3QO9B

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tsao-t, a non-nucleoside rt inhibitor (nnrti)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ ribonuclease H
publication title Crystal Structure of tert-Butyldimethylsilyl-spiroaminooxathioledioxide-thymine (TSAO-T) in Complex with HIV-1 Reverse Transcriptase (RT) Redefines the Elastic Limits of the Non-nucleoside Inhibitor-Binding Pocket.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
total genus 105
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qo9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9B03
4RNHA 5KG7A 4DL2A 4MK8A 2ZKUA 3H40A 5F8LA 3T5KA 4J9NA 3KK2A 1HQUB 2W9CB 4J9PA 2V4QA 2ATLA 1C0UB 3M8PA 2AGOA 1LW0B 2W8LA 2VG5B 4YP3A 2W7OA 3IGVA 1HQUA 5KFRA 3DI6A 2W9CA 3G6YA 2FJVA 2B43A 3G6XA 1C0UA 5KT2A 1IKXB 3MFIA 3DYAB 1TKXB 3GIMA 1TKTB 4ZHRB 1TQLA 2VG5A 4IG0B 3CJ0A 4QWBA 4RNOA 4TQSA 1RT7B 2XWYA 3NAHA 2DPJA 2IJNA 3H5SA 4R8UB 1IKXA 2FLLA 3MFHA 2OPPB 1TKXA 1VRUB 3DYAA 1TKTA 4ZHRA 4NLPA 4EEYA 4O3RA 4IG0A 4NZ0A 4QW8A 1RT7A 2YNFB 4ECXA 3LANA 4I7FB 3V81B 3UQSA 4R8UA 3I0RB 4RNNA 3GQCA 2FLPA 2OPPA 1VRUA 4EBCA 4JV1A 3LAMA 4GC6A 5KFGA 2BR0A 2YNFA 3MR2A 2IC3B 3V81A 3QYYA 3T5HA 5KT7A 3I0RA 3BREA 4I2QB 5KFMA 4IFYB 2FVQA 4ID5B 2BQUA 4LSLB 3QGIA 4F4YA 2AGPA 2J6SA 2WK4A 4ECTA 2IC3A 3SFGA 4DG1B 2BRLA 1JLFB 4I2QA 3CJ2A 2WB4A 4IFYA 4K50A 4ID5A 5KFPA 5KFXA 2JC1A 4LSLA 5C24B 3MEDA 3FQKA 4H54A 2FJXA 4NLSA 4YQWA 1C0TB 5J1EB 4ZVEA 4DG1A 4MKAA 1QUVA 4TY8B 3H4BA 1TL3B 3RB3A 1JLFA 3NMAA 4K4YA 2GC8A 4RW6B 3T1AA 1JKHB 5C24A 2CKWA 4JUZA 4KO0B 1CSJA 1S10A 4IH5A 2XGPA 3MEEB 2HMIB 5J1EA 4Q8FA 4TY8A 4U6PA 4K4TA 1TL3A 1RA6A 3V6KA 5DQGA 4EBEA 2R8JA 4RW6A 1JKHA 4F4ZA 2GIRA 2IAJB 4KO0A 3I5BA 4MIBA 3HHKA 5F8IA 3BSNA 3SI8A 4NLGA 3MEEA 2HMIA 3UPFA 3JYTB 3LP1A 4WXWA 2FLNA 3KK3B 4EYIB 2IAJA 1DTTB 2ASLA 3C6UB 1S0OA 3V6HA 1HQEB 3M9MB 1IKVB 5HLFB 3JYTA 5I3UB 5KFEA 1EETB 4WZQA 4XO0A 1NHUA 3PHEA 2D7SA 4NLXA 1S97A 1DTTA 2OPQB 3C6UA 4RNFA 1YVFA 1HQEA 2HNZB 4KB7A 4WFXA 5KT5A 4RNMA 1IKVA 5HLFA 1TL1B 5I3UA 1EETA 1HYSB 2J6TA 4QWEA 4ED1A 3BSCA 2OPQA 4Q45A 3KLVA 1RT3B 4K4VA 2E9ZA 2HNZA 4H4OB 4ZP7A 4Q44A 3UR0A 1SV5B 4TYAA 1S9EB 1TL1A 2B5JB 4DL5A 2IJFA 1TV6B 4R0EA 4RUAA 2IM0A 2JEGA 2E9RX 4PQUB 4XPCA 1KLMB 1UWBB 1RT3A 2YNIB 3JSMB 1OS5A 4IKAA 4NLTA 5DLGA 4H4OA 2AWZA 2AQ4A 1SV5A 2V0NA 1RYSA 1S9EA 2B5JA 3OSNA 1TV6A 1IKWB 2AGQA 4OL8A 4PQUA 1KLMA 1UWBA 2YNIA 3JSMA 1FKOB 2B6AB 4J9LA 2IBKA 1RTIB 4IDKB 1T03A 1S1XB 4H4MB 1IKWA 4TYBA 3C6TB 1N5YA 1FKOA 2B6AA 3KLIB 5KG5A 4DL4A 3RBDA 1RTIA 3E51A 1N6QB 1HNVA 4IDKA 1S1XA 4H4MA 3IGNA 4MIAA 3C6TA 1XR5A 2RF2B 4Y3CA 3TAMB 2JEFA 1N6QA 3H5XA 4NRUA 1LW2B 1S1VB 2DPIA 5KFQA 3NGDA 4ECZA 4ECWA 4ECUA 2EC0A 2RF2A 5EWEA 2W8KA 4KFBB 3DI6B 2JLEA 3TAMA 4QW9A 1LWCB 5HP1B 4ZVGA 5KG2A 1LW2A 1S1VA 1HARA 4FS1A 3OSPA 3BQ1A 2WONB 4KHRA 5HROA 2R2SA 1IKYB 2R2TA 1XR7A 3BR9A 4KFBA 3HVTA 4RW9B 5KFYA 1LWCA 5HP1A 3PJXA 4NLOA 3VQSA 5L1LA 4F50A 2IA6A 3V4IB 2WONA 4URGA 3G6VA 3EPGA 3ITHB 4RUCA 2WTFA 1IKYA 4IRCA 3SFUA 5EDWA 3BSOA 4RW9A 3GV8B 3Q8PB 1S1WB 3V4IA 4K4WA 2C28A 4TQRA 3ITHA 3DLEB 2YKNB 3FSIA 3CIZA 4DEZA 1RTJB 4KBIA 4ZMMA 3Q8QB 3MR6A 4ZP6A 5KFLA 4NLQA 1Z4UA 3MR5A 2R8KA 5KFSA 5DQIA 3DOLB 3FDSA 3PW0A 1S1WA 3DLEA 2YKNA 1RDRA 1JLQB 2V9WA 1RTJA 4NLVA 1EP4B 4YR0A 3DOLA 3QGHA 4KHMA 2YNGB 4LSNA 1JLQA 3MEDB 3OLAA 5J2MB 1EP4A 5KFNA 3GIJA 2R8HA 2ZE2B 3DM2B 1TP7A 3D28A 3MF5A 3KHGA 5KFTA 2YNGA 5T14A 3QZ8A 3KOAA 1SUQB 5KFBA 3DLKB 4PUOB 2C2RA 4X2BA 2R2UA 5HBMA 3RB0A 2ZD1B 3H2LA 5J2MA 3QLHB 1GX5A 2ZE2A 1RT1B 3DM2A 3FQLA 4NLDA 2XC9A 4J9RA 3KHHA 1SUQA 3DLKA 4PUOA 5KG0A 4EO6A 4ZVHA 1S6QB 1QAJA 2ZD1A 1RTDA 2XCAA 4Y2AA 3PW2A 3KHRA 5F8JA 3QLHA 5F9NA 3KK1B 2XI3A 4G1QB 1RT1A 5EWGA 1JLGB 3I5CA 4U7CA 3E01B 1REVA 3LP1B 4J9QA 3T5JA 2JEIA 1S6QA 1K1SA 3CDWA 3KK1A 4Y2CA 4G1QA 3LP2B 1JLGA 4Q0BB 5L9XA 3E01A 3MEGB 2JC0A 1S9GB 1C1BB 4WFZA 3IRXB 2QV6A 4IH6A 2OH2A 1ZTTA 4DL6A 4NLRA 3DDKA 2R8IA 3LP2A 4Q0BA 1XR6A 5JUMA 3KNAA 3MEGA 3KMQA 3BQ0A 2R2RA 3BQ2A 4MK9A 1S9GA 1C1BA 1T94A 3IRXA 1RT6B 3NAIA 3UDLA 1T3NA 1S6PB 2RDJA 1ZETA 2BANB 5CYQB 2OPRB 5KFWA 3QZ7A 5F9LA 4ED6A 1RT6A 2XCPA 4DL3A 1S6PA 2BANA 3DMJB 5CYQA 5L1IA 5DLFA 2OPRA 3FFIB 5DG7A 2VA2A 2HAIA 2WOMB 2AX0A 3DLGB 5KFVA 1S1UA 4FS2A 3GIIA 3G86A 4XPEA 2BRKA 4QWCA 4WXOA 1J5OB 1S4FA 5K14B 3MR3A 2ASDA 3DMJA 4IQXA 1ZTWA 1T03B 4ECRA 3FFIA 2ALZA 5KFCA 4FBUA 2WOMA 2HNYB 3DLGA 1WNEA 4K4UA 3I0SB 1FK9B 4RW8A 1N5YB 5DG9A 4ICLB 4R5PB 5DG8A 4QWAA 2YNHB 1J5OA 2HNDB 5K14A 2BE2B 1HNVB 3BSAA 2OPSB 3H5YA 3RB6A 5KFUA 4O3QA 4MFBB 3PZPA 2HNYA 4K4XA 3I0SA 1FK9A 5FDLB 4O4GB 2BQ3A 3CDEA 4QPXA 4ICLA 4R5PA 2FVRA 4NYZA 2YNHA 5KG1A 4EO8A 2HNDA 4ECYA 2BE2A 5L1JA 3PW5A 1BQMA 1S1TB 2OPSA 1TKZB 3IS9B 3DRRA 4MFBA 1JIHA 5KT6A 5FDLA 4O4GA 2UUWA 3HVAA 1S0NA 1K1QA 4Y34A 4LQ9A 1S1TA 4WZMA 1TKZA 3IS9A 1T05B 2ILZA 1JLCB 2IM3A 2WHOA 3QGGA 5HROB 5KG6A 4IR1A 3H4DA 3GV5B 3HVTB 3LP0A 3KHLA 4WE1A 2C2DA 4O44B 1NNDA 4NLYA 4ED3A 2AU0A 1T05A 2IM2A 1JLCA 5I42B 2UUTA 4YMEA 3KLFB 1U09A 1IM4A 3PJWA 3T5LA 2J6UA 4IFVA 2XI2A 5CYMA 1C1CB 5J2QB 3QO9B 4EBDA 2O5DA 1DLOB 5KFKA 4O44A 5L1KA 3V6JA 4K4SA 3NBPB 5I42A 3KLFA 5KFAA 1FKPB 3RAQA 5KFJA 4ED2A 3OL6A 1C1CA 5J2QA 3QO9A 1SH0A 1QE1B 1DLOA 1R0AB 3TVKA 2R8GA 3NBPA 1C2PA 2W9BB 1FKPA 3N6LA 4NCGB 4IRDA 5KFZA 3KLEA 3RAXA 1QE1A 1R0AA 4WFYA 3V6DB 3EPIA 2W9BA 4ZVFA 4LSNB 4NCGA 2FVCA 4URQU 4PWDB 4TN2A 5KFIA 1LW0A 3BGRB 3V6DA 2FVSA 1NHVA 4IR9A 5HBMB 2I1RA 1RAJA 4PWDA 3CO9A 2W7PA 4K4ZA 2HWHA 3QIPB 1HNIB 3KLHB 2FJWA 4O4RA 3I5AA 3BGRA 2WRMA 3GYNA 4WYLA 3KLGB 4MK7A 2QE5A 3N6MA 4MKBA 4RW7B 4ZPCA 1RA7A 3PVXA 5KT4A 3RB4A 1RTDB 4J9OA 4ZPAA 3Q8RB 3QIPA 1SH2A 1HNIA 3KLHA 4M94A 2GIQA 2C22A 3KJVB 3KLGA 1N4LA 1REVB 5J2NB 2CJQA 3DRSB 4RW7A 5KG4A 5KT3A 4O3SA 4J9KA 4I7FA 3ICLA 3IN5A 3RBEA 1JXLA 4HKQA 1D0EA 2UVUA 5C5JA 3PW7A 1S9FA 3KJVA 3TQ1A 5DGAA 3IG1B 1N48A 5J2NA 1MMLA 3DRSA 2D3ZA 3OLBA 2UVVA 1QAIA 3H98A 5F8HA 4ECSA 4ZP8A 2VG7B 3CDUA 3ISNC 4RZRA 4IH7A 4F4XA 3QIDA 2UVWA 3OL7A 3IG1A 3LAKA 5C25B 3H59A 4G3IA 3HVWA 2VG7A 2D41A 2BQRA 4I2PB 4MH8A 4LQ3A 1DTQB 3MECB 2JEJA 4ZPBA 4F4WA 4WYWA 5EUHA 5DGBA 2W9AA 2RDIA 4TY9A 5C25A 1KHVA 5JXSA 3GIKA 1C0TA 1N56A 4IOBA 4KAIA 5F8GA 3PR5B 4I2PA 1DTQA 3MECA 1HPZB 4KKOB 3H5UA 4TLRA 2YKMB 5KFDA 3OHBA 1LWFB 4J9MA 4ECVA 4RW4B 3CJ5A 2I5JB 4ED8A 3NL0A 3OHAA 4KSEB 2V4RA 4O3OA 5D3GB 2VA3A 3M9NB 2UVRA 1RT4B 1S1UB 3CJ4A 1HPZA 4KKOA 1JLAB 2YKMA 1S48A 1LWFA 1S49A 4QWDA 4RW4A 3EZUA 2I5JA 3NKYA 3CJ3A 5D3GA 1RT4A 1S0MA 4RW8B 1RYRA 3OL9A 1RT2B 4O3NA 1I6JA 1LWEB 1JLAA 2AX1A 4YR3A 3KK3A 1HMVB 1JLEB 3FRZA 4JV2A 1JLBB 1W25A 2WCXA 2C2EA 1BQNB 3BJYA 5KG3A 4EYHB 1VRTB 1RT2A 1SH3A 1RTHB 3LALA 1LWEA 4O3PA 1HMVA 1JLEA 2FVPA 2F8EX 1BQMB 4YR2A 1JX4A 4IRKA 1JLBA 3DOKB 2D3UA 4B3OB 3OL8A 3DRRB 4GC7A 1BQNA 4JV0A 5F8MA 5F8NA 4RU9A 1RT5B 3D5MA 1VRTA 1RTHA 4Q43A 1HYSA 5KFFA 3GV7B 2ASJA 5KFOA 4HYKA 1TVRB 2RKIB 3DOKA 3GILA 4B3OA 4ED0A 1GX6A 4KE5A 5EWFA 1RT5A 5KFHA 4J9SA 3M9OB 4FBTA 2ILYA 3M8QB 3LP0B 4IG3B 4WE1B 2IM1A 1TVRA 2RKIA 1D1UA 1KHWA 3CVKA 4URSA 3PR4A 3MTKA 2XGQA 2E9TA 5J2PB 3N6NA 4DL7A 2VG6B 4IFVB 5DQHA 4ZP9A 5CYMB 3DRPB 4ECQA 3M8QA 4IG3A 4ZPDA 3Q8SB 4KV8B 4NRTA 4M95A 5C42B 3PW4A 3HKWA 4ED7A 3T19A 5J2PA 2VG6A 1MU2B 2IMWP 3DRPA 3KMSA 4NLWA 3CWJA 4KV8A 4TXSA 5C42A 3ISND 3KLIA 3KK2B 2HWIA 1MU2A 4NLUA 3M8PB 4Q8EA 3KLEB
chains in the Genus database with same CATH superfamily
2WW4A 2M9KA 3H40A 5F8LA 3HO1A 4OJGA 4USJC 2O1PA 4USMA 3DI6A 2W9CA 1SB6A 1E6YA 3KYLA 1WKJA 1VRUB 2WBMA 4EEYA 4EBCA 4JV1A 2AJ2A 2D3O1 1WDDA 3QYYA 3T5HA 3R7BB 1AUSL 1NDKA 1ZZNA 2RDDA 4ID5A 3F41A 3GJTB 2JC1A 4YB7A 4NLSA 1YJVA 4XTTA 5C2GA 5DDPC 3GSIA 4JUZA 4LF1A 1N34J 3SI8A 2BJ9A 2Z57B 2BXJA 2OP5A 2QMXA 2E5GA 1IKVB 3ZNJ1 4IQMA 3MI7X 4NE9C 1FFWB 1QAXA 5I4MA 5KT5A 2ZH6A 3IXQA 2HVDA 3PG9A 2VBWA 4DQRA 1UW9A 1PSDA 1T9TA 2H51B 4RUAA 3N4WA 1K47A 2HHWA 3QSIA 2XS5A 2ZJQQ 1UWBA 2YNIA 4J9LA 1WKLA 5IT9Y 3C6TB 1FJGF 2OGUA 3CD7A 1S5ZA 2P8IA 3CJRA 1N6QA 3NOCA 2VF3A 4LFAF 4ITSA 3VAMA 1K9MT 4ZVGA 2DK2A 2MPUA 5KFYA 4HVZA 3K57A 2PMWA 2DGWA 2YX7A 4RW9A 2G13A 1OPZA 1WEZA 1FD2A 3GFYA 1JLQA 4DF4A 3TJ8A 1SC4B 4OQJA 3M30B 3DM2B 5T14A 3HCXA 1PG5B 2XC9A 5KG0A 4OX8A 1R0BG 4G65A 2HFOA 1VBZA 1I1GA 1FWPA 4ILMA 2DEJA 4Y2CA 3E01A 1NDCA 3BBBA 3TA0A 3LP2A 1XR6A 2H3EB 4WFAQ 2XZDB 2NSBA 3BQ2A 1UMJA 3QZ7A 3CUNA 3ILJA 5F9LA 3NGSA 3QT7A 3DXBA 3OUYA 3BO4A 2ZHOA 4J90A 5DG7A 1TK5A 1RHRB 3DLGB 1Y0HA 1YBAA 2EFQA 1T03B 5A8WA 1KTQA 3OBIA 2VC0A 4MFBB 3HFKA 2BE2A 3NP5A 5L1JA 1AZSA 3CCZA 1TKZB 4CH1A 3DRRA 5FDLA 5HQLA 1ZM9A 3RUBL 3HVTB 1TFWA 1S77D 4NLYA 1NNDA 4A8WA 2CG4A 2PN6A 4OHWA 4LBPA 1R8AA 1YTYA 2VH7A 2ZDPA 4C8ZA 2P5VA 1TL7B 4WP9A 4X66J 3I4PA 3RJMB 4DV0J 3J7Z5 1UVJA 3G82A 2QA4S 1RAJA 3CJQA 4N8OA 3HXMA 1RTDB 2LCWA 2HQFA 2CJQA 3R6LB 3ET6A 4OZNA 5C5JA 3BBFA 1VQNS 4ES3A 2KI2A 4IH7A 3Q2TC 3QIDA 2GMLA 3HD2A 4NCAA 4LQ3A 4ZPBA 5EUHA 5DGBA 3ONQA 1C0TA 4I2PA 2V2VA 5KFDA 5ETVA 3SQGB 1F2GA 1LWFA 4DSLA 3EZUA 3IA0A 4NXNJ 1RT2B 1LWEB 3FRZA 5ADZA 1Q8BA 4Q7AA 4B3SJ 4ZJQA 2KYXA 1H72C 4USHA 2J0QD 4HYKA 2BX6A 1JJ2R 2F1FA 3EDQB 1W26A 2CFXA 3DRXA 3D6HB 1X5OA 1RK8A 5U47A 2CQ4A 5J2PB 1VHIA 2E5IA 3DFEA 5D78A 2HHPA 5DQHA 4ZP9A 3MMBB 1Y3KA 4ECQA 3B4MA 4LIWA 3HHLB 4AQYJ 1HNXJ 4WTYA 2QEXS 3RRGA 1YQHA 2PA8D 3ZTQA 2EKYA 5EHHA 3VAHA 1T9XA 3X3UA 2U1AA 1NK8A 3LWLA 2HEKA 3H7HB 1RCXB 3CGIA 2W8LA 2FC8A 4PXDA 5KT2A 1XMOJ 4ZHRB 5HMWA 5LMNJ 2OIHA 2FLLA 5BJRA 2UUCF 5K20B 1PCAA 2Y1RI 1EAYC 1CJTB 4DR4J 2MGZA 2KHCA 4FPRA 2IA0A 4BLGA 4KHPJ 2DITA 4LF7F 1XBWA 4DPUA 4YFUA 4K50A 3Q8UA 1SBRA 4DUZF 2PI5A 3CW2C 1TL3B 4OYIA 1CSJA 3C19A 3MEEB 2HLUA 3KG0A 5DQGA 2UXDJ 4K5RA 4KO0A 2BM1A 2HMIA 1X31C 2I38A 3E3XA 1DTTB 2RNEA 5HLFB 4XO0A 2MLXA 1KQFB 5AT1B 3FMBA 4WFXA 1YJ9S 2BVZA 3A13A 4L6V3 3D1HA 3KLVA 2O01C 2E9ZA 4Q44A 1Q79A 4OHVA 1TV6B 4XPCA 4LBIA 2FYXA 2HBRB 2AJ1A 4OL8A 2ZDOA 4JI3J 2B6AB 2OMOA 2R7XA 4IDKB 5CXTA 1Q86T 2EXUA 1M1HA 1XMQF 2DPIA 1LW2B 1RTZA 1S12A 3UD3P 1FDNA 5HMXA 1FDAA 2G0JA 2RU3A 4KHRA 2GFFA 1XR7A 3BM7A 1SKWA 2G0CA 2XHWA 3BSOA 4QYZK 3T9NA 2U2FA 1VIXA 3CE8A 5DDOC 4KBIA 4P10A 4Z37A 3FDSA 4WKRA 4LF6J 2DH8A 2HG4A 2KM8B 2YNGB 4ZS6A 4DLEA 1CVJA 2RUGA 4WBFA 3Q89A 1TP7A 3MF5A 1WEXA 4M5GA 3UE2A 1FRLA 2V5HG 3D3CJ 4J9RA 4FF2A 4KIAA 4EO6A 3PW2A 2YQ0A 2OLWA 2QYCA 3I5CA 1M5OC 4LF9J 5HJYA 3GR1A 3U1NA 4CNYA 2AYEA 5A8KA 1MMNA 4DN9A 1BC6A 4DR3F 2XZWA 3T6JA 3RRHA 3JQMA 3GJSB 2DHHA 1F9HA 4LRBA 4C9DA 2K06A 1S76D 3AOAA 4TU8A 3K5LA 4QJVA 4X84A 4IQXA 4ECRA 2C2NA 4C11B 4NZ7A 3PHTA 5CHCB 4DV3F 3PZPA 4K4XA 4O4GB 1WOPA 3MM7A 2R3VA 2HVEA 2ZVIA 2WHOA 3O44A 4ZVOB 4C3KA 1O51A 2P6SA 1B7YB 2LU2A 2UU9J 2IM2A 1HQ2A 3IRWP 1NJYA 1TU0B 1G2EA 1JMTA 2CUYA 1PJ6A 4E98A 3NBPA 2WVDA 4OI6A 1QE1A 1R0AA 2BJDA 3FRYA 1NHKL 4URQU 4TN2A 3ILOA 2L3MA 3SSQA 2V69A 5HATA 4KYZA 4C3LA 3QT6A 4TU7A 2PO4A 3QIPA 3C16B 3ICLA 6FD1A 3K0JA 4CDIA 3IG1B 2OTJS 2MJNA 4FYYB 4B9NA 5IQ6A 1FERA 4OZ3A 1UA0A 3C46A 4DBQA 3CJKB 4UOCA 3OHBA 3UFCX 3NL0A 3MCMA 3QQCD 3GFZA 2ABYA 4XIUA 1RT4A 2K3KA 4JV2A 1NU4A 4ZVPB 2Q6BA 1HMVA 1HHQA 4K8RA 3MOZA 3OJUA 1WC4A 1IWAA 5F8NA 3W62A 5E3QA 3D2WA 2FHKA 3MPDA 3PTWA 2GS8A 4I6YA 1UP1A 4FBTA 2Z0GA 3FBEA 1Y11A 2IM1A 1D1UA 1IR1A 3BB5A 5GMKa 1EB0A 1V9OA 1P8GA 3HKWA 2NPIA 4HACA 5BYSA 4GKKF 3FVYA 1H0HB 1H38A 2FZGB 2HHXA 3M8PB 2GHPA 4DF8A 3OR2B 1HQUB 2KYZA 1AXQA 3D0IE 4CYUB 4KPCA 4N56A 3N9UC 3IGVA 4GVLA 1UPPA 5E3PA 1RACB 2VL1A 2H9ZA 2Z56B 2IJNA 4F04B 4IG0A 1RT7A 4I7FB 1RKIA 4ZIWA 2OPPA 3HMJG 4GC6A 1VQ7S 1NPRA 2QLXA 4I64A 2QX0A 2YNFA 2IC3B 2BJ8A 3K5NA 3RU0A 2FQQB 2F4VF 2BQUA 3BN7A 5GAGU 2MY7A 3SCLE 4ECTA 3MD1A 2KH9A 3DHXA 2ZKTA 1YHQS 1Y10A 5J1EB 2HSEB 4DR7J 2RJZA 4ELTA 3I9V9 1M1KT 5CQGA 3TEHB 2QSWA 1SQFA 3A8IA 4C0HA 1HL6A 4PR6A 3J81j 4CLFA 1P27B 2CQ1A 4DDFA 1E6VB 4NLXA 3H20A 2KKHA 3UDVA 4TYAA 4QIFA 1S9EB 1Q78A 4DL5A 1RT3A 2AWZA 2AEFA 4LT6A 4DSEA 2O66A 1VGYA 3DOMA 3IWXA 1WTFA 3M6VA 2RF2B 2LQJA 3M8ZA 3IAS9 1UFLA 4EGLA 2MQOA 4Q2LA 1TL5A 2EPIA 5HP1B 1S1VA 3Q0AA 4I69A 2KJWA 2ROGA 1IKYB 3LGHA 4M5KA 1ZAXA 1KNZA 3VQSA 2XMTA 1ACMB 1ULRA 1VR6A 1S1WB 4O23A 4U7UK 2RQKA 1RHJB 1PJ5A 1RTJB 4MYUA 4J9UE 1Z4UA 5MLCV 3F44A 1U48A 3M2RA 2Z30B 4ALZA 2K1RA 2DRAA 3UN2A 3BH6B 4Y00A 2R8HA 2NSCA 1IBMF 2C42A 4Q5VA 2ZD1B 5J2MA 5ETLA 2OTLS 2LA4A 2VPXB 2MZ1A 1VIOA 3R6GB 1QAJA 2RAQA 3KNGA 4Y2AA 3KHRA 5AE3A 4CNZA 4U7CA 3LP1B 4BC9A 4DMZA 1H7WA 4CI0B 3WDOA 5D4PA 4OYZA 1ZTTA 2B9EA 2FC9A 2V4JA 1Q81T 3WC2A 1VQKS 4BC7A 1NSPA 3QMQA 1YBTA 4YB1P 4FNHA 5DLFA 4CM0A 2HQCA 2EFGA 2LA6A 3KTQA 4LFBF 1WHYA 2VZ9A 4B17A 4WXOA 1J5OB 4DCOB 3G9CA 3DMJA 4FVCA 1VQMS 1FE4A 5KFCA 4RW8A 2ZITA 4B9UA 2OPSB 2HNYA 4FP9A 4WPAA 2K2PA 2HNDA 1DRZA 1SIZA 5ETPA 3E2EA 1JK9B 3QGGA 1TL4A 3CJTA 3LP0A 4WE1A 3GCWP 2LXUA 1VQYA 2DB1A 4YHHJ 2M8DB 3PJWA 2XI2A 4NCBA 3TA2A 4X4TA 1QAYA 4OHZA 3TRGA 2NXEA 4YEAA 3MM8B 3UWTA 2ZFHA 3CXCR 1A6LA 1SC6A 4L75A 3RAXA 3I87A 3FCHA 2CNOB 2DO0A 4PWDB 1ZM2A 1FVSA 2BKPA 2DCUB 3UN3A 2VONA 4DR6J 4ZPAA 1U6FA 4W90B 3BDPA 4CO1A 3S7RA 4N77A 8RUCA 3B8HA 3DCAA 4DR6F 2YKPA 1RB0A 4AD6A 4F4XA 5A0YB 3BGFA 5C25B 3MECB 2H54B 4HT7A 4ZOSA 3LTOA 4A8FA 2I5JB 2MZSA 2BE7D 2V50A 4BDPA 1S1UB 1WUUA 2NCKL 2CAJA 3O2IA 1FRJA 2XQCA 2I2YA 5AXLA 2YH1A 1Q8LA 1QD1A 2EK6A 4OLPA 1U1KA 2XY7A 5IT0A 2BOPA 2OSQA 1WHXA 2BMBA 4UUXA 1N32F 2AIRB 4CH0S 4X4RA 1KDNA 1LEOA 7AT1B 4NOHA 2DH9A 4J9SA 2ILYA 2R4FA 1EQMA 3HHNB 3NS7B 4O0NA 3DRPA 4LF4J 5K8MA 3KLIA 1GK8A 2A6OA 4DL2A 2DRBA 5HANA 9ATCB 2W7OA 1H2TZ 1F6TA 4DR2F 4P7TA 3UDCA 1EJ7L 3A3PB 2MKYA 4C8YA 4QR0A 4NLPA 3JB9k 4AUKA 1N88A 1JB0C 3UCUP 2A2CA 2NR0A 3LAMA 4ZVSB 1PJ7A 4WU2A 2A1BA 4J9VA 1R6VA 2FHOB 4LSLA 5B08A 2QMUB 1WI6A 4IH5A 1UVKA 1PYSB 2WBRA 4K4TA 3VVUA 2Y1JA 3TZYA 2W7AA 5B0AA 1R27B 2DNKA 1CJKA 3BS9A 2E7VA 2UXBJ 1OSDA 3L09A 4WZQA 1I94F 3EDRB 4OYXA 1HQEA 3SV4A 1BUXA 1XJWB 4LF5F 4QWEA 4RPFA 4Q45A 3W1YC 1FXLA 1GMVA 4DV7J 2HS4A 2L9NA 3K89A 3QRPA 1FKOB 4DPOA 4FYVB 2Z2ZA 3DU5A 2P6TA 4H4MB 1RTIA 1VJQA 4DV4J 1NH8A 2CWXA 3NMRA 1FFSB 1NMEB 3H5XA 4I67A 4C8KA 3DI6B 4NPOA 4BBYA 3I31A 5HROA 3Q8YA 3PJXA 3W2WB 3J80Y 3D6MB 3Q8PB 2B9YA 1U6BA 3CMQA 2QJ3A 1UZDA 4LRCA 1U6ZA 1XNQF 3MR6A 3CCRS 4F0HA 1YRUA 1BWEA 3NGUA 4QQBA 4FKXA 4YR0A 1KOHA 1Q0NA 1NJIT 4IOAQ 3OLAA 2NXUA 3X1LB 2DGXA 1SUQB 5KFBA 5CZVA 5HBMA 3H2LA 3U27A 3ZZ0A 1U2RA 1RT1A 5BXIA 4P2MA 3KK1A 1K8AT 2DNPA 3DNCA 5BYRA 5GAEI 2R8IA 3MEGA 4DUTA 4Z7YA 3C66A 4OYAA 1C1BA 3IRXA 4DQPA 3BKTA 2ADCA 5CYQB 5KFWA 2ZNYA 2MZTA 2OPRA 1UFWA 1W7WA 4XPEA 4QWCA 2GX8A 4X4VA 5LSLA 3U02A 4K4UA 2AMCB 1FK9B 2XMUA 4DV6J 4UT4A 4O3QA 3QWUA 1U1RA 4JP8A 1IBCB 3VAJA 4M5DA 4LQ9A 4WFBQ 1AT1B 4DV6F 4IR1A 4QR2A 3OD2A 5H9FK 3V6JA 1S57A 4ELUA 3KJFB 2R8GA 2N82B 1KFDA 3EZ5A 4NCGB 2X51A 5KFZA 2MSSA 4DU7A 5K8NA 3V6DB 2PI4A 3FBBA 1RISA 2DNYA 1RHMB 4X4SA 4OX6A 1SVDA 3GYNA 5FIIA 1H73A 2B4UA 5L8RC 3BO2A 2PMZD 2LQ9A 1N4LA 4O3SA 3K5OA 3Q2SC 4ZA1A 2VQFJ 3OVBA 1S9FA 3TQ1A 3UN5A 5J2NA 1SL1A 3C8YA 3NGTA 3OL7A 3H59A 2V6AA 2PA3A 2J8SA 2HVIA 2YH0A 4JI7F 4HHUA 2NXNA 1TAQA 3ZZZA 4FVMA 3D6FB 4CO2A 3CJ5A 1HPZA 2IYGA 2CQCA 4OFZA 3VGTA 4QWDA 2IJRA 3FUYA 5BR8J 5D3GA 1S0MA 1VBXA 1R8BA 3HFVA 5EGYA 3BJYA 2MMYA 1JLEA 2CQ0A 3DRRB 1KSPA 1RT5B 2FJDB 5KFFA 2KG0A 5T41A 4B3OA 3KXDA 3UCGA 5KFHA 3WX4A 5FLXU 1IUJA 3R9LA 2DJWA 3MTKA 4DV5F 4EK2A 1OY9A 2W4CA 4CWBA 1MU2B 1VISA 3CWJA 1I5OB 3M2VA 1RKJA 2F5GA 2AGPA 4RNHA 4DX5A 4B3TJ 4J9NA 1HNZJ 3NNCA 2IHR1 1MWZA 2V4QA 2LEBA 1D8ZA 3G82B 3OFGA 5H9EJ 3A8EA 4NX9A 1ZPVA 4Y2IA 5HK4A 1C0UA 4KH1B 4CLUA 5B09A 1TQLA 1TKTA 1B4SA 3V81B 4R8UA 3I0RB 2ZUGA 3MM6A 3GPAA 1XQIA 2MLZA 3RGIA 4W92B 3W5XA 2MQQA 3JSYA 2WK4A 2GJFA 3A3NB 4DG1B 4LF8F 1JLFB 2EWHA 4RLEA 3RR7A 5KFXA 1OQ6A 1VHFA 1C0TB 2UUAJ 1QUVA 2GHVC 5T7LB 2KVQE 2W2NP 4UY85 4Q8FA 1RA6A 4F3MA 3KUEA 3V6KA 4F4ZA 5E0OA 4OYPA 3UPFA 3RAMA 5LSRA 4HTJA 3C6UB 2D7SA 2GGPB 3QJPA 4PZVA 1X0FA 4GMKA 4UTGA 4ED1A 3Q8VA 1JXEA 4NI2A 4JI1J 5HN0A 4B9SA 4RBVA 4A48A 4DR1F 3TO8A 2OD6A 2WVCA 3O5TB 1S1XB 5E3CA 3MMAA 5E33A 2GV1A 2PFDA 4MIAA 1OJ4A 2HQIA 1T11A 1CJUA 3K17A 2JEFA 4ATNA 4U9RA 1DBDA 4KFBB 2CJKA 1LWCB 2J7UA 4Z2XA 4CLKA 2DHSA 3U1MA 4NLOA 3V4IB 3EPGA 1SJQA 5F41A 2AYGA 4RWXA 2GJIA 4D3GA 2KN4A 1KC8T 2BJ3A 1DURA 4ZKAA 3M2UA 3AJ2A 3GE9A 3WX8A 4JI2J 1S7HA 3UO0A 2M70A 3DLKB 4X65J 1AFJA 2XLIA 4G1QB 4ZCIA 1O0PA 4B9VA 4X65F 5J1NA 1LOUA 1V6HA 5CCLA 3EM1A 1FI4A 5E2QA 3MDFA 5EX3A 2Y9HA 1YJUA 4OI3A 1S9GA 3L95X 3MTJA 2A0FB 1LV5A 2LFVA 2ZBIA 2RQCA 2KXNB 1L5UA 3CCLS 2G1HA 1UEKA 1UPMB 2VA2A 2AEMA 1PAEX 4FS2A 2OO4A 4PYDA 2QG9B 1U7LA 3ETOA 2YNHB 2RS2A 4FXDA 4UOGA 4NA3A 2NXJA 3PW5A 2Y1IA 1BE4A 1UVLA 5CH7B 4GKJJ 3KDNA 1HWLA 1JJHA 4TU9A 4O44B 1JLCA 6FDRA 5I42B 3KLFB 4IFVA 3ZO7A 1FCAA 5RUBA 2MQPA 3QFWA 2J7KA 3OL6A 1C1CA 1DLOA 3R97A 1QVGR 3EVOA 1FKPA 3FMWA 2VDHA 2FVCA 2E1CA 3BGRB 4DPWA 2I1RA 4K4ZA 2HHQA 1HNIB 5LXYA 3TQEA 2DVIA 2YWFA 4MK7A 1RA7A 5LJ5Y 3PVXA 1B0PA 1LWXA 2YKQA 3ZZTA 4ZCMA 3KLHA 4AYBD 2XTJP 3HFZB 3RBEA 3IN5A 2XSFA 5A8RA 1X8DA 1QAIA 1S7IA 2KHDA 5HMYA 3W8PA 5DZ6A 2QO3A 5F8GA 2M4MA 1CQNA 3H5UA 3I9ZA 2ZC4A 3HI9A 2VJUA 2K7KA 2CPZA 3N5FA 4DCPB 3GB0A 1X4GA 2MZRA 2HS0A 2JX2A 2UUBF 1T02A 3FCWA 4Q43A 4JI5F 1QJHA 2GVDA 1GMWD 1KS2A 4URSA 1G3OA 2GJ2A 3P49B 2FGOA 2CNNB 1SJ1A 1H7XA 3Q8SB 5EN1A 3A8KA 2UXCF 2DNHA 4JI4J 3KMSA 3SXLA 4DFJA 2HWIA 4CTAA 3M7VA 2KB2A 3C14B 2K8GA 4LMZA 3CCSS 4MAKA 1HBUA 3SEOA 4X62J 2ZNZA 3QAEA 4X4NA 4JI4F 4F7VA 1U0HB 4BWJA 2B43A 4CLLA 1P6TA 3W5ZA 3CJ0A 4HDHA 4QZVB 3AXMA 2BKNA 4NZ0A 2KXFA 2MSTA 2BW7A 2JRSA 3IBCB 4I2QA 1LNQA 5DDQC 2B7BB 2GC8A 1N5TA 4X64J 4A47A 1VJWA 4OV1A 3OXGA 3D68A 5F8IA 4EWTA 3TJAA 4QBUA 2FLNA 1KLNA 3AB4B 3LUYA 6AT1B 4F2RA 3JYTA 1TL1B 2OAUA 2EEYA 3MM5B 4OIXA 1OYDA 4WFNQ 3T1YJ 2D1CA 2KFYA 2B5JA 4PKDB 4S0MA 3TWZA 1PKUA 3M32B 1CJVB 1KFSA 4TNOA 5HQ8A 5ETOA 2LEPA 2VUGA 4C8NA 3TUIC 1XR5A 2P9EA 1OSCA 3B4DA 1X4AA 3GYGA 3W66A 1RCOB 5GMDA 4OI4A 2X7IA 2JJ4D 1WHWA 2WONB 1ZBTA 1LQ9A 2I9SA 5L1LA 1LFPA 5FD1A 3HM9A 4TQRA 1R8CA 5KFLA 4NLQA 2JFKA 2R8KA 4OX9F 5KFSA 2B3TB 1HBOA 2JSXA 1U4BA 1IBLF 3D4JA 4JI0J 4HTIA 2R7OA 3SIPB 5KFTA 3KHGA 2E1PA 2ZHAA 3ELHA 5GADI 4CM2A 4LR7A 1GX5A 5ITHA 4PUOA 4ZVHA 1S6QB 4JI0F 1REVA 2JEIA 3LH2S 1XTZA 3HT3A 2QV6A 2OH2A 4NLRA 2EFOA 3KMQA 3BQ0A 1RT6B 2PE8A 2ZBPA 4KR0B 2BANB 4Y2MA 3K58A 1YX2A 1SCJB 2CVEA 2ZHBA 3MAAB 1HWUA 2HAIA 3JSRA 4OI1A 1YJTA 2RS8A 5GADU 3BSAA 3US5A 3H5YA 2C3PA 5THWA 3CDEA 1LK5A 5KG1A 4JOUA 1BQMA 1S1TB 1H98A 1LK7A 1RBAA 3HVAA 1HBNB 1RHUB 2AJFE 4MT1A 2DGUA 2CPDA 3MR7A 2R9LA 3QO9B 1EARA 3PRBA 5KFKA 5L1KA 3M8RA 2F9JA 5A6PA 2DHAA 3AOBA 3W60A 4ZPTR 3M2RB 2IY5B 5F3ZA 2L48A 3T1HJ 5KFIA 1LW0A 2UV8G 4FKYA 1ZH5A 4KGZB 1UJ5A 3UD4P 2RQMA 2EBEA 3RB4A 5IWAJ 3HDSA 1EX8A 3M1VA 4CT9A 1FO1A 1IJFB 1ZAVA 1RAFB 2VG7B 4ZJOA 1F2HA 4F4AA 2CJBA 2V4JB 3O3LA 3K7RA 5ETRA 2M8HA 4WYWA 4LJMA 3MM9B 3MPYA 3AJ1A 4B3MJ 1Q53A 1GTEA 2CXEA 2MKKA 2W01A 2BZ2A 1JLAB 1S48A 1ICEB 2RVJA 2JHEA 2LXIA 4RW8B 1X7VA 3HSZA 1X5TA 4JI6J 1JLBB 1SL2A 2HAFA 2C2EA 2HBQB 4DWIA 4EYHB 3R5GA 1SH3A 2EG1A 4YR2A 4JV0A 1XEZA 3IWLA 2APOA 5KFOA 2OSRA 3DOKA 1WHVA 1WF2A 1HI1A 2IVFB 4C7QA 3M8QB 3LP0B 4WE1B 1TVRA 1OYEA 1ZPWX 5B0DA 1N36F 1JNZB 3J7AN 4HR2A 2EW9A 1HR0J 3OTOF 5LMUJ 4NLWA 3KK2B 2BM0A 2W2PP 2WSFC 2CYYA 5L46A 2AGOA 3P6YC 5KFRA 2CQGA 4DV2F 4GVBB 1NK0A 5IC4B 3MFHA 2JLGA 5LSOA 4ECXA 3LANA 3HX9A 2ZM6J 1VRUA 3OVAA 2AEJA 4K59A 3BDEA 5KT7A 2ZZTA 4EMDA 2YX1A 5I3QA 4FDFA 3MEDA 1OMSA 2FJXA 4TY8B 2XY6A 1FVQA 2B4OA 2CKWA 3HKZD 1RADB 2Z2MA 2CZ4A 5IOLA 4NLGA 3NS6A 1KBRA 4USIA 1NK5A 3TX0A 4EYIB 1RJJA 2CQ3A 2W24A 1CLFA 2RQ4A 1FTCA 1N33F 1EKRA 1FX4A 2EFPA 4RNMA 3SDEB 1IKVA 4C97A 3DN9A 3BSCA 2ZWOA 4DV1F 2F4FA 3CMAS 2E9RX 4PQUB 5B0CA 1R43A 1IKWB 2IBKA 2J0SD 2YPZA 3K5PA 3KLIB 1TTHB 2MKSA 4TVAB 3CTRA 3C6TA 4B9TA 3TAMB 1NZ8A 1YRXA 5KFQA 1FWKA 3SCKE 1M0SA 2ZH1A 2HHHJ 2ADBA 2VFSA 4MJKA 4QIGA 4R25A 4ZDNA 3FEXB 3LWMA 2WTFA 1YZ7A 3IR5B 1NJWA 2V8PA 1FXRA 5DM7Q 4K4WA 5IV3A 4E2FB 4ZP6A 2KDOA 3RBXA 2ZBQA 1QVFR 1FJ7A 3TANA 3T6BA 2DEIA 2VV5A 3FKBA 3EGWB 1VRQC 3KUGA 4P2SA 3CCES 2PDAA 4X2BA 3RB0A 3M30A 3DM2A 1FDDA 2E5LF 1JLGB 4ZCLA 1FTRA 4FYDA 2ERRA 1KWMA 4IH6A 2RIJA 3GWCA 2XY5A 5D0HA 4N41A 1S6PB 4L72B 4WCEQ 1MLAA 2KRBA 4WIIA 3G86A 2WW8A 1M5PC 1QUPA 4FBUA 1RBOB 3A4TA 3DLGA 2Z8QA 5DG9A 4ICLB 4QR1A 1TUVA 2X3DA 2WSEC 1WDTA 4MFBA 3W8GA 1TKZA 3R8YA 1T05B 5HROB 3H4DA 5A2QU 2UV8A 3L3CA 2C2DA 1X9MA 1F5AA 4B3RJ 3PJ9A 2O5DA 3KG4A 2AZ1A 2VPZB 3PV8A 1KQGB 2AHOB 3TVKA 3HSGA 1UVIA 1RU1A 1B64A 2W9BB 4B3RF 3PDNA 2LLZA 1TL7A 3ILIA 4U7UD 1UCNA 2FZKB 2FVSA 4ZN1A 3PYFA 5HBMB 4PEOA 3OXLA 3J7ZT 4MKBA 2ZBRA 3Q8RB 1ZS6A 2JFDA 4Y0FA 1DJ0A 3QJLA 2V8GA 2PT0A 2D3ZA 4ZP8A 3AD9C 1SJ3P 3JQJA 3GZ7A 1U49A 1R7IA 4G3IA 2D41A 4F4WA 2RDIA 3NGRA 1FJEB 2C2KB 1G6BA 2E66A 4HT5A 4TLRA 4KKOB 2YKMB 4RW4B 2F7VA 4KSEB 4O3OA 5ETNA 3NKYA 1YK9A 2VDIA 3SQGA 4DPXA 2BACA 4YR3A 3K8WA 1N34F 1WOSA 2QMWA 4UOHA 5KG3A 5A6WA 1RT2A 3BR8A 1RTHB 1LWEA 5M2UA 3OL8A 1OY6A 3D5MA 1WORA 2V34A 4KE5A 2C3YA 1S59A 2DY1A 4LFCJ 4ZPDA 1FD8A 5J2PA 5ETQA 2VQEJ 3SCJE 1HLWA 3ISND 1KD1T 4MK8A 4Y28C 3EXCX 4J9PA 1U2FA 2HGLA 3R7NB 2L9DA 2VG5B 4YP3A 3VGVA 2WVFA 2MKJA 2V94A 1IKXB 3MFIA 1TKXB 2XMMA 2GW8A 4ZHRA 5D4LA 1U24A 4L3KA 1VQ9S 3QSYB 4OZ0A 1CJTA 2Z2LA 4A8SA 3PYEA 3QGIA 1BY9A 9RUBA 3POTB 3MMCB 5JMNA 2WB4A 4JBCA 3P3DA 2G9OA 4K0KJ 4R0JA 4FXVA 3VAGA 1T9VA 1TL3A 3RW6A 2DNGA 1VQ4S 2LKZA 3B54A 5LOQA 3MEEA 2HPUA 3TEGA 2C2MB 4DUYJ 4KC5A 2A18A 1VQ6S 3A1YG 2D3OR 4BHQA 1RWPB 3PHEA 2CADA 2QC3A 1DTTA 2OPQB 4RNFA 1YVFA 2HNZB 1DQAA 5HLFA 4DX6A 2JVRA 3HPOA 4BS2A 4H4OB 2IJFA 2IM0A 4WJBA 1Y5NB 2BE9B 2QN6B 3AAWB 4UZBA 1TV6A 2FTRA 4GO7X 2IPOB 1CG2A 2COLA 1FX2A 3NNAA 1WG5A 2B6AA 4DL4A 3E51A 1BD6A 3R27A 4IDKA 4M5MA 4GRSA 1MROB 1U1LA 2N7YA 1VLOA 2VIHA 5H9EK 4DL0C 4ECUA 1S6OA 3DDNA 4L3NA 1LW2A 2XSJB 1RUSA 4M5JA 4OLOA 2HFUA 3ISZA 3RR8A 5IV4A 3P4UB 3R5CA 2NQPA 4P52A 3PKMA 3DLEB 2J5AA 4ZVUB 2MY8A 5MAOA 1RGVA 4QYZJ 4XK8C 4FPIA 1EP4B 2NZCA 2CA9A 2M5YA 4X66F 1FF2A 2QLJB 4DV0F 1EHWA 2YNGA 1WJ9A 4LIRA 2C2RA 3CNQP 3EICA 4AL5A 1F1BB 2YQ3A 5D4NA 3HHEA 3PXGa 1BWVA 1MSWD 1QSSA 2HZAA 2QA4G 4ETXA 2LQ5A 2B56A 1ELOA 1XERA 3VGSA 4DL6A 5JUMA 2H4YB 1OPIA 2WVEA 5G0RB 1S0VA 4U96A 4NA1A 2BEFA 2AZ3A 4F26A 2CG8A 3GIIA 2GMJA 3OR1B 3D66A 1U8SA 5K14B 2QFIA 3TYTA 3TI0A 1DQ8A 3ULHA 4AE5A 2V2QA 3RB6A 4C11A 2FPHX 3Q86A 3ZC4A 4NXNF 4QPXA 2VU5A 3IS9B 4O4GA 4B3SF 1Q5VA 1FFGB 1FE0A 4WZMA 5HO4A 2ILZA 2PD1A 1Z2ZA 5K8OA 3KHLA 4YMEA 2QIFA 4WP8A 1HNWJ 5CYMA 2HWTA 1Q7YT 4HI2A 4EZ6A 2FHJD 2ZBCA 4ANDA 1XMBA 3FSXA 3D9BA 4AQYF 1HNXF 1C2PA 2CJ9A 1QSLA 7FD1A 5FLXY 3I32A 2NLWA 5M2RA 2VBXA 1YKWA 1TUGB 3ZTOA 2MEWA 2LP4A 1FDBA 4PPZA 3N6MA 4LBHA 2VJVA 1XMOF 3DRSB 2VASA 3K2YA 3MEKA 5IM0B 5LMNF 1NM2A 1J5EJ 2UVUA 1N52B 3C16A 5DGAA 1ZAWA 4U95A 2B51A 4ECSA 3SMZA 2KM8C 3HJVA 3IG1A 1RAEB 4DR4F 2EG2A 2BYCA 2W9AA 8ATCB 4KHPF 3S6EA 3FGVA 2LDIA 1APSA 2EBGA 3BH7B 2V4RA 4C2MA 3CJKA 3IR7B 2OFHX 3I56S 1S49A 3S1TA 3NLCA 5CZXA 3CJ3A 1FHTA 2AX1A 3KK3A 2UXDF 2XYGB 2XNRA 4O3PA 1V3SA 2D3UA 3VCDA 4CO5A 2RKIB 2R7TA 1T3OA 4PRFA 2IRUA 4I6WA 5IZHA 4IG3B 2VKRA 4PYAA 1KHWA 2D9OA 2XS7A 2W25A 1VC6A 2VG6B 4IFVB 4DZDA 1Y9OA 3L9ZA 4KV8B 2HFVA 1JQGA 4JI3F 2ZH9A 3T5KA 3M8PA 1FT8A 4E0DA 3OR2A 1HQUA 4CYUA 1F5BA 1F60B 2GZOA 2G2YA 3CCQS 3CD0A 1VK3A 4QW8A 1XIQA 3UQSA 3GQCA 2ZWPA 4I56A 3MUMP 2BR0A 4ENOA 2GCFA 4IFYB 3WC0A 2IC3A 3CJ2A 4ZJLA 5C24B 4LF6F 3FQKA 1CBKA 4MKAA 4RW6B 3T1AA 1JKHB 5J1EA 3LPYA 1D8YA 4EBEA 4M1KA 3HT0A 3QRRA 1JJ4A 1X4BA 4NYOA 4JYAJ 1U1NA 4LF9F 1U25A 3Q23A 4WU3A 3QNWB 1E6VA 4DN0A 1N8RT 1I3OB 3EVMA 3PY8A 1GTHA 5HVFA 5KTQA 1VBYA 2M88A 1NPPA 5CD4H 4IKAA 1FRIA 1S9EA 2DR5A 2AGQA 5HI7A 2HW3A 2ZOFA 1N5YA 4DR5J 4CTAB 3FK4A 1ZA1B 3IGNA 4CQ1A 1WD6A 2YKAA 4OYBA 2FB0A 1WSVA 3AD8C 3AFGA 4HLBA 3AHPA 4ECWA 2W4DA 3NCPA 2RF2A 2E7WA 4P6QA 3A8JA 5KG2A 3MCOA 2R2TA 5GVQA 3C15B 3TW0A 5HP1A 2VFTA 3LPEA 1JJCB 3ZZRA 2ZOGA 3CO0P 1CPZA 3TA1A 3ITHB 4RUCA 2DR9A 2E1RA 1IKYA 3AODA 3SFUA 5EDWA 3BV8A 2FJBB 2UU9F 1GMWA 2YKNB 3Q8QB 1U45A 2HBYB 1S1WA 5EX0A 1RTJA 5K9FA 1VDHA 3HZGA 3VQTA 3D28A 3QZ8A 2POKA 3QLHB 3KHHA 4NEYA 2KZZA 2ZD1A 3H8YA 4ILRA 2VODA 3CDWA 4Q0BB 3N01A 1NKCA 2G1DA 2ZH2A 1M5VC 2PFFB 4FN5A 2HK3A 2MTLA 1NDLA 2F9DA 2DR6A 4ED6A 4DL3A 5L1IA 2DD8S 2WOMB 4YY3J 2RB7A 3I0SB 3EYZA 4R5PB 4QWAA 1J5OA 2HFNA 1OY8A 4CIOA 4EO8A 3L7PA 2OPSA 3D0HE 1M1GA 1U02A 3FEYB 3P8BB 1S0NA 3L4BC 3SCIE 3M6WA 4Y34A 2WSCC 2VFRA 5LXRA 1PYOB 3PIOQ 2BJ1A 1LFWA 2I6WA 1DHMA 5IQQA 5GAGI 1HHTP 5J2QB 3TJ9A 3PYDA 2QL5B 1HBMB 1EZZB 2YQ1A 1U47A 4DSFA 3U7JA 3J81U 3KLEA 3MM8A 1U2CA 2AT1B 1V5IB 3IBFB 4RUHA 4JV5J 3OFFA 2DISA 3OTEA 1NHVA 1V5VA 1X5PA 4PWDA 4CRJA 4WK3A 3ZZOA 3PRDA 2VKZG 4RW7B 2HHUA 3G6ES 1R89A 1REVB 4FF3A 1HFEL 1BGXT 1Z2LA 1AUDA 4PXEA 3CDUA 3MD3A 1TFYA 2GAGC 4FF4A 1R0CB 3HVWA 4IUFA 3DGVA 3MURP 1DTQB 3LO3A 5A0YA 2WB1D 5C25A 2BJ7A 2J9DE 5JXSA 3BO3A 3G8QA 1N56A 3MECA 1SJRA 4CLZA 2Z2YB 3NWRA 2GVZB 4DR7F 3JAMU 2I5JA 4OJ3A 3JTOA 1GFWB 2HQDA 3UI3A 1F5CA 1IM6A 1BQNB 3DHWC 1VRTB 3THPA 1BQMB 2QFJA 2K7JA 1RHQB 4RU9A 3AH6A 1HYSA 3AQPA 3H2VE 4C3MA 4CCHA 4ED0A 3K59A 4NA2A 1GH8A 1RWMB 5ETMA 3PR4A 2QRRA 3HJFA 1DZ5A 2XGQA 2V8DA 5AXMA 5C42B 2E29A 3DDIA 1XN9A 2CPXA 5GAHU 4OHXA 5AJ3J 4NLUA 1TZ0A 3I55S 2PC6A 2FJEB 1LW0B 3HLUA 4M5IA 4RL1A 3QAUA 1IR0A 1WI8A 3DYAB 3QJJA 1DFDA 2LU1A 2QLBB 1X4CA 4RJVA 2DNQA 4WIQA 2C3MA 2FY8A 3QGPA 1GNKA 2FLPA 1R8PA 2DHXA 4C98A 5L9NA 3SYZA 3DLHA 4P7VA 5D6GA 1NEEA 3M8YA 3BN4A 1RXOB 4H54A 4FF1A 3KJNB 1NJXA 4ZVQB 2R8JA 2YKOA 2IAJB 1CS4B 5BYQA 4DQIA 4C48A 4PG6A 3OVSA 1VMBA 4RR5A 1O5JA 4K2JA 3BGUA 5I3UB 2YVSA 1EETB 3D0GE 2SXLA 3QBCA 2UP1A 2Q3PA 2J7WA 2QGFB 1T9UA 1P1TA 3JS9A 1SV5B 4PWUA 4I0WA 1VQOS 3GJRB 1KLMB 3JSMB 2GIFA 3M8WA 2DXFA 2CQHA 1UJ6A 2MKIA 4F2SA 4HHJA 4YB6A 2QA2A 2FUG9 1FKOA 2YWKA 3K5MA 3TX8A 1T9WA 1FNMA 4H4MA 1RU2A 1HKAA 2QLWA 2QTWA 4Y3CA 4MKVA 1F3FA 3NGDA 4ECZA 3SZ2A 3J7YU 1TAUA 3DU6A 5LM7E 2DNOA 3CC2S 2HFSA 2NXCA 4FS1A 3TNVA 2HRYA 3OSPA 3G71S 2MLYA 3R7SB 2DCLA 1TR0A 3HZEA 1PGZA 2EC2A 3D7SB 4F50A 2KFNA 4UQGA 1T0TV 4M5HA 4CO4A 3CULA 4YHHF 3W2WA 2XM3A 1QTMA 4LVOP 3DOLB 2W2QP 3J7A1 1RDRA 2XMVA 4YN3B 2HURA 3UW1A 2B9XA 4LSNA 3MEDB 3TVZA 2ZE2B 1TMMA 1QTNB 4Q2MA 2M2BA 4XAKA 3GG0A 1VC5A 1SUQA 4OX7A 5F8JA 3JQKA 3EGZA 4J9QA 1NK4A 1NB2A 5HQMA 3CF5Q 2BOAA 3GFXA 1SQGA 1UVNA 3FJ2A 2XHCA 1F9FA 3W2VB 3NAIA 2MXYA 3UDLA 3UVJB 2B0GA 2FZCB 2RRBA 2IDLA 5CYQA 3JTNA 3FFIB 3H90A 2KT5A 1FJGJ 4PG4A 2ALZA 2JNJA 2D69A 1ROFA 4LFAJ 3GYXB 1FK9A 2DHGA 2LQ8A 2FVRA 4NYZA 3ETMA 4PQAA 1PO6A 4QU7A 3CDBA 5H1SV 4LR9A 1JIHA 4UOFA 3AJDA 5KT6A 4DS4A 3T9ZA 1N54B 1Y5IB 3LF0A 5DZ7A 2UUTA 1NK9A 2Y0SD 3T3FA 4KGMA 4NXMJ 3PEJA 5E5NA 1WC6A 3N6LA 3QRQA 1CULA 5H9FJ 3I6PA 4LF4F 4WFYA 1VFJA 3GIRA 3EPIA 4ZVFA 4NCGA 3G87A 4NXMF 3V6DA 1NUEA 4ZPCA 3KLGB 2YX4A 1D3WA 1GXLA 3I96A 4J9OA 1X4HA 3KJVB 3DGPB 2CPEA 4J9KA 2IVMA 2Q66A 3BKFA 3KDOA 2XG8A 3ZTRA 2DBBA 3F73A 5DS7A 2XULA 2UVWA 3FC9A 3LQVA 1IXKA 3TZZA 2CJAA 4TY9A 1KHVA 1SI9A 3W65A 3FBCA 3BGOP 4ED8A 1VCTA 3MAHA 3O6QA 3AA8A 1KTVA 2KJVA 3CJ4A 4DSJA 1XNRJ 1A9NB 4EZ9A 2OELA 4V19J 5JJBA 4HEA9 1NBEB 1XNRF 1RWOB 2UXBF 1T8EA 3G2XA 2MJUA 4L74A 2EK1A 5EWFA 1RT5A 3RYLA 1O6XA 3KJQB 4Y6IA 5DM6Q 4K2XA 1ZM4A 4IYQA 4UUWA 4DV7F 2RRNA 3OTCA 1MU2A 2OEJA 2VOPA 3KFWX 2W9CB 1E6YB 4DV4F 1H2VZ 3OTBA 2VICA 2E1MC 1UTAA 4RNOA 2NUHA 3T41A 2DIVA 3AT1B 4QIWD 3H5SA 1FJCA 3KG1A 2R7RA 3WIUA 2ZH5A 3GSDA 3IMQJ 3CT9A 5LJ3Y 3V81A 3I0RA 3BREA 2F40A 5KFMA 4ID5B 1YIJS 3H42A 1CQMA 4QIEA 2BRLA 4KT0C 1B7FA 1GXUA 1X4EA 2ZUAA 3VAIA 4DG1A 3BYRA 2V2KA 1JLFA 1S10A 2HZVA 1M90T 5CCMA 2CZVC 4AXJA 3CD5A 2VBYA 3F56A 4ETZA 5LT5A 5T7LA 3HHKA 1IVZA 4RUBA 4WXWA 4JI8J 5D0EA 4UY8T 2KU7A 1L3TA 1L3SA 2RT3A 3C6UA 1KVJA 2J6TA 4JI8F 2GGPA 1Y5LB 3NRBA 3HHLD 3UR0A 1WWHA 4MTPA 1T95A 1UWBB 2YNIB 1UA1A 2H48B 2HHVA 4Y65A 3HHDA 1N5SA 2JVOA 1RZMA 3NGKA 1UEUA 1RLCL 1N6QB 1HNVA 1S99A 2VPYB 1S1XA 3TZXA 4DFMA 2ZH7A 3SQOP 2OJ3A 3ENVA 2ASYA 2KTQA 2M52A 4A8MP 4DS5A 2ZOMA 2MKCA 1Q1KA 3BQ1A 2UUCJ 1GXTA 4AL6A 4KFBA 2ZC3A 4RW9B 1LWCA 3VAFA 5D8HB 2X3GA 4URGA 4IRCA 5F0UA 3V4IA 2C28A 1UW4A 4LF7J 4OI0A 2FD2A 3PW0A 2XYHB 2V67A 1JLQB 4DUZJ 5A2QY 3QATA 2CQBA 3GIJA 2PEBA 3KOAA 2KXHA 4PPDA 2LEAA 2BDPA 5ETTA 4FZVA 1K73T 3DLKA 4OMFG 1SC1B 3E01B 1T9YA 1FA0A 1IR2A 3GLJA 4G1QA 3LP2B 2MHNA 2E44A 3V2UC 4PG5A 5CYJA 5E3AA 2VQFF 2Y8WA 4IOCQ 3KNAA 2GNKA 3OUYB 2A2DA 4DFKA 4UW2A 2ACMA 3D3BJ 2C2OB 2R42A 2AX0A 5KFVA 4O0IA 1XMQJ 4U8VA 5A8WB 4P73A 1S4FA 4USWA 3BPSP 2BE2B 4BWMA 1AZSB 1U1PA 4KPYA 5BR8F 1U1MA 5FDLB 5HVHA 3UR3C 4ECYA 4GO5X 2YNHA 3R5AA 1MWYA 1KRPA 3PACA 5KG6A 4K7QA 3GV5B 4ED3A 5IS2A 1RSCA 1RWUA 4O44A 2HHSA 5I42A 3KLFA 5KFAA 3R5BA 1FRXA 2Q43A 3CEDA 3TZWA 1XWLA 1FRMA 4CLSA 4NASA 4U67Q 3BYPA 2XZTB 1VLYA 2ALYB 1K0TA 5HJXA 1U1QA 2KT2A 3D54A 2JH3A 4B3TF 1HNZF 4PCQA 2W7PA 3CO9A 1M5HA 3IAM9 3BGRA 3LOUA 4WYLA 4B02A 1D09B 3ET6B 1SH2A 1HNIA 1P9QC 4M5NA 4DI6A 2OHDA 5KT3A 4DR3J 2RH3A 1BQXA 2HRTA 2CRLA 3OLBA 3ISNC 5AXKA 2DT9A 1GT8A 4I2PB 2LYVA 3LW5C 4ZPVR 2LECA 5CD4A 3CCTA 1T7PA 2HKEA 1LWFB 4USUA 2MB0B 3OHAA 1WC5A 5HVGA 2UUAF 3A3OB 4DV3J 4FNIA 5L39A 4DX7A 1Y3JA 1YJNS 3PFOA 1NKBA 4Z7CA 4CO0A 3AA9A 1CC8A 4C8LA 4TKTA 4F3QA 2MZJA 1FRKA 1IQTA 1NAQA 3ZNUA 5GMEA 1FNXH 5CYMB 4JI1F 2N7CA 2I0XA 2HK2A 3PX4A 2XO6A 2ROPA 3CIMA 5KG7A 1X9SA 4USKA 3C14A 4CP5A 4KH0B 3AXKA 3GIMA 2Q6CA 2XWYA 1U0HA 4G1IA 1NJZA 2HYIB 3ENQA 4A8KA 1VK8A 2MGZB 4P2XA 5D0GA 4AFFA 2A6MA 1Y4ZB 2DYAA 4KTQA 3IFEA 5HL7Q 4LR8A 4B9MA 2FHJA 2WVBA 1MN7A 4G1PA 2AP6A 2AKWB 4OJ1A 3R5DA 3PO5A 3VWSA 3NMAA 4F8RA 2H65B 4KO0B 4JI2F 1KKHA 1X5SA 2XGPA 2HMIB 4Y2KA 3MPWA 2ZH4A 4MIBA 4WF9Q 3KK3B 3PNIA 1YG0A 1OWXA 3SSSA 1NXIA 3OTDA 4K4VA 4ZP7A 5IC6B 1TL1A 3MM5A 3ZZPA 3D1OA 1OS5A 4NLTA 1EQ0A 1SKRA 4GKKJ 1CEZA 3OSNA 4D3HA 1VQLS 2MQMA 3S01A 1EIYB 3PCOB 2KG1A 4M63A 4M5LA 1GMUA 3RBDA 5KG5A 3M32A 1CJVA 2LQBA 1DQ9A 1RAHB 5J1PA 1HARA 1F3VA 4CLYA 5ETSA 4GKJF 2IA6A 2WONA 4LRDA 5L38A 4A8XA 2RRAA 4ED4A 3N5BA 2IIHA 2F4VJ 4DSIA 3R1HA 1S6UA 3G96A 2V9WA 4NLVA 1PC4A 1M5SA 2MQ8A 5B7WA 1LXJA 2RSQA 1M5KC 2AJQA 3W63A 4OZLA 4MKYA 3CMES 1MN9A 5B0FA 1V3ZA 2R7SA 5A8KB 1TMJA 1S6QA 3DLLQ 4UZCA 4C8MA 2JC0A 1B70B 4WFZA 5K8PA 3DDKA 2EI5A 2NYHA 5M2PA 2RDJA 1ZA2B 2LVWA 1UL3A 4L73A 1RT6A 2XCPA 1HIYA 2BANA 3MAAA 4XDDA 2FY1A 4JB8B 4A8OA 3N79A 1WNEA 1N5YB 4ELVA 3MM7B 1I51B 1RWNB 3JSBA 3L7UA 5JVGQ 7FDRA 1IN0A 3OQ2A 2Q1LA 4G6VB 1HWKA 1VQSA 5E41A 2DY9A 3TUZC 1S1TA 4EUVA 1OO0B 3HP6A 1HBNA 4MMOA 2A3JA 3PX0A 1YJRA 2J6UA 2N4DA 3NBPB 2Y3YA 2N4CA 3QO9A 1QE1B 2MQNA 1R0AB 2HS3A 2ROEA 2HHTA 4WK1A 2LXFA 1IBMJ 2EVZA 3VAKA 2HIQA 4X62F 3QIPB 4O4RA 3CSKA 4OJHA 1NKEA 2FDNA 4ANEA 2G0IA 4MYTA 4P71A 2ZH3A 1N48A 3VALA 1RAGB 2CQDA 5F8HA 1NDPA 2VG7A 2JEJA 2NS1B 4J91A 4PG7A 4LFBJ 4LVNP 4KAIA 1QY7A 3FEZA 4OYOA 3ZTPA 2X1FA 3MM9A 1RT4B 1PAUB 4ER8A 4DPTA 3JTPA 4X64F 2F8MA 3MXHP 4O3NA 3EJMA 1JLAA 4LRFA 1HMVB 1W25A 5KOXA 3F0NA 2F8EX 1JLBA 3GJQB 5F8MA 1HWJA 1MMDA 2BV3A 3PEHA 3R2CJ 5LL6d 2FJAB 3G8TA 1TELA 3QWPA 2E9TA 4HACB 3U1LA 4DLGA 3W3SA 4C8OA 1R6YA 3M8QA 1H74A 2XYPB 5HSPA 3T1YF 2BJEA 3PW4A 3GR0A 4CLWA 2QT7A 4USTA 2DGVA 4TXSA 1HW8A 1HI0P 3KLEB 2LMIA 2ZKUA 2FHMA 3KK2A 2JOQA 2F3JA 1WELA 5G4DA 1W2BR 1Q82T 3VZHA 4IG0B 4TQSA 1RT7B 1L3UA 1LXNA 4HH1A 2OPPB 1NH7A 4GVBA 4O3RA 2V2ZA 2N3LA 4H4KA 2YNFB 4E8UA 5ETKA 2CDQA 3IM8A 4NWBA 3ILLA 2ACYA 1UJ4A 3FZBA 4I68A 3MOJB 2BBEA 5KFPA 4P75A 3H4BA 4ZLLA 4F0MA 3RB3A 1K44A 4TY8A 5F3TA 3CPWR 1WTBA 2HFZA 3VVTA 2J0XA 2AJ4A 3CD6S 3VR1A 4HI1A 1LKZA 2IFXA 2ASLA 2G4BA 3V6HA 4QYRA 5KFEA 1N32J 3B82A 2QSFA 1G7CB 4KB7A 2H5JB 4OZ5A 1HYSB 3MGJA 3GCXP 2NREA 1VOMA 1RT3B 2PIIA 4ILLA 3SDEA 1NK6A 2P9GA 4R0EA 3GU0A 2OMLA 1RYSA 2V0NA 2DXDA 3IO1A 2DKOB 4TLQA 4WTOB 4PQUA 3DOMB 3ZXWA 1U8WA 3P45B 1NRKA 3M4XA 1IKWA 4I1TA 2PGCA 3OPKA 1H2UX 4P9SA 4DR2J 1S1VB 4X4QA 4OZJA 2EC0A 4CLTA 2JLEA 3TAMA 2CNLB 2AD9A 1OIAA 3ADAC 2XO7A 3IWNC 3G8SA 1HHSA 4F36A 4XDCA 2J0WA 4QPTA 4DEZA 4CZCA 3LGMA 5DQIA 1SQEA 2K1RB 1WKKA 5C2CA 3RTVA 2HGNA 5J2MB 3EMTA 3T1HF 4H4KC 2CVIA 2KVIA 4DQSA 2CPJA 3IP0A 4YDDB 1WG1A 1JXVA 1KVKA 3J81Y 1WACA 5JVHQ 3HF5A 3T5JA 1I94J 1GAOA 5IWAF 1JLGA 4P74A 4LF5J 2BABA 1RP5A 1KVIA 4NZ6A 5IT9U 4KGXB 3R3TA 1SKSA 4DJBA 1X4FA 3RW7A 4ED5A 4OZ1A 1GEHA 1T3NA 4DX8H 1FESA 3MCNA 3EXYA 3VZIA 1S6PA 4K5SA 3DMJB 1BLUA 2YBVA 1NSAA 4LREA 3MR3A 2VOOA 4KJIA 4B3MF 2HNYB 2AF6A 2KRRA 4OV6A 2KZMA 2HNDB 1X9WA 3GONA 1TUWA 4ICLA 2BUNA 4JI6F 2IRXA 1H6KX 1UAWA 1TKDA 2Z58B 3W64A 2HZCA 1FEHA 3JAMY 1KEKA 4NYPA 4PABA 1T05A 1IM4A 1XNQJ 4EBDA 1KOOA 4K4SA 2K3IA 2HVHA 4U8YA 2HVZA 4ED2A 1D9DA 3PKYA 4C6AA 3D67A 3O1LA 4IRDA 4KRWA 1HR0F 2B8QA 5LMUF 2FGCA 2W9BA 4LSNB 4CT8A 3FBFA 2JLFA 4IR9A 3G4SS 3I5AA 1WF1A 4AXIA 4X4OA 2QE5A 2XLJA 1NK7A 1YGYA 2HGMA 1XK8A 2GIQA 3W9IA 1UWAA 1NZAA 1MMLA 2UVVA 2RU9A 3H98A 3GFHA 2ZM6F 1SXLA 4L76A 1X4DA 1BXNA 3BF4A 1RHKB 1BHNA 2JDJA 1UEVA 1W2IA 2IMOA 4ECVA 3PYGA 1KP6A 2VA3A 4KKOA 2YKMA 4RW4A 4ZIVA 2DNLA 1NLKL 2VC1A 1UVMA 1PBAA 3VHQA 4DFPA 2Q79A 1JX4A 2FVPA 5K5MA 1Q5YA 3DLJA 1RTHA 2QL7B 2ASJA 4RBTA 2HQ3A 1KR4A 4F0KA 5GAEU 3AB2B 4DL7A 3UNYA 1AFIA 3DRPB 3ENWA 4C0BA 4NRTA 1SKUB 2DR8A 2OI2A 3CDAA 1RWVB 3MUVP 2PEHA 1CULB 1S72S 4LRAA 3MUTP 3HK2A 2V8HA 1PYTA 2E5JA 3A12A 4PXCA 2G2OA 2FJVA 3G6XA 1HWIA 3WIVA 5KOWA 2X1AA 2VG5A 4QWBA 2HHHF 4EI2A 1IKXA 1TKXA 5FJ4A 4X4UA 2WZ1A 2Y8YA 3MPVA 1SIWB 3P5BP 1Q4RA 5D15A 1ITPA 2DNZA 4QIVA 4JI7J 1WOOA 4LSLB 4FYXB 1FXDA 3C2PA 1N5QA 3POTA 3TVYA 3MMCA 1Q8IA 4N5SA 4WP3A 2GQCA 3Q83A 3HD1A 2B8PA 4U6PA 4ZVRB 4YDXA 1CJKB 2DGQA 1NB7A 4CH7A 1YI2S 1S0OA 4HL9A 1HQEB 1B3TA 3W5YA 2OPQA 4DV5J 2HNZA 1YZ6A 2DGSA 5DLGA 4H4OA 3FSYA 2AQ4A 4PXBA 4ZCKA 2OFGX 1RTIB 2KO1A 1T03A 4A4JA 3EGNA 4TYBA 5SUHA 3ZZYA 2HRUA 2QLFB 4OHYA 1EKSA 1X0PA 1MROA 5EWEA 2W8KA 3D1QA 2H4WB 1KONA 3HVTA 1Q95G 3DRYA 4ZLNA 2XSJA 2AYMA 3G6VA 2KFZA 3GV8B 3TR5A 1QDUB 3CIZA 4I4BA 4DQQA 2YWEA 3MR5A 4LF8J 2J9DA 2RILA 3MCSA 3EZOA 3DLEA 3NY0A 1YBUA 3FZ2A 4KHMA 2JWNA 1UKUA 2MQLA 2XEXA 1EP4A 3UCZP 2Y1LB 1S79A 4DZ6A 1MNEA 1NCLA 2O3DA 3BGLA 1MG7A 4NLDA 1RT1B 2PSZA 1J2VA 3AD7C 2CPYA 1RTDA 2XCAA 1AYEA 3EX7B 2L08A 3KK1B 2XI3A 1AW0A 2YY3A 5AE1A 3VV2B 2JL9A 1IQZA 5B0GA 1V3RA 3MEGB 1DY3A 1C1BB 3IRXB 2F63A 4LF2A 5SZTA 3M8SA 4DHVA 2ZVSA 3CCUS 2NPFA 4MK9A 2H5IB 4DR1J 4NMXA 1ZETA 2OPRB 1SL0A 3OFEA 3QT5A 2DRDA 5G0RA 1D9FA 3B6BA 2MHEA 2VFUA 2P9CA 5E3RA 3UD5A 2ASDA 1ZYQA 3DC2A 2C2ZB 3OR1A 2CPFA 5DG8A 4ES1A 2B7CB 5K14A 1HNVB 1RABB 2BQ3A 3BZQA 3QPIA 4M5DB 3RRKA 4AT1B 1VQ8S 4J37A 5C7PA 3IS9A 1B0VA 2AU0A 2A10A 1Q16B 5A76A 5CA5A 3L7OA 2GA7A 3MMBA 4BCAA 4UF4A 3HHLA 3CCWA 3R5JB 2XMWA 4LFCF 4QU6A 4OYMA 2CJXB 3GP9A 5D4OA 2VQEF 3M6XA 3CCJS 2CDRB 3TUJC 1CC7A 2XNQA 2HLTA 1C4CA 1R8HA 2B4VA 2WRMA 1N0UA 3OJSA 1ZZFA 2OKQA 5J2NB 4HHHA 5KG4A 1L3KA 1JXLA 4HKQA 3DRSA 2R7VA 2OEMA 5IM0A 2YWWA 5IFMA 2VHGA 4HDGA 2IBOA 1KQSR 3GIKA 1RBLA 5HMZA 2VBZA 3UNGC 3MAQA 3PR5B 2EFVA 1HPZB 5DO2A 3KKFA 5D3GB 2M3DA 3CCVS 4K0KF 3NEKA 1I6JA 1JLEB 2FLOA 1YRTA 2IVYA 3LALA 1OQ3A 4DUYF 4B3OB 1RQ0A 2M0GB 1YDLA 4X4PA 4F67A 2BW2A 3PRVA 1XC9A 2GQQA 2AYBA 2RKIA 4P2FA 2DGOA 1C4AA 3KUHA 1SJFA 4IG3A 1SJ4P 4ED7A 3M2VB 2ZZMA 3T19A 2VG6A 4KGVB 2IMWP 4KV8A 2H5EA 3CCMS 4DXLA 1IWGA 4HH0A 2L9WA 3H2UB 3N0VA 3R2DJ 1C0UB 2IRYA 2N3OA 2MKHA 2CQPA 3HHLC 1TKTB 2RHQB 5DRKA 3NAHA 2QZ8A 3ENAA 2CIMA 4R8UB 5D0RA 3MM6B 3MMJA 1Y7PA 4RNNA 2V63A 4RKUC 5KFGA 3RBZA 1A0OB 4AL7A 2ZH8A 3MZIA 4F4YA 2XS2A 3HULA 4IFYA 2XMAA 2F8HA 4NL5A 3GTYX 5C24A 2V68A 2QA1A 4RW6A 3CB4A 1JKHA 3S8SA 2UUBJ 1A7GE 3CC7S 3M9MB 3OW2R 1S97A 4JI5J 1WC0A 4RWWA 1AROP 1VYAA 4NI2B 4F25A 2CWKA 2UZAA 1L3VA 4NMLA 4CO3A 2OD4A 2I8EA 2JEGA 5AE2A 1QSYA 2UXCJ 4YOEA 2CQIA 1Z1ZA 1F0XA 3MMAB 4C0OC 1CJUB 1ZM3A 1VS3A 1RAIB 2DXEA 2CQ2A 1R31A 3TOQA 1FWLA 1FNOA 4NRUA 2M7SA 2W4PA 2C3UA 4ZLPA 1YITS 3SBMA 3UDEA 2R2SA 3BR9A 3CJ8A 1NSKL 3NCQA 4FXWA 3C15A 1H3DA 3ITHA 5F0WA 2VFVA 1HNWF 3M2UB 2J8AA 3ZTSA 2YKNA 2CJYB 3VTIA 3EUNA 4F4KA 3QGHA 3TAPA 2B4PA 1J27A 3WQPA 2D74B 1YSJA 3OXFA 2L41A 3DXSX 3QLHA 3OV7A 5EWGA 1MWQA 4DSKA 3EE3A 3TUPA 2D9PA 5L9XA 3P5TL 1P1LA 1RI7A 1S9GB 4USVA 1Q8KA 2H1YA 1J5EF 4Q0BA 4DPYA 4OI2A 5HAOA 1YWXA 3EVWA 1B99A 4EFAC 1HW9A 2YXLA 2R7UA 2WAQD 2EFNA 4N47A 5B0BA 3Q24A 3BPDA 4WKYA 1R3NA 2E7XA 3I82A 1RWKB 2WOMA 1HD0A 3K8VA 3AQOA 5KFUA 4ZK7M 3I0SA 1VI7A 4R5PA 1U26A 4P72A 4A8YA 2UUWA 2IM3A 1JLCB 5I3PA 2AV5A 2LDYA 3THTA 1C1CB 4OX9J 1DLOB 1S4EA 1WC3A 1PC5A 3SSRA 3RAQA 1FKPB 5KFJA 2DNMA 1HA1A 5J2QA 1IBLJ 1HBMA 2DR7A 5IXUA 1QM9A 2RUSA 5DJBA 4N8NA 4B08A 2JZ5A 1REGX 1O8BA 2HBZB 3AOCA 2J9CA 3FCVA 2HWHA 3KLHB 2FJWA 2CPIA 4DCJB 1SC3B 1PBUA 4MIWA 5KT4A 5A8RB 4RW7A 4LSZB 4I7FA 1D0EA 3PW7A 2NZ4A 4YUDA 1F9EB 2XMKA 3LAKA 2BQRA 4MH8A 4RO0A 4ANCA 4IOBA 1GQEA 3V5RA 3RG6A 1ZOTA 1DTQA 2PMHA 2X1GA 3SV3A 2UVRA 3M9NB 2DTJA 1WF0A 1JNRB 2GVZA 3PIPQ 2WCXA 3KWMA 1YLXA 2DGTA 3CJSA 4CLPA 2IYIA 3H25A 4GC7A 1BQNA 3QFHA 1VRTA 2GVDB 4JYAF 1UFKA 4ZPWR 2W2MP 3GILA 1GX6A 3B78A 3M9OB 2G2ZA 4IO1A 4KGKA 3N6NA 2ZZNA 4ZITA 1Q7LB 4QOTA 4DU8A 3NWGA 5C42A 1HBUB 1PIEA 4Q8EA 3NOGA 4A46A 1KQKA 2GAHC 4M8LA 4DR5F 1VC0A 3WHIA 2ATLA 2MZQA 3IM9A 3GMGA 1U0SA 3G6YA 4I6AA 2YWGA 4WWSA 5AXNA 3TP2A 1VQ5S 2DPJA 2NUUG 3DYAA 3NS5A 2QL9B 3GG1A 3MHYA 4IO9Q 3IR6B 1YJ7A 3MR2A 1WG4A 4I2QB 1G4CA 2FVQA 2J6SA 1NPKA 2GHWA 3SFGA 2VD3A 4UQTA 4OYWA 1G1XA 5DETA 3TAQA 4YQWA 4ZVEA 2XWXA 2DH7A 2Z4PA 4K4YA 3NNHA 3BKUA 1WSRA 3BBCA 5IT4A 1NO8A 4OZ2A 2GIRA 3I5BA 3BSNA 2KT3A 3C3LA 3ZZUA 3JYTB 3LP1A 2IAJA 2DO4A 1CS4A 2GQ2A 3HSJA 3MPUB 4YS2A 1NHUA 1X60A 3JXOA 1WEYA 1AA1B 1WC1A 5I3UA 1EETA 3LA0A 4J7CA 4N7TA 3MWBA 3FNNA 5CAAA 1K0VA 3NXZA 4ZVTB 1N36J 4V19X 3WBZA 2B5JB 2C3OA 3N28A 5KAKA 1SV5A 1UZHA 3M05A 3OTOJ 2P2CB 1KLMA 3JSMA 3O8WA 1RWWB 2AJ0A 3P96A 1FKAF 1DARA 2NYIA 4NEZA 3W9JA 4YY3F 4W98A 1Y00A 3RZAA 4DV2J 4PG8A 1SPBP 1TK8A 4QW9A 1HI8A 3DKDA 3HVRA 2RE1A 2V9KA 2QYGA 3ZFVA 1HBOB 1FEEA 3FSIA 3I4HX 4V1Ak 4ZMMA 1RAAB 2OEKA 2J76E 5B0EA 3NCRA 2ZJRQ 5E7OB 1BMQB 3DOLA 4KY3A 4W4MA 3NG8A 4DOZA 2XMJA 4FYWB 5KFNA 2OUGA 3VF0B 2HQGA 4PUOB 1MW7A 3M6UA 2R2UA 3Q22A 2ZE2A 3FQLA 4JV5F 1URRA 5F9NA 4ID8A 2Y0BB 2BKOA 1K1SA 1N33J 1VBKA 2HIYA 2CPHA 4ES2A 1HD1A 2XBPA 3HSDA 4DV1J 1N0VC 2R2RA 1T94A 4PAAA 3PFEA 1NSQA 3W2VA 2CNKB 4EU0A 2B9WA 5GAHI 1RE1B 2RD5C 3UVJA 2VB6A 2X1BA 1IBKJ 3IC1A 1S1UA 2BRKA 2EKNA 1ZTWA 3FFIA 5DDRC 2KL8A 3D6TB 3W7BA 2AW0A 3TARA 1IBKF 3VGUA 3J80U 2GO9A 1RAOA 4B9LA 3WZ0A 1K1QA 4YB5A 3H0PA 2YTCA 2ATCB 3PO4A 1FRHA 1U09A 3T5LA 1DAXA 5CABA 2V8VA 1QLNA 2GO8A 2R7WA 1UETA 2CZ9A 2W2OP 1SH0A 8AT1B 1KN6A 2E5HA 1N5VA 4ERDA 4F3OA 2IDEA 5D77A 3PM9A 5AJ3F 2MYFA 4LUBA 3EWGA 4N76A 2YWHA 3EGVA 2E5LJ 3OT9A 3M1VB 3CC4S 2R7QA 4ZN3A 2RHSB 3E8OA 1RLDA 4M94A 2C22A 3KLGA 2XB2D 3W9HA 3OFHA 4ZLJA 3KJVA 2DNNA 2DNRA 2E1AA 3DGPA 1VQPS 3QT8A 3PX6A 2W1BA 4RZRA 2C1EB 1P9YA 2XLKA 1PILA 3IBWA 3V4MA 2F65A 1RWXB 1D9AA 2ZJPQ 3THVA 1IJEB 3LGNA 4PWWA 4J9MA 2GMHA 1JWWA 3DLBA 2YPYA 4KQZA 3J7YI 2MDAA 4RU2A 2VPWB 4QCLA 3OL9A 1RYRA 3R1LA 4F02A 2ZEJA 4C4WA 2O67A 2J9EA 4IRKA 3DOKB 3BEGB 2FIUA 3GV7B 4RBUA 1TVRB 1URNA 1YJWS 1B0TA 1TK0A 2DIUA 3W61A 1AB8A 3CVKA 4RX6A 1U1OA 2RMLA 4M95A 4J5OA 2BA9A 4A8QA 3AY0A
chains in the Genus database with same CATH topology
4RNHA 2LMIA 2M9KA 2ZKUA 5F8LA 3H40A 3T5KA 2FHMA 3KK2A 4J9NA 3HO1A 3NNCA 2IHR1 1MWZA 2V4QA 3M8PA 2JOQA 2F3JA 4OJGA 1FT8A 2LEBA 1D8ZA 4USJC 4E0DA 1WELA 3OFGA 2O1PA 3OR2A 5H9EJ 1HQUA 5G4DA 3DI6A 3A8EA 4NX9A 2W9CA 1SB6A 1ZPVA 1W2BR 4Y2IA 1E6YA 1C0UA 5B09A 3KYLA 1Q82T 3VZHA 1F5BA 1F60B 1TQLA 4IG0B 4TQSA 3CCQS 1RT7B 1L3UA 1LXNA 4HH1A 2OPPB 1VRUB 1NH7A 2WBMA 1TKTA 4O3RA 4EEYA 2N3LA 3CD0A 1VK3A 4QW8A 4H4KA 2YNFB 3V81B 4E8UA 3UQSA 4R8UA 3I0RB 2ZUGA 3GQCA 4EBCA 4JV1A 2CDQA 3MM6A 4I56A 3MUMP 4NWBA 2BR0A 2ACYA 1UJ4A 3QYYA 3T5HA 2GCFA 3FZBA 4W92B 4IFYB 4I68A 3JSYA 2MQQA 3WC0A 2WK4A 2IC3A 4DG1B 4LF8F 1ZZNA 1JLFB 2EWHA 3CJ2A 4RLEA 3RR7A 3MOJB 4ID5A 2BBEA 3F41A 5KFXA 2JC1A 5C24B 4YB7A 5KFPA 4LF6F 3FQKA 1OQ6A 4NLSA 1VHFA 1C0TB 1YJVA 4MKAA 1QUVA 3H4BA 3RB3A 2GHVC 5DDPC 4RW6B 3T1AA 1JKHB 5T7LB 4JUZA 5J1EA 3LPYA 4UY85 4Q8FA 1D8YA 4TY8A 5F3TA 1RA6A 4F3MA 3V6KA 4EBEA 3CPWR 1WTBA 4F4ZA 5E0OA 2HFZA 4M1KA 3SI8A 3UPFA 2J0XA 2AJ4A 3RAMA 3CD6S 2BXJA 2OP5A 1JJ4A 3VR1A 1X4BA 4HI1A 5LSRA 2QMXA 1LKZA 2IFXA 3C6UB 4HTJA 2E5GA 2ASLA 2G4BA 4NYOA 3V6HA 4QYRA 1IKVB 5KFEA 1U1NA 4LF9F 2D7SA 1U25A 3Q23A 4IQMA 2GGPB 3B82A 2QSFA 3QJPA 3MI7X 1G7CB 4WU3A 1QAXA 5I4MA 4KB7A 5KT5A 2ZH6A 3IXQA 4OZ5A 1E6VA 1HYSB 4DN0A 1N8RT 3MGJA 4GMKA 1X0FA 4ED1A 1VOMA 2NREA 3PY8A 2VBWA 1RT3B 4DQRA 2PIIA 1JXEA 4ILLA 1GTHA 3SDEA 1PSDA 2P9GA 1NK6A 5KTQA 1VBYA 4R0EA 4RUAA 5HN0A 4B9SA 2M88A 4RBVA 5CD4H 3N4WA 2OMLA 4IKAA 4A48A 4DR1F 1RYSA 2V0NA 1FRIA 1S9EA 3TO8A 2OD6A 2DR5A 3IO1A 2HHWA 2AGQA 4TLQA 2XS5A 5HI7A 4PQUA 2ZJQQ 1UWBA 2YNIA 4J9LA 5IT9Y 1NRKA 2HW3A 3O5TB 3M4XA 1S1XB 1IKWA 2ZOFA 5E3CA 4I1TA 3C6TB 2PGCA 1N5YA 1FJGF 3MMAA 3OPKA 1H2UX 4CTAB 5E33A 3IGNA 2GV1A 4CQ1A 4MIAA 1WD6A 2YKAA 3CD7A 2FB0A 2HQIA 2JEFA 1N6QA 1S1VB 4HLBA 3AHPA 4ECWA 4ATNA 4X4QA 4OZJA 4U9RA 2W4DA 3NCPA 2RF2A 4LFAF 2EC0A 1DBDA 2E7WA 4ITSA