3QO9B

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tsao-t, a non-nucleoside rt inhibitor (nnrti)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ ribonuclease H
publication title Crystal Structure of tert-Butyldimethylsilyl-spiroaminooxathioledioxide-thymine (TSAO-T) in Complex with HIV-1 Reverse Transcriptase (RT) Redefines the Elastic Limits of the Non-nucleoside Inhibitor-Binding Pocket.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
total genus 105
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qo9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9B03
5F8NA 2DPJA 2HNYA 5L1LA 3DOKB 2BE2A 5KFRA 1N56A 5F8LA 3V81B 4RW6A 2HAIA 5KT7A 1TV6A 5CYMA 1MU2B 1S6PB 4PUOB 3M9MB 1RT2A 4TY8A 3OSPA 2IM3A 4Q0BA 1DTQA 1GX5A 2XGPA 3CIZA 4KHRA 1TKTA 1LWEA 2WOMB 4I2PA 5C25A 5KT3A 1EETB 3FSIA 2HMIA 2W8KA 4FBUA 4K4SA 1RT6B 4KHMA 4R8UA 3I0RB 3NBPB 4TYBA 4TY9A 2AQ4A 5I42A 4WXWA 4WXOA 3KJVA 1DTTA 3MEDA 3CJ5A 1KLMB 3EPGA 3OL9A 1RTJA 2BRKA 1XR5A 2YNHB 3MTKA 3D28A 3ICLA 4ZMMA 4NCGA 4ZPCA 4QWAA 2ASLA 3KOAA 2B6AB 4R5PB 4J9NA 1BQNB 3QO9B 4MFBB 2BQUA 2JC1A 1U09A 2IM2A 4H4MB 4O3SA 1SV5A 4ZPBA 2HWIA 1SH3A 4ED6A 4NLGA 2RF2A 1C0UB 2B5JA 2UUWA 4ZHRB 3BQ2A 1S1TB 4ECQA 3V4IB 3KLGA 4IH6A 1S1VA 4KAIA 5DLGA 2HNZA 3Q8SB 4ICLA 1KHVA 4WYLA 5KFTA 3JYTA 5C42A 3PHEA 1IKVA 3IG1B 4MH8A 3C6TA 3DRSB 1S9GA 3BSOA 1HPZB 4I2QB 1JLEB 1RT4A 5HLFB 2FVQA 3BSCA 3NAIA 1TP7A 4URQU 4MK8A 3CVKA 4YR2A 4QW9A 2B43A 1JLFA 2VG7B 5J2NA 3PJWA 4JV0A 3SFUA 5KFMA 3MFIA 5FDLB 2AGPA 4O4GA 4RW4A 3V6DA 3KHRA 2E9RX 4RU9A 3RAXA 4F4WA 2FLLA 2IJNA 3KLFB 3BGRA 1TVRB 1JLCB 3NGDA 2AGOA 2AX1A 4Q43A 3M8QB 3VQSA 1LWCB 2ZE2A 3ISNC 2YNIA 2XCPA 3MR6A 3CWJA 4F4ZA 5C24B 2R8JA 4ZVFA 3DRRB 4EBDA 2C28A 4YQWA 1RT3B 1HQEB 3V6KA 2ALZA 5KFYA 2AGQA 1IKWB 3V81A 4J9QA 4RZRA 3BREA 1FKPB 1S1WB 4NLOA 5KFGA 4FBTA 1MU2A 4WE1B 2W9BA 4ED1A 1NHVA 4KO0A 5KG0A 2IM1A 2WRMA 2XI3A 4Q8EA 4EBCA 2WOMA 4NLVA 5J2PA 2FVSA 3V6HA 5KFCA 2C2RA 1S4FA 3OL8A 1RT6A 5I3UB 4NLSA 4QWBA 3I0RA 3NBPA 5EWEA 1S6QB 1KLMA 3MEGB 5DLFA 4U7CA 2YNHA 5KG2A 2YNFB 5EUHA 5EWFA 4QPXA 4TXSA 1S1UB 4NRTA 2W9CB 4R5PA 5J2MB 1BQNA 3ITHA 3QO9A 4MFBA 3TAMB 2W8LA 3PW0A 1JXLA 4PWDB 4ED3A 1HQUA 3KMSA 1I6JA 2WK4A 5KFBA 2WCXA 5KFOA 5KFQA 5EDWA 3FFIB 4QWDA 2JEIA 1IKYB 2BANB 1C0UA 3LP0B 3JSMB 3KK3B 1RYSA 2ASDA 3KK1B 4ZHRA 1HYSA 5KFKA 1S1TA 4XO0A 3V4IA 4TQRA 2ZD1A 2QV6A 4IG3B 3LP2B 3CJ0A 3N6MA 3IG1A 5DQGA 4IKAA 4RNOA 4KBIA 4MK7A 4ZPAA 1HPZA 4I2QA 1JLEA 2E9TA 5HLFA 3NKYA 2JEJA 1TKZB 2W7OA 2BRLA 4LSLB 1RA6A 2W9AA 3NL0A 3DI6B 3DMJB 5F8MA 1S9EB 3GYNA 2YNGA 3KNAA 1N5YB 1JLGB 4M95A 1TL1A 5FDLA 1RT1B 4EO6A 4NLDA 4IG0A 4XPCA 2F8EX 2ILZA 3KLFA 5KT2A 1TVRA 1JLCA 4YMEA 2UVVA 1FK9B 3M8QA 4NZ0A 3PW5A 2OPSB 3LAMA 1REVB 2DPIA 1J5OB 2IAJB 4H4OB 4ZVGA 1RT3A 2YKNB 3KLVA 1HQEA 4DEZA 1RA7A 4YR3A 2J6TA 1JLQA 2AX0A 4JV2A 2FLNA 2QE5A 1S1WA 5DQIA 5C5JA 4ECTA 4WE1A 2R2UA 1LW0B 3T5LA 3TVKA 1TKXB 2HNDA 5DG8A 4NLWA 3GILA 3RB4A 5J1EA 3TQ1A 4KKOA 1RTIA 3KLEB 3CJ3A 3BSAA 1IKXA 4ED8A 1C1CB 5KFNA 2FJWA 3KHHA 2UVWA 2IC3B 4TLRA 1TL3B 2GIRA 1S6QA 3MEGA 3DDKA 4O3NA 3KLHB 2YNFA 3LANA 3CDWA 1ZTTA 2V9WA 2YKMB 1CSJA 3QYYA 1S1UA 3LP1A 5J2QB 5J2MA 3QIPA 1MMLA 5CYQB 1HNVB 3TAMA 2FJVA 4QWCA 3GIIA 4RW8B 3E51A 2EC0A 1R0AA 3IRXB 3DLGB 4WFZA 3IGNA 5KFWA 5DGBA 1QAIA 4B3OA 4K4ZA 3I0SB 3OLBA 4J9SA 3C6UB 4LSNB 3JSMA 1C1BA 3KK3A 4Y34A 4IDKA 4ECYA 3M8PB 4WFYA 5KFEA 2J6UA 1SUQA 5F8IA 4IQXA 3DLEB 1RT7B 3PW2A 4G1QB 4IRCA 2R8KA 4IG3A 3LP2A 4ECVA 2V0NA 1BQMB 3KHGA 5KG4A 5KFAA 1JLBB 3GIKA 1C0TB 4IFVB 4WFXA 4Q8FA 1S0NA 4K4VA 3MEEB 4NRUA 4EYHB 1VRUB 3DRPB 3D5MA 3N6LA 3PW4A 4ED2A 4NLRA 2IBKA 4O3RA 1K1SA 1JKHB 4LSLA 2BQRA 4K50A 3DMJA 2OPPB 5KFIA 4KFBA 1C2PA 3FQLA 4WZQA 1N5YA 3CJ2A 2ZKUA 1HNIA 3DLKB 5HBMB 4JUZA 4QWEA 4NLQA 2XC9A 1D1UA 2RKIA 2ASJA 2D3ZA 1YVFA 3DYAA 4K4XA 2D7SA 3OL7A 3CDEA 3QGIA 3H4DA 4IR1A 1FK9A 2FVRA 2IA6A 1NNDA 2OPSA 3NMAA 3V6JA 4H54A 3PVXA 3DOKA 3MECB 1J5OA 5L1KA 5L9XA 3KLIB 1SH2A 2IAJA 5F8GA 4K4YA 5K14B 2YKNA 1S6PA 4PUOA 1T05B 1JLAB 1GX6A 1N6QB 3RB6A 3DM2B 3UR0A 4URSA 4GC7A 2JC0A 4MIAA 1EP4B 2XI2A 1LW0A 5DG9A 1EETA 1N48A 4ED7A 3G86A 4ID5B 1TKXA 5KFVA 4RNNA 2R2TA 4ECUA 2HNYB 3KK2B 1OS5A 4KV8B 2BE2B 3UDLA 3UQSA 3QZ8A 3NAHA 5KFUA 4Q45A 3LALA 4ZP8A 4F4YA 2R8HA 2UVRA 3IS9B 1C1CA 5KFXA 1T3NA 2V4QA 4F4XA 2IC3A 4ECZA 3OL6A 2B6AA 1QUVA 1DTQB 1RTHB 4ZP9A 3KLHA 4RUCA 3IN5A 5HP1B 3QLHB 3E01B 2FJXA 1TKTB 1LWEB 2CKWA 2YKMA 4H4MA 4TQSA 3PZPA 5J2QA 5CYQA 2D3UA 4J9RA 4IOBA 1IM4A 4FS1A 5I42B 3RAQA 3KJVB 3I0SA 3M9NB 3GIMA 3Q8QB 3C6UA 4LSNA 4DL2A 3RB3A 1S10A 5KFJA 1DLOB 4EO8A 3M8PA 1T03B 4YR0A 2J6SA 3DLEA 4ECRA 1RT7A 5F9NA 4G1QA 1ZETA 3OSNA 2I1RA 3G6VA 2BQ3A 4DL5A 3DRSA 4HKQA 1BQMA 1SV5B 2C22A 1JLBA 4RW7B 2R8IA 1C0TA 3T19A 3T5HA 3MEEA 4J9LA 1QE1B 1VRUA 2VG7A 3DRPA 2FVPA 2IM0A 4I7FB 3Q8RB 2OPPA 4ICLB 3H59A 4O3QA 4EBEA 1S1XB 3DLKA 5HBMA 5C42B 2R8GA 1RAJA 4YP3A 4RNHA 1LWFB 3BQ0A 1LWCA 3PR5B 3H2LA 2OPQB 1D0EA 3GV5B 5KG1A 1RT4B 5C24A 2FVCA 3DRRA 4ZP6A 4R0EA 1IKWA 3OLAA 3GV8B 3KLIA 4O4GB 4X2BA 1FKPA 2V4RA 1Z4UA 5KFLA 5K14A 4J9PA 3FDSA 2VG5B 1N6QA 3DM2A 4NLPA 3MR5A 1VRTB 3GIJA 3GV7B 3MR2A 2VA3A 3BJYA 1EP4A 1RT5B 2RDIA 2ZE2B 4ID5A 4IRDA 1LW2B 3GQCA 2RDJA 4NLYA 4IFYB 3KK2A 5I3UA 4KV8A 1S48A 3MF5A 1UWBB 4TN2A 3BSNA 3SFGA 4J9OA 3LAKA 1WNEA 4MKAA 4LQ3A 4IH7A 3IS9A 2VG6B 1ZTWA 3UPFA 2W9BB 5DGAA 4DG1B 1FKOB 3I5AA 5JUMA 4KO0B 2W9CA 1RTHA 1RDRA 4JV1A 3QIDA 5HP1A 3QLHA 3E01A 2W7PA 4EYIB 1HMVB 3QGGA 5J2PB 4PWDA 2XGQA 2I5JB 1W25A 1K1QA 3HVAA 3HVTB 1XR7A 3DOLB 4NLXA 1N4LA 3FFIA 4U6PA 3T5KA 3RBDA 1IKYA 2BANA 3LP0A 3HKWA 3MR3A 1HARA 4KSEB 3KK1A 3PR4A 5KT6A 3G6YA 2FLPA 1QAJA 1TQLA 1DLOA 3N6NA 3T5JA 3ISND 2AWZA 1T03A 4K4WA 1S0MA 2OPRB 3MFHA 3ITHB 4J9MA 1S9FA 3G6XA 4Y2CA 1HQUB 5HROB 3KHLA 4RW7A 3H5UA 4J9KA 1TKZA 3EZUA 4EEYA 3KMQA 4WZMA 3DI6A 1QE1A 1S9EA 3RBEA 3H5SA 4K4TA 1JLGA 1HYSB 1RT1A 4I7FA 2R2SA 3HVWA 4O4RA 4WYWA 2ZD1B 3QGHA 4DL7A 1S97A 3CDUA 3I5BA 1S1XA 4XPEA 1NHUA 4ZVEA 1RTDB 4O44B 5KG5A 5L1IA 3SI8A 1LWFA 5F8JA 2WB4A 2IJFA 4MIBA 4O3PA 4F50A 1REVA 2WONB 2OPQA 4Y3CA 2E9ZA 4DL6A 4H4OA 2XCAA 5KFZA 5D3GB 4ECXA 2YNGB 2GC8A 1KHWA 4RW9B 5JXSA 3H4BA 3EPIA 1TL1B 4PQUB 3H98A 4RUAA 4IG0B 4FS2A 2C2DA 1XR6A 5KG7A 2VG5A 4URGA 5KFPA 1VRTA 2WHOA 5KG3A 2VA2A 1RT5A 4KE5A 3PW7A 4QW8A 1LW2A 3KLEA 4RW6B 5KFSA 4IFYA 2C2EA 4Q44A 1TV6B 3OHAA 1UWBA 5CYMB 4M94A 3OHBA 1RT2B 4TY8B 3M9OB 1JLQB 1TL3A 4Q0BB 3H5YA 2JEFA 4MK9A 1JIHA 1S0OA 4ZP7A 2VG6A 2GIQA 4HYKA 4ED0A 4ZPDA 5C25B 5KT5A 4I2PB 3H40A 4DG1A 1FKOA 3FRZA 2HMIB 2CJQA 5DG7A 4TYAA 3BR9A 2HNDB 2JEGA 4IRKA 5KFDA 1HNVA 1HMVA 2R2RA 4IH5A 4RW8A 3CJ4A 4ZVHA 5DQHA 1RYRA 3IRXA 4R8UB 3DLGA 2I5JA 5J1EB 3PJXA 3BQ1A 4DL3A 4KKOB 4ECSA 1RTIB 3HVTA 1DTTB 3MEDB 3DOLA 4O3OA 1IKXB 2ILYA 1RTJB 5F9LA 5EWGA 4OL8A 4NCGB 1S49A 5KFHA 2WTFA 1T94A 4NYZA 4DL4A 3IGVA 2UVUA 3FQKA 4ECWA 2D41A 4NLUA 4RNMA 5KG6A 3LP1B 1SH0A 2OPRA 4IFVA 3QIPB 2OH2A 3T1AA 2RF2B 1R0AB 5HROA 2XWYA 2B5JB 4B3OB 5L1JA 1JKHA 4G3IA 3KLGB 1S1VB 4K4UA 2HNZB 1C1BB 4IDKB 3JYTB 5F8HA 1SUQB 3QZ7A 1JX4A 1IKVB 4IR9A 5KFFA 3C6TB 1S9GB 1RTDA 2UUTA 4O44A 2ATLA 2O5DA 2WONA 4Y2AA 4RNFA 3MECA 2AU0A 1JLFB 2JLEA 5J2NB 4LQ9A 4MKBA 3Q8PB 4RW4B 4GC6A 4NLTA 3V6DB 4KB7A 3RB0A 3HHKA 2IMWP 5D3GA 4KFBB 1T05A 2BR0A 3BGRB 4RW9A 1JLAA 1HNIB 2HWHA 4PQUA 3I5CA 3H5XA 2RKIB 3DYAB 5KT4A 5T14A 3CO9A 2YNIB
chains in the Genus database with same CATH superfamily
3CGIA 5CQGA 2DR8A 3OSPA 4N8NA 1K44A 2VFRA 4DUZF 2V69A 1OSDA 2LQ5A 4PZVA 1LFPA 1HWUA 4M1KA 2ZH2A 4R5PB 2XYGB 3W62A 4DQSA 2ZOGA 1SH3A 2DCUB 2ZH8A 4JI0J 5KFTA 2FUG9 2DHXA 3R6GB 2CQ0A 2DBBA 3IG1B 3ENQA 2FJEB 9ATCB 3FBFA 3RBXA 1WDTA 5B0GA 4ZPVR 5KFMA 2MKIA 2PMWA 1LWCB 3ISNC 4K5RA 1DBDA 4L3KA 2B51A 2CA9A 4J9QA 3AJ2A 2IDLA 1N8RT 3VV2B 4MJKA 2XI3A 1EB0A 2FC9A 1OYEA 3EDQB 2WVCA 2D69A 4UW2A 1FO1A 3K58A 2JLFA 2F9JA 2P6SA 2J5AA 4OX9J 3T1HF 2WVBA 2IJRA 3FRYA 3KK3B 3BYRA 1YHQS 2B3TB 3D1QA 3LP2B 5T7LB 1PGZA 4FF3A 1ZM9A 2Z2LA 1QJHA 1M1KT 3P4UB 4P71A 4RNOA 3MWBA 3BR8A 2RMLA 1F9EB 3NKYA 3GR1A 3MMCA 2W7OA 2YNGA 4DPUA 1KOOA 2VF3A 3FZ2A 4DV0F 3SYZA 1R27B 1BLUA 2XS5A 2ABYA 2Z8QA 1REVB 1FCAA 1UJ4A 3BGUA 3KLVA 2MGZB 1TKXB 1L3KA 2QA1A 4CYUA 2GIFA 4ELVA 3QYYA 1LK7A 3HJVA 5CZXA 4RW8B 1R8PA 3QRRA 3MM8B 3I0SB 4LSNB 2EBEA 4NEYA 2J7UA 4WFYA 3PW2A 4IRCA 2E5LF 3S8SA 4ZLNA 3HPOA 4IFVB 3PRBA 4X4NA 2ZHBA 4QYZJ 3FBCA 4ZVOB 4K50A 2RQMA 3GPAA 5ETKA 2HBQB 1IJEB 3TJ8A 1UJ5A 2UXCJ 1IQTA 1FK9A 1MLAA 5AE2A 3DOKA 3GJRB 2QEXS 3PEHA 4PUOA 3JTOA 1Q5VA 1FT8A 1Y9OA 3CCUS 4RNNA 3QT6A 2FY8A 3W1YC 3EWGA 2YWGA 4DSJA 2ADBA 4ZVPB 4LFCF 3OL6A 4LRDA 2RU3A 2CQIA 2F8MA 3X1LB 1X5SA 2ACMA 4JI5F 4IOBA 2QA2A 1Q8KA 4M5IA 2B7CB 4CH7A 4DL2A 4HACA 4P2SA 1QAYA 2BJ8A 5F9NA 1ZETA 3OSNA 5CA5A 2C22A 4OYXA 3MEEA 2GQCA 1QE1B 2AW0A 2IM0A 2HRTA 1IWAA 3KUGA 1D0EA 3VGTA 5C24A 5BYSA 2HHSA 3OLAA 4JV5F 3W2WB 1KN6A 4DV4F 1LWXA 2BX6A 4M63A 4PXCA 2RDIA 4KV8A 3GFZA 2OTJS 1RDRA 3VALA 3OVBA 1LQ9A 1HWIA 3HJFA 2KKHA 1RWUA 1AXQA 3QPIA 3MMJA 1GQEA 4ZS6A 3M6WA 1UEKA 1R3NA 4I7FA 2V67A 1T02A 1Q8BA 1K9MT 2GCFA 4X4UA 2P9GA 4DPXA 3H4BA 4G65A 1XR6A 5KFPA 1BWEA 4KE5A 5LMNF 1RJJA 2CNLB 1UAWA 1YDLA 1JLQB 2GIQA 3LTOA 4ED0A 1Y00A 1RWKB 4DG1A 2CJ9A 2IRUA 2YKPA 2DVIA 3CC7S 1N36F 1IBKJ 1WJ9A 3CCES 4BWJA 1WI6A 2RSQA 4DR5F 4CO2A 2BZ2A 1RTDA 3J7ZT 1L3VA 2R7OA 2XYPB 1T05A 1HNIB 4ZVRB 1P9YA 4ZIVA 3C8YA 3CO9A 4ECUA 1YJ9S 5GMEA 2IM3A 1YBTA 2MEWA 5D4OA 4JI3J 2E7WA 2OD4A 3W5XA 3VAFA 4R8UA 5I42A 1AFJA 3KJVA 3MEDA 3AOBA 3D28A 4OLPA 2KZMA 2V8GA 4NA2A 2A18A 2HFVA 3I9ZA 5IT0A 2NPFA 2J76E 4DUZJ 3VAMA 2HVHA 5DLGA 4ICLA 4J7CA 2ZDPA 2AGOA 4ZJQA 1U7LA 3MMCB 3K5OA 4YOEA 4P9SA 2IJNA 5DS7A 2ZBPA 2DKOB 3ZXWA 2FDNA 2XCPA 3LWMA 4EBDA 2RS8A 2ZH3A 4CWBA 2AGQA 1NK7A 4RZRA 2Q6BA 3SSRA 1MU2A 2W9BA 4ED1A 1B0TA 3GE9A 2M8DB 2FVSA 1OYDA 3K7RA 4DI6A 4CYUB 5LOQA 1FWPA 2GMHA 1KLMA 2QLJB 3CE8A 3TA0A 2YWWA 4DX6A 1BQNA 1I6JA 3OD2A 2XSFA 4RX6A 3K5MA 3MCOA 4ZHRA 4DV5F 3W5ZA 4EUVA 1MN7A 3IR5B 3R5AA 4B9LA 3Q89A 1J5EF 1JLEA 3J80Y 4QIWD 3T1HJ 1FK9B 4X84A 1VJQA 4NZ0A 2DYAA 1WHVA 2IIHA 4USHA 8RUCA 4NMXA 4JV2A 2R2UA 2LXFA 5BYQA 4OHZA 2FJWA 2HG4A 4O3NA 3DRXA 3LANA 2VV5A 2BKNA 5IC4B 1EZZB 4J9SA 4HACB 4LF8F 1Z1ZA 4ZPTR 5KG4A 5KFAA 3MEEB 5G0RA 5DM7Q 3D5MA 2M9KA 2FLOA 1Q5YA 1NJIT 2IFXA 2K8GA 3OXLA 3H4DA 2IA6A 1XEZA 1N34J 5D4NA 1S6PA 1NH7A 4PG6A 4UT4A 5BR8F 1N48A 3MHYA 4KV8B 3KTQA 3CTRA 5A2QY 5KFXA 3QWUA 2CPZA 2GO8A 4DV1J 2R7TA 4QR2A 4FS1A 2B4OA 3M9NB 1R0CB 5HJXA 1D9FA 3R8YA 1D8ZA 4HTIA 3HM9A 2W01A 1SV5B 3G71S 4LFCJ 4HT7A 3T9NA 2MKSA 4F8RA 4I7FB 2HQFA 3E8OA 3GSIA 4OZ3A 4CM0A 5E5NA 4DR2J 4AL5A 3DGPA 3J81U 4J9PA 3O3LA 3M05A 3DM2A 2HHQA 5A8KA 2B4PA 2B8PA 2ZZNA 2M70A 5E3QA 1O8BA 2J7KA 4J9OA 3PO5A 1KTQA 4IH7A 4DG1B 4KO0B 3ETMA 2W9CA 4M5MA 4DFMA 2XGQA 4JV5J 2BANA 2X7IA 4DV4J 2HFUA 2JSXA 1TQLA 2AWZA 2ZH1A 2JLGA 3UFCX 3G82A 2LVWA 2MQQA 2ZC3A 1HQUB 2DO0A 1HL6A 1O0PA 4EU0A 1ZH5A 2E1AA 1T3OA 4PRFA 1HHQA 3DC2A 3MUTP 4ZVEA 1RTDB 1F5BA 2WB4A 2CFXA 2EK1A 4J5OA 1BE4A 2IA0A 1RHJB 3FUYA 4ZLLA 1BXNA 1RT5A 1Q8IA 3P6YC 4ENOA 3MAAA 4JB8B 2GMJA 4KGVB 2ZDOA 1S0OA 4Z7CA 3OR1A 1C4CA 5DQHA 4R8UB 1BC6A 4ES3A 3EX7B 3MEDB 4YEAA 3W65A 4WCEQ 3D54A 5LMNJ 2OPRA 4YN3B 4B3OB 2E7VA 4USWA 1U6BA 3KYLA 4DSFA 3PRVA 3MUMP 3VR1A 2RUSA 4WFBQ 3LGHA 3HHKA 4KFBB 2B9EA 3OJSA 1N36J 4DCOB 4DR5J 2CZ9A 2Q66A 3HCXA 2MYFA 1MU2B 3JQMA 4KHRA 5C25A 2HMIA 4FBUA 2X1GA 2N3OA 4TYBA 4TY9A 2AQ4A 1KLMB 1XR5A 4QWAA 1F3VA 1T0TV 1BQNB 2BQUA 2JC1A 4PWWA 2HWIA 4OHYA 1KONA 2Q1LA 3R5DA 2CUYA 3RJMB 4QYZK 3J7YI 4ZHRB 1HHSA 1N52B 2HNZA 3NS5A 3PHEA 1IKVA 1JLEB 3TJ9A 2R7WA 3NAIA 3JQKA 1NJZA 2DB1A 5DM6Q 1RISA 2AX1A 2BW2A 3CCLS 4NXMF 2N7YA 1RAHB 3V81A 1X4BA 2K1RA 2HLTA 2WOMA 3VAKA 3DKDA 3IMQJ 3D2WA 2F7VA 4B3RF 4AE5A 1O6XA 4U7CA 4X64F 3MAHA 1RK8A 1VBKA 1JXLA 3HHLB 3CDBA 3ILJA 3KMSA 2IRXA 2WK4A 2J9CA 4KGZB 2B7BB 1C0UA 2LA4A 3RR7A 3KK1B 5KFKA 1S1TA 4V1Ak 3N6MA 2ROEA 2VPZB 5HLFA 4DR1J 2W9AA 4YB6A 1KD1T 1TL1A 3W61A 1WEXA 1G7CB 1FDAA 2FZKB 4H4KA 4I4BA 4DV5J 1Q1KA 4DEZA 4YR3A 1PAEX 3L09A 3K2YA 3CC4S 1J5EJ 1PO6A 3TAQA 1HD1A 4D3HA 4KKOA 3GONA 1D09B 4PEOA 5IFMA 5B08A 1ULRA 1KFSA 3LP1A 2NREA 4QWCA 2AJ0A 3BPDA 1HW9A 2HGLA 3KDOA 3FBBA 4ECVA 1RB0A 3UD5A 1TR0A 4QPTA 1HNWF 3NGKA 4RWXA 3ISZA 2IBKA 2ZBQA 5KFIA 3D7SB 5H9EJ 3OL7A 3OTCA 4IR1A 3B54A 4GKJF 2OP5A 4LF8J 3MECB 1ZYQA 4CM2A 2Y1IA 3DGPB 2DISA 1JLAB 1GX6A 3DM2B 5A8KB 4CT9A 2JC0A 5DG9A 4K8RA 4DFJA 2JNJA 3U1LA 5KFUA 4Q2MA 1HNXF 1FWKA 1XTZA 4A8FA 1TKTB 4TQSA 1U26A 1LXNA 1HR0J 2VKRA 3PXGa 5BR8J 4EO8A 1VC6A 2I1RA 2BQ3A 3US5A 2E66A 3M4XA 3NLCA 1UPPA 5HJYA 1WG1A 2HZCA 4YP3A 4M5GA 3N5FA 2Z2MA 1V3RA 1X5OA 3MR5A 4F3OA 1LEOA 3SIPB 1RT5B 2FTRA 1AT1B 3GQCA 1KVJA 3MF5A 4TN2A 3HHEA 1YITS 3POTA 4HDHA 4FYYB 3I5AA 2ZBIA 1LNQA 2ZJRQ 3MDFA 2UUBJ 3HFZB 3T5JA 4PWUA 2OPRB 5ETNA 2B9XA 1QTNB 2VPWB 3KJFB 3X3UA 1G1XA 1EHWA 4Z37A 1BGXT 5GADU 1RT1A 1RBOB 3QGHA 2XLIA 3J7Z5 3PIPQ 4XPEA 1OIAA 4ZLPA 2E9ZA 2H9ZA 2H4YB 1UKUA 4CT8A 1FVSA 3BZQA 4R0JA 3N0VA 4I6YA 1S59A 2A0FB 4P52A 5CYJA 3HHLD 5DRKA 1I5OB 2NPIA 4CLTA 3OFEA 1WTFA 2OHDA 1F9HA 3FSYA 3JSBA 5C25B 2F3JA 3A1YG 5LT5A 2HMIB 5A6WA 2LEAA 3HVTA 4OL8A 1OMSA 4DQQA 3TZXA 1T9VA 1HFEL 4G1PA 2Q43A 3MMBA 3TEHB 4BS2A 4QU6A 1N33F 1RHQB 3D1HA 4G3IA 2HNZB 4F3MA 2FHKA 1PG5B 1IKVB 3CNQP 3DU5A 1PCAA 2C3MA 2VQFJ 2Y3YA 1NDPA 2Y8YA 1CQNA 1I1GA 4I64A 1WC3A 4WK3A 4M5KA 1MMDA 1N56A 3V81B 4OQJA 4EZ6A 2HIYA 2K1RB 2WW4A 1E6VA 5E0OA 2WOMB 2HZVA 1H74A 2H5EA 2VBYA 1EARA 1RTJA 2M5YA 1NMEB 4ANDA 1WC0A 4P75A 3ELHA 1S4EA 5CAAA 1P9QC 1BMQB 2MQMA 5KTQA 4ELUA 1C0UB 2Y1JA 1S1TB 4O0IA 3Q8SB 1FWLA 4OI1A 4DPOA 2OI2A 5HLFB 3R7BB 1RADB 3PJWA 3IWLA 5D8HB 4OHXA 4FN5A 2WSEC 4NX9A 2KL8A 3MURP 4NLVA 2RHQB 2G1DA 4YDXA 2CQ2A 1H72C 5GADI 3QNWB 2CWKA 4N8OA 4NXMJ 3MCMA 1WHXA 3FFIB 1RYSA 5GAHU 4HHHA 5HMYA 4L6V3 5E3RA 1CS4A 2W4PA 2EVZA 3IR6B 4KBIA 4B3RJ 1WDDA 5B7WA 2AZ1A 3AH6A 1S9EB 1M0SA 4X64J 1UCNA 4X4SA 1KLNA 3E3XA 1G2EA 4KTQA 3Q22A 3N4WA 2ZUAA 2IBOA 4DX5A 2VBZA 2VQEF 1UVKA 2LCWA 3BBBA 1JMTA 3LW5C 5E3CA 3K5PA 2GVDA 4UOGA 3EGWB 3WX4A 3MEGA 2YQ3A 1SC4B 4JI2F 3BDPA 5J2MA 2EKYA 3IRXB 5F0WA 4IQMA 4EWTA 3I96A 2BOPA 1Q95G 3T6BA 2J6UA 5F8IA 1SKUB 3DLJA 3O8WA 5ETLA 4JI7F 3KHGA 1K1SA 4Y28C 3DMJA 2XNQA 4O23A 3BN4A 3SCKE 1NNDA 2HYIB 3TX8A 3HP6A 4MIAA 5IXUA 1ZPWX 5D0EA 5DDOC 5GVQA 2PDAA 1UTAA 3A8JA 1N0UA 3QZ8A 3POTB 1T3NA 3MM9A 4GKJJ 5G4DA 2YKMA 4F02A 4RBVA 5CYQA 2DEIA 4J9RA 1VOMA 2ROPA 2QN6B 4LF6J 2V5HG 4LF9J 2WW8A 2NZ4A 4DL5A 5ETOA 2KFNA 4C97A 4LRCA 3T19A 4WJBA 3T5HA 2PC6A 1VRUA 4GVBB 2XTJP 5LMUF 2R7SA 2BJ7A 2PA3A 4QQBA 1Y5IB 1IM6A 3H2LA 1RT4B 2WVDA 2FVCA 1FKPA 3EGNA 5KFLA 1RZMA 2F1FA 5LSOA 2O66A 3NGRA 5AXNA 1NK8A 4RPFA 4OYMA 1B99A 2W4DA 5LXRA 2YWKA 1FVQA 2G2ZA 2OUGA 1WNEA 2POKA 3QLHA 3H42A 2W7PA 4PWDA 2DR7A 1PJ6A 3HVTB 1OPIA 2QL7B 3PIOQ 1U1MA 1VQ5S 1IKYA 1D9AA 4DR3F 5A8RA 3PR4A 1KDNA 1AROP 1T03A 3B78A 3MMBB 2VB6A 4ETZA 4J9KA 1CG2A 2B9YA 3L3CA 4DMZA 4O4RA 5CH7B 2OTLS 3OJUA 1EX8A 4K0KF 4A48A 2Y9HA 3D0GE 1WF2A 3H98A 5KG7A 3MD3A 1OY6A 1BHNA 2LQJA 3L4BC 2LYVA 1LW2A 1S76D 4Q44A 1TL3A 2JEFA 4MK9A 2VG6A 2VONA 2ZZTA 2PMHA 3VAGA 2FHJA 1YIJS 2W24A 1RTIB 3DOLA 4O3OA 1RTJB 1NO8A 1S49A 3ENWA 1T9WA 1PBAA 3EUNA 3BO4A 4RBTA 1AZSA 1CEZA 3ILOA 1NDKA 3CJKA 4DR4F 3GG1A 2WONA 2PEBA 4MKBA 3PYDA 2IMWP 1FRIA 2BR0A 3J7A1 1MWZA 1CJVA 2KJWA 1N33J 4PYDA 5KFRA 2HAIA 3U7JA 4LRBA 1GX5A 1XK8A 2KT5A 2GV1A 4E8UA 3KUEA 3MTKA 3ICLA 3TO8A 4NCGA 2B6AB 5L39A 4XTTA 4H4MB 4ZPBA 4QBUA 4BLGA 4ED6A 3EE3A 3TVZA 2HPUA 3KLGA 1A7GE 2XNRA 5H9EK 3H2UB 1S9GA 2D9OA 2RT3A 2VG7B 3SFUA 1NXIA 4ZA1A 2FLLA 3DN9A 3AY0A 4J9VA 1YZ7A 3MR6A 2AD9A 4CRJA 2XB2D 5KG0A 2IM1A 4PQAA 4DS4A 4X66F 4DV7F 1U1NA 4LR9A 3I82A 1RWWB 3HULA 5HANA 2GVDB 3PNIA 1RT6A 1UW9A 4OYBA 1DURA 3MEGB 3OV7A 4TU8A 3TZYA 3CD0A 4QPXA 2DHHA 3MPUB 5J2MB 3M8SA 2GMLA 3QO9A 3PW0A 4EMDA 3ZZYA 4WFNQ 4OYOA 1KQFB 5FLXU 1RWXB 3CCQS 2GHPA 3EYZA 4OJ3A 1M90T 3G9CA 1Y5LB 4ANCA 4ZVTB 1U25A 3EMTA 1TKZB 3DMJB 2LP4A 4XDDA 2HLUA 2F8EX 3QT7A 5KT2A 4YMEA 1FFSB 3TNVA 2E1CA 3CJ8A 3IRWP 3LQVA 4H4OB 1RT3A 2HSEB 1CQMA 2J6TA 2KM8C 2M0GB 3CCMS 1VDHA 2KXNB 3C19A 3MM9B 4NL5A 3H90A 3NEKA 1U1RA 2NLWA 1APSA 2YKMB 1CSJA 3FBEA 2MXYA 3QIPA 1NKCA 5CYQB 1K73T 2DRDA 4AXIA 2VQEJ 7AT1B 4DN9A 4Y34A 4ECYA 3NMRA 5AE3A 3FCHA 4TNOA 1FD8A 1CJUA 2X51A 2RRAA 3TW0A 2WZ1A 1VRUB 4OYWA 4YUDA 2FZCB 5ETVA 4JI2J 4NLQA 4RUHA 1AA1B 1P6TA 2C2MB 3A8KA 3NOCA 4C2MA 3V6JA 2CJYB 1JB0C 2CJBA 5IWAF 4RUBA 5CZVA 5GAEU 4JI7J 3J81Y 5E3PA 3W2VA 1J27A 2HVZA 1OS5A 5D0RA 3NNCA 4AD6A 2QG9B 1FXDA 1U0SA 3QLHB 1R6VA 4YB7A 4FP9A 3KFWX 4CTAA 4CLWA 3GJSB 1HKAA 1N5QA 1R8HA 2E5IA 4Y2KA 5HAOA 5KFJA 2DHSA 2IY5B 1T03B 2XG8A 4ECRA 4HKQA 2DH7A 4Z2XA 3DHXA 5KOXA 4IOCQ 1JXEA 1Y3KA 4Y2MA 4ZN1A 4RNHA 4X65F 3SQGA 2HBZB 3U02A 1SL1A 3V4MA 5AXLA 1XMBA 3ZNUA 1V3ZA 4B9NA 2JVRA 3CUNA 3F41A 1LW2B 3OPKA 2GHWA 4LIWA 1Q86T 4JP8A 2VG6B 2K3IA 4Q2LA 1XR7A 3DOLB 2L9DA 1TL5A 4ILRA 1NJYA 4JYAJ 2MQNA 5KT6A 1WEYA 3ISND 5HQ8A 4J9MA 1ZM3A 1NHKL 2I6WA 2M8HA 1Q7YT 1PJ7A 3BYPA 4WYWA 3CJKB 4B3SJ 4C8YA 4F50A 2WONB 2PA8D 3ONQA 1LFWA 3GG0A 1SIZA 4LRAA 2QSFA 2DRAA 1CJVB 3H8YA 4NCBA 3I4PA 4IFYA 1R0BG 1UWBA 3D0IE 3L9ZA 3H40A 1VC0A 3O1LA 5ETSA 3VAIA 2R2RA 3FKBA 2WBMA 1M5KC 4J90A 1F6TA 4OFZA 1K47A 4NCGB 3CD7A 3BH6B 2ZHOA 1TL7A 5KG6A 3A3PB 1JK9B 2DH9A 3KLGB 1YK9A 1EKSA 4IR9A 2GVZB 1S9GB 3AODA 2UUTA 3SSQA 2ATLA 1EJ7L 1I3OB 2HHPA 1KP6A 2EW9A 4NLTA 4HHJA 1S79A 3WC0A 3OBIA 2LMIA 5F8NA 2DPJA 2LU1A 3CW2C 2DEJA 1YJVA 4FKYA 2MJNA 2KFYA 2ZH5A 2G9OA 4Q0BA 4HTJA 4DR4J 2XGPA 3FSIA 3CCJS 1RT6B 4J91A 4DPTA 3K17A 3QO9B 1VQ4S 1RKJA 4FYWB 2MZ1A 4G6VB 2HRYA 2SXLA 3D9BA 3M2RA 1TAUA 1S1VA 4CH0S 4JI8F 4EK2A 1HBOB 5C42A 3CMAS 5LJ5Y 2L9NA 4HI1A 4EEYA 2U1AA 3TVYA 3W60A 5E7OB 3RAXA 3OR2A 3BGRA 3QAUA 3LUYA 3GJQB 2ZE2A 4F4ZA 3SBMA 4NOHA 5HVFA 2LQ9A 1RT3B 3Q2TC 4A47A 1UW4A 4DSEA 2F9DA 3Q23A 3GFHA 1S4FA 1HHTP 1SXLA 2KXFA 2YNHA 3C3LA 4U7UD 1UZDA 4PXEA 2ASDA 4X66J 4DV7J 2RD5C 2J9DA 1CJUB 5DQGA 3CDAA 2DTJA 1N32F 2E9TA 3KNAA 3DI6B 3GYNA 2HFOA 3C66A 3SQOP 1HA1A 1JLCA 2UVVA 2EEYA 2CADA 2CDRB 2R7RA 2QGFB 3I9V9 1NK6A 1Q53A 4CLLA 2PN6A 1VBZA 4RR5A 4A8QA 5DQIA 3CB4A 3T5LA 2CQ3A 3W2VB 3W66A 2A2CA 3CCWA 4ED8A 1Z2LA 2MZJA 1VQ7S 4WU3A 3DDKA 4IOAQ 2MLZA 3UO0A 5DGBA 7FD1A 1XMOJ 3W9HA 4DSIA 3M30A 1KWMA 3W3SA 3AJDA 4WU2A 2DY1A 3DLHA 1ICEB 3G8SA 2Z2YB 2CG4A 1VQOS 1J5OA 4LF4F 1OQ6A 4K4YA 1WTBA 3PJ9A 1NB2A 1EETA 3T1YF 3RRGA 2OIHA 3THPA 3MMAB 3M2VA 3SCIE 3JSYA 3CD6S 1W26A 1VI7A 1QM9A 2W7AA 5JJBA 4D3GA 2FJXA 3SV3A 2EBGA 2XY7A 4A8OA 2E5JA 2ZITA 4P7VA 3GZ7A 3OTDA 3Q8QB 1YKWA 4TLQA 4KGXB 3DRSA 3AOCA 1C0TA 3C14A 2FGOA 2V4JB 2DO4A 1RAJA 4K5SA 4CQ1A 4YB1P 3GV5B 3R1LA 3R5CA 3DRRA 4F2SA 2FQQB 1F1BB 4A46A 1P8GA 4ZJOA 1HWJA 3ZTRA 2AT1B 2HBYB 4IRDA 2W2PP 4IFYB 1UWBB 3L7UA 4QZVB 3K8WA 4LQ3A 1OPZA 2CRLA 1PYTA 3ET6A 4JV1A 2RNEA 5GAGI 1FJCA 4UQGA 4NLXA 5BXIA 2YQ1A 1QAJA 1DLOA 3ZTOA 4K4WA 1HWLA 2HHHF 1HBMA 4RW7A 4CNZA 3CCVS 3FNNA 1VGYA 2QL9B 2ZH9A 1GTEA 4DL7A 2ZD1B 4E98A 2HQ3A 4DL0C 2IJFA 1HI1A 4FXWA 2XCAA 3EPIA 2J0SD 2MTLA 2K7JA 3KLEA 2KI2A 4N77A 1X7VA 2L9WA 3OHBA 1UVIA 4Q0BB 3KDNA 4DPWA 2Z2ZA 3P45B 2CIMA 5J1EB 4ZIWA 1M5SA 4OYAA 4C3KA 4ECWA 5SUHA 3BS9A 4BDPA 2XWYA 5FD1A 5L1JA 3SSSA 2YX1A 1S1VB 1C1BB 4RU2A 5F8HA 2C3UA 1F2GA 2LEBA 3U1NA 4KY3A 2M2BA 2YH0A 3C46A 3OR2B 1V5IB 2ADCA 3BGRB 5KT4A 5E41A 3D4JA 5L1LA 2FJBB 2BE2A 3Q86A 5F8LA 4RW6A 1TV6A 1DTQA 5E33A 3BGOP 3CIZA 1LWEA 1S7IA 1DRZA 2P2CB 2XO7A 1QTMA 1SVDA 2YNHB 4CCHA 3VGSA 4J9NA 2PO4A 2PMZD 2UUWA 2JX2A 4CLSA 2J0WA 1GH8A 3RBZA 3BSCA 3M2UA 1XJWB 1B64A 4F4WA 1JLCB 1RAFB 4JOUA 3NGDA 4A4JA 1URRA 2JL9A 4RBUA 4FZVA 2R8JA 2C28A 4C8ZA 4YQWA 2QA4G 4JI8J 5AXKA 2HGNA 2MKYA 1RLDA 3DHWC 1Q79A 5HMXA 3KUHA 1VQYA 5I3UB 1Q16B 2AYGA 4WP8A 5ADZA 3FJ2A 2GAHC 3UCGA 5A76A 5DLFA 1VFJA 5EWFA 3GP9A 2UV8G 5F3TA 2HZAA 2HRUA 5KFOA 5KFQA 5EDWA 4QWDA 2JEIA 3LP0B 2XULA 4DV6F 4TQRA 2VODA 4USJC 4L74A 3M30B 2EFVA 3SMZA 3C16A 1YRTA 4DQRA 4MYTA 3NGSA 2V9KA 3RU0A 1H2TZ 4GKKF 1J5OB 4OX7A 2KHCA 4K59A 5IS2A 2HVDA 5AXMA 2CQGA 3CJQA 2QA4S 2MQPA 3GILA 4CH1A 3M2VB 3JSRA 3BH7B 1RBAA 2UVWA 2B0GA 3QFHA 1W7WA 3KJNB 2NXNA 1U0HA 1GMWD 5A0YA 2UV8A 2FJVA 3IGNA 4PXDA 2V94A 4OI4A 1Q0NA 3W7BA 3HSJA 2ZZMA 1IR1A 2APOA 2MKCA 1C0TB 4I0WA 4BWMA 1H7XA 4DF4A 3AXKA 4ED2A 3OT9A 1TK8A 5K9FA 2D3O1 1N5YA 3PX0A 3PV8A 1KKHA 1JJ2R 3CDEA 3MR7A 2BJDA 2XSJA 1VCTA 1B0PA 2IAJA 5ETRA 3C15A 4ER8A 3RW6A 2NXJA 3MPDA 2CPHA 3G8TA 3LALA 2R8HA 1C1CA 3ET6B 3R27A 4ZP9A 5C2GA 3M32A 4JBCA 4OHVA 1REGX 3ADAC 4DZDA 2Q3PA 4LF4J 3PX6A 2FPHX 3CXCR 3CT9A 1DLOB 3BKUA 3M8PA 3T1YJ 3ZZUA 4G1QA 3G6VA 3OVSA 1NU4A 3H20A 4RW7B 4QJVA 2ZJPQ 1B0VA 1MROA 2AEMA 2OAUA 5CCMA 3UI3A 1SQGA 3PR5B 3EJMA 5KG1A 3CCRS 2MJUA 4UTGA 2GGPB 5B09A 2ROGA 3KLIA 4O4GB 3QT8A 1WHWA 4PG7A 4NXNF 1RAEB 2G13A 1S48A 4CDIA 2YY3A 3SFGA 2AJ1A 1ZM4A 5JUMA 1F3FA 3QIDA 4OZNA 2A1BA 2BKOA 3HVAA 3T5KA 2JDJA 5HN0A 4KSEB 1RCXB 1GK8A 4L73A 1GXUA 4DCPB 3D6FB 1S0MA 4UUXA 1FXRA 3ITHB 3EZUA 3KXDA 4WZMA 4OI3A 2W4CA 1A6LA 2J9DE 2R2SA 1NRKA 3TZZA 1NHUA 1LWFA 2HVEA 1RABB 2BJ3A 4DBQA 2VPXB 4IG0B 2C2DA 2HHHJ 2GX8A 1QSLA 1UVNA 1VQ8S 4C11B 1KS2A 1R43A 4RW6B 5KFSA 1TV6B 1M5HA 2N7CA 1HNVA 3HXMA 4ZVHA 1RYRA 4ECSA 2IHR1 2HHTA 5F9LA 6FDRA 1TMMA 2NSCA 3QT5A 2OFGX 4DL4A 2HK3A 2V8PA 2UVUA 3MOZA 5IOLA 3CMES 3T1AA 3R6LB 4I69A 1JKHA 3HD1A 3OFGA 1SUQB 2CZ4A 1JX4A 2GQ2A 2ZNYA 2VU5A 3UN2A 3M2UB 3K59A 3M1VA 4DF8A 1IR0A 4OIXA 1V3SA 5D3GA 4AXJA 3V2UC 2RKIB 4LBPA 3DYAB 1H2UX 3EDRB 2ZC4A 3BPSP 2NSBA 2AJ2A 1VBXA 1WELA 2CPDA 3M6XA 2HHXA 4DR6F 1BY9A 1PSDA 3CCSS 4TU7A 3PACA 2BRKA 4WTOB 1F9FA 1KQGB 3GFYA 3OFHA 2IM2A 1R7IA 4O3SA 5DDPC 1U1QA 4NLGA 3CCZA 2ZJQQ 2VBWA 4QR0A 2OKQA 4DX8H 5FLXY 2MSSA 1QD1A 3C6TA 2DNNA 3C16B 3A12A 2FVQA 4K2XA 3CVKA 1SKRA 2OEJA 4JV0A 4PG4A 2V50A 2CNKB 3HI9A 5I3QA 3K89A 2MHEA 4LF5F 2MLYA 2V63A 2QFJA 1IKWB 2DXDA 2GJ2A 3IBCB 5J2PA 2R4FA 3UCUP 1Y3JA 2AJ4A 1WEZA 3B6BA 3N9UC 2W2QP 1N0VC 1NUEA 1SB6A 5A0YB 4ED3A 2YX4A 5KFBA 2H1YA 2QV6A 2HS0A 2Y1LB 4IKAA 1HPZA 2UUCJ 4OJ1A 3NL0A 3Q8UA 5F8MA 1N5YB 4M95A 5FDLA 2OEKA 3QJPA 2F5GA 4J37A 2FJDB 4ILLA 2KHDA 1TZ0A 4M8LA 1RHKB 2IAJB 2V2VA 1X4AA 2FLNA 2QE5A 5HMZA 4ECTA 3RRHA 2HNDA 4OI6A 2VUGA 4OZLA 3TQ1A 1SC1B 1IKXA 3M6UA 1C1CB 4AT1B 1HNZJ 1K0TA 3MGJA 3M32B 4GKKJ 4WKYA 5MLCV 4OJHA 3TAMA 1FRMA 4Y0FA 3E51A 1AB8A 2RDDA 3DLGB 4WFZA 2JHEA 3EZOA 5L8RC 1VIOA 2V8VA 3JSMA 1VQ9S 3GTYX 3M8PB 3W9IA 3MM6A 4G1QB 3RTVA 3CO0P 3AD7C 3K0JA 2OGUA 4QWEA 2AMCB 3RRKA 4DXLA 1V9OA 2IPOB 4NCAA 2E7XA 4H54A 3LGMA 3KLIB 4FXVA 5HMWA 4ED7A 3DXBA 5KFVA 4X4TA 5L38A 2DNMA 2V68A 3UQSA 4LF7J 2DR6A 2K06A 4M5HA 5D4LA 1CPZA 1UEUA 2P6TA 3VVUA 4NZ7A 3LWLA 3PZPA 4DX7A 5LL6d 4DQIA 1XNRF 4PR6A 2CNNB 3TR5A 1U6FA 4DUYF 3QSIA 4LJMA 1H38A 4FYDA 1GTHA 3GLJA 2BM0A 2F40A 1LWFB 3W8GA 2EFPA 4FPRA 3TP2A 3I32A 3MUVP 1P1TA 3FDSA 1EP4A 3FEZA 2A6OA 2DK2A 1Q4RA 5D4PA 1RHUB 4DCJB 5K8MA 2X3DA 1X9MA 1NZ8A 1HBUA 1W25A 3UN5A 1VISA 1Y4ZB 2EPIA 2DR5A 2EKNA 4NXNJ 1RAOA 1S9FA 2DGSA 4DSKA 5BJRA 2HQGA 3D6HB 2CJXB 1JLGA 1FX2A 3NWRA 3I5BA 1S1XA 3FEXB 4MMOA 2CQ1A 3M1VB 4Y3CA 1NKEA 5D3GB 2YNGB 4C8NA 4FS2A 4OLOA 3EXCX 4X4QA 1FJGF 2DGWA 3UR3C 4DU7A 4HEA9 1NDCA 2C2EA 4M94A 5EN1A 1GMVA 1DY3A 1FKOA 1T11A 2G2OA 2YX7A 1QSSA 2CJQA 3B82A 2PI5A 1KBRA 4IRKA 4FDFA 1MG7A 4DSLA 1NDLA 2J7WA 3GIRA 3MTJA 4TVAB 3SEOA 2WTFA 1T94A 2DNQA 3FQKA 2WBRA 1SJFA 2QLXA 3R9LA 2IRYA 3BEGB 4ZDNA 3HZEA 4MKYA 3G8QA 3C6TB 4DJBA 2E5HA 4LQ9A 1GAOA 1X0FA 4P6QA 5GMKa 4RW9A 4QCLA 4Y00A 1NK9A 2HNYA 3DOKB 1CJTA 1UFKA 1B7YB 4N7TA 3K57A 1TU0B 4PUOB 2G0JA 2BA9A 3I31A 2V6AA 1TL4A 4KHMA 1WHYA 2KTQA 4DV0J 3TJAA 1UZHA 4ZMMA 2AYEA 4ZN3A 3PG9A 2Z0GA 4HHUA 4FKXA 3G96A 4KAIA 4DR6J 1KHVA 4DFPA 1F60B 3BO2A 1HPZB 1IQZA 2GNKA 3FEYB 5B0AA 5FDLB 3R2DJ 2HHWA 2BKPA 1FI4A 4Q43A 4YS2A 2QL5B 2RAQA 5C24B 2VBXA 2VC1A 2G0CA 2ALZA 2JOQA 1YJTA 1VQPS 4OI2A 2EFQA 5KFGA 2E5LJ 1ELOA 2C2OB 4Q8EA 1NK5A 4WP9A 2EK6A 5CXTA 2MPUA 5EHHA 2FB0A 5KG2A 4PCQA 4TXSA 4U95A 3TUPA 3TAMB 4LF5J 5HVHA 1KR4A 1RI7A 3JSMB 2RJZA 1HYSA 3V4IA 4FYVB 1RWNB 3D1OA 2MZSA 2QLBB 1VYAA 1FNOA 4F0MA 1MMNA 3PM9A 5D0HA 4IUFA 2JEJA 3HSDA 4FYXB 1YTYA 2FHOB 1U48A 4KT0C 1RAAB 2YWFA 3BBFA 4YDDB 4CLZA 2FYXA 4JI5J 1H0HB 3J7YU 1ZAVA 4JI0F 2KM8B 2E1PA 3BDEA 2N82B 4W4MA 2GS8A 5U47A 5DJBA 2DNKA 2ZBCA 2YNFA 5D6GA 2V9WA 3VTIA 1Q8LA 1R0AA 1Q7LB 3OLBA 4CO3A 4IDKA 2LECA 1WI8A 3VWSA 4PYAA 2V0NA 4AYBD 1FTRA 1XBWA 3THVA 2CZVC 4EYHB 4LFAF 4R25A 5L46A 4LSLA 2V2KA 4WZQA 3ZTQA 3CJ2A 2CQ4A 5EGYA 4GRSA 2F8HA 3CJRA 5CHCB 4UUWA 4P72A 4OX9F 3F56A 3H7HB 2V34A 1T05B 4JI1F 1EP4B 2XI2A 1MNEA 3VAHA 1MW7A 2B4VA 3MCSA 1FEEA 2LEPA 1X0PA 4HH1A 1ZAWA 2MLXA 1YLXA 5IQ6A 1IM4A 5I42B 1MN9A 3RAQA 3KJVB 2R7QA 1T8EA 4ANEA 2GJIA 1BQMA 2DH8A 4FVCA 4J9LA 2HK2A 3DRPA 1GFWB 4ICLB 1S1XB 3DLKA 5HBMA 2BJEA 4W90B 4M5JA 1LWCA 1TTHB 2HWTA 2BM1A 1XNRJ 3OFFA 4N41A 3W63A 1IBCB 3JS9A 4ID5A 4DUYJ 2RDJA 5IZHA 2F4FA 2L48A 5HSPA 2VZ9A 2W9BB 4E0DA 2KRBA 1FKOB 1YWXA 1R89A 1F0XA 3QGGA 1NJXA 2UXCF 4RKUC 4ED4A 1N4LA 3D66A 1ZA1B 3IBWA 5T7LA 2PSZA 3ZTSA 3H5UA 4DV3F 3MD1A 3RBEA 1H73A 4K4TA 3PTWA 1FX4A 2LLZA 3VGVA 1YGYA 2VD3A 4MIBA 3JB9k 1REVA 3VAJA 3GR0A 4MAKA 3G6ES 4RW9B 3UNGC 2VG5A 1ZM2A 2N4CA 1L3TA 1SIWB 1CJTB 2I38A 1FTCA 1RUSA 3OTOF 2EWHA 4Y6IA 4ZPDA 3FRZA 1KNZA 4TYAA 2GW8A 4RW8A 3L7OA 1ZZFA 2I5JA 2ILYA 5EWGA 1EAYC 5KFHA 1SPBP 2A2DA 2X3GA 4IFVA 4ZCKA 4C0HA 5DZ7A 1RAGB 4WP3A 4O44A 1WC5A 3WBZA 2EXUA 2O5DA 4USVA 5G0RB 1X4GA 3S01A 1PYSB 2B9WA 2RRBA 3OQ2A 4OZ2A 1N5VA 3ILLA 1FA0A 1T9YA 2NYHA 1T9TA 2VOOA 1VMBA 1S6PB 2Q79A 2XS7A 3FMBA 2C3YA 1WWHA 3HMJG 2KXHA 2HHVA 3KOAA 1IXKA 3HSZA 3PEJA 2UZAA 4FNIA 4ECQA 1YI2S 3V4IB 4IH6A 1WKJA 3A3OB 3AXMA 3HKZD 1SJ1A 4MK8A 4QW9A 2X1BA 2G4BA 4LMZA 3W2WA 2PEHA 3V6DA 3O5TB 5KAKA 3Q24A 4RWWA 5LSLA 1LXJA 1X4HA 5KFYA 1NSPA 4FBTA 4F0KA 2FZGB 2VOPA 4MTPA 3ZZRA 4C0OC 3P5TL 2B8QA 4WBFA 2G0IA 2YNFB 4USTA 5BYRA 2W9CB 2W8LA 1FHTA 1FRXA 1SJ4P 3VQTA 2WSFC 2BANB 2D1CA 4CO5A 5RUBA 1ZZNA 3CJ0A 4I6WA 3GB0A 4C98A 3G82B 4JI3F 2Z30B 4I2QA 3VZIA 4LSLB 1VQMS 3FMWA 3PRDA 2W2OP 2DPIA 2I9SA 1JLQA 2AX0A 4OYZA 2ASYA 3UDEA 1VLOA 1KRPA 2H5IB 2R7UA 1DQ9A 3MAAB 4LVNP 2ZFHA 1WG5A 4I56A 2WAQD 3GJTB 2M4MA 2KVIA 3OTBA 3OR1B 3WIUA 1QAIA 4P74A 1D3WA 1O5JA 4IQXA 3AJ1A 4HL9A 4KH0B 1BQMB 4WFXA 4K4VA 3DRPB 2QJ3A 3T9ZA 4ZITA 1FF2A 1HNIA 3DLKB 5HBMB 2DT9A 2NUHA 1TELA 4LT6A 1X8DA 4NYOA 4S0MA 2Q6CA 4ZOSA 3NMAA 4WF9Q 3HSGA 1AYEA 5J1NA 1ACMB 1SH2A 1YJRA 5DDQC 1LW0A 4ID5B 4LFAJ 1JNZB 1RWMB 3NOGA 1NKBA 2XMWA 2IC3A 3EXYA 1FDBA 2XMJA 3TQEA 3R2CJ 1HLWA 3C6UA 4JI1J 1OQ3A 6AT1B 4YR0A 5ETPA 2D3OR 1WD6A 2ZH4A 3NS7B 2XY5A 4DN0A 3IP0A 2E29A 1WG4A 3A3NB 4UOHA 2V4RA 5K14A 3FK4A 2VG5B 3AQOA 3GV7B 2MSTA 4USMA 3KK2A 1YBUA 3QJLA 3IS9A 3EVMA 3Q8VA 5DGAA 2IYIA 4EYIB 4B02A 1EKRA 2XEXA 1HWKA 2I5JB 4U6PA 2RH3A 3HKWA 2H48B 2QT7A 1HARA 1OY9A 2FLPA 3EVOA 1N34F 2WVFA 3CIMA 4N5SA 2JWNA 3A4TA 2OJ3A 3VHQA 3HVWA 1D8YA 2LKZA 2KH9A 3G2XA 4FVMA 1UP1A 4UOCA 3G87A 4O44B 3D3CJ 1XIQA 4DV1F 2NCKL 4DLEA 2GC8A 1TL1B 3AB2B 2C3OA 1D9DA 4DV3J 4KPCA 2K3KA 4QR1A 1BWVA 1SC6A 3OXGA 4QW8A 4ERDA 3NP5A 2DCLA 4C7QA 4I1TA 4CO0A 2JEGA 1UEVA 3KG4A 3CJTA 3GFXA 4DL3A 4KKOB 1Y0HA 1CC8A 4DR2F 3WC2A 3LP1B 1FNMA 3KNGA 4Z7YA 5T41A 3OTOJ 1CVJA 1QVFR 2QYGA 3R5BA 1M5OC 1WF0A 4CLKA 2V2ZA 2CPFA 2HAFA 3V6DB 4UZBA 2EI5A 2AV5A 2WB1D 3FC9A 5KOWA 1AUSL 4AQYF 3OW2R 2MKHA 1ZA2B 1DTTA 1HW8A 3CJ5A 3OL9A 3DNCA 4ZPCA 2ASLA 4USUA 5IT9U 1U09A 1SV5A 5B0DA 4KGKA 1NZAA 2PE8A 4ZCMA 1XNQF 4WYLA 2OD6A 4OHWA 4DUTA 2CJAA 5MAOA 3BSOA 4I2QB 4URQU 1YX2A 4KYZA 3VVTA 1F2HA 1YJNS 1AUDA 2EFNA 4OZ5A 2W2MP 4L3NA 4NA3A 1NHVA 4KO0A 3AFGA 1HNWJ 1TUGB 2HURA 2QO3A 4QIEA 3M7VA 3TEGA 5EUHA 2CG8A 1GT8A 4MFBA 3O6QA 2ZM6F 1HQUA 1GEHA 3R1HA 2WVEA 3N28A 4UOFA 3R5JB 4KPYA 1S6OA 3RYLA 1IWGA 5SZTA 4XAKA 4OZ0A 1UMJA 4DV2F 1KFDA 1HNXJ 3SXLA 1B70B 1U2FA 4Q5VA 1RT1B 2AHOB 2ZVSA 1KVIA 3ETOA 4CP5A 1RGVA 3UE2A 2NXUA 1PIEA 1IJFB 4WE1A 1LW0B 3TVKA 1FE0A 4NA1A 3CJ3A 2QIFA 5KFNA 2DD8S 2IC3B 4X62F 4ZK7M 4CLYA 3R7NB 3A8IA 4U96A 1KSPA 1WSRA 2QFIA 4B3OA 4K4ZA 3C6UB 1KOHA 4XIUA 2QLFB 4FF4A 3JXOA 1XWLA 1J2VA 2PFDA 3HK2A 1S0NA 1NJWA 2NUUG 2V8DA 2ZKTA 4KFBA 4C48A 2O3DA 1LV5A 2LA6A 1YVFA 3BKFA 5K8NA 3MPVA 4LVOP 5K14B 1TFWA 5D78A 2JVOA 4AUKA 2HGMA 3RB6A 1UA0A 8ATCB 3G86A 2P9EA 2EG1A 3KK2B 4DR1F 3ZZ0A 4F4YA 3IS9B 1DJ0A 2Z56B 1E6VB 4LSZB 5J2QA 2MQ8A 4LREA 1RKIA 2J6SA 1RT7A 1CULA 1IR2A 1ZBTA 2DGXA 3Q8YA 4CNYA 2BEFA 4EZ9A 2KG0A 4EBEA 2R8GA 4DU8A 4LF1A 4RJVA 3KG0A 3DOMA 3QWPA 3I6PA 1GNKA 2CPJA 3GMGA 8AT1B 1N6QA 4NLPA 3GIJA 3UCZP 4F7VA 1S12A 1MSWD 3BSNA 1EQMA 4P2XA 4XDCA 1ZTWA 4A8WA 2XHCA 2OMLA 4USIA 3HHLA 4G1IA 1IUJA 4YHHF 4BCAA 3KK1A 2BABA 3EVWA 3UDCA 2DNOA 3CCTA 3F73A 2H4WB 1SKWA 3KMQA 2XO6A 3H5SA 5K8PA 2J0XA 3K5LA 1CS4B 5L1IA 5F8JA 2HVIA 1SCJB 4E2FB 4W98A 1HR0F 2F63A 2XHWA 2ZNZA 3HX9A 2Y0SD 4EGLA 4URGA 1VRTA 5KG3A 3V5RA 2YBVA 2JFKA 1W2IA 3SZ2A 2BE9B 4KJIA 3SCJE 2GAGC 3AD9C 1T9UA 1NPKA 2ZUGA 1DTTB 2MHNA 2LQ8A 1VJWA 1UFLA 5JMNA 3W5YA 2D41A 4RNMA 1MWYA 1XERA 5HROA 4ED5A 3QQCD 2DJWA 2Y1RI 2FIUA 5DDRC 3GWCA 3TX0A 4LBIA 4Y2AA 1F5CA 3MECA 2JLEA 4K7QA 5F41A 2PI4A 3QGPA 1JLAA 3I5CA 4V19X 2UUBF 1WSVA 1SJRA 2H5JB 4N47A 2CPIA 1UFWA 2VPYB 4OV6A 2H3EB 4CIOA 1SI9A 1TKTA 2DNPA 5HL7Q 1S57A 2Z58B 4WXWA 1P27B 4MFBB 1BQXA 2KN4A 1FDDA 2RF2A 4AQYJ 3TA1A 5M2PA 4BC9A 3DU6A 1G6BA 2RB7A 1U1PA 3PYEA 2XBPA 1TP7A 2OO4A 2ZWPA 2B43A 5J2NA 3ILIA 1NSKL 4U67Q 5DO2A 5GMDA 2KYXA 4ZVFA 1XNQJ 1RSCA 4LFBF 1FKPB 3JAMU 4HH0A 4WE1B 2BJ1A 1SQEA 5CABA 1LK5A 3S1TA 2OFHX 3CEDA 3I0RA 4C8KA 5EWEA 2VQFF 5HI7A 2N3LA 1VIXA 1NEEA 2HHUA 2O01C 2AEFA 3AT1B 4LBHA 4PWDB 2WCXA 1IKYB 4P2FA 2A10A 5A8RB 4QYRA 2C2ZB 2AP6A 3TAPA 1C4AA 1RA6A 4M5NA 1XN9A 3CSKA 1QSYA 5K20B 4I6AA 2ZM6J 3KLFA 3LAMA 1FRHA 2AKWB 4ES1A 4ES2A 5C5JA 3R7SB 2VFUA 3NRBA 1S6UA 3NXZA 4DV2J 4OZ1A 5LMUJ 2BVZA 2ZWOA 1TL3B 5FJ4A 1S6QA 3P5BP 3ZTPA 5CD4A 5J2QB 1OSCA 3HHNB 2YKAA 4A8YA 3ZO7A 3HVRA 3Q0AA 5KFEA 3D68A 2RHSB 4GVLA 1RT7B 1CULB 4ALZA 4DDFA 3HD2A 3WQPA 4OZJA 1RAIB 4RLEA 2GJFA 3IR7B 3N6LA 4X62J 4NLRA 1QAXA 3M8ZA 2NXEA 1JJ4A 1AZSB 3FQLA 2ZKUA 2XY6A 2F65A 2O67A 4EFAC 3QGIA 3DOMB 2FVRA 2FHMA 1U1LA 2OPSA 1HQ2A 4OV1A 4DR3J 3TUJC 5F8GA 3TZWA 1N6QB 4NZ6A 3S6EA 5B0BA 2C2KB 1XC9A 2ZH7A 4DWIA 3D0HE 5C7PA 4MIWA 1R6YA 3WIVA 1NM2A 1LOUA 3T6JA 3FVYA 4ECZA 4K0KJ 3IN5A 1XMQF 1FRJA 3P49B 1Y11A 2CQHA 2HFSA 5E3AA 5E2QA 3GIMA 3RR8A 3DRYA 1FE4A 1OWXA 2FY1A 1DARA 1I51B 2YH1A 2XQCA 3QFWA 3IFEA 4BHQA 3PFOA 2QMXA 4UZCA 3ZZTA 2FVPA 3NNAA 4QU7A 1HI0P 2NR0A 1ZS6A 1RLCL 4JI6F 2KZZA 4ZP6A 4R0EA 9RUBA 1CBKA 4WIQA 2CWXA 4U8VA 1VRTB 3MR2A 4NPOA 1G3OA 1H2VZ 4TU9A 2KT2A 1RCOB 1RQ0A 2ATCB 3NCRA 3D3BJ 5HP1A 3E01A 4A8KA 4B9MA 3FFIA 3E2EA 3R97A 1YJUA 3N6NA 2PIIA 4Y2CA 1S77D 5HROB 3O2IA 2R9LA 2MZQA 1N5TA 3DLBA 3UVJA 1S9EA 5AE1A 3WHIA 1S97A 4CLFA 1R8BA 1V5VA 1FFWB 4KGMA 1SC3B 2MB0B 4DL6A 4YHHJ 1YQHA 3CPWR 2YQ0A 1KHWA 2BACA 4Y2IA 4ZCIA 2UP1A 4LF6F 4LF9F 2HFZA 1H98A 2VA2A 2U2FA 2I8EA 1NK0A 3FGVA 3OHAA 2KJVA 5DG7A 4C3LA 3IRXA 4LIRA 1RHRB 4LR8A 1U49A 1B4SA 2CQBA 3A8EA 2AYBA 2UXBF 1UA1A 3QIPB 2RF2B 5IV4A 1JQGA 1FNXH 1P1LA 3DDNA 1FXLA 5GAGU 2KFZA 3MXHP 4M5DA 5J2NB 3Q8PB 1I94F 3TWZA 4F25A 2MY7A 4PQUA 4C0BA 3M9OB 4HT5A 2FHJD 3HZGA 2IVFB 5CYMA 3M9MB 4TY8A 4F4AA 4P10A 5KT3A 4I2PA 3W64A 3NNHA 1YG0A 4K4SA 3I0RB 1KVKA 3RZAA 1UVLA 4ZVUB 2WSCC 5B0EA 2W2NP 3PYGA 5J1PA 3QAEA 2ZOFA 3MPYA 2UU9F 3EGZA 2A3JA 4CTAB 4C4WA 1B7FA 4GVBA 2MQLA 5IT4A 1NLKL 2CJKA 2AJFE 1HIYA 3LO3A 4P2MA 1RT4A 1RWVB 4YR2A 1RTZA 5D15A 1JLFA 3KLFB 4CO4A 2XMTA 3SQGB 2YNIA 2DNZA 2HIQA 4C8LA 3C2PA 1RACB 3V6KA 1EQ0A 1U02A 5D77A 1A0OB 2CDQA 3VGUA 4EBCA 2NYIA 3IAM9 3OL8A 1TUVA 5L9NA 1S6QB 3BBCA 3OUYA 3H25A 1U6ZA 5HATA 2W1BA 4LFBJ 4UY8T 5IWAJ 2XMKA 1VLYA 5DETA 1VK3A 4MK7A 4ZPAA 3AOAA 2BRLA 2DNYA 4LUBA 4PPZA 2ILZA 4U7UK 1TKDA 3PW5A 2OPSB 1UPMB 4C9DA 5A6PA 1ITPA 2VJUA 1HQEA 1RA7A 2KYZA 3IXQA 3IM9A 4MYUA 1X5TA 4V19J 3W9JA 2OLWA 3DDIA 3MEKA 4ZVQB 5ITHA 1RTIA 1DHMA 3PKMA 1RU1A 1KEKA 4X65J 1Q81T 4I67A 1S1UA 1WOOA 4M5LA 2EC0A 1M1GA 1VRQC 1T95A 1PC5A 2VFVA 1TL7B 4JI4F 4L76A 1R8CA 1VQLS 4NRUA 4WWSA 1PILA 3PW4A 4B3MF 2BQRA 3U27A 1RWOB 2ASJA 1Y10A 4DZ6A 3NGUA 1DAXA 2R42A 5JVHQ 3ZZZA 3VF0B 3AA8A 2VH7A 1N5SA 1FD2A 2DY9A 3UR0A 4URSA 2RRNA 4U8YA 2HEKA 3FZBA 2JZ5A 2UXDF 4Q45A 2AEJA 2B6AA 1QUVA 3KLHA 5HP1B 3E01B 4H4MA 2B4UA 1YJWS 1GMUA 3MPWA 3PYFA 1IBMF 3LA0A 4AL7A 4GO7X 1ROFA 1PAUB 4ATNA 3UVJB 1UJ6A 2VG7A 2GQQA 4OI0A 3SV4A 3SDEA 3M2RB 3Q8RB 1XMQJ 5C42B 3THTA 5AJ3F 3TARA 2HW3A 2QMWA 2VA3A 1V6HA 3BJYA 1FJEB 3DLLQ 2ZE2B 3S7RA 2HQDA 3CMQA 3ZFVA 5IC6B 1IN0A 1KC8T 2MQOA 4JI6J 3LH2S 2CVIA 5ETTA 3WX8A 1KQKA 3RBDA 2MY8A 2BBEA 3PCOB 3U1MA 2HS4A 3MFHA 2VDIA 1RE1B 2CPEA 3KHLA 1TKZA 4EI2A 1QVGR 1OY8A 5IM0A 2KT3A 4B9SA 3NGTA 2OPQA 2KU7A 4M5DB 1S99A 4KHPF 4H4OA 4ECXA 4PQUB 1FERA 1VQ6S 4WKRA 3KKFA 3PHTA 1VHFA 5I3PA 5CYMB 4TY8B 3ULHA 3QATA 3GCXP 1RBLA 2IDEA 3LF0A 2XZWA 4ZP7A 4HYKA 2IYGA 4I2PB 3IO1A 4C8MA 5KFDA 1NAQA 4NASA 1QUPA 4B3TF 3PFEA 1SL2A 3HDSA 1S5ZA 4NEZA 2YPZA 2LDYA 3JTPA 5IT9Y 2CPXA 1RWPB 1JJCB 2JH3A 3JQJA 4RNFA 1JLFB 2H65B 5B0FA 4GC6A 4A8XA 3RB0A 2BV3A 4JYAF 4CO1A 3H5XA 2UXBJ 2YXLA 1TUWA 2YNIB 1NCLA 4B9TA 1YSJA 5GAHI 1RT2A 4PKDB 3QRPA 4NI2A 3T3FA 1EETB 1N32J 4B3SF 1I94J 1SQFA 4WXOA 4F04B 2YTCA 2XMAA 3OUYB 2RIJA 2RILA 1U1OA 4UQTA 2ZOMA 2F4VF 3MI7X 3RUBL 3N5BA 2VICA 3BQ2A 3MCNA 4GO5X 3NCPA 1U2RA 4MH8A 3DRSB 2YKQA 2CNOB 1M5PC 3IWXA 3C14B 3IC1A 1SKSA 2DIVA 1VQNS 1W2BR 3OTEA 3LPEA 2UU9J 1WKLA 3QBCA 2BOAA 3CWJA 3DRRB 3DGVA 1HQEB 3M8RA 2VHGA 4NLOA 3BM7A 4W92B 2D9PA 5KFCA 1U24A 4QWBA 2QZ8A 3ZZOA 1X9WA 2EC2A 1S1UB 1VQSA 3CC2S 2YWEA 1CLFA 4P73A 2XLJA 4B9UA 1F5AA 1HBMB 5K5MA 5D0GA 4PXBA 5B0CA 4EO6A 4NLDA 1DQAA 1TVRA 4PG8A 2JJ4D 5DZ6A 1UETA 4F36A 2H54B 2OEMA 4ZVGA 1UVMA 1E6YA 4NLWA 2KO1A 3RB4A 1IBLF 3KLEB 3BSAA 1FFGB 1G4CA 3KLHB 2J8AA 3EICA 4NE9C 3BGFA 3R3TA 3GIIA 2QSWA 5JVGQ 3D6TB 1YRUA 3HT0A 2J0QD 2HQCA 3R5GA 2R8KA 1H6KX 2GVZA 3NG8A 1CC7A 5M2RA 3PKYA 4N56A 4O3RA 3SDEB 3FCVA 2D7SA 4A8SA 5H1SV 5L1KA 1R8AA 1VQKS 4IO1A 4JI4J 3HFVA 2VDHA 2COLA 2R2TA 4B3MJ 3P8BB 3P96A 2BE2B 2H51B 3UDLA 3I56S 1QLNA 4ZP8A 2UVRA 3M8YA 2V4QA 1DTQB 4OYIA 4RUCA 5K8OA 1LWEB 1YJ7A 2BJ9A 1FRLA 3BKTA 2D3UA 4FXDA 4KH1B 2J8SA 2PGCA 1HBOA 3DLEA 4KQZA 2IVMA 2X1AA 2LDIA 1JLBA 2UXDJ 2AJQA 1TK5A 3WZ0A 1NPRA 2OPPA 5IM0B 3L95X 4C3MA 1SJQA 3B4MA 3UW1A 2XZDB 3BQ0A 2OPQB 1IBMJ 4OJGA 2CVEA 2A6MA 1Z4UA 5HVGA 2ERRA 1Q82T 1XMOF 1EIYB 4FF1A 1AW0A 4ZLJA 3F44A 1VK8A 2M52A 1WORA 1HI8A 2DGOA 5M2UA 2OMOA 3BGLA 2BMBA 1L3SA 5AJ3J 1K1QA 2FGCA 2AZ3A 2CQPA 4AFFA 3G6YA 2XMMA 4O0NA 1X9SA 2FC8A 1UVJA 3PX4A 3UD3P 2RE1A 3MM7A 1WC4A 3ZZPA 3DI6A 1NPPA 3ENVA 3MM5A 3DXSX 4OYPA 3SI8A 4QIGA 2E1MC 4QIVA 5KFZA 1K8AT 3CD5A 4KIAA 3B8HA 4KRWA 3BO3A 4L72B 2K7KA 1RT2B 3H5YA 5IQQA 2XS2A 4WTYA 4NI2B 4KHPJ 1DFDA 1HMVA 1NB7A 1UL3A 2XM3A 3QMQA 2QRRA 1X60A 1WF1A 3ZNJ1 3IGVA 3T41A 1U0HB 1SH0A 2OH2A 3RAMA 1PC4A 3B4DA 3Q2SC 1QDUB 5ETQA 1ZAXA 3EGVA 2AF6A 3QZ7A 2CAJA 5KFFA 1FJ7A 4IO9Q 2KB2A 4PABA 1URNA 3OXFA 2AU0A 4ZVSB 4B3TJ 2IVYA 2LXUA 3GYXB 4ZKAA 5T14A 5I4MA 2VFSA 4RL1A 2R7XA 3P3DA 3MMAA 4X4OA 4DV6J 2XSJB 3UN3A 4BBYA 2QMUB 3IBFB 5KT7A 3UWTA 4IYQA 3JAMY 3C15B 1JWWA 2LFVA 3EPGA 4X4RA 3N79A 2NZCA 1FKAF 2XWXA 1TAQA 4UY85 1B3TA 3CJSA 5LSRA 3I87A 2B5JA 1YRXA 2DHAA 2G2YA 2V4JA 1VHIA 2M3DA 1U47A 3DFEA 3JYTA 2GO9A 4X4PA 4DR7F 1MROB 2DXFA 4RW4A 3KHRA 2PFFB 1TVRB 2F4VJ 3VQSA 2QYCA 2M88A 3RW7A 4QIFA 1KTVA 1YBAA 3BREA 3LPYA 4Q7AA 4CI0B 2V8HA 1U2CA 3O44A 2J9EA 1E6YB 3AHPA 5H9FJ 1H7WA 1YZ6A 4NLSA 6FD1A 3NBPA 4K2JA 2EFGA 1SL0A 1K0VA 3TUZC 3QJJA 4LRFA 3D6MB 1WACA 2JRSA 2L41A 2GFFA 5GAEI 1L5UA 4XO0A 3HHLC 2BYCA 2ZD1A 1GMWA 1DZ5A 4B9VA 1M1HA 2E5GA 2O1PA 2ACYA 3PO4A 5HO4A 3IWNC 2DR9A 4LF2A 4XPCA 2UUAF 3KWMA 3M8QA 4ZCLA 2DIUA 5THWA 1HD0A 2BE7D 2HS3A 2I2YA 1BUXA 1S1WA 2Z4PA 1RHMB 4LR7A 3G4SS 3F0NA 4P7TA 5IV3A 3K8VA 5J1EA 2DNGA 3KHHA 2QX0A 4ITSA 3EM1A 3KJQB 2P8IA 3CDWA 1HNVB 3HT3A 5KFWA 4YFUA 1C1BA 3NWGA 3DLEB 4IG3A 2C1EB 4ID8A 5FIIA 1IBLJ 1JLBB 2KRRA 3J80U 2RQCA 4HI2A 2FD2A 1LKZA 2VIHA 1JKHB 2OPPB 1WUUA 1C2PA 5C2CA 2C3PA 2XC9A 2RUGA 4HVZA 4QOTA 2YPYA 3PDNA 2Y0BB 2VC0A 1U45A 5L9XA 2YKNA 2MZRA 4TKTA 2L08A 2VL1A 5F0UA 1PKUA 1OJ4A 4YY3F 3SCLE 4F4XA 1WC6A 2CKWA 3W8PA 1A9NB 3RB3A 2ZBRA 4DFKA 5LXYA 4WIIA 3UNYA 2KG1A 1DQ8A 3HO1A 2ZVIA 1JNRB 4F0HA 2XZTB 3MM7B 2BW7A 1X4FA 4DHVA 4USKA 3MM5B 2FJAB 4BC7A 3H59A 4O3QA 5CCLA 2R7VA 2DITA 2K2PA 4ELTA 1CJKA 4GMKA 4X2BA 3JTNA 4F4KA 1RP5A 2RVJA 2MZTA 3QSYB 5A2QU 3VZHA 4NLYA 5I3UA 1U8WA 4MKAA 1GXTA 4OX8A 1RTHA 2AIRB 2BUNA 1HMVB 3BV8A 5J2PB 3TANA 3L7PA 3LP0A 3MR3A 1VC5A 4NMLA 3RG6A 3TRGA 2P9CA 3J81j 3N01A 2OSRA 1X4DA 4NYPA 3DCAA 3LGNA 3MZIA 2NQPA 1T9XA 4OMFG 4UF4A 3ENAA 3CDUA 4L75A 5LJ3Y 2XYHB 2MKJA 2DNHA 2R3VA 1S7HA 1X5PA 1HBNA 4RUAA 2DGTA 1L3UA 1VR6A 2M7SA 2WHOA 2L3MA 4I68A 1S0VA 4ZJLA 1X31C 2EG2A 3IAS9 5KT5A 2OSQA 3GU0A 2PT0A 3BR9A 2HNDB 5EX0A 3IA0A 3CJ4A 2CQCA 3MOJB 3PJXA 3RGIA 1IKXB 2D74B 2G1HA 4NYZA 4C6AA 4NLUA 2B5JB 2VKZG 1QY7A 3JYTB 3MM6B 4CLPA 3UD4P 2P5VA 1FRKA 2XMVA 4F67A 4PG5A 3GCWP 4RW4B 4B08A 4KB7A 1T7PA 2YKOA 2RQ4A 3KG1A 1U4BA 4HR2A 1PJ5A 1XQIA 5HQLA 4PPDA 2VFTA 3TUIC 1NSQA 3UDVA 3AA9A 3I55S 4WK1A 2ALYB 1Z2ZA 5HQMA 2W8KA 4DPYA 3NBPB 2Z57B 2DRBA 2RS2A 2OELA 2CPYA 2HKEA 3HHDA 4CZCA 2CYYA 2GHVC 2GA7A 4OX6A 3AAWB 2QLWA 1NBEB 3NS6A 4Y65A 1RU2A 2GGPA 4RO0A 3MFIA 5A8WA 4O4GA 4DLGA 2E9RX 4RU9A 3QRQA 3ZC4A 3M8QB 2QTWA 3BB5A 2ZEJA 2EFOA 2XLKA 4H4KC 1Y5NB 4DQPA 1S1WB 2BXJA 2WRMA 2VJVA 2RQKA 4DR7J 3V6HA 1FDNA 2C2RA 4NWBA 1M5VC 5F3ZA 1KQSR 2RU9A 4ILMA 2ZH6A 2QC3A 1IVZA 4HLBA 4NRTA 4R5PA 3ITHA 5HK4A 1HBUB 4B17A 1VS3A 3IM8A 2MMYA 2Y8WA 2LU2A 4IG3B 2C42A 3IG1A 1WC1A 1Q78A 2DHGA 3M8WA 3AD8C 1JLGB 4IG0A 3TOQA 2HBRB 2YVSA 3OVAA 4C11A 1GXLA 4ETXA 1MWQA 2YKNB 2AYMA 2BDPA 3HLUA 3D67A 3AQPA 1NK4A 5DG8A 3NCQA 2PD1A 4KC5A 3WDOA 3A13A 2UUAJ 4DS5A 4TLRA 4F2RA 2GIRA 3HFKA 3TA2A 1ZTTA 2MKKA 5AT1B 2JFDA 1MMLA 2DNRA 4ZPWR 3KK3A 1BD6A 1SUQA 3LP2A 4HDGA 3GIKA 1S72S 4Q8FA 4DOZA 3J7AN 1TMJA 2DNLA 2YWHA 3TYTA 4JUZA 1D1UA 2RKIA 2D3ZA 3BN7A 3DYAA 4K4XA 2W25A 3PVXA 1CJKB 4GC7A 2MGZA 4WPAA 1TKXA 2HNYB 2UUCF 3NAHA 1R31A 1RTHB 3EZ5A 1WKKA 4XK8C 4X4VA 1X4CA 4C8OA 2E1RA 3MM8A 3I0SA 4LSNA 1S10A 5CD4H 3GSDA 1FESA 1FJGJ 1FEHA 2R8IA 4YY3J 7FDRA 2V2QA 4YB5A 2DGVA 1U1KA 1ZPVA 4WFAQ 3MAQA 1HNZF 1PBUA 1UWAA 2NXCA 2DGQA 1HBNB 1IKWA 3GV8B 2IMOA 2X1FA 3NY0A 3AB4B 3CULA 2CQDA 4FF2A 2KDOA 2LQBA 3LAKA 3M6VA 3UPFA 1H3DA 5EX3A 3I4HX 2I0XA 2B56A 2NS1B 2AGPA 3GYGA 1O51A 2DXEA 1N54B 5ETMA 1Y7PA 1X4EA 3HF5A 1U8SA 1JJHA 2HQIA 4PAAA 1PYOB 1RXOB 3G6XA 1JXVA 3VCDA 2KVQE 2C2NA 1WOSA 1AFIA 2XMUA 1QE1A 4LF7F 1VBYA 1HYSB 3Q83A 5KG5A 4O3PA 2MDAA 4MT1A 4FNHA 5JXSA 2CXEA 3H0PA 3H2VE 2GZOA 1ZOTA 1NSAA 1TFYA 5H9FK 1WOPA 3PW7A 1IBKF 4F26A 4KR0B 1JIHA 4U9RA 4MKVA 2DGUA 2N4DA 4CLUA 4IH5A 4J9UE 3BQ1A 3DLGA 3K5NA 3TI0A 3FCWA 2ZHAA 4N76A 1SJ3P 1N88A 3LOUA 1NH8A 2E44A 4F3QA 2VASA 1R0AB 3BF4A 4K4UA 4IDKB 4A8MP 3CF5Q 5LM7E 1OO0B 5A8WB 2LXIA 2HFNA 2HWHA 3PY8A 4FPIA 1TK0A 3FSXA 4AL6A 1SBRA
chains in the Genus database with same CATH topology
4HT5A 2HNYA 2FHJD 3DOKB 3HZGA 5KFRA 2IVFB 2HAIA 3CGIA 5CQGA 5CYMA 3U7JA 3K57A 4PUOB 3M9MB 2DR8A 4TY8A 3OSPA 4N8NA 2VFRA 4DUZF 1GX5A 2BA9A 1XK8A 5KT3A 4I2PA 1OSDA 3NNHA 1YG0A 2KT5A 3I31A 4K4SA 2GV1A 2LQ5A 1TL4A 4KHMA 1WHYA 3I0RB 4E8UA 3RZAA 1UVLA 2KTQA 1LFPA 3MTKA 2WSCC 5B0EA 1HWUA 3ICLA 3TO8A 4ZMMA 4NCGA 2AYEA 4M1KA 2B6AB 2ZH2A 4R5PB 5L39A 2Z0GA 4H4MB 5J1PA 4ZPBA 3QAEA 4QBUA 2ZOGA 4DQSA 2ZOFA 3MPYA 2UU9F 1SH3A 3EGZA 2A3JA 4CTAB 4ED6A 4C4WA 3G96A 3TVZA 1B7FA 2DCUB 2ZH8A 2MQLA 2HPUA 3KLGA 4KAIA 5IT4A 5KFTA 1KHVA 2CJKA 1A7GE 2AJFE 2FUG9 2DHXA 4DFPA 2XNRA 2CQ0A 1F60B 2DBBA 3IG1B 3H2UB 3BO2A 3LO3A 3ENQA 2FJEB 1S9GA 1HPZB 1IQZA 1RT4A 2D9OA 2GNKA 4YR2A 5B0GA 4ZPVR 3FEYB 1JLFA 2VG7B 2RT3A 3SFUA 5B0AA 5KFMA 2MKIA 5FDLB 4ZA1A 2FLLA 3KLFB 3DN9A 2HHWA 4CO4A 3AY0A 2XMTA 4Q43A 1LWCB 3SQGB 3ISNC 2YNIA 3MR6A 2AD9A 4K5RA 5C24B 1DBDA 2DNZA 2HIQA 4C8LA 3C2PA 2VBXA 2VC1A 2G0CA 2B51A 2JOQA 3V6KA 2ALZA 1YJTA 4J9QA 5D77A 1VQPS 4OI2A 2EFQA 3AJ2A 5KFGA 1N8RT 1ELOA 4MJKA 2CDQA 2XB2D 5KG0A 2IM1A 4PQAA 4DS4A 2XI3A 4Q8EA 1NK5A 4X66F 4DV7F 4EBCA 1U1NA 2NYIA 3IAM9 3I82A 2EK6A 5CXTA 2FC9A 2MPUA 3OL8A 1TUVA 5EHHA 2FB0A 3PNIA 1RT6A 5L9NA 1DURA 1S6QB 3MEGB 4UW2A 1FO1A 3OV7A 5KG2A 2JLFA 3K58A 4TU8A 3OUYA 3H25A 2F9JA 2P6SA 2J5AA 4PCQA 3CD0A 4QPXA 4TXSA 1U6ZA 5J2MB 3M8SA 2GMLA 3QO9A 3TAMB 3PW0A 3ZZYA 3T1HF 1KR4A 4WFNQ 1RI7A 4UY8T 1KQFB 3FRYA 3JSMB 3KK3B 2XMKA 3CCQS 1YHQS 2RJZA 1HYSA 2B3TB 3V4IA 3D1QA 3LP2B 1VLYA 5T7LB 5DETA 1PGZA 1VK3A 1ZM9A 4FF3A 3D1OA 2GHPA 3EYZA 2Z2LA 1QJHA 2MZSA 4OJ3A 1M1KT 1M90T 3G9CA 4RNOA 3MWBA 1Y5LB 1FNOA 3BR8A 1MMNA 3PM9A 4MK7A 1U25A 2RMLA 4ZPAA 3NKYA 4IUFA 3GR1A 1TKZB 3MMCA 2W7OA 2JEJA 2BRLA 2DNYA 3DMJB 4LUBA 4PPZA 2YNGA 4XDDA 1YTYA 2HLUA 1KOOA 2FHOB 3FZ2A 1U48A 2F8EX 2ILZA 4DV0F 3SYZA 1R27B 1BLUA 5KT2A 4KT0C 4YMEA 3TNVA 2XS5A 4U7UK 2ABYA 1TKDA 2E1CA