3QO9B

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tsao-t, a non-nucleoside rt inhibitor (nnrti)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ ribonuclease H
publication title Crystal Structure of tert-Butyldimethylsilyl-spiroaminooxathioledioxide-thymine (TSAO-T) in Complex with HIV-1 Reverse Transcriptase (RT) Redefines the Elastic Limits of the Non-nucleoside Inhibitor-Binding Pocket.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 105
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qo9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9B03
4XPCA 1NHUA 4XPEA 3LP1A 4I2QB 3M8QA 1EP4A 4IG3A 3H5XA 2IM3A 2VG5A 2AWZA 5HBMA 4KV8A 3TVKA 4EO8A 2C2DA 4KHMA 1MU2B 4ZP6A 4YR3A 4Q8FA 5JUMA 1RT7B 2W7PA 5F8MA 3NL0A 4ECSA 4IOBA 2V4QA 2B5JA 4TYBA 3QIDA 2D3ZA 3H4DA 3Q8RB 2R2SA 3PZPA 4PQUB 2UUTA 2FLPA 1REVB 3PR5B 5DGBA 1RT1A 2I5JA 3CJ3A 5J2MB 2D7SA 4KHRA 3KLVA 4IH5A 3RBEA 2OPSA 2JEFA 1TL1A 5L1LA 1TQLA 4MIAA 1RA6A 4IFYB 5DQIA 3KMQA 4JV2A 1HNVA 5F8IA 3I0SA 3V6HA 4Q0BB 4NLSA 1MMLA 2FVSA 4FS1A 1S1XA 1JLGB 1JKHB 2ASLA 1HQEB 4FBUA 1IKYA 3MEDB 5KFOA 3IRXB 2VG6B 3DOKB 5C42A 5J2NB 3V6DB 1ZTTA 1ZTWA 2RDIA 5KFCA 3G6XA 2E9RX 4KAIA 4IRKA 1JLAA 3KNAA 4EO6A 3M9MB 3OL8A 1WNEA 3KHGA 5L1IA 5C24A 3M8PB 3DRRB 2C22A 4IRCA 4URQU 4H4MB 2OH2A 2YNGA 4ICLA 5L1KA 5KFEA 1IKXA 1T03B 1IKWB 3D28A 3OHAA 2R8GA 5DLFA 2R8KA 4Y2CA 3DLKA 3DOLA 3DI6A 3M9OB 5EWFA 2YNFB 3IN5A 3UPFA 1C2PA 4HYKA 2IMWP 1DLOA 2AX1A 2C2RA 4F4WA 1EETA 2RKIB 2UUWA 5KFKA 3MECA 2RF2A 5D3GB 5KT2A 4RUAA 4MK9A 5KFQA 3OL6A 1S6PA 4QW9A 3H4BA 1N48A 5CYQB 1BQNA 2WOMB 4KO0A 4MKBA 3QIPB 3BGRB 3KLFB 2BANA 2IAJB 1R0AB 2JC1A 3V81B 3C6UB 1RT2B 2HWHA 1ZETA 1HNIA 3GIMA 2J6TA 3HVWA 1FKOA 2BR0A 1XR7A 5J2QB 3MEEA 2WTFA 4EBDA 1RT3B 3TAMB 4KE5A 1QE1B 4IDKB 2W9BB 5F8GA 1LWEB 4ZMMA 2UVWA 1RDRA 1S48A 4OL8A 1UWBA 5HROA 5L1JA 4IH7A 3CVKA 1S9GB 2QE5A 5KT3A 3M8QB 1J5OA 4IG3B 3KK3B 4DG1B 4IRDA 1LW2A 3T19A 2W9AA 4KV8B 1Z4UA 3N6MA 3DRSB 1RTIB 3CO9A 2B6AA 4U7CA 3DYAB 3MR3A 3E01A 3Q8PB 3PR4A 2DPIA 1JLEB 2V0NA 2VA3A 4O4RA 3KLHB 1KHWA 5JXSA 3EZUA 3BSNA 4JV1A 4RW4B 5EWGA 4TLRA 2BRLA 4O3SA 4IFVA 1IKVA 2I5JB 1LWFB 2OPQA 4J9OA 1C1CB 3QO9B 4NLVA 4ZPDA 4J9MA 4HKQA 1C0TA 1JLQB 4ED3A 4XO0A 2OPSB 4FS2A 5EUHA 2VA2A 1TL1B 3JYTB 3N6NA 4J9QA 4K4WA 1S9FA 1RT4B 1TV6A 1N56A 3ISNC 1C1BB 3IGVA 2YKMB 4JUZA 3D5MA 2YKNA 2ASDA 2FVPA 2HNDA 2WHOA 4KBIA 4RW8A 2OPPA 5KFVA 5KFHA 5EWEA 4WZQA 3DRPA 1FK9B 5DG9A 4I7FA 5KFTA 2WCXA 5KFWA 4ID5A 5KFXA 1S9EA 5CYMA 4B3OB 2RDJA 3GV5B 3RAXA 2XC9A 1RTDB 2W8KA 2V4RA 2R2RA 4TXSA 4QWAA 3OHBA 5DGAA 4ZVHA 3OLAA 3LANA 4Y3CA 3GV7B 3T5JA 3PW2A 2YNGB 4ICLB 5C5JA 1LW0B 5KG6A 3IS9B 1HQUA 3DLKB 1HPZA 3PW7A 3DI6B 3T5KA 3RB6A 3LP0A 1HARA 1DTTB 1TKZA 1LWCB 4M94A 4NYZA 3UQSA 2XGQA 4ED8A 3QZ7A 2ZD1B 2RF2B 4ECVA 4DEZA 4LSLB 4Q8EA 1S6PB 5KFAA 2ZE2B 3GV8B 4PWDA 4O3OA 1BQNB 4KO0B 1CSJA 5KFNA 4ED2A 4LQ9A 2AX0A 4X2BA 4K4SA 5HP1B 5KFRA 2BANB 3RB3A 1S97A 1U09A 2FVRA 2JLEA 3DLEA 1HNIB 3I0RA 1N4LA 2R8IA 1NNDA 4NLYA 3KK1B 3H5UA 5KG0A 2HNYB 2VG7B 3MEEB 3RBDA 4O44A 1RAJA 3G6YA 3DMJA 2FJVA 4I2PA 1S1TA 1FKPA 1JLCA 3Q8QB 3KHRA 3PW4A 3LAMA 1TL3A 5F9NA 2XCPA 1VRUB 1N5YA 1UWBB 4R5PB 3FDSA 3QYYA 2ZKUA 4K4ZA 4WZMA 4TY9A 3GILA 4RW7B 3N6LA 4EYIB 5I42A 3DLGA 1TP7A 1K1QA 2ILZA 3PJXA 1KLMA 3DM2A 4K4TA 1S0MA 4O3QA 1S1VB 3CDWA 1RTHA 2FJXA 2R2TA 4KKOA 2R2UA 5C25B 1S1WB 3NKYA 3SI8A 3BREA 1TVRB 4NCGA 5KFLA 5KT4A 2ASJA 3PVXA 1RT5A 3CDEA 4IQXA 1S4FA 2IJNA 4TY8A 4ZPAA 1IKVB 4WFYA 3IG1B 2OPQB 2YNIA 3KLGA 3FRZA 3JSMA 3KLIA 4G1QA 1C0TB 2HWIA 1SV5A 3V4IB 4YQWA 1C0UA 2OPRB 3H40A 3LALA 4LSNA 2E9TA 4NRTA 2ALZA 2V9WA 4ECYA 1DTQA 1JIHA 1BQMB 2WONB 3GYNA 4ED1A 2BQUA 2YKNB 4WXWA 1S0OA 4K4UA 1TKXA 1TKTA 3KLEB 3DRPB 3OL9A 3H59A 4QWEA 4ID5B 5FDLA 3CJ5A 3KJVA 1S9EB 3QLHA 3QGIA 5HLFA 4ZHRA 3CDUA 3BSOA 2FLNA 2FLLA 3PW0A 1S6QA 1JLBB 4YP3A 1HMVB 4RNMA 3ITHA 3T5HA 5KFSA 2W8LA 2BE2B 4EBCA 3QGGA 4PUOB 3BQ1A 4R8UA 5DQHA 2IC3B 4YR2A 4QW8A 3MEGB 4H4OA 3LAKA 1HQUB 5J1EB 5KFZA 3UDLA 1S49A 3KK2B 2QV6A 4K4XA 1RT7A 3LP1B 2AQ4A 5KG3A 2WK4A 1EP4B 3SFGA 3T5LA 4NLRA 2VG5B 4RZRA 5HBMB 1RTJA 4IH6A 3FFIA 4IR1A 5KFPA 3EPIA 2EC0A 4PQUA 1REVA 1S0NA 1I6JA 1SH3A 2B5JB 3IGNA 1T3NA 2FJWA 5J2MA 2XI2A 4URSA 4RW6A 4ZPBA 3DLEB 3CIZA 3CWJA 4ED0A 3PJWA 3I0RB 4RUCA 3G86A 1RT1B 3KMSA 4YR0A 4G3IA 4IFYA 2C28A 2GIRA 3H2LA 2HMIA 4O4GA 5J2PA 3NAHA 3OSPA 3ISND 1S1TB 4Q0BA 4ECZA 1JLFA 1TL3B 1JXLA 1JKHA 3NAIA 4NLWA 1HQEA 5F8LA 3BJYA 3GIIA 1HNVB 3MEDA 3IRXA 3I0SB 3DOKA 1SUQA 3V6DA 5J2NA 5I42B 3DLGB 2F8EX 3BQ2A 4NLDA 1S1XB 1OS5A 4ZVEA 3DM2B 2XI3A 3HKWA 5KG1A 3GQCA 4DL4A 1RTHB 1IKYB 3BSAA 1RA7A 5C42B 5KFGA 3M8PA 2C2EA 2GC8A 4J9KA 3H98A 4NLXA 1JLAB 4QPXA 4RW9A 1S1UA 1T03A 3E51A 4IG0A 4MK7A 3DDKA 1RT5B 5C24B 3RAQA 1QAIA 5F8NA 4TY8B 4NLUA 2YNFA 2HNZA 4NLQA 3MR6A 3HVTA 3KLGB 4DL2A 1IKXB 2W7OA 4YMEA 2RKIA 4KB7A 1SV5B 5I3UA 2CJQA 3DOLB 4LSNB 5D3GA 4TQRA 1DLOB 3OSNA 5KFYA 1EETB 2WOMA 4EYHB 5KFUA 1R0AA 1N6QA 2IAJA 3MECB 4RNHA 4RNNA 3GIJA 1TKXB 3C6UA 1RT2A 1IM4A 2GIQA 2BQ3A 3TQ1A 3QZ8A 4DL3A 3HHKA 1QAJA 4J9RA 5FDLB 3QLHB 5KFDA 5KT7A 3OLBA 2D41A 4J9LA 5HLFB 1RT3A 4Q43A 3MFHA 3CJ4A 3H5YA 1HYSA 1K1SA 1QE1A 1SH2A 2W9BA 1FKOB 1LWEA 4MIBA 2AGPA 1RYSA 5F9LA 4K50A 3NMAA 3CJ0A 5KG7A 1S9GA 2B43A 4ZP9A 4ZVGA 2FVCA 4H4OB 3KK3A 3NBPA 4DG1A 2J6SA 5HROB 1XR6A 3DRSA 4MH8A 4MKAA 4ECTA 1RTIA 4QWCA 4GC7A 5T14A 4EBEA 3RB4A 2UVVA 3DYAA 1KHVA 2JC0A 1J5OB 1LW2B 1JLEA 2CKWA 1RTJB 4NRUA 3M9NB 3KLHA 1T05A 4IKAA 4ZVFA 4ZP7A 3FFIB 4ED6A 3V6KA 3MTKA 4J9PA 2B6AB 5DG7A 4RW4A 2IM2A 3Q8SB 3LP2A 5K14A 2R8HA 3E01B 4DL7A 1LWFA 1C1CA 3QO9A 3T1AA 1VRTA 3FQKA 2ILYA 4H54A 3I5BA 4R0EA 2UVRA 3C6TA 1JLQA 4RW6B 1D1UA 2WB4A 5DQGA 4MK8A 2FVQA 3BQ0A 2JEGA 4Q45A 3JYTA 4IR9A 2JEIA 4IFVB 4WE1A 2IA6A 1RT4A 3V6JA 1GX5A 1C1BA 3UR0A 4ECWA 2YKMA 4F50A 2HMIB 1GX6A 4O4GB 2UVUA 5J2PB 4Y2AA 3NGDA 2O5DA 4JV0A 3KHLA 1JLFB 1TV6B 2BRKA 3I5CA 4DL6A 1FK9A 4U6PA 3PW5A 2J6UA 4WYLA 3KOAA 2IJFA 5F8JA 1SUQB 4B3OA 4WYWA 2HNDB 3G6VA 2IBKA 4RW8B 4M95A 2OPPB 2YNHA 2W9CA 4RNFA 1RTDA 4I7FB 3GIKA 5CYMB 4ECRA 1RT6A 2I1RA 5F8HA 4KFBA 4RW9B 1S1UB 1S10A 1LW0A 4O3RA 1SH0A 4IG0B 3IS9A 3MFIA 5L9XA 5DG8A 4MFBA 5KG4A 1W25A 2HNZB 3HVTB 2WRMA 4TN2A 4I2QA 1DTTA 4EEYA 1LWCA 4ZPCA 5I3UB 1HPZB 2ZD1A 4Y34A 3FQLA 1MU2A 4Q44A 1NHVA 3KHHA 4F4YA 4LSLA 4TQSA 2ZE2A 3LP0B 1TKZB 2ATLA 4FBTA 4ECXA 4QWBA 4LQ3A 5HP1A 1N6QB 1QUVA 5KG5A 4ECQA 2DPJA 3VQSA 1XR5A 2XCAA 3H5SA 4PWDB 3EPGA 3KK1A 2HNYA 2VG7A 5DLGA 4ECUA 4NLTA 3HVAA 1HYSB 5KT6A 1VRUA 4O44B 4R5PA 4J9NA 3DMJB 2IM1A 4K4VA 4RW7A 4I2PB 1D0EA 3PHEA 3SFUA 1FKPB 1JLCB 4WFXA 3RB0A 4NLOA 2E9ZA 3NBPB 1JLGA 1S1VA 1N5YB 4O3NA 4NLGA 4J9SA 5KFJA 2IM0A 2AGOA 2VG6A 1JX4A 5C25A 4NLPA 4WXOA 4QWDA 1RYRA 3QGHA 1KLMB 1S1WA 1T05B 2AGQA 1TVRA 3I5AA 4KKOB 3DRRA 3LP2B 5K14B 4H4MA 5EDWA 3IG1A 1VRTB 1IKWA 4NCGB 2AU0A 3C6TB 3V4IA 2HAIA 4K4YA 2OPRA 1T94A 4WE1B 4URGA 2YNIB 4O3PA 3JSMB 3OL7A 3KLIB 4G1QB 1BQMA 2WONA 1C0UB 4GC6A 4DL5A 2XGPA 4WFZA 3MR5A 3KLEA 1DTQB 5CYQA 4TYAA 4F4XA 4KSEB 3QIPA 3BGRA 3KLFA 3MR2A 4ED7A 3CJ2A 2BQRA 3V81A 2YNHB 4RU9A 2W9CB 1TKTB 3FSIA 5KFIA 4RNOA 3MF5A 1JLBA 5KFFA 1HMVA 2D3UA 3KJVB 2R8JA 2BE2A 5J2QA 4PUOA 4ZHRB 5KFMA 1RT6B 2XWYA 2JEJA 3TAMA 4NZ0A 3BR9A 2IC3A 4KFBB 1S6QB 4IDKA 3MEGA 3ITHB 4ZP8A 1YVFA 5J1EA 3ICLA 4F4ZA 4MFBB 5KG2A 5KFBA 3KK2A 4R8UB 5KT5A 3BSCA
chains in the Genus database with same CATH superfamily
4OHYA 3R1LA 1LXNA 1S6OA 3GR0A 5F8MA 4WF9Q 2SXLA 2R2SA 2PEHA 2OI2A 4ID8A 1T8EA 3B8HA 3PG9A 4NEZA 2XG8A 3U7JA 4CLUA 1GT8A 3A13A 4O0IA 2HAFA 2YKAA 1IKYA 4DF8A 4JI3F 2ZJRQ 2BEFA 1T03B 2HFNA 3D28A 1L3SA 2R8GA 2V2ZA 3M9OB 5EWFA 2DNGA 4CH1A 2IMWP 4JYAF 4F4WA 1VQKS 4TKTA 1AYEA 2H51B 2HWHA 1RADB 1SJ3P 3A3OB 2YH1A 3FRYA 2P9CA 4ZMMA 4C8MA 4WU3A 1RDRA 2MSTA 1VC6A 3DYAB 3Q8PB 2DPIA 3Q22A 2UUAF 2OMOA 1C0TA 3N6NA 4K4WA 4DUTA 1NU4A 2FVPA 5G4DA 3I55S 5KFHA 3TOQA 2JLGA 4I7FA 5KFWA 3OR1B 2FGOA 3RAXA 3R5AA 3PRVA 1KDNA 1OJ4A 4L72B 1YJRA 2AYGA 1F9EB 2ZE2B 3QSIA 1KQFB 1U09A 3Q86A 1M1HA 3H5UA 4A8SA 1PO6A 2JX2A 1UW4A 2R7OA 1K1QA 1D9FA 4O3QA 3M2UB 3CDWA 2M52A 4CLTA 1FDAA 1LK5A 2RRBA 3PRDA 2M7SA 4NCGA 5CD4H 3RUBL 1PSDA 3IG1B 2YNIA 4DN9A 1N5SA 2ZNYA 3NNHA 2OPRB 4P2XA 3AAWB 2PEBA 3SV3A 3P49B 2EFNA 1BC6A 2F8HA 1CULB 4N76A 2B4OA 2N7YA 3M8SA 2BX6A 4R8UA 4AL6A 2M70A 1RP5A 4K4XA 1U1KA 3SMZA 3THTA 4IR1A 3D3CJ 2VV5A 2EC0A 2GCFA 2W2QP 5IQ6A 4EGLA 1VQMS 2ZOMA 4G3IA 3BPSP 3TX8A 3U1NA 1QLNA 1CS4A 4EWTA 5LSOA 1IM6A 5I42B 1YHQS 2XI3A 4RX6A 5C42B 5KFGA 4J9KA 4TVAB 4MAKA 4NXNJ 1FD8A 2DNYA 3NRBA 3GLJA 5HVGA 4A4JA 4IG0A 1F5AA 3D54A 4BWJA 3OUYA 1T02A 2WB1D 2HS4A 1V6HA 2GIQA 4DX5A 2D41A 2JRSA 1IBCB 5I3PA 2AD9A 1RUSA 1RKIA 2AZ1A 2FVCA 2RU9A 4JI6J 1P8GA 2XO7A 1NLKL 3HK2A 2DR6A 2AJQA 3BYPA 3KLHA 1QUPA 1RBLA 4DF4A 3FQKA 2ILYA 1FDNA 2J9CA 2CNKB 5E3CA 2DH9A 3M6WA 3T3FA 2B8QA 3X1LB 3GFYA 3EX7B 4WYWA 1UZHA 2AP6A 3N9UC 2GHPA 1C4AA 5L8RC 1R7IA 3DNCA 3D3BJ 4GKKF 1CJUB 2AJ0A 1WELA 4A46A 5HAOA 5KG4A 3PHTA 2WRMA 1LWCA 3WIVA 1PJ6A 5D6GA 3CIMA 4ECXA 5HP1A 1N6QB 1UVKA 4A8YA 2MQMA 1X9WA 2DTJA 4YDDB 2KZMA 1VMBA 3CJSA 1IN0A 1U45A 2DXDA 1RE1B 1RHUB 4FNIA 1JX4A 5ETSA 1RYRA 2MKJA 2NYIA 3SSSA 3B4MA 1VRTB 1GEHA 2UV8G 2VODA 3PEJA 1SXLA 1U1PA 2J0WA 5CYQA 3OTDA 4LT6A 2JEJA 4NZ0A 3DRXA 4ZP8A 5J1EA 3MWBA 3MUTP 3IM8A 4YB7A 4XPCA 4I2QB 3H5XA 2VG5A 4KV8A 1YBAA 2MGZA 3BN4A 4X65F 1G4CA 2M8HA 2VPXB 5T7LA 4WKYA 3GJTB 3FSYA 2QL5B 5CCLA 1HWLA 4LF5J 4ZVSB 3R5DA 2DH7A 1TL7A 1UETA 1VQOS 3HFZB 2DB1A 3HXMA 3G82A 2V4JB 1DHMA 3NCPA 4ES3A 1QVFR 3DLKA 2MKSA 1EETA 4JI5J 3FUYA 1IJFB 2F7VA 2UUWA 1TTHB 1SKSA 5HMZA 3V81B 4YFUA 1MMNA 4Q5VA 4WBFA 3MPDA 5HROA 4IH7A 1VC5A 1RZMA 3S01A 3QATA 2CADA 2W9AA 3DRSB 1H73A 3R5JB 4QU6A 4W92B 5EWGA 3NGUA 1R6YA 2OPSB 3EXCX 3VAKA 3ISNC 2WHOA 1UZDA 4OHVA 4P9SA 1S0VA 1J27A 1S9EA 2D9PA 3JSYA 4USMA 4ZLPA 5KOXA 4AL5A 2YNGB 5C5JA 2EVZA 4X4UA 2MJNA 3JAMY 3M05A 2DXEA 3H90A 3FZ2A 2B9WA 1H74A 2YX4A 4X2BA 3EVOA 1Y3KA 2MZSA 4M5JA 1HNIB 1JNRB 2XB2D 4I2PA 3TI0A 2J7UA 1VRUB 1WC4A 1QY7A 3QWUA 4K4TA 1S0MA 4A8WA 4DR5F 2MKYA 2QLXA 5I3QA 3PVXA 4ZPAA 2Z2LA 3V4IB 1X4FA 3HHLD 2QX0A 1MWZA 2FGCA 1DTQA 2W1BA 1O0PA 2DY9A 4K4UA 3DRPB 5K5MA 3Q2SC 1FNXH 5IS2A 1N32F 4ZHRA 1NUEA 4RJVA 4DS4A 2J0QD 2FYXA 1FTRA 4KJIA 2M9KA 3W61A 2QGFB 4Q7AA 2GO9A 4YR2A 2G2OA 4UT4A 2Z56B 1WSRA 3E8OA 1EP4B 3R2DJ 5KFPA 3NGKA 3MCSA 1QSSA 1I6JA 3LO3A 3FBCA 4B9SA 4RUCA 1OWXA 4ILRA 3H2LA 2E5HA 5J2PA 5D8HB 4Q0BA 1A6LA 1QVGR 3NAIA 5IC4B 4NLWA 3W5YA 3DOKA 2WSEC 5B09A 4DJBA 3Q24A 1RA7A 4OLPA 3Q89A 4CO3A 2ZWPA 4DL2A 2A6MA 1SVDA 4DLGA 1S59A 2Q6CA 1NSAA 1NPKA 2PD1A 3D7SB 2BM0A 5B0BA 1TKXB 4FKYA 1VYAA 4DPWA 1JXVA 4P52A 2FHJD 3WHIA 2RT3A 2FJBB 1K1SA 2IVMA 1K44A 2BJ7A 2G0JA 3R97A 2N7CA 1NK7A 1Q8IA 3EMTA 2DR7A 4MKAA 4GC7A 5LM7E 1LW2B 4J7CA 1UEUA 4IKAA 4LRAA 4BHQA 1KS2A 2B6AB 2CPZA 1C1CA 3VALA 5A8RB 3JYTA 2RS2A 1FX2A 3US5A 3W63A 4N56A 3BB5A 2C3UA 3DDIA 3I32A 4RW8B 1U49A 2F4FA 4DV1J 1XIQA 3IS9A 2RVJA 3GE9A 3NEKA 1RWXB 4Q2MA 4DR2F 4B9NA 3O2IA 5HI7A 3EGWB 4X4OA 4F4YA 4TQSA 3KJFB 4A8FA 3EPGA 2R7VA 2BM1A 3I31A 2VJUA 3OT9A 4OYZA 4K4VA 3DMJB 1W2IA 3DXBA 1OQ6A 3J81j 3VGUA 4QYZK 3ZZ0A 1HNXJ 1NJXA 3SQOP 2F63A 3MCOA 3HSZA 2HHQA 1FXRA 1X8DA 4YY3J 3EDRB 3HSGA 4WIIA 1MSWD 2ZUAA 1X60A 1AXQA 1H38A 3QIPA 3BGRA 5IWAF 1VLOA 4OYWA 2UUBF 2C2MB 2Y9HA 4IDKA 3MEGA 1WACA 3ITHB 3VTIA 2GHWA 3TVYA 5HBMA 4JI4J 5D77A 3GB0A 5THWA 4M5DA 4ECSA 3DGPA 4CM0A 2Y1RI 1X4CA 5FJ4A 1Q1KA 3UE2A 4USKA 1HNVA 3TEGA 5DM6Q 2NYHA 3D6MB 2HZCA 3G6XA 2E9RX 4OYMA 1VK3A 1M0SA 3M2RB 2R7WA 3CJTA 2XLIA 4LFAJ 4ELUA 1DLOA 2ZOGA 1VQ7S 2RF2A 5D3GB 5IT4A 1RTZA 1N48A 2IAJB 2V8VA 1ZETA 2ZZMA 1XWLA 4C7QA 2IFXA 4DR6F 4M1KA 4WP8A 1UKUA 1S9GB 4ALZA 2ZJPQ 4WK3A 4DG1B 2JFDA 1IJEB 1PG5B 1H3DA 4DR4F 4F3MA 1JLEB 1IWAA 3R6GB 3A1YG 1IKVA 3SQGB 5A8KA 4FS2A 5EUHA 3TO8A 3ZTPA 1RQ0A 4RKUC 4YHHJ 1AA1B 2OPPA 4JI7J 2KN4A 1WF2A 1RWNB 5HSPA 4TXSA 4DUYJ 1S76D 4M94A 4PPDA 2ADCA 2ZD1B 2DVIA 1ZM4A 1MROB 3KG4A 4KGMA 1CSJA 2AX0A 1SQGA 2FVRA 2H48B 1N4LA 1NNDA 1FJCA 4NLYA 1RHQB 2K3KA 1KVIA 4MYUA 4CM2A 5ETOA 5E5NA 3N6LA 3DLGA 4ETXA 1UVIA 4EU0A 4LF9J 1ZM3A 4PWUA 2OIHA 4BDPA 2HVEA 3AD7C 2Q79A 3BO4A 4F4KA 3BREA 3CDEA 2IJNA 1KN6A 2Z2ZA 1IQZA 4DU8A 1HW8A 4QIWD 4DXLA 2N3LA 4B9MA 4QWEA 3BH6B 3W8GA 5HLFA 1S6QA 4YP3A 1Y4ZB 5KFSA 2BE2B 2RHSB 3V4MA 2L08A 1OMSA 2AT1B 1CJKB 4FVMA 3SFGA 1YZ7A 4X66J 1IBMF 4ED5A 1HW9A 4UF4A 2V9KA 4CLFA 3K8WA 4LRCA 1Q4RA 4DV2F 2YQ3A 3BQ2A 3I0SB 3AT1B 2ACMA 2CYYA 2XMAA 1FRXA 1MWYA 1YIJS 4DR7F 1T03A 1R8BA 3OBIA 3NWRA 1SV5B 2PFFB 3DOLB 1XK8A 1JJCB 3F0NA 4DSEA 1U47A 2M8DB 1U2RA 4Y00A 3OJUA 4UTGA 3OLBA 2DIUA 4Q43A 3H2VE 1DRZA 1N5VA 4F8RA 1RYSA 2V94A 1PYSB 3RB4A 3DYAA 3M30A 3RW7A 1B7YB 4FYYB 5LSLA 3ETMA 3HJFA 4P71A 2CQ1A 2ZVSA 1X4DA 3C6TA 2WB4A 2PE8A 3M2VB 1N52B 4WE1A 1CJTB 4ZVQB 3V6JA 3UR0A 2C3MA 2OO4A 3OFGA 3AXMA 3I5CA 4CQ1A 2K7KA 5CZVA 1QAXA 2LXIA 3C46A 5F8HA 1PJ7A 1RHRB 2LXFA 1SH0A 3CULA 2HNZB 2L9DA 2CNLB 2IA0A 1U1LA 4TU9A 3FQLA 2WVEA 2ZE2A 1XR5A 4ZK7M 2U1AA 1DURA 2RUGA 2K3IA 2W01A 1APSA 4DQRA 4LF8F 4LRDA 3M2UA 4L3NA 4NLPA 1UAWA 4ZPWR 4K7QA 3HLUA 2FZCB 3BGUA 2RQCA 3IG1A 2EFPA 1IKWA 4P10A 2OPRA 1T94A 2I0XA 3DU5A 3AOAA 4M5HA 1NAQA 1IBLF 1CULA 5H9FK 4GKJF 4GVLA 3VR1A 3IP0A 1HD0A 4RU9A 3FSIA 4RNOA 3D0GE 4QJVA 5CAAA 2X3DA 1U1OA 2MLYA 1NBEB 1RT6B 4KFBB 2HURA 1SKWA 3ICLA 4N77A 3RAMA 3ENQA 1UEVA 3AQOA 3W7BA 3M8QA 3G8TA 2JZ5A 3A8EA 2W7PA 3D66A 1U0SA 3AJDA 4PQUB 2RUSA 2EG1A 2I5JA 1QDUB 1FEEA 3VAJA 1R31A 4KPYA 4MIAA 1RA6A 1KQSR 3G87A 2U2FA 3K17A 4NASA 1TMJA 4NLSA 2BABA 5AJ3J 1S72S 2ASLA 5C42A 4PG5A 2DNRA 2DNQA 1V3ZA 2L9NA 2AJFE 5L1KA 1B4SA 3TNVA 1C2PA 3HHLC 1VQ5S 4MK9A 4C6AA 1S6PA 5D0GA 2C2KB 3GIMA 1L3VA 4A8MP 1RWPB 3MEEA 2CNNB 2L48A 2CQGA 3D1QA 3UO0A 3QAEA 5HQLA 2QT7A 2YPYA 4IG3B 5D0HA 4X62F 3GG1A 4C8LA 2BKNA 4E0DA 4USVA 2OPQA 3G6ES 1RHMB 1N54B 3VGSA 2ASDA 2FHKA 5EWEA 4JI1F 1RTDB 2IDEA 1CJUA 2W8KA 2R2RA 1T9XA 4Y3CA 2W25A 2BE7D 2ZBPA 3PIPQ 2R7RA 2XGQA 4ED8A 1AROP 3RRKA 3HSJA 4KO0B 5AXKA 3TEHB 3X3UA 2VG7B 3G6YA 3FBBA 5A76A 4KY3A 2VQFJ 2EK6A 1MN7A 1S1VB 1RTHA 3T6JA 2R2TA 1M5OC 2RE1A 4ZVUB 2HGMA 3ADAC 2N4DA 3C14B 3OTOJ 5E0OA 1FD2A 4PPZA 1NK0A 4ED1A 3TYTA 3HULA 2MHNA 3QRQA 3QLHA 1S5ZA 3C15B 1PYOB 2E7VA 1WKKA 3PW0A 3T5HA 3IC1A 3V5RA 2W8LA 3L3CA 1YLXA 3HM9A 1TUWA 2B4PA 3BQ1A 5DQHA 2LKZA 4ZIWA 4QW8A 4ZIVA 3KKFA 1SC1B 1YRUA 2GGPB 4AQYF 5KTQA 2LYVA 4IH6A 3FFIA 2XMJA 1AW0A 4DV4J 2WVBA 3PX4A 2ROGA 3CWJA 4ED0A 2J7KA 3KMSA 4YR0A 2GNKA 3GYXB 3BBFA 5LOQA 4FPIA 3SYZA 1U1QA 2B3TB 3NAHA 1JXLA 1T11A 1BE4A 1PC4A 2V4JA 4FDFA 2DK2A 5CXTA 4J9VA 1Q0NA 4OHZA 5C24B 3RAQA 1U7LA 2RH3A 1Q79A 1IKXB 1XERA 1SJRA 3J80Y 5KFYA 2AYBA 3MECB 1HWIA 2BKPA 3QZ8A 4OYOA 3R5CA 4LIRA 3HVRA 1FKOB 2AGPA 2RMLA 1EARA 3A8KA 3NMAA 3SCIE 1XR6A 3DRSA 1FJEB 2UVVA 2FC8A 2EC2A 1RTJB 1T05A 4DOZA 1B7FA 4RW6B 1D1UA 2YWKA 1XMQF 4C8NA 2UVUA 2N3OA 2EFVA 2J6UA 5IXUA 3HF5A 4LF7F 2YKQA 2MSSA 1FXDA 4NXMJ 5CYMB 3FCHA 4P7VA 5HO4A 1S1UB 5AE2A 2MQLA 3VVTA 2Y0BB 1T9WA 3NS7B 2CJKA 2XMMA 3GP9A 2LEBA 2DNHA 4EZ9A 1LQ9A 1WHXA 5HMXA 1KWMA 3RYLA 1CBKA 2C2OB 2DNNA 4Y6IA 5KT6A 1VRUA 4WPAA 4J9NA 3GFHA 2EEYA 4PRFA 2XY6A 3PM9A 2IM0A 5LT5A 1RXOB 1Y11A 2MQNA 1KD1T 2AGQA 4WFNQ 2G13A 2NXEA 1KBRA 3V4IA 3K59A 4B9TA 4URGA 4F04B 3I96A 2QJ3A 3MPVA 1HHQA 2PA8D 3JQKA 1RAEB 3R7BB 2ZH4A 4DV7F 2RSQA 4HH1A 3DOMB 1TAUA 3PIOQ 3TAMA 2GAHC 2BW7A 1TK5A 4H4KA 3DLBA 4BBYA 1OY8A 1EP4A 2C2DA 5DDRC 4PR6A 1FNMA 4QQBA 1X4BA 1K0VA 5HJXA 4TYBA 4WFBQ 3SBMA 4LBPA 5EX0A 1TKDA 4IH5A 2JEFA 4JI8J 2ZH7A 4D3GA 3MR7A 2BJEA 4LF6J 3IRXB 5KFCA 2RJZA 2AW0A 2ZOFA 1J5EF 3KNAA 1N0VC 3UWTA 3Q8VA 4ICLA 4XAKA 4F4AA 2QSWA 2MKCA 2OAUA 3H4BA 2Y8YA 3IR7B 3UVJB 1WUUA 4TU7A 4FF4A 4FXVA 1UVJA 5F8GA 3UDCA 2LLZA 5KT3A 3HSDA 1LW2A 4PZVA 3CO9A 4LVNP 2B6AA 3MR3A 2FQQB 3BH7B 4DR3J 4OMFG 5A8RA 4RW4B 1F5CA 4OI3A 4CP5A 4DFMA 2RQMA 4DV5J 5B08A 1RT4B 1N56A 1C1BB 4DSIA 4A8XA 4ANDA 3Q2TC 2NUHA 4RW8A 2QL7B 3CCTA 3EVMA 3BM7A 4KPCA 1V3RA 2E7XA 1KTVA 2JDJA 4NZ6A 2CQIA 5KFAA 4LQ9A 3TANA 1X31C 2HQIA 1FEHA 2JLEA 3I0RA 3A12A 3RBDA 3FJ2A 3DMJA 1DARA 4NX9A 1XQIA 4F3QA 2OTJS 1FRIA 1ZA1B 1A9NB 2UV8A 1S1WB 3NKYA 2BKOA 2B4UA 2LXUA 1P6TA 3N79A 4W98A 5E3PA 1C0TB 2V9WA 5H9FJ 4ECYA 1MN9A 3GYNA 1P9QC 1NMEB 4KIAA 1P1LA 2H4YB 2HHPA 3EGZA 3GG0A 4ZCIA 2M2BA 2FLLA 2V63A 3ITHA 3QGGA 3TJ9A 4BC7A 4DQIA 1WC5A 1S49A 2QMUB 3R5GA 3LPEA 2AQ4A 1HNZJ 1RAOA 2VL1A 2HEKA 4CWBA 4G6VB 3ET6B 3CE8A 2ROEA 3WX8A 1NB7A 2FLOA 2VJVA 4DSLA 4NLDA 3E2EA 2O66A 4EUVA 5KG1A 3M2RA 4NOHA 4CTAA 4NLXA 3PKYA 1JXEA 2MTLA 1GXUA 5D3GA 4TQRA 2MJUA 5E3RA 4QBUA 3MM8B 2IAJA 1SJ4P 2LQ9A 5L38A 1FF2A 2CG4A 1HBUB 3TARA 2G4BA 4UY8T 1S9GA 1U1NA 2CPYA 1Q81T 1SC6A 4DG1A 2VQEJ 3PX6A 2V8DA 4LBIA 2UXDJ 3WIUA 1JLEA 1HR0J 4MK8A 3TA2A 4B3MJ 4GO7X 1VS3A 2BA9A 2ADBA 1IR2A 2HNDB 3G6VA 2BZ2A 4USUA 1NM2A 1R8HA 4USIA 1NJZA 2QYGA 3D0IE 4IG0B 2KTQA 4MFBA 1U24A 4C11B 1VQ4S 2CJBA 2HGNA 2ZD1A 4Q44A 4OI4A 1MROA 3CXCR 4FBTA 3ZTOA 5LMNJ 2YH0A 2QSFA 4OZNA 4M5MA 4PWDB 2QFJA 2AMCB 1O8BA 5ETLA 4CLWA 2DNZA 1T3OA 2B9YA 2LDYA 4YB1P 4J9SA 3ZZTA 4LFBJ 4QWDA 1SQFA 3RG6A 2Z2YB 2WAQD 4LRFA 1BWEA 3J7AN 2XZWA 1H2TZ 4JI6F 2W2OP 2XGPA 4PXBA 4TYAA 2AF6A 4F4XA 4QR0A 2V2VA 3UR3C 2DT9A 3T1HJ 2BE2A 5J2QA 1FKAF 2R42A 4CDIA 4RBVA 1WTBA 1EZZB 1CJKA 3OSNA 2XWXA 5CZXA 1SBRA 1YDLA 3Q8YA 1X5TA 2R7UA 3MCNA 1C4CA 2D7SA 2P9EA 4NMXA 1TL1A 2B0GA 2HBQB 2XSJA 1KONA 2KRRA 2BJ1A 5CCMA 4DPXA 3I0SA 3DDNA 3V6HA 1YTYA 3S8SA 2G2ZA 1WG1A 1B0VA 2ZITA 1KKHA 3MEDB 3D0HE 3MM5B 3DN9A 4EO6A 3PY8A 3EGVA 5ETNA 3Q8UA 3JXOA 3KHGA 1HHSA 2OH2A 3KUEA 2ZHOA 3DOLA 2LVWA 5B0FA 2XZTB 1KVJA 2RKIB 4ZPVR 4I6WA 4TLQA 2E1MC 1WF0A 5CYQB 4MKBA 2JC1A 1RT2B 2OLWA 3PFEA 3G9CA 4FPRA 2VUGA 2DXFA 1FWPA 2ZC4A 1NSQA 3Q0AA 2VPZB 3DRYA 4OI2A 4OFZA 3B78A 2PSZA 4KV8B 5LSRA 2QTWA 2EI5A 3GU0A 4WKRA 4E2FB 3M2VA 2D3OR 1RAIB 1WOSA 4HKQA 4XO0A 1VHFA 1KNZA 5DG9A 1TL7B 1RWWB 4B3OB 2HVDA 1T9YA 3GV5B 4V19X 3G82B 3PW2A 5H9EK 3SV4A 3DLKB 3FNNA 2VDIA 4LF5F 3GV8B 5GVQA 3R9LA 4O3OA 1PBAA 1ZPWX 4OYAA 1Y5LB 2V34A 2DO0A 4PKDB 5DS7A 4YS2A 4P73A 3IM9A 3QJJA 3BYRA 4K4ZA 4WZMA 4JI5F 3GILA 1TP7A 1U4BA 4J90A 1RCOB 2R2UA 1U6BA 3VAIA 4ATNA 1ROFA 3ETOA 5DZ6A 4WFYA 3KLGA 3FRZA 4HL9A 1H72C 2AKWB 2LQ5A 2KG1A 5F41A 4L73A 3NLCA 2BQUA 3N01A 4QOTA 3W8PA 2FZGB 1LEOA 5FDLA 3KYLA 2HVHA 1S9EB 2IDLA 4UOHA 2VFTA 4AXJA 1JLBB 3L7PA 1T9UA 2GJFA 3FEZA 1X4EA 3LPYA 2RIJA 2CQHA 4PQUA 2XYPB 2ZH2A 3CIZA 3H7HB 1UJ6A 1G2EA 1U26A 2YQ1A 1G6BA 2GIRA 2X1BA 2FD2A 1FFSB 4DCJB 2HZVA 1ZAWA 3S6EA 1S1XB 4AD6A 4LF4J 2KKHA 2GC8A 3LUYA 3CCVS 1I94J 4ZITA 3POTB 1EQMA 1R89A 2EWHA 2VOOA 2GW8A 3D6FB 1YJNS 4RU2A 3ENAA 2UXBJ 1IR0A 1UWAA 1XMBA 3TUIC 4MIBA 1OQ3A 2B43A 4QIFA 5IT9U 3CB4A 2W2MP 3NBPA 2H3EB 1J5OB 2BJ8A 3V6KA 1UTAA 3E01B 4IR9A 3RZAA 4Q45A 1RJJA 1R27B 2ZH6A 2KM8B 2VKZG 5J2PB 3NGDA 2BRKA 4ZN1A 4E98A 3PW5A 3IRWP 5HQMA 2KFZA 2B7CB 1WC6A 1RTDA 1YJTA 2JL9A 4DUZJ 2OUGA 1ITPA 1Y3JA 2D9OA 4A8KA 1NH8A 3UDVA 4DCPB 1TKZB 2CPXA 2CZVC 2ZH8A 2NPFA 2HBYB 2VG7A 4B3TJ 1R8CA 3HVAA 2G9OA 4HI1A 2QO3A 3PEHA 3J7A1 2IRUA 3AOCA 2AEJA 4YDXA 4WFXA 1S1VA 3HFVA 1NDPA 4LIWA 3F44A 1RK8A 4CT8A 5D0EA 4HH0A 4ES1A 4BS2A 4OX8A 3TAQA 4IQMA 1DQ8A 4KH1B 4GC6A 2DGQA 4FYXB 2P5VA 1NK8A 2LECA 2HSEB 2O1PA 3C15A 2F65A 1QSLA 2DNPA 1WI8A 3TZWA 4HHHA 4F4ZA 3EUNA 2GGPA 4XPEA 3UW1A 3BGOP 4GRSA 1M5VC 3H4DA 3FSXA 3G2XA 2UUTA 4DV1F 1Q53A 1REVB 3ZC4A 2XS7A 4J37A 5A6PA 3B82A 3KFWX 4IFYB 2GHVC 2GQQA 1GMVA 4LRBA 3CT9A 4CO2A 5F8IA 4KAIA 2ZH3A 2MZTA 5B0DA 5C24A 2FC9A 5D4OA 1R43A 1IKXA 3DI6A 2YNFB 2NREA 4IYQA 3BN7A 5KT2A 3MECA 1WEXA 3QIPB 3BGRB 2HQ3A 4HVZA 3ZTRA 1FKOA 4IDKB 1LWEB 3NS5A 3CTRA 4YY3F 3KK3B 5DJBA 2GS8A 4HT7A 4M5DB 1SL1A 3BSNA 1YBTA 4TNOA 2DGTA 2VA2A 2UU9F 4ZLJA 1TUVA 2HKEA 3IGVA 2YKMB 1YJWS 4JI4F 1Y7PA 4FVCA 3NS6A 1FK9B 4CLPA 5KFXA 5CYMA 2J8AA 3MMAB 2HIQA 2IRYA 4KRWA 4ZVHA 3OLAA 3M8YA 3VCDA 4ED4A 2PIIA 2F1FA 3P6YC 2B7BB 2RF2B 4OZ2A 1KRPA 4DEZA 1UVLA 1S97A 3JTNA 2Y0SD 4DZDA 3KK1B 1U2FA 4DN0A 2H5IB 5E3AA 2NZ4A 2V69A 4LFAF 2YWGA 2BYCA 1I1GA 3KDOA 3SI8A 3MM9B 1SB6A 5IQQA 2DNOA 1IKVB 5A8KB 3WC2A 2HLTA 3VF0B 1BQMB 3K5PA 2HVIA 3TX0A 3H59A 1TU0B 1WDTA 1WHYA 3DOMA 1NK6A 3BPDA 2D1CA 3QAUA 2Z57B 1RKJA 2ALYB 2IC3B 3ENVA 4YHHF 2MZ1A 2DD8S 1S0NA 1KR4A 2B5JB 1T3NA 1RWVB 3O8WA 4OV6A 4DUYF 1RT1B 4C3LA 4OX6A 2HMIA 1ELOA 3ZXWA 5E7OB 1U1MA 2H54B 3GIIA 3IRXA 3OD2A 3DLGB 1KQKA 1OS5A 1J2VA 2BW2A 3K5NA 3QRPA 3A8JA 1JLAB 4P74A 3E51A 1VBKA 4QU7A 2IVFB 3UVJA 7AT1B 4LF9F 3P45B 3FVYA 1XNRJ 5HLFB 4ILMA 3GIRA 4RUBA 3CJ0A 2RAQA 3BDPA 2Q43A 2J6SA 4F2SA 2COLA 2AJ4A 3IWLA 4RW4A 2R8HA 5K14A 1FE0A 2UVRA 3GFZA 1NJWA 3CSKA 1U1RA 1WTFA 1RT4A 4N8OA 1GX5A 1C1BA 4KTQA 3QJLA 4B3RJ 4KGVB 2C42A 2KHDA 2IJFA 5B0GA 4X66F 2YNHA 2DIVA 3J81U 3JSRA 2OTLS 2KG0A 5H9EJ 1S10A 1VK8A 4LUBA 1TZ0A 3D68A 3R8YA 2LDIA 3KHHA 4DLEA 4DQSA 3CC7S 1WJ9A 3PFOA 4NLTA 2KXNB 1RACB 1E6YA 1ZPVA 2E1PA 1D0EA 4NLOA 2VB6A 1UFKA 2KT2A 4ZDNA 1FRMA 3M30B 3QGHA 1S1WA 5ETPA 4KKOB 3KUGA 1WC0A 2BUNA 3C6TB 3CJKB 2R7TA 4WE1B 3UDEA 1BXNA 4G1QB 2IMOA 5ETTA 3KLFA 2PFDA 4ENOA 5KFIA 2F8MA 4IOAQ 3LW5C 3MMBA 2W24A 3BR9A 1IQTA 4HLBA 3K5LA 3AJ2A 3PYGA 5KFBA 4NMLA 4RLEA 2IM3A 1XBWA 3J7YU 3GSIA 1FWLA 2KZZA 3NWGA 3QIDA 1VFJA 2F5GA 3ET6A 2JH3A 1D3WA 5L1LA 4F7VA 1T95A 2DBBA 2VFSA 1JKHB 2VFUA 4FBUA 5DM7Q 5KFOA 3QNWB 3MCMA 3VGTA 1K73T 4L6V3 4KC5A 3C66A 5KFEA 1IKWB 5DLFA 3EYZA 1VLYA 3MM6A 2ERRA 4UOFA 1NKCA 3MM8A 5KFQA 5L9NA 2Y1LB 2HZAA 3QGPA 4FXWA 3C6UB 1HBUA 2M0GB 4C8YA 4DQQA 1S79A 3TWZA 3DHWC 4EI2A 4ANEA 2I9SA 3CO0P 1YITS 4CH7A 3M8QB 3T19A 1PJ5A 1JB0C 9RUBA 2AYEA 2V0NA 3UN5A 1NKEA 2CPFA 2I5JB 3QO9B 2K7JA 3I87A 1LK7A 2BE9B 1Q82T 3F41A 2EXUA 4OZ3A 2HNDA 2Z8QA 1F3VA 5HN0A 4ID5A 3LF0A 2Z30B 2RDJA 3EICA 2ZBCA 5D0RA 2C2NA 1WC3A 3W64A 3A8IA 3HO1A 4C11A 2DJWA 1N88A 4FXDA 1ZBTA 2GO8A 1X7VA 2OFGX 3B4DA 2F3JA 5AJ3F 1YBUA 3L7OA 4Q8EA 1S6PB 4PWDA 4R25A 4CO4A 3RTVA 1UA1A 2X1GA 1XNQJ 3MEEB 2MMYA 4K2XA 2VH7A 1S1TA 2W2PP 2WZ1A 1XMOJ 3LAMA 3VAGA 2E29A 2W4DA 2GZOA 2DGVA 2OEKA 1CC7A 5K8OA 5KAKA 5KT4A 1RT5A 2OPQB 3HT3A 1S57A 4MT1A 1LKZA 1N5QA 3DGVA 2GX8A 1WORA 3F56A 3OL9A 4QIVA 3EVWA 2AHOB 2LEPA 1M1KT 4KGZB 1RU2A 3TZZA 3OPKA 4HHJA 3HD2A 4H4OA 2FJEB 4MYTA 4RUHA 4NLRA 2XM3A 3NXZA 1EQ0A 3LA0A 3MPUB 2QLJB 1FO1A 1ZZFA 3MUVP 1N34J 3NNAA 4ECZA 4WWSA 3RGIA 3MEDA 4MK7A 1U6ZA 3MM5A 3CD6S 1HKAA 5AE3A 1RTHB 2JFKA 4USJC 1N36J 2MDAA 1WOOA 1VJWA 3MR6A 3HMJG 2RKIA 5A8WA 2ZKTA 2VQFF 2VFRA 2UXCJ 1RT2A 3DKDA 2BQ3A 3SDEB 3QLHB 3EM1A 4RL1A 3OTOF 1TFYA 3RBZA 4ZP9A 2YPZA 3CCUS 5D4PA 2NXUA 5GAGI 4RWXA 3T9NA 4ED6A 3FFIB 2DNLA 1VIOA 4OX7A 2KI2A 4CZCA 2PMWA 1SC4B 4DV6J 5J1NA 1BWVA 4JV0A 2HPUA 4B3OA 2XLJA 1RWUA 2WVDA 3MXHP 4ZOSA 4AXIA 1JJ4A 1I51B 4DFPA 4YB5A 2I1RA 5DG8A 1U8WA 2C1EB 4K0KF 1DY3A 3WZ0A 3H20A 1FE4A 1MU2A 3LP0B 2AJ2A 1CLFA 3DCAA 3M1VB 2JVOA 3W5ZA 1YWXA 2LA6A 4F25A 3BZQA 1FKPB 1JLCB 2GV1A 1JLGA 4OQJA 4O3NA 1YGYA 4USHA 1Q78A 3C8YA 1VI7A 2VG6A 4X4RA 4DFJA 1T05B 1ZAVA 5CYJA 4DSKA 4KGKA 2IJRA 2E66A 2FHMA 2KHCA 1BGXT 3MR2A 1JLBA 3EWGA 1Q5VA 3KJVB 2R8JA 2ZFHA 3AOBA 2NLWA 2LA4A 2IVYA 1CJVB 2XMTA 3I4HX 3TVKA 2DHGA 3PKMA 3UD5A 1VBXA 3EJMA 1TAQA 1GH8A 4NXMF 5K8MA 1I5OB 3G8QA 2B4VA 5DGBA 3KUHA 5GAHI 4DR1J 5EGYA 3TZYA 4KHRA 3RBEA 1KEKA 2ZDOA 2D74B 1BY9A 1S1XA 4B08A 1HQEB 3TA0A 3TUPA 2F9DA 2RDIA 4UUXA 1URRA 1WNEA 3M8PB 4URQU 4C0BA 1EKRA 2BVZA 3CDBA 3POTA 2FTRA 2GVZA 4HYKA 2X1AA 2RU3A 1S99A 2C2RA 3ILJA 2R3VA 4YEAA 2HG4A 4ZCMA 1SL2A 2BANA 2VBXA 5GAGU 2IIHA 3OQ2A 3TAPA 3IFEA 3TAMB 1UWBA 2KJWA 3P8BB 1J5OA 3ILOA 4JI0J 4KGXB 4HDHA 2DGSA 4U7CA 4Y2MA 2FHOB 1RAFB 3E01A 2KXHA 2VA3A 4O4RA 1KHWA 4ZCLA 4S0MA 1G1XA 2V2KA 9ATCB 2IBOA 1MMDA 1YJVA 4L75A 1ZOTA 2HK2A 3D5MA 1H98A 2DH8A 1QAYA 4OLOA 4DX8H 3E3XA 1SIZA 4ICLB 1Q16B 4JI8F 4N7TA 1ZYQA 3D4JA 2XQCA 1TKZA 3AFGA 4LF6F 1X9SA 5KFNA 2XMWA 4DZ6A 3UFCX 4I68A 1E6VA 2R8IA 1FA0A 1YQHA 2HNYB 1H7XA 4MKVA 3BKFA 2MQQA 3RRGA 1WSVA 4B02A 4XTTA 4RW7B 4NZ7A 4EZ6A 1SPBP 3ZNUA 3PJXA 4WCEQ 4X4SA 3HI9A 2MYFA 1MNEA 1IXKA 3G96A 3CCZA 2B9EA 3LALA 3CCJS 1F60B 4QCLA 2X1FA 2L41A 5G0RB 1FFGB 2DKOB 4DR3F 2VC1A 2BMBA 3I6PA 4RNMA 2KM8C 1H7WA 4DV5F 1CVJA 2FY1A 3GMGA 3LP1B 3AY0A 4WFAQ 3C3LA 3EPIA 1REVA 2XI2A 2E44A 2M3DA 3I0RB 1GMWA 1S12A 5BXIA 2LU2A 4IFYA 3B54A 4YB6A 2CZ9A 4LBHA 1WI6A 6FDRA 1X9MA 2QMXA 2VC0A 1RLCL 3H98A 1PC5A 5GMEA 4KHPJ 4MJKA 4RWWA 2YNFA 4B9LA 1X5OA 3HVTA 3C16B 3H8YA 2P8IA 3P5BP 4X4TA 2HLUA 3HT0A 3CW2C 5B0AA 3ULHA 3HHKA 5KFDA 5KT7A 2EKNA 4GVBB 3GTYX 2HGLA 1LWEA 1AFIA 5KG7A 3KK3A 4ZLNA 4QWCA 3MOJB 2C3OA 5F3TA 3P96A 1SJQA 5KOWA 1ICEB 1M5PC 3TVZA 4W4MA 4USTA 3KXDA 1CEZA 1IUJA 2YKMA 1LV5A 2DGWA 3OFEA 1NDCA 3QFWA 3OXFA 3MAQA 4DL6A 1FK9A 1HNZF 1OYEA 3MMAA 1HBMB 2POKA 4CTAB 4DI6A 2YWHA 2KYXA 1VQSA 5HMWA 2W2NP 3QWPA 3DHXA 3NGRA 4NYPA 4AE5A 5D4NA 2DPJA 3M6XA 2XYGB 3KK1A 2KO1A 2NR0A 4CI0B 4LFCJ 4DV0J 2RHQB 2RS8A 3LGMA 3QSYB 1G3OA 4O44B 2NXCA 1N5YB 4NLGA 2VPWB 1EJ7L 4WXOA 3HHDA 3MM9A 3I5AA 4H4MA 4YOEA 2E5LJ 4I69A 4NWBA 2EW9A 1U6FA 2B9XA 3JSMB 1WD6A 1BQMA 2VQEF 2G1HA 2UXDF 4NE9C 1HR0F 2GVDB 2MY7A 4F36A 4XDCA 3WBZA 4OHXA 2IC3A 3GJRB 4MFBB 3VAFA 4B3MF 5LL6d 3M6VA 2ZEJA 1OYDA 4Q8FA 3K89A 1FDDA 4WTYA 3ZZRA 2B5JA 2D3ZA 3PZPA 2O01C 2FLPA 4DV7J 1RT1A 3MPYA 4OZ1A 3PTWA 1T0TV 1UJ5A 2R7XA 1YJ9S 4U67Q 4DPYA 4Y2IA 1KOHA 3V6DB 1LXJA 5A6WA 5J2NB 5LMNF 3W2VB 1JLAA 4QR1A 3K58A 2DCLA 3M9MB 2C22A 4X64J 4OHWA 2ZZNA 1O6XA 2PO4A 1OY6A 2L9WA 2CPIA 4QW9A 4LFBF 2PI4A 1BHNA 1N33J 1A7GE 5J2QB 2CJYB 4RR5A 2CZ4A 4OL8A 2A1BA 1Q7LB 3SEOA 1RTIB 1Y0HA 2ZBIA 4JP8A 5JXSA 1IR1A 2BRLA 3QJPA 1U02A 1LWFB 4ZPDA 3JTOA 1TL1B 2CJAA 1G7CB 2WVFA 2XSJB 5IOLA 2N4CA 4UZCA 1S4EA 2DHAA 4EFAC 3MAHA 1NDKA 4B9VA 2APOA 3T6BA 2YKPA 3D2WA 3DU6A 2FJDB 1RHKB 4NYZA 3UQSA 2HBZB 1AT1B 4LSLB 4ED2A 4K59A 5IV3A 3R3TA 3TZXA 3DLEA 3JS9A 3W65A 4CIOA 3KHRA 2HIYA 4ITSA 2NQPA 4EYIB 1VQ6S 4KKOA 3CCQS 1SC3B 2CA9A 4MMOA 1TVRB 2ASJA 3CJKA 4IQXA 2XMUA 4TY8A 1B99A 3W2WA 2C3YA 3TQEA 4G1QA 1GNKA 4KH0B 1ZH5A 2MQ8A 4NRTA 2E9TA 1VR6A 2WONB 2PA3A 4KR0B 2ZHAA 1RCXB 1B3TA 4WXWA 2Q3PA 3TW0A 4UUWA 1OPIA 1UMJA 3QGIA 2OD4A 1MLAA 3BSOA 2QZ8A 3S1TA 4P2FA 4CLZA 1WKJA 2DR8A 1NEEA 3CCLS 2J9EA 3SSRA 3IAS9 4XIUA 3JQMA 3MOZA 2W4CA 2NXJA 4CNYA 3T5LA 1SIWB 2HRTA 2LFVA 2B8PA 1SH3A 3NOGA 1URNA 3UI3A 3AB4B 3BDEA 2UP1A 2D69A 1ACMB 4C0HA 1JLFA 2DRAA 1JKHA 1X4HA 3HKWA 1NSPA 1EHWA 3NGTA 1XTZA 3JSBA 2A2CA 3A3NB 1XC9A 4DX7A 1SKRA 1JJ2R 3KLGB 5C7PA 5I3UA 2XHWA 4U95A 1AUDA 5KFUA 1OY9A 4RNNA 2G1DA 4JI2J 3C6UA 4DV3J 4G1PA 5FDLB 1JQGA 4J9LA 3CD5A 5LJ5Y 1F9HA 3MFHA 4AL7A 1T9VA 1HYSA 3H5YA 2BV3A 2CQCA 2Z4PA 3C19A 3HHLB 4EMDA 3CF5Q 4ZVFA 2DEIA 3LP2A 2NPIA 3QO9A 4WTOB 1D09B 4IFVB 4WU2A 3MDFA 4F50A 3M32A 4ER8A 3KHLA 4U96A 2CQBA 4ZS6A 3KOAA 4C8ZA 3H2UB 3GIKA 4OZ5A 1RU1A 4FP9A 2QLBB 3T9ZA 2HQCA 2DNKA 1HFEL 3A4TA 2HHWA 3PDNA 2H4WB 1QUVA 4LF4F 1N0UA 5EHHA 2L3MA 3HKZD 1I94F 2OEJA 1UJ4A 4J5OA 3M8RA 3AA9A 3RB0A 2BXJA 4CYUA 3NBPB 3G8SA 5KFJA 2BJ9A 2XY7A 2UXBF 1FX4A 4YN3B 4M5IA 4ZJLA 1L3KA 3AB2B 2H1YA 4K4YA 4IUFA 5HK4A 1OSDA 1HBNB 1U8SA 3KLIB 4G65A 3NCQA 3T1YJ 3GPAA 4ERDA 2XTJP 1TKTB 2GJ2A 3FZBA 5IZHA 4Z37A 3GR1A 4FZVA 2VPYB 2I6WA 5KG2A 2AWZA 4PEOA 4YR3A 1W2BR 2E1CA 2HBRB 3L95X 1F3FA 2DR5A 4P72A 4OJHA 4DUZF 3CJ3A 5J2MB 2RD5C 1FXLA 4ELVA 5I4MA 3KMQA 3O6QA 4C8KA 4I56A 4PYAA 2VDHA 1KFSA 4J9UE 2P6SA 4B3TF 1GQEA 3GYGA 2AX1A 4F2RA 4PXEA 1YJUA 1Q8BA 1VGYA 4U8VA 2WOMB 3D1HA 3SDEA 2YY3A 1WOPA 2BBEA 3HVWA 1FJGJ 1RT3B 2V8HA 2ZJQQ 2R7SA 3ENWA 1Q86T 1NO8A 2B56A 1UL3A 2JJ4D 2H5EA 5MAOA 1WEYA 1PGZA 1EKSA 1GXLA 3JAMU 1S9FA 3MTJA 8RUCA 4Q2LA 4PXCA 4OX9J 2IHR1 5KFTA 3C2PA 2Y3YA 4GO5X 4DS5A 1NDLA 1HQUA 3L09A 3DI6B 2LQJA 3LP0A 1DTTB 2DHHA 1HBOB 3I4PA 3HD1A 3IXQA 1B70B 1NCLA 3M1VA 3IR6B 5KFRA 1FESA 4U8YA 1SL0A 1FKPA 1JLCA 3PW4A 1TL3A 4ZCKA 2DISA 5BR8J 3VZIA 2OELA 3ISZA 5CHCB 4OJGA 5KFLA 4UW2A 3BBBA 2V2QA 1VIXA 5DZ7A 2ALZA 1F6TA 1JIHA 3W66A 4PXDA 1L3UA 4ELTA 3KJVA 1M5KC 4BC9A 2MHEA 4DBQA 5BJRA 4C98A 1CJVA 2XNQA 3UN3A 2QN6B 2OEMA 1F0XA 5C2CA 4QIEA 2YTCA 4RZRA 3HFKA 2VD3A 2RQKA 4JOUA 2DEJA 1OIAA 3ILIA 1NZ8A 2WBMA 1M5HA 2XNRA 2HQGA 2KJVA 3W3SA 5F8LA 1HQEA 4IRDA 1SUQA 5CQGA 4DPTA 2MQOA 2RRNA 3ILLA 4CCHA 3BGFA 3M8PA 2V68A 3ZZOA 3CJ8A 3VHQA 4RW9A 1TUGB 4CNZA 5F8NA 2FJAB 1QAIA 4I6AA 3K2YA 2W7OA 4YMEA 3SCKE 5GMDA 1WG5A 1IM4A 3M8WA 7FDRA 3TQ1A 4DL3A 1QAJA 4JV5J 1P1TA 1WHVA 2O3DA 2YWFA 4HEA9 2I8EA 1CQNA 1VJQA 4HTIA 3K5OA 3L7UA 2ZDPA 3W62A 3OXLA 3QRRA 4ZP7A 4M5KA 3MTKA 4UZBA 3N5BA 3TP2A 2DRDA 2GA7A 5DQGA 2JEGA 2CPHA 2G0CA 5DO2A 5L39A 4DU7A 2HMIB 2HK3A 4BLGA 2FY8A 2UUCJ 1TV6B 5FLXU 1ZZNA 2HFUA 4ANCA 4TU8A 2PGCA 5L9XA 4FN5A 3UCZP 1Y9OA 1TK0A 3MD3A 2ZM6J 1RAHB 4FF1A 3ONQA 4F02A 3I9ZA 2VZ9A 4QWBA 3SZ2A 1TL4A 2XCAA 2RDDA 3R7SB 2HNYA 4DSFA 4HHUA 2KT3A 4RW7A 3PHEA 3SFUA 3QMQA 4B17A 3P4UB 1XNRF 3DRRA 5K14B 2MZJA 4HI2A 5EDWA 3AXKA 1X4GA 1HNWJ 2VBWA 3DC2A 4H4KC 4DPOA 3CMQA 4C2MA 1C0UB 5G0RA 3OXGA 4ED7A 2YNHB 3W60A 2LQBA 1RABB 3QPIA 3QT8A 2HHSA 4DPUA 5KFMA 2XWYA 3MPWA 2O67A 4B3SJ 1YRXA 4C8OA 3HX9A 3FCWA 3WC0A 2EKYA 3LP1A 4B3RF 4EO8A 2ZH1A 4X4QA 2HHUA 1RT7B 3NL0A 2KT5A 4IOBA 3FEYB 4QR2A 4P2MA 2CQ3A 2K06A 2K1RB 2OKQA 5LXYA 3Q8RB 2XZDB 2CVIA 4X4VA 1HLWA 1NXIA 2OSRA 3KLVA 3MGJA 4PABA 1E6YB 4QZVB 1FHTA 1DBDA 2CPDA 4NI2B 4WP9A 3AD9C 1F2GA 2BJ3A 5BYRA 2HQFA 4A8QA 3OL8A 3OTBA 2QLWA 3C16A 5F3ZA 2A6OA 1GAOA 3UPFA 1MWQA 3TUZC 3PNIA 3R6LB 1YX2A 5KFKA 2MQPA 2R7QA 3OV7A 1BQNA 2N82B 1R0AB 3KLFB 4GVBA 3RBXA 2MXYA 4CO1A 3TA1A 2J6TA 3UD3P 2BR0A 1XR7A 5FLXY 5LMUJ 3MMBB 4M5GA 2J9DA 2W9BB 2AJ1A 4OI6A 1NPPA 3HHEA 5L1JA 1T9TA 3BKTA 2YWEA 3HHNB 2VBYA 4TLRA 3MUMP 3AJ1A 1UA0A 1FCAA 5E2QA 1HIYA 4JUZA 1SJFA 1HQ2A 2YKNA 5KFVA 1UPPA 3MMCA 5AXNA 1HBMA 3DFEA 4C4WA 4NA3A 1R0CB 3FGVA 2V4RA 5IT0A 5CD4A 1JWWA 3OHBA 1B0PA 1N8RT 1GFWB 2UU9J 3KWMA 3THVA 3MM6B 5ETMA 3T5KA 1U2CA 2H65B 1ULRA 4ECVA 1RBAA 2XLKA 4LMZA 3NCRA 5KG0A 2KL8A 4O44A 2FJVA 3JTPA 4ILLA 2DO4A 1N5YA 4R5PB 2ILZA 3DLJA 3DM2A 2HRYA 2QA4G 1IBKJ 3SIPB 1KP6A 1F1BB 3CD0A 4CH0S 1F5BA 5F0WA 1S4FA 4C3MA 4CT9A 2F4VJ 3JSMA 2H5JB 1AFJA 3PYDA 4LSNA 1WG4A 3HZEA 2LP4A 2GVDA 4MIWA 1GMUA 4GMKA 4ID5B 2BACA 1R6VA 1Y00A 2FLNA 1PAUB 4F3OA 4PCQA 2KFNA 1HMVB 4C9DA 1X5PA 3LAKA 5KFZA 2QV6A 2WK4A 3MM7A 2CPEA 2EFQA 3RU0A 2HFVA 4NXNF 4BWMA 4URSA 3IO1A 4ZLLA 2CG8A 3G86A 1D8YA 1GTEA 4O4GA 1S1TB 1VISA 4U9RA 5DETA 3BJYA 3V6DA 1V5VA 5J2NA 3W2VA 4X4NA 4ZVEA 4CLYA 2C2EA 5DDQC 4C0OC 1XNQF 1RT5B 3TR5A 2LCWA 1LFPA 1XMOF 2CJQA 1RWMB 2HHHJ 2M88A 2VICA 2OJ3A 3NY0A 2BOAA 2J76E 4RPFA 5A0YB 4H4OB 3EZ5A 3MHYA 4ECTA 1RTIA 3JQJA 5C2GA 1KHVA 2JC0A 3CMAS 4NRUA 3M9NB 2WVCA 2IM2A 1NKBA 5DDOC 1LWFA 3T1AA 2MZQA 2OMLA 2FVQA 3CCSS 2IA6A 4ECWA 2FDNA 4Y2AA 4P75A 2I2YA 1RGVA 2CQ4A 4WYLA 3K5MA 2W9CA 2QMWA 3QT7A 2D3O1 1MG7A 3QQCD 4LF1A 3MFIA 1N34F 2EBEA 4EEYA 5A8WB 4USWA 1HPZB 1I3OB 4LSLA 1Q8LA 3O44A 2CAJA 4LQ3A 5KG5A 4NYOA 4ECQA 1PAEX 2A0FB 3H5SA 4JI3J 1N36F 5ETVA 2ZH5A 1RBOB 4OV1A 2CQ2A 1JNZB 2AYMA 3TJAA 4JYAJ 2DR9A 2DYAA 4C48A 2IYGA 2LMIA 2UXCF 1KLMB 1TVRA 2ZHBA 1GXTA 1BUXA 3KG1A 2XY5A 1L5UA 3D1OA 3BGLA 1R0BG 3OL7A 2WONA 5E33A 4QIGA 8AT1B 1PYTA 1DJ0A 4FYWB 1X0PA 3MF5A 1DFDA 5KFFA 2UUAJ 3MD1A 4RBTA 3HZGA 4DV6F 2CUYA 3GWCA 4Z7CA 2HS0A 4I1TA 1MU2B 3QFHA 2NUUG 2J0SD 3THPA 4M63A 4M5NA 1FWKA 3BO3A 2HHTA 4WJBA 1TQLA 3GONA 1RSCA 3PO5A 4L76A 3UD4P 3KJQB 2GMJA 1JLGB 2A18A 2V5HG 2VG6B 3OR1A 4CRJA 2EPIA 1UFLA 3R1HA 5HL7Q 1K47A 1UPMB 1NSKL 4Y2CA 2VOPA 4PQAA 3O3LA 2R9LA 3LGNA 2OD6A 4OYXA 1U0HB 3RR7A 3VAMA 3N28A 4XK8C 1F2HA 2JVRA 1XN9A 3Q83A 2V8PA 2QE5A 3FEXB 3IBCB 3MZIA 3SXLA 3HHLA 3N6MA 2DITA 2P6TA 2EBGA 2KVQE 5BYQA 4JV1A 4IFVA 3CGIA 3ZFVA 4J9OA 4J9MA 1DZ5A 4NLVA 4ED3A 1M90T 2XMVA 5MLCV 4KBIA 3QT6A 4WZQA 2PMZD 2M4MA 2WCXA 4HACB 2XC9A 4DR1F 1FJ7A 3LANA 3OR2B 5IM0B 1LW0B 4X84A 2Z2MA 3PW7A 2GVZB 2ZH9A 3PX0A 1TK8A 2OGUA 4RO0A 5BYSA 1HHTP 2BANB 2CQ0A 2YVSA 2DGUA 2OP5A 1QD1A 4WIQA 3O1LA 3SCLE 1UWBB 2ZKUA 1M5SA 5I42A 2DGXA 4OYBA 3CNQP 3KJNB 2CJXB 1YRTA 5C25B 1UW9A 4BCAA 1CC8A 1HWKA 2ZVIA 2LQ8A 4AUKA 1RAAB 2FHJA 1HBNA 3KLIA 4NA2A 3LGHA 1NPRA 1K9MT 3ZZPA 4LVOP 4JI0F 1TKTA 3KLEB 3CDUA 4OYIA 4K5SA 1WF1A 2VASA 4PUOB 3UDLA 3KK2B 1MW7A 4M8LA 1WEZA 1P27B 2RNEA 3O5TB 3W1YC 2XHCA 3K0JA 5IFMA 5J2MA 1NZAA 2JLFA 2NZCA 3PJWA 1FFWB 4GKKJ 1E6VB 3J80U 2C28A 1Q7YT 3JB9k 3MAAB 3FMWA 4I6YA 1QTNB 2ASYA 3OVBA 4NEYA 1EB0A 1BQXA 5M2RA 3DDKA 4RBUA 2Y1JA 2KXFA 4NLUA 2GJIA 4QYRA 3M6UA 3H42A 2WOMA 1KVKA 1N6QA 3FCVA 4RNHA 1GTHA 1TMMA 1RT3A 1IWGA 4UQTA 2RRAA 1SH2A 3F73A 1EIYB 3R27A 1AZSB 3UN2A 2G0IA 4QYZJ 4HDGA 3CCMS 1EAYC 3FC9A 2BJDA 4L74A 1VRTA 4H54A 4ZKAA 1BMQB 2JHEA 1NJYA 5EX3A 2W7AA 1YI2S 1VRQC 3CJRA 3P3DA 2H9ZA 4L3KA 1FVQA 4U6PA 1VOMA 5IT9Y 2IBKA 3PV8A 4RNFA 4X65J 2X7IA 3QT5A 1W25A 5K8PA 3HVTB 5ITHA 4I2QA 1HI8A 1DTTA 2WSFC 1YZ6A 2K8GA 1HBOA 1RISA 1Y5IB 1NHVA 3BR8A 2BDPA 2E5IA 1HNXF 4UOGA 1Q5YA 4AYBD 3NMRA 1FDBA 3CCWA 2E5JA 4KHPF 5HVFA 1FRKA 4A48A 4K0KJ 2ZUGA 1PCAA 3EGNA 4ZJOA 2AGOA 5M2PA 3I82A 1GK8A 1PILA 2CJ9A 2AU0A 5ADZA 3K57A 2GMLA 4O3PA 1ZS6A 4NL5A 3N4WA 4DL5A 4WFZA 1AB8A 1NHKL 3V81A 1WDDA 2KU7A 5K9FA 2LEAA 1H2VZ 3RR8A 5KT5A 5D4LA 5LJ3Y 1NHUA 4LR8A 2Y1IA 2VF3A 3HCXA 2V4QA 2GQ2A 2NCKL 2DGOA 3M8ZA 2PDAA 1VQNS 2OFHX 2J0XA 2OPSA 1B0TA 2VU5A 2AV5A 1PKUA 1MMLA 3PYFA 2YX7A 3AODA 1YSJA 4C97A 1ZTWA 1ZTTA 2HHVA 3WQPA 3NP5A 4UQGA 1SQEA 4LFCF 4H4MB 2YNGA 1IVZA 4DV0F 2IRXA 3J7ZT 3OHAA 1VC0A 2R8KA 3RJMB 3SCJE 1OPZA 3NGSA 4JBCA 1LNQA 2QA1A 1H2UX 3CCES 4LR7A 4DR5J 3ELHA 4M5LA 4ES2A 1HNIA 4UY85 2E5LF 1QE1B 2UVWA 5ETRA 4ZVPB 2KFYA 3IBWA 1Z4UA 4JI7F 4A47A 3PR4A 1N32J 4Z7YA 2QA2A 4O3SA 2DCUB 1JLQB 4P7TA 2E1AA 4J9QA 1M1GA 1TV6A 3PYEA 1AUSL 5H1SV 2EG2A 3W9HA 3DRPA 2VBZA 4HR2A 2PC6A 3A3PB 5AE1A 5A2QU 2HWTA 3W9IA 2A2DA 1FI4A 1HARA 3U02A 2YQ0A 4K4SA 5FD1A 3KDNA 3DLLQ 4X64F 2DHXA 3Q8QB 2RQ4A 1D9AA 3GFXA 2XO6A 3FMBA 2J8SA 2YXLA 3N5FA 2Y8WA 5HQ8A 2F9JA 1N33F 3LQVA 4YQWA 3H40A 1C0UA 2FB0A 3IWNC 2MPUA 4I0WA 1TKXA 2HFOA 2R4FA 1SI9A 1HWUA 3AD8C 2HFSA 2CDRB 3CJ5A 1V3SA 2QFIA 1NK5A 3GJQB 4EBCA 3I56S 3GCWP 5ETKA 3H0PA 2P2CB 4PG6A 2QEXS 5LXRA 1RT7A 3BO2A 4PG8A 2K1RA 3VGVA 1FTCA 4R0JA 3CMES 3DLEB 2VHGA 2B51A 1KLNA 4I67A 2ACYA 4NI2A 4DR2J 1R8AA 1D8ZA 1PBUA 2GFFA 4XDDA 2F8EX 1SJ1A 4DL4A 1IKYB 2MB0B 2AEMA 4N41A 1TELA 4TY8B 3W2WB 1RWOB 7FD1A 4KB7A 1NK9A 3CUNA 2MLXA 2NSBA 1F9FA 1DQ9A 1R0AA 2CPJA 3GIJA 3LWLA 2FIUA 3EZOA 4J9RA 2QA4S 1ZA2B 2MKIA 3BBCA 3CJ4A 2W9BA 1V5IB 5F9LA 4ZVGA 4CLKA 2X51A 5A2QY 2ROPA 4EBEA 3G71S 5IWAJ 1YK9A 2CQDA 4DL7A 2UUBJ 1BD6A 4ZVTB 1H0HB 3Q23A 4R0EA 1HI1A 1KC8T 2M5YA 3V2UC 1U48A 6AT1B 1JLFB 2XYHB 2XSFA 2ZZTA 2KRBA 3HJVA 1XJWB 4I7FB 1RAGB 1FT8A 1GMWD 1YG0A 2KYZA 2MY8A 1LOUA 2QIFA 2OSQA 4TN2A 4Y65A 5I3UB 2I38A 1NH7A 2E7WA 2CFXA 1VQLS 1D9DA 3AQPA 2HVZA 3MURP 2HW3A 1P9YA 1CPZA 1HYSB 3AHPA 3J81Y 2PT0A 2V8GA 3ZTSA 4R5PA 1QJHA 2IM1A 5HANA 3UCUP 1NK4A 2YX1A 1UEKA 4JI2F 2HFZA 4DV3F 3R5BA 1LFWA 3LP2B 2XULA 1VCTA 4JB8B 5AXLA 4DR6J 4NCGB 3KG0A 5D78A 2YNIB 5JVGQ 1WHWA 2LU1A 3M32B 1UVMA 1LWXA 4KSEB 4DR4J 3ZO7A 3CJ2A 2BQRA 4LF2A 4F0KA 1HMVA 3RRHA 1T7PA 2EFOA 3L4BC 4OZ0A 3WDOA 4R8UB 3ZZYA 2YBVA 5D15A 4ZP6A 3DLHA 1JMTA 5JUMA 3LWMA 3FBEA 3OTEA 1VQYA 3SQGA 1TFWA 3ZZZA 4V19J 4FS1A 1CS4B 4CYUB 4IOCQ 3BKUA 1CG2A 4IRCA 4IO9Q 3D67A 1VBZA 3IN5A 4D3HA 2VFVA 3OUYB 1VQPS 3OL6A 4P2SA 3FK4A 1O5JA 4K8RA 5A0YA 2WBRA 2WTFA 2JOQA 4EBDA 3PCOB 5U47A 3UCGA 1WKLA 3VWSA 1W7WA 4FNHA 2JWNA 4Y28C 3CC4S 3D6HB 2AEFA 3CDAA 3T1YF 4DWIA 4WP3A 3KLHB 3EZUA 4O0NA 2IYIA 3TJ8A 4AFFA 4K2JA 2J9DE 1Z2ZA 8ATCB 1HWJA 1IBMJ 2CIMA 5CA5A 2VIHA 5L46A 3NG8A 3T5JA 3BV8A 1KSPA 1HPZA 3ZNJ1 3RB6A 1S77D 2KB2A 4DV2J 1LWCB 2WW4A 3DXSX 3QZ7A 1HD1A 1RLDA 2QYCA 5HP1B 3RB3A 4KQZA 2ATCB 1FRLA 4DR7J 4Z2XA 2QC3A 2HS3A 4F67A 5JJBA 1NJIT 2XCPA 1Q95G 3PJ9A 3FDSA 2NS1B 1KLMA 2FJXA 2J7WA 4CO0A 4C3KA 1XEZA 2GQCA 1O51A 4NA1A 4V1Ak 3HDSA 5GMKa 3T41A 1FJGF 2ABYA 2Q66A 2HWIA 1SV5A 1UCNA 3AA8A 2V67A 1FERA 4DFKA 1S0OA 4LR9A 2X3GA 4DV4F 1PIEA 2GMHA 5K8NA 2DHSA 1H6KX 2Q1LA 3EE3A 3HPOA 1K8AT 2IPOB 4OIXA 1HQUB 5J1EB 4KT0C 3OVAA 5JMNA 4OX9F 3SSQA 2VG5B 3IBFB 2DNMA 2MGZB 1CQMA 1ZM2A 2FJWA 4ZPBA 5T7LB 4CLLA 1CJTA 1UP1A 4EK2A 4N5SA 2NSCA 1RB0A 3VAHA 1TL3B 1WC1A 1HA1A 1NB2A 1HL6A 3BSAA 1VQ8S 1TR0A 2E1RA 2HNZA 1X4AA 2CDQA 3GCXP 4LF8J 1SCJB 1EETB 1U0HA 1QM9A 5HJYA 1RWKB 5BR8F 2YWWA 5AXMA 2WW8A 4ZJQA 3G4SS 3GSDA 5CABA 2FPHX 4CO5A 3MEKA 2JSXA 4FF3A 4K50A 1IBLJ 5HROB 3U1LA 2PMHA 4GKJJ 2CKWA 2Q6BA 3UNGC 4J9PA 3Q8SB 5CH7B 4FYDA 1S7HA 3ZTQA 3BQ0A 2JEIA 3I9V9 1FVSA 4FKXA 2O5DA 4KYZA 2A3JA 3CCRS 2NXNA 5EN1A 4HACA 5F8JA 1SUQB 3IAM9 1UFWA 3UNYA 3KNGA 3W5XA 1YJ7A 4ECRA 1RT6A 4KFBA 4RW9B 3OR2A 5IM0A 1LW0A 4O3RA 2HHXA 4OZJA 5SUHA 4ZPCA 2PI5A 4A8OA 4Y34A 5T41A 2AZ3A 3P5TL 2MZRA 5GADI 3VQSA 3IA0A 2ZBQA 2XBPA 2F40A 2AIRB 5DLGA 4ECUA 2MEWA 3CPWR 1UVNA 5SZTA 5HATA 4I2PB 1X5SA 1Z1ZA 2QG9B 1FRHA 5C25A 2C3PA 1DQAA 3J7Z5 4OJ1A 3BF4A 2CXEA 4JV5F 3WX4A 3VZHA 4U7UK 3OVSA 4I64A 3OJSA 4X62J 3MR5A 3KLEA 1DTQB 2MLZA 1OSCA 2CQPA 3CJQA 3OFFA 1KTQA 3PXGa 4PUOA 4ZHRB 2MKHA 1YVFA 3KK2A 3VV2B 4PWWA 1KQGB 4IG3A 2UUCF 1YKWA 4PYDA 4KHMA 1K0TA 1SKUB 3EXYA 3VVUA 2EFGA 4JI1J 3BEGB 2IY5B 3M7VA 3PR5B 2UZAA 5FIIA 3MAAA 1VHIA 5DQIA 4JV2A 2HYIB 2ZM6F 4Q0BB 2FVSA 1ZM9A 1NRKA 3DOKB 4DCOB 4IRKA 1Y10A 1V9OA 5L1IA 2VKRA 3DRRB 4NCAA 5DDPC 4DDFA 4J91A 2KDOA 1S7IA 4RUAA 2FZKB 3IR5B 4KO0A 4PG7A 4WK1A 5HVHA 3EDQB 1QSYA 4OI0A 5GAEI 5AT1B 3W9JA 5GAHU 1JK9B 2XMKA 4KE5A 1HNWF 1AZSA 1W26A 3N0VA 5RUBA 1S48A 1HI0P 4DX6A 1S6UA 3CVKA 4IO1A 2XS2A 4LSZB 3K7RA 3TRGA 5DRKA 3BS9A 4U7UD 4CLSA 3QBCA 3PACA 2OHDA 3C14A 1C1CB 2RILA 4B3SF 3JYTB 3IWXA 2QLFB 4HT5A 4AQYJ 5HMYA 6FD1A 1RHJB 4AT1B 5GADU 4QWAA 2HQDA 2MKKA 5DGAA 2G2YA 3GV7B 1EX8A 5KG6A 3IS9B 2A10A 2ZNZA 3B6BA 5IV4A 2KH9A 4LREA 2FUG9 3NOCA 1BQNB 1VDHA 2EK1A 4OI1A 2GAGC 2ZWOA 1VBYA 1KFDA 1RAJA 5F0UA 3VQTA 5F9NA 3QYYA 4ZVOB 4TY9A 4I4BA 4UOCA 3S7RA 2CNOB 4MKYA 4OZLA 2CWKA 1Q8KA 5B7WA 2QL9B 5LMUF 3PO4A 4E8UA 2E5GA 4OYPA 2YKNB 3MMCB 5B0CA 2KVIA 1U25A 3LTOA 3RW6A 4DQPA 1XMQJ 3L9ZA 4F26A 4OJ3A 4ZPTR 3PRBA 4N8NA 3MEGB 4PAAA 5J1PA 3R2CJ 4FF2A 5KG3A 5HBMB 3GJSB 1RTJA 4LF7J 3IGNA 4ZVRB 3R7NB 3DGPB 3U1MA 4RW6A 3ZZUA 3IMQJ 4P6QA 3TUJC 5JVHQ 2BOPA 2RB7A 4G1IA 3OSPA 3ISND 1R8PA 4LJMA 4O23A 1HNVB 1RI7A 4N47A 4ZA1A 1REGX 3GQCA 3DM2B 3FBFA 1TL5A 4QPXA 1S1UA 2XEXA 4W90B 4NLQA 4ETZA 3CC2S 5K20B 1FNOA 5GAEU 2V6AA 3FKBA 4LSNB 1DLOB 2K2PA 4EYHB 5IC6B 4PG4A 2WSCC 1IBKF 4DL0C 4F0HA 4QPTA 2HRUA 1QE1A 5B0EA 2DRBA 2W4PA 2F4VF 1KOOA 4Y0FA 2C2ZB 1DAXA 1N5TA 4MTPA 4MH8A 5T14A 3MM7B 4B9UA 5DG7A 4NPOA 4DMZA 3I5BA 1JLQA 1L3TA 1R3NA 1A0OB 4Y2KA 1GX6A 4O4GB 1ZAXA 2Z58B 1FRJA 4HTJA 4F0MA 3OTCA 3NNCA 2DY1A 4M95A 2OPPB 5ETQA 1Y5NB 2YKOA 3MMJA 4YUDA 1B64A 3CD7A 1OO0B 2P9GA 5E3QA 2ATLA 3M4XA 3OFHA 1J5EJ 2CVEA 4ZN3A 3D9BA 2VONA 1QTMA 4DHVA 4FYVB 2CWXA 2E9ZA 3J7YI 3D6TB 2ZBRA 3HP6A 3CEDA 4K5RA 2PN6A 2HHHF 2Z0GA 1WWHA 3T1HF 1X0FA 2J5AA 3U27A 2HAIA 3GZ7A 1BLUA 3KTQA 2XS5A 3K8VA 4X4PA 2JNJA 3AH6A 3LOUA 1Z2LA 5M2UA 2W9CB 4NCBA 5E41A 3OW2R 1VQ9S 1JJHA 3MI7X 2D3UA 2GIFA 3LH2S 3H25A 2CRLA 2QRRA 1S6QB 4DSJA 2ZC3A 2V50A 3BSCA
chains in the Genus database with same CATH topology
3GWCA 2XMTA 3R1LA 4OHYA 1EP4A 2HS0A 3I4HX 4I1TA 2C2DA 1LXNA 3TVKA 5DDRC 2DHGA 1MU2B 4PR6A 3PKMA 1FNMA 4QQBA 1S6OA 1X4BA 3GR0A 5F8MA 1K0VA 1VBXA 1TAQA 4TYBA 2NUUG 4WFBQ 4WF9Q 1GH8A 2SXLA 2R2SA 2J0SD 2PEHA 4NXMF 5K8MA 3G8QA 2B4VA 5EX0A 3THPA 4M63A 5DGBA 5EGYA 5GAHI 1TKDA 4KHRA 4ID8A 4IH5A 1T8EA 3RBEA 3B8HA 1KEKA 2JEFA 3BO3A 2HHTA 4WJBA 1TQLA 2ZDOA 2ZH7A 2D74B 1BY9A 4D3GA 3PO5A 2XG8A 2BJEA 3UD4P 3U7JA 2GMJA 1S1XA 1JLGB 1GT8A 4B08A 4O0IA 1HQEB 2YKAA 3TA0A 1IKYA 2A18A 3IRXB 2V5HG 2VG6B 3OR1A 5KFCA 2RJZA 2F9DA 2AW0A 2RDIA 2ZOFA 1J5EF 2EPIA 1UFLA 3R1HA 3KNAA 4DF8A 4UUXA 1URRA 4JI3F 1N0VC 1WNEA 3UWTA 3M8PB 5HL7Q 2ZJRQ 4URQU 4ICLA 4C0BA 1T03B 2HFNA 3D28A 2BVZA 3CDBA 3POTA 2FTRA 1L3SA 4Y2CA 2R8GA 4XAKA 2VOPA 4PQAA 3M9OB 5EWFA 2DNGA 2QSWA 4CH1A 4HYKA 2IMWP 4JYAF 2MKCA 2X1AA 2RU3A 1S99A 4F4WA 2C2RA 2OAUA 3O3LA 1VQKS 2R9LA 3LGNA 2OD6A 4YEAA 3H4BA 2HG4A 3IR7B 4ZCMA 4TKTA 1SL2A 2BANA 2VBXA 3RR7A 3VAMA 5GAGU 2HWHA 3OQ2A 3TAPA 3N28A 4XK8C 4TU7A 1SJ3P 4FF4A 3IFEA 2YH1A 3FRYA 4FXVA 3TAMB 2P9CA 1UVJA 2JVRA 5F8GA 4ZMMA 4C8MA 4WU3A 1RDRA 3UDCA 1XN9A 1UWBA 2LLZA 2KJWA 2QE5A 3FEXB 3SXLA 2MSTA 3MZIA 5KT3A 1J5OA 3HHLA 1LW2A 3N6MA 2DITA 3CO9A 4LVNP 2B6AA 1VC6A 4HDHA 3DYAB 2DGSA 4U7CA 4Y2MA 2FHOB 2P6TA 3MR3A 3E01A 3Q8PB 2KXHA 2DPIA 3Q22A 2VA3A 4OMFG 4O4RA 1KHWA 2EBGA 4ZCLA 5BYQA 5A8RA 4JV1A 4RW4B 2UUAF 1F5CA 2OMOA 4IFVA 3CGIA 4OI3A 3ZFVA 2V2KA 4DFMA 1G1XA 4J9OA 4J9MA 1DZ5A 4NLVA 2IBOA 1MMDA 1C0TA 4ED3A 1YJVA 2RQMA 5B08A 3N6NA 4K4WA 1RT4B 1N56A 1ZOTA 1NU4A 1M90T 1C1BB 2XMVA 4A8XA 4DSIA 5MLCV 3Q2TC 2NUHA 3D5MA 1H98A 2FVPA 4KBIA 4RW8A 5G4DA 3I55S 5KFHA 2DH8A 4WZQA 2PMZD 3TOQA 2JLGA 4I7FA 2M4MA 2WCXA 5KFWA 3OR1B 2FGOA 3RAXA 3CCTA 1QAYA 2XC9A 4OLOA 3BM7A 4DR1F 1V3RA 3R5AA 4DX8H 1FJ7A 2E7XA 3LANA 3E3XA 1KTVA 4ICLB 1SIZA 3OR2B 5IM0B 1Q16B 1LW0B 4JI8F 4X84A 2Z2MA 1ZYQA 2JDJA