4DR4F 1X9WA 5BR8F 1NB7A 2YX7A 4I68A 2HWIA 2K3IA 3DMJB 2QMUB 2I5JB 2UU9J 2GNKA 1CC7A 3M1VA 3BBBA 3DXSX 4YB6A 3N6MA 3DRRA 1VQ4S 2CJ9A 4DR2F 3FDSA 5HANA 1XIQA 1R7IA 2DITA 1RAHB 2GJFA 2HG4A 2CQ1A 1E6YB 2ZBQA 2GZOA 1LQ9A 2BANB 5F8HA 4NI2A 1HD0A 2XHCA 4I2PB 2UXBF 3RR7A 2MB0B 2AEJA 1IR0A 1ROFA 3PYEA 5FD1A 4ECTA 3M9OB 3KNGA 4HH1A 3QAUA 1PO6A 1SL1A 4J37A 3DHXA 4J9OA 1XNQF 4DFPA 1XNRF 2J8AA 2HWTA 1QJHA 3H98A 3PNIA 3QZ7A 3IG1A 1IJEB 4EZ6A 1CJUA 3AXMA 3I56S 5E3AA 1VQSA 2CFXA 1X9SA 3R5BA 2FHJD 3SBMA 1LWFB 1U1NA 1KS2A 3CMAS 1NH8A 3W2VA 4USMA 5IWAJ 3OW2R 5IS2A 1VQPS 3DLEA 5J2MA 4FYYB 4X64F 3OL7A 5AXKA 1WC1A 3C2PA 1Y5IB 2ADCA 2UVRA 4YEAA 5I42A 4X65J 3CJKA 3TUPA 1NJZA 2UP1A 3TANA 2DHAA 3OSPA 1VJQA 3U1NA 3HF5A 1MMDA 5K20B 1YLXA 4PCQA 3TAPA 1PILA 1WF0A 1WUUA 2M8DB 1CVJA 4N8OA 4WFBQ 2MZ1A 3OBIA 2BJ1A 4P2SA 2HAFA 1S77D 1QSYA 3CDAA 2P5VA 3R5AA 4LREA 3MTJA 1T11A 4NLXA 1KWMA 1IKVA 1VC6A 1HI0P 4QQBA 1MG7A 2PDAA 4DV4F 1S1XB 2F7VA 4J9QA 1RT1B 5BYQA 1BE4A 1FRHA 3ZZOA 2QRRA 2HW3A 1Q16B 4CO5A 2QMWA 2BABA 5A8KB 2L9DA 3CDWA 4L3KA 1RT7A 4JI0F 4LFAJ 4V1Ak 2JC1A 1ZZFA 5IC6B 4LIWA 5L39A 3AQOA 3NAHA 5KFVA 2D41A 2MMYA 2YWFA 2JLEA 4LBIA 1Q79A 5L1JA 4R5PA 2DHSA 4KV8B 1TTHB 5A0YA 2DGVA 1RWNB 2P6TA 4A47A 4ITSA 3P49B 1ITPA 2GGPA 1RAIB 1S72S 2ZM6J 4CLLA 3QFHA 2YXLA 3TZYA 3M8RA 1UEKA 3IO1A 2CZ9A 2D3UA 1SUQA 2LDIA 1AT1B 3OL6A 3OFFA 2R4FA 4FYDA 3EXCX 1FRJA 3CXCR 5E3CA 4L74A 4X4TA 4OZ2A 3M2VA 4IRCA 1C4CA 2DGOA 4K2XA 4F26A 2UXDF 2EEYA 2ERRA 4DR3J 4NCAA 1Z2LA 2PC6A 4B3MJ 3HK2A 4U67Q 3BSAA 4NRTA 3KLIB 4YQWA 1JLEB 1WSVA 2HHWA 1F60B 4EYHB 1HWIA 2E7XA 5J2PA 1GXTA 2RMLA 3VQSA 2XSJB 1KTQA 2CQHA 4RLEA 1QAYA 3TUIC 3MTKA 2PSZA 4XO0A 3CCZA 2C2OB 4KTQA 2A6MA 4RUBA 3FMWA 4YR3A 1HWLA 4LR8A 2DNZA 4P6QA 4LSNB 4Y2KA 2DO4A 1J2VA 2EBGA 1U02A 4OZ5A 3ZO7A 3MUTP 4A4JA 1IBMJ 2AJ4A 5E0OA 2YKQA 1WEYA 1U1RA 1VJWA 2JZ5A 2LCWA 3BR9A 2AJ2A 4C0OC 4K5RA 3Q83A 1U2CA 3TQEA 1LOUA 2NXUA 2VG7B 4A8KA 1VBKA 1XK8A 4LR9A 1DRZA 1G1XA 2AYGA 2HHXA 2E9TA 1RWMB 3EPIA 4K0KF 5DG8A 2OPSB 2E9ZA 3ZFVA 3HO1A 4HLBA 3V6DA 4QZVB 3CCSS 4AE5A 2BACA 4F3OA 4FS1A 1WORA 2V2KA 2C2KB 3CD6S 3D6FB 3P96A 2KXFA 2LEPA 1S9EB 1Z2ZA 3FCVA 4DSJA 3N9UC 3CJ4A 3MCMA 4RW4B 3MM9A 2ZM6F 2HQGA 1U6ZA 4EU0A 4ILLA 1S49A 3CCVS 1MSWD 2F4FA 3WIVA 1HBOB 1U24A 3NBPA 3MPUB 2CRLA 4Q44A 4O3QA 1R27B 1HBNA 1S1VA 4IG0A 4KH1B 1OQ3A 2HMIB 4ECYA 3C8YA 4DPUA 1J5EJ 1TP7A 1TVRA 1WOOA 4DPWA 1DTQB 3MM6A 4XDCA 3K5PA 2VH7A 3V81B 4QIGA 2I0XA 3MPWA 2NCKL 1NUEA 2QGFB 5D78A 5F8NA 5GMEA 2AF6A 1VLYA 2BJEA 4PG7A 1T95A 2XM3A 3L7OA 1PC5A 3ET6B 5HBMA 3I0SB 3QLHA 1WF2A 1EETA 1HQUB 4H4OB 1JWWA 4RKUC 4P73A 4H54A 3MXHP 2H5IB 2VZ9A 1CULA 2ZH3A 3J7AN 4ECXA 3P5BP 3UD4P 2XLKA 1ZPVA 2WW8A 4C8ZA 3TI0A 2E5JA 2HBRB 4CNYA 5CAAA 2HIYA 2K3KA 4F25A 1SCJB 3K89A 2V9KA 4PG5A 3H25A 2AGQA 4ZITA 4DLGA 3CJ3A 1KVKA 2DNYA 3AOCA 2C3YA 3D7SB 4IO9Q 4TYAA 3LO3A 5KFCA 2KT2A 1JKHA 2HPUA 3RB4A 1R0AB 1CEZA 3TARA 1U8SA 4C8LA 1SC4B 2FB0A 4NL5A 3VALA 5HO4A 4DR7F 4ECWA 2VV5A 5HP1A 2B4UA 1QDUB 1XN9A 4QCLA 2YKAA 2A18A 3MEGA 1T9UA 2ILYA 2HVIA 1FF2A 2KVIA 5CZXA 2OP5A 3JSMB 2W7PA 3MM7A 4B9UA 4PABA 2KH9A 3GFYA 2FVRA 2B9YA 5KFRA 2YVSA 3GTYX 1CS4A 4ECUA 1FKOA 4FXWA 4CZCA 4IG3A 1U8WA 3DRPB 4H4KA 1YHQS 2BM1A 1NK7A 4OZ3A 1VRTA 5JVGQ 4WIIA 1IBLF 1T05B 3B54A 3KK1B 5AE1A 3DLHA 1A7GE 2F4VF 3MEEA 3H42A 1S7IA 1I3OB 2YNGB 1IKYA 2YWGA 4DV5J 1FKPB 5C24B 2EG2A 1TKZA 1UCNA 4R0JA 5F8LA 1PYTA 2OLWA 2ZH1A 2XS2A 4RW6B 2AKWB 1X4GA 3CW2C 3K57A 1H2UX 4I67A 4QYRA 4OHYA 4F50A 1KOHA 3AFGA 2EW9A 3DOKA 1JJ2R 1OMSA 2YWEA 2YKMB 4MK9A 3W5ZA 1IQTA 1UJ5A 4AUKA 1N36F 3IRXB 2E66A 2XO7A 5BJRA 1RT4B 1MWZA 1UVIA 4QPXA 3D68A 2XNRA 4F3QA 2YQ3A 1S9GA 2HURA 5KFKA 2DGQA 1WNEA 3UDEA 4DQQA 4DLEA 3O1LA 2MKYA 2R8KA 1WWHA 3OXLA 5A8RB 2H48B 3K5LA 1RTJA 5KFPA 2HEKA 4YR0A 3SSSA 3TAMA 3K8WA 1BMQB 2IRXA 2ZD1B 1HWKA 1RYRA 2ZUGA 3HPOA 5D4PA 2V67A 2GA7A 4CWBA 4ETZA 1GXUA 2XMJA 3GPAA 3Q23A 2ZHAA 1S6QA 3CCRS 3N28A 1RABB 4C11A 2OAUA 3S7RA 4DX8H 1RTHB 4GKKJ 2C2DA 3DGPA 3AD8C 1M1KT 4TKTA 3J7YI 2ZWOA 3VHQA 4NLPA 4IQMA 3DNCA 3M32A 2H65B 1K1QA 4DDFA 4WK3A 4K5SA 2CPEA 2QC3A 3SIPB 3PM9A 3RRHA 4EFAC 1EZZB 2Z2ZA 3FZBA 2VA3A 5HQ8A 1REVB 4DUYJ 1BXNA 1MROB 1WDDA 5KT6A 2G0JA 3LQVA 4G3IA 2HFSA 2V0NA 2GAHC 2DH8A 4C9DA 1MLAA 1UVNA 3IR5B 1WEZA 4B08A 1UA0A 1NSAA 2VBXA 1NB2A 2W8LA 2CPFA 2ZJPQ 4MAKA 2DHXA 1IKWB 4USKA 2BA9A 3IR7B 2HGMA 1HBUB 2ZHOA 2UUWA 4TLQA 4DR6J 3IA0A 1XMQF 3PO5A 2CJYB 4C8NA 2NSBA 4HDGA 3Q2SC 1NDPA 2FHMA 5KT2A 5AJ3J 3A13A 2CG4A 4G6VB 3C15B 1MU2B 1L3TA 3BKTA 3M6WA 4DV5F 3NMRA 3EMTA 4CLYA 1WD6A 1JB0C 1ULRA 3DOMA 1YQHA 2BYCA 3Q8PB 4KYZA 3VGSA 2RDIA 2Z8QA 1M5OC 4PUOA 4HT5A 5DZ7A 2VFTA 2FZKB 3KHRA 5FDLB 1T9XA 2E5HA 2ZNYA 5MAOA 4K8RA 2LQBA 2NS1B 1WSRA 2B5JB 3L9ZA 3KTQA 1NK5A 2YPYA 3HSGA 1HYSA 1HI8A 2IM2A 4M5DB 4WCEQ 5KFTA 3JYTB 1S0OA 2YNIB 4DPYA 4NLSA 1FWPA 3V4MA 3UI3A 2XZDB 2C42A 2YWHA 3BH7B 2ZH6A 1Y5NB 2MGZB 4A8MP 1B3TA 5HQLA 1S1TB 1ZAWA 3SFGA 4Q2MA 3AOBA 2V69A 3CCQS 1CJVA 1NNDA 4FN5A 1ZETA 1IXKA 4JYAJ 2V8VA 2E5GA 2CPDA 2YNFA 1GFWB 3SQGA 4B3RF 2AEFA 3HD2A 3PW0A 3MEKA 3LP0B 2L08A 3HHNB 1I1GA 1ELOA 1K1SA 2BJ3A 4F02A 3A3PB 1NAQA 3T1HF 1N32J 3NXZA 4CO2A 1DHMA 5HQMA 4X84A 2E1AA 2W8KA 2XCAA 5F0UA 4ELUA 4HDHA 1WHVA 1G6BA 1BQMA 2XSFA 2L41A 1L3KA 2Y0BB 4OZ1A 2VICA 3UWTA 5E33A 3K8VA 1IBKF 1KEKA 1S1WA 4I1TA 1TKXB 2J9CA 4RR5A 4DQPA 1FWLA 2O01C 2B8PA 2VG6B 1C0TB 4MJKA 1GMWA 3JSBA 1TK0A 5ETLA 2KJVA 4HI2A 2DKOB 3VVTA 4L6V3 4Y2CA 4KKOB 2RIJA 3W62A 3W61A 4OZ0A 3QJJA 3DI6B 4QW9A 3UVJB 4WJBA 3DOLA 1SV5A 3ETMA 2KYXA 3T5JA 3N5FA 5AJ3F 1WOSA 3A3NB 4F0MA 2MZSA 3UR3C 1U6FA 2GMJA 4C8YA 1OS5A 3Q0AA 4ECZA 3W63A 1OSDA 4IQXA 2LQJA 4ZVFA 2OFHX 3AHPA 2JFDA 4DPOA 3HHLB 2R42A 5DZ6A 1T3NA 3E01B 3D0GE 1RAJA 1X4CA 3G82B 5D3GA 1RUSA 1NH7A 4ZPDA 1UFWA 3QIPA 1JLBA 1B0VA 5CA5A 2FJVA 2LEAA 5HLFB 2XY7A 4ED5A 5G0RB 2XI3A 4ES1A 5L1LA 2MZQA 3QGHA 4ELTA 2VPZB 3QT8A 2OELA 4U9RA 3GU0A 2QFJA 3NS5A 5LJ3Y 4CLPA 1OYEA 3AJDA 8AT1B 1U25A 4LF4J 3DLLQ 2H5JB 1RTZA 4NOHA 5KFDA 3NEKA 1FJGF 3HZEA 3G4SS 3W60A 3MOZA 3PW5A 4DV2J 1FNOA 1CQNA 2KVQE 3C14A 2FLPA 2RQ4A 4ZHRB 2R7TA 3ZZPA 3GSDA 1RBLA 3CCWA 5CYMB 4NCGA 1NK9A 2X3GA 2DIUA 2HNDA 2EXUA 4USWA 4DL7A 1UJ4A 3MUMP 1YZ7A 3G8TA 3QT6A 2DXDA 2LKZA 5DETA 4JBCA 3TO8A 4J9UE 4TN2A 3TRGA 4Y3CA 3LUYA 5BXIA 3RUBL 1Y11A 4F2SA 4CM0A 2R7UA 1N8RT 1RT2B 2QG9B 2MKKA 4O3SA 2Z30B 3V6JA 3BO3A 4ZPVR 2WRMA 3R27A 1UZHA 3MAQA 3PJXA 1FK9B 2D7SA 2HNZA 1TMMA 5J2NB 3FK4A 2IRYA 1UWBB 4PQUB 1SL2A 2HQCA 4BHQA 2XLIA 4F0KA 1N34F 4NXNJ 3V4IA 4TY8B 2QL7B 3VAGA 5F8JA 2F1FA 4Q0BA 2CXEA 3I87A 3OSNA 4KHPF 2E1MC 5B0DA 1JLCB 5C5JA 3ENVA 4RBVA 2Q66A 3BN4A 1RWUA 3VGTA 3SZ2A 1ZOTA 3OL8A 4LF7J 5KT5A 1T9TA 4URQU 1BC6A 3HT0A 2GO9A 1T02A 2AQ4A 3HHLC 2FVQA 4PWDB 4ALZA 2UUBJ 5HVGA 1LV5A 2PEHA 4J9LA 4L76A 3CCUS 3FRYA 4IOAQ 4IFVB 5DGBA 3NWRA 2FJAB 3ZZTA 2P8IA 4LF9F 1CSJA 3DLJA 1NPKA 2RHSB 4PXBA 4LFCF 4O44A 3DDIA 4C0BA 1JLQA 1EQMA 3BH6B 2IC3A 2ZITA 2PIIA 3ZTPA 2WB1D 3P8BB 2V4JA 2RUSA 2M9KA 2PI4A 4BWJA 3WQPA 5GMKa 2ZH7A 3OD2A 2XHWA 2MZJA 2Q6BA 1GNKA 2WBRA 5KFLA 2KXHA 2V2ZA 3OV7A 3H90A 4C48A 1SC3B 4UOGA 2NPFA 2HHVA 2IJFA 2R8HA 3IC1A 1S57A 3MFHA 4LF4F 4ZCKA 4NZ6A 3MM5A 4K4SA 2V8HA 4FYXB 2FZGB 2UVWA 3FBFA 4U7UD 4TXSA 3G96A 3B4DA 2H54B 3DRXA 3NCQA 3M1VB 2O67A 4NMLA 1U0HA 1DLOA 3H0PA 2CDQA 1RDRA 2KU7A 3HSDA 4CTAA 3MR5A 4OYPA 2ZH8A 2GJ2A 2E29A 2BBEA 4DS5A 2XMWA 4C3MA 1ZA1B 4DV6F 5THWA 4CO4A 1FJ7A 4DUZF 4R8UA 3TVKA 1KNZA 5EX0A 2VBWA 2OHDA 4MFBB 2DPIA 2F8EX 4CH7A 3C16B 1A0OB 1IVZA 7FDRA 3TZWA 4ZA1A 2CQCA 4KE5A 2F9JA 3G9CA 1LWCB 3R5DA 1G3OA 3F56A 2K06A 5B0FA 4IH5A 1M0SA 3HT3A 1UFKA 4Y65A 2DNMA 2FIUA 1NJXA 2ZVSA 3FBEA 4RU2A 3PR4A 2HKEA 2M5YA 4PRFA 4DSIA 3PEHA 3V6HA 2RT3A 2WK4A 3W65A 4I7FA 3GFXA 4WE1A 9ATCB 4FKYA 2DO0A 5A8WB 4YDXA 3M8WA 1YJVA 3TJ9A 3DLGB 4QR0A 4Z37A 4MKYA 5E2QA 2DBBA 2M8HA 2RNEA 1Q78A 2IMWP 3G2XA 1NMEB 1QSSA 2XQCA 1JLGB 1VQ7S 4U96A 5IC4B 3UDLA 3G6VA 4DL3A 4WU3A 2B7CB 1NM2A 5I4MA 4RWXA 4B9VA 2B0GA 3GP9A 4CQ1A 3CJKB 3RYLA 2DGWA 1XWLA 1P8GA 1H7WA 2J9EA 2PE8A 1PJ7A 5JXSA 4PAAA 3LAMA 2F5GA 4N56A 4CDIA 1CJKB 3NRBA 4LFBF 2BJ9A 3BYRA 2DRBA 1A9NB 1DQAA 4Y6IA 1Q7YT 1W26A 2G4BA 1T9YA 5F0WA 2VPXB 4FBTA 5ETTA 4G1QB 3R5CA 3POTA 2E44A 2WTFA 1R3NA 3GR0A 4FNIA 2QEXS 5IFMA 2Q3PA 3LP2B 4ZVHA 3PX4A 2B8QA 2MQQA 1FDAA 4KGXB 5L8RC 1S48A 2ASLA 3CDEA 5KFJA 1RE1B 1HA1A 5JJBA 4N5SA 3THTA 2R8IA 4ES3A 3Q8UA 1TUWA 2JOQA 3OFEA 3QRRA 2VQEJ 3FVYA 1VLOA 4JI8J 1LW0B 1WC0A 2EC0A 2OSRA 2CQIA 1KFDA 3VV2B 1YTYA 4DF8A 3M8YA 1B4SA 1XC9A 1K44A 1PSDA 3H8YA 2W2PP 3EGNA 4WPAA 3VAHA 3I6PA 3HFKA 3OR1A 1KP6A 2DNRA 4J7CA 3AB4B 2CQ0A 4JI4F 4F67A 4D3GA 1KSPA 1QAXA 4B3OA 3EWGA 4ED8A 1CLFA 2DNPA 2GGPB 2ALYB 3FC9A 3KG1A 1N5QA 1RKIA 5KOXA 3PCOB 5BYSA 3I4PA 1B70B 4QR1A 4MIWA 4DZ6A 2EFPA 4N41A 2X1AA 1JLAA 2EFQA 2V5HG 2VODA 2ZDPA 3PYGA 1JJCB 4OFZA 2W9BA 2YX1A 2CZ4A 2RS2A 1YKWA 5I3UA 2E5LF 1ZH5A 3KJVB 4BWMA 3K5MA 1K8AT 4CLKA 2ROPA 1YI2S 2IM1A 3PX6A 1JNZB 2W01A 4ZJOA 4O4GA 4ZVUB 2N82B 3CCMS 1UFLA 2H1YA 3VWSA 4MIBA 5F9LA 3Q24A 2BE2A 2B51A 2QSWA 3NL0A 4DSFA 4EBCA 2XG8A 1EP4A 5C2GA 1N6QB 1N88A 2CJKA 3KLHA 5K14A 3CJ5A 3QJPA 5U47A 3RG6A 3CVKA 2A0FB 1IKXB 4DXLA 2OPPB 2MKIA 1BQNB 3HMJG 4WYLA 2CPZA 3IWNC 3BSNA 2R7RA 5B0BA 4QU7A 1YVFA 4S0MA 1CQMA 5D77A 2OTLS 4OLPA 2C3OA 4ZVQB 1GQEA 2BR0A 2ZUAA 5KFUA 1RU2A 5RUBA 1VIOA 3FGVA 1V5VA 5F3ZA 1DTTB 2Y8YA 2AGPA 4L72B 3NS7B 4NLDA 1YZ6A 4ER8A 2HRYA 3GIJA 5IZHA 4KO0B 4ZPBA 3MMCB 1EKRA 1VK8A 2WB4A 4UUWA 1R0CB 1N0VC 4Q45A 4W98A 3FEYB 2B56A 2K1RB 4O3PA 2CQGA 4XPEA 1KHVA 2ZC3A 1I5OB 2MLZA 3MMJA 1RT6A 4OI1A 2VQEF 2ZZNA 1TL7A 4M5HA 2V8GA 3KLGA 1F5BA 2ROEA 1RT5A 1J5OA 4TU7A 5HATA 1XJWB 2MDAA 2FVPA 3G6ES 3JB9k 1N5YA 2W1BA 1KBRA 2VF3A 1LNQA 3RW6A 2BW2A 3D3BJ 5C7PA 4ID8A 3MM9B 3OT9A 4DF4A 3CD5A 1LWEA 1Q4RA 4AL6A 1BD6A 4ERDA 3KLEA 1U47A 4PKDB 3LWLA 2IJNA 2CPIA 2IVMA 2DR9A 3M6VA 4W4MA 2RF2B 4OZLA 4YY3F 4UF4A 3MM6B 4ZS6A 2VONA 1TUVA 4GVBA 2C22A 1TL3B 3H40A 2KT5A 1I94J 2QV6A 2PFDA 2AGOA 2ABYA 5HVFA 1MW7A 4RUCA 3HX9A 4WP3A 1O6XA 3JS9A 2HRUA 4FPIA 2V8DA 5HBMB 3QLHB 1EETB 2MHNA 3UCZP 1MMLA 3CJTA 3W3SA 1PBUA 2VPYB 2QYCA 3M2UA 2ZE2A 2Y1IA 2R7OA 3IS9A 1SJ3P 2R2SA 1G7CB 4K4WA 2A3JA 4KBIA 4OI0A 3ILJA 3RU0A 3KOAA 2CNOB 2GMLA 1R0BG 1ICEB 2WAQD 1ZM9A 5DM7Q 2A2CA 1QVGR 2JL9A 3HSZA 1QAJA 2VA2A 4E98A 2AYEA 3LWMA 4F4YA 3MPDA 3K5NA 2ZWPA 4URGA 1AXQA 4DI6A 3HHDA 1OPZA 4WF9Q 4WFNQ 2XMAA 2DXEA 4ZVPB 2VASA 1NEEA 2MLYA 1AZSA 4J9PA 4K7QA 4MYTA 5ETMA 3T1YF 3IXQA 2XGPA 4WP8A 4DX6A 1K73T 3CTRA 2MZRA 4Q43A 1M90T 3MM7B 1HNIB 2AZ3A 4J90A 2UV8A 1S4FA 5IV4A 1APSA 1KRPA 1CS4B 3I5BA 4DV0J 4IG3B 4WBFA 5IT4A 1YJNS 1C1BB 3O44A 3CSKA 4O3OA 2IDLA 2ZBPA 3C66A 2RKIA 3RZAA 2CG8A 2ZEJA 4RW7A 1PAUB 1E6VA 1JLFA 3OHBA 4ZLJA 2VKRA 2W2MP 4NMXA 3M05A 2Y1RI 2VPWB 3SEOA 2Z57B 3OUYB 4EBEA 5LOQA 4QR2A 5DG9A 4FBUA 4DV7F 2W9CB 1PCAA 5HJYA 3BBFA 2X1FA 4K4UA 2KTQA 3M30B 2P9CA 2JEIA 5A2QU 3MM8A 4B3TJ 4A8WA 4ZP8A 2HSEB 2VDHA 4HKQA 3D6HB 1RTDB 2PN6A 1RTIB 3PHEA 3T9ZA 1ZYQA 2NUHA 1F5CA 2Y3YA 3C6TB 5DDOC 1SH2A 3T5KA 4OX8A 3JTNA 4PWWA 1B64A 1NKCA 2MYFA 4KR0B 1R6VA 2XLJA 4MKAA 1IR1A 2C1EB 1S9GB 1U1KA 3GV8B 2MY8A 3IN5A 1X5PA 1VDHA 1GXLA 1X0PA 1OY8A 4ZVSB 3OFHA 2ALZA 4A8OA 4OYXA 2G13A 4ZVOB 2AD9A 3AJ2A 2WVDA 4ATNA 3BGRB 2BRKA 4ENOA 2MEWA 3VGVA 1TL1B 3JSRA 5DLFA 4RBUA 3OTDA 2QLJB 2KG0A 1BLUA 2FUG9 4DL2A 3I32A 4DU8A 2LEBA 2CADA 3K2YA 1CJTA 4FP9A 4RPFA 3QNWB 5K8PA 2OPQB 4JI5J 5LMNF 1SH3A 5LMUF 4X4PA 3CDUA 4NE9C 4IDKA 4CLSA 3S01A 3MR6A 1SPBP 1TZ0A 3NKYA 4A46A 2YY3A 3OLAA 4USTA 2EVZA 4FVCA 3K0JA 1DBDA 1HMVB 4JI2F 3IWLA 3W5YA 3KK2B 3D1QA 1FFWB 4XPCA 3HP6A 3R1HA 1Y0HA 2IYIA 4DFMA 4TLRA 5M2UA 3MAAA 2I38A 3QJLA 3KG0A 1K9MT 3ZC4A 4WZMA 4HACA 4P10A 3FFIB 2J0XA 2IAJA 1R43A 1S0NA 1ZA2B 2BOAA 4K4YA 3VAKA 3VTIA 1YBAA 3UE2A 1S1UB 5GMDA 3JTPA 5ETQA 5F8GA 1UZDA 3RAXA 4FYWB 1RT3B 4DCPB 2HS0A 4CO3A 3EGVA 5KG5A 2FLNA 3FCHA 3N5BA 4NLOA 4F8RA 2I5JA 4BCAA 3H2VE 4DCJB 2Z2LA 2AYMA 1NLKL 4IOBA 2D9PA 2AZ1A 3W1YC 2QZ8A 2D3O1 4X66J 1ZBTA 3AT1B 5DLGA 4IR9A 4PUOB 5C25B 2JH3A 4P2MA 4LBHA 4NWBA 1I6JA 4C2MA 1HWJA 3RRGA 4DV1F 1E6YA 2PO4A 3WX4A 2LECA 2EK6A 2BANA 3AQPA 4CH1A 3KHGA 4I2PA 3ENWA 3KK3B 2DGXA 4Y0FA 3IFEA 4U7CA 4OLOA 2D9OA 1B0PA 3P4UB 1V9OA 4NEZA 3FZ2A 3TUJC 1SKRA 2NXCA 4ELVA 3KHHA 8ATCB 1Y3JA 1DY3A 4EEYA 2LFVA 4BC7A 1S79A 1VISA 5A6PA 1SB6A 4ICLB 3VQTA 2C2ZB 2FVSA 3OL9A 2VOOA 1MWYA 4ZIWA 5M2RA 5CD4A 1UWAA 5F41A 4PG6A 1C0UB 3TA2A 3CO0P 2B3TB 3WHIA 4H4MB 2OEMA 4IOCQ 5G4DA 4UTGA 1IUJA 1P9YA 2OD6A 3BGFA 2QO3A 4OZJA 5D4NA 1SQEA 4CH0S 4F7VA 4ZCLA 3NOGA 3BKUA 1FJEB 2IJRA 1HQ2A 2AX1A 1TV6B 5EUHA 1F3FA 3HVRA 3B78A 2RDDA 3PIPQ 1NHUA 3NWGA 1S1WB 3L3CA 5L9NA 3QO9B 3VF0B 4J9SA 2DT9A 2HRTA 2KJWA 2DY1A 2QLFB 4LF6J 1P1TA 3RAMA 3GV7B 2CZVC 2XWXA 5HMYA 4YOEA 2ASDA 3FRZA 4PPZA 1VQYA 4JI6J 2IA0A 4LF5J 2G0CA 1VQMS 1S1XA 2CQ3A 4J9KA 2KM8B 4X4NA 2QA1A 1Q5VA 1KOOA 5DQHA 1FHTA 5A8KA 2D3ZA 1T9VA 2ZVIA 2MKHA 4OX9J 3NNCA 2OO4A 2KN4A 3J81U 4PG8A 2J9DA 5HROA 1NDCA 3T3FA 3HD1A 3RTVA 2HGNA 2Z4PA 5KT4A 3KLFA 3AA8A 2HIQA 3I0RB 4QIFA 5KFOA 4ZP7A 1RA6A 2WZ1A 4ZVEA 2HHHJ 3HFZB 2LQ8A 3KUEA 4AD6A 3BJYA 3HVWA 3NMAA 4IH7A 5LL6d 4WP9A 2DR5A 2U2FA 3C19A 3W9JA 4L3NA 1U26A 2LXIA 2BDPA 5HMXA 1P6TA 2ZH9A 2AIRB 4O3RA 1XMOJ 1TK8A 2GC8A 1HLWA 5T7LB 3AD7C 1WF1A 7FD1A 1VYAA 3U1LA 3C14B 3R5GA 2DRAA 2MLXA 2HWHA 3IR6B 4CNZA 3GSIA 4ID5A 2PFFB 1LEOA 1Q7LB 1SH0A 3WZ0A 3KLIA 5M2PA 3CE8A 3EVOA 3CNQP 1BY9A 5CYJA 1WI6A 4M95A 2XSJA 2VUGA 1JJ4A 2OPRB 3SCIE 3DDNA 1NDKA 4MK7A 2J7UA 5J1NA 4TU8A 2CWXA 1PYOB 2XGQA 1JQGA 3IAM9 2R8JA 5T41A 4ECSA 4FDFA 1N48A 1KTVA 4KHMA 4C4WA 3BEGB 2GS8A 5CD4H 4ED0A 3ZZZA 5IM0B 4RW8A 2FLLA 4WU2A 1JMTA 1NHVA 1QLNA 3BDPA 2HNZB 2DNGA 2KO1A 2R3VA 1VC0A 2OTJS 4ZN3A 1GK8A 1VOMA 2H4YB 2KM8C 1HI1A 2XNQA 4U95A 4E0DA 3B82A 4Q0BB 4JP8A 2PA3A 1GMVA 1FI4A 3ELHA 2DNOA 4ANEA 4ED6A 2CYYA 1VBXA 2IRUA 1UTAA 5LM7E 3ISND 1Y3KA 2VG7A 1C2PA 3EGZA 1YJRA 3PRVA 2ZZTA 3DRSB 3FMBA 3OVBA 2OSQA 3KG4A 1YBTA 3H5XA 3PW4A 1VC5A 2X51A 3ADAC 3MMAB 1C1CB 3H2LA 1B7YB 1FDNA 2OPSA 1EKSA 4YB5A 2NR0A 5E3RA 2VIHA 1KVIA 3I4HX 1HBMB 2UUCF 1UW9A 4OHXA 5DDPC 4ZLPA 1S9EA 4AL5A 1VGYA 3OLBA 1X5TA 4OYWA 4IUFA 2RB7A 3BO2A 3QGPA 3N79A 4RW4A 4LSLB 4V19J 2RRNA 1WTFA 3GG0A 1S6UA 2FY8A 3LP1A 2VDIA 1HBOA 1N0UA 1RADB 3KUHA 4JI3J 4DFKA 1VRUB 1X8DA 1FO1A 2DH9A 3IGNA 5L9XA 1RQ0A 2HMIA 4DR5F 3IGVA 2XI2A 2LXUA 1DTQA 3RGIA 1YJUA 3V81A 2W4CA 3S6EA 1YJ7A 1BHNA 4UOFA 1GH8A 1X4AA 4J5OA 1V6HA 3PX0A 2VJVA 3LOUA 2FVCA 2WVFA 3FQLA 3NNAA 3QIDA 3CC4S 5KFWA 3ET6A 1R6YA 3I0SA 2CQBA 1HQUA 4H4OA 1ZPWX 3JQKA 2HBYB 4DPTA 3BGUA 2M7SA 4ED1A 3I9ZA 1SJ1A 5ETKA 1XERA 2A2DA 4Q7AA 2V8PA 4K2JA 2NZ4A 5F8MA 3PKMA 1FRLA 4Y2AA 1HFEL 3PO4A 3ISZA 4NYZA 1WKLA 3CCLS 2HFVA 3FEXB 2XB2D 1PIEA 2UU9F 3QYYA 4NPOA 3SSRA 1EJ7L 2CQPA 1ZAXA 2XWYA 2L9WA 3DM2B 4KPYA 3D1OA 1LK5A 5A2QY 3B4MA 2B7BB 3SDEA 2G9OA 4URSA 4WTOB 2F9DA 3M8PB 4JI7J 2CAJA 4ZP9A 3UD5A 1R0AA 2E1RA 2MHEA 3CJ0A 5GAHU 5HN0A 2XYPB 2ZH2A 4EZ9A 4YUDA 3GIIA 2D1CA 3BREA 1VQNS 4HYKA 3GYXB 1B99A 4I2QB 1VR6A 3THVA 1FWKA 5C42B 2UUTA 5KFFA 3W2WA 3KLVA 3SCKE 3JSMA 4KB7A 4LT6A 3QRPA 1ZM4A
chains in the Genus database with same CATH topology
2PI4A 1ZM3A 3HM9A 4BWJA 4JV0A 2RD5C 5GMKa 2ZH7A 3MWBA 4RW7B 1WHXA 2XHWA 4JV2A 1E6VB 1ZM2A 1JLFB 2MZJA 2Q6BA 3G8QA 4ED2A 1GNKA 2WBRA 3FSXA 1S6OA 1JIHA 3RW7A 3MOJB 3OTOF 5KFLA 1VQ5S 2GQCA 2KXHA 2RU3A 1D3WA 1JXLA 2NQPA 3MR3A 3DRPA 3GWCA 4ECQA 3OV7A 5J1EA 4ZPCA 4K50A 3O3LA 2WCXA 3NBPB 2NPFA 3PRBA 1RGVA 2XMMA 4WXWA 1IQZA 4J9RA 2FD2A 1T05A 2IJFA 3FFIA 2R8HA 2JFKA 2HHVA 3K7RA 3KK1A 3IC1A 1HBNB 2JLFA 1S1VB 3M4XA 5GAHI 4J9MA 3POTB 4ZP6A 4IG0B 3MFHA 1C4AA 1T94A 3IWXA 1QUVA 3D2WA 4IRDA 4LF4F 5DM6Q 1XR7A 4ZCKA 4NZ6A 3MM5A 2MQOA 2YNGA 4AYBD 1TVRB 5IWAF 4K4SA 3CD7A 2V8HA 2UVWA 1FKPA 4Y34A 5C24A 4TXSA 3G96A 3HXMA 4YOEA 1S1UA 2LA4A 3B4DA 3CD0A 1T03A 1FEEA 3US5A 3DRXA 2WSCC 1S76D 4KGMA 2AP6A 1KLNA 3TA1A 2KFYA 3NCQA 4HEA9 4LUBA 4RW6A 1QAIA 3M1VB 2AYBA 2O67A 4NMLA 4F2RA 2BOPA 1DLOA 4DV3F 3MGJA 1RT3A 1UL3A 4F4KA 1F0XA 2CDQA 1OPIA 1RDRA 3MHYA 2KU7A 4CTAA 4X65F 2PMHA 3MR5A 4I64A 1N4LA 3PW7A 2ZH8A 2GJ2A 2E29A 2BBEA 1V3ZA 3ONQA 2RQKA 4DS5A 2PT0A 2YH0A 4TY9A 2XMWA 4QWEA 4C3MA 3BQ2A 4CIOA 4DV6F 5THWA 2RQMA 4CO4A 1U7LA 1FJ7A 1KQFB 4DUZF 2CJBA 4V19X 4R0EA 4R8UA 3EX7B 3TVKA 1YRTA 1DJ0A 2CQ4A 1TKDA 2ZOFA 3MEDB 4AXIA 3JAMY 1KNZA 5EX0A 2YKMA 5E41A 2MJUA 3FNNA 1FVSA 2VBWA 2ACYA 3HKWA 1SKSA 3EZ5A 4C8MA 4LIRA 2ZKUA 3O6QA 1VFJA 4MFBB 2DNQA 3DRYA 5KFIA 2GFFA 1L3SA 2F8EX 2DPIA 4CH7A 1S9FA 3D1HA 5C25A 2E9RX 1XMBA 4AXJA 2HLUA 1RT4A 2CIMA 5DRKA 1AFJA 1F2GA 3FQKA 4K59A 7FDRA 3N0VA 4ZA1A 1M5HA 5D6GA 2CQCA 3DLKA 3I31A 3ZZYA 2NPIA 4QPTA 3CULA 4KE5A 2IMOA 2F9JA 3O2IA 3G9CA 1T3OA 1JK9B 5DG7A 1LWCB 4DHVA 4ED3A 4QWDA 4ETXA 2RDJA 1KR4A 3R5DA 1FRMA 1G3OA 3F56A 1FDDA 3V5RA 1U49A 4CO1A 3RB0A 3NP5A 4CCHA 2LDYA 1HR0F 5B0AA 4DQSA 1YSJA 3VAJA 5KFMA 1KQGB 3PY8A 5B0FA 2HYIB 4IH5A 1M0SA 3HT3A 3KK3A 2YKNA 5A8RA 4Y65A 4ILMA 2DNMA 3U27A 3HHEA 2FIUA 1NJXA 2ZVSA 4PXCA 5IT0A 4RU2A 3PR4A 1VQKS 3HDSA 2M5YA 1X4EA 4X4QA 4PRFA 2DCLA 1H3DA 4ZOSA 5KFQA 2GJIA 2FJEB 5DDRC 4DSIA 1JKHB 2QA2A 2ZD1A 1Q8LA 2CPJA 4G1PA 3PEHA 4LF8F 2VC1A 2G1DA 1R8CA 2BM0A 2RT3A 2WK4A 4DL0C 4I7FA 5L38A 3GFXA 1RJJA 4WE1A 1JLCA 5JUMA 4UY8T 1S0MA 4JI1F 2HNYA 4R25A 1VQLS 4IKAA 4U6PA 2J9DE 2DO0A 1FTRA 4KIAA 4QIWD 2W9BB 2O3DA 1FEHA 4X62F 2ILZA 5A8WB 4YDXA 1YJVA 5EWGA 4P7TA 3OHAA 2CPYA 4WK1A 1WHYA 2JJ4D 2KFZA 3DLGB 4QR0A 4Z37A 3Q8RB 4IDKB 5HP1B 4MKYA 4ICLA 2DBBA 2M8HA 5E2QA 2RNEA 5EGYA 3MR2A 3KKFA 1Q78A 4IH6A 4LFAF 1FTCA 2JEFA 2IMWP 5B0EA 1QTMA 5JVHQ 3DXBA 2OKQA 4Y2MA 1QSSA 1JLGB 3BS9A 4N8NA 1RTHA 4YDDB 2W4PA 2K7JA 3MEGB 4CT9A 1VQ7S 2O1PA 4OQJA 2SXLA 1X5OA 2B4OA 2FJWA 3UDLA 3G6VA 2YH1A 1LW2A 4DL3A 2WHOA 5DO2A 4WU3A 4FNHA 3HKZD 2B7CB 3PDNA 4TYBA 2I1RA 2I2YA 5I4MA 2MKJA 4KAIA 4RWXA 4B9VA 3D0IE 2EI5A 1UEUA 1HQEA 1X4DA 4MK8A 4RW9B 1QSLA 1C0UA 3U02A 2B0GA 1A6LA 2J7KA 2OMOA 4CQ1A 4N76A 3CJKB 3RYLA 1XWLA 2DGWA 1WG4A 5CHCB 3MCSA 1P8GA 2O66A 1H7WA 2I9SA 4I56A 1KONA 2J9EA 2PE8A 1FKOB 4H4MA 4OI3A 5JXSA 1REVA 5CXTA 3LAMA 1TL4A 4Y2IA 1TK5A 4C0HA 2P6SA 1UVJA 1N5VA 1MROA 3O5TB 3PFOA 4ES2A 4N56A 3NRBA 1JXEA 4GMKA 2BE2B 2UUAF 1VRTB 3E8OA 4C3KA 5LXYA 4DSKA 5KFXA 2EFNA 4I6YA 5F3TA 4LFBF 1GX6A 3QMQA 1AUDA 2IAJB 2DRBA 5KAKA 3MEEB 1YITS 1A9NB 2QLXA 1DQAA 3N6LA 4LMZA 2EPIA 4Y6IA 3RAQA 1Q7YT 3KLHB 1IKYB 1URNA 2G4BA 1VHFA 3BB5A 2HZCA 1GX5A 2W24A 4NXMF 5F0WA 5HL7Q 4A8QA 4FPRA 2VPXB 2JEJA 4FBTA 1TKZB 4HI1A 1TV6A 5GAGU 4FF4A 2YKPA 4G1QB 4MMOA 3R5CA 3POTA 4KRWA 2ZH5A 2KZZA 2E44A 2RS8A 2WTFA 1R3NA 3GR0A 4DR4F 4FNIA 1IKWA 3OFGA 2IBKA 1X9WA 2QEXS 3DCAA 2Q3PA 5IFMA 5BR8F 3G6YA 1HBUA 3QO9A 4DR1F 2YX7A 1NB7A 3LP2B 4I68A 2HWIA 1N56A 4C3LA 2K3IA 2EK1A 3DMJB 2B9WA 1UP1A 2FDNA 3VZIA 4DR3F 2RE1A 3CJ2A 4ZVHA 1H0HB 2I5JB 3PX4A 2B43A 3MPVA 3NS6A 2GNKA 1CC7A 4B3MF 3CUNA 3M1VA 3DXSX 3DOKB 2MQQA 1FDAA 4YB6A 3N6MA 5L8RC 1S48A 4FF2A 3DRRA 3G8SA 1XEZA 2ASLA 3CDEA 4IYQA 1YG0A 5KFJA 1HA1A 4KFBB 5L1KA 1VQ4S 5JJBA 5T14A 2CJ9A 2FHKA 4N5SA 3THTA 2R8IA 1WHWA 1IJFB 4DR2F 1VQOS 1HNVB 4ES3A 3FDSA 1L3UA 3H5SA 2CQDA 2EBEA 2YNHB 1T7PA 4DSLA 2QMXA 2DITA 1R7IA 2JOQA 2HG4A 3OFEA 4C7QA 4CO0A 1RK8A 3I55S 4ECVA 3FVYA 1E6YB 2CQ1A 2J76E 2VBYA 4WXOA 1LW0B 4DV1F 2EC0A 1I94F 1FJCA 2OSRA 3OR2B 2JLGA 2CQIA 1KFDA 1LQ9A 2BANB 5F8HA 1YTYA 1K0VA 3TAQA 1HD0A 4DF8A 2DNLA 5KFZA 4PR6A 1CC8A 1XC9A 4WZQA 1PSDA 3E51A 4BDPA 4I2PB 1RI7A 2RILA 4UW2A 5FDLA 3H8YA 1Q53A 2WOMB 1NJWA 3RR7A 3ZZUA 2UXBF 3C3LA 1UKUA 1RTJB 2MB0B 1IR0A 3EGNA 3VAHA 3I6PA 2EFVA 3HFKA 3OR1A 3TAMB 2B5JA 1ROFA 2DNRA 3AB4B 5FD1A 2CQ0A 3M6XA 4JI4F 4ECTA 4F67A 2KT3A 2AJFE 3KNGA 4D3GA 3M9OB 4HH1A 1KSPA 1QAXA 4B3OA 4ED8A 1R8PA 3I0RA 2HHTA 3QAUA 1CLFA 2DNPA 1PO6A 1SL1A 4J37A 4M5DA 2GGPB 3KHLA 3DHXA 2IBOA 3KG1A 1N5QA 4J9OA 2NREA 1XNQF 1RKIA 3GG1A 5KOXA 4DFPA 5BYSA 1XNRF 2J8AA 2YNIA 5DJBA 1S6QB 2HWTA